4NK8A

Crystal structure of the periplasmic alginate epimerase algg d317a mutant
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
424
structure length
417
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIAPHDRSHGLIIAENDVYGTKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 166
structure length 417
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk8A00
2O0WA 4U49A 2QY1A 1O8FA 4Z03A 4MXNA 4U4BA 3EQOA 4XLCA 2NTBA 1AIRA 3GQ9A 4YZXA 3VSVA 1RWRA 4NK6A 1RMGA 4OJ6A 3SUCA 1JTAA 1OFLA 2NSPA 4W8TA 5AMVA 1WMRA 3B4NA 1CZFA 3JURA 1O88A 2X6WA 3VMWA 2INVA 4XM3A 4YEJA 1O8LA 4PMHA 5C1EA 1NHCA 2QX3A 4MR0A 2NT9A 1HG8A 2O04A 4XL9A 2QXZA 1OOCA 1DBGA 1O8KA 2VBKA 1IDKA 2Z8GA 1OGMX 3KRGA 1O8DA 2X6XA 4XKWA 1IA5A 1X0CA 2INUA 5C1CA 4NK8A 4OJOA 3B90A 2EWEA 4XOPA 1KTWA 1DBOA 2VBEA 4I84A 3VMVA 1PE9A 1K5CA 2O17A 1XG2A 4XMYA 2NTQA 1O8GA 3GRHA 4XOTA 4OJ5A 4XNFA 4XONA 1JRGA 3FY3A 3WWGA 1IDJA 1O8MA 2VJIA 2NSTA 2X85A 4HWVA 4EW9A 3T9GA 2NZMA 4YZQA 4W8QA 2BSPA 3GQ8A 4W8SA 1O8EA 4XN0A 1PLUA 4XORA 1KCCA 3GQ7A 4C2LA 4OZYA 1RU4A 1KCDA 3GQAA 4Z06A 4URRA 1PXZA 3UW0A 4OJPA 4AVZA 2O1DA 2X3HA 1O8JA 1OFMA 4XLFA 3ZPPA 2UVFA 1O8IA 3VSTA 2IQ7A 1QCXA 1EE6A 2NT6A 3EQNA 2PYHA 1QJVA 4W8RA 4Z05A 2PECA 4YELA 4XLHA 2UVEA 3LMWA 2VBMA 2VJJA 4YZAA 1BHEA 1OGOX 2X6YA 3B8YA 4OZZA 4XN3A 4XLEA 4OJLA 1IB4A 1H80A 2O0VA 4XQFA 4YZ0A 4XLAA 2PYGA 4XR6A 1BN8A 1VBLA 3VSUA 2ODLA 3ZSCA 2NTPA 1O8HA 4XKVA 1GQ8A
chains in the Genus database with same CATH superfamily
2O0WA 3P4GA 4U49A 2QY1A 1O8FA 4Z03A 4MXNA 4U4BA 5JMCB 3EQOA 4XLCA 2NTBA 1QQ1A 4V02C 1OFEA 1AIRA 3GQ9A 4YZXA 3SY2A 1RWRA 3VSVA 4NK6A 2O6WA 1RMGA 4OJ6A 3SUCA 1JTAA 1OFLA 2QZAA 2NSPA 4W8TA 1KQ5A 1QA1A 5AMVA 1WMRA 3B4NA 1CZFA 2J8IA 3LJYA 3JURA 1HF2A 1O88A 2X6WA 3VMWA 2BM6A 2XT2A 2INVA 4OM9A 4XM3A 1O8LA 4PMHA 4YEJA 5C1EA 1NHCA 2QX3A 4MR0A 2NT9A 1HG8A 2O04A 4XL9A 4YEIA 2QXZA 1OOCA 1DBGA 1O8KA 2VBKA 1IDKA 2Z8GA 1OGMX 3KRGA 1O8DA 2X6XA 4XKWA 2BX6A 1IA5A 2BM7A 2IOUG 1X0CA 2F3LA 2INUA 5C1CA 4NK8A 2J8KA 2VFPA 4OJOA 3B90A 2EWEA 4OPWA 4XOPA 3BH6B 2BM4A 1KTWA 1DBOA 2VBEA 4I84A 2XTYA 4KH3A 3VMVA 1PE9A 1K5CA 2O17A 1LLWA 5DNSA 1XG2A 4XMYA 2NTQA 1L1IA 3TH0A 1TYXA 3NB2A 1O8GA 1WXRA 1TYVA 3GRHA 4XOTA 4OJ5A 4XNFA 4XONA 1QRBA 1JRGA 3FY3A 1IDJA 1O8MA 2VJIA 2NSTA 2XTWA 3NAWA 3WWGA 2X85A 4HWVA 2VFMA 3BH7B 4EW9A 3T9GA 2XTXA 2NZMA 4YZQA 4W8QA 2BSPA 3GQ8A 1CLWA 2V5IA 3RIQA 3AK5A 2BM5A 1O8EA 4W8SA 1PLUA 1TSPA 4XN0A 4XORA 1KCCA 3N6ZA 1TYWA 3GQ7A 4JRAC 4C2LA 4OZYA 1RU4A 1KCDA 3SYJA 2W7ZA 2VFQA 3GQAA 2VFOA 1OFDA 4Z06A 3SZEA 3H09A 4URRA 3PSSA 1PXZA 1K4ZA 3UW0A 4OJPA 4AVZA 2O1DA 1O8JA 2X3HA 1OFMA 3DU1X 4XLFA 3ZPPA 1EZGA 1O8IA 2UVFA 1QA3A 3PSZA 2YUHA 2IQ7A 3VSTA 3SQVA 1K8FA 3PETA 1QCXA 1EE6A 2NT6A 3EQNA 3ML3A 4YC5A 2PYHA 1QJVA 4W8RA 4Z05A 2PECA 4YELA 2G0YA 2QYUA 4XLHA 2UVEA 3LMWA 2VBMA 2VJJA 4YZAA 1QRCA 1TYUA 3JX8A 1BHEA 1OGOX 2X6YA 3B8YA 4OZZA 4XN3A 4XLEA 4OJLA 1IB4A 1DABA 1H80A 2O0VA 4XQFA 4YZ0A 2XT4A 1QA2A 1EA0A 4XLAA 2PYGA 2XC1A 4XR6A 4YFOA 3N90A 5JLVC 1LM1A 1BN8A 1VBLA 3VSUA 2ODLA 3ZSCA 2NTPA 4YCQA 2VFNA 1LLZA 1O8HA 3LYCA 1GQ8A 4XKVA 4YDTA 2B0RA
chains in the Genus database with same CATH topology
2O0WA 4U49A 2QY1A 1O8FA 4Z03A 4MXNA 4U4BA 3EQOA 4XLCA 2NTBA 1AIRA 3GQ9A 4YZXA 3VSVA 1RWRA 4NK6A 1RMGA 4OJ6A 3SUCA 1JTAA 1OFLA 2NSPA 4W8TA 5AMVA 1WMRA 3B4NA 1CZFA 3JURA 1O88A 2X6WA 3VMWA 2INVA 4XM3A 4YEJA 1O8LA 4PMHA 5C1EA 1NHCA 2QX3A 4MR0A 2NT9A 1HG8A 2O04A 4XL9A 2QXZA 1OOCA 1DBGA 1O8KA 2VBKA 1IDKA 2Z8GA 1OGMX 3KRGA 1O8DA 2X6XA 4XKWA 1IA5A 1X0CA 2INUA 5C1CA 4NK8A 4OJOA 3B90A 2EWEA 4XOPA 1KTWA 1DBOA 2VBEA 4I84A 3VMVA 1PE9A 1K5CA 2O17A 1XG2A 4XMYA 2NTQA 1O8GA 3GRHA 4XOTA 4OJ5A 4XNFA 4XONA 1JRGA 3FY3A 3WWGA 1IDJA 1O8MA 2VJIA 2NSTA 2X85A 4HWVA 4EW9A 3T9GA 2NZMA 4YZQA 4W8QA 2BSPA 3GQ8A 4W8SA 1O8EA 4XN0A 1PLUA 4XORA 1KCCA 3GQ7A 4C2LA 4OZYA 1RU4A 1KCDA 3GQAA 4Z06A 4URRA 1PXZA 3UW0A 4OJPA 4AVZA 2O1DA 2X3HA 1O8JA 1OFMA 4XLFA 3ZPPA 2UVFA 1O8IA 3VSTA 2IQ7A 1QCXA 1EE6A 2NT6A 3EQNA 2PYHA 1QJVA 4W8RA 4Z05A 2PECA 4YELA 4XLHA 2UVEA 3LMWA 2VBMA 2VJJA 4YZAA 1BHEA 1OGOX 2X6YA 3B8YA 4OZZA 4XN3A 4XLEA 4OJLA 1IB4A 1H80A 2O0VA 4XQFA 4YZ0A 4XLAA 2PYGA 4XR6A 1BN8A 1VBLA 3VSUA 2ODLA 3ZSCA 2NTPA 1O8HA 4XKVA 1GQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0W A;  4U49 A;  2QY1 A;  1O8F A;  4Z03 A;  4MXN A;  4U4B A;  3EQO A;  4XLC A;  2NTB A;  1AIR A;  3GQ9 A;  4YZX A;  3VSV A;  1RWR A;  4NK6 A;  1RMG A;  4OJ6 A;  3SUC A;  1JTA A;  1OFL A;  2NSP A;  4W8T A;  5AMV A;  1WMR A;  3B4N A;  1CZF A;  3JUR A;  1O88 A;  2X6W A;  3VMW A;  2INV A;  4XM3 A;  4YEJ A;  1O8L A;  4PMH A;  5C1E A;  1NHC A;  2QX3 A;  4MR0 A;  2NT9 A;  1HG8 A;  2O04 A;  4XL9 A;  2QXZ A;  1OOC A;  1DBG A;  1O8K A;  2VBK A;  1IDK A;  2Z8G A;  1OGM X;  3KRG A;  1O8D A;  2X6X A;  4XKW A;  1IA5 A;  1X0C A;  2INU A;  5C1C A;  4NK8 A;  4OJO A;  3B90 A;  2EWE A;  4XOP A;  1KTW A;  1DBO A;  2VBE A;  4I84 A;  3VMV A;  1PE9 A;  1K5C A;  2O17 A;  1XG2 A;  4XMY A;  2NTQ A;  1O8G A;  3GRH A;  4XOT A;  4OJ5 A;  4XNF A;  4XON A;  1JRG A;  3FY3 A;  3WWG A;  1IDJ A;  1O8M A;  2VJI A;  2NST A;  2X85 A;  4HWV A;  4EW9 A;  3T9G A;  2NZM A;  4YZQ A;  4W8Q A;  2BSP A;  3GQ8 A;  4W8S A;  1O8E A;  4XN0 A;  1PLU A;  4XOR A;  1KCC A;  3GQ7 A;  4C2L A;  4OZY A;  1RU4 A;  1KCD A;  3GQA A;  4Z06 A;  4URR A;  1PXZ A;  3UW0 A;  4OJP A;  4AVZ A;  2O1D A;  2X3H A;  1O8J A;  1OFM A;  4XLF A;  3ZPP A;  2UVF A;  1O8I A;  3VST A;  2IQ7 A;  1QCX A;  1EE6 A;  2NT6 A;  3EQN A;  2PYH A;  1QJV A;  4W8R A;  4Z05 A;  2PEC A;  4YEL A;  4XLH A;  2UVE A;  3LMW A;  2VBM A;  2VJJ A;  4YZA A;  1BHE A;  1OGO X;  2X6Y A;  3B8Y A;  4OZZ A;  4XN3 A;  4XLE A;  4OJL A;  1IB4 A;  1H80 A;  2O0V A;  4XQF A;  4YZ0 A;  4XLA A;  2PYG A;  4XR6 A;  1BN8 A;  1VBL A;  3VSU A;  2ODL A;  3ZSC A;  2NTP A;  1O8H A;  4XKV A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 2O0W A;  3P4G A;  4U49 A;  2QY1 A;  1O8F A;  4Z03 A;  4MXN A;  4U4B A;  5JMC B;  3EQO A;  4XLC A;  2NTB A;  1QQ1 A;  4V02 C;  1OFE A;  1AIR A;  3GQ9 A;  4YZX A;  3SY2 A;  1RWR A;  3VSV A;  4NK6 A;  2O6W A;  1RMG A;  4OJ6 A;  3SUC A;  1JTA A;  1OFL A;  2QZA A;  2NSP A;  4W8T A;  1KQ5 A;  1QA1 A;  5AMV A;  1WMR A;  3B4N A;  1CZF A;  2J8I A;  3LJY A;  3JUR A;  1HF2 A;  1O88 A;  2X6W A;  3VMW A;  2BM6 A;  2XT2 A;  2INV A;  4OM9 A;  4XM3 A;  1O8L A;  4PMH A;  4YEJ A;  5C1E A;  1NHC A;  2QX3 A;  4MR0 A;  2NT9 A;  1HG8 A;  2O04 A;  4XL9 A;  4YEI A;  2QXZ A;  1OOC A;  1DBG A;  1O8K A;  2VBK A;  1IDK A;  2Z8G A;  1OGM X;  3KRG A;  1O8D A;  2X6X A;  4XKW A;  2BX6 A;  1IA5 A;  2BM7 A;  2IOU G;  1X0C A;  2F3L A;  2INU A;  5C1C A;  4NK8 A;  2J8K A;  2VFP A;  4OJO A;  3B90 A;  2EWE A;  4OPW A;  4XOP A;  3BH6 B;  2BM4 A;  1KTW A;  1DBO A;  2VBE A;  4I84 A;  2XTY A;  4KH3 A;  3VMV A;  1PE9 A;  1K5C A;  2O17 A;  1LLW A;  5DNS A;  1XG2 A;  4XMY A;  2NTQ A;  1L1I A;  3TH0 A;  1TYX A;  3NB2 A;  1O8G A;  1WXR A;  1TYV A;  3GRH A;  4XOT A;  4OJ5 A;  4XNF A;  4XON A;  1QRB A;  1JRG A;  3FY3 A;  1IDJ A;  1O8M A;  2VJI A;  2NST A;  2XTW A;  3NAW A;  3WWG A;  2X85 A;  4HWV A;  2VFM A;  3BH7 B;  4EW9 A;  3T9G A;  2XTX A;  2NZM A;  4YZQ A;  4W8Q A;  2BSP A;  3GQ8 A;  1CLW A;  2V5I A;  3RIQ A;  3AK5 A;  2BM5 A;  1O8E A;  4W8S A;  1PLU A;  1TSP A;  4XN0 A;  4XOR A;  1KCC A;  3N6Z A;  1TYW A;  3GQ7 A;  4JRA C;  4C2L A;  4OZY A;  1RU4 A;  1KCD A;  3SYJ A;  2W7Z A;  2VFQ A;  3GQA A;  2VFO A;  1OFD A;  4Z06 A;  3SZE A;  3H09 A;  4URR A;  3PSS A;  1PXZ A;  1K4Z A;  3UW0 A;  4OJP A;  4AVZ A;  2O1D A;  1O8J A;  2X3H A;  1OFM A;  3DU1 X;  4XLF A;  3ZPP A;  1EZG A;  1O8I A;  2UVF A;  1QA3 A;  3PSZ A;  2YUH A;  2IQ7 A;  3VST A;  3SQV A;  1K8F A;  3PET A;  1QCX A;  1EE6 A;  2NT6 A;  3EQN A;  3ML3 A;  4YC5 A;  2PYH A;  1QJV A;  4W8R A;  4Z05 A;  2PEC A;  4YEL A;  2G0Y A;  2QYU A;  4XLH A;  2UVE A;  3LMW A;  2VBM A;  2VJJ A;  4YZA A;  1QRC A;  1TYU A;  3JX8 A;  1BHE A;  1OGO X;  2X6Y A;  3B8Y A;  4OZZ A;  4XN3 A;  4XLE A;  4OJL A;  1IB4 A;  1DAB A;  1H80 A;  2O0V A;  4XQF A;  4YZ0 A;  2XT4 A;  1QA2 A;  1EA0 A;  4XLA A;  2PYG A;  2XC1 A;  4XR6 A;  4YFO A;  3N90 A;  5JLV C;  1LM1 A;  1BN8 A;  1VBL A;  3VSU A;  2ODL A;  3ZSC A;  2NTP A;  4YCQ A;  2VFN A;  1LLZ A;  1O8H A;  3LYC A;  1GQ8 A;  4XKV A;  4YDT A;  2B0R A; 
#chains in the Genus database with same CATH homology
 2O0W A;  4U49 A;  2QY1 A;  1O8F A;  4Z03 A;  4MXN A;  4U4B A;  3EQO A;  4XLC A;  2NTB A;  1AIR A;  3GQ9 A;  4YZX A;  3VSV A;  1RWR A;  4NK6 A;  1RMG A;  4OJ6 A;  3SUC A;  1JTA A;  1OFL A;  2NSP A;  4W8T A;  5AMV A;  1WMR A;  3B4N A;  1CZF A;  3JUR A;  1O88 A;  2X6W A;  3VMW A;  2INV A;  4XM3 A;  4YEJ A;  1O8L A;  4PMH A;  5C1E A;  1NHC A;  2QX3 A;  4MR0 A;  2NT9 A;  1HG8 A;  2O04 A;  4XL9 A;  2QXZ A;  1OOC A;  1DBG A;  1O8K A;  2VBK A;  1IDK A;  2Z8G A;  1OGM X;  3KRG A;  1O8D A;  2X6X A;  4XKW A;  1IA5 A;  1X0C A;  2INU A;  5C1C A;  4NK8 A;  4OJO A;  3B90 A;  2EWE A;  4XOP A;  1KTW A;  1DBO A;  2VBE A;  4I84 A;  3VMV A;  1PE9 A;  1K5C A;  2O17 A;  1XG2 A;  4XMY A;  2NTQ A;  1O8G A;  3GRH A;  4XOT A;  4OJ5 A;  4XNF A;  4XON A;  1JRG A;  3FY3 A;  3WWG A;  1IDJ A;  1O8M A;  2VJI A;  2NST A;  2X85 A;  4HWV A;  4EW9 A;  3T9G A;  2NZM A;  4YZQ A;  4W8Q A;  2BSP A;  3GQ8 A;  4W8S A;  1O8E A;  4XN0 A;  1PLU A;  4XOR A;  1KCC A;  3GQ7 A;  4C2L A;  4OZY A;  1RU4 A;  1KCD A;  3GQA A;  4Z06 A;  4URR A;  1PXZ A;  3UW0 A;  4OJP A;  4AVZ A;  2O1D A;  2X3H A;  1O8J A;  1OFM A;  4XLF A;  3ZPP A;  2UVF A;  1O8I A;  3VST A;  2IQ7 A;  1QCX A;  1EE6 A;  2NT6 A;  3EQN A;  2PYH A;  1QJV A;  4W8R A;  4Z05 A;  2PEC A;  4YEL A;  4XLH A;  2UVE A;  3LMW A;  2VBM A;  2VJJ A;  4YZA A;  1BHE A;  1OGO X;  2X6Y A;  3B8Y A;  4OZZ A;  4XN3 A;  4XLE A;  4OJL A;  1IB4 A;  1H80 A;  2O0V A;  4XQF A;  4YZ0 A;  4XLA A;  2PYG A;  4XR6 A;  1BN8 A;  1VBL A;  3VSU A;  2ODL A;  3ZSC A;  2NTP A;  1O8H A;  4XKV A;  1GQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...