2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
2J8KA 3NAWA 2XTYA 4YDTA 2XT2A 3SY2A 2QZAA 3SQVA 2XT4A 4YCQA 3PSZA 3PSSA 4YEIA 4YFOA 3DU1X 4YC5A 2QYUA 2O6WA 5DNSA 2XTXA 2XTWA 3NB2A
chains in the Genus database with same CATH superfamily
2J8KA 1EZGA 4V02C 4Z03A 2XTYA 3VMVA 4XQFA 1QA2A 2X3HA 2XT2A 1TSPA 2UVFA 3FY3A 2BM6A 4OJLA 2NT9A 4OJ5A 2INVA 3LMWA 4URRA 3ZPPA 2PYGA 4YCQA 1BN8A 1KQ5A 1K5CA 3LJYA 4W8SA 2QX3A 2VBMA 2VFPA 4YC5A 1KCDA 2XC1A 2IQ7A 4JRAC 4OZZA 1QA1A 1WMRA 2INUA 1QQ1A 3T9GA 2BM5A 2BX6A 2O0VA 4YZ0A 1QRCA 2QXZA 1K4ZA 2XTWA 1EA0A 1GQ8A 4XONA 1O8HA 1DBGA 2B0RA 2X6WA 2QY1A 2NTPA 4XM3A 1QA3A 1KCCA 4XORA 1AIRA 4W8QA 4YEJA 2EWEA 1L1IA 5JLVC 4XMYA 4I84A 3B90A 1OFDA 3SUCA 3VSUA 1PXZA 1QJVA 3EQOA 1XG2A 3SY2A 2BM7A 1O8JA 1RWRA 2VFQA 2NT6A 3TH0A 3VSTA 1O8DA 4W8TA 4XOPA 1H80A 2O1DA 1OFLA 1HF2A 2X85A 4XR6A 1EE6A 1HG8A 3B8YA 4XN0A 3GQAA 4OPWA 2O6WA 1OOCA 3AK5A 2G0YA 1O8LA 3JX8A 4HWVA 3GRHA 4EW9A 2VJJA 2VFNA 4YZQA 2VBKA 4KH3A 1LM1A 1DABA 3UW0A 1JRGA 1X0CA 1RMGA 1OGMX 1TYWA 2O04A 2PECA 3H09A 4XKVA 4Z06A 3WWGA 4OZYA 1TYXA 3NAWA 1O8IA 1OFEA 2NTQA 2UVEA 4NK8A 2VJIA 1O8MA 2O17A 2QZAA 1LLZA 2YUHA 3ML3A 3SQVA 1K8FA 3PSSA 4Z05A 4YEIA 4YFOA 3DU1X 1O8GA 1CLWA 1JTAA 2QYUA 3P4GA 2BSPA 4XLFA 4U49A 4MR0A 3N6ZA 4XL9A 3SZEA 2W7ZA 2X6XA 3SYJA 1BHEA 5AMVA 5C1EA 4AVZA 1IDJA 2V5IA 1TYVA 1LLWA 3N90A 3GQ7A 3EQNA 1KTWA 1NHCA 3B4NA 2XT4A 3NB2A 1QRBA 1OGOX 2NTBA 1TYUA 2X6YA 3GQ9A 4W8RA 2F3LA 3BH7B 1RU4A 4YZXA 4YDTA 4PMHA 4XOTA 3JURA 2IOUG 2VFMA 3VMWA 2J8IA 4YELA 2NSPA 4XLEA 2ODLA 4XN3A 2NSTA 4XLHA 1IA5A 3PETA 3GQ8A 5JMCB 1PE9A 3PSZA 1PLUA 2BM4A 1IB4A 1IDKA 4YZAA 1O8EA 1OFMA 2VBEA 4OM9A 4XKWA 1O8FA 3RIQA 3ZSCA 4OJOA 2PYHA 2VFOA 1O88A 3KRGA 4OJ6A 5DNSA 4MXNA 3LYCA 3BH6B 5C1CA 1QCXA 2XTXA 4XLCA 4OJPA 4XLAA 2NZMA 1O8KA 1VBLA 4U4BA 2O0WA 4C2LA 1WXRA 3VSVA 1DBOA 4NK6A 2Z8GA 4XNFA 1CZFA
chains in the Genus database with same CATH topology
2J8KA 3NAWA 2XTYA 4YDTA 2XT2A 3SY2A 2QZAA 3SQVA 2XT4A 4YCQA 3PSZA 3PSSA 4YEIA 4YFOA 3DU1X 4YC5A 2QYUA 2O6WA 5DNSA 2XTXA 2XTWA 3NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8K A;  3NAW A;  2XTY A;  4YDT A;  2XT2 A;  3SY2 A;  2QZA A;  3SQV A;  2XT4 A;  4YCQ A;  3PSZ A;  3PSS A;  4YEI A;  4YFO A;  3DU1 X;  4YC5 A;  2QYU A;  2O6W A;  5DNS A;  2XTX A;  2XTW A;  3NB2 A; 
#chains in the Genus database with same CATH topology
 2J8K A;  1EZG A;  4V02 C;  4Z03 A;  2XTY A;  3VMV A;  4XQF A;  1QA2 A;  2X3H A;  2XT2 A;  1TSP A;  2UVF A;  3FY3 A;  2BM6 A;  4OJL A;  2NT9 A;  4OJ5 A;  2INV A;  3LMW A;  4URR A;  3ZPP A;  2PYG A;  4YCQ A;  1BN8 A;  1KQ5 A;  1K5C A;  3LJY A;  4W8S A;  2QX3 A;  2VBM A;  2VFP A;  4YC5 A;  1KCD A;  2XC1 A;  2IQ7 A;  4JRA C;  4OZZ A;  1QA1 A;  1WMR A;  2INU A;  1QQ1 A;  3T9G A;  2BM5 A;  2BX6 A;  2O0V A;  4YZ0 A;  1QRC A;  2QXZ A;  1K4Z A;  2XTW A;  1EA0 A;  1GQ8 A;  4XON A;  1O8H A;  1DBG A;  2B0R A;  2X6W A;  2QY1 A;  2NTP A;  4XM3 A;  1QA3 A;  1KCC A;  4XOR A;  1AIR A;  4W8Q A;  4YEJ A;  2EWE A;  1L1I A;  5JLV C;  4XMY A;  4I84 A;  3B90 A;  1OFD A;  3SUC A;  3VSU A;  1PXZ A;  1QJV A;  3EQO A;  1XG2 A;  3SY2 A;  2BM7 A;  1O8J A;  1RWR A;  2VFQ A;  2NT6 A;  3TH0 A;  3VST A;  1O8D A;  4W8T A;  4XOP A;  1H80 A;  2O1D A;  1OFL A;  1HF2 A;  2X85 A;  4XR6 A;  1EE6 A;  1HG8 A;  3B8Y A;  4XN0 A;  3GQA A;  4OPW A;  2O6W A;  1OOC A;  3AK5 A;  2G0Y A;  1O8L A;  3JX8 A;  4HWV A;  3GRH A;  4EW9 A;  2VJJ A;  2VFN A;  4YZQ A;  2VBK A;  4KH3 A;  1LM1 A;  1DAB A;  3UW0 A;  1JRG A;  1X0C A;  1RMG A;  1OGM X;  1TYW A;  2O04 A;  2PEC A;  3H09 A;  4XKV A;  4Z06 A;  3WWG A;  4OZY A;  1TYX A;  3NAW A;  1O8I A;  1OFE A;  2NTQ A;  2UVE A;  4NK8 A;  2VJI A;  1O8M A;  2O17 A;  2QZA A;  1LLZ A;  2YUH A;  3ML3 A;  3SQV A;  1K8F A;  3PSS A;  4Z05 A;  4YEI A;  4YFO A;  3DU1 X;  1O8G A;  1CLW A;  1JTA A;  2QYU A;  3P4G A;  2BSP A;  4XLF A;  4U49 A;  4MR0 A;  3N6Z A;  4XL9 A;  3SZE A;  2W7Z A;  2X6X A;  3SYJ A;  1BHE A;  5AMV A;  5C1E A;  4AVZ A;  1IDJ A;  2V5I A;  1TYV A;  1LLW A;  3N90 A;  3GQ7 A;  3EQN A;  1KTW A;  1NHC A;  3B4N A;  2XT4 A;  3NB2 A;  1QRB A;  1OGO X;  2NTB A;  1TYU A;  2X6Y A;  3GQ9 A;  4W8R A;  2F3L A;  3BH7 B;  1RU4 A;  4YZX A;  4YDT A;  4PMH A;  4XOT A;  3JUR A;  2IOU G;  2VFM A;  3VMW A;  2J8I A;  4YEL A;  2NSP A;  4XLE A;  2ODL A;  4XN3 A;  2NST A;  4XLH A;  1IA5 A;  3PET A;  3GQ8 A;  5JMC B;  1PE9 A;  3PSZ A;  1PLU A;  2BM4 A;  1IB4 A;  1IDK A;  4YZA A;  1O8E A;  1OFM A;  2VBE A;  4OM9 A;  4XKW A;  1O8F A;  3RIQ A;  3ZSC A;  4OJO A;  2PYH A;  2VFO A;  1O88 A;  3KRG A;  4OJ6 A;  5DNS A;  4MXN A;  3LYC A;  3BH6 B;  5C1C A;  1QCX A;  2XTX A;  4XLC A;  4OJP A;  4XLA A;  2NZM A;  1O8K A;  1VBL A;  4U4B A;  2O0W A;  4C2L A;  1WXR A;  3VSV A;  1DBO A;  4NK6 A;  2Z8G A;  4XNF A;  1CZF A; 
#chains in the Genus database with same CATH homology
 2J8K A;  3NAW A;  2XTY A;  4YDT A;  2XT2 A;  3SY2 A;  2QZA A;  3SQV A;  2XT4 A;  4YCQ A;  3PSZ A;  3PSS A;  4YEI A;  4YFO A;  3DU1 X;  4YC5 A;  2QYU A;  2O6W A;  5DNS A;  2XTX A;  2XTW A;  3NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...