5JLVC

Receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
b'EGRVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Botulinum neurotoxin type A
molecule tags Hydrolase
source organism Clostridium botulinum
publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
total genus 38
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jlvC00
2BM7A 4JRAC 2F3LA 2BM6A 2J8IA 5JMCB 3N90A 2BM5A 5JLVC 2BM4A 2G0YA 2W7ZA
chains in the Genus database with same CATH superfamily
4YELA 2V5IA 4XONA 2O04A 1TYXA 3KRGA 4XKWA 4YDTA 2XTWA 3VSTA 1HF2A 2NSPA 2QYUA 2VBMA 4JRAC 1O8KA 5C1CA 3JURA 2VFOA 4XLFA 2BM4A 4XQFA 3FY3A 3JX8A 4OJLA 1O8DA 2BM7A 3BH7B 4XKVA 4XLCA 1QJVA 2NT9A 2O17A 2PYHA 1K8FA 3ZSCA 3GQ9A 3EQNA 3LJYA 4OZZA 1QCXA 2PYGA 2VBKA 3VSUA 4YZQA 1CZFA 1BN8A 2O0WA 4W8TA 2IOUG 4XLEA 1IA5A 4YC5A 1O8EA 4HWVA 1EE6A 3LYCA 2INVA 4XL9A 4XLHA 1TYVA 4XR6A 2BM6A 3NB2A 4YEJA 4Z03A 1KCDA 1WMRA 4XORA 3ZPPA 1RWRA 4W8QA 4YZXA 4YEIA 1O8GA 1L1IA 4MXNA 3VMWA 1IDKA 4YZAA 3T9GA 2NZMA 2G0YA 3BH6B 4V02C 2XC1A 1DBGA 2VJJA 4Z06A 4NK6A 4URRA 2BSPA 3VSVA 1XG2A 3UW0A 1QRBA 1LM1A 1X0CA 2BM5A 3SUCA 2O1DA 1LLZA 3B90A 1QQ1A 1DABA 2NSTA 3P4GA 2J8KA 4W8SA 1WXRA 4OJ5A 4W8RA 2XTXA 1EA0A 4AVZA 2X85A 1LLWA 2VFNA 4C2LA 4OM9A 2NT6A 4EW9A 1JRGA 4I84A 2XTYA 3RIQA 1QA3A 1DBOA 3PSSA 5C1EA 3GQ7A 2EWEA 4OJPA 2F3LA 2VJIA 3SZEA 1O8JA 1OGMX 4XNFA 1KCCA 3N6ZA 3ML3A 1IB4A 1K5CA 4Z05A 1QA1A 1H80A 2PECA 1PXZA 1TYWA 3NAWA 2XT4A 5DNSA 1BHEA 5AMVA 3TH0A 3SYJA 3AK5A 1OOCA 1TSPA 1QA2A 5JLVC 3H09A 1OGOX 1VBLA 2ODLA 2X6WA 1OFEA 2QXZA 1O8MA 2O0VA 3GQ8A 4PMHA 2NTBA 2NTQA 2VFMA 4YFOA 4OPWA 1O8IA 1TYUA 1KTWA 3GRHA 4MR0A 2Z8GA 4XN0A 1JTAA 4YCQA 4XMYA 2YUHA 3SQVA 2VBEA 2XT2A 2J8IA 2QX3A 3B8YA 1AIRA 1RMGA 3EQOA 1QRCA 4XN3A 4NK8A 1O8HA 1K4ZA 2QZAA 2X6XA 1EZGA 1GQ8A 1KQ5A 2INUA 1O88A 5JMCB 4OZYA 1O8FA 1RU4A 3B4NA 4OJOA 2UVEA 3WWGA 1O8LA 1OFLA 3GQAA 3LMWA 2IQ7A 1PE9A 2X3HA 3PETA 4XLAA 1NHCA 2VFPA 2UVFA 1OFDA 4U4BA 1OFMA 4XOPA 4YZ0A 4XM3A 2VFQA 3PSZA 1IDJA 2X6YA 4KH3A 4XOTA 2B0RA 2BX6A 4OJ6A 3VMVA 3DU1X 4U49A 1CLWA 1PLUA 2O6WA 3N90A 3SY2A 2QY1A 1HG8A 2NTPA 2W7ZA
chains in the Genus database with same CATH topology
3LYCA 2VFNA 4OM9A 1TYVA 2V5IA 2J8IA 2BM6A 3RIQA 1QA3A 1QRCA 1TYXA 1HF2A 1K4ZA 4JRAC 2F3LA 4OJPA 1KQ5A 3SZEA 5JMCB 3N6ZA 3ML3A 2VFOA 4OJOA 2BM4A 2G0YA 3BH6B 3JX8A 4V02C 2XC1A 4OJLA 1TYWA 1QA1A 2BM7A 3BH7B 3PETA 3TH0A 3AK5A 3SYJA 1QRBA 2VFPA 1K8FA 1TSPA 2BM5A 3LJYA 1QA2A 5JLVC 3H09A 2VFQA 4KH3A 1DABA 1QQ1A 2B0RA 2BX6A 2VFMA 3P4GA 4OJ6A 4OPWA 1CLWA 1TYUA 3N90A 4OJ5A 1WXRA 2IOUG 2YUHA 2W7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BM7 A;  4JRA C;  2F3L A;  2BM6 A;  2J8I A;  5JMC B;  3N90 A;  2BM5 A;  5JLV C;  2BM4 A;  2G0Y A;  2W7Z A; 
#chains in the Genus database with same CATH topology
 4YEL A;  2V5I A;  4XON A;  2O04 A;  1TYX A;  3KRG A;  4XKW A;  4YDT A;  2XTW A;  3VST A;  1HF2 A;  2NSP A;  2QYU A;  2VBM A;  4JRA C;  1O8K A;  5C1C A;  3JUR A;  2VFO A;  4XLF A;  2BM4 A;  4XQF A;  3FY3 A;  3JX8 A;  4OJL A;  1O8D A;  2BM7 A;  3BH7 B;  4XKV A;  4XLC A;  1QJV A;  2NT9 A;  2O17 A;  2PYH A;  1K8F A;  3ZSC A;  3GQ9 A;  3EQN A;  3LJY A;  4OZZ A;  1QCX A;  2PYG A;  2VBK A;  3VSU A;  4YZQ A;  1CZF A;  1BN8 A;  2O0W A;  4W8T A;  2IOU G;  4XLE A;  1IA5 A;  4YC5 A;  1O8E A;  4HWV A;  1EE6 A;  3LYC A;  2INV A;  4XL9 A;  4XLH A;  1TYV A;  4XR6 A;  2BM6 A;  3NB2 A;  4YEJ A;  4Z03 A;  1KCD A;  1WMR A;  4XOR A;  3ZPP A;  1RWR A;  4W8Q A;  4YZX A;  4YEI A;  1O8G A;  1L1I A;  4MXN A;  3VMW A;  1IDK A;  4YZA A;  3T9G A;  2NZM A;  2G0Y A;  3BH6 B;  4V02 C;  2XC1 A;  1DBG A;  2VJJ A;  4Z06 A;  4NK6 A;  4URR A;  2BSP A;  3VSV A;  1XG2 A;  3UW0 A;  1QRB A;  1LM1 A;  1X0C A;  2BM5 A;  3SUC A;  2O1D A;  1LLZ A;  3B90 A;  1QQ1 A;  1DAB A;  2NST A;  3P4G A;  2J8K A;  4W8S A;  1WXR A;  4OJ5 A;  4W8R A;  2XTX A;  1EA0 A;  4AVZ A;  2X85 A;  1LLW A;  2VFN A;  4C2L A;  4OM9 A;  2NT6 A;  4EW9 A;  1JRG A;  4I84 A;  2XTY A;  3RIQ A;  1QA3 A;  1DBO A;  3PSS A;  5C1E A;  3GQ7 A;  2EWE A;  4OJP A;  2F3L A;  2VJI A;  3SZE A;  1O8J A;  1OGM X;  4XNF A;  1KCC A;  3N6Z A;  3ML3 A;  1IB4 A;  1K5C A;  4Z05 A;  1QA1 A;  1H80 A;  2PEC A;  1PXZ A;  1TYW A;  3NAW A;  2XT4 A;  5DNS A;  1BHE A;  5AMV A;  3TH0 A;  3SYJ A;  3AK5 A;  1OOC A;  1TSP A;  1QA2 A;  5JLV C;  3H09 A;  1OGO X;  1VBL A;  2ODL A;  2X6W A;  1OFE A;  2QXZ A;  1O8M A;  2O0V A;  3GQ8 A;  4PMH A;  2NTB A;  2NTQ A;  2VFM A;  4YFO A;  4OPW A;  1O8I A;  1TYU A;  1KTW A;  3GRH A;  4MR0 A;  2Z8G A;  4XN0 A;  1JTA A;  4YCQ A;  4XMY A;  2YUH A;  3SQV A;  2VBE A;  2XT2 A;  2J8I A;  2QX3 A;  3B8Y A;  1AIR A;  1RMG A;  3EQO A;  1QRC A;  4XN3 A;  4NK8 A;  1O8H A;  1K4Z A;  2QZA A;  2X6X A;  1EZG A;  1GQ8 A;  1KQ5 A;  2INU A;  1O88 A;  5JMC B;  4OZY A;  1O8F A;  1RU4 A;  3B4N A;  4OJO A;  2UVE A;  3WWG A;  1O8L A;  1OFL A;  3GQA A;  3LMW A;  2IQ7 A;  1PE9 A;  2X3H A;  3PET A;  4XLA A;  1NHC A;  2VFP A;  2UVF A;  1OFD A;  4U4B A;  1OFM A;  4XOP A;  4YZ0 A;  4XM3 A;  2VFQ A;  3PSZ A;  1IDJ A;  2X6Y A;  4KH3 A;  4XOT A;  2B0R A;  2BX6 A;  4OJ6 A;  3VMV A;  3DU1 X;  4U49 A;  1CLW A;  1PLU A;  2O6W A;  3N90 A;  3SY2 A;  2QY1 A;  1HG8 A;  2NTP A;  2W7Z A; 
#chains in the Genus database with same CATH homology
 3LYC A;  2VFN A;  4OM9 A;  1TYV A;  2V5I A;  2J8I A;  2BM6 A;  3RIQ A;  1QA3 A;  1QRC A;  1TYX A;  1HF2 A;  1K4Z A;  4JRA C;  2F3L A;  4OJP A;  1KQ5 A;  3SZE A;  5JMC B;  3N6Z A;  3ML3 A;  2VFO A;  4OJO A;  2BM4 A;  2G0Y A;  3BH6 B;  3JX8 A;  4V02 C;  2XC1 A;  4OJL A;  1TYW A;  1QA1 A;  2BM7 A;  3BH7 B;  3PET A;  3TH0 A;  3AK5 A;  3SYJ A;  1QRB A;  2VFP A;  1K8F A;  1TSP A;  2BM5 A;  3LJY A;  1QA2 A;  5JLV C;  3H09 A;  2VFQ A;  4KH3 A;  1DAB A;  1QQ1 A;  2B0R A;  2BX6 A;  2VFM A;  3P4G A;  4OJ6 A;  4OPW A;  1CLW A;  1TYU A;  3N90 A;  4OJ5 A;  1WXR A;  2IOU G;  2YUH A;  2W7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...