4NK8A

Crystal structure of the periplasmic alginate epimerase algg d317a mutant
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
424
structure length
417
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIAPHDRSHGLIIAENDVYGTKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 166
structure length 417
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk8A00
2NSTA 2O17A 4Z03A 4NK6A 2IQ7A 3LMWA 1PXZA 2ODLA 4YZQA 4OJ5A 1IB4A 1DBOA 2Z8GA 1K5CA 2O04A 4XL9A 1BHEA 2X3HA 3VSVA 2NTBA 4MXNA 1WMRA 1QCXA 1PE9A 2INVA 1PLUA 4XOPA 1KTWA 1OGOX 4NK8A 1RWRA 4XLAA 2PYHA 1AIRA 1O8HA 3VMWA 4XLFA 3GQAA 4XLHA 4U49A 1NHCA 2NSPA 3FY3A 4MR0A 4W8SA 4I84A 2O0WA 1IDJA 1BN8A 2X6YA 3UW0A 1IA5A 1GQ8A 1O8IA 2NTQA 1OFMA 5AMVA 3VSUA 1O8FA 2VBKA 1HG8A 2PECA 4XNFA 4XLCA 3B90A 2QXZA 1DBGA 4XR6A 2BSPA 1OGMX 4XN0A 4OJLA 3B8YA 4C2LA 4U4BA 3EQOA 3GRHA 2O1DA 2PYGA 3B4NA 4AVZA 4XKVA 4OJ6A 4YZAA 4YEJA 4YZ0A 4Z05A 2QY1A 1VBLA 4YELA 4W8QA 2UVFA 1KCCA 4URRA 3EQNA 3ZPPA 5C1EA 3GQ8A 2O0VA 3T9GA 1JTAA 4EW9A 3ZSCA 4XN3A 1X0CA 1XG2A 4XLEA 4PMHA 1RU4A 3GQ9A 2NZMA 2X85A 3WWGA 4OZYA 3SUCA 2VJIA 4OZZA 1OFLA 3JURA 1IDKA 4XONA 5C1CA 4HWVA 4Z06A 1QJVA 4XM3A 2EWEA 2QX3A 1O8MA 2VJJA 4XORA 1KCDA 2NTPA 3VMVA 1O8GA 2VBMA 3VSTA 1O8JA 2INUA 1O8KA 4OJPA 4XKWA 4XOTA 1O8LA 2NT6A 1O8EA 1JRGA 1EE6A 1H80A 1O88A 3KRGA 2NT9A 4YZXA 4XMYA 1O8DA 1OOCA 4W8TA 2VBEA 1CZFA 2UVEA 4OJOA 4W8RA 3GQ7A 2X6XA 1RMGA 2X6WA 4XQFA
chains in the Genus database with same CATH superfamily
2XTWA 1WXRA 2NSTA 2O17A 4Z03A 1L1IA 3N90A 2XTXA 4NK6A 2IQ7A 1TYWA 3LMWA 4YFOA 1PXZA 2ODLA 4YZQA 4OJ5A 1CLWA 3N6ZA 1IB4A 1DBOA 1LLZA 2Z8GA 1K5CA 1HF2A 2O04A 2QZAA 4XL9A 1BHEA 1QA1A 2X3HA 1TYUA 1TYXA 3VSVA 2NTBA 4MXNA 1WMRA 1QCXA 1PE9A 3TH0A 2YUHA 4OM9A 4YC5A 2INVA 2QYUA 1PLUA 4XOPA 1KTWA 1OGOX 2XTYA 4NK8A 3SY2A 1RWRA 4XLAA 2PYHA 3RIQA 1AIRA 1O8HA 3VMWA 1TSPA 4XLFA 3GQAA 2VFQA 4YDTA 2B0RA 1K4ZA 1LM1A 2VFOA 4XLHA 4U49A 1NHCA 2F3LA 2NSPA 3FY3A 4MR0A 4W8SA 4I84A 2O0WA 1QA3A 3SZEA 1LLWA 1IDJA 1BN8A 1QRCA 2IOUG 2X6YA 2XC1A 3UW0A 1IA5A 1GQ8A 1O8IA 2NTQA 1OFMA 5AMVA 3VSUA 1O8FA 2VBKA 1K8FA 1HG8A 2PECA 1QRBA 4XNFA 1TYVA 4XLCA 3B90A 2QXZA 1DBGA 4XR6A 3PSSA 2BSPA 1OGMX 3DU1X 4OJLA 4V02C 4XN0A 3B8YA 1EA0A 4C2LA 4U4BA 3EQOA 3GRHA 2O1DA 2PYGA 3B4NA 4AVZA 4XKVA 4OJ6A 1DABA 3H09A 4YZAA 4YEJA 3PSZA 4YZ0A 4Z05A 2QY1A 1VBLA 3JX8A 4YELA 4W8QA 2UVFA 5DNSA 1KCCA 2BM6A 2G0YA 3EQNA 4URRA 3ZPPA 5C1EA 3GQ8A 2O0VA 3T9GA 1JTAA 4EW9A 3LYCA 3ZSCA 2O6WA 2XT4A 4XN3A 1X0CA 1XG2A 3LJYA 3BH7B 1QA2A 3BH6B 4XLEA 2VFMA 2BM7A 4PMHA 4YCQA 3SYJA 1RU4A 3GQ9A 2J8KA 2NZMA 2X85A 3WWGA 3ML3A 4OZYA 3SUCA 4KH3A 2VJIA 3NB2A 4OZZA 1OFDA 1OFLA 3JURA 5JLVC 1IDKA 2W7ZA 1KQ5A 4HWVA 4XONA 3SQVA 4JRAC 5C1CA 4Z06A 1QJVA 2V5IA 4XM3A 4YEIA 2EWEA 2QX3A 3P4GA 1O8MA 2BM4A 2VJJA 4XORA 1KCDA 3PETA 2NTPA 3VMVA 1O8GA 2VBMA 2J8IA 3VSTA 2XT2A 1O8JA 1OFEA 2INUA 4OPWA 1O8KA 4OJPA 4XKWA 4XOTA 2VFPA 1O8LA 1O8EA 2NT6A 1JRGA 1EE6A 1H80A 1O88A 3KRGA 2NT9A 1EZGA 4YZXA 3NAWA 5JMCB 4XMYA 2BM5A 1O8DA 1OOCA 4W8TA 2VBEA 3AK5A 1CZFA 1QQ1A 2UVEA 4OJOA 4W8RA 3GQ7A 2BX6A 2X6XA 1RMGA 2VFNA 2X6WA 4XQFA
chains in the Genus database with same CATH topology
2NSTA 2O17A 4Z03A 4NK6A 2IQ7A 3LMWA 1PXZA 2ODLA 4YZQA 4OJ5A 1IB4A 1DBOA 2Z8GA 1K5CA 2O04A 4XL9A 1BHEA 2X3HA 3VSVA 2NTBA 4MXNA 1WMRA 1QCXA 1PE9A 2INVA 1PLUA 4XOPA 1KTWA 1OGOX 4NK8A 1RWRA 4XLAA 2PYHA 1AIRA 1O8HA 3VMWA 4XLFA 3GQAA 4XLHA 4U49A 1NHCA 2NSPA 3FY3A 4MR0A 4W8SA 4I84A 2O0WA 1IDJA 1BN8A 2X6YA 3UW0A 1IA5A 1GQ8A 1O8IA 2NTQA 1OFMA 5AMVA 3VSUA 1O8FA 2VBKA 1HG8A 2PECA 4XNFA 4XLCA 3B90A 2QXZA 1DBGA 4XR6A 2BSPA 1OGMX 4XN0A 4OJLA 3B8YA 4C2LA 4U4BA 3EQOA 3GRHA 2O1DA 2PYGA 3B4NA 4AVZA 4XKVA 4OJ6A 4YZAA 4YEJA 4YZ0A 4Z05A 2QY1A 1VBLA 4YELA 4W8QA 2UVFA 1KCCA 4URRA 3EQNA 3ZPPA 5C1EA 3GQ8A 2O0VA 3T9GA 1JTAA 4EW9A 3ZSCA 4XN3A 1X0CA 1XG2A 4XLEA 4PMHA 1RU4A 3GQ9A 2NZMA 2X85A 3WWGA 4OZYA 3SUCA 2VJIA 4OZZA 1OFLA 3JURA 1IDKA 4XONA 5C1CA 4HWVA 4Z06A 1QJVA 4XM3A 2EWEA 2QX3A 1O8MA 2VJJA 4XORA 1KCDA 2NTPA 3VMVA 1O8GA 2VBMA 3VSTA 1O8JA 2INUA 1O8KA 4OJPA 4XKWA 4XOTA 1O8LA 2NT6A 1O8EA 1JRGA 1EE6A 1H80A 1O88A 3KRGA 2NT9A 4YZXA 4XMYA 1O8DA 1OOCA 4W8TA 2VBEA 1CZFA 2UVEA 4OJOA 4W8RA 3GQ7A 2X6XA 1RMGA 2X6WA 4XQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NST A;  2O17 A;  4Z03 A;  4NK6 A;  2IQ7 A;  3LMW A;  1PXZ A;  2ODL A;  4YZQ A;  4OJ5 A;  1IB4 A;  1DBO A;  2Z8G A;  1K5C A;  2O04 A;  4XL9 A;  1BHE A;  2X3H A;  3VSV A;  2NTB A;  4MXN A;  1WMR A;  1QCX A;  1PE9 A;  2INV A;  1PLU A;  4XOP A;  1KTW A;  1OGO X;  4NK8 A;  1RWR A;  4XLA A;  2PYH A;  1AIR A;  1O8H A;  3VMW A;  4XLF A;  3GQA A;  4XLH A;  4U49 A;  1NHC A;  2NSP A;  3FY3 A;  4MR0 A;  4W8S A;  4I84 A;  2O0W A;  1IDJ A;  1BN8 A;  2X6Y A;  3UW0 A;  1IA5 A;  1GQ8 A;  1O8I A;  2NTQ A;  1OFM A;  5AMV A;  3VSU A;  1O8F A;  2VBK A;  1HG8 A;  2PEC A;  4XNF A;  4XLC A;  3B90 A;  2QXZ A;  1DBG A;  4XR6 A;  2BSP A;  1OGM X;  4XN0 A;  4OJL A;  3B8Y A;  4C2L A;  4U4B A;  3EQO A;  3GRH A;  2O1D A;  2PYG A;  3B4N A;  4AVZ A;  4XKV A;  4OJ6 A;  4YZA A;  4YEJ A;  4YZ0 A;  4Z05 A;  2QY1 A;  1VBL A;  4YEL A;  4W8Q A;  2UVF A;  1KCC A;  4URR A;  3EQN A;  3ZPP A;  5C1E A;  3GQ8 A;  2O0V A;  3T9G A;  1JTA A;  4EW9 A;  3ZSC A;  4XN3 A;  1X0C A;  1XG2 A;  4XLE A;  4PMH A;  1RU4 A;  3GQ9 A;  2NZM A;  2X85 A;  3WWG A;  4OZY A;  3SUC A;  2VJI A;  4OZZ A;  1OFL A;  3JUR A;  1IDK A;  4XON A;  5C1C A;  4HWV A;  4Z06 A;  1QJV A;  4XM3 A;  2EWE A;  2QX3 A;  1O8M A;  2VJJ A;  4XOR A;  1KCD A;  2NTP A;  3VMV A;  1O8G A;  2VBM A;  3VST A;  1O8J A;  2INU A;  1O8K A;  4OJP A;  4XKW A;  4XOT A;  1O8L A;  2NT6 A;  1O8E A;  1JRG A;  1EE6 A;  1H80 A;  1O88 A;  3KRG A;  2NT9 A;  4YZX A;  4XMY A;  1O8D A;  1OOC A;  4W8T A;  2VBE A;  1CZF A;  2UVE A;  4OJO A;  4W8R A;  3GQ7 A;  2X6X A;  1RMG A;  2X6W A;  4XQF A; 
#chains in the Genus database with same CATH topology
 2XTW A;  1WXR A;  2NST A;  2O17 A;  4Z03 A;  1L1I A;  3N90 A;  2XTX A;  4NK6 A;  2IQ7 A;  1TYW A;  3LMW A;  4YFO A;  1PXZ A;  2ODL A;  4YZQ A;  4OJ5 A;  1CLW A;  3N6Z A;  1IB4 A;  1DBO A;  1LLZ A;  2Z8G A;  1K5C A;  1HF2 A;  2O04 A;  2QZA A;  4XL9 A;  1BHE A;  1QA1 A;  2X3H A;  1TYU A;  1TYX A;  3VSV A;  2NTB A;  4MXN A;  1WMR A;  1QCX A;  1PE9 A;  3TH0 A;  2YUH A;  4OM9 A;  4YC5 A;  2INV A;  2QYU A;  1PLU A;  4XOP A;  1KTW A;  1OGO X;  2XTY A;  4NK8 A;  3SY2 A;  1RWR A;  4XLA A;  2PYH A;  3RIQ A;  1AIR A;  1O8H A;  3VMW A;  1TSP A;  4XLF A;  3GQA A;  2VFQ A;  4YDT A;  2B0R A;  1K4Z A;  1LM1 A;  2VFO A;  4XLH A;  4U49 A;  1NHC A;  2F3L A;  2NSP A;  3FY3 A;  4MR0 A;  4W8S A;  4I84 A;  2O0W A;  1QA3 A;  3SZE A;  1LLW A;  1IDJ A;  1BN8 A;  1QRC A;  2IOU G;  2X6Y A;  2XC1 A;  3UW0 A;  1IA5 A;  1GQ8 A;  1O8I A;  2NTQ A;  1OFM A;  5AMV A;  3VSU A;  1O8F A;  2VBK A;  1K8F A;  1HG8 A;  2PEC A;  1QRB A;  4XNF A;  1TYV A;  4XLC A;  3B90 A;  2QXZ A;  1DBG A;  4XR6 A;  3PSS A;  2BSP A;  1OGM X;  3DU1 X;  4OJL A;  4V02 C;  4XN0 A;  3B8Y A;  1EA0 A;  4C2L A;  4U4B A;  3EQO A;  3GRH A;  2O1D A;  2PYG A;  3B4N A;  4AVZ A;  4XKV A;  4OJ6 A;  1DAB A;  3H09 A;  4YZA A;  4YEJ A;  3PSZ A;  4YZ0 A;  4Z05 A;  2QY1 A;  1VBL A;  3JX8 A;  4YEL A;  4W8Q A;  2UVF A;  5DNS A;  1KCC A;  2BM6 A;  2G0Y A;  3EQN A;  4URR A;  3ZPP A;  5C1E A;  3GQ8 A;  2O0V A;  3T9G A;  1JTA A;  4EW9 A;  3LYC A;  3ZSC A;  2O6W A;  2XT4 A;  4XN3 A;  1X0C A;  1XG2 A;  3LJY A;  3BH7 B;  1QA2 A;  3BH6 B;  4XLE A;  2VFM A;  2BM7 A;  4PMH A;  4YCQ A;  3SYJ A;  1RU4 A;  3GQ9 A;  2J8K A;  2NZM A;  2X85 A;  3WWG A;  3ML3 A;  4OZY A;  3SUC A;  4KH3 A;  2VJI A;  3NB2 A;  4OZZ A;  1OFD A;  1OFL A;  3JUR A;  5JLV C;  1IDK A;  2W7Z A;  1KQ5 A;  4HWV A;  4XON A;  3SQV A;  4JRA C;  5C1C A;  4Z06 A;  1QJV A;  2V5I A;  4XM3 A;  4YEI A;  2EWE A;  2QX3 A;  3P4G A;  1O8M A;  2BM4 A;  2VJJ A;  4XOR A;  1KCD A;  3PET A;  2NTP A;  3VMV A;  1O8G A;  2VBM A;  2J8I A;  3VST A;  2XT2 A;  1O8J A;  1OFE A;  2INU A;  4OPW A;  1O8K A;  4OJP A;  4XKW A;  4XOT A;  2VFP A;  1O8L A;  1O8E A;  2NT6 A;  1JRG A;  1EE6 A;  1H80 A;  1O88 A;  3KRG A;  2NT9 A;  1EZG A;  4YZX A;  3NAW A;  5JMC B;  4XMY A;  2BM5 A;  1O8D A;  1OOC A;  4W8T A;  2VBE A;  3AK5 A;  1CZF A;  1QQ1 A;  2UVE A;  4OJO A;  4W8R A;  3GQ7 A;  2BX6 A;  2X6X A;  1RMG A;  2VFN A;  2X6W A;  4XQF A; 
#chains in the Genus database with same CATH homology
 2NST A;  2O17 A;  4Z03 A;  4NK6 A;  2IQ7 A;  3LMW A;  1PXZ A;  2ODL A;  4YZQ A;  4OJ5 A;  1IB4 A;  1DBO A;  2Z8G A;  1K5C A;  2O04 A;  4XL9 A;  1BHE A;  2X3H A;  3VSV A;  2NTB A;  4MXN A;  1WMR A;  1QCX A;  1PE9 A;  2INV A;  1PLU A;  4XOP A;  1KTW A;  1OGO X;  4NK8 A;  1RWR A;  4XLA A;  2PYH A;  1AIR A;  1O8H A;  3VMW A;  4XLF A;  3GQA A;  4XLH A;  4U49 A;  1NHC A;  2NSP A;  3FY3 A;  4MR0 A;  4W8S A;  4I84 A;  2O0W A;  1IDJ A;  1BN8 A;  2X6Y A;  3UW0 A;  1IA5 A;  1GQ8 A;  1O8I A;  2NTQ A;  1OFM A;  5AMV A;  3VSU A;  1O8F A;  2VBK A;  1HG8 A;  2PEC A;  4XNF A;  4XLC A;  3B90 A;  2QXZ A;  1DBG A;  4XR6 A;  2BSP A;  1OGM X;  4XN0 A;  4OJL A;  3B8Y A;  4C2L A;  4U4B A;  3EQO A;  3GRH A;  2O1D A;  2PYG A;  3B4N A;  4AVZ A;  4XKV A;  4OJ6 A;  4YZA A;  4YEJ A;  4YZ0 A;  4Z05 A;  2QY1 A;  1VBL A;  4YEL A;  4W8Q A;  2UVF A;  1KCC A;  4URR A;  3EQN A;  3ZPP A;  5C1E A;  3GQ8 A;  2O0V A;  3T9G A;  1JTA A;  4EW9 A;  3ZSC A;  4XN3 A;  1X0C A;  1XG2 A;  4XLE A;  4PMH A;  1RU4 A;  3GQ9 A;  2NZM A;  2X85 A;  3WWG A;  4OZY A;  3SUC A;  2VJI A;  4OZZ A;  1OFL A;  3JUR A;  1IDK A;  4XON A;  5C1C A;  4HWV A;  4Z06 A;  1QJV A;  4XM3 A;  2EWE A;  2QX3 A;  1O8M A;  2VJJ A;  4XOR A;  1KCD A;  2NTP A;  3VMV A;  1O8G A;  2VBM A;  3VST A;  1O8J A;  2INU A;  1O8K A;  4OJP A;  4XKW A;  4XOT A;  1O8L A;  2NT6 A;  1O8E A;  1JRG A;  1EE6 A;  1H80 A;  1O88 A;  3KRG A;  2NT9 A;  4YZX A;  4XMY A;  1O8D A;  1OOC A;  4W8T A;  2VBE A;  1CZF A;  2UVE A;  4OJO A;  4W8R A;  3GQ7 A;  2X6X A;  1RMG A;  2X6W A;  4XQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...