2PYHA

Azotobacter vinelandii mannuronan c-5 epimerase alge4 a-module complexed with mannuronan trisaccharide
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
376
structure length
376
Chain Sequence
MDYNVKDFGALGDGVSDDRASIQAAIDAAYAAGGGTVYLPAGEYRVSAAGEPGDGCLMLKDGVYLAGAGMGETVIKLIDGSDQKITGMVRSAYGEETSNFGMRDLTLDGNRDNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMSGYGFDPHEQTINLTIRDSVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGTDYSSLIDNDIAGVQQPIQLYGPHSTVSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
publication title Structural and Mutational Characterization of the Catalytic A-module of the Mannuronan C-5-epimerase AlgE4 from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 163
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pyhA00
3B90A 1IA5A 1IB4A 2VJIA 2NTQA 3EQOA 3VSVA 1OFLA 1PXZA 4OJ5A 3SUCA 1OOCA 4XORA 4PMHA 2O0WA 2QXZA 1BN8A 1RU4A 4OJLA 2X6XA 2O04A 4XN3A 1NHCA 4YZXA 4XKVA 2INVA 4OJPA 1DBOA 4MXNA 4XMYA 2NT6A 2O0VA 4MR0A 2O17A 4XLFA 2BSPA 2NSPA 4XLAA 4HWVA 3VMVA 4XR6A 3UW0A 2QX3A 1OGOX 3VSTA 4OJ6A 1KCCA 4YZAA 1KTWA 2QY1A 1K5CA 5AMVA 2X85A 2Z8GA 4XM3A 2NT9A 1EE6A 4U4BA 4YELA 3FY3A 3T9GA 4XOPA 2ODLA 4C2LA 1PE9A 4NK6A 3EQNA 1QJVA 1O8EA 2VJJA 5C1CA 1O88A 1O8DA 1AIRA 4URRA 1O8GA 4YZ0A 4U49A 1H80A 2VBMA 4I84A 4XKWA 1QCXA 2NZMA 4OZZA 2INUA 2PYGA 2PYHA 4XLCA 1RWRA 1CZFA 2VBKA 3GQ8A 5C1EA 2NSTA 1HG8A 3ZPPA 4Z03A 4YEJA 1X0CA 3GRHA 4XOTA 3VMWA 4OZYA 3ZSCA 1VBLA 3GQAA 1O8HA 1WMRA 3LMWA 1GQ8A 4W8QA 4XN0A 4XL9A 2X6YA 2UVFA 3GQ7A 1O8LA 4W8TA 3JURA 4AVZA 4XNFA 4W8SA 4XLHA 2X3HA 1BHEA 4YZQA 1O8KA 2NTPA 1O8FA 1XG2A 2VBEA 2X6WA 4OJOA 1JRGA 1OGMX 1RMGA 4XLEA 2EWEA 4XQFA 3GQ9A 1PLUA 2IQ7A 3VSUA 1IDJA 4W8RA 1OFMA 3WWGA 3B4NA 2O1DA 2UVEA 4Z05A 1KCDA 1IDKA 1O8IA 2PECA 3KRGA 4NK8A 4EW9A 3B8YA 1DBGA 1O8JA 2NTBA 4XONA 1O8MA 1JTAA 4Z06A
chains in the Genus database with same CATH superfamily
2VFMA 2VFPA 3B90A 3N90A 2VJIA 2NTQA 3EQOA 3PSZA 4YCQA 3VSVA 1OFLA 1PXZA 1IB4A 4OJ5A 1L1IA 3SUCA 1OOCA 4XORA 4PMHA 2XTYA 2O0WA 2QXZA 1BN8A 1RU4A 4OJLA 3SZEA 2X6XA 2O04A 1CLWA 2YUHA 4YEIA 4XN3A 1QA1A 1NHCA 4YZXA 3LJYA 2INVA 4OJPA 4XKVA 1DBOA 1LLWA 1QA2A 1HF2A 2BM5A 2BM6A 3LYCA 2NT6A 4MXNA 4OM9A 4XMYA 1TYVA 2O0VA 3DU1X 3SQVA 1EZGA 4MR0A 2VFOA 2O17A 4XLFA 2BSPA 2NSPA 4XLAA 1K4ZA 2BM7A 3RIQA 4HWVA 3VMVA 4XR6A 3UW0A 2QX3A 3H09A 1OGOX 3BH6B 2XT2A 2VFNA 3VSTA 1OFEA 4OJ6A 1KCCA 4YZAA 1KTWA 1EA0A 2QY1A 1K5CA 5AMVA 2X85A 2Z8GA 3JX8A 4XM3A 5JLVC 2NT9A 1EE6A 1LLZA 4OPWA 4U4BA 2F3LA 2BM4A 3FY3A 4YELA 2O6WA 4XOPA 3T9GA 2ODLA 3AK5A 4C2LA 3N6ZA 1PE9A 4NK6A 3EQNA 1TYXA 1QJVA 1O8EA 1LM1A 2VJJA 5C1CA 3PETA 1WXRA 1O88A 1O8DA 1AIRA 4URRA 1O8GA 2J8KA 4YC5A 5DNSA 4U49A 4YZ0A 1H80A 2BX6A 2VBMA 4I84A 4XKWA 1QCXA 2NZMA 4OZZA 2INUA 1TSPA 2PYGA 2PYHA 1RWRA 4XLCA 1QA3A 4YDTA 1CZFA 2VBKA 3GQ8A 5C1EA 4YFOA 2NSTA 1HG8A 2V5IA 4Z03A 3ZPPA 4YEJA 1KQ5A 3NB2A 1X0CA 3GRHA 4XOTA 3VMWA 4OZYA 2QYUA 3ZSCA 1TYWA 3BH7B 1VBLA 3GQAA 2W7ZA 1O8HA 1WMRA 3LMWA 1GQ8A 4W8QA 4XN0A 4XL9A 3SYJA 2X6YA 2UVFA 3GQ7A 5JMCB 1O8LA 4W8TA 3JURA 1QQ1A 4XNFA 4AVZA 4W8SA 4XLHA 4KH3A 3PSSA 2X3HA 1BHEA 2VFQA 1O8KA 2NTPA 4YZQA 1O8FA 1XG2A 2VBEA 2X6WA 4OJOA 1JRGA 1OGMX 1RMGA 4XLEA 2B0RA 1QRCA 2EWEA 1K8FA 3TH0A 4XQFA 3GQ9A 2XTWA 4JRAC 1PLUA 1OFDA 2IQ7A 3NAWA 3VSUA 1IDJA 2IOUG 2G0YA 2J8IA 4W8RA 1OFMA 3SY2A 3WWGA 3B4NA 4V02C 2O1DA 2UVEA 4Z05A 1KCDA 1DABA 1IA5A 2XTXA 2XT4A 2XC1A 1IDKA 3ML3A 1O8IA 2PECA 3KRGA 4NK8A 3P4GA 3B8YA 4EW9A 1DBGA 1O8JA 2NTBA 4XONA 1O8MA 1JTAA 1TYUA 2QZAA 1QRBA 4Z06A
chains in the Genus database with same CATH topology
3B90A 1IA5A 1IB4A 2VJIA 2NTQA 3EQOA 3VSVA 1OFLA 1PXZA 4OJ5A 3SUCA 1OOCA 4XORA 4PMHA 2O0WA 2QXZA 1BN8A 1RU4A 4OJLA 2X6XA 2O04A 4XN3A 1NHCA 4YZXA 4XKVA 2INVA 4OJPA 1DBOA 4MXNA 4XMYA 2NT6A 2O0VA 4MR0A 2O17A 4XLFA 2BSPA 2NSPA 4XLAA 4HWVA 3VMVA 4XR6A 3UW0A 2QX3A 1OGOX 3VSTA 4OJ6A 1KCCA 4YZAA 1KTWA 2QY1A 1K5CA 5AMVA 2X85A 2Z8GA 4XM3A 2NT9A 1EE6A 4U4BA 4YELA 3FY3A 3T9GA 4XOPA 2ODLA 4C2LA 1PE9A 4NK6A 3EQNA 1QJVA 1O8EA 2VJJA 5C1CA 1O88A 1O8DA 1AIRA 4URRA 1O8GA 4YZ0A 4U49A 1H80A 2VBMA 4I84A 4XKWA 1QCXA 2NZMA 4OZZA 2INUA 2PYGA 2PYHA 4XLCA 1RWRA 1CZFA 2VBKA 3GQ8A 5C1EA 2NSTA 1HG8A 3ZPPA 4Z03A 4YEJA 1X0CA 3GRHA 4XOTA 3VMWA 4OZYA 3ZSCA 1VBLA 3GQAA 1O8HA 1WMRA 3LMWA 1GQ8A 4W8QA 4XN0A 4XL9A 2X6YA 2UVFA 3GQ7A 1O8LA 4W8TA 3JURA 4AVZA 4XNFA 4W8SA 4XLHA 2X3HA 1BHEA 4YZQA 1O8KA 2NTPA 1O8FA 1XG2A 2VBEA 2X6WA 4OJOA 1JRGA 1OGMX 1RMGA 4XLEA 2EWEA 4XQFA 3GQ9A 1PLUA 2IQ7A 3VSUA 1IDJA 4W8RA 1OFMA 3WWGA 3B4NA 2O1DA 2UVEA 4Z05A 1KCDA 1IDKA 1O8IA 2PECA 3KRGA 4NK8A 4EW9A 3B8YA 1DBGA 1O8JA 2NTBA 4XONA 1O8MA 1JTAA 4Z06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B90 A;  1IA5 A;  1IB4 A;  2VJI A;  2NTQ A;  3EQO A;  3VSV A;  1OFL A;  1PXZ A;  4OJ5 A;  3SUC A;  1OOC A;  4XOR A;  4PMH A;  2O0W A;  2QXZ A;  1BN8 A;  1RU4 A;  4OJL A;  2X6X A;  2O04 A;  4XN3 A;  1NHC A;  4YZX A;  4XKV A;  2INV A;  4OJP A;  1DBO A;  4MXN A;  4XMY A;  2NT6 A;  2O0V A;  4MR0 A;  2O17 A;  4XLF A;  2BSP A;  2NSP A;  4XLA A;  4HWV A;  3VMV A;  4XR6 A;  3UW0 A;  2QX3 A;  1OGO X;  3VST A;  4OJ6 A;  1KCC A;  4YZA A;  1KTW A;  2QY1 A;  1K5C A;  5AMV A;  2X85 A;  2Z8G A;  4XM3 A;  2NT9 A;  1EE6 A;  4U4B A;  4YEL A;  3FY3 A;  3T9G A;  4XOP A;  2ODL A;  4C2L A;  1PE9 A;  4NK6 A;  3EQN A;  1QJV A;  1O8E A;  2VJJ A;  5C1C A;  1O88 A;  1O8D A;  1AIR A;  4URR A;  1O8G A;  4YZ0 A;  4U49 A;  1H80 A;  2VBM A;  4I84 A;  4XKW A;  1QCX A;  2NZM A;  4OZZ A;  2INU A;  2PYG A;  2PYH A;  4XLC A;  1RWR A;  1CZF A;  2VBK A;  3GQ8 A;  5C1E A;  2NST A;  1HG8 A;  3ZPP A;  4Z03 A;  4YEJ A;  1X0C A;  3GRH A;  4XOT A;  3VMW A;  4OZY A;  3ZSC A;  1VBL A;  3GQA A;  1O8H A;  1WMR A;  3LMW A;  1GQ8 A;  4W8Q A;  4XN0 A;  4XL9 A;  2X6Y A;  2UVF A;  3GQ7 A;  1O8L A;  4W8T A;  3JUR A;  4AVZ A;  4XNF A;  4W8S A;  4XLH A;  2X3H A;  1BHE A;  4YZQ A;  1O8K A;  2NTP A;  1O8F A;  1XG2 A;  2VBE A;  2X6W A;  4OJO A;  1JRG A;  1OGM X;  1RMG A;  4XLE A;  2EWE A;  4XQF A;  3GQ9 A;  1PLU A;  2IQ7 A;  3VSU A;  1IDJ A;  4W8R A;  1OFM A;  3WWG A;  3B4N A;  2O1D A;  2UVE A;  4Z05 A;  1KCD A;  1IDK A;  1O8I A;  2PEC A;  3KRG A;  4NK8 A;  4EW9 A;  3B8Y A;  1DBG A;  1O8J A;  2NTB A;  4XON A;  1O8M A;  1JTA A;  4Z06 A; 
#chains in the Genus database with same CATH topology
 2VFM A;  2VFP A;  3B90 A;  3N90 A;  2VJI A;  2NTQ A;  3EQO A;  3PSZ A;  4YCQ A;  3VSV A;  1OFL A;  1PXZ A;  1IB4 A;  4OJ5 A;  1L1I A;  3SUC A;  1OOC A;  4XOR A;  4PMH A;  2XTY A;  2O0W A;  2QXZ A;  1BN8 A;  1RU4 A;  4OJL A;  3SZE A;  2X6X A;  2O04 A;  1CLW A;  2YUH A;  4YEI A;  4XN3 A;  1QA1 A;  1NHC A;  4YZX A;  3LJY A;  2INV A;  4OJP A;  4XKV A;  1DBO A;  1LLW A;  1QA2 A;  1HF2 A;  2BM5 A;  2BM6 A;  3LYC A;  2NT6 A;  4MXN A;  4OM9 A;  4XMY A;  1TYV A;  2O0V A;  3DU1 X;  3SQV A;  1EZG A;  4MR0 A;  2VFO A;  2O17 A;  4XLF A;  2BSP A;  2NSP A;  4XLA A;  1K4Z A;  2BM7 A;  3RIQ A;  4HWV A;  3VMV A;  4XR6 A;  3UW0 A;  2QX3 A;  3H09 A;  1OGO X;  3BH6 B;  2XT2 A;  2VFN A;  3VST A;  1OFE A;  4OJ6 A;  1KCC A;  4YZA A;  1KTW A;  1EA0 A;  2QY1 A;  1K5C A;  5AMV A;  2X85 A;  2Z8G A;  3JX8 A;  4XM3 A;  5JLV C;  2NT9 A;  1EE6 A;  1LLZ A;  4OPW A;  4U4B A;  2F3L A;  2BM4 A;  3FY3 A;  4YEL A;  2O6W A;  4XOP A;  3T9G A;  2ODL A;  3AK5 A;  4C2L A;  3N6Z A;  1PE9 A;  4NK6 A;  3EQN A;  1TYX A;  1QJV A;  1O8E A;  1LM1 A;  2VJJ A;  5C1C A;  3PET A;  1WXR A;  1O88 A;  1O8D A;  1AIR A;  4URR A;  1O8G A;  2J8K A;  4YC5 A;  5DNS A;  4U49 A;  4YZ0 A;  1H80 A;  2BX6 A;  2VBM A;  4I84 A;  4XKW A;  1QCX A;  2NZM A;  4OZZ A;  2INU A;  1TSP A;  2PYG A;  2PYH A;  1RWR A;  4XLC A;  1QA3 A;  4YDT A;  1CZF A;  2VBK A;  3GQ8 A;  5C1E A;  4YFO A;  2NST A;  1HG8 A;  2V5I A;  4Z03 A;  3ZPP A;  4YEJ A;  1KQ5 A;  3NB2 A;  1X0C A;  3GRH A;  4XOT A;  3VMW A;  4OZY A;  2QYU A;  3ZSC A;  1TYW A;  3BH7 B;  1VBL A;  3GQA A;  2W7Z A;  1O8H A;  1WMR A;  3LMW A;  1GQ8 A;  4W8Q A;  4XN0 A;  4XL9 A;  3SYJ A;  2X6Y A;  2UVF A;  3GQ7 A;  5JMC B;  1O8L A;  4W8T A;  3JUR A;  1QQ1 A;  4XNF A;  4AVZ A;  4W8S A;  4XLH A;  4KH3 A;  3PSS A;  2X3H A;  1BHE A;  2VFQ A;  1O8K A;  2NTP A;  4YZQ A;  1O8F A;  1XG2 A;  2VBE A;  2X6W A;  4OJO A;  1JRG A;  1OGM X;  1RMG A;  4XLE A;  2B0R A;  1QRC A;  2EWE A;  1K8F A;  3TH0 A;  4XQF A;  3GQ9 A;  2XTW A;  4JRA C;  1PLU A;  1OFD A;  2IQ7 A;  3NAW A;  3VSU A;  1IDJ A;  2IOU G;  2G0Y A;  2J8I A;  4W8R A;  1OFM A;  3SY2 A;  3WWG A;  3B4N A;  4V02 C;  2O1D A;  2UVE A;  4Z05 A;  1KCD A;  1DAB A;  1IA5 A;  2XTX A;  2XT4 A;  2XC1 A;  1IDK A;  3ML3 A;  1O8I A;  2PEC A;  3KRG A;  4NK8 A;  3P4G A;  3B8Y A;  4EW9 A;  1DBG A;  1O8J A;  2NTB A;  4XON A;  1O8M A;  1JTA A;  1TYU A;  2QZA A;  1QRB A;  4Z06 A; 
#chains in the Genus database with same CATH homology
 3B90 A;  1IA5 A;  1IB4 A;  2VJI A;  2NTQ A;  3EQO A;  3VSV A;  1OFL A;  1PXZ A;  4OJ5 A;  3SUC A;  1OOC A;  4XOR A;  4PMH A;  2O0W A;  2QXZ A;  1BN8 A;  1RU4 A;  4OJL A;  2X6X A;  2O04 A;  4XN3 A;  1NHC A;  4YZX A;  4XKV A;  2INV A;  4OJP A;  1DBO A;  4MXN A;  4XMY A;  2NT6 A;  2O0V A;  4MR0 A;  2O17 A;  4XLF A;  2BSP A;  2NSP A;  4XLA A;  4HWV A;  3VMV A;  4XR6 A;  3UW0 A;  2QX3 A;  1OGO X;  3VST A;  4OJ6 A;  1KCC A;  4YZA A;  1KTW A;  2QY1 A;  1K5C A;  5AMV A;  2X85 A;  2Z8G A;  4XM3 A;  2NT9 A;  1EE6 A;  4U4B A;  4YEL A;  3FY3 A;  3T9G A;  4XOP A;  2ODL A;  4C2L A;  1PE9 A;  4NK6 A;  3EQN A;  1QJV A;  1O8E A;  2VJJ A;  5C1C A;  1O88 A;  1O8D A;  1AIR A;  4URR A;  1O8G A;  4YZ0 A;  4U49 A;  1H80 A;  2VBM A;  4I84 A;  4XKW A;  1QCX A;  2NZM A;  4OZZ A;  2INU A;  2PYG A;  2PYH A;  4XLC A;  1RWR A;  1CZF A;  2VBK A;  3GQ8 A;  5C1E A;  2NST A;  1HG8 A;  3ZPP A;  4Z03 A;  4YEJ A;  1X0C A;  3GRH A;  4XOT A;  3VMW A;  4OZY A;  3ZSC A;  1VBL A;  3GQA A;  1O8H A;  1WMR A;  3LMW A;  1GQ8 A;  4W8Q A;  4XN0 A;  4XL9 A;  2X6Y A;  2UVF A;  3GQ7 A;  1O8L A;  4W8T A;  3JUR A;  4AVZ A;  4XNF A;  4W8S A;  4XLH A;  2X3H A;  1BHE A;  4YZQ A;  1O8K A;  2NTP A;  1O8F A;  1XG2 A;  2VBE A;  2X6W A;  4OJO A;  1JRG A;  1OGM X;  1RMG A;  4XLE A;  2EWE A;  4XQF A;  3GQ9 A;  1PLU A;  2IQ7 A;  3VSU A;  1IDJ A;  4W8R A;  1OFM A;  3WWG A;  3B4N A;  2O1D A;  2UVE A;  4Z05 A;  1KCD A;  1IDK A;  1O8I A;  2PEC A;  3KRG A;  4NK8 A;  4EW9 A;  3B8Y A;  1DBG A;  1O8J A;  2NTB A;  4XON A;  1O8M A;  1JTA A;  4Z06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...