4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
2O0VA 4YELA 2VBKA 4U49A 2VBMA 4EW9A 4XMYA 4MXNA 1IDJA 4XKWA 1K5CA 2NSPA 4I84A 2NTQA 4NK8A 3GRHA 1AIRA 1GQ8A 1IDKA 2O17A 2INUA 2UVEA 4YZQA 4XL9A 1CZFA 1JTAA 4Z03A 1BHEA 2PECA 4AVZA 2Z8GA 3T9GA 3B90A 2IQ7A 5AMVA 4XOPA 1O8FA 3ZPPA 4OZYA 1O8JA 4XN3A 2X6YA 4W8TA 1O8DA 1H80A 1OGMX 4W8RA 3SUCA 4U4BA 2VJIA 1PXZA 3VSTA 1X0CA 1IA5A 4URRA 4XORA 1KCDA 4W8QA 1KTWA 4MR0A 2NZMA 3B4NA 3GQAA 1XG2A 3FY3A 1PLUA 2NT6A 1VBLA 4XLHA 2NTPA 4XQFA 4XNFA 1O8KA 4OJLA 4Z05A 3WWGA 4OZZA 1WMRA 2EWEA 4W8SA 4HWVA 2INVA 4XM3A 2NSTA 4OJOA 2VJJA 4XOTA 2NT9A 1RWRA 4XLCA 3JURA 1PE9A 1IB4A 2PYGA 4OJ5A 4YZXA 4YEJA 2O04A 1O8IA 2QX3A 1OFMA 1HG8A 1NHCA 1QCXA 2X6WA 2PYHA 2VBEA 4PMHA 2QY1A 1JRGA 1O88A 4C2LA 4YZAA 4XLEA 2BSPA 3LMWA 4XLFA 1QJVA 3B8YA 1KCCA 3KRGA 2UVFA 3VSVA 4XKVA 3VMVA 4XLAA 2O1DA 4XR6A 4NK6A 4YZ0A 1BN8A 3GQ8A 4Z06A 4OJPA 3VMWA 2X85A 2ODLA 1O8EA 2X3HA 1RMGA 1OGOX 3GQ7A 3EQOA 3VSUA 5C1EA 1O8MA 2NTBA 1O8LA 1O8GA 4XONA 1DBGA 1EE6A 1O8HA 3UW0A 5C1CA 3EQNA 1OOCA 2QXZA 1RU4A 4OJ6A 1DBOA 4XN0A 3ZSCA 2O0WA 1OFLA 3GQ9A 2X6XA
chains in the Genus database with same CATH superfamily
3FKSA 1JGSA 2E71A 2K7LA 3BTLA 2YWFA 3W5UA 1VQ6B 1ZG5A 1TUIA 1UZCA 4EEFG 2DFFA 2W25A 4OM9A 3BTJA 4I6ZA 1DDIA 4OOSA 3DU6A 1GV5A 5F27A 2DY1A 3ZMUA 3GFIA 1U5TC 3ONUA 4U0VA 2IAIA 3CDIA 3MWMA 5F64A 1ZREA 1Y0YA 2K5CA 1SD5A 4E7JA 4KH3A 4OIPF 2PIAA 5HKKA 1EH7A 4XBFA 1YG2A 3SYTA 1XX5A 1G7CA 3ESWB 2DJNA 2FU4A 1EKEA 4WF2A 4WXCA 4BGDA 4DYCA 4A3GJ 3FXLA 3I71A 5LLQA 3GF2A 4CHUA 1GUUA 3WTVC 5AMVA 2RNJA 1ZTRA 3OIOA 5FO1A 1O3TA 2ZCWA 2NVTJ 1LEBA 3Q0UA 3GO5A 3KZYA 4TMWA 1DDGA 1QGAA 2NNYA 2V9VA 2R7UA 2M8EA 2CYYA 5ICEA 5FLXK 4TKOB 3GQBA 3ZZ0A 3P4GA 1PJ6A 3BR3A 4ACAA 3QYEA 4AIJA 1R49A 1N05A 2EV5A 1KYWA 3JW4A 4YFNF 2R7XA 3LNNA 3OYEA 3CUQC 1JKPC 4X7CA 3LWFA 2DMNA 2HDWA 3K2AA 1UMQA 4P6VF 1LDDA 3H92A 4RLZA 4RBOA 2WJVA 1D8JA 1LB2A 2Z1DA 4OPWA 3HL2A 1VQMI 4FXUA 2CF4A 1O8KA 1QUEA 3LSGA 4OZZA 2L9VA 3CCLI 3AGPA 1RKTA 3QU3A 1DG1G 2PMUA 3PSZA 3R0AA 2R0QC 5M5YJ 5GAHJ 1G59A 2VQLA 4BEHB 3PSIA 3U2QA 3HBLA 2I8DA 3OZWA 2NXNB 2YX4A 1B72B 1ETQA 2ZB9A 4M3DA 3KZZA 2GQFA 1REPC 1R1TA 4FE4A 2E7WA 3BJ6A 3FXUA 4IF4A 3HOTA 1O88A 1LDJA 4RB0A 2XT2A 2W24A 1R5BA 3F9KA 2ZXHA 4MO7A 1VQ5I 2QLZA 3E5UA 4V02C 3ABMH 3BR1A 3K70D 4I98B 3KRGA 1V55H 1X1AA 3SEJA 3VNUA 3B6AA 1SKQA 2Q8KA 2E2HJ 5HXBA 1N8RD 2JK3A 2GM4A 4FE7A 1YI2B 1S7AA 2F5EA 2RDPA 3HYIA 3K6GA 2MD0A 4RDUA 2P7CB 1HOMA 3A0HC 4F93B 4ZV4A 1I3AA 1ZLJA 1BW6A 5HODA 1TL8A 5IYRA 1XB2A 2XGDA 4ZCMA 3ZZTA 3ERMA 3ABUA 1E3PA 3OR1C 5DD4A 3BQYA 1B23P 1OYWA 1WJDA 1O8LA 3PFIA 3AGQA 5C1CA 3AG2H 1MBJA 3ROUA 4NC6A 4P5OA 1FX0A 1OOCA 1U9NA 4ZDOA 1K73D 1RU4A 3F8BA 4OJ6A 2JMWA 3VYRB 4LITA 5JLXA 2HYJA 1J59A 3Q6QA 2OTLB 2V7TA 2ZZEA 4G7XA 1YFHA 4IRGA 3M8EA 2K9NA 2R92J 1I8DA 5HZBA 1XDUA 1SANA 5E1XA 2M2EA 2B9SA 3A2KA 2QN6A 4FK8A 3OMYA 3T1BA 2DYSH 1HDPA 2F43A 3NAUA 4ZH4F 1BM9A 2KDZA 4NK8A 1MBEA 1W7PA 1Z3XA 2M5WA 4FETA 4XL9A 2ACJA 4P2NA 1SFEA 3V7AA 2MSYA 3W2FA 2VQHA 1YE9A 3V7CA 3DLAA 1U2WA 2CQKA 3I56B 4IL6C 3H9JA 2VNJA 4I0BA 1AOYA 2BYVE 2DBBA 5BPDA 1G7TA 2OK7A 4OZYA 2X0LA 1YJNI 2H6CA 4AYBA 2QTZA 3IAM2 3CUOA 3VO1A 1O8DA 2PBIA 2Y0SA 4HBLA 3F8FA 3GZNB 2LLKA 2W1OA 1EWYA 2X1DA 2EFNA 4F52A 3TDUC 5EEAA 3CQZJ 3H1CA 3LOCA 1MMAA 1OCTC 3W2HA 5D8LB 3KCCA 1E63A 1QZZA 2NAZA 4M3BA 3ZPLA 1W5CC 3LNQA 2L3DA 3OZVA 3BZ6A 1UB9A 4I09A 2M5SA 3LVBA 2NVXJ 1E1QA 3ZMSA 5H5JA 1XG2A 1S7EA 2XKOA 1S8NA 2QTLA 2LRDA 1D3YA 3J7ZI 5M3FJ 2MW8A 4MFDA 1ELOA 5IK2A 3RZDJ 4QTRA 3BG6A 3HPGA 1FP2A 3FPPA 3W5VA 3S1MJ 5CQEA 3MCAA 4LD5A 2JWTA 5H6QA 1UD6A 3OAAA 5E18F 1EP1B 3CCVB 5E3LA 4RCYA 4C30A 1ULYA 1QRYA 5HNFA 2O03A 4PJLA 1K6OA 4OJ5A 2NYXA 3IP4B 3LA7A 3HOZJ 1R4NB 3OFNA 1FPQA 3BG5A 4DOZA 2RC5A 2K4JA 1RZ4A 5ICCA 1QPMA 3I0TA 3GFMA 2PJRA 1DU6A 2E1BA 1K9MD 4Q4ZF 1ZR2A 3ZIAA 4XLEA 4Z6YA 1H88C 2DA5A 2NS7A 3SXYA 2CBXA 3R61A 3JRHA 2V7FA 4PJMA 2L4MA 3ZQIA 4X05A 4II2A 5KAFC 4Q5SF 2R3SA 2IA2A 4KITB 2PEXA 1QVGB 2JA6J 4XR6A 4PC7A 4HPQA 2E1RA 4CXFA 2Q6KA 3GQ8A 2WAQN 4HQEA 2BX6A 2CW0F 2DPUA 3WTWC 4RCZA 5DSZA 5ICFA 1OB0A 5H6RA 3JREA 2K02A 2R5YA 1Z7UA 2CU7A 3DTKA 1WORA 1U8BA 3K10A 4D5FA 1UHSA 2CW7A 4OOIA 2W6IA 3LFKA 1Y8QB 3ZOBA 3T56B 1KC8D 2DMQA 5BPIA 4U7BA 4L5IA 4CYCB 4J19A 1FMWA 2BVLA 3IAS2 5EZHA 2NVQJ 1B59A 2OA4A 5E6TA 1MBHA 1DBOA 1UJ8A 4PJJA 4XN0A 4NBSA 1YX5A 5LEJA 4FX4A 3QU6A 5KSWB 5JR3A 2WTEA 3ZBUA 3Q3SA 2PQ8A 3IKVA 5GV7A 2CMPA 4WZLA 2L5QA 3JRIA 2VC1A 2DERA 1WI3A 4J0QA 4LGWA 1U5TA 4LG0A 4A0YA 3LO8A 1VQ9I 1DPUA 3WU1B 4HAMA 3H5AA 4GYGA 1ZH5A 1FTTA 1U5TB 4LG0B 1W5SA 5B66C 4I84A 3J80Z 3FXMA 4B47A 3DPLC 1KQ5A 2GWRA 1JTAA 1VQ7B 5HZAA 1Z91A 4Z03A 3PIOF 1YS7A 2GA2A 3HOYJ 1RPWA 1VI0A 2DPDA 2AHOA 4PJ0C 1WP6A 1GR1A 2VBWA 5FB2A 5D4RA 4G7HF 4A2UA 2GK6A 4U9UA 2BMWA 1UHMA 2DI3A 1LEAA 3COAC 1T8IA 3F72A 3HGGA 2HTSA 2IS2A 2BY3A 3JTGA 3DKYA 4CQJA 1VF9A 2TRTA 4U4BA 1QHGA 2ZL6A 3JQPA 2ESHA 4TV7A 1W7PB 1WHUA 2HI3A 3G1LA 5H20A 2XHKA 3S3OA 4DJAA 3IWFA 2QEXB 5D6EA 1G3TA 4AC0A 1XE1A 1BMFA 3DCFA 2P8TA 2ZBKA 4ZZDA 4YRVA 3FMRA 1IF1A 5FJ8J 2QENA 1RC9A 1ZN2A 3VOEA 3VSLA 1J75A 3MZ8A 4P25A 3CRZA 2HKXA 4DGWB 4B43A 2RC4A 3MZHA 4M4SA 3PETA 4OJOA 4S05A 2R7QA 2V7VA 5F08A 3L9FA 4M9SA 5ILVA 2Y9ZA 4HIZA 4X7FA 2AHQA 3M3YJ 4BQQA 4NBQA 3I4NJ 4G7WA 3U6BA 1ETWA 2D1VA 4UV8A 1H8EA 2W82A 1GVDA 1RESA 4WQMA 1HG8A 5CYVA 1D8KA 1G3WA 1K7AA 2X6WA 3FF5A 1YLOA 4G1VA 1MNMC 1DGRM 1YX2A 2X3UA 3D0SA 3OPOA 4NCNA 4BAYA 3P26A 1FIAA 3FM5A 3TEDA 4N0BA 3LMWA 3IWZA 2WV0A 4RGSA 5H59A 3F6VA 2EJRA 3WODF 1IV6A 2PLYA 3JSPA 1IO2A 4CDGA 2GQQA 3HSFA 4XKVA 3LSHA 4Y15A 1V3FA 1ETXA 3HRSA 2J5OA 3WE3A 1VQPB 3JRCA 3TW7A 2OTJB 2O1DA 2DA4A 3OR2C 5F0CA 1I18A 1WXRA 2JUGA 4FQGA 3P5JA 4BKXA 1FJLA 2AS5F 4G94A 3U1KA 5HNHA 3WNCA 4FHTA 1RMGA 5BSXA 3H3UA 3UR3C 3L2CA 3H3VK 1FOXA 2C5BA 5HLGA 5F0HA 4KMFA 1YOVB 2K9SA 1EZGA 1ZR4A 5A2QK 3M9AA 4L18B 3SZPA 3S32A 4YFKF 4A3MJ 4A69C 2GZWA 4LBYA 3VPRA 1TWFJ 3BWGA 3FMQA 5AIPA 1T0FA 4MFEA 2ZJQF 5GP9A 3HOVJ 2O6WA 2EZIA 2VLAA 1XPXA 4XRMA 1VQ4I 1NRKA 5HDGA 1WTHD 4DK0A 1B8IA 2KVOA 4F91B 4YDTA 3DWLE 2Y0MA 4IEJA 2E1CA 3TP0A 3A01A 4HLYA 2COMA 2P81A 4ZYEA 2QUFA 2Y0SN 2QBYA 2CQXA 2B0RA 2HLDA 4W1UA 1BJZA 4R79A 1FEXA 4RAGA 3NQOA 4M73A 1STZA 2YUHA 4KT5C 2QQAA 1IDKA 1IN7A 4UB8C 1OYYA 1WFXA 4EM1A 3LSKA 2Y75A 1SVOA 2FNPA 3UNGC 3JRBA 2IOUG 1RIOH 3HDDA 5DUIA 4QLCU 1OISA 5F04A 4RGXA 3PQKA 1MGTA 3BDDA 2JN9A 2G7HA 3L2UA 2RREA 2ZMEA 1A31A 1OCCH 4RAFA 5GTHC 3BG3A 4HF1A 1BQEA 3AG1H 3T9GA 1WOPA 5F4JA 2VIXA 3LQ6A 4EVIA 1FOYA 4UUVA 1AA7A 1O8JA 1Z77A 2IGOA 3VFZA 2LKSA 1HXDA 3OEHA 3SLDA 1BI0A 1WJAA 3MKLA 1GAWA 3HSEA 3QPLA 3BCFA 3RY8A 3CCYA 4S0HB 1T08B 2PN6A 2HQNA 2R7TA 3SKBA 2A6EF 4A3DJ 1NTCA 4E70A 1D1AA 1RETA 1Z9CA 1YIJB 2LFBA 4E7KA 2D5VA 1KQ0A 3K1NA 4QUZA 3P9CA 3U21A 2QSGX 4CGZA 2ADUA 4PAAA 3DEUA 5L3GA 3D5SC 1OGJA 3T5XA 2ZFWA 5DEQA 5LBQA 5J1UA 2H8WA 1V0FA 1BIAA 1HW2A 4UZUA 3W2WA 2C4TA 3V42A 4WX9A 1Z7LA 2STWA 4RM3A 1PE9A 2EBIA 1ZG3A 1IAWA 2R7VA 2BM6A 3SJZA 1J7KA 1OR7A 2KFDA 3BJAA 1R00A 4UUSA 1EFRA 2F5CA 2EILH 4PFOA 5J8CA 5KNLA 2GIVA 2M30A 2EIMH 1HCRA 1N75A 3FX3A 3WG9A 1RR8C 2CNDA 3R6KA 1JGGA 1NHCA 4BQNA 4DZPA 4L0YB 4PMHA 3Q5FA 2BPOA 1USSA 3GVJA 4BBSJ 3EYYA 3KYDB 3CCRB 4TMVA 1CQXA 2VODA 2FE3A 2EFPA 3I53A 4LK1F 4ENNA 2LDUA 4QFMA 2ZO4A 5FLVA 1QQ1A 3WXMA 2W00A 4RGUA 1IXRC 1K8FA 3VSVA 2HVQA 2DMUA 2Q1ZB 1KK2A 2HGCA 2R7RA 4CCNA 3G4SB 2WV1A 1ZGJA 2DW4A 3T53B 4N3NA 3I5UA 1P92A 2DFIA 1VHOA 3MKWB 1GDTA 1ITYA 2BGCA 1AWCA 2Q6LA 2F4MB 4PJNA 2CJJA 3TQNA 1TBXA 1V5VA 2WAQA 2B0LA 4H4KC 3KIOA 1NJID 4KDPA 3VSKA 4IHSA 3F22A 2JA5J 1PYVA 3FMSA 1T39A 1H9TA 1KZLA 3CLQA 2ZZFA 3HG9A 1O8HA 1R5GA 2YU3A 3FM3A 3A3BA 3GEZA 5C44J 2G0YA 3HUGB 4TN1A 2F1MA 3SQNA 1VQ5B 2NRAC 3HUGA 1C0WA 2E1NA 1IJFA 4G7ZF 4Y52J 3CUQA 2A05A 4PGGA 2A69F 4KUMA 2WB1N 2DN0A 4WXHA 4DNCA 1K78A 1FLIA 4RD6A 1MMNA 1O57A 2JJ2A 3QFRA 3RI4A 3N4MA 4B4CA 4BJ5C 1DP3A 3KYLA 3UKGA 3C2HA 3K2ZA 5KAIC 1HVXA 2DOAA 1KGSA 2BGJA 2FA5A 3HIFA 3GTLJ 1GJRA 3I4PA 3E5QA 2M87A 1TSPA 2JJ7A 2WBMA 4D0PA 2D74A 1U9OA 2W57A 2MLKA 5EEGA 2GXBA 4M3FA 2XAJA 3TO9A 1WSVA 1LFBA 3VWBA 1B9MA 1JJ8C 2VE9A 4AWXB 2E5NA 4GXOA 2VN2A 3WGIA 1JE8A 1JTXA 1V5GA 2Z2SB 3B02A 4KNYA 2CW8A 3VODA 2DYRH 5HDKA 4GQNA 1IJWC 2DFEA 1TT5B 1XN7A 3ULQB 2VFOA 2KIMA 4HX8A 2M34A 1D5YA 1DDNA 1IRZA 5EMNA 3LAPA 3J7YJ 4WWCA 1JUPA 1V5EA 4ZDPA 1MH3A 1FWZA 3FWEA 1SEUA 1X1PA 4XKCA 5LD2C 2V5IA 2IRFG 3GQAA 5DM6F 1HKQA 5C3EJ 4G7OF 2X51A 3SZTA 1IUYA 4XLHA 2F5FA 3I1FA 1Q82D 1FNDA 1ZELA 2NTPA 5GADJ 3F8NA 5CDFA 4I01A 1QVFB 4KN4X 2Y30A 2VJJA 2FQ3A 2QYOA 3QP6A 3TO6A 3LL7A 1YHQI 2C77A 2O8KA 1IRGA 3AK5A 2K9MA 3LMMA 1VZ0A 3ZN0A 1XG1A 1YRNA 5IP9J 4IRHA 4IOAF 2FRHA 5AONA 1VQ6I 2FEZA 4AUXA 1D8TA 3PNTA 1BI1A 4X8IA 1I1GA 4AC9A 4WZKA 2OBSA 2NVYJ 2WPDA 3NWTA 2L7KA 4QWQA 4NNJA 5FKLA 4XRSG 5IYCJ 5K5RA 1IZ1A 3K4BA 2FNAA 5LGUA 3MKYB 1VQKI 1TW3A 2DCUA 1QA6A 2CG4A 3QP5A 3W6JB 5TR9A 2BM7A 4NK6A 4ZGQB 2C6YA 2B5OA 3GTKJ 1QGYA 4LMYA 2LY2A 4JQFA 3BZCA 4PC6A 4X07A 4A3LJ 2M7AA 5A89A 2BW3B 2FSWA 1BBYA 2LTPA 3IL2A 4CUGA 1OGOX 2V4JC 3WNBA 1QZEA 1QNTA 5L3DA 4B3AA 2DMTA 3Q38A 2ZNZA 1POGA 3FXOA 2BY0A 2W6JA 3BTCA 1B72A 1Z0XA 5E79C 2DOEA 2ZFUA 1FBSA 4KIBA 3TKYA 4BS9A 3CO7C 1QH0A 3RQIA 3A0BC 5B3SH 4EGYA 2HZTA 3DKWA 1J9IA 4CH7A 1H9GA 5ILSA 2YUSA 1VNDA 4HSRA 1COWA 3OWTA 2VFNA 3WTXC 1Y56A 2XEXA 2I5UA 3DBLB 3KX2A 1SVMA 2G9WA 4Y4RA 1FTZA 3BZKA 2ELKA 3OZUA 3A8JA 5K5OA 4XKWA 2EV6A 3W2IA 3WBKA 3BR2A 4RAYA 4A5MA 4FWTA 1FY7A 1QFYA 2IXSA 3V8JA 3GVLA 2WZPP 4MEXF 2OTLI 1JKRC 3WYAA 4E7IA 2JZYA 2A3SA 3NB2A 3FISA 1UD8A 2RNGA 1RRJA 4ZYGA 1VTNC 2R6HA 2ZZQA 1H85A 4RD0A 4I76A 3OYGA 4ASNA 2PMHA 1LFUP 2VONA 3ASQA 1G6NA 2AXTC 1W0TA 4L5JA 5TGTA 2CQNA 3ZQ7A 1QPIA 3Q0WA 3SLNA 2EB7A 2X6YA 5DD8A 2M7BA 2OF7A 2OK8A 2AXLA 3HEFA 3H0GJ 1QRBA 4G12A 3BT9A 1YI2I 1USTA 2X1EA 1W2BB 1BR4A 1SFXA 3TP3A 4OOXA 3SUCA 3AG3H 1HF2A 3V7SA 3BG7A 4W8QA 2XDVA 3L2QA 3WGHA 1GHCA 2ETHA 1R7JA 5IP6A 1IRXA 3W6KB 4EMSA 2K9QA 3GBGA 4ACBA 2A61A 4GRIA 1YIJI 2CV1A 1E0EA 1KTVA 1ODDA 1VBLA 5TJJA 4L8JA 3PIPF 2RN7A 5L3CA 2XPWA 1KYZA 3HKZA 3M8FA 3ML3A 4PFPA 2JPBA 1JT0A 1N78A 1EP3B 1TWGJ 2INVA 3QWLA 4Z4ZA 1ENHA 4G5GA 5HS8A 2PYGA 1QGZA 4RD4A 1BR2A 4YEJA 1MMDA 4XICA 2L02A 2XAGA 3P9KA 3D5RC 3J80K 3EDPA 3CJTB 4C43A 2CFXA 1MKMA 4AIDA 4WK8F 1YX3A 2BF4A 2HXIA 3B82A 2PYHA 2VBEA 2W48A 1I39A 3C18A 2XGCA 3HM5A 4HF0A 1P9QC 1WJBA 4IVNA 4LOCA 5FGMA 2UXXA 1KZHA 4CA0A 1KCCA 3ES9A 1FBQA 4YALA 1XDSA 1EH6A 1QA3A 2JPCA 3CPWB 1E79A 2XNDA 1KRHA 2L0KA 3JCUC 5TRDA 3HTSB 3KLNA 3IH2A 2XROA 3LSTA 2XUBA 1W5TA 1Z6RA 1WH5A 3BCBA 4N4OB 1ZRFA 3LQQA 1N08A 3CCMB 1KONA 2O0YA 4RJLA 5ICGA 1XGSA 3PNVA 1PKVA 2UV1A 1E64A 3L2RA 2DU9A 1H8AC 5D5VB 4E7HA 1JHFA 4N9HA 2XTWA 2YR2A 4RM0A 3BJOA 3K4NA 1EV7A 3CC4B 1I50J 2F5DA 3ZMDA 1Z67A 3QYFA 2D1HA 4D5CA 3BQZA 3EQNA 1EJ9A 2QXZA 1JT6A 1EA3A 1NK3P 3GVAA 3L00A 3D26A 4HNTA 3HAGA 1A6IA 2WZNA 5EGOB 1X4OA 4LBVA 4E6KG 2HKOA 3GCMA 1SAUA 4B3XA 2BEOA 4IO9F 3GQ9A 3A35A 5EZGA 4U49A 3ABKH 1G8XA 3V7RA 2GJKA 3DDYA 3MVPA 2MG4A 5C4JJ 2FBIA 4MXNA 1EFCA 3DV8A 1GXQA 2XGEA 1XCBA 1HKSA 2J7KA 2PG4A 4C2UA 2BXZA 5CVJA 2HDDA 3JU4A 3DTIA 2XAUA 2F4IA 3HGYA 4RPDA 3FKJA 3GSIA 4P22A 3ABTA 3TH0A 1V5FA 4C3HJ 3MKZA 5FL7A 2VBVA 2O3FA 1V54H 2HOEA 1UCRA 2W7NA 4X0GA 3PO2J 4II3A 1QFJA 1KA8A 2TCTA 5TV2A 4ESJA 2DA3A 3LAJA 1WVRA 3C2BA 3EPZA 4AU7A 2C78A 1RKWA 5CJ9A 2EH3A 4DQLA 2FUG2 1N0UA 3OY9A 1XFOA 1JJ2B 3ONYA 1ON1A 1IHMA 2OCCH 1WOOA 4Z4SA 4I7HA 3OOCA 2RV8A 3T8RA 1KQSB 2CUJA 3HOXJ 5A88A 2KPMA 2Q0OA 3DU1X 2C4UA 1LVKA 1MNDA 4URRA 1AKHB 3RZOJ 2KIFA 2MC4A 1DQUA 4MR0A 3K0LA 1TZLA 2PJPA 3KP5A 3M07A 3ZQQA 4PC2A 2IPQX 3BQJA 3KFWX 3DLLF 1W0JA 4Z05A 4IHTA 2VFPA 3HSRA 1HA8A 3KEOA 4GDFA 2LF7A 3LSIA 2WADA 4YCQA 2GIZA 3GZ5A 3L09A 3I4MJ 1X1BA 2ZNYA 3R6JA 1BOAA 2JQ7A 1FYKA 4IHWA 5GV8A 2IA0A 1YW8A 5HS7A 2K27A 4CCJA 2EIJH 1QHHD 4BXFA 4E7LA 2QGGA 4K1XA 4GCVA 3J7AO 2IEKA 4M71A 3LQRA 3JRGA 2IGKA 4F3QA 5KHDA 5ILUA 3E6BA 1KQ9A 3F0CA 3D1NI 1CLWA 3A01B 2HDCA 2UVFA 3AVYA 5LGNA 2I10A 3CC4I 3VMVA 1SMYF 3FBNB 1ETVA 3A02A 2M0MA 4DBRA 1LVAA 3ISXA 2LR8A 3QRFF 2HPMA 2OAZA 3H36A 5JVTA 2H8RA 1MH4A 3RPQA 1IDZA 3BCDA 3VEPA 4XLNF 3P27A 1BN8A 5BMZA 1YJ9I 3AVXA 3C7JA 1IDYA 4MYUA 4KISA 2LC2A 2XF5A 2ZMEB 3SEQA 1YO5C 1Z21A 3FXJA 4IKFA 2GJPA 1H8HA 4HX4A 2HYFA 2F6CA 4PUSA 1DGWY 3FKIJ 3WQZA 2NTBA 1O8GA 2N8GA 2KJCA 5EJCA 3GZ6A 3KETA 2P0WA 3RYRA 2XNJA 4N4NB 2QMUA 3ABLH 4ZYHA 3N05A 4UHTA 5CVUA 2MD5A 3OYCA 2DK5A 3W2GA 3RDIA 2P4WA 1F60A 2Z5UA 1KJZA 3CCSB 4KKTA 3W6VA 1BW5A 2VBKA 3O2PE 1HQCA 2F2EA 2R5ZB 1YJWB 2K4BA 3PA1A 4LLNA 3PSFA 2R5ZA 1E2XA 4RD2A 4TMXA 1HC8A 3CJRB 2QEXI 1ZM2A 3SY2A 1YJWI 3TW6A 3CMEB 2YU9J 2W7ZA 1XCVA 2M0CA 3WHCA 4KA4A 1DARA 2UVEA 2DDBA 2GXAA 2WAEA 2COBA 3BR0A 1WQ2A 4HG2A 1CZFA 1JTYA 1TP4A 2P5KA 3HHGA 4NQWB 1F4KA 2ZL7A 1VF7A 1R5OA 1NG7A 1MIJA 1P4XA 4LIVA 2VJ4A 5EGOA 4HRIA 3F6OA 4XSZF 3DQVC 5LEKA 4A93J 3QAHA 1MNEA 3ZP5A 4PDKA 4AIKA 4BU2A 2ZSHB 2BVNA 1FMVA 5E1ZB 2DT7B 5HS9A 4E7ZA 4Y17A 4FTHA 3NAWA 3RTRA 5B1BH 2V9PA 3SJPA 3VSTA 1P6RA 5E8GA 1KTWA 4EJOA 1APLC 5E20A 5CKTA 4PCQA 1R1VA 4RM2A 3BCAA 5JBQA 1PLUA 3A1YA 4K2EA 3ZQGA 3DXJF 4HNUA 3E7LA 5JLWA 2VUMJ 3CMAB 3IRRA 2H6BA 2WA0A 5HLHA 4OAYA 5J4YA 4YAWA 5FA6A 2VQCA 2XV4S 2V9KA 4G6TB 5K7ZA 2FXAA 2K3PA 4XLCA 4HSTA 1PUFA 2VNIA 5TISC 4YZXA 2FMLA 2ZTNA 2R7FA 2X8KA 3ML6A 3CD6I 3WY9A 1E62A 2XNCA 4UB6C 5BNGA 1FYMA 2CS3A 4M72A 4A3FJ 1OFCX 3VYTB 4Y9UA 3GTJJ 1TYXA 3TO7A 3M8JA 2GJRA 1T95A 2LG4A 3OSGA 3TMOA 2GLOA 4C2LA 3BY6A 5E3OA 3PUFA 3TOAA 1JA0A 4A3CJ 1OYIA 4LJZF 3FK7A 3GTPJ 1X4PA 4IPAA 2GOXB 4XLFA 1K8AD 1B1BA 4V2FA 4UVCA 2ELJA 3JAMZ 3JRDA 2KIQA 4LB5A 1XB4A 2W4SA 4D7MA 2H27A 1I6HJ 3KE2A 4BNCA 1TT0A 1A35A 4AYBN 4ZZLA 3OYMA 1B2RA 2LSOA 2E1MC 2PMZN 5EF6A 1YS6A 1MDMA 1QQIA 1U6GA 1NB0A 1ZYRF 1GVHA 2CUFA 5HVQC 5J40A 4XIDA 1G7RA 2QQ9A 1R5NA 4R1HA 4M74A 4ZTFA 3OIQA 4I99C 3ZMZA 3VSUA 2DETA 4W97A 3N97A 1TC3C 1D1CA 4G9YA 5CLSA 1KK1A 1T5EA 1JXSA 4Y7CA 5D5WB 5J4VA 1OFDA 3CZ6A 4A0ZA 4LC0A 2QGUA 1OFLA 4FISA 1X2MA 2IGNA 5CVIA 1MJ9A 2LYCA 2VKHA 3OOUA 1P7IA 3QQAA 1JB9A 3OE7A 4C3IJ 1GLNA 2K85A 1CNFA 1R1UA 2PECA 3PUBA 2L9NA 4OMZA 1IDJA 1OFEA 1K5CA 4MTDA 4GYIA 3KP3A 2VT3A 2GXGA 1R71A 1WDTA 5FO0A 2HZDA 5C4XJ 2GBYA 3CF5F 3S15J 2BGIA 2HTJA 3SFIA 4EGZA 2XAHA 4U87A 4A3IJ 2F1LA 4M0LA 3OYJA 1YW7A 1Q7YD 1M1EB 2LY9A 4XOPA 3RIRA 3H0DA 3HRMA 5J8FA 1IN8A 1PDNC 1ZUNB 1H89C 3I9V2 3K9TA 4AIHA 4ZDLA 3F23A 4IHXA 1H80A 2KRHA 2RQQA 3G71I 2HCJB 2C5HA 2M8GX 4AVPA 3FXKA 1Z1DA 1HLVA 1W0UA 2KT0A 2DTZA 5LHGA 2V7XA 2LH9A 1QBJA 2XTXA 1BX0A 1Q1VA 2FVGA 4I0AA 1ZM9A 3OIPA 3CTAA 2ECBA 2ICWG 1ZAOA 2V7WA 3LSJA 2DODA 2DO7A 3FXQA 2VKEA 4QVJA 1EXMA 2XRLA 4ESBA 3MMYB 2D3LA 2JDIA 4RDKA 4Z4RA 4DZJA 1WSUA 2XTYA 3ZMTA 1WCMJ 3OYNA 2DXIA 3CMMA 1VQLI 4MEYF 1X58A 2BW3A 3DTEA 3SZGA 3GLLA 4KJZA 3LSMA 2EFWA 1UD2A 1E43A 1VLOA 4FN5A 4A6DA 2L7MP 3K1PA 5FLMJ 4O3MA 3DEEA 1D2EA 2TDXA 2JA2A 3HOSA 5IYDJ 4N9IA 2CV0A 2GAUA 2EPFA 1LM1A 1F36A 3KP4A 4I02A 3S2WA 1W36D 2VBTA 2E36A 5A8AA 3A8KA 5D8KB 2R5YB 3MZYA 1SFUA 3VO2A 2R7WA 4ZYDA 3CF2A 3HC7A 1A6QA 4CCLA 3IC7A 4MHGA 1WWXA 3GIRA 3KL9A 4KYWA 1NB9A 2UXNA 3WHBA 4C0SA 1M1KD 5FKOA 4G1BA 2LF8A 2DTRA 4BE2A 4CYCA 1O3RA 4R71A 2QZAA 3I59A 3I55I 2OUMA 2QQ8A 2XZPA 3L7WA 2HS5A 4MNUA 2ZC2A 3JQQA 2LVSA 4OINF 2VXZA 5KK1A 3VDXA 2WR8A 4HV6A 4P26A 3QODA 2ZBUA 3I55B 4LFUA 3CO6C 2K3FA 3EETA 3CCQB 4Z06A 1HA3A 3BH7B 5CQGA 2ODLA 1ON2A 4WZTA 3GTQJ 4HEA2 2Q2EA 3ZR8X 4D9JA 1QA2A 4BQAA 2IA1A 1ZM3A 2DQLA 1DABA 5CVRA 4DYRA 3KEWA 1UD4A 1GT0C 2QDXA 1CQTA 5FFXA 2ESNA 2RGVA 3VR6A 2D9RA 3U9GA 2VI6A 1TYWA 2LREA 2ZMEC 3QFCA 2VE8A 4TSFA 3ZSCA 2Y69H 3CCUI 3F8CA 1IW7F 2XOKA 3G2BA 4B44A 1MBKA 4GFBA 4YELA 2DYIA 1E3OC 4V2GA 2WAFA 3N6ZA 4EW9A 1S7OA 1MDMB 2Y2ZA 3GTGJ 4YAOA 2HNHA 4LG3A 4JOMA 2L01A 3Q9SA 5IY5H 4XLPF 3AKZA 1K79A 2UUZA 1XS9A 4WWVA 1AIRA 2KL4A 1RQPA 2OBTA 2O17A 5DV5A 2OTJI 4L0ZB 1EP2B 1G2HA 4RPBA 2VC0A 1YIOA 2BXYA 4AF6A 4A6EA 2D45A 2E2JJ 4YEIA 1I1SA 2ZSIB 1S72B 4RDJA 4NHJA 4DNRB 2P6TA 1QG0A 1F9NA 3HJEA 1YJ9B 4B3FX 1FNCA 3E3VA 1E3HA 1TQMA 3ZQFA 3GVKA 2WYRA 3ZC3A 3O8HA 3ONQA 1O3SA 5E3MA 3S1NJ 4CICA 4X1EA 1IB0A 2JJ1A 3S16J 2H1LA 3OEEA 1OGMX 1Z3YA 3OJXA 2CO5A 2E7XA 1Y1WJ 4BYYA 2DLLA 2QSFX 3PUNA 1TQPA 1X3ZB 2FD5A 5FD5A 4HDVA 2H1KA 3BROA 4YFOA 1ZLKA 1I7PA 3EUKL 1FIPA 2K9LA 1Q1HA 1WPKA 2OJED 5AN9A 2LP0A 3ZQLA 5DNSA 3BPVA 2BVMA 4XQFA 3MFKA 4Y7NJ 4QVAA 1HSJA 3WNDA 5J3OA 3A1PA 4JX4A 1FRNA 5DCMA 3E6CC 3E0JB 1ZARA 2QF7A 3PFYA 4MGRA 3GW2A 3EUAA 4EV0A 2B7CA 2OZ6A 2XAFA 1KU7A 4H9GA 2EZKA 2X1CA 1LKXA 4YXWA 2IS1A 1FYLA 1XGNA 1XMXA 5FROA 5HDNA 4ANJA 2HVSA 1H0MA 2KJBA 1FNBA 4F7ZA 4ZCLA 3TGNA 3GX4X 1WOSA 4DIQA 1QO0D 1MMSA 2QY1A 1S5LC 3SEZA 2E35A 4YZAA 5IPAA 2LMDA 2XF7A 1HKTA 2W84A 2OYNA 1UAAA 5AIQA 3AL0B 2VQGA 1LLWA 2P7VB 1N0VC 3F21A 2OQRA 2DT6A 4LBZA 1S9HA 5BSYA 5IT9K 1OGIA 4XLAA 3LSPA 3H9NA 5EEHA 3M7GA 4OAZA 3W2VA 4YZ0A 4O5VA 2QBYB 4M9XA 1ETKA 5IYWA 1QGPA 1W87A 2HEOA 1IXSB 1T6ZA 1QZYA 2GREA 1OCOH 1OPCA 3GTMJ 1WPCA 1QVTA 2STTA 1MBFA 4Z4WA 4NDLA 3ZMVA 1Z6TA 2VL8A 3CDLA 1SC7A 1SAXA 1CF7B 1I27A 2V6CA 3QOEA 4B3GA 3D5LA 3I58A 1BI3A 1T2KA 4TT3A 4YC5A 5L3FA 3CJNA 2JSPA 3RPUD 2D2WA 3R6SA 4IX7A 4BQOA 4FX0A 1SM4A 3RPUA 2Z3YA 4ZCIA 1VFCA 4OPVA 5FNZA 4QPQA 1AKHA 1JJ6C 2NOJB 1A36A 4KN7X 4WXDA 2HQRA 2VBMA 5K7FA 4XMYA 1KU3A 3S17J 1J9ZA 5E1WA 3CMAI 3JX8A 3OYBA 4HW0A 2Q2EB 1VQNB 3SJMA 1TQIA 2QE7A 1EFUA 3IRQA 2X6OA 1W1WE 2BY1A 2BZTA 2OC6A 2XGJA 3M1EA 3G6EB 1OR7C 2HXOA 2HPIA 5BQTA 2AQFA 2EA4A 2OCEA 4NC7A 5E3NA 2RKHA 1BR1A 4GO1A 4WZEA 1SVLA 2JN6A 3OJWA 2BHZA 4RA2A 3ZPPA 4MLOA 4HE5A 5B6IA 3JR9A 1QUFA 3Q3AA 3OKXA 4KKUA 1JUMA 2PX9A 3HKZN 3CMYA 5J1RA 1SD4A 4L9TA 4UUSB 4W8RA 4BXUA 2P3MA 2G0EA 3QSYA 3ASOH 2V1XA 4L5EA 2R93J 4X6AJ 4YIIA 3U2RA 5JHUA 3OSFA 1OCRH 2IW5A 2NV4A 4X06A 2VB6A 4E0FA 2DEUA 4Z4VA 2VOOA 2YSRA 3GMEA 4G6DA 4QPOA 4Y33A 4HDUA 2OPTA 3RSNA 3BLYA 4M6VA 3L2WA 3MHPA 2R7OA 1FRQA 2V1DA 1G3YA 1XC5A 1SKYB 3CCRI 2BN4A 1B9NA 3EUHA 2LZJA 2KMUA 3ECOA 3F8MA 3QYBA 3V4GA 4XRSA 2CGPA 1IB4A 4YG2F 1HF0A 5FFZA 3PVDA 1YW9A 5F4MA 2BM4A 3ZRGA 2XT4A 1S4MA 3BOQA 4KICA 3CPXA 2QX3A 2ZZGA 4BHBA 2EFOA 3VMFA 1RNLA 3CCJB 4C9YA 4PABA 2EA2A 1KU9A 1OCPA 1MD0A 1B4AA 1UHWA 3IH4A 3WTZA 1OKRA 2MH2A 2B7BA 2K86A 3BY2A 1WJCA 1OQYA 4UVBA 1E3ZA 1BN5A 3KZIC 1XGOA 2A68F 4C2MJ 1LUJB 2DA2A 1D1BA 3I64A 2NVUB 1YHQB 4MQVA 3SZEA 2EV0A 2KLOA 3KP6A 2XZOA 3WG7H 5D5UB 5KCMA 1TTTA 2XKPA 3CC7I 3Q39A 3B78A 5EG0B 5TY0A 3BY1A 2XC7A 1WJFA 1HW1A 4NQWA 3S1RJ 4IRIA 2VFQA 1BJAA 3P7NA 1P4MA 1ZG1A 4CCKA 3WU0A 3IHUA 2OZUA 2ZXJA 3A3GA 4P6YA 4IOCF 1MSFC 1BPLA 2BBYA 3K4MA 3CCMI 2QSHX 1F20A 1N07A 2E34A 1D1NA 3AAFA 1R5HA 2L7ZA 4D1QA 3H35A 5FRNA 1UD3A 1E3XA 4P1VA 2ZJRF 3IUOA 5LHHA 1YLFA 4Z2YA 3K69A 2CFOA 3WTTC 2Z33A 4V19K 3K70C 2O8XA 2P6SA 4RD3A 2WWYA 3WTSC 1I3QJ 4YAUA 5D6FA 2PI0A 2EWNA 3E1YE 2Z99A 4YZQA 4FT8A 2INUA 4MIMA 1ACIA 2BM0A 4E4HA 2DA1A 3GFLA 1P7JA 4HX7A 1TLHB 4L9NA 2O9LA 5KW9A 2QA4B 2KZVA 4DBQA 4YIFA 3S1QJ 1JI8A 1S6LA 4BJ6C 4CSWA 1QFZA 1VQOB 3PENA 2HYGD 4BHPA 2FX0A 4UAJA 3QPTA 5IYPA 1IN4A 4UVAA 1WJ5A 5M3MJ 5F4OA 4W8TA 3K4LA 4G8XA 4BXXJ 3ASPA 2DQRA 1YRNB 3WE2A 2CK3A 5HOOA 3W3CA 1FX7A 2R7SA 1R5ID 3SFZA 2Q6OA 2V31A 4RD1A 2FBHA 5L3BA 2B63J 1OB5A 2ELHA 1D5VA 1NHAA 5ERIA 3BR6A 1VQPI 1Y8RB 1VQLB 3WGGA 1MZBA 2E1MB 5J3LA 2QKLB 4HE6A 4LB6B 4YIRX 2H94A 3FXRA 2JSCA 1XD7A 4XNFA 5KVRA 4J00A 5L46A 1M90D 2DAOA 2KISA 1RI7A 4XM3A 4B09A 3ZGKA 5LHIA 2I1LA 2VYQA 2NT9A 2FX3A 2VT2A 3PO3J 2AQEA 2O7OA 1FDRA 5JLVC 4Z4TA 3CESA 5LRRA 2J5PA 1LJ9A 3GFJA 4L9VA 1O7LA 3G73A 3HOWJ 2MABA 3V8LA 3OW7A 1T33A 2L54A 5K5QA 1P4WA 2UZKA 2X48A 2LD5A 1GXPA 4IXAA 3AG4H 4M6XA 2DA6A 4M3GA 2DK8A 4ROXA 2J8KA 2DIEA 1DP7P 2E19A 5FKKA 1X1CA 1W35A 2DA7A 4RMNA 2EZHA 4XRFA 4LBWA 4UZFA 2IT0A 2NS0A 1X3UA 5LGTA 2Y9YA 3H5NA 1T6XA 3KPHA 3RKWA 3AL0C 2XSDC 2ZITA 2HR3A 4KMUX 4M2LA 3GWZA 2QCOA 2XVCA 4HA8A 1HZEA 2MBFA 4HQMA 1TTYA 2DCEA 2E60A 1BOBA 1PUFB 1D0ZA 2JT1A 3C2GA 3RIQA 3JRAA 2F3LA 5A2QZ 1J0RA 2XRNA 1EE6A 1W4MA 3ELKA 1N25A 1SD7A 4OIRF 2JA8J 4ITVA 4BE1A 5IYNA 2IS6A 4YFXF 4A3KJ 2Y48A 1MABA 2R9VA 3C1DA 1W0KA 3JQRA 1OJLA 3CUQB 5LFAA 4J01A 5DCFA 1WSRA 1Q86D 1GVJA 3FK6A 4PSWA 3FHZA 3L1PA 4PGOA 1VQKB 1IJEA 1VHEA 1VQ9B 4A3EJ 3OS0A 2EIXA 1PP7U 1F1ZA 3Q9VA 2NSPA 1YJNB 4RLFA 1GQ8A 4ZGNB 1JUSA 3MN2A 5D5XB 2JRMA 3IV5A 3HZJA 2V1NA 2QZ8A 1K6YA 4IJAA 3OYKA 3PM1A 4U0WA 1SD6A 4P1WA 4UXNA 1S72I 2YS9A 4KT6A 5GAEJ 1U78A 4AVZA 1G7SA 1KK3A 2VNHA 3AVUA 3VYUB 3X2QH 5FKMA 2Z8GA 1JNYA 2IQ7A 1PUEE 2GA1A 3DBRB 3V8KA 4ZTJA 1OCZH 1XSDA 3T8TA 2VBXA 1F5TA 1OLTA 1X1DA 3HHHA 1VQ4B 3R0JA 3VB2A 1YYVA 1TYUA 3NE5B 1LDKB 5LRSA 1LE8B 2A07F 4ETSA 2A5WA 4PK4A 1LE8A 1BC7C 1R23A 2VJIA 1PXZA 2XF6A 1AMOA 2DJIA 2JA7J 2Z6BD 1E1RA 3KEYA 1Y6IA 1KCDA 2AO9A 5J35A 3GUDA 3S93A 3Q6RA 4ON0A 2VBYA 2FF4A 3QFTA 5F1RA 1V4RA 1TWHJ 3MAJA 5J6XA 2MA3A 3KLOA 1XSXA 3LFUA 1OHHA 1S29A 3O8GA 1Y39A 2Z9OA 2E2IJ 4B4DA 2KRCA 2YWEA 2EK5A 2M4GA 2HWVA 1E17A 1XTAA 3G05A 1PJ7A 3EQLF 1HBXG 3NEUA 5FLXZ 3ASSA 5FO5A 1YITB 2JUCA 3WTYC 2LOOA 2FOWA 2VNKA 1MJAA 2IBDA 5K7HA 2IP2A 2HOAA 3PA2A 3S8PA 4YHBA 1BLIA 2KQRA 3ZCOA 5JFRA 3G3ZA 1V0EA 3NWSA 2CW5A 2EFGA 1KU2A 3K1MA 4HV5A 4BY1J 5DCMB 1RQRA 3CB4A 3OYFA 3CCVI 5F0FA 1MJBA 2FBKA 2NS8A 3CLOA 4OP7A 1QRCA 1NG6A 1QJVA 4EJTA 3B8YA 3S3MA 1WRJA 2HMAA 1L0OC 3OYLA 2ZJPF 3KP2A 3HB9A 2M45A 1HSTA 3BG9A 3HTUA 1X19A 3B73A 2LKXA 1WJEA 2V7QA 2GK7A 4LLGF 4F55A 1ETYA 5CPRB 2JVGA 4JMQA 4YAFA 2XC1A 1VQOI 1VJSA 3QE2A 4IW3B 2IJLA 1ZGAA 3K7AJ 3PQJA 2FJ1A 3JTHA 2WSSA 5ED4A 3DEWA 3U6KA 1JKQC 3OYIA 1ZRDA 1IUFA 2IS4A 2PLFA 2ID3A 3JRFA 2JRTA 3O3KA 3CP8A 3S14J 4KIFA 4P55A 4EJWA 1IG7A 3H9QA 1QVUA 4BHCA 2XAQA 1VQMB 3UW0A 3MCZA 4NC8A 1RR7A 3RKXA 1KD1D 4IHVA 4X7DA 3A8IA 4Z4UA 3CJQB 4UZEA 1IXCA 1VLYA 3J7AY 4UNOA 4IHYA 3DBHB 1IRFA 1EF4A 2O0WA 2YWGA 3G4SI 3HRUA 2X6XA 4AM3A 1PP8F 3ZZUA 4M9ZA 3SHFA 3RKYA 1ZHFA 3I3LA 1L3LA 4U7DA 4ENJA 1BC8C 3GRHA 3OL3A 3C3WA 2RVCA 2XZLA 2GPJA 1BX1A 4RAZA 5CVVA 2CSOA 1TWCJ 3CC2I 2LKPA 2X4HA 1MW7A 2XB5A 1BA5A 1BHEA 1KQ8A 3QPSA 1X3WB 4OOVA 5JHFA 2FOKA 1EFTA 4FASD 3LQEA 3LA2A 2HDNB 1O8FA 1K83J 4B1RA 1K78B 5DS0A 2PJRB 2BM1A 2XSJC 1G3SA 5J47A 3HOUJ 3SDBA 2VJ5A 4TMZA 4U88A 1UD5A 1Y1VJ 4DNTB 1OMIA 3DKXA 4Q47A 4N3GA 2PMDA 1FOKA 2JVHA 1WI9A 3BPXA 1T56A 1BIBA 2A6TA 5DN6A 3E1SA 2NZMA 2QWWA 2DMPA 4Q48A 2DOGA 2PFBA 2W85A 3CCJI 2VZLA 4ZJZA 1MSEC 2NT6A 1U3EM 3T51B 4EH1A 9ANTA 2V79A 2O5RA 4KIGA 5E17F 1Q81D 2O6GE 3WWGA 2M9HA 1TNTA 3WBJA 1WMRA 1S0UA 1VQ8B 2EWEA 2NOGA 2NSTA 4PC3A 4W8SA 1UG2A 2PMZA 4BPRA 3AVWA 2MC3A 1RWRA 5DUKA 3L2VA 3CMEI 1T6YA 4RS8A 1CF7A 3I54A 3WU2C 4BACA 4FCYA 4X7EA 3ZXSA 1O8IA 2ZXWH 4A12A 3LYCA 2QA4I 1JKOC 2OQGA 1QCXA 3IH3A 5DDGA 3RQ4A 4HZFA 3RKQA 2KP6A 2P5VA 2R7ZJ 2FQ4A 4CO8A 3CCLB 2CRGA 4EM2A 5IOYA 2OBPA 2EFQA 4B48A 1W9XA 3PNYA 3TOBA 3BP8A 4CZZA 2QVOA 1YQAA 4QV2A 2DT5A 2E5ZA 4UUTA 1KK0A 5DM7F 1AU7A 1RUOA 3OW2B 4UV9A 4BL0B 2LNBA 5HLTA 2VBZA 3DF8A 4RB1A 1FSHA 1ETOA 3CW2A 2KRFA 1LNWA 4F92B 4XD7A 2R7DA 3J81K 1ZGWA 3GXOA 1LFPA 3G71B 3FIWA 4Y3OA 3W5HA 2BM5A 1I5ZA 1TW2A 4ABZA 1T98A 1RUNA 3E20A 3RCOA 4OPSA 4Z1MA 3JSOA 4ASUA 1O8EA 2X3HA 1XGMA 2QM3A 3OS2A 4DYQA 1D0XA 3RYPA 3G6EI 2IGMA 2MLGA 1XQBA 1BJKA 4X0CA 4P3IA 1P4AA 1N77A 1UG0A 2WB1A 4IQ4A 1DBGA 2Q6IA 1UELB 4DQKA 5IT9Z 2XB0X 1T6SA 5IT3A 4CCMA 1TWAJ 1DU0A 2CUZA 4PC1A 1FT9A 2BY2A 1QX4A 3DFGA 1WH7A 4XSXF 4CCOA 4BH9A 4CZCA 4H0EA 1U8RA 1DUXC 1HDDC 3GTOJ 2O0VA 2KHMA 5IYBJ 2PE3A 2VBUA 1K28D 1O3QA 3E6MA 2VPLA 2V6EA 1PJ5A 1R9TJ 4A0XA 3N90A 5E8IA 2JTVA 3BH6B 1SFOJ 1XMKA 4BBRJ 1WZ2A 3J81k 4P9FA 2NTQA 1EA0A 3BNWA 3ECHA 5B5EC 2CQQA 4P9UA 2L4AA 2BE5F 4MTEA 3NARA 4RLQA 5BS6A 2EQRA 2P5LC 2HOTA 3B8HA 1Z05A 2L9SA 2MH9A 3E5XA 3K4KA 3BTIA 3BC8A 4F7DA 3F3XA 1U2RA 2C2WA 1FSEA 2RC6A 1GV2A 2HU9A 2KIUA 2LK2A 4ESFA 3ZQCA 2YWHA 3B90A 3S2HJ 1XSVA 1GAQA 2HQAA 3OOPA 4UY8I 2X0KA 4IQJA 2A5YB 3HPHA 1ZQ3P 1O4XA 4MQ9F 1BI2A 3PL8A 1SFKA 3R4KA 2H09A 1K4TA 2MFZA 3ASNH 3FJOA 1Y0RA 3SDGA 2UWMA 1A5JA 1FNNA 3MD2A 1MMGA 1WU8A 3BC9A 4QHYA 2BHYA 3T0YA 2CUEA 4C2TA 3CCSI 3B4NA 1MBGA 4NUBA 1L1IA 3V76A 3O6BB 5DS9A 2CV2A 5FRMA 1JA1A 5L3EA 2OBRA 4M6YA 1FOWA 4ENKA 2VXDA 1R6RA 4P9SA 3SQVA 3S3NA 2OD5A 4XKBA 2VBSA 1TNSA 4KFCA 4G6IA 4RB2C 4LK0F 4GGGA 1Q9SA 3WTUC 3QFSA 4U0YA 1CGPA 4XK4A 5GPAA 1NK2P 2O04A 3GLXA 1QU3A 3FDYA 4M3EA 4Z4YA 1K4SA 3E97A 1OFMA 1X2NA 1VQ7I 4OIOF 2VOPA 3ASTA 3CXCB 3KP7A 3H3ZA 2CWEA 2ID6A 3GYHX 1UMKA 1CNEA 3ZUGA 1IGNA 1K61A 1JRGA 2MYSA 1Y0NA 3OL4A 4OIQF 2LY1A 3FZVA 2BSPA 3OP1A 2DOFA 1VQNI 4I2OA 2X9DA 2LBFA 1FP1D 3VYSB 1ZKGA 1S3JA 3PJRA 3MMPA 2OU2A 2VPRA 2HQ5A 4PZJA 2LBFB 6PAXA 3JAMK 2J8IA 1IC8A 2XPVA 1R22A 3CC7B 4S04A 3W2AA 4DK1A 1R36A 3QOPA 2ZL5A 3ZQHA 2JIZA 1ZK8A 1W7PD 2XIGA 4EJVA 3OYHA 1QA1A 2X53S 3SYJA 1G4DA 4E7SA 5M5WJ 3J81Z 5EDNA 3LA3A 1H42A 4OJPA 2X85A 2BV6A 2XASA 4JYKA 2ZXIA 3EYIA 1Y0UA 3K4CA 2L9RA 2ISZA 1A04A 2L2OA 5J1YA 3GQ7A 3EQOA 2BV3A 5K1YA 3FPKA 3DPUA 2E1OA 2WC2A 3A4CA 3K4JA 5F6FA 3TBIA 4XONA 5FKNA 5F1JA 4IZZA 1NH3A 3ERED 1J09A 2ISYA 2M3AA 1YTYA 5GAGJ 2VKVA 2M4KA 2CQ7A 5BOXA 3VMWA 1UFMA 4LIUA 5IOZA 4JRAC 1ZRCA 2F48A 2ZKZA 3H9GA 4PSXA 4EQQA 4RGRA 5B1AH 5IP7J 3IKTA 1FNMA 1NBMA 2ECCA 4JX5A 1SMTA 4Q7JB 3CCUB 4MYTA 1I6XA 3M1CA 3MQ0A 3CCEI 2XPUA 2ZJ2A 2QKMB 1B6AA 3R60A 4HLXA 4BDYA 1LPQA 2EINH 3DPTA 4QSHA 5FIUA 3CCEB 2KZGA 2F4OB 4EATA 2Y31A 5LMZA 2XGXA 3BR5A 2WY7Q 3H5RA 3MEXA 4JK1X 1GO2A 3OYAA 5EG0A 2V4DA 5GPCA 1AHDP 1NDHA 2VFMA 3H94A 4L9JA 2HOSA 4M53A 1W34A 2NPFA 4OU0A 3AFHA 4JP0A 2Z16A 1R4MB 2IVMA 4JX6A 2HFHA 4OWRB 3KYCB 2ME0A 3FBIB 2YX7A 4WCGA 1TLLA 5JI6A 3ASRA 4AF7A 3OS1A 4BJTA 1WGXA 5THXA 4R8HA 3ZPNA 4BUPA 2F5VA 4XN3A 2CC2A 2HVRA 4JBAA 1ONVA 4BEHA 4HOBA 1ERDA 4ENMA 1T38A 1FZPB 5JMCB 1J5YA 1R58A 2OV7A 2KDOA 1JHHA 1N06A 1YITI 4HYEA 4BDZA 1W36C 2D3NA 1X0CA 4HNVA 1T0FC 3W2EA 1IA5A 3H09A 4XORA 4RB3C 1FC3A 4Y9RA 1B8IB 2ZTGA 2DDAA 2R4GA 1BL0A 2O61A 3FY3A 3B6CA 2V26A 3PUMA 1TVCA 3TL4X 4LLLA 4DW6A 4EJUA 1WKMA 3CC2B 1IV8A 5H2FC 3PSSA 3A03A 3I59B 5M5XJ 4OJLA 4NB5A 1ORKA 2A6HF 5FD6A 4KKSA 4HWVA 3OYDA 1PJRA 2B7EA 2EIKH 4XOTA 4OPOA 4G6QA 2YPRA 3JURA 4O6JA 4CYDA 1TYVA 1AIPA 1PVEA 3REOA 4P3YA 5HLIA 4B8XA 4AD9A 2V7UA 3HRTA 3CDHA 2NNNA 3I56I 4A5NA 1P2FA 2CH0A 1D0YA 4ZYAA 3E6DA 2VASA 3NRVA 4QIWN 2MGQA 2K40A 1F43A 3M4OJ 4EM0B 4BE0A 1KMHA 2FMYA 3P9IA 3EUHC 3FHNA 2VKDA 1IN5A 5DYMA 3RJPA 3ZN1A 3G1MA 2M1BA 4PGHA 3S2DJ 1A8PA 4TMTA 1LLZA 4P96A 5D4SA 4BY7J 1FBUA 4Y13A 2KKOA 4RDLA 1OB2A 2F4NA 3BH4A 5GTIC 3KEQA 1XMAA 3CD6B 2DFHA 4DQ2A 2V1UA 1HW5A 1O7FA 5JVGF 4C3JJ 2ME6A 3U1DA 2CRVA 1ZM4A 3QPHA 5DTDA 1EH8A 5EYRA 3Q0VA 2WY8Q 4HF2A 3CP2A 2G7UA 1K4ZA 2BOLA 2QYUA 1DPRA 2RAEA 3G1OA 2RQPA 3LSRA 3AVVA 3DU5A 1IN6A 2EZLA 1VQ8I 5C1EA 3TDZC 4M1KA 5IYQA 2GOMA 3VNVA 1MRZA 1O8MA 4A3JJ 4ZC3A 3LJYA 3OV8A 1J2XA 3HXLA 4OMYA 4D7NA 3CCQI 3DP7A 4A3BJ 3ISPA 4P12A 1LQ1A 2BSAA 1U0JA 2WJYA 2QQBA 3AVTA 3ZBTA 2ZBVA 2L7FP
chains in the Genus database with same CATH topology
1MMNA 5LFAA 4J01A 2JJ2A 3FKSA 4PSWA 2IGNA 2LYCA 2VKHA 3OOUA 3OE7A 1GLNA 4BJ5C 1DP3A 3KYLA 3DU6A 3C2HA 3OS0A 1HVXA 3PUBA 2L9NA 1IDJA 2DOAA 1K5CA 2NSPA 4RLFA 2K5CA 1GQ8A 4E7JA 2HZDA 5HKKA 3SYTA 2WBMA 2V1NA 1K6YA 3OYKA 4U87A 4BGDA 4P1WA 3VWBA 4KT6A 3OYJA 4AVZA 2E5NA 2Z8GA 3VYUB 2Z2SB 1V5GA 2IQ7A 5AMVA 4XOPA 3H0DA 4ZTJA 2CW8A 4GQNA 1OLTA 1X1DA 3I9V2 3NE5B 1LDKB 4ZDLA 2R7UA 1H80A 4TKOB 3GQBA 2KRHA 2A5WA 2RQQA 4PK4A 2VJIA 1PXZA 1V5EA 2XF6A 3QYEA 4ZDPA 2DJIA 2Z6BD 2LH9A 1E1RA 3KEYA 1Y6IA 2R7XA 3LNNA 3OYEA 4XKCA 5LD2C 1KCDA 3S93A 3OIPA 2HDWA 3GQAA 2X51A 2WJVA 2JDIA 2D3LA 3MMYB 4XLHA 2Z1DA 3LFUA 3HL2A 1OHHA 1ZELA 4FXUA 3OYNA 2DXIA 2NTPA 3CMMA 1O8KA 3LSGA 2KRCA 5CDFA 4OZZA 2BW3A 3DTEA 2M4GA 3SZGA 3G05A 4KJZA 3LSMA 1UD2A 2VJJA 1E43A 1G59A 3LL7A 2VQLA 4BEHB 3PSIA 2I8DA 2K9MA 2LOOA 3DEEA 3LMMA 1VZ0A 2JA2A 3HOSA 3S8PA 2CV0A 1BLIA 2KQRA 3ZCOA 1W36D 1V0EA 3NWSA 3PNTA 3HOTA 2R7WA 3OYFA 1O88A 3CF2A 3HC7A 4CCLA 3F9KA 2ZXHA 1NG6A 2WPDA 3NWTA 2L7KA 1QJVA 4NNJA 3B8YA 3K70D 4BE2A 3S3MA 3K4BA 3KRGA 3OYLA 3MKYB 2OUMA 1X1AA 2XZPA 1X19A 2VXZA 3VDXA 1WJEA 3QODA 2V7QA 2GK7A 4NK6A 4F55A 5CPRB 2LY2A 2JVGA 4JQFA 4JMQA 4Z06A 2M7AA 5CQGA 3K6GA 1VJSA 1O8JA 2BW3B 2ODLA 2MD0A 2WSSA 4F93B 4HEA2 3ZR8X 4CUGA 4D9JA 1OGOX 3OYIA 2V4JC 2IS4A 3CP8A 3OR1C 3KEWA 1WJDA 1UD4A 3H9QA 1O8LA 2W6JA 3UW0A 5C1CA 4NC8A 1OOCA 4BS9A 2ZFUA 4P5OA 1FX0A 3VR6A 1RU4A 4ZDOA 4OJ6A 3CJQB 3VYRB 2LREA 4LITA 1VLYA 3J7AY 4TSFA 3ZSCA 2O0WA 2ZZEA 4CH7A 4G7XA 2XOKA 3G2BA 2X6XA 4HSRA 3OWTA 4YELA 4B44A 1COWA 1I8DA 2WAFA 4EW9A 1Y56A 3KX2A 2HNHA 4LG3A 4Y4RA 4JOMA 3AKZA 3A2KA 3I3LA 2UUZA 3OMYA 4XKWA 2F43A 4NK8A 3GRHA 1AIRA 2KL4A 3OL3A 2O17A 2IXSA 3GVLA 2WZPP 1Z3XA 2XZLA 4FETA 4XL9A 4E7IA 1UD8A 2RNGA 2ZSIB 2ZZQA 1MW7A 4DNRB 2VQHA 1YE9A 1BHEA 3DLAA 3OYGA 4B3FX 5JHFA 3H9JA 4FASD 5TGTA 1O8FA 3GVKA 4OZYA 2X6YA 2PJRB 3ONQA 4AYBA 3IAM2 1O8DA 2M7BA 2XSJC 2Y0SA 2W1OA 2X1DA 2VJ5A 3SDBA 2X1EA 4F52A 1UD5A 1BR4A 2JJ1A 3OEEA 1Z3YA 4DNTB 1OGMX 1MMAA 3DKXA 3SUCA 2JVHA 3BG7A 4W8QA 2A6TA 2XDVA 3L2QA 3E1SA 2M5SA 2NZMA 3EUKL 1E1QA 2K9LA 1IRXA 1XG2A 3GBGA 4ZJZA 4GRIA 2CV1A 2LRDA 1E0EA 2NT6A 3T51B 1VBLA 5IK2A 4L8JA 2BVMA 2O5RA 4XQFA 3BG6A 3HPGA 3HKZA 3FPPA 4PFPA 3WWGA 5CQEA 1WMRA 2EWEA 3OAAA 1N78A 4W8SA 1UD6A 2INVA 2NSTA 2PMZA 4C30A 3E0JB 5HNFA 4PJLA 3PFYA 1RWRA 3EUAA 3L2VA 2PYGA 4OJ5A 1BR2A 4YEJA 1MMDA 3IP4B 2X1CA 1LKXA 4YXWA 2IS1A 4BACA 3OFNA 1O8IA 3ZXSA 3D5RC 4DOZA 5FROA 4ANJA 2HVSA 1QCXA 1YX3A 2PJRA 2PYHA 4DIQA 2VBEA 3RQ4A 2E1BA 2QY1A 3SEZA 2KP6A 4YZAA 3ZIAA 4XLEA 2XF7A 1P9QC 1UAAA 1WJBA 1W9XA 4B48A 3PNYA 4CA0A 4PMHA 1KCCA 2V7FA 3AL0B 2VQGA 4PJMA 2E5ZA 1E79A 2DT6A 2XNDA 4II2A 1S9HA 5HLTA 4BL0B 4XLAA 4KITB 4XR6A 4HPQA 4YZ0A 4OAZA 3W2VA 4F92B 4XD7A 3GQ8A 3BCBA 4N4OB 1LFPA 4Y3OA 1KONA 3VMWA 4Z1MA 3RCOA 4ASUA 1O8EA 3PNVA 1PKVA 2UV1A 2X3HA 3L2RA 3OS2A 1OB0A 1D0XA 1WPCA 2IGMA 4E7HA 2VL8A 3DTKA 3K4NA 3K10A 3QOEA 1N77A 4B3GA 1UG0A 2CW7A 2WB1A 3D5LA 4IQ4A 2W6IA 3QYFA 4TT3A 1DBGA 2JSPA 1UELB 3RPUD 3T56B 3EQNA 4IX7A 2QXZA 4BQOA 1EA3A 4U7BA 1FMWA 2BVLA 3IAS2 4HNTA 4CCMA 3HAGA 2CUZA 1DBOA 4PJJA 4XN0A 1YX5A 1X4OA 4E6KG 4CZCA 4CCOA 1SAUA 4B3XA 3GQ9A 4QPQA 2O0VA 2KHMA 2NOJB 3A35A 4U49A 2VBMA 1K28D 1G8XA 4XMYA 2GJKA 2CMPA 3DDYA 2VPLA 2L5QA 2V6EA 4MXNA 4C2UA 3OYBA 2Q2EB 3JU4A 3H5AA 4I84A 2NTQA 2QE7A 3DTIA 2XAUA 2F4IA 2OC6A 2XGJA 3FKJA 4RLQA 4B47A 3DPLC 1OR7C 2L9SA 4P22A 1JTAA 3K4KA 1V5FA 3MKZA 4Z03A 5FL7A 3BC8A 2HPIA 2AQFA 4NC7A 1BR1A 2W7NA 4X0GA 2HU9A 4II3A 1WP6A 3B90A 2GK6A 3ZPPA 2HQAA 4MLOA 3EPZA 4AU7A 4IQJA 3HPHA 2FUG2 4KKUA 3OY9A 3PL8A 1SFKA 2IS2A 2MFZA 3OOCA 4W8RA 3DKYA 2UWMA 2CUJA 4U4BA 1QHGA 2KPMA 3MD2A 1MMGA 1LVKA 1MNDA 4URRA 3BC9A 4C2TA 4MR0A 2MC4A 1DQUA 3B4NA 4NUBA 2VB6A 3S3OA 2CV2A 1TZLA 5FRMA 4QPOA 4Y33A 4DJAA 3ZQQA 1BMFA 3RSNA 3BLYA 3L2WA 2VXDA 1R6RA 2R7OA 4YRVA 3S3NA 5DN6A 1W0JA 4XKBA 4Z05A 3VSLA 1SKYB 1HA8A 4G6IA 4DGWB 4B43A 4OJOA 2LZJA 2KMUA 2R7QA 3QYBA 1IB4A 4HIZA 3LSIA 2WADA 3ZRGA 4BQQA 2O04A 1QU3A 4G7WA 3FDYA 2QX3A 1X1BA 2ZZGA 1H8EA 2W82A 1OFMA 1HG8A 2X6WA 4CCJA 3OPOA 1DGRM 1QHHD 4BXFA 4C9YA 4E7LA 1JRGA 2MYSA 3OL4A 2LY1A 2BSPA 3LMWA 2LBFA 3VYSB 3PJRA 1WJCA 2IGKA 4F3QA 5KHDA 1E3ZA 2UVFA 2LBFB 4XKVA 3LSHA 3VMVA 1D1BA 3FBNB 4DBRA 3W2AA 2M0MA 4DK1A 2JIZA 2KLOA 2O1DA 3OYHA 2HPMA 2XZOA 3OR2C 5KCMA 2X53S 3BCDA 1BN8A 4E7SA 1I18A 2XC7A 4OJPA 1WJFA 2JUGA 2X85A 2ZXIA 4KISA 5HNHA 1RMGA 2LC2A 2XF5A 3K4CA 4IKFA 2L2OA 3SEQA 1Z21A 3UR3C 2GJPA 3GQ7A 1H8HA 3EQOA 2F6CA 4PUSA 3DPUA 4CCKA 3A4CA 1DGWY 3K4JA 4IZZA 3TBIA 4XONA 3WQZA 1O8GA 2NTBA 3A3GA 1J09A 2M3AA 3S32A 2P0WA 1BPLA 4N4NB 2M4KA 3N05A 3K4MA 4LIUA 3OYCA 3H9GA 4PSXA 2VLAA 1NRKA 4D1QA 5FRNA 3H35A 1NBMA 1UD3A 1E3XA 1WTHD 4KKTA 3IUOA 4DK0A 2VBKA 2KVOA 3M1CA 2CFOA 4F91B 3DWLE 3PSFA 3K70C 2QKMB 4BDYA 2HLDA 3CJRB 4R79A 3DPTA 4EATA 4YZQA 3H5RA 1IDKA 2WY7Q 2INUA 2UVEA 2WAEA 1WFXA 3OYAA 3LSKA 3UNGC 4HG2A 4E4HA 2V4DA 1CZFA 4NQWB 3H94A 2KZVA 4DBQA 1JI8A 1VF7A 4BJ6C 1NG7A 4CSWA 3AFHA 4E0FA 2Z16A 2RREA 3L2UA 2PECA 4LIVA 4OWRB 2VJ4A 3FBIB 3T9GA 4HRIA 3OS1A 2VIXA 4BJTA 3DQVC 1AA7A 3ZPNA 4BUPA 1WJ5A 2F5VA 1MNEA 2IGOA 4XN3A 2HVRA 4BU2A 2ZSHB 4W8TA 3K4LA 1FMVA 4BEHA 2DT7B 1ERDA 3OEHA 4E7ZA 2CK3A 1WJAA 2OV7A 3RTRA 2KDOA 5HOOA 3W3CA 2R7SA 3BCFA 4BDZA 1W36C 2V31A 2R7TA 2D3NA 1X0CA 3VSTA 1T0FC 1IA5A 1D1AA 4XORA 4E7KA 1KTWA 2ZTGA 5CKTA 3U21A 2R4GA 3FY3A 4RM2A 2E1MB 3BCAA 2QKLB 2V26A 3A1YA 1PLUA 3D5SC 4HNUA 3TL4X 1V0FA 4J00A 4XNFA 2WA0A 4OJLA 4OAYA 4UZUA 2VQCA 3W2WA 4KKSA 2V9KA 4HWVA 4XM3A 3V42A 4G6TB 3ZGKA 3OYDA 1PJRA 4XOTA 1Z7LA 2K3PA 2NT9A 3JURA 4XLCA 4HSTA 4RM3A 1PE9A 2AQEA 2R7VA 2ZTNA 4YZXA 2X8KA 3CESA 2CH0A 1EFRA 1D0YA 2CS3A 4PFOA 2VASA 4ZYAA 2MABA 5KNLA 3OW7A 3VYTB 1N75A 1NHCA 4BQNA 4BE0A 3M8JA 1KMHA 1T95A 2LG4A 2GJRA 3EUHC 3FHNA 2VKDA 3TMOA 3GVJA 4C2LA 1X4PA 4XLFA 2GOXB 2DIEA 1X1CA 3BH4A 2ELJA 2W00A 3VSVA 4RMNA 2HVQA 2Q1ZB 2W4SA 2R7RA 4CCNA 1TT0A 3OYMA 3T53B 2E1MC 3H5NA 3MKWB 3AL0C 2WY8Q 3CP2A 4PJNA 5HVQC 2BOLA 2WAQA 4H4KC 1HZEA 3VSKA 2E60A 2DCEA 3OIQA 4ZTFA 1BOBA 1PYVA 1KZLA 3VSUA 1D0ZA 3C2GA 3DU5A 5C1EA 2ZZFA 3HG9A 2GOMA 1O8MA 1O8HA 1EE6A 1D1CA 4ZC3A 3A3BA 1T5EA 4ITVA 3HUGB 4BE1A 2IS6A 2F1MA 3HXLA 1MABA 2R9VA 1U0JA 3CZ6A 1W0KA 2WJYA 1OFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0V A;  4YEL A;  2VBK A;  4U49 A;  2VBM A;  4EW9 A;  4XMY A;  4MXN A;  1IDJ A;  4XKW A;  1K5C A;  2NSP A;  4I84 A;  2NTQ A;  4NK8 A;  3GRH A;  1AIR A;  1GQ8 A;  1IDK A;  2O17 A;  2INU A;  2UVE A;  4YZQ A;  4XL9 A;  1CZF A;  1JTA A;  4Z03 A;  1BHE A;  2PEC A;  4AVZ A;  2Z8G A;  3T9G A;  3B90 A;  2IQ7 A;  5AMV A;  4XOP A;  1O8F A;  3ZPP A;  4OZY A;  1O8J A;  4XN3 A;  2X6Y A;  4W8T A;  1O8D A;  1H80 A;  1OGM X;  4W8R A;  3SUC A;  4U4B A;  2VJI A;  1PXZ A;  3VST A;  1X0C A;  1IA5 A;  4URR A;  4XOR A;  1KCD A;  4W8Q A;  1KTW A;  4MR0 A;  2NZM A;  3B4N A;  3GQA A;  1XG2 A;  3FY3 A;  1PLU A;  2NT6 A;  1VBL A;  4XLH A;  2NTP A;  4XQF A;  4XNF A;  1O8K A;  4OJL A;  4Z05 A;  3WWG A;  4OZZ A;  1WMR A;  2EWE A;  4W8S A;  4HWV A;  2INV A;  4XM3 A;  2NST A;  4OJO A;  2VJJ A;  4XOT A;  2NT9 A;  1RWR A;  4XLC A;  3JUR A;  1PE9 A;  1IB4 A;  2PYG A;  4OJ5 A;  4YZX A;  4YEJ A;  2O04 A;  1O8I A;  2QX3 A;  1OFM A;  1HG8 A;  1NHC A;  1QCX A;  2X6W A;  2PYH A;  2VBE A;  4PMH A;  2QY1 A;  1JRG A;  1O88 A;  4C2L A;  4YZA A;  4XLE A;  2BSP A;  3LMW A;  4XLF A;  1QJV A;  3B8Y A;  1KCC A;  3KRG A;  2UVF A;  3VSV A;  4XKV A;  3VMV A;  4XLA A;  2O1D A;  4XR6 A;  4NK6 A;  4YZ0 A;  1BN8 A;  3GQ8 A;  4Z06 A;  4OJP A;  3VMW A;  2X85 A;  2ODL A;  1O8E A;  2X3H A;  1RMG A;  1OGO X;  3GQ7 A;  3EQO A;  3VSU A;  5C1E A;  1O8M A;  2NTB A;  1O8L A;  1O8G A;  4XON A;  1DBG A;  1EE6 A;  1O8H A;  3UW0 A;  5C1C A;  3EQN A;  1OOC A;  2QXZ A;  1RU4 A;  4OJ6 A;  1DBO A;  4XN0 A;  3ZSC A;  2O0W A;  1OFL A;  3GQ9 A;  2X6X A; 
#chains in the Genus database with same CATH topology
 3FKS A;  1JGS A;  2E71 A;  2K7L A;  3BTL A;  2YWF A;  3W5U A;  1VQ6 B;  1ZG5 A;  1TUI A;  1UZC A;  4EEF G;  2DFF A;  2W25 A;  4OM9 A;  3BTJ A;  4I6Z A;  1DDI A;  4OOS A;  3DU6 A;  1GV5 A;  5F27 A;  2DY1 A;  3ZMU A;  3GFI A;  1U5T C;  3ONU A;  4U0V A;  2IAI A;  3CDI A;  3MWM A;  5F64 A;  1ZRE A;  1Y0Y A;  2K5C A;  1SD5 A;  4E7J A;  4KH3 A;  4OIP F;  2PIA A;  5HKK A;  1EH7 A;  4XBF A;  1YG2 A;  3SYT A;  1XX5 A;  1G7C A;  3ESW B;  2DJN A;  2FU4 A;  1EKE A;  4WF2 A;  4WXC A;  4BGD A;  4DYC A;  4A3G J;  3FXL A;  3I71 A;  5LLQ A;  3GF2 A;  4CHU A;  1GUU A;  3WTV C;  5AMV A;  2RNJ A;  1ZTR A;  3OIO A;  5FO1 A;  1O3T A;  2ZCW A;  2NVT J;  1LEB A;  3Q0U A;  3GO5 A;  3KZY A;  4TMW A;  1DDG A;  1QGA A;  2NNY A;  2V9V A;  2R7U A;  2M8E A;  2CYY A;  5ICE A;  5FLX K;  4TKO B;  3GQB A;  3ZZ0 A;  3P4G A;  1PJ6 A;  3BR3 A;  4ACA A;  3QYE A;  4AIJ A;  1R49 A;  1N05 A;  2EV5 A;  1KYW A;  3JW4 A;  4YFN F;  2R7X A;  3LNN A;  3OYE A;  3CUQ C;  1JKP C;  4X7C A;  3LWF A;  2DMN A;  2HDW A;  3K2A A;  1UMQ A;  4P6V F;  1LDD A;  3H92 A;  4RLZ A;  4RBO A;  2WJV A;  1D8J A;  1LB2 A;  2Z1D A;  4OPW A;  3HL2 A;  1VQM I;  4FXU A;  2CF4 A;  1O8K A;  1QUE A;  3LSG A;  4OZZ A;  2L9V A;  3CCL I;  3AGP A;  1RKT A;  3QU3 A;  1DG1 G;  2PMU A;  3PSZ A;  3R0A A;  2R0Q C;  5M5Y J;  5GAH J;  1G59 A;  2VQL A;  4BEH B;  3PSI A;  3U2Q A;  3HBL A;  2I8D A;  3OZW A;  2NXN B;  2YX4 A;  1B72 B;  1ETQ A;  2ZB9 A;  4M3D A;  3KZZ A;  2GQF A;  1REP C;  1R1T A;  4FE4 A;  2E7W A;  3BJ6 A;  3FXU A;  4IF4 A;  3HOT A;  1O88 A;  1LDJ A;  4RB0 A;  2XT2 A;  2W24 A;  1R5B A;  3F9K A;  2ZXH A;  4MO7 A;  1VQ5 I;  2QLZ A;  3E5U A;  4V02 C;  3ABM H;  3BR1 A;  3K70 D;  4I98 B;  3KRG A;  1V55 H;  1X1A A;  3SEJ A;  3VNU A;  3B6A A;  1SKQ A;  2Q8K A;  2E2H J;  5HXB A;  1N8R D;  2JK3 A;  2GM4 A;  4FE7 A;  1YI2 B;  1S7A A;  2F5E A;  2RDP A;  3HYI A;  3K6G A;  2MD0 A;  4RDU A;  2P7C B;  1HOM A;  3A0H C;  4F93 B;  4ZV4 A;  1I3A A;  1ZLJ A;  1BW6 A;  5HOD A;  1TL8 A;  5IYR A;  1XB2 A;  2XGD A;  4ZCM A;  3ZZT A;  3ERM A;  3ABU A;  1E3P A;  3OR1 C;  5DD4 A;  3BQY A;  1B23 P;  1OYW A;  1WJD A;  1O8L A;  3PFI A;  3AGQ A;  5C1C A;  3AG2 H;  1MBJ A;  3ROU A;  4NC6 A;  4P5O A;  1FX0 A;  1OOC A;  1U9N A;  4ZDO A;  1K73 D;  1RU4 A;  3F8B A;  4OJ6 A;  2JMW A;  3VYR B;  4LIT A;  5JLX A;  2HYJ A;  1J59 A;  3Q6Q A;  2OTL B;  2V7T A;  2ZZE A;  4G7X A;  1YFH A;  4IRG A;  3M8E A;  2K9N A;  2R92 J;  1I8D A;  5HZB A;  1XDU A;  1SAN A;  5E1X A;  2M2E A;  2B9S A;  3A2K A;  2QN6 A;  4FK8 A;  3OMY A;  3T1B A;  2DYS H;  1HDP A;  2F43 A;  3NAU A;  4ZH4 F;  1BM9 A;  2KDZ A;  4NK8 A;  1MBE A;  1W7P A;  1Z3X A;  2M5W A;  4FET A;  4XL9 A;  2ACJ A;  4P2N A;  1SFE A;  3V7A A;  2MSY A;  3W2F A;  2VQH A;  1YE9 A;  3V7C A;  3DLA A;  1U2W A;  2CQK A;  3I56 B;  4IL6 C;  3H9J A;  2VNJ A;  4I0B A;  1AOY A;  2BYV E;  2DBB A;  5BPD A;  1G7T A;  2OK7 A;  4OZY A;  2X0L A;  1YJN I;  2H6C A;  4AYB A;  2QTZ A;  3IAM 2;  3CUO A;  3VO1 A;  1O8D A;  2PBI A;  2Y0S A;  4HBL A;  3F8F A;  3GZN B;  2LLK A;  2W1O A;  1EWY A;  2X1D A;  2EFN A;  4F52 A;  3TDU C;  5EEA A;  3CQZ J;  3H1C A;  3LOC A;  1MMA A;  1OCT C;  3W2H A;  5D8L B;  3KCC A;  1E63 A;  1QZZ A;  2NAZ A;  4M3B A;  3ZPL A;  1W5C C;  3LNQ A;  2L3D A;  3OZV A;  3BZ6 A;  1UB9 A;  4I09 A;  2M5S A;  3LVB A;  2NVX J;  1E1Q A;  3ZMS A;  5H5J A;  1XG2 A;  1S7E A;  2XKO A;  1S8N A;  2QTL A;  2LRD A;  1D3Y A;  3J7Z I;  5M3F J;  2MW8 A;  4MFD A;  1ELO A;  5IK2 A;  3RZD J;  4QTR A;  3BG6 A;  3HPG A;  1FP2 A;  3FPP A;  3W5V A;  3S1M J;  5CQE A;  3MCA A;  4LD5 A;  2JWT A;  5H6Q A;  1UD6 A;  3OAA A;  5E18 F;  1EP1 B;  3CCV B;  5E3L A;  4RCY A;  4C30 A;  1ULY A;  1QRY A;  5HNF A;  2O03 A;  4PJL A;  1K6O A;  4OJ5 A;  2NYX A;  3IP4 B;  3LA7 A;  3HOZ J;  1R4N B;  3OFN A;  1FPQ A;  3BG5 A;  4DOZ A;  2RC5 A;  2K4J A;  1RZ4 A;  5ICC A;  1QPM A;  3I0T A;  3GFM A;  2PJR A;  1DU6 A;  2E1B A;  1K9M D;  4Q4Z F;  1ZR2 A;  3ZIA A;  4XLE A;  4Z6Y A;  1H88 C;  2DA5 A;  2NS7 A;  3SXY A;  2CBX A;  3R61 A;  3JRH A;  2V7F A;  4PJM A;  2L4M A;  3ZQI A;  4X05 A;  4II2 A;  5KAF C;  4Q5S F;  2R3S A;  2IA2 A;  4KIT B;  2PEX A;  1QVG B;  2JA6 J;  4XR6 A;  4PC7 A;  4HPQ A;  2E1R A;  4CXF A;  2Q6K A;  3GQ8 A;  2WAQ N;  4HQE A;  2BX6 A;  2CW0 F;  2DPU A;  3WTW C;  4RCZ A;  5DSZ A;  5ICF A;  1OB0 A;  5H6R A;  3JRE A;  2K02 A;  2R5Y A;  1Z7U A;  2CU7 A;  3DTK A;  1WOR A;  1U8B A;  3K10 A;  4D5F A;  1UHS A;  2CW7 A;  4OOI A;  2W6I A;  3LFK A;  1Y8Q B;  3ZOB A;  3T56 B;  1KC8 D;  2DMQ A;  5BPI A;  4U7B A;  4L5I A;  4CYC B;  4J19 A;  1FMW A;  2BVL A;  3IAS 2;  5EZH A;  2NVQ J;  1B59 A;  2OA4 A;  5E6T A;  1MBH A;  1DBO A;  1UJ8 A;  4PJJ A;  4XN0 A;  4NBS A;  1YX5 A;  5LEJ A;  4FX4 A;  3QU6 A;  5KSW B;  5JR3 A;  2WTE A;  3ZBU A;  3Q3S A;  2PQ8 A;  3IKV A;  5GV7 A;  2CMP A;  4WZL A;  2L5Q A;  3JRI A;  2VC1 A;  2DER A;  1WI3 A;  4J0Q A;  4LGW A;  1U5T A;  4LG0 A;  4A0Y A;  3LO8 A;  1VQ9 I;  1DPU A;  3WU1 B;  4HAM A;  3H5A A;  4GYG A;  1ZH5 A;  1FTT A;  1U5T B;  4LG0 B;  1W5S A;  5B66 C;  4I84 A;  3J80 Z;  3FXM A;  4B47 A;  3DPL C;  1KQ5 A;  2GWR A;  1JTA A;  1VQ7 B;  5HZA A;  1Z91 A;  4Z03 A;  3PIO F;  1YS7 A;  2GA2 A;  3HOY J;  1RPW A;  1VI0 A;  2DPD A;  2AHO A;  4PJ0 C;  1WP6 A;  1GR1 A;  2VBW A;  5FB2 A;  5D4R A;  4G7H F;  4A2U A;  2GK6 A;  4U9U A;  2BMW A;  1UHM A;  2DI3 A;  1LEA A;  3COA C;  1T8I A;  3F72 A;  3HGG A;  2HTS A;  2IS2 A;  2BY3 A;  3JTG A;  3DKY A;  4CQJ A;  1VF9 A;  2TRT A;  4U4B A;  1QHG A;  2ZL6 A;  3JQP A;  2ESH A;  4TV7 A;  1W7P B;  1WHU A;  2HI3 A;  3G1L A;  5H20 A;  2XHK A;  3S3O A;  4DJA A;  3IWF A;  2QEX B;  5D6E A;  1G3T A;  4AC0 A;  1XE1 A;  1BMF A;  3DCF A;  2P8T A;  2ZBK A;  4ZZD A;  4YRV A;  3FMR A;  1IF1 A;  5FJ8 J;  2QEN A;  1RC9 A;  1ZN2 A;  3VOE A;  3VSL A;  1J75 A;  3MZ8 A;  4P25 A;  3CRZ A;  2HKX A;  4DGW B;  4B43 A;  2RC4 A;  3MZH A;  4M4S A;  3PET A;  4OJO A;  4S05 A;  2R7Q A;  2V7V A;  5F08 A;  3L9F A;  4M9S A;  5ILV A;  2Y9Z A;  4HIZ A;  4X7F A;  2AHQ A;  3M3Y J;  4BQQ A;  4NBQ A;  3I4N J;  4G7W A;  3U6B A;  1ETW A;  2D1V A;  4UV8 A;  1H8E A;  2W82 A;  1GVD A;  1RES A;  4WQM A;  1HG8 A;  5CYV A;  1D8K A;  1G3W A;  1K7A A;  2X6W A;  3FF5 A;  1YLO A;  4G1V A;  1MNM C;  1DGR M;  1YX2 A;  2X3U A;  3D0S A;  3OPO A;  4NCN A;  4BAY A;  3P26 A;  1FIA A;  3FM5 A;  3TED A;  4N0B A;  3LMW A;  3IWZ A;  2WV0 A;  4RGS A;  5H59 A;  3F6V A;  2EJR A;  3WOD F;  1IV6 A;  2PLY A;  3JSP A;  1IO2 A;  4CDG A;  2GQQ A;  3HSF A;  4XKV A;  3LSH A;  4Y15 A;  1V3F A;  1ETX A;  3HRS A;  2J5O A;  3WE3 A;  1VQP B;  3JRC A;  3TW7 A;  2OTJ B;  2O1D A;  2DA4 A;  3OR2 C;  5F0C A;  1I18 A;  1WXR A;  2JUG A;  4FQG A;  3P5J A;  4BKX A;  1FJL A;  2AS5 F;  4G94 A;  3U1K A;  5HNH A;  3WNC A;  4FHT A;  1RMG A;  5BSX A;  3H3U A;  3UR3 C;  3L2C A;  3H3V K;  1FOX A;  2C5B A;  5HLG A;  5F0H A;  4KMF A;  1YOV B;  2K9S A;  1EZG A;  1ZR4 A;  5A2Q K;  3M9A A;  4L18 B;  3SZP A;  3S32 A;  4YFK F;  4A3M J;  4A69 C;  2GZW A;  4LBY A;  3VPR A;  1TWF J;  3BWG A;  3FMQ A;  5AIP A;  1T0F A;  4MFE A;  2ZJQ F;  5GP9 A;  3HOV J;  2O6W A;  2EZI A;  2VLA A;  1XPX A;  4XRM A;  1VQ4 I;  1NRK A;  5HDG A;  1WTH D;  4DK0 A;  1B8I A;  2KVO A;  4F91 B;  4YDT A;  3DWL E;  2Y0M A;  4IEJ A;  2E1C A;  3TP0 A;  3A01 A;  4HLY A;  2COM A;  2P81 A;  4ZYE A;  2QUF A;  2Y0S N;  2QBY A;  2CQX A;  2B0R A;  2HLD A;  4W1U A;  1BJZ A;  4R79 A;  1FEX A;  4RAG A;  3NQO A;  4M73 A;  1STZ A;  2YUH A;  4KT5 C;  2QQA A;  1IDK A;  1IN7 A;  4UB8 C;  1OYY A;  1WFX A;  4EM1 A;  3LSK A;  2Y75 A;  1SVO A;  2FNP A;  3UNG C;  3JRB A;  2IOU G;  1RIO H;  3HDD A;  5DUI A;  4QLC U;  1OIS A;  5F04 A;  4RGX A;  3PQK A;  1MGT A;  3BDD A;  2JN9 A;  2G7H A;  3L2U A;  2RRE A;  2ZME A;  1A31 A;  1OCC H;  4RAF A;  5GTH C;  3BG3 A;  4HF1 A;  1BQE A;  3AG1 H;  3T9G A;  1WOP A;  5F4J A;  2VIX A;  3LQ6 A;  4EVI A;  1FOY A;  4UUV A;  1AA7 A;  1O8J A;  1Z77 A;  2IGO A;  3VFZ A;  2LKS A;  1HXD A;  3OEH A;  3SLD A;  1BI0 A;  1WJA A;  3MKL A;  1GAW A;  3HSE A;  3QPL A;  3BCF A;  3RY8 A;  3CCY A;  4S0H B;  1T08 B;  2PN6 A;  2HQN A;  2R7T A;  3SKB A;  2A6E F;  4A3D J;  1NTC A;  4E70 A;  1D1A A;  1RET A;  1Z9C A;  1YIJ B;  2LFB A;  4E7K A;  2D5V A;  1KQ0 A;  3K1N A;  4QUZ A;  3P9C A;  3U21 A;  2QSG X;  4CGZ A;  2ADU A;  4PAA A;  3DEU A;  5L3G A;  3D5S C;  1OGJ A;  3T5X A;  2ZFW A;  5DEQ A;  5LBQ A;  5J1U A;  2H8W A;  1V0F A;  1BIA A;  1HW2 A;  4UZU A;  3W2W A;  2C4T A;  3V42 A;  4WX9 A;  1Z7L A;  2STW A;  4RM3 A;  1PE9 A;  2EBI A;  1ZG3 A;  1IAW A;  2R7V A;  2BM6 A;  3SJZ A;  1J7K A;  1OR7 A;  2KFD A;  3BJA A;  1R00 A;  4UUS A;  1EFR A;  2F5C A;  2EIL H;  4PFO A;  5J8C A;  5KNL A;  2GIV A;  2M30 A;  2EIM H;  1HCR A;  1N75 A;  3FX3 A;  3WG9 A;  1RR8 C;  2CND A;  3R6K A;  1JGG A;  1NHC A;  4BQN A;  4DZP A;  4L0Y B;  4PMH A;  3Q5F A;  2BPO A;  1USS A;  3GVJ A;  4BBS J;  3EYY A;  3KYD B;  3CCR B;  4TMV A;  1CQX A;  2VOD A;  2FE3 A;  2EFP A;  3I53 A;  4LK1 F;  4ENN A;  2LDU A;  4QFM A;  2ZO4 A;  5FLV A;  1QQ1 A;  3WXM A;  2W00 A;  4RGU A;  1IXR C;  1K8F A;  3VSV A;  2HVQ A;  2DMU A;  2Q1Z B;  1KK2 A;  2HGC A;  2R7R A;  4CCN A;  3G4S B;  2WV1 A;  1ZGJ A;  2DW4 A;  3T53 B;  4N3N A;  3I5U A;  1P92 A;  2DFI A;  1VHO A;  3MKW B;  1GDT A;  1ITY A;  2BGC A;  1AWC A;  2Q6L A;  2F4M B;  4PJN A;  2CJJ A;  3TQN A;  1TBX A;  1V5V A;  2WAQ A;  2B0L A;  4H4K C;  3KIO A;  1NJI D;  4KDP A;  3VSK A;  4IHS A;  3F22 A;  2JA5 J;  1PYV A;  3FMS A;  1T39 A;  1H9T A;  1KZL A;  3CLQ A;  2ZZF A;  3HG9 A;  1O8H A;  1R5G A;  2YU3 A;  3FM3 A;  3A3B A;  3GEZ A;  5C44 J;  2G0Y A;  3HUG B;  4TN1 A;  2F1M A;  3SQN A;  1VQ5 B;  2NRA C;  3HUG A;  1C0W A;  2E1N A;  1IJF A;  4G7Z F;  4Y52 J;  3CUQ A;  2A05 A;  4PGG A;  2A69 F;  4KUM A;  2WB1 N;  2DN0 A;  4WXH A;  4DNC A;  1K78 A;  1FLI A;  4RD6 A;  1MMN A;  1O57 A;  2JJ2 A;  3QFR A;  3RI4 A;  3N4M A;  4B4C A;  4BJ5 C;  1DP3 A;  3KYL A;  3UKG A;  3C2H A;  3K2Z A;  5KAI C;  1HVX A;  2DOA A;  1KGS A;  2BGJ A;  2FA5 A;  3HIF A;  3GTL J;  1GJR A;  3I4P A;  3E5Q A;  2M87 A;  1TSP A;  2JJ7 A;  2WBM A;  4D0P A;  2D74 A;  1U9O A;  2W57 A;  2MLK A;  5EEG A;  2GXB A;  4M3F A;  2XAJ A;  3TO9 A;  1WSV A;  1LFB A;  3VWB A;  1B9M A;  1JJ8 C;  2VE9 A;  4AWX B;  2E5N A;  4GXO A;  2VN2 A;  3WGI A;  1JE8 A;  1JTX A;  1V5G A;  2Z2S B;  3B02 A;  4KNY A;  2CW8 A;  3VOD A;  2DYR H;  5HDK A;  4GQN A;  1IJW C;  2DFE A;  1TT5 B;  1XN7 A;  3ULQ B;  2VFO A;  2KIM A;  4HX8 A;  2M34 A;  1D5Y A;  1DDN A;  1IRZ A;  5EMN A;  3LAP A;  3J7Y J;  4WWC A;  1JUP A;  1V5E A;  4ZDP A;  1MH3 A;  1FWZ A;  3FWE A;  1SEU A;  1X1P A;  4XKC A;  5LD2 C;  2V5I A;  2IRF G;  3GQA A;  5DM6 F;  1HKQ A;  5C3E J;  4G7O F;  2X51 A;  3SZT A;  1IUY A;  4XLH A;  2F5F A;  3I1F A;  1Q82 D;  1FND A;  1ZEL A;  2NTP A;  5GAD J;  3F8N A;  5CDF A;  4I01 A;  1QVF B;  4KN4 X;  2Y30 A;  2VJJ A;  2FQ3 A;  2QYO A;  3QP6 A;  3TO6 A;  3LL7 A;  1YHQ I;  2C77 A;  2O8K A;  1IRG A;  3AK5 A;  2K9M A;  3LMM A;  1VZ0 A;  3ZN0 A;  1XG1 A;  1YRN A;  5IP9 J;  4IRH A;  4IOA F;  2FRH A;  5AON A;  1VQ6 I;  2FEZ A;  4AUX A;  1D8T A;  3PNT A;  1BI1 A;  4X8I A;  1I1G A;  4AC9 A;  4WZK A;  2OBS A;  2NVY J;  2WPD A;  3NWT A;  2L7K A;  4QWQ A;  4NNJ A;  5FKL A;  4XRS G;  5IYC J;  5K5R A;  1IZ1 A;  3K4B A;  2FNA A;  5LGU A;  3MKY B;  1VQK I;  1TW3 A;  2DCU A;  1QA6 A;  2CG4 A;  3QP5 A;  3W6J B;  5TR9 A;  2BM7 A;  4NK6 A;  4ZGQ B;  2C6Y A;  2B5O A;  3GTK J;  1QGY A;  4LMY A;  2LY2 A;  4JQF A;  3BZC A;  4PC6 A;  4X07 A;  4A3L J;  2M7A A;  5A89 A;  2BW3 B;  2FSW A;  1BBY A;  2LTP A;  3IL2 A;  4CUG A;  1OGO X;  2V4J C;  3WNB A;  1QZE A;  1QNT A;  5L3D A;  4B3A A;  2DMT A;  3Q38 A;  2ZNZ A;  1POG A;  3FXO A;  2BY0 A;  2W6J A;  3BTC A;  1B72 A;  1Z0X A;  5E79 C;  2DOE A;  2ZFU A;  1FBS A;  4KIB A;  3TKY A;  4BS9 A;  3CO7 C;  1QH0 A;  3RQI A;  3A0B C;  5B3S H;  4EGY A;  2HZT A;  3DKW A;  1J9I A;  4CH7 A;  1H9G A;  5ILS A;  2YUS A;  1VND A;  4HSR A;  1COW A;  3OWT A;  2VFN A;  3WTX C;  1Y56 A;  2XEX A;  2I5U A;  3DBL B;  3KX2 A;  1SVM A;  2G9W A;  4Y4R A;  1FTZ A;  3BZK A;  2ELK A;  3OZU A;  3A8J A;  5K5O A;  4XKW A;  2EV6 A;  3W2I A;  3WBK A;  3BR2 A;  4RAY A;  4A5M A;  4FWT A;  1FY7 A;  1QFY A;  2IXS A;  3V8J A;  3GVL A;  2WZP P;  4MEX F;  2OTL I;  1JKR C;  3WYA A;  4E7I A;  2JZY A;  2A3S A;  3NB2 A;  3FIS A;  1UD8 A;  2RNG A;  1RRJ A;  4ZYG A;  1VTN C;  2R6H A;  2ZZQ A;  1H85 A;  4RD0 A;  4I76 A;  3OYG A;  4ASN A;  2PMH A;  1LFU P;  2VON A;  3ASQ A;  1G6N A;  2AXT C;  1W0T A;  4L5J A;  5TGT A;  2CQN A;  3ZQ7 A;  1QPI A;  3Q0W A;  3SLN A;  2EB7 A;  2X6Y A;  5DD8 A;  2M7B A;  2OF7 A;  2OK8 A;  2AXL A;  3HEF A;  3H0G J;  1QRB A;  4G12 A;  3BT9 A;  1YI2 I;  1UST A;  2X1E A;  1W2B B;  1BR4 A;  1SFX A;  3TP3 A;  4OOX A;  3SUC A;  3AG3 H;  1HF2 A;  3V7S A;  3BG7 A;  4W8Q A;  2XDV A;  3L2Q A;  3WGH A;  1GHC A;  2ETH A;  1R7J A;  5IP6 A;  1IRX A;  3W6K B;  4EMS A;  2K9Q A;  3GBG A;  4ACB A;  2A61 A;  4GRI A;  1YIJ I;  2CV1 A;  1E0E A;  1KTV A;  1ODD A;  1VBL A;  5TJJ A;  4L8J A;  3PIP F;  2RN7 A;  5L3C A;  2XPW A;  1KYZ A;  3HKZ A;  3M8F A;  3ML3 A;  4PFP A;  2JPB A;  1JT0 A;  1N78 A;  1EP3 B;  1TWG J;  2INV A;  3QWL A;  4Z4Z A;  1ENH A;  4G5G A;  5HS8 A;  2PYG A;  1QGZ A;  4RD4 A;  1BR2 A;  4YEJ A;  1MMD A;  4XIC A;  2L02 A;  2XAG A;  3P9K A;  3D5R C;  3J80 K;  3EDP A;  3CJT B;  4C43 A;  2CFX A;  1MKM A;  4AID A;  4WK8 F;  1YX3 A;  2BF4 A;  2HXI A;  3B82 A;  2PYH A;  2VBE A;  2W48 A;  1I39 A;  3C18 A;  2XGC A;  3HM5 A;  4HF0 A;  1P9Q C;  1WJB A;  4IVN A;  4LOC A;  5FGM A;  2UXX A;  1KZH A;  4CA0 A;  1KCC A;  3ES9 A;  1FBQ A;  4YAL A;  1XDS A;  1EH6 A;  1QA3 A;  2JPC A;  3CPW B;  1E79 A;  2XND A;  1KRH A;  2L0K A;  3JCU C;  5TRD A;  3HTS B;  3KLN A;  3IH2 A;  2XRO A;  3LST A;  2XUB A;  1W5T A;  1Z6R A;  1WH5 A;  3BCB A;  4N4O B;  1ZRF A;  3LQQ A;  1N08 A;  3CCM B;  1KON A;  2O0Y A;  4RJL A;  5ICG A;  1XGS A;  3PNV A;  1PKV A;  2UV1 A;  1E64 A;  3L2R A;  2DU9 A;  1H8A C;  5D5V B;  4E7H A;  1JHF A;  4N9H A;  2XTW A;  2YR2 A;  4RM0 A;  3BJO A;  3K4N A;  1EV7 A;  3CC4 B;  1I50 J;  2F5D A;  3ZMD A;  1Z67 A;  3QYF A;  2D1H A;  4D5C A;  3BQZ A;  3EQN A;  1EJ9 A;  2QXZ A;  1JT6 A;  1EA3 A;  1NK3 P;  3GVA A;  3L00 A;  3D26 A;  4HNT A;  3HAG A;  1A6I A;  2WZN A;  5EGO B;  1X4O A;  4LBV A;  4E6K G;  2HKO A;  3GCM A;  1SAU A;  4B3X A;  2BEO A;  4IO9 F;  3GQ9 A;  3A35 A;  5EZG A;  4U49 A;  3ABK H;  1G8X A;  3V7R A;  2GJK A;  3DDY A;  3MVP A;  2MG4 A;  5C4J J;  2FBI A;  4MXN A;  1EFC A;  3DV8 A;  1GXQ A;  2XGE A;  1XCB A;  1HKS A;  2J7K A;  2PG4 A;  4C2U A;  2BXZ A;  5CVJ A;  2HDD A;  3JU4 A;  3DTI A;  2XAU A;  2F4I A;  3HGY A;  4RPD A;  3FKJ A;  3GSI A;  4P22 A;  3ABT A;  3TH0 A;  1V5F A;  4C3H J;  3MKZ A;  5FL7 A;  2VBV A;  2O3F A;  1V54 H;  2HOE A;  1UCR A;  2W7N A;  4X0G A;  3PO2 J;  4II3 A;  1QFJ A;  1KA8 A;  2TCT A;  5TV2 A;  4ESJ A;  2DA3 A;  3LAJ A;  1WVR A;  3C2B A;  3EPZ A;  4AU7 A;  2C78 A;  1RKW A;  5CJ9 A;  2EH3 A;  4DQL A;  2FUG 2;  1N0U A;  3OY9 A;  1XFO A;  1JJ2 B;  3ONY A;  1ON1 A;  1IHM A;  2OCC H;  1WOO A;  4Z4S A;  4I7H A;  3OOC A;  2RV8 A;  3T8R A;  1KQS B;  2CUJ A;  3HOX J;  5A88 A;  2KPM A;  2Q0O A;  3DU1 X;  2C4U A;  1LVK A;  1MND A;  4URR A;  1AKH B;  3RZO J;  2KIF A;  2MC4 A;  1DQU A;  4MR0 A;  3K0L A;  1TZL A;  2PJP A;  3KP5 A;  3M07 A;  3ZQQ A;  4PC2 A;  2IPQ X;  3BQJ A;  3KFW X;  3DLL F;  1W0J A;  4Z05 A;  4IHT A;  2VFP A;  3HSR A;  1HA8 A;  3KEO A;  4GDF A;  2LF7 A;  3LSI A;  2WAD A;  4YCQ A;  2GIZ A;  3GZ5 A;  3L09 A;  3I4M J;  1X1B A;  2ZNY A;  3R6J A;  1BOA A;  2JQ7 A;  1FYK A;  4IHW A;  5GV8 A;  2IA0 A;  1YW8 A;  5HS7 A;  2K27 A;  4CCJ A;  2EIJ H;  1QHH D;  4BXF A;  4E7L A;  2QGG A;  4K1X A;  4GCV A;  3J7A O;  2IEK A;  4M71 A;  3LQR A;  3JRG A;  2IGK A;  4F3Q A;  5KHD A;  5ILU A;  3E6B A;  1KQ9 A;  3F0C A;  3D1N I;  1CLW A;  3A01 B;  2HDC A;  2UVF A;  3AVY A;  5LGN A;  2I10 A;  3CC4 I;  3VMV A;  1SMY F;  3FBN B;  1ETV A;  3A02 A;  2M0M A;  4DBR A;  1LVA A;  3ISX A;  2LR8 A;  3QRF F;  2HPM A;  2OAZ A;  3H36 A;  5JVT A;  2H8R A;  1MH4 A;  3RPQ A;  1IDZ A;  3BCD A;  3VEP A;  4XLN F;  3P27 A;  1BN8 A;  5BMZ A;  1YJ9 I;  3AVX A;  3C7J A;  1IDY A;  4MYU A;  4KIS A;  2LC2 A;  2XF5 A;  2ZME B;  3SEQ A;  1YO5 C;  1Z21 A;  3FXJ A;  4IKF A;  2GJP A;  1H8H A;  4HX4 A;  2HYF A;  2F6C A;  4PUS A;  1DGW Y;  3FKI J;  3WQZ A;  2NTB A;  1O8G A;  2N8G A;  2KJC A;  5EJC A;  3GZ6 A;  3KET A;  2P0W A;  3RYR A;  2XNJ A;  4N4N B;  2QMU A;  3ABL H;  4ZYH A;  3N05 A;  4UHT A;  5CVU A;  2MD5 A;  3OYC A;  2DK5 A;  3W2G A;  3RDI A;  2P4W A;  1F60 A;  2Z5U A;  1KJZ A;  3CCS B;  4KKT A;  3W6V A;  1BW5 A;  2VBK A;  3O2P E;  1HQC A;  2F2E A;  2R5Z B;  1YJW B;  2K4B A;  3PA1 A;  4LLN A;  3PSF A;  2R5Z A;  1E2X A;  4RD2 A;  4TMX A;  1HC8 A;  3CJR B;  2QEX I;  1ZM2 A;  3SY2 A;  1YJW I;  3TW6 A;  3CME B;  2YU9 J;  2W7Z A;  1XCV A;  2M0C A;  3WHC A;  4KA4 A;  1DAR A;  2UVE A;  2DDB A;  2GXA A;  2WAE A;  2COB A;  3BR0 A;  1WQ2 A;  4HG2 A;  1CZF A;  1JTY A;  1TP4 A;  2P5K A;  3HHG A;  4NQW B;  1F4K A;  2ZL7 A;  1VF7 A;  1R5O A;  1NG7 A;  1MIJ A;  1P4X A;  4LIV A;  2VJ4 A;  5EGO A;  4HRI A;  3F6O A;  4XSZ F;  3DQV C;  5LEK A;  4A93 J;  3QAH A;  1MNE A;  3ZP5 A;  4PDK A;  4AIK A;  4BU2 A;  2ZSH B;  2BVN A;  1FMV A;  5E1Z B;  2DT7 B;  5HS9 A;  4E7Z A;  4Y17 A;  4FTH A;  3NAW A;  3RTR A;  5B1B H;  2V9P A;  3SJP A;  3VST A;  1P6R A;  5E8G A;  1KTW A;  4EJO A;  1APL C;  5E20 A;  5CKT A;  4PCQ A;  1R1V A;  4RM2 A;  3BCA A;  5JBQ A;  1PLU A;  3A1Y A;  4K2E A;  3ZQG A;  3DXJ F;  4HNU A;  3E7L A;  5JLW A;  2VUM J;  3CMA B;  3IRR A;  2H6B A;  2WA0 A;  5HLH A;  4OAY A;  5J4Y A;  4YAW A;  5FA6 A;  2VQC A;  2XV4 S;  2V9K A;  4G6T B;  5K7Z A;  2FXA A;  2K3P A;  4XLC A;  4HST A;  1PUF A;  2VNI A;  5TIS C;  4YZX A;  2FML A;  2ZTN A;  2R7F A;  2X8K A;  3ML6 A;  3CD6 I;  3WY9 A;  1E62 A;  2XNC A;  4UB6 C;  5BNG A;  1FYM A;  2CS3 A;  4M72 A;  4A3F J;  1OFC X;  3VYT B;  4Y9U A;  3GTJ J;  1TYX A;  3TO7 A;  3M8J A;  2GJR A;  1T95 A;  2LG4 A;  3OSG A;  3TMO A;  2GLO A;  4C2L A;  3BY6 A;  5E3O A;  3PUF A;  3TOA A;  1JA0 A;  4A3C J;  1OYI A;  4LJZ F;  3FK7 A;  3GTP J;  1X4P A;  4IPA A;  2GOX B;  4XLF A;  1K8A D;  1B1B A;  4V2F A;  4UVC A;  2ELJ A;  3JAM Z;  3JRD A;  2KIQ A;  4LB5 A;  1XB4 A;  2W4S A;  4D7M A;  2H27 A;  1I6H J;  3KE2 A;  4BNC A;  1TT0 A;  1A35 A;  4AYB N;  4ZZL A;  3OYM A;  1B2R A;  2LSO A;  2E1M C;  2PMZ N;  5EF6 A;  1YS6 A;  1MDM A;  1QQI A;  1U6G A;  1NB0 A;  1ZYR F;  1GVH A;  2CUF A;  5HVQ C;  5J40 A;  4XID A;  1G7R A;  2QQ9 A;  1R5N A;  4R1H A;  4M74 A;  4ZTF A;  3OIQ A;  4I99 C;  3ZMZ A;  3VSU A;  2DET A;  4W97 A;  3N97 A;  1TC3 C;  1D1C A;  4G9Y A;  5CLS A;  1KK1 A;  1T5E A;  1JXS A;  4Y7C A;  5D5W B;  5J4V A;  1OFD A;  3CZ6 A;  4A0Z A;  4LC0 A;  2QGU A;  1OFL A;  4FIS A;  1X2M A;  2IGN A;  5CVI A;  1MJ9 A;  2LYC A;  2VKH A;  3OOU A;  1P7I A;  3QQA A;  1JB9 A;  3OE7 A;  4C3I J;  1GLN A;  2K85 A;  1CNF A;  1R1U A;  2PEC A;  3PUB A;  2L9N A;  4OMZ A;  1IDJ A;  1OFE A;  1K5C A;  4MTD A;  4GYI A;  3KP3 A;  2VT3 A;  2GXG A;  1R71 A;  1WDT A;  5FO0 A;  2HZD A;  5C4X J;  2GBY A;  3CF5 F;  3S15 J;  2BGI A;  2HTJ A;  3SFI A;  4EGZ A;  2XAH A;  4U87 A;  4A3I J;  2F1L A;  4M0L A;  3OYJ A;  1YW7 A;  1Q7Y D;  1M1E B;  2LY9 A;  4XOP A;  3RIR A;  3H0D A;  3HRM A;  5J8F A;  1IN8 A;  1PDN C;  1ZUN B;  1H89 C;  3I9V 2;  3K9T A;  4AIH A;  4ZDL A;  3F23 A;  4IHX A;  1H80 A;  2KRH A;  2RQQ A;  3G71 I;  2HCJ B;  2C5H A;  2M8G X;  4AVP A;  3FXK A;  1Z1D A;  1HLV A;  1W0U A;  2KT0 A;  2DTZ A;  5LHG A;  2V7X A;  2LH9 A;  1QBJ A;  2XTX A;  1BX0 A;  1Q1V A;  2FVG A;  4I0A A;  1ZM9 A;  3OIP A;  3CTA A;  2ECB A;  2ICW G;  1ZAO A;  2V7W A;  3LSJ A;  2DOD A;  2DO7 A;  3FXQ A;  2VKE A;  4QVJ A;  1EXM A;  2XRL A;  4ESB A;  3MMY B;  2D3L A;  2JDI A;  4RDK A;  4Z4R A;  4DZJ A;  1WSU A;  2XTY A;  3ZMT A;  1WCM J;  3OYN A;  2DXI A;  3CMM A;  1VQL I;  4MEY F;  1X58 A;  2BW3 A;  3DTE A;  3SZG A;  3GLL A;  4KJZ A;  3LSM A;  2EFW A;  1UD2 A;  1E43 A;  1VLO A;  4FN5 A;  4A6D A;  2L7M P;  3K1P A;  5FLM J;  4O3M A;  3DEE A;  1D2E A;  2TDX A;  2JA2 A;  3HOS A;  5IYD J;  4N9I A;  2CV0 A;  2GAU A;  2EPF A;  1LM1 A;  1F36 A;  3KP4 A;  4I02 A;  3S2W A;  1W36 D;  2VBT A;  2E36 A;  5A8A A;  3A8K A;  5D8K B;  2R5Y B;  3MZY A;  1SFU A;  3VO2 A;  2R7W A;  4ZYD A;  3CF2 A;  3HC7 A;  1A6Q A;  4CCL A;  3IC7 A;  4MHG A;  1WWX A;  3GIR A;  3KL9 A;  4KYW A;  1NB9 A;  2UXN A;  3WHB A;  4C0S A;  1M1K D;  5FKO A;  4G1B A;  2LF8 A;  2DTR A;  4BE2 A;  4CYC A;  1O3R A;  4R71 A;  2QZA A;  3I59 A;  3I55 I;  2OUM A;  2QQ8 A;  2XZP A;  3L7W A;  2HS5 A;  4MNU A;  2ZC2 A;  3JQQ A;  2LVS A;  4OIN F;  2VXZ A;  5KK1 A;  3VDX A;  2WR8 A;  4HV6 A;  4P26 A;  3QOD A;  2ZBU A;  3I55 B;  4LFU A;  3CO6 C;  2K3F A;  3EET A;  3CCQ B;  4Z06 A;  1HA3 A;  3BH7 B;  5CQG A;  2ODL A;  1ON2 A;  4WZT A;  3GTQ J;  4HEA 2;  2Q2E A;  3ZR8 X;  4D9J A;  1QA2 A;  4BQA A;  2IA1 A;  1ZM3 A;  2DQL A;  1DAB A;  5CVR A;  4DYR A;  3KEW A;  1UD4 A;  1GT0 C;  2QDX A;  1CQT A;  5FFX A;  2ESN A;  2RGV A;  3VR6 A;  2D9R A;  3U9G A;  2VI6 A;  1TYW A;  2LRE A;  2ZME C;  3QFC A;  2VE8 A;  4TSF A;  3ZSC A;  2Y69 H;  3CCU I;  3F8C A;  1IW7 F;  2XOK A;  3G2B A;  4B44 A;  1MBK A;  4GFB A;  4YEL A;  2DYI A;  1E3O C;  4V2G A;  2WAF A;  3N6Z A;  4EW9 A;  1S7O A;  1MDM B;  2Y2Z A;  3GTG J;  4YAO A;  2HNH A;  4LG3 A;  4JOM A;  2L01 A;  3Q9S A;  5IY5 H;  4XLP F;  3AKZ A;  1K79 A;  2UUZ A;  1XS9 A;  4WWV A;  1AIR A;  2KL4 A;  1RQP A;  2OBT A;  2O17 A;  5DV5 A;  2OTJ I;  4L0Z B;  1EP2 B;  1G2H A;  4RPB A;  2VC0 A;  1YIO A;  2BXY A;  4AF6 A;  4A6E A;  2D45 A;  2E2J J;  4YEI A;  1I1S A;  2ZSI B;  1S72 B;  4RDJ A;  4NHJ A;  4DNR B;  2P6T A;  1QG0 A;  1F9N A;  3HJE A;  1YJ9 B;  4B3F X;  1FNC A;  3E3V A;  1E3H A;  1TQM A;  3ZQF A;  3GVK A;  2WYR A;  3ZC3 A;  3O8H A;  3ONQ A;  1O3S A;  5E3M A;  3S1N J;  4CIC A;  4X1E A;  1IB0 A;  2JJ1 A;  3S16 J;  2H1L A;  3OEE A;  1OGM X;  1Z3Y A;  3OJX A;  2CO5 A;  2E7X A;  1Y1W J;  4BYY A;  2DLL A;  2QSF X;  3PUN A;  1TQP A;  1X3Z B;  2FD5 A;  5FD5 A;  4HDV A;  2H1K A;  3BRO A;  4YFO A;  1ZLK A;  1I7P A;  3EUK L;  1FIP A;  2K9L A;  1Q1H A;  1WPK A;  2OJE D;  5AN9 A;  2LP0 A;  3ZQL A;  5DNS A;  3BPV A;  2BVM A;  4XQF A;  3MFK A;  4Y7N J;  4QVA A;  1HSJ A;  3WND A;  5J3O A;  3A1P A;  4JX4 A;  1FRN A;  5DCM A;  3E6C C;  3E0J B;  1ZAR A;  2QF7 A;  3PFY A;  4MGR A;  3GW2 A;  3EUA A;  4EV0 A;  2B7C A;  2OZ6 A;  2XAF A;  1KU7 A;  4H9G A;  2EZK A;  2X1C A;  1LKX A;  4YXW A;  2IS1 A;  1FYL A;  1XGN A;  1XMX A;  5FRO A;  5HDN A;  4ANJ A;  2HVS A;  1H0M A;  2KJB A;  1FNB A;  4F7Z A;  4ZCL A;  3TGN A;  3GX4 X;  1WOS A;  4DIQ A;  1QO0 D;  1MMS A;  2QY1 A;  1S5L C;  3SEZ A;  2E35 A;  4YZA A;  5IPA A;  2LMD A;  2XF7 A;  1HKT A;  2W84 A;  2OYN A;  1UAA A;  5AIQ A;  3AL0 B;  2VQG A;  1LLW A;  2P7V B;  1N0V C;  3F21 A;  2OQR A;  2DT6 A;  4LBZ A;  1S9H A;  5BSY A;  5IT9 K;  1OGI A;  4XLA A;  3LSP A;  3H9N A;  5EEH A;  3M7G A;  4OAZ A;  3W2V A;  4YZ0 A;  4O5V A;  2QBY B;  4M9X A;  1ETK A;  5IYW A;  1QGP A;  1W87 A;  2HEO A;  1IXS B;  1T6Z A;  1QZY A;  2GRE A;  1OCO H;  1OPC A;  3GTM J;  1WPC A;  1QVT A;  2STT A;  1MBF A;  4Z4W A;  4NDL A;  3ZMV A;  1Z6T A;  2VL8 A;  3CDL A;  1SC7 A;  1SAX A;  1CF7 B;  1I27 A;  2V6C A;  3QOE A;  4B3G A;  3D5L A;  3I58 A;  1BI3 A;  1T2K A;  4TT3 A;  4YC5 A;  5L3F A;  3CJN A;  2JSP A;  3RPU D;  2D2W A;  3R6S A;  4IX7 A;  4BQO A;  4FX0 A;  1SM4 A;  3RPU A;  2Z3Y A;  4ZCI A;  1VFC A;  4OPV A;  5FNZ A;  4QPQ A;  1AKH A;  1JJ6 C;  2NOJ B;  1A36 A;  4KN7 X;  4WXD A;  2HQR A;  2VBM A;  5K7F A;  4XMY A;  1KU3 A;  3S17 J;  1J9Z A;  5E1W A;  3CMA I;  3JX8 A;  3OYB A;  4HW0 A;  2Q2E B;  1VQN B;  3SJM A;  1TQI A;  2QE7 A;  1EFU A;  3IRQ A;  2X6O A;  1W1W E;  2BY1 A;  2BZT A;  2OC6 A;  2XGJ A;  3M1E A;  3G6E B;  1OR7 C;  2HXO A;  2HPI A;  5BQT A;  2AQF A;  2EA4 A;  2OCE A;  4NC7 A;  5E3N A;  2RKH A;  1BR1 A;  4GO1 A;  4WZE A;  1SVL A;  2JN6 A;  3OJW A;  2BHZ A;  4RA2 A;  3ZPP A;  4MLO A;  4HE5 A;  5B6I A;  3JR9 A;  1QUF A;  3Q3A A;  3OKX A;  4KKU A;  1JUM A;  2PX9 A;  3HKZ N;  3CMY A;  5J1R A;  1SD4 A;  4L9T A;  4UUS B;  4W8R A;  4BXU A;  2P3M A;  2G0E A;  3QSY A;  3ASO H;  2V1X A;  4L5E A;  2R93 J;  4X6A J;  4YII A;  3U2R A;  5JHU A;  3OSF A;  1OCR H;  2IW5 A;  2NV4 A;  4X06 A;  2VB6 A;  4E0F A;  2DEU A;  4Z4V A;  2VOO A;  2YSR A;  3GME A;  4G6D A;  4QPO A;  4Y33 A;  4HDU A;  2OPT A;  3RSN A;  3BLY A;  4M6V A;  3L2W A;  3MHP A;  2R7O A;  1FRQ A;  2V1D A;  1G3Y A;  1XC5 A;  1SKY B;  3CCR I;  2BN4 A;  1B9N A;  3EUH A;  2LZJ A;  2KMU A;  3ECO A;  3F8M A;  3QYB A;  3V4G A;  4XRS A;  2CGP A;  1IB4 A;  4YG2 F;  1HF0 A;  5FFZ A;  3PVD A;  1YW9 A;  5F4M A;  2BM4 A;  3ZRG A;  2XT4 A;  1S4M A;  3BOQ A;  4KIC A;  3CPX A;  2QX3 A;  2ZZG A;  4BHB A;  2EFO A;  3VMF A;  1RNL A;  3CCJ B;  4C9Y A;  4PAB A;  2EA2 A;  1KU9 A;  1OCP A;  1MD0 A;  1B4A A;  1UHW A;  3IH4 A;  3WTZ A;  1OKR A;  2MH2 A;  2B7B A;  2K86 A;  3BY2 A;  1WJC A;  1OQY A;  4UVB A;  1E3Z A;  1BN5 A;  3KZI C;  1XGO A;  2A68 F;  4C2M J;  1LUJ B;  2DA2 A;  1D1B A;  3I64 A;  2NVU B;  1YHQ B;  4MQV A;  3SZE A;  2EV0 A;  2KLO A;  3KP6 A;  2XZO A;  3WG7 H;  5D5U B;  5KCM A;  1TTT A;  2XKP A;  3CC7 I;  3Q39 A;  3B78 A;  5EG0 B;  5TY0 A;  3BY1 A;  2XC7 A;  1WJF A;  1HW1 A;  4NQW A;  3S1R J;  4IRI A;  2VFQ A;  1BJA A;  3P7N A;  1P4M A;  1ZG1 A;  4CCK A;  3WU0 A;  3IHU A;  2OZU A;  2ZXJ A;  3A3G A;  4P6Y A;  4IOC F;  1MSF C;  1BPL A;  2BBY A;  3K4M A;  3CCM I;  2QSH X;  1F20 A;  1N07 A;  2E34 A;  1D1N A;  3AAF A;  1R5H A;  2L7Z A;  4D1Q A;  3H35 A;  5FRN A;  1UD3 A;  1E3X A;  4P1V A;  2ZJR F;  3IUO A;  5LHH A;  1YLF A;  4Z2Y A;  3K69 A;  2CFO A;  3WTT C;  2Z33 A;  4V19 K;  3K70 C;  2O8X A;  2P6S A;  4RD3 A;  2WWY A;  3WTS C;  1I3Q J;  4YAU A;  5D6F A;  2PI0 A;  2EWN A;  3E1Y E;  2Z99 A;  4YZQ A;  4FT8 A;  2INU A;  4MIM A;  1ACI A;  2BM0 A;  4E4H A;  2DA1 A;  3GFL A;  1P7J A;  4HX7 A;  1TLH B;  4L9N A;  2O9L A;  5KW9 A;  2QA4 B;  2KZV A;  4DBQ A;  4YIF A;  3S1Q J;  1JI8 A;  1S6L A;  4BJ6 C;  4CSW A;  1QFZ A;  1VQO B;  3PEN A;  2HYG D;  4BHP A;  2FX0 A;  4UAJ A;  3QPT A;  5IYP A;  1IN4 A;  4UVA A;  1WJ5 A;  5M3M J;  5F4O A;  4W8T A;  3K4L A;  4G8X A;  4BXX J;  3ASP A;  2DQR A;  1YRN B;  3WE2 A;  2CK3 A;  5HOO A;  3W3C A;  1FX7 A;  2R7S A;  1R5I D;  3SFZ A;  2Q6O A;  2V31 A;  4RD1 A;  2FBH A;  5L3B A;  2B63 J;  1OB5 A;  2ELH A;  1D5V A;  1NHA A;  5ERI A;  3BR6 A;  1VQP I;  1Y8R B;  1VQL B;  3WGG A;  1MZB A;  2E1M B;  5J3L A;  2QKL B;  4HE6 A;  4LB6 B;  4YIR X;  2H94 A;  3FXR A;  2JSC A;  1XD7 A;  4XNF A;  5KVR A;  4J00 A;  5L46 A;  1M90 D;  2DAO A;  2KIS A;  1RI7 A;  4XM3 A;  4B09 A;  3ZGK A;  5LHI A;  2I1L A;  2VYQ A;  2NT9 A;  2FX3 A;  2VT2 A;  3PO3 J;  2AQE A;  2O7O A;  1FDR A;  5JLV C;  4Z4T A;  3CES A;  5LRR A;  2J5P A;  1LJ9 A;  3GFJ A;  4L9V A;  1O7L A;  3G73 A;  3HOW J;  2MAB A;  3V8L A;  3OW7 A;  1T33 A;  2L54 A;  5K5Q A;  1P4W A;  2UZK A;  2X48 A;  2LD5 A;  1GXP A;  4IXA A;  3AG4 H;  4M6X A;  2DA6 A;  4M3G A;  2DK8 A;  4ROX A;  2J8K A;  2DIE A;  1DP7 P;  2E19 A;  5FKK A;  1X1C A;  1W35 A;  2DA7 A;  4RMN A;  2EZH A;  4XRF A;  4LBW A;  4UZF A;  2IT0 A;  2NS0 A;  1X3U A;  5LGT A;  2Y9Y A;  3H5N A;  1T6X A;  3KPH A;  3RKW A;  3AL0 C;  2XSD C;  2ZIT A;  2HR3 A;  4KMU X;  4M2L A;  3GWZ A;  2QCO A;  2XVC A;  4HA8 A;  1HZE A;  2MBF A;  4HQM A;  1TTY A;  2DCE A;  2E60 A;  1BOB A;  1PUF B;  1D0Z A;  2JT1 A;  3C2G A;  3RIQ A;  3JRA A;  2F3L A;  5A2Q Z;  1J0R A;  2XRN A;  1EE6 A;  1W4M A;  3ELK A;  1N25 A;  1SD7 A;  4OIR F;  2JA8 J;  4ITV A;  4BE1 A;  5IYN A;  2IS6 A;  4YFX F;  4A3K J;  2Y48 A;  1MAB A;  2R9V A;  3C1D A;  1W0K A;  3JQR A;  1OJL A;  3CUQ B;  5LFA A;  4J01 A;  5DCF A;  1WSR A;  1Q86 D;  1GVJ A;  3FK6 A;  4PSW A;  3FHZ A;  3L1P A;  4PGO A;  1VQK B;  1IJE A;  1VHE A;  1VQ9 B;  4A3E J;  3OS0 A;  2EIX A;  1PP7 U;  1F1Z A;  3Q9V A;  2NSP A;  1YJN B;  4RLF A;  1GQ8 A;  4ZGN B;  1JUS A;  3MN2 A;  5D5X B;  2JRM A;  3IV5 A;  3HZJ A;  2V1N A;  2QZ8 A;  1K6Y A;  4IJA A;  3OYK A;  3PM1 A;  4U0W A;  1SD6 A;  4P1W A;  4UXN A;  1S72 I;  2YS9 A;  4KT6 A;  5GAE J;  1U78 A;  4AVZ A;  1G7S A;  1KK3 A;  2VNH A;  3AVU A;  3VYU B;  3X2Q H;  5FKM A;  2Z8G A;  1JNY A;  2IQ7 A;  1PUE E;  2GA1 A;  3DBR B;  3V8K A;  4ZTJ A;  1OCZ H;  1XSD A;  3T8T A;  2VBX A;  1F5T A;  1OLT A;  1X1D A;  3HHH A;  1VQ4 B;  3R0J A;  3VB2 A;  1YYV A;  1TYU A;  3NE5 B;  1LDK B;  5LRS A;  1LE8 B;  2A07 F;  4ETS A;  2A5W A;  4PK4 A;  1LE8 A;  1BC7 C;  1R23 A;  2VJI A;  1PXZ A;  2XF6 A;  1AMO A;  2DJI A;  2JA7 J;  2Z6B D;  1E1R A;  3KEY A;  1Y6I A;  1KCD A;  2AO9 A;  5J35 A;  3GUD A;  3S93 A;  3Q6R A;  4ON0 A;  2VBY A;  2FF4 A;  3QFT A;  5F1R A;  1V4R A;  1TWH J;  3MAJ A;  5J6X A;  2MA3 A;  3KLO A;  1XSX A;  3LFU A;  1OHH A;  1S29 A;  3O8G A;  1Y39 A;  2Z9O A;  2E2I J;  4B4D A;  2KRC A;  2YWE A;  2EK5 A;  2M4G A;  2HWV A;  1E17 A;  1XTA A;  3G05 A;  1PJ7 A;  3EQL F;  1HBX G;  3NEU A;  5FLX Z;  3ASS A;  5FO5 A;  1YIT B;  2JUC A;  3WTY C;  2LOO A;  2FOW A;  2VNK A;  1MJA A;  2IBD A;  5K7H A;  2IP2 A;  2HOA A;  3PA2 A;  3S8P A;  4YHB A;  1BLI A;  2KQR A;  3ZCO A;  5JFR A;  3G3Z A;  1V0E A;  3NWS A;  2CW5 A;  2EFG A;  1KU2 A;  3K1M A;  4HV5 A;  4BY1 J;  5DCM B;  1RQR A;  3CB4 A;  3OYF A;  3CCV I;  5F0F A;  1MJB A;  2FBK A;  2NS8 A;  3CLO A;  4OP7 A;  1QRC A;  1NG6 A;  1QJV A;  4EJT A;  3B8Y A;  3S3M A;  1WRJ A;  2HMA A;  1L0O C;  3OYL A;  2ZJP F;  3KP2 A;  3HB9 A;  2M45 A;  1HST A;  3BG9 A;  3HTU A;  1X19 A;  3B73 A;  2LKX A;  1WJE A;  2V7Q A;  2GK7 A;  4LLG F;  4F55 A;  1ETY A;  5CPR B;  2JVG A;  4JMQ A;  4YAF A;  2XC1 A;  1VQO I;  1VJS A;  3QE2 A;  4IW3 B;  2IJL A;  1ZGA A;  3K7A J;  3PQJ A;  2FJ1 A;  3JTH A;  2WSS A;  5ED4 A;  3DEW A;  3U6K A;  1JKQ C;  3OYI A;  1ZRD A;  1IUF A;  2IS4 A;  2PLF A;  2ID3 A;  3JRF A;  2JRT A;  3O3K A;  3CP8 A;  3S14 J;  4KIF A;  4P55 A;  4EJW A;  1IG7 A;  3H9Q A;  1QVU A;  4BHC A;  2XAQ A;  1VQM B;  3UW0 A;  3MCZ A;  4NC8 A;  1RR7 A;  3RKX A;  1KD1 D;  4IHV A;  4X7D A;  3A8I A;  4Z4U A;  3CJQ B;  4UZE A;  1IXC A;  1VLY A;  3J7A Y;  4UNO A;  4IHY A;  3DBH B;  1IRF A;  1EF4 A;  2O0W A;  2YWG A;  3G4S I;  3HRU A;  2X6X A;  4AM3 A;  1PP8 F;  3ZZU A;  4M9Z A;  3SHF A;  3RKY A;  1ZHF A;  3I3L A;  1L3L A;  4U7D A;  4ENJ A;  1BC8 C;  3GRH A;  3OL3 A;  3C3W A;  2RVC A;  2XZL A;  2GPJ A;  1BX1 A;  4RAZ A;  5CVV A;  2CSO A;  1TWC J;  3CC2 I;  2LKP A;  2X4H A;  1MW7 A;  2XB5 A;  1BA5 A;  1BHE A;  1KQ8 A;  3QPS A;  1X3W B;  4OOV A;  5JHF A;  2FOK A;  1EFT A;  4FAS D;  3LQE A;  3LA2 A;  2HDN B;  1O8F A;  1K83 J;  4B1R A;  1K78 B;  5DS0 A;  2PJR B;  2BM1 A;  2XSJ C;  1G3S A;  5J47 A;  3HOU J;  3SDB A;  2VJ5 A;  4TMZ A;  4U88 A;  1UD5 A;  1Y1V J;  4DNT B;  1OMI A;  3DKX A;  4Q47 A;  4N3G A;  2PMD A;  1FOK A;  2JVH A;  1WI9 A;  3BPX A;  1T56 A;  1BIB A;  2A6T A;  5DN6 A;  3E1S A;  2NZM A;  2QWW A;  2DMP A;  4Q48 A;  2DOG A;  2PFB A;  2W85 A;  3CCJ I;  2VZL A;  4ZJZ A;  1MSE C;  2NT6 A;  1U3E M;  3T51 B;  4EH1 A;  9ANT A;  2V79 A;  2O5R A;  4KIG A;  5E17 F;  1Q81 D;  2O6G E;  3WWG A;  2M9H A;  1TNT A;  3WBJ A;  1WMR A;  1S0U A;  1VQ8 B;  2EWE A;  2NOG A;  2NST A;  4PC3 A;  4W8S A;  1UG2 A;  2PMZ A;  4BPR A;  3AVW A;  2MC3 A;  1RWR A;  5DUK A;  3L2V A;  3CME I;  1T6Y A;  4RS8 A;  1CF7 A;  3I54 A;  3WU2 C;  4BAC A;  4FCY A;  4X7E A;  3ZXS A;  1O8I A;  2ZXW H;  4A12 A;  3LYC A;  2QA4 I;  1JKO C;  2OQG A;  1QCX A;  3IH3 A;  5DDG A;  3RQ4 A;  4HZF A;  3RKQ A;  2KP6 A;  2P5V A;  2R7Z J;  2FQ4 A;  4CO8 A;  3CCL B;  2CRG A;  4EM2 A;  5IOY A;  2OBP A;  2EFQ A;  4B48 A;  1W9X A;  3PNY A;  3TOB A;  3BP8 A;  4CZZ A;  2QVO A;  1YQA A;  4QV2 A;  2DT5 A;  2E5Z A;  4UUT A;  1KK0 A;  5DM7 F;  1AU7 A;  1RUO A;  3OW2 B;  4UV9 A;  4BL0 B;  2LNB A;  5HLT A;  2VBZ A;  3DF8 A;  4RB1 A;  1FSH A;  1ETO A;  3CW2 A;  2KRF A;  1LNW A;  4F92 B;  4XD7 A;  2R7D A;  3J81 K;  1ZGW A;  3GXO A;  1LFP A;  3G71 B;  3FIW A;  4Y3O A;  3W5H A;  2BM5 A;  1I5Z A;  1TW2 A;  4ABZ A;  1T98 A;  1RUN A;  3E20 A;  3RCO A;  4OPS A;  4Z1M A;  3JSO A;  4ASU A;  1O8E A;  2X3H A;  1XGM A;  2QM3 A;  3OS2 A;  4DYQ A;  1D0X A;  3RYP A;  3G6E I;  2IGM A;  2MLG A;  1XQB A;  1BJK A;  4X0C A;  4P3I A;  1P4A A;  1N77 A;  1UG0 A;  2WB1 A;  4IQ4 A;  1DBG A;  2Q6I A;  1UEL B;  4DQK A;  5IT9 Z;  2XB0 X;  1T6S A;  5IT3 A;  4CCM A;  1TWA J;  1DU0 A;  2CUZ A;  4PC1 A;  1FT9 A;  2BY2 A;  1QX4 A;  3DFG A;  1WH7 A;  4XSX F;  4CCO A;  4BH9 A;  4CZC A;  4H0E A;  1U8R A;  1DUX C;  1HDD C;  3GTO J;  2O0V A;  2KHM A;  5IYB J;  2PE3 A;  2VBU A;  1K28 D;  1O3Q A;  3E6M A;  2VPL A;  2V6E A;  1PJ5 A;  1R9T J;  4A0X A;  3N90 A;  5E8I A;  2JTV A;  3BH6 B;  1SFO J;  1XMK A;  4BBR J;  1WZ2 A;  3J81 k;  4P9F A;  2NTQ A;  1EA0 A;  3BNW A;  3ECH A;  5B5E C;  2CQQ A;  4P9U A;  2L4A A;  2BE5 F;  4MTE A;  3NAR A;  4RLQ A;  5BS6 A;  2EQR A;  2P5L C;  2HOT A;  3B8H A;  1Z05 A;  2L9S A;  2MH9 A;  3E5X A;  3K4K A;  3BTI A;  3BC8 A;  4F7D A;  3F3X A;  1U2R A;  2C2W A;  1FSE A;  2RC6 A;  1GV2 A;  2HU9 A;  2KIU A;  2LK2 A;  4ESF A;  3ZQC A;  2YWH A;  3B90 A;  3S2H J;  1XSV A;  1GAQ A;  2HQA A;  3OOP A;  4UY8 I;  2X0K A;  4IQJ A;  2A5Y B;  3HPH A;  1ZQ3 P;  1O4X A;  4MQ9 F;  1BI2 A;  3PL8 A;  1SFK A;  3R4K A;  2H09 A;  1K4T A;  2MFZ A;  3ASN H;  3FJO A;  1Y0R A;  3SDG A;  2UWM A;  1A5J A;  1FNN A;  3MD2 A;  1MMG A;  1WU8 A;  3BC9 A;  4QHY A;  2BHY A;  3T0Y A;  2CUE A;  4C2T A;  3CCS I;  3B4N A;  1MBG A;  4NUB A;  1L1I A;  3V76 A;  3O6B B;  5DS9 A;  2CV2 A;  5FRM A;  1JA1 A;  5L3E A;  2OBR A;  4M6Y A;  1FOW A;  4ENK A;  2VXD A;  1R6R A;  4P9S A;  3SQV A;  3S3N A;  2OD5 A;  4XKB A;  2VBS A;  1TNS A;  4KFC A;  4G6I A;  4RB2 C;  4LK0 F;  4GGG A;  1Q9S A;  3WTU C;  3QFS A;  4U0Y A;  1CGP A;  4XK4 A;  5GPA A;  1NK2 P;  2O04 A;  3GLX A;  1QU3 A;  3FDY A;  4M3E A;  4Z4Y A;  1K4S A;  3E97 A;  1OFM A;  1X2N A;  1VQ7 I;  4OIO F;  2VOP A;  3AST A;  3CXC B;  3KP7 A;  3H3Z A;  2CWE A;  2ID6 A;  3GYH X;  1UMK A;  1CNE A;  3ZUG A;  1IGN A;  1K61 A;  1JRG A;  2MYS A;  1Y0N A;  3OL4 A;  4OIQ F;  2LY1 A;  3FZV A;  2BSP A;  3OP1 A;  2DOF A;  1VQN I;  4I2O A;  2X9D A;  2LBF A;  1FP1 D;  3VYS B;  1ZKG A;  1S3J A;  3PJR A;  3MMP A;  2OU2 A;  2VPR A;  2HQ5 A;  4PZJ A;  2LBF B;  6PAX A;  3JAM K;  2J8I A;  1IC8 A;  2XPV A;  1R22 A;  3CC7 B;  4S04 A;  3W2A A;  4DK1 A;  1R36 A;  3QOP A;  2ZL5 A;  3ZQH A;  2JIZ A;  1ZK8 A;  1W7P D;  2XIG A;  4EJV A;  3OYH A;  1QA1 A;  2X53 S;  3SYJ A;  1G4D A;  4E7S A;  5M5W J;  3J81 Z;  5EDN A;  3LA3 A;  1H42 A;  4OJP A;  2X85 A;  2BV6 A;  2XAS A;  4JYK A;  2ZXI A;  3EYI A;  1Y0U A;  3K4C A;  2L9R A;  2ISZ A;  1A04 A;  2L2O A;  5J1Y A;  3GQ7 A;  3EQO A;  2BV3 A;  5K1Y A;  3FPK A;  3DPU A;  2E1O A;  2WC2 A;  3A4C A;  3K4J A;  5F6F A;  3TBI A;  4XON A;  5FKN A;  5F1J A;  4IZZ A;  1NH3 A;  3ERE D;  1J09 A;  2ISY A;  2M3A A;  1YTY A;  5GAG J;  2VKV A;  2M4K A;  2CQ7 A;  5BOX A;  3VMW A;  1UFM A;  4LIU A;  5IOZ A;  4JRA C;  1ZRC A;  2F48 A;  2ZKZ A;  3H9G A;  4PSX A;  4EQQ A;  4RGR A;  5B1A H;  5IP7 J;  3IKT A;  1FNM A;  1NBM A;  2ECC A;  4JX5 A;  1SMT A;  4Q7J B;  3CCU B;  4MYT A;  1I6X A;  3M1C A;  3MQ0 A;  3CCE I;  2XPU A;  2ZJ2 A;  2QKM B;  1B6A A;  3R60 A;  4HLX A;  4BDY A;  1LPQ A;  2EIN H;  3DPT A;  4QSH A;  5FIU A;  3CCE B;  2KZG A;  2F4O B;  4EAT A;  2Y31 A;  5LMZ A;  2XGX A;  3BR5 A;  2WY7 Q;  3H5R A;  3MEX A;  4JK1 X;  1GO2 A;  3OYA A;  5EG0 A;  2V4D A;  5GPC A;  1AHD P;  1NDH A;  2VFM A;  3H94 A;  4L9J A;  2HOS A;  4M53 A;  1W34 A;  2NPF A;  4OU0 A;  3AFH A;  4JP0 A;  2Z16 A;  1R4M B;  2IVM A;  4JX6 A;  2HFH A;  4OWR B;  3KYC B;  2ME0 A;  3FBI B;  2YX7 A;  4WCG A;  1TLL A;  5JI6 A;  3ASR A;  4AF7 A;  3OS1 A;  4BJT A;  1WGX A;  5THX A;  4R8H A;  3ZPN A;  4BUP A;  2F5V A;  4XN3 A;  2CC2 A;  2HVR A;  4JBA A;  1ONV A;  4BEH A;  4HOB A;  1ERD A;  4ENM A;  1T38 A;  1FZP B;  5JMC B;  1J5Y A;  1R58 A;  2OV7 A;  2KDO A;  1JHH A;  1N06 A;  1YIT I;  4HYE A;  4BDZ A;  1W36 C;  2D3N A;  1X0C A;  4HNV A;  1T0F C;  3W2E A;  1IA5 A;  3H09 A;  4XOR A;  4RB3 C;  1FC3 A;  4Y9R A;  1B8I B;  2ZTG A;  2DDA A;  2R4G A;  1BL0 A;  2O61 A;  3FY3 A;  3B6C A;  2V26 A;  3PUM A;  1TVC A;  3TL4 X;  4LLL A;  4DW6 A;  4EJU A;  1WKM A;  3CC2 B;  1IV8 A;  5H2F C;  3PSS A;  3A03 A;  3I59 B;  5M5X J;  4OJL A;  4NB5 A;  1ORK A;  2A6H F;  5FD6 A;  4KKS A;  4HWV A;  3OYD A;  1PJR A;  2B7E A;  2EIK H;  4XOT A;  4OPO A;  4G6Q A;  2YPR A;  3JUR A;  4O6J A;  4CYD A;  1TYV A;  1AIP A;  1PVE A;  3REO A;  4P3Y A;  5HLI A;  4B8X A;  4AD9 A;  2V7U A;  3HRT A;  3CDH A;  2NNN A;  3I56 I;  4A5N A;  1P2F A;  2CH0 A;  1D0Y A;  4ZYA A;  3E6D A;  2VAS A;  3NRV A;  4QIW N;  2MGQ A;  2K40 A;  1F43 A;  3M4O J;  4EM0 B;  4BE0 A;  1KMH A;  2FMY A;  3P9I A;  3EUH C;  3FHN A;  2VKD A;  1IN5 A;  5DYM A;  3RJP A;  3ZN1 A;  3G1M A;  2M1B A;  4PGH A;  3S2D J;  1A8P A;  4TMT A;  1LLZ A;  4P96 A;  5D4S A;  4BY7 J;  1FBU A;  4Y13 A;  2KKO A;  4RDL A;  1OB2 A;  2F4N A;  3BH4 A;  5GTI C;  3KEQ A;  1XMA A;  3CD6 B;  2DFH A;  4DQ2 A;  2V1U A;  1HW5 A;  1O7F A;  5JVG F;  4C3J J;  2ME6 A;  3U1D A;  2CRV A;  1ZM4 A;  3QPH A;  5DTD A;  1EH8 A;  5EYR A;  3Q0V A;  2WY8 Q;  4HF2 A;  3CP2 A;  2G7U A;  1K4Z A;  2BOL A;  2QYU A;  1DPR A;  2RAE A;  3G1O A;  2RQP A;  3LSR A;  3AVV A;  3DU5 A;  1IN6 A;  2EZL A;  1VQ8 I;  5C1E A;  3TDZ C;  4M1K A;  5IYQ A;  2GOM A;  3VNV A;  1MRZ A;  1O8M A;  4A3J J;  4ZC3 A;  3LJY A;  3OV8 A;  1J2X A;  3HXL A;  4OMY A;  4D7N A;  3CCQ I;  3DP7 A;  4A3B J;  3ISP A;  4P12 A;  1LQ1 A;  2BSA A;  1U0J A;  2WJY A;  2QQB A;  3AVT A;  3ZBT A;  2ZBV A;  2L7F P; 
#chains in the Genus database with same CATH homology
 1MMN A;  5LFA A;  4J01 A;  2JJ2 A;  3FKS A;  4PSW A;  2IGN A;  2LYC A;  2VKH A;  3OOU A;  3OE7 A;  1GLN A;  4BJ5 C;  1DP3 A;  3KYL A;  3DU6 A;  3C2H A;  3OS0 A;  1HVX A;  3PUB A;  2L9N A;  1IDJ A;  2DOA A;  1K5C A;  2NSP A;  4RLF A;  2K5C A;  1GQ8 A;  4E7J A;  2HZD A;  5HKK A;  3SYT A;  2WBM A;  2V1N A;  1K6Y A;  3OYK A;  4U87 A;  4BGD A;  4P1W A;  3VWB A;  4KT6 A;  3OYJ A;  4AVZ A;  2E5N A;  2Z8G A;  3VYU B;  2Z2S B;  1V5G A;  2IQ7 A;  5AMV A;  4XOP A;  3H0D A;  4ZTJ A;  2CW8 A;  4GQN A;  1OLT A;  1X1D A;  3I9V 2;  3NE5 B;  1LDK B;  4ZDL A;  2R7U A;  1H80 A;  4TKO B;  3GQB A;  2KRH A;  2A5W A;  2RQQ A;  4PK4 A;  2VJI A;  1PXZ A;  1V5E A;  2XF6 A;  3QYE A;  4ZDP A;  2DJI A;  2Z6B D;  2LH9 A;  1E1R A;  3KEY A;  1Y6I A;  2R7X A;  3LNN A;  3OYE A;  4XKC A;  5LD2 C;  1KCD A;  3S93 A;  3OIP A;  2HDW A;  3GQA A;  2X51 A;  2WJV A;  2JDI A;  2D3L A;  3MMY B;  4XLH A;  2Z1D A;  3LFU A;  3HL2 A;  1OHH A;  1ZEL A;  4FXU A;  3OYN A;  2DXI A;  2NTP A;  3CMM A;  1O8K A;  3LSG A;  2KRC A;  5CDF A;  4OZZ A;  2BW3 A;  3DTE A;  2M4G A;  3SZG A;  3G05 A;  4KJZ A;  3LSM A;  1UD2 A;  2VJJ A;  1E43 A;  1G59 A;  3LL7 A;  2VQL A;  4BEH B;  3PSI A;  2I8D A;  2K9M A;  2LOO A;  3DEE A;  3LMM A;  1VZ0 A;  2JA2 A;  3HOS A;  3S8P A;  2CV0 A;  1BLI A;  2KQR A;  3ZCO A;  1W36 D;  1V0E A;  3NWS A;  3PNT A;  3HOT A;  2R7W A;  3OYF A;  1O88 A;  3CF2 A;  3HC7 A;  4CCL A;  3F9K A;  2ZXH A;  1NG6 A;  2WPD A;  3NWT A;  2L7K A;  1QJV A;  4NNJ A;  3B8Y A;  3K70 D;  4BE2 A;  3S3M A;  3K4B A;  3KRG A;  3OYL A;  3MKY B;  2OUM A;  1X1A A;  2XZP A;  1X19 A;  2VXZ A;  3VDX A;  1WJE A;  3QOD A;  2V7Q A;  2GK7 A;  4NK6 A;  4F55 A;  5CPR B;  2LY2 A;  2JVG A;  4JQF A;  4JMQ A;  4Z06 A;  2M7A A;  5CQG A;  3K6G A;  1VJS A;  1O8J A;  2BW3 B;  2ODL A;  2MD0 A;  2WSS A;  4F93 B;  4HEA 2;  3ZR8 X;  4CUG A;  4D9J A;  1OGO X;  3OYI A;  2V4J C;  2IS4 A;  3CP8 A;  3OR1 C;  3KEW A;  1WJD A;  1UD4 A;  3H9Q A;  1O8L A;  2W6J A;  3UW0 A;  5C1C A;  4NC8 A;  1OOC A;  4BS9 A;  2ZFU A;  4P5O A;  1FX0 A;  3VR6 A;  1RU4 A;  4ZDO A;  4OJ6 A;  3CJQ B;  3VYR B;  2LRE A;  4LIT A;  1VLY A;  3J7A Y;  4TSF A;  3ZSC A;  2O0W A;  2ZZE A;  4CH7 A;  4G7X A;  2XOK A;  3G2B A;  2X6X A;  4HSR A;  3OWT A;  4YEL A;  4B44 A;  1COW A;  1I8D A;  2WAF A;  4EW9 A;  1Y56 A;  3KX2 A;  2HNH A;  4LG3 A;  4Y4R A;  4JOM A;  3AKZ A;  3A2K A;  3I3L A;  2UUZ A;  3OMY A;  4XKW A;  2F43 A;  4NK8 A;  3GRH A;  1AIR A;  2KL4 A;  3OL3 A;  2O17 A;  2IXS A;  3GVL A;  2WZP P;  1Z3X A;  2XZL A;  4FET A;  4XL9 A;  4E7I A;  1UD8 A;  2RNG A;  2ZSI B;  2ZZQ A;  1MW7 A;  4DNR B;  2VQH A;  1YE9 A;  1BHE A;  3DLA A;  3OYG A;  4B3F X;  5JHF A;  3H9J A;  4FAS D;  5TGT A;  1O8F A;  3GVK A;  4OZY A;  2X6Y A;  2PJR B;  3ONQ A;  4AYB A;  3IAM 2;  1O8D A;  2M7B A;  2XSJ C;  2Y0S A;  2W1O A;  2X1D A;  2VJ5 A;  3SDB A;  2X1E A;  4F52 A;  1UD5 A;  1BR4 A;  2JJ1 A;  3OEE A;  1Z3Y A;  4DNT B;  1OGM X;  1MMA A;  3DKX A;  3SUC A;  2JVH A;  3BG7 A;  4W8Q A;  2A6T A;  2XDV A;  3L2Q A;  3E1S A;  2M5S A;  2NZM A;  3EUK L;  1E1Q A;  2K9L A;  1IRX A;  1XG2 A;  3GBG A;  4ZJZ A;  4GRI A;  2CV1 A;  2LRD A;  1E0E A;  2NT6 A;  3T51 B;  1VBL A;  5IK2 A;  4L8J A;  2BVM A;  2O5R A;  4XQF A;  3BG6 A;  3HPG A;  3HKZ A;  3FPP A;  4PFP A;  3WWG A;  5CQE A;  1WMR A;  2EWE A;  3OAA A;  1N78 A;  4W8S A;  1UD6 A;  2INV A;  2NST A;  2PMZ A;  4C30 A;  3E0J B;  5HNF A;  4PJL A;  3PFY A;  1RWR A;  3EUA A;  3L2V A;  2PYG A;  4OJ5 A;  1BR2 A;  4YEJ A;  1MMD A;  3IP4 B;  2X1C A;  1LKX A;  4YXW A;  2IS1 A;  4BAC A;  3OFN A;  1O8I A;  3ZXS A;  3D5R C;  4DOZ A;  5FRO A;  4ANJ A;  2HVS A;  1QCX A;  1YX3 A;  2PJR A;  2PYH A;  4DIQ A;  2VBE A;  3RQ4 A;  2E1B A;  2QY1 A;  3SEZ A;  2KP6 A;  4YZA A;  3ZIA A;  4XLE A;  2XF7 A;  1P9Q C;  1UAA A;  1WJB A;  1W9X A;  4B48 A;  3PNY A;  4CA0 A;  4PMH A;  1KCC A;  2V7F A;  3AL0 B;  2VQG A;  4PJM A;  2E5Z A;  1E79 A;  2DT6 A;  2XND A;  4II2 A;  1S9H A;  5HLT A;  4BL0 B;  4XLA A;  4KIT B;  4XR6 A;  4HPQ A;  4YZ0 A;  4OAZ A;  3W2V A;  4F92 B;  4XD7 A;  3GQ8 A;  3BCB A;  4N4O B;  1LFP A;  4Y3O A;  1KON A;  3VMW A;  4Z1M A;  3RCO A;  4ASU A;  1O8E A;  3PNV A;  1PKV A;  2UV1 A;  2X3H A;  3L2R A;  3OS2 A;  1OB0 A;  1D0X A;  1WPC A;  2IGM A;  4E7H A;  2VL8 A;  3DTK A;  3K4N A;  3K10 A;  3QOE A;  1N77 A;  4B3G A;  1UG0 A;  2CW7 A;  2WB1 A;  3D5L A;  4IQ4 A;  2W6I A;  3QYF A;  4TT3 A;  1DBG A;  2JSP A;  1UEL B;  3RPU D;  3T56 B;  3EQN A;  4IX7 A;  2QXZ A;  4BQO A;  1EA3 A;  4U7B A;  1FMW A;  2BVL A;  3IAS 2;  4HNT A;  4CCM A;  3HAG A;  2CUZ A;  1DBO A;  4PJJ A;  4XN0 A;  1YX5 A;  1X4O A;  4E6K G;  4CZC A;  4CCO A;  1SAU A;  4B3X A;  3GQ9 A;  4QPQ A;  2O0V A;  2KHM A;  2NOJ B;  3A35 A;  4U49 A;  2VBM A;  1K28 D;  1G8X A;  4XMY A;  2GJK A;  2CMP A;  3DDY A;  2VPL A;  2L5Q A;  2V6E A;  4MXN A;  4C2U A;  3OYB A;  2Q2E B;  3JU4 A;  3H5A A;  4I84 A;  2NTQ A;  2QE7 A;  3DTI A;  2XAU A;  2F4I A;  2OC6 A;  2XGJ A;  3FKJ A;  4RLQ A;  4B47 A;  3DPL C;  1OR7 C;  2L9S A;  4P22 A;  1JTA A;  3K4K A;  1V5F A;  3MKZ A;  4Z03 A;  5FL7 A;  3BC8 A;  2HPI A;  2AQF A;  4NC7 A;  1BR1 A;  2W7N A;  4X0G A;  2HU9 A;  4II3 A;  1WP6 A;  3B90 A;  2GK6 A;  3ZPP A;  2HQA A;  4MLO A;  3EPZ A;  4AU7 A;  4IQJ A;  3HPH A;  2FUG 2;  4KKU A;  3OY9 A;  3PL8 A;  1SFK A;  2IS2 A;  2MFZ A;  3OOC A;  4W8R A;  3DKY A;  2UWM A;  2CUJ A;  4U4B A;  1QHG A;  2KPM A;  3MD2 A;  1MMG A;  1LVK A;  1MND A;  4URR A;  3BC9 A;  4C2T A;  4MR0 A;  2MC4 A;  1DQU A;  3B4N A;  4NUB A;  2VB6 A;  3S3O A;  2CV2 A;  1TZL A;  5FRM A;  4QPO A;  4Y33 A;  4DJA A;  3ZQQ A;  1BMF A;  3RSN A;  3BLY A;  3L2W A;  2VXD A;  1R6R A;  2R7O A;  4YRV A;  3S3N A;  5DN6 A;  1W0J A;  4XKB A;  4Z05 A;  3VSL A;  1SKY B;  1HA8 A;  4G6I A;  4DGW B;  4B43 A;  4OJO A;  2LZJ A;  2KMU A;  2R7Q A;  3QYB A;  1IB4 A;  4HIZ A;  3LSI A;  2WAD A;  3ZRG A;  4BQQ A;  2O04 A;  1QU3 A;  4G7W A;  3FDY A;  2QX3 A;  1X1B A;  2ZZG A;  1H8E A;  2W82 A;  1OFM A;  1HG8 A;  2X6W A;  4CCJ A;  3OPO A;  1DGR M;  1QHH D;  4BXF A;  4C9Y A;  4E7L A;  1JRG A;  2MYS A;  3OL4 A;  2LY1 A;  2BSP A;  3LMW A;  2LBF A;  3VYS B;  3PJR A;  1WJC A;  2IGK A;  4F3Q A;  5KHD A;  1E3Z A;  2UVF A;  2LBF B;  4XKV A;  3LSH A;  3VMV A;  1D1B A;  3FBN B;  4DBR A;  3W2A A;  2M0M A;  4DK1 A;  2JIZ A;  2KLO A;  2O1D A;  3OYH A;  2HPM A;  2XZO A;  3OR2 C;  5KCM A;  2X53 S;  3BCD A;  1BN8 A;  4E7S A;  1I18 A;  2XC7 A;  4OJP A;  1WJF A;  2JUG A;  2X85 A;  2ZXI A;  4KIS A;  5HNH A;  1RMG A;  2LC2 A;  2XF5 A;  3K4C A;  4IKF A;  2L2O A;  3SEQ A;  1Z21 A;  3UR3 C;  2GJP A;  3GQ7 A;  1H8H A;  3EQO A;  2F6C A;  4PUS A;  3DPU A;  4CCK A;  3A4C A;  1DGW Y;  3K4J A;  4IZZ A;  3TBI A;  4XON A;  3WQZ A;  1O8G A;  2NTB A;  3A3G A;  1J09 A;  2M3A A;  3S32 A;  2P0W A;  1BPL A;  4N4N B;  2M4K A;  3N05 A;  3K4M A;  4LIU A;  3OYC A;  3H9G A;  4PSX A;  2VLA A;  1NRK A;  4D1Q A;  5FRN A;  3H35 A;  1NBM A;  1UD3 A;  1E3X A;  1WTH D;  4KKT A;  3IUO A;  4DK0 A;  2VBK A;  2KVO A;  3M1C A;  2CFO A;  4F91 B;  3DWL E;  3PSF A;  3K70 C;  2QKM B;  4BDY A;  2HLD A;  3CJR B;  4R79 A;  3DPT A;  4EAT A;  4YZQ A;  3H5R A;  1IDK A;  2WY7 Q;  2INU A;  2UVE A;  2WAE A;  1WFX A;  3OYA A;  3LSK A;  3UNG C;  4HG2 A;  4E4H A;  2V4D A;  1CZF A;  4NQW B;  3H94 A;  2KZV A;  4DBQ A;  1JI8 A;  1VF7 A;  4BJ6 C;  1NG7 A;  4CSW A;  3AFH A;  4E0F A;  2Z16 A;  2RRE A;  3L2U A;  2PEC A;  4LIV A;  4OWR B;  2VJ4 A;  3FBI B;  3T9G A;  4HRI A;  3OS1 A;  2VIX A;  4BJT A;  3DQV C;  1AA7 A;  3ZPN A;  4BUP A;  1WJ5 A;  2F5V A;  1MNE A;  2IGO A;  4XN3 A;  2HVR A;  4BU2 A;  2ZSH B;  4W8T A;  3K4L A;  1FMV A;  4BEH A;  2DT7 B;  1ERD A;  3OEH A;  4E7Z A;  2CK3 A;  1WJA A;  2OV7 A;  3RTR A;  2KDO A;  5HOO A;  3W3C A;  2R7S A;  3BCF A;  4BDZ A;  1W36 C;  2V31 A;  2R7T A;  2D3N A;  1X0C A;  3VST A;  1T0F C;  1IA5 A;  1D1A A;  4XOR A;  4E7K A;  1KTW A;  2ZTG A;  5CKT A;  3U21 A;  2R4G A;  3FY3 A;  4RM2 A;  2E1M B;  3BCA A;  2QKL B;  2V26 A;  3A1Y A;  1PLU A;  3D5S C;  4HNU A;  3TL4 X;  1V0F A;  4J00 A;  4XNF A;  2WA0 A;  4OJL A;  4OAY A;  4UZU A;  2VQC A;  3W2W A;  4KKS A;  2V9K A;  4HWV A;  4XM3 A;  3V42 A;  4G6T B;  3ZGK A;  3OYD A;  1PJR A;  4XOT A;  1Z7L A;  2K3P A;  2NT9 A;  3JUR A;  4XLC A;  4HST A;  4RM3 A;  1PE9 A;  2AQE A;  2R7V A;  2ZTN A;  4YZX A;  2X8K A;  3CES A;  2CH0 A;  1EFR A;  1D0Y A;  2CS3 A;  4PFO A;  2VAS A;  4ZYA A;  2MAB A;  5KNL A;  3OW7 A;  3VYT B;  1N75 A;  1NHC A;  4BQN A;  4BE0 A;  3M8J A;  1KMH A;  1T95 A;  2LG4 A;  2GJR A;  3EUH C;  3FHN A;  2VKD A;  3TMO A;  3GVJ A;  4C2L A;  1X4P A;  4XLF A;  2GOX B;  2DIE A;  1X1C A;  3BH4 A;  2ELJ A;  2W00 A;  3VSV A;  4RMN A;  2HVQ A;  2Q1Z B;  2W4S A;  2R7R A;  4CCN A;  1TT0 A;  3OYM A;  3T53 B;  2E1M C;  3H5N A;  3MKW B;  3AL0 C;  2WY8 Q;  3CP2 A;  4PJN A;  5HVQ C;  2BOL A;  2WAQ A;  4H4K C;  1HZE A;  3VSK A;  2E60 A;  2DCE A;  3OIQ A;  4ZTF A;  1BOB A;  1PYV A;  1KZL A;  3VSU A;  1D0Z A;  3C2G A;  3DU5 A;  5C1E A;  2ZZF A;  3HG9 A;  2GOM A;  1O8M A;  1O8H A;  1EE6 A;  1D1C A;  4ZC3 A;  3A3B A;  1T5E A;  4ITV A;  3HUG B;  4BE1 A;  2IS6 A;  2F1M A;  3HXL A;  1MAB A;  2R9V A;  1U0J A;  3CZ6 A;  1W0K A;  2WJY A;  1OFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...