4OZZA

Crystal structure of the periplasmic alginate epimerase algg t265n t268m double mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
424
structure length
423
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYNPNMAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N T268M double mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 169
structure length 423
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozzA00
4OJ5A 4U4BA 4W8QA 4AVZA 1O8FA 1EE6A 2VBMA 5C1EA 3SUCA 3ZSCA 1PE9A 2QX3A 1O88A 3GQ9A 4XM3A 3GQ8A 4OZZA 4YEJA 1AIRA 1KCCA 4XR6A 3KRGA 4Z06A 4XOPA 2Z8GA 2PYGA 2O17A 3WWGA 4PMHA 1X0CA 2VBKA 3JURA 4XNFA 1GQ8A 4EW9A 4C2LA 1NHCA 1O8LA 3B8YA 3EQOA 4YZ0A 2UVFA 4XLFA 2O0VA 4W8SA 3B4NA 1HG8A 1DBOA 3VMWA 1CZFA 3GRHA 1O8HA 1K5CA 1PXZA 1JTAA 2X6WA 2QXZA 2INVA 2NTPA 4URRA 1O8EA 1H80A 2X6XA 2BSPA 1O8MA 1OFMA 1JRGA 2NT6A 1O8IA 4XN0A 4U49A 2PYHA 1XG2A 4XKVA 3LMWA 5AMVA 2NZMA 4MR0A 4XL9A 2IQ7A 2NTBA 2QY1A 3VSVA 3T9GA 1QJVA 2O1DA 4XORA 4XMYA 4NK6A 3VMVA 4OJLA 4XLAA 4YZAA 1DBGA 4XOTA 1OGMX 2O04A 3FY3A 4YZQA 1QCXA 4XLCA 1OOCA 1RMGA 4OJOA 4XQFA 1OGOX 1PLUA 1VBLA 4W8TA 2X3HA 2VJJA 2O0WA 1BHEA 2UVEA 1IDKA 4XONA 3VSTA 3EQNA 4XLHA 4W8RA 1O8KA 5C1CA 4YZXA 4I84A 2VJIA 2X85A 1KTWA 1RU4A 2X6YA 1IA5A 4XLEA 4HWVA 4Z05A 2EWEA 4Z03A 1IDJA 4XKWA 4YELA 1RWRA 4XN3A 1IB4A 1O8DA 2NSPA 2NTQA 1O8JA 3GQ7A 3GQAA 4OZYA 3VSUA 4OJ6A 1OFLA 1O8GA 1WMRA 1KCDA 2VBEA 2NT9A 2NSTA 2ODLA 1BN8A 2INUA 4NK8A 4MXNA 3UW0A 3ZPPA 4OJPA 3B90A 2PECA
chains in the Genus database with same CATH superfamily
2QZAA 4OJ5A 1WXRA 1CLWA 4U4BA 4W8QA 4AVZA 1O8FA 2XT4A 2W7ZA 3BH7B 1EE6A 2VBMA 5C1EA 2XTWA 1QA1A 2XT2A 2G0YA 1QQ1A 1K4ZA 3SUCA 3ZSCA 1HF2A 1PE9A 2QX3A 1K8FA 3RIQA 1O88A 3GQ9A 4XM3A 3GQ8A 4OZZA 4YEJA 1AIRA 3SYJA 1KCCA 4YFOA 4XR6A 3KRGA 1EA0A 4Z06A 2VFMA 4XOPA 3PSSA 2Z8GA 4YDTA 2XC1A 3SZEA 2PYGA 3ML3A 2O17A 3WWGA 2BM5A 1KQ5A 4PMHA 1X0CA 2VBKA 3JURA 4XNFA 1GQ8A 4EW9A 1TYUA 4C2LA 1NHCA 1QA3A 2VFQA 1O8LA 3B8YA 3EQOA 1LM1A 2J8KA 2BM4A 2UVFA 4XLFA 4YZ0A 2O0VA 4W8SA 3B4NA 1HG8A 1DBOA 4YCQA 3VMWA 1CZFA 3GRHA 1O8HA 1K5CA 1PXZA 1JTAA 2X6WA 4YEIA 3LJYA 2QXZA 1LLZA 2INVA 2NTPA 4OM9A 4URRA 1H80A 1O8EA 1OFEA 2X6XA 1OFDA 2BSPA 1O8MA 1OFMA 2BX6A 1JRGA 2NT6A 1LLWA 1O8IA 4XN0A 4U49A 1TYVA 3JX8A 1TYXA 3SY2A 2PYHA 1XG2A 3DU1X 2XTYA 3LMWA 3H09A 2NZMA 4XKVA 4V02C 5AMVA 4MR0A 4XL9A 2YUHA 2IQ7A 2NTBA 2QY1A 3VSVA 3T9GA 1QJVA 2O1DA 4XORA 1EZGA 4XMYA 4NK6A 2O6WA 3TH0A 3VMVA 2VFOA 2F3LA 4JRAC 4OPWA 4OJLA 4XLAA 4YZAA 1DBGA 5JMCB 1DABA 4XOTA 1OGMX 2O04A 3FY3A 3BH6B 2VFPA 2VFNA 4YZQA 1QCXA 2V5IA 3PSZA 4XLCA 1OOCA 1RMGA 1TSPA 4OJOA 4XQFA 1OGOX 1PLUA 1VBLA 3NAWA 4W8TA 2X3HA 2VJJA 2O0WA 1BHEA 2UVEA 1IDKA 3N90A 3PETA 4XONA 3VSTA 3EQNA 3N6ZA 2B0RA 4XLHA 4W8RA 1O8KA 4YC5A 5C1CA 4YZXA 4I84A 2BM7A 2VJIA 2IOUG 2X85A 5JLVC 1KTWA 1RU4A 2X6YA 2J8IA 1IA5A 4XLEA 4HWVA 4Z05A 3NB2A 2EWEA 4Z03A 1IDJA 4XKWA 4YELA 3SQVA 1RWRA 4XN3A 2QYUA 1IB4A 1O8DA 1TYWA 2NSPA 2NTQA 1O8JA 3GQ7A 3GQAA 4OZYA 1QA2A 3VSUA 4OJ6A 2BM6A 3AK5A 1OFLA 1L1IA 1O8GA 1WMRA 1KCDA 2VBEA 2NT9A 2NSTA 4KH3A 2ODLA 1BN8A 2XTXA 5DNSA 2INUA 3LYCA 4NK8A 3P4GA 1QRBA 4MXNA 3UW0A 1QRCA 3ZPPA 4OJPA 3B90A 2PECA
chains in the Genus database with same CATH topology
4OJ5A 4U4BA 4W8QA 4AVZA 1O8FA 1EE6A 2VBMA 5C1EA 3SUCA 3ZSCA 1PE9A 2QX3A 1O88A 3GQ9A 4XM3A 3GQ8A 4OZZA 4YEJA 1AIRA 1KCCA 4XR6A 3KRGA 4Z06A 4XOPA 2Z8GA 2PYGA 2O17A 3WWGA 4PMHA 1X0CA 2VBKA 3JURA 4XNFA 1GQ8A 4EW9A 4C2LA 1NHCA 1O8LA 3B8YA 3EQOA 4YZ0A 2UVFA 4XLFA 2O0VA 4W8SA 3B4NA 1HG8A 1DBOA 3VMWA 1CZFA 3GRHA 1O8HA 1K5CA 1PXZA 1JTAA 2X6WA 2QXZA 2INVA 2NTPA 4URRA 1O8EA 1H80A 2X6XA 2BSPA 1O8MA 1OFMA 1JRGA 2NT6A 1O8IA 4XN0A 4U49A 2PYHA 1XG2A 4XKVA 3LMWA 5AMVA 2NZMA 4MR0A 4XL9A 2IQ7A 2NTBA 2QY1A 3VSVA 3T9GA 1QJVA 2O1DA 4XORA 4XMYA 4NK6A 3VMVA 4OJLA 4XLAA 4YZAA 1DBGA 4XOTA 1OGMX 2O04A 3FY3A 4YZQA 1QCXA 4XLCA 1OOCA 1RMGA 4OJOA 4XQFA 1OGOX 1PLUA 1VBLA 4W8TA 2X3HA 2VJJA 2O0WA 1BHEA 2UVEA 1IDKA 4XONA 3VSTA 3EQNA 4XLHA 4W8RA 1O8KA 5C1CA 4YZXA 4I84A 2VJIA 2X85A 1KTWA 1RU4A 2X6YA 1IA5A 4XLEA 4HWVA 4Z05A 2EWEA 4Z03A 1IDJA 4XKWA 4YELA 1RWRA 4XN3A 1IB4A 1O8DA 2NSPA 2NTQA 1O8JA 3GQ7A 3GQAA 4OZYA 3VSUA 4OJ6A 1OFLA 1O8GA 1WMRA 1KCDA 2VBEA 2NT9A 2NSTA 2ODLA 1BN8A 2INUA 4NK8A 4MXNA 3UW0A 3ZPPA 4OJPA 3B90A 2PECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJ5 A;  4U4B A;  4W8Q A;  4AVZ A;  1O8F A;  1EE6 A;  2VBM A;  5C1E A;  3SUC A;  3ZSC A;  1PE9 A;  2QX3 A;  1O88 A;  3GQ9 A;  4XM3 A;  3GQ8 A;  4OZZ A;  4YEJ A;  1AIR A;  1KCC A;  4XR6 A;  3KRG A;  4Z06 A;  4XOP A;  2Z8G A;  2PYG A;  2O17 A;  3WWG A;  4PMH A;  1X0C A;  2VBK A;  3JUR A;  4XNF A;  1GQ8 A;  4EW9 A;  4C2L A;  1NHC A;  1O8L A;  3B8Y A;  3EQO A;  4YZ0 A;  2UVF A;  4XLF A;  2O0V A;  4W8S A;  3B4N A;  1HG8 A;  1DBO A;  3VMW A;  1CZF A;  3GRH A;  1O8H A;  1K5C A;  1PXZ A;  1JTA A;  2X6W A;  2QXZ A;  2INV A;  2NTP A;  4URR A;  1O8E A;  1H80 A;  2X6X A;  2BSP A;  1O8M A;  1OFM A;  1JRG A;  2NT6 A;  1O8I A;  4XN0 A;  4U49 A;  2PYH A;  1XG2 A;  4XKV A;  3LMW A;  5AMV A;  2NZM A;  4MR0 A;  4XL9 A;  2IQ7 A;  2NTB A;  2QY1 A;  3VSV A;  3T9G A;  1QJV A;  2O1D A;  4XOR A;  4XMY A;  4NK6 A;  3VMV A;  4OJL A;  4XLA A;  4YZA A;  1DBG A;  4XOT A;  1OGM X;  2O04 A;  3FY3 A;  4YZQ A;  1QCX A;  4XLC A;  1OOC A;  1RMG A;  4OJO A;  4XQF A;  1OGO X;  1PLU A;  1VBL A;  4W8T A;  2X3H A;  2VJJ A;  2O0W A;  1BHE A;  2UVE A;  1IDK A;  4XON A;  3VST A;  3EQN A;  4XLH A;  4W8R A;  1O8K A;  5C1C A;  4YZX A;  4I84 A;  2VJI A;  2X85 A;  1KTW A;  1RU4 A;  2X6Y A;  1IA5 A;  4XLE A;  4HWV A;  4Z05 A;  2EWE A;  4Z03 A;  1IDJ A;  4XKW A;  4YEL A;  1RWR A;  4XN3 A;  1IB4 A;  1O8D A;  2NSP A;  2NTQ A;  1O8J A;  3GQ7 A;  3GQA A;  4OZY A;  3VSU A;  4OJ6 A;  1OFL A;  1O8G A;  1WMR A;  1KCD A;  2VBE A;  2NT9 A;  2NST A;  2ODL A;  1BN8 A;  2INU A;  4NK8 A;  4MXN A;  3UW0 A;  3ZPP A;  4OJP A;  3B90 A;  2PEC A; 
#chains in the Genus database with same CATH topology
 2QZA A;  4OJ5 A;  1WXR A;  1CLW A;  4U4B A;  4W8Q A;  4AVZ A;  1O8F A;  2XT4 A;  2W7Z A;  3BH7 B;  1EE6 A;  2VBM A;  5C1E A;  2XTW A;  1QA1 A;  2XT2 A;  2G0Y A;  1QQ1 A;  1K4Z A;  3SUC A;  3ZSC A;  1HF2 A;  1PE9 A;  2QX3 A;  1K8F A;  3RIQ A;  1O88 A;  3GQ9 A;  4XM3 A;  3GQ8 A;  4OZZ A;  4YEJ A;  1AIR A;  3SYJ A;  1KCC A;  4YFO A;  4XR6 A;  3KRG A;  1EA0 A;  4Z06 A;  2VFM A;  4XOP A;  3PSS A;  2Z8G A;  4YDT A;  2XC1 A;  3SZE A;  2PYG A;  3ML3 A;  2O17 A;  3WWG A;  2BM5 A;  1KQ5 A;  4PMH A;  1X0C A;  2VBK A;  3JUR A;  4XNF A;  1GQ8 A;  4EW9 A;  1TYU A;  4C2L A;  1NHC A;  1QA3 A;  2VFQ A;  1O8L A;  3B8Y A;  3EQO A;  1LM1 A;  2J8K A;  2BM4 A;  2UVF A;  4XLF A;  4YZ0 A;  2O0V A;  4W8S A;  3B4N A;  1HG8 A;  1DBO A;  4YCQ A;  3VMW A;  1CZF A;  3GRH A;  1O8H A;  1K5C A;  1PXZ A;  1JTA A;  2X6W A;  4YEI A;  3LJY A;  2QXZ A;  1LLZ A;  2INV A;  2NTP A;  4OM9 A;  4URR A;  1H80 A;  1O8E A;  1OFE A;  2X6X A;  1OFD A;  2BSP A;  1O8M A;  1OFM A;  2BX6 A;  1JRG A;  2NT6 A;  1LLW A;  1O8I A;  4XN0 A;  4U49 A;  1TYV A;  3JX8 A;  1TYX A;  3SY2 A;  2PYH A;  1XG2 A;  3DU1 X;  2XTY A;  3LMW A;  3H09 A;  2NZM A;  4XKV A;  4V02 C;  5AMV A;  4MR0 A;  4XL9 A;  2YUH A;  2IQ7 A;  2NTB A;  2QY1 A;  3VSV A;  3T9G A;  1QJV A;  2O1D A;  4XOR A;  1EZG A;  4XMY A;  4NK6 A;  2O6W A;  3TH0 A;  3VMV A;  2VFO A;  2F3L A;  4JRA C;  4OPW A;  4OJL A;  4XLA A;  4YZA A;  1DBG A;  5JMC B;  1DAB A;  4XOT A;  1OGM X;  2O04 A;  3FY3 A;  3BH6 B;  2VFP A;  2VFN A;  4YZQ A;  1QCX A;  2V5I A;  3PSZ A;  4XLC A;  1OOC A;  1RMG A;  1TSP A;  4OJO A;  4XQF A;  1OGO X;  1PLU A;  1VBL A;  3NAW A;  4W8T A;  2X3H A;  2VJJ A;  2O0W A;  1BHE A;  2UVE A;  1IDK A;  3N90 A;  3PET A;  4XON A;  3VST A;  3EQN A;  3N6Z A;  2B0R A;  4XLH A;  4W8R A;  1O8K A;  4YC5 A;  5C1C A;  4YZX A;  4I84 A;  2BM7 A;  2VJI A;  2IOU G;  2X85 A;  5JLV C;  1KTW A;  1RU4 A;  2X6Y A;  2J8I A;  1IA5 A;  4XLE A;  4HWV A;  4Z05 A;  3NB2 A;  2EWE A;  4Z03 A;  1IDJ A;  4XKW A;  4YEL A;  3SQV A;  1RWR A;  4XN3 A;  2QYU A;  1IB4 A;  1O8D A;  1TYW A;  2NSP A;  2NTQ A;  1O8J A;  3GQ7 A;  3GQA A;  4OZY A;  1QA2 A;  3VSU A;  4OJ6 A;  2BM6 A;  3AK5 A;  1OFL A;  1L1I A;  1O8G A;  1WMR A;  1KCD A;  2VBE A;  2NT9 A;  2NST A;  4KH3 A;  2ODL A;  1BN8 A;  2XTX A;  5DNS A;  2INU A;  3LYC A;  4NK8 A;  3P4G A;  1QRB A;  4MXN A;  3UW0 A;  1QRC A;  3ZPP A;  4OJP A;  3B90 A;  2PEC A; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  4U4B A;  4W8Q A;  4AVZ A;  1O8F A;  1EE6 A;  2VBM A;  5C1E A;  3SUC A;  3ZSC A;  1PE9 A;  2QX3 A;  1O88 A;  3GQ9 A;  4XM3 A;  3GQ8 A;  4OZZ A;  4YEJ A;  1AIR A;  1KCC A;  4XR6 A;  3KRG A;  4Z06 A;  4XOP A;  2Z8G A;  2PYG A;  2O17 A;  3WWG A;  4PMH A;  1X0C A;  2VBK A;  3JUR A;  4XNF A;  1GQ8 A;  4EW9 A;  4C2L A;  1NHC A;  1O8L A;  3B8Y A;  3EQO A;  4YZ0 A;  2UVF A;  4XLF A;  2O0V A;  4W8S A;  3B4N A;  1HG8 A;  1DBO A;  3VMW A;  1CZF A;  3GRH A;  1O8H A;  1K5C A;  1PXZ A;  1JTA A;  2X6W A;  2QXZ A;  2INV A;  2NTP A;  4URR A;  1O8E A;  1H80 A;  2X6X A;  2BSP A;  1O8M A;  1OFM A;  1JRG A;  2NT6 A;  1O8I A;  4XN0 A;  4U49 A;  2PYH A;  1XG2 A;  4XKV A;  3LMW A;  5AMV A;  2NZM A;  4MR0 A;  4XL9 A;  2IQ7 A;  2NTB A;  2QY1 A;  3VSV A;  3T9G A;  1QJV A;  2O1D A;  4XOR A;  4XMY A;  4NK6 A;  3VMV A;  4OJL A;  4XLA A;  4YZA A;  1DBG A;  4XOT A;  1OGM X;  2O04 A;  3FY3 A;  4YZQ A;  1QCX A;  4XLC A;  1OOC A;  1RMG A;  4OJO A;  4XQF A;  1OGO X;  1PLU A;  1VBL A;  4W8T A;  2X3H A;  2VJJ A;  2O0W A;  1BHE A;  2UVE A;  1IDK A;  4XON A;  3VST A;  3EQN A;  4XLH A;  4W8R A;  1O8K A;  5C1C A;  4YZX A;  4I84 A;  2VJI A;  2X85 A;  1KTW A;  1RU4 A;  2X6Y A;  1IA5 A;  4XLE A;  4HWV A;  4Z05 A;  2EWE A;  4Z03 A;  1IDJ A;  4XKW A;  4YEL A;  1RWR A;  4XN3 A;  1IB4 A;  1O8D A;  2NSP A;  2NTQ A;  1O8J A;  3GQ7 A;  3GQA A;  4OZY A;  3VSU A;  4OJ6 A;  1OFL A;  1O8G A;  1WMR A;  1KCD A;  2VBE A;  2NT9 A;  2NST A;  2ODL A;  1BN8 A;  2INU A;  4NK8 A;  4MXN A;  3UW0 A;  3ZPP A;  4OJP A;  3B90 A;  2PEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...