4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
molecule tags Viral protein
source organism Enterobacteria phage hk620
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
4W8SA 2INUA 4XLAA 3ZSCA 2NZMA 4YZAA 2NTQA 3GQ8A 3GQ9A 4Z06A 2O0WA 1O8EA 4NK8A 1NHCA 3GQ7A 3ZPPA 3B4NA 1EE6A 1RMGA 4XM3A 1BN8A 3VSTA 2NTBA 2VJJA 1KTWA 1GQ8A 1PXZA 2X6XA 1XG2A 1OOCA 1O8FA 4OZYA 4Z03A 4Z05A 3EQOA 3VSUA 3UW0A 1DBGA 1BHEA 3B90A 4YELA 4YZQA 1IB4A 2BSPA 3GQAA 2QY1A 4AVZA 1O8DA 4U4BA 1OFLA 4PMHA 1O8MA 1X0CA 3GRHA 4HWVA 3EQNA 4OZZA 4XLEA 1IDJA 2Z8GA 2VBEA 3SUCA 1O8HA 1OGMX 2UVFA 1QJVA 1JRGA 2O1DA 1O88A 1KCDA 1O8KA 1RWRA 4I84A 4XOPA 3B8YA 4YZXA 3JURA 4YZ0A 4W8QA 2X6WA 1QCXA 1WMRA 1PLUA 4XR6A 3FY3A 2O04A 3WWGA 4W8RA 4XN0A 1H80A 4XNFA 2INVA 2X3HA 2UVEA 4XLCA 2NSTA 2NT6A 4OJPA 4XONA 2PYGA 2NTPA 1RU4A 1CZFA 2NSPA 3KRGA 2EWEA 1VBLA 2QXZA 5C1EA 2PYHA 1O8IA 1OGOX 3LMWA 4MR0A 4XORA 3T9GA 1O8GA 1HG8A 1PE9A 2VJIA 3VMWA 2O17A 3VMVA 5AMVA 2VBMA 2X85A 4OJOA 2O0VA 1JTAA 4OJ5A 3VSVA 4XQFA 4OJLA 2X6YA 4OJ6A 4XL9A 1KCCA 1IA5A 4XN3A 2ODLA 1DBOA 4NK6A 4XKWA 1O8JA 4U49A 2PECA 1AIRA 4XKVA 1OFMA 2IQ7A 4C2LA 2VBKA 4MXNA 4YEJA 4XOTA 1K5CA 4URRA 5C1CA 4W8TA 1IDKA 4XLFA 2NT9A 2QX3A 4XMYA 4XLHA 4EW9A 1O8LA
chains in the Genus database with same CATH superfamily
3CCQI 1MIJA 1YX5A 3RPUA 2LOOA 3W6KB 3AKZA 1E64A 2NZMA 4W8SA 2VBXA 1SFOJ 2F1LA 2B9SA 3M3YJ 4RJLA 2E1MB 4EJVA 2CQ7A 2M87A 2BY3A 3FXJA 3IRRA 1FRNA 1U5TB 1PJ7A 4PUSA 4DQ2A 2VKVA 1NK3P 2IPQX 2JDIA 3AVUA 5JI6A 5LFAA 2GAUA 3RIQA 5A2QK 4RDLA 2PMDA 3MQ0A 1TVCA 4RCZA 4PCQA 1O8FA 1DBGA 1ZYRF 5L3DA 4L5EA 3O2PE 1J7KA 4B43A 1WOOA 3A8KA 3CUQC 3PUNA 2DMPA 2K7LA 2VQGA 2DA3A 4V2FA 2M0MA 2KMUA 3K4CA 3BTJA 1TWCJ 4ON0A 1QQIA 2P0WA 4F92B 5EZHA 3FM3A 2ZJ2A 3DFGA 4EGYA 1B8IB 3S2DJ 3DTEA 3EQNA 3F8FA 5GTHC 2L4MA 3HTUA 2KIUA 2MYSA 2W57A 2OYNA 4S04A 4RB1A 2IGNA 4B47A 3PIPF 2Z33A 2DCUA 2CV2A 3Q6QA 4LIVA 1O8KA 5IOYA 4XOPA 2DCEA 1U5TA 2GQQA 4ZYHA 2NOJB 4TN1A 2WPDA 3JU4A 3GFMA 1G8XA 1E63A 3GO5A 3ZQHA 2R92J 1A5JA 1RZ4A 2WY7Q 3PFYA 4EQQA 5IYPA 1KMHA 3WU1B 1YJ9B 5A89A 3WWGA 4Y3OA 1DABA 4P22A 5IYNA 5GP9A 3M07A 2IGMA 4LB6B 4C3IJ 2QEXI 1EFCA 1JKQC 1ZELA 1BOBA 4ENKA 4PC1A 4EM2A 3RQ4A 2NS8A 4D7MA 2JSCA 2VASA 3LQRA 2NSPA 5DTDA 3LQQA 3AGPA 3ONYA 4XRFA 2HVSA 3CD6I 1M1EB 2H1KA 1XB2A 2VJ5A 1SD6A 3QYEA 3KEWA 3V76A 2CV0A 1QUFA 2Y9YA 3VFZA 2R6HA 2XGCA 3J81Z 1JA1A 4M2LA 4UZEA 2V31A 4N4NB 5F4MA 1HG8A 4D7NA 2VFMA 4LG3A 2XC1A 3OL3A 3X2QH 4BQNA 1U6GA 4ZCIA 4M53A 2A6EF 5EDNA 2CMPA 3VMFA 2V6EA 1FNNA 2STTA 3PJRA 2ACJA 1FBSA 3EUAA 1LPQA 1UMKA 2XT2A 1YS6A 3DBLB 2ZCWA 2K27A 2EJRA 1RPWA 3E6BA 4ZGQB 2LF8A 5KW9A 3CCSB 2KT0A 4RD2A 4UB6C 3OL4A 3TP3A 1EFUA 3TMOA 4HAMA 1F20A 1R58A 4NK6A 4HOBA 2HGCA 1WGXA 2IQ7A 3R60A 1TZLA 2IA0A 2IA1A 2LBFA 5D4RA 3RQIA 3CO7C 1BL0A 4XBFA 5FKKA 1W5CC 2R4GA 5FJ8J 3GTGJ 3M7GA 3JRBA 1NDHA 2AQEA 2VT3A 4P9FA 1H8HA 2O0YA 1G2HA 4A3FJ 1OFDA 4B3AA 3KP2A 4HE6A 4ZV4A 5FA6A 1Y0UA 1YFHA 3COAC 1S7EA 3ML6A 4LK1F 3QAHA 3S8PA 4DQKA 5L3EA 2F5VA 1Z91A 2LKPA 1Q81D 2DOEA 2KDOA 3LSMA 4A93J 1R5OA 1ETKA 1GR1A 1MJBA 5AIQA 2FF4A 2NS0A 2ZJPF 1HA3A 2M3AA 2FXAA 1DUXC 2QA4B 2G7UA 2NPFA 4IVNA 1BOAA 5M5WJ 3BR0A 3ML3A 5IY5H 4XM3A 2AHOA 2Z9OA 1BN8A 2XGXA 3W2HA 3OW2B 1WSRA 2ZBVA 4M3EA 2J5PA 1H42A 3VSUA 1SAXA 2QYOA 4NC7A 1SKYB 1Y1VJ 1UZCA 4HV5A 5GPAA 4YELA 4E7ZA 2MSYA 1O3SA 2M5WA 1BW5A 2JN9A 5JHUA 2ZL7A 3JTHA 1EF4A 3F23A 1QGZA 4XKCA 4YHBA 3K2ZA 3GQAA 4CYDA 4XSXF 5KNLA 3VO1A 3BOQA 1ZK8A 1X0CA 4QPQA 5EJCA 3DKYA 1QGYA 1VQOI 4Y13A 2ZO4A 2Z8GA 2CFXA 2P7CB 2FSWA 1JJ8C 5FLVA 3MEXA 3CLQA 4G6IA 5K5OA 3OPOA 1JRGA 4E6KG 3CP2A 5IT3A 1JJ6C 2WR8A 2Z2SB 1QVFB 3MN2A 3LSGA 3RY8A 1IV8A 1VQ6I 3DEWA 5D6FA 2DK8A 1FBQA 2MW8A 5HOOA 2XC7A 2J5OA 2OUMA 1G7RA 2XAGA 3A02A 4WXCA 1VQ8I 4BBSJ 1WSVA 2OTLB 3AG3H 2BY1A 2R7FA 4TV7A 4XN0A 5J3LA 3VOEA 4QTRA 3BTCA 5FD5A 4PAAA 2QZAA 3WTSC 1I1SA 1XFOA 4NB5A 1ULYA 3H3VK 4OJPA 1MH3A 1SMTA 3C7JA 3EUHC 5F64A 3PO3J 2LY9A 4UXNA 3OS1A 1XDUA 2LREA 3DLLF 5LRRA 3SFZA 1WJBA 2RN7A 1VZ0A 3G6EB 2CSOA 2CUEA 2Z16A 3HHGA 2QTLA 2K86A 1VQ8B 3IAS2 3CCRI 4HQEA 1YIJB 4G8XA 1ETQA 1F9NA 3ZN0A 1SM4A 3KL9A 1PUFA 2FJ1A 3L2QA 2CS3A 1SFKA 3BTLA 1U2RA 2O17A 3CTAA 4KIGA 3DCFA 1IV6A 5AMVA 1T2KA 2XF5A 3OIPA 4RB3C 2EFGA 2M0CA 1HQCA 3CDIA 1CF7B 1W4MA 4HF2A 3E5XA 4JP0A 4X6AJ 4HLYA 3CDLA 3OZUA 1C0WA 2LFBA 4IL6C 4KUMA 5JLWA 3CCRB 2BXYA 5BQTA 3ABKH 2DA1A 1K4TA 2WZPP 2XVCA 3NRVA 4RGXA 3WHBA 5DM6F 2LKXA 5GAHJ 4MO7A 4KA4A 5C1CA 4OIQF 3V4GA 1TP4A 1FYMA 2D3LA 5FO1A 4XLFA 4BEHA 4WZTA 5HKKA 4I09A 4H4KC 2QSHX 4L9VA 3WBJA 1X3ZB 5K5QA 2DIEA 4PC7A 1WJDA 2EZHA 3GLXA 4TMVA 2K9NA 1HC8A 4DNRB 2WA0A 1ERDA 5HLGA 2XRNA 5HDKA 3QSYA 4YFXF 1MBGA 2LR8A 2J8IA 3ZPPA 3DTKA 1X1CA 3PQJA 2XROA 4LC0A 2ZMEC 3CZ6A 4N9HA 1NG6A 3EYYA 5LMZA 1KTWA 5F6FA 4UB8C 1T8IA 4KMUX 3MZ8A 4JQFA 3BR6A 1OYYA 3VYRB 4M6XA 3CUOA 2EB7A 1W0KA 1YI2I 2VKHA 3KZZA 2E5NA 1IAWA 1PP7U 4PJMA 2ESHA 4EM1A 1JE8A 2F1MA 2PLFA 2LRDA 2F4IA 4BS9A 4W97A 2J8KA 3K4JA 1WOPA 1HW1A 3HIFA 1ZM2A 2HKOA 1R00A 5BSXA 1BMFA 1VQ4B 2OZUA 1YHQI 4MGRA 1OR7A 2ECCA 4XRSA 4M71A 1OGIA 2HOEA 3BZ6A 3OEEA 3K4LA 1E17A 1YOVB 4BY1J 2FMLA 3LNQA 1BQEA 2OV7A 3PSFA 3LA3A 1H9GA 1YQAA 1QCXA 4EJUA 1RR8C 2PJPA 2AXTC 2BN4A 2MH9A 2NOGA 2GM4A 3V7AA 2MC4A 5F1RA 4S05A 5E6TA 4UZFA 3DLAA 1OHHA 2VLAA 2NSTA 3Q9SA 3D5LA 3G2BA 5KAFC 5F1JA 2Q6OA 1X2NA 1BLIA 1MGTA 1DG1G 3AVWA 1IN5A 3E1SA 4LLLA 3ZGKA 5KK1A 4B3XA 2BVMA 3HL2A 3ERED 4KISA 2H6BA 1XQBA 4X8IA 3VYUB 2YUHA 1IJEA 3FM5A 3LMWA 4G6DA 4K1XA 5J8CA 4FE4A 2RV8A 4MR0A 2DA4A 5E18F 2LY2A 1K78A 1T0FA 1QG0A 4A3KJ 1YLOA 2JVGA 4Q4ZF 3HOWJ 2DT7B 4RGRA 1ZHFA 1Y0RA 1NHAA 1GT0C 3FPKA 3QODA 3CCLB 2QCOA 4M3DA 1R5ID 3I4PA 4JK1X 4UV9A 1SAUA 4RMNA 1Q82D 2LG4A 2X48A 5EGOA 2HPMA 3GFIA 3A35A 3A3GA 2ID6A 3T56B 4ENNA 2MLKA 2P4WA 2OBSA 3ZOBA 4Y7CA 5F04A 4LLNA 4CA0A 3LSIA 5IOZA 4EVIA 4AIKA 5TR9A 1FX0A 4NC8A 4WXHA 3BP8A 3BR3A 2DBBA 3C2BA 1V0EA 4L0YB 4X7DA 2ISYA 2X4HA 2CRVA 3HG9A 5HDNA 3MD2A 1SC7A 3WG7H 3CCEB 1NB0A 1QA2A 3GZNB 3LSKA 4X1EA 1JUPA 2ZNYA 3ZMVA 2NT9A 3DQVC 4R71A 1CQTA 1K78B 2ID3A 3E20A 3BQYA 1T56A 1QFZA 2JA6J 2YWEA 4KN4X 4YZAA 1FOWA 1FTZA 1HKSA 5H2FC 4FK8A 3ABLH 1F60A 2ZMEB 2XGJA 3FXQA 1HSTA 1PJRA 3VNUA 2IS1A 2OZ6A 1ON1A 5ICCA 4ANJA 4Q5SF 2OQRA 2HXOA 2VZLA 2O3FA 4KN7X 1VTNC 4DK0A 1WDTA 1X2MA 3GQ7A 1JXSA 4F7ZA 3ZMUA 4ZZLA 1BJZA 3QPLA 1DPUA 4U7BA 3CJQB 2NS7A 1RIOH 1TQMA 5J8FA 4DBQA 2L4AA 3AG2H 4U7DA 3CMEI 4NQWA 1PXZA 4A3CJ 1TLLA 2PI0A 3GTKJ 2WZNA 2BW3A 5L3CA 3P9KA 1UD8A 5F27A 3VEPA 1GDTA 2V5IA 1FYLA 4H0EA 2EZLA 3HZJA 4HQMA 2KP6A 3HJEA 3V8JA 3E3VA 3ASOH 3LSHA 2DFHA 1HCRA 1YJNB 2DAOA 4D0PA 4KNYA 1R1VA 2EV0A 3PUFA 1SFEA 2QQ8A 4IKFA 2Q6LA 3I55B 1BPLA 3W6VA 2EIKH 4IHXA 2DEUA 3S1NJ 2VOPA 1G3YA 1P4MA 4P25A 3K4BA 5C4JJ 2R7WA 4EM0B 2PMZA 2NVQJ 2JPBA 1XMKA 4EGZA 5IP6A 1SD7A 1O88A 1H88C 1APLC 3Q3AA 1QU3A 4HDVA 5DDGA 4G7XA 1V4RA 1B1BA 5E1XA 3S15J 4F93B 1IF1A 2KRFA 1LM1A 2FA5A 3FBNB 3NWSA 2WBMA 1KQ8A 2DA7A 3GVJA 3KLOA 4XR6A 4YALA 3VPRA 3PNTA 1YIJI 2O04A 3M8JA 3H35A 1MBKA 1Y56A 4NBQA 1WZ2A 4N9IA 2HVQA 2DA6A 3DU6A 2XAHA 2JA5J 4J0QA 2Q6IA 3OYIA 2FEZA 3OSFA 1MNMC 1R22A 4A12A 1MDMA 2VNJA 4KITB 1BJAA 2FBKA 3TDUC 1XMAA 3HOVJ 4Z4RA 1M1KD 3BR2A 1IN7A 1T08B 1KGSA 3L7WA 1Q9SA 1BC8C 2WB1N 2R5YB 1TWHJ 2IT0A 2A3SA 4M6VA 3G3ZA 2GIZA 4ZC3A 3LO8A 3R4KA 4Y33A 1YITB 3S93A 2ME0A 1DDIA 5D6EA 1V3FA 4UVAA 4L0ZB 2L9RA 3AG1H 3OYKA 4I02A 3JAMZ 2KIMA 1Z7LA 4LOCA 5B6IA 1VQKB 2X85A 1T6YA 4EV0A 5BOXA 2OBPA 1BM9A 2NXNB 1D2EA 1UG2A 1TYXA 2Y30A 2E1OA 4HX8A 2PEXA 1Y0YA 4OJ5A 2QGUA 4M3FA 1Q7YD 4BDYA 4YIIA 3ABTA 3AFHA 2ECBA 2EFPA 1EH6A 3I58A 2VE9A 1D3YA 4BL0B 2JJ2A 4UUTA 2FU4A 4G9YA 4QV2A 2X1CA 1NG7A 5LHIA 3JRAA 4XKVA 2KLOA 4PJLA 1EV7A 3WTZA 4AM3A 2BM0A 5C44J 3IUOA 4G12A 3I4MJ 1WCMJ 5HS9A 5IYWA 1YTYA 1K4SA 3CXCB 5J6XA 2FQ3A 2JZYA 2GXBA 2XB0X 2XKPA 3SJPA 1SVOA 2Y69H 4F52A 2HYFA 1LE8B 2QENA 2R5YA 5GV8A 3OYMA 4A3MJ 1CGPA 1FLIA 2JA7J 1VJSA 2INUA 2V7VA 3ULQB 1IRGA 4N0BA 1W0UA 3OKXA 3IL2A 2M7AA 3T5XA 5LGNA 3E6CC 4AF7A 1A36A 5KAIC 1O7LA 4CCJA 4M9ZA 4YG2F 4QVAA 4L8JA 5J3OA 2YPRA 5IYCJ 2YWFA 3OY9A 4B3FX 3Q3SA 4PJJA 2QE7A 2UZKA 3T53B 2LF7A 3BY1A 3WYAA 2CF4A 3OYEA 4ZTFA 2XTXA 1E3PA 4C2MJ 1PDNC 2JA8J 1R5BA 3OJXA 2E1MC 1ITYA 4C0SA 1GV2A 1S0UA 1ZREA 3HOZJ 3RCOA 3IP4B 1U9OA 2L01A 1BHEA 2DK5A 2VT2A 2M4GA 2QY1A 5C3EJ 3J81K 4XD7A 3L00A 3PUBA 1OB2A 4YIFA 5JHFA 4Y9UA 4KJZA 4MIMA 1IG7A 5BPDA 5J40A 2EQRA 4KDPA 2PMZN 1KQ0A 2F3LA 3I4NJ 4GCVA 2L7ZA 1AHDP 2LDUA 2ZFWA 1QA1A 1PUFB 2E36A 1RWRA 4I84A 5EG0B 4HDUA 2RC5A 2X6WA 2LP0A 3H9QA 4JX6A 2DTRA 1R7JA 3QFCA 4OPWA 2GPJA 3P26A 3FY3A 5CLSA 4M9SA 1HW5A 1JTYA 3RDIA 3ZQ7A 1BN5A 4YFKF 2YX4A 2EWNA 2QLZA 5M5XJ 1F5TA 1EXMA 3GTMJ 3BH7B 2R5ZB 4OPSA 3F6VA 3H0DA 2BX6A 4C2UA 2NRAC 4X7CA 4W1UA 3J7YJ 3N97A 5BMZA 3VSLA 1U3EM 3GFLA 4RM0A 4D1QA 4F91B 1UMQA 3PQKA 4RD6A 5J1RA 3GEZA 2PQ8A 2ZXIA 2HQ5A 4FISA 1QRCA 4RBOA 2ELKA 1PYVA 1VF7A 4AF6A 4XORA 3WU0A 3HAGA 4IF4A 3T9GA 1F4KA 1Z6TA 2YU3A 4ABZA 5E17F 1E1QA 2GQFA 3J80K 3ELKA 3OV8A 5E3NA 3OS2A 3HGYA 3ZIAA 2ETHA 4NCNA 1WJFA 1ZH5A 2YUSA 3D0SA 3ZR8X 1AKHA 4EEFG 1Y1WJ 1VHEA 1HOMA 4NC6A 1O3RA 1YW7A 1H8EA 2VFPA 2F48A 1N07A 3CPWB 2F43A 1Z67A 1YRNA 4BQOA 4IW3B 3W5UA 3H09A 4N4OB 3B82A 4QHYA 4EATA 4IPAA 2JUGA 1OCRH 2M45A 3U21A 4D5FA 2IBDA 2GLOA 1AIRA 2VFNA 2E1CA 2CW5A 3GTQJ 1B8IA 3P27A 2VNHA 3OJWA 2DTZA 1X1BA 2NAZA 2Z1DA 4Y4RA 3PETA 3W6JB 1XTAA 3TW7A 3O8HA 1SVMA 2ZFUA 3C2GA 3QPSA 4R8HA 3Q38A 2W00A 4W8TA 3VR6A 3JRIA 4AD9A 2V9PA 2L9VA 1S29A 2QX3A 2C6YA 3GIRA 4G6TB 2E7XA 3FKIJ 4RD1A 5E8GA 2O03A 4A6DA 5EYRA 4OP7A 4RLZA 4P3YA 3ZRGA 2AO9A 2CW0F 4FT8A 3HB9A 3CCMB 4I2OA 3WGGA 4YIRX 2O8XA 2QZ8A 1MMGA 3MVPA 1OCTC 4AIJA 2QMUA 2A6TA 1N0VC 4XSZF 1F43A 5D4SA 2R7ZJ 2V1XA 4KIFA 3QWLA 3QP5A 3U1KA 2CV1A 3HRUA 2NNYA 2DODA 2ZXJA 3IV5A 4P1WA 4ZYAA 3JX8A 1Z6RA 2HNHA 5HS7A 3SY2A 4MHGA 3R0AA 4BBRJ 2VBTA 3WXMA 2CWEA 3W3CA 2W82A 2EIMH 1ZRFA 1VQNB 4CQJA 1KU2A 2HKXA 2PIAA 1FY7A 2XT4A 3H9GA 3VODA 3E0JB 4HF0A 2DPUA 1YX2A 1E62A 1USSA 2M8EA 1LVKA 4C2TA 3K1PA 4BHPA 1LB2A 3KZYA 1USTA 2V1DA 1RQPA 1TBXA 2HWVA 1LEBA 4CSWA 1I5ZA 2Z5UA 2WAEA 2E35A 1JKOC 2CNDA 1ORKA 1JGSA 3F3XA 3N05A 3G05A 3B8YA 4PK4A 5FFXA 4YZXA 2JJ1A 2RGVA 3Q0WA 2WV0A 1WJEA 1SD4A 4BUPA 3CC7B 2JA2A 1FX7A 3BR1A 1Z9CA 3MKLA 2GJKA 1E1RA 2BYVE 4DQLA 4GXOA 1V54H 3Q39A 2E60A 5E1ZB 4AWXB 1P92A 3LA7A 3TQNA 3HHHA 4DGWB 3OYDA 2X3HA 2VXDA 5F0FA 2BEOA 4HA8A 4ENMA 4CICA 2DI3A 1I27A 1K6OA 1WU8A 1WI3A 3KRGA 5KHDA 3CD6B 2O7OA 2AQFA 3FHZA 4NHJA 2D9RA 2CRGA 2QUFA 3P4GA 3WY9A 3KFWX 2D3NA 2IVMA 4XKBA 3OSGA 3GF2A 4TT3A 3SYJA 5LEJA 1K9MD 1E2XA 1QPIA 2HS5A 3EETA 2KPMA 4RDJA 2FNAA 2DT6A 2R3SA 3CMAB 4YRVA 2ZJRF 1QRYA 3S14J 3FDYA 1R9TJ 4BAYA 2XSJC 1U5TC 4L9TA 4N3NA 5LLQA 3OW7A 2RDPA 3K70D 3E5QA 1VQPB 4MLOA 1F1ZA 1HF2A 1S3JA 2ZBUA 4NQWB 1X19A 2Y9ZA 3CCYA 3OOUA 3NWTA 2V7WA 4PFPA 1R23A 2OC6A 2A69F 4RLFA 5LGUA 1J0RA 1W5TA 2IGOA 1OCZH 4OIRF 1ZRCA 1T6ZA 2A05A 3W2IA 2QGGA 5FGMA 3DKWA 4Z4TA 1FEXA 5JFRA 2VPLA 1N8RD 5DCFA 3ZSCA 1K6YA 2FOKA 3WGHA 3LVBA 3K4NA 4A0YA 1B23P 2HZDA 4RDUA 3HUGB 3BZCA 4F3QA 3W2FA 3QOEA 1OGJA 2K3FA 2LMDA 1ZM4A 5B5EC 1FC3A 1YIOA 3DU5A 1QX4A 1LEAA 2RQPA 1D8TA 4M74A 4DNTB 2NTBA 5B66C 2XB5A 1N08A 3MZYA 2VI6A 1VQPI 4GYGA 1ODDA 1VQ7I 3UW0A 1D8JA 1Y8QB 4YZQA 3CO6C 4RGUA 4ZDLA 1KJZA 4QUZA 2CW8A 2FOWA 1SFXA 3C1DA 2O61A 3MMPA 2ZZFA 1K79A 3B8HA 2XTWA 2P6TA 1VQKI 3BG5A 2E1RA 4IEJA 1KK1A 4HIZA 2BM4A 3Q0VA 1IN8A 1VQ9B 2Y0SN 2RQQA 2RVCA 3ONQA 5FO5A 1I18A 3OOPA 5DCMA 2NVXJ 3GTJJ 1T5EA 3QYBA 1OGMX 1HDPA 1U2WA 4IXAA 5EEAA 1OMIA 2GJRA 3HDDA 3J7ZI 3Q6RA 2D1HA 4FCYA 2Y48A 2IEKA 2JJ7A 1DP3A 3BQZA 5HVQC 4CDGA 1VQ6B 3I55I 3M4OJ 1GUUA 2VNKA 3WHCA 2PJRA 4I98B 5D5UB 3S2WA 1LKXA 2GOXB 5LEKA 3ES9A 4EMSA 1U78A 4L18B 1LNWA 1OQYA 1D0ZA 1ZLJA 1D5VA 1FSHA 4G7WA 3CCJB 1S4MA 2WY8Q 1UG0A 2EZKA 2M4KA 4QWQA 1JI8A 3ERMA 2DA2A 1WFXA 2MD5A 3G1OA 4ZCLA 1K8FA 2BM7A 2X1DA 3TKYA 3WTVC 4XONA 1S7AA 3RSNA 2C5HA 2HCJB 4CYCA 4I01A 5H20A 2J7KA 4M72A 2HTSA 1N78A 3JRFA 3PSSA 2MLGA 1ZG1A 4F55A 1BA5A 3QFTA 1GVDA 1MBFA 1LVAA 2HQNA 3IH2A 1X1AA 3M1CA 5HODA 3FWEA 5DD8A 1XX5A 3S32A 1XSXA 1HW2A 3HRTA 4RPDA 3P9IA 1IXRC 3HPGA 3VO2A 3DKXA 5HZBA 2XPWA 3BC9A 3TW6A 1IXSB 3B6AA 2PBIA 4DZPA 2XGEA 3OAAA 2E2IJ 1U9NA 2PJRB 2ZL5A 1OCOH 1WH5A 2O0VA 3L2UA 2AHQA 3SLDA 2YR2A 3Q0UA 1FYKA 2DT5A 1BC7C 2PG4A 2X6YA 5FFZA 2NVTJ 1V5FA 3LL7A 1YJWI 4G1BA 2E34A 3GZ6A 1D1BA 3RZOJ 4HEA2 4XKWA 1EA0A 4Y9RA 1YS7A 1MW7A 2W84A 2YS9A 3KE2A 1IN6A 3GZ5A 1KK3A 3GQBA 1ONVA 5FO0A 1G7TA 5GPCA 3CESA 1ZG5A 3ZQLA 3TGNA 2QEXB 5F4OA 2R9VA 2HQRA 4M9XA 2L9NA 2C2WA 4BJ6C 2VN2A 3D5SC 2F5CA 2GOMA 5FD6A 3S1QJ 4RS8A 1Y6IA 2D1VA 2QQAA 2KFDA 4UHTA 2FNPA 5ILVA 5ED4A 3AL0C 2P3MA 2IJLA 4Z1MA 3DPUA 1QNTA 2VBSA 5FKNA 3S2HJ 3H36A 3H94A 2O0WA 2UWMA 3Q9VA 5FRNA 3BZKA 3CCEI 4G7HF 3UR3C 4R1HA 3D26A 1PVEA 2A6HF 3LFKA 2PMUA 2RKHA 3LSPA 3KP7A 2Z99A 2XAJA 5JLXA 5IP9J 1JKPC 2VODA 1RMGA 3ZQCA 3CUQB 3VSTA 1JKRC 1DARA 2COBA 4Z4VA 2EA2A 3FK6A 1P9QC 4BXXJ 2IA2A 1BJKA 5FRMA 4OZYA 4Z03A 3OOCA 2MH2A 2R5ZA 1SANA 3B90A 3JRGA 1QBJA 1X3UA 3WNDA 3JSPA 3PNVA 2DMUA 1FRQA 3BJOA 1O7FA 4Y15A 2HU9A 3WG9A 1HF0A 4DNCA 1O8MA 4A3GJ 1IB0A 4RA2A 2HEOA 4P5OA 3S3MA 2O5RA 4G7OF 1J9IA 1YX3A 3T8TA 2XNJA 5ILUA 3A4CA 1TTTA 1RQRA 1W2BB 1REPC 1WHUA 2PN6A 4YZ0A 3TO6A 1QQ1A 1DQUA 4M3GA 1AOYA 2FVGA 3TO7A 1Z21A 3SFIA 3CDHA 2XTYA 3IAM2 5HLTA 1VFCA 2IS4A 4JX5A 3OYHA 2I5UA 3CUQA 4Y52J 1K4ZA 4OOVA 3GTPJ 4NBSA 1IUFA 1MBEA 4HPQA 2C77A 1TL8A 1A6QA 4LK0F 5J4YA 3IKTA 4PABA 1TSPA 2UVEA 3IH3A 2NT6A 2CG4A 3U9GA 5BSYA 4LG0B 2NVYJ 2JWTA 1XG1A 1BR4A 1XGMA 1TT0A 1XPXA 1KU7A 1SKQA 5F4JA 1CZFA 5DUKA 4UY8I 5EZGA 5DM7F 3G71B 1XE1A 2OTJB 3RTRA 4K2EA 2WTEA 1G7CA 2GZWA 4CCKA 1W1WE 5B1AH 3JW4A 3K1NA 1YW9A 3A01A 2C78A 1IJFA 3WTTC 3NB2A 3L2RA 1NBMA 1TWGJ 3I71A 4GFBA 3ZMDA 3CW2A 2VJIA 2ZB9A 4ESFA 4XK4A 2WAFA 1ETOA 1MBJA 4UV8A 5E3OA 4U88A 5CPRB 3BJAA 3ZMZA 4XICA 4UVBA 4PGHA 1OB5A 1VQLB 1B72B 1JTAA 2FX3A 2BW3B 2UXXA 2B7BA 1T95A 3ZN1A 1HLVA 1W5SA 4LD5A 4XL9A 3P5JA 2K4JA 3EYIA 2KRCA 1IRXA 3MWMA 1SMYF 3P9CA 4O5VA 1FNBA 4J19A 4DJAA 4MQVA 3OYNA 2VE8A 2AXLA 4UUVA 3JSOA 3K7AJ 3FJOA 2M5SA 5DS0A 2E1BA 1WXRA 2Y2ZA 3BC8A 3E97A 1I7PA 5CQEA 3FKSA 5E20A 1FIPA 3W2VA 3CMEB 1ON2A 1F36A 4PC3A 2W4SA 4YFNF 2O6GE 3TEDA 3CP8A 4MEXF 1UD3A 4WQMA 2ZZEA 1NB9A 3SKBA 2C4TA 3CC4B 2MFZA 4OINF 1W0JA 3B02A 4E7KA 4BKXA 2XOKA 2A68F 3IWZA 3GQ8A 4P96A 3GQ9A 2E19A 3KZIC 4ZGNB 2VQCA 4BQQA 4XRMA 1QZYA 3E6MA 3VYSB 1VQ5B 3CMYA 3I0TA 4IRGA 3J7AO 1YE9A 3BR5A 3RPUD 4QFMA 5KVRA 3I5UA 3WTYC 1X3WB 1HBXG 1QZZA 1MD0A 1QUEA 2P8TA 2X6OA 3CMMA 4HNVA 3ECOA 3HM5A 4HSRA 2RNJA 5M3MJ 1DU0A 3E1YE 3KEYA 3V7CA 5BS6A 1ZG3A 2JK3A 5H59A 1L3LA 4ZYDA 1IDYA 2V7FA 1VQLI 3H5NA 3BPXA 1KD1D 1HA8A 4OU0A 2K9LA 3U2RA 2CQKA 3NAUA 4CO8A 4V02C 3DDYA 2L9SA 3SQVA 5CVIA 1YO5C 3PA1A 1U0JA 3BG7A 4XLEA 4Z4UA 1Z77A 2ADUA 1FPQA 2VBEA 3ABMH 5LRSA 4WK8F 3BCAA 3BROA 4A2UA 4ASNA 3PSIA 1FZPB 3QP6A 3RKYA 3BCFA 1R5GA 5FB2A 1EWYA 3QPTA 2VQHA 5FL7A 3F8CA 2EIXA 5DV5A 1ZGWA 4JRAC 1QGAA 1QHHD 4W8QA 1FNCA 3IC7A 4U0VA 4BJ5C 2A07F 1GO2A 3AGQA 2CO5A 4G7ZF 1FMVA 1IO2A 1BR2A 2WAQA 2CQNA 3E5UA 5HLIA 2K3PA 2DFEA 2HR3A 3B73A 2TCTA 4L5IA 1TNTA 2KRHA 3S1RJ 5LHHA 2KL4A 2KVOA 4ASUA 2QSFX 2DDAA 3ZBUA 2QF7A 2LLKA 3JQPA 1XD7A 2BGCA 4HV6A 3HRSA 3ZQGA 4P1VA 4PJ0C 5C1EA 5L46A 2BE5F 1OFEA 3I64A 1W34A 1O8IA 1X1DA 5E1WA 3OZVA 1AMOA 3KP5A 1BBYA 1T98A 4CHUA 2UXNA 4YC5A 1B59A 5CDFA 1EA3A 2RC4A 1NJID 3DEUA 3HSFA 3HUGA 5TV2A 2V26A 1QVTA 3A0BC 3QFSA 4MTEA 2HDWA 2GWRA 2VBUA 1H85A 3ZXSA 3OS0A 3OYGA 3HTSB 4QVJA 3H5AA 1TYUA 4E7SA 4Z4SA 4OJLA 4BXUA 3PIOF 2QN6A 4E4HA 4IZZA 1I6XA 1Y39A 1YJWB 3WE2A 2D2WA 3FPPA 2K85A 3KLNA 4ZDOA 4MYUA 2H6CA 2XKOA 2FMYA 4BDZA 1FJLA 1W7PD 3KP3A 3FMSA 4RDKA 5IYBJ 4IO9F 4B4DA 1UCRA 3MAJA 3SZPA 4MFEA 1G7SA 3WBKA 4ZYGA 5JMCB 1WKMA 2K5CA 2LY1A 2PE3A 1MSFC 2H8WA 2B0RA 1E0EA 2F5DA 1UB9A 4UZUA 1X58A 2M9HA 3GUDA 1GVHA 3S16J 2LYCA 3EQLF 2QTZA 4XMYA 4BGDA 3MCAA 5FLXZ 4B8XA 1MSEC 3TBIA 1O8LA 2GA2A 3S3NA 2VUMJ 3GTOJ 2M7BA 2Q2EA 3ASNH 1OFCX 5DCMB 2XASA 2XUBA 5D5XB 3GYHX 3GVKA 4IX7A 3OIOA 3H9JA 4A3LJ 2OD5A 1NHCA 4OAYA 3S1MJ 1FOYA 4Q47A 3BCBA 1KONA 1GLNA 5CVRA 2VJ4A 3ZZUA 5DEQA 4QLCU 1GQ8A 4X7EA 4BHCA 2XHKA 1I1GA 1JGGA 2C5BA 4LBVA 2VIXA 3FZVA 5J1YA 1ZR2A 1PJ5A 3MMYB 1GV5A 2BVNA 1GXQA 1MMAA 1XSVA 4I6ZA 5TRDA 3ZPLA 4PDKA 2BSPA 2R7OA 2EFWA 2BV6A 2QKLB 1OKRA 5L3BA 1R71A 4YFOA 4HZFA 2ZTNA 4B44A 3F9KA 1IRFA 3DXJF 2LBFB 1QGPA 4M3BA 4A3JJ 1XCVA 3KP6A 4HWVA 2V9KA 2FBHA 1AKHB 3V8KA 2W6JA 2Y0SA 3OYFA 3K70C 1WTHD 2Q2EB 3LWFA 4JOMA 4ACAA 1PKVA 3RKXA 2XZOA 5E79C 2VC0A 3HOYJ 2EILH 1TYVA 4RD0A 4LLGF 1T33A 3KCCA 4ESJA 2BPOA 4FASD 2DW4A 2BM1A 3H3UA 1D0XA 1L0OC 3FX3A 1DGWY 1WJAA 3V7SA 3TDZC 3R6JA 3GFJA 3K69A 2K40A 4KH3A 2BY0A 3F6OA 4J01A 1KK0A 5GV7A 1ETVA 2DQRA 4BE1A 1EP1B 5J1UA 4P6VF 3BH4A 2DOAA 1H8AC 5HLHA 1PJ6A 4LMYA 3SEJA 5ICEA 3FXLA 4J00A 3JRDA 4OMZA 3CC2I 1YJ9I 2KIFA 4AU7A 4BEHB 1FBUA 2XF7A 3WTXC 4EJTA 1BR1A 3GX4X 1N06A 2MC3A 1J59A 5C4XJ 2GREA 4EJOA 2L5QA 3F21A 1W36D 5BNGA 3OEHA 2P5VA 3HPHA 4LJZF 1B6AA 2CUFA 2Q8KA 2R7QA 2BGIA 2QXZA 5K7HA 1VQMI 1W9XA 2HDCA 1RUOA 3PA2A 4DYQA 2DJIA 4XLPF 2VBYA 1TUIA 4OOSA 4X06A 2XZLA 3V8LA 1ZN2A 1A6IA 2YWGA 4AYBN 1PE9A 5H6RA 1IGNA 1LJ9A 3J81k 2TDXA 3CCVI 4M0LA 4GO1A 3DWLE 4CGZA 1O3QA 3ZC3A 4ENJA 2RC6A 1UHSA 2XAUA 3WTUC 5CQGA 2XDVA 2L54A 3VYTB 5DD4A 3R6SA 1E43A 3LNNA 3CCUB 2PX9A 3SDBA 3S3OA 2ZL6A 2K9SA 1B9MA 2L3DA 1MNEA 1BW6A 2DA5A 2Y75A 2OJED 1LFBA 3TP0A 2VBKA 3LSJA 4RAGA 3VDXA 1T38A 1VQ5I 2ZZQA 1TQIA 2HTJA 3G1LA 1TW3A 2DLLA 2CUZA 2W85A 1V5EA 2Y0MA 5AIPA 2E2JJ 3BT9A 5FROA 3CJRB 3W2WA 4XLHA 1JA0A 2LSOA 1Y0NA 3ISPA 4JMQA 1RI7A 2JN6A 1HXDA 3SYTA 3CCUI 3HBLA 3ASQA 4BYYA 3OP1A 2DDBA 5D8KB 3BG6A 2RREA 5FIUA 1VI0A 1WRJA 2P81A 4KIBA 2BBYA 1W36C 4B3GA 1OR7C 2ZJQF 1HZEA 2QDXA 3FHNA 4G94A 3AG4H 2HOSA 1O8EA 4NK8A 2KQRA 3NARA 3AK5A 2DOFA 2NVUB 2DJNA 1EE6A 4C3JJ 1RESA 4BACA 2DO7A 5K7FA 3CLOA 3M1EA 2DPDA 3FIWA 3LSRA 3I3LA 3ONUA 2N8GA 1MMNA 2L7FP 4V2GA 3N90A 3CQZJ 3EQOA 1G6NA 5KSWB 1ZTRA 2BHZA 1W87A 1NTCA 4WXDA 4LBYA 2QKMB 4YCQA 3ROUA 4E7IA 3ZZTA 4C43A 3K9TA 1IB4A 2KZVA 3WTWC 4PZJA 4PC6A 4M6YA 1LDJA 1WJCA 4AVZA 3BNWA 4LBZA 2M34A 2OQGA 1OFLA 5K7ZA 2FBIA 2CC2A 4RAYA 4CZZA 3QPHA 1NK2P 3A01B 4IHYA 5E3LA 6PAXA 1P4WA 1WVRA 3NQOA 2CGPA 2OA4A 5A2QZ 3JQQA 3DF8A 1RKWA 2QVOA 2FD5A 3G6EI 2V7QA 3PO2J 2EA4A 1UHWA 4Y17A 2A61A 1OCCH 3A1YA 5B1BH 3HSRA 1YW8A 4TMXA 2XAFA 2IW5A 5F0CA 3E7LA 4OIPF 3JTGA 1FSEA 1OLTA 3DP7A 5J47A 1ZR4A 1TWFJ 1XC5A 3OYCA 4P9SA 2B7CA 3QU3A 1ETWA 5CYVA 2JSPA 3R6KA 2CQQA 1UELB 1X4PA 2QA4I 2R7XA 2O9LA 4XLCA 5ILSA 5ICFA 3QFRA 3W5VA 2QQ9A 1BIBA 4PSWA 4AIDA 2NTPA 3RZDJ 2ZTGA 3MFKA 3H3ZA 2B7EA 2LC2A 3GVLA 3HOXJ 4A3BJ 3FXKA 3DBRB 2CW7A 3H92A 1AU7A 2AS5F 3V42A 1GJRA 2EINH 1ENHA 3F22A 2VONA 1E3HA 4E70A 1FIAA 3RJPA 2ZXHA 4CZCA 4II2A 4FTHA 2F5FA 1IJWC 1E79A 4G1VA 1WP6A 1Q86D 3G4SI 3T0YA 3JQRA 1QRBA 3QQAA 2H8RA 3ABUA 5DSZA 1E3XA 3OYBA 4HF1A 3CPXA 2ZITA 1GAWA 4IJAA 2VBMA 4IHTA 4II3A 4M4SA 3CF5F 5FKLA 4YAFA 2WSSA 2P5LC 1N05A 3QOPA 3K1MA 3KYLA 4XN3A 2XNDA 4U49A 1IA5A 3RKQA 3BWGA 2R7SA 3LQEA 1ZGAA 2OK8A 4IQJA 2V7UA 1Z1DA 3W2GA 1OFMA 4BHBA 5A88A 2WAQN 4YEJA 1JUSA 1X1PA 3GXOA 3JREA 2JMWA 4QSHA 2Z6BD 2RAEA 4PJNA 4URRA 4DYRA 3N6ZA 3FXOA 4QIWN 2CJJA 4FQGA 3WQZA 3FKJA 3T1BA 3L2CA 4IOAF 1GAQA 1KYZA 1V5GA 2V4JC 1RNLA 4OOIA 2ESNA 4FN5A 4XLAA 4ESBA 1VLYA 2XF6A 2X0KA 4I76A 2GBYA 1LFUP 3A0HC 1VQ9I 4AC9A 4M73A 1IRZA 1BX1A 2JRMA 3WODF 5HS8A 1D0YA 4WZEA 4NDLA 2R93J 3T8RA 2FQ4A 3M8FA 1I8DA 3FXUA 1YI2B 3K2AA 4TSFA 3I59A 1NRKA 3GW2A 1MDMB 2B63J 4WCGA 3ASRA 3SXYA 2X8KA 4CYCB 1HDDC 1TQPA 3RKWA 2PMHA 1BIAA 1Z3XA 3CF2A 4DIQA 3LAPA 1RR7A 3TL4X 1O57A 5EGOB 1T6XA 2X1EA 4B09A 5CJ9A 3K4MA 1UD6A 5AONA 4AVPA 3I54A 1IUYA 1EFRA 2ZNZA 1ZLKA 4AYBA 5IK2A 1IXCA 4BNCA 1OJLA 1MRZA 2DYSH 1UAAA 3SEQA 3R61A 1P4AA 2MA3A 2HPIA 3BCDA 4U87A 3BG9A 2F2EA 2HOTA 1GXPA 1EP2B 4IRIA 1JTXA 4P26A 2OCCH 3UNGC 2M8GX 1QJVA 1PP8F 2XZPA 2IOUG 2YWHA 1KCDA 1D1AA 1KC8D 5JBQA 2IGKA 3JURA 1Z3YA 1S9HA 3I59B 3HSEA 2C4UA 3SZGA 3JR9A 3GSIA 4OAZA 1VQ4I 1SVLA 1ZAOA 4CCNA 3DEEA 3O3KA 3LJYA 2Q0OA 5F08A 1BI2A 4LB5A 4X7FA 2L02A 1Q1HA 4XNFA 4FX0A 1IN4A 5H6QA 3FMQA 4BXFA 1LE8A 2DYIA 1JJ2B 3IKVA 4HNTA 2OCEA 3SHFA 4X07A 5HDGA 2D45A 2CBXA 4PC2A 4JX4A 1LQ1A 2HMAA 4A0ZA 1G4DA 1S7OA 1S72I 2HVRA 3ASPA 1R5HA 2JIZA 2W48A 2VKDA 3ZQQA 1FWZA 3J7AY 3HXLA 2F4MB 2X9DA 2OPTA 2QBYB 1A04A 3GMEA 4CUGA 2K9MA 1OYWA 5K5RA 4JYKA 1QO0D 2PFBA 3ZCOA 1W35A 1O8GA 3HC7A 2VPRA 2DFIA 1S72B 1KQ9A 1I3QJ 4AC0A 5GADJ 4A3EJ 3I56B 3IRQA 2JT1A 3K6GA 4OJOA 1IZ1A 1I50J 1EJ9A 2WADA 4RAFA 3LYCA 2I10A 2O8KA 1B9NA 3B6CA 4LIUA 2DOGA 3AVTA 2DXIA 5J4VA 3NEUA 4XQFA 3CC2B 5H5JA 5JLVC 3QE2A 3MKWB 3I1FA 1MJAA 3FK7A 3S17J 3ZUGA 3KX2A 1DBOA 5ERIA 1I39A 1FMWA 2E7WA 4PGGA 5D8LB 2XIGA 1WH7A 4CCLA 4YAUA 1YG2A 1QA6A 5THXA 3W5HA 2ICWG 3HOUJ 3RYRA 2KHMA 1DDGA 3WU2C 1LLWA 4XOTA 1J5YA 2HLDA 2ZSHB 3T51B 3ZBTA 1K5CA 2OBRA 4TMZA 2WWYA 3DU1X 1XB4A 1YITI 3BTIA 4R79A 1SEUA 2VXZA 2F5EA 4BE0A 4FXUA 4Z4WA 4UAJA 4RM3A 1RUNA 3KETA 3K10A 4KFCA 1XDSA 4ETSA 2HXIA 1D8KA 1J09A 3SJMA 3G71I 2R7RA 3KYDB 2DMNA 2H1LA 1XGOA 2M1BA 4LITA 2JTVA 4WF2A 1E3OC 4Z06A 1W7PB 4IQ4A 4BH9A 4UNOA 3H0GJ 3I56I 4KT5C 4IHVA 2DFFA 3VWBA 2R7TA 3TO9A 1CLWA 4GGGA 3DV8A 4L5JA 2E5ZA 5B3SH 2BV3A 1MH4A 2R7DA 2X6XA 3KEQA 3UKGA 4HE5A 2M30A 1OOCA 2RNGA 1CQXA 1G59A 2LD5A 2W7NA 3G1MA 4YXWA 2L0KA 3NAWA 2ZKZA 1K83J 2VNIA 3MCZA 2W6IA 1O8DA 1QA3A 4PSXA 1AIPA 4LFUA 2BY2A 4C3HJ 2CYYA 4IOCF 4D5CA 2D5VA 2FE3A 1ZM3A 4D9JA 5LBQA 3CCSI 1EZGA 3DPTA 3RPQA 2QM3A 3HKZN 2V1UA 1D1NA 3GLLA 5K1YA 1QFJA 3OWTA 1VQOB 5IT9Z 2JQ7A 2UUZA 4DYCA 3QYFA 2O1DA 4DOZA 2DYRH 2FRHA 5IPAA 1W7PA 2IRFG 1R1TA 4BY7J 1FTTA 3F0CA 4GYIA 4DZJA 2XNCA 2QSGX 5DNSA 1VQNI 1T6SA 5JR3A 5JVGF 1QH0A 2V7XA 2R7UA 4FWTA 2QWWA 1H80A 4RB2C 1QPMA 2WJVA 2VBWA 2INVA 3BPVA 4GDFA 1MMSA 4PGOA 5AN9A 2GIVA 3KEOA 2LKSA 5TJJA 1JT6A 1R5NA 4HLXA 1UD4A 1RU4A 1KU9A 4WX9A 3TOBA 1XS9A 1G3TA 2OTJI 1VLOA 1WSUA 3CCLI 4P55A 2PYHA 2WB1A 4CCOA 4FHTA 3A2KA 4TMWA 3HEFA 4C30A 2ELHA 3ECHA 1IDZA 4MYTA 1RC9A 2XPVA 1FNMA 2QQBA 4WZKA 3A3BA 2OTLI 1WWXA 3A1PA 3C3WA 3DPLC 4TKOB 2OK7A 1XGSA 2H09A 5HXBA 3M8EA 4BE2A 5F0HA 3CCMI 1P4XA 2IAIA 5FLXK 2K02A 4CH7A 5EEHA 2B5OA 4OM9A 1FOXA 2VYQA 2EFQA 5EG0A 4L9JA 1BI1A 2JPCA 1LUJB 2PECA 3LQ6A 1MZBA 4UUSA 5E3MA 1ACIA 4RCYA 1DGRM 2ELJA 1G3WA 1I6HJ 1EP3B 3EUKL 5E8IA 3OE7A 5D5VB 2W1OA 2EPFA 4RAZA 1KK2A 4RPBA 3G4SB 4RD4A 3FXMA 4E0FA 4EH1A 4EW9A 1R6RA 4C9YA 5FKMA 1D5YA 3SDGA 5FLMJ 1QZEA 4KMFA 2JRTA 5TISC 2QYUA 2BXZA 3GCMA 2NTQA 4XIDA 1COWA 2MBFA 1B4AA 3P7NA 2E71A 2BM6A 2YSRA 1QHGA 3BY6A 4X0CA 4X05A 2P6SA 5L3GA 1KTVA 1H89C 2V1NA 1UFMA 3C18A 5EEGA 4P9UA 1UD2A 3FMRA 5A8AA 1K8AD 2W7ZA 4LGWA 2DU9A 5CVJA 1ZKGA 4ZZDA 2VFOA 1S6LA 1JHHA 3PFIA 3OYLA 1B2RA 1POGA 1XG2A 4UUSB 2L7KA 4P3IA 1KQ5A 1CF7A 5CVUA 2HDNB 4Y7NJ 3NE5B 5IYQA 3OR1C 3MKYB 1FT9A 3MKZA 1YRNB 2X3UA 2A5WA 4H9GA 2LK2A 2XPUA 2ISZA 2VKEA 3HGGA 4GRIA 4B48A 3AAFA 1XGNA 2UV1A 2CUJA 1ZGJA 3CJNA 3F8BA 3I53A 3O8GA 2HYJA 2V6CA 1WOSA 3I9V2 3REOA 3CCJI 2VBZA 3U6BA 3LOCA 4EJWA 2WJYA 2UVFA 3OYAA 4OWRB 3H9NA 1LFPA 1K61A 3RI4A 1KZLA 5IYDJ 4KICA 2OBTA 2HDDA 1E3ZA 3RYPA 1CNFA 3SEZA 4OMYA 4P12A 1WMRA 4IRHA 1PLUA 5IT9K 1MABA 1ETYA 1JHFA 2WV1A 3M9AA 4E7JA 3WNCA 4YDTA 2X0LA 4MFDA 1SD5A 4ITVA 2IS2A 2DMTA 2LVSA 4Q48A 2I8DA 3F8NA 3U6KA 1EKEA 1FP2A 2HI3A 2XEXA 1I3AA 2XAQA 5CVVA 1CNEA 2CU7A 5DN6A 3VB2A 5FNZA 4MQ9F 2LH9A 4FE7A 2CFOA 3U2QA 4HW0A 1A8PA 4KYWA 2BMWA 2Y31A 3PM1A 3OMYA 5KCMA 4P2NA 3CB4A 4ROXA 2LNBA 2YX7A 2HFHA 4ZH4F 1TC3C 4ZCMA 2EFOA 3ZQFA 1K28D 3VMWA 3L1PA 3OYJA 4DW6A 4Z2YA 1HSJA 5LGTA 2YU9J 3L09A 1U8BA 5EF6A 4IHWA 4MEYF 3L2WA 1R49A 4I99C 1IW7F 1OISA 5D5WB 1R4MB 4ZYEA 5FKOA 1ZM9A 4OJ6A 4MTDA 2A5YB 2VQLA 2ODLA 1XCBA 2V7TA 1O8JA 4I7HA 3GTLJ 4C2LA 2TRTA 5ICGA 1IHMA 3H1CA 4XLNF 3IWFA 5L3FA 1TT5B 4A3IJ 3TH0A 3HKZA 2EBIA 2MG4A 1X4OA 3ZP5A 2BOLA 1Y8RB 3PSZA 2L7MP 1LDDA 4RLQA 1KZHA 1IDKA 2VBVA 3PUMA 2G7HA 3CCVB 2IXSA 4I0BA 2CK3A 4U0YA 4HYEA 3LMMA 4P6YA 2Q1ZB 2R7VA 1DP7P 1P7JA 1XMXA 3ZPNA 4BQAA 2HYGD 2ME6A 3D1NI 1HVXA 4TMTA 1VQMB 3KPHA 2KDZA 4DK1A 2CQXA 4HBLA 4WWVA 3LAJA 2FX0A 4CCMA 1PUEE 2EH3A 3AVXA 2NYXA 1DDNA 2D74A 3A8IA 3B4NA 4JBAA 2BSAA 3ESWB 1WPCA 1XSDA 5HNFA 2O6WA 5J35A 1N0UA 1WQ2A 2VJJA 1EFTA 4ACBA 4OPOA 1KA8A 3N4MA 4Z05A 1ELOA 3CCQB 3AVYA 2DERA 3H5RA 1BI3A 3PL8A 4Q7JB 4RGSA 3ZQIA 1OCPA 3BH6B 1DU6A 1RRJA 5M3FJ 9ANTA 2B0LA 1O4XA 2V4DA 4U4BA 1J2XA 1VF9A 3AVVA 4BU2A 1VNDA 3HRMA 2X51A 4G6QA 2QBYA 2ZC2A 3LA2A 3GBGA 3PNYA 3O6BB 2GXGA 1FNDA 2IP2A 4OIOF 2GJPA 2EV5A 2STWA 1OYIA 3OFNA 1DPRA 1RETA 2NNNA 2V79A 5CKTA 2P7VB 1JNYA 3HYIA 1Z7UA 3BJ6A 3LFUA 1NH3A 1K7AA 1R1UA 3FXRA 4DBRA 2ZMEA 1FOKA 1J9ZA 3PENA 5GAEJ 2XGDA 2BZTA 4YEIA 2G0YA 2Z3YA 2KISA 4AUXA 1KRHA 3ASTA 4MNUA 4HX4A 3J80Z 3WNBA 1OB0A 3EUHA 4I0AA 4QPOA 3CC7I 1R4NB 5TY0A 2R0QC 1YJNI 3QU6A 2PYGA 5HZAA 2HOAA 5LHGA 1BX0A 3FBIB 1BI0A 2ZBKA 5GAGJ 1VBLA 4KKTA 3GRHA 4S0HB 2K9QA 4NUBA 4N3GA 2F4OB 1WORA 1N75A 1TLHB 2E1NA 2MABA 3JCUC 4O3MA 4Z6YA 4U9UA 1YLFA 3V7RA 4HX7A 2LTPA 3GWZA 1H9TA 3PVDA 1S5LC 2H94A 2EV6A 3SQNA 4B1RA 4OOXA 3KIOA 1ETXA 4KKUA 4A0XA 3BY2A 4LBWA 3VMVA 1V5VA 2WYRA 3HOTA 1UJ8A 3K0LA 4B4CA 3BG3A 1SFUA 1J75A 3GVAA 2DMQA 4UVCA 3IH4A 2VOOA 2EIJH 1V0FA 3CRZA 2OF7A 3SZTA 5GTIC 2PLYA 4A5MA 3L2VA 2BF4A 1EH8A 1P7IA 2BHYA 3JRHA 4ZTJA 5BPIA 1T39A 2W24A 3SJZA 4V19K 1OPCA 3VNVA 2COMA 2BGJA 3JAMK 2DY1A 3BLYA 1MKMA 4X0GA 1JT0A 2VC1A 1A35A 5HNHA 2JUCA 3FF5A 3FISA 4YAWA 2XV4S 1EH7A 2BVLA 3L9FA 1GVJA 1VQ7B 1TW2A 3ISXA 1TWAJ 2FUG2 4A6EA 4ZDPA 2EFNA 1FP1D 3LSTA 2EK5A 3OZWA 3A8JA 2DETA 4NNJA 1G3SA 3BDDA 5DYMA 3Q5FA 1WPKA 4A5NA 2W25A 1LDKB 2EZIA 2V9VA 4E7LA 2JVHA 3BQJA 4KT6A 2E2HJ 2KZGA 3SLNA 4LG0A 4BPRA 5EMNA 4RB0A 3CC4I 4U0WA 3KP4A 4FETA 3OIQA 2HZTA 2WC2A 2KKOA 2KJCA 4A3DJ 3WE3A 2DN0A 3R0JA 1ZUNB 3G73A 3IHUA 4KKSA 2NV4A 1TYWA 1TTYA 2KJBA 5DUIA 2L2OA 4RM2A 4PMHA 2VB6A 4A69C 4F7DA 3SZEA 1WI9A 1P2FA 2OU2A 3OR2C 1M90D 4OZZA 3D5RC 4HNUA 2IS6A 1L1IA 1IDJA 2M2EA 1MMDA 1O8HA 1B72A 3SUCA 3MZHA 3ZMSA 2G9WA 3ASSA 2KIQA 4O6JA 4BJTA 1D1CA 3F8MA 3C2HA 3EPZA 2GK7A 5TGTA 2F6CA 2ZSIB 1KU3A 4AIHA 2XRLA 3B78A 3ZMTA 1IC8A 1WJ5A 1S8NA 2BM5A 1ZQ3P 4W8RA 1Z05A 3KYCB 4WZLA 4XRSG 3RIRA 1ZRDA 4RD3A 1VHOA 1AA7A 2EWEA 3F72A 5IP7J 4M1KA 3CMAI 3DTIA 2LZJA 3DBHB 1T0FC 3TOAA 1Z0XA 1OGOX 1GHCA 4OPVA 5DS9A 1KYWA 4G5GA 2ZXWH 2P5KA 4FX4A 5LD2C 4Z4YA 4Z4ZA 1QVUA 2MGQA 1JUMA 1MNDA 5IYRA 3W2AA 1HKTA 1QFYA 2MD0A 1JB9A 3QRFF 5JVTA 3VSKA 4PFOA 2GXAA 2ZZGA 2K4BA 2GK6A 1H0MA 1U8RA 1A31A 1MJ9A 1O3TA 2VFQA 2Q6KA 3VSVA 1ZARA 3MHPA 3HOSA 1YYVA 3EDPA 1UD5A 1R36A 1LLZA 1AWCA 2CH0A 3E6DA 2H27A 1KCCA 1XN7A 3U1DA 2F4NA 4CXFA 3ZZ0A 4HG2A 2GA1A 1YHQB 1STZA 4E7HA 3K4KA 1TNSA 2I1LA 2OAZA 3JRCA 3W2EA 1RKTA 1FDRA 2VL8A 1N25A 4L9NA 4MXNA 1W0TA 1N77A 1HKQA 3WGIA 3AL0B 3CJTB 1QVGB 2DQLA 1MBHA 3A03A 1V55H 2XSDC 2X53S 4HRIA 2HQAA 4WWCA 1P6RA 5M5YJ 1Q1VA 4YAOA 1K73D 4GQNA 1KQSB 2G0EA 4ZJZA 4IHSA 4HSTA 1UHMA
chains in the Genus database with same CATH topology
3CP8A 1UD3A 1YX5A 1VJSA 2LOOA 3K10A 3AKZA 2ZZEA 2INUA 2NZMA 2MFZA 1W0JA 1J09A 2M7AA 4E7KA 2XOKA 2R7RA 3GQ8A 3GQ9A 4LITA 4CCJA 4Z06A 4L8JA 2E1MB 4IQ4A 2VQCA 4BQQA 4B3FX 3OY9A 4PUSA 3VYSB 4PJJA 3VWBA 2QE7A 3T53B 1YE9A 2R7TA 3RPUD 3OYEA 2JDIA 5LFAA 4ZTFA 2E5ZA 2E1MC 2X6XA 3CMMA 4HSRA 3KEYA 2RNGA 1O8FA 1OOCA 3RCOA 3IP4B 1G59A 1DBGA 2W7NA 1BHEA 4YXWA 4B43A 2V7FA 3H5NA 2M4GA 2QY1A 2W6IA 2VQGA 1HA8A 4XD7A 2K9LA 1O8DA 3PUBA 2M0MA 4PSXA 2KMUA 3K4CA 5JHFA 2P0WA 4KJZA 4F92B 2L9SA 3DDYA 4D9JA 3EQNA 1U0JA 3BG7A 3DPTA 3DTEA 4XLEA 2MYSA 2VBEA 3OWTA 3BCAA 2IGNA 2UUZA 4B47A 3QYFA 2O1DA 3PSIA 2CV2A 4LIVA 4DOZA 3BCFA 5FL7A 1O8KA 1RWRA 4I84A 2VQHA 4XOPA 2DCEA 1QHHD 2X6WA 2NOJB 4W8QA 3H9QA 4BJ5C 2WPDA 3JU4A 1G8XA 1FMVA 3PFYA 2WY7Q 1BR2A 1KMHA 2WAQA 3FY3A 2K3PA 3WWGA 4Y3OA 2R7UA 4P22A 1H80A 2WJVA 2INVA 2KRHA 2IGMA 3H0DA 2KL4A 2KVOA 4C2UA 4ASUA 1ZELA 1BOBA 3VSLA 4D1QA 4F91B 3RQ4A 1UD4A 1RU4A 2NSPA 2VASA 5C1EA 2HVSA 2PYHA 2WB1A 2ZXIA 4CCOA 2VJ5A 3QYEA 3A2KA 3KEWA 1O8IA 1X1DA 4C30A 2CV0A 1PYVA 1VF7A 4XORA 3HAGA 2V31A 3T9GA 4N4NB 3A3BA 5CDFA 1HG8A 1E1QA 1EA3A 4LG3A 3OL3A 3OS2A 4BQNA 4TKOB 3DPLC 2V26A 3ZIAA 1WJFA 3ZR8X 2CMPA 2HDWA 4BE2A 2V6EA 3PJRA 1H8EA 3EUAA 3ZXSA 3OS0A 3OYGA 3H5AA 4CH7A 4E7SA 4OJLA 2F43A 4E4HA 4IZZA 4BQOA 3FPPA 4N4OB 4ZDOA 3OL4A 4NK6A 4EATA 3TMOA 4BDZA 2JUGA 2PECA 3U21A 1AIRA 2IQ7A 1TZLA 2LBFA 1DGRM 2ELJA 2R4GA 2K5CA 1X1BA 2LY1A 2Z1DA 3EUKL 4Y4RA 2AQEA 3OE7A 2W1OA 1E0EA 4UZUA 2ZFUA 3C2GA 1H8HA 2W00A 4W8TA 3VR6A 2LYCA 4E0FA 2QX3A 4XMYA 4BGDA 4EW9A 1R6RA 4G6TB 4C9YA 3TBIA 1O8LA 3S3NA 2M7BA 3S8PA 2NTQA 3ZRGA 2F5VA 1COWA 3GVKA 2KDOA 3LSMA 4IX7A 3H9JA 1MMGA 1QHGA 2A6TA 2M3AA 1NHCA 2V1NA 4OAYA 1UD2A 3BCBA 1KONA 1GLNA 2VJ4A 4XM3A 1BN8A 2CV1A 1GQ8A 4P1WA 4ZYAA 3OYLA 2HNHA 1XG2A 2VIXA 2L7KA 3VSUA 3MMYB 4NC7A 1SKYB 3NE5B 3W3CA 2W82A 3OR1C 1MMAA 4YELA 3MKYB 4E7ZA 3MKZA 2BSPA 2A5WA 2R7OA 3H9GA 3GQAA 2QKLB 3E0JB 4XKCA 5KNLA 2ZTNA 4B44A 3F9KA 1LVKA 4GRIA 2LBFB 4B48A 4C2TA 1X0CA 2UV1A 2CUJA 2V9KA 4QPQA 4HWVA 3DKYA 2W6JA 2Y0SA 3OYFA 3K70C 1WTHD 2Q2EB 4JOMA 3I9V2 2XZOA 1PKVA 2Z8GA 4CSWA 2WJYA 2WAEA 4G6IA 3OYAA 4OWRB 3OPOA 1JRGA 1LFPA 4E6KG 2UVFA 1KZLA 3CP2A 4FASD 3N05A 2Z2SB 3G05A 1D0XA 4PK4A 3LSGA 1E3ZA 3B8YA 4YZXA 2JJ1A 1DGWY 1WJAA 5HOOA 2XC7A 1WMRA 2OUMA 1PLUA 1WJEA 4BUPA 4J01A 1MABA 4BE1A 2JA2A 4E7JA 2GJKA 3BH4A 2DOAA 1E1RA 4ITVA 4XN0A 2IS2A 2E60A 4J00A 4DGWB 3OYDA 2X3HA 4AU7A 2I8DA 4BEHB 2XF7A 4OJPA 2VXDA 1BR1A 3EUHC 3OEHA 2L5QA 1W36D 3HPHA 3OS1A 2LREA 3KRGA 2R7QA 5KHDA 2AQFA 2QXZA 5DN6A 1W9XA 1WJBA 1VZ0A 2LH9A 2Z16A 2CFOA 2DJIA 2D3NA 3IAS2 4XKBA 4TT3A 3OMYA 5KCMA 2XZLA 1PE9A 2KPMA 1K28D 3VMWA 2DT6A 2CS3A 1SFKA 3OYJA 3L2QA 2O17A 4YRVA 5AMVA 3DWLE 2XF5A 3OIPA 3FDYA 2XAUA 3L2WA 5CQGA 2XDVA 2XSJC 3VYTB 4OJ6A 1E43A 3LNNA 3OW7A 3K70D 4MLOA 3SDBA 2VQLA 2ODLA 1O8JA 4NQWB 3S3OA 1X19A 4C2LA 3OOUA 1MNEA 3NWTA 4PFPA 2OC6A 2WZPP 2VBKA 3VDXA 4RLFA 2ZZQA 3HKZA 2CUZA 1V5EA 5C1CA 1X4OA 2IGOA 2BOLA 5FROA 4RLQA 2D3LA 3CJRB 1IDKA 4XLFA 4BEHA 5HKKA 3W2WA 4XLHA 4H4KC 2IXSA 2CK3A 4JMQA 2VPLA 3LMMA 3ZSCA 1K6YA 3SYTA 2Q1ZB 3K4NA 2R7VA 2HZDA 3ZPNA 2DIEA 3HUGB 1WJDA 1HVXA 3BG6A 2RREA 4F3QA 1W36C 3QOEA 4DK1A 4B3GA 4DNRB 1OR7C 2WA0A 1HZEA 1ERDA 3FHNA 4CCMA 1O8EA 4NK8A 3DU5A 2KQRA 3ZPPA 3DTKA 1X1CA 1EE6A 3B4NA 4BACA 4DNTB 1WPCA 5HNFA 3CZ6A 2NTBA 1NG6A 2VJJA 1KTWA 3I3LA 4JQFA 1MMNA 4Z05A 3VYRB 3EQOA 3UW0A 3H5RA 3PL8A 2QKMB 4YZQA 1IB4A 4ZDLA 4E7IA 1W0KA 2VKHA 2CW8A 2KZVA 2ZZFA 2E5NA 1WJCA 4AVZA 2V4DA 4PJMA 4U4BA 1OFLA 4HIZA 2F1MA 2LRDA 2F4IA 4BS9A 2RQQA 4BU2A 2X51A 3K4JA 3ONQA 3GBGA 3PNYA 1I18A 1OGMX 1BMFA 1T5EA 3QYBA 2GJPA 2GJRA 2V7QA 1DP3A 3OEEA 3K4LA 5HVQC 3OFNA 2OV7A 2PJRA 3PSFA 3A1YA 5CKTA 1QCXA 1LKXA 2GOXB 1OLTA 3LFUA 4DBRA 4G7WA 1D0ZA 3OYCA 2MC4A 2WY8Q 1UG0A 2M4KA 1JI8A 2JSPA 1WFXA 1UELB 1X4PA 1OB0A 2R7XA 3DLAA 2X1DA 4QPOA 4XLCA 2VLAA 1OHHA 2NSTA 3D5LA 3G2BA 4XONA 3RSNA 2PYGA 2NTPA 4PSWA 1BLIA 2ZTGA 3E1SA 3FBIB 2LC2A 3ZGKA 4B3XA 2BVMA 3HL2A 4KISA 1N78A 3GVLA 1VBLA 2CW7A 3VYUB 3V42A 4F55A 4KKTA 3LMWA 1X1AA 3M1CA 4NUBA 4MR0A 1N75A 2LY2A 2MABA 2ZXHA 3S32A 4CZCA 4II2A 2JVGA 1E79A 2DT7B 1WP6A 3HPGA 3DKXA 4KKUA 3QODA 1E3XA 3OYBA 3BC9A 3VMVA 1SAUA 4RMNA 3OAAA 2VBMA 2PJRB 4II3A 3HOTA 2LG4A 3A35A 2HPMA 3A3GA 3T56B 3L2UA 2O0VA 1V0FA 2X6YA 3L2VA 4ZTJA 2WSSA 4CA0A 1V5FA 3LL7A 3LSIA 3KYLA 2XNDA 4XN3A 1IA5A 1D1BA 4U49A 4HEA2 4XKWA 2R7SA 1FX0A 4NC8A 3BLYA 4IQJA 1V0EA 4X0GA 1OFMA 1MW7A 5HNHA 4YEJA 3HG9A 3GQBA 2Z6BD 4URRA 3MD2A 4PJNA 2BVLA 3CESA 3LSKA 2NT9A 3WQZA 2FUG2 2R9VA 3DQVC 2L9NA 3FKJA 4BJ6C 3D5SC 2GOMA 1V5GA 2V4JC 4ZDPA 1Y6IA 4XLAA 3AL0C 1VLYA 2XF6A 4YZAA 4NNJA 4Z1MA 3DPUA 2XGJA 3OYMA 1LDKB 4E7LA 2JVHA 1PJRA 3H94A 2IS1A 1D0YA 2UWMA 2O0WA 5FRNA 4ANJA 3UR3C 1I8DA 4KT6A 4DK0A 4TSFA 3GQ7A 1NRKA 1RMGA 2X8KA 4U7BA 3CJQB 3VSTA 1Z3XA 3CF2A 4DIQA 4DBQA 1PXZA 3TL4X 4FETA 3OIQA 1P9QC 5FRMA 4OZYA 4Z03A 3OOCA 2BW3A 2X1EA 1UD8A 3B90A 3K4MA 4KKSA 1UD6A 1EFRA 3PNVA 2L2OA 2KP6A 4RM2A 2HU9A 3LSHA 4AYBA 5IK2A 4IKFA 4PMHA 1O8MA 2VB6A 3GRHA 1BPLA 1UAAA 3OR2C 4P5OA 3SEQA 3BCDA 2HPIA 3D5RC 4HNUA 4U87A 2IS6A 4OZZA 3K4BA 3S3MA 2O5RA 1IDJA 1MMDA 1O8HA 2R7WA 3SUCA 1YX3A 2PMZA 3A4CA 3UNGC 1QJVA 2XZPA 4BJTA 1O88A 1KCDA 1D1AA 1D1CA 1QU3A 3C2HA 4G7XA 2IGKA 3EPZA 2GK7A 3JURA 5TGTA 4YZ0A 1Z3YA 4F93B 1DQUA 1S9HA 2F6CA 2ZSIB 3FBNB 1Z21A 2WBMA 3NWSA 3SZGA 3GVJA 4OAZA 4XR6A 3IAM2 5HLTA 3PNTA 2IS4A 3OYHA 4CCNA 2O04A 3M8JA 3H35A 1Y56A 3DEEA 1WJ5A 2HVQA 4HPQA 4W8RA 3DU6A 4W8SA 4XNFA 3OYIA 2UVEA 2NT6A 4BXFA 4HNTA 1BR4A 1TT0A 4KITB 1CZFA 1AA7A 2EWEA 3DTIA 2HVRA 2LZJA 1T0FC 3RTRA 2JIZA 1OGOX 3ZQQA 2VKDA 3J7AY 3HXLA 4CCKA 5LD2C 4CUGA 2K9MA 4ZC3A 4Y33A 3ZCOA 1MNDA 3L2RA 1NBMA 3HC7A 3S93A 3W2AA 2MD0A 1O8GA 2VJIA 2WAFA 3VSKA 4PFOA 3OYKA 2ZZGA 1Z7LA 4OJOA 2X85A 3K6GA 5CPRB 2GK6A 2WADA 1JTAA 4LIUA 2BW3B 2DXIA 4OJ5A 3VSVA 1T95A 4XQFA 3HOSA 4XL9A 4BDYA 3MKWB 1UD5A 2KRCA 3AFHA 2CH0A 2JJ2A 1KCCA 1IRXA 4BL0B 3KX2A 1DBOA 4HG2A 1FMWA 2X1CA 4E7HA 1NG7A 3K4KA 4CCLA 4XKVA 2KLOA 4PJLA 4DJAA 3OYNA 3IUOA 2VL8A 2KHMA 4MXNA 1N77A 4XOTA 3AL0B 2HLDA 2ZSHB 2M5SA 3T51B 2E1BA 1K5CA 3BC8A 2X53S 4HRIA 2HQAA 5CQEA 4F52A 3FKSA 4GQNA 3W2VA 4R79A 2VXZA 4ZJZA 4BE0A 4FXUA 4HSTA 3SEZA 2W4SA 4RM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8S A;  2INU A;  4XLA A;  3ZSC A;  2NZM A;  4YZA A;  2NTQ A;  3GQ8 A;  3GQ9 A;  4Z06 A;  2O0W A;  1O8E A;  4NK8 A;  1NHC A;  3GQ7 A;  3ZPP A;  3B4N A;  1EE6 A;  1RMG A;  4XM3 A;  1BN8 A;  3VST A;  2NTB A;  2VJJ A;  1KTW A;  1GQ8 A;  1PXZ A;  2X6X A;  1XG2 A;  1OOC A;  1O8F A;  4OZY A;  4Z03 A;  4Z05 A;  3EQO A;  3VSU A;  3UW0 A;  1DBG A;  1BHE A;  3B90 A;  4YEL A;  4YZQ A;  1IB4 A;  2BSP A;  3GQA A;  2QY1 A;  4AVZ A;  1O8D A;  4U4B A;  1OFL A;  4PMH A;  1O8M A;  1X0C A;  3GRH A;  4HWV A;  3EQN A;  4OZZ A;  4XLE A;  1IDJ A;  2Z8G A;  2VBE A;  3SUC A;  1O8H A;  1OGM X;  2UVF A;  1QJV A;  1JRG A;  2O1D A;  1O88 A;  1KCD A;  1O8K A;  1RWR A;  4I84 A;  4XOP A;  3B8Y A;  4YZX A;  3JUR A;  4YZ0 A;  4W8Q A;  2X6W A;  1QCX A;  1WMR A;  1PLU A;  4XR6 A;  3FY3 A;  2O04 A;  3WWG A;  4W8R A;  4XN0 A;  1H80 A;  4XNF A;  2INV A;  2X3H A;  2UVE A;  4XLC A;  2NST A;  2NT6 A;  4OJP A;  4XON A;  2PYG A;  2NTP A;  1RU4 A;  1CZF A;  2NSP A;  3KRG A;  2EWE A;  1VBL A;  2QXZ A;  5C1E A;  2PYH A;  1O8I A;  1OGO X;  3LMW A;  4MR0 A;  4XOR A;  3T9G A;  1O8G A;  1HG8 A;  1PE9 A;  2VJI A;  3VMW A;  2O17 A;  3VMV A;  5AMV A;  2VBM A;  2X85 A;  4OJO A;  2O0V A;  1JTA A;  4OJ5 A;  3VSV A;  4XQF A;  4OJL A;  2X6Y A;  4OJ6 A;  4XL9 A;  1KCC A;  1IA5 A;  4XN3 A;  2ODL A;  1DBO A;  4NK6 A;  4XKW A;  1O8J A;  4U49 A;  2PEC A;  1AIR A;  4XKV A;  1OFM A;  2IQ7 A;  4C2L A;  2VBK A;  4MXN A;  4YEJ A;  4XOT A;  1K5C A;  4URR A;  5C1C A;  4W8T A;  1IDK A;  4XLF A;  2NT9 A;  2QX3 A;  4XMY A;  4XLH A;  4EW9 A;  1O8L A; 
#chains in the Genus database with same CATH topology
 3CCQ I;  1MIJ A;  1YX5 A;  3RPU A;  2LOO A;  3W6K B;  3AKZ A;  1E64 A;  2NZM A;  4W8S A;  2VBX A;  1SFO J;  2F1L A;  2B9S A;  3M3Y J;  4RJL A;  2E1M B;  4EJV A;  2CQ7 A;  2M87 A;  2BY3 A;  3FXJ A;  3IRR A;  1FRN A;  1U5T B;  1PJ7 A;  4PUS A;  4DQ2 A;  2VKV A;  1NK3 P;  2IPQ X;  2JDI A;  3AVU A;  5JI6 A;  5LFA A;  2GAU A;  3RIQ A;  5A2Q K;  4RDL A;  2PMD A;  3MQ0 A;  1TVC A;  4RCZ A;  4PCQ A;  1O8F A;  1DBG A;  1ZYR F;  5L3D A;  4L5E A;  3O2P E;  1J7K A;  4B43 A;  1WOO A;  3A8K A;  3CUQ C;  3PUN A;  2DMP A;  2K7L A;  2VQG A;  2DA3 A;  4V2F A;  2M0M A;  2KMU A;  3K4C A;  3BTJ A;  1TWC J;  4ON0 A;  1QQI A;  2P0W A;  4F92 B;  5EZH A;  3FM3 A;  2ZJ2 A;  3DFG A;  4EGY A;  1B8I B;  3S2D J;  3DTE A;  3EQN A;  3F8F A;  5GTH C;  2L4M A;  3HTU A;  2KIU A;  2MYS A;  2W57 A;  2OYN A;  4S04 A;  4RB1 A;  2IGN A;  4B47 A;  3PIP F;  2Z33 A;  2DCU A;  2CV2 A;  3Q6Q A;  4LIV A;  1O8K A;  5IOY A;  4XOP A;  2DCE A;  1U5T A;  2GQQ A;  4ZYH A;  2NOJ B;  4TN1 A;  2WPD A;  3JU4 A;  3GFM A;  1G8X A;  1E63 A;  3GO5 A;  3ZQH A;  2R92 J;  1A5J A;  1RZ4 A;  2WY7 Q;  3PFY A;  4EQQ A;  5IYP A;  1KMH A;  3WU1 B;  1YJ9 B;  5A89 A;  3WWG A;  4Y3O A;  1DAB A;  4P22 A;  5IYN A;  5GP9 A;  3M07 A;  2IGM A;  4LB6 B;  4C3I J;  2QEX I;  1EFC A;  1JKQ C;  1ZEL A;  1BOB A;  4ENK A;  4PC1 A;  4EM2 A;  3RQ4 A;  2NS8 A;  4D7M A;  2JSC A;  2VAS A;  3LQR A;  2NSP A;  5DTD A;  3LQQ A;  3AGP A;  3ONY A;  4XRF A;  2HVS A;  3CD6 I;  1M1E B;  2H1K A;  1XB2 A;  2VJ5 A;  1SD6 A;  3QYE A;  3KEW A;  3V76 A;  2CV0 A;  1QUF A;  2Y9Y A;  3VFZ A;  2R6H A;  2XGC A;  3J81 Z;  1JA1 A;  4M2L A;  4UZE A;  2V31 A;  4N4N B;  5F4M A;  1HG8 A;  4D7N A;  2VFM A;  4LG3 A;  2XC1 A;  3OL3 A;  3X2Q H;  4BQN A;  1U6G A;  4ZCI A;  4M53 A;  2A6E F;  5EDN A;  2CMP A;  3VMF A;  2V6E A;  1FNN A;  2STT A;  3PJR A;  2ACJ A;  1FBS A;  3EUA A;  1LPQ A;  1UMK A;  2XT2 A;  1YS6 A;  3DBL B;  2ZCW A;  2K27 A;  2EJR A;  1RPW A;  3E6B A;  4ZGQ B;  2LF8 A;  5KW9 A;  3CCS B;  2KT0 A;  4RD2 A;  4UB6 C;  3OL4 A;  3TP3 A;  1EFU A;  3TMO A;  4HAM A;  1F20 A;  1R58 A;  4NK6 A;  4HOB A;  2HGC A;  1WGX A;  2IQ7 A;  3R60 A;  1TZL A;  2IA0 A;  2IA1 A;  2LBF A;  5D4R A;  3RQI A;  3CO7 C;  1BL0 A;  4XBF A;  5FKK A;  1W5C C;  2R4G A;  5FJ8 J;  3GTG J;  3M7G A;  3JRB A;  1NDH A;  2AQE A;  2VT3 A;  4P9F A;  1H8H A;  2O0Y A;  1G2H A;  4A3F J;  1OFD A;  4B3A A;  3KP2 A;  4HE6 A;  4ZV4 A;  5FA6 A;  1Y0U A;  1YFH A;  3COA C;  1S7E A;  3ML6 A;  4LK1 F;  3QAH A;  3S8P A;  4DQK A;  5L3E A;  2F5V A;  1Z91 A;  2LKP A;  1Q81 D;  2DOE A;  2KDO A;  3LSM A;  4A93 J;  1R5O A;  1ETK A;  1GR1 A;  1MJB A;  5AIQ A;  2FF4 A;  2NS0 A;  2ZJP F;  1HA3 A;  2M3A A;  2FXA A;  1DUX C;  2QA4 B;  2G7U A;  2NPF A;  4IVN A;  1BOA A;  5M5W J;  3BR0 A;  3ML3 A;  5IY5 H;  4XM3 A;  2AHO A;  2Z9O A;  1BN8 A;  2XGX A;  3W2H A;  3OW2 B;  1WSR A;  2ZBV A;  4M3E A;  2J5P A;  1H42 A;  3VSU A;  1SAX A;  2QYO A;  4NC7 A;  1SKY B;  1Y1V J;  1UZC A;  4HV5 A;  5GPA A;  4YEL A;  4E7Z A;  2MSY A;  1O3S A;  2M5W A;  1BW5 A;  2JN9 A;  5JHU A;  2ZL7 A;  3JTH A;  1EF4 A;  3F23 A;  1QGZ A;  4XKC A;  4YHB A;  3K2Z A;  3GQA A;  4CYD A;  4XSX F;  5KNL A;  3VO1 A;  3BOQ A;  1ZK8 A;  1X0C A;  4QPQ A;  5EJC A;  3DKY A;  1QGY A;  1VQO I;  4Y13 A;  2ZO4 A;  2Z8G A;  2CFX A;  2P7C B;  2FSW A;  1JJ8 C;  5FLV A;  3MEX A;  3CLQ A;  4G6I A;  5K5O A;  3OPO A;  1JRG A;  4E6K G;  3CP2 A;  5IT3 A;  1JJ6 C;  2WR8 A;  2Z2S B;  1QVF B;  3MN2 A;  3LSG A;  3RY8 A;  1IV8 A;  1VQ6 I;  3DEW A;  5D6F A;  2DK8 A;  1FBQ A;  2MW8 A;  5HOO A;  2XC7 A;  2J5O A;  2OUM A;  1G7R A;  2XAG A;  3A02 A;  4WXC A;  1VQ8 I;  4BBS J;  1WSV A;  2OTL B;  3AG3 H;  2BY1 A;  2R7F A;  4TV7 A;  4XN0 A;  5J3L A;  3VOE A;  4QTR A;  3BTC A;  5FD5 A;  4PAA A;  2QZA A;  3WTS C;  1I1S A;  1XFO A;  4NB5 A;  1ULY A;  3H3V K;  4OJP A;  1MH3 A;  1SMT A;  3C7J A;  3EUH C;  5F64 A;  3PO3 J;  2LY9 A;  4UXN A;  3OS1 A;  1XDU A;  2LRE A;  3DLL F;  5LRR A;  3SFZ A;  1WJB A;  2RN7 A;  1VZ0 A;  3G6E B;  2CSO A;  2CUE A;  2Z16 A;  3HHG A;  2QTL A;  2K86 A;  1VQ8 B;  3IAS 2;  3CCR I;  4HQE A;  1YIJ B;  4G8X A;  1ETQ A;  1F9N A;  3ZN0 A;  1SM4 A;  3KL9 A;  1PUF A;  2FJ1 A;  3L2Q A;  2CS3 A;  1SFK A;  3BTL A;  1U2R A;  2O17 A;  3CTA A;  4KIG A;  3DCF A;  1IV6 A;  5AMV A;  1T2K A;  2XF5 A;  3OIP A;  4RB3 C;  2EFG A;  2M0C A;  1HQC A;  3CDI A;  1CF7 B;  1W4M A;  4HF2 A;  3E5X A;  4JP0 A;  4X6A J;  4HLY A;  3CDL A;  3OZU A;  1C0W A;  2LFB A;  4IL6 C;  4KUM A;  5JLW A;  3CCR B;  2BXY A;  5BQT A;  3ABK H;  2DA1 A;  1K4T A;  2WZP P;  2XVC A;  3NRV A;  4RGX A;  3WHB A;  5DM6 F;  2LKX A;  5GAH J;  4MO7 A;  4KA4 A;  5C1C A;  4OIQ F;  3V4G A;  1TP4 A;  1FYM A;  2D3L A;  5FO1 A;  4XLF A;  4BEH A;  4WZT A;  5HKK A;  4I09 A;  4H4K C;  2QSH X;  4L9V A;  3WBJ A;  1X3Z B;  5K5Q A;  2DIE A;  4PC7 A;  1WJD A;  2EZH A;  3GLX A;  4TMV A;  2K9N A;  1HC8 A;  4DNR B;  2WA0 A;  1ERD A;  5HLG A;  2XRN A;  5HDK A;  3QSY A;  4YFX F;  1MBG A;  2LR8 A;  2J8I A;  3ZPP A;  3DTK A;  1X1C A;  3PQJ A;  2XRO A;  4LC0 A;  2ZME C;  3CZ6 A;  4N9H A;  1NG6 A;  3EYY A;  5LMZ A;  1KTW A;  5F6F A;  4UB8 C;  1T8I A;  4KMU X;  3MZ8 A;  4JQF A;  3BR6 A;  1OYY A;  3VYR B;  4M6X A;  3CUO A;  2EB7 A;  1W0K A;  1YI2 I;  2VKH A;  3KZZ A;  2E5N A;  1IAW A;  1PP7 U;  4PJM A;  2ESH A;  4EM1 A;  1JE8 A;  2F1M A;  2PLF A;  2LRD A;  2F4I A;  4BS9 A;  4W97 A;  2J8K A;  3K4J A;  1WOP A;  1HW1 A;  3HIF A;  1ZM2 A;  2HKO A;  1R00 A;  5BSX A;  1BMF A;  1VQ4 B;  2OZU A;  1YHQ I;  4MGR A;  1OR7 A;  2ECC A;  4XRS A;  4M71 A;  1OGI A;  2HOE A;  3BZ6 A;  3OEE A;  3K4L A;  1E17 A;  1YOV B;  4BY1 J;  2FML A;  3LNQ A;  1BQE A;  2OV7 A;  3PSF A;  3LA3 A;  1H9G A;  1YQA A;  1QCX A;  4EJU A;  1RR8 C;  2PJP A;  2AXT C;  2BN4 A;  2MH9 A;  2NOG A;  2GM4 A;  3V7A A;  2MC4 A;  5F1R A;  4S05 A;  5E6T A;  4UZF A;  3DLA A;  1OHH A;  2VLA A;  2NST A;  3Q9S A;  3D5L A;  3G2B A;  5KAF C;  5F1J A;  2Q6O A;  1X2N A;  1BLI A;  1MGT A;  1DG1 G;  3AVW A;  1IN5 A;  3E1S A;  4LLL A;  3ZGK A;  5KK1 A;  4B3X A;  2BVM A;  3HL2 A;  3ERE D;  4KIS A;  2H6B A;  1XQB A;  4X8I A;  3VYU B;  2YUH A;  1IJE A;  3FM5 A;  3LMW A;  4G6D A;  4K1X A;  5J8C A;  4FE4 A;  2RV8 A;  4MR0 A;  2DA4 A;  5E18 F;  2LY2 A;  1K78 A;  1T0F A;  1QG0 A;  4A3K J;  1YLO A;  2JVG A;  4Q4Z F;  3HOW J;  2DT7 B;  4RGR A;  1ZHF A;  1Y0R A;  1NHA A;  1GT0 C;  3FPK A;  3QOD A;  3CCL B;  2QCO A;  4M3D A;  1R5I D;  3I4P A;  4JK1 X;  4UV9 A;  1SAU A;  4RMN A;  1Q82 D;  2LG4 A;  2X48 A;  5EGO A;  2HPM A;  3GFI A;  3A35 A;  3A3G A;  2ID6 A;  3T56 B;  4ENN A;  2MLK A;  2P4W A;  2OBS A;  3ZOB A;  4Y7C A;  5F04 A;  4LLN A;  4CA0 A;  3LSI A;  5IOZ A;  4EVI A;  4AIK A;  5TR9 A;  1FX0 A;  4NC8 A;  4WXH A;  3BP8 A;  3BR3 A;  2DBB A;  3C2B A;  1V0E A;  4L0Y B;  4X7D A;  2ISY A;  2X4H A;  2CRV A;  3HG9 A;  5HDN A;  3MD2 A;  1SC7 A;  3WG7 H;  3CCE B;  1NB0 A;  1QA2 A;  3GZN B;  3LSK A;  4X1E A;  1JUP A;  2ZNY A;  3ZMV A;  2NT9 A;  3DQV C;  4R71 A;  1CQT A;  1K78 B;  2ID3 A;  3E20 A;  3BQY A;  1T56 A;  1QFZ A;  2JA6 J;  2YWE A;  4KN4 X;  4YZA A;  1FOW A;  1FTZ A;  1HKS A;  5H2F C;  4FK8 A;  3ABL H;  1F60 A;  2ZME B;  2XGJ A;  3FXQ A;  1HST A;  1PJR A;  3VNU A;  2IS1 A;  2OZ6 A;  1ON1 A;  5ICC A;  4ANJ A;  4Q5S F;  2OQR A;  2HXO A;  2VZL A;  2O3F A;  4KN7 X;  1VTN C;  4DK0 A;  1WDT A;  1X2M A;  3GQ7 A;  1JXS A;  4F7Z A;  3ZMU A;  4ZZL A;  1BJZ A;  3QPL A;  1DPU A;  4U7B A;  3CJQ B;  2NS7 A;  1RIO H;  1TQM A;  5J8F A;  4DBQ A;  2L4A A;  3AG2 H;  4U7D A;  3CME I;  4NQW A;  1PXZ A;  4A3C J;  1TLL A;  2PI0 A;  3GTK J;  2WZN A;  2BW3 A;  5L3C A;  3P9K A;  1UD8 A;  5F27 A;  3VEP A;  1GDT A;  2V5I A;  1FYL A;  4H0E A;  2EZL A;  3HZJ A;  4HQM A;  2KP6 A;  3HJE A;  3V8J A;  3E3V A;  3ASO H;  3LSH A;  2DFH A;  1HCR A;  1YJN B;  2DAO A;  4D0P A;  4KNY A;  1R1V A;  2EV0 A;  3PUF A;  1SFE A;  2QQ8 A;  4IKF A;  2Q6L A;  3I55 B;  1BPL A;  3W6V A;  2EIK H;  4IHX A;  2DEU A;  3S1N J;  2VOP A;  1G3Y A;  1P4M A;  4P25 A;  3K4B A;  5C4J J;  2R7W A;  4EM0 B;  2PMZ A;  2NVQ J;  2JPB A;  1XMK A;  4EGZ A;  5IP6 A;  1SD7 A;  1O88 A;  1H88 C;  1APL C;  3Q3A A;  1QU3 A;  4HDV A;  5DDG A;  4G7X A;  1V4R A;  1B1B A;  5E1X A;  3S15 J;  4F93 B;  1IF1 A;  2KRF A;  1LM1 A;  2FA5 A;  3FBN B;  3NWS A;  2WBM A;  1KQ8 A;  2DA7 A;  3GVJ A;  3KLO A;  4XR6 A;  4YAL A;  3VPR A;  3PNT A;  1YIJ I;  2O04 A;  3M8J A;  3H35 A;  1MBK A;  1Y56 A;  4NBQ A;  1WZ2 A;  4N9I A;  2HVQ A;  2DA6 A;  3DU6 A;  2XAH A;  2JA5 J;  4J0Q A;  2Q6I A;  3OYI A;  2FEZ A;  3OSF A;  1MNM C;  1R22 A;  4A12 A;  1MDM A;  2VNJ A;  4KIT B;  1BJA A;  2FBK A;  3TDU C;  1XMA A;  3HOV J;  4Z4R A;  1M1K D;  3BR2 A;  1IN7 A;  1T08 B;  1KGS A;  3L7W A;  1Q9S A;  1BC8 C;  2WB1 N;  2R5Y B;  1TWH J;  2IT0 A;  2A3S A;  4M6V A;  3G3Z A;  2GIZ A;  4ZC3 A;  3LO8 A;  3R4K A;  4Y33 A;  1YIT B;  3S93 A;  2ME0 A;  1DDI A;  5D6E A;  1V3F A;  4UVA A;  4L0Z B;  2L9R A;  3AG1 H;  3OYK A;  4I02 A;  3JAM Z;  2KIM A;  1Z7L A;  4LOC A;  5B6I A;  1VQK B;  2X85 A;  1T6Y A;  4EV0 A;  5BOX A;  2OBP A;  1BM9 A;  2NXN B;  1D2E A;  1UG2 A;  1TYX A;  2Y30 A;  2E1O A;  4HX8 A;  2PEX A;  1Y0Y A;  4OJ5 A;  2QGU A;  4M3F A;  1Q7Y D;  4BDY A;  4YII A;  3ABT A;  3AFH A;  2ECB A;  2EFP A;  1EH6 A;  3I58 A;  2VE9 A;  1D3Y A;  4BL0 B;  2JJ2 A;  4UUT A;  2FU4 A;  4G9Y A;  4QV2 A;  2X1C A;  1NG7 A;  5LHI A;  3JRA A;  4XKV A;  2KLO A;  4PJL A;  1EV7 A;  3WTZ A;  4AM3 A;  2BM0 A;  5C44 J;  3IUO A;  4G12 A;  3I4M J;  1WCM J;  5HS9 A;  5IYW A;  1YTY A;  1K4S A;  3CXC B;  5J6X A;  2FQ3 A;  2JZY A;  2GXB A;  2XB0 X;  2XKP A;  3SJP A;  1SVO A;  2Y69 H;  4F52 A;  2HYF A;  1LE8 B;  2QEN A;  2R5Y A;  5GV8 A;  3OYM A;  4A3M J;  1CGP A;  1FLI A;  2JA7 J;  1VJS A;  2INU A;  2V7V A;  3ULQ B;  1IRG A;  4N0B A;  1W0U A;  3OKX A;  3IL2 A;  2M7A A;  3T5X A;  5LGN A;  3E6C C;  4AF7 A;  1A36 A;  5KAI C;  1O7L A;  4CCJ A;  4M9Z A;  4YG2 F;  4QVA A;  4L8J A;  5J3O A;  2YPR A;  5IYC J;  2YWF A;  3OY9 A;  4B3F X;  3Q3S A;  4PJJ A;  2QE7 A;  2UZK A;  3T53 B;  2LF7 A;  3BY1 A;  3WYA A;  2CF4 A;  3OYE A;  4ZTF A;  2XTX A;  1E3P A;  4C2M J;  1PDN C;  2JA8 J;  1R5B A;  3OJX A;  2E1M C;  1ITY A;  4C0S A;  1GV2 A;  1S0U A;  1ZRE A;  3HOZ J;  3RCO A;  3IP4 B;  1U9O A;  2L01 A;  1BHE A;  2DK5 A;  2VT2 A;  2M4G A;  2QY1 A;  5C3E J;  3J81 K;  4XD7 A;  3L00 A;  3PUB A;  1OB2 A;  4YIF A;  5JHF A;  4Y9U A;  4KJZ A;  4MIM A;  1IG7 A;  5BPD A;  5J40 A;  2EQR A;  4KDP A;  2PMZ N;  1KQ0 A;  2F3L A;  3I4N J;  4GCV A;  2L7Z A;  1AHD P;  2LDU A;  2ZFW A;  1QA1 A;  1PUF B;  2E36 A;  1RWR A;  4I84 A;  5EG0 B;  4HDU A;  2RC5 A;  2X6W A;  2LP0 A;  3H9Q A;  4JX6 A;  2DTR A;  1R7J A;  3QFC A;  4OPW A;  2GPJ A;  3P26 A;  3FY3 A;  5CLS A;  4M9S A;  1HW5 A;  1JTY A;  3RDI A;  3ZQ7 A;  1BN5 A;  4YFK F;  2YX4 A;  2EWN A;  2QLZ A;  5M5X J;  1F5T A;  1EXM A;  3GTM J;  3BH7 B;  2R5Z B;  4OPS A;  3F6V A;  3H0D A;  2BX6 A;  4C2U A;  2NRA C;  4X7C A;  4W1U A;  3J7Y J;  3N97 A;  5BMZ A;  3VSL A;  1U3E M;  3GFL A;  4RM0 A;  4D1Q A;  4F91 B;  1UMQ A;  3PQK A;  4RD6 A;  5J1R A;  3GEZ A;  2PQ8 A;  2ZXI A;  2HQ5 A;  4FIS A;  1QRC A;  4RBO A;  2ELK A;  1PYV A;  1VF7 A;  4AF6 A;  4XOR A;  3WU0 A;  3HAG A;  4IF4 A;  3T9G A;  1F4K A;  1Z6T A;  2YU3 A;  4ABZ A;  5E17 F;  1E1Q A;  2GQF A;  3J80 K;  3ELK A;  3OV8 A;  5E3N A;  3OS2 A;  3HGY A;  3ZIA A;  2ETH A;  4NCN A;  1WJF A;  1ZH5 A;  2YUS A;  3D0S A;  3ZR8 X;  1AKH A;  4EEF G;  1Y1W J;  1VHE A;  1HOM A;  4NC6 A;  1O3R A;  1YW7 A;  1H8E A;  2VFP A;  2F48 A;  1N07 A;  3CPW B;  2F43 A;  1Z67 A;  1YRN A;  4BQO A;  4IW3 B;  3W5U A;  3H09 A;  4N4O B;  3B82 A;  4QHY A;  4EAT A;  4IPA A;  2JUG A;  1OCR H;  2M45 A;  3U21 A;  4D5F A;  2IBD A;  2GLO A;  1AIR A;  2VFN A;  2E1C A;  2CW5 A;  3GTQ J;  1B8I A;  3P27 A;  2VNH A;  3OJW A;  2DTZ A;  1X1B A;  2NAZ A;  2Z1D A;  4Y4R A;  3PET A;  3W6J B;  1XTA A;  3TW7 A;  3O8H A;  1SVM A;  2ZFU A;  3C2G A;  3QPS A;  4R8H A;  3Q38 A;  2W00 A;  4W8T A;  3VR6 A;  3JRI A;  4AD9 A;  2V9P A;  2L9V A;  1S29 A;  2QX3 A;  2C6Y A;  3GIR A;  4G6T B;  2E7X A;  3FKI J;  4RD1 A;  5E8G A;  2O03 A;  4A6D A;  5EYR A;  4OP7 A;  4RLZ A;  4P3Y A;  3ZRG A;  2AO9 A;  2CW0 F;  4FT8 A;  3HB9 A;  3CCM B;  4I2O A;  3WGG A;  4YIR X;  2O8X A;  2QZ8 A;  1MMG A;  3MVP A;  1OCT C;  4AIJ A;  2QMU A;  2A6T A;  1N0V C;  4XSZ F;  1F43 A;  5D4S A;  2R7Z J;  2V1X A;  4KIF A;  3QWL A;  3QP5 A;  3U1K A;  2CV1 A;  3HRU A;  2NNY A;  2DOD A;  2ZXJ A;  3IV5 A;  4P1W A;  4ZYA A;  3JX8 A;  1Z6R A;  2HNH A;  5HS7 A;  3SY2 A;  4MHG A;  3R0A A;  4BBR J;  2VBT A;  3WXM A;  2CWE A;  3W3C A;  2W82 A;  2EIM H;  1ZRF A;  1VQN B;  4CQJ A;  1KU2 A;  2HKX A;  2PIA A;  1FY7 A;  2XT4 A;  3H9G A;  3VOD A;  3E0J B;  4HF0 A;  2DPU A;  1YX2 A;  1E62 A;  1USS A;  2M8E A;  1LVK A;  4C2T A;  3K1P A;  4BHP A;  1LB2 A;  3KZY A;  1UST A;  2V1D A;  1RQP A;  1TBX A;  2HWV A;  1LEB A;  4CSW A;  1I5Z A;  2Z5U A;  2WAE A;  2E35 A;  1JKO C;  2CND A;  1ORK A;  1JGS A;  3F3X A;  3N05 A;  3G05 A;  3B8Y A;  4PK4 A;  5FFX A;  4YZX A;  2JJ1 A;  2RGV A;  3Q0W A;  2WV0 A;  1WJE A;  1SD4 A;  4BUP A;  3CC7 B;  2JA2 A;  1FX7 A;  3BR1 A;  1Z9C A;  3MKL A;  2GJK A;  1E1R A;  2BYV E;  4DQL A;  4GXO A;  1V54 H;  3Q39 A;  2E60 A;  5E1Z B;  4AWX B;  1P92 A;  3LA7 A;  3TQN A;  3HHH A;  4DGW B;  3OYD A;  2X3H A;  2VXD A;  5F0F A;  2BEO A;  4HA8 A;  4ENM A;  4CIC A;  2DI3 A;  1I27 A;  1K6O A;  1WU8 A;  1WI3 A;  3KRG A;  5KHD A;  3CD6 B;  2O7O A;  2AQF A;  3FHZ A;  4NHJ A;  2D9R A;  2CRG A;  2QUF A;  3P4G A;  3WY9 A;  3KFW X;  2D3N A;  2IVM A;  4XKB A;  3OSG A;  3GF2 A;  4TT3 A;  3SYJ A;  5LEJ A;  1K9M D;  1E2X A;  1QPI A;  2HS5 A;  3EET A;  2KPM A;  4RDJ A;  2FNA A;  2DT6 A;  2R3S A;  3CMA B;  4YRV A;  2ZJR F;  1QRY A;  3S14 J;  3FDY A;  1R9T J;  4BAY A;  2XSJ C;  1U5T C;  4L9T A;  4N3N A;  5LLQ A;  3OW7 A;  2RDP A;  3K70 D;  3E5Q A;  1VQP B;  4MLO A;  1F1Z A;  1HF2 A;  1S3J A;  2ZBU A;  4NQW B;  1X19 A;  2Y9Z A;  3CCY A;  3OOU A;  3NWT A;  2V7W A;  4PFP A;  1R23 A;  2OC6 A;  2A69 F;  4RLF A;  5LGU A;  1J0R A;  1W5T A;  2IGO A;  1OCZ H;  4OIR F;  1ZRC A;  1T6Z A;  2A05 A;  3W2I A;  2QGG A;  5FGM A;  3DKW A;  4Z4T A;  1FEX A;  5JFR A;  2VPL A;  1N8R D;  5DCF A;  3ZSC A;  1K6Y A;  2FOK A;  3WGH A;  3LVB A;  3K4N A;  4A0Y A;  1B23 P;  2HZD A;  4RDU A;  3HUG B;  3BZC A;  4F3Q A;  3W2F A;  3QOE A;  1OGJ A;  2K3F A;  2LMD A;  1ZM4 A;  5B5E C;  1FC3 A;  1YIO A;  3DU5 A;  1QX4 A;  1LEA A;  2RQP A;  1D8T A;  4M74 A;  4DNT B;  2NTB A;  5B66 C;  2XB5 A;  1N08 A;  3MZY A;  2VI6 A;  1VQP I;  4GYG A;  1ODD A;  1VQ7 I;  3UW0 A;  1D8J A;  1Y8Q B;  4YZQ A;  3CO6 C;  4RGU A;  4ZDL A;  1KJZ A;  4QUZ A;  2CW8 A;  2FOW A;  1SFX A;  3C1D A;  2O61 A;  3MMP A;  2ZZF A;  1K79 A;  3B8H A;  2XTW A;  2P6T A;  1VQK I;  3BG5 A;  2E1R A;  4IEJ A;  1KK1 A;  4HIZ A;  2BM4 A;  3Q0V A;  1IN8 A;  1VQ9 B;  2Y0S N;  2RQQ A;  2RVC A;  3ONQ A;  5FO5 A;  1I18 A;  3OOP A;  5DCM A;  2NVX J;  3GTJ J;  1T5E A;  3QYB A;  1OGM X;  1HDP A;  1U2W A;  4IXA A;  5EEA A;  1OMI A;  2GJR A;  3HDD A;  3J7Z I;  3Q6R A;  2D1H A;  4FCY A;  2Y48 A;  2IEK A;  2JJ7 A;  1DP3 A;  3BQZ A;  5HVQ C;  4CDG A;  1VQ6 B;  3I55 I;  3M4O J;  1GUU A;  2VNK A;  3WHC A;  2PJR A;  4I98 B;  5D5U B;  3S2W A;  1LKX A;  2GOX B;  5LEK A;  3ES9 A;  4EMS A;  1U78 A;  4L18 B;  1LNW A;  1OQY A;  1D0Z A;  1ZLJ A;  1D5V A;  1FSH A;  4G7W A;  3CCJ B;  1S4M A;  2WY8 Q;  1UG0 A;  2EZK A;  2M4K A;  4QWQ A;  1JI8 A;  3ERM A;  2DA2 A;  1WFX A;  2MD5 A;  3G1O A;  4ZCL A;  1K8F A;  2BM7 A;  2X1D A;  3TKY A;  3WTV C;  4XON A;  1S7A A;  3RSN A;  2C5H A;  2HCJ B;  4CYC A;  4I01 A;  5H20 A;  2J7K A;  4M72 A;  2HTS A;  1N78 A;  3JRF A;  3PSS A;  2MLG A;  1ZG1 A;  4F55 A;  1BA5 A;  3QFT A;  1GVD A;  1MBF A;  1LVA A;  2HQN A;  3IH2 A;  1X1A A;  3M1C A;  5HOD A;  3FWE A;  5DD8 A;  1XX5 A;  3S32 A;  1XSX A;  1HW2 A;  3HRT A;  4RPD A;  3P9I A;  1IXR C;  3HPG A;  3VO2 A;  3DKX A;  5HZB A;  2XPW A;  3BC9 A;  3TW6 A;  1IXS B;  3B6A A;  2PBI A;  4DZP A;  2XGE A;  3OAA A;  2E2I J;  1U9N A;  2PJR B;  2ZL5 A;  1OCO H;  1WH5 A;  2O0V A;  3L2U A;  2AHQ A;  3SLD A;  2YR2 A;  3Q0U A;  1FYK A;  2DT5 A;  1BC7 C;  2PG4 A;  2X6Y A;  5FFZ A;  2NVT J;  1V5F A;  3LL7 A;  1YJW I;  4G1B A;  2E34 A;  3GZ6 A;  1D1B A;  3RZO J;  4HEA 2;  4XKW A;  1EA0 A;  4Y9R A;  1YS7 A;  1MW7 A;  2W84 A;  2YS9 A;  3KE2 A;  1IN6 A;  3GZ5 A;  1KK3 A;  3GQB A;  1ONV A;  5FO0 A;  1G7T A;  5GPC A;  3CES A;  1ZG5 A;  3ZQL A;  3TGN A;  2QEX B;  5F4O A;  2R9V A;  2HQR A;  4M9X A;  2L9N A;  2C2W A;  4BJ6 C;  2VN2 A;  3D5S C;  2F5C A;  2GOM A;  5FD6 A;  3S1Q J;  4RS8 A;  1Y6I A;  2D1V A;  2QQA A;  2KFD A;  4UHT A;  2FNP A;  5ILV A;  5ED4 A;  3AL0 C;  2P3M A;  2IJL A;  4Z1M A;  3DPU A;  1QNT A;  2VBS A;  5FKN A;  3S2H J;  3H36 A;  3H94 A;  2O0W A;  2UWM A;  3Q9V A;  5FRN A;  3BZK A;  3CCE I;  4G7H F;  3UR3 C;  4R1H A;  3D26 A;  1PVE A;  2A6H F;  3LFK A;  2PMU A;  2RKH A;  3LSP A;  3KP7 A;  2Z99 A;  2XAJ A;  5JLX A;  5IP9 J;  1JKP C;  2VOD A;  1RMG A;  3ZQC A;  3CUQ B;  3VST A;  1JKR C;  1DAR A;  2COB A;  4Z4V A;  2EA2 A;  3FK6 A;  1P9Q C;  4BXX J;  2IA2 A;  1BJK A;  5FRM A;  4OZY A;  4Z03 A;  3OOC A;  2MH2 A;  2R5Z A;  1SAN A;  3B90 A;  3JRG A;  1QBJ A;  1X3U A;  3WND A;  3JSP A;  3PNV A;  2DMU A;  1FRQ A;  3BJO A;  1O7F A;  4Y15 A;  2HU9 A;  3WG9 A;  1HF0 A;  4DNC A;  1O8M A;  4A3G J;  1IB0 A;  4RA2 A;  2HEO A;  4P5O A;  3S3M A;  2O5R A;  4G7O F;  1J9I A;  1YX3 A;  3T8T A;  2XNJ A;  5ILU A;  3A4C A;  1TTT A;  1RQR A;  1W2B B;  1REP C;  1WHU A;  2PN6 A;  4YZ0 A;  3TO6 A;  1QQ1 A;  1DQU A;  4M3G A;  1AOY A;  2FVG A;  3TO7 A;  1Z21 A;  3SFI A;  3CDH A;  2XTY A;  3IAM 2;  5HLT A;  1VFC A;  2IS4 A;  4JX5 A;  3OYH A;  2I5U A;  3CUQ A;  4Y52 J;  1K4Z A;  4OOV A;  3GTP J;  4NBS A;  1IUF A;  1MBE A;  4HPQ A;  2C77 A;  1TL8 A;  1A6Q A;  4LK0 F;  5J4Y A;  3IKT A;  4PAB A;  1TSP A;  2UVE A;  3IH3 A;  2NT6 A;  2CG4 A;  3U9G A;  5BSY A;  4LG0 B;  2NVY J;  2JWT A;  1XG1 A;  1BR4 A;  1XGM A;  1TT0 A;  1XPX A;  1KU7 A;  1SKQ A;  5F4J A;  1CZF A;  5DUK A;  4UY8 I;  5EZG A;  5DM7 F;  3G71 B;  1XE1 A;  2OTJ B;  3RTR A;  4K2E A;  2WTE A;  1G7C A;  2GZW A;  4CCK A;  1W1W E;  5B1A H;  3JW4 A;  3K1N A;  1YW9 A;  3A01 A;  2C78 A;  1IJF A;  3WTT C;  3NB2 A;  3L2R A;  1NBM A;  1TWG J;  3I71 A;  4GFB A;  3ZMD A;  3CW2 A;  2VJI A;  2ZB9 A;  4ESF A;  4XK4 A;  2WAF A;  1ETO A;  1MBJ A;  4UV8 A;  5E3O A;  4U88 A;  5CPR B;  3BJA A;  3ZMZ A;  4XIC A;  4UVB A;  4PGH A;  1OB5 A;  1VQL B;  1B72 B;  1JTA A;  2FX3 A;  2BW3 B;  2UXX A;  2B7B A;  1T95 A;  3ZN1 A;  1HLV A;  1W5S A;  4LD5 A;  4XL9 A;  3P5J A;  2K4J A;  3EYI A;  2KRC A;  1IRX A;  3MWM A;  1SMY F;  3P9C A;  4O5V A;  1FNB A;  4J19 A;  4DJA A;  4MQV A;  3OYN A;  2VE8 A;  2AXL A;  4UUV A;  3JSO A;  3K7A J;  3FJO A;  2M5S A;  5DS0 A;  2E1B A;  1WXR A;  2Y2Z A;  3BC8 A;  3E97 A;  1I7P A;  5CQE A;  3FKS A;  5E20 A;  1FIP A;  3W2V A;  3CME B;  1ON2 A;  1F36 A;  4PC3 A;  2W4S A;  4YFN F;  2O6G E;  3TED A;  3CP8 A;  4MEX F;  1UD3 A;  4WQM A;  2ZZE A;  1NB9 A;  3SKB A;  2C4T A;  3CC4 B;  2MFZ A;  4OIN F;  1W0J A;  3B02 A;  4E7K A;  4BKX A;  2XOK A;  2A68 F;  3IWZ A;  3GQ8 A;  4P96 A;  3GQ9 A;  2E19 A;  3KZI C;  4ZGN B;  2VQC A;  4BQQ A;  4XRM A;  1QZY A;  3E6M A;  3VYS B;  1VQ5 B;  3CMY A;  3I0T A;  4IRG A;  3J7A O;  1YE9 A;  3BR5 A;  3RPU D;  4QFM A;  5KVR A;  3I5U A;  3WTY C;  1X3W B;  1HBX G;  1QZZ A;  1MD0 A;  1QUE A;  2P8T A;  2X6O A;  3CMM A;  4HNV A;  3ECO A;  3HM5 A;  4HSR A;  2RNJ A;  5M3M J;  1DU0 A;  3E1Y E;  3KEY A;  3V7C A;  5BS6 A;  1ZG3 A;  2JK3 A;  5H59 A;  1L3L A;  4ZYD A;  1IDY A;  2V7F A;  1VQL I;  3H5N A;  3BPX A;  1KD1 D;  1HA8 A;  4OU0 A;  2K9L A;  3U2R A;  2CQK A;  3NAU A;  4CO8 A;  4V02 C;  3DDY A;  2L9S A;  3SQV A;  5CVI A;  1YO5 C;  3PA1 A;  1U0J A;  3BG7 A;  4XLE A;  4Z4U A;  1Z77 A;  2ADU A;  1FPQ A;  2VBE A;  3ABM H;  5LRS A;  4WK8 F;  3BCA A;  3BRO A;  4A2U A;  4ASN A;  3PSI A;  1FZP B;  3QP6 A;  3RKY A;  3BCF A;  1R5G A;  5FB2 A;  1EWY A;  3QPT A;  2VQH A;  5FL7 A;  3F8C A;  2EIX A;  5DV5 A;  1ZGW A;  4JRA C;  1QGA A;  1QHH D;  4W8Q A;  1FNC A;  3IC7 A;  4U0V A;  4BJ5 C;  2A07 F;  1GO2 A;  3AGQ A;  2CO5 A;  4G7Z F;  1FMV A;  1IO2 A;  1BR2 A;  2WAQ A;  2CQN A;  3E5U A;  5HLI A;  2K3P A;  2DFE A;  2HR3 A;  3B73 A;  2TCT A;  4L5I A;  1TNT A;  2KRH A;  3S1R J;  5LHH A;  2KL4 A;  2KVO A;  4ASU A;  2QSF X;  2DDA A;  3ZBU A;  2QF7 A;  2LLK A;  3JQP A;  1XD7 A;  2BGC A;  4HV6 A;  3HRS A;  3ZQG A;  4P1V A;  4PJ0 C;  5C1E A;  5L46 A;  2BE5 F;  1OFE A;  3I64 A;  1W34 A;  1O8I A;  1X1D A;  5E1W A;  3OZV A;  1AMO A;  3KP5 A;  1BBY A;  1T98 A;  4CHU A;  2UXN A;  4YC5 A;  1B59 A;  5CDF A;  1EA3 A;  2RC4 A;  1NJI D;  3DEU A;  3HSF A;  3HUG A;  5TV2 A;  2V26 A;  1QVT A;  3A0B C;  3QFS A;  4MTE A;  2HDW A;  2GWR A;  2VBU A;  1H85 A;  3ZXS A;  3OS0 A;  3OYG A;  3HTS B;  4QVJ A;  3H5A A;  1TYU A;  4E7S A;  4Z4S A;  4OJL A;  4BXU A;  3PIO F;  2QN6 A;  4E4H A;  4IZZ A;  1I6X A;  1Y39 A;  1YJW B;  3WE2 A;  2D2W A;  3FPP A;  2K85 A;  3KLN A;  4ZDO A;  4MYU A;  2H6C A;  2XKO A;  2FMY A;  4BDZ A;  1FJL A;  1W7P D;  3KP3 A;  3FMS A;  4RDK A;  5IYB J;  4IO9 F;  4B4D A;  1UCR A;  3MAJ A;  3SZP A;  4MFE A;  1G7S A;  3WBK A;  4ZYG A;  5JMC B;  1WKM A;  2K5C A;  2LY1 A;  2PE3 A;  1MSF C;  2H8W A;  2B0R A;  1E0E A;  2F5D A;  1UB9 A;  4UZU A;  1X58 A;  2M9H A;  3GUD A;  1GVH A;  3S16 J;  2LYC A;  3EQL F;  2QTZ A;  4XMY A;  4BGD A;  3MCA A;  5FLX Z;  4B8X A;  1MSE C;  3TBI A;  1O8L A;  2GA2 A;  3S3N A;  2VUM J;  3GTO J;  2M7B A;  2Q2E A;  3ASN H;  1OFC X;  5DCM B;  2XAS A;  2XUB A;  5D5X B;  3GYH X;  3GVK A;  4IX7 A;  3OIO A;  3H9J A;  4A3L J;  2OD5 A;  1NHC A;  4OAY A;  3S1M J;  1FOY A;  4Q47 A;  3BCB A;  1KON A;  1GLN A;  5CVR A;  2VJ4 A;  3ZZU A;  5DEQ A;  4QLC U;  1GQ8 A;  4X7E A;  4BHC A;  2XHK A;  1I1G A;  1JGG A;  2C5B A;  4LBV A;  2VIX A;  3FZV A;  5J1Y A;  1ZR2 A;  1PJ5 A;  3MMY B;  1GV5 A;  2BVN A;  1GXQ A;  1MMA A;  1XSV A;  4I6Z A;  5TRD A;  3ZPL A;  4PDK A;  2BSP A;  2R7O A;  2EFW A;  2BV6 A;  2QKL B;  1OKR A;  5L3B A;  1R71 A;  4YFO A;  4HZF A;  2ZTN A;  4B44 A;  3F9K A;  1IRF A;  3DXJ F;  2LBF B;  1QGP A;  4M3B A;  4A3J J;  1XCV A;  3KP6 A;  4HWV A;  2V9K A;  2FBH A;  1AKH B;  3V8K A;  2W6J A;  2Y0S A;  3OYF A;  3K70 C;  1WTH D;  2Q2E B;  3LWF A;  4JOM A;  4ACA A;  1PKV A;  3RKX A;  2XZO A;  5E79 C;  2VC0 A;  3HOY J;  2EIL H;  1TYV A;  4RD0 A;  4LLG F;  1T33 A;  3KCC A;  4ESJ A;  2BPO A;  4FAS D;  2DW4 A;  2BM1 A;  3H3U A;  1D0X A;  1L0O C;  3FX3 A;  1DGW Y;  1WJA A;  3V7S A;  3TDZ C;  3R6J A;  3GFJ A;  3K69 A;  2K40 A;  4KH3 A;  2BY0 A;  3F6O A;  4J01 A;  1KK0 A;  5GV7 A;  1ETV A;  2DQR A;  4BE1 A;  1EP1 B;  5J1U A;  4P6V F;  3BH4 A;  2DOA A;  1H8A C;  5HLH A;  1PJ6 A;  4LMY A;  3SEJ A;  5ICE A;  3FXL A;  4J00 A;  3JRD A;  4OMZ A;  3CC2 I;  1YJ9 I;  2KIF A;  4AU7 A;  4BEH B;  1FBU A;  2XF7 A;  3WTX C;  4EJT A;  1BR1 A;  3GX4 X;  1N06 A;  2MC3 A;  1J59 A;  5C4X J;  2GRE A;  4EJO A;  2L5Q A;  3F21 A;  1W36 D;  5BNG A;  3OEH A;  2P5V A;  3HPH A;  4LJZ F;  1B6A A;  2CUF A;  2Q8K A;  2R7Q A;  2BGI A;  2QXZ A;  5K7H A;  1VQM I;  1W9X A;  2HDC A;  1RUO A;  3PA2 A;  4DYQ A;  2DJI A;  4XLP F;  2VBY A;  1TUI A;  4OOS A;  4X06 A;  2XZL A;  3V8L A;  1ZN2 A;  1A6I A;  2YWG A;  4AYB N;  1PE9 A;  5H6R A;  1IGN A;  1LJ9 A;  3J81 k;  2TDX A;  3CCV I;  4M0L A;  4GO1 A;  3DWL E;  4CGZ A;  1O3Q A;  3ZC3 A;  4ENJ A;  2RC6 A;  1UHS A;  2XAU A;  3WTU C;  5CQG A;  2XDV A;  2L54 A;  3VYT B;  5DD4 A;  3R6S A;  1E43 A;  3LNN A;  3CCU B;  2PX9 A;  3SDB A;  3S3O A;  2ZL6 A;  2K9S A;  1B9M A;  2L3D A;  1MNE A;  1BW6 A;  2DA5 A;  2Y75 A;  2OJE D;  1LFB A;  3TP0 A;  2VBK A;  3LSJ A;  4RAG A;  3VDX A;  1T38 A;  1VQ5 I;  2ZZQ A;  1TQI A;  2HTJ A;  3G1L A;  1TW3 A;  2DLL A;  2CUZ A;  2W85 A;  1V5E A;  2Y0M A;  5AIP A;  2E2J J;  3BT9 A;  5FRO A;  3CJR B;  3W2W A;  4XLH A;  1JA0 A;  2LSO A;  1Y0N A;  3ISP A;  4JMQ A;  1RI7 A;  2JN6 A;  1HXD A;  3SYT A;  3CCU I;  3HBL A;  3ASQ A;  4BYY A;  3OP1 A;  2DDB A;  5D8K B;  3BG6 A;  2RRE A;  5FIU A;  1VI0 A;  1WRJ A;  2P81 A;  4KIB A;  2BBY A;  1W36 C;  4B3G A;  1OR7 C;  2ZJQ F;  1HZE A;  2QDX A;  3FHN A;  4G94 A;  3AG4 H;  2HOS A;  1O8E A;  4NK8 A;  2KQR A;  3NAR A;  3AK5 A;  2DOF A;  2NVU B;  2DJN A;  1EE6 A;  4C3J J;  1RES A;  4BAC A;  2DO7 A;  5K7F A;  3CLO A;  3M1E A;  2DPD A;  3FIW A;  3LSR A;  3I3L A;  3ONU A;  2N8G A;  1MMN A;  2L7F P;  4V2G A;  3N90 A;  3CQZ J;  3EQO A;  1G6N A;  5KSW B;  1ZTR A;  2BHZ A;  1W87 A;  1NTC A;  4WXD A;  4LBY A;  2QKM B;  4YCQ A;  3ROU A;  4E7I A;  3ZZT A;  4C43 A;  3K9T A;  1IB4 A;  2KZV A;  3WTW C;  4PZJ A;  4PC6 A;  4M6Y A;  1LDJ A;  1WJC A;  4AVZ A;  3BNW A;  4LBZ A;  2M34 A;  2OQG A;  1OFL A;  5K7Z A;  2FBI A;  2CC2 A;  4RAY A;  4CZZ A;  3QPH A;  1NK2 P;  3A01 B;  4IHY A;  5E3L A;  6PAX A;  1P4W A;  1WVR A;  3NQO A;  2CGP A;  2OA4 A;  5A2Q Z;  3JQQ A;  3DF8 A;  1RKW A;  2QVO A;  2FD5 A;  3G6E I;  2V7Q A;  3PO2 J;  2EA4 A;  1UHW A;  4Y17 A;  2A61 A;  1OCC H;  3A1Y A;  5B1B H;  3HSR A;  1YW8 A;  4TMX A;  2XAF A;  2IW5 A;  5F0C A;  3E7L A;  4OIP F;  3JTG A;  1FSE A;  1OLT A;  3DP7 A;  5J47 A;  1ZR4 A;  1TWF J;  1XC5 A;  3OYC A;  4P9S A;  2B7C A;  3QU3 A;  1ETW A;  5CYV A;  2JSP A;  3R6K A;  2CQQ A;  1UEL B;  1X4P A;  2QA4 I;  2R7X A;  2O9L A;  4XLC A;  5ILS A;  5ICF A;  3QFR A;  3W5V A;  2QQ9 A;  1BIB A;  4PSW A;  4AID A;  2NTP A;  3RZD J;  2ZTG A;  3MFK A;  3H3Z A;  2B7E A;  2LC2 A;  3GVL A;  3HOX J;  4A3B J;  3FXK A;  3DBR B;  2CW7 A;  3H92 A;  1AU7 A;  2AS5 F;  3V42 A;  1GJR A;  2EIN H;  1ENH A;  3F22 A;  2VON A;  1E3H A;  4E70 A;  1FIA A;  3RJP A;  2ZXH A;  4CZC A;  4II2 A;  4FTH A;  2F5F A;  1IJW C;  1E79 A;  4G1V A;  1WP6 A;  1Q86 D;  3G4S I;  3T0Y A;  3JQR A;  1QRB A;  3QQA A;  2H8R A;  3ABU A;  5DSZ A;  1E3X A;  3OYB A;  4HF1 A;  3CPX A;  2ZIT A;  1GAW A;  4IJA A;  2VBM A;  4IHT A;  4II3 A;  4M4S A;  3CF5 F;  5FKL A;  4YAF A;  2WSS A;  2P5L C;  1N05 A;  3QOP A;  3K1M A;  3KYL A;  4XN3 A;  2XND A;  4U49 A;  1IA5 A;  3RKQ A;  3BWG A;  2R7S A;  3LQE A;  1ZGA A;  2OK8 A;  4IQJ A;  2V7U A;  1Z1D A;  3W2G A;  1OFM A;  4BHB A;  5A88 A;  2WAQ N;  4YEJ A;  1JUS A;  1X1P A;  3GXO A;  3JRE A;  2JMW A;  4QSH A;  2Z6B D;  2RAE A;  4PJN A;  4URR A;  4DYR A;  3N6Z A;  3FXO A;  4QIW N;  2CJJ A;  4FQG A;  3WQZ A;  3FKJ A;  3T1B A;  3L2C A;  4IOA F;  1GAQ A;  1KYZ A;  1V5G A;  2V4J C;  1RNL A;  4OOI A;  2ESN A;  4FN5 A;  4XLA A;  4ESB A;  1VLY A;  2XF6 A;  2X0K A;  4I76 A;  2GBY A;  1LFU P;  3A0H C;  1VQ9 I;  4AC9 A;  4M73 A;  1IRZ A;  1BX1 A;  2JRM A;  3WOD F;  5HS8 A;  1D0Y A;  4WZE A;  4NDL A;  2R93 J;  3T8R A;  2FQ4 A;  3M8F A;  1I8D A;  3FXU A;  1YI2 B;  3K2A A;  4TSF A;  3I59 A;  1NRK A;  3GW2 A;  1MDM B;  2B63 J;  4WCG A;  3ASR A;  3SXY A;  2X8K A;  4CYC B;  1HDD C;  1TQP A;  3RKW A;  2PMH A;  1BIA A;  1Z3X A;  3CF2 A;  4DIQ A;  3LAP A;  1RR7 A;  3TL4 X;  1O57 A;  5EGO B;  1T6X A;  2X1E A;  4B09 A;  5CJ9 A;  3K4M A;  1UD6 A;  5AON A;  4AVP A;  3I54 A;  1IUY A;  1EFR A;  2ZNZ A;  1ZLK A;  4AYB A;  5IK2 A;  1IXC A;  4BNC A;  1OJL A;  1MRZ A;  2DYS H;  1UAA A;  3SEQ A;  3R61 A;  1P4A A;  2MA3 A;  2HPI A;  3BCD A;  4U87 A;  3BG9 A;  2F2E A;  2HOT A;  1GXP A;  1EP2 B;  4IRI A;  1JTX A;  4P26 A;  2OCC H;  3UNG C;  2M8G X;  1QJV A;  1PP8 F;  2XZP A;  2IOU G;  2YWH A;  1KCD A;  1D1A A;  1KC8 D;  5JBQ A;  2IGK A;  3JUR A;  1Z3Y A;  1S9H A;  3I59 B;  3HSE A;  2C4U A;  3SZG A;  3JR9 A;  3GSI A;  4OAZ A;  1VQ4 I;  1SVL A;  1ZAO A;  4CCN A;  3DEE A;  3O3K A;  3LJY A;  2Q0O A;  5F08 A;  1BI2 A;  4LB5 A;  4X7F A;  2L02 A;  1Q1H A;  4XNF A;  4FX0 A;  1IN4 A;  5H6Q A;  3FMQ A;  4BXF A;  1LE8 A;  2DYI A;  1JJ2 B;  3IKV A;  4HNT A;  2OCE A;  3SHF A;  4X07 A;  5HDG A;  2D45 A;  2CBX A;  4PC2 A;  4JX4 A;  1LQ1 A;  2HMA A;  4A0Z A;  1G4D A;  1S7O A;  1S72 I;  2HVR A;  3ASP A;  1R5H A;  2JIZ A;  2W48 A;  2VKD A;  3ZQQ A;  1FWZ A;  3J7A Y;  3HXL A;  2F4M B;  2X9D A;  2OPT A;  2QBY B;  1A04 A;  3GME A;  4CUG A;  2K9M A;  1OYW A;  5K5R A;  4JYK A;  1QO0 D;  2PFB A;  3ZCO A;  1W35 A;  1O8G A;  3HC7 A;  2VPR A;  2DFI A;  1S72 B;  1KQ9 A;  1I3Q J;  4AC0 A;  5GAD J;  4A3E J;  3I56 B;  3IRQ A;  2JT1 A;  3K6G A;  4OJO A;  1IZ1 A;  1I50 J;  1EJ9 A;  2WAD A;  4RAF A;  3LYC A;  2I10 A;  2O8K A;  1B9N A;  3B6C A;  4LIU A;  2DOG A;  3AVT A;  2DXI A;  5J4V A;  3NEU A;  4XQF A;  3CC2 B;  5H5J A;  5JLV C;  3QE2 A;  3MKW B;  3I1F A;  1MJA A;  3FK7 A;  3S17 J;  3ZUG A;  3KX2 A;  1DBO A;  5ERI A;  1I39 A;  1FMW A;  2E7W A;  4PGG A;  5D8L B;  2XIG A;  1WH7 A;  4CCL A;  4YAU A;  1YG2 A;  1QA6 A;  5THX A;  3W5H A;  2ICW G;  3HOU J;  3RYR A;  2KHM A;  1DDG A;  3WU2 C;  1LLW A;  4XOT A;  1J5Y A;  2HLD A;  2ZSH B;  3T51 B;  3ZBT A;  1K5C A;  2OBR A;  4TMZ A;  2WWY A;  3DU1 X;  1XB4 A;  1YIT I;  3BTI A;  4R79 A;  1SEU A;  2VXZ A;  2F5E A;  4BE0 A;  4FXU A;  4Z4W A;  4UAJ A;  4RM3 A;  1RUN A;  3KET A;  3K10 A;  4KFC A;  1XDS A;  4ETS A;  2HXI A;  1D8K A;  1J09 A;  3SJM A;  3G71 I;  2R7R A;  3KYD B;  2DMN A;  2H1L A;  1XGO A;  2M1B A;  4LIT A;  2JTV A;  4WF2 A;  1E3O C;  4Z06 A;  1W7P B;  4IQ4 A;  4BH9 A;  4UNO A;  3H0G J;  3I56 I;  4KT5 C;  4IHV A;  2DFF A;  3VWB A;  2R7T A;  3TO9 A;  1CLW A;  4GGG A;  3DV8 A;  4L5J A;  2E5Z A;  5B3S H;  2BV3 A;  1MH4 A;  2R7D A;  2X6X A;  3KEQ A;  3UKG A;  4HE5 A;  2M30 A;  1OOC A;  2RNG A;  1CQX A;  1G59 A;  2LD5 A;  2W7N A;  3G1M A;  4YXW A;  2L0K A;  3NAW A;  2ZKZ A;  1K83 J;  2VNI A;  3MCZ A;  2W6I A;  1O8D A;  1QA3 A;  4PSX A;  1AIP A;  4LFU A;  2BY2 A;  4C3H J;  2CYY A;  4IOC F;  4D5C A;  2D5V A;  2FE3 A;  1ZM3 A;  4D9J A;  5LBQ A;  3CCS I;  1EZG A;  3DPT A;  3RPQ A;  2QM3 A;  3HKZ N;  2V1U A;  1D1N A;  3GLL A;  5K1Y A;  1QFJ A;  3OWT A;  1VQO B;  5IT9 Z;  2JQ7 A;  2UUZ A;  4DYC A;  3QYF A;  2O1D A;  4DOZ A;  2DYR H;  2FRH A;  5IPA A;  1W7P A;  2IRF G;  1R1T A;  4BY7 J;  1FTT A;  3F0C A;  4GYI A;  4DZJ A;  2XNC A;  2QSG X;  5DNS A;  1VQN I;  1T6S A;  5JR3 A;  5JVG F;  1QH0 A;  2V7X A;  2R7U A;  4FWT A;  2QWW A;  1H80 A;  4RB2 C;  1QPM A;  2WJV A;  2VBW A;  2INV A;  3BPV A;  4GDF A;  1MMS A;  4PGO A;  5AN9 A;  2GIV A;  3KEO A;  2LKS A;  5TJJ A;  1JT6 A;  1R5N A;  4HLX A;  1UD4 A;  1RU4 A;  1KU9 A;  4WX9 A;  3TOB A;  1XS9 A;  1G3T A;  2OTJ I;  1VLO A;  1WSU A;  3CCL I;  4P55 A;  2PYH A;  2WB1 A;  4CCO A;  4FHT A;  3A2K A;  4TMW A;  3HEF A;  4C30 A;  2ELH A;  3ECH A;  1IDZ A;  4MYT A;  1RC9 A;  2XPV A;  1FNM A;  2QQB A;  4WZK A;  3A3B A;  2OTL I;  1WWX A;  3A1P A;  3C3W A;  3DPL C;  4TKO B;  2OK7 A;  1XGS A;  2H09 A;  5HXB A;  3M8E A;  4BE2 A;  5F0H A;  3CCM I;  1P4X A;  2IAI A;  5FLX K;  2K02 A;  4CH7 A;  5EEH A;  2B5O A;  4OM9 A;  1FOX A;  2VYQ A;  2EFQ A;  5EG0 A;  4L9J A;  1BI1 A;  2JPC A;  1LUJ B;  2PEC A;  3LQ6 A;  1MZB A;  4UUS A;  5E3M A;  1ACI A;  4RCY A;  1DGR M;  2ELJ A;  1G3W A;  1I6H J;  1EP3 B;  3EUK L;  5E8I A;  3OE7 A;  5D5V B;  2W1O A;  2EPF A;  4RAZ A;  1KK2 A;  4RPB A;  3G4S B;  4RD4 A;  3FXM A;  4E0F A;  4EH1 A;  4EW9 A;  1R6R A;  4C9Y A;  5FKM A;  1D5Y A;  3SDG A;  5FLM J;  1QZE A;  4KMF A;  2JRT A;  5TIS C;  2QYU A;  2BXZ A;  3GCM A;  2NTQ A;  4XID A;  1COW A;  2MBF A;  1B4A A;  3P7N A;  2E71 A;  2BM6 A;  2YSR A;  1QHG A;  3BY6 A;  4X0C A;  4X05 A;  2P6S A;  5L3G A;  1KTV A;  1H89 C;  2V1N A;  1UFM A;  3C18 A;  5EEG A;  4P9U A;  1UD2 A;  3FMR A;  5A8A A;  1K8A D;  2W7Z A;  4LGW A;  2DU9 A;  5CVJ A;  1ZKG A;  4ZZD A;  2VFO A;  1S6L A;  1JHH A;  3PFI A;  3OYL A;  1B2R A;  1POG A;  1XG2 A;  4UUS B;  2L7K A;  4P3I A;  1KQ5 A;  1CF7 A;  5CVU A;  2HDN B;  4Y7N J;  3NE5 B;  5IYQ A;  3OR1 C;  3MKY B;  1FT9 A;  3MKZ A;  1YRN B;  2X3U A;  2A5W A;  4H9G A;  2LK2 A;  2XPU A;  2ISZ A;  2VKE A;  3HGG A;  4GRI A;  4B48 A;  3AAF A;  1XGN A;  2UV1 A;  2CUJ A;  1ZGJ A;  3CJN A;  3F8B A;  3I53 A;  3O8G A;  2HYJ A;  2V6C A;  1WOS A;  3I9V 2;  3REO A;  3CCJ I;  2VBZ A;  3U6B A;  3LOC A;  4EJW A;  2WJY A;  2UVF A;  3OYA A;  4OWR B;  3H9N A;  1LFP A;  1K61 A;  3RI4 A;  1KZL A;  5IYD J;  4KIC A;  2OBT A;  2HDD A;  1E3Z A;  3RYP A;  1CNF A;  3SEZ A;  4OMY A;  4P12 A;  1WMR A;  4IRH A;  1PLU A;  5IT9 K;  1MAB A;  1ETY A;  1JHF A;  2WV1 A;  3M9A A;  4E7J A;  3WNC A;  4YDT A;  2X0L A;  4MFD A;  1SD5 A;  4ITV A;  2IS2 A;  2DMT A;  2LVS A;  4Q48 A;  2I8D A;  3F8N A;  3U6K A;  1EKE A;  1FP2 A;  2HI3 A;  2XEX A;  1I3A A;  2XAQ A;  5CVV A;  1CNE A;  2CU7 A;  5DN6 A;  3VB2 A;  5FNZ A;  4MQ9 F;  2LH9 A;  4FE7 A;  2CFO A;  3U2Q A;  4HW0 A;  1A8P A;  4KYW A;  2BMW A;  2Y31 A;  3PM1 A;  3OMY A;  5KCM A;  4P2N A;  3CB4 A;  4ROX A;  2LNB A;  2YX7 A;  2HFH A;  4ZH4 F;  1TC3 C;  4ZCM A;  2EFO A;  3ZQF A;  1K28 D;  3VMW A;  3L1P A;  3OYJ A;  4DW6 A;  4Z2Y A;  1HSJ A;  5LGT A;  2YU9 J;  3L09 A;  1U8B A;  5EF6 A;  4IHW A;  4MEY F;  3L2W A;  1R49 A;  4I99 C;  1IW7 F;  1OIS A;  5D5W B;  1R4M B;  4ZYE A;  5FKO A;  1ZM9 A;  4OJ6 A;  4MTD A;  2A5Y B;  2VQL A;  2ODL A;  1XCB A;  2V7T A;  1O8J A;  4I7H A;  3GTL J;  4C2L A;  2TRT A;  5ICG A;  1IHM A;  3H1C A;  4XLN F;  3IWF A;  5L3F A;  1TT5 B;  4A3I J;  3TH0 A;  3HKZ A;  2EBI A;  2MG4 A;  1X4O A;  3ZP5 A;  2BOL A;  1Y8R B;  3PSZ A;  2L7M P;  1LDD A;  4RLQ A;  1KZH A;  1IDK A;  2VBV A;  3PUM A;  2G7H A;  3CCV B;  2IXS A;  4I0B A;  2CK3 A;  4U0Y A;  4HYE A;  3LMM A;  4P6Y A;  2Q1Z B;  2R7V A;  1DP7 P;  1P7J A;  1XMX A;  3ZPN A;  4BQA A;  2HYG D;  2ME6 A;  3D1N I;  1HVX A;  4TMT A;  1VQM B;  3KPH A;  2KDZ A;  4DK1 A;  2CQX A;  4HBL A;  4WWV A;  3LAJ A;  2FX0 A;  4CCM A;  1PUE E;  2EH3 A;  3AVX A;  2NYX A;  1DDN A;  2D74 A;  3A8I A;  3B4N A;  4JBA A;  2BSA A;  3ESW B;  1WPC A;  1XSD A;  5HNF A;  2O6W A;  5J35 A;  1N0U A;  1WQ2 A;  2VJJ A;  1EFT A;  4ACB A;  4OPO A;  1KA8 A;  3N4M A;  4Z05 A;  1ELO A;  3CCQ B;  3AVY A;  2DER A;  3H5R A;  1BI3 A;  3PL8 A;  4Q7J B;  4RGS A;  3ZQI A;  1OCP A;  3BH6 B;  1DU6 A;  1RRJ A;  5M3F J;  9ANT A;  2B0L A;  1O4X A;  2V4D A;  4U4B A;  1J2X A;  1VF9 A;  3AVV A;  4BU2 A;  1VND A;  3HRM A;  2X51 A;  4G6Q A;  2QBY A;  2ZC2 A;  3LA2 A;  3GBG A;  3PNY A;  3O6B B;  2GXG A;  1FND A;  2IP2 A;  4OIO F;  2GJP A;  2EV5 A;  2STW A;  1OYI A;  3OFN A;  1DPR A;  1RET A;  2NNN A;  2V79 A;  5CKT A;  2P7V B;  1JNY A;  3HYI A;  1Z7U A;  3BJ6 A;  3LFU A;  1NH3 A;  1K7A A;  1R1U A;  3FXR A;  4DBR A;  2ZME A;  1FOK A;  1J9Z A;  3PEN A;  5GAE J;  2XGD A;  2BZT A;  4YEI A;  2G0Y A;  2Z3Y A;  2KIS A;  4AUX A;  1KRH A;  3AST A;  4MNU A;  4HX4 A;  3J80 Z;  3WNB A;  1OB0 A;  3EUH A;  4I0A A;  4QPO A;  3CC7 I;  1R4N B;  5TY0 A;  2R0Q C;  1YJN I;  3QU6 A;  2PYG A;  5HZA A;  2HOA A;  5LHG A;  1BX0 A;  3FBI B;  1BI0 A;  2ZBK A;  5GAG J;  1VBL A;  4KKT A;  3GRH A;  4S0H B;  2K9Q A;  4NUB A;  4N3G A;  2F4O B;  1WOR A;  1N75 A;  1TLH B;  2E1N A;  2MAB A;  3JCU C;  4O3M A;  4Z6Y A;  4U9U A;  1YLF A;  3V7R A;  4HX7 A;  2LTP A;  3GWZ A;  1H9T A;  3PVD A;  1S5L C;  2H94 A;  2EV6 A;  3SQN A;  4B1R A;  4OOX A;  3KIO A;  1ETX A;  4KKU A;  4A0X A;  3BY2 A;  4LBW A;  3VMV A;  1V5V A;  2WYR A;  3HOT A;  1UJ8 A;  3K0L A;  4B4C A;  3BG3 A;  1SFU A;  1J75 A;  3GVA A;  2DMQ A;  4UVC A;  3IH4 A;  2VOO A;  2EIJ H;  1V0F A;  3CRZ A;  2OF7 A;  3SZT A;  5GTI C;  2PLY A;  4A5M A;  3L2V A;  2BF4 A;  1EH8 A;  1P7I A;  2BHY A;  3JRH A;  4ZTJ A;  5BPI A;  1T39 A;  2W24 A;  3SJZ A;  4V19 K;  1OPC A;  3VNV A;  2COM A;  2BGJ A;  3JAM K;  2DY1 A;  3BLY A;  1MKM A;  4X0G A;  1JT0 A;  2VC1 A;  1A35 A;  5HNH A;  2JUC A;  3FF5 A;  3FIS A;  4YAW A;  2XV4 S;  1EH7 A;  2BVL A;  3L9F A;  1GVJ A;  1VQ7 B;  1TW2 A;  3ISX A;  1TWA J;  2FUG 2;  4A6E A;  4ZDP A;  2EFN A;  1FP1 D;  3LST A;  2EK5 A;  3OZW A;  3A8J A;  2DET A;  4NNJ A;  1G3S A;  3BDD A;  5DYM A;  3Q5F A;  1WPK A;  4A5N A;  2W25 A;  1LDK B;  2EZI A;  2V9V A;  4E7L A;  2JVH A;  3BQJ A;  4KT6 A;  2E2H J;  2KZG A;  3SLN A;  4LG0 A;  4BPR A;  5EMN A;  4RB0 A;  3CC4 I;  4U0W A;  3KP4 A;  4FET A;  3OIQ A;  2HZT A;  2WC2 A;  2KKO A;  2KJC A;  4A3D J;  3WE3 A;  2DN0 A;  3R0J A;  1ZUN B;  3G73 A;  3IHU A;  4KKS A;  2NV4 A;  1TYW A;  1TTY A;  2KJB A;  5DUI A;  2L2O A;  4RM2 A;  4PMH A;  2VB6 A;  4A69 C;  4F7D A;  3SZE A;  1WI9 A;  1P2F A;  2OU2 A;  3OR2 C;  1M90 D;  4OZZ A;  3D5R C;  4HNU A;  2IS6 A;  1L1I A;  1IDJ A;  2M2E A;  1MMD A;  1O8H A;  1B72 A;  3SUC A;  3MZH A;  3ZMS A;  2G9W A;  3ASS A;  2KIQ A;  4O6J A;  4BJT A;  1D1C A;  3F8M A;  3C2H A;  3EPZ A;  2GK7 A;  5TGT A;  2F6C A;  2ZSI B;  1KU3 A;  4AIH A;  2XRL A;  3B78 A;  3ZMT A;  1IC8 A;  1WJ5 A;  1S8N A;  2BM5 A;  1ZQ3 P;  4W8R A;  1Z05 A;  3KYC B;  4WZL A;  4XRS G;  3RIR A;  1ZRD A;  4RD3 A;  1VHO A;  1AA7 A;  2EWE A;  3F72 A;  5IP7 J;  4M1K A;  3CMA I;  3DTI A;  2LZJ A;  3DBH B;  1T0F C;  3TOA A;  1Z0X A;  1OGO X;  1GHC A;  4OPV A;  5DS9 A;  1KYW A;  4G5G A;  2ZXW H;  2P5K A;  4FX4 A;  5LD2 C;  4Z4Y A;  4Z4Z A;  1QVU A;  2MGQ A;  1JUM A;  1MND A;  5IYR A;  3W2A A;  1HKT A;  1QFY A;  2MD0 A;  1JB9 A;  3QRF F;  5JVT A;  3VSK A;  4PFO A;  2GXA A;  2ZZG A;  2K4B A;  2GK6 A;  1H0M A;  1U8R A;  1A31 A;  1MJ9 A;  1O3T A;  2VFQ A;  2Q6K A;  3VSV A;  1ZAR A;  3MHP A;  3HOS A;  1YYV A;  3EDP A;  1UD5 A;  1R36 A;  1LLZ A;  1AWC A;  2CH0 A;  3E6D A;  2H27 A;  1KCC A;  1XN7 A;  3U1D A;  2F4N A;  4CXF A;  3ZZ0 A;  4HG2 A;  2GA1 A;  1YHQ B;  1STZ A;  4E7H A;  3K4K A;  1TNS A;  2I1L A;  2OAZ A;  3JRC A;  3W2E A;  1RKT A;  1FDR A;  2VL8 A;  1N25 A;  4L9N A;  4MXN A;  1W0T A;  1N77 A;  1HKQ A;  3WGI A;  3AL0 B;  3CJT B;  1QVG B;  2DQL A;  1MBH A;  3A03 A;  1V55 H;  2XSD C;  2X53 S;  4HRI A;  2HQA A;  4WWC A;  1P6R A;  5M5Y J;  1Q1V A;  4YAO A;  1K73 D;  4GQN A;  1KQS B;  2G0E A;  4ZJZ A;  4IHS A;  4HST A;  1UHM A; 
#chains in the Genus database with same CATH homology
 3CP8 A;  1UD3 A;  1YX5 A;  1VJS A;  2LOO A;  3K10 A;  3AKZ A;  2ZZE A;  2INU A;  2NZM A;  2MFZ A;  1W0J A;  1J09 A;  2M7A A;  4E7K A;  2XOK A;  2R7R A;  3GQ8 A;  3GQ9 A;  4LIT A;  4CCJ A;  4Z06 A;  4L8J A;  2E1M B;  4IQ4 A;  2VQC A;  4BQQ A;  4B3F X;  3OY9 A;  4PUS A;  3VYS B;  4PJJ A;  3VWB A;  2QE7 A;  3T53 B;  1YE9 A;  2R7T A;  3RPU D;  3OYE A;  2JDI A;  5LFA A;  4ZTF A;  2E5Z A;  2E1M C;  2X6X A;  3CMM A;  4HSR A;  3KEY A;  2RNG A;  1O8F A;  1OOC A;  3RCO A;  3IP4 B;  1G59 A;  1DBG A;  2W7N A;  1BHE A;  4YXW A;  4B43 A;  2V7F A;  3H5N A;  2M4G A;  2QY1 A;  2W6I A;  2VQG A;  1HA8 A;  4XD7 A;  2K9L A;  1O8D A;  3PUB A;  2M0M A;  4PSX A;  2KMU A;  3K4C A;  5JHF A;  2P0W A;  4KJZ A;  4F92 B;  2L9S A;  3DDY A;  4D9J A;  3EQN A;  1U0J A;  3BG7 A;  3DPT A;  3DTE A;  4XLE A;  2MYS A;  2VBE A;  3OWT A;  3BCA A;  2IGN A;  2UUZ A;  4B47 A;  3QYF A;  2O1D A;  3PSI A;  2CV2 A;  4LIV A;  4DOZ A;  3BCF A;  5FL7 A;  1O8K A;  1RWR A;  4I84 A;  2VQH A;  4XOP A;  2DCE A;  1QHH D;  2X6W A;  2NOJ B;  4W8Q A;  3H9Q A;  4BJ5 C;  2WPD A;  3JU4 A;  1G8X A;  1FMV A;  3PFY A;  2WY7 Q;  1BR2 A;  1KMH A;  2WAQ A;  3FY3 A;  2K3P A;  3WWG A;  4Y3O A;  2R7U A;  4P22 A;  1H80 A;  2WJV A;  2INV A;  2KRH A;  2IGM A;  3H0D A;  2KL4 A;  2KVO A;  4C2U A;  4ASU A;  1ZEL A;  1BOB A;  3VSL A;  4D1Q A;  4F91 B;  3RQ4 A;  1UD4 A;  1RU4 A;  2NSP A;  2VAS A;  5C1E A;  2HVS A;  2PYH A;  2WB1 A;  2ZXI A;  4CCO A;  2VJ5 A;  3QYE A;  3A2K A;  3KEW A;  1O8I A;  1X1D A;  4C30 A;  2CV0 A;  1PYV A;  1VF7 A;  4XOR A;  3HAG A;  2V31 A;  3T9G A;  4N4N B;  3A3B A;  5CDF A;  1HG8 A;  1E1Q A;  1EA3 A;  4LG3 A;  3OL3 A;  3OS2 A;  4BQN A;  4TKO B;  3DPL C;  2V26 A;  3ZIA A;  1WJF A;  3ZR8 X;  2CMP A;  2HDW A;  4BE2 A;  2V6E A;  3PJR A;  1H8E A;  3EUA A;  3ZXS A;  3OS0 A;  3OYG A;  3H5A A;  4CH7 A;  4E7S A;  4OJL A;  2F43 A;  4E4H A;  4IZZ A;  4BQO A;  3FPP A;  4N4O B;  4ZDO A;  3OL4 A;  4NK6 A;  4EAT A;  3TMO A;  4BDZ A;  2JUG A;  2PEC A;  3U21 A;  1AIR A;  2IQ7 A;  1TZL A;  2LBF A;  1DGR M;  2ELJ A;  2R4G A;  2K5C A;  1X1B A;  2LY1 A;  2Z1D A;  3EUK L;  4Y4R A;  2AQE A;  3OE7 A;  2W1O A;  1E0E A;  4UZU A;  2ZFU A;  3C2G A;  1H8H A;  2W00 A;  4W8T A;  3VR6 A;  2LYC A;  4E0F A;  2QX3 A;  4XMY A;  4BGD A;  4EW9 A;  1R6R A;  4G6T B;  4C9Y A;  3TBI A;  1O8L A;  3S3N A;  2M7B A;  3S8P A;  2NTQ A;  3ZRG A;  2F5V A;  1COW A;  3GVK A;  2KDO A;  3LSM A;  4IX7 A;  3H9J A;  1MMG A;  1QHG A;  2A6T A;  2M3A A;  1NHC A;  2V1N A;  4OAY A;  1UD2 A;  3BCB A;  1KON A;  1GLN A;  2VJ4 A;  4XM3 A;  1BN8 A;  2CV1 A;  1GQ8 A;  4P1W A;  4ZYA A;  3OYL A;  2HNH A;  1XG2 A;  2VIX A;  2L7K A;  3VSU A;  3MMY B;  4NC7 A;  1SKY B;  3NE5 B;  3W3C A;  2W82 A;  3OR1 C;  1MMA A;  4YEL A;  3MKY B;  4E7Z A;  3MKZ A;  2BSP A;  2A5W A;  2R7O A;  3H9G A;  3GQA A;  2QKL B;  3E0J B;  4XKC A;  5KNL A;  2ZTN A;  4B44 A;  3F9K A;  1LVK A;  4GRI A;  2LBF B;  4B48 A;  4C2T A;  1X0C A;  2UV1 A;  2CUJ A;  2V9K A;  4QPQ A;  4HWV A;  3DKY A;  2W6J A;  2Y0S A;  3OYF A;  3K70 C;  1WTH D;  2Q2E B;  4JOM A;  3I9V 2;  2XZO A;  1PKV A;  2Z8G A;  4CSW A;  2WJY A;  2WAE A;  4G6I A;  3OYA A;  4OWR B;  3OPO A;  1JRG A;  1LFP A;  4E6K G;  2UVF A;  1KZL A;  3CP2 A;  4FAS D;  3N05 A;  2Z2S B;  3G05 A;  1D0X A;  4PK4 A;  3LSG A;  1E3Z A;  3B8Y A;  4YZX A;  2JJ1 A;  1DGW Y;  1WJA A;  5HOO A;  2XC7 A;  1WMR A;  2OUM A;  1PLU A;  1WJE A;  4BUP A;  4J01 A;  1MAB A;  4BE1 A;  2JA2 A;  4E7J A;  2GJK A;  3BH4 A;  2DOA A;  1E1R A;  4ITV A;  4XN0 A;  2IS2 A;  2E60 A;  4J00 A;  4DGW B;  3OYD A;  2X3H A;  4AU7 A;  2I8D A;  4BEH B;  2XF7 A;  4OJP A;  2VXD A;  1BR1 A;  3EUH C;  3OEH A;  2L5Q A;  1W36 D;  3HPH A;  3OS1 A;  2LRE A;  3KRG A;  2R7Q A;  5KHD A;  2AQF A;  2QXZ A;  5DN6 A;  1W9X A;  1WJB A;  1VZ0 A;  2LH9 A;  2Z16 A;  2CFO A;  2DJI A;  2D3N A;  3IAS 2;  4XKB A;  4TT3 A;  3OMY A;  5KCM A;  2XZL A;  1PE9 A;  2KPM A;  1K28 D;  3VMW A;  2DT6 A;  2CS3 A;  1SFK A;  3OYJ A;  3L2Q A;  2O17 A;  4YRV A;  5AMV A;  3DWL E;  2XF5 A;  3OIP A;  3FDY A;  2XAU A;  3L2W A;  5CQG A;  2XDV A;  2XSJ C;  3VYT B;  4OJ6 A;  1E43 A;  3LNN A;  3OW7 A;  3K70 D;  4MLO A;  3SDB A;  2VQL A;  2ODL A;  1O8J A;  4NQW B;  3S3O A;  1X19 A;  4C2L A;  3OOU A;  1MNE A;  3NWT A;  4PFP A;  2OC6 A;  2WZP P;  2VBK A;  3VDX A;  4RLF A;  2ZZQ A;  3HKZ A;  2CUZ A;  1V5E A;  5C1C A;  1X4O A;  2IGO A;  2BOL A;  5FRO A;  4RLQ A;  2D3L A;  3CJR B;  1IDK A;  4XLF A;  4BEH A;  5HKK A;  3W2W A;  4XLH A;  4H4K C;  2IXS A;  2CK3 A;  4JMQ A;  2VPL A;  3LMM A;  3ZSC A;  1K6Y A;  3SYT A;  2Q1Z B;  3K4N A;  2R7V A;  2HZD A;  3ZPN A;  2DIE A;  3HUG B;  1WJD A;  1HVX A;  3BG6 A;  2RRE A;  4F3Q A;  1W36 C;  3QOE A;  4DK1 A;  4B3G A;  4DNR B;  1OR7 C;  2WA0 A;  1HZE A;  1ERD A;  3FHN A;  4CCM A;  1O8E A;  4NK8 A;  3DU5 A;  2KQR A;  3ZPP A;  3DTK A;  1X1C A;  1EE6 A;  3B4N A;  4BAC A;  4DNT B;  1WPC A;  5HNF A;  3CZ6 A;  2NTB A;  1NG6 A;  2VJJ A;  1KTW A;  3I3L A;  4JQF A;  1MMN A;  4Z05 A;  3VYR B;  3EQO A;  3UW0 A;  3H5R A;  3PL8 A;  2QKM B;  4YZQ A;  1IB4 A;  4ZDL A;  4E7I A;  1W0K A;  2VKH A;  2CW8 A;  2KZV A;  2ZZF A;  2E5N A;  1WJC A;  4AVZ A;  2V4D A;  4PJM A;  4U4B A;  1OFL A;  4HIZ A;  2F1M A;  2LRD A;  2F4I A;  4BS9 A;  2RQQ A;  4BU2 A;  2X51 A;  3K4J A;  3ONQ A;  3GBG A;  3PNY A;  1I18 A;  1OGM X;  1BMF A;  1T5E A;  3QYB A;  2GJP A;  2GJR A;  2V7Q A;  1DP3 A;  3OEE A;  3K4L A;  5HVQ C;  3OFN A;  2OV7 A;  2PJR A;  3PSF A;  3A1Y A;  5CKT A;  1QCX A;  1LKX A;  2GOX B;  1OLT A;  3LFU A;  4DBR A;  4G7W A;  1D0Z A;  3OYC A;  2MC4 A;  2WY8 Q;  1UG0 A;  2M4K A;  1JI8 A;  2JSP A;  1WFX A;  1UEL B;  1X4P A;  1OB0 A;  2R7X A;  3DLA A;  2X1D A;  4QPO A;  4XLC A;  2VLA A;  1OHH A;  2NST A;  3D5L A;  3G2B A;  4XON A;  3RSN A;  2PYG A;  2NTP A;  4PSW A;  1BLI A;  2ZTG A;  3E1S A;  3FBI B;  2LC2 A;  3ZGK A;  4B3X A;  2BVM A;  3HL2 A;  4KIS A;  1N78 A;  3GVL A;  1VBL A;  2CW7 A;  3VYU B;  3V42 A;  4F55 A;  4KKT A;  3LMW A;  1X1A A;  3M1C A;  4NUB A;  4MR0 A;  1N75 A;  2LY2 A;  2MAB A;  2ZXH A;  3S32 A;  4CZC A;  4II2 A;  2JVG A;  1E79 A;  2DT7 B;  1WP6 A;  3HPG A;  3DKX A;  4KKU A;  3QOD A;  1E3X A;  3OYB A;  3BC9 A;  3VMV A;  1SAU A;  4RMN A;  3OAA A;  2VBM A;  2PJR B;  4II3 A;  3HOT A;  2LG4 A;  3A35 A;  2HPM A;  3A3G A;  3T56 B;  3L2U A;  2O0V A;  1V0F A;  2X6Y A;  3L2V A;  4ZTJ A;  2WSS A;  4CA0 A;  1V5F A;  3LL7 A;  3LSI A;  3KYL A;  2XND A;  4XN3 A;  1IA5 A;  1D1B A;  4U49 A;  4HEA 2;  4XKW A;  2R7S A;  1FX0 A;  4NC8 A;  3BLY A;  4IQJ A;  1V0E A;  4X0G A;  1OFM A;  1MW7 A;  5HNH A;  4YEJ A;  3HG9 A;  3GQB A;  2Z6B D;  4URR A;  3MD2 A;  4PJN A;  2BVL A;  3CES A;  3LSK A;  2NT9 A;  3WQZ A;  2FUG 2;  2R9V A;  3DQV C;  2L9N A;  3FKJ A;  4BJ6 C;  3D5S C;  2GOM A;  1V5G A;  2V4J C;  4ZDP A;  1Y6I A;  4XLA A;  3AL0 C;  1VLY A;  2XF6 A;  4YZA A;  4NNJ A;  4Z1M A;  3DPU A;  2XGJ A;  3OYM A;  1LDK B;  4E7L A;  2JVH A;  1PJR A;  3H94 A;  2IS1 A;  1D0Y A;  2UWM A;  2O0W A;  5FRN A;  4ANJ A;  3UR3 C;  1I8D A;  4KT6 A;  4DK0 A;  4TSF A;  3GQ7 A;  1NRK A;  1RMG A;  2X8K A;  4U7B A;  3CJQ B;  3VST A;  1Z3X A;  3CF2 A;  4DIQ A;  4DBQ A;  1PXZ A;  3TL4 X;  4FET A;  3OIQ A;  1P9Q C;  5FRM A;  4OZY A;  4Z03 A;  3OOC A;  2BW3 A;  2X1E A;  1UD8 A;  3B90 A;  3K4M A;  4KKS A;  1UD6 A;  1EFR A;  3PNV A;  2L2O A;  2KP6 A;  4RM2 A;  2HU9 A;  3LSH A;  4AYB A;  5IK2 A;  4IKF A;  4PMH A;  1O8M A;  2VB6 A;  3GRH A;  1BPL A;  1UAA A;  3OR2 C;  4P5O A;  3SEQ A;  3BCD A;  2HPI A;  3D5R C;  4HNU A;  4U87 A;  2IS6 A;  4OZZ A;  3K4B A;  3S3M A;  2O5R A;  1IDJ A;  1MMD A;  1O8H A;  2R7W A;  3SUC A;  1YX3 A;  2PMZ A;  3A4C A;  3UNG C;  1QJV A;  2XZP A;  4BJT A;  1O88 A;  1KCD A;  1D1A A;  1D1C A;  1QU3 A;  3C2H A;  4G7X A;  2IGK A;  3EPZ A;  2GK7 A;  3JUR A;  5TGT A;  4YZ0 A;  1Z3Y A;  4F93 B;  1DQU A;  1S9H A;  2F6C A;  2ZSI B;  3FBN B;  1Z21 A;  2WBM A;  3NWS A;  3SZG A;  3GVJ A;  4OAZ A;  4XR6 A;  3IAM 2;  5HLT A;  3PNT A;  2IS4 A;  3OYH A;  4CCN A;  2O04 A;  3M8J A;  3H35 A;  1Y56 A;  3DEE A;  1WJ5 A;  2HVQ A;  4HPQ A;  4W8R A;  3DU6 A;  4W8S A;  4XNF A;  3OYI A;  2UVE A;  2NT6 A;  4BXF A;  4HNT A;  1BR4 A;  1TT0 A;  4KIT B;  1CZF A;  1AA7 A;  2EWE A;  3DTI A;  2HVR A;  2LZJ A;  1T0F C;  3RTR A;  2JIZ A;  1OGO X;  3ZQQ A;  2VKD A;  3J7A Y;  3HXL A;  4CCK A;  5LD2 C;  4CUG A;  2K9M A;  4ZC3 A;  4Y33 A;  3ZCO A;  1MND A;  3L2R A;  1NBM A;  3HC7 A;  3S93 A;  3W2A A;  2MD0 A;  1O8G A;  2VJI A;  2WAF A;  3VSK A;  4PFO A;  3OYK A;  2ZZG A;  1Z7L A;  4OJO A;  2X85 A;  3K6G A;  5CPR B;  2GK6 A;  2WAD A;  1JTA A;  4LIU A;  2BW3 B;  2DXI A;  4OJ5 A;  3VSV A;  1T95 A;  4XQF A;  3HOS A;  4XL9 A;  4BDY A;  3MKW B;  1UD5 A;  2KRC A;  3AFH A;  2CH0 A;  2JJ2 A;  1KCC A;  1IRX A;  4BL0 B;  3KX2 A;  1DBO A;  4HG2 A;  1FMW A;  2X1C A;  4E7H A;  1NG7 A;  3K4K A;  4CCL A;  4XKV A;  2KLO A;  4PJL A;  4DJA A;  3OYN A;  3IUO A;  2VL8 A;  2KHM A;  4MXN A;  1N77 A;  4XOT A;  3AL0 B;  2HLD A;  2ZSH B;  2M5S A;  3T51 B;  2E1B A;  1K5C A;  3BC8 A;  2X53 S;  4HRI A;  2HQA A;  5CQE A;  4F52 A;  3FKS A;  4GQN A;  3W2V A;  4R79 A;  2VXZ A;  4ZJZ A;  4BE0 A;  4FXU A;  4HST A;  3SEZ A;  2W4S A;  4RM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...