4OZZA

Crystal structure of the periplasmic alginate epimerase algg t265n t268m double mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
424
structure length
423
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYNPNMAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N T268M double mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 169
structure length 423
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozzA00
2NSPA 2O0VA 4I84A 2NT9A 2X6XA 3GQ9A 4XKWA 4XL9A 4U49A 4XN3A 1O8LA 4XM3A 2INVA 4XN0A 2VBMA 4XLHA 3JURA 1O8GA 2O1DA 1AIRA 2X85A 1RU4A 4XOTA 1KCDA 4OJ6A 2O17A 4XKVA 3VSUA 3FY3A 1VBLA 1JRGA 3VSVA 4MR0A 1O8DA 1X0CA 2IQ7A 1QJVA 2NZMA 4U4BA 1PE9A 3EQOA 3ZPPA 1KCCA 1JTAA 2X6WA 2EWEA 2X6YA 4XLCA 4XMYA 1PXZA 3GQ7A 4XQFA 1DBOA 2ODLA 1OFMA 1EE6A 3T9GA 2O0WA 4AVZA 4URRA 2O04A 4YEJA 5C1CA 3GQ8A 2Z8GA 4YELA 1RWRA 4YZAA 3GRHA 1K5CA 4OZZA 2VBEA 4XLEA 2BSPA 3KRGA 2PECA 2VBKA 4XLAA 4NK8A 4XORA 4OJLA 2QX3A 2VJJA 1O8MA 4YZ0A 1PLUA 4XNFA 1IA5A 4XONA 3ZSCA 3B4NA 4XLFA 4YZQA 1O8FA 4OZYA 4W8TA 4W8RA 2UVFA 1O8EA 2VJIA 4Z03A 1BN8A 1HG8A 1NHCA 4OJ5A 1OGOX 4PMHA 3B8YA 1IDJA 4OJOA 3GQAA 3UW0A 1RMGA 2QY1A 3VMVA 2QXZA 2NT6A 1OOCA 1OGMX 5AMVA 3LMWA 4MXNA 1CZFA 1O8IA 1BHEA 2NSTA 2UVEA 4Z05A 1H80A 4YZXA 3EQNA 5C1EA 4EW9A 2PYHA 4XR6A 2X3HA 4XOPA 4C2LA 2INUA 1WMRA 3VMWA 1KTWA 4HWVA 3WWGA 1OFLA 4W8QA 3SUCA 1IB4A 1GQ8A 1O8JA 1XG2A 2PYGA 1DBGA 1QCXA 1IDKA 4W8SA 4NK6A 3B90A 1O88A 2NTPA 1O8KA 4OJPA 4Z06A 3VSTA 2NTBA 1O8HA 2NTQA
chains in the Genus database with same CATH superfamily
2NSPA 3PSSA 1TSPA 2O0VA 4I84A 2NT9A 2X6XA 3GQ9A 4XKWA 4XL9A 4U49A 4XN3A 1O8LA 4KH3A 2J8KA 2INVA 2V5IA 3BH7B 2BX6A 4XM3A 2VBMA 4XLHA 4XN0A 5JLVC 3JURA 1O8GA 2O1DA 2XTWA 5DNSA 2QYUA 3BH6B 1AIRA 2X85A 1RU4A 4XOTA 1KCDA 4OJ6A 2O17A 1TYXA 4XKVA 2YUHA 4YC5A 3VSUA 3N6ZA 3FY3A 1VBLA 1JRGA 3VSVA 4MR0A 1O8DA 1X0CA 2IQ7A 1QJVA 3SQVA 2NZMA 2XC1A 2F3LA 4U4BA 1WXRA 1PE9A 2O6WA 2XTXA 1K4ZA 3EQOA 3ZPPA 1QRCA 3NB2A 1KCCA 1JTAA 3AK5A 1LM1A 2X6WA 2EWEA 2X6YA 2BM4A 4XLCA 1CLWA 2B0RA 1PXZA 3GQ7A 4XMYA 4YFOA 3SZEA 4OM9A 4XQFA 3N90A 3H09A 3SY2A 1DBOA 2ODLA 2XT4A 3JX8A 1OFMA 1QA3A 1EE6A 1DABA 2W7ZA 3T9GA 2O0WA 1LLWA 4AVZA 4URRA 3LJYA 2O04A 4YEJA 5C1CA 3GQ8A 2Z8GA 4YELA 1RWRA 4YZAA 3SYJA 3GRHA 1K5CA 2XTYA 2BM7A 2BM5A 1QQ1A 1TYUA 4OZZA 4YEIA 2VBEA 4XLEA 4YCQA 2BSPA 3DU1X 3KRGA 2PECA 1HF2A 2VBKA 4XLAA 4NK8A 4XORA 4OJLA 2QX3A 2VJJA 1O8MA 4YZ0A 1TYWA 1PLUA 4XNFA 1IA5A 4XONA 3ZSCA 1K8FA 3B4NA 4XLFA 4YZQA 1O8FA 4OZYA 4W8TA 4V02C 3NAWA 3PETA 4W8RA 1LLZA 1O8EA 2UVFA 2VJIA 4Z03A 1BN8A 1HG8A 1QRBA 1OFEA 1KQ5A 1NHCA 2J8IA 4OJ5A 1OGOX 4PMHA 3B8YA 1IDJA 4OJOA 3GQAA 3UW0A 1RMGA 2QY1A 3ML3A 2QXZA 3VMVA 2NT6A 1OOCA 1OGMX 5AMVA 2VFPA 3LMWA 4MXNA 1CZFA 3TH0A 2VFMA 1O8IA 2VFNA 1BHEA 2G0YA 2NSTA 2UVEA 2IOUG 1EA0A 3LYCA 2BM6A 4JRAC 4Z05A 1H80A 1OFDA 4YZXA 5JMCB 3EQNA 5C1EA 4EW9A 2PYHA 4XR6A 2X3HA 4XOPA 4C2LA 2INUA 1WMRA 3VMWA 2VFOA 1KTWA 4OPWA 4HWVA 3WWGA 1OFLA 1QA1A 4W8QA 3SUCA 4YDTA 1EZGA 3P4GA 3RIQA 1GQ8A 1IB4A 1O8JA 1XG2A 2PYGA 1DBGA 1QCXA 1IDKA 1TYVA 2XT2A 4W8SA 4NK6A 2QZAA 3B90A 1QA2A 1O88A 2NTPA 1O8KA 2VFQA 3PSZA 1L1IA 4OJPA 4Z06A 3VSTA 2NTBA 1O8HA 2NTQA
chains in the Genus database with same CATH topology
2NSPA 2O0VA 4I84A 2NT9A 2X6XA 3GQ9A 4XKWA 4XL9A 4U49A 4XN3A 1O8LA 4XM3A 2INVA 4XN0A 2VBMA 4XLHA 3JURA 1O8GA 2O1DA 1AIRA 2X85A 1RU4A 4XOTA 1KCDA 4OJ6A 2O17A 4XKVA 3VSUA 3FY3A 1VBLA 1JRGA 3VSVA 4MR0A 1O8DA 1X0CA 2IQ7A 1QJVA 2NZMA 4U4BA 1PE9A 3EQOA 3ZPPA 1KCCA 1JTAA 2X6WA 2EWEA 2X6YA 4XLCA 4XMYA 1PXZA 3GQ7A 4XQFA 1DBOA 2ODLA 1OFMA 1EE6A 3T9GA 2O0WA 4AVZA 4URRA 2O04A 4YEJA 5C1CA 3GQ8A 2Z8GA 4YELA 1RWRA 4YZAA 3GRHA 1K5CA 4OZZA 2VBEA 4XLEA 2BSPA 3KRGA 2PECA 2VBKA 4XLAA 4NK8A 4XORA 4OJLA 2QX3A 2VJJA 1O8MA 4YZ0A 1PLUA 4XNFA 1IA5A 4XONA 3ZSCA 3B4NA 4XLFA 4YZQA 1O8FA 4OZYA 4W8TA 4W8RA 2UVFA 1O8EA 2VJIA 4Z03A 1BN8A 1HG8A 1NHCA 4OJ5A 1OGOX 4PMHA 3B8YA 1IDJA 4OJOA 3GQAA 3UW0A 1RMGA 2QY1A 3VMVA 2QXZA 2NT6A 1OOCA 1OGMX 5AMVA 3LMWA 4MXNA 1CZFA 1O8IA 1BHEA 2NSTA 2UVEA 4Z05A 1H80A 4YZXA 3EQNA 5C1EA 4EW9A 2PYHA 4XR6A 2X3HA 4XOPA 4C2LA 2INUA 1WMRA 3VMWA 1KTWA 4HWVA 3WWGA 1OFLA 4W8QA 3SUCA 1IB4A 1GQ8A 1O8JA 1XG2A 2PYGA 1DBGA 1QCXA 1IDKA 4W8SA 4NK6A 3B90A 1O88A 2NTPA 1O8KA 4OJPA 4Z06A 3VSTA 2NTBA 1O8HA 2NTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSP A;  2O0V A;  4I84 A;  2NT9 A;  2X6X A;  3GQ9 A;  4XKW A;  4XL9 A;  4U49 A;  4XN3 A;  1O8L A;  4XM3 A;  2INV A;  4XN0 A;  2VBM A;  4XLH A;  3JUR A;  1O8G A;  2O1D A;  1AIR A;  2X85 A;  1RU4 A;  4XOT A;  1KCD A;  4OJ6 A;  2O17 A;  4XKV A;  3VSU A;  3FY3 A;  1VBL A;  1JRG A;  3VSV A;  4MR0 A;  1O8D A;  1X0C A;  2IQ7 A;  1QJV A;  2NZM A;  4U4B A;  1PE9 A;  3EQO A;  3ZPP A;  1KCC A;  1JTA A;  2X6W A;  2EWE A;  2X6Y A;  4XLC A;  4XMY A;  1PXZ A;  3GQ7 A;  4XQF A;  1DBO A;  2ODL A;  1OFM A;  1EE6 A;  3T9G A;  2O0W A;  4AVZ A;  4URR A;  2O04 A;  4YEJ A;  5C1C A;  3GQ8 A;  2Z8G A;  4YEL A;  1RWR A;  4YZA A;  3GRH A;  1K5C A;  4OZZ A;  2VBE A;  4XLE A;  2BSP A;  3KRG A;  2PEC A;  2VBK A;  4XLA A;  4NK8 A;  4XOR A;  4OJL A;  2QX3 A;  2VJJ A;  1O8M A;  4YZ0 A;  1PLU A;  4XNF A;  1IA5 A;  4XON A;  3ZSC A;  3B4N A;  4XLF A;  4YZQ A;  1O8F A;  4OZY A;  4W8T A;  4W8R A;  2UVF A;  1O8E A;  2VJI A;  4Z03 A;  1BN8 A;  1HG8 A;  1NHC A;  4OJ5 A;  1OGO X;  4PMH A;  3B8Y A;  1IDJ A;  4OJO A;  3GQA A;  3UW0 A;  1RMG A;  2QY1 A;  3VMV A;  2QXZ A;  2NT6 A;  1OOC A;  1OGM X;  5AMV A;  3LMW A;  4MXN A;  1CZF A;  1O8I A;  1BHE A;  2NST A;  2UVE A;  4Z05 A;  1H80 A;  4YZX A;  3EQN A;  5C1E A;  4EW9 A;  2PYH A;  4XR6 A;  2X3H A;  4XOP A;  4C2L A;  2INU A;  1WMR A;  3VMW A;  1KTW A;  4HWV A;  3WWG A;  1OFL A;  4W8Q A;  3SUC A;  1IB4 A;  1GQ8 A;  1O8J A;  1XG2 A;  2PYG A;  1DBG A;  1QCX A;  1IDK A;  4W8S A;  4NK6 A;  3B90 A;  1O88 A;  2NTP A;  1O8K A;  4OJP A;  4Z06 A;  3VST A;  2NTB A;  1O8H A;  2NTQ A; 
#chains in the Genus database with same CATH topology
 2NSP A;  3PSS A;  1TSP A;  2O0V A;  4I84 A;  2NT9 A;  2X6X A;  3GQ9 A;  4XKW A;  4XL9 A;  4U49 A;  4XN3 A;  1O8L A;  4KH3 A;  2J8K A;  2INV A;  2V5I A;  3BH7 B;  2BX6 A;  4XM3 A;  2VBM A;  4XLH A;  4XN0 A;  5JLV C;  3JUR A;  1O8G A;  2O1D A;  2XTW A;  5DNS A;  2QYU A;  3BH6 B;  1AIR A;  2X85 A;  1RU4 A;  4XOT A;  1KCD A;  4OJ6 A;  2O17 A;  1TYX A;  4XKV A;  2YUH A;  4YC5 A;  3VSU A;  3N6Z A;  3FY3 A;  1VBL A;  1JRG A;  3VSV A;  4MR0 A;  1O8D A;  1X0C A;  2IQ7 A;  1QJV A;  3SQV A;  2NZM A;  2XC1 A;  2F3L A;  4U4B A;  1WXR A;  1PE9 A;  2O6W A;  2XTX A;  1K4Z A;  3EQO A;  3ZPP A;  1QRC A;  3NB2 A;  1KCC A;  1JTA A;  3AK5 A;  1LM1 A;  2X6W A;  2EWE A;  2X6Y A;  2BM4 A;  4XLC A;  1CLW A;  2B0R A;  1PXZ A;  3GQ7 A;  4XMY A;  4YFO A;  3SZE A;  4OM9 A;  4XQF A;  3N90 A;  3H09 A;  3SY2 A;  1DBO A;  2ODL A;  2XT4 A;  3JX8 A;  1OFM A;  1QA3 A;  1EE6 A;  1DAB A;  2W7Z A;  3T9G A;  2O0W A;  1LLW A;  4AVZ A;  4URR A;  3LJY A;  2O04 A;  4YEJ A;  5C1C A;  3GQ8 A;  2Z8G A;  4YEL A;  1RWR A;  4YZA A;  3SYJ A;  3GRH A;  1K5C A;  2XTY A;  2BM7 A;  2BM5 A;  1QQ1 A;  1TYU A;  4OZZ A;  4YEI A;  2VBE A;  4XLE A;  4YCQ A;  2BSP A;  3DU1 X;  3KRG A;  2PEC A;  1HF2 A;  2VBK A;  4XLA A;  4NK8 A;  4XOR A;  4OJL A;  2QX3 A;  2VJJ A;  1O8M A;  4YZ0 A;  1TYW A;  1PLU A;  4XNF A;  1IA5 A;  4XON A;  3ZSC A;  1K8F A;  3B4N A;  4XLF A;  4YZQ A;  1O8F A;  4OZY A;  4W8T A;  4V02 C;  3NAW A;  3PET A;  4W8R A;  1LLZ A;  1O8E A;  2UVF A;  2VJI A;  4Z03 A;  1BN8 A;  1HG8 A;  1QRB A;  1OFE A;  1KQ5 A;  1NHC A;  2J8I A;  4OJ5 A;  1OGO X;  4PMH A;  3B8Y A;  1IDJ A;  4OJO A;  3GQA A;  3UW0 A;  1RMG A;  2QY1 A;  3ML3 A;  2QXZ A;  3VMV A;  2NT6 A;  1OOC A;  1OGM X;  5AMV A;  2VFP A;  3LMW A;  4MXN A;  1CZF A;  3TH0 A;  2VFM A;  1O8I A;  2VFN A;  1BHE A;  2G0Y A;  2NST A;  2UVE A;  2IOU G;  1EA0 A;  3LYC A;  2BM6 A;  4JRA C;  4Z05 A;  1H80 A;  1OFD A;  4YZX A;  5JMC B;  3EQN A;  5C1E A;  4EW9 A;  2PYH A;  4XR6 A;  2X3H A;  4XOP A;  4C2L A;  2INU A;  1WMR A;  3VMW A;  2VFO A;  1KTW A;  4OPW A;  4HWV A;  3WWG A;  1OFL A;  1QA1 A;  4W8Q A;  3SUC A;  4YDT A;  1EZG A;  3P4G A;  3RIQ A;  1GQ8 A;  1IB4 A;  1O8J A;  1XG2 A;  2PYG A;  1DBG A;  1QCX A;  1IDK A;  1TYV A;  2XT2 A;  4W8S A;  4NK6 A;  2QZA A;  3B90 A;  1QA2 A;  1O88 A;  2NTP A;  1O8K A;  2VFQ A;  3PSZ A;  1L1I A;  4OJP A;  4Z06 A;  3VST A;  2NTB A;  1O8H A;  2NTQ A; 
#chains in the Genus database with same CATH homology
 2NSP A;  2O0V A;  4I84 A;  2NT9 A;  2X6X A;  3GQ9 A;  4XKW A;  4XL9 A;  4U49 A;  4XN3 A;  1O8L A;  4XM3 A;  2INV A;  4XN0 A;  2VBM A;  4XLH A;  3JUR A;  1O8G A;  2O1D A;  1AIR A;  2X85 A;  1RU4 A;  4XOT A;  1KCD A;  4OJ6 A;  2O17 A;  4XKV A;  3VSU A;  3FY3 A;  1VBL A;  1JRG A;  3VSV A;  4MR0 A;  1O8D A;  1X0C A;  2IQ7 A;  1QJV A;  2NZM A;  4U4B A;  1PE9 A;  3EQO A;  3ZPP A;  1KCC A;  1JTA A;  2X6W A;  2EWE A;  2X6Y A;  4XLC A;  4XMY A;  1PXZ A;  3GQ7 A;  4XQF A;  1DBO A;  2ODL A;  1OFM A;  1EE6 A;  3T9G A;  2O0W A;  4AVZ A;  4URR A;  2O04 A;  4YEJ A;  5C1C A;  3GQ8 A;  2Z8G A;  4YEL A;  1RWR A;  4YZA A;  3GRH A;  1K5C A;  4OZZ A;  2VBE A;  4XLE A;  2BSP A;  3KRG A;  2PEC A;  2VBK A;  4XLA A;  4NK8 A;  4XOR A;  4OJL A;  2QX3 A;  2VJJ A;  1O8M A;  4YZ0 A;  1PLU A;  4XNF A;  1IA5 A;  4XON A;  3ZSC A;  3B4N A;  4XLF A;  4YZQ A;  1O8F A;  4OZY A;  4W8T A;  4W8R A;  2UVF A;  1O8E A;  2VJI A;  4Z03 A;  1BN8 A;  1HG8 A;  1NHC A;  4OJ5 A;  1OGO X;  4PMH A;  3B8Y A;  1IDJ A;  4OJO A;  3GQA A;  3UW0 A;  1RMG A;  2QY1 A;  3VMV A;  2QXZ A;  2NT6 A;  1OOC A;  1OGM X;  5AMV A;  3LMW A;  4MXN A;  1CZF A;  1O8I A;  1BHE A;  2NST A;  2UVE A;  4Z05 A;  1H80 A;  4YZX A;  3EQN A;  5C1E A;  4EW9 A;  2PYH A;  4XR6 A;  2X3H A;  4XOP A;  4C2L A;  2INU A;  1WMR A;  3VMW A;  1KTW A;  4HWV A;  3WWG A;  1OFL A;  4W8Q A;  3SUC A;  1IB4 A;  1GQ8 A;  1O8J A;  1XG2 A;  2PYG A;  1DBG A;  1QCX A;  1IDK A;  4W8S A;  4NK6 A;  3B90 A;  1O88 A;  2NTP A;  1O8K A;  4OJP A;  4Z06 A;  3VST A;  2NTB A;  1O8H A;  2NTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...