2PYHA

Azotobacter vinelandii mannuronan c-5 epimerase alge4 a-module complexed with mannuronan trisaccharide
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
376
structure length
376
Chain Sequence
MDYNVKDFGALGDGVSDDRASIQAAIDAAYAAGGGTVYLPAGEYRVSAAGEPGDGCLMLKDGVYLAGAGMGETVIKLIDGSDQKITGMVRSAYGEETSNFGMRDLTLDGNRDNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMSGYGFDPHEQTINLTIRDSVAHDNGLDGFVADYLVDSVFENNVAYANDRHGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGLEDLALPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIQERNDGTDYSSLIDNDIAGVQQPIQLYGPHSTVSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mutational Characterization of the Catalytic A-module of the Mannuronan C-5-epimerase AlgE4 from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase 4
total genus 163
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2pyhA00
2O0WA 2NTBA 1IB4A 3B90A 3GQAA 4XL9A 4U49A 3T9GA 4I84A 2NT9A 4Z05A 4XLFA 3LMWA 2NSPA 3GQ8A 3SUCA 1RMGA 2O17A 1OOCA 4XOPA 4W8SA 1H80A 1JTAA 2INVA 1O8MA 4XNFA 5C1EA 4OJPA 3WWGA 1CZFA 4OJLA 1EE6A 1OGMX 3UW0A 2VBMA 2VBEA 2QXZA 2PECA 2Z8GA 4OZZA 4Z06A 2X6XA 2NT6A 2VBKA 1O8LA 1HG8A 4U4BA 3VSTA 1BN8A 4XLHA 2NSTA 4YELA 1KTWA 3EQOA 2NZMA 4XLAA 1X0CA 1IDJA 2INUA 4YZAA 3ZPPA 3JURA 1BHEA 3GQ9A 4XQFA 2UVFA 4YEJA 2NTPA 1PXZA 2PYHA 2O1DA 2X6WA 1RU4A 1IDKA 4XORA 1NHCA 4EW9A 2O04A 4AVZA 3GRHA 2X6YA 4HWVA 4W8RA 4XLCA 2EWEA 2IQ7A 5AMVA 3VMVA 1PE9A 4MR0A 4YZ0A 1DBOA 1QJVA 1VBLA 1RWRA 1O8KA 1IA5A 3GQ7A 2X85A 4XMYA 4OJ5A 4C2LA 1KCDA 1WMRA 4XN0A 1OFLA 3VMWA 3B4NA 4W8TA 1JRGA 1O8HA 4URRA 1QCXA 4W8QA 1KCCA 3VSUA 4XR6A 1OGOX 2BSPA 4YZQA 1DBGA 1O8FA 4OZYA 4XKWA 2QY1A 1O8JA 4XM3A 4Z03A 2VJJA 1O88A 4NK6A 4YZXA 4XKVA 4OJ6A 2PYGA 4OJOA 1O8GA 2ODLA 2VJIA 1O8IA 4XOTA 1PLUA 4NK8A 3FY3A 1OFMA 4MXNA 1XG2A 4XLEA 1O8DA 2O0VA 3ZSCA 2UVEA 2NTQA 3VSVA 3EQNA 2QX3A 4XN3A 3B8YA 1O8EA 1AIRA 5C1CA 4PMHA 4XONA 1GQ8A 1K5CA 2X3HA 3KRGA
chains in the Genus database with same CATH superfamily
2O0WA 1DABA 2NTBA 3BH6B 4OPWA 1IB4A 3B90A 3GQAA 4XL9A 4U49A 1TYWA 3T9GA 4I84A 2NT9A 1LLWA 4Z05A 4XLFA 3LMWA 2NSPA 3GQ8A 3SUCA 1RMGA 2O17A 1OOCA 4XOPA 4W8SA 2BX6A 1H80A 1JTAA 2INVA 1O8MA 4OM9A 4XNFA 5C1EA 1QA1A 4KH3A 2G0YA 4OJPA 3WWGA 1CZFA 1EA0A 1QRBA 4OJLA 4YFOA 1EE6A 1OGMX 1LLZA 3UW0A 2VBMA 2VBEA 2QXZA 2PECA 2Z8GA 3H09A 4OZZA 2X6XA 4Z06A 2NT6A 2XC1A 2VBKA 1HF2A 3LYCA 1TYUA 1O8LA 3AK5A 2O6WA 1HG8A 4U4BA 1WXRA 1TYVA 1OFDA 3VSTA 1BN8A 4XLHA 3RIQA 2NSTA 4YELA 1KTWA 3EQOA 1L1IA 2NZMA 3PSZA 4XLAA 2YUHA 1X0CA 1IDJA 3ML3A 2INUA 4YZAA 4YDTA 3JURA 3ZPPA 1BHEA 1TYXA 2VFQA 3GQ9A 4XQFA 2UVFA 2VFMA 1K8FA 2BM5A 1PXZA 2NTPA 2QZAA 2VFNA 1TSPA 4YCQA 2PYHA 5JMCB 1QA2A 2O1DA 1QA3A 2X6WA 1RU4A 1IDKA 4XORA 2VFOA 1NHCA 4EW9A 3BH7B 2IOUG 2O04A 1LM1A 4AVZA 3GRHA 2X6YA 4HWVA 4W8RA 3SZEA 3TH0A 4XLCA 2XTXA 2EWEA 4YC5A 2IQ7A 5AMVA 3SY2A 1PE9A 1QQ1A 4MR0A 2BM4A 1DBOA 3VMVA 4YZ0A 3PSSA 1QJVA 4V02C 1VBLA 1RWRA 1O8KA 3DU1X 4JRAC 3GQ7A 1IA5A 2X85A 4XMYA 2J8KA 4OJ5A 4YEIA 4C2LA 1KCDA 3N90A 4YEJA 1WMRA 4XN0A 1OFLA 3VMWA 3NB2A 2XT4A 3B4NA 1JRGA 4W8TA 1EZGA 1O8HA 1QRCA 1OFEA 2J8IA 4URRA 1QCXA 2XT2A 2XTYA 2BM6A 2F3LA 4W8QA 1KCCA 3VSUA 4XR6A 1OGOX 2BSPA 4YZQA 1DBGA 1O8FA 4OZYA 4XKWA 2QY1A 2W7ZA 1O8JA 4XM3A 4Z03A 5JLVC 2VJJA 1K4ZA 1O88A 4NK6A 4YZXA 3NAWA 4XKVA 3SQVA 2XTWA 3PETA 4OJ6A 3LJYA 2B0RA 2PYGA 1KQ5A 1O8GA 2ODLA 2VJIA 1O8IA 4OJOA 3P4GA 4XOTA 3JX8A 1PLUA 5DNSA 4NK8A 3FY3A 2V5IA 1OFMA 4MXNA 3N6ZA 1XG2A 4XLEA 1O8DA 2O0VA 2BM7A 3ZSCA 2UVEA 2NTQA 3SYJA 2VFPA 3VSVA 3EQNA 2QX3A 4XN3A 3B8YA 1O8EA 1AIRA 2QYUA 5C1CA 4PMHA 4XONA 1GQ8A 1CLWA 2X3HA 1K5CA 3KRGA
chains in the Genus database with same CATH topology
2O0WA 2NTBA 1IB4A 3B90A 3GQAA 4XL9A 4U49A 3T9GA 4I84A 2NT9A 4Z05A 4XLFA 3LMWA 2NSPA 3GQ8A 3SUCA 1RMGA 2O17A 1OOCA 4XOPA 4W8SA 1H80A 1JTAA 2INVA 1O8MA 4XNFA 5C1EA 4OJPA 3WWGA 1CZFA 4OJLA 1EE6A 1OGMX 3UW0A 2VBMA 2VBEA 2QXZA 2PECA 2Z8GA 4OZZA 4Z06A 2X6XA 2NT6A 2VBKA 1O8LA 1HG8A 4U4BA 3VSTA 1BN8A 4XLHA 2NSTA 4YELA 1KTWA 3EQOA 2NZMA 4XLAA 1X0CA 1IDJA 2INUA 4YZAA 3ZPPA 3JURA 1BHEA 3GQ9A 4XQFA 2UVFA 4YEJA 2NTPA 1PXZA 2PYHA 2O1DA 2X6WA 1RU4A 1IDKA 4XORA 1NHCA 4EW9A 2O04A 4AVZA 3GRHA 2X6YA 4HWVA 4W8RA 4XLCA 2EWEA 2IQ7A 5AMVA 3VMVA 1PE9A 4MR0A 4YZ0A 1DBOA 1QJVA 1VBLA 1RWRA 1O8KA 1IA5A 3GQ7A 2X85A 4XMYA 4OJ5A 4C2LA 1KCDA 1WMRA 4XN0A 1OFLA 3VMWA 3B4NA 4W8TA 1JRGA 1O8HA 4URRA 1QCXA 4W8QA 1KCCA 3VSUA 4XR6A 1OGOX 2BSPA 4YZQA 1DBGA 1O8FA 4OZYA 4XKWA 2QY1A 1O8JA 4XM3A 4Z03A 2VJJA 1O88A 4NK6A 4YZXA 4XKVA 4OJ6A 2PYGA 4OJOA 1O8GA 2ODLA 2VJIA 1O8IA 4XOTA 1PLUA 4NK8A 3FY3A 1OFMA 4MXNA 1XG2A 4XLEA 1O8DA 2O0VA 3ZSCA 2UVEA 2NTQA 3VSVA 3EQNA 2QX3A 4XN3A 3B8YA 1O8EA 1AIRA 5C1CA 4PMHA 4XONA 1GQ8A 1K5CA 2X3HA 3KRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0W A;  2NTB A;  1IB4 A;  3B90 A;  3GQA A;  4XL9 A;  4U49 A;  3T9G A;  4I84 A;  2NT9 A;  4Z05 A;  4XLF A;  3LMW A;  2NSP A;  3GQ8 A;  3SUC A;  1RMG A;  2O17 A;  1OOC A;  4XOP A;  4W8S A;  1H80 A;  1JTA A;  2INV A;  1O8M A;  4XNF A;  5C1E A;  4OJP A;  3WWG A;  1CZF A;  4OJL A;  1EE6 A;  1OGM X;  3UW0 A;  2VBM A;  2VBE A;  2QXZ A;  2PEC A;  2Z8G A;  4OZZ A;  4Z06 A;  2X6X A;  2NT6 A;  2VBK A;  1O8L A;  1HG8 A;  4U4B A;  3VST A;  1BN8 A;  4XLH A;  2NST A;  4YEL A;  1KTW A;  3EQO A;  2NZM A;  4XLA A;  1X0C A;  1IDJ A;  2INU A;  4YZA A;  3ZPP A;  3JUR A;  1BHE A;  3GQ9 A;  4XQF A;  2UVF A;  4YEJ A;  2NTP A;  1PXZ A;  2PYH A;  2O1D A;  2X6W A;  1RU4 A;  1IDK A;  4XOR A;  1NHC A;  4EW9 A;  2O04 A;  4AVZ A;  3GRH A;  2X6Y A;  4HWV A;  4W8R A;  4XLC A;  2EWE A;  2IQ7 A;  5AMV A;  3VMV A;  1PE9 A;  4MR0 A;  4YZ0 A;  1DBO A;  1QJV A;  1VBL A;  1RWR A;  1O8K A;  1IA5 A;  3GQ7 A;  2X85 A;  4XMY A;  4OJ5 A;  4C2L A;  1KCD A;  1WMR A;  4XN0 A;  1OFL A;  3VMW A;  3B4N A;  4W8T A;  1JRG A;  1O8H A;  4URR A;  1QCX A;  4W8Q A;  1KCC A;  3VSU A;  4XR6 A;  1OGO X;  2BSP A;  4YZQ A;  1DBG A;  1O8F A;  4OZY A;  4XKW A;  2QY1 A;  1O8J A;  4XM3 A;  4Z03 A;  2VJJ A;  1O88 A;  4NK6 A;  4YZX A;  4XKV A;  4OJ6 A;  2PYG A;  4OJO A;  1O8G A;  2ODL A;  2VJI A;  1O8I A;  4XOT A;  1PLU A;  4NK8 A;  3FY3 A;  1OFM A;  4MXN A;  1XG2 A;  4XLE A;  1O8D A;  2O0V A;  3ZSC A;  2UVE A;  2NTQ A;  3VSV A;  3EQN A;  2QX3 A;  4XN3 A;  3B8Y A;  1O8E A;  1AIR A;  5C1C A;  4PMH A;  4XON A;  1GQ8 A;  1K5C A;  2X3H A;  3KRG A; 
#chains in the Genus database with same CATH topology
 2O0W A;  1DAB A;  2NTB A;  3BH6 B;  4OPW A;  1IB4 A;  3B90 A;  3GQA A;  4XL9 A;  4U49 A;  1TYW A;  3T9G A;  4I84 A;  2NT9 A;  1LLW A;  4Z05 A;  4XLF A;  3LMW A;  2NSP A;  3GQ8 A;  3SUC A;  1RMG A;  2O17 A;  1OOC A;  4XOP A;  4W8S A;  2BX6 A;  1H80 A;  1JTA A;  2INV A;  1O8M A;  4OM9 A;  4XNF A;  5C1E A;  1QA1 A;  4KH3 A;  2G0Y A;  4OJP A;  3WWG A;  1CZF A;  1EA0 A;  1QRB A;  4OJL A;  4YFO A;  1EE6 A;  1OGM X;  1LLZ A;  3UW0 A;  2VBM A;  2VBE A;  2QXZ A;  2PEC A;  2Z8G A;  3H09 A;  4OZZ A;  2X6X A;  4Z06 A;  2NT6 A;  2XC1 A;  2VBK A;  1HF2 A;  3LYC A;  1TYU A;  1O8L A;  3AK5 A;  2O6W A;  1HG8 A;  4U4B A;  1WXR A;  1TYV A;  1OFD A;  3VST A;  1BN8 A;  4XLH A;  3RIQ A;  2NST A;  4YEL A;  1KTW A;  3EQO A;  1L1I A;  2NZM A;  3PSZ A;  4XLA A;  2YUH A;  1X0C A;  1IDJ A;  3ML3 A;  2INU A;  4YZA A;  4YDT A;  3JUR A;  3ZPP A;  1BHE A;  1TYX A;  2VFQ A;  3GQ9 A;  4XQF A;  2UVF A;  2VFM A;  1K8F A;  2BM5 A;  1PXZ A;  2NTP A;  2QZA A;  2VFN A;  1TSP A;  4YCQ A;  2PYH A;  5JMC B;  1QA2 A;  2O1D A;  1QA3 A;  2X6W A;  1RU4 A;  1IDK A;  4XOR A;  2VFO A;  1NHC A;  4EW9 A;  3BH7 B;  2IOU G;  2O04 A;  1LM1 A;  4AVZ A;  3GRH A;  2X6Y A;  4HWV A;  4W8R A;  3SZE A;  3TH0 A;  4XLC A;  2XTX A;  2EWE A;  4YC5 A;  2IQ7 A;  5AMV A;  3SY2 A;  1PE9 A;  1QQ1 A;  4MR0 A;  2BM4 A;  1DBO A;  3VMV A;  4YZ0 A;  3PSS A;  1QJV A;  4V02 C;  1VBL A;  1RWR A;  1O8K A;  3DU1 X;  4JRA C;  3GQ7 A;  1IA5 A;  2X85 A;  4XMY A;  2J8K A;  4OJ5 A;  4YEI A;  4C2L A;  1KCD A;  3N90 A;  4YEJ A;  1WMR A;  4XN0 A;  1OFL A;  3VMW A;  3NB2 A;  2XT4 A;  3B4N A;  1JRG A;  4W8T A;  1EZG A;  1O8H A;  1QRC A;  1OFE A;  2J8I A;  4URR A;  1QCX A;  2XT2 A;  2XTY A;  2BM6 A;  2F3L A;  4W8Q A;  1KCC A;  3VSU A;  4XR6 A;  1OGO X;  2BSP A;  4YZQ A;  1DBG A;  1O8F A;  4OZY A;  4XKW A;  2QY1 A;  2W7Z A;  1O8J A;  4XM3 A;  4Z03 A;  5JLV C;  2VJJ A;  1K4Z A;  1O88 A;  4NK6 A;  4YZX A;  3NAW A;  4XKV A;  3SQV A;  2XTW A;  3PET A;  4OJ6 A;  3LJY A;  2B0R A;  2PYG A;  1KQ5 A;  1O8G A;  2ODL A;  2VJI A;  1O8I A;  4OJO A;  3P4G A;  4XOT A;  3JX8 A;  1PLU A;  5DNS A;  4NK8 A;  3FY3 A;  2V5I A;  1OFM A;  4MXN A;  3N6Z A;  1XG2 A;  4XLE A;  1O8D A;  2O0V A;  2BM7 A;  3ZSC A;  2UVE A;  2NTQ A;  3SYJ A;  2VFP A;  3VSV A;  3EQN A;  2QX3 A;  4XN3 A;  3B8Y A;  1O8E A;  1AIR A;  2QYU A;  5C1C A;  4PMH A;  4XON A;  1GQ8 A;  1CLW A;  2X3H A;  1K5C A;  3KRG A; 
#chains in the Genus database with same CATH homology
 2O0W A;  2NTB A;  1IB4 A;  3B90 A;  3GQA A;  4XL9 A;  4U49 A;  3T9G A;  4I84 A;  2NT9 A;  4Z05 A;  4XLF A;  3LMW A;  2NSP A;  3GQ8 A;  3SUC A;  1RMG A;  2O17 A;  1OOC A;  4XOP A;  4W8S A;  1H80 A;  1JTA A;  2INV A;  1O8M A;  4XNF A;  5C1E A;  4OJP A;  3WWG A;  1CZF A;  4OJL A;  1EE6 A;  1OGM X;  3UW0 A;  2VBM A;  2VBE A;  2QXZ A;  2PEC A;  2Z8G A;  4OZZ A;  4Z06 A;  2X6X A;  2NT6 A;  2VBK A;  1O8L A;  1HG8 A;  4U4B A;  3VST A;  1BN8 A;  4XLH A;  2NST A;  4YEL A;  1KTW A;  3EQO A;  2NZM A;  4XLA A;  1X0C A;  1IDJ A;  2INU A;  4YZA A;  3ZPP A;  3JUR A;  1BHE A;  3GQ9 A;  4XQF A;  2UVF A;  4YEJ A;  2NTP A;  1PXZ A;  2PYH A;  2O1D A;  2X6W A;  1RU4 A;  1IDK A;  4XOR A;  1NHC A;  4EW9 A;  2O04 A;  4AVZ A;  3GRH A;  2X6Y A;  4HWV A;  4W8R A;  4XLC A;  2EWE A;  2IQ7 A;  5AMV A;  3VMV A;  1PE9 A;  4MR0 A;  4YZ0 A;  1DBO A;  1QJV A;  1VBL A;  1RWR A;  1O8K A;  1IA5 A;  3GQ7 A;  2X85 A;  4XMY A;  4OJ5 A;  4C2L A;  1KCD A;  1WMR A;  4XN0 A;  1OFL A;  3VMW A;  3B4N A;  4W8T A;  1JRG A;  1O8H A;  4URR A;  1QCX A;  4W8Q A;  1KCC A;  3VSU A;  4XR6 A;  1OGO X;  2BSP A;  4YZQ A;  1DBG A;  1O8F A;  4OZY A;  4XKW A;  2QY1 A;  1O8J A;  4XM3 A;  4Z03 A;  2VJJ A;  1O88 A;  4NK6 A;  4YZX A;  4XKV A;  4OJ6 A;  2PYG A;  4OJO A;  1O8G A;  2ODL A;  2VJI A;  1O8I A;  4XOT A;  1PLU A;  4NK8 A;  3FY3 A;  1OFM A;  4MXN A;  1XG2 A;  4XLE A;  1O8D A;  2O0V A;  3ZSC A;  2UVE A;  2NTQ A;  3VSV A;  3EQN A;  2QX3 A;  4XN3 A;  3B8Y A;  1O8E A;  1AIR A;  5C1C A;  4PMH A;  4XON A;  1GQ8 A;  1K5C A;  2X3H A;  3KRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...