4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
5C1EA 4HWVA 2INUA 4XOTA 1OOCA 1HG8A 1OGMX 4XKWA 2PYHA 2PECA 4XLAA 1OFLA 2O0WA 4OJLA 2VBMA 4OJPA 3VMWA 2NSTA 4XKVA 2X6XA 1XG2A 4XNFA 1H80A 1O8EA 2PYGA 3GQ9A 3B4NA 1PE9A 2VBKA 4OZZA 1KTWA 1X0CA 5AMVA 4YELA 4XN0A 1O8MA 4XLFA 3GQAA 2Z8GA 4Z06A 1O8KA 1KCCA 4MXNA 1O8JA 2QY1A 3KRGA 4YZ0A 2EWEA 3VMVA 3ZSCA 4MR0A 2VJJA 4YZXA 1OGOX 4U49A 3ZPPA 4XL9A 4XQFA 4W8TA 3UW0A 4XLCA 1DBGA 2O17A 1IA5A 1RWRA 2NT9A 2QX3A 2VBEA 3VSVA 2IQ7A 1RMGA 4YZAA 5C1CA 1O8GA 2QXZA 1O8IA 4OJOA 3VSUA 1AIRA 2O1DA 1CZFA 1GQ8A 2INVA 3GQ8A 1O88A 1WMRA 1BHEA 2NZMA 1JTAA 4XMYA 1PLUA 4YEJA 2UVEA 1RU4A 3LMWA 1VBLA 4U4BA 1O8LA 2UVFA 1EE6A 3GRHA 4YZQA 3B90A 1PXZA 2ODLA 2NTQA 2X6YA 4XN3A 3JURA 4W8QA 4I84A 4NK6A 4PMHA 4Z03A 1QJVA 4OZYA 4XOPA 3B8YA 1DBOA 4XLEA 2X3HA 3FY3A 1IDKA 2BSPA 3WWGA 4EW9A 4XONA 2NT6A 1O8HA 4XM3A 3T9GA 1KCDA 2NSPA 2O04A 1QCXA 4XR6A 1IDJA 2X85A 1NHCA 2X6WA 1O8FA 4AVZA 3GQ7A 1O8DA 4C2LA 4W8RA 1OFMA 2O0VA 2NTBA 3SUCA 1K5CA 2NTPA 4NK8A 1BN8A 3EQOA 4Z05A 4XORA 3EQNA 4URRA 4OJ5A 1IB4A 4OJ6A 4XLHA 1JRGA 3VSTA 4W8SA 2VJIA
chains in the Genus database with same CATH superfamily
1YW8A 1T98A 2IBDA 2I8DA 1VQ6B 4V19K 4M3GA 2QYOA 1MMDA 1KQ0A 4MEYF 3CCMB 3J81K 3KZYA 4MTEA 2OQGA 1AU7A 3B6AA 3FX3A 3ZQLA 2CUFA 3ASQA 1ZRFA 3BPXA 4N9HA 2ADUA 2HR3A 2IPQX 4Q47A 3HOTA 2YU9J 4B44A 3HSFA 3OW7A 1X58A 1RKWA 3IRQA 3KYCB 2L0KA 4IEJA 4MFDA 3CC7I 3DQVC 4O5VA 2AHQA 2IGOA 1R9TJ 1MBFA 3PUFA 4MFEA 4OZZA 2GK7A 1AA7A 2FMLA 3OSFA 1SANA 1O8KA 2E7XA 2EILH 5E1ZB 1Z21A 2A05A 4KDPA 1B1BA 2PJPA 1MMAA 2KRHA 3J7ZI 2CK3A 2V1NA 3PIOF 3O6BB 1QUEA 5B6IA 4U49A 2VJ4A 5LGUA 3R6SA 2K7LA 2LF7A 1K61A 1JKPC 1A36A 2ZZFA 5DD4A 2E1NA 1ZHFA 3ESWB 3CUOA 4L9NA 4I99C 3HPGA 1FDRA 2ZZEA 2B0RA 4L9TA 2O03A 4UUSB 1K6OA 4JX5A 2V7WA 4TMWA 4OIQF 2MFZA 5DTDA 2XAFA 2R7TA 2P7CB 2O6GE 4KT6A 2BY1A 4WXCA 1RUNA 2EWNA 2DYSH 4LD5A 1YTYA 3OFNA 4B3FX 4KIGA 3GO5A 3CCQB 1FMVA 1Y56A 2BXZA 3BR3A 5B1AH 1JT0A 4RM3A 4IQJA 1QFJA 3OW2B 2A6HF 1I6XA 4LG3A 4M0LA 2UV1A 3ZRGA 3MAJA 4OPVA 3VYSB 5JR3A 5CVIA 1E17A 2B7BA 4A3KJ 1YJWB 5FRMA 1OCRH 4PSWA 2ICWG 2E5NA 2XTYA 3JRCA 3S8PA 4A0ZA 1XC5A 3G3ZA 1FY7A 1F60A 5KK1A 3WU2C 2IGKA 2QQAA 4XN3A 4P96A 1JKOC 1MSFC 2VXDA 1OB2A 4NK6A 1YITB 1ETXA 1WFXA 2OTJB 3BP8A 3LYCA 3HRMA 5BS6A 2HTJA 3TBIA 5DDGA 5EYRA 2Y30A 5A89A 3B8YA 1OISA 5A2QK 4N3NA 2GXBA 1KQ9A 3IP4B 2NVYJ 1R6RA 3VFZA 2PMZA 3K4KA 5HS8A 4G94A 2C4UA 4HX8A 1GXPA 3Q6RA 1NHAA 4XIDA 1FLIA 4U0YA 3QE2A 2OC6A 1WJ5A 1L0OC 2XB5A 3R4KA 5KCMA 3FMSA 1BMFA 4IOCF 1VQOB 4BU2A 1ZRCA 2HZDA 3RDIA 2NTBA 3BNWA 1R5NA 3BY2A 3JQPA 5M5YJ 2VFNA 4UVBA 1HF2A 4RLQA 3H0DA 3GQBA 5IOZA 2YUSA 3LSGA 4Y17A 3W6KB 1M1EB 3GZ6A 1ZH5A 1ZUNB 4MQVA 1D2EA 1Z3YA 2IP2A 1OOCA 2NS8A 4ZCLA 3HTSB 2PYHA 1OYWA 1W87A 1YI2I 5J1UA 1X1AA 4OJLA 3OIQA 3ZMSA 2XUBA 1TNSA 2LBFB 4IRIA 1AIPA 4OJPA 3I59A 4ON0A 1QZZA 1JNYA 9ANTA 1RC9A 1KK2A 5FKLA 4IJAA 1FBUA 3EETA 4L0YB 4CICA 1FWZA 2V7XA 1QO0D 3EUHC 2R9VA 3E0JB 3MD2A 1O8MA 3F9KA 1I27A 4QLCU 2KL4A 2LOOA 2VKHA 4JRAC 2QSHX 1ENHA 5GTIC 1F20A 1JUMA 2KP6A 3DP7A 3J80K 1K4TA 1IW7F 1MMNA 2JA6J 3JREA 3S17J 2R7FA 5E20A 1WSRA 1X1PA 3I4NJ 2ZTGA 4QSHA 3WG9A 4DBRA 3ZQCA 4W1UA 3AVTA 4Z4RA 1XMKA 3ABUA 2HXOA 3JRIA 1WJDA 4AF6A 3L9FA 4CZZA 2X51A 2G0EA 2K9NA 2JPCA 2UWMA 2LYCA 3F6OA 4A2UA 1F4KA 2DK8A 1WDTA 3LFUA 5KSWB 2K3FA 2O7OA 2OU2A 3ZZTA 3S3OA 3GQ8A 2GQQA 2CQQA 3HRTA 1LFUP 1XN7A 2NV4A 5TISC 4PC1A 2VPLA 2DLLA 1MNMC 1B6AA 3N4MA 1GXQA 3REOA 1EFUA 1N78A 3RQ4A 3CMAI 3GVKA 2W85A 3J7AY 4II3A 1UHSA 1ZAOA 1O7FA 3OL3A 3PFYA 3T8TA 1WSUA 2OCCH 2VFOA 2E1OA 5DSZA 4PMHA 4ABZA 1O7LA 4RJLA 4OZYA 3W2WA 1A35A 3MWMA 2A6EF 4HBLA 2X3HA 3FY3A 2W6JA 2WZPP 3ZIAA 1WPCA 2CS3A 3A3BA 3OR2C 1WHUA 4Z4YA 2QN6A 4HDVA 1ZG3A 1DDGA 2R5YA 3P4GA 4EM1A 1FSHA 3BG5A 5L3CA 3W2AA 2L9SA 1YE9A 3K70D 3WBJA 3FF5A 3A1PA 4P1WA 4AU7A 1WSVA 4XR6A 2DYRH 2X85A 1XSDA 4HE6A 3ASTA 4LC0A 2L5QA 4OOSA 3O3KA 4C3JJ 1IGNA 2JA2A 2Q6IA 2BW3A 3ISPA 3NWTA 4D1QA 3BY1A 4QUZA 1QVGB 1G7CA 1DGWY 3SUCA 2QF7A 3A4CA 4ZTJA 1SD4A 2KIFA 1ZR2A 1KZLA 5FKNA 1IB4A 4CHUA 2PJRA 2A07F 2AO9A 3ECOA 3VSKA 1ETWA 2FNPA 2GXGA 1MNDA 5FKKA 2R6HA 4O6JA 2ZO4A 5CVRA 1K4SA 6PAXA 1R4MB 1WOOA 1T08B 3BCAA 2EFWA 1AHDP 2V1UA 2OK7A 1HA3A 2PMHA 2ZMEA 1FRQA 3I5UA 5C1EA 1YFHA 3E6DA 4M9XA 2EIXA 4QFMA 1OGMX 2G7UA 3M3YJ 1UG2A 2NS0A 4E70A 5AIQA 3ZMVA 1U6GA 4WXHA 2DMQA 4KN4X 1TWHJ 2NYXA 2O0WA 2NOJB 4FCYA 1N05A 1DP3A 4CYCA 1FYKA 4AD9A 4MQ9F 2X6XA 1OGIA 1TBXA 4YAFA 3N90A 4X0GA 2HI3A 3KEWA 1UD6A 1ZGJA 2PQ8A 1SVOA 2AQEA 2ZNZA 1Y8RB 4NC8A 4S0HB 3AG1H 5JLWA 3V7SA 3CCMI 1A6QA 4BDZA 1JXSA 2NPFA 5IP9J 4RLZA 2Y69H 5IYWA 5KNLA 3CPWB 2M4KA 3PNTA 3SEQA 1V55H 3A03A 1PYVA 4Z4SA 5GPCA 1DQUA 1GUUA 1HLVA 3B73A 1FPQA 3CMEB 2Q1ZB 3LA3A 4C9YA 4XQFA 3OYNA 1YIJI 3PUMA 4Y7CA 2DA7A 2KZVA 2HDDA 2MBFA 4F91B 1JI8A 1HQCA 4P25A 1R22A 3H9GA 1PDNC 4LB5A 5C1CA 3F8FA 5A2QZ 1P4MA 4B3GA 1O8IA 4A3BJ 1DPRA 3KCCA 1KA8A 3RI4A 1LE8B 3HOXJ 1JJ6C 2ACJA 1IJEA 3U2QA 4LJZF 5AIPA 3JTGA 2WB1A 2STWA 1WJEA 3ZBUA 2EFQA 5IOYA 2ZNYA 5D4SA 4E7IA 4BAYA 1TT5B 1BI1A 2VBVA 3FJOA 4TKOB 1TP4A 3QWLA 5HZAA 1NTCA 1M90D 3O2PE 1Z3XA 4YAOA 1A31A 2BPOA 3Q3AA 2IW5A 2O6WA 2RNJA 2LY2A 2W4SA 3QU6A 4EM2A 3ZP5A 1UZCA 2M0CA 3OYLA 4W8QA 2FA5A 1FRNA 4ASUA 2C77A 5F08A 1HW1A 2ZL5A 3P27A 4C2TA 2V7UA 1FP2A 1E64A 2BYVE 3PQKA 1IF1A 4IHVA 1EFCA 1SKQA 3LQ6A 4R1HA 3DPLC 3CXCB 2C78A 4B3XA 4A0XA 4LBVA 1LNWA 5CJ9A 3DWLE 1FYMA 1YHQB 1YO5C 2Z9OA 3S14J 4I0AA 2JRTA 1R1TA 3GZ5A 2LP0A 4FE4A 4L0ZB 4OPWA 3JRGA 3CD6I 4XM3A 3A2KA 3T9GA 3CC4B 5B66C 4DNTB 4YIFA 3BQJA 4KMUX 2V4DA 2K4BA 2NNNA 3TO7A 3LL7A 2WV1A 1XPXA 4D5FA 2GBYA 1MD0A 3EPZA 2EZHA 4TV7A 1WVRA 3TH0A 4P55A 5DNSA 2ZJ2A 1V3FA 2J7KA 5D6FA 3OS2A 4Q5SF 1APLC 4CYDA 5KHDA 2IVMA 3DLLF 1W36C 2W1OA 3FZVA 4HAMA 5DEQA 2D5VA 2XPWA 4ZJZA 4BEHB 4ZYDA 2QCOA 1Y1WJ 2ZL6A 3WNDA 2R92J 3CQZJ 2CUEA 2H09A 5J1RA 4BS9A 1U5TA 5GV8A 1FX7A 4QHYA 2EBIA 3CCYA 5HLIA 1VQOI 2ZBUA 3GIRA 2QLZA 1MNEA 2DA5A 1W34A 2EPFA 3H36A 1H8AC 2CGPA 1PE9A 2BSAA 1MMGA 2EV0A 5TV2A 3ULQB 2W48A 1S7AA 2WAFA 4Y33A 5DCMB 5FFZA 3WGGA 4EV0A 2M7AA 2EV5A 4KFCA 3CC7B 4BH9A 1UD5A 1K9MD 2ECBA 3OIPA 2K9QA 4LGWA 1WJBA 3KRGA 3HUGB 1Y1VJ 4FX4A 1HF0A 1W0JA 5EG0B 1YLFA 1TW2A 4DGWB 5GAGJ 1E63A 3CTAA 1LUJB 4EM0B 5CVVA 1DDIA 4U0WA 1D3YA 4MTDA 4W8TA 1LPQA 3VO1A 3JTHA 2WJVA 2F6CA 2V9VA 4RGRA 1EKEA 3RQIA 5M3MJ 2XC7A 1W7PB 5B3SH 2NT9A 4Z4TA 4P3YA 5JHUA 5LEKA 3LO8A 4RCYA 1L1IA 1BC8C 1O3QA 4BBRJ 1F5TA 2CW0F 2CC2A 3FBNB 1OMIA 1ZRDA 1IXRC 1AIRA 3K1NA 1FIAA 4N9IA 1FOWA 1ZG1A 3I56I 1WP6A 3I53A 3ZMDA 3PENA 3WYAA 2Y31A 2INVA 3VODA 4B43A 3OYCA 4XMYA 2PLFA 2LDUA 3BR5A 3QQAA 1QBJA 2X0KA 3SYTA 2ZSHB 1POGA 4Y4RA 1ZM4A 3GFLA 5D5VB 2LFBA 2W00A 5ICGA 4XBFA 1T6YA 2YX4A 2UXXA 3PSZA 2X6YA 3VYRB 1GLNA 4UNOA 2OZUA 4PUSA 2QA4B 3SLNA 1TQMA 1CGPA 2M3AA 2JA7J 2YWGA 3KP3A 3VEPA 2K85A 5FB2A 5CQGA 3S1NJ 1IDYA 3D5LA 4ESBA 1JTYA 3SJPA 3HOZJ 1EP1B 1FNNA 1JA0A 2LY1A 1GV5A 3PO3J 4FT8A 2E2IJ 1WJCA 4Z4VA 5IP6A 4G5GA 3HG9A 3DEWA 3JRFA 2W82A 2J5OA 3BTJA 2KVOA 1OR7A 2ELJA 2RREA 1BI0A 1NHCA 2DETA 2B7CA 2IA0A 4ENMA 4IRGA 1HCRA 2QZAA 2KIUA 3IAS2 4LBWA 1KMHA 2K5CA 3EYIA 3AVWA 1V5EA 4XORA 3SJMA 4KISA 2HPIA 4Z4WA 1BW6A 1WOSA 5B1BH 1BLIA 1KK3A 1W2BB 1YOVB 2PX9A 1VQ9I 4PJNA 1VLYA 4W8SA 4UZUA 1PUFB 1HA8A 2XTWA 1MBHA 1LQ1A 1YJNI 3E1SA 2OBPA 3FM5A 1CNEA 1PJ6A 1MBEA 1ONVA 4IKFA 2E7WA 4GQNA 4PFPA 2HWVA 2RQPA 5TR9A 3ERMA 3FDYA 1HW2A 1D8JA 1WGXA 1QFYA 1WOPA 3D0SA 4DNCA 2CW7A 2B0LA 5EGOB 3C3WA 2DMPA 4A0YA 2XF5A 1U9OA 5F1RA 4GYGA 3B4NA 3I71A 1D8KA 2ELKA 2H8RA 3E5XA 5BSXA 4IZZA 5D5UB 2QMUA 4ZGQB 3OPOA 4IOAF 4F92B 4Z2YA 1UD2A 2MH9A 3PJRA 3JSOA 1OCZH 2MC3A 4OU0A 3A35A 4YAWA 2K9LA 3DBHB 2EWEA 3RZDJ 2W7ZA 1QA2A 4PCQA 3MHPA 2VJJA 1WI9A 2D1VA 1K83J 3NWSA 5J3OA 3I64A 1CNFA 1OGOX 4HV5A 3FISA 1FT9A 4XKCA 4A12A 4WCGA 3ZCOA 5DM6F 4M3DA 2BHZA 3ASRA 4E7ZA 1P6RA 3IAM2 4JMQA 4R71A 5JLVC 4BPRA 3I58A 2A6TA 3VSVA 3JRDA 4QIWN 2DXIA 2ZBVA 4H0EA 4ZYEA 2QUFA 2HCJB 3BROA 2B7EA 4YZAA 2V7TA 1QVUA 3PSSA 4PJMA 1J7KA 4OMYA 1BIBA 1I3AA 4ESFA 1A6IA 1QGAA 4FXUA 4U7BA 1H85A 2BXYA 4OP7A 3WNBA 2YR2A 5HLGA 1LDJA 1VTNC 1Q86D 4FASD 4KUMA 4CH7A 3HGYA 3V42A 1O57A 4YEJA 3BCDA 1TTTA 5K7FA 4GDFA 3L7WA 2IS6A 3H5RA 3SEJA 4HLYA 4NUBA 5HDNA 2Q8KA 4NBQA 4XRSA 5H6QA 1W7PD 4YIRX 2PBIA 3ZMUA 4J00A 2E2HJ 3LNQA 4ZCIA 2WAEA 3FWEA 4JP0A 1D5YA 5E1WA 3W5UA 3BR0A 2LTPA 3CMAB 3QYFA 2EQRA 3A01A 4E4HA 4AYBA 3ZN1A 1W4MA 2V1DA 3K10A 2YWFA 3HM5A 2EV6A 4MLOA 2PEXA 1GO2A 4IO9F 2PIAA 4WWCA 4XLEA 4WQMA 2XAGA 3KP5A 3WTTC 1AKHB 4A69C 2BE5F 5HVQC 4BXXJ 2R5ZA 2X1EA 4IX7A 1SD5A 3OZVA 2NT6A 2CV0A 1MBKA 3X2QH 3FIWA 4IXAA 4F3QA 2HPMA 2RVCA 5FKMA 2XROA 4WZKA 1FC3A 5FO1A 1K8FA 4X7CA 4XRFA 2M45A 4RDUA 1IV6A 2BM1A 3N05A 4B1RA 2CRVA 3KEYA 2KRFA 4NC6A 2WAQA 1VQPI 1P4WA 4RB1A 5J8FA 1SFOJ 3W2FA 1MH4A 3LMMA 3ML6A 3BZ6A 2VJ5A 3L2QA 1BN8A 3C2HA 5E3OA 1LFBA 4L5EA 5L3EA 1MBGA 2P8TA 3DKWA 4LIVA 3CP2A 5AONA 3ZQHA 4KH3A 2IXSA 2R7XA 2I5UA 1XCBA 3BR2A 3GVLA 2XAUA 1G8XA 4PC6A 2CJJA 3FXOA 4KIBA 4BUPA 5B5EC 1UHWA 4S05A 5IYQA 5E8GA 1XTAA 4ENJA 3GTGJ 2R7RA 1D0YA 2ESHA 2DJIA 5LHIA 3ONQA 3RY8A 2DCUA 4N4NB 1WKMA 4RGUA 2JJ2A 5AMVA 5JHFA 3S2DJ 1OFLA 4IPAA 3CCLI 1ETQA 2F5DA 5IY5H 2VE9A 1IB0A 3TDUC 2JQ7A 2K02A 1XG2A 2YWEA 2Z5UA 1IN8A 1SAXA 2RDPA 4V2FA 2GREA 2GOMA 3KETA 5GADJ 2JVGA 3W2EA 3SYJA 4XLFA 3HKZA 3PA1A 1SEUA 4IF4A 3B02A 1IXSB 2KFDA 4HF1A 1DGRM 2CMPA 2DN0A 1LLWA 3TMOA 2DFFA 2DA6A 4HPQA 3JRAA 1BJKA 1VQ4I 3SFZA 1E1RA 3GFMA 3NE5B 1FMWA 3AL0B 2Y0SA 1D1NA 3TL4X 1DBGA 3CDHA 3NQOA 2BM5A 2VBYA 2R7VA 3FHZA 3FBIB 4A3IJ 2HDNB 4RDJA 4HIZA 2MD0A 3V7RA 3JAMZ 2OBTA 2JDIA 3IWFA 3FK7A 2OYNA 1YIJB 1GVJA 2OZ6A 1O8GA 4DW6A 3OYHA 1DG1G 4A3LJ 5H5JA 4BJTA 3KZZA 2K4JA 5FLXZ 3CUQA 3ZQQA 1U2WA 5K1YA 3GTMJ 2DOGA 2CUZA 3KP4A 3DF8A 3OS1A 3T0YA 1ZG5A 5THXA 2DMNA 3RPUA 4Y9UA 3CJNA 2GIZA 4KKTA 3LMWA 3KP7A 4EH1A 1O8LA 2UVFA 2VBSA 1EE6A 1B9MA 5D5XB 4OM9A 2JRMA 2LREA 2LF8A 3VNUA 2CV1A 4P9FA 3IC7A 1GVDA 2QSFX 2VT2A 1OB0A 4ZZLA 2V26A 4G6QA 4UB8C 3SZGA 3M7GA 2HFHA 5DUIA 4BACA 2B63J 2EINH 3I59B 2MSYA 3HEFA 2EA4A 4A3GJ 5HOOA 1N06A 4KN7X 2H27A 1EFTA 2HLDA 4I98B 2G0YA 1SFEA 3FXJA 4WX9A 4RLFA 2H6BA 2JZYA 3RPQA 2ZJQF 1DBOA 1RZ4A 2MH2A 2XV4S 3LSKA 4OIOF 4L5JA 1UJ8A 1IDKA 4P26A 1BBYA 5FIUA 2LY9A 2CH0A 1DP7P 4P2NA 2L4MA 3WGHA 3ONYA 1UMQA 3P5JA 3FXKA 4I09A 4AC0A 1LKXA 4HDUA 3OWTA 1ETYA 2BZTA 2V6EA 5HKKA 2NSPA 2JUCA 2QA4I 1DU6A 3H9QA 3CD6B 2LH9A 3DXJF 4IL6C 4YG2F 1G6NA 2DCEA 3HRUA 2EFNA 3K4JA 4C2UA 4UY8I 3TW7A 1QZYA 2M4GA 1W36D 2DAOA 1E3ZA 2IOUG 3ZXSA 3DFGA 1WH5A 1FNBA 4ZGNB 2NS7A 3F6VA 2BF4A 1JHFA 3JRHA 2WR8A 4Z05A 3V4GA 2XSDC 3DU6A 1EP3B 4K2EA 2L9VA 1R00A 4BXUA 4OOXA 1WPKA 2V4JC 4LOCA 4BYYA 4MNUA 2MD5A 3PSIA 2R7UA 4L9JA 2PLYA 4XOTA 3ZQIA 1S7OA 2QGGA 5J35A 3OS0A 1IG7A 3C2GA 2LRDA 1VNDA 1MIJA 2IEKA 3GTOJ 2JPBA 4HE5A 4J19A 3N97A 1E3PA 3UR3C 3SDBA 1H80A 4HRIA 1EXMA 4RBOA 2WADA 2OUMA 2XGCA 4YXWA 4NB5A 2DTRA 2IA2A 4ETSA 3K9TA 1G2HA 3EQLF 3K7AJ 1EH7A 2CF4A 1FBSA 2YUHA 4MEXF 3F8CA 4HF2A 5IYRA 3QPLA 1MJBA 1MJ9A 4C30A 2UUZA 2BY2A 4HNTA 3DEEA 3OYAA 3ZZ0A 1ACIA 1V0FA 3SZEA 4E7HA 2JN6A 5ICFA 4HSRA 1TC3C 3PO2J 2MLGA 1UELB 2L01A 4NBSA 2Z16A 2M1BA 2HOTA 4R79A 1R49A 1LVAA 5BOXA 3ZPPA 2HU9A 3S93A 5IYDJ 2EZIA 4G9YA 4S04A 3QYEA 5GV7A 4X1EA 4E7JA 2GK6A 3CC2I 5M3FJ 2ELHA 1QGPA 3W5HA 4WZEA 3BT9A 1VJSA 2HGCA 1VQNB 2IQ7A 3A8JA 4PZJA 3ONUA 2CQNA 4M53A 5H20A 2BW3B 3ABKH 4CCMA 3ASOH 5IYCJ 3DPUA 1FX0A 4X06A 4GRIA 4TSFA 3VMFA 1OYIA 1XD7A 3H3ZA 4G7XA 4ROXA 2PJRB 3WE3A 3S1RJ 2CYYA 4G6TB 3I56B 3DBLB 3E7LA 4NCNA 3G4SI 1ZM3A 2EIJH 3CCJI 2I1LA 2DK5A 2AS5F 1OGJA 3I3LA 1VHOA 3EUKL 3K2AA 2LC2A 1IRFA 4X7EA 5D5WB 4CA0A 2DY1A 2Z33A 4RM0A 3GTJJ 3IUOA 2QTLA 3CW2A 1NDHA 1BM9A 1FSEA 5DS0A 2OF7A 1X2MA 3MKYB 4HOBA 1NK3P 1KRHA 1I6HJ 1HKTA 2VQHA 3VSLA 2FNAA 5FJ8J 4L5IA 2DIEA 4DQLA 2VC0A 3VPRA 3K1PA 5F0HA 3CCEI 1TYUA 4JQFA 2QSGX 2Q6OA 3HL2A 5M5XJ 4XICA 5EEAA 3WU0A 5TY0A 3SKBA 1SMTA 4XONA 2JJ7A 3DPTA 1BC7C 3W3CA 2BHYA 4OPOA 4D5CA 2P5LC 1KCDA 4BGDA 1MKMA 1OFCX 2QYUA 3BZCA 4CZCA 4RAFA 2BY3A 3E5UA 3V8JA 1LDKB 2VIXA 3BZKA 2OBSA 4KKSA 4AVZA 5IK2A 1FOKA 2V9KA 1OHHA 4B47A 2MA3A 2JT1A 3C1DA 4EATA 3H92A 1X3ZB 4XSZF 1PUEE 5FD5A 2VPRA 1ZLKA 5DCFA 2OA4A 5L3BA 2XSJC 3GTPJ 2OD5A 2VE8A 2WPDA 3BCBA 3DTEA 1ZQ3P 1RESA 3F8BA 3J81Z 2ISYA 5D8KB 2BV3A 1SFUA 5JFRA 1YW9A 1WTHD 1SKYB 2VQGA 1CQTA 5EZGA 3S16J 3FXLA 1J5YA 3RKYA 1D8TA 5FNZA 1VQ9B 2VODA 3BPVA 3CO6C 3OJWA 4II2A 2HYGD 1RIOH 2VOPA 1XQBA 2E2JJ 2WY7Q 5BPDA 1YJNB 2ZXIA 1J0RA 3HHGA 4UHTA 4G7HF 1Y0YA 2DOFA 3J81k 3VMWA 3OY9A 1HXDA 2WB1N 1T8IA 1E2XA 1YX2A 3COAC 1DUXC 1OB5A 3BH6B 1S5LC 3LA2A 2GIVA 2XOKA 2VBKA 1TQIA 3CMMA 3LA7A 4M74A 2E1CA 1SFXA 2KPMA 2W25A 2D45A 2CWEA 3T1BA 1DPUA 4P3IA 2NAZA 3ZUGA 3ASPA 2QY1A 1HSJA 1NG7A 1H8EA 3OIOA 3U1KA 1J59A 1NRKA 2X0LA 2CQKA 4G6IA 2IGNA 3GF2A 4HQEA 1M1KD 2F48A 4MR0A 4AWXB 5IT9K 1I1SA 2QZ8A 2ZFWA 1NK2P 3S2HJ 2G9WA 2EJRA 1ZGWA 3ASSA 3QPSA 3MKLA 3BWGA 4NHJA 1HC8A 1TW3A 3GFIA 1FBQA 3QAHA 3V8LA 2XEXA 5DV5A 1P7JA 4PGHA 1ITYA 2QXZA 3AFHA 2HQNA 3E5QA 2O61A 4B4DA 2HOAA 1VF7A 2Y2ZA 1CLWA 3K0LA 2BV6A 1K4ZA 3T8RA 1YX3A 2IGMA 2OQRA 2V1XA 1TTYA 1H42A 3A1YA 4YAUA 1D0ZA 2P81A 3DEUA 1TVCA 1JTAA 4EMSA 4L8JA 4PGGA 2XAHA 4IVNA 4LG0B 1Z7UA 1YS6A 2RC6A 5FL7A 5HDGA 5GAHJ 1KONA 2Z1DA 5LMZA 2LR8A 3QFTA 1U5TB 3WODF 4AVPA 3PL8A 2NVXJ 4U7DA 4H4KC 5DS9A 2DFEA 2Y0MA 3FMQA 3CCVI 4HQMA 4RPDA 1X4PA 3WTXC 2BVNA 3L2WA 4EJOA 1Q1HA 3G6EB 2KLOA 2L7KA 2XPUA 2E71A 2H8WA 3CCUI 1RUOA 3KX2A 5H6RA 3L00A 4M73A 4M72A 1FP1D 1ZREA 3H5NA 4XKBA 5FO5A 3WTYC 1HW5A 1TWFJ 1TYVA 4RAZA 3DCFA 3QPTA 1FTZA 3BH7B 2ZXJA 1G7TA 5F6FA 2W24A 4LLLA 4EJVA 4Y52J 2VKEA 1VHEA 3VNVA 2IS1A 2DA4A 1SAUA 3CP8A 4FHTA 3B8HA 4M9ZA 3OOPA 3BG9A 5EMNA 1J9IA 2VASA 5KAFC 2O0VA 3QRFF 1RI7A 5DYMA 1J09A 4Y13A 3M9AA 4M2LA 3EQOA 3WTUC 1EV7A 1JUPA 2C5HA 3LSJA 4LFUA 4EJWA 1EA3A 1P4AA 1VQPB 2PN6A 2HKOA 3I54A 4CUGA 4Z1MA 1Y8QB 1RPWA 2MYSA 4I76A 1MDMA 4M9SA 1E1QA 3QFRA 3AVUA 2VJIA 1TT0A 5HNHA 2NVQJ 4HWVA 2XGXA 1QRBA 2CW5A 2XPVA 2Q2EB 2X3UA 4PAAA 1T56A 2DI3A 3E6BA 4PC2A 1W35A 4XLAA 2OV7A 2F5VA 1V0EA 2GQFA 5CPRB 4IQ4A 1OQYA 3IH4A 3EUAA 3CCRI 4IHWA 4K1XA 4YFKF 2IS2A 1PJRA 2ETHA 2DT5A 1S72I 3CCLB 3ZPNA 2XZLA 4LBYA 1RRJA 3T56B 2X4HA 3HIFA 5K7ZA 2E1RA 2LKPA 1ZYRF 3F72A 4LK0F 1D0XA 3H3UA 3GW2A 3J80Z 3FPKA 2QE7A 4F93B 3RIQA 4HEA2 2HZTA 4YZ0A 4NNJA 2VN2A 3FKIJ 1NJID 4OWRB 3PA2A 1TWAJ 4E7LA 2YSRA 2M8GX 1OCCH 5CKTA 3A02A 5J1YA 4HW0A 2M87A 3TEDA 4ASNA 3TKYA 5E8IA 2M7BA 4XLCA 1GAQA 4RB2C 2HQRA 2BGJA 2L2OA 2YU3A 4C3IJ 1G7RA 1XX5A 3NAWA 3OE7A 2EK5A 1VQ4B 3SQVA 2FOWA 3LSTA 3BQYA 4IHTA 4YALA 2ZSIB 2P5VA 1LVKA 4TMVA 1TYWA 2DT6A 5L3FA 3VSUA 1ON2A 3HPHA 5IT3A 1V5GA 1YJ9I 1H9GA 1F36A 1G3YA 2K40A 2V9PA 3RYRA 2IRFG 3E1YE 2R4GA 4GGGA 4BNCA 2VNHA 4BY1J 2VNJA 1UAAA 3JQQA 1S9HA 3GTQJ 1OFEA 2FD5A 1R4NB 2AXTC 1VQNI 2FQ3A 3B90A 1OCOH 2R3SA 2ODLA 2LSOA 3VYUB 3VOEA 3JU4A 4PC3A 2DYIA 4BQAA 1EP2B 5A88A 3PNVA 3IH3A 2PMUA 4E7SA 1LE8A 2VNKA 2RKHA 3LOCA 1XGMA 5LHGA 1EF4A 2D1HA 1WI3A 3IWZA 4RD1A 3L2UA 3K4BA 3ZN0A 2F2EA 2KIQA 1COWA 2DW4A 3IRRA 3ZZUA 3GWZA 2Q6KA 1Z0XA 1V4RA 4UVAA 5BQTA 5CLSA 2CFXA 4MGRA 2F5FA 4PK4A 2BMWA 1IDJA 2GM4A 3SHFA 3BR6A 4QTRA 1ORKA 1Z05A 5LGTA 1SD7A 4BQQA 3OJXA 2XKOA 3ROUA 1Q9SA 2OCEA 1YRNA 3AL0C 1X1CA 4KICA 2KZGA 2M5WA 1VQ5I 4OAZA 4KMFA 4PGOA 3ZBTA 4NK8A 4RS8A 3R6JA 1CF7A 3EQNA 4I2OA 4ACAA 2O3FA 1JRGA 2W7NA 4OJ5A 5LLQA 4URRA 3VSTA 3RKQA 4BHCA 1NB0A 3AK5A 4ZYHA 4A3FJ 3B78A 1JGGA 1BR2A 1FTTA 3QU3A 3KL9A 4ZDOA 4JK1X 2QDXA 4XKWA 2MC4A 3LSMA 1Y0UA 5EEHA 2NNYA 3QFSA 3EUHA 1IJWC 2NOGA 5BMZA 4DK0A 2GWRA 2E1BA 2I10A 5FRNA 4A3JJ 1YW7A 5FROA 5IYPA 1OJLA 2VFQA 2CG4A 2O9LA 3QSYA 2JWTA 2CO5A 3K69A 2DFIA 2LKXA 2FBIA 4M3BA 1RR8C 4U9UA 1D1CA 4KA4A 4A93J 3OYFA 1IRGA 3H9NA 2UZKA 1I7PA 4UAJA 4Z06A 3FXMA 3Q3SA 4I01A 2E1MB 3KLOA 1JA1A 4ZZDA 1DABA 1QUFA 3VMVA 4ZYGA 3OYBA 1IRZA 4ZV4A 4I0BA 3OYJA 4XRMA 2QVOA 4JBAA 3WTWC 2R5ZB 1G59A 1WXRA 1Y39A 3AAFA 3LQEA 2YS9A 3KPHA 1G3WA 3GTLJ 3G2BA 2BM6A 4ZH4F 2DT7B 2O17A 2KHMA 5E3LA 2NVTJ 3OOUA 2D74A 1SVMA 3J7AO 2FX3A 2KIMA 5DCMA 3U9GA 4DBQA 4N4OB 1FYLA 2O5RA 3OYIA 1B23P 2EFPA 1RMGA 4RM2A 5JVTA 3EDPA 3KZIC 5EEGA 3CC2B 4IW3B 2H1KA 2L7ZA 5CDFA 2LVSA 3HUGA 4N3GA 5E18F 1IN7A 1QPMA 1OLTA 2CSOA 4B3AA 4FISA 1PP8F 1KK1A 3V7CA 4J0QA 3DKYA 5E1XA 3MCZA 1RU4A 2CQXA 4FE7A 1OCPA 1I50J 3U21A 4G7ZF 1VBLA 1YG2A 3PETA 5K7HA 4YZQA 3GBGA 3K6GA 2P6SA 5HS9A 1MSEC 5HLTA 1I1GA 2KISA 5GAEJ 3I4MJ 4HF0A 2GPJA 1PXZA 2XC1A 1S0UA 3G4SB 1CQXA 2AQFA 3CCJB 2HOSA 3H1CA 3BLYA 4G6DA 4LITA 5DN6A 2EFOA 3TDZC 2VKVA 3K4CA 3KIOA 4Z4UA 4AIHA 4RAGA 3W6JB 1P4XA 2ME0A 4I6ZA 1ODDA 4AIJA 3QFCA 3B82A 2HDCA 3FHNA 2ZJRF 3IKVA 3WWGA 1B9NA 3OYMA 2EIMH 2HYFA 4BQOA 4EW9A 3CCEB 3LNNA 2JA8J 4U87A 1OFDA 1RR7A 3AVYA 3TO9A 1STZA 2DEUA 4WK8F 4RDLA 3TGNA 2VQLA 2QM3A 3OYGA 2OTLB 2W84A 3HKZN 1QA1A 4UXNA 4X0CA 2E36A 3ZGKA 1VQMB 3D1NI 2KQRA 1RETA 2H6CA 2X6WA 3K2ZA 3G6EI 1QU3A 1K78A 1O8DA 4C2LA 5TJJA 3MEXA 4KJZA 1QX4A 1ZN2A 2QBYA 2NTPA 3HYIA 2XGDA 2E5ZA 2VBXA 1FIPA 1E43A 4NQWA 2E60A 2XNDA 3MZYA 4WWVA 1W0UA 1JJ8C 5J3LA 3C18A 1ZELA 1QFZA 4P1VA 3CJRB 1Z6RA 3CUQB 3BOQA 2HQ5A 2GAUA 2VBZA 1BI2A 3BQZA 1VQLI 4IHSA 3R6KA 3TOAA 2XT2A 1XGOA 2FVGA 2VLAA 4RD4A 5CVJA 4GYIA 1HKQA 4HLXA 3U2RA 2XTXA 3LSPA 5GP9A 4BXFA 4C3HJ 3M1EA 3I9V2 3LQQA 4C2MJ 4PJJA 5FLVA 1PVEA 2JA5J 1XSVA 4ZYAA 2ZMEC 3SXYA 2NSTA 3ML3A 4OPSA 1VFCA 3U6KA 1PP7U 5JI6A 2PYGA 4A5NA 2RNGA 3PFIA 2WV0A 4D0PA 1DDNA 1I18A 2KT0A 1HOMA 2P7VB 4YFXF 2HDWA 2Z3YA 2O8KA 4G7OF 2F5EA 3KEOA 3OR1C 2GLOA 2L4AA 1R7JA 2LD5A 1Z7LA 3LSIA 3O8GA 1A04A 2L02A 1Z6TA 3A0BC 4JX4A 3GX4X 1V54H 1UD3A 4FWTA 2F4OB 2XDVA 3CLQA 4YZXA 3CJTB 1XB2A 2B9SA 1KJZA 4XL9A 2EIKH 4PC7A 3HSRA 5EGOA 3DKXA 2CV2A 3Q6QA 1KC8D 2X48A 3MZHA 1QHGA 1NBMA 2CFOA 5F04A 1D1BA 2OBRA 3ZMTA 1I8DA 3CDLA 1Z1DA 3HGGA 1X19A 1T0FA 1YIOA 4OMZA 4CCJA 4EGYA 1NG6A 3F21A 5JVGF 1QVFB 4WF2A 3OL4A 3H0GJ 4HSTA 1H8HA 3CJQB 3HBLA 2E34A 2V7VA 3A8IA 1R1UA 4H9GA 1CZFA 1GQ8A 3W2GA 2D3LA 3CLOA 4PFOA 2GA2A 1FJLA 5E3MA 3S15J 2QKMB 2MGQA 4GCVA 2VC1A 3BJAA 2L54A 4OAYA 2IT0A 1ETKA 1BW5A 2WC2A 4JYKA 5JMCB 1VZ0A 1KZHA 4PJLA 4XLPF 3L1PA 1MRZA 1UMKA 3WE2A 1IC8A 1TLLA 3Q5FA 3WNCA 1Q7YD 2DA1A 5ED4A 2COMA 4UVCA 4N0BA 1C0WA 1S29A 2C4TA 3GZNB 4Z03A 5F0CA 5IPAA 5F4OA 2BGCA 1YYVA 3FMRA 1NB9A 3PVDA 1PKVA 3LFKA 1QRCA 3CCVB 2PMZN 3JR9A 2BY0A 4B48A 5J4YA 3QOPA 1REPC 3D26A 3OZWA 4YFNF 3FM3A 2RGVA 2DTZA 4V02C 2BX6A 5HZBA 3CCUB 1KU3A 2R7QA 2Y9YA 3ZPLA 5HNFA 2M5SA 1B72A 1ZM9A 2GOXB 2DPDA 3I1FA 3HSEA 3S3NA 2O8XA 3HOVJ 3P9CA 2QQ8A 2KJBA 2DPUA 2R7ZJ 2HTSA 4M6VA 3PIPF 4LBZA 3SZTA 3MKWB 2A5WA 2DJNA 1HVXA 2FUG2 3OYEA 2V6CA 1AKHA 2Y48A 3LSRA 4OJ6A 3F8NA 1FOYA 2FU4A 5E6TA 4NDLA 3K4LA 4ENKA 1WH7A 1RQRA 2WA0A 5K5QA 5EZHA 3H94A 4M71A 3DTKA 3TOBA 3P9KA 1X1BA 4A5MA 5LGNA 3HOUJ 2HNHA 3SFIA 2JSCA 1R5HA 4E6KG 2DBBA 3CF2A 2DERA 2PE3A 1XG1A 2QKLB 2XHKA 3RSNA 1LFPA 2YPRA 3R60A 4AC9A 2R93J 1TWGJ 1O8EA 1B4AA 1U5TC 2FQ4A 3BG3A 2BVLA 3GQ9A 1KU9A 4AIKA 2GXAA 1KTWA 1J9ZA 1X0CA 4KNYA 3FKSA 4DYCA 2JN9A 4OIPF 4RD6A 2NVUB 1VF9A 3CCRB 3GQAA 3ERED 2MLKA 1S72B 1OPCA 1KU7A 1U8BA 3R0AA 3WQZA 3RPUD 5IP7J 1B8IA 3E6MA 2ZJPF 2VYQA 3ZSCA 1IUYA 1U78A 1U2RA 2LK2A 5FKOA 1QPIA 4CCNA 3ZQGA 1BA5A 3W2HA 3KYLA 4KYWA 2F1MA 1BOAA 3BC8A 1H88C 1IHMA 4TN1A 1T33A 1TUIA 1Y0RA 3UW0A 4IHXA 4A3CJ 1FNCA 2XRLA 1KU2A 1HSTA 3VB2A 2ZXWH 3WG7H 1T2KA 4KKUA 4F7ZA 1LJ9A 3MVPA 3JQRA 3Q0UA 1G3SA 2OK8A 1O3RA 4BE0A 3RJPA 3G1MA 1TLHB 1EH6A 2O1DA 1JKRC 2MABA 2ECCA 3ELKA 3I55B 1O88A 1AOYA 3ECHA 2M0MA 3CF5F 1O4XA 1BHEA 4HYEA 2ME6A 3NARA 2BBYA 3NAUA 2QENA 5J47A 4FN5A 1PLUA 4EGZA 4YDTA 3GLLA 4P5OA 4DQKA 5KW9A 3G1OA 5C44J 4X8IA 1YJ9B 2HVRA 5L3DA 5LD2C 2F5CA 3QPHA 1E3HA 1SC7A 1HBXG 4ANJA 4JOMA 2XF7A 5LRRA 2R5YB 3BH4A 4P12A 2BM7A 1T95A 3FXUA 1BR4A 3QP5A 1BQEA 3OZUA 3AGPA 4CO8A 1VQ8B 2NTQA 3PNYA 1DU0A 3JURA 1B2RA 1HKSA 4BQNA 3F23A 1MW7A 1G4DA 2RV8A 1NH3A 1QRYA 5LHHA 1B59A 2DODA 1WCMJ 3OP1A 1I3QJ 3BTCA 4RPBA 2ZITA 3J7YJ 3MZ8A 4P9UA 2QGUA 3WU1B 3ABTA 4G8XA 1ETVA 4M6XA 1O3TA 1GHCA 4YFOA 3S2WA 3N6ZA 4Q7JB 4RD3A 1XGNA 3GYHX 4PABA 1O8HA 3CCSB 1HDPA 2C5BA 1U9NA 3E20A 2PFBA 1E0EA 2ZMEB 2VXZA 2RC5A 2RN7A 2WY8Q 1E79A 1ZM2A 3DDYA 3AVVA 1TNTA 2BGIA 4UUSA 1O8FA 2JVHA 5KAIC 3GQ7A 1USSA 2FMYA 2ZXHA 4CYCB 2VL8A 1H9TA 3RKXA 4LLGF 1OR7C 3DV8A 5HXBA 1QH0A 2EZKA 1JGSA 2X8KA 3RZOJ 4LIUA 2IJLA 4MIMA 1VQ5B 4D7MA 2A3SA 1N75A 4QPQA 3D5RC 2HXIA 4ZCMA 3MN2A 2OTLI 1HG8A 2XT4A 1USTA 2LG4A 4Y15A 3QP6A 1D5VA 3GVJA 1VQMI 2JSPA 1JE8A 1U0JA 3B6CA 5ICCA 1GJRA 4X7FA 2VBMA 2O0YA 3BG7A 5FA6A 3P9IA 4LMYA 1HDDC 2VOOA 3T53B 1R58A 1ZK8A 3TO6A 5F0FA 4EJUA 5LRSA 4L9VA 4A3MJ 1ERDA 4DNRB 2R7WA 4DYRA 1BIAA 4YELA 1T5EA 2HVQA 4AIDA 3ISXA 3GCMA 1FEXA 1FNDA 4RAYA 4BHPA 2Z8GA 2FJ1A 2D2WA 4ZTFA 4A3DJ 1KCCA 3P26A 2E19A 3Q0WA 5EF6A 5KVRA 2LMDA 3L2RA 1QQ1A 3WY9A 1R5GA 3AKZA 4MYTA 4L18B 4DQ2A 2ZTNA 3KE2A 1R71A 5ERIA 3VYTB 1X2NA 1QHHD 2YWHA 2ID3A 5D4RA 1WJAA 3H5AA 2JTVA 5L46A 4AF7A 2L9RA 1ELOA 3Q39A 4P6VF 3Q38A 1T38A 2DOEA 1VQKI 1XDUA 2GZWA 2KJCA 2HMAA 2QEXB 4QVAA 1ZTRA 5D6EA 1KYWA 1XB4A 3G1LA 4FTHA 3SLDA 3RCOA 3HHHA 1OYYA 4J01A 2H1LA 1GT0C 4Y9RA 1QVTA 1P2FA 1W0KA 3GLXA 5C4JJ 4P9SA 1F1ZA 1BPLA 1BR1A 3PQJA 2M9HA 3QOEA 1IJFA 4G1BA 4DK1A 1I5ZA 2V5IA 1WRJA 3ASNH 2OJED 4BL0B 1VQ7I 4UB6C 4CDGA 1MDMB 1YQAA 1KQ8A 3FPPA 1QZEA 3VO2A 1LM1A 4YCQA 3V8KA 1XSXA 5F4MA 4U4BA 4A6DA 2Q0OA 2Z2SB 1Y0NA 2DDBA 2NRAC 2VNIA 2KMUA 2X6OA 4HX4A 4XD7A 3WHBA 1Q1VA 3V76A 2LBFA 2V31A 1R5BA 2DQRA 1H0MA 1IO2A 3OEHA 4CGZA 5FGMA 3GMEA 1K7AA 3ES9A 2DO7A 2QQ9A 2XIGA 3LQRA 3GUDA 1KQSB 1EJ9A 2VZLA 3LSHA 2WSSA 4HZFA 4I84A 4A6EA 2KKOA 3SZPA 1K28D 2K86A 4OIRF 5A8AA 5EDNA 4XLNF 1JKQC 4RDKA 3ZR8X 5F1JA 5FLMJ 2ISZA 2J8KA 4D9JA 2FSWA 5EJCA 1BL0A 1BJAA 1JHHA 1WQ2A 2IA1A 3VDXA 2EZLA 2XKPA 2KDZA 3G71I 4M6YA 2E1MC 1XCVA 3HTUA 4U0VA 3D5SC 3S1MJ 1IAWA 2RC4A 1XMXA 2ZL7A 2FX0A 3OAAA 5ILUA 1OCTC 5ILVA 5ILSA 1QNTA 2VONA 4DJAA 2K27A 1L3LA 3ZMZA 5HODA 2Z99A 3AG4H 2XASA 2VBUA 2LNBA 1XS9A 2ZZGA 1R23A 2XB0X 4PJ0C 3BTIA 5L3GA 2FOKA 2M30A 2P6TA 3M8FA 1VQ6I 1KQ5A 4XLHA 3NB2A 3H09A 1XFOA 1TQPA 3M1CA 4NC7A 4EVIA 3M4OJ 1T6XA 5BSYA 3OEEA 1WU8A 1ON1A 1D1AA 1SD6A 2XAJA 1IZ1A 1IDZA 2INUA 1QA3A 4KITB 4WZLA 1VQLB 2DU9A 3JSPA 2JMWA 2XF6A 1ULYA 4JX6A 1WORA 4MHGA 4BKXA 1PJ7A 1UFMA 1N25A 4MO7A 1F9NA 1MABA 2OPTA 4DZPA 4ENNA 1P7IA 5TRDA 4BBSJ 2VBWA 5E79C 1N08A 1OKRA 3GVAA 2EH3A 4PSXA 1RQPA 2RAEA 3CRZA 4M1KA 1FNMA 2F4IA 1FOXA 4LK1F 2CBXA 4RD2A 2A68F 4HG2A 1JT6A 1T0FC 1PJ5A 4YIIA 3K1MA 1WWXA 2GJKA 2PMDA 1ZKGA 2HEOA 2Y75A 3G05A 5LBQA 2Q6LA 4E7KA 3S1QJ 4Y7NJ 2BM0A 3R61A 3BC9A 2BEOA 2Z6BD 2JUGA 2AHOA 3OOCA 4MYUA 3JX8A 3TW6A 1IA5A 1EA0A 1Q81D 3IH2A 3DBRB 2FBKA 2QX3A 1GDTA 4FK8A 1G3TA 1TZLA 3M8EA 1MJAA 4LB6B 3CCQI 1QA6A 1WZ2A 4PDKA 2AXLA 1YRNB 2FEZA 3SY2A 2HOEA 1P92A 3ABLH 2LZJA 1Y6IA 1S8NA 3PUBA 5HDKA 3NRVA 1CF7B 3LJYA 4RB0A 1ZGAA 1WMRA 4CSWA 1YJWI 1XE1A 1BN5A 2CW8A 2M8EA 1W5SA 1A8PA 1T6ZA 2WWYA 3PM1A 3CUQC 3OV8A 4RGSA 2BVMA 3U1DA 3HAGA 3CO7C 3FXRA 2ID6A 3H35A 1MH3A 1IN5A 2K9SA 3SJZA 1YITI 4B09A 2FXAA 2OTJI 5C4XJ 2C6YA 2JIZA 2E35A 3WXMA 5J4VA 3FK6A 2LKSA 1SVLA 3I55I 1QGZA 2RQQA 4BE2A 2D3NA 2FRHA 4OOIA 3OYDA 3F8MA 2STTA 1G7SA 1Z77A 4XOPA 2FE3A 4W97A 4XRSG 4LG0A 3RYPA 1GR1A 4BHBA 3BCFA 2BSPA 5DD8A 2K9MA 3M07A 1X3WB 4V2GA 4WZTA 3G71B 2C2WA 1XDSA 2TRTA 3LVBA 4U88A 1H89C 3W2IA 2HVSA 4I7HA 1VQ8I 3H3VK 1UD8A 2A69F 4A3EJ 1MZBA 2O04A 4BJ6C 3CMYA 2HYJA 2ZZQA 3TQNA 2V7FA 4RA2A 1N07A 5FD6A 3AGQA 4X6AJ 4DYQA 1K5CA 2A61A 2DQLA 3HZJA 1A5JA 1UHMA 2VI6A 4TMZA 1BX0A 2WJYA 3UNGC 1QG0A 3W2VA 4EQQA 2L7FP 4KT5C 3GSIA 3CCSI 1TWCJ 2QWWA 5E3NA 2WZNA 1LEBA 4CQJA 3S32A 3C7JA 1N0UA 1XMAA 1J75A 2L7MP 3OMYA 4C43A 4ESJA 4TMTA 5AN9A 1MBJA 3F3XA 3TP3A 3MCAA 4HV6A 1N8RD 2WBMA 5GPAA 4XKVA 3SDGA 1SMYF 4I02A 1SM4A 1T6SA 2BOLA 5H2FC 3MFKA 4OINF 4QWQA 5HLHA 3WTVC 1VLOA 2CNDA 2ZFUA 3BJ6A 3WGIA 1WJFA 3U6BA 4XN0A 5E17F 5TGTA 5K5OA 1SFKA 3MKZA 1R1VA 3E6CC 3KYDB 5IT9Z 4MXNA 1O8JA 2J8IA 2FF4A 3AG3H 2TCTA 2Q2EA 1AMOA 2LLKA 2DDAA 3MMYB 5ICEA 2G7HA 2J5PA 4GXOA 3F22A 1DARA 4KIFA 3ZC3A 1LEAA 3SEZA 2F1LA 2D9RA 1IV8A 2XZOA 1JJ2B 3EYYA 4EJTA 2IS4A 4FX0A 2H94A 4QPOA 5F64A 5D8LB 4M4SA 2VBEA 1K73D 3LWFA 2WYRA 1HZEA 3M8JA 3Q9SA 1T39A 5F27A 2W57A 2JJ1A 5J8CA 1K78B 2X1DA 1MGTA 1X3UA 4IHYA 1N0VC 3QYBA 2BN4A 1BOBA 1KTVA 2A5YB 3E3VA 1Z67A 3I0TA 3JAMK 2QBYB 5F4JA 3A01B 2L9NA 1R36A 1MMSA 4E0FA 4NQWB 4AM3A 1X4OA 1UD4A 3O8HA 4BEHA 3L2CA 3Q9VA 1KYZA 3GTKJ 2R7SA 3PUNA 1LDDA 4XSXF 3L2VA 4Z4ZA 2F43A 5FLXK 4QV2A 2ZKZA 3VWBA 3DTIA 1ZLJA 3CESA 1X1DA 3IHUA 1U3EM 3VR6A 1EZGA 3BG6A 2QEXI 4Q48A 1UB9A 2ZB9A 4AYBN 1S7EA 2XRNA 1W5TA 4X07A 4BDYA 3IL2A 3LAJA 1R5OA 2PG4A 4CCOA 1GVHA 2V79A 3A8KA 3KLNA 3S3MA 3MMPA 2R7DA 5CVUA 1J2XA 4BJ5C 2FBHA 3HJEA 5IYBJ 1VI0A 2M34A 4G12A 5J40A 2OAZA 2ESNA 1EFRA 2HKXA 4DZJA 4G7WA 4RD0A 1QJVA 5C3EJ 1E62A 2VUMJ 4Z6YA 3SQNA 4F52A 4GFBA 3GFJA 4EEFG 5EG0A 1W9XA 4HNVA 4HNUA 3ABMH 1Z91A 2YX7A 5FFXA 4ZDLA 1TYXA 1IN4A 3HB9A 1YLOA 4TMXA 3T51B 2WAQN 2CU7A 3GEZA 3H9JA 3K4MA 4YEIA 4F7DA 4BE1A 5GTHC 3Q0VA 1W7PA 5FO0A 1I39A 2M2EA 2XZPA 2DA2A 1W0TA 1K79A 3F0CA 2PI0A 2L3DA 1BJZA 2XAQA 2NXNB 4O3MA 1YI2B 1OFMA 3HOWJ 3K70C 3W5VA 1KK0A 2R7OA 5K5RA 3HDDA 2DA3A 4HX7A 4B4CA 1ZR4A 1GAWA 3BR1A 4FETA 1Q82D 3A0HC 2VKDA 2X53S 4YC5A 1S3JA 3CDIA 3BJOA 4ITVA 1N77A 3HOSA 3R0JA 1AWCA 2P3MA 2KDOA 2TDXA 3C2BA 1IN6A 3WTSC 3KEQA 1KGSA 1BX1A 3L09A 3KFWX 1QQIA 5M5WJ 4AUXA 3JRBA 1S4MA 2PECA 1Z9CA 1YS7A 1RNLA 2GJRA 3CPXA 2P4WA 4B8XA 4ACBA 1JTXA 2VFPA 4G1VA 3UKGA 4XNFA 3ZQ7A 4GO1A 3IV5A 3GXOA 4BY7J 1LB2A 2GA1A 3K4NA 3RIRA 1IRXA 4YRVA 4Q4ZF 4F55A 2BM4A 2X1CA 2ZCWA 1QGYA 3DLAA 4RCZA 1E3XA 4QVJA 5H59A 2Y0SN 1E3OC 3CMEI 2WTEA 1W1WE 3DU5A 3JW4A 3QODA 4D7NA 3LAPA 4X05A 2QQBA 4UZEA 1XGSA 3IKTA 4DIQA 4CXFA 2VB6A 2R0QC 1IXCA 4CCKA 1U8RA 2B5OA 3AVXA 1K8AD 1BI3A 2XNCA 3W6VA 4M3EA 1B72B 1RWRA 4FQGA 3E97A 4RMNA 1V5VA 2DFHA 5DUKA 5J6XA 1JB9A 3TP0A 1YX5A 1VQKB 2HQAA 4OJOA 4CCLA 1F43A 3A3GA 2EA2A 1FZPB 2QTZA 1LLZA 1PUFA 2NZMA 3HRSA 1W5CC 2F4MB 4UUVA 4TT3A 1V5FA 4C0SA 3WTZA 4UV8A 2UVEA 1K6YA 5LEJA 4XK4A 4P22A 1IUFA 3CB4A 4X7DA 1R5ID 1UG0A 3BY6A 4R8HA 2ZBKA 3GRHA 2KRCA 2CUJA 2JK3A 2P5KA 4RGXA 1VQ7B 3NEUA 2XGEA 2MW8A 3KP2A 3T5XA 1UCRA 4M3FA 2DMTA 3OSGA 3ZQFA 2N8GA 4HA8A 3BDDA 2CQ7A 2EFGA 1RKTA 5HS7A 1EH8A 5BNGA 3RTRA 2DMUA 2K3PA 1YHQI 4UV9A 2EB7A 2HS5A 2X9DA 3FXQA 1S6LA 4WXDA 5DM7F 3KP6A 2IAIA 3CC4I 1GV2A 4Y3OA 3AG2H 4DOZA 5LFAA 4UUTA 3G73A 1KD1D 1ZARA 4UZFA 4ZC3A 2F3LA 3WHCA 3ZOBA 5IYNA 5CQEA 1B8IB 2CRGA 3HOYJ 1TSPA 2COBA 3I4PA 3HXLA 3P7NA 4ZDPA 2V7QA 2W6IA 4YHBA 1QCXA 4IRHA 2VFMA 3HC7A 3V7AA 5JBQA 1ETOA 4LLNA 3OYKA 1O3SA 2VBTA 2XNJA 3MQ0A 3WBKA 4RB3C 3JCUC 3OKXA 4OOVA 4P6YA 3PSFA 4W8RA 1JUSA 2VQCA 5CYVA 5JLXA 2Y9ZA 2P0WA 2ZC2A 2XVCA 2MG4A 2UXNA 3FKJA 2VT3A 2DOAA 1TL8A 3BTLA 2F4NA 3CZ6A 2XGJA 1P9QC 2GJPA 5BPIA 3RKWA 3DU1X 1EWYA
chains in the Genus database with same CATH topology
1TT0A 1N75A 5HNHA 4QPQA 4UZUA 1HA8A 2I8DA 3D5RC 3E1SA 4HWVA 1MMDA 1HG8A 2LG4A 2Q2EB 3GVJA 4IKFA 2JSPA 1U0JA 4GQNA 4XLAA 4PFPA 2OV7A 3FDYA 3HOTA 2F5VA 1V0EA 2VBMA 4B44A 3BG7A 4IQ4A 2CW7A 5CPRB 3OW7A 3EUAA 3T53B 2IS2A 1PJRA 2XF5A 3DQVC 1ERDA 2IGOA 4DNRB 3B4NA 2R7WA 4OZZA 3ZPNA 2XZLA 2GK7A 1AA7A 4YELA 1T5EA 2HVQA 4IZZA 3T56B 3OPOA 2Z8GA 4F92B 4ZTFA 1O8KA 1D0XA 1UD2A 1KCCA 3PJRA 4F93B 2QE7A 4HEA2 1Z21A 3A35A 4YZ0A 4NNJA 2K9LA 2EWEA 3L2RA 1MMAA 2KRHA 3AKZA 2CK3A 4OWRB 3FY3A 2V1NA 4E7LA 2ZTNA 2VJJA 3VYTB 1QHHD 3NWSA 5CKTA 1OGOX 4U49A 1WJAA 2VJ4A 3H5AA 4XKCA 3ZCOA 2ZZFA 2M7BA 4XLCA 4E7ZA 4JMQA 3IAM2 2L2OA 3HPGA 2ZZEA 3OE7A 2A6TA 3VSVA 2DXIA 4YZAA 2ZSIB 1LVKA 2MFZA 2R7TA 2DT6A 3RCOA 4J01A 4PJMA 3VSUA 1W0KA 3HPHA 4FXUA 4KT6A 4U7BA 1BPLA 1BR1A 1V5GA 3QOEA 3OFNA 4DK1A 4FASD 4B3FX 1Y56A 1FMVA 4CH7A 4IQJA 4RM3A 4BL0B 3FPPA 2R4GA 3V42A 4YEJA 3BCDA 4LG3A 1UAAA 2UV1A 3ZRGA 1S9HA 2IS6A 3H5RA 4U4BA 2Z2SB 3VYSB 4NUBA 2KMUA 4XD7A 5FRMA 3B90A 2LBFA 4PSWA 2V31A 2E5NA 2ODLA 3VYUB 4J00A 3JU4A 3S8PA 3OEHA 2WAEA 2IGKA 4XN3A 2VXDA 3PNVA 3LSHA 3QYFA 2WSSA 4I84A 4E4HA 4AYBA 4NK6A 3K10A 4E7SA 1WFXA 1K28D 4MLOA 3ZR8X 3TBIA 3L2UA 3K4BA 3B8YA 4XLEA 4D9JA 5HVQC 3VDXA 2X1EA 1COWA 4IX7A 2NT6A 2CV0A 3IP4B 2E1MC 3D5SC 2HPMA 4F3QA 1R6RA 2PMZA 3K4KA 3OAAA 4PK4A 1IDJA 2OC6A 1WJ5A 3N05A 5KCMA 4DJAA 1BMFA 4BQQA 3KEYA 2WAQA 4BU2A 3AL0C 2ZZGA 1X1CA 2HZDA 2NTBA 3LMMA 4OAZA 1BN8A 4NK8A 2VJ5A 3L2QA 3C2HA 3EQNA 4URRA 4OJ5A 4LIVA 4XLHA 2W7NA 1JRGA 3CP2A 3VSTA 2IXSA 2R7XA 4RLQA 3M1CA 3H0DA 3GQBA 4NC7A 3GVLA 3LSGA 2XAUA 1G8XA 4BUPA 3OEEA 1BR2A 1D1AA 1Z3YA 2INUA 1OOCA 4KITB 2R7RA 4ZDOA 1D0YA 4XKWA 2DJIA 2MC4A 3LSMA 3ONQA 2PYHA 4N4NB 2JJ2A 5JHFA 2XF6A 1OFLA 1X1AA 4OJLA 3OIQA 4DK0A 2LBFB 4OJPA 2E1BA 5FRNA 1MABA 5FROA 1XG2A 2GOMA 2VBKA 4PSXA 2JVGA 1D1CA 2F4IA 3EUHC 3OYFA 2R9VA 3E0JB 3MD2A 1O8MA 4XLFA 3F9KA 4HG2A 3HKZA 4Z06A 2KL4A 2LOOA 2VKHA 2E1MB 1T0FC 3VMVA 2GJKA 3OYBA 1DGRM 2CMPA 2KP6A 3OYJA 3TMOA 1MMNA 4HPQA 1G59A 3G05A 4E7KA 3BC9A 3G2BA 1E1RA 3NE5B 2DT7B 1FMWA 3AL0B 2Y0SA 2Z6BD 3TL4X 4DBRA 2JUGA 2ZTGA 3OOCA 1DBGA 2KHMA 2O17A 2R7VA 1IA5A 3FBIB 3OOUA 1WJDA 4HIZA 2MD0A 2QX3A 4DBQA 4N4OB 2X51A 2O5RA 3OYIA 2JDIA 1RMGA 1TZLA 4RM2A 2UWMA 1O8GA 3OYHA 2LYCA 4BJTA 5CDFA 3LFUA 2LZJA 1Y6IA 3S3OA 3ZQQA 1OLTA 3PUBA 3GQ8A 2CUZA 3OS1A 1WMRA 4CSWA 2VPLA 3DKYA 2CW8A 4KKTA 1RU4A 3LMWA 3U21A 1VBLA 1O8LA 2UVFA 1EE6A 4YZQA 3GBGA 3K6GA 3HAGA 2BVMA 2LREA 5HLTA 1N78A 3RQ4A 1PXZA 3H35A 2CV1A 3GVKA 3J7AY 4II3A 1OB0A 2JIZA 3OL3A 2V26A 2AQFA 3PFYA 3SZGA 4BACA 3BLYA 4LITA 5DN6A 5HOOA 2RQQA 2HLDA 4BE2A 4PMHA 2D3NA 3K4CA 3OYDA 4OZYA 4RLFA 3W2WA 4XOPA 1DBOA 3LSKA 3FHNA 2X3HA 2W6JA 3BCFA 2WZPP 3ZIAA 1WPCA 1IDKA 2BSPA 2K9MA 2CS3A 2CH0A 3OYMA 3OR2C 3A3BA 4BQOA 3WWGA 4EW9A 3LNNA 4U87A 2HVSA 3W2AA 2V6EA 2L9SA 1LKXA 1YE9A 3OWTA 3K70D 1UD8A 5HKKA 2NSPA 4P1WA 4AU7A 2VQLA 4BJ6C 4XR6A 3OYGA 2O04A 2X85A 3H9QA 2ZZQA 2LH9A 2V7FA 2L5QA 2KQRA 2X6WA 2DCEA 3ZGKA 3K4JA 2JA2A 4C2UA 2BW3A 3NWTA 1QU3A 4D1QA 2M4GA 1O8DA 4C2LA 1DGWY 4KJZA 1W36D 3SUCA 1E3ZA 1K5CA 3ZXSA 3A4CA 4ZTJA 1KZLA 2NTPA 2E5ZA 4Z05A 2WJYA 1E43A 2XNDA 2E60A 3UNGC 2PJRA 1IB4A 3DU6A 3VSKA 3W2VA 1MNDA 1ZELA 3CJRB 2V4JC 3BCAA 3PSIA 3S32A 2R7UA 5C1EA 4XOTA 2VLAA 1OGMX 3OS0A 3OMYA 3C2GA 2LRDA 4BXFA 2O0WA 3I9V2 2NOJB 4PJJA 1DP3A 4ZYAA 2NSTA 2WBMA 4XKVA 2X6XA 3UR3C 3SDBA 1H80A 4HRIA 4X0GA 2WADA 2BOLA 2OUMA 3KEWA 4YXWA 2RNGA 1UD6A 2PYGA 2ZFUA 5AMVA 1WJFA 4XN0A 1I18A 2AQEA 4NC8A 5TGTA 4C30A 2HDWA 2UUZA 4HNTA 1SFKA 3DEEA 3OYAA 3MKZA 1V0FA 4MXNA 4E7HA 1O8JA 4BDZA 3OR1C 1Z7LA 3LSIA 4HSRA 5KNLA 1UELB 1UD3A 3MMYB 2M4KA 2Z16A 3PNTA 2XDVA 3SEQA 4R79A 1PYVA 4YZXA 1DQUA 3ZPPA 2HU9A 3S93A 2Q1ZB 3SEZA 4XL9A 4C9YA 4XQFA 3OYNA 2CV2A 3DKXA 3QYEA 4E7JA 2KZVA 2GK6A 2XZOA 2IS4A 1QHGA 4F91B 4QPOA 1JI8A 2CFOA 1NBMA 1D1BA 1I8DA 1VJSA 2VBEA 3H9GA 2IQ7A 1HZEA 3M8JA 1X19A 5C1CA 2BW3B 4CCJA 2JJ1A 2X1DA 1NG6A 4CCMA 3QYBA 4B3GA 3DPUA 3OL4A 1BOBA 1FX0A 1O8IA 4GRIA 4HSTA 1H8HA 3CJQB 4TSFA 1CZFA 2L9NA 1GQ8A 4G7XA 4E0FA 4NQWB 1X4OA 2PJRB 4BEHA 1UD4A 2WB1A 1WJEA 2D3LA 2R7SA 4PFOA 3L2VA 4E7IA 4G6TB 2F43A 3VR6A 3VWBA 3DTIA 3CESA 1X1DA 2QKMB 4TKOB 3BG6A 3I3LA 4OAYA 3EUKL 4BDYA 1Z3XA 2LC2A 4CCOA 1VZ0A 4PJLA 4CA0A 3S3MA 2LY2A 3IUOA 4BJ5C 2W4SA 3OYLA 3MKYB 4W8QA 1EFRA 4ASUA 4G7WA 4Z03A 4C2TA 2VQHA 3VSLA 1QJVA 2DIEA 4F52A 1PKVA 3DPLC 4B3XA 4B48A 3DWLE 4JQFA 1W9XA 4HNUA 3HL2A 4ZDLA 4XONA 3T51B 3DPTA 3W3CA 3H9JA 4XM3A 3K4MA 2R7QA 3A2KA 3T9GA 5HNFA 2M5SA 4DNTB 1KCDA 2GOXB 4BE1A 4BGDA 2V4DA 3S3NA 4CZCA 3LL7A 2XZPA 1LDKB 2VIXA 5IK2A 4KKSA 4AVZA 3EPZA 1OFMA 2V9KA 3K70C 4B47A 4EATA 1OHHA 3MKWB 2R7OA 2A5WA 1HVXA 2FUG2 3OYEA 2XSJC 4OJ6A 4FETA 2WPDA 3BCBA 2VKDA 3DTEA 3K4LA 3OS2A 2X53S 5KHDA 1W36C 2WA0A 4ITVA 1N77A 2W1OA 3HOSA 2KDOA 4ZJZA 1WTHD 4BEHB 1SKYB 3H94A 3DTKA 2VQGA 1X1BA 4BS9A 2HNHA 2PECA 4II2A 4E6KG 2WY7Q 3CF2A 2QKLB 2ZXIA 2GJRA 3RSNA 3VMWA 1MNEA 1LFPA 3OY9A 4XNFA 1O8EA 3GQ9A 2BVLA 1PE9A 1KTWA 1MMGA 3K4NA 4YRVA 1X0CA 1IRXA 3FKSA 2WAFA 2XOKA 4Y33A 3CMMA 4F55A 2X1CA 2M7AA 2KPMA 3GQAA 3DLAA 1UD5A 1E3XA 3OIPA 2QY1A 1WJBA 1NG7A 3KRGA 1H8EA 3HUGB 3WQZA 3RPUD 1NRKA 1W0JA 3DU5A 3QODA 4G6IA 4DGWB 3ZSCA 2IGNA 4MR0A 4DIQA 2VB6A 4CCNA 4CCKA 3KYLA 2F1MA 3BC8A 4W8TA 3UW0A 2WJVA 2F6CA 1RWRA 4KKUA 4RMNA 2XC7A 2NT9A 4BE0A 2QXZA 1YX5A 3AFHA 3FBNB 2HQAA 4OJOA 4CCLA 3A3GA 1AIRA 1VF7A 2O1DA 2MABA 1WP6A 1YX3A 2IGMA 2INVA 1O88A 3A1YA 2M0MA 1D0ZA 1BHEA 2NZMA 4B43A 4TT3A 3OYCA 1JTAA 4XMYA 1V5FA 1PLUA 4L8JA 2UVEA 1K6YA 4P5OA 4P22A 3SYTA 1UG0A 2ZSHB 5FL7A 3GRHA 2HVRA 2KRCA 5LD2C 4Y4RA 1KONA 2CUJA 2Z1DA 4ANJA 4JOMA 2W00A 2XF7A 3PL8A 3BH4A 1T95A 1BR4A 4H4KC 2NTQA 2X6YA 3VYRB 1GLNA 3PNYA 3JURA 4BQNA 1MW7A 4PUSA 1X4PA 3L2WA 3RTRA 2K3PA 2M3AA 2KLOA 2L7KA 5CQGA 3D5LA 4Y3OA 4DOZA 3KX2A 5LFAA 3H5NA 4XKBA 2LY1A 4ZC3A 1O8HA 1WJCA 5CQEA 3HG9A 1E0EA 2VXZA 3HXLA 2W82A 2WY8Q 4ZDPA 1E79A 2KVOA 2V7QA 2W6IA 3DDYA 2RREA 2ELJA 3HC7A 1QCXA 1NHCA 3OYKA 2IS1A 2JVHA 1O8FA 1SAUA 3CP8A 3GQ7A 3PSFA 4W8RA 2VQCA 3IAS2 2O0VA 2VASA 2ZXHA 1KMHA 2K5CA 1J09A 2P0WA 2VL8A 1V5EA 3EQOA 3FKJA 4XORA 1OR7C 4KISA 2HPIA 1EA3A 2X8KA 1BLIA 2DOAA 4LIUA 2XGJA 4CUGA 3CZ6A 4Z1MA 1P9QC 2MYSA 2GJPA 1E1QA 4PJNA 1VLYA 4W8SA 2VJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1E A;  4HWV A;  2INU A;  4XOT A;  1OOC A;  1HG8 A;  1OGM X;  4XKW A;  2PYH A;  2PEC A;  4XLA A;  1OFL A;  2O0W A;  4OJL A;  2VBM A;  4OJP A;  3VMW A;  2NST A;  4XKV A;  2X6X A;  1XG2 A;  4XNF A;  1H80 A;  1O8E A;  2PYG A;  3GQ9 A;  3B4N A;  1PE9 A;  2VBK A;  4OZZ A;  1KTW A;  1X0C A;  5AMV A;  4YEL A;  4XN0 A;  1O8M A;  4XLF A;  3GQA A;  2Z8G A;  4Z06 A;  1O8K A;  1KCC A;  4MXN A;  1O8J A;  2QY1 A;  3KRG A;  4YZ0 A;  2EWE A;  3VMV A;  3ZSC A;  4MR0 A;  2VJJ A;  4YZX A;  1OGO X;  4U49 A;  3ZPP A;  4XL9 A;  4XQF A;  4W8T A;  3UW0 A;  4XLC A;  1DBG A;  2O17 A;  1IA5 A;  1RWR A;  2NT9 A;  2QX3 A;  2VBE A;  3VSV A;  2IQ7 A;  1RMG A;  4YZA A;  5C1C A;  1O8G A;  2QXZ A;  1O8I A;  4OJO A;  3VSU A;  1AIR A;  2O1D A;  1CZF A;  1GQ8 A;  2INV A;  3GQ8 A;  1O88 A;  1WMR A;  1BHE A;  2NZM A;  1JTA A;  4XMY A;  1PLU A;  4YEJ A;  2UVE A;  1RU4 A;  3LMW A;  1VBL A;  4U4B A;  1O8L A;  2UVF A;  1EE6 A;  3GRH A;  4YZQ A;  3B90 A;  1PXZ A;  2ODL A;  2NTQ A;  2X6Y A;  4XN3 A;  3JUR A;  4W8Q A;  4I84 A;  4NK6 A;  4PMH A;  4Z03 A;  1QJV A;  4OZY A;  4XOP A;  3B8Y A;  1DBO A;  4XLE A;  2X3H A;  3FY3 A;  1IDK A;  2BSP A;  3WWG A;  4EW9 A;  4XON A;  2NT6 A;  1O8H A;  4XM3 A;  3T9G A;  1KCD A;  2NSP A;  2O04 A;  1QCX A;  4XR6 A;  1IDJ A;  2X85 A;  1NHC A;  2X6W A;  1O8F A;  4AVZ A;  3GQ7 A;  1O8D A;  4C2L A;  4W8R A;  1OFM A;  2O0V A;  2NTB A;  3SUC A;  1K5C A;  2NTP A;  4NK8 A;  1BN8 A;  3EQO A;  4Z05 A;  4XOR A;  3EQN A;  4URR A;  4OJ5 A;  1IB4 A;  4OJ6 A;  4XLH A;  1JRG A;  3VST A;  4W8S A;  2VJI A; 
#chains in the Genus database with same CATH topology
 1YW8 A;  1T98 A;  2IBD A;  2I8D A;  1VQ6 B;  4V19 K;  4M3G A;  2QYO A;  1MMD A;  1KQ0 A;  4MEY F;  3CCM B;  3J81 K;  3KZY A;  4MTE A;  2OQG A;  1AU7 A;  3B6A A;  3FX3 A;  3ZQL A;  2CUF A;  3ASQ A;  1ZRF A;  3BPX A;  4N9H A;  2ADU A;  2HR3 A;  2IPQ X;  4Q47 A;  3HOT A;  2YU9 J;  4B44 A;  3HSF A;  3OW7 A;  1X58 A;  1RKW A;  3IRQ A;  3KYC B;  2L0K A;  4IEJ A;  4MFD A;  3CC7 I;  3DQV C;  4O5V A;  2AHQ A;  2IGO A;  1R9T J;  1MBF A;  3PUF A;  4MFE A;  4OZZ A;  2GK7 A;  1AA7 A;  2FML A;  3OSF A;  1SAN A;  1O8K A;  2E7X A;  2EIL H;  5E1Z B;  1Z21 A;  2A05 A;  4KDP A;  1B1B A;  2PJP A;  1MMA A;  2KRH A;  3J7Z I;  2CK3 A;  2V1N A;  3PIO F;  3O6B B;  1QUE A;  5B6I A;  4U49 A;  2VJ4 A;  5LGU A;  3R6S A;  2K7L A;  2LF7 A;  1K61 A;  1JKP C;  1A36 A;  2ZZF A;  5DD4 A;  2E1N A;  1ZHF A;  3ESW B;  3CUO A;  4L9N A;  4I99 C;  3HPG A;  1FDR A;  2ZZE A;  2B0R A;  4L9T A;  2O03 A;  4UUS B;  1K6O A;  4JX5 A;  2V7W A;  4TMW A;  4OIQ F;  2MFZ A;  5DTD A;  2XAF A;  2R7T A;  2P7C B;  2O6G E;  4KT6 A;  2BY1 A;  4WXC A;  1RUN A;  2EWN A;  2DYS H;  4LD5 A;  1YTY A;  3OFN A;  4B3F X;  4KIG A;  3GO5 A;  3CCQ B;  1FMV A;  1Y56 A;  2BXZ A;  3BR3 A;  5B1A H;  1JT0 A;  4RM3 A;  4IQJ A;  1QFJ A;  3OW2 B;  2A6H F;  1I6X A;  4LG3 A;  4M0L A;  2UV1 A;  3ZRG A;  3MAJ A;  4OPV A;  3VYS B;  5JR3 A;  5CVI A;  1E17 A;  2B7B A;  4A3K J;  1YJW B;  5FRM A;  1OCR H;  4PSW A;  2ICW G;  2E5N A;  2XTY A;  3JRC A;  3S8P A;  4A0Z A;  1XC5 A;  3G3Z A;  1FY7 A;  1F60 A;  5KK1 A;  3WU2 C;  2IGK A;  2QQA A;  4XN3 A;  4P96 A;  1JKO C;  1MSF C;  2VXD A;  1OB2 A;  4NK6 A;  1YIT B;  1ETX A;  1WFX A;  2OTJ B;  3BP8 A;  3LYC A;  3HRM A;  5BS6 A;  2HTJ A;  3TBI A;  5DDG A;  5EYR A;  2Y30 A;  5A89 A;  3B8Y A;  1OIS A;  5A2Q K;  4N3N A;  2GXB A;  1KQ9 A;  3IP4 B;  2NVY J;  1R6R A;  3VFZ A;  2PMZ A;  3K4K A;  5HS8 A;  4G94 A;  2C4U A;  4HX8 A;  1GXP A;  3Q6R A;  1NHA A;  4XID A;  1FLI A;  4U0Y A;  3QE2 A;  2OC6 A;  1WJ5 A;  1L0O C;  2XB5 A;  3R4K A;  5KCM A;  3FMS A;  1BMF A;  4IOC F;  1VQO B;  4BU2 A;  1ZRC A;  2HZD A;  3RDI A;  2NTB A;  3BNW A;  1R5N A;  3BY2 A;  3JQP A;  5M5Y J;  2VFN A;  4UVB A;  1HF2 A;  4RLQ A;  3H0D A;  3GQB A;  5IOZ A;  2YUS A;  3LSG A;  4Y17 A;  3W6K B;  1M1E B;  3GZ6 A;  1ZH5 A;  1ZUN B;  4MQV A;  1D2E A;  1Z3Y A;  2IP2 A;  1OOC A;  2NS8 A;  4ZCL A;  3HTS B;  2PYH A;  1OYW A;  1W87 A;  1YI2 I;  5J1U A;  1X1A A;  4OJL A;  3OIQ A;  3ZMS A;  2XUB A;  1TNS A;  2LBF B;  4IRI A;  1AIP A;  4OJP A;  3I59 A;  4ON0 A;  1QZZ A;  1JNY A;  9ANT A;  1RC9 A;  1KK2 A;  5FKL A;  4IJA A;  1FBU A;  3EET A;  4L0Y B;  4CIC A;  1FWZ A;  2V7X A;  1QO0 D;  3EUH C;  2R9V A;  3E0J B;  3MD2 A;  1O8M A;  3F9K A;  1I27 A;  4QLC U;  2KL4 A;  2LOO A;  2VKH A;  4JRA C;  2QSH X;  1ENH A;  5GTI C;  1F20 A;  1JUM A;  2KP6 A;  3DP7 A;  3J80 K;  1K4T A;  1IW7 F;  1MMN A;  2JA6 J;  3JRE A;  3S17 J;  2R7F A;  5E20 A;  1WSR A;  1X1P A;  3I4N J;  2ZTG A;  4QSH A;  3WG9 A;  4DBR A;  3ZQC A;  4W1U A;  3AVT A;  4Z4R A;  1XMK A;  3ABU A;  2HXO A;  3JRI A;  1WJD A;  4AF6 A;  3L9F A;  4CZZ A;  2X51 A;  2G0E A;  2K9N A;  2JPC A;  2UWM A;  2LYC A;  3F6O A;  4A2U A;  1F4K A;  2DK8 A;  1WDT A;  3LFU A;  5KSW B;  2K3F A;  2O7O A;  2OU2 A;  3ZZT A;  3S3O A;  3GQ8 A;  2GQQ A;  2CQQ A;  3HRT A;  1LFU P;  1XN7 A;  2NV4 A;  5TIS C;  4PC1 A;  2VPL A;  2DLL A;  1MNM C;  1B6A A;  3N4M A;  1GXQ A;  3REO A;  1EFU A;  1N78 A;  3RQ4 A;  3CMA I;  3GVK A;  2W85 A;  3J7A Y;  4II3 A;  1UHS A;  1ZAO A;  1O7F A;  3OL3 A;  3PFY A;  3T8T A;  1WSU A;  2OCC H;  2VFO A;  2E1O A;  5DSZ A;  4PMH A;  4ABZ A;  1O7L A;  4RJL A;  4OZY A;  3W2W A;  1A35 A;  3MWM A;  2A6E F;  4HBL A;  2X3H A;  3FY3 A;  2W6J A;  2WZP P;  3ZIA A;  1WPC A;  2CS3 A;  3A3B A;  3OR2 C;  1WHU A;  4Z4Y A;  2QN6 A;  4HDV A;  1ZG3 A;  1DDG A;  2R5Y A;  3P4G A;  4EM1 A;  1FSH A;  3BG5 A;  5L3C A;  3W2A A;  2L9S A;  1YE9 A;  3K70 D;  3WBJ A;  3FF5 A;  3A1P A;  4P1W A;  4AU7 A;  1WSV A;  4XR6 A;  2DYR H;  2X85 A;  1XSD A;  4HE6 A;  3AST A;  4LC0 A;  2L5Q A;  4OOS A;  3O3K A;  4C3J J;  1IGN A;  2JA2 A;  2Q6I A;  2BW3 A;  3ISP A;  3NWT A;  4D1Q A;  3BY1 A;  4QUZ A;  1QVG B;  1G7C A;  1DGW Y;  3SUC A;  2QF7 A;  3A4C A;  4ZTJ A;  1SD4 A;  2KIF A;  1ZR2 A;  1KZL A;  5FKN A;  1IB4 A;  4CHU A;  2PJR A;  2A07 F;  2AO9 A;  3ECO A;  3VSK A;  1ETW A;  2FNP A;  2GXG A;  1MND A;  5FKK A;  2R6H A;  4O6J A;  2ZO4 A;  5CVR A;  1K4S A;  6PAX A;  1R4M B;  1WOO A;  1T08 B;  3BCA A;  2EFW A;  1AHD P;  2V1U A;  2OK7 A;  1HA3 A;  2PMH A;  2ZME A;  1FRQ A;  3I5U A;  5C1E A;  1YFH A;  3E6D A;  4M9X A;  2EIX A;  4QFM A;  1OGM X;  2G7U A;  3M3Y J;  1UG2 A;  2NS0 A;  4E70 A;  5AIQ A;  3ZMV A;  1U6G A;  4WXH A;  2DMQ A;  4KN4 X;  1TWH J;  2NYX A;  2O0W A;  2NOJ B;  4FCY A;  1N05 A;  1DP3 A;  4CYC A;  1FYK A;  4AD9 A;  4MQ9 F;  2X6X A;  1OGI A;  1TBX A;  4YAF A;  3N90 A;  4X0G A;  2HI3 A;  3KEW A;  1UD6 A;  1ZGJ A;  2PQ8 A;  1SVO A;  2AQE A;  2ZNZ A;  1Y8R B;  4NC8 A;  4S0H B;  3AG1 H;  5JLW A;  3V7S A;  3CCM I;  1A6Q A;  4BDZ A;  1JXS A;  2NPF A;  5IP9 J;  4RLZ A;  2Y69 H;  5IYW A;  5KNL A;  3CPW B;  2M4K A;  3PNT A;  3SEQ A;  1V55 H;  3A03 A;  1PYV A;  4Z4S A;  5GPC A;  1DQU A;  1GUU A;  1HLV A;  3B73 A;  1FPQ A;  3CME B;  2Q1Z B;  3LA3 A;  4C9Y A;  4XQF A;  3OYN A;  1YIJ I;  3PUM A;  4Y7C A;  2DA7 A;  2KZV A;  2HDD A;  2MBF A;  4F91 B;  1JI8 A;  1HQC A;  4P25 A;  1R22 A;  3H9G A;  1PDN C;  4LB5 A;  5C1C A;  3F8F A;  5A2Q Z;  1P4M A;  4B3G A;  1O8I A;  4A3B J;  1DPR A;  3KCC A;  1KA8 A;  3RI4 A;  1LE8 B;  3HOX J;  1JJ6 C;  2ACJ A;  1IJE A;  3U2Q A;  4LJZ F;  5AIP A;  3JTG A;  2WB1 A;  2STW A;  1WJE A;  3ZBU A;  2EFQ A;  5IOY A;  2ZNY A;  5D4S A;  4E7I A;  4BAY A;  1TT5 B;  1BI1 A;  2VBV A;  3FJO A;  4TKO B;  1TP4 A;  3QWL A;  5HZA A;  1NTC A;  1M90 D;  3O2P E;  1Z3X A;  4YAO A;  1A31 A;  2BPO A;  3Q3A A;  2IW5 A;  2O6W A;  2RNJ A;  2LY2 A;  2W4S A;  3QU6 A;  4EM2 A;  3ZP5 A;  1UZC A;  2M0C A;  3OYL A;  4W8Q A;  2FA5 A;  1FRN A;  4ASU A;  2C77 A;  5F08 A;  1HW1 A;  2ZL5 A;  3P27 A;  4C2T A;  2V7U A;  1FP2 A;  1E64 A;  2BYV E;  3PQK A;  1IF1 A;  4IHV A;  1EFC A;  1SKQ A;  3LQ6 A;  4R1H A;  3DPL C;  3CXC B;  2C78 A;  4B3X A;  4A0X A;  4LBV A;  1LNW A;  5CJ9 A;  3DWL E;  1FYM A;  1YHQ B;  1YO5 C;  2Z9O A;  3S14 J;  4I0A A;  2JRT A;  1R1T A;  3GZ5 A;  2LP0 A;  4FE4 A;  4L0Z B;  4OPW A;  3JRG A;  3CD6 I;  4XM3 A;  3A2K A;  3T9G A;  3CC4 B;  5B66 C;  4DNT B;  4YIF A;  3BQJ A;  4KMU X;  2V4D A;  2K4B A;  2NNN A;  3TO7 A;  3LL7 A;  2WV1 A;  1XPX A;  4D5F A;  2GBY A;  1MD0 A;  3EPZ A;  2EZH A;  4TV7 A;  1WVR A;  3TH0 A;  4P55 A;  5DNS A;  2ZJ2 A;  1V3F A;  2J7K A;  5D6F A;  3OS2 A;  4Q5S F;  1APL C;  4CYD A;  5KHD A;  2IVM A;  3DLL F;  1W36 C;  2W1O A;  3FZV A;  4HAM A;  5DEQ A;  2D5V A;  2XPW A;  4ZJZ A;  4BEH B;  4ZYD A;  2QCO A;  1Y1W J;  2ZL6 A;  3WND A;  2R92 J;  3CQZ J;  2CUE A;  2H09 A;  5J1R A;  4BS9 A;  1U5T A;  5GV8 A;  1FX7 A;  4QHY A;  2EBI A;  3CCY A;  5HLI A;  1VQO I;  2ZBU A;  3GIR A;  2QLZ A;  1MNE A;  2DA5 A;  1W34 A;  2EPF A;  3H36 A;  1H8A C;  2CGP A;  1PE9 A;  2BSA A;  1MMG A;  2EV0 A;  5TV2 A;  3ULQ B;  2W48 A;  1S7A A;  2WAF A;  4Y33 A;  5DCM B;  5FFZ A;  3WGG A;  4EV0 A;  2M7A A;  2EV5 A;  4KFC A;  3CC7 B;  4BH9 A;  1UD5 A;  1K9M D;  2ECB A;  3OIP A;  2K9Q A;  4LGW A;  1WJB A;  3KRG A;  3HUG B;  1Y1V J;  4FX4 A;  1HF0 A;  1W0J A;  5EG0 B;  1YLF A;  1TW2 A;  4DGW B;  5GAG J;  1E63 A;  3CTA A;  1LUJ B;  4EM0 B;  5CVV A;  1DDI A;  4U0W A;  1D3Y A;  4MTD A;  4W8T A;  1LPQ A;  3VO1 A;  3JTH A;  2WJV A;  2F6C A;  2V9V A;  4RGR A;  1EKE A;  3RQI A;  5M3M J;  2XC7 A;  1W7P B;  5B3S H;  2NT9 A;  4Z4T A;  4P3Y A;  5JHU A;  5LEK A;  3LO8 A;  4RCY A;  1L1I A;  1BC8 C;  1O3Q A;  4BBR J;  1F5T A;  2CW0 F;  2CC2 A;  3FBN B;  1OMI A;  1ZRD A;  1IXR C;  1AIR A;  3K1N A;  1FIA A;  4N9I A;  1FOW A;  1ZG1 A;  3I56 I;  1WP6 A;  3I53 A;  3ZMD A;  3PEN A;  3WYA A;  2Y31 A;  2INV A;  3VOD A;  4B43 A;  3OYC A;  4XMY A;  2PLF A;  2LDU A;  3BR5 A;  3QQA A;  1QBJ A;  2X0K A;  3SYT A;  2ZSH B;  1POG A;  4Y4R A;  1ZM4 A;  3GFL A;  5D5V B;  2LFB A;  2W00 A;  5ICG A;  4XBF A;  1T6Y A;  2YX4 A;  2UXX A;  3PSZ A;  2X6Y A;  3VYR B;  1GLN A;  4UNO A;  2OZU A;  4PUS A;  2QA4 B;  3SLN A;  1TQM A;  1CGP A;  2M3A A;  2JA7 J;  2YWG A;  3KP3 A;  3VEP A;  2K85 A;  5FB2 A;  5CQG A;  3S1N J;  1IDY A;  3D5L A;  4ESB A;  1JTY A;  3SJP A;  3HOZ J;  1EP1 B;  1FNN A;  1JA0 A;  2LY1 A;  1GV5 A;  3PO3 J;  4FT8 A;  2E2I J;  1WJC A;  4Z4V A;  5IP6 A;  4G5G A;  3HG9 A;  3DEW A;  3JRF A;  2W82 A;  2J5O A;  3BTJ A;  2KVO A;  1OR7 A;  2ELJ A;  2RRE A;  1BI0 A;  1NHC A;  2DET A;  2B7C A;  2IA0 A;  4ENM A;  4IRG A;  1HCR A;  2QZA A;  2KIU A;  3IAS 2;  4LBW A;  1KMH A;  2K5C A;  3EYI A;  3AVW A;  1V5E A;  4XOR A;  3SJM A;  4KIS A;  2HPI A;  4Z4W A;  1BW6 A;  1WOS A;  5B1B H;  1BLI A;  1KK3 A;  1W2B B;  1YOV B;  2PX9 A;  1VQ9 I;  4PJN A;  1VLY A;  4W8S A;  4UZU A;  1PUF B;  1HA8 A;  2XTW A;  1MBH A;  1LQ1 A;  1YJN I;  3E1S A;  2OBP A;  3FM5 A;  1CNE A;  1PJ6 A;  1MBE A;  1ONV A;  4IKF A;  2E7W A;  4GQN A;  4PFP A;  2HWV A;  2RQP A;  5TR9 A;  3ERM A;  3FDY A;  1HW2 A;  1D8J A;  1WGX A;  1QFY A;  1WOP A;  3D0S A;  4DNC A;  2CW7 A;  2B0L A;  5EGO B;  3C3W A;  2DMP A;  4A0Y A;  2XF5 A;  1U9O A;  5F1R A;  4GYG A;  3B4N A;  3I71 A;  1D8K A;  2ELK A;  2H8R A;  3E5X A;  5BSX A;  4IZZ A;  5D5U B;  2QMU A;  4ZGQ B;  3OPO A;  4IOA F;  4F92 B;  4Z2Y A;  1UD2 A;  2MH9 A;  3PJR A;  3JSO A;  1OCZ H;  2MC3 A;  4OU0 A;  3A35 A;  4YAW A;  2K9L A;  3DBH B;  2EWE A;  3RZD J;  2W7Z A;  1QA2 A;  4PCQ A;  3MHP A;  2VJJ A;  1WI9 A;  2D1V A;  1K83 J;  3NWS A;  5J3O A;  3I64 A;  1CNF A;  1OGO X;  4HV5 A;  3FIS A;  1FT9 A;  4XKC A;  4A12 A;  4WCG A;  3ZCO A;  5DM6 F;  4M3D A;  2BHZ A;  3ASR A;  4E7Z A;  1P6R A;  3IAM 2;  4JMQ A;  4R71 A;  5JLV C;  4BPR A;  3I58 A;  2A6T A;  3VSV A;  3JRD A;  4QIW N;  2DXI A;  2ZBV A;  4H0E A;  4ZYE A;  2QUF A;  2HCJ B;  3BRO A;  2B7E A;  4YZA A;  2V7T A;  1QVU A;  3PSS A;  4PJM A;  1J7K A;  4OMY A;  1BIB A;  1I3A A;  4ESF A;  1A6I A;  1QGA A;  4FXU A;  4U7B A;  1H85 A;  2BXY A;  4OP7 A;  3WNB A;  2YR2 A;  5HLG A;  1LDJ A;  1VTN C;  1Q86 D;  4FAS D;  4KUM A;  4CH7 A;  3HGY A;  3V42 A;  1O57 A;  4YEJ A;  3BCD A;  1TTT A;  5K7F A;  4GDF A;  3L7W A;  2IS6 A;  3H5R A;  3SEJ A;  4HLY A;  4NUB A;  5HDN A;  2Q8K A;  4NBQ A;  4XRS A;  5H6Q A;  1W7P D;  4YIR X;  2PBI A;  3ZMU A;  4J00 A;  2E2H J;  3LNQ A;  4ZCI A;  2WAE A;  3FWE A;  4JP0 A;  1D5Y A;  5E1W A;  3W5U A;  3BR0 A;  2LTP A;  3CMA B;  3QYF A;  2EQR A;  3A01 A;  4E4H A;  4AYB A;  3ZN1 A;  1W4M A;  2V1D A;  3K10 A;  2YWF A;  3HM5 A;  2EV6 A;  4MLO A;  2PEX A;  1GO2 A;  4IO9 F;  2PIA A;  4WWC A;  4XLE A;  4WQM A;  2XAG A;  3KP5 A;  3WTT C;  1AKH B;  4A69 C;  2BE5 F;  5HVQ C;  4BXX J;  2R5Z A;  2X1E A;  4IX7 A;  1SD5 A;  3OZV A;  2NT6 A;  2CV0 A;  1MBK A;  3X2Q H;  3FIW A;  4IXA A;  4F3Q A;  2HPM A;  2RVC A;  5FKM A;  2XRO A;  4WZK A;  1FC3 A;  5FO1 A;  1K8F A;  4X7C A;  4XRF A;  2M45 A;  4RDU A;  1IV6 A;  2BM1 A;  3N05 A;  4B1R A;  2CRV A;  3KEY A;  2KRF A;  4NC6 A;  2WAQ A;  1VQP I;  1P4W A;  4RB1 A;  5J8F A;  1SFO J;  3W2F A;  1MH4 A;  3LMM A;  3ML6 A;  3BZ6 A;  2VJ5 A;  3L2Q A;  1BN8 A;  3C2H A;  5E3O A;  1LFB A;  4L5E A;  5L3E A;  1MBG A;  2P8T A;  3DKW A;  4LIV A;  3CP2 A;  5AON A;  3ZQH A;  4KH3 A;  2IXS A;  2R7X A;  2I5U A;  1XCB A;  3BR2 A;  3GVL A;  2XAU A;  1G8X A;  4PC6 A;  2CJJ A;  3FXO A;  4KIB A;  4BUP A;  5B5E C;  1UHW A;  4S05 A;  5IYQ A;  5E8G A;  1XTA A;  4ENJ A;  3GTG J;  2R7R A;  1D0Y A;  2ESH A;  2DJI A;  5LHI A;  3ONQ A;  3RY8 A;  2DCU A;  4N4N B;  1WKM A;  4RGU A;  2JJ2 A;  5AMV A;  5JHF A;  3S2D J;  1OFL A;  4IPA A;  3CCL I;  1ETQ A;  2F5D A;  5IY5 H;  2VE9 A;  1IB0 A;  3TDU C;  2JQ7 A;  2K02 A;  1XG2 A;  2YWE A;  2Z5U A;  1IN8 A;  1SAX A;  2RDP A;  4V2F A;  2GRE A;  2GOM A;  3KET A;  5GAD J;  2JVG A;  3W2E A;  3SYJ A;  4XLF A;  3HKZ A;  3PA1 A;  1SEU A;  4IF4 A;  3B02 A;  1IXS B;  2KFD A;  4HF1 A;  1DGR M;  2CMP A;  2DN0 A;  1LLW A;  3TMO A;  2DFF A;  2DA6 A;  4HPQ A;  3JRA A;  1BJK A;  1VQ4 I;  3SFZ A;  1E1R A;  3GFM A;  3NE5 B;  1FMW A;  3AL0 B;  2Y0S A;  1D1N A;  3TL4 X;  1DBG A;  3CDH A;  3NQO A;  2BM5 A;  2VBY A;  2R7V A;  3FHZ A;  3FBI B;  4A3I J;  2HDN B;  4RDJ A;  4HIZ A;  2MD0 A;  3V7R A;  3JAM Z;  2OBT A;  2JDI A;  3IWF A;  3FK7 A;  2OYN A;  1YIJ B;  1GVJ A;  2OZ6 A;  1O8G A;  4DW6 A;  3OYH A;  1DG1 G;  4A3L J;  5H5J A;  4BJT A;  3KZZ A;  2K4J A;  5FLX Z;  3CUQ A;  3ZQQ A;  1U2W A;  5K1Y A;  3GTM J;  2DOG A;  2CUZ A;  3KP4 A;  3DF8 A;  3OS1 A;  3T0Y A;  1ZG5 A;  5THX A;  2DMN A;  3RPU A;  4Y9U A;  3CJN A;  2GIZ A;  4KKT A;  3LMW A;  3KP7 A;  4EH1 A;  1O8L A;  2UVF A;  2VBS A;  1EE6 A;  1B9M A;  5D5X B;  4OM9 A;  2JRM A;  2LRE A;  2LF8 A;  3VNU A;  2CV1 A;  4P9F A;  3IC7 A;  1GVD A;  2QSF X;  2VT2 A;  1OB0 A;  4ZZL A;  2V26 A;  4G6Q A;  4UB8 C;  3SZG A;  3M7G A;  2HFH A;  5DUI A;  4BAC A;  2B63 J;  2EIN H;  3I59 B;  2MSY A;  3HEF A;  2EA4 A;  4A3G J;  5HOO A;  1N06 A;  4KN7 X;  2H27 A;  1EFT A;  2HLD A;  4I98 B;  2G0Y A;  1SFE A;  3FXJ A;  4WX9 A;  4RLF A;  2H6B A;  2JZY A;  3RPQ A;  2ZJQ F;  1DBO A;  1RZ4 A;  2MH2 A;  2XV4 S;  3LSK A;  4OIO F;  4L5J A;  1UJ8 A;  1IDK A;  4P26 A;  1BBY A;  5FIU A;  2LY9 A;  2CH0 A;  1DP7 P;  4P2N A;  2L4M A;  3WGH A;  3ONY A;  1UMQ A;  3P5J A;  3FXK A;  4I09 A;  4AC0 A;  1LKX A;  4HDU A;  3OWT A;  1ETY A;  2BZT A;  2V6E A;  5HKK A;  2NSP A;  2JUC A;  2QA4 I;  1DU6 A;  3H9Q A;  3CD6 B;  2LH9 A;  3DXJ F;  4IL6 C;  4YG2 F;  1G6N A;  2DCE A;  3HRU A;  2EFN A;  3K4J A;  4C2U A;  4UY8 I;  3TW7 A;  1QZY A;  2M4G A;  1W36 D;  2DAO A;  1E3Z A;  2IOU G;  3ZXS A;  3DFG A;  1WH5 A;  1FNB A;  4ZGN B;  2NS7 A;  3F6V A;  2BF4 A;  1JHF A;  3JRH A;  2WR8 A;  4Z05 A;  3V4G A;  2XSD C;  3DU6 A;  1EP3 B;  4K2E A;  2L9V A;  1R00 A;  4BXU A;  4OOX A;  1WPK A;  2V4J C;  4LOC A;  4BYY A;  4MNU A;  2MD5 A;  3PSI A;  2R7U A;  4L9J A;  2PLY A;  4XOT A;  3ZQI A;  1S7O A;  2QGG A;  5J35 A;  3OS0 A;  1IG7 A;  3C2G A;  2LRD A;  1VND A;  1MIJ A;  2IEK A;  3GTO J;  2JPB A;  4HE5 A;  4J19 A;  3N97 A;  1E3P A;  3UR3 C;  3SDB A;  1H80 A;  4HRI A;  1EXM A;  4RBO A;  2WAD A;  2OUM A;  2XGC A;  4YXW A;  4NB5 A;  2DTR A;  2IA2 A;  4ETS A;  3K9T A;  1G2H A;  3EQL F;  3K7A J;  1EH7 A;  2CF4 A;  1FBS A;  2YUH A;  4MEX F;  3F8C A;  4HF2 A;  5IYR A;  3QPL A;  1MJB A;  1MJ9 A;  4C30 A;  2UUZ A;  2BY2 A;  4HNT A;  3DEE A;  3OYA A;  3ZZ0 A;  1ACI A;  1V0F A;  3SZE A;  4E7H A;  2JN6 A;  5ICF A;  4HSR A;  1TC3 C;  3PO2 J;  2MLG A;  1UEL B;  2L01 A;  4NBS A;  2Z16 A;  2M1B A;  2HOT A;  4R79 A;  1R49 A;  1LVA A;  5BOX A;  3ZPP A;  2HU9 A;  3S93 A;  5IYD J;  2EZI A;  4G9Y A;  4S04 A;  3QYE A;  5GV7 A;  4X1E A;  4E7J A;  2GK6 A;  3CC2 I;  5M3F J;  2ELH A;  1QGP A;  3W5H A;  4WZE A;  3BT9 A;  1VJS A;  2HGC A;  1VQN B;  2IQ7 A;  3A8J A;  4PZJ A;  3ONU A;  2CQN A;  4M53 A;  5H20 A;  2BW3 B;  3ABK H;  4CCM A;  3ASO H;  5IYC J;  3DPU A;  1FX0 A;  4X06 A;  4GRI A;  4TSF A;  3VMF A;  1OYI A;  1XD7 A;  3H3Z A;  4G7X A;  4ROX A;  2PJR B;  3WE3 A;  3S1R J;  2CYY A;  4G6T B;  3I56 B;  3DBL B;  3E7L A;  4NCN A;  3G4S I;  1ZM3 A;  2EIJ H;  3CCJ I;  2I1L A;  2DK5 A;  2AS5 F;  1OGJ A;  3I3L A;  1VHO A;  3EUK L;  3K2A A;  2LC2 A;  1IRF A;  4X7E A;  5D5W B;  4CA0 A;  2DY1 A;  2Z33 A;  4RM0 A;  3GTJ J;  3IUO A;  2QTL A;  3CW2 A;  1NDH A;  1BM9 A;  1FSE A;  5DS0 A;  2OF7 A;  1X2M A;  3MKY B;  4HOB A;  1NK3 P;  1KRH A;  1I6H J;  1HKT A;  2VQH A;  3VSL A;  2FNA A;  5FJ8 J;  4L5I A;  2DIE A;  4DQL A;  2VC0 A;  3VPR A;  3K1P A;  5F0H A;  3CCE I;  1TYU A;  4JQF A;  2QSG X;  2Q6O A;  3HL2 A;  5M5X J;  4XIC A;  5EEA A;  3WU0 A;  5TY0 A;  3SKB A;  1SMT A;  4XON A;  2JJ7 A;  3DPT A;  1BC7 C;  3W3C A;  2BHY A;  4OPO A;  4D5C A;  2P5L C;  1KCD A;  4BGD A;  1MKM A;  1OFC X;  2QYU A;  3BZC A;  4CZC A;  4RAF A;  2BY3 A;  3E5U A;  3V8J A;  1LDK B;  2VIX A;  3BZK A;  2OBS A;  4KKS A;  4AVZ A;  5IK2 A;  1FOK A;  2V9K A;  1OHH A;  4B47 A;  2MA3 A;  2JT1 A;  3C1D A;  4EAT A;  3H92 A;  1X3Z B;  4XSZ F;  1PUE E;  5FD5 A;  2VPR A;  1ZLK A;  5DCF A;  2OA4 A;  5L3B A;  2XSJ C;  3GTP J;  2OD5 A;  2VE8 A;  2WPD A;  3BCB A;  3DTE A;  1ZQ3 P;  1RES A;  3F8B A;  3J81 Z;  2ISY A;  5D8K B;  2BV3 A;  1SFU A;  5JFR A;  1YW9 A;  1WTH D;  1SKY B;  2VQG A;  1CQT A;  5EZG A;  3S16 J;  3FXL A;  1J5Y A;  3RKY A;  1D8T A;  5FNZ A;  1VQ9 B;  2VOD A;  3BPV A;  3CO6 C;  3OJW A;  4II2 A;  2HYG D;  1RIO H;  2VOP A;  1XQB A;  2E2J J;  2WY7 Q;  5BPD A;  1YJN B;  2ZXI A;  1J0R A;  3HHG A;  4UHT A;  4G7H F;  1Y0Y A;  2DOF A;  3J81 k;  3VMW A;  3OY9 A;  1HXD A;  2WB1 N;  1T8I A;  1E2X A;  1YX2 A;  3COA C;  1DUX C;  1OB5 A;  3BH6 B;  1S5L C;  3LA2 A;  2GIV A;  2XOK A;  2VBK A;  1TQI A;  3CMM A;  3LA7 A;  4M74 A;  2E1C A;  1SFX A;  2KPM A;  2W25 A;  2D45 A;  2CWE A;  3T1B A;  1DPU A;  4P3I A;  2NAZ A;  3ZUG A;  3ASP A;  2QY1 A;  1HSJ A;  1NG7 A;  1H8E A;  3OIO A;  3U1K A;  1J59 A;  1NRK A;  2X0L A;  2CQK A;  4G6I A;  2IGN A;  3GF2 A;  4HQE A;  1M1K D;  2F48 A;  4MR0 A;  4AWX B;  5IT9 K;  1I1S A;  2QZ8 A;  2ZFW A;  1NK2 P;  3S2H J;  2G9W A;  2EJR A;  1ZGW A;  3ASS A;  3QPS A;  3MKL A;  3BWG A;  4NHJ A;  1HC8 A;  1TW3 A;  3GFI A;  1FBQ A;  3QAH A;  3V8L A;  2XEX A;  5DV5 A;  1P7J A;  4PGH A;  1ITY A;  2QXZ A;  3AFH A;  2HQN A;  3E5Q A;  2O61 A;  4B4D A;  2HOA A;  1VF7 A;  2Y2Z A;  1CLW A;  3K0L A;  2BV6 A;  1K4Z A;  3T8R A;  1YX3 A;  2IGM A;  2OQR A;  2V1X A;  1TTY A;  1H42 A;  3A1Y A;  4YAU A;  1D0Z A;  2P81 A;  3DEU A;  1TVC A;  1JTA A;  4EMS A;  4L8J A;  4PGG A;  2XAH A;  4IVN A;  4LG0 B;  1Z7U A;  1YS6 A;  2RC6 A;  5FL7 A;  5HDG A;  5GAH J;  1KON A;  2Z1D A;  5LMZ A;  2LR8 A;  3QFT A;  1U5T B;  3WOD F;  4AVP A;  3PL8 A;  2NVX J;  4U7D A;  4H4K C;  5DS9 A;  2DFE A;  2Y0M A;  3FMQ A;  3CCV I;  4HQM A;  4RPD A;  1X4P A;  3WTX C;  2BVN A;  3L2W A;  4EJO A;  1Q1H A;  3G6E B;  2KLO A;  2L7K A;  2XPU A;  2E71 A;  2H8W A;  3CCU I;  1RUO A;  3KX2 A;  5H6R A;  3L00 A;  4M73 A;  4M72 A;  1FP1 D;  1ZRE A;  3H5N A;  4XKB A;  5FO5 A;  3WTY C;  1HW5 A;  1TWF J;  1TYV A;  4RAZ A;  3DCF A;  3QPT A;  1FTZ A;  3BH7 B;  2ZXJ A;  1G7T A;  5F6F A;  2W24 A;  4LLL A;  4EJV A;  4Y52 J;  2VKE A;  1VHE A;  3VNV A;  2IS1 A;  2DA4 A;  1SAU A;  3CP8 A;  4FHT A;  3B8H A;  4M9Z A;  3OOP A;  3BG9 A;  5EMN A;  1J9I A;  2VAS A;  5KAF C;  2O0V A;  3QRF F;  1RI7 A;  5DYM A;  1J09 A;  4Y13 A;  3M9A A;  4M2L A;  3EQO A;  3WTU C;  1EV7 A;  1JUP A;  2C5H A;  3LSJ A;  4LFU A;  4EJW A;  1EA3 A;  1P4A A;  1VQP B;  2PN6 A;  2HKO A;  3I54 A;  4CUG A;  4Z1M A;  1Y8Q B;  1RPW A;  2MYS A;  4I76 A;  1MDM A;  4M9S A;  1E1Q A;  3QFR A;  3AVU A;  2VJI A;  1TT0 A;  5HNH A;  2NVQ J;  4HWV A;  2XGX A;  1QRB A;  2CW5 A;  2XPV A;  2Q2E B;  2X3U A;  4PAA A;  1T56 A;  2DI3 A;  3E6B A;  4PC2 A;  1W35 A;  4XLA A;  2OV7 A;  2F5V A;  1V0E A;  2GQF A;  5CPR B;  4IQ4 A;  1OQY A;  3IH4 A;  3EUA A;  3CCR I;  4IHW A;  4K1X A;  4YFK F;  2IS2 A;  1PJR A;  2ETH A;  2DT5 A;  1S72 I;  3CCL B;  3ZPN A;  2XZL A;  4LBY A;  1RRJ A;  3T56 B;  2X4H A;  3HIF A;  5K7Z A;  2E1R A;  2LKP A;  1ZYR F;  3F72 A;  4LK0 F;  1D0X A;  3H3U A;  3GW2 A;  3J80 Z;  3FPK A;  2QE7 A;  4F93 B;  3RIQ A;  4HEA 2;  2HZT A;  4YZ0 A;  4NNJ A;  2VN2 A;  3FKI J;  1NJI D;  4OWR B;  3PA2 A;  1TWA J;  4E7L A;  2YSR A;  2M8G X;  1OCC H;  5CKT A;  3A02 A;  5J1Y A;  4HW0 A;  2M87 A;  3TED A;  4ASN A;  3TKY A;  5E8I A;  2M7B A;  4XLC A;  1GAQ A;  4RB2 C;  2HQR A;  2BGJ A;  2L2O A;  2YU3 A;  4C3I J;  1G7R A;  1XX5 A;  3NAW A;  3OE7 A;  2EK5 A;  1VQ4 B;  3SQV A;  2FOW A;  3LST A;  3BQY A;  4IHT A;  4YAL A;  2ZSI B;  2P5V A;  1LVK A;  4TMV A;  1TYW A;  2DT6 A;  5L3F A;  3VSU A;  1ON2 A;  3HPH A;  5IT3 A;  1V5G A;  1YJ9 I;  1H9G A;  1F36 A;  1G3Y A;  2K40 A;  2V9P A;  3RYR A;  2IRF G;  3E1Y E;  2R4G A;  4GGG A;  4BNC A;  2VNH A;  4BY1 J;  2VNJ A;  1UAA A;  3JQQ A;  1S9H A;  3GTQ J;  1OFE A;  2FD5 A;  1R4N B;  2AXT C;  1VQN I;  2FQ3 A;  3B90 A;  1OCO H;  2R3S A;  2ODL A;  2LSO A;  3VYU B;  3VOE A;  3JU4 A;  4PC3 A;  2DYI A;  4BQA A;  1EP2 B;  5A88 A;  3PNV A;  3IH3 A;  2PMU A;  4E7S A;  1LE8 A;  2VNK A;  2RKH A;  3LOC A;  1XGM A;  5LHG A;  1EF4 A;  2D1H A;  1WI3 A;  3IWZ A;  4RD1 A;  3L2U A;  3K4B A;  3ZN0 A;  2F2E A;  2KIQ A;  1COW A;  2DW4 A;  3IRR A;  3ZZU A;  3GWZ A;  2Q6K A;  1Z0X A;  1V4R A;  4UVA A;  5BQT A;  5CLS A;  2CFX A;  4MGR A;  2F5F A;  4PK4 A;  2BMW A;  1IDJ A;  2GM4 A;  3SHF A;  3BR6 A;  4QTR A;  1ORK A;  1Z05 A;  5LGT A;  1SD7 A;  4BQQ A;  3OJX A;  2XKO A;  3ROU A;  1Q9S A;  2OCE A;  1YRN A;  3AL0 C;  1X1C A;  4KIC A;  2KZG A;  2M5W A;  1VQ5 I;  4OAZ A;  4KMF A;  4PGO A;  3ZBT A;  4NK8 A;  4RS8 A;  3R6J A;  1CF7 A;  3EQN A;  4I2O A;  4ACA A;  2O3F A;  1JRG A;  2W7N A;  4OJ5 A;  5LLQ A;  4URR A;  3VST A;  3RKQ A;  4BHC A;  1NB0 A;  3AK5 A;  4ZYH A;  4A3F J;  3B78 A;  1JGG A;  1BR2 A;  1FTT A;  3QU3 A;  3KL9 A;  4ZDO A;  4JK1 X;  2QDX A;  4XKW A;  2MC4 A;  3LSM A;  1Y0U A;  5EEH A;  2NNY A;  3QFS A;  3EUH A;  1IJW C;  2NOG A;  5BMZ A;  4DK0 A;  2GWR A;  2E1B A;  2I10 A;  5FRN A;  4A3J J;  1YW7 A;  5FRO A;  5IYP A;  1OJL A;  2VFQ A;  2CG4 A;  2O9L A;  3QSY A;  2JWT A;  2CO5 A;  3K69 A;  2DFI A;  2LKX A;  2FBI A;  4M3B A;  1RR8 C;  4U9U A;  1D1C A;  4KA4 A;  4A93 J;  3OYF A;  1IRG A;  3H9N A;  2UZK A;  1I7P A;  4UAJ A;  4Z06 A;  3FXM A;  3Q3S A;  4I01 A;  2E1M B;  3KLO A;  1JA1 A;  4ZZD A;  1DAB A;  1QUF A;  3VMV A;  4ZYG A;  3OYB A;  1IRZ A;  4ZV4 A;  4I0B A;  3OYJ A;  4XRM A;  2QVO A;  4JBA A;  3WTW C;  2R5Z B;  1G59 A;  1WXR A;  1Y39 A;  3AAF A;  3LQE A;  2YS9 A;  3KPH A;  1G3W A;  3GTL J;  3G2B A;  2BM6 A;  4ZH4 F;  2DT7 B;  2O17 A;  2KHM A;  5E3L A;  2NVT J;  3OOU A;  2D74 A;  1SVM A;  3J7A O;  2FX3 A;  2KIM A;  5DCM A;  3U9G A;  4DBQ A;  4N4O B;  1FYL A;  2O5R A;  3OYI A;  1B23 P;  2EFP A;  1RMG A;  4RM2 A;  5JVT A;  3EDP A;  3KZI C;  5EEG A;  3CC2 B;  4IW3 B;  2H1K A;  2L7Z A;  5CDF A;  2LVS A;  3HUG A;  4N3G A;  5E18 F;  1IN7 A;  1QPM A;  1OLT A;  2CSO A;  4B3A A;  4FIS A;  1PP8 F;  1KK1 A;  3V7C A;  4J0Q A;  3DKY A;  5E1X A;  3MCZ A;  1RU4 A;  2CQX A;  4FE7 A;  1OCP A;  1I50 J;  3U21 A;  4G7Z F;  1VBL A;  1YG2 A;  3PET A;  5K7H A;  4YZQ A;  3GBG A;  3K6G A;  2P6S A;  5HS9 A;  1MSE C;  5HLT A;  1I1G A;  2KIS A;  5GAE J;  3I4M J;  4HF0 A;  2GPJ A;  1PXZ A;  2XC1 A;  1S0U A;  3G4S B;  1CQX A;  2AQF A;  3CCJ B;  2HOS A;  3H1C A;  3BLY A;  4G6D A;  4LIT A;  5DN6 A;  2EFO A;  3TDZ C;  2VKV A;  3K4C A;  3KIO A;  4Z4U A;  4AIH A;  4RAG A;  3W6J B;  1P4X A;  2ME0 A;  4I6Z A;  1ODD A;  4AIJ A;  3QFC A;  3B82 A;  2HDC A;  3FHN A;  2ZJR F;  3IKV A;  3WWG A;  1B9N A;  3OYM A;  2EIM H;  2HYF A;  4BQO A;  4EW9 A;  3CCE B;  3LNN A;  2JA8 J;  4U87 A;  1OFD A;  1RR7 A;  3AVY A;  3TO9 A;  1STZ A;  2DEU A;  4WK8 F;  4RDL A;  3TGN A;  2VQL A;  2QM3 A;  3OYG A;  2OTL B;  2W84 A;  3HKZ N;  1QA1 A;  4UXN A;  4X0C A;  2E36 A;  3ZGK A;  1VQM B;  3D1N I;  2KQR A;  1RET A;  2H6C A;  2X6W A;  3K2Z A;  3G6E I;  1QU3 A;  1K78 A;  1O8D A;  4C2L A;  5TJJ A;  3MEX A;  4KJZ A;  1QX4 A;  1ZN2 A;  2QBY A;  2NTP A;  3HYI A;  2XGD A;  2E5Z A;  2VBX A;  1FIP A;  1E43 A;  4NQW A;  2E60 A;  2XND A;  3MZY A;  4WWV A;  1W0U A;  1JJ8 C;  5J3L A;  3C18 A;  1ZEL A;  1QFZ A;  4P1V A;  3CJR B;  1Z6R A;  3CUQ B;  3BOQ A;  2HQ5 A;  2GAU A;  2VBZ A;  1BI2 A;  3BQZ A;  1VQL I;  4IHS A;  3R6K A;  3TOA A;  2XT2 A;  1XGO A;  2FVG A;  2VLA A;  4RD4 A;  5CVJ A;  4GYI A;  1HKQ A;  4HLX A;  3U2R A;  2XTX A;  3LSP A;  5GP9 A;  4BXF A;  4C3H J;  3M1E A;  3I9V 2;  3LQQ A;  4C2M J;  4PJJ A;  5FLV A;  1PVE A;  2JA5 J;  1XSV A;  4ZYA A;  2ZME C;  3SXY A;  2NST A;  3ML3 A;  4OPS A;  1VFC A;  3U6K A;  1PP7 U;  5JI6 A;  2PYG A;  4A5N A;  2RNG A;  3PFI A;  2WV0 A;  4D0P A;  1DDN A;  1I18 A;  2KT0 A;  1HOM A;  2P7V B;  4YFX F;  2HDW A;  2Z3Y A;  2O8K A;  4G7O F;  2F5E A;  3KEO A;  3OR1 C;  2GLO A;  2L4A A;  1R7J A;  2LD5 A;  1Z7L A;  3LSI A;  3O8G A;  1A04 A;  2L02 A;  1Z6T A;  3A0B C;  4JX4 A;  3GX4 X;  1V54 H;  1UD3 A;  4FWT A;  2F4O B;  2XDV A;  3CLQ A;  4YZX A;  3CJT B;  1XB2 A;  2B9S A;  1KJZ A;  4XL9 A;  2EIK H;  4PC7 A;  3HSR A;  5EGO A;  3DKX A;  2CV2 A;  3Q6Q A;  1KC8 D;  2X48 A;  3MZH A;  1QHG A;  1NBM A;  2CFO A;  5F04 A;  1D1B A;  2OBR A;  3ZMT A;  1I8D A;  3CDL A;  1Z1D A;  3HGG A;  1X19 A;  1T0F A;  1YIO A;  4OMZ A;  4CCJ A;  4EGY A;  1NG6 A;  3F21 A;  5JVG F;  1QVF B;  4WF2 A;  3OL4 A;  3H0G J;  4HST A;  1H8H A;  3CJQ B;  3HBL A;  2E34 A;  2V7V A;  3A8I A;  1R1U A;  4H9G A;  1CZF A;  1GQ8 A;  3W2G A;  2D3L A;  3CLO A;  4PFO A;  2GA2 A;  1FJL A;  5E3M A;  3S15 J;  2QKM B;  2MGQ A;  4GCV A;  2VC1 A;  3BJA A;  2L54 A;  4OAY A;  2IT0 A;  1ETK A;  1BW5 A;  2WC2 A;  4JYK A;  5JMC B;  1VZ0 A;  1KZH A;  4PJL A;  4XLP F;  3L1P A;  1MRZ A;  1UMK A;  3WE2 A;  1IC8 A;  1TLL A;  3Q5F A;  3WNC A;  1Q7Y D;  2DA1 A;  5ED4 A;  2COM A;  4UVC A;  4N0B A;  1C0W A;  1S29 A;  2C4T A;  3GZN B;  4Z03 A;  5F0C A;  5IPA A;  5F4O A;  2BGC A;  1YYV A;  3FMR A;  1NB9 A;  3PVD A;  1PKV A;  3LFK A;  1QRC A;  3CCV B;  2PMZ N;  3JR9 A;  2BY0 A;  4B48 A;  5J4Y A;  3QOP A;  1REP C;  3D26 A;  3OZW A;  4YFN F;  3FM3 A;  2RGV A;  2DTZ A;  4V02 C;  2BX6 A;  5HZB A;  3CCU B;  1KU3 A;  2R7Q A;  2Y9Y A;  3ZPL A;  5HNF A;  2M5S A;  1B72 A;  1ZM9 A;  2GOX B;  2DPD A;  3I1F A;  3HSE A;  3S3N A;  2O8X A;  3HOV J;  3P9C A;  2QQ8 A;  2KJB A;  2DPU A;  2R7Z J;  2HTS A;  4M6V A;  3PIP F;  4LBZ A;  3SZT A;  3MKW B;  2A5W A;  2DJN A;  1HVX A;  2FUG 2;  3OYE A;  2V6C A;  1AKH A;  2Y48 A;  3LSR A;  4OJ6 A;  3F8N A;  1FOY A;  2FU4 A;  5E6T A;  4NDL A;  3K4L A;  4ENK A;  1WH7 A;  1RQR A;  2WA0 A;  5K5Q A;  5EZH A;  3H94 A;  4M71 A;  3DTK A;  3TOB A;  3P9K A;  1X1B A;  4A5M A;  5LGN A;  3HOU J;  2HNH A;  3SFI A;  2JSC A;  1R5H A;  4E6K G;  2DBB A;  3CF2 A;  2DER A;  2PE3 A;  1XG1 A;  2QKL B;  2XHK A;  3RSN A;  1LFP A;  2YPR A;  3R60 A;  4AC9 A;  2R93 J;  1TWG J;  1O8E A;  1B4A A;  1U5T C;  2FQ4 A;  3BG3 A;  2BVL A;  3GQ9 A;  1KU9 A;  4AIK A;  2GXA A;  1KTW A;  1J9Z A;  1X0C A;  4KNY A;  3FKS A;  4DYC A;  2JN9 A;  4OIP F;  4RD6 A;  2NVU B;  1VF9 A;  3CCR B;  3GQA A;  3ERE D;  2MLK A;  1S72 B;  1OPC A;  1KU7 A;  1U8B A;  3R0A A;  3WQZ A;  3RPU D;  5IP7 J;  1B8I A;  3E6M A;  2ZJP F;  2VYQ A;  3ZSC A;  1IUY A;  1U78 A;  1U2R A;  2LK2 A;  5FKO A;  1QPI A;  4CCN A;  3ZQG A;  1BA5 A;  3W2H A;  3KYL A;  4KYW A;  2F1M A;  1BOA A;  3BC8 A;  1H88 C;  1IHM A;  4TN1 A;  1T33 A;  1TUI A;  1Y0R A;  3UW0 A;  4IHX A;  4A3C J;  1FNC A;  2XRL A;  1KU2 A;  1HST A;  3VB2 A;  2ZXW H;  3WG7 H;  1T2K A;  4KKU A;  4F7Z A;  1LJ9 A;  3MVP A;  3JQR A;  3Q0U A;  1G3S A;  2OK8 A;  1O3R A;  4BE0 A;  3RJP A;  3G1M A;  1TLH B;  1EH6 A;  2O1D A;  1JKR C;  2MAB A;  2ECC A;  3ELK A;  3I55 B;  1O88 A;  1AOY A;  3ECH A;  2M0M A;  3CF5 F;  1O4X A;  1BHE A;  4HYE A;  2ME6 A;  3NAR A;  2BBY A;  3NAU A;  2QEN A;  5J47 A;  4FN5 A;  1PLU A;  4EGZ A;  4YDT A;  3GLL A;  4P5O A;  4DQK A;  5KW9 A;  3G1O A;  5C44 J;  4X8I A;  1YJ9 B;  2HVR A;  5L3D A;  5LD2 C;  2F5C A;  3QPH A;  1E3H A;  1SC7 A;  1HBX G;  4ANJ A;  4JOM A;  2XF7 A;  5LRR A;  2R5Y B;  3BH4 A;  4P12 A;  2BM7 A;  1T95 A;  3FXU A;  1BR4 A;  3QP5 A;  1BQE A;  3OZU A;  3AGP A;  4CO8 A;  1VQ8 B;  2NTQ A;  3PNY A;  1DU0 A;  3JUR A;  1B2R A;  1HKS A;  4BQN A;  3F23 A;  1MW7 A;  1G4D A;  2RV8 A;  1NH3 A;  1QRY A;  5LHH A;  1B59 A;  2DOD A;  1WCM J;  3OP1 A;  1I3Q J;  3BTC A;  4RPB A;  2ZIT A;  3J7Y J;  3MZ8 A;  4P9U A;  2QGU A;  3WU1 B;  3ABT A;  4G8X A;  1ETV A;  4M6X A;  1O3T A;  1GHC A;  4YFO A;  3S2W A;  3N6Z A;  4Q7J B;  4RD3 A;  1XGN A;  3GYH X;  4PAB A;  1O8H A;  3CCS B;  1HDP A;  2C5B A;  1U9N A;  3E20 A;  2PFB A;  1E0E A;  2ZME B;  2VXZ A;  2RC5 A;  2RN7 A;  2WY8 Q;  1E79 A;  1ZM2 A;  3DDY A;  3AVV A;  1TNT A;  2BGI A;  4UUS A;  1O8F A;  2JVH A;  5KAI C;  3GQ7 A;  1USS A;  2FMY A;  2ZXH A;  4CYC B;  2VL8 A;  1H9T A;  3RKX A;  4LLG F;  1OR7 C;  3DV8 A;  5HXB A;  1QH0 A;  2EZK A;  1JGS A;  2X8K A;  3RZO J;  4LIU A;  2IJL A;  4MIM A;  1VQ5 B;  4D7M A;  2A3S A;  1N75 A;  4QPQ A;  3D5R C;  2HXI A;  4ZCM A;  3MN2 A;  2OTL I;  1HG8 A;  2XT4 A;  1UST A;  2LG4 A;  4Y15 A;  3QP6 A;  1D5V A;  3GVJ A;  1VQM I;  2JSP A;  1JE8 A;  1U0J A;  3B6C A;  5ICC A;  1GJR A;  4X7F A;  2VBM A;  2O0Y A;  3BG7 A;  5FA6 A;  3P9I A;  4LMY A;  1HDD C;  2VOO A;  3T53 B;  1R58 A;  1ZK8 A;  3TO6 A;  5F0F A;  4EJU A;  5LRS A;  4L9V A;  4A3M J;  1ERD A;  4DNR B;  2R7W A;  4DYR A;  1BIA A;  4YEL A;  1T5E A;  2HVQ A;  4AID A;  3ISX A;  3GCM A;  1FEX A;  1FND A;  4RAY A;  4BHP A;  2Z8G A;  2FJ1 A;  2D2W A;  4ZTF A;  4A3D J;  1KCC A;  3P26 A;  2E19 A;  3Q0W A;  5EF6 A;  5KVR A;  2LMD A;  3L2R A;  1QQ1 A;  3WY9 A;  1R5G A;  3AKZ A;  4MYT A;  4L18 B;  4DQ2 A;  2ZTN A;  3KE2 A;  1R71 A;  5ERI A;  3VYT B;  1X2N A;  1QHH D;  2YWH A;  2ID3 A;  5D4R A;  1WJA A;  3H5A A;  2JTV A;  5L46 A;  4AF7 A;  2L9R A;  1ELO A;  3Q39 A;  4P6V F;  3Q38 A;  1T38 A;  2DOE A;  1VQK I;  1XDU A;  2GZW A;  2KJC A;  2HMA A;  2QEX B;  4QVA A;  1ZTR A;  5D6E A;  1KYW A;  1XB4 A;  3G1L A;  4FTH A;  3SLD A;  3RCO A;  3HHH A;  1OYY A;  4J01 A;  2H1L A;  1GT0 C;  4Y9R A;  1QVT A;  1P2F A;  1W0K A;  3GLX A;  5C4J J;  4P9S A;  1F1Z A;  1BPL A;  1BR1 A;  3PQJ A;  2M9H A;  3QOE A;  1IJF A;  4G1B A;  4DK1 A;  1I5Z A;  2V5I A;  1WRJ A;  3ASN H;  2OJE D;  4BL0 B;  1VQ7 I;  4UB6 C;  4CDG A;  1MDM B;  1YQA A;  1KQ8 A;  3FPP A;  1QZE A;  3VO2 A;  1LM1 A;  4YCQ A;  3V8K A;  1XSX A;  5F4M A;  4U4B A;  4A6D A;  2Q0O A;  2Z2S B;  1Y0N A;  2DDB A;  2NRA C;  2VNI A;  2KMU A;  2X6O A;  4HX4 A;  4XD7 A;  3WHB A;  1Q1V A;  3V76 A;  2LBF A;  2V31 A;  1R5B A;  2DQR A;  1H0M A;  1IO2 A;  3OEH A;  4CGZ A;  5FGM A;  3GME A;  1K7A A;  3ES9 A;  2DO7 A;  2QQ9 A;  2XIG A;  3LQR A;  3GUD A;  1KQS B;  1EJ9 A;  2VZL A;  3LSH A;  2WSS A;  4HZF A;  4I84 A;  4A6E A;  2KKO A;  3SZP A;  1K28 D;  2K86 A;  4OIR F;  5A8A A;  5EDN A;  4XLN F;  1JKQ C;  4RDK A;  3ZR8 X;  5F1J A;  5FLM J;  2ISZ A;  2J8K A;  4D9J A;  2FSW A;  5EJC A;  1BL0 A;  1BJA A;  1JHH A;  1WQ2 A;  2IA1 A;  3VDX A;  2EZL A;  2XKP A;  2KDZ A;  3G71 I;  4M6Y A;  2E1M C;  1XCV A;  3HTU A;  4U0V A;  3D5S C;  3S1M J;  1IAW A;  2RC4 A;  1XMX A;  2ZL7 A;  2FX0 A;  3OAA A;  5ILU A;  1OCT C;  5ILV A;  5ILS A;  1QNT A;  2VON A;  4DJA A;  2K27 A;  1L3L A;  3ZMZ A;  5HOD A;  2Z99 A;  3AG4 H;  2XAS A;  2VBU A;  2LNB A;  1XS9 A;  2ZZG A;  1R23 A;  2XB0 X;  4PJ0 C;  3BTI A;  5L3G A;  2FOK A;  2M30 A;  2P6T A;  3M8F A;  1VQ6 I;  1KQ5 A;  4XLH A;  3NB2 A;  3H09 A;  1XFO A;  1TQP A;  3M1C A;  4NC7 A;  4EVI A;  3M4O J;  1T6X A;  5BSY A;  3OEE A;  1WU8 A;  1ON1 A;  1D1A A;  1SD6 A;  2XAJ A;  1IZ1 A;  1IDZ A;  2INU A;  1QA3 A;  4KIT B;  4WZL A;  1VQL B;  2DU9 A;  3JSP A;  2JMW A;  2XF6 A;  1ULY A;  4JX6 A;  1WOR A;  4MHG A;  4BKX A;  1PJ7 A;  1UFM A;  1N25 A;  4MO7 A;  1F9N A;  1MAB A;  2OPT A;  4DZP A;  4ENN A;  1P7I A;  5TRD A;  4BBS J;  2VBW A;  5E79 C;  1N08 A;  1OKR A;  3GVA A;  2EH3 A;  4PSX A;  1RQP A;  2RAE A;  3CRZ A;  4M1K A;  1FNM A;  2F4I A;  1FOX A;  4LK1 F;  2CBX A;  4RD2 A;  2A68 F;  4HG2 A;  1JT6 A;  1T0F C;  1PJ5 A;  4YII A;  3K1M A;  1WWX A;  2GJK A;  2PMD A;  1ZKG A;  2HEO A;  2Y75 A;  3G05 A;  5LBQ A;  2Q6L A;  4E7K A;  3S1Q J;  4Y7N J;  2BM0 A;  3R61 A;  3BC9 A;  2BEO A;  2Z6B D;  2JUG A;  2AHO A;  3OOC A;  4MYU A;  3JX8 A;  3TW6 A;  1IA5 A;  1EA0 A;  1Q81 D;  3IH2 A;  3DBR B;  2FBK A;  2QX3 A;  1GDT A;  4FK8 A;  1G3T A;  1TZL A;  3M8E A;  1MJA A;  4LB6 B;  3CCQ I;  1QA6 A;  1WZ2 A;  4PDK A;  2AXL A;  1YRN B;  2FEZ A;  3SY2 A;  2HOE A;  1P92 A;  3ABL H;  2LZJ A;  1Y6I A;  1S8N A;  3PUB A;  5HDK A;  3NRV A;  1CF7 B;  3LJY A;  4RB0 A;  1ZGA A;  1WMR A;  4CSW A;  1YJW I;  1XE1 A;  1BN5 A;  2CW8 A;  2M8E A;  1W5S A;  1A8P A;  1T6Z A;  2WWY A;  3PM1 A;  3CUQ C;  3OV8 A;  4RGS A;  2BVM A;  3U1D A;  3HAG A;  3CO7 C;  3FXR A;  2ID6 A;  3H35 A;  1MH3 A;  1IN5 A;  2K9S A;  3SJZ A;  1YIT I;  4B09 A;  2FXA A;  2OTJ I;  5C4X J;  2C6Y A;  2JIZ A;  2E35 A;  3WXM A;  5J4V A;  3FK6 A;  2LKS A;  1SVL A;  3I55 I;  1QGZ A;  2RQQ A;  4BE2 A;  2D3N A;  2FRH A;  4OOI A;  3OYD A;  3F8M A;  2STT A;  1G7S A;  1Z77 A;  4XOP A;  2FE3 A;  4W97 A;  4XRS G;  4LG0 A;  3RYP A;  1GR1 A;  4BHB A;  3BCF A;  2BSP A;  5DD8 A;  2K9M A;  3M07 A;  1X3W B;  4V2G A;  4WZT A;  3G71 B;  2C2W A;  1XDS A;  2TRT A;  3LVB A;  4U88 A;  1H89 C;  3W2I A;  2HVS A;  4I7H A;  1VQ8 I;  3H3V K;  1UD8 A;  2A69 F;  4A3E J;  1MZB A;  2O04 A;  4BJ6 C;  3CMY A;  2HYJ A;  2ZZQ A;  3TQN A;  2V7F A;  4RA2 A;  1N07 A;  5FD6 A;  3AGQ A;  4X6A J;  4DYQ A;  1K5C A;  2A61 A;  2DQL A;  3HZJ A;  1A5J A;  1UHM A;  2VI6 A;  4TMZ A;  1BX0 A;  2WJY A;  3UNG C;  1QG0 A;  3W2V A;  4EQQ A;  2L7F P;  4KT5 C;  3GSI A;  3CCS I;  1TWC J;  2QWW A;  5E3N A;  2WZN A;  1LEB A;  4CQJ A;  3S32 A;  3C7J A;  1N0U A;  1XMA A;  1J75 A;  2L7M P;  3OMY A;  4C43 A;  4ESJ A;  4TMT A;  5AN9 A;  1MBJ A;  3F3X A;  3TP3 A;  3MCA A;  4HV6 A;  1N8R D;  2WBM A;  5GPA A;  4XKV A;  3SDG A;  1SMY F;  4I02 A;  1SM4 A;  1T6S A;  2BOL A;  5H2F C;  3MFK A;  4OIN F;  4QWQ A;  5HLH A;  3WTV C;  1VLO A;  2CND A;  2ZFU A;  3BJ6 A;  3WGI A;  1WJF A;  3U6B A;  4XN0 A;  5E17 F;  5TGT A;  5K5O A;  1SFK A;  3MKZ A;  1R1V A;  3E6C C;  3KYD B;  5IT9 Z;  4MXN A;  1O8J A;  2J8I A;  2FF4 A;  3AG3 H;  2TCT A;  2Q2E A;  1AMO A;  2LLK A;  2DDA A;  3MMY B;  5ICE A;  2G7H A;  2J5P A;  4GXO A;  3F22 A;  1DAR A;  4KIF A;  3ZC3 A;  1LEA A;  3SEZ A;  2F1L A;  2D9R A;  1IV8 A;  2XZO A;  1JJ2 B;  3EYY A;  4EJT A;  2IS4 A;  4FX0 A;  2H94 A;  4QPO A;  5F64 A;  5D8L B;  4M4S A;  2VBE A;  1K73 D;  3LWF A;  2WYR A;  1HZE A;  3M8J A;  3Q9S A;  1T39 A;  5F27 A;  2W57 A;  2JJ1 A;  5J8C A;  1K78 B;  2X1D A;  1MGT A;  1X3U A;  4IHY A;  1N0V C;  3QYB A;  2BN4 A;  1BOB A;  1KTV A;  2A5Y B;  3E3V A;  1Z67 A;  3I0T A;  3JAM K;  2QBY B;  5F4J A;  3A01 B;  2L9N A;  1R36 A;  1MMS A;  4E0F A;  4NQW B;  4AM3 A;  1X4O A;  1UD4 A;  3O8H A;  4BEH A;  3L2C A;  3Q9V A;  1KYZ A;  3GTK J;  2R7S A;  3PUN A;  1LDD A;  4XSX F;  3L2V A;  4Z4Z A;  2F43 A;  5FLX K;  4QV2 A;  2ZKZ A;  3VWB A;  3DTI A;  1ZLJ A;  3CES A;  1X1D A;  3IHU A;  1U3E M;  3VR6 A;  1EZG A;  3BG6 A;  2QEX I;  4Q48 A;  1UB9 A;  2ZB9 A;  4AYB N;  1S7E A;  2XRN A;  1W5T A;  4X07 A;  4BDY A;  3IL2 A;  3LAJ A;  1R5O A;  2PG4 A;  4CCO A;  1GVH A;  2V79 A;  3A8K A;  3KLN A;  3S3M A;  3MMP A;  2R7D A;  5CVU A;  1J2X A;  4BJ5 C;  2FBH A;  3HJE A;  5IYB J;  1VI0 A;  2M34 A;  4G12 A;  5J40 A;  2OAZ A;  2ESN A;  1EFR A;  2HKX A;  4DZJ A;  4G7W A;  4RD0 A;  1QJV A;  5C3E J;  1E62 A;  2VUM J;  4Z6Y A;  3SQN A;  4F52 A;  4GFB A;  3GFJ A;  4EEF G;  5EG0 A;  1W9X A;  4HNV A;  4HNU A;  3ABM H;  1Z91 A;  2YX7 A;  5FFX A;  4ZDL A;  1TYX A;  1IN4 A;  3HB9 A;  1YLO A;  4TMX A;  3T51 B;  2WAQ N;  2CU7 A;  3GEZ A;  3H9J A;  3K4M A;  4YEI A;  4F7D A;  4BE1 A;  5GTH C;  3Q0V A;  1W7P A;  5FO0 A;  1I39 A;  2M2E A;  2XZP A;  2DA2 A;  1W0T A;  1K79 A;  3F0C A;  2PI0 A;  2L3D A;  1BJZ A;  2XAQ A;  2NXN B;  4O3M A;  1YI2 B;  1OFM A;  3HOW J;  3K70 C;  3W5V A;  1KK0 A;  2R7O A;  5K5R A;  3HDD A;  2DA3 A;  4HX7 A;  4B4C A;  1ZR4 A;  1GAW A;  3BR1 A;  4FET A;  1Q82 D;  3A0H C;  2VKD A;  2X53 S;  4YC5 A;  1S3J A;  3CDI A;  3BJO A;  4ITV A;  1N77 A;  3HOS A;  3R0J A;  1AWC A;  2P3M A;  2KDO A;  2TDX A;  3C2B A;  1IN6 A;  3WTS C;  3KEQ A;  1KGS A;  1BX1 A;  3L09 A;  3KFW X;  1QQI A;  5M5W J;  4AUX A;  3JRB A;  1S4M A;  2PEC A;  1Z9C A;  1YS7 A;  1RNL A;  2GJR A;  3CPX A;  2P4W A;  4B8X A;  4ACB A;  1JTX A;  2VFP A;  4G1V A;  3UKG A;  4XNF A;  3ZQ7 A;  4GO1 A;  3IV5 A;  3GXO A;  4BY7 J;  1LB2 A;  2GA1 A;  3K4N A;  3RIR A;  1IRX A;  4YRV A;  4Q4Z F;  4F55 A;  2BM4 A;  2X1C A;  2ZCW A;  1QGY A;  3DLA A;  4RCZ A;  1E3X A;  4QVJ A;  5H59 A;  2Y0S N;  1E3O C;  3CME I;  2WTE A;  1W1W E;  3DU5 A;  3JW4 A;  3QOD A;  4D7N A;  3LAP A;  4X05 A;  2QQB A;  4UZE A;  1XGS A;  3IKT A;  4DIQ A;  4CXF A;  2VB6 A;  2R0Q C;  1IXC A;  4CCK A;  1U8R A;  2B5O A;  3AVX A;  1K8A D;  1BI3 A;  2XNC A;  3W6V A;  4M3E A;  1B72 B;  1RWR A;  4FQG A;  3E97 A;  4RMN A;  1V5V A;  2DFH A;  5DUK A;  5J6X A;  1JB9 A;  3TP0 A;  1YX5 A;  1VQK B;  2HQA A;  4OJO A;  4CCL A;  1F43 A;  3A3G A;  2EA2 A;  1FZP B;  2QTZ A;  1LLZ A;  1PUF A;  2NZM A;  3HRS A;  1W5C C;  2F4M B;  4UUV A;  4TT3 A;  1V5F A;  4C0S A;  3WTZ A;  4UV8 A;  2UVE A;  1K6Y A;  5LEJ A;  4XK4 A;  4P22 A;  1IUF A;  3CB4 A;  4X7D A;  1R5I D;  1UG0 A;  3BY6 A;  4R8H A;  2ZBK A;  3GRH A;  2KRC A;  2CUJ A;  2JK3 A;  2P5K A;  4RGX A;  1VQ7 B;  3NEU A;  2XGE A;  2MW8 A;  3KP2 A;  3T5X A;  1UCR A;  4M3F A;  2DMT A;  3OSG A;  3ZQF A;  2N8G A;  4HA8 A;  3BDD A;  2CQ7 A;  2EFG A;  1RKT A;  5HS7 A;  1EH8 A;  5BNG A;  3RTR A;  2DMU A;  2K3P A;  1YHQ I;  4UV9 A;  2EB7 A;  2HS5 A;  2X9D A;  3FXQ A;  1S6L A;  4WXD A;  5DM7 F;  3KP6 A;  2IAI A;  3CC4 I;  1GV2 A;  4Y3O A;  3AG2 H;  4DOZ A;  5LFA A;  4UUT A;  3G73 A;  1KD1 D;  1ZAR A;  4UZF A;  4ZC3 A;  2F3L A;  3WHC A;  3ZOB A;  5IYN A;  5CQE A;  1B8I B;  2CRG A;  3HOY J;  1TSP A;  2COB A;  3I4P A;  3HXL A;  3P7N A;  4ZDP A;  2V7Q A;  2W6I A;  4YHB A;  1QCX A;  4IRH A;  2VFM A;  3HC7 A;  3V7A A;  5JBQ A;  1ETO A;  4LLN A;  3OYK A;  1O3S A;  2VBT A;  2XNJ A;  3MQ0 A;  3WBK A;  4RB3 C;  3JCU C;  3OKX A;  4OOV A;  4P6Y A;  3PSF A;  4W8R A;  1JUS A;  2VQC A;  5CYV A;  5JLX A;  2Y9Z A;  2P0W A;  2ZC2 A;  2XVC A;  2MG4 A;  2UXN A;  3FKJ A;  2VT3 A;  2DOA A;  1TL8 A;  3BTL A;  2F4N A;  3CZ6 A;  2XGJ A;  1P9Q C;  2GJP A;  5BPI A;  3RKW A;  3DU1 X;  1EWY A; 
#chains in the Genus database with same CATH homology
 1TT0 A;  1N75 A;  5HNH A;  4QPQ A;  4UZU A;  1HA8 A;  2I8D A;  3D5R C;  3E1S A;  4HWV A;  1MMD A;  1HG8 A;  2LG4 A;  2Q2E B;  3GVJ A;  4IKF A;  2JSP A;  1U0J A;  4GQN A;  4XLA A;  4PFP A;  2OV7 A;  3FDY A;  3HOT A;  2F5V A;  1V0E A;  2VBM A;  4B44 A;  3BG7 A;  4IQ4 A;  2CW7 A;  5CPR B;  3OW7 A;  3EUA A;  3T53 B;  2IS2 A;  1PJR A;  2XF5 A;  3DQV C;  1ERD A;  2IGO A;  4DNR B;  3B4N A;  2R7W A;  4OZZ A;  3ZPN A;  2XZL A;  2GK7 A;  1AA7 A;  4YEL A;  1T5E A;  2HVQ A;  4IZZ A;  3T56 B;  3OPO A;  2Z8G A;  4F92 B;  4ZTF A;  1O8K A;  1D0X A;  1UD2 A;  1KCC A;  3PJR A;  4F93 B;  2QE7 A;  4HEA 2;  1Z21 A;  3A35 A;  4YZ0 A;  4NNJ A;  2K9L A;  2EWE A;  3L2R A;  1MMA A;  2KRH A;  3AKZ A;  2CK3 A;  4OWR B;  3FY3 A;  2V1N A;  4E7L A;  2ZTN A;  2VJJ A;  3VYT B;  1QHH D;  3NWS A;  5CKT A;  1OGO X;  4U49 A;  1WJA A;  2VJ4 A;  3H5A A;  4XKC A;  3ZCO A;  2ZZF A;  2M7B A;  4XLC A;  4E7Z A;  4JMQ A;  3IAM 2;  2L2O A;  3HPG A;  2ZZE A;  3OE7 A;  2A6T A;  3VSV A;  2DXI A;  4YZA A;  2ZSI B;  1LVK A;  2MFZ A;  2R7T A;  2DT6 A;  3RCO A;  4J01 A;  4PJM A;  3VSU A;  1W0K A;  3HPH A;  4FXU A;  4KT6 A;  4U7B A;  1BPL A;  1BR1 A;  1V5G A;  3QOE A;  3OFN A;  4DK1 A;  4FAS D;  4B3F X;  1Y56 A;  1FMV A;  4CH7 A;  4IQJ A;  4RM3 A;  4BL0 B;  3FPP A;  2R4G A;  3V42 A;  4YEJ A;  3BCD A;  4LG3 A;  1UAA A;  2UV1 A;  3ZRG A;  1S9H A;  2IS6 A;  3H5R A;  4U4B A;  2Z2S B;  3VYS B;  4NUB A;  2KMU A;  4XD7 A;  5FRM A;  3B90 A;  2LBF A;  4PSW A;  2V31 A;  2E5N A;  2ODL A;  3VYU B;  4J00 A;  3JU4 A;  3S8P A;  3OEH A;  2WAE A;  2IGK A;  4XN3 A;  2VXD A;  3PNV A;  3LSH A;  3QYF A;  2WSS A;  4I84 A;  4E4H A;  4AYB A;  4NK6 A;  3K10 A;  4E7S A;  1WFX A;  1K28 D;  4MLO A;  3ZR8 X;  3TBI A;  3L2U A;  3K4B A;  3B8Y A;  4XLE A;  4D9J A;  5HVQ C;  3VDX A;  2X1E A;  1COW A;  4IX7 A;  2NT6 A;  2CV0 A;  3IP4 B;  2E1M C;  3D5S C;  2HPM A;  4F3Q A;  1R6R A;  2PMZ A;  3K4K A;  3OAA A;  4PK4 A;  1IDJ A;  2OC6 A;  1WJ5 A;  3N05 A;  5KCM A;  4DJA A;  1BMF A;  4BQQ A;  3KEY A;  2WAQ A;  4BU2 A;  3AL0 C;  2ZZG A;  1X1C A;  2HZD A;  2NTB A;  3LMM A;  4OAZ A;  1BN8 A;  4NK8 A;  2VJ5 A;  3L2Q A;  3C2H A;  3EQN A;  4URR A;  4OJ5 A;  4LIV A;  4XLH A;  2W7N A;  1JRG A;  3CP2 A;  3VST A;  2IXS A;  2R7X A;  4RLQ A;  3M1C A;  3H0D A;  3GQB A;  4NC7 A;  3GVL A;  3LSG A;  2XAU A;  1G8X A;  4BUP A;  3OEE A;  1BR2 A;  1D1A A;  1Z3Y A;  2INU A;  1OOC A;  4KIT B;  2R7R A;  4ZDO A;  1D0Y A;  4XKW A;  2DJI A;  2MC4 A;  3LSM A;  3ONQ A;  2PYH A;  4N4N B;  2JJ2 A;  5JHF A;  2XF6 A;  1OFL A;  1X1A A;  4OJL A;  3OIQ A;  4DK0 A;  2LBF B;  4OJP A;  2E1B A;  5FRN A;  1MAB A;  5FRO A;  1XG2 A;  2GOM A;  2VBK A;  4PSX A;  2JVG A;  1D1C A;  2F4I A;  3EUH C;  3OYF A;  2R9V A;  3E0J B;  3MD2 A;  1O8M A;  4XLF A;  3F9K A;  4HG2 A;  3HKZ A;  4Z06 A;  2KL4 A;  2LOO A;  2VKH A;  2E1M B;  1T0F C;  3VMV A;  2GJK A;  3OYB A;  1DGR M;  2CMP A;  2KP6 A;  3OYJ A;  3TMO A;  1MMN A;  4HPQ A;  1G59 A;  3G05 A;  4E7K A;  3BC9 A;  3G2B A;  1E1R A;  3NE5 B;  2DT7 B;  1FMW A;  3AL0 B;  2Y0S A;  2Z6B D;  3TL4 X;  4DBR A;  2JUG A;  2ZTG A;  3OOC A;  1DBG A;  2KHM A;  2O17 A;  2R7V A;  1IA5 A;  3FBI B;  3OOU A;  1WJD A;  4HIZ A;  2MD0 A;  2QX3 A;  4DBQ A;  4N4O B;  2X51 A;  2O5R A;  3OYI A;  2JDI A;  1RMG A;  1TZL A;  4RM2 A;  2UWM A;  1O8G A;  3OYH A;  2LYC A;  4BJT A;  5CDF A;  3LFU A;  2LZJ A;  1Y6I A;  3S3O A;  3ZQQ A;  1OLT A;  3PUB A;  3GQ8 A;  2CUZ A;  3OS1 A;  1WMR A;  4CSW A;  2VPL A;  3DKY A;  2CW8 A;  4KKT A;  1RU4 A;  3LMW A;  3U21 A;  1VBL A;  1O8L A;  2UVF A;  1EE6 A;  4YZQ A;  3GBG A;  3K6G A;  3HAG A;  2BVM A;  2LRE A;  5HLT A;  1N78 A;  3RQ4 A;  1PXZ A;  3H35 A;  2CV1 A;  3GVK A;  3J7A Y;  4II3 A;  1OB0 A;  2JIZ A;  3OL3 A;  2V26 A;  2AQF A;  3PFY A;  3SZG A;  4BAC A;  3BLY A;  4LIT A;  5DN6 A;  5HOO A;  2RQQ A;  2HLD A;  4BE2 A;  4PMH A;  2D3N A;  3K4C A;  3OYD A;  4OZY A;  4RLF A;  3W2W A;  4XOP A;  1DBO A;  3LSK A;  3FHN A;  2X3H A;  2W6J A;  3BCF A;  2WZP P;  3ZIA A;  1WPC A;  1IDK A;  2BSP A;  2K9M A;  2CS3 A;  2CH0 A;  3OYM A;  3OR2 C;  3A3B A;  4BQO A;  3WWG A;  4EW9 A;  3LNN A;  4U87 A;  2HVS A;  3W2A A;  2V6E A;  2L9S A;  1LKX A;  1YE9 A;  3OWT A;  3K70 D;  1UD8 A;  5HKK A;  2NSP A;  4P1W A;  4AU7 A;  2VQL A;  4BJ6 C;  4XR6 A;  3OYG A;  2O04 A;  2X85 A;  3H9Q A;  2ZZQ A;  2LH9 A;  2V7F A;  2L5Q A;  2KQR A;  2X6W A;  2DCE A;  3ZGK A;  3K4J A;  2JA2 A;  4C2U A;  2BW3 A;  3NWT A;  1QU3 A;  4D1Q A;  2M4G A;  1O8D A;  4C2L A;  1DGW Y;  4KJZ A;  1W36 D;  3SUC A;  1E3Z A;  1K5C A;  3ZXS A;  3A4C A;  4ZTJ A;  1KZL A;  2NTP A;  2E5Z A;  4Z05 A;  2WJY A;  1E43 A;  2XND A;  2E60 A;  3UNG C;  2PJR A;  1IB4 A;  3DU6 A;  3VSK A;  3W2V A;  1MND A;  1ZEL A;  3CJR B;  2V4J C;  3BCA A;  3PSI A;  3S32 A;  2R7U A;  5C1E A;  4XOT A;  2VLA A;  1OGM X;  3OS0 A;  3OMY A;  3C2G A;  2LRD A;  4BXF A;  2O0W A;  3I9V 2;  2NOJ B;  4PJJ A;  1DP3 A;  4ZYA A;  2NST A;  2WBM A;  4XKV A;  2X6X A;  3UR3 C;  3SDB A;  1H80 A;  4HRI A;  4X0G A;  2WAD A;  2BOL A;  2OUM A;  3KEW A;  4YXW A;  2RNG A;  1UD6 A;  2PYG A;  2ZFU A;  5AMV A;  1WJF A;  4XN0 A;  1I18 A;  2AQE A;  4NC8 A;  5TGT A;  4C30 A;  2HDW A;  2UUZ A;  4HNT A;  1SFK A;  3DEE A;  3OYA A;  3MKZ A;  1V0F A;  4MXN A;  4E7H A;  1O8J A;  4BDZ A;  3OR1 C;  1Z7L A;  3LSI A;  4HSR A;  5KNL A;  1UEL B;  1UD3 A;  3MMY B;  2M4K A;  2Z16 A;  3PNT A;  2XDV A;  3SEQ A;  4R79 A;  1PYV A;  4YZX A;  1DQU A;  3ZPP A;  2HU9 A;  3S93 A;  2Q1Z B;  3SEZ A;  4XL9 A;  4C9Y A;  4XQF A;  3OYN A;  2CV2 A;  3DKX A;  3QYE A;  4E7J A;  2KZV A;  2GK6 A;  2XZO A;  2IS4 A;  1QHG A;  4F91 B;  4QPO A;  1JI8 A;  2CFO A;  1NBM A;  1D1B A;  1I8D A;  1VJS A;  2VBE A;  3H9G A;  2IQ7 A;  1HZE A;  3M8J A;  1X19 A;  5C1C A;  2BW3 B;  4CCJ A;  2JJ1 A;  2X1D A;  1NG6 A;  4CCM A;  3QYB A;  4B3G A;  3DPU A;  3OL4 A;  1BOB A;  1FX0 A;  1O8I A;  4GRI A;  4HST A;  1H8H A;  3CJQ B;  4TSF A;  1CZF A;  2L9N A;  1GQ8 A;  4G7X A;  4E0F A;  4NQW B;  1X4O A;  2PJR B;  4BEH A;  1UD4 A;  2WB1 A;  1WJE A;  2D3L A;  2R7S A;  4PFO A;  3L2V A;  4E7I A;  4G6T B;  2F43 A;  3VR6 A;  3VWB A;  3DTI A;  3CES A;  1X1D A;  2QKM B;  4TKO B;  3BG6 A;  3I3L A;  4OAY A;  3EUK L;  4BDY A;  1Z3X A;  2LC2 A;  4CCO A;  1VZ0 A;  4PJL A;  4CA0 A;  3S3M A;  2LY2 A;  3IUO A;  4BJ5 C;  2W4S A;  3OYL A;  3MKY B;  4W8Q A;  1EFR A;  4ASU A;  4G7W A;  4Z03 A;  4C2T A;  2VQH A;  3VSL A;  1QJV A;  2DIE A;  4F52 A;  1PKV A;  3DPL C;  4B3X A;  4B48 A;  3DWL E;  4JQF A;  1W9X A;  4HNU A;  3HL2 A;  4ZDL A;  4XON A;  3T51 B;  3DPT A;  3W3C A;  3H9J A;  4XM3 A;  3K4M A;  2R7Q A;  3A2K A;  3T9G A;  5HNF A;  2M5S A;  4DNT B;  1KCD A;  2GOX B;  4BE1 A;  4BGD A;  2V4D A;  3S3N A;  4CZC A;  3LL7 A;  2XZP A;  1LDK B;  2VIX A;  5IK2 A;  4KKS A;  4AVZ A;  3EPZ A;  1OFM A;  2V9K A;  3K70 C;  4B47 A;  4EAT A;  1OHH A;  3MKW B;  2R7O A;  2A5W A;  1HVX A;  2FUG 2;  3OYE A;  2XSJ C;  4OJ6 A;  4FET A;  2WPD A;  3BCB A;  2VKD A;  3DTE A;  3K4L A;  3OS2 A;  2X53 S;  5KHD A;  1W36 C;  2WA0 A;  4ITV A;  1N77 A;  2W1O A;  3HOS A;  2KDO A;  4ZJZ A;  1WTH D;  4BEH B;  1SKY B;  3H94 A;  3DTK A;  2VQG A;  1X1B A;  4BS9 A;  2HNH A;  2PEC A;  4II2 A;  4E6K G;  2WY7 Q;  3CF2 A;  2QKL B;  2ZXI A;  2GJR A;  3RSN A;  3VMW A;  1MNE A;  1LFP A;  3OY9 A;  4XNF A;  1O8E A;  3GQ9 A;  2BVL A;  1PE9 A;  1KTW A;  1MMG A;  3K4N A;  4YRV A;  1X0C A;  1IRX A;  3FKS A;  2WAF A;  2XOK A;  4Y33 A;  3CMM A;  4F55 A;  2X1C A;  2M7A A;  2KPM A;  3GQA A;  3DLA A;  1UD5 A;  1E3X A;  3OIP A;  2QY1 A;  1WJB A;  1NG7 A;  3KRG A;  1H8E A;  3HUG B;  3WQZ A;  3RPU D;  1NRK A;  1W0J A;  3DU5 A;  3QOD A;  4G6I A;  4DGW B;  3ZSC A;  2IGN A;  4MR0 A;  4DIQ A;  2VB6 A;  4CCN A;  4CCK A;  3KYL A;  2F1M A;  3BC8 A;  4W8T A;  3UW0 A;  2WJV A;  2F6C A;  1RWR A;  4KKU A;  4RMN A;  2XC7 A;  2NT9 A;  4BE0 A;  2QXZ A;  1YX5 A;  3AFH A;  3FBN B;  2HQA A;  4OJO A;  4CCL A;  3A3G A;  1AIR A;  1VF7 A;  2O1D A;  2MAB A;  1WP6 A;  1YX3 A;  2IGM A;  2INV A;  1O88 A;  3A1Y A;  2M0M A;  1D0Z A;  1BHE A;  2NZM A;  4B43 A;  4TT3 A;  3OYC A;  1JTA A;  4XMY A;  1V5F A;  1PLU A;  4L8J A;  2UVE A;  1K6Y A;  4P5O A;  4P22 A;  3SYT A;  1UG0 A;  2ZSH B;  5FL7 A;  3GRH A;  2HVR A;  2KRC A;  5LD2 C;  4Y4R A;  1KON A;  2CUJ A;  2Z1D A;  4ANJ A;  4JOM A;  2W00 A;  2XF7 A;  3PL8 A;  3BH4 A;  1T95 A;  1BR4 A;  4H4K C;  2NTQ A;  2X6Y A;  3VYR B;  1GLN A;  3PNY A;  3JUR A;  4BQN A;  1MW7 A;  4PUS A;  1X4P A;  3L2W A;  3RTR A;  2K3P A;  2M3A A;  2KLO A;  2L7K A;  5CQG A;  3D5L A;  4Y3O A;  4DOZ A;  3KX2 A;  5LFA A;  3H5N A;  4XKB A;  2LY1 A;  4ZC3 A;  1O8H A;  1WJC A;  5CQE A;  3HG9 A;  1E0E A;  2VXZ A;  3HXL A;  2W82 A;  2WY8 Q;  4ZDP A;  1E79 A;  2KVO A;  2V7Q A;  2W6I A;  3DDY A;  2RRE A;  2ELJ A;  3HC7 A;  1QCX A;  1NHC A;  3OYK A;  2IS1 A;  2JVH A;  1O8F A;  1SAU A;  3CP8 A;  3GQ7 A;  3PSF A;  4W8R A;  2VQC A;  3IAS 2;  2O0V A;  2VAS A;  2ZXH A;  1KMH A;  2K5C A;  1J09 A;  2P0W A;  2VL8 A;  1V5E A;  3EQO A;  3FKJ A;  4XOR A;  1OR7 C;  4KIS A;  2HPI A;  1EA3 A;  2X8K A;  1BLI A;  2DOA A;  4LIU A;  2XGJ A;  4CUG A;  3CZ6 A;  4Z1M A;  1P9Q C;  2MYS A;  2GJP A;  1E1Q A;  4PJN A;  1VLY A;  4W8S A;  2VJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...