2ODLA

Crystal structure of the hmw1 secretion domain from haemophilus influenzae
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
372
structure length
372
Chain Sequence
GLQGMDVVHGTATMQVDGNKTIIRNSVDAIINWKQFNIDQNEMVQFLQENNNSAVFNRVTSNQISQLKGILDSNGQVFLINPNGITIGKDAIINTNGFTASTLDISNENIKARNFTFEQTKDKALAEIVNHGLITVGKDGSVNLIGGKVKNEGVISVNGGSISLLAGQKITISDIINPTITYSIAAPENEAVNLGDIFAKGGNINVRAATIRNQGKLSADSVSKDKSGNIVLSAKEGEAEIGGVISAQNQQAKGGKLMITGDKVTLKTGAVIDLSGKEGGETYLGGDERGEGKNGIQLAKKTSLEKGSTINVSGKEKGGRAIVWGDIALIDGNINAQGSGDIAKTGGFVETSGHDLFIKDNAIVDAKEWLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Haemophilus influenzae HMW1 pro-piece reveals a structural domain essential for bacterial two-partner secretion.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
molecule keywords Adhesin
total genus 146
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2odlA00
2X6YA 1BN8A 2NTQA 2EWEA 3T9GA 3KRGA 2O0WA 2INUA 1O8GA 4PMHA 1OFMA 3EQNA 4XN3A 1O8LA 4XOTA 1IB4A 1O8HA 1O8DA 1XG2A 2NT9A 3UW0A 1OGOX 3FY3A 2NT6A 4XORA 1CZFA 1IDKA 4OJ5A 1BHEA 4XLEA 4URRA 3B90A 4AVZA 1DBOA 4NK6A 4YELA 3GQ8A 3VSVA 1KCCA 4MR0A 4W8QA 1PXZA 4OJLA 4MXNA 2O17A 5C1EA 4XOPA 1K5CA 3VMWA 4NK8A 4XKWA 4XMYA 1O8MA 3GQ7A 4W8SA 4YEJA 4XM3A 2X6WA 1KCDA 4OZYA 2VJJA 2IQ7A 2O1DA 1O8KA 1OFLA 1HG8A 2X3HA 4YZ0A 4HWVA 1RWRA 1RMGA 3VSTA 1OOCA 2X6XA 2VBKA 4U49A 3LMWA 4YZAA 4XL9A 2QX3A 3SUCA 4XONA 4W8TA 2QXZA 1IA5A 1RU4A 1X0CA 1QJVA 3ZSCA 1PLUA 1QCXA 2PYHA 2X85A 4W8RA 4XN0A 1EE6A 4OJPA 1JRGA 2VJIA 4Z05A 2Z8GA 3GQAA 2NTPA 3GQ9A 2NTBA 2UVFA 2O0VA 4OJ6A 2O04A 4OZZA 4XLHA 2NSPA 4Z03A 3ZPPA 4C2LA 3B8YA 4YZQA 1WMRA 4Z06A 1PE9A 1AIRA 2PYGA 1O88A 1JTAA 1KTWA 2NSTA 4XLCA 1O8JA 4YZXA 3WWGA 4XLAA 4I84A 4XKVA 5AMVA 1DBGA 2ODLA 4OJOA 3JURA 4U4BA 4XNFA 2UVEA 1NHCA 3GRHA 3EQOA 3VSUA 1H80A 4XR6A 1GQ8A 1O8FA 1O8EA 1IDJA 1OGMX 4XQFA 5C1CA 3VMVA 2VBMA 2PECA 4EW9A 2INVA 1VBLA 1O8IA 2NZMA 2VBEA 2BSPA 4XLFA 2QY1A 3B4NA
chains in the Genus database with same CATH superfamily
2X6YA 3ML3A 3N6ZA 1BN8A 2NTQA 2EWEA 3BH7B 3T9GA 3KRGA 2O0WA 1QA3A 2INUA 1K4ZA 1O8GA 1DABA 2QYUA 4PMHA 1OFMA 3EQNA 4XN3A 1O8LA 4XOTA 3RIQA 3SY2A 1IB4A 1O8HA 2BM6A 1O8DA 1XG2A 2NT9A 3SYJA 3UW0A 1EA0A 1OGOX 3FY3A 2NT6A 4XORA 4YDTA 3BH6B 2B0RA 1CZFA 1IDKA 3H09A 1HF2A 4OJ5A 1BHEA 4XLEA 1OFEA 4URRA 2J8KA 2VFNA 3B90A 2VFOA 4AVZA 3NAWA 2BM7A 1DBOA 4NK6A 3GQ8A 4YELA 3VSVA 4MR0A 1KCCA 4W8QA 1PXZA 4OJLA 4MXNA 2O17A 4YC5A 5C1EA 5JLVC 4XOPA 1K5CA 3VMWA 4NK8A 4XKWA 1WXRA 1TYWA 4XMYA 1O8MA 3GQ7A 4W8SA 4YEJA 4XM3A 2X6WA 1KCDA 2BM5A 4OZYA 2V5IA 2F3LA 2VJJA 3PSSA 1L1IA 2IQ7A 2O1DA 1O8KA 1OFLA 1HG8A 2W7ZA 2X3HA 4YZ0A 4HWVA 3TH0A 1RWRA 4KH3A 1RMGA 1LLZA 3VSTA 1OOCA 2X6XA 1QRBA 2VBKA 4U49A 3LMWA 4YZAA 4XL9A 3SZEA 2QX3A 3SUCA 4YEIA 4XONA 4W8TA 2QXZA 2XC1A 1IA5A 1RU4A 5DNSA 1X0CA 4YFOA 1QJVA 1CLWA 1PLUA 1TYVA 1QCXA 2IOUG 2PYHA 2VFPA 2X85A 4W8RA 4OM9A 2G0YA 4XN0A 1EE6A 2XTWA 3PSZA 4OJPA 1JRGA 2VJIA 1KQ5A 1QQ1A 4Z05A 5JMCB 2J8IA 2Z8GA 2QZAA 2NTPA 3GQAA 3GQ9A 1EZGA 2NTBA 1K8FA 2UVFA 2O0VA 4OJ6A 3DU1X 2O04A 4OZZA 4XLHA 2NSPA 1TYXA 2XTYA 3ZSCA 4Z03A 3ZPPA 4C2LA 3B8YA 1LLWA 2XT2A 4YZQA 1WMRA 4Z06A 1PE9A 1AIRA 2PYGA 1O88A 1JTAA 1KTWA 3P4GA 2NSTA 4XLCA 2BM4A 1O8JA 3JX8A 4YZXA 3WWGA 4XLAA 4I84A 4XKVA 3LJYA 4JRAC 5AMVA 1DBGA 2XT4A 2ODLA 4OJOA 3JURA 4U4BA 1OFDA 4OPWA 1QRCA 2UVEA 3PETA 4XNFA 1NHCA 3GRHA 3SQVA 3EQOA 3VSUA 3NB2A 1H80A 4XR6A 3AK5A 1GQ8A 2YUHA 1O8FA 1O8EA 1IDJA 1OGMX 1TYUA 4XQFA 1QA1A 2XTXA 5C1CA 1LM1A 1QA2A 3VMVA 2VBMA 2VFQA 2PECA 4EW9A 2INVA 1VBLA 1O8IA 3LYCA 1TSPA 2NZMA 2O6WA 2BX6A 2VBEA 2BSPA 2VFMA 4XLFA 2QY1A 3N90A 4YCQA 4V02C 3B4NA
chains in the Genus database with same CATH topology
2X6YA 1BN8A 2NTQA 2EWEA 3T9GA 3KRGA 2O0WA 2INUA 1O8GA 4PMHA 1OFMA 3EQNA 4XN3A 1O8LA 4XOTA 1IB4A 1O8HA 1O8DA 1XG2A 2NT9A 3UW0A 1OGOX 3FY3A 2NT6A 4XORA 1CZFA 1IDKA 4OJ5A 1BHEA 4XLEA 4URRA 3B90A 4AVZA 1DBOA 4NK6A 4YELA 3GQ8A 3VSVA 1KCCA 4MR0A 4W8QA 1PXZA 4OJLA 4MXNA 2O17A 5C1EA 4XOPA 1K5CA 3VMWA 4NK8A 4XKWA 4XMYA 1O8MA 3GQ7A 4W8SA 4YEJA 4XM3A 2X6WA 1KCDA 4OZYA 2VJJA 2IQ7A 2O1DA 1O8KA 1OFLA 1HG8A 2X3HA 4YZ0A 4HWVA 1RWRA 1RMGA 3VSTA 1OOCA 2X6XA 2VBKA 4U49A 3LMWA 4YZAA 4XL9A 2QX3A 3SUCA 4XONA 4W8TA 2QXZA 1IA5A 1RU4A 1X0CA 1QJVA 3ZSCA 1PLUA 1QCXA 2PYHA 2X85A 4W8RA 4XN0A 1EE6A 4OJPA 1JRGA 2VJIA 4Z05A 2Z8GA 3GQAA 2NTPA 3GQ9A 2NTBA 2UVFA 2O0VA 4OJ6A 2O04A 4OZZA 4XLHA 2NSPA 4Z03A 3ZPPA 4C2LA 3B8YA 4YZQA 1WMRA 4Z06A 1PE9A 1AIRA 2PYGA 1O88A 1JTAA 1KTWA 2NSTA 4XLCA 1O8JA 4YZXA 3WWGA 4XLAA 4I84A 4XKVA 5AMVA 1DBGA 2ODLA 4OJOA 3JURA 4U4BA 4XNFA 2UVEA 1NHCA 3GRHA 3EQOA 3VSUA 1H80A 4XR6A 1GQ8A 1O8FA 1O8EA 1IDJA 1OGMX 4XQFA 5C1CA 3VMVA 2VBMA 2PECA 4EW9A 2INVA 1VBLA 1O8IA 2NZMA 2VBEA 2BSPA 4XLFA 2QY1A 3B4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6Y A;  1BN8 A;  2NTQ A;  2EWE A;  3T9G A;  3KRG A;  2O0W A;  2INU A;  1O8G A;  4PMH A;  1OFM A;  3EQN A;  4XN3 A;  1O8L A;  4XOT A;  1IB4 A;  1O8H A;  1O8D A;  1XG2 A;  2NT9 A;  3UW0 A;  1OGO X;  3FY3 A;  2NT6 A;  4XOR A;  1CZF A;  1IDK A;  4OJ5 A;  1BHE A;  4XLE A;  4URR A;  3B90 A;  4AVZ A;  1DBO A;  4NK6 A;  4YEL A;  3GQ8 A;  3VSV A;  1KCC A;  4MR0 A;  4W8Q A;  1PXZ A;  4OJL A;  4MXN A;  2O17 A;  5C1E A;  4XOP A;  1K5C A;  3VMW A;  4NK8 A;  4XKW A;  4XMY A;  1O8M A;  3GQ7 A;  4W8S A;  4YEJ A;  4XM3 A;  2X6W A;  1KCD A;  4OZY A;  2VJJ A;  2IQ7 A;  2O1D A;  1O8K A;  1OFL A;  1HG8 A;  2X3H A;  4YZ0 A;  4HWV A;  1RWR A;  1RMG A;  3VST A;  1OOC A;  2X6X A;  2VBK A;  4U49 A;  3LMW A;  4YZA A;  4XL9 A;  2QX3 A;  3SUC A;  4XON A;  4W8T A;  2QXZ A;  1IA5 A;  1RU4 A;  1X0C A;  1QJV A;  3ZSC A;  1PLU A;  1QCX A;  2PYH A;  2X85 A;  4W8R A;  4XN0 A;  1EE6 A;  4OJP A;  1JRG A;  2VJI A;  4Z05 A;  2Z8G A;  3GQA A;  2NTP A;  3GQ9 A;  2NTB A;  2UVF A;  2O0V A;  4OJ6 A;  2O04 A;  4OZZ A;  4XLH A;  2NSP A;  4Z03 A;  3ZPP A;  4C2L A;  3B8Y A;  4YZQ A;  1WMR A;  4Z06 A;  1PE9 A;  1AIR A;  2PYG A;  1O88 A;  1JTA A;  1KTW A;  2NST A;  4XLC A;  1O8J A;  4YZX A;  3WWG A;  4XLA A;  4I84 A;  4XKV A;  5AMV A;  1DBG A;  2ODL A;  4OJO A;  3JUR A;  4U4B A;  4XNF A;  2UVE A;  1NHC A;  3GRH A;  3EQO A;  3VSU A;  1H80 A;  4XR6 A;  1GQ8 A;  1O8F A;  1O8E A;  1IDJ A;  1OGM X;  4XQF A;  5C1C A;  3VMV A;  2VBM A;  2PEC A;  4EW9 A;  2INV A;  1VBL A;  1O8I A;  2NZM A;  2VBE A;  2BSP A;  4XLF A;  2QY1 A;  3B4N A; 
#chains in the Genus database with same CATH topology
 2X6Y A;  3ML3 A;  3N6Z A;  1BN8 A;  2NTQ A;  2EWE A;  3BH7 B;  3T9G A;  3KRG A;  2O0W A;  1QA3 A;  2INU A;  1K4Z A;  1O8G A;  1DAB A;  2QYU A;  4PMH A;  1OFM A;  3EQN A;  4XN3 A;  1O8L A;  4XOT A;  3RIQ A;  3SY2 A;  1IB4 A;  1O8H A;  2BM6 A;  1O8D A;  1XG2 A;  2NT9 A;  3SYJ A;  3UW0 A;  1EA0 A;  1OGO X;  3FY3 A;  2NT6 A;  4XOR A;  4YDT A;  3BH6 B;  2B0R A;  1CZF A;  1IDK A;  3H09 A;  1HF2 A;  4OJ5 A;  1BHE A;  4XLE A;  1OFE A;  4URR A;  2J8K A;  2VFN A;  3B90 A;  2VFO A;  4AVZ A;  3NAW A;  2BM7 A;  1DBO A;  4NK6 A;  3GQ8 A;  4YEL A;  3VSV A;  4MR0 A;  1KCC A;  4W8Q A;  1PXZ A;  4OJL A;  4MXN A;  2O17 A;  4YC5 A;  5C1E A;  5JLV C;  4XOP A;  1K5C A;  3VMW A;  4NK8 A;  4XKW A;  1WXR A;  1TYW A;  4XMY A;  1O8M A;  3GQ7 A;  4W8S A;  4YEJ A;  4XM3 A;  2X6W A;  1KCD A;  2BM5 A;  4OZY A;  2V5I A;  2F3L A;  2VJJ A;  3PSS A;  1L1I A;  2IQ7 A;  2O1D A;  1O8K A;  1OFL A;  1HG8 A;  2W7Z A;  2X3H A;  4YZ0 A;  4HWV A;  3TH0 A;  1RWR A;  4KH3 A;  1RMG A;  1LLZ A;  3VST A;  1OOC A;  2X6X A;  1QRB A;  2VBK A;  4U49 A;  3LMW A;  4YZA A;  4XL9 A;  3SZE A;  2QX3 A;  3SUC A;  4YEI A;  4XON A;  4W8T A;  2QXZ A;  2XC1 A;  1IA5 A;  1RU4 A;  5DNS A;  1X0C A;  4YFO A;  1QJV A;  1CLW A;  1PLU A;  1TYV A;  1QCX A;  2IOU G;  2PYH A;  2VFP A;  2X85 A;  4W8R A;  4OM9 A;  2G0Y A;  4XN0 A;  1EE6 A;  2XTW A;  3PSZ A;  4OJP A;  1JRG A;  2VJI A;  1KQ5 A;  1QQ1 A;  4Z05 A;  5JMC B;  2J8I A;  2Z8G A;  2QZA A;  2NTP A;  3GQA A;  3GQ9 A;  1EZG A;  2NTB A;  1K8F A;  2UVF A;  2O0V A;  4OJ6 A;  3DU1 X;  2O04 A;  4OZZ A;  4XLH A;  2NSP A;  1TYX A;  2XTY A;  3ZSC A;  4Z03 A;  3ZPP A;  4C2L A;  3B8Y A;  1LLW A;  2XT2 A;  4YZQ A;  1WMR A;  4Z06 A;  1PE9 A;  1AIR A;  2PYG A;  1O88 A;  1JTA A;  1KTW A;  3P4G A;  2NST A;  4XLC A;  2BM4 A;  1O8J A;  3JX8 A;  4YZX A;  3WWG A;  4XLA A;  4I84 A;  4XKV A;  3LJY A;  4JRA C;  5AMV A;  1DBG A;  2XT4 A;  2ODL A;  4OJO A;  3JUR A;  4U4B A;  1OFD A;  4OPW A;  1QRC A;  2UVE A;  3PET A;  4XNF A;  1NHC A;  3GRH A;  3SQV A;  3EQO A;  3VSU A;  3NB2 A;  1H80 A;  4XR6 A;  3AK5 A;  1GQ8 A;  2YUH A;  1O8F A;  1O8E A;  1IDJ A;  1OGM X;  1TYU A;  4XQF A;  1QA1 A;  2XTX A;  5C1C A;  1LM1 A;  1QA2 A;  3VMV A;  2VBM A;  2VFQ A;  2PEC A;  4EW9 A;  2INV A;  1VBL A;  1O8I A;  3LYC A;  1TSP A;  2NZM A;  2O6W A;  2BX6 A;  2VBE A;  2BSP A;  2VFM A;  4XLF A;  2QY1 A;  3N90 A;  4YCQ A;  4V02 C;  3B4N A; 
#chains in the Genus database with same CATH homology
 2X6Y A;  1BN8 A;  2NTQ A;  2EWE A;  3T9G A;  3KRG A;  2O0W A;  2INU A;  1O8G A;  4PMH A;  1OFM A;  3EQN A;  4XN3 A;  1O8L A;  4XOT A;  1IB4 A;  1O8H A;  1O8D A;  1XG2 A;  2NT9 A;  3UW0 A;  1OGO X;  3FY3 A;  2NT6 A;  4XOR A;  1CZF A;  1IDK A;  4OJ5 A;  1BHE A;  4XLE A;  4URR A;  3B90 A;  4AVZ A;  1DBO A;  4NK6 A;  4YEL A;  3GQ8 A;  3VSV A;  1KCC A;  4MR0 A;  4W8Q A;  1PXZ A;  4OJL A;  4MXN A;  2O17 A;  5C1E A;  4XOP A;  1K5C A;  3VMW A;  4NK8 A;  4XKW A;  4XMY A;  1O8M A;  3GQ7 A;  4W8S A;  4YEJ A;  4XM3 A;  2X6W A;  1KCD A;  4OZY A;  2VJJ A;  2IQ7 A;  2O1D A;  1O8K A;  1OFL A;  1HG8 A;  2X3H A;  4YZ0 A;  4HWV A;  1RWR A;  1RMG A;  3VST A;  1OOC A;  2X6X A;  2VBK A;  4U49 A;  3LMW A;  4YZA A;  4XL9 A;  2QX3 A;  3SUC A;  4XON A;  4W8T A;  2QXZ A;  1IA5 A;  1RU4 A;  1X0C A;  1QJV A;  3ZSC A;  1PLU A;  1QCX A;  2PYH A;  2X85 A;  4W8R A;  4XN0 A;  1EE6 A;  4OJP A;  1JRG A;  2VJI A;  4Z05 A;  2Z8G A;  3GQA A;  2NTP A;  3GQ9 A;  2NTB A;  2UVF A;  2O0V A;  4OJ6 A;  2O04 A;  4OZZ A;  4XLH A;  2NSP A;  4Z03 A;  3ZPP A;  4C2L A;  3B8Y A;  4YZQ A;  1WMR A;  4Z06 A;  1PE9 A;  1AIR A;  2PYG A;  1O88 A;  1JTA A;  1KTW A;  2NST A;  4XLC A;  1O8J A;  4YZX A;  3WWG A;  4XLA A;  4I84 A;  4XKV A;  5AMV A;  1DBG A;  2ODL A;  4OJO A;  3JUR A;  4U4B A;  4XNF A;  2UVE A;  1NHC A;  3GRH A;  3EQO A;  3VSU A;  1H80 A;  4XR6 A;  1GQ8 A;  1O8F A;  1O8E A;  1IDJ A;  1OGM X;  4XQF A;  5C1C A;  3VMV A;  2VBM A;  2PEC A;  4EW9 A;  2INV A;  1VBL A;  1O8I A;  2NZM A;  2VBE A;  2BSP A;  4XLF A;  2QY1 A;  3B4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...