4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
4XLCA 2X85A 3GQ7A 3LMWA 2O1DA 1EE6A 2O17A 1RU4A 2PYHA 1O88A 4XLEA 2NT6A 2Z8GA 1H80A 3EQNA 4EW9A 1O8LA 2UVFA 4W8QA 2VBMA 3B90A 4Z03A 4NK8A 4OJ5A 4XNFA 3FY3A 1HG8A 5C1CA 4XMYA 1O8EA 2O0VA 2NTPA 4YZQA 4YEJA 4W8TA 1O8JA 3WWGA 1IDKA 3GQAA 1OGMX 2EWEA 4AVZA 4XOPA 1BN8A 4XM3A 3JURA 4MXNA 2NSPA 3ZPPA 5AMVA 2ODLA 2NTBA 1DBOA 4U4BA 4NK6A 4XQFA 1OFLA 2NTQA 4URRA 2O04A 4HWVA 4YZ0A 1KCDA 3VSUA 1BHEA 1O8FA 2NSTA 1QCXA 4OZZA 2IQ7A 1AIRA 3GQ9A 4XLAA 2PECA 1KTWA 3GRHA 2VBKA 1OOCA 4Z06A 2UVEA 4XLFA 2X6XA 1K5CA 3ZSCA 4OZYA 1WMRA 2VJJA 1O8IA 1KCCA 3UW0A 2QY1A 4XONA 4XORA 2PYGA 4XKWA 3EQOA 4MR0A 4I84A 4YZAA 4XN3A 4U49A 4W8RA 1GQ8A 4XN0A 1O8KA 4PMHA 2NT9A 1O8GA 2QX3A 1JTAA 3VMVA 4XKVA 1PLUA 1OFMA 4YZXA 1O8HA 2NZMA 2X6WA 4OJOA 1DBGA 2BSPA 4W8SA 1JRGA 2VBEA 3VSTA 5C1EA 4C2LA 1VBLA 2INUA 1RWRA 1PE9A 4OJLA 3B8YA 4XOTA 3B4NA 3GQ8A 3SUCA 3VMWA 1O8DA 2VJIA 1PXZA 3T9GA 1IA5A 4OJPA 1CZFA 1RMGA 1X0CA 4XL9A 1IB4A 1QJVA 2QXZA 4OJ6A 4XR6A 2O0WA 4Z05A 1O8MA 3VSVA 1OGOX 4XLHA 2X3HA 2X6YA 2INVA 3KRGA 1XG2A 1IDJA 1NHCA 4YELA
chains in the Genus database with same CATH superfamily
4DQLA 1B8IB 1WJDA 2Z5UA 5A89A 5KNLA 2VOOA 1OGJA 1I18A 1YW7A 2X48A 5L3CA 2Y48A 2COMA 2VBWA 3LSGA 4PC1A 4YAUA 2VNKA 5H6RA 2BY3A 4N4OB 5J1RA 4RAZA 4OOXA 3F21A 1V5VA 3RPUA 3IV5A 2TDXA 2HXOA 2BGJA 2K9NA 4BY1J 3HOWJ 4G94A 1R5NA 3C3WA 2OTJI 1IHMA 2H94A 1ITYA 3NE5B 4C43A 5LD2C 3PENA 4XRSA 1R1UA 2G7HA 1VTNC 3M8JA 2A05A 2XB0X 2O7OA 3ZMTA 4DJAA 4EJTA 1N07A 1IJFA 3V7CA 3AKZA 3QODA 2IGMA 1YIJB 4EVIA 1E3OC 5ICGA 3G73A 1SAXA 5FA6A 4YZ0A 4NQWA 2X51A 2QKLB 1V5EA 3BR0A 3BR3A 3S17J 1B59A 1BM9A 2EV6A 1KONA 4OP7A 4OZZA 1LDJA 3GQ9A 2PECA 3RYPA 4O5VA 4FQGA 3KZIC 1O3QA 2IRFG 1Z21A 3GLLA 1H8EA 3FPPA 1AKHA 1RUNA 1L1IA 4A2UA 1GT0C 5IYPA 2C6YA 3AVYA 2XF7A 3KETA 1WMRA 3GZ5A 2OK8A 1TVCA 3LA2A 1PJ5A 2FSWA 5AIQA 1SFOJ 2HLDA 5FO1A 4AC9A 3GXOA 2HEOA 1NRKA 1WORA 3UR3C 3ELKA 2O03A 3AG3H 3H1CA 2P5KA 2W25A 5LBQA 1A8PA 2GXAA 1TNSA 3S2HJ 4YZAA 2VPLA 4BEHB 4U49A 5FD6A 3I1FA 4W8RA 2E35A 1TQMA 2YPRA 1A04A 1MMGA 4D0PA 1ZR2A 4I7HA 1E3PA 3E0JB 3K4LA 3RQ4A 4BGDA 4UZEA 2VXZA 2FQ4A 2LY1A 3IWZA 4YXWA 4FWTA 3E1YE 1PLUA 5H2FC 2K4JA 3P27A 1XG1A 4LFUA 1FX0A 2RNGA 2K3FA 1ELOA 2G7UA 1QFYA 2HZTA 2Y9YA 3CJNA 2UZKA 1JTXA 3P7NA 1UJ8A 3ZZTA 1MH4A 2KLOA 3CC4I 2CV0A 1E0EA 3WGGA 5FKKA 4DGWB 4QIWN 2R5ZB 3BTCA 1TW3A 3RPUD 1XE1A 2QMUA 5LHIA 2YWFA 4P6VF 2OA4A 3A0HC 4RD3A 5DD8A 5BPIA 5C44J 2LNBA 1FDRA 4HV6A 2XT2A 4E7SA 3OW7A 4AIKA 2VI6A 2OF7A 3PUNA 4M2LA 2W85A 2EIKH 3T53B 5E1XA 5CDFA 1OCRH 1ZK8A 3WG9A 4I76A 5CVJA 3LFUA 4GGGA 4M3FA 4RMNA 3W6KB 2F2EA 2ZO4A 3H9GA 1LDDA 1D0YA 2IXSA 4AF6A 1SC7A 2LVSA 3AG2H 2D3LA 5J8CA 1TWGJ 5AIPA 3MHPA 1IG7A 1YFHA 2I10A 4LC0A 4BNCA 3VEPA 1IN5A 3U1KA 5LGNA 4FX4A 1ZG5A 2EK5A 2ZZEA 2L7FP 2DY1A 5FO5A 3JW4A 2BY0A 5BNGA 4KDPA 2YWGA 4W8QA 3B90A 2FXAA 3GTGJ 2MC4A 6PAXA 1ZM4A 4XNFA 1ON2A 1K6YA 1TLHB 3SFZA 3TKYA 3J80Z 4G12A 3H94A 3SKBA 2ZJRF 4F7ZA 1U9OA 3WODF 4XIDA 3AGQA 2E34A 4OU0A 1RETA 2Q1ZB 4HOBA 3JCUC 5E1ZB 4A6EA 4PJJA 4PJMA 4BJ5C 3Q6RA 2BM4A 3LSKA 2GA2A 3D1NI 4C2UA 1OFDA 4IO9F 1YLFA 1N78A 3WTXC 1SMTA 3CUOA 2ZITA 1QA2A 4A3CJ 5DD4A 1H8HA 4ASUA 3KP5A 1NG7A 4O3MA 1OPCA 4FCYA 3A03A 4X0CA 2VT3A 3HOXJ 1IGNA 3P26A 2YU3A 5FKNA 2F1LA 1KCDA 1TQPA 1JE8A 2KJCA 5CVRA 4ZCLA 2FU4A 2X3UA 2VQHA 2IS2A 2VC1A 3PFYA 4C0SA 4G1BA 4YAFA 3FXJA 3HOYJ 1FX7A 2V1NA 2FOWA 4MFEA 1FLIA 2VBKA 5KAFC 3WTUC 4PFPA 2V9PA 4IVNA 4M1KA 2V7TA 1HLVA 1YE9A 4BXUA 2VJJA 1O8IA 3R61A 1Z9CA 4NDLA 2CO5A 4IOCF 1X3WB 1DDGA 3UW0A 2WYRA 3CP2A 2I8DA 4XRSG 4HG2A 3QP6A 3ZQHA 1B72A 2CF4A 1ZH5A 3WGIA 5HS9A 2EPFA 3GF2A 2LTPA 1XSXA 4EJVA 4EMSA 1T6ZA 4LG0B 3PQKA 3QYEA 1LLZA 1CNEA 1JUMA 1QNTA 4J0QA 3WBKA 4DZPA 2IOUG 4RD4A 2OK7A 2GA1A 3WQZA 1VNDA 2DDAA 3GCMA 3HG9A 3PUFA 3BR1A 3ZN1A 3CCQI 1O8GA 2DAOA 1H8AC 4M73A 2MSYA 4Z4SA 2DEUA 3CPWB 3EYIA 3QPLA 1LKXA 3SJZA 5HDGA 1I7PA 3KLNA 4C3JJ 5HODA 2VBZA 3DPLC 1MMNA 1RRJA 3FKJA 2M5WA 4G9YA 2VLAA 3Q5FA 1ZLKA 2C77A 2OQGA 2LH9A 1VBLA 3TBIA 1EH7A 1K78A 1KQ9A 3ZUGA 4PK4A 3BLYA 4F7DA 3MVPA 1QVTA 5F6FA 1O4XA 2XGJA 2E71A 4PCQA 4QUZA 3HRTA 3CCUI 3G71I 1FYMA 3WTVC 3V76A 2BV6A 5DS9A 3NRVA 1FEXA 1I1SA 1FNBA 3SZEA 4EJWA 3NEUA 4EEFG 1R5HA 2WAQA 3CCSI 5J35A 3I9V2 3CC2B 1CZFA 1LDKB 1SANA 1AA7A 2QF7A 1EV7A 3M8EA 1C0WA 2VODA 5A2QZ 3HOTA 1VQLB 5E3LA 4IRIA 1KYZA 1Z67A 2W00A 4RD2A 3LL7A 4Y52J 4D7MA 1YJNI 3K6GA 4JYKA 3OOPA 2B9SA 5GTHC 3QFTA 4YIIA 2XDVA 1MDMB 2FNPA 2BN4A 3LMWA 3CC7I 2GJRA 1H0MA 4QTRA 3AVTA 2O1DA 4IHSA 2HQAA 2XASA 3WNBA 4CYCA 1O88A 2DOEA 1ZQ3P 2XAJA 5HDKA 3HIFA 1XSDA 3ONYA 4K2EA 2GAUA 3H09A 2A61A 1TNTA 3TDZC 5K7HA 1LJ9A 4GDFA 2RVCA 3ABTA 4LLNA 2BV3A 5F4JA 2J8IA 3BG9A 5HNFA 2DT7B 3BZCA 2H8RA 4GFBA 3SYJA 1FT9A 4TSFA 4WK8F 2E1MC 5LEKA 1VQ5I 1H9TA 4AF7A 4AVZA 3AG1H 1BN8A 2NSPA 2HTJA 3A01A 4L5EA 2HPMA 1OKRA 1I6HJ 1YO5C 3ZPNA 2KMUA 3BPVA 3HXLA 3FKIJ 3NWTA 4U4BA 1IXCA 2CS3A 4DYQA 3E1SA 5THXA 1ZARA 4W97A 3VR6A 2K5CA 3FZVA 5F04A 1A31A 4HLXA 4CCLA 5HZBA 4HWVA 1JUPA 2FMYA 1PUEE 4ZYAA 3U21A 4EATA 4P26A 4HX4A 2XF5A 3ONUA 2OV7A 5FLXZ 3G6EI 2F4OB 2R5YA 1YI2B 2NNYA 2DXIA 3CMAI 1HCRA 3P5JA 4M6VA 4A5NA 4DW6A 1BA5A 1RQRA 2G0YA 3E97A 1YQAA 3EETA 2LP0A 1EP3B 2ID3A 3K4BA 1QX4A 2EFGA 1MBJA 4BPRA 1KCCA 1GV5A 3K4CA 2IA0A 1WH7A 1OYWA 2EZHA 1P4MA 1T33A 2RREA 2YX4A 1RZ4A 3BROA 4P25A 3CF5F 2PEXA 9ANTA 3LSIA 1ETVA 1MIJA 3M07A 4ZZDA 5TGTA 1J2XA 3ASSA 3LWFA 3D5LA 4R79A 1MBFA 4RPDA 2H6CA 1K8AD 1JKQC 1HDPA 3PFIA 2DFFA 3OZUA 1EKEA 4X8IA 1KU2A 3CQZJ 2VXDA 1JTAA 3AVXA 4G6DA 5LHGA 2B0RA 1OHHA 4B4DA 1WQ2A 1Z91A 3H5AA 4GO1A 1Q1VA 1O3TA 4UZUA 3L9FA 4HAMA 4KKUA 1PP7U 5CQGA 4ZV4A 1HA8A 3VWBA 2R92J 4M6XA 4IKFA 1TT0A 2WWYA 3LNQA 2EFWA 4FXUA 4AWXB 2V31A 5GPAA 3CDHA 2QCOA 3GQ8A 2L7KA 3L00A 4IL6C 2QENA 3ISXA 3H36A 1VQ8B 2QTLA 3T9GA 2J5PA 1I50J 1QGPA 2DIEA 4OIRF 3CPXA 4IOAF 1W5TA 3OYBA 5C4JJ 3CCEI 2QXZA 1T2KA 3TO9A 2WA0A 2Z2SB 4I6ZA 2DODA 4A3LJ 3SQVA 3K4JA 3HUGB 3MAJA 3LFKA 3CCRI 2JA5J 1I8DA 2FX3A 3B82A 2ELKA 2VQLA 3RI4A 3S15J 1MNEA 3OZVA 4RDLA 5JBQA 1Q81D 3GFJA 3AVUA 2QLZA 4Q4ZF 4IHTA 3MFKA 4X1EA 3W3CA 3EPZA 2ZTNA 3A1YA 2D5VA 1QPMA 3FDYA 5J4YA 5LHHA 3ZQQA 3H0GJ 4U88A 1V3FA 5H6QA 4DNCA 4YC5A 3R6SA 1SD7A 2OJED 1ETQA 3CESA 1MBGA 3T8RA 3PSZA 1JGGA 4I99C 3HBLA 1JUSA 2OBPA 4P3IA 3HHHA 3SY2A 4Y7CA 2ZFUA 4ZYHA 1BC7C 1WJBA 4ZGNB 1QFZA 2Q6IA 3KL9A 1I1GA 4GYIA 2QQAA 3C1DA 1Z0XA 2KVOA 5DN6A 3CMEB 1E2XA 1ODDA 3PNVA 3SEQA 3HRMA 2XSJC 4U7BA 2R7RA 1J9ZA 1S7OA 1ZTRA 3REOA 1FNNA 5F0CA 4AVPA 4X7CA 3WWGA 2VJ5A 3KPHA 3I54A 4HX8A 4F91B 4YIRX 3GZ6A 3JURA 3ZPPA 5AMVA 2HYGD 3J80K 2KZGA 3W5UA 5F27A 4Z1MA 1LVKA 3QYBA 3DTEA 3H5RA 2NYXA 4KITB 5BSXA 2VNIA 4ZJZA 1O7FA 3OL3A 2Q2EA 2L01A 3CTAA 1G59A 2WADA 1D5YA 2ZXJA 1K8FA 2BMWA 1EFCA 1Y0RA 3N4MA 4QHYA 1FBUA 2WJYA 1TL8A 2LR8A 2FQ3A 3JQPA 2X6XA 4UUVA 1TW2A 3AFHA 4I09A 4MTEA 1YJ9I 4KT6A 3A2KA 2COBA 2XGXA 3CCJB 1U2RA 3IL2A 1ZYRF 2QY1A 3OOUA 4HDVA 4P6YA 3F23A 3BTIA 2WAFA 2Y30A 1YW9A 5EZGA 2KJBA 2PJRB 3BTLA 3G1LA 1GV2A 1NH3A 1J75A 2KRFA 3GZNB 1WPKA 2R3SA 1XDUA 2IAIA 4N3GA 3BH6B 1NBMA 2EJRA 2H09A 3QU3A 5HS7A 5HLTA 1FTZA 1EA0A 1B1BA 1GXQA 3V4GA 3BC8A 1VQ9B 2OZ6A 1R1VA 1WJ5A 4P55A 1QPIA 2X0LA 1Y8RB 2MH9A 1OJLA 4BACA 3LQQA 4A3IJ 1FNCA 3IH3A 2ZCWA 1MSEC 5IYQA 1JA0A 3FK7A 4X7EA 4JQFA 5EDNA 3PQJA 1G3YA 4LBWA 2QSFX 1MMDA 3U1DA 2CFXA 5FB2A 2HKOA 3I0TA 5EGOA 1VQ7B 2X1EA 4DQ2A 4FT8A 3LA3A 2N8GA 4Y4RA 3LAPA 1E3XA 3RQIA 1X1DA 2XPWA 4L0ZB 3RIQA 5DS0A 4NBSA 2JSCA 4O6JA 1GUUA 2ESNA 4A12A 5H59A 4IPAA 3OW2B 1HBXG 3DU5A 3DEEA 3OYLA 1XQBA 1OGOX 2KHMA 1D1AA 2YUSA 2DJIA 3RTRA 1FPQA 3HGYA 4R1HA 3GBGA 3JR9A 1E43A 3CD6B 2NS7A 4W1UA 4OOIA 1K9MD 2P5VA 4YELA 3TGNA 5EEAA 3VNVA 5TV2A 2Z33A 3JQQA 1VQNB 4Z4TA 2BVLA 1EE6A 1X2NA 3DKXA 1NB0A 4IHVA 2O17A 2XT4A 1B8IA 2H1LA 4B3XA 4HNUA 4AM3A 4DNRB 3EQNA 2EQRA 4GYGA 1TBXA 1X4OA 2HS5A 2Z99A 4FASD 1KQ8A 4ZDPA 2LKPA 4AIDA 1HKSA 1W87A 3GX4X 2V9KA 1I3AA 2CQKA 3KIOA 2GJPA 2NOGA 1GAQA 1N08A 1X2MA 2X1DA 1CF7B 1V0FA 4P1WA 2E1RA 4QFMA 1BR4A 2ZMEB 4WWVA 3QYFA 1K61A 2CRVA 1EWYA 3HSEA 3J81Z 2YSRA 1WJAA 1BR2A 3SXYA 5IP7J 2YU9J 3AL0C 2XNJA 2EZKA 2BZTA 4OWRB 2V7QA 3GWZA 1QA6A 2JDIA 1BX0A 5FROA 3SYTA 4URRA 4X7FA 3U2RA 3OZWA 4CICA 3PNTA 4RD6A 1X3ZB 1BOAA 1WWXA 3F8FA 1XSVA 2B7EA 4B8XA 4L8JA 1FC3A 2VBYA 2IQ7A 4C9YA 4ZDOA 2W82A 2ZSIB 3CDIA 3KE2A 1JT6A 2BW3B 1U3EM 1ETWA 3ZQGA 2DYRH 1VQPB 4QLCU 3FMRA 3A02A 2QBYB 3HSRA 5D6FA 1V4RA 5KVRA 2RAEA 4ASNA 3PO3J 2O6GE 3IP4B 5D5VB 2Z9OA 5FLXK 3WHCA 2V5IA 2CG4A 1WSVA 3ESWB 1F43A 3FXMA 1XGSA 1USTA 3X2QH 1ACIA 1O3SA 2ZTGA 3GVJA 4PC3A 3WNDA 4ZC3A 1WI3A 2EIMH 3BY2A 2DOAA 2MABA 5GADJ 4JX6A 2LBFB 4C30A 3PNYA 2PE3A 3K7AJ 4MEYF 3CCVB 1PVEA 5ICFA 1K6OA 2R0QC 3IH2A 2HOSA 3OYGA 2WY7Q 2L54A 3O3KA 2XTYA 4LD5A 4XN0A 2B7CA 1MGTA 4BEHA 1XC5A 4UUSB 3K1PA 1UD5A 4L9TA 2CGPA 2XROA 1Y1VJ 4G5GA 2ISZA 4LB5A 2E19A 3VSKA 2JJ1A 2FEZA 2L4MA 4BDYA 2M2EA 4Y9RA 1N25A 3R6JA 4IQ4A 1ZLJA 1F60A 2KISA 2BSPA 2DA4A 2QTZA 2KIUA 2XZLA 3VSTA 1GVDA 3SDGA 3CCLI 3SJMA 3HTSB 2V4DA 3A0BC 2ID6A 3ML3A 4YCQA 2FRHA 3W2VA 2ZB9A 5B1BH 3QU6A 2B7BA 5J3OA 3F72A 3F0CA 1ETOA 3DDYA 2RDPA 4M9XA 4KIFA 1QVGB 4HIZA 5CVUA 4AU7A 5JFRA 1T98A 1DUXC 1UHWA 3Q0UA 3OYNA 1UB9A 1MMAA 2R7DA 1OB2A 1Z1DA 4XSXF 4E70A 1G6NA 3TL4X 2Y69H 3W6JB 5IYCJ 3EYYA 3BG3A 3I56B 3ZP5A 1ETYA 1JKRC 2ZFWA 2R6HA 4BXFA 3ZOBA 4L18B 2BM1A 4B48A 1B9NA 5ILSA 2I1LA 1RR7A 2AQFA 2LSOA 2M87A 2DERA 3GQ7A 4FK8A 4LITA 1F20A 4IHWA 1S4MA 2QSGX 2W1OA 1E1RA 3FISA 1T6XA 5F64A 2WPDA 1Q86D 3WTTC 2PYHA 4HF1A 2DA1A 1BOBA 3BR5A 5D6EA 5KAIC 3CJTB 3TDUC 2V7WA 2EA2A 4B3GA 2B5OA 2RQQA 3BTJA 3DKYA 1V54H 4PGGA 3CCMI 1HF2A 3TH0A 1EFTA 2RC6A 4Z03A 2STWA 2IGKA 1OCCH 2KDZA 1S9HA 1G7RA 1VQ6B 3HRUA 3OEHA 1OISA 3CZ6A 1VQLI 1O8EA 5FL7A 2OTLB 3TO7A 4WZKA 4YEJA 5GAHJ 3QFCA 3BJOA 1AOYA 1MBKA 4YEIA 4HW0A 1XS9A 1R36A 4S05A 1MBEA 2V7XA 1T8IA 1QZYA 3LSMA 4QPQA 4XM3A 4MXNA 1JKOC 4KIBA 2LY9A 5J1UA 4HZFA 2EFPA 1ERDA 4WXHA 5EMNA 2QQBA 3ZBTA 1BL0A 4M4SA 3F6OA 3I59B 3HGGA 4EM0B 1MZBA 1X1PA 2A6TA 2H8WA 4AIHA 2DMPA 4BHPA 4RAGA 4KUMA 2DPUA 5EZHA 1O8FA 3H9NA 3PSSA 3VSUA 3DWLE 2ZXHA 1W36D 1QCXA 1WXRA 2CUEA 4XLAA 2DN0A 5DM6F 1HW1A 3T5XA 4X05A 2QGGA 1S6LA 3L09A 3TEDA 1KMHA 4CDGA 2XAHA 4ACAA 2K7LA 2HOAA 5HKKA 2IS4A 2XTWA 3ZZ0A 3VO1A 3NWSA 2IA2A 2XVCA 1SFEA 4ANJA 3L2CA 4XONA 1TWFJ 2CYYA 2L4AA 3VB2A 4D9JA 1F1ZA 1XX5A 2DMTA 4DBQA 4EV0A 2WY8Q 2D3NA 4XD7A 3Q3AA 1K4ZA 4J19A 2P4WA 4N3NA 2X0KA 1U0JA 3F8NA 4II2A 3Q9SA 2Q6LA 4ZYEA 2ZBUA 2IPQX 3GEZA 3COAC 1T95A 2C4TA 4ZCIA 3BP8A 4KISA 2FBIA 3FM5A 1YI2I 5M5XJ 5K5QA 1SFUA 2B0LA 1PE9A 4F92B 3CO6C 2BY2A 4KNYA 2AHQA 2W84A 1Y6IA 3V7SA 4Y9UA 1P6RA 4YZXA 1O8HA 4OIQF 1UHSA 3P9KA 4CH7A 2B63J 4FETA 1S72B 2CW8A 1MRZA 2V1UA 5E17F 1K7AA 4B3FX 2RC4A 1KZHA 3ASPA 5ILVA 2F5DA 4AYBA 4ZH4F 3J7AY 4A3FJ 4GCVA 3B8YA 3CP8A 5B66C 4M72A 1ZAOA 1O8DA 1BJAA 2AHOA 1SD6A 1Z7UA 2VJIA 3VYSB 2GPJA 2VBVA 5FLVA 1IA5A 5BQTA 3H9QA 1RMGA 5D5WB 3RCOA 4YHBA 4RB1A 2BHZA 3S2DJ 2VNHA 4OPOA 2HPIA 4TMXA 3QSYA 1GLNA 5IY5H 5B5EC 3T56B 4WWCA 2M8GX 3DBLB 2M3AA 2CV2A 1UELB 1I3QJ 2VJ4A 3ZMVA 3JRFA 1W0KA 1QZZA 3TMOA 4AIJA 3OKXA 2MC3A 3DLAA 4N9IA 4Z6YA 4A69C 3LNNA 1LNWA 4WX9A 2HZDA 4A3BJ 1XG2A 3UNGC 2CQQA 1U5TA 2Y2ZA 1P4AA 1QQIA 3IWFA 3RKQA 1TT5B 5DUIA 1XCBA 1T6SA 1WI9A 4F52A 4P9FA 1BPLA 1OFCX 3WBJA 2Z3YA 3ML6A 4BL0B 4XSZF 1S5LC 2V79A 4EW9A 4TV7A 5D4SA 1DPRA 2QZAA 2OD5A 3MQ0A 3HAGA 3S3MA 2GLOA 3CMYA 1LE8B 1IRGA 5AN9A 2R7TA 5E1WA 5D8LB 5E8GA 4BE0A 1H42A 1TLLA 4B4CA 1T0FA 2VBUA 1KTVA 4ZGQB 1BJKA 4TN1A 1RIOH 1WCMJ 2K9QA 5BOXA 2PQ8A 1MW7A 4KH3A 4EQQA 3R60A 1IXRC 1D2EA 1R58A 2J5OA 2XGDA 3J7YJ 1UD2A 4RB3C 4P96A 3I4NJ 1UD6A 2HNHA 2GIZA 2QEXI 2IW5A 3W5HA 3KEWA 3SEJA 5HVQC 5HDNA 1BMFA 4KKSA 2MFZA 3ECOA 2DA2A 3GVAA 1IJEA 2PLFA 4X7DA 3J81K 2RV8A 2AXLA 3DEWA 4AUXA 3ES9A 1ENHA 3P9CA 2PLYA 2MLGA 5FLMJ 3GTMJ 4P22A 1JHHA 1QA3A 2BM0A 2Y75A 5E18F 4FE4A 5CVVA 2R7OA 4XLNF 1QGZA 3I4MJ 1QQ1A 2KRCA 1Z05A 3J81k 4PC2A 2NVYJ 3ONQA 2DTZA 5DCMA 4IF4A 3FK6A 3NB2A 1HW2A 5DSZA 2YWHA 2X9DA 2STTA 2DMQA 1W36C 2MA3A 1S3JA 1XN7A 1COWA 2OBTA 2C2WA 4B44A 2QA4B 3GO5A 2BY1A 2LYCA 3MN2A 2NNNA 3F8BA 3BPXA 4UB8C 1R9TJ 3DLLF 4CQJA 4J01A 2A3SA 3FXUA 2KT0A 3K4NA 4PABA 1TUIA 5CLSA 1M1EB 2R7SA 2EFNA 3E6DA 1A6IA 3OYJA 1XTAA 4IQJA 3PIPF 3VFZA 3VMVA 1X1CA 3IHUA 5ED4A 3NARA 4E7JA 1TTYA 3JRAA 4NC8A 1KJZA 2X8KA 4JMQA 5E6TA 4Y15A 1FP2A 5JR3A 3WTSC 2QZ8A 4C2LA 2KRHA 4WQMA 5TY0A 2Z6BD 2E36A 5H20A 4NUBA 5K7ZA 1RWRA 1FYLA 3OYIA 1QO0D 1CQTA 1FSEA 3FXRA 3K70C 1BX1A 5DDGA 5EF6A 3S32A 1X19A 2ZJPF 3SUCA 2PFBA 1LM1A 1VQ4B 2GOXB 2QE7A 3OIOA 3RPQA 1K4TA 1HZEA 4OJPA 5FJ8J 1XMXA 4LGWA 2X4HA 2EWNA 1VQ9I 2W6IA 2HYFA 2YS9A 2XPVA 4S0HB 4E7IA 3KYDB 3RZOJ 1QA1A 2M5SA 4N0BA 2WZPP 3OSFA 1IV6A 1FRQA 2X3HA 3WNCA 3E6CC 4RA2A 2L9VA 3KRGA 2IA1A 5J40A 5BPDA 3LQRA 1IUYA 2XHKA 5IP6A 4DK0A 1JTYA 4HF0A 2BX6A 2UUZA 3GLXA 1ZGWA 4D1QA 1U8BA 3M1CA 3EUKL 1WGXA 5DEQA 4I01A 1POGA 2K40A 3BG5A 2VE9A 1G3WA 2E1MB 3DPTA 4CO8A 5K5RA 2DPDA 4H4KC 1O8LA 4KN4X 3CRZA 2VE8A 3OS0A 1EP1B 3W2EA 2OBRA 2EV0A 1V55H 1OQYA 1JJ8C 2LZJA 1AKHB 2KIFA 4KT5C 1WTHD 4XMYA 4A93J 1YHQB 1QGYA 3SLDA 1W0UA 1J9IA 3K4MA 2GOMA 2W4SA 3DKWA 4YZQA 2WTEA 4I0BA 3S1MJ 1NK3P 2ZBKA 3FHNA 2GK7A 3K2ZA 1NG6A 4U0YA 1IW7F 4DYCA 1PJ6A 1R7JA 1MMSA 2LREA 4Y13A 1WHUA 2PMHA 4KN7X 1O3RA 2DYIA 3DEUA 3IRQA 4UUTA 3DF8A 1VQNI 1TZLA 4IJAA 2I5UA 2L9NA 4DK1A 1R5GA 2A6HF 3E5XA 1IXSB 2L0KA 1LB2A 5L46A 2OCCH 2MW8A 3K4KA 5JHFA 1DDNA 2JPBA 1BHEA 2D1HA 3A4CA 3Q0WA 4M3GA 2VFPA 3QWLA 4Y17A 4BH9A 4OIPF 2VKVA 1EXMA 4UHTA 4FX0A 3I5UA 1OOCA 5JLVC 2FD5A 1RKTA 5K1YA 1A36A 3D5SC 5EJCA 3ERED 2PMUA 3BCBA 1XB4A 2CW5A 3SFIA 3GFLA 2QDXA 2F4MB 4RCZA 2K85A 2OUMA 4XKWA 2A5YB 2O8KA 2M4KA 2ZSHB 4XICA 2D1VA 1RKWA 4CCKA 2PJRA 4QVAA 1RR8C 2NPFA 1S8NA 3KLOA 1WOSA 5JVGF 2J8KA 1GQ8A 4RD0A 1JT0A 1O8KA 4G6QA 3BJAA 4KKTA 2CMPA 1Y39A 2QQ8A 1JI8A 2JPCA 4G6TB 4B47A 5LGUA 3LSRA 3M8FA 3QP5A 3V7AA 1JHFA 3KP4A 2JTVA 1VQPI 2X6WA 2G0EA 2ZL6A 1DBGA 1LQ1A 2OCEA 2BHYA 2NS0A 2IGOA 1B23P 3K0LA 2Q8KA 4OJLA 3VOEA 3N05A 3BNWA 3JQRA 1W7PA 4RLFA 3HOVJ 2VQCA 4TT3A 3JAMZ 3SJPA 2VC0A 1YS6A 2WZNA 3TW7A 4NBQA 1PJRA 3ZC3A 3JRIA 3CCVI 2BPOA 3B6AA 1G7TA 2XZOA 2CV1A 2FOKA 3O8GA 5E79C 4HQMA 1VLOA 4P3YA 2CRGA 1P2FA 1U5TC 4S04A 3J7AO 1X0CA 1L0OC 1KK2A 4Q48A 3KEQA 1OR7A 3V8LA 1IAWA 2VIXA 2R93J 1RESA 2ZL7A 4C2MJ 1WJEA 2GBYA 2RC5A 1RUOA 2DI3A 1UMQA 1L3LA 4ENKA 2X6YA 2R7VA 2DYSH 2HVSA 3VMFA 5D5UB 3R0JA 5AONA 1NHCA 1VLYA 2RKHA 2E1NA 2X85A 2M0MA 3RKYA 2M7BA 2PJPA 3KFWX 5B1AH 2DFEA 1BI3A 1OFEA 4ZTJA 4A0YA 5IOYA 1BW6A 4V2GA 1T0FC 2NT6A 2KQRA 1UD8A 4P12A 1AU7A 4MQ9F 4CCNA 4KFCA 1OB5A 2JJ2A 2LF7A 1YRNA 4G7WA 4HDUA 2V6EA 3GIRA 1QHHD 2RGVA 5JLWA 1NTCA 2D9RA 4IXAA 1OCOH 4CCOA 3I56I 3BR2A 2L2OA 5LRRA 2ME6A 1Y8QB 3E7LA 1H88C 2VONA 1ZHFA 2VB6A 3QPTA 2M4GA 2VYQA 4Z4YA 1KU9A 1B72B 1KRHA 1HSJA 4M6YA 1JNYA 5KW9A 2ZMEA 3ASNH 3B73A 4M9SA 4ABZA 1LUJB 3L2RA 2ODLA 4V02C 3LO8A 2BGCA 2CC2A 1DBOA 4NK6A 3A8JA 2VKDA 4UY8I 2A6EF 1DGRM 1WKMA 1NB9A 2PIAA 2VZLA 1BR1A 4BUPA 4K1XA 1P92A 3S1QJ 1H9GA 3SDBA 5IT3A 3OSGA 1J0RA 4NHJA 3I71A 2LD5A 2DETA 2HWVA 3D5RC 3O2PE 3RIRA 4KMUX 1KTWA 1B2RA 3LMMA 2CW7A 1VQ6I 2ZNYA 2EILH 3L7WA 4HF2A 1ON1A 1T08B 3PVDA 3OEEA 4V2FA 2OTLI 2DQLA 3G2BA 1HC8A 2DFIA 4EM1A 5BS6A 3OAAA 2QBYA 4CCJA 2NVQJ 4UV9A 4WXDA 3PSFA 1W7PD 3V7RA 1BW5A 1QFJA 1QRCA 4L5JA 5L3FA 5GAGJ 2CW0F 4YIFA 3C2HA 4XN3A 1WOPA 2JN9A 1HXDA 4PSWA 3JRBA 1IN4A 1EH6A 2LKXA 4E6KG 3O8HA 4PMHA 1H89C 1JKPC 1R49A 1SVOA 3RKWA 1AIPA 2UWMA 5JMCB 1FNMA 4OPVA 3W2AA 3CB4A 2CSOA 2KIMA 4JX4A 3MMYB 3PUBA 3Q0VA 3HEFA 4W8SA 4OM9A 5DYMA 4CYCB 1XDSA 3OIQA 1TWAJ 4A3MJ 1Y0NA 4E7HA 3OP1A 3S3OA 4IRGA 3KYCB 1V0EA 3OJXA 3M4OJ 4RDJA 4U7DA 2E5NA 1A35A 1E62A 4Z4ZA 3FBIB 1AWCA 2Z16A 3TP3A 2EH3A 3V8KA 1YIJI 1RNLA 2FVGA 4RB2C 3OMYA 4YFNF 3OWTA 4NB5A 3SHFA 1F9NA 4FTHA 3C2BA 4XL9A 1OLTA 1U2WA 1R5ID 2E5ZA 3KP2A 1N8RD 3ABUA 1IRFA 2PMZN 1IDZA 1G8XA 2F5CA 3CUQB 2GXBA 1Y56A 2LKSA 1X4PA 2HU9A 2W7NA 1UD3A 2XF6A 5TJJA 3A01B 4YALA 1BJZA 2K9LA 1IF1A 3BOQA 2JRMA 2Y31A 3FMSA 3ISPA 3LSJA 3PM1A 1S72I 3BH4A 5FKOA 4YRVA 3DPUA 2W6JA 1G2HA 3LJYA 2GQQA 1DP3A 2X53S 5LLQA 2OYNA 1VQOB 4Y33A 4P2NA 4AYBN 2VUMJ 4L9VA 5FFZA 5JLXA 3IC7A 2DT6A 2R5YB 1H85A 2VNJA 4YAOA 1VHOA 3AL0B 3DXJF 2KZVA 4I0AA 4WCGA 4G7HF 1HG8A 4PDKA 5GPCA 2ICWG 4RS8A 1K28D 2LRDA 1AMOA 3E5UA 2O3FA 4XRFA 4ZCMA 1K73D 1SD4A 2NTPA 2LK2A 2NS8A 4Z4WA 3U2QA 4MIMA 2YX7A 3QQAA 2DJNA 1Z6TA 2LG4A 2ETHA 4RPBA 2NAZA 1SFXA 3HKZN 4ETSA 1HW5A 4DOZA 3BQJA 4B43A 2QQ9A 1PKVA 4PGOA 2CQNA 1KK0A 3B78A 3N6ZA 3S8PA 3CCSB 1IN7A 3BQYA 3I59A 4IRHA 1QUEA 3ZIAA 1Q9SA 1EZGA 5LMZA 2ECBA 4KA4A 3GYHX 5EG0B 2W57A 2QGUA 2M7AA 4M74A 3U9GA 1OCTC 2UVEA 1YJNB 4Z06A 3B6CA 2ELJA 4MTDA 4G1VA 5J6XA 3CC7B 3BCDA 3G1MA 5F4OA 3QPHA 1YOVB 4RGXA 4XORA 3WU1B 1MSFC 3VNUA 2CWEA 2IGNA 1IDYA 4HE5A 3HRSA 1QVFB 2GREA 1WRJA 1HKQA 4J00A 2JA2A 1LLWA 1ZGJA 3OR2C 1Q1HA 2E2JJ 2JA6J 3PUMA 4M53A 5CKTA 3SQNA 2V9VA 3HPHA 1BLIA 1KZLA 2GXGA 1FNDA 4MYTA 4RDKA 2EFQA 1Z77A 4CSWA 3S1NJ 2BF4A 3KCCA 1GDTA 3MCZA 1OFMA 1I27A 4HRIA 3OYEA 1N06A 1P4XA 2KFDA 3C2GA 1JRGA 3HOSA 1HOMA 4G7XA 2EZIA 1VF7A 1OR7C 3F22A 2HVQA 3SZGA 1IJWC 4C2TA 2GQFA 4A0XA 2KL4A 3L1PA 3GMEA 1VHEA 5TR9A 4HQEA 2ZXWH 3CJQB 5IYBJ 3S14J 1BIBA 2ZJ2A 4RGRA 1CGPA 1YS7A 2KDOA 2XC7A 3PA2A 4ESJA 2C4UA 3W2FA 2DCEA 5HNHA 4PGHA 5JI6A 3HJEA 4A3JJ 4P1VA 5GAEJ 2FUG2 2MLKA 4P9UA 4ZZLA 1DABA 2HYJA 3CMAB 1J09A 1WFXA 2XAUA 2EIJH 4GXOA 4PSXA 1FJLA 2JVHA 3P4GA 4AC0A 3JAMK 5B3SH 4LG3A 1MBHA 1D5VA 5KHDA 5D4RA 4FE7A 2L3DA 2Y0SA 1UAAA 2P0WA 4L9NA 1XFOA 2QKMB 4TMWA 3ABKH 1PYVA 2XPUA 5E20A 2LC2A 5CQEA 4A3GJ 4MYUA 1JGSA 2DA7A 1Y0YA 3ASTA 3FPKA 3MKLA 4LLGF 3LSHA 5ICEA 1Y1WJ 2HDNB 4MO7A 1VQKB 3PIOF 2V7FA 2TCTA 5C3EJ 2M8EA 3KZYA 1MJAA 3OR1C 3ZMDA 2NVTJ 3OJWA 1PP8F 3QOPA 4OMZA 3M7GA 4NC7A 4WZLA 2P3MA 2V7VA 1EFRA 2ZMEC 3V42A 2ELHA 2R5ZA 4PJ0C 1GJRA 2PN6A 3HOUJ 3I64A 2XOKA 5KSWB 3ABLH 1ONVA 4F93B 1LE8A 2BYVE 1F5TA 1EP2B 1WSRA 5GV8A 1TTTA 2F4IA 3FKSA 2RQPA 3ASQA 1G4DA 1TYWA 4DIQA 3KEOA 1O8JA 1IDKA 3GFMA 1HDDC 2H6BA 1FMWA 1IRXA 1YITB 1ZG1A 2MBFA 2WB1N 3WE3A 4X06A 1E79A 1ZGAA 3CXCB 1KK3A 2YUHA 1JB9A 5FD5A 2C5BA 3WG7H 2JIZA 2L7MP 2DOGA 1NHAA 2F1MA 3L2QA 2HTSA 1Z6RA 1GXPA 3BWGA 2HMAA 3GW2A 4X07A 4LIUA 2QUFA 3WTWC 2P6SA 3I55B 2WSSA 3ZMSA 4X6AJ 2F43A 3S16J 3CCRB 2BSAA 2WR8A 3CC2I 4BAYA 4RM0A 4MLOA 4IW3B 2DTRA 3K1MA 4E7KA 2FX0A 3ERMA 3IRRA 3VYTB 1DU0A 4HSTA 3WYAA 1IN6A 2K4BA 4YFXF 2BM6A 3ZGKA 1R71A 1E1QA 3ULQB 3J7ZI 4R8HA 1PDNC 2CQ7A 4UVAA 3FWEA 4C3HJ 1W0JA 3HSFA 3K9TA 2QN6A 3ZXSA 3DV8A 4HE6A 1LFPA 2F5FA 3MCAA 1Z3YA 2WV1A 3H3ZA 4E7ZA 5FIUA 1MNDA 3G05A 1G3TA 1KQ5A 3AAFA 3OYAA 3OIPA 4CA0A 4HNTA 2X6OA 4NCNA 3I4PA 3DCFA 1XMAA 2MH2A 2PX9A 4L9JA 4RB0A 2LMDA 1MJBA 2VASA 4RM3A 4CUGA 5BSYA 3G4SB 5F08A 4ITVA 3BR6A 4N9HA 2DMUA 4HEA2 4JX5A 2FA5A 1R4MB 3ZMUA 1BIAA 1D1BA 3OE7A 5DNSA 1W35A 2LFBA 4AD9A 5CJ9A 2O6WA 1D8JA 3K69A 1OCZH 4A6DA 2CBXA 2R7FA 4UVBA 2M0CA 1PXZA 3VYUB 1UD4A 4WXCA 3ASOH 2PMZA 1IB4A 3W6VA 3AVWA 1QJVA 4LG0A 2XUBA 3CW2A 4XR6A 4OJ6A 1YX5A 3Q3SA 3ZCOA 2IS6A 1E3HA 3IAM2 3K70D 4TMZA 5HZAA 1OGIA 4BYYA 2JWTA 2ZJQF 1YJ9B 2EZLA 2BGIA 3HZJA 3A1PA 3R0AA 2VFNA 3GTKJ 5IPAA 1N05A 2DCUA 3ZQIA 3IUOA 2XZPA 4DZJA 3ABMH 2D74A 2MYSA 1JJ6C 2BOLA 2E2IJ 4RJLA 2W7ZA 1KYWA 4CZCA 3RYRA 2E1CA 5ERIA 2FBHA 1SEUA 1J5YA 4HBLA 4A3KJ 1WJFA 4BE2A 1WZ2A 2EA4A 2UVFA 3ECHA 5DV5A 3OYCA 4TMVA 3E5QA 2VFMA 4II3A 4LBVA 5J8FA 3JRCA 1HA3A 2IJLA 3HM5A 4UV8A 1ZM3A 5C1CA 1D8TA 2XGCA 2DK5A 3V8JA 3WU2C 4EJUA 1E3ZA 1ZM9A 3HB9A 3BG6A 4LMYA 2IT0A 1ZG3A 3JTHA 1SFKA 4UB6C 5KK1A 3LAJA 3HDDA 1XD7A 5FRMA 4G7OF 4PC7A 3BJ6A 2CNDA 1G3SA 3HKZA 1N75A 2JSPA 1ZREA 4M71A 1VQMB 1MDMA 1SKQA 2Q6OA 1KQSB 2R7QA 4IEJA 2NTQA 3IH4A 1SAUA 4NNJA 1PUFB 3PO2J 2RNJA 1SKYB 2O04A 1SM4A 1GVJA 5IYWA 1KU7A 5GP9A 3F9KA 3TW6A 3KYLA 1XGNA 4PZJA 3S3NA 4OMYA 1VQ8I 4EGYA 1GVHA 2R9VA 3BT9A 3FXQA 4HA8A 3WY9A 4FISA 1ZRDA 5E8IA 1DARA 3SZPA 3ZSCA 2ESHA 2TRTA 5F1JA 2FF4A 2M30A 5HS8A 5HOOA 2HR3A 5IP9J 1ZR4A 2LOOA 3FBNB 2CFOA 1SVLA 2XRNA 3MKYB 2DDBA 4U87A 1IC8A 5B6IA 4IZZA 4D5CA 1VF9A 4CXFA 2V26A 1R6RA 3ZRGA 1WOOA 4JOMA 2MG4A 1G7CA 4RLZA 4H0EA 2NVXJ 1BQEA 3BZKA 2K9SA 2JA7J 5A88A 1FOYA 4G6IA 2JZYA 1P7JA 1TYUA 3QFRA 3MZ8A 2FMLA 2C78A 2CK3A 3HL2A 1NK2P 2JMWA 4BQOA 3CJRB 3CMEI 2L7ZA 2HXIA 5L3GA 3GQBA 4GQNA 3IKTA 4N4NB 2HQRA 3KP3A 5C1EA 1F4KA 4QWQA 2VOPA 2R7ZJ 2INUA 4Y3OA 4U0WA 2CH0A 1N77A 1UG0A 4LIVA 3ZBUA 3GTQJ 4ESBA 4Q47A 4BDZA 1S29A 2XKPA 1REPC 1N0UA 1YX2A 3KZZA 2AO9A 3H35A 5LRSA 2HVRA 4MQVA 1Q82D 1V5FA 3PA1A 1YJWB 2OC6A 1YIOA 1O7LA 2V4JC 1XGOA 4KICA 3ZN0A 2CUZA 1W1WE 1YW8A 4Z05A 2MGQA 2K3PA 3NAUA 3F6VA 3FXKA 2K86A 2EB7A 3Q9VA 1JA1A 1NJID 2FE3A 3CLOA 4UVCA 3SZTA 3OYKA 4YG2F 1MABA 2FNAA 3CCJI 1VFCA 4BJTA 2F5VA 2HDDA 1HSTA 3KEYA 1EF4A 1R23A 2D2WA 1BBYA 2FBKA 2Z1DA 1T5EA 3GTPJ 4OOSA 5IK2A 4KIGA 2DA3A 5DUKA 3GFIA 3FXOA 3GSIA 2VBMA 1O57A 3CCYA 4LK1F 4NK8A 1WU8A 3JRHA 1U9NA 2OZUA 3TP0A 2QM3A 4BKXA 4M3EA 3EDPA 4KYWA 3CO7C 1KU3A 2WAEA 2DT5A 1VI0A 4A3EJ 2E1BA 4LBZA 3LQEA 4I2OA 4MFDA 1B6AA 2BXYA 3AG4H 3HUGA 4RM2A 3F8CA 3HC7A 3CCLB 2WB1A 1YX3A 3BQZA 2EWEA 1TC3C 4JBAA 3GQAA 4Z2YA 1UZCA 3BCFA 2KIQA 4I98B 2HOEA 4LK0F 2HOTA 1QRYA 2BVNA 2HQ5A 3CDLA 2HGCA 1VQ7I 3GTJJ 2WC2A 2O8XA 4NQWB 3GVLA 1X1BA 1SVMA 1VQOI 2VBTA 1WJCA 4TKOB 2F4NA 4U0VA 3F3XA 3CF2A 2UV1A 2ZZFA 3DU1X 5JVTA 4B1RA 1AIRA 4YFOA 1A5JA 3JTGA 2DLLA 4QSHA 3S1RJ 1OYIA 3AVVA 3WTZA 4XLFA 3WHBA 1K5CA 2F48A 4DNTB 4RBOA 1KQ0A 3OOCA 2HFHA 5J47A 1LFUP 3RKXA 1UFMA 3GUDA 4IX7A 1F36A 1ZUNB 3CD6I 4BS9A 2XB5A 4KMFA 2PYGA 5CYVA 1KA8A 4WF2A 1LEAA 1W9XA 3U6KA 2GWRA 2L5QA 3OFNA 3DQVC 3M9AA 4MR0A 4ZDLA 1DDIA 3CCMB 3BZ6A 3PETA 3Q6QA 2L02A 3PJRA 2XNCA 1UCRA 1R00A 4IHYA 4LJZF 1QHGA 4BQQA 1ETXA 3G3ZA 3T51B 3G1OA 2HI3A 1GO2A 1D3YA 4QVJA 4DQKA 1FBSA 2RN7A 5IT9Z 2P7VB 3I53A 1T56A 5FNZA 1S0UA 1DGWY 1I6XA 1TWCJ 1U5TB 3MKWB 3GTOJ 2IVMA 4BE1A 1FMVA 1I39A 4UZFA 2L9RA 3L2WA 3DTIA 5IOZA 2M9HA 2R7WA 3WGHA 1R1TA 1IRZA 4KJZA 3ZPLA 2ISYA 2XAGA 2HDCA 1X58A 1E17A 2P5LC 4EJOA 2E60A 3VMWA 5E3NA 1MH3A 5C4XJ 1QG0A 2ZZGA 1OMIA 2JUGA 1FZPB 1OB0A 3VSLA 1P9QC 3MKZA 3TQNA 1FYKA 3K1NA 2OTJB 1ZM2A 4ROXA 2JJ7A 1K79A 3CUQA 4CGZA 4F55A 4M9ZA 1FOWA 2XSDC 3UKGA 2BXZA 3HPGA 4NC6A 4P9SA 3LSTA 2F5EA 2DW4A 4JRAC 1A6QA 4HNVA 3MZHA 2UXNA 2VN2A 4UNOA 1MD0A 4G8XA 4XK4A 2XKOA 1D0ZA 4MNUA 1T6YA 1RU4A 1STZA 3FMQA 4ENMA 3OYFA 1H80A 5M3FJ 4PFOA 3RZDJ 4RAYA 3PL8A 1WVRA 1S7AA 3ROUA 4X0GA 1VJSA 1BI2A 5DCFA 4OJ5A 3Q39A 1IV8A 3E3VA 3AK5A 1FOXA 1GHCA 4CHUA 1ZRCA 1FBQA 2XIGA 4BQAA 1LEBA 1FTTA 5DCMB 3BC9A 1LVAA 5F0FA 3L2VA 4H9GA 2XEXA 5CPRB 2A07F 3O6BB 2Y0SN 3OY9A 4A3DJ 2YR2A 5LFAA 4OPSA 4XOPA 2GIVA 2O5RA 3M1EA 4OAYA 4BY7J 1BI0A 1HKTA 1HF0A 2HDWA 2M1BA 4JP0A 3VO2A 3FJOA 1WSUA 1VQKI 4BBSJ 1W34A 2VFQA 3FM3A 1D0XA 3EUHA 3H3VK 1M90D 5FGMA 3RDIA 2XRLA 4QPOA 2Y0MA 2IS1A 1D8KA 4CZZA 1IB0A 5CVIA 3OYMA 3A3BA 2AXTC 3ZZUA 3OYHA 3I3LA 1FRNA 2LF8A 2EINH 5EEHA 5K5OA 2Y9ZA 2JN6A 3FHZA 5EG0A 3LVBA 2V6CA 1ZN2A 2KP6A 3BY6A 1T38A 1SD5A 2BE5F 5BMZA 2DOFA 2JA8J 1Q7YD 1CF7A 1QBJA 1FY7A 1YITI 1D1CA 3OS2A 3DBHB 3MWMA 2O0YA 3CC4B 2XAFA 4DBRA 4E4HA 1CNFA 1R4NB 2JQ7A 2R4GA 3C18A 3VYRB 4YAWA 3QE2A 1CLWA 1OCPA 2C5HA 2E7WA 1IZ1A 3DTKA 3MZYA 4I02A 5F0HA 5TRDA 3WE2A 1LPQA 4MEXF 4WZEA 4Q7JB 3I55I 1KD1D 3BCAA 2KKOA 5GTIC 2XNDA 5HLHA 2GZWA 3QAHA 2H27A 3W5VA 1IN8A 5JHUA 4EGZA 4XKCA 1HVXA 4EH1A 2AQEA 2BW3A 5EEGA 1JXSA 5TISC 1S7EA 2VBSA 5IYNA 2UXXA 1K78B 1Y0UA 2FJ1A 3SEZA 4HYEA 3N97A 4HSRA 2QEXB 2EV5A 2VFOA 3E6BA 2DK8A 2PI0A 1WP6A 2YWEA 1CQXA 2V1DA 2F6CA 3AGPA 4FN5A 3MEXA 2IP2A 2P8TA 5DTDA 2VBXA 2LBFA 2VKEA 3IKVA 5J4VA 4BHBA 2DO7A 3HOZJ 2ZC2A 1RPWA 4YFKF 3JRGA 2KPMA 2W24A 3PSIA 1TQIA 3RY8A 2CU7A 3T0YA 4ENNA 5IYDJ 1BI1A 2GK6A 3S2WA 2E1OA 4UUSA 5HXBA 3E6MA 3VSVA 3G4SI 2OU2A 2BM7A 3BDDA 1GR1A 1FIAA 4RAFA 5D8KB 3M3YJ 2WBMA 1R22A 4BJ6C 4PUSA 3H3UA 4R71A 4HLYA 1XCVA 3OS1A 4MGRA 3ZQFA 1IUFA 1EH8A 2ADUA 3OYDA 2L9SA 2Z8GA 4YDTA 3H92A 3QPSA 1EJ9A 2QYOA 1QVUA 1FOKA 2HQNA 3FY3A 2VKHA 3ZQLA 3DP7A 4OINF 3IAS2 4DYRA 2O0VA 2H1KA 3RSNA 3FIWA 1YYVA 2HCJB 5DM7F 2A68F 2V1XA 2DFHA 3A3GA 2NV4A 3WXMA 3D0SA 4ON0A 1XB2A 2V7UA 2D45A 4LLLA 4ZTFA 1HQCA 1LFBA 5J3LA 4UAJA 1ZRFA 1QGAA 2J7KA 2XV4S 2DU9A 3BY1A 2JVGA 2M45A 2NVUB 3QOEA 2P81A 3CCQB 1ZELA 4E0FA 2ME0A 1J7KA 1R5BA 2JUCA 1X1AA 5KCMA 2ACJA 1FWZA 2ZKZA 1U78A 5M5WJ 1AHDP 1G7SA 1UMKA 1WDTA 4M0LA 1D1NA 2QVOA 5FKMA 2BEOA 2DMNA 4RLQA 4OIOF 1R5OA 2EIXA 2JT1A 5LGTA 1BC8C 4RCYA 1W7PB 4OOVA 2EBIA 4WZTA 1JJ2B 1RC9A 2CUJA 5E3MA 2O9LA 2F3LA 4ZYGA 3GTLJ 1VQMI 2PG4A 3DU6A 3TOBA 4L0YB 1DG1G 1WPCA 2PBIA 4TMTA 3G71B 3JRDA 3CCUB 3FX3A 4XLPF 2ZL5A 5LEJA 3DBRB 2NOJB 4MHGA 4GRIA 5L3BA 3HTUA 3ZR8X 1FIPA 1Z3XA 4U9UA 3L2UA 2ECCA 3B02A 4M3BA 4OPWA 3A35A 4PJLA 5E3OA 3ZMZA 1YTYA 4XBFA 1W0TA 4OJOA 2ZNZA 2BBYA 4B3AA 3WTYC 2AS5F 5A2QK 4RGUA 3KP7A 3ZQ7A 2DA6A 1RQPA 2LLKA 1GAWA 2VBEA 4D5FA 2CQXA 1VZ0A 4ZYDA 2ZZQA 5IT9K 1V5GA 4C3IJ 5F1RA 1YRNB 1MJ9A 3CUQC 3HHGA 1TYXA 3B4NA 2VL8A 2XGEA 5FKLA 3RJPA 4XRMA 3ZQCA 1QZEA 3P9IA 3D26A 5H5JA 3OPOA 1E63A 3SLNA 4Z4UA 1TP4A 5FRNA 2PMDA 2VT2A 2O0WA 2HKXA 4LB6B 1O8MA 3F8MA 3R6KA 3QFSA 2OQRA 1FP1D 1U6GA 1VQ5B 4Z4VA 1ZKGA 3BH7B 3LSPA 2NRAC 4OZYA 3CLQA 4XLCA 5D5XB 3LOCA 1P4WA 1KC8D 5L3EA 4XLEA 3DFGA 5M3MJ 2W48A 2QA4I 4EM2A 1KK1A 3Q38A 3NAWA 1MKMA 2XAQA 2IEKA 4P5OA 5J1YA 3K10A 3LQ6A 1TSPA 4F3QA 2MD0A 4G7ZF 3U6BA 3G6EB 3LYCA 1BN5A 5A8AA 1YJWI 3I58A 2NXNB 2OAZA 3H5NA 4UXNA 3E20A 2BVMA 3A8KA 4RDUA 3TO6A 3H9JA 1EA3A 3EUHC 1I5ZA 5FO0A 4A0ZA 4BQNA 1FSHA 3S93A 3JREA 4W8TA 3EUAA 3H0DA 4Q5SF 4BHCA 1OGMX 1DQUA 5L3DA 2VQGA 2BM5A 3C7JA 5K7FA 5M5YJ 1DP7P 1SMYF 2G9WA 2NTBA 4BXXJ 4A5MA 1W4MA 4XQFA 2P7CB 2Q2EB 2Q6KA 1OFLA 2E7XA 2A5WA 1K83J 3N90A 4L5IA 4PJNA 1IO2A 1E64A 1PUFA 1TYVA 2NSTA 2QYUA 1VQ4I 3R4KA 1W5SA 1USSA 1DPUA 3B8HA 1QU3A 3GRHA 1T39A 1YG2A 3WU0A 1APLC 4Z4RA 1Z7LA 3TOAA 1U8RA 4E7LA 2JK3A 2GM4A 5GV7A 1B4AA 3BG7A 5ILUA 3W2HA 3NQOA 3T8TA 2WJVA 2VPRA 4BU2A 2GJKA 2MD5A 3EQLF 2X1CA 4FHTA 3VPRA 2R7UA 3EQOA 3W2IA 4LBYA 4D7NA 2LDUA 1N0VC 3JU4A 4M3DA 3VDXA 4I84A 2QWWA 3JSOA 2K9MA 1QRBA 3JSPA 1UHMA 1UG2A 5ICCA 1P7IA 4ENJA 4HV5A 1WH5A 4JK1X 2JRTA 1RI7A 4RGSA 2XC1A 4LOCA 4V19K 3HYIA 3CCEB 2WV0A 2R7XA 2NT9A 1J59A 4CYDA 4XKBA 2QX3A 2CJJA 1EFUA 2EFOA 2DBBA 2DQRA 4XKVA 2ZXIA 1YHQI 1MNMC 2DA5A 2IBDA 2A69F 1NDHA 1TWHJ 2NZMA 1PJ7A 4QV2A 5EYRA 4CCMA 2P6TA 3ASRA 5EGOB 4PAAA 2CUFA 3VODA 4Y7NJ 3QRFF 2E2HJ 3K2AA 1B9MA 4HX7A 5HLGA 4PC6A 4ESFA 1OYYA 3MMPA 3JX8A 3W2WA 1ORKA 4XOTA 2OBSA 2ZBVA 1XPXA 2XTXA 4OAZA 3CMMA 1DU6A 1ETKA 1K4SA 2LY2A 1W5CC 4HPQA 3W2GA 2M34A 1X3UA 5HLIA 3T1BA 1XMKA 3FF5A 1W2BB 4ACBA 1QH0A 1KGSA 2Q0OA 3KP6A 5F4MA 1QUFA 2WAQN 1XGMA 3FXLA 3MD2A 1YLOA 3LA7A 2QSHX 5FFXA 1M1KD 2K02A 4B09A 3OV8A 3GVKA 3KX2A 5IYRA 2O61A 4XLHA 2INVA 2K27A 3OL4A 4BBRJ 4RD1A 1IDJA 4IHXA 2OPTA 1ULYA 3A8IA
chains in the Genus database with same CATH topology
3OYKA 2X85A 2M0MA 1MABA 2M7BA 1WJDA 4BJTA 2F5VA 5KNLA 3KEYA 2BVLA 4ZTJA 1EE6A 1I18A 3DKXA 2O17A 1T0FC 2Z1DA 2KQRA 3LSGA 4B3XA 4HNUA 1T5EA 1UD8A 4CCNA 4DNRB 5IK2A 3EQNA 2JJ2A 1X4OA 4N4OB 4G7WA 2VBMA 4FASD 2V6EA 4NK8A 1QHHD 4ZDPA 2V9KA 2GJPA 2WAEA 4CCOA 2E1BA 2L2OA 2X1DA 1V0FA 4P1WA 3NE5B 1BR4A 2VB6A 2M4GA 3QYFA 4RM2A 3HC7A 5LD2C 3GQAA 2WB1A 1YX3A 2EWEA 1WJAA 3BCFA 1BR2A 3M8JA 4DJAA 3AL0C 4OWRB 3AKZA 3QODA 2IGMA 3L2RA 2V7QA 1DBOA 2ODLA 4NK6A 2JDIA 2VKDA 4NQWB 3SYTA 5FROA 1DGRM 3GVLA 1X1BA 4URRA 3PNTA 1BR1A 1WJCA 4BUPA 4TKOB 4YZ0A 2X51A 2QKLB 1V5EA 3CF2A 3SDBA 2UV1A 2ZZFA 4L8JA 1KONA 4OZZA 2IQ7A 3D5RC 4C9YA 4ZDOA 2W82A 2ZSIB 1AIRA 1KTWA 2PECA 3GQ9A 3LMMA 2CW7A 2BW3B 1Z21A 4XLFA 1H8EA 1K5CA 3FPPA 3OEEA 4DNTB 2XF7A 3G2BA 1WMRA 3OAAA 3OOCA 4CCJA 2HLDA 3IP4B 4IX7A 1NRKA 3PSFA 3UR3C 4BS9A 2ZTGA 2PYGA 3GVJA 4ZC3A 2NT6A 1W9XA 2DOAA 2MABA 2L5QA 2LBFB 4C30A 3DQVC 3PNYA 3OFNA 4MR0A 4ZDLA 4YZAA 2VPLA 3C2HA 4XN3A 4BEHB 4U49A 3OYGA 2WY7Q 4PSWA 3PJRA 4W8RA 4XN0A 4BEHA 4E6KG 4PMHA 1QHGA 4BQQA 1UD5A 1MMGA 3T51B 2UWMA 3E0JB 3K4LA 3VSKA 3RQ4A 4BGDA 2JJ1A 3W2AA 2VXZA 4BDYA 2LY1A 1PLUA 4YXWA 1DGWY 4IQ4A 3MMYB 3PUBA 3MKWB 1FX0A 2RNGA 2BSPA 4W8SA 4BE1A 1FMVA 3L2WA 2XZLA 3VSTA 3DTIA 3OIQA 2V4DA 4E7HA 2R7WA 3S3OA 1V0EA 4KJZA 3W2VA 2KLOA 2E5NA 2CV0A 3FBIB 1E0EA 2Z16A 2E60A 3DDYA 4DGWB 3VMWA 4HIZA 4AU7A 3RPUD 3OMYA 3OWTA 2ZZGA 2JUGA 1OB0A 4XL9A 1P9QC 1OLTA 3VSLA 3OYNA 1MMAA 2E5ZA 3MKZA 1G8XA 3TL4X 4E7SA 1Y56A 3T53B 1X4PA 2HU9A 4F55A 2W7NA 2XF6A 1UD3A 5CDFA 4BXFA 3HPGA 3LFUA 2K9LA 4RMNA 4B48A 3H9GA 2IXSA 2AQFA 1D0YA 3GQ7A 3BH4A 4LITA 2W1OA 4YRVA 1E1RA 3DPUA 2D3LA 2W6JA 2WPDA 1D0ZA 1DP3A 2X53S 1RU4A 2PYHA 1BOBA 3OYFA 1H80A 4Y33A 4PFOA 4B3GA 3PL8A 2DT6A 2ZZEA 2RQQA 3DKYA 4W8QA 3AL0B 3B90A 4X0GA 1VJSA 4Z03A 2KZVA 4OJ5A 2MC4A 2IGKA 4XNFA 1S9HA 1HG8A 1K6YA 3OEHA 3CZ6A 3H94A 1K28D 2LRDA 1O8EA 3BC9A 5FL7A 2NTPA 3L2VA 4YEJA 2Q1ZB 5CPRB 4BJ5C 4PJJA 4PJMA 3LSKA 4C2UA 3OY9A 5LFAA 4XOPA 3LSMA 4QPQA 4XM3A 2O5RA 1N78A 4OAYA 4MXNA 2LG4A 1ERDA 2HDWA 1H8HA 4ASUA 4DOZA 4B43A 1NG7A 1PKVA 1D0XA 2A6TA 3S8PA 1KCDA 3VSUA 4QPOA 3ZIAA 2IS1A 1O8FA 3DWLE 2VQHA 2ZXHA 1W36D 2IS2A 1QCXA 3PFYA 3OYMA 3A3BA 4XLAA 3OYHA 3I3LA 2V1NA 2VBKA 2M7AA 1KMHA 4Z06A 2UVEA 2ELJA 5HKKA 4PFPA 2KP6A 2IS4A 1YE9A 2VJJA 3BCDA 1O8IA 3NWSA 4ANJA 3UW0A 4XONA 4XORA 3CP2A 2I8DA 4D9JA 1D1CA 2IGNA 4HG2A 4DBQA 3OS2A 2WY8Q 2D3NA 4XD7A 4DBRA 4E4HA 4J00A 2JA2A 2R4GA 3VYRB 3OR2C 1U0JA 3QYEA 4II2A 3DTKA 5CKTA 1T95A 3HPHA 3WQZA 1BLIA 1KZLA 3HG9A 1O8GA 4KISA 3BCAA 2XNDA 4CSWA 4F92B 1Y6IA 4XKCA 4YZXA 1OFMA 1HVXA 1LKXA 4HRIA 1O8HA 3OYEA 2AQEA 2BW3A 4CH7A 3DPLC 1MMNA 4FETA 3C2GA 3FKJA 1JRGA 3HOSA 2CW8A 3SEZA 2VLAA 1VF7A 4HSRA 1OR7C 4G7XA 2HVQA 2LH9A 3SZGA 3TBIA 4C2TA 4B3FX 1PE9A 2KL4A 1WP6A 1VBLA 4PK4A 3BLYA 4AYBA 3J7AY 3CJQB 2XGJA 2KDOA 3B8YA 2XC7A 3CP8A 2F6CA 2DCEA 5HNHA 1O8DA 2VJIA 3VYSB 2LBFA 2FUG2 1IA5A 3H9QA 2WAQA 1CZFA 1RMGA 1J09A 1WFXA 2XAUA 1LDKB 2KPMA 1AA7A 3I9V2 2JVHA 3PSIA 4PSXA 3RCOA 2HPIA 3HOTA 2GK6A 1GLNA 3T56B 4LG3A 5KHDA 2M3AA 2CV2A 1UELB 2VJ4A 2P0WA 2W00A 2Y0SA 3LL7A 1UAAA 1W0KA 3TMOA 3VSVA 3K6GA 3DLAA 3LNNA 2QKMB 1XG2A 2HZDA 1PYVA 2XDVA 2WBMA 2LC2A 3UNGC 5CQEA 3LMWA 4BJ6C 4PUSA 2GJRA 3LSHA 2O1DA 2HQAA 4F52A 2V7FA 1BPLA 3OS1A 4BL0B 1O88A 2Z8GA 3OYDA 3OR1C 2L9SA 4EW9A 4NC7A 3HAGA 1EFRA 3S3MA 3V42A 3FY3A 2VKHA 2R7TA 2XOKA 4F93B 5HNFA 2DT7B 3IAS2 4BE0A 2F4IA 2O0VA 4TSFA 3RSNA 3FKSA 2E1MC 4DIQA 1MW7A 1O8JA 1IDKA 3A3GA 4AVZA 1FMWA 1IRXA 1UD2A 1UD6A 1BN8A 2NSPA 2HNHA 2HPMA 1E79A 4ZTFA 3ZPNA 2KMUA 3HXLA 3KEWA 3NWTA 4U4BA 5HVQC 2CS3A 2JIZA 3E1SA 1BMFA 4KKSA 2MFZA 3VR6A 2K5CA 2F1MA 3L2QA 4HWVA 4CCLA 2JVGA 4LIUA 4ZYAA 3U21A 4EATA 3QOEA 2XF5A 2WSSA 1ZELA 2OV7A 4E0FA 2F43A 4P22A 2DXIA 1X1AA 5KCMA 4MLOA 2R7OA 4E7KA 4RLQA 2KRCA 3VYTB 4HSTA 3K4BA 3ONQA 1KCCA 3ZGKA 3K4CA 1E1QA 1W36C 2RREA 2CUJA 1COWA 1W0JA 4B44A 3ZXSA 3DU6A 1WPCA 2LYCA 1LFPA 3LSIA 1Z3YA 4E7ZA 1MNDA 4J01A 3G05A 2NOJB 3K4NA 5TGTA 4GRIA 3OYAA 3OIPA 3D5LA 3ZR8X 4CA0A 4R79A 4HNTA 2R7SA 1Z3XA 3OYJA 4IQJA 3L2UA 2VXDA 1JTAA 3VMVA 3A35A 4PJLA 1X1CA 1OHHA 2VASA 4RM3A 4CUGA 4E7JA 4ITVA 3H5AA 4UZUA 4NC8A 4JMQA 2X8KA 4OJOA 4KKUA 4HEA2 5CQGA 1HA8A 3VWBA 4IKFA 2VBEA 1TT0A 2KRHA 4C2LA 2Z6BD 1VZ0A 1RWRA 1D1BA 4NUBA 2ZZQA 4FXUA 3OE7A 2V31A 1V5GA 3OYIA 3K70C 3B4NA 3GQ8A 2L7KA 3SUCA 3S32A 1X19A 2VL8A 2INVA 2GOXB 2QE7A 1PXZA 3VYUB 3T9GA 3OPOA 1UD4A 1HZEA 4OJPA 2PMZA 2DIEA 1IB4A 5FRNA 1QJVA 3OYBA 2QXZA 4OJ6A 4XR6A 2O0WA 1YX5A 2WA0A 2W6IA 2Z2SB 3ZCOA 4E7IA 2IS6A 3IAM2 3K4JA 3HUGB 3K70D 1I8DA 2M5SA 1O8MA 2VQLA 1MNEA 2X3HA 3KRGA 4DK0A 4OZYA 4XLCA 2UUZA 3IUOA 2XZPA 4D1QA 3W3CA 3M1CA 3EPZA 3EUKL 2MYSA 2ZTNA 3A1YA 2BOLA 3FDYA 3ZQQA 4CZCA 2E1MB 4XLEA 3DPTA 1WJFA 3CESA 4H4KC 4BE2A 1O8LA 4P5OA 2UVFA 3OS0A 3K10A 3OYCA 4F3QA 2MD0A 2ZFUA 4II3A 1WJBA 2LZJA 1WTHD 3H5NA 5C1CA 2BVMA 4XMYA 2KVOA 5DN6A 1E3ZA 3H9JA 1EA3A 3K4MA 2GOMA 2W4SA 3EUHC 3PNVA 3SEQA 2XSJC 4U7BA 2R7RA 4YZQA 3BG6A 4BQNA 3S93A 4W8TA 1SFKA 3EUAA 3H0DA 3WWGA 3FHNA 2GK7A 2VJ5A 1OGMX 1NG6A 1DQUA 5FRMA 4F91B 2VQGA 3JURA 3ZPPA 3HKZA 1N75A 2JSPA 2LREA 5AMVA 4Z1MA 1LVKA 1TZLA 3DTEA 3QYBA 3H5RA 2NTBA 2R7QA 4XQFA 1OFLA 2Q2EB 4KITB 2NTQA 4NNJA 1SAUA 2L9NA 2A5WA 1SKYB 4ZJZA 4DK1A 2O04A 4PJNA 3OL3A 3K4KA 3F9KA 5JHFA 1G59A 3KYLA 2WADA 1BHEA 2NSTA 3A4CA 3S3NA 2R9VA 1QU3A 2WJYA 3GRHA 1OOCA 2X6XA 3D5SC 1Z7LA 3BCBA 4E7LA 3ZSCA 3AFHA 5HOOA 3BG7A 4KT6A 3A2KA 2LOOA 2WJVA 4BU2A 2GJKA 3FBNB 2QY1A 2CFOA 3OOUA 2X1CA 3MKYB 2OUMA 4XKWA 2R7UA 2WAFA 3EQOA 2PJRB 2M4KA 2ZSHB 4U87A 4IZZA 3JU4A 3VDXA 4I84A 4CCKA 2PJRA 2V26A 1R6RA 2K9MA 3ZRGA 4JOMA 1NBMA 1GQ8A 5HLTA 1O8KA 4KKTA 2NT9A 2CMPA 3BC8A 2R7XA 1WJ5A 4XKBA 2QX3A 1JI8A 4G6IA 4G6TB 4B47A 4BACA 2CK3A 3HL2A 4XKVA 2ZXIA 2NZMA 2X6WA 4BQOA 3CJRB 3GQBA 4GQNA 1DBGA 4JQFA 4CCMA 2IGOA 4N4NB 5C1EA 1MMDA 2INUA 4OJLA 4Y3OA 3N05A 2CH0A 4RLFA 1N77A 1UG0A 4LIVA 2VQCA 2X1EA 3W2WA 4TT3A 4XOTA 4BDZA 1PJRA 3CMMA 4OAZA 4Y4RA 2LY2A 1E3XA 4HPQA 2XZOA 1X1DA 2CV1A 3H35A 2HVRA 1V5FA 1X0CA 2OC6A 2V4JC 2CUZA 2VIXA 3MD2A 4Z05A 2K3PA 1WJEA 3DU5A 3KX2A 3GVKA 3DEEA 3OYLA 1OGOX 4XLHA 2KHMA 1D1AA 2X6YA 2DJIA 3RTRA 2R7VA 1E43A 3OL4A 3GBGA 2HVSA 2WZPP 1IDJA 3OW7A 1NHCA 1VLYA 4YELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  2X85 A;  3GQ7 A;  3LMW A;  2O1D A;  1EE6 A;  2O17 A;  1RU4 A;  2PYH A;  1O88 A;  4XLE A;  2NT6 A;  2Z8G A;  1H80 A;  3EQN A;  4EW9 A;  1O8L A;  2UVF A;  4W8Q A;  2VBM A;  3B90 A;  4Z03 A;  4NK8 A;  4OJ5 A;  4XNF A;  3FY3 A;  1HG8 A;  5C1C A;  4XMY A;  1O8E A;  2O0V A;  2NTP A;  4YZQ A;  4YEJ A;  4W8T A;  1O8J A;  3WWG A;  1IDK A;  3GQA A;  1OGM X;  2EWE A;  4AVZ A;  4XOP A;  1BN8 A;  4XM3 A;  3JUR A;  4MXN A;  2NSP A;  3ZPP A;  5AMV A;  2ODL A;  2NTB A;  1DBO A;  4U4B A;  4NK6 A;  4XQF A;  1OFL A;  2NTQ A;  4URR A;  2O04 A;  4HWV A;  4YZ0 A;  1KCD A;  3VSU A;  1BHE A;  1O8F A;  2NST A;  1QCX A;  4OZZ A;  2IQ7 A;  1AIR A;  3GQ9 A;  4XLA A;  2PEC A;  1KTW A;  3GRH A;  2VBK A;  1OOC A;  4Z06 A;  2UVE A;  4XLF A;  2X6X A;  1K5C A;  3ZSC A;  4OZY A;  1WMR A;  2VJJ A;  1O8I A;  1KCC A;  3UW0 A;  2QY1 A;  4XON A;  4XOR A;  2PYG A;  4XKW A;  3EQO A;  4MR0 A;  4I84 A;  4YZA A;  4XN3 A;  4U49 A;  4W8R A;  1GQ8 A;  4XN0 A;  1O8K A;  4PMH A;  2NT9 A;  1O8G A;  2QX3 A;  1JTA A;  3VMV A;  4XKV A;  1PLU A;  1OFM A;  4YZX A;  1O8H A;  2NZM A;  2X6W A;  4OJO A;  1DBG A;  2BSP A;  4W8S A;  1JRG A;  2VBE A;  3VST A;  5C1E A;  4C2L A;  1VBL A;  2INU A;  1RWR A;  1PE9 A;  4OJL A;  3B8Y A;  4XOT A;  3B4N A;  3GQ8 A;  3SUC A;  3VMW A;  1O8D A;  2VJI A;  1PXZ A;  3T9G A;  1IA5 A;  4OJP A;  1CZF A;  1RMG A;  1X0C A;  4XL9 A;  1IB4 A;  1QJV A;  2QXZ A;  4OJ6 A;  4XR6 A;  2O0W A;  4Z05 A;  1O8M A;  3VSV A;  1OGO X;  4XLH A;  2X3H A;  2X6Y A;  2INV A;  3KRG A;  1XG2 A;  1IDJ A;  1NHC A;  4YEL A; 
#chains in the Genus database with same CATH topology
 4DQL A;  1B8I B;  1WJD A;  2Z5U A;  5A89 A;  5KNL A;  2VOO A;  1OGJ A;  1I18 A;  1YW7 A;  2X48 A;  5L3C A;  2Y48 A;  2COM A;  2VBW A;  3LSG A;  4PC1 A;  4YAU A;  2VNK A;  5H6R A;  2BY3 A;  4N4O B;  5J1R A;  4RAZ A;  4OOX A;  3F21 A;  1V5V A;  3RPU A;  3IV5 A;  2TDX A;  2HXO A;  2BGJ A;  2K9N A;  4BY1 J;  3HOW J;  4G94 A;  1R5N A;  3C3W A;  2OTJ I;  1IHM A;  2H94 A;  1ITY A;  3NE5 B;  4C43 A;  5LD2 C;  3PEN A;  4XRS A;  1R1U A;  2G7H A;  1VTN C;  3M8J A;  2A05 A;  2XB0 X;  2O7O A;  3ZMT A;  4DJA A;  4EJT A;  1N07 A;  1IJF A;  3V7C A;  3AKZ A;  3QOD A;  2IGM A;  1YIJ B;  4EVI A;  1E3O C;  5ICG A;  3G73 A;  1SAX A;  5FA6 A;  4YZ0 A;  4NQW A;  2X51 A;  2QKL B;  1V5E A;  3BR0 A;  3BR3 A;  3S17 J;  1B59 A;  1BM9 A;  2EV6 A;  1KON A;  4OP7 A;  4OZZ A;  1LDJ A;  3GQ9 A;  2PEC A;  3RYP A;  4O5V A;  4FQG A;  3KZI C;  1O3Q A;  2IRF G;  1Z21 A;  3GLL A;  1H8E A;  3FPP A;  1AKH A;  1RUN A;  1L1I A;  4A2U A;  1GT0 C;  5IYP A;  2C6Y A;  3AVY A;  2XF7 A;  3KET A;  1WMR A;  3GZ5 A;  2OK8 A;  1TVC A;  3LA2 A;  1PJ5 A;  2FSW A;  5AIQ A;  1SFO J;  2HLD A;  5FO1 A;  4AC9 A;  3GXO A;  2HEO A;  1NRK A;  1WOR A;  3UR3 C;  3ELK A;  2O03 A;  3AG3 H;  3H1C A;  2P5K A;  2W25 A;  5LBQ A;  1A8P A;  2GXA A;  1TNS A;  3S2H J;  4YZA A;  2VPL A;  4BEH B;  4U49 A;  5FD6 A;  3I1F A;  4W8R A;  2E35 A;  1TQM A;  2YPR A;  1A04 A;  1MMG A;  4D0P A;  1ZR2 A;  4I7H A;  1E3P A;  3E0J B;  3K4L A;  3RQ4 A;  4BGD A;  4UZE A;  2VXZ A;  2FQ4 A;  2LY1 A;  3IWZ A;  4YXW A;  4FWT A;  3E1Y E;  1PLU A;  5H2F C;  2K4J A;  3P27 A;  1XG1 A;  4LFU A;  1FX0 A;  2RNG A;  2K3F A;  1ELO A;  2G7U A;  1QFY A;  2HZT A;  2Y9Y A;  3CJN A;  2UZK A;  1JTX A;  3P7N A;  1UJ8 A;  3ZZT A;  1MH4 A;  2KLO A;  3CC4 I;  2CV0 A;  1E0E A;  3WGG A;  5FKK A;  4DGW B;  4QIW N;  2R5Z B;  3BTC A;  1TW3 A;  3RPU D;  1XE1 A;  2QMU A;  5LHI A;  2YWF A;  4P6V F;  2OA4 A;  3A0H C;  4RD3 A;  5DD8 A;  5BPI A;  5C44 J;  2LNB A;  1FDR A;  4HV6 A;  2XT2 A;  4E7S A;  3OW7 A;  4AIK A;  2VI6 A;  2OF7 A;  3PUN A;  4M2L A;  2W85 A;  2EIK H;  3T53 B;  5E1X A;  5CDF A;  1OCR H;  1ZK8 A;  3WG9 A;  4I76 A;  5CVJ A;  3LFU A;  4GGG A;  4M3F A;  4RMN A;  3W6K B;  2F2E A;  2ZO4 A;  3H9G A;  1LDD A;  1D0Y A;  2IXS A;  4AF6 A;  1SC7 A;  2LVS A;  3AG2 H;  2D3L A;  5J8C A;  1TWG J;  5AIP A;  3MHP A;  1IG7 A;  1YFH A;  2I10 A;  4LC0 A;  4BNC A;  3VEP A;  1IN5 A;  3U1K A;  5LGN A;  4FX4 A;  1ZG5 A;  2EK5 A;  2ZZE A;  2L7F P;  2DY1 A;  5FO5 A;  3JW4 A;  2BY0 A;  5BNG A;  4KDP A;  2YWG A;  4W8Q A;  3B90 A;  2FXA A;  3GTG J;  2MC4 A;  6PAX A;  1ZM4 A;  4XNF A;  1ON2 A;  1K6Y A;  1TLH B;  3SFZ A;  3TKY A;  3J80 Z;  4G12 A;  3H94 A;  3SKB A;  2ZJR F;  4F7Z A;  1U9O A;  3WOD F;  4XID A;  3AGQ A;  2E34 A;  4OU0 A;  1RET A;  2Q1Z B;  4HOB A;  3JCU C;  5E1Z B;  4A6E A;  4PJJ A;  4PJM A;  4BJ5 C;  3Q6R A;  2BM4 A;  3LSK A;  2GA2 A;  3D1N I;  4C2U A;  1OFD A;  4IO9 F;  1YLF A;  1N78 A;  3WTX C;  1SMT A;  3CUO A;  2ZIT A;  1QA2 A;  4A3C J;  5DD4 A;  1H8H A;  4ASU A;  3KP5 A;  1NG7 A;  4O3M A;  1OPC A;  4FCY A;  3A03 A;  4X0C A;  2VT3 A;  3HOX J;  1IGN A;  3P26 A;  2YU3 A;  5FKN A;  2F1L A;  1KCD A;  1TQP A;  1JE8 A;  2KJC A;  5CVR A;  4ZCL A;  2FU4 A;  2X3U A;  2VQH A;  2IS2 A;  2VC1 A;  3PFY A;  4C0S A;  4G1B A;  4YAF A;  3FXJ A;  3HOY J;  1FX7 A;  2V1N A;  2FOW A;  4MFE A;  1FLI A;  2VBK A;  5KAF C;  3WTU C;  4PFP A;  2V9P A;  4IVN A;  4M1K A;  2V7T A;  1HLV A;  1YE9 A;  4BXU A;  2VJJ A;  1O8I A;  3R61 A;  1Z9C A;  4NDL A;  2CO5 A;  4IOC F;  1X3W B;  1DDG A;  3UW0 A;  2WYR A;  3CP2 A;  2I8D A;  4XRS G;  4HG2 A;  3QP6 A;  3ZQH A;  1B72 A;  2CF4 A;  1ZH5 A;  3WGI A;  5HS9 A;  2EPF A;  3GF2 A;  2LTP A;  1XSX A;  4EJV A;  4EMS A;  1T6Z A;  4LG0 B;  3PQK A;  3QYE A;  1LLZ A;  1CNE A;  1JUM A;  1QNT A;  4J0Q A;  3WBK A;  4DZP A;  2IOU G;  4RD4 A;  2OK7 A;  2GA1 A;  3WQZ A;  1VND A;  2DDA A;  3GCM A;  3HG9 A;  3PUF A;  3BR1 A;  3ZN1 A;  3CCQ I;  1O8G A;  2DAO A;  1H8A C;  4M73 A;  2MSY A;  4Z4S A;  2DEU A;  3CPW B;  3EYI A;  3QPL A;  1LKX A;  3SJZ A;  5HDG A;  1I7P A;  3KLN A;  4C3J J;  5HOD A;  2VBZ A;  3DPL C;  1MMN A;  1RRJ A;  3FKJ A;  2M5W A;  4G9Y A;  2VLA A;  3Q5F A;  1ZLK A;  2C77 A;  2OQG A;  2LH9 A;  1VBL A;  3TBI A;  1EH7 A;  1K78 A;  1KQ9 A;  3ZUG A;  4PK4 A;  3BLY A;  4F7D A;  3MVP A;  1QVT A;  5F6F A;  1O4X A;  2XGJ A;  2E71 A;  4PCQ A;  4QUZ A;  3HRT A;  3CCU I;  3G71 I;  1FYM A;  3WTV C;  3V76 A;  2BV6 A;  5DS9 A;  3NRV A;  1FEX A;  1I1S A;  1FNB A;  3SZE A;  4EJW A;  3NEU A;  4EEF G;  1R5H A;  2WAQ A;  3CCS I;  5J35 A;  3I9V 2;  3CC2 B;  1CZF A;  1LDK B;  1SAN A;  1AA7 A;  2QF7 A;  1EV7 A;  3M8E A;  1C0W A;  2VOD A;  5A2Q Z;  3HOT A;  1VQL B;  5E3L A;  4IRI A;  1KYZ A;  1Z67 A;  2W00 A;  4RD2 A;  3LL7 A;  4Y52 J;  4D7M A;  1YJN I;  3K6G A;  4JYK A;  3OOP A;  2B9S A;  5GTH C;  3QFT A;  4YII A;  2XDV A;  1MDM B;  2FNP A;  2BN4 A;  3LMW A;  3CC7 I;  2GJR A;  1H0M A;  4QTR A;  3AVT A;  2O1D A;  4IHS A;  2HQA A;  2XAS A;  3WNB A;  4CYC A;  1O88 A;  2DOE A;  1ZQ3 P;  2XAJ A;  5HDK A;  3HIF A;  1XSD A;  3ONY A;  4K2E A;  2GAU A;  3H09 A;  2A61 A;  1TNT A;  3TDZ C;  5K7H A;  1LJ9 A;  4GDF A;  2RVC A;  3ABT A;  4LLN A;  2BV3 A;  5F4J A;  2J8I A;  3BG9 A;  5HNF A;  2DT7 B;  3BZC A;  2H8R A;  4GFB A;  3SYJ A;  1FT9 A;  4TSF A;  4WK8 F;  2E1M C;  5LEK A;  1VQ5 I;  1H9T A;  4AF7 A;  4AVZ A;  3AG1 H;  1BN8 A;  2NSP A;  2HTJ A;  3A01 A;  4L5E A;  2HPM A;  1OKR A;  1I6H J;  1YO5 C;  3ZPN A;  2KMU A;  3BPV A;  3HXL A;  3FKI J;  3NWT A;  4U4B A;  1IXC A;  2CS3 A;  4DYQ A;  3E1S A;  5THX A;  1ZAR A;  4W97 A;  3VR6 A;  2K5C A;  3FZV A;  5F04 A;  1A31 A;  4HLX A;  4CCL A;  5HZB A;  4HWV A;  1JUP A;  2FMY A;  1PUE E;  4ZYA A;  3U21 A;  4EAT A;  4P26 A;  4HX4 A;  2XF5 A;  3ONU A;  2OV7 A;  5FLX Z;  3G6E I;  2F4O B;  2R5Y A;  1YI2 B;  2NNY A;  2DXI A;  3CMA I;  1HCR A;  3P5J A;  4M6V A;  4A5N A;  4DW6 A;  1BA5 A;  1RQR A;  2G0Y A;  3E97 A;  1YQA A;  3EET A;  2LP0 A;  1EP3 B;  2ID3 A;  3K4B A;  1QX4 A;  2EFG A;  1MBJ A;  4BPR A;  1KCC A;  1GV5 A;  3K4C A;  2IA0 A;  1WH7 A;  1OYW A;  2EZH A;  1P4M A;  1T33 A;  2RRE A;  2YX4 A;  1RZ4 A;  3BRO A;  4P25 A;  3CF5 F;  2PEX A;  9ANT A;  3LSI A;  1ETV A;  1MIJ A;  3M07 A;  4ZZD A;  5TGT A;  1J2X A;  3ASS A;  3LWF A;  3D5L A;  4R79 A;  1MBF A;  4RPD A;  2H6C A;  1K8A D;  1JKQ C;  1HDP A;  3PFI A;  2DFF A;  3OZU A;  1EKE A;  4X8I A;  1KU2 A;  3CQZ J;  2VXD A;  1JTA A;  3AVX A;  4G6D A;  5LHG A;  2B0R A;  1OHH A;  4B4D A;  1WQ2 A;  1Z91 A;  3H5A A;  4GO1 A;  1Q1V A;  1O3T A;  4UZU A;  3L9F A;  4HAM A;  4KKU A;  1PP7 U;  5CQG A;  4ZV4 A;  1HA8 A;  3VWB A;  2R92 J;  4M6X A;  4IKF A;  1TT0 A;  2WWY A;  3LNQ A;  2EFW A;  4FXU A;  4AWX B;  2V31 A;  5GPA A;  3CDH A;  2QCO A;  3GQ8 A;  2L7K A;  3L00 A;  4IL6 C;  2QEN A;  3ISX A;  3H36 A;  1VQ8 B;  2QTL A;  3T9G A;  2J5P A;  1I50 J;  1QGP A;  2DIE A;  4OIR F;  3CPX A;  4IOA F;  1W5T A;  3OYB A;  5C4J J;  3CCE I;  2QXZ A;  1T2K A;  3TO9 A;  2WA0 A;  2Z2S B;  4I6Z A;  2DOD A;  4A3L J;  3SQV A;  3K4J A;  3HUG B;  3MAJ A;  3LFK A;  3CCR I;  2JA5 J;  1I8D A;  2FX3 A;  3B82 A;  2ELK A;  2VQL A;  3RI4 A;  3S15 J;  1MNE A;  3OZV A;  4RDL A;  5JBQ A;  1Q81 D;  3GFJ A;  3AVU A;  2QLZ A;  4Q4Z F;  4IHT A;  3MFK A;  4X1E A;  3W3C A;  3EPZ A;  2ZTN A;  3A1Y A;  2D5V A;  1QPM A;  3FDY A;  5J4Y A;  5LHH A;  3ZQQ A;  3H0G J;  4U88 A;  1V3F A;  5H6Q A;  4DNC A;  4YC5 A;  3R6S A;  1SD7 A;  2OJE D;  1ETQ A;  3CES A;  1MBG A;  3T8R A;  3PSZ A;  1JGG A;  4I99 C;  3HBL A;  1JUS A;  2OBP A;  4P3I A;  3HHH A;  3SY2 A;  4Y7C A;  2ZFU A;  4ZYH A;  1BC7 C;  1WJB A;  4ZGN B;  1QFZ A;  2Q6I A;  3KL9 A;  1I1G A;  4GYI A;  2QQA A;  3C1D A;  1Z0X A;  2KVO A;  5DN6 A;  3CME B;  1E2X A;  1ODD A;  3PNV A;  3SEQ A;  3HRM A;  2XSJ C;  4U7B A;  2R7R A;  1J9Z A;  1S7O A;  1ZTR A;  3REO A;  1FNN A;  5F0C A;  4AVP A;  4X7C A;  3WWG A;  2VJ5 A;  3KPH A;  3I54 A;  4HX8 A;  4F91 B;  4YIR X;  3GZ6 A;  3JUR A;  3ZPP A;  5AMV A;  2HYG D;  3J80 K;  2KZG A;  3W5U A;  5F27 A;  4Z1M A;  1LVK A;  3QYB A;  3DTE A;  3H5R A;  2NYX A;  4KIT B;  5BSX A;  2VNI A;  4ZJZ A;  1O7F A;  3OL3 A;  2Q2E A;  2L01 A;  3CTA A;  1G59 A;  2WAD A;  1D5Y A;  2ZXJ A;  1K8F A;  2BMW A;  1EFC A;  1Y0R A;  3N4M A;  4QHY A;  1FBU A;  2WJY A;  1TL8 A;  2LR8 A;  2FQ3 A;  3JQP A;  2X6X A;  4UUV A;  1TW2 A;  3AFH A;  4I09 A;  4MTE A;  1YJ9 I;  4KT6 A;  3A2K A;  2COB A;  2XGX A;  3CCJ B;  1U2R A;  3IL2 A;  1ZYR F;  2QY1 A;  3OOU A;  4HDV A;  4P6Y A;  3F23 A;  3BTI A;  2WAF A;  2Y30 A;  1YW9 A;  5EZG A;  2KJB A;  2PJR B;  3BTL A;  3G1L A;  1GV2 A;  1NH3 A;  1J75 A;  2KRF A;  3GZN B;  1WPK A;  2R3S A;  1XDU A;  2IAI A;  4N3G A;  3BH6 B;  1NBM A;  2EJR A;  2H09 A;  3QU3 A;  5HS7 A;  5HLT A;  1FTZ A;  1EA0 A;  1B1B A;  1GXQ A;  3V4G A;  3BC8 A;  1VQ9 B;  2OZ6 A;  1R1V A;  1WJ5 A;  4P55 A;  1QPI A;  2X0L A;  1Y8R B;  2MH9 A;  1OJL A;  4BAC A;  3LQQ A;  4A3I J;  1FNC A;  3IH3 A;  2ZCW A;  1MSE C;  5IYQ A;  1JA0 A;  3FK7 A;  4X7E A;  4JQF A;  5EDN A;  3PQJ A;  1G3Y A;  4LBW A;  2QSF X;  1MMD A;  3U1D A;  2CFX A;  5FB2 A;  2HKO A;  3I0T A;  5EGO A;  1VQ7 B;  2X1E A;  4DQ2 A;  4FT8 A;  3LA3 A;  2N8G A;  4Y4R A;  3LAP A;  1E3X A;  3RQI A;  1X1D A;  2XPW A;  4L0Z B;  3RIQ A;  5DS0 A;  4NBS A;  2JSC A;  4O6J A;  1GUU A;  2ESN A;  4A12 A;  5H59 A;  4IPA A;  3OW2 B;  1HBX G;  3DU5 A;  3DEE A;  3OYL A;  1XQB A;  1OGO X;  2KHM A;  1D1A A;  2YUS A;  2DJI A;  3RTR A;  1FPQ A;  3HGY A;  4R1H A;  3GBG A;  3JR9 A;  1E43 A;  3CD6 B;  2NS7 A;  4W1U A;  4OOI A;  1K9M D;  2P5V A;  4YEL A;  3TGN A;  5EEA A;  3VNV A;  5TV2 A;  2Z33 A;  3JQQ A;  1VQN B;  4Z4T A;  2BVL A;  1EE6 A;  1X2N A;  3DKX A;  1NB0 A;  4IHV A;  2O17 A;  2XT4 A;  1B8I A;  2H1L A;  4B3X A;  4HNU A;  4AM3 A;  4DNR B;  3EQN A;  2EQR A;  4GYG A;  1TBX A;  1X4O A;  2HS5 A;  2Z99 A;  4FAS D;  1KQ8 A;  4ZDP A;  2LKP A;  4AID A;  1HKS A;  1W87 A;  3GX4 X;  2V9K A;  1I3A A;  2CQK A;  3KIO A;  2GJP A;  2NOG A;  1GAQ A;  1N08 A;  1X2M A;  2X1D A;  1CF7 B;  1V0F A;  4P1W A;  2E1R A;  4QFM A;  1BR4 A;  2ZME B;  4WWV A;  3QYF A;  1K61 A;  2CRV A;  1EWY A;  3HSE A;  3J81 Z;  2YSR A;  1WJA A;  1BR2 A;  3SXY A;  5IP7 J;  2YU9 J;  3AL0 C;  2XNJ A;  2EZK A;  2BZT A;  4OWR B;  2V7Q A;  3GWZ A;  1QA6 A;  2JDI A;  1BX0 A;  5FRO A;  3SYT A;  4URR A;  4X7F A;  3U2R A;  3OZW A;  4CIC A;  3PNT A;  4RD6 A;  1X3Z B;  1BOA A;  1WWX A;  3F8F A;  1XSV A;  2B7E A;  4B8X A;  4L8J A;  1FC3 A;  2VBY A;  2IQ7 A;  4C9Y A;  4ZDO A;  2W82 A;  2ZSI B;  3CDI A;  3KE2 A;  1JT6 A;  2BW3 B;  1U3E M;  1ETW A;  3ZQG A;  2DYR H;  1VQP B;  4QLC U;  3FMR A;  3A02 A;  2QBY B;  3HSR A;  5D6F A;  1V4R A;  5KVR A;  2RAE A;  4ASN A;  3PO3 J;  2O6G E;  3IP4 B;  5D5V B;  2Z9O A;  5FLX K;  3WHC A;  2V5I A;  2CG4 A;  1WSV A;  3ESW B;  1F43 A;  3FXM A;  1XGS A;  1UST A;  3X2Q H;  1ACI A;  1O3S A;  2ZTG A;  3GVJ A;  4PC3 A;  3WND A;  4ZC3 A;  1WI3 A;  2EIM H;  3BY2 A;  2DOA A;  2MAB A;  5GAD J;  4JX6 A;  2LBF B;  4C30 A;  3PNY A;  2PE3 A;  3K7A J;  4MEY F;  3CCV B;  1PVE A;  5ICF A;  1K6O A;  2R0Q C;  3IH2 A;  2HOS A;  3OYG A;  2WY7 Q;  2L54 A;  3O3K A;  2XTY A;  4LD5 A;  4XN0 A;  2B7C A;  1MGT A;  4BEH A;  1XC5 A;  4UUS B;  3K1P A;  1UD5 A;  4L9T A;  2CGP A;  2XRO A;  1Y1V J;  4G5G A;  2ISZ A;  4LB5 A;  2E19 A;  3VSK A;  2JJ1 A;  2FEZ A;  2L4M A;  4BDY A;  2M2E A;  4Y9R A;  1N25 A;  3R6J A;  4IQ4 A;  1ZLJ A;  1F60 A;  2KIS A;  2BSP A;  2DA4 A;  2QTZ A;  2KIU A;  2XZL A;  3VST A;  1GVD A;  3SDG A;  3CCL I;  3SJM A;  3HTS B;  2V4D A;  3A0B C;  2ID6 A;  3ML3 A;  4YCQ A;  2FRH A;  3W2V A;  2ZB9 A;  5B1B H;  3QU6 A;  2B7B A;  5J3O A;  3F72 A;  3F0C A;  1ETO A;  3DDY A;  2RDP A;  4M9X A;  4KIF A;  1QVG B;  4HIZ A;  5CVU A;  4AU7 A;  5JFR A;  1T98 A;  1DUX C;  1UHW A;  3Q0U A;  3OYN A;  1UB9 A;  1MMA A;  2R7D A;  1OB2 A;  1Z1D A;  4XSX F;  4E70 A;  1G6N A;  3TL4 X;  2Y69 H;  3W6J B;  5IYC J;  3EYY A;  3BG3 A;  3I56 B;  3ZP5 A;  1ETY A;  1JKR C;  2ZFW A;  2R6H A;  4BXF A;  3ZOB A;  4L18 B;  2BM1 A;  4B48 A;  1B9N A;  5ILS A;  2I1L A;  1RR7 A;  2AQF A;  2LSO A;  2M87 A;  2DER A;  3GQ7 A;  4FK8 A;  4LIT A;  1F20 A;  4IHW A;  1S4M A;  2QSG X;  2W1O A;  1E1R A;  3FIS A;  1T6X A;  5F64 A;  2WPD A;  1Q86 D;  3WTT C;  2PYH A;  4HF1 A;  2DA1 A;  1BOB A;  3BR5 A;  5D6E A;  5KAI C;  3CJT B;  3TDU C;  2V7W A;  2EA2 A;  4B3G A;  2B5O A;  2RQQ A;  3BTJ A;  3DKY A;  1V54 H;  4PGG A;  3CCM I;  1HF2 A;  3TH0 A;  1EFT A;  2RC6 A;  4Z03 A;  2STW A;  2IGK A;  1OCC H;  2KDZ A;  1S9H A;  1G7R A;  1VQ6 B;  3HRU A;  3OEH A;  1OIS A;  3CZ6 A;  1VQL I;  1O8E A;  5FL7 A;  2OTL B;  3TO7 A;  4WZK A;  4YEJ A;  5GAH J;  3QFC A;  3BJO A;  1AOY A;  1MBK A;  4YEI A;  4HW0 A;  1XS9 A;  1R36 A;  4S05 A;  1MBE A;  2V7X A;  1T8I A;  1QZY A;  3LSM A;  4QPQ A;  4XM3 A;  4MXN A;  1JKO C;  4KIB A;  2LY9 A;  5J1U A;  4HZF A;  2EFP A;  1ERD A;  4WXH A;  5EMN A;  2QQB A;  3ZBT A;  1BL0 A;  4M4S A;  3F6O A;  3I59 B;  3HGG A;  4EM0 B;  1MZB A;  1X1P A;  2A6T A;  2H8W A;  4AIH A;  2DMP A;  4BHP A;  4RAG A;  4KUM A;  2DPU A;  5EZH A;  1O8F A;  3H9N A;  3PSS A;  3VSU A;  3DWL E;  2ZXH A;  1W36 D;  1QCX A;  1WXR A;  2CUE A;  4XLA A;  2DN0 A;  5DM6 F;  1HW1 A;  3T5X A;  4X05 A;  2QGG A;  1S6L A;  3L09 A;  3TED A;  1KMH A;  4CDG A;  2XAH A;  4ACA A;  2K7L A;  2HOA A;  5HKK A;  2IS4 A;  2XTW A;  3ZZ0 A;  3VO1 A;  3NWS A;  2IA2 A;  2XVC A;  1SFE A;  4ANJ A;  3L2C A;  4XON A;  1TWF J;  2CYY A;  2L4A A;  3VB2 A;  4D9J A;  1F1Z A;  1XX5 A;  2DMT A;  4DBQ A;  4EV0 A;  2WY8 Q;  2D3N A;  4XD7 A;  3Q3A A;  1K4Z A;  4J19 A;  2P4W A;  4N3N A;  2X0K A;  1U0J A;  3F8N A;  4II2 A;  3Q9S A;  2Q6L A;  4ZYE A;  2ZBU A;  2IPQ X;  3GEZ A;  3COA C;  1T95 A;  2C4T A;  4ZCI A;  3BP8 A;  4KIS A;  2FBI A;  3FM5 A;  1YI2 I;  5M5X J;  5K5Q A;  1SFU A;  2B0L A;  1PE9 A;  4F92 B;  3CO6 C;  2BY2 A;  4KNY A;  2AHQ A;  2W84 A;  1Y6I A;  3V7S A;  4Y9U A;  1P6R A;  4YZX A;  1O8H A;  4OIQ F;  1UHS A;  3P9K A;  4CH7 A;  2B63 J;  4FET A;  1S72 B;  2CW8 A;  1MRZ A;  2V1U A;  5E17 F;  1K7A A;  4B3F X;  2RC4 A;  1KZH A;  3ASP A;  5ILV A;  2F5D A;  4AYB A;  4ZH4 F;  3J7A Y;  4A3F J;  4GCV A;  3B8Y A;  3CP8 A;  5B66 C;  4M72 A;  1ZAO A;  1O8D A;  1BJA A;  2AHO A;  1SD6 A;  1Z7U A;  2VJI A;  3VYS B;  2GPJ A;  2VBV A;  5FLV A;  1IA5 A;  5BQT A;  3H9Q A;  1RMG A;  5D5W B;  3RCO A;  4YHB A;  4RB1 A;  2BHZ A;  3S2D J;  2VNH A;  4OPO A;  2HPI A;  4TMX A;  3QSY A;  1GLN A;  5IY5 H;  5B5E C;  3T56 B;  4WWC A;  2M8G X;  3DBL B;  2M3A A;  2CV2 A;  1UEL B;  1I3Q J;  2VJ4 A;  3ZMV A;  3JRF A;  1W0K A;  1QZZ A;  3TMO A;  4AIJ A;  3OKX A;  2MC3 A;  3DLA A;  4N9I A;  4Z6Y A;  4A69 C;  3LNN A;  1LNW A;  4WX9 A;  2HZD A;  4A3B J;  1XG2 A;  3UNG C;  2CQQ A;  1U5T A;  2Y2Z A;  1P4A A;  1QQI A;  3IWF A;  3RKQ A;  1TT5 B;  5DUI A;  1XCB A;  1T6S A;  1WI9 A;  4F52 A;  4P9F A;  1BPL A;  1OFC X;  3WBJ A;  2Z3Y A;  3ML6 A;  4BL0 B;  4XSZ F;  1S5L C;  2V79 A;  4EW9 A;  4TV7 A;  5D4S A;  1DPR A;  2QZA A;  2OD5 A;  3MQ0 A;  3HAG A;  3S3M A;  2GLO A;  3CMY A;  1LE8 B;  1IRG A;  5AN9 A;  2R7T A;  5E1W A;  5D8L B;  5E8G A;  4BE0 A;  1H42 A;  1TLL A;  4B4C A;  1T0F A;  2VBU A;  1KTV A;  4ZGQ B;  1BJK A;  4TN1 A;  1RIO H;  1WCM J;  2K9Q A;  5BOX A;  2PQ8 A;  1MW7 A;  4KH3 A;  4EQQ A;  3R60 A;  1IXR C;  1D2E A;  1R58 A;  2J5O A;  2XGD A;  3J7Y J;  1UD2 A;  4RB3 C;  4P96 A;  3I4N J;  1UD6 A;  2HNH A;  2GIZ A;  2QEX I;  2IW5 A;  3W5H A;  3KEW A;  3SEJ A;  5HVQ C;  5HDN A;  1BMF A;  4KKS A;  2MFZ A;  3ECO A;  2DA2 A;  3GVA A;  1IJE A;  2PLF A;  4X7D A;  3J81 K;  2RV8 A;  2AXL A;  3DEW A;  4AUX A;  3ES9 A;  1ENH A;  3P9C A;  2PLY A;  2MLG A;  5FLM J;  3GTM J;  4P22 A;  1JHH A;  1QA3 A;  2BM0 A;  2Y75 A;  5E18 F;  4FE4 A;  5CVV A;  2R7O A;  4XLN F;  1QGZ A;  3I4M J;  1QQ1 A;  2KRC A;  1Z05 A;  3J81 k;  4PC2 A;  2NVY J;  3ONQ A;  2DTZ A;  5DCM A;  4IF4 A;  3FK6 A;  3NB2 A;  1HW2 A;  5DSZ A;  2YWH A;  2X9D A;  2STT A;  2DMQ A;  1W36 C;  2MA3 A;  1S3J A;  1XN7 A;  1COW A;  2OBT A;  2C2W A;  4B44 A;  2QA4 B;  3GO5 A;  2BY1 A;  2LYC A;  3MN2 A;  2NNN A;  3F8B A;  3BPX A;  4UB8 C;  1R9T J;  3DLL F;  4CQJ A;  4J01 A;  2A3S A;  3FXU A;  2KT0 A;  3K4N A;  4PAB A;  1TUI A;  5CLS A;  1M1E B;  2R7S A;  2EFN A;  3E6D A;  1A6I A;  3OYJ A;  1XTA A;  4IQJ A;  3PIP F;  3VFZ A;  3VMV A;  1X1C A;  3IHU A;  5ED4 A;  3NAR A;  4E7J A;  1TTY A;  3JRA A;  4NC8 A;  1KJZ A;  2X8K A;  4JMQ A;  5E6T A;  4Y15 A;  1FP2 A;  5JR3 A;  3WTS C;  2QZ8 A;  4C2L A;  2KRH A;  4WQM A;  5TY0 A;  2Z6B D;  2E36 A;  5H20 A;  4NUB A;  5K7Z A;  1RWR A;  1FYL A;  3OYI A;  1QO0 D;  1CQT A;  1FSE A;  3FXR A;  3K70 C;  1BX1 A;  5DDG A;  5EF6 A;  3S32 A;  1X19 A;  2ZJP F;  3SUC A;  2PFB A;  1LM1 A;  1VQ4 B;  2GOX B;  2QE7 A;  3OIO A;  3RPQ A;  1K4T A;  1HZE A;  4OJP A;  5FJ8 J;  1XMX A;  4LGW A;  2X4H A;  2EWN A;  1VQ9 I;  2W6I A;  2HYF A;  2YS9 A;  2XPV A;  4S0H B;  4E7I A;  3KYD B;  3RZO J;  1QA1 A;  2M5S A;  4N0B A;  2WZP P;  3OSF A;  1IV6 A;  1FRQ A;  2X3H A;  3WNC A;  3E6C C;  4RA2 A;  2L9V A;  3KRG A;  2IA1 A;  5J40 A;  5BPD A;  3LQR A;  1IUY A;  2XHK A;  5IP6 A;  4DK0 A;  1JTY A;  4HF0 A;  2BX6 A;  2UUZ A;  3GLX A;  1ZGW A;  4D1Q A;  1U8B A;  3M1C A;  3EUK L;  1WGX A;  5DEQ A;  4I01 A;  1POG A;  2K40 A;  3BG5 A;  2VE9 A;  1G3W A;  2E1M B;  3DPT A;  4CO8 A;  5K5R A;  2DPD A;  4H4K C;  1O8L A;  4KN4 X;  3CRZ A;  2VE8 A;  3OS0 A;  1EP1 B;  3W2E A;  2OBR A;  2EV0 A;  1V55 H;  1OQY A;  1JJ8 C;  2LZJ A;  1AKH B;  2KIF A;  4KT5 C;  1WTH D;  4XMY A;  4A93 J;  1YHQ B;  1QGY A;  3SLD A;  1W0U A;  1J9I A;  3K4M A;  2GOM A;  2W4S A;  3DKW A;  4YZQ A;  2WTE A;  4I0B A;  3S1M J;  1NK3 P;  2ZBK A;  3FHN A;  2GK7 A;  3K2Z A;  1NG6 A;  4U0Y A;  1IW7 F;  4DYC A;  1PJ6 A;  1R7J A;  1MMS A;  2LRE A;  4Y13 A;  1WHU A;  2PMH A;  4KN7 X;  1O3R A;  2DYI A;  3DEU A;  3IRQ A;  4UUT A;  3DF8 A;  1VQN I;  1TZL A;  4IJA A;  2I5U A;  2L9N A;  4DK1 A;  1R5G A;  2A6H F;  3E5X A;  1IXS B;  2L0K A;  1LB2 A;  5L46 A;  2OCC H;  2MW8 A;  3K4K A;  5JHF A;  1DDN A;  2JPB A;  1BHE A;  2D1H A;  3A4C A;  3Q0W A;  4M3G A;  2VFP A;  3QWL A;  4Y17 A;  4BH9 A;  4OIP F;  2VKV A;  1EXM A;  4UHT A;  4FX0 A;  3I5U A;  1OOC A;  5JLV C;  2FD5 A;  1RKT A;  5K1Y A;  1A36 A;  3D5S C;  5EJC A;  3ERE D;  2PMU A;  3BCB A;  1XB4 A;  2CW5 A;  3SFI A;  3GFL A;  2QDX A;  2F4M B;  4RCZ A;  2K85 A;  2OUM A;  4XKW A;  2A5Y B;  2O8K A;  2M4K A;  2ZSH B;  4XIC A;  2D1V A;  1RKW A;  4CCK A;  2PJR A;  4QVA A;  1RR8 C;  2NPF A;  1S8N A;  3KLO A;  1WOS A;  5JVG F;  2J8K A;  1GQ8 A;  4RD0 A;  1JT0 A;  1O8K A;  4G6Q A;  3BJA A;  4KKT A;  2CMP A;  1Y39 A;  2QQ8 A;  1JI8 A;  2JPC A;  4G6T B;  4B47 A;  5LGU A;  3LSR A;  3M8F A;  3QP5 A;  3V7A A;  1JHF A;  3KP4 A;  2JTV A;  1VQP I;  2X6W A;  2G0E A;  2ZL6 A;  1DBG A;  1LQ1 A;  2OCE A;  2BHY A;  2NS0 A;  2IGO A;  1B23 P;  3K0L A;  2Q8K A;  4OJL A;  3VOE A;  3N05 A;  3BNW A;  3JQR A;  1W7P A;  4RLF A;  3HOV J;  2VQC A;  4TT3 A;  3JAM Z;  3SJP A;  2VC0 A;  1YS6 A;  2WZN A;  3TW7 A;  4NBQ A;  1PJR A;  3ZC3 A;  3JRI A;  3CCV I;  2BPO A;  3B6A A;  1G7T A;  2XZO A;  2CV1 A;  2FOK A;  3O8G A;  5E79 C;  4HQM A;  1VLO A;  4P3Y A;  2CRG A;  1P2F A;  1U5T C;  4S04 A;  3J7A O;  1X0C A;  1L0O C;  1KK2 A;  4Q48 A;  3KEQ A;  1OR7 A;  3V8L A;  1IAW A;  2VIX A;  2R93 J;  1RES A;  2ZL7 A;  4C2M J;  1WJE A;  2GBY A;  2RC5 A;  1RUO A;  2DI3 A;  1UMQ A;  1L3L A;  4ENK A;  2X6Y A;  2R7V A;  2DYS H;  2HVS A;  3VMF A;  5D5U B;  3R0J A;  5AON A;  1NHC A;  1VLY A;  2RKH A;  2E1N A;  2X85 A;  2M0M A;  3RKY A;  2M7B A;  2PJP A;  3KFW X;  5B1A H;  2DFE A;  1BI3 A;  1OFE A;  4ZTJ A;  4A0Y A;  5IOY A;  1BW6 A;  4V2G A;  1T0F C;  2NT6 A;  2KQR A;  1UD8 A;  4P12 A;  1AU7 A;  4MQ9 F;  4CCN A;  4KFC A;  1OB5 A;  2JJ2 A;  2LF7 A;  1YRN A;  4G7W A;  4HDU A;  2V6E A;  3GIR A;  1QHH D;  2RGV A;  5JLW A;  1NTC A;  2D9R A;  4IXA A;  1OCO H;  4CCO A;  3I56 I;  3BR2 A;  2L2O A;  5LRR A;  2ME6 A;  1Y8Q B;  3E7L A;  1H88 C;  2VON A;  1ZHF A;  2VB6 A;  3QPT A;  2M4G A;  2VYQ A;  4Z4Y A;  1KU9 A;  1B72 B;  1KRH A;  1HSJ A;  4M6Y A;  1JNY A;  5KW9 A;  2ZME A;  3ASN H;  3B73 A;  4M9S A;  4ABZ A;  1LUJ B;  3L2R A;  2ODL A;  4V02 C;  3LO8 A;  2BGC A;  2CC2 A;  1DBO A;  4NK6 A;  3A8J A;  2VKD A;  4UY8 I;  2A6E F;  1DGR M;  1WKM A;  1NB9 A;  2PIA A;  2VZL A;  1BR1 A;  4BUP A;  4K1X A;  1P92 A;  3S1Q J;  1H9G A;  3SDB A;  5IT3 A;  3OSG A;  1J0R A;  4NHJ A;  3I71 A;  2LD5 A;  2DET A;  2HWV A;  3D5R C;  3O2P E;  3RIR A;  4KMU X;  1KTW A;  1B2R A;  3LMM A;  2CW7 A;  1VQ6 I;  2ZNY A;  2EIL H;  3L7W A;  4HF2 A;  1ON1 A;  1T08 B;  3PVD A;  3OEE A;  4V2F A;  2OTL I;  2DQL A;  3G2B A;  1HC8 A;  2DFI A;  4EM1 A;  5BS6 A;  3OAA A;  2QBY A;  4CCJ A;  2NVQ J;  4UV9 A;  4WXD A;  3PSF A;  1W7P D;  3V7R A;  1BW5 A;  1QFJ A;  1QRC A;  4L5J A;  5L3F A;  5GAG J;  2CW0 F;  4YIF A;  3C2H A;  4XN3 A;  1WOP A;  2JN9 A;  1HXD A;  4PSW A;  3JRB A;  1IN4 A;  1EH6 A;  2LKX A;  4E6K G;  3O8H A;  4PMH A;  1H89 C;  1JKP C;  1R49 A;  1SVO A;  3RKW A;  1AIP A;  2UWM A;  5JMC B;  1FNM A;  4OPV A;  3W2A A;  3CB4 A;  2CSO A;  2KIM A;  4JX4 A;  3MMY B;  3PUB A;  3Q0V A;  3HEF A;  4W8S A;  4OM9 A;  5DYM A;  4CYC B;  1XDS A;  3OIQ A;  1TWA J;  4A3M J;  1Y0N A;  4E7H A;  3OP1 A;  3S3O A;  4IRG A;  3KYC B;  1V0E A;  3OJX A;  3M4O J;  4RDJ A;  4U7D A;  2E5N A;  1A35 A;  1E62 A;  4Z4Z A;  3FBI B;  1AWC A;  2Z16 A;  3TP3 A;  2EH3 A;  3V8K A;  1YIJ I;  1RNL A;  2FVG A;  4RB2 C;  3OMY A;  4YFN F;  3OWT A;  4NB5 A;  3SHF A;  1F9N A;  4FTH A;  3C2B A;  4XL9 A;  1OLT A;  1U2W A;  1R5I D;  2E5Z A;  3KP2 A;  1N8R D;  3ABU A;  1IRF A;  2PMZ N;  1IDZ A;  1G8X A;  2F5C A;  3CUQ B;  2GXB A;  1Y56 A;  2LKS A;  1X4P A;  2HU9 A;  2W7N A;  1UD3 A;  2XF6 A;  5TJJ A;  3A01 B;  4YAL A;  1BJZ A;  2K9L A;  1IF1 A;  3BOQ A;  2JRM A;  2Y31 A;  3FMS A;  3ISP A;  3LSJ A;  3PM1 A;  1S72 I;  3BH4 A;  5FKO A;  4YRV A;  3DPU A;  2W6J A;  1G2H A;  3LJY A;  2GQQ A;  1DP3 A;  2X53 S;  5LLQ A;  2OYN A;  1VQO B;  4Y33 A;  4P2N A;  4AYB N;  2VUM J;  4L9V A;  5FFZ A;  5JLX A;  3IC7 A;  2DT6 A;  2R5Y B;  1H85 A;  2VNJ A;  4YAO A;  1VHO A;  3AL0 B;  3DXJ F;  2KZV A;  4I0A A;  4WCG A;  4G7H F;  1HG8 A;  4PDK A;  5GPC A;  2ICW G;  4RS8 A;  1K28 D;  2LRD A;  1AMO A;  3E5U A;  2O3F A;  4XRF A;  4ZCM A;  1K73 D;  1SD4 A;  2NTP A;  2LK2 A;  2NS8 A;  4Z4W A;  3U2Q A;  4MIM A;  2YX7 A;  3QQA A;  2DJN A;  1Z6T A;  2LG4 A;  2ETH A;  4RPB A;  2NAZ A;  1SFX A;  3HKZ N;  4ETS A;  1HW5 A;  4DOZ A;  3BQJ A;  4B43 A;  2QQ9 A;  1PKV A;  4PGO A;  2CQN A;  1KK0 A;  3B78 A;  3N6Z A;  3S8P A;  3CCS B;  1IN7 A;  3BQY A;  3I59 A;  4IRH A;  1QUE A;  3ZIA A;  1Q9S A;  1EZG A;  5LMZ A;  2ECB A;  4KA4 A;  3GYH X;  5EG0 B;  2W57 A;  2QGU A;  2M7A A;  4M74 A;  3U9G A;  1OCT C;  2UVE A;  1YJN B;  4Z06 A;  3B6C A;  2ELJ A;  4MTD A;  4G1V A;  5J6X A;  3CC7 B;  3BCD A;  3G1M A;  5F4O A;  3QPH A;  1YOV B;  4RGX A;  4XOR A;  3WU1 B;  1MSF C;  3VNU A;  2CWE A;  2IGN A;  1IDY A;  4HE5 A;  3HRS A;  1QVF B;  2GRE A;  1WRJ A;  1HKQ A;  4J00 A;  2JA2 A;  1LLW A;  1ZGJ A;  3OR2 C;  1Q1H A;  2E2J J;  2JA6 J;  3PUM A;  4M53 A;  5CKT A;  3SQN A;  2V9V A;  3HPH A;  1BLI A;  1KZL A;  2GXG A;  1FND A;  4MYT A;  4RDK A;  2EFQ A;  1Z77 A;  4CSW A;  3S1N J;  2BF4 A;  3KCC A;  1GDT A;  3MCZ A;  1OFM A;  1I27 A;  4HRI A;  3OYE A;  1N06 A;  1P4X A;  2KFD A;  3C2G A;  1JRG A;  3HOS A;  1HOM A;  4G7X A;  2EZI A;  1VF7 A;  1OR7 C;  3F22 A;  2HVQ A;  3SZG A;  1IJW C;  4C2T A;  2GQF A;  4A0X A;  2KL4 A;  3L1P A;  3GME A;  1VHE A;  5TR9 A;  4HQE A;  2ZXW H;  3CJQ B;  5IYB J;  3S14 J;  1BIB A;  2ZJ2 A;  4RGR A;  1CGP A;  1YS7 A;  2KDO A;  2XC7 A;  3PA2 A;  4ESJ A;  2C4U A;  3W2F A;  2DCE A;  5HNH A;  4PGH A;  5JI6 A;  3HJE A;  4A3J J;  4P1V A;  5GAE J;  2FUG 2;  2MLK A;  4P9U A;  4ZZL A;  1DAB A;  2HYJ A;  3CMA B;  1J09 A;  1WFX A;  2XAU A;  2EIJ H;  4GXO A;  4PSX A;  1FJL A;  2JVH A;  3P4G A;  4AC0 A;  3JAM K;  5B3S H;  4LG3 A;  1MBH A;  1D5V A;  5KHD A;  5D4R A;  4FE7 A;  2L3D A;  2Y0S A;  1UAA A;  2P0W A;  4L9N A;  1XFO A;  2QKM B;  4TMW A;  3ABK H;  1PYV A;  2XPU A;  5E20 A;  2LC2 A;  5CQE A;  4A3G J;  4MYU A;  1JGS A;  2DA7 A;  1Y0Y A;  3AST A;  3FPK A;  3MKL A;  4LLG F;  3LSH A;  5ICE A;  1Y1W J;  2HDN B;  4MO7 A;  1VQK B;  3PIO F;  2V7F A;  2TCT A;  5C3E J;  2M8E A;  3KZY A;  1MJA A;  3OR1 C;  3ZMD A;  2NVT J;  3OJW A;  1PP8 F;  3QOP A;  4OMZ A;  3M7G A;  4NC7 A;  4WZL A;  2P3M A;  2V7V A;  1EFR A;  2ZME C;  3V42 A;  2ELH A;  2R5Z A;  4PJ0 C;  1GJR A;  2PN6 A;  3HOU J;  3I64 A;  2XOK A;  5KSW B;  3ABL H;  1ONV A;  4F93 B;  1LE8 A;  2BYV E;  1F5T A;  1EP2 B;  1WSR A;  5GV8 A;  1TTT A;  2F4I A;  3FKS A;  2RQP A;  3ASQ A;  1G4D A;  1TYW A;  4DIQ A;  3KEO A;  1O8J A;  1IDK A;  3GFM A;  1HDD C;  2H6B A;  1FMW A;  1IRX A;  1YIT B;  1ZG1 A;  2MBF A;  2WB1 N;  3WE3 A;  4X06 A;  1E79 A;  1ZGA A;  3CXC B;  1KK3 A;  2YUH A;  1JB9 A;  5FD5 A;  2C5B A;  3WG7 H;  2JIZ A;  2L7M P;  2DOG A;  1NHA A;  2F1M A;  3L2Q A;  2HTS A;  1Z6R A;  1GXP A;  3BWG A;  2HMA A;  3GW2 A;  4X07 A;  4LIU A;  2QUF A;  3WTW C;  2P6S A;  3I55 B;  2WSS A;  3ZMS A;  4X6A J;  2F43 A;  3S16 J;  3CCR B;  2BSA A;  2WR8 A;  3CC2 I;  4BAY A;  4RM0 A;  4MLO A;  4IW3 B;  2DTR A;  3K1M A;  4E7K A;  2FX0 A;  3ERM A;  3IRR A;  3VYT B;  1DU0 A;  4HST A;  3WYA A;  1IN6 A;  2K4B A;  4YFX F;  2BM6 A;  3ZGK A;  1R71 A;  1E1Q A;  3ULQ B;  3J7Z I;  4R8H A;  1PDN C;  2CQ7 A;  4UVA A;  3FWE A;  4C3H J;  1W0J A;  3HSF A;  3K9T A;  2QN6 A;  3ZXS A;  3DV8 A;  4HE6 A;  1LFP A;  2F5F A;  3MCA A;  1Z3Y A;  2WV1 A;  3H3Z A;  4E7Z A;  5FIU A;  1MND A;  3G05 A;  1G3T A;  1KQ5 A;  3AAF A;  3OYA A;  3OIP A;  4CA0 A;  4HNT A;  2X6O A;  4NCN A;  3I4P A;  3DCF A;  1XMA A;  2MH2 A;  2PX9 A;  4L9J A;  4RB0 A;  2LMD A;  1MJB A;  2VAS A;  4RM3 A;  4CUG A;  5BSY A;  3G4S B;  5F08 A;  4ITV A;  3BR6 A;  4N9H A;  2DMU A;  4HEA 2;  4JX5 A;  2FA5 A;  1R4M B;  3ZMU A;  1BIA A;  1D1B A;  3OE7 A;  5DNS A;  1W35 A;  2LFB A;  4AD9 A;  5CJ9 A;  2O6W A;  1D8J A;  3K69 A;  1OCZ H;  4A6D A;  2CBX A;  2R7F A;  4UVB A;  2M0C A;  1PXZ A;  3VYU B;  1UD4 A;  4WXC A;  3ASO H;  2PMZ A;  1IB4 A;  3W6V A;  3AVW A;  1QJV A;  4LG0 A;  2XUB A;  3CW2 A;  4XR6 A;  4OJ6 A;  1YX5 A;  3Q3S A;  3ZCO A;  2IS6 A;  1E3H A;  3IAM 2;  3K70 D;  4TMZ A;  5HZA A;  1OGI A;  4BYY A;  2JWT A;  2ZJQ F;  1YJ9 B;  2EZL A;  2BGI A;  3HZJ A;  3A1P A;  3R0A A;  2VFN A;  3GTK J;  5IPA A;  1N05 A;  2DCU A;  3ZQI A;  3IUO A;  2XZP A;  4DZJ A;  3ABM H;  2D74 A;  2MYS A;  1JJ6 C;  2BOL A;  2E2I J;  4RJL A;  2W7Z A;  1KYW A;  4CZC A;  3RYR A;  2E1C A;  5ERI A;  2FBH A;  1SEU A;  1J5Y A;  4HBL A;  4A3K J;  1WJF A;  4BE2 A;  1WZ2 A;  2EA4 A;  2UVF A;  3ECH A;  5DV5 A;  3OYC A;  4TMV A;  3E5Q A;  2VFM A;  4II3 A;  4LBV A;  5J8F A;  3JRC A;  1HA3 A;  2IJL A;  3HM5 A;  4UV8 A;  1ZM3 A;  5C1C A;  1D8T A;  2XGC A;  2DK5 A;  3V8J A;  3WU2 C;  4EJU A;  1E3Z A;  1ZM9 A;  3HB9 A;  3BG6 A;  4LMY A;  2IT0 A;  1ZG3 A;  3JTH A;  1SFK A;  4UB6 C;  5KK1 A;  3LAJ A;  3HDD A;  1XD7 A;  5FRM A;  4G7O F;  4PC7 A;  3BJ6 A;  2CND A;  1G3S A;  3HKZ A;  1N75 A;  2JSP A;  1ZRE A;  4M71 A;  1VQM B;  1MDM A;  1SKQ A;  2Q6O A;  1KQS B;  2R7Q A;  4IEJ A;  2NTQ A;  3IH4 A;  1SAU A;  4NNJ A;  1PUF B;  3PO2 J;  2RNJ A;  1SKY B;  2O04 A;  1SM4 A;  1GVJ A;  5IYW A;  1KU7 A;  5GP9 A;  3F9K A;  3TW6 A;  3KYL A;  1XGN A;  4PZJ A;  3S3N A;  4OMY A;  1VQ8 I;  4EGY A;  1GVH A;  2R9V A;  3BT9 A;  3FXQ A;  4HA8 A;  3WY9 A;  4FIS A;  1ZRD A;  5E8I A;  1DAR A;  3SZP A;  3ZSC A;  2ESH A;  2TRT A;  5F1J A;  2FF4 A;  2M30 A;  5HS8 A;  5HOO A;  2HR3 A;  5IP9 J;  1ZR4 A;  2LOO A;  3FBN B;  2CFO A;  1SVL A;  2XRN A;  3MKY B;  2DDB A;  4U87 A;  1IC8 A;  5B6I A;  4IZZ A;  4D5C A;  1VF9 A;  4CXF A;  2V26 A;  1R6R A;  3ZRG A;  1WOO A;  4JOM A;  2MG4 A;  1G7C A;  4RLZ A;  4H0E A;  2NVX J;  1BQE A;  3BZK A;  2K9S A;  2JA7 J;  5A88 A;  1FOY A;  4G6I A;  2JZY A;  1P7J A;  1TYU A;  3QFR A;  3MZ8 A;  2FML A;  2C78 A;  2CK3 A;  3HL2 A;  1NK2 P;  2JMW A;  4BQO A;  3CJR B;  3CME I;  2L7Z A;  2HXI A;  5L3G A;  3GQB A;  4GQN A;  3IKT A;  4N4N B;  2HQR A;  3KP3 A;  5C1E A;  1F4K A;  4QWQ A;  2VOP A;  2R7Z J;  2INU A;  4Y3O A;  4U0W A;  2CH0 A;  1N77 A;  1UG0 A;  4LIV A;  3ZBU A;  3GTQ J;  4ESB A;  4Q47 A;  4BDZ A;  1S29 A;  2XKP A;  1REP C;  1N0U A;  1YX2 A;  3KZZ A;  2AO9 A;  3H35 A;  5LRS A;  2HVR A;  4MQV A;  1Q82 D;  1V5F A;  3PA1 A;  1YJW B;  2OC6 A;  1YIO A;  1O7L A;  2V4J C;  1XGO A;  4KIC A;  3ZN0 A;  2CUZ A;  1W1W E;  1YW8 A;  4Z05 A;  2MGQ A;  2K3P A;  3NAU A;  3F6V A;  3FXK A;  2K86 A;  2EB7 A;  3Q9V A;  1JA1 A;  1NJI D;  2FE3 A;  3CLO A;  4UVC A;  3SZT A;  3OYK A;  4YG2 F;  1MAB A;  2FNA A;  3CCJ I;  1VFC A;  4BJT A;  2F5V A;  2HDD A;  1HST A;  3KEY A;  1EF4 A;  1R23 A;  2D2W A;  1BBY A;  2FBK A;  2Z1D A;  1T5E A;  3GTP J;  4OOS A;  5IK2 A;  4KIG A;  2DA3 A;  5DUK A;  3GFI A;  3FXO A;  3GSI A;  2VBM A;  1O57 A;  3CCY A;  4LK1 F;  4NK8 A;  1WU8 A;  3JRH A;  1U9N A;  2OZU A;  3TP0 A;  2QM3 A;  4BKX A;  4M3E A;  3EDP A;  4KYW A;  3CO7 C;  1KU3 A;  2WAE A;  2DT5 A;  1VI0 A;  4A3E J;  2E1B A;  4LBZ A;  3LQE A;  4I2O A;  4MFD A;  1B6A A;  2BXY A;  3AG4 H;  3HUG A;  4RM2 A;  3F8C A;  3HC7 A;  3CCL B;  2WB1 A;  1YX3 A;  3BQZ A;  2EWE A;  1TC3 C;  4JBA A;  3GQA A;  4Z2Y A;  1UZC A;  3BCF A;  2KIQ A;  4I98 B;  2HOE A;  4LK0 F;  2HOT A;  1QRY A;  2BVN A;  2HQ5 A;  3CDL A;  2HGC A;  1VQ7 I;  3GTJ J;  2WC2 A;  2O8X A;  4NQW B;  3GVL A;  1X1B A;  1SVM A;  1VQO I;  2VBT A;  1WJC A;  4TKO B;  2F4N A;  4U0V A;  3F3X A;  3CF2 A;  2UV1 A;  2ZZF A;  3DU1 X;  5JVT A;  4B1R A;  1AIR A;  4YFO A;  1A5J A;  3JTG A;  2DLL A;  4QSH A;  3S1R J;  1OYI A;  3AVV A;  3WTZ A;  4XLF A;  3WHB A;  1K5C A;  2F48 A;  4DNT B;  4RBO A;  1KQ0 A;  3OOC A;  2HFH A;  5J47 A;  1LFU P;  3RKX A;  1UFM A;  3GUD A;  4IX7 A;  1F36 A;  1ZUN B;  3CD6 I;  4BS9 A;  2XB5 A;  4KMF A;  2PYG A;  5CYV A;  1KA8 A;  4WF2 A;  1LEA A;  1W9X A;  3U6K A;  2GWR A;  2L5Q A;  3OFN A;  3DQV C;  3M9A A;  4MR0 A;  4ZDL A;  1DDI A;  3CCM B;  3BZ6 A;  3PET A;  3Q6Q A;  2L02 A;  3PJR A;  2XNC A;  1UCR A;  1R00 A;  4IHY A;  4LJZ F;  1QHG A;  4BQQ A;  1ETX A;  3G3Z A;  3T51 B;  3G1O A;  2HI3 A;  1GO2 A;  1D3Y A;  4QVJ A;  4DQK A;  1FBS A;  2RN7 A;  5IT9 Z;  2P7V B;  3I53 A;  1T56 A;  5FNZ A;  1S0U A;  1DGW Y;  1I6X A;  1TWC J;  1U5T B;  3MKW B;  3GTO J;  2IVM A;  4BE1 A;  1FMV A;  1I39 A;  4UZF A;  2L9R A;  3L2W A;  3DTI A;  5IOZ A;  2M9H A;  2R7W A;  3WGH A;  1R1T A;  1IRZ A;  4KJZ A;  3ZPL A;  2ISY A;  2XAG A;  2HDC A;  1X58 A;  1E17 A;  2P5L C;  4EJO A;  2E60 A;  3VMW A;  5E3N A;  1MH3 A;  5C4X J;  1QG0 A;  2ZZG A;  1OMI A;  2JUG A;  1FZP B;  1OB0 A;  3VSL A;  1P9Q C;  3MKZ A;  3TQN A;  1FYK A;  3K1N A;  2OTJ B;  1ZM2 A;  4ROX A;  2JJ7 A;  1K79 A;  3CUQ A;  4CGZ A;  4F55 A;  4M9Z A;  1FOW A;  2XSD C;  3UKG A;  2BXZ A;  3HPG A;  4NC6 A;  4P9S A;  3LST A;  2F5E A;  2DW4 A;  4JRA C;  1A6Q A;  4HNV A;  3MZH A;  2UXN A;  2VN2 A;  4UNO A;  1MD0 A;  4G8X A;  4XK4 A;  2XKO A;  1D0Z A;  4MNU A;  1T6Y A;  1RU4 A;  1STZ A;  3FMQ A;  4ENM A;  3OYF A;  1H80 A;  5M3F J;  4PFO A;  3RZD J;  4RAY A;  3PL8 A;  1WVR A;  1S7A A;  3ROU A;  4X0G A;  1VJS A;  1BI2 A;  5DCF A;  4OJ5 A;  3Q39 A;  1IV8 A;  3E3V A;  3AK5 A;  1FOX A;  1GHC A;  4CHU A;  1ZRC A;  1FBQ A;  2XIG A;  4BQA A;  1LEB A;  1FTT A;  5DCM B;  3BC9 A;  1LVA A;  5F0F A;  3L2V A;  4H9G A;  2XEX A;  5CPR B;  2A07 F;  3O6B B;  2Y0S N;  3OY9 A;  4A3D J;  2YR2 A;  5LFA A;  4OPS A;  4XOP A;  2GIV A;  2O5R A;  3M1E A;  4OAY A;  4BY7 J;  1BI0 A;  1HKT A;  1HF0 A;  2HDW A;  2M1B A;  4JP0 A;  3VO2 A;  3FJO A;  1WSU A;  1VQK I;  4BBS J;  1W34 A;  2VFQ A;  3FM3 A;  1D0X A;  3EUH A;  3H3V K;  1M90 D;  5FGM A;  3RDI A;  2XRL A;  4QPO A;  2Y0M A;  2IS1 A;  1D8K A;  4CZZ A;  1IB0 A;  5CVI A;  3OYM A;  3A3B A;  2AXT C;  3ZZU A;  3OYH A;  3I3L A;  1FRN A;  2LF8 A;  2EIN H;  5EEH A;  5K5O A;  2Y9Z A;  2JN6 A;  3FHZ A;  5EG0 A;  3LVB A;  2V6C A;  1ZN2 A;  2KP6 A;  3BY6 A;  1T38 A;  1SD5 A;  2BE5 F;  5BMZ A;  2DOF A;  2JA8 J;  1Q7Y D;  1CF7 A;  1QBJ A;  1FY7 A;  1YIT I;  1D1C A;  3OS2 A;  3DBH B;  3MWM A;  2O0Y A;  3CC4 B;  2XAF A;  4DBR A;  4E4H A;  1CNF A;  1R4N B;  2JQ7 A;  2R4G A;  3C18 A;  3VYR B;  4YAW A;  3QE2 A;  1CLW A;  1OCP A;  2C5H A;  2E7W A;  1IZ1 A;  3DTK A;  3MZY A;  4I02 A;  5F0H A;  5TRD A;  3WE2 A;  1LPQ A;  4MEX F;  4WZE A;  4Q7J B;  3I55 I;  1KD1 D;  3BCA A;  2KKO A;  5GTI C;  2XND A;  5HLH A;  2GZW A;  3QAH A;  2H27 A;  3W5V A;  1IN8 A;  5JHU A;  4EGZ A;  4XKC A;  1HVX A;  4EH1 A;  2AQE A;  2BW3 A;  5EEG A;  1JXS A;  5TIS C;  1S7E A;  2VBS A;  5IYN A;  2UXX A;  1K78 B;  1Y0U A;  2FJ1 A;  3SEZ A;  4HYE A;  3N97 A;  4HSR A;  2QEX B;  2EV5 A;  2VFO A;  3E6B A;  2DK8 A;  2PI0 A;  1WP6 A;  2YWE A;  1CQX A;  2V1D A;  2F6C A;  3AGP A;  4FN5 A;  3MEX A;  2IP2 A;  2P8T A;  5DTD A;  2VBX A;  2LBF A;  2VKE A;  3IKV A;  5J4V A;  4BHB A;  2DO7 A;  3HOZ J;  2ZC2 A;  1RPW A;  4YFK F;  3JRG A;  2KPM A;  2W24 A;  3PSI A;  1TQI A;  3RY8 A;  2CU7 A;  3T0Y A;  4ENN A;  5IYD J;  1BI1 A;  2GK6 A;  3S2W A;  2E1O A;  4UUS A;  5HXB A;  3E6M A;  3VSV A;  3G4S I;  2OU2 A;  2BM7 A;  3BDD A;  1GR1 A;  1FIA A;  4RAF A;  5D8K B;  3M3Y J;  2WBM A;  1R22 A;  4BJ6 C;  4PUS A;  3H3U A;  4R71 A;  4HLY A;  1XCV A;  3OS1 A;  4MGR A;  3ZQF A;  1IUF A;  1EH8 A;  2ADU A;  3OYD A;  2L9S A;  2Z8G A;  4YDT A;  3H92 A;  3QPS A;  1EJ9 A;  2QYO A;  1QVU A;  1FOK A;  2HQN A;  3FY3 A;  2VKH A;  3ZQL A;  3DP7 A;  4OIN F;  3IAS 2;  4DYR A;  2O0V A;  2H1K A;  3RSN A;  3FIW A;  1YYV A;  2HCJ B;  5DM7 F;  2A68 F;  2V1X A;  2DFH A;  3A3G A;  2NV4 A;  3WXM A;  3D0S A;  4ON0 A;  1XB2 A;  2V7U A;  2D45 A;  4LLL A;  4ZTF A;  1HQC A;  1LFB A;  5J3L A;  4UAJ A;  1ZRF A;  1QGA A;  2J7K A;  2XV4 S;  2DU9 A;  3BY1 A;  2JVG A;  2M45 A;  2NVU B;  3QOE A;  2P81 A;  3CCQ B;  1ZEL A;  4E0F A;  2ME0 A;  1J7K A;  1R5B A;  2JUC A;  1X1A A;  5KCM A;  2ACJ A;  1FWZ A;  2ZKZ A;  1U78 A;  5M5W J;  1AHD P;  1G7S A;  1UMK A;  1WDT A;  4M0L A;  1D1N A;  2QVO A;  5FKM A;  2BEO A;  2DMN A;  4RLQ A;  4OIO F;  1R5O A;  2EIX A;  2JT1 A;  5LGT A;  1BC8 C;  4RCY A;  1W7P B;  4OOV A;  2EBI A;  4WZT A;  1JJ2 B;  1RC9 A;  2CUJ A;  5E3M A;  2O9L A;  2F3L A;  4ZYG A;  3GTL J;  1VQM I;  2PG4 A;  3DU6 A;  3TOB A;  4L0Y B;  1DG1 G;  1WPC A;  2PBI A;  4TMT A;  3G71 B;  3JRD A;  3CCU B;  3FX3 A;  4XLP F;  2ZL5 A;  5LEJ A;  3DBR B;  2NOJ B;  4MHG A;  4GRI A;  5L3B A;  3HTU A;  3ZR8 X;  1FIP A;  1Z3X A;  4U9U A;  3L2U A;  2ECC A;  3B02 A;  4M3B A;  4OPW A;  3A35 A;  4PJL A;  5E3O A;  3ZMZ A;  1YTY A;  4XBF A;  1W0T A;  4OJO A;  2ZNZ A;  2BBY A;  4B3A A;  3WTY C;  2AS5 F;  5A2Q K;  4RGU A;  3KP7 A;  3ZQ7 A;  2DA6 A;  1RQP A;  2LLK A;  1GAW A;  2VBE A;  4D5F A;  2CQX A;  1VZ0 A;  4ZYD A;  2ZZQ A;  5IT9 K;  1V5G A;  4C3I J;  5F1R A;  1YRN B;  1MJ9 A;  3CUQ C;  3HHG A;  1TYX A;  3B4N A;  2VL8 A;  2XGE A;  5FKL A;  3RJP A;  4XRM A;  3ZQC A;  1QZE A;  3P9I A;  3D26 A;  5H5J A;  3OPO A;  1E63 A;  3SLN A;  4Z4U A;  1TP4 A;  5FRN A;  2PMD A;  2VT2 A;  2O0W A;  2HKX A;  4LB6 B;  1O8M A;  3F8M A;  3R6K A;  3QFS A;  2OQR A;  1FP1 D;  1U6G A;  1VQ5 B;  4Z4V A;  1ZKG A;  3BH7 B;  3LSP A;  2NRA C;  4OZY A;  3CLQ A;  4XLC A;  5D5X B;  3LOC A;  1P4W A;  1KC8 D;  5L3E A;  4XLE A;  3DFG A;  5M3M J;  2W48 A;  2QA4 I;  4EM2 A;  1KK1 A;  3Q38 A;  3NAW A;  1MKM A;  2XAQ A;  2IEK A;  4P5O A;  5J1Y A;  3K10 A;  3LQ6 A;  1TSP A;  4F3Q A;  2MD0 A;  4G7Z F;  3U6B A;  3G6E B;  3LYC A;  1BN5 A;  5A8A A;  1YJW I;  3I58 A;  2NXN B;  2OAZ A;  3H5N A;  4UXN A;  3E20 A;  2BVM A;  3A8K A;  4RDU A;  3TO6 A;  3H9J A;  1EA3 A;  3EUH C;  1I5Z A;  5FO0 A;  4A0Z A;  4BQN A;  1FSH A;  3S93 A;  3JRE A;  4W8T A;  3EUA A;  3H0D A;  4Q5S F;  4BHC A;  1OGM X;  1DQU A;  5L3D A;  2VQG A;  2BM5 A;  3C7J A;  5K7F A;  5M5Y J;  1DP7 P;  1SMY F;  2G9W A;  2NTB A;  4BXX J;  4A5M A;  1W4M A;  4XQF A;  2P7C B;  2Q2E B;  2Q6K A;  1OFL A;  2E7X A;  2A5W A;  1K83 J;  3N90 A;  4L5I A;  4PJN A;  1IO2 A;  1E64 A;  1PUF A;  1TYV A;  2NST A;  2QYU A;  1VQ4 I;  3R4K A;  1W5S A;  1USS A;  1DPU A;  3B8H A;  1QU3 A;  3GRH A;  1T39 A;  1YG2 A;  3WU0 A;  1APL C;  4Z4R A;  1Z7L A;  3TOA A;  1U8R A;  4E7L A;  2JK3 A;  2GM4 A;  5GV7 A;  1B4A A;  3BG7 A;  5ILU A;  3W2H A;  3NQO A;  3T8T A;  2WJV A;  2VPR A;  4BU2 A;  2GJK A;  2MD5 A;  3EQL F;  2X1C A;  4FHT A;  3VPR A;  2R7U A;  3EQO A;  3W2I A;  4LBY A;  4D7N A;  2LDU A;  1N0V C;  3JU4 A;  4M3D A;  3VDX A;  4I84 A;  2QWW A;  3JSO A;  2K9M A;  1QRB A;  3JSP A;  1UHM A;  1UG2 A;  5ICC A;  1P7I A;  4ENJ A;  4HV5 A;  1WH5 A;  4JK1 X;  2JRT A;  1RI7 A;  4RGS A;  2XC1 A;  4LOC A;  4V19 K;  3HYI A;  3CCE B;  2WV0 A;  2R7X A;  2NT9 A;  1J59 A;  4CYD A;  4XKB A;  2QX3 A;  2CJJ A;  1EFU A;  2EFO A;  2DBB A;  2DQR A;  4XKV A;  2ZXI A;  1YHQ I;  1MNM C;  2DA5 A;  2IBD A;  2A69 F;  1NDH A;  1TWH J;  2NZM A;  1PJ7 A;  4QV2 A;  5EYR A;  4CCM A;  2P6T A;  3ASR A;  5EGO B;  4PAA A;  2CUF A;  3VOD A;  4Y7N J;  3QRF F;  2E2H J;  3K2A A;  1B9M A;  4HX7 A;  5HLG A;  4PC6 A;  4ESF A;  1OYY A;  3MMP A;  3JX8 A;  3W2W A;  1ORK A;  4XOT A;  2OBS A;  2ZBV A;  1XPX A;  2XTX A;  4OAZ A;  3CMM A;  1DU6 A;  1ETK A;  1K4S A;  2LY2 A;  1W5C C;  4HPQ A;  3W2G A;  2M34 A;  1X3U A;  5HLI A;  3T1B A;  1XMK A;  3FF5 A;  1W2B B;  4ACB A;  1QH0 A;  1KGS A;  2Q0O A;  3KP6 A;  5F4M A;  1QUF A;  2WAQ N;  1XGM A;  3FXL A;  3MD2 A;  1YLO A;  3LA7 A;  2QSH X;  5FFX A;  1M1K D;  2K02 A;  4B09 A;  3OV8 A;  3GVK A;  3KX2 A;  5IYR A;  2O61 A;  4XLH A;  2INV A;  2K27 A;  3OL4 A;  4BBR J;  4RD1 A;  1IDJ A;  4IHX A;  2OPT A;  1ULY A;  3A8I A; 
#chains in the Genus database with same CATH homology
 3OYK A;  2X85 A;  2M0M A;  1MAB A;  2M7B A;  1WJD A;  4BJT A;  2F5V A;  5KNL A;  3KEY A;  2BVL A;  4ZTJ A;  1EE6 A;  1I18 A;  3DKX A;  2O17 A;  1T0F C;  2Z1D A;  2KQR A;  3LSG A;  4B3X A;  4HNU A;  1T5E A;  1UD8 A;  4CCN A;  4DNR B;  5IK2 A;  3EQN A;  2JJ2 A;  1X4O A;  4N4O B;  4G7W A;  2VBM A;  4FAS D;  2V6E A;  4NK8 A;  1QHH D;  4ZDP A;  2V9K A;  2GJP A;  2WAE A;  4CCO A;  2E1B A;  2L2O A;  2X1D A;  1V0F A;  4P1W A;  3NE5 B;  1BR4 A;  2VB6 A;  2M4G A;  3QYF A;  4RM2 A;  3HC7 A;  5LD2 C;  3GQA A;  2WB1 A;  1YX3 A;  2EWE A;  1WJA A;  3BCF A;  1BR2 A;  3M8J A;  4DJA A;  3AL0 C;  4OWR B;  3AKZ A;  3QOD A;  2IGM A;  3L2R A;  2V7Q A;  1DBO A;  2ODL A;  4NK6 A;  2JDI A;  2VKD A;  4NQW B;  3SYT A;  5FRO A;  1DGR M;  3GVL A;  1X1B A;  4URR A;  3PNT A;  1BR1 A;  1WJC A;  4BUP A;  4TKO B;  4YZ0 A;  2X51 A;  2QKL B;  1V5E A;  3CF2 A;  3SDB A;  2UV1 A;  2ZZF A;  4L8J A;  1KON A;  4OZZ A;  2IQ7 A;  3D5R C;  4C9Y A;  4ZDO A;  2W82 A;  2ZSI B;  1AIR A;  1KTW A;  2PEC A;  3GQ9 A;  3LMM A;  2CW7 A;  2BW3 B;  1Z21 A;  4XLF A;  1H8E A;  1K5C A;  3FPP A;  3OEE A;  4DNT B;  2XF7 A;  3G2B A;  1WMR A;  3OAA A;  3OOC A;  4CCJ A;  2HLD A;  3IP4 B;  4IX7 A;  1NRK A;  3PSF A;  3UR3 C;  4BS9 A;  2ZTG A;  2PYG A;  3GVJ A;  4ZC3 A;  2NT6 A;  1W9X A;  2DOA A;  2MAB A;  2L5Q A;  2LBF B;  4C30 A;  3DQV C;  3PNY A;  3OFN A;  4MR0 A;  4ZDL A;  4YZA A;  2VPL A;  3C2H A;  4XN3 A;  4BEH B;  4U49 A;  3OYG A;  2WY7 Q;  4PSW A;  3PJR A;  4W8R A;  4XN0 A;  4BEH A;  4E6K G;  4PMH A;  1QHG A;  4BQQ A;  1UD5 A;  1MMG A;  3T51 B;  2UWM A;  3E0J B;  3K4L A;  3VSK A;  3RQ4 A;  4BGD A;  2JJ1 A;  3W2A A;  2VXZ A;  4BDY A;  2LY1 A;  1PLU A;  4YXW A;  1DGW Y;  4IQ4 A;  3MMY B;  3PUB A;  3MKW B;  1FX0 A;  2RNG A;  2BSP A;  4W8S A;  4BE1 A;  1FMV A;  3L2W A;  2XZL A;  3VST A;  3DTI A;  3OIQ A;  2V4D A;  4E7H A;  2R7W A;  3S3O A;  1V0E A;  4KJZ A;  3W2V A;  2KLO A;  2E5N A;  2CV0 A;  3FBI B;  1E0E A;  2Z16 A;  2E60 A;  3DDY A;  4DGW B;  3VMW A;  4HIZ A;  4AU7 A;  3RPU D;  3OMY A;  3OWT A;  2ZZG A;  2JUG A;  1OB0 A;  4XL9 A;  1P9Q C;  1OLT A;  3VSL A;  3OYN A;  1MMA A;  2E5Z A;  3MKZ A;  1G8X A;  3TL4 X;  4E7S A;  1Y56 A;  3T53 B;  1X4P A;  2HU9 A;  4F55 A;  2W7N A;  2XF6 A;  1UD3 A;  5CDF A;  4BXF A;  3HPG A;  3LFU A;  2K9L A;  4RMN A;  4B48 A;  3H9G A;  2IXS A;  2AQF A;  1D0Y A;  3GQ7 A;  3BH4 A;  4LIT A;  2W1O A;  4YRV A;  1E1R A;  3DPU A;  2D3L A;  2W6J A;  2WPD A;  1D0Z A;  1DP3 A;  2X53 S;  1RU4 A;  2PYH A;  1BOB A;  3OYF A;  1H80 A;  4Y33 A;  4PFO A;  4B3G A;  3PL8 A;  2DT6 A;  2ZZE A;  2RQQ A;  3DKY A;  4W8Q A;  3AL0 B;  3B90 A;  4X0G A;  1VJS A;  4Z03 A;  2KZV A;  4OJ5 A;  2MC4 A;  2IGK A;  4XNF A;  1S9H A;  1HG8 A;  1K6Y A;  3OEH A;  3CZ6 A;  3H94 A;  1K28 D;  2LRD A;  1O8E A;  3BC9 A;  5FL7 A;  2NTP A;  3L2V A;  4YEJ A;  2Q1Z B;  5CPR B;  4BJ5 C;  4PJJ A;  4PJM A;  3LSK A;  4C2U A;  3OY9 A;  5LFA A;  4XOP A;  3LSM A;  4QPQ A;  4XM3 A;  2O5R A;  1N78 A;  4OAY A;  4MXN A;  2LG4 A;  1ERD A;  2HDW A;  1H8H A;  4ASU A;  4DOZ A;  4B43 A;  1NG7 A;  1PKV A;  1D0X A;  2A6T A;  3S8P A;  1KCD A;  3VSU A;  4QPO A;  3ZIA A;  2IS1 A;  1O8F A;  3DWL E;  2VQH A;  2ZXH A;  1W36 D;  2IS2 A;  1QCX A;  3PFY A;  3OYM A;  3A3B A;  4XLA A;  3OYH A;  3I3L A;  2V1N A;  2VBK A;  2M7A A;  1KMH A;  4Z06 A;  2UVE A;  2ELJ A;  5HKK A;  4PFP A;  2KP6 A;  2IS4 A;  1YE9 A;  2VJJ A;  3BCD A;  1O8I A;  3NWS A;  4ANJ A;  3UW0 A;  4XON A;  4XOR A;  3CP2 A;  2I8D A;  4D9J A;  1D1C A;  2IGN A;  4HG2 A;  4DBQ A;  3OS2 A;  2WY8 Q;  2D3N A;  4XD7 A;  4DBR A;  4E4H A;  4J00 A;  2JA2 A;  2R4G A;  3VYR B;  3OR2 C;  1U0J A;  3QYE A;  4II2 A;  3DTK A;  5CKT A;  1T95 A;  3HPH A;  3WQZ A;  1BLI A;  1KZL A;  3HG9 A;  1O8G A;  4KIS A;  3BCA A;  2XND A;  4CSW A;  4F92 B;  1Y6I A;  4XKC A;  4YZX A;  1OFM A;  1HVX A;  1LKX A;  4HRI A;  1O8H A;  3OYE A;  2AQE A;  2BW3 A;  4CH7 A;  3DPL C;  1MMN A;  4FET A;  3C2G A;  3FKJ A;  1JRG A;  3HOS A;  2CW8 A;  3SEZ A;  2VLA A;  1VF7 A;  4HSR A;  1OR7 C;  4G7X A;  2HVQ A;  2LH9 A;  3SZG A;  3TBI A;  4C2T A;  4B3F X;  1PE9 A;  2KL4 A;  1WP6 A;  1VBL A;  4PK4 A;  3BLY A;  4AYB A;  3J7A Y;  3CJQ B;  2XGJ A;  2KDO A;  3B8Y A;  2XC7 A;  3CP8 A;  2F6C A;  2DCE A;  5HNH A;  1O8D A;  2VJI A;  3VYS B;  2LBF A;  2FUG 2;  1IA5 A;  3H9Q A;  2WAQ A;  1CZF A;  1RMG A;  1J09 A;  1WFX A;  2XAU A;  1LDK B;  2KPM A;  1AA7 A;  3I9V 2;  2JVH A;  3PSI A;  4PSX A;  3RCO A;  2HPI A;  3HOT A;  2GK6 A;  1GLN A;  3T56 B;  4LG3 A;  5KHD A;  2M3A A;  2CV2 A;  1UEL B;  2VJ4 A;  2P0W A;  2W00 A;  2Y0S A;  3LL7 A;  1UAA A;  1W0K A;  3TMO A;  3VSV A;  3K6G A;  3DLA A;  3LNN A;  2QKM B;  1XG2 A;  2HZD A;  1PYV A;  2XDV A;  2WBM A;  2LC2 A;  3UNG C;  5CQE A;  3LMW A;  4BJ6 C;  4PUS A;  2GJR A;  3LSH A;  2O1D A;  2HQA A;  4F52 A;  2V7F A;  1BPL A;  3OS1 A;  4BL0 B;  1O88 A;  2Z8G A;  3OYD A;  3OR1 C;  2L9S A;  4EW9 A;  4NC7 A;  3HAG A;  1EFR A;  3S3M A;  3V42 A;  3FY3 A;  2VKH A;  2R7T A;  2XOK A;  4F93 B;  5HNF A;  2DT7 B;  3IAS 2;  4BE0 A;  2F4I A;  2O0V A;  4TSF A;  3RSN A;  3FKS A;  2E1M C;  4DIQ A;  1MW7 A;  1O8J A;  1IDK A;  3A3G A;  4AVZ A;  1FMW A;  1IRX A;  1UD2 A;  1UD6 A;  1BN8 A;  2NSP A;  2HNH A;  2HPM A;  1E79 A;  4ZTF A;  3ZPN A;  2KMU A;  3HXL A;  3KEW A;  3NWT A;  4U4B A;  5HVQ C;  2CS3 A;  2JIZ A;  3E1S A;  1BMF A;  4KKS A;  2MFZ A;  3VR6 A;  2K5C A;  2F1M A;  3L2Q A;  4HWV A;  4CCL A;  2JVG A;  4LIU A;  4ZYA A;  3U21 A;  4EAT A;  3QOE A;  2XF5 A;  2WSS A;  1ZEL A;  2OV7 A;  4E0F A;  2F43 A;  4P22 A;  2DXI A;  1X1A A;  5KCM A;  4MLO A;  2R7O A;  4E7K A;  4RLQ A;  2KRC A;  3VYT B;  4HST A;  3K4B A;  3ONQ A;  1KCC A;  3ZGK A;  3K4C A;  1E1Q A;  1W36 C;  2RRE A;  2CUJ A;  1COW A;  1W0J A;  4B44 A;  3ZXS A;  3DU6 A;  1WPC A;  2LYC A;  1LFP A;  3LSI A;  1Z3Y A;  4E7Z A;  1MND A;  4J01 A;  3G05 A;  2NOJ B;  3K4N A;  5TGT A;  4GRI A;  3OYA A;  3OIP A;  3D5L A;  3ZR8 X;  4CA0 A;  4R79 A;  4HNT A;  2R7S A;  1Z3X A;  3OYJ A;  4IQJ A;  3L2U A;  2VXD A;  1JTA A;  3VMV A;  3A35 A;  4PJL A;  1X1C A;  1OHH A;  2VAS A;  4RM3 A;  4CUG A;  4E7J A;  4ITV A;  3H5A A;  4UZU A;  4NC8 A;  4JMQ A;  2X8K A;  4OJO A;  4KKU A;  4HEA 2;  5CQG A;  1HA8 A;  3VWB A;  4IKF A;  2VBE A;  1TT0 A;  2KRH A;  4C2L A;  2Z6B D;  1VZ0 A;  1RWR A;  1D1B A;  4NUB A;  2ZZQ A;  4FXU A;  3OE7 A;  2V31 A;  1V5G A;  3OYI A;  3K70 C;  3B4N A;  3GQ8 A;  2L7K A;  3SUC A;  3S32 A;  1X19 A;  2VL8 A;  2INV A;  2GOX B;  2QE7 A;  1PXZ A;  3VYU B;  3T9G A;  3OPO A;  1UD4 A;  1HZE A;  4OJP A;  2PMZ A;  2DIE A;  1IB4 A;  5FRN A;  1QJV A;  3OYB A;  2QXZ A;  4OJ6 A;  4XR6 A;  2O0W A;  1YX5 A;  2WA0 A;  2W6I A;  2Z2S B;  3ZCO A;  4E7I A;  2IS6 A;  3IAM 2;  3K4J A;  3HUG B;  3K70 D;  1I8D A;  2M5S A;  1O8M A;  2VQL A;  1MNE A;  2X3H A;  3KRG A;  4DK0 A;  4OZY A;  4XLC A;  2UUZ A;  3IUO A;  2XZP A;  4D1Q A;  3W3C A;  3M1C A;  3EPZ A;  3EUK L;  2MYS A;  2ZTN A;  3A1Y A;  2BOL A;  3FDY A;  3ZQQ A;  4CZC A;  2E1M B;  4XLE A;  3DPT A;  1WJF A;  3CES A;  4H4K C;  4BE2 A;  1O8L A;  4P5O A;  2UVF A;  3OS0 A;  3K10 A;  3OYC A;  4F3Q A;  2MD0 A;  2ZFU A;  4II3 A;  1WJB A;  2LZJ A;  1WTH D;  3H5N A;  5C1C A;  2BVM A;  4XMY A;  2KVO A;  5DN6 A;  1E3Z A;  3H9J A;  1EA3 A;  3K4M A;  2GOM A;  2W4S A;  3EUH C;  3PNV A;  3SEQ A;  2XSJ C;  4U7B A;  2R7R A;  4YZQ A;  3BG6 A;  4BQN A;  3S93 A;  4W8T A;  1SFK A;  3EUA A;  3H0D A;  3WWG A;  3FHN A;  2GK7 A;  2VJ5 A;  1OGM X;  1NG6 A;  1DQU A;  5FRM A;  4F91 B;  2VQG A;  3JUR A;  3ZPP A;  3HKZ A;  1N75 A;  2JSP A;  2LRE A;  5AMV A;  4Z1M A;  1LVK A;  1TZL A;  3DTE A;  3QYB A;  3H5R A;  2NTB A;  2R7Q A;  4XQF A;  1OFL A;  2Q2E B;  4KIT B;  2NTQ A;  4NNJ A;  1SAU A;  2L9N A;  2A5W A;  1SKY B;  4ZJZ A;  4DK1 A;  2O04 A;  4PJN A;  3OL3 A;  3K4K A;  3F9K A;  5JHF A;  1G59 A;  3KYL A;  2WAD A;  1BHE A;  2NST A;  3A4C A;  3S3N A;  2R9V A;  1QU3 A;  2WJY A;  3GRH A;  1OOC A;  2X6X A;  3D5S C;  1Z7L A;  3BCB A;  4E7L A;  3ZSC A;  3AFH A;  5HOO A;  3BG7 A;  4KT6 A;  3A2K A;  2LOO A;  2WJV A;  4BU2 A;  2GJK A;  3FBN B;  2QY1 A;  2CFO A;  3OOU A;  2X1C A;  3MKY B;  2OUM A;  4XKW A;  2R7U A;  2WAF A;  3EQO A;  2PJR B;  2M4K A;  2ZSH B;  4U87 A;  4IZZ A;  3JU4 A;  3VDX A;  4I84 A;  4CCK A;  2PJR A;  2V26 A;  1R6R A;  2K9M A;  3ZRG A;  4JOM A;  1NBM A;  1GQ8 A;  5HLT A;  1O8K A;  4KKT A;  2NT9 A;  2CMP A;  3BC8 A;  2R7X A;  1WJ5 A;  4XKB A;  2QX3 A;  1JI8 A;  4G6I A;  4G6T B;  4B47 A;  4BAC A;  2CK3 A;  3HL2 A;  4XKV A;  2ZXI A;  2NZM A;  2X6W A;  4BQO A;  3CJR B;  3GQB A;  4GQN A;  1DBG A;  4JQF A;  4CCM A;  2IGO A;  4N4N B;  5C1E A;  1MMD A;  2INU A;  4OJL A;  4Y3O A;  3N05 A;  2CH0 A;  4RLF A;  1N77 A;  1UG0 A;  4LIV A;  2VQC A;  2X1E A;  3W2W A;  4TT3 A;  4XOT A;  4BDZ A;  1PJR A;  3CMM A;  4OAZ A;  4Y4R A;  2LY2 A;  1E3X A;  4HPQ A;  2XZO A;  1X1D A;  2CV1 A;  3H35 A;  2HVR A;  1V5F A;  1X0C A;  2OC6 A;  2V4J C;  2CUZ A;  2VIX A;  3MD2 A;  4Z05 A;  2K3P A;  1WJE A;  3DU5 A;  3KX2 A;  3GVK A;  3DEE A;  3OYL A;  1OGO X;  4XLH A;  2KHM A;  1D1A A;  2X6Y A;  2DJI A;  3RTR A;  2R7V A;  1E43 A;  3OL4 A;  3GBG A;  2HVS A;  2WZP P;  1IDJ A;  3OW7 A;  1NHC A;  1VLY A;  4YEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...