4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
2VJIA 1O8GA 4XM3A 5C1EA 3VSTA 2UVEA 3VSUA 2NSTA 3VMVA 4U49A 2O0VA 3VMWA 1O8LA 1NHCA 3UW0A 4OJLA 2INUA 4OJ5A 2NT9A 3B90A 4OJ6A 4YEJA 2UVFA 1KCCA 1VBLA 2X6YA 2O04A 1H80A 4YZ0A 1O88A 1X0CA 1O8JA 4XLFA 4XLEA 4XOPA 1IDJA 4XKVA 4PMHA 2QXZA 2NTBA 4XL9A 4NK8A 3B4NA 4I84A 1RU4A 2ODLA 1EE6A 1WMRA 4W8TA 1O8MA 1QCXA 2X6WA 4OZYA 2NTPA 3T9GA 4AVZA 2Z8GA 3SUCA 1O8HA 5C1CA 3GQ8A 1IA5A 4OZZA 1BHEA 3WWGA 4XNFA 4W8SA 3KRGA 2QY1A 1AIRA 2PYGA 4XN0A 1O8DA 3B8YA 4XMYA 2NZMA 1O8FA 4XN3A 1OFMA 1QJVA 2PECA 1IDKA 2VBEA 4MXNA 2X85A 3EQOA 4XLHA 4W8RA 1KCDA 3GQ9A 1JTAA 1O8KA 1OGMX 3FY3A 4EW9A 4Z05A 4YZQA 1PLUA 1OGOX 4OJPA 1IB4A 4XQFA 1JRGA 1O8IA 1PXZA 2VJJA 1XG2A 4U4BA 4URRA 4YZXA 2NT6A 5AMVA 4XORA 1HG8A 1BN8A 3VSVA 1K5CA 4MR0A 2NSPA 1O8EA 2PYHA 3ZPPA 1OOCA 4XLAA 4XR6A 1GQ8A 2X6XA 2QX3A 1RMGA 3LMWA 3ZSCA 1OFLA 2IQ7A 3GQ7A 4Z03A 2EWEA 2X3HA 1DBGA 3JURA 2O0WA 4XOTA 2BSPA 1PE9A 3GRHA 4Z06A 4XLCA 4OJOA 2VBMA 2VBKA 1RWRA 1CZFA 3EQNA 3GQAA 2INVA 2NTQA 4HWVA 4XKWA 4NK6A 2O1DA 4XONA 1DBOA 1KTWA 4YZAA 2O17A 4C2LA 4YELA 4W8QA
chains in the Genus database with same CATH superfamily
3KP3A 2VFNA 2WJVA 1SVLA 4IRGA 1LJ9A 2UVEA 3PSFA 4IRHA 4FISA 4O3MA 2VFQA 3ZN1A 2EWNA 1MNMC 2E7WA 3CCVI 3EUKL 2K9LA 2CC2A 2WBMA 2JK3A 1JJ2B 4OJLA 3QQAA 2A6TA 3BCBA 3Q0UA 2LBFB 3QAHA 5B1BH 1DUXC 2LRDA 3VO2A 1VBLA 3CCYA 2VQGA 4UVAA 5JLWA 2F1LA 1VQPB 1X2MA 1T98A 3ML3A 3U2QA 2L54A 5LHIA 4II3A 4CDGA 5CVRA 3TKYA 1ITYA 4YALA 2KPMA 1RQPA 2HYGD 2PN6A 1LE8A 3D26A 4V02C 3WTYC 5CYVA 1WJ5A 2D2WA 2WV1A 3DXJF 1QRYA 2JTVA 2F4IA 2C6YA 5HZBA 1BN5A 5D5VB 4J19A 3T5XA 4KNYA 3I5UA 3CUQB 1O3QA 1FEXA 1YS6A 2DMUA 2EILH 2XF6A 3RQIA 1IN8A 2WR8A 1DP3A 4RGRA 3OYGA 4MTEA 1FBUA 4M6XA 1EJ9A 1HCRA 4E6KG 2L4MA 1K28D 1H85A 3JQQA 2E1RA 4A3BJ 4PUSA 3G4SB 3CPWB 3DQVC 1E3HA 2EBIA 2P6TA 2NS0A 3ZPLA 3PO2J 2H6CA 1H0MA 4G94A 2E1BA 3HUGA 3E0JB 3IH4A 5JMCB 1LKXA 3ECHA 1OHHA 2F48A 2L02A 5AIPA 2PEXA 3VOEA 1QA2A 1BOBA 3BTLA 3EETA 2OC6A 1B6AA 1R4MB 2M3AA 2BY3A 3OOCA 3KZIC 5BOXA 4YRVA 4PJNA 4E0FA 2FNAA 5IYWA 4AUXA 4FETA 4OJPA 3PUNA 4DBQA 4QPOA 1JRGA 2A5YB 3ZQQA 1QX4A 3BTJA 2WYRA 1HSJA 1VQ5B 2XPUA 4HOBA 4URRA 1JT6A 3Q0WA 3AG1H 4J01A 5DYMA 5B66C 2OBSA 3F23A 1BPLA 2XRLA 4LB5A 1EFUA 1O8EA 1I6XA 5F4JA 4OIOF 1JJ8C 1UFMA 2HPMA 1Y6IA 4FQGA 3CCJI 4KDPA 3B78A 3RPQA 3SKBA 1ZGJA 2QDXA 3LVBA 2QQBA 4OIRF 2R7ZJ 3HL2A 2BZTA 4BL0B 2XRNA 1RQRA 1LFUP 4Q5SF 1ERDA 1KD1D 2VNIA 2FEZA 3I56B 2XGDA 2CBXA 3BR1A 5EEHA 4BUPA 1A31A 4I2OA 3I0TA 4E7SA 1W0JA 2CO5A 5F1RA 1WJEA 5JLVC 4DNRB 5GADJ 3B6CA 2LNBA 4QPQA 3VPRA 4DZPA 1J75A 4GQNA 2PMDA 5E20A 1BLIA 2KVOA 4M2LA 3CJQB 2ETHA 3I55I 3IUOA 2VN2A 5D6FA 2UUZA 4YDTA 1IN7A 3Q5FA 2V7VA 1BIAA 2ISYA 4MIMA 5EDNA 1E62A 1UMKA 4AC0A 2ZKZA 2BF4A 3H3UA 2NSTA 3GEZA 2Q2EB 3CCLI 4XKBA 4U0WA 5CQEA 1PJ5A 3LSIA 3VMWA 3ONUA 4ESBA 2VE9A 3ISPA 4FTHA 1W0KA 4JX4A 2GREA 1UD8A 4P6VF 1XG1A 4OJ6A 4YEJA 3WNBA 4G5GA 4EJVA 2VBUA 5EZGA 1FX0A 2Z99A 3HB9A 3ZGKA 2YU9J 1ZM3A 2IA1A 3CUOA 4PCQA 2CW7A 5K5QA 2ZNYA 1SFUA 1O3SA 1Y0YA 1B8IA 4Y52J 3W2EA 3GFLA 3OYBA 2VLAA 4LIVA 2DYRH 5KCMA 4HNUA 2UV1A 4B43A 3DPUA 5L3DA 2NS8A 2BPOA 4X07A 1E43A 4QWQA 2L9VA 1TT0A 3BOQA 4HSTA 1VQ4B 2LYCA 2F1MA 2WSSA 4B3FX 1IHMA 3HEFA 1OR7C 3PNTA 5K5RA 1BIBA 2VBTA 5E3MA 1QCXA 2V7QA 1BC7C 4G1BA 5IT9K 4RLZA 4YC5A 1KMHA 4E7KA 1FSHA 2ZJ2A 2EZIA 2KFDA 3WE2A 2LY2A 1XFOA 2B7BA 4LBYA 4UAJA 4ACBA 4B4DA 2K3PA 2ECBA 2LFBA 2J5OA 5ED4A 2QBYA 2K85A 1TLLA 3NWSA 2EFWA 3F0CA 5CJ9A 1AWCA 2OTLB 2HQRA 1UG0A 3J7AO 2ID6A 5A8AA 2KL4A 3ASOH 3DBLB 5GPCA 1QPIA 1E63A 1H8EA 3G1MA 2K4JA 3K4MA 4YEIA 4KICA 1TYXA 2EIJH 3BCDA 5DUIA 3JREA 2DDBA 5DM6F 4XLHA 1TBXA 3OWTA 2VODA 4DIQA 2CV2A 2KZGA 1ETOA 2VPLA 3A3BA 2A68F 3LYCA 1GJRA 2BXZA 2HR3A 4O6JA 2P7CB 3WNDA 4DOZA 4ZYHA 4B47A 1FBSA 2WJYA 4EM0B 4XIDA 1I50J 1ZG3A 1VQNB 3E5QA 4M3FA 3DTKA 2F2EA 5IT9Z 3VSVA 5GAEJ 1FDRA 2KDZA 2HYFA 1N06A 2M34A 1BJAA 3A8IA 1BC8C 3LSKA 4UUVA 1FYLA 2GXAA 2MW8A 1BW6A 4AIJA 4TSFA 4V19K 1TNSA 2QENA 2QZ8A 2FRHA 2BV3A 2IQ7A 4OM9A 3BY6A 3ZMDA 4P1VA 3GQ7A 4Z03A 4AIKA 4C3HJ 2DCEA 3K4JA 3ULQB 1I3AA 5HLHA 2BSAA 2FX0A 4HE5A 1R71A 3Q3SA 4CCNA 1ZYRF 2YUSA 4JQFA 3QSYA 5GP9A 1MBKA 1NG7A 2XAGA 4YIRX 2VBMA 1RETA 1ZREA 3EQNA 2KIMA 3N4MA 4LG3A 3F22A 1E1RA 4RDLA 4OMYA 3CCJB 2CH0A 2IAIA 2L01A 2AXTC 2B7CA 1QQIA 1T6SA 4BKXA 1FIAA 2E2HJ 2NV4A 1I18A 4U87A 2A6HF 4YELA 4BYYA 2L5QA 3I54A 3R6SA 2IP2A 5M5WJ 3MVPA 2HCJB 4M71A 3IAM2 3JAMZ 1FYKA 4A2UA 4BBRJ 1RUNA 2PQ8A 3K6GA 1CNFA 2X0LA 4BJ5C 3HPHA 4UNOA 3V76A 3W5UA 3EUHC 1ZKGA 1VQMB 1D8TA 2M4GA 4BXFA 2NVUB 4U49A 3N05A 3PVDA 3OIOA 2MLGA 2ICWG 3SQNA 3OSFA 2Z5UA 1W36C 1TT5B 1Z05A 1ZR4A 1KCCA 3FIWA 2QEXB 1VQLI 2BVNA 2O04A 3SQVA 1OQYA 1QHGA 2K9SA 3A01A 4P26A 2K9NA 2PI0A 3SLNA 5HS9A 2F43A 3DLAA 2VNHA 3PJRA 3DPLC 4WXHA 3G4SI 3M8JA 2NTBA 3GCMA 1S72I 2JA8J 1WTHD 4A3MJ 3B4NA 2X1CA 3CCUB 2ODLA 3F8NA 4PGGA 3OYIA 4IW3B 2HEOA 3PUMA 3N6ZA 4UB8C 3GX4X 1MDMA 1HOMA 3CCEB 2F5CA 5FKLA 2XTXA 2FBHA 2F5FA 4ETSA 3OYKA 2EZLA 1XB4A 3LA7A 3SEQA 1NDHA 4ZGNB 5B1AH 1VTNC 4D7NA 4ZYEA 2V1UA 5CVUA 4HV5A 2LLKA 4P9FA 3PSIA 4XICA 5IYNA 4Z4UA 3E1SA 1WPKA 4MYTA 3U1KA 4RLQA 4IOCF 1T5EA 2GK7A 3M8EA 4AVPA 3WGHA 3S14J 2WWYA 2IJLA 3OYMA 4L0ZB 1FNDA 3T8TA 1L1IA 1VNDA 3E7LA 4Y9RA 4HDVA 4B4CA 1TP4A 3M9AA 5K1YA 1XB2A 5FLXZ 2BX6A 4LLGF 1SD6A 1OKRA 2NNYA 1H8AC 1OFEA 2DT5A 3CZ6A 2VZLA 1O8KA 1FLIA 1ORKA 4UHTA 3J7YJ 4CA0A 2XF5A 5A88A 4X7DA 1ODDA 2FA5A 3FHNA 4HX4A 3TEDA 2W84A 3F6OA 4XRFA 1DDGA 2XAQA 3LL7A 1R22A 1MBGA 2Q6LA 3ZQHA 4MR0A 3ZXSA 2KP6A 3BZ6A 2BM7A 1R1UA 3HOXJ 1Y0RA 1XMAA 3K1PA 4NQWA 2VT3A 4JYKA 3MHPA 2HYJA 2DN0A 4RB2C 3VODA 4M3BA 3LSRA 4YFXF 1F20A 2V7UA 5F4OA 1ZM4A 1IXSB 2JRTA 2HNHA 2EV0A 2VBZA 2GJPA 2M4KA 1EA0A 3K1NA 1SFEA 4A3EJ 1JNYA 2C2WA 4EV0A 5E3NA 1XE1A 2FXAA 4HAMA 1Q81D 1MSEC 1ACIA 4EJTA 5EYRA 2CQQA 2VBKA 1VQKI 5E17F 4S04A 5HDKA 1HDPA 9ANTA 4ENJA 4HWVA 1JA0A 4PK4A 4RAZA 2V7XA 2MH9A 2HOAA 1KU7A 1I7PA 4A3FJ 1T6XA 1IJEA 4YZ0A 2EV6A 5DM7F 1VQ8B 4P5OA 2VFPA 2L4AA 1O3RA 3DBHB 1N0VC 2I10A 1HSTA 4UV8A 3A0HC 1BJKA 2B0RA 3K4LA 5GTHC 2ZNZA 4ASNA 5LMZA 3RSNA 4XRMA 2WAQA 5DD8A 3CC2B 3ZPNA 3HOVJ 3MKYB 3KYLA 4U88A 2M8EA 2RNGA 5L3CA 2XPVA 4I0AA 4FE7A 4BAYA 2ZL7A 2DQRA 3BG7A 1HBXG 5FO0A 4G6IA 4JK1X 1ZG5A 3BJOA 2V4JC 2BY1A 2R4GA 3F3XA 3HBLA 3K4CA 4ZTFA 2XT4A 2W4SA 5IYBJ 1P4WA 1RPWA 4A3KJ 1ZGWA 1COWA 3F8BA 4XKVA 1Z6TA 3C7JA 3MFKA 3S1MJ 3WG9A 1IDJA 3BH4A 4PMHA 3E6MA 3JRCA 3SJPA 1KYWA 3ZQFA 4KT5C 4A0ZA 3DV8A 4I0BA 1XCVA 2NVTJ 1XMXA 2BHYA 1EP1B 3MCZA 2Y48A 1WRJA 3GMEA 2GJRA 1VQLB 1QZZA 1EE6A 3SLDA 5BMZA 4PC7A 2K27A 3RDIA 5IYCJ 1IN5A 4A5MA 1LQ1A 3OR1C 4M4SA 5TR9A 5KHDA 1BL0A 2J8KA 3OYDA 1YTYA 3NB2A 5DS0A 2H27A 3B73A 3V7SA 1S9HA 1BM9A 2Y75A 5DSZA 4E7HA 3J80Z 1JGGA 4MYUA 3QFRA 3DEEA 3A02A 3PL8A 4PC6A 2ZCWA 2E2JJ 3GF2A 3V7CA 3BQYA 4XN0A 1E79A 3S1NJ 3E1YE 4RM2A 3PA1A 2XC7A 1P92A 2V7TA 4OP7A 1CQTA 2X85A 1EP2B 5JI6A 1VQ9I 1EFCA 4PFPA 1JTAA 1TL8A 3A0BC 4L8JA 1HKSA 1S8NA 2RQPA 1GAQA 3KZYA 1O8IA 3AAFA 3CCRB 1OYYA 4YIFA 2L2OA 1MIJA 3Q39A 1MBEA 2XIGA 3WQZA 4HDUA 3H9GA 1OYIA 1OCOH 4WWCA 4FX4A 1IF1A 2HOTA 2CFXA 4OPOA 1HA8A 2Y0MA 2PMZN 3LQRA 4XLAA 3IH2A 2QBYB 5CKTA 1GVDA 3M1CA 1G7RA 3BR6A 4HF2A 4ZZDA 1OFLA 1XSXA 1IV8A 3LSTA 1CGPA 4QSHA 5FA6A 1Y0UA 2YU3A 4QIWN 2EWEA 1MJ9A 2ZC2A 3OW2B 1D3YA 1T08B 3U2RA 3ZMZA 2NVQJ 4TMWA 3HKZN 4RGUA 1Z91A 2DK8A 1VQOB 2BOLA 2M1BA 2Q1ZB 2PIAA 1P4AA 4R1HA 2W24A 4AD9A 1XPXA 3H9NA 4RS8A 1GAWA 2ESHA 4EJOA 5B6IA 2INVA 1BI2A 1D0XA 3NE5B 4ENNA 4Y9UA 2V7FA 1PJ6A 2B0LA 3H5NA 2LP0A 4XKWA 2W00A 1DBOA 1KTWA 1ON2A 1DG1G 3QPHA 4YZAA 3TDZC 2WA0A 3HGGA 1KU3A 1U8BA 1XC5A 3FXKA 3RPUD 1HVXA 2DFHA 3J81Z 3K2AA 1VQ6I 4ZCLA 4ITVA 4CSWA 5FLVA 3HTSB 2RC6A 4ZCMA 2X1DA 3DKYA 1FT9A 5J3LA 1WJDA 4P9SA 3W5HA 2R5ZB 4JRAC 5IYDJ 4M9XA 1SFXA 3GVAA 1I27A 3B90A 2R7DA 3CCQI 2XT2A 5KK1A 2C77A 2JT1A 4CCLA 2AXLA 5KVRA 3WTZA 2Z9OA 1X0CA 4F7DA 5EMNA 3N90A 2GOMA 3BWGA 4MEYF 3FXOA 2VQCA 5BS6A 3OFNA 4XLFA 3VNVA 3ML6A 4H0EA 2LDUA 3VYSB 1LLZA 4PABA 3O6BB 2A61A 1QRCA 4LITA 4R79A 2KIQA 4BE2A 2OBRA 4F92B 4IHWA 3GTQJ 2L3DA 1RIOH 1JKOC 2KQRA 2VPRA 4A6EA 1QGZA 2C78A 4YZQA 2KLOA 2V6EA 2R0QC 1ZQ3P 4P3IA 4UZFA 4OZYA 2BM1A 3FM3A 4YAUA 3KX2A 1QBJA 3RQ4A 3S16J 1USTA 1PJ7A 3BC9A 3T9GA 2HVSA 1OLTA 3V42A 2H09A 2DY1A 1IXRC 2DYSH 4JMQA 1H42A 1JTXA 5J6XA 4G7ZF 5FO1A 4YFKF 1Z21A 1SFOJ 4X0CA 1TWGJ 2EZHA 4PJMA 1W0UA 2WZNA 4PC2A 2XF7A 1D2EA 3KYDB 1YI2I 4N4NB 5FD5A 2YPRA 2F6CA 4LLNA 3LAPA 3OY9A 2D74A 1UB9A 2ZXWH 4XMYA 2JRMA 2D5VA 1K78B 4UZEA 3F8FA 4XN3A 2PECA 2W25A 1BR2A 4H4KC 4CCJA 3TO7A 4RDJA 4D1QA 1IDKA 3A8KA 3JX8A 3QYEA 1LEBA 3GSIA 4NB5A 2FMLA 4CCMA 3EQOA 3W2FA 4ZV4A 4W8RA 1N77A 1USSA 2D1HA 3FY3A 1YRNA 3U9GA 2ZZQA 2IPQX 5BSXA 3DF8A 1S7OA 1OCPA 3JRBA 1NJID 2NT6A 2VFOA 2KIUA 3S8PA 3DU5A 2J5PA 2JZYA 3F6VA 2C5HA 2EIXA 2CJJA 5L3GA 2XPWA 4BHCA 2GJKA 4B3GA 2DT6A 4ZZLA 3HSEA 2TCTA 3CC4I 1WXRA 4MLOA 2XGJA 3L2VA 4C2UA 2O8XA 2L9RA 4Z4VA 2CW8A 4E70A 1E3OC 2R5ZA 2ESNA 1WSRA 3LMMA 3RJPA 5HDGA 4KIGA 2R7RA 1DU6A 4ZYAA 1W7PD 3GIRA 3C2BA 2E2IJ 2MABA 3L9FA 2R5YA 3F72A 4OJOA 1G2HA 1AHDP 1WSUA 4IJAA 3ASRA 3QP6A 2LKPA 2IS1A 4YCQA 1PDNC 3C18A 3F8CA 3I4NJ 4XD7A 4ZC3A 3LFKA 3M3YJ 1SKYB 1GR1A 3BR0A 5CVVA 5D5WB 4C2LA 2FQ3A 5ICFA 1KU9A 2A05A 3MZYA 4KISA 5F0CA 4X7FA 1OCRH 1E3PA 4RLFA 4XM3A 1UHMA 4LD5A 4KFCA 4G8XA 4ABZA 3SJMA 1OFCX 2OZUA 3VMVA 1O4XA 1DDIA 2AHQA 5FGMA 5FKNA 2VIXA 1O8LA 1J7KA 2LY1A 1NG6A 3W6KB 3PO3J 3I64A 2G0EA 1F4KA 2GK6A 1GVJA 1G3YA 4HV6A 3KEQA 1IO2A 3H09A 3JSPA 4CCKA 3BG5A 1B72B 1IRZA 2HTJA 4C30A 3TP3A 4RPBA 2V1DA 1KQ0A 3M4OJ 3WHCA 3OR2C 1Q1VA 4UUSA 3D5RC 1TYVA 1HLVA 2P5LC 2KHMA 3GUDA 5JVGF 3T53B 1BR4A 2BVMA 4CZCA 1O7FA 4BBSJ 3W2WA 2O6GE 1XSDA 4UXNA 3QPTA 2H1LA 1KK2A 2DA1A 2LKSA 2LOOA 1VHEA 3DWLE 2ZZGA 3LO8A 4CXFA 2XEXA 3SHFA 1G3SA 2E5ZA 2M45A 2DOGA 3CXCB 1D0ZA 5HZAA 1R6RA 3H0DA 3GTKJ 2HVQA 3CUQC 1QRBA 2E1MB 4WXCA 4A0XA 4E4HA 3AKZA 1SAUA 3H92A 2DQLA 3SFZA 3AVWA 1RKWA 5E1WA 1O7LA 1FC3A 1MH3A 3CP8A 2ADUA 5F27A 4ESJA 2BGJA 1ENHA 1EH7A 3ERMA 4AF7A 2HWVA 1ETQA 2CNDA 3KP2A 2BV6A 2PYGA 4DK0A 5L3EA 4DNCA 1O8DA 2ZFUA 2V7WA 3CCSB 4U7DA 4JOMA 2CQXA 4RAGA 2RKHA 5IPAA 5K7ZA 4MXNA 2QGUA 2VC1A 2LF7A 2O7OA 4F7ZA 4KMUX 4CGZA 2JA5J 5KW9A 2VJ5A 5E79C 1ZAOA 1S4MA 3CMAB 4X05A 3IH3A 2YWGA 3I53A 4G6TB 3K10A 4ZDLA 4DBRA 3I56I 3S17J 1KQSB 2M5WA 2BW3A 2VJ4A 1PKVA 2HLDA 1D8KA 5EJCA 1D0YA 2QX3A 1B1BA 3G73A 3G2BA 3GXOA 1T39A 3H5RA 2LY9A 2RC4A 1I8DA 1R5HA 5F6FA 4EGYA 2CG4A 2ZBUA 1WFXA 1G8XA 4M3DA 4UZUA 3KPHA 3QOPA 2Y9YA 1QA3A 2BM4A 4P1WA 1RR7A 1T38A 4FXUA 1FIPA 1TWFJ 2QSHX 5IY5H 3LSPA 1R00A 4KA4A 1TQIA 1RWRA 1D1NA 5EEGA 2HOSA 1OYWA 3MKZA 1UD6A 3BPVA 4DQKA 1OFDA 4A3JJ 4IKFA 3G1OA 2X8KA 2BW3B 4G7OF 4M6VA 4ENMA 4LBZA 4D7MA 1N07A 2KDOA 1T95A 2ZZEA 4AYBN 1EH8A 4KKSA 4GYGA 5C1EA 4G12A 1F1ZA 1ZK8A 2ECCA 3W2VA 2BVLA 4EATA 3LQEA 4FE4A 3KP6A 2MD5A 1A04A 4PDKA 1SMTA 3MZ8A 5IP6A 1DU0A 2R7SA 3ZBTA 2Q0OA 1MBHA 2L0KA 1Q86D 3P9KA 3HSRA 1E3XA 1Z3YA 2JN6A 1YW7A 1WJBA 2M0MA 3OOPA 1UHSA 2CUEA 1UMQA 2FBKA 3SZGA 2ELJA 2XGXA 1QGPA 1WH5A 2DFEA 1ZR2A 2COMA 3NRVA 5IK2A 1VLOA 4XOPA 3CLQA 1X4OA 3QPLA 1UD4A 4UV9A 1U5TC 3TGNA 4LK0F 5B3SH 1JGSA 1LDDA 5L3FA 2BN4A 2QQAA 1RU4A 3ZN0A 2LZJA 4A6DA 1IUFA 5HLGA 2WTEA 3ZMUA 5FD6A 1VQOI 4YAWA 2B5OA 1H89C 2HS5A 2P0WA 4BHPA 1EZGA 1P9QC 2DLLA 1VQPI 5HOOA 1IJFA 1UELB 3PETA 4Z4ZA 5LLQA 3OYCA 3JQRA 3CF5F 2NOGA 1QQ1A 3GTOJ 2Y2ZA 6PAXA 5J35A 3QODA 3SUCA 5DUKA 4EM2A 3N97A 4Z4TA 1OGJA 1R5GA 4OWRB 3TQNA 1D1BA 3DFGA 4OZZA 3PUFA 1WJAA 2EFGA 3E20A 4UUSB 4FX0A 2DU9A 2KJBA 4IO9F 2X51A 1U0JA 5GPAA 3B6AA 4PAAA 5AIQA 3E5XA 1BBYA 5JHFA 5LHGA 3U6BA 4ZGQB 2NZMA 3D1NI 3V8KA 2M9HA 2X53S 2OU2A 2WZPP 5HXBA 2EFPA 2MC4A 1W0TA 4AYBA 1R58A 1U8RA 1POGA 2IBDA 2PE3A 2Q6IA 1OGMX 1R7JA 2VE8A 3HOUJ 1JTYA 2HOEA 1U6GA 4GDFA 2XASA 4B3AA 2HDDA 2IA0A 2DI3A 3WGIA 3Q6QA 4XLPF 2FMYA 2DAOA 3O8HA 1F9NA 2RVCA 2L7ZA 1JB9A 4XORA 3CB4A 2EK5A 4RM0A 2H8WA 4A3LJ 1K5CA 2E71A 3Q0VA 3RKQA 1SAXA 5LGTA 1RI7A 2DA3A 1APLC 4LJZF 1KQ5A 1BW5A 1X1PA 4TKOB 2QUFA 1KU2A 4G1VA 2QKLB 2M30A 3H3ZA 3A8JA 1S7EA 5KAFC 1RMGA 5BPDA 4Y4RA 2IXSA 4IQJA 2CQNA 4I7HA 4PC1A 2E5NA 3VMFA 2JMWA 3C2GA 2K40A 3V7RA 2CMPA 3CDLA 3FXLA 4M0LA 2X3HA 1WH7A 5E8IA 1Y39A 1JJ6C 1IXCA 1UG2A 1T6YA 2DJIA 3FMQA 1PE9A 3K2ZA 3KEYA 3TOAA 4KJZA 2WC2A 1U78A 1YX3A 3BH7B 1MABA 3CD6B 1UD2A 3H36A 1FBQA 4P9UA 2O61A 1Z67A 2KISA 4PJLA 2H6BA 3CLOA 2XZPA 5LHHA 3UR3C 1XS9A 4RMNA 2Y31A 4O5VA 2HMAA 2JJ1A 4QLCU 3D5SC 2QTLA 4P12A 1MMAA 3BY2A 1ZRDA 2BGIA 3G71I 2VONA 1YW9A 3KIOA 1XX5A 5TGTA 4G9YA 3JR9A 3S3MA 2UWMA 2QMUA 3ONYA 1OB2A 3T0YA 3T8RA 1CQXA 1A6IA 3O8GA 4Y15A 1Z6RA 3RYRA 1FNBA 1PUFA 4MNUA 3BPXA 3CDHA 2AQFA 2ELHA 1YYVA 4L5IA 1YQAA 4YIIA 1IJWC 3VYUB 2R7WA 4CHUA 3OP1A 3CTAA 4RB0A 1BOAA 3BR3A 4IF4A 2XB0X 3WGGA 3Q6RA 1R1TA 1VQ6B 5FRNA 1JT0A 2DYIA 1JA1A 5H6RA 1QZEA 5F04A 4XLEA 2D3NA 1QVUA 1MGTA 4V2GA 2DPDA 1D5VA 2IGKA 1YOVB 4Q7JB 3CMMA 1B9MA 2XGEA 1FOXA 3JTGA 5JFRA 3HOYJ 4WWVA 1IN4A 3A4CA 3WY9A 3HZJA 3I59B 3TW7A 1LDJA 3HXLA 4E7JA 1OCZH 2JSCA 5FIUA 4NUBA 2BE5F 2VNKA 1NB9A 4HW0A 2M5SA 1L3LA 4MFDA 3OPOA 2JA7J 1DARA 5M5XJ 2G9WA 2OCEA 1CNEA 4M9ZA 2GOXB 3BC8A 1MKMA 3S1QJ 2H8RA 2HXIA 2OUMA 5CVIA 1YITB 5HKKA 1IRGA 4HIZA 3QYFA 3Q9SA 1BHEA 4FK8A 4OPWA 1K4ZA 5IYRA 4OIQF 2DK5A 3A01B 3E6DA 4HSRA 2GLOA 3GLLA 3KYCB 3Q9VA 2FX3A 1AIRA 1B2RA 2CUJA 2NOJB 2JWTA 3GZ6A 3RPUA 3IRRA 3K9TA 4KIBA 1JKRC 2VBWA 2A3SA 3G1LA 2Y0SN 5BPIA 3V7AA 4RM3A 5FLMJ 2M7AA 3H9QA 2ME6A 4M74A 3VFZA 3CCEI 5TY0A 3W2IA 3RIQA 1BR1A 1AIPA 2EJRA 2XKOA 3FDYA 3OAAA 1SD5A 1H88C 4E7IA 2CSOA 3P26A 1YJ9B 3AGPA 4E7LA 1D1CA 1LDKB 2DXIA 4BY1J 1ZM2A 3MZHA 3DCFA 3K0LA 4EQQA 2VBVA 3OW7A 3GLXA 3ZCOA 1QU3A 4HF0A 4G7WA 4N4OB 3M1EA 2X48A 1XGNA 3COAC 3FMSA 4PGHA 2DA5A 2CK3A 2DA2A 3EDPA 3ES9A 1AKHB 1R5BA 4R8HA 4XSZF 2NSPA 4OAYA 1OOCA 4M72A 1ZTRA 3CMYA 1ETYA 2P5KA 3DKWA 4KN7X 1QFZA 3L7WA 4KYWA 2HZDA 2D3LA 2DEUA 1K61A 4WZTA 3H94A 1GO2A 2KRCA 2XNDA 2NNNA 1RESA 3FBIB 1FZPB 2O5RA 3H0GJ 1O57A 2NVXJ 3MWMA 5KAIC 2N8GA 1YITI 2NRAC 2P8TA 3QFSA 1VQ9B 2Y0SA 3CP2A 5FKKA 4I6ZA 1NK2P 2PLYA 3QFTA 1MJAA 4FN5A 2KZVA 3DEUA 3QU3A 1T2KA 3ZMTA 2JJ2A 3WTVC 2DJNA 3O3KA 3BG9A 4Z4WA 5B5EC 1W34A 3AVTA 2LK2A 4AU7A 2JPBA 4FT8A 2OK8A 4LBVA 1X3ZB 2NYXA 3CMEI 3KFWX 1KZHA 2EB7A 2QE7A 3PSZA 1X58A 3VYRB 3CJRB 2ZO4A 5H5JA 2P81A 1MBJA 3SZTA 4B48A 2Z1DA 1W36D 1V0EA 3P27A 1MNDA 2HGCA 5F0HA 4WZLA 4IX7A 4PJ0C 4P25A 3A1YA 1MDMB 2BM0A 5ICCA 4ZTJA 4C0SA 2L7MP 2OPTA 2XNCA 5GAGJ 4J0QA 4X6AJ 1QUEA 2PJRB 3HOWJ 5FROA 1FY7A 4IZZA 1PP8F 2BEOA 3ABKH 1BI3A 4D5FA 2HTSA 2V79A 3BR2A 3WU0A 1YRNB 4AM3A 3GZNB 5J8CA 4AIHA 1TVCA 2VBYA 1V5FA 1G3WA 4BQNA 1Z0XA 2RN7A 2QCOA 2W1OA 1EF4A 2VB6A 5K7FA 4NC8A 1OPCA 1GHCA 2OCCH 2OZ6A 3SDGA 3J7ZI 1VQ8I 2DTRA 4N9IA 4NQWB 5FNZA 4KH3A 2OQRA 2B7EA 2VQHA 1FNMA 2B9SA 2AHOA 4ZYDA 2PMUA 4RBOA 1YHQB 2I5UA 1PVEA 5LFAA 1N8RD 2F5VA 1G6NA 2WAQN 2MBFA 1QVTA 1ZARA 3BJ6A 3CJNA 3WXMA 4R71A 2CUFA 5ERIA 2HXOA 4P6YA 3M07A 3CW2A 5M3FJ 2XTWA 2NTPA 5E18F 2B63J 4Z4RA 4W97A 1HF0A 2W82A 5E8GA 2EQRA 1S29A 5THXA 3GYHX 1T0FC 1J2XA 1YW8A 3ZQIA 4BDZA 3QWLA 3WODF 4B44A 3K4KA 5TRDA 1P4XA 2CW0F 3AVXA 2JIZA 3TO9A 1K83J 1O8FA 1KTVA 1OFMA 3OYHA 4Y17A 3GWZA 3FX3A 1NH3A 1IG7A 1DDNA 2W6IA 3JU4A 5K7HA 1QNTA 2YS9A 1QGYA 1QHHD 4EW9A 2R5YB 4RCZA 4ZDPA 2V9VA 5FJ8J 1KQ8A 3L2UA 3FJOA 1HW5A 1CLWA 1PXZA 3GZ5A 4YZXA 1EV7A 2KIFA 3M8FA 3UNGC 2GQQA 2Y69H 1E64A 2P5VA 4G7XA 4HE6A 4QFMA 2E34A 3BT9A 1OCTC 2DFIA 1HG8A 1S6LA 1YO5C 4X8IA 1MMGA 3IP4B 1HW1A 1WJFA 3C2HA 3CPXA 4WXDA 4EJUA 1S72B 2M7BA 3AVVA 2EH3A 3HC7A 2XV4S 2XAHA 1T0FA 3ZSCA 1T8IA 3ABLH 2LMDA 1TQMA 3EUHA 5IYQA 3K4BA 5L46A 2O0WA 4XLNF 1IDYA 2BSPA 4BEHA 4CICA 2F4NA 2EFQA 4NC6A 4I76A 3ZQGA 4G7HF 3OEEA 4LFUA 3HGYA 3G71B 3H5AA 1SKQA 2KRFA 2K02A 3HKZA 4B3XA 1WP6A 4M3EA 4KKUA 1LFBA 4JBAA 4U0VA 4LC0A 1WI9A 4XONA 4V2FA 3I55B 1W5TA 5ILVA 2WADA 3VSLA 4BDYA 1Y8QB 2Y9ZA 3L00A 3HRMA 5BNGA 1SC7A 3HG9A 4ZDOA 1ZLJA 3ZZTA 3DLLF 2V6CA 5DCFA 1KC8D 3HPGA 5GAHJ 3I59A 3JRDA 1TYWA 3SXYA 3BP8A 1FYMA 4OOXA 3AVYA 2Q8KA 4IHYA 2O0VA 2ZL6A 1X1AA 4OPSA 1NHCA 2DMTA 1R5NA 3MEXA 4WZEA 3NEUA 3MCAA 4I09A 2QSFX 1OB5A 3HRSA 4NDLA 2W7ZA 4IEJA 3CCUI 3E5UA 1X3WB 4A3DJ 1FMVA 1O88A 1YJWI 3U21A 3CC7B 4U0YA 3TDUC 3GBGA 4ZYGA 3K70C 3ECOA 2EFNA 1IGNA 4RPDA 4A3GJ 3WU1B 5FL7A 1L0OC 4HPQA 3X2QH 2BYVE 3BR5A 1MMDA 5CLSA 4PSWA 1EFRA 2G0YA 2IGNA 3BCFA 3DTIA 2PG4A 2VXDA 2JA2A 1XMKA 5HLIA 4ZH4F 4WF2A 1W5SA 4B1RA 2CRGA 5CVJA 5F08A 3AFHA 3BH6B 3BLYA 2KKOA 1BI0A 2DW4A 2H1KA 1KK3A 3ZP5A 1B4AA 2HDWA 2VASA 1KRHA 5D4RA 1OB0A 2EIKH 4XSXF 3LSJA 5C1CA 3GQ8A 1ZHFA 3NWTA 5IT3A 5M5YJ 1IA5A 3CD6I 2JA6J 4XNFA 1K7AA 3OIQA 3R60A 2IA2A 3MD2A 1JHHA 2D45A 3MMPA 4K2EA 4F91B 1MRZA 1PJRA 3I4PA 4HBLA 1GV5A 2XHKA 2VNJA 3AG4H 2OTJI 1ZG1A 4BH9A 3CDIA 3ZOBA 5HVQC 1OJLA 5HNHA 4X0GA 1KCDA 3M7GA 1G59A 1WKMA 3QFCA 2R7FA 4IXAA 2TRTA 3FMRA 1IV6A 3RZOJ 1LLWA 1W5CC 2JUCA 1FPQA 2VJJA 2BMWA 1M1KD 2XUBA 3L09A 1AKHA 3QYBA 1VHOA 2STWA 4BNCA 5K5OA 1K4TA 3JAMK 1BN8A 1LE8B 2E1OA 2DOAA 2V5IA 3LNQA 2O8KA 5ILUA 1QGAA 4EM1A 1DABA 2DMPA 3UKGA 2UZKA 3OJWA 1XGSA 4MHGA 2VQLA 2K9MA 1ELOA 1BA5A 1QG0A 2CRVA 3I4MJ 3JRGA 3DPTA 2CWEA 4ENKA 1F43A 4XOTA 3CCVB 3FF5A 2GBYA 4WCGA 3JRIA 1E2XA 1FOKA 2R7UA 2RAEA 1XD7A 3K69A 2QWWA 3VR6A 4HG2A 1CZFA 2Z6BD 2MFZA 3AK5A 1U5TB 1G3TA 1N78A 3PUBA 4II2A 1JUMA 1ZN2A 2DBBA 3S1RJ 1IB0A 3IWFA 1I5ZA 3S2HJ 1J5YA 2BM5A 2DOEA 3J7AY 1ZLKA 5A89A 4JX5A 2BXYA 2Z3YA 1H9TA 1U2RA 4LG0B 4LK1F 2MSYA 4LB6B 2QF7A 5D6EA 3D5LA 5H6QA 4DYCA 2VBSA 3L2QA 3HSFA 4RB3C 5ILSA 3RKWA 4CQJA 5M3MJ 3ZUGA 2XNJA 5E6TA 2FSWA 2QKMB 3BG3A 2DFFA 4GRIA 2DA6A 3G6EI 2ZMEC 1FSEA 2X1EA 3LSMA 2ZJPF 1GDTA 4IHXA 1MJBA 3AG2H 2M2EA 2QQ9A 3FKSA 5DN6A 2R6HA 4NBQA 1ZRFA 5EZHA 1ETKA 4HEA2 3VSKA 3CMAI 3KL9A 4NNJA 2GXGA 4D9JA 3OL4A 4JP0A 2PFBA 2R3SA 4AIDA 2C4TA 4W8TA 4C2MJ 1O8MA 1Y1WJ 4Z4SA 2HQ5A 3BTCA 3H35A 4P22A 3WBJA 4M3GA 2QEXI 5L3BA 4FHTA 2EINH 3CCSI 5JBQA 4XRSA 4AVZA 2FQ4A 2Z8GA 5IP9J 5C44J 3GFJA 2DT7B 3GW2A 3KZZA 1YHQI 4UVBA 5GV7A 4HLYA 3SZEA 3RIRA 4HZFA 3WTXC 4U7BA 3A3GA 1QA6A 2XAUA 2HDNB 1X19A 3HUGB 4GGGA 3JRAA 2X3UA 3WWGA 3KRGA 5J4YA 4DZJA 3R61A 2ELKA 2XDVA 5HODA 2V26A 3B8YA 1UHWA 1X1CA 4Q47A 2P6SA 4HLXA 1Z9CA 1DQUA 4M9SA 2L9NA 4C2TA 2RC5A 2VBEA 1YLOA 2BBYA 3SYTA 3OJXA 1WCMJ 4KN4X 5FKMA 3NARA 1FNCA 2R7OA 1N25A 2JQ7A 2MD0A 4M6YA 4XKCA 5D5UB 4EH1A 5EGOA 4L9TA 4BS9A 1FNNA 1SD4A 1MH4A 3BG6A 2WAFA 2CF4A 3J81k 3P9CA 3CMEB 2XGCA 4UY8I 3GTPJ 4P2NA 3WYAA 3ABUA 2FVGA 4CYDA 1HW2A 3LMWA 4BJTA 1JUPA 4KITB 2R7XA 1KA8A 2Y30A 1WHUA 5J1RA 3WTUC 2IT0A 4AWXB 4GXOA 4L18B 1BX0A 3R4KA 1WOPA 1X1BA 1G7TA 1ONVA 5LEJA 2BGCA 1YIJI 3KCCA 5HLTA 1WVRA 1VQNI 1KK1A 3FHZA 2ZTNA 2NVYJ 2OA4A 1UAAA 1R49A 1WSVA 2Z16A 4N3GA 1VQ7I 3OIPA 2QM3A 3OYLA 2ZJRF 5FLXK 1AMOA 1BI1A 2YX7A 4P3YA 3AG3H 2VYQA 3VB2A 3JCUC 4NK6A 2O1DA 3LNNA 5LEKA 3JRFA 4J00A 2A6EF 1NHAA 4YAFA 2WV0A 2XB5A 3BZKA 3PENA 1IW7F 2ME0A 1FP2A 3CF2A 5E3OA 5AONA 2ISZA 4UUTA 3HM5A 3HRUA 2FNPA 1JKPC 4TMVA 1K8AD 2BHZA 4X7EA 4UVCA 2E19A 3VYTB 4BACA 2IVMA 3I71A 2VOPA 3HJEA 2ZTGA 4QV2A 3JTHA 1EP3B 2WB1A 3ZBUA 1LVAA 3S3NA 1QVFB 2ZL5A 3KE2A 5HNFA 2UXXA 3ONQA 1DP7P 3KEOA 4EMSA 1QVGB 4DYQA 2DA7A 4L9NA 1QPMA 4A3CJ 2X6OA 1FOWA 1QZYA 4RGSA 1IN6A 2E60A 2QVOA 2QSGX 2XAFA 1OISA 3WE3A 2QXZA 5EEAA 3EYIA 3BCAA 1ETWA 1WGXA 2W85A 3IC7A 4RD0A 3T56B 2RQQA 2XZOA 1Z7UA 1R1VA 5KNLA 1KGSA 4PC3A 1VJSA 1UZCA 1V4RA 2EA4A 5DEQA 1RZ4A 3MMYB 3RCOA 1MZBA 3GVKA 2X6WA 4EVIA 4RD1A 3W2HA 3BTIA 2LBFA 2F4MB 1W87A 3AGQA 2HI3A 4BGDA 1LFPA 2KT0A 3HHGA 2RGVA 5EGOB 1MMNA 3SY2A 3WTTC 2ZMEA 3QOEA 1U9NA 3ISXA 2C5BA 4P55A 1WZ2A 1BMFA 4F93B 1R9TJ 2O03A 2W6JA 3DKXA 4QVJA 1P7JA 4B8XA 4Y7CA 1Q7YD 3W6VA 5IOYA 1J09A 1ULYA 4YFNF 2JN9A 2I1LA 1S5LC 4MQ9F 1T56A 3ERED 4CO8A 2E1CA 1TSPA 3PSSA 3IL2A 1HXDA 2PMHA 3CRZA 2LF8A 2W57A 1W7PA 3OE7A 4BU2A 4Y3OA 2CV1A 4A5NA 3V8JA 1WORA 3DP7A 1U9OA 3RYPA 3FBNB 1PLUA 3HAGA 3JSOA 1X2NA 4RDUA 2LG4A 1G7SA 3P9IA 1IRXA 1R4NB 3G05A 2PMZA 3AL0C 2VKEA 3ZMSA 1WU8A 1A8PA 1SMYF 2MLKA 5LGNA 3ZQLA 1NK3P 3LQ6A 5DS9A 4KMFA 4A93J 1GQ8A 5H59A 3DBRB 1XDSA 3ABTA 3ESWB 4CUGA 3LOCA 3BNWA 1WOOA 2CUZA 3TMOA 3K4NA 2PBIA 3T1BA 4ZJZA 5HS7A 4IOAF 2DCUA 3HOZJ 2PJRA 4LLLA 4BHBA 5DCMA 1OGIA 1Y8RB 1YG2A 5ICGA 3GRHA 2GWRA 1LPQA 3FXJA 3VDXA 3J80K 5E1ZB 2QA4I 1EWYA 1WPCA 1GXQA 3A1PA 2K7LA 3REOA 3OKXA 3KP4A 1HDDC 3PFYA 2XSJC 4TMTA 4RD4A 2J7KA 5F4MA 2VXZA 1GVHA 4DJAA 1O8GA 3IRQA 1KYZA 5D4SA 1TW3A 4C9YA 3VSUA 1VQ5I 4BE1A 2DMNA 2MC3A 3FM5A 2V31A 3L1PA 3TO6A 3UW0A 2HQAA 3FXQA 2FD5A 4BEHB 3OYJA 3KETA 1TWCJ 2X6YA 2K5CA 1H80A 3OEHA 3WTSC 1I3QJ 1MBFA 3DTEA 4OPVA 1ZELA 4PSXA 4HRIA 1YE9A 1YS7A 4BPRA 3MKLA 1V5VA 3PNVA 2ZBVA 2NAZA 1WWXA 5FO5A 1SFKA 2OF7A 4HQMA 5FFXA 2OQGA 4ESFA 3OS1A 3VNUA 3R0AA 1H9GA 4NK8A 4RB1A 3SYJA 1JXSA 3TBIA 1PP7U 4W1UA 2R7TA 4X7CA 1X3UA 4Z6YA 3QRFF 2O3FA 2MG4A 3J81K 1FOYA 2VKHA 4HYEA 4KIFA 5FB2A 3OS2A 3IKTA 3RKXA 1CF7B 2IGMA 3QP5A 3MAJA 1V5EA 5JR3A 4L5JA 3IHUA 2LD5A 1IAWA 2OJED 3S2WA 2QYOA 4MQVA 3ASTA 2HDCA 2I8DA 2XTYA 4QHYA 4BXUA 2R7QA 2GA1A 4DW6A 1DPRA 1RC9A 4F52A 4NBSA 4W8SA 5D5XB 3P5JA 4I99C 1GXPA 2LTPA 3FXRA 1UCRA 3WG7H 4LG0A 4Q48A 3FXMA 3HOTA 4IHTA 3P4GA 1V5GA 3ZQCA 1X1DA 3S2DJ 1STZA 1Z7LA 2E1MC 3HDDA 1D8JA 1FTZA 4HF1A 5CQGA 5TJJA 1HKTA 5J3OA 3GQ9A 5FRMA 1I1SA 4Z05A 5J40A 1H8HA 4FWTA 1OGOX 2CFOA 1IB4A 2FOKA 4XQFA 1U5TA 2IGOA 2LSOA 3PA2A 1Q1HA 2KJCA 2JDIA 5F1JA 4GYIA 3B82A 2E7XA 3E6BA 5J8FA 1I6HJ 4LBWA 4BQQA 1Z1DA 3WU2C 4Z4YA 3MN2A 2YX4A 3FK6A 3KLOA 3E6CC 2VKDA 1VF7A 3W2GA 3WNCA 2FBIA 2YWEA 1XCBA 1LM1A 1K6OA 1BX1A 4YAOA 1HC8A 2IEKA 1F36A 2XKPA 3MQ0A 1XTAA 3OOUA 1PUEE 3OYFA 3S15J 4AC9A 3W2AA 2VC0A 4QTRA 3CJTB 1U3EM 1K9MD 2RREA 1DBGA 1TWHJ 2CGPA 2VT2A 2FE3A 2DTZA 2ZSHB 1KK0A 1XQBA 1UD3A 3ZZUA 1Y0NA 1I1GA 2AQEA 2CYYA 4XLCA 1O3TA 1M1EB 5DD4A 4UB6C 3GQAA 4EJWA 1AA7A 1MD0A 2HQNA 3TOBA 3U1DA 5LGUA 3CC7I 4MTDA 1SD7A 2OTJB 4Q4ZF 5TISC 2M8GX 4C43A 2EPFA 2VUMJ 1SEUA 3ZC3A 2QN6A 2HKXA 2HFHA 2K9QA 2VJIA 4LIUA 1R36A 5BQTA 3RZDJ 3B8HA 3GVJA 1K78A 3ASNH 2DERA 1N75A 4D5CA 3CO7C 2E35A 1UD5A 4ACAA 3DU6A 1VZ0A 3PFIA 1I39A 5LBQA 1YX2A 1JUSA 5TV2A 5DTDA 3LAJA 2GXBA 2RDPA 5E3LA 1ZGAA 1YI2B 2K86A 2WY7Q 2ACJA 2ZXIA 3R6JA 1MMSA 3NAUA 3L2CA 5C4XJ 3SEJA 4HX8A 3HYIA 2G7UA 5FFZA 2FJ1A 1DGRM 2A69F 1U2WA 2WAEA 3CQZJ 1O8JA 1QA1A 1YIOA 2W48A 3V8LA 5C3EJ 1EXMA 4OMZA 4GFBA 4KKTA 4I98B 1NB0A 3OMYA 2A07F 1RNLA 1M90D 3CC2I 1N08A 4AF6A 3LSGA 1DGWY 1WJCA 1NBMA 4QVAA 4WQMA 1RKTA 2XZLA 2ID3A 3OYNA 3S93A 3HTUA 3WHBA 1QH0A 4RD3A 2WB1N 1WMRA 1MSFC 1TW2A 2COBA 3HHHA 3FPKA 4RA2A 3ZRGA 1Y1VJ 2DDAA 2D1VA 2DO7A 1OR7A 3QU6A 5JLXA 4F3QA 5LRRA 1VFCA 2CW5A 1Y56A 2VKVA 1YJ9I 3F9KA 1XGOA 4L5EA 4CH7A 4FASD 3W5VA 4KT6A 3VO1A 2H94A 1YJNB 4YG2F 3C3WA 5IYPA 2JJ7A 4RAYA 2CU7A 3EUAA 1EA3A 1T33A 3Q3AA 1Q9SA 3I1FA 1QO0D 2ZZFA 1DPUA 3SJZA 2YUHA 2ZBKA 1TLHB 3FK7A 3OZUA 4WX9A 2Q2EA 2XC1A 1QJVA 3PQKA 2GIZA 1R5ID 2P7VB 2K4BA 5LRSA 3IWZA 4HNTA 1S0UA 3PIPF 2DODA 2KMUA 4MO7A 2QLZA 4NC7A 3CCMB 4LMYA 3SZPA 3CCMI 3QE2A 2DA4A 3OV8A 4IRIA 4P96A 5JVTA 1HA3A 4MFEA 2R92J 2QYUA 4U4BA 1LEAA 4GCVA 3KLNA 3LA3A 2D9RA 1ON1A 1SVOA 2HZTA 1EFTA 2CS3A 5LD2C 2HU9A 1V0FA 2QTZA 3A35A 2ZB9A 2LKXA 3RY8A 1HQCA 3KEWA 2F5DA 3EQLF 4OAZA 3B02A 4OINF 3RKYA 1EH6A 2MH2A 4G6DA 4Y33A 3W6JB 3WBKA 3L2WA 2BM6A 2IS6A 3ZPPA 5HS8A 2G7HA 2X6XA 1P6RA 3ELKA 1WOSA 4B09A 5J1YA 2DIEA 4A69C 2XOKA 2M0CA 2ZJQF 1TZLA 2RNJA 3A2KA 3FPPA 2EZKA 2OBTA 3BY1A 3OZVA 1ETVA 2LR8A 5H20A 1YIJB 1FWZA 2X4HA 1E0EA 3P7NA 3OYAA 4Z06A 4L9VA 3SFIA 3FISA 4I02A 5DDGA 2C4UA 1HKQA 2R7VA 3JW4A 5AN9A 3TH0A 2OBPA 2IS2A 1P2FA 2L7FP 2V1NA 4I01A 3TW6A 1V55H 1SANA 1QFYA 1FJLA 2QGGA 3KP7A 5F64A 4OOIA 3CC4B 2O17A 2TDXA 1IDZA 3E97A 2JVHA 1R5OA 1RR8C 3A03A 2P3MA 1K6YA 1XDUA 1F5TA 4CYCB 1J9ZA 2IW5A 3LFUA 1FRNA 1OCCH 2GPJA 2F4OB 1VQMI 4M53A 2QA4B 4D0PA 1ZRCA 2OAZA 3NQOA 4PZJA 3WTWC 1P4MA 1OMIA 5EG0B 2PX9A 4OJ5A 2X0KA 2W7NA 5D8LB 1JE8A 4MEXF 2AO9A 2ZSIB 1MNEA 3TP0A 5J4VA 2R9VA 3E3VA 1J9IA 3DU1X 4ASUA 2UXNA 4DNTB 3F8MA 1E3ZA 2BY0A 1IZ1A 4QUZA 4N0BA 3AVUA 2MYSA 4A3IJ 2OYNA 3PM1A 1A36A 4IHVA 1VLYA 3BQJA 2EA2A 3FKJA 1W2BB 1B59A 1AOYA 2HVRA 3S3OA 5KSWB 1BQEA 1J0RA 3CO6C 2LVSA 3H3VK 4RCYA 3OL3A 3CUQA 3IKVA 2GAUA 4PFOA 4XL9A 4NHJA 4I84A 1W7PB 2LREA 1FMWA 1TWAJ 4FCYA 3C1DA 1UJ8A 1SM4A 3GO5A 1XGMA 3LSHA 3S32A 1TTTA 1RUOA 5EG0A 2XVCA 1IC8A 2V9KA 4IPAA 1YFHA 2R93J 1PYVA 3U6KA 3BQZA 2GQFA 3ZQ7A 4NCNA 3OYEA 1R23A 2ZXJA 4MGRA 5CPRB 3GTGJ 2JSPA 4BJ6C 2CQ7A 2ZMEB 3JRHA 2YR2A 3D0SA 2V9PA 1S3JA 5GTIC 3HOSA 1SVMA 3HIFA 4Y7NJ 4DQLA 2QY1A 2QQ8A 1WDTA 1VQKB 3ASQA 2F3LA 1E1QA 3G6EB 4L0YB 3CCQB 1P7IA 3OZWA 5BSYA 3L2RA 2ZFWA 3Q38A 2YWHA 4GO1A 1W9XA 4YXWA 1GV2A 4S0HB 2GM4A 5EF6A 1NRKA 3T51B 4HQEA 4WK8F 1KQ9A 2FU4A 2A5WA 4BE0A 4PGOA 1V54H 2WY8Q 3H1CA 1EKEA 3AL0B 2ZITA 2MA3A 1ZUNB 2IOUG 3PQJA 2JUGA 4Z2YA 4A12A 2OTLI 2PJPA 1GUUA 1TQPA 1B23P 5J47A 1TUIA 1GLNA 1WQ2A 3W3CA 4M1KA 5AMVA 2E36A 4RDKA 1B8IB 4G6QA 4OOSA 2EV5A 3IV5A 1NTCA 3FWEA 5DNSA 4DQ2A 2NXNB 1T6ZA 2PYHA 1KJZA 3QPSA 2F5EA 4ZCIA 4IQ4A 4CYCA 1QFJA 1A5JA 2EIMH 1VF9A 1KONA 3BROA 3BJAA 4YFOA 2AS5F 4S05A 1BJZA 4TV7A 1WI3A 3G3ZA 2OD5A 3ZR8X 1JI8A 5CDFA 1D5YA 1VQ4I 2JPCA 1FP1D 2WPDA 4RJLA 4BQOA 4HNVA 2BY2A 4X1EA 3RTRA 4OOVA 2Z2SB 1K8FA 3TL4X 3K1MA 2E1NA 4XBFA 2OK7A 1Q82D 4N3NA 4E7ZA 3NAWA 2EFOA 1IUYA 4IL6C 4HA8A 5H2FC 1FTTA 4XRSG 3K7AJ 4WZKA 4EEFG 1HF2A 1G4DA 3KP5A 1K79A 1A6QA 2IRFG 1K73D 4IHSA 4TMXA 3LQQA 5IOZA 3GTMJ 1S7AA 4BQAA 2VOOA 2VBXA 2P4WA 2V1XA 3VSTA 1JHFA 2GIVA 3DEWA 1A35A 3ZZ0A 3ASPA 2QZAA 3CCRI 3PIOF 2VFMA 2XSDC 3K70D 4BY7J 1F60A 3ROUA 4YHBA 1CF7A 4U9UA 4DYRA 3GFIA 1K4SA 3R6KA 4ANJA 2INUA 2NT9A 4F55A 2YSRA 3BZCA 2UVFA 4OU0A 2L7KA 1LB2A 1W1WE 2CQKA 1REPC 4CCOA 5DV5A 2J8IA 2DETA 3R0JA 5D8KB 1QUFA 1LNWA 5GV8A 2LH9A 4KUMA 2XAJA 4W8QA 2STTA 5ICEA 5HDNA 1W4MA 4Y13A 3JQPA 2M87A 3PNYA 3HRTA 1YJNI 1FRQA 3CCLB 1D1AA 1N0UA 3VEPA 1ETXA 1B9NA 2L9SA 4C3IJ 2DOFA 2FOWA 3IAS2 1TNTA 4Z1MA 3LA2A 5DCMB 4XK4A 2O0YA 1Z3XA 1PUFB 4IVNA 4RD2A 3I9V2 4C3JJ 1XSVA 2MGQA 3ABMH 1FX7A 4K1XA 4TMZA 5E1XA 1C0WA 1YLFA 2HKOA 3CESA 3I3LA 1O8HA 1LVKA 1W35A 1YX5A 2KRHA 3GQBA 3OS0A 3GTLJ 3SDBA 1VQ7B 1N05A 3FZVA 5J1UA 3FXUA 4BXXJ 5JHUA 3RI4A 1ZM9A 3LWFA 4A0YA 1LUJB 2FF4A 4TT3A 2HPIA 1G7CA 2Q6OA 4X06A 3GVLA 3DDYA 3O2PE 2Z33A 3H9JA 2CV0A 4ROXA 3BDDA 3ZIAA 2NS7A 3I58A 1TYUA 2YWFA 4CZZA 1TTYA 5F0FA 3F21A 1J59A 4HX7A 1JKQC 1XG2A 1AU7A 1MW7A 4DK1A 2VI6A 4PJJA 5A2QK 1HZEA 2NPFA 1YJWB 4ON0A 3EPZA 3LJYA 1V3FA 3FKIJ 2K3FA 4M73A 2PLFA 2Q6KA 2XROA 2JVGA 1GT0C 4XR6A 3OSGA 2VL8A 3ZMVA 4H9GA 1IRFA 2X9DA 4TN1A 2O6WA 3V4GA 4JX6A 1RRJA 3JURA 3GFMA 1TC3C 4LGWA 4RGXA 1VI0A 4RAFA 1B72A 3EYYA 1ZH5A 3ASSA 4N9HA 2OV7A 3GTJJ 3VWBA 2RV8A 2FUG2 5FKOA 2V4DA 1E17A 2NTQA 3SEZA 2O9LA 4OIPF 1Z77A 2ZXHA 1X4PA 4RD6A 1KZLA 4EGZA 1XN7A 4L9JA 2GA2A 2GZWA 4DGWB 5C4JJ 3MKWB 5IP7J 2LC2A 5A2QZ 4LOCA 2DPUA 2DMQA 2IS4A
chains in the Genus database with same CATH topology
3RPUD 2Z1DA 4B48A 4DJAA 1HVXA 1MNDA 1O8GA 2WJVA 4IX7A 4ITVA 4CSWA 4C9YA 2UVEA 3VSUA 3PSFA 3A1YA 4BE1A 4ZTJA 2X1DA 3DKYA 1WJDA 3EUKL 2K9LA 2V31A 2PJRB 2WBMA 3UW0A 5FROA 4OJLA 2A6TA 4IZZA 2HQAA 3BCBA 2LBFB 3B90A 4BEHB 3OYJA 2LRDA 1VBLA 2X6YA 2K5CA 2VQGA 1H80A 4YZ0A 4CCLA 3OEHA 1V5FA 4BQNA 3DTEA 2W1OA 1X0CA 4II3A 2VB6A 4NC8A 1ZELA 2GOMA 2KPMA 2VQCA 3OFNA 4XLFA 4PSXA 4HRIA 1YE9A 3PNVA 4NQWB 3VYSB 1WJ5A 2VQHA 1SFKA 4LITA 4R79A 2F4IA 3OS1A 5LFAA 4BE2A 2F5VA 4F92B 4NK8A 3TBIA 2R7TA 2KQRA 2XF6A 2KLOA 2V6EA 2VKHA 1DP3A 4OZYA 3OYGA 3OS2A 3KX2A 2NTPA 3RQ4A 3BC9A 2IGMA 3T9GA 2HVSA 1OLTA 1V5EA 3V42A 4E6KG 4JMQA 1K28D 2W82A 4PUSA 3DQVC 1Z21A 2I8DA 1T0FC 4PJMA 2R7QA 2XF7A 4BDZA 4F52A 4W8SA 2E1BA 4B44A 3K4KA 4N4NB 3E0JB 1LKXA 1OHHA 2F6CA 3OY9A 2JIZA 4XMYA 1O8FA 4XN3A 1OFMA 3OYHA 3HOTA 4H4KC 1BR2A 4CCJA 2PECA 1BOBA 1V5GA 4D1QA 1X1DA 1IDKA 1Z7LA 2E1MC 2OC6A 3QYEA 2M3AA 4CCMA 3EQOA 2W6IA 3JU4A 5CQGA 3OOCA 3GQ9A 1N77A 1QHHD 4YRVA 5FRMA 4PJNA 4W8RA 4E0FA 3FY3A 4EW9A 4Z05A 1H8HA 4FETA 1OGOX 4OJPA 4ZDPA 2CFOA 4DBQA 1IB4A 3L2UA 4QPOA 4XQFA 2ZZQA 2IGOA 3ZQQA 1JRGA 1PXZA 4URRA 4YZXA 4G7XA 3UNGC 2NT6A 4J01A 2JDIA 1HG8A 3S8PA 3DU5A 4BQQA 1MMGA 3IP4B 1WJFA 3C2HA 2GJKA 1BPLA 4B3GA 1O8EA 2DT6A 2VKDA 1VF7A 2M7BA 4MLOA 3HC7A 2HPMA 2XGJA 1Y6IA 3L2VA 4C2UA 3ZSCA 3OOUA 3OYFA 2CW8A 4BL0B 3HL2A 3W2AA 1ERDA 2RREA 3LMMA 1DBGA 3K4BA 2O0WA 2R7RA 2BSPA 2ZSHB 4ZYAA 4BEHA 4BUPA 1UD3A 4E7SA 2AQEA 4XLCA 2MABA 3OEEA 4OJOA 3H5AA 1W0JA 4B3XA 3HKZA 1WP6A 1WJEA 3GQAA 4DNRB 4KKUA 1AA7A 4QPQA 4GQNA 2IS1A 4XONA 1BLIA 2KVOA 3CJQB 4XD7A 3IUOA 4ZC3A 1SKYB 4C2LA 2UUZA 2WADA 3VSLA 4BDYA 4ZDOA 2IS4A 3HG9A 4KISA 2VJIA 4LIUA 3GVJA 4RLFA 4XM3A 3HPGA 1N75A 2NSTA 2Q2EB 1UD5A 3VMVA 4XKBA 2O0VA 3DU6A 1VZ0A 5CQEA 1X1AA 2VIXA 3LSIA 1O8LA 3VMWA 2LY1A 1W0KA 1NG6A 1NHCA 1UD8A 2GK6A 2WY7Q 2ZXIA 4YEJA 4OJ6A 4CCKA 1FX0A 1FMVA 1O88A 4C30A 3ZGKA 3U21A 1DGRM 2JJ2A 3GBGA 2CW7A 2WAEA 3OR2C 1O8JA 3K70C 3D5RC 2VLAA 3OYBA 4LIVA 5KCMA 4KKTA 4HNUA 2KHMA 2UV1A 4B43A 3DPUA 4HPQA 5FL7A 3T53B 3OMYA 1BR4A 2BVMA 1E43A 4CZCA 1MMDA 3W2WA 3LSGA 1DGWY 1WJCA 4PSWA 1TT0A 1NBMA 4HSTA 1EFRA 2LOOA 2LYCA 2ZZGA 2IGNA 3DWLE 3OYNA 3S93A 2F1MA 3DTIA 2WSSA 3BCFA 4B3FX 2VXDA 2JA2A 1WMRA 1OR7C 3PNTA 2XZLA 1QCXA 2E5ZA 3AFHA 2V7QA 3BLYA 1D0ZA 1R6RA 3ZRGA 3H0DA 2HVQA 4F3QA 2HDWA 1KMHA 2VASA 2E1MB 3AKZA 1Y56A 4E4HA 4E7KA 1OB0A 1SAUA 2LY2A 3F9KA 4CH7A 4FASD 5C1CA 3CP8A 3GQ8A 4KT6A 3NWTA 2K3PA 1IA5A 3EUAA 1EA3A 3NWSA 4XNFA 1UG0A 3OIQA 2KL4A 2ZZFA 3MD2A 2PYGA 4DK0A 1H8EA 1O8DA 2ZFUA 4F91B 1PJRA 4JOMA 3K4MA 1QJVA 3BCDA 4HNTA 4MXNA 5HVQC 5HNHA 4X0GA 2KMUA 4NC7A 3OWTA 4XLHA 4DIQA 1G59A 2CV2A 1KCDA 2VPLA 3A3BA 2VJ5A 4DOZA 4U4BA 2VJJA 4B47A 2WJYA 4G6TB 2CS3A 3K10A 2HU9A 3QYBA 4ZDLA 4DBRA 3DTKA 5LD2C 1V0FA 3A35A 1BN8A 3KEWA 3VSVA 2DOAA 2BW3A 4OAZA 2VJ4A 4Y33A 1PKVA 2HLDA 3LSKA 3L2WA 3ZPPA 1W36D 2IS6A 1D0YA 4TSFA 2QX3A 2X6XA 3G2BA 3H5RA 2DIEA 2IQ7A 2VQLA 2K9MA 2XOKA 3GQ7A 4Z03A 1I8DA 1TZLA 2DCEA 3K4JA 3A2KA 3FPPA 1WFXA 1G8XA 4UZUA 3DPTA 4XOTA 4CCNA 4P1WA 1E0EA 4FXUA 3OYAA 4Z06A 4JQFA 2R7UA 2R7VA 1NG7A 3VR6A 4HG2A 2VBMA 1RWRA 1CZFA 3EQNA 2IS2A 2Z6BD 2MFZA 4LG3A 1E1RA 3MKZA 2V1NA 1UD6A 2CH0A 1N78A 3PUBA 4IKFA 4II2A 2X8KA 2BW3B 1I18A 2O17A 2JVHA 4U87A 4YELA 2L5QA 2KDOA 1K6YA 1T95A 3IAM2 3J7AY 2ZZEA 4KKSA 3K6GA 5C1EA 3LFUA 4BJ5C 3HPHA 3EUHC 3D5LA 3W2VA 2BVLA 2M4GA 4BXFA 4EATA 4U49A 3N05A 2R7SA 3L2QA 4OJ5A 2W7NA 1E3XA 2QKMB 1Z3YA 1W36C 1KCCA 4GRIA 1WJBA 1MNEA 2ZSIB 2R9VA 2O04A 2X1EA 2M0MA 3LSMA 4ASUA 4DNTB 3SZGA 1E3ZA 2ELJA 3FKSA 1QHGA 2MYSA 5DN6A 1VLYA 5IK2A 4XOPA 1X4OA 3FKJA 1UD4A 2F43A 3DLAA 2HVRA 3S3OA 4HEA2 3VSKA 3PJRA 3DPLC 3M8JA 2NTBA 3OL3A 4XL9A 4PFOA 1WTHD 3B4NA 4I84A 1RU4A 2LREA 2X1CA 4NNJA 1FMWA 2LZJA 4D9JA 3OL4A 2ODLA 3OYIA 3LSHA 4W8TA 3S32A 1O8MA 2P0WA 4P22A 1P9QC 3H35A 5HOOA 1UELB 3OYKA 3SEQA 3OYCA 4AVZA 2V9KA 2Z8GA 1PYVA 2DT7B 3SUCA 3QODA 3OYEA 5CPRB 2JSPA 4OWRB 1D1BA 4BJ6C 4U7BA 2XAUA 3PSIA 3A3GA 1WJAA 1X19A 3HUGB 3E1SA 3HOSA 3WWGA 4RLQA 1T5EA 3KRGA 2GK7A 2QY1A 2X51A 1U0JA 2XDVA 3OYMA 2V26A 1E1QA 5JHFA 3B8YA 1X1CA 2NZMA 3L2RA 1W9XA 4YXWA 2X53S 2WZPP 1DQUA 2L9NA 4C2TA 2VBEA 1NRKA 3T51B 2MC4A 2A5WA 4BE0A 4AYBA 2WY8Q 3SYTA 3CZ6A 3AL0B 1O8KA 1OGMX 2JUGA 2R7OA 1GLNA 2MD0A 2XF5A 4XKCA 4CA0A 3FHNA 3W3CA 5AMVA 4XORA 3LL7A 4BS9A 3BG6A 1K5CA 4MR0A 3ZXSA 2WAFA 2KP6A 2PYHA 4IQ4A 4TKOB 2QKLB 1KONA 1RMGA 3LMWA 4BJTA 4KITB 2R7XA 4Y4RA 2IXSA 2HNHA 4IQJA 2E5NA 2GJPA 2M4KA 3C2GA 2X3HA 2CMPA 3ZR8X 1X1BA 1JI8A 5CDFA 5HLTA 2WPDA 2DJIA 4BQOA 2ZTNA 1PE9A 3KEYA 1UAAA 4KJZA 3RTRA 2Z16A 3OIPA 2Z2SB 3TL4X 3OYLA 1YX3A 2VBKA 4E7ZA 1MABA 1UD2A 4PJLA 4HWVA 4NK6A 2XZPA 4PK4A 2O1DA 3LNNA 3UR3C 4RMNA 4J00A 2JJ1A 3D5SC 4P5OA 1MMAA 3CF2A 3VSTA 2UWMA 5TGTA 3K4LA 3S3MA 3VYTB 4BACA 3K70D 3RSNA 2WAQA 2ZTGA 4ANJA 2INUA 2NT9A 3ZPNA 4F55A 2AQFA 2WB1A 3MKYB 3KYLA 3S3NA 2RNGA 2UVFA 3VYUB 2L7KA 5HNFA 2R7WA 3ONQA 3BG7A 4G6IA 4CCOA 2V4JC 5FRNA 2R4GA 3K4CA 4ZTFA 2W4SA 4XLEA 2LH9A 2D3NA 1COWA 1IDJA 4XKVA 4W8QA 2E60A 2IGKA 3BH4A 4PMHA 3PNYA 2QXZA 3CMMA 3BCAA 3T56B 2RQQA 1D1AA 2XZOA 3A4CA 5KNLA 2GJRA 1EE6A 1VJSA 2L9SA 3RCOA 3MMYB 3HXLA 4E7JA 3GVKA 3IAS2 2X6WA 4NUBA 4Z1MA 1Z3XA 2M5SA 3OPOA 2LBFA 3OR1C 3I9V2 5KHDA 4BGDA 3OYDA 1LFPA 2GOXB 3CESA 1MMNA 3BC8A 3I3LA 1O8HA 3QOEA 1LVKA 2OUMA 1S9HA 5HKKA 4OZZA 4E7HA 1YX5A 4HIZA 2KRHA 3QYFA 1BHEA 1BMFA 3GQBA 3DEEA 4F93B 3OS0A 2W6JA 3DKXA 3SDBA 3PL8A 4HSRA 1AIRA 1J09A 2CUJA 2NOJB 4XN0A 1E79A 4RM2A 4TT3A 2HPIA 4RM3A 2XC7A 3H9QA 2M7AA 3DDYA 2CV0A 3H9JA 3GVLA 1BR1A 2X85A 3OE7A 3ZIAA 3OAAA 4BU2A 3FDYA 4Y3OA 2CV1A 4PFPA 4E7IA 1JTAA 4E7LA 1D1CA 1LDKB 3FBNB 2DXIA 4L8JA 1PLUA 3OW7A 4YZQA 3HAGA 1XG2A 1O8IA 2LG4A 3ZCOA 1QU3A 1MW7A 1IRXA 2L2OA 3G05A 4N4OB 2PMZA 4PJJA 3AL0C 1HZEA 4G7WA 4DK1A 3WQZA 3H9GA 2CK3A 3EPZA 2NSPA 1HA8A 4OAYA 1OOCA 2JVGA 4XLAA 4XR6A 5CKTA 1V0EA 3M1CA 1GQ8A 4CUGA 2HZDA 2D3LA 2VL8A 1OFLA 2CUZA 3TMOA 3H94A 3K4NA 4ZJZA 2KRCA 2XNDA 3FBIB 2EWEA 2O5RA 3JURA 2PJRA 2Y0SA 3CP2A 2BOLA 3GRHA 2Q1ZB 2KZVA 3VDXA 2OV7A 3VWBA 2V4DA 2FUG2 1WPCA 2INVA 3NE5B 1D0XA 2NTQA 3SEZA 2V7FA 1X4PA 2ZXHA 3H5NA 4XKWA 2W00A 4AU7A 1KZLA 1DBOA 3PFYA 4DGWB 3MKWB 1KTWA 2XSJC 4YZAA 2LC2A 2WA0A 2QE7A 3VYRB 3CJRB 2VXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJI A;  1O8G A;  4XM3 A;  5C1E A;  3VST A;  2UVE A;  3VSU A;  2NST A;  3VMV A;  4U49 A;  2O0V A;  3VMW A;  1O8L A;  1NHC A;  3UW0 A;  4OJL A;  2INU A;  4OJ5 A;  2NT9 A;  3B90 A;  4OJ6 A;  4YEJ A;  2UVF A;  1KCC A;  1VBL A;  2X6Y A;  2O04 A;  1H80 A;  4YZ0 A;  1O88 A;  1X0C A;  1O8J A;  4XLF A;  4XLE A;  4XOP A;  1IDJ A;  4XKV A;  4PMH A;  2QXZ A;  2NTB A;  4XL9 A;  4NK8 A;  3B4N A;  4I84 A;  1RU4 A;  2ODL A;  1EE6 A;  1WMR A;  4W8T A;  1O8M A;  1QCX A;  2X6W A;  4OZY A;  2NTP A;  3T9G A;  4AVZ A;  2Z8G A;  3SUC A;  1O8H A;  5C1C A;  3GQ8 A;  1IA5 A;  4OZZ A;  1BHE A;  3WWG A;  4XNF A;  4W8S A;  3KRG A;  2QY1 A;  1AIR A;  2PYG A;  4XN0 A;  1O8D A;  3B8Y A;  4XMY A;  2NZM A;  1O8F A;  4XN3 A;  1OFM A;  1QJV A;  2PEC A;  1IDK A;  2VBE A;  4MXN A;  2X85 A;  3EQO A;  4XLH A;  4W8R A;  1KCD A;  3GQ9 A;  1JTA A;  1O8K A;  1OGM X;  3FY3 A;  4EW9 A;  4Z05 A;  4YZQ A;  1PLU A;  1OGO X;  4OJP A;  1IB4 A;  4XQF A;  1JRG A;  1O8I A;  1PXZ A;  2VJJ A;  1XG2 A;  4U4B A;  4URR A;  4YZX A;  2NT6 A;  5AMV A;  4XOR A;  1HG8 A;  1BN8 A;  3VSV A;  1K5C A;  4MR0 A;  2NSP A;  1O8E A;  2PYH A;  3ZPP A;  1OOC A;  4XLA A;  4XR6 A;  1GQ8 A;  2X6X A;  2QX3 A;  1RMG A;  3LMW A;  3ZSC A;  1OFL A;  2IQ7 A;  3GQ7 A;  4Z03 A;  2EWE A;  2X3H A;  1DBG A;  3JUR A;  2O0W A;  4XOT A;  2BSP A;  1PE9 A;  3GRH A;  4Z06 A;  4XLC A;  4OJO A;  2VBM A;  2VBK A;  1RWR A;  1CZF A;  3EQN A;  3GQA A;  2INV A;  2NTQ A;  4HWV A;  4XKW A;  4NK6 A;  2O1D A;  4XON A;  1DBO A;  1KTW A;  4YZA A;  2O17 A;  4C2L A;  4YEL A;  4W8Q A; 
#chains in the Genus database with same CATH topology
 3KP3 A;  2VFN A;  2WJV A;  1SVL A;  4IRG A;  1LJ9 A;  2UVE A;  3PSF A;  4IRH A;  4FIS A;  4O3M A;  2VFQ A;  3ZN1 A;  2EWN A;  1MNM C;  2E7W A;  3CCV I;  3EUK L;  2K9L A;  2CC2 A;  2WBM A;  2JK3 A;  1JJ2 B;  4OJL A;  3QQA A;  2A6T A;  3BCB A;  3Q0U A;  2LBF B;  3QAH A;  5B1B H;  1DUX C;  2LRD A;  3VO2 A;  1VBL A;  3CCY A;  2VQG A;  4UVA A;  5JLW A;  2F1L A;  1VQP B;  1X2M A;  1T98 A;  3ML3 A;  3U2Q A;  2L54 A;  5LHI A;  4II3 A;  4CDG A;  5CVR A;  3TKY A;  1ITY A;  4YAL A;  2KPM A;  1RQP A;  2HYG D;  2PN6 A;  1LE8 A;  3D26 A;  4V02 C;  3WTY C;  5CYV A;  1WJ5 A;  2D2W A;  2WV1 A;  3DXJ F;  1QRY A;  2JTV A;  2F4I A;  2C6Y A;  5HZB A;  1BN5 A;  5D5V B;  4J19 A;  3T5X A;  4KNY A;  3I5U A;  3CUQ B;  1O3Q A;  1FEX A;  1YS6 A;  2DMU A;  2EIL H;  2XF6 A;  3RQI A;  1IN8 A;  2WR8 A;  1DP3 A;  4RGR A;  3OYG A;  4MTE A;  1FBU A;  4M6X A;  1EJ9 A;  1HCR A;  4E6K G;  2L4M A;  1K28 D;  1H85 A;  3JQQ A;  2E1R A;  4A3B J;  4PUS A;  3G4S B;  3CPW B;  3DQV C;  1E3H A;  2EBI A;  2P6T A;  2NS0 A;  3ZPL A;  3PO2 J;  2H6C A;  1H0M A;  4G94 A;  2E1B A;  3HUG A;  3E0J B;  3IH4 A;  5JMC B;  1LKX A;  3ECH A;  1OHH A;  2F48 A;  2L02 A;  5AIP A;  2PEX A;  3VOE A;  1QA2 A;  1BOB A;  3BTL A;  3EET A;  2OC6 A;  1B6A A;  1R4M B;  2M3A A;  2BY3 A;  3OOC A;  3KZI C;  5BOX A;  4YRV A;  4PJN A;  4E0F A;  2FNA A;  5IYW A;  4AUX A;  4FET A;  4OJP A;  3PUN A;  4DBQ A;  4QPO A;  1JRG A;  2A5Y B;  3ZQQ A;  1QX4 A;  3BTJ A;  2WYR A;  1HSJ A;  1VQ5 B;  2XPU A;  4HOB A;  4URR A;  1JT6 A;  3Q0W A;  3AG1 H;  4J01 A;  5DYM A;  5B66 C;  2OBS A;  3F23 A;  1BPL A;  2XRL A;  4LB5 A;  1EFU A;  1O8E A;  1I6X A;  5F4J A;  4OIO F;  1JJ8 C;  1UFM A;  2HPM A;  1Y6I A;  4FQG A;  3CCJ I;  4KDP A;  3B78 A;  3RPQ A;  3SKB A;  1ZGJ A;  2QDX A;  3LVB A;  2QQB A;  4OIR F;  2R7Z J;  3HL2 A;  2BZT A;  4BL0 B;  2XRN A;  1RQR A;  1LFU P;  4Q5S F;  1ERD A;  1KD1 D;  2VNI A;  2FEZ A;  3I56 B;  2XGD A;  2CBX A;  3BR1 A;  5EEH A;  4BUP A;  1A31 A;  4I2O A;  3I0T A;  4E7S A;  1W0J A;  2CO5 A;  5F1R A;  1WJE A;  5JLV C;  4DNR B;  5GAD J;  3B6C A;  2LNB A;  4QPQ A;  3VPR A;  4DZP A;  1J75 A;  4GQN A;  2PMD A;  5E20 A;  1BLI A;  2KVO A;  4M2L A;  3CJQ B;  2ETH A;  3I55 I;  3IUO A;  2VN2 A;  5D6F A;  2UUZ A;  4YDT A;  1IN7 A;  3Q5F A;  2V7V A;  1BIA A;  2ISY A;  4MIM A;  5EDN A;  1E62 A;  1UMK A;  4AC0 A;  2ZKZ A;  2BF4 A;  3H3U A;  2NST A;  3GEZ A;  2Q2E B;  3CCL I;  4XKB A;  4U0W A;  5CQE A;  1PJ5 A;  3LSI A;  3VMW A;  3ONU A;  4ESB A;  2VE9 A;  3ISP A;  4FTH A;  1W0K A;  4JX4 A;  2GRE A;  1UD8 A;  4P6V F;  1XG1 A;  4OJ6 A;  4YEJ A;  3WNB A;  4G5G A;  4EJV A;  2VBU A;  5EZG A;  1FX0 A;  2Z99 A;  3HB9 A;  3ZGK A;  2YU9 J;  1ZM3 A;  2IA1 A;  3CUO A;  4PCQ A;  2CW7 A;  5K5Q A;  2ZNY A;  1SFU A;  1O3S A;  1Y0Y A;  1B8I A;  4Y52 J;  3W2E A;  3GFL A;  3OYB A;  2VLA A;  4LIV A;  2DYR H;  5KCM A;  4HNU A;  2UV1 A;  4B43 A;  3DPU A;  5L3D A;  2NS8 A;  2BPO A;  4X07 A;  1E43 A;  4QWQ A;  2L9V A;  1TT0 A;  3BOQ A;  4HST A;  1VQ4 B;  2LYC A;  2F1M A;  2WSS A;  4B3F X;  1IHM A;  3HEF A;  1OR7 C;  3PNT A;  5K5R A;  1BIB A;  2VBT A;  5E3M A;  1QCX A;  2V7Q A;  1BC7 C;  4G1B A;  5IT9 K;  4RLZ A;  4YC5 A;  1KMH A;  4E7K A;  1FSH A;  2ZJ2 A;  2EZI A;  2KFD A;  3WE2 A;  2LY2 A;  1XFO A;  2B7B A;  4LBY A;  4UAJ A;  4ACB A;  4B4D A;  2K3P A;  2ECB A;  2LFB A;  2J5O A;  5ED4 A;  2QBY A;  2K85 A;  1TLL A;  3NWS A;  2EFW A;  3F0C A;  5CJ9 A;  1AWC A;  2OTL B;  2HQR A;  1UG0 A;  3J7A O;  2ID6 A;  5A8A A;  2KL4 A;  3ASO H;  3DBL B;  5GPC A;  1QPI A;  1E63 A;  1H8E A;  3G1M A;  2K4J A;  3K4M A;  4YEI A;  4KIC A;  1TYX A;  2EIJ H;  3BCD A;  5DUI A;  3JRE A;  2DDB A;  5DM6 F;  4XLH A;  1TBX A;  3OWT A;  2VOD A;  4DIQ A;  2CV2 A;  2KZG A;  1ETO A;  2VPL A;  3A3B A;  2A68 F;  3LYC A;  1GJR A;  2BXZ A;  2HR3 A;  4O6J A;  2P7C B;  3WND A;  4DOZ A;  4ZYH A;  4B47 A;  1FBS A;  2WJY A;  4EM0 B;  4XID A;  1I50 J;  1ZG3 A;  1VQN B;  3E5Q A;  4M3F A;  3DTK A;  2F2E A;  5IT9 Z;  3VSV A;  5GAE J;  1FDR A;  2KDZ A;  2HYF A;  1N06 A;  2M34 A;  1BJA A;  3A8I A;  1BC8 C;  3LSK A;  4UUV A;  1FYL A;  2GXA A;  2MW8 A;  1BW6 A;  4AIJ A;  4TSF A;  4V19 K;  1TNS A;  2QEN A;  2QZ8 A;  2FRH A;  2BV3 A;  2IQ7 A;  4OM9 A;  3BY6 A;  3ZMD A;  4P1V A;  3GQ7 A;  4Z03 A;  4AIK A;  4C3H J;  2DCE A;  3K4J A;  3ULQ B;  1I3A A;  5HLH A;  2BSA A;  2FX0 A;  4HE5 A;  1R71 A;  3Q3S A;  4CCN A;  1ZYR F;  2YUS A;  4JQF A;  3QSY A;  5GP9 A;  1MBK A;  1NG7 A;  2XAG A;  4YIR X;  2VBM A;  1RET A;  1ZRE A;  3EQN A;  2KIM A;  3N4M A;  4LG3 A;  3F22 A;  1E1R A;  4RDL A;  4OMY A;  3CCJ B;  2CH0 A;  2IAI A;  2L01 A;  2AXT C;  2B7C A;  1QQI A;  1T6S A;  4BKX A;  1FIA A;  2E2H J;  2NV4 A;  1I18 A;  4U87 A;  2A6H F;  4YEL A;  4BYY A;  2L5Q A;  3I54 A;  3R6S A;  2IP2 A;  5M5W J;  3MVP A;  2HCJ B;  4M71 A;  3IAM 2;  3JAM Z;  1FYK A;  4A2U A;  4BBR J;  1RUN A;  2PQ8 A;  3K6G A;  1CNF A;  2X0L A;  4BJ5 C;  3HPH A;  4UNO A;  3V76 A;  3W5U A;  3EUH C;  1ZKG A;  1VQM B;  1D8T A;  2M4G A;  4BXF A;  2NVU B;  4U49 A;  3N05 A;  3PVD A;  3OIO A;  2MLG A;  2ICW G;  3SQN A;  3OSF A;  2Z5U A;  1W36 C;  1TT5 B;  1Z05 A;  1ZR4 A;  1KCC A;  3FIW A;  2QEX B;  1VQL I;  2BVN A;  2O04 A;  3SQV A;  1OQY A;  1QHG A;  2K9S A;  3A01 A;  4P26 A;  2K9N A;  2PI0 A;  3SLN A;  5HS9 A;  2F43 A;  3DLA A;  2VNH A;  3PJR A;  3DPL C;  4WXH A;  3G4S I;  3M8J A;  2NTB A;  3GCM A;  1S72 I;  2JA8 J;  1WTH D;  4A3M J;  3B4N A;  2X1C A;  3CCU B;  2ODL A;  3F8N A;  4PGG A;  3OYI A;  4IW3 B;  2HEO A;  3PUM A;  3N6Z A;  4UB8 C;  3GX4 X;  1MDM A;  1HOM A;  3CCE B;  2F5C A;  5FKL A;  2XTX A;  2FBH A;  2F5F A;  4ETS A;  3OYK A;  2EZL A;  1XB4 A;  3LA7 A;  3SEQ A;  1NDH A;  4ZGN B;  5B1A H;  1VTN C;  4D7N A;  4ZYE A;  2V1U A;  5CVU A;  4HV5 A;  2LLK A;  4P9F A;  3PSI A;  4XIC A;  5IYN A;  4Z4U A;  3E1S A;  1WPK A;  4MYT A;  3U1K A;  4RLQ A;  4IOC F;  1T5E A;  2GK7 A;  3M8E A;  4AVP A;  3WGH A;  3S14 J;  2WWY A;  2IJL A;  3OYM A;  4L0Z B;  1FND A;  3T8T A;  1L1I A;  1VND A;  3E7L A;  4Y9R A;  4HDV A;  4B4C A;  1TP4 A;  3M9A A;  5K1Y A;  1XB2 A;  5FLX Z;  2BX6 A;  4LLG F;  1SD6 A;  1OKR A;  2NNY A;  1H8A C;  1OFE A;  2DT5 A;  3CZ6 A;  2VZL A;  1O8K A;  1FLI A;  1ORK A;  4UHT A;  3J7Y J;  4CA0 A;  2XF5 A;  5A88 A;  4X7D A;  1ODD A;  2FA5 A;  3FHN A;  4HX4 A;  3TED A;  2W84 A;  3F6O A;  4XRF A;  1DDG A;  2XAQ A;  3LL7 A;  1R22 A;  1MBG A;  2Q6L A;  3ZQH A;  4MR0 A;  3ZXS A;  2KP6 A;  3BZ6 A;  2BM7 A;  1R1U A;  3HOX J;  1Y0R A;  1XMA A;  3K1P A;  4NQW A;  2VT3 A;  4JYK A;  3MHP A;  2HYJ A;  2DN0 A;  4RB2 C;  3VOD A;  4M3B A;  3LSR A;  4YFX F;  1F20 A;  2V7U A;  5F4O A;  1ZM4 A;  1IXS B;  2JRT A;  2HNH A;  2EV0 A;  2VBZ A;  2GJP A;  2M4K A;  1EA0 A;  3K1N A;  1SFE A;  4A3E J;  1JNY A;  2C2W A;  4EV0 A;  5E3N A;  1XE1 A;  2FXA A;  4HAM A;  1Q81 D;  1MSE C;  1ACI A;  4EJT A;  5EYR A;  2CQQ A;  2VBK A;  1VQK I;  5E17 F;  4S04 A;  5HDK A;  1HDP A;  9ANT A;  4ENJ A;  4HWV A;  1JA0 A;  4PK4 A;  4RAZ A;  2V7X A;  2MH9 A;  2HOA A;  1KU7 A;  1I7P A;  4A3F J;  1T6X A;  1IJE A;  4YZ0 A;  2EV6 A;  5DM7 F;  1VQ8 B;  4P5O A;  2VFP A;  2L4A A;  1O3R A;  3DBH B;  1N0V C;  2I10 A;  1HST A;  4UV8 A;  3A0H C;  1BJK A;  2B0R A;  3K4L A;  5GTH C;  2ZNZ A;  4ASN A;  5LMZ A;  3RSN A;  4XRM A;  2WAQ A;  5DD8 A;  3CC2 B;  3ZPN A;  3HOV J;  3MKY B;  3KYL A;  4U88 A;  2M8E A;  2RNG A;  5L3C A;  2XPV A;  4I0A A;  4FE7 A;  4BAY A;  2ZL7 A;  2DQR A;  3BG7 A;  1HBX G;  5FO0 A;  4G6I A;  4JK1 X;  1ZG5 A;  3BJO A;  2V4J C;  2BY1 A;  2R4G A;  3F3X A;  3HBL A;  3K4C A;  4ZTF A;  2XT4 A;  2W4S A;  5IYB J;  1P4W A;  1RPW A;  4A3K J;  1ZGW A;  1COW A;  3F8B A;  4XKV A;  1Z6T A;  3C7J A;  3MFK A;  3S1M J;  3WG9 A;  1IDJ A;  3BH4 A;  4PMH A;  3E6M A;  3JRC A;  3SJP A;  1KYW A;  3ZQF A;  4KT5 C;  4A0Z A;  3DV8 A;  4I0B A;  1XCV A;  2NVT J;  1XMX A;  2BHY A;  1EP1 B;  3MCZ A;  2Y48 A;  1WRJ A;  3GME A;  2GJR A;  1VQL B;  1QZZ A;  1EE6 A;  3SLD A;  5BMZ A;  4PC7 A;  2K27 A;  3RDI A;  5IYC J;  1IN5 A;  4A5M A;  1LQ1 A;  3OR1 C;  4M4S A;  5TR9 A;  5KHD A;  1BL0 A;  2J8K A;  3OYD A;  1YTY A;  3NB2 A;  5DS0 A;  2H27 A;  3B73 A;  3V7S A;  1S9H A;  1BM9 A;  2Y75 A;  5DSZ A;  4E7H A;  3J80 Z;  1JGG A;  4MYU A;  3QFR A;  3DEE A;  3A02 A;  3PL8 A;  4PC6 A;  2ZCW A;  2E2J J;  3GF2 A;  3V7C A;  3BQY A;  4XN0 A;  1E79 A;  3S1N J;  3E1Y E;  4RM2 A;  3PA1 A;  2XC7 A;  1P92 A;  2V7T A;  4OP7 A;  1CQT A;  2X85 A;  1EP2 B;  5JI6 A;  1VQ9 I;  1EFC A;  4PFP A;  1JTA A;  1TL8 A;  3A0B C;  4L8J A;  1HKS A;  1S8N A;  2RQP A;  1GAQ A;  3KZY A;  1O8I A;  3AAF A;  3CCR B;  1OYY A;  4YIF A;  2L2O A;  1MIJ A;  3Q39 A;  1MBE A;  2XIG A;  3WQZ A;  4HDU A;  3H9G A;  1OYI A;  1OCO H;  4WWC A;  4FX4 A;  1IF1 A;  2HOT A;  2CFX A;  4OPO A;  1HA8 A;  2Y0M A;  2PMZ N;  3LQR A;  4XLA A;  3IH2 A;  2QBY B;  5CKT A;  1GVD A;  3M1C A;  1G7R A;  3BR6 A;  4HF2 A;  4ZZD A;  1OFL A;  1XSX A;  1IV8 A;  3LST A;  1CGP A;  4QSH A;  5FA6 A;  1Y0U A;  2YU3 A;  4QIW N;  2EWE A;  1MJ9 A;  2ZC2 A;  3OW2 B;  1D3Y A;  1T08 B;  3U2R A;  3ZMZ A;  2NVQ J;  4TMW A;  3HKZ N;  4RGU A;  1Z91 A;  2DK8 A;  1VQO B;  2BOL A;  2M1B A;  2Q1Z B;  2PIA A;  1P4A A;  4R1H A;  2W24 A;  4AD9 A;  1XPX A;  3H9N A;  4RS8 A;  1GAW A;  2ESH A;  4EJO A;  5B6I A;  2INV A;  1BI2 A;  1D0X A;  3NE5 B;  4ENN A;  4Y9U A;  2V7F A;  1PJ6 A;  2B0L A;  3H5N A;  2LP0 A;  4XKW A;  2W00 A;  1DBO A;  1KTW A;  1ON2 A;  1DG1 G;  3QPH A;  4YZA A;  3TDZ C;  2WA0 A;  3HGG A;  1KU3 A;  1U8B A;  1XC5 A;  3FXK A;  3RPU D;  1HVX A;  2DFH A;  3J81 Z;  3K2A A;  1VQ6 I;  4ZCL A;  4ITV A;  4CSW A;  5FLV A;  3HTS B;  2RC6 A;  4ZCM A;  2X1D A;  3DKY A;  1FT9 A;  5J3L A;  1WJD A;  4P9S A;  3W5H A;  2R5Z B;  4JRA C;  5IYD J;  4M9X A;  1SFX A;  3GVA A;  1I27 A;  3B90 A;  2R7D A;  3CCQ I;  2XT2 A;  5KK1 A;  2C77 A;  2JT1 A;  4CCL A;  2AXL A;  5KVR A;  3WTZ A;  2Z9O A;  1X0C A;  4F7D A;  5EMN A;  3N90 A;  2GOM A;  3BWG A;  4MEY F;  3FXO A;  2VQC A;  5BS6 A;  3OFN A;  4XLF A;  3VNV A;  3ML6 A;  4H0E A;  2LDU A;  3VYS B;  1LLZ A;  4PAB A;  3O6B B;  2A61 A;  1QRC A;  4LIT A;  4R79 A;  2KIQ A;  4BE2 A;  2OBR A;  4F92 B;  4IHW A;  3GTQ J;  2L3D A;  1RIO H;  1JKO C;  2KQR A;  2VPR A;  4A6E A;  1QGZ A;  2C78 A;  4YZQ A;  2KLO A;  2V6E A;  2R0Q C;  1ZQ3 P;  4P3I A;  4UZF A;  4OZY A;  2BM1 A;  3FM3 A;  4YAU A;  3KX2 A;  1QBJ A;  3RQ4 A;  3S16 J;  1UST A;  1PJ7 A;  3BC9 A;  3T9G A;  2HVS A;  1OLT A;  3V42 A;  2H09 A;  2DY1 A;  1IXR C;  2DYS H;  4JMQ A;  1H42 A;  1JTX A;  5J6X A;  4G7Z F;  5FO1 A;  4YFK F;  1Z21 A;  1SFO J;  4X0C A;  1TWG J;  2EZH A;  4PJM A;  1W0U A;  2WZN A;  4PC2 A;  2XF7 A;  1D2E A;  3KYD B;  1YI2 I;  4N4N B;  5FD5 A;  2YPR A;  2F6C A;  4LLN A;  3LAP A;  3OY9 A;  2D74 A;  1UB9 A;  2ZXW H;  4XMY A;  2JRM A;  2D5V A;  1K78 B;  4UZE A;  3F8F A;  4XN3 A;  2PEC A;  2W25 A;  1BR2 A;  4H4K C;  4CCJ A;  3TO7 A;  4RDJ A;  4D1Q A;  1IDK A;  3A8K A;  3JX8 A;  3QYE A;  1LEB A;  3GSI A;  4NB5 A;  2FML A;  4CCM A;  3EQO A;  3W2F A;  4ZV4 A;  4W8R A;  1N77 A;  1USS A;  2D1H A;  3FY3 A;  1YRN A;  3U9G A;  2ZZQ A;  2IPQ X;  5BSX A;  3DF8 A;  1S7O A;  1OCP A;  3JRB A;  1NJI D;  2NT6 A;  2VFO A;  2KIU A;  3S8P A;  3DU5 A;  2J5P A;  2JZY A;  3F6V A;  2C5H A;  2EIX A;  2CJJ A;  5L3G A;  2XPW A;  4BHC A;  2GJK A;  4B3G A;  2DT6 A;  4ZZL A;  3HSE A;  2TCT A;  3CC4 I;  1WXR A;  4MLO A;  2XGJ A;  3L2V A;  4C2U A;  2O8X A;  2L9R A;  4Z4V A;  2CW8 A;  4E70 A;  1E3O C;  2R5Z A;  2ESN A;  1WSR A;  3LMM A;  3RJP A;  5HDG A;  4KIG A;  2R7R A;  1DU6 A;  4ZYA A;  1W7P D;  3GIR A;  3C2B A;  2E2I J;  2MAB A;  3L9F A;  2R5Y A;  3F72 A;  4OJO A;  1G2H A;  1AHD P;  1WSU A;  4IJA A;  3ASR A;  3QP6 A;  2LKP A;  2IS1 A;  4YCQ A;  1PDN C;  3C18 A;  3F8C A;  3I4N J;  4XD7 A;  4ZC3 A;  3LFK A;  3M3Y J;  1SKY B;  1GR1 A;  3BR0 A;  5CVV A;  5D5W B;  4C2L A;  2FQ3 A;  5ICF A;  1KU9 A;  2A05 A;  3MZY A;  4KIS A;  5F0C A;  4X7F A;  1OCR H;  1E3P A;  4RLF A;  4XM3 A;  1UHM A;  4LD5 A;  4KFC A;  4G8X A;  4ABZ A;  3SJM A;  1OFC X;  2OZU A;  3VMV A;  1O4X A;  1DDI A;  2AHQ A;  5FGM A;  5FKN A;  2VIX A;  1O8L A;  1J7K A;  2LY1 A;  1NG6 A;  3W6K B;  3PO3 J;  3I64 A;  2G0E A;  1F4K A;  2GK6 A;  1GVJ A;  1G3Y A;  4HV6 A;  3KEQ A;  1IO2 A;  3H09 A;  3JSP A;  4CCK A;  3BG5 A;  1B72 B;  1IRZ A;  2HTJ A;  4C30 A;  3TP3 A;  4RPB A;  2V1D A;  1KQ0 A;  3M4O J;  3WHC A;  3OR2 C;  1Q1V A;  4UUS A;  3D5R C;  1TYV A;  1HLV A;  2P5L C;  2KHM A;  3GUD A;  5JVG F;  3T53 B;  1BR4 A;  2BVM A;  4CZC A;  1O7F A;  4BBS J;  3W2W A;  2O6G E;  1XSD A;  4UXN A;  3QPT A;  2H1L A;  1KK2 A;  2DA1 A;  2LKS A;  2LOO A;  1VHE A;  3DWL E;  2ZZG A;  3LO8 A;  4CXF A;  2XEX A;  3SHF A;  1G3S A;  2E5Z A;  2M45 A;  2DOG A;  3CXC B;  1D0Z A;  5HZA A;  1R6R A;  3H0D A;  3GTK J;  2HVQ A;  3CUQ C;  1QRB A;  2E1M B;  4WXC A;  4A0X A;  4E4H A;  3AKZ A;  1SAU A;  3H92 A;  2DQL A;  3SFZ A;  3AVW A;  1RKW A;  5E1W A;  1O7L A;  1FC3 A;  1MH3 A;  3CP8 A;  2ADU A;  5F27 A;  4ESJ A;  2BGJ A;  1ENH A;  1EH7 A;  3ERM A;  4AF7 A;  2HWV A;  1ETQ A;  2CND A;  3KP2 A;  2BV6 A;  2PYG A;  4DK0 A;  5L3E A;  4DNC A;  1O8D A;  2ZFU A;  2V7W A;  3CCS B;  4U7D A;  4JOM A;  2CQX A;  4RAG A;  2RKH A;  5IPA A;  5K7Z A;  4MXN A;  2QGU A;  2VC1 A;  2LF7 A;  2O7O A;  4F7Z A;  4KMU X;  4CGZ A;  2JA5 J;  5KW9 A;  2VJ5 A;  5E79 C;  1ZAO A;  1S4M A;  3CMA B;  4X05 A;  3IH3 A;  2YWG A;  3I53 A;  4G6T B;  3K10 A;  4ZDL A;  4DBR A;  3I56 I;  3S17 J;  1KQS B;  2M5W A;  2BW3 A;  2VJ4 A;  1PKV A;  2HLD A;  1D8K A;  5EJC A;  1D0Y A;  2QX3 A;  1B1B A;  3G73 A;  3G2B A;  3GXO A;  1T39 A;  3H5R A;  2LY9 A;  2RC4 A;  1I8D A;  1R5H A;  5F6F A;  4EGY A;  2CG4 A;  2ZBU A;  1WFX A;  1G8X A;  4M3D A;  4UZU A;  3KPH A;  3QOP A;  2Y9Y A;  1QA3 A;  2BM4 A;  4P1W A;  1RR7 A;  1T38 A;  4FXU A;  1FIP A;  1TWF J;  2QSH X;  5IY5 H;  3LSP A;  1R00 A;  4KA4 A;  1TQI A;  1RWR A;  1D1N A;  5EEG A;  2HOS A;  1OYW A;  3MKZ A;  1UD6 A;  3BPV A;  4DQK A;  1OFD A;  4A3J J;  4IKF A;  3G1O A;  2X8K A;  2BW3 B;  4G7O F;  4M6V A;  4ENM A;  4LBZ A;  4D7M A;  1N07 A;  2KDO A;  1T95 A;  2ZZE A;  4AYB N;  1EH8 A;  4KKS A;  4GYG A;  5C1E A;  4G12 A;  1F1Z A;  1ZK8 A;  2ECC A;  3W2V A;  2BVL A;  4EAT A;  3LQE A;  4FE4 A;  3KP6 A;  2MD5 A;  1A04 A;  4PDK A;  1SMT A;  3MZ8 A;  5IP6 A;  1DU0 A;  2R7S A;  3ZBT A;  2Q0O A;  1MBH A;  2L0K A;  1Q86 D;  3P9K A;  3HSR A;  1E3X A;  1Z3Y A;  2JN6 A;  1YW7 A;  1WJB A;  2M0M A;  3OOP A;  1UHS A;  2CUE A;  1UMQ A;  2FBK A;  3SZG A;  2ELJ A;  2XGX A;  1QGP A;  1WH5 A;  2DFE A;  1ZR2 A;  2COM A;  3NRV A;  5IK2 A;  1VLO A;  4XOP A;  3CLQ A;  1X4O A;  3QPL A;  1UD4 A;  4UV9 A;  1U5T C;  3TGN A;  4LK0 F;  5B3S H;  1JGS A;  1LDD A;  5L3F A;  2BN4 A;  2QQA A;  1RU4 A;  3ZN0 A;  2LZJ A;  4A6D A;  1IUF A;  5HLG A;  2WTE A;  3ZMU A;  5FD6 A;  1VQO I;  4YAW A;  2B5O A;  1H89 C;  2HS5 A;  2P0W A;  4BHP A;  1EZG A;  1P9Q C;  2DLL A;  1VQP I;  5HOO A;  1IJF A;  1UEL B;  3PET A;  4Z4Z A;  5LLQ A;  3OYC A;  3JQR A;  3CF5 F;  2NOG A;  1QQ1 A;  3GTO J;  2Y2Z A;  6PAX A;  5J35 A;  3QOD A;  3SUC A;  5DUK A;  4EM2 A;  3N97 A;  4Z4T A;  1OGJ A;  1R5G A;  4OWR B;  3TQN A;  1D1B A;  3DFG A;  4OZZ A;  3PUF A;  1WJA A;  2EFG A;  3E20 A;  4UUS B;  4FX0 A;  2DU9 A;  2KJB A;  4IO9 F;  2X51 A;  1U0J A;  5GPA A;  3B6A A;  4PAA A;  5AIQ A;  3E5X A;  1BBY A;  5JHF A;  5LHG A;  3U6B A;  4ZGQ B;  2NZM A;  3D1N I;  3V8K A;  2M9H A;  2X53 S;  2OU2 A;  2WZP P;  5HXB A;  2EFP A;  2MC4 A;  1W0T A;  4AYB A;  1R58 A;  1U8R A;  1POG A;  2IBD A;  2PE3 A;  2Q6I A;  1OGM X;  1R7J A;  2VE8 A;  3HOU J;  1JTY A;  2HOE A;  1U6G A;  4GDF A;  2XAS A;  4B3A A;  2HDD A;  2IA0 A;  2DI3 A;  3WGI A;  3Q6Q A;  4XLP F;  2FMY A;  2DAO A;  3O8H A;  1F9N A;  2RVC A;  2L7Z A;  1JB9 A;  4XOR A;  3CB4 A;  2EK5 A;  4RM0 A;  2H8W A;  4A3L J;  1K5C A;  2E71 A;  3Q0V A;  3RKQ A;  1SAX A;  5LGT A;  1RI7 A;  2DA3 A;  1APL C;  4LJZ F;  1KQ5 A;  1BW5 A;  1X1P A;  4TKO B;  2QUF A;  1KU2 A;  4G1V A;  2QKL B;  2M30 A;  3H3Z A;  3A8J A;  1S7E A;  5KAF C;  1RMG A;  5BPD A;  4Y4R A;  2IXS A;  4IQJ A;  2CQN A;  4I7H A;  4PC1 A;  2E5N A;  3VMF A;  2JMW A;  3C2G A;  2K40 A;  3V7R A;  2CMP A;  3CDL A;  3FXL A;  4M0L A;  2X3H A;  1WH7 A;  5E8I A;  1Y39 A;  1JJ6 C;  1IXC A;  1UG2 A;  1T6Y A;  2DJI A;  3FMQ A;  1PE9 A;  3K2Z A;  3KEY A;  3TOA A;  4KJZ A;  2WC2 A;  1U78 A;  1YX3 A;  3BH7 B;  1MAB A;  3CD6 B;  1UD2 A;  3H36 A;  1FBQ A;  4P9U A;  2O61 A;  1Z67 A;  2KIS A;  4PJL A;  2H6B A;  3CLO A;  2XZP A;  5LHH A;  3UR3 C;  1XS9 A;  4RMN A;  2Y31 A;  4O5V A;  2HMA A;  2JJ1 A;  4QLC U;  3D5S C;  2QTL A;  4P12 A;  1MMA A;  3BY2 A;  1ZRD A;  2BGI A;  3G71 I;  2VON A;  1YW9 A;  3KIO A;  1XX5 A;  5TGT A;  4G9Y A;  3JR9 A;  3S3M A;  2UWM A;  2QMU A;  3ONY A;  1OB2 A;  3T0Y A;  3T8R A;  1CQX A;  1A6I A;  3O8G A;  4Y15 A;  1Z6R A;  3RYR A;  1FNB A;  1PUF A;  4MNU A;  3BPX A;  3CDH A;  2AQF A;  2ELH A;  1YYV A;  4L5I A;  1YQA A;  4YII A;  1IJW C;  3VYU B;  2R7W A;  4CHU A;  3OP1 A;  3CTA A;  4RB0 A;  1BOA A;  3BR3 A;  4IF4 A;  2XB0 X;  3WGG A;  3Q6R A;  1R1T A;  1VQ6 B;  5FRN A;  1JT0 A;  2DYI A;  1JA1 A;  5H6R A;  1QZE A;  5F04 A;  4XLE A;  2D3N A;  1QVU A;  1MGT A;  4V2G A;  2DPD A;  1D5V A;  2IGK A;  1YOV B;  4Q7J B;  3CMM A;  1B9M A;  2XGE A;  1FOX A;  3JTG A;  5JFR A;  3HOY J;  4WWV A;  1IN4 A;  3A4C A;  3WY9 A;  3HZJ A;  3I59 B;  3TW7 A;  1LDJ A;  3HXL A;  4E7J A;  1OCZ H;  2JSC A;  5FIU A;  4NUB A;  2BE5 F;  2VNK A;  1NB9 A;  4HW0 A;  2M5S A;  1L3L A;  4MFD A;  3OPO A;  2JA7 J;  1DAR A;  5M5X J;  2G9W A;  2OCE A;  1CNE A;  4M9Z A;  2GOX B;  3BC8 A;  1MKM A;  3S1Q J;  2H8R A;  2HXI A;  2OUM A;  5CVI A;  1YIT B;  5HKK A;  1IRG A;  4HIZ A;  3QYF A;  3Q9S A;  1BHE A;  4FK8 A;  4OPW A;  1K4Z A;  5IYR A;  4OIQ F;  2DK5 A;  3A01 B;  3E6D A;  4HSR A;  2GLO A;  3GLL A;  3KYC B;  3Q9V A;  2FX3 A;  1AIR A;  1B2R A;  2CUJ A;  2NOJ B;  2JWT A;  3GZ6 A;  3RPU A;  3IRR A;  3K9T A;  4KIB A;  1JKR C;  2VBW A;  2A3S A;  3G1L A;  2Y0S N;  5BPI A;  3V7A A;  4RM3 A;  5FLM J;  2M7A A;  3H9Q A;  2ME6 A;  4M74 A;  3VFZ A;  3CCE I;  5TY0 A;  3W2I A;  3RIQ A;  1BR1 A;  1AIP A;  2EJR A;  2XKO A;  3FDY A;  3OAA A;  1SD5 A;  1H88 C;  4E7I A;  2CSO A;  3P26 A;  1YJ9 B;  3AGP A;  4E7L A;  1D1C A;  1LDK B;  2DXI A;  4BY1 J;  1ZM2 A;  3MZH A;  3DCF A;  3K0L A;  4EQQ A;  2VBV A;  3OW7 A;  3GLX A;  3ZCO A;  1QU3 A;  4HF0 A;  4G7W A;  4N4O B;  3M1E A;  2X48 A;  1XGN A;  3COA C;  3FMS A;  4PGH A;  2DA5 A;  2CK3 A;  2DA2 A;  3EDP A;  3ES9 A;  1AKH B;  1R5B A;  4R8H A;  4XSZ F;  2NSP A;  4OAY A;  1OOC A;  4M72 A;  1ZTR A;  3CMY A;  1ETY A;  2P5K A;  3DKW A;  4KN7 X;  1QFZ A;  3L7W A;  4KYW A;  2HZD A;  2D3L A;  2DEU A;  1K61 A;  4WZT A;  3H94 A;  1GO2 A;  2KRC A;  2XND A;  2NNN A;  1RES A;  3FBI B;  1FZP B;  2O5R A;  3H0G J;  1O57 A;  2NVX J;  3MWM A;  5KAI C;  2N8G A;  1YIT I;  2NRA C;  2P8T A;  3QFS A;  1VQ9 B;  2Y0S A;  3CP2 A;  5FKK A;  4I6Z A;  1NK2 P;  2PLY A;  3QFT A;  1MJA A;  4FN5 A;  2KZV A;  3DEU A;  3QU3 A;  1T2K A;  3ZMT A;  2JJ2 A;  3WTV C;  2DJN A;  3O3K A;  3BG9 A;  4Z4W A;  5B5E C;  1W34 A;  3AVT A;  2LK2 A;  4AU7 A;  2JPB A;  4FT8 A;  2OK8 A;  4LBV A;  1X3Z B;  2NYX A;  3CME I;  3KFW X;  1KZH A;  2EB7 A;  2QE7 A;  3PSZ A;  1X58 A;  3VYR B;  3CJR B;  2ZO4 A;  5H5J A;  2P81 A;  1MBJ A;  3SZT A;  4B48 A;  2Z1D A;  1W36 D;  1V0E A;  3P27 A;  1MND A;  2HGC A;  5F0H A;  4WZL A;  4IX7 A;  4PJ0 C;  4P25 A;  3A1Y A;  1MDM B;  2BM0 A;  5ICC A;  4ZTJ A;  4C0S A;  2L7M P;  2OPT A;  2XNC A;  5GAG J;  4J0Q A;  4X6A J;  1QUE A;  2PJR B;  3HOW J;  5FRO A;  1FY7 A;  4IZZ A;  1PP8 F;  2BEO A;  3ABK H;  1BI3 A;  4D5F A;  2HTS A;  2V79 A;  3BR2 A;  3WU0 A;  1YRN B;  4AM3 A;  3GZN B;  5J8C A;  4AIH A;  1TVC A;  2VBY A;  1V5F A;  1G3W A;  4BQN A;  1Z0X A;  2RN7 A;  2QCO A;  2W1O A;  1EF4 A;  2VB6 A;  5K7F A;  4NC8 A;  1OPC A;  1GHC A;  2OCC H;  2OZ6 A;  3SDG A;  3J7Z I;  1VQ8 I;  2DTR A;  4N9I A;  4NQW B;  5FNZ A;  4KH3 A;  2OQR A;  2B7E A;  2VQH A;  1FNM A;  2B9S A;  2AHO A;  4ZYD A;  2PMU A;  4RBO A;  1YHQ B;  2I5U A;  1PVE A;  5LFA A;  1N8R D;  2F5V A;  1G6N A;  2WAQ N;  2MBF A;  1QVT A;  1ZAR A;  3BJ6 A;  3CJN A;  3WXM A;  4R71 A;  2CUF A;  5ERI A;  2HXO A;  4P6Y A;  3M07 A;  3CW2 A;  5M3F J;  2XTW A;  2NTP A;  5E18 F;  2B63 J;  4Z4R A;  4W97 A;  1HF0 A;  2W82 A;  5E8G A;  2EQR A;  1S29 A;  5THX A;  3GYH X;  1T0F C;  1J2X A;  1YW8 A;  3ZQI A;  4BDZ A;  3QWL A;  3WOD F;  4B44 A;  3K4K A;  5TRD A;  1P4X A;  2CW0 F;  3AVX A;  2JIZ A;  3TO9 A;  1K83 J;  1O8F A;  1KTV A;  1OFM A;  3OYH A;  4Y17 A;  3GWZ A;  3FX3 A;  1NH3 A;  1IG7 A;  1DDN A;  2W6I A;  3JU4 A;  5K7H A;  1QNT A;  2YS9 A;  1QGY A;  1QHH D;  4EW9 A;  2R5Y B;  4RCZ A;  4ZDP A;  2V9V A;  5FJ8 J;  1KQ8 A;  3L2U A;  3FJO A;  1HW5 A;  1CLW A;  1PXZ A;  3GZ5 A;  4YZX A;  1EV7 A;  2KIF A;  3M8F A;  3UNG C;  2GQQ A;  2Y69 H;  1E64 A;  2P5V A;  4G7X A;  4HE6 A;  4QFM A;  2E34 A;  3BT9 A;  1OCT C;  2DFI A;  1HG8 A;  1S6L A;  1YO5 C;  4X8I A;  1MMG A;  3IP4 B;  1HW1 A;  1WJF A;  3C2H A;  3CPX A;  4WXD A;  4EJU A;  1S72 B;  2M7B A;  3AVV A;  2EH3 A;  3HC7 A;  2XV4 S;  2XAH A;  1T0F A;  3ZSC A;  1T8I A;  3ABL H;  2LMD A;  1TQM A;  3EUH A;  5IYQ A;  3K4B A;  5L46 A;  2O0W A;  4XLN F;  1IDY A;  2BSP A;  4BEH A;  4CIC A;  2F4N A;  2EFQ A;  4NC6 A;  4I76 A;  3ZQG A;  4G7H F;  3OEE A;  4LFU A;  3HGY A;  3G71 B;  3H5A A;  1SKQ A;  2KRF A;  2K02 A;  3HKZ A;  4B3X A;  1WP6 A;  4M3E A;  4KKU A;  1LFB A;  4JBA A;  4U0V A;  4LC0 A;  1WI9 A;  4XON A;  4V2F A;  3I55 B;  1W5T A;  5ILV A;  2WAD A;  3VSL A;  4BDY A;  1Y8Q B;  2Y9Z A;  3L00 A;  3HRM A;  5BNG A;  1SC7 A;  3HG9 A;  4ZDO A;  1ZLJ A;  3ZZT A;  3DLL F;  2V6C A;  5DCF A;  1KC8 D;  3HPG A;  5GAH J;  3I59 A;  3JRD A;  1TYW A;  3SXY A;  3BP8 A;  1FYM A;  4OOX A;  3AVY A;  2Q8K A;  4IHY A;  2O0V A;  2ZL6 A;  1X1A A;  4OPS A;  1NHC A;  2DMT A;  1R5N A;  3MEX A;  4WZE A;  3NEU A;  3MCA A;  4I09 A;  2QSF X;  1OB5 A;  3HRS A;  4NDL A;  2W7Z A;  4IEJ A;  3CCU I;  3E5U A;  1X3W B;  4A3D J;  1FMV A;  1O88 A;  1YJW I;  3U21 A;  3CC7 B;  4U0Y A;  3TDU C;  3GBG A;  4ZYG A;  3K70 C;  3ECO A;  2EFN A;  1IGN A;  4RPD A;  4A3G J;  3WU1 B;  5FL7 A;  1L0O C;  4HPQ A;  3X2Q H;  2BYV E;  3BR5 A;  1MMD A;  5CLS A;  4PSW A;  1EFR A;  2G0Y A;  2IGN A;  3BCF A;  3DTI A;  2PG4 A;  2VXD A;  2JA2 A;  1XMK A;  5HLI A;  4ZH4 F;  4WF2 A;  1W5S A;  4B1R A;  2CRG A;  5CVJ A;  5F08 A;  3AFH A;  3BH6 B;  3BLY A;  2KKO A;  1BI0 A;  2DW4 A;  2H1K A;  1KK3 A;  3ZP5 A;  1B4A A;  2HDW A;  2VAS A;  1KRH A;  5D4R A;  1OB0 A;  2EIK H;  4XSX F;  3LSJ A;  5C1C A;  3GQ8 A;  1ZHF A;  3NWT A;  5IT3 A;  5M5Y J;  1IA5 A;  3CD6 I;  2JA6 J;  4XNF A;  1K7A A;  3OIQ A;  3R60 A;  2IA2 A;  3MD2 A;  1JHH A;  2D45 A;  3MMP A;  4K2E A;  4F91 B;  1MRZ A;  1PJR A;  3I4P A;  4HBL A;  1GV5 A;  2XHK A;  2VNJ A;  3AG4 H;  2OTJ I;  1ZG1 A;  4BH9 A;  3CDI A;  3ZOB A;  5HVQ C;  1OJL A;  5HNH A;  4X0G A;  1KCD A;  3M7G A;  1G59 A;  1WKM A;  3QFC A;  2R7F A;  4IXA A;  2TRT A;  3FMR A;  1IV6 A;  3RZO J;  1LLW A;  1W5C C;  2JUC A;  1FPQ A;  2VJJ A;  2BMW A;  1M1K D;  2XUB A;  3L09 A;  1AKH A;  3QYB A;  1VHO A;  2STW A;  4BNC A;  5K5O A;  1K4T A;  3JAM K;  1BN8 A;  1LE8 B;  2E1O A;  2DOA A;  2V5I A;  3LNQ A;  2O8K A;  5ILU A;  1QGA A;  4EM1 A;  1DAB A;  2DMP A;  3UKG A;  2UZK A;  3OJW A;  1XGS A;  4MHG A;  2VQL A;  2K9M A;  1ELO A;  1BA5 A;  1QG0 A;  2CRV A;  3I4M J;  3JRG A;  3DPT A;  2CWE A;  4ENK A;  1F43 A;  4XOT A;  3CCV B;  3FF5 A;  2GBY A;  4WCG A;  3JRI A;  1E2X A;  1FOK A;  2R7U A;  2RAE A;  1XD7 A;  3K69 A;  2QWW A;  3VR6 A;  4HG2 A;  1CZF A;  2Z6B D;  2MFZ A;  3AK5 A;  1U5T B;  1G3T A;  1N78 A;  3PUB A;  4II2 A;  1JUM A;  1ZN2 A;  2DBB A;  3S1R J;  1IB0 A;  3IWF A;  1I5Z A;  3S2H J;  1J5Y A;  2BM5 A;  2DOE A;  3J7A Y;  1ZLK A;  5A89 A;  4JX5 A;  2BXY A;  2Z3Y A;  1H9T A;  1U2R A;  4LG0 B;  4LK1 F;  2MSY A;  4LB6 B;  2QF7 A;  5D6E A;  3D5L A;  5H6Q A;  4DYC A;  2VBS A;  3L2Q A;  3HSF A;  4RB3 C;  5ILS A;  3RKW A;  4CQJ A;  5M3M J;  3ZUG A;  2XNJ A;  5E6T A;  2FSW A;  2QKM B;  3BG3 A;  2DFF A;  4GRI A;  2DA6 A;  3G6E I;  2ZME C;  1FSE A;  2X1E A;  3LSM A;  2ZJP F;  1GDT A;  4IHX A;  1MJB A;  3AG2 H;  2M2E A;  2QQ9 A;  3FKS A;  5DN6 A;  2R6H A;  4NBQ A;  1ZRF A;  5EZH A;  1ETK A;  4HEA 2;  3VSK A;  3CMA I;  3KL9 A;  4NNJ A;  2GXG A;  4D9J A;  3OL4 A;  4JP0 A;  2PFB A;  2R3S A;  4AID A;  2C4T A;  4W8T A;  4C2M J;  1O8M A;  1Y1W J;  4Z4S A;  2HQ5 A;  3BTC A;  3H35 A;  4P22 A;  3WBJ A;  4M3G A;  2QEX I;  5L3B A;  4FHT A;  2EIN H;  3CCS I;  5JBQ A;  4XRS A;  4AVZ A;  2FQ4 A;  2Z8G A;  5IP9 J;  5C44 J;  3GFJ A;  2DT7 B;  3GW2 A;  3KZZ A;  1YHQ I;  4UVB A;  5GV7 A;  4HLY A;  3SZE A;  3RIR A;  4HZF A;  3WTX C;  4U7B A;  3A3G A;  1QA6 A;  2XAU A;  2HDN B;  1X19 A;  3HUG B;  4GGG A;  3JRA A;  2X3U A;  3WWG A;  3KRG A;  5J4Y A;  4DZJ A;  3R61 A;  2ELK A;  2XDV A;  5HOD A;  2V26 A;  3B8Y A;  1UHW A;  1X1C A;  4Q47 A;  2P6S A;  4HLX A;  1Z9C A;  1DQU A;  4M9S A;  2L9N A;  4C2T A;  2RC5 A;  2VBE A;  1YLO A;  2BBY A;  3SYT A;  3OJX A;  1WCM J;  4KN4 X;  5FKM A;  3NAR A;  1FNC A;  2R7O A;  1N25 A;  2JQ7 A;  2MD0 A;  4M6Y A;  4XKC A;  5D5U B;  4EH1 A;  5EGO A;  4L9T A;  4BS9 A;  1FNN A;  1SD4 A;  1MH4 A;  3BG6 A;  2WAF A;  2CF4 A;  3J81 k;  3P9C A;  3CME B;  2XGC A;  4UY8 I;  3GTP J;  4P2N A;  3WYA A;  3ABU A;  2FVG A;  4CYD A;  1HW2 A;  3LMW A;  4BJT A;  1JUP A;  4KIT B;  2R7X A;  1KA8 A;  2Y30 A;  1WHU A;  5J1R A;  3WTU C;  2IT0 A;  4AWX B;  4GXO A;  4L18 B;  1BX0 A;  3R4K A;  1WOP A;  1X1B A;  1G7T A;  1ONV A;  5LEJ A;  2BGC A;  1YIJ I;  3KCC A;  5HLT A;  1WVR A;  1VQN I;  1KK1 A;  3FHZ A;  2ZTN A;  2NVY J;  2OA4 A;  1UAA A;  1R49 A;  1WSV A;  2Z16 A;  4N3G A;  1VQ7 I;  3OIP A;  2QM3 A;  3OYL A;  2ZJR F;  5FLX K;  1AMO A;  1BI1 A;  2YX7 A;  4P3Y A;  3AG3 H;  2VYQ A;  3VB2 A;  3JCU C;  4NK6 A;  2O1D A;  3LNN A;  5LEK A;  3JRF A;  4J00 A;  2A6E F;  1NHA A;  4YAF A;  2WV0 A;  2XB5 A;  3BZK A;  3PEN A;  1IW7 F;  2ME0 A;  1FP2 A;  3CF2 A;  5E3O A;  5AON A;  2ISZ A;  4UUT A;  3HM5 A;  3HRU A;  2FNP A;  1JKP C;  4TMV A;  1K8A D;  2BHZ A;  4X7E A;  4UVC A;  2E19 A;  3VYT B;  4BAC A;  2IVM A;  3I71 A;  2VOP A;  3HJE A;  2ZTG A;  4QV2 A;  3JTH A;  1EP3 B;  2WB1 A;  3ZBU A;  1LVA A;  3S3N A;  1QVF B;  2ZL5 A;  3KE2 A;  5HNF A;  2UXX A;  3ONQ A;  1DP7 P;  3KEO A;  4EMS A;  1QVG B;  4DYQ A;  2DA7 A;  4L9N A;  1QPM A;  4A3C J;  2X6O A;  1FOW A;  1QZY A;  4RGS A;  1IN6 A;  2E60 A;  2QVO A;  2QSG X;  2XAF A;  1OIS A;  3WE3 A;  2QXZ A;  5EEA A;  3EYI A;  3BCA A;  1ETW A;  1WGX A;  2W85 A;  3IC7 A;  4RD0 A;  3T56 B;  2RQQ A;  2XZO A;  1Z7U A;  1R1V A;  5KNL A;  1KGS A;  4PC3 A;  1VJS A;  1UZC A;  1V4R A;  2EA4 A;  5DEQ A;  1RZ4 A;  3MMY B;  3RCO A;  1MZB A;  3GVK A;  2X6W A;  4EVI A;  4RD1 A;  3W2H A;  3BTI A;  2LBF A;  2F4M B;  1W87 A;  3AGQ A;  2HI3 A;  4BGD A;  1LFP A;  2KT0 A;  3HHG A;  2RGV A;  5EGO B;  1MMN A;  3SY2 A;  3WTT C;  2ZME A;  3QOE A;  1U9N A;  3ISX A;  2C5B A;  4P55 A;  1WZ2 A;  1BMF A;  4F93 B;  1R9T J;  2O03 A;  2W6J A;  3DKX A;  4QVJ A;  1P7J A;  4B8X A;  4Y7C A;  1Q7Y D;  3W6V A;  5IOY A;  1J09 A;  1ULY A;  4YFN F;  2JN9 A;  2I1L A;  1S5L C;  4MQ9 F;  1T56 A;  3ERE D;  4CO8 A;  2E1C A;  1TSP A;  3PSS A;  3IL2 A;  1HXD A;  2PMH A;  3CRZ A;  2LF8 A;  2W57 A;  1W7P A;  3OE7 A;  4BU2 A;  4Y3O A;  2CV1 A;  4A5N A;  3V8J A;  1WOR A;  3DP7 A;  1U9O A;  3RYP A;  3FBN B;  1PLU A;  3HAG A;  3JSO A;  1X2N A;  4RDU A;  2LG4 A;  1G7S A;  3P9I A;  1IRX A;  1R4N B;  3G05 A;  2PMZ A;  3AL0 C;  2VKE A;  3ZMS A;  1WU8 A;  1A8P A;  1SMY F;  2MLK A;  5LGN A;  3ZQL A;  1NK3 P;  3LQ6 A;  5DS9 A;  4KMF A;  4A93 J;  1GQ8 A;  5H59 A;  3DBR B;  1XDS A;  3ABT A;  3ESW B;  4CUG A;  3LOC A;  3BNW A;  1WOO A;  2CUZ A;  3TMO A;  3K4N A;  2PBI A;  3T1B A;  4ZJZ A;  5HS7 A;  4IOA F;  2DCU A;  3HOZ J;  2PJR A;  4LLL A;  4BHB A;  5DCM A;  1OGI A;  1Y8R B;  1YG2 A;  5ICG A;  3GRH A;  2GWR A;  1LPQ A;  3FXJ A;  3VDX A;  3J80 K;  5E1Z B;  2QA4 I;  1EWY A;  1WPC A;  1GXQ A;  3A1P A;  2K7L A;  3REO A;  3OKX A;  3KP4 A;  1HDD C;  3PFY A;  2XSJ C;  4TMT A;  4RD4 A;  2J7K A;  5F4M A;  2VXZ A;  1GVH A;  4DJA A;  1O8G A;  3IRQ A;  1KYZ A;  5D4S A;  1TW3 A;  4C9Y A;  3VSU A;  1VQ5 I;  4BE1 A;  2DMN A;  2MC3 A;  3FM5 A;  2V31 A;  3L1P A;  3TO6 A;  3UW0 A;  2HQA A;  3FXQ A;  2FD5 A;  4BEH B;  3OYJ A;  3KET A;  1TWC J;  2X6Y A;  2K5C A;  1H80 A;  3OEH A;  3WTS C;  1I3Q J;  1MBF A;  3DTE A;  4OPV A;  1ZEL A;  4PSX A;  4HRI A;  1YE9 A;  1YS7 A;  4BPR A;  3MKL A;  1V5V A;  3PNV A;  2ZBV A;  2NAZ A;  1WWX A;  5FO5 A;  1SFK A;  2OF7 A;  4HQM A;  5FFX A;  2OQG A;  4ESF A;  3OS1 A;  3VNU A;  3R0A A;  1H9G A;  4NK8 A;  4RB1 A;  3SYJ A;  1JXS A;  3TBI A;  1PP7 U;  4W1U A;  2R7T A;  4X7C A;  1X3U A;  4Z6Y A;  3QRF F;  2O3F A;  2MG4 A;  3J81 K;  1FOY A;  2VKH A;  4HYE A;  4KIF A;  5FB2 A;  3OS2 A;  3IKT A;  3RKX A;  1CF7 B;  2IGM A;  3QP5 A;  3MAJ A;  1V5E A;  5JR3 A;  4L5J A;  3IHU A;  2LD5 A;  1IAW A;  2OJE D;  3S2W A;  2QYO A;  4MQV A;  3AST A;  2HDC A;  2I8D A;  2XTY A;  4QHY A;  4BXU A;  2R7Q A;  2GA1 A;  4DW6 A;  1DPR A;  1RC9 A;  4F52 A;  4NBS A;  4W8S A;  5D5X B;  3P5J A;  4I99 C;  1GXP A;  2LTP A;  3FXR A;  1UCR A;  3WG7 H;  4LG0 A;  4Q48 A;  3FXM A;  3HOT A;  4IHT A;  3P4G A;  1V5G A;  3ZQC A;  1X1D A;  3S2D J;  1STZ A;  1Z7L A;  2E1M C;  3HDD A;  1D8J A;  1FTZ A;  4HF1 A;  5CQG A;  5TJJ A;  1HKT A;  5J3O A;  3GQ9 A;  5FRM A;  1I1S A;  4Z05 A;  5J40 A;  1H8H A;  4FWT A;  1OGO X;  2CFO A;  1IB4 A;  2FOK A;  4XQF A;  1U5T A;  2IGO A;  2LSO A;  3PA2 A;  1Q1H A;  2KJC A;  2JDI A;  5F1J A;  4GYI A;  3B82 A;  2E7X A;  3E6B A;  5J8F A;  1I6H J;  4LBW A;  4BQQ A;  1Z1D A;  3WU2 C;  4Z4Y A;  3MN2 A;  2YX4 A;  3FK6 A;  3KLO A;  3E6C C;  2VKD A;  1VF7 A;  3W2G A;  3WNC A;  2FBI A;  2YWE A;  1XCB A;  1LM1 A;  1K6O A;  1BX1 A;  4YAO A;  1HC8 A;  2IEK A;  1F36 A;  2XKP A;  3MQ0 A;  1XTA A;  3OOU A;  1PUE E;  3OYF A;  3S15 J;  4AC9 A;  3W2A A;  2VC0 A;  4QTR A;  3CJT B;  1U3E M;  1K9M D;  2RRE A;  1DBG A;  1TWH J;  2CGP A;  2VT2 A;  2FE3 A;  2DTZ A;  2ZSH B;  1KK0 A;  1XQB A;  1UD3 A;  3ZZU A;  1Y0N A;  1I1G A;  2AQE A;  2CYY A;  4XLC A;  1O3T A;  1M1E B;  5DD4 A;  4UB6 C;  3GQA A;  4EJW A;  1AA7 A;  1MD0 A;  2HQN A;  3TOB A;  3U1D A;  5LGU A;  3CC7 I;  4MTD A;  1SD7 A;  2OTJ B;  4Q4Z F;  5TIS C;  2M8G X;  4C43 A;  2EPF A;  2VUM J;  1SEU A;  3ZC3 A;  2QN6 A;  2HKX A;  2HFH A;  2K9Q A;  2VJI A;  4LIU A;  1R36 A;  5BQT A;  3RZD J;  3B8H A;  3GVJ A;  1K78 A;  3ASN H;  2DER A;  1N75 A;  4D5C A;  3CO7 C;  2E35 A;  1UD5 A;  4ACA A;  3DU6 A;  1VZ0 A;  3PFI A;  1I39 A;  5LBQ A;  1YX2 A;  1JUS A;  5TV2 A;  5DTD A;  3LAJ A;  2GXB A;  2RDP A;  5E3L A;  1ZGA A;  1YI2 B;  2K86 A;  2WY7 Q;  2ACJ A;  2ZXI A;  3R6J A;  1MMS A;  3NAU A;  3L2C A;  5C4X J;  3SEJ A;  4HX8 A;  3HYI A;  2G7U A;  5FFZ A;  2FJ1 A;  1DGR M;  2A69 F;  1U2W A;  2WAE A;  3CQZ J;  1O8J A;  1QA1 A;  1YIO A;  2W48 A;  3V8L A;  5C3E J;  1EXM A;  4OMZ A;  4GFB A;  4KKT A;  4I98 B;  1NB0 A;  3OMY A;  2A07 F;  1RNL A;  1M90 D;  3CC2 I;  1N08 A;  4AF6 A;  3LSG A;  1DGW Y;  1WJC A;  1NBM A;  4QVA A;  4WQM A;  1RKT A;  2XZL A;  2ID3 A;  3OYN A;  3S93 A;  3HTU A;  3WHB A;  1QH0 A;  4RD3 A;  2WB1 N;  1WMR A;  1MSF C;  1TW2 A;  2COB A;  3HHH A;  3FPK A;  4RA2 A;  3ZRG A;  1Y1V J;  2DDA A;  2D1V A;  2DO7 A;  1OR7 A;  3QU6 A;  5JLX A;  4F3Q A;  5LRR A;  1VFC A;  2CW5 A;  1Y56 A;  2VKV A;  1YJ9 I;  3F9K A;  1XGO A;  4L5E A;  4CH7 A;  4FAS D;  3W5V A;  4KT6 A;  3VO1 A;  2H94 A;  1YJN B;  4YG2 F;  3C3W A;  5IYP A;  2JJ7 A;  4RAY A;  2CU7 A;  3EUA A;  1EA3 A;  1T33 A;  3Q3A A;  1Q9S A;  3I1F A;  1QO0 D;  2ZZF A;  1DPU A;  3SJZ A;  2YUH A;  2ZBK A;  1TLH B;  3FK7 A;  3OZU A;  4WX9 A;  2Q2E A;  2XC1 A;  1QJV A;  3PQK A;  2GIZ A;  1R5I D;  2P7V B;  2K4B A;  5LRS A;  3IWZ A;  4HNT A;  1S0U A;  3PIP F;  2DOD A;  2KMU A;  4MO7 A;  2QLZ A;  4NC7 A;  3CCM B;  4LMY A;  3SZP A;  3CCM I;  3QE2 A;  2DA4 A;  3OV8 A;  4IRI A;  4P96 A;  5JVT A;  1HA3 A;  4MFE A;  2R92 J;  2QYU A;  4U4B A;  1LEA A;  4GCV A;  3KLN A;  3LA3 A;  2D9R A;  1ON1 A;  1SVO A;  2HZT A;  1EFT A;  2CS3 A;  5LD2 C;  2HU9 A;  1V0F A;  2QTZ A;  3A35 A;  2ZB9 A;  2LKX A;  3RY8 A;  1HQC A;  3KEW A;  2F5D A;  3EQL F;  4OAZ A;  3B02 A;  4OIN F;  3RKY A;  1EH6 A;  2MH2 A;  4G6D A;  4Y33 A;  3W6J B;  3WBK A;  3L2W A;  2BM6 A;  2IS6 A;  3ZPP A;  5HS8 A;  2G7H A;  2X6X A;  1P6R A;  3ELK A;  1WOS A;  4B09 A;  5J1Y A;  2DIE A;  4A69 C;  2XOK A;  2M0C A;  2ZJQ F;  1TZL A;  2RNJ A;  3A2K A;  3FPP A;  2EZK A;  2OBT A;  3BY1 A;  3OZV A;  1ETV A;  2LR8 A;  5H20 A;  1YIJ B;  1FWZ A;  2X4H A;  1E0E A;  3P7N A;  3OYA A;  4Z06 A;  4L9V A;  3SFI A;  3FIS A;  4I02 A;  5DDG A;  2C4U A;  1HKQ A;  2R7V A;  3JW4 A;  5AN9 A;  3TH0 A;  2OBP A;  2IS2 A;  1P2F A;  2L7F P;  2V1N A;  4I01 A;  3TW6 A;  1V55 H;  1SAN A;  1QFY A;  1FJL A;  2QGG A;  3KP7 A;  5F64 A;  4OOI A;  3CC4 B;  2O17 A;  2TDX A;  1IDZ A;  3E97 A;  2JVH A;  1R5O A;  1RR8 C;  3A03 A;  2P3M A;  1K6Y A;  1XDU A;  1F5T A;  4CYC B;  1J9Z A;  2IW5 A;  3LFU A;  1FRN A;  1OCC H;  2GPJ A;  2F4O B;  1VQM I;  4M53 A;  2QA4 B;  4D0P A;  1ZRC A;  2OAZ A;  3NQO A;  4PZJ A;  3WTW C;  1P4M A;  1OMI A;  5EG0 B;  2PX9 A;  4OJ5 A;  2X0K A;  2W7N A;  5D8L B;  1JE8 A;  4MEX F;  2AO9 A;  2ZSI B;  1MNE A;  3TP0 A;  5J4V A;  2R9V A;  3E3V A;  1J9I A;  3DU1 X;  4ASU A;  2UXN A;  4DNT B;  3F8M A;  1E3Z A;  2BY0 A;  1IZ1 A;  4QUZ A;  4N0B A;  3AVU A;  2MYS A;  4A3I J;  2OYN A;  3PM1 A;  1A36 A;  4IHV A;  1VLY A;  3BQJ A;  2EA2 A;  3FKJ A;  1W2B B;  1B59 A;  1AOY A;  2HVR A;  3S3O A;  5KSW B;  1BQE A;  1J0R A;  3CO6 C;  2LVS A;  3H3V K;  4RCY A;  3OL3 A;  3CUQ A;  3IKV A;  2GAU A;  4PFO A;  4XL9 A;  4NHJ A;  4I84 A;  1W7P B;  2LRE A;  1FMW A;  1TWA J;  4FCY A;  3C1D A;  1UJ8 A;  1SM4 A;  3GO5 A;  1XGM A;  3LSH A;  3S32 A;  1TTT A;  1RUO A;  5EG0 A;  2XVC A;  1IC8 A;  2V9K A;  4IPA A;  1YFH A;  2R93 J;  1PYV A;  3U6K A;  3BQZ A;  2GQF A;  3ZQ7 A;  4NCN A;  3OYE A;  1R23 A;  2ZXJ A;  4MGR A;  5CPR B;  3GTG J;  2JSP A;  4BJ6 C;  2CQ7 A;  2ZME B;  3JRH A;  2YR2 A;  3D0S A;  2V9P A;  1S3J A;  5GTI C;  3HOS A;  1SVM A;  3HIF A;  4Y7N J;  4DQL A;  2QY1 A;  2QQ8 A;  1WDT A;  1VQK B;  3ASQ A;  2F3L A;  1E1Q A;  3G6E B;  4L0Y B;  3CCQ B;  1P7I A;  3OZW A;  5BSY A;  3L2R A;  2ZFW A;  3Q38 A;  2YWH A;  4GO1 A;  1W9X A;  4YXW A;  1GV2 A;  4S0H B;  2GM4 A;  5EF6 A;  1NRK A;  3T51 B;  4HQE A;  4WK8 F;  1KQ9 A;  2FU4 A;  2A5W A;  4BE0 A;  4PGO A;  1V54 H;  2WY8 Q;  3H1C A;  1EKE A;  3AL0 B;  2ZIT A;  2MA3 A;  1ZUN B;  2IOU G;  3PQJ A;  2JUG A;  4Z2Y A;  4A12 A;  2OTL I;  2PJP A;  1GUU A;  1TQP A;  1B23 P;  5J47 A;  1TUI A;  1GLN A;  1WQ2 A;  3W3C A;  4M1K A;  5AMV A;  2E36 A;  4RDK A;  1B8I B;  4G6Q A;  4OOS A;  2EV5 A;  3IV5 A;  1NTC A;  3FWE A;  5DNS A;  4DQ2 A;  2NXN B;  1T6Z A;  2PYH A;  1KJZ A;  3QPS A;  2F5E A;  4ZCI A;  4IQ4 A;  4CYC A;  1QFJ A;  1A5J A;  2EIM H;  1VF9 A;  1KON A;  3BRO A;  3BJA A;  4YFO A;  2AS5 F;  4S05 A;  1BJZ A;  4TV7 A;  1WI3 A;  3G3Z A;  2OD5 A;  3ZR8 X;  1JI8 A;  5CDF A;  1D5Y A;  1VQ4 I;  2JPC A;  1FP1 D;  2WPD A;  4RJL A;  4BQO A;  4HNV A;  2BY2 A;  4X1E A;  3RTR A;  4OOV A;  2Z2S B;  1K8F A;  3TL4 X;  3K1M A;  2E1N A;  4XBF A;  2OK7 A;  1Q82 D;  4N3N A;  4E7Z A;  3NAW A;  2EFO A;  1IUY A;  4IL6 C;  4HA8 A;  5H2F C;  1FTT A;  4XRS G;  3K7A J;  4WZK A;  4EEF G;  1HF2 A;  1G4D A;  3KP5 A;  1K79 A;  1A6Q A;  2IRF G;  1K73 D;  4IHS A;  4TMX A;  3LQQ A;  5IOZ A;  3GTM J;  1S7A A;  4BQA A;  2VOO A;  2VBX A;  2P4W A;  2V1X A;  3VST A;  1JHF A;  2GIV A;  3DEW A;  1A35 A;  3ZZ0 A;  3ASP A;  2QZA A;  3CCR I;  3PIO F;  2VFM A;  2XSD C;  3K70 D;  4BY7 J;  1F60 A;  3ROU A;  4YHB A;  1CF7 A;  4U9U A;  4DYR A;  3GFI A;  1K4S A;  3R6K A;  4ANJ A;  2INU A;  2NT9 A;  4F55 A;  2YSR A;  3BZC A;  2UVF A;  4OU0 A;  2L7K A;  1LB2 A;  1W1W E;  2CQK A;  1REP C;  4CCO A;  5DV5 A;  2J8I A;  2DET A;  3R0J A;  5D8K B;  1QUF A;  1LNW A;  5GV8 A;  2LH9 A;  4KUM A;  2XAJ A;  4W8Q A;  2STT A;  5ICE A;  5HDN A;  1W4M A;  4Y13 A;  3JQP A;  2M87 A;  3PNY A;  3HRT A;  1YJN I;  1FRQ A;  3CCL B;  1D1A A;  1N0U A;  3VEP A;  1ETX A;  1B9N A;  2L9S A;  4C3I J;  2DOF A;  2FOW A;  3IAS 2;  1TNT A;  4Z1M A;  3LA2 A;  5DCM B;  4XK4 A;  2O0Y A;  1Z3X A;  1PUF B;  4IVN A;  4RD2 A;  3I9V 2;  4C3J J;  1XSV A;  2MGQ A;  3ABM H;  1FX7 A;  4K1X A;  4TMZ A;  5E1X A;  1C0W A;  1YLF A;  2HKO A;  3CES A;  3I3L A;  1O8H A;  1LVK A;  1W35 A;  1YX5 A;  2KRH A;  3GQB A;  3OS0 A;  3GTL J;  3SDB A;  1VQ7 B;  1N05 A;  3FZV A;  5J1U A;  3FXU A;  4BXX J;  5JHU A;  3RI4 A;  1ZM9 A;  3LWF A;  4A0Y A;  1LUJ B;  2FF4 A;  4TT3 A;  2HPI A;  1G7C A;  2Q6O A;  4X06 A;  3GVL A;  3DDY A;  3O2P E;  2Z33 A;  3H9J A;  2CV0 A;  4ROX A;  3BDD A;  3ZIA A;  2NS7 A;  3I58 A;  1TYU A;  2YWF A;  4CZZ A;  1TTY A;  5F0F A;  3F21 A;  1J59 A;  4HX7 A;  1JKQ C;  1XG2 A;  1AU7 A;  1MW7 A;  4DK1 A;  2VI6 A;  4PJJ A;  5A2Q K;  1HZE A;  2NPF A;  1YJW B;  4ON0 A;  3EPZ A;  3LJY A;  1V3F A;  3FKI J;  2K3F A;  4M73 A;  2PLF A;  2Q6K A;  2XRO A;  2JVG A;  1GT0 C;  4XR6 A;  3OSG A;  2VL8 A;  3ZMV A;  4H9G A;  1IRF A;  2X9D A;  4TN1 A;  2O6W A;  3V4G A;  4JX6 A;  1RRJ A;  3JUR A;  3GFM A;  1TC3 C;  4LGW A;  4RGX A;  1VI0 A;  4RAF A;  1B72 A;  3EYY A;  1ZH5 A;  3ASS A;  4N9H A;  2OV7 A;  3GTJ J;  3VWB A;  2RV8 A;  2FUG 2;  5FKO A;  2V4D A;  1E17 A;  2NTQ A;  3SEZ A;  2O9L A;  4OIP F;  1Z77 A;  2ZXH A;  1X4P A;  4RD6 A;  1KZL A;  4EGZ A;  1XN7 A;  4L9J A;  2GA2 A;  2GZW A;  4DGW B;  5C4J J;  3MKW B;  5IP7 J;  2LC2 A;  5A2Q Z;  4LOC A;  2DPU A;  2DMQ A;  2IS4 A; 
#chains in the Genus database with same CATH homology
 3RPU D;  2Z1D A;  4B48 A;  4DJA A;  1HVX A;  1MND A;  1O8G A;  2WJV A;  4IX7 A;  4ITV A;  4CSW A;  4C9Y A;  2UVE A;  3VSU A;  3PSF A;  3A1Y A;  4BE1 A;  4ZTJ A;  2X1D A;  3DKY A;  1WJD A;  3EUK L;  2K9L A;  2V31 A;  2PJR B;  2WBM A;  3UW0 A;  5FRO A;  4OJL A;  2A6T A;  4IZZ A;  2HQA A;  3BCB A;  2LBF B;  3B90 A;  4BEH B;  3OYJ A;  2LRD A;  1VBL A;  2X6Y A;  2K5C A;  2VQG A;  1H80 A;  4YZ0 A;  4CCL A;  3OEH A;  1V5F A;  4BQN A;  3DTE A;  2W1O A;  1X0C A;  4II3 A;  2VB6 A;  4NC8 A;  1ZEL A;  2GOM A;  2KPM A;  2VQC A;  3OFN A;  4XLF A;  4PSX A;  4HRI A;  1YE9 A;  3PNV A;  4NQW B;  3VYS B;  1WJ5 A;  2VQH A;  1SFK A;  4LIT A;  4R79 A;  2F4I A;  3OS1 A;  5LFA A;  4BE2 A;  2F5V A;  4F92 B;  4NK8 A;  3TBI A;  2R7T A;  2KQR A;  2XF6 A;  2KLO A;  2V6E A;  2VKH A;  1DP3 A;  4OZY A;  3OYG A;  3OS2 A;  3KX2 A;  2NTP A;  3RQ4 A;  3BC9 A;  2IGM A;  3T9G A;  2HVS A;  1OLT A;  1V5E A;  3V42 A;  4E6K G;  4JMQ A;  1K28 D;  2W82 A;  4PUS A;  3DQV C;  1Z21 A;  2I8D A;  1T0F C;  4PJM A;  2R7Q A;  2XF7 A;  4BDZ A;  4F52 A;  4W8S A;  2E1B A;  4B44 A;  3K4K A;  4N4N B;  3E0J B;  1LKX A;  1OHH A;  2F6C A;  3OY9 A;  2JIZ A;  4XMY A;  1O8F A;  4XN3 A;  1OFM A;  3OYH A;  3HOT A;  4H4K C;  1BR2 A;  4CCJ A;  2PEC A;  1BOB A;  1V5G A;  4D1Q A;  1X1D A;  1IDK A;  1Z7L A;  2E1M C;  2OC6 A;  3QYE A;  2M3A A;  4CCM A;  3EQO A;  2W6I A;  3JU4 A;  5CQG A;  3OOC A;  3GQ9 A;  1N77 A;  1QHH D;  4YRV A;  5FRM A;  4PJN A;  4W8R A;  4E0F A;  3FY3 A;  4EW9 A;  4Z05 A;  1H8H A;  4FET A;  1OGO X;  4OJP A;  4ZDP A;  2CFO A;  4DBQ A;  1IB4 A;  3L2U A;  4QPO A;  4XQF A;  2ZZQ A;  2IGO A;  3ZQQ A;  1JRG A;  1PXZ A;  4URR A;  4YZX A;  4G7X A;  3UNG C;  2NT6 A;  4J01 A;  2JDI A;  1HG8 A;  3S8P A;  3DU5 A;  4BQQ A;  1MMG A;  3IP4 B;  1WJF A;  3C2H A;  2GJK A;  1BPL A;  4B3G A;  1O8E A;  2DT6 A;  2VKD A;  1VF7 A;  2M7B A;  4MLO A;  3HC7 A;  2HPM A;  2XGJ A;  1Y6I A;  3L2V A;  4C2U A;  3ZSC A;  3OOU A;  3OYF A;  2CW8 A;  4BL0 B;  3HL2 A;  3W2A A;  1ERD A;  2RRE A;  3LMM A;  1DBG A;  3K4B A;  2O0W A;  2R7R A;  2BSP A;  2ZSH B;  4ZYA A;  4BEH A;  4BUP A;  1UD3 A;  4E7S A;  2AQE A;  4XLC A;  2MAB A;  3OEE A;  4OJO A;  3H5A A;  1W0J A;  4B3X A;  3HKZ A;  1WP6 A;  1WJE A;  3GQA A;  4DNR B;  4KKU A;  1AA7 A;  4QPQ A;  4GQN A;  2IS1 A;  4XON A;  1BLI A;  2KVO A;  3CJQ B;  4XD7 A;  3IUO A;  4ZC3 A;  1SKY B;  4C2L A;  2UUZ A;  2WAD A;  3VSL A;  4BDY A;  4ZDO A;  2IS4 A;  3HG9 A;  4KIS A;  2VJI A;  4LIU A;  3GVJ A;  4RLF A;  4XM3 A;  3HPG A;  1N75 A;  2NST A;  2Q2E B;  1UD5 A;  3VMV A;  4XKB A;  2O0V A;  3DU6 A;  1VZ0 A;  5CQE A;  1X1A A;  2VIX A;  3LSI A;  1O8L A;  3VMW A;  2LY1 A;  1W0K A;  1NG6 A;  1NHC A;  1UD8 A;  2GK6 A;  2WY7 Q;  2ZXI A;  4YEJ A;  4OJ6 A;  4CCK A;  1FX0 A;  1FMV A;  1O88 A;  4C30 A;  3ZGK A;  3U21 A;  1DGR M;  2JJ2 A;  3GBG A;  2CW7 A;  2WAE A;  3OR2 C;  1O8J A;  3K70 C;  3D5R C;  2VLA A;  3OYB A;  4LIV A;  5KCM A;  4KKT A;  4HNU A;  2KHM A;  2UV1 A;  4B43 A;  3DPU A;  4HPQ A;  5FL7 A;  3T53 B;  3OMY A;  1BR4 A;  2BVM A;  1E43 A;  4CZC A;  1MMD A;  3W2W A;  3LSG A;  1DGW Y;  1WJC A;  4PSW A;  1TT0 A;  1NBM A;  4HST A;  1EFR A;  2LOO A;  2LYC A;  2ZZG A;  2IGN A;  3DWL E;  3OYN A;  3S93 A;  2F1M A;  3DTI A;  2WSS A;  3BCF A;  4B3F X;  2VXD A;  2JA2 A;  1WMR A;  1OR7 C;  3PNT A;  2XZL A;  1QCX A;  2E5Z A;  3AFH A;  2V7Q A;  3BLY A;  1D0Z A;  1R6R A;  3ZRG A;  3H0D A;  2HVQ A;  4F3Q A;  2HDW A;  1KMH A;  2VAS A;  2E1M B;  3AKZ A;  1Y56 A;  4E4H A;  4E7K A;  1OB0 A;  1SAU A;  2LY2 A;  3F9K A;  4CH7 A;  4FAS D;  5C1C A;  3CP8 A;  3GQ8 A;  4KT6 A;  3NWT A;  2K3P A;  1IA5 A;  3EUA A;  1EA3 A;  3NWS A;  4XNF A;  1UG0 A;  3OIQ A;  2KL4 A;  2ZZF A;  3MD2 A;  2PYG A;  4DK0 A;  1H8E A;  1O8D A;  2ZFU A;  4F91 B;  1PJR A;  4JOM A;  3K4M A;  1QJV A;  3BCD A;  4HNT A;  4MXN A;  5HVQ C;  5HNH A;  4X0G A;  2KMU A;  4NC7 A;  3OWT A;  4XLH A;  4DIQ A;  1G59 A;  2CV2 A;  1KCD A;  2VPL A;  3A3B A;  2VJ5 A;  4DOZ A;  4U4B A;  2VJJ A;  4B47 A;  2WJY A;  4G6T B;  2CS3 A;  3K10 A;  2HU9 A;  3QYB A;  4ZDL A;  4DBR A;  3DTK A;  5LD2 C;  1V0F A;  3A35 A;  1BN8 A;  3KEW A;  3VSV A;  2DOA A;  2BW3 A;  4OAZ A;  2VJ4 A;  4Y33 A;  1PKV A;  2HLD A;  3LSK A;  3L2W A;  3ZPP A;  1W36 D;  2IS6 A;  1D0Y A;  4TSF A;  2QX3 A;  2X6X A;  3G2B A;  3H5R A;  2DIE A;  2IQ7 A;  2VQL A;  2K9M A;  2XOK A;  3GQ7 A;  4Z03 A;  1I8D A;  1TZL A;  2DCE A;  3K4J A;  3A2K A;  3FPP A;  1WFX A;  1G8X A;  4UZU A;  3DPT A;  4XOT A;  4CCN A;  4P1W A;  1E0E A;  4FXU A;  3OYA A;  4Z06 A;  4JQF A;  2R7U A;  2R7V A;  1NG7 A;  3VR6 A;  4HG2 A;  2VBM A;  1RWR A;  1CZF A;  3EQN A;  2IS2 A;  2Z6B D;  2MFZ A;  4LG3 A;  1E1R A;  3MKZ A;  2V1N A;  1UD6 A;  2CH0 A;  1N78 A;  3PUB A;  4IKF A;  4II2 A;  2X8K A;  2BW3 B;  1I18 A;  2O17 A;  2JVH A;  4U87 A;  4YEL A;  2L5Q A;  2KDO A;  1K6Y A;  1T95 A;  3IAM 2;  3J7A Y;  2ZZE A;  4KKS A;  3K6G A;  5C1E A;  3LFU A;  4BJ5 C;  3HPH A;  3EUH C;  3D5L A;  3W2V A;  2BVL A;  2M4G A;  4BXF A;  4EAT A;  4U49 A;  3N05 A;  2R7S A;  3L2Q A;  4OJ5 A;  2W7N A;  1E3X A;  2QKM B;  1Z3Y A;  1W36 C;  1KCC A;  4GRI A;  1WJB A;  1MNE A;  2ZSI B;  2R9V A;  2O04 A;  2X1E A;  2M0M A;  3LSM A;  4ASU A;  4DNT B;  3SZG A;  1E3Z A;  2ELJ A;  3FKS A;  1QHG A;  2MYS A;  5DN6 A;  1VLY A;  5IK2 A;  4XOP A;  1X4O A;  3FKJ A;  1UD4 A;  2F43 A;  3DLA A;  2HVR A;  3S3O A;  4HEA 2;  3VSK A;  3PJR A;  3DPL C;  3M8J A;  2NTB A;  3OL3 A;  4XL9 A;  4PFO A;  1WTH D;  3B4N A;  4I84 A;  1RU4 A;  2LRE A;  2X1C A;  4NNJ A;  1FMW A;  2LZJ A;  4D9J A;  3OL4 A;  2ODL A;  3OYI A;  3LSH A;  4W8T A;  3S32 A;  1O8M A;  2P0W A;  4P22 A;  1P9Q C;  3H35 A;  5HOO A;  1UEL B;  3OYK A;  3SEQ A;  3OYC A;  4AVZ A;  2V9K A;  2Z8G A;  1PYV A;  2DT7 B;  3SUC A;  3QOD A;  3OYE A;  5CPR B;  2JSP A;  4OWR B;  1D1B A;  4BJ6 C;  4U7B A;  2XAU A;  3PSI A;  3A3G A;  1WJA A;  1X19 A;  3HUG B;  3E1S A;  3HOS A;  3WWG A;  4RLQ A;  1T5E A;  3KRG A;  2GK7 A;  2QY1 A;  2X51 A;  1U0J A;  2XDV A;  3OYM A;  2V26 A;  1E1Q A;  5JHF A;  3B8Y A;  1X1C A;  2NZM A;  3L2R A;  1W9X A;  4YXW A;  2X53 S;  2WZP P;  1DQU A;  2L9N A;  4C2T A;  2VBE A;  1NRK A;  3T51 B;  2MC4 A;  2A5W A;  4BE0 A;  4AYB A;  2WY8 Q;  3SYT A;  3CZ6 A;  3AL0 B;  1O8K A;  1OGM X;  2JUG A;  2R7O A;  1GLN A;  2MD0 A;  2XF5 A;  4XKC A;  4CA0 A;  3FHN A;  3W3C A;  5AMV A;  4XOR A;  3LL7 A;  4BS9 A;  3BG6 A;  1K5C A;  4MR0 A;  3ZXS A;  2WAF A;  2KP6 A;  2PYH A;  4IQ4 A;  4TKO B;  2QKL B;  1KON A;  1RMG A;  3LMW A;  4BJT A;  4KIT B;  2R7X A;  4Y4R A;  2IXS A;  2HNH A;  4IQJ A;  2E5N A;  2GJP A;  2M4K A;  3C2G A;  2X3H A;  2CMP A;  3ZR8 X;  1X1B A;  1JI8 A;  5CDF A;  5HLT A;  2WPD A;  2DJI A;  4BQO A;  2ZTN A;  1PE9 A;  3KEY A;  1UAA A;  4KJZ A;  3RTR A;  2Z16 A;  3OIP A;  2Z2S B;  3TL4 X;  3OYL A;  1YX3 A;  2VBK A;  4E7Z A;  1MAB A;  1UD2 A;  4PJL A;  4HWV A;  4NK6 A;  2XZP A;  4PK4 A;  2O1D A;  3LNN A;  3UR3 C;  4RMN A;  4J00 A;  2JJ1 A;  3D5S C;  4P5O A;  1MMA A;  3CF2 A;  3VST A;  2UWM A;  5TGT A;  3K4L A;  3S3M A;  3VYT B;  4BAC A;  3K70 D;  3RSN A;  2WAQ A;  2ZTG A;  4ANJ A;  2INU A;  2NT9 A;  3ZPN A;  4F55 A;  2AQF A;  2WB1 A;  3MKY B;  3KYL A;  3S3N A;  2RNG A;  2UVF A;  3VYU B;  2L7K A;  5HNF A;  2R7W A;  3ONQ A;  3BG7 A;  4G6I A;  4CCO A;  2V4J C;  5FRN A;  2R4G A;  3K4C A;  4ZTF A;  2W4S A;  4XLE A;  2LH9 A;  2D3N A;  1COW A;  1IDJ A;  4XKV A;  4W8Q A;  2E60 A;  2IGK A;  3BH4 A;  4PMH A;  3PNY A;  2QXZ A;  3CMM A;  3BCA A;  3T56 B;  2RQQ A;  1D1A A;  2XZO A;  3A4C A;  5KNL A;  2GJR A;  1EE6 A;  1VJS A;  2L9S A;  3RCO A;  3MMY B;  3HXL A;  4E7J A;  3GVK A;  3IAS 2;  2X6W A;  4NUB A;  4Z1M A;  1Z3X A;  2M5S A;  3OPO A;  2LBF A;  3OR1 C;  3I9V 2;  5KHD A;  4BGD A;  3OYD A;  1LFP A;  2GOX B;  3CES A;  1MMN A;  3BC8 A;  3I3L A;  1O8H A;  3QOE A;  1LVK A;  2OUM A;  1S9H A;  5HKK A;  4OZZ A;  4E7H A;  1YX5 A;  4HIZ A;  2KRH A;  3QYF A;  1BHE A;  1BMF A;  3GQB A;  3DEE A;  4F93 B;  3OS0 A;  2W6J A;  3DKX A;  3SDB A;  3PL8 A;  4HSR A;  1AIR A;  1J09 A;  2CUJ A;  2NOJ B;  4XN0 A;  1E79 A;  4RM2 A;  4TT3 A;  2HPI A;  4RM3 A;  2XC7 A;  3H9Q A;  2M7A A;  3DDY A;  2CV0 A;  3H9J A;  3GVL A;  1BR1 A;  2X85 A;  3OE7 A;  3ZIA A;  3OAA A;  4BU2 A;  3FDY A;  4Y3O A;  2CV1 A;  4PFP A;  4E7I A;  1JTA A;  4E7L A;  1D1C A;  1LDK B;  3FBN B;  2DXI A;  4L8J A;  1PLU A;  3OW7 A;  4YZQ A;  3HAG A;  1XG2 A;  1O8I A;  2LG4 A;  3ZCO A;  1QU3 A;  1MW7 A;  1IRX A;  2L2O A;  3G05 A;  4N4O B;  2PMZ A;  4PJJ A;  3AL0 C;  1HZE A;  4G7W A;  4DK1 A;  3WQZ A;  3H9G A;  2CK3 A;  3EPZ A;  2NSP A;  1HA8 A;  4OAY A;  1OOC A;  2JVG A;  4XLA A;  4XR6 A;  5CKT A;  1V0E A;  3M1C A;  1GQ8 A;  4CUG A;  2HZD A;  2D3L A;  2VL8 A;  1OFL A;  2CUZ A;  3TMO A;  3H94 A;  3K4N A;  4ZJZ A;  2KRC A;  2XND A;  3FBI B;  2EWE A;  2O5R A;  3JUR A;  2PJR A;  2Y0S A;  3CP2 A;  2BOL A;  3GRH A;  2Q1Z B;  2KZV A;  3VDX A;  2OV7 A;  3VWB A;  2V4D A;  2FUG 2;  1WPC A;  2INV A;  3NE5 B;  1D0X A;  2NTQ A;  3SEZ A;  2V7F A;  1X4P A;  2ZXH A;  3H5N A;  4XKW A;  2W00 A;  4AU7 A;  1KZL A;  1DBO A;  3PFY A;  4DGW B;  3MKW B;  1KTW A;  2XSJ C;  4YZA A;  2LC2 A;  2WA0 A;  2QE7 A;  3VYR B;  3CJR B;  2VXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...