2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
2QZAA 3NB2A 3PSSA 2XT4A 3PSZA 2XTYA 2QYUA 3NAWA 3SY2A 3DU1X 2J8KA 5DNSA 2XT2A 4YEIA 4YFOA 4YC5A 2O6WA 2XTWA 4YCQA 4YDTA 3SQVA 2XTXA
chains in the Genus database with same CATH superfamily
1DBGA 1LLZA 3LMWA 4OJOA 2F3LA 4U4BA 2QY1A 2UVFA 3NB2A 4XOPA 2O1DA 3EQNA 3UW0A 4OJ6A 1PLUA 1XG2A 1LLWA 2XC1A 2O0WA 4PMHA 1O8EA 2BM6A 1JRGA 1VBLA 4OZYA 4XKVA 5AMVA 1DABA 4HWVA 4XORA 4W8SA 5C1EA 3GRHA 1L1IA 2IOUG 4W8QA 1TSPA 1K5CA 1DBOA 3LJYA 4YZXA 4W8RA 3AK5A 1OGOX 4EW9A 1KTWA 4KH3A 1RMGA 2X6XA 3KRGA 4NK8A 2YUHA 1O8HA 1OFDA 4YEIA 1QA3A 1HF2A 2X3HA 2BSPA 2IQ7A 1JTAA 3LYCA 1QQ1A 1OFMA 2XTXA 4XQFA 2O17A 2NSTA 2BX6A 2NTPA 3GQ8A 4YZQA 4OM9A 1TYXA 2NT6A 3RIQA 1TYVA 3PSSA 3TH0A 2XT4A 3GQAA 3PSZA 1O8JA 4Z06A 2BM7A 4V02C 4XLEA 2QYUA 2BM5A 3WWGA 1QA1A 4YEJA 4XLFA 1LM1A 1WXRA 2QXZA 2PYGA 2VBMA 1TYUA 2INVA 1QJVA 4YZ0A 4OJLA 1O8DA 1O8GA 1IA5A 1AIRA 1EZGA 2VBEA 2QX3A 4XL9A 2O6WA 1PXZA 4URRA 4YC5A 4YFOA 3ZSCA 4XMYA 4XLHA 1HG8A 1OGMX 4C2LA 1GQ8A 2NSPA 3H09A 1QRBA 1H80A 3VSUA 4YCQA 2VFPA 4XLCA 3SQVA 2O0VA 4NK6A 3VSVA 4OJ5A 2Z8GA 2PYHA 1O8FA 1CLWA 3SZEA 1EA0A 1TYWA 2INUA 3ML3A 1K4ZA 1OFLA 2XTYA 3PETA 4XM3A 4XKWA 1O8MA 1O8IA 2G0YA 2VJIA 4XOTA 4MR0A 1IDKA 3NAWA 1EE6A 3T9GA 3SUCA 4XONA 2V5IA 3VMWA 5JMCB 4XLAA 3DU1X 3B90A 4XN0A 2VFOA 1BHEA 4AVZA 2VFMA 5DNSA 4OJPA 3B8YA 3GQ7A 1WMRA 1BN8A 2NTQA 4XNFA 3EQOA 1O8KA 2X6YA 1QRCA 3JURA 2UVEA 4W8TA 3VSTA 3B4NA 3JX8A 4MXNA 1PE9A 2VBKA 2EWEA 2ODLA 2VFQA 4Z03A 1O88A 2BM4A 2NT9A 2X85A 2QZAA 3GQ9A 1RU4A 2NTBA 1OFEA 1KQ5A 2VFNA 3SYJA 2O04A 3BH6B 3FY3A 4YELA 5C1CA 1O8LA 4I84A 1OOCA 4OZZA 3SY2A 2PECA 1QA2A 2J8IA 3ZPPA 4U49A 1NHCA 1CZFA 4Z05A 3N6ZA 4JRAC 1QCXA 1X0CA 2J8KA 4XR6A 2B0RA 2NZMA 2W7ZA 2XT2A 4XN3A 2X6WA 4OPWA 3VMVA 4YZAA 3BH7B 1KCCA 1K8FA 3P4GA 1KCDA 2XTWA 1IB4A 4YDTA 1IDJA 1RWRA 2VJJA 3N90A 5JLVC
chains in the Genus database with same CATH topology
2QZAA 3NB2A 3PSSA 2XT4A 3PSZA 2XTYA 2QYUA 3NAWA 3SY2A 3DU1X 2J8KA 5DNSA 2XT2A 4YEIA 4YFOA 4YC5A 2O6WA 2XTWA 4YCQA 4YDTA 3SQVA 2XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZA A;  3NB2 A;  3PSS A;  2XT4 A;  3PSZ A;  2XTY A;  2QYU A;  3NAW A;  3SY2 A;  3DU1 X;  2J8K A;  5DNS A;  2XT2 A;  4YEI A;  4YFO A;  4YC5 A;  2O6W A;  2XTW A;  4YCQ A;  4YDT A;  3SQV A;  2XTX A; 
#chains in the Genus database with same CATH topology
 1DBG A;  1LLZ A;  3LMW A;  4OJO A;  2F3L A;  4U4B A;  2QY1 A;  2UVF A;  3NB2 A;  4XOP A;  2O1D A;  3EQN A;  3UW0 A;  4OJ6 A;  1PLU A;  1XG2 A;  1LLW A;  2XC1 A;  2O0W A;  4PMH A;  1O8E A;  2BM6 A;  1JRG A;  1VBL A;  4OZY A;  4XKV A;  5AMV A;  1DAB A;  4HWV A;  4XOR A;  4W8S A;  5C1E A;  3GRH A;  1L1I A;  2IOU G;  4W8Q A;  1TSP A;  1K5C A;  1DBO A;  3LJY A;  4YZX A;  4W8R A;  3AK5 A;  1OGO X;  4EW9 A;  1KTW A;  4KH3 A;  1RMG A;  2X6X A;  3KRG A;  4NK8 A;  2YUH A;  1O8H A;  1OFD A;  4YEI A;  1QA3 A;  1HF2 A;  2X3H A;  2BSP A;  2IQ7 A;  1JTA A;  3LYC A;  1QQ1 A;  1OFM A;  2XTX A;  4XQF A;  2O17 A;  2NST A;  2BX6 A;  2NTP A;  3GQ8 A;  4YZQ A;  4OM9 A;  1TYX A;  2NT6 A;  3RIQ A;  1TYV A;  3PSS A;  3TH0 A;  2XT4 A;  3GQA A;  3PSZ A;  1O8J A;  4Z06 A;  2BM7 A;  4V02 C;  4XLE A;  2QYU A;  2BM5 A;  3WWG A;  1QA1 A;  4YEJ A;  4XLF A;  1LM1 A;  1WXR A;  2QXZ A;  2PYG A;  2VBM A;  1TYU A;  2INV A;  1QJV A;  4YZ0 A;  4OJL A;  1O8D A;  1O8G A;  1IA5 A;  1AIR A;  1EZG A;  2VBE A;  2QX3 A;  4XL9 A;  2O6W A;  1PXZ A;  4URR A;  4YC5 A;  4YFO A;  3ZSC A;  4XMY A;  4XLH A;  1HG8 A;  1OGM X;  4C2L A;  1GQ8 A;  2NSP A;  3H09 A;  1QRB A;  1H80 A;  3VSU A;  4YCQ A;  2VFP A;  4XLC A;  3SQV A;  2O0V A;  4NK6 A;  3VSV A;  4OJ5 A;  2Z8G A;  2PYH A;  1O8F A;  1CLW A;  3SZE A;  1EA0 A;  1TYW A;  2INU A;  3ML3 A;  1K4Z A;  1OFL A;  2XTY A;  3PET A;  4XM3 A;  4XKW A;  1O8M A;  1O8I A;  2G0Y A;  2VJI A;  4XOT A;  4MR0 A;  1IDK A;  3NAW A;  1EE6 A;  3T9G A;  3SUC A;  4XON A;  2V5I A;  3VMW A;  5JMC B;  4XLA A;  3DU1 X;  3B90 A;  4XN0 A;  2VFO A;  1BHE A;  4AVZ A;  2VFM A;  5DNS A;  4OJP A;  3B8Y A;  3GQ7 A;  1WMR A;  1BN8 A;  2NTQ A;  4XNF A;  3EQO A;  1O8K A;  2X6Y A;  1QRC A;  3JUR A;  2UVE A;  4W8T A;  3VST A;  3B4N A;  3JX8 A;  4MXN A;  1PE9 A;  2VBK A;  2EWE A;  2ODL A;  2VFQ A;  4Z03 A;  1O88 A;  2BM4 A;  2NT9 A;  2X85 A;  2QZA A;  3GQ9 A;  1RU4 A;  2NTB A;  1OFE A;  1KQ5 A;  2VFN A;  3SYJ A;  2O04 A;  3BH6 B;  3FY3 A;  4YEL A;  5C1C A;  1O8L A;  4I84 A;  1OOC A;  4OZZ A;  3SY2 A;  2PEC A;  1QA2 A;  2J8I A;  3ZPP A;  4U49 A;  1NHC A;  1CZF A;  4Z05 A;  3N6Z A;  4JRA C;  1QCX A;  1X0C A;  2J8K A;  4XR6 A;  2B0R A;  2NZM A;  2W7Z A;  2XT2 A;  4XN3 A;  2X6W A;  4OPW A;  3VMV A;  4YZA A;  3BH7 B;  1KCC A;  1K8F A;  3P4G A;  1KCD A;  2XTW A;  1IB4 A;  4YDT A;  1IDJ A;  1RWR A;  2VJJ A;  3N90 A;  5JLV C; 
#chains in the Genus database with same CATH homology
 2QZA A;  3NB2 A;  3PSS A;  2XT4 A;  3PSZ A;  2XTY A;  2QYU A;  3NAW A;  3SY2 A;  3DU1 X;  2J8K A;  5DNS A;  2XT2 A;  4YEI A;  4YFO A;  4YC5 A;  2O6W A;  2XTW A;  4YCQ A;  4YDT A;  3SQV A;  2XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...