4XLHA

Tailspike protein double mutant d339a/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlhA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlhA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlhA02
1O8DA 4Z05A 3FY3A 4YELA 4YZQA 1IA5A 1IB4A 3JURA 1OFLA 4XLCA 3GQ7A 4XKVA 2UVEA 4URRA 2PYGA 1OGMX 2O0VA 2INUA 4HWVA 2INVA 3VSUA 1RWRA 1H80A 2NSPA 1JRGA 4YZXA 1VBLA 1HG8A 4XORA 3B4NA 2X3HA 1GQ8A 3LMWA 2IQ7A 1O8HA 4YZ0A 1O8LA 1IDKA 2O1DA 3ZPPA 1IDJA 1RMGA 4NK6A 1O8KA 4XM3A 3KRGA 1RU4A 4XL9A 4XN3A 3UW0A 2X6YA 4XLFA 1O8IA 5C1CA 2NTQA 3ZSCA 1QCXA 1O8EA 4YZAA 3VMVA 5AMVA 2QXZA 3SUCA 4W8TA 4XMYA 1O8FA 4YEJA 1O8GA 2ODLA 2NSTA 1NHCA 4OZYA 4Z03A 2NTBA 2VBEA 2PECA 1KCDA 3VSVA 4OJPA 1WMRA 4XOPA 1KTWA 4XLEA 1K5CA 1DBGA 2NZMA 4PMHA 2NT9A 1EE6A 4OJLA 1X0CA 4W8SA 1KCCA 4I84A 3WWGA 2PYHA 1BHEA 2NT6A 2X6XA 4OZZA 3EQOA 2EWEA 2X85A 1BN8A 4U4BA 3GQ8A 4OJ5A 1O8MA 1PLUA 1PXZA 4XNFA 2O0WA 2VJIA 2O17A 1AIRA 1DBOA 2Z8GA 4XQFA 3EQNA 2QX3A 1O8JA 3B8YA 1CZFA 2QY1A 2VBMA 3GRHA 4XKWA 2X6WA 4XLHA 4EW9A 2O04A 4MXNA 4AVZA 3GQAA 1JTAA 1OOCA 3B90A 4XR6A 3GQ9A 2UVFA 2VBKA 4W8QA 2NTPA 1OGOX 4NK8A 4XN0A 3VSTA 4XLAA 1QJVA 4XOTA 3T9GA 4OJOA 5C1EA 2VJJA 2BSPA 1O88A 4W8RA 1OFMA 4U49A 4Z06A 4C2LA 1PE9A 4MR0A 4OJ6A 3VMWA 1XG2A 4XONA
chains in the Genus database with same CATH superfamily
1MMAA 3CLOA 3FY3A 2LF7A 2ZMEA 4IL6C 4RB3C 4A12A 2CV1A 1BX1A 4JOMA 1WTHD 2DOGA 4AF6A 5ICEA 2QQAA 3DKXA 2DMNA 3K1MA 1JUPA 3H1CA 1LEAA 2E7XA 4BS9A 2OK8A 1QVUA 5FO0A 4PCQA 5B5EC 2QZAA 3PL8A 2OJED 3DPLC 3GTMJ 3CDLA 2PMZN 5CDFA 1JHFA 1FP2A 3E7LA 1Q1HA 2KL4A 2QWWA 4AF7A 4C0SA 1RR7A 5K7FA 4TKOB 1PP7U 3JRIA 3ZN1A 3VSUA 1RWRA 2NNYA 2WA0A 1SM4A 5F4JA 2I8DA 2NSPA 2IS4A 1YJNI 2EFGA 3WGHA 1HZEA 3S14J 1HG8A 3KEQA 2VI6A 3CCMI 3RI4A 3NAUA 3TOAA 3OE7A 2A6HF 3M8EA 3OS1A 1EF4A 2BW3B 1ACIA 4BE1A 5EEAA 1DDGA 4MLOA 1Y8QB 3JRDA 1S3JA 2HTSA 2BVLA 1UD4A 4X8IA 1I6XA 2EWNA 1Q86D 2O1DA 2EB7A 4F91B 2HPMA 1KRHA 3B78A 1A6QA 1U3EM 1Q9SA 2IOUG 5CVUA 1UAAA 2CC2A 3G71B 3ZIAA 1ZLKA 2VBSA 4G7XA 2PE3A 2DK8A 4OIRF 4DYRA 3CESA 2EFPA 1RRJA 4BL0B 2FSWA 3M1EA 3PSFA 4MIMA 4Z6YA 1FJLA 2W6JA 1SEUA 1SAXA 3GZNB 3WG7H 4KNYA 1OLTA 5FD6A 1GO2A 5GTHC 1FOKA 4HNUA 3CCRB 4Z2YA 4L5JA 4YRVA 1P4MA 3PQKA 1K6YA 1KA8A 3GTPJ 3FHNA 3HOZJ 5FKKA 1VQ4B 2K9MA 3ESWB 1OCPA 2DFHA 2NRAC 3W5HA 1MMGA 5B66C 1B72A 5JMCB 4KJZA 4Z4RA 1YJNB 1K5CA 2VN2A 3K4MA 3ZQFA 2EH3A 2XF7A 4G7OF 3ELKA 2AXTC 1XSVA 2FEZA 1LE8A 3QYEA 2WY8Q 2X3UA 2NT6A 4U7BA 1RKWA 1Y39A 2DO7A 3M07A 2XUBA 4Y7CA 3CCQB 4A2UA 2XASA 3FMSA 3ISPA 3IL2A 2XVCA 3FDYA 2H8RA 4K2EA 1OJLA 4XLNF 2CBXA 3BQZA 2FBKA 1DPRA 4M6YA 1K78B 2OBRA 1TTTA 1JTYA 4A3DJ 3CCQI 3GTOJ 1TQPA 1E79A 3Q38A 4X7CA 3BWGA 4MEXF 2Z33A 4CO8A 4FHTA 1NG6A 2A05A 3A8KA 1CGPA 2XF5A 5DUKA 1VQ9B 2X6WA 3U2QA 3LSKA 5A2QZ 3OEHA 4AVZA 2OTJI 4KKTA 3GQAA 2HR3A 1OGIA 3PNVA 5E3MA 2R4GA 1BL0A 2QENA 1YJWB 2XT2A 4E7HA 1GXQA 3VFZA 3SLDA 2OYNA 5TGTA 2CV0A 1G4DA 2EIMH 5JVGF 1QGZA 4IEJA 3H3VK 5KAFC 3E5UA 2ZJPF 4HYEA 4KN4X 4B09A 2J8KA 2GOMA 2Y48A 5JLXA 3V42A 5ICGA 1R5GA 3Q0VA 3GCMA 2NOJB 2K5CA 3LFKA 3BTLA 5DS0A 1IRZA 2BXZA 3OOUA 4CCLA 3BR3A 2A68F 2LZJA 1BJAA 2A3SA 2BHYA 2PG4A 2E36A 2W25A 2NV4A 3DXJF 3CCLB 3D5LA 2XC1A 2VQCA 3F72A 4XKVA 5LGTA 3G2BA 2X6OA 3NAWA 2DODA 4BACA 4X6AJ 5GTIC 3KE2A 3JSOA 1TWGJ 2K02A 2NS0A 4JYKA 2BY2A 2K3FA 3GUDA 2QF7A 4D1QA 4Y33A 2QE7A 2C5HA 2WC2A 1BIBA 3ZGKA 4BE2A 1VFCA 3G6EB 3V8LA 4F3QA 4YZXA 2KVOA 1QRBA 2CSOA 2F4IA 4EGYA 3DFGA 2Q8KA 1BC8C 2VQLA 3WTZA 3L9FA 1ZGWA 3GVJA 5HLHA 3SXYA 4NC7A 4AWXB 4B3XA 5L3FA 3G6EI 1D1AA 2LP0A 3CQZJ 3LAJA 4C2UA 4A0ZA 1Q82D 2DI3A 3W2GA 1KGSA 3KL9A 5LHIA 1D8KA 2GOXB 2NVUB 3COAC 4F52A 3B73A 4D7MA 2P8TA 1V55H 2HYJA 2ME0A 3MZYA 4CYCA 1E3OC 1JB9A 2DTRA 4UXNA 4JMQA 3WYAA 1QFYA 3ZZUA 3OIQA 1HOMA 2W24A 3G1LA 4ESBA 1I7PA 1T6ZA 1E1QA 2W1OA 1Z3YA 4TMZA 2G7HA 2DA4A 3MKWB 2C4TA 1VF9A 5LHGA 2HOEA 1O8EA 5E79C 5J35A 3G1MA 1IXCA 2OF7A 3DU6A 1IV6A 2BF4A 1KQ8A 1EZGA 3F0CA 3IUOA 4EJVA 1D2EA 4PJNA 1MBKA 2CQXA 1WPKA 2V7VA 3KETA 2DT7B 2V26A 1VQMI 3RQIA 3FKIJ 1NK3P 1MH3A 1J7KA 4X1EA 3A8JA 2K86A 2WAEA 3MN2A 4CYDA 4U7DA 4A3FJ 2VYQA 3DEUA 1EFTA 2RC5A 2CQKA 4HG2A 4CSWA 1GVJA 2AXLA 4II2A 2K9QA 2MA3A 1DUXC 1EV7A 3WBKA 2KT0A 4DZPA 5F6FA 1Z6TA 1B2RA 2PYHA 2ICWG 2KISA 3R0JA 1W9XA 3J7YJ 1D5VA 2D3LA 1LVKA 5TISC 1LNWA 2X8KA 2J8IA 3CD6I 4YAFA 1V5EA 4MYUA 2LFBA 4RBOA 4BDYA 1PLUA 2O0YA 1WU8A 2CFXA 1QGAA 4EQQA 2CNDA 4XRSG 1ETYA 1S29A 2HKOA 5L3EA 2QGGA 4RPDA 4A3GJ 1ZGAA 3MEXA 1B9NA 4FISA 1KQ0A 2YWHA 4M9XA 1KJZA 5FGMA 4FK8A 1OYWA 4P1VA 2IA0A 3DTKA 2O8XA 1J75A 3L2UA 1U8RA 4R79A 5K7HA 5ILVA 2XTWA 4DNTB 3H9NA 1SANA 2XEXA 2ZZQA 2LKSA 3KP5A 1XFOA 4NBSA 1IRFA 1AKHB 4GRIA 4OINF 2M1BA 3NARA 4A3JJ 4C30A 4NNJA 2DA3A 1DDNA 3PQJA 2IEKA 2UXNA 1JKOC 5IOYA 3PUBA 1WVRA 2V9KA 2Y0MA 3SLNA 4M0LA 2YSRA 1IN7A 3LA7A 5DCMB 3S1MJ 1P4AA 1TUIA 2XZOA 2F4OB 2IJLA 2VFQA 1IV8A 2DYSH 4WXHA 4C2LA 1KU9A 4HNVA 1WKMA 3R6KA 1UMQA 2M0MA 1T2KA 2JA2A 3OJXA 1O8DA 1UD2A 3CLQA 4LK0F 5DD8A 4MHGA 4NCNA 3IHUA 3I0TA 1EP2B 5J8CA 2EINH 2JTVA 2JSCA 1LB2A 5FRMA 3MFKA 1YTYA 2V31A 2UVEA 5HNFA 3G05A 1HKTA 3P9CA 4IJAA 5E1WA 5AIPA 3TGNA 2QN6A 4OPVA 4Y4RA 5LGUA 4B4DA 1K4ZA 2OCEA 2L9VA 3BPVA 3QPSA 2MLGA 3SYTA 4LBWA 3D1NI 1KMHA 3TQNA 4ZDLA 1ZM2A 2X0LA 1Y0NA 4F55A 2CF4A 2CJJA 3EYYA 1XX5A 5FKMA 2V7TA 2LTPA 3HM5A 1MW7A 1VI0A 1PJ5A 3DEEA 4M9SA 1X4OA 4MFEA 2JSPA 3F3XA 5ICCA 1WCMJ 4WXCA 3GFLA 3EDPA 2F3LA 3TW7A 2LKPA 3D5SC 5L3DA 3N90A 1U9OA 3CC4I 4PSWA 4C2MJ 1KTVA 1P7JA 5EGOA 2GPJA 1VQ5I 3JRAA 3BNWA 1OFCX 1YO5C 2X6YA 2BZTA 2XKPA 2FOKA 2EA2A 3CJQB 1SKQA 1BIAA 3ASTA 4JQFA 4RAFA 2L4AA 5E18F 1QG0A 2MABA 2E1MB 1VQ5B 5AMVA 3B82A 3ZQIA 3WE2A 2K4BA 4KT6A 5FO5A 3DLAA 4BY7J 4ENNA 3T0YA 3MVPA 1WGXA 5D5WB 2CUJA 2CUZA 3MWMA 4LBZA 5BS6A 1F36A 3H36A 5D8LB 2L9NA 3O2PE 4YFXF 2HDWA 5KNLA 2C5BA 2RAEA 5FFXA 4ZJZA 1Z9CA 2QKMB 1Y6IA 1TNTA 3AVVA 4HX7A 1R22A 3F21A 1YFHA 4V2GA 1ZM3A 4M3FA 4CGZA 2DJNA 2ZBUA 2O61A 2EWEA 1SMYF 3FMQA 3H5AA 1X1BA 2OBTA 2XGJA 2TCTA 1E43A 2B0LA 3S2WA 2DAOA 3K4LA 3WY9A 1NG7A 2VJIA 3H9GA 1K83J 3BG9A 4KIBA 2G0YA 2E2JJ 2E35A 4G7WA 2FU4A 3P26A 3BPXA 1SFUA 3A0HC 2BGJA 3OOCA 1K8FA 4AU7A 1W7PD 2BOLA 5DD4A 2R7DA 3ECHA 1R00A 4UVBA 3OZWA 1OR7A 2PEXA 2LLKA 4EEFG 4FASD 1V54H 3HDDA 1D8JA 3J80Z 2YS9A 1R9TJ 3F8BA 3GQ9A 5LMZA 2YPRA 3VNVA 1ZR2A 4TMXA 2D1HA 2R7TA 3KIOA 2DPUA 2GAUA 3T9GA 3OYLA 3ISXA 3FK7A 2EV6A 3RPQA 2DBBA 4Y15A 4D7NA 3LJYA 2HTJA 2ZSHB 4YIFA 2STWA 3AL0C 2GA2A 2R7WA 1FNDA 3LSMA 2DPDA 3I64A 1ZLJA 4WCGA 3G4SB 3BR1A 4L9JA 3ERED 4BXFA 3ASPA 2ELKA 1ZUNB 4C3JJ 3K4NA 1S8NA 3WODF 4YHBA 5F27A 4NC6A 1POGA 3DTIA 1REPC 1K9MD 2R7RA 2VUMJ 1B8IB 1R6RA 2ZTGA 3ONUA 3V76A 1ETKA 1Y0UA 3CP2A 1ZELA 1PP8F 4ACAA 3D0SA 2MGQA 4RD0A 3HOVJ 2XB5A 2NVQJ 1T08B 2BYVE 3NEUA 1GVDA 3K69A 2LSOA 3KP4A 4HEA2 4LLGF 3VODA 3I4NJ 2Q6KA 4IXAA 4TV7A 4DQKA 4PABA 1CNFA 3WGIA 4JBAA 4KIGA 2RC4A 1KQSB 1T6YA 5EMNA 1YS6A 1S72I 4NUBA 1IC8A 3FKJA 1RQRA 4IF4A 4XM3A 2DA7A 2JDIA 5D5UB 1Y1WJ 1D0ZA 1I5ZA 4PJMA 3HIFA 4BHCA 1BC7C 4UY8I 4I0AA 4U88A 2QEXI 1SKYB 2L9SA 1WOSA 4KISA 3QSYA 3J7ZI 4IRIA 2CO5A 3WNBA 3I1FA 1HF2A 4A5NA 2VFPA 2JVHA 2JJ1A 4I98B 4C9YA 3TEDA 2NVTJ 2ZZEA 2H6CA 4IOCF 3FPPA 2QEXB 2QXZA 4HX8A 2V6EA 5A2QK 2C78A 3LO8A 4BNCA 1ZYRF 3H5RA 1S4MA 4P3IA 2KQRA 5IYQA 1YHQI 4UNOA 2R7VA 5CPRB 2Y69H 2VKDA 3OAAA 4OJPA 1YW7A 3VSLA 1E3ZA 2JK3A 2WPDA 3OYBA 1MSFC 2VNKA 2GZWA 3BR0A 3WXMA 4HQMA 4N4OB 3WTTC 3KEWA 1IN6A 1LUJB 2W84A 3JTHA 4A3KJ 1K78A 1T95A 3GQBA 3MCAA 3WWGA 5A8AA 5EYRA 2JA7J 1H8EA 2HI3A 1Q7YD 3AVXA 2E1CA 2CW5A 4OM9A 4OJ5A 4PC6A 2IW5A 1QZEA 3JU4A 3HPHA 3F8CA 3K70C 2MD0A 1QPIA 1HW5A 4IHWA 3G73A 4X7EA 2OUMA 4TMWA 5HZBA 1UD5A 2EK5A 1O8JA 3S1RJ 5HZAA 3FBIB 5KAIC 4B3AA 2BE5F 4GXOA 5J4YA 1YIJB 3FX3A 3OYIA 3QFSA 1W87A 2GJRA 1HC8A 3NB2A 2VONA 5J47A 4LBYA 2VLAA 1NTCA 3SZGA 2HOAA 1A5JA 3B90A 3LQ6A 1YI2B 4RAYA 2H8WA 3K4CA 4UV8A 1XC5A 2JRMA 3BT9A 1I3AA 5M5WJ 5L46A 4I76A 1BM9A 5FLXK 3M4OJ 1L0OC 2M3AA 4ZH4F 1XGOA 1YG2A 3B02A 2GQQA 5F04A 2FA5A 1JKPC 2VJJA 3NWTA 5B6IA 3JCUC 1XG2A 4OPWA 3OR2C 3E0JB 3H35A 4IRGA 1P4WA 2IGMA 2V1DA 3FXJA 1I27A 4YFKF 5DDGA 1VQ8B 1WORA 1O3SA 1U6GA 3JREA 1OCRH 3IP4B 4HSRA 2WR8A 1IRXA 1IHMA 3RIRA 4BHBA 4IO9F 4GQNA 1V5FA 4LIVA 1YLFA 3TH0A 1FX7A 2Z5UA 3PO2J 2YWGA 1A31A 2W7NA 4NQWB 2DW4A 4R71A 2R9VA 3OSFA 1DPUA 1XGNA 5H5JA 4QIWN 3LWFA 1IZ1A 3SKBA 1G7TA 3CUQC 1FPQA 1PUEE 4E70A 4O6JA 2INVA 2XAFA 4ASUA 3V7AA 2WZNA 1G7SA 5DN6A 5HS9A 1A6IA 3B6CA 1CF7A 5HNHA 4IHYA 3A1YA 1Z1DA 4HLYA 1IXSB 4ON0A 1KU7A 3GXOA 2EZHA 1WOPA 1A8PA 2RVCA 2CS3A 4Y13A 1ZG5A 4OP7A 5F08A 1QGYA 1FY7A 3BR5A 2M87A 3W5VA 5BPIA 4UVAA 3I54A 4Z4WA 4OOVA 4I02A 2DEUA 2CWEA 1TW2A 2JMWA 2Z99A 2ME6A 3ZMSA 1Z6RA 3OZUA 2OPTA 2EBIA 3V8JA 1YIOA 2DDBA 3Q5FA 2KKOA 5F1JA 3Q9SA 3ZMZA 1T8IA 2YU3A 1FNCA 1G7CA 4PK4A 1FIAA 1MJBA 3ABKH 1MNEA 2EILH 5EF6A 2WJVA 2E34A 3IH4A 4G94A 4JK1X 4BYYA 1Z7LA 4I2OA 4AC0A 4AIDA 3L2CA 1FNNA 2B7BA 3GZ5A 4OPOA 1LKXA 4CZZA 3DEWA 3JR9A 2RDPA 3LSTA 3P4GA 3ZQGA 5E1ZB 4ZYAA 3A2KA 4Z4ZA 4YC5A 3OZVA 2UXXA 4M73A 1P92A 2XGXA 3CC4B 3MKZA 3QP6A 3CW2A 3K4JA 1Y8RB 2HQAA 3H5NA 1FOXA 3AVTA 4I84A 3T8TA 2D1VA 3TO6A 4HE6A 4DNRB 1X1DA 1IN4A 1HXDA 3S17J 2P5KA 3HKZA 4EM1A 1FP1D 2Q1ZB 5CLSA 2KHMA 1EXMA 2JN9A 3S15J 5FL7A 1X1PA 4BBRJ 4L8JA 4G7HF 4XICA 3FKSA 1X19A 1ZGJA 3HGGA 1T39A 2IP2A 4DNCA 2O17A 1J09A 5D6EA 1P2FA 1TZLA 3E3VA 4CCNA 2GWRA 4CCKA 1BBYA 1R5HA 1NH3A 2A69F 4RCYA 2J7KA 2E71A 3AGPA 3DPTA 5BOXA 1QFJA 2JN6A 4U0VA 2YWEA 5JBQA 2DJIA 1BMFA 1FYMA 1VHEA 4MXNA 2M4KA 4FX0A 1GVHA 1B6AA 3RDIA 3ABUA 1J9ZA 4KKSA 3T1BA 1YYVA 4QSHA 1XB2A 2R7QA 3BC8A 2JWTA 3A01A 1VQOI 5ERIA 2CUFA 3TW6A 3W6VA 1UZCA 1W4MA 4Q47A 4DOZA 3OEEA 1X1CA 4LITA 2X48A 1T5EA 2LNBA 1EKEA 4NHJA 4ESFA 1IJWC 3AVWA 1PE9A 1VQOB 1QH0A 3OOPA 2VNJA 4Z05A 1R36A 4YZQA 5LLQA 4XK4A 3G3ZA 2ETHA 5F0FA 1VQPI 3I4PA 3OYEA 1RETA 4GCVA 2P81A 2BHZA 2BM5A 4L9VA 2VFOA 3EUAA 3JTGA 5M5XJ 2M4GA 3G1OA 1YJWI 3VWBA 3K4BA 3FXQA 5DM7F 2Q2EB 3HG9A 3HTSB 3KZZA 4H4KC 2UUZA 5E20A 4G6DA 3E6MA 1H80A 3K2AA 4DK0A 1S5LC 2VB6A 2M7AA 3CDHA 4AYBA 3CMAI 3SYJA 1RNLA 2MBFA 1O57A 1HDPA 1S9HA 3CCMB 2FJ1A 2XPUA 4A3IJ 3GTJJ 3M8JA 4P26A 3MMPA 3DU1X 3SZEA 4LB6B 3BLYA 4MYTA 2PN6A 2R5YB 1MIJA 4FQGA 4P9SA 3PENA 5JR3A 3W5UA 5K5OA 4LG0A 4X0GA 3HOUJ 1XPXA 1B59A 1H8AC 2QTLA 4AIJA 4F7DA 3FXUA 3I55I 1H42A 2M5SA 3H0DA 2VODA 3IAM2 5E3OA 2DOEA 2ELJA 2KZGA 2X4HA 1UJ8A 3HRMA 1BW6A 1N0UA 3QFTA 3HB9A 2WBMA 4BUPA 5DUIA 1JJ6C 3Q0UA 4PGOA 4Y9UA 2VIXA 5IYNA 4UHTA 3DV8A 3R6SA 2PLFA 3PUMA 2Q2EA 1B9MA 4GYIA 1O8FA 2WV0A 3GVAA 1YJ9B 5JLVC 1GJRA 5LHHA 3BROA 3KP3A 3ZQQA 4RB2C 3CCRI 3BR6A 1NHAA 3M9AA 4Y17A 5BSXA 2PECA 2JA8J 1AIPA 1XE1A 1X2MA 3WQZA 1RIOH 4EJUA 2P5VA 3MKLA 1JKRC 1K4SA 4HNTA 3E6DA 1ZREA 2ISZA 2IT0A 2P3MA 1DBGA 3BTJA 2HGCA 1T0FA 4X7FA 2W82A 2VKHA 4AM3A 3LFUA 3BR2A 1JT0A 4MGRA 3NE5B 3BDDA 2X51A 1W0KA 1HSTA 3C2BA 4RD4A 2LMDA 3RYRA 4RD6A 1O8MA 4P25A 5M3FJ 3E1YE 1AU7A 5J3LA 4JRAC 3ULQB 5FKLA 2XGEA 3I56I 4A69C 1F20A 4IVNA 1X3UA 4TMVA 3KX2A 1IAWA 4QVJA 1HF0A 3KYDB 4MEYF 1U5TA 3WHBA 2WYRA 4AIKA 2QY1A 1NK2P 2K27A 4AD9A 4F92B 4HX4A 1GT0C 4B48A 2DLLA 2ZC2A 4UUVA 3I53A 1FBQA 1DABA 3S1NJ 1HCRA 3X2QH 4A0YA 3U1KA 3VO2A 2H6BA 4DW6A 1W0UA 1DG1G 2VBKA 1BPLA 1R4NB 3VEPA 4M3GA 1IUYA 5EZGA 1W5CC 4XLAA 4XIDA 1KK2A 3H09A 1R5NA 1QJVA 1DQUA 2FE3A 1PUFB 2LYCA 3ABMH 2PJRB 1TBXA 3W2AA 3GF2A 1HKSA 2KP6A 4B4CA 1U78A 4KMFA 2M45A 4KITB 3W2HA 4AYBN 3M8FA 4QFMA 2DMQA 2GJPA 2BY0A 4LOCA 2KFDA 5J6XA 1IA5A 1TTYA 2LD5A 1TWFJ 1PJ6A 2VFNA 3LNQA 2QMUA 1FMVA 4DIQA 1WZ2A 2VBVA 2NS8A 3U21A 3LQEA 3T56B 3HTUA 3OWTA 3PIPF 2R6HA 1QHHD 2B9SA 5IT3A 4URRA 1J0RA 3CJRB 5M5YJ 2CH0A 4ESJA 4M4SA 2WTEA 3QWLA 2CG4A 2Z9OA 1IDZA 1JHHA 5CVVA 1U2RA 1T33A 1JUSA 2PI0A 2V79A 1O4XA 1VBLA 2B63J 1YX5A 3RSNA 4DQ2A 1BX0A 2K9SA 2IS6A 4E7KA 3VB2A 1Q1VA 2XV4S 3D26A 1NB9A 3CC7B 4C43A 1TWHJ 1USTA 3S1QJ 2KMUA 3BCAA 2RKHA 1OYYA 3R4KA 4NBQA 3M3YJ 3P27A 5ILSA 4CHUA 4IHSA 1FTZA 2JRTA 3H0GJ 3P7NA 4DYCA 1NRKA 2PMUA 1R4MB 1RU4A 5FO1A 5FLMJ 3PIOF 4DZJA 2ZZFA 4Z4SA 3FXMA 2V9VA 4Y52J 3SJMA 2H94A 2L9RA 2L01A 2L7MP 3GYHX 3KEOA 2QSHX 1FX0A 1X4PA 5DEQA 4Z4YA 1O7LA 2MW8A 2G0EA 1Z91A 1SFEA 3E97A 4O5VA 5F64A 3V7CA 1A35A 4OIQF 4P12A 2VFMA 2NVXJ 3WNCA 3ZUGA 3GMEA 2V1NA 2PLYA 3RZOJ 3GVKA 2VBUA 1XDSA 4P5OA 3KP6A 4TT3A 2C4UA 2ZL5A 1F43A 2NTBA 1G3WA 2JT1A 3Q3AA 5D4RA 1N75A 1YS7A 1RR8C 3VR6A 2AHQA 5IK2A 4E6KG 1MD0A 3H3UA 4E7SA 1OGJA 1UHSA 1K28D 4LB5A 2VE9A 1WRJA 5BMZA 2ZB9A 2CW7A 4OOIA 2EPFA 1M1KD 2LREA 2X85A 3SDBA 2IRFG 1EJ9A 4YAUA 4ZGNB 1WJCA 3OYHA 5JI6A 2F1LA 4D0PA 4ITVA 3IWZA 1D1NA 1FOWA 1S7EA 2P6TA 4M6XA 2GJKA 1E3XA 2LC2A 2DETA 3GRHA 1FBSA 1SD6A 2KRHA 5HVQC 3RYPA 2JUGA 5M3MJ 2C6YA 1VF7A 5AN9A 1MBJA 2EJRA 2MD5A 2O04A 4PJJA 5GP9A 2OBPA 5HXBA 1WJDA 3I71A 4BGDA 2X1CA 5BNGA 2BM6A 2M2EA 3GBGA 1F9NA 2QVOA 1C0WA 3CZ6A 1S7OA 5E1XA 3CO7C 2F6CA 1TYUA 4IQ4A 1APLC 3VSTA 4MTDA 3S2DJ 1MNMC 2KPMA 1MKMA 3GVLA 2WB1A 2AS5F 1V5VA 1TT0A 2MH2A 2DT6A 3GFMA 1T98A 3VYTB 2ZSIB 4OAZA 5J3OA 1H88C 2J5PA 2VC1A 2L7KA 5IYDJ 5FLXZ 3IH3A 1I8DA 5L3GA 3V4GA 2MG4A 2VBXA 2NXNB 2V9PA 1FYKA 3CXCB 3TMOA 1WXRA 4B3GA 2TDXA 1BJZA 2EFOA 2IVMA 2IGKA 3EQLF 2YUSA 1T6XA 5TJJA 4RA2A 2BY1A 4HW0A 2PYGA 3QOEA 1GXPA 2G9WA 2DT5A 3KFWX 1TW3A 1FLIA 4HWVA 2KIMA 1E17A 4OPSA 4UVCA 4ZCMA 2JVGA 1JKQC 1VQ6B 1ON1A 2ZKZA 3CUOA 4M3BA 3HSRA 1ETWA 2NOGA 4ACBA 3TP0A 3DBRB 4KMUX 2M8EA 3CMEI 2W00A 1GDTA 2E1BA 4WZEA 3UKGA 2CUEA 3TKYA 2Y75A 4BH9A 4WX9A 1VQKB 2R92J 1Z21A 1EH6A 2DIEA 1O8LA 2HS5A 4AC9A 1KONA 1GLNA 2GBYA 2EFWA 3OYGA 4HRIA 4NK6A 3AAFA 5CKTA 5KHDA 4DBQA 1UMKA 3CMEB 1N08A 4CCMA 2VZLA 1OCTC 2CW0F 3UW0A 3RJPA 2E5NA 2HZTA 4XLFA 2K40A 1OYIA 2VJ5A 1RQPA 2W7ZA 3ZSCA 3S2HJ 2VOOA 5CJ9A 3Q6QA 2A5YB 2FVGA 2DDAA 1G2HA 4P1WA 4XMYA 2VBWA 1TL8A 5JVTA 2ODLA 3S3MA 1X3WB 2RNGA 4Z03A 4LMYA 4N9IA 1XN7A 3MCZA 2ZCWA 3EYIA 4M53A 5LFAA 5DNSA 3ZZTA 2E1RA 2GIVA 3H92A 2XKOA 1GAQA 2P7VB 3HHGA 2VNIA 3BJOA 5L3CA 3I58A 1VJSA 2BGIA 3K2ZA 3K1PA 3A8IA 4DK1A 1B1BA 1ETXA 4C3HJ 5D4SA 5TRDA 1RUNA 3ZBUA 3W2VA 5GV8A 2X6XA 4BJ5C 2DFIA 2YU9J 4AUXA 2D9RA 1MBEA 3WTYC 5IYRA 4D5CA 5JLWA 3OKXA 3LNNA 3LMMA 3ZQLA 2O0WA 3CP8A 2E7WA 3OW2B 3GLLA 4BAYA 5D8KB 5ED4A 1OCZH 5EDNA 1WH7A 3ASRA 2Z8GA 1RI7A 1CZFA 2DTZA 3OFNA 3VPRA 3W2EA 5DYMA 2HLDA 1PJRA 3L7WA 2LY2A 4KDPA 4A3CJ 2F5FA 1IUFA 2GK7A 2JQ7A 1MZBA 3EUHA 3KEYA 4O3MA 2BM1A 1TSPA 1H85A 1FOYA 1BR2A 2OA4A 2V7UA 3DF8A 1OOCA 2DMTA 3GW2A 2AQEA 2VASA 3TP3A 3JAMK 4RDUA 4UZUA 5HS7A 4IZZA 3ZP5A 1OGOX 2VQHA 3VMFA 2M30A 4V02C 2LH9A 3SZTA 3CCLI 4TMTA 3AG2H 4BEHB 2PJPA 1YE9A 3VOEA 4W8RA 2M7BA 3E5XA 2HDNB 4MR0A 1Y0YA 3CPWB 2LG4A 2QA4I 4OOXA 1ZRFA 1D3YA 2IPQX 3QU6A 4OMZA 4XRSA 2DYIA 2KIQA 4YCQA 4PAAA 1QU3A 4B43A 4ENMA 1H8HA 1XGSA 4A3EJ 3BCFA 5KSWB 2FNAA 3J81K 2HVRA 2V7QA 3CCJB 1R23A 3HJEA 1DARA 2XDVA 3EPZA 5JFRA 2QKLB 3ZR8X 1LPQA 2DYRH 4WZKA 1T0FC 3BY6A 2B7EA 2FBHA 3KLOA 4MQ9F 1BN5A 2BBYA 5E6TA 1W7PA 2YR2A 3BP8A 2PQ8A 2PFBA 1JRGA 2M34A 4RPBA 2HQRA 3CCSI 2ZZGA 3B4NA 2BV6A 3LMWA 2NVYJ 3AG1H 4YXWA 1O8HA 1BI0A 4ZYEA 1CF7B 4XRFA 1UD3A 1KK0A 1BA5A 3BC9A 2ZFUA 3I59A 1QNTA 2XF6A 3HOYJ 4Z4UA 4FWTA 2QBYA 4G6QA 1EP3B 3L2WA 1WJEA 4X05A 1G6NA 1IN8A 1KYZA 3F6OA 3OR1C 4LGWA 1N25A 1VLYA 1HW1A 3JSPA 1YI2I 2DOFA 2ZO4A 1ZR4A 1O8IA 2XNJA 3HUGB 4OMYA 3FF5A 1ZARA 3DLLF 3BTIA 2JIZA 5EEGA 1BOAA 4QHYA 3ABTA 1YRNA 1OHHA 1W36D 2W57A 3BY1A 1CQTA 4DBRA 5E17F 3ZC3A 2DK5A 1F4KA 2XZLA 2BMWA 2WWYA 3A3GA 3CC7I 4PGHA 2EZIA 4EH1A 5KVRA 1WMRA 4RAGA 3WTVC 4XOPA 2HQ5A 4P9FA 2JUCA 1KTWA 2LVSA 3ZCOA 2VOPA 2NZMA 2QQ9A 4BQNA 4WZLA 3GTQJ 4HZFA 1KCCA 3HPGA 4A3BJ 3ASOH 1JNYA 1BHEA 5LD2C 4QPQA 3QP5A 3GQ8A 1PVEA 3R0AA 1E3HA 1E64A 3T8RA 4RDLA 3K9TA 3SQNA 2HYGD 3CO6C 4G6TB 4IW3B 3R6JA 3C2HA 4CA0A 5H59A 3I9V2 3OL4A 1R71A 5DCFA 3T5XA 3E6CC 4KICA 3CCVI 2MC4A 1DBOA 3UNGC 1Y0RA 3N6ZA 3BJAA 4CZCA 2QCOA 4UUSA 5IPAA 1K8AD 4GO1A 3HEFA 5FJ8J 3A01B 3JRBA 1ENHA 4HOBA 2HOSA 2VBMA 2DOAA 2CFOA 1IF1A 2LF8A 1JA1A 2QSFX 1JJ2B 2V5IA 2BVNA 3CCVB 2AQFA 5C3EJ 5IY5H 1KU2A 3WGGA 1ERDA 1EFCA 1I1GA 4M1KA 2V7XA 2HVQA 1JJ8C 5HS8A 3EUHC 2ECCA 1ZQ3P 4HLXA 1QUEA 3LSIA 1ON2A 4KUMA 3F22A 2OTLI 2VXZA 3CCUI 1YITI 4OJOA 1OB5A 3FM5A 2Y0SA 1OCCH 2DQRA 2WV1A 2RREA 2XC7A 1AMOA 4A6EA 3W2WA 2XTYA 1WJFA 2R7FA 1N07A 3WG9A 3ROUA 1FTTA 2HXIA 3E6BA 4LD5A 4RGUA 4CCOA 3O8HA 4RCZA 1K73D 2VQGA 3ZPLA 1ZN2A 2LY1A 3I5UA 3JRCA 1VNDA 1Z3XA 1OFLA 2VPRA 2ZBKA 2DXIA 4E7ZA 2XHKA 2HU9A 3BG6A 4NB5A 3QFRA 2LR8A 3CUQB 5FFZA 5K1YA 1MH4A 2IBDA 2F4MB 1FDRA 4I7HA 4GGGA 2PX9A 5GAGJ 3KYLA 3L2RA 1FNBA 3GIRA 1NDHA 3QQAA 1QA2A 1OQYA 2UWMA 4UUSB 4OIOF 5GV7A 4XORA 4WK8F 4B1RA 1J9IA 3K0LA 3O6BB 1GQ8A 5FKOA 4J0QA 5EG0A 2IQ7A 3QAHA 3SFZA 3UR3C 3RKQA 3K10A 4EM0B 3MMYB 1O3RA 1IDKA 1RESA 2FOWA 2MC3A 2XAUA 3FHZA 5FIUA 2BM4A 3OSGA 1RMGA 1KU3A 3QPLA 4OU0A 2FUG2 2E19A 3N05A 4PFOA 3CCUB 1YITB 1SMTA 3U6BA 2LRDA 1FRNA 1QGPA 2ID6A 5D5VB 2DMUA 1EH8A 4UB8C 3W6KB 3FWEA 1IRGA 2HDCA 1VQNI 5GPAA 4L9NA 5C4JJ 1ZG3A 3MZHA 3IWFA 1KZHA 4UUTA 1E62A 1BOBA 4FX4A 2DA1A 1XGMA 2DFEA 2GIZA 1PDNC 2P7CB 2ZTNA 1OCOH 5B3SH 1R1TA 2OC6A 1HSJA 1U2WA 3GZ6A 4ENJA 4HQEA 3WBJA 1IN5A 1W34A 2NSTA 1D1CA 1JUMA 3S32A 2IA2A 4U0YA 1LM1A 1KCDA 1ULYA 3SEZA 3ASNH 1FC3A 2RQQA 4N4NB 1SC7A 1VQKI 5ICFA 3DDYA 1OB0A 2RV8A 1ONVA 3CUQA 1T56A 2Q6OA 2YX4A 3S3OA 3JRFA 4ZDOA 3ES9A 1EE6A 4B47A 5HDNA 3DWLE 4XSXF 4A93J 1KK3A 1G3YA 2EIJH 3FK6A 2O7OA 5HLIA 4Z4VA 5EEHA 3DBHB 1U5TB 2PMHA 5LEJA 5TY0A 1BN8A 5A89A 3RCOA 1QPMA 1LVAA 1WJ5A 3TDZC 3WTWC 4YG2F 2QTZA 1QVGB 5IYPA 1YX3A 5F1RA 3C1DA 1R5ID 1X3ZB 2IAIA 2CQQA 1JE8A 2YUHA 2P6SA 2HFHA 1JT6A 2HCJB 3B8YA 2QM3A 4G8XA 9ANTA 2ZJQF 2CMPA 2A6EF 1E0EA 4XLHA 2Z2SB 1X2NA 4NQWA 3SEJA 1UB9A 2QYUA 4XKBA 2ID3A 3RPUA 2EA4A 4XD7A 1N0VC 1T38A 3L00A 5IT9Z 5IYWA 1OFEA 2X1EA 2NTPA 3RIQA 3OYKA 2PIAA 2ZJ2A 2STTA 4WQMA 1ZRDA 1SD4A 4ETSA 3PFIA 5DSZA 5FD5A 3SZPA 4UB6C 1ZRCA 4P55A 3BJ6A 4ZYGA 1QQ1A 3N4MA 4L5EA 1Y56A 2M8GX 5DS9A 3PJRA 5HODA 1JI8A 1QQIA 2Y2ZA 2O3FA 3OMYA 2GK6A 4G7ZF 1R5OA 4EMSA 2XIGA 4HAMA 2COMA 4LFUA 4J01A 5B1AH 3OYJA 3E20A 5H6RA 3HKZN 1LE8B 3QU3A 2KJCA 4OAYA 2FMLA 3DTEA 3QRFF 5CVJA 4EJOA 2ZXWH 1I39A 3CMMA 4BQOA 1MRZA 2OD5A 1HDDC 2DFFA 1FSHA 4MQVA 3CTAA 4OOSA 4YFOA 4WXDA 4RGXA 2AO9A 2VKEA 1MMNA 2RQPA 3FXRA 1TVCA 3AK5A 3W3CA 3G4SI 1TLLA 3IRQA 2KLOA 4Q48A 2FF4A 2V1XA 2KDZA 3TOBA 1ZM4A 1FBUA 5FKNA 5CQGA 5LRSA 4RDKA 2C77A 2QA4B 1FIPA 1X1AA 5CQEA 2QQ8A 5THXA 4KT5C 4GFBA 1JA0A 1XG1A 3RY8A 2LDUA 1G7RA 2R7XA 1JXSA 3CCJI 1TYXA 3ABLH 3OYMA 5TR9A 3HL2A 2DA6A 1RUOA 4IOAF 1YHQB 3ASQA 5EJCA 2M5WA 4XSZF 4Z1MA 1MSEC 3OP1A 3PNYA 3HOSA 5KW9A 1D1BA 4YZAA 2VBYA 3ASSA 2HMAA 1SFOJ 3SUCA 3C2GA 3LSRA 2XNCA 1YJ9I 3EETA 4E7LA 3M1CA 5KK1A 4XBFA 3FISA 4OZYA 4KA4A 1FT9A 4E0FA 2FBIA 3HRSA 1W0TA 2IS2A 4HV6A 3FMRA 3PVDA 2O5RA 5J8FA 2D5VA 1KZLA 2E2HJ 4RD1A 2CQ7A 1OFDA 4EM2A 1EFRA 4RM0A 1Q81D 3LSJA 3RQ4A 3LVBA 4KN7X 4CQJA 4QV2A 1L3LA 4A0XA 4ANJA 3C18A 3GTGJ 3W6JB 1ELOA 2OBSA 4WWVA 4Q4ZF 3NRVA 4IHXA 3LQRA 4P3YA 4B44A 3ZZ0A 4M9ZA 2P5LC 2Q6IA 3GEZA 3F6VA 3LYCA 4KFCA 1ZHFA 1D5YA 4CH7A 1W5SA 3F8FA 1SD7A 1FYLA 1W5TA 1PXZA 3LL7A 2ZXIA 1FMWA 3OY9A 3PSSA 1AIRA 4YIRX 3BZCA 3IC7A 2V7WA 4X0CA 3HRTA 1H89C 2OZUA 1GAWA 4QVAA 3AG3H 1XTAA 4LIUA 5IYBJ 1BR4A 3CD6B 3BH4A 5J4VA 2IXSA 2XGCA 3LA3A 2OQRA 2ELHA 3RKXA 1EP1B 2ESNA 3SDGA 4V19K 5IP9J 2L02A 5JHFA 3MAJA 4PC2A 3BG3A 3AVYA 1HLVA 2YX7A 5ILUA 4R8HA 4B8XA 1EH7A 1YW8A 1OMIA 3BOQA 1IW7F 1TYWA 2XPWA 2FMYA 5DV5A 4QTRA 3V8KA 1YIJI 4II3A 4QWQA 3VMWA 4UAJA 3HZJA 4AIHA 5E3NA 1PKVA 1QFZA 1NB0A 3DPUA 3RKYA 3JQQA 1GHCA 1Z77A 3HAGA 1VQ7B 2CYYA 3GQ7A 3GFJA 4U0WA 1MJAA 5HOOA 3ZQCA 5IYCJ 1UD8A 4EGZA 4WWCA 1XMKA 1SVLA 3F23A 3I3LA 2QDXA 2ZNZA 3ERMA 1R5BA 1YX2A 3A3BA 1MMSA 4I01A 1HA3A 3A02A 4G1VA 4IHTA 3CC2I 4XRMA 2FX0A 3H94A 4ZYHA 3IAS2 3I59B 2EV5A 3LSGA 4IPAA 2CQNA 3CJTB 3K70D 1RZ4A 3IRRA 2ZJRF 3U6KA 5TV2A 1IO2A 3BG7A 4ABZA 4DGWB 2WADA 3ZOBA 4HDVA 4FCYA 3QFCA 1L1IA 1O3QA 2DU9A 1XQBA 1P6RA 1LDKB 1WP6A 2ZL7A 4UV9A 2WJYA 3TO7A 3HUGA 3PA1A 5FA6A 5E3LA 3ZBTA 3U9GA 1YW9A 3U2RA 1I6HJ 4L0ZB 3AG4H 1ETOA 4XN3A 1WJAA 2XB0X 2O8KA 2ZL6A 2FX3A 4GDFA 1SFKA 2N8GA 3BQYA 1E3PA 1V0FA 5KCMA 1DGRM 3KPHA 3HSEA 1MBFA 2MSYA 2V7FA 4EJTA 2XRLA 2H27A 3J81k 3BZ6A 4RJLA 4MO7A 2R5ZB 1UG2A 2EV0A 3CF2A 4N0BA 2NS7A 4RLQA 4W97A 2VNHA 2YWFA 2DERA 1A04A 4KYWA 1TT5B 4PDKA 3VSVA 2QYOA 1VQ4I 1ZKGA 4Q5SF 1V3FA 4QPOA 1DU6A 2F43A 5BPDA 3CMYA 4WF2A 2B7CA 2GXGA 4HDUA 1O7FA 1RPWA 4GYGA 1OKRA 2ZXHA 3NQOA 2MH9A 1WI3A 1WH5A 2EQRA 1QRYA 2Y9YA 3EQOA 1K79A 3HGYA 4Z4TA 4IQJA 2IGOA 5FROA 2CK3A 2L4MA 3CCYA 3HHHA 4L9TA 2L0KA 4XNFA 2WZPP 4G5GA 2KIUA 4LJZF 1W0JA 4ZTFA 1SD5A 2CRGA 3CRZA 1ZG1A 2VL8A 3PM1A 4RB0A 4XQFA 2W4SA 4ZZLA 2E5ZA 1TQIA 3WTXC 2XSDC 3OW7A 2QBYB 3DP7A 2RC6A 4V2FA 1FRQA 1QHGA 2W48A 2XAGA 1VQ9I 3LAPA 3Q9VA 5AONA 2XGDA 3L09A 4CUGA 5GADJ 4IRHA 3M7GA 1H9GA 3O8GA 4XR6A 4BQAA 3TO9A 2UVFA 1BI2A 1TWAJ 1VTNC 3ZQHA 3DQVC 4PFPA 5HLGA 3JW4A 5H6QA 3BH6B 3MD2A 3VSKA 3FXOA 2VE8A 3ONQA 4D9JA 1N77A 5EG0B 1O88A 4RDJA 4J19A 4OJ6A 3J7AY 4KKUA 3ZMUA 3MQ0A 3PETA 2D45A 4LG3A 2I10A 2NYXA 3K7AJ 2FQ3A 2Z16A 1I3QJ 4P96A 3OYNA 1LJ9A 3RTRA 4H9GA 1B8IA 4RM3A 2L7ZA 3IV5A 4E7JA 3CMAB 2Y30A 2HOTA 4BBSJ 2OU2A 1K4TA 1PJ7A 2A6TA 4TN1A 3IH2A 4N9HA 2HWVA 2Y31A 1BQEA 3OYFA 1FZPB 4YDTA 2BGCA 3FPKA 2UV1A 4EJWA 3RKWA 5K5QA 5CVRA 4N3NA 5JHUA 1XS9A 1VQPB 3I55B 2ZBVA 2F5EA 1D0YA 2HVSA 3LQQA 5F4MA 2DCEA 4Y3OA 1EFUA 2MYSA 2V6CA 1QCXA 3Q39A 5IOZA 3HOTA 5FLVA 1WQ2A 1TQMA 2X9DA 5IP7J 1HVXA 4RM2A 1O8KA 3KRGA 4QLCU 4XL9A 5L3BA 2VXDA 4RS8A 3FM3A 3PO3J 2CGPA 3ZPNA 2XSJC 2BN4A 1JGSA 1U9NA 2Q0OA 2NTQA 1HKQA 2VPLA 2FRHA 1ETQA 2B5OA 2J5OA 1X58A 2F2EA 1S72B 1XMXA 2OK7A 2JJ7A 3A0BC 1WWXA 2K85A 1MBGA 1PUFA 2PJRA 2WAFA 4YEJA 3WU0A 2Z6BD 2WB1N 2RNJA 4G9YA 4PZJA 1B23P 1UFMA 1M90D 1B72B 4PC3A 1W36C 4U9UA 2L54A 2QLZA 2VBEA 1TC3C 3FIWA 2H1KA 4Y7NJ 1LLZA 4P6VF 1QUFA 3ML3A 4BXUA 3CJNA 4ZC3A 2IS1A 1P4XA 4HE5A 1IB0A 4YIIA 3I56B 2EIXA 3AVUA 2BVMA 4IKFA 2X1DA 2R7ZJ 4OJLA 1H9TA 2OTJB 3VDXA 3K4KA 5A88A 1KYWA 3KYCB 1WJBA 1F60A 3OS0A 2DCUA 1FSEA 1DDIA 4HBLA 1XCVA 2KJBA 1P7IA 1W35A 2PMDA 2V4JC 3NWSA 4CXFA 3V7SA 4BJTA 1I18A 4NC8A 5GAHJ 1E63A 4F93B 1J2XA 3FBNB 4XKCA 2FXAA 4A6DA 2L7FP 3SJPA 2W6IA 1IGNA 4FETA 1QX4A 2JPCA 1MMDA 3VO1A 1EA0A 4RGRA 3KCCA 4EW9A 3F8MA 5LRRA 3I4MJ 1LDDA 1BI1A 2F5DA 4EATA 3OS2A 1TYVA 5BQTA 2KIFA 4S04A 2BPOA 4C3IJ 4PC1A 1R7JA 4M72A 2RGVA 4DYQA 2BV3A 3DKWA 3AFHA 4I0BA 2HEOA 3HXLA 4HA8A 1R49A 4XN0A 4P6YA 5BSYA 3TBIA 3GTKJ 4XOTA 4ZYDA 2DY1A 1QA1A 2JZYA 1EA3A 2VC0A 4AVPA 4LLLA 2HZDA 3S8PA 2QQBA 2C2WA 3RZDJ 3F8NA 1VQMB 4LC0A 5LBQA 1W2BB 1DGWY 2XRNA 4YELA 3HRUA 5B1BH 1CLWA 3U1DA 1S6LA 3VYSB 4X06A 4ZGQB 2VBTA 4ZZDA 4HSTA 1T6SA 3TDUC 3JURA 4A3MJ 2VKVA 2VT3A 1N05A 2R7OA 4P2NA 4YAOA 3FJOA 1MBHA 2I5UA 2K7LA 4L18B 1F1ZA 1WDTA 1OGMX 1IJEA 2GM4A 3HYIA 2WSSA 4ZCLA 2IGNA 4BY1J 2LOOA 3W2FA 3ECOA 1F5TA 1ZAOA 1CQXA 3WHCA 3CPXA 3S16J 2DN0A 1VHOA 1RKTA 1HW2A 2E60A 4M6VA 4L0YB 1K61A 2R0QC 2X3HA 3S93A 3OIPA 2XAJA 4JX5A 5D5XB 5J40A 2O6WA 2H1LA 2Y9ZA 2WAQN 4H0EA 3PNTA 1E2XA 4BE0A 1SFXA 1IDJA 1UD6A 2ZITA 2K9NA 5H20A 4S0HB 1XSXA 1VQ7I 4RGSA 2BXYA 5C4XJ 3C7JA 4RB1A 4M3EA 1K6OA 2O9LA 2EIKH 3E5QA 2COBA 4E7IA 2QZ8A 4LLNA 4R1HA 5C1CA 4DQLA 3CC2B 3ZMDA 1XDUA 3ZMTA 4M74A 4D5FA 1TP4A 4KH3A 2BM7A 2H09A 1YOVB 2LKXA 1WSVA 2OTLB 4CYCB 5F4OA 1MNDA 2QUFA 1P9QC 5HDKA 1JTXA 3HOWJ 2G7UA 1LFPA 2XPVA 4YALA 2VJ4A 3TL4X 2FNPA 4YAWA 1LEBA 4RMNA 1OPCA 3K6GA 4RLFA 3LSHA 3CCEB 3GLXA 4FT8A 2R5ZA 1X0CA 5DTDA 3EUKL 2OAZA 3J81Z 1MJ9A 3R60A 1IDYA 2F1MA 2BEOA 1DP3A 3JQRA 4OZZA 6PAXA 2DMPA 2F5VA 3PUNA 3CCEI 2K3PA 1XB4A 1XD7A 2ESHA 3C3WA 1UHWA 5D6FA 2XZPA 2HDDA 1G3TA 4ENKA 3QODA 2R7SA 3OV8A 4J00A 2PBIA 2OZ6A 4F7ZA 2M9HA 2ZXJA 1Z7UA 2QX3A 2FQ4A 1HBXG 3QE2A 4PSXA 4M71A 4XKWA 3J7AO 2L5QA 2DA5A 1TLHB 2E2IJ 1E1RA 3ML6A 2KRFA 1XMAA 3W2IA 2K9LA 4HIZA 2O03A 2GQFA 5EZHA 4PGGA 5J1YA 3WTUC 4JX4A 1LDJA 1EWYA 1N8RD 4ZTJA 1M1EB 3KLNA 1XSDA 4NDLA 4RLZA 4LK1F 4BU2A 1OFMA 4C2TA 3O3KA 3K1NA 3OJWA 3Q3SA 3VNUA 1BLIA 2Z3YA 3FXKA 4FTHA 3QPHA 2GXBA 4RD3A 5IT9K 4G6IA 1QO0D 1WI9A 4I09A 2XAHA 1D8TA 1WPCA 2M0CA 1K7AA 1QA6A 4FN5A 4I6ZA 2W85A 4I99C 3GX4X 1QA3A 1ZH5A 3BCBA 3G71I 2GA1A 3S3NA 3R61A 2BM0A 3QOPA 3P9KA 3WU2C 2LY9A 5E8IA 2INUA 1VZ0A 4JP0A 3BCDA 2NNNA 4ROXA 3H9JA 1G59A 2CV2A 1VLOA 4DJAA 3Q6RA 1KQ5A 2KZVA 4BDZA 2A07F 1H0MA 3JRGA 4Y9RA 5FNZA 1N06A 3HSFA 3BQJA 3A03A 3H3ZA 1KD1D 1V4RA 2HXOA 4YZ0A 2Y0SN 1UHMA 4EVIA 2X0KA 4OIPF 3ZPPA 3BG5A 1R1VA 2HNHA 4E4HA 2D3NA 1QZYA 1TWCJ 2E1NA 4P9UA 1VQ6I 3WNDA 5K5RA 1FNMA 3OIOA 1KQ9A 1KK1A 2A5WA 3BZKA 3LSPA 1S0UA 1SVOA 3B8HA 1OR7C 3CB4A 1AHDP 1VQNB 2V4DA 1LLWA 3JX8A 1WOOA 4S05A 3OL3A 3JRHA 2B0RA 2GXAA 4ZCIA 3B6AA 1PYVA 1U0JA 2MFZA 2WAQA 3DCFA 4ZV4A 4FE7A 4PUSA 3VMVA 1B4AA 1GV2A 4W8TA 4PJLA 4BEHA 4U87A 3WTSC 3V7RA 1LFUP 2LBFB 1W1WE 3VYUB 1NHCA 4A5MA 2P0WA 4HV5A 1Y1VJ 1WHUA 1W7PB 4CICA 1DP7P 1I50J 1BI3A 1QRCA 3BY2A 2HKXA 2K4JA 3BH7B 1ORKA 4CCJA 2CRVA 2HYFA 5E8GA 4ASNA 2NT9A 4M2LA 3OYAA 4W8SA 1O3TA 4HF2A 3GTLJ 1I1SA 2XT4A 2WY7Q 3D5RC 3GFIA 3WU1B 4LBVA 1UELB 4HF1A 2ACJA 1AOYA 2GLOA 4U4BA 1WFXA 2XROA 4X07A 2ZMEC 1USSA 4Q7JB 3H9QA 2KDOA 4RD2A 3KZYA 1ETVA 1RC9A 4G12A 2L2OA 4XLPF 1QVTA 1MDMB 2D2WA 3EQNA 3HOXJ 3GSIA 3A1PA 1V5GA 5CVIA 2XNDA 2EZKA 2NAZA 2X53S 4P22A 2LBFA 5C44J 1TNSA 3J80K 1KC8D 1IG7A 4PC7A 4MNUA 3P9IA 1JTAA 2P4WA 1J5YA 2ADUA 3P5JA 3OYCA 2R5YA 3PSZA 1G8XA 5LEKA 2RN7A 3HC7A 4W8QA 3IKTA 1ZM9A 1D0XA 3SHFA 1FWZA 3CDIA 1VQLI 4KIFA 1IJFA 5C1EA 1GUUA 1A36A 1XCBA 2OQGA 3PUFA 4HPQA 4JX6A 1QBJA 4IHVA 3QYBA 5HDGA 2VBZA 3SEQA 2R7UA 1S7AA 3OPOA 4U49A 2VT2A 1YRNB 1YLOA 4WZTA 3LOCA 2L3DA 1VQ8I 1R1UA 2DQLA 2ZNYA 4XONA 4LG0B 3GO5A 5GAEJ 2LK2A 3A35A 1ITYA 3SJZA 3IKVA 3HBLA 5HKKA 1IB4A 4MTEA 2QSGX 1NJID 2Z1DA 3L2VA 4YEIA 5DM6F 2ZFWA 2Q6LA 3ONYA 4PJ0C 3KP7A 4XLCA 5J1UA 3E1SA 2V1UA 2I1LA 1LFBA 2JJ2A 1UCRA 2FD5A 3L2QA 2D74A 4TSFA 3PSIA 3CCSB 1HQCA 3GWZA 4FXUA 1U5TC 5F0HA 1FEXA 3SQVA 2A61A 2MLKA 3ZMVA 4BJ6C 2O0VA 3REOA 3KP2A 1GR1A 1YQAA 2O6GE 4UZEA 3FZVA 3AGQA 1AKHA 4FE4A 3MZ8A 2OCCH 1R58A 3VYRB 1AWCA 4MFDA 3KZIC 1MDMA 3N97A 5FRNA 3QPTA 1Z0XA 1G3SA 1N78A 3DKYA 3ZN0A 3ZQ7A 3LA2A 2OV7A 5DCMA 4N3GA 4L5IA 2F5CA 1BR1A 4M3DA 1BJKA 2ISYA 1MGTA 4X7DA 1VQLB 3Q0WA 4BHPA 1ODDA 5AIQA 2HPIA 3ZRGA 1JGGA 1GV5A 1DU0A 2UZKA 2R93J 2EFQA 2HQNA 5IP6A 3PFYA 1WSRA 1J59A 5H2FC 1QVFB 4BPRA 3ZXSA 2KRCA 2ECBA 3JAMZ 2E1MC 2XAQA 3SFIA 5EGOB 2E1OA 5J1RA 3FXLA 1O8GA 4G1BA 4RAZA 1U8BA 2XOKA 1SAUA 5FB2A 4BQQA 2IA1A 4K1XA 2CU7A 4YFNF 4CDGA 1Z67A 4XLEA 3MHPA 2PMZA 4ZDPA 2F4NA 4PMHA 2BX6A 2EFNA 3SY2A 3AKZA 2XTXA 1V0EA 3A4CA 1UG0A 3OYDA 1CNEA 1ZTRA 3QYFA 1HA8A 5LGNA 5F0CA 5HLTA 2CW8A 2R3SA 3MKYB 2ZMEB 2JPBA 3F9KA 5GPCA 3WE3A 5K7ZA 3L1PA 2BY3A 1COWA 1NBMA 3JQPA 2GREA 2TRTA 1BW5A 4B3FX 2JA5J 1QZZA 2BSAA 1WSUA 2BW3A 2NPFA 4IX7A 2JA6J 2EZLA 4BKXA 4UZFA 2F48A 3PA2A 1STZA 1SVMA 3RPUD 3BTCA 4HF0A 4OWRB 3CF5F 1LQ1A 1OB2A 4NK8A 4QUZA 2AHOA 4W1UA 4EV0A 4A3LJ 4BXXJ 1OISA 5CYVA 2QGUA 3T51B 2BSPA 1Z05A 1AA7A 3T53B 4Z06A 1ZK8A 2DA2A 3DU5A 3DBLB 1IXRC 3AL0B 1MABA
chains in the Genus database with same CATH topology
1MMAA 3FY3A 2Z16A 3IP4B 1WTHD 3OYNA 3RTRA 2CV1A 4HSRA 4RM3A 4JOMA 1IRXA 1QU3A 4GQNA 4B43A 3DKXA 1H8HA 1V5FA 4LIVA 4E7JA 3BCFA 4BS9A 2HVRA 2W7NA 4NQWB 2V7QA 2R9VA 3PL8A 2A6TA 3DPLC 5CDFA 2XDVA 3EPZA 2KL4A 2QKLB 3ZR8X 2INVA 3OYFA 4TKOB 4ASUA 3VSUA 1T0FC 1RWRA 2UV1A 2WA0A 5DN6A 2I8DA 2NSPA 2IS4A 1JRGA 1HZEA 5HNHA 1HG8A 3A1YA 2ZZGA 3B4NA 3LMWA 1D0YA 2HVSA 3OE7A 2CS3A 3OS1A 4YXWA 2DCEA 4Y3OA 2BW3B 1O8HA 4BE1A 2MYSA 1UD3A 4MLOA 3BC9A 1UD4A 2ZFUA 2BVLA 2O1DA 2XF6A 3HOTA 4F91B 2HPMA 1HVXA 4RM2A 1O8KA 3L2WA 1WJEA 4Z06A 3KRGA 1UAAA 4XL9A 3ZIAA 2VXDA 3OR1C 1VLYA 4G7XA 3CESA 4PK4A 3ZPNA 1O8IA 2XSJC 4BL0B 3HUGB 1MNEA 2NTQA 2VPLA 2WJVA 3PSFA 2JIZA 2W6JA 1Z7LA 2PJRA 1OLTA 2WAFA 4YEJA 1OHHA 1W36D 2Z6BD 1LKXA 4DBRA 4HNUA 1W36C 4YRVA 2XZLA 2VBEA 1K6YA 3FHNA 3A3GA 2K9MA 1WMRA 4ZYAA 3A2KA 4XOPA 1KTWA 1MMGA 1K5CA 3ZCOA 4ZC3A 4KJZA 2IS1A 3MKZA 2NZMA 3K4JA 3K4MA 4BQNA 2HQAA 3H5NA 2XF7A 2BVMA 4IKFA 2X1DA 4OJLA 3HPGA 4I84A 1KCCA 3VDXA 3K4KA 1BHEA 4DNRB 3QYEA 2WY8Q 1X1DA 5LD2C 1WJBA 2NT6A 4U7BA 3HKZA 4QPQA 2Q1ZB 2KHMA 3OS0A 3GQ8A 3FDYA 5FL7A 4L8JA 2V4JC 3NWSA 3FKSA 4G6TB 1X19A 4BJTA 3C2HA 4CA0A 4NC8A 3I9V2 3OL4A 1I18A 2O17A 1J09A 4CCNA 4F93B 1TZLA 3FBNB 4XKCA 1E79A 1DBOA 2MC4A 3UNGC 4CCKA 4CZCA 2W6IA 4FETA 1MMDA 1NG6A 2VBMA 2XF5A 3DPTA 2DOAA 2X6WA 2CFOA 4EW9A 2DJIA 3LSKA 1BMFA 4MXNA 3OEHA 2AQFA 2M4KA 4AVZA 4EATA 1ERDA 4KKTA 3OS2A 3GQAA 3PNVA 2R4GA 2HVQA 4KKSA 3AFHA 4E7HA 2R7QA 3BC8A 3HXLA 3EUHC 4XN0A 3TBIA 3LSIA 5TGTA 2CV0A 4XOTA 2VXZA 4DOZA 3OEEA 4OJOA 1X1CA 1EA3A 4LITA 1T5EA 3S8PA 2HZDA 2Y0SA 2RREA 1MABA 2GOMA 1PE9A 3V42A 2XC7A 3W2WA 1WJFA 1DGWY 2NOJB 2K5CA 4YELA 4YZQA 4Z05A 3VYSB 3OOUA 4CCLA 2LZJA 4HSTA 4CCOA 3JURA 2VQGA 2LY1A 3OYEA 2R7OA 1Z3XA 3D5LA 1OFLA 2VQCA 2DXIA 4XKVA 4E7ZA 2HU9A 3EUAA 3BG6A 3G2BA 2M4GA 4BACA 3VWBA 1OGMX 3K4BA 2Q2EB 3HG9A 2WSSA 2IGNA 2LOOA 3KYLA 4H4KC 2UUZA 3L2RA 4D1QA 2QE7A 4Y33A 4BE2A 3ZGKA 1H80A 4DK0A 4F3QA 4YZXA 2UWMA 2VB6A 2M7AA 4AYBA 2E60A 2KVOA 1S9HA 4XORA 2F4IA 2X3HA 2VQLA 3S93A 3GVJA 1GQ8A 3OIPA 4NC7A 2IQ7A 4B3XA 3M8JA 3UR3C 1D1AA 3K10A 3PNTA 3MMYB 4C2UA 4BE0A 2XAUA 1IDKA 1IDJA 3BLYA 1UD6A 1RMGA 2FUG2 3N05A 4PFOA 2GOXB 4X0GA 4F52A 2LRDA 2M5SA 3H0DA 4JMQA 4E7IA 3IAM2 3OIQA 2ELJA 1E1QA 5C1CA 2W1OA 1Z3YA 3MKWB 2WBMA 1BOBA 4BUPA 1QCXA 1O8EA 2VIXA 3DU6A 2ZTNA 3IUOA 2OC6A 3AL0B 1O8FA 4PJNA 1MNDA 1P9QC 2NSTA 1D1CA 3S32A 3ZQQA 2DT7B 2V26A 2PECA 1KCDA 1LFPA 3SEZA 2RQQA 4N4NB 3DDYA 3WQZA 2WAEA 2VJ4A 3TL4X 1OB0A 4RMNA 4HNTA 1DBGA 3K6GA 4HG2A 4RLFA 3LSHA 4II2A 4CSWA 3S3OA 4ZDOA 1EE6A 1X0CA 4B47A 2W82A 2VKHA 3DWLE 3EUKL 3LFUA 2PYHA 1W9XA 3NE5B 2D3LA 1LVKA 2F1MA 1DP3A 4OZZA 2X8KA 2X51A 1W0KA 1BN8A 1V5EA 2F5VA 3RCOA 1O8MA 1WJ5A 2K3PA 4BDYA 1YX3A 1PLUA 2XZPA 2R7SA 3QODA 4J00A 3KX2A 2QX3A 3B8YA 2QY1A 2CMPA 4PSXA 4XKWA 4F92B 3DTKA 4B48A 1E0EA 2L5QA 4XLHA 2Z2SB 3L2UA 1E1RA 4R79A 4XKBA 4DNTB 2ZZQA 2K9LA 4HIZA 4XD7A 4GRIA 2VBKA 1BPLA 2X1EA 2NTPA 4C30A 4NNJA 3OYKA 4XLAA 1QJVA 1DQUA 4ZTJA 3PUBA 2V9KA 2PJRB 2LYCA 3W2AA 4BU2A 2XZOA 2KP6A 1OFMA 4C2LA 4KITB 4C2TA 2GJPA 1Y56A 3PJRA 1O8DA 2M0MA 1JI8A 2JA2A 1BLIA 1IA5A 1UD2A 3OMYA 2GK6A 4G6IA 1FMVA 4DIQA 1WPCA 3U21A 3T56B 3OWTA 4J01A 5FRMA 3OYJA 1QHHD 2V31A 3BCBA 3S3NA 3CJRB 5HNFA 3G05A 2UVEA 2CH0A 4URRA 4OAYA 3DTEA 4Y4RA 3CMMA 4BQOA 2INUA 1VZ0A 3SYTA 3BCDA 1KMHA 3H9JA 1G59A 2CV2A 4ZDLA 1MMNA 4F55A 4DJAA 2KZVA 4BDZA 1VBLA 3W3CA 1YX5A 3RSNA 2KLOA 2IS6A 4E7KA 1MW7A 3DEEA 1X4OA 5CQGA 2JSPA 4YZ0A 1X1AA 5CQEA 3ZPPA 3D5SC 2KMUA 3BCAA 2HNHA 4E4HA 2D3NA 4PSWA 2R7XA 1NRKA 1RU4A 3OYMA 2A5WA 3HL2A 2ZZFA 1OR7C 2V4DA 2X6YA 4Z1MA 3OL3A 3CJQB 1FX0A 1X4PA 3PNYA 3HOSA 1PYVA 1U0JA 2MFZA 2WAQA 4JQFA 1D1BA 4YZAA 4PUSA 2MABA 2E1MB 3VMVA 5AMVA 3SUCA 3C2GA 4W8TA 4PJLA 4BEHA 4U87A 4E7LA 2V1NA 3M1CA 3GVKA 2LBFB 3VYUB 1NHCA 4OZYA 4KT6A 4P5OA 2P0WA 4TT3A 4E0FA 2NTBA 2IS2A 3DLAA 1N75A 2O5RA 2CUJA 2CUZA 1KZLA 3VR6A 5IK2A 4E6KG 1EFRA 4E7SA 4CCJA 2L9NA 3RQ4A 5KNLA 2HDWA 2NT9A 1K28D 4ZJZA 3OYAA 2QKMB 4W8SA 1Y6IA 4ANJA 2WY7Q 3D5RC 2CW7A 4B44A 1UELB 2EWEA 2LREA 2X85A 3SDBA 3H5AA 1WFXA 1X1BA 2XGJA 4U4BA 4CH7A 1E43A 1WJCA 3H9QA 3OYHA 3K4LA 1NG7A 3LL7A 2ZXIA 1FMWA 2VJIA 2KDOA 3H9GA 1PXZA 3OY9A 1AIRA 4G7WA 4ITVA 2L2OA 3EQNA 3OOCA 4AU7A 4LIUA 2GJKA 1BR4A 1E3XA 2BOLA 1V5GA 2LC2A 3BH4A 2XNDA 3GRHA 2IXSA 2X53S 2KRHA 4P22A 5HVQC 2LBFA 2JUGA 1VF7A 2O04A 5JHFA 4PJJA 4FASD 1JTAA 1WJDA 4BGDA 3OYCA 2X1CA 1G8XA 3GBGA 3GQ9A 3CZ6A 3HC7A 4W8QA 2F6CA 1D0XA 4IQ4A 3VSTA 2KPMA 3GVLA 2R7TA 2WB1A 3T9GA 5C1EA 3OYLA 4HPQA 1TT0A 4II3A 2DT6A 3QYBA 3SEQA 3VYTB 3OPOA 2ZSIB 2R7UA 4U49A 3VMWA 4OAZA 2ZSHB 4XONA 2L7KA 3AL0C 1I8DA 3A35A 2R7WA 1PKVA 3LSMA 5HKKA 1IB4A 3DPUA 2Z1DA 3L2VA 3TMOA 4B3GA 3HAGA 4BXFA 4XLCA 3GQ7A 3E1SA 4TSFA 5HOOA 2IGKA 3K4NA 3L2QA 1UD8A 2JJ2A 3PSIA 2PYGA 3DTIA 3QOEA 4FXUA 3I3LA 2R7RA 2O0VA 4BJ6C 3A3BA 1R6RA 2ZTGA 4HWVA 2JVGA 3H94A 3CP2A 1ZELA 3IAS2 3LSGA 3VYRB 3K70D 5FRNA 3BG7A 1N78A 3DKYA 2WADA 4DGWB 4HEA2 2OV7A 2W00A 2E1BA 1LDKB 1WP6A 1O8LA 1BR1A 1Z21A 2DIEA 2WJYA 1KONA 1GLNA 4HRIA 3OYGA 4NUBA 4NK6A 3FKJA 5CKTA 4XM3A 5KHDA 4DBQA 2JDIA 1D0ZA 4PJMA 2HPIA 3ZRGA 4CCMA 4XN3A 2L9SA 1WJAA 4KISA 1SKYB 3UW0A 3PFYA 2E5NA 1SFKA 4XLFA 1V0FA 5KCMA 3ZXSA 1DGRM 2KRCA 2JVHA 2VJ5A 2JJ1A 4C9YA 3FPPA 2ZZEA 3ZSCA 2V7FA 2E1MC 2QXZA 4P1WA 2V6EA 4XMYA 1O8GA 2ODLA 3S3MA 3CF2A 2XOKA 1SAUA 4RLQA 2RNGA 3H5RA 4BQQA 4Z03A 2KQRA 2R7VA 5CPRB 5LFAA 2VKDA 3OAAA 3VSVA 4OJPA 1E3ZA 3VSLA 2WPDA 3OYBA 4QPOA 4XLEA 2PMZA 2F43A 4ZDPA 4PMHA 4N4OB 1VJSA 3KEWA 3GQBA 4DK1A 3WWGA 1T95A 3AKZA 2ZXHA 3W2VA 1V0EA 2X6XA 1UG0A 3A4CA 4BJ5C 3OYDA 1H8EA 3QYFA 3EQOA 1HA8A 4IQJA 4OJ5A 2IGOA 5FROA 5HLTA 2CK3A 3MKYB 2CW8A 3JU4A 3HPHA 3LNNA 3K70C 3LMMA 2MD0A 4XNFA 3F9KA 2WZPP 2O0WA 3CP8A 1COWA 1NBMA 2OUMA 4ZTFA 1W0JA 2Z8GA 2VL8A 1UD5A 4XQFA 4B3FX 2W4SA 2E5ZA 3OW7A 1O8JA 1CZFA 3FBIB 3OFNA 1QHGA 1PJRA 2HLDA 3OYIA 2BW3A 2LY2A 2GJRA 2GK7A 4IX7A 3KEYA 2VLAA 3SZGA 4CUGA 1BR2A 1OOCA 3B90A 4XR6A 2AQEA 2VASA 2UVFA 3K4CA 3RPUD 4UZUA 4OWRB 4IZZA 1OGOX 4NK8A 2VQHA 3DQVC 4PFPA 2LH9A 2M3AA 3MD2A 3VSKA 3ONQA 4BEHB 2VJJA 4D9JA 1N77A 3T51B 1YE9A 1AA7A 3NWTA 1O88A 2M7BA 2BSPA 4W8RA 3T53B 3OR2C 3E0JB 3DU5A 3H35A 3J7AY 4KKUA 2IGMA 4MR0A 4OJ6A 1XG2A 4LG3A 2LG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8D A;  4Z05 A;  3FY3 A;  4YEL A;  4YZQ A;  1IA5 A;  1IB4 A;  3JUR A;  1OFL A;  4XLC A;  3GQ7 A;  4XKV A;  2UVE A;  4URR A;  2PYG A;  1OGM X;  2O0V A;  2INU A;  4HWV A;  2INV A;  3VSU A;  1RWR A;  1H80 A;  2NSP A;  1JRG A;  4YZX A;  1VBL A;  1HG8 A;  4XOR A;  3B4N A;  2X3H A;  1GQ8 A;  3LMW A;  2IQ7 A;  1O8H A;  4YZ0 A;  1O8L A;  1IDK A;  2O1D A;  3ZPP A;  1IDJ A;  1RMG A;  4NK6 A;  1O8K A;  4XM3 A;  3KRG A;  1RU4 A;  4XL9 A;  4XN3 A;  3UW0 A;  2X6Y A;  4XLF A;  1O8I A;  5C1C A;  2NTQ A;  3ZSC A;  1QCX A;  1O8E A;  4YZA A;  3VMV A;  5AMV A;  2QXZ A;  3SUC A;  4W8T A;  4XMY A;  1O8F A;  4YEJ A;  1O8G A;  2ODL A;  2NST A;  1NHC A;  4OZY A;  4Z03 A;  2NTB A;  2VBE A;  2PEC A;  1KCD A;  3VSV A;  4OJP A;  1WMR A;  4XOP A;  1KTW A;  4XLE A;  1K5C A;  1DBG A;  2NZM A;  4PMH A;  2NT9 A;  1EE6 A;  4OJL A;  1X0C A;  4W8S A;  1KCC A;  4I84 A;  3WWG A;  2PYH A;  1BHE A;  2NT6 A;  2X6X A;  4OZZ A;  3EQO A;  2EWE A;  2X85 A;  1BN8 A;  4U4B A;  3GQ8 A;  4OJ5 A;  1O8M A;  1PLU A;  1PXZ A;  4XNF A;  2O0W A;  2VJI A;  2O17 A;  1AIR A;  1DBO A;  2Z8G A;  4XQF A;  3EQN A;  2QX3 A;  1O8J A;  3B8Y A;  1CZF A;  2QY1 A;  2VBM A;  3GRH A;  4XKW A;  2X6W A;  4XLH A;  4EW9 A;  2O04 A;  4MXN A;  4AVZ A;  3GQA A;  1JTA A;  1OOC A;  3B90 A;  4XR6 A;  3GQ9 A;  2UVF A;  2VBK A;  4W8Q A;  2NTP A;  1OGO X;  4NK8 A;  4XN0 A;  3VST A;  4XLA A;  1QJV A;  4XOT A;  3T9G A;  4OJO A;  5C1E A;  2VJJ A;  2BSP A;  1O88 A;  4W8R A;  1OFM A;  4U49 A;  4Z06 A;  4C2L A;  1PE9 A;  4MR0 A;  4OJ6 A;  3VMW A;  1XG2 A;  4XON A; 
#chains in the Genus database with same CATH topology
 1MMA A;  3CLO A;  3FY3 A;  2LF7 A;  2ZME A;  4IL6 C;  4RB3 C;  4A12 A;  2CV1 A;  1BX1 A;  4JOM A;  1WTH D;  2DOG A;  4AF6 A;  5ICE A;  2QQA A;  3DKX A;  2DMN A;  3K1M A;  1JUP A;  3H1C A;  1LEA A;  2E7X A;  4BS9 A;  2OK8 A;  1QVU A;  5FO0 A;  4PCQ A;  5B5E C;  2QZA A;  3PL8 A;  2OJE D;  3DPL C;  3GTM J;  3CDL A;  2PMZ N;  5CDF A;  1JHF A;  1FP2 A;  3E7L A;  1Q1H A;  2KL4 A;  2QWW A;  4AF7 A;  4C0S A;  1RR7 A;  5K7F A;  4TKO B;  1PP7 U;  3JRI A;  3ZN1 A;  3VSU A;  1RWR A;  2NNY A;  2WA0 A;  1SM4 A;  5F4J A;  2I8D A;  2NSP A;  2IS4 A;  1YJN I;  2EFG A;  3WGH A;  1HZE A;  3S14 J;  1HG8 A;  3KEQ A;  2VI6 A;  3CCM I;  3RI4 A;  3NAU A;  3TOA A;  3OE7 A;  2A6H F;  3M8E A;  3OS1 A;  1EF4 A;  2BW3 B;  1ACI A;  4BE1 A;  5EEA A;  1DDG A;  4MLO A;  1Y8Q B;  3JRD A;  1S3J A;  2HTS A;  2BVL A;  1UD4 A;  4X8I A;  1I6X A;  2EWN A;  1Q86 D;  2O1D A;  2EB7 A;  4F91 B;  2HPM A;  1KRH A;  3B78 A;  1A6Q A;  1U3E M;  1Q9S A;  2IOU G;  5CVU A;  1UAA A;  2CC2 A;  3G71 B;  3ZIA A;  1ZLK A;  2VBS A;  4G7X A;  2PE3 A;  2DK8 A;  4OIR F;  4DYR A;  3CES A;  2EFP A;  1RRJ A;  4BL0 B;  2FSW A;  3M1E A;  3PSF A;  4MIM A;  4Z6Y A;  1FJL A;  2W6J A;  1SEU A;  1SAX A;  3GZN B;  3WG7 H;  4KNY A;  1OLT A;  5FD6 A;  1GO2 A;  5GTH C;  1FOK A;  4HNU A;  3CCR B;  4Z2Y A;  4L5J A;  4YRV A;  1P4M A;  3PQK A;  1K6Y A;  1KA8 A;  3GTP J;  3FHN A;  3HOZ J;  5FKK A;  1VQ4 B;  2K9M A;  3ESW B;  1OCP A;  2DFH A;  2NRA C;  3W5H A;  1MMG A;  5B66 C;  1B72 A;  5JMC B;  4KJZ A;  4Z4R A;  1YJN B;  1K5C A;  2VN2 A;  3K4M A;  3ZQF A;  2EH3 A;  2XF7 A;  4G7O F;  3ELK A;  2AXT C;  1XSV A;  2FEZ A;  1LE8 A;  3QYE A;  2WY8 Q;  2X3U A;  2NT6 A;  4U7B A;  1RKW A;  1Y39 A;  2DO7 A;  3M07 A;  2XUB A;  4Y7C A;  3CCQ B;  4A2U A;  2XAS A;  3FMS A;  3ISP A;  3IL2 A;  2XVC A;  3FDY A;  2H8R A;  4K2E A;  1OJL A;  4XLN F;  2CBX A;  3BQZ A;  2FBK A;  1DPR A;  4M6Y A;  1K78 B;  2OBR A;  1TTT A;  1JTY A;  4A3D J;  3CCQ I;  3GTO J;  1TQP A;  1E79 A;  3Q38 A;  4X7C A;  3BWG A;  4MEX F;  2Z33 A;  4CO8 A;  4FHT A;  1NG6 A;  2A05 A;  3A8K A;  1CGP A;  2XF5 A;  5DUK A;  1VQ9 B;  2X6W A;  3U2Q A;  3LSK A;  5A2Q Z;  3OEH A;  4AVZ A;  2OTJ I;  4KKT A;  3GQA A;  2HR3 A;  1OGI A;  3PNV A;  5E3M A;  2R4G A;  1BL0 A;  2QEN A;  1YJW B;  2XT2 A;  4E7H A;  1GXQ A;  3VFZ A;  3SLD A;  2OYN A;  5TGT A;  2CV0 A;  1G4D A;  2EIM H;  5JVG F;  1QGZ A;  4IEJ A;  3H3V K;  5KAF C;  3E5U A;  2ZJP F;  4HYE A;  4KN4 X;  4B09 A;  2J8K A;  2GOM A;  2Y48 A;  5JLX A;  3V42 A;  5ICG A;  1R5G A;  3Q0V A;  3GCM A;  2NOJ B;  2K5C A;  3LFK A;  3BTL A;  5DS0 A;  1IRZ A;  2BXZ A;  3OOU A;  4CCL A;  3BR3 A;  2A68 F;  2LZJ A;  1BJA A;  2A3S A;  2BHY A;  2PG4 A;  2E36 A;  2W25 A;  2NV4 A;  3DXJ F;  3CCL B;  3D5L A;  2XC1 A;  2VQC A;  3F72 A;  4XKV A;  5LGT A;  3G2B A;  2X6O A;  3NAW A;  2DOD A;  4BAC A;  4X6A J;  5GTI C;  3KE2 A;  3JSO A;  1TWG J;  2K02 A;  2NS0 A;  4JYK A;  2BY2 A;  2K3F A;  3GUD A;  2QF7 A;  4D1Q A;  4Y33 A;  2QE7 A;  2C5H A;  2WC2 A;  1BIB A;  3ZGK A;  4BE2 A;  1VFC A;  3G6E B;  3V8L A;  4F3Q A;  4YZX A;  2KVO A;  1QRB A;  2CSO A;  2F4I A;  4EGY A;  3DFG A;  2Q8K A;  1BC8 C;  2VQL A;  3WTZ A;  3L9F A;  1ZGW A;  3GVJ A;  5HLH A;  3SXY A;  4NC7 A;  4AWX B;  4B3X A;  5L3F A;  3G6E I;  1D1A A;  2LP0 A;  3CQZ J;  3LAJ A;  4C2U A;  4A0Z A;  1Q82 D;  2DI3 A;  3W2G A;  1KGS A;  3KL9 A;  5LHI A;  1D8K A;  2GOX B;  2NVU B;  3COA C;  4F52 A;  3B73 A;  4D7M A;  2P8T A;  1V55 H;  2HYJ A;  2ME0 A;  3MZY A;  4CYC A;  1E3O C;  1JB9 A;  2DTR A;  4UXN A;  4JMQ A;  3WYA A;  1QFY A;  3ZZU A;  3OIQ A;  1HOM A;  2W24 A;  3G1L A;  4ESB A;  1I7P A;  1T6Z A;  1E1Q A;  2W1O A;  1Z3Y A;  4TMZ A;  2G7H A;  2DA4 A;  3MKW B;  2C4T A;  1VF9 A;  5LHG A;  2HOE A;  1O8E A;  5E79 C;  5J35 A;  3G1M A;  1IXC A;  2OF7 A;  3DU6 A;  1IV6 A;  2BF4 A;  1KQ8 A;  1EZG A;  3F0C A;  3IUO A;  4EJV A;  1D2E A;  4PJN A;  1MBK A;  2CQX A;  1WPK A;  2V7V A;  3KET A;  2DT7 B;  2V26 A;  1VQM I;  3RQI A;  3FKI J;  1NK3 P;  1MH3 A;  1J7K A;  4X1E A;  3A8J A;  2K86 A;  2WAE A;  3MN2 A;  4CYD A;  4U7D A;  4A3F J;  2VYQ A;  3DEU A;  1EFT A;  2RC5 A;  2CQK A;  4HG2 A;  4CSW A;  1GVJ A;  2AXL A;  4II2 A;  2K9Q A;  2MA3 A;  1DUX C;  1EV7 A;  3WBK A;  2KT0 A;  4DZP A;  5F6F A;  1Z6T A;  1B2R A;  2PYH A;  2ICW G;  2KIS A;  3R0J A;  1W9X A;  3J7Y J;  1D5V A;  2D3L A;  1LVK A;  5TIS C;  1LNW A;  2X8K A;  2J8I A;  3CD6 I;  4YAF A;  1V5E A;  4MYU A;  2LFB A;  4RBO A;  4BDY A;  1PLU A;  2O0Y A;  1WU8 A;  2CFX A;  1QGA A;  4EQQ A;  2CND A;  4XRS G;  1ETY A;  1S29 A;  2HKO A;  5L3E A;  2QGG A;  4RPD A;  4A3G J;  1ZGA A;  3MEX A;  1B9N A;  4FIS A;  1KQ0 A;  2YWH A;  4M9X A;  1KJZ A;  5FGM A;  4FK8 A;  1OYW A;  4P1V A;  2IA0 A;  3DTK A;  2O8X A;  1J75 A;  3L2U A;  1U8R A;  4R79 A;  5K7H A;  5ILV A;  2XTW A;  4DNT B;  3H9N A;  1SAN A;  2XEX A;  2ZZQ A;  2LKS A;  3KP5 A;  1XFO A;  4NBS A;  1IRF A;  1AKH B;  4GRI A;  4OIN F;  2M1B A;  3NAR A;  4A3J J;  4C30 A;  4NNJ A;  2DA3 A;  1DDN A;  3PQJ A;  2IEK A;  2UXN A;  1JKO C;  5IOY A;  3PUB A;  1WVR A;  2V9K A;  2Y0M A;  3SLN A;  4M0L A;  2YSR A;  1IN7 A;  3LA7 A;  5DCM B;  3S1M J;  1P4A A;  1TUI A;  2XZO A;  2F4O B;  2IJL A;  2VFQ A;  1IV8 A;  2DYS H;  4WXH A;  4C2L A;  1KU9 A;  4HNV A;  1WKM A;  3R6K A;  1UMQ A;  2M0M A;  1T2K A;  2JA2 A;  3OJX A;  1O8D A;  1UD2 A;  3CLQ A;  4LK0 F;  5DD8 A;  4MHG A;  4NCN A;  3IHU A;  3I0T A;  1EP2 B;  5J8C A;  2EIN H;  2JTV A;  2JSC A;  1LB2 A;  5FRM A;  3MFK A;  1YTY A;  2V31 A;  2UVE A;  5HNF A;  3G05 A;  1HKT A;  3P9C A;  4IJA A;  5E1W A;  5AIP A;  3TGN A;  2QN6 A;  4OPV A;  4Y4R A;  5LGU A;  4B4D A;  1K4Z A;  2OCE A;  2L9V A;  3BPV A;  3QPS A;  2MLG A;  3SYT A;  4LBW A;  3D1N I;  1KMH A;  3TQN A;  4ZDL A;  1ZM2 A;  2X0L A;  1Y0N A;  4F55 A;  2CF4 A;  2CJJ A;  3EYY A;  1XX5 A;  5FKM A;  2V7T A;  2LTP A;  3HM5 A;  1MW7 A;  1VI0 A;  1PJ5 A;  3DEE A;  4M9S A;  1X4O A;  4MFE A;  2JSP A;  3F3X A;  5ICC A;  1WCM J;  4WXC A;  3GFL A;  3EDP A;  2F3L A;  3TW7 A;  2LKP A;  3D5S C;  5L3D A;  3N90 A;  1U9O A;  3CC4 I;  4PSW A;  4C2M J;  1KTV A;  1P7J A;  5EGO A;  2GPJ A;  1VQ5 I;  3JRA A;  3BNW A;  1OFC X;  1YO5 C;  2X6Y A;  2BZT A;  2XKP A;  2FOK A;  2EA2 A;  3CJQ B;  1SKQ A;  1BIA A;  3AST A;  4JQF A;  4RAF A;  2L4A A;  5E18 F;  1QG0 A;  2MAB A;  2E1M B;  1VQ5 B;  5AMV A;  3B82 A;  3ZQI A;  3WE2 A;  2K4B A;  4KT6 A;  5FO5 A;  3DLA A;  4BY7 J;  4ENN A;  3T0Y A;  3MVP A;  1WGX A;  5D5W B;  2CUJ A;  2CUZ A;  3MWM A;  4LBZ A;  5BS6 A;  1F36 A;  3H36 A;  5D8L B;  2L9N A;  3O2P E;  4YFX F;  2HDW A;  5KNL A;  2C5B A;  2RAE A;  5FFX A;  4ZJZ A;  1Z9C A;  2QKM B;  1Y6I A;  1TNT A;  3AVV A;  4HX7 A;  1R22 A;  3F21 A;  1YFH A;  4V2G A;  1ZM3 A;  4M3F A;  4CGZ A;  2DJN A;  2ZBU A;  2O61 A;  2EWE A;  1SMY F;  3FMQ A;  3H5A A;  1X1B A;  2OBT A;  2XGJ A;  2TCT A;  1E43 A;  2B0L A;  3S2W A;  2DAO A;  3K4L A;  3WY9 A;  1NG7 A;  2VJI A;  3H9G A;  1K83 J;  3BG9 A;  4KIB A;  2G0Y A;  2E2J J;  2E35 A;  4G7W A;  2FU4 A;  3P26 A;  3BPX A;  1SFU A;  3A0H C;  2BGJ A;  3OOC A;  1K8F A;  4AU7 A;  1W7P D;  2BOL A;  5DD4 A;  2R7D A;  3ECH A;  1R00 A;  4UVB A;  3OZW A;  1OR7 A;  2PEX A;  2LLK A;  4EEF G;  4FAS D;  1V54 H;  3HDD A;  1D8J A;  3J80 Z;  2YS9 A;  1R9T J;  3F8B A;  3GQ9 A;  5LMZ A;  2YPR A;  3VNV A;  1ZR2 A;  4TMX A;  2D1H A;  2R7T A;  3KIO A;  2DPU A;  2GAU A;  3T9G A;  3OYL A;  3ISX A;  3FK7 A;  2EV6 A;  3RPQ A;  2DBB A;  4Y15 A;  4D7N A;  3LJY A;  2HTJ A;  2ZSH B;  4YIF A;  2STW A;  3AL0 C;  2GA2 A;  2R7W A;  1FND A;  3LSM A;  2DPD A;  3I64 A;  1ZLJ A;  4WCG A;  3G4S B;  3BR1 A;  4L9J A;  3ERE D;  4BXF A;  3ASP A;  2ELK A;  1ZUN B;  4C3J J;  3K4N A;  1S8N A;  3WOD F;  4YHB A;  5F27 A;  4NC6 A;  1POG A;  3DTI A;  1REP C;  1K9M D;  2R7R A;  2VUM J;  1B8I B;  1R6R A;  2ZTG A;  3ONU A;  3V76 A;  1ETK A;  1Y0U A;  3CP2 A;  1ZEL A;  1PP8 F;  4ACA A;  3D0S A;  2MGQ A;  4RD0 A;  3HOV J;  2XB5 A;  2NVQ J;  1T08 B;  2BYV E;  3NEU A;  1GVD A;  3K69 A;  2LSO A;  3KP4 A;  4HEA 2;  4LLG F;  3VOD A;  3I4N J;  2Q6K A;  4IXA A;  4TV7 A;  4DQK A;  4PAB A;  1CNF A;  3WGI A;  4JBA A;  4KIG A;  2RC4 A;  1KQS B;  1T6Y A;  5EMN A;  1YS6 A;  1S72 I;  4NUB A;  1IC8 A;  3FKJ A;  1RQR A;  4IF4 A;  4XM3 A;  2DA7 A;  2JDI A;  5D5U B;  1Y1W J;  1D0Z A;  1I5Z A;  4PJM A;  3HIF A;  4BHC A;  1BC7 C;  4UY8 I;  4I0A A;  4U88 A;  2QEX I;  1SKY B;  2L9S A;  1WOS A;  4KIS A;  3QSY A;  3J7Z I;  4IRI A;  2CO5 A;  3WNB A;  3I1F A;  1HF2 A;  4A5N A;  2VFP A;  2JVH A;  2JJ1 A;  4I98 B;  4C9Y A;  3TED A;  2NVT J;  2ZZE A;  2H6C A;  4IOC F;  3FPP A;  2QEX B;  2QXZ A;  4HX8 A;  2V6E A;  5A2Q K;  2C78 A;  3LO8 A;  4BNC A;  1ZYR F;  3H5R A;  1S4M A;  4P3I A;  2KQR A;  5IYQ A;  1YHQ I;  4UNO A;  2R7V A;  5CPR B;  2Y69 H;  2VKD A;  3OAA A;  4OJP A;  1YW7 A;  3VSL A;  1E3Z A;  2JK3 A;  2WPD A;  3OYB A;  1MSF C;  2VNK A;  2GZW A;  3BR0 A;  3WXM A;  4HQM A;  4N4O B;  3WTT C;  3KEW A;  1IN6 A;  1LUJ B;  2W84 A;  3JTH A;  4A3K J;  1K78 A;  1T95 A;  3GQB A;  3MCA A;  3WWG A;  5A8A A;  5EYR A;  2JA7 J;  1H8E A;  2HI3 A;  1Q7Y D;  3AVX A;  2E1C A;  2CW5 A;  4OM9 A;  4OJ5 A;  4PC6 A;  2IW5 A;  1QZE A;  3JU4 A;  3HPH A;  3F8C A;  3K70 C;  2MD0 A;  1QPI A;  1HW5 A;  4IHW A;  3G73 A;  4X7E A;  2OUM A;  4TMW A;  5HZB A;  1UD5 A;  2EK5 A;  1O8J A;  3S1R J;  5HZA A;  3FBI B;  5KAI C;  4B3A A;  2BE5 F;  4GXO A;  5J4Y A;  1YIJ B;  3FX3 A;  3OYI A;  3QFS A;  1W87 A;  2GJR A;  1HC8 A;  3NB2 A;  2VON A;  5J47 A;  4LBY A;  2VLA A;  1NTC A;  3SZG A;  2HOA A;  1A5J A;  3B90 A;  3LQ6 A;  1YI2 B;  4RAY A;  2H8W A;  3K4C A;  4UV8 A;  1XC5 A;  2JRM A;  3BT9 A;  1I3A A;  5M5W J;  5L46 A;  4I76 A;  1BM9 A;  5FLX K;  3M4O J;  1L0O C;  2M3A A;  4ZH4 F;  1XGO A;  1YG2 A;  3B02 A;  2GQQ A;  5F04 A;  2FA5 A;  1JKP C;  2VJJ A;  3NWT A;  5B6I A;  3JCU C;  1XG2 A;  4OPW A;  3OR2 C;  3E0J B;  3H35 A;  4IRG A;  1P4W A;  2IGM A;  2V1D A;  3FXJ A;  1I27 A;  4YFK F;  5DDG A;  1VQ8 B;  1WOR A;  1O3S A;  1U6G A;  3JRE A;  1OCR H;  3IP4 B;  4HSR A;  2WR8 A;  1IRX A;  1IHM A;  3RIR A;  4BHB A;  4IO9 F;  4GQN A;  1V5F A;  4LIV A;  1YLF A;  3TH0 A;  1FX7 A;  2Z5U A;  3PO2 J;  2YWG A;  1A31 A;  2W7N A;  4NQW B;  2DW4 A;  4R71 A;  2R9V A;  3OSF A;  1DPU A;  1XGN A;  5H5J A;  4QIW N;  3LWF A;  1IZ1 A;  3SKB A;  1G7T A;  3CUQ C;  1FPQ A;  1PUE E;  4E70 A;  4O6J A;  2INV A;  2XAF A;  4ASU A;  3V7A A;  2WZN A;  1G7S A;  5DN6 A;  5HS9 A;  1A6I A;  3B6C A;  1CF7 A;  5HNH A;  4IHY A;  3A1Y A;  1Z1D A;  4HLY A;  1IXS B;  4ON0 A;  1KU7 A;  3GXO A;  2EZH A;  1WOP A;  1A8P A;  2RVC A;  2CS3 A;  4Y13 A;  1ZG5 A;  4OP7 A;  5F08 A;  1QGY A;  1FY7 A;  3BR5 A;  2M87 A;  3W5V A;  5BPI A;  4UVA A;  3I54 A;  4Z4W A;  4OOV A;  4I02 A;  2DEU A;  2CWE A;  1TW2 A;  2JMW A;  2Z99 A;  2ME6 A;  3ZMS A;  1Z6R A;  3OZU A;  2OPT A;  2EBI A;  3V8J A;  1YIO A;  2DDB A;  3Q5F A;  2KKO A;  5F1J A;  3Q9S A;  3ZMZ A;  1T8I A;  2YU3 A;  1FNC A;  1G7C A;  4PK4 A;  1FIA A;  1MJB A;  3ABK H;  1MNE A;  2EIL H;  5EF6 A;  2WJV A;  2E34 A;  3IH4 A;  4G94 A;  4JK1 X;  4BYY A;  1Z7L A;  4I2O A;  4AC0 A;  4AID A;  3L2C A;  1FNN A;  2B7B A;  3GZ5 A;  4OPO A;  1LKX A;  4CZZ A;  3DEW A;  3JR9 A;  2RDP A;  3LST A;  3P4G A;  3ZQG A;  5E1Z B;  4ZYA A;  3A2K A;  4Z4Z A;  4YC5 A;  3OZV A;  2UXX A;  4M73 A;  1P92 A;  2XGX A;  3CC4 B;  3MKZ A;  3QP6 A;  3CW2 A;  3K4J A;  1Y8R B;  2HQA A;  3H5N A;  1FOX A;  3AVT A;  4I84 A;  3T8T A;  2D1V A;  3TO6 A;  4HE6 A;  4DNR B;  1X1D A;  1IN4 A;  1HXD A;  3S17 J;  2P5K A;  3HKZ A;  4EM1 A;  1FP1 D;  2Q1Z B;  5CLS A;  2KHM A;  1EXM A;  2JN9 A;  3S15 J;  5FL7 A;  1X1P A;  4BBR J;  4L8J A;  4G7H F;  4XIC A;  3FKS A;  1X19 A;  1ZGJ A;  3HGG A;  1T39 A;  2IP2 A;  4DNC A;  2O17 A;  1J09 A;  5D6E A;  1P2F A;  1TZL A;  3E3V A;  4CCN A;  2GWR A;  4CCK A;  1BBY A;  1R5H A;  1NH3 A;  2A69 F;  4RCY A;  2J7K A;  2E71 A;  3AGP A;  3DPT A;  5BOX A;  1QFJ A;  2JN6 A;  4U0V A;  2YWE A;  5JBQ A;  2DJI A;  1BMF A;  1FYM A;  1VHE A;  4MXN A;  2M4K A;  4FX0 A;  1GVH A;  1B6A A;  3RDI A;  3ABU A;  1J9Z A;  4KKS A;  3T1B A;  1YYV A;  4QSH A;  1XB2 A;  2R7Q A;  3BC8 A;  2JWT A;  3A01 A;  1VQO I;  5ERI A;  2CUF A;  3TW6 A;  3W6V A;  1UZC A;  1W4M A;  4Q47 A;  4DOZ A;  3OEE A;  1X1C A;  4LIT A;  2X48 A;  1T5E A;  2LNB A;  1EKE A;  4NHJ A;  4ESF A;  1IJW C;  3AVW A;  1PE9 A;  1VQO B;  1QH0 A;  3OOP A;  2VNJ A;  4Z05 A;  1R36 A;  4YZQ A;  5LLQ A;  4XK4 A;  3G3Z A;  2ETH A;  5F0F A;  1VQP I;  3I4P A;  3OYE A;  1RET A;  4GCV A;  2P81 A;  2BHZ A;  2BM5 A;  4L9V A;  2VFO A;  3EUA A;  3JTG A;  5M5X J;  2M4G A;  3G1O A;  1YJW I;  3VWB A;  3K4B A;  3FXQ A;  5DM7 F;  2Q2E B;  3HG9 A;  3HTS B;  3KZZ A;  4H4K C;  2UUZ A;  5E20 A;  4G6D A;  3E6M A;  1H80 A;  3K2A A;  4DK0 A;  1S5L C;  2VB6 A;  2M7A A;  3CDH A;  4AYB A;  3CMA I;  3SYJ A;  1RNL A;  2MBF A;  1O57 A;  1HDP A;  1S9H A;  3CCM B;  2FJ1 A;  2XPU A;  4A3I J;  3GTJ J;  3M8J A;  4P26 A;  3MMP A;  3DU1 X;  3SZE A;  4LB6 B;  3BLY A;  4MYT A;  2PN6 A;  2R5Y B;  1MIJ A;  4FQG A;  4P9S A;  3PEN A;  5JR3 A;  3W5U A;  5K5O A;  4LG0 A;  4X0G A;  3HOU J;  1XPX A;  1B59 A;  1H8A C;  2QTL A;  4AIJ A;  4F7D A;  3FXU A;  3I55 I;  1H42 A;  2M5S A;  3H0D A;  2VOD A;  3IAM 2;  5E3O A;  2DOE A;  2ELJ A;  2KZG A;  2X4H A;  1UJ8 A;  3HRM A;  1BW6 A;  1N0U A;  3QFT A;  3HB9 A;  2WBM A;  4BUP A;  5DUI A;  1JJ6 C;  3Q0U A;  4PGO A;  4Y9U A;  2VIX A;  5IYN A;  4UHT A;  3DV8 A;  3R6S A;  2PLF A;  3PUM A;  2Q2E A;  1B9M A;  4GYI A;  1O8F A;  2WV0 A;  3GVA A;  1YJ9 B;  5JLV C;  1GJR A;  5LHH A;  3BRO A;  3KP3 A;  3ZQQ A;  4RB2 C;  3CCR I;  3BR6 A;  1NHA A;  3M9A A;  4Y17 A;  5BSX A;  2PEC A;  2JA8 J;  1AIP A;  1XE1 A;  1X2M A;  3WQZ A;  1RIO H;  4EJU A;  2P5V A;  3MKL A;  1JKR C;  1K4S A;  4HNT A;  3E6D A;  1ZRE A;  2ISZ A;  2IT0 A;  2P3M A;  1DBG A;  3BTJ A;  2HGC A;  1T0F A;  4X7F A;  2W82 A;  2VKH A;  4AM3 A;  3LFU A;  3BR2 A;  1JT0 A;  4MGR A;  3NE5 B;  3BDD A;  2X51 A;  1W0K A;  1HST A;  3C2B A;  4RD4 A;  2LMD A;  3RYR A;  4RD6 A;  1O8M A;  4P25 A;  5M3F J;  3E1Y E;  1AU7 A;  5J3L A;  4JRA C;  3ULQ B;  5FKL A;  2XGE A;  3I56 I;  4A69 C;  1F20 A;  4IVN A;  1X3U A;  4TMV A;  3KX2 A;  1IAW A;  4QVJ A;  1HF0 A;  3KYD B;  4MEY F;  1U5T A;  3WHB A;  2WYR A;  4AIK A;  2QY1 A;  1NK2 P;  2K27 A;  4AD9 A;  4F92 B;  4HX4 A;  1GT0 C;  4B48 A;  2DLL A;  2ZC2 A;  4UUV A;  3I53 A;  1FBQ A;  1DAB A;  3S1N J;  1HCR A;  3X2Q H;  4A0Y A;  3U1K A;  3VO2 A;  2H6B A;  4DW6 A;  1W0U A;  1DG1 G;  2VBK A;  1BPL A;  1R4N B;  3VEP A;  4M3G A;  1IUY A;  5EZG A;  1W5C C;  4XLA A;  4XID A;  1KK2 A;  3H09 A;  1R5N A;  1QJV A;  1DQU A;  2FE3 A;  1PUF B;  2LYC A;  3ABM H;  2PJR B;  1TBX A;  3W2A A;  3GF2 A;  1HKS A;  2KP6 A;  4B4C A;  1U78 A;  4KMF A;  2M45 A;  4KIT B;  3W2H A;  4AYB N;  3M8F A;  4QFM A;  2DMQ A;  2GJP A;  2BY0 A;  4LOC A;  2KFD A;  5J6X A;  1IA5 A;  1TTY A;  2LD5 A;  1TWF J;  1PJ6 A;  2VFN A;  3LNQ A;  2QMU A;  1FMV A;  4DIQ A;  1WZ2 A;  2VBV A;  2NS8 A;  3U21 A;  3LQE A;  3T56 B;  3HTU A;  3OWT A;  3PIP F;  2R6H A;  1QHH D;  2B9S A;  5IT3 A;  4URR A;  1J0R A;  3CJR B;  5M5Y J;  2CH0 A;  4ESJ A;  4M4S A;  2WTE A;  3QWL A;  2CG4 A;  2Z9O A;  1IDZ A;  1JHH A;  5CVV A;  1U2R A;  1T33 A;  1JUS A;  2PI0 A;  2V79 A;  1O4X A;  1VBL A;  2B63 J;  1YX5 A;  3RSN A;  4DQ2 A;  1BX0 A;  2K9S A;  2IS6 A;  4E7K A;  3VB2 A;  1Q1V A;  2XV4 S;  3D26 A;  1NB9 A;  3CC7 B;  4C43 A;  1TWH J;  1UST A;  3S1Q J;  2KMU A;  3BCA A;  2RKH A;  1OYY A;  3R4K A;  4NBQ A;  3M3Y J;  3P27 A;  5ILS A;  4CHU A;  4IHS A;  1FTZ A;  2JRT A;  3H0G J;  3P7N A;  4DYC A;  1NRK A;  2PMU A;  1R4M B;  1RU4 A;  5FO1 A;  5FLM J;  3PIO F;  4DZJ A;  2ZZF A;  4Z4S A;  3FXM A;  2V9V A;  4Y52 J;  3SJM A;  2H94 A;  2L9R A;  2L01 A;  2L7M P;  3GYH X;  3KEO A;  2QSH X;  1FX0 A;  1X4P A;  5DEQ A;  4Z4Y A;  1O7L A;  2MW8 A;  2G0E A;  1Z91 A;  1SFE A;  3E97 A;  4O5V A;  5F64 A;  3V7C A;  1A35 A;  4OIQ F;  4P12 A;  2VFM A;  2NVX J;  3WNC A;  3ZUG A;  3GME A;  2V1N A;  2PLY A;  3RZO J;  3GVK A;  2VBU A;  1XDS A;  4P5O A;  3KP6 A;  4TT3 A;  2C4U A;  2ZL5 A;  1F43 A;  2NTB A;  1G3W A;  2JT1 A;  3Q3A A;  5D4R A;  1N75 A;  1YS7 A;  1RR8 C;  3VR6 A;  2AHQ A;  5IK2 A;  4E6K G;  1MD0 A;  3H3U A;  4E7S A;  1OGJ A;  1UHS A;  1K28 D;  4LB5 A;  2VE9 A;  1WRJ A;  5BMZ A;  2ZB9 A;  2CW7 A;  4OOI A;  2EPF A;  1M1K D;  2LRE A;  2X85 A;  3SDB A;  2IRF G;  1EJ9 A;  4YAU A;  4ZGN B;  1WJC A;  3OYH A;  5JI6 A;  2F1L A;  4D0P A;  4ITV A;  3IWZ A;  1D1N A;  1FOW A;  1S7E A;  2P6T A;  4M6X A;  2GJK A;  1E3X A;  2LC2 A;  2DET A;  3GRH A;  1FBS A;  1SD6 A;  2KRH A;  5HVQ C;  3RYP A;  2JUG A;  5M3M J;  2C6Y A;  1VF7 A;  5AN9 A;  1MBJ A;  2EJR A;  2MD5 A;  2O04 A;  4PJJ A;  5GP9 A;  2OBP A;  5HXB A;  1WJD A;  3I71 A;  4BGD A;  2X1C A;  5BNG A;  2BM6 A;  2M2E A;  3GBG A;  1F9N A;  2QVO A;  1C0W A;  3CZ6 A;  1S7O A;  5E1X A;  3CO7 C;  2F6C A;  1TYU A;  4IQ4 A;  1APL C;  3VST A;  4MTD A;  3S2D J;  1MNM C;  2KPM A;  1MKM A;  3GVL A;  2WB1 A;  2AS5 F;  1V5V A;  1TT0 A;  2MH2 A;  2DT6 A;  3GFM A;  1T98 A;  3VYT B;  2ZSI B;  4OAZ A;  5J3O A;  1H88 C;  2J5P A;  2VC1 A;  2L7K A;  5IYD J;  5FLX Z;  3IH3 A;  1I8D A;  5L3G A;  3V4G A;  2MG4 A;  2VBX A;  2NXN B;  2V9P A;  1FYK A;  3CXC B;  3TMO A;  1WXR A;  4B3G A;  2TDX A;  1BJZ A;  2EFO A;  2IVM A;  2IGK A;  3EQL F;  2YUS A;  1T6X A;  5TJJ A;  4RA2 A;  2BY1 A;  4HW0 A;  2PYG A;  3QOE A;  1GXP A;  2G9W A;  2DT5 A;  3KFW X;  1TW3 A;  1FLI A;  4HWV A;  2KIM A;  1E17 A;  4OPS A;  4UVC A;  4ZCM A;  2JVG A;  1JKQ C;  1VQ6 B;  1ON1 A;  2ZKZ A;  3CUO A;  4M3B A;  3HSR A;  1ETW A;  2NOG A;  4ACB A;  3TP0 A;  3DBR B;  4KMU X;  2M8E A;  3CME I;  2W00 A;  1GDT A;  2E1B A;  4WZE A;  3UKG A;  2CUE A;  3TKY A;  2Y75 A;  4BH9 A;  4WX9 A;  1VQK B;  2R92 J;  1Z21 A;  1EH6 A;  2DIE A;  1O8L A;  2HS5 A;  4AC9 A;  1KON A;  1GLN A;  2GBY A;  2EFW A;  3OYG A;  4HRI A;  4NK6 A;  3AAF A;  5CKT A;  5KHD A;  4DBQ A;  1UMK A;  3CME B;  1N08 A;  4CCM A;  2VZL A;  1OCT C;  2CW0 F;  3UW0 A;  3RJP A;  2E5N A;  2HZT A;  4XLF A;  2K40 A;  1OYI A;  2VJ5 A;  1RQP A;  2W7Z A;  3ZSC A;  3S2H J;  2VOO A;  5CJ9 A;  3Q6Q A;  2A5Y B;  2FVG A;  2DDA A;  1G2H A;  4P1W A;  4XMY A;  2VBW A;  1TL8 A;  5JVT A;  2ODL A;  3S3M A;  1X3W B;  2RNG A;  4Z03 A;  4LMY A;  4N9I A;  1XN7 A;  3MCZ A;  2ZCW A;  3EYI A;  4M53 A;  5LFA A;  5DNS A;  3ZZT A;  2E1R A;  2GIV A;  3H92 A;  2XKO A;  1GAQ A;  2P7V B;  3HHG A;  2VNI A;  3BJO A;  5L3C A;  3I58 A;  1VJS A;  2BGI A;  3K2Z A;  3K1P A;  3A8I A;  4DK1 A;  1B1B A;  1ETX A;  4C3H J;  5D4S A;  5TRD A;  1RUN A;  3ZBU A;  3W2V A;  5GV8 A;  2X6X A;  4BJ5 C;  2DFI A;  2YU9 J;  4AUX A;  2D9R A;  1MBE A;  3WTY C;  5IYR A;  4D5C A;  5JLW A;  3OKX A;  3LNN A;  3LMM A;  3ZQL A;  2O0W A;  3CP8 A;  2E7W A;  3OW2 B;  3GLL A;  4BAY A;  5D8K B;  5ED4 A;  1OCZ H;  5EDN A;  1WH7 A;  3ASR A;  2Z8G A;  1RI7 A;  1CZF A;  2DTZ A;  3OFN A;  3VPR A;  3W2E A;  5DYM A;  2HLD A;  1PJR A;  3L7W A;  2LY2 A;  4KDP A;  4A3C J;  2F5F A;  1IUF A;  2GK7 A;  2JQ7 A;  1MZB A;  3EUH A;  3KEY A;  4O3M A;  2BM1 A;  1TSP A;  1H85 A;  1FOY A;  1BR2 A;  2OA4 A;  2V7U A;  3DF8 A;  1OOC A;  2DMT A;  3GW2 A;  2AQE A;  2VAS A;  3TP3 A;  3JAM K;  4RDU A;  4UZU A;  5HS7 A;  4IZZ A;  3ZP5 A;  1OGO X;  2VQH A;  3VMF A;  2M30 A;  4V02 C;  2LH9 A;  3SZT A;  3CCL I;  4TMT A;  3AG2 H;  4BEH B;  2PJP A;  1YE9 A;  3VOE A;  4W8R A;  2M7B A;  3E5X A;  2HDN B;  4MR0 A;  1Y0Y A;  3CPW B;  2LG4 A;  2QA4 I;  4OOX A;  1ZRF A;  1D3Y A;  2IPQ X;  3QU6 A;  4OMZ A;  4XRS A;  2DYI A;  2KIQ A;  4YCQ A;  4PAA A;  1QU3 A;  4B43 A;  4ENM A;  1H8H A;  1XGS A;  4A3E J;  3BCF A;  5KSW B;  2FNA A;  3J81 K;  2HVR A;  2V7Q A;  3CCJ B;  1R23 A;  3HJE A;  1DAR A;  2XDV A;  3EPZ A;  5JFR A;  2QKL B;  3ZR8 X;  1LPQ A;  2DYR H;  4WZK A;  1T0F C;  3BY6 A;  2B7E A;  2FBH A;  3KLO A;  4MQ9 F;  1BN5 A;  2BBY A;  5E6T A;  1W7P A;  2YR2 A;  3BP8 A;  2PQ8 A;  2PFB A;  1JRG A;  2M34 A;  4RPB A;  2HQR A;  3CCS I;  2ZZG A;  3B4N A;  2BV6 A;  3LMW A;  2NVY J;  3AG1 H;  4YXW A;  1O8H A;  1BI0 A;  4ZYE A;  1CF7 B;  4XRF A;  1UD3 A;  1KK0 A;  1BA5 A;  3BC9 A;  2ZFU A;  3I59 A;  1QNT A;  2XF6 A;  3HOY J;  4Z4U A;  4FWT A;  2QBY A;  4G6Q A;  1EP3 B;  3L2W A;  1WJE A;  4X05 A;  1G6N A;  1IN8 A;  1KYZ A;  3F6O A;  3OR1 C;  4LGW A;  1N25 A;  1VLY A;  1HW1 A;  3JSP A;  1YI2 I;  2DOF A;  2ZO4 A;  1ZR4 A;  1O8I A;  2XNJ A;  3HUG B;  4OMY A;  3FF5 A;  1ZAR A;  3DLL F;  3BTI A;  2JIZ A;  5EEG A;  1BOA A;  4QHY A;  3ABT A;  1YRN A;  1OHH A;  1W36 D;  2W57 A;  3BY1 A;  1CQT A;  4DBR A;  5E17 F;  3ZC3 A;  2DK5 A;  1F4K A;  2XZL A;  2BMW A;  2WWY A;  3A3G A;  3CC7 I;  4PGH A;  2EZI A;  4EH1 A;  5KVR A;  1WMR A;  4RAG A;  3WTV C;  4XOP A;  2HQ5 A;  4P9F A;  2JUC A;  1KTW A;  2LVS A;  3ZCO A;  2VOP A;  2NZM A;  2QQ9 A;  4BQN A;  4WZL A;  3GTQ J;  4HZF A;  1KCC A;  3HPG A;  4A3B J;  3ASO H;  1JNY A;  1BHE A;  5LD2 C;  4QPQ A;  3QP5 A;  3GQ8 A;  1PVE A;  3R0A A;  1E3H A;  1E64 A;  3T8R A;  4RDL A;  3K9T A;  3SQN A;  2HYG D;  3CO6 C;  4G6T B;  4IW3 B;  3R6J A;  3C2H A;  4CA0 A;  5H59 A;  3I9V 2;  3OL4 A;  1R71 A;  5DCF A;  3T5X A;  3E6C C;  4KIC A;  3CCV I;  2MC4 A;  1DBO A;  3UNG C;  1Y0R A;  3N6Z A;  3BJA A;  4CZC A;  2QCO A;  4UUS A;  5IPA A;  1K8A D;  4GO1 A;  3HEF A;  5FJ8 J;  3A01 B;  3JRB A;  1ENH A;  4HOB A;  2HOS A;  2VBM A;  2DOA A;  2CFO A;  1IF1 A;  2LF8 A;  1JA1 A;  2QSF X;  1JJ2 B;  2V5I A;  2BVN A;  3CCV B;  2AQF A;  5C3E J;  5IY5 H;  1KU2 A;  3WGG A;  1ERD A;  1EFC A;  1I1G A;  4M1K A;  2V7X A;  2HVQ A;  1JJ8 C;  5HS8 A;  3EUH C;  2ECC A;  1ZQ3 P;  4HLX A;  1QUE A;  3LSI A;  1ON2 A;  4KUM A;  3F22 A;  2OTL I;  2VXZ A;  3CCU I;  1YIT I;  4OJO A;  1OB5 A;  3FM5 A;  2Y0S A;  1OCC H;  2DQR A;  2WV1 A;  2RRE A;  2XC7 A;  1AMO A;  4A6E A;  3W2W A;  2XTY A;  1WJF A;  2R7F A;  1N07 A;  3WG9 A;  3ROU A;  1FTT A;  2HXI A;  3E6B A;  4LD5 A;  4RGU A;  4CCO A;  3O8H A;  4RCZ A;  1K73 D;  2VQG A;  3ZPL A;  1ZN2 A;  2LY1 A;  3I5U A;  3JRC A;  1VND A;  1Z3X A;  1OFL A;  2VPR A;  2ZBK A;  2DXI A;  4E7Z A;  2XHK A;  2HU9 A;  3BG6 A;  4NB5 A;  3QFR A;  2LR8 A;  3CUQ B;  5FFZ A;  5K1Y A;  1MH4 A;  2IBD A;  2F4M B;  1FDR A;  4I7H A;  4GGG A;  2PX9 A;  5GAG J;  3KYL A;  3L2R A;  1FNB A;  3GIR A;  1NDH A;  3QQA A;  1QA2 A;  1OQY A;  2UWM A;  4UUS B;  4OIO F;  5GV7 A;  4XOR A;  4WK8 F;  4B1R A;  1J9I A;  3K0L A;  3O6B B;  1GQ8 A;  5FKO A;  4J0Q A;  5EG0 A;  2IQ7 A;  3QAH A;  3SFZ A;  3UR3 C;  3RKQ A;  3K10 A;  4EM0 B;  3MMY B;  1O3R A;  1IDK A;  1RES A;  2FOW A;  2MC3 A;  2XAU A;  3FHZ A;  5FIU A;  2BM4 A;  3OSG A;  1RMG A;  1KU3 A;  3QPL A;  4OU0 A;  2FUG 2;  2E19 A;  3N05 A;  4PFO A;  3CCU B;  1YIT B;  1SMT A;  3U6B A;  2LRD A;  1FRN A;  1QGP A;  2ID6 A;  5D5V B;  2DMU A;  1EH8 A;  4UB8 C;  3W6K B;  3FWE A;  1IRG A;  2HDC A;  1VQN I;  5GPA A;  4L9N A;  5C4J J;  1ZG3 A;  3MZH A;  3IWF A;  1KZH A;  4UUT A;  1E62 A;  1BOB A;  4FX4 A;  2DA1 A;  1XGM A;  2DFE A;  2GIZ A;  1PDN C;  2P7C B;  2ZTN A;  1OCO H;  5B3S H;  1R1T A;  2OC6 A;  1HSJ A;  1U2W A;  3GZ6 A;  4ENJ A;  4HQE A;  3WBJ A;  1IN5 A;  1W34 A;  2NST A;  1D1C A;  1JUM A;  3S32 A;  2IA2 A;  4U0Y A;  1LM1 A;  1KCD A;  1ULY A;  3SEZ A;  3ASN H;  1FC3 A;  2RQQ A;  4N4N B;  1SC7 A;  1VQK I;  5ICF A;  3DDY A;  1OB0 A;  2RV8 A;  1ONV A;  3CUQ A;  1T56 A;  2Q6O A;  2YX4 A;  3S3O A;  3JRF A;  4ZDO A;  3ES9 A;  1EE6 A;  4B47 A;  5HDN A;  3DWL E;  4XSX F;  4A93 J;  1KK3 A;  1G3Y A;  2EIJ H;  3FK6 A;  2O7O A;  5HLI A;  4Z4V A;  5EEH A;  3DBH B;  1U5T B;  2PMH A;  5LEJ A;  5TY0 A;  1BN8 A;  5A89 A;  3RCO A;  1QPM A;  1LVA A;  1WJ5 A;  3TDZ C;  3WTW C;  4YG2 F;  2QTZ A;  1QVG B;  5IYP A;  1YX3 A;  5F1R A;  3C1D A;  1R5I D;  1X3Z B;  2IAI A;  2CQQ A;  1JE8 A;  2YUH A;  2P6S A;  2HFH A;  1JT6 A;  2HCJ B;  3B8Y A;  2QM3 A;  4G8X A;  9ANT A;  2ZJQ F;  2CMP A;  2A6E F;  1E0E A;  4XLH A;  2Z2S B;  1X2N A;  4NQW A;  3SEJ A;  1UB9 A;  2QYU A;  4XKB A;  2ID3 A;  3RPU A;  2EA4 A;  4XD7 A;  1N0V C;  1T38 A;  3L00 A;  5IT9 Z;  5IYW A;  1OFE A;  2X1E A;  2NTP A;  3RIQ A;  3OYK A;  2PIA A;  2ZJ2 A;  2STT A;  4WQM A;  1ZRD A;  1SD4 A;  4ETS A;  3PFI A;  5DSZ A;  5FD5 A;  3SZP A;  4UB6 C;  1ZRC A;  4P55 A;  3BJ6 A;  4ZYG A;  1QQ1 A;  3N4M A;  4L5E A;  1Y56 A;  2M8G X;  5DS9 A;  3PJR A;  5HOD A;  1JI8 A;  1QQI A;  2Y2Z A;  2O3F A;  3OMY A;  2GK6 A;  4G7Z F;  1R5O A;  4EMS A;  2XIG A;  4HAM A;  2COM A;  4LFU A;  4J01 A;  5B1A H;  3OYJ A;  3E20 A;  5H6R A;  3HKZ N;  1LE8 B;  3QU3 A;  2KJC A;  4OAY A;  2FML A;  3DTE A;  3QRF F;  5CVJ A;  4EJO A;  2ZXW H;  1I39 A;  3CMM A;  4BQO A;  1MRZ A;  2OD5 A;  1HDD C;  2DFF A;  1FSH A;  4MQV A;  3CTA A;  4OOS A;  4YFO A;  4WXD A;  4RGX A;  2AO9 A;  2VKE A;  1MMN A;  2RQP A;  3FXR A;  1TVC A;  3AK5 A;  3W3C A;  3G4S I;  1TLL A;  3IRQ A;  2KLO A;  4Q48 A;  2FF4 A;  2V1X A;  2KDZ A;  3TOB A;  1ZM4 A;  1FBU A;  5FKN A;  5CQG A;  5LRS A;  4RDK A;  2C77 A;  2QA4 B;  1FIP A;  1X1A A;  5CQE A;  2QQ8 A;  5THX A;  4KT5 C;  4GFB A;  1JA0 A;  1XG1 A;  3RY8 A;  2LDU A;  1G7R A;  2R7X A;  1JXS A;  3CCJ I;  1TYX A;  3ABL H;  3OYM A;  5TR9 A;  3HL2 A;  2DA6 A;  1RUO A;  4IOA F;  1YHQ B;  3ASQ A;  5EJC A;  2M5W A;  4XSZ F;  4Z1M A;  1MSE C;  3OP1 A;  3PNY A;  3HOS A;  5KW9 A;  1D1B A;  4YZA A;  2VBY A;  3ASS A;  2HMA A;  1SFO J;  3SUC A;  3C2G A;  3LSR A;  2XNC A;  1YJ9 I;  3EET A;  4E7L A;  3M1C A;  5KK1 A;  4XBF A;  3FIS A;  4OZY A;  4KA4 A;  1FT9 A;  4E0F A;  2FBI A;  3HRS A;  1W0T A;  2IS2 A;  4HV6 A;  3FMR A;  3PVD A;  2O5R A;  5J8F A;  2D5V A;  1KZL A;  2E2H J;  4RD1 A;  2CQ7 A;  1OFD A;  4EM2 A;  1EFR A;  4RM0 A;  1Q81 D;  3LSJ A;  3RQ4 A;  3LVB A;  4KN7 X;  4CQJ A;  4QV2 A;  1L3L A;  4A0X A;  4ANJ A;  3C18 A;  3GTG J;  3W6J B;  1ELO A;  2OBS A;  4WWV A;  4Q4Z F;  3NRV A;  4IHX A;  3LQR A;  4P3Y A;  4B44 A;  3ZZ0 A;  4M9Z A;  2P5L C;  2Q6I A;  3GEZ A;  3F6V A;  3LYC A;  4KFC A;  1ZHF A;  1D5Y A;  4CH7 A;  1W5S A;  3F8F A;  1SD7 A;  1FYL A;  1W5T A;  1PXZ A;  3LL7 A;  2ZXI A;  1FMW A;  3OY9 A;  3PSS A;  1AIR A;  4YIR X;  3BZC A;  3IC7 A;  2V7W A;  4X0C A;  3HRT A;  1H89 C;  2OZU A;  1GAW A;  4QVA A;  3AG3 H;  1XTA A;  4LIU A;  5IYB J;  1BR4 A;  3CD6 B;  3BH4 A;  5J4V A;  2IXS A;  2XGC A;  3LA3 A;  2OQR A;  2ELH A;  3RKX A;  1EP1 B;  2ESN A;  3SDG A;  4V19 K;  5IP9 J;  2L02 A;  5JHF A;  3MAJ A;  4PC2 A;  3BG3 A;  3AVY A;  1HLV A;  2YX7 A;  5ILU A;  4R8H A;  4B8X A;  1EH7 A;  1YW8 A;  1OMI A;  3BOQ A;  1IW7 F;  1TYW A;  2XPW A;  2FMY A;  5DV5 A;  4QTR A;  3V8K A;  1YIJ I;  4II3 A;  4QWQ A;  3VMW A;  4UAJ A;  3HZJ A;  4AIH A;  5E3N A;  1PKV A;  1QFZ A;  1NB0 A;  3DPU A;  3RKY A;  3JQQ A;  1GHC A;  1Z77 A;  3HAG A;  1VQ7 B;  2CYY A;  3GQ7 A;  3GFJ A;  4U0W A;  1MJA A;  5HOO A;  3ZQC A;  5IYC J;  1UD8 A;  4EGZ A;  4WWC A;  1XMK A;  1SVL A;  3F23 A;  3I3L A;  2QDX A;  2ZNZ A;  3ERM A;  1R5B A;  1YX2 A;  3A3B A;  1MMS A;  4I01 A;  1HA3 A;  3A02 A;  4G1V A;  4IHT A;  3CC2 I;  4XRM A;  2FX0 A;  3H94 A;  4ZYH A;  3IAS 2;  3I59 B;  2EV5 A;  3LSG A;  4IPA A;  2CQN A;  3CJT B;  3K70 D;  1RZ4 A;  3IRR A;  2ZJR F;  3U6K A;  5TV2 A;  1IO2 A;  3BG7 A;  4ABZ A;  4DGW B;  2WAD A;  3ZOB A;  4HDV A;  4FCY A;  3QFC A;  1L1I A;  1O3Q A;  2DU9 A;  1XQB A;  1P6R A;  1LDK B;  1WP6 A;  2ZL7 A;  4UV9 A;  2WJY A;  3TO7 A;  3HUG A;  3PA1 A;  5FA6 A;  5E3L A;  3ZBT A;  3U9G A;  1YW9 A;  3U2R A;  1I6H J;  4L0Z B;  3AG4 H;  1ETO A;  4XN3 A;  1WJA A;  2XB0 X;  2O8K A;  2ZL6 A;  2FX3 A;  4GDF A;  1SFK A;  2N8G A;  3BQY A;  1E3P A;  1V0F A;  5KCM A;  1DGR M;  3KPH A;  3HSE A;  1MBF A;  2MSY A;  2V7F A;  4EJT A;  2XRL A;  2H27 A;  3J81 k;  3BZ6 A;  4RJL A;  4MO7 A;  2R5Z B;  1UG2 A;  2EV0 A;  3CF2 A;  4N0B A;  2NS7 A;  4RLQ A;  4W97 A;  2VNH A;  2YWF A;  2DER A;  1A04 A;  4KYW A;  1TT5 B;  4PDK A;  3VSV A;  2QYO A;  1VQ4 I;  1ZKG A;  4Q5S F;  1V3F A;  4QPO A;  1DU6 A;  2F43 A;  5BPD A;  3CMY A;  4WF2 A;  2B7C A;  2GXG A;  4HDU A;  1O7F A;  1RPW A;  4GYG A;  1OKR A;  2ZXH A;  3NQO A;  2MH9 A;  1WI3 A;  1WH5 A;  2EQR A;  1QRY A;  2Y9Y A;  3EQO A;  1K79 A;  3HGY A;  4Z4T A;  4IQJ A;  2IGO A;  5FRO A;  2CK3 A;  2L4M A;  3CCY A;  3HHH A;  4L9T A;  2L0K A;  4XNF A;  2WZP P;  4G5G A;  2KIU A;  4LJZ F;  1W0J A;  4ZTF A;  1SD5 A;  2CRG A;  3CRZ A;  1ZG1 A;  2VL8 A;  3PM1 A;  4RB0 A;  4XQF A;  2W4S A;  4ZZL A;  2E5Z A;  1TQI A;  3WTX C;  2XSD C;  3OW7 A;  2QBY B;  3DP7 A;  2RC6 A;  4V2F A;  1FRQ A;  1QHG A;  2W48 A;  2XAG A;  1VQ9 I;  3LAP A;  3Q9V A;  5AON A;  2XGD A;  3L09 A;  4CUG A;  5GAD J;  4IRH A;  3M7G A;  1H9G A;  3O8G A;  4XR6 A;  4BQA A;  3TO9 A;  2UVF A;  1BI2 A;  1TWA J;  1VTN C;  3ZQH A;  3DQV C;  4PFP A;  5HLG A;  3JW4 A;  5H6Q A;  3BH6 B;  3MD2 A;  3VSK A;  3FXO A;  2VE8 A;  3ONQ A;  4D9J A;  1N77 A;  5EG0 B;  1O88 A;  4RDJ A;  4J19 A;  4OJ6 A;  3J7A Y;  4KKU A;  3ZMU A;  3MQ0 A;  3PET A;  2D45 A;  4LG3 A;  2I10 A;  2NYX A;  3K7A J;  2FQ3 A;  2Z16 A;  1I3Q J;  4P96 A;  3OYN A;  1LJ9 A;  3RTR A;  4H9G A;  1B8I A;  4RM3 A;  2L7Z A;  3IV5 A;  4E7J A;  3CMA B;  2Y30 A;  2HOT A;  4BBS J;  2OU2 A;  1K4T A;  1PJ7 A;  2A6T A;  4TN1 A;  3IH2 A;  4N9H A;  2HWV A;  2Y31 A;  1BQE A;  3OYF A;  1FZP B;  4YDT A;  2BGC A;  3FPK A;  2UV1 A;  4EJW A;  3RKW A;  5K5Q A;  5CVR A;  4N3N A;  5JHU A;  1XS9 A;  1VQP B;  3I55 B;  2ZBV A;  2F5E A;  1D0Y A;  2HVS A;  3LQQ A;  5F4M A;  2DCE A;  4Y3O A;  1EFU A;  2MYS A;  2V6C A;  1QCX A;  3Q39 A;  5IOZ A;  3HOT A;  5FLV A;  1WQ2 A;  1TQM A;  2X9D A;  5IP7 J;  1HVX A;  4RM2 A;  1O8K A;  3KRG A;  4QLC U;  4XL9 A;  5L3B A;  2VXD A;  4RS8 A;  3FM3 A;  3PO3 J;  2CGP A;  3ZPN A;  2XSJ C;  2BN4 A;  1JGS A;  1U9N A;  2Q0O A;  2NTQ A;  1HKQ A;  2VPL A;  2FRH A;  1ETQ A;  2B5O A;  2J5O A;  1X58 A;  2F2E A;  1S72 B;  1XMX A;  2OK7 A;  2JJ7 A;  3A0B C;  1WWX A;  2K85 A;  1MBG A;  1PUF A;  2PJR A;  2WAF A;  4YEJ A;  3WU0 A;  2Z6B D;  2WB1 N;  2RNJ A;  4G9Y A;  4PZJ A;  1B23 P;  1UFM A;  1M90 D;  1B72 B;  4PC3 A;  1W36 C;  4U9U A;  2L54 A;  2QLZ A;  2VBE A;  1TC3 C;  3FIW A;  2H1K A;  4Y7N J;  1LLZ A;  4P6V F;  1QUF A;  3ML3 A;  4BXU A;  3CJN A;  4ZC3 A;  2IS1 A;  1P4X A;  4HE5 A;  1IB0 A;  4YII A;  3I56 B;  2EIX A;  3AVU A;  2BVM A;  4IKF A;  2X1D A;  2R7Z J;  4OJL A;  1H9T A;  2OTJ B;  3VDX A;  3K4K A;  5A88 A;  1KYW A;  3KYC B;  1WJB A;  1F60 A;  3OS0 A;  2DCU A;  1FSE A;  1DDI A;  4HBL A;  1XCV A;  2KJB A;  1P7I A;  1W35 A;  2PMD A;  2V4J C;  3NWS A;  4CXF A;  3V7S A;  4BJT A;  1I18 A;  4NC8 A;  5GAH J;  1E63 A;  4F93 B;  1J2X A;  3FBN B;  4XKC A;  2FXA A;  4A6D A;  2L7F P;  3SJP A;  2W6I A;  1IGN A;  4FET A;  1QX4 A;  2JPC A;  1MMD A;  3VO1 A;  1EA0 A;  4RGR A;  3KCC A;  4EW9 A;  3F8M A;  5LRR A;  3I4M J;  1LDD A;  1BI1 A;  2F5D A;  4EAT A;  3OS2 A;  1TYV A;  5BQT A;  2KIF A;  4S04 A;  2BPO A;  4C3I J;  4PC1 A;  1R7J A;  4M72 A;  2RGV A;  4DYQ A;  2BV3 A;  3DKW A;  3AFH A;  4I0B A;  2HEO A;  3HXL A;  4HA8 A;  1R49 A;  4XN0 A;  4P6Y A;  5BSY A;  3TBI A;  3GTK J;  4XOT A;  4ZYD A;  2DY1 A;  1QA1 A;  2JZY A;  1EA3 A;  2VC0 A;  4AVP A;  4LLL A;  2HZD A;  3S8P A;  2QQB A;  2C2W A;  3RZD J;  3F8N A;  1VQM B;  4LC0 A;  5LBQ A;  1W2B B;  1DGW Y;  2XRN A;  4YEL A;  3HRU A;  5B1B H;  1CLW A;  3U1D A;  1S6L A;  3VYS B;  4X06 A;  4ZGQ B;  2VBT A;  4ZZD A;  4HST A;  1T6S A;  3TDU C;  3JUR A;  4A3M J;  2VKV A;  2VT3 A;  1N05 A;  2R7O A;  4P2N A;  4YAO A;  3FJO A;  1MBH A;  2I5U A;  2K7L A;  4L18 B;  1F1Z A;  1WDT A;  1OGM X;  1IJE A;  2GM4 A;  3HYI A;  2WSS A;  4ZCL A;  2IGN A;  4BY1 J;  2LOO A;  3W2F A;  3ECO A;  1F5T A;  1ZAO A;  1CQX A;  3WHC A;  3CPX A;  3S16 J;  2DN0 A;  1VHO A;  1RKT A;  1HW2 A;  2E60 A;  4M6V A;  4L0Y B;  1K61 A;  2R0Q C;  2X3H A;  3S93 A;  3OIP A;  2XAJ A;  4JX5 A;  5D5X B;  5J40 A;  2O6W A;  2H1L A;  2Y9Z A;  2WAQ N;  4H0E A;  3PNT A;  1E2X A;  4BE0 A;  1SFX A;  1IDJ A;  1UD6 A;  2ZIT A;  2K9N A;  5H20 A;  4S0H B;  1XSX A;  1VQ7 I;  4RGS A;  2BXY A;  5C4X J;  3C7J A;  4RB1 A;  4M3E A;  1K6O A;  2O9L A;  2EIK H;  3E5Q A;  2COB A;  4E7I A;  2QZ8 A;  4LLN A;  4R1H A;  5C1C A;  4DQL A;  3CC2 B;  3ZMD A;  1XDU A;  3ZMT A;  4M74 A;  4D5F A;  1TP4 A;  4KH3 A;  2BM7 A;  2H09 A;  1YOV B;  2LKX A;  1WSV A;  2OTL B;  4CYC B;  5F4O A;  1MND A;  2QUF A;  1P9Q C;  5HDK A;  1JTX A;  3HOW J;  2G7U A;  1LFP A;  2XPV A;  4YAL A;  2VJ4 A;  3TL4 X;  2FNP A;  4YAW A;  1LEB A;  4RMN A;  1OPC A;  3K6G A;  4RLF A;  3LSH A;  3CCE B;  3GLX A;  4FT8 A;  2R5Z A;  1X0C A;  5DTD A;  3EUK L;  2OAZ A;  3J81 Z;  1MJ9 A;  3R60 A;  1IDY A;  2F1M A;  2BEO A;  1DP3 A;  3JQR A;  4OZZ A;  6PAX A;  2DMP A;  2F5V A;  3PUN A;  3CCE I;  2K3P A;  1XB4 A;  1XD7 A;  2ESH A;  3C3W A;  1UHW A;  5D6F A;  2XZP A;  2HDD A;  1G3T A;  4ENK A;  3QOD A;  2R7S A;  3OV8 A;  4J00 A;  2PBI A;  2OZ6 A;  4F7Z A;  2M9H A;  2ZXJ A;  1Z7U A;  2QX3 A;  2FQ4 A;  1HBX G;  3QE2 A;  4PSX A;  4M71 A;  4XKW A;  3J7A O;  2L5Q A;  2DA5 A;  1TLH B;  2E2I J;  1E1R A;  3ML6 A;  2KRF A;  1XMA A;  3W2I A;  2K9L A;  4HIZ A;  2O03 A;  2GQF A;  5EZH A;  4PGG A;  5J1Y A;  3WTU C;  4JX4 A;  1LDJ A;  1EWY A;  1N8R D;  4ZTJ A;  1M1E B;  3KLN A;  1XSD A;  4NDL A;  4RLZ A;  4LK1 F;  4BU2 A;  1OFM A;  4C2T A;  3O3K A;  3K1N A;  3OJW A;  3Q3S A;  3VNU A;  1BLI A;  2Z3Y A;  3FXK A;  4FTH A;  3QPH A;  2GXB A;  4RD3 A;  5IT9 K;  4G6I A;  1QO0 D;  1WI9 A;  4I09 A;  2XAH A;  1D8T A;  1WPC A;  2M0C A;  1K7A A;  1QA6 A;  4FN5 A;  4I6Z A;  2W85 A;  4I99 C;  3GX4 X;  1QA3 A;  1ZH5 A;  3BCB A;  3G71 I;  2GA1 A;  3S3N A;  3R61 A;  2BM0 A;  3QOP A;  3P9K A;  3WU2 C;  2LY9 A;  5E8I A;  2INU A;  1VZ0 A;  4JP0 A;  3BCD A;  2NNN A;  4ROX A;  3H9J A;  1G59 A;  2CV2 A;  1VLO A;  4DJA A;  3Q6R A;  1KQ5 A;  2KZV A;  4BDZ A;  2A07 F;  1H0M A;  3JRG A;  4Y9R A;  5FNZ A;  1N06 A;  3HSF A;  3BQJ A;  3A03 A;  3H3Z A;  1KD1 D;  1V4R A;  2HXO A;  4YZ0 A;  2Y0S N;  1UHM A;  4EVI A;  2X0K A;  4OIP F;  3ZPP A;  3BG5 A;  1R1V A;  2HNH A;  4E4H A;  2D3N A;  1QZY A;  1TWC J;  2E1N A;  4P9U A;  1VQ6 I;  3WND A;  5K5R A;  1FNM A;  3OIO A;  1KQ9 A;  1KK1 A;  2A5W A;  3BZK A;  3LSP A;  1S0U A;  1SVO A;  3B8H A;  1OR7 C;  3CB4 A;  1AHD P;  1VQN B;  2V4D A;  1LLW A;  3JX8 A;  1WOO A;  4S05 A;  3OL3 A;  3JRH A;  2B0R A;  2GXA A;  4ZCI A;  3B6A A;  1PYV A;  1U0J A;  2MFZ A;  2WAQ A;  3DCF A;  4ZV4 A;  4FE7 A;  4PUS A;  3VMV A;  1B4A A;  1GV2 A;  4W8T A;  4PJL A;  4BEH A;  4U87 A;  3WTS C;  3V7R A;  1LFU P;  2LBF B;  1W1W E;  3VYU B;  1NHC A;  4A5M A;  2P0W A;  4HV5 A;  1Y1V J;  1WHU A;  1W7P B;  4CIC A;  1DP7 P;  1I50 J;  1BI3 A;  1QRC A;  3BY2 A;  2HKX A;  2K4J A;  3BH7 B;  1ORK A;  4CCJ A;  2CRV A;  2HYF A;  5E8G A;  4ASN A;  2NT9 A;  4M2L A;  3OYA A;  4W8S A;  1O3T A;  4HF2 A;  3GTL J;  1I1S A;  2XT4 A;  2WY7 Q;  3D5R C;  3GFI A;  3WU1 B;  4LBV A;  1UEL B;  4HF1 A;  2ACJ A;  1AOY A;  2GLO A;  4U4B A;  1WFX A;  2XRO A;  4X07 A;  2ZME C;  1USS A;  4Q7J B;  3H9Q A;  2KDO A;  4RD2 A;  3KZY A;  1ETV A;  1RC9 A;  4G12 A;  2L2O A;  4XLP F;  1QVT A;  1MDM B;  2D2W A;  3EQN A;  3HOX J;  3GSI A;  3A1P A;  1V5G A;  5CVI A;  2XND A;  2EZK A;  2NAZ A;  2X53 S;  4P22 A;  2LBF A;  5C44 J;  1TNS A;  3J80 K;  1KC8 D;  1IG7 A;  4PC7 A;  4MNU A;  3P9I A;  1JTA A;  2P4W A;  1J5Y A;  2ADU A;  3P5J A;  3OYC A;  2R5Y A;  3PSZ A;  1G8X A;  5LEK A;  2RN7 A;  3HC7 A;  4W8Q A;  3IKT A;  1ZM9 A;  1D0X A;  3SHF A;  1FWZ A;  3CDI A;  1VQL I;  4KIF A;  1IJF A;  5C1E A;  1GUU A;  1A36 A;  1XCB A;  2OQG A;  3PUF A;  4HPQ A;  4JX6 A;  1QBJ A;  4IHV A;  3QYB A;  5HDG A;  2VBZ A;  3SEQ A;  2R7U A;  1S7A A;  3OPO A;  4U49 A;  2VT2 A;  1YRN B;  1YLO A;  4WZT A;  3LOC A;  2L3D A;  1VQ8 I;  1R1U A;  2DQL A;  2ZNY A;  4XON A;  4LG0 B;  3GO5 A;  5GAE J;  2LK2 A;  3A35 A;  1ITY A;  3SJZ A;  3IKV A;  3HBL A;  5HKK A;  1IB4 A;  4MTE A;  2QSG X;  1NJI D;  2Z1D A;  3L2V A;  4YEI A;  5DM6 F;  2ZFW A;  2Q6L A;  3ONY A;  4PJ0 C;  3KP7 A;  4XLC A;  5J1U A;  3E1S A;  2V1U A;  2I1L A;  1LFB A;  2JJ2 A;  1UCR A;  2FD5 A;  3L2Q A;  2D74 A;  4TSF A;  3PSI A;  3CCS B;  1HQC A;  3GWZ A;  4FXU A;  1U5T C;  5F0H A;  1FEX A;  3SQV A;  2A61 A;  2MLK A;  3ZMV A;  4BJ6 C;  2O0V A;  3REO A;  3KP2 A;  1GR1 A;  1YQA A;  2O6G E;  4UZE A;  3FZV A;  3AGQ A;  1AKH A;  4FE4 A;  3MZ8 A;  2OCC H;  1R58 A;  3VYR B;  1AWC A;  4MFD A;  3KZI C;  1MDM A;  3N97 A;  5FRN A;  3QPT A;  1Z0X A;  1G3S A;  1N78 A;  3DKY A;  3ZN0 A;  3ZQ7 A;  3LA2 A;  2OV7 A;  5DCM A;  4N3G A;  4L5I A;  2F5C A;  1BR1 A;  4M3D A;  1BJK A;  2ISY A;  1MGT A;  4X7D A;  1VQL B;  3Q0W A;  4BHP A;  1ODD A;  5AIQ A;  2HPI A;  3ZRG A;  1JGG A;  1GV5 A;  1DU0 A;  2UZK A;  2R93 J;  2EFQ A;  2HQN A;  5IP6 A;  3PFY A;  1WSR A;  1J59 A;  5H2F C;  1QVF B;  4BPR A;  3ZXS A;  2KRC A;  2ECB A;  3JAM Z;  2E1M C;  2XAQ A;  3SFI A;  5EGO B;  2E1O A;  5J1R A;  3FXL A;  1O8G A;  4G1B A;  4RAZ A;  1U8B A;  2XOK A;  1SAU A;  5FB2 A;  4BQQ A;  2IA1 A;  4K1X A;  2CU7 A;  4YFN F;  4CDG A;  1Z67 A;  4XLE A;  3MHP A;  2PMZ A;  4ZDP A;  2F4N A;  4PMH A;  2BX6 A;  2EFN A;  3SY2 A;  3AKZ A;  2XTX A;  1V0E A;  3A4C A;  1UG0 A;  3OYD A;  1CNE A;  1ZTR A;  3QYF A;  1HA8 A;  5LGN A;  5F0C A;  5HLT A;  2CW8 A;  2R3S A;  3MKY B;  2ZME B;  2JPB A;  3F9K A;  5GPC A;  3WE3 A;  5K7Z A;  3L1P A;  2BY3 A;  1COW A;  1NBM A;  3JQP A;  2GRE A;  2TRT A;  1BW5 A;  4B3F X;  2JA5 J;  1QZZ A;  2BSA A;  1WSU A;  2BW3 A;  2NPF A;  4IX7 A;  2JA6 J;  2EZL A;  4BKX A;  4UZF A;  2F48 A;  3PA2 A;  1STZ A;  1SVM A;  3RPU D;  3BTC A;  4HF0 A;  4OWR B;  3CF5 F;  1LQ1 A;  1OB2 A;  4NK8 A;  4QUZ A;  2AHO A;  4W1U A;  4EV0 A;  4A3L J;  4BXX J;  1OIS A;  5CYV A;  2QGU A;  3T51 B;  2BSP A;  1Z05 A;  1AA7 A;  3T53 B;  4Z06 A;  1ZK8 A;  2DA2 A;  3DU5 A;  3DBL B;  1IXR C;  3AL0 B;  1MAB A; 
#chains in the Genus database with same CATH homology
 1MMA A;  3FY3 A;  2Z16 A;  3IP4 B;  1WTH D;  3OYN A;  3RTR A;  2CV1 A;  4HSR A;  4RM3 A;  4JOM A;  1IRX A;  1QU3 A;  4GQN A;  4B43 A;  3DKX A;  1H8H A;  1V5F A;  4LIV A;  4E7J A;  3BCF A;  4BS9 A;  2HVR A;  2W7N A;  4NQW B;  2V7Q A;  2R9V A;  3PL8 A;  2A6T A;  3DPL C;  5CDF A;  2XDV A;  3EPZ A;  2KL4 A;  2QKL B;  3ZR8 X;  2INV A;  3OYF A;  4TKO B;  4ASU A;  3VSU A;  1T0F C;  1RWR A;  2UV1 A;  2WA0 A;  5DN6 A;  2I8D A;  2NSP A;  2IS4 A;  1JRG A;  1HZE A;  5HNH A;  1HG8 A;  3A1Y A;  2ZZG A;  3B4N A;  3LMW A;  1D0Y A;  2HVS A;  3OE7 A;  2CS3 A;  3OS1 A;  4YXW A;  2DCE A;  4Y3O A;  2BW3 B;  1O8H A;  4BE1 A;  2MYS A;  1UD3 A;  4MLO A;  3BC9 A;  1UD4 A;  2ZFU A;  2BVL A;  2O1D A;  2XF6 A;  3HOT A;  4F91 B;  2HPM A;  1HVX A;  4RM2 A;  1O8K A;  3L2W A;  1WJE A;  4Z06 A;  3KRG A;  1UAA A;  4XL9 A;  3ZIA A;  2VXD A;  3OR1 C;  1VLY A;  4G7X A;  3CES A;  4PK4 A;  3ZPN A;  1O8I A;  2XSJ C;  4BL0 B;  3HUG B;  1MNE A;  2NTQ A;  2VPL A;  2WJV A;  3PSF A;  2JIZ A;  2W6J A;  1Z7L A;  2PJR A;  1OLT A;  2WAF A;  4YEJ A;  1OHH A;  1W36 D;  2Z6B D;  1LKX A;  4DBR A;  4HNU A;  1W36 C;  4YRV A;  2XZL A;  2VBE A;  1K6Y A;  3FHN A;  3A3G A;  2K9M A;  1WMR A;  4ZYA A;  3A2K A;  4XOP A;  1KTW A;  1MMG A;  1K5C A;  3ZCO A;  4ZC3 A;  4KJZ A;  2IS1 A;  3MKZ A;  2NZM A;  3K4J A;  3K4M A;  4BQN A;  2HQA A;  3H5N A;  2XF7 A;  2BVM A;  4IKF A;  2X1D A;  4OJL A;  3HPG A;  4I84 A;  1KCC A;  3VDX A;  3K4K A;  1BHE A;  4DNR B;  3QYE A;  2WY8 Q;  1X1D A;  5LD2 C;  1WJB A;  2NT6 A;  4U7B A;  3HKZ A;  4QPQ A;  2Q1Z B;  2KHM A;  3OS0 A;  3GQ8 A;  3FDY A;  5FL7 A;  4L8J A;  2V4J C;  3NWS A;  3FKS A;  4G6T B;  1X19 A;  4BJT A;  3C2H A;  4CA0 A;  4NC8 A;  3I9V 2;  3OL4 A;  1I18 A;  2O17 A;  1J09 A;  4CCN A;  4F93 B;  1TZL A;  3FBN B;  4XKC A;  1E79 A;  1DBO A;  2MC4 A;  3UNG C;  4CCK A;  4CZC A;  2W6I A;  4FET A;  1MMD A;  1NG6 A;  2VBM A;  2XF5 A;  3DPT A;  2DOA A;  2X6W A;  2CFO A;  4EW9 A;  2DJI A;  3LSK A;  1BMF A;  4MXN A;  3OEH A;  2AQF A;  2M4K A;  4AVZ A;  4EAT A;  1ERD A;  4KKT A;  3OS2 A;  3GQA A;  3PNV A;  2R4G A;  2HVQ A;  4KKS A;  3AFH A;  4E7H A;  2R7Q A;  3BC8 A;  3HXL A;  3EUH C;  4XN0 A;  3TBI A;  3LSI A;  5TGT A;  2CV0 A;  4XOT A;  2VXZ A;  4DOZ A;  3OEE A;  4OJO A;  1X1C A;  1EA3 A;  4LIT A;  1T5E A;  3S8P A;  2HZD A;  2Y0S A;  2RRE A;  1MAB A;  2GOM A;  1PE9 A;  3V42 A;  2XC7 A;  3W2W A;  1WJF A;  1DGW Y;  2NOJ B;  2K5C A;  4YEL A;  4YZQ A;  4Z05 A;  3VYS B;  3OOU A;  4CCL A;  2LZJ A;  4HST A;  4CCO A;  3JUR A;  2VQG A;  2LY1 A;  3OYE A;  2R7O A;  1Z3X A;  3D5L A;  1OFL A;  2VQC A;  2DXI A;  4XKV A;  4E7Z A;  2HU9 A;  3EUA A;  3BG6 A;  3G2B A;  2M4G A;  4BAC A;  3VWB A;  1OGM X;  3K4B A;  2Q2E B;  3HG9 A;  2WSS A;  2IGN A;  2LOO A;  3KYL A;  4H4K C;  2UUZ A;  3L2R A;  4D1Q A;  2QE7 A;  4Y33 A;  4BE2 A;  3ZGK A;  1H80 A;  4DK0 A;  4F3Q A;  4YZX A;  2UWM A;  2VB6 A;  2M7A A;  4AYB A;  2E60 A;  2KVO A;  1S9H A;  4XOR A;  2F4I A;  2X3H A;  2VQL A;  3S93 A;  3GVJ A;  1GQ8 A;  3OIP A;  4NC7 A;  2IQ7 A;  4B3X A;  3M8J A;  3UR3 C;  1D1A A;  3K10 A;  3PNT A;  3MMY B;  4C2U A;  4BE0 A;  2XAU A;  1IDK A;  1IDJ A;  3BLY A;  1UD6 A;  1RMG A;  2FUG 2;  3N05 A;  4PFO A;  2GOX B;  4X0G A;  4F52 A;  2LRD A;  2M5S A;  3H0D A;  4JMQ A;  4E7I A;  3IAM 2;  3OIQ A;  2ELJ A;  1E1Q A;  5C1C A;  2W1O A;  1Z3Y A;  3MKW B;  2WBM A;  1BOB A;  4BUP A;  1QCX A;  1O8E A;  2VIX A;  3DU6 A;  2ZTN A;  3IUO A;  2OC6 A;  3AL0 B;  1O8F A;  4PJN A;  1MND A;  1P9Q C;  2NST A;  1D1C A;  3S32 A;  3ZQQ A;  2DT7 B;  2V26 A;  2PEC A;  1KCD A;  1LFP A;  3SEZ A;  2RQQ A;  4N4N B;  3DDY A;  3WQZ A;  2WAE A;  2VJ4 A;  3TL4 X;  1OB0 A;  4RMN A;  4HNT A;  1DBG A;  3K6G A;  4HG2 A;  4RLF A;  3LSH A;  4II2 A;  4CSW A;  3S3O A;  4ZDO A;  1EE6 A;  1X0C A;  4B47 A;  2W82 A;  2VKH A;  3DWL E;  3EUK L;  3LFU A;  2PYH A;  1W9X A;  3NE5 B;  2D3L A;  1LVK A;  2F1M A;  1DP3 A;  4OZZ A;  2X8K A;  2X51 A;  1W0K A;  1BN8 A;  1V5E A;  2F5V A;  3RCO A;  1O8M A;  1WJ5 A;  2K3P A;  4BDY A;  1YX3 A;  1PLU A;  2XZP A;  2R7S A;  3QOD A;  4J00 A;  3KX2 A;  2QX3 A;  3B8Y A;  2QY1 A;  2CMP A;  4PSX A;  4XKW A;  4F92 B;  3DTK A;  4B48 A;  1E0E A;  2L5Q A;  4XLH A;  2Z2S B;  3L2U A;  1E1R A;  4R79 A;  4XKB A;  4DNT B;  2ZZQ A;  2K9L A;  4HIZ A;  4XD7 A;  4GRI A;  2VBK A;  1BPL A;  2X1E A;  2NTP A;  4C30 A;  4NNJ A;  3OYK A;  4XLA A;  1QJV A;  1DQU A;  4ZTJ A;  3PUB A;  2V9K A;  2PJR B;  2LYC A;  3W2A A;  4BU2 A;  2XZO A;  2KP6 A;  1OFM A;  4C2L A;  4KIT B;  4C2T A;  2GJP A;  1Y56 A;  3PJR A;  1O8D A;  2M0M A;  1JI8 A;  2JA2 A;  1BLI A;  1IA5 A;  1UD2 A;  3OMY A;  2GK6 A;  4G6I A;  1FMV A;  4DIQ A;  1WPC A;  3U21 A;  3T56 B;  3OWT A;  4J01 A;  5FRM A;  3OYJ A;  1QHH D;  2V31 A;  3BCB A;  3S3N A;  3CJR B;  5HNF A;  3G05 A;  2UVE A;  2CH0 A;  4URR A;  4OAY A;  3DTE A;  4Y4R A;  3CMM A;  4BQO A;  2INU A;  1VZ0 A;  3SYT A;  3BCD A;  1KMH A;  3H9J A;  1G59 A;  2CV2 A;  4ZDL A;  1MMN A;  4F55 A;  4DJA A;  2KZV A;  4BDZ A;  1VBL A;  3W3C A;  1YX5 A;  3RSN A;  2KLO A;  2IS6 A;  4E7K A;  1MW7 A;  3DEE A;  1X4O A;  5CQG A;  2JSP A;  4YZ0 A;  1X1A A;  5CQE A;  3ZPP A;  3D5S C;  2KMU A;  3BCA A;  2HNH A;  4E4H A;  2D3N A;  4PSW A;  2R7X A;  1NRK A;  1RU4 A;  3OYM A;  2A5W A;  3HL2 A;  2ZZF A;  1OR7 C;  2V4D A;  2X6Y A;  4Z1M A;  3OL3 A;  3CJQ B;  1FX0 A;  1X4P A;  3PNY A;  3HOS A;  1PYV A;  1U0J A;  2MFZ A;  2WAQ A;  4JQF A;  1D1B A;  4YZA A;  4PUS A;  2MAB A;  2E1M B;  3VMV A;  5AMV A;  3SUC A;  3C2G A;  4W8T A;  4PJL A;  4BEH A;  4U87 A;  4E7L A;  2V1N A;  3M1C A;  3GVK A;  2LBF B;  3VYU B;  1NHC A;  4OZY A;  4KT6 A;  4P5O A;  2P0W A;  4TT3 A;  4E0F A;  2NTB A;  2IS2 A;  3DLA A;  1N75 A;  2O5R A;  2CUJ A;  2CUZ A;  1KZL A;  3VR6 A;  5IK2 A;  4E6K G;  1EFR A;  4E7S A;  4CCJ A;  2L9N A;  3RQ4 A;  5KNL A;  2HDW A;  2NT9 A;  1K28 D;  4ZJZ A;  3OYA A;  2QKM B;  4W8S A;  1Y6I A;  4ANJ A;  2WY7 Q;  3D5R C;  2CW7 A;  4B44 A;  1UEL B;  2EWE A;  2LRE A;  2X85 A;  3SDB A;  3H5A A;  1WFX A;  1X1B A;  2XGJ A;  4U4B A;  4CH7 A;  1E43 A;  1WJC A;  3H9Q A;  3OYH A;  3K4L A;  1NG7 A;  3LL7 A;  2ZXI A;  1FMW A;  2VJI A;  2KDO A;  3H9G A;  1PXZ A;  3OY9 A;  1AIR A;  4G7W A;  4ITV A;  2L2O A;  3EQN A;  3OOC A;  4AU7 A;  4LIU A;  2GJK A;  1BR4 A;  1E3X A;  2BOL A;  1V5G A;  2LC2 A;  3BH4 A;  2XND A;  3GRH A;  2IXS A;  2X53 S;  2KRH A;  4P22 A;  5HVQ C;  2LBF A;  2JUG A;  1VF7 A;  2O04 A;  5JHF A;  4PJJ A;  4FAS D;  1JTA A;  1WJD A;  4BGD A;  3OYC A;  2X1C A;  1G8X A;  3GBG A;  3GQ9 A;  3CZ6 A;  3HC7 A;  4W8Q A;  2F6C A;  1D0X A;  4IQ4 A;  3VST A;  2KPM A;  3GVL A;  2R7T A;  2WB1 A;  3T9G A;  5C1E A;  3OYL A;  4HPQ A;  1TT0 A;  4II3 A;  2DT6 A;  3QYB A;  3SEQ A;  3VYT B;  3OPO A;  2ZSI B;  2R7U A;  4U49 A;  3VMW A;  4OAZ A;  2ZSH B;  4XON A;  2L7K A;  3AL0 C;  1I8D A;  3A35 A;  2R7W A;  1PKV A;  3LSM A;  5HKK A;  1IB4 A;  3DPU A;  2Z1D A;  3L2V A;  3TMO A;  4B3G A;  3HAG A;  4BXF A;  4XLC A;  3GQ7 A;  3E1S A;  4TSF A;  5HOO A;  2IGK A;  3K4N A;  3L2Q A;  1UD8 A;  2JJ2 A;  3PSI A;  2PYG A;  3DTI A;  3QOE A;  4FXU A;  3I3L A;  2R7R A;  2O0V A;  4BJ6 C;  3A3B A;  1R6R A;  2ZTG A;  4HWV A;  2JVG A;  3H94 A;  3CP2 A;  1ZEL A;  3IAS 2;  3LSG A;  3VYR B;  3K70 D;  5FRN A;  3BG7 A;  1N78 A;  3DKY A;  2WAD A;  4DGW B;  4HEA 2;  2OV7 A;  2W00 A;  2E1B A;  1LDK B;  1WP6 A;  1O8L A;  1BR1 A;  1Z21 A;  2DIE A;  2WJY A;  1KON A;  1GLN A;  4HRI A;  3OYG A;  4NUB A;  4NK6 A;  3FKJ A;  5CKT A;  4XM3 A;  5KHD A;  4DBQ A;  2JDI A;  1D0Z A;  4PJM A;  2HPI A;  3ZRG A;  4CCM A;  4XN3 A;  2L9S A;  1WJA A;  4KIS A;  1SKY B;  3UW0 A;  3PFY A;  2E5N A;  1SFK A;  4XLF A;  1V0F A;  5KCM A;  3ZXS A;  1DGR M;  2KRC A;  2JVH A;  2VJ5 A;  2JJ1 A;  4C9Y A;  3FPP A;  2ZZE A;  3ZSC A;  2V7F A;  2E1M C;  2QXZ A;  4P1W A;  2V6E A;  4XMY A;  1O8G A;  2ODL A;  3S3M A;  3CF2 A;  2XOK A;  1SAU A;  4RLQ A;  2RNG A;  3H5R A;  4BQQ A;  4Z03 A;  2KQR A;  2R7V A;  5CPR B;  5LFA A;  2VKD A;  3OAA A;  3VSV A;  4OJP A;  1E3Z A;  3VSL A;  2WPD A;  3OYB A;  4QPO A;  4XLE A;  2PMZ A;  2F43 A;  4ZDP A;  4PMH A;  4N4O B;  1VJS A;  3KEW A;  3GQB A;  4DK1 A;  3WWG A;  1T95 A;  3AKZ A;  2ZXH A;  3W2V A;  1V0E A;  2X6X A;  1UG0 A;  3A4C A;  4BJ5 C;  3OYD A;  1H8E A;  3QYF A;  3EQO A;  1HA8 A;  4IQJ A;  4OJ5 A;  2IGO A;  5FRO A;  5HLT A;  2CK3 A;  3MKY B;  2CW8 A;  3JU4 A;  3HPH A;  3LNN A;  3K70 C;  3LMM A;  2MD0 A;  4XNF A;  3F9K A;  2WZP P;  2O0W A;  3CP8 A;  1COW A;  1NBM A;  2OUM A;  4ZTF A;  1W0J A;  2Z8G A;  2VL8 A;  1UD5 A;  4XQF A;  4B3F X;  2W4S A;  2E5Z A;  3OW7 A;  1O8J A;  1CZF A;  3FBI B;  3OFN A;  1QHG A;  1PJR A;  2HLD A;  3OYI A;  2BW3 A;  2LY2 A;  2GJR A;  2GK7 A;  4IX7 A;  3KEY A;  2VLA A;  3SZG A;  4CUG A;  1BR2 A;  1OOC A;  3B90 A;  4XR6 A;  2AQE A;  2VAS A;  2UVF A;  3K4C A;  3RPU D;  4UZU A;  4OWR B;  4IZZ A;  1OGO X;  4NK8 A;  2VQH A;  3DQV C;  4PFP A;  2LH9 A;  2M3A A;  3MD2 A;  3VSK A;  3ONQ A;  4BEH B;  2VJJ A;  4D9J A;  1N77 A;  3T51 B;  1YE9 A;  1AA7 A;  3NWT A;  1O88 A;  2M7B A;  2BSP A;  4W8R A;  3T53 B;  3OR2 C;  3E0J B;  3DU5 A;  3H35 A;  3J7A Y;  4KKU A;  2IGM A;  4MR0 A;  4OJ6 A;  1XG2 A;  4LG3 A;  2LG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...