3DU1X

The 2.0 angstrom resolution crystal structure of hetl, a pentapeptide repeat protein involved in heterocyst differentiation regulation from the cyanobacterium nostoc sp. strain pcc 7120
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
237
structure length
237
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRANFGRTIQWGNLAADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAELKGAIMPDGSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords All3740 protein
publication title The 2A resolution crystal structure of HetL, a pentapeptide repeat protein involved in regulation of heterocyst differentiation in the cyanobacterium Nostoc sp. strain PCC 7120
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Structural protein
total genus 107
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2008-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3du1X00
2QZAA 2J8KA 2QYUA 2XTWA 4YDTA 3SY2A 5DNSA 3SQVA 2XT2A 3NB2A 3NAWA 4YC5A 4YCQA 3PSSA 2XTYA 2O6WA 3DU1X 4YFOA 2XT4A 4YEIA 3PSZA 2XTXA
chains in the Genus database with same CATH superfamily
3JX8A 2NTPA 3TH0A 3FY3A 3PETA 2V5IA 1K4ZA 2PYGA 3GQAA 4C2LA 1OGOX 2J8KA 2EWEA 2QYUA 4XOTA 3UW0A 3BH7B 4XLAA 1CLWA 1O8JA 1QA1A 1BN8A 1OFLA 4XLCA 4YZQA 3SY2A 1TYXA 2X6WA 3RIQA 1RU4A 2NTBA 3SQVA 4XLEA 3WWGA 3SUCA 4XKVA 3NAWA 1O8DA 1O88A 1AIRA 2VFMA 1O8KA 4YELA 4YC5A 2INUA 2NSTA 1DBGA 1LLWA 4YCQA 2X85A 3VMWA 2XTYA 3EQOA 4XNFA 2UVFA 2O6WA 2UVEA 1XG2A 2PYHA 2XT4A 4MR0A 4EW9A 1TYVA 2QX3A 4YEIA 3B8YA 3LYCA 5JLVC 1IDKA 4OJOA 3B90A 2W7ZA 3ZPPA 2QZAA 1KCCA 1CZFA 4XM3A 1K5CA 3H09A 1OFDA 4XLHA 4OM9A 4XMYA 1X0CA 3JURA 4PMHA 2ODLA 4V02C 1GQ8A 1OFEA 2VFOA 1EZGA 1O8FA 2BX6A 2X6YA 1RMGA 4I84A 4YZXA 4XQFA 2VBEA 2VFPA 3BH6B 2BM5A 1VBLA 2VFNA 4NK8A 2NZMA 3PSSA 1O8MA 3GQ7A 4OPWA 4YFOA 3T9GA 2BM6A 1KTWA 4XN0A 3VMVA 2O0WA 2O0VA 4HWVA 1TSPA 4XL9A 1KQ5A 2BM4A 2QXZA 1IDJA 2VJJA 4AVZA 2NT9A 2X6XA 4U4BA 1LLZA 4XONA 5JMCB 2X3HA 2XC1A 1OFMA 2BSPA 1O8HA 4W8TA 5AMVA 1QA2A 3LJYA 3P4GA 4MXNA 2NT6A 4OZYA 1QRBA 1BHEA 1QCXA 2XTWA 4OJPA 3KRGA 4YDTA 1WXRA 1TYWA 1O8LA 1HF2A 2O17A 1DABA 3VSUA 2IOUG 4XLFA 2XT2A 3NB2A 4KH3A 1JTAA 4OJLA 3N90A 4Z03A 3GRHA 2NTQA 4XOPA 4Z06A 1L1IA 4YZ0A 2O1DA 2O04A 1PLUA 3DU1X 3GQ8A 4XR6A 4XORA 4YZAA 4U49A 4YEJA 1H80A 4XN3A 4URRA 1RWRA 2J8IA 3ML3A 2PECA 2XTXA 4Z05A 3VSVA 1DBOA 2INVA 2QY1A 2BM7A 3GQ9A 2VFQA 4W8QA 1QJVA 1QQ1A 1OGMX 3N6ZA 1HG8A 1PXZA 1LM1A 2B0RA 4XKWA 1O8IA 1IB4A 1NHCA 2VBKA 2VJIA 1QRCA 3B4NA 1EA0A 1O8EA 2Z8GA 5DNSA 4NK6A 1K8FA 3LMWA 4OJ6A 1JRGA 1EE6A 1O8GA 4W8SA 5C1EA 3SZEA 1OOCA 1TYUA 3VSTA 1QA3A 2YUHA 3AK5A 3SYJA 2VBMA 4W8RA 2NSPA 1IA5A 2G0YA 4JRAC 2F3LA 3ZSCA 1WMRA 5C1CA 2IQ7A 3PSZA 1KCDA 4OZZA 4OJ5A 1PE9A 3EQNA
chains in the Genus database with same CATH topology
2QZAA 2J8KA 2QYUA 2XTWA 4YDTA 3SY2A 5DNSA 3SQVA 2XT2A 3NB2A 3NAWA 4YC5A 4YCQA 3PSSA 2XTYA 2O6WA 3DU1X 4YFOA 2XT4A 4YEIA 3PSZA 2XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZA A;  2J8K A;  2QYU A;  2XTW A;  4YDT A;  3SY2 A;  5DNS A;  3SQV A;  2XT2 A;  3NB2 A;  3NAW A;  4YC5 A;  4YCQ A;  3PSS A;  2XTY A;  2O6W A;  3DU1 X;  4YFO A;  2XT4 A;  4YEI A;  3PSZ A;  2XTX A; 
#chains in the Genus database with same CATH topology
 3JX8 A;  2NTP A;  3TH0 A;  3FY3 A;  3PET A;  2V5I A;  1K4Z A;  2PYG A;  3GQA A;  4C2L A;  1OGO X;  2J8K A;  2EWE A;  2QYU A;  4XOT A;  3UW0 A;  3BH7 B;  4XLA A;  1CLW A;  1O8J A;  1QA1 A;  1BN8 A;  1OFL A;  4XLC A;  4YZQ A;  3SY2 A;  1TYX A;  2X6W A;  3RIQ A;  1RU4 A;  2NTB A;  3SQV A;  4XLE A;  3WWG A;  3SUC A;  4XKV A;  3NAW A;  1O8D A;  1O88 A;  1AIR A;  2VFM A;  1O8K A;  4YEL A;  4YC5 A;  2INU A;  2NST A;  1DBG A;  1LLW A;  4YCQ A;  2X85 A;  3VMW A;  2XTY A;  3EQO A;  4XNF A;  2UVF A;  2O6W A;  2UVE A;  1XG2 A;  2PYH A;  2XT4 A;  4MR0 A;  4EW9 A;  1TYV A;  2QX3 A;  4YEI A;  3B8Y A;  3LYC A;  5JLV C;  1IDK A;  4OJO A;  3B90 A;  2W7Z A;  3ZPP A;  2QZA A;  1KCC A;  1CZF A;  4XM3 A;  1K5C A;  3H09 A;  1OFD A;  4XLH A;  4OM9 A;  4XMY A;  1X0C A;  3JUR A;  4PMH A;  2ODL A;  4V02 C;  1GQ8 A;  1OFE A;  2VFO A;  1EZG A;  1O8F A;  2BX6 A;  2X6Y A;  1RMG A;  4I84 A;  4YZX A;  4XQF A;  2VBE A;  2VFP A;  3BH6 B;  2BM5 A;  1VBL A;  2VFN A;  4NK8 A;  2NZM A;  3PSS A;  1O8M A;  3GQ7 A;  4OPW A;  4YFO A;  3T9G A;  2BM6 A;  1KTW A;  4XN0 A;  3VMV A;  2O0W A;  2O0V A;  4HWV A;  1TSP A;  4XL9 A;  1KQ5 A;  2BM4 A;  2QXZ A;  1IDJ A;  2VJJ A;  4AVZ A;  2NT9 A;  2X6X A;  4U4B A;  1LLZ A;  4XON A;  5JMC B;  2X3H A;  2XC1 A;  1OFM A;  2BSP A;  1O8H A;  4W8T A;  5AMV A;  1QA2 A;  3LJY A;  3P4G A;  4MXN A;  2NT6 A;  4OZY A;  1QRB A;  1BHE A;  1QCX A;  2XTW A;  4OJP A;  3KRG A;  4YDT A;  1WXR A;  1TYW A;  1O8L A;  1HF2 A;  2O17 A;  1DAB A;  3VSU A;  2IOU G;  4XLF A;  2XT2 A;  3NB2 A;  4KH3 A;  1JTA A;  4OJL A;  3N90 A;  4Z03 A;  3GRH A;  2NTQ A;  4XOP A;  4Z06 A;  1L1I A;  4YZ0 A;  2O1D A;  2O04 A;  1PLU A;  3DU1 X;  3GQ8 A;  4XR6 A;  4XOR A;  4YZA A;  4U49 A;  4YEJ A;  1H80 A;  4XN3 A;  4URR A;  1RWR A;  2J8I A;  3ML3 A;  2PEC A;  2XTX A;  4Z05 A;  3VSV A;  1DBO A;  2INV A;  2QY1 A;  2BM7 A;  3GQ9 A;  2VFQ A;  4W8Q A;  1QJV A;  1QQ1 A;  1OGM X;  3N6Z A;  1HG8 A;  1PXZ A;  1LM1 A;  2B0R A;  4XKW A;  1O8I A;  1IB4 A;  1NHC A;  2VBK A;  2VJI A;  1QRC A;  3B4N A;  1EA0 A;  1O8E A;  2Z8G A;  5DNS A;  4NK6 A;  1K8F A;  3LMW A;  4OJ6 A;  1JRG A;  1EE6 A;  1O8G A;  4W8S A;  5C1E A;  3SZE A;  1OOC A;  1TYU A;  3VST A;  1QA3 A;  2YUH A;  3AK5 A;  3SYJ A;  2VBM A;  4W8R A;  2NSP A;  1IA5 A;  2G0Y A;  4JRA C;  2F3L A;  3ZSC A;  1WMR A;  5C1C A;  2IQ7 A;  3PSZ A;  1KCD A;  4OZZ A;  4OJ5 A;  1PE9 A;  3EQN A; 
#chains in the Genus database with same CATH homology
 2QZA A;  2J8K A;  2QYU A;  2XTW A;  4YDT A;  3SY2 A;  5DNS A;  3SQV A;  2XT2 A;  3NB2 A;  3NAW A;  4YC5 A;  4YCQ A;  3PSS A;  2XTY A;  2O6W A;  3DU1 X;  4YFO A;  2XT4 A;  4YEI A;  3PSZ A;  2XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...