4NK8A

Crystal structure of the periplasmic alginate epimerase algg d317a mutant
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
424
structure length
417
Chain Sequence
b'EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIAPHDRSHGLIIAENDVYGTKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase
molecule tags Isomerase
source organism Pseudomonas syringae pv. tomato
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
total genus 166
structure length 417
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk8A00
4XLFA 2NT6A 1NHCA 1O8KA 1JRGA 4OJ5A 4U4BA 1O88A 4XL9A 2X3HA 2PECA 2X6WA 2UVFA 1O8JA 4XONA 3VMWA 1O8EA 1O8LA 2O1DA 3B90A 3T9GA 4OJ6A 2NTQA 4XKWA 4NK6A 1OFLA 2X6XA 4Z05A 2IQ7A 1RWRA 4XNFA 3GQ9A 1XG2A 4YZ0A 4OJPA 2NTBA 4XMYA 1RU4A 4XLHA 3GQ7A 2PYHA 1OGOX 3GQAA 1JTAA 1IDJA 1BN8A 4OZZA 5AMVA 3SUCA 1KTWA 3ZPPA 3FY3A 4YZXA 5C1CA 2X6YA 2VBMA 1CZFA 1OFMA 4YZQA 1WMRA 1KCCA 3ZSCA 4YELA 1EE6A 2VJJA 1O8MA 1PXZA 2Z8GA 2NTPA 4XLCA 1IDKA 4XOPA 2BSPA 4W8TA 4NK8A 4XORA 4AVZA 3VMVA 4OJLA 2EWEA 2UVEA 2QY1A 3GQ8A 1K5CA 3VSTA 4C2LA 3B8YA 2VJIA 4OZYA 2VBKA 5C1EA 4XM3A 3EQNA 2X85A 2QX3A 4W8QA 4PMHA 1X0CA 1O8HA 1GQ8A 1OOCA 2VBEA 3GRHA 1BHEA 4HWVA 3UW0A 4W8SA 1O8FA 1IA5A 3VSUA 4I84A 4XLAA 2O0VA 4XN3A 3B4NA 4Z06A 1KCDA 3JURA 1QJVA 1AIRA 1OGMX 2QXZA 2INUA 4URRA 4XLEA 1H80A 1IB4A 4XQFA 2O17A 1QCXA 2NSPA 3EQOA 4OJOA 4XR6A 4EW9A 4MR0A 4YEJA 1O8IA 3VSVA 1DBGA 2NT9A 1PLUA 4W8RA 2NSTA 4Z03A 2NZMA 4MXNA 3WWGA 2PYGA 4YZAA 1O8DA 1PE9A 2O04A 3LMWA 1O8GA 4XKVA 1DBOA 1VBLA 2INVA 4XOTA 2O0WA 4XN0A 1RMGA 3KRGA 2ODLA 4U49A 1HG8A
chains in the Genus database with same CATH superfamily
4XLFA 2NT6A 1NHCA 1O8KA 3N90A 4YFOA 1JRGA 1QQ1A 4OJ5A 1K8FA 3SZEA 4U4BA 3ML3A 3SQVA 3LYCA 1O88A 4XL9A 5JMCB 2X3HA 2PECA 2X6WA 3DU1X 2XTWA 4OM9A 2UVFA 1O8JA 3NB2A 4XONA 3PSSA 1HF2A 1O8EA 3VMWA 1O8LA 1TYVA 2O1DA 3B90A 3T9GA 1QA2A 4OJ6A 2NTQA 4XKWA 4NK6A 1OFLA 2X6XA 1LLWA 4YC5A 5DNSA 4Z05A 2IQ7A 1RWRA 4XNFA 3GQ9A 1XG2A 4YZ0A 2J8IA 4OJPA 4V02C 2NTBA 4XMYA 1RU4A 4XLHA 4YCQA 3GQ7A 1L1IA 1OGOX 2PYHA 3GQAA 1JTAA 1IDJA 1BN8A 4OZZA 5AMVA 3SUCA 1KTWA 3SYJA 3FY3A 4YZXA 3ZPPA 2J8KA 1TSPA 3N6ZA 5C1CA 1QA3A 3P4GA 2X6YA 1IB4A 3RIQA 3TH0A 2VBMA 1CZFA 1EA0A 1OFMA 4YZQA 1WMRA 1KCCA 2BM5A 2F3LA 2VFQA 3ZSCA 4YELA 1EE6A 2VJJA 2XTYA 2BM6A 5JLVC 1O8MA 3LJYA 3SY2A 1PXZA 2Z8GA 3BH7B 2NTPA 4XLCA 1IDKA 4XOPA 2XTXA 2BSPA 2QZAA 2W7ZA 4NK8A 4W8TA 4XORA 2XT4A 4AVZA 3VMVA 4OJLA 2EWEA 2UVEA 2QY1A 3GQ8A 4JRAC 1K5CA 3VSTA 4C2LA 3BH6B 3B8YA 1QA1A 1K4ZA 1EZGA 2VJIA 4OZYA 2VBKA 1WXRA 2BX6A 5C1EA 1LLZA 4XM3A 3EQNA 2VFOA 2X85A 2QX3A 1TYXA 2B0RA 2VFMA 1X0CA 2VFNA 4PMHA 4W8QA 1O8HA 1GQ8A 1OOCA 1TYWA 2VBEA 3NAWA 3GRHA 3PETA 4YDTA 1BHEA 4KH3A 4HWVA 1OFDA 1KQ5A 3UW0A 2IOUG 4W8SA 1O8FA 1OFEA 1IA5A 3VSUA 4I84A 3JX8A 4XLAA 1CLWA 2O0VA 4XN3A 3B4NA 3AK5A 4Z06A 1KCDA 3JURA 1TYUA 1QJVA 1AIRA 1OGMX 2QXZA 2INUA 2YUHA 4URRA 1H80A 4XLEA 4XQFA 2O17A 1QCXA 2NSPA 3EQOA 4OJOA 4XR6A 4EW9A 4MR0A 4YEJA 1O8IA 2QYUA 2V5IA 2XC1A 1LM1A 3VSVA 1DBGA 2NT9A 1PLUA 4W8RA 2BM4A 2NSTA 1QRBA 4Z03A 2VFPA 1QRCA 2NZMA 2O6WA 4MXNA 3WWGA 2PYGA 4YEIA 3PSZA 4YZAA 1O8DA 2G0YA 1PE9A 2O04A 3LMWA 1O8GA 1DABA 4XKVA 2BM7A 1DBOA 1VBLA 2INVA 4XOTA 2XT2A 2O0WA 3H09A 4OPWA 4XN0A 1RMGA 3KRGA 2ODLA 4U49A 1HG8A
chains in the Genus database with same CATH topology
4XLFA 2NT6A 1NHCA 1O8KA 1JRGA 4OJ5A 4U4BA 1O88A 4XL9A 2X3HA 2PECA 2X6WA 2UVFA 1O8JA 4XONA 3VMWA 1O8EA 1O8LA 2O1DA 3B90A 3T9GA 4OJ6A 2NTQA 4XKWA 4NK6A 1OFLA 2X6XA 4Z05A 2IQ7A 1RWRA 4XNFA 3GQ9A 1XG2A 4YZ0A 4OJPA 2NTBA 4XMYA 1RU4A 4XLHA 3GQ7A 2PYHA 1OGOX 3GQAA 1JTAA 1IDJA 1BN8A 4OZZA 5AMVA 3SUCA 1KTWA 3ZPPA 3FY3A 4YZXA 5C1CA 2X6YA 2VBMA 1CZFA 1OFMA 4YZQA 1WMRA 1KCCA 3ZSCA 4YELA 1EE6A 2VJJA 1O8MA 1PXZA 2Z8GA 2NTPA 4XLCA 1IDKA 4XOPA 2BSPA 4W8TA 4NK8A 4XORA 4AVZA 3VMVA 4OJLA 2EWEA 2UVEA 2QY1A 3GQ8A 1K5CA 3VSTA 4C2LA 3B8YA 2VJIA 4OZYA 2VBKA 5C1EA 4XM3A 3EQNA 2X85A 2QX3A 4W8QA 4PMHA 1X0CA 1O8HA 1GQ8A 1OOCA 2VBEA 3GRHA 1BHEA 4HWVA 3UW0A 4W8SA 1O8FA 1IA5A 3VSUA 4I84A 4XLAA 2O0VA 4XN3A 3B4NA 4Z06A 1KCDA 3JURA 1QJVA 1AIRA 1OGMX 2QXZA 2INUA 4URRA 4XLEA 1H80A 1IB4A 4XQFA 2O17A 1QCXA 2NSPA 3EQOA 4OJOA 4XR6A 4EW9A 4MR0A 4YEJA 1O8IA 3VSVA 1DBGA 2NT9A 1PLUA 4W8RA 2NSTA 4Z03A 2NZMA 4MXNA 3WWGA 2PYGA 4YZAA 1O8DA 1PE9A 2O04A 3LMWA 1O8GA 4XKVA 1DBOA 1VBLA 2INVA 4XOTA 2O0WA 4XN0A 1RMGA 3KRGA 2ODLA 4U49A 1HG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLF A;  2NT6 A;  1NHC A;  1O8K A;  1JRG A;  4OJ5 A;  4U4B A;  1O88 A;  4XL9 A;  2X3H A;  2PEC A;  2X6W A;  2UVF A;  1O8J A;  4XON A;  3VMW A;  1O8E A;  1O8L A;  2O1D A;  3B90 A;  3T9G A;  4OJ6 A;  2NTQ A;  4XKW A;  4NK6 A;  1OFL A;  2X6X A;  4Z05 A;  2IQ7 A;  1RWR A;  4XNF A;  3GQ9 A;  1XG2 A;  4YZ0 A;  4OJP A;  2NTB A;  4XMY A;  1RU4 A;  4XLH A;  3GQ7 A;  2PYH A;  1OGO X;  3GQA A;  1JTA A;  1IDJ A;  1BN8 A;  4OZZ A;  5AMV A;  3SUC A;  1KTW A;  3ZPP A;  3FY3 A;  4YZX A;  5C1C A;  2X6Y A;  2VBM A;  1CZF A;  1OFM A;  4YZQ A;  1WMR A;  1KCC A;  3ZSC A;  4YEL A;  1EE6 A;  2VJJ A;  1O8M A;  1PXZ A;  2Z8G A;  2NTP A;  4XLC A;  1IDK A;  4XOP A;  2BSP A;  4W8T A;  4NK8 A;  4XOR A;  4AVZ A;  3VMV A;  4OJL A;  2EWE A;  2UVE A;  2QY1 A;  3GQ8 A;  1K5C A;  3VST A;  4C2L A;  3B8Y A;  2VJI A;  4OZY A;  2VBK A;  5C1E A;  4XM3 A;  3EQN A;  2X85 A;  2QX3 A;  4W8Q A;  4PMH A;  1X0C A;  1O8H A;  1GQ8 A;  1OOC A;  2VBE A;  3GRH A;  1BHE A;  4HWV A;  3UW0 A;  4W8S A;  1O8F A;  1IA5 A;  3VSU A;  4I84 A;  4XLA A;  2O0V A;  4XN3 A;  3B4N A;  4Z06 A;  1KCD A;  3JUR A;  1QJV A;  1AIR A;  1OGM X;  2QXZ A;  2INU A;  4URR A;  4XLE A;  1H80 A;  1IB4 A;  4XQF A;  2O17 A;  1QCX A;  2NSP A;  3EQO A;  4OJO A;  4XR6 A;  4EW9 A;  4MR0 A;  4YEJ A;  1O8I A;  3VSV A;  1DBG A;  2NT9 A;  1PLU A;  4W8R A;  2NST A;  4Z03 A;  2NZM A;  4MXN A;  3WWG A;  2PYG A;  4YZA A;  1O8D A;  1PE9 A;  2O04 A;  3LMW A;  1O8G A;  4XKV A;  1DBO A;  1VBL A;  2INV A;  4XOT A;  2O0W A;  4XN0 A;  1RMG A;  3KRG A;  2ODL A;  4U49 A;  1HG8 A; 
#chains in the Genus database with same CATH topology
 4XLF A;  2NT6 A;  1NHC A;  1O8K A;  3N90 A;  4YFO A;  1JRG A;  1QQ1 A;  4OJ5 A;  1K8F A;  3SZE A;  4U4B A;  3ML3 A;  3SQV A;  3LYC A;  1O88 A;  4XL9 A;  5JMC B;  2X3H A;  2PEC A;  2X6W A;  3DU1 X;  2XTW A;  4OM9 A;  2UVF A;  1O8J A;  3NB2 A;  4XON A;  3PSS A;  1HF2 A;  1O8E A;  3VMW A;  1O8L A;  1TYV A;  2O1D A;  3B90 A;  3T9G A;  1QA2 A;  4OJ6 A;  2NTQ A;  4XKW A;  4NK6 A;  1OFL A;  2X6X A;  1LLW A;  4YC5 A;  5DNS A;  4Z05 A;  2IQ7 A;  1RWR A;  4XNF A;  3GQ9 A;  1XG2 A;  4YZ0 A;  2J8I A;  4OJP A;  4V02 C;  2NTB A;  4XMY A;  1RU4 A;  4XLH A;  4YCQ A;  3GQ7 A;  1L1I A;  1OGO X;  2PYH A;  3GQA A;  1JTA A;  1IDJ A;  1BN8 A;  4OZZ A;  5AMV A;  3SUC A;  1KTW A;  3SYJ A;  3FY3 A;  4YZX A;  3ZPP A;  2J8K A;  1TSP A;  3N6Z A;  5C1C A;  1QA3 A;  3P4G A;  2X6Y A;  1IB4 A;  3RIQ A;  3TH0 A;  2VBM A;  1CZF A;  1EA0 A;  1OFM A;  4YZQ A;  1WMR A;  1KCC A;  2BM5 A;  2F3L A;  2VFQ A;  3ZSC A;  4YEL A;  1EE6 A;  2VJJ A;  2XTY A;  2BM6 A;  5JLV C;  1O8M A;  3LJY A;  3SY2 A;  1PXZ A;  2Z8G A;  3BH7 B;  2NTP A;  4XLC A;  1IDK A;  4XOP A;  2XTX A;  2BSP A;  2QZA A;  2W7Z A;  4NK8 A;  4W8T A;  4XOR A;  2XT4 A;  4AVZ A;  3VMV A;  4OJL A;  2EWE A;  2UVE A;  2QY1 A;  3GQ8 A;  4JRA C;  1K5C A;  3VST A;  4C2L A;  3BH6 B;  3B8Y A;  1QA1 A;  1K4Z A;  1EZG A;  2VJI A;  4OZY A;  2VBK A;  1WXR A;  2BX6 A;  5C1E A;  1LLZ A;  4XM3 A;  3EQN A;  2VFO A;  2X85 A;  2QX3 A;  1TYX A;  2B0R A;  2VFM A;  1X0C A;  2VFN A;  4PMH A;  4W8Q A;  1O8H A;  1GQ8 A;  1OOC A;  1TYW A;  2VBE A;  3NAW A;  3GRH A;  3PET A;  4YDT A;  1BHE A;  4KH3 A;  4HWV A;  1OFD A;  1KQ5 A;  3UW0 A;  2IOU G;  4W8S A;  1O8F A;  1OFE A;  1IA5 A;  3VSU A;  4I84 A;  3JX8 A;  4XLA A;  1CLW A;  2O0V A;  4XN3 A;  3B4N A;  3AK5 A;  4Z06 A;  1KCD A;  3JUR A;  1TYU A;  1QJV A;  1AIR A;  1OGM X;  2QXZ A;  2INU A;  2YUH A;  4URR A;  1H80 A;  4XLE A;  4XQF A;  2O17 A;  1QCX A;  2NSP A;  3EQO A;  4OJO A;  4XR6 A;  4EW9 A;  4MR0 A;  4YEJ A;  1O8I A;  2QYU A;  2V5I A;  2XC1 A;  1LM1 A;  3VSV A;  1DBG A;  2NT9 A;  1PLU A;  4W8R A;  2BM4 A;  2NST A;  1QRB A;  4Z03 A;  2VFP A;  1QRC A;  2NZM A;  2O6W A;  4MXN A;  3WWG A;  2PYG A;  4YEI A;  3PSZ A;  4YZA A;  1O8D A;  2G0Y A;  1PE9 A;  2O04 A;  3LMW A;  1O8G A;  1DAB A;  4XKV A;  2BM7 A;  1DBO A;  1VBL A;  2INV A;  4XOT A;  2XT2 A;  2O0W A;  3H09 A;  4OPW A;  4XN0 A;  1RMG A;  3KRG A;  2ODL A;  4U49 A;  1HG8 A; 
#chains in the Genus database with same CATH homology
 4XLF A;  2NT6 A;  1NHC A;  1O8K A;  1JRG A;  4OJ5 A;  4U4B A;  1O88 A;  4XL9 A;  2X3H A;  2PEC A;  2X6W A;  2UVF A;  1O8J A;  4XON A;  3VMW A;  1O8E A;  1O8L A;  2O1D A;  3B90 A;  3T9G A;  4OJ6 A;  2NTQ A;  4XKW A;  4NK6 A;  1OFL A;  2X6X A;  4Z05 A;  2IQ7 A;  1RWR A;  4XNF A;  3GQ9 A;  1XG2 A;  4YZ0 A;  4OJP A;  2NTB A;  4XMY A;  1RU4 A;  4XLH A;  3GQ7 A;  2PYH A;  1OGO X;  3GQA A;  1JTA A;  1IDJ A;  1BN8 A;  4OZZ A;  5AMV A;  3SUC A;  1KTW A;  3ZPP A;  3FY3 A;  4YZX A;  5C1C A;  2X6Y A;  2VBM A;  1CZF A;  1OFM A;  4YZQ A;  1WMR A;  1KCC A;  3ZSC A;  4YEL A;  1EE6 A;  2VJJ A;  1O8M A;  1PXZ A;  2Z8G A;  2NTP A;  4XLC A;  1IDK A;  4XOP A;  2BSP A;  4W8T A;  4NK8 A;  4XOR A;  4AVZ A;  3VMV A;  4OJL A;  2EWE A;  2UVE A;  2QY1 A;  3GQ8 A;  1K5C A;  3VST A;  4C2L A;  3B8Y A;  2VJI A;  4OZY A;  2VBK A;  5C1E A;  4XM3 A;  3EQN A;  2X85 A;  2QX3 A;  4W8Q A;  4PMH A;  1X0C A;  1O8H A;  1GQ8 A;  1OOC A;  2VBE A;  3GRH A;  1BHE A;  4HWV A;  3UW0 A;  4W8S A;  1O8F A;  1IA5 A;  3VSU A;  4I84 A;  4XLA A;  2O0V A;  4XN3 A;  3B4N A;  4Z06 A;  1KCD A;  3JUR A;  1QJV A;  1AIR A;  1OGM X;  2QXZ A;  2INU A;  4URR A;  4XLE A;  1H80 A;  1IB4 A;  4XQF A;  2O17 A;  1QCX A;  2NSP A;  3EQO A;  4OJO A;  4XR6 A;  4EW9 A;  4MR0 A;  4YEJ A;  1O8I A;  3VSV A;  1DBG A;  2NT9 A;  1PLU A;  4W8R A;  2NST A;  4Z03 A;  2NZM A;  4MXN A;  3WWG A;  2PYG A;  4YZA A;  1O8D A;  1PE9 A;  2O04 A;  3LMW A;  1O8G A;  4XKV A;  1DBO A;  1VBL A;  2INV A;  4XOT A;  2O0W A;  4XN0 A;  1RMG A;  3KRG A;  2ODL A;  4U49 A;  1HG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...