5JLVC

Receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
EGRVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Botulinum neurotoxin type A
publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
total genus 38
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jlvC00
2G0YA 5JLVC 2F3LA 2BM4A 3N90A 2BM7A 2BM6A 2BM5A 4JRAC 2W7ZA 5JMCB 2J8IA
chains in the Genus database with same CATH superfamily
3BH6B 3GQAA 3B90A 2XT4A 2O0WA 2PECA 1HG8A 4NK6A 1X0CA 2VFPA 3LMWA 4OJPA 4C2LA 3ML3A 2XTXA 4HWVA 4XORA 3SZEA 3B4NA 1LLZA 3LYCA 2UVEA 3VSVA 4OJLA 1OGMX 4YDTA 3DU1X 1K8FA 1OGOX 3N90A 2VFOA 3GRHA 4MR0A 4PMHA 2NTQA 2PYGA 2XC1A 4YC5A 2VBKA 4XR6A 1PE9A 4YFOA 1K4ZA 1CZFA 1OOCA 4XOPA 3P4GA 2XTYA 4XLHA 4XLCA 3WWGA 1KQ5A 1LM1A 2BSPA 1LLWA 2X3HA 3T9GA 2QYUA 2B0RA 2UVFA 1AIRA 2X6XA 1WMRA 1O88A 4YZXA 3SQVA 1RU4A 4XN3A 4Z05A 4AVZA 1QCXA 2BM4A 2QX3A 3LJYA 3PETA 1CLWA 1QJVA 2NTPA 4XLEA 3VSUA 3BH7B 1JTAA 1QA1A 2NZMA 4U49A 4OZZA 4XKVA 1O8KA 4XKWA 1TYVA 1O8DA 2BM6A 1VBLA 2QXZA 3GQ8A 3JURA 4JRAC 1O8JA 3VMVA 1QRBA 4YEJA 4XLAA 1IB4A 4EW9A 4YZQA 5C1EA 3TH0A 3KRGA 4URRA 1RMGA 5JMCB 4NK8A 3N6ZA 1OFLA 2VJJA 4XQFA 1IDKA 3B8YA 1DABA 4OJOA 2ODLA 1DBOA 3PSZA 4OM9A 3VMWA 1DBGA 2J8KA 3ZSCA 3JX8A 2F3LA 3ZPPA 5C1CA 3GQ7A 4XOTA 2BM7A 2NT6A 4YZ0A 1WXRA 2NTBA 5AMVA 1KTWA 1NHCA 2O04A 4KH3A 1O8HA 1TYXA 2IOUG 2X85A 4XN0A 2EWEA 3EQOA 4W8QA 4YCQA 2QZAA 3UW0A 1GQ8A 2W7ZA 2X6YA 2QY1A 3PSSA 1IA5A 2O0VA 1RWRA 3NAWA 2VBEA 4XL9A 1O8IA 1O8LA 1PLUA 3NB2A 2BM5A 4I84A 2VFNA 4Z03A 4OJ5A 1QA3A 4YZAA 2BX6A 3RIQA 2V5IA 5JLVC 2NSPA 4MXNA 3SUCA 2VFQA 2O17A 4YEIA 1L1IA 1OFDA 3AK5A 2O1DA 1IDJA 1TSPA 1O8EA 2VFMA 4XLFA 4V02C 2NT9A 4U4BA 2XTWA 4Z06A 3SYJA 1QA2A 1EA0A 4YELA 2G0YA 2INUA 1O8MA 2Z8GA 1EE6A 4W8TA 1KCDA 1TYWA 1EZGA 3FY3A 2INVA 1OFMA 1OFEA 1H80A 1XG2A 2XT2A 4W8SA 2J8IA 2PYHA 2VBMA 1JRGA 4XM3A 3SY2A 2VJIA 3GQ9A 1QQ1A 2YUHA 1BHEA 1BN8A 1HF2A 3EQNA 4W8RA 2O6WA 1KCCA 4OPWA 1PXZA 1O8FA 1TYUA 4OZYA 4OJ6A 1QRCA 3VSTA 1O8GA 3H09A 2X6WA 5DNSA 2NSTA 4XMYA 4XNFA 1K5CA 2IQ7A 4XONA
chains in the Genus database with same CATH topology
3BH6B 3JX8A 1TSPA 2F3LA 2BM4A 2VFMA 4V02C 3LJYA 3PETA 1CLWA 2BM7A 2VFPA 3BH7B 4OJPA 1WXRA 3ML3A 3SYJA 1QA1A 1QA2A 3SZEA 3LYCA 2G0YA 4KH3A 1TYXA 2IOUG 4OJLA 1TYVA 1K8FA 1TYWA 3N90A 2VFOA 2BM6A 2XC1A 4JRAC 2W7ZA 1QRBA 2J8IA 1K4ZA 1QQ1A 2YUHA 1HF2A 3TH0A 3P4GA 2BM5A 2VFNA 4OPWA 4OJ5A 1QA3A 1KQ5A 1TYUA 2BX6A 3N6ZA 1QRCA 4OJ6A 3H09A 2V5IA 3RIQA 5JLVC 2VFQA 1DABA 4OJOA 3AK5A 2B0RA 4OM9A 5JMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0Y A;  5JLV C;  2F3L A;  2BM4 A;  3N90 A;  2BM7 A;  2BM6 A;  2BM5 A;  4JRA C;  2W7Z A;  5JMC B;  2J8I A; 
#chains in the Genus database with same CATH topology
 3BH6 B;  3GQA A;  3B90 A;  2XT4 A;  2O0W A;  2PEC A;  1HG8 A;  4NK6 A;  1X0C A;  2VFP A;  3LMW A;  4OJP A;  4C2L A;  3ML3 A;  2XTX A;  4HWV A;  4XOR A;  3SZE A;  3B4N A;  1LLZ A;  3LYC A;  2UVE A;  3VSV A;  4OJL A;  1OGM X;  4YDT A;  3DU1 X;  1K8F A;  1OGO X;  3N90 A;  2VFO A;  3GRH A;  4MR0 A;  4PMH A;  2NTQ A;  2PYG A;  2XC1 A;  4YC5 A;  2VBK A;  4XR6 A;  1PE9 A;  4YFO A;  1K4Z A;  1CZF A;  1OOC A;  4XOP A;  3P4G A;  2XTY A;  4XLH A;  4XLC A;  3WWG A;  1KQ5 A;  1LM1 A;  2BSP A;  1LLW A;  2X3H A;  3T9G A;  2QYU A;  2B0R A;  2UVF A;  1AIR A;  2X6X A;  1WMR A;  1O88 A;  4YZX A;  3SQV A;  1RU4 A;  4XN3 A;  4Z05 A;  4AVZ A;  1QCX A;  2BM4 A;  2QX3 A;  3LJY A;  3PET A;  1CLW A;  1QJV A;  2NTP A;  4XLE A;  3VSU A;  3BH7 B;  1JTA A;  1QA1 A;  2NZM A;  4U49 A;  4OZZ A;  4XKV A;  1O8K A;  4XKW A;  1TYV A;  1O8D A;  2BM6 A;  1VBL A;  2QXZ A;  3GQ8 A;  3JUR A;  4JRA C;  1O8J A;  3VMV A;  1QRB A;  4YEJ A;  4XLA A;  1IB4 A;  4EW9 A;  4YZQ A;  5C1E A;  3TH0 A;  3KRG A;  4URR A;  1RMG A;  5JMC B;  4NK8 A;  3N6Z A;  1OFL A;  2VJJ A;  4XQF A;  1IDK A;  3B8Y A;  1DAB A;  4OJO A;  2ODL A;  1DBO A;  3PSZ A;  4OM9 A;  3VMW A;  1DBG A;  2J8K A;  3ZSC A;  3JX8 A;  2F3L A;  3ZPP A;  5C1C A;  3GQ7 A;  4XOT A;  2BM7 A;  2NT6 A;  4YZ0 A;  1WXR A;  2NTB A;  5AMV A;  1KTW A;  1NHC A;  2O04 A;  4KH3 A;  1O8H A;  1TYX A;  2IOU G;  2X85 A;  4XN0 A;  2EWE A;  3EQO A;  4W8Q A;  4YCQ A;  2QZA A;  3UW0 A;  1GQ8 A;  2W7Z A;  2X6Y A;  2QY1 A;  3PSS A;  1IA5 A;  2O0V A;  1RWR A;  3NAW A;  2VBE A;  4XL9 A;  1O8I A;  1O8L A;  1PLU A;  3NB2 A;  2BM5 A;  4I84 A;  2VFN A;  4Z03 A;  4OJ5 A;  1QA3 A;  4YZA A;  2BX6 A;  3RIQ A;  2V5I A;  5JLV C;  2NSP A;  4MXN A;  3SUC A;  2VFQ A;  2O17 A;  4YEI A;  1L1I A;  1OFD A;  3AK5 A;  2O1D A;  1IDJ A;  1TSP A;  1O8E A;  2VFM A;  4XLF A;  4V02 C;  2NT9 A;  4U4B A;  2XTW A;  4Z06 A;  3SYJ A;  1QA2 A;  1EA0 A;  4YEL A;  2G0Y A;  2INU A;  1O8M A;  2Z8G A;  1EE6 A;  4W8T A;  1KCD A;  1TYW A;  1EZG A;  3FY3 A;  2INV A;  1OFM A;  1OFE A;  1H80 A;  1XG2 A;  2XT2 A;  4W8S A;  2J8I A;  2PYH A;  2VBM A;  1JRG A;  4XM3 A;  3SY2 A;  2VJI A;  3GQ9 A;  1QQ1 A;  2YUH A;  1BHE A;  1BN8 A;  1HF2 A;  3EQN A;  4W8R A;  2O6W A;  1KCC A;  4OPW A;  1PXZ A;  1O8F A;  1TYU A;  4OZY A;  4OJ6 A;  1QRC A;  3VST A;  1O8G A;  3H09 A;  2X6W A;  5DNS A;  2NST A;  4XMY A;  4XNF A;  1K5C A;  2IQ7 A;  4XON A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  3JX8 A;  1TSP A;  2F3L A;  2BM4 A;  2VFM A;  4V02 C;  3LJY A;  3PET A;  1CLW A;  2BM7 A;  2VFP A;  3BH7 B;  4OJP A;  1WXR A;  3ML3 A;  3SYJ A;  1QA1 A;  1QA2 A;  3SZE A;  3LYC A;  2G0Y A;  4KH3 A;  1TYX A;  2IOU G;  4OJL A;  1TYV A;  1K8F A;  1TYW A;  3N90 A;  2VFO A;  2BM6 A;  2XC1 A;  4JRA C;  2W7Z A;  1QRB A;  2J8I A;  1K4Z A;  1QQ1 A;  2YUH A;  1HF2 A;  3TH0 A;  3P4G A;  2BM5 A;  2VFN A;  4OPW A;  4OJ5 A;  1QA3 A;  1KQ5 A;  1TYU A;  2BX6 A;  3N6Z A;  1QRC A;  4OJ6 A;  3H09 A;  2V5I A;  3RIQ A;  5JLV C;  2VFQ A;  1DAB A;  4OJO A;  3AK5 A;  2B0R A;  4OM9 A;  5JMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...