4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
1O8GA 4XOPA 3VSTA 3GQ8A 3T9GA 3VSVA 1O8EA 1BHEA 2PECA 3GQAA 2X85A 1IA5A 4XN3A 3VSUA 1O8LA 4XONA 4U49A 3SUCA 1JTAA 1DBOA 4YZ0A 4XKVA 2UVEA 1EE6A 2VBEA 1IDJA 4XLCA 1O88A 2X6XA 3WWGA 1PXZA 2NT6A 1OFLA 4YELA 2VBMA 4AVZA 4YZAA 2X3HA 4XMYA 1CZFA 2QY1A 4XNFA 2QXZA 2BSPA 5AMVA 1KTWA 4OZYA 1O8IA 1PE9A 2IQ7A 1WMRA 3B8YA 4W8QA 2EWEA 4MXNA 4C2LA 1OOCA 1OGMX 3EQNA 4W8RA 4Z05A 4XKWA 3EQOA 4OJ6A 5C1EA 2O0WA 3VMVA 1BN8A 2VBKA 2O0VA 2O17A 4OJOA 4YEJA 2VJJA 4XORA 2NTQA 2INVA 1RWRA 4OZZA 1RU4A 1PLUA 4URRA 1K5CA 2PYHA 1HG8A 2Z8GA 4XQFA 1AIRA 4XN0A 4OJLA 1GQ8A 3UW0A 2QX3A 1IDKA 3GQ7A 4OJ5A 2O1DA 2NZMA 2NSTA 4I84A 1KCDA 4NK8A 1RMGA 1KCCA 2NTBA 2NT9A 3VMWA 3JURA 4XL9A 2PYGA 1NHCA 4NK6A 1XG2A 4XR6A 3GRHA 4Z06A 4XLHA 1QCXA 1O8JA 2X6WA 1OGOX 2NSPA 4YZQA 1X0CA 4U4BA 2NTPA 5C1CA 4XLAA 1OFMA 3B4NA 3B90A 4Z03A 4MR0A 2ODLA 1O8DA 1DBGA 3ZPPA 1QJVA 3FY3A 1H80A 4HWVA 4XLEA 2X6YA 3GQ9A 4EW9A 1IB4A 4XLFA 4W8TA 3ZSCA 4YZXA 1O8HA 4XOTA 4XM3A 1O8KA 4PMHA 2O04A 2VJIA 3KRGA 3LMWA 4W8SA 1JRGA 4OJPA 2INUA 2UVFA 1VBLA 1O8MA 1O8FA
chains in the Genus database with same CATH superfamily
3ZXSA 2FUG2 4RJLA 2ECCA 2QZ8A 3HG9A 4ZJZA 2VNIA 2W4SA 4A3FJ 2IPQX 2K9MA 2XAJA 1L3LA 4BJTA 1YOVB 4UY8I 4HQEA 3TW6A 2VBWA 1HSJA 3VDXA 5K1YA 1V5FA 2ZXIA 1LDKB 3S3MA 3AVVA 4HOBA 1IG7A 2CC2A 2L02A 3HOZJ 2MLGA 3ZMVA 1T38A 4XLPF 1I50J 2G7UA 3V8JA 4UXNA 3A01A 2VNJA 2DN0A 2GXAA 5F08A 3SDBA 2MABA 4ZGQB 2YUSA 2ZL6A 2VNHA 4C0SA 2GIVA 1JJ6C 4RD1A 1LDJA 2IP2A 2JSPA 3EUHC 3K2ZA 4PC1A 3A8KA 3T8RA 4E7KA 1APLC 4YZAA 1T56A 4PABA 5E8IA 1CZFA 1MJ9A 4RAFA 4A2UA 4G8XA 2FF4A 1WMRA 4W8QA 1S3JA 2V1UA 3E5UA 2C5HA 2QA4I 4PAAA 5HS9A 5KVRA 3CCLI 3BLYA 3ASPA 4ESBA 4BNCA 5EMNA 1EA3A 2HDDA 2LDUA 4L0YB 2QENA 4B3XA 1DDGA 2WJYA 3GQBA 5AN9A 2VBKA 2QKLB 1WOPA 2K5CA 4V19K 3R0AA 2VPRA 2WAQN 2FD5A 3CUQA 3JRHA 2M5SA 4P6YA 1Z6TA 1UG0A 1SFOJ 2WSSA 4O6JA 3CDIA 3NRVA 4M3FA 4QPQA 4AWXB 5F4OA 3FKJA 5FIUA 3ABKH 4YFNF 4PC2A 4Q48A 2W1OA 2P5LC 2VBTA 2X9DA 1FLIA 3OW7A 5D6EA 3QFSA 1HCRA 3VWBA 5E6TA 4N0BA 1YHQB 3WTYC 1I27A 4IO9F 1Z77A 3BP8A 1N06A 3E3VA 3I0TA 4OIOF 4P9SA 2NT9A 5AIPA 1NB0A 2M87A 2ELKA 3CMEI 2Z1DA 2XKOA 3SZTA 3B8HA 1QRBA 2BVLA 3KP5A 2XAQA 1N78A 1LFPA 2DT7B 3WTUC 3W2IA 3OYDA 2NSPA 2Q6IA 2ISYA 2EIJH 1EH7A 2DOGA 1W7PA 1K79A 3T1BA 2OC6A 4RLFA 4RB3C 4A3EJ 2XF7A 1T0FC 4UB6C 2F5CA 4BUPA 3GVKA 1JT6A 4AYBA 1T5EA 4TMTA 1J5YA 3R4KA 3F21A 1MMAA 1WVRA 4F52A 2VZLA 3OYIA 3H1CA 1BM9A 3MCZA 2WY8Q 4FN5A 1GAWA 4IHSA 3K4MA 4XLFA 1RC9A 3BTCA 1V3FA 2A68F 4QSHA 1PVEA 1B9NA 4RD4A 1TWFJ 2CJJA 3PVDA 5DM7F 5EDNA 4BDYA 2PMZA 3RQIA 2VJIA 1BJAA 3KRGA 2R7XA 4OINF 4FQGA 1Q82D 3M8JA 2ZL5A 3HEFA 3OR2C 3RYRA 3WE3A 4N3NA 3FX3A 4S04A 1RNLA 1KK0A 3HPGA 2BVMA 2A6TA 2AQEA 5CVVA 3VSUA 3E6DA 3S3OA 2WZNA 3LSHA 1GV2A 4DJAA 4Z4SA 2I5UA 1MD0A 2GK7A 1JA1A 4KISA 2MD5A 5HLHA 3RYPA 2IGOA 4OWRB 3CCLB 1D1AA 4UB8C 3E0JB 3HM5A 1F43A 4C30A 1KJZA 4B09A 4UAJA 2VBVA 2BYVE 4JK1X 1FYMA 3HOWJ 3K2AA 1Y8QB 4PJNA 2G0EA 2MLKA 2WR8A 3G4SB 2BM5A 2E35A 3K7AJ 1RQPA 2VBZA 3J7AO 2C78A 2JN9A 2QY1A 3DTEA 2QE7A 2QXZA 1IXRC 3E6MA 1XCVA 4GCVA 4A5MA 2DDAA 3V7SA 5A2QK 1H0MA 4HLXA 1HZEA 2DOFA 5FLVA 3SEJA 1OFCX 1R1VA 2OK7A 1I6XA 4A12A 4X0CA 4MIMA 1MNEA 1IO2A 2P6SA 4MQ9F 2O0WA 4Q5SF 1DU6A 2XGJA 5IP7J 2R92J 1DDIA 1E0EA 3SYTA 3FPKA 3V8KA 1VQNI 1Z9CA 4RB1A 4OIPF 3J81k 1QUEA 1S7AA 3BR2A 2ZJQF 5KW9A 3CMEB 1TYXA 2VYQA 3DU6A 3BY2A 4ZYHA 2QQBA 3O6BB 1HG8A 1U3EM 2K3PA 3CDHA 3PFIA 2Y0MA 1JKOC 1GQ8A 1R7JA 2LH9A 2D1HA 1VI0A 4OAYA 4PGOA 4ZCMA 1WOSA 2MG4A 1OGIA 1VQ9I 3J7AY 1MABA 3H35A 5F4MA 5A88A 1N25A 3K1PA 5F27A 3Q38A 2HS5A 2VT2A 5ERIA 4Y9UA 1BX0A 2OJED 1OR7C 1VLYA 3HB9A 2OBRA 1MGTA 3TO9A 3NWSA 1FT9A 3G71I 2VBXA 2DFFA 3LFKA 2MA3A 3OS0A 1PUFB 1KGSA 5ICGA 2Y75A 1KZHA 1QX4A 3B4NA 4Y17A 3B6AA 4M9SA 1IDYA 1B2RA 2MBFA 4F55A 2D1VA 2JA5J 2DQRA 4OU0A 5IOZA 1FX7A 3U1KA 2KRHA 4LG3A 5BNGA 1K7AA 4A93J 4D7MA 5L3CA 2XEXA 3LFUA 2IEKA 3B82A 2E1MB 2CFOA 2VN2A 3K69A 1XSVA 3PL8A 4H4KC 2J5PA 4M73A 2HLDA 3ZSCA 1JKPC 5BPIA 2O0YA 3H3UA 1MKMA 1FEXA 2GA1A 1LEBA 1O3RA 3CESA 5FFZA 3JQQA 4M6YA 5ICCA 4WF2A 2DCEA 3FXUA 4OZZA 5ILUA 3RKXA 2QVOA 1ON1A 1MJBA 2DA5A 1HW1A 1RETA 3M1EA 4E7LA 1ZM2A 1DGRM 2DA4A 4EJTA 4XOPA 2GXBA 3DV8A 4WWVA 4O5VA 1KK1A 4KH3A 3VSVA 2COMA 1AHDP 4B3AA 2QYOA 1YX2A 3LA3A 1IA5A 2V1XA 4OPSA 1C0WA 5HS8A 1FNDA 3TDZC 1I7PA 5L3EA 3AFHA 5D4SA 1T6ZA 2UVEA 2K85A 5FRMA 5ICEA 4U0WA 3KLOA 2XIGA 4MNUA 3W5VA 1FP1D 4TSFA 1KYWA 4NC8A 3ZR8X 5F4JA 3PO2J 2X0LA 1WJ5A 4MTEA 1MBGA 1NK3P 4M6VA 1U5TA 1N07A 2GQFA 4XRFA 1YJNB 1PXZA 2NVYJ 1MW7A 3KZZA 1JGSA 4ANJA 2V5IA 2VBMA 3HSRA 4WZLA 1K61A 1KQ8A 1DG1G 3CCQB 3N05A 1KU3A 2JA8J 3I4MJ 3L1PA 4EM2A 1W34A 3KL9A 4AVPA 4EATA 4P2NA 2ZL7A 4HA8A 1XE1A 1P4AA 1WSRA 2XV4S 3HOTA 1G6NA 3H92A 4IHTA 3EQOA 2F6CA 4DYCA 2CBXA 1XC5A 4EMSA 1ZREA 1VQ9B 2O17A 2P7CB 4M9ZA 4YEJA 2VJJA 3KLNA 4IXAA 4DNRB 2K27A 3BQYA 4C2TA 2IJLA 5FNZA 1FZPB 1RU4A 2IGKA 1T95A 1R5OA 3BR6A 2G9WA 1U2WA 4BBRJ 4A3BJ 2LY1A 3DCFA 3RY8A 5B6IA 1KRHA 1Y0RA 2JQ7A 2HMAA 2NPFA 4FASD 3G71B 1Z05A 1VNDA 2IA2A 3G1MA 4MGRA 3R6JA 4PC3A 1KCCA 1DDNA 1F5TA 2Z3YA 1EFUA 2BY3A 4H9GA 3KZIC 2ZBVA 4NK6A 2JUGA 5F04A 1HKSA 2LMDA 5L3BA 2QN6A 2XOKA 1WORA 4B43A 2CU7A 4NHJA 2LVSA 3RIRA 4F91B 3H5NA 2STTA 1QCXA 1EFTA 3U21A 5EGOA 2HEOA 4YRVA 5E8GA 1ENHA 4U7DA 2XNCA 3BY1A 4X05A 3W2WA 1DUXC 2NTPA 2LR8A 3NAUA 4X1EA 2O61A 5M3FJ 2ZTGA 3BCDA 2V1NA 3H5RA 5DEQA 1ZAOA 2GBYA 5DS9A 1IZ1A 3CMAB 2G0YA 2LOOA 1PUFA 3BR1A 2LC2A 4K2EA 3A0HC 5D5WB 2VQLA 3G6EB 3QE2A 5L46A 2JUCA 3FHNA 2CG4A 2O3FA 4Q47A 3RDIA 3V42A 1GAQA 4ASUA 4F92B 5DM6F 5BSXA 2FQ3A 1R5HA 4Y7CA 1BI1A 2W00A 4ZTFA 3KEOA 3MMYB 3S14J 2CV2A 3RI4A 1LKXA 3O3KA 5DD4A 1YRNB 1BA5A 1XPXA 3GFIA 2FNPA 3RKYA 3PA2A 4OJPA 1EKEA 2EZIA 4R1HA 3WGGA 1O8FA 1POGA 2BY1A 4N4OB 4LJZF 3GMEA 2X51A 2DPDA 5E17F 5HZBA 3ML6A 2XSDC 3GTLJ 2LF8A 4RCYA 5D8LB 2H94A 3FKSA 4YDTA 1FNNA 3J81Z 3GQAA 2O7OA 3GLLA 4BS9A 4CICA 2UXNA 5HVQC 2NVTJ 3NB2A 3JW4A 2ETHA 3PNYA 3JSPA 2XDVA 3F6VA 4KKUA 4P96A 1RQRA 2VBEA 4BYYA 4M71A 2HVQA 2LLKA 1K28D 1W87A 2QEXI 5B1AH 1BJZA 3NARA 1Y8RB 3K10A 4Y52J 1WTHD 1LFUP 3HKZA 3FBIB 3JRGA 4KIGA 1QA2A 4KNYA 2M45A 5IYBJ 2MSYA 2KIMA 1NTCA 2W85A 3SLDA 4OZYA 1QA1A 2OAZA 2JA2A 1TWGJ 2KFDA 1IJFA 2XGDA 1I5ZA 3BPXA 3W5UA 4CHUA 4HQMA 2HWVA 3IWFA 4W1UA 2JRMA 3KFWX 3BNWA 2EFQA 2CV0A 2NS7A 5E3NA 3FMQA 2PI0A 4B4DA 1D1NA 2VFOA 2QDXA 2DAOA 1FOWA 2Z16A 5IYDJ 4RPBA 5LGUA 2R7DA 4YXWA 2ZCWA 1SD4A 3SY2A 1SKQA 3GFMA 3F0CA 2VFQA 3L2RA 2XTXA 5LRSA 3SQNA 4BDZA 4M3EA 4EVIA 3LSPA 4AIJA 1MH4A 2JVGA 3DEEA 1SVOA 2RREA 1XGMA 1K73D 1P4MA 3ZQQA 1HA3A 1TQIA 3E5QA 3P26A 4RD3A 1XGOA 2A5WA 2KT0A 5EG0B 3GO5A 4RDJA 4IHVA 1B4AA 3JURA 2CNDA 1IN4A 3CCSI 4IHXA 4A0YA 3HPHA 4HSTA 4KKTA 2DMTA 5DUIA 1ON2A 1P92A 2VQGA 2R7RA 2M0MA 4II3A 3SHFA 1J2XA 2M2EA 2V9VA 2M7BA 5FO5A 4IRGA 1LNWA 3ONUA 3GRHA 3BG5A 2C77A 4KDPA 3RZOJ 4IX7A 1U8RA 4AIHA 1R1UA 4XLAA 2JDIA 4TN1A 1BMFA 3BTLA 1W0TA 4NBQA 1J0RA 2CUFA 1QH0A 1X1BA 3BZKA 3H9QA 3LSGA 1GO2A 2V31A 1N75A 2HR3A 3CUOA 1YO5C 3CC7I 3B73A 2Q2EB 2LBFB 2XKPA 1Z3XA 2CQ7A 4C3IJ 5D4RA 4LB5A 1GHCA 1H9TA 1NDHA 2EV5A 3AKZA 5E79C 1VQPI 2WA0A 1PJ5A 1UCRA 1VF9A 4XM3A 4AUXA 1G3TA 2B7CA 2XB0X 1DQUA 4HNTA 4W8SA 1UD5A 3LA2A 2NXNB 4CYCA 2UVFA 1OGJA 1B59A 1MZBA 4CH7A 1YRNA 2EINH 2KVOA 2QEXB 3ONYA 4QV2A 1DABA 2GPJA 2VPLA 2XUBA 1MDMB 4BY7J 4GXOA 4L5IA 2VASA 1LE8B 1DP3A 3HIFA 3I54A 2GIZA 3KP3A 4NB5A 4IOCF 1UJ8A 3IKTA 4ENMA 1N77A 2F4IA 4KUMA 4HW0A 1ZH5A 3ASRA 3PSSA 2JN6A 4RM3A 2KHMA 4QLCU 1F20A 1T6SA 2YWHA 1OFEA 1QGYA 1B9MA 1ZRFA 4E70A 3R6KA 5EJCA 2ZZFA 4BXXJ 3CLQA 3T8TA 3UNGC 3F8MA 1B8IB 3LQQA 2W25A 1MMGA 4OAZA 3V7RA 4CCNA 3FJOA 3U2QA 3V7AA 2DTZA 1EP1B 1QZYA 4LBWA 2EIXA 4AVZA 1EWYA 2FX3A 3S32A 1IF1A 2R7WA 1ZARA 1ZM3A 2CV1A 2C2WA 4EJVA 3I58A 4AIDA 3LSRA 2WWYA 1REPC 1VQ8I 3HOUJ 3JRIA 2Y48A 3ESWB 1VQ4I 2WC2A 2KJBA 2HQAA 2RC4A 2O8XA 3F8CA 4C9YA 1UMKA 2JJ7A 2C4UA 3GTPJ 3PFYA 2WV1A 2ZMEB 4W8RA 2Y69H 5FLXZ 1L1IA 3F6OA 3SKBA 1SD6A 3VODA 3BY6A 2TCTA 3WNBA 3DTIA 4J19A 4Z2YA 2LFBA 2Y31A 5E1ZB 3IH3A 1E3XA 3GVAA 3CCSB 1ITYA 3D1NI 1UZCA 3ZN0A 1SFKA 4YG2F 1FOXA 2N8GA 3G73A 2QWWA 2F4NA 5FGMA 2JPBA 1Z21A 2Q8KA 2VODA 4KJZA 4LIVA 1D8JA 2QX3A 1PP8F 2HGCA 3BOQA 3LOCA 4P9FA 1QFYA 5BOXA 3CC4I 2R4GA 4HF1A 1T8IA 2D5VA 1LLZA 2XF6A 4HX8A 3IKVA 2JIZA 2PJRA 2K4JA 3S2HJ 3AL0B 3W2EA 3RKQA 1A04A 5EG0A 1G59A 4PCQA 3CC7B 3AVWA 3CUQB 3WTXC 4RGXA 1YW8A 1A35A 3D0SA 3MQ0A 2BGIA 3WTSC 1M90D 3ERMA 2W57A 4XLHA 1QU3A 1O8JA 1OGOX 2NYXA 4P9UA 4QFMA 2B0RA 2ZBKA 2L9SA 4WX9A 1JKQC 3Q3AA 3ZZTA 5C1CA 1YG2A 1D1CA 2HTJA 1SFUA 5FB2A 1DPRA 5LGTA 4JMQA 4Z03A 5JLVC 1KU7A 4GYGA 2QQ9A 2ZJ2A 3NQOA 3DQVC 2Q0OA 3F8FA 4WXDA 2NVUB 3KP4A 4ZZLA 3W6JB 1BIAA 1R22A 2YU9J 1H80A 2CF4A 1SVMA 2R7SA 3JREA 3SJZA 2YX7A 1LFBA 1QVUA 1NK2P 3TH0A 1LM1A 2LTPA 1YX3A 3DKWA 1RUNA 1JI8A 2ZZEA 2C6YA 4IQ4A 3DKXA 4I09A 2LG4A 3FZVA 1WP6A 4A6EA 4DBQA 4KITB 3L2UA 1SFXA 3PQJA 1ETKA 4IHYA 2DBBA 2X1EA 5B1BH 3Q3SA 2QZAA 4I76A 4EJWA 1DARA 1YYVA 2W7ZA 4XRSA 4F7DA 5HS7A 5DUKA 4KMUX 2L7MP 1Z67A 3IWZA 5K7FA 2E71A 3HTSB 1R5NA 3GQ8A 3I1FA 4PJJA 3A2KA 3CJNA 2QSHX 2ZB9A 2E1OA 4ZYDA 2XAGA 1S72I 1BIBA 1XFOA 1YQAA 4GYIA 2DT6A 3KE2A 3I71A 2V4DA 5DYMA 3DEWA 4XONA 1VQ8B 1P2FA 4BQAA 1OQYA 4LG0A 4JQFA 2B0LA 1MMNA 2GOXB 3KCCA 3I53A 2L0KA 3W6KB 1NG7A 1E3ZA 3JSOA 4QPOA 4HDVA 4MQVA 1GR1A 2X6XA 2CH0A 3QYEA 3H09A 3BTJA 5GAGJ 3ABTA 3I9V2 3JRCA 2CK3A 1OFLA 2DODA 1GDTA 1WDTA 4YAWA 1BPLA 2XPUA 3IH2A 5FD5A 1KU2A 2A6EF 4BU2A 1B8IA 1FMVA 3Q9SA 3W3CA 4QIWN 2H8RA 2BHYA 2CS3A 4CXFA 2YU3A 3KX2A 2M4KA 1E3HA 1X1PA 2OYNA 1KTWA 2RV8A 2Z9OA 4L18B 3FMSA 4A69C 1WSUA 4OPWA 4IPAA 4KMFA 4V2FA 3DLLF 1YS6A 3QP5A 3I55I 1EF4A 2KJCA 1VJSA 5F0HA 1VF7A 1O57A 3OZVA 3IRRA 5J1UA 1IRXA 2HZTA 2V1DA 3W2AA 5J35A 2DPUA 2F5FA 1H9GA 3W5HA 3AVXA 4LLLA 1ZR4A 2ZMEA 4NBSA 3CC4B 1QRYA 1FBSA 2ZFWA 1AOYA 5IYPA 1KQ0A 1O7LA 1WRJA 1WPKA 1FNMA 2DYRH 1VQ6I 1HOMA 1OB0A 4ZCIA 1WKMA 2BM4A 4ZDPA 2EWNA 1TW2A 3IP4B 4JOMA 1BQEA 4OOXA 3GX4X 5GP9A 4A3MJ 4P25A 1YS7A 2QTLA 1JJ2B 3CCMI 1UG2A 3DU1X 4YC5A 2EB7A 2HYGD 1JXSA 2O1DA 3Q9VA 1KCDA 4IEJA 2F43A 2BV3A 3MZYA 2FX0A 5E1WA 4II2A 5E1XA 5DN6A 5LEKA 4EGYA 1F9NA 4A3LJ 1ZGJA 1A36A 2DFHA 2PYGA 1NHCA 3BWGA 4R8HA 3HUGB 4XBFA 1LDDA 4U88A 3C2BA 4PGHA 1S8NA 2ME6A 3CO7C 5GTIC 3BROA 3WBKA 5GPAA 3VO2A 2ZXHA 4RLZA 3DU5A 1QGZA 4M3DA 4FETA 2HYFA 2PQ8A 2GJRA 3GFJA 5A2QZ 4MFDA 4QUZA 1KMHA 3RPUD 4ZYGA 2RC6A 2HQNA 3Q5FA 3KYCB 1BL0A 2H1LA 3RZDJ 2QBYB 2E1RA 4ACBA 5IYQA 4HSRA 3ZRGA 2HKXA 4BE1A 1S72B 2EPFA 2EBIA 4BEHA 2HDWA 1VTNC 2R6HA 1ZQ3P 4P5OA 2BGJA 2WY7Q 3BTIA 3ECHA 1A31A 2XRNA 3QU6A 2V6EA 4PMHA 1MMDA 1ZGWA 4IRHA 4XK4A 5LFAA 3OY9A 3EYIA 1ETQA 3ELKA 2LZJA 3K1NA 3R0JA 5CPRB 1S0UA 3TBIA 3VSTA 3MWMA 1M1KD 4LD5A 3ZOBA 1PUEE 3CRZA 1TUIA 2JK3A 2WAFA 4UVCA 3DPTA 3GSIA 2WZPP 1G7TA 4JRAC 4L9VA 2DMPA 4I99C 1XDSA 2ESNA 3PIPF 4ENJA 1MSEC 3FKIJ 4IF4A 4BHPA 1HA8A 1DBOA 5JLWA 4MLOA 1K4ZA 2K02A 3DPUA 2CQXA 3MD2A 3GZ5A 2ID3A 2Z99A 3I55B 4Y13A 3RTRA 1BI2A 3AL0C 1BW5A 5E3MA 1HQCA 1FMWA 2L9VA 2ZSIB 1T2KA 4NQWA 1J59A 2I1LA 3CUQC 2LKXA 2CW5A 3K70C 4G12A 1J7KA 4YELA 1X4OA 1V0FA 2F5DA 2O6GE 5BSYA 4AF7A 3K70D 3RPQA 3F8BA 2PFBA 1U2RA 3FK7A 2K86A 1VQ6B 3J80K 3V4GA 2FOWA 4P3YA 5H5JA 3BR5A 5GPCA 5B66C 4AIKA 1CQXA 1IN5A 2P8TA 3W6VA 1EA0A 3HZJA 1X58A 5IP6A 4C2LA 2M3AA 2V7FA 3BT9A 4PFOA 3CCMB 5D5XB 1OGMX 1RI7A 4A3CJ 1M1EB 2ELJA 2VQHA 3BCFA 3WHCA 2WBMA 2QA4B 4OJOA 3VYRB 1U5TB 4OOIA 2VJ4A 4PC6A 1TYVA 2DW4A 3CCUI 1IRFA 1FSEA 2KZVA 5F1JA 3PUFA 3FHZA 4EH1A 3G1LA 2L9RA 3FDYA 1UMQA 4CZZA 2Y9ZA 1W7PD 1WQ2A 1X1CA 1DGWY 1QUFA 5AIQA 4OJ5A 1WJBA 3TP3A 4I84A 2DXIA 2BY0A 2AHOA 2VXDA 3N97A 1GLNA 3O8GA 2EJRA 2ESHA 2EV0A 5ILVA 4P55A 2BXZA 2OBTA 3JRAA 1LPQA 2QSGX 2X0KA 1W5TA 4OOSA 2DYSH 2Y9YA 5JVTA 3S17J 3DTKA 2UV1A 1BC7C 2FBHA 3GTQJ 2DMUA 3K0LA 3SEZA 2M9HA 3GW2A 4KIFA 3LSKA 3S1NJ 3QQAA 3QOEA 3M7GA 3F72A 3EQLF 4LFUA 1X2NA 3FXLA 1TC3C 2CUEA 3HUGA 1RPWA 3DBHB 1HW2A 2HKOA 1YX5A 3L7WA 1LLWA 1CLWA 2L4AA 1IAWA 1S7EA 4CDGA 4C43A 2E34A 3B90A 2E36A 1EFCA 3A35A 1UHWA 1AU7A 3P9KA 1W4MA 5HODA 1QO0D 2AQFA 4HEA2 1MNMC 5AONA 3X2QH 1P4WA 9ANTA 4TMZA 1DBGA 1O8DA 3ZPPA 2X6YA 2COBA 2I10A 1QQIA 4YHBA 2K40A 1KZLA 3LQEA 2QBYA 1U78A 2R9VA 3LJYA 2BY2A 4XOTA 3M1CA 3VSLA 1BJKA 3ZMSA 5FRNA 5GV8A 1ONVA 2JVHA 2DK8A 5M5XJ 3GVJA 5EGOB 1IJWC 1R5BA 3O2PE 4AU7A 2P0WA 4RD0A 2INUA 3WTZA 1SAUA 4PJLA 3BC8A 2QYUA 2GLOA 3BPVA 3NAWA 4HLYA 1PDNC 4JYKA 2XAFA 3HGGA 4BXFA 3BG3A 3LQRA 4YCQA 2E1NA 1G3YA 3M8EA 2D9RA 3WU1B 3VPRA 2VB6A 2DLLA 4M6XA 4XN3A 1X3ZB 2E2JJ 3DDYA 3ZBUA 1V54H 3ZQIA 2FNAA 1XCBA 5E18F 3IV5A 3QRFF 3COAC 2DCUA 5CVRA 2D45A 5J4YA 4OMZA 2BBYA 2R7FA 4GGGA 1IXSB 1LVAA 4KA4A 4UZUA 1O88A 3ABUA 3G3ZA 4L8JA 1P4XA 1R5ID 2O6WA 3FMRA 2Q1ZB 2W6JA 1W0JA 2DA2A 2FRHA 1LB2A 4PC7A 1KC8D 5HNHA 2O9LA 1JHHA 2OBSA 1ZG3A 2HOEA 5E20A 2XT4A 2VFNA 3VOEA 4TT3A 1O8IA 1AIPA 4O3MA 4A3GJ 5CVJA 1Y1VJ 3CCJI 4X06A 2DT5A 3FXJA 3B02A 3W2VA 4EV0A 1E1QA 1SKYB 3K4JA 2LP0A 4FTHA 3PA1A 1F1ZA 2HVSA 5DSZA 1R6RA 3GYHX 2WB1N 4UNOA 5H2FC 5CYVA 2KMUA 2KPMA 4IL6C 3ZUGA 2ZITA 1G2HA 1U9OA 1ZTRA 1JHFA 3GZNB 2STWA 5C44J 1OYIA 2CQQA 1XDUA 3DPLC 4N9IA 1VQNB 4Z1MA 2GOMA 2RGVA 1D0ZA 2PLYA 3C2HA 3OS1A 2ACJA 4I0AA 4XQFA 3H9JA 3HBLA 1JB9A 3PSZA 4KICA 2GA2A 1SFEA 3L00A 1D8KA 5KCMA 1O3SA 3H9NA 4LLGF 3MKWB 3ZIAA 2D2WA 4XKCA 3S8PA 2NZMA 3OWTA 3ASQA 4NK8A 1GVDA 1OKRA 1ZN2A 2RDPA 3FM5A 2CSOA 4B1RA 3ZMUA 5DNSA 3CLOA 3LNQA 3FM3A 2XAHA 3CCRI 3OSGA 2YR2A 4CCOA 3BZCA 1KA8A 1X1AA 4D9JA 1Q86D 1XG2A 3FXMA 1D5VA 2A6HF 1N8RD 4ZZDA 2KQRA 4BQOA 3CMMA 4G7HF 3A3GA 1NHAA 4YIIA 3OP1A 2YWFA 3ERED 1XMAA 3C7JA 2FE3A 1DP7P 2JMWA 1D3YA 4LMYA 3ZQLA 1EH8A 5HOOA 1NB9A 5KK1A 2ADUA 3JTHA 1UD6A 1R58A 5J1RA 3AG4H 1YITI 2EFOA 2DY1A 4ZYAA 3OMYA 2QF7A 4B4CA 2L7FP 3K4CA 5FKMA 1Y0NA 2L01A 1IHMA 2PJPA 4UZFA 1KQ5A 4E7HA 2R7ZJ 2PEXA 3NWTA 2KIQA 2ZXJA 1HKTA 1K8FA 1QA3A 1Y1WJ 3Q39A 2DDBA 2AXLA 5H6QA 1U5TC 5B3SH 4E7ZA 2H6CA 4Z4RA 1JTYA 1R4MB 2F1LA 1D0YA 4RAYA 4FT8A 2XZPA 3OYKA 5E3LA 2H27A 1V0EA 1MIJA 1WGXA 5JHFA 1BHEA 2E19A 3JRDA 4KT5C 1B6AA 1HXDA 2BEOA 4B44A 1O8LA 2QUFA 2CQKA 3H9GA 3WTVC 3OEEA 1Q1HA 1H8HA 1WJDA 1X3UA 4XKVA 3CCJB 3PUBA 2XZLA 3I5UA 2RQQA 1ZELA 4WCGA 2NNYA 4YAFA 1SD5A 2BOLA 3A02A 3F8NA 3ZQFA 1E1RA 1WJAA 2ZTNA 4X6AJ 4CYCB 3E20A 4ZYEA 1S6LA 3JAMZ 1ETVA 2UWMA 2W6IA 3C2GA 1HF0A 2KZGA 2XNJA 1BW6A 4CCMA 4IRIA 4EEFG 3KEQA 2J8IA 5IK2A 1MNDA 4UV9A 2IBDA 1RIOH 5KSWB 2V9KA 3AG3H 3IH4A 4EJUA 4X7FA 1AKHB 1PJ6A 5CDFA 4CCJA 1WWXA 3LL7A 1H8EA 1D8TA 4JX5A 1I1GA 4XKWA 3LAPA 1TW3A 3K4LA 5LLQA 1PJRA 2XNDA 4G6IA 3E7LA 3IL2A 4LBYA 4DNTB 2KP6A 2X6OA 1FRNA 4PJMA 3ASOH 1MBKA 1W5SA 1EP2B 1BN8A 2A61A 3CCVI 4IHWA 3WGHA 3BC9A 1QVGB 1AWCA 2R7QA 3IHUA 1RUOA 2X3UA 2V26A 3FIWA 4AC9A 5IY5H 4X7CA 2INVA 2IS6A 1JKRC 2HVRA 3OSFA 2JJ1A 3CCRB 4XRSG 3OOPA 4ZDLA 3OYMA 3TW7A 1GVJA 1MMSA 4Z4ZA 2YPRA 5CQEA 3B6CA 1AIRA 3UW0A 3KEWA 1LEAA 1EV7A 1STZA 1YLOA 4GFBA 2DOEA 3OS2A 3OYNA 4HPQA 1KD1D 3BCAA 2NTBA 3LAJA 2LY9A 2ZXWH 2JT1A 4E4HA 4LBVA 2X1CA 3PNVA 1H89C 3F9KA 1X2MA 4C3JJ 1QNTA 5M5WJ 1JGGA 1YITB 3GWZA 5IPAA 3HAGA 2E1MC 3GF2A 4C3HJ 3TOBA 4PUSA 1ELOA 3WNCA 3QSYA 2XB5A 4BJ5C 3C1DA 4LITA 2OTJI 2DFEA 4ZCLA 2EK5A 2Y2ZA 2Q6KA 1MBHA 2I8DA 2IS4A 1VQKI 1TBXA 5C4XJ 4J0QA 4YALA 4B48A 4X7EA 3MKLA 5TISC 1H85A 3CCYA 3DF8A 4RLQA 2MFZA 2PJRB 2DEUA 3KZYA 3ZQ7A 1H8AC 1QJVA 2KL4A 3BG9A 1ZKGA 3GUDA 3AGPA 4CQJA 1KK2A 1TVCA 4RDUA 4OMYA 3AAFA 2F3LA 3PO3J 2EIKH 3FXRA 4UV8A 2DI3A 3WHBA 3F22A 1FYKA 3HGYA 4RB2C 2KDZA 1HBXG 1XMKA 1FIPA 2MYSA 1JRGA 1NG6A 2X4HA 4U0YA 3JAMK 1O8MA 1RESA 3QPHA 1Q81D 5HLIA 2EA2A 1G7SA 2ZJRF 4EM1A 3SJMA 3WTTC 2E5ZA 1QA6A 5DD8A 2Y0SA 3ASTA 4G1BA 4ZTJA 4B3FX 2PX9A 3BJOA 1FSHA 2LK2A 4Z4UA 1J75A 4Y7NJ 2QKMB 2QCOA 4U49A 1JTAA 1OLTA 5JHUA 4YIFA 4BPRA 2YWGA 2IGMA 3I4NJ 3ECOA 1KONA 1BI3A 1UELB 1Z7UA 3G2BA 3FXOA 3I59B 5FFXA 4QVJA 3CF2A 2A5YB 1WJCA 2OQGA 1R1TA 1JT0A 3MZ8A 1QVTA 1QHGA 3SJPA 2L5QA 3FF5A 4R79A 3IAM2 3P9IA 3DEUA 3A1YA 1K4SA 1G7CA 4D0PA 3IC7A 1XS9A 3DBRB 4HRIA 1R23A 4WZKA 1WJFA 2OZ6A 5GV7A 2BSPA 2FBIA 3BQJA 2CYYA 2IS1A 2XC1A 4LK0F 5BS6A 2QQ8A 3GIRA 4LG0B 3O8HA 1BBYA 1FBQA 2E5NA 2K9LA 3JQRA 3BH7B 2A3SA 4PFPA 5GAHJ 1W1WE 1TLHB 2OUMA 4HV6A 1AKHA 4G1VA 4Z05A 3AGQA 4BHBA 4RM2A 1S9HA 5DCFA 2KRFA 1FX0A 1SANA 4PGGA 3FISA 2LKPA 1KTVA 4X07A 5FL7A 4TKOB 2DFIA 3ZBTA 5F64A 1ZK8A 2M7AA 2J7KA 2HFHA 5K7ZA 4MFEA 2VE9A 2VUMJ 1TYUA 2L9NA 1OISA 1UHSA 2OBPA 3HHHA 3MN2A 1EFRA 4BXUA 3BH4A 1BR4A 5EYRA 5HXBA 5IYRA 3AG1H 5LEJA 1YJWI 4YAOA 6PAXA 4EM0B 5HZAA 1TWCJ 2DA6A 5F0CA 5KHDA 2HCJB 1BN5A 3E5XA 3AVUA 2NSTA 4FE7A 4BE0A 5HKKA 4X7DA 2OCCH 3A03A 5FKLA 2K4BA 4I0BA 1VQKB 1RMGA 3LVBA 1YTYA 5D8KB 4XL9A 1USSA 4DBRA 3ROUA 1JNYA 3A8JA 2B7BA 3QFRA 4XD7A 4N4NB 4I7HA 4TMVA 1MRZA 4UVAA 3GXOA 1CGPA 4OM9A 3RJPA 2ME0A 4IZZA 2NS0A 4DQKA 4XR6A 3TQNA 1NH3A 3I56I 2JWTA 3JQPA 2XTYA 4CGZA 1EH6A 4RCZA 2B63J 4OP7A 1BOBA 3TKYA 4HAMA 3C18A 1QFZA 3OYFA 4P1VA 2CMPA 4IKFA 1O3TA 3ML3A 1OFMA 3OR1C 2HPIA 4GDFA 3CCEI 2EIMH 2EQRA 4NDLA 1MBFA 3S3NA 1FRQA 4JBAA 1I1SA 5K7HA 2E60A 1ETYA 2R93J 2L7ZA 4D5FA 4XLEA 2V7WA 2ZZGA 4ZH4F 5FO0A 3A0BC 3Q6RA 4ZGNB 4KYWA 4BE2A 4OPOA 1Z91A 4V02C 1IRZA 4RPDA 2XSJC 4HX7A 1DU0A 2CW0F 2BGCA 3VO1A 2EFNA 2XPVA 3SFIA 2J8KA 4L9NA 5TGTA 5J47A 3TDUC 3C3WA 2X1DA 5LGNA 3J7ZI 4PDKA 1QZEA 5CJ9A 2YS9A 5GTHC 3OIPA 2V7VA 3Q6QA 1VQPB 2KIFA 2W24A 1T33A 2W82A 4A3IJ 3R60A 3M3YJ 1HSTA 4YIRX 1RR8C 2JA6J 2YWEA 3T9GA 3CJRB 2VOOA 4QWQA 3OZUA 2XPWA 3T5XA 1JE8A 2ZBUA 1L0OC 3ZZ0A 2GXGA 2VJ5A 4BEHB 5HDNA 3ZPLA 4AYBN 3ASSA 2XROA 2DJIA 1XX5A 1FJLA 3JU4A 2NAZA 2HU9A 1D5YA 1HW5A 1W5CC 3LMMA 1IDJA 1XG1A 3QFTA 2KLOA 1KQ9A 2EZLA 1JUSA 4MO7A 3WWGA 1E17A 1P9QC 3BJ6A 3I59A 4ESJA 1P7IA 1QGAA 2KKOA 5CKTA 3DWLE 4WWCA 2LF7A 2PMZN 2VONA 1QFJA 3VYTB 4XNFA 3HJEA 2YX4A 3DFGA 1TQMA 2DOAA 4B8XA 1RKWA 4PSWA 4RGRA 1J9ZA 2GZWA 1ZGAA 2GQQA 3HRTA 1OOCA 1YJWB 2JSCA 1OCRH 4OOVA 1MBEA 1R36A 1H88C 3AVYA 3ZQGA 3H3ZA 1TP4A 3PNTA 3VMFA 1VQ4B 5LBQA 4G5GA 2O0VA 4GRIA 5HLTA 1W36C 4X8IA 3W2GA 1AMOA 4MTDA 4NQWB 2VBUA 4XKBA 4A5NA 1W36D 2NTQA 3EUHA 2OU2A 3ABMH 1RWRA 1NBMA 2VKVA 2MC4A 5F1RA 1K5CA 4BACA 4XSXF 2Z8GA 1MSFC 3OPOA 3I56B 1ODDA 2DERA 1OPCA 1K6OA 3B78A 3LO8A 1ZLJA 2R7TA 1N0VC 5J8FA 3GQ7A 2QSFX 3P27A 4L5JA 2FU4A 5JR3A 2BXYA 2VFMA 2V9PA 1FY7A 3CCEB 3HRUA 4G7ZF 1CF7A 4KFCA 4UHTA 1MBJA 2HQRA 3PSIA 4D7NA 3NE5B 2DJNA 3JRBA 1IXCA 4FXUA 2OA4A 5J8CA 3E6CC 1ACIA 4KIBA 3GTOJ 1N08A 2ZNYA 3VB2A 4Z06A 1OFDA 2IA1A 1BR2A 2X6WA 4M74A 2M30A 5LD2C 1WPCA 2BPOA 5J1YA 4UUSA 2P3MA 2VOPA 3RPUA 3J80Z 1E2XA 5H6RA 4ETSA 4ASNA 2KDOA 2UZKA 2F1MA 3CC2I 3H0DA 3HRSA 2ID6A 2F48A 3CJTB 1BOAA 5TR9A 3GQ9A 3W2HA 2XASA 1IB4A 2XRLA 4U87A 3N4MA 2CW8A 1XD7A 3P5JA 3OE7A 2F5EA 5FO1A 1O8KA 1WXRA 4TMWA 1Z7LA 2O04A 4M72A 2EFPA 3LSIA 3LMWA 2JJ2A 4B47A 2HZDA 2UXXA 5IP9J 1S29A 4CCKA 1O8GA 2BW3A 5EZHA 2AO9A 3N90A 3BG6A 1T0FA 1W35A 4G7XA 1S4MA 3QYFA 2XTWA 1IN7A 4P26A 4ITVA 1T6YA 2VFPA 1SAXA 4U0VA 3OYJA 1GVHA 4Y9RA 4G94A 2H1KA 1IUYA 1OCZH 1B23P 5KAFC 4Y15A 2W7NA 4BJ6C 2TRTA 5FKNA 3CJQB 4G6TB 3G4SI 1TNSA 4YFKF 1TWHJ 1QRCA 2ZMEC 3OV8A 2FJ1A 4BAYA 3S93A 3L2QA 3GTGJ 3U9GA 1JJ8C 4HE6A 4XICA 4LGWA 5ILSA 1JA0A 4G6DA 3M4OJ 3L2WA 4FCYA 4FISA 3JTGA 4AD9A 3HOVJ 2GJPA 1Y39A 4ZV4A 2MH2A 2CUZA 1W2BB 5AMVA 2E2HJ 3GBGA 1PE9A 2W48A 4RS8A 2VIXA 1G4DA 2EWEA 4EQQA 4P3IA 4IW3B 1Z6RA 2WYRA 5ED4A 2D3LA 3T0YA 2JPCA 4BQQA 2HDNB 4UVBA 2XGXA 1WI3A 4BGDA 4Q4ZF 4XIDA 3LSMA 4A0ZA 1HLVA 1JTXA 1VQ5I 3R61A 1V4RA 4Z4TA 3WTWC 2OPTA 3PIOF 4FX0A 4P12A 1BC8C 1CNEA 1K6YA 3ONQA 4XORA 2O8KA 1E79A 4LBZA 2HOSA 5CLSA 5J4VA 4XSZF 3CW2A 3JRFA 1WZ2A 3TP0A 1ZLKA 2R5ZA 4URRA 4AM3A 3SEQA 2DMQA 2R7UA 2PYHA 3A4CA 3V8LA 3CXCB 4RBOA 3CD6I 2F2EA 1YJ9I 3VFZA 1P6RA 1QVFB 1X3WB 1IDKA 3HTUA 2KIUA 1CQTA 2FMLA 4QVAA 1XTAA 3PUNA 1BR1A 4MEYF 4WQMA 4A3KJ 3MZHA 4QHYA 2IAIA 1VHOA 4OIQF 4KN4X 1XGSA 2FXAA 1ETXA 1V5VA 2DK5A 3A8IA 4N3GA 1Y0YA 2DIEA 1TLLA 3ZC3A 3CC2B 1PP7U 3OFNA 4GQNA 1P7JA 1FBUA 2PG4A 4CUGA 3MKYB 1EJ9A 4D5CA 1FYLA 2RNJA 2WV0A 4EJOA 2PMDA 5EEHA 4YZQA 2HYJA 3D5SC 1E3OC 1EXMA 4YFOA 3CMYA 3REOA 4HIZA 3ZMZA 2LKSA 1I3AA 3ZN1A 4DYQA 3T53B 3VR6A 5IYWA 2XT2A 3VNUA 3SXYA 2VC0A 2L54A 1HKQA 2NOGA 2BHZA 4MR0A 3D5LA 1GUUA 1Y6IA 3PUMA 4EW9A 1R5GA 3QFCA 3TO6A 3E1SA 1IJEA 4NC7A 4D1QA 4NNJA 2BMWA 1VQ7I 1Y0UA 2QM3A 2QQAA 5L3GA 2FQ4A 5IT9Z 3WY9A 3CZ6A 1V5GA 4J00A 1OR7A 2OF7A 2ISZA 1S7OA 3L09A 3OL3A 4P6VF 4TMXA 1SMYF 3L9FA 4H0EA 2H09A 3OKXA 2MGQA 1J09A 2VT3A 5IT3A 4E7JA 4MEXF 4A0XA 2FOKA 3QP6A 3OYGA 4V2GA 2HDCA 3ZZUA 1T08B 2M8GX 3WGIA 1F4KA 2DA3A 2ELHA 2LYCA 3FK6A 4GO1A 2DA1A 1I39A 4DZJA 4UUTA 4E6KG 1W0KA 2DETA 3PETA 2CQNA 2GK6A 3ASNH 1WFXA 5D6FA 4R71A 3SUCA 4PZJA 2GWRA 3AK5A 4LK1F 2X48A 1YJNI 1F60A 2P4WA 3BQZA 5D5UB 3OIQA 1Q1VA 1Q7YD 1K8AD 4XLCA 3CCQI 5LMZA 1VQ5B 1T98A 1WU8A 1K9MD 2NOJB 3WODF 2M1BA 1D1BA 1IRGA 2RKHA 4N9HA 2E7XA 4S0HB 3LWFA 3SZGA 1B1BA 2IW5A 4BKXA 1UD8A 2IRFG 5LHHA 1KK3A 1QBJA 2RNGA 1LQ1A 3QPSA 1OCPA 1XGNA 1IB0A 1VHEA 4E7SA 1FP2A 2L3DA 4CZCA 1YFHA 1YIJI 3B8YA 3Q0UA 5FA6A 3LYCA 3DXJF 3HL2A 2P5KA 2WADA 2HNHA 5GAEJ 4MXNA 3LA7A 5L3DA 1W0UA 3CD6B 4RB0A 2CUJA 1YJ9B 3K4NA 4L5EA 2HOTA 3EUAA 1SEUA 4OJ6A 4HX4A 1IUFA 1TT0A 2WAQA 2XGCA 2IVMA 2YUHA 4L9TA 1GV5A 3MKZA 1YW9A 2VKDA 4HV5A 1AA7A 1ZRCA 1FC3A 2QGUA 4IQJA 2QGGA 3GLXA 3OYCA 1TTYA 2YSRA 2P7VB 3GCMA 3HOYJ 4NUBA 1G3SA 3L2VA 2FVGA 4G9YA 3K9TA 5B5EC 2A05A 3KIOA 2K3FA 4RGSA 3OOCA 4UZEA 3CPWB 4XN0A 3KP2A 3CCUB 1RZ4A 1ZM4A 4HNVA 1XB2A 1EZGA 3HKZN 5BQTA 3ZQCA 4CA0A 3SLNA 3FBNB 1VLOA 2JZYA 4DK0A 3MMPA 3RIQA 3OW2B 3WQZA 3VMWA 2P6TA 3WE2A 2IOUG 4IOAF 2LSOA 1UFMA 2XC7A 3S2WA 1R49A 1WI9A 2BM1A 4YAUA 1WH7A 1RR7A 1USTA 2IXSA 3JCUC 1VQ7B 3AVTA 5IT9K 4WXHA 3BCBA 3GZ6A 3HHGA 4M1KA 1TWAJ 2M8EA 3CMAI 4U4BA 2DQLA 2OZUA 3QOPA 1UD3A 2VC1A 3CP8A 4G6QA 3G6EI 5TRDA 5EEGA 2Q6LA 3MCAA 4M0LA 4LLNA 3RCOA 3GEZA 4M3BA 4ACAA 1FPQA 1TQPA 1TL8A 2CW7A 1A8PA 2EZHA 2PE3A 2PLFA 3P7NA 1T39A 5K5OA 5HLGA 3DBLB 4IVNA 2CWEA 4BQNA 4ESFA 1I6HJ 4YZXA 3EETA 1WCMJ 5IYCJ 3ISXA 3E6BA 1PJ7A 3N6ZA 2DYIA 2E2IJ 2ZC2A 3TMOA 5DDGA 4LOCA 2V7XA 1OHHA 3CPXA 3FWEA 1VBLA 4ZDOA 3AG2H 3J7YJ 2AS5F 2LY2A 2Z2SB 2ZNZA 3OOUA 1D2EA 5JI6A 3SFZA 3GTKJ 3FPPA 2AXTC 4M3GA 4DYRA 5K5RA 2VLAA 5LRRA 2QLZA 3KEYA 1BLIA 3ZPNA 2PECA 1XN7A 5H20A 4BL0B 2WTEA 3NEUA 5BPDA 2Y0SN 1WHUA 1FWZA 2ZO4A 3OYAA 4DOZA 2VQCA 5DV5A 4LC0A 2Z5UA 3TOAA 1YIJB 1IN8A 2FEZA 4WK8F 3H94A 2O5RA 2RC5A 3HRMA 4I01A 2E1BA 5IOYA 1X4PA 4MYUA 4JP0A 5J3OA 2B7EA 1EE6A 2M0CA 3K1MA 2RVCA 5F6FA 2J5OA 3SDGA 3S1QJ 2BSAA 2BX6A 2ZSHB 4P1WA 4Z6YA 4MYTA 1QZZA 1Z0XA 3U6BA 4PSXA 1FTZA 3QWLA 3RKWA 3JR9A 4DW6A 1ZR2A 3KP6A 2WPDA 2VI6A 2X3HA 3S1RJ 2RN7A 2KISA 4RAZA 5FLMJ 4MHGA 4BY1J 2EFGA 4E0FA 2OCEA 2OK8A 5EEAA 4XRMA 3H36A 3OYEA 3F23A 1WSVA 3EQNA 5C1EA 1HVXA 1Q9SA 4L0ZB 1HDPA 1FTTA 1E43A 3MAJA 4CO8A 2HPMA 1OB5A 2CRGA 4DZPA 3BG7A 3L2CA 3K6GA 3ES9A 2VKHA 4B3GA 1IN6A 2EILH 1W9XA 3G1OA 1TTTA 5HNFA 2XGEA 3MVPA 1R71A 4RDLA 3WU0A 1T6XA 2VBSA 4KN7X 5F0FA 2H8WA 3P4GA 1OYYA 2MW8A 1IW7F 3E97A 3ABLH 1X1DA 3WG9A 2F4OB 2O03A 4KT6A 1N0UA 5JMCB 5CVIA 4DIQA 2BF4A 3BJAA 1GJRA 4M53A 2L7KA 3FXKA 3OIOA 2OD5A 5JLXA 3ZGKA 1VFCA 1SMTA 4ROXA 5H59A 2K9NA 1N05A 2EV6A 5CVUA 4AC0A 3ULQB 3I4PA 3KETA 4DGWB 1HC8A 3E1YE 1KQSB 3HC7A 4E7IA 4AF6A 3CQZJ 3K4KA 2NVXJ 2IS2A 1ZM9A 1U8BA 1PYVA 4Y33A 5K5QA 1GXPA 2PMUA 2LNBA 2XVCA 3EYYA 2QTZA 5IYNA 4F3QA 2VE8A 4HBLA 3MFKA 3QPLA 4I6ZA 1BX1A 2FA5A 2FMYA 4DQLA 2ZFUA 3JX8A 3S16J 2Y30A 4CCLA 4C2UA 4W97A 3S1MJ 2BM7A 3CO6C 4Z4WA 2F4MB 4NC6A 3GFLA 4CSWA 2DMNA 3KPHA 4LIUA 1QQ1A 3U2RA 2X53S 3LSTA 1ZRDA 1XMXA 3HXLA 1WJEA 3OYBA 3WNDA 5L3FA 3FY3A 3V76A 2M5WA 1U0JA 2HTSA 3UKGA 3PQKA 4IJAA 5E3OA 4RD6A 3DLAA 4FX4A 1G7RA 2QMUA 3OEHA 3ISPA 4M4SA 1O3QA 2PMHA 2DA7A 2GM4A 5FKKA 2UUZA 3HSFA 5LHGA 2D3NA 3Q0WA 1YE9A 1ULYA 4HDUA 3IRQA 3U1DA 3HDDA 2DO7A 1V5EA 2X8KA 2JA7J 4Y3OA 3S2DJ 4HNUA 2V7UA 3ZMDA 1G8XA 2OV7A 5FKOA 4S05A 2WAEA 3F3XA 3ZP5A 4ENNA 1K83J 3OZWA 3W2FA 3EUKL 3KYDB 2BZTA 5FD6A 2X85A 2WB1A 2VBYA 3WU2C 5JFRA 3D5RC 2IGNA 2B5OA 1JUPA 2HXIA 1TSPA 1YI2I 4YZ0A 3V7CA 1ZG5A 5LHIA 4BH9A 2Z33A 1SM4A 1X19A 4FHTA 1I3QJ 2XAUA 1TZLA 3P9CA 3OAAA 5DTDA 4G7WA 1R9TJ 2PIAA 3HOSA 5JBQA 3CDLA 1G3WA 2EA4A 2BV6A 1ZHFA 3SQVA 1QPMA 4Y4RA 3DKYA 3VYUB 3HOXJ 2R5YB 5JVGF 2R7VA 2V7QA 5HDGA 1RRJA 1FIAA 3MHPA 5DCMB 2EFWA 5EZGA 1IV8A 2EZKA 2MC3A 3QPTA 4PK4A 2NS8A 1U9NA 1IDZA 2WJVA 3M8FA 4ENKA 3OYLA 3OJWA 2V7TA 4TV7A 4A3JJ 1GXQA 3H3VK 2TDXA 1OCOH 3HSEA 3QAHA 3D26A 5C3EJ 1SC7A 1EP3B 5GADJ 1XQBA 2CO5A 5FROA 3KYLA 1IV6A 1MH3A 2LREA 3IUOA 5KNLA 2NV4A 3WYAA 5CQGA 2CGPA 1FNBA 1O7FA 1U6GA 1UAAA 1XSXA 4Z4YA 1PLUA 1XB4A 5DS0A 2ZKZA 2HXOA 2R7OA 1NRKA 3CCVB 5BMZA 4M2LA 4BBSJ 1E62A 4OJLA 2ZZQA 4EGZA 1O4XA 2P81A 4A3DJ 1FNCA 2NNNA 3J81K 3DP7A 2VXZA 1VQOI 1LJ9A 3I64A 3T51B 4KKSA 1I8DA 1Z1DA 3QYBA 3SZEA 2LD5A 3M9AA 4OIRF 3PSFA 4ABZA 1WOOA 1IC8A 2OTLI 4JX4A 3WBJA 4RD2A 5EF6A 3I3LA 1SVLA 5TY0A 3BR3A 2VKEA 2XZOA 1K78B 1FDRA 2MD0A 4RDKA 1VQMI 1BI0A 3SZPA 3WG7H 2GREA 3M07A 1X0CA 1NJID 3CP2A 1E3PA 1VQLI 4K1XA 2K9SA 4HF2A 2JTVA 4F7ZA 5TV2A 4P22A 3QU3A 3LSJA 4YFXF 3HYIA 2L4MA 2W84A 4L9JA 3OYHA 5J40A 1K4TA 1ETWA 1ZG1A 3KP7A 5C4JJ 1CF7B 2OTJB 2HOAA 3K4BA 1JUMA 2XHKA 2GAUA 1A6QA 3ZCOA 4FWTA 3TO7A 2RAEA 4RMNA 3Q0VA 4NCNA 1UD4A 2NRAC 4I02A 1O8HA 1B72B 4RAGA 1R4NB 5J6XA 3BH6B 1H42A 3A3BA 4XLNF 2VNKA 1YI2B 4WXCA 3PJRA 2RQPA 1SD7A 3VYSB 1DPUA 4X0GA 3GVLA 4UUSB 4LB6B 3UR3C 3CF5F 1PKVA 4DQ2A 1KU9A 1ZYRF 3GTMJ 5A8AA 2PBIA 2H6BA 4FE4A 2P5VA 3S15J 1UHMA 3H5AA 3LNNA 1O8EA 1QHHD 1QPIA 5FJ8J 2IT0A 4HG2A 1TT5B 4U7BA 4G7OF 3A01B 4RGUA 1UD2A 2FSWA 2VL8A 1OCTC 5TJJA 2BM0A 4BHCA 1R00A 3BZ6A 3LQ6A 3WXMA 5M5YJ 2B9SA 3VEPA 1KYZA 2FBKA 1E63A 2NT6A 3G05A 1V55H 2BW3B 2V6CA 1OB2A 1F36A 2EH3A 4QTRA 1XSDA 2L2OA 4F93B 2R5YA 2PN6A 2E7WA 4CYDA 5HDKA 4XMYA 1J9IA 2CRVA 3TEDA 1Y56A 3EDPA 2R0QC 4A6DA 2KRCA 2IQ7A 2BE5F 4HYEA 3U6KA 1OYWA 5DCMA 1A6IA 1HDDC 1OJLA 1IGNA 4WZTA 1FOYA 4Q7JB 1RKTA 2HQ5A 2E1CA 4Z4VA 2ECBA 3ZMTA 2A69F 3VMVA 4C2MJ 1VQOB 3VNVA 1VZ0A 1CNFA 2K7LA 2Z6BD 2BM6A 5J3LA 2A07F 3SYJA 2M34A 3BDDA 1A5JA 1OCCH 4HZFA 2OTLB 4U9UA 2Q6OA 2DTRA 3TGNA 2JRTA 2MH9A 3CB4A 4UUVA 2AHQA 4I2OA 2V4JC 1TNTA 4ON0A 1VQMB 4ZC3A 1D0XA 2M4GA 2OQRA 3PM1A 4I98B 3RSNA 2CFXA 4DNCA 3H0GJ 1S5LC 1ZUNB 2C4TA 1HF2A 4DK1A 2K9QA 3GTJJ 3OJXA 1VQLB 4HE5A 2V79A 5KAIC 2XF5A 1QGPA 1E64A 5THXA 1OMIA 2DU9A 2Q2EA 2LBFA 3FXQA 5M3MJ 3CTAA 2ZJPF 2BVNA 1TYWA 2ICWG 4HF0A 4YEIA 2R5ZB 3OL4A 1W7PB 5ICFA 1YLFA 3ZQHA 5D5VB 1MJAA 1Z3YA 3MEXA 2IA0A 1UB9A 1K78A 2GJKA 3R6SA 1LVKA 1YHQI 1FOKA 4RA2A 3EPZA 4OPVA 1GT0C 3IAS2 4JX6A 3RQ4A 2F5VA 2G7HA 3BR0A 2NVQJ 1QG0A 2ODLA 1MDMA 2HI3A 1LE8A 4HWVA 4FK8A 1ETOA 2BN4A 4RM0A 2C5BA 1YW7A 1YIOA 2R3SA 1LUJB 4PJ0C 4W8TA 1ORKA 5FLXK 3A1PA 4WZEA 3PENA 1WH5A 5A89A 3TL4X 3VSKA 2D74A 4M9XA 3QODA 3T56B 1I18A 1B72A 1COWA 4J01A 1ERDA 2LRDA
chains in the Genus database with same CATH topology
3ZXSA 1J09A 2FUG2 4E7JA 3HG9A 4ZJZA 2KVOA 3OYGA 2W4SA 1D0YA 2XZPA 2K9MA 3OYKA 4BJTA 1V0EA 2VPLA 2LYCA 5JHFA 1BHEA 1DP3A 2VASA 3VDXA 1V5FA 2ZXIA 4E6KG 1LDKB 3S3MA 1W0KA 4B44A 2GK6A 1O8LA 1WFXA 3H9GA 1N77A 3OEEA 2F4IA 1H8HA 1WJDA 3SUCA 4RM3A 4XKVA 3PUBA 2XZLA 2KHMA 2RQQA 1ZELA 3OIQA 2BOLA 2MABA 3SDBA 1E1RA 2ZTNA 1WJAA 4XLCA 2ZZFA 2JSPA 2NOJB 3UNGC 3EUHC 2UWMA 1D1BA 4OAZA 1MMGA 4CCNA 3C2GA 2W6IA 3SZGA 4CCMA 1UD8A 4E7KA 4AVZA 5IK2A 4YZAA 2RNGA 1MNDA 3S32A 2R7WA 1CZFA 4E7SA 2CV1A 4CZCA 2V9KA 1WMRA 3B8YA 4W8QA 3HL2A 2WADA 4C9YA 2HQAA 2HNHA 4CCJA 5CDFA 4MXNA 3LL7A 2CUJA 1H8EA 3PFYA 3K4NA 3BLYA 4W8RA 1EA3A 2XNDA 3EUAA 4XKWA 3K4LA 4OJ6A 1PJRA 4G6IA 4B3XA 1TT0A 2WAQA 2KP6A 2WJYA 3GQBA 2QKLB 4PJMA 4DNTB 3DTIA 2K5CA 1BN8A 3MKZA 2VBKA 2VKDA 3BC9A 1AA7A 2R7QA 4IQJA 1E3XA 3OYCA 2INVA 2V26A 2M5SA 1SFKA 1UG0A 2IS6A 2WSSA 2HVRA 2JJ1A 4NUBA 3L2VA 4QPQA 4ZDLA 3OYMA 3FKJA 1Z21A 5CQEA 3OOCA 4KJZA 4LIVA 2W1OA 4XN0A 3KEWA 1AIRA 2QX3A 3UW0A 3OW7A 3VWBA 3OS2A 4CA0A 3OYNA 4HPQA 3FBNB 3BCAA 4DK0A 2NTBA 2R4GA 2NT9A 3WQZA 3VMWA 2XF6A 4E4HA 2JIZA 2X1CA 3PNVA 2PJRA 3AL0B 2XC7A 2Z1DA 3F9KA 1G59A 2BVLA 1N78A 3HAGA 1LFPA 2E1MC 2IXSA 2DT7B 4PUSA 3BCBA 3OYDA 4XLHA 1QU3A 1O8JA 2NSPA 1OGOX 4BJ5C 4LITA 4U4BA 2L9SA 5C1CA 1UD3A 2OC6A 3CP8A 2I8DA 4RLFA 1D1CA 2IS4A 2XF7A 1T0FC 4BUPA 3GVKA 4AYBA 1T5EA 4Z03A 3RCOA 4B48A 4JMQA 3DQVC 1MMAA 4F52A 4RLQA 2CW7A 2MFZA 3OYIA 2PJRB 1H80A 1QJVA 2KL4A 2R7SA 2WY8Q 3K4MA 1YX3A 4XLFA 4BQNA 1JI8A 2ZZEA 4YZXA 4IQ4A 3DKXA 2LG4A 1WP6A 4DBQA 4KITB 3L2UA 3TMOA 4BDYA 2PMZA 2VJIA 3KRGA 2MYSA 2X1EA 2R7XA 1JRGA 1NG6A 1OHHA 1VBLA 1O8MA 4ZDOA 2LY2A 2Z2SB 3M8JA 3OOUA 3OR2C 3FPPA 3GQ8A 2E5ZA 2Y0SA 4PJJA 2VLAA 3A2KA 4ZTJA 1BLIA 4B3FX 3KEYA 3ZPNA 2PECA 3HPGA 2BVMA 2A6TA 4BL0B 2DT6A 2AQEA 3OYAA 2V4DA 3VSUA 2QKMB 2VQCA 4XONA 3LSHA 4DOZA 3S3OA 4DJAA 1OLTA 1JTAA 4U49A 2GK7A 3H94A 4JQFA 1MMNA 2O5RA 2IGMA 2GOXB 1X4PA 2E1BA 1KONA 1UELB 3G2BA 4KISA 1E3ZA 1NG7A 1EE6A 3CF2A 2IGOA 1WJCA 4OWRB 4QPOA 2ZSHB 2X6XA 1D1AA 2CH0A 3QYEA 4P1WA 3E0JB 4PSXA 4C30A 1QHGA 3I9V2 2CK3A 2L5QA 4E7ZA 4R79A 1OFLA 3IAM2 1BPLA 4PJNA 3A1YA 4BU2A 2WPDA 1FMVA 2X3HA 3W3CA 4HRIA 2QY1A 3DTEA 1WJFA 2CS3A 2QE7A 3KX2A 2M4KA 1KTWA 2BSPA 2QXZA 4E0FA 2IS1A 1HZEA 2E5NA 2K9LA 3OYEA 1VJSA 4PFPA 1VF7A 3EQNA 2OUMA 1HVXA 1MNEA 3W2AA 1IRXA 4Z05A 5C1EA 1E43A 2O0WA 2HPMA 2XGJA 3BG7A 4RM2A 1S9HA 3K6GA 1E0EA 2VKHA 3SYTA 1FX0A 4B3GA 1W9XA 5FL7A 4TKOB 2M7AA 5HNFA 4OJPA 3DU6A 1OB0A 2L9NA 1EFRA 4ZDPA 1HG8A 3IP4B 4JOMA 2K3PA 1BR4A 3BH4A 1X1DA 1GQ8A 2LH9A 4KT6A 4OAYA 4DIQA 5KHDA 2O1DA 2NSTA 2L7KA 1KCDA 4BE0A 2F43A 5HKKA 1RMGA 3ZGKA 4II2A 3J7AY 3H35A 1MABA 5DN6A 4XL9A 4DBRA 4DGWB 4XD7A 3HC7A 4N4NB 4E7IA 2PYGA 1NHCA 3K4KA 2IS2A 1PYVA 3HUGB 4Y33A 4IZZA 4XR6A 4F3QA 1OR7C 1VLYA 2ZFUA 3NWSA 4CCLA 4C2UA 2ZXHA 1BOBA 3DU5A 3OYFA 4FETA 2CMPA 3OS0A 2GJRA 4IKFA 4CSWA 1OFMA 3B4NA 3OR1C 2HPIA 4LIUA 4F55A 2X53S 3S3NA 1KMHA 3RPUD 3HXLA 2E60A 1WJEA 3OYBA 2KRHA 4LG3A 3FY3A 4XLEA 2ZZGA 1U0JA 3LFUA 4HSRA 3ZRGA 2E1MB 2CFOA 3DLAA 4H4KC 3PL8A 4BE1A 4BE2A 4BEHA 2HDWA 2HLDA 3OEHA 2XSJC 3ZSCA 4P5OA 2WY7Q 3CESA 2V6EA 2UUZA 4PMHA 1MMDA 2D3NA 2DCEA 5TGTA 1YE9A 5LFAA 4OZZA 2X1DA 3OY9A 2X8KA 1V5EA 3OIPA 4Y3OA 4E7LA 2LZJA 5CPRB 1DGRM 2W82A 3TBIA 4HNUA 4XOPA 3VSTA 1G8XA 2OV7A 3T9GA 3VSVA 2WAEA 3CJRB 2WAFA 3EUKL 3DPTA 2WZPP 2X85A 2WB1A 1IA5A 3D5RC 2IGNA 4BEHB 2VJ5A 1HA8A 1DBOA 3AFHA 4YZ0A 4MLOA 2UVEA 5FRMA 3DPUA 2DJIA 3MD2A 1X19A 3JU4A 2HU9A 4TSFA 2XAUA 1IDJA 1TZLA 3LMMA 3RTRA 3OAAA 4G7WA 2KLOA 4NC8A 3ZR8X 3HOSA 3AL0C 3WWGA 1WJ5A 1FMWA 1P9QC 2ZSIB 3DKYA 4Y4RA 3VYUB 2R7VA 2V7QA 1PXZA 2NT6A 1MW7A 4ANJA 3K70C 5CKTA 4YELA 1X4OA 1V0FA 3DWLE 2VBMA 3K70D 3N05A 3VYTB 4XNFA 4PK4A 2DOAA 4EATA 4PSWA 2WJVA 3OYLA 4C2LA 3HOTA 2M3AA 2V7FA 4PFOA 1OOCA 1OGMX 3EQOA 2ELJA 2VQHA 3PNTA 2F6CA 5FROA 3KYLA 3BCFA 2WBMA 2O0VA 4GRIA 5HLTA 1W36C 2O17A 4YEJA 4OJOA 2VJJA 4NQWB 3VYRB 2LREA 2VJ4A 3IUOA 4XKBA 5KNLA 1W36D 2NTQA 4DNRB 4C2TA 1RWRA 5CQGA 2KZVA 1NBMA 1RU4A 1UAAA 2IGKA 1T95A 1PLUA 2MC4A 3FDYA 1K5CA 4BACA 1NRKA 2R7OA 2LY1A 2Z8GA 3OPOA 4OJLA 1X1CA 1DGWY 2ZZQA 2R7TA 3GQ7A 4OJ5A 1WJBA 4FASD 4I84A 2DXIA 2VXDA 1GLNA 1KCCA 2VXZA 3T51B 4KKSA 1I8DA 3QYBA 3PSFA 3PSIA 3DTKA 2UV1A 3NE5B 4FXUA 4NK6A 2JUGA 2XOKA 3SEZA 3I3LA 4B43A 3LSKA 2XZOA 3QOEA 2MD0A 4Z06A 4F91B 3H5NA 1BR2A 2X6WA 5LD2C 1WPCA 1YX5A 3U21A 1QCXA 4YRVA 1X0CA 3CP2A 2NTPA 3W2WA 4P22A 2ZTGA 3BCDA 3B90A 2V1NA 3H5RA 3A35A 3OYHA 2KDOA 2LOOA 2F1MA 2AQFA 4HEA2 3H0DA 2LC2A 3K4BA 1DBGA 1O8DA 3ZPPA 2VQLA 3GQ9A 2X6YA 3FHNA 3V42A 4ASUA 3ZCOA 1IB4A 4F92B 4RMNA 1KZLA 4U87A 1UD4A 2W00A 1O8HA 2R9VA 2CW8A 4ZTFA 4XOTA 3M1CA 3VSLA 3MMYB 5FRNA 2CV2A 3A3BA 3OE7A 1LKXA 2JVHA 3GVJA 1Z7LA 1O8KA 3PJRA 3VYSB 2O04A 3LSIA 4X0GA 3GVLA 3LMWA 2JJ2A 4AU7A 2P0WA 2HZDA 4B47A 3UR3C 1SAUA 4PJLA 3BC8A 1PKVA 2INUA 4CCKA 1O8FA 1O8GA 4N4OB 2X51A 2BW3A 3BG6A 4BXFA 4G7XA 3H5AA 3QYFA 3FKSA 3LNNA 1O8EA 4ITVA 3GQAA 1QHHD 4BS9A 4HG2A 5HVQC 2VB6A 4U7BA 4XN3A 3OYJA 3DDYA 3PNYA 1UD2A 2XDVA 2VL8A 2W7NA 4KKUA 4BJ6C 2VBEA 3CJQB 4G6TB 4UZUA 1O88A 2HVQA 1K28D 3L2QA 3S93A 4L8JA 2Q1ZB 2W6JA 3G05A 1W0JA 2BW3B 3K10A 1WTHD 3L2WA 3HKZA 3FBIB 5HNHA 2L2OA 4F93B 2GJPA 4XMYA 2CUZA 5AMVA 1Y56A 4TT3A 4OZYA 2KRCA 3GBGA 2JA2A 1O8IA 1PE9A 2IQ7A 2VIXA 2EWEA 2D3LA 3W2VA 1SKYB 4BQQA 1E1QA 3K4JA 4BGDA 2HVSA 3LSMA 2CV0A 1R6RA 3VMVA 2Z16A 2KMUA 1VZ0A 4YXWA 2KPMA 2Z6BD 1K6YA 3ONQA 4XORA 1E79A 3L2RA 4BDZA 4URRA 3SEQA 2R7UA 2PYHA 3DPLC 3A4CA 4Z1MA 2GOMA 2JVGA 3DEEA 1D0ZA 2RREA 3C2HA 2V4JC 3OS1A 4XQFA 3H9JA 4ZC3A 1D0XA 2M4GA 1IDKA 5KCMA 3RSNA 3ZIAA 2NZMA 3MKWB 4DK1A 3ZQQA 4XKCA 3S8PA 3OWTA 4NK8A 1BR1A 2A5WA 2XF5A 3JURA 2LBFA 3HPHA 4HSTA 2DIEA 3OFNA 4KKTA 4GQNA 4CCOA 2VQGA 2R7RA 2M0MA 4II3A 4D9JA 1X1AA 3OL4A 1XG2A 3GRHA 2M7BA 4CUGA 3MKYB 1Z3YA 4IX7A 2KQRA 4BQOA 4YZQA 3CMMA 3D5SC 2GJKA 3A3GA 1LVKA 4HIZA 4XLAA 2JDIA 3VR6A 3EPZA 1BMFA 3T53B 3IAS2 3RQ4A 2F5VA 1X1BA 3H9QA 3LSGA 5HOOA 2V31A 2ODLA 3D5LA 1N75A 4MR0A 2Q2EB 2LBFB 1Y6IA 1UD6A 4HWVA 4EW9A 1Z3XA 3E1SA 3OMYA 4NC7A 4ZYAA 4NNJA 4D1QA 4W8TA 3K4CA 3AKZA 2WA0A 1V5GA 3CZ6A 4XM3A 3TL4X 3VSKA 4J00A 4E7HA 3OL3A 1DQUA 3NWTA 4HNTA 1I18A 3QODA 3T56B 4W8SA 1COWA 1UD5A 2UVFA 4J01A 1ERDA 4CH7A 2LRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8G A;  4XOP A;  3VST A;  3GQ8 A;  3T9G A;  3VSV A;  1O8E A;  1BHE A;  2PEC A;  3GQA A;  2X85 A;  1IA5 A;  4XN3 A;  3VSU A;  1O8L A;  4XON A;  4U49 A;  3SUC A;  1JTA A;  1DBO A;  4YZ0 A;  4XKV A;  2UVE A;  1EE6 A;  2VBE A;  1IDJ A;  4XLC A;  1O88 A;  2X6X A;  3WWG A;  1PXZ A;  2NT6 A;  1OFL A;  4YEL A;  2VBM A;  4AVZ A;  4YZA A;  2X3H A;  4XMY A;  1CZF A;  2QY1 A;  4XNF A;  2QXZ A;  2BSP A;  5AMV A;  1KTW A;  4OZY A;  1O8I A;  1PE9 A;  2IQ7 A;  1WMR A;  3B8Y A;  4W8Q A;  2EWE A;  4MXN A;  4C2L A;  1OOC A;  1OGM X;  3EQN A;  4W8R A;  4Z05 A;  4XKW A;  3EQO A;  4OJ6 A;  5C1E A;  2O0W A;  3VMV A;  1BN8 A;  2VBK A;  2O0V A;  2O17 A;  4OJO A;  4YEJ A;  2VJJ A;  4XOR A;  2NTQ A;  2INV A;  1RWR A;  4OZZ A;  1RU4 A;  1PLU A;  4URR A;  1K5C A;  2PYH A;  1HG8 A;  2Z8G A;  4XQF A;  1AIR A;  4XN0 A;  4OJL A;  1GQ8 A;  3UW0 A;  2QX3 A;  1IDK A;  3GQ7 A;  4OJ5 A;  2O1D A;  2NZM A;  2NST A;  4I84 A;  1KCD A;  4NK8 A;  1RMG A;  1KCC A;  2NTB A;  2NT9 A;  3VMW A;  3JUR A;  4XL9 A;  2PYG A;  1NHC A;  4NK6 A;  1XG2 A;  4XR6 A;  3GRH A;  4Z06 A;  4XLH A;  1QCX A;  1O8J A;  2X6W A;  1OGO X;  2NSP A;  4YZQ A;  1X0C A;  4U4B A;  2NTP A;  5C1C A;  4XLA A;  1OFM A;  3B4N A;  3B90 A;  4Z03 A;  4MR0 A;  2ODL A;  1O8D A;  1DBG A;  3ZPP A;  1QJV A;  3FY3 A;  1H80 A;  4HWV A;  4XLE A;  2X6Y A;  3GQ9 A;  4EW9 A;  1IB4 A;  4XLF A;  4W8T A;  3ZSC A;  4YZX A;  1O8H A;  4XOT A;  4XM3 A;  1O8K A;  4PMH A;  2O04 A;  2VJI A;  3KRG A;  3LMW A;  4W8S A;  1JRG A;  4OJP A;  2INU A;  2UVF A;  1VBL A;  1O8M A;  1O8F A; 
#chains in the Genus database with same CATH topology
 3ZXS A;  2FUG 2;  4RJL A;  2ECC A;  2QZ8 A;  3HG9 A;  4ZJZ A;  2VNI A;  2W4S A;  4A3F J;  2IPQ X;  2K9M A;  2XAJ A;  1L3L A;  4BJT A;  1YOV B;  4UY8 I;  4HQE A;  3TW6 A;  2VBW A;  1HSJ A;  3VDX A;  5K1Y A;  1V5F A;  2ZXI A;  1LDK B;  3S3M A;  3AVV A;  4HOB A;  1IG7 A;  2CC2 A;  2L02 A;  3HOZ J;  2MLG A;  3ZMV A;  1T38 A;  4XLP F;  1I50 J;  2G7U A;  3V8J A;  4UXN A;  3A01 A;  2VNJ A;  2DN0 A;  2GXA A;  5F08 A;  3SDB A;  2MAB A;  4ZGQ B;  2YUS A;  2ZL6 A;  2VNH A;  4C0S A;  2GIV A;  1JJ6 C;  4RD1 A;  1LDJ A;  2IP2 A;  2JSP A;  3EUH C;  3K2Z A;  4PC1 A;  3A8K A;  3T8R A;  4E7K A;  1APL C;  4YZA A;  1T56 A;  4PAB A;  5E8I A;  1CZF A;  1MJ9 A;  4RAF A;  4A2U A;  4G8X A;  2FF4 A;  1WMR A;  4W8Q A;  1S3J A;  2V1U A;  3E5U A;  2C5H A;  2QA4 I;  4PAA A;  5HS9 A;  5KVR A;  3CCL I;  3BLY A;  3ASP A;  4ESB A;  4BNC A;  5EMN A;  1EA3 A;  2HDD A;  2LDU A;  4L0Y B;  2QEN A;  4B3X A;  1DDG A;  2WJY A;  3GQB A;  5AN9 A;  2VBK A;  2QKL B;  1WOP A;  2K5C A;  4V19 K;  3R0A A;  2VPR A;  2WAQ N;  2FD5 A;  3CUQ A;  3JRH A;  2M5S A;  4P6Y A;  1Z6T A;  1UG0 A;  1SFO J;  2WSS A;  4O6J A;  3CDI A;  3NRV A;  4M3F A;  4QPQ A;  4AWX B;  5F4O A;  3FKJ A;  5FIU A;  3ABK H;  4YFN F;  4PC2 A;  4Q48 A;  2W1O A;  2P5L C;  2VBT A;  2X9D A;  1FLI A;  3OW7 A;  5D6E A;  3QFS A;  1HCR A;  3VWB A;  5E6T A;  4N0B A;  1YHQ B;  3WTY C;  1I27 A;  4IO9 F;  1Z77 A;  3BP8 A;  1N06 A;  3E3V A;  3I0T A;  4OIO F;  4P9S A;  2NT9 A;  5AIP A;  1NB0 A;  2M87 A;  2ELK A;  3CME I;  2Z1D A;  2XKO A;  3SZT A;  3B8H A;  1QRB A;  2BVL A;  3KP5 A;  2XAQ A;  1N78 A;  1LFP A;  2DT7 B;  3WTU C;  3W2I A;  3OYD A;  2NSP A;  2Q6I A;  2ISY A;  2EIJ H;  1EH7 A;  2DOG A;  1W7P A;  1K79 A;  3T1B A;  2OC6 A;  4RLF A;  4RB3 C;  4A3E J;  2XF7 A;  1T0F C;  4UB6 C;  2F5C A;  4BUP A;  3GVK A;  1JT6 A;  4AYB A;  1T5E A;  4TMT A;  1J5Y A;  3R4K A;  3F21 A;  1MMA A;  1WVR A;  4F52 A;  2VZL A;  3OYI A;  3H1C A;  1BM9 A;  3MCZ A;  2WY8 Q;  4FN5 A;  1GAW A;  4IHS A;  3K4M A;  4XLF A;  1RC9 A;  3BTC A;  1V3F A;  2A68 F;  4QSH A;  1PVE A;  1B9N A;  4RD4 A;  1TWF J;  2CJJ A;  3PVD A;  5DM7 F;  5EDN A;  4BDY A;  2PMZ A;  3RQI A;  2VJI A;  1BJA A;  3KRG A;  2R7X A;  4OIN F;  4FQG A;  1Q82 D;  3M8J A;  2ZL5 A;  3HEF A;  3OR2 C;  3RYR A;  3WE3 A;  4N3N A;  3FX3 A;  4S04 A;  1RNL A;  1KK0 A;  3HPG A;  2BVM A;  2A6T A;  2AQE A;  5CVV A;  3VSU A;  3E6D A;  3S3O A;  2WZN A;  3LSH A;  1GV2 A;  4DJA A;  4Z4S A;  2I5U A;  1MD0 A;  2GK7 A;  1JA1 A;  4KIS A;  2MD5 A;  5HLH A;  3RYP A;  2IGO A;  4OWR B;  3CCL B;  1D1A A;  4UB8 C;  3E0J B;  3HM5 A;  1F43 A;  4C30 A;  1KJZ A;  4B09 A;  4UAJ A;  2VBV A;  2BYV E;  4JK1 X;  1FYM A;  3HOW J;  3K2A A;  1Y8Q B;  4PJN A;  2G0E A;  2MLK A;  2WR8 A;  3G4S B;  2BM5 A;  2E35 A;  3K7A J;  1RQP A;  2VBZ A;  3J7A O;  2C78 A;  2JN9 A;  2QY1 A;  3DTE A;  2QE7 A;  2QXZ A;  1IXR C;  3E6M A;  1XCV A;  4GCV A;  4A5M A;  2DDA A;  3V7S A;  5A2Q K;  1H0M A;  4HLX A;  1HZE A;  2DOF A;  5FLV A;  3SEJ A;  1OFC X;  1R1V A;  2OK7 A;  1I6X A;  4A12 A;  4X0C A;  4MIM A;  1MNE A;  1IO2 A;  2P6S A;  4MQ9 F;  2O0W A;  4Q5S F;  1DU6 A;  2XGJ A;  5IP7 J;  2R92 J;  1DDI A;  1E0E A;  3SYT A;  3FPK A;  3V8K A;  1VQN I;  1Z9C A;  4RB1 A;  4OIP F;  3J81 k;  1QUE A;  1S7A A;  3BR2 A;  2ZJQ F;  5KW9 A;  3CME B;  1TYX A;  2VYQ A;  3DU6 A;  3BY2 A;  4ZYH A;  2QQB A;  3O6B B;  1HG8 A;  1U3E M;  2K3P A;  3CDH A;  3PFI A;  2Y0M A;  1JKO C;  1GQ8 A;  1R7J A;  2LH9 A;  2D1H A;  1VI0 A;  4OAY A;  4PGO A;  4ZCM A;  1WOS A;  2MG4 A;  1OGI A;  1VQ9 I;  3J7A Y;  1MAB A;  3H35 A;  5F4M A;  5A88 A;  1N25 A;  3K1P A;  5F27 A;  3Q38 A;  2HS5 A;  2VT2 A;  5ERI A;  4Y9U A;  1BX0 A;  2OJE D;  1OR7 C;  1VLY A;  3HB9 A;  2OBR A;  1MGT A;  3TO9 A;  3NWS A;  1FT9 A;  3G71 I;  2VBX A;  2DFF A;  3LFK A;  2MA3 A;  3OS0 A;  1PUF B;  1KGS A;  5ICG A;  2Y75 A;  1KZH A;  1QX4 A;  3B4N A;  4Y17 A;  3B6A A;  4M9S A;  1IDY A;  1B2R A;  2MBF A;  4F55 A;  2D1V A;  2JA5 J;  2DQR A;  4OU0 A;  5IOZ A;  1FX7 A;  3U1K A;  2KRH A;  4LG3 A;  5BNG A;  1K7A A;  4A93 J;  4D7M A;  5L3C A;  2XEX A;  3LFU A;  2IEK A;  3B82 A;  2E1M B;  2CFO A;  2VN2 A;  3K69 A;  1XSV A;  3PL8 A;  4H4K C;  2J5P A;  4M73 A;  2HLD A;  3ZSC A;  1JKP C;  5BPI A;  2O0Y A;  3H3U A;  1MKM A;  1FEX A;  2GA1 A;  1LEB A;  1O3R A;  3CES A;  5FFZ A;  3JQQ A;  4M6Y A;  5ICC A;  4WF2 A;  2DCE A;  3FXU A;  4OZZ A;  5ILU A;  3RKX A;  2QVO A;  1ON1 A;  1MJB A;  2DA5 A;  1HW1 A;  1RET A;  3M1E A;  4E7L A;  1ZM2 A;  1DGR M;  2DA4 A;  4EJT A;  4XOP A;  2GXB A;  3DV8 A;  4WWV A;  4O5V A;  1KK1 A;  4KH3 A;  3VSV A;  2COM A;  1AHD P;  4B3A A;  2QYO A;  1YX2 A;  3LA3 A;  1IA5 A;  2V1X A;  4OPS A;  1C0W A;  5HS8 A;  1FND A;  3TDZ C;  1I7P A;  5L3E A;  3AFH A;  5D4S A;  1T6Z A;  2UVE A;  2K85 A;  5FRM A;  5ICE A;  4U0W A;  3KLO A;  2XIG A;  4MNU A;  3W5V A;  1FP1 D;  4TSF A;  1KYW A;  4NC8 A;  3ZR8 X;  5F4J A;  3PO2 J;  2X0L A;  1WJ5 A;  4MTE A;  1MBG A;  1NK3 P;  4M6V A;  1U5T A;  1N07 A;  2GQF A;  4XRF A;  1YJN B;  1PXZ A;  2NVY J;  1MW7 A;  3KZZ A;  1JGS A;  4ANJ A;  2V5I A;  2VBM A;  3HSR A;  4WZL A;  1K61 A;  1KQ8 A;  1DG1 G;  3CCQ B;  3N05 A;  1KU3 A;  2JA8 J;  3I4M J;  3L1P A;  4EM2 A;  1W34 A;  3KL9 A;  4AVP A;  4EAT A;  4P2N A;  2ZL7 A;  4HA8 A;  1XE1 A;  1P4A A;  1WSR A;  2XV4 S;  3HOT A;  1G6N A;  3H92 A;  4IHT A;  3EQO A;  2F6C A;  4DYC A;  2CBX A;  1XC5 A;  4EMS A;  1ZRE A;  1VQ9 B;  2O17 A;  2P7C B;  4M9Z A;  4YEJ A;  2VJJ A;  3KLN A;  4IXA A;  4DNR B;  2K27 A;  3BQY A;  4C2T A;  2IJL A;  5FNZ A;  1FZP B;  1RU4 A;  2IGK A;  1T95 A;  1R5O A;  3BR6 A;  2G9W A;  1U2W A;  4BBR J;  4A3B J;  2LY1 A;  3DCF A;  3RY8 A;  5B6I A;  1KRH A;  1Y0R A;  2JQ7 A;  2HMA A;  2NPF A;  4FAS D;  3G71 B;  1Z05 A;  1VND A;  2IA2 A;  3G1M A;  4MGR A;  3R6J A;  4PC3 A;  1KCC A;  1DDN A;  1F5T A;  2Z3Y A;  1EFU A;  2BY3 A;  4H9G A;  3KZI C;  2ZBV A;  4NK6 A;  2JUG A;  5F04 A;  1HKS A;  2LMD A;  5L3B A;  2QN6 A;  2XOK A;  1WOR A;  4B43 A;  2CU7 A;  4NHJ A;  2LVS A;  3RIR A;  4F91 B;  3H5N A;  2STT A;  1QCX A;  1EFT A;  3U21 A;  5EGO A;  2HEO A;  4YRV A;  5E8G A;  1ENH A;  4U7D A;  2XNC A;  3BY1 A;  4X05 A;  3W2W A;  1DUX C;  2NTP A;  2LR8 A;  3NAU A;  4X1E A;  2O61 A;  5M3F J;  2ZTG A;  3BCD A;  2V1N A;  3H5R A;  5DEQ A;  1ZAO A;  2GBY A;  5DS9 A;  1IZ1 A;  3CMA B;  2G0Y A;  2LOO A;  1PUF A;  3BR1 A;  2LC2 A;  4K2E A;  3A0H C;  5D5W B;  2VQL A;  3G6E B;  3QE2 A;  5L46 A;  2JUC A;  3FHN A;  2CG4 A;  2O3F A;  4Q47 A;  3RDI A;  3V42 A;  1GAQ A;  4ASU A;  4F92 B;  5DM6 F;  5BSX A;  2FQ3 A;  1R5H A;  4Y7C A;  1BI1 A;  2W00 A;  4ZTF A;  3KEO A;  3MMY B;  3S14 J;  2CV2 A;  3RI4 A;  1LKX A;  3O3K A;  5DD4 A;  1YRN B;  1BA5 A;  1XPX A;  3GFI A;  2FNP A;  3RKY A;  3PA2 A;  4OJP A;  1EKE A;  2EZI A;  4R1H A;  3WGG A;  1O8F A;  1POG A;  2BY1 A;  4N4O B;  4LJZ F;  3GME A;  2X51 A;  2DPD A;  5E17 F;  5HZB A;  3ML6 A;  2XSD C;  3GTL J;  2LF8 A;  4RCY A;  5D8L B;  2H94 A;  3FKS A;  4YDT A;  1FNN A;  3J81 Z;  3GQA A;  2O7O A;  3GLL A;  4BS9 A;  4CIC A;  2UXN A;  5HVQ C;  2NVT J;  3NB2 A;  3JW4 A;  2ETH A;  3PNY A;  3JSP A;  2XDV A;  3F6V A;  4KKU A;  4P96 A;  1RQR A;  2VBE A;  4BYY A;  4M71 A;  2HVQ A;  2LLK A;  1K28 D;  1W87 A;  2QEX I;  5B1A H;  1BJZ A;  3NAR A;  1Y8R B;  3K10 A;  4Y52 J;  1WTH D;  1LFU P;  3HKZ A;  3FBI B;  3JRG A;  4KIG A;  1QA2 A;  4KNY A;  2M45 A;  5IYB J;  2MSY A;  2KIM A;  1NTC A;  2W85 A;  3SLD A;  4OZY A;  1QA1 A;  2OAZ A;  2JA2 A;  1TWG J;  2KFD A;  1IJF A;  2XGD A;  1I5Z A;  3BPX A;  3W5U A;  4CHU A;  4HQM A;  2HWV A;  3IWF A;  4W1U A;  2JRM A;  3KFW X;  3BNW A;  2EFQ A;  2CV0 A;  2NS7 A;  5E3N A;  3FMQ A;  2PI0 A;  4B4D A;  1D1N A;  2VFO A;  2QDX A;  2DAO A;  1FOW A;  2Z16 A;  5IYD J;  4RPB A;  5LGU A;  2R7D A;  4YXW A;  2ZCW A;  1SD4 A;  3SY2 A;  1SKQ A;  3GFM A;  3F0C A;  2VFQ A;  3L2R A;  2XTX A;  5LRS A;  3SQN A;  4BDZ A;  4M3E A;  4EVI A;  3LSP A;  4AIJ A;  1MH4 A;  2JVG A;  3DEE A;  1SVO A;  2RRE A;  1XGM A;  1K73 D;  1P4M A;  3ZQQ A;  1HA3 A;  1TQI A;  3E5Q A;  3P26 A;  4RD3 A;  1XGO A;  2A5W A;  2KT0 A;  5EG0 B;  3GO5 A;  4RDJ A;  4IHV A;  1B4A A;  3JUR A;  2CND A;  1IN4 A;  3CCS I;  4IHX A;  4A0Y A;  3HPH A;  4HST A;  4KKT A;  2DMT A;  5DUI A;  1ON2 A;  1P92 A;  2VQG A;  2R7R A;  2M0M A;  4II3 A;  3SHF A;  1J2X A;  2M2E A;  2V9V A;  2M7B A;  5FO5 A;  4IRG A;  1LNW A;  3ONU A;  3GRH A;  3BG5 A;  2C77 A;  4KDP A;  3RZO J;  4IX7 A;  1U8R A;  4AIH A;  1R1U A;  4XLA A;  2JDI A;  4TN1 A;  1BMF A;  3BTL A;  1W0T A;  4NBQ A;  1J0R A;  2CUF A;  1QH0 A;  1X1B A;  3BZK A;  3H9Q A;  3LSG A;  1GO2 A;  2V31 A;  1N75 A;  2HR3 A;  3CUO A;  1YO5 C;  3CC7 I;  3B73 A;  2Q2E B;  2LBF B;  2XKP A;  1Z3X A;  2CQ7 A;  4C3I J;  5D4R A;  4LB5 A;  1GHC A;  1H9T A;  1NDH A;  2EV5 A;  3AKZ A;  5E79 C;  1VQP I;  2WA0 A;  1PJ5 A;  1UCR A;  1VF9 A;  4XM3 A;  4AUX A;  1G3T A;  2B7C A;  2XB0 X;  1DQU A;  4HNT A;  4W8S A;  1UD5 A;  3LA2 A;  2NXN B;  4CYC A;  2UVF A;  1OGJ A;  1B59 A;  1MZB A;  4CH7 A;  1YRN A;  2EIN H;  2KVO A;  2QEX B;  3ONY A;  4QV2 A;  1DAB A;  2GPJ A;  2VPL A;  2XUB A;  1MDM B;  4BY7 J;  4GXO A;  4L5I A;  2VAS A;  1LE8 B;  1DP3 A;  3HIF A;  3I54 A;  2GIZ A;  3KP3 A;  4NB5 A;  4IOC F;  1UJ8 A;  3IKT A;  4ENM A;  1N77 A;  2F4I A;  4KUM A;  4HW0 A;  1ZH5 A;  3ASR A;  3PSS A;  2JN6 A;  4RM3 A;  2KHM A;  4QLC U;  1F20 A;  1T6S A;  2YWH A;  1OFE A;  1QGY A;  1B9M A;  1ZRF A;  4E70 A;  3R6K A;  5EJC A;  2ZZF A;  4BXX J;  3CLQ A;  3T8T A;  3UNG C;  3F8M A;  1B8I B;  3LQQ A;  2W25 A;  1MMG A;  4OAZ A;  3V7R A;  4CCN A;  3FJO A;  3U2Q A;  3V7A A;  2DTZ A;  1EP1 B;  1QZY A;  4LBW A;  2EIX A;  4AVZ A;  1EWY A;  2FX3 A;  3S32 A;  1IF1 A;  2R7W A;  1ZAR A;  1ZM3 A;  2CV1 A;  2C2W A;  4EJV A;  3I58 A;  4AID A;  3LSR A;  2WWY A;  1REP C;  1VQ8 I;  3HOU J;  3JRI A;  2Y48 A;  3ESW B;  1VQ4 I;  2WC2 A;  2KJB A;  2HQA A;  2RC4 A;  2O8X A;  3F8C A;  4C9Y A;  1UMK A;  2JJ7 A;  2C4U A;  3GTP J;  3PFY A;  2WV1 A;  2ZME B;  4W8R A;  2Y69 H;  5FLX Z;  1L1I A;  3F6O A;  3SKB A;  1SD6 A;  3VOD A;  3BY6 A;  2TCT A;  3WNB A;  3DTI A;  4J19 A;  4Z2Y A;  2LFB A;  2Y31 A;  5E1Z B;  3IH3 A;  1E3X A;  3GVA A;  3CCS B;  1ITY A;  3D1N I;  1UZC A;  3ZN0 A;  1SFK A;  4YG2 F;  1FOX A;  2N8G A;  3G73 A;  2QWW A;  2F4N A;  5FGM A;  2JPB A;  1Z21 A;  2Q8K A;  2VOD A;  4KJZ A;  4LIV A;  1D8J A;  2QX3 A;  1PP8 F;  2HGC A;  3BOQ A;  3LOC A;  4P9F A;  1QFY A;  5BOX A;  3CC4 I;  2R4G A;  4HF1 A;  1T8I A;  2D5V A;  1LLZ A;  2XF6 A;  4HX8 A;  3IKV A;  2JIZ A;  2PJR A;  2K4J A;  3S2H J;  3AL0 B;  3W2E A;  3RKQ A;  1A04 A;  5EG0 A;  1G59 A;  4PCQ A;  3CC7 B;  3AVW A;  3CUQ B;  3WTX C;  4RGX A;  1YW8 A;  1A35 A;  3D0S A;  3MQ0 A;  2BGI A;  3WTS C;  1M90 D;  3ERM A;  2W57 A;  4XLH A;  1QU3 A;  1O8J A;  1OGO X;  2NYX A;  4P9U A;  4QFM A;  2B0R A;  2ZBK A;  2L9S A;  4WX9 A;  1JKQ C;  3Q3A A;  3ZZT A;  5C1C A;  1YG2 A;  1D1C A;  2HTJ A;  1SFU A;  5FB2 A;  1DPR A;  5LGT A;  4JMQ A;  4Z03 A;  5JLV C;  1KU7 A;  4GYG A;  2QQ9 A;  2ZJ2 A;  3NQO A;  3DQV C;  2Q0O A;  3F8F A;  4WXD A;  2NVU B;  3KP4 A;  4ZZL A;  3W6J B;  1BIA A;  1R22 A;  2YU9 J;  1H80 A;  2CF4 A;  1SVM A;  2R7S A;  3JRE A;  3SJZ A;  2YX7 A;  1LFB A;  1QVU A;  1NK2 P;  3TH0 A;  1LM1 A;  2LTP A;  1YX3 A;  3DKW A;  1RUN A;  1JI8 A;  2ZZE A;  2C6Y A;  4IQ4 A;  3DKX A;  4I09 A;  2LG4 A;  3FZV A;  1WP6 A;  4A6E A;  4DBQ A;  4KIT B;  3L2U A;  1SFX A;  3PQJ A;  1ETK A;  4IHY A;  2DBB A;  2X1E A;  5B1B H;  3Q3S A;  2QZA A;  4I76 A;  4EJW A;  1DAR A;  1YYV A;  2W7Z A;  4XRS A;  4F7D A;  5HS7 A;  5DUK A;  4KMU X;  2L7M P;  1Z67 A;  3IWZ A;  5K7F A;  2E71 A;  3HTS B;  1R5N A;  3GQ8 A;  3I1F A;  4PJJ A;  3A2K A;  3CJN A;  2QSH X;  2ZB9 A;  2E1O A;  4ZYD A;  2XAG A;  1S72 I;  1BIB A;  1XFO A;  1YQA A;  4GYI A;  2DT6 A;  3KE2 A;  3I71 A;  2V4D A;  5DYM A;  3DEW A;  4XON A;  1VQ8 B;  1P2F A;  4BQA A;  1OQY A;  4LG0 A;  4JQF A;  2B0L A;  1MMN A;  2GOX B;  3KCC A;  3I53 A;  2L0K A;  3W6K B;  1NG7 A;  1E3Z A;  3JSO A;  4QPO A;  4HDV A;  4MQV A;  1GR1 A;  2X6X A;  2CH0 A;  3QYE A;  3H09 A;  3BTJ A;  5GAG J;  3ABT A;  3I9V 2;  3JRC A;  2CK3 A;  1OFL A;  2DOD A;  1GDT A;  1WDT A;  4YAW A;  1BPL A;  2XPU A;  3IH2 A;  5FD5 A;  1KU2 A;  2A6E F;  4BU2 A;  1B8I A;  1FMV A;  3Q9S A;  3W3C A;  4QIW N;  2H8R A;  2BHY A;  2CS3 A;  4CXF A;  2YU3 A;  3KX2 A;  2M4K A;  1E3H A;  1X1P A;  2OYN A;  1KTW A;  2RV8 A;  2Z9O A;  4L18 B;  3FMS A;  4A69 C;  1WSU A;  4OPW A;  4IPA A;  4KMF A;  4V2F A;  3DLL F;  1YS6 A;  3QP5 A;  3I55 I;  1EF4 A;  2KJC A;  1VJS A;  5F0H A;  1VF7 A;  1O57 A;  3OZV A;  3IRR A;  5J1U A;  1IRX A;  2HZT A;  2V1D A;  3W2A A;  5J35 A;  2DPU A;  2F5F A;  1H9G A;  3W5H A;  3AVX A;  4LLL A;  1ZR4 A;  2ZME A;  4NBS A;  3CC4 B;  1QRY A;  1FBS A;  2ZFW A;  1AOY A;  5IYP A;  1KQ0 A;  1O7L A;  1WRJ A;  1WPK A;  1FNM A;  2DYR H;  1VQ6 I;  1HOM A;  1OB0 A;  4ZCI A;  1WKM A;  2BM4 A;  4ZDP A;  2EWN A;  1TW2 A;  3IP4 B;  4JOM A;  1BQE A;  4OOX A;  3GX4 X;  5GP9 A;  4A3M J;  4P25 A;  1YS7 A;  2QTL A;  1JJ2 B;  3CCM I;  1UG2 A;  3DU1 X;  4YC5 A;  2EB7 A;  2HYG D;  1JXS A;  2O1D A;  3Q9V A;  1KCD A;  4IEJ A;  2F43 A;  2BV3 A;  3MZY A;  2FX0 A;  5E1W A;  4II2 A;  5E1X A;  5DN6 A;  5LEK A;  4EGY A;  1F9N A;  4A3L J;  1ZGJ A;  1A36 A;  2DFH A;  2PYG A;  1NHC A;  3BWG A;  4R8H A;  3HUG B;  4XBF A;  1LDD A;  4U88 A;  3C2B A;  4PGH A;  1S8N A;  2ME6 A;  3CO7 C;  5GTI C;  3BRO A;  3WBK A;  5GPA A;  3VO2 A;  2ZXH A;  4RLZ A;  3DU5 A;  1QGZ A;  4M3D A;  4FET A;  2HYF A;  2PQ8 A;  2GJR A;  3GFJ A;  5A2Q Z;  4MFD A;  4QUZ A;  1KMH A;  3RPU D;  4ZYG A;  2RC6 A;  2HQN A;  3Q5F A;  3KYC B;  1BL0 A;  2H1L A;  3RZD J;  2QBY B;  2E1R A;  4ACB A;  5IYQ A;  4HSR A;  3ZRG A;  2HKX A;  4BE1 A;  1S72 B;  2EPF A;  2EBI A;  4BEH A;  2HDW A;  1VTN C;  2R6H A;  1ZQ3 P;  4P5O A;  2BGJ A;  2WY7 Q;  3BTI A;  3ECH A;  1A31 A;  2XRN A;  3QU6 A;  2V6E A;  4PMH A;  1MMD A;  1ZGW A;  4IRH A;  4XK4 A;  5LFA A;  3OY9 A;  3EYI A;  1ETQ A;  3ELK A;  2LZJ A;  3K1N A;  3R0J A;  5CPR B;  1S0U A;  3TBI A;  3VST A;  3MWM A;  1M1K D;  4LD5 A;  3ZOB A;  1PUE E;  3CRZ A;  1TUI A;  2JK3 A;  2WAF A;  4UVC A;  3DPT A;  3GSI A;  2WZP P;  1G7T A;  4JRA C;  4L9V A;  2DMP A;  4I99 C;  1XDS A;  2ESN A;  3PIP F;  4ENJ A;  1MSE C;  3FKI J;  4IF4 A;  4BHP A;  1HA8 A;  1DBO A;  5JLW A;  4MLO A;  1K4Z A;  2K02 A;  3DPU A;  2CQX A;  3MD2 A;  3GZ5 A;  2ID3 A;  2Z99 A;  3I55 B;  4Y13 A;  3RTR A;  1BI2 A;  3AL0 C;  1BW5 A;  5E3M A;  1HQC A;  1FMW A;  2L9V A;  2ZSI B;  1T2K A;  4NQW A;  1J59 A;  2I1L A;  3CUQ C;  2LKX A;  2CW5 A;  3K70 C;  4G12 A;  1J7K A;  4YEL A;  1X4O A;  1V0F A;  2F5D A;  2O6G E;  5BSY A;  4AF7 A;  3K70 D;  3RPQ A;  3F8B A;  2PFB A;  1U2R A;  3FK7 A;  2K86 A;  1VQ6 B;  3J80 K;  3V4G A;  2FOW A;  4P3Y A;  5H5J A;  3BR5 A;  5GPC A;  5B66 C;  4AIK A;  1CQX A;  1IN5 A;  2P8T A;  3W6V A;  1EA0 A;  3HZJ A;  1X58 A;  5IP6 A;  4C2L A;  2M3A A;  2V7F A;  3BT9 A;  4PFO A;  3CCM B;  5D5X B;  1OGM X;  1RI7 A;  4A3C J;  1M1E B;  2ELJ A;  2VQH A;  3BCF A;  3WHC A;  2WBM A;  2QA4 B;  4OJO A;  3VYR B;  1U5T B;  4OOI A;  2VJ4 A;  4PC6 A;  1TYV A;  2DW4 A;  3CCU I;  1IRF A;  1FSE A;  2KZV A;  5F1J A;  3PUF A;  3FHZ A;  4EH1 A;  3G1L A;  2L9R A;  3FDY A;  1UMQ A;  4CZZ A;  2Y9Z A;  1W7P D;  1WQ2 A;  1X1C A;  1DGW Y;  1QUF A;  5AIQ A;  4OJ5 A;  1WJB A;  3TP3 A;  4I84 A;  2DXI A;  2BY0 A;  2AHO A;  2VXD A;  3N97 A;  1GLN A;  3O8G A;  2EJR A;  2ESH A;  2EV0 A;  5ILV A;  4P55 A;  2BXZ A;  2OBT A;  3JRA A;  1LPQ A;  2QSG X;  2X0K A;  1W5T A;  4OOS A;  2DYS H;  2Y9Y A;  5JVT A;  3S17 J;  3DTK A;  2UV1 A;  1BC7 C;  2FBH A;  3GTQ J;  2DMU A;  3K0L A;  3SEZ A;  2M9H A;  3GW2 A;  4KIF A;  3LSK A;  3S1N J;  3QQA A;  3QOE A;  3M7G A;  3F72 A;  3EQL F;  4LFU A;  1X2N A;  3FXL A;  1TC3 C;  2CUE A;  3HUG A;  1RPW A;  3DBH B;  1HW2 A;  2HKO A;  1YX5 A;  3L7W A;  1LLW A;  1CLW A;  2L4A A;  1IAW A;  1S7E A;  4CDG A;  4C43 A;  2E34 A;  3B90 A;  2E36 A;  1EFC A;  3A35 A;  1UHW A;  1AU7 A;  3P9K A;  1W4M A;  5HOD A;  1QO0 D;  2AQF A;  4HEA 2;  1MNM C;  5AON A;  3X2Q H;  1P4W A;  9ANT A;  4TMZ A;  1DBG A;  1O8D A;  3ZPP A;  2X6Y A;  2COB A;  2I10 A;  1QQI A;  4YHB A;  2K40 A;  1KZL A;  3LQE A;  2QBY A;  1U78 A;  2R9V A;  3LJY A;  2BY2 A;  4XOT A;  3M1C A;  3VSL A;  1BJK A;  3ZMS A;  5FRN A;  5GV8 A;  1ONV A;  2JVH A;  2DK8 A;  5M5X J;  3GVJ A;  5EGO B;  1IJW C;  1R5B A;  3O2P E;  4AU7 A;  2P0W A;  4RD0 A;  2INU A;  3WTZ A;  1SAU A;  4PJL A;  3BC8 A;  2QYU A;  2GLO A;  3BPV A;  3NAW A;  4HLY A;  1PDN C;  4JYK A;  2XAF A;  3HGG A;  4BXF A;  3BG3 A;  3LQR A;  4YCQ A;  2E1N A;  1G3Y A;  3M8E A;  2D9R A;  3WU1 B;  3VPR A;  2VB6 A;  2DLL A;  4M6X A;  4XN3 A;  1X3Z B;  2E2J J;  3DDY A;  3ZBU A;  1V54 H;  3ZQI A;  2FNA A;  1XCB A;  5E18 F;  3IV5 A;  3QRF F;  3COA C;  2DCU A;  5CVR A;  2D45 A;  5J4Y A;  4OMZ A;  2BBY A;  2R7F A;  4GGG A;  1IXS B;  1LVA A;  4KA4 A;  4UZU A;  1O88 A;  3ABU A;  3G3Z A;  4L8J A;  1P4X A;  1R5I D;  2O6W A;  3FMR A;  2Q1Z B;  2W6J A;  1W0J A;  2DA2 A;  2FRH A;  1LB2 A;  4PC7 A;  1KC8 D;  5HNH A;  2O9L A;  1JHH A;  2OBS A;  1ZG3 A;  2HOE A;  5E20 A;  2XT4 A;  2VFN A;  3VOE A;  4TT3 A;  1O8I A;  1AIP A;  4O3M A;  4A3G J;  5CVJ A;  1Y1V J;  3CCJ I;  4X06 A;  2DT5 A;  3FXJ A;  3B02 A;  3W2V A;  4EV0 A;  1E1Q A;  1SKY B;  3K4J A;  2LP0 A;  4FTH A;  3PA1 A;  1F1Z A;  2HVS A;  5DSZ A;  1R6R A;  3GYH X;  2WB1 N;  4UNO A;  5H2F C;  5CYV A;  2KMU A;  2KPM A;  4IL6 C;  3ZUG A;  2ZIT A;  1G2H A;  1U9O A;  1ZTR A;  1JHF A;  3GZN B;  2STW A;  5C44 J;  1OYI A;  2CQQ A;  1XDU A;  3DPL C;  4N9I A;  1VQN B;  4Z1M A;  2GOM A;  2RGV A;  1D0Z A;  2PLY A;  3C2H A;  3OS1 A;  2ACJ A;  4I0A A;  4XQF A;  3H9J A;  3HBL A;  1JB9 A;  3PSZ A;  4KIC A;  2GA2 A;  1SFE A;  3L00 A;  1D8K A;  5KCM A;  1O3S A;  3H9N A;  4LLG F;  3MKW B;  3ZIA A;  2D2W A;  4XKC A;  3S8P A;  2NZM A;  3OWT A;  3ASQ A;  4NK8 A;  1GVD A;  1OKR A;  1ZN2 A;  2RDP A;  3FM5 A;  2CSO A;  4B1R A;  3ZMU A;  5DNS A;  3CLO A;  3LNQ A;  3FM3 A;  2XAH A;  3CCR I;  3OSG A;  2YR2 A;  4CCO A;  3BZC A;  1KA8 A;  1X1A A;  4D9J A;  1Q86 D;  1XG2 A;  3FXM A;  1D5V A;  2A6H F;  1N8R D;  4ZZD A;  2KQR A;  4BQO A;  3CMM A;  4G7H F;  3A3G A;  1NHA A;  4YII A;  3OP1 A;  2YWF A;  3ERE D;  1XMA A;  3C7J A;  2FE3 A;  1DP7 P;  2JMW A;  1D3Y A;  4LMY A;  3ZQL A;  1EH8 A;  5HOO A;  1NB9 A;  5KK1 A;  2ADU A;  3JTH A;  1UD6 A;  1R58 A;  5J1R A;  3AG4 H;  1YIT I;  2EFO A;  2DY1 A;  4ZYA A;  3OMY A;  2QF7 A;  4B4C A;  2L7F P;  3K4C A;  5FKM A;  1Y0N A;  2L01 A;  1IHM A;  2PJP A;  4UZF A;  1KQ5 A;  4E7H A;  2R7Z J;  2PEX A;  3NWT A;  2KIQ A;  2ZXJ A;  1HKT A;  1K8F A;  1QA3 A;  1Y1W J;  3Q39 A;  2DDB A;  2AXL A;  5H6Q A;  1U5T C;  5B3S H;  4E7Z A;  2H6C A;  4Z4R A;  1JTY A;  1R4M B;  2F1L A;  1D0Y A;  4RAY A;  4FT8 A;  2XZP A;  3OYK A;  5E3L A;  2H27 A;  1V0E A;  1MIJ A;  1WGX A;  5JHF A;  1BHE A;  2E19 A;  3JRD A;  4KT5 C;  1B6A A;  1HXD A;  2BEO A;  4B44 A;  1O8L A;  2QUF A;  2CQK A;  3H9G A;  3WTV C;  3OEE A;  1Q1H A;  1H8H A;  1WJD A;  1X3U A;  4XKV A;  3CCJ B;  3PUB A;  2XZL A;  3I5U A;  2RQQ A;  1ZEL A;  4WCG A;  2NNY A;  4YAF A;  1SD5 A;  2BOL A;  3A02 A;  3F8N A;  3ZQF A;  1E1R A;  1WJA A;  2ZTN A;  4X6A J;  4CYC B;  3E20 A;  4ZYE A;  1S6L A;  3JAM Z;  1ETV A;  2UWM A;  2W6I A;  3C2G A;  1HF0 A;  2KZG A;  2XNJ A;  1BW6 A;  4CCM A;  4IRI A;  4EEF G;  3KEQ A;  2J8I A;  5IK2 A;  1MND A;  4UV9 A;  2IBD A;  1RIO H;  5KSW B;  2V9K A;  3AG3 H;  3IH4 A;  4EJU A;  4X7F A;  1AKH B;  1PJ6 A;  5CDF A;  4CCJ A;  1WWX A;  3LL7 A;  1H8E A;  1D8T A;  4JX5 A;  1I1G A;  4XKW A;  3LAP A;  1TW3 A;  3K4L A;  5LLQ A;  1PJR A;  2XND A;  4G6I A;  3E7L A;  3IL2 A;  4LBY A;  4DNT B;  2KP6 A;  2X6O A;  1FRN A;  4PJM A;  3ASO H;  1MBK A;  1W5S A;  1EP2 B;  1BN8 A;  2A61 A;  3CCV I;  4IHW A;  3WGH A;  3BC9 A;  1QVG B;  1AWC A;  2R7Q A;  3IHU A;  1RUO A;  2X3U A;  2V26 A;  3FIW A;  4AC9 A;  5IY5 H;  4X7C A;  2INV A;  2IS6 A;  1JKR C;  2HVR A;  3OSF A;  2JJ1 A;  3CCR B;  4XRS G;  3OOP A;  4ZDL A;  3OYM A;  3TW7 A;  1GVJ A;  1MMS A;  4Z4Z A;  2YPR A;  5CQE A;  3B6C A;  1AIR A;  3UW0 A;  3KEW A;  1LEA A;  1EV7 A;  1STZ A;  1YLO A;  4GFB A;  2DOE A;  3OS2 A;  3OYN A;  4HPQ A;  1KD1 D;  3BCA A;  2NTB A;  3LAJ A;  2LY9 A;  2ZXW H;  2JT1 A;  4E4H A;  4LBV A;  2X1C A;  3PNV A;  1H89 C;  3F9K A;  1X2M A;  4C3J J;  1QNT A;  5M5W J;  1JGG A;  1YIT B;  3GWZ A;  5IPA A;  3HAG A;  2E1M C;  3GF2 A;  4C3H J;  3TOB A;  4PUS A;  1ELO A;  3WNC A;  3QSY A;  2XB5 A;  4BJ5 C;  3C1D A;  4LIT A;  2OTJ I;  2DFE A;  4ZCL A;  2EK5 A;  2Y2Z A;  2Q6K A;  1MBH A;  2I8D A;  2IS4 A;  1VQK I;  1TBX A;  5C4X J;  4J0Q A;  4YAL A;  4B48 A;  4X7E A;  3MKL A;  5TIS C;  1H85 A;  3CCY A;  3DF8 A;  4RLQ A;  2MFZ A;  2PJR B;  2DEU A;  3KZY A;  3ZQ7 A;  1H8A C;  1QJV A;  2KL4 A;  3BG9 A;  1ZKG A;  3GUD A;  3AGP A;  4CQJ A;  1KK2 A;  1TVC A;  4RDU A;  4OMY A;  3AAF A;  2F3L A;  3PO3 J;  2EIK H;  3FXR A;  4UV8 A;  2DI3 A;  3WHB A;  3F22 A;  1FYK A;  3HGY A;  4RB2 C;  2KDZ A;  1HBX G;  1XMK A;  1FIP A;  2MYS A;  1JRG A;  1NG6 A;  2X4H A;  4U0Y A;  3JAM K;  1O8M A;  1RES A;  3QPH A;  1Q81 D;  5HLI A;  2EA2 A;  1G7S A;  2ZJR F;  4EM1 A;  3SJM A;  3WTT C;  2E5Z A;  1QA6 A;  5DD8 A;  2Y0S A;  3AST A;  4G1B A;  4ZTJ A;  4B3F X;  2PX9 A;  3BJO A;  1FSH A;  2LK2 A;  4Z4U A;  1J75 A;  4Y7N J;  2QKM B;  2QCO A;  4U49 A;  1JTA A;  1OLT A;  5JHU A;  4YIF A;  4BPR A;  2YWG A;  2IGM A;  3I4N J;  3ECO A;  1KON A;  1BI3 A;  1UEL B;  1Z7U A;  3G2B A;  3FXO A;  3I59 B;  5FFX A;  4QVJ A;  3CF2 A;  2A5Y B;  1WJC A;  2OQG A;  1R1T A;  1JT0 A;  3MZ8 A;  1QVT A;  1QHG A;  3SJP A;  2L5Q A;  3FF5 A;  4R79 A;  3IAM 2;  3P9I A;  3DEU A;  3A1Y A;  1K4S A;  1G7C A;  4D0P A;  3IC7 A;  1XS9 A;  3DBR B;  4HRI A;  1R23 A;  4WZK A;  1WJF A;  2OZ6 A;  5GV7 A;  2BSP A;  2FBI A;  3BQJ A;  2CYY A;  2IS1 A;  2XC1 A;  4LK0 F;  5BS6 A;  2QQ8 A;  3GIR A;  4LG0 B;  3O8H A;  1BBY A;  1FBQ A;  2E5N A;  2K9L A;  3JQR A;  3BH7 B;  2A3S A;  4PFP A;  5GAH J;  1W1W E;  1TLH B;  2OUM A;  4HV6 A;  1AKH A;  4G1V A;  4Z05 A;  3AGQ A;  4BHB A;  4RM2 A;  1S9H A;  5DCF A;  2KRF A;  1FX0 A;  1SAN A;  4PGG A;  3FIS A;  2LKP A;  1KTV A;  4X07 A;  5FL7 A;  4TKO B;  2DFI A;  3ZBT A;  5F64 A;  1ZK8 A;  2M7A A;  2J7K A;  2HFH A;  5K7Z A;  4MFE A;  2VE9 A;  2VUM J;  1TYU A;  2L9N A;  1OIS A;  1UHS A;  2OBP A;  3HHH A;  3MN2 A;  1EFR A;  4BXU A;  3BH4 A;  1BR4 A;  5EYR A;  5HXB A;  5IYR A;  3AG1 H;  5LEJ A;  1YJW I;  4YAO A;  6PAX A;  4EM0 B;  5HZA A;  1TWC J;  2DA6 A;  5F0C A;  5KHD A;  2HCJ B;  1BN5 A;  3E5X A;  3AVU A;  2NST A;  4FE7 A;  4BE0 A;  5HKK A;  4X7D A;  2OCC H;  3A03 A;  5FKL A;  2K4B A;  4I0B A;  1VQK B;  1RMG A;  3LVB A;  1YTY A;  5D8K B;  4XL9 A;  1USS A;  4DBR A;  3ROU A;  1JNY A;  3A8J A;  2B7B A;  3QFR A;  4XD7 A;  4N4N B;  4I7H A;  4TMV A;  1MRZ A;  4UVA A;  3GXO A;  1CGP A;  4OM9 A;  3RJP A;  2ME0 A;  4IZZ A;  2NS0 A;  4DQK A;  4XR6 A;  3TQN A;  1NH3 A;  3I56 I;  2JWT A;  3JQP A;  2XTY A;  4CGZ A;  1EH6 A;  4RCZ A;  2B63 J;  4OP7 A;  1BOB A;  3TKY A;  4HAM A;  3C18 A;  1QFZ A;  3OYF A;  4P1V A;  2CMP A;  4IKF A;  1O3T A;  3ML3 A;  1OFM A;  3OR1 C;  2HPI A;  4GDF A;  3CCE I;  2EIM H;  2EQR A;  4NDL A;  1MBF A;  3S3N A;  1FRQ A;  4JBA A;  1I1S A;  5K7H A;  2E60 A;  1ETY A;  2R93 J;  2L7Z A;  4D5F A;  4XLE A;  2V7W A;  2ZZG A;  4ZH4 F;  5FO0 A;  3A0B C;  3Q6R A;  4ZGN B;  4KYW A;  4BE2 A;  4OPO A;  1Z91 A;  4V02 C;  1IRZ A;  4RPD A;  2XSJ C;  4HX7 A;  1DU0 A;  2CW0 F;  2BGC A;  3VO1 A;  2EFN A;  2XPV A;  3SFI A;  2J8K A;  4L9N A;  5TGT A;  5J47 A;  3TDU C;  3C3W A;  2X1D A;  5LGN A;  3J7Z I;  4PDK A;  1QZE A;  5CJ9 A;  2YS9 A;  5GTH C;  3OIP A;  2V7V A;  3Q6Q A;  1VQP B;  2KIF A;  2W24 A;  1T33 A;  2W82 A;  4A3I J;  3R60 A;  3M3Y J;  1HST A;  4YIR X;  1RR8 C;  2JA6 J;  2YWE A;  3T9G A;  3CJR B;  2VOO A;  4QWQ A;  3OZU A;  2XPW A;  3T5X A;  1JE8 A;  2ZBU A;  1L0O C;  3ZZ0 A;  2GXG A;  2VJ5 A;  4BEH B;  5HDN A;  3ZPL A;  4AYB N;  3ASS A;  2XRO A;  2DJI A;  1XX5 A;  1FJL A;  3JU4 A;  2NAZ A;  2HU9 A;  1D5Y A;  1HW5 A;  1W5C C;  3LMM A;  1IDJ A;  1XG1 A;  3QFT A;  2KLO A;  1KQ9 A;  2EZL A;  1JUS A;  4MO7 A;  3WWG A;  1E17 A;  1P9Q C;  3BJ6 A;  3I59 A;  4ESJ A;  1P7I A;  1QGA A;  2KKO A;  5CKT A;  3DWL E;  4WWC A;  2LF7 A;  2PMZ N;  2VON A;  1QFJ A;  3VYT B;  4XNF A;  3HJE A;  2YX4 A;  3DFG A;  1TQM A;  2DOA A;  4B8X A;  1RKW A;  4PSW A;  4RGR A;  1J9Z A;  2GZW A;  1ZGA A;  2GQQ A;  3HRT A;  1OOC A;  1YJW B;  2JSC A;  1OCR H;  4OOV A;  1MBE A;  1R36 A;  1H88 C;  3AVY A;  3ZQG A;  3H3Z A;  1TP4 A;  3PNT A;  3VMF A;  1VQ4 B;  5LBQ A;  4G5G A;  2O0V A;  4GRI A;  5HLT A;  1W36 C;  4X8I A;  3W2G A;  1AMO A;  4MTD A;  4NQW B;  2VBU A;  4XKB A;  4A5N A;  1W36 D;  2NTQ A;  3EUH A;  2OU2 A;  3ABM H;  1RWR A;  1NBM A;  2VKV A;  2MC4 A;  5F1R A;  1K5C A;  4BAC A;  4XSX F;  2Z8G A;  1MSF C;  3OPO A;  3I56 B;  1ODD A;  2DER A;  1OPC A;  1K6O A;  3B78 A;  3LO8 A;  1ZLJ A;  2R7T A;  1N0V C;  5J8F A;  3GQ7 A;  2QSF X;  3P27 A;  4L5J A;  2FU4 A;  5JR3 A;  2BXY A;  2VFM A;  2V9P A;  1FY7 A;  3CCE B;  3HRU A;  4G7Z F;  1CF7 A;  4KFC A;  4UHT A;  1MBJ A;  2HQR A;  3PSI A;  4D7N A;  3NE5 B;  2DJN A;  3JRB A;  1IXC A;  4FXU A;  2OA4 A;  5J8C A;  3E6C C;  1ACI A;  4KIB A;  3GTO J;  1N08 A;  2ZNY A;  3VB2 A;  4Z06 A;  1OFD A;  2IA1 A;  1BR2 A;  2X6W A;  4M74 A;  2M30 A;  5LD2 C;  1WPC A;  2BPO A;  5J1Y A;  4UUS A;  2P3M A;  2VOP A;  3RPU A;  3J80 Z;  1E2X A;  5H6R A;  4ETS A;  4ASN A;  2KDO A;  2UZK A;  2F1M A;  3CC2 I;  3H0D A;  3HRS A;  2ID6 A;  2F48 A;  3CJT B;  1BOA A;  5TR9 A;  3GQ9 A;  3W2H A;  2XAS A;  1IB4 A;  2XRL A;  4U87 A;  3N4M A;  2CW8 A;  1XD7 A;  3P5J A;  3OE7 A;  2F5E A;  5FO1 A;  1O8K A;  1WXR A;  4TMW A;  1Z7L A;  2O04 A;  4M72 A;  2EFP A;  3LSI A;  3LMW A;  2JJ2 A;  4B47 A;  2HZD A;  2UXX A;  5IP9 J;  1S29 A;  4CCK A;  1O8G A;  2BW3 A;  5EZH A;  2AO9 A;  3N90 A;  3BG6 A;  1T0F A;  1W35 A;  4G7X A;  1S4M A;  3QYF A;  2XTW A;  1IN7 A;  4P26 A;  4ITV A;  1T6Y A;  2VFP A;  1SAX A;  4U0V A;  3OYJ A;  1GVH A;  4Y9R A;  4G94 A;  2H1K A;  1IUY A;  1OCZ H;  1B23 P;  5KAF C;  4Y15 A;  2W7N A;  4BJ6 C;  2TRT A;  5FKN A;  3CJQ B;  4G6T B;  3G4S I;  1TNS A;  4YFK F;  1TWH J;  1QRC A;  2ZME C;  3OV8 A;  2FJ1 A;  4BAY A;  3S93 A;  3L2Q A;  3GTG J;  3U9G A;  1JJ8 C;  4HE6 A;  4XIC A;  4LGW A;  5ILS A;  1JA0 A;  4G6D A;  3M4O J;  3L2W A;  4FCY A;  4FIS A;  3JTG A;  4AD9 A;  3HOV J;  2GJP A;  1Y39 A;  4ZV4 A;  2MH2 A;  2CUZ A;  1W2B B;  5AMV A;  2E2H J;  3GBG A;  1PE9 A;  2W48 A;  4RS8 A;  2VIX A;  1G4D A;  2EWE A;  4EQQ A;  4P3I A;  4IW3 B;  1Z6R A;  2WYR A;  5ED4 A;  2D3L A;  3T0Y A;  2JPC A;  4BQQ A;  2HDN B;  4UVB A;  2XGX A;  1WI3 A;  4BGD A;  4Q4Z F;  4XID A;  3LSM A;  4A0Z A;  1HLV A;  1JTX A;  1VQ5 I;  3R61 A;  1V4R A;  4Z4T A;  3WTW C;  2OPT A;  3PIO F;  4FX0 A;  4P12 A;  1BC8 C;  1CNE A;  1K6Y A;  3ONQ A;  4XOR A;  2O8K A;  1E79 A;  4LBZ A;  2HOS A;  5CLS A;  5J4V A;  4XSZ F;  3CW2 A;  3JRF A;  1WZ2 A;  3TP0 A;  1ZLK A;  2R5Z A;  4URR A;  4AM3 A;  3SEQ A;  2DMQ A;  2R7U A;  2PYH A;  3A4C A;  3V8L A;  3CXC B;  4RBO A;  3CD6 I;  2F2E A;  1YJ9 I;  3VFZ A;  1P6R A;  1QVF B;  1X3W B;  1IDK A;  3HTU A;  2KIU A;  1CQT A;  2FML A;  4QVA A;  1XTA A;  3PUN A;  1BR1 A;  4MEY F;  4WQM A;  4A3K J;  3MZH A;  4QHY A;  2IAI A;  1VHO A;  4OIQ F;  4KN4 X;  1XGS A;  2FXA A;  1ETX A;  1V5V A;  2DK5 A;  3A8I A;  4N3G A;  1Y0Y A;  2DIE A;  1TLL A;  3ZC3 A;  3CC2 B;  1PP7 U;  3OFN A;  4GQN A;  1P7J A;  1FBU A;  2PG4 A;  4CUG A;  3MKY B;  1EJ9 A;  4D5C A;  1FYL A;  2RNJ A;  2WV0 A;  4EJO A;  2PMD A;  5EEH A;  4YZQ A;  2HYJ A;  3D5S C;  1E3O C;  1EXM A;  4YFO A;  3CMY A;  3REO A;  4HIZ A;  3ZMZ A;  2LKS A;  1I3A A;  3ZN1 A;  4DYQ A;  3T53 B;  3VR6 A;  5IYW A;  2XT2 A;  3VNU A;  3SXY A;  2VC0 A;  2L54 A;  1HKQ A;  2NOG A;  2BHZ A;  4MR0 A;  3D5L A;  1GUU A;  1Y6I A;  3PUM A;  4EW9 A;  1R5G A;  3QFC A;  3TO6 A;  3E1S A;  1IJE A;  4NC7 A;  4D1Q A;  4NNJ A;  2BMW A;  1VQ7 I;  1Y0U A;  2QM3 A;  2QQA A;  5L3G A;  2FQ4 A;  5IT9 Z;  3WY9 A;  3CZ6 A;  1V5G A;  4J00 A;  1OR7 A;  2OF7 A;  2ISZ A;  1S7O A;  3L09 A;  3OL3 A;  4P6V F;  4TMX A;  1SMY F;  3L9F A;  4H0E A;  2H09 A;  3OKX A;  2MGQ A;  1J09 A;  2VT3 A;  5IT3 A;  4E7J A;  4MEX F;  4A0X A;  2FOK A;  3QP6 A;  3OYG A;  4V2G A;  2HDC A;  3ZZU A;  1T08 B;  2M8G X;  3WGI A;  1F4K A;  2DA3 A;  2ELH A;  2LYC A;  3FK6 A;  4GO1 A;  2DA1 A;  1I39 A;  4DZJ A;  4UUT A;  4E6K G;  1W0K A;  2DET A;  3PET A;  2CQN A;  2GK6 A;  3ASN H;  1WFX A;  5D6F A;  4R71 A;  3SUC A;  4PZJ A;  2GWR A;  3AK5 A;  4LK1 F;  2X48 A;  1YJN I;  1F60 A;  2P4W A;  3BQZ A;  5D5U B;  3OIQ A;  1Q1V A;  1Q7Y D;  1K8A D;  4XLC A;  3CCQ I;  5LMZ A;  1VQ5 B;  1T98 A;  1WU8 A;  1K9M D;  2NOJ B;  3WOD F;  2M1B A;  1D1B A;  1IRG A;  2RKH A;  4N9H A;  2E7X A;  4S0H B;  3LWF A;  3SZG A;  1B1B A;  2IW5 A;  4BKX A;  1UD8 A;  2IRF G;  5LHH A;  1KK3 A;  1QBJ A;  2RNG A;  1LQ1 A;  3QPS A;  1OCP A;  1XGN A;  1IB0 A;  1VHE A;  4E7S A;  1FP2 A;  2L3D A;  4CZC A;  1YFH A;  1YIJ I;  3B8Y A;  3Q0U A;  5FA6 A;  3LYC A;  3DXJ F;  3HL2 A;  2P5K A;  2WAD A;  2HNH A;  5GAE J;  4MXN A;  3LA7 A;  5L3D A;  1W0U A;  3CD6 B;  4RB0 A;  2CUJ A;  1YJ9 B;  3K4N A;  4L5E A;  2HOT A;  3EUA A;  1SEU A;  4OJ6 A;  4HX4 A;  1IUF A;  1TT0 A;  2WAQ A;  2XGC A;  2IVM A;  2YUH A;  4L9T A;  1GV5 A;  3MKZ A;  1YW9 A;  2VKD A;  4HV5 A;  1AA7 A;  1ZRC A;  1FC3 A;  2QGU A;  4IQJ A;  2QGG A;  3GLX A;  3OYC A;  1TTY A;  2YSR A;  2P7V B;  3GCM A;  3HOY J;  4NUB A;  1G3S A;  3L2V A;  2FVG A;  4G9Y A;  3K9T A;  5B5E C;  2A05 A;  3KIO A;  2K3F A;  4RGS A;  3OOC A;  4UZE A;  3CPW B;  4XN0 A;  3KP2 A;  3CCU B;  1RZ4 A;  1ZM4 A;  4HNV A;  1XB2 A;  1EZG A;  3HKZ N;  5BQT A;  3ZQC A;  4CA0 A;  3SLN A;  3FBN B;  1VLO A;  2JZY A;  4DK0 A;  3MMP A;  3RIQ A;  3OW2 B;  3WQZ A;  3VMW A;  2P6T A;  3WE2 A;  2IOU G;  4IOA F;  2LSO A;  1UFM A;  2XC7 A;  3S2W A;  1R49 A;  1WI9 A;  2BM1 A;  4YAU A;  1WH7 A;  1RR7 A;  1UST A;  2IXS A;  3JCU C;  1VQ7 B;  3AVT A;  5IT9 K;  4WXH A;  3BCB A;  3GZ6 A;  3HHG A;  4M1K A;  1TWA J;  2M8E A;  3CMA I;  4U4B A;  2DQL A;  2OZU A;  3QOP A;  1UD3 A;  2VC1 A;  3CP8 A;  4G6Q A;  3G6E I;  5TRD A;  5EEG A;  2Q6L A;  3MCA A;  4M0L A;  4LLN A;  3RCO A;  3GEZ A;  4M3B A;  4ACA A;  1FPQ A;  1TQP A;  1TL8 A;  2CW7 A;  1A8P A;  2EZH A;  2PE3 A;  2PLF A;  3P7N A;  1T39 A;  5K5O A;  5HLG A;  3DBL B;  4IVN A;  2CWE A;  4BQN A;  4ESF A;  1I6H J;  4YZX A;  3EET A;  1WCM J;  5IYC J;  3ISX A;  3E6B A;  1PJ7 A;  3N6Z A;  2DYI A;  2E2I J;  2ZC2 A;  3TMO A;  5DDG A;  4LOC A;  2V7X A;  1OHH A;  3CPX A;  3FWE A;  1VBL A;  4ZDO A;  3AG2 H;  3J7Y J;  2AS5 F;  2LY2 A;  2Z2S B;  2ZNZ A;  3OOU A;  1D2E A;  5JI6 A;  3SFZ A;  3GTK J;  3FPP A;  2AXT C;  4M3G A;  4DYR A;  5K5R A;  2VLA A;  5LRR A;  2QLZ A;  3KEY A;  1BLI A;  3ZPN A;  2PEC A;  1XN7 A;  5H20 A;  4BL0 B;  2WTE A;  3NEU A;  5BPD A;  2Y0S N;  1WHU A;  1FWZ A;  2ZO4 A;  3OYA A;  4DOZ A;  2VQC A;  5DV5 A;  4LC0 A;  2Z5U A;  3TOA A;  1YIJ B;  1IN8 A;  2FEZ A;  4WK8 F;  3H94 A;  2O5R A;  2RC5 A;  3HRM A;  4I01 A;  2E1B A;  5IOY A;  1X4P A;  4MYU A;  4JP0 A;  5J3O A;  2B7E A;  1EE6 A;  2M0C A;  3K1M A;  2RVC A;  5F6F A;  2J5O A;  3SDG A;  3S1Q J;  2BSA A;  2BX6 A;  2ZSH B;  4P1W A;  4Z6Y A;  4MYT A;  1QZZ A;  1Z0X A;  3U6B A;  4PSX A;  1FTZ A;  3QWL A;  3RKW A;  3JR9 A;  4DW6 A;  1ZR2 A;  3KP6 A;  2WPD A;  2VI6 A;  2X3H A;  3S1R J;  2RN7 A;  2KIS A;  4RAZ A;  5FLM J;  4MHG A;  4BY1 J;  2EFG A;  4E0F A;  2OCE A;  2OK8 A;  5EEA A;  4XRM A;  3H36 A;  3OYE A;  3F23 A;  1WSV A;  3EQN A;  5C1E A;  1HVX A;  1Q9S A;  4L0Z B;  1HDP A;  1FTT A;  1E43 A;  3MAJ A;  4CO8 A;  2HPM A;  1OB5 A;  2CRG A;  4DZP A;  3BG7 A;  3L2C A;  3K6G A;  3ES9 A;  2VKH A;  4B3G A;  1IN6 A;  2EIL H;  1W9X A;  3G1O A;  1TTT A;  5HNF A;  2XGE A;  3MVP A;  1R71 A;  4RDL A;  3WU0 A;  1T6X A;  2VBS A;  4KN7 X;  5F0F A;  2H8W A;  3P4G A;  1OYY A;  2MW8 A;  1IW7 F;  3E97 A;  3ABL H;  1X1D A;  3WG9 A;  2F4O B;  2O03 A;  4KT6 A;  1N0U A;  5JMC B;  5CVI A;  4DIQ A;  2BF4 A;  3BJA A;  1GJR A;  4M53 A;  2L7K A;  3FXK A;  3OIO A;  2OD5 A;  5JLX A;  3ZGK A;  1VFC A;  1SMT A;  4ROX A;  5H59 A;  2K9N A;  1N05 A;  2EV6 A;  5CVU A;  4AC0 A;  3ULQ B;  3I4P A;  3KET A;  4DGW B;  1HC8 A;  3E1Y E;  1KQS B;  3HC7 A;  4E7I A;  4AF6 A;  3CQZ J;  3K4K A;  2NVX J;  2IS2 A;  1ZM9 A;  1U8B A;  1PYV A;  4Y33 A;  5K5Q A;  1GXP A;  2PMU A;  2LNB A;  2XVC A;  3EYY A;  2QTZ A;  5IYN A;  4F3Q A;  2VE8 A;  4HBL A;  3MFK A;  3QPL A;  4I6Z A;  1BX1 A;  2FA5 A;  2FMY A;  4DQL A;  2ZFU A;  3JX8 A;  3S16 J;  2Y30 A;  4CCL A;  4C2U A;  4W97 A;  3S1M J;  2BM7 A;  3CO6 C;  4Z4W A;  2F4M B;  4NC6 A;  3GFL A;  4CSW A;  2DMN A;  3KPH A;  4LIU A;  1QQ1 A;  3U2R A;  2X53 S;  3LST A;  1ZRD A;  1XMX A;  3HXL A;  1WJE A;  3OYB A;  3WND A;  5L3F A;  3FY3 A;  3V76 A;  2M5W A;  1U0J A;  2HTS A;  3UKG A;  3PQK A;  4IJA A;  5E3O A;  4RD6 A;  3DLA A;  4FX4 A;  1G7R A;  2QMU A;  3OEH A;  3ISP A;  4M4S A;  1O3Q A;  2PMH A;  2DA7 A;  2GM4 A;  5FKK A;  2UUZ A;  3HSF A;  5LHG A;  2D3N A;  3Q0W A;  1YE9 A;  1ULY A;  4HDU A;  3IRQ A;  3U1D A;  3HDD A;  2DO7 A;  1V5E A;  2X8K A;  2JA7 J;  4Y3O A;  3S2D J;  4HNU A;  2V7U A;  3ZMD A;  1G8X A;  2OV7 A;  5FKO A;  4S05 A;  2WAE A;  3F3X A;  3ZP5 A;  4ENN A;  1K83 J;  3OZW A;  3W2F A;  3EUK L;  3KYD B;  2BZT A;  5FD6 A;  2X85 A;  2WB1 A;  2VBY A;  3WU2 C;  5JFR A;  3D5R C;  2IGN A;  2B5O A;  1JUP A;  2HXI A;  1TSP A;  1YI2 I;  4YZ0 A;  3V7C A;  1ZG5 A;  5LHI A;  4BH9 A;  2Z33 A;  1SM4 A;  1X19 A;  4FHT A;  1I3Q J;  2XAU A;  1TZL A;  3P9C A;  3OAA A;  5DTD A;  4G7W A;  1R9T J;  2PIA A;  3HOS A;  5JBQ A;  3CDL A;  1G3W A;  2EA4 A;  2BV6 A;  1ZHF A;  3SQV A;  1QPM A;  4Y4R A;  3DKY A;  3VYU B;  3HOX J;  2R5Y B;  5JVG F;  2R7V A;  2V7Q A;  5HDG A;  1RRJ A;  1FIA A;  3MHP A;  5DCM B;  2EFW A;  5EZG A;  1IV8 A;  2EZK A;  2MC3 A;  3QPT A;  4PK4 A;  2NS8 A;  1U9N A;  1IDZ A;  2WJV A;  3M8F A;  4ENK A;  3OYL A;  3OJW A;  2V7T A;  4TV7 A;  4A3J J;  1GXQ A;  3H3V K;  2TDX A;  1OCO H;  3HSE A;  3QAH A;  3D26 A;  5C3E J;  1SC7 A;  1EP3 B;  5GAD J;  1XQB A;  2CO5 A;  5FRO A;  3KYL A;  1IV6 A;  1MH3 A;  2LRE A;  3IUO A;  5KNL A;  2NV4 A;  3WYA A;  5CQG A;  2CGP A;  1FNB A;  1O7F A;  1U6G A;  1UAA A;  1XSX A;  4Z4Y A;  1PLU A;  1XB4 A;  5DS0 A;  2ZKZ A;  2HXO A;  2R7O A;  1NRK A;  3CCV B;  5BMZ A;  4M2L A;  4BBS J;  1E62 A;  4OJL A;  2ZZQ A;  4EGZ A;  1O4X A;  2P81 A;  4A3D J;  1FNC A;  2NNN A;  3J81 K;  3DP7 A;  2VXZ A;  1VQO I;  1LJ9 A;  3I64 A;  3T51 B;  4KKS A;  1I8D A;  1Z1D A;  3QYB A;  3SZE A;  2LD5 A;  3M9A A;  4OIR F;  3PSF A;  4ABZ A;  1WOO A;  1IC8 A;  2OTL I;  4JX4 A;  3WBJ A;  4RD2 A;  5EF6 A;  3I3L A;  1SVL A;  5TY0 A;  3BR3 A;  2VKE A;  2XZO A;  1K78 B;  1FDR A;  2MD0 A;  4RDK A;  1VQM I;  1BI0 A;  3SZP A;  3WG7 H;  2GRE A;  3M07 A;  1X0C A;  1NJI D;  3CP2 A;  1E3P A;  1VQL I;  4K1X A;  2K9S A;  4HF2 A;  2JTV A;  4F7Z A;  5TV2 A;  4P22 A;  3QU3 A;  3LSJ A;  4YFX F;  3HYI A;  2L4M A;  2W84 A;  4L9J A;  3OYH A;  5J40 A;  1K4T A;  1ETW A;  1ZG1 A;  3KP7 A;  5C4J J;  1CF7 B;  2OTJ B;  2HOA A;  3K4B A;  1JUM A;  2XHK A;  2GAU A;  1A6Q A;  3ZCO A;  4FWT A;  3TO7 A;  2RAE A;  4RMN A;  3Q0V A;  4NCN A;  1UD4 A;  2NRA C;  4I02 A;  1O8H A;  1B72 B;  4RAG A;  1R4N B;  5J6X A;  3BH6 B;  1H42 A;  3A3B A;  4XLN F;  2VNK A;  1YI2 B;  4WXC A;  3PJR A;  2RQP A;  1SD7 A;  3VYS B;  1DPU A;  4X0G A;  3GVL A;  4UUS B;  4LB6 B;  3UR3 C;  3CF5 F;  1PKV A;  4DQ2 A;  1KU9 A;  1ZYR F;  3GTM J;  5A8A A;  2PBI A;  2H6B A;  4FE4 A;  2P5V A;  3S15 J;  1UHM A;  3H5A A;  3LNN A;  1O8E A;  1QHH D;  1QPI A;  5FJ8 J;  2IT0 A;  4HG2 A;  1TT5 B;  4U7B A;  4G7O F;  3A01 B;  4RGU A;  1UD2 A;  2FSW A;  2VL8 A;  1OCT C;  5TJJ A;  2BM0 A;  4BHC A;  1R00 A;  3BZ6 A;  3LQ6 A;  3WXM A;  5M5Y J;  2B9S A;  3VEP A;  1KYZ A;  2FBK A;  1E63 A;  2NT6 A;  3G05 A;  1V55 H;  2BW3 B;  2V6C A;  1OB2 A;  1F36 A;  2EH3 A;  4QTR A;  1XSD A;  2L2O A;  4F93 B;  2R5Y A;  2PN6 A;  2E7W A;  4CYD A;  5HDK A;  4XMY A;  1J9I A;  2CRV A;  3TED A;  1Y56 A;  3EDP A;  2R0Q C;  4A6D A;  2KRC A;  2IQ7 A;  2BE5 F;  4HYE A;  3U6K A;  1OYW A;  5DCM A;  1A6I A;  1HDD C;  1OJL A;  1IGN A;  4WZT A;  1FOY A;  4Q7J B;  1RKT A;  2HQ5 A;  2E1C A;  4Z4V A;  2ECB A;  3ZMT A;  2A69 F;  3VMV A;  4C2M J;  1VQO B;  3VNV A;  1VZ0 A;  1CNF A;  2K7L A;  2Z6B D;  2BM6 A;  5J3L A;  2A07 F;  3SYJ A;  2M34 A;  3BDD A;  1A5J A;  1OCC H;  4HZF A;  2OTL B;  4U9U A;  2Q6O A;  2DTR A;  3TGN A;  2JRT A;  2MH9 A;  3CB4 A;  4UUV A;  2AHQ A;  4I2O A;  2V4J C;  1TNT A;  4ON0 A;  1VQM B;  4ZC3 A;  1D0X A;  2M4G A;  2OQR A;  3PM1 A;  4I98 B;  3RSN A;  2CFX A;  4DNC A;  3H0G J;  1S5L C;  1ZUN B;  2C4T A;  1HF2 A;  4DK1 A;  2K9Q A;  3GTJ J;  3OJX A;  1VQL B;  4HE5 A;  2V79 A;  5KAI C;  2XF5 A;  1QGP A;  1E64 A;  5THX A;  1OMI A;  2DU9 A;  2Q2E A;  2LBF A;  3FXQ A;  5M3M J;  3CTA A;  2ZJP F;  2BVN A;  1TYW A;  2ICW G;  4HF0 A;  4YEI A;  2R5Z B;  3OL4 A;  1W7P B;  5ICF A;  1YLF A;  3ZQH A;  5D5V B;  1MJA A;  1Z3Y A;  3MEX A;  2IA0 A;  1UB9 A;  1K78 A;  2GJK A;  3R6S A;  1LVK A;  1YHQ I;  1FOK A;  4RA2 A;  3EPZ A;  4OPV A;  1GT0 C;  3IAS 2;  4JX6 A;  3RQ4 A;  2F5V A;  2G7H A;  3BR0 A;  2NVQ J;  1QG0 A;  2ODL A;  1MDM A;  2HI3 A;  1LE8 A;  4HWV A;  4FK8 A;  1ETO A;  2BN4 A;  4RM0 A;  2C5B A;  1YW7 A;  1YIO A;  2R3S A;  1LUJ B;  4PJ0 C;  4W8T A;  1ORK A;  5FLX K;  3A1P A;  4WZE A;  3PEN A;  1WH5 A;  5A89 A;  3TL4 X;  3VSK A;  2D74 A;  4M9X A;  3QOD A;  3T56 B;  1I18 A;  1B72 A;  1COW A;  4J01 A;  1ERD A;  2LRD A; 
#chains in the Genus database with same CATH homology
 3ZXS A;  1J09 A;  2FUG 2;  4E7J A;  3HG9 A;  4ZJZ A;  2KVO A;  3OYG A;  2W4S A;  1D0Y A;  2XZP A;  2K9M A;  3OYK A;  4BJT A;  1V0E A;  2VPL A;  2LYC A;  5JHF A;  1BHE A;  1DP3 A;  2VAS A;  3VDX A;  1V5F A;  2ZXI A;  4E6K G;  1LDK B;  3S3M A;  1W0K A;  4B44 A;  2GK6 A;  1O8L A;  1WFX A;  3H9G A;  1N77 A;  3OEE A;  2F4I A;  1H8H A;  1WJD A;  3SUC A;  4RM3 A;  4XKV A;  3PUB A;  2XZL A;  2KHM A;  2RQQ A;  1ZEL A;  3OIQ A;  2BOL A;  2MAB A;  3SDB A;  1E1R A;  2ZTN A;  1WJA A;  4XLC A;  2ZZF A;  2JSP A;  2NOJ B;  3UNG C;  3EUH C;  2UWM A;  1D1B A;  4OAZ A;  1MMG A;  4CCN A;  3C2G A;  2W6I A;  3SZG A;  4CCM A;  1UD8 A;  4E7K A;  4AVZ A;  5IK2 A;  4YZA A;  2RNG A;  1MND A;  3S32 A;  2R7W A;  1CZF A;  4E7S A;  2CV1 A;  4CZC A;  2V9K A;  1WMR A;  3B8Y A;  4W8Q A;  3HL2 A;  2WAD A;  4C9Y A;  2HQA A;  2HNH A;  4CCJ A;  5CDF A;  4MXN A;  3LL7 A;  2CUJ A;  1H8E A;  3PFY A;  3K4N A;  3BLY A;  4W8R A;  1EA3 A;  2XND A;  3EUA A;  4XKW A;  3K4L A;  4OJ6 A;  1PJR A;  4G6I A;  4B3X A;  1TT0 A;  2WAQ A;  2KP6 A;  2WJY A;  3GQB A;  2QKL B;  4PJM A;  4DNT B;  3DTI A;  2K5C A;  1BN8 A;  3MKZ A;  2VBK A;  2VKD A;  3BC9 A;  1AA7 A;  2R7Q A;  4IQJ A;  1E3X A;  3OYC A;  2INV A;  2V26 A;  2M5S A;  1SFK A;  1UG0 A;  2IS6 A;  2WSS A;  2HVR A;  2JJ1 A;  4NUB A;  3L2V A;  4QPQ A;  4ZDL A;  3OYM A;  3FKJ A;  1Z21 A;  5CQE A;  3OOC A;  4KJZ A;  4LIV A;  2W1O A;  4XN0 A;  3KEW A;  1AIR A;  2QX3 A;  3UW0 A;  3OW7 A;  3VWB A;  3OS2 A;  4CA0 A;  3OYN A;  4HPQ A;  3FBN B;  3BCA A;  4DK0 A;  2NTB A;  2R4G A;  2NT9 A;  3WQZ A;  3VMW A;  2XF6 A;  4E4H A;  2JIZ A;  2X1C A;  3PNV A;  2PJR A;  3AL0 B;  2XC7 A;  2Z1D A;  3F9K A;  1G59 A;  2BVL A;  1N78 A;  3HAG A;  1LFP A;  2E1M C;  2IXS A;  2DT7 B;  4PUS A;  3BCB A;  3OYD A;  4XLH A;  1QU3 A;  1O8J A;  2NSP A;  1OGO X;  4BJ5 C;  4LIT A;  4U4B A;  2L9S A;  5C1C A;  1UD3 A;  2OC6 A;  3CP8 A;  2I8D A;  4RLF A;  1D1C A;  2IS4 A;  2XF7 A;  1T0F C;  4BUP A;  3GVK A;  4AYB A;  1T5E A;  4Z03 A;  3RCO A;  4B48 A;  4JMQ A;  3DQV C;  1MMA A;  4F52 A;  4RLQ A;  2CW7 A;  2MFZ A;  3OYI A;  2PJR B;  1H80 A;  1QJV A;  2KL4 A;  2R7S A;  2WY8 Q;  3K4M A;  1YX3 A;  4XLF A;  4BQN A;  1JI8 A;  2ZZE A;  4YZX A;  4IQ4 A;  3DKX A;  2LG4 A;  1WP6 A;  4DBQ A;  4KIT B;  3L2U A;  3TMO A;  4BDY A;  2PMZ A;  2VJI A;  3KRG A;  2MYS A;  2X1E A;  2R7X A;  1JRG A;  1NG6 A;  1OHH A;  1VBL A;  1O8M A;  4ZDO A;  2LY2 A;  2Z2S B;  3M8J A;  3OOU A;  3OR2 C;  3FPP A;  3GQ8 A;  2E5Z A;  2Y0S A;  4PJJ A;  2VLA A;  3A2K A;  4ZTJ A;  1BLI A;  4B3F X;  3KEY A;  3ZPN A;  2PEC A;  3HPG A;  2BVM A;  2A6T A;  4BL0 B;  2DT6 A;  2AQE A;  3OYA A;  2V4D A;  3VSU A;  2QKM B;  2VQC A;  4XON A;  3LSH A;  4DOZ A;  3S3O A;  4DJA A;  1OLT A;  1JTA A;  4U49 A;  2GK7 A;  3H94 A;  4JQF A;  1MMN A;  2O5R A;  2IGM A;  2GOX B;  1X4P A;  2E1B A;  1KON A;  1UEL B;  3G2B A;  4KIS A;  1E3Z A;  1NG7 A;  1EE6 A;  3CF2 A;  2IGO A;  1WJC A;  4OWR B;  4QPO A;  2ZSH B;  2X6X A;  1D1A A;  2CH0 A;  3QYE A;  4P1W A;  3E0J B;  4PSX A;  4C30 A;  1QHG A;  3I9V 2;  2CK3 A;  2L5Q A;  4E7Z A;  4R79 A;  1OFL A;  3IAM 2;  1BPL A;  4PJN A;  3A1Y A;  4BU2 A;  2WPD A;  1FMV A;  2X3H A;  3W3C A;  4HRI A;  2QY1 A;  3DTE A;  1WJF A;  2CS3 A;  2QE7 A;  3KX2 A;  2M4K A;  1KTW A;  2BSP A;  2QXZ A;  4E0F A;  2IS1 A;  1HZE A;  2E5N A;  2K9L A;  3OYE A;  1VJS A;  4PFP A;  1VF7 A;  3EQN A;  2OUM A;  1HVX A;  1MNE A;  3W2A A;  1IRX A;  4Z05 A;  5C1E A;  1E43 A;  2O0W A;  2HPM A;  2XGJ A;  3BG7 A;  4RM2 A;  1S9H A;  3K6G A;  1E0E A;  2VKH A;  3SYT A;  1FX0 A;  4B3G A;  1W9X A;  5FL7 A;  4TKO B;  2M7A A;  5HNF A;  4OJP A;  3DU6 A;  1OB0 A;  2L9N A;  1EFR A;  4ZDP A;  1HG8 A;  3IP4 B;  4JOM A;  2K3P A;  1BR4 A;  3BH4 A;  1X1D A;  1GQ8 A;  2LH9 A;  4KT6 A;  4OAY A;  4DIQ A;  5KHD A;  2O1D A;  2NST A;  2L7K A;  1KCD A;  4BE0 A;  2F43 A;  5HKK A;  1RMG A;  3ZGK A;  4II2 A;  3J7A Y;  3H35 A;  1MAB A;  5DN6 A;  4XL9 A;  4DBR A;  4DGW B;  4XD7 A;  3HC7 A;  4N4N B;  4E7I A;  2PYG A;  1NHC A;  3K4K A;  2IS2 A;  1PYV A;  3HUG B;  4Y33 A;  4IZZ A;  4XR6 A;  4F3Q A;  1OR7 C;  1VLY A;  2ZFU A;  3NWS A;  4CCL A;  4C2U A;  2ZXH A;  1BOB A;  3DU5 A;  3OYF A;  4FET A;  2CMP A;  3OS0 A;  2GJR A;  4IKF A;  4CSW A;  1OFM A;  3B4N A;  3OR1 C;  2HPI A;  4LIU A;  4F55 A;  2X53 S;  3S3N A;  1KMH A;  3RPU D;  3HXL A;  2E60 A;  1WJE A;  3OYB A;  2KRH A;  4LG3 A;  3FY3 A;  4XLE A;  2ZZG A;  1U0J A;  3LFU A;  4HSR A;  3ZRG A;  2E1M B;  2CFO A;  3DLA A;  4H4K C;  3PL8 A;  4BE1 A;  4BE2 A;  4BEH A;  2HDW A;  2HLD A;  3OEH A;  2XSJ C;  3ZSC A;  4P5O A;  2WY7 Q;  3CES A;  2V6E A;  2UUZ A;  4PMH A;  1MMD A;  2D3N A;  2DCE A;  5TGT A;  1YE9 A;  5LFA A;  4OZZ A;  2X1D A;  3OY9 A;  2X8K A;  1V5E A;  3OIP A;  4Y3O A;  4E7L A;  2LZJ A;  5CPR B;  1DGR M;  2W82 A;  3TBI A;  4HNU A;  4XOP A;  3VST A;  1G8X A;  2OV7 A;  3T9G A;  3VSV A;  2WAE A;  3CJR B;  2WAF A;  3EUK L;  3DPT A;  2WZP P;  2X85 A;  2WB1 A;  1IA5 A;  3D5R C;  2IGN A;  4BEH B;  2VJ5 A;  1HA8 A;  1DBO A;  3AFH A;  4YZ0 A;  4MLO A;  2UVE A;  5FRM A;  3DPU A;  2DJI A;  3MD2 A;  1X19 A;  3JU4 A;  2HU9 A;  4TSF A;  2XAU A;  1IDJ A;  1TZL A;  3LMM A;  3RTR A;  3OAA A;  4G7W A;  2KLO A;  4NC8 A;  3ZR8 X;  3HOS A;  3AL0 C;  3WWG A;  1WJ5 A;  1FMW A;  1P9Q C;  2ZSI B;  3DKY A;  4Y4R A;  3VYU B;  2R7V A;  2V7Q A;  1PXZ A;  2NT6 A;  1MW7 A;  4ANJ A;  3K70 C;  5CKT A;  4YEL A;  1X4O A;  1V0F A;  3DWL E;  2VBM A;  3K70 D;  3N05 A;  3VYT B;  4XNF A;  4PK4 A;  2DOA A;  4EAT A;  4PSW A;  2WJV A;  3OYL A;  4C2L A;  3HOT A;  2M3A A;  2V7F A;  4PFO A;  1OOC A;  1OGM X;  3EQO A;  2ELJ A;  2VQH A;  3PNT A;  2F6C A;  5FRO A;  3KYL A;  3BCF A;  2WBM A;  2O0V A;  4GRI A;  5HLT A;  1W36 C;  2O17 A;  4YEJ A;  4OJO A;  2VJJ A;  4NQW B;  3VYR B;  2LRE A;  2VJ4 A;  3IUO A;  4XKB A;  5KNL A;  1W36 D;  2NTQ A;  4DNR B;  4C2T A;  1RWR A;  5CQG A;  2KZV A;  1NBM A;  1RU4 A;  1UAA A;  2IGK A;  1T95 A;  1PLU A;  2MC4 A;  3FDY A;  1K5C A;  4BAC A;  1NRK A;  2R7O A;  2LY1 A;  2Z8G A;  3OPO A;  4OJL A;  1X1C A;  1DGW Y;  2ZZQ A;  2R7T A;  3GQ7 A;  4OJ5 A;  1WJB A;  4FAS D;  4I84 A;  2DXI A;  2VXD A;  1GLN A;  1KCC A;  2VXZ A;  3T51 B;  4KKS A;  1I8D A;  3QYB A;  3PSF A;  3PSI A;  3DTK A;  2UV1 A;  3NE5 B;  4FXU A;  4NK6 A;  2JUG A;  2XOK A;  3SEZ A;  3I3L A;  4B43 A;  3LSK A;  2XZO A;  3QOE A;  2MD0 A;  4Z06 A;  4F91 B;  3H5N A;  1BR2 A;  2X6W A;  5LD2 C;  1WPC A;  1YX5 A;  3U21 A;  1QCX A;  4YRV A;  1X0C A;  3CP2 A;  2NTP A;  3W2W A;  4P22 A;  2ZTG A;  3BCD A;  3B90 A;  2V1N A;  3H5R A;  3A35 A;  3OYH A;  2KDO A;  2LOO A;  2F1M A;  2AQF A;  4HEA 2;  3H0D A;  2LC2 A;  3K4B A;  1DBG A;  1O8D A;  3ZPP A;  2VQL A;  3GQ9 A;  2X6Y A;  3FHN A;  3V42 A;  4ASU A;  3ZCO A;  1IB4 A;  4F92 B;  4RMN A;  1KZL A;  4U87 A;  1UD4 A;  2W00 A;  1O8H A;  2R9V A;  2CW8 A;  4ZTF A;  4XOT A;  3M1C A;  3VSL A;  3MMY B;  5FRN A;  2CV2 A;  3A3B A;  3OE7 A;  1LKX A;  2JVH A;  3GVJ A;  1Z7L A;  1O8K A;  3PJR A;  3VYS B;  2O04 A;  3LSI A;  4X0G A;  3GVL A;  3LMW A;  2JJ2 A;  4AU7 A;  2P0W A;  2HZD A;  4B47 A;  3UR3 C;  1SAU A;  4PJL A;  3BC8 A;  1PKV A;  2INU A;  4CCK A;  1O8F A;  1O8G A;  4N4O B;  2X51 A;  2BW3 A;  3BG6 A;  4BXF A;  4G7X A;  3H5A A;  3QYF A;  3FKS A;  3LNN A;  1O8E A;  4ITV A;  3GQA A;  1QHH D;  4BS9 A;  4HG2 A;  5HVQ C;  2VB6 A;  4U7B A;  4XN3 A;  3OYJ A;  3DDY A;  3PNY A;  1UD2 A;  2XDV A;  2VL8 A;  2W7N A;  4KKU A;  4BJ6 C;  2VBE A;  3CJQ B;  4G6T B;  4UZU A;  1O88 A;  2HVQ A;  1K28 D;  3L2Q A;  3S93 A;  4L8J A;  2Q1Z B;  2W6J A;  3G05 A;  1W0J A;  2BW3 B;  3K10 A;  1WTH D;  3L2W A;  3HKZ A;  3FBI B;  5HNH A;  2L2O A;  4F93 B;  2GJP A;  4XMY A;  2CUZ A;  5AMV A;  1Y56 A;  4TT3 A;  4OZY A;  2KRC A;  3GBG A;  2JA2 A;  1O8I A;  1PE9 A;  2IQ7 A;  2VIX A;  2EWE A;  2D3L A;  3W2V A;  1SKY B;  4BQQ A;  1E1Q A;  3K4J A;  4BGD A;  2HVS A;  3LSM A;  2CV0 A;  1R6R A;  3VMV A;  2Z16 A;  2KMU A;  1VZ0 A;  4YXW A;  2KPM A;  2Z6B D;  1K6Y A;  3ONQ A;  4XOR A;  1E79 A;  3L2R A;  4BDZ A;  4URR A;  3SEQ A;  2R7U A;  2PYH A;  3DPL C;  3A4C A;  4Z1M A;  2GOM A;  2JVG A;  3DEE A;  1D0Z A;  2RRE A;  3C2H A;  2V4J C;  3OS1 A;  4XQF A;  3H9J A;  4ZC3 A;  1D0X A;  2M4G A;  1IDK A;  5KCM A;  3RSN A;  3ZIA A;  2NZM A;  3MKW B;  4DK1 A;  3ZQQ A;  4XKC A;  3S8P A;  3OWT A;  4NK8 A;  1BR1 A;  2A5W A;  2XF5 A;  3JUR A;  2LBF A;  3HPH A;  4HST A;  2DIE A;  3OFN A;  4KKT A;  4GQN A;  4CCO A;  2VQG A;  2R7R A;  2M0M A;  4II3 A;  4D9J A;  1X1A A;  3OL4 A;  1XG2 A;  3GRH A;  2M7B A;  4CUG A;  3MKY B;  1Z3Y A;  4IX7 A;  2KQR A;  4BQO A;  4YZQ A;  3CMM A;  3D5S C;  2GJK A;  3A3G A;  1LVK A;  4HIZ A;  4XLA A;  2JDI A;  3VR6 A;  3EPZ A;  1BMF A;  3T53 B;  3IAS 2;  3RQ4 A;  2F5V A;  1X1B A;  3H9Q A;  3LSG A;  5HOO A;  2V31 A;  2ODL A;  3D5L A;  1N75 A;  4MR0 A;  2Q2E B;  2LBF B;  1Y6I A;  1UD6 A;  4HWV A;  4EW9 A;  1Z3X A;  3E1S A;  3OMY A;  4NC7 A;  4ZYA A;  4NNJ A;  4D1Q A;  4W8T A;  3K4C A;  3AKZ A;  2WA0 A;  1V5G A;  3CZ6 A;  4XM3 A;  3TL4 X;  3VSK A;  4J00 A;  4E7H A;  3OL3 A;  1DQU A;  3NWT A;  4HNT A;  1I18 A;  3QOD A;  3T56 B;  4W8S A;  1COW A;  1UD5 A;  2UVF A;  4J01 A;  1ERD A;  4CH7 A;  2LRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...