4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
3GQAA 3VSVA 2QY1A 2EWEA 1PE9A 4XLEA 3UW0A 2UVFA 4XLCA 3FY3A 4MR0A 4U4BA 1QCXA 3LMWA 4I84A 4NK8A 4XKVA 1PXZA 2INVA 2X6YA 4C2LA 4OJOA 4W8RA 1KCDA 4HWVA 3WWGA 1H80A 4XQFA 1OFMA 1NHCA 2ODLA 1WMRA 1O8HA 1KTWA 2NTPA 3B90A 4XL9A 4W8TA 1KCCA 4YZAA 3GQ7A 2X85A 4AVZA 2PYGA 4XN0A 2VJJA 1JTAA 3JURA 3SUCA 1IB4A 2NT9A 1EE6A 4EW9A 3KRGA 1DBOA 4PMHA 2O0VA 5AMVA 1IDJA 1OFLA 2O04A 2NTBA 2O17A 2PYHA 1RWRA 4XONA 4OZZA 3EQNA 2Z8GA 2O1DA 1OGOX 4Z05A 2O0WA 1O8FA 2QX3A 1PLUA 1VBLA 4OJ5A 4XKWA 1XG2A 4W8QA 4OJLA 4YZXA 1O8KA 1X0CA 4YELA 1JRGA 5C1EA 3VSUA 2VBEA 4XN3A 4XMYA 3B4NA 2NT6A 4URRA 4NK6A 4Z06A 1IA5A 2X6WA 3EQOA 3GRHA 4XOPA 3GQ9A 1AIRA 4XLHA 1QJVA 2NSTA 4XR6A 2NTQA 3B8YA 2BSPA 4MXNA 4XLFA 1RU4A 4Z03A 1GQ8A 1OGMX 1HG8A 1O8MA 1O8IA 4OJ6A 2NSPA 2PECA 3GQ8A 4XOTA 2INUA 1BHEA 1K5CA 2UVEA 3ZPPA 4W8SA 4XORA 4U49A 3ZSCA 2NZMA 1CZFA 2VBMA 2QXZA 4YZ0A 3VMVA 3VSTA 2X3HA 1O8GA 4OZYA 1O8JA 3T9GA 4YEJA 2IQ7A 2X6XA 1RMGA 1OOCA 3VMWA 4XM3A 5C1CA 1BN8A 1O8DA 4XLAA 1IDKA 1O8EA 4XNFA 1O88A 2VJIA 1O8LA 2VBKA 4YZQA 1DBGA 4OJPA
chains in the Genus database with same CATH superfamily
4OPOA 3OZWA 3BCAA 4ABZA 3M9AA 2HDNB 3VNUA 2GWRA 4BJTA 3ML6A 3GEZA 3H9QA 4XLEA 3TDZC 2WYRA 1YJNI 2G9WA 2MW8A 5L3DA 4XLCA 4WCGA 3D26A 2X1CA 4HLYA 1O57A 5JLXA 1UB9A 5ILUA 3JRDA 1SFUA 1E2XA 1HQCA 4Y17A 1B72B 1I1GA 4RLFA 1KMHA 1DGRM 1BR4A 1O3TA 4B3GA 1H9GA 4N4NB 3CCMB 3LA3A 5IYNA 1VQLB 4WQMA 4OOIA 2C2WA 4HOBA 3KEYA 3B90A 3FBNB 2Z1DA 2CV0A 1XGNA 1R58A 1TTYA 4PK4A 3J80K 2O3FA 3M8FA 3MVPA 2Q8KA 1RQPA 4BU2A 4ON0A 5GAGJ 1QGAA 4RJLA 4LFUA 1S7AA 2V9KA 2QQ9A 1I27A 1NG7A 2Z16A 4NDLA 2HVRA 1R5ID 4EJOA 3OSGA 4N3GA 3RY8A 3LSKA 1T8IA 4BDYA 5JHUA 4XONA 4RMNA 5ICEA 2R7UA 4F7DA 2DMPA 4G7ZF 2VJ4A 3M8EA 3CMEB 2VBTA 2NNYA 1T95A 4XBFA 1BI3A 1X2NA 3ZZUA 4G6QA 2ZJ2A 4ASNA 4KYWA 3ASNH 1Z91A 2P5LC 1WH7A 2WTEA 3GTKJ 3AGPA 4LBVA 1W4MA 5JR3A 3G2BA 4XKBA 5KK1A 1H88C 2X51A 4Y7NJ 5C1EA 2NVTJ 4XICA 5F4OA 1JHFA 3GW2A 3QPLA 2P7VB 4XMYA 3NB2A 2O6GE 4HNTA 1DDNA 1ORKA 2KL4A 3MEXA 2D3LA 3CJRB 1U78A 4AWXB 2V9PA 1IJWC 3JSPA 3F8MA 3SLNA 3J80Z 4I0AA 3ASTA 4DQLA 2KIUA 1P4MA 2VB6A 1VI0A 4P5OA 3T53B 4LK1F 1W5SA 2HQNA 2VBWA 1RZ4A 1S29A 3TOBA 2NPFA 1ZRFA 4BQAA 3TO6A 3LNNA 3LVBA 3W2HA 1TLLA 3GTMJ 2BM5A 2V79A 1S8NA 2GLOA 1N78A 1IF1A 4Z4RA 4KICA 1LKXA 1T6ZA 3CLOA 2H94A 2O9LA 3SZTA 2XPWA 4GCVA 3CCYA 3SDBA 3UNGC 3IAM2 3KP7A 1BIAA 2XEXA 1JUSA 4N4OB 1TYXA 1VTNC 3C7JA 3RDIA 4UVAA 1LFUP 2V7QA 3TGNA 2KRFA 2WY8Q 3WGIA 4UB8C 4R79A 1TW2A 2KPMA 3WHCA 3SJZA 2EA2A 3CZ6A 2M5SA 2A6EF 4RM0A 3R4KA 1IJEA 4OIQF 1JJ2B 3HIFA 1D5VA 1BJAA 1F20A 2ISZA 1D8KA 5M5WJ 3HC7A 1UHSA 2DMQA 1QRYA 2DT6A 2NOGA 4Y4RA 2L7FP 2P5KA 2LF8A 3PUFA 1I39A 4P9UA 1MNMC 4U87A 3W5HA 1S7OA 3R60A 3U1DA 3S1RJ 1R71A 1SFOJ 3H9JA 3M4OJ 4P26A 3VO1A 1J7KA 3OOCA 3DXJF 4M3BA 5K7ZA 3B8HA 4B4CA 5C44J 2F1MA 3PNTA 1DDGA 4FXUA 3JX8A 1QA3A 3CDHA 2G0EA 1WKMA 3AG1H 3FX3A 4RAGA 1MMSA 3OYBA 2DCUA 3DU6A 4XQFA 3GBGA 4WZTA 4Y9UA 4U88A 2VC1A 3HRUA 3OYAA 5J3LA 1D3YA 3M8JA 2JA8J 2LF7A 1O8HA 3DTKA 4G7HF 4U9UA 2IAIA 2V7VA 3CJTB 3ZPPA 5JBQA 4BS9A 3VB2A 1WP6A 3JURA 4L0YB 4A3EJ 4HF0A 3H9GA 3OIPA 3A3BA 5FO1A 2FRHA 5K7FA 4HX4A 1K6YA 2H27A 2MLGA 3BH7B 2HVSA 3A0HC 5FLVA 2EILH 2ID6A 3HUGB 1VQ8I 5FRNA 2O04A 3HHHA 4R1HA 2DEUA 1W7PA 2QBYA 1RWRA 5KNLA 4EGZA 2KRHA 3BP8A 4L5JA 1W1WE 1I6XA 2DIEA 1MBHA 3WTUC 3BTCA 2VODA 3N6ZA 3WBJA 3NAWA 1G59A 2Y30A 4OMZA 2D1HA 3OZUA 3O3KA 3S3OA 1HA8A 2QEXB 4YRVA 3WBKA 3RKWA 1ETQA 4RLQA 1D8JA 1RRJA 3ZQQA 1R5GA 2XNJA 2E19A 2XRNA 3KYCB 4HEA2 2JN9A 3DEWA 1B23P 3Q0UA 5H6RA 1J9IA 5H20A 3CQZJ 2LD5A 2X1EA 3PUBA 5BSYA 2OCEA 3HKZA 3E1YE 4YFNF 3K1NA 4HBLA 3SDGA 2PX9A 3QFRA 3GQ9A 3D5RC 4QTRA 1ZUNB 2BOLA 4M6YA 2BEOA 2FMLA 4P96A 4BQQA 3T56B 2GREA 2M4GA 5D4SA 2XNDA 3GYHX 1QPIA 3GUDA 1VNDA 4G1VA 3F23A 2ZBKA 1KYWA 3DKXA 3PNYA 4EVIA 4EM2A 4IOCF 1O8MA 1XB4A 2HZDA 2ECCA 5BNGA 3OR1C 3LSGA 2W7NA 3B6CA 2DQLA 5KHDA 3OIQA 1MDMA 5H5JA 3V7AA 3HPHA 4NC7A 2HMAA 4U0WA 4QIWN 3N97A 4O6JA 1OGIA 3OEEA 4XORA 2HPMA 1MSFC 4U49A 3A01A 3IL2A 4J00A 1QPMA 5EZHA 2HTJA 1RETA 1SD4A 2GA1A 4MFDA 5JLWA 1T5EA 1D1NA 2VBMA 2F4NA 5JI6A 2VT3A 2D2WA 4YEIA 1IW7F 3H5NA 1YJWB 1MGTA 1EV7A 4AUXA 5FKLA 4DNRB 4BKXA 4C3IJ 4RDKA 2LBFA 1BX0A 4HNVA 1X3UA 4JX4A 5DSZA 4DK1A 3E6DA 2XPUA 2FF4A 5J8CA 2PYHA 1TP4A 3NRVA 4IRIA 4ESJA 1JA0A 2CUZA 4YAWA 3GVAA 3FF5A 3TL4X 4Z6YA 3I59A 3EYIA 4OMYA 2NS7A 4XSXF 2VZLA 4UHTA 1KGSA 1W7PD 3GTGJ 3LFUA 3L2WA 4UUVA 1QCXA 4CYCA 5FL7A 3N4MA 5GAHJ 1PDNC 3K69A 4IHWA 4KIBA 1S9HA 3JQQA 5GTHC 2L5QA 2M3AA 1HW5A 3TP0A 3CD6I 3W5VA 4RS8A 5LEJA 4C2TA 2E1BA 3LO8A 5JLVC 2XROA 3K70C 4BDZA 3FXUA 3BG9A 3LQ6A 5AIPA 3HSRA 2A61A 4PGGA 4ANJA 3H5AA 3T8RA 4PUSA 2OTJB 1XB2A 3DBHB 2PYGA 2IS4A 3OL4A 4EV0A 3J81k 2LZJA 1GR1A 2OBRA 4F93B 4G8XA 1OR7A 5DCFA 1YI2I 3J7AY 4A3LJ 2BHYA 3W2EA 2R7OA 2NT9A 1X3ZB 2E1OA 3OYKA 1EE6A 2L7MP 2PQ8A 2D9RA 1Q82D 1LDKB 4RA2A 1ZARA 1CNEA 2B5OA 4OP7A 3D5LA 1CF7A 1ERDA 2R7VA 4YIRX 3JREA 4P2NA 2WBMA 4J01A 4EM1A 1QA2A 1R49A 3GMEA 1EF4A 2DPDA 3BR2A 1QFZA 2YWEA 3FPKA 2OQRA 2CSOA 2E5ZA 1Y0NA 2KRCA 1YG2A 2Q1ZB 4TV7A 5J4VA 1YOVB 3OKXA 3K4NA 4FX4A 4CGZA 4CCLA 5CKTA 1X1PA 4OJLA 3OAAA 1LE8B 2XTWA 2DA5A 2O8XA 2RAEA 5HDKA 4Y15A 2WAQA 1JUMA 1ZGJA 2KIQA 1LLWA 2PEXA 4PFOA 5FLXK 1MD0A 4NK6A 2QKLB 1H8AC 4QV2A 2WJYA 3F3XA 2LR8A 5FJ8J 3GXOA 3GRHA 1SFXA 2FE3A 3S8PA 5HNHA 4ENNA 9ANTA 2CW5A 1JHHA 1AA7A 4P1WA 3NEUA 2O5RA 1FX7A 1NG6A 1W9XA 3AVWA 1OCRH 3MZYA 3TBIA 4G6TB 3ZR8X 4OPVA 3ASSA 5B1BH 1R22A 2DO7A 2PIAA 4DOZA 1G3WA 1GXPA 1HBXG 3S3NA 1VF7A 3GZ5A 3M7GA 3BJAA 2DN0A 2FBKA 2XPVA 4OJ6A 1MBEA 2IJLA 3BTIA 4UUTA 3CCMI 5FKKA 2V1DA 4YFKF 4CYDA 1D5YA 4BHCA 4KISA 2CUEA 4NBQA 4Y9RA 2BBYA 2I10A 3DPUA 1GVDA 3FXOA 3Q9VA 1U6GA 2UXXA 2AQFA 3M1EA 4RBOA 3A8JA 4PJ0C 5FKOA 1CZFA 5IYDJ 1XD7A 1NK3P 1WWXA 4MIMA 1GHCA 1UD4A 1FOYA 1MDMB 2VKVA 3PA2A 4DQKA 2ESNA 1IN8A 4PDKA 4QVJA 1JI8A 4LIVA 1NB0A 3S16J 2M7AA 1FOKA 2GBYA 3WTZA 4BXFA 1BM9A 1IN4A 1K4ZA 4FE7A 2W24A 3CCVI 1Z3XA 3WHBA 3E1SA 3DTEA 1FX0A 3HTSB 2XZPA 2LSOA 3AGQA 2MLKA 2OV7A 1V4RA 3DEUA 1HKTA 3FDYA 1HCRA 3JRIA 2M5WA 2Z99A 3VPRA 2UVFA 2LKPA 1A31A 1QUFA 3F21A 1QVUA 1FMVA 1EA0A 5EYRA 2X3UA 2BV6A 2EFOA 5KCMA 3V42A 3K4KA 1BQEA 1PXZA 3OV8A 3A8IA 1SD6A 3OJWA 1MABA 1AKHB 3OIOA 3R0JA 2VLAA 3EPZA 1XSDA 1WJBA 2DI3A 2ODLA 2XSDC 1WMRA 3BH4A 2COBA 3DTIA 4W1UA 2JWTA 2RVCA 4BHBA 1FNMA 4Y13A 2ZXJA 4MNUA 5F1JA 1K78B 3EUHC 4CYCB 5CVUA 1G3TA 1ZYRF 2UUZA 4NQWA 5K5RA 3OYEA 5TRDA 1GAWA 2ZTGA 4RAFA 1X19A 4DIQA 4ITVA 4LC0A 2GAUA 1U0JA 3A0BC 2YX4A 4AF6A 1K4TA 3OZVA 4ROXA 5D8KB 2VT2A 2X1DA 2BW3B 4KDPA 3H94A 3CJQB 4DQ2A 4A0ZA 3I56B 4GYIA 3OYCA 4PC3A 1VQNI 3EQNA 1EKEA 3MWMA 3HM5A 3TDUC 3FHNA 3A3GA 1QX4A 1Z67A 2FNAA 4B3XA 3P5JA 2PJPA 2XTXA 1ZG3A 1ZQ3P 2LKSA 3I55I 3WG9A 1W5CC 1R1VA 3F8NA 4M6XA 3VYUB 1W36C 4UNOA 2QF7A 1R4NB 2L4MA 5FLXZ 2XNCA 2R7DA 2FUG2 1VBLA 4OJ5A 2KJBA 4U0YA 2XC1A 3SEZA 1HDDC 2B0LA 4U0VA 5HS9A 4X6AJ 4JX5A 2CNDA 2NT6A 3S1MJ 3JTHA 1HXDA 1HW2A 3CO7C 3EQOA 1ZTRA 3LSIA 5A2QK 5IYBJ 2WJVA 2ZJQF 1G2HA 2IPQX 2CMPA 3FMRA 3VDXA 2F5VA 3BTLA 5LMZA 4FT8A 3DKYA 2OBTA 4HAMA 1FTTA 3PSZA 4KMFA 2PJRA 2QQ8A 5E17F 1DPUA 4PC7A 3RCOA 4ZCIA 4EQQA 1VQ6I 3PFYA 2DBBA 3E0JB 5CQEA 3WXMA 3B6AA 2DOEA 1ETXA 5GP9A 5H2FC 1KZHA 1B9MA 2VQHA 4UZFA 3RKXA 2FOKA 2GK7A 1HF0A 3L00A 3AL0C 3ZUGA 4M72A 1KRHA 2K85A 1MJAA 4YZ0A 2D74A 2KZVA 4BACA 1IN7A 2X3HA 2W85A 1T98A 4BGDA 4ZC3A 1BPLA 1GT0C 1RMGA 1VZ0A 2LTPA 3K10A 1D1BA 4QLCU 2Q0OA 4C30A 1LNWA 4LGWA 2NNNA 4X7EA 3CD6B 5F4JA 5BSXA 4HV6A 1LM1A 2Y48A 1Y0YA 1S5LC 2L7KA 1YX3A 3WU1B 4UZEA 2EV5A 3FPPA 3W2GA 1TWAJ 4E7LA 5DN6A 2A69F 5LGNA 1QBJA 4R71A 2XT2A 2BY0A 2RC4A 1QA6A 3CC2I 1G3SA 4OJOA 1RKTA 1JJ6C 2YPRA 2H09A 4OINF 2K40A 2CF4A 3VYSB 2GPJA 3QFCA 2KIMA 2HU9A 1GLNA 3WU0A 4XL9A 2JJ7A 4HW0A 2CW7A 1R23A 2Y2ZA 1TNTA 3TP3A 1YJ9I 1MSEC 2EFNA 1PJ6A 4LJZF 1YFHA 2A5YB 4HPQA 1VQOB 2CRVA 3CPWB 2JTVA 4D5CA 4KH3A 4FE4A 2LH9A 3GLLA 4DYQA 4F92B 1HOMA 5FLMJ 3L2RA 1FOXA 4BHPA 1UD8A 3CMMA 4C9YA 4G9YA 1FIPA 1CGPA 2E36A 4PJLA 4CICA 1PJRA 5D5VB 3K4CA 3GWZA 3FIWA 4BQOA 1OR7C 2IBDA 1N07A 1XMAA 1BIBA 2VFNA 2LREA 3NAUA 4I02A 1KK1A 3O2PE 2BVLA 4U7BA 1GDTA 1S7EA 2R7SA 2MABA 3I9V2 2XASA 4ZCLA 4G12A 1VQ8B 3E5XA 2W57A 2XF7A 3WTTC 4G6DA 2EQRA 1X0CA 4Q47A 4RCYA 3K4MA 4MYUA 3K6GA 4UV9A 3HOUJ 5E3LA 4XLPF 1QO0D 2GXAA 1ETVA 3IH4A 4GDFA 3GF2A 3A8KA 4I2OA 2L9SA 2MC4A 3WY9A 2X6WA 4IJAA 5L3CA 2HYFA 1RUNA 1R1TA 4BY1J 1YS6A 2ME0A 3E5UA 3WTWC 2LYCA 4IHYA 3CUQA 1R7JA 3IP4B 2J5OA 4W97A 3PIPF 4I6ZA 2KLOA 2IW5A 5TR9A 1QGPA 3CMAB 4IXAA 3HOSA 1BR1A 3V8KA 3U2RA 4Z1MA 2QA4I 2BY2A 1RI7A 2DYSH 2VBXA 3FZVA 1W0KA 1KK3A 3QFSA 1U8BA 1O8IA 3G1LA 4MO7A 1ZLKA 2NVUB 3QRFF 3DV8A 4V19K 3S2DJ 1KC8D 3ZMSA 2C77A 1VQ4B 2X6OA 3CCSB 1MBGA 4S04A 1LLZA 1WPKA 1ZLJA 2H8WA 2ZC2A 4M73A 3HZJA 3C2GA 3OOPA 4M1KA 3V7RA 4QWQA 1EXMA 3MHPA 2NZMA 4FASD 3SHFA 2ZBUA 3OYGA 1DP7P 2GA2A 5D4RA 1WOOA 4RB0A 3OYLA 1PP8F 5HS7A 2AHOA 2IA2A 2FQ3A 2GXGA 2KHMA 3CCLB 1M90D 3H09A 1O8GA 1U5TA 2BE5F 2VOOA 1YO5C 4V2FA 1XFOA 3ONYA 1VQMI 3SZPA 3KIOA 4BAYA 1EFTA 1BOBA 3V7SA 1I5ZA 2V4DA 2EBIA 3SFIA 3VODA 3HGGA 1CF7B 4X7CA 4X7DA 3SKBA 2BW3A 4HDVA 4PC1A 1DUXC 4WZKA 5TJJA 4A2UA 5IT9K 4F3QA 4MQ9F 2GJRA 3K7AJ 5FD5A 1POGA 1WXRA 3HOVJ 1Q9SA 2CG4A 2NXNB 5DS0A 2JA7J 4C2LA 2XGEA 3ASQA 3I56I 4IOAF 2MFZA 4HWVA 1ZGAA 1LJ9A 3S2WA 2FX0A 3V8LA 1JXSA 3WWGA 1NHCA 3RKQA 2DXIA 5M3FJ 1PUFA 1GJRA 4A3GJ 2XAQA 4WXDA 5C4XJ 1L0OC 4YCQA 1I50J 2MSYA 3SJPA 3BR1A 4CHUA 1ZM3A 2W00A 2WSSA 1XGOA 2VPRA 2L9NA 4ZYHA 4YFXF 2IT0A 5HLHA 1K79A 3ABMH 1XE1A 3EUKL 3K4JA 1DBOA 4TT3A 1X2MA 2QSHX 1GXQA 1SC7A 1ZRCA 2M0CA 3W2IA 2MG4A 5E6TA 4P3IA 2E2IJ 3BQJA 3T1BA 1LEBA 4M9XA 3TKYA 3QODA 1HVXA 4MHGA 2Z8GA 4XD7A 3BC9A 2C5BA 3E97A 2STTA 1WJAA 2V1XA 1IC8A 4DBRA 1YJNB 2QX3A 2XUBA 1V5GA 3IRRA 2A68F 2OF7A 4PJMA 3TEDA 4M0LA 1PLUA 3SZEA 1K9MD 1T6SA 3VEPA 1SEUA 4FISA 2DOAA 3PSIA 2HLDA 1TYWA 3RIRA 4HV5A 2HFHA 2VBEA 3S14J 3FXLA 3FK7A 3QPHA 2Z2SB 2NRAC 2OK7A 3ONUA 1Q1VA 4LK0F 2ICWG 5M5XJ 4RB3C 3H0GJ 3JRBA 1AIRA 4A3IJ 3ZBUA 3MD2A 1QGYA 5IYRA 5ERIA 4FHTA 3CRZA 3HOYJ 1XCVA 1R6RA 2P81A 2WWYA 4Q48A 4PC2A 2B7BA 1J5YA 4MYTA 4Z03A 3SQNA 3F72A 4NC8A 4AC0A 1YLFA 4IO9F 1ZN2A 1YTYA 1OGMX 4NB5A 1OCCH 3O8HA 1CNFA 2LFBA 1QHGA 5KAIC 2E35A 3BQZA 3QOPA 3DFGA 4JMQA 4X1EA 1MJ9A 3RPQA 2BY3A 2OC6A 5EGOB 2ZFUA 4HIZA 2XAFA 1ZH5A 1HA3A 2EIMH 2X0LA 3VYRB 3BZCA 1VHEA 2W7ZA 1U5TC 4RD0A 2UVEA 2IGOA 1VQ5I 3G73A 4I98B 5IP6A 2WB1N 1V3FA 3PSSA 2E1MB 4PCQA 4OZYA 1ZM9A 4CZCA 2IEKA 2X6XA 3F8FA 1JB9A 1D0XA 3PSFA 4RPDA 5A88A 1BN8A 2E7XA 1XS9A 1N06A 1SM4A 4BBSJ 2X6YA 3ONQA 1MNEA 2ELKA 3AVXA 4OJPA 1TW3A 3ISXA 3E6BA 2MD5A 1BR2A 5IOZA 1T6XA 5BS6A 3I4NJ 1WFXA 3RTRA 1QZYA 1FC3A 1D1AA 3LNQA 1DU6A 4H0EA 5D5UB 2W25A 4KT6A 1G4DA 2ISYA 3LSTA 3DU1X 3G1MA 1B8IB 3SFZA 2LKXA 5C3EJ 2AO9A 3QP6A 3BNWA 2ADUA 5B5EC 2CRGA 4E7IA 2EB7A 2VNKA 1WJFA 2VQCA 5FO5A 4UY8I 3S2HJ 3KZIC 1ZGWA 1YHQB 4OOVA 3CCEB 3GQ7A 2JUGA 3JRGA 1K61A 4OIPF 1TWHJ 2R92J 2GIZA 3SEQA 2ZZGA 3HOTA 2BXYA 2X4HA 2HYJA 4KN7X 1DPRA 2DJIA 1H9TA 1NHAA 3ZZ0A 3CCJB 3ZQHA 4RDJA 2Z5UA 4LBYA 1SMTA 3KRGA 2M7BA 4A3MJ 1UCRA 2HS5A 5F04A 2J5PA 2IGKA 3FWEA 1BI0A 3KP3A 4HSRA 2EZIA 4N9HA 1KYZA 3GIRA 1T08B 5LEKA 1UHMA 4PFPA 3K70D 2R5ZA 1K7AA 4TMTA 3PVDA 1KU2A 4M4SA 2WY7Q 4WX9A 1MW7A 4CZZA 4JP0A 3OYIA 2XAGA 3IH2A 4MQVA 3RSNA 1WPCA 2ZO4A 5E8IA 1J59A 1YRNA 2RREA 1FZPB 1XG2A 2KKOA 5HLTA 1O8KA 2CS3A 2DW4A 2RGVA 5GADJ 1JRGA 2HOAA 2EJRA 2YR2A 5LLQA 1BL0A 1J09A 4HQMA 2IS1A 4QVAA 2HKOA 3G05A 2ZNZA 4PC6A 4URRA 1TZLA 4FETA 3JCUC 4PSWA 3ES9A 5DD4A 4BBRJ 2K4JA 2FSWA 2Q2EA 3FMSA 1FYLA 4JQFA 4BE2A 2D5VA 4AC9A 2LLKA 3OYDA 2DMUA 3BZKA 1FEXA 1N25A 4B4DA 3CC2B 2BSPA 1BW6A 3OYHA 2XF5A 4IHSA 2UZKA 2BF4A 4IHTA 4GO1A 1HKSA 3DF8A 2F4MB 1HG8A 1W2BB 2YSRA 1GO2A 1XCBA 2PLFA 2UV1A 4Z4WA 3CUQC 3H35A 2OTLI 2HXIA 1EP1B 3JQPA 2INUA 1TT0A 5HDGA 2OCCH 2XDVA 4E4HA 5CQGA 3I71A 2HYGD 5L3BA 2YWFA 4I7HA 3HHGA 1VQ7I 3G6EB 3UKGA 1CQXA 3EUHA 3FHZA 4IVNA 3FKIJ 3E6MA 1OPCA 1IO2A 4MFEA 5K5QA 1ELOA 1QH0A 2HWVA 3FM3A 3JRFA 1OHHA 2OZUA 5DDGA 4Z4ZA 2IP2A 2YWHA 4FN5A 5F0HA 2EFGA 1P92A 3DEEA 5LFAA 3IAS2 2JJ1A 4LG0B 2CV1A 3CCUI 3RPUA 4HX8A 1D1CA 2RQPA 1DBGA 2NVXJ 3K1PA 4P6YA 3REOA 2VKHA 4JYKA 2QCOA 2QBYB 3WYAA 3AL0B 2P5VA 1K8FA 4EH1A 1LVKA 2DU9A 5CYVA 4LG0A 2JIZA 2DETA 1Z77A 2DA3A 2ZL6A 2A05A 4ZDPA 1FJLA 5ILVA 2XZOA 3QWLA 4NK8A 2O7OA 2INVA 4G94A 4I0BA 1NRKA 2O61A 2JZYA 1NDHA 3KYDB 4F7ZA 5HDNA 4G6IA 2VBVA 4PABA 1UG2A 5J1UA 4IHVA 3ZQLA 1LPQA 1QQ1A 3G3ZA 3IHUA 4BY7J 4RGXA 4PZJA 1TQMA 5JHFA 2GQQA 1MKMA 2BVMA 2X85A 4AVZA 2B9SA 5LHIA 2VJJA 2V1NA 3I4PA 4O5VA 4ESFA 1J9ZA 4UVCA 1AIPA 2G7UA 5J40A 1JNYA 2WAQN 3JW4A 3B73A 2QA4B 2ZKZA 3VYTB 2WB1A 1J75A 2XB5A 2CUJA 4RD3A 1OFLA 4LB6B 3RQIA 2EFPA 4DZJA 3QYBA 1LFPA 3RZDJ 3TH0A 1TNSA 4OZZA 1Y1VJ 3DWLE 1XSVA 2VNIA 4KKTA 2PBIA 1QG0A 1MH4A 1XTAA 2EA4A 1ETKA 4KNYA 1WI9A 1UJ8A 2XIGA 4A93J 3SY2A 3ECHA 1FSHA 2M8EA 2R7RA 2B7CA 4BXUA 2DA7A 2BM0A 3BDDA 2EV0A 4L5EA 4HDUA 4FCYA 1O3RA 2I1LA 1XPXA 5D5XB 4RD4A 1R4MB 3E20A 2YUHA 4YZXA 3A01B 1QU3A 2IOUG 2J8IA 1R5NA 3CCQI 2VBSA 3I64A 1K4SA 3QE2A 4YAFA 3ABUA 2XKPA 3ECOA 4GQNA 4Z06A 4LIUA 2GK6A 2XAUA 1IA5A 1Z6TA 5FKNA 2O8KA 2W84A 1WZ2A 1QJVA 3LSJA 3SXYA 1TLHB 2GOXB 2V1UA 2BPOA 2R7WA 3PO3J 1U9NA 3ULQB 5IP9J 3A03A 1Q7YD 2BM6A 1SMYF 5E3NA 3OYJA 1ZKGA 3OEHA 1FT9A 3GO5A 4XIDA 2JK3A 4AF7A 3L2VA 3QSYA 1XDSA 4RAYA 5F1RA 3PO2J 4ASUA 3LJYA 4XRSG 3P7NA 1BLIA 4I76A 3FISA 2WZNA 1RR8C 2KT0A 2LVSA 4AD9A 2EZKA 2LNBA 5F08A 4UUSA 3H36A 5HNFA 4ZDOA 2CK3A 1AMOA 1FP1D 3VNVA 1YRNB 4GFBA 4UZUA 1VJSA 5JVTA 1QUEA 2XOKA 4H9GA 4LG3A 5F0FA 2BM7A 1K83J 4G7XA 2K5CA 3MCZA 1OCZH 1WJ5A 2OBPA 3HTUA 5LGUA 1YIOA 1DGWY 4A3KJ 5LGTA 3MQ0A 2MA3A 3JTGA 4P9FA 1ETWA 5EG0B 1H8HA 2J7KA 4JX6A 4OIRF 2WAFA 5E8GA 2GIVA 1JKOC 5B66C 2Q6IA 1T39A 2NAZA 3WODF 4PGHA 2Q2EB 3QP5A 4ESBA 1B4AA 1P6RA 1IB0A 2MGQA 1TVCA 1Y1WJ 2PLYA 2V5IA 1O88A 2VJIA 2JMWA 1ZK8A 1QRBA 2BMWA 1S72B 1LEAA 1PYVA 1O3SA 1W7PB 1I3AA 1WJDA 1EWYA 1PE9A 4V02C 3CCLI 1J2XA 1OFCX 1DP3A 3ABKH 1FSEA 2ZBVA 3G71B 3QU3A 3CCEI 3E5QA 3DDYA 4AU7A 4XKVA 2CBXA 4NCNA 1N8RD 3WNCA 5AN9A 2HOTA 3HG9A 1MMGA 5F64A 3ERMA 1IV6A 1IGNA 3Q6RA 4RPBA 1R9TJ 3CCJI 1Y0RA 1W0JA 2BGIA 5CDFA 1F9NA 4OOXA 5IT3A 3N05A 1HW1A 5DEQA 1VQPB 3ZGKA 1FLIA 4KJZA 2A6TA 1T56A 3CCUB 2F5EA 2A3SA 2X9DA 1YX2A 4LD5A 1A6QA 4N9IA 5D5WB 2K4BA 4N0BA 3BZ6A 2ZTNA 1GVHA 4DYCA 2FBIA 2ETHA 3CTAA 2O0VA 2VFPA 1F1ZA 4YG2F 2NTBA 1ETYA 2M2EA 1G7TA 5F0CA 2HQ5A 4CO8A 4ETSA 3S3MA 1BMFA 1Z05A 3I59B 1VLYA 2EZHA 2K7LA 4F55A 2O1DA 3CF5F 1YW8A 4RB2C 4Z05A 2ZJRF 4BJ5C 4S0HB 4CXFA 2B0RA 2IVMA 3T0YA 3WE3A 1WRJA 3CW2A 4JRAC 3FK6A 3K1MA 4C43A 4XKWA 3FXKA 1A6IA 4CSWA 2VQGA 1QA1A 1JGSA 1S3JA 4LOCA 4BE0A 3PUNA 3ERED 3CPXA 2XAJA 2VBYA 3ZMVA 5E1ZB 3HEFA 2ZMEC 1EFCA 2DTRA 4B8XA 1PKVA 2K3FA 2DCEA 3LL7A 2BSAA 2OYNA 1KQSB 3CC4B 4XOPA 2DT7B 2FEZA 3TOAA 3F22A 1E63A 1Z6RA 1W35A 4J19A 2MYSA 3BCBA 4XR6A 2CQKA 5EZGA 2C5HA 3K2AA 1ODDA 3TO7A 4TMZA 2KJCA 1OB2A 1IG7A 2L4AA 2L54A 3KLNA 2VKDA 2P6TA 4PJJA 3W6JB 4CUGA 5L3GA 3T8TA 3KFWX 2CFOA 4ZZDA 4Z2YA 1TC3C 2NSPA 5TISC 3QOEA 3EUAA 3ZN1A 2QGUA 4ENMA 4A3JJ 2BV3A 3GQ8A 1NTCA 5LHGA 1VQNB 4YIIA 1B59A 1OYWA 4A5NA 5D8LB 1HDPA 3GFIA 2IRFG 4A3CJ 1COWA 2GZWA 3JRHA 1GAQA 1X1AA 4Q4ZF 3ZPLA 1K5CA 1ULYA 1PUEE 4HA8A 3LSPA 2NYXA 1B6AA 2QXZA 4QSHA 2XGDA 4B43A 1RUOA 2NV4A 5DUKA 3IRQA 2V31A 4LBZA 4UUSB 4A3BJ 3KZYA 3P9CA 2V7TA 3JSOA 3EQLF 2DA1A 3PQJA 4P12A 2FA5A 5CVJA 1JA1A 1W87A 2F5FA 2CJJA 4UXNA 4XNFA 2DOGA 5FROA 2R7ZJ 4YZQA 4IQJA 3GFJA 2M34A 3DKWA 5EG0A 4HQEA 1K6OA 5DS9A 1B8IA 1I7PA 3KX2A 2LY9A 3W6KB 1R36A 2DMNA 1OFDA 3BG7A 4IZZA 1V54H 4BNCA 2C78A 2WPDA 5DD8A 1PUFB 1SVOA 1WCMJ 3CUOA 2QZAA 3GFLA 4AIDA 4A3FJ 3ZOBA 1LFBA 4OM9A 2LDUA 2P3MA 3S93A 2ZXWH 2V7XA 5FA6A 1L1IA 3CC7B 1XGMA 3HOXJ 5J8FA 4YHBA 1WJEA 4XSZF 1KCCA 1JKQC 3BC8A 2UWMA 2CFXA 4Z4UA 2PE3A 4CCOA 1O4XA 1N77A 1B72A 2VOPA 1JTAA 2R5ZB 4KUMA 4L9NA 4NNJA 4RGSA 4EEFG 1H8EA 4TMVA 3AK5A 4PJNA 1P2FA 2DQRA 3F6OA 1LDDA 3ZQ7A 5IOYA 1IAWA 1PJ5A 3G4SB 1BI2A 4HRIA 5HZAA 3MKYB 1TYVA 2ECBA 3VMFA 1X1BA 1V5EA 2H6BA 3I58A 1F4KA 2QYUA 1YYVA 4DK0A 1GVJA 2QENA 3M07A 4EATA 4TKOB 1IXSB 2FU4A 3JAMK 1LE8A 2YS9A 4P6VF 4BUPA 5FO0A 2CQNA 2LRDA 4D7NA 1E1QA 3CP8A 3MMPA 5HS8A 2HCJB 1YX5A 2ZMEA 3FMQA 5BMZA 4LBWA 3ESWB 2M9HA 5HODA 4ZTFA 5GAEJ 2O0WA 1G7SA 2V26A 4DYRA 2FOWA 4XK4A 4A12A 3COAC 3Q38A 2F43A 3VO2A 1IV8A 4BH9A 3LOCA 2PFBA 3LWFA 5KW9A 4NBSA 4GXOA 5IK2A 1IUYA 3KYLA 3ZIAA 3BH6B 2FVGA 1BJZA 4LB5A 5E1WA 3I4MJ 4M3GA 1ZREA 2ESHA 1XQBA 1KZLA 1I18A 3FXMA 4RB1A 3FKSA 2R9VA 4XLHA 1X4OA 3OL3A 3UR3C 3IKVA 5CJ9A 2NSTA 1JUPA 3DBRB 1ZR4A 1LDJA 3HAGA 3L1PA 1AHDP 5ILSA 4IX7A 3CCRI 1D0YA 1ON2A 3PNVA 3TO9A 4MXNA 2TCTA 3HBLA 3CDLA 3KLOA 4WK8F 4QPQA 1QQIA 4LMYA 1Y0UA 4XLFA 3BTJA 1P7JA 2OPTA 4MTDA 4YAUA 4OAZA 5IY5H 4YDTA 2XKOA 4BEHA 2HOSA 2VKEA 5IYWA 3WE2A 1M1KD 1A36A 2E1NA 1E0EA 3U6BA 4E6KG 2LOOA 4QPOA 3AVTA 1DQUA 3QYFA 1Z1DA 3F9KA 1E79A 4HF2A 3PQKA 3CXCB 3G4SI 1MRZA 1OGJA 2CW8A 4Z4TA 5IYPA 2F48A 2O0YA 4AM3A 2VPLA 3CLQA 2L2OA 3I3LA 2K9MA 1WOPA 3ZSCA 2X8KA 2K9SA 3AG2H 1E17A 5KSWB 2WV1A 1YE9A 5IYCJ 3ZP5A 5EJCA 3VMVA 3VSTA 3ML3A 4K2EA 4V2GA 1VFCA 4X8IA 3T9GA 3FJOA 1KK2A 3OFNA 1D8TA 1MMNA 3CUQB 4DNCA 3Q3AA 1O8EA 2ME6A 4FK8A 1TYUA 3H9NA 1VQ6B 2YX7A 2M8GX 3NWTA 1Z0XA 3VSKA 3S17J 2R7XA 4TMWA 3VSVA 1FYKA 4CCNA 4ZYAA 3D1NI 2W1OA 1VQLI 4ZGQB 2FQ4A 2V7WA 2W48A 3GZNB 5L46A 3UW0A 3BPXA 1MNDA 2E71A 2K9QA 2AQEA 1SFEA 1HKQA 1WTHD 1SD5A 3L9FA 3BY6A 3BCDA 2FX3A 4YAOA 3CCQB 1E3XA 1KONA 2I8DA 4NC6A 3AVVA 4RAZA 2R5YA 2O6WA 1FNCA 5E18F 1ZR2A 3ZMTA 4OAYA 4AVPA 3G1OA 4S05A 3Q6QA 4YZAA 1UMQA 1UHWA 2FNPA 2VASA 5BPDA 3GSIA 3D5SC 5F6FA 2Y9YA 1ZG1A 2JN6A 1MMAA 1JE8A 1USSA 3KL9A 5EMNA 5IT9Z 4XRSA 4RLZA 4PMHA 3Q0WA 5HLGA 3OW2B 3AKZA 3ASRA 3HJEA 2OBSA 2HGCA 4YC5A 4HYEA 4B44A 2W6JA 2CO5A 4A6EA 4F91B 2JPCA 2EZLA 3AAFA 2D45A 3SEJA 2A6HF 2XC7A 4HLXA 4L9TA 1J0RA 2NVYJ 1VQMB 1OGOX 2Q6OA 4EJWA 3DP7A 3CC4I 2Z6BD 2F4IA 3IH3A 4KMUX 1FYMA 3KP4A 1QRCA 1RPWA 4C3JJ 1ON1A 1MJBA 2LC2A 3ISPA 3GLXA 3LQQA 2V6EA 3W2FA 1KTVA 3PENA 4RDLA 4XN3A 5HOOA 5CVIA 4ENJA 2DY1A 4M3DA 2HQRA 3HRMA 3TQNA 2WR8A 2A5WA 2ELHA 3HL2A 2MD0A 4ENKA 5L3FA 4WZLA 3BG6A 3M3YJ 2B63J 4HE5A 1OYIA 3KZZA 2CU7A 2HOEA 2KDOA 1SVLA 1UZCA 1ZRDA 3KETA 3HOWJ 2RC5A 3KE2A 1A8PA 1TWCJ 1A35A 4X0CA 3I53A 5BPIA 1RU4A 2BVNA 5JVGF 4LLGF 2QEXI 4XRFA 1FBQA 2K27A 3W2VA 2HPIA 5ED4A 3J7AO 3CO6C 2ZSIB 2UXNA 4UAJA 5ICGA 1QFYA 5DNSA 2ZZFA 1YI2B 4BPRA 3T5XA 5E3OA 3SYTA 1HLVA 3RYRA 1K73D 2J8KA 4N3NA 2F2EA 3P4GA 3K4BA 1HC8A 1E1RA 1IUFA 2OQGA 4RD6A 1ZM4A 2DFEA 3U1KA 3SLDA 2D3NA 1IRFA 2EH3A 2QTLA 1TT5B 1QZEA 1O3QA 1Z21A 1I3QJ 3PJRA 3K0LA 2M0MA 2JJ2A 1CLWA 2EWNA 1BW5A 3DPLC 5HXBA 4AIKA 1KCDA 1X4PA 3A02A 3A35A 3QYEA 1VQ4I 2R7QA 2VI6A 4YEJA 3CMYA 2IQ7A 1OOCA 2H1LA 2I5UA 4CQJA 4JK1X 2GQFA 2W6IA 4M9SA 4UV8A 1WSVA 3I55B 1NH3A 4Y7CA 3LFKA 1WU8A 3LYCA 1YITI 2JPBA 4D1QA 3Q39A 5GPCA 4P55A 1N08A 3OYNA 3CCSI 2F4OB 2QLZA 3JQRA 1G3YA 3GTPJ 4IPAA 1WOSA 2KVOA 3W3CA 5TV2A 2P0WA 3ABTA 3F6VA 4BQNA 1MZBA 2R7TA 2EK5A 4MR0A 2HTSA 4ZTJA 3A4CA 3I1FA 4I84A 4DJAA 3GTQJ 3WNDA 1XSXA 1VHOA 2CW0F 2E1MC 2QSFX 3SJMA 4C3HJ 1G6NA 1U3EM 2G0YA 2XHKA 2QDXA 3W2WA 1CQTA 2Y9ZA 1A04A 4XKCA 1KTWA 2NTPA 2JRTA 2XT4A 4F52A 4WF2A 3BWGA 1DU0A 1JT0A 3E7LA 2P4WA 5H6QA 5JMCB 3BR6A 1RNLA 2JSPA 3LA2A 1EH7A 3FBIB 2DERA 1IJFA 5GTIC 2E7WA 2K9NA 3KEOA 2XTYA 3MAJA 1IDJA 4P3YA 1VQ5B 2A07F 4ZJZA 3CP2A 1USTA 4GRIA 1Z7LA 2PMZN 4AIJA 4EM0B 4X0GA 1EJ9A 2VJ5A 2XGXA 3VFZA 2JDIA 3C1DA 2V7FA 2H6CA 4A69C 2DA2A 2Y75A 3KP2A 3OW7A 1Y6IA 2MC3A 3V4GA 1EA3A 1TWFJ 1P4AA 1IDZA 4FX0A 4RD2A 4PSXA 2OTJI 3D0SA 1EFUA 3U2QA 1O8FA 1SANA 4A5MA 1QGZA 1KK0A 2F5DA 3OYFA 3LAPA 4RD1A 1ONVA 4YELA 2QQAA 2L0KA 2K86A 3OE7A 1ZHFA 1OCTC 5C4JJ 3FXQA 4A0XA 2JA6J 3BG3A 3MZ8A 5DYMA 1TQIA 4WXHA 2IA1A 3CC7I 2L01A 4Q5SF 1Y8RB 1FNBA 1UD2A 3ZZTA 2X53S 5EEAA 2ZSHB 4OU0A 2JT1A 1HSJA 4GYGA 1RIOH 2B7EA 2VNJA 3HUGA 1P7IA 3WTYC 1WGXA 4FQGA 1FRQA 3ZPNA 2CGPA 4Y3OA 1RKWA 4JOMA 1JKPC 5B3SH 1QVTA 3IC7A 2Y0MA 5IYQA 1YJ9B 3PUMA 1FOWA 1W0TA 1ZAOA 4CCJA 1YJWI 2M87A 2KP6A 2XF6A 4CH7A 3P9IA 2MBFA 3OYMA 5LD2C 2IXSA 3MN2A 2DMTA 2DYRH 2ZZQA 5F4MA 1KJZA 1Y56A 1U9OA 3L2CA 1Z9CA 4QUZA 4RM3A 2FMYA 3MZHA 1A5JA 2ELJA 5FFXA 3X2QH 5DTDA 3ZCOA 5DM6F 1S0UA 2DA6A 4KA4A 2VIXA 2JA5J 3PM1A 4XM3A 3NE5B 5C1CA 3T51B 2HDDA 2Y0SN 4XLAA 3PIOF 2ZFWA 3OSFA 3Q0VA 1LQ1A 4J0QA 5DM7F 2ZZEA 2KMUA 4R8HA 3S15J 4WXCA 2R3SA 1T6YA 5GV7A 4EJUA 1U8RA 2QY1A 2XGCA 2JSCA 5DCMA 1FBUA 1W34A 1PVEA 3ZQIA 4BEHB 3ROUA 1PJ7A 4HX7A 1QVFB 2ZMEB 4M9ZA 4ZYEA 1Z7UA 4C2UA 3O6BB 3TW6A 5E79C 3HPGA 1W0UA 2PMHA 3HYIA 1P9QC 1OFMA 2BXZA 3GVKA 2YU3A 5TY0A 3CCRB 3KCCA 5B6IA 4L0ZB 1Q1HA 2DYIA 2VFMA 2JUCA 1WORA 2Y0SA 3CCVB 4IHXA 1KQ9A 1XX5A 2WA0A 2COMA 3SUCA 3HKZN 4FWTA 3LA7A 4WZEA 1XDUA 2JVGA 1H0MA 4X7FA 3U9GA 2EIXA 3G6EI 1VQ7B 3MMYB 4LLNA 1K78A 2F6CA 5H59A 4NQWB 1RESA 3V8JA 1BC8C 1OCPA 4KIFA 3V7CA 3ZMUA 1HSTA 3JRCA 1LUJB 2Z33A 2L9VA 2VFQA 3H1CA 2E1RA 3OS2A 5EGOA 3J81K 1X1CA 3BY1A 1WDTA 3RPUD 4AYBA 4HZFA 5HLIA 3ZN0A 3CB4A 4L9VA 1OCOH 1EFRA 3MKLA 2MH9A 2OZ6A 3H3VK 4B09A 6PAXA 3OMYA 4MEXF 2LY2A 2P8TA 3HRSA 4IRGA 4U7DA 3IUOA 2FBHA 2VNHA 4X05A 3HB9A 1ENHA 4E7JA 2F1LA 3GFMA 2CQ7A 1Y8QB 2QYOA 2VXZA 3KEQA 2VC0A 4HF1A 2LG4A 3PETA 2PN6A 1XN7A 5LHHA 4RM2A 2LBFB 1I8DA 3WNBA 3JAMZ 2XB0X 2DK5A 2QVOA 2H8RA 2VBZA 5J4YA 1QFJA 4DGWB 4ZH4F 3C2BA 4IQ4A 1E3OC 3VR6A 3HSFA 2N8GA 3Q5FA 2HZTA 2W82A 2XAHA 3OOUA 4E7ZA 1YS7A 1JGGA 2E5NA 5EEHA 4ZYDA 3MKWB 1F36A 2XV4S 2ZXIA 3AFHA 1W5TA 1OB0A 1B9NA 2LMDA 2PECA 5A89A 2ZL7A 5B1AH 3P9KA 3DBLB 5JFRA 2QE7A 3R61A 3VSLA 4HG2A 3SQVA 2PMZA 3KP6A 2RV8A 5CLSA 5TGTA 1H42A 1BA5A 3DQVC 2X0KA 3ZQCA 1QVGB 4W8SA 2R5YB 3HRTA 2K02A 1D2EA 1YITB 1R5HA 3TMOA 1FP2A 1OKRA 2EFWA 1R5OA 3HOZJ 1YIJB 3OS0A 1BC7C 2OK8A 3BQYA 3QFTA 1TL8A 4G1BA 2OTLB 4UVBA 2XRLA 3LAJA 2R0QC 4Z4YA 2IGNA 4H4KC 3L2QA 1E62A 2PI0A 4IRHA 5AIQA 2Q6LA 3WTSC 4QFMA 1DG1G 1BI1A 1X58A 3M1CA 1M1EB 5KAFC 2KZGA 5FRMA 2BZTA 4I01A 1NB9A 1LVAA 4E7HA 3F0CA 4G7OF 2XGJA 1BOAA 1QHHD 2DTZA 2OD5A 2ZXHA 1N0UA 4EMSA 2L7ZA 4A3DJ 5FNZA 3DPTA 2EINH 1VF9A 2WADA 4FTHA 1OQYA 3OPOA 1N05A 2Y69H 3S32A 2DLLA 1U2WA 2HR3A 1ITYA 1OYYA 3NWSA 3LQEA 2D1VA 1SAUA 5FD6A 5J1RA 3OS1A 5L3EA 3J7ZI 1V5VA 3WGHA 3Q9SA 4W8RA 2XSJC 2P7CB 2VXDA 1SVMA 5E1XA 3L7WA 3MKZA 3WGGA 4DNTB 3IKTA 5LRRA 2FD5A 3DU5A 1T0FA 2Q6KA 4BE1A 5A2QZ 2LY1A 1IN5A 2ACJA 3W6VA 1G8XA 5THXA 4XN0A 3N90A 2GXBA 4A0YA 1UD5A 2P6SA 2QZ8A 1SFKA 3BCFA 1MH3A 2DOFA 2BM1A 1MIJA 2PG4A 4PGOA 3P27A 5BQTA 3RI4A 2WZPP 4EW9A 2DFFA 3B82A 5K5OA 3IWFA 4LITA 4M53A 2GOMA 3K2ZA 3NARA 5AMVA 1UMKA 4OPSA 5DV5A 4AYBN 4OWRB 1ZM2A 4II3A 5FGMA 1WH5A 3B78A 1I1SA 5J6XA 2VE8A 5IP7J 3QU6A 2YWGA 4HNUA 4ACBA 3OWTA 2CV2A 5BOXA 2XZLA 1R1UA 3ZBTA 1IRGA 1BBYA 1Q86D 1GV5A 4G7WA 2CYYA 1OLTA 2HNHA 1G7RA 3BROA 4W8QA 5K7HA 4YALA 3ZC3A 5D6EA 1ETOA 1E3HA 4MEYF 4WWCA 1VQ9I 2M4KA 1TWGJ 2M30A 3QPTA 1FDRA 2DK8A 1UFMA 1Z3YA 2QKMB 3PFIA 3RZOJ 2STWA 3H92A 4CDGA 1KD1D 1FY7A 3R6SA 2ZNYA 1K28D 1S4MA 5LRSA 3OY9A 4X06A 3GTJJ 3EDPA 3CF2A 4BXXJ 3B8YA 2QQBA 3HGYA 3JRAA 2L02A 4RGRA 2JVHA 2HEOA 1V0EA 1VQPI 2BGJA 3GCMA 1JT6A 2NOJB 3VOEA 2KFDA 2DPUA 3LSMA 1ZG5A 1Q81D 4ZV4A 2DODA 3L09A 2R7FA 2OA4A 3C18A 1GUUA 2QM3A 3OP1A 3HXLA 4BJ6C 4P25A 4XOTA 4E0FA 4I09A 2AXTC 1IRZA 1H85A 2F3LA 3WTXC 4O3MA 1JKRC 3BG5A 2VONA 3PL8A 2M1BA 3HSEA 4M3EA 2BY1A 5E3MA 2R4GA 1DABA 4II2A 1SKYB 1T0FC 5CPRB 3WTVC 3GX4X 3NQOA 3RIQA 2IA0A 1NBMA 2C4TA 4KKSA 2DFHA 1F5TA 4OIOF 1EH6A 5FFZA 1FPQA 4X07A 5J35A 1O8JA 4CCKA 3K9TA 1YW7A 1IN6A 4TN1A 1XMXA 2HI3A 2OU2A 2ZCWA 1WI3A 2RNJA 1O8DA 1WJCA 1EH8A 4EJVA 1R00A 3DLLF 1XG1A 2ZITA 2VBKA 3TW7A 1VLOA 2NS0A 3WU2C 2CQXA 3RQ4A 2X48A 2PJRB 1VQ9B 3CMEI 2EWEA 1FNDA 1RQRA 2KQRA 4KT5C 1X3WB 2BGCA 5EDNA 2GM4A 3FY3A 1V55H 4ZZLA 1FIAA 1O7LA 3CDIA 1MBKA 3H3ZA 4M3FA 3ZQFA 1JJ8C 2CUFA 1SAXA 5J3OA 3AG4H 2QN6A 1N0VC 1D0ZA 3HDDA 1XGSA 4KKUA 2IS2A 1R5BA 1H80A 3GZ6A 1ZELA 1QZZA 1XMKA 3H3UA 1TSPA 3IV5A 1T33A 1NK2P 3JU4A 5D6FA 1AU7A 1EZGA 1LB2A 1TUIA 1VQKB 1N75A 1UELB 2QTZA 4I99C 1F60A 2HQAA 3F8CA 2C6YA 4B47A 1E43A 1UG0A 3RJPA 4MTEA 3ELKA 5GV8A 2VQLA 3RYPA 2KIFA 1E64A 4Y33A 3O8GA 2AS5F 1BX1A 2RKHA 3KP5A 1SKQA 2OJED 3LSHA 5E20A 3S1NJ 4ZGNB 3MCAA 2EFQA 1B2RA 3BY2A 4M71A 4KN4X 4PAAA 4CCMA 2DJNA 2WV0A 1AWCA 2E2JJ 1TTTA 2V9VA 2ZB9A 3ZMZA 1QNTA 3LMMA 2F5CA 2K3PA 3MFKA 4EJTA 2O17A 3A1YA 3BJ6A 1C0WA 2RNGA 3I5UA 5J47A 2TRTA 1E3ZA 2PMUA 2CWEA 5DCMB 3EETA 1HF2A 1ACIA 2XVCA 3GTOJ 1YQAA 3SYJA 3F8BA 4E7SA 3A1PA 4TSFA 4JBAA 4EGYA 1WSUA 1Y39A 1DDIA 4L9JA 3AVYA 1OJLA 1HZEA 2Y31A 4IL6C 2OAZA 2RQQA 3PA1A 4Z4VA 2L9RA 1T2KA 1DARA 1APLC 3GQBA 3R6JA 5FIUA 1O7FA 1XC5A 4B48A 2DDBA 1P4XA 1L3LA 2TDXA 3ZMDA 2QWWA 4AIHA 1FMWA 1YIJI 4D0PA 4XRMA 3IWZA 2QSGX 4TMXA 5AONA 2ZL5A 3FKJA 1VQKI 3ABLH 4L5IA 1GQ8A 2BM4A 2BYVE 2RC6A 5HZBA 3E6CC 2JRMA 3EYYA 1IDYA 2DFIA 2CC2A 4ZCMA 3BR3A 1F43A 3C3WA 5M3MJ 5M5YJ 1S72I 3QQAA 4E70A 4M74A 2NVQJ 4ZDLA 2G7HA 3LSRA 2H1KA 2L3DA 3G71I 2E34A 2KISA 2VN2A 4GGGA 4IW3B 3J7YJ 4YFOA 1V0FA 1E3PA 3FXJA 2MH2A 5ICFA 4HSTA 1KQ8A 1IHMA 1TQPA 2HDWA 4NUBA 3BR5A 3RKYA 5F27A 2Z9OA 3K4LA 3BOQA 3P26A 2KDZA 3BPVA 3C2HA 2WAEA 2VE9A 4OOSA 4XLNF 2RDPA 4MGRA 1O8LA 4DZPA 3A2KA 2HXOA 3KPHA 4C0SA 3GQAA 2LP0A 1K8AD 3QPSA 1MMDA 1AKHA 4ZYGA 4RCZA 4WWVA 1G7CA 1YLOA 4ACAA 3CJNA 3ZXSA 3FM5A 4KFCA 2W4SA 2HVQA 1W36D 2NS8A 5HVQC 4U4BA 4L18B 3LMWA 2FJ1A 2K9LA 1OISA 3ZRGA 3ASOH 5J1YA 2VBUA 1KQ5A 4B1RA 5ICCA 4YIFA 2DT5A 3FXRA 1MBJA 5K1YA 2QMUA 4OPWA 2LK2A 3CMAI 3I54A 4P9SA 4IEJA 2GJKA 2JQ7A 2E60A 3U6KA 4W8TA 3GVJA 1B1BA 1RC9A 3L2UA 3B02A 4E7KA 3OJXA 3DCFA 3GVLA 2BX6A 2R93J 4DW6A 1IZ1A 2CH0A 1BJKA 1IB4A 1U2RA 2GJPA 1KU9A 1JTXA 1STZA 4P22A 2O03A 1KA8A 5CVRA 1KQ0A 3AG3H 1UD6A 3R0AA 2BHZA 1KU3A 4P1VA 1YW9A 4LLLA 2WC2A 3BT9A 2YUSA 4RGUA 2V6CA 4MLOA 2RN7A 2EIJH 5DUIA 2V7UA 1P4WA 1RR7A 3SZGA 1FTZA 4NHJA 3BR0A 1VQOI 4M6VA 1UAAA 4Q7JB 3S1QJ 4M2LA 4B3AA 5FB2A 2EIKH 3QAHA 1JTYA 4Y52J 4QHYA 1NJID 3R6KA 5LBQA 1IXRC 1I6HJ 1EP2B 1SD7A 1FBSA 3VSUA 3I0TA 1EP3B 3WG7H 3B4NA 2AXLA 3W5UA 4IF4A 3V76A 3ASPA 1FWZA 2DAOA 4BL0B 4DBQA 1T38A 3BLYA 2ZJPF 3VWBA 4KIGA 2VUMJ 2R6HA 4A6DA 2PMDA 2IGMA 4D7MA 2Z3YA 4D5FA 3JR9A 4B3FX 1GV2A 3Q3SA 1PP7U 2BN4A 4YXWA 2NTQA 5KVRA 2VL8A 1OMIA 2DDAA 5EEGA 4C2MJ 4IKFA 5HKKA 2EPFA 3DLAA 5FKMA 3CESA 3W2AA 4D9JA 3U21A 3H0DA 5GPAA 1IXCA 1MBFA 1S6LA 1AOYA 1FRNA 4Z4SA 1WHUA 1H89C 2HDCA 1OFEA 2VYQA 1WQ2A 1WSRA 2HKXA 1FNNA 1BHEA 2E2HJ 3J81Z 1TBXA 4RDUA 2AHQA 5EF6A 5CVVA 2IS6A 1KU7A 1U5TB 2DA4A 4BYYA 1UD3A 3KEWA 2EV6A 3OR2C 3ZQGA 1REPC 4HE6A 3LQRA 4KITB 5IPAA 1X1DA 2FXAA 2YU9J 3WQZA 2OUMA 4CA0A 2E1CA 4G5GA 2C4UA 4L8JA 2VFOA 2JA2A 3AVUA 2ID3A 3GTLJ 1OB5A 1IRXA 3BJOA 2CQQA 3E3VA 1BN5A 2M45A 2V4JC 1V5FA 3VMWA 2QGGA 2QUFA 1IDKA 1YHQI 5A8AA 1WVRA 3H5RA 4K1XA 4UB6C
chains in the Genus database with same CATH topology
1PYVA 3BCAA 1WJDA 4BJTA 2QY1A 3H9QA 1PE9A 4XLEA 2L7KA 1YX3A 4XLCA 1DP3A 4BEHB 3FPPA 4E7LA 2X1CA 5DN6A 3DDYA 4AU7A 4C2UA 4XKVA 3HPGA 4OJOA 1KCDA 3HG9A 1MMGA 1P9QC 1DGRM 1BR4A 4RLFA 1KMHA 4B3GA 1OFMA 5CDFA 4N4NB 1W0JA 3GVKA 3VYSB 2HU9A 3KEYA 3N05A 1GLNA 3ZGKA 3B90A 4KJZA 3FBNB 2A6TA 2Y0SA 2Z1DA 4XL9A 2CV0A 4PK4A 2CW7A 2WA0A 3SUCA 4BU2A 4HPQA 2JVGA 2ZTNA 2LH9A 2V9KA 3MMYB 4F92B 3L2RA 1NG7A 2Z16A 2O0VA 2HVRA 2F6CA 4NQWB 1UD8A 3CMMA 3LSKA 4C9YA 4BDYA 2NTBA 4PJLA 4XONA 4RMNA 1PJRA 3S3MA 3K4CA 2R7UA 1BMFA 4BQOA 1OR7C 1VLYA 2VJ4A 2LREA 4F55A 2O1DA 3OS2A 1T95A 2BVLA 4U7BA 1X1CA 4Z05A 2R7SA 4BJ5C 2MABA 3RPUD 3I9V2 4AYBA 2XF7A 4XKWA 1EFRA 4CSWA 1X0CA 3G2BA 4XKBA 5C1EA 2VQGA 2X51A 4BE0A 3K4MA 3K6GA 3OMYA 4XMYA 2LY2A 4HNTA 3IUOA 4E7JA 2KL4A 1PKVA 2D3LA 2L9SA 3CJRB 2MC4A 2DCEA 2X6WA 3LL7A 4XOPA 2VXZA 2DT7B 2LG4A 2LYCA 1I8DA 4RM2A 2LBFB 2MYSA 3BCBA 4XR6A 2VB6A 3IP4B 4P5OA 3T53B 2KLOA 3HOSA 1BR1A 4DGWB 4Z1MA 3VR6A 4IQ4A 3LNNA 2VKDA 4PJJA 4CUGA 2W82A 3OOUA 1W0KA 4E7ZA 2CFOA 2E5NA 1N78A 1O8IA 2NSPA 3MKWB 3AFHA 2PECA 2ZXIA 1OB0A 3QOEA 3EUAA 3GQ8A 1LKXA 2UVEA 2QE7A 3VSLA 4HG2A 3SDBA 3UNGC 2PMZA 1COWA 3IAM2 5TGTA 3C2GA 4N4OB 3DQVC 1X1AA 1K5CA 4W8SA 2V7QA 2NZMA 2WY8Q 3TMOA 4FASD 3OYGA 3OS0A 4R79A 3OYLA 2QXZA 2KPMA 4B43A 2V31A 2KHMA 3CZ6A 2M5SA 1O8GA 2IGNA 4H4KC 3L2QA 1BOBA 4XNFA 3M1CA 3HC7A 5FROA 5FRMA 2V4DA 2DT6A 1WPCA 4Y4RA 4IQJA 4YZQA 4E7HA 2XGJA 4U87A 2BW3A 1QHHD 2ZXHA 3H9JA 3KX2A 3OOCA 3DPTA 2WADA 3BG7A 4IZZA 3OPOA 2WPDA 4F3QA 3S32A 2GJRA 2F1MA 3PNTA 4FXUA 3NWSA 1SAUA 3OS1A 4C2LA 4W8RA 2XSJC 2MFZA 3OYBA 4HWVA 3WWGA 3DU6A 2VXDA 3GBGA 4XQFA 1NHCA 3OYAA 2DXIA 3S93A 3MKZA 4DNTB 3M8JA 1O8HA 3DTKA 1WJEA 3DU5A 4BE1A 1KCCA 2LY1A 3BC8A 2UWMA 1G8XA 4BS9A 4XN0A 2W00A 2WSSA 1UD5A 4CCOA 1N77A 1WP6A 1JTAA 3JURA 1SFKA 3A3BA 2L9NA 3H9GA 3OIPA 3BCFA 4NNJA 1H8EA 1K6YA 4PJNA 2WZPP 4EW9A 2HVSA 3EUKL 3K4JA 4HRIA 4TT3A 3MKYB 1DBOA 4LITA 2GOMA 1X1BA 3HUGB 5FRNA 5AMVA 1V5EA 2O04A 4OWRB 4DK0A 4II3A 5KNLA 1RWRA 4EATA 2KRHA 3QODA 1HVXA 4TKOB 2Z8GA 4XD7A 3BC9A 2DIEA 4BUPA 2LRDA 1E1QA 3CP8A 1G59A 4HNUA 1WJAA 1YX5A 4DBRA 3OWTA 1V5GA 3S3OA 4ZTFA 4PJMA 2CV2A 1HA8A 2XZLA 2V26A 2O0WA 4YRVA 1PLUA 4G7WA 4RLQA 2F43A 1OLTA 2HNHA 4W8QA 3ZQQA 4HEA2 2DOAA 3PSIA 2HLDA 2VBEA 5IK2A 3ZIAA 3KYLA 2X1EA 2Z2SB 3PUBA 3HKZA 2M4KA 1KZLA 1I18A 1Z3YA 2QKMB 3FKSA 3GQ9A 2R9VA 4XLHA 3D5RC 1X4OA 1AIRA 3OL3A 3MD2A 3UR3C 2BOLA 2NSTA 1K28D 4BQQA 3HAGA 3OY9A 1R6RA 3T56B 4IX7A 2M4GA 3CF2A 2XNDA 1D0YA 3PNVA 3B8YA 4MXNA 2JVHA 4QPQA 4XLFA 1V0EA 4Z03A 4NC8A 2NOJB 3DKXA 3PNYA 1OGMX 4OAZA 3LSMA 1O8MA 4BEHA 1QHGA 2HZDA 3OR1C 1E0EA 3HXLA 3LSGA 4BJ6C 2LOOA 4QPOA 4XOTA 4E6KG 2W7NA 5KHDA 1DQUA 2OC6A 2ZFUA 3F9KA 3OIQA 3QYFA 1E79A 4HIZA 3VYRB 3HPHA 3PL8A 4NC7A 2CW8A 2R4GA 2VPLA 4II2A 1SKYB 2IGOA 3OEEA 2L2OA 4XORA 1T0FC 3I3LA 2K9MA 5CPRB 2HPMA 4U49A 2X8KA 4J00A 3ZSCA 1YE9A 1T5EA 2VBMA 1NBMA 4KKSA 3VMVA 3VSTA 2E1MB 4OZYA 4JMQA 1O8JA 4CZCA 3T9GA 2X6XA 3H5NA 4CCKA 1D0XA 3PSFA 3OFNA 1MMNA 4DNRB 1BN8A 2LBFA 1O8DA 4DK1A 1WJCA 1O8EA 2VBKA 2X6YA 3NWTA 3ONQA 3VSKA 1MNEA 2R7XA 2PYHA 4OJPA 3RQ4A 3VSVA 4CCNA 4ZYAA 2PJRB 2W1OA 1BR2A 2CUZA 2EWEA 3UW0A 3TL4X 1WFXA 1MNDA 2KQRA 3RTRA 2AQEA 1D1AA 1WTHD 3FY3A 4KT6A 3LFUA 3L2WA 1QCXA 5FL7A 1S9HA 3BCDA 4KKUA 1D0ZA 2L5QA 2M3AA 2IS2A 1E3XA 1H80A 1KONA 2I8DA 1ZELA 4C2TA 2E1BA 3JU4A 4E7IA 3K70C 1WJFA 2VQCA 4BDZA 1N75A 1UELB 4OAYA 4ANJA 4YZAA 3H5AA 2HQAA 4PUSA 2JUGA 4B47A 1E43A 2PYGA 1UG0A 2VASA 3OL4A 2IS4A 3GQ7A 3D5SC 2VQLA 2LZJA 4Y33A 3SEQA 1MMAA 3HOTA 4F93B 3J7AY 2ZZGA 2NT9A 3LSHA 2DJIA 2R7OA 3OYKA 1EE6A 1LDKB 3KRGA 4PMHA 2M7BA 4CCMA 3D5LA 1ERDA 2R7VA 2IGKA 3AKZA 3LMMA 2WBMA 2K3PA 4HSRA 4B44A 4J01A 3A1YA 2W6JA 2O17A 3K70D 2RNGA 4PFPA 1E3ZA 4U4BA 4F91B 2WY7Q 1MW7A 2XC7A 3OYIA 2E5ZA 1OGOX 2KRCA 4E7SA 2Q1ZB 3RSNA 2Z6BD 2F4IA 4TSFA 3K4NA 2RREA 4CCLA 2LC2A 5CKTA 1HZEA 1XG2A 5HLTA 3OAAA 1O8KA 4OJLA 2CS3A 2V6EA 1JRGA 2RQQA 2WAQA 4XN3A 5HOOA 4PFOA 1J09A 3GQBA 2IS1A 4URRA 2A5WA 3G05A 4NK6A 2QKLB 1TZLA 4FETA 4PSWA 4B48A 2MD0A 3HL2A 2WJYA 3BG6A 3GRHA 3S8PA 5HNHA 2KDOA 1FMWA 4JQFA 4BE2A 1AA7A 3OYDA 4P1WA 2O5RA 1W9XA 1NG6A 2BSPA 3TBIA 3OYHA 2XF5A 4G6TB 3ZR8X 1RU4A 3FKJA 1GQ8A 4DOZA 3S3NA 1VF7A 1HG8A 3W2VA 2HPIA 4OJ6A 2UV1A 2ZSIB 3H35A 2ZZFA 2INUA 1TT0A 3SYTA 2XDVA 4E4HA 5CQGA 3K4BA 1E1RA 4ZDLA 4KISA 3ZPPA 3DPUA 2AQFA 2D3NA 1CZFA 3PJRA 1Z21A 1UD4A 1V0FA 2M0MA 2JJ2A 1OHHA 3DPLC 4HSTA 1X4PA 2HDWA 4NUBA 3A35A 3QYEA 1JI8A 4LIVA 2R7QA 4YEJA 2IQ7A 1OOCA 3K4LA 3DEEA 2M7AA 5LFAA 2W6IA 3IAS2 4BXFA 2JJ1A 3C2HA 2WAEA 2CV1A 1Z3XA 1O8LA 1FX0A 3E1SA 3DTEA 1D1CA 2XZPA 1DBGA 4D1QA 3A2KA 3GQAA 3OYNA 2OV7A 2VKHA 3FDYA 1MMDA 3AL0B 1LVKA 2UVFA 2KVOA 3W3CA 3ZXSA 2P0WA 4BQNA 2R7TA 1FMVA 2JIZA 2W4SA 2HVQA 1W36D 4ZDPA 5HVQC 2XZOA 4ZTJA 4MR0A 3A4CA 5KCMA 3V42A 4DJAA 2K9LA 3K4KA 1PXZA 3LMWA 3ZRGA 2INVA 1NRKA 4I84A 4NK8A 2E1MC 1MABA 2VLAA 3EPZA 4G6IA 1WJBA 2ODLA 1WMRA 3BH4A 3DTIA 3W2WA 1KTWA 4XKCA 2GJKA 2NTPA 2E60A 4F52A 4W8TA 3EUHC 3GVJA 5JHFA 2UUZA 2ZTGA 2BVMA 2X85A 4AVZA 3OYEA 3L2UA 4E7KA 3GVLA 2VJJA 2V1NA 4E0FA 1X19A 1IB4A 2CH0A 4DIQA 4ITVA 1U0JA 2JSPA 2GJPA 3FBIB 4P22A 3VYTB 2WB1A 1UD6A 2X1DA 1IDJA 2CUJA 1OFLA 2BW3B 3QYBA 1LFPA 3CJQB 3CP2A 4GRIA 4ZJZA 1Z7LA 3H94A 4X0GA 3OYCA 4OZZA 4MLOA 3EQNA 2VJ5A 2JDIA 3DWLE 3FHNA 3A3GA 4KKTA 2V7FA 3SZGA 4B3XA 3OW7A 1UAAA 1Y6IA 1EA3A 2R7RA 4PSXA 3VYUB 1O8FA 2QX3A 1W36C 1VBLA 2FUG2 4OJ5A 3OYFA 4YZXA 1QU3A 4YELA 3VSUA 3SEZA 3OE7A 3B4NA 2NT6A 4GQNA 4Z06A 4LIUA 2GK6A 4DBQA 2XAUA 4BL0B 3VWBA 3BLYA 1UD2A 3EQOA 1IA5A 1QJVA 2IGMA 3LSIA 2X53S 2GOXB 2WJVA 4B3FX 2R7WA 2CMPA 3VDXA 2ZSHB 4YXWA 2F5VA 2NTQA 3DKYA 3OYJA 2VL8A 4IKFA 3OEHA 5HKKA 3DLAA 2PJRA 3CESA 3W2AA 4D9JA 3L2VA 3ZPNA 3U21A 3H0DA 4Y3OA 4JOMA 4ASUA 3RCOA 3PFYA 3E0JB 5CQEA 1BLIA 1BHEA 2VQHA 4CCJA 2XF6A 2KP6A 4ZDOA 5HNFA 4CH7A 2IS6A 2CK3A 2GK7A 3OYMA 3AL0C 4UZUA 5LD2C 2IXSA 1VJSA 2XOKA 2ZZQA 1UD3A 4LG3A 3KEWA 3OR2C 4G7XA 2K5CA 1WJ5A 4KITB 1Y56A 1X1DA 4RM3A 1DGWY 3WQZA 2OUMA 2KZVA 4CA0A 4BACA 4YZ0A 1H8HA 4L8JA 2ELJA 2X3HA 2JA2A 2WAFA 1IRXA 4ZC3A 3ZCOA 4BGDA 1BPLA 2V4JC 2VIXA 1V5FA 1VZ0A 3K10A 1RMGA 4XM3A 3NE5B 3VMWA 1D1BA 2Q2EB 3T51B 5C1CA 4XLAA 4C30A 1IDKA 1O88A 2VJIA 2ZZEA 2KMUA 3H5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQA A;  3VSV A;  2QY1 A;  2EWE A;  1PE9 A;  4XLE A;  3UW0 A;  2UVF A;  4XLC A;  3FY3 A;  4MR0 A;  4U4B A;  1QCX A;  3LMW A;  4I84 A;  4NK8 A;  4XKV A;  1PXZ A;  2INV A;  2X6Y A;  4C2L A;  4OJO A;  4W8R A;  1KCD A;  4HWV A;  3WWG A;  1H80 A;  4XQF A;  1OFM A;  1NHC A;  2ODL A;  1WMR A;  1O8H A;  1KTW A;  2NTP A;  3B90 A;  4XL9 A;  4W8T A;  1KCC A;  4YZA A;  3GQ7 A;  2X85 A;  4AVZ A;  2PYG A;  4XN0 A;  2VJJ A;  1JTA A;  3JUR A;  3SUC A;  1IB4 A;  2NT9 A;  1EE6 A;  4EW9 A;  3KRG A;  1DBO A;  4PMH A;  2O0V A;  5AMV A;  1IDJ A;  1OFL A;  2O04 A;  2NTB A;  2O17 A;  2PYH A;  1RWR A;  4XON A;  4OZZ A;  3EQN A;  2Z8G A;  2O1D A;  1OGO X;  4Z05 A;  2O0W A;  1O8F A;  2QX3 A;  1PLU A;  1VBL A;  4OJ5 A;  4XKW A;  1XG2 A;  4W8Q A;  4OJL A;  4YZX A;  1O8K A;  1X0C A;  4YEL A;  1JRG A;  5C1E A;  3VSU A;  2VBE A;  4XN3 A;  4XMY A;  3B4N A;  2NT6 A;  4URR A;  4NK6 A;  4Z06 A;  1IA5 A;  2X6W A;  3EQO A;  3GRH A;  4XOP A;  3GQ9 A;  1AIR A;  4XLH A;  1QJV A;  2NST A;  4XR6 A;  2NTQ A;  3B8Y A;  2BSP A;  4MXN A;  4XLF A;  1RU4 A;  4Z03 A;  1GQ8 A;  1OGM X;  1HG8 A;  1O8M A;  1O8I A;  4OJ6 A;  2NSP A;  2PEC A;  3GQ8 A;  4XOT A;  2INU A;  1BHE A;  1K5C A;  2UVE A;  3ZPP A;  4W8S A;  4XOR A;  4U49 A;  3ZSC A;  2NZM A;  1CZF A;  2VBM A;  2QXZ A;  4YZ0 A;  3VMV A;  3VST A;  2X3H A;  1O8G A;  4OZY A;  1O8J A;  3T9G A;  4YEJ A;  2IQ7 A;  2X6X A;  1RMG A;  1OOC A;  3VMW A;  4XM3 A;  5C1C A;  1BN8 A;  1O8D A;  4XLA A;  1IDK A;  1O8E A;  4XNF A;  1O88 A;  2VJI A;  1O8L A;  2VBK A;  4YZQ A;  1DBG A;  4OJP A; 
#chains in the Genus database with same CATH topology
 4OPO A;  3OZW A;  3BCA A;  4ABZ A;  3M9A A;  2HDN B;  3VNU A;  2GWR A;  4BJT A;  3ML6 A;  3GEZ A;  3H9Q A;  4XLE A;  3TDZ C;  2WYR A;  1YJN I;  2G9W A;  2MW8 A;  5L3D A;  4XLC A;  4WCG A;  3D26 A;  2X1C A;  4HLY A;  1O57 A;  5JLX A;  1UB9 A;  5ILU A;  3JRD A;  1SFU A;  1E2X A;  1HQC A;  4Y17 A;  1B72 B;  1I1G A;  4RLF A;  1KMH A;  1DGR M;  1BR4 A;  1O3T A;  4B3G A;  1H9G A;  4N4N B;  3CCM B;  3LA3 A;  5IYN A;  1VQL B;  4WQM A;  4OOI A;  2C2W A;  4HOB A;  3KEY A;  3B90 A;  3FBN B;  2Z1D A;  2CV0 A;  1XGN A;  1R58 A;  1TTY A;  4PK4 A;  3J80 K;  2O3F A;  3M8F A;  3MVP A;  2Q8K A;  1RQP A;  4BU2 A;  4ON0 A;  5GAG J;  1QGA A;  4RJL A;  4LFU A;  1S7A A;  2V9K A;  2QQ9 A;  1I27 A;  1NG7 A;  2Z16 A;  4NDL A;  2HVR A;  1R5I D;  4EJO A;  3OSG A;  4N3G A;  3RY8 A;  3LSK A;  1T8I A;  4BDY A;  5JHU A;  4XON A;  4RMN A;  5ICE A;  2R7U A;  4F7D A;  2DMP A;  4G7Z F;  2VJ4 A;  3M8E A;  3CME B;  2VBT A;  2NNY A;  1T95 A;  4XBF A;  1BI3 A;  1X2N A;  3ZZU A;  4G6Q A;  2ZJ2 A;  4ASN A;  4KYW A;  3ASN H;  1Z91 A;  2P5L C;  1WH7 A;  2WTE A;  3GTK J;  3AGP A;  4LBV A;  1W4M A;  5JR3 A;  3G2B A;  4XKB A;  5KK1 A;  1H88 C;  2X51 A;  4Y7N J;  5C1E A;  2NVT J;  4XIC A;  5F4O A;  1JHF A;  3GW2 A;  3QPL A;  2P7V B;  4XMY A;  3NB2 A;  2O6G E;  4HNT A;  1DDN A;  1ORK A;  2KL4 A;  3MEX A;  2D3L A;  3CJR B;  1U78 A;  4AWX B;  2V9P A;  1IJW C;  3JSP A;  3F8M A;  3SLN A;  3J80 Z;  4I0A A;  3AST A;  4DQL A;  2KIU A;  1P4M A;  2VB6 A;  1VI0 A;  4P5O A;  3T53 B;  4LK1 F;  1W5S A;  2HQN A;  2VBW A;  1RZ4 A;  1S29 A;  3TOB A;  2NPF A;  1ZRF A;  4BQA A;  3TO6 A;  3LNN A;  3LVB A;  3W2H A;  1TLL A;  3GTM J;  2BM5 A;  2V79 A;  1S8N A;  2GLO A;  1N78 A;  1IF1 A;  4Z4R A;  4KIC A;  1LKX A;  1T6Z A;  3CLO A;  2H94 A;  2O9L A;  3SZT A;  2XPW A;  4GCV A;  3CCY A;  3SDB A;  3UNG C;  3IAM 2;  3KP7 A;  1BIA A;  2XEX A;  1JUS A;  4N4O B;  1TYX A;  1VTN C;  3C7J A;  3RDI A;  4UVA A;  1LFU P;  2V7Q A;  3TGN A;  2KRF A;  2WY8 Q;  3WGI A;  4UB8 C;  4R79 A;  1TW2 A;  2KPM A;  3WHC A;  3SJZ A;  2EA2 A;  3CZ6 A;  2M5S A;  2A6E F;  4RM0 A;  3R4K A;  1IJE A;  4OIQ F;  1JJ2 B;  3HIF A;  1D5V A;  1BJA A;  1F20 A;  2ISZ A;  1D8K A;  5M5W J;  3HC7 A;  1UHS A;  2DMQ A;  1QRY A;  2DT6 A;  2NOG A;  4Y4R A;  2L7F P;  2P5K A;  2LF8 A;  3PUF A;  1I39 A;  4P9U A;  1MNM C;  4U87 A;  3W5H A;  1S7O A;  3R60 A;  3U1D A;  3S1R J;  1R71 A;  1SFO J;  3H9J A;  3M4O J;  4P26 A;  3VO1 A;  1J7K A;  3OOC A;  3DXJ F;  4M3B A;  5K7Z A;  3B8H A;  4B4C A;  5C44 J;  2F1M A;  3PNT A;  1DDG A;  4FXU A;  3JX8 A;  1QA3 A;  3CDH A;  2G0E A;  1WKM A;  3AG1 H;  3FX3 A;  4RAG A;  1MMS A;  3OYB A;  2DCU A;  3DU6 A;  4XQF A;  3GBG A;  4WZT A;  4Y9U A;  4U88 A;  2VC1 A;  3HRU A;  3OYA A;  5J3L A;  1D3Y A;  3M8J A;  2JA8 J;  2LF7 A;  1O8H A;  3DTK A;  4G7H F;  4U9U A;  2IAI A;  2V7V A;  3CJT B;  3ZPP A;  5JBQ A;  4BS9 A;  3VB2 A;  1WP6 A;  3JUR A;  4L0Y B;  4A3E J;  4HF0 A;  3H9G A;  3OIP A;  3A3B A;  5FO1 A;  2FRH A;  5K7F A;  4HX4 A;  1K6Y A;  2H27 A;  2MLG A;  3BH7 B;  2HVS A;  3A0H C;  5FLV A;  2EIL H;  2ID6 A;  3HUG B;  1VQ8 I;  5FRN A;  2O04 A;  3HHH A;  4R1H A;  2DEU A;  1W7P A;  2QBY A;  1RWR A;  5KNL A;  4EGZ A;  2KRH A;  3BP8 A;  4L5J A;  1W1W E;  1I6X A;  2DIE A;  1MBH A;  3WTU C;  3BTC A;  2VOD A;  3N6Z A;  3WBJ A;  3NAW A;  1G59 A;  2Y30 A;  4OMZ A;  2D1H A;  3OZU A;  3O3K A;  3S3O A;  1HA8 A;  2QEX B;  4YRV A;  3WBK A;  3RKW A;  1ETQ A;  4RLQ A;  1D8J A;  1RRJ A;  3ZQQ A;  1R5G A;  2XNJ A;  2E19 A;  2XRN A;  3KYC B;  4HEA 2;  2JN9 A;  3DEW A;  1B23 P;  3Q0U A;  5H6R A;  1J9I A;  5H20 A;  3CQZ J;  2LD5 A;  2X1E A;  3PUB A;  5BSY A;  2OCE A;  3HKZ A;  3E1Y E;  4YFN F;  3K1N A;  4HBL A;  3SDG A;  2PX9 A;  3QFR A;  3GQ9 A;  3D5R C;  4QTR A;  1ZUN B;  2BOL A;  4M6Y A;  2BEO A;  2FML A;  4P96 A;  4BQQ A;  3T56 B;  2GRE A;  2M4G A;  5D4S A;  2XND A;  3GYH X;  1QPI A;  3GUD A;  1VND A;  4G1V A;  3F23 A;  2ZBK A;  1KYW A;  3DKX A;  3PNY A;  4EVI A;  4EM2 A;  4IOC F;  1O8M A;  1XB4 A;  2HZD A;  2ECC A;  5BNG A;  3OR1 C;  3LSG A;  2W7N A;  3B6C A;  2DQL A;  5KHD A;  3OIQ A;  1MDM A;  5H5J A;  3V7A A;  3HPH A;  4NC7 A;  2HMA A;  4U0W A;  4QIW N;  3N97 A;  4O6J A;  1OGI A;  3OEE A;  4XOR A;  2HPM A;  1MSF C;  4U49 A;  3A01 A;  3IL2 A;  4J00 A;  1QPM A;  5EZH A;  2HTJ A;  1RET A;  1SD4 A;  2GA1 A;  4MFD A;  5JLW A;  1T5E A;  1D1N A;  2VBM A;  2F4N A;  5JI6 A;  2VT3 A;  2D2W A;  4YEI A;  1IW7 F;  3H5N A;  1YJW B;  1MGT A;  1EV7 A;  4AUX A;  5FKL A;  4DNR B;  4BKX A;  4C3I J;  4RDK A;  2LBF A;  1BX0 A;  4HNV A;  1X3U A;  4JX4 A;  5DSZ A;  4DK1 A;  3E6D A;  2XPU A;  2FF4 A;  5J8C A;  2PYH A;  1TP4 A;  3NRV A;  4IRI A;  4ESJ A;  1JA0 A;  2CUZ A;  4YAW A;  3GVA A;  3FF5 A;  3TL4 X;  4Z6Y A;  3I59 A;  3EYI A;  4OMY A;  2NS7 A;  4XSX F;  2VZL A;  4UHT A;  1KGS A;  1W7P D;  3GTG J;  3LFU A;  3L2W A;  4UUV A;  1QCX A;  4CYC A;  5FL7 A;  3N4M A;  5GAH J;  1PDN C;  3K69 A;  4IHW A;  4KIB A;  1S9H A;  3JQQ A;  5GTH C;  2L5Q A;  2M3A A;  1HW5 A;  3TP0 A;  3CD6 I;  3W5V A;  4RS8 A;  5LEJ A;  4C2T A;  2E1B A;  3LO8 A;  5JLV C;  2XRO A;  3K70 C;  4BDZ A;  3FXU A;  3BG9 A;  3LQ6 A;  5AIP A;  3HSR A;  2A61 A;  4PGG A;  4ANJ A;  3H5A A;  3T8R A;  4PUS A;  2OTJ B;  1XB2 A;  3DBH B;  2PYG A;  2IS4 A;  3OL4 A;  4EV0 A;  3J81 k;  2LZJ A;  1GR1 A;  2OBR A;  4F93 B;  4G8X A;  1OR7 A;  5DCF A;  1YI2 I;  3J7A Y;  4A3L J;  2BHY A;  3W2E A;  2R7O A;  2NT9 A;  1X3Z B;  2E1O A;  3OYK A;  1EE6 A;  2L7M P;  2PQ8 A;  2D9R A;  1Q82 D;  1LDK B;  4RA2 A;  1ZAR A;  1CNE A;  2B5O A;  4OP7 A;  3D5L A;  1CF7 A;  1ERD A;  2R7V A;  4YIR X;  3JRE A;  4P2N A;  2WBM A;  4J01 A;  4EM1 A;  1QA2 A;  1R49 A;  3GME A;  1EF4 A;  2DPD A;  3BR2 A;  1QFZ A;  2YWE A;  3FPK A;  2OQR A;  2CSO A;  2E5Z A;  1Y0N A;  2KRC A;  1YG2 A;  2Q1Z B;  4TV7 A;  5J4V A;  1YOV B;  3OKX A;  3K4N A;  4FX4 A;  4CGZ A;  4CCL A;  5CKT A;  1X1P A;  4OJL A;  3OAA A;  1LE8 B;  2XTW A;  2DA5 A;  2O8X A;  2RAE A;  5HDK A;  4Y15 A;  2WAQ A;  1JUM A;  1ZGJ A;  2KIQ A;  1LLW A;  2PEX A;  4PFO A;  5FLX K;  1MD0 A;  4NK6 A;  2QKL B;  1H8A C;  4QV2 A;  2WJY A;  3F3X A;  2LR8 A;  5FJ8 J;  3GXO A;  3GRH A;  1SFX A;  2FE3 A;  3S8P A;  5HNH A;  4ENN A;  9ANT A;  2CW5 A;  1JHH A;  1AA7 A;  4P1W A;  3NEU A;  2O5R A;  1FX7 A;  1NG6 A;  1W9X A;  3AVW A;  1OCR H;  3MZY A;  3TBI A;  4G6T B;  3ZR8 X;  4OPV A;  3ASS A;  5B1B H;  1R22 A;  2DO7 A;  2PIA A;  4DOZ A;  1G3W A;  1GXP A;  1HBX G;  3S3N A;  1VF7 A;  3GZ5 A;  3M7G A;  3BJA A;  2DN0 A;  2FBK A;  2XPV A;  4OJ6 A;  1MBE A;  2IJL A;  3BTI A;  4UUT A;  3CCM I;  5FKK A;  2V1D A;  4YFK F;  4CYD A;  1D5Y A;  4BHC A;  4KIS A;  2CUE A;  4NBQ A;  4Y9R A;  2BBY A;  2I10 A;  3DPU A;  1GVD A;  3FXO A;  3Q9V A;  1U6G A;  2UXX A;  2AQF A;  3M1E A;  4RBO A;  3A8J A;  4PJ0 C;  5FKO A;  1CZF A;  5IYD J;  1XD7 A;  1NK3 P;  1WWX A;  4MIM A;  1GHC A;  1UD4 A;  1FOY A;  1MDM B;  2VKV A;  3PA2 A;  4DQK A;  2ESN A;  1IN8 A;  4PDK A;  4QVJ A;  1JI8 A;  4LIV A;  1NB0 A;  3S16 J;  2M7A A;  1FOK A;  2GBY A;  3WTZ A;  4BXF A;  1BM9 A;  1IN4 A;  1K4Z A;  4FE7 A;  2W24 A;  3CCV I;  1Z3X A;  3WHB A;  3E1S A;  3DTE A;  1FX0 A;  3HTS B;  2XZP A;  2LSO A;  3AGQ A;  2MLK A;  2OV7 A;  1V4R A;  3DEU A;  1HKT A;  3FDY A;  1HCR A;  3JRI A;  2M5W A;  2Z99 A;  3VPR A;  2UVF A;  2LKP A;  1A31 A;  1QUF A;  3F21 A;  1QVU A;  1FMV A;  1EA0 A;  5EYR A;  2X3U A;  2BV6 A;  2EFO A;  5KCM A;  3V42 A;  3K4K A;  1BQE A;  1PXZ A;  3OV8 A;  3A8I A;  1SD6 A;  3OJW A;  1MAB A;  1AKH B;  3OIO A;  3R0J A;  2VLA A;  3EPZ A;  1XSD A;  1WJB A;  2DI3 A;  2ODL A;  2XSD C;  1WMR A;  3BH4 A;  2COB A;  3DTI A;  4W1U A;  2JWT A;  2RVC A;  4BHB A;  1FNM A;  4Y13 A;  2ZXJ A;  4MNU A;  5F1J A;  1K78 B;  3EUH C;  4CYC B;  5CVU A;  1G3T A;  1ZYR F;  2UUZ A;  4NQW A;  5K5R A;  3OYE A;  5TRD A;  1GAW A;  2ZTG A;  4RAF A;  1X19 A;  4DIQ A;  4ITV A;  4LC0 A;  2GAU A;  1U0J A;  3A0B C;  2YX4 A;  4AF6 A;  1K4T A;  3OZV A;  4ROX A;  5D8K B;  2VT2 A;  2X1D A;  2BW3 B;  4KDP A;  3H94 A;  3CJQ B;  4DQ2 A;  4A0Z A;  3I56 B;  4GYI A;  3OYC A;  4PC3 A;  1VQN I;  3EQN A;  1EKE A;  3MWM A;  3HM5 A;  3TDU C;  3FHN A;  3A3G A;  1QX4 A;  1Z67 A;  2FNA A;  4B3X A;  3P5J A;  2PJP A;  2XTX A;  1ZG3 A;  1ZQ3 P;  2LKS A;  3I55 I;  3WG9 A;  1W5C C;  1R1V A;  3F8N A;  4M6X A;  3VYU B;  1W36 C;  4UNO A;  2QF7 A;  1R4N B;  2L4M A;  5FLX Z;  2XNC A;  2R7D A;  2FUG 2;  1VBL A;  4OJ5 A;  2KJB A;  4U0Y A;  2XC1 A;  3SEZ A;  1HDD C;  2B0L A;  4U0V A;  5HS9 A;  4X6A J;  4JX5 A;  2CND A;  2NT6 A;  3S1M J;  3JTH A;  1HXD A;  1HW2 A;  3CO7 C;  3EQO A;  1ZTR A;  3LSI A;  5A2Q K;  5IYB J;  2WJV A;  2ZJQ F;  1G2H A;  2IPQ X;  2CMP A;  3FMR A;  3VDX A;  2F5V A;  3BTL A;  5LMZ A;  4FT8 A;  3DKY A;  2OBT A;  4HAM A;  1FTT A;  3PSZ A;  4KMF A;  2PJR A;  2QQ8 A;  5E17 F;  1DPU A;  4PC7 A;  3RCO A;  4ZCI A;  4EQQ A;  1VQ6 I;  3PFY A;  2DBB A;  3E0J B;  5CQE A;  3WXM A;  3B6A A;  2DOE A;  1ETX A;  5GP9 A;  5H2F C;  1KZH A;  1B9M A;  2VQH A;  4UZF A;  3RKX A;  2FOK A;  2GK7 A;  1HF0 A;  3L00 A;  3AL0 C;  3ZUG A;  4M72 A;  1KRH A;  2K85 A;  1MJA A;  4YZ0 A;  2D74 A;  2KZV A;  4BAC A;  1IN7 A;  2X3H A;  2W85 A;  1T98 A;  4BGD A;  4ZC3 A;  1BPL A;  1GT0 C;  1RMG A;  1VZ0 A;  2LTP A;  3K10 A;  1D1B A;  4QLC U;  2Q0O A;  4C30 A;  1LNW A;  4LGW A;  2NNN A;  4X7E A;  3CD6 B;  5F4J A;  5BSX A;  4HV6 A;  1LM1 A;  2Y48 A;  1Y0Y A;  1S5L C;  2L7K A;  1YX3 A;  3WU1 B;  4UZE A;  2EV5 A;  3FPP A;  3W2G A;  1TWA J;  4E7L A;  5DN6 A;  2A69 F;  5LGN A;  1QBJ A;  4R71 A;  2XT2 A;  2BY0 A;  2RC4 A;  1QA6 A;  3CC2 I;  1G3S A;  4OJO A;  1RKT A;  1JJ6 C;  2YPR A;  2H09 A;  4OIN F;  2K40 A;  2CF4 A;  3VYS B;  2GPJ A;  3QFC A;  2KIM A;  2HU9 A;  1GLN A;  3WU0 A;  4XL9 A;  2JJ7 A;  4HW0 A;  2CW7 A;  1R23 A;  2Y2Z A;  1TNT A;  3TP3 A;  1YJ9 I;  1MSE C;  2EFN A;  1PJ6 A;  4LJZ F;  1YFH A;  2A5Y B;  4HPQ A;  1VQO B;  2CRV A;  3CPW B;  2JTV A;  4D5C A;  4KH3 A;  4FE4 A;  2LH9 A;  3GLL A;  4DYQ A;  4F92 B;  1HOM A;  5FLM J;  3L2R A;  1FOX A;  4BHP A;  1UD8 A;  3CMM A;  4C9Y A;  4G9Y A;  1FIP A;  1CGP A;  2E36 A;  4PJL A;  4CIC A;  1PJR A;  5D5V B;  3K4C A;  3GWZ A;  3FIW A;  4BQO A;  1OR7 C;  2IBD A;  1N07 A;  1XMA A;  1BIB A;  2VFN A;  2LRE A;  3NAU A;  4I02 A;  1KK1 A;  3O2P E;  2BVL A;  4U7B A;  1GDT A;  1S7E A;  2R7S A;  2MAB A;  3I9V 2;  2XAS A;  4ZCL A;  4G12 A;  1VQ8 B;  3E5X A;  2W57 A;  2XF7 A;  3WTT C;  4G6D A;  2EQR A;  1X0C A;  4Q47 A;  4RCY A;  3K4M A;  4MYU A;  3K6G A;  4UV9 A;  3HOU J;  5E3L A;  4XLP F;  1QO0 D;  2GXA A;  1ETV A;  3IH4 A;  4GDF A;  3GF2 A;  3A8K A;  4I2O A;  2L9S A;  2MC4 A;  3WY9 A;  2X6W A;  4IJA A;  5L3C A;  2HYF A;  1RUN A;  1R1T A;  4BY1 J;  1YS6 A;  2ME0 A;  3E5U A;  3WTW C;  2LYC A;  4IHY A;  3CUQ A;  1R7J A;  3IP4 B;  2J5O A;  4W97 A;  3PIP F;  4I6Z A;  2KLO A;  2IW5 A;  5TR9 A;  1QGP A;  3CMA B;  4IXA A;  3HOS A;  1BR1 A;  3V8K A;  3U2R A;  4Z1M A;  2QA4 I;  2BY2 A;  1RI7 A;  2DYS H;  2VBX A;  3FZV A;  1W0K A;  1KK3 A;  3QFS A;  1U8B A;  1O8I A;  3G1L A;  4MO7 A;  1ZLK A;  2NVU B;  3QRF F;  3DV8 A;  4V19 K;  3S2D J;  1KC8 D;  3ZMS A;  2C77 A;  1VQ4 B;  2X6O A;  3CCS B;  1MBG A;  4S04 A;  1LLZ A;  1WPK A;  1ZLJ A;  2H8W A;  2ZC2 A;  4M73 A;  3HZJ A;  3C2G A;  3OOP A;  4M1K A;  3V7R A;  4QWQ A;  1EXM A;  3MHP A;  2NZM A;  4FAS D;  3SHF A;  2ZBU A;  3OYG A;  1DP7 P;  2GA2 A;  5D4R A;  1WOO A;  4RB0 A;  3OYL A;  1PP8 F;  5HS7 A;  2AHO A;  2IA2 A;  2FQ3 A;  2GXG A;  2KHM A;  3CCL B;  1M90 D;  3H09 A;  1O8G A;  1U5T A;  2BE5 F;  2VOO A;  1YO5 C;  4V2F A;  1XFO A;  3ONY A;  1VQM I;  3SZP A;  3KIO A;  4BAY A;  1EFT A;  1BOB A;  3V7S A;  1I5Z A;  2V4D A;  2EBI A;  3SFI A;  3VOD A;  3HGG A;  1CF7 B;  4X7C A;  4X7D A;  3SKB A;  2BW3 A;  4HDV A;  4PC1 A;  1DUX C;  4WZK A;  5TJJ A;  4A2U A;  5IT9 K;  4F3Q A;  4MQ9 F;  2GJR A;  3K7A J;  5FD5 A;  1POG A;  1WXR A;  3HOV J;  1Q9S A;  2CG4 A;  2NXN B;  5DS0 A;  2JA7 J;  4C2L A;  2XGE A;  3ASQ A;  3I56 I;  4IOA F;  2MFZ A;  4HWV A;  1ZGA A;  1LJ9 A;  3S2W A;  2FX0 A;  3V8L A;  1JXS A;  3WWG A;  1NHC A;  3RKQ A;  2DXI A;  5M3F J;  1PUF A;  1GJR A;  4A3G J;  2XAQ A;  4WXD A;  5C4X J;  1L0O C;  4YCQ A;  1I50 J;  2MSY A;  3SJP A;  3BR1 A;  4CHU A;  1ZM3 A;  2W00 A;  2WSS A;  1XGO A;  2VPR A;  2L9N A;  4ZYH A;  4YFX F;  2IT0 A;  5HLH A;  1K79 A;  3ABM H;  1XE1 A;  3EUK L;  3K4J A;  1DBO A;  4TT3 A;  1X2M A;  2QSH X;  1GXQ A;  1SC7 A;  1ZRC A;  2M0C A;  3W2I A;  2MG4 A;  5E6T A;  4P3I A;  2E2I J;  3BQJ A;  3T1B A;  1LEB A;  4M9X A;  3TKY A;  3QOD A;  1HVX A;  4MHG A;  2Z8G A;  4XD7 A;  3BC9 A;  2C5B A;  3E97 A;  2STT A;  1WJA A;  2V1X A;  1IC8 A;  4DBR A;  1YJN B;  2QX3 A;  2XUB A;  1V5G A;  3IRR A;  2A68 F;  2OF7 A;  4PJM A;  3TED A;  4M0L A;  1PLU A;  3SZE A;  1K9M D;  1T6S A;  3VEP A;  1SEU A;  4FIS A;  2DOA A;  3PSI A;  2HLD A;  1TYW A;  3RIR A;  4HV5 A;  2HFH A;  2VBE A;  3S14 J;  3FXL A;  3FK7 A;  3QPH A;  2Z2S B;  2NRA C;  2OK7 A;  3ONU A;  1Q1V A;  4LK0 F;  2ICW G;  5M5X J;  4RB3 C;  3H0G J;  3JRB A;  1AIR A;  4A3I J;  3ZBU A;  3MD2 A;  1QGY A;  5IYR A;  5ERI A;  4FHT A;  3CRZ A;  3HOY J;  1XCV A;  1R6R A;  2P81 A;  2WWY A;  4Q48 A;  4PC2 A;  2B7B A;  1J5Y A;  4MYT A;  4Z03 A;  3SQN A;  3F72 A;  4NC8 A;  4AC0 A;  1YLF A;  4IO9 F;  1ZN2 A;  1YTY A;  1OGM X;  4NB5 A;  1OCC H;  3O8H A;  1CNF A;  2LFB A;  1QHG A;  5KAI C;  2E35 A;  3BQZ A;  3QOP A;  3DFG A;  4JMQ A;  4X1E A;  1MJ9 A;  3RPQ A;  2BY3 A;  2OC6 A;  5EGO B;  2ZFU A;  4HIZ A;  2XAF A;  1ZH5 A;  1HA3 A;  2EIM H;  2X0L A;  3VYR B;  3BZC A;  1VHE A;  2W7Z A;  1U5T C;  4RD0 A;  2UVE A;  2IGO A;  1VQ5 I;  3G73 A;  4I98 B;  5IP6 A;  2WB1 N;  1V3F A;  3PSS A;  2E1M B;  4PCQ A;  4OZY A;  1ZM9 A;  4CZC A;  2IEK A;  2X6X A;  3F8F A;  1JB9 A;  1D0X A;  3PSF A;  4RPD A;  5A88 A;  1BN8 A;  2E7X A;  1XS9 A;  1N06 A;  1SM4 A;  4BBS J;  2X6Y A;  3ONQ A;  1MNE A;  2ELK A;  3AVX A;  4OJP A;  1TW3 A;  3ISX A;  3E6B A;  2MD5 A;  1BR2 A;  5IOZ A;  1T6X A;  5BS6 A;  3I4N J;  1WFX A;  3RTR A;  1QZY A;  1FC3 A;  1D1A A;  3LNQ A;  1DU6 A;  4H0E A;  5D5U B;  2W25 A;  4KT6 A;  1G4D A;  2ISY A;  3LST A;  3DU1 X;  3G1M A;  1B8I B;  3SFZ A;  2LKX A;  5C3E J;  2AO9 A;  3QP6 A;  3BNW A;  2ADU A;  5B5E C;  2CRG A;  4E7I A;  2EB7 A;  2VNK A;  1WJF A;  2VQC A;  5FO5 A;  4UY8 I;  3S2H J;  3KZI C;  1ZGW A;  1YHQ B;  4OOV A;  3CCE B;  3GQ7 A;  2JUG A;  3JRG A;  1K61 A;  4OIP F;  1TWH J;  2R92 J;  2GIZ A;  3SEQ A;  2ZZG A;  3HOT A;  2BXY A;  2X4H A;  2HYJ A;  4KN7 X;  1DPR A;  2DJI A;  1H9T A;  1NHA A;  3ZZ0 A;  3CCJ B;  3ZQH A;  4RDJ A;  2Z5U A;  4LBY A;  1SMT A;  3KRG A;  2M7B A;  4A3M J;  1UCR A;  2HS5 A;  5F04 A;  2J5P A;  2IGK A;  3FWE A;  1BI0 A;  3KP3 A;  4HSR A;  2EZI A;  4N9H A;  1KYZ A;  3GIR A;  1T08 B;  5LEK A;  1UHM A;  4PFP A;  3K70 D;  2R5Z A;  1K7A A;  4TMT A;  3PVD A;  1KU2 A;  4M4S A;  2WY7 Q;  4WX9 A;  1MW7 A;  4CZZ A;  4JP0 A;  3OYI A;  2XAG A;  3IH2 A;  4MQV A;  3RSN A;  1WPC A;  2ZO4 A;  5E8I A;  1J59 A;  1YRN A;  2RRE A;  1FZP B;  1XG2 A;  2KKO A;  5HLT A;  1O8K A;  2CS3 A;  2DW4 A;  2RGV A;  5GAD J;  1JRG A;  2HOA A;  2EJR A;  2YR2 A;  5LLQ A;  1BL0 A;  1J09 A;  4HQM A;  2IS1 A;  4QVA A;  2HKO A;  3G05 A;  2ZNZ A;  4PC6 A;  4URR A;  1TZL A;  4FET A;  3JCU C;  4PSW A;  3ES9 A;  5DD4 A;  4BBR J;  2K4J A;  2FSW A;  2Q2E A;  3FMS A;  1FYL A;  4JQF A;  4BE2 A;  2D5V A;  4AC9 A;  2LLK A;  3OYD A;  2DMU A;  3BZK A;  1FEX A;  1N25 A;  4B4D A;  3CC2 B;  2BSP A;  1BW6 A;  3OYH A;  2XF5 A;  4IHS A;  2UZK A;  2BF4 A;  4IHT A;  4GO1 A;  1HKS A;  3DF8 A;  2F4M B;  1HG8 A;  1W2B B;  2YSR A;  1GO2 A;  1XCB A;  2PLF A;  2UV1 A;  4Z4W A;  3CUQ C;  3H35 A;  2OTL I;  2HXI A;  1EP1 B;  3JQP A;  2INU A;  1TT0 A;  5HDG A;  2OCC H;  2XDV A;  4E4H A;  5CQG A;  3I71 A;  2HYG D;  5L3B A;  2YWF A;  4I7H A;  3HHG A;  1VQ7 I;  3G6E B;  3UKG A;  1CQX A;  3EUH A;  3FHZ A;  4IVN A;  3FKI J;  3E6M A;  1OPC A;  1IO2 A;  4MFE A;  5K5Q A;  1ELO A;  1QH0 A;  2HWV A;  3FM3 A;  3JRF A;  1OHH A;  2OZU A;  5DDG A;  4Z4Z A;  2IP2 A;  2YWH A;  4FN5 A;  5F0H A;  2EFG A;  1P92 A;  3DEE A;  5LFA A;  3IAS 2;  2JJ1 A;  4LG0 B;  2CV1 A;  3CCU I;  3RPU A;  4HX8 A;  1D1C A;  2RQP A;  1DBG A;  2NVX J;  3K1P A;  4P6Y A;  3REO A;  2VKH A;  4JYK A;  2QCO A;  2QBY B;  3WYA A;  3AL0 B;  2P5V A;  1K8F A;  4EH1 A;  1LVK A;  2DU9 A;  5CYV A;  4LG0 A;  2JIZ A;  2DET A;  1Z77 A;  2DA3 A;  2ZL6 A;  2A05 A;  4ZDP A;  1FJL A;  5ILV A;  2XZO A;  3QWL A;  4NK8 A;  2O7O A;  2INV A;  4G94 A;  4I0B A;  1NRK A;  2O61 A;  2JZY A;  1NDH A;  3KYD B;  4F7Z A;  5HDN A;  4G6I A;  2VBV A;  4PAB A;  1UG2 A;  5J1U A;  4IHV A;  3ZQL A;  1LPQ A;  1QQ1 A;  3G3Z A;  3IHU A;  4BY7 J;  4RGX A;  4PZJ A;  1TQM A;  5JHF A;  2GQQ A;  1MKM A;  2BVM A;  2X85 A;  4AVZ A;  2B9S A;  5LHI A;  2VJJ A;  2V1N A;  3I4P A;  4O5V A;  4ESF A;  1J9Z A;  4UVC A;  1AIP A;  2G7U A;  5J40 A;  1JNY A;  2WAQ N;  3JW4 A;  3B73 A;  2QA4 B;  2ZKZ A;  3VYT B;  2WB1 A;  1J75 A;  2XB5 A;  2CUJ A;  4RD3 A;  1OFL A;  4LB6 B;  3RQI A;  2EFP A;  4DZJ A;  3QYB A;  1LFP A;  3RZD J;  3TH0 A;  1TNS A;  4OZZ A;  1Y1V J;  3DWL E;  1XSV A;  2VNI A;  4KKT A;  2PBI A;  1QG0 A;  1MH4 A;  1XTA A;  2EA4 A;  1ETK A;  4KNY A;  1WI9 A;  1UJ8 A;  2XIG A;  4A93 J;  3SY2 A;  3ECH A;  1FSH A;  2M8E A;  2R7R A;  2B7C A;  4BXU A;  2DA7 A;  2BM0 A;  3BDD A;  2EV0 A;  4L5E A;  4HDU A;  4FCY A;  1O3R A;  2I1L A;  1XPX A;  5D5X B;  4RD4 A;  1R4M B;  3E20 A;  2YUH A;  4YZX A;  3A01 B;  1QU3 A;  2IOU G;  2J8I A;  1R5N A;  3CCQ I;  2VBS A;  3I64 A;  1K4S A;  3QE2 A;  4YAF A;  3ABU A;  2XKP A;  3ECO A;  4GQN A;  4Z06 A;  4LIU A;  2GK6 A;  2XAU A;  1IA5 A;  1Z6T A;  5FKN A;  2O8K A;  2W84 A;  1WZ2 A;  1QJV A;  3LSJ A;  3SXY A;  1TLH B;  2GOX B;  2V1U A;  2BPO A;  2R7W A;  3PO3 J;  1U9N A;  3ULQ B;  5IP9 J;  3A03 A;  1Q7Y D;  2BM6 A;  1SMY F;  5E3N A;  3OYJ A;  1ZKG A;  3OEH A;  1FT9 A;  3GO5 A;  4XID A;  2JK3 A;  4AF7 A;  3L2V A;  3QSY A;  1XDS A;  4RAY A;  5F1R A;  3PO2 J;  4ASU A;  3LJY A;  4XRS G;  3P7N A;  1BLI A;  4I76 A;  3FIS A;  2WZN A;  1RR8 C;  2KT0 A;  2LVS A;  4AD9 A;  2EZK A;  2LNB A;  5F08 A;  4UUS A;  3H36 A;  5HNF A;  4ZDO A;  2CK3 A;  1AMO A;  1FP1 D;  3VNV A;  1YRN B;  4GFB A;  4UZU A;  1VJS A;  5JVT A;  1QUE A;  2XOK A;  4H9G A;  4LG3 A;  5F0F A;  2BM7 A;  1K83 J;  4G7X A;  2K5C A;  3MCZ A;  1OCZ H;  1WJ5 A;  2OBP A;  3HTU A;  5LGU A;  1YIO A;  1DGW Y;  4A3K J;  5LGT A;  3MQ0 A;  2MA3 A;  3JTG A;  4P9F A;  1ETW A;  5EG0 B;  1H8H A;  2J7K A;  4JX6 A;  4OIR F;  2WAF A;  5E8G A;  2GIV A;  1JKO C;  5B66 C;  2Q6I A;  1T39 A;  2NAZ A;  3WOD F;  4PGH A;  2Q2E B;  3QP5 A;  4ESB A;  1B4A A;  1P6R A;  1IB0 A;  2MGQ A;  1TVC A;  1Y1W J;  2PLY A;  2V5I A;  1O88 A;  2VJI A;  2JMW A;  1ZK8 A;  1QRB A;  2BMW A;  1S72 B;  1LEA A;  1PYV A;  1O3S A;  1W7P B;  1I3A A;  1WJD A;  1EWY A;  1PE9 A;  4V02 C;  3CCL I;  1J2X A;  1OFC X;  1DP3 A;  3ABK H;  1FSE A;  2ZBV A;  3G71 B;  3QU3 A;  3CCE I;  3E5Q A;  3DDY A;  4AU7 A;  4XKV A;  2CBX A;  4NCN A;  1N8R D;  3WNC A;  5AN9 A;  2HOT A;  3HG9 A;  1MMG A;  5F64 A;  3ERM A;  1IV6 A;  1IGN A;  3Q6R A;  4RPB A;  1R9T J;  3CCJ I;  1Y0R A;  1W0J A;  2BGI A;  5CDF A;  1F9N A;  4OOX A;  5IT3 A;  3N05 A;  1HW1 A;  5DEQ A;  1VQP B;  3ZGK A;  1FLI A;  4KJZ A;  2A6T A;  1T56 A;  3CCU B;  2F5E A;  2A3S A;  2X9D A;  1YX2 A;  4LD5 A;  1A6Q A;  4N9I A;  5D5W B;  2K4B A;  4N0B A;  3BZ6 A;  2ZTN A;  1GVH A;  4DYC A;  2FBI A;  2ETH A;  3CTA A;  2O0V A;  2VFP A;  1F1Z A;  4YG2 F;  2NTB A;  1ETY A;  2M2E A;  1G7T A;  5F0C A;  2HQ5 A;  4CO8 A;  4ETS A;  3S3M A;  1BMF A;  1Z05 A;  3I59 B;  1VLY A;  2EZH A;  2K7L A;  4F55 A;  2O1D A;  3CF5 F;  1YW8 A;  4RB2 C;  4Z05 A;  2ZJR F;  4BJ5 C;  4S0H B;  4CXF A;  2B0R A;  2IVM A;  3T0Y A;  3WE3 A;  1WRJ A;  3CW2 A;  4JRA C;  3FK6 A;  3K1M A;  4C43 A;  4XKW A;  3FXK A;  1A6I A;  4CSW A;  2VQG A;  1QA1 A;  1JGS A;  1S3J A;  4LOC A;  4BE0 A;  3PUN A;  3ERE D;  3CPX A;  2XAJ A;  2VBY A;  3ZMV A;  5E1Z B;  3HEF A;  2ZME C;  1EFC A;  2DTR A;  4B8X A;  1PKV A;  2K3F A;  2DCE A;  3LL7 A;  2BSA A;  2OYN A;  1KQS B;  3CC4 B;  4XOP A;  2DT7 B;  2FEZ A;  3TOA A;  3F22 A;  1E63 A;  1Z6R A;  1W35 A;  4J19 A;  2MYS A;  3BCB A;  4XR6 A;  2CQK A;  5EZG A;  2C5H A;  3K2A A;  1ODD A;  3TO7 A;  4TMZ A;  2KJC A;  1OB2 A;  1IG7 A;  2L4A A;  2L54 A;  3KLN A;  2VKD A;  2P6T A;  4PJJ A;  3W6J B;  4CUG A;  5L3G A;  3T8T A;  3KFW X;  2CFO A;  4ZZD A;  4Z2Y A;  1TC3 C;  2NSP A;  5TIS C;  3QOE A;  3EUA A;  3ZN1 A;  2QGU A;  4ENM A;  4A3J J;  2BV3 A;  3GQ8 A;  1NTC A;  5LHG A;  1VQN B;  4YII A;  1B59 A;  1OYW A;  4A5N A;  5D8L B;  1HDP A;  3GFI A;  2IRF G;  4A3C J;  1COW A;  2GZW A;  3JRH A;  1GAQ A;  1X1A A;  4Q4Z F;  3ZPL A;  1K5C A;  1ULY A;  1PUE E;  4HA8 A;  3LSP A;  2NYX A;  1B6A A;  2QXZ A;  4QSH A;  2XGD A;  4B43 A;  1RUO A;  2NV4 A;  5DUK A;  3IRQ A;  2V31 A;  4LBZ A;  4UUS B;  4A3B J;  3KZY A;  3P9C A;  2V7T A;  3JSO A;  3EQL F;  2DA1 A;  3PQJ A;  4P12 A;  2FA5 A;  5CVJ A;  1JA1 A;  1W87 A;  2F5F A;  2CJJ A;  4UXN A;  4XNF A;  2DOG A;  5FRO A;  2R7Z J;  4YZQ A;  4IQJ A;  3GFJ A;  2M34 A;  3DKW A;  5EG0 A;  4HQE A;  1K6O A;  5DS9 A;  1B8I A;  1I7P A;  3KX2 A;  2LY9 A;  3W6K B;  1R36 A;  2DMN A;  1OFD A;  3BG7 A;  4IZZ A;  1V54 H;  4BNC A;  2C78 A;  2WPD A;  5DD8 A;  1PUF B;  1SVO A;  1WCM J;  3CUO A;  2QZA A;  3GFL A;  4AID A;  4A3F J;  3ZOB A;  1LFB A;  4OM9 A;  2LDU A;  2P3M A;  3S93 A;  2ZXW H;  2V7X A;  5FA6 A;  1L1I A;  3CC7 B;  1XGM A;  3HOX J;  5J8F A;  4YHB A;  1WJE A;  4XSZ F;  1KCC A;  1JKQ C;  3BC8 A;  2UWM A;  2CFX A;  4Z4U A;  2PE3 A;  4CCO A;  1O4X A;  1N77 A;  1B72 A;  2VOP A;  1JTA A;  2R5Z B;  4KUM A;  4L9N A;  4NNJ A;  4RGS A;  4EEF G;  1H8E A;  4TMV A;  3AK5 A;  4PJN A;  1P2F A;  2DQR A;  3F6O A;  1LDD A;  3ZQ7 A;  5IOY A;  1IAW A;  1PJ5 A;  3G4S B;  1BI2 A;  4HRI A;  5HZA A;  3MKY B;  1TYV A;  2ECB A;  3VMF A;  1X1B A;  1V5E A;  2H6B A;  3I58 A;  1F4K A;  2QYU A;  1YYV A;  4DK0 A;  1GVJ A;  2QEN A;  3M07 A;  4EAT A;  4TKO B;  1IXS B;  2FU4 A;  3JAM K;  1LE8 A;  2YS9 A;  4P6V F;  4BUP A;  5FO0 A;  2CQN A;  2LRD A;  4D7N A;  1E1Q A;  3CP8 A;  3MMP A;  5HS8 A;  2HCJ B;  1YX5 A;  2ZME A;  3FMQ A;  5BMZ A;  4LBW A;  3ESW B;  2M9H A;  5HOD A;  4ZTF A;  5GAE J;  2O0W A;  1G7S A;  2V26 A;  4DYR A;  2FOW A;  4XK4 A;  4A12 A;  3COA C;  3Q38 A;  2F43 A;  3VO2 A;  1IV8 A;  4BH9 A;  3LOC A;  2PFB A;  3LWF A;  5KW9 A;  4NBS A;  4GXO A;  5IK2 A;  1IUY A;  3KYL A;  3ZIA A;  3BH6 B;  2FVG A;  1BJZ A;  4LB5 A;  5E1W A;  3I4M J;  4M3G A;  1ZRE A;  2ESH A;  1XQB A;  1KZL A;  1I18 A;  3FXM A;  4RB1 A;  3FKS A;  2R9V A;  4XLH A;  1X4O A;  3OL3 A;  3UR3 C;  3IKV A;  5CJ9 A;  2NST A;  1JUP A;  3DBR B;  1ZR4 A;  1LDJ A;  3HAG A;  3L1P A;  1AHD P;  5ILS A;  4IX7 A;  3CCR I;  1D0Y A;  1ON2 A;  3PNV A;  3TO9 A;  4MXN A;  2TCT A;  3HBL A;  3CDL A;  3KLO A;  4WK8 F;  4QPQ A;  1QQI A;  4LMY A;  1Y0U A;  4XLF A;  3BTJ A;  1P7J A;  2OPT A;  4MTD A;  4YAU A;  4OAZ A;  5IY5 H;  4YDT A;  2XKO A;  4BEH A;  2HOS A;  2VKE A;  5IYW A;  3WE2 A;  1M1K D;  1A36 A;  2E1N A;  1E0E A;  3U6B A;  4E6K G;  2LOO A;  4QPO A;  3AVT A;  1DQU A;  3QYF A;  1Z1D A;  3F9K A;  1E79 A;  4HF2 A;  3PQK A;  3CXC B;  3G4S I;  1MRZ A;  1OGJ A;  2CW8 A;  4Z4T A;  5IYP A;  2F48 A;  2O0Y A;  4AM3 A;  2VPL A;  3CLQ A;  2L2O A;  3I3L A;  2K9M A;  1WOP A;  3ZSC A;  2X8K A;  2K9S A;  3AG2 H;  1E17 A;  5KSW B;  2WV1 A;  1YE9 A;  5IYC J;  3ZP5 A;  5EJC A;  3VMV A;  3VST A;  3ML3 A;  4K2E A;  4V2G A;  1VFC A;  4X8I A;  3T9G A;  3FJO A;  1KK2 A;  3OFN A;  1D8T A;  1MMN A;  3CUQ B;  4DNC A;  3Q3A A;  1O8E A;  2ME6 A;  4FK8 A;  1TYU A;  3H9N A;  1VQ6 B;  2YX7 A;  2M8G X;  3NWT A;  1Z0X A;  3VSK A;  3S17 J;  2R7X A;  4TMW A;  3VSV A;  1FYK A;  4CCN A;  4ZYA A;  3D1N I;  2W1O A;  1VQL I;  4ZGQ B;  2FQ4 A;  2V7W A;  2W48 A;  3GZN B;  5L46 A;  3UW0 A;  3BPX A;  1MND A;  2E71 A;  2K9Q A;  2AQE A;  1SFE A;  1HKQ A;  1WTH D;  1SD5 A;  3L9F A;  3BY6 A;  3BCD A;  2FX3 A;  4YAO A;  3CCQ B;  1E3X A;  1KON A;  2I8D A;  4NC6 A;  3AVV A;  4RAZ A;  2R5Y A;  2O6W A;  1FNC A;  5E18 F;  1ZR2 A;  3ZMT A;  4OAY A;  4AVP A;  3G1O A;  4S05 A;  3Q6Q A;  4YZA A;  1UMQ A;  1UHW A;  2FNP A;  2VAS A;  5BPD A;  3GSI A;  3D5S C;  5F6F A;  2Y9Y A;  1ZG1 A;  2JN6 A;  1MMA A;  1JE8 A;  1USS A;  3KL9 A;  5EMN A;  5IT9 Z;  4XRS A;  4RLZ A;  4PMH A;  3Q0W A;  5HLG A;  3OW2 B;  3AKZ A;  3ASR A;  3HJE A;  2OBS A;  2HGC A;  4YC5 A;  4HYE A;  4B44 A;  2W6J A;  2CO5 A;  4A6E A;  4F91 B;  2JPC A;  2EZL A;  3AAF A;  2D45 A;  3SEJ A;  2A6H F;  2XC7 A;  4HLX A;  4L9T A;  1J0R A;  2NVY J;  1VQM B;  1OGO X;  2Q6O A;  4EJW A;  3DP7 A;  3CC4 I;  2Z6B D;  2F4I A;  3IH3 A;  4KMU X;  1FYM A;  3KP4 A;  1QRC A;  1RPW A;  4C3J J;  1ON1 A;  1MJB A;  2LC2 A;  3ISP A;  3GLX A;  3LQQ A;  2V6E A;  3W2F A;  1KTV A;  3PEN A;  4RDL A;  4XN3 A;  5HOO A;  5CVI A;  4ENJ A;  2DY1 A;  4M3D A;  2HQR A;  3HRM A;  3TQN A;  2WR8 A;  2A5W A;  2ELH A;  3HL2 A;  2MD0 A;  4ENK A;  5L3F A;  4WZL A;  3BG6 A;  3M3Y J;  2B63 J;  4HE5 A;  1OYI A;  3KZZ A;  2CU7 A;  2HOE A;  2KDO A;  1SVL A;  1UZC A;  1ZRD A;  3KET A;  3HOW J;  2RC5 A;  3KE2 A;  1A8P A;  1TWC J;  1A35 A;  4X0C A;  3I53 A;  5BPI A;  1RU4 A;  2BVN A;  5JVG F;  4LLG F;  2QEX I;  4XRF A;  1FBQ A;  2K27 A;  3W2V A;  2HPI A;  5ED4 A;  3J7A O;  3CO6 C;  2ZSI B;  2UXN A;  4UAJ A;  5ICG A;  1QFY A;  5DNS A;  2ZZF A;  1YI2 B;  4BPR A;  3T5X A;  5E3O A;  3SYT A;  1HLV A;  3RYR A;  1K73 D;  2J8K A;  4N3N A;  2F2E A;  3P4G A;  3K4B A;  1HC8 A;  1E1R A;  1IUF A;  2OQG A;  4RD6 A;  1ZM4 A;  2DFE A;  3U1K A;  3SLD A;  2D3N A;  1IRF A;  2EH3 A;  2QTL A;  1TT5 B;  1QZE A;  1O3Q A;  1Z21 A;  1I3Q J;  3PJR A;  3K0L A;  2M0M A;  2JJ2 A;  1CLW A;  2EWN A;  1BW5 A;  3DPL C;  5HXB A;  4AIK A;  1KCD A;  1X4P A;  3A02 A;  3A35 A;  3QYE A;  1VQ4 I;  2R7Q A;  2VI6 A;  4YEJ A;  3CMY A;  2IQ7 A;  1OOC A;  2H1L A;  2I5U A;  4CQJ A;  4JK1 X;  2GQF A;  2W6I A;  4M9S A;  4UV8 A;  1WSV A;  3I55 B;  1NH3 A;  4Y7C A;  3LFK A;  1WU8 A;  3LYC A;  1YIT I;  2JPB A;  4D1Q A;  3Q39 A;  5GPC A;  4P55 A;  1N08 A;  3OYN A;  3CCS I;  2F4O B;  2QLZ A;  3JQR A;  1G3Y A;  3GTP J;  4IPA A;  1WOS A;  2KVO A;  3W3C A;  5TV2 A;  2P0W A;  3ABT A;  3F6V A;  4BQN A;  1MZB A;  2R7T A;  2EK5 A;  4MR0 A;  2HTS A;  4ZTJ A;  3A4C A;  3I1F A;  4I84 A;  4DJA A;  3GTQ J;  3WND A;  1XSX A;  1VHO A;  2CW0 F;  2E1M C;  2QSF X;  3SJM A;  4C3H J;  1G6N A;  1U3E M;  2G0Y A;  2XHK A;  2QDX A;  3W2W A;  1CQT A;  2Y9Z A;  1A04 A;  4XKC A;  1KTW A;  2NTP A;  2JRT A;  2XT4 A;  4F52 A;  4WF2 A;  3BWG A;  1DU0 A;  1JT0 A;  3E7L A;  2P4W A;  5H6Q A;  5JMC B;  3BR6 A;  1RNL A;  2JSP A;  3LA2 A;  1EH7 A;  3FBI B;  2DER A;  1IJF A;  5GTI C;  2E7W A;  2K9N A;  3KEO A;  2XTY A;  3MAJ A;  1IDJ A;  4P3Y A;  1VQ5 B;  2A07 F;  4ZJZ A;  3CP2 A;  1UST A;  4GRI A;  1Z7L A;  2PMZ N;  4AIJ A;  4EM0 B;  4X0G A;  1EJ9 A;  2VJ5 A;  2XGX A;  3VFZ A;  2JDI A;  3C1D A;  2V7F A;  2H6C A;  4A69 C;  2DA2 A;  2Y75 A;  3KP2 A;  3OW7 A;  1Y6I A;  2MC3 A;  3V4G A;  1EA3 A;  1TWF J;  1P4A A;  1IDZ A;  4FX0 A;  4RD2 A;  4PSX A;  2OTJ I;  3D0S A;  1EFU A;  3U2Q A;  1O8F A;  1SAN A;  4A5M A;  1QGZ A;  1KK0 A;  2F5D A;  3OYF A;  3LAP A;  4RD1 A;  1ONV A;  4YEL A;  2QQA A;  2L0K A;  2K86 A;  3OE7 A;  1ZHF A;  1OCT C;  5C4J J;  3FXQ A;  4A0X A;  2JA6 J;  3BG3 A;  3MZ8 A;  5DYM A;  1TQI A;  4WXH A;  2IA1 A;  3CC7 I;  2L01 A;  4Q5S F;  1Y8R B;  1FNB A;  1UD2 A;  3ZZT A;  2X53 S;  5EEA A;  2ZSH B;  4OU0 A;  2JT1 A;  1HSJ A;  4GYG A;  1RIO H;  2B7E A;  2VNJ A;  3HUG A;  1P7I A;  3WTY C;  1WGX A;  4FQG A;  1FRQ A;  3ZPN A;  2CGP A;  4Y3O A;  1RKW A;  4JOM A;  1JKP C;  5B3S H;  1QVT A;  3IC7 A;  2Y0M A;  5IYQ A;  1YJ9 B;  3PUM A;  1FOW A;  1W0T A;  1ZAO A;  4CCJ A;  1YJW I;  2M87 A;  2KP6 A;  2XF6 A;  4CH7 A;  3P9I A;  2MBF A;  3OYM A;  5LD2 C;  2IXS A;  3MN2 A;  2DMT A;  2DYR H;  2ZZQ A;  5F4M A;  1KJZ A;  1Y56 A;  1U9O A;  3L2C A;  1Z9C A;  4QUZ A;  4RM3 A;  2FMY A;  3MZH A;  1A5J A;  2ELJ A;  5FFX A;  3X2Q H;  5DTD A;  3ZCO A;  5DM6 F;  1S0U A;  2DA6 A;  4KA4 A;  2VIX A;  2JA5 J;  3PM1 A;  4XM3 A;  3NE5 B;  5C1C A;  3T51 B;  2HDD A;  2Y0S N;  4XLA A;  3PIO F;  2ZFW A;  3OSF A;  3Q0V A;  1LQ1 A;  4J0Q A;  5DM7 F;  2ZZE A;  2KMU A;  4R8H A;  3S15 J;  4WXC A;  2R3S A;  1T6Y A;  5GV7 A;  4EJU A;  1U8R A;  2QY1 A;  2XGC A;  2JSC A;  5DCM A;  1FBU A;  1W34 A;  1PVE A;  3ZQI A;  4BEH B;  3ROU A;  1PJ7 A;  4HX7 A;  1QVF B;  2ZME B;  4M9Z A;  4ZYE A;  1Z7U A;  4C2U A;  3O6B B;  3TW6 A;  5E79 C;  3HPG A;  1W0U A;  2PMH A;  3HYI A;  1P9Q C;  1OFM A;  2BXZ A;  3GVK A;  2YU3 A;  5TY0 A;  3CCR B;  3KCC A;  5B6I A;  4L0Z B;  1Q1H A;  2DYI A;  2VFM A;  2JUC A;  1WOR A;  2Y0S A;  3CCV B;  4IHX A;  1KQ9 A;  1XX5 A;  2WA0 A;  2COM A;  3SUC A;  3HKZ N;  4FWT A;  3LA7 A;  4WZE A;  1XDU A;  2JVG A;  1H0M A;  4X7F A;  3U9G A;  2EIX A;  3G6E I;  1VQ7 B;  3MMY B;  4LLN A;  1K78 A;  2F6C A;  5H59 A;  4NQW B;  1RES A;  3V8J A;  1BC8 C;  1OCP A;  4KIF A;  3V7C A;  3ZMU A;  1HST A;  3JRC A;  1LUJ B;  2Z33 A;  2L9V A;  2VFQ A;  3H1C A;  2E1R A;  3OS2 A;  5EGO A;  3J81 K;  1X1C A;  3BY1 A;  1WDT A;  3RPU D;  4AYB A;  4HZF A;  5HLI A;  3ZN0 A;  3CB4 A;  4L9V A;  1OCO H;  1EFR A;  3MKL A;  2MH9 A;  2OZ6 A;  3H3V K;  4B09 A;  6PAX A;  3OMY A;  4MEX F;  2LY2 A;  2P8T A;  3HRS A;  4IRG A;  4U7D A;  3IUO A;  2FBH A;  2VNH A;  4X05 A;  3HB9 A;  1ENH A;  4E7J A;  2F1L A;  3GFM A;  2CQ7 A;  1Y8Q B;  2QYO A;  2VXZ A;  3KEQ A;  2VC0 A;  4HF1 A;  2LG4 A;  3PET A;  2PN6 A;  1XN7 A;  5LHH A;  4RM2 A;  2LBF B;  1I8D A;  3WNB A;  3JAM Z;  2XB0 X;  2DK5 A;  2QVO A;  2H8R A;  2VBZ A;  5J4Y A;  1QFJ A;  4DGW B;  4ZH4 F;  3C2B A;  4IQ4 A;  1E3O C;  3VR6 A;  3HSF A;  2N8G A;  3Q5F A;  2HZT A;  2W82 A;  2XAH A;  3OOU A;  4E7Z A;  1YS7 A;  1JGG A;  2E5N A;  5EEH A;  4ZYD A;  3MKW B;  1F36 A;  2XV4 S;  2ZXI A;  3AFH A;  1W5T A;  1OB0 A;  1B9N A;  2LMD A;  2PEC A;  5A89 A;  2ZL7 A;  5B1A H;  3P9K A;  3DBL B;  5JFR A;  2QE7 A;  3R61 A;  3VSL A;  4HG2 A;  3SQV A;  2PMZ A;  3KP6 A;  2RV8 A;  5CLS A;  5TGT A;  1H42 A;  1BA5 A;  3DQV C;  2X0K A;  3ZQC A;  1QVG B;  4W8S A;  2R5Y B;  3HRT A;  2K02 A;  1D2E A;  1YIT B;  1R5H A;  3TMO A;  1FP2 A;  1OKR A;  2EFW A;  1R5O A;  3HOZ J;  1YIJ B;  3OS0 A;  1BC7 C;  2OK8 A;  3BQY A;  3QFT A;  1TL8 A;  4G1B A;  2OTL B;  4UVB A;  2XRL A;  3LAJ A;  2R0Q C;  4Z4Y A;  2IGN A;  4H4K C;  3L2Q A;  1E62 A;  2PI0 A;  4IRH A;  5AIQ A;  2Q6L A;  3WTS C;  4QFM A;  1DG1 G;  1BI1 A;  1X58 A;  3M1C A;  1M1E B;  5KAF C;  2KZG A;  5FRM A;  2BZT A;  4I01 A;  1NB9 A;  1LVA A;  4E7H A;  3F0C A;  4G7O F;  2XGJ A;  1BOA A;  1QHH D;  2DTZ A;  2OD5 A;  2ZXH A;  1N0U A;  4EMS A;  2L7Z A;  4A3D J;  5FNZ A;  3DPT A;  2EIN H;  1VF9 A;  2WAD A;  4FTH A;  1OQY A;  3OPO A;  1N05 A;  2Y69 H;  3S32 A;  2DLL A;  1U2W A;  2HR3 A;  1ITY A;  1OYY A;  3NWS A;  3LQE A;  2D1V A;  1SAU A;  5FD6 A;  5J1R A;  3OS1 A;  5L3E A;  3J7Z I;  1V5V A;  3WGH A;  3Q9S A;  4W8R A;  2XSJ C;  2P7C B;  2VXD A;  1SVM A;  5E1X A;  3L7W A;  3MKZ A;  3WGG A;  4DNT B;  3IKT A;  5LRR A;  2FD5 A;  3DU5 A;  1T0F A;  2Q6K A;  4BE1 A;  5A2Q Z;  2LY1 A;  1IN5 A;  2ACJ A;  3W6V A;  1G8X A;  5THX A;  4XN0 A;  3N90 A;  2GXB A;  4A0Y A;  1UD5 A;  2P6S A;  2QZ8 A;  1SFK A;  3BCF A;  1MH3 A;  2DOF A;  2BM1 A;  1MIJ A;  2PG4 A;  4PGO A;  3P27 A;  5BQT A;  3RI4 A;  2WZP P;  4EW9 A;  2DFF A;  3B82 A;  5K5O A;  3IWF A;  4LIT A;  4M53 A;  2GOM A;  3K2Z A;  3NAR A;  5AMV A;  1UMK A;  4OPS A;  5DV5 A;  4AYB N;  4OWR B;  1ZM2 A;  4II3 A;  5FGM A;  1WH5 A;  3B78 A;  1I1S A;  5J6X A;  2VE8 A;  5IP7 J;  3QU6 A;  2YWG A;  4HNU A;  4ACB A;  3OWT A;  2CV2 A;  5BOX A;  2XZL A;  1R1U A;  3ZBT A;  1IRG A;  1BBY A;  1Q86 D;  1GV5 A;  4G7W A;  2CYY A;  1OLT A;  2HNH A;  1G7R A;  3BRO A;  4W8Q A;  5K7H A;  4YAL A;  3ZC3 A;  5D6E A;  1ETO A;  1E3H A;  4MEY F;  4WWC A;  1VQ9 I;  2M4K A;  1TWG J;  2M30 A;  3QPT A;  1FDR A;  2DK8 A;  1UFM A;  1Z3Y A;  2QKM B;  3PFI A;  3RZO J;  2STW A;  3H92 A;  4CDG A;  1KD1 D;  1FY7 A;  3R6S A;  2ZNY A;  1K28 D;  1S4M A;  5LRS A;  3OY9 A;  4X06 A;  3GTJ J;  3EDP A;  3CF2 A;  4BXX J;  3B8Y A;  2QQB A;  3HGY A;  3JRA A;  2L02 A;  4RGR A;  2JVH A;  2HEO A;  1V0E A;  1VQP I;  2BGJ A;  3GCM A;  1JT6 A;  2NOJ B;  3VOE A;  2KFD A;  2DPU A;  3LSM A;  1ZG5 A;  1Q81 D;  4ZV4 A;  2DOD A;  3L09 A;  2R7F A;  2OA4 A;  3C18 A;  1GUU A;  2QM3 A;  3OP1 A;  3HXL A;  4BJ6 C;  4P25 A;  4XOT A;  4E0F A;  4I09 A;  2AXT C;  1IRZ A;  1H85 A;  2F3L A;  3WTX C;  4O3M A;  1JKR C;  3BG5 A;  2VON A;  3PL8 A;  2M1B A;  3HSE A;  4M3E A;  2BY1 A;  5E3M A;  2R4G A;  1DAB A;  4II2 A;  1SKY B;  1T0F C;  5CPR B;  3WTV C;  3GX4 X;  3NQO A;  3RIQ A;  2IA0 A;  1NBM A;  2C4T A;  4KKS A;  2DFH A;  1F5T A;  4OIO F;  1EH6 A;  5FFZ A;  1FPQ A;  4X07 A;  5J35 A;  1O8J A;  4CCK A;  3K9T A;  1YW7 A;  1IN6 A;  4TN1 A;  1XMX A;  2HI3 A;  2OU2 A;  2ZCW A;  1WI3 A;  2RNJ A;  1O8D A;  1WJC A;  1EH8 A;  4EJV A;  1R00 A;  3DLL F;  1XG1 A;  2ZIT A;  2VBK A;  3TW7 A;  1VLO A;  2NS0 A;  3WU2 C;  2CQX A;  3RQ4 A;  2X48 A;  2PJR B;  1VQ9 B;  3CME I;  2EWE A;  1FND A;  1RQR A;  2KQR A;  4KT5 C;  1X3W B;  2BGC A;  5EDN A;  2GM4 A;  3FY3 A;  1V55 H;  4ZZL A;  1FIA A;  1O7L A;  3CDI A;  1MBK A;  3H3Z A;  4M3F A;  3ZQF A;  1JJ8 C;  2CUF A;  1SAX A;  5J3O A;  3AG4 H;  2QN6 A;  1N0V C;  1D0Z A;  3HDD A;  1XGS A;  4KKU A;  2IS2 A;  1R5B A;  1H80 A;  3GZ6 A;  1ZEL A;  1QZZ A;  1XMK A;  3H3U A;  1TSP A;  3IV5 A;  1T33 A;  1NK2 P;  3JU4 A;  5D6F A;  1AU7 A;  1EZG A;  1LB2 A;  1TUI A;  1VQK B;  1N75 A;  1UEL B;  2QTZ A;  4I99 C;  1F60 A;  2HQA A;  3F8C A;  2C6Y A;  4B47 A;  1E43 A;  1UG0 A;  3RJP A;  4MTE A;  3ELK A;  5GV8 A;  2VQL A;  3RYP A;  2KIF A;  1E64 A;  4Y33 A;  3O8G A;  2AS5 F;  1BX1 A;  2RKH A;  3KP5 A;  1SKQ A;  2OJE D;  3LSH A;  5E20 A;  3S1N J;  4ZGN B;  3MCA A;  2EFQ A;  1B2R A;  3BY2 A;  4M71 A;  4KN4 X;  4PAA A;  4CCM A;  2DJN A;  2WV0 A;  1AWC A;  2E2J J;  1TTT A;  2V9V A;  2ZB9 A;  3ZMZ A;  1QNT A;  3LMM A;  2F5C A;  2K3P A;  3MFK A;  4EJT A;  2O17 A;  3A1Y A;  3BJ6 A;  1C0W A;  2RNG A;  3I5U A;  5J47 A;  2TRT A;  1E3Z A;  2PMU A;  2CWE A;  5DCM B;  3EET A;  1HF2 A;  1ACI A;  2XVC A;  3GTO J;  1YQA A;  3SYJ A;  3F8B A;  4E7S A;  3A1P A;  4TSF A;  4JBA A;  4EGY A;  1WSU A;  1Y39 A;  1DDI A;  4L9J A;  3AVY A;  1OJL A;  1HZE A;  2Y31 A;  4IL6 C;  2OAZ A;  2RQQ A;  3PA1 A;  4Z4V A;  2L9R A;  1T2K A;  1DAR A;  1APL C;  3GQB A;  3R6J A;  5FIU A;  1O7F A;  1XC5 A;  4B48 A;  2DDB A;  1P4X A;  1L3L A;  2TDX A;  3ZMD A;  2QWW A;  4AIH A;  1FMW A;  1YIJ I;  4D0P A;  4XRM A;  3IWZ A;  2QSG X;  4TMX A;  5AON A;  2ZL5 A;  3FKJ A;  1VQK I;  3ABL H;  4L5I A;  1GQ8 A;  2BM4 A;  2BYV E;  2RC6 A;  5HZB A;  3E6C C;  2JRM A;  3EYY A;  1IDY A;  2DFI A;  2CC2 A;  4ZCM A;  3BR3 A;  1F43 A;  3C3W A;  5M3M J;  5M5Y J;  1S72 I;  3QQA A;  4E70 A;  4M74 A;  2NVQ J;  4ZDL A;  2G7H A;  3LSR A;  2H1K A;  2L3D A;  3G71 I;  2E34 A;  2KIS A;  2VN2 A;  4GGG A;  4IW3 B;  3J7Y J;  4YFO A;  1V0F A;  1E3P A;  3FXJ A;  2MH2 A;  5ICF A;  4HST A;  1KQ8 A;  1IHM A;  1TQP A;  2HDW A;  4NUB A;  3BR5 A;  3RKY A;  5F27 A;  2Z9O A;  3K4L A;  3BOQ A;  3P26 A;  2KDZ A;  3BPV A;  3C2H A;  2WAE A;  2VE9 A;  4OOS A;  4XLN F;  2RDP A;  4MGR A;  1O8L A;  4DZP A;  3A2K A;  2HXO A;  3KPH A;  4C0S A;  3GQA A;  2LP0 A;  1K8A D;  3QPS A;  1MMD A;  1AKH A;  4ZYG A;  4RCZ A;  4WWV A;  1G7C A;  1YLO A;  4ACA A;  3CJN A;  3ZXS A;  3FM5 A;  4KFC A;  2W4S A;  2HVQ A;  1W36 D;  2NS8 A;  5HVQ C;  4U4B A;  4L18 B;  3LMW A;  2FJ1 A;  2K9L A;  1OIS A;  3ZRG A;  3ASO H;  5J1Y A;  2VBU A;  1KQ5 A;  4B1R A;  5ICC A;  4YIF A;  2DT5 A;  3FXR A;  1MBJ A;  5K1Y A;  2QMU A;  4OPW A;  2LK2 A;  3CMA I;  3I54 A;  4P9S A;  4IEJ A;  2GJK A;  2JQ7 A;  2E60 A;  3U6K A;  4W8T A;  3GVJ A;  1B1B A;  1RC9 A;  3L2U A;  3B02 A;  4E7K A;  3OJX A;  3DCF A;  3GVL A;  2BX6 A;  2R93 J;  4DW6 A;  1IZ1 A;  2CH0 A;  1BJK A;  1IB4 A;  1U2R A;  2GJP A;  1KU9 A;  1JTX A;  1STZ A;  4P22 A;  2O03 A;  1KA8 A;  5CVR A;  1KQ0 A;  3AG3 H;  1UD6 A;  3R0A A;  2BHZ A;  1KU3 A;  4P1V A;  1YW9 A;  4LLL A;  2WC2 A;  3BT9 A;  2YUS A;  4RGU A;  2V6C A;  4MLO A;  2RN7 A;  2EIJ H;  5DUI A;  2V7U A;  1P4W A;  1RR7 A;  3SZG A;  1FTZ A;  4NHJ A;  3BR0 A;  1VQO I;  4M6V A;  1UAA A;  4Q7J B;  3S1Q J;  4M2L A;  4B3A A;  5FB2 A;  2EIK H;  3QAH A;  1JTY A;  4Y52 J;  4QHY A;  1NJI D;  3R6K A;  5LBQ A;  1IXR C;  1I6H J;  1EP2 B;  1SD7 A;  1FBS A;  3VSU A;  3I0T A;  1EP3 B;  3WG7 H;  3B4N A;  2AXL A;  3W5U A;  4IF4 A;  3V76 A;  3ASP A;  1FWZ A;  2DAO A;  4BL0 B;  4DBQ A;  1T38 A;  3BLY A;  2ZJP F;  3VWB A;  4KIG A;  2VUM J;  2R6H A;  4A6D A;  2PMD A;  2IGM A;  4D7M A;  2Z3Y A;  4D5F A;  3JR9 A;  4B3F X;  1GV2 A;  3Q3S A;  1PP7 U;  2BN4 A;  4YXW A;  2NTQ A;  5KVR A;  2VL8 A;  1OMI A;  2DDA A;  5EEG A;  4C2M J;  4IKF A;  5HKK A;  2EPF A;  3DLA A;  5FKM A;  3CES A;  3W2A A;  4D9J A;  3U21 A;  3H0D A;  5GPA A;  1IXC A;  1MBF A;  1S6L A;  1AOY A;  1FRN A;  4Z4S A;  1WHU A;  1H89 C;  2HDC A;  1OFE A;  2VYQ A;  1WQ2 A;  1WSR A;  2HKX A;  1FNN A;  1BHE A;  2E2H J;  3J81 Z;  1TBX A;  4RDU A;  2AHQ A;  5EF6 A;  5CVV A;  2IS6 A;  1KU7 A;  1U5T B;  2DA4 A;  4BYY A;  1UD3 A;  3KEW A;  2EV6 A;  3OR2 C;  3ZQG A;  1REP C;  4HE6 A;  3LQR A;  4KIT B;  5IPA A;  1X1D A;  2FXA A;  2YU9 J;  3WQZ A;  2OUM A;  4CA0 A;  2E1C A;  4G5G A;  2C4U A;  4L8J A;  2VFO A;  2JA2 A;  3AVU A;  2ID3 A;  3GTL J;  1OB5 A;  1IRX A;  3BJO A;  2CQQ A;  3E3V A;  1BN5 A;  2M45 A;  2V4J C;  1V5F A;  3VMW A;  2QGG A;  2QUF A;  1IDK A;  1YHQ I;  5A8A A;  1WVR A;  3H5R A;  4K1X A;  4UB6 C; 
#chains in the Genus database with same CATH homology
 1PYV A;  3BCA A;  1WJD A;  4BJT A;  2QY1 A;  3H9Q A;  1PE9 A;  4XLE A;  2L7K A;  1YX3 A;  4XLC A;  1DP3 A;  4BEH B;  3FPP A;  4E7L A;  2X1C A;  5DN6 A;  3DDY A;  4AU7 A;  4C2U A;  4XKV A;  3HPG A;  4OJO A;  1KCD A;  3HG9 A;  1MMG A;  1P9Q C;  1DGR M;  1BR4 A;  4RLF A;  1KMH A;  4B3G A;  1OFM A;  5CDF A;  4N4N B;  1W0J A;  3GVK A;  3VYS B;  2HU9 A;  3KEY A;  3N05 A;  1GLN A;  3ZGK A;  3B90 A;  4KJZ A;  3FBN B;  2A6T A;  2Y0S A;  2Z1D A;  4XL9 A;  2CV0 A;  4PK4 A;  2CW7 A;  2WA0 A;  3SUC A;  4BU2 A;  4HPQ A;  2JVG A;  2ZTN A;  2LH9 A;  2V9K A;  3MMY B;  4F92 B;  3L2R A;  1NG7 A;  2Z16 A;  2O0V A;  2HVR A;  2F6C A;  4NQW B;  1UD8 A;  3CMM A;  3LSK A;  4C9Y A;  4BDY A;  2NTB A;  4PJL A;  4XON A;  4RMN A;  1PJR A;  3S3M A;  3K4C A;  2R7U A;  1BMF A;  4BQO A;  1OR7 C;  1VLY A;  2VJ4 A;  2LRE A;  4F55 A;  2O1D A;  3OS2 A;  1T95 A;  2BVL A;  4U7B A;  1X1C A;  4Z05 A;  2R7S A;  4BJ5 C;  2MAB A;  3RPU D;  3I9V 2;  4AYB A;  2XF7 A;  4XKW A;  1EFR A;  4CSW A;  1X0C A;  3G2B A;  4XKB A;  5C1E A;  2VQG A;  2X51 A;  4BE0 A;  3K4M A;  3K6G A;  3OMY A;  4XMY A;  2LY2 A;  4HNT A;  3IUO A;  4E7J A;  2KL4 A;  1PKV A;  2D3L A;  2L9S A;  3CJR B;  2MC4 A;  2DCE A;  2X6W A;  3LL7 A;  4XOP A;  2VXZ A;  2DT7 B;  2LG4 A;  2LYC A;  1I8D A;  4RM2 A;  2LBF B;  2MYS A;  3BCB A;  4XR6 A;  2VB6 A;  3IP4 B;  4P5O A;  3T53 B;  2KLO A;  3HOS A;  1BR1 A;  4DGW B;  4Z1M A;  3VR6 A;  4IQ4 A;  3LNN A;  2VKD A;  4PJJ A;  4CUG A;  2W82 A;  3OOU A;  1W0K A;  4E7Z A;  2CFO A;  2E5N A;  1N78 A;  1O8I A;  2NSP A;  3MKW B;  3AFH A;  2PEC A;  2ZXI A;  1OB0 A;  3QOE A;  3EUA A;  3GQ8 A;  1LKX A;  2UVE A;  2QE7 A;  3VSL A;  4HG2 A;  3SDB A;  3UNG C;  2PMZ A;  1COW A;  3IAM 2;  5TGT A;  3C2G A;  4N4O B;  3DQV C;  1X1A A;  1K5C A;  4W8S A;  2V7Q A;  2NZM A;  2WY8 Q;  3TMO A;  4FAS D;  3OYG A;  3OS0 A;  4R79 A;  3OYL A;  2QXZ A;  2KPM A;  4B43 A;  2V31 A;  2KHM A;  3CZ6 A;  2M5S A;  1O8G A;  2IGN A;  4H4K C;  3L2Q A;  1BOB A;  4XNF A;  3M1C A;  3HC7 A;  5FRO A;  5FRM A;  2V4D A;  2DT6 A;  1WPC A;  4Y4R A;  4IQJ A;  4YZQ A;  4E7H A;  2XGJ A;  4U87 A;  2BW3 A;  1QHH D;  2ZXH A;  3H9J A;  3KX2 A;  3OOC A;  3DPT A;  2WAD A;  3BG7 A;  4IZZ A;  3OPO A;  2WPD A;  4F3Q A;  3S32 A;  2GJR A;  2F1M A;  3PNT A;  4FXU A;  3NWS A;  1SAU A;  3OS1 A;  4C2L A;  4W8R A;  2XSJ C;  2MFZ A;  3OYB A;  4HWV A;  3WWG A;  3DU6 A;  2VXD A;  3GBG A;  4XQF A;  1NHC A;  3OYA A;  2DXI A;  3S93 A;  3MKZ A;  4DNT B;  3M8J A;  1O8H A;  3DTK A;  1WJE A;  3DU5 A;  4BE1 A;  1KCC A;  2LY1 A;  3BC8 A;  2UWM A;  1G8X A;  4BS9 A;  4XN0 A;  2W00 A;  2WSS A;  1UD5 A;  4CCO A;  1N77 A;  1WP6 A;  1JTA A;  3JUR A;  1SFK A;  3A3B A;  2L9N A;  3H9G A;  3OIP A;  3BCF A;  4NNJ A;  1H8E A;  1K6Y A;  4PJN A;  2WZP P;  4EW9 A;  2HVS A;  3EUK L;  3K4J A;  4HRI A;  4TT3 A;  3MKY B;  1DBO A;  4LIT A;  2GOM A;  1X1B A;  3HUG B;  5FRN A;  5AMV A;  1V5E A;  2O04 A;  4OWR B;  4DK0 A;  4II3 A;  5KNL A;  1RWR A;  4EAT A;  2KRH A;  3QOD A;  1HVX A;  4TKO B;  2Z8G A;  4XD7 A;  3BC9 A;  2DIE A;  4BUP A;  2LRD A;  1E1Q A;  3CP8 A;  1G59 A;  4HNU A;  1WJA A;  1YX5 A;  4DBR A;  3OWT A;  1V5G A;  3S3O A;  4ZTF A;  4PJM A;  2CV2 A;  1HA8 A;  2XZL A;  2V26 A;  2O0W A;  4YRV A;  1PLU A;  4G7W A;  4RLQ A;  2F43 A;  1OLT A;  2HNH A;  4W8Q A;  3ZQQ A;  4HEA 2;  2DOA A;  3PSI A;  2HLD A;  2VBE A;  5IK2 A;  3ZIA A;  3KYL A;  2X1E A;  2Z2S B;  3PUB A;  3HKZ A;  2M4K A;  1KZL A;  1I18 A;  1Z3Y A;  2QKM B;  3FKS A;  3GQ9 A;  2R9V A;  4XLH A;  3D5R C;  1X4O A;  1AIR A;  3OL3 A;  3MD2 A;  3UR3 C;  2BOL A;  2NST A;  1K28 D;  4BQQ A;  3HAG A;  3OY9 A;  1R6R A;  3T56 B;  4IX7 A;  2M4G A;  3CF2 A;  2XND A;  1D0Y A;  3PNV A;  3B8Y A;  4MXN A;  2JVH A;  4QPQ A;  4XLF A;  1V0E A;  4Z03 A;  4NC8 A;  2NOJ B;  3DKX A;  3PNY A;  1OGM X;  4OAZ A;  3LSM A;  1O8M A;  4BEH A;  1QHG A;  2HZD A;  3OR1 C;  1E0E A;  3HXL A;  3LSG A;  4BJ6 C;  2LOO A;  4QPO A;  4XOT A;  4E6K G;  2W7N A;  5KHD A;  1DQU A;  2OC6 A;  2ZFU A;  3F9K A;  3OIQ A;  3QYF A;  1E79 A;  4HIZ A;  3VYR B;  3HPH A;  3PL8 A;  4NC7 A;  2CW8 A;  2R4G A;  2VPL A;  4II2 A;  1SKY B;  2IGO A;  3OEE A;  2L2O A;  4XOR A;  1T0F C;  3I3L A;  2K9M A;  5CPR B;  2HPM A;  4U49 A;  2X8K A;  4J00 A;  3ZSC A;  1YE9 A;  1T5E A;  2VBM A;  1NBM A;  4KKS A;  3VMV A;  3VST A;  2E1M B;  4OZY A;  4JMQ A;  1O8J A;  4CZC A;  3T9G A;  2X6X A;  3H5N A;  4CCK A;  1D0X A;  3PSF A;  3OFN A;  1MMN A;  4DNR B;  1BN8 A;  2LBF A;  1O8D A;  4DK1 A;  1WJC A;  1O8E A;  2VBK A;  2X6Y A;  3NWT A;  3ONQ A;  3VSK A;  1MNE A;  2R7X A;  2PYH A;  4OJP A;  3RQ4 A;  3VSV A;  4CCN A;  4ZYA A;  2PJR B;  2W1O A;  1BR2 A;  2CUZ A;  2EWE A;  3UW0 A;  3TL4 X;  1WFX A;  1MND A;  2KQR A;  3RTR A;  2AQE A;  1D1A A;  1WTH D;  3FY3 A;  4KT6 A;  3LFU A;  3L2W A;  1QCX A;  5FL7 A;  1S9H A;  3BCD A;  4KKU A;  1D0Z A;  2L5Q A;  2M3A A;  2IS2 A;  1E3X A;  1H80 A;  1KON A;  2I8D A;  1ZEL A;  4C2T A;  2E1B A;  3JU4 A;  4E7I A;  3K70 C;  1WJF A;  2VQC A;  4BDZ A;  1N75 A;  1UEL B;  4OAY A;  4ANJ A;  4YZA A;  3H5A A;  2HQA A;  4PUS A;  2JUG A;  4B47 A;  1E43 A;  2PYG A;  1UG0 A;  2VAS A;  3OL4 A;  2IS4 A;  3GQ7 A;  3D5S C;  2VQL A;  2LZJ A;  4Y33 A;  3SEQ A;  1MMA A;  3HOT A;  4F93 B;  3J7A Y;  2ZZG A;  2NT9 A;  3LSH A;  2DJI A;  2R7O A;  3OYK A;  1EE6 A;  1LDK B;  3KRG A;  4PMH A;  2M7B A;  4CCM A;  3D5L A;  1ERD A;  2R7V A;  2IGK A;  3AKZ A;  3LMM A;  2WBM A;  2K3P A;  4HSR A;  4B44 A;  4J01 A;  3A1Y A;  2W6J A;  2O17 A;  3K70 D;  2RNG A;  4PFP A;  1E3Z A;  4U4B A;  4F91 B;  2WY7 Q;  1MW7 A;  2XC7 A;  3OYI A;  2E5Z A;  1OGO X;  2KRC A;  4E7S A;  2Q1Z B;  3RSN A;  2Z6B D;  2F4I A;  4TSF A;  3K4N A;  2RRE A;  4CCL A;  2LC2 A;  5CKT A;  1HZE A;  1XG2 A;  5HLT A;  3OAA A;  1O8K A;  4OJL A;  2CS3 A;  2V6E A;  1JRG A;  2RQQ A;  2WAQ A;  4XN3 A;  5HOO A;  4PFO A;  1J09 A;  3GQB A;  2IS1 A;  4URR A;  2A5W A;  3G05 A;  4NK6 A;  2QKL B;  1TZL A;  4FET A;  4PSW A;  4B48 A;  2MD0 A;  3HL2 A;  2WJY A;  3BG6 A;  3GRH A;  3S8P A;  5HNH A;  2KDO A;  1FMW A;  4JQF A;  4BE2 A;  1AA7 A;  3OYD A;  4P1W A;  2O5R A;  1W9X A;  1NG6 A;  2BSP A;  3TBI A;  3OYH A;  2XF5 A;  4G6T B;  3ZR8 X;  1RU4 A;  3FKJ A;  1GQ8 A;  4DOZ A;  3S3N A;  1VF7 A;  1HG8 A;  3W2V A;  2HPI A;  4OJ6 A;  2UV1 A;  2ZSI B;  3H35 A;  2ZZF A;  2INU A;  1TT0 A;  3SYT A;  2XDV A;  4E4H A;  5CQG A;  3K4B A;  1E1R A;  4ZDL A;  4KIS A;  3ZPP A;  3DPU A;  2AQF A;  2D3N A;  1CZF A;  3PJR A;  1Z21 A;  1UD4 A;  1V0F A;  2M0M A;  2JJ2 A;  1OHH A;  3DPL C;  4HST A;  1X4P A;  2HDW A;  4NUB A;  3A35 A;  3QYE A;  1JI8 A;  4LIV A;  2R7Q A;  4YEJ A;  2IQ7 A;  1OOC A;  3K4L A;  3DEE A;  2M7A A;  5LFA A;  2W6I A;  3IAS 2;  4BXF A;  2JJ1 A;  3C2H A;  2WAE A;  2CV1 A;  1Z3X A;  1O8L A;  1FX0 A;  3E1S A;  3DTE A;  1D1C A;  2XZP A;  1DBG A;  4D1Q A;  3A2K A;  3GQA A;  3OYN A;  2OV7 A;  2VKH A;  3FDY A;  1MMD A;  3AL0 B;  1LVK A;  2UVF A;  2KVO A;  3W3C A;  3ZXS A;  2P0W A;  4BQN A;  2R7T A;  1FMV A;  2JIZ A;  2W4S A;  2HVQ A;  1W36 D;  4ZDP A;  5HVQ C;  2XZO A;  4ZTJ A;  4MR0 A;  3A4C A;  5KCM A;  3V42 A;  4DJA A;  2K9L A;  3K4K A;  1PXZ A;  3LMW A;  3ZRG A;  2INV A;  1NRK A;  4I84 A;  4NK8 A;  2E1M C;  1MAB A;  2VLA A;  3EPZ A;  4G6I A;  1WJB A;  2ODL A;  1WMR A;  3BH4 A;  3DTI A;  3W2W A;  1KTW A;  4XKC A;  2GJK A;  2NTP A;  2E60 A;  4F52 A;  4W8T A;  3EUH C;  3GVJ A;  5JHF A;  2UUZ A;  2ZTG A;  2BVM A;  2X85 A;  4AVZ A;  3OYE A;  3L2U A;  4E7K A;  3GVL A;  2VJJ A;  2V1N A;  4E0F A;  1X19 A;  1IB4 A;  2CH0 A;  4DIQ A;  4ITV A;  1U0J A;  2JSP A;  2GJP A;  3FBI B;  4P22 A;  3VYT B;  2WB1 A;  1UD6 A;  2X1D A;  1IDJ A;  2CUJ A;  1OFL A;  2BW3 B;  3QYB A;  1LFP A;  3CJQ B;  3CP2 A;  4GRI A;  4ZJZ A;  1Z7L A;  3H94 A;  4X0G A;  3OYC A;  4OZZ A;  4MLO A;  3EQN A;  2VJ5 A;  2JDI A;  3DWL E;  3FHN A;  3A3G A;  4KKT A;  2V7F A;  3SZG A;  4B3X A;  3OW7 A;  1UAA A;  1Y6I A;  1EA3 A;  2R7R A;  4PSX A;  3VYU B;  1O8F A;  2QX3 A;  1W36 C;  1VBL A;  2FUG 2;  4OJ5 A;  3OYF A;  4YZX A;  1QU3 A;  4YEL A;  3VSU A;  3SEZ A;  3OE7 A;  3B4N A;  2NT6 A;  4GQN A;  4Z06 A;  4LIU A;  2GK6 A;  4DBQ A;  2XAU A;  4BL0 B;  3VWB A;  3BLY A;  1UD2 A;  3EQO A;  1IA5 A;  1QJV A;  2IGM A;  3LSI A;  2X53 S;  2GOX B;  2WJV A;  4B3F X;  2R7W A;  2CMP A;  3VDX A;  2ZSH B;  4YXW A;  2F5V A;  2NTQ A;  3DKY A;  3OYJ A;  2VL8 A;  4IKF A;  3OEH A;  5HKK A;  3DLA A;  2PJR A;  3CES A;  3W2A A;  4D9J A;  3L2V A;  3ZPN A;  3U21 A;  3H0D A;  4Y3O A;  4JOM A;  4ASU A;  3RCO A;  3PFY A;  3E0J B;  5CQE A;  1BLI A;  1BHE A;  2VQH A;  4CCJ A;  2XF6 A;  2KP6 A;  4ZDO A;  5HNF A;  4CH7 A;  2IS6 A;  2CK3 A;  2GK7 A;  3OYM A;  3AL0 C;  4UZU A;  5LD2 C;  2IXS A;  1VJS A;  2XOK A;  2ZZQ A;  1UD3 A;  4LG3 A;  3KEW A;  3OR2 C;  4G7X A;  2K5C A;  1WJ5 A;  4KIT B;  1Y56 A;  1X1D A;  4RM3 A;  1DGW Y;  3WQZ A;  2OUM A;  2KZV A;  4CA0 A;  4BAC A;  4YZ0 A;  1H8H A;  4L8J A;  2ELJ A;  2X3H A;  2JA2 A;  2WAF A;  1IRX A;  4ZC3 A;  3ZCO A;  4BGD A;  1BPL A;  2V4J C;  2VIX A;  1V5F A;  1VZ0 A;  3K10 A;  1RMG A;  4XM3 A;  3NE5 B;  3VMW A;  1D1B A;  2Q2E B;  3T51 B;  5C1C A;  4XLA A;  4C30 A;  1IDK A;  1O88 A;  2VJI A;  2ZZE A;  2KMU A;  3H5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...