5JLVC

Receptor binding domain of botulinum neurotoxin a in complex with human glycosylated sv2c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
EGRVERDKYANFTINFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Botulinum neurotoxin type A
publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 38
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jlvC00
5JMCB 3N90A 5JLVC 2BM7A 2BM5A 2J8IA 2BM6A 2W7ZA 2F3LA 2BM4A 2G0YA 4JRAC
chains in the Genus database with same CATH superfamily
1O8IA 1CLWA 4OJ6A 1OOCA 4W8TA 5DNSA 2X6YA 2EWEA 1EE6A 3SUCA 4YEIA 3EQOA 1O8DA 1GQ8A 2O04A 1IA5A 3BH7B 4XLAA 3N90A 4XKWA 3H09A 4XLHA 4YZXA 2BM5A 2IOUG 3VSTA 2O17A 1DBGA 4XLCA 3NAWA 4YZAA 4EW9A 3UW0A 4W8QA 2VBMA 2BX6A 3FY3A 4OZZA 2X3HA 4MR0A 3B4NA 1O8LA 2VFOA 2XC1A 2XTXA 4XORA 1L1IA 4Z05A 1BHEA 2BM7A 3B8YA 4XOPA 1OFLA 4XNFA 1QRBA 1OFDA 3P4GA 3SY2A 1IDKA 3VSUA 2F3LA 1PE9A 2NSTA 2XT4A 4YDTA 2VBEA 2XT2A 1O8JA 3T9GA 4OJOA 1RWRA 2PECA 4NK8A 2BM6A 2NTQA 3LYCA 3SQVA 2NT9A 4HWVA 2XTYA 1OFEA 4XN0A 2X85A 4URRA 1JTAA 1LLZA 4YZQA 2VJIA 1K8FA 1QCXA 4OPWA 4YELA 1HF2A 2INUA 2VFNA 2O1DA 2VFMA 4XMYA 2VFPA 4OZYA 1WXRA 2UVEA 1VBLA 2VJJA 1O8MA 2IQ7A 2BM4A 2PYHA 3BH6B 2Z8GA 4YEJA 1WMRA 3GQ7A 4AVZA 2X6XA 3KRGA 2VFQA 3N6ZA 1TYUA 1CZFA 2NTPA 2VBKA 2XTWA 3WWGA 1O8EA 2NZMA 2QYUA 3ZSCA 5JMCB 1EZGA 2O0WA 2QXZA 3ML3A 3VMVA 3VMWA 2J8KA 2NSPA 2YUHA 5C1CA 1O8GA 1QRCA 1NHCA 3SYJA 4OJPA 4XM3A 4YC5A 4Z06A 5JLVC 2O0VA 1H80A 1JRGA 1O8HA 4KH3A 1QA1A 3GQ9A 4OM9A 4V02C 1O88A 4XLEA 3RIQA 3PSZA 4XKVA 2BSPA 3SZEA 2QX3A 1RU4A 4W8SA 2W7ZA 3DU1X 1IB4A 4MXNA 1LM1A 1X0CA 2G0YA 1TSPA 1TYVA 1QJVA 3ZPPA 4U49A 4YFOA 3AK5A 1XG2A 3JURA 3PETA 3GRHA 5AMVA 2NTBA 2X6WA 3B90A 4YZ0A 3VSVA 3GQ8A 4W8RA 4XR6A 4OJ5A 4XLFA 1LLWA 1RMGA 2QY1A 4XONA 4XN3A 4NK6A 2NT6A 1IDJA 1DABA 1PLUA 3JX8A 3NB2A 2O6WA 4JRAC 1TYWA 3EQNA 3PSSA 4OJLA 4XOTA 1OGMX 1O8KA 3GQAA 1KQ5A 1OFMA 1QQ1A 4YCQA 2QZAA 4U4BA 4C2LA 1KTWA 2J8IA 1K5CA 2B0RA 2INVA 1O8FA 4Z03A 1TYXA 1BN8A 1OGOX 3LJYA 1KCDA 1EA0A 4PMHA 3TH0A 2UVFA 1DBOA 2V5IA 1PXZA 1AIRA 1HG8A 3LMWA 5C1EA 2ODLA 4XQFA 1KCCA 2PYGA 1QA2A 1K4ZA 4I84A 1QA3A 4XL9A
chains in the Genus database with same CATH topology
1CLWA 4OJ6A 5JMCB 3ML3A 4OJOA 1DABA 2YUHA 2BM6A 3JX8A 1QRCA 3LYCA 4OJPA 4JRAC 3BH7B 3SYJA 1TYWA 4OJLA 3N90A 5JLVC 3H09A 1QA1A 4KH3A 2BM5A 2IOUG 4OM9A 1KQ5A 4V02C 1QQ1A 1K8FA 4OPWA 3RIQA 1HF2A 2VFNA 2VFMA 3SZEA 2VFPA 1WXRA 2J8IA 2BX6A 2B0RA 2W7ZA 2BM4A 2XC1A 2VFOA 1TYXA 2G0YA 3BH6B 1TSPA 1TYVA 3LJYA 3AK5A 3TH0A 3PETA 2BM7A 2V5IA 2VFQA 3N6ZA 1QRBA 1TYUA 3P4GA 1QA2A 2F3LA 4OJ5A 1K4ZA 1QA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JMC B;  3N90 A;  5JLV C;  2BM7 A;  2BM5 A;  2J8I A;  2BM6 A;  2W7Z A;  2F3L A;  2BM4 A;  2G0Y A;  4JRA C; 
#chains in the Genus database with same CATH topology
 1O8I A;  1CLW A;  4OJ6 A;  1OOC A;  4W8T A;  5DNS A;  2X6Y A;  2EWE A;  1EE6 A;  3SUC A;  4YEI A;  3EQO A;  1O8D A;  1GQ8 A;  2O04 A;  1IA5 A;  3BH7 B;  4XLA A;  3N90 A;  4XKW A;  3H09 A;  4XLH A;  4YZX A;  2BM5 A;  2IOU G;  3VST A;  2O17 A;  1DBG A;  4XLC A;  3NAW A;  4YZA A;  4EW9 A;  3UW0 A;  4W8Q A;  2VBM A;  2BX6 A;  3FY3 A;  4OZZ A;  2X3H A;  4MR0 A;  3B4N A;  1O8L A;  2VFO A;  2XC1 A;  2XTX A;  4XOR A;  1L1I A;  4Z05 A;  1BHE A;  2BM7 A;  3B8Y A;  4XOP A;  1OFL A;  4XNF A;  1QRB A;  1OFD A;  3P4G A;  3SY2 A;  1IDK A;  3VSU A;  2F3L A;  1PE9 A;  2NST A;  2XT4 A;  4YDT A;  2VBE A;  2XT2 A;  1O8J A;  3T9G A;  4OJO A;  1RWR A;  2PEC A;  4NK8 A;  2BM6 A;  2NTQ A;  3LYC A;  3SQV A;  2NT9 A;  4HWV A;  2XTY A;  1OFE A;  4XN0 A;  2X85 A;  4URR A;  1JTA A;  1LLZ A;  4YZQ A;  2VJI A;  1K8F A;  1QCX A;  4OPW A;  4YEL A;  1HF2 A;  2INU A;  2VFN A;  2O1D A;  2VFM A;  4XMY A;  2VFP A;  4OZY A;  1WXR A;  2UVE A;  1VBL A;  2VJJ A;  1O8M A;  2IQ7 A;  2BM4 A;  2PYH A;  3BH6 B;  2Z8G A;  4YEJ A;  1WMR A;  3GQ7 A;  4AVZ A;  2X6X A;  3KRG A;  2VFQ A;  3N6Z A;  1TYU A;  1CZF A;  2NTP A;  2VBK A;  2XTW A;  3WWG A;  1O8E A;  2NZM A;  2QYU A;  3ZSC A;  5JMC B;  1EZG A;  2O0W A;  2QXZ A;  3ML3 A;  3VMV A;  3VMW A;  2J8K A;  2NSP A;  2YUH A;  5C1C A;  1O8G A;  1QRC A;  1NHC A;  3SYJ A;  4OJP A;  4XM3 A;  4YC5 A;  4Z06 A;  5JLV C;  2O0V A;  1H80 A;  1JRG A;  1O8H A;  4KH3 A;  1QA1 A;  3GQ9 A;  4OM9 A;  4V02 C;  1O88 A;  4XLE A;  3RIQ A;  3PSZ A;  4XKV A;  2BSP A;  3SZE A;  2QX3 A;  1RU4 A;  4W8S A;  2W7Z A;  3DU1 X;  1IB4 A;  4MXN A;  1LM1 A;  1X0C A;  2G0Y A;  1TSP A;  1TYV A;  1QJV A;  3ZPP A;  4U49 A;  4YFO A;  3AK5 A;  1XG2 A;  3JUR A;  3PET A;  3GRH A;  5AMV A;  2NTB A;  2X6W A;  3B90 A;  4YZ0 A;  3VSV A;  3GQ8 A;  4W8R A;  4XR6 A;  4OJ5 A;  4XLF A;  1LLW A;  1RMG A;  2QY1 A;  4XON A;  4XN3 A;  4NK6 A;  2NT6 A;  1IDJ A;  1DAB A;  1PLU A;  3JX8 A;  3NB2 A;  2O6W A;  4JRA C;  1TYW A;  3EQN A;  3PSS A;  4OJL A;  4XOT A;  1OGM X;  1O8K A;  3GQA A;  1KQ5 A;  1OFM A;  1QQ1 A;  4YCQ A;  2QZA A;  4U4B A;  4C2L A;  1KTW A;  2J8I A;  1K5C A;  2B0R A;  2INV A;  1O8F A;  4Z03 A;  1TYX A;  1BN8 A;  1OGO X;  3LJY A;  1KCD A;  1EA0 A;  4PMH A;  3TH0 A;  2UVF A;  1DBO A;  2V5I A;  1PXZ A;  1AIR A;  1HG8 A;  3LMW A;  5C1E A;  2ODL A;  4XQF A;  1KCC A;  2PYG A;  1QA2 A;  1K4Z A;  4I84 A;  1QA3 A;  4XL9 A; 
#chains in the Genus database with same CATH homology
 1CLW A;  4OJ6 A;  5JMC B;  3ML3 A;  4OJO A;  1DAB A;  2YUH A;  2BM6 A;  3JX8 A;  1QRC A;  3LYC A;  4OJP A;  4JRA C;  3BH7 B;  3SYJ A;  1TYW A;  4OJL A;  3N90 A;  5JLV C;  3H09 A;  1QA1 A;  4KH3 A;  2BM5 A;  2IOU G;  4OM9 A;  1KQ5 A;  4V02 C;  1QQ1 A;  1K8F A;  4OPW A;  3RIQ A;  1HF2 A;  2VFN A;  2VFM A;  3SZE A;  2VFP A;  1WXR A;  2J8I A;  2BX6 A;  2B0R A;  2W7Z A;  2BM4 A;  2XC1 A;  2VFO A;  1TYX A;  2G0Y A;  3BH6 B;  1TSP A;  1TYV A;  3LJY A;  3AK5 A;  3TH0 A;  3PET A;  2BM7 A;  2V5I A;  2VFQ A;  3N6Z A;  1QRB A;  1TYU A;  3P4G A;  1QA2 A;  2F3L A;  4OJ5 A;  1K4Z A;  1QA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...