2ODLA

Crystal structure of the hmw1 secretion domain from haemophilus influenzae
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
372
structure length
372
Chain Sequence
GLQGMDVVHGTATMQVDGNKTIIRNSVDAIINWKQFNIDQNEMVQFLQENNNSAVFNRVTSNQISQLKGILDSNGQVFLINPNGITIGKDAIINTNGFTASTLDISNENIKARNFTFEQTKDKALAEIVNHGLITVGKDGSVNLIGGKVKNEGVISVNGGSISLLAGQKITISDIINPTITYSIAAPENEAVNLGDIFAKGGNINVRAATIRNQGKLSADSVSKDKSGNIVLSAKEGEAEIGGVISAQNQQAKGGKLMITGDKVTLKTGAVIDLSGKEGGETYLGGDERGEGKNGIQLAKKTSLEKGSTINVSGKEKGGRAIVWGDIALIDGNINAQGSGDIAKTGGFVETSGHDLFIKDNAIVDAKEWLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Haemophilus influenzae HMW1 pro-piece reveals a structural domain essential for bacterial two-partner secretion.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
molecule keywords Adhesin
total genus 146
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2odlA00
1IDKA 1HG8A 4YZQA 2EWEA 3T9GA 4XMYA 1DBOA 1O8LA 2X3HA 3GQ7A 4OJPA 1WMRA 4XR6A 4OJ6A 4HWVA 2NTQA 4XNFA 4OJLA 4XLHA 2UVEA 5C1EA 3ZSCA 2X85A 1NHCA 4NK8A 1JRGA 4Z03A 1BHEA 3GQ9A 3LMWA 2O04A 4NK6A 4OZYA 1GQ8A 2VBMA 4Z06A 1O88A 1CZFA 3SUCA 1DBGA 1O8GA 1O8DA 1O8KA 3KRGA 1O8EA 2BSPA 3JURA 3FY3A 1OFMA 2ODLA 2NTPA 1JTAA 4W8QA 4XN3A 4XONA 4MXNA 4XOTA 2IQ7A 2O0WA 2NT6A 3WWGA 4PMHA 1IB4A 2NTBA 2VBKA 2X6WA 4U4BA 1KCCA 4XLCA 1O8IA 3VMVA 3ZPPA 2O1DA 4Z05A 4XLFA 4OZZA 2NSPA 1OGMX 1IA5A 4XQFA 4C2LA 2NSTA 1EE6A 4EW9A 1OOCA 3VSVA 2INUA 4U49A 1BN8A 3GQAA 4AVZA 3EQNA 5AMVA 1H80A 1KTWA 3UW0A 2UVFA 2PYHA 1RU4A 4XN0A 3VSTA 4XLAA 4XM3A 2O0VA 1XG2A 4MR0A 1IDJA 1K5CA 1VBLA 2Z8GA 4XKVA 1PLUA 2VBEA 3B4NA 4YELA 4YEJA 5C1CA 4OJOA 4XKWA 1X0CA 4I84A 3B90A 4XLEA 4YZXA 2X6YA 1O8JA 4W8SA 1QCXA 2QXZA 2X6XA 3VSUA 4YZAA 1OGOX 4XOPA 3EQOA 2NZMA 2NT9A 2PYGA 3GRHA 4OJ5A 1O8FA 1KCDA 2VJJA 2QX3A 4W8TA 4W8RA 4XORA 1OFLA 1AIRA 4URRA 2QY1A 3VMWA 2PECA 1O8HA 1RMGA 1QJVA 2INVA 4XL9A 3GQ8A 1PE9A 4YZ0A 1O8MA 2O17A 1PXZA 1RWRA 2VJIA 3B8YA
chains in the Genus database with same CATH superfamily
1IDKA 3LYCA 3BH6B 1HG8A 4YZQA 2EWEA 1DABA 3T9GA 4XMYA 1DBOA 1O8LA 2X3HA 3GQ7A 4OJPA 1WMRA 4XR6A 4OJ6A 4HWVA 1TYXA 2NTQA 4XNFA 4YEIA 4OJLA 4XLHA 2UVEA 5C1EA 3ZSCA 1TYWA 2X85A 1NHCA 4NK8A 1JRGA 4Z03A 3TH0A 1BHEA 3GQ9A 1LLWA 3LMWA 1EZGA 2O04A 4NK6A 1QA3A 3PSZA 3N90A 4OZYA 4YC5A 1GQ8A 1TSPA 3P4GA 2VBMA 4Z06A 1O88A 1CZFA 3SUCA 1DBGA 2BM7A 1O8GA 1O8DA 1O8KA 1QQ1A 1K4ZA 3KRGA 1O8EA 1QRCA 1TYUA 1LM1A 2BSPA 3FY3A 1OFMA 3JURA 3N6ZA 2ODLA 2NTPA 1JTAA 3PETA 4W8QA 4XN3A 4MXNA 1K8FA 4XOTA 4XONA 2IQ7A 2O0WA 2XTWA 1L1IA 2NT6A 2XTXA 3WWGA 4PMHA 1IB4A 2NTBA 2VBKA 2VFOA 2X6WA 2XT4A 3DU1X 4U4BA 1KCCA 4XLCA 1O8IA 3VMVA 4YDTA 3ZPPA 1WXRA 2O1DA 4Z05A 3NAWA 2O6WA 4XLFA 2YUHA 4OZZA 1HF2A 2NSPA 2J8KA 1OGMX 4KH3A 2W7ZA 1IA5A 1LLZA 2BM6A 4V02C 4C2LA 2NSTA 1EE6A 4EW9A 1OFDA 2VFQA 4XQFA 1OOCA 1QRBA 3VSVA 3NB2A 2B0RA 2INUA 4OPWA 4U49A 2VFMA 1BN8A 3GQAA 4AVZA 2VFNA 2G0YA 3EQNA 5AMVA 1H80A 1KTWA 3UW0A 2UVFA 2PYHA 1RU4A 3BH7B 4XN0A 3VSTA 5DNSA 4XLAA 3RIQA 4XM3A 2O0VA 3SYJA 3SZEA 1XG2A 4MR0A 1IDJA 2BM4A 5JLVC 4YCQA 1TYVA 1K5CA 3SY2A 1VBLA 1CLWA 2Z8GA 4XKVA 1PLUA 2VBEA 1QA2A 3B4NA 4YELA 4YEJA 5C1CA 3ML3A 2V5IA 3LJYA 4OJOA 4XKWA 1X0CA 4I84A 3B90A 4XLEA 4YZXA 2X6YA 1O8JA 4W8SA 1QCXA 2QXZA 2X6XA 3VSUA 4YZAA 1OGOX 4XOPA 3H09A 4JRAC 1OFEA 4OM9A 3EQOA 2NZMA 2NT9A 2XT2A 2PYGA 3GRHA 1QA1A 4OJ5A 1KQ5A 1O8FA 2QZAA 3JX8A 1KCDA 2VJJA 2F3LA 2QX3A 4W8TA 4W8RA 2XC1A 4XORA 1OFLA 1AIRA 4URRA 3SQVA 2QY1A 4YFOA 3VMWA 2PECA 1O8HA 1RMGA 2BX6A 1QJVA 2BM5A 2INVA 3PSSA 2XTYA 4XL9A 1EA0A 2QYUA 3GQ8A 2J8IA 1PE9A 2VFPA 4YZ0A 1O8MA 2O17A 1PXZA 1RWRA 3AK5A 2IOUG 2VJIA 5JMCB 3B8YA
chains in the Genus database with same CATH topology
1IDKA 1HG8A 4YZQA 2EWEA 3T9GA 4XMYA 1DBOA 1O8LA 2X3HA 3GQ7A 4OJPA 1WMRA 4XR6A 4OJ6A 4HWVA 2NTQA 4XNFA 4OJLA 4XLHA 2UVEA 5C1EA 3ZSCA 2X85A 1NHCA 4NK8A 1JRGA 4Z03A 1BHEA 3GQ9A 3LMWA 2O04A 4NK6A 4OZYA 1GQ8A 2VBMA 4Z06A 1O88A 1CZFA 3SUCA 1DBGA 1O8GA 1O8DA 1O8KA 3KRGA 1O8EA 2BSPA 3JURA 3FY3A 1OFMA 2ODLA 2NTPA 1JTAA 4W8QA 4XN3A 4XONA 4MXNA 4XOTA 2IQ7A 2O0WA 2NT6A 3WWGA 4PMHA 1IB4A 2NTBA 2VBKA 2X6WA 4U4BA 1KCCA 4XLCA 1O8IA 3VMVA 3ZPPA 2O1DA 4Z05A 4XLFA 4OZZA 2NSPA 1OGMX 1IA5A 4XQFA 4C2LA 2NSTA 1EE6A 4EW9A 1OOCA 3VSVA 2INUA 4U49A 1BN8A 3GQAA 4AVZA 3EQNA 5AMVA 1H80A 1KTWA 3UW0A 2UVFA 2PYHA 1RU4A 4XN0A 3VSTA 4XLAA 4XM3A 2O0VA 1XG2A 4MR0A 1IDJA 1K5CA 1VBLA 2Z8GA 4XKVA 1PLUA 2VBEA 3B4NA 4YELA 4YEJA 5C1CA 4OJOA 4XKWA 1X0CA 4I84A 3B90A 4XLEA 4YZXA 2X6YA 1O8JA 4W8SA 1QCXA 2QXZA 2X6XA 3VSUA 4YZAA 1OGOX 4XOPA 3EQOA 2NZMA 2NT9A 2PYGA 3GRHA 4OJ5A 1O8FA 1KCDA 2VJJA 2QX3A 4W8TA 4W8RA 4XORA 1OFLA 1AIRA 4URRA 2QY1A 3VMWA 2PECA 1O8HA 1RMGA 1QJVA 2INVA 4XL9A 3GQ8A 1PE9A 4YZ0A 1O8MA 2O17A 1PXZA 1RWRA 2VJIA 3B8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDK A;  1HG8 A;  4YZQ A;  2EWE A;  3T9G A;  4XMY A;  1DBO A;  1O8L A;  2X3H A;  3GQ7 A;  4OJP A;  1WMR A;  4XR6 A;  4OJ6 A;  4HWV A;  2NTQ A;  4XNF A;  4OJL A;  4XLH A;  2UVE A;  5C1E A;  3ZSC A;  2X85 A;  1NHC A;  4NK8 A;  1JRG A;  4Z03 A;  1BHE A;  3GQ9 A;  3LMW A;  2O04 A;  4NK6 A;  4OZY A;  1GQ8 A;  2VBM A;  4Z06 A;  1O88 A;  1CZF A;  3SUC A;  1DBG A;  1O8G A;  1O8D A;  1O8K A;  3KRG A;  1O8E A;  2BSP A;  3JUR A;  3FY3 A;  1OFM A;  2ODL A;  2NTP A;  1JTA A;  4W8Q A;  4XN3 A;  4XON A;  4MXN A;  4XOT A;  2IQ7 A;  2O0W A;  2NT6 A;  3WWG A;  4PMH A;  1IB4 A;  2NTB A;  2VBK A;  2X6W A;  4U4B A;  1KCC A;  4XLC A;  1O8I A;  3VMV A;  3ZPP A;  2O1D A;  4Z05 A;  4XLF A;  4OZZ A;  2NSP A;  1OGM X;  1IA5 A;  4XQF A;  4C2L A;  2NST A;  1EE6 A;  4EW9 A;  1OOC A;  3VSV A;  2INU A;  4U49 A;  1BN8 A;  3GQA A;  4AVZ A;  3EQN A;  5AMV A;  1H80 A;  1KTW A;  3UW0 A;  2UVF A;  2PYH A;  1RU4 A;  4XN0 A;  3VST A;  4XLA A;  4XM3 A;  2O0V A;  1XG2 A;  4MR0 A;  1IDJ A;  1K5C A;  1VBL A;  2Z8G A;  4XKV A;  1PLU A;  2VBE A;  3B4N A;  4YEL A;  4YEJ A;  5C1C A;  4OJO A;  4XKW A;  1X0C A;  4I84 A;  3B90 A;  4XLE A;  4YZX A;  2X6Y A;  1O8J A;  4W8S A;  1QCX A;  2QXZ A;  2X6X A;  3VSU A;  4YZA A;  1OGO X;  4XOP A;  3EQO A;  2NZM A;  2NT9 A;  2PYG A;  3GRH A;  4OJ5 A;  1O8F A;  1KCD A;  2VJJ A;  2QX3 A;  4W8T A;  4W8R A;  4XOR A;  1OFL A;  1AIR A;  4URR A;  2QY1 A;  3VMW A;  2PEC A;  1O8H A;  1RMG A;  1QJV A;  2INV A;  4XL9 A;  3GQ8 A;  1PE9 A;  4YZ0 A;  1O8M A;  2O17 A;  1PXZ A;  1RWR A;  2VJI A;  3B8Y A; 
#chains in the Genus database with same CATH topology
 1IDK A;  3LYC A;  3BH6 B;  1HG8 A;  4YZQ A;  2EWE A;  1DAB A;  3T9G A;  4XMY A;  1DBO A;  1O8L A;  2X3H A;  3GQ7 A;  4OJP A;  1WMR A;  4XR6 A;  4OJ6 A;  4HWV A;  1TYX A;  2NTQ A;  4XNF A;  4YEI A;  4OJL A;  4XLH A;  2UVE A;  5C1E A;  3ZSC A;  1TYW A;  2X85 A;  1NHC A;  4NK8 A;  1JRG A;  4Z03 A;  3TH0 A;  1BHE A;  3GQ9 A;  1LLW A;  3LMW A;  1EZG A;  2O04 A;  4NK6 A;  1QA3 A;  3PSZ A;  3N90 A;  4OZY A;  4YC5 A;  1GQ8 A;  1TSP A;  3P4G A;  2VBM A;  4Z06 A;  1O88 A;  1CZF A;  3SUC A;  1DBG A;  2BM7 A;  1O8G A;  1O8D A;  1O8K A;  1QQ1 A;  1K4Z A;  3KRG A;  1O8E A;  1QRC A;  1TYU A;  1LM1 A;  2BSP A;  3FY3 A;  1OFM A;  3JUR A;  3N6Z A;  2ODL A;  2NTP A;  1JTA A;  3PET A;  4W8Q A;  4XN3 A;  4MXN A;  1K8F A;  4XOT A;  4XON A;  2IQ7 A;  2O0W A;  2XTW A;  1L1I A;  2NT6 A;  2XTX A;  3WWG A;  4PMH A;  1IB4 A;  2NTB A;  2VBK A;  2VFO A;  2X6W A;  2XT4 A;  3DU1 X;  4U4B A;  1KCC A;  4XLC A;  1O8I A;  3VMV A;  4YDT A;  3ZPP A;  1WXR A;  2O1D A;  4Z05 A;  3NAW A;  2O6W A;  4XLF A;  2YUH A;  4OZZ A;  1HF2 A;  2NSP A;  2J8K A;  1OGM X;  4KH3 A;  2W7Z A;  1IA5 A;  1LLZ A;  2BM6 A;  4V02 C;  4C2L A;  2NST A;  1EE6 A;  4EW9 A;  1OFD A;  2VFQ A;  4XQF A;  1OOC A;  1QRB A;  3VSV A;  3NB2 A;  2B0R A;  2INU A;  4OPW A;  4U49 A;  2VFM A;  1BN8 A;  3GQA A;  4AVZ A;  2VFN A;  2G0Y A;  3EQN A;  5AMV A;  1H80 A;  1KTW A;  3UW0 A;  2UVF A;  2PYH A;  1RU4 A;  3BH7 B;  4XN0 A;  3VST A;  5DNS A;  4XLA A;  3RIQ A;  4XM3 A;  2O0V A;  3SYJ A;  3SZE A;  1XG2 A;  4MR0 A;  1IDJ A;  2BM4 A;  5JLV C;  4YCQ A;  1TYV A;  1K5C A;  3SY2 A;  1VBL A;  1CLW A;  2Z8G A;  4XKV A;  1PLU A;  2VBE A;  1QA2 A;  3B4N A;  4YEL A;  4YEJ A;  5C1C A;  3ML3 A;  2V5I A;  3LJY A;  4OJO A;  4XKW A;  1X0C A;  4I84 A;  3B90 A;  4XLE A;  4YZX A;  2X6Y A;  1O8J A;  4W8S A;  1QCX A;  2QXZ A;  2X6X A;  3VSU A;  4YZA A;  1OGO X;  4XOP A;  3H09 A;  4JRA C;  1OFE A;  4OM9 A;  3EQO A;  2NZM A;  2NT9 A;  2XT2 A;  2PYG A;  3GRH A;  1QA1 A;  4OJ5 A;  1KQ5 A;  1O8F A;  2QZA A;  3JX8 A;  1KCD A;  2VJJ A;  2F3L A;  2QX3 A;  4W8T A;  4W8R A;  2XC1 A;  4XOR A;  1OFL A;  1AIR A;  4URR A;  3SQV A;  2QY1 A;  4YFO A;  3VMW A;  2PEC A;  1O8H A;  1RMG A;  2BX6 A;  1QJV A;  2BM5 A;  2INV A;  3PSS A;  2XTY A;  4XL9 A;  1EA0 A;  2QYU A;  3GQ8 A;  2J8I A;  1PE9 A;  2VFP A;  4YZ0 A;  1O8M A;  2O17 A;  1PXZ A;  1RWR A;  3AK5 A;  2IOU G;  2VJI A;  5JMC B;  3B8Y A; 
#chains in the Genus database with same CATH homology
 1IDK A;  1HG8 A;  4YZQ A;  2EWE A;  3T9G A;  4XMY A;  1DBO A;  1O8L A;  2X3H A;  3GQ7 A;  4OJP A;  1WMR A;  4XR6 A;  4OJ6 A;  4HWV A;  2NTQ A;  4XNF A;  4OJL A;  4XLH A;  2UVE A;  5C1E A;  3ZSC A;  2X85 A;  1NHC A;  4NK8 A;  1JRG A;  4Z03 A;  1BHE A;  3GQ9 A;  3LMW A;  2O04 A;  4NK6 A;  4OZY A;  1GQ8 A;  2VBM A;  4Z06 A;  1O88 A;  1CZF A;  3SUC A;  1DBG A;  1O8G A;  1O8D A;  1O8K A;  3KRG A;  1O8E A;  2BSP A;  3JUR A;  3FY3 A;  1OFM A;  2ODL A;  2NTP A;  1JTA A;  4W8Q A;  4XN3 A;  4XON A;  4MXN A;  4XOT A;  2IQ7 A;  2O0W A;  2NT6 A;  3WWG A;  4PMH A;  1IB4 A;  2NTB A;  2VBK A;  2X6W A;  4U4B A;  1KCC A;  4XLC A;  1O8I A;  3VMV A;  3ZPP A;  2O1D A;  4Z05 A;  4XLF A;  4OZZ A;  2NSP A;  1OGM X;  1IA5 A;  4XQF A;  4C2L A;  2NST A;  1EE6 A;  4EW9 A;  1OOC A;  3VSV A;  2INU A;  4U49 A;  1BN8 A;  3GQA A;  4AVZ A;  3EQN A;  5AMV A;  1H80 A;  1KTW A;  3UW0 A;  2UVF A;  2PYH A;  1RU4 A;  4XN0 A;  3VST A;  4XLA A;  4XM3 A;  2O0V A;  1XG2 A;  4MR0 A;  1IDJ A;  1K5C A;  1VBL A;  2Z8G A;  4XKV A;  1PLU A;  2VBE A;  3B4N A;  4YEL A;  4YEJ A;  5C1C A;  4OJO A;  4XKW A;  1X0C A;  4I84 A;  3B90 A;  4XLE A;  4YZX A;  2X6Y A;  1O8J A;  4W8S A;  1QCX A;  2QXZ A;  2X6X A;  3VSU A;  4YZA A;  1OGO X;  4XOP A;  3EQO A;  2NZM A;  2NT9 A;  2PYG A;  3GRH A;  4OJ5 A;  1O8F A;  1KCD A;  2VJJ A;  2QX3 A;  4W8T A;  4W8R A;  4XOR A;  1OFL A;  1AIR A;  4URR A;  2QY1 A;  3VMW A;  2PEC A;  1O8H A;  1RMG A;  1QJV A;  2INV A;  4XL9 A;  3GQ8 A;  1PE9 A;  4YZ0 A;  1O8M A;  2O17 A;  1PXZ A;  1RWR A;  2VJI A;  3B8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...