2VBKA

Native tailspike protein of bacteriophage sf6
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
511
structure length
511
Chain Sequence
QFGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
publication title An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6.
pubmed doi rcsb
source organism Enterobacteria phage sf6
total genus 188
structure length 511
sequence length 511
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbkA00
3EQNA 4XLHA 1O8GA 4Z06A 4OJPA 4W8RA 4Z03A 4W8SA 4XKWA 1PLUA 1RWRA 4U49A 4YZQA 2X6XA 1O8KA 2NTBA 1OGOX 1O8LA 4XLAA 4XORA 4XM3A 5C1CA 2X6WA 4XLEA 3VMWA 3GQ8A 1O8HA 3ZPPA 2O0WA 1O88A 2NTPA 4I84A 2UVFA 1BN8A 1KTWA 1K5CA 1IDJA 1O8JA 2VJIA 2O1DA 4XLCA 2VBEA 2O0VA 2X85A 1O8MA 1O8FA 4OJ5A 4NK8A 1OOCA 3GRHA 3VSVA 4YZAA 2NT9A 2QX3A 2PYGA 2NSTA 4XR6A 4XL9A 4YELA 1QCXA 4XN0A 4Z05A 2PYHA 3GQ9A 4XKVA 3T9GA 4XONA 4OJLA 4XQFA 1EE6A 2X6YA 4U4BA 2NZMA 2VBKA 4XLFA 4HWVA 3B4NA 3EQOA 1NHCA 3GQ7A 1OGMX 2INUA 2O17A 4AVZA 2QXZA 2QY1A 4MR0A 2BSPA 4OJOA 1O8IA 1DBGA 1RMGA 3KRGA 3VSUA 1IDKA 2NT6A 4XMYA 4URRA 4XOPA 2EWEA 4OZYA 4YZXA 2VJJA 1BHEA 1XG2A 5AMVA 2IQ7A 2PECA 4EW9A 1X0CA 1AIRA 5C1EA 1RU4A 2ODLA 1DBOA 3SUCA 2INVA 1HG8A 3B8YA 3VMVA 4XOTA 2O04A 3WWGA 4YZ0A 4C2LA 1O8EA 3GQAA 3UW0A 3FY3A 4OJ6A 1KCDA 1PXZA 3JURA 1JTAA 4OZZA 4W8QA 1PE9A 1IA5A 1WMRA 1IB4A 4W8TA 1KCCA 4XN3A 1OFLA 2NTQA 3B90A 1H80A 3VSTA 1OFMA 2X3HA 1QJVA 3ZSCA 1CZFA 4XNFA 2VBMA 2NSPA 2UVEA 1GQ8A 4PMHA 2Z8GA 4MXNA 3LMWA 4NK6A 4YEJA 1VBLA 1O8DA 1JRGA
chains in the Genus database with same CATH superfamily
2J8IA 3BH6B 3EQNA 4XLHA 1O8GA 3NAWA 4Z06A 4YFOA 4OJPA 4W8RA 4Z03A 4W8SA 4XKWA 1PLUA 2G0YA 1K4ZA 2YUHA 1RWRA 1QA2A 3JX8A 4U49A 4YZQA 2X6XA 2QYUA 1O8KA 4OM9A 3NB2A 3BH7B 2NTBA 1OGOX 1O8LA 4XLAA 4XORA 4XM3A 5C1CA 1QQ1A 2X6WA 1LLZA 4XLEA 3VMWA 2BM5A 3GQ8A 3H09A 1O8HA 3ZPPA 3TH0A 4YEIA 2O0WA 1O88A 2NTPA 3PSZA 4I84A 2UVFA 1BN8A 2XT2A 1KTWA 1K5CA 1IDJA 2VFMA 1TSPA 1O8JA 2VJIA 4KH3A 2VFOA 2O1DA 4XLCA 3SYJA 2VBEA 1TYWA 5DNSA 2O0VA 1HF2A 2X85A 1O8MA 3SZEA 2J8KA 1QA3A 1CLWA 1O8FA 4OJ5A 4NK8A 1OOCA 1KQ5A 1LLWA 3GRHA 3VSVA 4YZAA 1TYXA 2BM4A 2NT9A 2QX3A 2PYGA 2NSTA 2W7ZA 4XL9A 4XR6A 4YELA 1QCXA 4XN0A 3LJYA 4Z05A 2PYHA 1EA0A 3GQ9A 4XKVA 3T9GA 1OFDA 2V5IA 4XONA 4YC5A 3SY2A 4OJLA 4XQFA 1EE6A 2X6YA 2BM6A 4U4BA 1L1IA 2NZMA 3P4GA 2VBKA 4XLFA 4HWVA 1WXRA 4JRAC 3B4NA 3EQOA 2XTWA 3DU1X 1NHCA 5JMCB 3GQ7A 1QRBA 1OGMX 2INUA 1DABA 2B0RA 2O17A 4AVZA 2QXZA 2QY1A 2XT4A 2BSPA 4MR0A 4OJOA 1O8IA 1DBGA 1RMGA 3KRGA 3VSUA 3RIQA 2VFQA 1IDKA 2NT6A 1TYUA 4URRA 1K8FA 4XMYA 2EWEA 4OZYA 4XOPA 2O6WA 4YZXA 2VJJA 3AK5A 1BHEA 2XTXA 1XG2A 2VFPA 5AMVA 2IQ7A 2PECA 3ML3A 4EW9A 4YCQA 2IOUG 1X0CA 2BM7A 1AIRA 5C1EA 1RU4A 1OFEA 1LM1A 2ODLA 1DBOA 3LYCA 2INVA 3SUCA 5JLVC 1HG8A 3B8YA 4V02C 4YDTA 3VMVA 4XOTA 1EZGA 2O04A 3WWGA 4YZ0A 2XTYA 4C2LA 1O8EA 3GQAA 3UW0A 3FY3A 4OJ6A 1KCDA 3PSSA 1QRCA 1PXZA 3JURA 1JTAA 2QZAA 4OZZA 1PE9A 4W8QA 3N90A 3SQVA 1WMRA 1IA5A 1IB4A 4W8TA 1TYVA 2BX6A 1KCCA 4XN3A 1OFLA 2F3LA 2NTQA 3PETA 3B90A 1H80A 3VSTA 1OFMA 2X3HA 4OPWA 1QJVA 3ZSCA 1CZFA 4XNFA 2VBMA 2NSPA 2XC1A 2UVEA 1GQ8A 3N6ZA 2VFNA 4PMHA 1QA1A 2Z8GA 4MXNA 3LMWA 4NK6A 4YEJA 1VBLA 1O8DA 1JRGA
chains in the Genus database with same CATH topology
3EQNA 4XLHA 1O8GA 4Z06A 4OJPA 4W8RA 4Z03A 4W8SA 4XKWA 1PLUA 1RWRA 4U49A 4YZQA 2X6XA 1O8KA 2NTBA 1OGOX 1O8LA 4XLAA 4XORA 4XM3A 5C1CA 2X6WA 4XLEA 3VMWA 3GQ8A 1O8HA 3ZPPA 2O0WA 1O88A 2NTPA 4I84A 2UVFA 1BN8A 1KTWA 1K5CA 1IDJA 1O8JA 2VJIA 2O1DA 4XLCA 2VBEA 2O0VA 2X85A 1O8MA 1O8FA 4OJ5A 4NK8A 1OOCA 3GRHA 3VSVA 4YZAA 2NT9A 2QX3A 2PYGA 2NSTA 4XR6A 4XL9A 4YELA 1QCXA 4XN0A 4Z05A 2PYHA 3GQ9A 4XKVA 3T9GA 4XONA 4OJLA 4XQFA 1EE6A 2X6YA 4U4BA 2NZMA 2VBKA 4XLFA 4HWVA 3B4NA 3EQOA 1NHCA 3GQ7A 1OGMX 2INUA 2O17A 4AVZA 2QXZA 2QY1A 4MR0A 2BSPA 4OJOA 1O8IA 1DBGA 1RMGA 3KRGA 3VSUA 1IDKA 2NT6A 4XMYA 4URRA 4XOPA 2EWEA 4OZYA 4YZXA 2VJJA 1BHEA 1XG2A 5AMVA 2IQ7A 2PECA 4EW9A 1X0CA 1AIRA 5C1EA 1RU4A 2ODLA 1DBOA 3SUCA 2INVA 1HG8A 3B8YA 3VMVA 4XOTA 2O04A 3WWGA 4YZ0A 4C2LA 1O8EA 3GQAA 3UW0A 3FY3A 4OJ6A 1KCDA 1PXZA 3JURA 1JTAA 4OZZA 4W8QA 1PE9A 1IA5A 1WMRA 1IB4A 4W8TA 1KCCA 4XN3A 1OFLA 2NTQA 3B90A 1H80A 3VSTA 1OFMA 2X3HA 1QJVA 3ZSCA 1CZFA 4XNFA 2VBMA 2NSPA 2UVEA 1GQ8A 4PMHA 2Z8GA 4MXNA 3LMWA 4NK6A 4YEJA 1VBLA 1O8DA 1JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQN A;  4XLH A;  1O8G A;  4Z06 A;  4OJP A;  4W8R A;  4Z03 A;  4W8S A;  4XKW A;  1PLU A;  1RWR A;  4U49 A;  4YZQ A;  2X6X A;  1O8K A;  2NTB A;  1OGO X;  1O8L A;  4XLA A;  4XOR A;  4XM3 A;  5C1C A;  2X6W A;  4XLE A;  3VMW A;  3GQ8 A;  1O8H A;  3ZPP A;  2O0W A;  1O88 A;  2NTP A;  4I84 A;  2UVF A;  1BN8 A;  1KTW A;  1K5C A;  1IDJ A;  1O8J A;  2VJI A;  2O1D A;  4XLC A;  2VBE A;  2O0V A;  2X85 A;  1O8M A;  1O8F A;  4OJ5 A;  4NK8 A;  1OOC A;  3GRH A;  3VSV A;  4YZA A;  2NT9 A;  2QX3 A;  2PYG A;  2NST A;  4XR6 A;  4XL9 A;  4YEL A;  1QCX A;  4XN0 A;  4Z05 A;  2PYH A;  3GQ9 A;  4XKV A;  3T9G A;  4XON A;  4OJL A;  4XQF A;  1EE6 A;  2X6Y A;  4U4B A;  2NZM A;  2VBK A;  4XLF A;  4HWV A;  3B4N A;  3EQO A;  1NHC A;  3GQ7 A;  1OGM X;  2INU A;  2O17 A;  4AVZ A;  2QXZ A;  2QY1 A;  4MR0 A;  2BSP A;  4OJO A;  1O8I A;  1DBG A;  1RMG A;  3KRG A;  3VSU A;  1IDK A;  2NT6 A;  4XMY A;  4URR A;  4XOP A;  2EWE A;  4OZY A;  4YZX A;  2VJJ A;  1BHE A;  1XG2 A;  5AMV A;  2IQ7 A;  2PEC A;  4EW9 A;  1X0C A;  1AIR A;  5C1E A;  1RU4 A;  2ODL A;  1DBO A;  3SUC A;  2INV A;  1HG8 A;  3B8Y A;  3VMV A;  4XOT A;  2O04 A;  3WWG A;  4YZ0 A;  4C2L A;  1O8E A;  3GQA A;  3UW0 A;  3FY3 A;  4OJ6 A;  1KCD A;  1PXZ A;  3JUR A;  1JTA A;  4OZZ A;  4W8Q A;  1PE9 A;  1IA5 A;  1WMR A;  1IB4 A;  4W8T A;  1KCC A;  4XN3 A;  1OFL A;  2NTQ A;  3B90 A;  1H80 A;  3VST A;  1OFM A;  2X3H A;  1QJV A;  3ZSC A;  1CZF A;  4XNF A;  2VBM A;  2NSP A;  2UVE A;  1GQ8 A;  4PMH A;  2Z8G A;  4MXN A;  3LMW A;  4NK6 A;  4YEJ A;  1VBL A;  1O8D A;  1JRG A; 
#chains in the Genus database with same CATH topology
 2J8I A;  3BH6 B;  3EQN A;  4XLH A;  1O8G A;  3NAW A;  4Z06 A;  4YFO A;  4OJP A;  4W8R A;  4Z03 A;  4W8S A;  4XKW A;  1PLU A;  2G0Y A;  1K4Z A;  2YUH A;  1RWR A;  1QA2 A;  3JX8 A;  4U49 A;  4YZQ A;  2X6X A;  2QYU A;  1O8K A;  4OM9 A;  3NB2 A;  3BH7 B;  2NTB A;  1OGO X;  1O8L A;  4XLA A;  4XOR A;  4XM3 A;  5C1C A;  1QQ1 A;  2X6W A;  1LLZ A;  4XLE A;  3VMW A;  2BM5 A;  3GQ8 A;  3H09 A;  1O8H A;  3ZPP A;  3TH0 A;  4YEI A;  2O0W A;  1O88 A;  2NTP A;  3PSZ A;  4I84 A;  2UVF A;  1BN8 A;  2XT2 A;  1KTW A;  1K5C A;  1IDJ A;  2VFM A;  1TSP A;  1O8J A;  2VJI A;  4KH3 A;  2VFO A;  2O1D A;  4XLC A;  3SYJ A;  2VBE A;  1TYW A;  5DNS A;  2O0V A;  1HF2 A;  2X85 A;  1O8M A;  3SZE A;  2J8K A;  1QA3 A;  1CLW A;  1O8F A;  4OJ5 A;  4NK8 A;  1OOC A;  1KQ5 A;  1LLW A;  3GRH A;  3VSV A;  4YZA A;  1TYX A;  2BM4 A;  2NT9 A;  2QX3 A;  2PYG A;  2NST A;  2W7Z A;  4XL9 A;  4XR6 A;  4YEL A;  1QCX A;  4XN0 A;  3LJY A;  4Z05 A;  2PYH A;  1EA0 A;  3GQ9 A;  4XKV A;  3T9G A;  1OFD A;  2V5I A;  4XON A;  4YC5 A;  3SY2 A;  4OJL A;  4XQF A;  1EE6 A;  2X6Y A;  2BM6 A;  4U4B A;  1L1I A;  2NZM A;  3P4G A;  2VBK A;  4XLF A;  4HWV A;  1WXR A;  4JRA C;  3B4N A;  3EQO A;  2XTW A;  3DU1 X;  1NHC A;  5JMC B;  3GQ7 A;  1QRB A;  1OGM X;  2INU A;  1DAB A;  2B0R A;  2O17 A;  4AVZ A;  2QXZ A;  2QY1 A;  2XT4 A;  2BSP A;  4MR0 A;  4OJO A;  1O8I A;  1DBG A;  1RMG A;  3KRG A;  3VSU A;  3RIQ A;  2VFQ A;  1IDK A;  2NT6 A;  1TYU A;  4URR A;  1K8F A;  4XMY A;  2EWE A;  4OZY A;  4XOP A;  2O6W A;  4YZX A;  2VJJ A;  3AK5 A;  1BHE A;  2XTX A;  1XG2 A;  2VFP A;  5AMV A;  2IQ7 A;  2PEC A;  3ML3 A;  4EW9 A;  4YCQ A;  2IOU G;  1X0C A;  2BM7 A;  1AIR A;  5C1E A;  1RU4 A;  1OFE A;  1LM1 A;  2ODL A;  1DBO A;  3LYC A;  2INV A;  3SUC A;  5JLV C;  1HG8 A;  3B8Y A;  4V02 C;  4YDT A;  3VMV A;  4XOT A;  1EZG A;  2O04 A;  3WWG A;  4YZ0 A;  2XTY A;  4C2L A;  1O8E A;  3GQA A;  3UW0 A;  3FY3 A;  4OJ6 A;  1KCD A;  3PSS A;  1QRC A;  1PXZ A;  3JUR A;  1JTA A;  2QZA A;  4OZZ A;  1PE9 A;  4W8Q A;  3N90 A;  3SQV A;  1WMR A;  1IA5 A;  1IB4 A;  4W8T A;  1TYV A;  2BX6 A;  1KCC A;  4XN3 A;  1OFL A;  2F3L A;  2NTQ A;  3PET A;  3B90 A;  1H80 A;  3VST A;  1OFM A;  2X3H A;  4OPW A;  1QJV A;  3ZSC A;  1CZF A;  4XNF A;  2VBM A;  2NSP A;  2XC1 A;  2UVE A;  1GQ8 A;  3N6Z A;  2VFN A;  4PMH A;  1QA1 A;  2Z8G A;  4MXN A;  3LMW A;  4NK6 A;  4YEJ A;  1VBL A;  1O8D A;  1JRG A; 
#chains in the Genus database with same CATH homology
 3EQN A;  4XLH A;  1O8G A;  4Z06 A;  4OJP A;  4W8R A;  4Z03 A;  4W8S A;  4XKW A;  1PLU A;  1RWR A;  4U49 A;  4YZQ A;  2X6X A;  1O8K A;  2NTB A;  1OGO X;  1O8L A;  4XLA A;  4XOR A;  4XM3 A;  5C1C A;  2X6W A;  4XLE A;  3VMW A;  3GQ8 A;  1O8H A;  3ZPP A;  2O0W A;  1O88 A;  2NTP A;  4I84 A;  2UVF A;  1BN8 A;  1KTW A;  1K5C A;  1IDJ A;  1O8J A;  2VJI A;  2O1D A;  4XLC A;  2VBE A;  2O0V A;  2X85 A;  1O8M A;  1O8F A;  4OJ5 A;  4NK8 A;  1OOC A;  3GRH A;  3VSV A;  4YZA A;  2NT9 A;  2QX3 A;  2PYG A;  2NST A;  4XR6 A;  4XL9 A;  4YEL A;  1QCX A;  4XN0 A;  4Z05 A;  2PYH A;  3GQ9 A;  4XKV A;  3T9G A;  4XON A;  4OJL A;  4XQF A;  1EE6 A;  2X6Y A;  4U4B A;  2NZM A;  2VBK A;  4XLF A;  4HWV A;  3B4N A;  3EQO A;  1NHC A;  3GQ7 A;  1OGM X;  2INU A;  2O17 A;  4AVZ A;  2QXZ A;  2QY1 A;  4MR0 A;  2BSP A;  4OJO A;  1O8I A;  1DBG A;  1RMG A;  3KRG A;  3VSU A;  1IDK A;  2NT6 A;  4XMY A;  4URR A;  4XOP A;  2EWE A;  4OZY A;  4YZX A;  2VJJ A;  1BHE A;  1XG2 A;  5AMV A;  2IQ7 A;  2PEC A;  4EW9 A;  1X0C A;  1AIR A;  5C1E A;  1RU4 A;  2ODL A;  1DBO A;  3SUC A;  2INV A;  1HG8 A;  3B8Y A;  3VMV A;  4XOT A;  2O04 A;  3WWG A;  4YZ0 A;  4C2L A;  1O8E A;  3GQA A;  3UW0 A;  3FY3 A;  4OJ6 A;  1KCD A;  1PXZ A;  3JUR A;  1JTA A;  4OZZ A;  4W8Q A;  1PE9 A;  1IA5 A;  1WMR A;  1IB4 A;  4W8T A;  1KCC A;  4XN3 A;  1OFL A;  2NTQ A;  3B90 A;  1H80 A;  3VST A;  1OFM A;  2X3H A;  1QJV A;  3ZSC A;  1CZF A;  4XNF A;  2VBM A;  2NSP A;  2UVE A;  1GQ8 A;  4PMH A;  2Z8G A;  4MXN A;  3LMW A;  4NK6 A;  4YEJ A;  1VBL A;  1O8D A;  1JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...