2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
2XT2A 2J8KA 5DNSA 3NB2A 2XTXA 3SY2A 2QYUA 3NAWA 2O6WA 2XT4A 3PSSA 2QZAA 4YDTA 3PSZA 4YC5A 2XTYA 4YEIA 4YFOA 3DU1X 2XTWA 3SQVA 4YCQA
chains in the Genus database with same CATH superfamily
2X6XA 2O0WA 2O1DA 3TH0A 4OM9A 4YEJA 2YUHA 3ML3A 4XKVA 2NT6A 4PMHA 1O8LA 1K8FA 1DABA 2QX3A 4YZAA 2X85A 4XR6A 2X6YA 2X3HA 1O8EA 2NTBA 3NAWA 3LMWA 1WMRA 1BHEA 2NT9A 2XT4A 4XLAA 4OJPA 4YZXA 2BM5A 1XG2A 4XL9A 1QA2A 1LLZA 2X6WA 1O8FA 1OGOX 3JURA 4W8RA 2VFPA 3GQAA 2IOUG 2VFMA 4KH3A 1QJVA 1IB4A 1OOCA 2INUA 4OZYA 1O88A 3AK5A 1DBGA 2B0RA 2XTWA 1LM1A 1BN8A 2NZMA 4NK8A 3SQVA 3ZSCA 2PYGA 3EQNA 3VMWA 3VSTA 2J8KA 3GRHA 1L1IA 2VJIA 4W8SA 1K4ZA 1QCXA 1VBLA 3B90A 2BM4A 1OFLA 4EW9A 3FY3A 2PYHA 2XTXA 3GQ8A 2W7ZA 4XLEA 2G0YA 4MR0A 3N90A 2NTPA 2QXZA 3PSSA 3JX8A 4Z06A 1IDKA 2BSPA 1KQ5A 2XC1A 4XNFA 2INVA 1GQ8A 1H80A 3SYJA 2Z8GA 1HG8A 1OFDA 4XLFA 2O0VA 4MXNA 4YFOA 1QRCA 3DU1X 4JRAC 1KCCA 1RMGA 2QY1A 1O8KA 3VMVA 1LLWA 2PECA 1PXZA 1EE6A 1NHCA 3SZEA 3LJYA 2VBEA 4W8TA 4XOTA 4YELA 5C1EA 1DBOA 3B8YA 1RWRA 3NB2A 4U4BA 4Z03A 1QA3A 2UVFA 2VFNA 4AVZA 4W8QA 4OJ5A 4XMYA 1HF2A 2O6WA 1CLWA 4XKWA 1X0CA 2ODLA 4XLHA 2UVEA 1O8HA 1O8JA 2V5IA 2NSTA 4XN3A 2O04A 4YC5A 4XLCA 1WXRA 1K5CA 4U49A 2O17A 3WWGA 1TYUA 1TYWA 4XQFA 3T9GA 4XORA 1PLUA 2BM7A 1OFMA 4OJOA 2NSPA 1JTAA 5C1CA 3BH7B 4YZQA 1TYXA 3B4NA 3VSUA 1QQ1A 4XONA 2XT2A 1EA0A 4OZZA 5AMVA 3PETA 1CZFA 3VSVA 3GQ7A 1OGMX 1KTWA 3LYCA 5DNSA 1RU4A 3RIQA 2VFOA 1JRGA 2IQ7A 2NTQA 3P4GA 2BX6A 1OFEA 1AIRA 3SY2A 4HWVA 2QYUA 5JMCB 2VFQA 4I84A 3GQ9A 2QZAA 4XM3A 4YDTA 3ZPPA 1TSPA 4V02C 2F3LA 1O8DA 4OJLA 4NK6A 1QRBA 3PSZA 3KRGA 4XOPA 5JLVC 2J8IA 1QA1A 1IDJA 3EQOA 1O8IA 2XTYA 1TYVA 2VBMA 4YZ0A 3SUCA 1KCDA 1PE9A 4OJ6A 4YEIA 4URRA 3N6ZA 3UW0A 2BM6A 1O8MA 3BH6B 1O8GA 4C2LA 4OPWA 3H09A 4XN0A 4Z05A 2VBKA 2VJJA 1EZGA 4YCQA 1IA5A 2EWEA
chains in the Genus database with same CATH topology
2XT2A 2J8KA 5DNSA 3NB2A 2XTXA 3SY2A 2QYUA 3NAWA 2O6WA 2XT4A 3PSSA 2QZAA 4YDTA 3PSZA 4YC5A 2XTYA 4YEIA 4YFOA 3DU1X 2XTWA 3SQVA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT2 A;  2J8K A;  5DNS A;  3NB2 A;  2XTX A;  3SY2 A;  2QYU A;  3NAW A;  2O6W A;  2XT4 A;  3PSS A;  2QZA A;  4YDT A;  3PSZ A;  4YC5 A;  2XTY A;  4YEI A;  4YFO A;  3DU1 X;  2XTW A;  3SQV A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 2X6X A;  2O0W A;  2O1D A;  3TH0 A;  4OM9 A;  4YEJ A;  2YUH A;  3ML3 A;  4XKV A;  2NT6 A;  4PMH A;  1O8L A;  1K8F A;  1DAB A;  2QX3 A;  4YZA A;  2X85 A;  4XR6 A;  2X6Y A;  2X3H A;  1O8E A;  2NTB A;  3NAW A;  3LMW A;  1WMR A;  1BHE A;  2NT9 A;  2XT4 A;  4XLA A;  4OJP A;  4YZX A;  2BM5 A;  1XG2 A;  4XL9 A;  1QA2 A;  1LLZ A;  2X6W A;  1O8F A;  1OGO X;  3JUR A;  4W8R A;  2VFP A;  3GQA A;  2IOU G;  2VFM A;  4KH3 A;  1QJV A;  1IB4 A;  1OOC A;  2INU A;  4OZY A;  1O88 A;  3AK5 A;  1DBG A;  2B0R A;  2XTW A;  1LM1 A;  1BN8 A;  2NZM A;  4NK8 A;  3SQV A;  3ZSC A;  2PYG A;  3EQN A;  3VMW A;  3VST A;  2J8K A;  3GRH A;  1L1I A;  2VJI A;  4W8S A;  1K4Z A;  1QCX A;  1VBL A;  3B90 A;  2BM4 A;  1OFL A;  4EW9 A;  3FY3 A;  2PYH A;  2XTX A;  3GQ8 A;  2W7Z A;  4XLE A;  2G0Y A;  4MR0 A;  3N90 A;  2NTP A;  2QXZ A;  3PSS A;  3JX8 A;  4Z06 A;  1IDK A;  2BSP A;  1KQ5 A;  2XC1 A;  4XNF A;  2INV A;  1GQ8 A;  1H80 A;  3SYJ A;  2Z8G A;  1HG8 A;  1OFD A;  4XLF A;  2O0V A;  4MXN A;  4YFO A;  1QRC A;  3DU1 X;  4JRA C;  1KCC A;  1RMG A;  2QY1 A;  1O8K A;  3VMV A;  1LLW A;  2PEC A;  1PXZ A;  1EE6 A;  1NHC A;  3SZE A;  3LJY A;  2VBE A;  4W8T A;  4XOT A;  4YEL A;  5C1E A;  1DBO A;  3B8Y A;  1RWR A;  3NB2 A;  4U4B A;  4Z03 A;  1QA3 A;  2UVF A;  2VFN A;  4AVZ A;  4W8Q A;  4OJ5 A;  4XMY A;  1HF2 A;  2O6W A;  1CLW A;  4XKW A;  1X0C A;  2ODL A;  4XLH A;  2UVE A;  1O8H A;  1O8J A;  2V5I A;  2NST A;  4XN3 A;  2O04 A;  4YC5 A;  4XLC A;  1WXR A;  1K5C A;  4U49 A;  2O17 A;  3WWG A;  1TYU A;  1TYW A;  4XQF A;  3T9G A;  4XOR A;  1PLU A;  2BM7 A;  1OFM A;  4OJO A;  2NSP A;  1JTA A;  5C1C A;  3BH7 B;  4YZQ A;  1TYX A;  3B4N A;  3VSU A;  1QQ1 A;  4XON A;  2XT2 A;  1EA0 A;  4OZZ A;  5AMV A;  3PET A;  1CZF A;  3VSV A;  3GQ7 A;  1OGM X;  1KTW A;  3LYC A;  5DNS A;  1RU4 A;  3RIQ A;  2VFO A;  1JRG A;  2IQ7 A;  2NTQ A;  3P4G A;  2BX6 A;  1OFE A;  1AIR A;  3SY2 A;  4HWV A;  2QYU A;  5JMC B;  2VFQ A;  4I84 A;  3GQ9 A;  2QZA A;  4XM3 A;  4YDT A;  3ZPP A;  1TSP A;  4V02 C;  2F3L A;  1O8D A;  4OJL A;  4NK6 A;  1QRB A;  3PSZ A;  3KRG A;  4XOP A;  5JLV C;  2J8I A;  1QA1 A;  1IDJ A;  3EQO A;  1O8I A;  2XTY A;  1TYV A;  2VBM A;  4YZ0 A;  3SUC A;  1KCD A;  1PE9 A;  4OJ6 A;  4YEI A;  4URR A;  3N6Z A;  3UW0 A;  2BM6 A;  1O8M A;  3BH6 B;  1O8G A;  4C2L A;  4OPW A;  3H09 A;  4XN0 A;  4Z05 A;  2VBK A;  2VJJ A;  1EZG A;  4YCQ A;  1IA5 A;  2EWE A; 
#chains in the Genus database with same CATH homology
 2XT2 A;  2J8K A;  5DNS A;  3NB2 A;  2XTX A;  3SY2 A;  2QYU A;  3NAW A;  2O6W A;  2XT4 A;  3PSS A;  2QZA A;  4YDT A;  3PSZ A;  4YC5 A;  2XTY A;  4YEI A;  4YFO A;  3DU1 X;  2XTW A;  3SQV A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...