5JLVC

Receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
EGRVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
molecule keywords Botulinum neurotoxin type A
total genus 38
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jlvC00
2J8IA 2F3LA 2BM4A 2W7ZA 5JLVC 2G0YA 4JRAC 3N90A 5JMCB 2BM7A 2BM5A 2BM6A
chains in the Genus database with same CATH superfamily
2UVFA 1O8MA 1DBGA 2QYUA 2W7ZA 2X6YA 2VFPA 4XL9A 2O0WA 2Z8GA 4YZAA 5DNSA 3SZEA 3VMWA 3H09A 2UVEA 1TYXA 3DU1X 1HF2A 2BM6A 2VBEA 2NSPA 4NK8A 1QJVA 1OFLA 1LM1A 1PE9A 1OFEA 1O8HA 2QX3A 4XN3A 4XN0A 1TYUA 4AVZA 4Z05A 2VBMA 2O6WA 1WXRA 4XNFA 3JURA 2O0VA 2PECA 3EQNA 3RIQA 3SYJA 3KRGA 4OZYA 1KCCA 1O8FA 2X6WA 4XKVA 4YELA 1CZFA 1BHEA 2NT9A 1HG8A 4XMYA 3UW0A 4XLCA 1TYWA 1RU4A 4OJLA 4XKWA 3ZPPA 1IDKA 2YUHA 1XG2A 1O8GA 1K8FA 3SUCA 4XOTA 1O8IA 2XC1A 4XM3A 5JMCB 3LMWA 1OGOX 2NSTA 4YFOA 1LLWA 5AMVA 3GQ9A 5JLVC 1O8LA 2VJIA 3PSZA 4XLFA 2O04A 2VJJA 1DABA 4YEIA 1NHCA 4MXNA 4OZZA 2PYHA 1O8EA 2O1DA 4Z03A 4XR6A 4YC5A 4HWVA 2BX6A 3BH7B 2X85A 4U49A 4PMHA 1H80A 1O8KA 4U4BA 4YZQA 2X6XA 1VBLA 3P4GA 3GRHA 1IB4A 1RWRA 2BSPA 2VFNA 1K5CA 3VMVA 1IDJA 1LLZA 1CLWA 3GQAA 2J8IA 1KTWA 1RMGA 4W8SA 5C1CA 2IOUG 3N6ZA 4W8QA 3VSUA 1PLUA 1AIRA 3EQOA 3NAWA 2INVA 2XTXA 4XLAA 4XQFA 2INUA 2XTYA 4W8TA 2ODLA 4XLHA 3B8YA 1OFDA 2XT4A 3LJYA 4URRA 4YCQA 4OJOA 4YDTA 4OJ5A 2BM5A 1JTAA 1QQ1A 2XTWA 1DBOA 1PXZA 2B0RA 2VFMA 4NK6A 4OM9A 2PYGA 4JRAC 3ZSCA 1EA0A 2QZAA 4MR0A 4XORA 3FY3A 2NTQA 1KCDA 4YZ0A 3LYCA 1OGMX 3ML3A 3NB2A 5C1EA 4XOPA 4C2LA 4OJ6A 3B4NA 3GQ7A 1IA5A 3B90A 1QA3A 3JX8A 4V02C 3SQVA 3VSVA 1EZGA 4OPWA 2VBKA 3PSSA 1KQ5A 2IQ7A 2EWEA 1QCXA 4EW9A 1QRCA 1GQ8A 2G0YA 1L1IA 1TSPA 4Z06A 2NZMA 2O17A 1K4ZA 1QA1A 3GQ8A 2J8KA 4W8RA 1JRGA 2BM4A 4XONA 1O8JA 4XLEA 3VSTA 4OJPA 3T9GA 2QXZA 1OOCA 1O88A 3WWGA 2BM7A 2X3HA 1O8DA 1X0CA 2F3LA 2NT6A 2V5IA 2NTPA 3SY2A 1TYVA 3PETA 3TH0A 1WMRA 3AK5A 1QRBA 4I84A 2QY1A 3BH6B 4YEJA 3N90A 2VFOA 2VFQA 1OFMA 2NTBA 2XT2A 1QA2A 4KH3A 1BN8A 1EE6A 4YZXA
chains in the Genus database with same CATH topology
1KQ5A 2J8IA 2IOUG 1K8FA 2W7ZA 3N6ZA 2VFPA 1QRCA 2G0YA 2XC1A 3SZEA 1TSPA 5JMCB 3H09A 1QA1A 1K4ZA 1TYXA 1HF2A 2BM6A 2BM4A 5JLVC 3LJYA 4OJPA 1TYUA 1QA2A 1DABA 4OJOA 4OJ5A 2BM7A 2BM5A 1QQ1A 1WXRA 2F3LA 2B0RA 4OM9A 2VFMA 2V5IA 3RIQA 3SYJA 4JRAC 1TYVA 2BX6A 3BH7B 3PETA 2YUHA 3TH0A 3AK5A 1QRBA 3LYCA 3ML3A 3BH6B 3P4GA 4OJ6A 3N90A 2VFOA 1TYWA 2VFQA 2VFNA 3JX8A 4OJLA 4V02C 1QA3A 4KH3A 4OPWA 1CLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  2F3L A;  2BM4 A;  2W7Z A;  5JLV C;  2G0Y A;  4JRA C;  3N90 A;  5JMC B;  2BM7 A;  2BM5 A;  2BM6 A; 
#chains in the Genus database with same CATH topology
 2UVF A;  1O8M A;  1DBG A;  2QYU A;  2W7Z A;  2X6Y A;  2VFP A;  4XL9 A;  2O0W A;  2Z8G A;  4YZA A;  5DNS A;  3SZE A;  3VMW A;  3H09 A;  2UVE A;  1TYX A;  3DU1 X;  1HF2 A;  2BM6 A;  2VBE A;  2NSP A;  4NK8 A;  1QJV A;  1OFL A;  1LM1 A;  1PE9 A;  1OFE A;  1O8H A;  2QX3 A;  4XN3 A;  4XN0 A;  1TYU A;  4AVZ A;  4Z05 A;  2VBM A;  2O6W A;  1WXR A;  4XNF A;  3JUR A;  2O0V A;  2PEC A;  3EQN A;  3RIQ A;  3SYJ A;  3KRG A;  4OZY A;  1KCC A;  1O8F A;  2X6W A;  4XKV A;  4YEL A;  1CZF A;  1BHE A;  2NT9 A;  1HG8 A;  4XMY A;  3UW0 A;  4XLC A;  1TYW A;  1RU4 A;  4OJL A;  4XKW A;  3ZPP A;  1IDK A;  2YUH A;  1XG2 A;  1O8G A;  1K8F A;  3SUC A;  4XOT A;  1O8I A;  2XC1 A;  4XM3 A;  5JMC B;  3LMW A;  1OGO X;  2NST A;  4YFO A;  1LLW A;  5AMV A;  3GQ9 A;  5JLV C;  1O8L A;  2VJI A;  3PSZ A;  4XLF A;  2O04 A;  2VJJ A;  1DAB A;  4YEI A;  1NHC A;  4MXN A;  4OZZ A;  2PYH A;  1O8E A;  2O1D A;  4Z03 A;  4XR6 A;  4YC5 A;  4HWV A;  2BX6 A;  3BH7 B;  2X85 A;  4U49 A;  4PMH A;  1H80 A;  1O8K A;  4U4B A;  4YZQ A;  2X6X A;  1VBL A;  3P4G A;  3GRH A;  1IB4 A;  1RWR A;  2BSP A;  2VFN A;  1K5C A;  3VMV A;  1IDJ A;  1LLZ A;  1CLW A;  3GQA A;  2J8I A;  1KTW A;  1RMG A;  4W8S A;  5C1C A;  2IOU G;  3N6Z A;  4W8Q A;  3VSU A;  1PLU A;  1AIR A;  3EQO A;  3NAW A;  2INV A;  2XTX A;  4XLA A;  4XQF A;  2INU A;  2XTY A;  4W8T A;  2ODL A;  4XLH A;  3B8Y A;  1OFD A;  2XT4 A;  3LJY A;  4URR A;  4YCQ A;  4OJO A;  4YDT A;  4OJ5 A;  2BM5 A;  1JTA A;  1QQ1 A;  2XTW A;  1DBO A;  1PXZ A;  2B0R A;  2VFM A;  4NK6 A;  4OM9 A;  2PYG A;  4JRA C;  3ZSC A;  1EA0 A;  2QZA A;  4MR0 A;  4XOR A;  3FY3 A;  2NTQ A;  1KCD A;  4YZ0 A;  3LYC A;  1OGM X;  3ML3 A;  3NB2 A;  5C1E A;  4XOP A;  4C2L A;  4OJ6 A;  3B4N A;  3GQ7 A;  1IA5 A;  3B90 A;  1QA3 A;  3JX8 A;  4V02 C;  3SQV A;  3VSV A;  1EZG A;  4OPW A;  2VBK A;  3PSS A;  1KQ5 A;  2IQ7 A;  2EWE A;  1QCX A;  4EW9 A;  1QRC A;  1GQ8 A;  2G0Y A;  1L1I A;  1TSP A;  4Z06 A;  2NZM A;  2O17 A;  1K4Z A;  1QA1 A;  3GQ8 A;  2J8K A;  4W8R A;  1JRG A;  2BM4 A;  4XON A;  1O8J A;  4XLE A;  3VST A;  4OJP A;  3T9G A;  2QXZ A;  1OOC A;  1O88 A;  3WWG A;  2BM7 A;  2X3H A;  1O8D A;  1X0C A;  2F3L A;  2NT6 A;  2V5I A;  2NTP A;  3SY2 A;  1TYV A;  3PET A;  3TH0 A;  1WMR A;  3AK5 A;  1QRB A;  4I84 A;  2QY1 A;  3BH6 B;  4YEJ A;  3N90 A;  2VFO A;  2VFQ A;  1OFM A;  2NTB A;  2XT2 A;  1QA2 A;  4KH3 A;  1BN8 A;  1EE6 A;  4YZX A; 
#chains in the Genus database with same CATH homology
 1KQ5 A;  2J8I A;  2IOU G;  1K8F A;  2W7Z A;  3N6Z A;  2VFP A;  1QRC A;  2G0Y A;  2XC1 A;  3SZE A;  1TSP A;  5JMC B;  3H09 A;  1QA1 A;  1K4Z A;  1TYX A;  1HF2 A;  2BM6 A;  2BM4 A;  5JLV C;  3LJY A;  4OJP A;  1TYU A;  1QA2 A;  1DAB A;  4OJO A;  4OJ5 A;  2BM7 A;  2BM5 A;  1QQ1 A;  1WXR A;  2F3L A;  2B0R A;  4OM9 A;  2VFM A;  2V5I A;  3RIQ A;  3SYJ A;  4JRA C;  1TYV A;  2BX6 A;  3BH7 B;  3PET A;  2YUH A;  3TH0 A;  3AK5 A;  1QRB A;  3LYC A;  3ML3 A;  3BH6 B;  3P4G A;  4OJ6 A;  3N90 A;  2VFO A;  1TYW A;  2VFQ A;  2VFN A;  3JX8 A;  4OJL A;  4V02 C;  1QA3 A;  4KH3 A;  4OPW A;  1CLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...