4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
4YZ0A 4U49A 4YZXA 2O04A 1O8HA 3GQAA 2BSPA 2UVEA 3EQOA 1GQ8A 2NZMA 4MXNA 1O88A 1X0CA 1BN8A 1O8EA 4XOTA 1O8IA 2NTQA 2VJIA 4W8TA 1O8MA 2PYGA 3GRHA 3B90A 1JTAA 2UVFA 2ODLA 4XOPA 1DBGA 3FY3A 3T9GA 4XNFA 4I84A 3ZSCA 3ZPPA 3VMWA 1XG2A 2IQ7A 2NTBA 1DBOA 2O1DA 1KCCA 1KTWA 4OJLA 1VBLA 1PXZA 1O8LA 1PLUA 4Z06A 4OZZA 2O0VA 2NSTA 3B4NA 2X85A 1QCXA 1PE9A 2NSPA 1IDKA 3GQ8A 2NTPA 2QX3A 4OZYA 4U4BA 1IA5A 1HG8A 1KCDA 3VSUA 4PMHA 3WWGA 1NHCA 1O8DA 1RU4A 3EQNA 3GQ7A 3GQ9A 4OJ5A 4XN3A 2O0WA 1O8JA 2X6XA 4XL9A 4EW9A 2NT6A 4XKVA 4XLFA 4XKWA 2INVA 1OFLA 2Z8GA 4Z05A 4W8SA 2X6YA 4XQFA 1IDJA 1OGMX 1BHEA 2INUA 1QJVA 2QY1A 2NT9A 3UW0A 1O8FA 5AMVA 2X6WA 4XR6A 2VBMA 5C1CA 2QXZA 3JURA 4W8QA 4C2LA 4NK6A 4XLCA 1H80A 3KRGA 3LMWA 1AIRA 4XORA 4YEJA 4XLHA 4YZQA 1OFMA 1O8KA 2PECA 4YZAA 4XONA 4OJ6A 2VBEA 2EWEA 3VMVA 1EE6A 4XN0A 1WMRA 4XM3A 2X3HA 3SUCA 4URRA 5C1EA 4W8RA 1RWRA 1K5CA 4OJPA 4XLAA 4NK8A 3VSVA 2PYHA 1CZFA 4YELA 1RMGA 2VJJA 3B8YA 4XMYA 4OJOA 1JRGA 2O17A 1OGOX 4Z03A 4AVZA 1O8GA 1OOCA 4XLEA 1IB4A 4MR0A 4HWVA 3VSTA 2VBKA
chains in the Genus database with same CATH superfamily
3HOTA 1PP8F 3T8TA 1LFPA 1W0TA 1AWCA 2GXBA 3OOUA 4RDKA 3CPWB 1DUXC 4ESFA 3MKZA 2VPRA 3CMAI 1MMSA 3H35A 4MFEA 3QAHA 2F5DA 2VBYA 4B44A 2M8GX 5C4XJ 1N0UA 1SAUA 2PFBA 3FXMA 1DQUA 5ERIA 2Z9OA 1GVDA 2PJRA 2QZAA 3H5AA 4QIWN 1WSUA 2YWHA 1IN6A 3CF5F 2LMDA 2CNDA 1TUIA 2W82A 1VQ8B 2BM6A 4BDZA 1K78B 1XMAA 1JTAA 4P9FA 2PLFA 3W2EA 1DBGA 2VBZA 4XNFA 2PLYA 4CQJA 2XGDA 4PC2A 2QGUA 2ZCWA 3BG5A 1AKHB 3GFIA 1WI9A 3I9V2 3GTJJ 3A01B 3KZZA 1ZG1A 2A07F 1Y1VJ 4OZZA 1FPQA 3BTLA 3FMSA 3HZJA 4WXCA 5BMZA 4X05A 2KISA 5CYVA 3QPHA 1XMXA 5KCMA 2IW5A 2H1KA 2E1RA 2JA5J 1Q86D 5GADJ 2HOEA 2WY8Q 5JI6A 1HA3A 4I7HA 1X1PA 2VKDA 4PGOA 1XMKA 3W2IA 4AC9A 1UJ8A 3GQ7A 3R4KA 3BQYA 2M30A 3BCDA 1MBGA 3G2BA 4NQWB 1ZG5A 1BLIA 4DNTB 1MH4A 4KKSA 2NVTJ 5FRNA 4CDGA 2JA6J 2NVQJ 4FASD 1OYYA 4ZC3A 1NH3A 3JR9A 2IA1A 3TH0A 4BEHB 1CQXA 4EJWA 2VIXA 1X58A 2LZJA 2D5VA 5HZAA 1QVUA 5GPAA 1U5TA 1NK2P 1ZAOA 3SFZA 1O3RA 4WWCA 4ENKA 2X6WA 2FD5A 2IS6A 2XPVA 1XQBA 4E6KG 2VQGA 3WGGA 2CW5A 5IT3A 4V19K 4H4KC 4LB6B 2KRCA 4N0BA 1OCOH 1KK1A 1F1ZA 3ZXSA 4RD0A 1YJNB 1O3QA 5LLQA 1USTA 1WJ5A 3HUGB 2CJJA 1BR4A 3BCBA 4G6IA 2VL8A 1WJAA 2HS5A 2HDCA 1ZGWA 1S3JA 1VQPI 5C3EJ 1IGNA 1JA1A 1JKPC 3RKQA 1Y56A 4R8HA 3FJOA 2MH9A 2ZJ2A 4LLGF 2V1DA 4ENMA 5K7ZA 1I6XA 1OHHA 1V5VA 3OP1A 3CCVB 1RRJA 3MAJA 4LIVA 3A1PA 3I56B 2WJVA 2XRNA 5FFXA 3LQEA 2ZL5A 4HX4A 1TYVA 4I76A 1CZFA 2PYHA 2X6OA 2ACJA 4AIKA 3OYLA 2XGJA 3DU5A 1DP3A 1FLIA 4E7KA 2DDAA 2W6IA 2P3MA 5HOOA 3AVTA 3P9CA 2QA4I 5JR3A 3H0GJ 3MEXA 2ZBVA 2BVLA 4DQLA 3VO2A 2X53S 1TYUA 1ETQA 5FFZA 2VBKA 1XSXA 3FWEA 4EM2A 3S3OA 1HQCA 3BY1A 3HRUA 3QPTA 2QKMB 2NOJB 1WI3A 2IGOA 2PMZN 3P9IA 2XZPA 3FIWA 4A3IJ 2CG4A 3GTOJ 1B1BA 3DPUA 2YWGA 3OIOA 2GZWA 2MBFA 1R49A 1TNSA 1SVOA 4XRSA 3P4GA 1UZCA 1SC7A 2PIAA 5J4VA 3TO9A 2XTYA 4E4HA 3FY3A 3IAM2 2L5QA 2E36A 1E17A 1WP6A 3LVBA 1W5CC 2YU3A 3CCEB 2YWFA 3HSRA 1XX5A 1QZYA 3MZ8A 4YIFA 4JMQA 4A6DA 1WOOA 5L3EA 1ZHFA 1ETOA 4RD3A 1JTXA 4YXWA 1UD8A 1MJBA 3LQQA 2DA7A 3K7AJ 2GIVA 1HBXG 2IOUG 1FYLA 4IF4A 3ZMSA 4A2UA 1CF7A 4OIQF 2O0YA 3AG4H 3W6VA 3UR3C 1I3AA 4WQMA 3GO5A 1QGAA 1HG8A 4Z6YA 1ETKA 3KETA 3ZR8X 4GYIA 1MGTA 1IJFA 2HKOA 1G59A 2IA0A 4B48A 4ACBA 4I01A 2E7WA 3HC7A 3LNQA 1C0WA 1JT6A 5E79C 2K85A 3TEDA 4LBYA 1BA5A 4MNUA 3SFIA 2BY2A 3HOZJ 3FM5A 2A6TA 4K2EA 1KD1D 2E1NA 3G1MA 3A35A 4HDVA 2WWYA 3OKXA 2X6YA 1I5ZA 2M34A 4HE5A 5LRRA 2ZXIA 3W2HA 2INUA 3RIRA 1O7FA 3BG6A 4IOCF 3JREA 1Z91A 3J7AY 1SMTA 3JAMZ 1XGOA 5GAEJ 1KC8D 3L9FA 3OR1C 3JURA 3AK5A 2RQPA 1BJKA 2D1HA 4EMSA 1LQ1A 3T51B 3RY8A 4XLCA 1I18A 4U88A 2JTVA 3GWZA 4IO9F 4RLZA 4L9TA 2DTZA 4I02A 3Q9SA 2GA2A 1VQKB 3J80Z 3A0HC 4PSXA 2IS2A 3EYYA 4WK8F 2NAZA 1WPKA 1ZLKA 4U7DA 1NDHA 1VQLB 3L00A 1VQ5B 2BY3A 3O2PE 1TYWA 1ZGAA 5FLXZ 1IJEA 1WJCA 3CZ6A 4KISA 2G7UA 2D3LA 4EM0B 3BCAA 5C44J 2JT1A 3IKTA 1R5OA 1LUJB 3CUQC 1G7CA 1R1TA 4HF0A 1O57A 1SAXA 3BOQA 3H92A 4ZYGA 1FOXA 1YJNI 4LLNA 2LLKA 4PAAA 2OQGA 3OSFA 2VJJA 3B8YA 3PO2J 5B66C 4UY8I 3KP7A 3CB4A 3T8RA 1J59A 1ON2A 2Y48A 2IGNA 5KK1A 1TLLA 1FNNA 1ZKGA 1Y8QB 1T56A 3CCVI 1Y0YA 3BT9A 3I71A 3GIRA 3J81K 2K86A 2Z5UA 1EFTA 3L2CA 2YPRA 3OWTA 4FX4A 3MHPA 4PJMA 1O8HA 2JVGA 3I56I 3JRHA 2EIXA 2E60A 2ZZFA 5HODA 5TR9A 5ILUA 5EEGA 2QQ9A 4EJUA 4XRMA 1PP7U 2ESNA 1RPWA 2ZFWA 4II2A 4LG0B 1UFMA 1SKYB 2ZBKA 4W8TA 2DU9A 3T0YA 4KKUA 3LYCA 2VASA 3BTIA 2DQRA 5LEJA 1REPC 3T9GA 3QYEA 3VEPA 1BX0A 1NBMA 4J0QA 2XPUA 2X1CA 3RYPA 2FX3A 4KT5C 3ZQHA 1QG0A 1T6XA 4WXDA 5L3GA 1MKMA 1SVMA 3RKWA 5BSXA 3LSGA 1JUSA 4L0YB 4M6VA 4HV5A 2KMUA 1MBEA 3TO6A 4CA0A 1MMDA 1LNWA 2FQ3A 4M3DA 1R5BA 1IDKA 5E3OA 3IWZA 2W57A 2NTPA 5HDKA 1WJFA 2EA2A 3LNNA 1JJ6C 3FHNA 4U4BA 1FX0A 3K0LA 4V2GA 2NOGA 1WORA 5EG0B 3OJWA 4AVPA 2DODA 1I27A 2DA3A 3AL0B 3S3NA 1XFOA 2Z2SB 1R00A 1V5GA 3B6AA 3OOPA 4BQOA 3ZQCA 4HF1A 3OJXA 4OJ5A 4MHGA 4RDUA 3CRZA 3AG2H 1J0RA 2NS0A 1CGPA 2DOAA 2XB0X 3DXJF 5GAGJ 3LWFA 2OCCH 1G7RA 4OM9A 3AGQA 4C2UA 4B3AA 2MD5A 2XB5A 3WTVC 2VFQA 1W7PB 2K9SA 3FZVA 1HA8A 4RB0A 3GSIA 3Q0UA 1LFUP 1ZRCA 3NQOA 3BY6A 1QQIA 1YFHA 4QV2A 1XGSA 1DDGA 2L7FP 3KLNA 3ULQB 2ZITA 1APLC 4DQKA 4NB5A 3KP3A 4AWXB 1TQIA 4EM1A 5B1AH 4BJ6C 2NV4A 1TL8A 4CYCA 3PM1A 1H80A 1S5LC 1D1CA 1WQ2A 3VPRA 5DN6A 5FO1A 4HW0A 4BH9A 2V6EA 3UNGC 3GFJA 2C5BA 4AYBA 4Y15A 2EZLA 3BQZA 5JLVC 1GUUA 2FXAA 2PMHA 1FJLA 5IYQA 2LK2A 3IH2A 2WAFA 3SY2A 1XDSA 3LQRA 2B5OA 3W5HA 5TGTA 4KH3A 2ZMEA 1O3TA 2X8KA 3LOCA 4V02C 2FA5A 2DJNA 1TQMA 3RJPA 1YRNB 2MABA 1LDDA 3I59A 1LLWA 2EV6A 4Y9RA 3JAMK 2Z6BD 5CDFA 3FXLA 1FNDA 3TDZC 2DW4A 2QDXA 2ZZEA 3ZMZA 1G7SA 4ZTJA 3FXQA 5IYCJ 1E3ZA 1SD6A 1VQLI 1IV8A 3GLXA 4JOMA 2R5YB 5FJ8J 1Z9CA 1VQ5I 1UD3A 3A8IA 1B9MA 3ZN1A 3B82A 1O8GA 1OOCA 3JRIA 2IS1A 2K27A 2EINH 3G1OA 1IRFA 4M6YA 4I09A 5E1XA 2NXNB 5J1UA 1S9HA 2AQEA 2XV4S 1EA0A 4BJTA 1OISA 4H0EA 1PYVA 2DPDA 2ME6A 2ZSIB 1IC8A 2VBXA 3WTXC 1BM9A 4M3BA 4HX7A 1FNCA 2AXTC 4QPOA 2HOAA 4DYRA 3DLLF 3M3YJ 4L18B 3QFSA 2BM4A 4HQEA 1LVAA 2STTA 3GF2A 1EFUA 1GJRA 1YI2B 2E19A 1B72B 1MRZA 5K5RA 4RB1A 1T08B 1H88C 3M4OJ 5FD6A 3GRHA 3FXRA 5ED4A 1BJZA 2JN6A 4CYDA 3ASRA 1ORKA 2F5FA 3OS2A 4HX8A 1CNEA 1KQ0A 1W1WE 3ZIAA 5E3LA 3TP3A 2RKHA 4CUGA 5EF6A 2C2WA 1MDMB 1WKMA 1YIJB 1JI8A 2GXAA 4XICA 2X3UA 3AVUA 4M9ZA 2F5CA 5A8AA 3ZBTA 5F6FA 1B8IB 1T39A 1DG1G 2V9PA 4Q48A 3NAUA 2DIEA 3R6JA 1MBJA 2AS5F 3FM3A 1IA5A 3IRRA 4MYTA 2CYYA 1FYKA 1SMYF 4BHCA 1E2XA 1FBUA 2R92J 1IXCA 2OC6A 2A6EF 1KQ8A 1IAWA 2KPMA 1I50J 2TDXA 2COMA 1FP1D 1W9XA 3OS0A 3CJQB 1PUFA 2JA7J 1Q9SA 2OBSA 5TY0A 2O3FA 2FBIA 4XKVA 4OPSA 5AIQA 4JP0A 4XLFA 2HZDA 3G6EB 2DFFA 2WAQN 1OFLA 5D8KB 2KP6A 2W25A 4WXHA 5DCMA 4XQFA 2CFXA 1QU3A 3GVLA 2E35A 4X7DA 1U3EM 4RB2C 5LD2C 3MCAA 3UW0A 4IVNA 2VBTA 2WZPP 3C18A 3UKGA 1VQ9I 5D5VB 3A2KA 5DNSA 1ZM4A 3CDIA 1B9NA 1Y0NA 5GPCA 4BDYA 3VWBA 2QXZA 1LB2A 1VQOB 4C2LA 1EF4A 4G12A 3HYIA 3TQNA 1A5JA 1BPLA 3A3GA 1VZ0A 4C30A 1OFMA 2BY1A 1VI0A 4GGGA 3N4MA 1X2NA 2XGEA 2HCJB 5IP6A 3FBIB 2MG4A 4G6QA 3OZWA 3S17J 2FBKA 1H85A 2O8KA 1EJ9A 2XZLA 1H9TA 2DJIA 1MNEA 3EPZA 4QHYA 1ACIA 2C4TA 1EP3B 2IPQX 2QQBA 4M72A 5F1RA 3S2WA 2L3DA 4KDPA 2PG4A 4HA8A 2JWTA 1CQTA 1FEXA 2VZLA 1DU0A 1PDNC 5GV8A 2BGIA 2GIZA 2BX6A 3ESWB 4KN4X 1TZLA 2VKHA 4R79A 4JX6A 4KIGA 2JMWA 4TSFA 4XSZF 4A93J 4XLEA 2XSDC 4F92B 3ZQFA 2FOKA 3D5SC 1BC7C 4X7FA 4MR0A 3ZZUA 3B02A 4U0WA 2VNJA 5M3MJ 1WFXA 2H8WA 3G73A 3I3LA 2EB7A 5DS0A 1H0MA 1OMIA 4CZCA 2WV1A 3AVXA 3OYEA 4JX5A 1IG7A 1FTZA 4P2NA 1IF1A 4S04A 2KHMA 2PE3A 2W84A 3HBLA 2E1CA 5F08A 1T6ZA 1NHAA 2JA2A 2R93J 1Y0RA 1IN4A 3CCSB 3HOXJ 4J01A 2YSRA 2GJKA 1QQ1A 3ZSCA 1D8TA 1M1KD 3ZPPA 1BJAA 3BR3A 4IQ4A 4QLCU 1XG2A 4ROXA 1QA1A 4YC5A 2QEXI 2XAJA 1VBLA 3H5RA 2R7ZJ 5J8CA 3GYHX 4RM2A 1VQNB 5JMCB 3DTIA 1I1SA 1U5TC 3KIOA 3ZMDA 3TW7A 3GZ6A 1Z05A 1E3HA 2QN6A 3JQQA 4M1KA 1QNTA 1YI2I 4HYEA 2CU7A 1UG0A 2KVOA 4P6VF 4YCQA 2ADUA 4XRFA 1STZA 4FE4A 3KYDB 2DPUA 2BHYA 4CGZA 2CQNA 3QQAA 2M45A 3SEQA 1GXQA 3TL4X 4UZEA 1SFKA 3EQNA 2K4BA 2YWEA 2Z1DA 2K4JA 2X0LA 4QUZA 1QA2A 1T0FA 3GX4X 1YIJI 3L2VA 1KZLA 1JT0A 2EIKH 1MIJA 2G0YA 2RC6A 2FBHA 2JPBA 3BDDA 1LE8B 4JQFA 4U0YA 4C3HJ 2M8EA 2X4HA 3V42A 1ELOA 1JE8A 3G4SB 1FMVA 2L7KA 2VJ4A 1QBJA 2H94A 2Y9YA 3BP8A 1UHSA 2FUG2 1MABA 3KP2A 2JA8J 1P6RA 5KNLA 4IQJA 3W6KB 1O7LA 2BXYA 4IHSA 1ZYRF 4LK1F 3HSEA 4BQQA 3PSIA 4W8QA 1XGMA 1MMAA 5FD5A 2P7CB 2LF7A 3U6BA 2D2WA 3LA7A 5D4RA 4UB8C 1MMGA 4IRHA 3WBJA 3G6EI 4BKXA 1M90D 3K4MA 4AIHA 3S15J 3HRSA 2RNJA 1MSEC 1EH8A 2VBVA 3LSRA 3OZUA 2QKLB 2HQNA 3PUBA 1FT9A 1MH3A 2R7XA 3LL7A 1PVEA 5IOYA 3S1RJ 1D2EA 2MH2A 3A02A 4XM3A 1NB9A 1B23P 2X3HA 4ETSA 3H0DA 1N78A 3DDYA 1UMKA 1E0EA 3SEJA 2DK5A 5B3SH 4URRA 3WNDA 1HOMA 2YS9A 2V7QA 3N97A 2JUCA 2XAFA 4AM3A 5CLSA 3REOA 2Y0MA 3AG3H 1RMGA 5EYRA 5DM7F 2YUSA 3WHCA 4UVBA 2ZTNA 1HXDA 1RC9A 2AO9A 1WZ2A 5DSZA 2YR2A 5HLIA 2OQRA 4A0XA 3CUOA 1BI2A 5IK2A 3A4CA 3IWFA 4I2OA 2EPFA 3WNCA 4QWQA 1BI0A 2QA4B 1K6OA 3BH7B 1OR7A 5FRMA 1GAQA 2CO5A 2Y2ZA 3A1YA 5BSYA 3TDUC 3WTSC 3CJNA 3Q9VA 1DDNA 3W2FA 4PC3A 2NZMA 4IRIA 2OJED 3H09A 4AIJA 5HXBA 1QHGA 1O8EA 4HNTA 3FXOA 1QUEA 3IRQA 4HLYA 3LSJA 2BM1A 1BC8C 1KMHA 1BI1A 5ILSA 1OCCH 4DBRA 3QPLA 2DYRH 2D45A 2C77A 3RKYA 2X1EA 4FK8A 3OYKA 1YQAA 2XHKA 3LA3A 1BN5A 2XASA 2O1DA 1PJ5A 1TTTA 5E1WA 3TMOA 4UNOA 4RAYA 1SFOJ 1JGGA 3VMFA 3PFYA 1YJ9B 3CO7C 4HSRA 3PQJA 1N07A 4P3IA 1T38A 3SYJA 4IX7A 4CO8A 2LKSA 3KX2A 5M5WJ 2EFPA 4IPAA 3OS1A 4Z4VA 2QX3A 3DEWA 4O3MA 4CCNA 1N05A 1QH0A 4OZYA 3CCRB 5EDNA 2EFOA 4ANJA 4M53A 1IO2A 2CQXA 4RMNA 4V2FA 4ABZA 3CCSI 3VSUA 4PC6A 3RKXA 3N90A 1NHCA 1K78A 2BXZA 3K70C 1BIBA 2QMUA 1VFCA 2ELKA 3CF2A 1EV7A 5H6RA 1AKHA 1VQNI 1ZRDA 3A01A 4XKWA 4Q7JB 5LHIA 2EIJH 4M3EA 1BL0A 1IDZA 3WY9A 3BWGA 1LLZA 1P7IA 2W1OA 2KKOA 3FISA 2CK3A 2VE9A 3I55B 3O6BB 1NJID 3PVDA 2E5ZA 2KZVA 2WSSA 2VFOA 4XR6A 2F4IA 1U0JA 1QFJA 3M7GA 1EFRA 3GW2A 4RPDA 1RIOH 3ONQA 4NNJA 5BNGA 4RAFA 1DU6A 3MN2A 2JUGA 4Y9UA 1E1RA 2OTLB 1XB4A 2V9VA 2B7CA 2R3SA 3IH4A 4NQWA 2XGXA 1IJWC 1QVGB 1NK3P 1A6QA 2MLKA 2W48A 3G4SI 4LK0F 3HDDA 3P27A 4DW6A 5JFRA 3ABUA 4NBSA 2IJLA 2L01A 2P6SA 3F8NA 1D1AA 4BEHA 1W34A 2HXIA 2L54A 4OP7A 3VMVA 3LAPA 4LBZA 2ZTGA 2CRVA 2OZUA 1EE6A 2VE8A 1KYWA 1YJWI 2VQLA 4JRAC 1EP1B 3WNBA 2LF8A 1TW3A 2WJYA 2MW8A 3ASOH 3OL3A 2ZJRF 4M4SA 4DK0A 2XF6A 1IXSB 3OAAA 2DTRA 4PJJA 4CCLA 2BW3B 3BG3A 3SXYA 4CCMA 5BPIA 2HU9A 2OCEA 3KP4A 3OYFA 3HUGA 4IHTA 3VYRB 5KW9A 3WU2C 5GAHJ 4M3GA 1IW7F 4TMZA 4Z03A 2EQRA 4GFBA 3MZHA 4NHJA 2L02A 1TW2A 3V4GA 1R5GA 1FIPA 4G7OF 4OIPF 5IOZA 1U2WA 2W24A 5IYPA 5FROA 3SEZA 2HR3A 5J6XA 3U1KA 5CVVA 3MMPA 1OFCX 4X7CA 4BL0B 3RPUA 4P5OA 5F0HA 1QO0D 1BIAA 2M4KA 2RVCA 4RGRA 4GYGA 1FOWA 1XTAA 4GQNA 3PFIA 2B0LA 4J00A 1BN8A 4G7ZF 2EV5A 2IGKA 1X19A 4G8XA 3I64A 2Y69H 1FRQA 1HW1A 1GHCA 2R7QA 3KEQA 1RETA 5K5OA 2BF4A 3N05A 1WTHD 2J8KA 3BR0A 3FDYA 4B3FX 3HKZN 3ONYA 2E1MB 2ZZQA 1LM1A 1OCRH 2QCOA 1POGA 1PUEE 3K10A 1AHDP 1KTWA 4WZKA 3P7NA 2ZJPF 4KN7X 4KNYA 1Q81D 2E71A 4A6EA 1VJSA 4LLLA 3F21A 4ZTFA 2HI3A 3AFHA 4YFKF 3RZOJ 2GWRA 3F8CA 1ZN2A 1ULYA 3ABMH 4XLNF 4E7LA 3BR6A 2ZL7A 2F3LA 3GQBA 1IXRC 1BR2A 2FRHA 3D0SA 1G3WA 1X4PA 3BC8A 5CQEA 2R5ZA 5BPDA 4RCZA 1TP4A 3NE5B 3GFMA 2WY7Q 2JPCA 4NDLA 4RAZA 4ZV4A 5ICEA 2LG4A 5FA6A 3CMEI 3JCUC 2ZJQF 1LKXA 1DP7P 1YJ9I 3HEFA 5JLXA 4BE2A 2GPJA 2NT6A 2UZKA 1QHHD 1LDJA 3JQPA 5DS9A 4ASNA 4OOSA 1P2FA 2ZXWH 3E6DA 2YU9J 1JNYA 3GXOA 3RCOA 2ZMEC 1IDJA 1RKWA 3ABTA 5IY5H 4ZCLA 1OGMX 1J09A 5D6FA 3CCRI 2QY1A 2FOWA 3OFNA 1LEAA 3G05A 1O8FA 3CC4B 3G3ZA 1D1NA 1XDUA 5F4MA 3W6JB 1S7EA 4WCGA 2IT0A 3PQKA 4QTRA 1GLNA 4PFOA 1FSHA 1XCBA 4NBQA 1WH7A 2CW0F 3DBRB 3IKVA 1FC3A 3WGHA 4BGDA 5K7HA 1ZRFA 4RCYA 4UUSB 3ZN0A 4IHXA 4PJ0C 4P55A 5M5YJ 1LEBA 1RUNA 3VSLA 4KIFA 2RAEA 5DD4A 2LBFB 2JQ7A 2PMZA 3I55I 1E63A 5FNZA 5IYDJ 1QA6A 5B6IA 2UXXA 1KRHA 3QYFA 2EK5A 2GM4A 4P1VA 1QX4A 3OMYA 5IP9J 2CQQA 3FPKA 2XDVA 2VQCA 3E5XA 1IV6A 2OBPA 1IHMA 1S4MA 1S8NA 2Q0OA 1FRNA 3P26A 3FXJA 1RKTA 3E97A 4Y3OA 2OTLI 3R6KA 4C3JJ 1KQSB 4OJPA 4P6YA 4E7ZA 3GEZA 1VTNC 4YELA 1ZLJA 1D8KA 3ZUGA 3M07A 4LITA 3P5JA 4X0GA 5J3LA 4EEFG 2HTSA 4MTDA 3KYLA 2P6TA 3Q0VA 1K73D 1V0EA 4Y4RA 4GO1A 3EUHA 4BHPA 4I99C 3R60A 1XB2A 1YS7A 1MMNA 1VLOA 3GLLA 4OIOF 3VSTA 2XTWA 1WOSA 3E5QA 2BN4A 9ANTA 3VNUA 1GO2A 3M8FA 4I6ZA 4U49A 4YZXA 3IHUA 4A5MA 1X1BA 2VN2A 2CUZA 1L3LA 2K9QA 2OAZA 1KTVA 1YO5C 4L0ZB 1V55H 4TKOB 4M9XA 3DKXA 4KMUX 4A12A 4JBAA 2MC3A 3U2RA 1IB0A 2PX9A 4IEJA 4KICA 3VMWA 1ETYA 2FNAA 1Z6RA 4EGZA 1OGJA 3OY9A 1P4MA 3ES9A 3DTKA 4HLXA 4AIDA 3B78A 1G4DA 3K6GA 4W97A 3C7JA 2LD5A 3QU6A 2NSPA 3RQ4A 3O8GA 3NRVA 3HOSA 2HVSA 2P5LC 3S3MA 4DYCA 1D0XA 2HZTA 4MLOA 4LG0A 1U9OA 2MD0A 4BHBA 1BI3A 2IGMA 4DZJA 2HWVA 2GREA 4AD9A 3QOEA 3OW2B 2DBBA 1RU4A 3LJYA 4UZUA 1OFDA 2O0WA 2CSOA 1PJ6A 4FXUA 1J5YA 1W4MA 3SJPA 4S05A 3CCQB 4TN1A 1QGPA 1ZM3A 1D1BA 3KZYA 2DLLA 2Y75A 5B5EC 3ML6A 2VC1A 3H9NA 3CDHA 2HYGD 1I3QJ 1OCZH 1E1QA 1NTCA 3W3CA 2BV3A 4RDLA 3EQLF 4PUSA 3ONUA 3DWLE 2Z3YA 3KFWX 4HV6A 2JJ7A 4UV8A 3SHFA 1TSPA 1JGSA 1XN7A 4CICA 1OB0A 5EG0A 2FMLA 3RSNA 5HNFA 3L7WA 3JQRA 4BNCA 1Q7YD 2JJ2A 2JSPA 3DV8A 3H3ZA 1FOYA 2Q6OA 4TMXA 3SLDA 2IAIA 2V7WA 3I54A 4B8XA 2DFEA 3ASNH 1W7PA 4PZJA 2XC7A 2I8DA 1NG6A 2E2HJ 2BM7A 1UD6A 3LFUA 1MZBA 1G3YA 2P5KA 1EWYA 1IUFA 4MQVA 4D7MA 3CC4I 3E1SA 1WDTA 1KU3A 3QP6A 3PENA 3QSYA 2A68F 2QSFX 2OV7A 4PK4A 2OUMA 3K69A 1T6YA 4OPWA 3OYJA 3BQJA 1X2MA 2QVOA 4P96A 3H3UA 4X07A 4H9GA 3CC7B 1Q1VA 4C0SA 3GVJA 5TISC 1UHMA 1MD0A 3W2AA 4NK8A 4KT6A 4BXXJ 2R4GA 1ZH5A 1LVKA 4ZJZA 2DA1A 2VB6A 3NEUA 4HPQA 1T95A 4HRIA 2BYVE 2M7BA 1T2KA 3BCFA 3SQVA 4A69C 3ISPA 4A3FJ 1P4XA 1QRYA 5DDGA 5H5JA 1QVFB 5KSWB 4TMTA 3JSPA 1Y0UA 2FU4A 2NS8A 3M8JA 2PI0A 2W85A 3E6MA 3W2WA 2CV1A 5E17F 4A3KJ 3DLAA 5CVRA 2V7FA 3AG1H 3GCMA 2AHOA 1D0YA 3R0JA 2KL4A 1YRNA 3ZQLA 4RGSA 5A2QZ 1CNFA 2VBWA 2P4WA 1ZQ3P 1NB0A 3F9KA 5F04A 1O8IA 2NTQA 5IYWA 2I5UA 4D5CA 2B7EA 1HC8A 2CUFA 2R5YA 5JHFA 1XSDA 3SDBA 1T0FC 2BVNA 1WWXA 4Z4ZA 3Q5FA 3GVKA 1SFUA 4CCKA 2OBTA 2EZIA 4G6DA 2BPOA 3K4KA 3J80K 2NTBA 4KKTA 3OR2C 4YDTA 1WGXA 3RYRA 5J1YA 4Z06A 2QZ8A 4DJAA 1DABA 1XPXA 3LSPA 1H89C 1OCTC 1A31A 3BLYA 1VHEA 2QEXB 2HNHA 2XAHA 2ZMEB 5EZGA 5KAIC 5H2FC 5FLXK 4YIRX 3VYUB 1T8IA 1PE9A 3L1PA 2G9WA 3OOCA 2V26A 5IP7J 1OJLA 2NVYJ 2QE7A 1K61A 1W5SA 4OPVA 2RV8A 3K1NA 1B72A 2KQRA 4I98B 2B9SA 2V31A 3W5UA 3VNVA 4BACA 3HB9A 4P9UA 3A0BC 2E5NA 5LRSA 2O9LA 2H27A 2GQQA 3MKLA 4M74A 4AF6A 3EYIA 5HLHA 2HLDA 1F36A 2XAQA 2DA6A 3S1NJ 3D5LA 4LD5A 1Y1WJ 5LBQA 5K1YA 4Y52J 3H9QA 4AC0A 1U2RA 3JTHA 3OW7A 1KQ5A 1MDMA 4G7XA 2DETA 3OYIA 2INVA 4XKBA 4ENJA 2HMAA 4MO7A 4KITB 3EUAA 1ZG3A 4ZDOA 1B8IA 2EJRA 1Z21A 4XSXF 3HG9A 1QJVA 4Y13A 3AVWA 1X1AA 3WU0A 5HNHA 3QRFF 1X1DA 1W0JA 1JUMA 1EFCA 3CCJB 1Z7UA 2EFQA 1BOBA 2HYJA 3U6KA 4DIQA 2QF7A 4XBFA 3R0AA 4QSHA 2XROA 4J19A 3HRMA 2IP2A 3Q6QA 3VYSB 1MNDA 2DN0A 3CCQI 1JB9A 3JRBA 5LFAA 2DOGA 4FN5A 2DMTA 4XORA 1FWZA 2Z16A 4Z1MA 3CO6C 2R7OA 2PECA 4LFUA 1J7KA 1DGRM 1USSA 1W5TA 1ZR2A 4YZAA 2QLZA 2Y30A 2DFIA 1IRXA 2K9MA 2LRDA 4WF2A 1R23A 4ZH4F 4RS8A 4P25A 2WB1N 3BJAA 1TT0A 1OR7C 1XS9A 2LYCA 3CD6B 1MBFA 3KE2A 1SKQA 5AIPA 3ZCOA 4D9JA 3QU3A 3PNYA 1H8HA 1ETWA 1YE9A 2CUEA 3EETA 3BC9A 2MFZA 3FKJA 1KJZA 4N4NB 2V1UA 2NVUB 4EJTA 1G6NA 4MYUA 4KJZA 3CUQB 3GZ5A 1F43A 2Q6KA 5DTDA 3P9KA 3BJ6A 4WZTA 2ESHA 5KHDA 1D8JA 1R22A 3ZRGA 5FIUA 2JDIA 4HDUA 2QBYB 1OGOX 3WTZA 3DPTA 1R9TJ 3T1BA 2HDDA 1TWFJ 4OMZA 5EEAA 2L2OA 4X8IA 2LNBA 4KYWA 2FSWA 3V7SA 3DEEA 3K9TA 3IP4B 2OTJB 4NC7A 3CC7I 4U7BA 3F23A 1YX3A 2VNIA 4ZCIA 4M0LA 1ZELA 3DTEA 2LKXA 1N75A 3DPLC 3DU6A 3DCFA 1U6GA 1O88A 2HEOA 1X0CA 1RQPA 2HTJA 5M3FJ 4ZYAA 3LQ6A 4RJLA 3AVYA 4YAWA 4YFNF 1LPQA 3D26A 2J7KA 2QYUA 4BE0A 2WAQA 2VFMA 3B90A 1Z77A 2AQFA 3FPPA 3F3XA 1O4XA 2HDNB 2RQQA 3D1NI 2NVXJ 3TP0A 1Y8RB 1KCCA 4PGGA 4B4CA 2V9KA 3FK7A 3I0TA 2VUMJ 5DUKA 3PUNA 4UZFA 3GTLJ 3SDGA 1E64A 1PXZA 1VHOA 3K2ZA 4F7DA 4RA2A 2X85A 2Q6LA 2NRAC 4PSWA 3PJRA 4BY1J 1R1UA 3V76A 3LSHA 3ROUA 1F60A 3F8BA 1ZREA 2LP0A 2ZB9A 4RGXA 3SJZA 4PC7A 1MBKA 3QFTA 4OWRB 1P7JA 3E5UA 3GTKJ 3AKZA 3M9AA 1H8EA 4RD2A 2KZGA 2LY9A 3WWGA 3ZQIA 4HF2A 3CQZJ 3WQZA 2K3FA 4UAJA 3JRDA 1U9NA 3V8KA 4XL9A 1X3WB 2ICWG 1NRKA 2EFNA 4YFOA 4PCQA 3MZYA 3DBLB 3IC7A 4B1RA 4YAUA 4YG2F 4G5GA 1ZTRA 4XKCA 2QQAA 2CF4A 2E1BA 4C2MJ 3HHGA 3TOAA 2EIMH 2CC2A 1N77A 1VQMB 4PJLA 3N6ZA 2NT9A 3Q3SA 4Q4ZF 1FNMA 2X48A 1QUFA 2A5WA 3BG7A 1S6LA 1KONA 2MYSA 2M4GA 5FL7A 2VBMA 2ZXJA 3L2WA 3KL9A 1KYZA 1K9MD 4NK6A 2O7OA 2K5CA 5A89A 3H9JA 1JJ2B 1SFEA 3ZOBA 1WHUA 4BYYA 3CCLB 3FXUA 1P4AA 3S14J 4CXFA 3F0CA 1FBQA 2BE5F 2DCEA 3HSFA 4A3MJ 1UELB 3SLNA 4ZGQB 2RREA 2J5OA 2CW7A 1LE8A 2WV0A 3ERED 3K4JA 1KZHA 3AAFA 2L7MP 3LA2A 4F55A 4A3EJ 2PJPA 3E1YE 2EWEA 1K4ZA 2PEXA 4WWVA 1V0FA 3CCJI 4R1HA 2L4AA 2UV1A 4UUTA 3H9GA 3HPGA 5E8IA 5LMZA 1UHWA 4B43A 2FMYA 2MGQA 1K83J 3F6OA 5FKOA 1GAWA 3G1LA 2Q8KA 4W8RA 2LY1A 1K5CA 4XRSG 1YJWB 3K70D 1S7AA 1IZ1A 3CJRB 4RLFA 5KVRA 4NC6A 1YS6A 1D5VA 2R7RA 3S16J 2XNDA 1R6RA 3K4BA 5EEHA 4XIDA 2WR8A 2ZNZA 4AUXA 1VQ6B 2UUZA 4OAYA 3CD6I 1WH5A 3ZP5A 1FX7A 1YG2A 2A6HF 5IT9Z 2Y0SN 2QM3A 2A05A 3E7LA 3I53A 4RPBA 4Z2YA 3H94A 3PIPF 2WA0A 3MQ0A 3EQOA 2R9VA 1WJEA 2M2EA 5EGOA 4PABA 4ZDLA 4HEA2 1AOYA 1TVCA 1HSJA 1I1GA 2X0KA 3OL4A 1LJ9A 2XF5A 2W00A 5JVTA 4OMYA 4YHBA 1Y39A 2DERA 1I39A 2VQHA 4L9VA 1V54H 1ZM2A 1MJAA 1E62A 1FIAA 2TCTA 4LBVA 2KIUA 2Q1ZB 4G9YA 4L9JA 3V8JA 2OTJI 2P81A 2BOLA 1O8LA 1UMQA 5BS6A 2KT0A 2A5YB 5DV5A 1JHHA 2R7SA 1BBYA 2LR8A 2F43A 4RAGA 3WYAA 4B4DA 4CCOA 4IHYA 3M1CA 2CV0A 1OFEA 2NNYA 1RR8C 1V3FA 2CS3A 3U1DA 4WZLA 2EH3A 2ZFUA 3VDXA 2GJPA 4G1BA 2XT2A 1KCDA 3CP8A 1FBSA 1OLTA 3K4LA 3L09A 4MEXF 4BQNA 2V79A 4OAZA 3GQ9A 2LKPA 1XC5A 4A3GJ 1O8JA 2Q2EB 5CQGA 2CBXA 2H6BA 2HYFA 4UVCA 4X0CA 5DYMA 1JUPA 2K9NA 3KCCA 2I1LA 1TT5B 2W7ZA 1X1CA 2MSYA 3CMEB 2KJCA 2JSCA 1DPUA 2XC1A 1ETXA 5J1RA 1FMWA 2DYSH 3BTJA 3S1MJ 2L0KA 4II3A 1L1IA 4FE7A 1OB2A 3JX8A 1S72B 1R71A 1VNDA 4HAMA 1RQRA 3BG9A 3OEHA 2VOPA 1XGNA 2L4MA 1HCRA 3KEWA 3AVVA 5FGMA 2JK3A 5LGNA 2V7XA 1UG2A 2PQ8A 5BQTA 1CLWA 5A88A 3KRGA 5JBQA 2O61A 4IZZA 3DU1X 4YEJA 1U8RA 2NNNA 3EUHC 4QPQA 3MCZA 3MD2A 1ERDA 3VOEA 2X51A 4OIRF 1J75A 2ECCA 1VQMI 1Z3XA 2QSHX 5CKTA 1YX5A 3SZPA 4MEYF 3R61A 2K3PA 2ZC2A 4UV9A 4C3IJ 1JXSA 1VF7A 1GV5A 5FLMJ 2FVGA 2ME0A 3QOPA 1VQ7B 5ILVA 4HG2A 1V5FA 3JRFA 2WBMA 3JRAA 2MC4A 3OIPA 2I10A 4P1WA 4E7IA 1ZR4A 3GTPJ 4PGHA 4LIUA 1JTYA 4Z4SA 1FYMA 4OU0A 3CCLI 2PJRB 3QPSA 3PA1A 1E3PA 1R36A 3FKIJ 4HIZA 5E3NA 3JRGA 3SZGA 2IA2A 3CW2A 4I0BA 2F2EA 2CUJA 1IRZA 4Z4RA 1K8FA 1HVXA 3CP2A 2YUHA 3HIFA 4FT8A 1UD5A 4MFDA 3DF8A 1N06A 3S93A 4D5FA 3PUMA 2R7FA 3GMEA 1GR1A 2VLAA 2K7LA 4LG3A 1B6AA 1KU7A 1K4TA 4B3GA 4EATA 5CVUA 2VJ5A 3GQAA 3E6CC 3OIQA 2E7XA 2VT3A 1Z1DA 2KIQA 4IL6C 1FZPB 1W87A 5E6TA 3PSZA 4UXNA 2N8GA 4FCYA 1QPIA 2VBUA 4XOTA 4IRGA 4OINF 4EH1A 5GP9A 2HVRA 4RDJA 4JX4A 3SYTA 1KA8A 2BW3A 3IL2A 3U2QA 2XEXA 2UVFA 5EJCA 1VQ6I 2WZNA 4N3NA 2NYXA 4OOIA 4HOBA 2ODLA 4Y7NJ 4Z4UA 4ASUA 5KAFC 1VQ4B 1BQEA 3RQIA 2X1DA 1K7AA 5J40A 2EFGA 2OK8A 4OJLA 4PJNA 4M73A 3HGYA 4MGRA 1GT0C 2GK7A 1PLUA 3NAWA 2O03A 2M1BA 3OEEA 2JVHA 2FNPA 3ASQA 5IT9K 2A3SA 1SD4A 1YHQI 4RB3C 1K79A 1U5TB 1QZZA 3BZCA 1KU2A 1R5ID 1AIPA 3AL0C 4IKFA 4BAYA 4BUPA 1W36C 5CVIA 1R1VA 3OYHA 3ELKA 4F91B 3GTGJ 5GTIC 5JLWA 6PAXA 2WTEA 4FETA 3HAGA 2DCUA 4X1EA 1UD4A 2R7WA 2DAOA 4HSTA 4A3BJ 1A6IA 5L46A 2LREA 2CV2A 3A8KA 2OPTA 3ISXA 2STWA 1OGIA 2FJ1A 5K5QA 3J81Z 3T56B 2VPLA 2XAGA 2F6CA 2IBDA 4FX0A 1OPCA 1BHEA 4YFXF 3FMQA 1XE1A 3QP5A 2JZYA 4E7SA 3RDIA 4FTHA 3ZPLA 4P12A 2IEKA 3DBHB 1H8AC 5F64A 5L3BA 4YALA 1HKTA 2L9NA 4ZYDA 3J7AO 1FTTA 1RI7A 1QPMA 3FHZA 3LMWA 4PFPA 3J7YJ 4KUMA 1Z6TA 5C4JJ 1FP2A 2EWNA 1IRGA 5L3CA 3HJEA 1MSFC 1BW5A 2F4NA 4L9NA 4RD1A 2HQAA 2K02A 2B63J 1S72I 1D3YA 2HPMA 5IYRA 4XD7A 4L8JA 1EXMA 1KK2A 3QYBA 2RC4A 1ZGJA 2DDBA 4B47A 1G8XA 2R5ZB 4YIIA 3SUCA 5TRDA 3ZGKA 2LSOA 1T6SA 4BQAA 1RNLA 1EA3A 1H9GA 1T33A 3HKZA 5L3DA 3TGNA 1EP2B 2R6HA 4IXAA 4WX9A 2VFNA 1GVJA 3OZVA 3VSVA 5HS9A 5E20A 5FO5A 3JTGA 4CHUA 1QGZA 3TO7A 3BZKA 4BBRJ 2R7UA 4UUSA 3H36A 3K4CA 4LOCA 3W2VA 4OOXA 2O17A 5J35A 2VI6A 2LDUA 4BS9A 4D1QA 4W1UA 2C5HA 1IB4A 2LBFA 3T53B 4FQGA 3ECOA 1VQ7I 3I4NJ 4E0FA 4MTEA 1B59A 3LMMA 3HTSB 4UHTA 4C9YA 5F0CA 2XPWA 4Z4WA 2HVQA 2XVCA 3VSKA 1BX1A 2H6CA 1VQ8I 1CF7B 3HOWJ 4X06A 4B3XA 1MBHA 1VLYA 3LFKA 5HS7A 1BOAA 1M1EB 2KRFA 2VJIA 2VXDA 2LVSA 3CJTB 4A0ZA 3Q39A 1YITB 1O8MA 2FQ4A 5CJ9A 2DK8A 1J2XA 2VKVA 4IHWA 1HF0A 4IHVA 3ZQ7A 5M5XJ 4GRIA 3COAC 3GTMJ 5FB2A 3O8HA 1G7TA 2XKOA 5HDGA 3ASTA 4S0HB 2XNJA 5H59A 2L9SA 2O0VA 2HPIA 2KIMA 2CRGA 3PIOF 2DA4A 4RBOA 3SZEA 3GFLA 4UVAA 1HKQA 1PJ7A 2WADA 3ZMVA 3CMMA 4A3LJ 3NARA 2R7DA 5D5WB 2YX7A 3HM5A 1OKRA 1OQYA 5L3FA 3VFZA 4JYKA 1SFXA 3EDPA 2QUFA 1VQ4I 3L2QA 3RIQA 2CFOA 1AA7A 4FHTA 5IPAA 4N9HA 2NS7A 3S1QJ 5E18F 1D5YA 2DT5A 3F72A 3E20A 2EZHA 5H20A 1R4MB 1X3UA 4N3GA 3ZZTA 1XD7A 2R0QC 4BXFA 2BGJA 4Z05A 2DMUA 3K1PA 4LGWA 4W8SA 3MKYB 1YYVA 1HDDC 3LSKA 3WHBA 5H6QA 2QTZA 3CLOA 4U0VA 4NCNA 2XGCA 1JHFA 4G94A 2O5RA 3HOVJ 4UB6C 5AMVA 3PA2A 2OA4A 3MFKA 2O6GE 1FY7A 2C78A 5HVQC 4F93B 3SZTA 3WBKA 4F3QA 2DFHA 2DY1A 1ZUNB 2K40A 3E6BA 1COWA 4R71A 5J8FA 1AIRA 2FEZA 2BM0A 4U87A 4AU7A 2QGGA 3QE2A 4WZEA 2DEUA 2V5IA 2XOKA 4EJOA 2DMNA 1TWHJ 4ZGNB 2BBYA 2F5EA 4OJ6A 3WE3A 3TKYA 3DP7A 2C4UA 3ERMA 4G6TB 3I4MJ 3PL8A 2GAUA 3SJMA 1TWAJ 5EZHA 5F4OA 2HGCA 5FKNA 3RTRA 4ESBA 1ZM9A 3TW6A 4L5EA 3OYMA 1U8BA 2V1NA 1S7OA 1J9ZA 4BXUA 5C1EA 2XT4A 1WOPA 4DZPA 3WTTC 5DD8A 2HQRA 2XAUA 1GVHA 1RESA 5CPRB 4ESJA 4GDFA 3BNWA 4AF7A 1BR1A 1Z67A 1WSVA 4KMFA 2VFPA 4LMYA 2O8XA 1JRGA 5TJJA 3LO8A 4IJAA 2HFHA 1RUOA 3BH6B 1TQPA 2F5VA 2GK6A 4ZCMA 2P8TA 1LDKB 3FX3A 1QFYA 5JHUA 3WGIA 1DARA 1MW7A 3B8HA 3G71B 1YW9A 2VT2A 1R5HA 4AYBN 2E2JJ 4C2TA 3CTAA 2QTLA 3OYDA 3H3VK 1AU7A 5J3OA 2O04A 1QA3A 1Z0XA 3J81k 2EZKA 1EH7A 1KK0A 2EV0A 2BGCA 3CCUB 1EKEA 1X4OA 2EFWA 2UVEA 2XRLA 4HQMA 1N08A 1F5TA 1YX2A 1ONVA 1ODDA 3OYAA 3BPXA 3FBNB 1OYWA 4RLQA 2Y9ZA 2PMUA 1A36A 2XNCA 1K8AD 3CCEI 3VR6A 1YIOA 1Y6IA 3BR2A 4XOPA 3E0JB 2JN9A 1K28D 1KGSA 4RGUA 1U78A 2DO7A 1GXPA 1R5NA 4P22A 3VO1A 5DCFA 2L9VA 1A04A 3LSIA 1R58A 4QVJA 1RZ4A 2M5WA 2M7AA 2KDZA 2W7NA 3H1CA 1X3ZB 5EMNA 2B7BA 1B4AA 2BSAA 3C2HA 2NPFA 2D3NA 1N8RD 5LHGA 3I58A 3C2BA 1HW2A 3WTYC 3HGGA 3B4NA 4QFMA 3GQ8A 1V4RA 1QZEA 3F8FA 2DQLA 2QWWA 2WAEA 1W0KA 1YITI 3KP5A 2LC2A 2VXZA 2QSGX 1FOKA 3Q38A 4EVIA 3IUOA 1Q1HA 3MWMA 3V7CA 5GTHC 1IN7A 4PMHA 1NG7A 4F52A 3U21A 1JKQC 2EBIA 2D9RA 2ZO4A 2VBSA 3ZBUA 1A8PA 4NC8A 4CYCB 3CCMB 1IN8A 2L7ZA 2XUBA 2VOOA 2X6XA 2GJRA 2HXOA 5ICGA 2ZL6A 1K4SA 1GV2A 5E1ZB 4EW9A 4Y17A 5FO0A 2BEOA 1JKOC 3MMYB 1WU8A 2Z8GA 1VF9A 1YW7A 2A61A 3L2UA 4I0AA 3T5XA 4DNCA 2Z33A 4LB5A 4DNRB 3L2RA 3F6VA 4GCVA 1XG1A 4M6XA 1ON1A 5LHHA 2GBYA 4M71A 3RPQA 4OPOA 3I59B 5D6EA 3NWSA 2PBIA 4LJZF 1VQKI 4UUVA 2ECBA 2OYNA 4FWTA 3VYTB 2ID3A 5AN9A 1N25A 3S2DJ 3JU4A 2V6CA 5THXA 5D5XB 2OF7A 5LGUA 2CQ7A 4CCJA 2BV6A 3HHHA 3WG9A 3KZIC 4ITVA 2DYIA 1YLFA 2V7VA 2Y31A 3EUKL 1IUYA 3OYCA 3GTQJ 4LBWA 4O6JA 2V4DA 3A03A 4ENNA 2VBEA 2LH9A 3B73A 3O3KA 4DQ2A 4ZYEA 2AXLA 2COBA 2RNGA 2ID6A 3IAS2 2DMPA 4TMWA 2LOOA 4CH7A 4M9SA 4XN0A 3CLQA 4D7NA 4K1XA 1WMRA 3ASSA 4DBQA 3GZNB 2W4SA 5J4YA 2M5SA 3WTWC 1EZGA 1S0UA 2D1VA 3BPVA 1Z3YA 4O5VA 5DM6F 3C1DA 3ZMUA 3S2HJ 1ITYA 2F1LA 2DI3A 3OPOA 1S29A 3SQNA 3OV8A 5FLVA 2BM5A 2JIZA 4E7HA 4Q47A 4OJOA 5F0FA 2R7TA 5J47A 4M2LA 4ZZLA 1MNMC 2OD5A 2KJBA 3NWTA 3DQVC 1BMFA 2B0RA 2OBRA 3K1MA 3V7RA 4CSWA 2Q6IA 4YAFA 2P5VA 2VC0A 4DOZA 1SM4A 3QFRA 2ZKZA 4IW3B 4YZ0A 2HOTA 1I7PA 1MJ9A 2DOEA 3ECHA 1SD7A 1LFBA 5ICFA 2BSPA 1B2RA 1Z7LA 3HL2A 3CUQA 3TBIA 3W5VA 1E43A 3TOBA 2AHQA 1WXRA 1TWGJ 4QVAA 3WODF 2E34A 2QQ8A 1DGWY 2GOMA 3ABKH 1SVLA 3GVAA 3I1FA 4MQ9F 4G1VA 4C43A 2QBYA 3G71I 1H42A 2PN6A 3I5UA 1FSEA 1PUFB 2H1LA 2IQ7A 4PC1A 4Q5SF 1HZEA 5FKMA 1YW8A 1SD5A 3KLOA 1ZK8A 3RPUD 4Y7CA 3V7AA 2XF7A 3ZPNA 3IV5A 3PSSA 4KA4A 1UD2A 5DCMB 3BTCA 1D0ZA 3CCUI 1QCXA 1TLHB 1OCPA 2RDPA 2CWEA 4RM0A 2HQ5A 3D5RC 4XK4A 1YLOA 2BY0A 2ZBUA 4PDKA 4N4OB 1RR7A 2LY2A 2M87A 1DDIA 5TV2A 1J9IA 2WYRA 2CH0A 1A35A 4TMVA 4IOAF 2DT6A 3FKSA 5CVJA 3X2QH 4KIBA 4DYQA 4XN3A 4EQQA 2MA3A 2EILH 1PKVA 2XKPA 1IN5A 1EH6A 2L9RA 2WB1A 1KQ9A 2ELJA 1V5EA 1ENHA 2IVMA 5ICCA 2ZZGA 1ZARA 5F4JA 3PUFA 3A3BA 2ISYA 3CC2B 1WJDA 2ELHA 5HLGA 5D8LB 3DKWA 3M1EA 3AGPA 2A69F 5DUIA 3PO3J 4A3CJ 4L5IA 3ASPA 2KFDA 1YOVB 2MLGA 4P3YA 1HKSA 1UCRA 3ZC3A 4A3DJ 2F48A 1FDRA 2W6JA 5GV7A 4NUBA 3WE2A 3BZ6A 5A2QK 4G7WA 5C1CA 3CCMI 2P7VB 4E70A 3LSMA 3KPHA 3K4NA 1W35A 1TNTA 4BU2A 4GXOA 3OSGA 3CXCB 5HKKA 1QVTA 1KK3A 4HZFA 3BROA 2UWMA 3W2GA 4DK1A 2IXSA 4XLHA 1QRCA 4YZQA 2GXGA 3QWLA 1ETVA 2QENA 3BR1A 1Q82D 2M0MA 5AONA 2HOSA 2CW8A 2OZ6A 3KYCB 4P26A 3JRCA 2DA2A 3JW4A 3B6CA 2K9LA 3LSTA 2CGPA 2ETHA 1QGYA 2H09A 3CDLA 1HLVA 3V8LA 2XSJC 3FK6A 2P0WA 4BY7J 1TWCJ 1TTYA 2OU2A 3GBGA 1R7JA 4ON0A 3U9GA 2M0CA 2IRFG 2GOXB 1E79A 1RWRA 3CMYA 3CMAB 1E3XA 2G0EA 1JJ8C 4BBSJ 1KU9A 5JVGF 1F9NA 4ZDPA 1QFZA 2VNHA 5BOXA 2LFBA 2OK7A 2VYQA 3RZDJ 4AVZA 2TRTA 3VB2A 4G7HF 4F7ZA 2KIFA 2ISZA 5E8GA 3F8MA 4A3JJ 4YRVA 2V7UA 4RD6A 1IDYA 1F4KA 1T5EA 2H8RA 2O6WA 1DPRA 2WC2A 2XIGA 4U9UA 4B09A 2BHZA 4A0YA 5IYNA 2XTXA 2FX0A 4N9IA 3OYNA 1OYIA 2M3AA 1WJBA 2V7TA 5LGTA 2RN7A 1GQ8A 2YX4A 4YAOA 4MXNA 4BJ5C 2DT7B 4EJVA 1UAAA 1WSRA 4ZYHA 1XSVA 4YEIA 5D4SA 3CPXA 4RD4A 2PYGA 1HDPA 2M9HA 5K7FA 2DXIA 1BW6A 2E1MC 1GDTA 4ZZDA 2X9DA 2G7HA 4A5NA 4HNVA 2HDWA 1XCVA 1SEUA 2JJ1A 3GUDA 3WXMA 4I84A 1FNBA 1DBOA 2VNKA 5HDNA 3FXKA 1YTYA 5HZBA 3J7ZI 2JRMA 3ZZ0A 5LEKA 3MKWB 3PETA 3E3VA 4HBLA 2NSTA 1OB5A 3VODA 2F4OB 3ML3A 2ZSHB 3KEOA 3QFCA 4LC0A 2DA5A 3HTUA 4RM3A 4TV7A 4BPRA 2DMQA 1P4WA 3LAJA 4Z4TA 2DOFA 4EV0A 4EGYA 4TT3A 2BMWA 2ZNYA 5HS8A 2KLOA 1JKRC 1I6HJ 3BJOA 2CQKA 4X7EA 1YHQB 3DFGA 3RI4A 1QRBA 1O8DA 3HOUJ 1TBXA 3ABLH 2FE3A 3QODA 3BR5A 1WVRA 2ZXHA 2J8IA 1WPCA 1R4NB 2KDOA 4BE1A 1SANA 2E2IJ 2PMDA 2F4MB 1WRJA 1G3SA 2LTPA 2EA4A 3KEYA 3I4PA 3H5NA 3WG7H 3ZQQA 1JA0A 1VQPB 4KFCA 1G3TA 2JRTA 1HF2A 3DKYA 1VQOI 3OYBA 2IS4A 3CCYA 4P9SA 3Q0WA 4D0PA 4FISA 3CESA 2VKEA 4Y33A 5EGOB 1F20A 3C2GA 1N0VC 2F1MA 2E1OA 5E3MA 4ACAA 1WCMJ 1W2BB 2VODA 4M3FA 2V4JC 3ZMTA 4CZZA 1E3OC 3FMRA 5DEQA 3NB2A 2Q2EA 3FF5A 3HXLA 2BZTA 5F27A 3CC2I 4X6AJ 4JK1X 4HE6A 3MVPA 2Y0SA 4XLPF 1UB9A 2FF4A 1K6YA 2QYOA 1O3SA 1O8KA 2R7VA 3ZQGA 2RC5A 3SKBA 5FKLA 2GQFA 3PNVA 4XONA 3A8JA 3Q3AA 4MIMA 5D5UB 3PSFA 4L5JA 2CMPA 3HPHA 4OOVA 1HW5A 3M8EA 1I8DA 1AMOA 2C6YA 3K2AA 2D74A 5FKKA 3PNTA 1W0UA 3Q6RA 3BY2A 2HKXA 5F1JA 1T98A 1W36D 2V1XA 2UXNA 2Z99A 4XLAA 1L0OC 3WTUC 3DEUA 3KP6A 3OYGA 2WPDA 2GLOA 3IH3A 5IYBJ 4Z4YA 3C3WA 3WU1B 2GA1A 2RGVA 4XMYA 3HOYJ 1VQ9B 1TYXA 3S32A 1G2HA 1PJRA 1HSTA 2BVMA 1W7PD 3R6SA 3S8PA 3JSOA 2VONA 2XZOA 4HNUA 3OE7A 1TC3C 3BH4A 2KRHA 3F22A 4DGWB 5B1BH 5HLTA 1P92A 4E7JA 1P9QC 2J5PA 3HRTA 4HWVA
chains in the Genus database with same CATH topology
3HOTA 3DLAA 1LFPA 3I3LA 4C9YA 2V7FA 3OOUA 2HVQA 1D0YA 3MKZA 2KL4A 3H35A 3VSKA 4B44A 4CZCA 1SAUA 2PJRA 3OYEA 1DQUA 3H5AA 4B3XA 3F9KA 1VLYA 1O8IA 2NTQA 2KHMA 2VJIA 2VXDA 2W82A 1O8MA 4BDZA 2JA2A 1JTAA 5JHFA 3SDBA 1T0FC 1DBGA 4J01A 2GJKA 4XNFA 3ZSCA 4GRIA 3GVKA 3ZPPA 1XG2A 4IQ4A 4CCKA 2NTBA 3K4KA 4KKTA 3OR2C 3I9V2 1VBLA 3H5RA 4Z06A 4DJAA 2L9SA 4RM2A 2O0VA 4OZZA 2HPIA 3BLYA 3DTIA 2HNHA 1PE9A 3VYUB 2KVOA 1UG0A 3OOCA 2V26A 2WADA 3CMMA 2QE7A 5KCMA 2KQRA 2WY8Q 2V31A 4BACA 3SEQA 2VKDA 3TL4X 3EQNA 3GQ7A 1SFKA 2E5NA 3L2QA 2CFOA 2Z1DA 1AA7A 3BCDA 3G2BA 2HLDA 4NQWB 1BLIA 4DNTB 1KZLA 3L2VA 3D5LA 4KKSA 5FRNA 3OW7A 3H9QA 4FASD 4ZC3A 4G7XA 4BXFA 2INVA 3OYIA 4XKBA 4JQFA 4Z05A 4BEHB 4W8SA 3V42A 4KITB 3EUAA 3MKYB 1FMVA 2VIXA 4ZDOA 2L7KA 3LSKA 2LZJA 2VJ4A 1Z21A 1QJVA 3HG9A 1X1AA 2FUG2 1MABA 5HNHA 5KNLA 1X1DA 2O5RA 4IQJA 1W0JA 5AMVA 2X6WA 2IS6A 1BOBA 4BQQA 3PSIA 4W8QA 4E6KG 5HVQC 2VQGA 1MMAA 4DIQA 4F93B 4F3QA 4H4KC 2KRCA 3VYSB 1MNDA 1MMGA 3ZXSA 1COWA 5LFAA 1AIRA 4XORA 1WJ5A 3HUGB 2Z16A 3BCBA 1BR4A 3K4MA 4U87A 4AU7A 2VL8A 2XOKA 1WJAA 4G6IA 4Z1MA 2R7OA 2PECA 4YZAA 1DGRM 4OJ6A 1Y56A 2QKLB 2LRDA 1IRXA 2K9MA 3PUBA 4G6TB 1TT0A 1OR7C 3PL8A 2LYCA 3LL7A 2R7XA 1OHHA 3ZCOA 4D9JA 1H8HA 1KMHA 3PNYA 4XM3A 3BC9A 1YE9A 3RTRA 2X3HA 2MFZA 3FKJA 3H0DA 4N4NB 1N78A 3DDYA 3OYMA 1E0EA 2V1NA 4KJZA 4URRA 5C1EA 4LIVA 2V7QA 2WJVA 2XAUA 5CPRB 2PYHA 1CZFA 1BR1A 1RMGA 5KHDA 3OYLA 2XGJA 3DU5A 3ZRGA 1DP3A 4E7KA 2W6IA 2JDIA 1JRGA 2ZTNA 1OGOX 3DPTA 5HOOA 2F5VA 2GK6A 1LDKB 1MW7A 2L2OA 2BVLA 2X53S 5IK2A 3A4CA 2VBKA 3DEEA 4C2TA 3S3OA 3IP4B 3OYDA 4NC7A 5FRMA 4U7BA 2O04A 1YX3A 3A1YA 2QKMB 1ZELA 2NOJB 2IGOA 3DTEA 1X4OA 2UVEA 2NZMA 1N75A 3DPLC 3DU6A 2XZPA 1O88A 3DPUA 1X0CA 1QHGA 1O8EA 4HNTA 4ZYAA 3OYAA 3FBNB 4RLQA 3VR6A 1Y6IA 4BE0A 2WAQA 3B90A 4XOPA 4E4HA 2AQFA 3E0JB 3IAM2 2L5QA 4DBRA 1K28D 3FPPA 4P22A 3FY3A 1WP6A 2RQQA 2X1EA 3OYKA 3LSIA 2O1DA 1KCCA 2V9KA 2M7AA 2W7NA 3TMOA 4JMQA 1PXZA 3C2HA 3PFYA 2D3NA 4HSRA 4YXWA 3B4NA 2X85A 1UD8A 4PSWA 3PJRA 4IX7A 3GQ8A 3LSHA 3KX2A 3OS1A 2QX3A 2WAEA 1W0KA 4OZYA 3UR3C 4CCNA 4OWRB 2LC2A 2VXZA 4ANJA 3AKZA 3IUOA 1H8EA 1HG8A 4RMNA 3VSUA 4PMHA 1NG7A 3ZR8X 3U21A 4F52A 3WWGA 1NHCA 2R7UA 3K70C 4NC8A 1G59A 3WQZA 4B48A 3HC7A 2X6XA 2GJRA 3CF2A 4XL9A 4EW9A 1NRKA 2A6TA 4XKWA 3A35A 3MMYB 2Z8GA 4XKCA 2E1BA 2X6YA 2W1OA 2ZXIA 3L2UA 2INUA 1N77A 4DNRB 3BG6A 2CK3A 3L2RA 4PJLA 2NT9A 2E5ZA 3J7AY 2KZVA 2WSSA 4XR6A 2A5WA 2F4IA 3BG7A 1U0JA 1KONA 2MYSA 2M4GA 3NWSA 3OR1C 1EFRA 5FL7A 2VBMA 3JURA 3L2WA 4NK6A 3T51B 2K5CA 3VYTB 3H9JA 3ONQA 4NNJA 4XLCA 3JU4A 1I18A 2JUGA 1E1RA 4CCJA 2DCEA 4ITVA 4PSXA 2IS2A 1UELB 3EUKL 2RREA 3OYCA 2CW7A 2V4DA 3K4JA 2VBEA 2LH9A 4BEHA 4F55A 1D1AA 2EWEA 1WJCA 3CZ6A 2RNGA 3VMVA 2ZTGA 1V0FA 3IAS2 4KISA 1EE6A 2LOOA 2UV1A 4CH7A 4XN0A 3H9GA 3BCAA 3HPGA 2D3LA 1WMRA 4B43A 2VQLA 4DBQA 2W4SA 2M5SA 2WJYA 1Z3YA 4W8RA 2LY1A 3OPOA 1K5CA 3OL3A 4DK0A 3K70D 2XF6A 3CJRB 4RLFA 3OAAA 4PJJA 4CCLA 2BW3B 2VJJA 4CCMA 3B8YA 2R7RA 4E7HA 2JIZA 2HU9A 2XNDA 4OJOA 3OYFA 3VYRB 1R6RA 3K4BA 2R7TA 4Z03A 2IGNA 2UUZA 3NWTA 3DQVC 4OAYA 1BMFA 4CSWA 5FROA 3SEZA 4BL0B 4DOZA 4P5OA 4YZ0A 3OWTA 2M4KA 4PJMA 1O8HA 2JVGA 3H94A 2E60A 2WA0A 2ZZFA 1Z7LA 3HL2A 2BSPA 3EQOA 2R9VA 1WJEA 4GQNA 3TBIA 1E43A 4J00A 4II2A 4ZDLA 2IGKA 1BN8A 1X19A 4HEA2 1SKYB 4W8TA 4KKUA 2R7QA 2VASA 3OL4A 2XF5A 2W00A 1DGWY 2GOMA 3N05A 3T9GA 2VQHA 3QYEA 1WTHD 3FDYA 1NBMA 4B3FX 2X1CA 2E1MB 2ZZQA 2IQ7A 3K10A 1KTWA 1HZEA 2Q1ZB 3RPUD 2BOLA 3LSGA 2XF7A 1O8LA 3ZPNA 1VJSA 4ZTFA 1UD2A 3AFHA 2R7SA 1D0ZA 1QCXA 2KMUA 4CA0A 2F43A 1MMDA 1IDKA 4CCOA 3D5RC 4E7LA 2NTPA 3M1CA 1WJFA 3GQBA 1BR2A 2CV0A 3LNNA 5CQEA 1X4PA 3BC8A 3FHNA 4N4OB 2LY2A 4U4BA 1FX0A 3NE5B 2CS3A 2CH0A 2ZFUA 3VDXA 2GJPA 1KCDA 3AL0B 2WY7Q 2DT6A 1OLTA 3CP8A 2Z2SB 1V5GA 3K4LA 4BQNA 4BQOA 3S3NA 2LG4A 4OAZA 3FKSA 3GQ9A 4OJ5A 4XN3A 1O8JA 2Q2EB 5CQGA 2ELJA 1PKVA 2WB1A 1LKXA 1V5EA 2DOAA 2ZZGA 4BE2A 2NT6A 3A3BA 1X1CA 1QHHD 1WJDA 4C2UA 1HA8A 3RCOA 1FMWA 1IDJA 1OGMX 1J09A 4II3A 2QY1A 3OFNA 3G05A 1O8FA 2W6JA 4NUBA 3OEHA 4G7WA 3KEWA 5C1CA 3LSMA 1GLNA 4PFOA 3K4NA 4BJ6C 4BU2A 5HKKA 1H80A 1D1CA 4BGDA 3KRGA 5DN6A 2V6EA 3UNGC 4IZZA 2UWMA 4DK1A 4YEJA 2IXSA 4XLHA 4AYBA 4YZQA 4QPQA 3EUHC 3MD2A 1ERDA 2X51A 3VSLA 2M0MA 2CW8A 2WAFA 2LBFB 1Z3XA 2PMZA 5CKTA 1YX5A 2K9LA 2K3PA 1VF7A 5TGTA 2XSJC 3QYFA 4HG2A 1V5FA 2P0WA 2WBMA 3OMYA 2X8KA 2MC4A 3OIPA 2XDVA 4P1WA 2VQCA 2MABA 4E7IA 3GBGA 4LIUA 2Z6BD 5CDFA 2GOXB 2PJRB 1E79A 1RWRA 4Y3OA 4OJPA 1E3XA 2ZZEA 4HIZA 4E7ZA 4ZTJA 4YELA 1E3ZA 3SZGA 4ZDPA 4JOMA 4LITA 1UD3A 4X0GA 2CUJA 2O17A 3KYLA 1HVXA 3CP2A 1UD5A 4AVZA 1V0EA 1O8GA 1OOCA 4Y4RA 2IS1A 3S93A 1S9HA 1MMNA 2AQEA 4YRVA 4BJTA 2VLAA 1T5EA 3VSTA 1PYVA 4LG3A 2ZSIB 4U49A 4B3GA 4YZXA 4EATA 2VJ5A 3GQAA 1X1BA 3OYNA 2CUZA 2M3AA 1WJBA 4QPOA 3OIQA 4TKOB 1GQ8A 4MXNA 4BJ5C 3DKXA 2DT7B 1UAAA 4XOTA 2HVRA 3SYTA 2BW3A 2PYGA 3GRHA 2UVFA 2DXIA 2ODLA 2E1MC 2JJ1A 4ASUA 2HDWA 4I84A 3OS2A 3VMWA 1DBOA 2X1DA 3ZIAA 4OJLA 4PJNA 4CUGA 3OY9A 3DTKA 2GK7A 3MKWB 1JI8A 1PLUA 3OEEA 2NSTA 2JVHA 3K6GA 2NSPA 2ZSHB 3RQ4A 4RM3A 3HOSA 2HVSA 2DIEA 4TT3A 3S3MA 2KLOA 3AL0C 4IKFA 1IA5A 1D0XA 4MLOA 2MD0A 4BUPA 1W36C 2IGMA 2OC6A 3OYHA 4F91B 2KPMA 1O8DA 3QOEA 1RU4A 4FETA 3QODA 4UZUA 2O0WA 3HAGA 1UD4A 3OS0A 3CJQB 4HSTA 2R7WA 2ZXHA 1W9XA 4FXUA 2LREA 2CV2A 1WPCA 4XKVA 2KDOA 4BE1A 4XLFA 2HZDA 1D1BA 3T56B 1OFLA 2VPLA 2KP6A 3KEYA 4XQFA 2F6CA 3H5NA 3ZQQA 1QU3A 1E1QA 1BHEA 3GVLA 3W3CA 5LD2C 3DKYA 4PUSA 3UW0A 3OYBA 2IS4A 3DWLE 2WZPP 4E7SA 3A2KA 3CESA 4Y33A 3VWBA 1OB0A 4BDYA 3C2GA 2F1MA 2QXZA 4C2LA 3RSNA 5HNFA 2L9NA 2V4JC 3LMWA 2JJ2A 3HXLA 4PFPA 2JSPA 1BPLA 3A3GA 1VZ0A 4C30A 2Y0SA 1OFMA 1O8KA 1K6YA 2R7VA 3FBIB 2HQAA 3PNVA 4XONA 2XC7A 2I8DA 1NG6A 2HPMA 2XZLA 1UD6A 3PSFA 4XD7A 3LFUA 2CMPA 3HPHA 4L8JA 2DJIA 3E1SA 1MNEA 3QYBA 3EPZA 1I8DA 4B47A 2OV7A 4PK4A 2OUMA 1G8XA 3PNTA 3OYJA 3SUCA 3ZGKA 1W36D 1EA3A 3HKZA 3GVJA 4XLAA 3W2AA 4NK8A 3VSVA 3OYGA 2WPDA 4KT6A 2R4GA 1LVKA 4ZJZA 1TZLA 2VB6A 2VKHA 4HPQA 4XMYA 3S32A 1T95A 3K4CA 1PJRA 2BVMA 2M7BA 3S8PA 3W2VA 4R79A 4HRIA 3BCFA 4TSFA 4HNUA 2XZOA 4XLEA 4BS9A 4D1QA 4F92B 3OE7A 1IB4A 3BH4A 2KRHA 2LBFA 3D5SC 3T53B 4DGWB 5HLTA 4MR0A 4E7JA 3M8JA 4E0FA 1P9QC 3W2WA 2CV1A 3LMMA 1WFXA 4HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZ0 A;  4U49 A;  4YZX A;  2O04 A;  1O8H A;  3GQA A;  2BSP A;  2UVE A;  3EQO A;  1GQ8 A;  2NZM A;  4MXN A;  1O88 A;  1X0C A;  1BN8 A;  1O8E A;  4XOT A;  1O8I A;  2NTQ A;  2VJI A;  4W8T A;  1O8M A;  2PYG A;  3GRH A;  3B90 A;  1JTA A;  2UVF A;  2ODL A;  4XOP A;  1DBG A;  3FY3 A;  3T9G A;  4XNF A;  4I84 A;  3ZSC A;  3ZPP A;  3VMW A;  1XG2 A;  2IQ7 A;  2NTB A;  1DBO A;  2O1D A;  1KCC A;  1KTW A;  4OJL A;  1VBL A;  1PXZ A;  1O8L A;  1PLU A;  4Z06 A;  4OZZ A;  2O0V A;  2NST A;  3B4N A;  2X85 A;  1QCX A;  1PE9 A;  2NSP A;  1IDK A;  3GQ8 A;  2NTP A;  2QX3 A;  4OZY A;  4U4B A;  1IA5 A;  1HG8 A;  1KCD A;  3VSU A;  4PMH A;  3WWG A;  1NHC A;  1O8D A;  1RU4 A;  3EQN A;  3GQ7 A;  3GQ9 A;  4OJ5 A;  4XN3 A;  2O0W A;  1O8J A;  2X6X A;  4XL9 A;  4EW9 A;  2NT6 A;  4XKV A;  4XLF A;  4XKW A;  2INV A;  1OFL A;  2Z8G A;  4Z05 A;  4W8S A;  2X6Y A;  4XQF A;  1IDJ A;  1OGM X;  1BHE A;  2INU A;  1QJV A;  2QY1 A;  2NT9 A;  3UW0 A;  1O8F A;  5AMV A;  2X6W A;  4XR6 A;  2VBM A;  5C1C A;  2QXZ A;  3JUR A;  4W8Q A;  4C2L A;  4NK6 A;  4XLC A;  1H80 A;  3KRG A;  3LMW A;  1AIR A;  4XOR A;  4YEJ A;  4XLH A;  4YZQ A;  1OFM A;  1O8K A;  2PEC A;  4YZA A;  4XON A;  4OJ6 A;  2VBE A;  2EWE A;  3VMV A;  1EE6 A;  4XN0 A;  1WMR A;  4XM3 A;  2X3H A;  3SUC A;  4URR A;  5C1E A;  4W8R A;  1RWR A;  1K5C A;  4OJP A;  4XLA A;  4NK8 A;  3VSV A;  2PYH A;  1CZF A;  4YEL A;  1RMG A;  2VJJ A;  3B8Y A;  4XMY A;  4OJO A;  1JRG A;  2O17 A;  1OGO X;  4Z03 A;  4AVZ A;  1O8G A;  1OOC A;  4XLE A;  1IB4 A;  4MR0 A;  4HWV A;  3VST A;  2VBK A; 
#chains in the Genus database with same CATH topology
 3HOT A;  1PP8 F;  3T8T A;  1LFP A;  1W0T A;  1AWC A;  2GXB A;  3OOU A;  4RDK A;  3CPW B;  1DUX C;  4ESF A;  3MKZ A;  2VPR A;  3CMA I;  1MMS A;  3H35 A;  4MFE A;  3QAH A;  2F5D A;  2VBY A;  4B44 A;  2M8G X;  5C4X J;  1N0U A;  1SAU A;  2PFB A;  3FXM A;  1DQU A;  5ERI A;  2Z9O A;  1GVD A;  2PJR A;  2QZA A;  3H5A A;  4QIW N;  1WSU A;  2YWH A;  1IN6 A;  3CF5 F;  2LMD A;  2CND A;  1TUI A;  2W82 A;  1VQ8 B;  2BM6 A;  4BDZ A;  1K78 B;  1XMA A;  1JTA A;  4P9F A;  2PLF A;  3W2E A;  1DBG A;  2VBZ A;  4XNF A;  2PLY A;  4CQJ A;  2XGD A;  4PC2 A;  2QGU A;  2ZCW A;  3BG5 A;  1AKH B;  3GFI A;  1WI9 A;  3I9V 2;  3GTJ J;  3A01 B;  3KZZ A;  1ZG1 A;  2A07 F;  1Y1V J;  4OZZ A;  1FPQ A;  3BTL A;  3FMS A;  3HZJ A;  4WXC A;  5BMZ A;  4X05 A;  2KIS A;  5CYV A;  3QPH A;  1XMX A;  5KCM A;  2IW5 A;  2H1K A;  2E1R A;  2JA5 J;  1Q86 D;  5GAD J;  2HOE A;  2WY8 Q;  5JI6 A;  1HA3 A;  4I7H A;  1X1P A;  2VKD A;  4PGO A;  1XMK A;  3W2I A;  4AC9 A;  1UJ8 A;  3GQ7 A;  3R4K A;  3BQY A;  2M30 A;  3BCD A;  1MBG A;  3G2B A;  4NQW B;  1ZG5 A;  1BLI A;  4DNT B;  1MH4 A;  4KKS A;  2NVT J;  5FRN A;  4CDG A;  2JA6 J;  2NVQ J;  4FAS D;  1OYY A;  4ZC3 A;  1NH3 A;  3JR9 A;  2IA1 A;  3TH0 A;  4BEH B;  1CQX A;  4EJW A;  2VIX A;  1X58 A;  2LZJ A;  2D5V A;  5HZA A;  1QVU A;  5GPA A;  1U5T A;  1NK2 P;  1ZAO A;  3SFZ A;  1O3R A;  4WWC A;  4ENK A;  2X6W A;  2FD5 A;  2IS6 A;  2XPV A;  1XQB A;  4E6K G;  2VQG A;  3WGG A;  2CW5 A;  5IT3 A;  4V19 K;  4H4K C;  4LB6 B;  2KRC A;  4N0B A;  1OCO H;  1KK1 A;  1F1Z A;  3ZXS A;  4RD0 A;  1YJN B;  1O3Q A;  5LLQ A;  1UST A;  1WJ5 A;  3HUG B;  2CJJ A;  1BR4 A;  3BCB A;  4G6I A;  2VL8 A;  1WJA A;  2HS5 A;  2HDC A;  1ZGW A;  1S3J A;  1VQP I;  5C3E J;  1IGN A;  1JA1 A;  1JKP C;  3RKQ A;  1Y56 A;  4R8H A;  3FJO A;  2MH9 A;  2ZJ2 A;  4LLG F;  2V1D A;  4ENM A;  5K7Z A;  1I6X A;  1OHH A;  1V5V A;  3OP1 A;  3CCV B;  1RRJ A;  3MAJ A;  4LIV A;  3A1P A;  3I56 B;  2WJV A;  2XRN A;  5FFX A;  3LQE A;  2ZL5 A;  4HX4 A;  1TYV A;  4I76 A;  1CZF A;  2PYH A;  2X6O A;  2ACJ A;  4AIK A;  3OYL A;  2XGJ A;  3DU5 A;  1DP3 A;  1FLI A;  4E7K A;  2DDA A;  2W6I A;  2P3M A;  5HOO A;  3AVT A;  3P9C A;  2QA4 I;  5JR3 A;  3H0G J;  3MEX A;  2ZBV A;  2BVL A;  4DQL A;  3VO2 A;  2X53 S;  1TYU A;  1ETQ A;  5FFZ A;  2VBK A;  1XSX A;  3FWE A;  4EM2 A;  3S3O A;  1HQC A;  3BY1 A;  3HRU A;  3QPT A;  2QKM B;  2NOJ B;  1WI3 A;  2IGO A;  2PMZ N;  3P9I A;  2XZP A;  3FIW A;  4A3I J;  2CG4 A;  3GTO J;  1B1B A;  3DPU A;  2YWG A;  3OIO A;  2GZW A;  2MBF A;  1R49 A;  1TNS A;  1SVO A;  4XRS A;  3P4G A;  1UZC A;  1SC7 A;  2PIA A;  5J4V A;  3TO9 A;  2XTY A;  4E4H A;  3FY3 A;  3IAM 2;  2L5Q A;  2E36 A;  1E17 A;  1WP6 A;  3LVB A;  1W5C C;  2YU3 A;  3CCE B;  2YWF A;  3HSR A;  1XX5 A;  1QZY A;  3MZ8 A;  4YIF A;  4JMQ A;  4A6D A;  1WOO A;  5L3E A;  1ZHF A;  1ETO A;  4RD3 A;  1JTX A;  4YXW A;  1UD8 A;  1MJB A;  3LQQ A;  2DA7 A;  3K7A J;  2GIV A;  1HBX G;  2IOU G;  1FYL A;  4IF4 A;  3ZMS A;  4A2U A;  1CF7 A;  4OIQ F;  2O0Y A;  3AG4 H;  3W6V A;  3UR3 C;  1I3A A;  4WQM A;  3GO5 A;  1QGA A;  1HG8 A;  4Z6Y A;  1ETK A;  3KET A;  3ZR8 X;  4GYI A;  1MGT A;  1IJF A;  2HKO A;  1G59 A;  2IA0 A;  4B48 A;  4ACB A;  4I01 A;  2E7W A;  3HC7 A;  3LNQ A;  1C0W A;  1JT6 A;  5E79 C;  2K85 A;  3TED A;  4LBY A;  1BA5 A;  4MNU A;  3SFI A;  2BY2 A;  3HOZ J;  3FM5 A;  2A6T A;  4K2E A;  1KD1 D;  2E1N A;  3G1M A;  3A35 A;  4HDV A;  2WWY A;  3OKX A;  2X6Y A;  1I5Z A;  2M34 A;  4HE5 A;  5LRR A;  2ZXI A;  3W2H A;  2INU A;  3RIR A;  1O7F A;  3BG6 A;  4IOC F;  3JRE A;  1Z91 A;  3J7A Y;  1SMT A;  3JAM Z;  1XGO A;  5GAE J;  1KC8 D;  3L9F A;  3OR1 C;  3JUR A;  3AK5 A;  2RQP A;  1BJK A;  2D1H A;  4EMS A;  1LQ1 A;  3T51 B;  3RY8 A;  4XLC A;  1I18 A;  4U88 A;  2JTV A;  3GWZ A;  4IO9 F;  4RLZ A;  4L9T A;  2DTZ A;  4I02 A;  3Q9S A;  2GA2 A;  1VQK B;  3J80 Z;  3A0H C;  4PSX A;  2IS2 A;  3EYY A;  4WK8 F;  2NAZ A;  1WPK A;  1ZLK A;  4U7D A;  1NDH A;  1VQL B;  3L00 A;  1VQ5 B;  2BY3 A;  3O2P E;  1TYW A;  1ZGA A;  5FLX Z;  1IJE A;  1WJC A;  3CZ6 A;  4KIS A;  2G7U A;  2D3L A;  4EM0 B;  3BCA A;  5C44 J;  2JT1 A;  3IKT A;  1R5O A;  1LUJ B;  3CUQ C;  1G7C A;  1R1T A;  4HF0 A;  1O57 A;  1SAX A;  3BOQ A;  3H92 A;  4ZYG A;  1FOX A;  1YJN I;  4LLN A;  2LLK A;  4PAA A;  2OQG A;  3OSF A;  2VJJ A;  3B8Y A;  3PO2 J;  5B66 C;  4UY8 I;  3KP7 A;  3CB4 A;  3T8R A;  1J59 A;  1ON2 A;  2Y48 A;  2IGN A;  5KK1 A;  1TLL A;  1FNN A;  1ZKG A;  1Y8Q B;  1T56 A;  3CCV I;  1Y0Y A;  3BT9 A;  3I71 A;  3GIR A;  3J81 K;  2K86 A;  2Z5U A;  1EFT A;  3L2C A;  2YPR A;  3OWT A;  4FX4 A;  3MHP A;  4PJM A;  1O8H A;  2JVG A;  3I56 I;  3JRH A;  2EIX A;  2E60 A;  2ZZF A;  5HOD A;  5TR9 A;  5ILU A;  5EEG A;  2QQ9 A;  4EJU A;  4XRM A;  1PP7 U;  2ESN A;  1RPW A;  2ZFW A;  4II2 A;  4LG0 B;  1UFM A;  1SKY B;  2ZBK A;  4W8T A;  2DU9 A;  3T0Y A;  4KKU A;  3LYC A;  2VAS A;  3BTI A;  2DQR A;  5LEJ A;  1REP C;  3T9G A;  3QYE A;  3VEP A;  1BX0 A;  1NBM A;  4J0Q A;  2XPU A;  2X1C A;  3RYP A;  2FX3 A;  4KT5 C;  3ZQH A;  1QG0 A;  1T6X A;  4WXD A;  5L3G A;  1MKM A;  1SVM A;  3RKW A;  5BSX A;  3LSG A;  1JUS A;  4L0Y B;  4M6V A;  4HV5 A;  2KMU A;  1MBE A;  3TO6 A;  4CA0 A;  1MMD A;  1LNW A;  2FQ3 A;  4M3D A;  1R5B A;  1IDK A;  5E3O A;  3IWZ A;  2W57 A;  2NTP A;  5HDK A;  1WJF A;  2EA2 A;  3LNN A;  1JJ6 C;  3FHN A;  4U4B A;  1FX0 A;  3K0L A;  4V2G A;  2NOG A;  1WOR A;  5EG0 B;  3OJW A;  4AVP A;  2DOD A;  1I27 A;  2DA3 A;  3AL0 B;  3S3N A;  1XFO A;  2Z2S B;  1R00 A;  1V5G A;  3B6A A;  3OOP A;  4BQO A;  3ZQC A;  4HF1 A;  3OJX A;  4OJ5 A;  4MHG A;  4RDU A;  3CRZ A;  3AG2 H;  1J0R A;  2NS0 A;  1CGP A;  2DOA A;  2XB0 X;  3DXJ F;  5GAG J;  3LWF A;  2OCC H;  1G7R A;  4OM9 A;  3AGQ A;  4C2U A;  4B3A A;  2MD5 A;  2XB5 A;  3WTV C;  2VFQ A;  1W7P B;  2K9S A;  3FZV A;  1HA8 A;  4RB0 A;  3GSI A;  3Q0U A;  1LFU P;  1ZRC A;  3NQO A;  3BY6 A;  1QQI A;  1YFH A;  4QV2 A;  1XGS A;  1DDG A;  2L7F P;  3KLN A;  3ULQ B;  2ZIT A;  1APL C;  4DQK A;  4NB5 A;  3KP3 A;  4AWX B;  1TQI A;  4EM1 A;  5B1A H;  4BJ6 C;  2NV4 A;  1TL8 A;  4CYC A;  3PM1 A;  1H80 A;  1S5L C;  1D1C A;  1WQ2 A;  3VPR A;  5DN6 A;  5FO1 A;  4HW0 A;  4BH9 A;  2V6E A;  3UNG C;  3GFJ A;  2C5B A;  4AYB A;  4Y15 A;  2EZL A;  3BQZ A;  5JLV C;  1GUU A;  2FXA A;  2PMH A;  1FJL A;  5IYQ A;  2LK2 A;  3IH2 A;  2WAF A;  3SY2 A;  1XDS A;  3LQR A;  2B5O A;  3W5H A;  5TGT A;  4KH3 A;  2ZME A;  1O3T A;  2X8K A;  3LOC A;  4V02 C;  2FA5 A;  2DJN A;  1TQM A;  3RJP A;  1YRN B;  2MAB A;  1LDD A;  3I59 A;  1LLW A;  2EV6 A;  4Y9R A;  3JAM K;  2Z6B D;  5CDF A;  3FXL A;  1FND A;  3TDZ C;  2DW4 A;  2QDX A;  2ZZE A;  3ZMZ A;  1G7S A;  4ZTJ A;  3FXQ A;  5IYC J;  1E3Z A;  1SD6 A;  1VQL I;  1IV8 A;  3GLX A;  4JOM A;  2R5Y B;  5FJ8 J;  1Z9C A;  1VQ5 I;  1UD3 A;  3A8I A;  1B9M A;  3ZN1 A;  3B82 A;  1O8G A;  1OOC A;  3JRI A;  2IS1 A;  2K27 A;  2EIN H;  3G1O A;  1IRF A;  4M6Y A;  4I09 A;  5E1X A;  2NXN B;  5J1U A;  1S9H A;  2AQE A;  2XV4 S;  1EA0 A;  4BJT A;  1OIS A;  4H0E A;  1PYV A;  2DPD A;  2ME6 A;  2ZSI B;  1IC8 A;  2VBX A;  3WTX C;  1BM9 A;  4M3B A;  4HX7 A;  1FNC A;  2AXT C;  4QPO A;  2HOA A;  4DYR A;  3DLL F;  3M3Y J;  4L18 B;  3QFS A;  2BM4 A;  4HQE A;  1LVA A;  2STT A;  3GF2 A;  1EFU A;  1GJR A;  1YI2 B;  2E19 A;  1B72 B;  1MRZ A;  5K5R A;  4RB1 A;  1T08 B;  1H88 C;  3M4O J;  5FD6 A;  3GRH A;  3FXR A;  5ED4 A;  1BJZ A;  2JN6 A;  4CYD A;  3ASR A;  1ORK A;  2F5F A;  3OS2 A;  4HX8 A;  1CNE A;  1KQ0 A;  1W1W E;  3ZIA A;  5E3L A;  3TP3 A;  2RKH A;  4CUG A;  5EF6 A;  2C2W A;  1MDM B;  1WKM A;  1YIJ B;  1JI8 A;  2GXA A;  4XIC A;  2X3U A;  3AVU A;  4M9Z A;  2F5C A;  5A8A A;  3ZBT A;  5F6F A;  1B8I B;  1T39 A;  1DG1 G;  2V9P A;  4Q48 A;  3NAU A;  2DIE A;  3R6J A;  1MBJ A;  2AS5 F;  3FM3 A;  1IA5 A;  3IRR A;  4MYT A;  2CYY A;  1FYK A;  1SMY F;  4BHC A;  1E2X A;  1FBU A;  2R92 J;  1IXC A;  2OC6 A;  2A6E F;  1KQ8 A;  1IAW A;  2KPM A;  1I50 J;  2TDX A;  2COM A;  1FP1 D;  1W9X A;  3OS0 A;  3CJQ B;  1PUF A;  2JA7 J;  1Q9S A;  2OBS A;  5TY0 A;  2O3F A;  2FBI A;  4XKV A;  4OPS A;  5AIQ A;  4JP0 A;  4XLF A;  2HZD A;  3G6E B;  2DFF A;  2WAQ N;  1OFL A;  5D8K B;  2KP6 A;  2W25 A;  4WXH A;  5DCM A;  4XQF A;  2CFX A;  1QU3 A;  3GVL A;  2E35 A;  4X7D A;  1U3E M;  4RB2 C;  5LD2 C;  3MCA A;  3UW0 A;  4IVN A;  2VBT A;  2WZP P;  3C18 A;  3UKG A;  1VQ9 I;  5D5V B;  3A2K A;  5DNS A;  1ZM4 A;  3CDI A;  1B9N A;  1Y0N A;  5GPC A;  4BDY A;  3VWB A;  2QXZ A;  1LB2 A;  1VQO B;  4C2L A;  1EF4 A;  4G12 A;  3HYI A;  3TQN A;  1A5J A;  1BPL A;  3A3G A;  1VZ0 A;  4C30 A;  1OFM A;  2BY1 A;  1VI0 A;  4GGG A;  3N4M A;  1X2N A;  2XGE A;  2HCJ B;  5IP6 A;  3FBI B;  2MG4 A;  4G6Q A;  3OZW A;  3S17 J;  2FBK A;  1H85 A;  2O8K A;  1EJ9 A;  2XZL A;  1H9T A;  2DJI A;  1MNE A;  3EPZ A;  4QHY A;  1ACI A;  2C4T A;  1EP3 B;  2IPQ X;  2QQB A;  4M72 A;  5F1R A;  3S2W A;  2L3D A;  4KDP A;  2PG4 A;  4HA8 A;  2JWT A;  1CQT A;  1FEX A;  2VZL A;  1DU0 A;  1PDN C;  5GV8 A;  2BGI A;  2GIZ A;  2BX6 A;  3ESW B;  4KN4 X;  1TZL A;  2VKH A;  4R79 A;  4JX6 A;  4KIG A;  2JMW A;  4TSF A;  4XSZ F;  4A93 J;  4XLE A;  2XSD C;  4F92 B;  3ZQF A;  2FOK A;  3D5S C;  1BC7 C;  4X7F A;  4MR0 A;  3ZZU A;  3B02 A;  4U0W A;  2VNJ A;  5M3M J;  1WFX A;  2H8W A;  3G73 A;  3I3L A;  2EB7 A;  5DS0 A;  1H0M A;  1OMI A;  4CZC A;  2WV1 A;  3AVX A;  3OYE A;  4JX5 A;  1IG7 A;  1FTZ A;  4P2N A;  1IF1 A;  4S04 A;  2KHM A;  2PE3 A;  2W84 A;  3HBL A;  2E1C A;  5F08 A;  1T6Z A;  1NHA A;  2JA2 A;  2R93 J;  1Y0R A;  1IN4 A;  3CCS B;  3HOX J;  4J01 A;  2YSR A;  2GJK A;  1QQ1 A;  3ZSC A;  1D8T A;  1M1K D;  3ZPP A;  1BJA A;  3BR3 A;  4IQ4 A;  4QLC U;  1XG2 A;  4ROX A;  1QA1 A;  4YC5 A;  2QEX I;  2XAJ A;  1VBL A;  3H5R A;  2R7Z J;  5J8C A;  3GYH X;  4RM2 A;  1VQN B;  5JMC B;  3DTI A;  1I1S A;  1U5T C;  3KIO A;  3ZMD A;  3TW7 A;  3GZ6 A;  1Z05 A;  1E3H A;  2QN6 A;  3JQQ A;  4M1K A;  1QNT A;  1YI2 I;  4HYE A;  2CU7 A;  1UG0 A;  2KVO A;  4P6V F;  4YCQ A;  2ADU A;  4XRF A;  1STZ A;  4FE4 A;  3KYD B;  2DPU A;  2BHY A;  4CGZ A;  2CQN A;  3QQA A;  2M45 A;  3SEQ A;  1GXQ A;  3TL4 X;  4UZE A;  1SFK A;  3EQN A;  2K4B A;  2YWE A;  2Z1D A;  2K4J A;  2X0L A;  4QUZ A;  1QA2 A;  1T0F A;  3GX4 X;  1YIJ I;  3L2V A;  1KZL A;  1JT0 A;  2EIK H;  1MIJ A;  2G0Y A;  2RC6 A;  2FBH A;  2JPB A;  3BDD A;  1LE8 B;  4JQF A;  4U0Y A;  4C3H J;  2M8E A;  2X4H A;  3V42 A;  1ELO A;  1JE8 A;  3G4S B;  1FMV A;  2L7K A;  2VJ4 A;  1QBJ A;  2H94 A;  2Y9Y A;  3BP8 A;  1UHS A;  2FUG 2;  1MAB A;  3KP2 A;  2JA8 J;  1P6R A;  5KNL A;  4IQJ A;  3W6K B;  1O7L A;  2BXY A;  4IHS A;  1ZYR F;  4LK1 F;  3HSE A;  4BQQ A;  3PSI A;  4W8Q A;  1XGM A;  1MMA A;  5FD5 A;  2P7C B;  2LF7 A;  3U6B A;  2D2W A;  3LA7 A;  5D4R A;  4UB8 C;  1MMG A;  4IRH A;  3WBJ A;  3G6E I;  4BKX A;  1M90 D;  3K4M A;  4AIH A;  3S15 J;  3HRS A;  2RNJ A;  1MSE C;  1EH8 A;  2VBV A;  3LSR A;  3OZU A;  2QKL B;  2HQN A;  3PUB A;  1FT9 A;  1MH3 A;  2R7X A;  3LL7 A;  1PVE A;  5IOY A;  3S1R J;  1D2E A;  2MH2 A;  3A02 A;  4XM3 A;  1NB9 A;  1B23 P;  2X3H A;  4ETS A;  3H0D A;  1N78 A;  3DDY A;  1UMK A;  1E0E A;  3SEJ A;  2DK5 A;  5B3S H;  4URR A;  3WND A;  1HOM A;  2YS9 A;  2V7Q A;  3N97 A;  2JUC A;  2XAF A;  4AM3 A;  5CLS A;  3REO A;  2Y0M A;  3AG3 H;  1RMG A;  5EYR A;  5DM7 F;  2YUS A;  3WHC A;  4UVB A;  2ZTN A;  1HXD A;  1RC9 A;  2AO9 A;  1WZ2 A;  5DSZ A;  2YR2 A;  5HLI A;  2OQR A;  4A0X A;  3CUO A;  1BI2 A;  5IK2 A;  3A4C A;  3IWF A;  4I2O A;  2EPF A;  3WNC A;  4QWQ A;  1BI0 A;  2QA4 B;  1K6O A;  3BH7 B;  1OR7 A;  5FRM A;  1GAQ A;  2CO5 A;  2Y2Z A;  3A1Y A;  5BSY A;  3TDU C;  3WTS C;  3CJN A;  3Q9V A;  1DDN A;  3W2F A;  4PC3 A;  2NZM A;  4IRI A;  2OJE D;  3H09 A;  4AIJ A;  5HXB A;  1QHG A;  1O8E A;  4HNT A;  3FXO A;  1QUE A;  3IRQ A;  4HLY A;  3LSJ A;  2BM1 A;  1BC8 C;  1KMH A;  1BI1 A;  5ILS A;  1OCC H;  4DBR A;  3QPL A;  2DYR H;  2D45 A;  2C77 A;  3RKY A;  2X1E A;  4FK8 A;  3OYK A;  1YQA A;  2XHK A;  3LA3 A;  1BN5 A;  2XAS A;  2O1D A;  1PJ5 A;  1TTT A;  5E1W A;  3TMO A;  4UNO A;  4RAY A;  1SFO J;  1JGG A;  3VMF A;  3PFY A;  1YJ9 B;  3CO7 C;  4HSR A;  3PQJ A;  1N07 A;  4P3I A;  1T38 A;  3SYJ A;  4IX7 A;  4CO8 A;  2LKS A;  3KX2 A;  5M5W J;  2EFP A;  4IPA A;  3OS1 A;  4Z4V A;  2QX3 A;  3DEW A;  4O3M A;  4CCN A;  1N05 A;  1QH0 A;  4OZY A;  3CCR B;  5EDN A;  2EFO A;  4ANJ A;  4M53 A;  1IO2 A;  2CQX A;  4RMN A;  4V2F A;  4ABZ A;  3CCS I;  3VSU A;  4PC6 A;  3RKX A;  3N90 A;  1NHC A;  1K78 A;  2BXZ A;  3K70 C;  1BIB A;  2QMU A;  1VFC A;  2ELK A;  3CF2 A;  1EV7 A;  5H6R A;  1AKH A;  1VQN I;  1ZRD A;  3A01 A;  4XKW A;  4Q7J B;  5LHI A;  2EIJ H;  4M3E A;  1BL0 A;  1IDZ A;  3WY9 A;  3BWG A;  1LLZ A;  1P7I A;  2W1O A;  2KKO A;  3FIS A;  2CK3 A;  2VE9 A;  3I55 B;  3O6B B;  1NJI D;  3PVD A;  2E5Z A;  2KZV A;  2WSS A;  2VFO A;  4XR6 A;  2F4I A;  1U0J A;  1QFJ A;  3M7G A;  1EFR A;  3GW2 A;  4RPD A;  1RIO H;  3ONQ A;  4NNJ A;  5BNG A;  4RAF A;  1DU6 A;  3MN2 A;  2JUG A;  4Y9U A;  1E1R A;  2OTL B;  1XB4 A;  2V9V A;  2B7C A;  2R3S A;  3IH4 A;  4NQW A;  2XGX A;  1IJW C;  1QVG B;  1NK3 P;  1A6Q A;  2MLK A;  2W48 A;  3G4S I;  4LK0 F;  3HDD A;  3P27 A;  4DW6 A;  5JFR A;  3ABU A;  4NBS A;  2IJL A;  2L01 A;  2P6S A;  3F8N A;  1D1A A;  4BEH A;  1W34 A;  2HXI A;  2L54 A;  4OP7 A;  3VMV A;  3LAP A;  4LBZ A;  2ZTG A;  2CRV A;  2OZU A;  1EE6 A;  2VE8 A;  1KYW A;  1YJW I;  2VQL A;  4JRA C;  1EP1 B;  3WNB A;  2LF8 A;  1TW3 A;  2WJY A;  2MW8 A;  3ASO H;  3OL3 A;  2ZJR F;  4M4S A;  4DK0 A;  2XF6 A;  1IXS B;  3OAA A;  2DTR A;  4PJJ A;  4CCL A;  2BW3 B;  3BG3 A;  3SXY A;  4CCM A;  5BPI A;  2HU9 A;  2OCE A;  3KP4 A;  3OYF A;  3HUG A;  4IHT A;  3VYR B;  5KW9 A;  3WU2 C;  5GAH J;  4M3G A;  1IW7 F;  4TMZ A;  4Z03 A;  2EQR A;  4GFB A;  3MZH A;  4NHJ A;  2L02 A;  1TW2 A;  3V4G A;  1R5G A;  1FIP A;  4G7O F;  4OIP F;  5IOZ A;  1U2W A;  2W24 A;  5IYP A;  5FRO A;  3SEZ A;  2HR3 A;  5J6X A;  3U1K A;  5CVV A;  3MMP A;  1OFC X;  4X7C A;  4BL0 B;  3RPU A;  4P5O A;  5F0H A;  1QO0 D;  1BIA A;  2M4K A;  2RVC A;  4RGR A;  4GYG A;  1FOW A;  1XTA A;  4GQN A;  3PFI A;  2B0L A;  4J00 A;  1BN8 A;  4G7Z F;  2EV5 A;  2IGK A;  1X19 A;  4G8X A;  3I64 A;  2Y69 H;  1FRQ A;  1HW1 A;  1GHC A;  2R7Q A;  3KEQ A;  1RET A;  5K5O A;  2BF4 A;  3N05 A;  1WTH D;  2J8K A;  3BR0 A;  3FDY A;  4B3F X;  3HKZ N;  3ONY A;  2E1M B;  2ZZQ A;  1LM1 A;  1OCR H;  2QCO A;  1POG A;  1PUE E;  3K10 A;  1AHD P;  1KTW A;  4WZK A;  3P7N A;  2ZJP F;  4KN7 X;  4KNY A;  1Q81 D;  2E71 A;  4A6E A;  1VJS A;  4LLL A;  3F21 A;  4ZTF A;  2HI3 A;  3AFH A;  4YFK F;  3RZO J;  2GWR A;  3F8C A;  1ZN2 A;  1ULY A;  3ABM H;  4XLN F;  4E7L A;  3BR6 A;  2ZL7 A;  2F3L A;  3GQB A;  1IXR C;  1BR2 A;  2FRH A;  3D0S A;  1G3W A;  1X4P A;  3BC8 A;  5CQE A;  2R5Z A;  5BPD A;  4RCZ A;  1TP4 A;  3NE5 B;  3GFM A;  2WY7 Q;  2JPC A;  4NDL A;  4RAZ A;  4ZV4 A;  5ICE A;  2LG4 A;  5FA6 A;  3CME I;  3JCU C;  2ZJQ F;  1LKX A;  1DP7 P;  1YJ9 I;  3HEF A;  5JLX A;  4BE2 A;  2GPJ A;  2NT6 A;  2UZK A;  1QHH D;  1LDJ A;  3JQP A;  5DS9 A;  4ASN A;  4OOS A;  1P2F A;  2ZXW H;  3E6D A;  2YU9 J;  1JNY A;  3GXO A;  3RCO A;  2ZME C;  1IDJ A;  1RKW A;  3ABT A;  5IY5 H;  4ZCL A;  1OGM X;  1J09 A;  5D6F A;  3CCR I;  2QY1 A;  2FOW A;  3OFN A;  1LEA A;  3G05 A;  1O8F A;  3CC4 B;  3G3Z A;  1D1N A;  1XDU A;  5F4M A;  3W6J B;  1S7E A;  4WCG A;  2IT0 A;  3PQK A;  4QTR A;  1GLN A;  4PFO A;  1FSH A;  1XCB A;  4NBQ A;  1WH7 A;  2CW0 F;  3DBR B;  3IKV A;  1FC3 A;  3WGH A;  4BGD A;  5K7H A;  1ZRF A;  4RCY A;  4UUS B;  3ZN0 A;  4IHX A;  4PJ0 C;  4P55 A;  5M5Y J;  1LEB A;  1RUN A;  3VSL A;  4KIF A;  2RAE A;  5DD4 A;  2LBF B;  2JQ7 A;  2PMZ A;  3I55 I;  1E63 A;  5FNZ A;  5IYD J;  1QA6 A;  5B6I A;  2UXX A;  1KRH A;  3QYF A;  2EK5 A;  2GM4 A;  4P1V A;  1QX4 A;  3OMY A;  5IP9 J;  2CQQ A;  3FPK A;  2XDV A;  2VQC A;  3E5X A;  1IV6 A;  2OBP A;  1IHM A;  1S4M A;  1S8N A;  2Q0O A;  1FRN A;  3P26 A;  3FXJ A;  1RKT A;  3E97 A;  4Y3O A;  2OTL I;  3R6K A;  4C3J J;  1KQS B;  4OJP A;  4P6Y A;  4E7Z A;  3GEZ A;  1VTN C;  4YEL A;  1ZLJ A;  1D8K A;  3ZUG A;  3M07 A;  4LIT A;  3P5J A;  4X0G A;  5J3L A;  4EEF G;  2HTS A;  4MTD A;  3KYL A;  2P6T A;  3Q0V A;  1K73 D;  1V0E A;  4Y4R A;  4GO1 A;  3EUH A;  4BHP A;  4I99 C;  3R60 A;  1XB2 A;  1YS7 A;  1MMN A;  1VLO A;  3GLL A;  4OIO F;  3VST A;  2XTW A;  1WOS A;  3E5Q A;  2BN4 A;  9ANT A;  3VNU A;  1GO2 A;  3M8F A;  4I6Z A;  4U49 A;  4YZX A;  3IHU A;  4A5M A;  1X1B A;  2VN2 A;  2CUZ A;  1L3L A;  2K9Q A;  2OAZ A;  1KTV A;  1YO5 C;  4L0Z B;  1V55 H;  4TKO B;  4M9X A;  3DKX A;  4KMU X;  4A12 A;  4JBA A;  2MC3 A;  3U2R A;  1IB0 A;  2PX9 A;  4IEJ A;  4KIC A;  3VMW A;  1ETY A;  2FNA A;  1Z6R A;  4EGZ A;  1OGJ A;  3OY9 A;  1P4M A;  3ES9 A;  3DTK A;  4HLX A;  4AID A;  3B78 A;  1G4D A;  3K6G A;  4W97 A;  3C7J A;  2LD5 A;  3QU6 A;  2NSP A;  3RQ4 A;  3O8G A;  3NRV A;  3HOS A;  2HVS A;  2P5L C;  3S3M A;  4DYC A;  1D0X A;  2HZT A;  4MLO A;  4LG0 A;  1U9O A;  2MD0 A;  4BHB A;  1BI3 A;  2IGM A;  4DZJ A;  2HWV A;  2GRE A;  4AD9 A;  3QOE A;  3OW2 B;  2DBB A;  1RU4 A;  3LJY A;  4UZU A;  1OFD A;  2O0W A;  2CSO A;  1PJ6 A;  4FXU A;  1J5Y A;  1W4M A;  3SJP A;  4S05 A;  3CCQ B;  4TN1 A;  1QGP A;  1ZM3 A;  1D1B A;  3KZY A;  2DLL A;  2Y75 A;  5B5E C;  3ML6 A;  2VC1 A;  3H9N A;  3CDH A;  2HYG D;  1I3Q J;  1OCZ H;  1E1Q A;  1NTC A;  3W3C A;  2BV3 A;  4RDL A;  3EQL F;  4PUS A;  3ONU A;  3DWL E;  2Z3Y A;  3KFW X;  4HV6 A;  2JJ7 A;  4UV8 A;  3SHF A;  1TSP A;  1JGS A;  1XN7 A;  4CIC A;  1OB0 A;  5EG0 A;  2FML A;  3RSN A;  5HNF A;  3L7W A;  3JQR A;  4BNC A;  1Q7Y D;  2JJ2 A;  2JSP A;  3DV8 A;  3H3Z A;  1FOY A;  2Q6O A;  4TMX A;  3SLD A;  2IAI A;  2V7W A;  3I54 A;  4B8X A;  2DFE A;  3ASN H;  1W7P A;  4PZJ A;  2XC7 A;  2I8D A;  1NG6 A;  2E2H J;  2BM7 A;  1UD6 A;  3LFU A;  1MZB A;  1G3Y A;  2P5K A;  1EWY A;  1IUF A;  4MQV A;  4D7M A;  3CC4 I;  3E1S A;  1WDT A;  1KU3 A;  3QP6 A;  3PEN A;  3QSY A;  2A68 F;  2QSF X;  2OV7 A;  4PK4 A;  2OUM A;  3K69 A;  1T6Y A;  4OPW A;  3OYJ A;  3BQJ A;  1X2M A;  2QVO A;  4P96 A;  3H3U A;  4X07 A;  4H9G A;  3CC7 B;  1Q1V A;  4C0S A;  3GVJ A;  5TIS C;  1UHM A;  1MD0 A;  3W2A A;  4NK8 A;  4KT6 A;  4BXX J;  2R4G A;  1ZH5 A;  1LVK A;  4ZJZ A;  2DA1 A;  2VB6 A;  3NEU A;  4HPQ A;  1T95 A;  4HRI A;  2BYV E;  2M7B A;  1T2K A;  3BCF A;  3SQV A;  4A69 C;  3ISP A;  4A3F J;  1P4X A;  1QRY A;  5DDG A;  5H5J A;  1QVF B;  5KSW B;  4TMT A;  3JSP A;  1Y0U A;  2FU4 A;  2NS8 A;  3M8J A;  2PI0 A;  2W85 A;  3E6M A;  3W2W A;  2CV1 A;  5E17 F;  4A3K J;  3DLA A;  5CVR A;  2V7F A;  3AG1 H;  3GCM A;  2AHO A;  1D0Y A;  3R0J A;  2KL4 A;  1YRN A;  3ZQL A;  4RGS A;  5A2Q Z;  1CNF A;  2VBW A;  2P4W A;  1ZQ3 P;  1NB0 A;  3F9K A;  5F04 A;  1O8I A;  2NTQ A;  5IYW A;  2I5U A;  4D5C A;  2B7E A;  1HC8 A;  2CUF A;  2R5Y A;  5JHF A;  1XSD A;  3SDB A;  1T0F C;  2BVN A;  1WWX A;  4Z4Z A;  3Q5F A;  3GVK A;  1SFU A;  4CCK A;  2OBT A;  2EZI A;  4G6D A;  2BPO A;  3K4K A;  3J80 K;  2NTB A;  4KKT A;  3OR2 C;  4YDT A;  1WGX A;  3RYR A;  5J1Y A;  4Z06 A;  2QZ8 A;  4DJA A;  1DAB A;  1XPX A;  3LSP A;  1H89 C;  1OCT C;  1A31 A;  3BLY A;  1VHE A;  2QEX B;  2HNH A;  2XAH A;  2ZME B;  5EZG A;  5KAI C;  5H2F C;  5FLX K;  4YIR X;  3VYU B;  1T8I A;  1PE9 A;  3L1P A;  2G9W A;  3OOC A;  2V26 A;  5IP7 J;  1OJL A;  2NVY J;  2QE7 A;  1K61 A;  1W5S A;  4OPV A;  2RV8 A;  3K1N A;  1B72 A;  2KQR A;  4I98 B;  2B9S A;  2V31 A;  3W5U A;  3VNV A;  4BAC A;  3HB9 A;  4P9U A;  3A0B C;  2E5N A;  5LRS A;  2O9L A;  2H27 A;  2GQQ A;  3MKL A;  4M74 A;  4AF6 A;  3EYI A;  5HLH A;  2HLD A;  1F36 A;  2XAQ A;  2DA6 A;  3S1N J;  3D5L A;  4LD5 A;  1Y1W J;  5LBQ A;  5K1Y A;  4Y52 J;  3H9Q A;  4AC0 A;  1U2R A;  3JTH A;  3OW7 A;  1KQ5 A;  1MDM A;  4G7X A;  2DET A;  3OYI A;  2INV A;  4XKB A;  4ENJ A;  2HMA A;  4MO7 A;  4KIT B;  3EUA A;  1ZG3 A;  4ZDO A;  1B8I A;  2EJR A;  1Z21 A;  4XSX F;  3HG9 A;  1QJV A;  4Y13 A;  3AVW A;  1X1A A;  3WU0 A;  5HNH A;  3QRF F;  1X1D A;  1W0J A;  1JUM A;  1EFC A;  3CCJ B;  1Z7U A;  2EFQ A;  1BOB A;  2HYJ A;  3U6K A;  4DIQ A;  2QF7 A;  4XBF A;  3R0A A;  4QSH A;  2XRO A;  4J19 A;  3HRM A;  2IP2 A;  3Q6Q A;  3VYS B;  1MND A;  2DN0 A;  3CCQ I;  1JB9 A;  3JRB A;  5LFA A;  2DOG A;  4FN5 A;  2DMT A;  4XOR A;  1FWZ A;  2Z16 A;  4Z1M A;  3CO6 C;  2R7O A;  2PEC A;  4LFU A;  1J7K A;  1DGR M;  1USS A;  1W5T A;  1ZR2 A;  4YZA A;  2QLZ A;  2Y30 A;  2DFI A;  1IRX A;  2K9M A;  2LRD A;  4WF2 A;  1R23 A;  4ZH4 F;  4RS8 A;  4P25 A;  2WB1 N;  3BJA A;  1TT0 A;  1OR7 C;  1XS9 A;  2LYC A;  3CD6 B;  1MBF A;  3KE2 A;  1SKQ A;  5AIP A;  3ZCO A;  4D9J A;  3QU3 A;  3PNY A;  1H8H A;  1ETW A;  1YE9 A;  2CUE A;  3EET A;  3BC9 A;  2MFZ A;  3FKJ A;  1KJZ A;  4N4N B;  2V1U A;  2NVU B;  4EJT A;  1G6N A;  4MYU A;  4KJZ A;  3CUQ B;  3GZ5 A;  1F43 A;  2Q6K A;  5DTD A;  3P9K A;  3BJ6 A;  4WZT A;  2ESH A;  5KHD A;  1D8J A;  1R22 A;  3ZRG A;  5FIU A;  2JDI A;  4HDU A;  2QBY B;  1OGO X;  3WTZ A;  3DPT A;  1R9T J;  3T1B A;  2HDD A;  1TWF J;  4OMZ A;  5EEA A;  2L2O A;  4X8I A;  2LNB A;  4KYW A;  2FSW A;  3V7S A;  3DEE A;  3K9T A;  3IP4 B;  2OTJ B;  4NC7 A;  3CC7 I;  4U7B A;  3F23 A;  1YX3 A;  2VNI A;  4ZCI A;  4M0L A;  1ZEL A;  3DTE A;  2LKX A;  1N75 A;  3DPL C;  3DU6 A;  3DCF A;  1U6G A;  1O88 A;  2HEO A;  1X0C A;  1RQP A;  2HTJ A;  5M3F J;  4ZYA A;  3LQ6 A;  4RJL A;  3AVY A;  4YAW A;  4YFN F;  1LPQ A;  3D26 A;  2J7K A;  2QYU A;  4BE0 A;  2WAQ A;  2VFM A;  3B90 A;  1Z77 A;  2AQF A;  3FPP A;  3F3X A;  1O4X A;  2HDN B;  2RQQ A;  3D1N I;  2NVX J;  3TP0 A;  1Y8R B;  1KCC A;  4PGG A;  4B4C A;  2V9K A;  3FK7 A;  3I0T A;  2VUM J;  5DUK A;  3PUN A;  4UZF A;  3GTL J;  3SDG A;  1E64 A;  1PXZ A;  1VHO A;  3K2Z A;  4F7D A;  4RA2 A;  2X85 A;  2Q6L A;  2NRA C;  4PSW A;  3PJR A;  4BY1 J;  1R1U A;  3V76 A;  3LSH A;  3ROU A;  1F60 A;  3F8B A;  1ZRE A;  2LP0 A;  2ZB9 A;  4RGX A;  3SJZ A;  4PC7 A;  1MBK A;  3QFT A;  4OWR B;  1P7J A;  3E5U A;  3GTK J;  3AKZ A;  3M9A A;  1H8E A;  4RD2 A;  2KZG A;  2LY9 A;  3WWG A;  3ZQI A;  4HF2 A;  3CQZ J;  3WQZ A;  2K3F A;  4UAJ A;  3JRD A;  1U9N A;  3V8K A;  4XL9 A;  1X3W B;  2ICW G;  1NRK A;  2EFN A;  4YFO A;  4PCQ A;  3MZY A;  3DBL B;  3IC7 A;  4B1R A;  4YAU A;  4YG2 F;  4G5G A;  1ZTR A;  4XKC A;  2QQA A;  2CF4 A;  2E1B A;  4C2M J;  3HHG A;  3TOA A;  2EIM H;  2CC2 A;  1N77 A;  1VQM B;  4PJL A;  3N6Z A;  2NT9 A;  3Q3S A;  4Q4Z F;  1FNM A;  2X48 A;  1QUF A;  2A5W A;  3BG7 A;  1S6L A;  1KON A;  2MYS A;  2M4G A;  5FL7 A;  2VBM A;  2ZXJ A;  3L2W A;  3KL9 A;  1KYZ A;  1K9M D;  4NK6 A;  2O7O A;  2K5C A;  5A89 A;  3H9J A;  1JJ2 B;  1SFE A;  3ZOB A;  1WHU A;  4BYY A;  3CCL B;  3FXU A;  1P4A A;  3S14 J;  4CXF A;  3F0C A;  1FBQ A;  2BE5 F;  2DCE A;  3HSF A;  4A3M J;  1UEL B;  3SLN A;  4ZGQ B;  2RRE A;  2J5O A;  2CW7 A;  1LE8 A;  2WV0 A;  3ERE D;  3K4J A;  1KZH A;  3AAF A;  2L7M P;  3LA2 A;  4F55 A;  4A3E J;  2PJP A;  3E1Y E;  2EWE A;  1K4Z A;  2PEX A;  4WWV A;  1V0F A;  3CCJ I;  4R1H A;  2L4A A;  2UV1 A;  4UUT A;  3H9G A;  3HPG A;  5E8I A;  5LMZ A;  1UHW A;  4B43 A;  2FMY A;  2MGQ A;  1K83 J;  3F6O A;  5FKO A;  1GAW A;  3G1L A;  2Q8K A;  4W8R A;  2LY1 A;  1K5C A;  4XRS G;  1YJW B;  3K70 D;  1S7A A;  1IZ1 A;  3CJR B;  4RLF A;  5KVR A;  4NC6 A;  1YS6 A;  1D5V A;  2R7R A;  3S16 J;  2XND A;  1R6R A;  3K4B A;  5EEH A;  4XID A;  2WR8 A;  2ZNZ A;  4AUX A;  1VQ6 B;  2UUZ A;  4OAY A;  3CD6 I;  1WH5 A;  3ZP5 A;  1FX7 A;  1YG2 A;  2A6H F;  5IT9 Z;  2Y0S N;  2QM3 A;  2A05 A;  3E7L A;  3I53 A;  4RPB A;  4Z2Y A;  3H94 A;  3PIP F;  2WA0 A;  3MQ0 A;  3EQO A;  2R9V A;  1WJE A;  2M2E A;  5EGO A;  4PAB A;  4ZDL A;  4HEA 2;  1AOY A;  1TVC A;  1HSJ A;  1I1G A;  2X0K A;  3OL4 A;  1LJ9 A;  2XF5 A;  2W00 A;  5JVT A;  4OMY A;  4YHB A;  1Y39 A;  2DER A;  1I39 A;  2VQH A;  4L9V A;  1V54 H;  1ZM2 A;  1MJA A;  1E62 A;  1FIA A;  2TCT A;  4LBV A;  2KIU A;  2Q1Z B;  4G9Y A;  4L9J A;  3V8J A;  2OTJ I;  2P81 A;  2BOL A;  1O8L A;  1UMQ A;  5BS6 A;  2KT0 A;  2A5Y B;  5DV5 A;  1JHH A;  2R7S A;  1BBY A;  2LR8 A;  2F43 A;  4RAG A;  3WYA A;  4B4D A;  4CCO A;  4IHY A;  3M1C A;  2CV0 A;  1OFE A;  2NNY A;  1RR8 C;  1V3F A;  2CS3 A;  3U1D A;  4WZL A;  2EH3 A;  2ZFU A;  3VDX A;  2GJP A;  4G1B A;  2XT2 A;  1KCD A;  3CP8 A;  1FBS A;  1OLT A;  3K4L A;  3L09 A;  4MEX F;  4BQN A;  2V79 A;  4OAZ A;  3GQ9 A;  2LKP A;  1XC5 A;  4A3G J;  1O8J A;  2Q2E B;  5CQG A;  2CBX A;  2H6B A;  2HYF A;  4UVC A;  4X0C A;  5DYM A;  1JUP A;  2K9N A;  3KCC A;  2I1L A;  1TT5 B;  2W7Z A;  1X1C A;  2MSY A;  3CME B;  2KJC A;  2JSC A;  1DPU A;  2XC1 A;  1ETX A;  5J1R A;  1FMW A;  2DYS H;  3BTJ A;  3S1M J;  2L0K A;  4II3 A;  1L1I A;  4FE7 A;  1OB2 A;  3JX8 A;  1S72 B;  1R71 A;  1VND A;  4HAM A;  1RQR A;  3BG9 A;  3OEH A;  2VOP A;  1XGN A;  2L4M A;  1HCR A;  3KEW A;  3AVV A;  5FGM A;  2JK3 A;  5LGN A;  2V7X A;  1UG2 A;  2PQ8 A;  5BQT A;  1CLW A;  5A88 A;  3KRG A;  5JBQ A;  2O61 A;  4IZZ A;  3DU1 X;  4YEJ A;  1U8R A;  2NNN A;  3EUH C;  4QPQ A;  3MCZ A;  3MD2 A;  1ERD A;  3VOE A;  2X51 A;  4OIR F;  1J75 A;  2ECC A;  1VQM I;  1Z3X A;  2QSH X;  5CKT A;  1YX5 A;  3SZP A;  4MEY F;  3R61 A;  2K3P A;  2ZC2 A;  4UV9 A;  4C3I J;  1JXS A;  1VF7 A;  1GV5 A;  5FLM J;  2FVG A;  2ME0 A;  3QOP A;  1VQ7 B;  5ILV A;  4HG2 A;  1V5F A;  3JRF A;  2WBM A;  3JRA A;  2MC4 A;  3OIP A;  2I10 A;  4P1W A;  4E7I A;  1ZR4 A;  3GTP J;  4PGH A;  4LIU A;  1JTY A;  4Z4S A;  1FYM A;  4OU0 A;  3CCL I;  2PJR B;  3QPS A;  3PA1 A;  1E3P A;  1R36 A;  3FKI J;  4HIZ A;  5E3N A;  3JRG A;  3SZG A;  2IA2 A;  3CW2 A;  4I0B A;  2F2E A;  2CUJ A;  1IRZ A;  4Z4R A;  1K8F A;  1HVX A;  3CP2 A;  2YUH A;  3HIF A;  4FT8 A;  1UD5 A;  4MFD A;  3DF8 A;  1N06 A;  3S93 A;  4D5F A;  3PUM A;  2R7F A;  3GME A;  1GR1 A;  2VLA A;  2K7L A;  4LG3 A;  1B6A A;  1KU7 A;  1K4T A;  4B3G A;  4EAT A;  5CVU A;  2VJ5 A;  3GQA A;  3E6C C;  3OIQ A;  2E7X A;  2VT3 A;  1Z1D A;  2KIQ A;  4IL6 C;  1FZP B;  1W87 A;  5E6T A;  3PSZ A;  4UXN A;  2N8G A;  4FCY A;  1QPI A;  2VBU A;  4XOT A;  4IRG A;  4OIN F;  4EH1 A;  5GP9 A;  2HVR A;  4RDJ A;  4JX4 A;  3SYT A;  1KA8 A;  2BW3 A;  3IL2 A;  3U2Q A;  2XEX A;  2UVF A;  5EJC A;  1VQ6 I;  2WZN A;  4N3N A;  2NYX A;  4OOI A;  4HOB A;  2ODL A;  4Y7N J;  4Z4U A;  4ASU A;  5KAF C;  1VQ4 B;  1BQE A;  3RQI A;  2X1D A;  1K7A A;  5J40 A;  2EFG A;  2OK8 A;  4OJL A;  4PJN A;  4M73 A;  3HGY A;  4MGR A;  1GT0 C;  2GK7 A;  1PLU A;  3NAW A;  2O03 A;  2M1B A;  3OEE A;  2JVH A;  2FNP A;  3ASQ A;  5IT9 K;  2A3S A;  1SD4 A;  1YHQ I;  4RB3 C;  1K79 A;  1U5T B;  1QZZ A;  3BZC A;  1KU2 A;  1R5I D;  1AIP A;  3AL0 C;  4IKF A;  4BAY A;  4BUP A;  1W36 C;  5CVI A;  1R1V A;  3OYH A;  3ELK A;  4F91 B;  3GTG J;  5GTI C;  5JLW A;  6PAX A;  2WTE A;  4FET A;  3HAG A;  2DCU A;  4X1E A;  1UD4 A;  2R7W A;  2DAO A;  4HST A;  4A3B J;  1A6I A;  5L46 A;  2LRE A;  2CV2 A;  3A8K A;  2OPT A;  3ISX A;  2STW A;  1OGI A;  2FJ1 A;  5K5Q A;  3J81 Z;  3T56 B;  2VPL A;  2XAG A;  2F6C A;  2IBD A;  4FX0 A;  1OPC A;  1BHE A;  4YFX F;  3FMQ A;  1XE1 A;  3QP5 A;  2JZY A;  4E7S A;  3RDI A;  4FTH A;  3ZPL A;  4P12 A;  2IEK A;  3DBH B;  1H8A C;  5F64 A;  5L3B A;  4YAL A;  1HKT A;  2L9N A;  4ZYD A;  3J7A O;  1FTT A;  1RI7 A;  1QPM A;  3FHZ A;  3LMW A;  4PFP A;  3J7Y J;  4KUM A;  1Z6T A;  5C4J J;  1FP2 A;  2EWN A;  1IRG A;  5L3C A;  3HJE A;  1MSF C;  1BW5 A;  2F4N A;  4L9N A;  4RD1 A;  2HQA A;  2K02 A;  2B63 J;  1S72 I;  1D3Y A;  2HPM A;  5IYR A;  4XD7 A;  4L8J A;  1EXM A;  1KK2 A;  3QYB A;  2RC4 A;  1ZGJ A;  2DDB A;  4B47 A;  1G8X A;  2R5Z B;  4YII A;  3SUC A;  5TRD A;  3ZGK A;  2LSO A;  1T6S A;  4BQA A;  1RNL A;  1EA3 A;  1H9G A;  1T33 A;  3HKZ A;  5L3D A;  3TGN A;  1EP2 B;  2R6H A;  4IXA A;  4WX9 A;  2VFN A;  1GVJ A;  3OZV A;  3VSV A;  5HS9 A;  5E20 A;  5FO5 A;  3JTG A;  4CHU A;  1QGZ A;  3TO7 A;  3BZK A;  4BBR J;  2R7U A;  4UUS A;  3H36 A;  3K4C A;  4LOC A;  3W2V A;  4OOX A;  2O17 A;  5J35 A;  2VI6 A;  2LDU A;  4BS9 A;  4D1Q A;  4W1U A;  2C5H A;  1IB4 A;  2LBF A;  3T53 B;  4FQG A;  3ECO A;  1VQ7 I;  3I4N J;  4E0F A;  4MTE A;  1B59 A;  3LMM A;  3HTS B;  4UHT A;  4C9Y A;  5F0C A;  2XPW A;  4Z4W A;  2HVQ A;  2XVC A;  3VSK A;  1BX1 A;  2H6C A;  1VQ8 I;  1CF7 B;  3HOW J;  4X06 A;  4B3X A;  1MBH A;  1VLY A;  3LFK A;  5HS7 A;  1BOA A;  1M1E B;  2KRF A;  2VJI A;  2VXD A;  2LVS A;  3CJT B;  4A0Z A;  3Q39 A;  1YIT B;  1O8M A;  2FQ4 A;  5CJ9 A;  2DK8 A;  1J2X A;  2VKV A;  4IHW A;  1HF0 A;  4IHV A;  3ZQ7 A;  5M5X J;  4GRI A;  3COA C;  3GTM J;  5FB2 A;  3O8H A;  1G7T A;  2XKO A;  5HDG A;  3AST A;  4S0H B;  2XNJ A;  5H59 A;  2L9S A;  2O0V A;  2HPI A;  2KIM A;  2CRG A;  3PIO F;  2DA4 A;  4RBO A;  3SZE A;  3GFL A;  4UVA A;  1HKQ A;  1PJ7 A;  2WAD A;  3ZMV A;  3CMM A;  4A3L J;  3NAR A;  2R7D A;  5D5W B;  2YX7 A;  3HM5 A;  1OKR A;  1OQY A;  5L3F A;  3VFZ A;  4JYK A;  1SFX A;  3EDP A;  2QUF A;  1VQ4 I;  3L2Q A;  3RIQ A;  2CFO A;  1AA7 A;  4FHT A;  5IPA A;  4N9H A;  2NS7 A;  3S1Q J;  5E18 F;  1D5Y A;  2DT5 A;  3F72 A;  3E20 A;  2EZH A;  5H20 A;  1R4M B;  1X3U A;  4N3G A;  3ZZT A;  1XD7 A;  2R0Q C;  4BXF A;  2BGJ A;  4Z05 A;  2DMU A;  3K1P A;  4LGW A;  4W8S A;  3MKY B;  1YYV A;  1HDD C;  3LSK A;  3WHB A;  5H6Q A;  2QTZ A;  3CLO A;  4U0V A;  4NCN A;  2XGC A;  1JHF A;  4G94 A;  2O5R A;  3HOV J;  4UB6 C;  5AMV A;  3PA2 A;  2OA4 A;  3MFK A;  2O6G E;  1FY7 A;  2C78 A;  5HVQ C;  4F93 B;  3SZT A;  3WBK A;  4F3Q A;  2DFH A;  2DY1 A;  1ZUN B;  2K40 A;  3E6B A;  1COW A;  4R71 A;  5J8F A;  1AIR A;  2FEZ A;  2BM0 A;  4U87 A;  4AU7 A;  2QGG A;  3QE2 A;  4WZE A;  2DEU A;  2V5I A;  2XOK A;  4EJO A;  2DMN A;  1TWH J;  4ZGN B;  2BBY A;  2F5E A;  4OJ6 A;  3WE3 A;  3TKY A;  3DP7 A;  2C4U A;  3ERM A;  4G6T B;  3I4M J;  3PL8 A;  2GAU A;  3SJM A;  1TWA J;  5EZH A;  5F4O A;  2HGC A;  5FKN A;  3RTR A;  4ESB A;  1ZM9 A;  3TW6 A;  4L5E A;  3OYM A;  1U8B A;  2V1N A;  1S7O A;  1J9Z A;  4BXU A;  5C1E A;  2XT4 A;  1WOP A;  4DZP A;  3WTT C;  5DD8 A;  2HQR A;  2XAU A;  1GVH A;  1RES A;  5CPR B;  4ESJ A;  4GDF A;  3BNW A;  4AF7 A;  1BR1 A;  1Z67 A;  1WSV A;  4KMF A;  2VFP A;  4LMY A;  2O8X A;  1JRG A;  5TJJ A;  3LO8 A;  4IJA A;  2HFH A;  1RUO A;  3BH6 B;  1TQP A;  2F5V A;  2GK6 A;  4ZCM A;  2P8T A;  1LDK B;  3FX3 A;  1QFY A;  5JHU A;  3WGI A;  1DAR A;  1MW7 A;  3B8H A;  3G71 B;  1YW9 A;  2VT2 A;  1R5H A;  4AYB N;  2E2J J;  4C2T A;  3CTA A;  2QTL A;  3OYD A;  3H3V K;  1AU7 A;  5J3O A;  2O04 A;  1QA3 A;  1Z0X A;  3J81 k;  2EZK A;  1EH7 A;  1KK0 A;  2EV0 A;  2BGC A;  3CCU B;  1EKE A;  1X4O A;  2EFW A;  2UVE A;  2XRL A;  4HQM A;  1N08 A;  1F5T A;  1YX2 A;  1ONV A;  1ODD A;  3OYA A;  3BPX A;  3FBN B;  1OYW A;  4RLQ A;  2Y9Z A;  2PMU A;  1A36 A;  2XNC A;  1K8A D;  3CCE I;  3VR6 A;  1YIO A;  1Y6I A;  3BR2 A;  4XOP A;  3E0J B;  2JN9 A;  1K28 D;  1KGS A;  4RGU A;  1U78 A;  2DO7 A;  1GXP A;  1R5N A;  4P22 A;  3VO1 A;  5DCF A;  2L9V A;  1A04 A;  3LSI A;  1R58 A;  4QVJ A;  1RZ4 A;  2M5W A;  2M7A A;  2KDZ A;  2W7N A;  3H1C A;  1X3Z B;  5EMN A;  2B7B A;  1B4A A;  2BSA A;  3C2H A;  2NPF A;  2D3N A;  1N8R D;  5LHG A;  3I58 A;  3C2B A;  1HW2 A;  3WTY C;  3HGG A;  3B4N A;  4QFM A;  3GQ8 A;  1V4R A;  1QZE A;  3F8F A;  2DQL A;  2QWW A;  2WAE A;  1W0K A;  1YIT I;  3KP5 A;  2LC2 A;  2VXZ A;  2QSG X;  1FOK A;  3Q38 A;  4EVI A;  3IUO A;  1Q1H A;  3MWM A;  3V7C A;  5GTH C;  1IN7 A;  4PMH A;  1NG7 A;  4F52 A;  3U21 A;  1JKQ C;  2EBI A;  2D9R A;  2ZO4 A;  2VBS A;  3ZBU A;  1A8P A;  4NC8 A;  4CYC B;  3CCM B;  1IN8 A;  2L7Z A;  2XUB A;  2VOO A;  2X6X A;  2GJR A;  2HXO A;  5ICG A;  2ZL6 A;  1K4S A;  1GV2 A;  5E1Z B;  4EW9 A;  4Y17 A;  5FO0 A;  2BEO A;  1JKO C;  3MMY B;  1WU8 A;  2Z8G A;  1VF9 A;  1YW7 A;  2A61 A;  3L2U A;  4I0A A;  3T5X A;  4DNC A;  2Z33 A;  4LB5 A;  4DNR B;  3L2R A;  3F6V A;  4GCV A;  1XG1 A;  4M6X A;  1ON1 A;  5LHH A;  2GBY A;  4M71 A;  3RPQ A;  4OPO A;  3I59 B;  5D6E A;  3NWS A;  2PBI A;  4LJZ F;  1VQK I;  4UUV A;  2ECB A;  2OYN A;  4FWT A;  3VYT B;  2ID3 A;  5AN9 A;  1N25 A;  3S2D J;  3JU4 A;  2V6C A;  5THX A;  5D5X B;  2OF7 A;  5LGU A;  2CQ7 A;  4CCJ A;  2BV6 A;  3HHH A;  3WG9 A;  3KZI C;  4ITV A;  2DYI A;  1YLF A;  2V7V A;  2Y31 A;  3EUK L;  1IUY A;  3OYC A;  3GTQ J;  4LBW A;  4O6J A;  2V4D A;  3A03 A;  4ENN A;  2VBE A;  2LH9 A;  3B73 A;  3O3K A;  4DQ2 A;  4ZYE A;  2AXL A;  2COB A;  2RNG A;  2ID6 A;  3IAS 2;  2DMP A;  4TMW A;  2LOO A;  4CH7 A;  4M9S A;  4XN0 A;  3CLQ A;  4D7N A;  4K1X A;  1WMR A;  3ASS A;  4DBQ A;  3GZN B;  2W4S A;  5J4Y A;  2M5S A;  3WTW C;  1EZG A;  1S0U A;  2D1V A;  3BPV A;  1Z3Y A;  4O5V A;  5DM6 F;  3C1D A;  3ZMU A;  3S2H J;  1ITY A;  2F1L A;  2DI3 A;  3OPO A;  1S29 A;  3SQN A;  3OV8 A;  5FLV A;  2BM5 A;  2JIZ A;  4E7H A;  4Q47 A;  4OJO A;  5F0F A;  2R7T A;  5J47 A;  4M2L A;  4ZZL A;  1MNM C;  2OD5 A;  2KJB A;  3NWT A;  3DQV C;  1BMF A;  2B0R A;  2OBR A;  3K1M A;  3V7R A;  4CSW A;  2Q6I A;  4YAF A;  2P5V A;  2VC0 A;  4DOZ A;  1SM4 A;  3QFR A;  2ZKZ A;  4IW3 B;  4YZ0 A;  2HOT A;  1I7P A;  1MJ9 A;  2DOE A;  3ECH A;  1SD7 A;  1LFB A;  5ICF A;  2BSP A;  1B2R A;  1Z7L A;  3HL2 A;  3CUQ A;  3TBI A;  3W5V A;  1E43 A;  3TOB A;  2AHQ A;  1WXR A;  1TWG J;  4QVA A;  3WOD F;  2E34 A;  2QQ8 A;  1DGW Y;  2GOM A;  3ABK H;  1SVL A;  3GVA A;  3I1F A;  4MQ9 F;  4G1V A;  4C43 A;  2QBY A;  3G71 I;  1H42 A;  2PN6 A;  3I5U A;  1FSE A;  1PUF B;  2H1L A;  2IQ7 A;  4PC1 A;  4Q5S F;  1HZE A;  5FKM A;  1YW8 A;  1SD5 A;  3KLO A;  1ZK8 A;  3RPU D;  4Y7C A;  3V7A A;  2XF7 A;  3ZPN A;  3IV5 A;  3PSS A;  4KA4 A;  1UD2 A;  5DCM B;  3BTC A;  1D0Z A;  3CCU I;  1QCX A;  1TLH B;  1OCP A;  2RDP A;  2CWE A;  4RM0 A;  2HQ5 A;  3D5R C;  4XK4 A;  1YLO A;  2BY0 A;  2ZBU A;  4PDK A;  4N4O B;  1RR7 A;  2LY2 A;  2M87 A;  1DDI A;  5TV2 A;  1J9I A;  2WYR A;  2CH0 A;  1A35 A;  4TMV A;  4IOA F;  2DT6 A;  3FKS A;  5CVJ A;  3X2Q H;  4KIB A;  4DYQ A;  4XN3 A;  4EQQ A;  2MA3 A;  2EIL H;  1PKV A;  2XKP A;  1IN5 A;  1EH6 A;  2L9R A;  2WB1 A;  1KQ9 A;  2ELJ A;  1V5E A;  1ENH A;  2IVM A;  5ICC A;  2ZZG A;  1ZAR A;  5F4J A;  3PUF A;  3A3B A;  2ISY A;  3CC2 B;  1WJD A;  2ELH A;  5HLG A;  5D8L B;  3DKW A;  3M1E A;  3AGP A;  2A69 F;  5DUI A;  3PO3 J;  4A3C J;  4L5I A;  3ASP A;  2KFD A;  1YOV B;  2MLG A;  4P3Y A;  1HKS A;  1UCR A;  3ZC3 A;  4A3D J;  2F48 A;  1FDR A;  2W6J A;  5GV7 A;  4NUB A;  3WE2 A;  3BZ6 A;  5A2Q K;  4G7W A;  5C1C A;  3CCM I;  2P7V B;  4E70 A;  3LSM A;  3KPH A;  3K4N A;  1W35 A;  1TNT A;  4BU2 A;  4GXO A;  3OSG A;  3CXC B;  5HKK A;  1QVT A;  1KK3 A;  4HZF A;  3BRO A;  2UWM A;  3W2G A;  4DK1 A;  2IXS A;  4XLH A;  1QRC A;  4YZQ A;  2GXG A;  3QWL A;  1ETV A;  2QEN A;  3BR1 A;  1Q82 D;  2M0M A;  5AON A;  2HOS A;  2CW8 A;  2OZ6 A;  3KYC B;  4P26 A;  3JRC A;  2DA2 A;  3JW4 A;  3B6C A;  2K9L A;  3LST A;  2CGP A;  2ETH A;  1QGY A;  2H09 A;  3CDL A;  1HLV A;  3V8L A;  2XSJ C;  3FK6 A;  2P0W A;  4BY7 J;  1TWC J;  1TTY A;  2OU2 A;  3GBG A;  1R7J A;  4ON0 A;  3U9G A;  2M0C A;  2IRF G;  2GOX B;  1E79 A;  1RWR A;  3CMY A;  3CMA B;  1E3X A;  2G0E A;  1JJ8 C;  4BBS J;  1KU9 A;  5JVG F;  1F9N A;  4ZDP A;  1QFZ A;  2VNH A;  5BOX A;  2LFB A;  2OK7 A;  2VYQ A;  3RZD J;  4AVZ A;  2TRT A;  3VB2 A;  4G7H F;  4F7Z A;  2KIF A;  2ISZ A;  5E8G A;  3F8M A;  4A3J J;  4YRV A;  2V7U A;  4RD6 A;  1IDY A;  1F4K A;  1T5E A;  2H8R A;  2O6W A;  1DPR A;  2WC2 A;  2XIG A;  4U9U A;  4B09 A;  2BHZ A;  4A0Y A;  5IYN A;  2XTX A;  2FX0 A;  4N9I A;  3OYN A;  1OYI A;  2M3A A;  1WJB A;  2V7T A;  5LGT A;  2RN7 A;  1GQ8 A;  2YX4 A;  4YAO A;  4MXN A;  4BJ5 C;  2DT7 B;  4EJV A;  1UAA A;  1WSR A;  4ZYH A;  1XSV A;  4YEI A;  5D4S A;  3CPX A;  4RD4 A;  2PYG A;  1HDP A;  2M9H A;  5K7F A;  2DXI A;  1BW6 A;  2E1M C;  1GDT A;  4ZZD A;  2X9D A;  2G7H A;  4A5N A;  4HNV A;  2HDW A;  1XCV A;  1SEU A;  2JJ1 A;  3GUD A;  3WXM A;  4I84 A;  1FNB A;  1DBO A;  2VNK A;  5HDN A;  3FXK A;  1YTY A;  5HZB A;  3J7Z I;  2JRM A;  3ZZ0 A;  5LEK A;  3MKW B;  3PET A;  3E3V A;  4HBL A;  2NST A;  1OB5 A;  3VOD A;  2F4O B;  3ML3 A;  2ZSH B;  3KEO A;  3QFC A;  4LC0 A;  2DA5 A;  3HTU A;  4RM3 A;  4TV7 A;  4BPR A;  2DMQ A;  1P4W A;  3LAJ A;  4Z4T A;  2DOF A;  4EV0 A;  4EGY A;  4TT3 A;  2BMW A;  2ZNY A;  5HS8 A;  2KLO A;  1JKR C;  1I6H J;  3BJO A;  2CQK A;  4X7E A;  1YHQ B;  3DFG A;  3RI4 A;  1QRB A;  1O8D A;  3HOU J;  1TBX A;  3ABL H;  2FE3 A;  3QOD A;  3BR5 A;  1WVR A;  2ZXH A;  2J8I A;  1WPC A;  1R4N B;  2KDO A;  4BE1 A;  1SAN A;  2E2I J;  2PMD A;  2F4M B;  1WRJ A;  1G3S A;  2LTP A;  2EA4 A;  3KEY A;  3I4P A;  3H5N A;  3WG7 H;  3ZQQ A;  1JA0 A;  1VQP B;  4KFC A;  1G3T A;  2JRT A;  1HF2 A;  3DKY A;  1VQO I;  3OYB A;  2IS4 A;  3CCY A;  4P9S A;  3Q0W A;  4D0P A;  4FIS A;  3CES A;  2VKE A;  4Y33 A;  5EGO B;  1F20 A;  3C2G A;  1N0V C;  2F1M A;  2E1O A;  5E3M A;  4ACA A;  1WCM J;  1W2B B;  2VOD A;  4M3F A;  2V4J C;  3ZMT A;  4CZZ A;  1E3O C;  3FMR A;  5DEQ A;  3NB2 A;  2Q2E A;  3FF5 A;  3HXL A;  2BZT A;  5F27 A;  3CC2 I;  4X6A J;  4JK1 X;  4HE6 A;  3MVP A;  2Y0S A;  4XLP F;  1UB9 A;  2FF4 A;  1K6Y A;  2QYO A;  1O3S A;  1O8K A;  2R7V A;  3ZQG A;  2RC5 A;  3SKB A;  5FKL A;  2GQF A;  3PNV A;  4XON A;  3A8J A;  3Q3A A;  4MIM A;  5D5U B;  3PSF A;  4L5J A;  2CMP A;  3HPH A;  4OOV A;  1HW5 A;  3M8E A;  1I8D A;  1AMO A;  2C6Y A;  3K2A A;  2D74 A;  5FKK A;  3PNT A;  1W0U A;  3Q6R A;  3BY2 A;  2HKX A;  5F1J A;  1T98 A;  1W36 D;  2V1X A;  2UXN A;  2Z99 A;  4XLA A;  1L0O C;  3WTU C;  3DEU A;  3KP6 A;  3OYG A;  2WPD A;  2GLO A;  3IH3 A;  5IYB J;  4Z4Y A;  3C3W A;  3WU1 B;  2GA1 A;  2RGV A;  4XMY A;  3HOY J;  1VQ9 B;  1TYX A;  3S32 A;  1G2H A;  1PJR A;  1HST A;  2BVM A;  1W7P D;  3R6S A;  3S8P A;  3JSO A;  2VON A;  2XZO A;  4HNU A;  3OE7 A;  1TC3 C;  3BH4 A;  2KRH A;  3F22 A;  4DGW B;  5B1B H;  5HLT A;  1P92 A;  4E7J A;  1P9Q C;  2J5P A;  3HRT A;  4HWV A; 
#chains in the Genus database with same CATH homology
 3HOT A;  3DLA A;  1LFP A;  3I3L A;  4C9Y A;  2V7F A;  3OOU A;  2HVQ A;  1D0Y A;  3MKZ A;  2KL4 A;  3H35 A;  3VSK A;  4B44 A;  4CZC A;  1SAU A;  2PJR A;  3OYE A;  1DQU A;  3H5A A;  4B3X A;  3F9K A;  1VLY A;  1O8I A;  2NTQ A;  2KHM A;  2VJI A;  2VXD A;  2W82 A;  1O8M A;  4BDZ A;  2JA2 A;  1JTA A;  5JHF A;  3SDB A;  1T0F C;  1DBG A;  4J01 A;  2GJK A;  4XNF A;  3ZSC A;  4GRI A;  3GVK A;  3ZPP A;  1XG2 A;  4IQ4 A;  4CCK A;  2NTB A;  3K4K A;  4KKT A;  3OR2 C;  3I9V 2;  1VBL A;  3H5R A;  4Z06 A;  4DJA A;  2L9S A;  4RM2 A;  2O0V A;  4OZZ A;  2HPI A;  3BLY A;  3DTI A;  2HNH A;  1PE9 A;  3VYU B;  2KVO A;  1UG0 A;  3OOC A;  2V26 A;  2WAD A;  3CMM A;  2QE7 A;  5KCM A;  2KQR A;  2WY8 Q;  2V31 A;  4BAC A;  3SEQ A;  2VKD A;  3TL4 X;  3EQN A;  3GQ7 A;  1SFK A;  2E5N A;  3L2Q A;  2CFO A;  2Z1D A;  1AA7 A;  3BCD A;  3G2B A;  2HLD A;  4NQW B;  1BLI A;  4DNT B;  1KZL A;  3L2V A;  3D5L A;  4KKS A;  5FRN A;  3OW7 A;  3H9Q A;  4FAS D;  4ZC3 A;  4G7X A;  4BXF A;  2INV A;  3OYI A;  4XKB A;  4JQF A;  4Z05 A;  4BEH B;  4W8S A;  3V42 A;  4KIT B;  3EUA A;  3MKY B;  1FMV A;  2VIX A;  4ZDO A;  2L7K A;  3LSK A;  2LZJ A;  2VJ4 A;  1Z21 A;  1QJV A;  3HG9 A;  1X1A A;  2FUG 2;  1MAB A;  5HNH A;  5KNL A;  1X1D A;  2O5R A;  4IQJ A;  1W0J A;  5AMV A;  2X6W A;  2IS6 A;  1BOB A;  4BQQ A;  3PSI A;  4W8Q A;  4E6K G;  5HVQ C;  2VQG A;  1MMA A;  4DIQ A;  4F93 B;  4F3Q A;  4H4K C;  2KRC A;  3VYS B;  1MND A;  1MMG A;  3ZXS A;  1COW A;  5LFA A;  1AIR A;  4XOR A;  1WJ5 A;  3HUG B;  2Z16 A;  3BCB A;  1BR4 A;  3K4M A;  4U87 A;  4AU7 A;  2VL8 A;  2XOK A;  1WJA A;  4G6I A;  4Z1M A;  2R7O A;  2PEC A;  4YZA A;  1DGR M;  4OJ6 A;  1Y56 A;  2QKL B;  2LRD A;  1IRX A;  2K9M A;  3PUB A;  4G6T B;  1TT0 A;  1OR7 C;  3PL8 A;  2LYC A;  3LL7 A;  2R7X A;  1OHH A;  3ZCO A;  4D9J A;  1H8H A;  1KMH A;  3PNY A;  4XM3 A;  3BC9 A;  1YE9 A;  3RTR A;  2X3H A;  2MFZ A;  3FKJ A;  3H0D A;  4N4N B;  1N78 A;  3DDY A;  3OYM A;  1E0E A;  2V1N A;  4KJZ A;  4URR A;  5C1E A;  4LIV A;  2V7Q A;  2WJV A;  2XAU A;  5CPR B;  2PYH A;  1CZF A;  1BR1 A;  1RMG A;  5KHD A;  3OYL A;  2XGJ A;  3DU5 A;  3ZRG A;  1DP3 A;  4E7K A;  2W6I A;  2JDI A;  1JRG A;  2ZTN A;  1OGO X;  3DPT A;  5HOO A;  2F5V A;  2GK6 A;  1LDK B;  1MW7 A;  2L2O A;  2BVL A;  2X53 S;  5IK2 A;  3A4C A;  2VBK A;  3DEE A;  4C2T A;  3S3O A;  3IP4 B;  3OYD A;  4NC7 A;  5FRM A;  4U7B A;  2O04 A;  1YX3 A;  3A1Y A;  2QKM B;  1ZEL A;  2NOJ B;  2IGO A;  3DTE A;  1X4O A;  2UVE A;  2NZM A;  1N75 A;  3DPL C;  3DU6 A;  2XZP A;  1O88 A;  3DPU A;  1X0C A;  1QHG A;  1O8E A;  4HNT A;  4ZYA A;  3OYA A;  3FBN B;  4RLQ A;  3VR6 A;  1Y6I A;  4BE0 A;  2WAQ A;  3B90 A;  4XOP A;  4E4H A;  2AQF A;  3E0J B;  3IAM 2;  2L5Q A;  4DBR A;  1K28 D;  3FPP A;  4P22 A;  3FY3 A;  1WP6 A;  2RQQ A;  2X1E A;  3OYK A;  3LSI A;  2O1D A;  1KCC A;  2V9K A;  2M7A A;  2W7N A;  3TMO A;  4JMQ A;  1PXZ A;  3C2H A;  3PFY A;  2D3N A;  4HSR A;  4YXW A;  3B4N A;  2X85 A;  1UD8 A;  4PSW A;  3PJR A;  4IX7 A;  3GQ8 A;  3LSH A;  3KX2 A;  3OS1 A;  2QX3 A;  2WAE A;  1W0K A;  4OZY A;  3UR3 C;  4CCN A;  4OWR B;  2LC2 A;  2VXZ A;  4ANJ A;  3AKZ A;  3IUO A;  1H8E A;  1HG8 A;  4RMN A;  3VSU A;  4PMH A;  1NG7 A;  3ZR8 X;  3U21 A;  4F52 A;  3WWG A;  1NHC A;  2R7U A;  3K70 C;  4NC8 A;  1G59 A;  3WQZ A;  4B48 A;  3HC7 A;  2X6X A;  2GJR A;  3CF2 A;  4XL9 A;  4EW9 A;  1NRK A;  2A6T A;  4XKW A;  3A35 A;  3MMY B;  2Z8G A;  4XKC A;  2E1B A;  2X6Y A;  2W1O A;  2ZXI A;  3L2U A;  2INU A;  1N77 A;  4DNR B;  3BG6 A;  2CK3 A;  3L2R A;  4PJL A;  2NT9 A;  2E5Z A;  3J7A Y;  2KZV A;  2WSS A;  4XR6 A;  2A5W A;  2F4I A;  3BG7 A;  1U0J A;  1KON A;  2MYS A;  2M4G A;  3NWS A;  3OR1 C;  1EFR A;  5FL7 A;  2VBM A;  3JUR A;  3L2W A;  4NK6 A;  3T51 B;  2K5C A;  3VYT B;  3H9J A;  3ONQ A;  4NNJ A;  4XLC A;  3JU4 A;  1I18 A;  2JUG A;  1E1R A;  4CCJ A;  2DCE A;  4ITV A;  4PSX A;  2IS2 A;  1UEL B;  3EUK L;  2RRE A;  3OYC A;  2CW7 A;  2V4D A;  3K4J A;  2VBE A;  2LH9 A;  4BEH A;  4F55 A;  1D1A A;  2EWE A;  1WJC A;  3CZ6 A;  2RNG A;  3VMV A;  2ZTG A;  1V0F A;  3IAS 2;  4KIS A;  1EE6 A;  2LOO A;  2UV1 A;  4CH7 A;  4XN0 A;  3H9G A;  3BCA A;  3HPG A;  2D3L A;  1WMR A;  4B43 A;  2VQL A;  4DBQ A;  2W4S A;  2M5S A;  2WJY A;  1Z3Y A;  4W8R A;  2LY1 A;  3OPO A;  1K5C A;  3OL3 A;  4DK0 A;  3K70 D;  2XF6 A;  3CJR B;  4RLF A;  3OAA A;  4PJJ A;  4CCL A;  2BW3 B;  2VJJ A;  4CCM A;  3B8Y A;  2R7R A;  4E7H A;  2JIZ A;  2HU9 A;  2XND A;  4OJO A;  3OYF A;  3VYR B;  1R6R A;  3K4B A;  2R7T A;  4Z03 A;  2IGN A;  2UUZ A;  3NWT A;  3DQV C;  4OAY A;  1BMF A;  4CSW A;  5FRO A;  3SEZ A;  4BL0 B;  4DOZ A;  4P5O A;  4YZ0 A;  3OWT A;  2M4K A;  4PJM A;  1O8H A;  2JVG A;  3H94 A;  2E60 A;  2WA0 A;  2ZZF A;  1Z7L A;  3HL2 A;  2BSP A;  3EQO A;  2R9V A;  1WJE A;  4GQN A;  3TBI A;  1E43 A;  4J00 A;  4II2 A;  4ZDL A;  2IGK A;  1BN8 A;  1X19 A;  4HEA 2;  1SKY B;  4W8T A;  4KKU A;  2R7Q A;  2VAS A;  3OL4 A;  2XF5 A;  2W00 A;  1DGW Y;  2GOM A;  3N05 A;  3T9G A;  2VQH A;  3QYE A;  1WTH D;  3FDY A;  1NBM A;  4B3F X;  2X1C A;  2E1M B;  2ZZQ A;  2IQ7 A;  3K10 A;  1KTW A;  1HZE A;  2Q1Z B;  3RPU D;  2BOL A;  3LSG A;  2XF7 A;  1O8L A;  3ZPN A;  1VJS A;  4ZTF A;  1UD2 A;  3AFH A;  2R7S A;  1D0Z A;  1QCX A;  2KMU A;  4CA0 A;  2F43 A;  1MMD A;  1IDK A;  4CCO A;  3D5R C;  4E7L A;  2NTP A;  3M1C A;  1WJF A;  3GQB A;  1BR2 A;  2CV0 A;  3LNN A;  5CQE A;  1X4P A;  3BC8 A;  3FHN A;  4N4O B;  2LY2 A;  4U4B A;  1FX0 A;  3NE5 B;  2CS3 A;  2CH0 A;  2ZFU A;  3VDX A;  2GJP A;  1KCD A;  3AL0 B;  2WY7 Q;  2DT6 A;  1OLT A;  3CP8 A;  2Z2S B;  1V5G A;  3K4L A;  4BQN A;  4BQO A;  3S3N A;  2LG4 A;  4OAZ A;  3FKS A;  3GQ9 A;  4OJ5 A;  4XN3 A;  1O8J A;  2Q2E B;  5CQG A;  2ELJ A;  1PKV A;  2WB1 A;  1LKX A;  1V5E A;  2DOA A;  2ZZG A;  4BE2 A;  2NT6 A;  3A3B A;  1X1C A;  1QHH D;  1WJD A;  4C2U A;  1HA8 A;  3RCO A;  1FMW A;  1IDJ A;  1OGM X;  1J09 A;  4II3 A;  2QY1 A;  3OFN A;  3G05 A;  1O8F A;  2W6J A;  4NUB A;  3OEH A;  4G7W A;  3KEW A;  5C1C A;  3LSM A;  1GLN A;  4PFO A;  3K4N A;  4BJ6 C;  4BU2 A;  5HKK A;  1H80 A;  1D1C A;  4BGD A;  3KRG A;  5DN6 A;  2V6E A;  3UNG C;  4IZZ A;  2UWM A;  4DK1 A;  4YEJ A;  2IXS A;  4XLH A;  4AYB A;  4YZQ A;  4QPQ A;  3EUH C;  3MD2 A;  1ERD A;  2X51 A;  3VSL A;  2M0M A;  2CW8 A;  2WAF A;  2LBF B;  1Z3X A;  2PMZ A;  5CKT A;  1YX5 A;  2K9L A;  2K3P A;  1VF7 A;  5TGT A;  2XSJ C;  3QYF A;  4HG2 A;  1V5F A;  2P0W A;  2WBM A;  3OMY A;  2X8K A;  2MC4 A;  3OIP A;  2XDV A;  4P1W A;  2VQC A;  2MAB A;  4E7I A;  3GBG A;  4LIU A;  2Z6B D;  5CDF A;  2GOX B;  2PJR B;  1E79 A;  1RWR A;  4Y3O A;  4OJP A;  1E3X A;  2ZZE A;  4HIZ A;  4E7Z A;  4ZTJ A;  4YEL A;  1E3Z A;  3SZG A;  4ZDP A;  4JOM A;  4LIT A;  1UD3 A;  4X0G A;  2CUJ A;  2O17 A;  3KYL A;  1HVX A;  3CP2 A;  1UD5 A;  4AVZ A;  1V0E A;  1O8G A;  1OOC A;  4Y4R A;  2IS1 A;  3S93 A;  1S9H A;  1MMN A;  2AQE A;  4YRV A;  4BJT A;  2VLA A;  1T5E A;  3VST A;  1PYV A;  4LG3 A;  2ZSI B;  4U49 A;  4B3G A;  4YZX A;  4EAT A;  2VJ5 A;  3GQA A;  1X1B A;  3OYN A;  2CUZ A;  2M3A A;  1WJB A;  4QPO A;  3OIQ A;  4TKO B;  1GQ8 A;  4MXN A;  4BJ5 C;  3DKX A;  2DT7 B;  1UAA A;  4XOT A;  2HVR A;  3SYT A;  2BW3 A;  2PYG A;  3GRH A;  2UVF A;  2DXI A;  2ODL A;  2E1M C;  2JJ1 A;  4ASU A;  2HDW A;  4I84 A;  3OS2 A;  3VMW A;  1DBO A;  2X1D A;  3ZIA A;  4OJL A;  4PJN A;  4CUG A;  3OY9 A;  3DTK A;  2GK7 A;  3MKW B;  1JI8 A;  1PLU A;  3OEE A;  2NST A;  2JVH A;  3K6G A;  2NSP A;  2ZSH B;  3RQ4 A;  4RM3 A;  3HOS A;  2HVS A;  2DIE A;  4TT3 A;  3S3M A;  2KLO A;  3AL0 C;  4IKF A;  1IA5 A;  1D0X A;  4MLO A;  2MD0 A;  4BUP A;  1W36 C;  2IGM A;  2OC6 A;  3OYH A;  4F91 B;  2KPM A;  1O8D A;  3QOE A;  1RU4 A;  4FET A;  3QOD A;  4UZU A;  2O0W A;  3HAG A;  1UD4 A;  3OS0 A;  3CJQ B;  4HST A;  2R7W A;  2ZXH A;  1W9X A;  4FXU A;  2LRE A;  2CV2 A;  1WPC A;  4XKV A;  2KDO A;  4BE1 A;  4XLF A;  2HZD A;  1D1B A;  3T56 B;  1OFL A;  2VPL A;  2KP6 A;  3KEY A;  4XQF A;  2F6C A;  3H5N A;  3ZQQ A;  1QU3 A;  1E1Q A;  1BHE A;  3GVL A;  3W3C A;  5LD2 C;  3DKY A;  4PUS A;  3UW0 A;  3OYB A;  2IS4 A;  3DWL E;  2WZP P;  4E7S A;  3A2K A;  3CES A;  4Y33 A;  3VWB A;  1OB0 A;  4BDY A;  3C2G A;  2F1M A;  2QXZ A;  4C2L A;  3RSN A;  5HNF A;  2L9N A;  2V4J C;  3LMW A;  2JJ2 A;  3HXL A;  4PFP A;  2JSP A;  1BPL A;  3A3G A;  1VZ0 A;  4C30 A;  2Y0S A;  1OFM A;  1O8K A;  1K6Y A;  2R7V A;  3FBI B;  2HQA A;  3PNV A;  4XON A;  2XC7 A;  2I8D A;  1NG6 A;  2HPM A;  2XZL A;  1UD6 A;  3PSF A;  4XD7 A;  3LFU A;  2CMP A;  3HPH A;  4L8J A;  2DJI A;  3E1S A;  1MNE A;  3QYB A;  3EPZ A;  1I8D A;  4B47 A;  2OV7 A;  4PK4 A;  2OUM A;  1G8X A;  3PNT A;  3OYJ A;  3SUC A;  3ZGK A;  1W36 D;  1EA3 A;  3HKZ A;  3GVJ A;  4XLA A;  3W2A A;  4NK8 A;  3VSV A;  3OYG A;  2WPD A;  4KT6 A;  2R4G A;  1LVK A;  4ZJZ A;  1TZL A;  2VB6 A;  2VKH A;  4HPQ A;  4XMY A;  3S32 A;  1T95 A;  3K4C A;  1PJR A;  2BVM A;  2M7B A;  3S8P A;  3W2V A;  4R79 A;  4HRI A;  3BCF A;  4TSF A;  4HNU A;  2XZO A;  4XLE A;  4BS9 A;  4D1Q A;  4F92 B;  3OE7 A;  1IB4 A;  3BH4 A;  2KRH A;  2LBF A;  3D5S C;  3T53 B;  4DGW B;  5HLT A;  4MR0 A;  4E7J A;  3M8J A;  4E0F A;  1P9Q C;  3W2W A;  2CV1 A;  3LMM A;  1WFX A;  4HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...