2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
4YEIA 2XT4A 2O6WA 2XTXA 4YFOA 2XT2A 3SY2A 4YC5A 3DU1X 2XTWA 3NAWA 3PSSA 2QZAA 2XTYA 2J8KA 4YDTA 5DNSA 3SQVA 2QYUA 3NB2A 3PSZA 4YCQA
chains in the Genus database with same CATH superfamily
2V5IA 2XT4A 3GQ8A 1KQ5A 2INUA 2X85A 2VBKA 2NSTA 2X3HA 3T9GA 2BM6A 3UW0A 2O6WA 1QRBA 1HF2A 3H09A 3VSUA 1L1IA 4NK6A 2BM4A 1OOCA 4YFOA 4XLAA 1O8FA 3EQNA 1PXZA 3SUCA 2NT6A 4XLCA 1OFLA 4W8TA 1GQ8A 2XT2A 2VFMA 3JX8A 4OPWA 2IOUG 1CLWA 2QX3A 4XN0A 5C1CA 4XM3A 1KCDA 1O8HA 4XR6A 2VJIA 3GQ9A 4W8SA 4OZYA 1QA3A 4KH3A 2NTBA 1LLZA 4XMYA 4YDTA 1LLWA 1JTAA 2EWEA 1BN8A 4XORA 2NT9A 2QYUA 3NB2A 3LYCA 2NTPA 4XLHA 1RMGA 3GRHA 1TYVA 2G0YA 3ZPPA 2VBMA 1AIRA 1IDKA 2NZMA 2VFPA 4OJLA 1WMRA 1IA5A 1OGMX 1IDJA 3KRGA 4V02C 1O88A 4YEJA 2O0WA 2VBEA 4XKVA 1PLUA 4YZ0A 2BM7A 2ODLA 1RWRA 3BH7B 1O8KA 1TSPA 2B0RA 4NK8A 1PE9A 2PECA 2VFOA 4XOPA 1O8IA 3DU1X 4PMHA 3EQOA 4XLEA 1K4ZA 3NAWA 3PSSA 4MXNA 1VBLA 2PYGA 2Z8GA 3PETA 3B4NA 2YUHA 3RIQA 1RU4A 4Z05A 3GQ7A 4OJ5A 1EZGA 1O8JA 1DBGA 2VFNA 3P4GA 3SZEA 3VSVA 3PSZA 2X6XA 3VMWA 4EW9A 2W7ZA 4Z06A 4XQFA 1TYUA 1QQ1A 4U4BA 2X6YA 1OFDA 3ML3A 1X0CA 1O8DA 1O8MA 1OGOX 1OFEA 2PYHA 4XOTA 2J8IA 4W8RA 2O0VA 4XNFA 3VMVA 5C1EA 1CZFA 2NSPA 4YZQA 2VFQA 3SY2A 2UVEA 4C2LA 1QA2A 2XTWA 4OJOA 4XLFA 1QA1A 1WXRA 1K5CA 4W8QA 3LJYA 1EA0A 1DABA 2BSPA 3GQAA 4I84A 3B8YA 2IQ7A 4JRAC 1BHEA 4OZZA 1QCXA 3FY3A 1QRCA 1XG2A 1HG8A 2X6WA 4YELA 3B90A 1LM1A 4YEIA 4Z03A 1EE6A 1K8FA 1O8EA 3VSTA 2BM5A 3N90A 4OJ6A 3WWGA 4MR0A 4URRA 5AMVA 1O8GA 2XTXA 3ZSCA 1KCCA 1NHCA 5JLVC 3LMWA 4AVZA 2BX6A 2O04A 3BH6B 5JMCB 1TYXA 2INVA 2QXZA 2QY1A 4OM9A 4XL9A 2VJJA 2F3LA 4XKWA 4XN3A 2XC1A 3AK5A 1H80A 1QJVA 4YC5A 1JRGA 1OFMA 1IB4A 4YZAA 1KTWA 1DBOA 1TYWA 2NTQA 2QZAA 4OJPA 2XTYA 3SYJA 2J8KA 2O1DA 3TH0A 2O17A 1O8LA 4U49A 3N6ZA 4XONA 5DNSA 3SQVA 4YZXA 4HWVA 2UVFA 4YCQA 3JURA
chains in the Genus database with same CATH topology
4YEIA 2XT4A 2O6WA 2XTXA 4YFOA 2XT2A 3SY2A 4YC5A 3DU1X 2XTWA 3NAWA 3PSSA 2QZAA 2XTYA 2J8KA 4YDTA 5DNSA 3SQVA 2QYUA 3NB2A 3PSZA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEI A;  2XT4 A;  2O6W A;  2XTX A;  4YFO A;  2XT2 A;  3SY2 A;  4YC5 A;  3DU1 X;  2XTW A;  3NAW A;  3PSS A;  2QZA A;  2XTY A;  2J8K A;  4YDT A;  5DNS A;  3SQV A;  2QYU A;  3NB2 A;  3PSZ A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 2V5I A;  2XT4 A;  3GQ8 A;  1KQ5 A;  2INU A;  2X85 A;  2VBK A;  2NST A;  2X3H A;  3T9G A;  2BM6 A;  3UW0 A;  2O6W A;  1QRB A;  1HF2 A;  3H09 A;  3VSU A;  1L1I A;  4NK6 A;  2BM4 A;  1OOC A;  4YFO A;  4XLA A;  1O8F A;  3EQN A;  1PXZ A;  3SUC A;  2NT6 A;  4XLC A;  1OFL A;  4W8T A;  1GQ8 A;  2XT2 A;  2VFM A;  3JX8 A;  4OPW A;  2IOU G;  1CLW A;  2QX3 A;  4XN0 A;  5C1C A;  4XM3 A;  1KCD A;  1O8H A;  4XR6 A;  2VJI A;  3GQ9 A;  4W8S A;  4OZY A;  1QA3 A;  4KH3 A;  2NTB A;  1LLZ A;  4XMY A;  4YDT A;  1LLW A;  1JTA A;  2EWE A;  1BN8 A;  4XOR A;  2NT9 A;  2QYU A;  3NB2 A;  3LYC A;  2NTP A;  4XLH A;  1RMG A;  3GRH A;  1TYV A;  2G0Y A;  3ZPP A;  2VBM A;  1AIR A;  1IDK A;  2NZM A;  2VFP A;  4OJL A;  1WMR A;  1IA5 A;  1OGM X;  1IDJ A;  3KRG A;  4V02 C;  1O88 A;  4YEJ A;  2O0W A;  2VBE A;  4XKV A;  1PLU A;  4YZ0 A;  2BM7 A;  2ODL A;  1RWR A;  3BH7 B;  1O8K A;  1TSP A;  2B0R A;  4NK8 A;  1PE9 A;  2PEC A;  2VFO A;  4XOP A;  1O8I A;  3DU1 X;  4PMH A;  3EQO A;  4XLE A;  1K4Z A;  3NAW A;  3PSS A;  4MXN A;  1VBL A;  2PYG A;  2Z8G A;  3PET A;  3B4N A;  2YUH A;  3RIQ A;  1RU4 A;  4Z05 A;  3GQ7 A;  4OJ5 A;  1EZG A;  1O8J A;  1DBG A;  2VFN A;  3P4G A;  3SZE A;  3VSV A;  3PSZ A;  2X6X A;  3VMW A;  4EW9 A;  2W7Z A;  4Z06 A;  4XQF A;  1TYU A;  1QQ1 A;  4U4B A;  2X6Y A;  1OFD A;  3ML3 A;  1X0C A;  1O8D A;  1O8M A;  1OGO X;  1OFE A;  2PYH A;  4XOT A;  2J8I A;  4W8R A;  2O0V A;  4XNF A;  3VMV A;  5C1E A;  1CZF A;  2NSP A;  4YZQ A;  2VFQ A;  3SY2 A;  2UVE A;  4C2L A;  1QA2 A;  2XTW A;  4OJO A;  4XLF A;  1QA1 A;  1WXR A;  1K5C A;  4W8Q A;  3LJY A;  1EA0 A;  1DAB A;  2BSP A;  3GQA A;  4I84 A;  3B8Y A;  2IQ7 A;  4JRA C;  1BHE A;  4OZZ A;  1QCX A;  3FY3 A;  1QRC A;  1XG2 A;  1HG8 A;  2X6W A;  4YEL A;  3B90 A;  1LM1 A;  4YEI A;  4Z03 A;  1EE6 A;  1K8F A;  1O8E A;  3VST A;  2BM5 A;  3N90 A;  4OJ6 A;  3WWG A;  4MR0 A;  4URR A;  5AMV A;  1O8G A;  2XTX A;  3ZSC A;  1KCC A;  1NHC A;  5JLV C;  3LMW A;  4AVZ A;  2BX6 A;  2O04 A;  3BH6 B;  5JMC B;  1TYX A;  2INV A;  2QXZ A;  2QY1 A;  4OM9 A;  4XL9 A;  2VJJ A;  2F3L A;  4XKW A;  4XN3 A;  2XC1 A;  3AK5 A;  1H80 A;  1QJV A;  4YC5 A;  1JRG A;  1OFM A;  1IB4 A;  4YZA A;  1KTW A;  1DBO A;  1TYW A;  2NTQ A;  2QZA A;  4OJP A;  2XTY A;  3SYJ A;  2J8K A;  2O1D A;  3TH0 A;  2O17 A;  1O8L A;  4U49 A;  3N6Z A;  4XON A;  5DNS A;  3SQV A;  4YZX A;  4HWV A;  2UVF A;  4YCQ A;  3JUR A; 
#chains in the Genus database with same CATH homology
 4YEI A;  2XT4 A;  2O6W A;  2XTX A;  4YFO A;  2XT2 A;  3SY2 A;  4YC5 A;  3DU1 X;  2XTW A;  3NAW A;  3PSS A;  2QZA A;  2XTY A;  2J8K A;  4YDT A;  5DNS A;  3SQV A;  2QYU A;  3NB2 A;  3PSZ A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...