2ODLA

Crystal structure of the hmw1 secretion domain from haemophilus influenzae
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
372
structure length
372
Chain Sequence
GLQGMDVVHGTATMQVDGNKTIIRNSVDAIINWKQFNIDQNEMVQFLQENNNSAVFNRVTSNQISQLKGILDSNGQVFLINPNGITIGKDAIINTNGFTASTLDISNENIKARNFTFEQTKDKALAEIVNHGLITVGKDGSVNLIGGKVKNEGVISVNGGSISLLAGQKITISDIINPTITYSIAAPENEAVNLGDIFAKGGNINVRAATIRNQGKLSADSVSKDKSGNIVLSAKEGEAEIGGVISAQNQQAKGGKLMITGDKVTLKTGAVIDLSGKEGGETYLGGDERGEGKNGIQLAKKTSLEKGSTINVSGKEKGGRAIVWGDIALIDGNINAQGSGDIAKTGGFVETSGHDLFIKDNAIVDAKEWLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin
publication title The structure of the Haemophilus influenzae HMW1 pro-piece reveals a structural domain essential for bacterial two-partner secretion.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Cell adhesion
total genus 146
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2006-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2odlA00
5AMVA 4YZ0A 4OJ5A 4XLCA 4PMHA 1KCCA 2PYHA 3GQ9A 4XKVA 3B8YA 1O8KA 2VBKA 1IDJA 1RU4A 2NT6A 1O8EA 3B4NA 4OJLA 2X3HA 2X6YA 3GQAA 1KTWA 2NT9A 2NTQA 1CZFA 1O8DA 1PE9A 1O8GA 1PXZA 4XL9A 4URRA 4XN0A 4Z05A 3VMWA 4C2LA 1O88A 1O8LA 4XM3A 3UW0A 1X0CA 1QCXA 3VSTA 1O8MA 2O04A 4XLAA 4EW9A 2QX3A 2NSPA 1O8JA 4OZZA 4XOTA 1OGOX 1VBLA 4XMYA 2O1DA 4OJ6A 4YZXA 1EE6A 2UVEA 2O0VA 3JURA 3T9GA 5C1EA 1OFLA 2VBEA 1XG2A 4XOPA 3LMWA 4W8TA 2VJJA 4XN3A 1WMRA 4XKWA 3EQOA 2BSPA 3ZSCA 4W8RA 1HG8A 4W8QA 4XLHA 4YELA 1IB4A 1JTAA 5C1CA 1IA5A 2NTBA 2UVFA 2QY1A 1QJVA 4XONA 1NHCA 1OGMX 4W8SA 3B90A 2PECA 4NK6A 3VSVA 4XNFA 1DBOA 1JRGA 3EQNA 4OJPA 1RWRA 2QXZA 1O8HA 4YZAA 4MXNA 1PLUA 3WWGA 1KCDA 4Z06A 1DBGA 3VSUA 1AIRA 2X6XA 4YEJA 1K5CA 1IDKA 2IQ7A 4XLFA 3GQ7A 4MR0A 3KRGA 4I84A 2VBMA 4AVZA 1OOCA 2X6WA 2X85A 2NSTA 3GRHA 1OFMA 2INUA 1H80A 2VJIA 1BN8A 2O0WA 4Z03A 3FY3A 4XQFA 3SUCA 2Z8GA 4U4BA 1RMGA 2EWEA 4YZQA 4XORA 1O8IA 4U49A 3VMVA 3ZPPA 4HWVA 1GQ8A 2ODLA 2INVA 2NTPA 4OZYA 4XR6A 2NZMA 1O8FA 4NK8A 1BHEA 4XLEA 2PYGA 3GQ8A 2O17A 4OJOA
chains in the Genus database with same CATH superfamily
5AMVA 1LLWA 2BM4A 4YZ0A 4OJ5A 4XLCA 4PMHA 4YDTA 2XTXA 1KCCA 1EZGA 2PYHA 2XTYA 3GQ9A 4XKVA 1TYXA 3B8YA 4KH3A 1O8KA 2VBKA 1IDJA 1RU4A 2NT6A 2VFMA 2J8IA 1O8EA 2XTWA 3B4NA 1QA3A 4OJLA 1K8FA 2X3HA 3TH0A 3N90A 2X6YA 3GQAA 1KTWA 3N6ZA 2NT9A 2NTQA 4V02C 4YC5A 1CZFA 1L1IA 1O8DA 1PE9A 1O8GA 1PXZA 1LM1A 3PETA 4URRA 4XL9A 4XN0A 4Z05A 1TYUA 3SY2A 3SYJA 1OFEA 1O88A 1O8LA 4XM3A 3UW0A 1QA2A 1X0CA 1QCXA 3VSTA 1O8MA 2O04A 4XLAA 4EW9A 2QX3A 2VFOA 2NSPA 1O8JA 2J8KA 2W7ZA 2VFPA 4OZZA 1OGOX 4XOTA 4C2LA 3AK5A 1VBLA 4XMYA 5JLVC 2O1DA 4OJ6A 1QQ1A 2BM6A 4YZXA 1EE6A 2UVEA 2O0VA 3JURA 4YEIA 3T9GA 5C1EA 3VMWA 1OFLA 1TYVA 2B0RA 2VBEA 1HF2A 1XG2A 3JX8A 4XOPA 4YFOA 3LMWA 3P4GA 2YUHA 4W8TA 2VJJA 4XN3A 1WMRA 4XKWA 3EQOA 2IOUG 2BSPA 3ZSCA 3BH6B 4W8RA 1HG8A 4W8QA 4XLHA 1DABA 4YELA 1WXRA 3SQVA 1IB4A 1JTAA 5C1CA 1IA5A 2NTBA 2UVFA 2QY1A 1QJVA 4XONA 2BX6A 1NHCA 1QRBA 2XT2A 1OGMX 2QZAA 4OM9A 5JMCB 4W8SA 3B90A 2PECA 2V5IA 4NK6A 5DNSA 3VSVA 1TYWA 1DBOA 1QRCA 4XNFA 1JRGA 2G0YA 3EQNA 4OJPA 2QYUA 1RWRA 2QXZA 1O8HA 1QA1A 4YZAA 3NAWA 4MXNA 1PLUA 3WWGA 1KCDA 2BM5A 4JRAC 1DBGA 4Z06A 2O6WA 1CLWA 3VSUA 3H09A 1AIRA 2X6XA 4YEJA 1K5CA 1IDKA 2XC1A 2VFNA 2IQ7A 4XLFA 3SZEA 3GQ7A 4MR0A 3KRGA 4I84A 2VBMA 4AVZA 1OOCA 1EA0A 2X6WA 2X85A 2NSTA 3DU1X 2VFQA 3RIQA 3BH7B 3GRHA 1OFMA 2INUA 3ML3A 1H80A 3LJYA 2VJIA 1BN8A 2O0WA 3LYCA 1KQ5A 4Z03A 3FY3A 4XQFA 3SUCA 4YCQA 4OPWA 3PSZA 2Z8GA 4U4BA 1RMGA 2F3LA 2EWEA 4YZQA 1K4ZA 1O8IA 4U49A 4XORA 3VMVA 1OFDA 3ZPPA 4HWVA 1TSPA 1GQ8A 2ODLA 3NB2A 2INVA 2NTPA 4OZYA 4XR6A 2NZMA 1O8FA 4NK8A 1BHEA 1LLZA 4XLEA 2XT4A 2BM7A 2PYGA 3PSSA 3GQ8A 2O17A 4OJOA
chains in the Genus database with same CATH topology
5AMVA 4YZ0A 4OJ5A 4XLCA 4PMHA 1KCCA 2PYHA 3GQ9A 4XKVA 3B8YA 1O8KA 2VBKA 1IDJA 1RU4A 2NT6A 1O8EA 3B4NA 4OJLA 2X3HA 2X6YA 3GQAA 1KTWA 2NT9A 2NTQA 1CZFA 1O8DA 1PE9A 1O8GA 1PXZA 4XL9A 4URRA 4XN0A 4Z05A 3VMWA 4C2LA 1O88A 1O8LA 4XM3A 3UW0A 1X0CA 1QCXA 3VSTA 1O8MA 2O04A 4XLAA 4EW9A 2QX3A 2NSPA 1O8JA 4OZZA 4XOTA 1OGOX 1VBLA 4XMYA 2O1DA 4OJ6A 4YZXA 1EE6A 2UVEA 2O0VA 3JURA 3T9GA 5C1EA 1OFLA 2VBEA 1XG2A 4XOPA 3LMWA 4W8TA 2VJJA 4XN3A 1WMRA 4XKWA 3EQOA 2BSPA 3ZSCA 4W8RA 1HG8A 4W8QA 4XLHA 4YELA 1IB4A 1JTAA 5C1CA 1IA5A 2NTBA 2UVFA 2QY1A 1QJVA 4XONA 1NHCA 1OGMX 4W8SA 3B90A 2PECA 4NK6A 3VSVA 4XNFA 1DBOA 1JRGA 3EQNA 4OJPA 1RWRA 2QXZA 1O8HA 4YZAA 4MXNA 1PLUA 3WWGA 1KCDA 4Z06A 1DBGA 3VSUA 1AIRA 2X6XA 4YEJA 1K5CA 1IDKA 2IQ7A 4XLFA 3GQ7A 4MR0A 3KRGA 4I84A 2VBMA 4AVZA 1OOCA 2X6WA 2X85A 2NSTA 3GRHA 1OFMA 2INUA 1H80A 2VJIA 1BN8A 2O0WA 4Z03A 3FY3A 4XQFA 3SUCA 2Z8GA 4U4BA 1RMGA 2EWEA 4YZQA 4XORA 1O8IA 4U49A 3VMVA 3ZPPA 4HWVA 1GQ8A 2ODLA 2INVA 2NTPA 4OZYA 4XR6A 2NZMA 1O8FA 4NK8A 1BHEA 4XLEA 2PYGA 3GQ8A 2O17A 4OJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AMV A;  4YZ0 A;  4OJ5 A;  4XLC A;  4PMH A;  1KCC A;  2PYH A;  3GQ9 A;  4XKV A;  3B8Y A;  1O8K A;  2VBK A;  1IDJ A;  1RU4 A;  2NT6 A;  1O8E A;  3B4N A;  4OJL A;  2X3H A;  2X6Y A;  3GQA A;  1KTW A;  2NT9 A;  2NTQ A;  1CZF A;  1O8D A;  1PE9 A;  1O8G A;  1PXZ A;  4XL9 A;  4URR A;  4XN0 A;  4Z05 A;  3VMW A;  4C2L A;  1O88 A;  1O8L A;  4XM3 A;  3UW0 A;  1X0C A;  1QCX A;  3VST A;  1O8M A;  2O04 A;  4XLA A;  4EW9 A;  2QX3 A;  2NSP A;  1O8J A;  4OZZ A;  4XOT A;  1OGO X;  1VBL A;  4XMY A;  2O1D A;  4OJ6 A;  4YZX A;  1EE6 A;  2UVE A;  2O0V A;  3JUR A;  3T9G A;  5C1E A;  1OFL A;  2VBE A;  1XG2 A;  4XOP A;  3LMW A;  4W8T A;  2VJJ A;  4XN3 A;  1WMR A;  4XKW A;  3EQO A;  2BSP A;  3ZSC A;  4W8R A;  1HG8 A;  4W8Q A;  4XLH A;  4YEL A;  1IB4 A;  1JTA A;  5C1C A;  1IA5 A;  2NTB A;  2UVF A;  2QY1 A;  1QJV A;  4XON A;  1NHC A;  1OGM X;  4W8S A;  3B90 A;  2PEC A;  4NK6 A;  3VSV A;  4XNF A;  1DBO A;  1JRG A;  3EQN A;  4OJP A;  1RWR A;  2QXZ A;  1O8H A;  4YZA A;  4MXN A;  1PLU A;  3WWG A;  1KCD A;  4Z06 A;  1DBG A;  3VSU A;  1AIR A;  2X6X A;  4YEJ A;  1K5C A;  1IDK A;  2IQ7 A;  4XLF A;  3GQ7 A;  4MR0 A;  3KRG A;  4I84 A;  2VBM A;  4AVZ A;  1OOC A;  2X6W A;  2X85 A;  2NST A;  3GRH A;  1OFM A;  2INU A;  1H80 A;  2VJI A;  1BN8 A;  2O0W A;  4Z03 A;  3FY3 A;  4XQF A;  3SUC A;  2Z8G A;  4U4B A;  1RMG A;  2EWE A;  4YZQ A;  4XOR A;  1O8I A;  4U49 A;  3VMV A;  3ZPP A;  4HWV A;  1GQ8 A;  2ODL A;  2INV A;  2NTP A;  4OZY A;  4XR6 A;  2NZM A;  1O8F A;  4NK8 A;  1BHE A;  4XLE A;  2PYG A;  3GQ8 A;  2O17 A;  4OJO A; 
#chains in the Genus database with same CATH topology
 5AMV A;  1LLW A;  2BM4 A;  4YZ0 A;  4OJ5 A;  4XLC A;  4PMH A;  4YDT A;  2XTX A;  1KCC A;  1EZG A;  2PYH A;  2XTY A;  3GQ9 A;  4XKV A;  1TYX A;  3B8Y A;  4KH3 A;  1O8K A;  2VBK A;  1IDJ A;  1RU4 A;  2NT6 A;  2VFM A;  2J8I A;  1O8E A;  2XTW A;  3B4N A;  1QA3 A;  4OJL A;  1K8F A;  2X3H A;  3TH0 A;  3N90 A;  2X6Y A;  3GQA A;  1KTW A;  3N6Z A;  2NT9 A;  2NTQ A;  4V02 C;  4YC5 A;  1CZF A;  1L1I A;  1O8D A;  1PE9 A;  1O8G A;  1PXZ A;  1LM1 A;  3PET A;  4URR A;  4XL9 A;  4XN0 A;  4Z05 A;  1TYU A;  3SY2 A;  3SYJ A;  1OFE A;  1O88 A;  1O8L A;  4XM3 A;  3UW0 A;  1QA2 A;  1X0C A;  1QCX A;  3VST A;  1O8M A;  2O04 A;  4XLA A;  4EW9 A;  2QX3 A;  2VFO A;  2NSP A;  1O8J A;  2J8K A;  2W7Z A;  2VFP A;  4OZZ A;  1OGO X;  4XOT A;  4C2L A;  3AK5 A;  1VBL A;  4XMY A;  5JLV C;  2O1D A;  4OJ6 A;  1QQ1 A;  2BM6 A;  4YZX A;  1EE6 A;  2UVE A;  2O0V A;  3JUR A;  4YEI A;  3T9G A;  5C1E A;  3VMW A;  1OFL A;  1TYV A;  2B0R A;  2VBE A;  1HF2 A;  1XG2 A;  3JX8 A;  4XOP A;  4YFO A;  3LMW A;  3P4G A;  2YUH A;  4W8T A;  2VJJ A;  4XN3 A;  1WMR A;  4XKW A;  3EQO A;  2IOU G;  2BSP A;  3ZSC A;  3BH6 B;  4W8R A;  1HG8 A;  4W8Q A;  4XLH A;  1DAB A;  4YEL A;  1WXR A;  3SQV A;  1IB4 A;  1JTA A;  5C1C A;  1IA5 A;  2NTB A;  2UVF A;  2QY1 A;  1QJV A;  4XON A;  2BX6 A;  1NHC A;  1QRB A;  2XT2 A;  1OGM X;  2QZA A;  4OM9 A;  5JMC B;  4W8S A;  3B90 A;  2PEC A;  2V5I A;  4NK6 A;  5DNS A;  3VSV A;  1TYW A;  1DBO A;  1QRC A;  4XNF A;  1JRG A;  2G0Y A;  3EQN A;  4OJP A;  2QYU A;  1RWR A;  2QXZ A;  1O8H A;  1QA1 A;  4YZA A;  3NAW A;  4MXN A;  1PLU A;  3WWG A;  1KCD A;  2BM5 A;  4JRA C;  1DBG A;  4Z06 A;  2O6W A;  1CLW A;  3VSU A;  3H09 A;  1AIR A;  2X6X A;  4YEJ A;  1K5C A;  1IDK A;  2XC1 A;  2VFN A;  2IQ7 A;  4XLF A;  3SZE A;  3GQ7 A;  4MR0 A;  3KRG A;  4I84 A;  2VBM A;  4AVZ A;  1OOC A;  1EA0 A;  2X6W A;  2X85 A;  2NST A;  3DU1 X;  2VFQ A;  3RIQ A;  3BH7 B;  3GRH A;  1OFM A;  2INU A;  3ML3 A;  1H80 A;  3LJY A;  2VJI A;  1BN8 A;  2O0W A;  3LYC A;  1KQ5 A;  4Z03 A;  3FY3 A;  4XQF A;  3SUC A;  4YCQ A;  4OPW A;  3PSZ A;  2Z8G A;  4U4B A;  1RMG A;  2F3L A;  2EWE A;  4YZQ A;  1K4Z A;  1O8I A;  4U49 A;  4XOR A;  3VMV A;  1OFD A;  3ZPP A;  4HWV A;  1TSP A;  1GQ8 A;  2ODL A;  3NB2 A;  2INV A;  2NTP A;  4OZY A;  4XR6 A;  2NZM A;  1O8F A;  4NK8 A;  1BHE A;  1LLZ A;  4XLE A;  2XT4 A;  2BM7 A;  2PYG A;  3PSS A;  3GQ8 A;  2O17 A;  4OJO A; 
#chains in the Genus database with same CATH homology
 5AMV A;  4YZ0 A;  4OJ5 A;  4XLC A;  4PMH A;  1KCC A;  2PYH A;  3GQ9 A;  4XKV A;  3B8Y A;  1O8K A;  2VBK A;  1IDJ A;  1RU4 A;  2NT6 A;  1O8E A;  3B4N A;  4OJL A;  2X3H A;  2X6Y A;  3GQA A;  1KTW A;  2NT9 A;  2NTQ A;  1CZF A;  1O8D A;  1PE9 A;  1O8G A;  1PXZ A;  4XL9 A;  4URR A;  4XN0 A;  4Z05 A;  3VMW A;  4C2L A;  1O88 A;  1O8L A;  4XM3 A;  3UW0 A;  1X0C A;  1QCX A;  3VST A;  1O8M A;  2O04 A;  4XLA A;  4EW9 A;  2QX3 A;  2NSP A;  1O8J A;  4OZZ A;  4XOT A;  1OGO X;  1VBL A;  4XMY A;  2O1D A;  4OJ6 A;  4YZX A;  1EE6 A;  2UVE A;  2O0V A;  3JUR A;  3T9G A;  5C1E A;  1OFL A;  2VBE A;  1XG2 A;  4XOP A;  3LMW A;  4W8T A;  2VJJ A;  4XN3 A;  1WMR A;  4XKW A;  3EQO A;  2BSP A;  3ZSC A;  4W8R A;  1HG8 A;  4W8Q A;  4XLH A;  4YEL A;  1IB4 A;  1JTA A;  5C1C A;  1IA5 A;  2NTB A;  2UVF A;  2QY1 A;  1QJV A;  4XON A;  1NHC A;  1OGM X;  4W8S A;  3B90 A;  2PEC A;  4NK6 A;  3VSV A;  4XNF A;  1DBO A;  1JRG A;  3EQN A;  4OJP A;  1RWR A;  2QXZ A;  1O8H A;  4YZA A;  4MXN A;  1PLU A;  3WWG A;  1KCD A;  4Z06 A;  1DBG A;  3VSU A;  1AIR A;  2X6X A;  4YEJ A;  1K5C A;  1IDK A;  2IQ7 A;  4XLF A;  3GQ7 A;  4MR0 A;  3KRG A;  4I84 A;  2VBM A;  4AVZ A;  1OOC A;  2X6W A;  2X85 A;  2NST A;  3GRH A;  1OFM A;  2INU A;  1H80 A;  2VJI A;  1BN8 A;  2O0W A;  4Z03 A;  3FY3 A;  4XQF A;  3SUC A;  2Z8G A;  4U4B A;  1RMG A;  2EWE A;  4YZQ A;  4XOR A;  1O8I A;  4U49 A;  3VMV A;  3ZPP A;  4HWV A;  1GQ8 A;  2ODL A;  2INV A;  2NTP A;  4OZY A;  4XR6 A;  2NZM A;  1O8F A;  4NK8 A;  1BHE A;  4XLE A;  2PYG A;  3GQ8 A;  2O17 A;  4OJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...