3DU1X

The 2.0 angstrom resolution crystal structure of hetl, a pentapeptide repeat protein involved in heterocyst differentiation regulation from the cyanobacterium nostoc sp. strain pcc 7120
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
237
structure length
237
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Structural protein
molecule keywords All3740 protein
total genus 107
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3du1X00
5DNSA 3SQVA 2XTXA 2QYUA 2XT2A 3NAWA 3PSSA 4YFOA 3NB2A 3SY2A 2O6WA 2XT4A 3PSZA 4YEIA 4YDTA 2J8KA 4YCQA 2XTYA 3DU1X 4YC5A 2QZAA 2XTWA
chains in the Genus database with same CATH superfamily
3B90A 4XQFA 3SUCA 1IDKA 2NT9A 1H80A 4XOPA 3ML3A 1O88A 1HG8A 3GRHA 4OPWA 3SQVA 1RMGA 1QA1A 2X6XA 1QA3A 1LLZA 2QYUA 3VSTA 2O04A 4XORA 1DBGA 4JRAC 1X0CA 1KCDA 3PSSA 1O8LA 4PMHA 1O8GA 2VJJA 1PE9A 4OJLA 4YZ0A 1TYUA 1XG2A 1EA0A 1DBOA 1GQ8A 1TSPA 2PYGA 3VMWA 1K8FA 3VSUA 1KCCA 2IOUG 1BN8A 2X6YA 2UVEA 4YC5A 2BM7A 1PXZA 2X3HA 3FY3A 2W7ZA 4XNFA 4Z03A 2VFNA 2NT6A 1PLUA 3ZSCA 1RWRA 1QRBA 2VBEA 4XLEA 1IB4A 4I84A 2VFQA 1DABA 3BH7B 1VBLA 2Z8GA 4OJ5A 4XKVA 1O8HA 2VBMA 5DNSA 1QA2A 1QCXA 4Z06A 1O8DA 2VFOA 1AIRA 2XT2A 5C1CA 4W8RA 1TYWA 1WXRA 2V5IA 1IA5A 3H09A 1O8KA 2XT4A 3AK5A 3PSZA 4YEIA 1JRGA 1OFLA 4V02C 4YDTA 2BSPA 3KRGA 1EZGA 2QX3A 4YZAA 3LYCA 4MR0A 1OGMX 2NSPA 2XTYA 3JX8A 3EQOA 4XN3A 1QRCA 3SYJA 4XL9A 2QZAA 1OOCA 3P4GA 2NZMA 4XLFA 1O8IA 3T9GA 1HF2A 2X6WA 4OJ6A 4OJPA 5C1EA 3BH6B 3PETA 2NTQA 4NK6A 1QQ1A 1IDJA 3GQ7A 2G0YA 3WWGA 4C2LA 1O8JA 4XOTA 1O8MA 4XN0A 2NTPA 4XKWA 2XTXA 1JTAA 3NAWA 4HWVA 3UW0A 2INVA 4YEJA 2O0VA 4U49A 2PECA 2VFPA 3SY2A 1CZFA 2B0RA 2BM6A 1LLWA 1LM1A 2UVFA 4XM3A 4EW9A 4URRA 1O8FA 1RU4A 2NTBA 3B8YA 3TH0A 1K4ZA 1KQ5A 4OZZA 3GQ8A 3ZPPA 2QY1A 3DU1X 4XONA 2IQ7A 2QXZA 3N6ZA 4XMYA 3VMVA 3SZEA 1OFDA 3RIQA 2VJIA 3N90A 4OJOA 2XTWA 1NHCA 3GQAA 2BX6A 4XLCA 3VSVA 1WMRA 1QJVA 4OM9A 2INUA 2F3LA 1L1IA 4MXNA 5JMCB 4XLAA 3EQNA 4XR6A 4YZXA 2YUHA 3LMWA 4OZYA 4W8SA 2BM5A 2VBKA 1CLWA 1TYVA 5AMVA 2PYHA 2O0WA 2BM4A 1TYXA 3B4NA 4XLHA 4YFOA 3NB2A 2O6WA 2O1DA 4Z05A 5JLVC 4YZQA 1BHEA 2NSTA 3GQ9A 1O8EA 4U4BA 1EE6A 1K5CA 4YELA 2J8KA 4YCQA 1KTWA 4AVZA 1OGOX 1OFEA 2EWEA 2J8IA 4W8TA 2XC1A 2O17A 2ODLA 4W8QA 3JURA 4NK8A 2VFMA 3LJYA 1OFMA 2X85A 4KH3A
chains in the Genus database with same CATH topology
5DNSA 3SQVA 2XTXA 2QYUA 2XT2A 3NAWA 3PSSA 4YFOA 3NB2A 3SY2A 2O6WA 2XT4A 3PSZA 4YEIA 4YDTA 2J8KA 4YCQA 2XTYA 3DU1X 4YC5A 2QZAA 2XTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNS A;  3SQV A;  2XTX A;  2QYU A;  2XT2 A;  3NAW A;  3PSS A;  4YFO A;  3NB2 A;  3SY2 A;  2O6W A;  2XT4 A;  3PSZ A;  4YEI A;  4YDT A;  2J8K A;  4YCQ A;  2XTY A;  3DU1 X;  4YC5 A;  2QZA A;  2XTW A; 
#chains in the Genus database with same CATH topology
 3B90 A;  4XQF A;  3SUC A;  1IDK A;  2NT9 A;  1H80 A;  4XOP A;  3ML3 A;  1O88 A;  1HG8 A;  3GRH A;  4OPW A;  3SQV A;  1RMG A;  1QA1 A;  2X6X A;  1QA3 A;  1LLZ A;  2QYU A;  3VST A;  2O04 A;  4XOR A;  1DBG A;  4JRA C;  1X0C A;  1KCD A;  3PSS A;  1O8L A;  4PMH A;  1O8G A;  2VJJ A;  1PE9 A;  4OJL A;  4YZ0 A;  1TYU A;  1XG2 A;  1EA0 A;  1DBO A;  1GQ8 A;  1TSP A;  2PYG A;  3VMW A;  1K8F A;  3VSU A;  1KCC A;  2IOU G;  1BN8 A;  2X6Y A;  2UVE A;  4YC5 A;  2BM7 A;  1PXZ A;  2X3H A;  3FY3 A;  2W7Z A;  4XNF A;  4Z03 A;  2VFN A;  2NT6 A;  1PLU A;  3ZSC A;  1RWR A;  1QRB A;  2VBE A;  4XLE A;  1IB4 A;  4I84 A;  2VFQ A;  1DAB A;  3BH7 B;  1VBL A;  2Z8G A;  4OJ5 A;  4XKV A;  1O8H A;  2VBM A;  5DNS A;  1QA2 A;  1QCX A;  4Z06 A;  1O8D A;  2VFO A;  1AIR A;  2XT2 A;  5C1C A;  4W8R A;  1TYW A;  1WXR A;  2V5I A;  1IA5 A;  3H09 A;  1O8K A;  2XT4 A;  3AK5 A;  3PSZ A;  4YEI A;  1JRG A;  1OFL A;  4V02 C;  4YDT A;  2BSP A;  3KRG A;  1EZG A;  2QX3 A;  4YZA A;  3LYC A;  4MR0 A;  1OGM X;  2NSP A;  2XTY A;  3JX8 A;  3EQO A;  4XN3 A;  1QRC A;  3SYJ A;  4XL9 A;  2QZA A;  1OOC A;  3P4G A;  2NZM A;  4XLF A;  1O8I A;  3T9G A;  1HF2 A;  2X6W A;  4OJ6 A;  4OJP A;  5C1E A;  3BH6 B;  3PET A;  2NTQ A;  4NK6 A;  1QQ1 A;  1IDJ A;  3GQ7 A;  2G0Y A;  3WWG A;  4C2L A;  1O8J A;  4XOT A;  1O8M A;  4XN0 A;  2NTP A;  4XKW A;  2XTX A;  1JTA A;  3NAW A;  4HWV A;  3UW0 A;  2INV A;  4YEJ A;  2O0V A;  4U49 A;  2PEC A;  2VFP A;  3SY2 A;  1CZF A;  2B0R A;  2BM6 A;  1LLW A;  1LM1 A;  2UVF A;  4XM3 A;  4EW9 A;  4URR A;  1O8F A;  1RU4 A;  2NTB A;  3B8Y A;  3TH0 A;  1K4Z A;  1KQ5 A;  4OZZ A;  3GQ8 A;  3ZPP A;  2QY1 A;  3DU1 X;  4XON A;  2IQ7 A;  2QXZ A;  3N6Z A;  4XMY A;  3VMV A;  3SZE A;  1OFD A;  3RIQ A;  2VJI A;  3N90 A;  4OJO A;  2XTW A;  1NHC A;  3GQA A;  2BX6 A;  4XLC A;  3VSV A;  1WMR A;  1QJV A;  4OM9 A;  2INU A;  2F3L A;  1L1I A;  4MXN A;  5JMC B;  4XLA A;  3EQN A;  4XR6 A;  4YZX A;  2YUH A;  3LMW A;  4OZY A;  4W8S A;  2BM5 A;  2VBK A;  1CLW A;  1TYV A;  5AMV A;  2PYH A;  2O0W A;  2BM4 A;  1TYX A;  3B4N A;  4XLH A;  4YFO A;  3NB2 A;  2O6W A;  2O1D A;  4Z05 A;  5JLV C;  4YZQ A;  1BHE A;  2NST A;  3GQ9 A;  1O8E A;  4U4B A;  1EE6 A;  1K5C A;  4YEL A;  2J8K A;  4YCQ A;  1KTW A;  4AVZ A;  1OGO X;  1OFE A;  2EWE A;  2J8I A;  4W8T A;  2XC1 A;  2O17 A;  2ODL A;  4W8Q A;  3JUR A;  4NK8 A;  2VFM A;  3LJY A;  1OFM A;  2X85 A;  4KH3 A; 
#chains in the Genus database with same CATH homology
 5DNS A;  3SQV A;  2XTX A;  2QYU A;  2XT2 A;  3NAW A;  3PSS A;  4YFO A;  3NB2 A;  3SY2 A;  2O6W A;  2XT4 A;  3PSZ A;  4YEI A;  4YDT A;  2J8K A;  4YCQ A;  2XTY A;  3DU1 X;  4YC5 A;  2QZA A;  2XTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...