4NK8A

Crystal structure of the periplasmic alginate epimerase algg d317a mutant
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
424
structure length
417
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIATKMASMGYNQSSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVGNTYRDNIVYGIAPHDRSHGLIIAENDVYGTKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Catalytic Mechanism and Mode of Action of the Periplasmic Alginate Epimerase AlgG.
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 166
structure length 417
sequence length 424
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4nk8A00
1PE9A 3JURA 1JRGA 4XLAA 4XR6A 1KCDA 1EE6A 1IDJA 3VSVA 1RU4A 3FY3A 4URRA 2NT9A 3T9GA 3SUCA 4XONA 4YZ0A 1WMRA 4XLCA 3B4NA 1OGMX 4W8TA 4OJOA 4XLEA 1RWRA 1O8DA 2QX3A 4YEJA 1QJVA 2VJJA 4YZXA 1O8FA 4XQFA 3EQNA 2VBMA 2NTBA 3B90A 1CZFA 2ODLA 4XKVA 4XL9A 4XN0A 3UW0A 1GQ8A 4XKWA 3VMVA 3ZPPA 1O8LA 4EW9A 3GQ7A 1NHCA 1O8KA 1PXZA 1VBLA 3KRGA 2NTPA 2NSPA 1DBGA 4W8SA 2INVA 1OFMA 1IA5A 4XOTA 2O04A 4Z06A 1XG2A 4Z05A 4XM3A 4YZQA 1OFLA 1O8HA 3VMWA 3GQAA 1O8GA 2QXZA 4XNFA 4HWVA 1KTWA 4U4BA 4XORA 1BHEA 4W8RA 2X6XA 5AMVA 4AVZA 1KCCA 1O8MA 4NK6A 2NT6A 2PECA 2X3HA 4U49A 2IQ7A 4OJLA 2O17A 1O88A 1JTAA 5C1CA 3GQ8A 4C2LA 4XN3A 2UVFA 1QCXA 1AIRA 1OGOX 4YZAA 2O1DA 4MR0A 5C1EA 4I84A 2O0VA 2PYHA 1O8IA 4XLFA 2NSTA 2X6YA 1K5CA 4NK8A 2O0WA 4OZYA 3GQ9A 2NZMA 2PYGA 3WWGA 1O8EA 4MXNA 1HG8A 4XOPA 3LMWA 1X0CA 3ZSCA 3VSTA 3VSUA 4XLHA 1RMGA 4XMYA 2VBKA 2EWEA 3B8YA 1PLUA 1IDKA 1H80A 2QY1A 2NTQA 2VJIA 4YELA 2Z8GA 4OJPA 3EQOA 2BSPA 1OOCA 2UVEA 4PMHA 4OZZA 4Z03A 2INUA 1DBOA 2X6WA 3GRHA 4W8QA 1O8JA 1IB4A 4OJ6A 2X85A 4OJ5A 1BN8A 2VBEA
chains in the Genus database with same CATH superfamily
1PE9A 3JURA 1JRGA 4XLAA 4XR6A 3PSSA 1KCDA 1EE6A 1TYUA 4YC5A 1IDJA 3N90A 1TYWA 2BM4A 2VFPA 3VSVA 1RU4A 1QA3A 3FY3A 4URRA 2NT9A 3JX8A 3H09A 3SUCA 4XONA 3T9GA 4YZ0A 1WMRA 4XLCA 4OPWA 2BM6A 3B4NA 3RIQA 1QA1A 1QRCA 1OGMX 4W8TA 4OJOA 4XLEA 1RWRA 1O8DA 2QX3A 4YEJA 1QJVA 2J8KA 2VFOA 2VJJA 2XTXA 3BH7B 1O8FA 4XQFA 2XTWA 3EQNA 2VBMA 2NTBA 3B90A 1CZFA 2ODLA 4XKVA 4XL9A 4XN0A 3UW0A 1GQ8A 4XKWA 4YFOA 2B0RA 1HF2A 3VMVA 3ZPPA 1O8LA 4EW9A 3GQ7A 1NHCA 1O8KA 1PXZA 1VBLA 1KQ5A 3KRGA 2NTPA 3N6ZA 2NSPA 1DBGA 4W8SA 2INVA 1OFMA 1IA5A 3SZEA 4XOTA 2O04A 4Z06A 4OM9A 3SY2A 2G0YA 1XG2A 3P4GA 4Z05A 4XM3A 4YZQA 1OFLA 2O6WA 1O8HA 3VMWA 3LYCA 3TH0A 1L1IA 1LLWA 2BM7A 3GQAA 1O8GA 2J8IA 4V02C 2VFQA 2QXZA 4XNFA 4HWVA 1KTWA 4U4BA 4XORA 1LM1A 2YUHA 1BHEA 5JMCB 4W8RA 2QZAA 2X6XA 5AMVA 2W7ZA 4AVZA 1KCCA 1O8MA 3ML3A 1CLWA 5DNSA 4NK6A 2NT6A 4YZXA 2XT4A 2PECA 2X3HA 1DABA 2F3LA 4YEIA 4U49A 2IQ7A 4OJLA 2O17A 4YCQA 1O88A 1JTAA 5C1CA 3GQ8A 4C2LA 4XN3A 2UVFA 1QCXA 1AIRA 2BX6A 1OGOX 1QRBA 4YZAA 1QA2A 4KH3A 2O1DA 1TYXA 4MR0A 4I84A 5C1EA 2O0VA 2QYUA 2PYHA 2VFNA 2XTYA 1O8IA 4XLFA 2NSTA 2X6YA 2V5IA 4NK8A 1OFDA 2O0WA 4OZYA 1K5CA 3GQ9A 2XC1A 1K4ZA 2NZMA 2PYGA 3WWGA 1O8EA 3NB2A 4MXNA 1HG8A 4XOPA 3LMWA 3PETA 1X0CA 1OFEA 3VSTA 3ZSCA 3VSUA 4XLHA 1QQ1A 4YDTA 1LLZA 1RMGA 2VFMA 4XMYA 1EZGA 2VBKA 3NAWA 2EWEA 3B8YA 1PLUA 1IDKA 3DU1X 1EA0A 1H80A 2IOUG 2QY1A 2NTQA 2VJIA 4YELA 2Z8GA 3AK5A 3BH6B 4OJPA 3PSZA 3LJYA 3EQOA 2BSPA 1OOCA 2UVEA 4PMHA 4OZZA 3SYJA 4Z03A 2INUA 1DBOA 2X6WA 3GRHA 4W8QA 1O8JA 1WXRA 1TYVA 4JRAC 4OJ6A 3SQVA 1K8FA 1IB4A 2X85A 2XT2A 1TSPA 4OJ5A 5JLVC 2BM5A 1BN8A 2VBEA
chains in the Genus database with same CATH topology
1PE9A 3JURA 1JRGA 4XLAA 4XR6A 1KCDA 1EE6A 1IDJA 3VSVA 1RU4A 3FY3A 4URRA 2NT9A 3T9GA 3SUCA 4XONA 4YZ0A 1WMRA 4XLCA 3B4NA 1OGMX 4W8TA 4OJOA 4XLEA 1RWRA 1O8DA 2QX3A 4YEJA 1QJVA 2VJJA 4YZXA 1O8FA 4XQFA 3EQNA 2VBMA 2NTBA 3B90A 1CZFA 2ODLA 4XKVA 4XL9A 4XN0A 3UW0A 1GQ8A 4XKWA 3VMVA 3ZPPA 1O8LA 4EW9A 3GQ7A 1NHCA 1O8KA 1PXZA 1VBLA 3KRGA 2NTPA 2NSPA 1DBGA 4W8SA 2INVA 1OFMA 1IA5A 4XOTA 2O04A 4Z06A 1XG2A 4Z05A 4XM3A 4YZQA 1OFLA 1O8HA 3VMWA 3GQAA 1O8GA 2QXZA 4XNFA 4HWVA 1KTWA 4U4BA 4XORA 1BHEA 4W8RA 2X6XA 5AMVA 4AVZA 1KCCA 1O8MA 4NK6A 2NT6A 2PECA 2X3HA 4U49A 2IQ7A 4OJLA 2O17A 1O88A 1JTAA 5C1CA 3GQ8A 4C2LA 4XN3A 2UVFA 1QCXA 1AIRA 1OGOX 4YZAA 2O1DA 4MR0A 5C1EA 4I84A 2O0VA 2PYHA 1O8IA 4XLFA 2NSTA 2X6YA 1K5CA 4NK8A 2O0WA 4OZYA 3GQ9A 2NZMA 2PYGA 3WWGA 1O8EA 4MXNA 1HG8A 4XOPA 3LMWA 1X0CA 3ZSCA 3VSTA 3VSUA 4XLHA 1RMGA 4XMYA 2VBKA 2EWEA 3B8YA 1PLUA 1IDKA 1H80A 2QY1A 2NTQA 2VJIA 4YELA 2Z8GA 4OJPA 3EQOA 2BSPA 1OOCA 2UVEA 4PMHA 4OZZA 4Z03A 2INUA 1DBOA 2X6WA 3GRHA 4W8QA 1O8JA 1IB4A 4OJ6A 2X85A 4OJ5A 1BN8A 2VBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE9 A;  3JUR A;  1JRG A;  4XLA A;  4XR6 A;  1KCD A;  1EE6 A;  1IDJ A;  3VSV A;  1RU4 A;  3FY3 A;  4URR A;  2NT9 A;  3T9G A;  3SUC A;  4XON A;  4YZ0 A;  1WMR A;  4XLC A;  3B4N A;  1OGM X;  4W8T A;  4OJO A;  4XLE A;  1RWR A;  1O8D A;  2QX3 A;  4YEJ A;  1QJV A;  2VJJ A;  4YZX A;  1O8F A;  4XQF A;  3EQN A;  2VBM A;  2NTB A;  3B90 A;  1CZF A;  2ODL A;  4XKV A;  4XL9 A;  4XN0 A;  3UW0 A;  1GQ8 A;  4XKW A;  3VMV A;  3ZPP A;  1O8L A;  4EW9 A;  3GQ7 A;  1NHC A;  1O8K A;  1PXZ A;  1VBL A;  3KRG A;  2NTP A;  2NSP A;  1DBG A;  4W8S A;  2INV A;  1OFM A;  1IA5 A;  4XOT A;  2O04 A;  4Z06 A;  1XG2 A;  4Z05 A;  4XM3 A;  4YZQ A;  1OFL A;  1O8H A;  3VMW A;  3GQA A;  1O8G A;  2QXZ A;  4XNF A;  4HWV A;  1KTW A;  4U4B A;  4XOR A;  1BHE A;  4W8R A;  2X6X A;  5AMV A;  4AVZ A;  1KCC A;  1O8M A;  4NK6 A;  2NT6 A;  2PEC A;  2X3H A;  4U49 A;  2IQ7 A;  4OJL A;  2O17 A;  1O88 A;  1JTA A;  5C1C A;  3GQ8 A;  4C2L A;  4XN3 A;  2UVF A;  1QCX A;  1AIR A;  1OGO X;  4YZA A;  2O1D A;  4MR0 A;  5C1E A;  4I84 A;  2O0V A;  2PYH A;  1O8I A;  4XLF A;  2NST A;  2X6Y A;  1K5C A;  4NK8 A;  2O0W A;  4OZY A;  3GQ9 A;  2NZM A;  2PYG A;  3WWG A;  1O8E A;  4MXN A;  1HG8 A;  4XOP A;  3LMW A;  1X0C A;  3ZSC A;  3VST A;  3VSU A;  4XLH A;  1RMG A;  4XMY A;  2VBK A;  2EWE A;  3B8Y A;  1PLU A;  1IDK A;  1H80 A;  2QY1 A;  2NTQ A;  2VJI A;  4YEL A;  2Z8G A;  4OJP A;  3EQO A;  2BSP A;  1OOC A;  2UVE A;  4PMH A;  4OZZ A;  4Z03 A;  2INU A;  1DBO A;  2X6W A;  3GRH A;  4W8Q A;  1O8J A;  1IB4 A;  4OJ6 A;  2X85 A;  4OJ5 A;  1BN8 A;  2VBE A; 
#chains in the Genus database with same CATH topology
 1PE9 A;  3JUR A;  1JRG A;  4XLA A;  4XR6 A;  3PSS A;  1KCD A;  1EE6 A;  1TYU A;  4YC5 A;  1IDJ A;  3N90 A;  1TYW A;  2BM4 A;  2VFP A;  3VSV A;  1RU4 A;  1QA3 A;  3FY3 A;  4URR A;  2NT9 A;  3JX8 A;  3H09 A;  3SUC A;  4XON A;  3T9G A;  4YZ0 A;  1WMR A;  4XLC A;  4OPW A;  2BM6 A;  3B4N A;  3RIQ A;  1QA1 A;  1QRC A;  1OGM X;  4W8T A;  4OJO A;  4XLE A;  1RWR A;  1O8D A;  2QX3 A;  4YEJ A;  1QJV A;  2J8K A;  2VFO A;  2VJJ A;  2XTX A;  3BH7 B;  1O8F A;  4XQF A;  2XTW A;  3EQN A;  2VBM A;  2NTB A;  3B90 A;  1CZF A;  2ODL A;  4XKV A;  4XL9 A;  4XN0 A;  3UW0 A;  1GQ8 A;  4XKW A;  4YFO A;  2B0R A;  1HF2 A;  3VMV A;  3ZPP A;  1O8L A;  4EW9 A;  3GQ7 A;  1NHC A;  1O8K A;  1PXZ A;  1VBL A;  1KQ5 A;  3KRG A;  2NTP A;  3N6Z A;  2NSP A;  1DBG A;  4W8S A;  2INV A;  1OFM A;  1IA5 A;  3SZE A;  4XOT A;  2O04 A;  4Z06 A;  4OM9 A;  3SY2 A;  2G0Y A;  1XG2 A;  3P4G A;  4Z05 A;  4XM3 A;  4YZQ A;  1OFL A;  2O6W A;  1O8H A;  3VMW A;  3LYC A;  3TH0 A;  1L1I A;  1LLW A;  2BM7 A;  3GQA A;  1O8G A;  2J8I A;  4V02 C;  2VFQ A;  2QXZ A;  4XNF A;  4HWV A;  1KTW A;  4U4B A;  4XOR A;  1LM1 A;  2YUH A;  1BHE A;  5JMC B;  4W8R A;  2QZA A;  2X6X A;  5AMV A;  2W7Z A;  4AVZ A;  1KCC A;  1O8M A;  3ML3 A;  1CLW A;  5DNS A;  4NK6 A;  2NT6 A;  4YZX A;  2XT4 A;  2PEC A;  2X3H A;  1DAB A;  2F3L A;  4YEI A;  4U49 A;  2IQ7 A;  4OJL A;  2O17 A;  4YCQ A;  1O88 A;  1JTA A;  5C1C A;  3GQ8 A;  4C2L A;  4XN3 A;  2UVF A;  1QCX A;  1AIR A;  2BX6 A;  1OGO X;  1QRB A;  4YZA A;  1QA2 A;  4KH3 A;  2O1D A;  1TYX A;  4MR0 A;  4I84 A;  5C1E A;  2O0V A;  2QYU A;  2PYH A;  2VFN A;  2XTY A;  1O8I A;  4XLF A;  2NST A;  2X6Y A;  2V5I A;  4NK8 A;  1OFD A;  2O0W A;  4OZY A;  1K5C A;  3GQ9 A;  2XC1 A;  1K4Z A;  2NZM A;  2PYG A;  3WWG A;  1O8E A;  3NB2 A;  4MXN A;  1HG8 A;  4XOP A;  3LMW A;  3PET A;  1X0C A;  1OFE A;  3VST A;  3ZSC A;  3VSU A;  4XLH A;  1QQ1 A;  4YDT A;  1LLZ A;  1RMG A;  2VFM A;  4XMY A;  1EZG A;  2VBK A;  3NAW A;  2EWE A;  3B8Y A;  1PLU A;  1IDK A;  3DU1 X;  1EA0 A;  1H80 A;  2IOU G;  2QY1 A;  2NTQ A;  2VJI A;  4YEL A;  2Z8G A;  3AK5 A;  3BH6 B;  4OJP A;  3PSZ A;  3LJY A;  3EQO A;  2BSP A;  1OOC A;  2UVE A;  4PMH A;  4OZZ A;  3SYJ A;  4Z03 A;  2INU A;  1DBO A;  2X6W A;  3GRH A;  4W8Q A;  1O8J A;  1WXR A;  1TYV A;  4JRA C;  4OJ6 A;  3SQV A;  1K8F A;  1IB4 A;  2X85 A;  2XT2 A;  1TSP A;  4OJ5 A;  5JLV C;  2BM5 A;  1BN8 A;  2VBE A; 
#chains in the Genus database with same CATH homology
 1PE9 A;  3JUR A;  1JRG A;  4XLA A;  4XR6 A;  1KCD A;  1EE6 A;  1IDJ A;  3VSV A;  1RU4 A;  3FY3 A;  4URR A;  2NT9 A;  3T9G A;  3SUC A;  4XON A;  4YZ0 A;  1WMR A;  4XLC A;  3B4N A;  1OGM X;  4W8T A;  4OJO A;  4XLE A;  1RWR A;  1O8D A;  2QX3 A;  4YEJ A;  1QJV A;  2VJJ A;  4YZX A;  1O8F A;  4XQF A;  3EQN A;  2VBM A;  2NTB A;  3B90 A;  1CZF A;  2ODL A;  4XKV A;  4XL9 A;  4XN0 A;  3UW0 A;  1GQ8 A;  4XKW A;  3VMV A;  3ZPP A;  1O8L A;  4EW9 A;  3GQ7 A;  1NHC A;  1O8K A;  1PXZ A;  1VBL A;  3KRG A;  2NTP A;  2NSP A;  1DBG A;  4W8S A;  2INV A;  1OFM A;  1IA5 A;  4XOT A;  2O04 A;  4Z06 A;  1XG2 A;  4Z05 A;  4XM3 A;  4YZQ A;  1OFL A;  1O8H A;  3VMW A;  3GQA A;  1O8G A;  2QXZ A;  4XNF A;  4HWV A;  1KTW A;  4U4B A;  4XOR A;  1BHE A;  4W8R A;  2X6X A;  5AMV A;  4AVZ A;  1KCC A;  1O8M A;  4NK6 A;  2NT6 A;  2PEC A;  2X3H A;  4U49 A;  2IQ7 A;  4OJL A;  2O17 A;  1O88 A;  1JTA A;  5C1C A;  3GQ8 A;  4C2L A;  4XN3 A;  2UVF A;  1QCX A;  1AIR A;  1OGO X;  4YZA A;  2O1D A;  4MR0 A;  5C1E A;  4I84 A;  2O0V A;  2PYH A;  1O8I A;  4XLF A;  2NST A;  2X6Y A;  1K5C A;  4NK8 A;  2O0W A;  4OZY A;  3GQ9 A;  2NZM A;  2PYG A;  3WWG A;  1O8E A;  4MXN A;  1HG8 A;  4XOP A;  3LMW A;  1X0C A;  3ZSC A;  3VST A;  3VSU A;  4XLH A;  1RMG A;  4XMY A;  2VBK A;  2EWE A;  3B8Y A;  1PLU A;  1IDK A;  1H80 A;  2QY1 A;  2NTQ A;  2VJI A;  4YEL A;  2Z8G A;  4OJP A;  3EQO A;  2BSP A;  1OOC A;  2UVE A;  4PMH A;  4OZZ A;  4Z03 A;  2INU A;  1DBO A;  2X6W A;  3GRH A;  4W8Q A;  1O8J A;  1IB4 A;  4OJ6 A;  2X85 A;  4OJ5 A;  1BN8 A;  2VBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...