1O8FA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 30mm ca2+
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 140
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8fA00
4OZZA 1IDJA 1O8KA 2Z8GA 3EQNA 4OJ6A 4XLFA 1X0CA 4MXNA 4XONA 3EQOA 3GQ8A 4XLEA 4AVZA 4Z05A 2QX3A 2ODLA 2VJJA 2NSTA 3VSVA 4XLCA 4XR6A 4W8RA 2VJIA 2X6YA 1BN8A 1VBLA 2BSPA 3KRGA 4W8QA 2X6XA 2VBEA 1RU4A 1DBGA 1PE9A 1KCCA 4MR0A 1QJVA 3T9GA 4C2LA 2O1DA 3B90A 2O04A 1EE6A 4OJPA 1BHEA 1OFMA 4I84A 1IB4A 1NHCA 1XG2A 1RMGA 2PYGA 4YZ0A 3SUCA 1O8EA 1H80A 4OZYA 1PXZA 2X85A 4OJOA 1CZFA 4U4BA 4XOPA 4U49A 4XL9A 2O0WA 2QXZA 2UVFA 4XMYA 1KTWA 4HWVA 4W8TA 1O8IA 4XKWA 1WMRA 4W8SA 4YZXA 1OGOX 2IQ7A 2PYHA 4YEJA 1DBOA 4XN0A 4YELA 3B4NA 2O0VA 4OJLA 4PMHA 2VBKA 4YZAA 3ZPPA 5C1CA 1QCXA 4XNFA 3UW0A 5AMVA 3VMVA 1IDKA 2QY1A 4XQFA 1KCDA 4YZQA 4OJ5A 1OFLA 4XN3A 1GQ8A 4XOTA 3GQ7A 2UVEA 3FY3A 2NTBA 3GRHA 4XLAA 3ZSCA 1O8DA 2O17A 2NT9A 1IA5A 3GQAA 1O8MA 1JRGA 1OOCA 2INVA 4XM3A 4URRA 1HG8A 4XORA 3VSTA 1AIRA 2PECA 2NTQA 4NK6A 1K5CA 3VMWA 2EWEA 1O8FA 1PLUA 3B8YA 2NT6A 1RWRA 2VBMA 1O88A 4EW9A 1O8HA 3VSUA 5C1EA 4Z06A 2INUA 4Z03A 1OGMX 2NTPA 3LMWA 2X6WA 2NSPA 3WWGA 4NK8A 1O8LA 3JURA 2NZMA 2X3HA 3GQ9A 1O8GA 4XKVA 1JTAA 4XLHA 1O8JA
chains in the Genus database with same CATH superfamily
2VFNA 4OZZA 1IDJA 1O8KA 2Z8GA 1TSPA 3EQNA 4OJ6A 2BM6A 4OM9A 1QRBA 4XLFA 1X0CA 4MXNA 4XONA 1TYWA 3EQOA 3GQ8A 1HF2A 3N6ZA 2VFPA 2YUHA 3SY2A 4XLEA 4AVZA 4Z05A 2VFQA 2F3LA 2QX3A 1TYUA 2ODLA 4YEIA 2VJJA 1K4ZA 2NSTA 3VSVA 4XLCA 4XR6A 2BX6A 4W8RA 2QZAA 2VJIA 2X6YA 2IOUG 1BN8A 1VBLA 2BSPA 3KRGA 3NB2A 4W8QA 2X6XA 2VBEA 1RU4A 2W7ZA 3PSZA 4JRAC 1DBGA 4YFOA 1TYXA 3SQVA 1PE9A 1KCCA 4MR0A 1QJVA 1LM1A 3T9GA 5DNSA 2O6WA 4C2LA 5JLVC 2O1DA 3B90A 2O04A 2G0YA 1EE6A 2XTWA 1BHEA 1OFMA 4I84A 4OJPA 4YDTA 4YELA 1XG2A 1IB4A 1NHCA 3SYJA 1RMGA 2PYGA 4YZ0A 3SUCA 3P4GA 1O8EA 1H80A 2BM7A 1TYVA 4OZYA 1QA1A 3BH6B 1EA0A 1K8FA 1PXZA 1QRCA 3SZEA 1QA3A 2X85A 4OJOA 1CZFA 2QYUA 3PSSA 2V5IA 4U4BA 4XOPA 2BM4A 2BM5A 4U49A 4XL9A 2O0WA 2QXZA 2UVFA 3LYCA 4XMYA 1KTWA 3NAWA 4HWVA 4W8TA 1O8IA 2XT2A 2J8KA 1WMRA 4KH3A 4XKWA 4W8SA 4YZXA 2XC1A 1OFDA 1KQ5A 1OGOX 2IQ7A 2PYHA 4YEJA 1L1IA 1DBOA 3H09A 4XN0A 3B4NA 2O0VA 4OPWA 4OJLA 2VBKA 4PMHA 4YZAA 3JX8A 3ZPPA 5C1CA 3TH0A 1QCXA 4XNFA 3UW0A 5AMVA 3VMVA 1IDKA 2QY1A 4XQFA 1KCDA 4YZQA 1QA2A 4OJ5A 1OFLA 3N90A 3AK5A 4V02C 4XN3A 1GQ8A 4XOTA 3GQ7A 3ML3A 2XTYA 2UVEA 3FY3A 2NTBA 3GRHA 2XT4A 3DU1X 4XLAA 3ZSCA 1O8DA 1LLZA 2O17A 4YC5A 2NT9A 1IA5A 3GQAA 1O8MA 2VFMA 1JRGA 1OOCA 1CLWA 2INVA 4URRA 1HG8A 3BH7B 4XM3A 1AIRA 4XORA 2PECA 2XTXA 3RIQA 3VSTA 2NTQA 1LLWA 2J8IA 4NK6A 1WXRA 3PETA 1K5CA 3VMWA 2EWEA 1O8FA 4YCQA 1PLUA 3B8YA 2NT6A 1RWRA 2VBMA 1O88A 4EW9A 1O8HA 3VSUA 5C1EA 2VFOA 4Z06A 1EZGA 2INUA 1DABA 1QQ1A 4Z03A 1OGMX 2NTPA 1OFEA 3LMWA 2X6WA 2NSPA 3WWGA 5JMCB 2B0RA 4NK8A 1O8LA 3JURA 2NZMA 3LJYA 2X3HA 3GQ9A 1O8GA 4XKVA 1JTAA 4XLHA 1O8JA
chains in the Genus database with same CATH topology
4OZZA 1IDJA 1O8KA 2Z8GA 3EQNA 4OJ6A 4XLFA 1X0CA 4MXNA 4XONA 3EQOA 3GQ8A 4XLEA 4AVZA 4Z05A 2QX3A 2ODLA 2VJJA 2NSTA 3VSVA 4XLCA 4XR6A 4W8RA 2VJIA 2X6YA 1BN8A 1VBLA 2BSPA 3KRGA 4W8QA 2X6XA 2VBEA 1RU4A 1DBGA 1PE9A 1KCCA 4MR0A 1QJVA 3T9GA 4C2LA 2O1DA 3B90A 2O04A 1EE6A 4OJPA 1BHEA 1OFMA 4I84A 1IB4A 1NHCA 1XG2A 1RMGA 2PYGA 4YZ0A 3SUCA 1O8EA 1H80A 4OZYA 1PXZA 2X85A 4OJOA 1CZFA 4U4BA 4XOPA 4U49A 4XL9A 2O0WA 2QXZA 2UVFA 4XMYA 1KTWA 4HWVA 4W8TA 1O8IA 4XKWA 1WMRA 4W8SA 4YZXA 1OGOX 2IQ7A 2PYHA 4YEJA 1DBOA 4XN0A 4YELA 3B4NA 2O0VA 4OJLA 4PMHA 2VBKA 4YZAA 3ZPPA 5C1CA 1QCXA 4XNFA 3UW0A 5AMVA 3VMVA 1IDKA 2QY1A 4XQFA 1KCDA 4YZQA 4OJ5A 1OFLA 4XN3A 1GQ8A 4XOTA 3GQ7A 2UVEA 3FY3A 2NTBA 3GRHA 4XLAA 3ZSCA 1O8DA 2O17A 2NT9A 1IA5A 3GQAA 1O8MA 1JRGA 1OOCA 2INVA 4XM3A 4URRA 1HG8A 4XORA 3VSTA 1AIRA 2PECA 2NTQA 4NK6A 1K5CA 3VMWA 2EWEA 1O8FA 1PLUA 3B8YA 2NT6A 1RWRA 2VBMA 1O88A 4EW9A 1O8HA 3VSUA 5C1EA 4Z06A 2INUA 4Z03A 1OGMX 2NTPA 3LMWA 2X6WA 2NSPA 3WWGA 4NK8A 1O8LA 3JURA 2NZMA 2X3HA 3GQ9A 1O8GA 4XKVA 1JTAA 4XLHA 1O8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZZ A;  1IDJ A;  1O8K A;  2Z8G A;  3EQN A;  4OJ6 A;  4XLF A;  1X0C A;  4MXN A;  4XON A;  3EQO A;  3GQ8 A;  4XLE A;  4AVZ A;  4Z05 A;  2QX3 A;  2ODL A;  2VJJ A;  2NST A;  3VSV A;  4XLC A;  4XR6 A;  4W8R A;  2VJI A;  2X6Y A;  1BN8 A;  1VBL A;  2BSP A;  3KRG A;  4W8Q A;  2X6X A;  2VBE A;  1RU4 A;  1DBG A;  1PE9 A;  1KCC A;  4MR0 A;  1QJV A;  3T9G A;  4C2L A;  2O1D A;  3B90 A;  2O04 A;  1EE6 A;  4OJP A;  1BHE A;  1OFM A;  4I84 A;  1IB4 A;  1NHC A;  1XG2 A;  1RMG A;  2PYG A;  4YZ0 A;  3SUC A;  1O8E A;  1H80 A;  4OZY A;  1PXZ A;  2X85 A;  4OJO A;  1CZF A;  4U4B A;  4XOP A;  4U49 A;  4XL9 A;  2O0W A;  2QXZ A;  2UVF A;  4XMY A;  1KTW A;  4HWV A;  4W8T A;  1O8I A;  4XKW A;  1WMR A;  4W8S A;  4YZX A;  1OGO X;  2IQ7 A;  2PYH A;  4YEJ A;  1DBO A;  4XN0 A;  4YEL A;  3B4N A;  2O0V A;  4OJL A;  4PMH A;  2VBK A;  4YZA A;  3ZPP A;  5C1C A;  1QCX A;  4XNF A;  3UW0 A;  5AMV A;  3VMV A;  1IDK A;  2QY1 A;  4XQF A;  1KCD A;  4YZQ A;  4OJ5 A;  1OFL A;  4XN3 A;  1GQ8 A;  4XOT A;  3GQ7 A;  2UVE A;  3FY3 A;  2NTB A;  3GRH A;  4XLA A;  3ZSC A;  1O8D A;  2O17 A;  2NT9 A;  1IA5 A;  3GQA A;  1O8M A;  1JRG A;  1OOC A;  2INV A;  4XM3 A;  4URR A;  1HG8 A;  4XOR A;  3VST A;  1AIR A;  2PEC A;  2NTQ A;  4NK6 A;  1K5C A;  3VMW A;  2EWE A;  1O8F A;  1PLU A;  3B8Y A;  2NT6 A;  1RWR A;  2VBM A;  1O88 A;  4EW9 A;  1O8H A;  3VSU A;  5C1E A;  4Z06 A;  2INU A;  4Z03 A;  1OGM X;  2NTP A;  3LMW A;  2X6W A;  2NSP A;  3WWG A;  4NK8 A;  1O8L A;  3JUR A;  2NZM A;  2X3H A;  3GQ9 A;  1O8G A;  4XKV A;  1JTA A;  4XLH A;  1O8J A; 
#chains in the Genus database with same CATH topology
 2VFN A;  4OZZ A;  1IDJ A;  1O8K A;  2Z8G A;  1TSP A;  3EQN A;  4OJ6 A;  2BM6 A;  4OM9 A;  1QRB A;  4XLF A;  1X0C A;  4MXN A;  4XON A;  1TYW A;  3EQO A;  3GQ8 A;  1HF2 A;  3N6Z A;  2VFP A;  2YUH A;  3SY2 A;  4XLE A;  4AVZ A;  4Z05 A;  2VFQ A;  2F3L A;  2QX3 A;  1TYU A;  2ODL A;  4YEI A;  2VJJ A;  1K4Z A;  2NST A;  3VSV A;  4XLC A;  4XR6 A;  2BX6 A;  4W8R A;  2QZA A;  2VJI A;  2X6Y A;  2IOU G;  1BN8 A;  1VBL A;  2BSP A;  3KRG A;  3NB2 A;  4W8Q A;  2X6X A;  2VBE A;  1RU4 A;  2W7Z A;  3PSZ A;  4JRA C;  1DBG A;  4YFO A;  1TYX A;  3SQV A;  1PE9 A;  1KCC A;  4MR0 A;  1QJV A;  1LM1 A;  3T9G A;  5DNS A;  2O6W A;  4C2L A;  5JLV C;  2O1D A;  3B90 A;  2O04 A;  2G0Y A;  1EE6 A;  2XTW A;  1BHE A;  1OFM A;  4I84 A;  4OJP A;  4YDT A;  4YEL A;  1XG2 A;  1IB4 A;  1NHC A;  3SYJ A;  1RMG A;  2PYG A;  4YZ0 A;  3SUC A;  3P4G A;  1O8E A;  1H80 A;  2BM7 A;  1TYV A;  4OZY A;  1QA1 A;  3BH6 B;  1EA0 A;  1K8F A;  1PXZ A;  1QRC A;  3SZE A;  1QA3 A;  2X85 A;  4OJO A;  1CZF A;  2QYU A;  3PSS A;  2V5I A;  4U4B A;  4XOP A;  2BM4 A;  2BM5 A;  4U49 A;  4XL9 A;  2O0W A;  2QXZ A;  2UVF A;  3LYC A;  4XMY A;  1KTW A;  3NAW A;  4HWV A;  4W8T A;  1O8I A;  2XT2 A;  2J8K A;  1WMR A;  4KH3 A;  4XKW A;  4W8S A;  4YZX A;  2XC1 A;  1OFD A;  1KQ5 A;  1OGO X;  2IQ7 A;  2PYH A;  4YEJ A;  1L1I A;  1DBO A;  3H09 A;  4XN0 A;  3B4N A;  2O0V A;  4OPW A;  4OJL A;  2VBK A;  4PMH A;  4YZA A;  3JX8 A;  3ZPP A;  5C1C A;  3TH0 A;  1QCX A;  4XNF A;  3UW0 A;  5AMV A;  3VMV A;  1IDK A;  2QY1 A;  4XQF A;  1KCD A;  4YZQ A;  1QA2 A;  4OJ5 A;  1OFL A;  3N90 A;  3AK5 A;  4V02 C;  4XN3 A;  1GQ8 A;  4XOT A;  3GQ7 A;  3ML3 A;  2XTY A;  2UVE A;  3FY3 A;  2NTB A;  3GRH A;  2XT4 A;  3DU1 X;  4XLA A;  3ZSC A;  1O8D A;  1LLZ A;  2O17 A;  4YC5 A;  2NT9 A;  1IA5 A;  3GQA A;  1O8M A;  2VFM A;  1JRG A;  1OOC A;  1CLW A;  2INV A;  4URR A;  1HG8 A;  3BH7 B;  4XM3 A;  1AIR A;  4XOR A;  2PEC A;  2XTX A;  3RIQ A;  3VST A;  2NTQ A;  1LLW A;  2J8I A;  4NK6 A;  1WXR A;  3PET A;  1K5C A;  3VMW A;  2EWE A;  1O8F A;  4YCQ A;  1PLU A;  3B8Y A;  2NT6 A;  1RWR A;  2VBM A;  1O88 A;  4EW9 A;  1O8H A;  3VSU A;  5C1E A;  2VFO A;  4Z06 A;  1EZG A;  2INU A;  1DAB A;  1QQ1 A;  4Z03 A;  1OGM X;  2NTP A;  1OFE A;  3LMW A;  2X6W A;  2NSP A;  3WWG A;  5JMC B;  2B0R A;  4NK8 A;  1O8L A;  3JUR A;  2NZM A;  3LJY A;  2X3H A;  3GQ9 A;  1O8G A;  4XKV A;  1JTA A;  4XLH A;  1O8J A; 
#chains in the Genus database with same CATH homology
 4OZZ A;  1IDJ A;  1O8K A;  2Z8G A;  3EQN A;  4OJ6 A;  4XLF A;  1X0C A;  4MXN A;  4XON A;  3EQO A;  3GQ8 A;  4XLE A;  4AVZ A;  4Z05 A;  2QX3 A;  2ODL A;  2VJJ A;  2NST A;  3VSV A;  4XLC A;  4XR6 A;  4W8R A;  2VJI A;  2X6Y A;  1BN8 A;  1VBL A;  2BSP A;  3KRG A;  4W8Q A;  2X6X A;  2VBE A;  1RU4 A;  1DBG A;  1PE9 A;  1KCC A;  4MR0 A;  1QJV A;  3T9G A;  4C2L A;  2O1D A;  3B90 A;  2O04 A;  1EE6 A;  4OJP A;  1BHE A;  1OFM A;  4I84 A;  1IB4 A;  1NHC A;  1XG2 A;  1RMG A;  2PYG A;  4YZ0 A;  3SUC A;  1O8E A;  1H80 A;  4OZY A;  1PXZ A;  2X85 A;  4OJO A;  1CZF A;  4U4B A;  4XOP A;  4U49 A;  4XL9 A;  2O0W A;  2QXZ A;  2UVF A;  4XMY A;  1KTW A;  4HWV A;  4W8T A;  1O8I A;  4XKW A;  1WMR A;  4W8S A;  4YZX A;  1OGO X;  2IQ7 A;  2PYH A;  4YEJ A;  1DBO A;  4XN0 A;  4YEL A;  3B4N A;  2O0V A;  4OJL A;  4PMH A;  2VBK A;  4YZA A;  3ZPP A;  5C1C A;  1QCX A;  4XNF A;  3UW0 A;  5AMV A;  3VMV A;  1IDK A;  2QY1 A;  4XQF A;  1KCD A;  4YZQ A;  4OJ5 A;  1OFL A;  4XN3 A;  1GQ8 A;  4XOT A;  3GQ7 A;  2UVE A;  3FY3 A;  2NTB A;  3GRH A;  4XLA A;  3ZSC A;  1O8D A;  2O17 A;  2NT9 A;  1IA5 A;  3GQA A;  1O8M A;  1JRG A;  1OOC A;  2INV A;  4XM3 A;  4URR A;  1HG8 A;  4XOR A;  3VST A;  1AIR A;  2PEC A;  2NTQ A;  4NK6 A;  1K5C A;  3VMW A;  2EWE A;  1O8F A;  1PLU A;  3B8Y A;  2NT6 A;  1RWR A;  2VBM A;  1O88 A;  4EW9 A;  1O8H A;  3VSU A;  5C1E A;  4Z06 A;  2INU A;  4Z03 A;  1OGM X;  2NTP A;  3LMW A;  2X6W A;  2NSP A;  3WWG A;  4NK8 A;  1O8L A;  3JUR A;  2NZM A;  2X3H A;  3GQ9 A;  1O8G A;  4XKV A;  1JTA A;  4XLH A;  1O8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...