4OZZA

Crystal structure of the periplasmic alginate epimerase algg t265n t268m double mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
424
structure length
423
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYNPNMAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N T268M double mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 169
structure length 423
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozzA00
1O8MA 4XNFA 4NK8A 4I84A 1QJVA 2PYHA 2VJJA 2Z8GA 4XLFA 2QXZA 1NHCA 1O8DA 1H80A 1O8FA 2VBMA 3B90A 2X85A 4XONA 2NTBA 4YZXA 2PECA 4XORA 2QY1A 4XKWA 4AVZA 1O8GA 1OGOX 4OJLA 3LMWA 4W8QA 2INVA 4OZYA 4YEJA 3ZSCA 1GQ8A 2X3HA 1CZFA 3VMVA 2UVEA 1RWRA 2O04A 3VSVA 1IDJA 1JTAA 1DBGA 1JRGA 2VBKA 2O0VA 1O8LA 4XQFA 3GQ9A 3VMWA 1QCXA 4MXNA 2NT9A 2QX3A 4XN3A 2ODLA 2BSPA 1IA5A 1O8EA 4OJ6A 1O8JA 3B8YA 4W8TA 2NT6A 1OGMX 2O17A 4Z05A 3VSUA 3WWGA 4XR6A 2NTPA 1O88A 1OFLA 4MR0A 1HG8A 1BN8A 3GRHA 4U49A 3UW0A 4OJPA 4U4BA 4OZZA 3SUCA 2X6XA 1KTWA 2O0WA 1IDKA 4PMHA 3GQ7A 4XOTA 4URRA 4EW9A 1O8KA 1K5CA 1WMRA 2VBEA 4NK6A 3T9GA 3EQNA 4YZQA 2NTQA 2EWEA 1KCCA 3FY3A 3EQOA 5C1EA 1BHEA 2NSPA 4C2LA 4YZAA 4YZ0A 4W8RA 4XLEA 2X6YA 3JURA 4XLHA 4XM3A 2NZMA 5C1CA 2X6WA 2PYGA 4HWVA 2IQ7A 4XLCA 4Z03A 1DBOA 1O8IA 1IB4A 4OJ5A 3KRGA 4XKVA 2O1DA 2INUA 4XLAA 1PXZA 4XL9A 1EE6A 3ZPPA 1X0CA 1O8HA 1PLUA 1RU4A 3VSTA 2NSTA 4XN0A 2VJIA 2UVFA 1RMGA 1VBLA 1XG2A 4YELA 1PE9A 4XMYA 1OFMA 4Z06A 4W8SA 1OOCA 3B4NA 4XOPA 4OJOA 1AIRA 5AMVA 3GQAA 3GQ8A 1KCDA
chains in the Genus database with same CATH superfamily
1O8MA 4XNFA 4NK8A 4I84A 1QJVA 2PYHA 2VJJA 3RIQA 2Z8GA 4XLFA 3AK5A 2QXZA 1NHCA 1O8DA 1H80A 1O8FA 2VBMA 3B90A 2X85A 3NB2A 4XONA 2NTBA 3N90A 4YZXA 2PECA 4XORA 1OFDA 2QY1A 4XKWA 1CLWA 1TYUA 4AVZA 2O6WA 1O8GA 1OGOX 2XTXA 4OJLA 3SQVA 3LMWA 3SYJA 4W8QA 2INVA 2B0RA 4OZYA 4YEJA 3ZSCA 1DABA 1GQ8A 2X3HA 1CZFA 3VMVA 2UVEA 1RWRA 2O04A 3VSVA 1HF2A 2VFNA 2XC1A 1IDJA 3PSSA 2BM6A 3JX8A 5DNSA 1JTAA 1DBGA 1JRGA 2VBKA 2O0VA 4OM9A 1O8LA 4XQFA 3GQ9A 3VMWA 1EZGA 1QCXA 4MXNA 2NT9A 2QX3A 1LM1A 2ODLA 3H09A 4XN3A 2BSPA 1IA5A 1O8EA 1TSPA 2J8KA 1O8JA 3B8YA 4OJ6A 4W8TA 2NT6A 1OGMX 2BM5A 2O17A 4Z05A 3VSUA 2F3LA 3WWGA 2J8IA 2NTPA 4XR6A 1O88A 1OFLA 4MR0A 2BX6A 1HG8A 1WXRA 1QA1A 1BN8A 3GRHA 4U49A 3SY2A 4JRAC 4OJPA 3UW0A 4U4BA 2BM7A 2QZAA 4OZZA 3SUCA 2X6XA 1QRBA 3LJYA 1KTWA 2O0WA 1IDKA 2W7ZA 1K8FA 4PMHA 3GQ7A 4XOTA 3LYCA 2XT4A 2VFQA 2XTWA 4URRA 2VFMA 3SZEA 4EW9A 1O8KA 1K5CA 1WMRA 3ML3A 1KQ5A 2VBEA 1TYVA 3PSZA 3NAWA 4NK6A 3T9GA 3TH0A 1EA0A 1K4ZA 2XT2A 3EQNA 4YZQA 4YFOA 4KH3A 2VFPA 1OFEA 2NTQA 2EWEA 4YCQA 3FY3A 1KCCA 3EQOA 5C1EA 1TYXA 1BHEA 2NSPA 4C2LA 4YZAA 4YZ0A 4W8RA 4XLEA 2X6YA 3JURA 4XLHA 4XM3A 2NZMA 5C1CA 2X6WA 2PYGA 3BH7B 4YC5A 4HWVA 2IQ7A 3N6ZA 2G0YA 4XLCA 4Z03A 1DBOA 1O8IA 3P4GA 1IB4A 4OJ5A 1TYWA 3KRGA 1LLZA 4XKVA 2IOUG 2O1DA 2INUA 4XLAA 1PXZA 2V5IA 5JMCB 4XL9A 2QYUA 1EE6A 3ZPPA 1LLWA 2YUHA 1L1IA 1X0CA 4YDTA 1QRCA 1QQ1A 5JLVC 1O8HA 1PLUA 1RU4A 2VFOA 3VSTA 4YEIA 2XTYA 4V02C 2NSTA 3BH6B 3DU1X 4XN0A 2VJIA 2UVFA 1RMGA 1VBLA 1QA2A 1XG2A 4YELA 1QA3A 1PE9A 4XMYA 1OFMA 4Z06A 3PETA 4W8SA 1OOCA 3B4NA 4OPWA 4OJOA 4XOPA 1AIRA 5AMVA 2BM4A 3GQAA 3GQ8A 1KCDA
chains in the Genus database with same CATH topology
1O8MA 4XNFA 4NK8A 4I84A 1QJVA 2PYHA 2VJJA 2Z8GA 4XLFA 2QXZA 1NHCA 1O8DA 1H80A 1O8FA 2VBMA 3B90A 2X85A 4XONA 2NTBA 4YZXA 2PECA 4XORA 2QY1A 4XKWA 4AVZA 1O8GA 1OGOX 4OJLA 3LMWA 4W8QA 2INVA 4OZYA 4YEJA 3ZSCA 1GQ8A 2X3HA 1CZFA 3VMVA 2UVEA 1RWRA 2O04A 3VSVA 1IDJA 1JTAA 1DBGA 1JRGA 2VBKA 2O0VA 1O8LA 4XQFA 3GQ9A 3VMWA 1QCXA 4MXNA 2NT9A 2QX3A 4XN3A 2ODLA 2BSPA 1IA5A 1O8EA 4OJ6A 1O8JA 3B8YA 4W8TA 2NT6A 1OGMX 2O17A 4Z05A 3VSUA 3WWGA 4XR6A 2NTPA 1O88A 1OFLA 4MR0A 1HG8A 1BN8A 3GRHA 4U49A 3UW0A 4OJPA 4U4BA 4OZZA 3SUCA 2X6XA 1KTWA 2O0WA 1IDKA 4PMHA 3GQ7A 4XOTA 4URRA 4EW9A 1O8KA 1K5CA 1WMRA 2VBEA 4NK6A 3T9GA 3EQNA 4YZQA 2NTQA 2EWEA 1KCCA 3FY3A 3EQOA 5C1EA 1BHEA 2NSPA 4C2LA 4YZAA 4YZ0A 4W8RA 4XLEA 2X6YA 3JURA 4XLHA 4XM3A 2NZMA 5C1CA 2X6WA 2PYGA 4HWVA 2IQ7A 4XLCA 4Z03A 1DBOA 1O8IA 1IB4A 4OJ5A 3KRGA 4XKVA 2O1DA 2INUA 4XLAA 1PXZA 4XL9A 1EE6A 3ZPPA 1X0CA 1O8HA 1PLUA 1RU4A 3VSTA 2NSTA 4XN0A 2VJIA 2UVFA 1RMGA 1VBLA 1XG2A 4YELA 1PE9A 4XMYA 1OFMA 4Z06A 4W8SA 1OOCA 3B4NA 4XOPA 4OJOA 1AIRA 5AMVA 3GQAA 3GQ8A 1KCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8M A;  4XNF A;  4NK8 A;  4I84 A;  1QJV A;  2PYH A;  2VJJ A;  2Z8G A;  4XLF A;  2QXZ A;  1NHC A;  1O8D A;  1H80 A;  1O8F A;  2VBM A;  3B90 A;  2X85 A;  4XON A;  2NTB A;  4YZX A;  2PEC A;  4XOR A;  2QY1 A;  4XKW A;  4AVZ A;  1O8G A;  1OGO X;  4OJL A;  3LMW A;  4W8Q A;  2INV A;  4OZY A;  4YEJ A;  3ZSC A;  1GQ8 A;  2X3H A;  1CZF A;  3VMV A;  2UVE A;  1RWR A;  2O04 A;  3VSV A;  1IDJ A;  1JTA A;  1DBG A;  1JRG A;  2VBK A;  2O0V A;  1O8L A;  4XQF A;  3GQ9 A;  3VMW A;  1QCX A;  4MXN A;  2NT9 A;  2QX3 A;  4XN3 A;  2ODL A;  2BSP A;  1IA5 A;  1O8E A;  4OJ6 A;  1O8J A;  3B8Y A;  4W8T A;  2NT6 A;  1OGM X;  2O17 A;  4Z05 A;  3VSU A;  3WWG A;  4XR6 A;  2NTP A;  1O88 A;  1OFL A;  4MR0 A;  1HG8 A;  1BN8 A;  3GRH A;  4U49 A;  3UW0 A;  4OJP A;  4U4B A;  4OZZ A;  3SUC A;  2X6X A;  1KTW A;  2O0W A;  1IDK A;  4PMH A;  3GQ7 A;  4XOT A;  4URR A;  4EW9 A;  1O8K A;  1K5C A;  1WMR A;  2VBE A;  4NK6 A;  3T9G A;  3EQN A;  4YZQ A;  2NTQ A;  2EWE A;  1KCC A;  3FY3 A;  3EQO A;  5C1E A;  1BHE A;  2NSP A;  4C2L A;  4YZA A;  4YZ0 A;  4W8R A;  4XLE A;  2X6Y A;  3JUR A;  4XLH A;  4XM3 A;  2NZM A;  5C1C A;  2X6W A;  2PYG A;  4HWV A;  2IQ7 A;  4XLC A;  4Z03 A;  1DBO A;  1O8I A;  1IB4 A;  4OJ5 A;  3KRG A;  4XKV A;  2O1D A;  2INU A;  4XLA A;  1PXZ A;  4XL9 A;  1EE6 A;  3ZPP A;  1X0C A;  1O8H A;  1PLU A;  1RU4 A;  3VST A;  2NST A;  4XN0 A;  2VJI A;  2UVF A;  1RMG A;  1VBL A;  1XG2 A;  4YEL A;  1PE9 A;  4XMY A;  1OFM A;  4Z06 A;  4W8S A;  1OOC A;  3B4N A;  4XOP A;  4OJO A;  1AIR A;  5AMV A;  3GQA A;  3GQ8 A;  1KCD A; 
#chains in the Genus database with same CATH topology
 1O8M A;  4XNF A;  4NK8 A;  4I84 A;  1QJV A;  2PYH A;  2VJJ A;  3RIQ A;  2Z8G A;  4XLF A;  3AK5 A;  2QXZ A;  1NHC A;  1O8D A;  1H80 A;  1O8F A;  2VBM A;  3B90 A;  2X85 A;  3NB2 A;  4XON A;  2NTB A;  3N90 A;  4YZX A;  2PEC A;  4XOR A;  1OFD A;  2QY1 A;  4XKW A;  1CLW A;  1TYU A;  4AVZ A;  2O6W A;  1O8G A;  1OGO X;  2XTX A;  4OJL A;  3SQV A;  3LMW A;  3SYJ A;  4W8Q A;  2INV A;  2B0R A;  4OZY A;  4YEJ A;  3ZSC A;  1DAB A;  1GQ8 A;  2X3H A;  1CZF A;  3VMV A;  2UVE A;  1RWR A;  2O04 A;  3VSV A;  1HF2 A;  2VFN A;  2XC1 A;  1IDJ A;  3PSS A;  2BM6 A;  3JX8 A;  5DNS A;  1JTA A;  1DBG A;  1JRG A;  2VBK A;  2O0V A;  4OM9 A;  1O8L A;  4XQF A;  3GQ9 A;  3VMW A;  1EZG A;  1QCX A;  4MXN A;  2NT9 A;  2QX3 A;  1LM1 A;  2ODL A;  3H09 A;  4XN3 A;  2BSP A;  1IA5 A;  1O8E A;  1TSP A;  2J8K A;  1O8J A;  3B8Y A;  4OJ6 A;  4W8T A;  2NT6 A;  1OGM X;  2BM5 A;  2O17 A;  4Z05 A;  3VSU A;  2F3L A;  3WWG A;  2J8I A;  2NTP A;  4XR6 A;  1O88 A;  1OFL A;  4MR0 A;  2BX6 A;  1HG8 A;  1WXR A;  1QA1 A;  1BN8 A;  3GRH A;  4U49 A;  3SY2 A;  4JRA C;  4OJP A;  3UW0 A;  4U4B A;  2BM7 A;  2QZA A;  4OZZ A;  3SUC A;  2X6X A;  1QRB A;  3LJY A;  1KTW A;  2O0W A;  1IDK A;  2W7Z A;  1K8F A;  4PMH A;  3GQ7 A;  4XOT A;  3LYC A;  2XT4 A;  2VFQ A;  2XTW A;  4URR A;  2VFM A;  3SZE A;  4EW9 A;  1O8K A;  1K5C A;  1WMR A;  3ML3 A;  1KQ5 A;  2VBE A;  1TYV A;  3PSZ A;  3NAW A;  4NK6 A;  3T9G A;  3TH0 A;  1EA0 A;  1K4Z A;  2XT2 A;  3EQN A;  4YZQ A;  4YFO A;  4KH3 A;  2VFP A;  1OFE A;  2NTQ A;  2EWE A;  4YCQ A;  3FY3 A;  1KCC A;  3EQO A;  5C1E A;  1TYX A;  1BHE A;  2NSP A;  4C2L A;  4YZA A;  4YZ0 A;  4W8R A;  4XLE A;  2X6Y A;  3JUR A;  4XLH A;  4XM3 A;  2NZM A;  5C1C A;  2X6W A;  2PYG A;  3BH7 B;  4YC5 A;  4HWV A;  2IQ7 A;  3N6Z A;  2G0Y A;  4XLC A;  4Z03 A;  1DBO A;  1O8I A;  3P4G A;  1IB4 A;  4OJ5 A;  1TYW A;  3KRG A;  1LLZ A;  4XKV A;  2IOU G;  2O1D A;  2INU A;  4XLA A;  1PXZ A;  2V5I A;  5JMC B;  4XL9 A;  2QYU A;  1EE6 A;  3ZPP A;  1LLW A;  2YUH A;  1L1I A;  1X0C A;  4YDT A;  1QRC A;  1QQ1 A;  5JLV C;  1O8H A;  1PLU A;  1RU4 A;  2VFO A;  3VST A;  4YEI A;  2XTY A;  4V02 C;  2NST A;  3BH6 B;  3DU1 X;  4XN0 A;  2VJI A;  2UVF A;  1RMG A;  1VBL A;  1QA2 A;  1XG2 A;  4YEL A;  1QA3 A;  1PE9 A;  4XMY A;  1OFM A;  4Z06 A;  3PET A;  4W8S A;  1OOC A;  3B4N A;  4OPW A;  4OJO A;  4XOP A;  1AIR A;  5AMV A;  2BM4 A;  3GQA A;  3GQ8 A;  1KCD A; 
#chains in the Genus database with same CATH homology
 1O8M A;  4XNF A;  4NK8 A;  4I84 A;  1QJV A;  2PYH A;  2VJJ A;  2Z8G A;  4XLF A;  2QXZ A;  1NHC A;  1O8D A;  1H80 A;  1O8F A;  2VBM A;  3B90 A;  2X85 A;  4XON A;  2NTB A;  4YZX A;  2PEC A;  4XOR A;  2QY1 A;  4XKW A;  4AVZ A;  1O8G A;  1OGO X;  4OJL A;  3LMW A;  4W8Q A;  2INV A;  4OZY A;  4YEJ A;  3ZSC A;  1GQ8 A;  2X3H A;  1CZF A;  3VMV A;  2UVE A;  1RWR A;  2O04 A;  3VSV A;  1IDJ A;  1JTA A;  1DBG A;  1JRG A;  2VBK A;  2O0V A;  1O8L A;  4XQF A;  3GQ9 A;  3VMW A;  1QCX A;  4MXN A;  2NT9 A;  2QX3 A;  4XN3 A;  2ODL A;  2BSP A;  1IA5 A;  1O8E A;  4OJ6 A;  1O8J A;  3B8Y A;  4W8T A;  2NT6 A;  1OGM X;  2O17 A;  4Z05 A;  3VSU A;  3WWG A;  4XR6 A;  2NTP A;  1O88 A;  1OFL A;  4MR0 A;  1HG8 A;  1BN8 A;  3GRH A;  4U49 A;  3UW0 A;  4OJP A;  4U4B A;  4OZZ A;  3SUC A;  2X6X A;  1KTW A;  2O0W A;  1IDK A;  4PMH A;  3GQ7 A;  4XOT A;  4URR A;  4EW9 A;  1O8K A;  1K5C A;  1WMR A;  2VBE A;  4NK6 A;  3T9G A;  3EQN A;  4YZQ A;  2NTQ A;  2EWE A;  1KCC A;  3FY3 A;  3EQO A;  5C1E A;  1BHE A;  2NSP A;  4C2L A;  4YZA A;  4YZ0 A;  4W8R A;  4XLE A;  2X6Y A;  3JUR A;  4XLH A;  4XM3 A;  2NZM A;  5C1C A;  2X6W A;  2PYG A;  4HWV A;  2IQ7 A;  4XLC A;  4Z03 A;  1DBO A;  1O8I A;  1IB4 A;  4OJ5 A;  3KRG A;  4XKV A;  2O1D A;  2INU A;  4XLA A;  1PXZ A;  4XL9 A;  1EE6 A;  3ZPP A;  1X0C A;  1O8H A;  1PLU A;  1RU4 A;  3VST A;  2NST A;  4XN0 A;  2VJI A;  2UVF A;  1RMG A;  1VBL A;  1XG2 A;  4YEL A;  1PE9 A;  4XMY A;  1OFM A;  4Z06 A;  4W8S A;  1OOC A;  3B4N A;  4XOP A;  4OJO A;  1AIR A;  5AMV A;  3GQA A;  3GQ8 A;  1KCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...