3DU1X

The 2.0 angstrom resolution crystal structure of hetl, a pentapeptide repeat protein involved in heterocyst differentiation regulation from the cyanobacterium nostoc sp. strain pcc 7120
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
237
structure length
237
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords All3740 protein
publication title The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb
source organism Nostoc sp.
total genus 107
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3du1X00
4YDTA 4YFOA 3PSZA 2XTWA 2XTYA 4YEIA 2XT2A 2QYUA 3NAWA 3NB2A 3PSSA 4YCQA 2XT4A 3SQVA 2J8KA 3SY2A 2XTXA 4YC5A 2QZAA 2O6WA 3DU1X 5DNSA
chains in the Genus database with same CATH superfamily
4XOPA 1QA3A 1K4ZA 1OOCA 2NZMA 4OJ6A 4XONA 1QRCA 2PECA 2BM5A 3B90A 1NHCA 3GRHA 2XTWA 1O8JA 1TYUA 1OFDA 2NT9A 2W7ZA 4XL9A 1CZFA 4Z03A 4NK6A 4XORA 3WWGA 1DBGA 2J8IA 4PMHA 2VFPA 3AK5A 1O8EA 1K8FA 3GQ8A 3RIQA 1O8FA 1QA1A 2BX6A 1OGOX 3VMVA 1IDJA 1WMRA 2G0YA 4U4BA 1HG8A 4V02C 2EWEA 2J8KA 2YUHA 2VBKA 2VJJA 3N90A 1GQ8A 1EE6A 2XC1A 1O8LA 2INUA 3BH7B 4NK8A 2QZAA 2VFNA 2QXZA 2QY1A 4YZ0A 1RMGA 4C2LA 4U49A 4W8SA 2UVFA 4OM9A 4XLHA 4YDTA 1OFMA 2NSPA 3FY3A 3LMWA 5C1EA 3ML3A 1QQ1A 2BM7A 4YZQA 3ZPPA 1BHEA 4XOTA 1PXZA 1CLWA 2XTYA 4XKVA 2O0WA 1JTAA 1LLWA 4XNFA 2X6WA 1KQ5A 1TSPA 1BN8A 1VBLA 1QA2A 4XQFA 3NAWA 3NB2A 3B4NA 4OPWA 2X6YA 3PSSA 2BM4A 4XKWA 2NTBA 1RU4A 2O0VA 3SQVA 4YZXA 3H09A 2O04A 2VFOA 3T9GA 4EW9A 1XG2A 4XLEA 5C1CA 2NTQA 2Z8GA 3GQ9A 3P4GA 4XLAA 1RWRA 4W8RA 1PE9A 2VFQA 2XTXA 4OJ5A 4XN3A 3SZEA 1TYVA 1QCXA 2IOUG 4JRAC 3BH6B 2NSTA 1H80A 1WXRA 1EA0A 4YFOA 1AIRA 1KTWA 4W8TA 1KCDA 1O8DA 4AVZA 4KH3A 3GQ7A 1IA5A 3SUCA 4W8QA 2O17A 2V5IA 1O8IA 4OZYA 4Z06A 4YEIA 2VJIA 2XT2A 3JURA 4XLCA 3LYCA 1QJVA 4XM3A 2QYUA 4HWVA 2PYGA 1O8HA 3VSTA 4YCQA 1JRGA 2B0RA 2XT4A 4I84A 2X6XA 1TYWA 2UVEA 1PLUA 1K5CA 3N6ZA 4MR0A 2O1DA 4XLFA 1OFLA 2VFMA 1TYXA 2X3HA 1IB4A 3DU1X 5AMVA 3VSVA 4YZAA 1DBOA 1OGMX 3JX8A 5DNSA 2IQ7A 4URRA 1KCCA 3GQAA 1O8KA 2BSPA 4MXNA 1LLZA 4XN0A 4XR6A 3PSZA 4OJLA 1L1IA 4OJPA 2QX3A 1O8MA 4YELA 1IDKA 3KRGA 4OZZA 5JLVC 2NTPA 1O88A 1QRBA 3EQNA 4XMYA 3ZSCA 2NT6A 2INVA 3B8YA 1OFEA 1X0CA 2F3LA 2X85A 3EQOA 1HF2A 4YEJA 3SYJA 3SY2A 1EZGA 2ODLA 3LJYA 3UW0A 2BM6A 3VMWA 2VBMA 3TH0A 4YC5A 1LM1A 2O6WA 2VBEA 4Z05A 1DABA 1O8GA 5JMCB 3PETA 3VSUA 4OJOA 2PYHA
chains in the Genus database with same CATH topology
4YDTA 4YFOA 3PSZA 2XTWA 2XTYA 4YEIA 2XT2A 2QYUA 3NAWA 3NB2A 3PSSA 4YCQA 2XT4A 3SQVA 2J8KA 3SY2A 2XTXA 4YC5A 2QZAA 2O6WA 3DU1X 5DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  4YFO A;  3PSZ A;  2XTW A;  2XTY A;  4YEI A;  2XT2 A;  2QYU A;  3NAW A;  3NB2 A;  3PSS A;  4YCQ A;  2XT4 A;  3SQV A;  2J8K A;  3SY2 A;  2XTX A;  4YC5 A;  2QZA A;  2O6W A;  3DU1 X;  5DNS A; 
#chains in the Genus database with same CATH topology
 4XOP A;  1QA3 A;  1K4Z A;  1OOC A;  2NZM A;  4OJ6 A;  4XON A;  1QRC A;  2PEC A;  2BM5 A;  3B90 A;  1NHC A;  3GRH A;  2XTW A;  1O8J A;  1TYU A;  1OFD A;  2NT9 A;  2W7Z A;  4XL9 A;  1CZF A;  4Z03 A;  4NK6 A;  4XOR A;  3WWG A;  1DBG A;  2J8I A;  4PMH A;  2VFP A;  3AK5 A;  1O8E A;  1K8F A;  3GQ8 A;  3RIQ A;  1O8F A;  1QA1 A;  2BX6 A;  1OGO X;  3VMV A;  1IDJ A;  1WMR A;  2G0Y A;  4U4B A;  1HG8 A;  4V02 C;  2EWE A;  2J8K A;  2YUH A;  2VBK A;  2VJJ A;  3N90 A;  1GQ8 A;  1EE6 A;  2XC1 A;  1O8L A;  2INU A;  3BH7 B;  4NK8 A;  2QZA A;  2VFN A;  2QXZ A;  2QY1 A;  4YZ0 A;  1RMG A;  4C2L A;  4U49 A;  4W8S A;  2UVF A;  4OM9 A;  4XLH A;  4YDT A;  1OFM A;  2NSP A;  3FY3 A;  3LMW A;  5C1E A;  3ML3 A;  1QQ1 A;  2BM7 A;  4YZQ A;  3ZPP A;  1BHE A;  4XOT A;  1PXZ A;  1CLW A;  2XTY A;  4XKV A;  2O0W A;  1JTA A;  1LLW A;  4XNF A;  2X6W A;  1KQ5 A;  1TSP A;  1BN8 A;  1VBL A;  1QA2 A;  4XQF A;  3NAW A;  3NB2 A;  3B4N A;  4OPW A;  2X6Y A;  3PSS A;  2BM4 A;  4XKW A;  2NTB A;  1RU4 A;  2O0V A;  3SQV A;  4YZX A;  3H09 A;  2O04 A;  2VFO A;  3T9G A;  4EW9 A;  1XG2 A;  4XLE A;  5C1C A;  2NTQ A;  2Z8G A;  3GQ9 A;  3P4G A;  4XLA A;  1RWR A;  4W8R A;  1PE9 A;  2VFQ A;  2XTX A;  4OJ5 A;  4XN3 A;  3SZE A;  1TYV A;  1QCX A;  2IOU G;  4JRA C;  3BH6 B;  2NST A;  1H80 A;  1WXR A;  1EA0 A;  4YFO A;  1AIR A;  1KTW A;  4W8T A;  1KCD A;  1O8D A;  4AVZ A;  4KH3 A;  3GQ7 A;  1IA5 A;  3SUC A;  4W8Q A;  2O17 A;  2V5I A;  1O8I A;  4OZY A;  4Z06 A;  4YEI A;  2VJI A;  2XT2 A;  3JUR A;  4XLC A;  3LYC A;  1QJV A;  4XM3 A;  2QYU A;  4HWV A;  2PYG A;  1O8H A;  3VST A;  4YCQ A;  1JRG A;  2B0R A;  2XT4 A;  4I84 A;  2X6X A;  1TYW A;  2UVE A;  1PLU A;  1K5C A;  3N6Z A;  4MR0 A;  2O1D A;  4XLF A;  1OFL A;  2VFM A;  1TYX A;  2X3H A;  1IB4 A;  3DU1 X;  5AMV A;  3VSV A;  4YZA A;  1DBO A;  1OGM X;  3JX8 A;  5DNS A;  2IQ7 A;  4URR A;  1KCC A;  3GQA A;  1O8K A;  2BSP A;  4MXN A;  1LLZ A;  4XN0 A;  4XR6 A;  3PSZ A;  4OJL A;  1L1I A;  4OJP A;  2QX3 A;  1O8M A;  4YEL A;  1IDK A;  3KRG A;  4OZZ A;  5JLV C;  2NTP A;  1O88 A;  1QRB A;  3EQN A;  4XMY A;  3ZSC A;  2NT6 A;  2INV A;  3B8Y A;  1OFE A;  1X0C A;  2F3L A;  2X85 A;  3EQO A;  1HF2 A;  4YEJ A;  3SYJ A;  3SY2 A;  1EZG A;  2ODL A;  3LJY A;  3UW0 A;  2BM6 A;  3VMW A;  2VBM A;  3TH0 A;  4YC5 A;  1LM1 A;  2O6W A;  2VBE A;  4Z05 A;  1DAB A;  1O8G A;  5JMC B;  3PET A;  3VSU A;  4OJO A;  2PYH A; 
#chains in the Genus database with same CATH homology
 4YDT A;  4YFO A;  3PSZ A;  2XTW A;  2XTY A;  4YEI A;  2XT2 A;  2QYU A;  3NAW A;  3NB2 A;  3PSS A;  4YCQ A;  2XT4 A;  3SQV A;  2J8K A;  3SY2 A;  2XTX A;  4YC5 A;  2QZA A;  2O6W A;  3DU1 X;  5DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...