1O8FA

Pectate lyase c from erwinia chrysanthemi at ph 9.5 with 30mm ca2+
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 140
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8fA00
3B8YA 4XONA 5AMVA 1QJVA 1DBGA 2VJJA 4W8TA 4HWVA 4OJPA 1O8DA 4XLEA 2O0VA 1CZFA 1OGMX 2O1DA 4U4BA 4XL9A 1BN8A 4XLCA 2Z8GA 2NSTA 2NZMA 5C1CA 2O04A 2VJIA 2O17A 2O0WA 1AIRA 3GRHA 4AVZA 1KCCA 3EQOA 4OJOA 3VSVA 2NT6A 1O8KA 4W8QA 1O8LA 3GQ9A 4XNFA 1KCDA 2ODLA 2NTBA 1O8IA 4XMYA 2QXZA 2UVFA 4YZXA 1RWRA 2X6XA 3VSTA 1K5CA 1H80A 4OJ6A 3GQ7A 4W8RA 2X3HA 4XORA 1XG2A 2IQ7A 4C2LA 2INVA 3VSUA 4XR6A 4XQFA 4PMHA 1HG8A 1OOCA 3VMVA 3WWGA 2NTQA 1OGOX 4MXNA 4XN0A 1IDJA 2VBKA 1KTWA 1JRGA 2PECA 1QCXA 2QX3A 2VBMA 1JTAA 1WMRA 1IDKA 3ZPPA 2X85A 1O8FA 4Z06A 2NT9A 4NK6A 1BHEA 3SUCA 2UVEA 1DBOA 1O8JA 1PE9A 4OZYA 2PYGA 3GQ8A 1GQ8A 4I84A 2NSPA 4XLHA 4URRA 1O8GA 4Z05A 1IA5A 3T9GA 4NK8A 5C1EA 3KRGA 3GQAA 1O8EA 2PYHA 1NHCA 4OJLA 4XLFA 2QY1A 4XOTA 4YZ0A 3FY3A 1PLUA 2X6WA 1O88A 3EQNA 4OZZA 4EW9A 3LMWA 1RMGA 4XM3A 4XKWA 4YZAA 4XOPA 3UW0A 4MR0A 1RU4A 1X0CA 3B90A 4XKVA 4YZQA 1VBLA 4Z03A 4XLAA 1O8MA 1O8HA 2EWEA 4W8SA 4XN3A 3VMWA 1PXZA 3JURA 1EE6A 1OFLA 4YEJA 3ZSCA 2VBEA 1OFMA 4U49A 2NTPA 2BSPA 2INUA 2X6YA 4OJ5A 3B4NA 4YELA 1IB4A
chains in the Genus database with same CATH superfamily
3B8YA 2QZAA 1EZGA 2BM7A 4OM9A 4XONA 5AMVA 1QJVA 1DBGA 2VJJA 4W8TA 2XTXA 4HWVA 4OJPA 1K8FA 1O8DA 4XLEA 2XTYA 1TYVA 2IOUG 2J8IA 2O0VA 1CZFA 1OGMX 2O1DA 1KQ5A 4U4BA 4XL9A 1BN8A 4XLCA 2J8KA 2NSTA 2NZMA 2Z8GA 5C1CA 2O04A 2VJIA 3BH6B 2O17A 2V5IA 2O0WA 1HF2A 1TYWA 1AIRA 3GRHA 4AVZA 1KCCA 3EQOA 4OJOA 3VSVA 5DNSA 2G0YA 3NB2A 2NT6A 1EA0A 3PSSA 1O8KA 3DU1X 4W8QA 1O8LA 3GQ9A 4XNFA 1KCDA 2ODLA 2NTBA 1O8IA 4XMYA 2QXZA 2UVFA 4YZXA 1TSPA 1RWRA 3LYCA 2X6XA 4YCQA 4YC5A 1QRCA 3VSTA 1K5CA 1H80A 1CLWA 4OJ6A 3GQ7A 2VFNA 4W8RA 3SQVA 1LM1A 1K4ZA 2X3HA 4XORA 1XG2A 3P4GA 2IQ7A 2VFOA 2INVA 4C2LA 3VSUA 1LLWA 4XR6A 4PMHA 4XQFA 3LJYA 1HG8A 1OOCA 2O6WA 3H09A 2BM5A 3AK5A 3VMVA 4YDTA 4KH3A 1QA3A 3SY2A 3VMWA 4OPWA 3WWGA 2NTQA 1OGOX 1LLZA 3SZEA 4MXNA 4XN0A 1IDJA 2VFQA 2VBKA 1KTWA 1JRGA 2PECA 1QCXA 2QX3A 2VBMA 1JTAA 1QRBA 1WMRA 1WXRA 1IDKA 3ZPPA 4YEIA 2X85A 3ML3A 1O8FA 1TYXA 4Z06A 2VFPA 2NT9A 4NK6A 1BHEA 3SUCA 2XT4A 2UVEA 1DBOA 1O8JA 2YUHA 3BH7B 1PE9A 4OZYA 2PYGA 3GQ8A 1GQ8A 2VFMA 4I84A 2NSPA 3SYJA 2B0RA 3N90A 4XLHA 4JRAC 4URRA 1L1IA 1O8GA 2XT2A 4Z05A 1IA5A 3T9GA 4NK8A 4YFOA 5C1EA 1QA1A 2QYUA 3GQAA 1O8EA 3KRGA 1IB4A 2BX6A 2PYHA 1NHCA 4OJLA 4XLFA 3TH0A 2QY1A 4XOTA 4YZ0A 3FY3A 2W7ZA 1PLUA 2X6WA 1O88A 4V02C 3EQNA 4OZZA 4EW9A 3LMWA 1RMGA 4XM3A 4XKWA 4YZAA 4XOPA 3UW0A 4MR0A 1RU4A 2BM6A 1X0CA 3B90A 4XKVA 4YZQA 1VBLA 2XTWA 3PETA 4XLAA 4Z03A 1O8MA 1O8HA 2EWEA 2XC1A 3PSZA 4W8SA 4XN3A 1PXZA 3JURA 1EE6A 1OFLA 3RIQA 3NAWA 5JLVC 4YEJA 1TYUA 3ZSCA 1DABA 2VBEA 1OFMA 2BM4A 3JX8A 2NTPA 3N6ZA 1OFEA 2BSPA 2INUA 2X6YA 4U49A 1QQ1A 4OJ5A 1QA2A 3B4NA 4YELA 5JMCB 1OFDA 2F3LA
chains in the Genus database with same CATH topology
3B8YA 4XONA 5AMVA 1QJVA 1DBGA 2VJJA 4W8TA 4HWVA 4OJPA 1O8DA 4XLEA 2O0VA 1CZFA 1OGMX 2O1DA 4U4BA 4XL9A 1BN8A 4XLCA 2Z8GA 2NSTA 2NZMA 5C1CA 2O04A 2VJIA 2O17A 2O0WA 1AIRA 3GRHA 4AVZA 1KCCA 3EQOA 4OJOA 3VSVA 2NT6A 1O8KA 4W8QA 1O8LA 3GQ9A 4XNFA 1KCDA 2ODLA 2NTBA 1O8IA 4XMYA 2QXZA 2UVFA 4YZXA 1RWRA 2X6XA 3VSTA 1K5CA 1H80A 4OJ6A 3GQ7A 4W8RA 2X3HA 4XORA 1XG2A 2IQ7A 4C2LA 2INVA 3VSUA 4XR6A 4XQFA 4PMHA 1HG8A 1OOCA 3VMVA 3WWGA 2NTQA 1OGOX 4MXNA 4XN0A 1IDJA 2VBKA 1KTWA 1JRGA 2PECA 1QCXA 2QX3A 2VBMA 1JTAA 1WMRA 1IDKA 3ZPPA 2X85A 1O8FA 4Z06A 2NT9A 4NK6A 1BHEA 3SUCA 2UVEA 1DBOA 1O8JA 1PE9A 4OZYA 2PYGA 3GQ8A 1GQ8A 4I84A 2NSPA 4XLHA 4URRA 1O8GA 4Z05A 1IA5A 3T9GA 4NK8A 5C1EA 3KRGA 3GQAA 1O8EA 2PYHA 1NHCA 4OJLA 4XLFA 2QY1A 4XOTA 4YZ0A 3FY3A 1PLUA 2X6WA 1O88A 3EQNA 4OZZA 4EW9A 3LMWA 1RMGA 4XM3A 4XKWA 4YZAA 4XOPA 3UW0A 4MR0A 1RU4A 1X0CA 3B90A 4XKVA 4YZQA 1VBLA 4Z03A 4XLAA 1O8MA 1O8HA 2EWEA 4W8SA 4XN3A 3VMWA 1PXZA 3JURA 1EE6A 1OFLA 4YEJA 3ZSCA 2VBEA 1OFMA 4U49A 2NTPA 2BSPA 2INUA 2X6YA 4OJ5A 3B4NA 4YELA 1IB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8Y A;  4XON A;  5AMV A;  1QJV A;  1DBG A;  2VJJ A;  4W8T A;  4HWV A;  4OJP A;  1O8D A;  4XLE A;  2O0V A;  1CZF A;  1OGM X;  2O1D A;  4U4B A;  4XL9 A;  1BN8 A;  4XLC A;  2Z8G A;  2NST A;  2NZM A;  5C1C A;  2O04 A;  2VJI A;  2O17 A;  2O0W A;  1AIR A;  3GRH A;  4AVZ A;  1KCC A;  3EQO A;  4OJO A;  3VSV A;  2NT6 A;  1O8K A;  4W8Q A;  1O8L A;  3GQ9 A;  4XNF A;  1KCD A;  2ODL A;  2NTB A;  1O8I A;  4XMY A;  2QXZ A;  2UVF A;  4YZX A;  1RWR A;  2X6X A;  3VST A;  1K5C A;  1H80 A;  4OJ6 A;  3GQ7 A;  4W8R A;  2X3H A;  4XOR A;  1XG2 A;  2IQ7 A;  4C2L A;  2INV A;  3VSU A;  4XR6 A;  4XQF A;  4PMH A;  1HG8 A;  1OOC A;  3VMV A;  3WWG A;  2NTQ A;  1OGO X;  4MXN A;  4XN0 A;  1IDJ A;  2VBK A;  1KTW A;  1JRG A;  2PEC A;  1QCX A;  2QX3 A;  2VBM A;  1JTA A;  1WMR A;  1IDK A;  3ZPP A;  2X85 A;  1O8F A;  4Z06 A;  2NT9 A;  4NK6 A;  1BHE A;  3SUC A;  2UVE A;  1DBO A;  1O8J A;  1PE9 A;  4OZY A;  2PYG A;  3GQ8 A;  1GQ8 A;  4I84 A;  2NSP A;  4XLH A;  4URR A;  1O8G A;  4Z05 A;  1IA5 A;  3T9G A;  4NK8 A;  5C1E A;  3KRG A;  3GQA A;  1O8E A;  2PYH A;  1NHC A;  4OJL A;  4XLF A;  2QY1 A;  4XOT A;  4YZ0 A;  3FY3 A;  1PLU A;  2X6W A;  1O88 A;  3EQN A;  4OZZ A;  4EW9 A;  3LMW A;  1RMG A;  4XM3 A;  4XKW A;  4YZA A;  4XOP A;  3UW0 A;  4MR0 A;  1RU4 A;  1X0C A;  3B90 A;  4XKV A;  4YZQ A;  1VBL A;  4Z03 A;  4XLA A;  1O8M A;  1O8H A;  2EWE A;  4W8S A;  4XN3 A;  3VMW A;  1PXZ A;  3JUR A;  1EE6 A;  1OFL A;  4YEJ A;  3ZSC A;  2VBE A;  1OFM A;  4U49 A;  2NTP A;  2BSP A;  2INU A;  2X6Y A;  4OJ5 A;  3B4N A;  4YEL A;  1IB4 A; 
#chains in the Genus database with same CATH topology
 3B8Y A;  2QZA A;  1EZG A;  2BM7 A;  4OM9 A;  4XON A;  5AMV A;  1QJV A;  1DBG A;  2VJJ A;  4W8T A;  2XTX A;  4HWV A;  4OJP A;  1K8F A;  1O8D A;  4XLE A;  2XTY A;  1TYV A;  2IOU G;  2J8I A;  2O0V A;  1CZF A;  1OGM X;  2O1D A;  1KQ5 A;  4U4B A;  4XL9 A;  1BN8 A;  4XLC A;  2J8K A;  2NST A;  2NZM A;  2Z8G A;  5C1C A;  2O04 A;  2VJI A;  3BH6 B;  2O17 A;  2V5I A;  2O0W A;  1HF2 A;  1TYW A;  1AIR A;  3GRH A;  4AVZ A;  1KCC A;  3EQO A;  4OJO A;  3VSV A;  5DNS A;  2G0Y A;  3NB2 A;  2NT6 A;  1EA0 A;  3PSS A;  1O8K A;  3DU1 X;  4W8Q A;  1O8L A;  3GQ9 A;  4XNF A;  1KCD A;  2ODL A;  2NTB A;  1O8I A;  4XMY A;  2QXZ A;  2UVF A;  4YZX A;  1TSP A;  1RWR A;  3LYC A;  2X6X A;  4YCQ A;  4YC5 A;  1QRC A;  3VST A;  1K5C A;  1H80 A;  1CLW A;  4OJ6 A;  3GQ7 A;  2VFN A;  4W8R A;  3SQV A;  1LM1 A;  1K4Z A;  2X3H A;  4XOR A;  1XG2 A;  3P4G A;  2IQ7 A;  2VFO A;  2INV A;  4C2L A;  3VSU A;  1LLW A;  4XR6 A;  4PMH A;  4XQF A;  3LJY A;  1HG8 A;  1OOC A;  2O6W A;  3H09 A;  2BM5 A;  3AK5 A;  3VMV A;  4YDT A;  4KH3 A;  1QA3 A;  3SY2 A;  3VMW A;  4OPW A;  3WWG A;  2NTQ A;  1OGO X;  1LLZ A;  3SZE A;  4MXN A;  4XN0 A;  1IDJ A;  2VFQ A;  2VBK A;  1KTW A;  1JRG A;  2PEC A;  1QCX A;  2QX3 A;  2VBM A;  1JTA A;  1QRB A;  1WMR A;  1WXR A;  1IDK A;  3ZPP A;  4YEI A;  2X85 A;  3ML3 A;  1O8F A;  1TYX A;  4Z06 A;  2VFP A;  2NT9 A;  4NK6 A;  1BHE A;  3SUC A;  2XT4 A;  2UVE A;  1DBO A;  1O8J A;  2YUH A;  3BH7 B;  1PE9 A;  4OZY A;  2PYG A;  3GQ8 A;  1GQ8 A;  2VFM A;  4I84 A;  2NSP A;  3SYJ A;  2B0R A;  3N90 A;  4XLH A;  4JRA C;  4URR A;  1L1I A;  1O8G A;  2XT2 A;  4Z05 A;  1IA5 A;  3T9G A;  4NK8 A;  4YFO A;  5C1E A;  1QA1 A;  2QYU A;  3GQA A;  1O8E A;  3KRG A;  1IB4 A;  2BX6 A;  2PYH A;  1NHC A;  4OJL A;  4XLF A;  3TH0 A;  2QY1 A;  4XOT A;  4YZ0 A;  3FY3 A;  2W7Z A;  1PLU A;  2X6W A;  1O88 A;  4V02 C;  3EQN A;  4OZZ A;  4EW9 A;  3LMW A;  1RMG A;  4XM3 A;  4XKW A;  4YZA A;  4XOP A;  3UW0 A;  4MR0 A;  1RU4 A;  2BM6 A;  1X0C A;  3B90 A;  4XKV A;  4YZQ A;  1VBL A;  2XTW A;  3PET A;  4XLA A;  4Z03 A;  1O8M A;  1O8H A;  2EWE A;  2XC1 A;  3PSZ A;  4W8S A;  4XN3 A;  1PXZ A;  3JUR A;  1EE6 A;  1OFL A;  3RIQ A;  3NAW A;  5JLV C;  4YEJ A;  1TYU A;  3ZSC A;  1DAB A;  2VBE A;  1OFM A;  2BM4 A;  3JX8 A;  2NTP A;  3N6Z A;  1OFE A;  2BSP A;  2INU A;  2X6Y A;  4U49 A;  1QQ1 A;  4OJ5 A;  1QA2 A;  3B4N A;  4YEL A;  5JMC B;  1OFD A;  2F3L A; 
#chains in the Genus database with same CATH homology
 3B8Y A;  4XON A;  5AMV A;  1QJV A;  1DBG A;  2VJJ A;  4W8T A;  4HWV A;  4OJP A;  1O8D A;  4XLE A;  2O0V A;  1CZF A;  1OGM X;  2O1D A;  4U4B A;  4XL9 A;  1BN8 A;  4XLC A;  2Z8G A;  2NST A;  2NZM A;  5C1C A;  2O04 A;  2VJI A;  2O17 A;  2O0W A;  1AIR A;  3GRH A;  4AVZ A;  1KCC A;  3EQO A;  4OJO A;  3VSV A;  2NT6 A;  1O8K A;  4W8Q A;  1O8L A;  3GQ9 A;  4XNF A;  1KCD A;  2ODL A;  2NTB A;  1O8I A;  4XMY A;  2QXZ A;  2UVF A;  4YZX A;  1RWR A;  2X6X A;  3VST A;  1K5C A;  1H80 A;  4OJ6 A;  3GQ7 A;  4W8R A;  2X3H A;  4XOR A;  1XG2 A;  2IQ7 A;  4C2L A;  2INV A;  3VSU A;  4XR6 A;  4XQF A;  4PMH A;  1HG8 A;  1OOC A;  3VMV A;  3WWG A;  2NTQ A;  1OGO X;  4MXN A;  4XN0 A;  1IDJ A;  2VBK A;  1KTW A;  1JRG A;  2PEC A;  1QCX A;  2QX3 A;  2VBM A;  1JTA A;  1WMR A;  1IDK A;  3ZPP A;  2X85 A;  1O8F A;  4Z06 A;  2NT9 A;  4NK6 A;  1BHE A;  3SUC A;  2UVE A;  1DBO A;  1O8J A;  1PE9 A;  4OZY A;  2PYG A;  3GQ8 A;  1GQ8 A;  4I84 A;  2NSP A;  4XLH A;  4URR A;  1O8G A;  4Z05 A;  1IA5 A;  3T9G A;  4NK8 A;  5C1E A;  3KRG A;  3GQA A;  1O8E A;  2PYH A;  1NHC A;  4OJL A;  4XLF A;  2QY1 A;  4XOT A;  4YZ0 A;  3FY3 A;  1PLU A;  2X6W A;  1O88 A;  3EQN A;  4OZZ A;  4EW9 A;  3LMW A;  1RMG A;  4XM3 A;  4XKW A;  4YZA A;  4XOP A;  3UW0 A;  4MR0 A;  1RU4 A;  1X0C A;  3B90 A;  4XKV A;  4YZQ A;  1VBL A;  4Z03 A;  4XLA A;  1O8M A;  1O8H A;  2EWE A;  4W8S A;  4XN3 A;  3VMW A;  1PXZ A;  3JUR A;  1EE6 A;  1OFL A;  4YEJ A;  3ZSC A;  2VBE A;  1OFM A;  4U49 A;  2NTP A;  2BSP A;  2INU A;  2X6Y A;  4OJ5 A;  3B4N A;  4YEL A;  1IB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...