5JLVC

Receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
EGRVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
molecule keywords Botulinum neurotoxin type A
total genus 38
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jlvC00
5JLVC 2F3LA 5JMCB 2BM5A 2BM4A 2BM6A 2G0YA 4JRAC 2J8IA 2W7ZA 2BM7A 3N90A
chains in the Genus database with same CATH superfamily
2IOUG 5C1EA 2INVA 3VSUA 2NT6A 2YUHA 1QRCA 3GQ8A 2NTQA 1RU4A 3WWGA 3NB2A 4OJ5A 4U49A 3LMWA 4YDTA 2X3HA 4PMHA 2QZAA 1QRBA 2W7ZA 1KTWA 1H80A 1K4ZA 1QCXA 4U4BA 4YELA 4URRA 2X6WA 3P4GA 2NTPA 4YZ0A 3PSZA 1EE6A 1KCDA 2BSPA 1TSPA 2XTXA 3KRGA 1O8HA 2NZMA 1LLWA 2O0WA 1DABA 4XKWA 3VSTA 3LYCA 1KCCA 1TYXA 1OGMX 3GRHA 4YEJA 3SUCA 4OJLA 1IA5A 4MXNA 5AMVA 5JMCB 1BN8A 2XT2A 4Z06A 3T9GA 2VFQA 4W8RA 2J8IA 1DBOA 4XONA 2QXZA 3BH7B 4XL9A 4XN0A 1O8GA 2O0VA 2X85A 2PYGA 4YFOA 1IB4A 5DNSA 3VMVA 1O8LA 3B4NA 4YC5A 4OZZA 1AIRA 2XTWA 3EQOA 1HG8A 2NTBA 2VBKA 3GQ9A 4XM3A 4OZYA 2O17A 2J8KA 2VFOA 4MR0A 4Z03A 3SY2A 3N6ZA 1DBGA 3B90A 3GQ7A 4XORA 1HF2A 1O88A 1OFLA 2NSPA 4XLAA 3ML3A 3LJYA 1O8MA 3PETA 4XOTA 2B0RA 2QY1A 2BM5A 4Z05A 1QA3A 1OFMA 4XQFA 3AK5A 4OM9A 3FY3A 1BHEA 3UW0A 2IQ7A 4XR6A 2VFNA 1RWRA 3GQAA 2QX3A 2VFMA 5C1CA 3JURA 1QJVA 4W8QA 1K5CA 2O6WA 3SYJA 3ZPPA 1X0CA 4W8SA 1VBLA 1LM1A 3TH0A 2INUA 2VJJA 2QYUA 1JTAA 4I84A 4KH3A 4NK8A 2X6YA 2PECA 3B8YA 3JX8A 4XKVA 4XLFA 1OOCA 4JRAC 4C2LA 1O8DA 1NHCA 2VBEA 2EWEA 3N90A 4XOPA 3DU1X 4AVZA 1JRGA 2XT4A 2NSTA 1O8JA 2O04A 1O8FA 3BH6B 3RIQA 1WMRA 4NK6A 4XN3A 2NT9A 2VFPA 1EA0A 2Z8GA 3NAWA 4XNFA 1GQ8A 2O1DA 1OFEA 4HWVA 1CLWA 1PE9A 1LLZA 1TYWA 1KQ5A 1PLUA 1CZFA 4YCQA 1IDKA 1K8FA 4YZAA 4YZQA 4OJPA 4XLHA 1O8KA 1O8EA 2G0YA 2UVFA 3EQNA 3PSSA 1QQ1A 1TYVA 2VJIA 3VSVA 4OPWA 4V02C 1OGOX 3H09A 1IDJA 2BM6A 4YZXA 2XC1A 2V5IA 4XLEA 4W8TA 1EZGA 2PYHA 2X6XA 4OJOA 1XG2A 4XLCA 1WXRA 1QA1A 3ZSCA 2ODLA 3SQVA 4OJ6A 2BM7A 5JLVC 2BX6A 1L1IA 2F3LA 1OFDA 2UVEA 4YEIA 1QA2A 2BM4A 3VMWA 1PXZA 4EW9A 1TYUA 2VBMA 4XMYA 1O8IA 2XTYA 3SZEA 1RMGA
chains in the Genus database with same CATH topology
2IOUG 2YUHA 2VFMA 1QRCA 4OJPA 4OJ5A 3SYJA 2G0YA 1QQ1A 1TYVA 3TH0A 2W7ZA 1QRBA 1K4ZA 4KH3A 4OPWA 3P4GA 3H09A 4V02C 3BH7B 3JX8A 2BM6A 2VFOA 4JRAC 2XC1A 3N6ZA 1TSPA 2V5IA 3N90A 1HF2A 4OJOA 1DABA 3LYCA 1WXRA 1QA1A 3BH6B 1TYXA 3RIQA 2VFPA 3ML3A 2BM7A 3LJYA 3PETA 2BX6A 4OJLA 4OJ6A 2F3LA 5JLVC 2B0RA 5JMCB 1QA2A 2BM5A 2BM4A 1QA3A 3AK5A 1CLWA 1TYUA 2VFQA 1TYWA 1KQ5A 4OM9A 2J8IA 3SZEA 1K8FA 2VFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLV C;  2F3L A;  5JMC B;  2BM5 A;  2BM4 A;  2BM6 A;  2G0Y A;  4JRA C;  2J8I A;  2W7Z A;  2BM7 A;  3N90 A; 
#chains in the Genus database with same CATH topology
 2IOU G;  5C1E A;  2INV A;  3VSU A;  2NT6 A;  2YUH A;  1QRC A;  3GQ8 A;  2NTQ A;  1RU4 A;  3WWG A;  3NB2 A;  4OJ5 A;  4U49 A;  3LMW A;  4YDT A;  2X3H A;  4PMH A;  2QZA A;  1QRB A;  2W7Z A;  1KTW A;  1H80 A;  1K4Z A;  1QCX A;  4U4B A;  4YEL A;  4URR A;  2X6W A;  3P4G A;  2NTP A;  4YZ0 A;  3PSZ A;  1EE6 A;  1KCD A;  2BSP A;  1TSP A;  2XTX A;  3KRG A;  1O8H A;  2NZM A;  1LLW A;  2O0W A;  1DAB A;  4XKW A;  3VST A;  3LYC A;  1KCC A;  1TYX A;  1OGM X;  3GRH A;  4YEJ A;  3SUC A;  4OJL A;  1IA5 A;  4MXN A;  5AMV A;  5JMC B;  1BN8 A;  2XT2 A;  4Z06 A;  3T9G A;  2VFQ A;  4W8R A;  2J8I A;  1DBO A;  4XON A;  2QXZ A;  3BH7 B;  4XL9 A;  4XN0 A;  1O8G A;  2O0V A;  2X85 A;  2PYG A;  4YFO A;  1IB4 A;  5DNS A;  3VMV A;  1O8L A;  3B4N A;  4YC5 A;  4OZZ A;  1AIR A;  2XTW A;  3EQO A;  1HG8 A;  2NTB A;  2VBK A;  3GQ9 A;  4XM3 A;  4OZY A;  2O17 A;  2J8K A;  2VFO A;  4MR0 A;  4Z03 A;  3SY2 A;  3N6Z A;  1DBG A;  3B90 A;  3GQ7 A;  4XOR A;  1HF2 A;  1O88 A;  1OFL A;  2NSP A;  4XLA A;  3ML3 A;  3LJY A;  1O8M A;  3PET A;  4XOT A;  2B0R A;  2QY1 A;  2BM5 A;  4Z05 A;  1QA3 A;  1OFM A;  4XQF A;  3AK5 A;  4OM9 A;  3FY3 A;  1BHE A;  3UW0 A;  2IQ7 A;  4XR6 A;  2VFN A;  1RWR A;  3GQA A;  2QX3 A;  2VFM A;  5C1C A;  3JUR A;  1QJV A;  4W8Q A;  1K5C A;  2O6W A;  3SYJ A;  3ZPP A;  1X0C A;  4W8S A;  1VBL A;  1LM1 A;  3TH0 A;  2INU A;  2VJJ A;  2QYU A;  1JTA A;  4I84 A;  4KH3 A;  4NK8 A;  2X6Y A;  2PEC A;  3B8Y A;  3JX8 A;  4XKV A;  4XLF A;  1OOC A;  4JRA C;  4C2L A;  1O8D A;  1NHC A;  2VBE A;  2EWE A;  3N90 A;  4XOP A;  3DU1 X;  4AVZ A;  1JRG A;  2XT4 A;  2NST A;  1O8J A;  2O04 A;  1O8F A;  3BH6 B;  3RIQ A;  1WMR A;  4NK6 A;  4XN3 A;  2NT9 A;  2VFP A;  1EA0 A;  2Z8G A;  3NAW A;  4XNF A;  1GQ8 A;  2O1D A;  1OFE A;  4HWV A;  1CLW A;  1PE9 A;  1LLZ A;  1TYW A;  1KQ5 A;  1PLU A;  1CZF A;  4YCQ A;  1IDK A;  1K8F A;  4YZA A;  4YZQ A;  4OJP A;  4XLH A;  1O8K A;  1O8E A;  2G0Y A;  2UVF A;  3EQN A;  3PSS A;  1QQ1 A;  1TYV A;  2VJI A;  3VSV A;  4OPW A;  4V02 C;  1OGO X;  3H09 A;  1IDJ A;  2BM6 A;  4YZX A;  2XC1 A;  2V5I A;  4XLE A;  4W8T A;  1EZG A;  2PYH A;  2X6X A;  4OJO A;  1XG2 A;  4XLC A;  1WXR A;  1QA1 A;  3ZSC A;  2ODL A;  3SQV A;  4OJ6 A;  2BM7 A;  5JLV C;  2BX6 A;  1L1I A;  2F3L A;  1OFD A;  2UVE A;  4YEI A;  1QA2 A;  2BM4 A;  3VMW A;  1PXZ A;  4EW9 A;  1TYU A;  2VBM A;  4XMY A;  1O8I A;  2XTY A;  3SZE A;  1RMG A; 
#chains in the Genus database with same CATH homology
 2IOU G;  2YUH A;  2VFM A;  1QRC A;  4OJP A;  4OJ5 A;  3SYJ A;  2G0Y A;  1QQ1 A;  1TYV A;  3TH0 A;  2W7Z A;  1QRB A;  1K4Z A;  4KH3 A;  4OPW A;  3P4G A;  3H09 A;  4V02 C;  3BH7 B;  3JX8 A;  2BM6 A;  2VFO A;  4JRA C;  2XC1 A;  3N6Z A;  1TSP A;  2V5I A;  3N90 A;  1HF2 A;  4OJO A;  1DAB A;  3LYC A;  1WXR A;  1QA1 A;  3BH6 B;  1TYX A;  3RIQ A;  2VFP A;  3ML3 A;  2BM7 A;  3LJY A;  3PET A;  2BX6 A;  4OJL A;  4OJ6 A;  2F3L A;  5JLV C;  2B0R A;  5JMC B;  1QA2 A;  2BM5 A;  2BM4 A;  1QA3 A;  3AK5 A;  1CLW A;  1TYU A;  2VFQ A;  1TYW A;  1KQ5 A;  4OM9 A;  2J8I A;  3SZE A;  1K8F A;  2VFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...