2PYHA

Azotobacter vinelandii mannuronan c-5 epimerase alge4 a-module complexed with mannuronan trisaccharide
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
376
structure length
376
Chain Sequence
b'MDYNVKDFGALGDGVSDDRASIQAAIDAAYAAGGGTVYLPAGEYRVSAAGEPGDGCLMLKDGVYLAGAGMGETVIKLIDGSDQKITGMVRSAYGEETSNFGMRDLTLDGNRDNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMSGYGFDPHEQTINLTIRDSVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGTDYSSLIDNDIAGVQQPIQLYGPHSTVSGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
publication title Structural and Mutational Characterization of the Catalytic A-module of the Mannuronan C-5-epimerase AlgE4 from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Isomerase
total genus 163
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pyhA00
1O88A 2NZMA 4OJOA 2O1DA 2UVFA 3ZSCA 4W8QA 4XM3A 4XOPA 1IB4A 2VBKA 1O8EA 4U4BA 3VMWA 1IDKA 4XORA 3SUCA 4OJ5A 3B4NA 4YZ0A 3GQ9A 4URRA 4YZXA 1JTAA 2NT6A 2NTQA 2O04A 4XKWA 4YEJA 1IDJA 2PYGA 4OJ6A 1OGOX 3GRHA 3JURA 4XLCA 5AMVA 3KRGA 1PXZA 3GQ8A 1GQ8A 1H80A 3EQOA 3VSUA 4XLFA 4AVZA 4OZYA 1OOCA 5C1CA 4PMHA 2INVA 1DBOA 2VJIA 3B8YA 1BHEA 4NK6A 1EE6A 2QY1A 1X0CA 1PLUA 1HG8A 1O8MA 1O8FA 2O17A 4XN3A 1WMRA 1O8HA 1KCDA 2EWEA 4W8RA 4XOTA 4NK8A 4YZQA 4C2LA 1IA5A 3GQAA 1NHCA 3VSVA 2X3HA 4XKVA 4XQFA 1OGMX 1QCXA 2NTPA 2X85A 4OZZA 3EQNA 1OFLA 4YELA 4XR6A 3VSTA 1DBGA 2X6XA 4EW9A 1RU4A 2PYHA 2QX3A 1AIRA 4OJLA 4XL9A 4XNFA 4XLAA 4XLHA 2X6YA 3T9GA 2Z8GA 4I84A 1KCCA 4XONA 1O8GA 4XN0A 4U49A 2O0WA 2VBEA 4HWVA 2BSPA 3UW0A 3VMVA 2NSTA 2NSPA 1O8DA 1O8KA 2IQ7A 5C1EA 2QXZA 2PECA 2O0VA 2INUA 4Z03A 1RMGA 4YZAA 2VJJA 1BN8A 1O8JA 4MXNA 1VBLA 1O8LA 1RWRA 4Z06A 4MR0A 3LMWA 3FY3A 1JRGA 1QJVA 2NT9A 1OFMA 1XG2A 2X6WA 4W8TA 1K5CA 3GQ7A 4XMYA 1PE9A 3B90A 1CZFA 2UVEA 4Z05A 1KTWA 4OJPA 2VBMA 2NTBA 3ZPPA 2ODLA 1O8IA 4W8SA 4XLEA 3WWGA
chains in the Genus database with same CATH superfamily
2XC1A 1O88A 5JLVC 2NZMA 4OJOA 2O1DA 4YEIA 2UVFA 3H09A 2F3LA 1QQ1A 3ZSCA 4W8QA 4XM3A 4XOPA 1KQ5A 1IB4A 2W7ZA 2VBKA 2BM7A 2XTWA 4OM9A 1O8EA 4U4BA 3VMWA 1IDKA 4XORA 1LLWA 2XTXA 3SUCA 2IOUG 4OJ5A 3B4NA 3PSSA 1QRCA 4YZ0A 3GQ9A 1HF2A 4URRA 1EA0A 4YZXA 1JTAA 2NT6A 2NTQA 2O04A 3NAWA 4XKWA 4YEJA 1IDJA 1QA1A 2PYGA 4OJ6A 1OGOX 3GRHA 3JURA 4XLCA 5AMVA 3SQVA 3KRGA 3SYJA 1QA2A 1TYXA 1PXZA 2VFPA 3GQ8A 3RIQA 2J8KA 1GQ8A 3PETA 1H80A 3EQOA 3VSUA 2XT2A 4XLFA 4AVZA 4YCQA 4OZYA 1OOCA 2VFQA 5C1CA 4PMHA 1TYVA 3SZEA 2INVA 1DBOA 1L1IA 2VJIA 3B8YA 3BH6B 1BHEA 4NK6A 1EE6A 2QY1A 1X0CA 1EZGA 1PLUA 1HG8A 1O8MA 1O8FA 2O17A 4OPWA 3TH0A 4YFOA 4XN3A 1WMRA 3AK5A 1O8HA 1KCDA 2EWEA 4W8RA 4XOTA 4NK8A 3LJYA 4YZQA 4C2LA 2B0RA 3GQAA 1IA5A 1NHCA 3VSVA 2X3HA 4XKVA 4XQFA 1OGMX 1QCXA 2NTPA 2X85A 4OZZA 1CLWA 3EQNA 1OFLA 4YELA 4XR6A 3VSTA 1DBGA 2X6XA 4EW9A 1RU4A 1LM1A 2BM4A 1AIRA 2PYHA 2QX3A 4OJLA 4V02C 4XL9A 2VFMA 3PSZA 3N6ZA 2BM6A 4XNFA 4XLAA 2XTYA 4XLHA 1K4ZA 2V5IA 1QA3A 2X6YA 3T9GA 2O6WA 1WXRA 2Z8GA 2QZAA 4I84A 3BH7B 5DNSA 4JRAC 1KCCA 4XONA 3SY2A 1O8GA 1LLZA 4XN0A 4YC5A 4U49A 2O0WA 2VBEA 4HWVA 1TSPA 2BSPA 3UW0A 2J8IA 3VMVA 4YDTA 2NSTA 2NSPA 1O8DA 1O8KA 2IQ7A 3N90A 5C1EA 2QXZA 2PECA 2BX6A 1TYWA 2O0VA 2VFNA 2INUA 4Z03A 1RMGA 4YZAA 2VJJA 1BN8A 1O8JA 4MXNA 1VBLA 1O8LA 1K8FA 1RWRA 3DU1X 4MR0A 4Z06A 3JX8A 3LMWA 2G0YA 3ML3A 5JMCB 3FY3A 1JRGA 1QJVA 1TYUA 1OFMA 1XG2A 2NT9A 2X6WA 4W8TA 2XT4A 3NB2A 1K5CA 3GQ7A 4XMYA 1PE9A 4KH3A 2YUHA 1OFDA 2BM5A 3LYCA 3B90A 1CZFA 2UVEA 4Z05A 1DABA 1KTWA 4OJPA 3P4GA 1QRBA 2VBMA 1OFEA 2NTBA 2QYUA 3ZPPA 2ODLA 1O8IA 4W8SA 2VFOA 4XLEA 3WWGA
chains in the Genus database with same CATH topology
1O88A 2NZMA 4OJOA 2O1DA 2UVFA 3ZSCA 4W8QA 4XM3A 4XOPA 1IB4A 2VBKA 1O8EA 4U4BA 3VMWA 1IDKA 4XORA 3SUCA 4OJ5A 3B4NA 4YZ0A 3GQ9A 4URRA 4YZXA 1JTAA 2NT6A 2NTQA 2O04A 4XKWA 4YEJA 1IDJA 2PYGA 4OJ6A 1OGOX 3GRHA 3JURA 4XLCA 5AMVA 3KRGA 1PXZA 3GQ8A 1GQ8A 1H80A 3EQOA 3VSUA 4XLFA 4AVZA 4OZYA 1OOCA 5C1CA 4PMHA 2INVA 1DBOA 2VJIA 3B8YA 1BHEA 4NK6A 1EE6A 2QY1A 1X0CA 1PLUA 1HG8A 1O8MA 1O8FA 2O17A 4XN3A 1WMRA 1O8HA 1KCDA 2EWEA 4W8RA 4XOTA 4NK8A 4YZQA 4C2LA 1IA5A 3GQAA 1NHCA 3VSVA 2X3HA 4XKVA 4XQFA 1OGMX 1QCXA 2NTPA 2X85A 4OZZA 3EQNA 1OFLA 4YELA 4XR6A 3VSTA 1DBGA 2X6XA 4EW9A 1RU4A 2PYHA 2QX3A 1AIRA 4OJLA 4XL9A 4XNFA 4XLAA 4XLHA 2X6YA 3T9GA 2Z8GA 4I84A 1KCCA 4XONA 1O8GA 4XN0A 4U49A 2O0WA 2VBEA 4HWVA 2BSPA 3UW0A 3VMVA 2NSTA 2NSPA 1O8DA 1O8KA 2IQ7A 5C1EA 2QXZA 2PECA 2O0VA 2INUA 4Z03A 1RMGA 4YZAA 2VJJA 1BN8A 1O8JA 4MXNA 1VBLA 1O8LA 1RWRA 4Z06A 4MR0A 3LMWA 3FY3A 1JRGA 1QJVA 2NT9A 1OFMA 1XG2A 2X6WA 4W8TA 1K5CA 3GQ7A 4XMYA 1PE9A 3B90A 1CZFA 2UVEA 4Z05A 1KTWA 4OJPA 2VBMA 2NTBA 3ZPPA 2ODLA 1O8IA 4W8SA 4XLEA 3WWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O88 A;  2NZM A;  4OJO A;  2O1D A;  2UVF A;  3ZSC A;  4W8Q A;  4XM3 A;  4XOP A;  1IB4 A;  2VBK A;  1O8E A;  4U4B A;  3VMW A;  1IDK A;  4XOR A;  3SUC A;  4OJ5 A;  3B4N A;  4YZ0 A;  3GQ9 A;  4URR A;  4YZX A;  1JTA A;  2NT6 A;  2NTQ A;  2O04 A;  4XKW A;  4YEJ A;  1IDJ A;  2PYG A;  4OJ6 A;  1OGO X;  3GRH A;  3JUR A;  4XLC A;  5AMV A;  3KRG A;  1PXZ A;  3GQ8 A;  1GQ8 A;  1H80 A;  3EQO A;  3VSU A;  4XLF A;  4AVZ A;  4OZY A;  1OOC A;  5C1C A;  4PMH A;  2INV A;  1DBO A;  2VJI A;  3B8Y A;  1BHE A;  4NK6 A;  1EE6 A;  2QY1 A;  1X0C A;  1PLU A;  1HG8 A;  1O8M A;  1O8F A;  2O17 A;  4XN3 A;  1WMR A;  1O8H A;  1KCD A;  2EWE A;  4W8R A;  4XOT A;  4NK8 A;  4YZQ A;  4C2L A;  1IA5 A;  3GQA A;  1NHC A;  3VSV A;  2X3H A;  4XKV A;  4XQF A;  1OGM X;  1QCX A;  2NTP A;  2X85 A;  4OZZ A;  3EQN A;  1OFL A;  4YEL A;  4XR6 A;  3VST A;  1DBG A;  2X6X A;  4EW9 A;  1RU4 A;  2PYH A;  2QX3 A;  1AIR A;  4OJL A;  4XL9 A;  4XNF A;  4XLA A;  4XLH A;  2X6Y A;  3T9G A;  2Z8G A;  4I84 A;  1KCC A;  4XON A;  1O8G A;  4XN0 A;  4U49 A;  2O0W A;  2VBE A;  4HWV A;  2BSP A;  3UW0 A;  3VMV A;  2NST A;  2NSP A;  1O8D A;  1O8K A;  2IQ7 A;  5C1E A;  2QXZ A;  2PEC A;  2O0V A;  2INU A;  4Z03 A;  1RMG A;  4YZA A;  2VJJ A;  1BN8 A;  1O8J A;  4MXN A;  1VBL A;  1O8L A;  1RWR A;  4Z06 A;  4MR0 A;  3LMW A;  3FY3 A;  1JRG A;  1QJV A;  2NT9 A;  1OFM A;  1XG2 A;  2X6W A;  4W8T A;  1K5C A;  3GQ7 A;  4XMY A;  1PE9 A;  3B90 A;  1CZF A;  2UVE A;  4Z05 A;  1KTW A;  4OJP A;  2VBM A;  2NTB A;  3ZPP A;  2ODL A;  1O8I A;  4W8S A;  4XLE A;  3WWG A; 
#chains in the Genus database with same CATH topology
 2XC1 A;  1O88 A;  5JLV C;  2NZM A;  4OJO A;  2O1D A;  4YEI A;  2UVF A;  3H09 A;  2F3L A;  1QQ1 A;  3ZSC A;  4W8Q A;  4XM3 A;  4XOP A;  1KQ5 A;  1IB4 A;  2W7Z A;  2VBK A;  2BM7 A;  2XTW A;  4OM9 A;  1O8E A;  4U4B A;  3VMW A;  1IDK A;  4XOR A;  1LLW A;  2XTX A;  3SUC A;  2IOU G;  4OJ5 A;  3B4N A;  3PSS A;  1QRC A;  4YZ0 A;  3GQ9 A;  1HF2 A;  4URR A;  1EA0 A;  4YZX A;  1JTA A;  2NT6 A;  2NTQ A;  2O04 A;  3NAW A;  4XKW A;  4YEJ A;  1IDJ A;  1QA1 A;  2PYG A;  4OJ6 A;  1OGO X;  3GRH A;  3JUR A;  4XLC A;  5AMV A;  3SQV A;  3KRG A;  3SYJ A;  1QA2 A;  1TYX A;  1PXZ A;  2VFP A;  3GQ8 A;  3RIQ A;  2J8K A;  1GQ8 A;  3PET A;  1H80 A;  3EQO A;  3VSU A;  2XT2 A;  4XLF A;  4AVZ A;  4YCQ A;  4OZY A;  1OOC A;  2VFQ A;  5C1C A;  4PMH A;  1TYV A;  3SZE A;  2INV A;  1DBO A;  1L1I A;  2VJI A;  3B8Y A;  3BH6 B;  1BHE A;  4NK6 A;  1EE6 A;  2QY1 A;  1X0C A;  1EZG A;  1PLU A;  1HG8 A;  1O8M A;  1O8F A;  2O17 A;  4OPW A;  3TH0 A;  4YFO A;  4XN3 A;  1WMR A;  3AK5 A;  1O8H A;  1KCD A;  2EWE A;  4W8R A;  4XOT A;  4NK8 A;  3LJY A;  4YZQ A;  4C2L A;  2B0R A;  3GQA A;  1IA5 A;  1NHC A;  3VSV A;  2X3H A;  4XKV A;  4XQF A;  1OGM X;  1QCX A;  2NTP A;  2X85 A;  4OZZ A;  1CLW A;  3EQN A;  1OFL A;  4YEL A;  4XR6 A;  3VST A;  1DBG A;  2X6X A;  4EW9 A;  1RU4 A;  1LM1 A;  2BM4 A;  1AIR A;  2PYH A;  2QX3 A;  4OJL A;  4V02 C;  4XL9 A;  2VFM A;  3PSZ A;  3N6Z A;  2BM6 A;  4XNF A;  4XLA A;  2XTY A;  4XLH A;  1K4Z A;  2V5I A;  1QA3 A;  2X6Y A;  3T9G A;  2O6W A;  1WXR A;  2Z8G A;  2QZA A;  4I84 A;  3BH7 B;  5DNS A;  4JRA C;  1KCC A;  4XON A;  3SY2 A;  1O8G A;  1LLZ A;  4XN0 A;  4YC5 A;  4U49 A;  2O0W A;  2VBE A;  4HWV A;  1TSP A;  2BSP A;  3UW0 A;  2J8I A;  3VMV A;  4YDT A;  2NST A;  2NSP A;  1O8D A;  1O8K A;  2IQ7 A;  3N90 A;  5C1E A;  2QXZ A;  2PEC A;  2BX6 A;  1TYW A;  2O0V A;  2VFN A;  2INU A;  4Z03 A;  1RMG A;  4YZA A;  2VJJ A;  1BN8 A;  1O8J A;  4MXN A;  1VBL A;  1O8L A;  1K8F A;  1RWR A;  3DU1 X;  4MR0 A;  4Z06 A;  3JX8 A;  3LMW A;  2G0Y A;  3ML3 A;  5JMC B;  3FY3 A;  1JRG A;  1QJV A;  1TYU A;  1OFM A;  1XG2 A;  2NT9 A;  2X6W A;  4W8T A;  2XT4 A;  3NB2 A;  1K5C A;  3GQ7 A;  4XMY A;  1PE9 A;  4KH3 A;  2YUH A;  1OFD A;  2BM5 A;  3LYC A;  3B90 A;  1CZF A;  2UVE A;  4Z05 A;  1DAB A;  1KTW A;  4OJP A;  3P4G A;  1QRB A;  2VBM A;  1OFE A;  2NTB A;  2QYU A;  3ZPP A;  2ODL A;  1O8I A;  4W8S A;  2VFO A;  4XLE A;  3WWG A; 
#chains in the Genus database with same CATH homology
 1O88 A;  2NZM A;  4OJO A;  2O1D A;  2UVF A;  3ZSC A;  4W8Q A;  4XM3 A;  4XOP A;  1IB4 A;  2VBK A;  1O8E A;  4U4B A;  3VMW A;  1IDK A;  4XOR A;  3SUC A;  4OJ5 A;  3B4N A;  4YZ0 A;  3GQ9 A;  4URR A;  4YZX A;  1JTA A;  2NT6 A;  2NTQ A;  2O04 A;  4XKW A;  4YEJ A;  1IDJ A;  2PYG A;  4OJ6 A;  1OGO X;  3GRH A;  3JUR A;  4XLC A;  5AMV A;  3KRG A;  1PXZ A;  3GQ8 A;  1GQ8 A;  1H80 A;  3EQO A;  3VSU A;  4XLF A;  4AVZ A;  4OZY A;  1OOC A;  5C1C A;  4PMH A;  2INV A;  1DBO A;  2VJI A;  3B8Y A;  1BHE A;  4NK6 A;  1EE6 A;  2QY1 A;  1X0C A;  1PLU A;  1HG8 A;  1O8M A;  1O8F A;  2O17 A;  4XN3 A;  1WMR A;  1O8H A;  1KCD A;  2EWE A;  4W8R A;  4XOT A;  4NK8 A;  4YZQ A;  4C2L A;  1IA5 A;  3GQA A;  1NHC A;  3VSV A;  2X3H A;  4XKV A;  4XQF A;  1OGM X;  1QCX A;  2NTP A;  2X85 A;  4OZZ A;  3EQN A;  1OFL A;  4YEL A;  4XR6 A;  3VST A;  1DBG A;  2X6X A;  4EW9 A;  1RU4 A;  2PYH A;  2QX3 A;  1AIR A;  4OJL A;  4XL9 A;  4XNF A;  4XLA A;  4XLH A;  2X6Y A;  3T9G A;  2Z8G A;  4I84 A;  1KCC A;  4XON A;  1O8G A;  4XN0 A;  4U49 A;  2O0W A;  2VBE A;  4HWV A;  2BSP A;  3UW0 A;  3VMV A;  2NST A;  2NSP A;  1O8D A;  1O8K A;  2IQ7 A;  5C1E A;  2QXZ A;  2PEC A;  2O0V A;  2INU A;  4Z03 A;  1RMG A;  4YZA A;  2VJJ A;  1BN8 A;  1O8J A;  4MXN A;  1VBL A;  1O8L A;  1RWR A;  4Z06 A;  4MR0 A;  3LMW A;  3FY3 A;  1JRG A;  1QJV A;  2NT9 A;  1OFM A;  1XG2 A;  2X6W A;  4W8T A;  1K5C A;  3GQ7 A;  4XMY A;  1PE9 A;  3B90 A;  1CZF A;  2UVE A;  4Z05 A;  1KTW A;  4OJP A;  2VBM A;  2NTB A;  3ZPP A;  2ODL A;  1O8I A;  4W8S A;  4XLE A;  3WWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...