4OZZA

Crystal structure of the periplasmic alginate epimerase algg t265n t268m double mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
424
structure length
423
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYNPNMAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N T268M double mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 169
structure length 423
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozzA00
4PMHA 3KRGA 4NK8A 2UVFA 4W8RA 1RU4A 2X3HA 4Z03A 3VMVA 4W8SA 1OFLA 4MXNA 4HWVA 1O8EA 4XKVA 1IB4A 4YZAA 1IA5A 3VSVA 2NZMA 4XOTA 3GQ8A 1OOCA 3B90A 2NT9A 4XONA 4XLEA 4XM3A 1BN8A 4YELA 2BSPA 3WWGA 3T9GA 1PLUA 3ZPPA 4Z06A 1O8MA 1EE6A 4XLCA 2VJJA 3FY3A 2X6XA 3VSUA 2VBEA 1O8FA 3EQNA 2UVEA 2PYHA 1PXZA 4XR6A 1KCDA 2NSPA 2QXZA 4XLHA 3EQOA 2INUA 1DBGA 4XN3A 2O0VA 1HG8A 4OJ6A 1O8LA 1O8IA 2VBMA 3JURA 1KCCA 2QY1A 2VJIA 1K5CA 1KTWA 1BHEA 5AMVA 1O8HA 1NHCA 2NT6A 2VBKA 1WMRA 2X6YA 1O8JA 4OJ5A 3VSTA 1GQ8A 4YZQA 3VMWA 5C1EA 1JTAA 4AVZA 3GQ9A 4XQFA 1IDJA 1DBOA 4OJOA 1O8GA 4EW9A 1O88A 3LMWA 1JRGA 4YZ0A 1O8DA 1IDKA 1X0CA 4U49A 2NTBA 4XLFA 1RWRA 5C1CA 4XKWA 4YZXA 2X85A 3ZSCA 1CZFA 2O0WA 2ODLA 4W8TA 1PE9A 4XN0A 2O1DA 3B4NA 4YEJA 4OJPA 2Z8GA 2O04A 3UW0A 1VBLA 1QCXA 4XLAA 4C2LA 3B8YA 4XORA 1H80A 4W8QA 1RMGA 4URRA 1QJVA 4I84A 4OJLA 2PECA 1OGOX 2IQ7A 3SUCA 3GQAA 4Z05A 2EWEA 1AIRA 4OZYA 1OGMX 4U4BA 1XG2A 2QX3A 2NTPA 4XNFA 2NSTA 2NTQA 2PYGA 4OZZA 4XOPA 4XL9A 2O17A 2INVA 4NK6A 1O8KA 1OFMA 4XMYA 2X6WA 4MR0A 3GRHA 3GQ7A
chains in the Genus database with same CATH superfamily
4PMHA 3KRGA 4YC5A 4NK8A 2UVFA 3SYJA 3LJYA 4W8RA 1RU4A 5DNSA 2X3HA 4Z03A 2B0RA 4W8SA 1OFLA 4MXNA 3VMVA 3SY2A 4HWVA 1O8EA 1QA3A 1TYWA 4XKVA 3PSZA 2BM5A 1LLWA 4YZAA 3VSVA 1IA5A 2XTWA 1IB4A 1L1IA 2NZMA 4XOTA 3GQ8A 1OOCA 1HF2A 3B90A 2NT9A 4XONA 4XLEA 4XM3A 1BN8A 2V5IA 1K8FA 4YELA 2BSPA 3WWGA 3T9GA 1PLUA 3ZPPA 4Z06A 1O8MA 1EE6A 4XLCA 2VJJA 1QA1A 1QQ1A 3FY3A 2BM7A 2X6XA 3NB2A 3BH6B 2VBEA 3VSUA 3SQVA 2XC1A 1O8FA 3EQNA 2UVEA 2O6WA 2PYHA 1PXZA 4KH3A 4XR6A 4YDTA 1KCDA 2NSPA 2QXZA 3DU1X 3EQOA 4XLHA 1K4ZA 2INUA 2W7ZA 3TH0A 1DBGA 1EZGA 4XN3A 2O0VA 1HG8A 4OJ6A 2XTXA 1O8LA 3P4GA 5JLVC 1O8IA 1TYVA 2VBMA 3JURA 1KCCA 2J8KA 2QY1A 2VJIA 3PSSA 1K5CA 3BH7B 1KTWA 1BHEA 1LM1A 2XT4A 5AMVA 1O8HA 1NHCA 3JX8A 1LLZA 1TYUA 2NT6A 1OFDA 2VBKA 1WMRA 2X6YA 3NAWA 2VFNA 1O8JA 2VFQA 4OJ5A 3VSTA 2BX6A 1GQ8A 2YUHA 4YZQA 3VMWA 5C1EA 1JTAA 2QZAA 4AVZA 3GQ9A 4YEIA 1CLWA 4XQFA 1IDJA 3SZEA 1DBOA 3N6ZA 4JRAC 4OJOA 4OM9A 1O8GA 4EW9A 1O88A 1WXRA 3LMWA 1JRGA 4YZ0A 2BM6A 4YFOA 1O8DA 1IDKA 1X0CA 4U49A 2IOUG 2NTBA 1KQ5A 1RWRA 4XLFA 3RIQA 1QRCA 1TSPA 5C1CA 4XKWA 4YZXA 2X85A 3ZSCA 1CZFA 2O0WA 2ODLA 4W8TA 1PE9A 4XN0A 3AK5A 2O1DA 3B4NA 3N90A 4YEJA 4OJPA 2Z8GA 2O04A 3ML3A 1VBLA 1TYXA 3UW0A 1QCXA 4XLAA 2G0YA 4V02C 4C2LA 3LYCA 3B8YA 4XORA 1QRBA 1H80A 1QA2A 4W8QA 1RMGA 4URRA 2XTYA 1QJVA 2QYUA 4I84A 3H09A 4OJLA 2VFPA 2PECA 1OGOX 2IQ7A 3SUCA 3GQAA 4Z05A 2EWEA 4OPWA 2F3LA 1AIRA 4OZYA 1DABA 1OGMX 4U4BA 1XG2A 1OFEA 2BM4A 2QX3A 5JMCB 2NTPA 4XNFA 2NSTA 2NTQA 2PYGA 4OZZA 4XOPA 4XL9A 1EA0A 4YCQA 2VFOA 2O17A 2INVA 4NK6A 2VFMA 1O8KA 1OFMA 4XMYA 2J8IA 2X6WA 3PETA 2XT2A 4MR0A 3GRHA 3GQ7A
chains in the Genus database with same CATH topology
4PMHA 3KRGA 4NK8A 2UVFA 4W8RA 1RU4A 2X3HA 4Z03A 3VMVA 4W8SA 1OFLA 4MXNA 4HWVA 1O8EA 4XKVA 1IB4A 4YZAA 1IA5A 3VSVA 2NZMA 4XOTA 3GQ8A 1OOCA 3B90A 2NT9A 4XONA 4XLEA 4XM3A 1BN8A 4YELA 2BSPA 3WWGA 3T9GA 1PLUA 3ZPPA 4Z06A 1O8MA 1EE6A 4XLCA 2VJJA 3FY3A 2X6XA 3VSUA 2VBEA 1O8FA 3EQNA 2UVEA 2PYHA 1PXZA 4XR6A 1KCDA 2NSPA 2QXZA 4XLHA 3EQOA 2INUA 1DBGA 4XN3A 2O0VA 1HG8A 4OJ6A 1O8LA 1O8IA 2VBMA 3JURA 1KCCA 2QY1A 2VJIA 1K5CA 1KTWA 1BHEA 5AMVA 1O8HA 1NHCA 2NT6A 2VBKA 1WMRA 2X6YA 1O8JA 4OJ5A 3VSTA 1GQ8A 4YZQA 3VMWA 5C1EA 1JTAA 4AVZA 3GQ9A 4XQFA 1IDJA 1DBOA 4OJOA 1O8GA 4EW9A 1O88A 3LMWA 1JRGA 4YZ0A 1O8DA 1IDKA 1X0CA 4U49A 2NTBA 4XLFA 1RWRA 5C1CA 4XKWA 4YZXA 2X85A 3ZSCA 1CZFA 2O0WA 2ODLA 4W8TA 1PE9A 4XN0A 2O1DA 3B4NA 4YEJA 4OJPA 2Z8GA 2O04A 3UW0A 1VBLA 1QCXA 4XLAA 4C2LA 3B8YA 4XORA 1H80A 4W8QA 1RMGA 4URRA 1QJVA 4I84A 4OJLA 2PECA 1OGOX 2IQ7A 3SUCA 3GQAA 4Z05A 2EWEA 1AIRA 4OZYA 1OGMX 4U4BA 1XG2A 2QX3A 2NTPA 4XNFA 2NSTA 2NTQA 2PYGA 4OZZA 4XOPA 4XL9A 2O17A 2INVA 4NK6A 1O8KA 1OFMA 4XMYA 2X6WA 4MR0A 3GRHA 3GQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMH A;  3KRG A;  4NK8 A;  2UVF A;  4W8R A;  1RU4 A;  2X3H A;  4Z03 A;  3VMV A;  4W8S A;  1OFL A;  4MXN A;  4HWV A;  1O8E A;  4XKV A;  1IB4 A;  4YZA A;  1IA5 A;  3VSV A;  2NZM A;  4XOT A;  3GQ8 A;  1OOC A;  3B90 A;  2NT9 A;  4XON A;  4XLE A;  4XM3 A;  1BN8 A;  4YEL A;  2BSP A;  3WWG A;  3T9G A;  1PLU A;  3ZPP A;  4Z06 A;  1O8M A;  1EE6 A;  4XLC A;  2VJJ A;  3FY3 A;  2X6X A;  3VSU A;  2VBE A;  1O8F A;  3EQN A;  2UVE A;  2PYH A;  1PXZ A;  4XR6 A;  1KCD A;  2NSP A;  2QXZ A;  4XLH A;  3EQO A;  2INU A;  1DBG A;  4XN3 A;  2O0V A;  1HG8 A;  4OJ6 A;  1O8L A;  1O8I A;  2VBM A;  3JUR A;  1KCC A;  2QY1 A;  2VJI A;  1K5C A;  1KTW A;  1BHE A;  5AMV A;  1O8H A;  1NHC A;  2NT6 A;  2VBK A;  1WMR A;  2X6Y A;  1O8J A;  4OJ5 A;  3VST A;  1GQ8 A;  4YZQ A;  3VMW A;  5C1E A;  1JTA A;  4AVZ A;  3GQ9 A;  4XQF A;  1IDJ A;  1DBO A;  4OJO A;  1O8G A;  4EW9 A;  1O88 A;  3LMW A;  1JRG A;  4YZ0 A;  1O8D A;  1IDK A;  1X0C A;  4U49 A;  2NTB A;  4XLF A;  1RWR A;  5C1C A;  4XKW A;  4YZX A;  2X85 A;  3ZSC A;  1CZF A;  2O0W A;  2ODL A;  4W8T A;  1PE9 A;  4XN0 A;  2O1D A;  3B4N A;  4YEJ A;  4OJP A;  2Z8G A;  2O04 A;  3UW0 A;  1VBL A;  1QCX A;  4XLA A;  4C2L A;  3B8Y A;  4XOR A;  1H80 A;  4W8Q A;  1RMG A;  4URR A;  1QJV A;  4I84 A;  4OJL A;  2PEC A;  1OGO X;  2IQ7 A;  3SUC A;  3GQA A;  4Z05 A;  2EWE A;  1AIR A;  4OZY A;  1OGM X;  4U4B A;  1XG2 A;  2QX3 A;  2NTP A;  4XNF A;  2NST A;  2NTQ A;  2PYG A;  4OZZ A;  4XOP A;  4XL9 A;  2O17 A;  2INV A;  4NK6 A;  1O8K A;  1OFM A;  4XMY A;  2X6W A;  4MR0 A;  3GRH A;  3GQ7 A; 
#chains in the Genus database with same CATH topology
 4PMH A;  3KRG A;  4YC5 A;  4NK8 A;  2UVF A;  3SYJ A;  3LJY A;  4W8R A;  1RU4 A;  5DNS A;  2X3H A;  4Z03 A;  2B0R A;  4W8S A;  1OFL A;  4MXN A;  3VMV A;  3SY2 A;  4HWV A;  1O8E A;  1QA3 A;  1TYW A;  4XKV A;  3PSZ A;  2BM5 A;  1LLW A;  4YZA A;  3VSV A;  1IA5 A;  2XTW A;  1IB4 A;  1L1I A;  2NZM A;  4XOT A;  3GQ8 A;  1OOC A;  1HF2 A;  3B90 A;  2NT9 A;  4XON A;  4XLE A;  4XM3 A;  1BN8 A;  2V5I A;  1K8F A;  4YEL A;  2BSP A;  3WWG A;  3T9G A;  1PLU A;  3ZPP A;  4Z06 A;  1O8M A;  1EE6 A;  4XLC A;  2VJJ A;  1QA1 A;  1QQ1 A;  3FY3 A;  2BM7 A;  2X6X A;  3NB2 A;  3BH6 B;  2VBE A;  3VSU A;  3SQV A;  2XC1 A;  1O8F A;  3EQN A;  2UVE A;  2O6W A;  2PYH A;  1PXZ A;  4KH3 A;  4XR6 A;  4YDT A;  1KCD A;  2NSP A;  2QXZ A;  3DU1 X;  3EQO A;  4XLH A;  1K4Z A;  2INU A;  2W7Z A;  3TH0 A;  1DBG A;  1EZG A;  4XN3 A;  2O0V A;  1HG8 A;  4OJ6 A;  2XTX A;  1O8L A;  3P4G A;  5JLV C;  1O8I A;  1TYV A;  2VBM A;  3JUR A;  1KCC A;  2J8K A;  2QY1 A;  2VJI A;  3PSS A;  1K5C A;  3BH7 B;  1KTW A;  1BHE A;  1LM1 A;  2XT4 A;  5AMV A;  1O8H A;  1NHC A;  3JX8 A;  1LLZ A;  1TYU A;  2NT6 A;  1OFD A;  2VBK A;  1WMR A;  2X6Y A;  3NAW A;  2VFN A;  1O8J A;  2VFQ A;  4OJ5 A;  3VST A;  2BX6 A;  1GQ8 A;  2YUH A;  4YZQ A;  3VMW A;  5C1E A;  1JTA A;  2QZA A;  4AVZ A;  3GQ9 A;  4YEI A;  1CLW A;  4XQF A;  1IDJ A;  3SZE A;  1DBO A;  3N6Z A;  4JRA C;  4OJO A;  4OM9 A;  1O8G A;  4EW9 A;  1O88 A;  1WXR A;  3LMW A;  1JRG A;  4YZ0 A;  2BM6 A;  4YFO A;  1O8D A;  1IDK A;  1X0C A;  4U49 A;  2IOU G;  2NTB A;  1KQ5 A;  1RWR A;  4XLF A;  3RIQ A;  1QRC A;  1TSP A;  5C1C A;  4XKW A;  4YZX A;  2X85 A;  3ZSC A;  1CZF A;  2O0W A;  2ODL A;  4W8T A;  1PE9 A;  4XN0 A;  3AK5 A;  2O1D A;  3B4N A;  3N90 A;  4YEJ A;  4OJP A;  2Z8G A;  2O04 A;  3ML3 A;  1VBL A;  1TYX A;  3UW0 A;  1QCX A;  4XLA A;  2G0Y A;  4V02 C;  4C2L A;  3LYC A;  3B8Y A;  4XOR A;  1QRB A;  1H80 A;  1QA2 A;  4W8Q A;  1RMG A;  4URR A;  2XTY A;  1QJV A;  2QYU A;  4I84 A;  3H09 A;  4OJL A;  2VFP A;  2PEC A;  1OGO X;  2IQ7 A;  3SUC A;  3GQA A;  4Z05 A;  2EWE A;  4OPW A;  2F3L A;  1AIR A;  4OZY A;  1DAB A;  1OGM X;  4U4B A;  1XG2 A;  1OFE A;  2BM4 A;  2QX3 A;  5JMC B;  2NTP A;  4XNF A;  2NST A;  2NTQ A;  2PYG A;  4OZZ A;  4XOP A;  4XL9 A;  1EA0 A;  4YCQ A;  2VFO A;  2O17 A;  2INV A;  4NK6 A;  2VFM A;  1O8K A;  1OFM A;  4XMY A;  2J8I A;  2X6W A;  3PET A;  2XT2 A;  4MR0 A;  3GRH A;  3GQ7 A; 
#chains in the Genus database with same CATH homology
 4PMH A;  3KRG A;  4NK8 A;  2UVF A;  4W8R A;  1RU4 A;  2X3H A;  4Z03 A;  3VMV A;  4W8S A;  1OFL A;  4MXN A;  4HWV A;  1O8E A;  4XKV A;  1IB4 A;  4YZA A;  1IA5 A;  3VSV A;  2NZM A;  4XOT A;  3GQ8 A;  1OOC A;  3B90 A;  2NT9 A;  4XON A;  4XLE A;  4XM3 A;  1BN8 A;  4YEL A;  2BSP A;  3WWG A;  3T9G A;  1PLU A;  3ZPP A;  4Z06 A;  1O8M A;  1EE6 A;  4XLC A;  2VJJ A;  3FY3 A;  2X6X A;  3VSU A;  2VBE A;  1O8F A;  3EQN A;  2UVE A;  2PYH A;  1PXZ A;  4XR6 A;  1KCD A;  2NSP A;  2QXZ A;  4XLH A;  3EQO A;  2INU A;  1DBG A;  4XN3 A;  2O0V A;  1HG8 A;  4OJ6 A;  1O8L A;  1O8I A;  2VBM A;  3JUR A;  1KCC A;  2QY1 A;  2VJI A;  1K5C A;  1KTW A;  1BHE A;  5AMV A;  1O8H A;  1NHC A;  2NT6 A;  2VBK A;  1WMR A;  2X6Y A;  1O8J A;  4OJ5 A;  3VST A;  1GQ8 A;  4YZQ A;  3VMW A;  5C1E A;  1JTA A;  4AVZ A;  3GQ9 A;  4XQF A;  1IDJ A;  1DBO A;  4OJO A;  1O8G A;  4EW9 A;  1O88 A;  3LMW A;  1JRG A;  4YZ0 A;  1O8D A;  1IDK A;  1X0C A;  4U49 A;  2NTB A;  4XLF A;  1RWR A;  5C1C A;  4XKW A;  4YZX A;  2X85 A;  3ZSC A;  1CZF A;  2O0W A;  2ODL A;  4W8T A;  1PE9 A;  4XN0 A;  2O1D A;  3B4N A;  4YEJ A;  4OJP A;  2Z8G A;  2O04 A;  3UW0 A;  1VBL A;  1QCX A;  4XLA A;  4C2L A;  3B8Y A;  4XOR A;  1H80 A;  4W8Q A;  1RMG A;  4URR A;  1QJV A;  4I84 A;  4OJL A;  2PEC A;  1OGO X;  2IQ7 A;  3SUC A;  3GQA A;  4Z05 A;  2EWE A;  1AIR A;  4OZY A;  1OGM X;  4U4B A;  1XG2 A;  2QX3 A;  2NTP A;  4XNF A;  2NST A;  2NTQ A;  2PYG A;  4OZZ A;  4XOP A;  4XL9 A;  2O17 A;  2INV A;  4NK6 A;  1O8K A;  1OFM A;  4XMY A;  2X6W A;  4MR0 A;  3GRH A;  3GQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...