2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
2XTYA 2QZAA 4YDTA 3DU1X 2XT2A 3NB2A 2XTXA 4YEIA 3SQVA 5DNSA 4YC5A 2QYUA 3PSZA 2O6WA 4YCQA 3NAWA 2XTWA 3SY2A 3PSSA 2J8KA 2XT4A 4YFOA
chains in the Genus database with same CATH superfamily
4YZAA 2QX3A 4V02C 4XORA 4U4BA 4URRA 2O04A 1OFEA 2NTQA 1KTWA 2O0WA 1K8FA 1KCCA 4YDTA 4I84A 4YELA 2G0YA 1BN8A 1OFMA 1OGMX 1O8EA 2IOUG 2X3HA 4YEJA 4OJPA 4XN0A 1PXZA 1TYWA 3ML3A 1OGOX 1IA5A 1RU4A 1TYVA 4Z03A 4OM9A 4XKVA 1DBGA 3ZPPA 1KQ5A 3GQAA 4XLCA 3WWGA 1LM1A 2VFOA 3KRGA 4OJOA 4YC5A 4AVZA 1WMRA 4OJ6A 3N6ZA 2O6WA 4XQFA 4XLFA 1O8MA 5AMVA 4NK8A 2ODLA 1HF2A 3T9GA 1JTAA 1O8IA 4YZ0A 1O8FA 3JURA 4OZYA 3VSUA 1O8JA 2BM5A 2INVA 3SUCA 1K5CA 4Z05A 1NHCA 2QXZA 1RMGA 1QQ1A 2VFQA 1QA3A 2B0RA 2X6WA 2INUA 3VMVA 1TYUA 4XR6A 3DU1X 3VMWA 1WXRA 2PECA 2VJIA 3LYCA 2NSPA 2XTXA 4XN3A 1TSPA 3SYJA 4YEIA 3SQVA 3GQ7A 2X85A 4NK6A 1QCXA 1O8GA 3GQ9A 3B90A 2PYHA 2W7ZA 4PMHA 2NSTA 1RWRA 4YCQA 2F3LA 2Z8GA 4XM3A 5JLVC 1O8DA 4KH3A 1H80A 2VJJA 3ZSCA 1QA1A 3B8YA 1O8HA 4MR0A 2IQ7A 1BHEA 1OOCA 2UVEA 2XT4A 2NZMA 1DBOA 2VFPA 2VBMA 3H09A 1OFLA 5C1CA 4XKWA 2QZAA 2BM7A 1HG8A 4W8TA 2BM4A 1AIRA 4W8QA 3AK5A 3NB2A 3UW0A 1O88A 2BSPA 4XOPA 1PE9A 2XC1A 1DABA 1O8LA 1QRCA 1IDKA 1TYXA 3LMWA 2VBKA 2J8IA 3B4NA 3BH7B 3VSTA 4OZZA 2X6YA 2YUHA 1PLUA 1K4ZA 4XLHA 3SZEA 2O1DA 2VFMA 3EQOA 3EQNA 3VSVA 4W8SA 4C2LA 3NAWA 2NT9A 2EWEA 3RIQA 1XG2A 1L1IA 4MXNA 3SY2A 2BM6A 1IDJA 1EZGA 3PSSA 2VFNA 1KCDA 2UVFA 2O0VA 4W8RA 4YFOA 1JRGA 1CLWA 4YZXA 5JMCB 2XTYA 3PETA 4EW9A 4XLAA 4YZQA 2PYGA 2V5IA 4XLEA 2BX6A 2XT2A 3BH6B 3GQ8A 3LJYA 2NTBA 1GQ8A 1LLWA 1EE6A 1X0CA 1LLZA 1OFDA 1QJVA 3TH0A 3JX8A 4OJLA 5DNSA 2O17A 2NTPA 1VBLA 4JRAC 3P4GA 2X6XA 2VBEA 4XONA 4XL9A 1IB4A 5C1EA 2QYUA 4XOTA 1EA0A 3PSZA 1O8KA 1QA2A 4XNFA 4XMYA 4U49A 2XTWA 2QY1A 2NT6A 4OPWA 1CZFA 3GRHA 1QRBA 4OJ5A 2J8KA 4HWVA 4Z06A 3N90A 3FY3A
chains in the Genus database with same CATH topology
2XTYA 2QZAA 4YDTA 3DU1X 2XT2A 3NB2A 2XTXA 4YEIA 3SQVA 5DNSA 4YC5A 2QYUA 3PSZA 2O6WA 4YCQA 3NAWA 2XTWA 3SY2A 3PSSA 2J8KA 2XT4A 4YFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTY A;  2QZA A;  4YDT A;  3DU1 X;  2XT2 A;  3NB2 A;  2XTX A;  4YEI A;  3SQV A;  5DNS A;  4YC5 A;  2QYU A;  3PSZ A;  2O6W A;  4YCQ A;  3NAW A;  2XTW A;  3SY2 A;  3PSS A;  2J8K A;  2XT4 A;  4YFO A; 
#chains in the Genus database with same CATH topology
 4YZA A;  2QX3 A;  4V02 C;  4XOR A;  4U4B A;  4URR A;  2O04 A;  1OFE A;  2NTQ A;  1KTW A;  2O0W A;  1K8F A;  1KCC A;  4YDT A;  4I84 A;  4YEL A;  2G0Y A;  1BN8 A;  1OFM A;  1OGM X;  1O8E A;  2IOU G;  2X3H A;  4YEJ A;  4OJP A;  4XN0 A;  1PXZ A;  1TYW A;  3ML3 A;  1OGO X;  1IA5 A;  1RU4 A;  1TYV A;  4Z03 A;  4OM9 A;  4XKV A;  1DBG A;  3ZPP A;  1KQ5 A;  3GQA A;  4XLC A;  3WWG A;  1LM1 A;  2VFO A;  3KRG A;  4OJO A;  4YC5 A;  4AVZ A;  1WMR A;  4OJ6 A;  3N6Z A;  2O6W A;  4XQF A;  4XLF A;  1O8M A;  5AMV A;  4NK8 A;  2ODL A;  1HF2 A;  3T9G A;  1JTA A;  1O8I A;  4YZ0 A;  1O8F A;  3JUR A;  4OZY A;  3VSU A;  1O8J A;  2BM5 A;  2INV A;  3SUC A;  1K5C A;  4Z05 A;  1NHC A;  2QXZ A;  1RMG A;  1QQ1 A;  2VFQ A;  1QA3 A;  2B0R A;  2X6W A;  2INU A;  3VMV A;  1TYU A;  4XR6 A;  3DU1 X;  3VMW A;  1WXR A;  2PEC A;  2VJI A;  3LYC A;  2NSP A;  2XTX A;  4XN3 A;  1TSP A;  3SYJ A;  4YEI A;  3SQV A;  3GQ7 A;  2X85 A;  4NK6 A;  1QCX A;  1O8G A;  3GQ9 A;  3B90 A;  2PYH A;  2W7Z A;  4PMH A;  2NST A;  1RWR A;  4YCQ A;  2F3L A;  2Z8G A;  4XM3 A;  5JLV C;  1O8D A;  4KH3 A;  1H80 A;  2VJJ A;  3ZSC A;  1QA1 A;  3B8Y A;  1O8H A;  4MR0 A;  2IQ7 A;  1BHE A;  1OOC A;  2UVE A;  2XT4 A;  2NZM A;  1DBO A;  2VFP A;  2VBM A;  3H09 A;  1OFL A;  5C1C A;  4XKW A;  2QZA A;  2BM7 A;  1HG8 A;  4W8T A;  2BM4 A;  1AIR A;  4W8Q A;  3AK5 A;  3NB2 A;  3UW0 A;  1O88 A;  2BSP A;  4XOP A;  1PE9 A;  2XC1 A;  1DAB A;  1O8L A;  1QRC A;  1IDK A;  1TYX A;  3LMW A;  2VBK A;  2J8I A;  3B4N A;  3BH7 B;  3VST A;  4OZZ A;  2X6Y A;  2YUH A;  1PLU A;  1K4Z A;  4XLH A;  3SZE A;  2O1D A;  2VFM A;  3EQO A;  3EQN A;  3VSV A;  4W8S A;  4C2L A;  3NAW A;  2NT9 A;  2EWE A;  3RIQ A;  1XG2 A;  1L1I A;  4MXN A;  3SY2 A;  2BM6 A;  1IDJ A;  1EZG A;  3PSS A;  2VFN A;  1KCD A;  2UVF A;  2O0V A;  4W8R A;  4YFO A;  1JRG A;  1CLW A;  4YZX A;  5JMC B;  2XTY A;  3PET A;  4EW9 A;  4XLA A;  4YZQ A;  2PYG A;  2V5I A;  4XLE A;  2BX6 A;  2XT2 A;  3BH6 B;  3GQ8 A;  3LJY A;  2NTB A;  1GQ8 A;  1LLW A;  1EE6 A;  1X0C A;  1LLZ A;  1OFD A;  1QJV A;  3TH0 A;  3JX8 A;  4OJL A;  5DNS A;  2O17 A;  2NTP A;  1VBL A;  4JRA C;  3P4G A;  2X6X A;  2VBE A;  4XON A;  4XL9 A;  1IB4 A;  5C1E A;  2QYU A;  4XOT A;  1EA0 A;  3PSZ A;  1O8K A;  1QA2 A;  4XNF A;  4XMY A;  4U49 A;  2XTW A;  2QY1 A;  2NT6 A;  4OPW A;  1CZF A;  3GRH A;  1QRB A;  4OJ5 A;  2J8K A;  4HWV A;  4Z06 A;  3N90 A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 2XTY A;  2QZA A;  4YDT A;  3DU1 X;  2XT2 A;  3NB2 A;  2XTX A;  4YEI A;  3SQV A;  5DNS A;  4YC5 A;  2QYU A;  3PSZ A;  2O6W A;  4YCQ A;  3NAW A;  2XTW A;  3SY2 A;  3PSS A;  2J8K A;  2XT4 A;  4YFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...