3DU1X

The 2.0 angstrom resolution crystal structure of hetl, a pentapeptide repeat protein involved in heterocyst differentiation regulation from the cyanobacterium nostoc sp. strain pcc 7120
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
237
structure length
237
Chain Sequence
b'HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All3740 protein
publication title The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Structural protein
total genus 107
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3du1X00
3NAWA 4YC5A 2XTWA 2QYUA 2XTXA 3NB2A 4YEIA 4YCQA 2XTYA 4YDTA 2XT4A 3SQVA 2O6WA 3DU1X 4YFOA 2J8KA 2QZAA 2XT2A 3SY2A 5DNSA 3PSSA 3PSZA
chains in the Genus database with same CATH superfamily
1PE9A 1NHCA 2QXZA 1IB4A 3SUCA 3ML3A 3VMWA 2X6YA 3KRGA 4XKWA 4W8SA 1VBLA 1LLWA 3B90A 1XG2A 4XLAA 3ZPPA 1H80A 1HG8A 1O8KA 1DBOA 1GQ8A 3BH7B 2QYUA 1WXRA 3LYCA 2XC1A 2X6XA 2O04A 1PLUA 4Z03A 1WMRA 4YEIA 4YCQA 2XTYA 4XLFA 4NK6A 1OOCA 3GQ7A 4JRAC 3FY3A 3GRHA 4V02C 4XMYA 3VSVA 4XQFA 1L1IA 2J8KA 4XR6A 1O8IA 2F3LA 2W7ZA 2XT2A 3SY2A 5JLVC 4OZYA 4C2LA 3RIQA 3LJYA 3PSSA 2O17A 3B8YA 1QJVA 2INUA 1KTWA 2NTBA 4Z06A 1QA3A 3LMWA 2PYGA 1BHEA 4XONA 3N6ZA 3JX8A 4W8TA 4YELA 4YEJA 4XKVA 1KQ5A 4URRA 2INVA 2NTPA 4EW9A 1TYVA 1OGMX 2PECA 4U4BA 4Z05A 1BN8A 1DABA 4W8RA 3TH0A 4PMHA 3SYJA 1QA1A 1LM1A 4XLCA 1OFDA 1IDKA 2QX3A 2NSPA 4HWVA 1O8EA 4MXNA 2VFMA 4OJLA 3SQVA 2O1DA 4YZXA 2B0RA 2O6WA 3DU1X 4YFOA 1OFMA 5AMVA 5JMCB 1QA2A 2V5IA 2BM7A 3T9GA 2O0VA 1OGOX 1QRBA 1O8HA 2BM5A 4U49A 1O8LA 2VFPA 4XNFA 1TYWA 3AK5A 2NZMA 4OJ5A 3WWGA 3N90A 3VSTA 4W8QA 2ODLA 1O8JA 2BM6A 2BSPA 1K8FA 4OJ6A 2VJIA 1K5CA 4OPWA 1JRGA 2G0YA 4OZZA 1DBGA 4YC5A 4YZ0A 3UW0A 4XOPA 2J8IA 3EQOA 3GQ9A 2IQ7A 4XL9A 2XTXA 4XLEA 3JURA 1QQ1A 1EA0A 5C1EA 1OFEA 1IDJA 2X85A 1O8DA 3P4GA 1EE6A 1EZGA 1QRCA 4KH3A 4YZAA 3ZSCA 2VBMA 2EWEA 2VFOA 1HF2A 1TSPA 2QY1A 2X3HA 3B4NA 1O8MA 2VJJA 2NT6A 2VFNA 2BM4A 2NTQA 3VSUA 1TYXA 3NAWA 1AIRA 1O88A 4OJPA 3EQNA 1OFLA 3GQAA 1IA5A 2VFQA 2VBKA 1TYUA 2IOUG 2VBEA 4XM3A 4I84A 1CLWA 1PXZA 2XTWA 1LLZA 2O0WA 2UVFA 3H09A 1X0CA 4OJOA 4OM9A 1CZFA 1JTAA 2X6WA 3SZEA 4XOTA 1RU4A 3NB2A 3VMVA 4XLHA 4YZQA 1RWRA 4YDTA 1RMGA 1QCXA 2XT4A 3GQ8A 4NK8A 4XN3A 1O8FA 2NT9A 4AVZA 5C1CA 2BX6A 3BH6B 2Z8GA 1KCCA 2YUHA 1O8GA 2QZAA 4XN0A 4XORA 2PYHA 5DNSA 1KCDA 1K4ZA 2UVEA 4MR0A 3PETA 2NSTA 3PSZA
chains in the Genus database with same CATH topology
3NAWA 4YC5A 2XTWA 2QYUA 2XTXA 3NB2A 4YEIA 4YCQA 2XTYA 4YDTA 2XT4A 3SQVA 2O6WA 3DU1X 4YFOA 2J8KA 2QZAA 2XT2A 3SY2A 5DNSA 3PSSA 3PSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NAW A;  4YC5 A;  2XTW A;  2QYU A;  2XTX A;  3NB2 A;  4YEI A;  4YCQ A;  2XTY A;  4YDT A;  2XT4 A;  3SQV A;  2O6W A;  3DU1 X;  4YFO A;  2J8K A;  2QZA A;  2XT2 A;  3SY2 A;  5DNS A;  3PSS A;  3PSZ A; 
#chains in the Genus database with same CATH topology
 1PE9 A;  1NHC A;  2QXZ A;  1IB4 A;  3SUC A;  3ML3 A;  3VMW A;  2X6Y A;  3KRG A;  4XKW A;  4W8S A;  1VBL A;  1LLW A;  3B90 A;  1XG2 A;  4XLA A;  3ZPP A;  1H80 A;  1HG8 A;  1O8K A;  1DBO A;  1GQ8 A;  3BH7 B;  2QYU A;  1WXR A;  3LYC A;  2XC1 A;  2X6X A;  2O04 A;  1PLU A;  4Z03 A;  1WMR A;  4YEI A;  4YCQ A;  2XTY A;  4XLF A;  4NK6 A;  1OOC A;  3GQ7 A;  4JRA C;  3FY3 A;  3GRH A;  4V02 C;  4XMY A;  3VSV A;  4XQF A;  1L1I A;  2J8K A;  4XR6 A;  1O8I A;  2F3L A;  2W7Z A;  2XT2 A;  3SY2 A;  5JLV C;  4OZY A;  4C2L A;  3RIQ A;  3LJY A;  3PSS A;  2O17 A;  3B8Y A;  1QJV A;  2INU A;  1KTW A;  2NTB A;  4Z06 A;  1QA3 A;  3LMW A;  2PYG A;  1BHE A;  4XON A;  3N6Z A;  3JX8 A;  4W8T A;  4YEL A;  4YEJ A;  4XKV A;  1KQ5 A;  4URR A;  2INV A;  2NTP A;  4EW9 A;  1TYV A;  1OGM X;  2PEC A;  4U4B A;  4Z05 A;  1BN8 A;  1DAB A;  4W8R A;  3TH0 A;  4PMH A;  3SYJ A;  1QA1 A;  1LM1 A;  4XLC A;  1OFD A;  1IDK A;  2QX3 A;  2NSP A;  4HWV A;  1O8E A;  4MXN A;  2VFM A;  4OJL A;  3SQV A;  2O1D A;  4YZX A;  2B0R A;  2O6W A;  3DU1 X;  4YFO A;  1OFM A;  5AMV A;  5JMC B;  1QA2 A;  2V5I A;  2BM7 A;  3T9G A;  2O0V A;  1OGO X;  1QRB A;  1O8H A;  2BM5 A;  4U49 A;  1O8L A;  2VFP A;  4XNF A;  1TYW A;  3AK5 A;  2NZM A;  4OJ5 A;  3WWG A;  3N90 A;  3VST A;  4W8Q A;  2ODL A;  1O8J A;  2BM6 A;  2BSP A;  1K8F A;  4OJ6 A;  2VJI A;  1K5C A;  4OPW A;  1JRG A;  2G0Y A;  4OZZ A;  1DBG A;  4YC5 A;  4YZ0 A;  3UW0 A;  4XOP A;  2J8I A;  3EQO A;  3GQ9 A;  2IQ7 A;  4XL9 A;  2XTX A;  4XLE A;  3JUR A;  1QQ1 A;  1EA0 A;  5C1E A;  1OFE A;  1IDJ A;  2X85 A;  1O8D A;  3P4G A;  1EE6 A;  1EZG A;  1QRC A;  4KH3 A;  4YZA A;  3ZSC A;  2VBM A;  2EWE A;  2VFO A;  1HF2 A;  1TSP A;  2QY1 A;  2X3H A;  3B4N A;  1O8M A;  2VJJ A;  2NT6 A;  2VFN A;  2BM4 A;  2NTQ A;  3VSU A;  1TYX A;  3NAW A;  1AIR A;  1O88 A;  4OJP A;  3EQN A;  1OFL A;  3GQA A;  1IA5 A;  2VFQ A;  2VBK A;  1TYU A;  2IOU G;  2VBE A;  4XM3 A;  4I84 A;  1CLW A;  1PXZ A;  2XTW A;  1LLZ A;  2O0W A;  2UVF A;  3H09 A;  1X0C A;  4OJO A;  4OM9 A;  1CZF A;  1JTA A;  2X6W A;  3SZE A;  4XOT A;  1RU4 A;  3NB2 A;  3VMV A;  4XLH A;  4YZQ A;  1RWR A;  4YDT A;  1RMG A;  1QCX A;  2XT4 A;  3GQ8 A;  4NK8 A;  4XN3 A;  1O8F A;  2NT9 A;  4AVZ A;  5C1C A;  2BX6 A;  3BH6 B;  2Z8G A;  1KCC A;  2YUH A;  1O8G A;  2QZA A;  4XN0 A;  4XOR A;  2PYH A;  5DNS A;  1KCD A;  1K4Z A;  2UVE A;  4MR0 A;  3PET A;  2NST A;  3PSZ A; 
#chains in the Genus database with same CATH homology
 3NAW A;  4YC5 A;  2XTW A;  2QYU A;  2XTX A;  3NB2 A;  4YEI A;  4YCQ A;  2XTY A;  4YDT A;  2XT4 A;  3SQV A;  2O6W A;  3DU1 X;  4YFO A;  2J8K A;  2QZA A;  2XT2 A;  3SY2 A;  5DNS A;  3PSS A;  3PSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...