2PYHA

Azotobacter vinelandii mannuronan c-5 epimerase alge4 a-module complexed with mannuronan trisaccharide
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
376
structure length
376
Chain Sequence
MDYNVKDFGALGDGVSDDRASIQAAIDAAYAAGGGTVYLPAGEYRVSAAGEPGDGCLMLKDGVYLAGAGMGETVIKLIDGSDQKITGMVRSAYGEETSNFGMRDLTLDGNRDNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMSGYGFDPHEQTINLTIRDSVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGTDYSSLIDNDIAGVQQPIQLYGPHSTVSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
publication title Structural and Mutational Characterization of the Catalytic A-module of the Mannuronan C-5-epimerase AlgE4 from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Isomerase
total genus 163
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pyhA00
1DBOA 1O8EA 1PXZA 3EQNA 1O8DA 2X6YA 4NK6A 1GQ8A 4OJPA 1H80A 2VBEA 4YZQA 4OJLA 1OGOX 2EWEA 3ZPPA 3SUCA 2X85A 4XOPA 2X3HA 3VSUA 1RWRA 1X0CA 4YEJA 4XOTA 1WMRA 4YZAA 1OOCA 1O8LA 1IA5A 3VMVA 2PECA 1KTWA 4HWVA 4Z05A 4YZXA 3VSVA 2NSTA 4W8TA 2X6WA 4XNFA 1O8KA 2O1DA 4XONA 4W8RA 3EQOA 4MXNA 3UW0A 4OJ5A 1BHEA 1JRGA 1O8GA 2VBMA 4Z06A 4XKVA 4OJOA 4OJ6A 1OGMX 1OFMA 2O0VA 2QXZA 4W8QA 2Z8GA 3GRHA 1K5CA 3GQ7A 5AMVA 1QCXA 1EE6A 4XLFA 1OFLA 1XG2A 4MR0A 1O8FA 4XN0A 2NZMA 1O8HA 1RMGA 1JTAA 2NT9A 2INUA 4XKWA 2ODLA 4U4BA 4OZZA 4XM3A 3VSTA 1PLUA 3GQ8A 4EW9A 4W8SA 4XLCA 4XQFA 2NTBA 3GQAA 2QY1A 2VBKA 2QX3A 3B90A 3FY3A 4XR6A 3KRGA 3B8YA 2UVFA 3T9GA 1AIRA 1HG8A 1KCDA 3VMWA 1O88A 4U49A 1PE9A 4XLEA 3JURA 4I84A 2VJIA 2O17A 2VJJA 3B4NA 4NK8A 4OZYA 4PMHA 3GQ9A 4XL9A 1IB4A 1O8JA 5C1EA 1BN8A 2BSPA 2O04A 4Z03A 4AVZA 4XMYA 5C1CA 2X6XA 4XN3A 4YELA 2PYHA 1O8IA 1IDKA 1VBLA 4XORA 2INVA 2NTQA 3LMWA 2NT6A 3ZSCA 2IQ7A 1O8MA 1DBGA 1IDJA 2UVEA 3WWGA 2NTPA 4C2LA 1NHCA 1CZFA 4XLAA 1KCCA 4XLHA 2PYGA 4YZ0A 1QJVA 4URRA 2NSPA 2O0WA 1RU4A
chains in the Genus database with same CATH superfamily
3PETA 1DBOA 1O8EA 2B0RA 1PXZA 1LLWA 3EQNA 1O8DA 2X6YA 4NK6A 1GQ8A 1QA1A 3PSZA 4OJPA 1H80A 2VBEA 4YZQA 4OJLA 5JLVC 1OGOX 1QQ1A 2EWEA 2IOUG 3ZPPA 3SUCA 3SY2A 2QZAA 3H09A 2X85A 4XOPA 1LLZA 2BM7A 2X3HA 3VSUA 1RWRA 4YCQA 1X0CA 4YEJA 2VFOA 4OM9A 4XOTA 1OFEA 2XTXA 1DABA 2VFNA 1WMRA 3N90A 4YZAA 2G0YA 1OOCA 1O8LA 1IA5A 1TYXA 2PECA 1KTWA 2VFMA 4HWVA 4Z05A 4YZXA 3SZEA 2NSTA 4W8TA 2X6WA 4XNFA 3VSVA 1O8KA 2O1DA 2BM5A 4XONA 2QYUA 5JMCB 1HF2A 3BH6B 4W8RA 3SYJA 3EQOA 4MXNA 3UW0A 4OJ5A 1K4ZA 1BHEA 1JRGA 1O8GA 2VBMA 3PSSA 4Z06A 4XKVA 3SQVA 4OJOA 1TSPA 1OGMX 4JRAC 4OJ6A 1OFMA 2O0VA 2QXZA 4W8QA 2XT2A 2Z8GA 3GRHA 1K5CA 3P4GA 3GQ7A 3JX8A 5AMVA 1TYWA 1QCXA 1EE6A 2XC1A 3VMVA 1EZGA 3LJYA 4OPWA 1OFLA 4XLFA 1XG2A 4MR0A 1O8FA 4XN0A 2NZMA 1O8HA 1RMGA 1JTAA 2NT9A 2INUA 1CLWA 4XKWA 1TYUA 2BX6A 2ODLA 4U4BA 4OZZA 4XM3A 2BM4A 3VSTA 1PLUA 3GQ8A 4EW9A 4W8SA 2VFQA 3NB2A 4XLCA 4XQFA 3AK5A 2NTBA 3GQAA 2QY1A 2VBKA 3N6ZA 2QX3A 2J8IA 2XT4A 3B90A 3FY3A 2W7ZA 4XR6A 4YFOA 3KRGA 3B8YA 2UVFA 3T9GA 1AIRA 1HG8A 2J8KA 3VMWA 1KCDA 3LYCA 4YC5A 5DNSA 1O88A 2V5IA 4U49A 2VFPA 4V02C 1PE9A 3BH7B 4XLEA 4YEIA 3JURA 4I84A 1KQ5A 2VJJA 2O17A 2VJIA 3B4NA 4NK8A 4OZYA 4PMHA 1OFDA 3GQ9A 3TH0A 4XL9A 1QA2A 3NAWA 1IB4A 1O8JA 5C1EA 1BN8A 2BSPA 2BM6A 2O04A 1WXRA 1K8FA 4Z03A 4AVZA 4XMYA 2XTYA 1EA0A 5C1CA 2X6XA 4XN3A 4YELA 2PYHA 3DU1X 4KH3A 1O8IA 1IDKA 1VBLA 4XORA 2INVA 2NTQA 3LMWA 2O6WA 2F3LA 2NT6A 1LM1A 3ZSCA 2IQ7A 1O8MA 1QRBA 1DBGA 1IDJA 2UVEA 3ML3A 4YDTA 3WWGA 2NTPA 4C2LA 1NHCA 1CZFA 1TYVA 1L1IA 3RIQA 2YUHA 4XLAA 1KCCA 1QA3A 1QRCA 4XLHA 2PYGA 4YZ0A 1QJVA 4URRA 2NSPA 2XTWA 2O0WA 1RU4A
chains in the Genus database with same CATH topology
1DBOA 1O8EA 1PXZA 3EQNA 1O8DA 2X6YA 4NK6A 1GQ8A 4OJPA 1H80A 2VBEA 4YZQA 4OJLA 1OGOX 2EWEA 3ZPPA 3SUCA 2X85A 4XOPA 2X3HA 3VSUA 1RWRA 1X0CA 4YEJA 4XOTA 1WMRA 4YZAA 1OOCA 1O8LA 1IA5A 3VMVA 2PECA 1KTWA 4HWVA 4Z05A 4YZXA 3VSVA 2NSTA 4W8TA 2X6WA 4XNFA 1O8KA 2O1DA 4XONA 4W8RA 3EQOA 4MXNA 3UW0A 4OJ5A 1BHEA 1JRGA 1O8GA 2VBMA 4Z06A 4XKVA 4OJOA 4OJ6A 1OGMX 1OFMA 2O0VA 2QXZA 4W8QA 2Z8GA 3GRHA 1K5CA 3GQ7A 5AMVA 1QCXA 1EE6A 4XLFA 1OFLA 1XG2A 4MR0A 1O8FA 4XN0A 2NZMA 1O8HA 1RMGA 1JTAA 2NT9A 2INUA 4XKWA 2ODLA 4U4BA 4OZZA 4XM3A 3VSTA 1PLUA 3GQ8A 4EW9A 4W8SA 4XLCA 4XQFA 2NTBA 3GQAA 2QY1A 2VBKA 2QX3A 3B90A 3FY3A 4XR6A 3KRGA 3B8YA 2UVFA 3T9GA 1AIRA 1HG8A 1KCDA 3VMWA 1O88A 4U49A 1PE9A 4XLEA 3JURA 4I84A 2VJIA 2O17A 2VJJA 3B4NA 4NK8A 4OZYA 4PMHA 3GQ9A 4XL9A 1IB4A 1O8JA 5C1EA 1BN8A 2BSPA 2O04A 4Z03A 4AVZA 4XMYA 5C1CA 2X6XA 4XN3A 4YELA 2PYHA 1O8IA 1IDKA 1VBLA 4XORA 2INVA 2NTQA 3LMWA 2NT6A 3ZSCA 2IQ7A 1O8MA 1DBGA 1IDJA 2UVEA 3WWGA 2NTPA 4C2LA 1NHCA 1CZFA 4XLAA 1KCCA 4XLHA 2PYGA 4YZ0A 1QJVA 4URRA 2NSPA 2O0WA 1RU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBO A;  1O8E A;  1PXZ A;  3EQN A;  1O8D A;  2X6Y A;  4NK6 A;  1GQ8 A;  4OJP A;  1H80 A;  2VBE A;  4YZQ A;  4OJL A;  1OGO X;  2EWE A;  3ZPP A;  3SUC A;  2X85 A;  4XOP A;  2X3H A;  3VSU A;  1RWR A;  1X0C A;  4YEJ A;  4XOT A;  1WMR A;  4YZA A;  1OOC A;  1O8L A;  1IA5 A;  3VMV A;  2PEC A;  1KTW A;  4HWV A;  4Z05 A;  4YZX A;  3VSV A;  2NST A;  4W8T A;  2X6W A;  4XNF A;  1O8K A;  2O1D A;  4XON A;  4W8R A;  3EQO A;  4MXN A;  3UW0 A;  4OJ5 A;  1BHE A;  1JRG A;  1O8G A;  2VBM A;  4Z06 A;  4XKV A;  4OJO A;  4OJ6 A;  1OGM X;  1OFM A;  2O0V A;  2QXZ A;  4W8Q A;  2Z8G A;  3GRH A;  1K5C A;  3GQ7 A;  5AMV A;  1QCX A;  1EE6 A;  4XLF A;  1OFL A;  1XG2 A;  4MR0 A;  1O8F A;  4XN0 A;  2NZM A;  1O8H A;  1RMG A;  1JTA A;  2NT9 A;  2INU A;  4XKW A;  2ODL A;  4U4B A;  4OZZ A;  4XM3 A;  3VST A;  1PLU A;  3GQ8 A;  4EW9 A;  4W8S A;  4XLC A;  4XQF A;  2NTB A;  3GQA A;  2QY1 A;  2VBK A;  2QX3 A;  3B90 A;  3FY3 A;  4XR6 A;  3KRG A;  3B8Y A;  2UVF A;  3T9G A;  1AIR A;  1HG8 A;  1KCD A;  3VMW A;  1O88 A;  4U49 A;  1PE9 A;  4XLE A;  3JUR A;  4I84 A;  2VJI A;  2O17 A;  2VJJ A;  3B4N A;  4NK8 A;  4OZY A;  4PMH A;  3GQ9 A;  4XL9 A;  1IB4 A;  1O8J A;  5C1E A;  1BN8 A;  2BSP A;  2O04 A;  4Z03 A;  4AVZ A;  4XMY A;  5C1C A;  2X6X A;  4XN3 A;  4YEL A;  2PYH A;  1O8I A;  1IDK A;  1VBL A;  4XOR A;  2INV A;  2NTQ A;  3LMW A;  2NT6 A;  3ZSC A;  2IQ7 A;  1O8M A;  1DBG A;  1IDJ A;  2UVE A;  3WWG A;  2NTP A;  4C2L A;  1NHC A;  1CZF A;  4XLA A;  1KCC A;  4XLH A;  2PYG A;  4YZ0 A;  1QJV A;  4URR A;  2NSP A;  2O0W A;  1RU4 A; 
#chains in the Genus database with same CATH topology
 3PET A;  1DBO A;  1O8E A;  2B0R A;  1PXZ A;  1LLW A;  3EQN A;  1O8D A;  2X6Y A;  4NK6 A;  1GQ8 A;  1QA1 A;  3PSZ A;  4OJP A;  1H80 A;  2VBE A;  4YZQ A;  4OJL A;  5JLV C;  1OGO X;  1QQ1 A;  2EWE A;  2IOU G;  3ZPP A;  3SUC A;  3SY2 A;  2QZA A;  3H09 A;  2X85 A;  4XOP A;  1LLZ A;  2BM7 A;  2X3H A;  3VSU A;  1RWR A;  4YCQ A;  1X0C A;  4YEJ A;  2VFO A;  4OM9 A;  4XOT A;  1OFE A;  2XTX A;  1DAB A;  2VFN A;  1WMR A;  3N90 A;  4YZA A;  2G0Y A;  1OOC A;  1O8L A;  1IA5 A;  1TYX A;  2PEC A;  1KTW A;  2VFM A;  4HWV A;  4Z05 A;  4YZX A;  3SZE A;  2NST A;  4W8T A;  2X6W A;  4XNF A;  3VSV A;  1O8K A;  2O1D A;  2BM5 A;  4XON A;  2QYU A;  5JMC B;  1HF2 A;  3BH6 B;  4W8R A;  3SYJ A;  3EQO A;  4MXN A;  3UW0 A;  4OJ5 A;  1K4Z A;  1BHE A;  1JRG A;  1O8G A;  2VBM A;  3PSS A;  4Z06 A;  4XKV A;  3SQV A;  4OJO A;  1TSP A;  1OGM X;  4JRA C;  4OJ6 A;  1OFM A;  2O0V A;  2QXZ A;  4W8Q A;  2XT2 A;  2Z8G A;  3GRH A;  1K5C A;  3P4G A;  3GQ7 A;  3JX8 A;  5AMV A;  1TYW A;  1QCX A;  1EE6 A;  2XC1 A;  3VMV A;  1EZG A;  3LJY A;  4OPW A;  1OFL A;  4XLF A;  1XG2 A;  4MR0 A;  1O8F A;  4XN0 A;  2NZM A;  1O8H A;  1RMG A;  1JTA A;  2NT9 A;  2INU A;  1CLW A;  4XKW A;  1TYU A;  2BX6 A;  2ODL A;  4U4B A;  4OZZ A;  4XM3 A;  2BM4 A;  3VST A;  1PLU A;  3GQ8 A;  4EW9 A;  4W8S A;  2VFQ A;  3NB2 A;  4XLC A;  4XQF A;  3AK5 A;  2NTB A;  3GQA A;  2QY1 A;  2VBK A;  3N6Z A;  2QX3 A;  2J8I A;  2XT4 A;  3B90 A;  3FY3 A;  2W7Z A;  4XR6 A;  4YFO A;  3KRG A;  3B8Y A;  2UVF A;  3T9G A;  1AIR A;  1HG8 A;  2J8K A;  3VMW A;  1KCD A;  3LYC A;  4YC5 A;  5DNS A;  1O88 A;  2V5I A;  4U49 A;  2VFP A;  4V02 C;  1PE9 A;  3BH7 B;  4XLE A;  4YEI A;  3JUR A;  4I84 A;  1KQ5 A;  2VJJ A;  2O17 A;  2VJI A;  3B4N A;  4NK8 A;  4OZY A;  4PMH A;  1OFD A;  3GQ9 A;  3TH0 A;  4XL9 A;  1QA2 A;  3NAW A;  1IB4 A;  1O8J A;  5C1E A;  1BN8 A;  2BSP A;  2BM6 A;  2O04 A;  1WXR A;  1K8F A;  4Z03 A;  4AVZ A;  4XMY A;  2XTY A;  1EA0 A;  5C1C A;  2X6X A;  4XN3 A;  4YEL A;  2PYH A;  3DU1 X;  4KH3 A;  1O8I A;  1IDK A;  1VBL A;  4XOR A;  2INV A;  2NTQ A;  3LMW A;  2O6W A;  2F3L A;  2NT6 A;  1LM1 A;  3ZSC A;  2IQ7 A;  1O8M A;  1QRB A;  1DBG A;  1IDJ A;  2UVE A;  3ML3 A;  4YDT A;  3WWG A;  2NTP A;  4C2L A;  1NHC A;  1CZF A;  1TYV A;  1L1I A;  3RIQ A;  2YUH A;  4XLA A;  1KCC A;  1QA3 A;  1QRC A;  4XLH A;  2PYG A;  4YZ0 A;  1QJV A;  4URR A;  2NSP A;  2XTW A;  2O0W A;  1RU4 A; 
#chains in the Genus database with same CATH homology
 1DBO A;  1O8E A;  1PXZ A;  3EQN A;  1O8D A;  2X6Y A;  4NK6 A;  1GQ8 A;  4OJP A;  1H80 A;  2VBE A;  4YZQ A;  4OJL A;  1OGO X;  2EWE A;  3ZPP A;  3SUC A;  2X85 A;  4XOP A;  2X3H A;  3VSU A;  1RWR A;  1X0C A;  4YEJ A;  4XOT A;  1WMR A;  4YZA A;  1OOC A;  1O8L A;  1IA5 A;  3VMV A;  2PEC A;  1KTW A;  4HWV A;  4Z05 A;  4YZX A;  3VSV A;  2NST A;  4W8T A;  2X6W A;  4XNF A;  1O8K A;  2O1D A;  4XON A;  4W8R A;  3EQO A;  4MXN A;  3UW0 A;  4OJ5 A;  1BHE A;  1JRG A;  1O8G A;  2VBM A;  4Z06 A;  4XKV A;  4OJO A;  4OJ6 A;  1OGM X;  1OFM A;  2O0V A;  2QXZ A;  4W8Q A;  2Z8G A;  3GRH A;  1K5C A;  3GQ7 A;  5AMV A;  1QCX A;  1EE6 A;  4XLF A;  1OFL A;  1XG2 A;  4MR0 A;  1O8F A;  4XN0 A;  2NZM A;  1O8H A;  1RMG A;  1JTA A;  2NT9 A;  2INU A;  4XKW A;  2ODL A;  4U4B A;  4OZZ A;  4XM3 A;  3VST A;  1PLU A;  3GQ8 A;  4EW9 A;  4W8S A;  4XLC A;  4XQF A;  2NTB A;  3GQA A;  2QY1 A;  2VBK A;  2QX3 A;  3B90 A;  3FY3 A;  4XR6 A;  3KRG A;  3B8Y A;  2UVF A;  3T9G A;  1AIR A;  1HG8 A;  1KCD A;  3VMW A;  1O88 A;  4U49 A;  1PE9 A;  4XLE A;  3JUR A;  4I84 A;  2VJI A;  2O17 A;  2VJJ A;  3B4N A;  4NK8 A;  4OZY A;  4PMH A;  3GQ9 A;  4XL9 A;  1IB4 A;  1O8J A;  5C1E A;  1BN8 A;  2BSP A;  2O04 A;  4Z03 A;  4AVZ A;  4XMY A;  5C1C A;  2X6X A;  4XN3 A;  4YEL A;  2PYH A;  1O8I A;  1IDK A;  1VBL A;  4XOR A;  2INV A;  2NTQ A;  3LMW A;  2NT6 A;  3ZSC A;  2IQ7 A;  1O8M A;  1DBG A;  1IDJ A;  2UVE A;  3WWG A;  2NTP A;  4C2L A;  1NHC A;  1CZF A;  4XLA A;  1KCC A;  4XLH A;  2PYG A;  4YZ0 A;  1QJV A;  4URR A;  2NSP A;  2O0W A;  1RU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...