2QY1A

Pectate lyase a31g/r236f from xanthomonas campestris
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
330
structure length
330
Chain Sequence
GPVGYGAGTTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 125
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qy1A00
2ODLA 2NTQA 1O8HA 4XN0A 4C2LA 3GQ7A 2QXZA 1CZFA 1IDKA 3FY3A 4MR0A 4OJOA 5C1EA 4XN3A 3ZSCA 3T9GA 1KTWA 1IB4A 4U4BA 2NTPA 2X6YA 2QX3A 2X3HA 4URRA 4W8SA 4XKWA 3UW0A 2INVA 1RWRA 3GQ8A 4HWVA 1O8IA 1BHEA 1BN8A 2O17A 1IA5A 1OGMX 4XONA 3ZPPA 1X0CA 5C1CA 2NZMA 3VSUA 2VJIA 1RMGA 2VBKA 4MXNA 2O1DA 4U49A 4YEJA 2O04A 4Z05A 4XLEA 1K5CA 2O0WA 1O8KA 3EQOA 4W8QA 1IDJA 4OZYA 1JRGA 2EWEA 3VSVA 3B4NA 4NK8A 4XR6A 2UVFA 4XQFA 4OZZA 1RU4A 3JURA 3SUCA 1KCCA 1HG8A 3GQ9A 1O88A 2NTBA 4PMHA 4OJPA 1O8FA 2O0VA 4I84A 1DBOA 3EQNA 4YZQA 2PYGA 2IQ7A 2VBEA 4OJLA 1O8GA 1GQ8A 2Z8GA 4W8TA 2BSPA 1PLUA 1OGOX 4Z03A 4XLFA 3B8YA 4YELA 4XL9A 4XORA 4AVZA 1DBGA 1OFLA 4XLCA 4Z06A 4XM3A 2NSTA 2QY1A 3GQAA 1PE9A 4XMYA 4XOTA 1O8LA 2NT6A 3VSTA 1KCDA 4NK6A 1WMRA 1QCXA 2VBMA 5AMVA 1OOCA 1O8DA 4OJ6A 4YZXA 3KRGA 4EW9A 2PYHA 2X6WA 3B90A 2NT9A 2UVEA 4XNFA 3VMVA 4XLAA 2INUA 1QJVA 1O8JA 4YZAA 3VMWA 4XLHA 2X6XA 3LMWA 1NHCA 2VJJA 4XKVA 1JTAA 1O8MA 1VBLA 1H80A 1EE6A 4XOPA 1OFMA 4YZ0A 1AIRA 4W8RA 2PECA 3GRHA 1O8EA 2NSPA 4OJ5A 3WWGA 2X85A 1XG2A 1PXZA
chains in the Genus database with same CATH superfamily
3PETA 2ODLA 2NTQA 1O8HA 5JMCB 4XN0A 4C2LA 1QA1A 3GQ7A 2XT4A 2QXZA 1CZFA 2XTXA 1WXRA 1QA2A 1IDKA 3FY3A 4MR0A 4OJOA 3P4GA 4XN3A 5C1EA 3ZSCA 3T9GA 1OFEA 1KTWA 2J8IA 1IB4A 4U4BA 2BX6A 2NTPA 3JX8A 2X6YA 2QX3A 2V5IA 2X3HA 4URRA 1LLWA 4W8SA 4XKWA 3UW0A 2BM6A 2INVA 1RWRA 3GQ8A 3NB2A 3LYCA 4HWVA 1O8IA 1BHEA 1BN8A 2O17A 1IA5A 1OGMX 4XONA 3ZPPA 1X0CA 5C1CA 2NZMA 3VSUA 3ML3A 2XTWA 4YC5A 2VJIA 1RMGA 2VBKA 4MXNA 2O1DA 4U49A 4YEJA 2O04A 4Z05A 4XLEA 1K5CA 2O0WA 1O8KA 2O6WA 2QZAA 3EQOA 4W8QA 2VFMA 1IDJA 3SQVA 4OZYA 1JRGA 2EWEA 2IOUG 3N90A 3VSVA 4YCQA 3SY2A 3B4NA 3BH7B 4NK8A 4XR6A 4OM9A 2UVFA 4XQFA 1QRCA 4OZZA 1RU4A 3JURA 3N6ZA 3LJYA 3SUCA 1KCCA 1HG8A 3GQ9A 1O88A 2NTBA 2VFQA 4PMHA 4YFOA 3H09A 4OJPA 1O8FA 2O0VA 4I84A 1DBOA 4V02C 1TYXA 1QQ1A 3EQNA 4YZQA 1L1IA 2VFPA 2PYGA 2IQ7A 2VBEA 4OJLA 1O8GA 1GQ8A 4YDTA 1OFDA 2Z8GA 3TH0A 4W8TA 2BSPA 3RIQA 1KQ5A 1PLUA 1OGOX 1TYVA 4Z03A 1LLZA 1QA3A 4XLFA 1K4ZA 1HF2A 3B8YA 5JLVC 4YELA 2VFNA 4XL9A 4XORA 4AVZA 1DBGA 1OFLA 4XLCA 4Z06A 2BM7A 4XM3A 2NSTA 2QY1A 4JRAC 3GQAA 1PE9A 4XMYA 1LM1A 4XOTA 2J8KA 1O8LA 2F3LA 2NT6A 3VSTA 1KCDA 4NK6A 3SZEA 1WMRA 3PSSA 1QCXA 2VBMA 5AMVA 2W7ZA 4OPWA 1OOCA 1O8DA 2VFOA 4OJ6A 3KRGA 4YZXA 4EW9A 2PYHA 1K8FA 1CLWA 2G0YA 2XC1A 2BM5A 2X6WA 2YUHA 1EA0A 2XTYA 3B90A 2NT9A 3SYJA 3NAWA 2UVEA 2BM4A 3AK5A 4XNFA 3VMVA 1QRBA 2INUA 1QJVA 1O8JA 4XLAA 3BH6B 4YZAA 1DABA 3VMWA 4XLHA 2X6XA 2QYUA 3LMWA 1NHCA 2VJJA 1TYWA 4XKVA 1JTAA 1O8MA 1EZGA 1VBLA 3PSZA 1H80A 1EE6A 3DU1X 1OFMA 2B0RA 4XOPA 4YZ0A 2XT2A 1AIRA 4W8RA 1TYUA 2PECA 3GRHA 5DNSA 1O8EA 4YEIA 2NSPA 4OJ5A 1TSPA 4KH3A 3WWGA 2X85A 1XG2A 1PXZA
chains in the Genus database with same CATH topology
2ODLA 2NTQA 1O8HA 4XN0A 4C2LA 3GQ7A 2QXZA 1CZFA 1IDKA 3FY3A 4MR0A 4OJOA 5C1EA 4XN3A 3ZSCA 3T9GA 1KTWA 1IB4A 4U4BA 2NTPA 2X6YA 2QX3A 2X3HA 4URRA 4W8SA 4XKWA 3UW0A 2INVA 1RWRA 3GQ8A 4HWVA 1O8IA 1BHEA 1BN8A 2O17A 1IA5A 1OGMX 4XONA 3ZPPA 1X0CA 5C1CA 2NZMA 3VSUA 2VJIA 1RMGA 2VBKA 4MXNA 2O1DA 4U49A 4YEJA 2O04A 4Z05A 4XLEA 1K5CA 2O0WA 1O8KA 3EQOA 4W8QA 1IDJA 4OZYA 1JRGA 2EWEA 3VSVA 3B4NA 4NK8A 4XR6A 2UVFA 4XQFA 4OZZA 1RU4A 3JURA 3SUCA 1KCCA 1HG8A 3GQ9A 1O88A 2NTBA 4PMHA 4OJPA 1O8FA 2O0VA 4I84A 1DBOA 3EQNA 4YZQA 2PYGA 2IQ7A 2VBEA 4OJLA 1O8GA 1GQ8A 2Z8GA 4W8TA 2BSPA 1PLUA 1OGOX 4Z03A 4XLFA 3B8YA 4YELA 4XL9A 4XORA 4AVZA 1DBGA 1OFLA 4XLCA 4Z06A 4XM3A 2NSTA 2QY1A 3GQAA 1PE9A 4XMYA 4XOTA 1O8LA 2NT6A 3VSTA 1KCDA 4NK6A 1WMRA 1QCXA 2VBMA 5AMVA 1OOCA 1O8DA 4OJ6A 4YZXA 3KRGA 4EW9A 2PYHA 2X6WA 3B90A 2NT9A 2UVEA 4XNFA 3VMVA 4XLAA 2INUA 1QJVA 1O8JA 4YZAA 3VMWA 4XLHA 2X6XA 3LMWA 1NHCA 2VJJA 4XKVA 1JTAA 1O8MA 1VBLA 1H80A 1EE6A 4XOPA 1OFMA 4YZ0A 1AIRA 4W8RA 2PECA 3GRHA 1O8EA 2NSPA 4OJ5A 3WWGA 2X85A 1XG2A 1PXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODL A;  2NTQ A;  1O8H A;  4XN0 A;  4C2L A;  3GQ7 A;  2QXZ A;  1CZF A;  1IDK A;  3FY3 A;  4MR0 A;  4OJO A;  5C1E A;  4XN3 A;  3ZSC A;  3T9G A;  1KTW A;  1IB4 A;  4U4B A;  2NTP A;  2X6Y A;  2QX3 A;  2X3H A;  4URR A;  4W8S A;  4XKW A;  3UW0 A;  2INV A;  1RWR A;  3GQ8 A;  4HWV A;  1O8I A;  1BHE A;  1BN8 A;  2O17 A;  1IA5 A;  1OGM X;  4XON A;  3ZPP A;  1X0C A;  5C1C A;  2NZM A;  3VSU A;  2VJI A;  1RMG A;  2VBK A;  4MXN A;  2O1D A;  4U49 A;  4YEJ A;  2O04 A;  4Z05 A;  4XLE A;  1K5C A;  2O0W A;  1O8K A;  3EQO A;  4W8Q A;  1IDJ A;  4OZY A;  1JRG A;  2EWE A;  3VSV A;  3B4N A;  4NK8 A;  4XR6 A;  2UVF A;  4XQF A;  4OZZ A;  1RU4 A;  3JUR A;  3SUC A;  1KCC A;  1HG8 A;  3GQ9 A;  1O88 A;  2NTB A;  4PMH A;  4OJP A;  1O8F A;  2O0V A;  4I84 A;  1DBO A;  3EQN A;  4YZQ A;  2PYG A;  2IQ7 A;  2VBE A;  4OJL A;  1O8G A;  1GQ8 A;  2Z8G A;  4W8T A;  2BSP A;  1PLU A;  1OGO X;  4Z03 A;  4XLF A;  3B8Y A;  4YEL A;  4XL9 A;  4XOR A;  4AVZ A;  1DBG A;  1OFL A;  4XLC A;  4Z06 A;  4XM3 A;  2NST A;  2QY1 A;  3GQA A;  1PE9 A;  4XMY A;  4XOT A;  1O8L A;  2NT6 A;  3VST A;  1KCD A;  4NK6 A;  1WMR A;  1QCX A;  2VBM A;  5AMV A;  1OOC A;  1O8D A;  4OJ6 A;  4YZX A;  3KRG A;  4EW9 A;  2PYH A;  2X6W A;  3B90 A;  2NT9 A;  2UVE A;  4XNF A;  3VMV A;  4XLA A;  2INU A;  1QJV A;  1O8J A;  4YZA A;  3VMW A;  4XLH A;  2X6X A;  3LMW A;  1NHC A;  2VJJ A;  4XKV A;  1JTA A;  1O8M A;  1VBL A;  1H80 A;  1EE6 A;  4XOP A;  1OFM A;  4YZ0 A;  1AIR A;  4W8R A;  2PEC A;  3GRH A;  1O8E A;  2NSP A;  4OJ5 A;  3WWG A;  2X85 A;  1XG2 A;  1PXZ A; 
#chains in the Genus database with same CATH topology
 3PET A;  2ODL A;  2NTQ A;  1O8H A;  5JMC B;  4XN0 A;  4C2L A;  1QA1 A;  3GQ7 A;  2XT4 A;  2QXZ A;  1CZF A;  2XTX A;  1WXR A;  1QA2 A;  1IDK A;  3FY3 A;  4MR0 A;  4OJO A;  3P4G A;  4XN3 A;  5C1E A;  3ZSC A;  3T9G A;  1OFE A;  1KTW A;  2J8I A;  1IB4 A;  4U4B A;  2BX6 A;  2NTP A;  3JX8 A;  2X6Y A;  2QX3 A;  2V5I A;  2X3H A;  4URR A;  1LLW A;  4W8S A;  4XKW A;  3UW0 A;  2BM6 A;  2INV A;  1RWR A;  3GQ8 A;  3NB2 A;  3LYC A;  4HWV A;  1O8I A;  1BHE A;  1BN8 A;  2O17 A;  1IA5 A;  1OGM X;  4XON A;  3ZPP A;  1X0C A;  5C1C A;  2NZM A;  3VSU A;  3ML3 A;  2XTW A;  4YC5 A;  2VJI A;  1RMG A;  2VBK A;  4MXN A;  2O1D A;  4U49 A;  4YEJ A;  2O04 A;  4Z05 A;  4XLE A;  1K5C A;  2O0W A;  1O8K A;  2O6W A;  2QZA A;  3EQO A;  4W8Q A;  2VFM A;  1IDJ A;  3SQV A;  4OZY A;  1JRG A;  2EWE A;  2IOU G;  3N90 A;  3VSV A;  4YCQ A;  3SY2 A;  3B4N A;  3BH7 B;  4NK8 A;  4XR6 A;  4OM9 A;  2UVF A;  4XQF A;  1QRC A;  4OZZ A;  1RU4 A;  3JUR A;  3N6Z A;  3LJY A;  3SUC A;  1KCC A;  1HG8 A;  3GQ9 A;  1O88 A;  2NTB A;  2VFQ A;  4PMH A;  4YFO A;  3H09 A;  4OJP A;  1O8F A;  2O0V A;  4I84 A;  1DBO A;  4V02 C;  1TYX A;  1QQ1 A;  3EQN A;  4YZQ A;  1L1I A;  2VFP A;  2PYG A;  2IQ7 A;  2VBE A;  4OJL A;  1O8G A;  1GQ8 A;  4YDT A;  1OFD A;  2Z8G A;  3TH0 A;  4W8T A;  2BSP A;  3RIQ A;  1KQ5 A;  1PLU A;  1OGO X;  1TYV A;  4Z03 A;  1LLZ A;  1QA3 A;  4XLF A;  1K4Z A;  1HF2 A;  3B8Y A;  5JLV C;  4YEL A;  2VFN A;  4XL9 A;  4XOR A;  4AVZ A;  1DBG A;  1OFL A;  4XLC A;  4Z06 A;  2BM7 A;  4XM3 A;  2NST A;  2QY1 A;  4JRA C;  3GQA A;  1PE9 A;  4XMY A;  1LM1 A;  4XOT A;  2J8K A;  1O8L A;  2F3L A;  2NT6 A;  3VST A;  1KCD A;  4NK6 A;  3SZE A;  1WMR A;  3PSS A;  1QCX A;  2VBM A;  5AMV A;  2W7Z A;  4OPW A;  1OOC A;  1O8D A;  2VFO A;  4OJ6 A;  3KRG A;  4YZX A;  4EW9 A;  2PYH A;  1K8F A;  1CLW A;  2G0Y A;  2XC1 A;  2BM5 A;  2X6W A;  2YUH A;  1EA0 A;  2XTY A;  3B90 A;  2NT9 A;  3SYJ A;  3NAW A;  2UVE A;  2BM4 A;  3AK5 A;  4XNF A;  3VMV A;  1QRB A;  2INU A;  1QJV A;  1O8J A;  4XLA A;  3BH6 B;  4YZA A;  1DAB A;  3VMW A;  4XLH A;  2X6X A;  2QYU A;  3LMW A;  1NHC A;  2VJJ A;  1TYW A;  4XKV A;  1JTA A;  1O8M A;  1EZG A;  1VBL A;  3PSZ A;  1H80 A;  1EE6 A;  3DU1 X;  1OFM A;  2B0R A;  4XOP A;  4YZ0 A;  2XT2 A;  1AIR A;  4W8R A;  1TYU A;  2PEC A;  3GRH A;  5DNS A;  1O8E A;  4YEI A;  2NSP A;  4OJ5 A;  1TSP A;  4KH3 A;  3WWG A;  2X85 A;  1XG2 A;  1PXZ A; 
#chains in the Genus database with same CATH homology
 2ODL A;  2NTQ A;  1O8H A;  4XN0 A;  4C2L A;  3GQ7 A;  2QXZ A;  1CZF A;  1IDK A;  3FY3 A;  4MR0 A;  4OJO A;  5C1E A;  4XN3 A;  3ZSC A;  3T9G A;  1KTW A;  1IB4 A;  4U4B A;  2NTP A;  2X6Y A;  2QX3 A;  2X3H A;  4URR A;  4W8S A;  4XKW A;  3UW0 A;  2INV A;  1RWR A;  3GQ8 A;  4HWV A;  1O8I A;  1BHE A;  1BN8 A;  2O17 A;  1IA5 A;  1OGM X;  4XON A;  3ZPP A;  1X0C A;  5C1C A;  2NZM A;  3VSU A;  2VJI A;  1RMG A;  2VBK A;  4MXN A;  2O1D A;  4U49 A;  4YEJ A;  2O04 A;  4Z05 A;  4XLE A;  1K5C A;  2O0W A;  1O8K A;  3EQO A;  4W8Q A;  1IDJ A;  4OZY A;  1JRG A;  2EWE A;  3VSV A;  3B4N A;  4NK8 A;  4XR6 A;  2UVF A;  4XQF A;  4OZZ A;  1RU4 A;  3JUR A;  3SUC A;  1KCC A;  1HG8 A;  3GQ9 A;  1O88 A;  2NTB A;  4PMH A;  4OJP A;  1O8F A;  2O0V A;  4I84 A;  1DBO A;  3EQN A;  4YZQ A;  2PYG A;  2IQ7 A;  2VBE A;  4OJL A;  1O8G A;  1GQ8 A;  2Z8G A;  4W8T A;  2BSP A;  1PLU A;  1OGO X;  4Z03 A;  4XLF A;  3B8Y A;  4YEL A;  4XL9 A;  4XOR A;  4AVZ A;  1DBG A;  1OFL A;  4XLC A;  4Z06 A;  4XM3 A;  2NST A;  2QY1 A;  3GQA A;  1PE9 A;  4XMY A;  4XOT A;  1O8L A;  2NT6 A;  3VST A;  1KCD A;  4NK6 A;  1WMR A;  1QCX A;  2VBM A;  5AMV A;  1OOC A;  1O8D A;  4OJ6 A;  4YZX A;  3KRG A;  4EW9 A;  2PYH A;  2X6W A;  3B90 A;  2NT9 A;  2UVE A;  4XNF A;  3VMV A;  4XLA A;  2INU A;  1QJV A;  1O8J A;  4YZA A;  3VMW A;  4XLH A;  2X6X A;  3LMW A;  1NHC A;  2VJJ A;  4XKV A;  1JTA A;  1O8M A;  1VBL A;  1H80 A;  1EE6 A;  4XOP A;  1OFM A;  4YZ0 A;  1AIR A;  4W8R A;  2PEC A;  3GRH A;  1O8E A;  2NSP A;  4OJ5 A;  3WWG A;  2X85 A;  1XG2 A;  1PXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...