2XTWA

Structure of qnrb1 (full length), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
b'GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
total genus 79
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtwA00
5DNSA 3SY2A 4YDTA 2XTXA 2O6WA 3PSSA 2XT2A 2J8KA 2XTWA 3NB2A 4YCQA 4YFOA 3NAWA 4YC5A 2XT4A 2QZAA 3PSZA 2QYUA 4YEIA 3DU1X 3SQVA 2XTYA
chains in the Genus database with same CATH superfamily
2NT9A 3LYCA 1TYUA 1BN8A 4W8TA 1LLWA 3VSUA 3GQAA 4Z03A 1O8EA 2O04A 3ZPPA 1KCCA 2VBMA 2VJIA 1TYXA 2X3HA 3VSVA 1DABA 2VFPA 1HF2A 3AK5A 2XC1A 4XKVA 4YELA 3PSSA 2O0VA 2NT6A 2XT2A 2YUHA 1EA0A 4Z05A 3N6ZA 2NSTA 2UVEA 4W8SA 4NK6A 2VJJA 1KCDA 1KTWA 1OFDA 2PYHA 4XORA 3NAWA 2XT4A 2QZAA 4XOPA 1O88A 1VBLA 3GQ9A 1TYVA 2QYUA 4YZQA 4I84A 1O8JA 1IDKA 2QY1A 2BX6A 4XLAA 3SQVA 2O1DA 2VFQA 3H09A 2PECA 1EE6A 5JLVC 1L1IA 1RWRA 4MXNA 3LMWA 2XTXA 4NK8A 4XOTA 5AMVA 3B90A 2BM4A 4OZYA 1QCXA 3VMWA 1TSPA 4OJ6A 4XQFA 3SZEA 2O6WA 1OFLA 4KH3A 2NTQA 4XM3A 1O8DA 2X85A 4W8RA 4URRA 1QA2A 2BM7A 2X6WA 2BSPA 1QRBA 4U4BA 1K5CA 4OM9A 1QJVA 5C1EA 1LM1A 2J8IA 2INVA 2Z8GA 3KRGA 1GQ8A 4OJLA 1IDJA 3VMVA 1OGOX 4YZ0A 3P4GA 4W8QA 2W7ZA 2G0YA 1IA5A 2UVFA 4YZAA 1JRGA 3SYJA 2XTYA 1OGMX 1O8KA 2NTBA 4PMHA 3ZSCA 1K8FA 2EWEA 2IQ7A 1H80A 4U49A 5DNSA 4XLHA 1TYWA 1AIRA 1NHCA 3B8YA 1QQ1A 1OFMA 1CZFA 3JX8A 4EW9A 2O17A 4OPWA 4HWVA 1WMRA 4V02C 4Z06A 2NTPA 3SUCA 4XL9A 2QXZA 1OFEA 3NB2A 5JMCB 4YCQA 4YEJA 4XN3A 4YFOA 4C2LA 3WWGA 4OJ5A 1O8LA 1DBOA 2VBKA 2VFMA 2B0RA 4XLEA 2X6YA 3PSZA 1QA3A 2F3LA 3LJYA 4XKWA 2QX3A 1CLWA 2NZMA 3T9GA 2BM6A 2PYGA 3DU1X 3FY3A 3GRHA 1O8MA 2VFOA 4XR6A 3B4NA 1X0CA 1LLZA 1K4ZA 1EZGA 3N90A 4YZXA 1RU4A 3ML3A 4XN0A 3SY2A 4XMYA 3UW0A 4YDTA 4XLCA 1JTAA 1DBGA 3TH0A 1O8GA 2O0WA 1QRCA 2NSPA 2VBEA 2VFNA 3RIQA 4XNFA 4JRAC 1O8FA 1PLUA 2V5IA 2J8KA 1RMGA 2XTWA 3BH6B 3EQOA 1OOCA 3PETA 4OJPA 3EQNA 5C1CA 1WXRA 3VSTA 1O8IA 2BM5A 1PXZA 3JURA 4AVZA 1QA1A 1KQ5A 2INUA 4XLFA 2ODLA 1PE9A 1BHEA 1HG8A 2IOUG 3BH7B 4YC5A 1IB4A 1XG2A 1O8HA 4MR0A 4XONA 3GQ7A 4OJOA 3GQ8A 4YEIA 2X6XA 4OZZA
chains in the Genus database with same CATH topology
5DNSA 3SY2A 4YDTA 2XTXA 2O6WA 3PSSA 2XT2A 2J8KA 2XTWA 3NB2A 4YCQA 4YFOA 3NAWA 4YC5A 2XT4A 2QZAA 3PSZA 2QYUA 4YEIA 3DU1X 3SQVA 2XTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNS A;  3SY2 A;  4YDT A;  2XTX A;  2O6W A;  3PSS A;  2XT2 A;  2J8K A;  2XTW A;  3NB2 A;  4YCQ A;  4YFO A;  3NAW A;  4YC5 A;  2XT4 A;  2QZA A;  3PSZ A;  2QYU A;  4YEI A;  3DU1 X;  3SQV A;  2XTY A; 
#chains in the Genus database with same CATH topology
 2NT9 A;  3LYC A;  1TYU A;  1BN8 A;  4W8T A;  1LLW A;  3VSU A;  3GQA A;  4Z03 A;  1O8E A;  2O04 A;  3ZPP A;  1KCC A;  2VBM A;  2VJI A;  1TYX A;  2X3H A;  3VSV A;  1DAB A;  2VFP A;  1HF2 A;  3AK5 A;  2XC1 A;  4XKV A;  4YEL A;  3PSS A;  2O0V A;  2NT6 A;  2XT2 A;  2YUH A;  1EA0 A;  4Z05 A;  3N6Z A;  2NST A;  2UVE A;  4W8S A;  4NK6 A;  2VJJ A;  1KCD A;  1KTW A;  1OFD A;  2PYH A;  4XOR A;  3NAW A;  2XT4 A;  2QZA A;  4XOP A;  1O88 A;  1VBL A;  3GQ9 A;  1TYV A;  2QYU A;  4YZQ A;  4I84 A;  1O8J A;  1IDK A;  2QY1 A;  2BX6 A;  4XLA A;  3SQV A;  2O1D A;  2VFQ A;  3H09 A;  2PEC A;  1EE6 A;  5JLV C;  1L1I A;  1RWR A;  4MXN A;  3LMW A;  2XTX A;  4NK8 A;  4XOT A;  5AMV A;  3B90 A;  2BM4 A;  4OZY A;  1QCX A;  3VMW A;  1TSP A;  4OJ6 A;  4XQF A;  3SZE A;  2O6W A;  1OFL A;  4KH3 A;  2NTQ A;  4XM3 A;  1O8D A;  2X85 A;  4W8R A;  4URR A;  1QA2 A;  2BM7 A;  2X6W A;  2BSP A;  1QRB A;  4U4B A;  1K5C A;  4OM9 A;  1QJV A;  5C1E A;  1LM1 A;  2J8I A;  2INV A;  2Z8G A;  3KRG A;  1GQ8 A;  4OJL A;  1IDJ A;  3VMV A;  1OGO X;  4YZ0 A;  3P4G A;  4W8Q A;  2W7Z A;  2G0Y A;  1IA5 A;  2UVF A;  4YZA A;  1JRG A;  3SYJ A;  2XTY A;  1OGM X;  1O8K A;  2NTB A;  4PMH A;  3ZSC A;  1K8F A;  2EWE A;  2IQ7 A;  1H80 A;  4U49 A;  5DNS A;  4XLH A;  1TYW A;  1AIR A;  1NHC A;  3B8Y A;  1QQ1 A;  1OFM A;  1CZF A;  3JX8 A;  4EW9 A;  2O17 A;  4OPW A;  4HWV A;  1WMR A;  4V02 C;  4Z06 A;  2NTP A;  3SUC A;  4XL9 A;  2QXZ A;  1OFE A;  3NB2 A;  5JMC B;  4YCQ A;  4YEJ A;  4XN3 A;  4YFO A;  4C2L A;  3WWG A;  4OJ5 A;  1O8L A;  1DBO A;  2VBK A;  2VFM A;  2B0R A;  4XLE A;  2X6Y A;  3PSZ A;  1QA3 A;  2F3L A;  3LJY A;  4XKW A;  2QX3 A;  1CLW A;  2NZM A;  3T9G A;  2BM6 A;  2PYG A;  3DU1 X;  3FY3 A;  3GRH A;  1O8M A;  2VFO A;  4XR6 A;  3B4N A;  1X0C A;  1LLZ A;  1K4Z A;  1EZG A;  3N90 A;  4YZX A;  1RU4 A;  3ML3 A;  4XN0 A;  3SY2 A;  4XMY A;  3UW0 A;  4YDT A;  4XLC A;  1JTA A;  1DBG A;  3TH0 A;  1O8G A;  2O0W A;  1QRC A;  2NSP A;  2VBE A;  2VFN A;  3RIQ A;  4XNF A;  4JRA C;  1O8F A;  1PLU A;  2V5I A;  2J8K A;  1RMG A;  2XTW A;  3BH6 B;  3EQO A;  1OOC A;  3PET A;  4OJP A;  3EQN A;  5C1C A;  1WXR A;  3VST A;  1O8I A;  2BM5 A;  1PXZ A;  3JUR A;  4AVZ A;  1QA1 A;  1KQ5 A;  2INU A;  4XLF A;  2ODL A;  1PE9 A;  1BHE A;  1HG8 A;  2IOU G;  3BH7 B;  4YC5 A;  1IB4 A;  1XG2 A;  1O8H A;  4MR0 A;  4XON A;  3GQ7 A;  4OJO A;  3GQ8 A;  4YEI A;  2X6X A;  4OZZ A; 
#chains in the Genus database with same CATH homology
 5DNS A;  3SY2 A;  4YDT A;  2XTX A;  2O6W A;  3PSS A;  2XT2 A;  2J8K A;  2XTW A;  3NB2 A;  4YCQ A;  4YFO A;  3NAW A;  4YC5 A;  2XT4 A;  2QZA A;  3PSZ A;  2QYU A;  4YEI A;  3DU1 X;  3SQV A;  2XTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...