4OZZA

Crystal structure of the periplasmic alginate epimerase algg t265n t268m double mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
424
structure length
423
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYNPNMAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N T268M double mutant
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 169
structure length 423
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozzA00
4XNFA 2BSPA 2UVFA 2NTBA 1O8FA 1KCDA 1RWRA 1O8EA 1KCCA 3GQ9A 1QCXA 2VJIA 2NT6A 1GQ8A 2NZMA 3B4NA 4XOTA 2Z8GA 1O8DA 1O8JA 4U4BA 3B90A 1PE9A 1KTWA 1O8IA 4NK8A 1K5CA 2O17A 4XL9A 4EW9A 2INVA 2QX3A 2VBMA 4W8QA 4YEJA 1OGOX 1WMRA 1EE6A 3SUCA 4XLEA 4YZ0A 2O04A 2IQ7A 4OJPA 1O8GA 1QJVA 4XR6A 2X6YA 1JRGA 2VBEA 1NHCA 3T9GA 4W8TA 3EQOA 3VMVA 4OJ6A 4MR0A 1O8HA 2NTQA 3VSTA 1OOCA 4YELA 1RU4A 1BHEA 4OZYA 2X85A 2PYGA 3VMWA 2O0VA 2PYHA 3WWGA 4YZXA 4XMYA 1H80A 4MXNA 1JTAA 2QY1A 4XQFA 2X6XA 1X0CA 4OJ5A 4OJLA 2VBKA 4XORA 1IDKA 4XONA 4XN3A 3EQNA 1XG2A 3FY3A 4OZZA 2EWEA 1O88A 1DBOA 1O8KA 4Z03A 3GQAA 4U49A 4XLFA 1AIRA 2NSPA 3LMWA 4C2LA 1PLUA 3KRGA 3ZSCA 4NK6A 4YZAA 2X6WA 4OJOA 1IDJA 1HG8A 4I84A 2NT9A 2ODLA 4XOPA 4W8SA 4XM3A 4XLHA 4XN0A 5C1CA 1CZFA 3B8YA 5AMVA 3GQ7A 4Z06A 1O8MA 2UVEA 2O0WA 3VSUA 4AVZA 1IA5A 1VBLA 4XKWA 1RMGA 4Z05A 1DBGA 5C1EA 1OFMA 1OGMX 3VSVA 1OFLA 4XLAA 3ZPPA 3UW0A 2INUA 1PXZA 2VJJA 3GQ8A 4URRA 3JURA 4HWVA 1O8LA 2X3HA 4XKVA 4XLCA 2NSTA 1BN8A 4YZQA 4W8RA 3GRHA 2NTPA 4PMHA 1IB4A 2PECA 2QXZA 2O1DA
chains in the Genus database with same CATH superfamily
4XNFA 4YC5A 2XTWA 2UVFA 2NTBA 1O8FA 1KCDA 1RWRA 1O8EA 3BH6B 1KCCA 2YUHA 1QCXA 3GQ9A 2VJIA 2NT6A 3BH7B 1GQ8A 2NZMA 3B4NA 2VFOA 4XOTA 2Z8GA 1O8DA 1O8JA 4U4BA 3B90A 2BX6A 3SZEA 1PE9A 1CLWA 2W7ZA 4OM9A 2J8IA 1KTWA 1O8IA 4NK8A 1K5CA 1QA2A 2O17A 4XL9A 4EW9A 2INVA 3NB2A 2QX3A 2VBMA 4W8QA 4YEJA 1OGOX 1WMRA 1EE6A 3SUCA 2VFQA 4XLEA 1TYWA 4JRAC 2O04A 3LJYA 2IQ7A 4OJPA 4YZ0A 1O8GA 1QJVA 4XR6A 2X6YA 1JRGA 2VBEA 1NHCA 2BM7A 4W8TA 2V5IA 3RIQA 3T9GA 1HF2A 3EQOA 3VMVA 3N90A 1K8FA 4MR0A 4OJ6A 1O8HA 2NTQA 3VSTA 1QQ1A 5DNSA 1OOCA 1QA1A 4YELA 2QXZA 3PETA 1RU4A 1BHEA 4OZYA 2XTYA 2X85A 2PYGA 3VMWA 2O0VA 4YCQA 2PYHA 3WWGA 4YZXA 2O6WA 4XMYA 2VFMA 3PSZA 1H80A 4MXNA 1K4ZA 1JTAA 2QY1A 4XQFA 2B0RA 1EA0A 2X6XA 1X0CA 4OPWA 4OJ5A 4OJLA 2VBKA 1TYUA 1IDKA 1QRBA 4XORA 4XONA 4XN3A 3SY2A 1DABA 3EQNA 1LLWA 3SQVA 1TYXA 1XG2A 3FY3A 4OZZA 2EWEA 3DU1X 1O88A 1DBOA 1O8KA 2IOUG 4Z03A 3GQAA 1LM1A 4U49A 4XLFA 4YDTA 2QYUA 1AIRA 2NSPA 3LMWA 3N6ZA 1PLUA 3KRGA 4C2LA 2XT2A 1KQ5A 3ZSCA 2BM6A 4NK6A 4YZAA 2XT4A 2X6WA 4OJOA 3SYJA 1L1IA 1IDJA 1HG8A 1OFEA 4I84A 5JLVC 2NT9A 1QRCA 2F3LA 1LLZA 2ODLA 2VFNA 4W8SA 4XLHA 4XM3A 4XN0A 4XOPA 4YFOA 1TSPA 5C1CA 1CZFA 2XC1A 3B8YA 5JMCB 5AMVA 3GQ7A 4Z06A 1O8MA 2BM4A 2UVEA 3H09A 3NAWA 2O0WA 3VSUA 4AVZA 1IA5A 1VBLA 4XKWA 2XTXA 1RMGA 2J8KA 4Z05A 2G0YA 1DBGA 3PSSA 3TH0A 5C1EA 1OFMA 1OGMX 3ML3A 3VSVA 1QA3A 1TYVA 1OFLA 4YEIA 4XLAA 3ZPPA 3UW0A 4V02C 2INUA 1PXZA 2VJJA 3GQ8A 3P4GA 4URRA 3JURA 2VFPA 4HWVA 1O8LA 2O1DA 2QZAA 2X3HA 4XKVA 4XLCA 2NSTA 1BN8A 4YZQA 4KH3A 4W8RA 3AK5A 1OFDA 3GRHA 3LYCA 1EZGA 2NTPA 4PMHA 1IB4A 3JX8A 2PECA 2BM5A 2BSPA 1WXRA
chains in the Genus database with same CATH topology
4XNFA 2BSPA 2UVFA 2NTBA 1O8FA 1KCDA 1RWRA 1O8EA 1KCCA 3GQ9A 1QCXA 2VJIA 2NT6A 1GQ8A 2NZMA 3B4NA 4XOTA 2Z8GA 1O8DA 1O8JA 4U4BA 3B90A 1PE9A 1KTWA 1O8IA 4NK8A 1K5CA 2O17A 4XL9A 4EW9A 2INVA 2QX3A 2VBMA 4W8QA 4YEJA 1OGOX 1WMRA 1EE6A 3SUCA 4XLEA 4YZ0A 2O04A 2IQ7A 4OJPA 1O8GA 1QJVA 4XR6A 2X6YA 1JRGA 2VBEA 1NHCA 3T9GA 4W8TA 3EQOA 3VMVA 4OJ6A 4MR0A 1O8HA 2NTQA 3VSTA 1OOCA 4YELA 1RU4A 1BHEA 4OZYA 2X85A 2PYGA 3VMWA 2O0VA 2PYHA 3WWGA 4YZXA 4XMYA 1H80A 4MXNA 1JTAA 2QY1A 4XQFA 2X6XA 1X0CA 4OJ5A 4OJLA 2VBKA 4XORA 1IDKA 4XONA 4XN3A 3EQNA 1XG2A 3FY3A 4OZZA 2EWEA 1O88A 1DBOA 1O8KA 4Z03A 3GQAA 4U49A 4XLFA 1AIRA 2NSPA 3LMWA 4C2LA 1PLUA 3KRGA 3ZSCA 4NK6A 4YZAA 2X6WA 4OJOA 1IDJA 1HG8A 4I84A 2NT9A 2ODLA 4XOPA 4W8SA 4XM3A 4XLHA 4XN0A 5C1CA 1CZFA 3B8YA 5AMVA 3GQ7A 4Z06A 1O8MA 2UVEA 2O0WA 3VSUA 4AVZA 1IA5A 1VBLA 4XKWA 1RMGA 4Z05A 1DBGA 5C1EA 1OFMA 1OGMX 3VSVA 1OFLA 4XLAA 3ZPPA 3UW0A 2INUA 1PXZA 2VJJA 3GQ8A 4URRA 3JURA 4HWVA 1O8LA 2X3HA 4XKVA 4XLCA 2NSTA 1BN8A 4YZQA 4W8RA 3GRHA 2NTPA 4PMHA 1IB4A 2PECA 2QXZA 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  2BSP A;  2UVF A;  2NTB A;  1O8F A;  1KCD A;  1RWR A;  1O8E A;  1KCC A;  3GQ9 A;  1QCX A;  2VJI A;  2NT6 A;  1GQ8 A;  2NZM A;  3B4N A;  4XOT A;  2Z8G A;  1O8D A;  1O8J A;  4U4B A;  3B90 A;  1PE9 A;  1KTW A;  1O8I A;  4NK8 A;  1K5C A;  2O17 A;  4XL9 A;  4EW9 A;  2INV A;  2QX3 A;  2VBM A;  4W8Q A;  4YEJ A;  1OGO X;  1WMR A;  1EE6 A;  3SUC A;  4XLE A;  4YZ0 A;  2O04 A;  2IQ7 A;  4OJP A;  1O8G A;  1QJV A;  4XR6 A;  2X6Y A;  1JRG A;  2VBE A;  1NHC A;  3T9G A;  4W8T A;  3EQO A;  3VMV A;  4OJ6 A;  4MR0 A;  1O8H A;  2NTQ A;  3VST A;  1OOC A;  4YEL A;  1RU4 A;  1BHE A;  4OZY A;  2X85 A;  2PYG A;  3VMW A;  2O0V A;  2PYH A;  3WWG A;  4YZX A;  4XMY A;  1H80 A;  4MXN A;  1JTA A;  2QY1 A;  4XQF A;  2X6X A;  1X0C A;  4OJ5 A;  4OJL A;  2VBK A;  4XOR A;  1IDK A;  4XON A;  4XN3 A;  3EQN A;  1XG2 A;  3FY3 A;  4OZZ A;  2EWE A;  1O88 A;  1DBO A;  1O8K A;  4Z03 A;  3GQA A;  4U49 A;  4XLF A;  1AIR A;  2NSP A;  3LMW A;  4C2L A;  1PLU A;  3KRG A;  3ZSC A;  4NK6 A;  4YZA A;  2X6W A;  4OJO A;  1IDJ A;  1HG8 A;  4I84 A;  2NT9 A;  2ODL A;  4XOP A;  4W8S A;  4XM3 A;  4XLH A;  4XN0 A;  5C1C A;  1CZF A;  3B8Y A;  5AMV A;  3GQ7 A;  4Z06 A;  1O8M A;  2UVE A;  2O0W A;  3VSU A;  4AVZ A;  1IA5 A;  1VBL A;  4XKW A;  1RMG A;  4Z05 A;  1DBG A;  5C1E A;  1OFM A;  1OGM X;  3VSV A;  1OFL A;  4XLA A;  3ZPP A;  3UW0 A;  2INU A;  1PXZ A;  2VJJ A;  3GQ8 A;  4URR A;  3JUR A;  4HWV A;  1O8L A;  2X3H A;  4XKV A;  4XLC A;  2NST A;  1BN8 A;  4YZQ A;  4W8R A;  3GRH A;  2NTP A;  4PMH A;  1IB4 A;  2PEC A;  2QXZ A;  2O1D A; 
#chains in the Genus database with same CATH topology
 4XNF A;  4YC5 A;  2XTW A;  2UVF A;  2NTB A;  1O8F A;  1KCD A;  1RWR A;  1O8E A;  3BH6 B;  1KCC A;  2YUH A;  1QCX A;  3GQ9 A;  2VJI A;  2NT6 A;  3BH7 B;  1GQ8 A;  2NZM A;  3B4N A;  2VFO A;  4XOT A;  2Z8G A;  1O8D A;  1O8J A;  4U4B A;  3B90 A;  2BX6 A;  3SZE A;  1PE9 A;  1CLW A;  2W7Z A;  4OM9 A;  2J8I A;  1KTW A;  1O8I A;  4NK8 A;  1K5C A;  1QA2 A;  2O17 A;  4XL9 A;  4EW9 A;  2INV A;  3NB2 A;  2QX3 A;  2VBM A;  4W8Q A;  4YEJ A;  1OGO X;  1WMR A;  1EE6 A;  3SUC A;  2VFQ A;  4XLE A;  1TYW A;  4JRA C;  2O04 A;  3LJY A;  2IQ7 A;  4OJP A;  4YZ0 A;  1O8G A;  1QJV A;  4XR6 A;  2X6Y A;  1JRG A;  2VBE A;  1NHC A;  2BM7 A;  4W8T A;  2V5I A;  3RIQ A;  3T9G A;  1HF2 A;  3EQO A;  3VMV A;  3N90 A;  1K8F A;  4MR0 A;  4OJ6 A;  1O8H A;  2NTQ A;  3VST A;  1QQ1 A;  5DNS A;  1OOC A;  1QA1 A;  4YEL A;  2QXZ A;  3PET A;  1RU4 A;  1BHE A;  4OZY A;  2XTY A;  2X85 A;  2PYG A;  3VMW A;  2O0V A;  4YCQ A;  2PYH A;  3WWG A;  4YZX A;  2O6W A;  4XMY A;  2VFM A;  3PSZ A;  1H80 A;  4MXN A;  1K4Z A;  1JTA A;  2QY1 A;  4XQF A;  2B0R A;  1EA0 A;  2X6X A;  1X0C A;  4OPW A;  4OJ5 A;  4OJL A;  2VBK A;  1TYU A;  1IDK A;  1QRB A;  4XOR A;  4XON A;  4XN3 A;  3SY2 A;  1DAB A;  3EQN A;  1LLW A;  3SQV A;  1TYX A;  1XG2 A;  3FY3 A;  4OZZ A;  2EWE A;  3DU1 X;  1O88 A;  1DBO A;  1O8K A;  2IOU G;  4Z03 A;  3GQA A;  1LM1 A;  4U49 A;  4XLF A;  4YDT A;  2QYU A;  1AIR A;  2NSP A;  3LMW A;  3N6Z A;  1PLU A;  3KRG A;  4C2L A;  2XT2 A;  1KQ5 A;  3ZSC A;  2BM6 A;  4NK6 A;  4YZA A;  2XT4 A;  2X6W A;  4OJO A;  3SYJ A;  1L1I A;  1IDJ A;  1HG8 A;  1OFE A;  4I84 A;  5JLV C;  2NT9 A;  1QRC A;  2F3L A;  1LLZ A;  2ODL A;  2VFN A;  4W8S A;  4XLH A;  4XM3 A;  4XN0 A;  4XOP A;  4YFO A;  1TSP A;  5C1C A;  1CZF A;  2XC1 A;  3B8Y A;  5JMC B;  5AMV A;  3GQ7 A;  4Z06 A;  1O8M A;  2BM4 A;  2UVE A;  3H09 A;  3NAW A;  2O0W A;  3VSU A;  4AVZ A;  1IA5 A;  1VBL A;  4XKW A;  2XTX A;  1RMG A;  2J8K A;  4Z05 A;  2G0Y A;  1DBG A;  3PSS A;  3TH0 A;  5C1E A;  1OFM A;  1OGM X;  3ML3 A;  3VSV A;  1QA3 A;  1TYV A;  1OFL A;  4YEI A;  4XLA A;  3ZPP A;  3UW0 A;  4V02 C;  2INU A;  1PXZ A;  2VJJ A;  3GQ8 A;  3P4G A;  4URR A;  3JUR A;  2VFP A;  4HWV A;  1O8L A;  2O1D A;  2QZA A;  2X3H A;  4XKV A;  4XLC A;  2NST A;  1BN8 A;  4YZQ A;  4KH3 A;  4W8R A;  3AK5 A;  1OFD A;  3GRH A;  3LYC A;  1EZG A;  2NTP A;  4PMH A;  1IB4 A;  3JX8 A;  2PEC A;  2BM5 A;  2BSP A;  1WXR A; 
#chains in the Genus database with same CATH homology
 4XNF A;  2BSP A;  2UVF A;  2NTB A;  1O8F A;  1KCD A;  1RWR A;  1O8E A;  1KCC A;  3GQ9 A;  1QCX A;  2VJI A;  2NT6 A;  1GQ8 A;  2NZM A;  3B4N A;  4XOT A;  2Z8G A;  1O8D A;  1O8J A;  4U4B A;  3B90 A;  1PE9 A;  1KTW A;  1O8I A;  4NK8 A;  1K5C A;  2O17 A;  4XL9 A;  4EW9 A;  2INV A;  2QX3 A;  2VBM A;  4W8Q A;  4YEJ A;  1OGO X;  1WMR A;  1EE6 A;  3SUC A;  4XLE A;  4YZ0 A;  2O04 A;  2IQ7 A;  4OJP A;  1O8G A;  1QJV A;  4XR6 A;  2X6Y A;  1JRG A;  2VBE A;  1NHC A;  3T9G A;  4W8T A;  3EQO A;  3VMV A;  4OJ6 A;  4MR0 A;  1O8H A;  2NTQ A;  3VST A;  1OOC A;  4YEL A;  1RU4 A;  1BHE A;  4OZY A;  2X85 A;  2PYG A;  3VMW A;  2O0V A;  2PYH A;  3WWG A;  4YZX A;  4XMY A;  1H80 A;  4MXN A;  1JTA A;  2QY1 A;  4XQF A;  2X6X A;  1X0C A;  4OJ5 A;  4OJL A;  2VBK A;  4XOR A;  1IDK A;  4XON A;  4XN3 A;  3EQN A;  1XG2 A;  3FY3 A;  4OZZ A;  2EWE A;  1O88 A;  1DBO A;  1O8K A;  4Z03 A;  3GQA A;  4U49 A;  4XLF A;  1AIR A;  2NSP A;  3LMW A;  4C2L A;  1PLU A;  3KRG A;  3ZSC A;  4NK6 A;  4YZA A;  2X6W A;  4OJO A;  1IDJ A;  1HG8 A;  4I84 A;  2NT9 A;  2ODL A;  4XOP A;  4W8S A;  4XM3 A;  4XLH A;  4XN0 A;  5C1C A;  1CZF A;  3B8Y A;  5AMV A;  3GQ7 A;  4Z06 A;  1O8M A;  2UVE A;  2O0W A;  3VSU A;  4AVZ A;  1IA5 A;  1VBL A;  4XKW A;  1RMG A;  4Z05 A;  1DBG A;  5C1E A;  1OFM A;  1OGM X;  3VSV A;  1OFL A;  4XLA A;  3ZPP A;  3UW0 A;  2INU A;  1PXZ A;  2VJJ A;  3GQ8 A;  4URR A;  3JUR A;  4HWV A;  1O8L A;  2X3H A;  4XKV A;  4XLC A;  2NST A;  1BN8 A;  4YZQ A;  4W8R A;  3GRH A;  2NTP A;  4PMH A;  1IB4 A;  2PEC A;  2QXZ A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...