2QY1A

Pectate lyase a31g/r236f from xanthomonas campestris
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
330
structure length
330
Chain Sequence
b'GPVGYGAGTTGGGNKVPVNVATFEAMQSAIDSYSGSGGLVLNYTGKFDFGTIKDVCAQWKLPAKTVQIKNKSDVTIKGANGSAANFGIRVVGNAHNVIIQNMTIGLLQGGEDADSISLEGNSSGEPSKIWVDHNTVFASLTKCSGAGDASFDGGIDMKKGVHHVTVSYNYVYNYQKVALNGYSDSDTKNSAARTTYHHNRFENVESRVPLQRFGLSHIYNNYFNNVTTSGINVRMGGIAKIESNYFENIKNPVTSRDSSEIGYWDLINNYVGSGITWGTPDGSKPYANATNWISTKVFPESLGYIYTVTPAAQVKAKVIATAGAGKNLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase II
publication title Improvement of the thermostability and activity of a pectate lyase by single amino acid substitutions, using a strategy based on melting-temperature-guided sequence alignment.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Lyase
total genus 125
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2qy1A00
1O8DA 2VJJA 1O8GA 1O8LA 4XLFA 1K5CA 1PE9A 4U4BA 3VSUA 3GQ9A 1QJVA 2IQ7A 2NTPA 4XLAA 1CZFA 2NT6A 3B8YA 3VSVA 4EW9A 4Z03A 5C1EA 2NSTA 2X3HA 4OZZA 5AMVA 1KCCA 1PXZA 1XG2A 4HWVA 2O0VA 3T9GA 1RWRA 2ODLA 3KRGA 4AVZA 4XOPA 4XKVA 4XL9A 3SUCA 1O88A 2UVEA 2UVFA 3EQOA 4YZAA 4YZQA 4YELA 2Z8GA 3VSTA 4XN3A 5C1CA 1OFLA 4NK6A 2EWEA 3VMWA 1HG8A 3VMVA 4YZ0A 1KCDA 1O8FA 2VBEA 4MR0A 4XLEA 4OJ6A 4U49A 3GQ7A 4NK8A 1DBOA 2NTQA 1RMGA 1KTWA 2QXZA 1O8JA 2INVA 4C2LA 2QY1A 1O8EA 4I84A 4OZYA 1JRGA 1OGOX 2PYGA 3GQAA 3GRHA 2X85A 1WMRA 2PECA 4XN0A 3LMWA 1QCXA 4XM3A 1DBGA 3B4NA 2O04A 1OGMX 4Z06A 1X0CA 2X6XA 4XR6A 2VJIA 3EQNA 1O8IA 2X6YA 1IA5A 2X6WA 4XOTA 1NHCA 4OJLA 3UW0A 2VBKA 1O8HA 4XQFA 2O1DA 3GQ8A 4YZXA 4XKWA 4URRA 2PYHA 4W8QA 2BSPA 2QX3A 4OJOA 1EE6A 4W8SA 2NT9A 2O0WA 2NZMA 4OJPA 4XLHA 1OOCA 4YEJA 3ZPPA 3JURA 1GQ8A 2INUA 4XORA 3FY3A 4XLCA 1O8KA 1IDJA 2NTBA 3B90A 2O17A 1BHEA 1IDKA 2NSPA 1AIRA 1VBLA 1PLUA 4Z05A 2VBMA 1OFMA 4W8TA 1IB4A 1RU4A 4XONA 4MXNA 1BN8A 4OJ5A 1JTAA 4PMHA 3WWGA 4XNFA 4W8RA 4XMYA 1H80A 3ZSCA 1O8MA
chains in the Genus database with same CATH superfamily
2VFPA 1O8DA 2BM7A 2VFNA 2VJJA 1O8GA 1O8LA 4XLFA 1K5CA 1PE9A 2IOUG 1CLWA 4U4BA 3VSUA 2XTXA 3N90A 3GQ9A 1QJVA 2IQ7A 2NTPA 4XLAA 1TYVA 2YUHA 3SQVA 1DABA 1CZFA 2NT6A 3B8YA 4JRAC 4V02C 3VSVA 4EW9A 2G0YA 3AK5A 4YC5A 4Z03A 5C1EA 2NSTA 2X3HA 3BH6B 3SY2A 4OZZA 5AMVA 1OFDA 1KCCA 1QA3A 1PXZA 1XG2A 4HWVA 2O0VA 2V5IA 3T9GA 3P4GA 2O6WA 1RWRA 2J8IA 1QQ1A 2ODLA 3KRGA 2BX6A 4KH3A 3LJYA 4XOPA 4XKVA 4XL9A 3SUCA 4AVZA 1O88A 2UVEA 3BH7B 2UVFA 3EQOA 2B0RA 4YZAA 4YZQA 2Z8GA 4YELA 4XN3A 3SYJA 1K8FA 1OFLA 4NK6A 5C1CA 2EWEA 3VMWA 1HG8A 3VMVA 4YZ0A 1KCDA 1L1IA 1O8FA 2VBEA 4MR0A 4YEIA 4XLEA 4OJ6A 4U49A 3GQ7A 4NK8A 1TYWA 1DBOA 1QRBA 3NAWA 1LLZA 2NTQA 2VFOA 3PSZA 1RMGA 1QRCA 4YDTA 1WXRA 1KTWA 5DNSA 2QXZA 2BM6A 1EZGA 1O8JA 2INVA 2QY1A 2XTWA 4OPWA 4C2LA 1O8EA 4I84A 3JX8A 1JRGA 1OGOX 2PYGA 4OZYA 2XT4A 3GQAA 3GRHA 2X85A 1LM1A 1WMRA 2PECA 4XN0A 3LMWA 1QCXA 2F3LA 4XM3A 1DBGA 3B4NA 1LLWA 1OGMX 2O04A 3TH0A 4Z06A 1X0CA 2X6XA 4XR6A 2VJIA 3EQNA 1O8IA 2X6YA 1IA5A 1OFEA 2X6WA 4XOTA 1TYUA 1NHCA 4OJLA 3PSSA 3UW0A 2BM5A 2VBKA 1O8HA 4XQFA 4YCQA 5JLVC 1TYXA 2O1DA 3GQ8A 4YZXA 3VSTA 4XKWA 1EA0A 3RIQA 4URRA 2PYHA 4W8QA 2BSPA 2QX3A 4OJOA 3DU1X 1EE6A 4W8SA 2NT9A 2O0WA 2NZMA 2VFQA 3ML3A 4OJPA 4XLHA 1QA2A 1OOCA 2VFMA 4YEJA 3ZPPA 1HF2A 1KQ5A 3JURA 1GQ8A 2INUA 4XORA 3FY3A 2J8KA 4XLCA 1O8KA 1IDJA 2NTBA 2W7ZA 3SZEA 3N6ZA 3B90A 2O17A 1QA1A 1BHEA 1IDKA 2NSPA 2XTYA 1AIRA 1VBLA 1PLUA 3LYCA 3PETA 2BM4A 4Z05A 2VBMA 4OM9A 1OFMA 4W8TA 2XC1A 1IB4A 1RU4A 1TSPA 4XONA 4MXNA 1K4ZA 1BN8A 4OJ5A 1JTAA 4PMHA 3H09A 3WWGA 4XNFA 5JMCB 2XT2A 3NB2A 4YFOA 2QZAA 4W8RA 4XMYA 1H80A 2QYUA 3ZSCA 1O8MA
chains in the Genus database with same CATH topology
1O8DA 2VJJA 1O8GA 1O8LA 4XLFA 1K5CA 1PE9A 4U4BA 3VSUA 3GQ9A 1QJVA 2IQ7A 2NTPA 4XLAA 1CZFA 2NT6A 3B8YA 3VSVA 4EW9A 4Z03A 5C1EA 2NSTA 2X3HA 4OZZA 5AMVA 1KCCA 1PXZA 1XG2A 4HWVA 2O0VA 3T9GA 1RWRA 2ODLA 3KRGA 4AVZA 4XOPA 4XKVA 4XL9A 3SUCA 1O88A 2UVEA 2UVFA 3EQOA 4YZAA 4YZQA 4YELA 2Z8GA 3VSTA 4XN3A 5C1CA 1OFLA 4NK6A 2EWEA 3VMWA 1HG8A 3VMVA 4YZ0A 1KCDA 1O8FA 2VBEA 4MR0A 4XLEA 4OJ6A 4U49A 3GQ7A 4NK8A 1DBOA 2NTQA 1RMGA 1KTWA 2QXZA 1O8JA 2INVA 4C2LA 2QY1A 1O8EA 4I84A 4OZYA 1JRGA 1OGOX 2PYGA 3GQAA 3GRHA 2X85A 1WMRA 2PECA 4XN0A 3LMWA 1QCXA 4XM3A 1DBGA 3B4NA 2O04A 1OGMX 4Z06A 1X0CA 2X6XA 4XR6A 2VJIA 3EQNA 1O8IA 2X6YA 1IA5A 2X6WA 4XOTA 1NHCA 4OJLA 3UW0A 2VBKA 1O8HA 4XQFA 2O1DA 3GQ8A 4YZXA 4XKWA 4URRA 2PYHA 4W8QA 2BSPA 2QX3A 4OJOA 1EE6A 4W8SA 2NT9A 2O0WA 2NZMA 4OJPA 4XLHA 1OOCA 4YEJA 3ZPPA 3JURA 1GQ8A 2INUA 4XORA 3FY3A 4XLCA 1O8KA 1IDJA 2NTBA 3B90A 2O17A 1BHEA 1IDKA 2NSPA 1AIRA 1VBLA 1PLUA 4Z05A 2VBMA 1OFMA 4W8TA 1IB4A 1RU4A 4XONA 4MXNA 1BN8A 4OJ5A 1JTAA 4PMHA 3WWGA 4XNFA 4W8RA 4XMYA 1H80A 3ZSCA 1O8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8D A;  2VJJ A;  1O8G A;  1O8L A;  4XLF A;  1K5C A;  1PE9 A;  4U4B A;  3VSU A;  3GQ9 A;  1QJV A;  2IQ7 A;  2NTP A;  4XLA A;  1CZF A;  2NT6 A;  3B8Y A;  3VSV A;  4EW9 A;  4Z03 A;  5C1E A;  2NST A;  2X3H A;  4OZZ A;  5AMV A;  1KCC A;  1PXZ A;  1XG2 A;  4HWV A;  2O0V A;  3T9G A;  1RWR A;  2ODL A;  3KRG A;  4AVZ A;  4XOP A;  4XKV A;  4XL9 A;  3SUC A;  1O88 A;  2UVE A;  2UVF A;  3EQO A;  4YZA A;  4YZQ A;  4YEL A;  2Z8G A;  3VST A;  4XN3 A;  5C1C A;  1OFL A;  4NK6 A;  2EWE A;  3VMW A;  1HG8 A;  3VMV A;  4YZ0 A;  1KCD A;  1O8F A;  2VBE A;  4MR0 A;  4XLE A;  4OJ6 A;  4U49 A;  3GQ7 A;  4NK8 A;  1DBO A;  2NTQ A;  1RMG A;  1KTW A;  2QXZ A;  1O8J A;  2INV A;  4C2L A;  2QY1 A;  1O8E A;  4I84 A;  4OZY A;  1JRG A;  1OGO X;  2PYG A;  3GQA A;  3GRH A;  2X85 A;  1WMR A;  2PEC A;  4XN0 A;  3LMW A;  1QCX A;  4XM3 A;  1DBG A;  3B4N A;  2O04 A;  1OGM X;  4Z06 A;  1X0C A;  2X6X A;  4XR6 A;  2VJI A;  3EQN A;  1O8I A;  2X6Y A;  1IA5 A;  2X6W A;  4XOT A;  1NHC A;  4OJL A;  3UW0 A;  2VBK A;  1O8H A;  4XQF A;  2O1D A;  3GQ8 A;  4YZX A;  4XKW A;  4URR A;  2PYH A;  4W8Q A;  2BSP A;  2QX3 A;  4OJO A;  1EE6 A;  4W8S A;  2NT9 A;  2O0W A;  2NZM A;  4OJP A;  4XLH A;  1OOC A;  4YEJ A;  3ZPP A;  3JUR A;  1GQ8 A;  2INU A;  4XOR A;  3FY3 A;  4XLC A;  1O8K A;  1IDJ A;  2NTB A;  3B90 A;  2O17 A;  1BHE A;  1IDK A;  2NSP A;  1AIR A;  1VBL A;  1PLU A;  4Z05 A;  2VBM A;  1OFM A;  4W8T A;  1IB4 A;  1RU4 A;  4XON A;  4MXN A;  1BN8 A;  4OJ5 A;  1JTA A;  4PMH A;  3WWG A;  4XNF A;  4W8R A;  4XMY A;  1H80 A;  3ZSC A;  1O8M A; 
#chains in the Genus database with same CATH topology
 2VFP A;  1O8D A;  2BM7 A;  2VFN A;  2VJJ A;  1O8G A;  1O8L A;  4XLF A;  1K5C A;  1PE9 A;  2IOU G;  1CLW A;  4U4B A;  3VSU A;  2XTX A;  3N90 A;  3GQ9 A;  1QJV A;  2IQ7 A;  2NTP A;  4XLA A;  1TYV A;  2YUH A;  3SQV A;  1DAB A;  1CZF A;  2NT6 A;  3B8Y A;  4JRA C;  4V02 C;  3VSV A;  4EW9 A;  2G0Y A;  3AK5 A;  4YC5 A;  4Z03 A;  5C1E A;  2NST A;  2X3H A;  3BH6 B;  3SY2 A;  4OZZ A;  5AMV A;  1OFD A;  1KCC A;  1QA3 A;  1PXZ A;  1XG2 A;  4HWV A;  2O0V A;  2V5I A;  3T9G A;  3P4G A;  2O6W A;  1RWR A;  2J8I A;  1QQ1 A;  2ODL A;  3KRG A;  2BX6 A;  4KH3 A;  3LJY A;  4XOP A;  4XKV A;  4XL9 A;  3SUC A;  4AVZ A;  1O88 A;  2UVE A;  3BH7 B;  2UVF A;  3EQO A;  2B0R A;  4YZA A;  4YZQ A;  2Z8G A;  4YEL A;  4XN3 A;  3SYJ A;  1K8F A;  1OFL A;  4NK6 A;  5C1C A;  2EWE A;  3VMW A;  1HG8 A;  3VMV A;  4YZ0 A;  1KCD A;  1L1I A;  1O8F A;  2VBE A;  4MR0 A;  4YEI A;  4XLE A;  4OJ6 A;  4U49 A;  3GQ7 A;  4NK8 A;  1TYW A;  1DBO A;  1QRB A;  3NAW A;  1LLZ A;  2NTQ A;  2VFO A;  3PSZ A;  1RMG A;  1QRC A;  4YDT A;  1WXR A;  1KTW A;  5DNS A;  2QXZ A;  2BM6 A;  1EZG A;  1O8J A;  2INV A;  2QY1 A;  2XTW A;  4OPW A;  4C2L A;  1O8E A;  4I84 A;  3JX8 A;  1JRG A;  1OGO X;  2PYG A;  4OZY A;  2XT4 A;  3GQA A;  3GRH A;  2X85 A;  1LM1 A;  1WMR A;  2PEC A;  4XN0 A;  3LMW A;  1QCX A;  2F3L A;  4XM3 A;  1DBG A;  3B4N A;  1LLW A;  1OGM X;  2O04 A;  3TH0 A;  4Z06 A;  1X0C A;  2X6X A;  4XR6 A;  2VJI A;  3EQN A;  1O8I A;  2X6Y A;  1IA5 A;  1OFE A;  2X6W A;  4XOT A;  1TYU A;  1NHC A;  4OJL A;  3PSS A;  3UW0 A;  2BM5 A;  2VBK A;  1O8H A;  4XQF A;  4YCQ A;  5JLV C;  1TYX A;  2O1D A;  3GQ8 A;  4YZX A;  3VST A;  4XKW A;  1EA0 A;  3RIQ A;  4URR A;  2PYH A;  4W8Q A;  2BSP A;  2QX3 A;  4OJO A;  3DU1 X;  1EE6 A;  4W8S A;  2NT9 A;  2O0W A;  2NZM A;  2VFQ A;  3ML3 A;  4OJP A;  4XLH A;  1QA2 A;  1OOC A;  2VFM A;  4YEJ A;  3ZPP A;  1HF2 A;  1KQ5 A;  3JUR A;  1GQ8 A;  2INU A;  4XOR A;  3FY3 A;  2J8K A;  4XLC A;  1O8K A;  1IDJ A;  2NTB A;  2W7Z A;  3SZE A;  3N6Z A;  3B90 A;  2O17 A;  1QA1 A;  1BHE A;  1IDK A;  2NSP A;  2XTY A;  1AIR A;  1VBL A;  1PLU A;  3LYC A;  3PET A;  2BM4 A;  4Z05 A;  2VBM A;  4OM9 A;  1OFM A;  4W8T A;  2XC1 A;  1IB4 A;  1RU4 A;  1TSP A;  4XON A;  4MXN A;  1K4Z A;  1BN8 A;  4OJ5 A;  1JTA A;  4PMH A;  3H09 A;  3WWG A;  4XNF A;  5JMC B;  2XT2 A;  3NB2 A;  4YFO A;  2QZA A;  4W8R A;  4XMY A;  1H80 A;  2QYU A;  3ZSC A;  1O8M A; 
#chains in the Genus database with same CATH homology
 1O8D A;  2VJJ A;  1O8G A;  1O8L A;  4XLF A;  1K5C A;  1PE9 A;  4U4B A;  3VSU A;  3GQ9 A;  1QJV A;  2IQ7 A;  2NTP A;  4XLA A;  1CZF A;  2NT6 A;  3B8Y A;  3VSV A;  4EW9 A;  4Z03 A;  5C1E A;  2NST A;  2X3H A;  4OZZ A;  5AMV A;  1KCC A;  1PXZ A;  1XG2 A;  4HWV A;  2O0V A;  3T9G A;  1RWR A;  2ODL A;  3KRG A;  4AVZ A;  4XOP A;  4XKV A;  4XL9 A;  3SUC A;  1O88 A;  2UVE A;  2UVF A;  3EQO A;  4YZA A;  4YZQ A;  4YEL A;  2Z8G A;  3VST A;  4XN3 A;  5C1C A;  1OFL A;  4NK6 A;  2EWE A;  3VMW A;  1HG8 A;  3VMV A;  4YZ0 A;  1KCD A;  1O8F A;  2VBE A;  4MR0 A;  4XLE A;  4OJ6 A;  4U49 A;  3GQ7 A;  4NK8 A;  1DBO A;  2NTQ A;  1RMG A;  1KTW A;  2QXZ A;  1O8J A;  2INV A;  4C2L A;  2QY1 A;  1O8E A;  4I84 A;  4OZY A;  1JRG A;  1OGO X;  2PYG A;  3GQA A;  3GRH A;  2X85 A;  1WMR A;  2PEC A;  4XN0 A;  3LMW A;  1QCX A;  4XM3 A;  1DBG A;  3B4N A;  2O04 A;  1OGM X;  4Z06 A;  1X0C A;  2X6X A;  4XR6 A;  2VJI A;  3EQN A;  1O8I A;  2X6Y A;  1IA5 A;  2X6W A;  4XOT A;  1NHC A;  4OJL A;  3UW0 A;  2VBK A;  1O8H A;  4XQF A;  2O1D A;  3GQ8 A;  4YZX A;  4XKW A;  4URR A;  2PYH A;  4W8Q A;  2BSP A;  2QX3 A;  4OJO A;  1EE6 A;  4W8S A;  2NT9 A;  2O0W A;  2NZM A;  4OJP A;  4XLH A;  1OOC A;  4YEJ A;  3ZPP A;  3JUR A;  1GQ8 A;  2INU A;  4XOR A;  3FY3 A;  4XLC A;  1O8K A;  1IDJ A;  2NTB A;  3B90 A;  2O17 A;  1BHE A;  1IDK A;  2NSP A;  1AIR A;  1VBL A;  1PLU A;  4Z05 A;  2VBM A;  1OFM A;  4W8T A;  1IB4 A;  1RU4 A;  4XON A;  4MXN A;  1BN8 A;  4OJ5 A;  1JTA A;  4PMH A;  3WWG A;  4XNF A;  4W8R A;  4XMY A;  1H80 A;  3ZSC A;  1O8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...