4XN0A

Tailspike protein mutant e372a of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 226
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xn0A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xn0A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xn0A02
1HG8A 1WMRA 1IDKA 2QY1A 4HWVA 1IDJA 4MXNA 2INVA 5C1CA 1EE6A 1RMGA 2QXZA 1BN8A 4XLCA 2VBMA 1KCCA 2O0VA 1DBGA 1H80A 1PE9A 3LMWA 1O8FA 5C1EA 2O1DA 1OGOX 3T9GA 1O88A 1XG2A 3ZPPA 4YZ0A 2NTBA 3VSTA 4C2LA 2NTQA 4OJPA 3WWGA 1DBOA 4XN3A 1OOCA 3GQ8A 2VJJA 3SUCA 1OGMX 1O8IA 4XORA 2X85A 1IA5A 3JURA 2BSPA 2PECA 4XLFA 4OJ6A 4YELA 3GQAA 2UVEA 3EQNA 4XQFA 4Z05A 4XONA 4XL9A 4XOTA 3GQ7A 4I84A 3B90A 4MR0A 2NZMA 2Z8GA 4XLHA 4NK8A 4U4BA 2QX3A 3UW0A 3VMVA 4AVZA 1O8KA 3ZSCA 4XKVA 2O04A 4W8SA 4YZXA 4XOPA 1PXZA 4XMYA 2X6WA 2NT9A 3KRGA 4XN0A 3VSVA 1JTAA 2X6YA 4XLAA 4XLEA 2O17A 1PLUA 1O8LA 3GRHA 1K5CA 1KCDA 2UVFA 1O8JA 1O8EA 2ODLA 1O8DA 4OJOA 1GQ8A 1RU4A 4PMHA 2PYHA 1QJVA 1NHCA 2NSPA 2NT6A 4OZZA 1JRGA 2IQ7A 2EWEA 4W8RA 1VBLA 2X6XA 3EQOA 3FY3A 4U49A 1OFMA 2INUA 4XM3A 2X3HA 4EW9A 4OZYA 4XNFA 4YZQA 1AIRA 3VSUA 1CZFA 1KTWA 4OJ5A 4Z03A 3VMWA 2VBEA 2O0WA 1O8GA 1O8HA 4NK6A 2NSTA 1BHEA 2NTPA 4W8TA 4Z06A 4YZAA 1X0CA 3GQ9A 4W8QA 5AMVA 1RWRA 4XR6A 2PYGA 1OFLA 4URRA 4XKWA 3B4NA 1IB4A 2VBKA 3B8YA 2VJIA 1O8MA 4YEJA 4OJLA 1QCXA
chains in the Genus database with same CATH superfamily
3SKBA 3T1BA 3A0HC 3KEQA 2CYYA 1SFKA 2CBXA 2Z99A 3TW6A 4WWVA 3LFKA 1PKVA 2DOGA 1BI0A 2V79A 2ZBKA 4Y52J 1DDGA 2BVLA 2R7QA 2J5OA 3OL4A 3FHZA 1RMGA 4Z2YA 1F43A 1E62A 4R8HA 1JTYA 3WTWC 1WOSA 3W2FA 3CO7C 3VSKA 4BHBA 4A3KJ 1TT5B 1X1BA 2E1MB 4S04A 5IYQA 1R49A 2XF6A 2EWNA 2DCEA 1X3UA 1GVDA 2HR3A 4FASD 4CCMA 3ZRGA 4IHXA 3K10A 3K7AJ 2MC3A 4OJPA 1G8XA 5F1JA 3WG9A 4PK4A 5DCMB 5J1YA 4AWXB 2X85A 4IKFA 5LGTA 3PL8A 5DNSA 2QUFA 3G71B 2QQ9A 3IHUA 2KJCA 1MMNA 2W7NA 1EWYA 2MA3A 3I53A 1J09A 1AOYA 1VZ0A 3BJ6A 4M0LA 1IN6A 1UD2A 2X9DA 4FQGA 1KK2A 2GK7A 4BS9A 2BVNA 3CB4A 2IS1A 4V02C 1YW8A 1CLWA 5F0HA 1F36A 2VT2A 1BR4A 3I58A 3K9TA 3GTOJ 2OBTA 4E6KG 4IHYA 2UV1A 2V7WA 5J4VA 1WI9A 2F48A 3T53B 4EVIA 4J19A 1VHEA 3HRSA 3IH4A 3OP1A 1A36A 1S6LA 2RQPA 1K83J 4IO9F 1K4ZA 1USSA 2JA6J 2KZVA 3FXOA 3J81Z 3V7AA 2HDCA 1KCDA 5GV8A 2CG4A 1OKRA 2H1LA 3H92A 1ODDA 3PSFA 4QVAA 4X05A 2OUMA 3DFGA 3PUNA 3FKJA 5FL7A 3IKVA 1FLIA 2H09A 3E97A 1XMAA 2B0RA 1NHCA 3HPGA 1VQ5I 3ZMZA 5M3FJ 1MMSA 1L0OC 4LBYA 1NTCA 2OBPA 2ME6A 4W8RA 1R4MB 2ZMEC 1O7FA 2BHYA 2DTZA 1ETQA 4G1VA 4I2OA 3SYJA 4I99C 3ELKA 4NBSA 5CVUA 2LKSA 3SEQA 2VKEA 3QQAA 1N75A 4RAZA 3OYBA 2R7WA 5HLHA 2IS4A 2BM6A 3MN2A 1X3WB 3TL4X 4A3LJ 4X6AJ 3CUOA 3EUHA 4BEHB 3K4NA 2QTLA 1E3PA 1FT9A 5E8IA 4A3DJ 4PC6A 3IAS2 3CXCB 1O8GA 2VXZA 5FO5A 5EGOA 2CV1A 4D5CA 2PN6A 1FYKA 2D3LA 4J0QA 2XGJA 4W8QA 1K4SA 4ASUA 4WCGA 2XAHA 3OYDA 1E1RA 2DETA 1STZA 4BDYA 3PA1A 1MNDA 4EJVA 2XAQA 2X6OA 1ZTRA 2IA1A 4AYBA 4DNCA 2QN6A 4IQ4A 2YUHA 4X06A 4FT8A 2E19A 4ZDLA 2OTJI 3MCAA 3ISPA 1LJ9A 1AIPA 1ZM2A 1ZYRF 3G05A 5GAGJ 1MH4A 3J7AO 1XD7A 3KP7A 4B3FX 2OQGA 3W5HA 2XRNA 4G7ZF 1PP7U 2V9VA 1O57A 1FOWA 4EQQA 5K1YA 4RD3A 4UAJA 2QXZA 3I64A 1Z1DA 3QFSA 1RR8C 4RLFA 3QFTA 1W1WE 4LG3A 1YLOA 2HZTA 2E1CA 1IRGA 3SFZA 4BJ5C 2GM4A 3Q5FA 4IRIA 3W2VA 3O2PE 3BG9A 3CMEB 4OAZA 3PO2J 1QU3A 3RIQA 2PJRA 3GO5A 3MD2A 2XZPA 3VO1A 3N97A 4AVPA 4RPBA 1LE8A 3JRAA 2V6CA 4II2A 4E7KA 1KZLA 3DBRB 4XORA 1I7PA 1MH3A 4OOVA 2ESHA 3SUCA 2XRLA 1FP1D 2NAZA 3ASTA 2XTYA 1UD6A 2H1KA 1VQOB 3M8JA 3WU1B 2V7UA 3S1MJ 1I3AA 2HMAA 1RNLA 4YALA 1J2XA 1MBEA 5KVRA 2M45A 4XOTA 3ZXSA 3AL0C 5L46A 5FKOA 3IRQA 2QM3A 1JKRC 3CZ6A 4MR0A 2X51A 3A4CA 2QA4I 1VTNC 1O4XA 4MEXF 2FRHA 2DMQA 3VMVA 2F5VA 1VF7A 1YE9A 2HGCA 3KYLA 3FHNA 2CRVA 1U5TA 1ONVA 1T08B 4XMYA 1QVFB 1T95A 5L3GA 4OOXA 5GPCA 4ENKA 5IOYA 2XGCA 2YWFA 1FBSA 3CPWB 2UXNA 4KNYA 2EV6A 2BYVE 5H59A 2Q6IA 2MSYA 2BV3A 1XCBA 2DT7B 3OL3A 3RYRA 2OK8A 3T5XA 1JTXA 1JKQC 3K1PA 4RGRA 1ITYA 1ZLJA 5A8AA 3H9GA 3UNGC 3CCQI 1MMDA 3DP7A 4E7IA 1NDHA 3T8TA 1FBUA 1SKQA 4EJWA 4XICA 2VBVA 4MEYF 2W00A 1GT0C 3J7AY 4P96A 1OCZH 4QLCU 3SQNA 1QX4A 1BOBA 1KD1D 5EEHA 3OIOA 2R5ZA 1WVRA 2WPDA 1A6QA 2XC1A 2N8GA 3HTUA 2XGDA 5C4JJ 2VQHA 4AYBN 5AONA 4G7WA 5M3MJ 2M30A 2FBKA 2W84A 2E1RA 2BM7A 1IXRC 1RR7A 4LJZF 3T51B 3UW0A 2QZAA 3J7YJ 2FUG2 1VQ8B 1K61A 3Q9SA 4E7LA 2HDDA 2VBEA 1M1KD 1XN7A 3LO8A 3VYRB 1E43A 1TUIA 1B8IB 1O7LA 2NSTA 5L3EA 4RDJA 3D5RC 1H89C 4YZAA 4D5FA 1F1ZA 4XR6A 2K9MA 3L00A 4P6YA 1UD3A 1S72B 1PJRA 2HKOA 2NRAC 1DDIA 1R00A 3OSGA 2HQNA 2AS5F 1WPCA 3B8YA 3F21A 1NRKA 5HNHA 3FXMA 2PE3A 3QOEA 4BQNA 1QCXA 2B0LA 5LLQA 1TC3C 1XMKA 5C44J 4KT6A 3AG3H 3HKZA 4DYRA 4HF2A 1HA8A 3F22A 3TP3A 2XPVA 3OIQA 2NNNA 1BBYA 1R71A 2D2WA 1XC5A 1TTTA 1X1AA 3H09A 4A0YA 3FXUA 5HLGA 1B4AA 4NC7A 1WJBA 3DQVC 3A35A 3I55B 3PUFA 3MKZA 2PEXA 5H20A 2JPCA 2EQRA 4JX4A 1JHHA 2M0MA 1J0RA 1KGSA 2WB1A 1FP2A 4N9HA 4E7HA 1K7AA 2EV5A 5HDGA 4KKUA 3W2AA 2O1DA 1FIPA 4XRFA 1WGXA 3TO7A 3RKXA 3D1NI 4YAFA 2IGMA 4V19K 1RUNA 1FSEA 4RD4A 1DBOA 1GV2A 5DTDA 4BE1A 2KRFA 1S5LC 3L09A 4AD9A 3GZNB 4U0VA 2VFMA 2DFHA 2VNHA 1YO5C 1GXQA 1DU6A 4P1WA 2M9HA 4KN4X 4RAFA 3WTUC 3I4PA 1ETKA 4XL9A 1P4WA 3ZMTA 5IPAA 2DOFA 2C78A 3OY9A 1F5TA 3GQ7A 4PJNA 1YIJI 1K6OA 2H27A 5DEQA 5IK2A 1HVXA 3D0SA 3BTLA 2Z8GA 1IV8A 2WAQA 1FRQA 1S9HA 1SANA 3ZSCA 4LMYA 2XZLA 2J8IA 2E1OA 1W87A 3VOEA 2DQLA 4DQKA 2BXZA 5HLTA 1VQ7B 4A3IJ 3AVXA 4WF2A 3KRGA 2AXTC 2NXNB 3MWMA 4A5MA 2CF4A 2X6YA 2YX4A 2QKLB 3DTEA 1WSVA 1O8LA 1OGJA 4P22A 2JZYA 3SLNA 5AIPA 2IBDA 2DT6A 5ERIA 2JN9A 3KE2A 2KP6A 1K28D 1DDNA 1MBHA 4I0BA 1X3ZB 3NWTA 3A3BA 2KIUA 2R7UA 4O3MA 1D1AA 1WP6A 2GJRA 4L9NA 4G6TB 1DUXC 3QPLA 2EIKH 3ASRA 4I09A 2IGKA 1D8TA 1OB5A 2LBFA 4LBZA 3RTRA 2DAOA 1HOMA 2BVMA 2VKHA 3EUAA 4XM3A 3MMPA 5J40A 5AN9A 1Z7LA 1JHFA 5FO0A 1FNMA 1RESA 5B1AH 3CCEI 3ZQLA 3CCUI 2K27A 2FBHA 3HJEA 3CQZJ 5HVQC 4G8XA 1A5JA 2QGUA 3HKZN 4IX7A 3I54A 1XSDA 2R7TA 2OYNA 2L2OA 3BR5A 3V4GA 2D45A 3JRDA 4PC1A 4ZCIA 3GLLA 4C3HJ 3HRUA 4MFEA 1IF1A 2Z33A 1X2MA 1G3SA 2BY1A 4EM1A 3Q6RA 3CTAA 4I76A 1LEBA 2QWWA 2EZHA 3NQOA 3G1LA 1K79A 5JLVC 2WB1N 4BXFA 2NVQJ 3BR0A 1HCRA 1BW5A 4ZGQB 3OIPA 3JR9A 3Q6QA 2F4NA 3K2AA 2VJIA 5F6FA 3LA3A 4LOCA 3IRRA 1R5HA 4W97A 3BDDA 2HFHA 3SZPA 3ASPA 2VNIA 2IOUG 2BZTA 1X1DA 4JYKA 3V8KA 4DGWB 3S1QJ 5IYBJ 3BT9A 1HDDC 4N3GA 3S2WA 2INVA 5C1CA 5J6XA 5L3BA 2IPQX 3ONUA 4M3BA 3S1RJ 1KCCA 3W6VA 3M7GA 3NAUA 3GVJA 2O0VA 1XGSA 1QFYA 3IKTA 1X2NA 1N8RD 2RVCA 1ORKA 3OYMA 1OGOX 3LYCA 1XG2A 3R0AA 3CW2A 2KHMA 2WAQN 1BX1A 1OR7C 3U2RA 1XFOA 4RGSA 5EMNA 3ZR8X 2VBUA 3ZZUA 3G73A 4Z4RA 5LGUA 2VFQA 3WWGA 2IA0A 2FX3A 1ZG3A 1OOCA 1J9ZA 2VJJA 3DEUA 5D8LB 1O8IA 2JK3A 5A2QK 2Y69H 1YYVA 2LVSA 1N07A 4QFMA 4X1EA 4BDZA 4YFXF 1GV5A 1PJ6A 3G3ZA 1E3HA 1VQ5B 2BGCA 3AL0B 4XONA 5IP7J 1PJ5A 2XZOA 2XHKA 2F5EA 5EYRA 2ELJA 2X1EA 3G6EI 1WHUA 4V2GA 3ABLH 3SJZA 2NZMA 3M1EA 3GBGA 2IJLA 5KK1A 1QUFA 3HRMA 4LC0A 1UG2A 1FIAA 4ZTFA 3JAMK 4BUPA 4E70A 3LQQA 3ZMDA 4UB8C 2NNYA 2QYUA 3LA2A 1FZPB 3GFMA 3PFIA 3PNTA 4HOBA 2XT2A 3N4MA 3ERED 1YRNB 1B72A 2QTZA 1NK3P 2ZJQF 2HLDA 4RD0A 2O6GE 1K6YA 4PSWA 2UUZA 4MQ9F 3I59B 5IYCJ 2MFZA 5FO1A 4AIDA 1Y1VJ 5D5XB 3KX2A 5F27A 1XQBA 3CJNA 4MIMA 1UG0A 3U1KA 5BPIA 4BE2A 4C3IJ 1A35A 3WTTC 4YFNF 4CCJA 3FY3A 5EZHA 4OIQF 1N06A 3K4JA 2NVYJ 4IF4A 2Y9ZA 4G6DA 2EIXA 4P2NA 2K86A 3MCZA 1ETYA 2P7VB 3UR3C 4N9IA 1R5NA 3REOA 1A31A 3I56I 3LSKA 3GCMA 2QENA 1HBXG 2DFFA 4ESJA 1JXSA 3ASSA 3S1NJ 3WTXC 1EXMA 1JKOC 4HA8A 2R9VA 1WRJA 1K8AD 2O0WA 3KPHA 2O5RA 3OZWA 4KKSA 5BQTA 2ACJA 2CQQA 4ZV4A 2MG4A 2Q2EB 2ZXJA 4YFKF 4L9JA 3JRBA 5FRMA 2RN7A 2Z16A 3ZZTA 4NBQA 1T6YA 1VQLI 1E3XA 1X58A 2BY3A 3HUGB 2DYRH 3KFWX 1CGPA 2X0LA 3ZPNA 1VLYA 2WJYA 4G6IA 1Z05A 2LR8A 4HAMA 2L7KA 2QMUA 2GPJA 1HC8A 2CW5A 5HS9A 2R7ZJ 5IT9K 1WORA 4YEJA 3D5LA 1JB9A 1XE1A 3FF5A 3QFRA 5TGTA 1GDTA 1MSFC 4RMNA 5DM6F 2CUZA 4MQVA 2LREA 1IO2A 1ULYA 2HI3A 1Y0YA 4MXNA 2M8EA 3CCYA 4M53A 3QP5A 3MAJA 3HOTA 1DABA 1Z7UA 2QA4B 3ROUA 3JRGA 5D5UB 3JQRA 4FXUA 3HZJA 4X0GA 4I98B 3V7SA 4BBRJ 2XAJA 1PE9A 3DPLC 3R4KA 5FJ8J 1WH5A 2WA0A 1QGPA 2DODA 1TWCJ 4Q4ZF 3A2KA 3LMWA 3WXMA 2XEXA 3WNCA 4U88A 5F0FA 3WTYC 1T8IA 1SD6A 3R0JA 1LVAA 4Y17A 5E8GA 3VSTA 5JVGF 4C2LA 1PDNC 4Z4ZA 4BY1J 1YHQI 1N0UA 2NV4A 2MYSA 3ECOA 4YDTA 4QUZA 2O3FA 1TVCA 2GA2A 1T6ZA 1Y56A 2Q6OA 4MO7A 2OA4A 1ZR2A 4L0YB 3F8NA 1IGNA 3ZN1A 1P6RA 3GTQJ 3CCQB 1W5SA 1XDSA 5KAIC 3R6SA 3F6VA 3CC2I 3CP8A 2JRMA 1V0FA 4M4SA 3A1PA 2L7FP 2LKPA 2NS0A 4JX6A 4YELA 4A3EJ 4BL0B 1O3SA 1VQ4I 2DA2A 4IRHA 3OMYA 3GX4X 2XF7A 1U78A 1WSRA 2LTPA 3H5RA 2F5CA 3BTJA 3LMMA 2DEUA 1OFEA 4HSTA 3VYTB 1LPQA 3BY2A 5H6RA 2JSPA 2WWYA 3BWGA 1TQPA 1SD7A 4GDFA 3K70D 1QUEA 3SJPA 4CQJA 4KA4A 2FNPA 2AHOA 4HIZA 1MD0A 1KYZA 5BOXA 4PGOA 5J8FA 1QRYA 5ICGA 2IT0A 2R4GA 2XGEA 2CFXA 2KT0A 3MVPA 4I02A 3ABUA 3F6OA 2R7XA 1ELOA 1U2RA 3QP6A 3A8JA 3A02A 4H9GA 4KICA 2EV0A 4OJOA 1N05A 1KQSB 3K4CA 1ON1A 1Z0XA 1YIOA 1K4TA 1B6AA 2FMYA 3HOYJ 3RDIA 2M0CA 1E64A 2F4OB 1Y39A 4U87A 4KN7X 3ZQCA 1T0FC 3A03A 1KZHA 2JJ1A 3W5VA 1AIRA 4BNCA 1LDJA 4PAAA 4YFOA 3VSUA 2OCCH 3SDBA 3G4SI 3QRFF 5TY0A 1SC7A 3OEHA 1V4RA 1Q82D 1LFPA 3JTHA 4PUSA 3BCDA 1KJZA 5DS0A 5EG0A 2FSWA 4EGZA 1F4KA 4P9UA 3H5AA 2EPFA 1VQPI 3L1PA 5DCMA 1SKYB 4ZTJA 2VFPA 2ZJRF 2GBYA 4Q48A 2D3NA 2PG4A 2ZSHB 3B6CA 2L9NA 5BNGA 4BJTA 3GIRA 2JIZA 4Z4YA 2NYXA 1R5OA 2RDPA 3BG7A 1GHCA 2E60A 2MLKA 1TYXA 1SFEA 1TW2A 4F3QA 4E0FA 2DBBA 4YIIA 1KTVA 3L2CA 2CFOA 3SEZA 3KYCB 2KDOA 2GXBA 3LQEA 2ZFUA 1QGAA 1UELB 3QWLA 3CC7I 4IOAF 4JOMA 1QPMA 3P26A 4GCVA 2PLYA 4AC9A 3HC7A 2HEOA 4PC3A 1T6SA 3OSFA 4IHVA 2OK7A 1ZRCA 2KKOA 1YIJB 3QODA 1YG2A 3OAAA 2CQNA 2V1XA 4FK8A 5F4JA 1V5FA 3BR2A 1AKHA 2IA2A 2JJ7A 3BR3A 4OPOA 1MDMA 1ZGWA 1Y0RA 4X7FA 1S7OA 1IJEA 3BPXA 4RS8A 3Q38A 2B7EA 3U6KA 1YI2I 5HOOA 5HKKA 3TOAA 4WXHA 2Q0OA 1IAWA 1WU8A 1IN7A 2K5CA 3OOUA 4Z4TA 3BOQA 2BX6A 2KZGA 1UJ8A 2OZ6A 2OZUA 2LP0A 2V31A 4P9SA 1TLHB 3QU3A 1AMOA 3T8RA 4S0HB 1RUOA 2R7SA 2VBTA 2O7OA 1ERDA 1GXPA 5E1ZB 3A01B 4F7DA 4P55A 2DYSH 1W0TA 2E35A 4KITB 1FMVA 2V4JC 2HOSA 4EV0A 2Q6KA 2KLOA 2F4MB 2B9SA 3FISA 5B1BH 1TWHJ 2K3FA 4BEHA 2PMZA 4OU0A 1AHDP 4RLZA 1R6RA 1G7TA 4EGYA 2EFGA 3CCEB 5EEGA 3CCUB 1B9MA 3E5UA 3WODF 2HTJA 4NQWA 1I5ZA 1BPLA 3GFLA 5DUKA 2QF7A 5HNFA 4CYCA 1OCTC 1MIJA 3OYGA 4C0SA 4Y33A 3DKWA 3GTKJ 2Z2SB 5DD4A 3TBIA 5D8KB 2G7HA 5E3OA 1O8JA 4DZJA 1O8DA 4GFBA 2PYHA 2VODA 3RY8A 5IYWA 2DA5A 2QGGA 1LEAA 2DFIA 3PUMA 2OJED 4LBWA 1ETXA 1SVOA 4TV7A 5HDKA 2IP2A 3FMQA 3KP4A 3FIWA 5ED4A 4U49A 3SY2A 2ECBA 3GVKA 3V42A 2DK5A 4M6XA 1HF0A 1EFTA 4XNFA 3PVDA 4TMVA 4YZQA 1MBJA 2IGOA 1CZFA 2XC7A 3A0BC 3PM1A 4IRGA 3VDXA 3JTGA 4ZCLA 4M9ZA 4Z03A 2DA1A 2VE8A 2ZCWA 3LQ6A 3HOZJ 3CCVI 2VFOA 1W0JA 3H0DA 1TWAJ 1QHGA 5IT3A 1VQ9I 3I5UA 3CJRB 1P7IA 1V0EA 1OYIA 2PMHA 3RI4A 2CQXA 2IAIA 2Z3YA 2QBYB 1G7SA 2EIJH 1AWCA 2XT4A 1E2XA 4DBRA 2QE7A 4OIPF 1QRBA 2K9QA 3J81K 4YRVA 3GZ6A 1OFLA 2STWA 1R5ID 4GGGA 4C43A 4XKWA 1T2KA 3TW7A 3BROA 1IUYA 1IUFA 1KRHA 1WCMJ 3FXKA 3DTIA 5IYPA 3FPPA 3WU2C 4D7MA 1MW7A 4LG0A 2MLGA 2DPDA 3K69A 5CQEA 4ETSA 2BY0A 4R1HA 3HGGA 2MD0A 1QFZA 2ETHA 3WTVC 3OOPA 2VNKA 3DU1X 3E1SA 2ZBVA 3G6EB 1OYWA 3ZIAA 1BC8C 4L9TA 3BH6B 1IXSB 2PMDA 1Q81D 3C3WA 3FXLA 5GPAA 3RKWA 2F5DA 2HXOA 4C30A 2QQ8A 1KQ9A 4EEFG 4E7JA 2O6WA 3L7WA 3HOUJ 3FPKA 2ZO4A 3CF5F 3OE7A 4YAWA 2P5KA 2YR2A 2BGJA 4UVBA 2RC5A 1O8FA 1OISA 3ZBTA 2QLZA 4BAYA 1ZGAA 4YZ0A 2MBFA 2P4WA 3HXLA 5F08A 3S3MA 3WE2A 2UWMA 1RETA 4KIBA 2DMNA 3HL2A 1QH0A 2P6SA 4Z1MA 3AVUA 2R5YA 3HSEA 1IZ1A 4BBSJ 1FOYA 1LLWA 3QYEA 3OJXA 1TZLA 4KYWA 4DIQA 2V4DA 2NS8A 3JW4A 4K1XA 1NJID 3PNVA 2DFEA 3CCSI 2CW8A 5FFZA 4RJLA 2JN6A 4XSXF 4JK1X 2JVHA 4L0ZB 1QNTA 3F9KA 1FWZA 1P2FA 1PVEA 3J80Z 2D9RA 1V5EA 3R6JA 4RM0A 2ZZFA 4R79A 2XVCA 5HZAA 2DJIA 2X1DA 1K78B 3PENA 2V1DA 2Q6LA 3H1CA 2YU3A 3WTZA 1G7CA 3I56B 1J5YA 3ZOBA 5JI6A 5C3EJ 1JGGA 1IRFA 2PQ8A 1D3YA 2IVMA 5K7FA 4YZXA 1G3TA 2Y48A 5J1UA 4G5GA 3GF2A 5CLSA 3K6GA 3KZIC 3U21A 1RQPA 5IP9J 3PO3J 5GADJ 2Z6BD 4DYQA 1EP1B 1K5CA 1N08A 3B78A 1G4DA 1VQLB 1OB2A 4XKCA 1JGSA 3AG4H 3Q0UA 1NHAA 1XG1A 3K0LA 2VUMJ 1W4MA 1YQAA 1WJ5A 2LOOA 3KLNA 3GTMJ 2V7XA 1TYUA 1JUSA 4A3FJ 1YX5A 2FMLA 2FQ3A 1JRGA 2IQ7A 3F0CA 4D0PA 1D5YA 2ZZEA 1IN8A 1IXCA 2WC2A 5CQGA 1FY7A 1VI0A 1FNBA 2C5HA 1DU0A 5EEAA 3HPHA 3P27A 4RLQA 1OCPA 4M3GA 4G7XA 4KDPA 5D5WB 4PJMA 3LSMA 4AUXA 4DQ2A 1EJ9A 1XPXA 2E71A 5CPRB 3H36A 2X8KA 1T6XA 4HPQA 4A3JJ 2G9WA 4EJTA 2GREA 2HPIA 3IUOA 4HX8A 1YHQB 5D6FA 1N25A 5FFXA 4DBQA 1YFHA 2GJKA 3H3VK 3WHBA 3PA2A 2VASA 2PYGA 3RCOA 3DTKA 3SHFA 5LGNA 3KEYA 4WX9A 5KCMA 3WBJA 1L3LA 1J7KA 1KK3A 4M3DA 4W1UA 1H0MA 4CUGA 3NARA 2B5OA 1HF2A 2LF8A 2O03A 3CC2B 2R93J 2UXXA 1VQ4B 1VQNI 2LY9A 4JMQA 4UUTA 4HX7A 5DV5A 2VKDA 5LRRA 1W36C 1RKTA 5JLWA 1EP2B 1DPRA 3G2BA 4KJZA 3WNDA 2ZC2A 3C18A 2RKHA 4GYIA 3TEDA 4B3AA 4LB5A 1I27A 4UXNA 1OGIA 3EQLF 1GVJA 1VQKI 2OD5A 4QWQA 1QBJA 1W0UA 3C2BA 4DK1A 2GQQA 1HLVA 4XRMA 2BEOA 4I0AA 2A61A 1H80A 2LC2A 2JSCA 1YW7A 3DBLB 4M1KA 5F4MA 5FRNA 4XLPF 5FA6A 5AIQA 3DCFA 4CCOA 1Q86D 1O88A 4ESFA 2VJ4A 2W25A 4B8XA 4WK8F 3W6JB 4HNUA 3SJMA 5BMZA 2BN4A 4G7HF 1UCRA 2EFQA 1T39A 1PP8F 3BR1A 3KL9A 1IN5A 1YOVB 3W2GA 3BLYA 3MFKA 2ZMEA 3M8EA 2DPUA 2D1HA 1UD5A 3RKQA 2GAUA 9ANTA 1WTHD 4BQAA 4QSHA 2X0KA 3CUQA 1H8AC 3WGHA 2FEZA 3QPTA 3EQNA 2QQBA 1E17A 5E1XA 3OZVA 3U9GA 1Y0NA 3L2UA 1ZR4A 2QQAA 1UB9A 2PJRB 1J59A 1ZM3A 3SLDA 5FROA 3PNYA 1SVMA 1U8RA 1LE8B 1FTTA 3HHGA 3DEEA 5DD8A 3H9NA 4KISA 4LGWA 4IW3B 2RC6A 3G4SB 4XKVA 3ZMUA 4IL6C 3OOCA 5L3DA 1PUEE 1IDYA 1UHSA 2Y30A 5TR9A 1VQPB 1K73D 4OPVA 4YIRX 2JA5J 2HU9A 5D6EA 1I6XA 1JUMA 2ADUA 2ZZGA 1TNTA 1Q1VA 1U0JA 4WQMA 3BJOA 1F20A 2R7FA 4ZJZA 2L54A 3KP6A 1XB4A 2ZJ2A 4HV6A 4HE5A 3ZGKA 2BSAA 2LSOA 4HG2A 1IJWC 1OHHA 4PMHA 4LFUA 1QJVA 2XNDA 3GTGJ 2NSPA 3CC7B 3DKYA 2XASA 3ZQQA 2EWEA 3E7LA 4NUBA 2QEXI 2HDNB 4HLYA 1X1PA 3MZ8A 2L9SA 1GJRA 2VBYA 3IAM2 2LMDA 4M3EA 1O3RA 1Q9SA 1K9MD 4UZFA 2QSHX 2CU7A 1KU7A 2B7BA 5HXBA 1A6IA 2J7KA 2WJVA 2JRTA 4JQFA 2OV7A 2GIZA 4BKXA 4HRIA 3CF2A 2PJPA 3BJAA 2V6EA 5DCFA 1YI2B 1O8HA 1Y0UA 4L18B 1YX3A 4MTDA 1BHEA 1OQYA 1MGTA 2X1CA 2XB5A 3O6BB 3RQIA 3RZDJ 2DJNA 4DJAA 1WOOA 3KIOA 3R61A 1EA3A 2L0KA 3N90A 1DARA 3OYAA 1F9NA 4IEJA 2LRDA 3TOBA 2FXAA 2V9PA 2ZKZA 2Q1ZB 1KQ0A 4M73A 1T5EA 3WGGA 1BM9A 1KU3A 2EZIA 2XAFA 1QPIA 3BZ6A 1XTAA 3OS2A 1IDKA 1NB9A 4KH3A 3JSPA 3MZYA 4PC7A 3WBKA 4ZDOA 3OZUA 3CDIA 3M1CA 1DQUA 3RJPA 1RRJA 4HX4A 3O8GA 1MJBA 2DMTA 2W82A 2VBXA 2CV2A 1WOPA 3OYFA 3ESWB 3GFJA 3LJYA 4ACAA 3UKGA 1YITI 3E5QA 2KIFA 4U9UA 2RC4A 3S2HJ 4D7NA 2CJJA 2EK5A 5J47A 3F72A 4G94A 4UHTA 3NB2A 4MYTA 2D5VA 3E6DA 4V2FA 4UV8A 4XN3A 3VYSB 3WYAA 2VYQA 3BQJA 5J3OA 2A05A 3KETA 1XSVA 2JQ7A 2L5QA 4BXXJ 2PECA 1JNYA 2H8WA 1SD4A 2A68F 1IN4A 4O5VA 4G1BA 2UVEA 2P5VA 3HB9A 3MKLA 1HDPA 4X7CA 2YSRA 4IHWA 1KONA 3KP2A 4C9YA 3NWSA 3DKXA 2BE5F 1JE8A 5J8CA 2W85A 4XLHA 3OW2B 2QX3A 4GQNA 1V54H 3GWZA 3VB2A 2JT1A 2BPOA 5CJ9A 4FCYA 3BZKA 2Q2EA 4A69C 5GAEJ 2WYRA 3CCVB 4XOPA 4CYDA 3TGNA 3TH0A 1D5VA 2X6WA 3CCRI 5F4OA 1VQ9B 3CMMA 2HPMA 3C1DA 5EDNA 2C4UA 2ISZA 3Q9VA 2DQRA 3RKYA 3OYLA 1Q7YD 5HS7A 2EFNA 1YJ9I 3JQPA 2ZB9A 2GQFA 2UZKA 2A69F 3FM3A 4CDGA 4FISA 1V5GA 1EP3B 2NT6A 4ZYHA 4ZCMA 2F3LA 3PIOF 1VFCA 2W48A 4OZZA 2XKOA 2WAFA 5E17F 2HZDA 2J8KA 2L9VA 2MH2A 3S17J 2CW7A 2DI3A 2DY1A 5FD6A 1BJKA 3ES9A 4CICA 4HDVA 2V7TA 2IGNA 2BF4A 3O3KA 4Z4WA 1BI3A 3S3OA 2JPBA 3WNBA 5FGMA 3PQJA 4TKOB 3FWEA 3OEEA 1RC9A 3K4LA 4X7EA 4M3FA 1XMXA 3GTJJ 3K1NA 2VNJA 4XRSA 2LBFB 2P6TA 3F8FA 3KEOA 3VFZA 3AVYA 2OTLI 3IH2A 4LD5A 5BS6A 4L5EA 4Z06A 3GEZA 1QO0D 2DU9A 2ZZQA 4L5JA 2COBA 1RWRA 2VB6A 3W2WA 1I39A 3ISXA 4BXUA 1V3FA 5CVJA 3LNNA 2QZ8A 4HNVA 3CRZA 3CJQB 2VQGA 4S05A 2VPLA 5L3FA 2HCJB 3OR2C 5FB2A 2XROA 4OP7A 2TCTA 4RPDA 1WPKA 3CCSB 1J75A 4ZGNB 2VFNA 1VNDA 3Q3SA 4OPWA 2HYFA 4O6JA 2MD5A 5HODA 1EFUA 1I6HJ 2GXAA 3OR1C 3AVWA 2FVGA 1TBXA 3M4OJ 1Z6RA 1IDZA 3SZGA 4BYYA 4BU2A 2GOXB 4ZC3A 3WU0A 3L2RA 2Y75A 3GW2A 2XV4S 2BGIA 1LQ1A 5C1EA 1TSPA 2JA7J 3H5NA 5KHDA 1B59A 4I6ZA 1EH8A 5DUIA 4NHJA 1CF7B 5B3SH 2ISYA 3JQQA 5J35A 4K2EA 3RPUD 1D1CA 2XPWA 4KMUX 1LB2A 3EYIA 4C2UA 1GO2A 4UZUA 1OCCH 4WZLA 1OGMX 2O8KA 4Y4RA 1PUFA 3EETA 4RA2A 1FX7A 1P4MA 1MJAA 1UMKA 3A3GA 5FLMJ 2PMUA 1S3JA 4UUSB 2LLKA 4A6EA 2VT3A 5HDNA 2CQKA 5JHFA 1XB2A 1MBGA 4Z05A 2K9LA 2QCOA 2AQEA 2WY8Q 5E79C 2L02A 5H5JA 2DK8A 1D8JA 2P81A 3P5JA 5JVTA 1HA3A 2WZPP 2PLFA 3S8PA 1TT0A 1Z3XA 3W6KB 1D1NA 4BACA 5E20A 3Q39A 3B90A 2L4AA 1EH6A 2FOWA 2K9SA 4M72A 2TRTA 5LMZA 2OBRA 3WQZA 2HQ5A 1TYWA 1AA7A 2O04A 4FX0A 5K5RA 1KQ8A 4AF7A 1FSHA 1ZN2A 1MMAA 2RGVA 5H6QA 3IV5A 5IYRA 3OYEA 5A88A 2K40A 1EF4A 4XN0A 1WI3A 1CQTA 3VSVA 3HG9A 5F0CA 1SEUA 1SFUA 1R5GA 3HDDA 2XKPA 2R92J 2OBSA 3S16J 4YXWA 2NVTJ 2BM5A 2R0QC 1T98A 4PJJA 1D0YA 4OPSA 2QDXA 3ZP5A 1TP4A 4HBLA 4H0EA 2HVRA 3M3YJ 4RB0A 3PQKA 5KW9A 3PSIA 1QA6A 1TW3A 4B43A 2DA7A 1VQNB 2Q8KA 1K8FA 4PGHA 4UV9A 3TMOA 1HKTA 5KSWB 2R7OA 4X0CA 1DP7P 4PSXA 4B4CA 4EW9A 3GFIA 4NCNA 1VQKB 1XCVA 2VKVA 3PSZA 1NB0A 1ZG1A 1Y1WJ 4HSRA 2OQRA 4WXDA 3I3LA 2JJ2A 4WZTA 4A0XA 2V26A 1P9QC 4KKTA 4RAGA 4IVNA 3HSRA 1IJFA 2RNGA 2E34A 3H9QA 3CC4I 1QFJA 3ZMSA 2JA2A 2C6YA 1IRXA 2CUEA 4B09A 5DM7F 2GA1A 3B6AA 2B7CA 3P4GA 1R36A 2VPRA 2JUGA 1FOKA 2LZJA 2HOAA 4DOZA 4FE4A 3T56B 5LFAA 4URRA 3RIRA 4KIFA 2PBIA 1TWFJ 1KYWA 1E0EA 1QVGB 5J3LA 2CGPA 3JCUC 2C2WA 1WJDA 5K5OA 1KU2A 4ENNA 1COWA 3KZYA 3WHCA 1LDKB 2BW3B 4Y3OA 2EH3A 5HLIA 3ZBUA 3ZN0A 1CNFA 3IH3A 3CCMI 1HQCA 4CGZA 4BPRA 1I3QJ 2HNHA 4ABZA 4HWVA 5FLXZ 2MC4A 3VR6A 1R7JA 1EE6A 4GRIA 4XLCA 3TDUC 4J00A 1RZ4A 4J01A 1BOAA 3M07A 2IS2A 1DBGA 3D26A 3E3VA 5M5YJ 1SM4A 2V9KA 2COMA 3GYHX 3QPSA 4HF1A 3T9GA 4RCYA 1H42A 2Y0SA 4EJUA 3WG7H 5CDFA 1HSJA 2RQQA 1QZZA 4CCNA 1KK1A 3GQ8A 3EUHC 5BPDA 2LY1A 2VBZA 4P3YA 1NG7A 4X07A 5LEKA 2FU4A 4RM2A 1E3ZA 3B02A 2OPTA 3WE3A 3OYHA 1P7JA 3CDLA 4RBOA 1R23A 4LIVA 3OKXA 4MFDA 1H8EA 3V76A 1WXRA 1BL0A 1BIAA 3LSRA 4HQEA 2QEXB 2BXYA 2E36A 1TWGJ 3ZPLA 3GSIA 3BNWA 4DYCA 3KP5A 3PIPF 4F91B 1HW1A 1R1VA 1WWXA 2HOTA 1YJWI 2L4MA 2R6HA 2AO9A 4Q7JB 4N4NB 3L2WA 4Q47A 1MKMA 3P9KA 4CH7A 4XIDA 3BH4A 2E7WA 1FJLA 5FKMA 2YWEA 2KL4A 2OC6A 3CDHA 3K4BA 2KIQA 2NT9A 2LG4A 5IP6A 3FX3A 3OYIA 2VE9A 3AVVA 1S7AA 2VXDA 2P8TA 4PJLA 1ZRFA 2ZXIA 1GLNA 3ABTA 4PFOA 5E3LA 4FN5A 4UY8I 3BCBA 3WGIA 1GQ8A 2WY7Q 1OYYA 2M87A 1JKPC 2KPMA 2EIMH 2IEKA 2WTEA 1H88C 4EH1A 1W9XA 4U0WA 4L5IA 4BY7J 1ZG5A 3PUBA 4QPQA 5B5EC 4QPOA 3HHHA 2HXIA 3Q3AA 4DW6A 3JU4A 2V7QA 4RGUA 2Y9YA 3W2EA 4RDLA 1KTWA 4PABA 1P92A 1W7PB 4XK4A 3B73A 2R7VA 1WZ2A 1E79A 2F5FA 1X4PA 3RPUA 2I5UA 3BCFA 5FIUA 3RZOJ 1YITB 1B1BA 3QFCA 4RD2A 2OF7A 3ONYA 1ZARA 2G0EA 1D0XA 2ZSIB 3VSLA 1HW5A 1REPC 1TQIA 2GZWA 3DBHB 1XS9A 5AMVA 1Y6IA 2BV6A 4NNJA 2MW8A 1U5TC 4LLGF 2DTRA 3P7NA 1ZM9A 3ASQA 4CXFA 3KCCA 3AGPA 1UMQA 1ZAOA 5EG0B 1UHWA 4PFPA 2Y0SN 3MQ0A 4RB2C 3GQBA 4MNUA 4CZCA 2VI6A 2CO5A 3DXJF 1LFUP 2DIEA 1O8MA 3F8BA 4N0BA 5D5VB 1CQXA 4LITA 3SYTA 1WMRA 2QYOA 2VLAA 1K78A 2CNDA 3LSHA 2KRCA 3FKIJ 4Y15A 4EMSA 1UAAA 3SZEA 4ENJA 2Z5UA 1BN5A 1ZRDA 2FQ4A 1JT6A 2DMPA 2M5WA 1ZM4A 4FHTA 4HQMA 2ZNZA 1BN8A 1LNWA 3C7JA 1FPQA 3VODA 1EFRA 3NAWA 3ZQHA 3I4NJ 4KUMA 2M4KA 2NVUB 3ZQ7A 4NC6A 1OMIA 4AIKA 4OOSA 1HXDA 3Q0WA 1BJZA 3BC9A 2ZJPF 1QVUA 2VC0A 3CCRB 2MGQA 2XPUA 1Z91A 3OYJA 3LAPA 3V8JA 5IYDJ 1ZELA 2KFDA 2DW4A 3HOSA 3BR6A 2VIXA 5E3NA 5TJJA 1AKHB 3TDZC 3BQZA 2FF4A 4I01A 4PDKA 1YJ9B 1MDMB 3DLAA 3LQRA 1IA5A 2PFBA 3JURA 4ACBA 1X4OA 1T0FA 4OM9A 3QPHA 2XNJA 1C0WA 1NBMA 1OPCA 2DOAA 3H94A 4XQFA 5LEJA 1OB0A 3J81k 4C3JJ 2VZLA 2EFWA 2EA4A 1VF9A 4MTEA 3HAGA 2BM4A 3BY6A 5K7ZA 5CVRA 5ICCA 5CKTA 4NK8A 4U4BA 3CCJI 1O3TA 2KMUA 5TRDA 2PMZN 1D2EA 4ROXA 4UZEA 2ME0A 5ICFA 2XSDC 3IWZA 3CUQC 2HVSA 4A3CJ 2EBIA 5L3CA 2OTLB 5E6TA 1I1GA 1JTAA 3AKZA 1PLUA 4FE7A 4HE6A 2UVFA 3JX8A 2ODLA 5GP9A 2YWGA 4A5NA 2BM0A 3GTPJ 2WAEA 4NQWB 1OFDA 3IL2A 1LKXA 1UHMA 4FTHA 2DXIA 4ZYEA 4CYCB 4OIRF 2VONA 3GZ5A 3I4MJ 5EF6A 1H8HA 2E2JJ 3HOWJ 3LNQA 2P7CB 2DA6A 3SXYA 1W5TA 1FNNA 2W24A 1B8IA 3V7CA 3M9AA 1SVLA 4OWRB 2Y31A 1OFMA 2X3HA 2M2EA 5BSYA 4OZYA 2K4BA 2IXSA 4IPAA 3FMSA 3J80K 1IC8A 1MNMC 2ELKA 1FTZA 3JRCA 4CSWA 4UUVA 2CC2A 2FOKA 2KIMA 3GUDA 3H35A 3QAHA 1SMYF 1U9NA 1MABA 3QSYA 4WWCA 3AGQA 3JRFA 4C2TA 3SEJA 2ELHA 4NK6A 5JLXA 1YJNI 4Y7CA 2NTPA 4RDUA 3ULQB 3NRVA 2D74A 4QHYA 1HKQA 1U8BA 1XGOA 3DV8A 3Q0VA 4WZKA 4Z4SA 3AG2H 1ETOA 1EV7A 4H4KC 3S32A 3ZCOA 4JRAC 1LVKA 1ZH5A 1ZKGA 4F92B 4B3XA 4ITVA 2VBKA 2L7MP 1QQ1A 2X3UA 3QU6A 2HS5A 4TT3A 1Q1HA 2ZXWH 1Y8RB 4JP0A 2NOGA 3LL7A 1W36D 1Z21A 1HKSA 1PJ7A 1HG8A 3GLXA 2CRGA 5KAFC 4OAYA 3EYYA 4TMTA 3GVLA 4G9YA 4LLNA 4ZDPA 1GAWA 1E1QA 2EFOA 4UB6C 2A5WA 2CQ7A 4YIFA 2K4JA 4IOCF 1GVHA 4LK1F 4Y9RA 4FETA 1U2WA 1OFCX 1HSTA 1Z77A 1YTYA 3HM5A 2YWHA 2L9RA 4EJOA 4PGGA 4QTRA 2F1MA 1FYMA 4HV5A 4LG0B 1UZCA 2X53S 2XOKA 1A04A 3S93A 1ZHFA 2ZTGA 2HQAA 1QVTA 2X48A 3C2GA 2XGXA 2NTBA 4A6DA 3AG1H 4A3MJ 2RAEA 1X1CA 4Y13A 3CMAI 1R1UA 3HEFA 3AK5A 1R5BA 4AF6A 2RNJA 1Y8QB 4XKBA 5EGOB 1ZLKA 3DF8A 4RGXA 2GWRA 4Z6YA 2RV8A 1OCRH 1BQEA 2DO7A 1YW9A 2XIGA 3GQAA 3BH7B 1R4NB 3U1DA 5K5QA 3DLLF 2LD5A 2FJ1A 1U3EM 2W57A 5LHGA 2BOLA 1I18A 1POGA 1TNSA 4ZH4F 2R5YB 2CV0A 2HKXA 4NB5A 4MYUA 3PJRA 2WV0A 3MZHA 2ID3A 3F8MA 4DK0A 4MLOA 4KFCA 4II3A 4EM2A 1SAXA 2HWVA 4BGDA 2B63J 3S15J 3JREA 2C77A 5B6IA 4W8SA 5ICEA 2CK3A 2KRHA 4BHCA 1R22A 3CC4B 1MMGA 1G59A 3HOXJ 5E3MA 2ZTNA 4UVCA 1ZREA 3CCLI 2VQLA 3HOVJ 5D4RA 4XLEA 1EZGA 3GRHA 2TDXA 1KU9A 2M7AA 4M6YA 2WZNA 2QVOA 3FXRA 1EA0A 2Y0MA 2V1UA 4IHSA 3ZQIA 5F64A 1G6NA 3LWFA 4EM0B 4ESBA 1TL8A 1BR1A 3LFUA 2VBSA 1MNEA 6PAXA 3JSOA 3B82A 1FOXA 1MJ9A 1VQMI 2VOPA 3RQ4A 2CUJA 2K7LA 1GUUA 4HF0A 5FLVA 3OYNA 4U7BA 2BBYA 2HQRA 2XF5A 3CCMB 2P5LC 1OLTA 2EFPA 2KQRA 5TISC 1WQ2A 2PI0A 2WR8A 3CD6I 2XNCA 1ENHA 1JJ6C 2HVQA 1G2HA 5M5WJ 1VQ6I 3ZZ0A 1FC3A 2YX7A 4LK0F 2DLLA 3FM5A 1D1BA 1KK0A 2XAUA 5KNLA 2LFBA 2JDIA 4Y7NJ 4B1RA 3A8KA 3TQNA 3OV8A 5C4XJ 2L3DA 1BI1A 1VHOA 5LRSA 1U5TB 2VQCA 3R60A 2YU9J 3I1FA 4CO8A 4YG2F 3FK7A 3BC8A 1IRZA 1BX0A 4IZZA 2KDZA 1P4XA 1WFXA 3PETA 5E1WA 1JI8A 1JUPA 2H6BA 1FMWA 4AC0A 4OJLA 2EB7A 1T56A 3CO6C 3VNUA 3TO9A 2YPRA 1FRNA 2O61A 2W4SA 3F3XA 2F43A 2NS7A 4BE0A 3WTSC 3DWLE 2HDWA 3DU5A 4P9FA 3HYIA 2W6IA 1S29A 1WJCA 1JJ8C 2HTSA 1E63A 1IDJA 2FA5A 3E5XA 3VYUB 2BMWA 2ZBUA 4M2LA 1W2BB 1QQIA 5HS8A 2OU2A 2VJ5A 2JMWA 3KZZA 1RIOH 3OJWA 3HSFA 2R5ZB 1AU7A 3GTLJ 3GXOA 2ECCA 4OOIA 1WJFA 4IXAA 2QKMB 4NC8A 4XLNF 3ZQGA 1YJWB 2A6TA 1QA3A 4L9VA 3S14J 4KMFA 3NE5B 3OPOA 1XDUA 1O3QA 1U6GA 2M7BA 1I1SA 1MZBA 3OS0A 4XBFA 2X4HA 2O9LA 3VEPA 4RM3A 3CMYA 4BJ6C 3BG5A 1XGNA 2JVGA 3BTCA 3VO2A 1JT0A 3FMRA 2K85A 4ZZDA 4YAUA 4OIOF 3PSSA 4CHUA 3KP3A 1P4AA 2W6JA 4TMXA 3ABMH 4DQLA 3V7RA 1Z6TA 4XLFA 3BZCA 2GK6A 5K7HA 3ML3A 1YS7A 3FXQA 5FKKA 4BQQA 1PYVA 3OYKA 1GAQA 2FNAA 1BLIA 5IYNA 2G7UA 2YUSA 2KVOA 1V55H 1YRNA 3LVBA 3FK6A 2JWTA 2ZMEB 4YHBA 1HW2A 4I84A 2FBIA 4E4HA 1ACIA 5FKNA 1QA2A 1MRZA 2GXGA 2CW0F 5CYVA 4TN1A 4M6VA 4C2MJ 3CUQB 3FXJA 3I59A 2XDVA 4LIUA 3FDYA 1NK2P 1BI2A 5FD5A 2M4GA 1NH3A 2H94A 3RSNA 4P5OA 3VNVA 3ASOH 2H8RA 1LM1A 2DA3A 5E18F 4AM3A 2BHZA 4D1QA 1BR2A 2A3SA 4A93J 5LHIA 4QIWN 2QSFX 4YC5A 4YAOA 5FKLA 2MABA 2A5YB 3F23A 3G71I 4AIJA 2CH0A 3MHPA 3KEWA 3BPVA 4A3GJ 2CS3A 4I7HA 4N4OB 1T33A 3ZQFA 1LFBA 2O0YA 3LSTA 3CP2A 2X6XA 2ID6A 2DCUA 1VBLA 4PZJA 4TMZA 4ANJA 1QGZA 2LDUA 4RDKA 4AIHA 5BSXA 2BY2A 3CJTB 1DGWY 3DPUA 3HUGA 1H9TA 4M9XA 1USTA 1SD5A 3DU6A 1MBKA 1I50J 4E7SA 3ZC3A 1W7PD 1CF7A 2E5NA 1R9TJ 3U2QA 5J1RA 4A0ZA 3E6MA 2C4TA 3H0GJ 5DS9A 3QE2A 1FNDA 4W8TA 2HYJA 1VJSA 3AAFA 1X0CA 1FBQA 2Y2ZA 1IW7F 2R7RA 1QG0A 3GQ9A 1EKEA 1U9OA 2V7VA 1M1EB 2DT5A 3H3ZA 2F2EA 3KLOA 3GVAA 3EUKL 3H9JA 5F1RA 5A2QZ 4UUSA 1R1TA 2ICWG 3SZTA 3S2DJ 2GIVA 4U0YA 1WJAA 4E7ZA 2DERA 1IB4A 2AQFA 2ZXHA 3ZUGA 4HDUA 2A6EF 1ETVA 2ZFWA 1X19A 2L01A 2O8XA 3W3CA 4AU7A 1QA1A 2QSGX 5LHHA 4RCZA 3E6BA 5B66C 2IS6A 1FYLA 5CVVA 2VL8A 2DDAA 1WJEA 1BC7C 1QGYA 4LLLA 4X7DA 2QY1A 2EINH 1W5CC 1DP3A 1VLOA 5GTIC 4FWTA 3X2QH 1TLLA 1EH7A 1UFMA 4F52A 3E6CC 3CCJB 4FX4A 2VBMA 2E5ZA 1G3YA 3ONQA 3LSIA 4CZZA 2DMUA 2LYCA 2K3PA 3FZVA 1V5VA 3AVTA 1ZGJA 3L2VA 4G12A 1QZYA 4BH9A 3JAMZ 4WXCA 2PIAA 1MSEC 3W2HA 4D9JA 4U7DA 3E0JB 2E1NA 4B4DA 3J7ZI 3ZPPA 2E1MC 3I71A 1YS6A 1RI7A 1N0VC 3K4KA 4RD6A 5FNZA 4Z4VA 3AFHA 3D5SC 4KT5C 3F8CA 1SMTA 5DN6A 1S0UA 1Z3YA 1BMFA 2M8GX 3G1OA 4YCQA 1KC8D 4F55A 4TMWA 1WH7A 1FDRA 4XD7A 3HTSB 2CWEA 2M3AA 3FJOA 2M34A 4A2UA 4DNTB 3W2IA 1JJ2B 2ZITA 2I10A 4LB6B 4N3NA 5ILVA 3BQYA 2R3SA 4PCQA 2IW5A 5JFRA 1JA0A 2XTXA 4HEA2 2XAGA 2OTJB 4A12A 4UNOA 1N78A 2K02A 2EILH 1W35A 4CA0A 1I8DA 5D4SA 2ZL5A 1XSXA 2CUFA 4AVZA 2HYGD 2WADA 3W5UA 1O8KA 3K4MA 3NEUA 2R7DA 1TTYA 1NG6A 5GV7A 2LK2A 2LH9A 3BY1A 4HZFA 2XSJC 3ZMVA 4HW0A 4P6VF 1E3OC 1KA8A 1YJNB 3CMEI 3EDPA 5JHUA 4QVJA 1SFXA 3TO6A 4XLAA 4Y9UA 3L9FA 2O17A 3K2ZA 2FX0A 4X8IA 5GTHC 3IWFA 3E1YE 4Z4UA 2BM1A 1O8EA 3DPTA 2L7ZA 3MEXA 2BW3A 1FNCA 2GLOA 1RKWA 5IT9Z 3HIFA 3OYCA 1RPWA 3LOCA 1YLFA 3LSJA 5ILUA 1VQOI 1ZQ3P 2DYIA 3M8FA 1LDDA 3TP0A 1IG7A 2E2IJ 4CCKA 4KIGA 1A8PA 1T38A 4LBVA 3E20A 5TV2A 4BQOA 2OCEA 1HZEA 1M90D 2IRFG 4OMYA 4XSZF 2EZLA 5DDGA 3G1MA 4WZEA 1D8KA 3DEWA 3KYDB 2I1LA 2JA8J 4P12A 4R71A 3N05A 1XX5A 4NDLA 3VMWA 2M1BA 1WSUA 2HOEA 4OINF 2V5IA 5ILSA 2WV1A 3ECHA 1TQMA 3GMEA 4M74A 1LUJB 3COAC 2FD5A 2P0WA 3BG6A 3H3UA 1N77A 2DN0A 5THXA 3CMAB 3OS1A 2XUBA 2EA2A 3SDGA 1OCOH 4G7OF 4GYGA 2GJPA 2AHQA 2V1NA 5EZGA 2DA4A 1Z9CA 1S4MA 2XB0X 2ESNA 3QYBA 3ML6A 3MKWB 4TSFA 1BW6A 1FX0A 3VMFA 4DNRB 3ASNH 2WBMA 1B72B 3B4NA 3LAJA 3BP8A 2LY2A 2V7FA 1DGRM 4IJAA 2M5SA 2VOOA 1F60A 2G0YA 2STTA 3FBNB 2JUCA 4GXOA 1DPUA 1OR7A 4PJ0C 1ZK8A 4OMZA 2BSPA 3BCAA 2CMPA 5F04A 2YS9A 3IP4B 1G7RA 3P9CA 2A6HF 1APLC 4RD1A 3C2HA 3FBIB 1H85A 1VQ8I 5DYMA 3EPZA 2E7XA 4ENMA 3A8IA 1IHMA 1B9NA 4B44A 4EATA 4JX5A 5IY5H 1RQRA 2EJRA 5DSZA 2F1LA 4PC2A 1ETWA 4HLXA 3SQVA 1B2RA 4P3IA 2Z1DA 4A3BJ 3A01A 3CCLB 1ZUNB 2NTQA 2ZL7A 4F7ZA 1GR1A 3BG3A 4ASNA 4ZYDA 1DG1G 1S72I 2WSSA 3A1YA 4P26A 1B23P 1SAUA 5EJCA 3WY9A 3N6ZA 1L1IA 3PFYA 1IB0A 1BIBA 5LD2C 1S8NA 4IQJA 2JTVA 4OJ6A 2A07F 5HZBA 3OW7A 5A89A 3OWTA 1D0ZA 4JBAA 5GAHJ 1VQMB 2XTWA 5CVIA 3MKYB 2ZL6A 4B47A 3O8HA 3JRHA 3FKSA 2P3MA 1W7PA 3CESA 3I0TA 2RREA 1W34A 3CD6B 4F93B 5FLXK 3DDYA 1PUFB 4UVAA 3I55I 2W1OA 3ERMA 3LSGA 3K70C 1VQ6B 2NOJB 4HNTA 1PXZA 5H2FC 4P25A 3U6BA 2OAZA 3CLOA 4ON0A 3HGYA 4IHTA 3LSPA 1IV6A 4P1VA 1UD8A 2PX9A 5JBQA 1KMHA 4M71A 1SFOJ 1BJAA 4QV2A 2D1VA 2NVXJ 2MH9A 3I9V2 3L2QA 3JRIA 1W0KA 2GOMA 1JA1A 4HYEA 4DZPA 4B3GA 1RU4A 2CSOA 2ZNYA 3ABKH 5LBQA 3P9IA 3K1MA 2W7ZA 4G6QA 2AXLA 2H6CA 4M9SA 2VN2A 2DDBA 4MGRA 5J4YA 3CLQA 2FE3A 2C5BA 3EQOA 4GO1A 2F6CA 3TKYA 1J9IA 2NPFA 2INUA 4ZYAA 2KISA 1TYVA 1WKMA 2QBYA 3QOPA 3V8LA 1QRCA 1G3WA 5JR3A 1QZEA 4XRSG 4OJ5A 4RAYA 1FEXA 4CCLA 3SFIA 1XGMA 3CPXA 2LKXA 2VC1A 3IC7A 2KJBA 1QHHD 4MHGA 1WDTA 3R6KA 5IOZA 4BHPA 1S7EA 3BTIA 4RB3C 2Z9OA 2LNBA 1VQ7I 3QYFA 3HRTA 4Q5SF 1KQ5A 2E2HJ 1EFCA 1Z67A 2F4IA 3T0YA 5JMCB 2J5PA 1LLZA 1OJLA 2I8DA 4YEIA 2VBWA 3LA7A 4ZYGA 2DOEA 2LF7A 2K9NA 4B48A 1MBFA 1R58A 3OFNA 1H9GA 3HBLA 2EZKA 3S3NA 4L8JA 4ZZLA 1BA5A 1CNEA 3VWBA 3RPQA 1UD4A 2E1BA 3MMYB 3RYPA 4RB1A 5M5XJ 1YX2A 3B8HA 3VPRA 1ON2A
chains in the Genus database with same CATH topology
1HG8A 5TGTA 3OS2A 1IDKA 4OAYA 4RMNA 1SFKA 2CUZA 3GVLA 4ZDPA 2LREA 4ZDOA 1PKVA 1E1QA 2BVLA 2R7QA 1DQUA 3M1CA 4MXNA 3OL4A 3HOTA 2A5WA 1RMGA 2W82A 4FETA 4FXUA 2CV2A 4X0GA 3OYFA 3VSKA 1PE9A 3DPLC 2F1MA 3LMWA 2WA0A 2XOKA 1X1BA 2E1MB 3A2KA 2X53S 3S93A 2ZTGA 2XF6A 2HQAA 2DCEA 3C2GA 4FASD 2NTBA 4CCMA 3VSTA 3ZRGA 3K10A 4C2LA 1X1CA 4OJPA 1G8XA 2MYSA 4XN3A 3VYSB 4PK4A 1Y56A 2X85A 4XKBA 4IKFA 3PL8A 2BSPA 1V0FA 2L5QA 3CP8A 2PECA 1MMNA 4YELA 3GQAA 4BL0B 2W7NA 2UVEA 3OMYA 1J09A 2XF7A 1VZ0A 3H5RA 1UD2A 3LMMA 1KONA 2BOLA 4HSTA 3VYTB 4BS9A 2IS1A 2GK7A 1I18A 4C9YA 3NWSA 2CV0A 3DKXA 3PJRA 2JSPA 4XLHA 4DK0A 2QX3A 4GQNA 4MLOA 1BR4A 4II3A 3K70D 4E6KG 4BGDA 2UV1A 4W8SA 4XOPA 3T53B 4HIZA 2CK3A 2KRHA 2X6WA 3CMMA 2HPMA 1MMGA 1G59A 2ZTNA 2VQLA 2KZVA 2R4GA 4XLEA 3GRHA 3OYLA 2M7AA 1KCDA 2R7XA 3PSFA 2OUMA 3FKJA 4OJOA 5FL7A 3K4CA 1BR1A 3LFUA 1MNEA 1NHCA 3HPGA 1V5GA 2NT6A 4OZZA 3RQ4A 2CUJA 2WAFA 4W8RA 2HZDA 4U87A 3OYNA 2CW7A 4U7BA 2XF5A 1OLTA 2KQRA 1T0FC 2JJ1A 1AIRA 3VSUA 2IGNA 3SEQA 1N75A 2HVQA 3SDBA 3OYBA 2R7WA 3S3OA 2IS4A 4TKOB 3OEHA 1LFPA 3OEEA 3TL4X 4PUSA 3BCDA 4BEHB 3K4LA 1D1BA 3K4NA 2XAUA 3H5AA 3IAS2 2LBFB 5KNLA 1SKYB 2JDIA 1O8GA 4ZTJA 2VXZA 2CV1A 2D3NA 4Z06A 2ZSHB 4BJTA 2L9NA 2ZZQA 2D3LA 2VQCA 2XGJA 4W8QA 2JIZA 1RWRA 3BG7A 3OYDA 1E1RA 4ASUA 2VB6A 3W2WA 2E60A 3BC8A 4BDYA 1MNDA 4F3QA 4IZZA 1WFXA 3LNNA 4E0FA 4AYBA 4IQ4A 2CFOA 3SEZA 3CJQB 2KDOA 2VQGA 2VPLA 1JI8A 2ZFUA 4ZDLA 1UELB 1FMWA 3OR2C 4JOMA 4OJLA 3G05A 2W4SA 2F43A 4BE0A 3HC7A 4B3FX 3DWLE 2HDWA 3DU5A 2W6IA 1WJCA 1IDJA 3QODA 3VYUB 3OR1C 2VJ5A 3OAAA 2QXZA 1V5FA 3SZGA 1WJFA 4NC8A 2QKMB 4BU2A 2GOXB 2A6TA 4ZC3A 3L2RA 4RLFA 4LG3A 3NE5B 3OPOA 5C1EA 2M7BA 5HOOA 5HKKA 4BJ5C 3OS0A 3W2VA 4RM3A 3H5NA 4OAZA 4BJ6C 5KHDA 2JVGA 1QU3A 2K5CA 3OOUA 2PJRA 3MD2A 3RPUD 2XZPA 1D1CA 4C2UA 4UZUA 4II2A 4E7KA 1KZLA 4XORA 2V31A 1OGMX 4Y4RA 2W6JA 3SUCA 1UD6A 2GK6A 4XLFA 3A3GA 2R7SA 3M8JA 1ERDA 5JHFA 4Z05A 4BQQA 2K9LA 1PYVA 2AQEA 2WY8Q 3OYKA 4KITB 1FMVA 2V4JC 4XOTA 3ZXSA 3AL0C 2KLOA 1BLIA 2KVOA 2WZPP 4BEHA 3S8PA 2PMZA 1TT0A 1Z3XA 3CZ6A 4I84A 4BACA 2X51A 1R6RA 3A4CA 4E4HA 3B90A 4MR0A 3VMVA 2F5VA 1VF7A 3WQZA 1AA7A 2O04A 1BPLA 1YE9A 2XDVA 3FHNA 4LIUA 3KYLA 1MMAA 4XMYA 1T95A 3FDYA 3OYEA 5HNFA 2M4GA 3RSNA 4P5OA 4XN0A 3OYGA 3VSVA 3HG9A 4Y33A 4D1QA 4YXWA 1BR2A 2DT7B 2Z2SB 3OL3A 3TBIA 1O8JA 4PJJA 1O8DA 1D0YA 3H9GA 3UNGC 1MMDA 2MABA 2PYHA 4E7IA 2HVRA 2CH0A 3KEWA 3PSIA 3J7AY 2W00A 4B43A 2CS3A 4N4OB 1BOBA 3CP2A 2X6XA 3TMOA 2WPDA 1VBLA 4U49A 2R7OA 2VQHA 3GVKA 3V42A 4G7WA 4ANJA 4EW9A 4PSXA 4XNFA 4YZQA 2IGOA 1CZFA 4HSRA 2XC7A 3T51B 2JJ2A 1DGWY 3DPUA 3I3LA 3VDXA 2FUG2 4Z03A 2V26A 1P9QC 3DU6A 4E7LA 4KKTA 4E7SA 1W0JA 3H0DA 2E5NA 2RNGA 2VBEA 1QHGA 3H9QA 3LL7A 3VYRB 3CJRB 1E43A 2JA2A 1IRXA 2NSTA 1V0EA 4W8TA 3D5RC 1VJSA 4YZAA 1X0CA 3GQ9A 2R7RA 4DBRA 2QE7A 2JUGA 4XR6A 2LZJA 4YRVA 2K9MA 1OFLA 3EUKL 3H9JA 4DOZA 1UD3A 3T56B 5LFAA 1PJRA 4URRA 4XKWA 1WJAA 1E0EA 4E7ZA 1IB4A 2AQFA 2ZXHA 1WPCA 3B8YA 1NRKA 1X19A 4AU7A 5HNHA 3W3CA 3DTIA 1WJDA 3QOEA 4BQNA 1QCXA 3FPPA 2IS6A 1COWA 1MW7A 2VL8A 1LDKB 1WJEA 2BW3B 4Y3OA 5CQEA 4KT6A 3HKZA 2QY1A 2MD0A 1HA8A 4HWVA 3OIQA 2HNHA 1DP3A 3E1SA 2MC4A 3ZIAA 1X1AA 3VR6A 4F52A 1EE6A 4GRIA 4XLCA 2VBMA 2E5ZA 4NC7A 1WJBA 3DQVC 3LSIA 3ONQA 4J00A 4J01A 2LYCA 2K3PA 3MKZA 3A35A 2IS2A 4C30A 3L2VA 1DBGA 4E7JA 2M0MA 2V9KA 3OE7A 1O8FA 2WB1A 4E7HA 4D9JA 4KKUA 3W2AA 3E0JB 2O1DA 3T9GA 2Y0SA 3ZPPA 2E1MC 4YZ0A 2IGMA 3HXLA 3K4KA 3S3MA 2UWMA 5CDFA 3AFHA 2RQQA 3D5SC 4CCNA 5DN6A 3HL2A 1DBOA 3GQ8A 3EUHC 4Z1MA 4BE1A 1Z3YA 2LY1A 1BMFA 1NG7A 3QYEA 4RM2A 1TZLA 4F55A 1E3ZA 4XD7A 4DIQA 2V4DA 2M3AA 3OYHA 3PNVA 4P1WA 4LIVA 4DNTB 2CW8A 1H8EA 4XL9A 2JVHA 3OY9A 3GQ7A 4PJNA 3F9KA 4HEA2 5IK2A 1N78A 1HVXA 1V5EA 4F91B 2ZZFA 4R79A 4CA0A 2WAQA 2DJIA 2X1DA 1I8DA 2Z8GA 3UW0A 4AVZA 1O8KA 1S9HA 2WADA 4N4NB 3K4MA 3L2WA 2XZLA 3ZSCA 4CH7A 1NG6A 4YZXA 3BH4A 2LH9A 2KL4A 2XSJC 5HLTA 2OC6A 3K4BA 3K6GA 2NT9A 3KRGA 3U21A 2LG4A 2Z6BD 2X6YA 2QKLB 3DTEA 3OYIA 4XLAA 2O17A 1O8LA 1K5CA 2VXDA 4P22A 4PJLA 2ZXIA 1O8EA 3DPTA 4XKCA 1GLNA 2DT6A 4PFOA 2KP6A 1K28D 2BW3A 3BCBA 1GQ8A 3NWTA 2WY7Q 3A3BA 2R7UA 1WP6A 1D1AA 3OYCA 2KPMA 1WJ5A 2LOOA 2GJRA 4G6TB 1W9XA 1JRGA 1YX5A 4CCKA 2IQ7A 3PUBA 4QPQA 2IGKA 2LBFA 4BQOA 4QPOA 3RTRA 1HZEA 2ZZEA 2BVMA 2VKHA 3EUAA 4XM3A 3JU4A 2V7QA 1Z7LA 5CQGA 1KTWA 5HVQC 3HPHA 3N05A 4RLQA 2R7VA 4G7XA 1E79A 3VMWA 4IX7A 1X4PA 3BCFA 4PJMA 3LSMA 2R7TA 2L2OA 5CPRB 2X8KA 3VSLA 1D0XA 2ZSIB 4HPQA 3BG6A 2P0WA 1N77A 2HPIA 3IUOA 5AMVA 3OS1A 4DBQA 2GJKA 2GJPA 3ZPNA 2PYGA 1Y6IA 4NNJA 2V1NA 2VASA 3RCOA 3DTKA 3QYBA 3MKWB 3KEYA 4BXFA 4TSFA 1FX0A 4DNRB 5KCMA 2WBMA 3GQBA 4PFPA 3B4NA 3OIPA 4CUGA 2LY2A 2V7FA 4CZCA 1DGRM 2VJIA 2DIEA 2M5SA 1O8MA 4JMQA 3FBNB 4LITA 2VKDA 3SYTA 1W36C 2VLAA 1WMRA 3LSHA 2KRCA 3G2BA 4KJZA 1UAAA 3BCAA 2CMPA 1X1DA 4DGWB 3IP4B 2INVA 5C1CA 1KCCA 1BN8A 4DK1A 3C2HA 3FBIB 1EFRA 3GVJA 3EPZA 2O0VA 2M4KA 1H80A 4B44A 2LC2A 4EATA 5FRNA 3OYMA 3BC9A 1OGOX 4CCOA 1O88A 1XG2A 3OYJA 2KHMA 1OR7C 2VJ4A 2Z1DA 3ZR8X 4HNUA 2NTQA 1ZELA 3WWGA 3HOSA 2VIXA 1OOCA 2VJJA 3BLYA 2WSSA 3A1YA 1O8IA 1SAUA 3DLAA 3PFYA 1IA5A 3JURA 1UD5A 4BDZA 1X4OA 5LD2C 4IQJA 1WTHD 4OJ6A 1NBMA 2DOAA 3OW7A 3OWTA 3H94A 1D0ZA 3EQNA 4XQFA 3AL0B 3MKYB 1OB0A 4XONA 4B47A 3L2UA 3FKSA 2PJRB 2XZOA 3HAGA 5FROA 3PNYA 2ELJA 3CESA 2X1EA 3DEEA 2RREA 5CKTA 4F93B 4KISA 2NZMA 3DDYA 4NK8A 4U4BA 2KMUA 3GBGA 2W1OA 3LSGA 4XKVA 3K70C 3OOCA 4ZTFA 2NOJB 4HNTA 1PXZA 4BUPA 2HVSA 3PNTA 1UD8A 2HU9A 1KMHA 2ZZGA 1JTAA 3AKZA 1U0JA 1PLUA 4ZJZA 2HLDA 3I9V2 2UVFA 3L2QA 1K6YA 3ZGKA 4PSWA 2GOMA 2UUZA 1W0KA 2ODLA 4HG2A 2WAEA 4NQWB 4B3GA 1OHHA 1RU4A 4PMHA 1LKXA 2MFZA 2DXIA 1QJVA 2XNDA 2NSPA 3KX2A 1UG0A 3DKYA 3ZQQA 2EWEA 4NUBA 4BE2A 1H8HA 4CCJA 3EQOA 3FY3A 2F6CA 2L9SA 3K4JA 4OWRB 4ZYAA 3IAM2 1OFMA 2INUA 2X3HA 3UR3C 4OZYA 2IXSA 4CSWA 3LSKA 4OJ5A 2WJVA 3H35A 4CCLA 4JQFA 2OV7A 1MABA 1QHHD 4HRIA 3CF2A 4C2TA 2R9VA 2V6EA 3QYFA 2O0WA 2O5RA 4KKSA 1O8HA 4NK6A 2F4IA 1YX3A 1BHEA 2NTPA 2Q2EB 2X1CA 5FRMA 2Z16A 2I8DA 4DJAA 1E3XA 4B48A 3S32A 3HUGB 4H4KC 1EA3A 3ZCOA 3OFNA 1LVKA 1VLYA 3OYAA 3S3NA 4L8JA 2WJYA 4G6IA 2LRDA 4F92B 3VWBA 4B3XA 4ITVA 1UD4A 2E1BA 2VBKA 2L7KA 2Q1ZB 3MMYB 1T5EA 4TT3A 4YEJA 3D5LA 1W36D 1Z21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HG8 A;  1WMR A;  1IDK A;  2QY1 A;  4HWV A;  1IDJ A;  4MXN A;  2INV A;  5C1C A;  1EE6 A;  1RMG A;  2QXZ A;  1BN8 A;  4XLC A;  2VBM A;  1KCC A;  2O0V A;  1DBG A;  1H80 A;  1PE9 A;  3LMW A;  1O8F A;  5C1E A;  2O1D A;  1OGO X;  3T9G A;  1O88 A;  1XG2 A;  3ZPP A;  4YZ0 A;  2NTB A;  3VST A;  4C2L A;  2NTQ A;  4OJP A;  3WWG A;  1DBO A;  4XN3 A;  1OOC A;  3GQ8 A;  2VJJ A;  3SUC A;  1OGM X;  1O8I A;  4XOR A;  2X85 A;  1IA5 A;  3JUR A;  2BSP A;  2PEC A;  4XLF A;  4OJ6 A;  4YEL A;  3GQA A;  2UVE A;  3EQN A;  4XQF A;  4Z05 A;  4XON A;  4XL9 A;  4XOT A;  3GQ7 A;  4I84 A;  3B90 A;  4MR0 A;  2NZM A;  2Z8G A;  4XLH A;  4NK8 A;  4U4B A;  2QX3 A;  3UW0 A;  3VMV A;  4AVZ A;  1O8K A;  3ZSC A;  4XKV A;  2O04 A;  4W8S A;  4YZX A;  4XOP A;  1PXZ A;  4XMY A;  2X6W A;  2NT9 A;  3KRG A;  4XN0 A;  3VSV A;  1JTA A;  2X6Y A;  4XLA A;  4XLE A;  2O17 A;  1PLU A;  1O8L A;  3GRH A;  1K5C A;  1KCD A;  2UVF A;  1O8J A;  1O8E A;  2ODL A;  1O8D A;  4OJO A;  1GQ8 A;  1RU4 A;  4PMH A;  2PYH A;  1QJV A;  1NHC A;  2NSP A;  2NT6 A;  4OZZ A;  1JRG A;  2IQ7 A;  2EWE A;  4W8R A;  1VBL A;  2X6X A;  3EQO A;  3FY3 A;  4U49 A;  1OFM A;  2INU A;  4XM3 A;  2X3H A;  4EW9 A;  4OZY A;  4XNF A;  4YZQ A;  1AIR A;  3VSU A;  1CZF A;  1KTW A;  4OJ5 A;  4Z03 A;  3VMW A;  2VBE A;  2O0W A;  1O8G A;  1O8H A;  4NK6 A;  2NST A;  1BHE A;  2NTP A;  4W8T A;  4Z06 A;  4YZA A;  1X0C A;  3GQ9 A;  4W8Q A;  5AMV A;  1RWR A;  4XR6 A;  2PYG A;  1OFL A;  4URR A;  4XKW A;  3B4N A;  1IB4 A;  2VBK A;  3B8Y A;  2VJI A;  1O8M A;  4YEJ A;  4OJL A;  1QCX A; 
#chains in the Genus database with same CATH topology
 3SKB A;  3T1B A;  3A0H C;  3KEQ A;  2CYY A;  1SFK A;  2CBX A;  2Z99 A;  3TW6 A;  4WWV A;  3LFK A;  1PKV A;  2DOG A;  1BI0 A;  2V79 A;  2ZBK A;  4Y52 J;  1DDG A;  2BVL A;  2R7Q A;  2J5O A;  3OL4 A;  3FHZ A;  1RMG A;  4Z2Y A;  1F43 A;  1E62 A;  4R8H A;  1JTY A;  3WTW C;  1WOS A;  3W2F A;  3CO7 C;  3VSK A;  4BHB A;  4A3K J;  1TT5 B;  1X1B A;  2E1M B;  4S04 A;  5IYQ A;  1R49 A;  2XF6 A;  2EWN A;  2DCE A;  1X3U A;  1GVD A;  2HR3 A;  4FAS D;  4CCM A;  3ZRG A;  4IHX A;  3K10 A;  3K7A J;  2MC3 A;  4OJP A;  1G8X A;  5F1J A;  3WG9 A;  4PK4 A;  5DCM B;  5J1Y A;  4AWX B;  2X85 A;  4IKF A;  5LGT A;  3PL8 A;  5DNS A;  2QUF A;  3G71 B;  2QQ9 A;  3IHU A;  2KJC A;  1MMN A;  2W7N A;  1EWY A;  2MA3 A;  3I53 A;  1J09 A;  1AOY A;  1VZ0 A;  3BJ6 A;  4M0L A;  1IN6 A;  1UD2 A;  2X9D A;  4FQG A;  1KK2 A;  2GK7 A;  4BS9 A;  2BVN A;  3CB4 A;  2IS1 A;  4V02 C;  1YW8 A;  1CLW A;  5F0H A;  1F36 A;  2VT2 A;  1BR4 A;  3I58 A;  3K9T A;  3GTO J;  2OBT A;  4E6K G;  4IHY A;  2UV1 A;  2V7W A;  5J4V A;  1WI9 A;  2F48 A;  3T53 B;  4EVI A;  4J19 A;  1VHE A;  3HRS A;  3IH4 A;  3OP1 A;  1A36 A;  1S6L A;  2RQP A;  1K83 J;  4IO9 F;  1K4Z A;  1USS A;  2JA6 J;  2KZV A;  3FXO A;  3J81 Z;  3V7A A;  2HDC A;  1KCD A;  5GV8 A;  2CG4 A;  1OKR A;  2H1L A;  3H92 A;  1ODD A;  3PSF A;  4QVA A;  4X05 A;  2OUM A;  3DFG A;  3PUN A;  3FKJ A;  5FL7 A;  3IKV A;  1FLI A;  2H09 A;  3E97 A;  1XMA A;  2B0R A;  1NHC A;  3HPG A;  1VQ5 I;  3ZMZ A;  5M3F J;  1MMS A;  1L0O C;  4LBY A;  1NTC A;  2OBP A;  2ME6 A;  4W8R A;  1R4M B;  2ZME C;  1O7F A;  2BHY A;  2DTZ A;  1ETQ A;  4G1V A;  4I2O A;  3SYJ A;  4I99 C;  3ELK A;  4NBS A;  5CVU A;  2LKS A;  3SEQ A;  2VKE A;  3QQA A;  1N75 A;  4RAZ A;  3OYB A;  2R7W A;  5HLH A;  2IS4 A;  2BM6 A;  3MN2 A;  1X3W B;  3TL4 X;  4A3L J;  4X6A J;  3CUO A;  3EUH A;  4BEH B;  3K4N A;  2QTL A;  1E3P A;  1FT9 A;  5E8I A;  4A3D J;  4PC6 A;  3IAS 2;  3CXC B;  1O8G A;  2VXZ A;  5FO5 A;  5EGO A;  2CV1 A;  4D5C A;  2PN6 A;  1FYK A;  2D3L A;  4J0Q A;  2XGJ A;  4W8Q A;  1K4S A;  4ASU A;  4WCG A;  2XAH A;  3OYD A;  1E1R A;  2DET A;  1STZ A;  4BDY A;  3PA1 A;  1MND A;  4EJV A;  2XAQ A;  2X6O A;  1ZTR A;  2IA1 A;  4AYB A;  4DNC A;  2QN6 A;  4IQ4 A;  2YUH A;  4X06 A;  4FT8 A;  2E19 A;  4ZDL A;  2OTJ I;  3MCA A;  3ISP A;  1LJ9 A;  1AIP A;  1ZM2 A;  1ZYR F;  3G05 A;  5GAG J;  1MH4 A;  3J7A O;  1XD7 A;  3KP7 A;  4B3F X;  2OQG A;  3W5H A;  2XRN A;  4G7Z F;  1PP7 U;  2V9V A;  1O57 A;  1FOW A;  4EQQ A;  5K1Y A;  4RD3 A;  4UAJ A;  2QXZ A;  3I64 A;  1Z1D A;  3QFS A;  1RR8 C;  4RLF A;  3QFT A;  1W1W E;  4LG3 A;  1YLO A;  2HZT A;  2E1C A;  1IRG A;  3SFZ A;  4BJ5 C;  2GM4 A;  3Q5F A;  4IRI A;  3W2V A;  3O2P E;  3BG9 A;  3CME B;  4OAZ A;  3PO2 J;  1QU3 A;  3RIQ A;  2PJR A;  3GO5 A;  3MD2 A;  2XZP A;  3VO1 A;  3N97 A;  4AVP A;  4RPB A;  1LE8 A;  3JRA A;  2V6C A;  4II2 A;  4E7K A;  1KZL A;  3DBR B;  4XOR A;  1I7P A;  1MH3 A;  4OOV A;  2ESH A;  3SUC A;  2XRL A;  1FP1 D;  2NAZ A;  3AST A;  2XTY A;  1UD6 A;  2H1K A;  1VQO B;  3M8J A;  3WU1 B;  2V7U A;  3S1M J;  1I3A A;  2HMA A;  1RNL A;  4YAL A;  1J2X A;  1MBE A;  5KVR A;  2M45 A;  4XOT A;  3ZXS A;  3AL0 C;  5L46 A;  5FKO A;  3IRQ A;  2QM3 A;  1JKR C;  3CZ6 A;  4MR0 A;  2X51 A;  3A4C A;  2QA4 I;  1VTN C;  1O4X A;  4MEX F;  2FRH A;  2DMQ A;  3VMV A;  2F5V A;  1VF7 A;  1YE9 A;  2HGC A;  3KYL A;  3FHN A;  2CRV A;  1U5T A;  1ONV A;  1T08 B;  4XMY A;  1QVF B;  1T95 A;  5L3G A;  4OOX A;  5GPC A;  4ENK A;  5IOY A;  2XGC A;  2YWF A;  1FBS A;  3CPW B;  2UXN A;  4KNY A;  2EV6 A;  2BYV E;  5H59 A;  2Q6I A;  2MSY A;  2BV3 A;  1XCB A;  2DT7 B;  3OL3 A;  3RYR A;  2OK8 A;  3T5X A;  1JTX A;  1JKQ C;  3K1P A;  4RGR A;  1ITY A;  1ZLJ A;  5A8A A;  3H9G A;  3UNG C;  3CCQ I;  1MMD A;  3DP7 A;  4E7I A;  1NDH A;  3T8T A;  1FBU A;  1SKQ A;  4EJW A;  4XIC A;  2VBV A;  4MEY F;  2W00 A;  1GT0 C;  3J7A Y;  4P96 A;  1OCZ H;  4QLC U;  3SQN A;  1QX4 A;  1BOB A;  1KD1 D;  5EEH A;  3OIO A;  2R5Z A;  1WVR A;  2WPD A;  1A6Q A;  2XC1 A;  2N8G A;  3HTU A;  2XGD A;  5C4J J;  2VQH A;  4AYB N;  5AON A;  4G7W A;  5M3M J;  2M30 A;  2FBK A;  2W84 A;  2E1R A;  2BM7 A;  1IXR C;  1RR7 A;  4LJZ F;  3T51 B;  3UW0 A;  2QZA A;  3J7Y J;  2FUG 2;  1VQ8 B;  1K61 A;  3Q9S A;  4E7L A;  2HDD A;  2VBE A;  1M1K D;  1XN7 A;  3LO8 A;  3VYR B;  1E43 A;  1TUI A;  1B8I B;  1O7L A;  2NST A;  5L3E A;  4RDJ A;  3D5R C;  1H89 C;  4YZA A;  4D5F A;  1F1Z A;  4XR6 A;  2K9M A;  3L00 A;  4P6Y A;  1UD3 A;  1S72 B;  1PJR A;  2HKO A;  2NRA C;  1DDI A;  1R00 A;  3OSG A;  2HQN A;  2AS5 F;  1WPC A;  3B8Y A;  3F21 A;  1NRK A;  5HNH A;  3FXM A;  2PE3 A;  3QOE A;  4BQN A;  1QCX A;  2B0L A;  5LLQ A;  1TC3 C;  1XMK A;  5C44 J;  4KT6 A;  3AG3 H;  3HKZ A;  4DYR A;  4HF2 A;  1HA8 A;  3F22 A;  3TP3 A;  2XPV A;  3OIQ A;  2NNN A;  1BBY A;  1R71 A;  2D2W A;  1XC5 A;  1TTT A;  1X1A A;  3H09 A;  4A0Y A;  3FXU A;  5HLG A;  1B4A A;  4NC7 A;  1WJB A;  3DQV C;  3A35 A;  3I55 B;  3PUF A;  3MKZ A;  2PEX A;  5H20 A;  2JPC A;  2EQR A;  4JX4 A;  1JHH A;  2M0M A;  1J0R A;  1KGS A;  2WB1 A;  1FP2 A;  4N9H A;  4E7H A;  1K7A A;  2EV5 A;  5HDG A;  4KKU A;  3W2A A;  2O1D A;  1FIP A;  4XRF A;  1WGX A;  3TO7 A;  3RKX A;  3D1N I;  4YAF A;  2IGM A;  4V19 K;  1RUN A;  1FSE A;  4RD4 A;  1DBO A;  1GV2 A;  5DTD A;  4BE1 A;  2KRF A;  1S5L C;  3L09 A;  4AD9 A;  3GZN B;  4U0V A;  2VFM A;  2DFH A;  2VNH A;  1YO5 C;  1GXQ A;  1DU6 A;  4P1W A;  2M9H A;  4KN4 X;  4RAF A;  3WTU C;  3I4P A;  1ETK A;  4XL9 A;  1P4W A;  3ZMT A;  5IPA A;  2DOF A;  2C78 A;  3OY9 A;  1F5T A;  3GQ7 A;  4PJN A;  1YIJ I;  1K6O A;  2H27 A;  5DEQ A;  5IK2 A;  1HVX A;  3D0S A;  3BTL A;  2Z8G A;  1IV8 A;  2WAQ A;  1FRQ A;  1S9H A;  1SAN A;  3ZSC A;  4LMY A;  2XZL A;  2J8I A;  2E1O A;  1W87 A;  3VOE A;  2DQL A;  4DQK A;  2BXZ A;  5HLT A;  1VQ7 B;  4A3I J;  3AVX A;  4WF2 A;  3KRG A;  2AXT C;  2NXN B;  3MWM A;  4A5M A;  2CF4 A;  2X6Y A;  2YX4 A;  2QKL B;  3DTE A;  1WSV A;  1O8L A;  1OGJ A;  4P22 A;  2JZY A;  3SLN A;  5AIP A;  2IBD A;  2DT6 A;  5ERI A;  2JN9 A;  3KE2 A;  2KP6 A;  1K28 D;  1DDN A;  1MBH A;  4I0B A;  1X3Z B;  3NWT A;  3A3B A;  2KIU A;  2R7U A;  4O3M A;  1D1A A;  1WP6 A;  2GJR A;  4L9N A;  4G6T B;  1DUX C;  3QPL A;  2EIK H;  3ASR A;  4I09 A;  2IGK A;  1D8T A;  1OB5 A;  2LBF A;  4LBZ A;  3RTR A;  2DAO A;  1HOM A;  2BVM A;  2VKH A;  3EUA A;  4XM3 A;  3MMP A;  5J40 A;  5AN9 A;  1Z7L A;  1JHF A;  5FO0 A;  1FNM A;  1RES A;  5B1A H;  3CCE I;  3ZQL A;  3CCU I;  2K27 A;  2FBH A;  3HJE A;  3CQZ J;  5HVQ C;  4G8X A;  1A5J A;  2QGU A;  3HKZ N;  4IX7 A;  3I54 A;  1XSD A;  2R7T A;  2OYN A;  2L2O A;  3BR5 A;  3V4G A;  2D45 A;  3JRD A;  4PC1 A;  4ZCI A;  3GLL A;  4C3H J;  3HRU A;  4MFE A;  1IF1 A;  2Z33 A;  1X2M A;  1G3S A;  2BY1 A;  4EM1 A;  3Q6R A;  3CTA A;  4I76 A;  1LEB A;  2QWW A;  2EZH A;  3NQO A;  3G1L A;  1K79 A;  5JLV C;  2WB1 N;  4BXF A;  2NVQ J;  3BR0 A;  1HCR A;  1BW5 A;  4ZGQ B;  3OIP A;  3JR9 A;  3Q6Q A;  2F4N A;  3K2A A;  2VJI A;  5F6F A;  3LA3 A;  4LOC A;  3IRR A;  1R5H A;  4W97 A;  3BDD A;  2HFH A;  3SZP A;  3ASP A;  2VNI A;  2IOU G;  2BZT A;  1X1D A;  4JYK A;  3V8K A;  4DGW B;  3S1Q J;  5IYB J;  3BT9 A;  1HDD C;  4N3G A;  3S2W A;  2INV A;  5C1C A;  5J6X A;  5L3B A;  2IPQ X;  3ONU A;  4M3B A;  3S1R J;  1KCC A;  3W6V A;  3M7G A;  3NAU A;  3GVJ A;  2O0V A;  1XGS A;  1QFY A;  3IKT A;  1X2N A;  1N8R D;  2RVC A;  1ORK A;  3OYM A;  1OGO X;  3LYC A;  1XG2 A;  3R0A A;  3CW2 A;  2KHM A;  2WAQ N;  1BX1 A;  1OR7 C;  3U2R A;  1XFO A;  4RGS A;  5EMN A;  3ZR8 X;  2VBU A;  3ZZU A;  3G73 A;  4Z4R A;  5LGU A;  2VFQ A;  3WWG A;  2IA0 A;  2FX3 A;  1ZG3 A;  1OOC A;  1J9Z A;  2VJJ A;  3DEU A;  5D8L B;  1O8I A;  2JK3 A;  5A2Q K;  2Y69 H;  1YYV A;  2LVS A;  1N07 A;  4QFM A;  4X1E A;  4BDZ A;  4YFX F;  1GV5 A;  1PJ6 A;  3G3Z A;  1E3H A;  1VQ5 B;  2BGC A;  3AL0 B;  4XON A;  5IP7 J;  1PJ5 A;  2XZO A;  2XHK A;  2F5E A;  5EYR A;  2ELJ A;  2X1E A;  3G6E I;  1WHU A;  4V2G A;  3ABL H;  3SJZ A;  2NZM A;  3M1E A;  3GBG A;  2IJL A;  5KK1 A;  1QUF A;  3HRM A;  4LC0 A;  1UG2 A;  1FIA A;  4ZTF A;  3JAM K;  4BUP A;  4E70 A;  3LQQ A;  3ZMD A;  4UB8 C;  2NNY A;  2QYU A;  3LA2 A;  1FZP B;  3GFM A;  3PFI A;  3PNT A;  4HOB A;  2XT2 A;  3N4M A;  3ERE D;  1YRN B;  1B72 A;  2QTZ A;  1NK3 P;  2ZJQ F;  2HLD A;  4RD0 A;  2O6G E;  1K6Y A;  4PSW A;  2UUZ A;  4MQ9 F;  3I59 B;  5IYC J;  2MFZ A;  5FO1 A;  4AID A;  1Y1V J;  5D5X B;  3KX2 A;  5F27 A;  1XQB A;  3CJN A;  4MIM A;  1UG0 A;  3U1K A;  5BPI A;  4BE2 A;  4C3I J;  1A35 A;  3WTT C;  4YFN F;  4CCJ A;  3FY3 A;  5EZH A;  4OIQ F;  1N06 A;  3K4J A;  2NVY J;  4IF4 A;  2Y9Z A;  4G6D A;  2EIX A;  4P2N A;  2K86 A;  3MCZ A;  1ETY A;  2P7V B;  3UR3 C;  4N9I A;  1R5N A;  3REO A;  1A31 A;  3I56 I;  3LSK A;  3GCM A;  2QEN A;  1HBX G;  2DFF A;  4ESJ A;  1JXS A;  3ASS A;  3S1N J;  3WTX C;  1EXM A;  1JKO C;  4HA8 A;  2R9V A;  1WRJ A;  1K8A D;  2O0W A;  3KPH A;  2O5R A;  3OZW A;  4KKS A;  5BQT A;  2ACJ A;  2CQQ A;  4ZV4 A;  2MG4 A;  2Q2E B;  2ZXJ A;  4YFK F;  4L9J A;  3JRB A;  5FRM A;  2RN7 A;  2Z16 A;  3ZZT A;  4NBQ A;  1T6Y A;  1VQL I;  1E3X A;  1X58 A;  2BY3 A;  3HUG B;  2DYR H;  3KFW X;  1CGP A;  2X0L A;  3ZPN A;  1VLY A;  2WJY A;  4G6I A;  1Z05 A;  2LR8 A;  4HAM A;  2L7K A;  2QMU A;  2GPJ A;  1HC8 A;  2CW5 A;  5HS9 A;  2R7Z J;  5IT9 K;  1WOR A;  4YEJ A;  3D5L A;  1JB9 A;  1XE1 A;  3FF5 A;  3QFR A;  5TGT A;  1GDT A;  1MSF C;  4RMN A;  5DM6 F;  2CUZ A;  4MQV A;  2LRE A;  1IO2 A;  1ULY A;  2HI3 A;  1Y0Y A;  4MXN A;  2M8E A;  3CCY A;  4M53 A;  3QP5 A;  3MAJ A;  3HOT A;  1DAB A;  1Z7U A;  2QA4 B;  3ROU A;  3JRG A;  5D5U B;  3JQR A;  4FXU A;  3HZJ A;  4X0G A;  4I98 B;  3V7S A;  4BBR J;  2XAJ A;  1PE9 A;  3DPL C;  3R4K A;  5FJ8 J;  1WH5 A;  2WA0 A;  1QGP A;  2DOD A;  1TWC J;  4Q4Z F;  3A2K A;  3LMW A;  3WXM A;  2XEX A;  3WNC A;  4U88 A;  5F0F A;  3WTY C;  1T8I A;  1SD6 A;  3R0J A;  1LVA A;  4Y17 A;  5E8G A;  3VST A;  5JVG F;  4C2L A;  1PDN C;  4Z4Z A;  4BY1 J;  1YHQ I;  1N0U A;  2NV4 A;  2MYS A;  3ECO A;  4YDT A;  4QUZ A;  2O3F A;  1TVC A;  2GA2 A;  1T6Z A;  1Y56 A;  2Q6O A;  4MO7 A;  2OA4 A;  1ZR2 A;  4L0Y B;  3F8N A;  1IGN A;  3ZN1 A;  1P6R A;  3GTQ J;  3CCQ B;  1W5S A;  1XDS A;  5KAI C;  3R6S A;  3F6V A;  3CC2 I;  3CP8 A;  2JRM A;  1V0F A;  4M4S A;  3A1P A;  2L7F P;  2LKP A;  2NS0 A;  4JX6 A;  4YEL A;  4A3E J;  4BL0 B;  1O3S A;  1VQ4 I;  2DA2 A;  4IRH A;  3OMY A;  3GX4 X;  2XF7 A;  1U78 A;  1WSR A;  2LTP A;  3H5R A;  2F5C A;  3BTJ A;  3LMM A;  2DEU A;  1OFE A;  4HST A;  3VYT B;  1LPQ A;  3BY2 A;  5H6R A;  2JSP A;  2WWY A;  3BWG A;  1TQP A;  1SD7 A;  4GDF A;  3K70 D;  1QUE A;  3SJP A;  4CQJ A;  4KA4 A;  2FNP A;  2AHO A;  4HIZ A;  1MD0 A;  1KYZ A;  5BOX A;  4PGO A;  5J8F A;  1QRY A;  5ICG A;  2IT0 A;  2R4G A;  2XGE A;  2CFX A;  2KT0 A;  3MVP A;  4I02 A;  3ABU A;  3F6O A;  2R7X A;  1ELO A;  1U2R A;  3QP6 A;  3A8J A;  3A02 A;  4H9G A;  4KIC A;  2EV0 A;  4OJO A;  1N05 A;  1KQS B;  3K4C A;  1ON1 A;  1Z0X A;  1YIO A;  1K4T A;  1B6A A;  2FMY A;  3HOY J;  3RDI A;  2M0C A;  1E64 A;  2F4O B;  1Y39 A;  4U87 A;  4KN7 X;  3ZQC A;  1T0F C;  3A03 A;  1KZH A;  2JJ1 A;  3W5V A;  1AIR A;  4BNC A;  1LDJ A;  4PAA A;  4YFO A;  3VSU A;  2OCC H;  3SDB A;  3G4S I;  3QRF F;  5TY0 A;  1SC7 A;  3OEH A;  1V4R A;  1Q82 D;  1LFP A;  3JTH A;  4PUS A;  3BCD A;  1KJZ A;  5DS0 A;  5EG0 A;  2FSW A;  4EGZ A;  1F4K A;  4P9U A;  3H5A A;  2EPF A;  1VQP I;  3L1P A;  5DCM A;  1SKY B;  4ZTJ A;  2VFP A;  2ZJR F;  2GBY A;  4Q48 A;  2D3N A;  2PG4 A;  2ZSH B;  3B6C A;  2L9N A;  5BNG A;  4BJT A;  3GIR A;  2JIZ A;  4Z4Y A;  2NYX A;  1R5O A;  2RDP A;  3BG7 A;  1GHC A;  2E60 A;  2MLK A;  1TYX A;  1SFE A;  1TW2 A;  4F3Q A;  4E0F A;  2DBB A;  4YII A;  1KTV A;  3L2C A;  2CFO A;  3SEZ A;  3KYC B;  2KDO A;  2GXB A;  3LQE A;  2ZFU A;  1QGA A;  1UEL B;  3QWL A;  3CC7 I;  4IOA F;  4JOM A;  1QPM A;  3P26 A;  4GCV A;  2PLY A;  4AC9 A;  3HC7 A;  2HEO A;  4PC3 A;  1T6S A;  3OSF A;  4IHV A;  2OK7 A;  1ZRC A;  2KKO A;  1YIJ B;  3QOD A;  1YG2 A;  3OAA A;  2CQN A;  2V1X A;  4FK8 A;  5F4J A;  1V5F A;  3BR2 A;  1AKH A;  2IA2 A;  2JJ7 A;  3BR3 A;  4OPO A;  1MDM A;  1ZGW A;  1Y0R A;  4X7F A;  1S7O A;  1IJE A;  3BPX A;  4RS8 A;  3Q38 A;  2B7E A;  3U6K A;  1YI2 I;  5HOO A;  5HKK A;  3TOA A;  4WXH A;  2Q0O A;  1IAW A;  1WU8 A;  1IN7 A;  2K5C A;  3OOU A;  4Z4T A;  3BOQ A;  2BX6 A;  2KZG A;  1UJ8 A;  2OZ6 A;  2OZU A;  2LP0 A;  2V31 A;  4P9S A;  1TLH B;  3QU3 A;  1AMO A;  3T8R A;  4S0H B;  1RUO A;  2R7S A;  2VBT A;  2O7O A;  1ERD A;  1GXP A;  5E1Z B;  3A01 B;  4F7D A;  4P55 A;  2DYS H;  1W0T A;  2E35 A;  4KIT B;  1FMV A;  2V4J C;  2HOS A;  4EV0 A;  2Q6K A;  2KLO A;  2F4M B;  2B9S A;  3FIS A;  5B1B H;  1TWH J;  2K3F A;  4BEH A;  2PMZ A;  4OU0 A;  1AHD P;  4RLZ A;  1R6R A;  1G7T A;  4EGY A;  2EFG A;  3CCE B;  5EEG A;  3CCU B;  1B9M A;  3E5U A;  3WOD F;  2HTJ A;  4NQW A;  1I5Z A;  1BPL A;  3GFL A;  5DUK A;  2QF7 A;  5HNF A;  4CYC A;  1OCT C;  1MIJ A;  3OYG A;  4C0S A;  4Y33 A;  3DKW A;  3GTK J;  2Z2S B;  5DD4 A;  3TBI A;  5D8K B;  2G7H A;  5E3O A;  1O8J A;  4DZJ A;  1O8D A;  4GFB A;  2PYH A;  2VOD A;  3RY8 A;  5IYW A;  2DA5 A;  2QGG A;  1LEA A;  2DFI A;  3PUM A;  2OJE D;  4LBW A;  1ETX A;  1SVO A;  4TV7 A;  5HDK A;  2IP2 A;  3FMQ A;  3KP4 A;  3FIW A;  5ED4 A;  4U49 A;  3SY2 A;  2ECB A;  3GVK A;  3V42 A;  2DK5 A;  4M6X A;  1HF0 A;  1EFT A;  4XNF A;  3PVD A;  4TMV A;  4YZQ A;  1MBJ A;  2IGO A;  1CZF A;  2XC7 A;  3A0B C;  3PM1 A;  4IRG A;  3VDX A;  3JTG A;  4ZCL A;  4M9Z A;  4Z03 A;  2DA1 A;  2VE8 A;  2ZCW A;  3LQ6 A;  3HOZ J;  3CCV I;  2VFO A;  1W0J A;  3H0D A;  1TWA J;  1QHG A;  5IT3 A;  1VQ9 I;  3I5U A;  3CJR B;  1P7I A;  1V0E A;  1OYI A;  2PMH A;  3RI4 A;  2CQX A;  2IAI A;  2Z3Y A;  2QBY B;  1G7S A;  2EIJ H;  1AWC A;  2XT4 A;  1E2X A;  4DBR A;  2QE7 A;  4OIP F;  1QRB A;  2K9Q A;  3J81 K;  4YRV A;  3GZ6 A;  1OFL A;  2STW A;  1R5I D;  4GGG A;  4C43 A;  4XKW A;  1T2K A;  3TW7 A;  3BRO A;  1IUY A;  1IUF A;  1KRH A;  1WCM J;  3FXK A;  3DTI A;  5IYP A;  3FPP A;  3WU2 C;  4D7M A;  1MW7 A;  4LG0 A;  2MLG A;  2DPD A;  3K69 A;  5CQE A;  4ETS A;  2BY0 A;  4R1H A;  3HGG A;  2MD0 A;  1QFZ A;  2ETH A;  3WTV C;  3OOP A;  2VNK A;  3DU1 X;  3E1S A;  2ZBV A;  3G6E B;  1OYW A;  3ZIA A;  1BC8 C;  4L9T A;  3BH6 B;  1IXS B;  2PMD A;  1Q81 D;  3C3W A;  3FXL A;  5GPA A;  3RKW A;  2F5D A;  2HXO A;  4C30 A;  2QQ8 A;  1KQ9 A;  4EEF G;  4E7J A;  2O6W A;  3L7W A;  3HOU J;  3FPK A;  2ZO4 A;  3CF5 F;  3OE7 A;  4YAW A;  2P5K A;  2YR2 A;  2BGJ A;  4UVB A;  2RC5 A;  1O8F A;  1OIS A;  3ZBT A;  2QLZ A;  4BAY A;  1ZGA A;  4YZ0 A;  2MBF A;  2P4W A;  3HXL A;  5F08 A;  3S3M A;  3WE2 A;  2UWM A;  1RET A;  4KIB A;  2DMN A;  3HL2 A;  1QH0 A;  2P6S A;  4Z1M A;  3AVU A;  2R5Y A;  3HSE A;  1IZ1 A;  4BBS J;  1FOY A;  1LLW A;  3QYE A;  3OJX A;  1TZL A;  4KYW A;  4DIQ A;  2V4D A;  2NS8 A;  3JW4 A;  4K1X A;  1NJI D;  3PNV A;  2DFE A;  3CCS I;  2CW8 A;  5FFZ A;  4RJL A;  2JN6 A;  4XSX F;  4JK1 X;  2JVH A;  4L0Z B;  1QNT A;  3F9K A;  1FWZ A;  1P2F A;  1PVE A;  3J80 Z;  2D9R A;  1V5E A;  3R6J A;  4RM0 A;  2ZZF A;  4R79 A;  2XVC A;  5HZA A;  2DJI A;  2X1D A;  1K78 B;  3PEN A;  2V1D A;  2Q6L A;  3H1C A;  2YU3 A;  3WTZ A;  1G7C A;  3I56 B;  1J5Y A;  3ZOB A;  5JI6 A;  5C3E J;  1JGG A;  1IRF A;  2PQ8 A;  1D3Y A;  2IVM A;  5K7F A;  4YZX A;  1G3T A;  2Y48 A;  5J1U A;  4G5G A;  3GF2 A;  5CLS A;  3K6G A;  3KZI C;  3U21 A;  1RQP A;  5IP9 J;  3PO3 J;  5GAD J;  2Z6B D;  4DYQ A;  1EP1 B;  1K5C A;  1N08 A;  3B78 A;  1G4D A;  1VQL B;  1OB2 A;  4XKC A;  1JGS A;  3AG4 H;  3Q0U A;  1NHA A;  1XG1 A;  3K0L A;  2VUM J;  1W4M A;  1YQA A;  1WJ5 A;  2LOO A;  3KLN A;  3GTM J;  2V7X A;  1TYU A;  1JUS A;  4A3F J;  1YX5 A;  2FML A;  2FQ3 A;  1JRG A;  2IQ7 A;  3F0C A;  4D0P A;  1D5Y A;  2ZZE A;  1IN8 A;  1IXC A;  2WC2 A;  5CQG A;  1FY7 A;  1VI0 A;  1FNB A;  2C5H A;  1DU0 A;  5EEA A;  3HPH A;  3P27 A;  4RLQ A;  1OCP A;  4M3G A;  4G7X A;  4KDP A;  5D5W B;  4PJM A;  3LSM A;  4AUX A;  4DQ2 A;  1EJ9 A;  1XPX A;  2E71 A;  5CPR B;  3H36 A;  2X8K A;  1T6X A;  4HPQ A;  4A3J J;  2G9W A;  4EJT A;  2GRE A;  2HPI A;  3IUO A;  4HX8 A;  1YHQ B;  5D6F A;  1N25 A;  5FFX A;  4DBQ A;  1YFH A;  2GJK A;  3H3V K;  3WHB A;  3PA2 A;  2VAS A;  2PYG A;  3RCO A;  3DTK A;  3SHF A;  5LGN A;  3KEY A;  4WX9 A;  5KCM A;  3WBJ A;  1L3L A;  1J7K A;  1KK3 A;  4M3D A;  4W1U A;  1H0M A;  4CUG A;  3NAR A;  2B5O A;  1HF2 A;  2LF8 A;  2O03 A;  3CC2 B;  2R93 J;  2UXX A;  1VQ4 B;  1VQN I;  2LY9 A;  4JMQ A;  4UUT A;  4HX7 A;  5DV5 A;  2VKD A;  5LRR A;  1W36 C;  1RKT A;  5JLW A;  1EP2 B;  1DPR A;  3G2B A;  4KJZ A;  3WND A;  2ZC2 A;  3C18 A;  2RKH A;  4GYI A;  3TED A;  4B3A A;  4LB5 A;  1I27 A;  4UXN A;  1OGI A;  3EQL F;  1GVJ A;  1VQK I;  2OD5 A;  4QWQ A;  1QBJ A;  1W0U A;  3C2B A;  4DK1 A;  2GQQ A;  1HLV A;  4XRM A;  2BEO A;  4I0A A;  2A61 A;  1H80 A;  2LC2 A;  2JSC A;  1YW7 A;  3DBL B;  4M1K A;  5F4M A;  5FRN A;  4XLP F;  5FA6 A;  5AIQ A;  3DCF A;  4CCO A;  1Q86 D;  1O88 A;  4ESF A;  2VJ4 A;  2W25 A;  4B8X A;  4WK8 F;  3W6J B;  4HNU A;  3SJM A;  5BMZ A;  2BN4 A;  4G7H F;  1UCR A;  2EFQ A;  1T39 A;  1PP8 F;  3BR1 A;  3KL9 A;  1IN5 A;  1YOV B;  3W2G A;  3BLY A;  3MFK A;  2ZME A;  3M8E A;  2DPU A;  2D1H A;  1UD5 A;  3RKQ A;  2GAU A;  9ANT A;  1WTH D;  4BQA A;  4QSH A;  2X0K A;  3CUQ A;  1H8A C;  3WGH A;  2FEZ A;  3QPT A;  3EQN A;  2QQB A;  1E17 A;  5E1X A;  3OZV A;  3U9G A;  1Y0N A;  3L2U A;  1ZR4 A;  2QQA A;  1UB9 A;  2PJR B;  1J59 A;  1ZM3 A;  3SLD A;  5FRO A;  3PNY A;  1SVM A;  1U8R A;  1LE8 B;  1FTT A;  3HHG A;  3DEE A;  5DD8 A;  3H9N A;  4KIS A;  4LGW A;  4IW3 B;  2RC6 A;  3G4S B;  4XKV A;  3ZMU A;  4IL6 C;  3OOC A;  5L3D A;  1PUE E;  1IDY A;  1UHS A;  2Y30 A;  5TR9 A;  1VQP B;  1K73 D;  4OPV A;  4YIR X;  2JA5 J;  2HU9 A;  5D6E A;  1I6X A;  1JUM A;  2ADU A;  2ZZG A;  1TNT A;  1Q1V A;  1U0J A;  4WQM A;  3BJO A;  1F20 A;  2R7F A;  4ZJZ A;  2L54 A;  3KP6 A;  1XB4 A;  2ZJ2 A;  4HV6 A;  4HE5 A;  3ZGK A;  2BSA A;  2LSO A;  4HG2 A;  1IJW C;  1OHH A;  4PMH A;  4LFU A;  1QJV A;  2XND A;  3GTG J;  2NSP A;  3CC7 B;  3DKY A;  2XAS A;  3ZQQ A;  2EWE A;  3E7L A;  4NUB A;  2QEX I;  2HDN B;  4HLY A;  1X1P A;  3MZ8 A;  2L9S A;  1GJR A;  2VBY A;  3IAM 2;  2LMD A;  4M3E A;  1O3R A;  1Q9S A;  1K9M D;  4UZF A;  2QSH X;  2CU7 A;  1KU7 A;  2B7B A;  5HXB A;  1A6I A;  2J7K A;  2WJV A;  2JRT A;  4JQF A;  2OV7 A;  2GIZ A;  4BKX A;  4HRI A;  3CF2 A;  2PJP A;  3BJA A;  2V6E A;  5DCF A;  1YI2 B;  1O8H A;  1Y0U A;  4L18 B;  1YX3 A;  4MTD A;  1BHE A;  1OQY A;  1MGT A;  2X1C A;  2XB5 A;  3O6B B;  3RQI A;  3RZD J;  2DJN A;  4DJA A;  1WOO A;  3KIO A;  3R61 A;  1EA3 A;  2L0K A;  3N90 A;  1DAR A;  3OYA A;  1F9N A;  4IEJ A;  2LRD A;  3TOB A;  2FXA A;  2V9P A;  2ZKZ A;  2Q1Z B;  1KQ0 A;  4M73 A;  1T5E A;  3WGG A;  1BM9 A;  1KU3 A;  2EZI A;  2XAF A;  1QPI A;  3BZ6 A;  1XTA A;  3OS2 A;  1IDK A;  1NB9 A;  4KH3 A;  3JSP A;  3MZY A;  4PC7 A;  3WBK A;  4ZDO A;  3OZU A;  3CDI A;  3M1C A;  1DQU A;  3RJP A;  1RRJ A;  4HX4 A;  3O8G A;  1MJB A;  2DMT A;  2W82 A;  2VBX A;  2CV2 A;  1WOP A;  3OYF A;  3ESW B;  3GFJ A;  3LJY A;  4ACA A;  3UKG A;  1YIT I;  3E5Q A;  2KIF A;  4U9U A;  2RC4 A;  3S2H J;  4D7N A;  2CJJ A;  2EK5 A;  5J47 A;  3F72 A;  4G94 A;  4UHT A;  3NB2 A;  4MYT A;  2D5V A;  3E6D A;  4V2F A;  4UV8 A;  4XN3 A;  3VYS B;  3WYA A;  2VYQ A;  3BQJ A;  5J3O A;  2A05 A;  3KET A;  1XSV A;  2JQ7 A;  2L5Q A;  4BXX J;  2PEC A;  1JNY A;  2H8W A;  1SD4 A;  2A68 F;  1IN4 A;  4O5V A;  4G1B A;  2UVE A;  2P5V A;  3HB9 A;  3MKL A;  1HDP A;  4X7C A;  2YSR A;  4IHW A;  1KON A;  3KP2 A;  4C9Y A;  3NWS A;  3DKX A;  2BE5 F;  1JE8 A;  5J8C A;  2W85 A;  4XLH A;  3OW2 B;  2QX3 A;  4GQN A;  1V54 H;  3GWZ A;  3VB2 A;  2JT1 A;  2BPO A;  5CJ9 A;  4FCY A;  3BZK A;  2Q2E A;  4A69 C;  5GAE J;  2WYR A;  3CCV B;  4XOP A;  4CYD A;  3TGN A;  3TH0 A;  1D5V A;  2X6W A;  3CCR I;  5F4O A;  1VQ9 B;  3CMM A;  2HPM A;  3C1D A;  5EDN A;  2C4U A;  2ISZ A;  3Q9V A;  2DQR A;  3RKY A;  3OYL A;  1Q7Y D;  5HS7 A;  2EFN A;  1YJ9 I;  3JQP A;  2ZB9 A;  2GQF A;  2UZK A;  2A69 F;  3FM3 A;  4CDG A;  4FIS A;  1V5G A;  1EP3 B;  2NT6 A;  4ZYH A;  4ZCM A;  2F3L A;  3PIO F;  1VFC A;  2W48 A;  4OZZ A;  2XKO A;  2WAF A;  5E17 F;  2HZD A;  2J8K A;  2L9V A;  2MH2 A;  3S17 J;  2CW7 A;  2DI3 A;  2DY1 A;  5FD6 A;  1BJK A;  3ES9 A;  4CIC A;  4HDV A;  2V7T A;  2IGN A;  2BF4 A;  3O3K A;  4Z4W A;  1BI3 A;  3S3O A;  2JPB A;  3WNB A;  5FGM A;  3PQJ A;  4TKO B;  3FWE A;  3OEE A;  1RC9 A;  3K4L A;  4X7E A;  4M3F A;  1XMX A;  3GTJ J;  3K1N A;  2VNJ A;  4XRS A;  2LBF B;  2P6T A;  3F8F A;  3KEO A;  3VFZ A;  3AVY A;  2OTL I;  3IH2 A;  4LD5 A;  5BS6 A;  4L5E A;  4Z06 A;  3GEZ A;  1QO0 D;  2DU9 A;  2ZZQ A;  4L5J A;  2COB A;  1RWR A;  2VB6 A;  3W2W A;  1I39 A;  3ISX A;  4BXU A;  1V3F A;  5CVJ A;  3LNN A;  2QZ8 A;  4HNV A;  3CRZ A;  3CJQ B;  2VQG A;  4S05 A;  2VPL A;  5L3F A;  2HCJ B;  3OR2 C;  5FB2 A;  2XRO A;  4OP7 A;  2TCT A;  4RPD A;  1WPK A;  3CCS B;  1J75 A;  4ZGN B;  2VFN A;  1VND A;  3Q3S A;  4OPW A;  2HYF A;  4O6J A;  2MD5 A;  5HOD A;  1EFU A;  1I6H J;  2GXA A;  3OR1 C;  3AVW A;  2FVG A;  1TBX A;  3M4O J;  1Z6R A;  1IDZ A;  3SZG A;  4BYY A;  4BU2 A;  2GOX B;  4ZC3 A;  3WU0 A;  3L2R A;  2Y75 A;  3GW2 A;  2XV4 S;  2BGI A;  1LQ1 A;  5C1E A;  1TSP A;  2JA7 J;  3H5N A;  5KHD A;  1B59 A;  4I6Z A;  1EH8 A;  5DUI A;  4NHJ A;  1CF7 B;  5B3S H;  2ISY A;  3JQQ A;  5J35 A;  4K2E A;  3RPU D;  1D1C A;  2XPW A;  4KMU X;  1LB2 A;  3EYI A;  4C2U A;  1GO2 A;  4UZU A;  1OCC H;  4WZL A;  1OGM X;  2O8K A;  4Y4R A;  1PUF A;  3EET A;  4RA2 A;  1FX7 A;  1P4M A;  1MJA A;  1UMK A;  3A3G A;  5FLM J;  2PMU A;  1S3J A;  4UUS B;  2LLK A;  4A6E A;  2VT3 A;  5HDN A;  2CQK A;  5JHF A;  1XB2 A;  1MBG A;  4Z05 A;  2K9L A;  2QCO A;  2AQE A;  2WY8 Q;  5E79 C;  2L02 A;  5H5J A;  2DK8 A;  1D8J A;  2P81 A;  3P5J A;  5JVT A;  1HA3 A;  2WZP P;  2PLF A;  3S8P A;  1TT0 A;  1Z3X A;  3W6K B;  1D1N A;  4BAC A;  5E20 A;  3Q39 A;  3B90 A;  2L4A A;  1EH6 A;  2FOW A;  2K9S A;  4M72 A;  2TRT A;  5LMZ A;  2OBR A;  3WQZ A;  2HQ5 A;  1TYW A;  1AA7 A;  2O04 A;  4FX0 A;  5K5R A;  1KQ8 A;  4AF7 A;  1FSH A;  1ZN2 A;  1MMA A;  2RGV A;  5H6Q A;  3IV5 A;  5IYR A;  3OYE A;  5A88 A;  2K40 A;  1EF4 A;  4XN0 A;  1WI3 A;  1CQT A;  3VSV A;  3HG9 A;  5F0C A;  1SEU A;  1SFU A;  1R5G A;  3HDD A;  2XKP A;  2R92 J;  2OBS A;  3S16 J;  4YXW A;  2NVT J;  2BM5 A;  2R0Q C;  1T98 A;  4PJJ A;  1D0Y A;  4OPS A;  2QDX A;  3ZP5 A;  1TP4 A;  4HBL A;  4H0E A;  2HVR A;  3M3Y J;  4RB0 A;  3PQK A;  5KW9 A;  3PSI A;  1QA6 A;  1TW3 A;  4B43 A;  2DA7 A;  1VQN B;  2Q8K A;  1K8F A;  4PGH A;  4UV9 A;  3TMO A;  1HKT A;  5KSW B;  2R7O A;  4X0C A;  1DP7 P;  4PSX A;  4B4C A;  4EW9 A;  3GFI A;  4NCN A;  1VQK B;  1XCV A;  2VKV A;  3PSZ A;  1NB0 A;  1ZG1 A;  1Y1W J;  4HSR A;  2OQR A;  4WXD A;  3I3L A;  2JJ2 A;  4WZT A;  4A0X A;  2V26 A;  1P9Q C;  4KKT A;  4RAG A;  4IVN A;  3HSR A;  1IJF A;  2RNG A;  2E34 A;  3H9Q A;  3CC4 I;  1QFJ A;  3ZMS A;  2JA2 A;  2C6Y A;  1IRX A;  2CUE A;  4B09 A;  5DM7 F;  2GA1 A;  3B6A A;  2B7C A;  3P4G A;  1R36 A;  2VPR A;  2JUG A;  1FOK A;  2LZJ A;  2HOA A;  4DOZ A;  4FE4 A;  3T56 B;  5LFA A;  4URR A;  3RIR A;  4KIF A;  2PBI A;  1TWF J;  1KYW A;  1E0E A;  1QVG B;  5J3L A;  2CGP A;  3JCU C;  2C2W A;  1WJD A;  5K5O A;  1KU2 A;  4ENN A;  1COW A;  3KZY A;  3WHC A;  1LDK B;  2BW3 B;  4Y3O A;  2EH3 A;  5HLI A;  3ZBU A;  3ZN0 A;  1CNF A;  3IH3 A;  3CCM I;  1HQC A;  4CGZ A;  4BPR A;  1I3Q J;  2HNH A;  4ABZ A;  4HWV A;  5FLX Z;  2MC4 A;  3VR6 A;  1R7J A;  1EE6 A;  4GRI A;  4XLC A;  3TDU C;  4J00 A;  1RZ4 A;  4J01 A;  1BOA A;  3M07 A;  2IS2 A;  1DBG A;  3D26 A;  3E3V A;  5M5Y J;  1SM4 A;  2V9K A;  2COM A;  3GYH X;  3QPS A;  4HF1 A;  3T9G A;  4RCY A;  1H42 A;  2Y0S A;  4EJU A;  3WG7 H;  5CDF A;  1HSJ A;  2RQQ A;  1QZZ A;  4CCN A;  1KK1 A;  3GQ8 A;  3EUH C;  5BPD A;  2LY1 A;  2VBZ A;  4P3Y A;  1NG7 A;  4X07 A;  5LEK A;  2FU4 A;  4RM2 A;  1E3Z A;  3B02 A;  2OPT A;  3WE3 A;  3OYH A;  1P7J A;  3CDL A;  4RBO A;  1R23 A;  4LIV A;  3OKX A;  4MFD A;  1H8E A;  3V76 A;  1WXR A;  1BL0 A;  1BIA A;  3LSR A;  4HQE A;  2QEX B;  2BXY A;  2E36 A;  1TWG J;  3ZPL A;  3GSI A;  3BNW A;  4DYC A;  3KP5 A;  3PIP F;  4F91 B;  1HW1 A;  1R1V A;  1WWX A;  2HOT A;  1YJW I;  2L4M A;  2R6H A;  2AO9 A;  4Q7J B;  4N4N B;  3L2W A;  4Q47 A;  1MKM A;  3P9K A;  4CH7 A;  4XID A;  3BH4 A;  2E7W A;  1FJL A;  5FKM A;  2YWE A;  2KL4 A;  2OC6 A;  3CDH A;  3K4B A;  2KIQ A;  2NT9 A;  2LG4 A;  5IP6 A;  3FX3 A;  3OYI A;  2VE9 A;  3AVV A;  1S7A A;  2VXD A;  2P8T A;  4PJL A;  1ZRF A;  2ZXI A;  1GLN A;  3ABT A;  4PFO A;  5E3L A;  4FN5 A;  4UY8 I;  3BCB A;  3WGI A;  1GQ8 A;  2WY7 Q;  1OYY A;  2M87 A;  1JKP C;  2KPM A;  2EIM H;  2IEK A;  2WTE A;  1H88 C;  4EH1 A;  1W9X A;  4U0W A;  4L5I A;  4BY7 J;  1ZG5 A;  3PUB A;  4QPQ A;  5B5E C;  4QPO A;  3HHH A;  2HXI A;  3Q3A A;  4DW6 A;  3JU4 A;  2V7Q A;  4RGU A;  2Y9Y A;  3W2E A;  4RDL A;  1KTW A;  4PAB A;  1P92 A;  1W7P B;  4XK4 A;  3B73 A;  2R7V A;  1WZ2 A;  1E79 A;  2F5F A;  1X4P A;  3RPU A;  2I5U A;  3BCF A;  5FIU A;  3RZO J;  1YIT B;  1B1B A;  3QFC A;  4RD2 A;  2OF7 A;  3ONY A;  1ZAR A;  2G0E A;  1D0X A;  2ZSI B;  3VSL A;  1HW5 A;  1REP C;  1TQI A;  2GZW A;  3DBH B;  1XS9 A;  5AMV A;  1Y6I A;  2BV6 A;  4NNJ A;  2MW8 A;  1U5T C;  4LLG F;  2DTR A;  3P7N A;  1ZM9 A;  3ASQ A;  4CXF A;  3KCC A;  3AGP A;  1UMQ A;  1ZAO A;  5EG0 B;  1UHW A;  4PFP A;  2Y0S N;  3MQ0 A;  4RB2 C;  3GQB A;  4MNU A;  4CZC A;  2VI6 A;  2CO5 A;  3DXJ F;  1LFU P;  2DIE A;  1O8M A;  3F8B A;  4N0B A;  5D5V B;  1CQX A;  4LIT A;  3SYT A;  1WMR A;  2QYO A;  2VLA A;  1K78 A;  2CND A;  3LSH A;  2KRC A;  3FKI J;  4Y15 A;  4EMS A;  1UAA A;  3SZE A;  4ENJ A;  2Z5U A;  1BN5 A;  1ZRD A;  2FQ4 A;  1JT6 A;  2DMP A;  2M5W A;  1ZM4 A;  4FHT A;  4HQM A;  2ZNZ A;  1BN8 A;  1LNW A;  3C7J A;  1FPQ A;  3VOD A;  1EFR A;  3NAW A;  3ZQH A;  3I4N J;  4KUM A;  2M4K A;  2NVU B;  3ZQ7 A;  4NC6 A;  1OMI A;  4AIK A;  4OOS A;  1HXD A;  3Q0W A;  1BJZ A;  3BC9 A;  2ZJP F;  1QVU A;  2VC0 A;  3CCR B;  2MGQ A;  2XPU A;  1Z91 A;  3OYJ A;  3LAP A;  3V8J A;  5IYD J;  1ZEL A;  2KFD A;  2DW4 A;  3HOS A;  3BR6 A;  2VIX A;  5E3N A;  5TJJ A;  1AKH B;  3TDZ C;  3BQZ A;  2FF4 A;  4I01 A;  4PDK A;  1YJ9 B;  1MDM B;  3DLA A;  3LQR A;  1IA5 A;  2PFB A;  3JUR A;  4ACB A;  1X4O A;  1T0F A;  4OM9 A;  3QPH A;  2XNJ A;  1C0W A;  1NBM A;  1OPC A;  2DOA A;  3H94 A;  4XQF A;  5LEJ A;  1OB0 A;  3J81 k;  4C3J J;  2VZL A;  2EFW A;  2EA4 A;  1VF9 A;  4MTE A;  3HAG A;  2BM4 A;  3BY6 A;  5K7Z A;  5CVR A;  5ICC A;  5CKT A;  4NK8 A;  4U4B A;  3CCJ I;  1O3T A;  2KMU A;  5TRD A;  2PMZ N;  1D2E A;  4ROX A;  4UZE A;  2ME0 A;  5ICF A;  2XSD C;  3IWZ A;  3CUQ C;  2HVS A;  4A3C J;  2EBI A;  5L3C A;  2OTL B;  5E6T A;  1I1G A;  1JTA A;  3AKZ A;  1PLU A;  4FE7 A;  4HE6 A;  2UVF A;  3JX8 A;  2ODL A;  5GP9 A;  2YWG A;  4A5N A;  2BM0 A;  3GTP J;  2WAE A;  4NQW B;  1OFD A;  3IL2 A;  1LKX A;  1UHM A;  4FTH A;  2DXI A;  4ZYE A;  4CYC B;  4OIR F;  2VON A;  3GZ5 A;  3I4M J;  5EF6 A;  1H8H A;  2E2J J;  3HOW J;  3LNQ A;  2P7C B;  2DA6 A;  3SXY A;  1W5T A;  1FNN A;  2W24 A;  1B8I A;  3V7C A;  3M9A A;  1SVL A;  4OWR B;  2Y31 A;  1OFM A;  2X3H A;  2M2E A;  5BSY A;  4OZY A;  2K4B A;  2IXS A;  4IPA A;  3FMS A;  3J80 K;  1IC8 A;  1MNM C;  2ELK A;  1FTZ A;  3JRC A;  4CSW A;  4UUV A;  2CC2 A;  2FOK A;  2KIM A;  3GUD A;  3H35 A;  3QAH A;  1SMY F;  1U9N A;  1MAB A;  3QSY A;  4WWC A;  3AGQ A;  3JRF A;  4C2T A;  3SEJ A;  2ELH A;  4NK6 A;  5JLX A;  1YJN I;  4Y7C A;  2NTP A;  4RDU A;  3ULQ B;  3NRV A;  2D74 A;  4QHY A;  1HKQ A;  1U8B A;  1XGO A;  3DV8 A;  3Q0V A;  4WZK A;  4Z4S A;  3AG2 H;  1ETO A;  1EV7 A;  4H4K C;  3S32 A;  3ZCO A;  4JRA C;  1LVK A;  1ZH5 A;  1ZKG A;  4F92 B;  4B3X A;  4ITV A;  2VBK A;  2L7M P;  1QQ1 A;  2X3U A;  3QU6 A;  2HS5 A;  4TT3 A;  1Q1H A;  2ZXW H;  1Y8R B;  4JP0 A;  2NOG A;  3LL7 A;  1W36 D;  1Z21 A;  1HKS A;  1PJ7 A;  1HG8 A;  3GLX A;  2CRG A;  5KAF C;  4OAY A;  3EYY A;  4TMT A;  3GVL A;  4G9Y A;  4LLN A;  4ZDP A;  1GAW A;  1E1Q A;  2EFO A;  4UB6 C;  2A5W A;  2CQ7 A;  4YIF A;  2K4J A;  4IOC F;  1GVH A;  4LK1 F;  4Y9R A;  4FET A;  1U2W A;  1OFC X;  1HST A;  1Z77 A;  1YTY A;  3HM5 A;  2YWH A;  2L9R A;  4EJO A;  4PGG A;  4QTR A;  2F1M A;  1FYM A;  4HV5 A;  4LG0 B;  1UZC A;  2X53 S;  2XOK A;  1A04 A;  3S93 A;  1ZHF A;  2ZTG A;  2HQA A;  1QVT A;  2X48 A;  3C2G A;  2XGX A;  2NTB A;  4A6D A;  3AG1 H;  4A3M J;  2RAE A;  1X1C A;  4Y13 A;  3CMA I;  1R1U A;  3HEF A;  3AK5 A;  1R5B A;  4AF6 A;  2RNJ A;  1Y8Q B;  4XKB A;  5EGO B;  1ZLK A;  3DF8 A;  4RGX A;  2GWR A;  4Z6Y A;  2RV8 A;  1OCR H;  1BQE A;  2DO7 A;  1YW9 A;  2XIG A;  3GQA A;  3BH7 B;  1R4N B;  3U1D A;  5K5Q A;  3DLL F;  2LD5 A;  2FJ1 A;  1U3E M;  2W57 A;  5LHG A;  2BOL A;  1I18 A;  1POG A;  1TNS A;  4ZH4 F;  2R5Y B;  2CV0 A;  2HKX A;  4NB5 A;  4MYU A;  3PJR A;  2WV0 A;  3MZH A;  2ID3 A;  3F8M A;  4DK0 A;  4MLO A;  4KFC A;  4II3 A;  4EM2 A;  1SAX A;  2HWV A;  4BGD A;  2B63 J;  3S15 J;  3JRE A;  2C77 A;  5B6I A;  4W8S A;  5ICE A;  2CK3 A;  2KRH A;  4BHC A;  1R22 A;  3CC4 B;  1MMG A;  1G59 A;  3HOX J;  5E3M A;  2ZTN A;  4UVC A;  1ZRE A;  3CCL I;  2VQL A;  3HOV J;  5D4R A;  4XLE A;  1EZG A;  3GRH A;  2TDX A;  1KU9 A;  2M7A A;  4M6Y A;  2WZN A;  2QVO A;  3FXR A;  1EA0 A;  2Y0M A;  2V1U A;  4IHS A;  3ZQI A;  5F64 A;  1G6N A;  3LWF A;  4EM0 B;  4ESB A;  1TL8 A;  1BR1 A;  3LFU A;  2VBS A;  1MNE A;  6PAX A;  3JSO A;  3B82 A;  1FOX A;  1MJ9 A;  1VQM I;  2VOP A;  3RQ4 A;  2CUJ A;  2K7L A;  1GUU A;  4HF0 A;  5FLV A;  3OYN A;  4U7B A;  2BBY A;  2HQR A;  2XF5 A;  3CCM B;  2P5L C;  1OLT A;  2EFP A;  2KQR A;  5TIS C;  1WQ2 A;  2PI0 A;  2WR8 A;  3CD6 I;  2XNC A;  1ENH A;  1JJ6 C;  2HVQ A;  1G2H A;  5M5W J;  1VQ6 I;  3ZZ0 A;  1FC3 A;  2YX7 A;  4LK0 F;  2DLL A;  3FM5 A;  1D1B A;  1KK0 A;  2XAU A;  5KNL A;  2LFB A;  2JDI A;  4Y7N J;  4B1R A;  3A8K A;  3TQN A;  3OV8 A;  5C4X J;  2L3D A;  1BI1 A;  1VHO A;  5LRS A;  1U5T B;  2VQC A;  3R60 A;  2YU9 J;  3I1F A;  4CO8 A;  4YG2 F;  3FK7 A;  3BC8 A;  1IRZ A;  1BX0 A;  4IZZ A;  2KDZ A;  1P4X A;  1WFX A;  3PET A;  5E1W A;  1JI8 A;  1JUP A;  2H6B A;  1FMW A;  4AC0 A;  4OJL A;  2EB7 A;  1T56 A;  3CO6 C;  3VNU A;  3TO9 A;  2YPR A;  1FRN A;  2O61 A;  2W4S A;  3F3X A;  2F43 A;  2NS7 A;  4BE0 A;  3WTS C;  3DWL E;  2HDW A;  3DU5 A;  4P9F A;  3HYI A;  2W6I A;  1S29 A;  1WJC A;  1JJ8 C;  2HTS A;  1E63 A;  1IDJ A;  2FA5 A;  3E5X A;  3VYU B;  2BMW A;  2ZBU A;  4M2L A;  1W2B B;  1QQI A;  5HS8 A;  2OU2 A;  2VJ5 A;  2JMW A;  3KZZ A;  1RIO H;  3OJW A;  3HSF A;  2R5Z B;  1AU7 A;  3GTL J;  3GXO A;  2ECC A;  4OOI A;  1WJF A;  4IXA A;  2QKM B;  4NC8 A;  4XLN F;  3ZQG A;  1YJW B;  2A6T A;  1QA3 A;  4L9V A;  3S14 J;  4KMF A;  3NE5 B;  3OPO A;  1XDU A;  1O3Q A;  1U6G A;  2M7B A;  1I1S A;  1MZB A;  3OS0 A;  4XBF A;  2X4H A;  2O9L A;  3VEP A;  4RM3 A;  3CMY A;  4BJ6 C;  3BG5 A;  1XGN A;  2JVG A;  3BTC A;  3VO2 A;  1JT0 A;  3FMR A;  2K85 A;  4ZZD A;  4YAU A;  4OIO F;  3PSS A;  4CHU A;  3KP3 A;  1P4A A;  2W6J A;  4TMX A;  3ABM H;  4DQL A;  3V7R A;  1Z6T A;  4XLF A;  3BZC A;  2GK6 A;  5K7H A;  3ML3 A;  1YS7 A;  3FXQ A;  5FKK A;  4BQQ A;  1PYV A;  3OYK A;  1GAQ A;  2FNA A;  1BLI A;  5IYN A;  2G7U A;  2YUS A;  2KVO A;  1V55 H;  1YRN A;  3LVB A;  3FK6 A;  2JWT A;  2ZME B;  4YHB A;  1HW2 A;  4I84 A;  2FBI A;  4E4H A;  1ACI A;  5FKN A;  1QA2 A;  1MRZ A;  2GXG A;  2CW0 F;  5CYV A;  4TN1 A;  4M6V A;  4C2M J;  3CUQ B;  3FXJ A;  3I59 A;  2XDV A;  4LIU A;  3FDY A;  1NK2 P;  1BI2 A;  5FD5 A;  2M4G A;  1NH3 A;  2H94 A;  3RSN A;  4P5O A;  3VNV A;  3ASO H;  2H8R A;  1LM1 A;  2DA3 A;  5E18 F;  4AM3 A;  2BHZ A;  4D1Q A;  1BR2 A;  2A3S A;  4A93 J;  5LHI A;  4QIW N;  2QSF X;  4YC5 A;  4YAO A;  5FKL A;  2MAB A;  2A5Y B;  3F23 A;  3G71 I;  4AIJ A;  2CH0 A;  3MHP A;  3KEW A;  3BPV A;  4A3G J;  2CS3 A;  4I7H A;  4N4O B;  1T33 A;  3ZQF A;  1LFB A;  2O0Y A;  3LST A;  3CP2 A;  2X6X A;  2ID6 A;  2DCU A;  1VBL A;  4PZJ A;  4TMZ A;  4ANJ A;  1QGZ A;  2LDU A;  4RDK A;  4AIH A;  5BSX A;  2BY2 A;  3CJT B;  1DGW Y;  3DPU A;  3HUG A;  1H9T A;  4M9X A;  1UST A;  1SD5 A;  3DU6 A;  1MBK A;  1I50 J;  4E7S A;  3ZC3 A;  1W7P D;  1CF7 A;  2E5N A;  1R9T J;  3U2Q A;  5J1R A;  4A0Z A;  3E6M A;  2C4T A;  3H0G J;  5DS9 A;  3QE2 A;  1FND A;  4W8T A;  2HYJ A;  1VJS A;  3AAF A;  1X0C A;  1FBQ A;  2Y2Z A;  1IW7 F;  2R7R A;  1QG0 A;  3GQ9 A;  1EKE A;  1U9O A;  2V7V A;  1M1E B;  2DT5 A;  3H3Z A;  2F2E A;  3KLO A;  3GVA A;  3EUK L;  3H9J A;  5F1R A;  5A2Q Z;  4UUS A;  1R1T A;  2ICW G;  3SZT A;  3S2D J;  2GIV A;  4U0Y A;  1WJA A;  4E7Z A;  2DER A;  1IB4 A;  2AQF A;  2ZXH A;  3ZUG A;  4HDU A;  2A6E F;  1ETV A;  2ZFW A;  1X19 A;  2L01 A;  2O8X A;  3W3C A;  4AU7 A;  1QA1 A;  2QSG X;  5LHH A;  4RCZ A;  3E6B A;  5B66 C;  2IS6 A;  1FYL A;  5CVV A;  2VL8 A;  2DDA A;  1WJE A;  1BC7 C;  1QGY A;  4LLL A;  4X7D A;  2QY1 A;  2EIN H;  1W5C C;  1DP3 A;  1VLO A;  5GTI C;  4FWT A;  3X2Q H;  1TLL A;  1EH7 A;  1UFM A;  4F52 A;  3E6C C;  3CCJ B;  4FX4 A;  2VBM A;  2E5Z A;  1G3Y A;  3ONQ A;  3LSI A;  4CZZ A;  2DMU A;  2LYC A;  2K3P A;  3FZV A;  1V5V A;  3AVT A;  1ZGJ A;  3L2V A;  4G12 A;  1QZY A;  4BH9 A;  3JAM Z;  4WXC A;  2PIA A;  1MSE C;  3W2H A;  4D9J A;  4U7D A;  3E0J B;  2E1N A;  4B4D A;  3J7Z I;  3ZPP A;  2E1M C;  3I71 A;  1YS6 A;  1RI7 A;  1N0V C;  3K4K A;  4RD6 A;  5FNZ A;  4Z4V A;  3AFH A;  3D5S C;  4KT5 C;  3F8C A;  1SMT A;  5DN6 A;  1S0U A;  1Z3Y A;  1BMF A;  2M8G X;  3G1O A;  4YCQ A;  1KC8 D;  4F55 A;  4TMW A;  1WH7 A;  1FDR A;  4XD7 A;  3HTS B;  2CWE A;  2M3A A;  3FJO A;  2M34 A;  4A2U A;  4DNT B;  3W2I A;  1JJ2 B;  2ZIT A;  2I10 A;  4LB6 B;  4N3N A;  5ILV A;  3BQY A;  2R3S A;  4PCQ A;  2IW5 A;  5JFR A;  1JA0 A;  2XTX A;  4HEA 2;  2XAG A;  2OTJ B;  4A12 A;  4UNO A;  1N78 A;  2K02 A;  2EIL H;  1W35 A;  4CA0 A;  1I8D A;  5D4S A;  2ZL5 A;  1XSX A;  2CUF A;  4AVZ A;  2HYG D;  2WAD A;  3W5U A;  1O8K A;  3K4M A;  3NEU A;  2R7D A;  1TTY A;  1NG6 A;  5GV7 A;  2LK2 A;  2LH9 A;  3BY1 A;  4HZF A;  2XSJ C;  3ZMV A;  4HW0 A;  4P6V F;  1E3O C;  1KA8 A;  1YJN B;  3CME I;  3EDP A;  5JHU A;  4QVJ A;  1SFX A;  3TO6 A;  4XLA A;  4Y9U A;  3L9F A;  2O17 A;  3K2Z A;  2FX0 A;  4X8I A;  5GTH C;  3IWF A;  3E1Y E;  4Z4U A;  2BM1 A;  1O8E A;  3DPT A;  2L7Z A;  3MEX A;  2BW3 A;  1FNC A;  2GLO A;  1RKW A;  5IT9 Z;  3HIF A;  3OYC A;  1RPW A;  3LOC A;  1YLF A;  3LSJ A;  5ILU A;  1VQO I;  1ZQ3 P;  2DYI A;  3M8F A;  1LDD A;  3TP0 A;  1IG7 A;  2E2I J;  4CCK A;  4KIG A;  1A8P A;  1T38 A;  4LBV A;  3E20 A;  5TV2 A;  4BQO A;  2OCE A;  1HZE A;  1M90 D;  2IRF G;  4OMY A;  4XSZ F;  2EZL A;  5DDG A;  3G1M A;  4WZE A;  1D8K A;  3DEW A;  3KYD B;  2I1L A;  2JA8 J;  4P12 A;  4R71 A;  3N05 A;  1XX5 A;  4NDL A;  3VMW A;  2M1B A;  1WSU A;  2HOE A;  4OIN F;  2V5I A;  5ILS A;  2WV1 A;  3ECH A;  1TQM A;  3GME A;  4M74 A;  1LUJ B;  3COA C;  2FD5 A;  2P0W A;  3BG6 A;  3H3U A;  1N77 A;  2DN0 A;  5THX A;  3CMA B;  3OS1 A;  2XUB A;  2EA2 A;  3SDG A;  1OCO H;  4G7O F;  4GYG A;  2GJP A;  2AHQ A;  2V1N A;  5EZG A;  2DA4 A;  1Z9C A;  1S4M A;  2XB0 X;  2ESN A;  3QYB A;  3ML6 A;  3MKW B;  4TSF A;  1BW6 A;  1FX0 A;  3VMF A;  4DNR B;  3ASN H;  2WBM A;  1B72 B;  3B4N A;  3LAJ A;  3BP8 A;  2LY2 A;  2V7F A;  1DGR M;  4IJA A;  2M5S A;  2VOO A;  1F60 A;  2G0Y A;  2STT A;  3FBN B;  2JUC A;  4GXO A;  1DPU A;  1OR7 A;  4PJ0 C;  1ZK8 A;  4OMZ A;  2BSP A;  3BCA A;  2CMP A;  5F04 A;  2YS9 A;  3IP4 B;  1G7R A;  3P9C A;  2A6H F;  1APL C;  4RD1 A;  3C2H A;  3FBI B;  1H85 A;  1VQ8 I;  5DYM A;  3EPZ A;  2E7X A;  4ENM A;  3A8I A;  1IHM A;  1B9N A;  4B44 A;  4EAT A;  4JX5 A;  5IY5 H;  1RQR A;  2EJR A;  5DSZ A;  2F1L A;  4PC2 A;  1ETW A;  4HLX A;  3SQV A;  1B2R A;  4P3I A;  2Z1D A;  4A3B J;  3A01 A;  3CCL B;  1ZUN B;  2NTQ A;  2ZL7 A;  4F7Z A;  1GR1 A;  3BG3 A;  4ASN A;  4ZYD A;  1DG1 G;  1S72 I;  2WSS A;  3A1Y A;  4P26 A;  1B23 P;  1SAU A;  5EJC A;  3WY9 A;  3N6Z A;  1L1I A;  3PFY A;  1IB0 A;  1BIB A;  5LD2 C;  1S8N A;  4IQJ A;  2JTV A;  4OJ6 A;  2A07 F;  5HZB A;  3OW7 A;  5A89 A;  3OWT A;  1D0Z A;  4JBA A;  5GAH J;  1VQM B;  2XTW A;  5CVI A;  3MKY B;  2ZL6 A;  4B47 A;  3O8H A;  3JRH A;  3FKS A;  2P3M A;  1W7P A;  3CES A;  3I0T A;  2RRE A;  1W34 A;  3CD6 B;  4F93 B;  5FLX K;  3DDY A;  1PUF B;  4UVA A;  3I55 I;  2W1O A;  3ERM A;  3LSG A;  3K70 C;  1VQ6 B;  2NOJ B;  4HNT A;  1PXZ A;  5H2F C;  4P25 A;  3U6B A;  2OAZ A;  3CLO A;  4ON0 A;  3HGY A;  4IHT A;  3LSP A;  1IV6 A;  4P1V A;  1UD8 A;  2PX9 A;  5JBQ A;  1KMH A;  4M71 A;  1SFO J;  1BJA A;  4QV2 A;  2D1V A;  2NVX J;  2MH9 A;  3I9V 2;  3L2Q A;  3JRI A;  1W0K A;  2GOM A;  1JA1 A;  4HYE A;  4DZP A;  4B3G A;  1RU4 A;  2CSO A;  2ZNY A;  3ABK H;  5LBQ A;  3P9I A;  3K1M A;  2W7Z A;  4G6Q A;  2AXL A;  2H6C A;  4M9S A;  2VN2 A;  2DDB A;  4MGR A;  5J4Y A;  3CLQ A;  2FE3 A;  2C5B A;  3EQO A;  4GO1 A;  2F6C A;  3TKY A;  1J9I A;  2NPF A;  2INU A;  4ZYA A;  2KIS A;  1TYV A;  1WKM A;  2QBY A;  3QOP A;  3V8L A;  1QRC A;  1G3W A;  5JR3 A;  1QZE A;  4XRS G;  4OJ5 A;  4RAY A;  1FEX A;  4CCL A;  3SFI A;  1XGM A;  3CPX A;  2LKX A;  2VC1 A;  3IC7 A;  2KJB A;  1QHH D;  4MHG A;  1WDT A;  3R6K A;  5IOZ A;  4BHP A;  1S7E A;  3BTI A;  4RB3 C;  2Z9O A;  2LNB A;  1VQ7 I;  3QYF A;  3HRT A;  4Q5S F;  1KQ5 A;  2E2H J;  1EFC A;  1Z67 A;  2F4I A;  3T0Y A;  5JMC B;  2J5P A;  1LLZ A;  1OJL A;  2I8D A;  4YEI A;  2VBW A;  3LA7 A;  4ZYG A;  2DOE A;  2LF7 A;  2K9N A;  4B48 A;  1MBF A;  1R58 A;  3OFN A;  1H9G A;  3HBL A;  2EZK A;  3S3N A;  4L8J A;  4ZZL A;  1BA5 A;  1CNE A;  3VWB A;  3RPQ A;  1UD4 A;  2E1B A;  3MMY B;  3RYP A;  4RB1 A;  5M5X J;  1YX2 A;  3B8H A;  3VPR A;  1ON2 A; 
#chains in the Genus database with same CATH homology
 1HG8 A;  5TGT A;  3OS2 A;  1IDK A;  4OAY A;  4RMN A;  1SFK A;  2CUZ A;  3GVL A;  4ZDP A;  2LRE A;  4ZDO A;  1PKV A;  1E1Q A;  2BVL A;  2R7Q A;  1DQU A;  3M1C A;  4MXN A;  3OL4 A;  3HOT A;  2A5W A;  1RMG A;  2W82 A;  4FET A;  4FXU A;  2CV2 A;  4X0G A;  3OYF A;  3VSK A;  1PE9 A;  3DPL C;  2F1M A;  3LMW A;  2WA0 A;  2XOK A;  1X1B A;  2E1M B;  3A2K A;  2X53 S;  3S93 A;  2ZTG A;  2XF6 A;  2HQA A;  2DCE A;  3C2G A;  4FAS D;  2NTB A;  4CCM A;  3VST A;  3ZRG A;  3K10 A;  4C2L A;  1X1C A;  4OJP A;  1G8X A;  2MYS A;  4XN3 A;  3VYS B;  4PK4 A;  1Y56 A;  2X85 A;  4XKB A;  4IKF A;  3PL8 A;  2BSP A;  1V0F A;  2L5Q A;  3CP8 A;  2PEC A;  1MMN A;  4YEL A;  3GQA A;  4BL0 B;  2W7N A;  2UVE A;  3OMY A;  1J09 A;  2XF7 A;  1VZ0 A;  3H5R A;  1UD2 A;  3LMM A;  1KON A;  2BOL A;  4HST A;  3VYT B;  4BS9 A;  2IS1 A;  2GK7 A;  1I18 A;  4C9Y A;  3NWS A;  2CV0 A;  3DKX A;  3PJR A;  2JSP A;  4XLH A;  4DK0 A;  2QX3 A;  4GQN A;  4MLO A;  1BR4 A;  4II3 A;  3K70 D;  4E6K G;  4BGD A;  2UV1 A;  4W8S A;  4XOP A;  3T53 B;  4HIZ A;  2CK3 A;  2KRH A;  2X6W A;  3CMM A;  2HPM A;  1MMG A;  1G59 A;  2ZTN A;  2VQL A;  2KZV A;  2R4G A;  4XLE A;  3GRH A;  3OYL A;  2M7A A;  1KCD A;  2R7X A;  3PSF A;  2OUM A;  3FKJ A;  4OJO A;  5FL7 A;  3K4C A;  1BR1 A;  3LFU A;  1MNE A;  1NHC A;  3HPG A;  1V5G A;  2NT6 A;  4OZZ A;  3RQ4 A;  2CUJ A;  2WAF A;  4W8R A;  2HZD A;  4U87 A;  3OYN A;  2CW7 A;  4U7B A;  2XF5 A;  1OLT A;  2KQR A;  1T0F C;  2JJ1 A;  1AIR A;  3VSU A;  2IGN A;  3SEQ A;  1N75 A;  2HVQ A;  3SDB A;  3OYB A;  2R7W A;  3S3O A;  2IS4 A;  4TKO B;  3OEH A;  1LFP A;  3OEE A;  3TL4 X;  4PUS A;  3BCD A;  4BEH B;  3K4L A;  1D1B A;  3K4N A;  2XAU A;  3H5A A;  3IAS 2;  2LBF B;  5KNL A;  1SKY B;  2JDI A;  1O8G A;  4ZTJ A;  2VXZ A;  2CV1 A;  2D3N A;  4Z06 A;  2ZSH B;  4BJT A;  2L9N A;  2ZZQ A;  2D3L A;  2VQC A;  2XGJ A;  4W8Q A;  2JIZ A;  1RWR A;  3BG7 A;  3OYD A;  1E1R A;  4ASU A;  2VB6 A;  3W2W A;  2E60 A;  3BC8 A;  4BDY A;  1MND A;  4F3Q A;  4IZZ A;  1WFX A;  3LNN A;  4E0F A;  4AYB A;  4IQ4 A;  2CFO A;  3SEZ A;  3CJQ B;  2KDO A;  2VQG A;  2VPL A;  1JI8 A;  2ZFU A;  4ZDL A;  1UEL B;  1FMW A;  3OR2 C;  4JOM A;  4OJL A;  3G05 A;  2W4S A;  2F43 A;  4BE0 A;  3HC7 A;  4B3F X;  3DWL E;  2HDW A;  3DU5 A;  2W6I A;  1WJC A;  1IDJ A;  3QOD A;  3VYU B;  3OR1 C;  2VJ5 A;  3OAA A;  2QXZ A;  1V5F A;  3SZG A;  1WJF A;  4NC8 A;  2QKM B;  4BU2 A;  2GOX B;  2A6T A;  4ZC3 A;  3L2R A;  4RLF A;  4LG3 A;  3NE5 B;  3OPO A;  5C1E A;  2M7B A;  5HOO A;  5HKK A;  4BJ5 C;  3OS0 A;  3W2V A;  4RM3 A;  3H5N A;  4OAZ A;  4BJ6 C;  5KHD A;  2JVG A;  1QU3 A;  2K5C A;  3OOU A;  2PJR A;  3MD2 A;  3RPU D;  2XZP A;  1D1C A;  4C2U A;  4UZU A;  4II2 A;  4E7K A;  1KZL A;  4XOR A;  2V31 A;  1OGM X;  4Y4R A;  2W6J A;  3SUC A;  1UD6 A;  2GK6 A;  4XLF A;  3A3G A;  2R7S A;  3M8J A;  1ERD A;  5JHF A;  4Z05 A;  4BQQ A;  2K9L A;  1PYV A;  2AQE A;  2WY8 Q;  3OYK A;  4KIT B;  1FMV A;  2V4J C;  4XOT A;  3ZXS A;  3AL0 C;  2KLO A;  1BLI A;  2KVO A;  2WZP P;  4BEH A;  3S8P A;  2PMZ A;  1TT0 A;  1Z3X A;  3CZ6 A;  4I84 A;  4BAC A;  2X51 A;  1R6R A;  3A4C A;  4E4H A;  3B90 A;  4MR0 A;  3VMV A;  2F5V A;  1VF7 A;  3WQZ A;  1AA7 A;  2O04 A;  1BPL A;  1YE9 A;  2XDV A;  3FHN A;  4LIU A;  3KYL A;  1MMA A;  4XMY A;  1T95 A;  3FDY A;  3OYE A;  5HNF A;  2M4G A;  3RSN A;  4P5O A;  4XN0 A;  3OYG A;  3VSV A;  3HG9 A;  4Y33 A;  4D1Q A;  4YXW A;  1BR2 A;  2DT7 B;  2Z2S B;  3OL3 A;  3TBI A;  1O8J A;  4PJJ A;  1O8D A;  1D0Y A;  3H9G A;  3UNG C;  1MMD A;  2MAB A;  2PYH A;  4E7I A;  2HVR A;  2CH0 A;  3KEW A;  3PSI A;  3J7A Y;  2W00 A;  4B43 A;  2CS3 A;  4N4O B;  1BOB A;  3CP2 A;  2X6X A;  3TMO A;  2WPD A;  1VBL A;  4U49 A;  2R7O A;  2VQH A;  3GVK A;  3V42 A;  4G7W A;  4ANJ A;  4EW9 A;  4PSX A;  4XNF A;  4YZQ A;  2IGO A;  1CZF A;  4HSR A;  2XC7 A;  3T51 B;  2JJ2 A;  1DGW Y;  3DPU A;  3I3L A;  3VDX A;  2FUG 2;  4Z03 A;  2V26 A;  1P9Q C;  3DU6 A;  4E7L A;  4KKT A;  4E7S A;  1W0J A;  3H0D A;  2E5N A;  2RNG A;  2VBE A;  1QHG A;  3H9Q A;  3LL7 A;  3VYR B;  3CJR B;  1E43 A;  2JA2 A;  1IRX A;  2NST A;  1V0E A;  4W8T A;  3D5R C;  1VJS A;  4YZA A;  1X0C A;  3GQ9 A;  2R7R A;  4DBR A;  2QE7 A;  2JUG A;  4XR6 A;  2LZJ A;  4YRV A;  2K9M A;  1OFL A;  3EUK L;  3H9J A;  4DOZ A;  1UD3 A;  3T56 B;  5LFA A;  1PJR A;  4URR A;  4XKW A;  1WJA A;  1E0E A;  4E7Z A;  1IB4 A;  2AQF A;  2ZXH A;  1WPC A;  3B8Y A;  1NRK A;  1X19 A;  4AU7 A;  5HNH A;  3W3C A;  3DTI A;  1WJD A;  3QOE A;  4BQN A;  1QCX A;  3FPP A;  2IS6 A;  1COW A;  1MW7 A;  2VL8 A;  1LDK B;  1WJE A;  2BW3 B;  4Y3O A;  5CQE A;  4KT6 A;  3HKZ A;  2QY1 A;  2MD0 A;  1HA8 A;  4HWV A;  3OIQ A;  2HNH A;  1DP3 A;  3E1S A;  2MC4 A;  3ZIA A;  1X1A A;  3VR6 A;  4F52 A;  1EE6 A;  4GRI A;  4XLC A;  2VBM A;  2E5Z A;  4NC7 A;  1WJB A;  3DQV C;  3LSI A;  3ONQ A;  4J00 A;  4J01 A;  2LYC A;  2K3P A;  3MKZ A;  3A35 A;  2IS2 A;  4C30 A;  3L2V A;  1DBG A;  4E7J A;  2M0M A;  2V9K A;  3OE7 A;  1O8F A;  2WB1 A;  4E7H A;  4D9J A;  4KKU A;  3W2A A;  3E0J B;  2O1D A;  3T9G A;  2Y0S A;  3ZPP A;  2E1M C;  4YZ0 A;  2IGM A;  3HXL A;  3K4K A;  3S3M A;  2UWM A;  5CDF A;  3AFH A;  2RQQ A;  3D5S C;  4CCN A;  5DN6 A;  3HL2 A;  1DBO A;  3GQ8 A;  3EUH C;  4Z1M A;  4BE1 A;  1Z3Y A;  2LY1 A;  1BMF A;  1NG7 A;  3QYE A;  4RM2 A;  1TZL A;  4F55 A;  1E3Z A;  4XD7 A;  4DIQ A;  2V4D A;  2M3A A;  3OYH A;  3PNV A;  4P1W A;  4LIV A;  4DNT B;  2CW8 A;  1H8E A;  4XL9 A;  2JVH A;  3OY9 A;  3GQ7 A;  4PJN A;  3F9K A;  4HEA 2;  5IK2 A;  1N78 A;  1HVX A;  1V5E A;  4F91 B;  2ZZF A;  4R79 A;  4CA0 A;  2WAQ A;  2DJI A;  2X1D A;  1I8D A;  2Z8G A;  3UW0 A;  4AVZ A;  1O8K A;  1S9H A;  2WAD A;  4N4N B;  3K4M A;  3L2W A;  2XZL A;  3ZSC A;  4CH7 A;  1NG6 A;  4YZX A;  3BH4 A;  2LH9 A;  2KL4 A;  2XSJ C;  5HLT A;  2OC6 A;  3K4B A;  3K6G A;  2NT9 A;  3KRG A;  3U21 A;  2LG4 A;  2Z6B D;  2X6Y A;  2QKL B;  3DTE A;  3OYI A;  4XLA A;  2O17 A;  1O8L A;  1K5C A;  2VXD A;  4P22 A;  4PJL A;  2ZXI A;  1O8E A;  3DPT A;  4XKC A;  1GLN A;  2DT6 A;  4PFO A;  2KP6 A;  1K28 D;  2BW3 A;  3BCB A;  1GQ8 A;  3NWT A;  2WY7 Q;  3A3B A;  2R7U A;  1WP6 A;  1D1A A;  3OYC A;  2KPM A;  1WJ5 A;  2LOO A;  2GJR A;  4G6T B;  1W9X A;  1JRG A;  1YX5 A;  4CCK A;  2IQ7 A;  3PUB A;  4QPQ A;  2IGK A;  2LBF A;  4BQO A;  4QPO A;  3RTR A;  1HZE A;  2ZZE A;  2BVM A;  2VKH A;  3EUA A;  4XM3 A;  3JU4 A;  2V7Q A;  1Z7L A;  5CQG A;  1KTW A;  5HVQ C;  3HPH A;  3N05 A;  4RLQ A;  2R7V A;  4G7X A;  1E79 A;  3VMW A;  4IX7 A;  1X4P A;  3BCF A;  4PJM A;  3LSM A;  2R7T A;  2L2O A;  5CPR B;  2X8K A;  3VSL A;  1D0X A;  2ZSI B;  4HPQ A;  3BG6 A;  2P0W A;  1N77 A;  2HPI A;  3IUO A;  5AMV A;  3OS1 A;  4DBQ A;  2GJK A;  2GJP A;  3ZPN A;  2PYG A;  1Y6I A;  4NNJ A;  2V1N A;  2VAS A;  3RCO A;  3DTK A;  3QYB A;  3MKW B;  3KEY A;  4BXF A;  4TSF A;  1FX0 A;  4DNR B;  5KCM A;  2WBM A;  3GQB A;  4PFP A;  3B4N A;  3OIP A;  4CUG A;  2LY2 A;  2V7F A;  4CZC A;  1DGR M;  2VJI A;  2DIE A;  2M5S A;  1O8M A;  4JMQ A;  3FBN B;  4LIT A;  2VKD A;  3SYT A;  1W36 C;  2VLA A;  1WMR A;  3LSH A;  2KRC A;  3G2B A;  4KJZ A;  1UAA A;  3BCA A;  2CMP A;  1X1D A;  4DGW B;  3IP4 B;  2INV A;  5C1C A;  1KCC A;  1BN8 A;  4DK1 A;  3C2H A;  3FBI B;  1EFR A;  3GVJ A;  3EPZ A;  2O0V A;  2M4K A;  1H80 A;  4B44 A;  2LC2 A;  4EAT A;  5FRN A;  3OYM A;  3BC9 A;  1OGO X;  4CCO A;  1O88 A;  1XG2 A;  3OYJ A;  2KHM A;  1OR7 C;  2VJ4 A;  2Z1D A;  3ZR8 X;  4HNU A;  2NTQ A;  1ZEL A;  3WWG A;  3HOS A;  2VIX A;  1OOC A;  2VJJ A;  3BLY A;  2WSS A;  3A1Y A;  1O8I A;  1SAU A;  3DLA A;  3PFY A;  1IA5 A;  3JUR A;  1UD5 A;  4BDZ A;  1X4O A;  5LD2 C;  4IQJ A;  1WTH D;  4OJ6 A;  1NBM A;  2DOA A;  3OW7 A;  3OWT A;  3H94 A;  1D0Z A;  3EQN A;  4XQF A;  3AL0 B;  3MKY B;  1OB0 A;  4XON A;  4B47 A;  3L2U A;  3FKS A;  2PJR B;  2XZO A;  3HAG A;  5FRO A;  3PNY A;  2ELJ A;  3CES A;  2X1E A;  3DEE A;  2RRE A;  5CKT A;  4F93 B;  4KIS A;  2NZM A;  3DDY A;  4NK8 A;  4U4B A;  2KMU A;  3GBG A;  2W1O A;  3LSG A;  4XKV A;  3K70 C;  3OOC A;  4ZTF A;  2NOJ B;  4HNT A;  1PXZ A;  4BUP A;  2HVS A;  3PNT A;  1UD8 A;  2HU9 A;  1KMH A;  2ZZG A;  1JTA A;  3AKZ A;  1U0J A;  1PLU A;  4ZJZ A;  2HLD A;  3I9V 2;  2UVF A;  3L2Q A;  1K6Y A;  3ZGK A;  4PSW A;  2GOM A;  2UUZ A;  1W0K A;  2ODL A;  4HG2 A;  2WAE A;  4NQW B;  4B3G A;  1OHH A;  1RU4 A;  4PMH A;  1LKX A;  2MFZ A;  2DXI A;  1QJV A;  2XND A;  2NSP A;  3KX2 A;  1UG0 A;  3DKY A;  3ZQQ A;  2EWE A;  4NUB A;  4BE2 A;  1H8H A;  4CCJ A;  3EQO A;  3FY3 A;  2F6C A;  2L9S A;  3K4J A;  4OWR B;  4ZYA A;  3IAM 2;  1OFM A;  2INU A;  2X3H A;  3UR3 C;  4OZY A;  2IXS A;  4CSW A;  3LSK A;  4OJ5 A;  2WJV A;  3H35 A;  4CCL A;  4JQF A;  2OV7 A;  1MAB A;  1QHH D;  4HRI A;  3CF2 A;  4C2T A;  2R9V A;  2V6E A;  3QYF A;  2O0W A;  2O5R A;  4KKS A;  1O8H A;  4NK6 A;  2F4I A;  1YX3 A;  1BHE A;  2NTP A;  2Q2E B;  2X1C A;  5FRM A;  2Z16 A;  2I8D A;  4DJA A;  1E3X A;  4B48 A;  3S32 A;  3HUG B;  4H4K C;  1EA3 A;  3ZCO A;  3OFN A;  1LVK A;  1VLY A;  3OYA A;  3S3N A;  4L8J A;  2WJY A;  4G6I A;  2LRD A;  4F92 B;  3VWB A;  4B3X A;  4ITV A;  1UD4 A;  2E1B A;  2VBK A;  2L7K A;  2Q1Z B;  3MMY B;  1T5E A;  4TT3 A;  4YEJ A;  3D5L A;  1W36 D;  1Z21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...