4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
4YEJA 4YZAA 1O8EA 3VMVA 1OFLA 2O04A 2EWEA 4XN0A 2NTPA 4EW9A 2X85A 3GQ7A 1X0CA 2VJJA 4OZYA 4XKVA 3WWGA 2QX3A 2NSTA 4YZQA 1KCDA 2X6WA 4XLEA 1BN8A 2VBEA 4XLCA 1HG8A 4I84A 1QCXA 3GQ8A 3ZSCA 5C1CA 4URRA 2QXZA 4XQFA 4XOTA 3LMWA 1O8GA 2VBMA 3GRHA 1IB4A 4MR0A 1O8LA 3B4NA 3VMWA 1OFMA 2PYHA 3FY3A 1O88A 2NTBA 3B8YA 4XKWA 1XG2A 4XORA 4OZZA 4W8QA 4YELA 2NT6A 2X6YA 1OGMX 2X3HA 1KTWA 3GQAA 2NZMA 2VJIA 1OGOX 1EE6A 2ODLA 2BSPA 1DBOA 4Z05A 1OOCA 2INVA 4OJ5A 1O8MA 3EQNA 2O1DA 1BHEA 4NK6A 2QY1A 1CZFA 4AVZA 1IDJA 2UVEA 4U49A 1O8JA 1H80A 2O0WA 1NHCA 1WMRA 1JTAA 3EQOA 3SUCA 2NSPA 1DBGA 1O8DA 4NK8A 2NT9A 4C2LA 4U4BA 1QJVA 4OJOA 4OJ6A 3JURA 4XLFA 1PLUA 2O0VA 2PYGA 3GQ9A 3VSUA 2VBKA 3UW0A 4W8RA 1O8IA 4XLHA 4PMHA 1JRGA 1AIRA 1RMGA 4Z03A 4XR6A 2NTQA 5AMVA 4MXNA 1KCCA 4XONA 2X6XA 3B90A 1O8HA 4YZXA 1O8KA 1PE9A 3ZPPA 4OJPA 4XN3A 4XLAA 1O8FA 4XMYA 3T9GA 1RWRA 2INUA 4YZ0A 4HWVA 4XM3A 1VBLA 1PXZA 5C1EA 2PECA 3VSTA 1K5CA 1IA5A 1GQ8A 2O17A 3VSVA 4XL9A 4XOPA 1RU4A 4Z06A 3KRGA 4W8SA 1IDKA 2UVFA 4XNFA 2Z8GA 4OJLA 4W8TA 2IQ7A
chains in the Genus database with same CATH superfamily
1LE8B 5IYQA 2E60A 2CC2A 1Q1VA 1QZYA 4RBOA 2Z33A 4Q7JB 5AIQA 3CLQA 4BHBA 2VFMA 2W1OA 2GJKA 4WQMA 5M3FJ 3OFNA 2X85A 4W97A 5IT3A 3PA2A 2WY8Q 2GOMA 4LJZF 1IDYA 4JK1X 1YX2A 1EH8A 2YS9A 2XZOA 4ESBA 5E1ZB 4MFEA 3BQYA 1XB2A 4CYCB 2ZB9A 3V8KA 4A12A 3BY6A 4IPAA 3PSSA 2HXOA 3S2DJ 1JHFA 2BXZA 4IHVA 5B6IA 2JSPA 4DYQA 1K83J 1DGWY 4M6VA 5E3MA 2WAQA 3GFIA 4IKFA 4WWVA 1Y0RA 1D5YA 3ES9A 1VQ6B 3VNUA 3ZSCA 3K0LA 3F8FA 3JCUC 3CJRB 2HEOA 2O03A 3CB4A 4V19K 2DDAA 5DS9A 1E0EA 1AU7A 2H6CA 2VQGA 4G7HF 2M0CA 2ZL6A 2D2WA 1VQ9I 5E8GA 3ONQA 2M1BA 2WBMA 5CPRB 2HS5A 3ABUA 1FNBA 4JX4A 2QENA 1HC8A 2OK7A 4OZZA 1KQSB 1WZ2A 5BOXA 5HZAA 2CW7A 2P6SA 3SFIA 1WHUA 4G7WA 3WGHA 1UHSA 2KISA 4EGZA 2YUHA 4ZDPA 1VQ6I 2Q2EA 2R9VA 4ESJA 1VQLI 4F92B 5LEKA 5HOOA 1DU6A 1FBQA 1HZEA 2XZLA 4BYYA 4YC5A 1EFCA 4CH7A 2EQRA 3CCRI 1YJWI 2M8GX 3HGGA 4FTHA 3U1KA 5A2QK 3JREA 4PFOA 2O7OA 3N90A 3GEZA 4CCOA 1O8JA 2ZTNA 1X4OA 2E19A 3KYLA 2BGIA 3LNQA 4GGGA 2BY2A 2QWWA 3I55B 4UZUA 2EWNA 3ZGKA 1MBHA 2ZZGA 4XSXF 3KZZA 4XLFA 3OW2B 3WU1B 1RUNA 1EFRA 4F91B 5FB2A 2Z6BD 5JBQA 1T5EA 4IZZA 3DU5A 4C2TA 3LSHA 3O8HA 5K5OA 1KTVA 3L2RA 4EM1A 1BL0A 2LY2A 5GV8A 1NJID 1EKEA 2VUMJ 3CCRB 1YJWB 1RQPA 1W7PA 1F9NA 5J3LA 2HQ5A 1MZBA 1X2MA 2K85A 2LF7A 5F04A 5IY5H 4IHTA 1HQCA 3EUHC 2C77A 3V76A 4BJ6C 3LQ6A 4JMQA 1LJ9A 3KCCA 1O8KA 1ETVA 1VQ7I 4XN3A 3GTGJ 2E1OA 1FEXA 4KISA 4E7HA 1H9GA 2HYFA 4DJAA 5KNLA 2EV5A 2DT5A 1T56A 3ZMZA 5HZBA 2UXNA 3OSGA 4AIDA 1QH0A 4R71A 1LLWA 2CG4A 3IKTA 1PXZA 5LGNA 1U8BA 3QSYA 3VYTB 2ZXIA 2FX0A 5DUKA 5B66C 1GUUA 4GCVA 1OB0A 3DBHB 4Z4YA 3E6CC 1S7OA 1R23A 2E7XA 3LL7A 1ZARA 2NVQJ 1CNEA 3SLDA 2PJRB 3KRGA 4P9FA 1QFYA 4HLYA 1R1TA 2K4JA 4IXAA 1FIPA 3RDIA 2IT0A 1Y0NA 3F9KA 2VQHA 2P6TA 2R7OA 2MH9A 3IAM2 1B1BA 2J8IA 2F4MB 1SAUA 1CNFA 3GYHX 2KPMA 4UUTA 2MG4A 3RPQA 5GAHJ 3OYMA 4EW9A 4E7KA 2IXSA 4KYWA 2FUG2 5BSYA 4X05A 5B1AH 4ESFA 2Q0OA 3K1NA 4ANJA 3JX8A 3FXOA 3LA7A 1U5TB 2RREA 2CW8A 2VQLA 3W3CA 3OYCA 2LBFB 3E1YE 1OMIA 1W36C 2EFOA 4S0HB 1ZR2A 2VNIA 5TV2A 1IV8A 3LVBA 3JRGA 3CC4B 4BKXA 3H3UA 3CC2I 2HPIA 2OCCH 3OYJA 1D1AA 3CCSI 1O8GA 2ZNYA 2O8XA 2VBMA 5FRMA 4KFCA 4AC0A 3JTHA 1OCPA 3RKYA 4YFKF 1VQMI 1T8IA 3AGPA 3E6DA 1UD2A 3WGGA 5HS9A 4A0ZA 1DPUA 2K02A 1YOVB 4BY7J 5K7HA 2BV3A 3DPLC 1Q82D 3V42A 3HPGA 3C2HA 3HHHA 4E0FA 2YX4A 4IHYA 4IJAA 4FT8A 4X6AJ 2Y0SA 2AXLA 1K28D 5E1WA 1QA3A 1ZKGA 3A1PA 3ASSA 4YALA 4GO1A 2MC3A 4KUMA 1UD4A 4F7ZA 1ZGWA 1JGGA 4L9VA 3C7JA 5DCFA 2GK6A 3HYIA 5HDNA 2QKLB 5KAIC 1KRHA 2OV7A 2RKHA 3G1MA 1LVKA 5EG0B 4M1KA 4IQ4A 2HLDA 2B7EA 3CMEI 1WJ5A 4NC6A 3NAUA 2QF7A 2BM6A 1F36A 3F6VA 4GYIA 1U9OA 1V5GA 1WJAA 2O0WA 4YRVA 1KD1D 1KJZA 1JTAA 4EV0A 3FISA 1IN8A 3ZQQA 2R7VA 2L0KA 1F4KA 1WGXA 1HLVA 5HXBA 3CO7C 2X8KA 1VQ9B 1K78B 1B23P 3ASRA 4OJOA 3M4OJ 1VQLB 2WAEA 2VBKA 2VBZA 2H8RA 1QG0A 4IO9F 1NH3A 1AMOA 1R22A 1ZG1A 1VQPB 3QU6A 3PUBA 3T53B 1X1CA 3W5UA 2KRCA 1IG7A 5TRDA 1EH6A 2J5PA 1S7AA 3EUKL 3RKQA 3KYDB 2Y9ZA 1N06A 2ZL5A 1KK3A 1V54H 1X1AA 1TW2A 4LOCA 4D9JA 5C4JJ 1EFTA 2CGPA 3CD6I 3ONUA 3I59A 2EIKH 4BQQA 1FT9A 2OQGA 1ZYRF 4RB0A 3I55I 3TW7A 1FSHA 5LBQA 5CQEA 3OS0A 3ZCOA 2ADUA 5DYMA 3DKXA 3EYIA 4DQKA 2OTLB 4XKBA 2ZTGA 1WOOA 5JVGF 1TT5B 3VNVA 1FY7A 3CCUB 2EV6A 5HLHA 3BZCA 4E70A 4Z4RA 2IGOA 3BR6A 1N75A 1D8KA 2B7CA 2DODA 2IP2A 2IVMA 1O3SA 2PE3A 5TY0A 2W85A 1VQOB 3PO3J 3W6VA 1R58A 4DBRA 4J19A 3D5RC 3PENA 2WR8A 1WQ2A 2FBIA 2OBSA 3WHBA 3BOQA 4PUSA 1K6OA 3FM3A 2M5SA 1TT0A 2J5OA 3WE2A 2R7XA 1YJNB 2WV0A 3B6CA 4RM3A 2KRFA 2NSTA 5KVRA 2HOTA 4QFMA 3KEWA 2HDWA 1W9XA 1RKWA 4BJ5C 4X0GA 3A01B 5KHDA 1IC8A 3GZ5A 2H27A 1QVFB 2VNJA 1FIAA 4Y17A 3MCAA 3J7ZI 4DQLA 2GLOA 2RC5A 2C78A 2A61A 1YIJI 2KIUA 3CQZJ 4UB8C 3FXKA 4CDGA 5GADJ 3GMEA 2W4SA 4Y7CA 3SY2A 4M9SA 4FISA 1XMAA 5FLXK 2WZNA 2VOOA 3ASPA 2G7UA 4ROXA 2EFPA 1OFMA 1LFUP 1ON1A 1E3PA 3T1BA 1O88A 3WNCA 2BPOA 2X9DA 3HSEA 2XVCA 4EATA 3MWMA 3ZR8X 2XAGA 4WXCA 1Y8QB 1R5BA 1OGMX 3GLXA 4LLGF 5GP9A 1Z0XA 1GJRA 4HPQA 2LFBA 1LPQA 3AVUA 4KNYA 1KGSA 5J3OA 3N05A 3ZMTA 3SEZA 1TWFJ 4A3FJ 1VQ5B 3CPWB 2LKPA 2YUSA 3HHGA 2QBYA 3G05A 2W24A 3DTKA 4C3JJ 1JJ8C 2OD5A 2NS7A 4Z6YA 4A3EJ 1BR4A 3WQZA 4DGWB 4BQAA 4NK6A 2CQKA 3U6BA 3TO6A 4R79A 4U7DA 2LOOA 1X1PA 4ZH4F 4G1BA 3HRMA 2DPUA 1FX7A 4DZPA 4X7DA 1KU2A 1H85A 1ITYA 2V7FA 3VO2A 2LZJA 3P9IA 4BNCA 4U4BA 3HXLA 2YPRA 4OAYA 1VQ8I 1S7EA 2XPUA 4YG2F 3ZN0A 4YAOA 3WTWC 3I58A 4GYGA 2ZBVA 1HDDC 2XC7A 2BV6A 1H8EA 4BHCA 3FMRA 4NQWB 5E3OA 4KA4A 3MZYA 1FBUA 3OYHA 1TC3C 4OAZA 2FA5A 1TSPA 3Q39A 1QO0D 1Z21A 4NQWA 5GAEJ 2G9WA 4DK0A 1R1VA 3Q3AA 2XUBA 6PAXA 4OOSA 4CA0A 2D3NA 1E1RA 4QIWN 5L3DA 2H94A 2Y69H 3BWGA 3DTIA 3K7AJ 1ZRFA 4EM2A 2JMWA 1FSEA 4HF0A 4P5OA 3W6JB 1FP1D 1ZR4A 4X7FA 3GFMA 5HLIA 2VB6A 1U5TC 3R61A 1U2WA 5FFZA 3DKWA 2E1RA 1VQKB 3K70D 5GV7A 3MKYB 1KQ8A 2I10A 2MYSA 1UG2A 3QYEA 1K8AD 3KEYA 1KK0A 3K2ZA 1EH7A 4RGSA 4FASD 3VSTA 1H8HA 1Z05A 2JQ7A 1BR2A 1IA5A 2QQAA 2O17A 4P9SA 2QYUA 1ULYA 3HC7A 2K7LA 3CC2B 1P7IA 4ZZDA 1Y0UA 1XN7A 4D0PA 1U8RA 3FPPA 1ETOA 1BLIA 2EIJH 1U0JA 2N8GA 2PG4A 4RGRA 3WYAA 3BLYA 5FKOA 2VFQA 1AKHB 2IW5A 1S8NA 2Z99A 3CC4I 3J7AY 5E3NA 1ZELA 1BA5A 2JVGA 5L3EA 2VJJA 4HDVA 1T6YA 1G3YA 1VF7A 5A88A 2QA4B 3PETA 1Q81D 1FLIA 1D2EA 2L3DA 4A5MA 2OK8A 3OZUA 2V5IA 2ZSIB 4MYTA 1VQKI 4QUZA 1Z77A 1YLOA 2X4HA 3WG9A 2JA2A 5D5XB 2RC4A 2XTWA 1G6NA 3HEFA 3FXUA 3CMEB 4FCYA 3ZBUA 2BW3A 5JLWA 3EQLF 1Z6RA 4DNCA 3BCAA 3PQKA 2GIZA 2VIXA 4B8XA 4Q5SF 4B4CA 1IB4A 4DNTB 4ZCLA 1A8PA 2XTYA 1TYUA 3K10A 3CCLI 4IVNA 2EZIA 3KX2A 3IV5A 5LEJA 1D3YA 2R5ZB 1XG2A 2BX6A 3VOEA 2RNJA 2VBXA 4R8HA 3I56I 1D0ZA 4B3AA 3OOUA 2ZFWA 1T6SA 3IC7A 4FQGA 4HSTA 4LITA 1E79A 4KITB 2K27A 2ODLA 3QYFA 2DOFA 2LY9A 3UR3C 1DP3A 4TMXA 1V4RA 2HNHA 4QPQA 1JJ6C 1APLC 1BQEA 5K5RA 1G7RA 1FNCA 2A69F 5KSWB 4PC2A 5AONA 2EFGA 3NB2A 2ZO4A 1IDJA 2WAFA 1AWCA 4EJWA 4CSWA 3HTSB 3TDUC 3WBKA 4ZGNB 3CD6B 1BBYA 3JAMK 5EEAA 2BVNA 3GIRA 2H1KA 3F8MA 2GA1A 3I9V2 4HOBA 2NT9A 5J8FA 2DFHA 2I8DA 4XK4A 4C2LA 2BHYA 3CESA 4NB5A 4IHXA 2K3PA 3ZUGA 3J7AO 2JUGA 2RVCA 2RN7A 4Z2YA 5IT9K 4IRIA 2DOGA 3DEUA 1LFPA 2VC0A 1O8IA 3GQBA 2KHMA 1N07A 3E97A 1LEBA 1R5OA 3ECOA 4XR6A 2CK3A 1FWZA 4B43A 4PGGA 4WZTA 2KMUA 1J0RA 4CZCA 1JE8A 4O3MA 1W36D 1YYVA 4BXFA 3L1PA 3S1NJ 5IYNA 3M7GA 3H5NA 5J47A 3S93A 1OFCX 1GAQA 2CH0A 2FNPA 2A68F 2PBIA 2R4GA 2JK3A 4DK1A 3A8JA 2JWTA 1J09A 5DM7F 4IOAF 2INUA 3IL2A 4YZ0A 2CNDA 4FX0A 1YG2A 3BR3A 1HOMA 4U9UA 3K4MA 4A3MJ 3BC9A 1K5CA 1NBMA 5ICEA 4B3GA 2PMHA 2O5RA 1XG1A 3TO9A 1GVDA 4NUBA 3AG2H 3U1DA 1YTYA 3HOZJ 3ZBTA 2ISZA 3ZQ7A 4XNFA 4BQNA 1S6LA 2WC2A 3G3ZA 4TMVA 1O57A 1P4AA 4H4KC 2P81A 1WSVA 4AVPA 4QSHA 2CQQA 1RIOH 1IN7A 2V4JC 4P26A 3W2AA 1S29A 3EYYA 4XN0A 3HOWJ 1P6RA 3BG9A 4RGUA 3C3WA 3NARA 3P7NA 2FVGA 1PYVA 1V5FA 2F5CA 3WTXC 4A3JJ 1X0CA 2Q8KA 1WCMJ 2R92J 1JGSA 2M4KA 4CICA 3Q5FA 1K4SA 1XCVA 1B8IB 2OTJI 3PSZA 2CQ7A 3S1MJ 2Y48A 4FE4A 3ZC3A 4Z4SA 2VPLA 1MDMB 1QGAA 3G2BA 2HCJB 1MJAA 3OW7A 5A8AA 1QHGA 2QQ8A 3IKVA 2MLKA 4M3BA 2VKHA 4OIPF 3NWSA 2VFOA 4I84A 1P4XA 3OV8A 3AKZA 1RRJA 4X7EA 2EFNA 1PP8F 2DTZA 2FJ1A 3SDGA 2W00A 3BROA 2VONA 2L9NA 2L54A 5C3EJ 2B9SA 4EJUA 4L9JA 3ZPLA 1X2NA 1MMSA 2FEZA 4RAFA 3SHFA 3L00A 4ZYEA 1WOSA 1RI7A 1E3HA 4XORA 3CUQA 2VNHA 4HLXA 5EEGA 2OZUA 4E6KG 5JI6A 2X3UA 2CV0A 3OE7A 1VQ7B 4HX7A 2GK7A 3O3KA 3P5JA 3OMYA 2MLGA 4CQJA 2YU9J 3CDIA 3GTMJ 3BH7B 3RYPA 4M9ZA 1I1GA 4YFXF 1VQ8B 1YI2I 5B1BH 3MMYB 3WTZA 1VQPI 4BACA 3LSKA 5JHUA 2LNBA 3VDXA 5IYCJ 3ZP5A 4OMZA 4IOCF 4GXOA 1MBEA 3KP2A 5IP6A 4KKSA 4AYBN 2XGJA 4BDYA 1EXMA 1OKRA 1CF7A 4P25A 1PP7U 4U49A 3CTAA 3TP0A 3A02A 4BE2A 4RB3C 1GV2A 1S4MA 3CPXA 2CRGA 2O61A 4I0BA 1SM4A 4A93J 4KT5C 2VE8A 3OP1A 4P1VA 2HVRA 3DQVC 2ZJRF 3BR2A 1SVOA 4DZJA 4BEHA 1FNMA 2DMPA 2PYGA 3L7WA 5DCMA 4AIHA 3GLLA 1S9HA 1QHHD 2XAQA 1VI0A 4XLHA 4OPOA 2DA2A 3GVJA 4L18B 1E2XA 4Z03A 4I02A 5L3FA 2DPDA 1LDKB 3A0HC 2HZTA 4A3DJ 1GHCA 4XONA 4QTRA 5HLGA 4ZDOA 3CZ6A 2L7ZA 3C2BA 5ILSA 4WWCA 3I3LA 1YW8A 1UZCA 1R5ID 4MEYF 1ELOA 1EZGA 4L9NA 1IN5A 3HRUA 1I8DA 2JJ2A 4OJPA 4RAYA 3WGIA 1BR1A 1FBSA 1Z9CA 1BC7C 2F3LA 2GIVA 2L9RA 1E64A 4PC7A 4PZJA 4TMWA 2XROA 4IL6C 3A35A 2V1DA 1PUFA 2K9MA 3Q3SA 3QPLA 1K4TA 2WZPP 4YAUA 2L5QA 4HA8A 1M1KD 2BM4A 2PMUA 2VI6A 3MCZA 2FRHA 3FX3A 2ESHA 4U88A 2VBYA 5FKLA 5JLXA 1QQ1A 1F60A 1X3WB 2V9KA 3RKXA 2V7UA 3QPHA 2L2OA 1LQ1A 3CMMA 2PFBA 2RQQA 2DFEA 3NQOA 2VT3A 2L9SA 3DCFA 2PJRA 4HRIA 3JQQA 5IYPA 2FF4A 1MRZA 4PC1A 3FXJA 3COAC 4IRGA 4II3A 3MKZA 2E2IJ 2W6IA 3OYEA 1VHEA 2K40A 3DP7A 3FPKA 1T0FC 1V0FA 3GFLA 2ZBKA 1D0XA 4KIBA 3GQ7A 4JP0A 2E5NA 5D4RA 1VF9A 1BJKA 4M3EA 2M30A 4UNOA 1BIBA 4N9HA 4RD6A 4NBQA 3BH6B 3KIOA 1UMQA 1WJDA 5EZGA 2B0LA 4HE6A 4KKUA 2X6WA 3H9GA 2F2EA 1X1DA 1TYVA 3A8KA 2OA4A 4A69C 5F08A 1SAXA 1J75A 1JUMA 4RDKA 1E43A 1FOKA 3ABTA 3FMQA 4A3BJ 2DA4A 1OCOH 3LSPA 4M0LA 4A0XA 4EH1A 1A6IA 4MR0A 4BE1A 1LDDA 5H6QA 2QM3A 3QOPA 5E6TA 4MNUA 3UNGC 2UXXA 2ZJ2A 3ASOH 2XT4A 4TSFA 4B47A 2VKDA 2GQFA 2DJIA 2F4OB 4MFDA 5DM6F 1G2HA 4MYUA 4Z1MA 4YIIA 1VQOI 3GSIA 2NOJB 5J1RA 1WU8A 4I01A 1KYWA 1OGOX 4RAGA 3CW2A 4BDZA 1EE6A 1KU3A 2XGXA 1DBOA 4Z05A 3LQRA 5TR9A 1IRXA 1BW5A 4M3DA 5E20A 2STTA 2M0MA 4PK4A 2XF6A 1FNNA 1Z3YA 3CDLA 2NNYA 1CZFA 2EB7A 3FZVA 2ZJPF 2UVEA 1WMRA 2GPJA 4NHJA 5E1XA 2ZZFA 5L3CA 2L01A 4ZCMA 5FA6A 2CFOA 3GBGA 5TISC 5EZHA 3FHZA 3T56B 2EPFA 3GQ9A 3FKJA 2WB1N 1IAWA 3HM5A 3KZIC 4NC8A 2HVSA 5IP9J 4UUVA 2QZ8A 4DYRA 2AQEA 1M1EB 2FMLA 1J9ZA 3K6GA 1BI3A 2VE9A 1AA7A 1E3OC 3T8TA 1DG1G 4J0QA 4PMHA 2LC2A 4N4NB 1IXCA 4WXDA 2KFDA 3VYSB 1MKMA 2B0RA 5B3SH 4X07A 4Y9RA 1YX5A 1OJLA 1EJ9A 4AUXA 1V5EA 1YX3A 3AG1H 1XD7A 1W0JA 1G3WA 2LK2A 2F4IA 2DLLA 2PQ8A 3DEWA 2V79A 2X1EA 3TO7A 4IHWA 3QP5A 2M45A 3B82A 2CUEA 2ETHA 3BJAA 3NRVA 1K61A 1D0YA 4OOVA 3GXOA 4UUSB 5EEHA 3CF2A 1O7LA 3TOBA 4F7DA 3KETA 2YU3A 2CW0F 4RDUA 2V9VA 2ME6A 1FTZA 1P92A 1KK2A 4UUSA 1W5TA 2XHKA 2Y31A 5A2QZ 2Z5UA 3LO8A 2KZVA 2XRLA 1ZTRA 3ZQFA 3CCQB 5FKKA 2OTJB 2Y75A 3J81k 1X19A 4J01A 3JRFA 1QRBA 3OL4A 1GLNA 4ON0A 2CW5A 4PCQA 1MH3A 1IJFA 1O3QA 3CXCB 3R4KA 1R5GA 3MAJA 2XT2A 2F5DA 3SZPA 1RZ4A 2P3MA 1IZ1A 1RR8C 2G0EA 3J81K 1HVXA 1SKQA 5IYRA 4GQNA 2HGCA 2KDOA 2VC1A 3BY1A 2P0WA 1UB9A 4N3GA 1PUEE 2RGVA 3OR1C 4G7OF 1ETXA 1OR7C 1I39A 2VBWA 1YS7A 3SZGA 4NDLA 3LFUA 4XLEA 3RIRA 3OYFA 3KP5A 4BL0B 1WP6A 2OJED 5KK1A 1GO2A 1F5TA 1IRGA 1Y1VJ 3OSFA 1K4ZA 2AHQA 3LYCA 2W7ZA 2D1VA 2HU9A 1I27A 4EVIA 3JSOA 2FBHA 1A36A 2ELJA 3BQZA 4RLQA 1EP3B 3AVVA 5E3LA 2NVTJ 3A4CA 2IGNA 3CJQB 4YIRX 5K7FA 1BX1A 5FLMJ 4LC0A 1LDJA 1IHMA 2OCEA 3CP8A 3O8GA 4XBFA 4G8XA 2C2WA 3GO5A 1ZRDA 4WF2A 3H35A 3E0JB 4I0AA 5JMCB 1HSJA 3Q9SA 2F6CA 1YJ9B 4RM0A 4BPRA 2NXNB 3K69A 3T51B 3QQAA 4HV6A 1OOCA 2INVA 2G0YA 4G94A 3EQNA 2LLKA 3A3BA 4BU2A 2BVMA 3VFZA 1QUFA 1P7JA 4U87A 3MFKA 4HSRA 1N08A 3OAAA 4AYBA 2R7DA 3QYBA 2LR8A 2FQ4A 4RD4A 5HVQC 4V02C 1HSTA 5CVIA 3N4MA 2M87A 5DN6A 2O3FA 1QGZA 3H09A 1EA3A 4LB5A 1GT0C 1R7JA 2NS0A 4HIZA 1QX4A 4NBSA 1R6RA 1WI9A 1K79A 3FK7A 1X58A 3HRSA 4RLFA 3ZZ0A 5A89A 1O3RA 1R4NB 3ISXA 4CHUA 1OQYA 2R7UA 2MA3A 4LK1F 4S05A 2YWHA 2M4GA 2WTEA 2XAHA 2XKOA 5M5YJ 4W8RA 4Z4VA 1JRGA 1H88C 3IAS2 3G1OA 2VBTA 2NTQA 5KW9A 2VYQA 4OU0A 5ICCA 2VXDA 1P9QC 2EILH 2I5UA 4A2UA 2DMUA 1DUXC 3E5XA 1H89C 1JTXA 2QYOA 4C3HJ 2QTLA 4ENJA 2DIEA 1G7CA 1DDIA 3DWLE 2DK8A 5M5WJ 3S8PA 3D26A 2L7MP 2BY0A 2TDXA 2E35A 4XMYA 1MABA 3J81Z 3QE2A 2ZSHB 4LLLA 2CQXA 4CZZA 2EZLA 4IF4A 4Y3OA 4CXFA 1TLLA 1XDUA 3CUQB 4XM3A 2OUMA 1RESA 4CGZA 2IS1A 2PEXA 4ZV4A 2GJRA 1YJNI 2K3FA 1GQ8A 1OCCH 2YSRA 1REPC 3EUHA 2OAZA 1IDKA 2GM4A 3F8NA 4I99C 1R4MB 1ZLKA 1V5VA 3WTUC 2CMPA 3ESWB 3U2RA 1MNDA 4HNVA 4QVAA 3FHNA 3HL2A 5LGTA 1X1BA 4LD5A 5EDNA 2WV1A 2ZZQA 1GAWA 3VMFA 4DQ2A 2VKEA 2QLZA 3CJTB 3F3XA 2B63J 4R1HA 4A6DA 2JPBA 2KLOA 2XSJC 2Y2ZA 2QMUA 5CJ9A 3BG5A 2GXBA 3S17J 4PSWA 1ZUNB 2QBYB 1X4PA 2M8EA 2DFIA 5TJJA 2ACJA 5M5XJ 3I71A 4D1QA 1GVJA 1QPIA 4A3KJ 2HFHA 2PX9A 2HQRA 3LSGA 3K9TA 3KFWX 5LHGA 4S04A 3IRRA 1HA3A 2ZL7A 2XOKA 2JVHA 1K73D 2BM1A 1IGNA 1JNYA 1SMYF 1LE8A 4A3GJ 1B6AA 1KK1A 4OWRB 5EMNA 1YITI 3LA2A 2NTBA 4LGWA 4G7ZF 3MZ8A 2V31A 2M5WA 2BF4A 2HI3A 2R5ZA 1HF0A 5E79C 2WSSA 1QA1A 3BJOA 2LBFA 4CCNA 1R36A 1Q1HA 2DJNA 2X1CA 3HPHA 4PJ0C 3TDZC 1VQ4I 3SJMA 1K8FA 2NZMA 3V8LA 3FBNB 3M1CA 2R5YA 3KYCB 1Z7LA 2BSPA 3DLAA 5FFXA 4RJLA 1IXRC 1KMHA 1H8AC 1IF1A 2W6JA 2O1DA 2FE3A 1IRZA 2PIAA 5FO0A 2FX3A 1EP1B 5BPDA 4P3IA 4AVZA 5DNSA 3MKLA 1WJBA 3BC8A 4XRFA 3W2VA 4WK8F 4ZTFA 1XMXA 1C0WA 1UD5A 1OCTC 2HOEA 4OIRF 1Y8RB 2DW4A 2XC1A 3SXYA 3KEQA 1KC8D 1K9MD 5LHIA 3F6OA 4AWXB 2LDUA 2IGMA 1HBXG 2WYRA 5EF6A 2BOLA 4KDPA 3MQ0A 4RM2A 5J8CA 1N0VC 2WY7Q 2MC4A 3QWLA 3CCQI 1NTCA 2JA6J 4LBZA 3CC7B 3NAWA 4HNTA 2PMZN 3GWZA 1LKXA 1FRQA 5CVVA 4MXNA 4ACBA 2GBYA 2V4DA 1KZLA 2DETA 1RUOA 4UVBA 3BZKA 2XF7A 2DA6A 3ZRGA 2OBTA 3WODF 2CV1A 3VR6A 1MBFA 3ZZTA 4JQFA 2IRFG 1ORKA 1K78A 3M3YJ 2ZXWH 3GUDA 3VPRA 4BAYA 3A3GA 2IBDA 3ROUA 3R6JA 3L9FA 5FRNA 3VSLA 1RWRA 1SD7A 2ZKZA 2HDDA 1T95A 3KP4A 1NRKA 3ASNH 1XDSA 3R0JA 2QE7A 3WTYC 1JA1A 4UHTA 3TMOA 1QRCA 2VASA 3KE2A 2O8KA 4E7LA 1B2RA 1RU4A 1U78A 5F27A 2QEXI 1MJ9A 3ULQB 1NG7A 1B59A 1S0UA 4UVAA 4Y4RA 1N0UA 3PNYA 3OEHA 4GRIA 1W7PB 4NC7A 2HKXA 1FYMA 2P5VA 3RI4A 3BCFA 3LSRA 5FL7A 4I98B 1OFLA 3S3MA 3HOSA 3S16J 2YWFA 3ECHA 1I5ZA 3CCEI 4CCKA 1E63A 1ACIA 3JSPA 2HMAA 2XNDA 5CLSA 4Q48A 2NNNA 3D5SC 2H6BA 4CYDA 2LYCA 3QU3A 1SD6A 4BQOA 2VODA 1ONVA 3ABLH 4HDUA 1TTTA 4NNJA 1BN8A 2R7SA 2VKVA 2BVLA 5HS8A 1JKQC 2BEOA 2DBBA 4CO8A 5L3BA 1RPWA 1K6YA 2OBPA 1UHMA 3PM1A 4L5IA 3WE3A 2OTLI 3HDDA 1BPLA 2EFQA 3U9GA 4XOTA 1T2KA 1XQBA 1YW7A 2XIGA 1N05A 2XKPA 2V26A 2XTXA 3BCBA 1TWAJ 3REOA 3ZMUA 1WDTA 3TL4X 1FRNA 2JTVA 1HW5A 3QP6A 3I4NJ 2LG4A 3KLOA 5C4XJ 2NVYJ 1XSXA 2W82A 1RETA 3RPUA 4LIVA 1D1CA 4B3FX 1BOBA 4L5JA 3R6KA 2E5ZA 2JRTA 1U2RA 1ZLJA 2NS8A 5BS6A 3PNTA 3JQPA 2BM5A 2NPFA 4A3CJ 5F1JA 4AF7A 2XAFA 3OOPA 3OYDA 1XC5A 5FD5A 4TMTA 1Z3XA 4ZTJA 4KIGA 1OR7A 3CCYA 4HQMA 4LBYA 4PAAA 5J35A 2D45A 3HOUJ 2PLYA 1WH5A 4Z4UA 2LMDA 2B7BA 4G1VA 3FF5A 2PLFA 1IJWC 3HUGB 1SVLA 2ECBA 4MHGA 4AIKA 4YDTA 3TP3A 2X48A 3BG3A 1I7PA 2A5YB 4JX6A 4BEHB 4HG2A 4JYKA 4RB1A 3K4JA 4II2A 1QFJA 2E2JJ 5GTIC 4RPBA 3FXQA 1W87A 4UZEA 3IWZA 4N0BA 4OPSA 2MD5A 1V3FA 3FWEA 3F8CA 2FMYA 2XASA 4B1RA 5BQTA 1QZZA 3W2EA 5IT9Z 1XMKA 2R7TA 2A6EF 3DTEA 3TEDA 1IJEA 3CMAB 1PE9A 2QZAA 3LJYA 2GOXB 3HBLA 1VHOA 2BXYA 1H9TA 3TGNA 1GR1A 2VNKA 4PSXA 1EA0A 1OYIA 3F72A 3MKWB 2KIQA 1YRNB 2WADA 2Q1ZB 2ZFUA 5FROA 4HWVA 3CCJI 2X1DA 4XRMA 1GDTA 1DDGA 1MNEA 2HVQA 4DOZA 5GTHC 1FPQA 2ICWG 3TKYA 1ZH5A 2BYVE 3DU1X 3WTVC 4HX4A 3V7RA 2MSYA 4E7SA 1Q9SA 1PDNC 2IQ7A 2O6WA 3B78A 3H9JA 3Q0VA 3TW6A 3CCMB 1QPMA 1YITB 1VTNC 2ME0A 2MFZA 4PJJA 1ODDA 1IDZA 1TYWA 2XPWA 4EJVA 3JRBA 3ZQLA 2QQBA 2Z3YA 5ICGA 2B5OA 3OPOA 2V7XA 1JKRC 2D74A 1XFOA 4M6YA 3VEPA 1ZQ3P 4Y52J 1TWCJ 4KIFA 4M53A 1M90D 1UMKA 1UD3A 5F64A 3I59B 4RCZA 4YAWA 3I56B 5CQGA 4LK0F 3VB2A 3F22A 2Q2EB 3KPHA 4DW6A 1BM9A 1SFXA 2VBEA 2HTJA 2LVSA 2XZPA 1XX5A 2DMQA 4XLCA 5F1RA 5HDKA 4Y9UA 1HG8A 3ONYA 3DBRB 2VT2A 3GQ8A 2ZJQF 3OIPA 2H09A 2YWEA 3OS2A 2OC6A 5F6FA 1AKHA 1J5YA 5DS0A 2WPDA 3LSMA 3W2IA 3B4NA 2ZCWA 2CYYA 1R1UA 1QVUA 5EGOA 1WVRA 4OOIA 2PYHA 3PFIA 1MNMC 2DYIA 3CJNA 5ICFA 3M8FA 4OIOF 2AHOA 4MGRA 2GWRA 3OEEA 3HJEA 2X3HA 2JPCA 1G8XA 3O2PE 3I54A 4LB6B 4MO7A 1S5LC 2X51A 1J59A 2R7WA 5F4JA 2OQRA 3U2QA 3HGYA 1OYWA 2ZMEC 1T33A 2Q6OA 3P27A 2EA4A 1D1NA 3JRDA 3A03A 4BBRJ 3LQQA 4B4DA 1QVGB 4OP7A 2IEKA 1FJLA 1IN4A 1Y6IA 2P5LC 2E1BA 3LSIA 4EQQA 2LY1A 4HE5A 4F55A 1W5CC 4Y7NJ 2QUFA 1A35A 2D5VA 1ZM3A 4O6JA 1YIJB 2C4UA 1SANA 2M7BA 5D8LB 2I1LA 2BGCA 4NK8A 2JA8J 5J4YA 4G7XA 1JI8A 1VZ0A 1ZG3A 3S2HJ 3IP4B 4ZYGA 2BM0A 2YWGA 3KP3A 1Y0YA 2JDIA 2WAQN 2BZTA 1Y39A 2Y0SN 2XRNA 2L7FP 3E1SA 1VQ5I 2M7AA 1QNTA 3M1EA 1KQ5A 3LA3A 1E3XA 1TBXA 3F23A 5AMVA 5LRSA 2OU2A 2YR2A 2IA1A 2R0QC 2E2HJ 3V4GA 4K1XA 3V7AA 2JT1A 4IW3B 4ZZLA 4EEFG 1R5NA 2RNGA 4N9IA 1JT6A 1YS6A 3BTJA 2CS3A 2MABA 4E7ZA 5CDFA 3ZQHA 5IPAA 3L2WA 3GZ6A 2CFXA 3GTPJ 1U5TA 4G6QA 3AL0B 4UVCA 3IH4A 1G7SA 2LF8A 2UV1A 4MIMA 4HF2A 4A3LJ 2AXTC 1VBLA 2VJ5A 3BDDA 5C1EA 4RCYA 1I3QJ 1TP4A 3VYUB 2K4BA 4Z4ZA 5LMZA 1QUEA 1J2XA 1ZG5A 3DPUA 1AOYA 2QSGX 3K4CA 1FOXA 1DPRA 2IAIA 3SKBA 3HAGA 1T39A 2EZHA 2ZXHA 3E3VA 1MDMA 1G3SA 3I1FA 2GZWA 5EYRA 1XGNA 3R0AA 4HYEA 3T5XA 2K9NA 1BI2A 4FHTA 2R5YB 1JHHA 3Q38A 2UZKA 4L0ZB 3QFSA 1TNSA 4Y15A 4RD2A 1VQMB 2Z2SB 4RA2A 2VL8A 4YEJA 4QV2A 2HR3A 3VO1A 2HPMA 2V1XA 2XNJA 4D5FA 3ASTA 3CMAI 3HRTA 1SMTA 3K4LA 1QBJA 2AQFA 4BXUA 2DN0A 1YE9A 3PJRA 3H92A 4D5CA 1EP2B 5FD6A 3PVDA 4I09A 2XAJA 2NVXJ 1KA8A 5FLXZ 2ZXJA 4QPOA 3ERED 4M71A 1CQXA 1WI3A 4LBVA 3W5VA 3CCJB 2QCOA 5HNHA 3K4KA 3QFCA 3BJ6A 4RDJA 1HKQA 2DERA 2V7WA 1MMAA 3M8JA 2R7ZJ 3M07A 4QWQA 1J7KA 3CCVI 3WNDA 3I64A 1YIOA 1Z91A 2A6HF 1POGA 3EPZA 1P4MA 3RQIA 3W2WA 2M3AA 3E5UA 1W2BB 1IXSB 1PJ6A 1CF7B 2LP0A 3GF2A 3B8YA 4LMYA 4J00A 1U3EM 2DA3A 2BSAA 3BH4A 4L8JA 4E7IA 1B8IA 3S1QJ 5L46A 4X06A 2LTPA 5IOZA 3QFRA 1YO5C 1W5SA 3K4NA 3QPSA 4Z4TA 2VBSA 2K5CA 4P22A 3H94A 1BI0A 4BH9A 1I18A 5DCMB 1UELB 2W25A 2JRMA 3W6KB 4RD0A 4TKOB 3CMYA 1QU3A 3GTLJ 2UWMA 4DBQA 1I1SA 3DF8A 2F1LA 2KJCA 3SEQA 4L9TA 1Z6TA 3OKXA 3LSJA 1A6QA 2ELKA 2QY1A 5JHFA 2NVUB 4EJTA 3RCOA 3CUQC 1P4WA 3B02A 3T0YA 4QHYA 3W2GA 3SUCA 4XIDA 3RZDJ 4C0SA 3DKYA 4KJZA 4C3IJ 2DOAA 3H36A 3ZN1A 3OYIA 4ZCIA 1OISA 1Z67A 3CP2A 4HV5A 4XRSG 2BY3A 3E5QA 3MMPA 2JSCA 1OB5A 2XB0X 4OINF 1W0UA 4JX5A 4I6ZA 2IGKA 4AM3A 1EFUA 2CV2A 1FX0A 1PJ7A 1EWYA 3H3VK 5CVUA 4RAZA 1VFCA 2TCTA 2JUCA 3CCUI 1O3TA 4AC9A 1LUJB 1IW7F 1YFHA 2IA0A 4ACAA 4C30A 2OPTA 1L0OC 5FLVA 3BQJA 3BG7A 3L09A 3DDYA 4M3GA 4PGHA 1HW2A 2R93J 3CCEB 4PDKA 5EGOB 4M2LA 2ZC2A 2PJPA 3G6EI 2E71A 2BY1A 1SKYB 1YI2B 2D9RA 2XAUA 3FKIJ 2RV8A 1QGPA 1WPCA 3SEJA 2BMWA 1V0EA 4ENMA 2XEXA 4PJLA 2M34A 1FMWA 3T9GA 4V2GA 1K7AA 1KONA 1E1QA 2BE5F 4G5GA 1KZHA 5IYWA 4PJMA 2PECA 1WFXA 1BX0A 3OYLA 2H1LA 3CCSB 1XGMA 2R7QA 2K9SA 4XOPA 5FGMA 1QRYA 1KU7A 3OWTA 3DU6A 2F4NA 1HA8A 1I50J 4DNRB 2IS6A 1JB9A 3GVLA 2A07F 4LIUA 2JN6A 2DO7A 4EGYA 3ERMA 4ENNA 3OYBA 3BR0A 1FYKA 1FDRA 5C44J 3JRHA 1CGPA 1TWHJ 4OIQF 4AF6A 3HSFA 5CVRA 2KDZA 4LFUA 2X53S 3FXLA 5FIUA 4M3FA 2ELHA 4YZQA 2VXZA 1RC9A 2ZITA 2LRDA 3HUGA 1FZPB 2P7CB 2V6CA 1E62A 3OR2C 1JUPA 5BMZA 2A3SA 1MGTA 4BXXJ 1QGYA 4D7NA 2Q6KA 2L4MA 2BN4A 5CKTA 5ERIA 1UD6A 2E1MC 2PN6A 3L2QA 5THXA 3GW2A 3LMWA 3ZXSA 5TGTA 1DQUA 1FP2A 2E7WA 5FO5A 3KP6A 1NDHA 3FY3A 2NV4A 4HF1A 4UV8A 4G12A 1NHAA 4BY1J 3FBIB 3GZNB 4F52A 5JVTA 1D5VA 1RKTA 5BPIA 2ID6A 2QGUA 4FETA 4ZC3A 4UZFA 3GTKJ 9ANTA 1XSDA 3WXMA 1QZEA 1MH4A 2KQRA 2VJIA 1MMDA 1MMGA 3S14J 2GXGA 5F0FA 3BP8A 4XLPF 2VBUA 2CJJA 2HQAA 3PFYA 5LRRA 2VLAA 3KL9A 1TTYA 4KKTA 2E34A 2DOEA 3EETA 1S3JA 3LAJA 1BHEA 3PNVA 2IJLA 3CUOA 3KLNA 1FOYA 1XGOA 5ILVA 1BIAA 1ZM9A 1L1IA 2DT7B 3M9AA 1H80A 2HDNB 4C9YA 1JA0A 3FKSA 4RGXA 1QQIA 3PIPF 1NK3P 3P26A 4XD7A 4I76A 3W2FA 5D5VB 2NYXA 2GQQA 2MBFA 4OM9A 2V6EA 2KRHA 2Y9YA 2Z16A 2HYGD 1G59A 5E18F 2NOGA 3E6MA 3HKZN 5D6FA 3K1PA 1ERDA 3AVXA 1MD0A 4F3QA 1UCRA 2BHZA 1VJSA 3AVTA 2DYRH 2COMA 1D8JA 1IB0A 2QDXA 3OZVA 1R49A 1L3LA 2W84A 4U7BA 3B90A 1B72B 1QA2A 5JFRA 1DU0A 2E1MB 4KN4X 4YXWA 5J4VA 1GVHA 1LNWA 2VQCA 3OL3A 3Q6RA 1TQPA 1XPXA 3LMMA 4AU7A 3DV8A 3LWFA 2UUZA 3KZYA 1R00A 3H5AA 2DQRA 3OIQA 1GV5A 1MBKA 1UFMA 3K4BA 4G6DA 3RY8A 4FX4A 2K9QA 4KMFA 2BGJA 1ZGJA 2WJVA 3K70C 2LREA 2VN2A 1X3ZB 3TH0A 3K1MA 4E4HA 3VODA 3ZMVA 3A01A 4EMSA 1SD5A 2EBIA 4U0WA 3RYRA 4U0VA 2UVFA 1R71A 4PABA 1ZK8A 1NG6A 1SC7A 1VQNI 1DGRM 4PC6A 2C5HA 4YZAA 1B9MA 1ETKA 2A05A 5JR3A 4BUPA 3HOXJ 5B5EC 3JRCA 4UY8I 5HODA 2FBKA 1UJ8A 2O04A 3C2GA 5LD2C 1ZM2A 1MSFC 1JXSA 3H9QA 2EWEA 2NTPA 5DSZA 1TUIA 2BBYA 4LG0A 1SVMA 2X6OA 1A31A 4XKVA 5IYDJ 1LFBA 3OYKA 3WWGA 3CLOA 2LKXA 5K1YA 2DA5A 1JT0A 2QEXB 3A0BC 5F0CA 1FC3A 2LSOA 2F5VA 4FK8A 2VZLA 3IRQA 4P12A 4RB2C 3G71B 3JR9A 2XB5A 2DT6A 3I0TA 3R60A 4LG3A 4LBWA 3VSKA 1QCXA 2L7KA 3OOCA 4URRA 4BS9A 4XRSA 3SDBA 5FJ8J 1G4DA 4KH3A 1ZRCA 1FTTA 1DARA 1EV7A 2KKOA 4MTDA 2VFPA 4BE0A 2GXAA 3I4PA 2COBA 2FSWA 3GTJJ 5HKKA 1LM1A 4XKWA 4FE7A 4IHSA 4UV9A 3G73A 1PKVA 5DUIA 4A0YA 3X2QH 3U21A 1KTWA 1T38A 3GFJA 3AVYA 3NE5B 2DQLA 2R7RA 3D1NI 2PI0A 1WTHD 1BJZA 1E3ZA 2HQNA 1YW9A 2EJRA 2X0LA 3PIOF 1OGJA 3H5RA 2W48A 5H20A 4RS8A 1WKMA 3G6EB 1WSRA 3CC7I 5DD8A 2RC6A 2CF4A 4N4OB 2ZMEB 4RLZA 1ETYA 1IUYA 2ZZEA 5D5UB 3MN2A 3PSFA 1WWXA 3BTLA 4HW0A 3R6SA 3DFGA 3HZJA 4QLCU 4IX7A 3RPUD 3I5UA 4WZEA 2LKSA 2QSFX 2XGCA 3DBLB 3JRIA 1AIPA 3ABKH 3LQEA 3LNNA 1QJVA 1IUFA 4YIFA 5D5WB 1A5JA 4JOMA 4B09A 3VSUA 1KQ0A 1JJ2B 4B44A 3WBJA 5D4SA 5E8IA 1N25A 3UW0A 4OPWA 4X0CA 2DEUA 1W35A 5AN9A 1DP7P 1AIRA 2H8WA 2XPVA 3S3NA 2XDVA 3SYTA 3OYAA 2F48A 3E6BA 5K5QA 3FIWA 1ON2A 1BOAA 3Q0WA 5D8KB 4YAFA 4P6VF 5H59A 4CCLA 3PQJA 4YZXA 3RIQA 3D5LA 4X8IA 5LFAA 2CU7A 3H0DA 2CUFA 2AS5F 1P2FA 2Q6LA 3HB9A 4PJNA 4XLAA 3VWBA 5GAGJ 2A5WA 1O4XA 2JN9A 2VJ4A 5DV5A 3ASQA 2K9LA 2J7KA 3JAMZ 2HWVA 4M72A 4C43A 4A6EA 2R6HA 2M2EA 1WXRA 4HQEA 1YRNA 2CRVA 3E7LA 1O7FA 3FJOA 2V7QA 2ECCA 1IO2A 1S72B 2QN6A 3SQVA 3VSVA 1MJBA 5CYVA 4BHPA 2JA7J 1QFZA 3ZPNA 3S15J 4OJLA 3FMSA 2GAUA 2BW3B 1OPCA 4MQ9F 4C2MJ 2VOPA 2KZGA 5H6RA 3BY2A 4HZFA 4ITVA 1TVCA 3AGQA 1T08B 2P7VB 1WPKA 1HKTA 4RD1A 2XV4S 3B73A 1KQ9A 1N77A 5M3MJ 3L2UA 3H1CA 1IRFA 4I7HA 5HLTA 3WTSC 5JLVC 3HTUA 4OZYA 3M8EA 4KN7X 3TQNA 4C2UA 1GXPA 1JKOC 1KCDA 3SQNA 1JTYA 4ZYHA 3QODA 3QOEA 2E1NA 3ZMDA 1S72I 2HXIA 1OLTA 2JA5J 2MW8A 1I6XA 3RJPA 3OY9A 1CQTA 2PMDA 1VQNB 3W5HA 2HKOA 2FQ3A 5J6XA 2LD5A 1G3TA 4NCNA 1I3AA 3LFKA 1B72A 4XQFA 4CCJA 4XKCA 2EA2A 1O8LA 3C18A 5AIPA 5ED4A 4X1EA 2DCUA 3UKGA 3GVAA 4XLNF 4M9XA 1OHHA 3WNBA 2FU4A 2W7NA 1USTA 4F93B 2NT6A 3G71I 3BG6A 3GQAA 4QVJA 2KJBA 3H3ZA 3I4MJ 4PC3A 2O6GE 1T6XA 1T6ZA 3JTGA 4GDFA 1WJCA 5DEQA 2WB1A 1R5HA 2K86A 3OZWA 2P5KA 4OJ5A 5CVJA 5F0HA 3G4SI 1NB9A 1CLWA 5FO1A 3BZ6A 1H42A 3RTRA 3J80Z 3J7YJ 4P55A 3CRZA 4CCMA 1G7TA 4X7CA 3BTIA 4MLOA 2IOUG 1NHCA 1JUSA 3EQOA 1XS9A 1COWA 2D3LA 3JRAA 3ZQCA 2EK5A 4P2NA 4B3XA 3HOVJ 3F0CA 2V1NA 3FK6A 4IRHA 2V7TA 3L2CA 3HG9A 5IOYA 2XNCA 4BJTA 2TRTA 4L5EA 2KT0A 2A6TA 5L3GA 4H0EA 2HYJA 2JIZA 2E36A 3F8BA 3SZEA 2P4WA 3FXRA 1SFUA 1TL8A 2LH9A 2OZ6A 5GPAA 2EV0A 4DYCA 3MZHA 4H9GA 3DEEA 1FNDA 1YJ9I 5H5JA 4ABZA 1RMGA 1OCZH 2GREA 1ZM4A 1NK2P 1KCCA 3IH3A 1NB0A 2KVOA 3G1LA 2QKMB 5DDGA 3GVKA 3PUMA 2Z9OA 2DAOA 5FKMA 1WORA 3SJPA 3WY9A 3IH2A 1N8RD 1BMFA 1GXQA 3IWFA 2CWEA 1O8FA 4TT3A 1WRJA 2IPQX 5H2FC 1UHWA 2DU9A 4D7MA 3WTTC 5GPCA 4OPVA 3ELKA 1MBJA 1LEAA 1VNDA 1BC8C 2EZKA 2V7VA 3V7SA 4KMUX 4HAMA 3PO2J 3OJXA 3B6AA 1Z1DA 1TNTA 2W57A 4XL9A 2DFFA 3PA1A 1Z7UA 2Q6IA 3QAHA 1MSEC 1BN5A 3F21A 1YHQI 2ZMEA 5F4OA 4ZDLA 3BCDA 1T0FA 2Y30A 2DMNA 2KL4A 4M73A 2AO9A 3WU2C 1O8EA 4ZGQB 2F5FA 3HSRA 4ENKA 3U6KA 2WWYA 2JZYA 4YFOA 3ISPA 4B48A 3OYNA 2XSDC 2CSOA 3HOTA 2XGDA 5IP7J 5E17F 2QX3A 5HDGA 4WZLA 1U9NA 3ZMSA 2CBXA 3P4GA 4G6IA 1PVEA 2L9VA 4G6TB 2STWA 3HKZA 1F1ZA 1LVAA 4MQVA 5F4MA 2FXAA 5DTDA 2WA0A 3V7CA 4M4SA 4P6YA 2P8TA 2EFWA 3S2WA 2V1UA 1ZAOA 2ZNZA 5HS7A 4HX8A 3WU0A 4FN5A 5C1CA 3C1DA 1ETWA 2QXZA 4I2OA 3TBIA 2DA1A 3MEXA 3SYJA 4IQJA 3VMWA 4P9UA 2EIXA 3QRFF 1PJ5A 4JBAA 1SFOJ 1SEUA 1YHQB 1Q86D 1OCRH 3FM5A 1ZGAA 3PUFA 1IN6A 3KP7A 3ZOBA 3W2HA 4W1UA 2O9LA 4HEA2 3KEOA 1UAAA 1WJEA 1Q7YD 2VFNA 1OGIA 1BI1A 3QPTA 3VYRB 3ZQGA 3AVWA 2DA7A 2IS2A 1XGSA 3EUAA 3CCVB 1MIJA 2HOAA 4ETSA 1LB2A 3L2VA 2QSHX 1ZREA 1O8MA 1KYZA 1WJFA 3AL0C 5LHHA 5EJCA 5J40A 2CO5A 3ZQIA 1B4AA 4M74A 2DI3A 1XB4A 1Y1WJ 3P9KA 1FOWA 4Y33A 3S3OA 4MEXF 3JQRA 1RNLA 3B8HA 4G9YA 1DABA 1DBGA 4WCGA 4WZKA 3MD2A 2DK5A 2O0YA 1SFEA 1F43A 2MGQA 1VQ4B 4LG0B 5IYBJ 3ZZUA 3JURA 4EM0B 3RKWA 2O0VA 5KCMA 1N78A 1PUFB 1I6HJ 1HF2A 3WG7H 1W1WE 3RQ4A 1IV6A 2DY1A 2HOSA 3OJWA 1TLHB 4CYCA 3OS1A 4ZJZA 4DIQA 1UG0A 4XICA 3IHUA 5LLQA 3Q0UA 2CUJA 4M6XA 3JW4A 4HNUA 5D6EA 4YEIA 4AIJA 3T8RA 1ZN2A 3H9NA 3OIOA 1D8TA 2EINH 1O8HA 2YX7A 4GFBA 1JKPC 2L4AA 2C4TA 3BR5A 4FXUA 4IEJA 4RD3A 2QQ9A 1FYLA 1QVTA 1YQAA 2RQPA 3GTQJ 2QA4I 2DDBA 4FWTA 2CUZA 3K2AA 2C5BA 1RR7A 2ID3A 2FOKA 2OYNA 3A1YA 3DXJF 3N97A 3P9CA 1TW3A 1UD8A 2M9HA 2MH2A 2RDPA 2V9PA 1BW6A 2Y0MA 2DYSH 1TZLA 3PUNA 1A04A 3A2KA 1OFDA 3BPXA 4ZYAA 1D1BA 3AG3H 3GTOJ 2J8KA 1W7PD 3Q6QA 2ESNA 5IK2A 2GA2A 1KU9A 4P1WA 2BM7A 5HNFA 2PMZA 3PSIA 3BR1A 3RZOJ 3CCLB 1ETQA 2EH3A 4ASNA 1J9IA 3JU4A 2DTRA 3VMVA 3FDYA 4XSZF 3OYGA 1OYYA 3AAFA 4RMNA 4BBSJ 4CUGA 4U0YA 3HIFA 1VLYA 4RPDA 4YFNF 2R3SA 4UXNA 5FKNA 2QTZA 1WH7A 1E17A 2DCEA 2QVOA 1PJRA 2WJYA 1W4MA 3QFTA 2EIMH 1HCRA 2JJ1A 4K2EA 3DPTA 4N3NA 3LAPA 1YLFA 1U6GA 5DD4A 1OB2A 4L0YB 2ZBUA 1STZA 3G4SB 1HDPA 4PFPA 4LLNA 1XTAA 4A3IJ 4RDLA 2MD0A 5FNZA 2ISYA 2NRAC 1EF4A 1R9TJ 3AFHA 3CDHA 2X0KA 3GRHA 4JRAC 3CF5F 3NWTA 1B9NA 2IS4A 1XSVA 2XGEA 4BGDA 4OOXA 4UAJA 2KIMA 1SD4A 3ABMH 4MTEA 3GX4X 3CCMI 1RQRA 4W8QA 2R7FA 4YELA 2DMTA 1SFKA 4EJOA 2X6YA 5J1YA 2DXIA 4TMZA 3CO6C 4V2FA 1TQIA 1WOPA 2F43A 5BSXA 1MBGA 3I53A 3J80K 5J1UA 3S32A 1WSUA 1W0TA 4HBLA 3MHPA 2HDCA 3ML6A 1BJAA 4KT6A 1HKSA 2OF7A 3HOYJ 1ZHFA 3AK5A 1W34A 1V55H 3IUOA 3A8IA 3SLNA 5ILUA 1XE1A 5LGUA 4UB6C 1TYXA 2NSPA 3PL8A 1XCBA 4Z4WA 1O8DA 2CQNA 3AG4H 1Y56A 3E20A 1USSA 4P3YA 4WX9A 4TN1A 3Q9VA 3ZIAA 3MVPA 5KAFC 5K7ZA 3BPVA 3DLLF 4OJ6A 4TV7A 3D0SA 2FOWA 4YHBA 1H0MA 3SFZA 4Q47A 4Y13A 2E1CA 4ASUA 1PLUA 4E7JA 2FNAA 3O6BB 2OBRA 1FMVA 2VPRA 2G7HA 1W0KA 3S1RJ 3GCMA 3BNWA 3LOCA 4KICA 1F20A 4OMYA 2RAEA 3RSNA 2F1MA 1QA6A 2Z1DA 1MMNA 2QGGA 3TOAA 3SJZA 2X6XA 2FD5A 4A5NA 1VLOA 3ZPPA 3FXMA 1T98A 5BNGA 3NEUA 1ENHA 2F5EA 3BT9A 3LSTA 4WXHA 1OFEA 4ZYDA 3ML3A 1HXDA 2HTSA 2XF5A 4AD9A 1DDNA 4PGOA 2NAZA 4YCQA 3EDPA 1MW7A 2L02A 2C6YA 3H0GJ 1LLZA 3SZTA 4O5VA 2GJPA 3WHCA 1TQMA 2VBVA 2IA2A 3V8JA 1X3UA 2D1HA 1HW1A 3N6ZA 2HZDA 4Z06A 4P96A 4Q4ZF 4W8SA 2Z8GA 4W8TA 2KIFA 1AHDP 3BTCA 2KP6A 2JJ7A 5EG0A 1TWGJ
chains in the Genus database with same CATH topology
3PNYA 1NG6A 2E60A 3OEHA 1DGRM 4H4KC 4GRIA 4YZAA 4NC7A 4BUPA 2V4JC 3BCFA 3W2AA 5FL7A 1OFLA 3C2GA 2W1OA 5LD2C 3HOSA 4XN0A 3H9QA 3S3MA 2GJKA 2EWEA 3OFNA 2NTPA 2X85A 1PYVA 1V5FA 4CCKA 2WY8Q 1X0CA 4XKVA 2GOMA 2XNDA 3OYKA 3WWGA 2M4KA 3D5SC 2XZOA 2O04A 2LYCA 4BQOA 2VPLA 2F5VA 4NNJA 1BN8A 2R7SA 3G2BA 3OW7A 1QHGA 2JSPA 2BVLA 2VKHA 2DT6A 1DGWY 3NWSA 2WAQA 4LG3A 3VSKA 3AKZA 1K6YA 4IKFA 2L7KA 5FRNA 3OOCA 1QCXA 3ZSCA 4URRA 1BPLA 4BS9A 3SDBA 4XOTA 3CJRB 2W00A 2L9NA 2V26A 4BE0A 3BCBA 3TL4X 1E0EA 2VQGA 2LG4A 5HKKA 4XKWA 2W82A 2WBMA 3ONQA 4XORA 5CPRB 1PKVA 4OZZA 4E6KG 3OE7A 2CV0A 4LIVA 3U21A 2GK7A 1D1CA 2CW7A 4B3FX 1BOBA 1KTWA 2E5ZA 3OMYA 3NE5B 4G7WA 2R7RA 4ZDPA 3PNTA 1WTHD 1E3ZA 2R9VA 3MMYB 4F92B 5HOOA 4BACA 3H5RA 1HZEA 3LSKA 2XZLA 3VDXA 4CH7A 3OYDA 4KKSA 2XGJA 4N4OB 1Z3XA 4BDYA 4PFOA 4ZTJA 4U49A 4CCOA 1O8JA 2ZTNA 2ZZEA 1X4OA 3PSFA 3KYLA 4BE2A 4IX7A 3RPUD 4UZUA 3ZGKA 1QJVA 2HVRA 2ZZGA 3DQVC 3HUGB 3LNNA 4BEHA 4XLFA 4JOMA 2PYGA 3VSUA 4B44A 1EFRA 4BEHB 4F91B 4HG2A 2Z6BD 3K4JA 1T5EA 4II2A 1S9HA 4IZZA 1QHHD 3DU5A 3UW0A 4C2TA 3LSHA 4XLHA 3L2RA 3GVJA 1AIRA 3S3NA 4Z03A 2LY2A 4I84A 1LDKB 2XDVA 3SYTA 3OYAA 4XONA 4ZDOA 3CZ6A 3EUHC 3I3LA 4CCLA 4YZXA 4BJ6C 4JMQA 1O8KA 2R7TA 3D5LA 3DTEA 1PE9A 5LFAA 1I8DA 3H0DA 2JJ2A 4XN3A 4OJPA 1BR1A 2GOXB 4KISA 4E7HA 4PJNA 4XLAA 4DJAA 3VWBA 2A5WA 4PSXA 2VJ4A 5KNLA 2K9LA 3MKWB 3A35A 2K9MA 2WADA 2Q1ZB 2ZFUA 5FROA 2WZPP 4HWVA 2X1DA 1PXZA 2L5QA 1MNEA 2HVQA 4DOZA 3VYTB 2ZXIA 2V7QA 3VSVA 2V9KA 1OB0A 2L2OA 3LL7A 3KRGA 3CMMA 4E7SA 2RQQA 2PJRB 3ZPNA 4OJLA 2IQ7A 3H9JA 2L9SA 2BW3B 2PJRA 4HRIA 3F9KA 2VQHA 4ITVA 2R7OA 3IAM2 4II3A 3MKZA 2W6IA 2MFZA 4PJJA 3OYEA 1SAUA 1T0FC 2KPMA 1V0FA 3OYMA 1N77A 4EW9A 3OPOA 3L2UA 1D0XA 2IXSA 4E7KA 5HLTA 3GQ7A 2FUG2 4OZYA 2E5NA 4C2UA 4ANJA 1KCDA 2RREA 2CW8A 2VQLA 3W3CA 3QODA 3QOEA 5CQGA 1WJDA 2LBFB 3OYCA 1OLTA 2Q2EB 3OY9A 4KKUA 2X6WA 3H9GA 1X1DA 1W36C 2VBEA 2XZPA 4XLCA 1HG8A 3GQ8A 3OIPA 1E43A 2HPIA 3OS2A 3OYJA 1D1AA 2OC6A 4XQFA 4CCJA 4XKCA 1O8GA 2VBMA 2WPDA 3LSMA 5FRMA 4MR0A 1O8LA 3B4NA 4BE1A 1UD2A 3UNGC 2PYHA 3DPLC 3V42A 1OHHA 4TSFA 3HPGA 2VKDA 3C2HA 2DJIA 4B47A 4Z1MA 4E0FA 2W7NA 1K28D 4F93B 2NOJB 2NT6A 2Y0SA 3BG6A 3OEEA 2X3HA 1G8XA 3GQAA 2X51A 2R7WA 1UD4A 1OGOX 1EE6A 4BDZA 1WJCA 2GK6A 1DBOA 2WB1A 4Z05A 2QKLB 4OJ5A 1IRXA 2OV7A 1LVKA 4IQ4A 1Y6IA 2HLDA 3RTRA 2M0MA 2E1BA 3LSIA 1WJ5A 4PK4A 2LY1A 1Z3YA 2XF6A 4CCMA 4F55A 1CZFA 4MLOA 2UVEA 1V5GA 1WJAA 2O0WA 1NHCA 2M7BA 4YRVA 1WMRA 1JTAA 3EQOA 1COWA 4NK8A 2D3LA 2ZZFA 4G7XA 3ZQQA 1JI8A 1VZ0A 2R7VA 3IP4B 2X8KA 4B3XA 4OJOA 2CFOA 2V1NA 3GBGA 3T56B 3HG9A 2JDIA 3GQ9A 3FKJA 4BJTA 2JIZA 2WAEA 2A6TA 2VBKA 4NC8A 2HVSA 3E1SA 2LH9A 2AQEA 3K6GA 3DEEA 4PMHA 1AA7A 3PUBA 2M7AA 3T53B 2LC2A 1RMGA 1X1CA 1E3XA 2KRCA 4N4NB 5AMVA 1KCCA 3VYSB 3EUKL 2KVOA 2QKMB 1YX5A 2RNGA 3GVKA 1V5EA 1YX3A 1W0JA 1X1AA 2CS3A 2F4IA 2MABA 4E7ZA 2X1EA 1BMFA 4D9JA 5CDFA 1O8FA 4TT3A 3L2WA 4BQQA 3AL0B 1D0YA 2UV1A 3CF2A 1VBLA 2VJ5A 5C1EA 1UD3A 5CQEA 3OS0A 3VYUB 3ZCOA 3DKXA 4XKBA 2ZTGA 3DPUA 3K4CA 2KZVA 4XL9A 3HAGA 2ZXHA 1X19A 2IGOA 1N75A 4J01A 3OL4A 1GLNA 4ZDLA 2Z2SB 2VL8A 4YEJA 3BCDA 2HPMA 2KL4A 1O8EA 4DBRA 3D5RC 1HVXA 3K4LA 4PUSA 2M5SA 1TT0A 4B48A 2R7XA 2KDOA 3OYNA 4GQNA 2AQFA 3HOTA 2P0WA 4RM3A 2QX3A 2NSTA 1YE9A 3PJRA 3OR1C 1OR7C 3KEWA 2HDWA 1W9XA 4QPOA 3SZGA 4G6TB 4G6IA 4BJ5C 4X0GA 3HKZA 3LFUA 4XLEA 5KHDA 3K4KA 5HNHA 3OYFA 4BL0B 1WP6A 2WA0A 1MMAA 3M8JA 5C1CA 2QXZA 2W4SA 2HU9A 3TBIA 3EPZA 2ELJA 4RLQA 4IQJA 3VMWA 3W2WA 2M3AA 1OFMA 3A4CA 2IGNA 3CJQB 1O88A 3B8YA 4J00A 3BH4A 4EATA 4L8JA 3ZR8X 4E7IA 3CP8A 1OGMX 3H35A 4HEA2 3E0JB 1WJEA 1UAAA 3K4NA 4HPQA 2F6CA 2K5CA 3VYRB 3H94A 3N05A 4P22A 2IS2A 3SEZA 3EUAA 1I18A 1UELB 3G05A 4TKOB 3L2VA 3T51B 1OOCA 3DTKA 1QU3A 2INVA 1O8MA 1WJFA 3AL0C 2UWMA 3EQNA 4DBQA 4BU2A 3A3BA 2BVMA 3SEQA 4U87A 3OAAA 4HSRA 1BR4A 3WQZA 4DGWB 4AYBA 4NK6A 2QY1A 3QYBA 5JHFA 4R79A 2LOOA 3RCOA 4Y33A 5HVQC 3S3OA 5DN6A 3SUCA 1DBGA 1EA3A 3MD2A 2V7FA 3DKYA 4KJZA 3OYIA 2DOAA 2LZJA 4HIZA 1R6RA 4U4BA 3HXLA 4OAYA 3CP2A 4RLFA 3JURA 2O0VA 5KCMA 1N78A 2R7UA 2XC7A 1H8EA 2M4GA 4NQWB 3RQ4A 2IGKA 3OYHA 2CV2A 4OAZA 1FX0A 4W8RA 3OS1A 4ZJZA 1Z21A 1JRGA 4DIQA 4DK0A 1UG0A 3IAS2 2NTQA 4CA0A 2D3NA 1E1RA 2CUJA 4C30A 4HNUA 2VXDA 1P9QC 3BG7A 3DDYA 3DTIA 1O8HA 4P5OA 1SKYB 4FXUA 2XAUA 2DIEA 2VB6A 3DWLE 1WPCA 3S8PA 1V0EA 4PJLA 3K70D 1FMWA 2CUZA 4XMYA 3MKYB 1MABA 2MYSA 2ZSHB 3T9GA 3QYEA 4Y3OA 3A1YA 1KONA 1E1QA 3KEYA 2OUMA 4XM3A 1UD8A 2IS1A 4PJMA 4FASD 2PECA 3VSTA 1WFXA 1H8HA 1TZLA 3OYLA 1BR2A 3A2KA 2GJRA 4ZYAA 1GQ8A 2R7QA 2O17A 1IA5A 4XOPA 1D1BA 3HC7A 3OWTA 5IK2A 1IDKA 3DU6A 3FPPA 4P1WA 1HA8A 1BLIA 4DNRB 2CMPA 5HNFA 1U0JA 2IS6A 1MNDA 2PMZA 3PSIA 3FHNA 3HL2A 3GVLA 1X1BA 3BLYA 2ZZQA 4LIUA 3JU4A 3VMVA 3FDYA 3OYBA 3OYGA 3J7AY 1ZELA 2KLOA 2XSJC 4RMNA 4CUGA 2JVGA 1VLYA 2VJJA 1VF7A 2X53S 4YZQA 2DCEA 2WJYA 1PJRA 2VXZA 2ZSIB 4PSWA 2LRDA 2JJ1A 1X4PA 3DPTA 3OR2C 4D1QA 2JA2A 4PFPA 2MD0A 3LSGA 2BW3A 5CKTA 1UD6A 3BCAA 2E1MC 2JVHA 3AFHA 2XOKA 3L2QA 2VIXA 3LMWA 3ZXSA 3GRHA 1IB4A 5TGTA 3NWTA 4DNTB 1DQUA 2IS4A 3K10A 4OWRB 3KX2A 3FY3A 4BGDA 2NTBA 2V31A 1XG2A 3FBIB 4F52A 4W8QA 4YELA 1SFKA 2WSSA 1D0ZA 2X6YA 2DXIA 4FETA 2LBFA 4ZC3A 4CCNA 2X1CA 3HPHA 3OOUA 2F43A 2KQRA 2VJIA 4HSTA 4LITA 1E79A 3FBNB 2NZMA 3M1CA 1MMDA 1MMGA 4KITB 2ODLA 3QYFA 1Z7LA 3S32A 2HQAA 3PFYA 3UR3C 3DLAA 2VLAA 1DP3A 2BSPA 4KKTA 2HNHA 4QPQA 1KMHA 2W6JA 2O1DA 4KT6A 1BHEA 3PNVA 3IUOA 4AVZA 2DT7B 1IDJA 2WAFA 1H80A 4CSWA 3W2VA 1WJBA 3BC8A 4C9YA 3PL8A 4ZTFA 1UD5A 3FKSA 1O8DA 2NSPA 4XD7A 1Y56A 3I9V2 2NT9A 2I8DA 3ZIAA 4C2LA 3CESA 2K3PA 4OJ6A 1PLUA 2IGMA 2JUGA 4ASUA 2V6EA 2KRHA 2BOLA 4E7JA 2Z16A 4RM2A 2WY7Q 2MC4A 1FMVA 1G59A 1LFPA 1ERDA 1W0KA 4HNTA 1O8IA 3GQBA 2KHMA 4F3QA 1VJSA 2CK3A 4XR6A 4B43A 1LKXA 3RSNA 2KMUA 4MXNA 2F1MA 4CZCA 2Z1DA 1MMNA 1W36D 2V4DA 2X6XA 4BXFA 4U7BA 1KZLA 3B90A 3H5NA 3S93A 2XF7A 3ZPPA 2E1MB 3ZRGA 4YXWA 2CH0A 2CV1A 3VR6A 2VQCA 3OL3A 2R4GA 4JQFA 2XF5A 4DK1A 3LMMA 4AU7A 1MW7A 1J09A 2UUZA 3A3GA 1RWRA 2INUA 3H5AA 3OIQA 3VSLA 4YZ0A 3K4BA 1T95A 2WJVA 2GJPA 1NRKA 3K4MA 3K70C 2QE7A 3BC9A 1K5CA 2LREA 1NBMA 4B3GA 3TMOA 2O5RA 4NUBA 4E4HA 2HZDA 2VASA 1RU4A 4E7LA 4Z06A 4W8SA 2UVFA 4XNFA 4BQNA 2Z8GA 4W8TA 1NG7A 2KP6A 4Y4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEJ A;  4YZA A;  1O8E A;  3VMV A;  1OFL A;  2O04 A;  2EWE A;  4XN0 A;  2NTP A;  4EW9 A;  2X85 A;  3GQ7 A;  1X0C A;  2VJJ A;  4OZY A;  4XKV A;  3WWG A;  2QX3 A;  2NST A;  4YZQ A;  1KCD A;  2X6W A;  4XLE A;  1BN8 A;  2VBE A;  4XLC A;  1HG8 A;  4I84 A;  1QCX A;  3GQ8 A;  3ZSC A;  5C1C A;  4URR A;  2QXZ A;  4XQF A;  4XOT A;  3LMW A;  1O8G A;  2VBM A;  3GRH A;  1IB4 A;  4MR0 A;  1O8L A;  3B4N A;  3VMW A;  1OFM A;  2PYH A;  3FY3 A;  1O88 A;  2NTB A;  3B8Y A;  4XKW A;  1XG2 A;  4XOR A;  4OZZ A;  4W8Q A;  4YEL A;  2NT6 A;  2X6Y A;  1OGM X;  2X3H A;  1KTW A;  3GQA A;  2NZM A;  2VJI A;  1OGO X;  1EE6 A;  2ODL A;  2BSP A;  1DBO A;  4Z05 A;  1OOC A;  2INV A;  4OJ5 A;  1O8M A;  3EQN A;  2O1D A;  1BHE A;  4NK6 A;  2QY1 A;  1CZF A;  4AVZ A;  1IDJ A;  2UVE A;  4U49 A;  1O8J A;  1H80 A;  2O0W A;  1NHC A;  1WMR A;  1JTA A;  3EQO A;  3SUC A;  2NSP A;  1DBG A;  1O8D A;  4NK8 A;  2NT9 A;  4C2L A;  4U4B A;  1QJV A;  4OJO A;  4OJ6 A;  3JUR A;  4XLF A;  1PLU A;  2O0V A;  2PYG A;  3GQ9 A;  3VSU A;  2VBK A;  3UW0 A;  4W8R A;  1O8I A;  4XLH A;  4PMH A;  1JRG A;  1AIR A;  1RMG A;  4Z03 A;  4XR6 A;  2NTQ A;  5AMV A;  4MXN A;  1KCC A;  4XON A;  2X6X A;  3B90 A;  1O8H A;  4YZX A;  1O8K A;  1PE9 A;  3ZPP A;  4OJP A;  4XN3 A;  4XLA A;  1O8F A;  4XMY A;  3T9G A;  1RWR A;  2INU A;  4YZ0 A;  4HWV A;  4XM3 A;  1VBL A;  1PXZ A;  5C1E A;  2PEC A;  3VST A;  1K5C A;  1IA5 A;  1GQ8 A;  2O17 A;  3VSV A;  4XL9 A;  4XOP A;  1RU4 A;  4Z06 A;  3KRG A;  4W8S A;  1IDK A;  2UVF A;  4XNF A;  2Z8G A;  4OJL A;  4W8T A;  2IQ7 A; 
#chains in the Genus database with same CATH topology
 1LE8 B;  5IYQ A;  2E60 A;  2CC2 A;  1Q1V A;  1QZY A;  4RBO A;  2Z33 A;  4Q7J B;  5AIQ A;  3CLQ A;  4BHB A;  2VFM A;  2W1O A;  2GJK A;  4WQM A;  5M3F J;  3OFN A;  2X85 A;  4W97 A;  5IT3 A;  3PA2 A;  2WY8 Q;  2GOM A;  4LJZ F;  1IDY A;  4JK1 X;  1YX2 A;  1EH8 A;  2YS9 A;  2XZO A;  4ESB A;  5E1Z B;  4MFE A;  3BQY A;  1XB2 A;  4CYC B;  2ZB9 A;  3V8K A;  4A12 A;  3BY6 A;  4IPA A;  3PSS A;  2HXO A;  3S2D J;  1JHF A;  2BXZ A;  4IHV A;  5B6I A;  2JSP A;  4DYQ A;  1K83 J;  1DGW Y;  4M6V A;  5E3M A;  2WAQ A;  3GFI A;  4IKF A;  4WWV A;  1Y0R A;  1D5Y A;  3ES9 A;  1VQ6 B;  3VNU A;  3ZSC A;  3K0L A;  3F8F A;  3JCU C;  3CJR B;  2HEO A;  2O03 A;  3CB4 A;  4V19 K;  2DDA A;  5DS9 A;  1E0E A;  1AU7 A;  2H6C A;  2VQG A;  4G7H F;  2M0C A;  2ZL6 A;  2D2W A;  1VQ9 I;  5E8G A;  3ONQ A;  2M1B A;  2WBM A;  5CPR B;  2HS5 A;  3ABU A;  1FNB A;  4JX4 A;  2QEN A;  1HC8 A;  2OK7 A;  4OZZ A;  1KQS B;  1WZ2 A;  5BOX A;  5HZA A;  2CW7 A;  2P6S A;  3SFI A;  1WHU A;  4G7W A;  3WGH A;  1UHS A;  2KIS A;  4EGZ A;  2YUH A;  4ZDP A;  1VQ6 I;  2Q2E A;  2R9V A;  4ESJ A;  1VQL I;  4F92 B;  5LEK A;  5HOO A;  1DU6 A;  1FBQ A;  1HZE A;  2XZL A;  4BYY A;  4YC5 A;  1EFC A;  4CH7 A;  2EQR A;  3CCR I;  1YJW I;  2M8G X;  3HGG A;  4FTH A;  3U1K A;  5A2Q K;  3JRE A;  4PFO A;  2O7O A;  3N90 A;  3GEZ A;  4CCO A;  1O8J A;  2ZTN A;  1X4O A;  2E19 A;  3KYL A;  2BGI A;  3LNQ A;  4GGG A;  2BY2 A;  2QWW A;  3I55 B;  4UZU A;  2EWN A;  3ZGK A;  1MBH A;  2ZZG A;  4XSX F;  3KZZ A;  4XLF A;  3OW2 B;  3WU1 B;  1RUN A;  1EFR A;  4F91 B;  5FB2 A;  2Z6B D;  5JBQ A;  1T5E A;  4IZZ A;  3DU5 A;  4C2T A;  3LSH A;  3O8H A;  5K5O A;  1KTV A;  3L2R A;  4EM1 A;  1BL0 A;  2LY2 A;  5GV8 A;  1NJI D;  1EKE A;  2VUM J;  3CCR B;  1YJW B;  1RQP A;  1W7P A;  1F9N A;  5J3L A;  2HQ5 A;  1MZB A;  1X2M A;  2K85 A;  2LF7 A;  5F04 A;  5IY5 H;  4IHT A;  1HQC A;  3EUH C;  2C77 A;  3V76 A;  4BJ6 C;  3LQ6 A;  4JMQ A;  1LJ9 A;  3KCC A;  1O8K A;  1ETV A;  1VQ7 I;  4XN3 A;  3GTG J;  2E1O A;  1FEX A;  4KIS A;  4E7H A;  1H9G A;  2HYF A;  4DJA A;  5KNL A;  2EV5 A;  2DT5 A;  1T56 A;  3ZMZ A;  5HZB A;  2UXN A;  3OSG A;  4AID A;  1QH0 A;  4R71 A;  1LLW A;  2CG4 A;  3IKT A;  1PXZ A;  5LGN A;  1U8B A;  3QSY A;  3VYT B;  2ZXI A;  2FX0 A;  5DUK A;  5B66 C;  1GUU A;  4GCV A;  1OB0 A;  3DBH B;  4Z4Y A;  3E6C C;  1S7O A;  1R23 A;  2E7X A;  3LL7 A;  1ZAR A;  2NVQ J;  1CNE A;  3SLD A;  2PJR B;  3KRG A;  4P9F A;  1QFY A;  4HLY A;  1R1T A;  2K4J A;  4IXA A;  1FIP A;  3RDI A;  2IT0 A;  1Y0N A;  3F9K A;  2VQH A;  2P6T A;  2R7O A;  2MH9 A;  3IAM 2;  1B1B A;  2J8I A;  2F4M B;  1SAU A;  1CNF A;  3GYH X;  2KPM A;  4UUT A;  2MG4 A;  3RPQ A;  5GAH J;  3OYM A;  4EW9 A;  4E7K A;  2IXS A;  4KYW A;  2FUG 2;  5BSY A;  4X05 A;  5B1A H;  4ESF A;  2Q0O A;  3K1N A;  4ANJ A;  3JX8 A;  3FXO A;  3LA7 A;  1U5T B;  2RRE A;  2CW8 A;  2VQL A;  3W3C A;  3OYC A;  2LBF B;  3E1Y E;  1OMI A;  1W36 C;  2EFO A;  4S0H B;  1ZR2 A;  2VNI A;  5TV2 A;  1IV8 A;  3LVB A;  3JRG A;  3CC4 B;  4BKX A;  3H3U A;  3CC2 I;  2HPI A;  2OCC H;  3OYJ A;  1D1A A;  3CCS I;  1O8G A;  2ZNY A;  2O8X A;  2VBM A;  5FRM A;  4KFC A;  4AC0 A;  3JTH A;  1OCP A;  3RKY A;  4YFK F;  1VQM I;  1T8I A;  3AGP A;  3E6D A;  1UD2 A;  3WGG A;  5HS9 A;  4A0Z A;  1DPU A;  2K02 A;  1YOV B;  4BY7 J;  5K7H A;  2BV3 A;  3DPL C;  1Q82 D;  3V42 A;  3HPG A;  3C2H A;  3HHH A;  4E0F A;  2YX4 A;  4IHY A;  4IJA A;  4FT8 A;  4X6A J;  2Y0S A;  2AXL A;  1K28 D;  5E1W A;  1QA3 A;  1ZKG A;  3A1P A;  3ASS A;  4YAL A;  4GO1 A;  2MC3 A;  4KUM A;  1UD4 A;  4F7Z A;  1ZGW A;  1JGG A;  4L9V A;  3C7J A;  5DCF A;  2GK6 A;  3HYI A;  5HDN A;  2QKL B;  5KAI C;  1KRH A;  2OV7 A;  2RKH A;  3G1M A;  1LVK A;  5EG0 B;  4M1K A;  4IQ4 A;  2HLD A;  2B7E A;  3CME I;  1WJ5 A;  4NC6 A;  3NAU A;  2QF7 A;  2BM6 A;  1F36 A;  3F6V A;  4GYI A;  1U9O A;  1V5G A;  1WJA A;  2O0W A;  4YRV A;  1KD1 D;  1KJZ A;  1JTA A;  4EV0 A;  3FIS A;  1IN8 A;  3ZQQ A;  2R7V A;  2L0K A;  1F4K A;  1WGX A;  1HLV A;  5HXB A;  3CO7 C;  2X8K A;  1VQ9 B;  1K78 B;  1B23 P;  3ASR A;  4OJO A;  3M4O J;  1VQL B;  2WAE A;  2VBK A;  2VBZ A;  2H8R A;  1QG0 A;  4IO9 F;  1NH3 A;  1AMO A;  1R22 A;  1ZG1 A;  1VQP B;  3QU6 A;  3PUB A;  3T53 B;  1X1C A;  3W5U A;  2KRC A;  1IG7 A;  5TRD A;  1EH6 A;  2J5P A;  1S7A A;  3EUK L;  3RKQ A;  3KYD B;  2Y9Z A;  1N06 A;  2ZL5 A;  1KK3 A;  1V54 H;  1X1A A;  1TW2 A;  4LOC A;  4D9J A;  5C4J J;  1EFT A;  2CGP A;  3CD6 I;  3ONU A;  3I59 A;  2EIK H;  4BQQ A;  1FT9 A;  2OQG A;  1ZYR F;  4RB0 A;  3I55 I;  3TW7 A;  1FSH A;  5LBQ A;  5CQE A;  3OS0 A;  3ZCO A;  2ADU A;  5DYM A;  3DKX A;  3EYI A;  4DQK A;  2OTL B;  4XKB A;  2ZTG A;  1WOO A;  5JVG F;  1TT5 B;  3VNV A;  1FY7 A;  3CCU B;  2EV6 A;  5HLH A;  3BZC A;  4E70 A;  4Z4R A;  2IGO A;  3BR6 A;  1N75 A;  1D8K A;  2B7C A;  2DOD A;  2IP2 A;  2IVM A;  1O3S A;  2PE3 A;  5TY0 A;  2W85 A;  1VQO B;  3PO3 J;  3W6V A;  1R58 A;  4DBR A;  4J19 A;  3D5R C;  3PEN A;  2WR8 A;  1WQ2 A;  2FBI A;  2OBS A;  3WHB A;  3BOQ A;  4PUS A;  1K6O A;  3FM3 A;  2M5S A;  1TT0 A;  2J5O A;  3WE2 A;  2R7X A;  1YJN B;  2WV0 A;  3B6C A;  4RM3 A;  2KRF A;  2NST A;  5KVR A;  2HOT A;  4QFM A;  3KEW A;  2HDW A;  1W9X A;  1RKW A;  4BJ5 C;  4X0G A;  3A01 B;  5KHD A;  1IC8 A;  3GZ5 A;  2H27 A;  1QVF B;  2VNJ A;  1FIA A;  4Y17 A;  3MCA A;  3J7Z I;  4DQL A;  2GLO A;  2RC5 A;  2C78 A;  2A61 A;  1YIJ I;  2KIU A;  3CQZ J;  4UB8 C;  3FXK A;  4CDG A;  5GAD J;  3GME A;  2W4S A;  4Y7C A;  3SY2 A;  4M9S A;  4FIS A;  1XMA A;  5FLX K;  2WZN A;  2VOO A;  3ASP A;  2G7U A;  4ROX A;  2EFP A;  1OFM A;  1LFU P;  1ON1 A;  1E3P A;  3T1B A;  1O88 A;  3WNC A;  2BPO A;  2X9D A;  3HSE A;  2XVC A;  4EAT A;  3MWM A;  3ZR8 X;  2XAG A;  4WXC A;  1Y8Q B;  1R5B A;  1OGM X;  3GLX A;  4LLG F;  5GP9 A;  1Z0X A;  1GJR A;  4HPQ A;  2LFB A;  1LPQ A;  3AVU A;  4KNY A;  1KGS A;  5J3O A;  3N05 A;  3ZMT A;  3SEZ A;  1TWF J;  4A3F J;  1VQ5 B;  3CPW B;  2LKP A;  2YUS A;  3HHG A;  2QBY A;  3G05 A;  2W24 A;  3DTK A;  4C3J J;  1JJ8 C;  2OD5 A;  2NS7 A;  4Z6Y A;  4A3E J;  1BR4 A;  3WQZ A;  4DGW B;  4BQA A;  4NK6 A;  2CQK A;  3U6B A;  3TO6 A;  4R79 A;  4U7D A;  2LOO A;  1X1P A;  4ZH4 F;  4G1B A;  3HRM A;  2DPU A;  1FX7 A;  4DZP A;  4X7D A;  1KU2 A;  1H85 A;  1ITY A;  2V7F A;  3VO2 A;  2LZJ A;  3P9I A;  4BNC A;  4U4B A;  3HXL A;  2YPR A;  4OAY A;  1VQ8 I;  1S7E A;  2XPU A;  4YG2 F;  3ZN0 A;  4YAO A;  3WTW C;  3I58 A;  4GYG A;  2ZBV A;  1HDD C;  2XC7 A;  2BV6 A;  1H8E A;  4BHC A;  3FMR A;  4NQW B;  5E3O A;  4KA4 A;  3MZY A;  1FBU A;  3OYH A;  1TC3 C;  4OAZ A;  2FA5 A;  1TSP A;  3Q39 A;  1QO0 D;  1Z21 A;  4NQW A;  5GAE J;  2G9W A;  4DK0 A;  1R1V A;  3Q3A A;  2XUB A;  6PAX A;  4OOS A;  4CA0 A;  2D3N A;  1E1R A;  4QIW N;  5L3D A;  2H94 A;  2Y69 H;  3BWG A;  3DTI A;  3K7A J;  1ZRF A;  4EM2 A;  2JMW A;  1FSE A;  4HF0 A;  4P5O A;  3W6J B;  1FP1 D;  1ZR4 A;  4X7F A;  3GFM A;  5HLI A;  2VB6 A;  1U5T C;  3R61 A;  1U2W A;  5FFZ A;  3DKW A;  2E1R A;  1VQK B;  3K70 D;  5GV7 A;  3MKY B;  1KQ8 A;  2I10 A;  2MYS A;  1UG2 A;  3QYE A;  1K8A D;  3KEY A;  1KK0 A;  3K2Z A;  1EH7 A;  4RGS A;  4FAS D;  3VST A;  1H8H A;  1Z05 A;  2JQ7 A;  1BR2 A;  1IA5 A;  2QQA A;  2O17 A;  4P9S A;  2QYU A;  1ULY A;  3HC7 A;  2K7L A;  3CC2 B;  1P7I A;  4ZZD A;  1Y0U A;  1XN7 A;  4D0P A;  1U8R A;  3FPP A;  1ETO A;  1BLI A;  2EIJ H;  1U0J A;  2N8G A;  2PG4 A;  4RGR A;  3WYA A;  3BLY A;  5FKO A;  2VFQ A;  1AKH B;  2IW5 A;  1S8N A;  2Z99 A;  3CC4 I;  3J7A Y;  5E3N A;  1ZEL A;  1BA5 A;  2JVG A;  5L3E A;  2VJJ A;  4HDV A;  1T6Y A;  1G3Y A;  1VF7 A;  5A88 A;  2QA4 B;  3PET A;  1Q81 D;  1FLI A;  1D2E A;  2L3D A;  4A5M A;  2OK8 A;  3OZU A;  2V5I A;  2ZSI B;  4MYT A;  1VQK I;  4QUZ A;  1Z77 A;  1YLO A;  2X4H A;  3WG9 A;  2JA2 A;  5D5X B;  2RC4 A;  2XTW A;  1G6N A;  3HEF A;  3FXU A;  3CME B;  4FCY A;  3ZBU A;  2BW3 A;  5JLW A;  3EQL F;  1Z6R A;  4DNC A;  3BCA A;  3PQK A;  2GIZ A;  2VIX A;  4B8X A;  4Q5S F;  4B4C A;  1IB4 A;  4DNT B;  4ZCL A;  1A8P A;  2XTY A;  1TYU A;  3K10 A;  3CCL I;  4IVN A;  2EZI A;  3KX2 A;  3IV5 A;  5LEJ A;  1D3Y A;  2R5Z B;  1XG2 A;  2BX6 A;  3VOE A;  2RNJ A;  2VBX A;  4R8H A;  3I56 I;  1D0Z A;  4B3A A;  3OOU A;  2ZFW A;  1T6S A;  3IC7 A;  4FQG A;  4HST A;  4LIT A;  1E79 A;  4KIT B;  2K27 A;  2ODL A;  3QYF A;  2DOF A;  2LY9 A;  3UR3 C;  1DP3 A;  4TMX A;  1V4R A;  2HNH A;  4QPQ A;  1JJ6 C;  1APL C;  1BQE A;  5K5R A;  1G7R A;  1FNC A;  2A69 F;  5KSW B;  4PC2 A;  5AON A;  2EFG A;  3NB2 A;  2ZO4 A;  1IDJ A;  2WAF A;  1AWC A;  4EJW A;  4CSW A;  3HTS B;  3TDU C;  3WBK A;  4ZGN B;  3CD6 B;  1BBY A;  3JAM K;  5EEA A;  2BVN A;  3GIR A;  2H1K A;  3F8M A;  2GA1 A;  3I9V 2;  4HOB A;  2NT9 A;  5J8F A;  2DFH A;  2I8D A;  4XK4 A;  4C2L A;  2BHY A;  3CES A;  4NB5 A;  4IHX A;  2K3P A;  3ZUG A;  3J7A O;  2JUG A;  2RVC A;  2RN7 A;  4Z2Y A;  5IT9 K;  4IRI A;  2DOG A;  3DEU A;  1LFP A;  2VC0 A;  1O8I A;  3GQB A;  2KHM A;  1N07 A;  3E97 A;  1LEB A;  1R5O A;  3ECO A;  4XR6 A;  2CK3 A;  1FWZ A;  4B43 A;  4PGG A;  4WZT A;  2KMU A;  1J0R A;  4CZC A;  1JE8 A;  4O3M A;  1W36 D;  1YYV A;  4BXF A;  3L1P A;  3S1N J;  5IYN A;  3M7G A;  3H5N A;  5J47 A;  3S93 A;  1OFC X;  1GAQ A;  2CH0 A;  2FNP A;  2A68 F;  2PBI A;  2R4G A;  2JK3 A;  4DK1 A;  3A8J A;  2JWT A;  1J09 A;  5DM7 F;  4IOA F;  2INU A;  3IL2 A;  4YZ0 A;  2CND A;  4FX0 A;  1YG2 A;  3BR3 A;  1HOM A;  4U9U A;  3K4M A;  4A3M J;  3BC9 A;  1K5C A;  1NBM A;  5ICE A;  4B3G A;  2PMH A;  2O5R A;  1XG1 A;  3TO9 A;  1GVD A;  4NUB A;  3AG2 H;  3U1D A;  1YTY A;  3HOZ J;  3ZBT A;  2ISZ A;  3ZQ7 A;  4XNF A;  4BQN A;  1S6L A;  2WC2 A;  3G3Z A;  4TMV A;  1O57 A;  1P4A A;  4H4K C;  2P81 A;  1WSV A;  4AVP A;  4QSH A;  2CQQ A;  1RIO H;  1IN7 A;  2V4J C;  4P26 A;  3W2A A;  1S29 A;  3EYY A;  4XN0 A;  3HOW J;  1P6R A;  3BG9 A;  4RGU A;  3C3W A;  3NAR A;  3P7N A;  2FVG A;  1PYV A;  1V5F A;  2F5C A;  3WTX C;  4A3J J;  1X0C A;  2Q8K A;  1WCM J;  2R92 J;  1JGS A;  2M4K A;  4CIC A;  3Q5F A;  1K4S A;  1XCV A;  1B8I B;  2OTJ I;  3PSZ A;  2CQ7 A;  3S1M J;  2Y48 A;  4FE4 A;  3ZC3 A;  4Z4S A;  2VPL A;  1MDM B;  1QGA A;  3G2B A;  2HCJ B;  1MJA A;  3OW7 A;  5A8A A;  1QHG A;  2QQ8 A;  3IKV A;  2MLK A;  4M3B A;  2VKH A;  4OIP F;  3NWS A;  2VFO A;  4I84 A;  1P4X A;  3OV8 A;  3AKZ A;  1RRJ A;  4X7E A;  2EFN A;  1PP8 F;  2DTZ A;  2FJ1 A;  3SDG A;  2W00 A;  3BRO A;  2VON A;  2L9N A;  2L54 A;  5C3E J;  2B9S A;  4EJU A;  4L9J A;  3ZPL A;  1X2N A;  1MMS A;  2FEZ A;  4RAF A;  3SHF A;  3L00 A;  4ZYE A;  1WOS A;  1RI7 A;  1E3H A;  4XOR A;  3CUQ A;  2VNH A;  4HLX A;  5EEG A;  2OZU A;  4E6K G;  5JI6 A;  2X3U A;  2CV0 A;  3OE7 A;  1VQ7 B;  4HX7 A;  2GK7 A;  3O3K A;  3P5J A;  3OMY A;  2MLG A;  4CQJ A;  2YU9 J;  3CDI A;  3GTM J;  3BH7 B;  3RYP A;  4M9Z A;  1I1G A;  4YFX F;  1VQ8 B;  1YI2 I;  5B1B H;  3MMY B;  3WTZ A;  1VQP I;  4BAC A;  3LSK A;  5JHU A;  2LNB A;  3VDX A;  5IYC J;  3ZP5 A;  4OMZ A;  4IOC F;  4GXO A;  1MBE A;  3KP2 A;  5IP6 A;  4KKS A;  4AYB N;  2XGJ A;  4BDY A;  1EXM A;  1OKR A;  1CF7 A;  4P25 A;  1PP7 U;  4U49 A;  3CTA A;  3TP0 A;  3A02 A;  4BE2 A;  4RB3 C;  1GV2 A;  1S4M A;  3CPX A;  2CRG A;  2O61 A;  4I0B A;  1SM4 A;  4A93 J;  4KT5 C;  2VE8 A;  3OP1 A;  4P1V A;  2HVR A;  3DQV C;  2ZJR F;  3BR2 A;  1SVO A;  4DZJ A;  4BEH A;  1FNM A;  2DMP A;  2PYG A;  3L7W A;  5DCM A;  4AIH A;  3GLL A;  1S9H A;  1QHH D;  2XAQ A;  1VI0 A;  4XLH A;  4OPO A;  2DA2 A;  3GVJ A;  4L18 B;  1E2X A;  4Z03 A;  4I02 A;  5L3F A;  2DPD A;  1LDK B;  3A0H C;  2HZT A;  4A3D J;  1GHC A;  4XON A;  4QTR A;  5HLG A;  4ZDO A;  3CZ6 A;  2L7Z A;  3C2B A;  5ILS A;  4WWC A;  3I3L A;  1YW8 A;  1UZC A;  1R5I D;  4MEY F;  1ELO A;  1EZG A;  4L9N A;  1IN5 A;  3HRU A;  1I8D A;  2JJ2 A;  4OJP A;  4RAY A;  3WGI A;  1BR1 A;  1FBS A;  1Z9C A;  1BC7 C;  2F3L A;  2GIV A;  2L9R A;  1E64 A;  4PC7 A;  4PZJ A;  4TMW A;  2XRO A;  4IL6 C;  3A35 A;  2V1D A;  1PUF A;  2K9M A;  3Q3S A;  3QPL A;  1K4T A;  2WZP P;  4YAU A;  2L5Q A;  4HA8 A;  1M1K D;  2BM4 A;  2PMU A;  2VI6 A;  3MCZ A;  2FRH A;  3FX3 A;  2ESH A;  4U88 A;  2VBY A;  5FKL A;  5JLX A;  1QQ1 A;  1F60 A;  1X3W B;  2V9K A;  3RKX A;  2V7U A;  3QPH A;  2L2O A;  1LQ1 A;  3CMM A;  2PFB A;  2RQQ A;  2DFE A;  3NQO A;  2VT3 A;  2L9S A;  3DCF A;  2PJR A;  4HRI A;  3JQQ A;  5IYP A;  2FF4 A;  1MRZ A;  4PC1 A;  3FXJ A;  3COA C;  4IRG A;  4II3 A;  3MKZ A;  2E2I J;  2W6I A;  3OYE A;  1VHE A;  2K40 A;  3DP7 A;  3FPK A;  1T0F C;  1V0F A;  3GFL A;  2ZBK A;  1D0X A;  4KIB A;  3GQ7 A;  4JP0 A;  2E5N A;  5D4R A;  1VF9 A;  1BJK A;  4M3E A;  2M30 A;  4UNO A;  1BIB A;  4N9H A;  4RD6 A;  4NBQ A;  3BH6 B;  3KIO A;  1UMQ A;  1WJD A;  5EZG A;  2B0L A;  4HE6 A;  4KKU A;  2X6W A;  3H9G A;  2F2E A;  1X1D A;  1TYV A;  3A8K A;  2OA4 A;  4A69 C;  5F08 A;  1SAX A;  1J75 A;  1JUM A;  4RDK A;  1E43 A;  1FOK A;  3ABT A;  3FMQ A;  4A3B J;  2DA4 A;  1OCO H;  3LSP A;  4M0L A;  4A0X A;  4EH1 A;  1A6I A;  4MR0 A;  4BE1 A;  1LDD A;  5H6Q A;  2QM3 A;  3QOP A;  5E6T A;  4MNU A;  3UNG C;  2UXX A;  2ZJ2 A;  3ASO H;  2XT4 A;  4TSF A;  4B47 A;  2VKD A;  2GQF A;  2DJI A;  2F4O B;  4MFD A;  5DM6 F;  1G2H A;  4MYU A;  4Z1M A;  4YII A;  1VQO I;  3GSI A;  2NOJ B;  5J1R A;  1WU8 A;  4I01 A;  1KYW A;  1OGO X;  4RAG A;  3CW2 A;  4BDZ A;  1EE6 A;  1KU3 A;  2XGX A;  1DBO A;  4Z05 A;  3LQR A;  5TR9 A;  1IRX A;  1BW5 A;  4M3D A;  5E20 A;  2STT A;  2M0M A;  4PK4 A;  2XF6 A;  1FNN A;  1Z3Y A;  3CDL A;  2NNY A;  1CZF A;  2EB7 A;  3FZV A;  2ZJP F;  2UVE A;  1WMR A;  2GPJ A;  4NHJ A;  5E1X A;  2ZZF A;  5L3C A;  2L01 A;  4ZCM A;  5FA6 A;  2CFO A;  3GBG A;  5TIS C;  5EZH A;  3FHZ A;  3T56 B;  2EPF A;  3GQ9 A;  3FKJ A;  2WB1 N;  1IAW A;  3HM5 A;  3KZI C;  4NC8 A;  2HVS A;  5IP9 J;  4UUV A;  2QZ8 A;  4DYR A;  2AQE A;  1M1E B;  2FML A;  1J9Z A;  3K6G A;  1BI3 A;  2VE9 A;  1AA7 A;  1E3O C;  3T8T A;  1DG1 G;  4J0Q A;  4PMH A;  2LC2 A;  4N4N B;  1IXC A;  4WXD A;  2KFD A;  3VYS B;  1MKM A;  2B0R A;  5B3S H;  4X07 A;  4Y9R A;  1YX5 A;  1OJL A;  1EJ9 A;  4AUX A;  1V5E A;  1YX3 A;  3AG1 H;  1XD7 A;  1W0J A;  1G3W A;  2LK2 A;  2F4I A;  2DLL A;  2PQ8 A;  3DEW A;  2V79 A;  2X1E A;  3TO7 A;  4IHW A;  3QP5 A;  2M45 A;  3B82 A;  2CUE A;  2ETH A;  3BJA A;  3NRV A;  1K61 A;  1D0Y A;  4OOV A;  3GXO A;  4UUS B;  5EEH A;  3CF2 A;  1O7L A;  3TOB A;  4F7D A;  3KET A;  2YU3 A;  2CW0 F;  4RDU A;  2V9V A;  2ME6 A;  1FTZ A;  1P92 A;  1KK2 A;  4UUS A;  1W5T A;  2XHK A;  2Y31 A;  5A2Q Z;  2Z5U A;  3LO8 A;  2KZV A;  2XRL A;  1ZTR A;  3ZQF A;  3CCQ B;  5FKK A;  2OTJ B;  2Y75 A;  3J81 k;  1X19 A;  4J01 A;  3JRF A;  1QRB A;  3OL4 A;  1GLN A;  4ON0 A;  2CW5 A;  4PCQ A;  1MH3 A;  1IJF A;  1O3Q A;  3CXC B;  3R4K A;  1R5G A;  3MAJ A;  2XT2 A;  2F5D A;  3SZP A;  1RZ4 A;  2P3M A;  1IZ1 A;  1RR8 C;  2G0E A;  3J81 K;  1HVX A;  1SKQ A;  5IYR A;  4GQN A;  2HGC A;  2KDO A;  2VC1 A;  3BY1 A;  2P0W A;  1UB9 A;  4N3G A;  1PUE E;  2RGV A;  3OR1 C;  4G7O F;  1ETX A;  1OR7 C;  1I39 A;  2VBW A;  1YS7 A;  3SZG A;  4NDL A;  3LFU A;  4XLE A;  3RIR A;  3OYF A;  3KP5 A;  4BL0 B;  1WP6 A;  2OJE D;  5KK1 A;  1GO2 A;  1F5T A;  1IRG A;  1Y1V J;  3OSF A;  1K4Z A;  2AHQ A;  3LYC A;  2W7Z A;  2D1V A;  2HU9 A;  1I27 A;  4EVI A;  3JSO A;  2FBH A;  1A36 A;  2ELJ A;  3BQZ A;  4RLQ A;  1EP3 B;  3AVV A;  5E3L A;  2NVT J;  3A4C A;  2IGN A;  3CJQ B;  4YIR X;  5K7F A;  1BX1 A;  5FLM J;  4LC0 A;  1LDJ A;  1IHM A;  2OCE A;  3CP8 A;  3O8G A;  4XBF A;  4G8X A;  2C2W A;  3GO5 A;  1ZRD A;  4WF2 A;  3H35 A;  3E0J B;  4I0A A;  5JMC B;  1HSJ A;  3Q9S A;  2F6C A;  1YJ9 B;  4RM0 A;  4BPR A;  2NXN B;  3K69 A;  3T51 B;  3QQA A;  4HV6 A;  1OOC A;  2INV A;  2G0Y A;  4G94 A;  3EQN A;  2LLK A;  3A3B A;  4BU2 A;  2BVM A;  3VFZ A;  1QUF A;  1P7J A;  4U87 A;  3MFK A;  4HSR A;  1N08 A;  3OAA A;  4AYB A;  2R7D A;  3QYB A;  2LR8 A;  2FQ4 A;  4RD4 A;  5HVQ C;  4V02 C;  1HST A;  5CVI A;  3N4M A;  2M87 A;  5DN6 A;  2O3F A;  1QGZ A;  3H09 A;  1EA3 A;  4LB5 A;  1GT0 C;  1R7J A;  2NS0 A;  4HIZ A;  1QX4 A;  4NBS A;  1R6R A;  1WI9 A;  1K79 A;  3FK7 A;  1X58 A;  3HRS A;  4RLF A;  3ZZ0 A;  5A89 A;  1O3R A;  1R4N B;  3ISX A;  4CHU A;  1OQY A;  2R7U A;  2MA3 A;  4LK1 F;  4S05 A;  2YWH A;  2M4G A;  2WTE A;  2XAH A;  2XKO A;  5M5Y J;  4W8R A;  4Z4V A;  1JRG A;  1H88 C;  3IAS 2;  3G1O A;  2VBT A;  2NTQ A;  5KW9 A;  2VYQ A;  4OU0 A;  5ICC A;  2VXD A;  1P9Q C;  2EIL H;  2I5U A;  4A2U A;  2DMU A;  1DUX C;  3E5X A;  1H89 C;  1JTX A;  2QYO A;  4C3H J;  2QTL A;  4ENJ A;  2DIE A;  1G7C A;  1DDI A;  3DWL E;  2DK8 A;  5M5W J;  3S8P A;  3D26 A;  2L7M P;  2BY0 A;  2TDX A;  2E35 A;  4XMY A;  1MAB A;  3J81 Z;  3QE2 A;  2ZSH B;  4LLL A;  2CQX A;  4CZZ A;  2EZL A;  4IF4 A;  4Y3O A;  4CXF A;  1TLL A;  1XDU A;  3CUQ B;  4XM3 A;  2OUM A;  1RES A;  4CGZ A;  2IS1 A;  2PEX A;  4ZV4 A;  2GJR A;  1YJN I;  2K3F A;  1GQ8 A;  1OCC H;  2YSR A;  1REP C;  3EUH A;  2OAZ A;  1IDK A;  2GM4 A;  3F8N A;  4I99 C;  1R4M B;  1ZLK A;  1V5V A;  3WTU C;  2CMP A;  3ESW B;  3U2R A;  1MND A;  4HNV A;  4QVA A;  3FHN A;  3HL2 A;  5LGT A;  1X1B A;  4LD5 A;  5EDN A;  2WV1 A;  2ZZQ A;  1GAW A;  3VMF A;  4DQ2 A;  2VKE A;  2QLZ A;  3CJT B;  3F3X A;  2B63 J;  4R1H A;  4A6D A;  2JPB A;  2KLO A;  2XSJ C;  2Y2Z A;  2QMU A;  5CJ9 A;  3BG5 A;  2GXB A;  3S17 J;  4PSW A;  1ZUN B;  2QBY B;  1X4P A;  2M8E A;  2DFI A;  5TJJ A;  2ACJ A;  5M5X J;  3I71 A;  4D1Q A;  1GVJ A;  1QPI A;  4A3K J;  2HFH A;  2PX9 A;  2HQR A;  3LSG A;  3K9T A;  3KFW X;  5LHG A;  4S04 A;  3IRR A;  1HA3 A;  2ZL7 A;  2XOK A;  2JVH A;  1K73 D;  2BM1 A;  1IGN A;  1JNY A;  1SMY F;  1LE8 A;  4A3G J;  1B6A A;  1KK1 A;  4OWR B;  5EMN A;  1YIT I;  3LA2 A;  2NTB A;  4LGW A;  4G7Z F;  3MZ8 A;  2V31 A;  2M5W A;  2BF4 A;  2HI3 A;  2R5Z A;  1HF0 A;  5E79 C;  2WSS A;  1QA1 A;  3BJO A;  2LBF A;  4CCN A;  1R36 A;  1Q1H A;  2DJN A;  2X1C A;  3HPH A;  4PJ0 C;  3TDZ C;  1VQ4 I;  3SJM A;  1K8F A;  2NZM A;  3V8L A;  3FBN B;  3M1C A;  2R5Y A;  3KYC B;  1Z7L A;  2BSP A;  3DLA A;  5FFX A;  4RJL A;  1IXR C;  1KMH A;  1H8A C;  1IF1 A;  2W6J A;  2O1D A;  2FE3 A;  1IRZ A;  2PIA A;  5FO0 A;  2FX3 A;  1EP1 B;  5BPD A;  4P3I A;  4AVZ A;  5DNS A;  3MKL A;  1WJB A;  3BC8 A;  4XRF A;  3W2V A;  4WK8 F;  4ZTF A;  1XMX A;  1C0W A;  1UD5 A;  1OCT C;  2HOE A;  4OIR F;  1Y8R B;  2DW4 A;  2XC1 A;  3SXY A;  3KEQ A;  1KC8 D;  1K9M D;  5LHI A;  3F6O A;  4AWX B;  2LDU A;  2IGM A;  1HBX G;  2WYR A;  5EF6 A;  2BOL A;  4KDP A;  3MQ0 A;  4RM2 A;  5J8C A;  1N0V C;  2WY7 Q;  2MC4 A;  3QWL A;  3CCQ I;  1NTC A;  2JA6 J;  4LBZ A;  3CC7 B;  3NAW A;  4HNT A;  2PMZ N;  3GWZ A;  1LKX A;  1FRQ A;  5CVV A;  4MXN A;  4ACB A;  2GBY A;  2V4D A;  1KZL A;  2DET A;  1RUO A;  4UVB A;  3BZK A;  2XF7 A;  2DA6 A;  3ZRG A;  2OBT A;  3WOD F;  2CV1 A;  3VR6 A;  1MBF A;  3ZZT A;  4JQF A;  2IRF G;  1ORK A;  1K78 A;  3M3Y J;  2ZXW H;  3GUD A;  3VPR A;  4BAY A;  3A3G A;  2IBD A;  3ROU A;  3R6J A;  3L9F A;  5FRN A;  3VSL A;  1RWR A;  1SD7 A;  2ZKZ A;  2HDD A;  1T95 A;  3KP4 A;  1NRK A;  3ASN H;  1XDS A;  3R0J A;  2QE7 A;  3WTY C;  1JA1 A;  4UHT A;  3TMO A;  1QRC A;  2VAS A;  3KE2 A;  2O8K A;  4E7L A;  1B2R A;  1RU4 A;  1U78 A;  5F27 A;  2QEX I;  1MJ9 A;  3ULQ B;  1NG7 A;  1B59 A;  1S0U A;  4UVA A;  4Y4R A;  1N0U A;  3PNY A;  3OEH A;  4GRI A;  1W7P B;  4NC7 A;  2HKX A;  1FYM A;  2P5V A;  3RI4 A;  3BCF A;  3LSR A;  5FL7 A;  4I98 B;  1OFL A;  3S3M A;  3HOS A;  3S16 J;  2YWF A;  3ECH A;  1I5Z A;  3CCE I;  4CCK A;  1E63 A;  1ACI A;  3JSP A;  2HMA A;  2XND A;  5CLS A;  4Q48 A;  2NNN A;  3D5S C;  2H6B A;  4CYD A;  2LYC A;  3QU3 A;  1SD6 A;  4BQO A;  2VOD A;  1ONV A;  3ABL H;  4HDU A;  1TTT A;  4NNJ A;  1BN8 A;  2R7S A;  2VKV A;  2BVL A;  5HS8 A;  1JKQ C;  2BEO A;  2DBB A;  4CO8 A;  5L3B A;  1RPW A;  1K6Y A;  2OBP A;  1UHM A;  3PM1 A;  4L5I A;  3WE3 A;  2OTL I;  3HDD A;  1BPL A;  2EFQ A;  3U9G A;  4XOT A;  1T2K A;  1XQB A;  1YW7 A;  2XIG A;  1N05 A;  2XKP A;  2V26 A;  2XTX A;  3BCB A;  1TWA J;  3REO A;  3ZMU A;  1WDT A;  3TL4 X;  1FRN A;  2JTV A;  1HW5 A;  3QP6 A;  3I4N J;  2LG4 A;  3KLO A;  5C4X J;  2NVY J;  1XSX A;  2W82 A;  1RET A;  3RPU A;  4LIV A;  1D1C A;  4B3F X;  1BOB A;  4L5J A;  3R6K A;  2E5Z A;  2JRT A;  1U2R A;  1ZLJ A;  2NS8 A;  5BS6 A;  3PNT A;  3JQP A;  2BM5 A;  2NPF A;  4A3C J;  5F1J A;  4AF7 A;  2XAF A;  3OOP A;  3OYD A;  1XC5 A;  5FD5 A;  4TMT A;  1Z3X A;  4ZTJ A;  4KIG A;  1OR7 A;  3CCY A;  4HQM A;  4LBY A;  4PAA A;  5J35 A;  2D45 A;  3HOU J;  2PLY A;  1WH5 A;  4Z4U A;  2LMD A;  2B7B A;  4G1V A;  3FF5 A;  2PLF A;  1IJW C;  3HUG B;  1SVL A;  2ECB A;  4MHG A;  4AIK A;  4YDT A;  3TP3 A;  2X48 A;  3BG3 A;  1I7P A;  2A5Y B;  4JX6 A;  4BEH B;  4HG2 A;  4JYK A;  4RB1 A;  3K4J A;  4II2 A;  1QFJ A;  2E2J J;  5GTI C;  4RPB A;  3FXQ A;  1W87 A;  4UZE A;  3IWZ A;  4N0B A;  4OPS A;  2MD5 A;  1V3F A;  3FWE A;  3F8C A;  2FMY A;  2XAS A;  4B1R A;  5BQT A;  1QZZ A;  3W2E A;  5IT9 Z;  1XMK A;  2R7T A;  2A6E F;  3DTE A;  3TED A;  1IJE A;  3CMA B;  1PE9 A;  2QZA A;  3LJY A;  2GOX B;  3HBL A;  1VHO A;  2BXY A;  1H9T A;  3TGN A;  1GR1 A;  2VNK A;  4PSX A;  1EA0 A;  1OYI A;  3F72 A;  3MKW B;  2KIQ A;  1YRN B;  2WAD A;  2Q1Z B;  2ZFU A;  5FRO A;  4HWV A;  3CCJ I;  2X1D A;  4XRM A;  1GDT A;  1DDG A;  1MNE A;  2HVQ A;  4DOZ A;  5GTH C;  1FPQ A;  2ICW G;  3TKY A;  1ZH5 A;  2BYV E;  3DU1 X;  3WTV C;  4HX4 A;  3V7R A;  2MSY A;  4E7S A;  1Q9S A;  1PDN C;  2IQ7 A;  2O6W A;  3B78 A;  3H9J A;  3Q0V A;  3TW6 A;  3CCM B;  1QPM A;  1YIT B;  1VTN C;  2ME0 A;  2MFZ A;  4PJJ A;  1ODD A;  1IDZ A;  1TYW A;  2XPW A;  4EJV A;  3JRB A;  3ZQL A;  2QQB A;  2Z3Y A;  5ICG A;  2B5O A;  3OPO A;  2V7X A;  1JKR C;  2D74 A;  1XFO A;  4M6Y A;  3VEP A;  1ZQ3 P;  4Y52 J;  1TWC J;  4KIF A;  4M53 A;  1M90 D;  1UMK A;  1UD3 A;  5F64 A;  3I59 B;  4RCZ A;  4YAW A;  3I56 B;  5CQG A;  4LK0 F;  3VB2 A;  3F22 A;  2Q2E B;  3KPH A;  4DW6 A;  1BM9 A;  1SFX A;  2VBE A;  2HTJ A;  2LVS A;  2XZP A;  1XX5 A;  2DMQ A;  4XLC A;  5F1R A;  5HDK A;  4Y9U A;  1HG8 A;  3ONY A;  3DBR B;  2VT2 A;  3GQ8 A;  2ZJQ F;  3OIP A;  2H09 A;  2YWE A;  3OS2 A;  2OC6 A;  5F6F A;  1AKH A;  1J5Y A;  5DS0 A;  2WPD A;  3LSM A;  3W2I A;  3B4N A;  2ZCW A;  2CYY A;  1R1U A;  1QVU A;  5EGO A;  1WVR A;  4OOI A;  2PYH A;  3PFI A;  1MNM C;  2DYI A;  3CJN A;  5ICF A;  3M8F A;  4OIO F;  2AHO A;  4MGR A;  2GWR A;  3OEE A;  3HJE A;  2X3H A;  2JPC A;  1G8X A;  3O2P E;  3I54 A;  4LB6 B;  4MO7 A;  1S5L C;  2X51 A;  1J59 A;  2R7W A;  5F4J A;  2OQR A;  3U2Q A;  3HGY A;  1OYW A;  2ZME C;  1T33 A;  2Q6O A;  3P27 A;  2EA4 A;  1D1N A;  3JRD A;  3A03 A;  4BBR J;  3LQQ A;  4B4D A;  1QVG B;  4OP7 A;  2IEK A;  1FJL A;  1IN4 A;  1Y6I A;  2P5L C;  2E1B A;  3LSI A;  4EQQ A;  2LY1 A;  4HE5 A;  4F55 A;  1W5C C;  4Y7N J;  2QUF A;  1A35 A;  2D5V A;  1ZM3 A;  4O6J A;  1YIJ B;  2C4U A;  1SAN A;  2M7B A;  5D8L B;  2I1L A;  2BGC A;  4NK8 A;  2JA8 J;  5J4Y A;  4G7X A;  1JI8 A;  1VZ0 A;  1ZG3 A;  3S2H J;  3IP4 B;  4ZYG A;  2BM0 A;  2YWG A;  3KP3 A;  1Y0Y A;  2JDI A;  2WAQ N;  2BZT A;  1Y39 A;  2Y0S N;  2XRN A;  2L7F P;  3E1S A;  1VQ5 I;  2M7A A;  1QNT A;  3M1E A;  1KQ5 A;  3LA3 A;  1E3X A;  1TBX A;  3F23 A;  5AMV A;  5LRS A;  2OU2 A;  2YR2 A;  2IA1 A;  2R0Q C;  2E2H J;  3V4G A;  4K1X A;  3V7A A;  2JT1 A;  4IW3 B;  4ZZL A;  4EEF G;  1R5N A;  2RNG A;  4N9I A;  1JT6 A;  1YS6 A;  3BTJ A;  2CS3 A;  2MAB A;  4E7Z A;  5CDF A;  3ZQH A;  5IPA A;  3L2W A;  3GZ6 A;  2CFX A;  3GTP J;  1U5T A;  4G6Q A;  3AL0 B;  4UVC A;  3IH4 A;  1G7S A;  2LF8 A;  2UV1 A;  4MIM A;  4HF2 A;  4A3L J;  2AXT C;  1VBL A;  2VJ5 A;  3BDD A;  5C1E A;  4RCY A;  1I3Q J;  1TP4 A;  3VYU B;  2K4B A;  4Z4Z A;  5LMZ A;  1QUE A;  1J2X A;  1ZG5 A;  3DPU A;  1AOY A;  2QSG X;  3K4C A;  1FOX A;  1DPR A;  2IAI A;  3SKB A;  3HAG A;  1T39 A;  2EZH A;  2ZXH A;  3E3V A;  1MDM A;  1G3S A;  3I1F A;  2GZW A;  5EYR A;  1XGN A;  3R0A A;  4HYE A;  3T5X A;  2K9N A;  1BI2 A;  4FHT A;  2R5Y B;  1JHH A;  3Q38 A;  2UZK A;  4L0Z B;  3QFS A;  1TNS A;  4Y15 A;  4RD2 A;  1VQM B;  2Z2S B;  4RA2 A;  2VL8 A;  4YEJ A;  4QV2 A;  2HR3 A;  3VO1 A;  2HPM A;  2V1X A;  2XNJ A;  4D5F A;  3AST A;  3CMA I;  3HRT A;  1SMT A;  3K4L A;  1QBJ A;  2AQF A;  4BXU A;  2DN0 A;  1YE9 A;  3PJR A;  3H92 A;  4D5C A;  1EP2 B;  5FD6 A;  3PVD A;  4I09 A;  2XAJ A;  2NVX J;  1KA8 A;  5FLX Z;  2ZXJ A;  4QPO A;  3ERE D;  4M71 A;  1CQX A;  1WI3 A;  4LBV A;  3W5V A;  3CCJ B;  2QCO A;  5HNH A;  3K4K A;  3QFC A;  3BJ6 A;  4RDJ A;  1HKQ A;  2DER A;  2V7W A;  1MMA A;  3M8J A;  2R7Z J;  3M07 A;  4QWQ A;  1J7K A;  3CCV I;  3WND A;  3I64 A;  1YIO A;  1Z91 A;  2A6H F;  1POG A;  3EPZ A;  1P4M A;  3RQI A;  3W2W A;  2M3A A;  3E5U A;  1W2B B;  1IXS B;  1PJ6 A;  1CF7 B;  2LP0 A;  3GF2 A;  3B8Y A;  4LMY A;  4J00 A;  1U3E M;  2DA3 A;  2BSA A;  3BH4 A;  4L8J A;  4E7I A;  1B8I A;  3S1Q J;  5L46 A;  4X06 A;  2LTP A;  5IOZ A;  3QFR A;  1YO5 C;  1W5S A;  3K4N A;  3QPS A;  4Z4T A;  2VBS A;  2K5C A;  4P22 A;  3H94 A;  1BI0 A;  4BH9 A;  1I18 A;  5DCM B;  1UEL B;  2W25 A;  2JRM A;  3W6K B;  4RD0 A;  4TKO B;  3CMY A;  1QU3 A;  3GTL J;  2UWM A;  4DBQ A;  1I1S A;  3DF8 A;  2F1L A;  2KJC A;  3SEQ A;  4L9T A;  1Z6T A;  3OKX A;  3LSJ A;  1A6Q A;  2ELK A;  2QY1 A;  5JHF A;  2NVU B;  4EJT A;  3RCO A;  3CUQ C;  1P4W A;  3B02 A;  3T0Y A;  4QHY A;  3W2G A;  3SUC A;  4XID A;  3RZD J;  4C0S A;  3DKY A;  4KJZ A;  4C3I J;  2DOA A;  3H36 A;  3ZN1 A;  3OYI A;  4ZCI A;  1OIS A;  1Z67 A;  3CP2 A;  4HV5 A;  4XRS G;  2BY3 A;  3E5Q A;  3MMP A;  2JSC A;  1OB5 A;  2XB0 X;  4OIN F;  1W0U A;  4JX5 A;  4I6Z A;  2IGK A;  4AM3 A;  1EFU A;  2CV2 A;  1FX0 A;  1PJ7 A;  1EWY A;  3H3V K;  5CVU A;  4RAZ A;  1VFC A;  2TCT A;  2JUC A;  3CCU I;  1O3T A;  4AC9 A;  1LUJ B;  1IW7 F;  1YFH A;  2IA0 A;  4ACA A;  4C30 A;  2OPT A;  1L0O C;  5FLV A;  3BQJ A;  3BG7 A;  3L09 A;  3DDY A;  4M3G A;  4PGH A;  1HW2 A;  2R93 J;  3CCE B;  4PDK A;  5EGO B;  4M2L A;  2ZC2 A;  2PJP A;  3G6E I;  2E71 A;  2BY1 A;  1SKY B;  1YI2 B;  2D9R A;  2XAU A;  3FKI J;  2RV8 A;  1QGP A;  1WPC A;  3SEJ A;  2BMW A;  1V0E A;  4ENM A;  2XEX A;  4PJL A;  2M34 A;  1FMW A;  3T9G A;  4V2G A;  1K7A A;  1KON A;  1E1Q A;  2BE5 F;  4G5G A;  1KZH A;  5IYW A;  4PJM A;  2PEC A;  1WFX A;  1BX0 A;  3OYL A;  2H1L A;  3CCS B;  1XGM A;  2R7Q A;  2K9S A;  4XOP A;  5FGM A;  1QRY A;  1KU7 A;  3OWT A;  3DU6 A;  2F4N A;  1HA8 A;  1I50 J;  4DNR B;  2IS6 A;  1JB9 A;  3GVL A;  2A07 F;  4LIU A;  2JN6 A;  2DO7 A;  4EGY A;  3ERM A;  4ENN A;  3OYB A;  3BR0 A;  1FYK A;  1FDR A;  5C44 J;  3JRH A;  1CGP A;  1TWH J;  4OIQ F;  4AF6 A;  3HSF A;  5CVR A;  2KDZ A;  4LFU A;  2X53 S;  3FXL A;  5FIU A;  4M3F A;  2ELH A;  4YZQ A;  2VXZ A;  1RC9 A;  2ZIT A;  2LRD A;  3HUG A;  1FZP B;  2P7C B;  2V6C A;  1E62 A;  3OR2 C;  1JUP A;  5BMZ A;  2A3S A;  1MGT A;  4BXX J;  1QGY A;  4D7N A;  2Q6K A;  2L4M A;  2BN4 A;  5CKT A;  5ERI A;  1UD6 A;  2E1M C;  2PN6 A;  3L2Q A;  5THX A;  3GW2 A;  3LMW A;  3ZXS A;  5TGT A;  1DQU A;  1FP2 A;  2E7W A;  5FO5 A;  3KP6 A;  1NDH A;  3FY3 A;  2NV4 A;  4HF1 A;  4UV8 A;  4G12 A;  1NHA A;  4BY1 J;  3FBI B;  3GZN B;  4F52 A;  5JVT A;  1D5V A;  1RKT A;  5BPI A;  2ID6 A;  2QGU A;  4FET A;  4ZC3 A;  4UZF A;  3GTK J;  9ANT A;  1XSD A;  3WXM A;  1QZE A;  1MH4 A;  2KQR A;  2VJI A;  1MMD A;  1MMG A;  3S14 J;  2GXG A;  5F0F A;  3BP8 A;  4XLP F;  2VBU A;  2CJJ A;  2HQA A;  3PFY A;  5LRR A;  2VLA A;  3KL9 A;  1TTY A;  4KKT A;  2E34 A;  2DOE A;  3EET A;  1S3J A;  3LAJ A;  1BHE A;  3PNV A;  2IJL A;  3CUO A;  3KLN A;  1FOY A;  1XGO A;  5ILV A;  1BIA A;  1ZM9 A;  1L1I A;  2DT7 B;  3M9A A;  1H80 A;  2HDN B;  4C9Y A;  1JA0 A;  3FKS A;  4RGX A;  1QQI A;  3PIP F;  1NK3 P;  3P26 A;  4XD7 A;  4I76 A;  3W2F A;  5D5V B;  2NYX A;  2GQQ A;  2MBF A;  4OM9 A;  2V6E A;  2KRH A;  2Y9Y A;  2Z16 A;  2HYG D;  1G59 A;  5E18 F;  2NOG A;  3E6M A;  3HKZ N;  5D6F A;  3K1P A;  1ERD A;  3AVX A;  1MD0 A;  4F3Q A;  1UCR A;  2BHZ A;  1VJS A;  3AVT A;  2DYR H;  2COM A;  1D8J A;  1IB0 A;  2QDX A;  3OZV A;  1R49 A;  1L3L A;  2W84 A;  4U7B A;  3B90 A;  1B72 B;  1QA2 A;  5JFR A;  1DU0 A;  2E1M B;  4KN4 X;  4YXW A;  5J4V A;  1GVH A;  1LNW A;  2VQC A;  3OL3 A;  3Q6R A;  1TQP A;  1XPX A;  3LMM A;  4AU7 A;  3DV8 A;  3LWF A;  2UUZ A;  3KZY A;  1R00 A;  3H5A A;  2DQR A;  3OIQ A;  1GV5 A;  1MBK A;  1UFM A;  3K4B A;  4G6D A;  3RY8 A;  4FX4 A;  2K9Q A;  4KMF A;  2BGJ A;  1ZGJ A;  2WJV A;  3K70 C;  2LRE A;  2VN2 A;  1X3Z B;  3TH0 A;  3K1M A;  4E4H A;  3VOD A;  3ZMV A;  3A01 A;  4EMS A;  1SD5 A;  2EBI A;  4U0W A;  3RYR A;  4U0V A;  2UVF A;  1R71 A;  4PAB A;  1ZK8 A;  1NG6 A;  1SC7 A;  1VQN I;  1DGR M;  4PC6 A;  2C5H A;  4YZA A;  1B9M A;  1ETK A;  2A05 A;  5JR3 A;  4BUP A;  3HOX J;  5B5E C;  3JRC A;  4UY8 I;  5HOD A;  2FBK A;  1UJ8 A;  2O04 A;  3C2G A;  5LD2 C;  1ZM2 A;  1MSF C;  1JXS A;  3H9Q A;  2EWE A;  2NTP A;  5DSZ A;  1TUI A;  2BBY A;  4LG0 A;  1SVM A;  2X6O A;  1A31 A;  4XKV A;  5IYD J;  1LFB A;  3OYK A;  3WWG A;  3CLO A;  2LKX A;  5K1Y A;  2DA5 A;  1JT0 A;  2QEX B;  3A0B C;  5F0C A;  1FC3 A;  2LSO A;  2F5V A;  4FK8 A;  2VZL A;  3IRQ A;  4P12 A;  4RB2 C;  3G71 B;  3JR9 A;  2XB5 A;  2DT6 A;  3I0T A;  3R60 A;  4LG3 A;  4LBW A;  3VSK A;  1QCX A;  2L7K A;  3OOC A;  4URR A;  4BS9 A;  4XRS A;  3SDB A;  5FJ8 J;  1G4D A;  4KH3 A;  1ZRC A;  1FTT A;  1DAR A;  1EV7 A;  2KKO A;  4MTD A;  2VFP A;  4BE0 A;  2GXA A;  3I4P A;  2COB A;  2FSW A;  3GTJ J;  5HKK A;  1LM1 A;  4XKW A;  4FE7 A;  4IHS A;  4UV9 A;  3G73 A;  1PKV A;  5DUI A;  4A0Y A;  3X2Q H;  3U21 A;  1KTW A;  1T38 A;  3GFJ A;  3AVY A;  3NE5 B;  2DQL A;  2R7R A;  3D1N I;  2PI0 A;  1WTH D;  1BJZ A;  1E3Z A;  2HQN A;  1YW9 A;  2EJR A;  2X0L A;  3PIO F;  1OGJ A;  3H5R A;  2W48 A;  5H20 A;  4RS8 A;  1WKM A;  3G6E B;  1WSR A;  3CC7 I;  5DD8 A;  2RC6 A;  2CF4 A;  4N4O B;  2ZME B;  4RLZ A;  1ETY A;  1IUY A;  2ZZE A;  5D5U B;  3MN2 A;  3PSF A;  1WWX A;  3BTL A;  4HW0 A;  3R6S A;  3DFG A;  3HZJ A;  4QLC U;  4IX7 A;  3RPU D;  3I5U A;  4WZE A;  2LKS A;  2QSF X;  2XGC A;  3DBL B;  3JRI A;  1AIP A;  3ABK H;  3LQE A;  3LNN A;  1QJV A;  1IUF A;  4YIF A;  5D5W B;  1A5J A;  4JOM A;  4B09 A;  3VSU A;  1KQ0 A;  1JJ2 B;  4B44 A;  3WBJ A;  5D4S A;  5E8I A;  1N25 A;  3UW0 A;  4OPW A;  4X0C A;  2DEU A;  1W35 A;  5AN9 A;  1DP7 P;  1AIR A;  2H8W A;  2XPV A;  3S3N A;  2XDV A;  3SYT A;  3OYA A;  2F48 A;  3E6B A;  5K5Q A;  3FIW A;  1ON2 A;  1BOA A;  3Q0W A;  5D8K B;  4YAF A;  4P6V F;  5H59 A;  4CCL A;  3PQJ A;  4YZX A;  3RIQ A;  3D5L A;  4X8I A;  5LFA A;  2CU7 A;  3H0D A;  2CUF A;  2AS5 F;  1P2F A;  2Q6L A;  3HB9 A;  4PJN A;  4XLA A;  3VWB A;  5GAG J;  2A5W A;  1O4X A;  2JN9 A;  2VJ4 A;  5DV5 A;  3ASQ A;  2K9L A;  2J7K A;  3JAM Z;  2HWV A;  4M72 A;  4C43 A;  4A6E A;  2R6H A;  2M2E A;  1WXR A;  4HQE A;  1YRN A;  2CRV A;  3E7L A;  1O7F A;  3FJO A;  2V7Q A;  2ECC A;  1IO2 A;  1S72 B;  2QN6 A;  3SQV A;  3VSV A;  1MJB A;  5CYV A;  4BHP A;  2JA7 J;  1QFZ A;  3ZPN A;  3S15 J;  4OJL A;  3FMS A;  2GAU A;  2BW3 B;  1OPC A;  4MQ9 F;  4C2M J;  2VOP A;  2KZG A;  5H6R A;  3BY2 A;  4HZF A;  4ITV A;  1TVC A;  3AGQ A;  1T08 B;  2P7V B;  1WPK A;  1HKT A;  4RD1 A;  2XV4 S;  3B73 A;  1KQ9 A;  1N77 A;  5M3M J;  3L2U A;  3H1C A;  1IRF A;  4I7H A;  5HLT A;  3WTS C;  5JLV C;  3HTU A;  4OZY A;  3M8E A;  4KN7 X;  3TQN A;  4C2U A;  1GXP A;  1JKO C;  1KCD A;  3SQN A;  1JTY A;  4ZYH A;  3QOD A;  3QOE A;  2E1N A;  3ZMD A;  1S72 I;  2HXI A;  1OLT A;  2JA5 J;  2MW8 A;  1I6X A;  3RJP A;  3OY9 A;  1CQT A;  2PMD A;  1VQN B;  3W5H A;  2HKO A;  2FQ3 A;  5J6X A;  2LD5 A;  1G3T A;  4NCN A;  1I3A A;  3LFK A;  1B72 A;  4XQF A;  4CCJ A;  4XKC A;  2EA2 A;  1O8L A;  3C18 A;  5AIP A;  5ED4 A;  4X1E A;  2DCU A;  3UKG A;  3GVA A;  4XLN F;  4M9X A;  1OHH A;  3WNB A;  2FU4 A;  2W7N A;  1UST A;  4F93 B;  2NT6 A;  3G71 I;  3BG6 A;  3GQA A;  4QVJ A;  2KJB A;  3H3Z A;  3I4M J;  4PC3 A;  2O6G E;  1T6X A;  1T6Z A;  3JTG A;  4GDF A;  1WJC A;  5DEQ A;  2WB1 A;  1R5H A;  2K86 A;  3OZW A;  2P5K A;  4OJ5 A;  5CVJ A;  5F0H A;  3G4S I;  1NB9 A;  1CLW A;  5FO1 A;  3BZ6 A;  1H42 A;  3RTR A;  3J80 Z;  3J7Y J;  4P55 A;  3CRZ A;  4CCM A;  1G7T A;  4X7C A;  3BTI A;  4MLO A;  2IOU G;  1NHC A;  1JUS A;  3EQO A;  1XS9 A;  1COW A;  2D3L A;  3JRA A;  3ZQC A;  2EK5 A;  4P2N A;  4B3X A;  3HOV J;  3F0C A;  2V1N A;  3FK6 A;  4IRH A;  2V7T A;  3L2C A;  3HG9 A;  5IOY A;  2XNC A;  4BJT A;  2TRT A;  4L5E A;  2KT0 A;  2A6T A;  5L3G A;  4H0E A;  2HYJ A;  2JIZ A;  2E36 A;  3F8B A;  3SZE A;  2P4W A;  3FXR A;  1SFU A;  1TL8 A;  2LH9 A;  2OZ6 A;  5GPA A;  2EV0 A;  4DYC A;  3MZH A;  4H9G A;  3DEE A;  1FND A;  1YJ9 I;  5H5J A;  4ABZ A;  1RMG A;  1OCZ H;  2GRE A;  1ZM4 A;  1NK2 P;  1KCC A;  3IH3 A;  1NB0 A;  2KVO A;  3G1L A;  2QKM B;  5DDG A;  3GVK A;  3PUM A;  2Z9O A;  2DAO A;  5FKM A;  1WOR A;  3SJP A;  3WY9 A;  3IH2 A;  1N8R D;  1BMF A;  1GXQ A;  3IWF A;  2CWE A;  1O8F A;  4TT3 A;  1WRJ A;  2IPQ X;  5H2F C;  1UHW A;  2DU9 A;  4D7M A;  3WTT C;  5GPC A;  4OPV A;  3ELK A;  1MBJ A;  1LEA A;  1VND A;  1BC8 C;  2EZK A;  2V7V A;  3V7S A;  4KMU X;  4HAM A;  3PO2 J;  3OJX A;  3B6A A;  1Z1D A;  1TNT A;  2W57 A;  4XL9 A;  2DFF A;  3PA1 A;  1Z7U A;  2Q6I A;  3QAH A;  1MSE C;  1BN5 A;  3F21 A;  1YHQ I;  2ZME A;  5F4O A;  4ZDL A;  3BCD A;  1T0F A;  2Y30 A;  2DMN A;  2KL4 A;  4M73 A;  2AO9 A;  3WU2 C;  1O8E A;  4ZGQ B;  2F5F A;  3HSR A;  4ENK A;  3U6K A;  2WWY A;  2JZY A;  4YFO A;  3ISP A;  4B48 A;  3OYN A;  2XSD C;  2CSO A;  3HOT A;  2XGD A;  5IP7 J;  5E17 F;  2QX3 A;  5HDG A;  4WZL A;  1U9N A;  3ZMS A;  2CBX A;  3P4G A;  4G6I A;  1PVE A;  2L9V A;  4G6T B;  2STW A;  3HKZ A;  1F1Z A;  1LVA A;  4MQV A;  5F4M A;  2FXA A;  5DTD A;  2WA0 A;  3V7C A;  4M4S A;  4P6Y A;  2P8T A;  2EFW A;  3S2W A;  2V1U A;  1ZAO A;  2ZNZ A;  5HS7 A;  4HX8 A;  3WU0 A;  4FN5 A;  5C1C A;  3C1D A;  1ETW A;  2QXZ A;  4I2O A;  3TBI A;  2DA1 A;  3MEX A;  3SYJ A;  4IQJ A;  3VMW A;  4P9U A;  2EIX A;  3QRF F;  1PJ5 A;  4JBA A;  1SFO J;  1SEU A;  1YHQ B;  1Q86 D;  1OCR H;  3FM5 A;  1ZGA A;  3PUF A;  1IN6 A;  3KP7 A;  3ZOB A;  3W2H A;  4W1U A;  2O9L A;  4HEA 2;  3KEO A;  1UAA A;  1WJE A;  1Q7Y D;  2VFN A;  1OGI A;  1BI1 A;  3QPT A;  3VYR B;  3ZQG A;  3AVW A;  2DA7 A;  2IS2 A;  1XGS A;  3EUA A;  3CCV B;  1MIJ A;  2HOA A;  4ETS A;  1LB2 A;  3L2V A;  2QSH X;  1ZRE A;  1O8M A;  1KYZ A;  1WJF A;  3AL0 C;  5LHH A;  5EJC A;  5J40 A;  2CO5 A;  3ZQI A;  1B4A A;  4M74 A;  2DI3 A;  1XB4 A;  1Y1W J;  3P9K A;  1FOW A;  4Y33 A;  3S3O A;  4MEX F;  3JQR A;  1RNL A;  3B8H A;  4G9Y A;  1DAB A;  1DBG A;  4WCG A;  4WZK A;  3MD2 A;  2DK5 A;  2O0Y A;  1SFE A;  1F43 A;  2MGQ A;  1VQ4 B;  4LG0 B;  5IYB J;  3ZZU A;  3JUR A;  4EM0 B;  3RKW A;  2O0V A;  5KCM A;  1N78 A;  1PUF B;  1I6H J;  1HF2 A;  3WG7 H;  1W1W E;  3RQ4 A;  1IV6 A;  2DY1 A;  2HOS A;  3OJW A;  1TLH B;  4CYC A;  3OS1 A;  4ZJZ A;  4DIQ A;  1UG0 A;  4XIC A;  3IHU A;  5LLQ A;  3Q0U A;  2CUJ A;  4M6X A;  3JW4 A;  4HNU A;  5D6E A;  4YEI A;  4AIJ A;  3T8R A;  1ZN2 A;  3H9N A;  3OIO A;  1D8T A;  2EIN H;  1O8H A;  2YX7 A;  4GFB A;  1JKP C;  2L4A A;  2C4T A;  3BR5 A;  4FXU A;  4IEJ A;  4RD3 A;  2QQ9 A;  1FYL A;  1QVT A;  1YQA A;  2RQP A;  3GTQ J;  2QA4 I;  2DDB A;  4FWT A;  2CUZ A;  3K2A A;  2C5B A;  1RR7 A;  2ID3 A;  2FOK A;  2OYN A;  3A1Y A;  3DXJ F;  3N97 A;  3P9C A;  1TW3 A;  1UD8 A;  2M9H A;  2MH2 A;  2RDP A;  2V9P A;  1BW6 A;  2Y0M A;  2DYS H;  1TZL A;  3PUN A;  1A04 A;  3A2K A;  1OFD A;  3BPX A;  4ZYA A;  1D1B A;  3AG3 H;  3GTO J;  2J8K A;  1W7P D;  3Q6Q A;  2ESN A;  5IK2 A;  2GA2 A;  1KU9 A;  4P1W A;  2BM7 A;  5HNF A;  2PMZ A;  3PSI A;  3BR1 A;  3RZO J;  3CCL B;  1ETQ A;  2EH3 A;  4ASN A;  1J9I A;  3JU4 A;  2DTR A;  3VMV A;  3FDY A;  4XSZ F;  3OYG A;  1OYY A;  3AAF A;  4RMN A;  4BBS J;  4CUG A;  4U0Y A;  3HIF A;  1VLY A;  4RPD A;  4YFN F;  2R3S A;  4UXN A;  5FKN A;  2QTZ A;  1WH7 A;  1E17 A;  2DCE A;  2QVO A;  1PJR A;  2WJY A;  1W4M A;  3QFT A;  2EIM H;  1HCR A;  2JJ1 A;  4K2E A;  3DPT A;  4N3N A;  3LAP A;  1YLF A;  1U6G A;  5DD4 A;  1OB2 A;  4L0Y B;  2ZBU A;  1STZ A;  3G4S B;  1HDP A;  4PFP A;  4LLN A;  1XTA A;  4A3I J;  4RDL A;  2MD0 A;  5FNZ A;  2ISY A;  2NRA C;  1EF4 A;  1R9T J;  3AFH A;  3CDH A;  2X0K A;  3GRH A;  4JRA C;  3CF5 F;  3NWT A;  1B9N A;  2IS4 A;  1XSV A;  2XGE A;  4BGD A;  4OOX A;  4UAJ A;  2KIM A;  1SD4 A;  3ABM H;  4MTE A;  3GX4 X;  3CCM I;  1RQR A;  4W8Q A;  2R7F A;  4YEL A;  2DMT A;  1SFK A;  4EJO A;  2X6Y A;  5J1Y A;  2DXI A;  4TMZ A;  3CO6 C;  4V2F A;  1TQI A;  1WOP A;  2F43 A;  5BSX A;  1MBG A;  3I53 A;  3J80 K;  5J1U A;  3S32 A;  1WSU A;  1W0T A;  4HBL A;  3MHP A;  2HDC A;  3ML6 A;  1BJA A;  4KT6 A;  1HKS A;  2OF7 A;  3HOY J;  1ZHF A;  3AK5 A;  1W34 A;  1V55 H;  3IUO A;  3A8I A;  3SLN A;  5ILU A;  1XE1 A;  5LGU A;  4UB6 C;  1TYX A;  2NSP A;  3PL8 A;  1XCB A;  4Z4W A;  1O8D A;  2CQN A;  3AG4 H;  1Y56 A;  3E20 A;  1USS A;  4P3Y A;  4WX9 A;  4TN1 A;  3Q9V A;  3ZIA A;  3MVP A;  5KAF C;  5K7Z A;  3BPV A;  3DLL F;  4OJ6 A;  4TV7 A;  3D0S A;  2FOW A;  4YHB A;  1H0M A;  3SFZ A;  4Q47 A;  4Y13 A;  2E1C A;  4ASU A;  1PLU A;  4E7J A;  2FNA A;  3O6B B;  2OBR A;  1FMV A;  2VPR A;  2G7H A;  1W0K A;  3S1R J;  3GCM A;  3BNW A;  3LOC A;  4KIC A;  1F20 A;  4OMY A;  2RAE A;  3RSN A;  2F1M A;  1QA6 A;  2Z1D A;  1MMN A;  2QGG A;  3TOA A;  3SJZ A;  2X6X A;  2FD5 A;  4A5N A;  1VLO A;  3ZPP A;  3FXM A;  1T98 A;  5BNG A;  3NEU A;  1ENH A;  2F5E A;  3BT9 A;  3LST A;  4WXH A;  1OFE A;  4ZYD A;  3ML3 A;  1HXD A;  2HTS A;  2XF5 A;  4AD9 A;  1DDN A;  4PGO A;  2NAZ A;  4YCQ A;  3EDP A;  1MW7 A;  2L02 A;  2C6Y A;  3H0G J;  1LLZ A;  3SZT A;  4O5V A;  2GJP A;  3WHC A;  1TQM A;  2VBV A;  2IA2 A;  3V8J A;  1X3U A;  2D1H A;  1HW1 A;  3N6Z A;  2HZD A;  4Z06 A;  4P96 A;  4Q4Z F;  4W8S A;  2Z8G A;  4W8T A;  2KIF A;  1AHD P;  3BTC A;  2KP6 A;  2JJ7 A;  5EG0 A;  1TWG J; 
#chains in the Genus database with same CATH homology
 3PNY A;  1NG6 A;  2E60 A;  3OEH A;  1DGR M;  4H4K C;  4GRI A;  4YZA A;  4NC7 A;  4BUP A;  2V4J C;  3BCF A;  3W2A A;  5FL7 A;  1OFL A;  3C2G A;  2W1O A;  5LD2 C;  3HOS A;  4XN0 A;  3H9Q A;  3S3M A;  2GJK A;  2EWE A;  3OFN A;  2NTP A;  2X85 A;  1PYV A;  1V5F A;  4CCK A;  2WY8 Q;  1X0C A;  4XKV A;  2GOM A;  2XND A;  3OYK A;  3WWG A;  2M4K A;  3D5S C;  2XZO A;  2O04 A;  2LYC A;  4BQO A;  2VPL A;  2F5V A;  4NNJ A;  1BN8 A;  2R7S A;  3G2B A;  3OW7 A;  1QHG A;  2JSP A;  2BVL A;  2VKH A;  2DT6 A;  1DGW Y;  3NWS A;  2WAQ A;  4LG3 A;  3VSK A;  3AKZ A;  1K6Y A;  4IKF A;  2L7K A;  5FRN A;  3OOC A;  1QCX A;  3ZSC A;  4URR A;  1BPL A;  4BS9 A;  3SDB A;  4XOT A;  3CJR B;  2W00 A;  2L9N A;  2V26 A;  4BE0 A;  3BCB A;  3TL4 X;  1E0E A;  2VQG A;  2LG4 A;  5HKK A;  4XKW A;  2W82 A;  2WBM A;  3ONQ A;  4XOR A;  5CPR B;  1PKV A;  4OZZ A;  4E6K G;  3OE7 A;  2CV0 A;  4LIV A;  3U21 A;  2GK7 A;  1D1C A;  2CW7 A;  4B3F X;  1BOB A;  1KTW A;  2E5Z A;  3OMY A;  3NE5 B;  4G7W A;  2R7R A;  4ZDP A;  3PNT A;  1WTH D;  1E3Z A;  2R9V A;  3MMY B;  4F92 B;  5HOO A;  4BAC A;  3H5R A;  1HZE A;  3LSK A;  2XZL A;  3VDX A;  4CH7 A;  3OYD A;  4KKS A;  2XGJ A;  4N4O B;  1Z3X A;  4BDY A;  4PFO A;  4ZTJ A;  4U49 A;  4CCO A;  1O8J A;  2ZTN A;  2ZZE A;  1X4O A;  3PSF A;  3KYL A;  4BE2 A;  4IX7 A;  3RPU D;  4UZU A;  3ZGK A;  1QJV A;  2HVR A;  2ZZG A;  3DQV C;  3HUG B;  3LNN A;  4BEH A;  4XLF A;  4JOM A;  2PYG A;  3VSU A;  4B44 A;  1EFR A;  4BEH B;  4F91 B;  4HG2 A;  2Z6B D;  3K4J A;  1T5E A;  4II2 A;  1S9H A;  4IZZ A;  1QHH D;  3DU5 A;  3UW0 A;  4C2T A;  3LSH A;  4XLH A;  3L2R A;  3GVJ A;  1AIR A;  3S3N A;  4Z03 A;  2LY2 A;  4I84 A;  1LDK B;  2XDV A;  3SYT A;  3OYA A;  4XON A;  4ZDO A;  3CZ6 A;  3EUH C;  3I3L A;  4CCL A;  4YZX A;  4BJ6 C;  4JMQ A;  1O8K A;  2R7T A;  3D5L A;  3DTE A;  1PE9 A;  5LFA A;  1I8D A;  3H0D A;  2JJ2 A;  4XN3 A;  4OJP A;  1BR1 A;  2GOX B;  4KIS A;  4E7H A;  4PJN A;  4XLA A;  4DJA A;  3VWB A;  2A5W A;  4PSX A;  2VJ4 A;  5KNL A;  2K9L A;  3MKW B;  3A35 A;  2K9M A;  2WAD A;  2Q1Z B;  2ZFU A;  5FRO A;  2WZP P;  4HWV A;  2X1D A;  1PXZ A;  2L5Q A;  1MNE A;  2HVQ A;  4DOZ A;  3VYT B;  2ZXI A;  2V7Q A;  3VSV A;  2V9K A;  1OB0 A;  2L2O A;  3LL7 A;  3KRG A;  3CMM A;  4E7S A;  2RQQ A;  2PJR B;  3ZPN A;  4OJL A;  2IQ7 A;  3H9J A;  2L9S A;  2BW3 B;  2PJR A;  4HRI A;  3F9K A;  2VQH A;  4ITV A;  2R7O A;  3IAM 2;  4II3 A;  3MKZ A;  2W6I A;  2MFZ A;  4PJJ A;  3OYE A;  1SAU A;  1T0F C;  2KPM A;  1V0F A;  3OYM A;  1N77 A;  4EW9 A;  3OPO A;  3L2U A;  1D0X A;  2IXS A;  4E7K A;  5HLT A;  3GQ7 A;  2FUG 2;  4OZY A;  2E5N A;  4C2U A;  4ANJ A;  1KCD A;  2RRE A;  2CW8 A;  2VQL A;  3W3C A;  3QOD A;  3QOE A;  5CQG A;  1WJD A;  2LBF B;  3OYC A;  1OLT A;  2Q2E B;  3OY9 A;  4KKU A;  2X6W A;  3H9G A;  1X1D A;  1W36 C;  2VBE A;  2XZP A;  4XLC A;  1HG8 A;  3GQ8 A;  3OIP A;  1E43 A;  2HPI A;  3OS2 A;  3OYJ A;  1D1A A;  2OC6 A;  4XQF A;  4CCJ A;  4XKC A;  1O8G A;  2VBM A;  2WPD A;  3LSM A;  5FRM A;  4MR0 A;  1O8L A;  3B4N A;  4BE1 A;  1UD2 A;  3UNG C;  2PYH A;  3DPL C;  3V42 A;  1OHH A;  4TSF A;  3HPG A;  2VKD A;  3C2H A;  2DJI A;  4B47 A;  4Z1M A;  4E0F A;  2W7N A;  1K28 D;  4F93 B;  2NOJ B;  2NT6 A;  2Y0S A;  3BG6 A;  3OEE A;  2X3H A;  1G8X A;  3GQA A;  2X51 A;  2R7W A;  1UD4 A;  1OGO X;  1EE6 A;  4BDZ A;  1WJC A;  2GK6 A;  1DBO A;  2WB1 A;  4Z05 A;  2QKL B;  4OJ5 A;  1IRX A;  2OV7 A;  1LVK A;  4IQ4 A;  1Y6I A;  2HLD A;  3RTR A;  2M0M A;  2E1B A;  3LSI A;  1WJ5 A;  4PK4 A;  2LY1 A;  1Z3Y A;  2XF6 A;  4CCM A;  4F55 A;  1CZF A;  4MLO A;  2UVE A;  1V5G A;  1WJA A;  2O0W A;  1NHC A;  2M7B A;  4YRV A;  1WMR A;  1JTA A;  3EQO A;  1COW A;  4NK8 A;  2D3L A;  2ZZF A;  4G7X A;  3ZQQ A;  1JI8 A;  1VZ0 A;  2R7V A;  3IP4 B;  2X8K A;  4B3X A;  4OJO A;  2CFO A;  2V1N A;  3GBG A;  3T56 B;  3HG9 A;  2JDI A;  3GQ9 A;  3FKJ A;  4BJT A;  2JIZ A;  2WAE A;  2A6T A;  2VBK A;  4NC8 A;  2HVS A;  3E1S A;  2LH9 A;  2AQE A;  3K6G A;  3DEE A;  4PMH A;  1AA7 A;  3PUB A;  2M7A A;  3T53 B;  2LC2 A;  1RMG A;  1X1C A;  1E3X A;  2KRC A;  4N4N B;  5AMV A;  1KCC A;  3VYS B;  3EUK L;  2KVO A;  2QKM B;  1YX5 A;  2RNG A;  3GVK A;  1V5E A;  1YX3 A;  1W0J A;  1X1A A;  2CS3 A;  2F4I A;  2MAB A;  4E7Z A;  2X1E A;  1BMF A;  4D9J A;  5CDF A;  1O8F A;  4TT3 A;  3L2W A;  4BQQ A;  3AL0 B;  1D0Y A;  2UV1 A;  3CF2 A;  1VBL A;  2VJ5 A;  5C1E A;  1UD3 A;  5CQE A;  3OS0 A;  3VYU B;  3ZCO A;  3DKX A;  4XKB A;  2ZTG A;  3DPU A;  3K4C A;  2KZV A;  4XL9 A;  3HAG A;  2ZXH A;  1X19 A;  2IGO A;  1N75 A;  4J01 A;  3OL4 A;  1GLN A;  4ZDL A;  2Z2S B;  2VL8 A;  4YEJ A;  3BCD A;  2HPM A;  2KL4 A;  1O8E A;  4DBR A;  3D5R C;  1HVX A;  3K4L A;  4PUS A;  2M5S A;  1TT0 A;  4B48 A;  2R7X A;  2KDO A;  3OYN A;  4GQN A;  2AQF A;  3HOT A;  2P0W A;  4RM3 A;  2QX3 A;  2NST A;  1YE9 A;  3PJR A;  3OR1 C;  1OR7 C;  3KEW A;  2HDW A;  1W9X A;  4QPO A;  3SZG A;  4G6T B;  4G6I A;  4BJ5 C;  4X0G A;  3HKZ A;  3LFU A;  4XLE A;  5KHD A;  3K4K A;  5HNH A;  3OYF A;  4BL0 B;  1WP6 A;  2WA0 A;  1MMA A;  3M8J A;  5C1C A;  2QXZ A;  2W4S A;  2HU9 A;  3TBI A;  3EPZ A;  2ELJ A;  4RLQ A;  4IQJ A;  3VMW A;  3W2W A;  2M3A A;  1OFM A;  3A4C A;  2IGN A;  3CJQ B;  1O88 A;  3B8Y A;  4J00 A;  3BH4 A;  4EAT A;  4L8J A;  3ZR8 X;  4E7I A;  3CP8 A;  1OGM X;  3H35 A;  4HEA 2;  3E0J B;  1WJE A;  1UAA A;  3K4N A;  4HPQ A;  2F6C A;  2K5C A;  3VYR B;  3H94 A;  3N05 A;  4P22 A;  2IS2 A;  3SEZ A;  3EUA A;  1I18 A;  1UEL B;  3G05 A;  4TKO B;  3L2V A;  3T51 B;  1OOC A;  3DTK A;  1QU3 A;  2INV A;  1O8M A;  1WJF A;  3AL0 C;  2UWM A;  3EQN A;  4DBQ A;  4BU2 A;  3A3B A;  2BVM A;  3SEQ A;  4U87 A;  3OAA A;  4HSR A;  1BR4 A;  3WQZ A;  4DGW B;  4AYB A;  4NK6 A;  2QY1 A;  3QYB A;  5JHF A;  4R79 A;  2LOO A;  3RCO A;  4Y33 A;  5HVQ C;  3S3O A;  5DN6 A;  3SUC A;  1DBG A;  1EA3 A;  3MD2 A;  2V7F A;  3DKY A;  4KJZ A;  3OYI A;  2DOA A;  2LZJ A;  4HIZ A;  1R6R A;  4U4B A;  3HXL A;  4OAY A;  3CP2 A;  4RLF A;  3JUR A;  2O0V A;  5KCM A;  1N78 A;  2R7U A;  2XC7 A;  1H8E A;  2M4G A;  4NQW B;  3RQ4 A;  2IGK A;  3OYH A;  2CV2 A;  4OAZ A;  1FX0 A;  4W8R A;  3OS1 A;  4ZJZ A;  1Z21 A;  1JRG A;  4DIQ A;  4DK0 A;  1UG0 A;  3IAS 2;  2NTQ A;  4CA0 A;  2D3N A;  1E1R A;  2CUJ A;  4C30 A;  4HNU A;  2VXD A;  1P9Q C;  3BG7 A;  3DDY A;  3DTI A;  1O8H A;  4P5O A;  1SKY B;  4FXU A;  2XAU A;  2DIE A;  2VB6 A;  3DWL E;  1WPC A;  3S8P A;  1V0E A;  4PJL A;  3K70 D;  1FMW A;  2CUZ A;  4XMY A;  3MKY B;  1MAB A;  2MYS A;  2ZSH B;  3T9G A;  3QYE A;  4Y3O A;  3A1Y A;  1KON A;  1E1Q A;  3KEY A;  2OUM A;  4XM3 A;  1UD8 A;  2IS1 A;  4PJM A;  4FAS D;  2PEC A;  3VST A;  1WFX A;  1H8H A;  1TZL A;  3OYL A;  1BR2 A;  3A2K A;  2GJR A;  4ZYA A;  1GQ8 A;  2R7Q A;  2O17 A;  1IA5 A;  4XOP A;  1D1B A;  3HC7 A;  3OWT A;  5IK2 A;  1IDK A;  3DU6 A;  3FPP A;  4P1W A;  1HA8 A;  1BLI A;  4DNR B;  2CMP A;  5HNF A;  1U0J A;  2IS6 A;  1MND A;  2PMZ A;  3PSI A;  3FHN A;  3HL2 A;  3GVL A;  1X1B A;  3BLY A;  2ZZQ A;  4LIU A;  3JU4 A;  3VMV A;  3FDY A;  3OYB A;  3OYG A;  3J7A Y;  1ZEL A;  2KLO A;  2XSJ C;  4RMN A;  4CUG A;  2JVG A;  1VLY A;  2VJJ A;  1VF7 A;  2X53 S;  4YZQ A;  2DCE A;  2WJY A;  1PJR A;  2VXZ A;  2ZSI B;  4PSW A;  2LRD A;  2JJ1 A;  1X4P A;  3DPT A;  3OR2 C;  4D1Q A;  2JA2 A;  4PFP A;  2MD0 A;  3LSG A;  2BW3 A;  5CKT A;  1UD6 A;  3BCA A;  2E1M C;  2JVH A;  3AFH A;  2XOK A;  3L2Q A;  2VIX A;  3LMW A;  3ZXS A;  3GRH A;  1IB4 A;  5TGT A;  3NWT A;  4DNT B;  1DQU A;  2IS4 A;  3K10 A;  4OWR B;  3KX2 A;  3FY3 A;  4BGD A;  2NTB A;  2V31 A;  1XG2 A;  3FBI B;  4F52 A;  4W8Q A;  4YEL A;  1SFK A;  2WSS A;  1D0Z A;  2X6Y A;  2DXI A;  4FET A;  2LBF A;  4ZC3 A;  4CCN A;  2X1C A;  3HPH A;  3OOU A;  2F43 A;  2KQR A;  2VJI A;  4HST A;  4LIT A;  1E79 A;  3FBN B;  2NZM A;  3M1C A;  1MMD A;  1MMG A;  4KIT B;  2ODL A;  3QYF A;  1Z7L A;  3S32 A;  2HQA A;  3PFY A;  3UR3 C;  3DLA A;  2VLA A;  1DP3 A;  2BSP A;  4KKT A;  2HNH A;  4QPQ A;  1KMH A;  2W6J A;  2O1D A;  4KT6 A;  1BHE A;  3PNV A;  3IUO A;  4AVZ A;  2DT7 B;  1IDJ A;  2WAF A;  1H80 A;  4CSW A;  3W2V A;  1WJB A;  3BC8 A;  4C9Y A;  3PL8 A;  4ZTF A;  1UD5 A;  3FKS A;  1O8D A;  2NSP A;  4XD7 A;  1Y56 A;  3I9V 2;  2NT9 A;  2I8D A;  3ZIA A;  4C2L A;  3CES A;  2K3P A;  4OJ6 A;  1PLU A;  2IGM A;  2JUG A;  4ASU A;  2V6E A;  2KRH A;  2BOL A;  4E7J A;  2Z16 A;  4RM2 A;  2WY7 Q;  2MC4 A;  1FMV A;  1G59 A;  1LFP A;  1ERD A;  1W0K A;  4HNT A;  1O8I A;  3GQB A;  2KHM A;  4F3Q A;  1VJS A;  2CK3 A;  4XR6 A;  4B43 A;  1LKX A;  3RSN A;  2KMU A;  4MXN A;  2F1M A;  4CZC A;  2Z1D A;  1MMN A;  1W36 D;  2V4D A;  2X6X A;  4BXF A;  4U7B A;  1KZL A;  3B90 A;  3H5N A;  3S93 A;  2XF7 A;  3ZPP A;  2E1M B;  3ZRG A;  4YXW A;  2CH0 A;  2CV1 A;  3VR6 A;  2VQC A;  3OL3 A;  2R4G A;  4JQF A;  2XF5 A;  4DK1 A;  3LMM A;  4AU7 A;  1MW7 A;  1J09 A;  2UUZ A;  3A3G A;  1RWR A;  2INU A;  3H5A A;  3OIQ A;  3VSL A;  4YZ0 A;  3K4B A;  1T95 A;  2WJV A;  2GJP A;  1NRK A;  3K4M A;  3K70 C;  2QE7 A;  3BC9 A;  1K5C A;  2LRE A;  1NBM A;  4B3G A;  3TMO A;  2O5R A;  4NUB A;  4E4H A;  2HZD A;  2VAS A;  1RU4 A;  4E7L A;  4Z06 A;  4W8S A;  2UVF A;  4XNF A;  4BQN A;  2Z8G A;  4W8T A;  1NG7 A;  2KP6 A;  4Y4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...