4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
3B90A 1BHEA 4XLFA 2QY1A 2O0VA 2ODLA 3ZPPA 4XMYA 4Z05A 3B4NA 2NSTA 2O1DA 4YZAA 4NK6A 4OZYA 1RWRA 4YELA 2X85A 1KCCA 1O8EA 4OJPA 1O8MA 1DBOA 1IDJA 1XG2A 2NZMA 4PMHA 1IDKA 1OGOX 3GQ8A 2X3HA 4XOPA 2O04A 4OJ5A 4XKWA 2EWEA 3GQ7A 4W8RA 4OJLA 1QCXA 2X6YA 1OFLA 3VSUA 1IA5A 3EQNA 4YZQA 2QX3A 1KTWA 3SUCA 1JTAA 1O8GA 2VBMA 2NTBA 1O8HA 1O8KA 1EE6A 4MR0A 2NT9A 1RMGA 1O8LA 5AMVA 4XNFA 4XN0A 4U49A 4W8SA 2UVEA 3GQAA 1O8IA 4XR6A 4YEJA 2X6XA 4XLCA 2NTQA 1K5CA 3ZSCA 4Z06A 3GQ9A 1IB4A 4YZ0A 4OJOA 3EQOA 3VMVA 1VBLA 4HWVA 3T9GA 4U4BA 1CZFA 2NT6A 2VJIA 1BN8A 2O17A 4XKVA 4XLHA 4XN3A 1O88A 1JRGA 4OZZA 1DBGA 3VMWA 4W8TA 1OGMX 4W8QA 3FY3A 2PYHA 3KRGA 2INVA 2UVFA 4C2LA 3B8YA 4XLEA 2O0WA 1PLUA 1OFMA 3LMWA 2QXZA 3JURA 2NSPA 3GRHA 3VSTA 3UW0A 1O8DA 4XQFA 2NTPA 3VSVA 2INUA 5C1CA 2X6WA 1QJVA 4XONA 3WWGA 4YZXA 4XORA 2IQ7A 4XM3A 1AIRA 1GQ8A 2PYGA 1HG8A 2BSPA 2VBEA 2VJJA 4AVZA 1O8FA 4I84A 1OOCA 1O8JA 1PE9A 1KCDA 4XLAA 2Z8GA 1WMRA 1RU4A 5C1EA 4EW9A 4NK8A 4XL9A 1PXZA 4MXNA 1H80A 1X0CA 4XOTA 4OJ6A 1NHCA 2PECA 4URRA 4Z03A 2VBKA
chains in the Genus database with same CATH superfamily
3CCVI 2OTJB 1IHMA 3VO2A 4ENMA 5F6FA 3CCLB 4RJLA 2M45A 4WF2A 2ODLA 2EPFA 2IGOA 5FO1A 2VE8A 4RAGA 2LK2A 3ABLH 2QBYB 1WZ2A 2LY2A 3K2ZA 2UWMA 3R60A 4A0YA 3FZVA 1JTYA 1WI9A 5HS7A 1IC8A 1Z6RA 1P7IA 2DMTA 1RR7A 4CO8A 2VIXA 2WA0A 3ISPA 3KP6A 2KP6A 3OS1A 2JSPA 1VQ9I 1K78A 3M7GA 4PMHA 2JMWA 5HDNA 4OIQF 2YR2A 1EXMA 5DEQA 2WB1A 5GAEJ 2DPUA 2E1RA 3HTUA 3J81Z 3I4MJ 1VLOA 4XK4A 2BSAA 2R7SA 2KRHA 3H9QA 1VQ4B 1V0FA 3BG5A 2Z1DA 3I4PA 1EP2B 5F4JA 5FKNA 1K83J 3NWTA 4Q4ZF 3ASOH 3A02A 1J0RA 4PK4A 2QGGA 2AXTC 4YFXF 3S32A 4V2GA 1TT5B 4BY7J 3CDHA 2F1MA 2NTBA 1MBEA 1TP4A 3IUOA 1K6YA 2Y0SN 4KICA 2V7UA 4MR0A 1RR8C 4H9GA 3JRDA 2ZZGA 4U49A 4YFNF 1UD2A 5HVQC 2M4KA 3G71B 2HDCA 2XAGA 2XNJA 2V9KA 4UZFA 3VR6A 3VNVA 1LPQA 2XGCA 3FKJA 5LLQA 2X6XA 4ASNA 1ETYA 4IX7A 1JE8A 1LLZA 3L09A 3KETA 2OC6A 1EFTA 5EMNA 1X1AA 5IY5H 2IGMA 1SANA 4EGZA 2MW8A 2P6SA 3NEUA 4PZJA 1ZLJA 3VMVA 1YFHA 1ETOA 1ZRDA 5E20A 1J2XA 1I39A 1FX0A 5IOYA 3PFIA 4EMSA 1BJZA 4A12A 1N77A 2MC3A 1LE8B 4AIJA 1WOSA 3R6JA 4LG3A 1Y56A 2XAQA 3OOPA 2X51A 1IJWC 4B09A 1W1WE 2IA0A 3CUQA 3FXMA 3HSEA 1VF7A 1XG1A 2XTXA 4D0PA 2LFBA 3NE5B 1O88A 2K86A 3IP4B 3I55I 2YSRA 4S05A 4MTDA 4CHUA 3GUDA 3J80Z 1B72A 2EZIA 5E1ZB 4HV6A 3JR9A 1SFEA 1FLIA 4OPOA 2VFNA 3Q3SA 4DZJA 1WJ5A 2PFBA 3JRAA 1OB5A 1YS6A 2DBBA 3ONQA 4QPOA 4HDVA 3K4MA 1MGTA 3ZQHA 2RDPA 2VE9A 4KKUA 2MH2A 4EEFG 5IYQA 3A3BA 5LBQA 3TO6A 3WGGA 2Y48A 3KP5A 1DUXC 4EM2A 2P7CB 2EV0A 5EJCA 3I59A 2ZXJA 4QV2A 3CJNA 1QRBA 2DLLA 3WTUC 3WY9A 4HNUA 4XORA 3PIOF 2ACJA 3BR6A 2BSPA 2L4AA 1JT0A 4S04A 1TTYA 4I84A 1VQ7I 4GXOA 2FSWA 2EK5A 1W35A 3ZP5A 2JQ7A 1YX3A 5EG0B 3TDUC 3WTSC 4J19A 3LSMA 2HPMA 3HXLA 2GXAA 2PECA 4URRA 1X3ZB 4N9IA 4DNCA 4KKTA 3T56B 4CYCB 1WJDA 1ONVA 1T33A 1JXSA 5GV8A 4HIZA 1VQ5B 2ETHA 1FP1D 4A2UA 3OMYA 4ZCLA 2QEXB 3CC7B 2L5QA 1ETXA 3DKXA 2WBMA 4ON0A 1ITYA 1LVKA 3BR3A 3K4BA 2YWHA 1B8IB 1O8MA 1IDJA 2ECBA 3CPWB 1G2HA 4L9TA 1W5SA 2VQCA 3KPHA 3WU0A 4KITB 4ESBA 4LBZA 4PJLA 3JRHA 3KYLA 4DGWB 3CCRI 1T95A 2ZXIA 4OOIA 2LTPA 1EF4A 5K7ZA 1Y0RA 2EIXA 3EUHC 1KZHA 2L7FP 4OJLA 2ZJ2A 2QKLB 2BY1A 4UUSA 2JA7J 2RAEA 4YEIA 4YZQA 2ZBUA 2PG4A 1G4DA 1J09A 1S29A 2MSYA 4RAYA 2B7CA 4G1BA 1TYVA 4JK1X 3HHGA 3V8LA 2XEXA 4RGXA 4AIKA 4MFDA 3KEYA 4EV0A 5ILUA 2KJBA 2OU2A 2X9DA 1TUIA 4FXUA 1U2WA 2R5YA 2BM7A 3M07A 3ZQCA 1WJFA 1T39A 2DT7B 2OCEA 4PUSA 1FBQA 4FK8A 3O3KA 3S8PA 1QQIA 4XR6A 4C3JJ 1YJNI 3P9IA 2JWTA 3HGGA 2TRTA 3RKXA 1VQ6B 4Y4RA 2E7WA 4YAUA 4A5NA 4FX4A 2NTQA 4MO7A 2ELKA 2FMYA 1K8FA 4RD4A 2JT1A 2ZBVA 1NTCA 3VNUA 1TSPA 2XSJC 5FGMA 4DBQA 1LFPA 2YWGA 3L7WA 1BIBA 4Q47A 3OP1A 2DFHA 2O03A 1QGAA 4Z1MA 3LAPA 4U4BA 4XRMA 4G7ZF 2Q6IA 2DMNA 1CZFA 4Y3OA 4ZYAA 2XKOA 2DU9A 3U6BA 2IS1A 1HKSA 3ISXA 3H3UA 4RA2A 1P6RA 4KA4A 2NOGA 4NDLA 3CPXA 4W8TA 1BMFA 1OR7C 2QLZA 3T5XA 5D5XB 4NC6A 2VLAA 3I0TA 2ZMEC 1GJRA 5GV7A 3BQZA 1UB9A 2XRNA 3TDZC 2R7RA 3ABTA 1SD5A 1WTHD 2HZTA 2VBSA 3LMWA 3GVAA 5FKOA 3QFRA 2DQRA 1MNEA 3HUGA 3HSFA 4B1RA 1FYKA 1I18A 3C2GA 4IRHA 2P0WA 1XDUA 2ZO4A 1B6AA 5HOOA 1FOXA 3GBGA 3RJPA 1REPC 2IS2A 2PX9A 4X8IA 4Y9RA 2E71A 2QYOA 3BPXA 2FX3A 1ZR4A 4WXDA 2PLFA 3L2UA 3P4GA 1VQPB 1P4AA 4AM3A 5LHGA 1KU2A 3FMQA 4KISA 5DCFA 2JDIA 1DQUA 1D1BA 1JUSA 3REOA 1TLLA 3OYIA 2WPDA 2HTSA 3OYAA 1UCRA 2E1NA 1U8RA 2VBYA 3D5RC 1AA7A 4I76A 2NVXJ 4MXNA 4HEA2 4BEHA 3WTVC 2O8KA 2XF6A 4A3FJ 5E1WA 2XAUA 3AL0B 4RS8A 3LWFA 5IP9J 5CVIA 3CO7C 1IG7A 2H94A 2J8IA 1BHEA 4UZEA 1TYWA 2BV6A 2E1BA 4R79A 1GVDA 2NPFA 3NB2A 3GTPJ 3E1YE 3WHCA 2CG4A 1JNYA 2CRVA 3J7YJ 1RKTA 1GHCA 1OB0A 2ZXWH 3I64A 2DOAA 4PFPA 5FLVA 2Q6OA 5IYCJ 4KT5C 2HCJB 2RREA 5K7FA 1LLWA 2M87A 1ZGAA 5DN6A 3HKZA 3E97A 4ZTJA 4AF6A 4QHYA 4CCKA 2DTZA 2W82A 2LDUA 1JKPC 3CP8A 2V7QA 2W6JA 2CWEA 2RKHA 4GDFA 5K5RA 1MH3A 5DS9A 1QCXA 2X6YA 3SZGA 1O3TA 1MBGA 3IRQA 1WFXA 4IVNA 2R7TA 2I10A 2N8GA 5HDGA 3E6CC 3ASNH 1FYMA 2HKOA 4GYIA 1R23A 4IHTA 5J1RA 2ZJPF 3D26A 5DYMA 5FFXA 2XV4S 4C3HJ 2WC2A 5M3FJ 3OSGA 3B6CA 5FD5A 3WU2C 4A69C 1NK2P 3W2FA 3AVUA 5KW9A 4MHGA 3EQLF 3RKQA 2UXNA 2GM4A 1ZM3A 3SZPA 3W5VA 4AWXB 5IYPA 4Z4YA 1QGPA 5HLIA 3EETA 2TCTA 3DTIA 1TNSA 1Z3YA 4YIFA 2VNIA 4CXFA 5J8CA 3C7JA 1OMIA 1ZHFA 3NARA 3DU1X 4IHXA 4Y33A 3HC7A 4IQJA 2PMDA 1JKRC 3GVLA 3ZMVA 2FBHA 1QU3A 3VDXA 4RM3A 4LFUA 3ASPA 4X0CA 1DGWY 3H36A 3JSOA 2L7MP 2RC4A 3MWMA 2XZOA 2DDAA 4PC1A 3AL0C 1SVLA 2GK7A 2LLKA 1QRYA 1LVAA 4V2FA 5J3OA 1EFUA 1JUPA 2L54A 1EWYA 4G9YA 1Z1DA 1VQLB 4C3IJ 3HSRA 3BQJA 4UXNA 1IN7A 2VFQA 3BLYA 4WWVA 1Z6TA 3G1OA 3SJMA 3BZCA 3CMEB 2X1CA 3O8GA 4B47A 2R6HA 2ZZQA 3FXKA 3VSVA 1S9HA 4E7JA 3RZOJ 4RLZA 3K4NA 1GV5A 1T6YA 3ASRA 2ZNZA 2X48A 3E5XA 3LO8A 2IQ7A 2R3SA 4B48A 3B82A 4LGWA 4J01A 4UUVA 1LKXA 1E1RA 2L0KA 4X07A 2HOTA 3PSSA 1E63A 5A2QK 1I27A 3WQZA 1OCOH 2A68F 2CV1A 3Q3AA 2E1MB 3EDPA 1ETQA 4NK8A 2MBFA 3G4SB 4XOTA 3K69A 1N06A 2VKVA 1M1EB 5FB2A 1SVOA 2GPJA 4ETSA 2R7OA 5H2FC 1ZELA 2F48A 2M5SA 3KP3A 3GO5A 2Q6KA 1E3XA 1P7JA 2M3AA 2BM5A 4XMYA 4OMZA 2K4JA 2CW8A 4YZAA 4R71A 2EZKA 1LEAA 3DTEA 3IAS2 1FRNA 2AQFA 4BAYA 3VYUB 4RDJA 2C5HA 1VQNI 2BY0A 1VQ8I 2IS6A 2R4GA 3FJOA 4G7WA 3ML3A 2OV7A 4PJMA 4M3FA 3CZ6A 3FK6A 4N9HA 4IKFA 2NNYA 2CW7A 2CUFA 2K9SA 2F3LA 4JP0A 1TLHB 4BKXA 2RNJA 2OF7A 2F6CA 2ZFWA 2Q0OA 2A5WA 2ZFUA 4A93J 1R71A 2DMPA 2ZBKA 2DYIA 4D7MA 3BR5A 3L2CA 2DIEA 3A01B 2OQRA 2UZKA 3PSFA 1YO5C 2DJNA 2BM6A 4BDYA 4F91B 4F7DA 2DA2A 3I1FA 1H89C 2ZSHB 3MN2A 3FWEA 2O3FA 4E7SA 1YRNB 3B8HA 2RQQA 1RRJA 2IS4A 1GAWA 3N90A 3DPTA 4YALA 4YG2F 3OEEA 1X3UA 1BR1A 4II3A 2NVUB 5HNFA 4BQOA 5D5VB 3P26A 5BSYA 1SM4A 4ESFA 1I1GA 2M9HA 2QN6A 4UHTA 1OQYA 4U0VA 3WTYC 3COAC 4RB0A 4G6DA 3MKLA 2F5CA 4BXXJ 2Q2EA 3CMAI 3ZQLA 2H8RA 3Q9SA 1T5EA 2E1MC 2A6HF 1WJBA 2F4NA 2BGJA 3Q5FA 4BXUA 2ELHA 2BVNA 3BCFA 5THXA 3GF2A 2XVCA 3F8MA 4UV8A 5E79C 4RB1A 3SEZA 2IA1A 3JQPA 1OGMX 4W8QA 2A6TA 2CQ7A 5LHHA 2UVFA 4ESJA 4EJTA 2MFZA 1EH6A 2EQRA 2HPIA 3GIRA 3PSZA 3MD2A 4B8XA 1BOAA 4IL6C 1POGA 4IZZA 2C4TA 1YITB 1G3YA 1KQ0A 3LSHA 1XCBA 4X05A 3T0YA 4TMTA 4HAMA 2V9VA 3RIQA 1EA0A 1FNNA 4HSRA 4OU0A 2MD5A 5H6QA 3PO2J 3OAAA 1G7RA 1PUFB 5M3MJ 1IN6A 4G5GA 4P6YA 4YZXA 2JN9A 5HS9A 1P92A 1IUYA 2XGXA 4RGUA 3VB2A 3M9AA 1L3LA 1VHOA 2Z5UA 4CCLA 3JU4A 4PC3A 2STTA 4AVZA 1WGXA 2PMZN 5H5JA 1OOCA 1PE9A 5GTIC 3WTWC 4HNTA 3C3WA 2XC1A 2QYUA 5C1EA 1IB0A 4EW9A 2KMUA 3S1NJ 3CCUI 1YYVA 3ZMUA 4NQWA 2XF7A 3IH3A 4KUMA 3I54A 1ZH5A 2EFOA 2VNKA 3OYHA 1OHHA 3OEHA 1SVMA 2EFPA 2R7UA 3F6VA 2L7ZA 2V4JC 4KDPA 4HBLA 3E6MA 4PAAA 1OCPA 1ORKA 2K40A 1V0EA 2JN6A 4BDZA 3ECHA 4OZYA 3F8CA 5DCMB 4RGRA 4EJVA 3BY1A 1M1KD 5IPAA 1SMYF 2BOLA 2L9VA 1FTTA 3JRGA 1V3FA 3KYDB 2HMAA 1IAWA 4A3JJ 2DA6A 4G7HF 5D8KB 4TMXA 4E0FA 5FLMJ 2EFNA 2B63J 1QVUA 1JB9A 3L2QA 3HOUJ 3SKBA 2Y2ZA 3VSKA 3CF5F 3P27A 4BJTA 1QHGA 2BM0A 3BNWA 1FC3A 4OJ5A 2DYSH 1RPWA 2FA5A 4JQFA 5FROA 2Y69H 1HSJA 2HQNA 2XZLA 2W85A 3DCFA 1XMAA 5B66C 2R5ZB 2YWEA 3EYYA 3F0CA 2MLKA 5JHUA 2DI3A 1R5HA 3QU6A 5F08A 1D0ZA 2EFQA 2W57A 3I3LA 5CVUA 1JGGA 2QBYA 2OJED 1B9MA 2Y0SA 3ECOA 3GWZA 1VQOI 5A89A 2VASA 3V7RA 1FMWA 2LBFB 5HLGA 3EYIA 1BJAA 3OFNA 3LSPA 1N0UA 4XSZF 3I56I 2O7OA 3DPUA 4W8SA 4X0GA 1EJ9A 2RQPA 3GQAA 1WOPA 4I98B 5L3GA 1HOMA 4RB2C 4QTRA 4U7DA 1HLVA 3LFKA 2XGEA 4GRIA 1IN5A 1P4WA 2A69F 3TP0A 1DDGA 1ZRCA 4LBVA 3ZN1A 3GTLJ 1XSXA 4KN4X 4ITVA 2V7FA 3BJOA 1H85A 2DERA 2DFIA 2QENA 4FTHA 3QQAA 3IWZA 1XPXA 1R1UA 4WCGA 4CA0A 1WP6A 1D8JA 3DBRB 4KMUX 1QZZA 5KNLA 4E7ZA 2NS7A 4HF0A 4U7BA 1PP8F 1QA2A 4HX4A 1I6XA 3EUKL 3JTGA 4G7XA 5ICFA 5D6FA 4CCOA 2W1OA 4IEJA 1E3ZA 3WBKA 5AN9A 3W2HA 2KFDA 5D5WB 1KQSB 1UAAA 3GTKJ 5IT9Z 2YU9J 4IHYA 2BEOA 1CNFA 1Z67A 4B3AA 1NG7A 1R6RA 1YIOA 1N08A 2OBSA 2D1HA 1LE8A 1W2BB 5GAGJ 1K8AD 1E2XA 1TWFJ 3EUHA 5LFAA 3IC7A 2QUFA 4FETA 1WRJA 4ZDOA 2RC5A 1JT6A 2F1LA 3SQVA 2K9LA 3AFHA 4LMYA 1XGNA 4R1HA 1WHUA 3JX8A 3AAFA 1F4KA 2I1LA 4RBOA 2OBTA 2CV2A 5AIPA 4XM3A 1VZ0A 2P5VA 3OL4A 3DP7A 4MNUA 3G73A 1WOOA 3CCYA 3FM5A 4L5EA 2XGJA 3E1SA 2HDNB 2JA5J 3ZQGA 2ZITA 3G1LA 3OIQA 2G0EA 3ZZTA 4HYEA 4DJAA 1X1DA 4A6DA 1V5EA 3GFLA 1QVTA 5C4XJ 1T6ZA 5F4OA 1P2FA 1IN8A 3DWLE 1N78A 2D1VA 4BYYA 1V4RA 3T1BA 2ZJRF 3AVWA 3E5QA 2IGKA 3KEQA 3LA3A 2O0YA 4OWRB 5FLXK 2BX6A 5FRNA 5CQEA 4D1QA 3MZHA 2EA2A 4M1KA 4UVBA 3MZYA 4U0WA 4C9YA 5LMZA 3U1KA 1LM1A 3CCEI 5GAHJ 4CGZA 2VONA 3G05A 1RWRA 2PI0A 4JYKA 1SAXA 1SAUA 4OJPA 1MDMA 3AG1H 1KK1A 4E7IA 4BU2A 4MTEA 3J81k 3GTJJ 5EG0A 3S1QJ 5LEJA 2VPLA 3FKSA 1Z0XA 3HTSB 1Y8QB 5B1AH 1E64A 3SLDA 1MMSA 2Z3YA 3QYFA 1O7LA 1UG0A 3V8JA 3J7ZI 1OR7A 3KL9A 1QA3A 3K1MA 2YUHA 1TWAJ 1QUEA 3F3XA 5E17F 2UXXA 2MGQA 2ZMEA 2I5UA 2HTJA 1O8HA 4A6EA 3C18A 5JLVC 5LD2C 1O8LA 1FPQA 2KJCA 3LSIA 3OL3A 1FP2A 4P9FA 4W1UA 2X6OA 2R0QC 3FXQA 4YEJA 2QZAA 3S16J 1Q82D 3CJQB 2L02A 2MYSA 3SYTA 1O7FA 3HBLA 1E1QA 3OZVA 2DJIA 3MAJA 2OYNA 1YIJI 4EM1A 1E17A 4U9UA 3ERMA 1TL8A 3C2HA 2FNPA 4BJ5C 4XKCA 4YIRX 2B7BA 5FJ8J 4OPVA 4DOZA 3ASQA 1I7PA 5TV2A 5D5UB 2CUEA 1H0MA 2KIUA 2XHKA 3QPHA 4HA8A 1HF2A 4FCYA 5JR3A 3K4KA 2V1DA 5EGOA 2QWWA 1BN8A 4XKVA 4EATA 1Z77A 2V7TA 1N07A 3J7AY 2BW3B 3DTKA 4KJZA 4ZDPA 4DQ2A 2YS9A 1H42A 3VYSB 3OYGA 3TQNA 1EP1B 1U2RA 5A8AA 2O8XA 3I58A 2BM1A 2GA2A 5EEAA 1TZLA 2ISYA 1IXRC 2ZTGA 3QFTA 3GFJA 3MVPA 4I7HA 4TV7A 1I3QJ 2ADUA 3L2RA 3KP7A 3GW2A 1HSTA 3H9JA 2VUMJ 3VEPA 4PABA 1X4OA 3BOQA 1T38A 2FBKA 3S2HJ 2EIMH 3BZKA 2FQ4A 3GRHA 2ZSIB 4A3KJ 2G7UA 4PC2A 2IVMA 4BS9A 2DQLA 3K7AJ 3H35A 5IOZA 1VQMI 2YX4A 5JI6A 4N3NA 3OSFA 1UHWA 3GFIA 3CCSB 3CO6C 4P2NA 2PYGA 1W87A 1B23P 1W7PA 1HG8A 2VBEA 2F4MB 1O8JA 3SEQA 4WZKA 1EZGA 2PEXA 4H0EA 4IW3B 3WG9A 3ERED 1CQXA 2NYXA 2ZKZA 5LRRA 2K9MA 2RV8A 5LGTA 4B3XA 5LGUA 4ROXA 3AK5A 1Y8RB 4CH7A 3B90A 1IDZA 3UR3C 1J7KA 4PCQA 2NRAC 2NVTJ 4TSFA 1OLTA 5ICGA 1J75A 1RUNA 4ACAA 1EP3B 3DKWA 4HX7A 2C6YA 3VWBA 2QGUA 2WV0A 3OOUA 5JFRA 2DXIA 3QPTA 1GR1A 2DY1A 4NK6A 4HNVA 3CUOA 3K1NA 5DM7F 2MLGA 1V54H 2COBA 2E2HJ 4GCVA 2C78A 2VBUA 1KCCA 1MJBA 2LKPA 1SFOJ 5L3DA 1EA3A 2P5LC 3JTHA 4LITA 2KDZA 1FNCA 3U6KA 1BI2A 4WWCA 4Y7CA 3E6BA 4CCMA 3LL7A 1OGOX 4XOPA 2A61A 3SHFA 1W7PD 3ZMSA 2FVGA 3SFZA 1Q81D 2HR3A 2XT2A 3PA1A 3C1DA 3KIOA 2MD0A 2JIZA 4RLQA 3TO7A 1HKQA 1TYXA 2BE5F 4HF1A 5DTDA 1QA6A 1JJ2B 4YHBA 2EINH 5L3FA 2E36A 3A0HC 1L1IA 3N97A 2HS5A 4AIHA 4LJZF 2OUMA 3L00A 4RAZA 5AMVA 2LNBA 2CC2A 1K4TA 1PKVA 4RD6A 5D6EA 2R7DA 2DCUA 3ABUA 3KFWX 3PQJA 1D1AA 2VJ5A 1FT9A 2ZXHA 5L3EA 3QOEA 1Y0YA 3QRFF 2NOJB 1KMHA 1TQIA 2J5PA 2PJRA 3ZSCA 5TGTA 5DSZA 4RLFA 3V7CA 4XICA 5D8LB 3QP6A 3GLLA 2R93J 4P9UA 5IYRA 3CCQB 4UVCA 3L2WA 3FK7A 5EZGA 1YLOA 1IXSB 1W0JA 3NQOA 3P5JA 1OJLA 2QKMB 2D74A 3ROUA 2VJ4A 5E3MA 4EJOA 5FO5A 1MJAA 2DO7A 3GZNB 3WBJA 2O17A 4E4HA 4LOCA 2YX7A 2BBYA 3MFKA 2CW0F 3CMYA 2LF7A 5CPRB 4A5MA 3BROA 1LDDA 3TL4X 3GLXA 4EJUA 3CD6B 1ZR2A 1Y1WJ 2W84A 3HDDA 1DBGA 4OZZA 1R9TJ 5GPCA 4M6YA 2GA1A 2HU9A 2A3SA 1QZEA 2DMQA 1ZGJA 1XSVA 1F36A 4P96A 1UJ8A 3BCAA 3ZCOA 3G3ZA 4M3GA 3H3VK 3LNNA 3SJPA 1KU7A 5JBQA 1PLUA 3FXRA 3TP3A 3W6KB 3UW0A 4XQFA 2VBZA 4L9JA 1MD0A 2XASA 3PUFA 3IKTA 3GX4X 4F55A 1HDPA 1T98A 3PETA 2D45A 2JJ2A 1X1PA 1G7TA 3PNVA 5JLWA 1EFRA 3CRZA 3S14J 1MW7A 3CCMI 4M9SA 2VZLA 1G3WA 2M7BA 1AIRA 2HYFA 4IHSA 3H1CA 1UHMA 3A8KA 1Q86D 1ZKGA 1BR4A 2F5FA 1OGJA 1IV6A 2WB1N 3SY2A 2HI3A 2FOKA 1I5ZA 2BVMA 4Z4WA 4FN5A 3ESWB 2PQ8A 5LEKA 3RYRA 1I3AA 2VI6A 2E60A 4EJWA 4XIDA 1D1NA 4QSHA 3LSRA 1JTXA 3BTCA 4MFEA 3JAMK 2WZPP 4HW0A 1M90D 2NSTA 4M6XA 4PGGA 3K4CA 5TISC 1R5NA 3IL2A 4U87A 2F2EA 1YX5A 5CVRA 3LVBA 4M3EA 4YELA 4OPWA 3CUQB 3H0DA 4Z4RA 2X8KA 4AUXA 1DBOA 3DQVC 1DP7P 1TW3A 5FKLA 2RVCA 2ZC2A 2RGVA 2EIJH 3CCLI 3M8JA 1B72B 1D3YA 4LG0B 3PUBA 1EV7A 4NNJA 1S7EA 3V42A 1K7AA 5BPDA 4AVPA 4XKBA 4A3DJ 4KYWA 1IA5A 2E1OA 1KTVA 1FYLA 2K02A 1UZCA 2CGPA 4DYCA 3SUCA 4H4KC 3V76A 3BP8A 1O8GA 2W00A 1QGZA 1IUFA 3SDGA 3KEOA 1FIAA 4Z4SA 1H9TA 1RI7A 3OR1C 4P1VA 2Z2SB 1OGIA 3KP2A 4NUBA 1WQ2A 3W2AA 4AC9A 2XOKA 3Q38A 2QMUA 3HRMA 3O2PE 5J6XA 3AVYA 1X1BA 1VQ4I 2AQEA 2HWVA 4XLNF 4L9VA 4RDKA 2VBWA 3QPLA 1TT0A 3U21A 1LNWA 4X7FA 5C3EJ 4OINF 3CC4B 1XDSA 4DQKA 3F9KA 4JOMA 3TH0A 2CMPA 4K1XA 2CSOA 1G3SA 3ZN0A 3FPKA 2JK3A 2P7VB 1O4XA 5FA6A 1YHQB 3ULQB 1WDTA 3HIFA 4XRFA 3F6OA 5J47A 1YJ9I 3H9NA 4DYQA 2NT6A 4S0HB 2BMWA 4RDLA 1S72B 3E3VA 3WGIA 4V19K 2OTLB 2QSHX 1BQEA 3FBIB 4QIWN 3IH2A 2ZZEA 1FY7A 3FPPA 1YRNA 1GUUA 1U9NA 1JA0A 3BTLA 1QFJA 4OOSA 1T08B 2CBXA 4TMVA 3LSKA 4U88A 5CLSA 4EQQA 3FBNB 2IW5A 4IHWA 1HCRA 3MMPA 2KQRA 2VT3A 4G6IA 3DPLC 1GXPA 4X6AJ 4A0XA 3PL8A 2GIVA 2KZVA 4UNOA 5E8GA 4UUSB 3AVTA 2M4GA 1A5JA 3SDBA 4MYTA 1WI3A 3E7LA 1IZ1A 4CZCA 2BYVE 2LSOA 5HLHA 1TQMA 1WH7A 4OAZA 2PMZA 4M3DA 4E6KG 4E7LA 4RPBA 3CESA 2R5YB 3CC2B 4LB6B 3W2EA 1SC7A 1V5GA 1FZPB 3PUNA 5CQGA 3R61A 1CF7A 2OZUA 1UMKA 4RM0A 2IRFG 4PC6A 2VN2A 3HRUA 1Z7LA 3A1PA 4BHCA 2VNJA 3M8EA 5GPAA 1U8BA 4XL9A 4M74A 1D8KA 5F27A 2FBIA 2BM4A 5J4VA 1NB9A 2LP0A 2OAZA 2ID3A 1RQPA 2VBKA 4ZTFA 1TNTA 1MBJA 2ELJA 2FEZA 1A35A 4XLFA 5DUKA 3WU1B 1LQ1A 1UD4A 5ICCA 2AHOA 1PUFA 1XX5A 4X1EA 1CNEA 1ZTRA 3J81K 2CF4A 3BZ6A 1G8XA 1S7AA 2RN7A 1JKOC 1S4MA 1A6QA 4YAFA 2XNDA 2HXIA 4YC5A 2V1NA 3F72A 3SJZA 4BE1A 2VFOA 2GJPA 1WWXA 2XKPA 1WVRA 2JVGA 2O5RA 2KIFA 4BJ6C 1VQ5I 2YU3A 2EWEA 1XMKA 4ZJZA 3CC7I 4E70A 3VSUA 1OYWA 4DK0A 2ICWG 2ZB9A 1AU7A 2K7LA 4Y15A 2CQQA 1JHHA 2VT2A 5JVTA 3HUGB 5IYBJ 1XB2A 4P25A 1JTAA 1BI0A 2YUSA 4HLXA 1IXCA 1WORA 2DT6A 1Z05A 3I4NJ 3LSGA 4I99C 2CFOA 1AWCA 2IOUG 1YQAA 2QQ9A 1QG0A 3OYBA 5F04A 4Z6YA 3KLNA 3OYFA 5H20A 1H8EA 4B44A 2GOXB 2BY2A 2L9NA 2PLYA 5TY0A 2QE7A 3G6EB 2GXGA 1G7CA 1D5VA 1ZM2A 2HGCA 5IT3A 2PBIA 1GLNA 2R5ZA 2V7WA 3PA2A 1FIPA 4GYGA 1IF1A 1XN7A 4ACBA 5F1JA 1MABA 5HZAA 4X7EA 1ACIA 4HF2A 2O6GE 1LDJA 3RIRA 5KSWB 2Y9YA 2D5VA 2JZYA 3A4CA 1N8RD 1X19A 1OB2A 2BPOA 2L01A 2I8DA 2JTVA 3J80K 2QA4B 2HQAA 2NNNA 1NJID 3UNGC 3D1NI 1VQ6I 2M8EA 3A0BC 4G6TB 1K79A 1IRXA 1R7JA 2E5NA 4XLHA 1VI0A 2Y9ZA 4MIMA 2OK8A 4BY1J 3HEFA 1HKTA 1VQKI 1RKWA 2QZ8A 1BW5A 4BL0B 3ZIAA 5ILSA 4ZYGA 1PP7U 1YLFA 3ZQ7A 4P12A 2L9RA 2WAQN 3GCMA 2O0WA 1OFMA 1GV2A 5E3NA 2HEOA 3HOVJ 4IRGA 3P9CA 4PJ0C 4RGSA 3DXJF 5AIQA 4XLPF 3HAGA 4J00A 1PJ6A 1MNDA 4LBWA 2GQQA 1FNBA 4X7DA 1J9ZA 4A3MJ 1GT0C 3ABKH 2YWFA 3LSJA 1RESA 2W24A 2BGCA 2IPQX 3ZMZA 3WTTC 3BG3A 3CCVB 5AONA 1IO2A 3D0SA 5K5OA 3DBLB 4BE0A 3M8FA 3PUMA 2LKSA 1EFCA 5H6RA 1BN5A 3S3MA 5E1XA 3T51B 4LK1F 3ZQQA 2R7FA 3HKZN 2GBYA 2V1UA 1QFYA 1H80A 2KT0A 1NHCA 1Q7YD 2JRTA 1QBJA 1HC8A 2XPUA 1VQ9B 4IRIA 5ILVA 1TWCJ 3LMMA 5E3OA 1VQPI 3KZZA 3BH6B 3OWTA 1YIJB 3AGPA 2RNGA 4BGDA 3AKZA 2R9VA 3K4LA 5E18F 2WTEA 2O1DA 3ZGKA 4MGRA 4E7KA 2V9PA 3IAM2 4OIOF 1D8TA 2VKEA 4OOXA 3WNDA 2LZJA 4P5OA 4TN1A 4Y7NJ 3O8HA 4CCNA 1NK3P 4P3YA 5FO0A 3F8NA 3RSNA 2YPRA 1I8DA 4QUZA 4BH9A 1XG2A 1DARA 1OKRA 1BIAA 1JGSA 2IAIA 4M71A 4MLOA 5E8IA 1UD6A 1WJAA 4Z2YA 1EKEA 1ELOA 2Z16A 2HVQA 2LREA 3GMEA 3MKYB 2O04A 3ONYA 1F1ZA 2X53S 2WV1A 2GXBA 4Q7JB 4TT3A 1OFEA 1HF0A 2M0MA 3OW7A 4WX9A 1S0UA 4YDTA 3CDLA 1G7SA 4AU7A 5IK2A 3W2IA 1Q1VA 4PGOA 1D2EA 2C5BA 5J4YA 2G7HA 2EV5A 3E20A 1W5TA 2PMUA 3P7NA 2JJ1A 2H8WA 4N3GA 3HYIA 1EE6A 1LJ9A 2CQNA 2W7NA 1IW7F 2LH9A 3E0JB 1OYIA 3CJTB 2LOOA 4HSTA 3ABMH 4BBSJ 5H59A 4DK1A 4DYRA 3D5SC 3WG7H 2E7XA 4BXFA 3QYBA 2DFEA 3JSPA 4N4OB 4QVAA 1YI2I 1O3QA 4WXHA 1LFUP 3WTZA 5DNSA 2Z6BD 1S5LC 6PAXA 2P6TA 3I55B 1YX2A 1E0EA 2X4HA 2V31A 3LQ6A 1VBLA 3OYEA 1VHEA 4I0AA 1KQ9A 2E35A 1IJFA 3S2DJ 1BOBA 4M2LA 1QVGB 2ESHA 5FIUA 4ZGQB 5K7HA 2O9LA 3JRFA 1MRZA 2Z9OA 4NBQA 1A6IA 5ERIA 3RQ4A 4ZCMA 3H92A 1DPRA 3ONUA 4XN3A 2XSDC 4IOAF 2CH0A 5LHIA 2GK6A 1U3EM 3VMWA 3R6SA 4U0YA 1RC9A 1QH0A 4Z4ZA 4YCQA 4CDGA 4YXWA 4LIVA 2INVA 2LY9A 1STZA 1OFCX 2K4BA 4IQ4A 4ZZDA 1BC8C 4J0QA 3GTOJ 5KAFC 4IHVA 1MSEC 1QPIA 3DU6A 3BG9A 3HRTA 4HQMA 5M5YJ 1TC3C 1VQ7B 2NSPA 5BSXA 1G59A 3HB9A 1XFOA 3ZRGA 1QPMA 2EZLA 2VQLA 5IYNA 4F7ZA 2WSSA 4L5IA 4Y52J 2C2WA 1KGSA 1WKMA 4AD9A 2CV0A 1YTYA 1E3PA 2Q8KA 9ANTA 3PVDA 4L5JA 2ISZA 2EJRA 4RCYA 2L4MA 5A88A 1U0JA 2Z8GA 1KK3A 1WMRA 4O5VA 1U9OA 1AKHB 2L9SA 5EEHA 4CSWA 2H09A 1ZQ3P 2HKXA 1BL0A 1T6SA 2H1LA 4ZH4F 3L1PA 1ULYA 2DOFA 3VMFA 2IEKA 1O3SA 3ZPNA 4Z03A 5J3LA 3IHUA 1UHSA 4KN7X 3CCRB 2QY1A 3ZPPA 2ZL7A 4BPRA 1R1TA 4Z05A 3NAUA 4FT8A 3N05A 3V4GA 3QYEA 4L0YB 2E2JJ 2O61A 1TVCA 2F4OB 2Q2EB 2F5EA 3B02A 3BTIA 4BNCA 1F20A 3B6AA 4OIPF 3LOCA 1SKYB 4HV5A 3IV5A 2CK3A 1JJ8C 2A6EF 3G4SI 3ZXSA 3K6GA 5D4SA 3FXJA 1XMXA 2XAJA 1EH8A 2J5OA 4KIFA 2GJRA 2HLDA 2WAFA 1T6XA 3RDIA 1IRZA 2EH3A 3AGQA 4ASUA 4G8XA 2JRMA 4M6VA 5F4MA 5B5EC 2R7WA 1NB0A 2XIGA 3DBHB 1YJNB 1OFLA 2FF4A 1QNTA 1FRQA 1T0FC 1U5TB 1ZG3A 3BDDA 2JA6J 2QX3A 3K70C 1FOYA 4IPAA 4EVIA 4F92B 5FD6A 2BN4A 3NRVA 1OCRH 3DF8A 2HZDA 2MC4A 4DZPA 1GXQA 1KONA 2VKHA 3WNCA 2ME6A 1YE9A 4XNFA 3GYHX 1TWHJ 1G3TA 1CQTA 1UG2A 2EILH 1KQ8A 2HNHA 4HX8A 3CLOA 3BQYA 5F0FA 3CCMB 5EZHA 3SFIA 2XC7A 4Z06A 1R5BA 1PUEE 3RY8A 1X3WB 2QDXA 4DBRA 4CYCA 3A03A 3KP4A 2WWYA 1MIJA 1SFXA 4UY8I 2PN6A 3HL2A 2HOSA 3JRBA 3QODA 1FX7A 1D0YA 4PSXA 4FQGA 2WY8Q 1HBXG 1FMVA 4ENKA 1QVFB 1XGMA 2AS5F 1MMGA 1H88C 4I0BA 2TDXA 5EEGA 2V26A 3DDYA 3VO1A 1YJWI 4EH1A 5IYDJ 1IV8A 3VYTB 4A3IJ 3ZMDA 1B8IA 3T53B 2LVSA 3K2AA 1W5CC 3W3CA 1USTA 2VPRA 3RKYA 3ZUGA 2Q6LA 3OS2A 3HOSA 3V7AA 1KQ5A 2XAHA 1HW5A 1MKMA 3CLQA 1A8PA 4NB5A 3T8TA 4D5FA 5E6TA 2HYJA 3QP5A 5D4RA 3B8YA 4WZTA 1TWGJ 3QE2A 3R6KA 5IP6A 2V6CA 2ESNA 1PJRA 5DV5A 4OIRF 3DEEA 2ZL6A 2K3FA 4Q5SF 1R4MB 3OYLA 3TEDA 5FKKA 4RPDA 2NTPA 1FJLA 5KAIC 4BQQA 4RCZA 1QQ1A 5JLXA 2X6WA 3O6BB 4XONA 4QFMA 4FX0A 3TKYA 1HVXA 4KIGA 1JUMA 2KPMA 4LBYA 2B0RA 2EA4A 3EPZA 2LMDA 1N75A 4C2TA 1AOYA 2C77A 4YAWA 4P55A 4IXAA 2AO9A 1XCVA 2DYRH 2WADA 1YITI 1DDIA 3S1MJ 1U5TC 3GQBA 3U2QA 3W5UA 3FXOA 1NG6A 2FUG2 3GSIA 1MBHA 2IJLA 2K5CA 1X2NA 4YIIA 1FNMA 2LRDA 4G94A 1X0CA 2LYCA 1ZAOA 4GFBA 3TW7A 3OYDA 1JJ6C 1W36C 4G6QA 4YFKF 2E19A 1BI3A 2P4WA 4FASD 2Q1ZB 3MKWB 2H27A 1BX0A 2F5VA 3MEXA 5A2QZ 4JBAA 2O0VA 2NAZA 2B7EA 4HOBA 3ZQFA 3D5LA 1JA1A 2VBVA 1U78A 3OKXA 3B4NA 3GZ5A 1WSUA 4M53A 2IT0A 2XT4A 4IOCF 3M1CA 2KIQA 1W34A 2M34A 1YJ9B 1B9NA 3ML6A 1MJ9A 1W0KA 3HJEA 1UD8A 3I71A 3HOXJ 2XNCA 3DEWA 3GQ8A 3TBIA 3QFCA 1KU3A 1FOKA 2GIZA 2K9QA 1Z9CA 3KX2A 1H8HA 4RAFA 4RMNA 2NVYJ 3OV8A 5BPIA 1XTAA 2GOMA 5DUIA 4GO1A 2GLOA 1QGYA 3JRCA 1FBSA 3G1MA 2MH9A 3A8JA 3WNBA 5J35A 2L2OA 3GTMJ 4JMQA 2VBMA 4ZYDA 1E43A 3OYNA 2M1BA 3BC9A 3GVKA 4B4DA 2F5DA 1K9MD 4BQAA 4P1WA 4HRIA 1K73D 2PIAA 3MCAA 5ICEA 4L18B 2VQHA 4WXCA 1A31A 4LG0A 3H0GJ 4ENJA 5J1YA 1A04A 1MBKA 3S2WA 3BH7B 4P6VF 2JVHA 5K1YA 1B59A 2KVOA 4RD2A 3KLOA 2BF4A 1Z7UA 2BHZA 2BXYA 1UMQA 4N4NB 4EGYA 5L3CA 2XTYA 4HWVA 3BCBA 1R49A 3U2RA 1S3JA 3BWGA 4WZLA 5TR9A 1KD1D 4FISA 2HOAA 1V5FA 1DG1G 1R5ID 2XF5A 4ABZA 3LA7A 2G9WA 4PDKA 3GTQJ 5CDFA 2CQKA 2VC0A 4ENNA 3CP2A 1G6NA 1FOWA 3BT9A 2G0YA 1N05A 2M30A 4BQNA 4ZYHA 3SLNA 2VC1A 3Q6RA 3FDYA 3JRIA 1GAQA 1TW2A 4AIDA 2GJKA 1OISA 1XD7A 4AYBN 1D1CA 4HZFA 2VL8A 1MDMB 4LC0A 1QRCA 4UVAA 3KRGA 2OZ6A 4C2UA 4C2LA 3HOYJ 3LA2A 3F8BA 5F1RA 5FFZA 2Y75A 5JMCB 1T56A 2EZHA 3KZYA 1Y1VJ 1Z3XA 2M7AA 3Q0UA 2NS8A 2HQRA 2CU7A 3HOTA 4LIUA 3JURA 3SZTA 5KCMA 2DK8A 3VSTA 3VPRA 1DP3A 1JI8A 5EF6A 2ZJQF 2HQ5A 2ZMEB 1J59A 2ZCWA 1ERDA 1IRFA 3QAHA 3BG6A 3F8FA 2EV6A 1F43A 1KA8A 5BQTA 2LY1A 2IA2A 2NS0A 3PM1A 1SD7A 1HQCA 2VB6A 4I01A 4P26A 3H3ZA 2DA7A 1H9GA 1Z91A 2VJJA 1B4AA 1U6GA 2E1CA 1DGRM 5HXBA 4ANJA 3HHHA 2Z33A 2OK7A 1ZARA 2ZNYA 1QZYA 1RU4A 1R4NB 2KISA 1ZREA 2DMUA 1K78B 3VSLA 2VBTA 1MH4A 1S6LA 1VQNB 2HDWA 1E62A 1VQ8B 2DETA 3ZPLA 4CZZA 2QVOA 4TMZA 2EBIA 4D7NA 2Z99A 1QO0D 3CCJI 2LKXA 4CQJA 4TKOB 3I5UA 5KK1A 2CUJA 3RZDJ 2QQ8A 5BOXA 4QVJA 4E7HA 4QWQA 4RD1A 2MG4A 2V7XA 2DA4A 3JW4A 2D3NA 5EGOB 3FHZA 1ZRFA 4F52A 3HPHA 2X85A 2GAUA 3LAJA 1USSA 1GDTA 1BX1A 5K5QA 1IDKA 2UV1A 3CW2A 4ZV4A 1HW1A 3OZUA 4I09A 4AC0A 1MZBA 2WY7Q 4UV9A 4AF7A 3WYAA 2Y30A 3CDIA 4W8RA 4M72A 3AVXA 3OJXA 1WCMJ 4OP7A 5CVVA 3BY2A 1HXDA 1I1SA 3FIWA 1BI1A 1VQKB 2Y0MA 2R92J 3BH4A 4OPSA 1ZLKA 1KTWA 2K85A 1R5GA 2DK5A 4BHPA 1COWA 4M4SA 4YFOA 5CYVA 2NT9A 2DDBA 2XPVA 5IP7J 1HA3A 2DA1A 4O3MA 4XN0A 2ZL5A 1ETWA 1R00A 3QOPA 2W6IA 1O3RA 2UVEA 1W7PB 3CMAB 3G2BA 2DW4A 3JQQA 1WXRA 4HDUA 3LQEA 1HW2A 2OTJI 3CTAA 1BA5A 2D2WA 2L3DA 3HM5A 3VYRB 5J1UA 2JPCA 1VNDA 1FSHA 2BGIA 2FXAA 3ASSA 2FQ3A 4YZ0A 1O57A 1WH5A 2J8KA 4OJOA 3EQOA 3KCCA 4LLNA 2HVRA 1Q9SA 1S8NA 2IBDA 4N0BA 2V6EA 2ZTNA 1I50J 3A3GA 4DNRB 1FNDA 1T8IA 3SEJA 3AVVA 1X4PA 1IN4A 5IT9K 2VYQA 4UZUA 2ZZFA 4GQNA 3B73A 3I59B 1YW8A 4FE7A 1UD3A 2VKDA 4G7OF 3S93A 3BC8A 3WODF 2ME0A 1BJKA 3WE3A 3OW2B 2F4IA 1UFMA 3FXUA 5B3SH 4HG2A 4PGHA 2C4UA 2WAQA 5HZBA 3ZZ0A 2JA2A 2AXLA 2H6BA 5J8FA 2ID6A 2IP2A 2VOPA 5IYWA 1P9QC 3HRSA 3OS0A 4L9NA 2QXZA 1B1BA 1OYYA 1TQPA 2DAOA 5ED4A 1IDYA 1SFKA 3LQQA 3A01A 2QTLA 1D0XA 3ZZUA 3Q39A 1QHHD 3M1EA 3CCUB 2INUA 3G71I 3BJ6A 1QFZA 3Q9VA 4XRSA 3QSYA 2FOWA 1ON1A 2H6CA 2P81A 2MABA 4PFOA 1RETA 1DABA 3J7AO 5F0CA 4A0ZA 4Y13A 4B3GA 1F9NA 1PYVA 1GVHA 3DV8A 4KMFA 4BE2A 4NBSA 4XLAA 3HOWJ 3F22A 3GXOA 2BXZA 2KDOA 5FKMA 1PJ7A 1ZUNB 1CLWA 2PJRB 1IJEA 3S15J 3FF5A 3FHNA 4QLCU 3IWFA 1RNLA 3RYPA 5TJJA 3CCSI 2IGNA 1YI2B 2UUZA 2W4SA 3CUQC 3IH4A 4M9XA 5CVJA 3S3NA 1MMDA 5LGNA 1LEBA 1KJZA 1NDHA 4X06A 3OYCA 1LB2A 3OYKA 1WJCA 2FE3A 3OYJA 2DPDA 3OYMA 3JREA 3OZWA 3R0AA 4WQMA 4WZEA 3CQZJ 2K9NA 3DLAA 2NVQJ 2CFXA 1VQOB 1W4MA 5HLTA 5FLXZ 2QQAA 2B9SA 1BPLA 4MYUA 1FBUA 3ZQIA 4X7CA 3GZ6A 5CJ9A 1YG2A 2CJJA 1ZM9A 3I56B 2FX0A 4A3EJ 3FKIJ 1DPUA 4HE5A 3GQ7A 2O6WA 3CF2A 4KIBA 4XRSG 3QPSA 3OIPA 4MQVA 3TMOA 5LRSA 3LNQA 4GGGA 1JHFA 2KZGA 3NWSA 3CXCB 1ODDA 3H5NA 2R7QA 4RM2A 3V7SA 1D5YA 3V8KA 3BPVA 2QSGX 1VJSA 4BBRJ 5TRDA 1L0OC 3MHPA 3DEUA 1X2MA 4PJNA 2R7ZJ 3Q6QA 1RMGA 3EUAA 2WJYA 3B78A 3OOCA 3U9GA 3M3YJ 2H1KA 1MBFA 3WTXC 2LR8A 2XTWA 1O8IA 3PJRA 2WR8A 2W25A 4CICA 1P4MA 4V02C 1X58A 3CJRB 1XS9A 2QF7A 2XAFA 4XLCA 1K61A 4MQ9F 1K5CA 2CRGA 3ES9A 2DFFA 3ZR8X 1VTNC 1NBMA 3OPOA 1TTTA 4D9JA 5JVGF 1IB4A 4OAYA 2KKOA 3R0JA 1LDKB 2QEXI 3ZBUA 4F3QA 2L7KA 1OCZH 1GO2A 3HG9A 4B3FX 1BBYA 4JX4A 5DCMA 3K0LA 2GREA 3H5AA 3OE7A 2JJ7A 3N4MA 1SFUA 2GWRA 1PDNC 2DCEA 1I6HJ 5DD8A 1XE1A 2EIKH 2XPWA 3CCQI 1KC8D 3W6JB 4HQEA 4KFCA 1KYZA 1Z21A 2PYHA 1XSDA 1HZEA 2D9RA 1ZGWA 3I53A 2J7KA 1WU8A 3PIPF 1XQBA 2D3LA 2CS3A 4UAJA 4JRAC 3JCUC 4D5CA 5FNZA 3HOZJ 1AHDP 5DS0A 3FMSA 3PNTA 4BEHB 1LUJB 3W2WA 2VFPA 1TBXA 1ZN2A 4BUPA 2GQFA 1O8DA 2VQGA 2OBPA 3OR2C 4L0ZB 3CD6I 1WSVA 3H94A 2LBFA 3F23A 1QJVA 2Y31A 5FL7A 1T0FA 3BR0A 3H9GA 3W2VA 1FEXA 4C2MJ 1WJEA 2PJPA 2RC6A 4MEXF 3S17J 1GQ8A 2HXOA 2V79A 1F5TA 2OCCH 1FTZA 1ZM4A 4KNYA 3PQKA 4OOVA 1OFDA 1BW6A 4PSWA 3CCEB 4IJAA 3ZBTA 4R8HA 1Q1HA 3SYJA 2WZNA 2B0LA 2XB0X 4A3LJ 1Y39A 1W0UA 2DTRA 1N0VC 2WAEA 2KRCA 2OBRA 2QSFX 3W5HA 5B6IA 1VF9A 3E5UA 2XB5A 1FDRA 3NAWA 4F93B 4DIQA 1ZYRF 2EB7A 2MA3A 1NH3A 3ZC3A 1MMNA 1R58A 1NHAA 3MCZA 1K4SA 3H09A 2JUCA 5CKTA 2E2IJ 4RDUA 5C4JJ 3BCDA 3RI4A 1W9XA 3VOEA 1T2KA 1BC7C 1AKHA 2HOEA 3UKGA 3ELKA 3Q0VA 2X0KA 1YJWB 3K70D 3FMRA 4JX6A 2JSCA 1E3HA 1QX4A 2VODA 2X3HA 3TOBA 1AIPA 4M73A 4DNTB 4PC7A 2JUGA 4ZCIA 3TW6A 4G1VA 3KZIC 3CB4A 1J5YA 3PFYA 2V5IA 3DU5A 3EQNA 5HDKA 4OMYA 5HNHA 2VOOA 1GVJA 2V4DA 1O8KA 2KIMA 2XGDA 3KYCB 3WXMA 2FJ1A 3DLLF 1RZ4A 3K10A 2OD5A 4A3BJ 2NXNB 5L3BA 2VFMA 1EH7A 2HYGD 4Z4TA 2P8TA 3R4KA 4M9ZA 3HGYA 2LD5A 4LB5A 1KRHA 3PSIA 3OY9A 1S7OA 1CF7B 2M0CA 3GEZA 4ZC3A 3BTJA 2LG4A 3A2KA 2EWNA 3GQ9A 2FRHA 1U5TA 5HS8A 2IXSA 1UELB 2KHMA 4A3GJ 3A1YA 3BY6A 3LFUA 4FWTA 4P22A 3T9GA 5HODA 4RB3C 1P4XA 1ZG1A 3E6DA 3QU3A 2HDDA 4KKSA 1V5VA 3DKYA 2VJIA 3SQNA 2PMHA 5BS6A 1BM9A 3DFGA 1MNMC 4B4CA 4M3BA 3CC4I 4RD3A 4NHJA 3K9TA 4W97A 2QQBA 4FE4A 3VFZA 1SKQA 2STWA 1JRGA 3L9FA 3LQRA 1VQMB 2FNAA 4QPQA 1H8AC 4I02A 5DD4A 1YHQI 2BV3A 2COMA 3PNYA 2A5YB 3QWLA 4M0LA 1ZG5A 3WGHA 2M5WA 2OQGA 3OIOA 1QUFA 4Z4VA 3QFSA 3M4OJ 1WPCA 1S72I 2E34A 1J9IA 4C43A 3IRRA 2OTLI 3SXYA 5DDGA 4G12A 4C0SA 2QCOA 4MEYF 4YAOA 5FRMA 4Y17A 3T8RA 2DEUA 2W7ZA 3LYCA 2DT5A 5C1CA 2X3UA 2LF8A 4P9SA 3WWGA 2V7VA 1IRGA 2K27A 4FHTA 1ETKA 3LJYA 4JX5A 4EM0B 2EFWA 1W36D 3K4JA 2KLOA 1IGNA 3ZOBA 1N25A 1KCDA 2BHYA 4WK8F 1ENHA 2A07F 4HPQA 1R1VA 1E79A 1PXZA 2DOGA 5M5WJ 2CYYA 2WYRA 2NV4A 2X1EA 2QTZA 2JA8J 2WJVA 1PVEA 3GFMA 4L8JA 3RCOA 1K6OA 2CNDA 4Q48A 5KVRA 3CC2I 4HE6A 4IF4A 4PJJA 4KT6A 2VXZA 4UUTA 2DA5A 3GTGJ 3A8IA 3FX3A 1AMOA 3TO9A 1K28D 4XSXF 4XBFA 1C0WA 2BW3A 3RKWA 1WSRA 2LC2A 4RD0A 1OPCA 3RPQA 1KYWA 4NCNA 2DN0A 1O8EA 1ZK8A 2GZWA 1VQLI 2VXDA 3BJAA 3A35A 2NZMA 2X1DA 3OJWA 4CCJA 4NC8A 3JAMZ 4LK0F 2XROA 1W0TA 1VLYA 1K4ZA 3TOAA 2M8GX 2M2EA 3IKVA 3CMEI 4UB8C 4C30A 3MKZA 5EDNA 1A36A 5E3LA 1DU0A 4XKWA 4IO9F 4YRVA 3W2GA 1BLIA 3W6VA 1Y0NA 1XGSA 2CQXA 3JQRA 1KZLA 3CMMA 2QM3A 4DW6A 1F60A 1LFBA 3C2BA 1B2RA 2R7VA 4CUGA 1KK0A 2HVSA 3K1PA 3FM3A 1SD4A 2KL4A 2ECCA 2R7XA 4ZGNB 3U1DA 1DDNA 1SEUA 5KHDA 5F0HA 2DODA 3I9V2 2XRLA 1NRKA 3WE2A 2B5OA 4OM9A 1V55H 2E5ZA 4TMWA 3MZ8A 1ON2A 1R36A 1RUOA 3PO3J 5L46A 1APLC 1E3OC 4DQLA 1QA1A 2OA4A 1JKQC 2CUZA 3LSTA 3S3OA 1YW9A 2F43A 3AG4H 4UB6C 3ZMTA 2PE3A 1YOVB 2JPBA 1DU6A 5F64A 1R5OA 1HDDC 4ZYEA 1XGOA 4LLGF 1VFCA 2W48A 1TYUA 1RIOH 1OCTC 2V1XA 2VBXA 2BZTA 3AG2H 3P9KA 5EYRA 4ZDLA 2VNHA 3N6ZA 1YW7A 4II2A 1UD5A 1WPKA 3WHBA 2XZPA 3F21A 3HZJA 4I6ZA 3G6EI 1MMAA 2XUBA 2FD5A 1RQRA 5B1BH 5J40A 3CCJB 3L2VA 3FISA 4AYBA 1HA8A 4KH3A 4XD7A 2KRFA 1Y0UA 5GP9A 3SZEA 3Q0WA 1YS7A 1OCCH 3RPUA 4BACA 3X2QH 4I2OA 3FY3A 3ASTA 1KU9A 2BVLA 2EFGA 1KK2A 2QA4I 1CGPA 4NC7A 4XLEA 2A05A 3FXLA 1FWZA 4K2EA 4Z4UA 1X1CA 5BNGA 1R22A 1SMTA 2K3PA 1BR2A 3KE2A 5C44J 4A3CJ 1PJ5A 2CW5A 5BMZA 2CO5A 2OPTA 2XDVA 3HPGA 2HFHA 4NQWB 3VODA 4LLLA 5GTHC 3PENA 4ZZLA 4Y9UA 4O6JA 2FMLA 3BR2A 5M5XJ 4P3IA 3BR1A 2DOEA 1MSFC 1FSEA 3BG7A 2AHQA 3S1RJ 3TGNA 3RTRA 1O8FA 3MMYB 2P5KA 3AG3H 5DM6F 3GVJA 1SD6A 5GADJ 1Y6IA 3KEWA 1ETVA 2P3MA 1XC5A 2DA3A 2FU4A 4LD5A 5JHFA 4B43A 2X0LA 2BY3A 4OJ6A 3H5RA 3RPUD 3RQIA 1XB4A 4HLYA 4CYDA 4BHBA 5HKKA 3MQ0A
chains in the Genus database with same CATH topology
2ELJA 3OYHA 4XLFA 1OHHA 3OEHA 2R7UA 1UD4A 2ODLA 4TKOB 2V4JC 2CUJA 2IGOA 1V0EA 4E7HA 2LY2A 4BDZA 2D3NA 2UWMA 4OZYA 4F52A 2BOLA 3HPHA 1G8XA 2X85A 2VIXA 4E0FA 2WA0A 2KP6A 3OS1A 2JSPA 4PMHA 2XNDA 3L2QA 1IDKA 2UV1A 2V1NA 4BE1A 2GJPA 2WB1A 3VSKA 4BJTA 2WY7Q 1QHGA 2JVGA 2O5RA 4BJ6C 4JQFA 2R7SA 5FROA 2XZLA 4ZJZA 2EWEA 4OJ5A 2KRHA 3H9QA 4W8RA 1V0FA 3VSUA 4DK0A 2Z1DA 1D0ZA 3BH4A 3I3LA 3NWTA 1KTWA 3HUGB 4PK4A 2Y0SA 2F1MA 3S32A 1JTAA 2NTBA 2VASA 1COWA 2DT6A 3IUOA 1FMWA 2LBFB 1K6YA 3LSGA 3OFNA 2NT9A 4MR0A 2CFOA 4XN0A 2ZZGA 3OYBA 4U49A 3DPUA 1UD2A 5HVQC 4W8SA 2M4KA 3OYFA 4X0GA 2W6IA 1H8EA 2V9KA 2UVEA 3VR6A 4B44A 3GQAA 2GOXB 3G2BA 2L9NA 3FKJA 2QE7A 2X6XA 4IX7A 2OC6A 1X1AA 1GLNA 2IGMA 4GRIA 3VYRB 1MABA 4YZ0A 4OJOA 3A4CA 4ITVA 1X19A 3EQOA 3VMVA 2V7FA 1FX0A 2HVRA 1N77A 2V6EA 2ZTNA 2I8DA 2HQAA 4LG3A 4CA0A 1WP6A 1Y56A 3A3GA 3UNGC 4DNRB 2X51A 1X4PA 5KNLA 4UZUA 2ZZFA 4GQNA 4G6TB 4E7ZA 1UD3A 1VF7A 1IRXA 4U7BA 2VKDA 2E5NA 3EUKL 4XLHA 3S93A 3NE5B 3IP4B 3BC8A 4G7XA 1O88A 4CCOA 2F4IA 2W1OA 1E3ZA 4HG2A 2WAQA 1UAAA 4BL0B 3ZIAA 1WJ5A 2JA2A 3ONQA 4QPOA 1NG7A 1R6RA 3K4MA 4KKUA 1P9QC 1OFMA 3OS0A 2O0WA 2QXZA 3HAGA 4J00A 3A3BA 1SFKA 1MNDA 5LFAA 1D0XA 4FETA 1QHHD 4ZDOA 2INUA 2K9LA 3AFHA 2MABA 4PFOA 4HNUA 4XORA 2CV2A 4XM3A 1VZ0A 4BE0A 3OL4A 4B3GA 2BSPA 1PYVA 4I84A 4BE2A 4XLAA 3S3MA 3T51B 2XGJA 3E1SA 3ZQQA 1YX3A 3OIQA 2KDOA 1H80A 3LSMA 4DJAA 1X1DA 2HPMA 1NHCA 2PJRB 3HXLA 1V5EA 2PECA 4URRA 3FHNA 1N78A 3DWLE 3LMMA 4KKTA 2IGNA 3T56B 2UUZA 1WJDA 2W4SA 2IGKA 3OWTA 4OWRB 2RNGA 3S3NA 4BGDA 1MMDA 3AKZA 5FRNA 5CQEA 4D1QA 3K4LA 2R9VA 4HIZA 4C9YA 2O1DA 3ZGKA 3OMYA 4E7KA 3IAM2 2L5QA 3OYCA 3OYKA 2LZJA 1WJCA 4P5OA 3G05A 1RWRA 3DKXA 2WBMA 3OYJA 4CCNA 3OYMA 1LVKA 3K4BA 1SAUA 4OJPA 3RSNA 1O8MA 1I8DA 1IDJA 1XG2A 3DLAA 4E7IA 4BU2A 5HLTA 4MLOA 2VQCA 4KITB 1BPLA 3FKSA 2VPLA 1UD6A 1WJAA 4PJLA 3KYLA 2Z16A 4DGWB 1T95A 2HVQA 2LREA 2ZXIA 3MKYB 2O04A 2X53S 3EUHC 3GQ7A 3QYFA 4OJLA 1UG0A 3CF2A 4TT3A 2QKLB 3OIPA 3TMOA 2M0MA 3OW7A 3NWSA 4YZQA 3H5NA 1J09A 2R7QA 4RM2A 4AU7A 5IK2A 1O8HA 1VJSA 4G7WA 3KEYA 4PJNA 2JJ1A 4FXUA 1EE6A 5LD2C 3EUAA 1O8LA 2WJYA 1RMGA 2W7NA 3LSIA 3OL3A 3OOCA 2LH9A 3E0JB 1WJFA 2LOOA 4HSTA 2DT7B 4PUSA 1O8IA 3S8PA 4DK1A 4XR6A 4YEJA 3PJRA 3CJQB 3D5SC 4BXFA 2MYSA 3CJRB 3QYBA 4Y4RA 3SYTA 4N4OB 2DJIA 4XLCA 1E1QA 2NTQA 1K5CA 3ZR8X 1NBMA 3OPOA 2Z6BD 4D9JA 3C2HA 1IB4A 4OAYA 4BJ5C 4XKCA 2XSJC 1LDKB 4DBQA 1LFPA 1E0EA 2V31A 4F3QA 4DOZA 2L7KA 3OYEA 1VBLA 1BOBA 4Z1MA 3HG9A 4U4BA 1CZFA 4B3FX 3K4KA 3H5AA 3OE7A 1BN8A 4XKVA 4Y3OA 4EATA 2DCEA 4ZYAA 3RQ4A 2IS1A 3J7AY 2BW3B 3DTKA 4KJZA 4ZDPA 4XN3A 3VYSB 3OYGA 2CH0A 2GK6A 3VMWA 4W8TA 1BMFA 1OR7C 1Z21A 4YXWA 2PYHA 1TZLA 4LIVA 1HZEA 2ZTGA 2INVA 4IQ4A 2VLAA 3L2RA 2D3LA 2CS3A 3H9JA 2R7RA 1X4OA 1WTHD 3DU6A 3LMWA 3PNTA 4BEHB 2NSPA 3GRHA 2ZSIB 3W2WA 1MNEA 1G59A 4BUPA 1O8DA 3ZRGA 2VQGA 4BS9A 1I18A 3C2GA 2P0WA 3OR2C 5HOOA 2VQLA 3GBGA 3H35A 2LBFA 2IS2A 3H94A 1QJVA 5FL7A 3H9GA 3W2VA 2WSSA 3L2UA 2CV0A 1WJEA 1GQ8A 2PYGA 1HG8A 4KISA 2VBEA 2JDIA 1DQUA 1D1BA 1O8JA 3OYIA 2WPDA 1U0JA 3SEQA 3OYAA 2Z8GA 4PSWA 1WMRA 2L9SA 3D5RC 4CSWA 1AA7A 4MXNA 4HEA2 4BEHA 2K9MA 2XF6A 2XAUA 4B3XA 3AL0B 4Z03A 4CH7A 2WAEA 2KRCA 3ZPNA 3B90A 1BHEA 3UR3C 2E1BA 4R79A 4TSFA 2QY1A 3ZPPA 1OLTA 4F93B 4DIQA 4Z05A 3VWBA 3N05A 3OOUA 3QYEA 2DXIA 2Q2EB 4NK6A 1MMNA 1OB0A 2DOAA 4PFPA 2CK3A 1SKYB 5CKTA 1KCCA 3BCDA 2RREA 1W9XA 1EA3A 3ZXSA 3K6GA 5DN6A 4LITA 1OGOX 3HKZA 4ZTJA 3K70D 4CCMA 3LL7A 4CCKA 2GJRA 2X3HA 2W82A 4XOPA 2HLDA 2WAFA 3CP8A 2V7QA 4DNTB 2W6JA 4ASUA 2JUGA 1QCXA 2X6YA 2R7WA 1OFLA 2MD0A 3SZGA 4RLQA 2JIZA 3PFYA 1T0FC 3EQNA 3DU5A 2QX3A 1WFXA 3K70C 2R7TA 5HNHA 4F92B 2V4DA 2HZDA 2MC4A 1O8KA 1KONA 2VKHA 2OUMA 5AMVA 3K10A 1YE9A 4XNFA 1PKVA 2HNHA 1D1AA 2VJ5A 3PSIA 3OY9A 2ZXHA 3QOEA 4ZC3A 3DTIA 1Z3YA 2LG4A 2NOJB 1KMHA 2XC7A 2PJRA 3A2KA 3ZSCA 5TGTA 4Z06A 4RLFA 3GQ9A 2IXSA 1UELB 2KHMA 4DBRA 3L2WA 3A1YA 3LFUA 1W0JA 3HL2A 4Y33A 3T9GA 3HC7A 3QODA 4P22A 1D0YA 4PSXA 2QKMB 2WY8Q 1FMVA 2VJ4A 4IQJA 3GVLA 4KKSA 1MMGA 3DKYA 2VJIA 3VDXA 4RM3A 1QU3A 2V26A 3DDYA 2O17A 4E4HA 1DGWY 3VYTB 5CPRB 3T53B 2XZOA 3W3CA 3TL4X 3AL0C 2GK7A 1JRGA 4OZZA 1DBGA 3OS2A 4QPQA 3HOSA 2HU9A 3PNYA 3B8YA 3BCAA 3ZCOA 3LNNA 1WPCA 1PJRA 1PLUA 3BLYA 3DEEA 3UW0A 2X1CA 4XQFA 3OYLA 2NTPA 4B47A 4BQQA 2ZZQA 3VSVA 1S9HA 4F55A 4E7JA 5FRMA 3K4NA 5C1CA 2X6WA 4XONA 2JJ2A 3WWGA 3PNVA 1EFRA 1HVXA 2KPMA 1MW7A 2IQ7A 1AIRA 2M7BA 4B48A 3EPZA 1W36D 4J01A 3K4JA 1N75A 1LKXA 2KLOA 4C2TA 1E1RA 1KCDA 2WADA 3GQBA 3WQZA 4HPQA 1NG6A 2FUG2 2E1MB 2CV1A 1E79A 1BR4A 2K5CA 4NK8A 1PXZA 1X0CA 2LRDA 4XOTA 2LYCA 2X1EA 2BVMA 2R7OA 2WJVA 3OYDA 1ZELA 1W36C 2M5SA 4L8JA 3RCOA 4FASD 2E60A 2Q1ZB 3MKWB 1E3XA 2F5VA 2M3AA 2O0VA 4PJJA 4XMYA 4KT6A 2VXZA 3D5LA 2WZPP 3B4NA 2NSTA 3K4CA 2CW8A 4YZAA 3M1CA 1K28D 4U87A 2BW3A 3DTEA 1YX5A 2LC2A 3IAS2 4YELA 2AQFA 1O8EA 3H0DA 3VYUB 2X8KA 1W0KA 3A35A 2VXDA 1DBOA 3DQVC 1UD8A 2NZMA 2X1DA 4CCJA 2IS6A 2R4GA 4NC8A 1VLYA 3GQ8A 2OV7A 3TBIA 3M8JA 4PJMA 3CZ6A 1H8HA 3KX2A 3PUBA 4C30A 2CW7A 3MKZA 4IKFA 4RMNA 4NNJA 4XKWA 4YRVA 3V42A 2GOMA 4XKBA 1BLIA 2F6CA 2ZFUA 2A5WA 1IA5A 1KZLA 3CMMA 2L2OA 3SUCA 2DIEA 4H4KC 4JMQA 1O8GA 2W00A 1E43A 3BC9A 3OYNA 2R7VA 3GVKA 2VBMA 4CUGA 2HVSA 3PSFA 3OR1C 4P1WA 2Z2SB 4HRIA 2KL4A 2R7XA 4BDYA 4NUBA 4F91B 3W2AA 2XOKA 2ZSHB 5KHDA 3I9V2 1NRKA 2VQHA 4E7SA 1X1BA 2E5ZA 2AQEA 1TT0A 3U21A 2RQQA 2CUZA 2F43A 3S3OA 2IS4A 2JVHA 3DPTA 3F9KA 4JOMA 2CMPA 2KVOA 3OEEA 1BR1A 4II3A 5HNFA 4BQOA 4N4NB 4HWVA 3BCBA 4ZDLA 1V5FA 1UD5A 4II2A 2NT6A 2XF5A 2XZPA 5CDFA 1T5EA 2E1MC 1MMAA 3CP2A 1WJBA 3L2VA 4AYBA 1HA8A 3FBIB 3BCFA 4BQNA 2ZZEA 4XD7A 3FPPA 3FDYA 2GJKA 3SEZA 1D1CA 4BACA 2VL8A 1OGMX 4W8QA 2A6TA 3FY3A 3KRGA 2BVLA 3LSKA 4C2UA 2UVFA 4C2LA 2MFZA 3FBNB 4NC7A 4XLEA 2HPIA 2KQRA 1X1CA 3MD2A 4G6IA 2K3PA 3DPLC 1BR2A 1Z3XA 2M7AA 3PL8A 4IZZA 2XDVA 2KZVA 3HPGA 4LIUA 4NQWB 3HOTA 5KCMA 3LSHA 3JURA 1JI8A 1DP3A 3VSTA 2M4GA 3SDBA 4CZCA 4HSRA 1ERDA 3OAAA 3BG6A 2LY1A 4YZXA 2VB6A 4OAZA 2PMZA 4E6KG 3BG7A 4E7LA 3CESA 1V5GA 3JU4A 3RTRA 4CCLA 5CQGA 2VJJA 4AVZA 1O8FA 3MMYB 1OOCA 1DGRM 1PE9A 4ANJA 4HNTA 3GVJA 1Y6IA 3KEWA 1RU4A 5C1EA 1Z7LA 4EW9A 3VSLA 2KMUA 4XL9A 5JHFA 4B43A 4OJ6A 3H5RA 2XF7A 3RPUD 2HDWA 5HKKA 2VBKA 4ZTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B90 A;  1BHE A;  4XLF A;  2QY1 A;  2O0V A;  2ODL A;  3ZPP A;  4XMY A;  4Z05 A;  3B4N A;  2NST A;  2O1D A;  4YZA A;  4NK6 A;  4OZY A;  1RWR A;  4YEL A;  2X85 A;  1KCC A;  1O8E A;  4OJP A;  1O8M A;  1DBO A;  1IDJ A;  1XG2 A;  2NZM A;  4PMH A;  1IDK A;  1OGO X;  3GQ8 A;  2X3H A;  4XOP A;  2O04 A;  4OJ5 A;  4XKW A;  2EWE A;  3GQ7 A;  4W8R A;  4OJL A;  1QCX A;  2X6Y A;  1OFL A;  3VSU A;  1IA5 A;  3EQN A;  4YZQ A;  2QX3 A;  1KTW A;  3SUC A;  1JTA A;  1O8G A;  2VBM A;  2NTB A;  1O8H A;  1O8K A;  1EE6 A;  4MR0 A;  2NT9 A;  1RMG A;  1O8L A;  5AMV A;  4XNF A;  4XN0 A;  4U49 A;  4W8S A;  2UVE A;  3GQA A;  1O8I A;  4XR6 A;  4YEJ A;  2X6X A;  4XLC A;  2NTQ A;  1K5C A;  3ZSC A;  4Z06 A;  3GQ9 A;  1IB4 A;  4YZ0 A;  4OJO A;  3EQO A;  3VMV A;  1VBL A;  4HWV A;  3T9G A;  4U4B A;  1CZF A;  2NT6 A;  2VJI A;  1BN8 A;  2O17 A;  4XKV A;  4XLH A;  4XN3 A;  1O88 A;  1JRG A;  4OZZ A;  1DBG A;  3VMW A;  4W8T A;  1OGM X;  4W8Q A;  3FY3 A;  2PYH A;  3KRG A;  2INV A;  2UVF A;  4C2L A;  3B8Y A;  4XLE A;  2O0W A;  1PLU A;  1OFM A;  3LMW A;  2QXZ A;  3JUR A;  2NSP A;  3GRH A;  3VST A;  3UW0 A;  1O8D A;  4XQF A;  2NTP A;  3VSV A;  2INU A;  5C1C A;  2X6W A;  1QJV A;  4XON A;  3WWG A;  4YZX A;  4XOR A;  2IQ7 A;  4XM3 A;  1AIR A;  1GQ8 A;  2PYG A;  1HG8 A;  2BSP A;  2VBE A;  2VJJ A;  4AVZ A;  1O8F A;  4I84 A;  1OOC A;  1O8J A;  1PE9 A;  1KCD A;  4XLA A;  2Z8G A;  1WMR A;  1RU4 A;  5C1E A;  4EW9 A;  4NK8 A;  4XL9 A;  1PXZ A;  4MXN A;  1H80 A;  1X0C A;  4XOT A;  4OJ6 A;  1NHC A;  2PEC A;  4URR A;  4Z03 A;  2VBK A; 
#chains in the Genus database with same CATH topology
 3CCV I;  2OTJ B;  1IHM A;  3VO2 A;  4ENM A;  5F6F A;  3CCL B;  4RJL A;  2M45 A;  4WF2 A;  2ODL A;  2EPF A;  2IGO A;  5FO1 A;  2VE8 A;  4RAG A;  2LK2 A;  3ABL H;  2QBY B;  1WZ2 A;  2LY2 A;  3K2Z A;  2UWM A;  3R60 A;  4A0Y A;  3FZV A;  1JTY A;  1WI9 A;  5HS7 A;  1IC8 A;  1Z6R A;  1P7I A;  2DMT A;  1RR7 A;  4CO8 A;  2VIX A;  2WA0 A;  3ISP A;  3KP6 A;  2KP6 A;  3OS1 A;  2JSP A;  1VQ9 I;  1K78 A;  3M7G A;  4PMH A;  2JMW A;  5HDN A;  4OIQ F;  2YR2 A;  1EXM A;  5DEQ A;  2WB1 A;  5GAE J;  2DPU A;  2E1R A;  3HTU A;  3J81 Z;  3I4M J;  1VLO A;  4XK4 A;  2BSA A;  2R7S A;  2KRH A;  3H9Q A;  1VQ4 B;  1V0F A;  3BG5 A;  2Z1D A;  3I4P A;  1EP2 B;  5F4J A;  5FKN A;  1K83 J;  3NWT A;  4Q4Z F;  3ASO H;  3A02 A;  1J0R A;  4PK4 A;  2QGG A;  2AXT C;  4YFX F;  3S32 A;  4V2G A;  1TT5 B;  4BY7 J;  3CDH A;  2F1M A;  2NTB A;  1MBE A;  1TP4 A;  3IUO A;  1K6Y A;  2Y0S N;  4KIC A;  2V7U A;  4MR0 A;  1RR8 C;  4H9G A;  3JRD A;  2ZZG A;  4U49 A;  4YFN F;  1UD2 A;  5HVQ C;  2M4K A;  3G71 B;  2HDC A;  2XAG A;  2XNJ A;  2V9K A;  4UZF A;  3VR6 A;  3VNV A;  1LPQ A;  2XGC A;  3FKJ A;  5LLQ A;  2X6X A;  4ASN A;  1ETY A;  4IX7 A;  1JE8 A;  1LLZ A;  3L09 A;  3KET A;  2OC6 A;  1EFT A;  5EMN A;  1X1A A;  5IY5 H;  2IGM A;  1SAN A;  4EGZ A;  2MW8 A;  2P6S A;  3NEU A;  4PZJ A;  1ZLJ A;  3VMV A;  1YFH A;  1ETO A;  1ZRD A;  5E20 A;  1J2X A;  1I39 A;  1FX0 A;  5IOY A;  3PFI A;  4EMS A;  1BJZ A;  4A12 A;  1N77 A;  2MC3 A;  1LE8 B;  4AIJ A;  1WOS A;  3R6J A;  4LG3 A;  1Y56 A;  2XAQ A;  3OOP A;  2X51 A;  1IJW C;  4B09 A;  1W1W E;  2IA0 A;  3CUQ A;  3FXM A;  3HSE A;  1VF7 A;  1XG1 A;  2XTX A;  4D0P A;  2LFB A;  3NE5 B;  1O88 A;  2K86 A;  3IP4 B;  3I55 I;  2YSR A;  4S05 A;  4MTD A;  4CHU A;  3GUD A;  3J80 Z;  1B72 A;  2EZI A;  5E1Z B;  4HV6 A;  3JR9 A;  1SFE A;  1FLI A;  4OPO A;  2VFN A;  3Q3S A;  4DZJ A;  1WJ5 A;  2PFB A;  3JRA A;  1OB5 A;  1YS6 A;  2DBB A;  3ONQ A;  4QPO A;  4HDV A;  3K4M A;  1MGT A;  3ZQH A;  2RDP A;  2VE9 A;  4KKU A;  2MH2 A;  4EEF G;  5IYQ A;  3A3B A;  5LBQ A;  3TO6 A;  3WGG A;  2Y48 A;  3KP5 A;  1DUX C;  4EM2 A;  2P7C B;  2EV0 A;  5EJC A;  3I59 A;  2ZXJ A;  4QV2 A;  3CJN A;  1QRB A;  2DLL A;  3WTU C;  3WY9 A;  4HNU A;  4XOR A;  3PIO F;  2ACJ A;  3BR6 A;  2BSP A;  2L4A A;  1JT0 A;  4S04 A;  1TTY A;  4I84 A;  1VQ7 I;  4GXO A;  2FSW A;  2EK5 A;  1W35 A;  3ZP5 A;  2JQ7 A;  1YX3 A;  5EG0 B;  3TDU C;  3WTS C;  4J19 A;  3LSM A;  2HPM A;  3HXL A;  2GXA A;  2PEC A;  4URR A;  1X3Z B;  4N9I A;  4DNC A;  4KKT A;  3T56 B;  4CYC B;  1WJD A;  1ONV A;  1T33 A;  1JXS A;  5GV8 A;  4HIZ A;  1VQ5 B;  2ETH A;  1FP1 D;  4A2U A;  3OMY A;  4ZCL A;  2QEX B;  3CC7 B;  2L5Q A;  1ETX A;  3DKX A;  2WBM A;  4ON0 A;  1ITY A;  1LVK A;  3BR3 A;  3K4B A;  2YWH A;  1B8I B;  1O8M A;  1IDJ A;  2ECB A;  3CPW B;  1G2H A;  4L9T A;  1W5S A;  2VQC A;  3KPH A;  3WU0 A;  4KIT B;  4ESB A;  4LBZ A;  4PJL A;  3JRH A;  3KYL A;  4DGW B;  3CCR I;  1T95 A;  2ZXI A;  4OOI A;  2LTP A;  1EF4 A;  5K7Z A;  1Y0R A;  2EIX A;  3EUH C;  1KZH A;  2L7F P;  4OJL A;  2ZJ2 A;  2QKL B;  2BY1 A;  4UUS A;  2JA7 J;  2RAE A;  4YEI A;  4YZQ A;  2ZBU A;  2PG4 A;  1G4D A;  1J09 A;  1S29 A;  2MSY A;  4RAY A;  2B7C A;  4G1B A;  1TYV A;  4JK1 X;  3HHG A;  3V8L A;  2XEX A;  4RGX A;  4AIK A;  4MFD A;  3KEY A;  4EV0 A;  5ILU A;  2KJB A;  2OU2 A;  2X9D A;  1TUI A;  4FXU A;  1U2W A;  2R5Y A;  2BM7 A;  3M07 A;  3ZQC A;  1WJF A;  1T39 A;  2DT7 B;  2OCE A;  4PUS A;  1FBQ A;  4FK8 A;  3O3K A;  3S8P A;  1QQI A;  4XR6 A;  4C3J J;  1YJN I;  3P9I A;  2JWT A;  3HGG A;  2TRT A;  3RKX A;  1VQ6 B;  4Y4R A;  2E7W A;  4YAU A;  4A5N A;  4FX4 A;  2NTQ A;  4MO7 A;  2ELK A;  2FMY A;  1K8F A;  4RD4 A;  2JT1 A;  2ZBV A;  1NTC A;  3VNU A;  1TSP A;  2XSJ C;  5FGM A;  4DBQ A;  1LFP A;  2YWG A;  3L7W A;  1BIB A;  4Q47 A;  3OP1 A;  2DFH A;  2O03 A;  1QGA A;  4Z1M A;  3LAP A;  4U4B A;  4XRM A;  4G7Z F;  2Q6I A;  2DMN A;  1CZF A;  4Y3O A;  4ZYA A;  2XKO A;  2DU9 A;  3U6B A;  2IS1 A;  1HKS A;  3ISX A;  3H3U A;  4RA2 A;  1P6R A;  4KA4 A;  2NOG A;  4NDL A;  3CPX A;  4W8T A;  1BMF A;  1OR7 C;  2QLZ A;  3T5X A;  5D5X B;  4NC6 A;  2VLA A;  3I0T A;  2ZME C;  1GJR A;  5GV7 A;  3BQZ A;  1UB9 A;  2XRN A;  3TDZ C;  2R7R A;  3ABT A;  1SD5 A;  1WTH D;  2HZT A;  2VBS A;  3LMW A;  3GVA A;  5FKO A;  3QFR A;  2DQR A;  1MNE A;  3HUG A;  3HSF A;  4B1R A;  1FYK A;  1I18 A;  3C2G A;  4IRH A;  2P0W A;  1XDU A;  2ZO4 A;  1B6A A;  5HOO A;  1FOX A;  3GBG A;  3RJP A;  1REP C;  2IS2 A;  2PX9 A;  4X8I A;  4Y9R A;  2E71 A;  2QYO A;  3BPX A;  2FX3 A;  1ZR4 A;  4WXD A;  2PLF A;  3L2U A;  3P4G A;  1VQP B;  1P4A A;  4AM3 A;  5LHG A;  1KU2 A;  3FMQ A;  4KIS A;  5DCF A;  2JDI A;  1DQU A;  1D1B A;  1JUS A;  3REO A;  1TLL A;  3OYI A;  2WPD A;  2HTS A;  3OYA A;  1UCR A;  2E1N A;  1U8R A;  2VBY A;  3D5R C;  1AA7 A;  4I76 A;  2NVX J;  4MXN A;  4HEA 2;  4BEH A;  3WTV C;  2O8K A;  2XF6 A;  4A3F J;  5E1W A;  2XAU A;  3AL0 B;  4RS8 A;  3LWF A;  5IP9 J;  5CVI A;  3CO7 C;  1IG7 A;  2H94 A;  2J8I A;  1BHE A;  4UZE A;  1TYW A;  2BV6 A;  2E1B A;  4R79 A;  1GVD A;  2NPF A;  3NB2 A;  3GTP J;  3E1Y E;  3WHC A;  2CG4 A;  1JNY A;  2CRV A;  3J7Y J;  1RKT A;  1GHC A;  1OB0 A;  2ZXW H;  3I64 A;  2DOA A;  4PFP A;  5FLV A;  2Q6O A;  5IYC J;  4KT5 C;  2HCJ B;  2RRE A;  5K7F A;  1LLW A;  2M87 A;  1ZGA A;  5DN6 A;  3HKZ A;  3E97 A;  4ZTJ A;  4AF6 A;  4QHY A;  4CCK A;  2DTZ A;  2W82 A;  2LDU A;  1JKP C;  3CP8 A;  2V7Q A;  2W6J A;  2CWE A;  2RKH A;  4GDF A;  5K5R A;  1MH3 A;  5DS9 A;  1QCX A;  2X6Y A;  3SZG A;  1O3T A;  1MBG A;  3IRQ A;  1WFX A;  4IVN A;  2R7T A;  2I10 A;  2N8G A;  5HDG A;  3E6C C;  3ASN H;  1FYM A;  2HKO A;  4GYI A;  1R23 A;  4IHT A;  5J1R A;  2ZJP F;  3D26 A;  5DYM A;  5FFX A;  2XV4 S;  4C3H J;  2WC2 A;  5M3F J;  3OSG A;  3B6C A;  5FD5 A;  3WU2 C;  4A69 C;  1NK2 P;  3W2F A;  3AVU A;  5KW9 A;  4MHG A;  3EQL F;  3RKQ A;  2UXN A;  2GM4 A;  1ZM3 A;  3SZP A;  3W5V A;  4AWX B;  5IYP A;  4Z4Y A;  1QGP A;  5HLI A;  3EET A;  2TCT A;  3DTI A;  1TNS A;  1Z3Y A;  4YIF A;  2VNI A;  4CXF A;  5J8C A;  3C7J A;  1OMI A;  1ZHF A;  3NAR A;  3DU1 X;  4IHX A;  4Y33 A;  3HC7 A;  4IQJ A;  2PMD A;  1JKR C;  3GVL A;  3ZMV A;  2FBH A;  1QU3 A;  3VDX A;  4RM3 A;  4LFU A;  3ASP A;  4X0C A;  1DGW Y;  3H36 A;  3JSO A;  2L7M P;  2RC4 A;  3MWM A;  2XZO A;  2DDA A;  4PC1 A;  3AL0 C;  1SVL A;  2GK7 A;  2LLK A;  1QRY A;  1LVA A;  4V2F A;  5J3O A;  1EFU A;  1JUP A;  2L54 A;  1EWY A;  4G9Y A;  1Z1D A;  1VQL B;  4C3I J;  3HSR A;  3BQJ A;  4UXN A;  1IN7 A;  2VFQ A;  3BLY A;  4WWV A;  1Z6T A;  3G1O A;  3SJM A;  3BZC A;  3CME B;  2X1C A;  3O8G A;  4B47 A;  2R6H A;  2ZZQ A;  3FXK A;  3VSV A;  1S9H A;  4E7J A;  3RZO J;  4RLZ A;  3K4N A;  1GV5 A;  1T6Y A;  3ASR A;  2ZNZ A;  2X48 A;  3E5X A;  3LO8 A;  2IQ7 A;  2R3S A;  4B48 A;  3B82 A;  4LGW A;  4J01 A;  4UUV A;  1LKX A;  1E1R A;  2L0K A;  4X07 A;  2HOT A;  3PSS A;  1E63 A;  5A2Q K;  1I27 A;  3WQZ A;  1OCO H;  2A68 F;  2CV1 A;  3Q3A A;  2E1M B;  3EDP A;  1ETQ A;  4NK8 A;  2MBF A;  3G4S B;  4XOT A;  3K69 A;  1N06 A;  2VKV A;  1M1E B;  5FB2 A;  1SVO A;  2GPJ A;  4ETS A;  2R7O A;  5H2F C;  1ZEL A;  2F48 A;  2M5S A;  3KP3 A;  3GO5 A;  2Q6K A;  1E3X A;  1P7J A;  2M3A A;  2BM5 A;  4XMY A;  4OMZ A;  2K4J A;  2CW8 A;  4YZA A;  4R71 A;  2EZK A;  1LEA A;  3DTE A;  3IAS 2;  1FRN A;  2AQF A;  4BAY A;  3VYU B;  4RDJ A;  2C5H A;  1VQN I;  2BY0 A;  1VQ8 I;  2IS6 A;  2R4G A;  3FJO A;  4G7W A;  3ML3 A;  2OV7 A;  4PJM A;  4M3F A;  3CZ6 A;  3FK6 A;  4N9H A;  4IKF A;  2NNY A;  2CW7 A;  2CUF A;  2K9S A;  2F3L A;  4JP0 A;  1TLH B;  4BKX A;  2RNJ A;  2OF7 A;  2F6C A;  2ZFW A;  2Q0O A;  2A5W A;  2ZFU A;  4A93 J;  1R71 A;  2DMP A;  2ZBK A;  2DYI A;  4D7M A;  3BR5 A;  3L2C A;  2DIE A;  3A01 B;  2OQR A;  2UZK A;  3PSF A;  1YO5 C;  2DJN A;  2BM6 A;  4BDY A;  4F91 B;  4F7D A;  2DA2 A;  3I1F A;  1H89 C;  2ZSH B;  3MN2 A;  3FWE A;  2O3F A;  4E7S A;  1YRN B;  3B8H A;  2RQQ A;  1RRJ A;  2IS4 A;  1GAW A;  3N90 A;  3DPT A;  4YAL A;  4YG2 F;  3OEE A;  1X3U A;  1BR1 A;  4II3 A;  2NVU B;  5HNF A;  4BQO A;  5D5V B;  3P26 A;  5BSY A;  1SM4 A;  4ESF A;  1I1G A;  2M9H A;  2QN6 A;  4UHT A;  1OQY A;  4U0V A;  3WTY C;  3COA C;  4RB0 A;  4G6D A;  3MKL A;  2F5C A;  4BXX J;  2Q2E A;  3CMA I;  3ZQL A;  2H8R A;  3Q9S A;  1T5E A;  2E1M C;  2A6H F;  1WJB A;  2F4N A;  2BGJ A;  3Q5F A;  4BXU A;  2ELH A;  2BVN A;  3BCF A;  5THX A;  3GF2 A;  2XVC A;  3F8M A;  4UV8 A;  5E79 C;  4RB1 A;  3SEZ A;  2IA1 A;  3JQP A;  1OGM X;  4W8Q A;  2A6T A;  2CQ7 A;  5LHH A;  2UVF A;  4ESJ A;  4EJT A;  2MFZ A;  1EH6 A;  2EQR A;  2HPI A;  3GIR A;  3PSZ A;  3MD2 A;  4B8X A;  1BOA A;  4IL6 C;  1POG A;  4IZZ A;  2C4T A;  1YIT B;  1G3Y A;  1KQ0 A;  3LSH A;  1XCB A;  4X05 A;  3T0Y A;  4TMT A;  4HAM A;  2V9V A;  3RIQ A;  1EA0 A;  1FNN A;  4HSR A;  4OU0 A;  2MD5 A;  5H6Q A;  3PO2 J;  3OAA A;  1G7R A;  1PUF B;  5M3M J;  1IN6 A;  4G5G A;  4P6Y A;  4YZX A;  2JN9 A;  5HS9 A;  1P92 A;  1IUY A;  2XGX A;  4RGU A;  3VB2 A;  3M9A A;  1L3L A;  1VHO A;  2Z5U A;  4CCL A;  3JU4 A;  4PC3 A;  2STT A;  4AVZ A;  1WGX A;  2PMZ N;  5H5J A;  1OOC A;  1PE9 A;  5GTI C;  3WTW C;  4HNT A;  3C3W A;  2XC1 A;  2QYU A;  5C1E A;  1IB0 A;  4EW9 A;  2KMU A;  3S1N J;  3CCU I;  1YYV A;  3ZMU A;  4NQW A;  2XF7 A;  3IH3 A;  4KUM A;  3I54 A;  1ZH5 A;  2EFO A;  2VNK A;  3OYH A;  1OHH A;  3OEH A;  1SVM A;  2EFP A;  2R7U A;  3F6V A;  2L7Z A;  2V4J C;  4KDP A;  4HBL A;  3E6M A;  4PAA A;  1OCP A;  1ORK A;  2K40 A;  1V0E A;  2JN6 A;  4BDZ A;  3ECH A;  4OZY A;  3F8C A;  5DCM B;  4RGR A;  4EJV A;  3BY1 A;  1M1K D;  5IPA A;  1SMY F;  2BOL A;  2L9V A;  1FTT A;  3JRG A;  1V3F A;  3KYD B;  2HMA A;  1IAW A;  4A3J J;  2DA6 A;  4G7H F;  5D8K B;  4TMX A;  4E0F A;  5FLM J;  2EFN A;  2B63 J;  1QVU A;  1JB9 A;  3L2Q A;  3HOU J;  3SKB A;  2Y2Z A;  3VSK A;  3CF5 F;  3P27 A;  4BJT A;  1QHG A;  2BM0 A;  3BNW A;  1FC3 A;  4OJ5 A;  2DYS H;  1RPW A;  2FA5 A;  4JQF A;  5FRO A;  2Y69 H;  1HSJ A;  2HQN A;  2XZL A;  2W85 A;  3DCF A;  1XMA A;  5B66 C;  2R5Z B;  2YWE A;  3EYY A;  3F0C A;  2MLK A;  5JHU A;  2DI3 A;  1R5H A;  3QU6 A;  5F08 A;  1D0Z A;  2EFQ A;  2W57 A;  3I3L A;  5CVU A;  1JGG A;  2QBY A;  2OJE D;  1B9M A;  2Y0S A;  3ECO A;  3GWZ A;  1VQO I;  5A89 A;  2VAS A;  3V7R A;  1FMW A;  2LBF B;  5HLG A;  3EYI A;  1BJA A;  3OFN A;  3LSP A;  1N0U A;  4XSZ F;  3I56 I;  2O7O A;  3DPU A;  4W8S A;  4X0G A;  1EJ9 A;  2RQP A;  3GQA A;  1WOP A;  4I98 B;  5L3G A;  1HOM A;  4RB2 C;  4QTR A;  4U7D A;  1HLV A;  3LFK A;  2XGE A;  4GRI A;  1IN5 A;  1P4W A;  2A69 F;  3TP0 A;  1DDG A;  1ZRC A;  4LBV A;  3ZN1 A;  3GTL J;  1XSX A;  4KN4 X;  4ITV A;  2V7F A;  3BJO A;  1H85 A;  2DER A;  2DFI A;  2QEN A;  4FTH A;  3QQA A;  3IWZ A;  1XPX A;  1R1U A;  4WCG A;  4CA0 A;  1WP6 A;  1D8J A;  3DBR B;  4KMU X;  1QZZ A;  5KNL A;  4E7Z A;  2NS7 A;  4HF0 A;  4U7B A;  1PP8 F;  1QA2 A;  4HX4 A;  1I6X A;  3EUK L;  3JTG A;  4G7X A;  5ICF A;  5D6F A;  4CCO A;  2W1O A;  4IEJ A;  1E3Z A;  3WBK A;  5AN9 A;  3W2H A;  2KFD A;  5D5W B;  1KQS B;  1UAA A;  3GTK J;  5IT9 Z;  2YU9 J;  4IHY A;  2BEO A;  1CNF A;  1Z67 A;  4B3A A;  1NG7 A;  1R6R A;  1YIO A;  1N08 A;  2OBS A;  2D1H A;  1LE8 A;  1W2B B;  5GAG J;  1K8A D;  1E2X A;  1TWF J;  3EUH A;  5LFA A;  3IC7 A;  2QUF A;  4FET A;  1WRJ A;  4ZDO A;  2RC5 A;  1JT6 A;  2F1L A;  3SQV A;  2K9L A;  3AFH A;  4LMY A;  1XGN A;  4R1H A;  1WHU A;  3JX8 A;  3AAF A;  1F4K A;  2I1L A;  4RBO A;  2OBT A;  2CV2 A;  5AIP A;  4XM3 A;  1VZ0 A;  2P5V A;  3OL4 A;  3DP7 A;  4MNU A;  3G73 A;  1WOO A;  3CCY A;  3FM5 A;  4L5E A;  2XGJ A;  3E1S A;  2HDN B;  2JA5 J;  3ZQG A;  2ZIT A;  3G1L A;  3OIQ A;  2G0E A;  3ZZT A;  4HYE A;  4DJA A;  1X1D A;  4A6D A;  1V5E A;  3GFL A;  1QVT A;  5C4X J;  1T6Z A;  5F4O A;  1P2F A;  1IN8 A;  3DWL E;  1N78 A;  2D1V A;  4BYY A;  1V4R A;  3T1B A;  2ZJR F;  3AVW A;  3E5Q A;  2IGK A;  3KEQ A;  3LA3 A;  2O0Y A;  4OWR B;  5FLX K;  2BX6 A;  5FRN A;  5CQE A;  4D1Q A;  3MZH A;  2EA2 A;  4M1K A;  4UVB A;  3MZY A;  4U0W A;  4C9Y A;  5LMZ A;  3U1K A;  1LM1 A;  3CCE I;  5GAH J;  4CGZ A;  2VON A;  3G05 A;  1RWR A;  2PI0 A;  4JYK A;  1SAX A;  1SAU A;  4OJP A;  1MDM A;  3AG1 H;  1KK1 A;  4E7I A;  4BU2 A;  4MTE A;  3J81 k;  3GTJ J;  5EG0 A;  3S1Q J;  5LEJ A;  2VPL A;  3FKS A;  1Z0X A;  3HTS B;  1Y8Q B;  5B1A H;  1E64 A;  3SLD A;  1MMS A;  2Z3Y A;  3QYF A;  1O7L A;  1UG0 A;  3V8J A;  3J7Z I;  1OR7 A;  3KL9 A;  1QA3 A;  3K1M A;  2YUH A;  1TWA J;  1QUE A;  3F3X A;  5E17 F;  2UXX A;  2MGQ A;  2ZME A;  2I5U A;  2HTJ A;  1O8H A;  4A6E A;  3C18 A;  5JLV C;  5LD2 C;  1O8L A;  1FPQ A;  2KJC A;  3LSI A;  3OL3 A;  1FP2 A;  4P9F A;  4W1U A;  2X6O A;  2R0Q C;  3FXQ A;  4YEJ A;  2QZA A;  3S16 J;  1Q82 D;  3CJQ B;  2L02 A;  2MYS A;  3SYT A;  1O7F A;  3HBL A;  1E1Q A;  3OZV A;  2DJI A;  3MAJ A;  2OYN A;  1YIJ I;  4EM1 A;  1E17 A;  4U9U A;  3ERM A;  1TL8 A;  3C2H A;  2FNP A;  4BJ5 C;  4XKC A;  4YIR X;  2B7B A;  5FJ8 J;  4OPV A;  4DOZ A;  3ASQ A;  1I7P A;  5TV2 A;  5D5U B;  2CUE A;  1H0M A;  2KIU A;  2XHK A;  3QPH A;  4HA8 A;  1HF2 A;  4FCY A;  5JR3 A;  3K4K A;  2V1D A;  5EGO A;  2QWW A;  1BN8 A;  4XKV A;  4EAT A;  1Z77 A;  2V7T A;  1N07 A;  3J7A Y;  2BW3 B;  3DTK A;  4KJZ A;  4ZDP A;  4DQ2 A;  2YS9 A;  1H42 A;  3VYS B;  3OYG A;  3TQN A;  1EP1 B;  1U2R A;  5A8A A;  2O8X A;  3I58 A;  2BM1 A;  2GA2 A;  5EEA A;  1TZL A;  2ISY A;  1IXR C;  2ZTG A;  3QFT A;  3GFJ A;  3MVP A;  4I7H A;  4TV7 A;  1I3Q J;  2ADU A;  3L2R A;  3KP7 A;  3GW2 A;  1HST A;  3H9J A;  2VUM J;  3VEP A;  4PAB A;  1X4O A;  3BOQ A;  1T38 A;  2FBK A;  3S2H J;  2EIM H;  3BZK A;  2FQ4 A;  3GRH A;  2ZSI B;  4A3K J;  2G7U A;  4PC2 A;  2IVM A;  4BS9 A;  2DQL A;  3K7A J;  3H35 A;  5IOZ A;  1VQM I;  2YX4 A;  5JI6 A;  4N3N A;  3OSF A;  1UHW A;  3GFI A;  3CCS B;  3CO6 C;  4P2N A;  2PYG A;  1W87 A;  1B23 P;  1W7P A;  1HG8 A;  2VBE A;  2F4M B;  1O8J A;  3SEQ A;  4WZK A;  1EZG A;  2PEX A;  4H0E A;  4IW3 B;  3WG9 A;  3ERE D;  1CQX A;  2NYX A;  2ZKZ A;  5LRR A;  2K9M A;  2RV8 A;  5LGT A;  4B3X A;  5LGU A;  4ROX A;  3AK5 A;  1Y8R B;  4CH7 A;  3B90 A;  1IDZ A;  3UR3 C;  1J7K A;  4PCQ A;  2NRA C;  2NVT J;  4TSF A;  1OLT A;  5ICG A;  1J75 A;  1RUN A;  4ACA A;  1EP3 B;  3DKW A;  4HX7 A;  2C6Y A;  3VWB A;  2QGU A;  2WV0 A;  3OOU A;  5JFR A;  2DXI A;  3QPT A;  1GR1 A;  2DY1 A;  4NK6 A;  4HNV A;  3CUO A;  3K1N A;  5DM7 F;  2MLG A;  1V54 H;  2COB A;  2E2H J;  4GCV A;  2C78 A;  2VBU A;  1KCC A;  1MJB A;  2LKP A;  1SFO J;  5L3D A;  1EA3 A;  2P5L C;  3JTH A;  4LIT A;  2KDZ A;  1FNC A;  3U6K A;  1BI2 A;  4WWC A;  4Y7C A;  3E6B A;  4CCM A;  3LL7 A;  1OGO X;  4XOP A;  2A61 A;  3SHF A;  1W7P D;  3ZMS A;  2FVG A;  3SFZ A;  1Q81 D;  2HR3 A;  2XT2 A;  3PA1 A;  3C1D A;  3KIO A;  2MD0 A;  2JIZ A;  4RLQ A;  3TO7 A;  1HKQ A;  1TYX A;  2BE5 F;  4HF1 A;  5DTD A;  1QA6 A;  1JJ2 B;  4YHB A;  2EIN H;  5L3F A;  2E36 A;  3A0H C;  1L1I A;  3N97 A;  2HS5 A;  4AIH A;  4LJZ F;  2OUM A;  3L00 A;  4RAZ A;  5AMV A;  2LNB A;  2CC2 A;  1K4T A;  1PKV A;  4RD6 A;  5D6E A;  2R7D A;  2DCU A;  3ABU A;  3KFW X;  3PQJ A;  1D1A A;  2VJ5 A;  1FT9 A;  2ZXH A;  5L3E A;  3QOE A;  1Y0Y A;  3QRF F;  2NOJ B;  1KMH A;  1TQI A;  2J5P A;  2PJR A;  3ZSC A;  5TGT A;  5DSZ A;  4RLF A;  3V7C A;  4XIC A;  5D8L B;  3QP6 A;  3GLL A;  2R93 J;  4P9U A;  5IYR A;  3CCQ B;  4UVC A;  3L2W A;  3FK7 A;  5EZG A;  1YLO A;  1IXS B;  1W0J A;  3NQO A;  3P5J A;  1OJL A;  2QKM B;  2D74 A;  3ROU A;  2VJ4 A;  5E3M A;  4EJO A;  5FO5 A;  1MJA A;  2DO7 A;  3GZN B;  3WBJ A;  2O17 A;  4E4H A;  4LOC A;  2YX7 A;  2BBY A;  3MFK A;  2CW0 F;  3CMY A;  2LF7 A;  5CPR B;  4A5M A;  3BRO A;  1LDD A;  3TL4 X;  3GLX A;  4EJU A;  3CD6 B;  1ZR2 A;  1Y1W J;  2W84 A;  3HDD A;  1DBG A;  4OZZ A;  1R9T J;  5GPC A;  4M6Y A;  2GA1 A;  2HU9 A;  2A3S A;  1QZE A;  2DMQ A;  1ZGJ A;  1XSV A;  1F36 A;  4P96 A;  1UJ8 A;  3BCA A;  3ZCO A;  3G3Z A;  4M3G A;  3H3V K;  3LNN A;  3SJP A;  1KU7 A;  5JBQ A;  1PLU A;  3FXR A;  3TP3 A;  3W6K B;  3UW0 A;  4XQF A;  2VBZ A;  4L9J A;  1MD0 A;  2XAS A;  3PUF A;  3IKT A;  3GX4 X;  4F55 A;  1HDP A;  1T98 A;  3PET A;  2D45 A;  2JJ2 A;  1X1P A;  1G7T A;  3PNV A;  5JLW A;  1EFR A;  3CRZ A;  3S14 J;  1MW7 A;  3CCM I;  4M9S A;  2VZL A;  1G3W A;  2M7B A;  1AIR A;  2HYF A;  4IHS A;  3H1C A;  1UHM A;  3A8K A;  1Q86 D;  1ZKG A;  1BR4 A;  2F5F A;  1OGJ A;  1IV6 A;  2WB1 N;  3SY2 A;  2HI3 A;  2FOK A;  1I5Z A;  2BVM A;  4Z4W A;  4FN5 A;  3ESW B;  2PQ8 A;  5LEK A;  3RYR A;  1I3A A;  2VI6 A;  2E60 A;  4EJW A;  4XID A;  1D1N A;  4QSH A;  3LSR A;  1JTX A;  3BTC A;  4MFE A;  3JAM K;  2WZP P;  4HW0 A;  1M90 D;  2NST A;  4M6X A;  4PGG A;  3K4C A;  5TIS C;  1R5N A;  3IL2 A;  4U87 A;  2F2E A;  1YX5 A;  5CVR A;  3LVB A;  4M3E A;  4YEL A;  4OPW A;  3CUQ B;  3H0D A;  4Z4R A;  2X8K A;  4AUX A;  1DBO A;  3DQV C;  1DP7 P;  1TW3 A;  5FKL A;  2RVC A;  2ZC2 A;  2RGV A;  2EIJ H;  3CCL I;  3M8J A;  1B72 B;  1D3Y A;  4LG0 B;  3PUB A;  1EV7 A;  4NNJ A;  1S7E A;  3V42 A;  1K7A A;  5BPD A;  4AVP A;  4XKB A;  4A3D J;  4KYW A;  1IA5 A;  2E1O A;  1KTV A;  1FYL A;  2K02 A;  1UZC A;  2CGP A;  4DYC A;  3SUC A;  4H4K C;  3V76 A;  3BP8 A;  1O8G A;  2W00 A;  1QGZ A;  1IUF A;  3SDG A;  3KEO A;  1FIA A;  4Z4S A;  1H9T A;  1RI7 A;  3OR1 C;  4P1V A;  2Z2S B;  1OGI A;  3KP2 A;  4NUB A;  1WQ2 A;  3W2A A;  4AC9 A;  2XOK A;  3Q38 A;  2QMU A;  3HRM A;  3O2P E;  5J6X A;  3AVY A;  1X1B A;  1VQ4 I;  2AQE A;  2HWV A;  4XLN F;  4L9V A;  4RDK A;  2VBW A;  3QPL A;  1TT0 A;  3U21 A;  1LNW A;  4X7F A;  5C3E J;  4OIN F;  3CC4 B;  1XDS A;  4DQK A;  3F9K A;  4JOM A;  3TH0 A;  2CMP A;  4K1X A;  2CSO A;  1G3S A;  3ZN0 A;  3FPK A;  2JK3 A;  2P7V B;  1O4X A;  5FA6 A;  1YHQ B;  3ULQ B;  1WDT A;  3HIF A;  4XRF A;  3F6O A;  5J47 A;  1YJ9 I;  3H9N A;  4DYQ A;  2NT6 A;  4S0H B;  2BMW A;  4RDL A;  1S72 B;  3E3V A;  3WGI A;  4V19 K;  2OTL B;  2QSH X;  1BQE A;  3FBI B;  4QIW N;  3IH2 A;  2ZZE A;  1FY7 A;  3FPP A;  1YRN A;  1GUU A;  1U9N A;  1JA0 A;  3BTL A;  1QFJ A;  4OOS A;  1T08 B;  2CBX A;  4TMV A;  3LSK A;  4U88 A;  5CLS A;  4EQQ A;  3FBN B;  2IW5 A;  4IHW A;  1HCR A;  3MMP A;  2KQR A;  2VT3 A;  4G6I A;  3DPL C;  1GXP A;  4X6A J;  4A0X A;  3PL8 A;  2GIV A;  2KZV A;  4UNO A;  5E8G A;  4UUS B;  3AVT A;  2M4G A;  1A5J A;  3SDB A;  4MYT A;  1WI3 A;  3E7L A;  1IZ1 A;  4CZC A;  2BYV E;  2LSO A;  5HLH A;  1TQM A;  1WH7 A;  4OAZ A;  2PMZ A;  4M3D A;  4E6K G;  4E7L A;  4RPB A;  3CES A;  2R5Y B;  3CC2 B;  4LB6 B;  3W2E A;  1SC7 A;  1V5G A;  1FZP B;  3PUN A;  5CQG A;  3R61 A;  1CF7 A;  2OZU A;  1UMK A;  4RM0 A;  2IRF G;  4PC6 A;  2VN2 A;  3HRU A;  1Z7L A;  3A1P A;  4BHC A;  2VNJ A;  3M8E A;  5GPA A;  1U8B A;  4XL9 A;  4M74 A;  1D8K A;  5F27 A;  2FBI A;  2BM4 A;  5J4V A;  1NB9 A;  2LP0 A;  2OAZ A;  2ID3 A;  1RQP A;  2VBK A;  4ZTF A;  1TNT A;  1MBJ A;  2ELJ A;  2FEZ A;  1A35 A;  4XLF A;  5DUK A;  3WU1 B;  1LQ1 A;  1UD4 A;  5ICC A;  2AHO A;  1PUF A;  1XX5 A;  4X1E A;  1CNE A;  1ZTR A;  3J81 K;  2CF4 A;  3BZ6 A;  1G8X A;  1S7A A;  2RN7 A;  1JKO C;  1S4M A;  1A6Q A;  4YAF A;  2XND A;  2HXI A;  4YC5 A;  2V1N A;  3F72 A;  3SJZ A;  4BE1 A;  2VFO A;  2GJP A;  1WWX A;  2XKP A;  1WVR A;  2JVG A;  2O5R A;  2KIF A;  4BJ6 C;  1VQ5 I;  2YU3 A;  2EWE A;  1XMK A;  4ZJZ A;  3CC7 I;  4E70 A;  3VSU A;  1OYW A;  4DK0 A;  2ICW G;  2ZB9 A;  1AU7 A;  2K7L A;  4Y15 A;  2CQQ A;  1JHH A;  2VT2 A;  5JVT A;  3HUG B;  5IYB J;  1XB2 A;  4P25 A;  1JTA A;  1BI0 A;  2YUS A;  4HLX A;  1IXC A;  1WOR A;  2DT6 A;  1Z05 A;  3I4N J;  3LSG A;  4I99 C;  2CFO A;  1AWC A;  2IOU G;  1YQA A;  2QQ9 A;  1QG0 A;  3OYB A;  5F04 A;  4Z6Y A;  3KLN A;  3OYF A;  5H20 A;  1H8E A;  4B44 A;  2GOX B;  2BY2 A;  2L9N A;  2PLY A;  5TY0 A;  2QE7 A;  3G6E B;  2GXG A;  1G7C A;  1D5V A;  1ZM2 A;  2HGC A;  5IT3 A;  2PBI A;  1GLN A;  2R5Z A;  2V7W A;  3PA2 A;  1FIP A;  4GYG A;  1IF1 A;  1XN7 A;  4ACB A;  5F1J A;  1MAB A;  5HZA A;  4X7E A;  1ACI A;  4HF2 A;  2O6G E;  1LDJ A;  3RIR A;  5KSW B;  2Y9Y A;  2D5V A;  2JZY A;  3A4C A;  1N8R D;  1X19 A;  1OB2 A;  2BPO A;  2L01 A;  2I8D A;  2JTV A;  3J80 K;  2QA4 B;  2HQA A;  2NNN A;  1NJI D;  3UNG C;  3D1N I;  1VQ6 I;  2M8E A;  3A0B C;  4G6T B;  1K79 A;  1IRX A;  1R7J A;  2E5N A;  4XLH A;  1VI0 A;  2Y9Z A;  4MIM A;  2OK8 A;  4BY1 J;  3HEF A;  1HKT A;  1VQK I;  1RKW A;  2QZ8 A;  1BW5 A;  4BL0 B;  3ZIA A;  5ILS A;  4ZYG A;  1PP7 U;  1YLF A;  3ZQ7 A;  4P12 A;  2L9R A;  2WAQ N;  3GCM A;  2O0W A;  1OFM A;  1GV2 A;  5E3N A;  2HEO A;  3HOV J;  4IRG A;  3P9C A;  4PJ0 C;  4RGS A;  3DXJ F;  5AIQ A;  4XLP F;  3HAG A;  4J00 A;  1PJ6 A;  1MND A;  4LBW A;  2GQQ A;  1FNB A;  4X7D A;  1J9Z A;  4A3M J;  1GT0 C;  3ABK H;  2YWF A;  3LSJ A;  1RES A;  2W24 A;  2BGC A;  2IPQ X;  3ZMZ A;  3WTT C;  3BG3 A;  3CCV B;  5AON A;  1IO2 A;  3D0S A;  5K5O A;  3DBL B;  4BE0 A;  3M8F A;  3PUM A;  2LKS A;  1EFC A;  5H6R A;  1BN5 A;  3S3M A;  5E1X A;  3T51 B;  4LK1 F;  3ZQQ A;  2R7F A;  3HKZ N;  2GBY A;  2V1U A;  1QFY A;  1H80 A;  2KT0 A;  1NHC A;  1Q7Y D;  2JRT A;  1QBJ A;  1HC8 A;  2XPU A;  1VQ9 B;  4IRI A;  5ILV A;  1TWC J;  3LMM A;  5E3O A;  1VQP I;  3KZZ A;  3BH6 B;  3OWT A;  1YIJ B;  3AGP A;  2RNG A;  4BGD A;  3AKZ A;  2R9V A;  3K4L A;  5E18 F;  2WTE A;  2O1D A;  3ZGK A;  4MGR A;  4E7K A;  2V9P A;  3IAM 2;  4OIO F;  1D8T A;  2VKE A;  4OOX A;  3WND A;  2LZJ A;  4P5O A;  4TN1 A;  4Y7N J;  3O8H A;  4CCN A;  1NK3 P;  4P3Y A;  5FO0 A;  3F8N A;  3RSN A;  2YPR A;  1I8D A;  4QUZ A;  4BH9 A;  1XG2 A;  1DAR A;  1OKR A;  1BIA A;  1JGS A;  2IAI A;  4M71 A;  4MLO A;  5E8I A;  1UD6 A;  1WJA A;  4Z2Y A;  1EKE A;  1ELO A;  2Z16 A;  2HVQ A;  2LRE A;  3GME A;  3MKY B;  2O04 A;  3ONY A;  1F1Z A;  2X53 S;  2WV1 A;  2GXB A;  4Q7J B;  4TT3 A;  1OFE A;  1HF0 A;  2M0M A;  3OW7 A;  4WX9 A;  1S0U A;  4YDT A;  3CDL A;  1G7S A;  4AU7 A;  5IK2 A;  3W2I A;  1Q1V A;  4PGO A;  1D2E A;  2C5B A;  5J4Y A;  2G7H A;  2EV5 A;  3E20 A;  1W5T A;  2PMU A;  3P7N A;  2JJ1 A;  2H8W A;  4N3G A;  3HYI A;  1EE6 A;  1LJ9 A;  2CQN A;  2W7N A;  1IW7 F;  2LH9 A;  3E0J B;  1OYI A;  3CJT B;  2LOO A;  4HST A;  3ABM H;  4BBS J;  5H59 A;  4DK1 A;  4DYR A;  3D5S C;  3WG7 H;  2E7X A;  4BXF A;  3QYB A;  2DFE A;  3JSP A;  4N4O B;  4QVA A;  1YI2 I;  1O3Q A;  4WXH A;  1LFU P;  3WTZ A;  5DNS A;  2Z6B D;  1S5L C;  6PAX A;  2P6T A;  3I55 B;  1YX2 A;  1E0E A;  2X4H A;  2V31 A;  3LQ6 A;  1VBL A;  3OYE A;  1VHE A;  4I0A A;  1KQ9 A;  2E35 A;  1IJF A;  3S2D J;  1BOB A;  4M2L A;  1QVG B;  2ESH A;  5FIU A;  4ZGQ B;  5K7H A;  2O9L A;  3JRF A;  1MRZ A;  2Z9O A;  4NBQ A;  1A6I A;  5ERI A;  3RQ4 A;  4ZCM A;  3H92 A;  1DPR A;  3ONU A;  4XN3 A;  2XSD C;  4IOA F;  2CH0 A;  5LHI A;  2GK6 A;  1U3E M;  3VMW A;  3R6S A;  4U0Y A;  1RC9 A;  1QH0 A;  4Z4Z A;  4YCQ A;  4CDG A;  4YXW A;  4LIV A;  2INV A;  2LY9 A;  1STZ A;  1OFC X;  2K4B A;  4IQ4 A;  4ZZD A;  1BC8 C;  4J0Q A;  3GTO J;  5KAF C;  4IHV A;  1MSE C;  1QPI A;  3DU6 A;  3BG9 A;  3HRT A;  4HQM A;  5M5Y J;  1TC3 C;  1VQ7 B;  2NSP A;  5BSX A;  1G59 A;  3HB9 A;  1XFO A;  3ZRG A;  1QPM A;  2EZL A;  2VQL A;  5IYN A;  4F7Z A;  2WSS A;  4L5I A;  4Y52 J;  2C2W A;  1KGS A;  1WKM A;  4AD9 A;  2CV0 A;  1YTY A;  1E3P A;  2Q8K A;  9ANT A;  3PVD A;  4L5J A;  2ISZ A;  2EJR A;  4RCY A;  2L4M A;  5A88 A;  1U0J A;  2Z8G A;  1KK3 A;  1WMR A;  4O5V A;  1U9O A;  1AKH B;  2L9S A;  5EEH A;  4CSW A;  2H09 A;  1ZQ3 P;  2HKX A;  1BL0 A;  1T6S A;  2H1L A;  4ZH4 F;  3L1P A;  1ULY A;  2DOF A;  3VMF A;  2IEK A;  1O3S A;  3ZPN A;  4Z03 A;  5J3L A;  3IHU A;  1UHS A;  4KN7 X;  3CCR B;  2QY1 A;  3ZPP A;  2ZL7 A;  4BPR A;  1R1T A;  4Z05 A;  3NAU A;  4FT8 A;  3N05 A;  3V4G A;  3QYE A;  4L0Y B;  2E2J J;  2O61 A;  1TVC A;  2F4O B;  2Q2E B;  2F5E A;  3B02 A;  3BTI A;  4BNC A;  1F20 A;  3B6A A;  4OIP F;  3LOC A;  1SKY B;  4HV5 A;  3IV5 A;  2CK3 A;  1JJ8 C;  2A6E F;  3G4S I;  3ZXS A;  3K6G A;  5D4S A;  3FXJ A;  1XMX A;  2XAJ A;  1EH8 A;  2J5O A;  4KIF A;  2GJR A;  2HLD A;  2WAF A;  1T6X A;  3RDI A;  1IRZ A;  2EH3 A;  3AGQ A;  4ASU A;  4G8X A;  2JRM A;  4M6V A;  5F4M A;  5B5E C;  2R7W A;  1NB0 A;  2XIG A;  3DBH B;  1YJN B;  1OFL A;  2FF4 A;  1QNT A;  1FRQ A;  1T0F C;  1U5T B;  1ZG3 A;  3BDD A;  2JA6 J;  2QX3 A;  3K70 C;  1FOY A;  4IPA A;  4EVI A;  4F92 B;  5FD6 A;  2BN4 A;  3NRV A;  1OCR H;  3DF8 A;  2HZD A;  2MC4 A;  4DZP A;  1GXQ A;  1KON A;  2VKH A;  3WNC A;  2ME6 A;  1YE9 A;  4XNF A;  3GYH X;  1TWH J;  1G3T A;  1CQT A;  1UG2 A;  2EIL H;  1KQ8 A;  2HNH A;  4HX8 A;  3CLO A;  3BQY A;  5F0F A;  3CCM B;  5EZH A;  3SFI A;  2XC7 A;  4Z06 A;  1R5B A;  1PUE E;  3RY8 A;  1X3W B;  2QDX A;  4DBR A;  4CYC A;  3A03 A;  3KP4 A;  2WWY A;  1MIJ A;  1SFX A;  4UY8 I;  2PN6 A;  3HL2 A;  2HOS A;  3JRB A;  3QOD A;  1FX7 A;  1D0Y A;  4PSX A;  4FQG A;  2WY8 Q;  1HBX G;  1FMV A;  4ENK A;  1QVF B;  1XGM A;  2AS5 F;  1MMG A;  1H88 C;  4I0B A;  2TDX A;  5EEG A;  2V26 A;  3DDY A;  3VO1 A;  1YJW I;  4EH1 A;  5IYD J;  1IV8 A;  3VYT B;  4A3I J;  3ZMD A;  1B8I A;  3T53 B;  2LVS A;  3K2A A;  1W5C C;  3W3C A;  1UST A;  2VPR A;  3RKY A;  3ZUG A;  2Q6L A;  3OS2 A;  3HOS A;  3V7A A;  1KQ5 A;  2XAH A;  1HW5 A;  1MKM A;  3CLQ A;  1A8P A;  4NB5 A;  3T8T A;  4D5F A;  5E6T A;  2HYJ A;  3QP5 A;  5D4R A;  3B8Y A;  4WZT A;  1TWG J;  3QE2 A;  3R6K A;  5IP6 A;  2V6C A;  2ESN A;  1PJR A;  5DV5 A;  4OIR F;  3DEE A;  2ZL6 A;  2K3F A;  4Q5S F;  1R4M B;  3OYL A;  3TED A;  5FKK A;  4RPD A;  2NTP A;  1FJL A;  5KAI C;  4BQQ A;  4RCZ A;  1QQ1 A;  5JLX A;  2X6W A;  3O6B B;  4XON A;  4QFM A;  4FX0 A;  3TKY A;  1HVX A;  4KIG A;  1JUM A;  2KPM A;  4LBY A;  2B0R A;  2EA4 A;  3EPZ A;  2LMD A;  1N75 A;  4C2T A;  1AOY A;  2C77 A;  4YAW A;  4P55 A;  4IXA A;  2AO9 A;  1XCV A;  2DYR H;  2WAD A;  1YIT I;  1DDI A;  3S1M J;  1U5T C;  3GQB A;  3U2Q A;  3W5U A;  3FXO A;  1NG6 A;  2FUG 2;  3GSI A;  1MBH A;  2IJL A;  2K5C A;  1X2N A;  4YII A;  1FNM A;  2LRD A;  4G94 A;  1X0C A;  2LYC A;  1ZAO A;  4GFB A;  3TW7 A;  3OYD A;  1JJ6 C;  1W36 C;  4G6Q A;  4YFK F;  2E19 A;  1BI3 A;  2P4W A;  4FAS D;  2Q1Z B;  3MKW B;  2H27 A;  1BX0 A;  2F5V A;  3MEX A;  5A2Q Z;  4JBA A;  2O0V A;  2NAZ A;  2B7E A;  4HOB A;  3ZQF A;  3D5L A;  1JA1 A;  2VBV A;  1U78 A;  3OKX A;  3B4N A;  3GZ5 A;  1WSU A;  4M53 A;  2IT0 A;  2XT4 A;  4IOC F;  3M1C A;  2KIQ A;  1W34 A;  2M34 A;  1YJ9 B;  1B9N A;  3ML6 A;  1MJ9 A;  1W0K A;  3HJE A;  1UD8 A;  3I71 A;  3HOX J;  2XNC A;  3DEW A;  3GQ8 A;  3TBI A;  3QFC A;  1KU3 A;  1FOK A;  2GIZ A;  2K9Q A;  1Z9C A;  3KX2 A;  1H8H A;  4RAF A;  4RMN A;  2NVY J;  3OV8 A;  5BPI A;  1XTA A;  2GOM A;  5DUI A;  4GO1 A;  2GLO A;  1QGY A;  3JRC A;  1FBS A;  3G1M A;  2MH9 A;  3A8J A;  3WNB A;  5J35 A;  2L2O A;  3GTM J;  4JMQ A;  2VBM A;  4ZYD A;  1E43 A;  3OYN A;  2M1B A;  3BC9 A;  3GVK A;  4B4D A;  2F5D A;  1K9M D;  4BQA A;  4P1W A;  4HRI A;  1K73 D;  2PIA A;  3MCA A;  5ICE A;  4L18 B;  2VQH A;  4WXC A;  1A31 A;  4LG0 A;  3H0G J;  4ENJ A;  5J1Y A;  1A04 A;  1MBK A;  3S2W A;  3BH7 B;  4P6V F;  2JVH A;  5K1Y A;  1B59 A;  2KVO A;  4RD2 A;  3KLO A;  2BF4 A;  1Z7U A;  2BHZ A;  2BXY A;  1UMQ A;  4N4N B;  4EGY A;  5L3C A;  2XTY A;  4HWV A;  3BCB A;  1R49 A;  3U2R A;  1S3J A;  3BWG A;  4WZL A;  5TR9 A;  1KD1 D;  4FIS A;  2HOA A;  1V5F A;  1DG1 G;  1R5I D;  2XF5 A;  4ABZ A;  3LA7 A;  2G9W A;  4PDK A;  3GTQ J;  5CDF A;  2CQK A;  2VC0 A;  4ENN A;  3CP2 A;  1G6N A;  1FOW A;  3BT9 A;  2G0Y A;  1N05 A;  2M30 A;  4BQN A;  4ZYH A;  3SLN A;  2VC1 A;  3Q6R A;  3FDY A;  3JRI A;  1GAQ A;  1TW2 A;  4AID A;  2GJK A;  1OIS A;  1XD7 A;  4AYB N;  1D1C A;  4HZF A;  2VL8 A;  1MDM B;  4LC0 A;  1QRC A;  4UVA A;  3KRG A;  2OZ6 A;  4C2U A;  4C2L A;  3HOY J;  3LA2 A;  3F8B A;  5F1R A;  5FFZ A;  2Y75 A;  5JMC B;  1T56 A;  2EZH A;  3KZY A;  1Y1V J;  1Z3X A;  2M7A A;  3Q0U A;  2NS8 A;  2HQR A;  2CU7 A;  3HOT A;  4LIU A;  3JUR A;  3SZT A;  5KCM A;  2DK8 A;  3VST A;  3VPR A;  1DP3 A;  1JI8 A;  5EF6 A;  2ZJQ F;  2HQ5 A;  2ZME B;  1J59 A;  2ZCW A;  1ERD A;  1IRF A;  3QAH A;  3BG6 A;  3F8F A;  2EV6 A;  1F43 A;  1KA8 A;  5BQT A;  2LY1 A;  2IA2 A;  2NS0 A;  3PM1 A;  1SD7 A;  1HQC A;  2VB6 A;  4I01 A;  4P26 A;  3H3Z A;  2DA7 A;  1H9G A;  1Z91 A;  2VJJ A;  1B4A A;  1U6G A;  2E1C A;  1DGR M;  5HXB A;  4ANJ A;  3HHH A;  2Z33 A;  2OK7 A;  1ZAR A;  2ZNY A;  1QZY A;  1RU4 A;  1R4N B;  2KIS A;  1ZRE A;  2DMU A;  1K78 B;  3VSL A;  2VBT A;  1MH4 A;  1S6L A;  1VQN B;  2HDW A;  1E62 A;  1VQ8 B;  2DET A;  3ZPL A;  4CZZ A;  2QVO A;  4TMZ A;  2EBI A;  4D7N A;  2Z99 A;  1QO0 D;  3CCJ I;  2LKX A;  4CQJ A;  4TKO B;  3I5U A;  5KK1 A;  2CUJ A;  3RZD J;  2QQ8 A;  5BOX A;  4QVJ A;  4E7H A;  4QWQ A;  4RD1 A;  2MG4 A;  2V7X A;  2DA4 A;  3JW4 A;  2D3N A;  5EGO B;  3FHZ A;  1ZRF A;  4F52 A;  3HPH A;  2X85 A;  2GAU A;  3LAJ A;  1USS A;  1GDT A;  1BX1 A;  5K5Q A;  1IDK A;  2UV1 A;  3CW2 A;  4ZV4 A;  1HW1 A;  3OZU A;  4I09 A;  4AC0 A;  1MZB A;  2WY7 Q;  4UV9 A;  4AF7 A;  3WYA A;  2Y30 A;  3CDI A;  4W8R A;  4M72 A;  3AVX A;  3OJX A;  1WCM J;  4OP7 A;  5CVV A;  3BY2 A;  1HXD A;  1I1S A;  3FIW A;  1BI1 A;  1VQK B;  2Y0M A;  2R92 J;  3BH4 A;  4OPS A;  1ZLK A;  1KTW A;  2K85 A;  1R5G A;  2DK5 A;  4BHP A;  1COW A;  4M4S A;  4YFO A;  5CYV A;  2NT9 A;  2DDB A;  2XPV A;  5IP7 J;  1HA3 A;  2DA1 A;  4O3M A;  4XN0 A;  2ZL5 A;  1ETW A;  1R00 A;  3QOP A;  2W6I A;  1O3R A;  2UVE A;  1W7P B;  3CMA B;  3G2B A;  2DW4 A;  3JQQ A;  1WXR A;  4HDU A;  3LQE A;  1HW2 A;  2OTJ I;  3CTA A;  1BA5 A;  2D2W A;  2L3D A;  3HM5 A;  3VYR B;  5J1U A;  2JPC A;  1VND A;  1FSH A;  2BGI A;  2FXA A;  3ASS A;  2FQ3 A;  4YZ0 A;  1O57 A;  1WH5 A;  2J8K A;  4OJO A;  3EQO A;  3KCC A;  4LLN A;  2HVR A;  1Q9S A;  1S8N A;  2IBD A;  4N0B A;  2V6E A;  2ZTN A;  1I50 J;  3A3G A;  4DNR B;  1FND A;  1T8I A;  3SEJ A;  3AVV A;  1X4P A;  1IN4 A;  5IT9 K;  2VYQ A;  4UZU A;  2ZZF A;  4GQN A;  3B73 A;  3I59 B;  1YW8 A;  4FE7 A;  1UD3 A;  2VKD A;  4G7O F;  3S93 A;  3BC8 A;  3WOD F;  2ME0 A;  1BJK A;  3WE3 A;  3OW2 B;  2F4I A;  1UFM A;  3FXU A;  5B3S H;  4HG2 A;  4PGH A;  2C4U A;  2WAQ A;  5HZB A;  3ZZ0 A;  2JA2 A;  2AXL A;  2H6B A;  5J8F A;  2ID6 A;  2IP2 A;  2VOP A;  5IYW A;  1P9Q C;  3HRS A;  3OS0 A;  4L9N A;  2QXZ A;  1B1B A;  1OYY A;  1TQP A;  2DAO A;  5ED4 A;  1IDY A;  1SFK A;  3LQQ A;  3A01 A;  2QTL A;  1D0X A;  3ZZU A;  3Q39 A;  1QHH D;  3M1E A;  3CCU B;  2INU A;  3G71 I;  3BJ6 A;  1QFZ A;  3Q9V A;  4XRS A;  3QSY A;  2FOW A;  1ON1 A;  2H6C A;  2P81 A;  2MAB A;  4PFO A;  1RET A;  1DAB A;  3J7A O;  5F0C A;  4A0Z A;  4Y13 A;  4B3G A;  1F9N A;  1PYV A;  1GVH A;  3DV8 A;  4KMF A;  4BE2 A;  4NBS A;  4XLA A;  3HOW J;  3F22 A;  3GXO A;  2BXZ A;  2KDO A;  5FKM A;  1PJ7 A;  1ZUN B;  1CLW A;  2PJR B;  1IJE A;  3S15 J;  3FF5 A;  3FHN A;  4QLC U;  3IWF A;  1RNL A;  3RYP A;  5TJJ A;  3CCS I;  2IGN A;  1YI2 B;  2UUZ A;  2W4S A;  3CUQ C;  3IH4 A;  4M9X A;  5CVJ A;  3S3N A;  1MMD A;  5LGN A;  1LEB A;  1KJZ A;  1NDH A;  4X06 A;  3OYC A;  1LB2 A;  3OYK A;  1WJC A;  2FE3 A;  3OYJ A;  2DPD A;  3OYM A;  3JRE A;  3OZW A;  3R0A A;  4WQM A;  4WZE A;  3CQZ J;  2K9N A;  3DLA A;  2NVQ J;  2CFX A;  1VQO B;  1W4M A;  5HLT A;  5FLX Z;  2QQA A;  2B9S A;  1BPL A;  4MYU A;  1FBU A;  3ZQI A;  4X7C A;  3GZ6 A;  5CJ9 A;  1YG2 A;  2CJJ A;  1ZM9 A;  3I56 B;  2FX0 A;  4A3E J;  3FKI J;  1DPU A;  4HE5 A;  3GQ7 A;  2O6W A;  3CF2 A;  4KIB A;  4XRS G;  3QPS A;  3OIP A;  4MQV A;  3TMO A;  5LRS A;  3LNQ A;  4GGG A;  1JHF A;  2KZG A;  3NWS A;  3CXC B;  1ODD A;  3H5N A;  2R7Q A;  4RM2 A;  3V7S A;  1D5Y A;  3V8K A;  3BPV A;  2QSG X;  1VJS A;  4BBR J;  5TRD A;  1L0O C;  3MHP A;  3DEU A;  1X2M A;  4PJN A;  2R7Z J;  3Q6Q A;  1RMG A;  3EUA A;  2WJY A;  3B78 A;  3OOC A;  3U9G A;  3M3Y J;  2H1K A;  1MBF A;  3WTX C;  2LR8 A;  2XTW A;  1O8I A;  3PJR A;  2WR8 A;  2W25 A;  4CIC A;  1P4M A;  4V02 C;  1X58 A;  3CJR B;  1XS9 A;  2QF7 A;  2XAF A;  4XLC A;  1K61 A;  4MQ9 F;  1K5C A;  2CRG A;  3ES9 A;  2DFF A;  3ZR8 X;  1VTN C;  1NBM A;  3OPO A;  1TTT A;  4D9J A;  5JVG F;  1IB4 A;  4OAY A;  2KKO A;  3R0J A;  1LDK B;  2QEX I;  3ZBU A;  4F3Q A;  2L7K A;  1OCZ H;  1GO2 A;  3HG9 A;  4B3F X;  1BBY A;  4JX4 A;  5DCM A;  3K0L A;  2GRE A;  3H5A A;  3OE7 A;  2JJ7 A;  3N4M A;  1SFU A;  2GWR A;  1PDN C;  2DCE A;  1I6H J;  5DD8 A;  1XE1 A;  2EIK H;  2XPW A;  3CCQ I;  1KC8 D;  3W6J B;  4HQE A;  4KFC A;  1KYZ A;  1Z21 A;  2PYH A;  1XSD A;  1HZE A;  2D9R A;  1ZGW A;  3I53 A;  2J7K A;  1WU8 A;  3PIP F;  1XQB A;  2D3L A;  2CS3 A;  4UAJ A;  4JRA C;  3JCU C;  4D5C A;  5FNZ A;  3HOZ J;  1AHD P;  5DS0 A;  3FMS A;  3PNT A;  4BEH B;  1LUJ B;  3W2W A;  2VFP A;  1TBX A;  1ZN2 A;  4BUP A;  2GQF A;  1O8D A;  2VQG A;  2OBP A;  3OR2 C;  4L0Z B;  3CD6 I;  1WSV A;  3H94 A;  2LBF A;  3F23 A;  1QJV A;  2Y31 A;  5FL7 A;  1T0F A;  3BR0 A;  3H9G A;  3W2V A;  1FEX A;  4C2M J;  1WJE A;  2PJP A;  2RC6 A;  4MEX F;  3S17 J;  1GQ8 A;  2HXO A;  2V79 A;  1F5T A;  2OCC H;  1FTZ A;  1ZM4 A;  4KNY A;  3PQK A;  4OOV A;  1OFD A;  1BW6 A;  4PSW A;  3CCE B;  4IJA A;  3ZBT A;  4R8H A;  1Q1H A;  3SYJ A;  2WZN A;  2B0L A;  2XB0 X;  4A3L J;  1Y39 A;  1W0U A;  2DTR A;  1N0V C;  2WAE A;  2KRC A;  2OBR A;  2QSF X;  3W5H A;  5B6I A;  1VF9 A;  3E5U A;  2XB5 A;  1FDR A;  3NAW A;  4F93 B;  4DIQ A;  1ZYR F;  2EB7 A;  2MA3 A;  1NH3 A;  3ZC3 A;  1MMN A;  1R58 A;  1NHA A;  3MCZ A;  1K4S A;  3H09 A;  2JUC A;  5CKT A;  2E2I J;  4RDU A;  5C4J J;  3BCD A;  3RI4 A;  1W9X A;  3VOE A;  1T2K A;  1BC7 C;  1AKH A;  2HOE A;  3UKG A;  3ELK A;  3Q0V A;  2X0K A;  1YJW B;  3K70 D;  3FMR A;  4JX6 A;  2JSC A;  1E3H A;  1QX4 A;  2VOD A;  2X3H A;  3TOB A;  1AIP A;  4M73 A;  4DNT B;  4PC7 A;  2JUG A;  4ZCI A;  3TW6 A;  4G1V A;  3KZI C;  3CB4 A;  1J5Y A;  3PFY A;  2V5I A;  3DU5 A;  3EQN A;  5HDK A;  4OMY A;  5HNH A;  2VOO A;  1GVJ A;  2V4D A;  1O8K A;  2KIM A;  2XGD A;  3KYC B;  3WXM A;  2FJ1 A;  3DLL F;  1RZ4 A;  3K10 A;  2OD5 A;  4A3B J;  2NXN B;  5L3B A;  2VFM A;  1EH7 A;  2HYG D;  4Z4T A;  2P8T A;  3R4K A;  4M9Z A;  3HGY A;  2LD5 A;  4LB5 A;  1KRH A;  3PSI A;  3OY9 A;  1S7O A;  1CF7 B;  2M0C A;  3GEZ A;  4ZC3 A;  3BTJ A;  2LG4 A;  3A2K A;  2EWN A;  3GQ9 A;  2FRH A;  1U5T A;  5HS8 A;  2IXS A;  1UEL B;  2KHM A;  4A3G J;  3A1Y A;  3BY6 A;  3LFU A;  4FWT A;  4P22 A;  3T9G A;  5HOD A;  4RB3 C;  1P4X A;  1ZG1 A;  3E6D A;  3QU3 A;  2HDD A;  4KKS A;  1V5V A;  3DKY A;  2VJI A;  3SQN A;  2PMH A;  5BS6 A;  1BM9 A;  3DFG A;  1MNM C;  4B4C A;  4M3B A;  3CC4 I;  4RD3 A;  4NHJ A;  3K9T A;  4W97 A;  2QQB A;  4FE4 A;  3VFZ A;  1SKQ A;  2STW A;  1JRG A;  3L9F A;  3LQR A;  1VQM B;  2FNA A;  4QPQ A;  1H8A C;  4I02 A;  5DD4 A;  1YHQ I;  2BV3 A;  2COM A;  3PNY A;  2A5Y B;  3QWL A;  4M0L A;  1ZG5 A;  3WGH A;  2M5W A;  2OQG A;  3OIO A;  1QUF A;  4Z4V A;  3QFS A;  3M4O J;  1WPC A;  1S72 I;  2E34 A;  1J9I A;  4C43 A;  3IRR A;  2OTL I;  3SXY A;  5DDG A;  4G12 A;  4C0S A;  2QCO A;  4MEY F;  4YAO A;  5FRM A;  4Y17 A;  3T8R A;  2DEU A;  2W7Z A;  3LYC A;  2DT5 A;  5C1C A;  2X3U A;  2LF8 A;  4P9S A;  3WWG A;  2V7V A;  1IRG A;  2K27 A;  4FHT A;  1ETK A;  3LJY A;  4JX5 A;  4EM0 B;  2EFW A;  1W36 D;  3K4J A;  2KLO A;  1IGN A;  3ZOB A;  1N25 A;  1KCD A;  2BHY A;  4WK8 F;  1ENH A;  2A07 F;  4HPQ A;  1R1V A;  1E79 A;  1PXZ A;  2DOG A;  5M5W J;  2CYY A;  2WYR A;  2NV4 A;  2X1E A;  2QTZ A;  2JA8 J;  2WJV A;  1PVE A;  3GFM A;  4L8J A;  3RCO A;  1K6O A;  2CND A;  4Q48 A;  5KVR A;  3CC2 I;  4HE6 A;  4IF4 A;  4PJJ A;  4KT6 A;  2VXZ A;  4UUT A;  2DA5 A;  3GTG J;  3A8I A;  3FX3 A;  1AMO A;  3TO9 A;  1K28 D;  4XSX F;  4XBF A;  1C0W A;  2BW3 A;  3RKW A;  1WSR A;  2LC2 A;  4RD0 A;  1OPC A;  3RPQ A;  1KYW A;  4NCN A;  2DN0 A;  1O8E A;  1ZK8 A;  2GZW A;  1VQL I;  2VXD A;  3BJA A;  3A35 A;  2NZM A;  2X1D A;  3OJW A;  4CCJ A;  4NC8 A;  3JAM Z;  4LK0 F;  2XRO A;  1W0T A;  1VLY A;  1K4Z A;  3TOA A;  2M8G X;  2M2E A;  3IKV A;  3CME I;  4UB8 C;  4C30 A;  3MKZ A;  5EDN A;  1A36 A;  5E3L A;  1DU0 A;  4XKW A;  4IO9 F;  4YRV A;  3W2G A;  1BLI A;  3W6V A;  1Y0N A;  1XGS A;  2CQX A;  3JQR A;  1KZL A;  3CMM A;  2QM3 A;  4DW6 A;  1F60 A;  1LFB A;  3C2B A;  1B2R A;  2R7V A;  4CUG A;  1KK0 A;  2HVS A;  3K1P A;  3FM3 A;  1SD4 A;  2KL4 A;  2ECC A;  2R7X A;  4ZGN B;  3U1D A;  1DDN A;  1SEU A;  5KHD A;  5F0H A;  2DOD A;  3I9V 2;  2XRL A;  1NRK A;  3WE2 A;  2B5O A;  4OM9 A;  1V55 H;  2E5Z A;  4TMW A;  3MZ8 A;  1ON2 A;  1R36 A;  1RUO A;  3PO3 J;  5L46 A;  1APL C;  1E3O C;  4DQL A;  1QA1 A;  2OA4 A;  1JKQ C;  2CUZ A;  3LST A;  3S3O A;  1YW9 A;  2F43 A;  3AG4 H;  4UB6 C;  3ZMT A;  2PE3 A;  1YOV B;  2JPB A;  1DU6 A;  5F64 A;  1R5O A;  1HDD C;  4ZYE A;  1XGO A;  4LLG F;  1VFC A;  2W48 A;  1TYU A;  1RIO H;  1OCT C;  2V1X A;  2VBX A;  2BZT A;  3AG2 H;  3P9K A;  5EYR A;  4ZDL A;  2VNH A;  3N6Z A;  1YW7 A;  4II2 A;  1UD5 A;  1WPK A;  3WHB A;  2XZP A;  3F21 A;  3HZJ A;  4I6Z A;  3G6E I;  1MMA A;  2XUB A;  2FD5 A;  1RQR A;  5B1B H;  5J40 A;  3CCJ B;  3L2V A;  3FIS A;  4AYB A;  1HA8 A;  4KH3 A;  4XD7 A;  2KRF A;  1Y0U A;  5GP9 A;  3SZE A;  3Q0W A;  1YS7 A;  1OCC H;  3RPU A;  4BAC A;  3X2Q H;  4I2O A;  3FY3 A;  3AST A;  1KU9 A;  2BVL A;  2EFG A;  1KK2 A;  2QA4 I;  1CGP A;  4NC7 A;  4XLE A;  2A05 A;  3FXL A;  1FWZ A;  4K2E A;  4Z4U A;  1X1C A;  5BNG A;  1R22 A;  1SMT A;  2K3P A;  1BR2 A;  3KE2 A;  5C44 J;  4A3C J;  1PJ5 A;  2CW5 A;  5BMZ A;  2CO5 A;  2OPT A;  2XDV A;  3HPG A;  2HFH A;  4NQW B;  3VOD A;  4LLL A;  5GTH C;  3PEN A;  4ZZL A;  4Y9U A;  4O6J A;  2FML A;  3BR2 A;  5M5X J;  4P3I A;  3BR1 A;  2DOE A;  1MSF C;  1FSE A;  3BG7 A;  2AHQ A;  3S1R J;  3TGN A;  3RTR A;  1O8F A;  3MMY B;  2P5K A;  3AG3 H;  5DM6 F;  3GVJ A;  1SD6 A;  5GAD J;  1Y6I A;  3KEW A;  1ETV A;  2P3M A;  1XC5 A;  2DA3 A;  2FU4 A;  4LD5 A;  5JHF A;  4B43 A;  2X0L A;  2BY3 A;  4OJ6 A;  3H5R A;  3RPU D;  3RQI A;  1XB4 A;  4HLY A;  4CYD A;  4BHB A;  5HKK A;  3MQ0 A; 
#chains in the Genus database with same CATH homology
 2ELJ A;  3OYH A;  4XLF A;  1OHH A;  3OEH A;  2R7U A;  1UD4 A;  2ODL A;  4TKO B;  2V4J C;  2CUJ A;  2IGO A;  1V0E A;  4E7H A;  2LY2 A;  4BDZ A;  2D3N A;  2UWM A;  4OZY A;  4F52 A;  2BOL A;  3HPH A;  1G8X A;  2X85 A;  2VIX A;  4E0F A;  2WA0 A;  2KP6 A;  3OS1 A;  2JSP A;  4PMH A;  2XND A;  3L2Q A;  1IDK A;  2UV1 A;  2V1N A;  4BE1 A;  2GJP A;  2WB1 A;  3VSK A;  4BJT A;  2WY7 Q;  1QHG A;  2JVG A;  2O5R A;  4BJ6 C;  4JQF A;  2R7S A;  5FRO A;  2XZL A;  4ZJZ A;  2EWE A;  4OJ5 A;  2KRH A;  3H9Q A;  4W8R A;  1V0F A;  3VSU A;  4DK0 A;  2Z1D A;  1D0Z A;  3BH4 A;  3I3L A;  3NWT A;  1KTW A;  3HUG B;  4PK4 A;  2Y0S A;  2F1M A;  3S32 A;  1JTA A;  2NTB A;  2VAS A;  1COW A;  2DT6 A;  3IUO A;  1FMW A;  2LBF B;  1K6Y A;  3LSG A;  3OFN A;  2NT9 A;  4MR0 A;  2CFO A;  4XN0 A;  2ZZG A;  3OYB A;  4U49 A;  3DPU A;  1UD2 A;  5HVQ C;  4W8S A;  2M4K A;  3OYF A;  4X0G A;  2W6I A;  1H8E A;  2V9K A;  2UVE A;  3VR6 A;  4B44 A;  3GQA A;  2GOX B;  3G2B A;  2L9N A;  3FKJ A;  2QE7 A;  2X6X A;  4IX7 A;  2OC6 A;  1X1A A;  1GLN A;  2IGM A;  4GRI A;  3VYR B;  1MAB A;  4YZ0 A;  4OJO A;  3A4C A;  4ITV A;  1X19 A;  3EQO A;  3VMV A;  2V7F A;  1FX0 A;  2HVR A;  1N77 A;  2V6E A;  2ZTN A;  2I8D A;  2HQA A;  4LG3 A;  4CA0 A;  1WP6 A;  1Y56 A;  3A3G A;  3UNG C;  4DNR B;  2X51 A;  1X4P A;  5KNL A;  4UZU A;  2ZZF A;  4GQN A;  4G6T B;  4E7Z A;  1UD3 A;  1VF7 A;  1IRX A;  4U7B A;  2VKD A;  2E5N A;  3EUK L;  4XLH A;  3S93 A;  3NE5 B;  3IP4 B;  3BC8 A;  4G7X A;  1O88 A;  4CCO A;  2F4I A;  2W1O A;  1E3Z A;  4HG2 A;  2WAQ A;  1UAA A;  4BL0 B;  3ZIA A;  1WJ5 A;  2JA2 A;  3ONQ A;  4QPO A;  1NG7 A;  1R6R A;  3K4M A;  4KKU A;  1P9Q C;  1OFM A;  3OS0 A;  2O0W A;  2QXZ A;  3HAG A;  4J00 A;  3A3B A;  1SFK A;  1MND A;  5LFA A;  1D0X A;  4FET A;  1QHH D;  4ZDO A;  2INU A;  2K9L A;  3AFH A;  2MAB A;  4PFO A;  4HNU A;  4XOR A;  2CV2 A;  4XM3 A;  1VZ0 A;  4BE0 A;  3OL4 A;  4B3G A;  2BSP A;  1PYV A;  4I84 A;  4BE2 A;  4XLA A;  3S3M A;  3T51 B;  2XGJ A;  3E1S A;  3ZQQ A;  1YX3 A;  3OIQ A;  2KDO A;  1H80 A;  3LSM A;  4DJA A;  1X1D A;  2HPM A;  1NHC A;  2PJR B;  3HXL A;  1V5E A;  2PEC A;  4URR A;  3FHN A;  1N78 A;  3DWL E;  3LMM A;  4KKT A;  2IGN A;  3T56 B;  2UUZ A;  1WJD A;  2W4S A;  2IGK A;  3OWT A;  4OWR B;  2RNG A;  3S3N A;  4BGD A;  1MMD A;  3AKZ A;  5FRN A;  5CQE A;  4D1Q A;  3K4L A;  2R9V A;  4HIZ A;  4C9Y A;  2O1D A;  3ZGK A;  3OMY A;  4E7K A;  3IAM 2;  2L5Q A;  3OYC A;  3OYK A;  2LZJ A;  1WJC A;  4P5O A;  3G05 A;  1RWR A;  3DKX A;  2WBM A;  3OYJ A;  4CCN A;  3OYM A;  1LVK A;  3K4B A;  1SAU A;  4OJP A;  3RSN A;  1O8M A;  1I8D A;  1IDJ A;  1XG2 A;  3DLA A;  4E7I A;  4BU2 A;  5HLT A;  4MLO A;  2VQC A;  4KIT B;  1BPL A;  3FKS A;  2VPL A;  1UD6 A;  1WJA A;  4PJL A;  3KYL A;  2Z16 A;  4DGW B;  1T95 A;  2HVQ A;  2LRE A;  2ZXI A;  3MKY B;  2O04 A;  2X53 S;  3EUH C;  3GQ7 A;  3QYF A;  4OJL A;  1UG0 A;  3CF2 A;  4TT3 A;  2QKL B;  3OIP A;  3TMO A;  2M0M A;  3OW7 A;  3NWS A;  4YZQ A;  3H5N A;  1J09 A;  2R7Q A;  4RM2 A;  4AU7 A;  5IK2 A;  1O8H A;  1VJS A;  4G7W A;  3KEY A;  4PJN A;  2JJ1 A;  4FXU A;  1EE6 A;  5LD2 C;  3EUA A;  1O8L A;  2WJY A;  1RMG A;  2W7N A;  3LSI A;  3OL3 A;  3OOC A;  2LH9 A;  3E0J B;  1WJF A;  2LOO A;  4HST A;  2DT7 B;  4PUS A;  1O8I A;  3S8P A;  4DK1 A;  4XR6 A;  4YEJ A;  3PJR A;  3CJQ B;  3D5S C;  4BXF A;  2MYS A;  3CJR B;  3QYB A;  4Y4R A;  3SYT A;  4N4O B;  2DJI A;  4XLC A;  1E1Q A;  2NTQ A;  1K5C A;  3ZR8 X;  1NBM A;  3OPO A;  2Z6B D;  4D9J A;  3C2H A;  1IB4 A;  4OAY A;  4BJ5 C;  4XKC A;  2XSJ C;  1LDK B;  4DBQ A;  1LFP A;  1E0E A;  2V31 A;  4F3Q A;  4DOZ A;  2L7K A;  3OYE A;  1VBL A;  1BOB A;  4Z1M A;  3HG9 A;  4U4B A;  1CZF A;  4B3F X;  3K4K A;  3H5A A;  3OE7 A;  1BN8 A;  4XKV A;  4Y3O A;  4EAT A;  2DCE A;  4ZYA A;  3RQ4 A;  2IS1 A;  3J7A Y;  2BW3 B;  3DTK A;  4KJZ A;  4ZDP A;  4XN3 A;  3VYS B;  3OYG A;  2CH0 A;  2GK6 A;  3VMW A;  4W8T A;  1BMF A;  1OR7 C;  1Z21 A;  4YXW A;  2PYH A;  1TZL A;  4LIV A;  1HZE A;  2ZTG A;  2INV A;  4IQ4 A;  2VLA A;  3L2R A;  2D3L A;  2CS3 A;  3H9J A;  2R7R A;  1X4O A;  1WTH D;  3DU6 A;  3LMW A;  3PNT A;  4BEH B;  2NSP A;  3GRH A;  2ZSI B;  3W2W A;  1MNE A;  1G59 A;  4BUP A;  1O8D A;  3ZRG A;  2VQG A;  4BS9 A;  1I18 A;  3C2G A;  2P0W A;  3OR2 C;  5HOO A;  2VQL A;  3GBG A;  3H35 A;  2LBF A;  2IS2 A;  3H94 A;  1QJV A;  5FL7 A;  3H9G A;  3W2V A;  2WSS A;  3L2U A;  2CV0 A;  1WJE A;  1GQ8 A;  2PYG A;  1HG8 A;  4KIS A;  2VBE A;  2JDI A;  1DQU A;  1D1B A;  1O8J A;  3OYI A;  2WPD A;  1U0J A;  3SEQ A;  3OYA A;  2Z8G A;  4PSW A;  1WMR A;  2L9S A;  3D5R C;  4CSW A;  1AA7 A;  4MXN A;  4HEA 2;  4BEH A;  2K9M A;  2XF6 A;  2XAU A;  4B3X A;  3AL0 B;  4Z03 A;  4CH7 A;  2WAE A;  2KRC A;  3ZPN A;  3B90 A;  1BHE A;  3UR3 C;  2E1B A;  4R79 A;  4TSF A;  2QY1 A;  3ZPP A;  1OLT A;  4F93 B;  4DIQ A;  4Z05 A;  3VWB A;  3N05 A;  3OOU A;  3QYE A;  2DXI A;  2Q2E B;  4NK6 A;  1MMN A;  1OB0 A;  2DOA A;  4PFP A;  2CK3 A;  1SKY B;  5CKT A;  1KCC A;  3BCD A;  2RRE A;  1W9X A;  1EA3 A;  3ZXS A;  3K6G A;  5DN6 A;  4LIT A;  1OGO X;  3HKZ A;  4ZTJ A;  3K70 D;  4CCM A;  3LL7 A;  4CCK A;  2GJR A;  2X3H A;  2W82 A;  4XOP A;  2HLD A;  2WAF A;  3CP8 A;  2V7Q A;  4DNT B;  2W6J A;  4ASU A;  2JUG A;  1QCX A;  2X6Y A;  2R7W A;  1OFL A;  2MD0 A;  3SZG A;  4RLQ A;  2JIZ A;  3PFY A;  1T0F C;  3EQN A;  3DU5 A;  2QX3 A;  1WFX A;  3K70 C;  2R7T A;  5HNH A;  4F92 B;  2V4D A;  2HZD A;  2MC4 A;  1O8K A;  1KON A;  2VKH A;  2OUM A;  5AMV A;  3K10 A;  1YE9 A;  4XNF A;  1PKV A;  2HNH A;  1D1A A;  2VJ5 A;  3PSI A;  3OY9 A;  2ZXH A;  3QOE A;  4ZC3 A;  3DTI A;  1Z3Y A;  2LG4 A;  2NOJ B;  1KMH A;  2XC7 A;  2PJR A;  3A2K A;  3ZSC A;  5TGT A;  4Z06 A;  4RLF A;  3GQ9 A;  2IXS A;  1UEL B;  2KHM A;  4DBR A;  3L2W A;  3A1Y A;  3LFU A;  1W0J A;  3HL2 A;  4Y33 A;  3T9G A;  3HC7 A;  3QOD A;  4P22 A;  1D0Y A;  4PSX A;  2QKM B;  2WY8 Q;  1FMV A;  2VJ4 A;  4IQJ A;  3GVL A;  4KKS A;  1MMG A;  3DKY A;  2VJI A;  3VDX A;  4RM3 A;  1QU3 A;  2V26 A;  3DDY A;  2O17 A;  4E4H A;  1DGW Y;  3VYT B;  5CPR B;  3T53 B;  2XZO A;  3W3C A;  3TL4 X;  3AL0 C;  2GK7 A;  1JRG A;  4OZZ A;  1DBG A;  3OS2 A;  4QPQ A;  3HOS A;  2HU9 A;  3PNY A;  3B8Y A;  3BCA A;  3ZCO A;  3LNN A;  1WPC A;  1PJR A;  1PLU A;  3BLY A;  3DEE A;  3UW0 A;  2X1C A;  4XQF A;  3OYL A;  2NTP A;  4B47 A;  4BQQ A;  2ZZQ A;  3VSV A;  1S9H A;  4F55 A;  4E7J A;  5FRM A;  3K4N A;  5C1C A;  2X6W A;  4XON A;  2JJ2 A;  3WWG A;  3PNV A;  1EFR A;  1HVX A;  2KPM A;  1MW7 A;  2IQ7 A;  1AIR A;  2M7B A;  4B48 A;  3EPZ A;  1W36 D;  4J01 A;  3K4J A;  1N75 A;  1LKX A;  2KLO A;  4C2T A;  1E1R A;  1KCD A;  2WAD A;  3GQB A;  3WQZ A;  4HPQ A;  1NG6 A;  2FUG 2;  2E1M B;  2CV1 A;  1E79 A;  1BR4 A;  2K5C A;  4NK8 A;  1PXZ A;  1X0C A;  2LRD A;  4XOT A;  2LYC A;  2X1E A;  2BVM A;  2R7O A;  2WJV A;  3OYD A;  1ZEL A;  1W36 C;  2M5S A;  4L8J A;  3RCO A;  4FAS D;  2E60 A;  2Q1Z B;  3MKW B;  1E3X A;  2F5V A;  2M3A A;  2O0V A;  4PJJ A;  4XMY A;  4KT6 A;  2VXZ A;  3D5L A;  2WZP P;  3B4N A;  2NST A;  3K4C A;  2CW8 A;  4YZA A;  3M1C A;  1K28 D;  4U87 A;  2BW3 A;  3DTE A;  1YX5 A;  2LC2 A;  3IAS 2;  4YEL A;  2AQF A;  1O8E A;  3H0D A;  3VYU B;  2X8K A;  1W0K A;  3A35 A;  2VXD A;  1DBO A;  3DQV C;  1UD8 A;  2NZM A;  2X1D A;  4CCJ A;  2IS6 A;  2R4G A;  4NC8 A;  1VLY A;  3GQ8 A;  2OV7 A;  3TBI A;  3M8J A;  4PJM A;  3CZ6 A;  1H8H A;  3KX2 A;  3PUB A;  4C30 A;  2CW7 A;  3MKZ A;  4IKF A;  4RMN A;  4NNJ A;  4XKW A;  4YRV A;  3V42 A;  2GOM A;  4XKB A;  1BLI A;  2F6C A;  2ZFU A;  2A5W A;  1IA5 A;  1KZL A;  3CMM A;  2L2O A;  3SUC A;  2DIE A;  4H4K C;  4JMQ A;  1O8G A;  2W00 A;  1E43 A;  3BC9 A;  3OYN A;  2R7V A;  3GVK A;  2VBM A;  4CUG A;  2HVS A;  3PSF A;  3OR1 C;  4P1W A;  2Z2S B;  4HRI A;  2KL4 A;  2R7X A;  4BDY A;  4NUB A;  4F91 B;  3W2A A;  2XOK A;  2ZSH B;  5KHD A;  3I9V 2;  1NRK A;  2VQH A;  4E7S A;  1X1B A;  2E5Z A;  2AQE A;  1TT0 A;  3U21 A;  2RQQ A;  2CUZ A;  2F43 A;  3S3O A;  2IS4 A;  2JVH A;  3DPT A;  3F9K A;  4JOM A;  2CMP A;  2KVO A;  3OEE A;  1BR1 A;  4II3 A;  5HNF A;  4BQO A;  4N4N B;  4HWV A;  3BCB A;  4ZDL A;  1V5F A;  1UD5 A;  4II2 A;  2NT6 A;  2XF5 A;  2XZP A;  5CDF A;  1T5E A;  2E1M C;  1MMA A;  3CP2 A;  1WJB A;  3L2V A;  4AYB A;  1HA8 A;  3FBI B;  3BCF A;  4BQN A;  2ZZE A;  4XD7 A;  3FPP A;  3FDY A;  2GJK A;  3SEZ A;  1D1C A;  4BAC A;  2VL8 A;  1OGM X;  4W8Q A;  2A6T A;  3FY3 A;  3KRG A;  2BVL A;  3LSK A;  4C2U A;  2UVF A;  4C2L A;  2MFZ A;  3FBN B;  4NC7 A;  4XLE A;  2HPI A;  2KQR A;  1X1C A;  3MD2 A;  4G6I A;  2K3P A;  3DPL C;  1BR2 A;  1Z3X A;  2M7A A;  3PL8 A;  4IZZ A;  2XDV A;  2KZV A;  3HPG A;  4LIU A;  4NQW B;  3HOT A;  5KCM A;  3LSH A;  3JUR A;  1JI8 A;  1DP3 A;  3VST A;  2M4G A;  3SDB A;  4CZC A;  4HSR A;  1ERD A;  3OAA A;  3BG6 A;  2LY1 A;  4YZX A;  2VB6 A;  4OAZ A;  2PMZ A;  4E6K G;  3BG7 A;  4E7L A;  3CES A;  1V5G A;  3JU4 A;  3RTR A;  4CCL A;  5CQG A;  2VJJ A;  4AVZ A;  1O8F A;  3MMY B;  1OOC A;  1DGR M;  1PE9 A;  4ANJ A;  4HNT A;  3GVJ A;  1Y6I A;  3KEW A;  1RU4 A;  5C1E A;  1Z7L A;  4EW9 A;  3VSL A;  2KMU A;  4XL9 A;  5JHF A;  4B43 A;  4OJ6 A;  3H5R A;  2XF7 A;  3RPU D;  2HDW A;  5HKK A;  2VBK A;  4ZTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...