3DU1X

The 2.0 angstrom resolution crystal structure of hetl, a pentapeptide repeat protein involved in heterocyst differentiation regulation from the cyanobacterium nostoc sp. strain pcc 7120
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
237
structure length
237
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Structural protein
molecule keywords All3740 protein
total genus 107
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3du1X00
3NB2A 2QZAA 5DNSA 3SQVA 3PSZA 4YFOA 4YDTA 4YCQA 3PSSA 4YC5A 2XT4A 2XTYA 3NAWA 2O6WA 2XTXA 2XTWA 3SY2A 2J8KA 4YEIA 2QYUA 3DU1X 2XT2A
chains in the Genus database with same CATH superfamily
1IA5A 1QA2A 3NB2A 4W8TA 2NZMA 1IB4A 4I84A 3EQNA 3AK5A 4V02C 3ML3A 2NTPA 2IQ7A 1LM1A 4YZ0A 1OOCA 4PMHA 1XG2A 4XLHA 4OJ5A 3PSZA 4XN3A 4XOTA 2NT6A 3GQAA 5C1EA 3FY3A 1JRGA 2QY1A 3H09A 4XOPA 1BN8A 2VFOA 4OM9A 4XORA 4XNFA 3TH0A 2VBKA 2J8IA 4Z03A 4XMYA 1EZGA 1NHCA 2NTQA 2XTWA 4KH3A 1O8KA 4OZZA 4XKVA 1RWRA 4OJOA 4YZXA 2QX3A 3KRGA 4C2LA 1WMRA 3RIQA 1QA3A 4XN0A 1HG8A 1O8JA 4XM3A 2O0VA 2X6XA 1OFEA 1O8GA 1RU4A 1OFDA 2O17A 3B90A 3EQOA 2PECA 4W8RA 1K8FA 2B0RA 2IOUG 4W8QA 3VSUA 3ZSCA 5C1CA 2VFQA 5DNSA 2VFMA 2X3HA 3SQVA 4U49A 1X0CA 1O8HA 3GQ8A 2YUHA 4MXNA 3PETA 1CZFA 4U4BA 2PYHA 4YCQA 1KCCA 1TYWA 4XLFA 4XKWA 1IDJA 4YC5A 4Z06A 2QXZA 2BM4A 3BH7B 4NK6A 2XT4A 2XTYA 1OGOX 3WWGA 2NT9A 1GQ8A 3GQ9A 3LYCA 4YZQA 4Z05A 3T9GA 5JLVC 2VJJA 2G0YA 1IDKA 4MR0A 4URRA 3SUCA 4EW9A 1QRCA 2O1DA 2VJIA 4HWVA 2VFNA 3VMWA 2BX6A 1O88A 5AMVA 1PXZA 1QJVA 2X85A 4OZYA 2QYUA 1RMGA 1BHEA 2V5IA 2O04A 4JRAC 3LJYA 2BM7A 1K5CA 1OFMA 2BM5A 1O8DA 4YEJA 3B4NA 1O8LA 4OJPA 4XR6A 4XL9A 1WXRA 3ZPPA 1L1IA 2W7ZA 4OPWA 4YELA 1DABA 1DBGA 2F3LA 1O8EA 3UW0A 2X6YA 2EWEA 3JX8A 3P4GA 4XLCA 1QQ1A 1LLWA 2Z8GA 1K4ZA 2O6WA 2VBMA 3NAWA 2NSTA 2X6WA 1OGMX 1TYUA 2XTXA 3VMVA 4XONA 3SY2A 2J8KA 3DU1X 3LMWA 1TSPA 3N6ZA 1KCDA 1H80A 2VBEA 1AIRA 2INUA 4XLEA 1QCXA 3JURA 2BSPA 4YZAA 1O8MA 2QZAA 2BM6A 3SZEA 1DBOA 4AVZA 1OFLA 4XQFA 1KQ5A 1KTWA 1EE6A 1O8IA 2NTBA 1O8FA 2PYGA 3B8YA 4OJLA 4OJ6A 4XLAA 1JTAA 1LLZA 4YDTA 4YFOA 3VSTA 3PSSA 1QA1A 1EA0A 3GRHA 1PLUA 2O0WA 3VSVA 5JMCB 2ODLA 1HF2A 2VFPA 3GQ7A 2UVFA 1TYVA 3SYJA 1VBLA 1PE9A 1QRBA 2UVEA 3BH6B 3N90A 4NK8A 2NSPA 4YEIA 2XC1A 2INVA 1CLWA 1TYXA 4W8SA 2XT2A
chains in the Genus database with same CATH topology
3NB2A 2QZAA 5DNSA 3SQVA 3PSZA 4YFOA 4YDTA 4YCQA 3PSSA 4YC5A 2XT4A 2XTYA 3NAWA 2O6WA 2XTXA 2XTWA 3SY2A 2J8KA 4YEIA 2QYUA 3DU1X 2XT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NB2 A;  2QZA A;  5DNS A;  3SQV A;  3PSZ A;  4YFO A;  4YDT A;  4YCQ A;  3PSS A;  4YC5 A;  2XT4 A;  2XTY A;  3NAW A;  2O6W A;  2XTX A;  2XTW A;  3SY2 A;  2J8K A;  4YEI A;  2QYU A;  3DU1 X;  2XT2 A; 
#chains in the Genus database with same CATH topology
 1IA5 A;  1QA2 A;  3NB2 A;  4W8T A;  2NZM A;  1IB4 A;  4I84 A;  3EQN A;  3AK5 A;  4V02 C;  3ML3 A;  2NTP A;  2IQ7 A;  1LM1 A;  4YZ0 A;  1OOC A;  4PMH A;  1XG2 A;  4XLH A;  4OJ5 A;  3PSZ A;  4XN3 A;  4XOT A;  2NT6 A;  3GQA A;  5C1E A;  3FY3 A;  1JRG A;  2QY1 A;  3H09 A;  4XOP A;  1BN8 A;  2VFO A;  4OM9 A;  4XOR A;  4XNF A;  3TH0 A;  2VBK A;  2J8I A;  4Z03 A;  4XMY A;  1EZG A;  1NHC A;  2NTQ A;  2XTW A;  4KH3 A;  1O8K A;  4OZZ A;  4XKV A;  1RWR A;  4OJO A;  4YZX A;  2QX3 A;  3KRG A;  4C2L A;  1WMR A;  3RIQ A;  1QA3 A;  4XN0 A;  1HG8 A;  1O8J A;  4XM3 A;  2O0V A;  2X6X A;  1OFE A;  1O8G A;  1RU4 A;  1OFD A;  2O17 A;  3B90 A;  3EQO A;  2PEC A;  4W8R A;  1K8F A;  2B0R A;  2IOU G;  4W8Q A;  3VSU A;  3ZSC A;  5C1C A;  2VFQ A;  5DNS A;  2VFM A;  2X3H A;  3SQV A;  4U49 A;  1X0C A;  1O8H A;  3GQ8 A;  2YUH A;  4MXN A;  3PET A;  1CZF A;  4U4B A;  2PYH A;  4YCQ A;  1KCC A;  1TYW A;  4XLF A;  4XKW A;  1IDJ A;  4YC5 A;  4Z06 A;  2QXZ A;  2BM4 A;  3BH7 B;  4NK6 A;  2XT4 A;  2XTY A;  1OGO X;  3WWG A;  2NT9 A;  1GQ8 A;  3GQ9 A;  3LYC A;  4YZQ A;  4Z05 A;  3T9G A;  5JLV C;  2VJJ A;  2G0Y A;  1IDK A;  4MR0 A;  4URR A;  3SUC A;  4EW9 A;  1QRC A;  2O1D A;  2VJI A;  4HWV A;  2VFN A;  3VMW A;  2BX6 A;  1O88 A;  5AMV A;  1PXZ A;  1QJV A;  2X85 A;  4OZY A;  2QYU A;  1RMG A;  1BHE A;  2V5I A;  2O04 A;  4JRA C;  3LJY A;  2BM7 A;  1K5C A;  1OFM A;  2BM5 A;  1O8D A;  4YEJ A;  3B4N A;  1O8L A;  4OJP A;  4XR6 A;  4XL9 A;  1WXR A;  3ZPP A;  1L1I A;  2W7Z A;  4OPW A;  4YEL A;  1DAB A;  1DBG A;  2F3L A;  1O8E A;  3UW0 A;  2X6Y A;  2EWE A;  3JX8 A;  3P4G A;  4XLC A;  1QQ1 A;  1LLW A;  2Z8G A;  1K4Z A;  2O6W A;  2VBM A;  3NAW A;  2NST A;  2X6W A;  1OGM X;  1TYU A;  2XTX A;  3VMV A;  4XON A;  3SY2 A;  2J8K A;  3DU1 X;  3LMW A;  1TSP A;  3N6Z A;  1KCD A;  1H80 A;  2VBE A;  1AIR A;  2INU A;  4XLE A;  1QCX A;  3JUR A;  2BSP A;  4YZA A;  1O8M A;  2QZA A;  2BM6 A;  3SZE A;  1DBO A;  4AVZ A;  1OFL A;  4XQF A;  1KQ5 A;  1KTW A;  1EE6 A;  1O8I A;  2NTB A;  1O8F A;  2PYG A;  3B8Y A;  4OJL A;  4OJ6 A;  4XLA A;  1JTA A;  1LLZ A;  4YDT A;  4YFO A;  3VST A;  3PSS A;  1QA1 A;  1EA0 A;  3GRH A;  1PLU A;  2O0W A;  3VSV A;  5JMC B;  2ODL A;  1HF2 A;  2VFP A;  3GQ7 A;  2UVF A;  1TYV A;  3SYJ A;  1VBL A;  1PE9 A;  1QRB A;  2UVE A;  3BH6 B;  3N90 A;  4NK8 A;  2NSP A;  4YEI A;  2XC1 A;  2INV A;  1CLW A;  1TYX A;  4W8S A;  2XT2 A; 
#chains in the Genus database with same CATH homology
 3NB2 A;  2QZA A;  5DNS A;  3SQV A;  3PSZ A;  4YFO A;  4YDT A;  4YCQ A;  3PSS A;  4YC5 A;  2XT4 A;  2XTY A;  3NAW A;  2O6W A;  2XTX A;  2XTW A;  3SY2 A;  2J8K A;  4YEI A;  2QYU A;  3DU1 X;  2XT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...