4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
1EE6A 1OOCA 3UW0A 2VJIA 4W8SA 2NZMA 3GQ7A 3VSTA 1IDKA 1IB4A 4XR6A 1JRGA 2INVA 1X0CA 2INUA 2PECA 2EWEA 2NTBA 4YZAA 2PYGA 4OJOA 1RMGA 4XLCA 1XG2A 4U4BA 1VBLA 2QY1A 4OJPA 2O1DA 2NT6A 1DBOA 1OFLA 4OZYA 1IA5A 5C1EA 3FY3A 4XNFA 3VMWA 4XKWA 4I84A 3VMVA 2ODLA 4U49A 3B4NA 4XQFA 4OZZA 1PE9A 4C2LA 4XLEA 2QXZA 4W8TA 1AIRA 3SUCA 4NK6A 2O0VA 5C1CA 1O8MA 4MR0A 4Z03A 2X3HA 1QJVA 1BHEA 4W8RA 3GQ8A 4XM3A 4PMHA 3T9GA 4YZ0A 2VBKA 4OJ6A 1WMRA 2VBMA 1HG8A 4XOTA 1RWRA 1QCXA 3JURA 1OGOX 1PXZA 2BSPA 3ZSCA 4OJLA 4XKVA 1GQ8A 3VSUA 1O8GA 3WWGA 2NSTA 2QX3A 1O8HA 2O17A 4XOPA 2VJJA 4XL9A 4W8QA 2O0WA 4Z05A 2X85A 3GQ9A 2PYHA 1RU4A 3VSVA 1PLUA 4Z06A 1CZFA 2NTPA 2IQ7A 1O8JA 4XMYA 2X6WA 2VBEA 3EQNA 4HWVA 1JTAA 1H80A 3B8YA 1O8DA 1NHCA 2X6XA 1O8KA 1O8LA 1O88A 3LMWA 1OGMX 2UVFA 4XN3A 4MXNA 1DBGA 4EW9A 1OFMA 4XLHA 3B90A 4OJ5A 1O8FA 4AVZA 1KCCA 3EQOA 4NK8A 5AMVA 2NTQA 2NT9A 4YEJA 1BN8A 1O8EA 3ZPPA 3KRGA 1O8IA 4XN0A 1IDJA 4YZQA 3GQAA 3GRHA 2NSPA 4XONA 2Z8GA 4URRA 4XLAA 2X6YA 1KTWA 4YZXA 1KCDA 4YELA 2UVEA 4XORA 1K5CA 2O04A 4XLFA
chains in the Genus database with same CATH superfamily
1SFKA 3V4GA 1AWCA 3FDYA 1MABA 1TW3A 2VJIA 3V7SA 4M6XA 3VSTA 2DLLA 4FE7A 3AFHA 3GX4X 2NNNA 2K86A 2L9SA 4P55A 2ZJRF 1EF4A 1ON1A 1I18A 4M2LA 1HF2A 1OHHA 4DW6A 2PECA 5HLHA 1FMVA 2L02A 5B66C 4A0ZA 4S05A 1IAWA 1IJEA 5LMZA 1R5BA 3ONUA 1T08B 1PJ6A 4U4BA 3HOUJ 4XBFA 3ABTA 3TW6A 1MKMA 1R23A 4PJJA 4IOAF 2DJIA 1VQ6I 4FK8A 2DO7A 2RN7A 2LKPA 3ISPA 4GXOA 3I4MJ 3HTSB 2V7QA 1NDHA 4LLLA 2HWVA 2KRHA 2KISA 4EMSA 3OZWA 2EZKA 2HEOA 4M3BA 4KT5C 1HF0A 3A0BC 1AU7A 3CCUB 1U5TC 2CV1A 3E0JB 4CXFA 2VL8A 3MCZA 5B6IA 2V7WA 3FKIJ 4JQFA 3IRRA 2W82A 3WY9A 1Z1DA 4Z03A 3B73A 1W1WE 3OR1C 3HOWJ 3KZYA 5A2QZ 4ENMA 3U6KA 5GPAA 3RZDJ 2HVSA 3C2BA 1VQOB 2HOEA 2E1NA 2AS5F 2CWEA 3CO7C 3A01A 4P3IA 3H9GA 2B0LA 1N05A 4BACA 1V5FA 3FBIB 4L9VA 2DODA 4Y7CA 1ZLKA 4UZEA 4ZYAA 4WF2A 4EVIA 3I55B 2JJ7A 3OS1A 1RKTA 3ZCOA 3HEFA 1QVUA 1GV2A 2KIUA 1O7FA 3DV8A 3OPOA 3QFTA 3I1FA 4D7NA 3B78A 5ICEA 3BG9A 4PSWA 4DK1A 1PDNC 1IC8A 1YW9A 2R9VA 2G9WA 3SZGA 4FX4A 2CJJA 3PENA 1U6GA 3OS2A 2PYHA 3R4KA 2VYQA 3VSVA 5JMCB 2MGQA 3WGHA 1P7IA 1CZFA 1U8BA 1OFEA 3ZMUA 1LQ1A 1MH3A 1OB0A 2CFXA 4HAMA 4CCJA 3OR2C 2V1UA 3H0GJ 4D7MA 2V7VA 4OPWA 3FISA 2FRHA 2VODA 3L00A 4PFOA 5E3LA 1P4MA 1U9NA 3G05A 5A88A 3CMMA 4J00A 1OYIA 4XKCA 4G7HF 4YRVA 3TOBA 5LHGA 3W2FA 1VLYA 2PQ8A 2YU3A 1S0UA 1PJRA 4OJ5A 2KDOA 2JRMA 1LVKA 5F1JA 1A31A 2EZHA 5K7FA 3GFIA 5H59A 1KZLA 3DXJF 1IHMA 2X1DA 2FOKA 3ZRGA 4LG0B 1BJKA 3GRHA 2W25A 3FIWA 3SYTA 3LQRA 2Z8GA 1K73D 3AVXA 1SFOJ 1I27A 5J35A 3G4SI 2XGCA 2VLAA 1YJ9I 3REOA 5GAEJ 1ZKGA 1FC3A 1P7JA 1X2NA 4DGWB 4YHBA 4H4KC 3C7JA 4BDZA 1V0EA 3OWTA 1K5CA 3I3LA 3GVLA 1J0RA 3BH4A 3ERMA 3EUAA 5J4VA 3KEQA 1IB0A 3IKVA 1K8AD 9ANTA 1IB4A 1IJFA 1TLHB 2D5VA 3B8HA 5DN6A 2MH9A 1LEAA 4Y3OA 1KQSB 5FO0A 5FROA 4HDVA 3PFYA 5J40A 5EEHA 3HTUA 4P3YA 4U0VA 2K9SA 2R7DA 2GK7A 4KH3A 2VQCA 4BJTA 5HLGA 3GTKJ 2VASA 2V31A 2RREA 3G1MA 4O5VA 5EG0A 4GQNA 3BQYA 1E3OC 2XRLA 3HKZN 1UJ8A 1TZLA 5E1XA 2K3FA 3JTGA 2IBDA 2V7FA 4Y4RA 3T8RA 3LFKA 1HSJA 3B4NA 3Q0UA 3PVDA 4C43A 2NYXA 3PUFA 1CF7B 2K40A 3WU2C 3I59A 1DDIA 2EV0A 3VYTB 1EV7A 3QP5A 4Z4TA 2IXSA 1MMSA 2DFEA 1E3ZA 1M1KD 4NQWB 2DOFA 3SUCA 3CMEB 2JK3A 4KIGA 3W2AA 4ZGQB 3M8JA 3OE7A 3JRFA 2FOWA 3GMEA 1BHEA 3O8GA 1XB4A 3BR0A 2X8KA 2KRCA 2ZFWA 1ZELA 2WA0A 3JR9A 4DJAA 2BGCA 2FUG2 5L3CA 1WMRA 1UG0A 5B1BH 1IN5A 1LNWA 2VBTA 2A6HF 2NOGA 1SAXA 2O6GE 1Z21A 1PKVA 2JWTA 2W85A 1J9ZA 2D1HA 1VNDA 3KPHA 2CW5A 5FL7A 4E0FA 2QYUA 3GBGA 2HLDA 3VSUA 2VBYA 3OYLA 3KCCA 2DERA 3K1PA 4JMQA 5FA6A 1TBXA 2KL4A 1Z05A 2MC4A 1N75A 1QGPA 1IUFA 3DBRB 2XKOA 4U0YA 1I5ZA 3U2QA 2DMUA 5DM7F 2O9LA 3A2KA 3I56I 1PLUA 2DDAA 3DTKA 1XB2A 5B3SH 5KNLA 1IG7A 1Q1HA 4U0WA 5LHIA 2WAQN 4HLXA 4RCZA 4A2UA 1FSHA 4UAJA 1JTAA 4P6YA 1VQ5I 3OIQA 1QX4A 1Z3XA 4DQ2A 3N4MA 3AK5A 4YDTA 2CQQA 2WB1N 2X53S 5CVIA 4M74A 4KKUA 4XLHA 1VQKI 2E5ZA 2FSWA 5KAIC 1WP6A 3ZGKA 4RD4A 2MFZA 1QGAA 3ZMVA 1H9GA 1BN8A 2F5EA 4UV8A 4KUMA 4PGGA 4BXFA 5EGOB 2NNYA 3GTGJ 2HTSA 4JX4A 1R9TJ 4NC6A 3LNNA 3GQAA 2WADA 3LL7A 2J8IA 5IYRA 4A3JJ 2IPQX 5L46A 1WZ2A 3D1NI 1JJ2B 2F5VA 4A3BJ 3BOQA 2NVXJ 4NCNA 4ASNA 2M4GA 4ZCMA 4XSZF 4BQNA 3S17J 5M5YJ 1K4SA 4UHTA 1T2KA 4X7EA 2CFOA 1YI2I 3KYDB 4XLPF 2QBYB 2JZYA 3WBJA 1XSDA 1SMTA 4WZLA 1ETXA 5E1WA 3UW0A 1TYXA 5ILUA 2OA4A 1D1BA 3J7ZI 3COAC 3DU1X 4YFXF 4BY7J 2HPIA 4RB3C 2INVA 1DG1G 3D5SC 3PSSA 3LA7A 2NTBA 4C9YA 3ZXSA 2JJ2A 2VT3A 4PC2A 4A0YA 5F08A 2BPOA 4LB6B 1DARA 2XC7A 1LLWA 2EILH 5DD8A 2C5BA 2DOAA 2F6CA 3W3CA 4E7HA 4OZYA 2ZBVA 2GQFA 4GYGA 3K1MA 3VYSB 5JI6A 3FY3A 4AC0A 1HBXG 3OP1A 2ZZEA 3ZR8X 4MEXF 1HDDC 1ODDA 3B6AA 3LSPA 5BNGA 2F43A 2IAIA 3BJOA 2K27A 4P9FA 4RPBA 2XTYA 3K4MA 5CVVA 3ASNH 2CQ7A 2E2HJ 2ZSIB 3EDPA 1YI2B 2A68F 1F5TA 3AVYA 3F6VA 3BTIA 5E3NA 1MRZA 2KFDA 3FXJA 5M3MJ 1T38A 2DA6A 2W84A 4Y33A 4HNVA 1EFUA 3VSLA 3OOUA 1QJVA 4BBRJ 3H9QA 5DCFA 1RR8C 2DEUA 3CDIA 3OL4A 4K2EA 4AIDA 2VE8A 2PMDA 2Q6LA 5F4MA 1YJWB 1IXSB 5JR3A 4LITA 2VBMA 2KHMA 2QCOA 2V1DA 1PXZA 1FTZA 2XV4S 3DTIA 2BM0A 3OEHA 3WE3A 4G7OF 2VNJA 1VQKB 4W1UA 4L9NA 4M53A 1FBSA 3ZMZA 4E7ZA 3IH3A 3RKWA 1B23P 4IO9F 4X7CA 4E7SA 1YW8A 2CQKA 1YIJI 5EEGA 3U21A 1A36A 1AOYA 2NV4A 4Z4YA 4Z05A 1DPRA 2VXDA 4PZJA 1QA3A 5J3LA 4D5FA 1Y0YA 2OTJI 5CDFA 2KQRA 2WV0A 1IUYA 3T56B 1QFZA 1X1DA 5E3MA 2GJRA 2DMPA 3L1PA 3B8YA 1X3WB 3NWTA 3V7AA 4ABZA 2Z9OA 3DQVC 2EWNA 3KP5A 1LEBA 4M1KA 2X6XA 2BF4A 4B3FX 1UG2A 2MLGA 3ROUA 3WU0A 2HDDA 2BVNA 4X07A 3GLXA 3ZQFA 3BY1A 4EM1A 2Y0SA 1DU0A 3MZ8A 3H9NA 2NTQA 3OYHA 1NG6A 2GIVA 1EP1B 5IT3A 3KFWX 4AD9A 2BZTA 1KONA 2BXZA 3FXLA 3OAAA 4A3LJ 5F27A 3WQZA 1BR1A 4OAZA 2DA5A 1OMIA 3GIRA 1XSVA 1K79A 3E6DA 2DYRH 2ZTGA 1H0MA 3ZQCA 3OJWA 4YELA 3ZC3A 4AIHA 1YE9A 2KDZA 1RESA 5HOOA 2YS9A 4BJ6C 2NAZA 3HHHA 4R79A 2VBXA 2YWEA 4JP0A 4WWCA 1DP3A 3R6JA 1VQ7B 2L0KA 4B1RA 4DYQA 2M4KA 5K7ZA 3FZVA 3WG7H 3Q39A 5C3EJ 2JN6A 4O3MA 4PAAA 1T6SA 3RTRA 2P3MA 1G7SA 2E36A 1MIJA 3JW4A 3J7AY 1N25A 1W36C 4E70A 3GYHX 2K4BA 3OYDA 2O6WA 4RCYA 5LRSA 3RIRA 5GPCA 4WCGA 1RIOH 4PC1A 4G1BA 3OW2B 3BCDA 1MBEA 3KZIC 3QOEA 2H8WA 1IW7F 1FOWA 5LGTA 1B9MA 3HBLA 4BEHB 2WWYA 2R7TA 4WXCA 3MMYB 4J19A 3C18A 2DTRA 1JJ8C 2RC4A 1XDSA 3VR6A 2O03A 2P5LC 3BCBA 1W7PB 3TP0A 4X0CA 1CLWA 4BJ5C 2XB0X 3CLOA 4RLFA 2RNGA 3S8PA 5JHUA 1H85A 2CF4A 3KETA 2ZTNA 3G4SB 2WAQA 1VQMB 1R4MB 2HQNA 3BTCA 1IRXA 2XB5A 2M3AA 5DCMB 5FRNA 4G5GA 1YHQI 4B09A 2DK5A 4OJ6A 4F91B 3CDLA 3A3GA 1XMKA 2R7FA 5GP9A 3ZQ7A 1W0TA 3CRZA 5DSZA 2QSHX 4UVBA 1IO2A 5CQEA 4LLNA 1OFDA 1FOXA 4OJLA 1ETYA 1ZTRA 5H6QA 4CO8A 2ZO4A 3HPGA 4BUPA 1W87A 1I6XA 3RSNA 2PMUA 5LEJA 1PJ7A 4RAGA 1R36A 5HZBA 1XG1A 1Z6RA 3HOTA 4L0ZB 1DQUA 3K69A 3FF5A 3OZUA 4QV2A 1E3XA 4L5IA 4M73A 3LAPA 3F72A 3ZN0A 1T56A 2M5SA 1QRYA 3ABUA 3OKXA 3A4CA 2FXAA 2E5NA 3PSIA 1IRZA 2JN9A 1HXDA 2CUZA 3W2VA 5FLVA 4MTEA 3RPUA 4IHXA 3OFNA 4YAUA 1D1NA 1XMAA 1IN6A 3QFRA 5IY5H 2Y2ZA 3QPSA 2CNDA 2TRTA 4C3JJ 1TNTA 2DY1A 1V55H 1OGMX 3K70D 1RUNA 3TEDA 2VKVA 3LSMA 1FX7A 1R5GA 4X7DA 5D8KB 1OCOH 2UXXA 4BQQA 3GFLA 5ILSA 3W2IA 1VF9A 3MKYB 2HGCA 3H3ZA 2PJRA 1O3RA 1WJEA 4QPQA 2X1CA 1TWGJ 1W4MA 3T0YA 2QENA 1Z7LA 3LSRA 3JRAA 2EZLA 1UAAA 4MNUA 1FWZA 3PNTA 2MABA 5BMZA 5LBQA 1HA8A 1S8NA 3E6CC 1SFUA 1HQCA 1KU9A 4XORA 4WXHA 1G59A 4JX5A 3SJPA 1W2BB 5HDGA 1VQ9B 4LK0F 3FXQA 2NRAC 4AM3A 1Q86D 4P25A 4Z4WA 1KD1D 3MCAA 2KKOA 2JDIA 4ZYGA 1QH0A 3AGPA 4ACAA 2RV8A 3BR1A 3FWEA 4IVNA 2ACJA 3AL0B 1YX2A 3FPPA 3ZBUA 5DS9A 2QDXA 3M7GA 1TC3C 1S4MA 1OGIA 2VN2A 1T39A 4N9IA 1VQ6B 2CUFA 1TNSA 3V8LA 3JQRA 1MMAA 1YLFA 2H94A 4BXUA 2XTWA 2QM3A 1V4RA 3WTSC 1YLOA 1SAUA 4QSHA 5IPAA 2R7SA 2TDXA 1COWA 1ZM4A 2CC2A 3CJNA 1X3ZB 1AKHA 5J4YA 1I3QJ 2DMNA 2EFOA 1FLIA 4WWVA 5IYWA 3DPLC 2PBIA 3Q5FA 4QVAA 5CVUA 3H35A 1G7CA 2W6JA 3EYYA 1QA1A 4QLCU 3M9AA 2XRNA 2ODLA 2BGJA 1EFTA 1IV8A 4L9JA 2ZXHA 2IRFG 2V79A 3JSPA 3G6EB 2RGVA 3JQPA 2I8DA 3DP7A 4XRSG 4KN7X 1NB0A 3SJZA 3KP6A 3S2WA 3JRHA 5HVQC 5E1ZB 3L7WA 3RY8A 2X3HA 3WE2A 2C78A 1UHMA 4HV5A 3GVJA 2DCEA 2OYNA 1VQ8B 5EMNA 3ABKH 1ORKA 1NG7A 4RM2A 3HRTA 2INUA 1QO0D 3H5AA 4HX4A 3W5VA 2PMZA 2G7UA 3FKJA 3A01B 1TTYA 2NPFA 4ZV4A 2BSPA 2PMHA 3L2CA 4HDUA 2R7VA 3U6BA 3RKXA 1HLVA 3KZZA 2XF5A 2DYIA 3RIQA 4XKVA 1H8HA 3W2WA 1GQ8A 1O8GA 1JTYA 1R1UA 5D5VB 4Z6YA 3ULQB 3HOVJ 2LFBA 1S3JA 2C5HA 1SEUA 3PUMA 1KU7A 1EFCA 1S6LA 4LBYA 3DPTA 3GTLJ 3HAGA 3M8EA 4DK0A 4XK4A 1TLLA 3I58A 5CVJA 4YIRX 1UD2A 1R1VA 3GEZA 1FBUA 1R4NB 2BVLA 4BL0B 2B7BA 2XNCA 2NTPA 4XMYA 4P5OA 1K6YA 3CCQI 4P9SA 1SVMA 2Z99A 3W5HA 2BM4A 3ABMH 2Y9ZA 3SZPA 4PDKA 1X2MA 4B3AA 5HZAA 1NHCA 1NRKA 1GR1A 3WXMA 3JREA 3GVAA 1O88A 2AHOA 5J3OA 2O8XA 1OLTA 1HKQA 2IEKA 1W5TA 1F36A 3VPRA 1DBGA 1U0JA 1S72B 2PI0A 2VZLA 1V5GA 4Z1MA 4IHVA 2J7KA 2Z5UA 2WJVA 3T8TA 5KCMA 3OYJA 3CW2A 2UWMA 1O8IA 3S1RJ 2EIJH 1W0UA 3LSTA 4QVJA 2CUEA 5IYQA 3TDZC 4AYBN 2ZJPF 4I7HA 3BDDA 4RPDA 3RPQA 2EPFA 1VHOA 5DTDA 1KK3A 2BEOA 4ZYEA 1P9QC 2A3SA 4GCVA 4CICA 3GFMA 3TMOA 1BX1A 4RAYA 3T1BA 4RB0A 5KK1A 2Y75A 1TWCJ 1LVAA 2AQEA 1ETOA 3H3VK 2PJPA 4OP7A 3SLNA 2D3NA 4E7LA 1NHAA 2IA0A 3ZIAA 5KVRA 2DCUA 5HLIA 1SVOA 5DNSA 1FIPA 3CJQB 1A04A 3WYAA 1JXSA 2E7XA 1S7AA 3DEWA 1EWYA 1D1AA 3TGNA 2PYGA 4BS9A 3A1PA 4TT3A 3IWFA 2HVRA 4YALA 3HM5A 4MLOA 5E20A 3OYFA 4KN4X 3OIOA 3BTLA 4D9JA 4ENJA 4DIQA 1F43A 1WJDA 1O3SA 1DBOA 4L9TA 4BU2A 3JAMK 2M8EA 3IWZA 3O3KA 1Y8RB 2AQFA 4LBZA 1NK3P 1XN7A 5EG0B 3ZPLA 3OYCA 3VMVA 4U49A 1EH6A 3PUNA 1USSA 2EIMH 3SFIA 1ELOA 5ICCA 5BPDA 2GJKA 3WNCA 2BHYA 2P5KA 2FBKA 2JSPA 1ACIA 4IRGA 2CUJA 2Q8KA 1S29A 4XLEA 1PJ5A 5D4SA 2M0CA 2F5DA 4WQMA 1TL8A 2XAJA 3OW7A 4N4OB 2NVYJ 5E8GA 1N08A 2ISYA 4NQWA 2ZZQA 2R5ZA 4E6KG 2UXNA 5CLSA 2LZJA 4EEFG 2YWGA 1MSEC 3N6ZA 2H09A 1R58A 3CDHA 5EJCA 2JT1A 2FNAA 5A2QK 1E3PA 2LY2A 3QOPA 3CCLI 2W6IA 2E1RA 2VOOA 2K9MA 3HSFA 1TQMA 3LFUA 4NC7A 1LDJA 3SHFA 1YITB 1BQEA 1QPMA 1FRQA 1IV6A 1ZAOA 4BY1J 1WTHD 4G8XA 4P22A 3L2UA 2QX3A 5B1AH 2JRTA 1YITI 4KKSA 1POGA 3KYCB 3LSIA 2IS6A 2M30A 3CUQB 1MJ9A 2LBFA 1TQIA 3WBKA 4QWQA 5HLTA 2W1OA 2STWA 1JT6A 4HF0A 1D8KA 5DEQA 1L0OC 1D0YA 3PNVA 5K5RA 1X1BA 3I4NJ 2W57A 2RAEA 2NVTJ 2JQ7A 4M6VA 3P9CA 4L8JA 2M2EA 1R7JA 2XAUA 3K7AJ 4PFPA 1D0ZA 1KZHA 4HNUA 3DCFA 1B8IA 1WU8A 1WXRA 2V6CA 3CESA 4AVZA 1S7EA 1KRHA 2WB1A 1ZM9A 2V5IA 2BOLA 1NH3A 1XGNA 2H8RA 4G1VA 5BPIA 4ZC3A 4ENKA 4BPRA 1G4DA 3Q9VA 3HOZJ 2YU9J 2WJYA 1K4ZA 5BS6A 1RPWA 1B6AA 2X4HA 1D5YA 1JJ6C 2BE5F 5KHDA 1VF7A 1EFRA 1HVXA 1MGTA 1WOPA 1K9MD 3WHBA 5HNFA 2JA7J 5DM6F 3L9FA 4U88A 1WI9A 2ISZA 5TJJA 2E1CA 2KZVA 1ZG3A 2Y69H 2XZPA 1A8PA 3PO3J 2ID6A 2ZBUA 4YAWA 1ZYRF 5JHFA 1QUEA 1D1CA 2DA4A 5JVTA 2VNKA 1OOCA 1PYVA 2LRDA 3N97A 2ZL6A 2K02A 4Q7JB 2D74A 3U2RA 2QBYA 3WG9A 1BA5A 2OF7A 2L3DA 2A5YB 5E8IA 1UD4A 5D4RA 2DU9A 4B4DA 3DU5A 1BBYA 1FOYA 2H6CA 2Z2SB 2F4MB 2LF8A 5H2FC 4OOXA 4PGOA 1DABA 1BJZA 3EUHC 4OJOA 2XC1A 1MDMA 1P4AA 2L7ZA 5ICFA 5J1RA 2DN0A 3ML6A 1XGSA 2OCEA 1KU2A 2XPWA 1KK0A 1H88C 2O5RA 1H89C 4YFOA 2ZCWA 3E3VA 2M1BA 4OIOF 2XPVA 2BV3A 5D8LB 4X0GA 5K7HA 2FVGA 1R6RA 4OAYA 4I84A 3RI4A 4JX6A 5EYRA 4PJ0C 3BQZA 1K78A 2YX4A 1S72I 2O61A 1ZM3A 3H3UA 2GXAA 2QGGA 3HRMA 3DFGA 3VDXA 2DI3A 3FXKA 3CC7B 1RC9A 1YYVA 4Q47A 3IAS2 1FIAA 3W6KB 4DZJA 2ZJ2A 3TO6A 4PCQA 1KC8D 2CW8A 1SM4A 2R7QA 1O8MA 3GVKA 3N05A 4OIPF 3GTOJ 1D8TA 4RDLA 5J6XA 4IZZA 3CCQB 4FETA 4XM3A 1Q81D 3A1YA 2ZZFA 1QVTA 4MHGA 4XIDA 2MH2A 2DA2A 3KEWA 1EH7A 1XMXA 4FCYA 1Y8QB 1XGMA 2M9HA 1E1QA 2OD5A 4J01A 1N77A 1ETKA 2GBYA 3ZZUA 4BE0A 4B43A 4I6ZA 2QKLB 5L3BA 5JVGF 2FE3A 2YPRA 4CCKA 4U7BA 1Z9CA 1RQPA 4L5EA 2X6OA 2Q6OA 3NEUA 4XL9A 1B1BA 4BGDA 4BDYA 4F7DA 1U5TB 3JRCA 3S3NA 2E1BA 1JKRC 3ZZ0A 1KA8A 1CQTA 2DXIA 1GVHA 2ZFUA 3V76A 3SDBA 4ESBA 3G1OA 1G6NA 2IQ7A 1O4XA 3IP4B 4KIFA 4UVCA 2R7RA 1CQXA 4UY8I 3A35A 1D2EA 1VQ8I 4HWVA 3K2AA 3HYIA 1DP7P 2P7CB 4XRSA 3K4CA 2VT2A 1OB5A 1LM1A 4D1QA 4FX0A 4W97A 2H1KA 1LE8A 3PUBA 2MYSA 1SD7A 3WGGA 3LQ6A 4RD1A 3JRIA 5E17F 3LSHA 3GWZA 1UMQA 2DMTA 2Y31A 1JE8A 2W24A 2E60A 5LLQA 2X48A 3BPXA 4WZEA 3SXYA 2RDPA 4FHTA 1CGPA 2IGOA 2STTA 4QHYA 4X05A 1E0EA 4BQAA 3LYCA 5HNHA 4S04A 3OEEA 1QNTA 4YZQA 5LFAA 2OZUA 3ZQGA 2KZGA 2PEXA 3F0CA 1YHQB 2VJ5A 3F3XA 4HX8A 5H20A 3JTHA 5FKLA 3ZQLA 3SY2A 3IHUA 4HG2A 2COBA 1CNFA 1GV5A 1JB9A 4KT6A 4Y15A 3S1NJ 4XRFA 3WU1B 2K7LA 3R61A 2EFPA 2B0RA 1HC8A 4ZCLA 1KJZA 2HQ5A 1F9NA 1LFBA 3HSRA 2GWRA 3EYIA 4IHYA 2V7TA 2BM7A 1DGWY 1QZZA 3F6OA 4ACBA 2R3SA 1KQ9A 2ZITA 1ON2A 2ESHA 3AGQA 1WSUA 1GXPA 1JUMA 1YX3A 1ETQA 2OUMA 1ZRDA 4RD3A 4UZUA 1G3SA 2DOEA 3A03A 1YRNB 3K6GA 2X3UA 5H6RA 1KMHA 2ZL7A 2ELKA 2YR2A 4UXNA 1GHCA 4I0AA 1YJNI 1J7KA 2MD0A 3JCUC 3J81k 3PSFA 2QGUA 4I2OA 2Z6BD 1I3AA 3N90A 1IN7A 1WPKA 4RGSA 3MKZA 1J75A 3LO8A 2P5VA 4HE5A 2NT6A 2L4MA 4ANJA 3VO1A 2EH3A 4IKFA 4XNFA 3CC4I 1ZG5A 3CD6I 1Y1VJ 4RDUA 3EUHA 1B2RA 1N8RD 3K4BA 3QAHA 1X58A 1VLOA 5F0HA 3EQLF 4JRAC 5EEAA 2O8KA 1EP3B 2GJPA 2O7OA 1HCRA 1ZH5A 3RQ4A 3BZ6A 4W8TA 1W35A 5D5UB 1AIRA 2ZKZA 2BN4A 2ZBKA 3HGGA 4C2UA 2Q2EA 4NK6A 2DQRA 4NC8A 2BX6A 3TBIA 4XICA 3JRDA 3CJTB 4KNYA 3C2GA 3ISXA 4IXAA 1SANA 2GAUA 4IQJA 1U2RA 5K1YA 3WTUC 1HG8A 2QKMB 3V8KA 1IDYA 1RWRA 1IXRC 3K1NA 3BG6A 3S2DJ 5DUIA 4Q4ZF 2W48A 2VKHA 4CUGA 2XZOA 4ZDLA 2HFHA 4G7XA 2JPCA 1IN4A 3O8HA 3CPWB 3I9V2 4I98B 3HB9A 1YFHA 4UB6C 2FJ1A 5AIQA 1REPC 2H27A 1N06A 4G6IA 1BX0A 2CH0A 4OPOA 1D0XA 3MKWB 4LB5A 1YW7A 3I54A 4WXDA 2VKEA 3ZPNA 3QWLA 3Q6RA 2HOTA 1TW2A 1ZGAA 5ED4A 1WOOA 4GRIA 1I1GA 2A5WA 3GXOA 3SQNA 2RQQA 5IP6A 3F22A 2CK3A 3AVUA 2BW3A 3L2RA 4BAYA 3FBNB 5DV5A 2GK6A 4DZPA 2K9QA 4EJTA 1R1TA 2XIGA 4RGRA 2GXBA 2QTZA 2IGKA 3AKZA 1CNEA 2JSCA 1FEXA 2VUMJ 4XRMA 5E18F 3PM1A 2R93J 3VODA 3ABLH 1O8FA 2LLKA 2KMUA 4HOBA 3BH6B 2EJRA 2M8GX 4NK8A 1TYVA 3AVVA 2F1MA 1GVDA 3GQBA 1UHWA 4AC9A 3LQQA 1RQRA 1OYWA 4I76A 2XSDC 2HKOA 3CTAA 4LG0A 3GTJJ 1D8JA 2MC3A 3CCJI 5FGMA 5F4JA 3Q3SA 4RDKA 3FHNA 3WNBA 4CCMA 1XDUA 1C0WA 2F5FA 3CMYA 1RNLA 2QZAA 2VBZA 1A6IA 1GVJA 1BN5A 4UUSB 1VTNC 2IA2A 2G0YA 3RKQA 4OOSA 5L3DA 3M07A 1BIAA 3DKYA 3AG2H 4CCNA 3TL4X 2EFGA 3PA2A 2HZTA 3SQVA 1VQ4I 2E2JJ 1RI7A 3H94A 2XAQA 4TMWA 3FXUA 2XPUA 2BY3A 2XAGA 3J81K 3QU6A 2O04A 5M5XJ 4HSRA 2AHQA 5FKKA 1W0KA 1LDKB 1ZK8A 2EB7A 3S3OA 2HNHA 3BR6A 1QFJA 2ELJA 3E1YE 1QPIA 2JA2A 2B5OA 1LLZA 2YWHA 1VBLA 4OJPA 5B5EC 2DFIA 2R5YB 4P1VA 4A3FJ 1FOKA 2O1DA 2L9VA 3TO7A 1XCVA 1AA7A 3CQZJ 4OIRF 4CYDA 2R92J 3S1QJ 4N4NB 5JBQA 3DWLE 4DBQA 4RM0A 1MMNA 2FBIA 3F9KA 3NAUA 4KA4A 2DFFA 4XLNF 3ASRA 2OJED 2Y9YA 2QEXI 3BZKA 2KRFA 2V1XA 2V9KA 1ENHA 1DPUA 2WSSA 1APLC 1VQLB 3DPUA 3K70C 4C2LA 1UZCA 1UB9A 2DA3A 1QHHD 5E3OA 4AU7A 3QQAA 4B47A 2W7ZA 3H1CA 3GTPJ 1QVGB 3SYJA 4HYEA 5A8AA 3DEEA 3IL2A 2J5PA 3SZTA 2OTJB 4Y9UA 4RS8A 3GCMA 1MSFC 4YFNF 4XOTA 4AIKA 3V8JA 3MD2A 2XKPA 4QFMA 2L9NA 3FX3A 4PSXA 4R8HA 4FQGA 3WHCA 1UHSA 4BHCA 4CQJA 4FWTA 1LFUP 2OTLB 1YIJB 1BIBA 2BYVE 5CQGA 4BHBA 2O0YA 2XASA 4RJLA 1Z7UA 3FXMA 2IS2A 1I1SA 1S7OA 1YS7A 4FXUA 2ICWG 1EA3A 3M1EA 1WKMA 1O8HA 2O17A 4XOPA 1UD8A 2VJJA 1SKYB 4W8QA 1X4PA 1ZHFA 3BC8A 4IEJA 1ZN2A 5F1RA 3WTWC 3KLNA 3LWFA 2CRVA 1VQ5B 3HGYA 4LD5A 3ZQIA 3FPKA 1WWXA 4LIUA 4DYCA 5IOZA 3A8IA 5AN9A 2HTJA 2PFBA 3I4PA 1ZREA 1LB2A 1J09A 2E71A 3IH2A 3E6MA 2IGNA 1H9TA 2IGMA 3WTXC 2VBVA 1QU3A 4KJZA 4MQVA 5E6TA 5D6FA 5L3EA 4B48A 3GTMJ 1X1CA 1WVRA 2VPLA 3J80Z 1MBKA 2EFQA 1FSEA 5IOYA 1U78A 1PUFA 4UUVA 2I5UA 1UELB 3A0HC 4HQEA 2EINH 2M7BA 3BP8A 5HDNA 2GREA 3OYIA 3Q6QA 4LC0A 4G6TB 3HUGA 4Y7NJ 2V9PA 2F3LA 4GO1A 5GADJ 3VSKA 2JUGA 1VJSA 1MNEA 5CPRB 5CJ9A 4F52A 3K4KA 5LHHA 3S93A 1N78A 1ERDA 4JYKA 1K83J 4PUSA 2F2EA 4HF1A 3W2HA 1UFMA 1TYUA 5F0FA 1KCDA 1BMFA 2H1LA 3HRUA 2OV7A 4UUTA 2LOOA 3MFKA 3SFZA 1W9XA 3R6KA 4RLZA 1R5OA 5HS9A 4M3EA 4EM2A 5DYMA 4HLYA 2R6HA 4K1XA 2D9RA 3MZYA 4IOCF 3G1LA 2X51A 2LP0A 3S3MA 2LY9A 1H8AC 2NS7A 1WH7A 4EJOA 2YWFA 3WNDA 2QSFX 1NTCA 2MG4A 1T8IA 3W6VA 1JKPC 3PIPF 1U3EM 1R5ID 3ZMDA 1D5VA 2DFHA 2VNIA 2XF7A 4LOCA 3UR3C 4X1EA 3MVPA 4KMUX 3F8FA 3A8JA 3HG9A 2VJ4A 4C3IJ 4E7JA 3IV5A 3DBHB 3F8MA 2OBTA 3VYUB 4BHPA 3Q0VA 5J8CA 1FRNA 3T53B 2QN6A 3C2HA 1GXQA 1WJ5A 3OOCA 3OZVA 1T0FC 1FMWA 4MFEA 4WZKA 4P6VF 2DETA 2X1EA 1TWHJ 3R0JA 3HOYJ 1KYWA 4HEA2 5C44J 2P6TA 3R0AA 2BGIA 1T6XA 3HKZA 2MW8A 2DT7B 4G7ZF 4IHTA 2AO9A 1ZM2A 3BZCA 4A3DJ 3HIFA 1FDRA 2J8KA 4Z4SA 4F93B 2V4DA 3FHZA 2P0WA 1OGJA 3OSFA 3GQ8A 1FYLA 3T9GA 1FYKA 3LSGA 2QSGX 4RBOA 1XC5A 4HX7A 2VBKA 1WORA 1FNDA 3I56B 1OYYA 5A89A 2VFMA 3LMMA 4FT8A 2R5ZB 5C4XJ 2VQHA 3CJRB 2BSAA 2DQLA 4Z4ZA 2QQAA 3BWGA 3ZSCA 1YX5A 1Q1VA 1W7PD 1JGGA 2F4IA 2WV1A 1KYZA 2D3LA 2LY1A 1F20A 3SEZA 2F5CA 5FKMA 4UB8C 3GZ5A 1R5NA 1FBQA 1HDPA 3GQ9A 1WFXA 2HS5A 2Q0OA 3D5RC 4M4SA 4YAOA 1RU4A 1QUFA 1E3HA 1QHGA 4Z06A 3UNGC 4X8IA 2QA4B 3IC7A 4RD2A 2VBEA 4Y13A 1Z6TA 2EIXA 2C2WA 4OPVA 1E2XA 1LJ9A 2XGJA 3BG7A 2DDBA 3HPHA 3EUKL 3L2QA 3J80K 1TQPA 4V2FA 4RD6A 1O8LA 1OFCX 3ES9A 1FZPB 1QQ1A 3I71A 4X7FA 4FN5A 1GT0C 4A3EJ 3LJYA 2WY8Q 3QPHA 2DK8A 2ME0A 1VQPB 1V5EA 3EQOA 3PSZA 3I55I 2HPMA 1QBJA 3CD6B 1E63A 4HW0A 2EK5A 3KRGA 3ZPPA 1F1ZA 1BR2A 2I10A 2LH9A 4L5JA 4A3CJ 1NBMA 4CSWA 2RC6A 2Z3YA 3BH7B 2NSPA 4XONA 4IPAA 1XTAA 4URRA 3KP4A 2DIEA 3K2ZA 2QF7A 2Z16A 4TMXA 4OM9A 3HC7A 1YJNB 5GV7A 4YIIA 3M3YJ 3TO9A 1I6HJ 2PX9A 1FPQA 1XGOA 1XX5A 1DUXC 2VQGA 2CV0A 2LD5A 3ASTA 1I50J 2KIFA 3QODA 1P6RA 2NXNB 1IRGA 2Q1ZB 3CCUI 2NVQJ 1VHEA 3D0SA 5TGTA 4NUBA 3BJAA 3V7CA 4BXXJ 1T5EA 2FD5A 4XR6A 4NHJA 3CCYA 2BBYA 1X1AA 2UUZA 2HZDA 4BE2A 2PMZN 2VE9A 2L5QA 2VQLA 2W00A 1E17A 2CQXA 3CP2A 4ZDPA 4C2TA 3BQJA 5F64A 4E7IA 4HRIA 1YJ9B 1GAWA 3MMPA 2WY7Q 2A6EF 3K10A 2Y30A 1SKQA 3OY9A 1KGSA 4LG3A 2CG4A 4LGWA 4M9ZA 5K5OA 1BC7C 1E64A 3K4LA 2KLOA 4P12A 1CF7A 3S32A 1U2WA 3I59B 3HRSA 3O2PE 3L2VA 3J7AO 3W2GA 4MO7A 1R5HA 4XQFA 5FO5A 1ULYA 4RA2A 4KKTA 1TT5B 1TP4A 2WAFA 2ID3A 1JTXA 3VEPA 4IQ4A 4B3XA 4EV0A 1H42A 1Z77A 2DPUA 4ENNA 5D6EA 1M90D 4CH7A 3MAJA 2BMWA 3BY2A 1XCBA 3GLLA 2XNJA 3F23A 1ZARA 4F55A 2X0LA 2R0QC 1IJWC 4KICA 5BQTA 4WX9A 5E79C 4A0XA 4OOVA 3BR3A 2IT0A 1STZA 4RB2C 5DCMA 3RQIA 1G3WA 4JK1X 1BI0A 4FISA 2EFNA 2VC0A 3TQNA 4F92B 1VQPI 1UD3A 5FKNA 4MEYF 2MLKA 2L7FP 4PJNA 2LDUA 4A3KJ 4RD0A 4C0SA 2ZXWH 3TOAA 3WTZA 2VONA 1K8FA 1G7TA 5HKKA 3GO5A 1HZEA 1TVCA 1YQAA 2GZWA 4UZFA 3CLQA 2N8GA 2XGEA 4U9UA 1OQYA 3AVWA 1EKEA 2VB6A 1IRFA 5KW9A 2QA4I 1U5TA 1U9OA 5K5QA 2DT5A 1VQOI 2BXYA 3NRVA 3OYEA 1FP2A 1O3TA 2BM1A 2OZ6A 1HSTA 3EQNA 2COMA 4M72A 1PUEE 4R1HA 2Y0MA 4KIBA 1WHUA 3QYFA 3AAFA 2BM5A 1HW2A 2C6YA 3CUOA 2VFOA 2VI6A 1O8KA 3HOXJ 4P2NA 3X2QH 3ONQA 4JBAA 3OIPA 2B7EA 4JOMA 3DLLF 4CDGA 4J0QA 2KP6A 4IF4A 4A6EA 1O3QA 1SC7A 1T95A 1AHDP 2JA8J 1ONVA 2HXIA 4BH9A 4D5CA 4CZCA 2C4TA 2EZIA 1QZYA 3HZJA 2A69F 1ETVA 1X19A 2OCCH 2XGDA 4ZDOA 3OV8A 1Z67A 2ESNA 2V7UA 2DTZA 2OPTA 4I02A 5EZHA 3ZBTA 1V5VA 1BOBA 4EJUA 2ADUA 1E62A 2OQRA 1YIOA 4R71A 4EGYA 1HKTA 4NBSA 5FIUA 3G71B 1A5JA 2UV1A 4HA8A 4CYCA 4RM3A 2P7VB 1BC8C 5F4OA 1BJAA 4PC7A 2XUBA 5C4JJ 2V7XA 1FNBA 5HDKA 2HI3A 2ZXIA 4XLFA 1I8DA 4RDJA 1XQBA 1MMGA 3C1DA 4KFCA 5FD5A 3RYPA 5HS7A 3ZUGA 4W8SA 3CMAI 1QGYA 3GQ7A 2MBFA 1FTTA 3BY6A 4OOIA 4Z4VA 3AG4H 3FM5A 2VNHA 1ZRFA 1B59A 3NARA 3MZHA 3OOPA 2VFPA 5D5WB 5IT9Z 2QTLA 2JUCA 4X06A 4ETSA 4YZAA 3BT9A 4RB1A 1EJ9A 1WI3A 3GSIA 4XLCA 4AIJA 5JLXA 4IRHA 3JRBA 2JA6J 4M0LA 3OYBA 2B63J 5IYDJ 2K9LA 1J5YA 1GUUA 1WOSA 1BW6A 3CCMB 2DMQA 2IVMA 2Y48A 3M1CA 3PQKA 4M3FA 5JFRA 4WK8F 1H8EA 1AKHB 5EDNA 1HOMA 2E34A 2L9RA 3P5JA 2IS1A 3RZOJ 3BLYA 2ZMEB 4P9UA 4M3DA 2JIZA 2BM6A 3KIOA 1W5SA 5GV8A 4MTDA 3K9TA 3E97A 1RETA 1VFCA 4G7WA 5FFXA 4TMVA 4II2A 3RYRA 2GLOA 3TH0A 1KTVA 4EM0B 2LREA 1MZBA 4OMZA 4DNRB 2DW4A 2DPDA 4P26A 2O0VA 3ZOBA 5C1CA 2EBIA 1W5CC 2JPBA 2RVCA 1HKSA 3NB2A 1A6QA 4EJVA 4Q48A 1OCZH 2XROA 1K6OA 3PO2J 2R4GA 1XSXA 1BW5A 2KIMA 2CS3A 2RNJA 3NAWA 1RR7A 2WR8A 1QCXA 2K9NA 2FMYA 1Z0XA 3LNQA 3SEQA 1JNYA 2WPDA 4L18B 4ZH4F 1QG0A 2R7OA 3VB2A 3E6BA 1MJAA 2VC1A 3CB4A 5ERIA 1SVLA 1O7LA 3K4JA 1I7PA 1KK2A 3GZ6A 1JA1A 4YFKF 1R22A 1Y0NA 3G73A 4PC3A 3PFIA 1G2HA 1RZ4A 2VXZA 3IUOA 1KQ5A 3CCLB 2OBPA 2E1MC 3F8BA 4AYBA 1HW1A 1TSPA 3CO6C 2YX7A 4ROXA 1Y6IA 2QQBA 1D3YA 3R6SA 3S15J 3HL2A 2QUFA 3CP8A 2GQQA 4Q5SF 3JX8A 5FFZA 2BW3B 3VFZA 1EP2B 2D45A 2MA3A 5J1UA 2M87A 1FX0A 3Q0WA 2IS4A 4XN3A 2NS8A 2A6TA 3ZMSA 3JRGA 3CCSI 2RC5A 3LSJA 1MBFA 2Z1DA 3HJEA 2FQ4A 3V7RA 4OPSA 4IL6C 1B72A 1IDZA 3B90A 2G7HA 4GGGA 3CZ6A 1KCCA 1P4XA 3BR2A 2VFNA 1J59A 2OTLI 2NT9A 1Z3YA 4YEJA 5L3FA 5FLMJ 3F21A 4CGZA 2Q6IA 2BV6A 2P4WA 4TMZA 3I0TA 2CRGA 2R7XA 1E43A 1HA3A 4N3NA 3Q9SA 2V4JC 2GIZA 5AONA 4OU0A 2ELHA 5J1YA 2F1LA 1K28D 1QRBA 5BOXA 3IKTA 2ZSHB 1OJLA 2M0MA 3WTYC 4OMYA 3MEXA 2OK8A 2RQPA 5FB2A 2G0EA 3H9JA 2FMLA 1VQLI 2QEXB 1IGNA 5DDGA 2VBSA 4Y52J 4LMYA 1B4AA 4A5NA 5FKOA 2HDWA 3IAM2 4N0BA 4A6DA 4UUSA 4IHWA 5IT9K 1JKOC 4LBVA 2IP2A 1TYWA 2ECCA 1USTA 3FK7A 4HZFA 3CCVB 1LPQA 2M7AA 1OCCH 4XD7A 1E79A 2XF6A 1F4KA 5F6FA 4ON0A 1RRJA 4LK1F 3TW7A 3S14J 4LBWA 3S1MJ 3GF2A 4KMFA 1RMGA 1FY7A 5IYPA 2KPMA 3KP3A 3W6JB 3PNYA 3BJ6A 1VZ0A 2V9VA 4O6JA 2LYCA 3H0DA 2CGPA 5AIPA 4TMTA 3KLOA 3LVBA 2LR8A 2X0KA 1BI3A 1DU6A 4DBRA 1VQ4B 4DNCA 2QWWA 1FNMA 1WDTA 4AF6A 5DUKA 4NBQA 5FRMA 4AVPA 1G8XA 5LGUA 4KISA 5IP7J 1YTYA 3B6CA 2NVUB 1BI1A 2FEZA 4XSXF 3IRQA 1VI0A 2W7NA 1ZG1A 4QUZA 2UZKA 3BG5A 1LDDA 3CPXA 4U87A 4UNOA 1LKXA 3ASPA 4HIZA 1UMKA 3CCJB 4HSTA 3T51B 3ERED 1UD6A 2YSRA 1Q9SA 1YS6A 3BTJA 3AG1H 2CW7A 4D0PA 1XD7A 2FX3A 2HQAA 1ZQ3P 3SLDA 2DJNA 3J7YJ 2HYGD 3OYMA 4N3GA 5IYBJ 2RKHA 2CSOA 4RGXA 3LOCA 4PABA 1OGOX 3G3ZA 2HU9A 2R7UA 4NNJA 2EV6A 1V3FA 4HV6A 4M3GA 4F7ZA 2PIAA 2ETHA 4ITVA 3CUQC 3RKYA 2B9SA 1SFXA 3L2WA 1IZ1A 2LG4A 2O0WA 2ZMEC 2UVFA 3GUDA 3RDIA 3H36A 1TUIA 3CCEB 2VIXA 3ZN1A 1TT0A 1WJFA 2E19A 5ICGA 3SDGA 2KT0A 3K4NA 1P92A 1UD5A 2LBFB 3U9GA 4A69C 1WJCA 1R00A 3FMQA 2EFWA 1H80A 4A3GJ 1QA6A 1BOAA 4DQKA 5CVRA 2F4NA 3DKXA 2FF4A 4RLQA 5F04A 2A61A 2H6BA 3ML3A 1ZGWA 2WTEA 5CYVA 1OFMA 3QP6A 2JVGA 4V19K 2B7CA 3PJRA 1X1PA 2PJRB 5ILVA 3T5XA 1RKWA 5GAHJ 2Q6KA 4LIVA 2WBMA 1IDJA 4ZYHA 1PUFB 2VBWA 1OR7C 2EV5A 4II3A 4PK4A 1QFYA 4DNTB 4Z4UA 2R7ZJ 3HXLA 3RJPA 3B82A 4YCQA 3P7NA 2WYRA 4YAFA 1VQNB 3HUGB 2GOXB 2X6YA 3E7LA 1KTWA 5CKTA 2KIQA 4YIFA 4P1WA 4YEIA 3E5XA 4LFUA 2ZZGA 2WC2A 4YG2F 1SMYF 4GYIA 4MIMA 4OWRB 2NZMA 4QTRA 5F0CA 4IHSA 1PP8F 1IDKA 5BSXA 3CC4B 1K61A 2E2IJ 1VQ9I 2DA7A 4ESJA 3ZQHA 2HDCA 3CC2I 4KYWA 1X0CA 5TY0A 2FNPA 2EWEA 2VOPA 1HW5A 3HSEA 1QQIA 5TRDA 4XKBA 1BPLA 4TSFA 1XE1A 1XG2A 1J9IA 3CCRI 2HR3A 5FLXZ 3WODF 5FO1A 4KITB 4N9HA 3UKGA 3D5LA 1SD4A 4DYRA 3GZNB 1OFLA 1IA5A 4A3MJ 3LSKA 3ZP5A 3ECOA 5J47A 1K4TA 1OCTC 4CHUA 3A3BA 2EA4A 3CC2B 1B9NA 3FK6A 3VMWA 4XKWA 1Y39A 1DGRM 4M9SA 1BLIA 2X9DA 2HKXA 2W4SA 4A3IJ 4H9GA 1R71A 2DA1A 2E7WA 4QIWN 4Y9RA 3VO2A 3NWSA 4TN1A 2YUHA 2WAEA 3W5UA 1ETWA 4TKOB 1P4WA 4HF2A 4EH1A 4F3QA 2L54A 2IOUG 4UVAA 2C77A 1MBJA 5DS0A 1AMOA 2ZJQF 3LQEA 3U1DA 2C4UA 4W8RA 3G2BA 3PIOF 5GTIC 4YZ0A 5TISC 1ZUNB 1BM9A 2VFQA 1EH8A 3JURA 2FA5A 2L7KA 1MBGA 3H09A 3EPZA 1KQ0A 2FX0A 3HHGA 5FNZA 4I0BA 2LK2A 2EA2A 3QPTA 3NQOA 3WWGA 1Q82D 2L01A 1GDTA 5HS8A 2V26A 2NSTA 1TWAJ 2BVMA 4TV7A 1IN8A 2WZPP 3H5NA 5FLXK 1QZEA 2ZL5A 5FJ8J 4IRIA 3MN2A 1T98A 1O57A 2VBUA 2OQGA 3DKWA 5HXBA 3JAMZ 3SEJA 3EETA 3FKSA 5LGNA 4LLGF 1TWFJ 2XGXA 5D5XB 3KE2A 2LF7A 2FQ3A 1PP7U 2K3PA 2A07F 3QYEA 3CCEI 1WGXA 2V6EA 1WQ2A 3VYRB 2E1MB 1VQMI 2CV2A 1FNCA 3FJOA 3QFCA 2HOAA 2CQNA 2P8TA 3FXRA 3E5QA 4GFBA 4CZZA 3P9KA 3KP7A 3RPUD 3QFSA 1Y56A 1K7AA 4FE4A 3LMWA 2DT6A 3AL0C 4M71A 2ZC2A 2L7MP 3A8KA 5EGOA 3OMYA 2CYYA 3P9IA 2LTPA 2LSOA 4OINF 4ZTJA 4EATA 3OJXA 2E1OA 4CCLA 1WRJA 1NB9A 1ITYA 2FU4A 3U1KA 4IJAA 2GPJA 3V42A 1WJAA 1ZR4A 4HE6A 2XSJC 4AUXA 1MJBA 3FM3A 3R60A 2XOKA 2OK7A 4RMNA 3ESWB 2QQ8A 3CCRB 3M4OJ 1JHFA 1JKQC 4YZXA 2IW5A 2D2WA 2P6SA 4G6QA 3WTVC 3BR5A 3CC7I 3E1SA 1EXMA 3VMFA 2LVSA 1DDGA 3RCOA 1T0FA 3VNUA 4BBSJ 1VQ7I 2PLFA 1EE6A 1Y1WJ 5BSYA 4B44A 3FMRA 3K0LA 1MW7A 4EJWA 5IYCJ 4ZYDA 4G94A 2F4OB 4PJMA 4C2MJ 1N0VC 1JRGA 2XVCA 3Q38A 1XFOA 1GLNA 1MNDA 5JLWA 1JUPA 3A02A 1U8RA 1LUJB 1YRNA 2M5WA 3F8CA 3QPLA 5IP9J 1VQNI 3BG3A 4PC6A 4YXWA 1Z91A 2LKXA 2OBSA 4ZJZA 2QY1A 1OKRA 1L1IA 3I53A 3LAJA 3WTTC 1FP1D 1SFEA 3ZMTA 3OYNA 2XAHA 3SKBA 1T6YA 4V2GA 1WPCA 2Y0SN 2GOMA 4Z4RA 2LC2A 3L09A 4EGZA 5THXA 4OZZA 2M34A 1DDNA 4HBLA 2DAOA 4UV9A 1RUOA 1EZGA 1MBHA 4V02C 2QXZA 1SD5A 3PL8A 2QQ9A 3W2EA 4ZZDA 3BPVA 2ZNZA 1GJRA 3GTQJ 3BCAA 1I39A 1NJID 2HCJB 2F48A 2Q2EB 3QRFF 2XT4A 4YC5A 2M45A 1QRCA 4MGRA 4A5MA 2K5CA 4B8XA 4HQMA 4E7KA 3QU3A 2PG4A 3D26A 5KAFC 3AVTA 2ZXJA 2L4AA 2CBXA 4B3GA 4G9YA 3TKYA 1W0JA 1KQ8A 5FD6A 1GO2A 3ASSA 3ASQA 2E35A 4RAZA 2QE7A 3AG3H 2LKSA 3OL3A 1BL0A 2BY1A 2QLZA 3CUQA 1R49A 2XT2A 3OS0A 4GDFA 1OISA 1Y0UA 3PQJA 2OC6A 3E5UA 1JGSA 3MQ0A 2ME6A 5M5WJ 1LFPA 1FJLA 1JI8A 2OBRA 3JQQA 5M3FJ 4H0EA 2JA5J 2HYFA 4PGHA 1TTTA 2XZLA 2L2OA 4ZZLA 3PA1A 1YJWI 1OB2A 6PAXA 1O8JA 1KU3A 2X6WA 2QZ8A 2BY2A 3DEUA 4EQQA 3P27A 1W34A 3OYGA 1YO5C 2WZNA 1P2FA 3I64A 2HQRA 2ZNYA 1QVFB 1B8IB 2HVQA 4AWXB 1F60A 4HNTA 3MWMA 4E4HA 4NB5A 1YG2A 3OYAA 4FTHA 1AIPA 2I1LA 2LMDA 4EW9A 1M1EB 2BHZA 2Z33A 1WSVA 3KX2A 4PJLA 2QVOA 5AMVA 1V0FA 3I5UA 4G6DA 1L3LA 4BQOA 4XN0A 4BE1A 2YUSA 3KEOA 3CXCB 4G12A 2O3FA 3MHPA 2KJCA 2XTXA 4IX7A 1T33A 2NS0A 4ASUA 4L0YB 3FMSA 2HXOA 4XLAA 3JU4A 1YOVB 2CU7A 2JTVA 4DQLA 1JT0A 1V54H 3LA2A 3GW2A 1E1RA 3DU6A 3S2HJ 4OIQF 1WCMJ 4CYCB 2VPRA 3PETA 4I09A 1X3UA 3DBLB 4NDLA 3TP3A 2CW0F 3CCVI 3KEYA 4I99C 2KJBA 4RGUA 2V1NA 5IK2A 2XDVA 3J81Z 1A35A 1S5LC 4C30A 1BR4A 4MQ9F 2EQRA 4BYYA 3SZEA 2J5OA 1FT9A 1MDMB 2R7WA 1PVEA 3LA3A 3DLAA 2IJLA 3H5RA 3OSGA 1IF1A 3HDDA 1G7RA 1N07A 1G3TA 3NE5B 2JVHA 2LNBA 4MXNA 3QSYA 4S0HB 4CA0A 1XS9A 3DDYA 4M9XA 3BROA 1MD0A 3C3WA 4AF7A 2PN6A 5L3GA 5C1EA 2FBHA 4BEHA 2R5YA 1K78B 4CCOA 1MNMC 2DYSH 3OYKA 4A93J 4MYUA 1IXCA 2VKDA 1SD6A 3M8FA 3CMAB 1FYMA 2ZB9A 1Y0RA 4DOZA 2XEXA 1PE9A 1OCPA 1W7PA 2XAFA 2ZMEA 5EZGA 2MSYA 4BKXA 3JSOA 1KK1A 1FNNA 2XNDA 3CCSB 1QA2A 3VNVA 2HMAA 4C3HJ 1JA0A 2EIKH 1JUSA 1OPCA 3F8NA 4WZTA 4MR0A 5LRRA 1XPXA 3ASOH 1G3YA 2CO5A 1Q7YD 3FXOA 5DD4A 4X6AJ 5TV2A 4ESFA 3SJMA 3G71I 4PMHA 3P4GA 3IH4A 5EF6A 1GAQA 3DF8A 2GA2A 5J8FA 3P26A 2GA1A 2ECBA 1BI2A 1UCRA 3QYBA 1S9HA 1MH4A 2DOGA 2OU2A 2NOJB 2AXTC 5H5JA 5TR9A 4B4CA 2OAZA 1JHHA 2AXLA 3BC9A 4ZTFA 1NK2P 3BNWA 2DBBA 3O6BB 3BCFA 3ZQQA 3CF2A 3E20A 3KP2A 1ZRCA 5KSWB 1WJBA 2P81A 2X85A 2QMUA 2HOSA 1EA0A 1N0UA 4MFDA 3MKLA 3Q3AA 2GM4A 2BY0A 3GFJA 4FASD 4IW3B 2TCTA 3DTEA 1W36D 1LE8B 2KVOA 4MYTA 1O8DA 4KDPA 3CMEI 4RAFA 3VOEA 1J2XA 5IYNA 3ONYA 2GXGA 4P96A 3KYLA 1OR7A 5LEKA 5HODA 2HYJA 4U7DA 4LJZF 3KL9A 3ELKA 2K4JA 5LD2C 4I01A 2JJ1A 3HOSA 1WH5A 2IA1A 2QYOA 1MMDA 4QPOA 4A12A 1WSRA 1T6ZA 3WGIA 1B72B 1O8EA 5GTHC 2K85A 3H92A 4M6YA 2CMPA 3CCMI 2JMWA 2PE3A 2MD5A 4ZGNB 1ZLJA 1X4OA 2HDNB 1OCRH 3VWBA 3QE2A 5JLVC 5GAGJ 4HPQA 3S16J 4BNCA 4Z2YA 3TDUC 3ZZTA 1QGZA 3B02A 2A05A 3CF5F 2UVEA 3ECHA 1ZGJA 1ZR2A 4ZCIA 3G6EI 2PLYA 2D1VA 4Y17A 2XHKA
chains in the Genus database with same CATH topology
1SFKA 3FDYA 4CCNA 3DKYA 2HDWA 2VJIA 3IAM2 3TL4X 1MABA 2JDIA 3VSTA 3AFHA 3FPPA 3AL0B 3H94A 2L9SA 2INUA 2M7AA 4XD7A 1I18A 2PECA 1E79A 1OHHA 2XF6A 4HSRA 1W0KA 1LDKB 1MMAA 1FMVA 1RMGA 3S3OA 2HNHA 2KPMA 2ELJA 1SAUA 1COWA 2R7SA 4U4BA 2JA2A 3PNYA 1VBLA 1VZ0A 4OJPA 2LYCA 3H0DA 2O1DA 4PJJA 2DJIA 1AA7A 3DPLC 2V7QA 4N4NB 3H35A 4DBRA 2W6JA 3DWLE 4DBQA 2KRHA 5FRMA 2ODLA 1G8XA 1MMNA 4KISA 3F9KA 2ZXHA 2CV1A 3E0JB 2V9KA 2WSSA 4C2LA 2I8DA 2VL8A 3DPUA 2W7NA 3K70C 1QHHD 4JQFA 2W82A 5HVQC 4AU7A 4U87A 4B47A 1LKXA 4HIZA 3OR1C 2X3HA 3GVJA 4Z03A 2DCEA 4HSTA 3T51B 1UD6A 3DEEA 2HVSA 4RM2A 1NG7A 2CW7A 3H9GA 2HQAA 3H5AA 4XOTA 1V5FA 3FBIB 3MD2A 3OYMA 2PMZA 4BACA 2L9NA 3FKJA 1OGOX 4PSXA 4ZYAA 2HU9A 2BSPA 2R7VA 3OS1A 5CQGA 2XF5A 4NNJA 3ZCOA 4XKVA 2R7UA 3W2WA 1H8HA 1GQ8A 3OPOA 1O8GA 4FXUA 2IS2A 4ITVA 1EA3A 1O8HA 2O17A 4XOPA 3L2WA 2VJJA 2LG4A 4PSWA 1SKYB 1UD8A 1X4PA 3BC8A 2R9VA 3SZGA 4DK1A 2O0WA 4W8QA 3DPTA 3HAGA 4DK0A 3OS2A 2PYHA 1UD2A 4LIUA 3VSVA 2VIXA 4BL0B 1TT0A 1WJFA 2BVLA 1CZFA 2NTPA 4XMYA 4P5OA 1K6YA 3K4NA 1OB0A 1J09A 2LBFB 4CCJA 3OR2C 1UD5A 1H80A 1WJCA 2IGNA 2IGMA 4PFOA 3G05A 1QU3A 3CMMA 4KJZA 4J00A 4XKCA 1NRKA 1NHCA 4YRVA 3DKXA 4RLQA 1O88A 4B48A 1VLYA 1X1CA 1OLTA 1DBGA 1OFMA 2VPLA 1PJRA 1U0JA 4OJ5A 2JVGA 2KDOA 1LVKA 3PJRA 1V5GA 2PJRB 4Z1MA 2WJVA 1UELB 1KZLA 5KCMA 3OYJA 2M7BA 4LIVA 2UWMA 1O8IA 2WBMA 2X1DA 3OYIA 3ZRGA 1IDJA 1OR7C 4G6TB 4II3A 4PK4A 4DNTB 3GRHA 1VJSA 3HXLA 3VSKA 2JUGA 3SYTA 1MNEA 2Z8GA 5CPRB 4F52A 1N78A 3K4KA 1ERDA 3S93A 3HUGB 2GOXB 2X6YA 2VLAA 4PUSA 1KTWA 1P9QC 5CKTA 1KCDA 1BMFA 4DGWB 4P1WA 2OV7A 4H4KC 3TMOA 4BDZA 1V0EA 2LOOA 3OWTA 1W9XA 2ZZGA 1K5CA 3I3LA 2O04A 2AQEA 3GVLA 3OOCA 3BH4A 3EUAA 4E7LA 2D3NA 3ZIAA 4OWRB 2NZMA 1IDKA 3CJQB 1IB4A 2X51A 3S3MA 1X0CA 5DN6A 2EWEA 1D1AA 2PYGA 4Y3OA 4BS9A 4XKBA 1BPLA 4TSFA 4TT3A 2HVRA 1XG2A 4MLOA 5FROA 3PFYA 2XF7A 3OYFA 3UR3C 4D9JA 2GK7A 4KITB 4DIQA 1WJDA 2VQCA 3D5LA 3HG9A 2VJ4A 2VASA 4BJTA 2RREA 4E7JA 2V31A 4BU2A 3LSKA 4GQNA 1DBOA 1OFLA 3A3BA 1IA5A 3VYUB 2AQFA 3T53B 3VMWA 4XKWA 1DGRM 1TZLA 1WJ5A 3C2HA 3OYCA 1BLIA 1T0FC 1FMWA 2V7FA 2W4SA 4Y4RA 4U49A 3VMVA 3B4NA 2X1EA 2GJKA 4HEA2 3NWSA 2JSPA 2WAEA 3VYTB 2CUJA 3HKZA 2IXSA 4XLEA 4TKOB 4F3QA 1E3ZA 2DT7B 4NQWB 3SUCA 3W2AA 3M8JA 4F93B 2V4DA 3OE7A 4N4OB 3OW7A 1BHEA 2P0WA 4W8RA 2X8KA 2KRCA 3GQ8A 2ZZQA 3T9GA 1ZELA 2WA0A 3G2BA 3LSGA 4E6KG 4DJAA 2VBKA 4YZ0A 2FUG2 2LZJA 1WMRA 1UG0A 3LMMA 1PKVA 1Z21A 2L7KA 2VQHA 3JURA 2LY2A 3EPZA 2W6IA 3CJRB 5FL7A 3ZSCA 1YX5A 2K9MA 3LFUA 4E0FA 4NC7A 3GBGA 2F4IA 2HLDA 3VSUA 3WWGA 2D3LA 2LY1A 3OYLA 1WTHD 4P22A 2NSTA 2V26A 3L2UA 3SEZA 2QX3A 4JMQA 2BVMA 2KL4A 2MC4A 1N75A 4KKSA 3LSIA 2IS6A 3GQ9A 1WFXA 3H5NA 2WZPP 3D5RC 3A2KA 1RU4A 2LBFA 1PLUA 3DTKA 1QHGA 4Z06A 3UNGC 5KNLA 3FKSA 2VBEA 1JTAA 2K3PA 5HLTA 3QYEA 2W1OA 2V6EA 2XGJA 3VYRB 3BG7A 2E1MB 2CV2A 3OIQA 3HPHA 3EUKL 1Z3XA 3L2QA 1D0YA 3PNVA 1X1BA 3RPUD 1O8LA 1Y56A 3LMWA 2X53S 2DT6A 3AL0C 4L8JA 2XAUA 4PFPA 2WY8Q 4KKUA 1D0ZA 4HNUA 4XLHA 2E5ZA 3CESA 4AVZA 1WP6A 3OMYA 3ZGKA 1V5EA 2WB1A 4ZTJA 2BOLA 2HPMA 3EQOA 2MFZA 4EATA 1BN8A 4ZC3A 3ZPPA 3KRGA 4BXFA 4CCLA 2WJYA 1BR2A 2LH9A 3LNNA 3GQAA 1NBMA 4CSWA 2WADA 3LL7A 3V42A 1WJAA 2NSPA 2XSJC 5KHDA 4XONA 1VF7A 1EFRA 1HVXA 4URRA 2DIEA 2XOKA 5HNFA 2Z16A 4RMNA 2F5VA 3HC7A 2M4GA 4YZXA 2KZVA 4BQNA 2XZPA 3E1SA 5JHFA 2VQGA 2CV0A 2CFOA 1D1CA 3RCOA 3QODA 1EE6A 1OOCA 2Q1ZB 3UW0A 1PYVA 2LRDA 5TGTA 1D1BA 4NUBA 4B44A 1MW7A 1T5EA 4PJMA 4XR6A 1JRGA 2HPIA 1X1AA 1UD4A 2INVA 2UUZA 2HZDA 4BE2A 3D5SC 3DU5A 1GLNA 1MNDA 2L5QA 2VQLA 2W00A 2Z2SB 3CP2A 3ZXSA 4ZDPA 4C9YA 4C2TA 2JJ2A 2NTBA 3EUHC 4E7IA 4OJOA 4HRIA 2WY7Q 2XC7A 4YXWA 2QY1A 3K10A 4ZJZA 2DOAA 2F6CA 3W3CA 2O5RA 3OY9A 4E7HA 4OZYA 4LG3A 3VYSB 3OYNA 3FY3A 4X0GA 3K4LA 2ZZEA 1WPCA 1R6RA 3ZR8X 2KLOA 4OAYA 4I84A 3S32A 2GOMA 3L2VA 2LC2A 2F43A 4XQFA 4OZZA 3K4MA 2ZSIB 4KKTA 3VDXA 2WAFA 4B3XA 2QXZA 4IQ4A 3IAS2 3PL8A 4Y33A 2CW8A 3VSLA 2R7QA 4CH7A 1O8MA 3OOUA 3N05A 3GVKA 1QJVA 3H9QA 4F55A 3OL4A 3BCAA 4IZZA 4FETA 4XM3A 2Q2EB 3A1YA 2ZZFA 4LITA 2VBMA 3KEWA 2K5CA 4E7KA 2KHMA 1PXZA 4B3GA 1E1QA 4F92B 3DTIA 4J01A 1N77A 1W0JA 3OEHA 1UD3A 4BE0A 4B43A 4PJNA 2QE7A 2QKLB 4CCKA 3OL3A 4E7ZA 4U7BA 4XL9A 4E7SA 4BGDA 3OS0A 4BDYA 1HZEA 5HKKA 3U21A 4Z05A 3S3NA 2OC6A 1JI8A 2E1BA 1LFPA 2VXDA 2DXIA 2VB6A 2ZFUA 2XZLA 2L2OA 3SDBA 2IQ7A 5CDFA 1O8JA 3IP4B 2X6WA 2KQRA 3OYEA 2R7RA 3A35A 3T56B 3EQNA 1X1DA 4HWVA 2GJRA 3K4CA 3B8YA 4D1QA 3NWTA 3QYFA 3OYGA 3DQVC 3PUBA 2MYSA 2X6XA 1O8KA 2HVQA 4B3FX 3ONQA 3LSHA 3OIPA 4JOMA 4E4HA 4HNTA 2UVFA 2KP6A 2E60A 3OYAA 1T95A 4EW9A 4CZCA 3KX2A 4PJLA 2IGOA 1X19A 2Y0SA 5AMVA 1V0FA 2NTQA 3OYHA 1NG6A 1E0EA 4ZDOA 5HNHA 3OEEA 4BQOA 4XN0A 1KONA 4YZQA 5LFAA 4BE1A 3OAAA 1BOBA 2VJ5A 1BR1A 3WQZA 4IX7A 4OAZA 4ASUA 2UV1A 4HG2A 4RM3A 4XLAA 3JU4A 4KT6A 2ZTGA 1E1RA 3DU6A 4YELA 2ZXIA 1YE9A 4XLFA 1I8DA 3KEYA 1MMGA 1DGWY 4BJ6C 4R79A 5HOOA 2V1NA 5IK2A 2XDVA 4W8SA 1DP3A 3GQ7A 4C30A 1BR4A 2OUMA 1YX3A 2M4KA 4UZUA 2R7WA 3K6GA 1KMHA 4YZAA 3RTRA 3DLAA 3H5RA 3NE5B 4XLCA 3J7AY 2MD0A 1W36C 3PSFA 2JVHA 2Z6BD 3OYBA 4CA0A 3OYDA 3DDYA 2K9LA 2NT6A 3MKZA 3M1CA 4ANJA 5C1EA 1H8EA 4IKFA 4XNFA 4BEHA 4CCOA 3OYKA 2IS1A 3BCDA 3BLYA 3QOEA 3K4BA 2VKDA 2JIZA 4BEHB 2R7TA 4DOZA 2GJPA 4G7WA 1PE9A 3MMYB 4II2A 2XNDA 3VR6A 2LREA 3RQ4A 4DNRB 4W8TA 3BCBA 1AIRA 4BJ5C 4NK6A 2O0VA 4C2UA 4RLFA 2ZTNA 4MR0A 2RNGA 4NC8A 3S8PA 5C1CA 2WAQA 3TBIA 1IRXA 2M3AA 5FRNA 4PMHA 3C2GA 2R4GA 4OJ6A 4IQJA 4F91B 3A3GA 2CS3A 2QKMB 1HG8A 1RWRA 1QCXA 3BG6A 3QYBA 3SEQA 1S9HA 2VKHA 5CQEA 4CUGA 2NOJB 4ZDLA 2WPDA 4G7XA 2XZOA 4OJLA 2R7OA 3I9V2 3BC9A 3HPGA 4BUPA 3K4JA 4ZTFA 4G6IA 3RSNA 3BCFA 3ZQQA 2CH0A 3CF2A 3HOTA 1D0XA 1WJBA 3MKWB 2X85A 1DQUA 2VXZA 3ZPNA 3IUOA 1E3XA 2E1MC 2M5SA 4GRIA 4AYBA 2A5WA 4FASD 2CK3A 2RQQA 2BW3A 1Y6IA 3A4CA 3FBNB 3L2RA 3DTEA 2E5NA 3PSIA 1W36D 2GK6A 2KVOA 3HL2A 3CP8A 2CUZA 3W2VA 1O8DA 3OFNA 2BW3B 2IGKA 3AKZA 3KYLA 1FX0A 1OGMX 2IS4A 4XN3A 2A6TA 3K70D 4MXNA 3LSMA 2Z1DA 5LD2C 3B90A 1O8FA 4BQQA 3CZ6A 2KMUA 3HOSA 2JJ1A 1KCCA 1MMDA 4QPOA 4NK8A 3MKYB 2NT9A 1Z3YA 4YEJA 2F1MA 1O8EA 3GQBA 2CMPA 2PJRA 1WJEA 4QPQA 2R7XA 1X4OA 2X1CA 1E43A 2V4JC 3VWBA 1Z7LA 1UAAA 4HPQA 1K28D 3PNTA 3FHNA 2ZSHB 2MABA 2M0MA 1HA8A 4CCMA 2UVEA 3H9JA 4XORA 1G59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE6 A;  1OOC A;  3UW0 A;  2VJI A;  4W8S A;  2NZM A;  3GQ7 A;  3VST A;  1IDK A;  1IB4 A;  4XR6 A;  1JRG A;  2INV A;  1X0C A;  2INU A;  2PEC A;  2EWE A;  2NTB A;  4YZA A;  2PYG A;  4OJO A;  1RMG A;  4XLC A;  1XG2 A;  4U4B A;  1VBL A;  2QY1 A;  4OJP A;  2O1D A;  2NT6 A;  1DBO A;  1OFL A;  4OZY A;  1IA5 A;  5C1E A;  3FY3 A;  4XNF A;  3VMW A;  4XKW A;  4I84 A;  3VMV A;  2ODL A;  4U49 A;  3B4N A;  4XQF A;  4OZZ A;  1PE9 A;  4C2L A;  4XLE A;  2QXZ A;  4W8T A;  1AIR A;  3SUC A;  4NK6 A;  2O0V A;  5C1C A;  1O8M A;  4MR0 A;  4Z03 A;  2X3H A;  1QJV A;  1BHE A;  4W8R A;  3GQ8 A;  4XM3 A;  4PMH A;  3T9G A;  4YZ0 A;  2VBK A;  4OJ6 A;  1WMR A;  2VBM A;  1HG8 A;  4XOT A;  1RWR A;  1QCX A;  3JUR A;  1OGO X;  1PXZ A;  2BSP A;  3ZSC A;  4OJL A;  4XKV A;  1GQ8 A;  3VSU A;  1O8G A;  3WWG A;  2NST A;  2QX3 A;  1O8H A;  2O17 A;  4XOP A;  2VJJ A;  4XL9 A;  4W8Q A;  2O0W A;  4Z05 A;  2X85 A;  3GQ9 A;  2PYH A;  1RU4 A;  3VSV A;  1PLU A;  4Z06 A;  1CZF A;  2NTP A;  2IQ7 A;  1O8J A;  4XMY A;  2X6W A;  2VBE A;  3EQN A;  4HWV A;  1JTA A;  1H80 A;  3B8Y A;  1O8D A;  1NHC A;  2X6X A;  1O8K A;  1O8L A;  1O88 A;  3LMW A;  1OGM X;  2UVF A;  4XN3 A;  4MXN A;  1DBG A;  4EW9 A;  1OFM A;  4XLH A;  3B90 A;  4OJ5 A;  1O8F A;  4AVZ A;  1KCC A;  3EQO A;  4NK8 A;  5AMV A;  2NTQ A;  2NT9 A;  4YEJ A;  1BN8 A;  1O8E A;  3ZPP A;  3KRG A;  1O8I A;  4XN0 A;  1IDJ A;  4YZQ A;  3GQA A;  3GRH A;  2NSP A;  4XON A;  2Z8G A;  4URR A;  4XLA A;  2X6Y A;  1KTW A;  4YZX A;  1KCD A;  4YEL A;  2UVE A;  4XOR A;  1K5C A;  2O04 A;  4XLF A; 
#chains in the Genus database with same CATH topology
 1SFK A;  3V4G A;  1AWC A;  3FDY A;  1MAB A;  1TW3 A;  2VJI A;  3V7S A;  4M6X A;  3VST A;  2DLL A;  4FE7 A;  3AFH A;  3GX4 X;  2NNN A;  2K86 A;  2L9S A;  4P55 A;  2ZJR F;  1EF4 A;  1ON1 A;  1I18 A;  4M2L A;  1HF2 A;  1OHH A;  4DW6 A;  2PEC A;  5HLH A;  1FMV A;  2L02 A;  5B66 C;  4A0Z A;  4S05 A;  1IAW A;  1IJE A;  5LMZ A;  1R5B A;  3ONU A;  1T08 B;  1PJ6 A;  4U4B A;  3HOU J;  4XBF A;  3ABT A;  3TW6 A;  1MKM A;  1R23 A;  4PJJ A;  4IOA F;  2DJI A;  1VQ6 I;  4FK8 A;  2DO7 A;  2RN7 A;  2LKP A;  3ISP A;  4GXO A;  3I4M J;  3HTS B;  2V7Q A;  1NDH A;  4LLL A;  2HWV A;  2KRH A;  2KIS A;  4EMS A;  3OZW A;  2EZK A;  2HEO A;  4M3B A;  4KT5 C;  1HF0 A;  3A0B C;  1AU7 A;  3CCU B;  1U5T C;  2CV1 A;  3E0J B;  4CXF A;  2VL8 A;  3MCZ A;  5B6I A;  2V7W A;  3FKI J;  4JQF A;  3IRR A;  2W82 A;  3WY9 A;  1Z1D A;  4Z03 A;  3B73 A;  1W1W E;  3OR1 C;  3HOW J;  3KZY A;  5A2Q Z;  4ENM A;  3U6K A;  5GPA A;  3RZD J;  2HVS A;  3C2B A;  1VQO B;  2HOE A;  2E1N A;  2AS5 F;  2CWE A;  3CO7 C;  3A01 A;  4P3I A;  3H9G A;  2B0L A;  1N05 A;  4BAC A;  1V5F A;  3FBI B;  4L9V A;  2DOD A;  4Y7C A;  1ZLK A;  4UZE A;  4ZYA A;  4WF2 A;  4EVI A;  3I55 B;  2JJ7 A;  3OS1 A;  1RKT A;  3ZCO A;  3HEF A;  1QVU A;  1GV2 A;  2KIU A;  1O7F A;  3DV8 A;  3OPO A;  3QFT A;  3I1F A;  4D7N A;  3B78 A;  5ICE A;  3BG9 A;  4PSW A;  4DK1 A;  1PDN C;  1IC8 A;  1YW9 A;  2R9V A;  2G9W A;  3SZG A;  4FX4 A;  2CJJ A;  3PEN A;  1U6G A;  3OS2 A;  2PYH A;  3R4K A;  2VYQ A;  3VSV A;  5JMC B;  2MGQ A;  3WGH A;  1P7I A;  1CZF A;  1U8B A;  1OFE A;  3ZMU A;  1LQ1 A;  1MH3 A;  1OB0 A;  2CFX A;  4HAM A;  4CCJ A;  3OR2 C;  2V1U A;  3H0G J;  4D7M A;  2V7V A;  4OPW A;  3FIS A;  2FRH A;  2VOD A;  3L00 A;  4PFO A;  5E3L A;  1P4M A;  1U9N A;  3G05 A;  5A88 A;  3CMM A;  4J00 A;  1OYI A;  4XKC A;  4G7H F;  4YRV A;  3TOB A;  5LHG A;  3W2F A;  1VLY A;  2PQ8 A;  2YU3 A;  1S0U A;  1PJR A;  4OJ5 A;  2KDO A;  2JRM A;  1LVK A;  5F1J A;  1A31 A;  2EZH A;  5K7F A;  3GFI A;  5H59 A;  1KZL A;  3DXJ F;  1IHM A;  2X1D A;  2FOK A;  3ZRG A;  4LG0 B;  1BJK A;  3GRH A;  2W25 A;  3FIW A;  3SYT A;  3LQR A;  2Z8G A;  1K73 D;  3AVX A;  1SFO J;  1I27 A;  5J35 A;  3G4S I;  2XGC A;  2VLA A;  1YJ9 I;  3REO A;  5GAE J;  1ZKG A;  1FC3 A;  1P7J A;  1X2N A;  4DGW B;  4YHB A;  4H4K C;  3C7J A;  4BDZ A;  1V0E A;  3OWT A;  1K5C A;  3I3L A;  3GVL A;  1J0R A;  3BH4 A;  3ERM A;  3EUA A;  5J4V A;  3KEQ A;  1IB0 A;  3IKV A;  1K8A D;  9ANT A;  1IB4 A;  1IJF A;  1TLH B;  2D5V A;  3B8H A;  5DN6 A;  2MH9 A;  1LEA A;  4Y3O A;  1KQS B;  5FO0 A;  5FRO A;  4HDV A;  3PFY A;  5J40 A;  5EEH A;  3HTU A;  4P3Y A;  4U0V A;  2K9S A;  2R7D A;  2GK7 A;  4KH3 A;  2VQC A;  4BJT A;  5HLG A;  3GTK J;  2VAS A;  2V31 A;  2RRE A;  3G1M A;  4O5V A;  5EG0 A;  4GQN A;  3BQY A;  1E3O C;  2XRL A;  3HKZ N;  1UJ8 A;  1TZL A;  5E1X A;  2K3F A;  3JTG A;  2IBD A;  2V7F A;  4Y4R A;  3T8R A;  3LFK A;  1HSJ A;  3B4N A;  3Q0U A;  3PVD A;  4C43 A;  2NYX A;  3PUF A;  1CF7 B;  2K40 A;  3WU2 C;  3I59 A;  1DDI A;  2EV0 A;  3VYT B;  1EV7 A;  3QP5 A;  4Z4T A;  2IXS A;  1MMS A;  2DFE A;  1E3Z A;  1M1K D;  4NQW B;  2DOF A;  3SUC A;  3CME B;  2JK3 A;  4KIG A;  3W2A A;  4ZGQ B;  3M8J A;  3OE7 A;  3JRF A;  2FOW A;  3GME A;  1BHE A;  3O8G A;  1XB4 A;  3BR0 A;  2X8K A;  2KRC A;  2ZFW A;  1ZEL A;  2WA0 A;  3JR9 A;  4DJA A;  2BGC A;  2FUG 2;  5L3C A;  1WMR A;  1UG0 A;  5B1B H;  1IN5 A;  1LNW A;  2VBT A;  2A6H F;  2NOG A;  1SAX A;  2O6G E;  1Z21 A;  1PKV A;  2JWT A;  2W85 A;  1J9Z A;  2D1H A;  1VND A;  3KPH A;  2CW5 A;  5FL7 A;  4E0F A;  2QYU A;  3GBG A;  2HLD A;  3VSU A;  2VBY A;  3OYL A;  3KCC A;  2DER A;  3K1P A;  4JMQ A;  5FA6 A;  1TBX A;  2KL4 A;  1Z05 A;  2MC4 A;  1N75 A;  1QGP A;  1IUF A;  3DBR B;  2XKO A;  4U0Y A;  1I5Z A;  3U2Q A;  2DMU A;  5DM7 F;  2O9L A;  3A2K A;  3I56 I;  1PLU A;  2DDA A;  3DTK A;  1XB2 A;  5B3S H;  5KNL A;  1IG7 A;  1Q1H A;  4U0W A;  5LHI A;  2WAQ N;  4HLX A;  4RCZ A;  4A2U A;  1FSH A;  4UAJ A;  1JTA A;  4P6Y A;  1VQ5 I;  3OIQ A;  1QX4 A;  1Z3X A;  4DQ2 A;  3N4M A;  3AK5 A;  4YDT A;  2CQQ A;  2WB1 N;  2X53 S;  5CVI A;  4M74 A;  4KKU A;  4XLH A;  1VQK I;  2E5Z A;  2FSW A;  5KAI C;  1WP6 A;  3ZGK A;  4RD4 A;  2MFZ A;  1QGA A;  3ZMV A;  1H9G A;  1BN8 A;  2F5E A;  4UV8 A;  4KUM A;  4PGG A;  4BXF A;  5EGO B;  2NNY A;  3GTG J;  2HTS A;  4JX4 A;  1R9T J;  4NC6 A;  3LNN A;  3GQA A;  2WAD A;  3LL7 A;  2J8I A;  5IYR A;  4A3J J;  2IPQ X;  5L46 A;  1WZ2 A;  3D1N I;  1JJ2 B;  2F5V A;  4A3B J;  3BOQ A;  2NVX J;  4NCN A;  4ASN A;  2M4G A;  4ZCM A;  4XSZ F;  4BQN A;  3S17 J;  5M5Y J;  1K4S A;  4UHT A;  1T2K A;  4X7E A;  2CFO A;  1YI2 I;  3KYD B;  4XLP F;  2QBY B;  2JZY A;  3WBJ A;  1XSD A;  1SMT A;  4WZL A;  1ETX A;  5E1W A;  3UW0 A;  1TYX A;  5ILU A;  2OA4 A;  1D1B A;  3J7Z I;  3COA C;  3DU1 X;  4YFX F;  4BY7 J;  2HPI A;  4RB3 C;  2INV A;  1DG1 G;  3D5S C;  3PSS A;  3LA7 A;  2NTB A;  4C9Y A;  3ZXS A;  2JJ2 A;  2VT3 A;  4PC2 A;  4A0Y A;  5F08 A;  2BPO A;  4LB6 B;  1DAR A;  2XC7 A;  1LLW A;  2EIL H;  5DD8 A;  2C5B A;  2DOA A;  2F6C A;  3W3C A;  4E7H A;  4OZY A;  2ZBV A;  2GQF A;  4GYG A;  3K1M A;  3VYS B;  5JI6 A;  3FY3 A;  4AC0 A;  1HBX G;  3OP1 A;  2ZZE A;  3ZR8 X;  4MEX F;  1HDD C;  1ODD A;  3B6A A;  3LSP A;  5BNG A;  2F43 A;  2IAI A;  3BJO A;  2K27 A;  4P9F A;  4RPB A;  2XTY A;  3K4M A;  5CVV A;  3ASN H;  2CQ7 A;  2E2H J;  2ZSI B;  3EDP A;  1YI2 B;  2A68 F;  1F5T A;  3AVY A;  3F6V A;  3BTI A;  5E3N A;  1MRZ A;  2KFD A;  3FXJ A;  5M3M J;  1T38 A;  2DA6 A;  2W84 A;  4Y33 A;  4HNV A;  1EFU A;  3VSL A;  3OOU A;  1QJV A;  4BBR J;  3H9Q A;  5DCF A;  1RR8 C;  2DEU A;  3CDI A;  3OL4 A;  4K2E A;  4AID A;  2VE8 A;  2PMD A;  2Q6L A;  5F4M A;  1YJW B;  1IXS B;  5JR3 A;  4LIT A;  2VBM A;  2KHM A;  2QCO A;  2V1D A;  1PXZ A;  1FTZ A;  2XV4 S;  3DTI A;  2BM0 A;  3OEH A;  3WE3 A;  4G7O F;  2VNJ A;  1VQK B;  4W1U A;  4L9N A;  4M53 A;  1FBS A;  3ZMZ A;  4E7Z A;  3IH3 A;  3RKW A;  1B23 P;  4IO9 F;  4X7C A;  4E7S A;  1YW8 A;  2CQK A;  1YIJ I;  5EEG A;  3U21 A;  1A36 A;  1AOY A;  2NV4 A;  4Z4Y A;  4Z05 A;  1DPR A;  2VXD A;  4PZJ A;  1QA3 A;  5J3L A;  4D5F A;  1Y0Y A;  2OTJ I;  5CDF A;  2KQR A;  2WV0 A;  1IUY A;  3T56 B;  1QFZ A;  1X1D A;  5E3M A;  2GJR A;  2DMP A;  3L1P A;  3B8Y A;  1X3W B;  3NWT A;  3V7A A;  4ABZ A;  2Z9O A;  3DQV C;  2EWN A;  3KP5 A;  1LEB A;  4M1K A;  2X6X A;  2BF4 A;  4B3F X;  1UG2 A;  2MLG A;  3ROU A;  3WU0 A;  2HDD A;  2BVN A;  4X07 A;  3GLX A;  3ZQF A;  3BY1 A;  4EM1 A;  2Y0S A;  1DU0 A;  3MZ8 A;  3H9N A;  2NTQ A;  3OYH A;  1NG6 A;  2GIV A;  1EP1 B;  5IT3 A;  3KFW X;  4AD9 A;  2BZT A;  1KON A;  2BXZ A;  3FXL A;  3OAA A;  4A3L J;  5F27 A;  3WQZ A;  1BR1 A;  4OAZ A;  2DA5 A;  1OMI A;  3GIR A;  1XSV A;  1K79 A;  3E6D A;  2DYR H;  2ZTG A;  1H0M A;  3ZQC A;  3OJW A;  4YEL A;  3ZC3 A;  4AIH A;  1YE9 A;  2KDZ A;  1RES A;  5HOO A;  2YS9 A;  4BJ6 C;  2NAZ A;  3HHH A;  4R79 A;  2VBX A;  2YWE A;  4JP0 A;  4WWC A;  1DP3 A;  3R6J A;  1VQ7 B;  2L0K A;  4B1R A;  4DYQ A;  2M4K A;  5K7Z A;  3FZV A;  3WG7 H;  3Q39 A;  5C3E J;  2JN6 A;  4O3M A;  4PAA A;  1T6S A;  3RTR A;  2P3M A;  1G7S A;  2E36 A;  1MIJ A;  3JW4 A;  3J7A Y;  1N25 A;  1W36 C;  4E70 A;  3GYH X;  2K4B A;  3OYD A;  2O6W A;  4RCY A;  5LRS A;  3RIR A;  5GPC A;  4WCG A;  1RIO H;  4PC1 A;  4G1B A;  3OW2 B;  3BCD A;  1MBE A;  3KZI C;  3QOE A;  2H8W A;  1IW7 F;  1FOW A;  5LGT A;  1B9M A;  3HBL A;  4BEH B;  2WWY A;  2R7T A;  4WXC A;  3MMY B;  4J19 A;  3C18 A;  2DTR A;  1JJ8 C;  2RC4 A;  1XDS A;  3VR6 A;  2O03 A;  2P5L C;  3BCB A;  1W7P B;  3TP0 A;  4X0C A;  1CLW A;  4BJ5 C;  2XB0 X;  3CLO A;  4RLF A;  2RNG A;  3S8P A;  5JHU A;  1H85 A;  2CF4 A;  3KET A;  2ZTN A;  3G4S B;  2WAQ A;  1VQM B;  1R4M B;  2HQN A;  3BTC A;  1IRX A;  2XB5 A;  2M3A A;  5DCM B;  5FRN A;  4G5G A;  1YHQ I;  4B09 A;  2DK5 A;  4OJ6 A;  4F91 B;  3CDL A;  3A3G A;  1XMK A;  2R7F A;  5GP9 A;  3ZQ7 A;  1W0T A;  3CRZ A;  5DSZ A;  2QSH X;  4UVB A;  1IO2 A;  5CQE A;  4LLN A;  1OFD A;  1FOX A;  4OJL A;  1ETY A;  1ZTR A;  5H6Q A;  4CO8 A;  2ZO4 A;  3HPG A;  4BUP A;  1W87 A;  1I6X A;  3RSN A;  2PMU A;  5LEJ A;  1PJ7 A;  4RAG A;  1R36 A;  5HZB A;  1XG1 A;  1Z6R A;  3HOT A;  4L0Z B;  1DQU A;  3K69 A;  3FF5 A;  3OZU A;  4QV2 A;  1E3X A;  4L5I A;  4M73 A;  3LAP A;  3F72 A;  3ZN0 A;  1T56 A;  2M5S A;  1QRY A;  3ABU A;  3OKX A;  3A4C A;  2FXA A;  2E5N A;  3PSI A;  1IRZ A;  2JN9 A;  1HXD A;  2CUZ A;  3W2V A;  5FLV A;  4MTE A;  3RPU A;  4IHX A;  3OFN A;  4YAU A;  1D1N A;  1XMA A;  1IN6 A;  3QFR A;  5IY5 H;  2Y2Z A;  3QPS A;  2CND A;  2TRT A;  4C3J J;  1TNT A;  2DY1 A;  1V55 H;  1OGM X;  3K70 D;  1RUN A;  3TED A;  2VKV A;  3LSM A;  1FX7 A;  1R5G A;  4X7D A;  5D8K B;  1OCO H;  2UXX A;  4BQQ A;  3GFL A;  5ILS A;  3W2I A;  1VF9 A;  3MKY B;  2HGC A;  3H3Z A;  2PJR A;  1O3R A;  1WJE A;  4QPQ A;  2X1C A;  1TWG J;  1W4M A;  3T0Y A;  2QEN A;  1Z7L A;  3LSR A;  3JRA A;  2EZL A;  1UAA A;  4MNU A;  1FWZ A;  3PNT A;  2MAB A;  5BMZ A;  5LBQ A;  1HA8 A;  1S8N A;  3E6C C;  1SFU A;  1HQC A;  1KU9 A;  4XOR A;  4WXH A;  1G59 A;  4JX5 A;  3SJP A;  1W2B B;  5HDG A;  1VQ9 B;  4LK0 F;  3FXQ A;  2NRA C;  4AM3 A;  1Q86 D;  4P25 A;  4Z4W A;  1KD1 D;  3MCA A;  2KKO A;  2JDI A;  4ZYG A;  1QH0 A;  3AGP A;  4ACA A;  2RV8 A;  3BR1 A;  3FWE A;  4IVN A;  2ACJ A;  3AL0 B;  1YX2 A;  3FPP A;  3ZBU A;  5DS9 A;  2QDX A;  3M7G A;  1TC3 C;  1S4M A;  1OGI A;  2VN2 A;  1T39 A;  4N9I A;  1VQ6 B;  2CUF A;  1TNS A;  3V8L A;  3JQR A;  1MMA A;  1YLF A;  2H94 A;  4BXU A;  2XTW A;  2QM3 A;  1V4R A;  3WTS C;  1YLO A;  1SAU A;  4QSH A;  5IPA A;  2R7S A;  2TDX A;  1COW A;  1ZM4 A;  2CC2 A;  3CJN A;  1X3Z B;  1AKH A;  5J4Y A;  1I3Q J;  2DMN A;  2EFO A;  1FLI A;  4WWV A;  5IYW A;  3DPL C;  2PBI A;  3Q5F A;  4QVA A;  5CVU A;  3H35 A;  1G7C A;  2W6J A;  3EYY A;  1QA1 A;  4QLC U;  3M9A A;  2XRN A;  2ODL A;  2BGJ A;  1EFT A;  1IV8 A;  4L9J A;  2ZXH A;  2IRF G;  2V79 A;  3JSP A;  3G6E B;  2RGV A;  3JQP A;  2I8D A;  3DP7 A;  4XRS G;  4KN7 X;  1NB0 A;  3SJZ A;  3KP6 A;  3S2W A;  3JRH A;  5HVQ C;  5E1Z B;  3L7W A;  3RY8 A;  2X3H A;  3WE2 A;  2C78 A;  1UHM A;  4HV5 A;  3GVJ A;  2DCE A;  2OYN A;  1VQ8 B;  5EMN A;  3ABK H;  1ORK A;  1NG7 A;  4RM2 A;  3HRT A;  2INU A;  1QO0 D;  3H5A A;  4HX4 A;  3W5V A;  2PMZ A;  2G7U A;  3FKJ A;  3A01 B;  1TTY A;  2NPF A;  4ZV4 A;  2BSP A;  2PMH A;  3L2C A;  4HDU A;  2R7V A;  3U6B A;  3RKX A;  1HLV A;  3KZZ A;  2XF5 A;  2DYI A;  3RIQ A;  4XKV A;  1H8H A;  3W2W A;  1GQ8 A;  1O8G A;  1JTY A;  1R1U A;  5D5V B;  4Z6Y A;  3ULQ B;  3HOV J;  2LFB A;  1S3J A;  2C5H A;  1SEU A;  3PUM A;  1KU7 A;  1EFC A;  1S6L A;  4LBY A;  3DPT A;  3GTL J;  3HAG A;  3M8E A;  4DK0 A;  4XK4 A;  1TLL A;  3I58 A;  5CVJ A;  4YIR X;  1UD2 A;  1R1V A;  3GEZ A;  1FBU A;  1R4N B;  2BVL A;  4BL0 B;  2B7B A;  2XNC A;  2NTP A;  4XMY A;  4P5O A;  1K6Y A;  3CCQ I;  4P9S A;  1SVM A;  2Z99 A;  3W5H A;  2BM4 A;  3ABM H;  2Y9Z A;  3SZP A;  4PDK A;  1X2M A;  4B3A A;  5HZA A;  1NHC A;  1NRK A;  1GR1 A;  3WXM A;  3JRE A;  3GVA A;  1O88 A;  2AHO A;  5J3O A;  2O8X A;  1OLT A;  1HKQ A;  2IEK A;  1W5T A;  1F36 A;  3VPR A;  1DBG A;  1U0J A;  1S72 B;  2PI0 A;  2VZL A;  1V5G A;  4Z1M A;  4IHV A;  2J7K A;  2Z5U A;  2WJV A;  3T8T A;  5KCM A;  3OYJ A;  3CW2 A;  2UWM A;  1O8I A;  3S1R J;  2EIJ H;  1W0U A;  3LST A;  4QVJ A;  2CUE A;  5IYQ A;  3TDZ C;  4AYB N;  2ZJP F;  4I7H A;  3BDD A;  4RPD A;  3RPQ A;  2EPF A;  1VHO A;  5DTD A;  1KK3 A;  2BEO A;  4ZYE A;  1P9Q C;  2A3S A;  4GCV A;  4CIC A;  3GFM A;  3TMO A;  1BX1 A;  4RAY A;  3T1B A;  4RB0 A;  5KK1 A;  2Y75 A;  1TWC J;  1LVA A;  2AQE A;  1ETO A;  3H3V K;  2PJP A;  4OP7 A;  3SLN A;  2D3N A;  4E7L A;  1NHA A;  2IA0 A;  3ZIA A;  5KVR A;  2DCU A;  5HLI A;  1SVO A;  5DNS A;  1FIP A;  3CJQ B;  1A04 A;  3WYA A;  1JXS A;  2E7X A;  1S7A A;  3DEW A;  1EWY A;  1D1A A;  3TGN A;  2PYG A;  4BS9 A;  3A1P A;  4TT3 A;  3IWF A;  2HVR A;  4YAL A;  3HM5 A;  4MLO A;  5E20 A;  3OYF A;  4KN4 X;  3OIO A;  3BTL A;  4D9J A;  4ENJ A;  4DIQ A;  1F43 A;  1WJD A;  1O3S A;  1DBO A;  4L9T A;  4BU2 A;  3JAM K;  2M8E A;  3IWZ A;  3O3K A;  1Y8R B;  2AQF A;  4LBZ A;  1NK3 P;  1XN7 A;  5EG0 B;  3ZPL A;  3OYC A;  3VMV A;  4U49 A;  1EH6 A;  3PUN A;  1USS A;  2EIM H;  3SFI A;  1ELO A;  5ICC A;  5BPD A;  2GJK A;  3WNC A;  2BHY A;  2P5K A;  2FBK A;  2JSP A;  1ACI A;  4IRG A;  2CUJ A;  2Q8K A;  1S29 A;  4XLE A;  1PJ5 A;  5D4S A;  2M0C A;  2F5D A;  4WQM A;  1TL8 A;  2XAJ A;  3OW7 A;  4N4O B;  2NVY J;  5E8G A;  1N08 A;  2ISY A;  4NQW A;  2ZZQ A;  2R5Z A;  4E6K G;  2UXN A;  5CLS A;  2LZJ A;  4EEF G;  2YWG A;  1MSE C;  3N6Z A;  2H09 A;  1R58 A;  3CDH A;  5EJC A;  2JT1 A;  2FNA A;  5A2Q K;  1E3P A;  2LY2 A;  3QOP A;  3CCL I;  2W6I A;  2E1R A;  2VOO A;  2K9M A;  3HSF A;  1TQM A;  3LFU A;  4NC7 A;  1LDJ A;  3SHF A;  1YIT B;  1BQE A;  1QPM A;  1FRQ A;  1IV6 A;  1ZAO A;  4BY1 J;  1WTH D;  4G8X A;  4P22 A;  3L2U A;  2QX3 A;  5B1A H;  2JRT A;  1YIT I;  4KKS A;  1POG A;  3KYC B;  3LSI A;  2IS6 A;  2M30 A;  3CUQ B;  1MJ9 A;  2LBF A;  1TQI A;  3WBK A;  4QWQ A;  5HLT A;  2W1O A;  2STW A;  1JT6 A;  4HF0 A;  1D8K A;  5DEQ A;  1L0O C;  1D0Y A;  3PNV A;  5K5R A;  1X1B A;  3I4N J;  2W57 A;  2RAE A;  2NVT J;  2JQ7 A;  4M6V A;  3P9C A;  4L8J A;  2M2E A;  1R7J A;  2XAU A;  3K7A J;  4PFP A;  1D0Z A;  1KZH A;  4HNU A;  3DCF A;  1B8I A;  1WU8 A;  1WXR A;  2V6C A;  3CES A;  4AVZ A;  1S7E A;  1KRH A;  2WB1 A;  1ZM9 A;  2V5I A;  2BOL A;  1NH3 A;  1XGN A;  2H8R A;  4G1V A;  5BPI A;  4ZC3 A;  4ENK A;  4BPR A;  1G4D A;  3Q9V A;  3HOZ J;  2YU9 J;  2WJY A;  1K4Z A;  5BS6 A;  1RPW A;  1B6A A;  2X4H A;  1D5Y A;  1JJ6 C;  2BE5 F;  5KHD A;  1VF7 A;  1EFR A;  1HVX A;  1MGT A;  1WOP A;  1K9M D;  3WHB A;  5HNF A;  2JA7 J;  5DM6 F;  3L9F A;  4U88 A;  1WI9 A;  2ISZ A;  5TJJ A;  2E1C A;  2KZV A;  1ZG3 A;  2Y69 H;  2XZP A;  1A8P A;  3PO3 J;  2ID6 A;  2ZBU A;  4YAW A;  1ZYR F;  5JHF A;  1QUE A;  1D1C A;  2DA4 A;  5JVT A;  2VNK A;  1OOC A;  1PYV A;  2LRD A;  3N97 A;  2ZL6 A;  2K02 A;  4Q7J B;  2D74 A;  3U2R A;  2QBY A;  3WG9 A;  1BA5 A;  2OF7 A;  2L3D A;  2A5Y B;  5E8I A;  1UD4 A;  5D4R A;  2DU9 A;  4B4D A;  3DU5 A;  1BBY A;  1FOY A;  2H6C A;  2Z2S B;  2F4M B;  2LF8 A;  5H2F C;  4OOX A;  4PGO A;  1DAB A;  1BJZ A;  3EUH C;  4OJO A;  2XC1 A;  1MDM A;  1P4A A;  2L7Z A;  5ICF A;  5J1R A;  2DN0 A;  3ML6 A;  1XGS A;  2OCE A;  1KU2 A;  2XPW A;  1KK0 A;  1H88 C;  2O5R A;  1H89 C;  4YFO A;  2ZCW A;  3E3V A;  2M1B A;  4OIO F;  2XPV A;  2BV3 A;  5D8L B;  4X0G A;  5K7H A;  2FVG A;  1R6R A;  4OAY A;  4I84 A;  3RI4 A;  4JX6 A;  5EYR A;  4PJ0 C;  3BQZ A;  1K78 A;  2YX4 A;  1S72 I;  2O61 A;  1ZM3 A;  3H3U A;  2GXA A;  2QGG A;  3HRM A;  3DFG A;  3VDX A;  2DI3 A;  3FXK A;  3CC7 B;  1RC9 A;  1YYV A;  4Q47 A;  3IAS 2;  1FIA A;  3W6K B;  4DZJ A;  2ZJ2 A;  3TO6 A;  4PCQ A;  1KC8 D;  2CW8 A;  1SM4 A;  2R7Q A;  1O8M A;  3GVK A;  3N05 A;  4OIP F;  3GTO J;  1D8T A;  4RDL A;  5J6X A;  4IZZ A;  3CCQ B;  4FET A;  4XM3 A;  1Q81 D;  3A1Y A;  2ZZF A;  1QVT A;  4MHG A;  4XID A;  2MH2 A;  2DA2 A;  3KEW A;  1EH7 A;  1XMX A;  4FCY A;  1Y8Q B;  1XGM A;  2M9H A;  1E1Q A;  2OD5 A;  4J01 A;  1N77 A;  1ETK A;  2GBY A;  3ZZU A;  4BE0 A;  4B43 A;  4I6Z A;  2QKL B;  5L3B A;  5JVG F;  2FE3 A;  2YPR A;  4CCK A;  4U7B A;  1Z9C A;  1RQP A;  4L5E A;  2X6O A;  2Q6O A;  3NEU A;  4XL9 A;  1B1B A;  4BGD A;  4BDY A;  4F7D A;  1U5T B;  3JRC A;  3S3N A;  2E1B A;  1JKR C;  3ZZ0 A;  1KA8 A;  1CQT A;  2DXI A;  1GVH A;  2ZFU A;  3V76 A;  3SDB A;  4ESB A;  3G1O A;  1G6N A;  2IQ7 A;  1O4X A;  3IP4 B;  4KIF A;  4UVC A;  2R7R A;  1CQX A;  4UY8 I;  3A35 A;  1D2E A;  1VQ8 I;  4HWV A;  3K2A A;  3HYI A;  1DP7 P;  2P7C B;  4XRS A;  3K4C A;  2VT2 A;  1OB5 A;  1LM1 A;  4D1Q A;  4FX0 A;  4W97 A;  2H1K A;  1LE8 A;  3PUB A;  2MYS A;  1SD7 A;  3WGG A;  3LQ6 A;  4RD1 A;  3JRI A;  5E17 F;  3LSH A;  3GWZ A;  1UMQ A;  2DMT A;  2Y31 A;  1JE8 A;  2W24 A;  2E60 A;  5LLQ A;  2X48 A;  3BPX A;  4WZE A;  3SXY A;  2RDP A;  4FHT A;  1CGP A;  2IGO A;  2STT A;  4QHY A;  4X05 A;  1E0E A;  4BQA A;  3LYC A;  5HNH A;  4S04 A;  3OEE A;  1QNT A;  4YZQ A;  5LFA A;  2OZU A;  3ZQG A;  2KZG A;  2PEX A;  3F0C A;  1YHQ B;  2VJ5 A;  3F3X A;  4HX8 A;  5H20 A;  3JTH A;  5FKL A;  3ZQL A;  3SY2 A;  3IHU A;  4HG2 A;  2COB A;  1CNF A;  1GV5 A;  1JB9 A;  4KT6 A;  4Y15 A;  3S1N J;  4XRF A;  3WU1 B;  2K7L A;  3R61 A;  2EFP A;  2B0R A;  1HC8 A;  4ZCL A;  1KJZ A;  2HQ5 A;  1F9N A;  1LFB A;  3HSR A;  2GWR A;  3EYI A;  4IHY A;  2V7T A;  2BM7 A;  1DGW Y;  1QZZ A;  3F6O A;  4ACB A;  2R3S A;  1KQ9 A;  2ZIT A;  1ON2 A;  2ESH A;  3AGQ A;  1WSU A;  1GXP A;  1JUM A;  1YX3 A;  1ETQ A;  2OUM A;  1ZRD A;  4RD3 A;  4UZU A;  1G3S A;  2DOE A;  3A03 A;  1YRN B;  3K6G A;  2X3U A;  5H6R A;  1KMH A;  2ZL7 A;  2ELK A;  2YR2 A;  4UXN A;  1GHC A;  4I0A A;  1YJN I;  1J7K A;  2MD0 A;  3JCU C;  3J81 k;  3PSF A;  2QGU A;  4I2O A;  2Z6B D;  1I3A A;  3N90 A;  1IN7 A;  1WPK A;  4RGS A;  3MKZ A;  1J75 A;  3LO8 A;  2P5V A;  4HE5 A;  2NT6 A;  2L4M A;  4ANJ A;  3VO1 A;  2EH3 A;  4IKF A;  4XNF A;  3CC4 I;  1ZG5 A;  3CD6 I;  1Y1V J;  4RDU A;  3EUH A;  1B2R A;  1N8R D;  3K4B A;  3QAH A;  1X58 A;  1VLO A;  5F0H A;  3EQL F;  4JRA C;  5EEA A;  2O8K A;  1EP3 B;  2GJP A;  2O7O A;  1HCR A;  1ZH5 A;  3RQ4 A;  3BZ6 A;  4W8T A;  1W35 A;  5D5U B;  1AIR A;  2ZKZ A;  2BN4 A;  2ZBK A;  3HGG A;  4C2U A;  2Q2E A;  4NK6 A;  2DQR A;  4NC8 A;  2BX6 A;  3TBI A;  4XIC A;  3JRD A;  3CJT B;  4KNY A;  3C2G A;  3ISX A;  4IXA A;  1SAN A;  2GAU A;  4IQJ A;  1U2R A;  5K1Y A;  3WTU C;  1HG8 A;  2QKM B;  3V8K A;  1IDY A;  1RWR A;  1IXR C;  3K1N A;  3BG6 A;  3S2D J;  5DUI A;  4Q4Z F;  2W48 A;  2VKH A;  4CUG A;  2XZO A;  4ZDL A;  2HFH A;  4G7X A;  2JPC A;  1IN4 A;  3O8H A;  3CPW B;  3I9V 2;  4I98 B;  3HB9 A;  1YFH A;  4UB6 C;  2FJ1 A;  5AIQ A;  1REP C;  2H27 A;  1N06 A;  4G6I A;  1BX0 A;  2CH0 A;  4OPO A;  1D0X A;  3MKW B;  4LB5 A;  1YW7 A;  3I54 A;  4WXD A;  2VKE A;  3ZPN A;  3QWL A;  3Q6R A;  2HOT A;  1TW2 A;  1ZGA A;  5ED4 A;  1WOO A;  4GRI A;  1I1G A;  2A5W A;  3GXO A;  3SQN A;  2RQQ A;  5IP6 A;  3F22 A;  2CK3 A;  3AVU A;  2BW3 A;  3L2R A;  4BAY A;  3FBN B;  5DV5 A;  2GK6 A;  4DZP A;  2K9Q A;  4EJT A;  1R1T A;  2XIG A;  4RGR A;  2GXB A;  2QTZ A;  2IGK A;  3AKZ A;  1CNE A;  2JSC A;  1FEX A;  2VUM J;  4XRM A;  5E18 F;  3PM1 A;  2R93 J;  3VOD A;  3ABL H;  1O8F A;  2LLK A;  2KMU A;  4HOB A;  3BH6 B;  2EJR A;  2M8G X;  4NK8 A;  1TYV A;  3AVV A;  2F1M A;  1GVD A;  3GQB A;  1UHW A;  4AC9 A;  3LQQ A;  1RQR A;  1OYW A;  4I76 A;  2XSD C;  2HKO A;  3CTA A;  4LG0 A;  3GTJ J;  1D8J A;  2MC3 A;  3CCJ I;  5FGM A;  5F4J A;  3Q3S A;  4RDK A;  3FHN A;  3WNB A;  4CCM A;  1XDU A;  1C0W A;  2F5F A;  3CMY A;  1RNL A;  2QZA A;  2VBZ A;  1A6I A;  1GVJ A;  1BN5 A;  4UUS B;  1VTN C;  2IA2 A;  2G0Y A;  3RKQ A;  4OOS A;  5L3D A;  3M07 A;  1BIA A;  3DKY A;  3AG2 H;  4CCN A;  3TL4 X;  2EFG A;  3PA2 A;  2HZT A;  3SQV A;  1VQ4 I;  2E2J J;  1RI7 A;  3H94 A;  2XAQ A;  4TMW A;  3FXU A;  2XPU A;  2BY3 A;  2XAG A;  3J81 K;  3QU6 A;  2O04 A;  5M5X J;  4HSR A;  2AHQ A;  5FKK A;  1W0K A;  1LDK B;  1ZK8 A;  2EB7 A;  3S3O A;  2HNH A;  3BR6 A;  1QFJ A;  2ELJ A;  3E1Y E;  1QPI A;  2JA2 A;  2B5O A;  1LLZ A;  2YWH A;  1VBL A;  4OJP A;  5B5E C;  2DFI A;  2R5Y B;  4P1V A;  4A3F J;  1FOK A;  2O1D A;  2L9V A;  3TO7 A;  1XCV A;  1AA7 A;  3CQZ J;  4OIR F;  4CYD A;  2R92 J;  3S1Q J;  4N4N B;  5JBQ A;  3DWL E;  4DBQ A;  4RM0 A;  1MMN A;  2FBI A;  3F9K A;  3NAU A;  4KA4 A;  2DFF A;  4XLN F;  3ASR A;  2OJE D;  2Y9Y A;  2QEX I;  3BZK A;  2KRF A;  2V1X A;  2V9K A;  1ENH A;  1DPU A;  2WSS A;  1APL C;  1VQL B;  3DPU A;  3K70 C;  4C2L A;  1UZC A;  1UB9 A;  2DA3 A;  1QHH D;  5E3O A;  4AU7 A;  3QQA A;  4B47 A;  2W7Z A;  3H1C A;  3GTP J;  1QVG B;  3SYJ A;  4HYE A;  5A8A A;  3DEE A;  3IL2 A;  2J5P A;  3SZT A;  2OTJ B;  4Y9U A;  4RS8 A;  3GCM A;  1MSF C;  4YFN F;  4XOT A;  4AIK A;  3V8J A;  3MD2 A;  2XKP A;  4QFM A;  2L9N A;  3FX3 A;  4PSX A;  4R8H A;  4FQG A;  3WHC A;  1UHS A;  4BHC A;  4CQJ A;  4FWT A;  1LFU P;  2OTL B;  1YIJ B;  1BIB A;  2BYV E;  5CQG A;  4BHB A;  2O0Y A;  2XAS A;  4RJL A;  1Z7U A;  3FXM A;  2IS2 A;  1I1S A;  1S7O A;  1YS7 A;  4FXU A;  2ICW G;  1EA3 A;  3M1E A;  1WKM A;  1O8H A;  2O17 A;  4XOP A;  1UD8 A;  2VJJ A;  1SKY B;  4W8Q A;  1X4P A;  1ZHF A;  3BC8 A;  4IEJ A;  1ZN2 A;  5F1R A;  3WTW C;  3KLN A;  3LWF A;  2CRV A;  1VQ5 B;  3HGY A;  4LD5 A;  3ZQI A;  3FPK A;  1WWX A;  4LIU A;  4DYC A;  5IOZ A;  3A8I A;  5AN9 A;  2HTJ A;  2PFB A;  3I4P A;  1ZRE A;  1LB2 A;  1J09 A;  2E71 A;  3IH2 A;  3E6M A;  2IGN A;  1H9T A;  2IGM A;  3WTX C;  2VBV A;  1QU3 A;  4KJZ A;  4MQV A;  5E6T A;  5D6F A;  5L3E A;  4B48 A;  3GTM J;  1X1C A;  1WVR A;  2VPL A;  3J80 Z;  1MBK A;  2EFQ A;  1FSE A;  5IOY A;  1U78 A;  1PUF A;  4UUV A;  2I5U A;  1UEL B;  3A0H C;  4HQE A;  2EIN H;  2M7B A;  3BP8 A;  5HDN A;  2GRE A;  3OYI A;  3Q6Q A;  4LC0 A;  4G6T B;  3HUG A;  4Y7N J;  2V9P A;  2F3L A;  4GO1 A;  5GAD J;  3VSK A;  2JUG A;  1VJS A;  1MNE A;  5CPR B;  5CJ9 A;  4F52 A;  3K4K A;  5LHH A;  3S93 A;  1N78 A;  1ERD A;  4JYK A;  1K83 J;  4PUS A;  2F2E A;  4HF1 A;  3W2H A;  1UFM A;  1TYU A;  5F0F A;  1KCD A;  1BMF A;  2H1L A;  3HRU A;  2OV7 A;  4UUT A;  2LOO A;  3MFK A;  3SFZ A;  1W9X A;  3R6K A;  4RLZ A;  1R5O A;  5HS9 A;  4M3E A;  4EM2 A;  5DYM A;  4HLY A;  2R6H A;  4K1X A;  2D9R A;  3MZY A;  4IOC F;  3G1L A;  2X51 A;  2LP0 A;  3S3M A;  2LY9 A;  1H8A C;  2NS7 A;  1WH7 A;  4EJO A;  2YWF A;  3WND A;  2QSF X;  1NTC A;  2MG4 A;  1T8I A;  3W6V A;  1JKP C;  3PIP F;  1U3E M;  1R5I D;  3ZMD A;  1D5V A;  2DFH A;  2VNI A;  2XF7 A;  4LOC A;  3UR3 C;  4X1E A;  3MVP A;  4KMU X;  3F8F A;  3A8J A;  3HG9 A;  2VJ4 A;  4C3I J;  4E7J A;  3IV5 A;  3DBH B;  3F8M A;  2OBT A;  3VYU B;  4BHP A;  3Q0V A;  5J8C A;  1FRN A;  3T53 B;  2QN6 A;  3C2H A;  1GXQ A;  1WJ5 A;  3OOC A;  3OZV A;  1T0F C;  1FMW A;  4MFE A;  4WZK A;  4P6V F;  2DET A;  2X1E A;  1TWH J;  3R0J A;  3HOY J;  1KYW A;  4HEA 2;  5C44 J;  2P6T A;  3R0A A;  2BGI A;  1T6X A;  3HKZ A;  2MW8 A;  2DT7 B;  4G7Z F;  4IHT A;  2AO9 A;  1ZM2 A;  3BZC A;  4A3D J;  3HIF A;  1FDR A;  2J8K A;  4Z4S A;  4F93 B;  2V4D A;  3FHZ A;  2P0W A;  1OGJ A;  3OSF A;  3GQ8 A;  1FYL A;  3T9G A;  1FYK A;  3LSG A;  2QSG X;  4RBO A;  1XC5 A;  4HX7 A;  2VBK A;  1WOR A;  1FND A;  3I56 B;  1OYY A;  5A89 A;  2VFM A;  3LMM A;  4FT8 A;  2R5Z B;  5C4X J;  2VQH A;  3CJR B;  2BSA A;  2DQL A;  4Z4Z A;  2QQA A;  3BWG A;  3ZSC A;  1YX5 A;  1Q1V A;  1W7P D;  1JGG A;  2F4I A;  2WV1 A;  1KYZ A;  2D3L A;  2LY1 A;  1F20 A;  3SEZ A;  2F5C A;  5FKM A;  4UB8 C;  3GZ5 A;  1R5N A;  1FBQ A;  1HDP A;  3GQ9 A;  1WFX A;  2HS5 A;  2Q0O A;  3D5R C;  4M4S A;  4YAO A;  1RU4 A;  1QUF A;  1E3H A;  1QHG A;  4Z06 A;  3UNG C;  4X8I A;  2QA4 B;  3IC7 A;  4RD2 A;  2VBE A;  4Y13 A;  1Z6T A;  2EIX A;  2C2W A;  4OPV A;  1E2X A;  1LJ9 A;  2XGJ A;  3BG7 A;  2DDB A;  3HPH A;  3EUK L;  3L2Q A;  3J80 K;  1TQP A;  4V2F A;  4RD6 A;  1O8L A;  1OFC X;  3ES9 A;  1FZP B;  1QQ1 A;  3I71 A;  4X7F A;  4FN5 A;  1GT0 C;  4A3E J;  3LJY A;  2WY8 Q;  3QPH A;  2DK8 A;  2ME0 A;  1VQP B;  1V5E A;  3EQO A;  3PSZ A;  3I55 I;  2HPM A;  1QBJ A;  3CD6 B;  1E63 A;  4HW0 A;  2EK5 A;  3KRG A;  3ZPP A;  1F1Z A;  1BR2 A;  2I10 A;  2LH9 A;  4L5J A;  4A3C J;  1NBM A;  4CSW A;  2RC6 A;  2Z3Y A;  3BH7 B;  2NSP A;  4XON A;  4IPA A;  1XTA A;  4URR A;  3KP4 A;  2DIE A;  3K2Z A;  2QF7 A;  2Z16 A;  4TMX A;  4OM9 A;  3HC7 A;  1YJN B;  5GV7 A;  4YII A;  3M3Y J;  3TO9 A;  1I6H J;  2PX9 A;  1FPQ A;  1XGO A;  1XX5 A;  1DUX C;  2VQG A;  2CV0 A;  2LD5 A;  3AST A;  1I50 J;  2KIF A;  3QOD A;  1P6R A;  2NXN B;  1IRG A;  2Q1Z B;  3CCU I;  2NVQ J;  1VHE A;  3D0S A;  5TGT A;  4NUB A;  3BJA A;  3V7C A;  4BXX J;  1T5E A;  2FD5 A;  4XR6 A;  4NHJ A;  3CCY A;  2BBY A;  1X1A A;  2UUZ A;  2HZD A;  4BE2 A;  2PMZ N;  2VE9 A;  2L5Q A;  2VQL A;  2W00 A;  1E17 A;  2CQX A;  3CP2 A;  4ZDP A;  4C2T A;  3BQJ A;  5F64 A;  4E7I A;  4HRI A;  1YJ9 B;  1GAW A;  3MMP A;  2WY7 Q;  2A6E F;  3K10 A;  2Y30 A;  1SKQ A;  3OY9 A;  1KGS A;  4LG3 A;  2CG4 A;  4LGW A;  4M9Z A;  5K5O A;  1BC7 C;  1E64 A;  3K4L A;  2KLO A;  4P12 A;  1CF7 A;  3S32 A;  1U2W A;  3I59 B;  3HRS A;  3O2P E;  3L2V A;  3J7A O;  3W2G A;  4MO7 A;  1R5H A;  4XQF A;  5FO5 A;  1ULY A;  4RA2 A;  4KKT A;  1TT5 B;  1TP4 A;  2WAF A;  2ID3 A;  1JTX A;  3VEP A;  4IQ4 A;  4B3X A;  4EV0 A;  1H42 A;  1Z77 A;  2DPU A;  4ENN A;  5D6E A;  1M90 D;  4CH7 A;  3MAJ A;  2BMW A;  3BY2 A;  1XCB A;  3GLL A;  2XNJ A;  3F23 A;  1ZAR A;  4F55 A;  2X0L A;  2R0Q C;  1IJW C;  4KIC A;  5BQT A;  4WX9 A;  5E79 C;  4A0X A;  4OOV A;  3BR3 A;  2IT0 A;  1STZ A;  4RB2 C;  5DCM A;  3RQI A;  1G3W A;  4JK1 X;  1BI0 A;  4FIS A;  2EFN A;  2VC0 A;  3TQN A;  4F92 B;  1VQP I;  1UD3 A;  5FKN A;  4MEY F;  2MLK A;  2L7F P;  4PJN A;  2LDU A;  4A3K J;  4RD0 A;  4C0S A;  2ZXW H;  3TOA A;  3WTZ A;  2VON A;  1K8F A;  1G7T A;  5HKK A;  3GO5 A;  1HZE A;  1TVC A;  1YQA A;  2GZW A;  4UZF A;  3CLQ A;  2N8G A;  2XGE A;  4U9U A;  1OQY A;  3AVW A;  1EKE A;  2VB6 A;  1IRF A;  5KW9 A;  2QA4 I;  1U5T A;  1U9O A;  5K5Q A;  2DT5 A;  1VQO I;  2BXY A;  3NRV A;  3OYE A;  1FP2 A;  1O3T A;  2BM1 A;  2OZ6 A;  1HST A;  3EQN A;  2COM A;  4M72 A;  1PUE E;  4R1H A;  2Y0M A;  4KIB A;  1WHU A;  3QYF A;  3AAF A;  2BM5 A;  1HW2 A;  2C6Y A;  3CUO A;  2VFO A;  2VI6 A;  1O8K A;  3HOX J;  4P2N A;  3X2Q H;  3ONQ A;  4JBA A;  3OIP A;  2B7E A;  4JOM A;  3DLL F;  4CDG A;  4J0Q A;  2KP6 A;  4IF4 A;  4A6E A;  1O3Q A;  1SC7 A;  1T95 A;  1AHD P;  2JA8 J;  1ONV A;  2HXI A;  4BH9 A;  4D5C A;  4CZC A;  2C4T A;  2EZI A;  1QZY A;  3HZJ A;  2A69 F;  1ETV A;  1X19 A;  2OCC H;  2XGD A;  4ZDO A;  3OV8 A;  1Z67 A;  2ESN A;  2V7U A;  2DTZ A;  2OPT A;  4I02 A;  5EZH A;  3ZBT A;  1V5V A;  1BOB A;  4EJU A;  2ADU A;  1E62 A;  2OQR A;  1YIO A;  4R71 A;  4EGY A;  1HKT A;  4NBS A;  5FIU A;  3G71 B;  1A5J A;  2UV1 A;  4HA8 A;  4CYC A;  4RM3 A;  2P7V B;  1BC8 C;  5F4O A;  1BJA A;  4PC7 A;  2XUB A;  5C4J J;  2V7X A;  1FNB A;  5HDK A;  2HI3 A;  2ZXI A;  4XLF A;  1I8D A;  4RDJ A;  1XQB A;  1MMG A;  3C1D A;  4KFC A;  5FD5 A;  3RYP A;  5HS7 A;  3ZUG A;  4W8S A;  3CMA I;  1QGY A;  3GQ7 A;  2MBF A;  1FTT A;  3BY6 A;  4OOI A;  4Z4V A;  3AG4 H;  3FM5 A;  2VNH A;  1ZRF A;  1B59 A;  3NAR A;  3MZH A;  3OOP A;  2VFP A;  5D5W B;  5IT9 Z;  2QTL A;  2JUC A;  4X06 A;  4ETS A;  4YZA A;  3BT9 A;  4RB1 A;  1EJ9 A;  1WI3 A;  3GSI A;  4XLC A;  4AIJ A;  5JLX A;  4IRH A;  3JRB A;  2JA6 J;  4M0L A;  3OYB A;  2B63 J;  5IYD J;  2K9L A;  1J5Y A;  1GUU A;  1WOS A;  1BW6 A;  3CCM B;  2DMQ A;  2IVM A;  2Y48 A;  3M1C A;  3PQK A;  4M3F A;  5JFR A;  4WK8 F;  1H8E A;  1AKH B;  5EDN A;  1HOM A;  2E34 A;  2L9R A;  3P5J A;  2IS1 A;  3RZO J;  3BLY A;  2ZME B;  4P9U A;  4M3D A;  2JIZ A;  2BM6 A;  3KIO A;  1W5S A;  5GV8 A;  4MTD A;  3K9T A;  3E97 A;  1RET A;  1VFC A;  4G7W A;  5FFX A;  4TMV A;  4II2 A;  3RYR A;  2GLO A;  3TH0 A;  1KTV A;  4EM0 B;  2LRE A;  1MZB A;  4OMZ A;  4DNR B;  2DW4 A;  2DPD A;  4P26 A;  2O0V A;  3ZOB A;  5C1C A;  2EBI A;  1W5C C;  2JPB A;  2RVC A;  1HKS A;  3NB2 A;  1A6Q A;  4EJV A;  4Q48 A;  1OCZ H;  2XRO A;  1K6O A;  3PO2 J;  2R4G A;  1XSX A;  1BW5 A;  2KIM A;  2CS3 A;  2RNJ A;  3NAW A;  1RR7 A;  2WR8 A;  1QCX A;  2K9N A;  2FMY A;  1Z0X A;  3LNQ A;  3SEQ A;  1JNY A;  2WPD A;  4L18 B;  4ZH4 F;  1QG0 A;  2R7O A;  3VB2 A;  3E6B A;  1MJA A;  2VC1 A;  3CB4 A;  5ERI A;  1SVL A;  1O7L A;  3K4J A;  1I7P A;  1KK2 A;  3GZ6 A;  1JA1 A;  4YFK F;  1R22 A;  1Y0N A;  3G73 A;  4PC3 A;  3PFI A;  1G2H A;  1RZ4 A;  2VXZ A;  3IUO A;  1KQ5 A;  3CCL B;  2OBP A;  2E1M C;  3F8B A;  4AYB A;  1HW1 A;  1TSP A;  3CO6 C;  2YX7 A;  4ROX A;  1Y6I A;  2QQB A;  1D3Y A;  3R6S A;  3S15 J;  3HL2 A;  2QUF A;  3CP8 A;  2GQQ A;  4Q5S F;  3JX8 A;  5FFZ A;  2BW3 B;  3VFZ A;  1EP2 B;  2D45 A;  2MA3 A;  5J1U A;  2M87 A;  1FX0 A;  3Q0W A;  2IS4 A;  4XN3 A;  2NS8 A;  2A6T A;  3ZMS A;  3JRG A;  3CCS I;  2RC5 A;  3LSJ A;  1MBF A;  2Z1D A;  3HJE A;  2FQ4 A;  3V7R A;  4OPS A;  4IL6 C;  1B72 A;  1IDZ A;  3B90 A;  2G7H A;  4GGG A;  3CZ6 A;  1KCC A;  1P4X A;  3BR2 A;  2VFN A;  1J59 A;  2OTL I;  2NT9 A;  1Z3Y A;  4YEJ A;  5L3F A;  5FLM J;  3F21 A;  4CGZ A;  2Q6I A;  2BV6 A;  2P4W A;  4TMZ A;  3I0T A;  2CRG A;  2R7X A;  1E43 A;  1HA3 A;  4N3N A;  3Q9S A;  2V4J C;  2GIZ A;  5AON A;  4OU0 A;  2ELH A;  5J1Y A;  2F1L A;  1K28 D;  1QRB A;  5BOX A;  3IKT A;  2ZSH B;  1OJL A;  2M0M A;  3WTY C;  4OMY A;  3MEX A;  2OK8 A;  2RQP A;  5FB2 A;  2G0E A;  3H9J A;  2FML A;  1VQL I;  2QEX B;  1IGN A;  5DDG A;  2VBS A;  4Y52 J;  4LMY A;  1B4A A;  4A5N A;  5FKO A;  2HDW A;  3IAM 2;  4N0B A;  4A6D A;  4UUS A;  4IHW A;  5IT9 K;  1JKO C;  4LBV A;  2IP2 A;  1TYW A;  2ECC A;  1UST A;  3FK7 A;  4HZF A;  3CCV B;  1LPQ A;  2M7A A;  1OCC H;  4XD7 A;  1E79 A;  2XF6 A;  1F4K A;  5F6F A;  4ON0 A;  1RRJ A;  4LK1 F;  3TW7 A;  3S14 J;  4LBW A;  3S1M J;  3GF2 A;  4KMF A;  1RMG A;  1FY7 A;  5IYP A;  2KPM A;  3KP3 A;  3W6J B;  3PNY A;  3BJ6 A;  1VZ0 A;  2V9V A;  4O6J A;  2LYC A;  3H0D A;  2CGP A;  5AIP A;  4TMT A;  3KLO A;  3LVB A;  2LR8 A;  2X0K A;  1BI3 A;  1DU6 A;  4DBR A;  1VQ4 B;  4DNC A;  2QWW A;  1FNM A;  1WDT A;  4AF6 A;  5DUK A;  4NBQ A;  5FRM A;  4AVP A;  1G8X A;  5LGU A;  4KIS A;  5IP7 J;  1YTY A;  3B6C A;  2NVU B;  1BI1 A;  2FEZ A;  4XSX F;  3IRQ A;  1VI0 A;  2W7N A;  1ZG1 A;  4QUZ A;  2UZK A;  3BG5 A;  1LDD A;  3CPX A;  4U87 A;  4UNO A;  1LKX A;  3ASP A;  4HIZ A;  1UMK A;  3CCJ B;  4HST A;  3T51 B;  3ERE D;  1UD6 A;  2YSR A;  1Q9S A;  1YS6 A;  3BTJ A;  3AG1 H;  2CW7 A;  4D0P A;  1XD7 A;  2FX3 A;  2HQA A;  1ZQ3 P;  3SLD A;  2DJN A;  3J7Y J;  2HYG D;  3OYM A;  4N3G A;  5IYB J;  2RKH A;  2CSO A;  4RGX A;  3LOC A;  4PAB A;  1OGO X;  3G3Z A;  2HU9 A;  2R7U A;  4NNJ A;  2EV6 A;  1V3F A;  4HV6 A;  4M3G A;  4F7Z A;  2PIA A;  2ETH A;  4ITV A;  3CUQ C;  3RKY A;  2B9S A;  1SFX A;  3L2W A;  1IZ1 A;  2LG4 A;  2O0W A;  2ZME C;  2UVF A;  3GUD A;  3RDI A;  3H36 A;  1TUI A;  3CCE B;  2VIX A;  3ZN1 A;  1TT0 A;  1WJF A;  2E19 A;  5ICG A;  3SDG A;  2KT0 A;  3K4N A;  1P92 A;  1UD5 A;  2LBF B;  3U9G A;  4A69 C;  1WJC A;  1R00 A;  3FMQ A;  2EFW A;  1H80 A;  4A3G J;  1QA6 A;  1BOA A;  4DQK A;  5CVR A;  2F4N A;  3DKX A;  2FF4 A;  4RLQ A;  5F04 A;  2A61 A;  2H6B A;  3ML3 A;  1ZGW A;  2WTE A;  5CYV A;  1OFM A;  3QP6 A;  2JVG A;  4V19 K;  2B7C A;  3PJR A;  1X1P A;  2PJR B;  5ILV A;  3T5X A;  1RKW A;  5GAH J;  2Q6K A;  4LIV A;  2WBM A;  1IDJ A;  4ZYH A;  1PUF B;  2VBW A;  1OR7 C;  2EV5 A;  4II3 A;  4PK4 A;  1QFY A;  4DNT B;  4Z4U A;  2R7Z J;  3HXL A;  3RJP A;  3B82 A;  4YCQ A;  3P7N A;  2WYR A;  4YAF A;  1VQN B;  3HUG B;  2GOX B;  2X6Y A;  3E7L A;  1KTW A;  5CKT A;  2KIQ A;  4YIF A;  4P1W A;  4YEI A;  3E5X A;  4LFU A;  2ZZG A;  2WC2 A;  4YG2 F;  1SMY F;  4GYI A;  4MIM A;  4OWR B;  2NZM A;  4QTR A;  5F0C A;  4IHS A;  1PP8 F;  1IDK A;  5BSX A;  3CC4 B;  1K61 A;  2E2I J;  1VQ9 I;  2DA7 A;  4ESJ A;  3ZQH A;  2HDC A;  3CC2 I;  4KYW A;  1X0C A;  5TY0 A;  2FNP A;  2EWE A;  2VOP A;  1HW5 A;  3HSE A;  1QQI A;  5TRD A;  4XKB A;  1BPL A;  4TSF A;  1XE1 A;  1XG2 A;  1J9I A;  3CCR I;  2HR3 A;  5FLX Z;  3WOD F;  5FO1 A;  4KIT B;  4N9H A;  3UKG A;  3D5L A;  1SD4 A;  4DYR A;  3GZN B;  1OFL A;  1IA5 A;  4A3M J;  3LSK A;  3ZP5 A;  3ECO A;  5J47 A;  1K4T A;  1OCT C;  4CHU A;  3A3B A;  2EA4 A;  3CC2 B;  1B9N A;  3FK6 A;  3VMW A;  4XKW A;  1Y39 A;  1DGR M;  4M9S A;  1BLI A;  2X9D A;  2HKX A;  2W4S A;  4A3I J;  4H9G A;  1R71 A;  2DA1 A;  2E7W A;  4QIW N;  4Y9R A;  3VO2 A;  3NWS A;  4TN1 A;  2YUH A;  2WAE A;  3W5U A;  1ETW A;  4TKO B;  1P4W A;  4HF2 A;  4EH1 A;  4F3Q A;  2L54 A;  2IOU G;  4UVA A;  2C77 A;  1MBJ A;  5DS0 A;  1AMO A;  2ZJQ F;  3LQE A;  3U1D A;  2C4U A;  4W8R A;  3G2B A;  3PIO F;  5GTI C;  4YZ0 A;  5TIS C;  1ZUN B;  1BM9 A;  2VFQ A;  1EH8 A;  3JUR A;  2FA5 A;  2L7K A;  1MBG A;  3H09 A;  3EPZ A;  1KQ0 A;  2FX0 A;  3HHG A;  5FNZ A;  4I0B A;  2LK2 A;  2EA2 A;  3QPT A;  3NQO A;  3WWG A;  1Q82 D;  2L01 A;  1GDT A;  5HS8 A;  2V26 A;  2NST A;  1TWA J;  2BVM A;  4TV7 A;  1IN8 A;  2WZP P;  3H5N A;  5FLX K;  1QZE A;  2ZL5 A;  5FJ8 J;  4IRI A;  3MN2 A;  1T98 A;  1O57 A;  2VBU A;  2OQG A;  3DKW A;  5HXB A;  3JAM Z;  3SEJ A;  3EET A;  3FKS A;  5LGN A;  4LLG F;  1TWF J;  2XGX A;  5D5X B;  3KE2 A;  2LF7 A;  2FQ3 A;  1PP7 U;  2K3P A;  2A07 F;  3QYE A;  3CCE I;  1WGX A;  2V6E A;  1WQ2 A;  3VYR B;  2E1M B;  1VQM I;  2CV2 A;  1FNC A;  3FJO A;  3QFC A;  2HOA A;  2CQN A;  2P8T A;  3FXR A;  3E5Q A;  4GFB A;  4CZZ A;  3P9K A;  3KP7 A;  3RPU D;  3QFS A;  1Y56 A;  1K7A A;  4FE4 A;  3LMW A;  2DT6 A;  3AL0 C;  4M71 A;  2ZC2 A;  2L7M P;  3A8K A;  5EGO A;  3OMY A;  2CYY A;  3P9I A;  2LTP A;  2LSO A;  4OIN F;  4ZTJ A;  4EAT A;  3OJX A;  2E1O A;  4CCL A;  1WRJ A;  1NB9 A;  1ITY A;  2FU4 A;  3U1K A;  4IJA A;  2GPJ A;  3V42 A;  1WJA A;  1ZR4 A;  4HE6 A;  2XSJ C;  4AUX A;  1MJB A;  3FM3 A;  3R60 A;  2XOK A;  2OK7 A;  4RMN A;  3ESW B;  2QQ8 A;  3CCR B;  3M4O J;  1JHF A;  1JKQ C;  4YZX A;  2IW5 A;  2D2W A;  2P6S A;  4G6Q A;  3WTV C;  3BR5 A;  3CC7 I;  3E1S A;  1EXM A;  3VMF A;  2LVS A;  1DDG A;  3RCO A;  1T0F A;  3VNU A;  4BBS J;  1VQ7 I;  2PLF A;  1EE6 A;  1Y1W J;  5BSY A;  4B44 A;  3FMR A;  3K0L A;  1MW7 A;  4EJW A;  5IYC J;  4ZYD A;  4G94 A;  2F4O B;  4PJM A;  4C2M J;  1N0V C;  1JRG A;  2XVC A;  3Q38 A;  1XFO A;  1GLN A;  1MND A;  5JLW A;  1JUP A;  3A02 A;  1U8R A;  1LUJ B;  1YRN A;  2M5W A;  3F8C A;  3QPL A;  5IP9 J;  1VQN I;  3BG3 A;  4PC6 A;  4YXW A;  1Z91 A;  2LKX A;  2OBS A;  4ZJZ A;  2QY1 A;  1OKR A;  1L1I A;  3I53 A;  3LAJ A;  3WTT C;  1FP1 D;  1SFE A;  3ZMT A;  3OYN A;  2XAH A;  3SKB A;  1T6Y A;  4V2G A;  1WPC A;  2Y0S N;  2GOM A;  4Z4R A;  2LC2 A;  3L09 A;  4EGZ A;  5THX A;  4OZZ A;  2M34 A;  1DDN A;  4HBL A;  2DAO A;  4UV9 A;  1RUO A;  1EZG A;  1MBH A;  4V02 C;  2QXZ A;  1SD5 A;  3PL8 A;  2QQ9 A;  3W2E A;  4ZZD A;  3BPV A;  2ZNZ A;  1GJR A;  3GTQ J;  3BCA A;  1I39 A;  1NJI D;  2HCJ B;  2F48 A;  2Q2E B;  3QRF F;  2XT4 A;  4YC5 A;  2M45 A;  1QRC A;  4MGR A;  4A5M A;  2K5C A;  4B8X A;  4HQM A;  4E7K A;  3QU3 A;  2PG4 A;  3D26 A;  5KAF C;  3AVT A;  2ZXJ A;  2L4A A;  2CBX A;  4B3G A;  4G9Y A;  3TKY A;  1W0J A;  1KQ8 A;  5FD6 A;  1GO2 A;  3ASS A;  3ASQ A;  2E35 A;  4RAZ A;  2QE7 A;  3AG3 H;  2LKS A;  3OL3 A;  1BL0 A;  2BY1 A;  2QLZ A;  3CUQ A;  1R49 A;  2XT2 A;  3OS0 A;  4GDF A;  1OIS A;  1Y0U A;  3PQJ A;  2OC6 A;  3E5U A;  1JGS A;  3MQ0 A;  2ME6 A;  5M5W J;  1LFP A;  1FJL A;  1JI8 A;  2OBR A;  3JQQ A;  5M3F J;  4H0E A;  2JA5 J;  2HYF A;  4PGH A;  1TTT A;  2XZL A;  2L2O A;  4ZZL A;  3PA1 A;  1YJW I;  1OB2 A;  6PAX A;  1O8J A;  1KU3 A;  2X6W A;  2QZ8 A;  2BY2 A;  3DEU A;  4EQQ A;  3P27 A;  1W34 A;  3OYG A;  1YO5 C;  2WZN A;  1P2F A;  3I64 A;  2HQR A;  2ZNY A;  1QVF B;  1B8I B;  2HVQ A;  4AWX B;  1F60 A;  4HNT A;  3MWM A;  4E4H A;  4NB5 A;  1YG2 A;  3OYA A;  4FTH A;  1AIP A;  2I1L A;  2LMD A;  4EW9 A;  1M1E B;  2BHZ A;  2Z33 A;  1WSV A;  3KX2 A;  4PJL A;  2QVO A;  5AMV A;  1V0F A;  3I5U A;  4G6D A;  1L3L A;  4BQO A;  4XN0 A;  4BE1 A;  2YUS A;  3KEO A;  3CXC B;  4G12 A;  2O3F A;  3MHP A;  2KJC A;  2XTX A;  4IX7 A;  1T33 A;  2NS0 A;  4ASU A;  4L0Y B;  3FMS A;  2HXO A;  4XLA A;  3JU4 A;  1YOV B;  2CU7 A;  2JTV A;  4DQL A;  1JT0 A;  1V54 H;  3LA2 A;  3GW2 A;  1E1R A;  3DU6 A;  3S2H J;  4OIQ F;  1WCM J;  4CYC B;  2VPR A;  3PET A;  4I09 A;  1X3U A;  3DBL B;  4NDL A;  3TP3 A;  2CW0 F;  3CCV I;  3KEY A;  4I99 C;  2KJB A;  4RGU A;  2V1N A;  5IK2 A;  2XDV A;  3J81 Z;  1A35 A;  1S5L C;  4C30 A;  1BR4 A;  4MQ9 F;  2EQR A;  4BYY A;  3SZE A;  2J5O A;  1FT9 A;  1MDM B;  2R7W A;  1PVE A;  3LA3 A;  3DLA A;  2IJL A;  3H5R A;  3OSG A;  1IF1 A;  3HDD A;  1G7R A;  1N07 A;  1G3T A;  3NE5 B;  2JVH A;  2LNB A;  4MXN A;  3QSY A;  4S0H B;  4CA0 A;  1XS9 A;  3DDY A;  4M9X A;  3BRO A;  1MD0 A;  3C3W A;  4AF7 A;  2PN6 A;  5L3G A;  5C1E A;  2FBH A;  4BEH A;  2R5Y A;  1K78 B;  4CCO A;  1MNM C;  2DYS H;  3OYK A;  4A93 J;  4MYU A;  1IXC A;  2VKD A;  1SD6 A;  3M8F A;  3CMA B;  1FYM A;  2ZB9 A;  1Y0R A;  4DOZ A;  2XEX A;  1PE9 A;  1OCP A;  1W7P A;  2XAF A;  2ZME A;  5EZG A;  2MSY A;  4BKX A;  3JSO A;  1KK1 A;  1FNN A;  2XND A;  3CCS B;  1QA2 A;  3VNV A;  2HMA A;  4C3H J;  1JA0 A;  2EIK H;  1JUS A;  1OPC A;  3F8N A;  4WZT A;  4MR0 A;  5LRR A;  1XPX A;  3ASO H;  1G3Y A;  2CO5 A;  1Q7Y D;  3FXO A;  5DD4 A;  4X6A J;  5TV2 A;  4ESF A;  3SJM A;  3G71 I;  4PMH A;  3P4G A;  3IH4 A;  5EF6 A;  1GAQ A;  3DF8 A;  2GA2 A;  5J8F A;  3P26 A;  2GA1 A;  2ECB A;  1BI2 A;  1UCR A;  3QYB A;  1S9H A;  1MH4 A;  2DOG A;  2OU2 A;  2NOJ B;  2AXT C;  5H5J A;  5TR9 A;  4B4C A;  2OAZ A;  1JHH A;  2AXL A;  3BC9 A;  4ZTF A;  1NK2 P;  3BNW A;  2DBB A;  3O6B B;  3BCF A;  3ZQQ A;  3CF2 A;  3E20 A;  3KP2 A;  1ZRC A;  5KSW B;  1WJB A;  2P81 A;  2X85 A;  2QMU A;  2HOS A;  1EA0 A;  1N0U A;  4MFD A;  3MKL A;  3Q3A A;  2GM4 A;  2BY0 A;  3GFJ A;  4FAS D;  4IW3 B;  2TCT A;  3DTE A;  1W36 D;  1LE8 B;  2KVO A;  4MYT A;  1O8D A;  4KDP A;  3CME I;  4RAF A;  3VOE A;  1J2X A;  5IYN A;  3ONY A;  2GXG A;  4P96 A;  3KYL A;  1OR7 A;  5LEK A;  5HOD A;  2HYJ A;  4U7D A;  4LJZ F;  3KL9 A;  3ELK A;  2K4J A;  5LD2 C;  4I01 A;  2JJ1 A;  3HOS A;  1WH5 A;  2IA1 A;  2QYO A;  1MMD A;  4QPO A;  4A12 A;  1WSR A;  1T6Z A;  3WGI A;  1B72 B;  1O8E A;  5GTH C;  2K85 A;  3H92 A;  4M6Y A;  2CMP A;  3CCM I;  2JMW A;  2PE3 A;  2MD5 A;  4ZGN B;  1ZLJ A;  1X4O A;  2HDN B;  1OCR H;  3VWB A;  3QE2 A;  5JLV C;  5GAG J;  4HPQ A;  3S16 J;  4BNC A;  4Z2Y A;  3TDU C;  3ZZT A;  1QGZ A;  3B02 A;  2A05 A;  3CF5 F;  2UVE A;  3ECH A;  1ZGJ A;  1ZR2 A;  4ZCI A;  3G6E I;  2PLY A;  2D1V A;  4Y17 A;  2XHK A; 
#chains in the Genus database with same CATH homology
 1SFK A;  3FDY A;  4CCN A;  3DKY A;  2HDW A;  2VJI A;  3IAM 2;  3TL4 X;  1MAB A;  2JDI A;  3VST A;  3AFH A;  3FPP A;  3AL0 B;  3H94 A;  2L9S A;  2INU A;  2M7A A;  4XD7 A;  1I18 A;  2PEC A;  1E79 A;  1OHH A;  2XF6 A;  4HSR A;  1W0K A;  1LDK B;  1MMA A;  1FMV A;  1RMG A;  3S3O A;  2HNH A;  2KPM A;  2ELJ A;  1SAU A;  1COW A;  2R7S A;  4U4B A;  2JA2 A;  3PNY A;  1VBL A;  1VZ0 A;  4OJP A;  2LYC A;  3H0D A;  2O1D A;  4PJJ A;  2DJI A;  1AA7 A;  3DPL C;  2V7Q A;  4N4N B;  3H35 A;  4DBR A;  2W6J A;  3DWL E;  4DBQ A;  2KRH A;  5FRM A;  2ODL A;  1G8X A;  1MMN A;  4KIS A;  3F9K A;  2ZXH A;  2CV1 A;  3E0J B;  2V9K A;  2WSS A;  4C2L A;  2I8D A;  2VL8 A;  3DPU A;  2W7N A;  3K70 C;  1QHH D;  4JQF A;  2W82 A;  5HVQ C;  4AU7 A;  4U87 A;  4B47 A;  1LKX A;  4HIZ A;  3OR1 C;  2X3H A;  3GVJ A;  4Z03 A;  2DCE A;  4HST A;  3T51 B;  1UD6 A;  3DEE A;  2HVS A;  4RM2 A;  1NG7 A;  2CW7 A;  3H9G A;  2HQA A;  3H5A A;  4XOT A;  1V5F A;  3FBI B;  3MD2 A;  3OYM A;  2PMZ A;  4BAC A;  2L9N A;  3FKJ A;  1OGO X;  4PSX A;  4ZYA A;  2HU9 A;  2BSP A;  2R7V A;  3OS1 A;  5CQG A;  2XF5 A;  4NNJ A;  3ZCO A;  4XKV A;  2R7U A;  3W2W A;  1H8H A;  1GQ8 A;  3OPO A;  1O8G A;  4FXU A;  2IS2 A;  4ITV A;  1EA3 A;  1O8H A;  2O17 A;  4XOP A;  3L2W A;  2VJJ A;  2LG4 A;  4PSW A;  1SKY B;  1UD8 A;  1X4P A;  3BC8 A;  2R9V A;  3SZG A;  4DK1 A;  2O0W A;  4W8Q A;  3DPT A;  3HAG A;  4DK0 A;  3OS2 A;  2PYH A;  1UD2 A;  4LIU A;  3VSV A;  2VIX A;  4BL0 B;  1TT0 A;  1WJF A;  2BVL A;  1CZF A;  2NTP A;  4XMY A;  4P5O A;  1K6Y A;  3K4N A;  1OB0 A;  1J09 A;  2LBF B;  4CCJ A;  3OR2 C;  1UD5 A;  1H80 A;  1WJC A;  2IGN A;  2IGM A;  4PFO A;  3G05 A;  1QU3 A;  3CMM A;  4KJZ A;  4J00 A;  4XKC A;  1NRK A;  1NHC A;  4YRV A;  3DKX A;  4RLQ A;  1O88 A;  4B48 A;  1VLY A;  1X1C A;  1OLT A;  1DBG A;  1OFM A;  2VPL A;  1PJR A;  1U0J A;  4OJ5 A;  2JVG A;  2KDO A;  1LVK A;  3PJR A;  1V5G A;  2PJR B;  4Z1M A;  2WJV A;  1UEL B;  1KZL A;  5KCM A;  3OYJ A;  2M7B A;  4LIV A;  2UWM A;  1O8I A;  2WBM A;  2X1D A;  3OYI A;  3ZRG A;  1IDJ A;  1OR7 C;  4G6T B;  4II3 A;  4PK4 A;  4DNT B;  3GRH A;  1VJS A;  3HXL A;  3VSK A;  2JUG A;  3SYT A;  1MNE A;  2Z8G A;  5CPR B;  4F52 A;  1N78 A;  3K4K A;  1ERD A;  3S93 A;  3HUG B;  2GOX B;  2X6Y A;  2VLA A;  4PUS A;  1KTW A;  1P9Q C;  5CKT A;  1KCD A;  1BMF A;  4DGW B;  4P1W A;  2OV7 A;  4H4K C;  3TMO A;  4BDZ A;  1V0E A;  2LOO A;  3OWT A;  1W9X A;  2ZZG A;  1K5C A;  3I3L A;  2O04 A;  2AQE A;  3GVL A;  3OOC A;  3BH4 A;  3EUA A;  4E7L A;  2D3N A;  3ZIA A;  4OWR B;  2NZM A;  1IDK A;  3CJQ B;  1IB4 A;  2X51 A;  3S3M A;  1X0C A;  5DN6 A;  2EWE A;  1D1A A;  2PYG A;  4Y3O A;  4BS9 A;  4XKB A;  1BPL A;  4TSF A;  4TT3 A;  2HVR A;  1XG2 A;  4MLO A;  5FRO A;  3PFY A;  2XF7 A;  3OYF A;  3UR3 C;  4D9J A;  2GK7 A;  4KIT B;  4DIQ A;  1WJD A;  2VQC A;  3D5L A;  3HG9 A;  2VJ4 A;  2VAS A;  4BJT A;  2RRE A;  4E7J A;  2V31 A;  4BU2 A;  3LSK A;  4GQN A;  1DBO A;  1OFL A;  3A3B A;  1IA5 A;  3VYU B;  2AQF A;  3T53 B;  3VMW A;  4XKW A;  1DGR M;  1TZL A;  1WJ5 A;  3C2H A;  3OYC A;  1BLI A;  1T0F C;  1FMW A;  2V7F A;  2W4S A;  4Y4R A;  4U49 A;  3VMV A;  3B4N A;  2X1E A;  2GJK A;  4HEA 2;  3NWS A;  2JSP A;  2WAE A;  3VYT B;  2CUJ A;  3HKZ A;  2IXS A;  4XLE A;  4TKO B;  4F3Q A;  1E3Z A;  2DT7 B;  4NQW B;  3SUC A;  3W2A A;  3M8J A;  4F93 B;  2V4D A;  3OE7 A;  4N4O B;  3OW7 A;  1BHE A;  2P0W A;  4W8R A;  2X8K A;  2KRC A;  3GQ8 A;  2ZZQ A;  3T9G A;  1ZEL A;  2WA0 A;  3G2B A;  3LSG A;  4E6K G;  4DJA A;  2VBK A;  4YZ0 A;  2FUG 2;  2LZJ A;  1WMR A;  1UG0 A;  3LMM A;  1PKV A;  1Z21 A;  2L7K A;  2VQH A;  3JUR A;  2LY2 A;  3EPZ A;  2W6I A;  3CJR B;  5FL7 A;  3ZSC A;  1YX5 A;  2K9M A;  3LFU A;  4E0F A;  4NC7 A;  3GBG A;  2F4I A;  2HLD A;  3VSU A;  3WWG A;  2D3L A;  2LY1 A;  3OYL A;  1WTH D;  4P22 A;  2NST A;  2V26 A;  3L2U A;  3SEZ A;  2QX3 A;  4JMQ A;  2BVM A;  2KL4 A;  2MC4 A;  1N75 A;  4KKS A;  3LSI A;  2IS6 A;  3GQ9 A;  1WFX A;  3H5N A;  2WZP P;  3D5R C;  3A2K A;  1RU4 A;  2LBF A;  1PLU A;  3DTK A;  1QHG A;  4Z06 A;  3UNG C;  5KNL A;  3FKS A;  2VBE A;  1JTA A;  2K3P A;  5HLT A;  3QYE A;  2W1O A;  2V6E A;  2XGJ A;  3VYR B;  3BG7 A;  2E1M B;  2CV2 A;  3OIQ A;  3HPH A;  3EUK L;  1Z3X A;  3L2Q A;  1D0Y A;  3PNV A;  1X1B A;  3RPU D;  1O8L A;  1Y56 A;  3LMW A;  2X53 S;  2DT6 A;  3AL0 C;  4L8J A;  2XAU A;  4PFP A;  2WY8 Q;  4KKU A;  1D0Z A;  4HNU A;  4XLH A;  2E5Z A;  3CES A;  4AVZ A;  1WP6 A;  3OMY A;  3ZGK A;  1V5E A;  2WB1 A;  4ZTJ A;  2BOL A;  2HPM A;  3EQO A;  2MFZ A;  4EAT A;  1BN8 A;  4ZC3 A;  3ZPP A;  3KRG A;  4BXF A;  4CCL A;  2WJY A;  1BR2 A;  2LH9 A;  3LNN A;  3GQA A;  1NBM A;  4CSW A;  2WAD A;  3LL7 A;  3V42 A;  1WJA A;  2NSP A;  2XSJ C;  5KHD A;  4XON A;  1VF7 A;  1EFR A;  1HVX A;  4URR A;  2DIE A;  2XOK A;  5HNF A;  2Z16 A;  4RMN A;  2F5V A;  3HC7 A;  2M4G A;  4YZX A;  2KZV A;  4BQN A;  2XZP A;  3E1S A;  5JHF A;  2VQG A;  2CV0 A;  2CFO A;  1D1C A;  3RCO A;  3QOD A;  1EE6 A;  1OOC A;  2Q1Z B;  3UW0 A;  1PYV A;  2LRD A;  5TGT A;  1D1B A;  4NUB A;  4B44 A;  1MW7 A;  1T5E A;  4PJM A;  4XR6 A;  1JRG A;  2HPI A;  1X1A A;  1UD4 A;  2INV A;  2UUZ A;  2HZD A;  4BE2 A;  3D5S C;  3DU5 A;  1GLN A;  1MND A;  2L5Q A;  2VQL A;  2W00 A;  2Z2S B;  3CP2 A;  3ZXS A;  4ZDP A;  4C9Y A;  4C2T A;  2JJ2 A;  2NTB A;  3EUH C;  4E7I A;  4OJO A;  4HRI A;  2WY7 Q;  2XC7 A;  4YXW A;  2QY1 A;  3K10 A;  4ZJZ A;  2DOA A;  2F6C A;  3W3C A;  2O5R A;  3OY9 A;  4E7H A;  4OZY A;  4LG3 A;  3VYS B;  3OYN A;  3FY3 A;  4X0G A;  3K4L A;  2ZZE A;  1WPC A;  1R6R A;  3ZR8 X;  2KLO A;  4OAY A;  4I84 A;  3S32 A;  2GOM A;  3L2V A;  2LC2 A;  2F43 A;  4XQF A;  4OZZ A;  3K4M A;  2ZSI B;  4KKT A;  3VDX A;  2WAF A;  4B3X A;  2QXZ A;  4IQ4 A;  3IAS 2;  3PL8 A;  4Y33 A;  2CW8 A;  3VSL A;  2R7Q A;  4CH7 A;  1O8M A;  3OOU A;  3N05 A;  3GVK A;  1QJV A;  3H9Q A;  4F55 A;  3OL4 A;  3BCA A;  4IZZ A;  4FET A;  4XM3 A;  2Q2E B;  3A1Y A;  2ZZF A;  4LIT A;  2VBM A;  3KEW A;  2K5C A;  4E7K A;  2KHM A;  1PXZ A;  4B3G A;  1E1Q A;  4F92 B;  3DTI A;  4J01 A;  1N77 A;  1W0J A;  3OEH A;  1UD3 A;  4BE0 A;  4B43 A;  4PJN A;  2QE7 A;  2QKL B;  4CCK A;  3OL3 A;  4E7Z A;  4U7B A;  4XL9 A;  4E7S A;  4BGD A;  3OS0 A;  4BDY A;  1HZE A;  5HKK A;  3U21 A;  4Z05 A;  3S3N A;  2OC6 A;  1JI8 A;  2E1B A;  1LFP A;  2VXD A;  2DXI A;  2VB6 A;  2ZFU A;  2XZL A;  2L2O A;  3SDB A;  2IQ7 A;  5CDF A;  1O8J A;  3IP4 B;  2X6W A;  2KQR A;  3OYE A;  2R7R A;  3A35 A;  3T56 B;  3EQN A;  1X1D A;  4HWV A;  2GJR A;  3K4C A;  3B8Y A;  4D1Q A;  3NWT A;  3QYF A;  3OYG A;  3DQV C;  3PUB A;  2MYS A;  2X6X A;  1O8K A;  2HVQ A;  4B3F X;  3ONQ A;  3LSH A;  3OIP A;  4JOM A;  4E4H A;  4HNT A;  2UVF A;  2KP6 A;  2E60 A;  3OYA A;  1T95 A;  4EW9 A;  4CZC A;  3KX2 A;  4PJL A;  2IGO A;  1X19 A;  2Y0S A;  5AMV A;  1V0F A;  2NTQ A;  3OYH A;  1NG6 A;  1E0E A;  4ZDO A;  5HNH A;  3OEE A;  4BQO A;  4XN0 A;  1KON A;  4YZQ A;  5LFA A;  4BE1 A;  3OAA A;  1BOB A;  2VJ5 A;  1BR1 A;  3WQZ A;  4IX7 A;  4OAZ A;  4ASU A;  2UV1 A;  4HG2 A;  4RM3 A;  4XLA A;  3JU4 A;  4KT6 A;  2ZTG A;  1E1R A;  3DU6 A;  4YEL A;  2ZXI A;  1YE9 A;  4XLF A;  1I8D A;  3KEY A;  1MMG A;  1DGW Y;  4BJ6 C;  4R79 A;  5HOO A;  2V1N A;  5IK2 A;  2XDV A;  4W8S A;  1DP3 A;  3GQ7 A;  4C30 A;  1BR4 A;  2OUM A;  1YX3 A;  2M4K A;  4UZU A;  2R7W A;  3K6G A;  1KMH A;  4YZA A;  3RTR A;  3DLA A;  3H5R A;  3NE5 B;  4XLC A;  3J7A Y;  2MD0 A;  1W36 C;  3PSF A;  2JVH A;  2Z6B D;  3OYB A;  4CA0 A;  3OYD A;  3DDY A;  2K9L A;  2NT6 A;  3MKZ A;  3M1C A;  4ANJ A;  5C1E A;  1H8E A;  4IKF A;  4XNF A;  4BEH A;  4CCO A;  3OYK A;  2IS1 A;  3BCD A;  3BLY A;  3QOE A;  3K4B A;  2VKD A;  2JIZ A;  4BEH B;  2R7T A;  4DOZ A;  2GJP A;  4G7W A;  1PE9 A;  3MMY B;  4II2 A;  2XND A;  3VR6 A;  2LRE A;  3RQ4 A;  4DNR B;  4W8T A;  3BCB A;  1AIR A;  4BJ5 C;  4NK6 A;  2O0V A;  4C2U A;  4RLF A;  2ZTN A;  4MR0 A;  2RNG A;  4NC8 A;  3S8P A;  5C1C A;  2WAQ A;  3TBI A;  1IRX A;  2M3A A;  5FRN A;  4PMH A;  3C2G A;  2R4G A;  4OJ6 A;  4IQJ A;  4F91 B;  3A3G A;  2CS3 A;  2QKM B;  1HG8 A;  1RWR A;  1QCX A;  3BG6 A;  3QYB A;  3SEQ A;  1S9H A;  2VKH A;  5CQE A;  4CUG A;  2NOJ B;  4ZDL A;  2WPD A;  4G7X A;  2XZO A;  4OJL A;  2R7O A;  3I9V 2;  3BC9 A;  3HPG A;  4BUP A;  3K4J A;  4ZTF A;  4G6I A;  3RSN A;  3BCF A;  3ZQQ A;  2CH0 A;  3CF2 A;  3HOT A;  1D0X A;  1WJB A;  3MKW B;  2X85 A;  1DQU A;  2VXZ A;  3ZPN A;  3IUO A;  1E3X A;  2E1M C;  2M5S A;  4GRI A;  4AYB A;  2A5W A;  4FAS D;  2CK3 A;  2RQQ A;  2BW3 A;  1Y6I A;  3A4C A;  3FBN B;  3L2R A;  3DTE A;  2E5N A;  3PSI A;  1W36 D;  2GK6 A;  2KVO A;  3HL2 A;  3CP8 A;  2CUZ A;  3W2V A;  1O8D A;  3OFN A;  2BW3 B;  2IGK A;  3AKZ A;  3KYL A;  1FX0 A;  1OGM X;  2IS4 A;  4XN3 A;  2A6T A;  3K70 D;  4MXN A;  3LSM A;  2Z1D A;  5LD2 C;  3B90 A;  1O8F A;  4BQQ A;  3CZ6 A;  2KMU A;  3HOS A;  2JJ1 A;  1KCC A;  1MMD A;  4QPO A;  4NK8 A;  3MKY B;  2NT9 A;  1Z3Y A;  4YEJ A;  2F1M A;  1O8E A;  3GQB A;  2CMP A;  2PJR A;  1WJE A;  4QPQ A;  2R7X A;  1X4O A;  2X1C A;  1E43 A;  2V4J C;  3VWB A;  1Z7L A;  1UAA A;  4HPQ A;  1K28 D;  3PNT A;  3FHN A;  2ZSH B;  2MAB A;  2M0M A;  1HA8 A;  4CCM A;  2UVE A;  3H9J A;  4XOR A;  1G59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...