4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
1CZFA 2ODLA 2UVEA 4OJ5A 1X0CA 4URRA 1O8KA 1RU4A 4Z06A 4NK6A 1RMGA 2VBEA 4W8TA 4XONA 4W8SA 4XQFA 4XN3A 1O8HA 3ZSCA 2VBKA 1K5CA 4XKVA 2NZMA 4XN0A 2QY1A 4Z03A 1JRGA 4XORA 2QX3A 3GQAA 2IQ7A 3ZPPA 5C1CA 3SUCA 1PE9A 3GQ8A 3UW0A 1OOCA 1O88A 1KTWA 2NT6A 5AMVA 1WMRA 4OJOA 1O8GA 1O8MA 3KRGA 4XL9A 1OFLA 3VMVA 4YEJA 2O0VA 2NSPA 4OZYA 4XLEA 4I84A 4XOTA 4XLHA 4OJ6A 1NHCA 1DBGA 1IDJA 1QJVA 4HWVA 4AVZA 4XOPA 1KCDA 1AIRA 1OGOX 1O8DA 4XMYA 2NTQA 1PLUA 1O8JA 3GQ7A 4XLAA 1IA5A 1H80A 3VSTA 2NSTA 2Z8GA 2PYGA 2INUA 1JTAA 1O8EA 2QXZA 3VMWA 1VBLA 1GQ8A 2EWEA 4OZZA 1EE6A 2NT9A 1O8FA 2O1DA 1OFMA 4XLFA 4XR6A 1BHEA 4U4BA 3GQ9A 3LMWA 4C2LA 2VJJA 2X85A 4MXNA 4OJPA 4YZQA 2BSPA 1QCXA 5C1EA 2O0WA 3T9GA 4XM3A 4PMHA 3WWGA 4MR0A 3JURA 4Z05A 2PYHA 2VJIA 1O8IA 2UVFA 3EQOA 3B8YA 4OJLA 3EQNA 1RWRA 4W8RA 1IB4A 4W8QA 2VBMA 4YZAA 1KCCA 3B4NA 1HG8A 2X3HA 4YZXA 3FY3A 2O04A 4YZ0A 2X6YA 4XKWA 2INVA 3VSUA 4XLCA 1DBOA 3B90A 1PXZA 3VSVA 1O8LA 2O17A 2X6XA 1BN8A 2NTPA 2PECA 4EW9A 1IDKA 2NTBA 4XNFA 3GRHA 1OGMX 4YELA 4U49A 4NK8A 2X6WA 1XG2A
chains in the Genus database with same CATH superfamily
3DEEA 2OQGA 4BQQA 4URRA 2KPMA 1SFXA 2V1DA 3ZMUA 1GXPA 3S16J 4I76A 1IN5A 2LTPA 2R7DA 4PFOA 3GVAA 3GW2A 2R7TA 2DOFA 3OAAA 3KP7A 4B3XA 2GXAA 1QFYA 4P26A 4LMYA 3A8KA 1YJWB 4U0YA 2EIXA 4G9YA 4I99C 1ODDA 2K85A 2WAEA 5ICEA 4K1XA 1ZR4A 1LJ9A 1Z21A 1WI9A 2V7FA 4ZZDA 1H8HA 4A0XA 2HYGD 4BBRJ 1SANA 1BA5A 1LKXA 2NNYA 1W0JA 4C2TA 3QYBA 2DOGA 1O88A 2LSOA 3M9AA 5DEQA 1BR4A 2M8GX 4FASD 4OJOA 2M3AA 2PEXA 2ZMEB 1PP7U 1MDMA 5IY5H 1O8MA 4XL9A 1EXMA 3MEXA 4RDLA 2B9SA 4F7ZA 3VYSB 4XOTA 1SD7A 3FIWA 3OSFA 3U6KA 1DBGA 2QZ8A 1ERDA 1VQ6B 5CPRB 1BC8C 2Y69H 3P27A 4PJLA 1W34A 1R1UA 3TP0A 3OYNA 2JK3A 3S1RJ 1KTVA 2IAIA 4E7HA 2DCUA 4FT8A 2C78A 4EGZA 1IRGA 1YX5A 4UHTA 2DQRA 3PO3J 2V6EA 1X2MA 4WXDA 3A3BA 3FXKA 2HKXA 1X4PA 3LA3A 2RAEA 2CQXA 2NSTA 4A2UA 3A02A 2DPUA 3DKXA 4DQLA 1X1CA 5HDGA 4E7SA 1HKSA 2QXZA 2IS6A 2LFBA 3I4NJ 1MMDA 1S6LA 1UD2A 1QRCA 2IGKA 4ZV4A 3KYCB 1FOKA 3CD6B 2Z9OA 2P5KA 4PJMA 4F52A 4K2EA 5IOZA 2HLDA 2F4NA 3A3GA 4XKBA 3CCVI 1CNFA 3BQJA 4ANJA 1BJKA 1COWA 1OCRH 3GLLA 2F5DA 1FRNA 1WJBA 5HLHA 3SYJA 1FSHA 1HQCA 1X2NA 2Q0OA 2IGNA 3ERMA 3LSRA 1T95A 5KSWB 4AUXA 1WH7A 4HA8A 4HEA2 2DIEA 2XNDA 3WNBA 3NE5B 4B4CA 4EJVA 1W1WE 4G6DA 1MDMB 1LEBA 4AIDA 2XSDC 2ZNZA 1BI2A 1RESA 4N0BA 3CC7I 1K4ZA 2ELHA 3W5VA 2GJKA 2QTLA 1D1NA 4A5NA 1YHQB 2XB5A 2ZXWH 2OTLB 4PC1A 3ZMDA 1HVXA 1VLYA 5D6EA 5FO1A 5EJCA 2EILH 3IUOA 3BDDA 3SJPA 2Y0SA 1SMTA 1IDKA 3DU5A 2V4JC 2KDOA 2WA0A 4RJLA 4YALA 4D5FA 1VQ5B 1JHFA 2Z1DA 3VDXA 4II2A 2D1VA 2ZZQA 1UD3A 3WTTC 2BXYA 5BS6A 1D0ZA 1X0CA 1QHHD 4ACBA 4Z4ZA 3BR5A 3JTGA 3GTOJ 2Y30A 3G1MA 1KRHA 2XZOA 3WY9A 1FNMA 2XT2A 4PFPA 4L0YB 4ZJZA 2CW0F 1Y0RA 1OYYA 2L9RA 2KIMA 2RV8A 2M7AA 1AU7A 1EFUA 3OW7A 3PUNA 4EM2A 5J3LA 3ZMZA 2HQAA 2XDVA 5LRSA 2EIMH 4A6EA 3ASRA 1ZGJA 3GQAA 1KU2A 1R7JA 3ZIAA 1D8TA 3FPKA 1QPMA 4II3A 3MKLA 2W24A 3K2ZA 3E6CC 3WG7H 5C4JJ 5JLWA 3HOYJ 2FOKA 3OYDA 4RDKA 2XOKA 1VQNB 3K1MA 1YE9A 2Y0MA 1IV6A 5HODA 2HOTA 3BJAA 3SLNA 3FMQA 2M1BA 2GM4A 3QYEA 1K8FA 3WTUC 1FWZA 4QVJA 4AC9A 4EJWA 4TN1A 3MZYA 1E3HA 3BCAA 2VKVA 3PIPF 2HWVA 1BLIA 2VT2A 4IRIA 4NCNA 3HBLA 4DYQA 2E60A 2P81A 3H94A 2KMUA 3CCLB 2ZSHB 1P92A 3KP3A 4UY8I 4RM0A 2L7KA 4RS8A 3ONQA 4Y7NJ 3BY2A 1NDHA 1C0WA 3K4BA 2O9LA 4WWVA 3HC7A 2FBKA 2ZJPF 3JQRA 2E71A 2I10A 3CCSI 2K9LA 3Q3SA 2V4DA 4LC0A 4OOXA 2VFMA 2O61A 1MBKA 3ZMVA 3BH6B 1GQ8A 3FXOA 4Z4RA 3VEPA 4KA4A 3I55B 1ETXA 5C44J 3LFKA 2HQRA 1F36A 1Z91A 4P1VA 2VUMJ 5FKLA 1HKQA 2VJJA 4Z6YA 5IYDJ 4LLLA 5JFRA 2EV6A 3BNWA 2VKEA 4PJJA 4MR0A 3X2QH 1R23A 3C18A 3CLOA 3SZEA 3KL9A 2VB6A 2BVLA 2OBSA 2XHKA 3NARA 3TDZC 2XTYA 1XGOA 3DF8A 5A88A 3GUDA 1OJLA 1XDUA 2HQ5A 3H1CA 5EG0A 5HXBA 2HEOA 2GOXB 5IT9K 5FFXA 4KKSA 2VJ5A 4UUSA 2R7FA 1RI7A 2VQHA 1QGZA 2WWYA 1R5NA 3L2UA 2KIQA 2LMDA 1NK2P 2DAOA 2NVTJ 1JA1A 3EUHC 4M3FA 3B90A 4RCZA 4YAOA 3LSPA 3L2RA 4HRIA 3CC4B 3MCAA 4UXNA 2H27A 2HZDA 4L9JA 1OKRA 4JX4A 2QKMB 4V2FA 1EH7A 1E3PA 1Z7LA 2FUG2 2XC7A 3PNVA 3VNUA 4NNJA 3ZQFA 1D5VA 4X7FA 3KETA 1OB5A 4U87A 3CCYA 3M1CA 4YELA 3A2KA 1XGNA 2X9DA 4CXFA 5BPIA 1XG2A 1AWCA 4HPQA 5FKKA 5HZAA 3SEQA 2DK5A 3OR2C 3W2EA 2F4MB 1BBYA 1MBJA 2E7XA 1BX0A 1ZTRA 1P7IA 2E5NA 4P9FA 4UUTA 1IHMA 3DTKA 1N0VC 1MJBA 4M6YA 5CVRA 1W4MA 4ENNA 4IHTA 2EIKH 2PLFA 3T5XA 3TDUC 2DODA 1BIAA 3BTIA 3P9KA 4XN3A 4XQFA 4KITB 3S2HJ 2MW8A 2CW8A 3KEYA 2WSSA 5KNLA 5FRMA 2O03A 2R7OA 2JRMA 1QUFA 4EV0A 2VOOA 2CV2A 1A6QA 4QV2A 1XCBA 4DK0A 2CV0A 1AHDP 2XIGA 3ABLH 1USTA 2BY0A 4YAFA 3ELKA 5EG0B 5DNSA 1VJSA 3GQ8A 3WBKA 2PX9A 5HNHA 3LOCA 2F3LA 3M3YJ 1BPLA 5IOYA 4UUSB 1IB0A 2ZL5A 4AIHA 4LLNA 1WMRA 3M7GA 3L2CA 1DDNA 4GRIA 4CCKA 1FP2A 2VBYA 1J7KA 5M5YJ 1WDTA 3J81k 3A0HC 1Z05A 3O2PE 1RNLA 3OV8A 1BI3A 3RI4A 1XMXA 3CTAA 3I54A 1T2KA 2HPMA 3BR2A 1FMWA 2CUEA 2XUBA 1AA7A 5CVUA 4GFBA 3S3NA 4C3HJ 3WTVC 4E6KG 5IK2A 3OS2A 2VC0A 5E18F 2TRTA 2E1MC 1WPCA 1PUFA 1XSXA 1YX2A 2W84A 2XAUA 4Y33A 3HSFA 2G7UA 3ASTA 4QIWN 3K70C 3GTKJ 3FPPA 1F9NA 2JUCA 1N06A 1I50J 2HZTA 3VMWA 2M9HA 3PNYA 1L3LA 2XGXA 1QUEA 4AC0A 1MNMC 2QSHX 4U9UA 2QEXI 3GFJA 1FX7A 2HPIA 4Y17A 5B1BH 3LAJA 1Z9CA 1UJ8A 2LZJA 4HZFA 4XSZF 4WX9A 3H9NA 2A5YB 2HOAA 3IRQA 2DA1A 2VNJA 2F6CA 4MQ9F 3OS0A 4J19A 1BL0A 1WJFA 1HW1A 4JX6A 4I0AA 4RLZA 3FISA 4ZC3A 1IV8A 3L2WA 2CC2A 3L2VA 4OPVA 1ZM3A 5DCMA 3RQIA 5ILVA 2Q6LA 1R71A 4L0ZB 2DMUA 3OPOA 1KA8A 2XTXA 2VIXA 3EQOA 1KU3A 2FX0A 2IS1A 1TYVA 2Y9ZA 4TMTA 3CCVB 3H3VK 2KIFA 3BWGA 1X19A 1SC7A 3AVTA 3ASSA 2VKHA 2HI3A 2ZJ2A 3PA1A 4PDKA 4W8QA 4PSXA 3CCQI 3FKIJ 5KAFC 2WAQA 1XTAA 3UKGA 3Q0UA 1J9IA 4KJZA 3HGYA 4WXHA 2K02A 2O04A 3E6MA 3FMRA 3LSKA 3HOXJ 2STTA 1FNBA 1OFDA 2TDXA 2INVA 2HVSA 1DBOA 2DY1A 4DNCA 3CJNA 2BV3A 3HOVJ 2VOPA 2M8EA 2JN9A 3CC7B 2W7NA 4BUPA 3LJYA 3JQQA 3UR3C 3S3OA 3KEWA 4EW9A 2FOWA 2VJ4A 2E34A 1RETA 3H0GJ 3OYFA 1OGMX 3DEWA 3TW7A 5D4RA 3RPUD 4BDYA 4U49A 1WFXA 5LRRA 2X6WA 2ZXHA 1YYVA 3K6GA 3HL2A 2ODLA 2CK3A 3JTHA 4OJ5A 2X0LA 2L9NA 1Z77A 1WQ2A 2K4BA 1E79A 1ZREA 4C43A 2IJLA 4CZCA 4Z06A 1WGXA 2I1LA 1SEUA 1B72A 3W5HA 3ZBTA 1T0FC 3DXJF 4W8SA 1EP3B 2JSPA 5DCMB 3CMMA 5B6IA 4MFDA 3ZSCA 4ZYGA 2QMUA 1BM9A 2NVYJ 2FMLA 4KFCA 1G3SA 1MNDA 1TLLA 2QWWA 4UVBA 2LVSA 2WR8A 4M6XA 1FYKA 3VNVA 1GT0C 2JRTA 2DA2A 3BZ6A 3ISPA 2JA6J 4P6VF 3JRHA 3DFGA 2NVUB 1I6XA 3OYJA 3IC7A 4FXUA 4LBZA 1YJWI 2D3NA 2G7HA 4KIBA 3KRGA 4PCQA 4P6YA 4F7DA 2TCTA 3VMVA 2IXSA 5E1WA 1WJAA 1FBUA 1Z6RA 4BE1A 3SKBA 4S0HB 2D9RA 3KP5A 2Q1ZB 5EEAA 4HDVA 4FWTA 1H8AC 1IN8A 3W2GA 4PK4A 1CQTA 1AKHB 2CU7A 4OAYA 1KK2A 2CWEA 4X7CA 2KP6A 4KN4X 3BTJA 3KE2A 9ANTA 1GVJA 4D0PA 2K3FA 1QZYA 1LDJA 4Y15A 2QDXA 1WH5A 5DDGA 1NBMA 5KAIC 5IYWA 2IGMA 5TGTA 3MD2A 2PYGA 4IHVA 1I39A 2BM4A 1RUNA 2PJPA 3E20A 1UG2A 4XBFA 3AFHA 1V55H 4V2GA 1B72B 3SEZA 4HE5A 4KNYA 3PSFA 3AVUA 1DGRM 5J4VA 2JSCA 3MWMA 4XLFA 5ICGA 3HRTA 5L3FA 5FLVA 2OF7A 4OWRB 1ETQA 4IW3B 4EM0B 2J8IA 1J59A 3I58A 1KD1D 1WORA 4PMHA 3CCMI 2V7TA 3V7AA 3BC8A 4OPOA 2IA1A 1BI0A 1Y6IA 3DEUA 5LBQA 5HLGA 4S04A 3OE7A 2X1DA 4RAGA 3J81K 1ZGWA 2VE8A 3AVXA 1S8NA 1GVHA 1BX1A 4XKCA 1QFZA 1G6NA 1VQMI 2M5WA 1YJNB 2CQQA 2NOJB 2EK5A 1T5EA 2IT0A 3W6KB 1RWRA 4ZTJA 2R5ZB 1BIBA 3KCCA 4JRAC 5DS9A 3W2WA 1T6XA 3KYLA 1T33A 1MJAA 2X3HA 2DMTA 3DU6A 4RAFA 3FM5A 5IT9Z 2L7FP 3PVDA 4AIKA 1KZLA 1PVEA 1QVUA 2L01A 1W2BB 3JR9A 1LVAA 2IRFG 3GXOA 1VQPI 2R5YA 1LFPA 3GFMA 3K9TA 4HW0A 3NRVA 2HDCA 1J09A 1Y8RB 5KW9A 2NTBA 3I59A 3RJPA 1YHQI 4XNFA 2J8KA 2XAFA 2BXZA 2H6CA 3MKYB 5DM7F 1STZA 4DW6A 1XG1A 4U88A 2WV1A 3KLNA 3CESA 4HX4A 4WK8F 5C4XJ 1MBFA 2XAQA 1ZG1A 1IRXA 2WAFA 1N0UA 1YTYA 2CW7A 2DA4A 2OD5A 4FETA 2YUHA 1ZAOA 3CCRI 2D5VA 4MNUA 4ZYEA 2EZKA 4N4OB 1PUEE 3W2VA 1LDKB 4Z4TA 3K10A 3ZZUA 1TZLA 3I5UA 4KICA 2LY9A 3S2WA 5F08A 4LG0A 3VFZA 4EVIA 4XKVA 3CCUI 1JKQC 1VQ4B 2V9PA 4IL6C 3R0JA 3G1LA 2A69F 2HOSA 4OPSA 4Z1MA 1KQSB 3GVKA 4UNOA 2VPRA 3GVLA 1ELOA 3UW0A 1I8DA 3G6EI 2ECBA 2BY2A 2MLKA 3BG5A 4CYCA 4AYBN 1T08B 1ZGAA 3H92A 3LMMA 1TT5B 2KZVA 4CQJA 2NSPA 1TYUA 1E3XA 2UXNA 3OYAA 5FROA 2AXLA 2R93J 3I4MJ 1V0FA 3T8RA 1D0YA 4D9JA 2XPVA 3QU3A 2ZBKA 3VPRA 4NDLA 1XMKA 1V0EA 1WOOA 1W0KA 1XC5A 4ZZLA 3HIFA 5HLTA 1I1SA 3E0JB 2FEZA 1AMOA 3CZ6A 4QUZA 1U2WA 1J2XA 3GYHX 1S7EA 2JQ7A 4Q7JB 1YW9A 2BM5A 4G7OF 3H3ZA 1K79A 4YRVA 1W0TA 3TP3A 1UG0A 2XRLA 1JT6A 2R9VA 4TKOB 5FIUA 2JA7J 1IUYA 3QFTA 2CS3A 5LGTA 2X3UA 3BPXA 2ZJRF 5JR3A 4CO8A 3LWFA 2E5ZA 2HR3A 2MC3A 2Q2EA 3FDYA 3PFIA 4HNUA 3KZYA 5J3OA 1ZARA 2DMPA 1ZN2A 2QEXB 1YS6A 2CUFA 5FB2A 3S14J 1MGTA 3IKVA 3Q9SA 2VODA 1T6YA 1PYVA 1S5LC 5AIPA 1T39A 3JRBA 4CYCB 3GO5A 2HTJA 2R6HA 3WTWC 4UZEA 1BJZA 4CH7A 4X7EA 2K9MA 3OYEA 1IB4A 3OYLA 4P3YA 1MH3A 4G6QA 1W0UA 3BG6A 4FX4A 1K78A 3GTMJ 1PJ5A 1LDDA 1WP6A 2DTRA 3KEOA 1XSDA 4ABZA 4ROXA 5ED4A 3LVBA 4C0SA 4XLCA 2P0WA 3CUOA 2K4JA 2D2WA 4A3KJ 3W2FA 1ZLJA 3HPGA 1WKMA 2VBSA 1FYMA 3CCQB 2IS4A 2YU3A 3FM3A 1YW8A 5FLXZ 1M90D 2EBIA 2PMUA 3C2BA 2BW3A 4DBQA 2JMWA 1KU9A 4BAYA 3A4CA 1ZM9A 2B5OA 5L3BA 1UCRA 4ZCLA 2GJPA 4B47A 2ZZGA 4P12A 2F4OB 4H0EA 4IHYA 2K9SA 1SVLA 2XGCA 4PUSA 4C3JJ 1EH8A 1RU4A 3PQJA 1BOBA 2EQRA 2EFOA 2Q2EB 5JLXA 1BJAA 4XRMA 3NB2A 3HOSA 3FX3A 5CVIA 3DP7A 3KP2A 3OOPA 1WJEA 1U2RA 1QVFB 5DS0A 5JHUA 2DW4A 4NHJA 4ZCMA 2MABA 1CLWA 3BH7B 3H5RA 1JB9A 1W87A 2OAZA 1N77A 2Q6IA 2MLGA 2V7VA 4N3NA 2C2WA 3OYGA 2HGCA 1TC3C 1XX5A 4PGOA 2RC4A 1XD7A 1NB0A 1QVTA 3PSIA 4PZJA 2FF4A 3MN2A 1VHEA 4GO1A 1K78B 4MLOA 2P8TA 4FCYA 3SQNA 3K69A 3HRMA 1FIAA 5EZHA 3S1MJ 3ZQHA 3TO9A 3E5XA 5J35A 4EATA 4LIUA 2BY1A 4F3QA 3CPXA 2IP2A 4BH9A 1RZ4A 1DABA 1YIJI 5FNZA 3SLDA 3JRIA 1B8IB 3IKTA 3QFSA 4HAMA 2LREA 1SMYF 4S05A 2OZUA 3K1PA 4XMYA 2BW3B 4ASNA 1P4AA 2F5VA 5L3DA 2RC6A 1WJCA 5K5QA 4I0BA 4YEIA 4M3DA 1O57A 3FZVA 4UB6C 4Z4UA 3AVYA 2GREA 4OM9A 2HOEA 2INUA 1ITYA 5E3MA 2UWMA 2QYUA 1LVKA 1UD4A 5D4SA 2HNHA 3S93A 2LD5A 2KLOA 2XEXA 3AVVA 3WG9A 4NK8A 2W7ZA 1EE6A 5IYCJ 3M1EA 2O1DA 3V8JA 2X48A 1KJZA 1NH3A 1AIPA 4P96A 5M3MJ 1YJ9I 4AM3A 4Z4VA 3G1OA 1YS7A 4X7DA 1F60A 3H9JA 1EFRA 1MW7A 2OC6A 1R5BA 2ZZFA 3JURA 2A6HF 1Y0YA 1EZGA 1V5FA 2V7XA 3F72A 4LB6B 2EFWA 2AS5F 2M0CA 1VQLB 4IJAA 3J80K 3J81Z 4ENMA 1WHUA 5JBQA 3WQZA 1XGSA 4OJLA 4RBOA 5J47A 2XZPA 1E62A 5DM6F 2AHOA 3CCMB 3TEDA 3B4NA 5HOOA 4A0YA 4AVPA 1BQEA 3FY3A 1U5TA 4KISA 2O5RA 3DKWA 2K86A 4MIMA 1XPXA 1H42A 1FP1D 1GDTA 3HKZN 5IP6A 5H5JA 3ONYA 2JA8J 2UVFA 4TMZA 2BSAA 1VQMB 1WOSA 3N90A 1IO2A 2R7ZJ 1MBHA 3ZZTA 2K7LA 4Z4SA 2CW5A 5EZGA 5F4MA 1QNTA 3P7NA 3FF5A 2O17A 2XV4S 4P9UA 1U8BA 2NTPA 3I53A 3V76A 1K6YA 1YI2I 2F5FA 1P9QC 3PJRA 1LLZA 2DEUA 2EZLA 4MGRA 3FBIB 4TMWA 4FX0A 5F0CA 5FGMA 4MYTA 1EA0A 1Q81D 2QN6A 3QPSA 1CZFA 1VQPB 4QWQA 4KIFA 2KL4A 3CCEI 1U5TC 4OIRF 1R36A 3B8HA 1QGPA 2BMWA 2W6JA 4LOCA 5HDNA 2LH9A 4XRFA 1V5EA 4AIJA 3OOCA 2PMZN 2COMA 2MBFA 3HRSA 3CCRB 1LE8A 3LSIA 5DTDA 4XORA 1BW5A 2GZWA 3RKXA 5HLIA 5THXA 3ZC3A 4UV9A 1S72B 5FJ8J 2F5EA 5JVTA 2E2IJ 1TWAJ 3J7AO 4ZGQB 1MMAA 3WNDA 2WPDA 2BX6A 4M9SA 3CCUB 4RD0A 2VYQA 4BY1J 2Z2SB 1F4KA 1OFLA 5HKKA 2ZL7A 3AVWA 1NHAA 1FZPB 3VWBA 1IZ1A 3T0YA 2DDBA 4G12A 4GXOA 2JDIA 2GK7A 1T56A 1QA1A 3OS1A 3PSZA 2F43A 4JP0A 3G6EB 1JUMA 4CCNA 4YFNF 5IYPA 1HA8A 2P6SA 3O3KA 3MZHA 1YQAA 5LHHA 1PDNC 1O8DA 5LGUA 2NTQA 3G71I 1JUPA 2IA0A 2M87A 2MA3A 3CDIA 3SZPA 2W85A 5LFAA 1DGWY 3OR1C 1QG0A 3VSTA 2XPWA 4B8XA 3W3CA 1JKOC 1B6AA 2HU9A 3JRAA 5FD6A 1LQ1A 4KT5C 3W5UA 3I3LA 1LLWA 4BPRA 4FN5A 2XTWA 4HF0A 1T8IA 2YX7A 3GZ6A 2XASA 2ME0A 5JVGF 1VF7A 1O8FA 2C5HA 2XF7A 4BNCA 4NC8A 3CC2B 1FMVA 4NC6A 2R4GA 1O3TA 5L3CA 4U4BA 1UD6A 4U0WA 3DLLF 4EGYA 3HAGA 1S7OA 3K1NA 4DIQA 1N05A 4OJPA 3V8KA 4PAAA 1KONA 1XSVA 4XM3A 3HHHA 3WWGA 4M53A 2IA2A 2MG4A 1X3ZB 2DPDA 4QPQA 4CCOA 3ABKH 4KIGA 4HQMA 4AD9A 2MH9A 2JA2A 3KZZA 5D6FA 4PC6A 3QSYA 1QVGB 4RGXA 3QOEA 2VQGA 3KFWX 1UAAA 1GO2A 1ETWA 1W36C 1EFCA 1FDRA 1A04A 2P4WA 4Y7CA 1I27A 1V5GA 4PJ0C 4A3MJ 5IPAA 3BY6A 3RZOJ 4OIOF 5TRDA 4BJ5C 3G2BA 3M8JA 2L02A 1QZZA 4PGGA 2JA5J 4BQAA 4P2NA 3VSVA 3K4NA 1R6RA 1YJNI 2BN4A 1MBGA 1GV5A 2CYYA 3BPVA 1M1KD 4M0LA 2DCEA 3R6KA 3EUHA 4BHPA 5L3GA 2BM7A 4M9ZA 3Q6RA 1PJRA 5GP9A 3VODA 5DN6A 5CYVA 4ZDPA 2JWTA 3QE2A 2WADA 3JAMK 1YO5C 3F23A 3O8HA 1WRJA 2M7BA 1MABA 2NNNA 4OMYA 2XSJC 3TKYA 1O8KA 4D7MA 2VXZA 3B73A 2PI0A 1KQ8A 2B7CA 1IN4A 4BGDA 4XRSG 1OHHA 4FE4A 3R61A 2WB1N 2XAJA 3WTXC 1DP3A 5JI6A 1R58A 3CJQB 3IV5A 1QO0D 3DKYA 1Z1DA 1KYZA 3E97A 3WTZA 3OYKA 2ICWG 2K3PA 5IT3A 4L9NA 3FK7A 2OQRA 1G3TA 1R5GA 2E2HJ 1OB0A 4MTDA 2Q8KA 2CNDA 3ZN1A 2P7VB 4F93B 2PBIA 4DOZA 5D5UB 1VNDA 2C77A 3TGNA 3A01A 1S4MA 4RB1A 2V31A 4E7IA 3E6BA 4QTRA 3BC9A 2PE3A 1BI1A 2YPRA 3MMPA 5JMCB 4RGRA 4G7WA 2JJ2A 5B5EC 4OZYA 3S2DJ 3FKSA 2NV4A 1VQ4I 4I84A 1FLIA 2RQPA 3F6OA 4J0QA 2BVMA 4XLNF 3REOA 3ROUA 2D1HA 3HOUJ 1VQ9B 5E8IA 3Q5FA 1HDDC 2MD0A 1QH0A 4B43A 1OGIA 1X3WB 3WE3A 2HMAA 3WGHA 3VMFA 2ADUA 3JX8A 3T8TA 1D1AA 5HS7A 3F3XA 5K5OA 3AGQA 3GZ5A 4A3DJ 1QGAA 1IN7A 2BY3A 4IPAA 1MZBA 5ERIA 1I1GA 1H80A 4G94A 1ZG3A 3T1BA 4RD3A 1ZUNB 4O6JA 1LFUP 1NG6A 4L5JA 1W7PA 4A3EJ 5A8AA 1YIJB 4AWXB 1O8EA 3M8EA 4M73A 1MBEA 1K28D 3F8CA 2O3FA 1UB9A 2W1OA 1V5VA 4Z4YA 2DDAA 5AIQA 3Q39A 3LQQA 3GWZA 4XR6A 3WU2C 3CP8A 3JREA 3CDHA 5HS9A 1T6ZA 2NOGA 3GVJA 1PJ7A 4H9GA 1Q86D 2JVGA 2DMQA 4FTHA 3T9GA 4EQQA 2ZSIB 1B9NA 1K7AA 1B1BA 3RTRA 4CYDA 2E1RA 4G6TB 4PC7A 3A01B 1O8IA 1VZ0A 2HXIA 5GPCA 3OJWA 2CV1A 2FU4A 3ZXSA 2HKOA 4IRHA 1YJ9B 2WBMA 2R7WA 2Y2ZA 4KT6A 4AYBA 4HLYA 1L0OC 4BE2A 2CF4A 1TYWA 3C1DA 3J80Z 3K4CA 1KQ9A 4RGSA 2DETA 3O6BB 3MHPA 3RDIA 3D1NI 2XF5A 4YZXA 5IYNA 3U2QA 2ELJA 4BHCA 4A3JJ 3B78A 4G5GA 3U2RA 2VFQA 2X6YA 2OTJB 1MD0A 3OWTA 2CMPA 2ZL6A 3LL7A 3Q38A 1IW7F 3WTYC 2KQRA 4YIIA 2DMNA 3MQ0A 4UUVA 4YDTA 2ZBUA 1ZHFA 2V1NA 1TW3A 2KRCA 4IHSA 2E1MB 2R7SA 4P3IA 4DZPA 2FRHA 2R92J 5GV8A 2QSFX 3GRHA 2AQEA 1QA2A 1G2HA 1ZG5A 2QGUA 3CO6C 2XZLA 3H5NA 4YIRX 3GTQJ 1LB2A 3RPQA 3EYIA 4BEHA 1RR7A 3Q9VA 5J1YA 5DUIA 4RM2A 4JX5A 4LBWA 1FJLA 1YI2B 4UB8C 3H36A 5DD4A 1U3EM 3ML6A 4W8TA 2CBXA 3OIQA 2QTZA 2F1MA 5E20A 3ZN0A 1H85A 2OJED 1T0FA 3FXQA 2VZLA 3PUBA 3BCDA 1PUFB 1ONVA 5FLXK 1HZEA 1SAXA 3CCEB 2QY1A 4Z03A 5B66C 3F21A 1DP7P 4BDZA 1D1BA 1E64A 2RC5A 4HNTA 4HE6A 5EF6A 1N78A 5C1CA 1VQKI 4M72A 4FE7A 3KIOA 3LO8A 4Y9UA 3L9FA 4GDFA 4M4SA 1KTWA 1OOCA 4FISA 5E8GA 2OBPA 3CXCB 4EJOA 1GUUA 5LEJA 3E6DA 5E6TA 4YEJA 3UNGC 1OGJA 4RDUA 3CMAI 3HSRA 1WI3A 2VQCA 4B3AA 2BM0A 2RKHA 3QOPA 1TQIA 3BJOA 4IX7A 1HOMA 1K73D 5L46A 3BR0A 3WGGA 3S1NJ 2L5QA 1FOXA 2ZXJA 3B82A 1LNWA 2L0KA 1JJ2B 3AG3H 3G4SB 5F4JA 2V6CA 2KFDA 1IA5A 1D3YA 3ASOH 5TISC 1D0XA 4BEHB 1FSEA 4YFXF 5ILUA 2Z8GA 1SFKA 2QBYA 4TMVA 4E7KA 2NPFA 3F0CA 3QAHA 2QA4I 2DO7A 2FD5A 2VKDA 3L00A 2XNCA 1HC8A 3H35A 4ZCIA 2ESHA 1I3QJ 3G71B 2DFIA 2NS0A 2V1UA 2B0LA 3SXYA 3BJ6A 2EFNA 3FXMA 1H8EA 1E3OC 2Y9YA 3LMWA 2L9VA 4WF2A 3JRFA 4BJTA 2A07F 2V9VA 3BZCA 1IRFA 1U9OA 3QFRA 4RB3C 2VFPA 2OU2A 4IQJA 1N8RD 4ENJA 5H59A 2CUZA 2H09A 2DFEA 3CCJI 1ENHA 2PQ8A 4UVCA 3E7LA 1TQPA 3PFYA 3VOEA 4HYEA 3D26A 3KPHA 3DTEA 5TR9A 3K4JA 2KKOA 4GYIA 2PG4A 1HBXG 3LNNA 3GF2A 2L9SA 4WZTA 1OCOH 3JRDA 2RNGA 5CVVA 1KCCA 1GHCA 1HSTA 4Y9RA 2C6YA 1EWYA 1GJRA 4B09A 1BW6A 1D8KA 4E7LA 3VYTB 3GQBA 3BG3A 4DYRA 3FHZA 4JOMA 5L3EA 2B0RA 2ZTNA 3K70D 5J6XA 2M34A 3BTCA 1VQLI 4LG3A 4W97A 4B3FX 3CLQA 1F20A 3RIQA 1RIOH 2X8KA 1XB4A 4IF4A 1CF7A 4YHBA 3ZQCA 2X6XA 3JSOA 1KC8D 2Z6BD 4PC2A 5CQEA 3PIOF 2JIZA 1YRNA 4KH3A 3NEUA 2FNPA 2JVHA 3OIOA 1IDYA 2L3DA 3L09A 4YG2F 4NBSA 2IOUG 2CFOA 2N8GA 5F04A 5B1AH 3AL0C 2E36A 1GAWA 3SJZA 1WTHD 1GV2A 1F5TA 1G8XA 3J7YJ 1FEXA 2XAGA 2XAHA 3HRUA 4FQGA 3ABMH 4L8JA 2Y48A 3QP5A 1IF1A 4CDGA 3JAMZ 3P9IA 4Z2YA 1F43A 2V1XA 3PQKA 1SFUA 1BMFA 1WCMJ 3N4MA 2GK6A 2UUZA 3R6JA 3GBGA 4DNRB 2AQFA 3EPZA 3BT9A 2ME6A 1MRZA 2DJIA 5EYRA 2IEKA 2PLYA 1IC8A 4D7NA 4IOAF 1R49A 1BR1A 1O8HA 4CZZA 3V8LA 4TV7A 2BM6A 4XN0A 5GPAA 2BE5F 1EV7A 4I2OA 2XVCA 3ASPA 2IQ7A 3CPWB 3ZPPA 4R1HA 2AHQA 2CH0A 3IWZA 3OIPA 4M3BA 3M8FA 3U9GA 1JT0A 5J40A 1I18A 4BS9A 1H0MA 5FKNA 2V7WA 2QKLB 2IS2A 2MC4A 4KKUA 1OLTA 1DPRA 3LSMA 4TSFA 5AN9A 2BZTA 4RD6A 1U8RA 1P6RA 3HKZA 3FWEA 1S72I 2KZGA 4X6AJ 1QJVA 2J7KA 4ZTFA 3QPLA 3HDDA 3SZGA 4KYWA 2KVOA 1CF7B 4DZJA 3PSSA 2A61A 4D5CA 3A8JA 1FYLA 3W2HA 4OAZA 1YRNB 1KCDA 4HV6A 5K7ZA 3VO1A 2EINH 1A6IA 4XLPF 1VF9A 1Y1WJ 2ACJA 2VNIA 1BN5A 2O7OA 3GSIA 5H20A 5BOXA 5FRNA 3A35A 3DTIA 3G3ZA 4EJUA 5CDFA 4A3LJ 5F6FA 5M5XJ 1QQIA 4HBLA 2BF4A 2DTZA 2K9QA 3GMEA 3MCZA 4A3GJ 3CRZA 4ETSA 5GAEJ 5E17F 4L9VA 2ZO4A 3M07A 1WPKA 3EQLF 4UV8A 2OK8A 3HHGA 1OCTC 1L1IA 1WJDA 4XIDA 4O5VA 2IVMA 5K5RA 3OYHA 2R5YB 4J01A 4A3CJ 5JHFA 3FHNA 1Y0UA 2HXOA 3MFKA 3I59B 4N3GA 1IAWA 2VL8A 2R7QA 2Z99A 1YITI 1DDIA 4XD7A 5CKTA 2VJIA 1RR8C 4Z4WA 4KMFA 1IJWC 2LKSA 2Y31A 3DDYA 2BEOA 3CC2I 4PJNA 4XK4A 3SFZA 2DN0A 1SKYB 1ZH5A 3QPHA 5D5XB 3QWLA 4QVAA 2VBMA 4WZKA 2LR8A 2VASA 1W35A 2C5BA 2GAUA 1OPCA 3BG7A 1TVCA 2GA1A 3NWTA 1DU6A 3VR6A 3TQNA 2XGJA 1FIPA 1G7SA 3OZUA 1YW7A 1WXRA 3A0BC 1V4RA 3ZQ7A 3ZQLA 4AF7A 4LG0B 2JZYA 3QRFF 1MSEC 3H0DA 1R22A 2QCOA 3KX2A 2JTVA 3I64A 1WU8A 1LFBA 2ID3A 3HUGA 1D1CA 3A1YA 3ZQQA 2EFPA 4OOSA 2XRNA 3L7WA 1E2XA 1B59A 1U78A 1WOPA 1AOYA 5JLVC 4XICA 1FOYA 1HF0A 1QPIA 2A5WA 3WU1B 2WAQN 2RREA 4WZEA 3GTPJ 1JNYA 5BSYA 1Y56A 3HTSB 3BQZA 1RMGA 4Q5SF 4M1KA 3B02A 2H1LA 2R7UA 3CF2A 2QF7A 4V19K 5B3SH 3W2IA 2RVCA 3C2HA 1DUXC 2DA6A 3ES9A 1X4OA 4KN7X 4BY7J 1NK3P 4HF1A 1NG7A 4HOBA 3OW2B 2NZMA 2M0MA 2R7VA 3GTLJ 3ISXA 1Z3XA 3FK6A 1MMSA 5LHGA 3MKWB 2X53S 1Y0NA 2BM1A 3RCOA 2P5LC 2F1LA 2LK2A 1JHHA 2X51A 1VLOA 2EIJH 2JJ7A 2CO5A 4E7JA 4A3IJ 4YC5A 4Y4RA 2GWRA 2DYSH 2O0VA 4G8XA 3RYPA 1S3JA 1TTYA 2KRHA 4JK1X 1XE1A 4CCMA 1RQPA 3B6CA 1G7CA 4RGUA 1KK0A 1Q82D 1IDJA 3ASNH 3RKQA 1FNDA 2O8XA 2Q6OA 3HYIA 2GIVA 4QSHA 3ZPNA 1VQKB 2YWEA 3H9QA 2OBTA 1T98A 1H9GA 3HUGB 2HDWA 4EMSA 1AIRA 1OGOX 2BHZA 5HNFA 1XS9A 1N25A 3CP2A 3CQZJ 2VNKA 2Z3YA 3CMAB 2PMDA 4XRSA 1IDZA 2XC1A 2VPLA 3ZZ0A 2YR2A 3CW2A 1RC9A 3NQOA 1VQ9I 3OKXA 3TL4X 2OCEA 5BSXA 3MZ8A 3CF5F 1ZYRF 4BHBA 1G59A 4KDPA 2GXGA 3JRCA 4H4KC 4OZZA 2OUMA 1ETVA 4BKXA 3LA2A 4WQMA 2LDUA 3SEJA 1B9MA 2YX4A 2O8KA 1TWCJ 4RAYA 4PC3A 1IUFA 2V5IA 2LF8A 1OFMA 4BQNA 2BGJA 2QQ9A 2E19A 3LSJA 4RA2A 1EP2B 3E1YE 3GQ9A 4C2LA 1KK1A 1Z3YA 4ACAA 5C1EA 3F8MA 2QA4B 2VLAA 2V9KA 2R0QC 4G7ZF 2CRVA 3AKZA 2BYVE 1WJ5A 3S8PA 1TYXA 1SFEA 2XKOA 3N6ZA 4Z05A 4X0CA 1DPUA 4RD4A 1I5ZA 4JYKA 3B8YA 2ZCWA 4X05A 1E1RA 4HF2A 2GLOA 3I1FA 1G3YA 2JT1A 2E2JJ 2GA2A 3ZMSA 3NAWA 1TBXA 2ZMEC 1P4WA 2BOLA 1HW5A 1KGSA 2EV5A 3MKZA 3OY9A 4A0ZA 1KU7A 2F4IA 2VT3A 3CCJB 4YZ0A 4P5OA 1IJEA 1K6OA 3MVPA 1ZLKA 2KT0A 1QHGA 2JPBA 2KJCA 3IH2A 1Y39A 3PA2A 3U6BA 2YWHA 1O8LA 4NQWA 1WZ2A 4ZDOA 2BV6A 2A6TA 2FQ4A 5FKMA 3CMEI 4P25A 1U9NA 5GAHJ 1GAQA 3DPLC 4NUBA 3LQ6A 1Z7UA 3QODA 4DBRA 1KMHA 1NTCA 1IXRC 1N07A 1O3QA 2OTJI 2M30A 5TV2A 3MAJA 1P2FA 2QYOA 3VO2A 4KUMA 3DU1X 2OK7A 3LSHA 4RAZA 3A8IA 2FE3A 2DJNA 3V7SA 4YAUA 4B1RA 1A31A 2VBKA 4EEFG 3AGPA 2VBWA 4MFEA 4QHYA 2VBEA 2ZITA 3RKWA 1W5SA 4LD5A 3ZQGA 4ZGNB 2DLLA 4BYYA 2YSRA 3IP4B 4I6ZA 3WODF 2VFNA 3VSLA 1EFTA 3BTLA 2FA5A 4WZLA 1JXSA 3GX4X 4P22A 2XPUA 4EJTA 3C3WA 4BQOA 1OYIA 1B23P 3EUKL 3SZTA 2W57A 2NVXJ 3S15J 2ELKA 1VQ8I 4OU0A 2H6BA 2GQFA 4OMZA 1ON2A 1I3AA 4XLEA 4PGHA 5LGNA 3F22A 2BGIA 4L9TA 1DG1G 4MEYF 1E3ZA 4GCVA 4HWVA 4NQWB 4RB0A 1H9TA 4Y52J 3I0TA 3IHUA 4I09A 3I71A 4G6IA 1FX0A 2QM3A 4HLXA 2E1CA 2VNHA 4JMQA 2CUJA 1O8JA 1K4SA 1IXSB 3HPHA 3PL8A 5DCFA 4F92B 3LNQA 2M45A 1UMQA 1OCPA 3TOBA 4M2LA 4HIZA 3HSEA 3SJMA 3FXLA 2LKXA 1E0EA 4CSWA 2O6GE 3TO6A 1U5TB 4PSWA 1V3FA 1TUIA 5LHIA 1QZEA 4C2UA 3NAUA 3G4SI 5E3OA 5EEGA 2HYJA 1R4MB 5FO5A 2QLZA 1VQOI 2BHYA 1G7RA 5IYBJ 5DYMA 1BC7C 2WZNA 3I56I 1RKWA 4BACA 2L4MA 4MXNA 2G9WA 3MMYB 3PM1A 1SFOJ 5M3FJ 4LK1F 3OL3A 3PNTA 3FMSA 3HM5A 3QU6A 3L2QA 1ZR2A 1R5OA 2QZAA 1N75A 3I9V2 3W6JB 4Q4ZF 4ZYAA 5F0HA 1FNNA 2KIUA 2LYCA 4HNVA 3DQVC 3HB9A 3RIRA 4ZH4F 2EZIA 2DQLA 2VE9A 3JU4A 3CB4A 2VFOA 5LLQA 1FRQA 1B4AA 1O7FA 2LBFA 4W8RA 4ZYDA 2PJRA 5J8FA 3KZIC 5F0FA 1NJID 2FXAA 2QVOA 1YITB 1ZRCA 2CQ7A 4BXUA 2A05A 2YUSA 2OPTA 2L4AA 3EDPA 2VBTA 1ZRFA 5E3NA 4G1BA 2YS9A 3A1PA 1LE8B 1U0JA 2ID6A 2IBDA 3HOWJ 4IO9F 1XB2A 4RLFA 3CUQA 1VQ7I 2XNJA 1WSUA 4FHTA 3SQVA 1KYWA 1RQRA 2DA7A 2E1OA 2K9NA 2ZKZA 4CICA 2LG4A 2DOEA 2GOMA 2VI6A 1IN6A 4ESBA 3OJXA 4DNTB 3C7JA 1X1PA 2EB7A 1TQMA 4ENKA 3LSGA 3HEFA 2DT7B 2ETHA 2MH2A 3IH3A 4B44A 4YFKF 5TJJA 4E70A 1FOWA 1ZM2A 1OYWA 5BNGA 3CJTB 3F6VA 4HQEA 5KHDA 1YFHA 1OB2A 5DSZA 4LITA 2A3SA 2CSOA 2JUGA 3CUQC 3WTSC 4IHXA 2EA2A 2QSGX 1D2EA 2ZC2A 3GFLA 1UHSA 1ZKGA 1REPC 2WJYA 1ZQ3P 1P4XA 3K4MA 5F1RA 2A68F 3ZR8X 1K8AD 2QX3A 1WSVA 1J5YA 1K4TA 5EMNA 2F2EA 5AONA 2LBFB 1SD6A 1USSA 2PJRB 1XDSA 3EETA 5HZBA 4A3BJ 1CNEA 3OZWA 3WHCA 4P9SA 4ESJA 2V79A 1LM1A 2UXXA 1RUOA 1Y8QB 2GIZA 5ICCA 2D74A 2VBZA 3PUMA 2ECCA 4XLHA 1V54H 3VYUB 1NHCA 4IEJA 2KRFA 3F8FA 2XKPA 2X6OA 4HSRA 2FX3A 2Y75A 2ISZA 4YXWA 4AVZA 3RPUA 4E4HA 1RRJA 3TH0A 3GTJJ 2NS8A 3OP1A 3CUQB 1R9TJ 2CQKA 1TWHJ 2VQLA 4BBSJ 1DU0A 2M4KA 1KK3A 2OV7A 1TP4A 1VFCA 3C2GA 4I98B 3F8NA 1PLUA 4DQ2A 1MIJA 2JPCA 3OOUA 4UZFA 3HTUA 3K7AJ 4BJ6C 1QGYA 2ESNA 4OP7A 2QQAA 1S0UA 3AG4H 1JTAA 3QFCA 1VBLA 2QQBA 1R00A 4YCQA 1FTTA 5J4YA 2ZFWA 4IVNA 3OYCA 5F4OA 2UZKA 2EWEA 2HYFA 3SYTA 2CGPA 1JKRC 1SAUA 1PP8F 3F8BA 4BXXJ 3E5UA 4RPDA 4HV5A 4ASUA 5A89A 3ZCOA 4ON0A 1SM4A 4RPBA 4DQKA 2J5OA 2ZZEA 5IYQA 1FBSA 1Z0XA 1X1BA 1UD8A 4X07A 2ZFUA 1ZM4A 1HLVA 4DGWB 4I7HA 5HDKA 5BPDA 2DFHA 1EF4A 5K7HA 3ERED 2PIAA 5EGOA 2PYHA 4C3IJ 4BU2A 4R71A 1ULYA 3PO2J 3RKYA 4QLCU 4CHUA 2GJRA 4EH1A 3GEZA 2KDZA 1BR2A 3IH4A 1MMGA 3PENA 1TSPA 1IXCA 1HG8A 4N9HA 5AMVA 5GV7A 1JJ6C 4LK0F 3WHBA 2I8DA 3CJRB 3ECOA 3JSPA 3ZQIA 3T51B 3SHFA 1Z6TA 3WBJA 2HFHA 3BQYA 3SDGA 3G73A 2ZTGA 1Y1VJ 2FSWA 4I02A 1W9XA 3CMYA 5FO0A 1I6HJ 3ZPLA 1BN8A 2V7QA 2BBYA 2HDDA 4G7XA 3D5SC 3S17J 2LY2A 2Z16A 2NXNB 3FXRA 1G4DA 1G7TA 4LBVA 2FBHA 1TW2A 2XB0X 4LJZF 3KYDB 4E0FA 2G0YA 2VC1A 1P7JA 3ZMTA 5GADJ 3BG9A 4JBAA 3K4LA 3W6VA 3KLOA 2ZJQF 5KVRA 2FQ3A 2UVEA 3U1DA 1OFCX 3LSTA 3CMEB 2IW5A 4I01A 4OIPF 1DARA 4MHGA 1VHOA 4HSTA 3RQ4A 1UZCA 4NK6A 4A5MA 1HXDA 1QA3A 3ONUA 2GPJA 1JE8A 3BR3A 2ZB9A 2ZXIA 3S32A 1JI8A 3ZOBA 2A6EF 3ZP5A 3LA7A 1TT0A 1T38A 5FD5A 5EGOB 3HJEA 4RD1A 2O6WA 2NS7A 4HX8A 1MKMA 3TOAA 2V26A 1W36D 4Y3OA 4LB5A 1E1QA 5J8CA 4ZYHA 3PETA 2L2OA 1H89C 4LGWA 3QPTA 2ISYA 4HG2A 4C30A 2CFXA 1QBJA 1RKTA 1LEAA 4N9IA 1W7PB 1PE9A 4TT3A 2WTEA 3VYRB 2DU9A 2E1BA 3ABTA 2XROA 2NT6A 1DQUA 4A69C 3AAFA 1D5YA 2DFFA 2Z5UA 2R7RA 3Q0VA 1LPQA 2P5VA 1KQ5A 3BLYA 2STWA 3EUAA 2LC2A 3KP6A 2O0YA 3QP6A 4UAJA 4G1VA 4MTEA 3LYCA 5HVQC 3G05A 1ZK8A 5LMZA 4F91B 4B3GA 5C3EJ 3WXMA 2Q6KA 1VQ8B 2WV0A 3EYYA 5A2QK 1XQBA 3OEHA 2MYSA 3HG9A 1PJ6A 2Y0SN 3GQ7A 2YWGA 1JGGA 4BL0B 1UD5A 2RN7A 5CQGA 2CJJA 1EP1B 3ZUGA 3FXUA 3CO7C 5D8KB 4N4NB 2QGGA 2LY1A 4RD2A 1EKEA 2OA4A 4GYGA 1IJFA 3BCFA 2QE7A 3P4GA 2DBBA 1KQ0A 1TTTA 1JKPC 4G7HF 3IAS2 2VN2A 1IRZA 1JGSA 4J00A 4M71A 2HCJB 3H5AA 4QPOA 3ECHA 5ICFA 3U1KA 2NVQJ 3VSKA 4A93J 2X85A 3O8GA 2DYRH 2EFQA 3NWSA 5D5VB 4FK8A 5TY0A 2O0WA 1AKHA 1YOVB 5H6RA 4U0VA 3D5LA 1IG7A 4LBYA 3OYMA 3K2AA 3J7AY 1NRKA 2QUFA 1FTZA 1VI0A 2XGDA 4KMUX 1O3SA 2EA4A 1HDPA 4A3FJ 1VQOB 4IRGA 3COAC 3BH4A 3H9GA 3I56B 1ETKA 5E1ZB 1E17A 1J9ZA 5IYRA 2FMYA 1POGA 1YIOA 3IAM2 1R4NB 2JJ1A 3P5JA 5LEKA 5K1YA 1Q9SA 4QFMA 5J1RA 1J0RA 1GR1A 3AG1H 4XKWA 3V7CA 4RB2C 4OINF 3LFUA 1TNSA 2CRGA 1SVOA 4WXCA 3ABUA 2VBXA 1HF2A 5H2FC 2HQNA 2MGQA 4WCGA 1YG2A 3RSNA 4NC7A 1HW2A 3OEEA 2LF7A 1YLOA 3P26A 2XF6A 3Q3AA 1WWXA 1A5JA 1LUJB 3DLAA 1O7LA 3DWLE 2EPFA 2X0KA 2DERA 4DJAA 2B7BA 5D8LB 1UELB 3CDLA 2X1CA 2NAZA 3WU0A 4A6DA 5EDNA 1CGPA 1XFOA 3GIRA 4X8IA 2IGOA 1JTYA 3LQRA 2R5ZA 3JW4A 4L18B 3AK5A 5ILSA 3VB2A 3W2AA 3JRGA 4IHWA 1VQ7B 4W1UA 4AU7A 5FA6A 2M2EA 3D0SA 3P9CA 4LLGF 3DPUA 1OFEA 1MMNA 1JTXA 2EWNA 1W7PD 4P1WA 4WWCA 1R5HA 1R1VA 4RLQA 1I7PA 1UFMA 2GQQA 2AXTC 4IZZA 4L5EA 1D8JA 4M6VA 3OMYA 1N08A 3LAPA 2DA3A 4D1QA 2E35A 2BGCA 2COBA 1ETOA 1X1AA 2B7EA 2G0EA 3BROA 5HS8A 1O3RA 1K9MD 4XSXF 3U21A 3OYIA 5D5WB 1OCZH 3N05A 1FC3A 4BE0A 2QBYB 1VQ6I 2FVGA 2YWFA 1XMAA 2W82A 2CQNA 4EM1A 4L5IA 4B4DA 1O8GA 4DK1A 1UHWA 4CGZA 2MFZA 3TO7A 3IL2A 4JQFA 3RZDJ 1APLC 4UVAA 4F55A 3E1SA 3FJOA 2CG4A 5K7FA 3BZKA 2HDNB 2OBRA 3CCSB 2MD5A 3A03A 3ASQA 2HS5A 2GXBA 1Q1VA 1R5ID 1MJ9A 2R7XA 2WC2A 5FFZA 4XOPA 2R3SA 3RY8A 4RDJA 3JCUC 1J75A 4R8HA 4YFOA 4NBQA 1ORKA 2ZBVA 3CD6I 3AL0B 4M74A 2E1NA 3K0LA 1NB9A 4CA0A 3GFIA 1E63A 2WJVA 3V42A 1W5TA 4CCLA 3SFIA 1JA0A 1YLFA 5F64A 1QX4A 1QQ1A 3ZRGA 3J7ZI 3DV8A 5BMZA 3R0AA 2RDPA 5CJ9A 1ETYA 2M4GA 2K27A 4CCJA 1K61A 3R6SA 3GZNB 1ACIA 2VBUA 1X58A 1H88C 2LOOA 3E5QA 1KZHA 3S3MA 2PMHA 1FBQA 1BHEA 2D45A 2D3LA 5KCMA 1Q1HA 2H1KA 2DA5A 1BOAA 5GAGJ 2BSPA 1UMKA 1S29A 3HGGA 6PAXA 3HOZJ 5FL7A 2P7CB 3HXLA 1SD5A 1P4MA 3FKJA 1W5CC 2OZ6A 2OTLI 2KISA 4M9XA 2W00A 3R4KA 3FBNB 4M3GA 5J1UA 4RM3A 5CLSA 3JQPA 2W6IA 5KK1A 3DBLB 1MSFC 1X3UA 3PUFA 4AF6A 4X1EA 4YZAA 3BP8A 4UZUA 5F1JA 2NRAC 2DXIA 3K4KA 4YAWA 1FPQA 2AO9A 2W48A 3SY2A 4CUGA 5LD2C 1UHMA 2EJRA 1VQ5I 2L54A 4ITVA 4ESFA 1MH4A 1QU3A 2B63J 1QFJA 3VSUA 2PMZA 4MEXF 4IKFA 4LIVA 2FNAA 3ZGKA 1E43A 2WY8Q 5DD8A 2PECA 2MSYA 3S1QJ 1TWFJ 1S7AA 2DI3A 3DPTA 3TW6A 1EJ9A 2EV0A 2H8RA 2E7WA 2I5UA 5IP7J 3B6AA 2EZHA 2FBIA 3N97A 2VBVA 3I4PA 2F48A 2GBYA 2RNJA 4HX7A 3GCMA 1CQXA 3ML3A 1HA3A 4U7BA 2W25A 3OZVA 1HKTA 3KP4A 2LLKA 1A8PA 2XGEA 5E79C 3Q6QA 1ON1A 3AG2H 2C4TA 4XONA 2RQQA 3TBIA 1QRBA 1K83J 2FJ1A 2Z33A 4MO7A 1OMIA 1VQNI 4C2MJ 1K5CA 1Z67A 2H94A 1JRGA 4U7DA 2LRDA 4BXFA 5FLMJ 2UV1A 1YX3A 1M1EB 4ZDLA 2KJBA 2JN6A 4M3EA 3OYBA 1TLHB 1XGMA 1XCVA 3OSGA 3SUCA 4OOIA 2DYIA 3H3UA 2WY7Q 4RCYA 4NB5A 1ZELA 4GGGA 2LP0A 1DDGA 2NYXA 3CCLI 4C9YA 2K40A 2EFGA 2EH3A 1JUSA 5M5WJ 4IOCF 3E3VA 5DUKA 2PN6A 3RYRA 1B2RA 1EH6A 1FNCA 4OJ6A 4IQ4A 3SDBA 4IXAA 1RPWA 4KKTA 1FY7A 5FKOA 4GQNA 5IP9J 4OOVA 1WVRA 3BR6A 3WE2A 1ZRDA 3ZBUA 2DOAA 5BQTA 2RGVA 3I55I 1PKVA 5GTIC 4HDUA 5A2QZ 2X1EA 1VTNC 1XN7A 2QENA 3T53B 4XLAA 4R79A 1A36A 3GTGJ 5EEHA 1U6GA 4X0GA 2P3MA 2DT6A 4B48A 3HZJA 1SVMA 3LQEA 3WGIA 2WZPP 2VONA 1R1TA 1OR7A 1TL8A 3H09A 3L1PA 5H6QA 1OCCH 1TNTA 4O3MA 2L7ZA 2QQ8A 2M5SA 2NT9A 1GVDA 5CVJA 1S9HA 1A35A 1IGNA 1O4XA 2LKPA 3TMOA 3OL4A 5F27A 1SKQA 2OCCH 3F9KA 4TMXA 1JJ8C 2V7UA 4PABA 2BPOA 4LFUA 1SD4A 3WNCA 2H8WA 4YZQA 1QCXA 4P55A 4OPWA 2X4HA 3HOTA 1B8IA 3FXJA 4MYUA 1F1ZA 2OYNA 1TWGJ 5E1XA 3DCFA 3BOQA 2WYRA 2C4UA 2W4SA 3EQNA 1OR7C 3Q0WA 2L7MP 4RMNA 3OFNA 3BR1A 5E3LA 2LNBA 1GLNA 1OISA 3CC4I 4OIQF 2DK8A 4V02C 3BY1A 3R60A 3DBHB 4YIFA 4X06A 3BCBA 1G3WA 2BVNA 3DBRB 2ZMEA 4DYCA 2XT4A 1T6SA 3QQAA 3V7RA 1QRYA 3QYFA 3T56B 2IPQX 5GTHC 2WB1A 3IWFA 4E7ZA 2ZNYA 1HCRA 2KHMA 2P6TA 1MNEA 1X1DA 2HVQA 1PXZA 3GLXA 1WSRA 2DT5A 3V4GA 4Y13A 3D5RC 2HTSA 1Q7YD 1FT9A 2K5CA 1OQYA 3ULQB 4A12A 3M4OJ 2YU9J 4Q48A 5DV5A 2HVRA 2VXDA 1GXQA 2PFBA 1HSJA 3KEQA 2F5CA 2J5PA 4MQVA 4Q47A 3ESWB 3WYAA 1EA3A 1QA6A 3IRRA
chains in the Genus database with same CATH topology
1IRXA 2WAFA 3DEEA 4BEHA 2CW7A 4FETA 4BQQA 2KPMA 4URRA 4RM2A 3LSGA 4PFOA 2DT7B 4B44A 4N4OB 3W2VA 2R7TA 1LDKB 3OAAA 4B3XA 3K10A 1TZLA 4W8TA 3OIQA 2F1MA 5KHDA 4LITA 2JUGA 2VBKA 3PUBA 2WAEA 2WJYA 3BCDA 4XKVA 1HZEA 2QY1A 4Z03A 3K4MA 1Z21A 2V7FA 3ZR8X 2QX3A 4BDZA 1D1BA 1H8HA 4HNTA 4Z1MA 2LBFB 3GVKA 1N78A 5C1CA 1LKXA 2PJRB 1W0JA 4C2TA 3QYBA 3GVLA 1KTWA 1O88A 1I8DA 1OOCA 1BR4A 4FASD 4OJOA 5AMVA 2M3AA 1O8MA 4XL9A 3LMMA 4YEJA 3UNGC 2KZVA 2NSPA 3VYSB 2VQCA 4XOTA 1E3XA 4XLHA 3OYAA 5FROA 3VYUB 4IX7A 1DBGA 1NHCA 1ERDA 4HSRA 4YXWA 1V0FA 5CPRB 2L5QA 1D0YA 4PJLA 4AVZA 4D9JA 4E4HA 1V0EA 3OYNA 2VQLA 1W0KA 2M4KA 4E7HA 2OV7A 1YX5A 5HLTA 3C2GA 1PLUA 2V6EA 3E0JB 3A3BA 3CZ6A 3OOUA 1IA5A 1X4PA 1D0XA 4BJ6C 4BEHB 2NSTA 2Z8GA 1SFKA 3DKXA 1X1CA 1JTAA 4E7SA 4E7KA 2QXZA 4YRVA 1VBLA 2VKDA 2IS6A 1UG0A 3H35A 3OYCA 1MMDA 2R9VA 4TKOB 2EWEA 1UD2A 3SYTA 2IGKA 1SAUA 2CS3A 4PJMA 4F52A 2HLDA 1H8EA 3A3GA 4XKBA 4ASUA 3ZCOA 4ANJA 1COWA 3LMWA 1WJBA 4BJTA 2ZZEA 2E5ZA 3FDYA 1X1BA 4HNUA 1UD8A 2ZFUA 4DGWB 2IGNA 4IQJA 2CUZA 2PYHA 4BU2A 1T95A 1PYVA 4HEA2 2DIEA 2XNDA 3PFYA 3NE5B 2GJRA 3DTEA 3K4JA 4CH7A 1BR2A 2K9MA 3OYEA 3LNNA 1IB4A 2L9SA 3OYLA 1MMGA 2RNGA 2GJKA 1KCCA 3BG6A 1HG8A 4E7LA 3GQBA 3VYTB 2I8DA 3CJRB 1WP6A 1HVXA 3T51B 1VLYA 4JOMA 2ZTNA 3K70D 4B3FX 4XLCA 4LG3A 2ZTGA 2P0WA 1W9XA 3IUOA 2X8KA 3HPGA 2X6XA 1BN8A 2V7QA 2Y0SA 2Z6BD 5CQEA 2IS4A 2JIZA 4G7XA 3D5SC 2JVHA 2LY2A 2Z16A 3DU5A 1IDKA 2V4JC 2KDOA 2CFOA 2WA0A 3AL0C 4E0FA 2BW3A 4DBQA 2Z1DA 3A4CA 1WTHD 3VDXA 1G8XA 3K4LA 4II2A 4B47A 2GJPA 2ZZQA 2ZZGA 1UD3A 4L8JA 2UVEA 1D0ZA 1X0CA 1QHHD 4PUSA 1RU4A 4HSTA 3RQ4A 1BMFA 2XZOA 4NK6A 2GK6A 2UUZA 3GBGA 1BOBA 4PFPA 4DNRB 2AQFA 3EPZA 4ZJZA 2Q2EB 2DJIA 3HOSA 2ZXIA 1BR1A 2M7AA 3S32A 1JI8A 1O8HA 1WJEA 1TT0A 3OW7A 2HQAA 2MABA 4XN0A 1W36D 3H5RA 1E1QA 2V26A 2XDVA 4Y3OA 1N77A 2L2OA 3GQAA 3ZIAA 2IQ7A 3ZPPA 3OYGA 4HG2A 4C30A 2CH0A 3OIPA 4II3A 1PE9A 4TT3A 3VYRB 3PSIA 2E1BA 1I18A 2NT6A 4BS9A 3OYDA 2QKLB 1DQUA 4MLOA 2IS2A 2XOKA 1YE9A 2MC4A 4KKUA 2R7RA 1OLTA 4TSFA 3LSMA 3UW0A 3BLYA 3EUAA 3QYEA 2LC2A 3HKZA 4EATA 4LIUA 5HVQC 3G05A 4ZTFA 4B3GA 4F3QA 3BCAA 3SZGA 4F91B 2KVOA 1QJVA 1BLIA 4OAZA 3H94A 2E60A 1KCDA 3OEHA 2LREA 2KMUA 2ZSHB 4XMYA 2BW3B 2L7KA 2MYSA 3HG9A 3ONQA 2F5VA 1WJCA 3K4BA 3GQ7A 1UD5A 4BL0B 3HC7A 5CQGA 2K9LA 2V4DA 3A35A 5FRNA 2INUA 3DTIA 2UWMA 4N4NB 1LVKA 1UD4A 2LY1A 5CDFA 2HNHA 3S93A 1GQ8A 2KLOA 3BCFA 2QE7A 1EE6A 2O1DA 3IAS2 4J00A 3H5AA 4QPOA 3VSKA 1WJDA 2VJJA 2X85A 3OYHA 4J01A 3NWSA 2O0WA 3H9JA 5JHFA 3FHNA 4PJJA 4MR0A 3D5LA 1EFRA 1MW7A 2OC6A 2VL8A 3OYMA 3J7AY 2R7QA 2ZZFA 4XD7A 3JURA 1NRKA 5CKTA 2VJIA 2VB6A 1V5FA 3DDYA 1SKYB 4PJNA 2BVLA 4OJLA 3WQZA 3BH4A 3H9GA 2XZPA 2GOXB 2VBMA 3IAM2 4KKSA 2VJ5A 2VASA 3B4NA 5HOOA 2JJ1A 3FY3A 2VQHA 3BG7A 4KISA 2O5RA 3NWTA 4XKWA 3L2UA 3VR6A 2XGJA 3EUHC 3LFUA 3B90A 3L2RA 4HRIA 3H0DA 2HZDA 3KX2A 3RSNA 4NC7A 3OEEA 2NTPA 2QKMB 2O17A 2XF6A 2FUG2 1Z7LA 2XC7A 1K6YA 3PNVA 4NNJA 3DLAA 1D1CA 1P9QC 3A1YA 3ZQQA 3DWLE 4U87A 3PJRA 3M1CA 3FBIB 4YELA 3A2KA 4DJAA 1XG2A 1UELB 2X1CA 1CZFA 4HPQA 3SEQA 2A5WA 2IGOA 3OR2C 2KL4A 3W2AA 2RREA 4AU7A 2E5NA 1Y56A 1RMGA 3DPUA 3DTKA 1MMNA 2W6JA 4P1WA 2R7UA 3CF2A 2LH9A 4XQFA 4KITB 3C2HA 4XN3A 4RLQA 2WSSA 1V5EA 1X4OA 2CW8A 3KEYA 3OOCA 1NG7A 5KNLA 5FRMA 4IZZA 2R7OA 2NZMA 3LSIA 4XORA 3OMYA 2M0MA 2CV2A 2R7VA 4D1QA 4DK0A 1Z3XA 2CV0A 1X1AA 3MKWB 2X53S 3U21A 3RCOA 3OYIA 3N05A 4BE0A 1VJSA 3GQ8A 5HNHA 2X51A 2W82A 1MMAA 1BPLA 2WPDA 1WMRA 1O8GA 4E7JA 4DK1A 4Y4RA 2MFZA 2Z2SB 4GRIA 4JQFA 4CCKA 5HKKA 1OFLA 2O0VA 4F55A 2KRHA 3E1SA 3VWBA 4CCMA 2JDIA 2GK7A 1IDJA 3OS1A 2HPMA 1FMWA 3ZPNA 1AA7A 3S3NA 2F43A 2R7XA 4CCNA 4XOPA 3H9QA 4E6KG 1HA8A 5IK2A 3HUGB 3OS2A 2HDWA 1AIRA 1O8DA 1OGOX 5HNFA 1WPCA 2NTQA 2E1MC 3CP2A 2XAUA 4Y33A 3AL0B 5LFAA 1DGWY 3OR1C 2VPLA 3VSTA 3K70C 4CA0A 3W3CA 3FPPA 3TL4X 2HU9A 2WJVA 3V42A 4CCLA 1G59A 3VMWA 3PNYA 3ZRGA 3I3LA 4H4KC 4OZZA 2OUMA 2M4GA 2HPIA 4CCJA 1VF7A 1O8FA 2LZJA 2XF7A 2LOOA 4NC8A 3S3MA 1OFMA 4BQNA 1FMVA 1BHEA 2R4GA 4U4BA 2F6CA 3OS0A 1UD6A 3HAGA 3GQ9A 2D3LA 1Z3YA 4C2LA 4DIQA 1WJFA 5KCMA 4OJPA 2BSPA 5C1EA 1KONA 2VLAA 4ZC3A 2V9KA 4XM3A 3L2WA 3WWGA 3AKZA 3L2VA 5FL7A 1WJ5A 3S8PA 3HXLA 3FKJA 4Z05A 4QPQA 4CCOA 3OPOA 3EQOA 2VIXA 3B8YA 2JA2A 2IS1A 2W00A 3FBNB 1E1RA 4RM3A 1X19A 2W6IA 2VKHA 3QOEA 2VQGA 1UAAA 4W8QA 2BOLA 4PSXA 1W36C 4YZAA 4UZUA 2WAQA 1V5GA 3MKZA 3OY9A 2DXIA 3K4KA 2F4IA 4KJZA 2O04A 4YZ0A 4P5OA 4CUGA 5LD2C 3LSKA 4BJ5C 3G2BA 3M8JA 1QU3A 1QHGA 4ITVA 2HVSA 1DBOA 2INVA 3VSVA 3VSUA 3K4NA 1R6RA 2PMZA 4IKFA 4LIVA 2DCEA 1O8LA 4ZDOA 2W7NA 2A6TA 4BUPA 3UR3C 3ZGKA 3S3OA 2WY8Q 1E43A 3KEWA 2PECA 1PJRA 5DN6A 2VJ4A 4EW9A 3DPLC 4NUBA 3OYFA 3QODA 3DPTA 4DBRA 1KMHA 1OGMX 4ZDPA 3RPUD 4BDYA 2WADA 1WFXA 4U49A 2X6WA 2ZXHA 3K6GA 2M7BA 3HL2A 1MABA 2CK3A 2ODLA 3LSHA 4OJ5A 2L9NA 2XSJC 1O8KA 2VXZA 1E79A 4U7BA 4CZCA 4Z06A 4BGDA 1OHHA 2VBEA 1DP3A 1T0FC 3CJQB 4XONA 2RQQA 3TBIA 4W8SA 3DKYA 3OYKA 2JSPA 3CMMA 3IP4B 3ZSCA 2K3PA 3VSLA 1K5CA 1MNDA 1JRGA 4P22A 2LRDA 4BXFA 3OYBA 2UV1A 1YX3A 4ZDLA 1OB0A 4BQOA 4F93B 4DOZA 3SUCA 3EUKL 2WY7Q 2V31A 4E7IA 3OYJA 1ZELA 3BC9A 4FXUA 2D3NA 3KRGA 4G7WA 4C9YA 2JJ2A 3VMVA 2IXSA 4OZYA 1WJAA 3FKSA 4XLEA 4I84A 4BE1A 2BVMA 4OJ6A 4IQ4A 3SDBA 2Q1ZB 4KKTA 1E3ZA 2MD0A 4HWVA 4NQWB 4B43A 4GQNA 4PK4A 4OAYA 2DOAA 2KP6A 4G6IA 1FX0A 1PKVA 1D1AA 2X1EA 4JMQA 2CUJA 3T53B 4XLAA 4R79A 1O8JA 4X0GA 3HPHA 3PL8A 1NBMA 4F92B 1H80A 2DT6A 4B48A 2IGMA 5TGTA 3MD2A 1NG6A 2PYGA 4HIZA 2WZPP 1O8EA 1K28D 1E0EA 4CSWA 3AFHA 4PSWA 2M5SA 3SEZA 2NT9A 2W1OA 3PSFA 1S9HA 4C2UA 1DGRM 3TMOA 3OL4A 4XLFA 3CP8A 3F9KA 4XR6A 4OWRB 4BACA 3GVJA 4MXNA 4YZQA 1QCXA 3MMYB 2JVGA 4PMHA 3T9GA 3OL3A 3PNTA 3L2QA 3HOTA 2ZSIB 3BC8A 1N75A 3OE7A 1Y6IA 3RTRA 3I9V2 4G6TB 2X1DA 1O8IA 1VZ0A 4ZYAA 2UVFA 2LYCA 3JU4A 3DQVC 2CV1A 2W4SA 3ZXSA 4XKCA 3EQNA 1OR7C 2WBMA 4RMNA 2NOJB 4KT6A 4AYBA 2LBFA 2R7WA 4BE2A 1T5EA 1GLNA 3OFNA 4ZTJA 1RWRA 4W8RA 3K4CA 2PJRA 3W2WA 3KYLA 2X3HA 3BCBA 3DU6A 2XF5A 4YZXA 2ELJA 3QYFA 3T56B 2WB1A 2X6YA 4E7ZA 1KZLA 2KHMA 3OWTA 2CMPA 3LL7A 1MNEA 1X1DA 2HVQA 2KQRA 1PXZA 3D5RC 1LFPA 1U0JA 2K5CA 1J09A 2V1NA 4RLFA 2HVRA 2KRCA 2R7SA 2E1MB 2VXDA 2NTBA 4XNFA 2AQEA 3GRHA 3MKYB 2XZLA 3H5NA 4NK8A 2LG4A 3CESA 1EA3A 2GOMA 4DNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZF A;  2ODL A;  2UVE A;  4OJ5 A;  1X0C A;  4URR A;  1O8K A;  1RU4 A;  4Z06 A;  4NK6 A;  1RMG A;  2VBE A;  4W8T A;  4XON A;  4W8S A;  4XQF A;  4XN3 A;  1O8H A;  3ZSC A;  2VBK A;  1K5C A;  4XKV A;  2NZM A;  4XN0 A;  2QY1 A;  4Z03 A;  1JRG A;  4XOR A;  2QX3 A;  3GQA A;  2IQ7 A;  3ZPP A;  5C1C A;  3SUC A;  1PE9 A;  3GQ8 A;  3UW0 A;  1OOC A;  1O88 A;  1KTW A;  2NT6 A;  5AMV A;  1WMR A;  4OJO A;  1O8G A;  1O8M A;  3KRG A;  4XL9 A;  1OFL A;  3VMV A;  4YEJ A;  2O0V A;  2NSP A;  4OZY A;  4XLE A;  4I84 A;  4XOT A;  4XLH A;  4OJ6 A;  1NHC A;  1DBG A;  1IDJ A;  1QJV A;  4HWV A;  4AVZ A;  4XOP A;  1KCD A;  1AIR A;  1OGO X;  1O8D A;  4XMY A;  2NTQ A;  1PLU A;  1O8J A;  3GQ7 A;  4XLA A;  1IA5 A;  1H80 A;  3VST A;  2NST A;  2Z8G A;  2PYG A;  2INU A;  1JTA A;  1O8E A;  2QXZ A;  3VMW A;  1VBL A;  1GQ8 A;  2EWE A;  4OZZ A;  1EE6 A;  2NT9 A;  1O8F A;  2O1D A;  1OFM A;  4XLF A;  4XR6 A;  1BHE A;  4U4B A;  3GQ9 A;  3LMW A;  4C2L A;  2VJJ A;  2X85 A;  4MXN A;  4OJP A;  4YZQ A;  2BSP A;  1QCX A;  5C1E A;  2O0W A;  3T9G A;  4XM3 A;  4PMH A;  3WWG A;  4MR0 A;  3JUR A;  4Z05 A;  2PYH A;  2VJI A;  1O8I A;  2UVF A;  3EQO A;  3B8Y A;  4OJL A;  3EQN A;  1RWR A;  4W8R A;  1IB4 A;  4W8Q A;  2VBM A;  4YZA A;  1KCC A;  3B4N A;  1HG8 A;  2X3H A;  4YZX A;  3FY3 A;  2O04 A;  4YZ0 A;  2X6Y A;  4XKW A;  2INV A;  3VSU A;  4XLC A;  1DBO A;  3B90 A;  1PXZ A;  3VSV A;  1O8L A;  2O17 A;  2X6X A;  1BN8 A;  2NTP A;  2PEC A;  4EW9 A;  1IDK A;  2NTB A;  4XNF A;  3GRH A;  1OGM X;  4YEL A;  4U49 A;  4NK8 A;  2X6W A;  1XG2 A; 
#chains in the Genus database with same CATH topology
 3DEE A;  2OQG A;  4BQQ A;  4URR A;  2KPM A;  1SFX A;  2V1D A;  3ZMU A;  1GXP A;  3S16 J;  4I76 A;  1IN5 A;  2LTP A;  2R7D A;  4PFO A;  3GVA A;  3GW2 A;  2R7T A;  2DOF A;  3OAA A;  3KP7 A;  4B3X A;  2GXA A;  1QFY A;  4P26 A;  4LMY A;  3A8K A;  1YJW B;  4U0Y A;  2EIX A;  4G9Y A;  4I99 C;  1ODD A;  2K85 A;  2WAE A;  5ICE A;  4K1X A;  1ZR4 A;  1LJ9 A;  1Z21 A;  1WI9 A;  2V7F A;  4ZZD A;  1H8H A;  4A0X A;  2HYG D;  4BBR J;  1SAN A;  1BA5 A;  1LKX A;  2NNY A;  1W0J A;  4C2T A;  3QYB A;  2DOG A;  1O88 A;  2LSO A;  3M9A A;  5DEQ A;  1BR4 A;  2M8G X;  4FAS D;  4OJO A;  2M3A A;  2PEX A;  2ZME B;  1PP7 U;  1MDM A;  5IY5 H;  1O8M A;  4XL9 A;  1EXM A;  3MEX A;  4RDL A;  2B9S A;  4F7Z A;  3VYS B;  4XOT A;  1SD7 A;  3FIW A;  3OSF A;  3U6K A;  1DBG A;  2QZ8 A;  1ERD A;  1VQ6 B;  5CPR B;  1BC8 C;  2Y69 H;  3P27 A;  4PJL A;  1W34 A;  1R1U A;  3TP0 A;  3OYN A;  2JK3 A;  3S1R J;  1KTV A;  2IAI A;  4E7H A;  2DCU A;  4FT8 A;  2C78 A;  4EGZ A;  1IRG A;  1YX5 A;  4UHT A;  2DQR A;  3PO3 J;  2V6E A;  1X2M A;  4WXD A;  3A3B A;  3FXK A;  2HKX A;  1X4P A;  3LA3 A;  2RAE A;  2CQX A;  2NST A;  4A2U A;  3A02 A;  2DPU A;  3DKX A;  4DQL A;  1X1C A;  5HDG A;  4E7S A;  1HKS A;  2QXZ A;  2IS6 A;  2LFB A;  3I4N J;  1MMD A;  1S6L A;  1UD2 A;  1QRC A;  2IGK A;  4ZV4 A;  3KYC B;  1FOK A;  3CD6 B;  2Z9O A;  2P5K A;  4PJM A;  4F52 A;  4K2E A;  5IOZ A;  2HLD A;  2F4N A;  3A3G A;  4XKB A;  3CCV I;  1CNF A;  3BQJ A;  4ANJ A;  1BJK A;  1COW A;  1OCR H;  3GLL A;  2F5D A;  1FRN A;  1WJB A;  5HLH A;  3SYJ A;  1FSH A;  1HQC A;  1X2N A;  2Q0O A;  2IGN A;  3ERM A;  3LSR A;  1T95 A;  5KSW B;  4AUX A;  1WH7 A;  4HA8 A;  4HEA 2;  2DIE A;  2XND A;  3WNB A;  3NE5 B;  4B4C A;  4EJV A;  1W1W E;  4G6D A;  1MDM B;  1LEB A;  4AID A;  2XSD C;  2ZNZ A;  1BI2 A;  1RES A;  4N0B A;  3CC7 I;  1K4Z A;  2ELH A;  3W5V A;  2GJK A;  2QTL A;  1D1N A;  4A5N A;  1YHQ B;  2XB5 A;  2ZXW H;  2OTL B;  4PC1 A;  3ZMD A;  1HVX A;  1VLY A;  5D6E A;  5FO1 A;  5EJC A;  2EIL H;  3IUO A;  3BDD A;  3SJP A;  2Y0S A;  1SMT A;  1IDK A;  3DU5 A;  2V4J C;  2KDO A;  2WA0 A;  4RJL A;  4YAL A;  4D5F A;  1VQ5 B;  1JHF A;  2Z1D A;  3VDX A;  4II2 A;  2D1V A;  2ZZQ A;  1UD3 A;  3WTT C;  2BXY A;  5BS6 A;  1D0Z A;  1X0C A;  1QHH D;  4ACB A;  4Z4Z A;  3BR5 A;  3JTG A;  3GTO J;  2Y30 A;  3G1M A;  1KRH A;  2XZO A;  3WY9 A;  1FNM A;  2XT2 A;  4PFP A;  4L0Y B;  4ZJZ A;  2CW0 F;  1Y0R A;  1OYY A;  2L9R A;  2KIM A;  2RV8 A;  2M7A A;  1AU7 A;  1EFU A;  3OW7 A;  3PUN A;  4EM2 A;  5J3L A;  3ZMZ A;  2HQA A;  2XDV A;  5LRS A;  2EIM H;  4A6E A;  3ASR A;  1ZGJ A;  3GQA A;  1KU2 A;  1R7J A;  3ZIA A;  1D8T A;  3FPK A;  1QPM A;  4II3 A;  3MKL A;  2W24 A;  3K2Z A;  3E6C C;  3WG7 H;  5C4J J;  5JLW A;  3HOY J;  2FOK A;  3OYD A;  4RDK A;  2XOK A;  1VQN B;  3K1M A;  1YE9 A;  2Y0M A;  1IV6 A;  5HOD A;  2HOT A;  3BJA A;  3SLN A;  3FMQ A;  2M1B A;  2GM4 A;  3QYE A;  1K8F A;  3WTU C;  1FWZ A;  4QVJ A;  4AC9 A;  4EJW A;  4TN1 A;  3MZY A;  1E3H A;  3BCA A;  2VKV A;  3PIP F;  2HWV A;  1BLI A;  2VT2 A;  4IRI A;  4NCN A;  3HBL A;  4DYQ A;  2E60 A;  2P81 A;  3H94 A;  2KMU A;  3CCL B;  2ZSH B;  1P92 A;  3KP3 A;  4UY8 I;  4RM0 A;  2L7K A;  4RS8 A;  3ONQ A;  4Y7N J;  3BY2 A;  1NDH A;  1C0W A;  3K4B A;  2O9L A;  4WWV A;  3HC7 A;  2FBK A;  2ZJP F;  3JQR A;  2E71 A;  2I10 A;  3CCS I;  2K9L A;  3Q3S A;  2V4D A;  4LC0 A;  4OOX A;  2VFM A;  2O61 A;  1MBK A;  3ZMV A;  3BH6 B;  1GQ8 A;  3FXO A;  4Z4R A;  3VEP A;  4KA4 A;  3I55 B;  1ETX A;  5C44 J;  3LFK A;  2HQR A;  1F36 A;  1Z91 A;  4P1V A;  2VUM J;  5FKL A;  1HKQ A;  2VJJ A;  4Z6Y A;  5IYD J;  4LLL A;  5JFR A;  2EV6 A;  3BNW A;  2VKE A;  4PJJ A;  4MR0 A;  3X2Q H;  1R23 A;  3C18 A;  3CLO A;  3SZE A;  3KL9 A;  2VB6 A;  2BVL A;  2OBS A;  2XHK A;  3NAR A;  3TDZ C;  2XTY A;  1XGO A;  3DF8 A;  5A88 A;  3GUD A;  1OJL A;  1XDU A;  2HQ5 A;  3H1C A;  5EG0 A;  5HXB A;  2HEO A;  2GOX B;  5IT9 K;  5FFX A;  4KKS A;  2VJ5 A;  4UUS A;  2R7F A;  1RI7 A;  2VQH A;  1QGZ A;  2WWY A;  1R5N A;  3L2U A;  2KIQ A;  2LMD A;  1NK2 P;  2DAO A;  2NVT J;  1JA1 A;  3EUH C;  4M3F A;  3B90 A;  4RCZ A;  4YAO A;  3LSP A;  3L2R A;  4HRI A;  3CC4 B;  3MCA A;  4UXN A;  2H27 A;  2HZD A;  4L9J A;  1OKR A;  4JX4 A;  2QKM B;  4V2F A;  1EH7 A;  1E3P A;  1Z7L A;  2FUG 2;  2XC7 A;  3PNV A;  3VNU A;  4NNJ A;  3ZQF A;  1D5V A;  4X7F A;  3KET A;  1OB5 A;  4U87 A;  3CCY A;  3M1C A;  4YEL A;  3A2K A;  1XGN A;  2X9D A;  4CXF A;  5BPI A;  1XG2 A;  1AWC A;  4HPQ A;  5FKK A;  5HZA A;  3SEQ A;  2DK5 A;  3OR2 C;  3W2E A;  2F4M B;  1BBY A;  1MBJ A;  2E7X A;  1BX0 A;  1ZTR A;  1P7I A;  2E5N A;  4P9F A;  4UUT A;  1IHM A;  3DTK A;  1N0V C;  1MJB A;  4M6Y A;  5CVR A;  1W4M A;  4ENN A;  4IHT A;  2EIK H;  2PLF A;  3T5X A;  3TDU C;  2DOD A;  1BIA A;  3BTI A;  3P9K A;  4XN3 A;  4XQF A;  4KIT B;  3S2H J;  2MW8 A;  2CW8 A;  3KEY A;  2WSS A;  5KNL A;  5FRM A;  2O03 A;  2R7O A;  2JRM A;  1QUF A;  4EV0 A;  2VOO A;  2CV2 A;  1A6Q A;  4QV2 A;  1XCB A;  4DK0 A;  2CV0 A;  1AHD P;  2XIG A;  3ABL H;  1UST A;  2BY0 A;  4YAF A;  3ELK A;  5EG0 B;  5DNS A;  1VJS A;  3GQ8 A;  3WBK A;  2PX9 A;  5HNH A;  3LOC A;  2F3L A;  3M3Y J;  1BPL A;  5IOY A;  4UUS B;  1IB0 A;  2ZL5 A;  4AIH A;  4LLN A;  1WMR A;  3M7G A;  3L2C A;  1DDN A;  4GRI A;  4CCK A;  1FP2 A;  2VBY A;  1J7K A;  5M5Y J;  1WDT A;  3J81 k;  3A0H C;  1Z05 A;  3O2P E;  1RNL A;  3OV8 A;  1BI3 A;  3RI4 A;  1XMX A;  3CTA A;  3I54 A;  1T2K A;  2HPM A;  3BR2 A;  1FMW A;  2CUE A;  2XUB A;  1AA7 A;  5CVU A;  4GFB A;  3S3N A;  4C3H J;  3WTV C;  4E6K G;  5IK2 A;  3OS2 A;  2VC0 A;  5E18 F;  2TRT A;  2E1M C;  1WPC A;  1PUF A;  1XSX A;  1YX2 A;  2W84 A;  2XAU A;  4Y33 A;  3HSF A;  2G7U A;  3AST A;  4QIW N;  3K70 C;  3GTK J;  3FPP A;  1F9N A;  2JUC A;  1N06 A;  1I50 J;  2HZT A;  3VMW A;  2M9H A;  3PNY A;  1L3L A;  2XGX A;  1QUE A;  4AC0 A;  1MNM C;  2QSH X;  4U9U A;  2QEX I;  3GFJ A;  1FX7 A;  2HPI A;  4Y17 A;  5B1B H;  3LAJ A;  1Z9C A;  1UJ8 A;  2LZJ A;  4HZF A;  4XSZ F;  4WX9 A;  3H9N A;  2A5Y B;  2HOA A;  3IRQ A;  2DA1 A;  2VNJ A;  2F6C A;  4MQ9 F;  3OS0 A;  4J19 A;  1BL0 A;  1WJF A;  1HW1 A;  4JX6 A;  4I0A A;  4RLZ A;  3FIS A;  4ZC3 A;  1IV8 A;  3L2W A;  2CC2 A;  3L2V A;  4OPV A;  1ZM3 A;  5DCM A;  3RQI A;  5ILV A;  2Q6L A;  1R71 A;  4L0Z B;  2DMU A;  3OPO A;  1KA8 A;  2XTX A;  2VIX A;  3EQO A;  1KU3 A;  2FX0 A;  2IS1 A;  1TYV A;  2Y9Z A;  4TMT A;  3CCV B;  3H3V K;  2KIF A;  3BWG A;  1X19 A;  1SC7 A;  3AVT A;  3ASS A;  2VKH A;  2HI3 A;  2ZJ2 A;  3PA1 A;  4PDK A;  4W8Q A;  4PSX A;  3CCQ I;  3FKI J;  5KAF C;  2WAQ A;  1XTA A;  3UKG A;  3Q0U A;  1J9I A;  4KJZ A;  3HGY A;  4WXH A;  2K02 A;  2O04 A;  3E6M A;  3FMR A;  3LSK A;  3HOX J;  2STT A;  1FNB A;  1OFD A;  2TDX A;  2INV A;  2HVS A;  1DBO A;  2DY1 A;  4DNC A;  3CJN A;  2BV3 A;  3HOV J;  2VOP A;  2M8E A;  2JN9 A;  3CC7 B;  2W7N A;  4BUP A;  3LJY A;  3JQQ A;  3UR3 C;  3S3O A;  3KEW A;  4EW9 A;  2FOW A;  2VJ4 A;  2E34 A;  1RET A;  3H0G J;  3OYF A;  1OGM X;  3DEW A;  3TW7 A;  5D4R A;  3RPU D;  4BDY A;  4U49 A;  1WFX A;  5LRR A;  2X6W A;  2ZXH A;  1YYV A;  3K6G A;  3HL2 A;  2ODL A;  2CK3 A;  3JTH A;  4OJ5 A;  2X0L A;  2L9N A;  1Z77 A;  1WQ2 A;  2K4B A;  1E79 A;  1ZRE A;  4C43 A;  2IJL A;  4CZC A;  4Z06 A;  1WGX A;  2I1L A;  1SEU A;  1B72 A;  3W5H A;  3ZBT A;  1T0F C;  3DXJ F;  4W8S A;  1EP3 B;  2JSP A;  5DCM B;  3CMM A;  5B6I A;  4MFD A;  3ZSC A;  4ZYG A;  2QMU A;  1BM9 A;  2NVY J;  2FML A;  4KFC A;  1G3S A;  1MND A;  1TLL A;  2QWW A;  4UVB A;  2LVS A;  2WR8 A;  4M6X A;  1FYK A;  3VNV A;  1GT0 C;  2JRT A;  2DA2 A;  3BZ6 A;  3ISP A;  2JA6 J;  4P6V F;  3JRH A;  3DFG A;  2NVU B;  1I6X A;  3OYJ A;  3IC7 A;  4FXU A;  4LBZ A;  1YJW I;  2D3N A;  2G7H A;  4KIB A;  3KRG A;  4PCQ A;  4P6Y A;  4F7D A;  2TCT A;  3VMV A;  2IXS A;  5E1W A;  1WJA A;  1FBU A;  1Z6R A;  4BE1 A;  3SKB A;  4S0H B;  2D9R A;  3KP5 A;  2Q1Z B;  5EEA A;  4HDV A;  4FWT A;  1H8A C;  1IN8 A;  3W2G A;  4PK4 A;  1CQT A;  1AKH B;  2CU7 A;  4OAY A;  1KK2 A;  2CWE A;  4X7C A;  2KP6 A;  4KN4 X;  3BTJ A;  3KE2 A;  9ANT A;  1GVJ A;  4D0P A;  2K3F A;  1QZY A;  1LDJ A;  4Y15 A;  2QDX A;  1WH5 A;  5DDG A;  1NBM A;  5KAI C;  5IYW A;  2IGM A;  5TGT A;  3MD2 A;  2PYG A;  4IHV A;  1I39 A;  2BM4 A;  1RUN A;  2PJP A;  3E20 A;  1UG2 A;  4XBF A;  3AFH A;  1V55 H;  4V2G A;  1B72 B;  3SEZ A;  4HE5 A;  4KNY A;  3PSF A;  3AVU A;  1DGR M;  5J4V A;  2JSC A;  3MWM A;  4XLF A;  5ICG A;  3HRT A;  5L3F A;  5FLV A;  2OF7 A;  4OWR B;  1ETQ A;  4IW3 B;  4EM0 B;  2J8I A;  1J59 A;  3I58 A;  1KD1 D;  1WOR A;  4PMH A;  3CCM I;  2V7T A;  3V7A A;  3BC8 A;  4OPO A;  2IA1 A;  1BI0 A;  1Y6I A;  3DEU A;  5LBQ A;  5HLG A;  4S04 A;  3OE7 A;  2X1D A;  4RAG A;  3J81 K;  1ZGW A;  2VE8 A;  3AVX A;  1S8N A;  1GVH A;  1BX1 A;  4XKC A;  1QFZ A;  1G6N A;  1VQM I;  2M5W A;  1YJN B;  2CQQ A;  2NOJ B;  2EK5 A;  1T5E A;  2IT0 A;  3W6K B;  1RWR A;  4ZTJ A;  2R5Z B;  1BIB A;  3KCC A;  4JRA C;  5DS9 A;  3W2W A;  1T6X A;  3KYL A;  1T33 A;  1MJA A;  2X3H A;  2DMT A;  3DU6 A;  4RAF A;  3FM5 A;  5IT9 Z;  2L7F P;  3PVD A;  4AIK A;  1KZL A;  1PVE A;  1QVU A;  2L01 A;  1W2B B;  3JR9 A;  1LVA A;  2IRF G;  3GXO A;  1VQP I;  2R5Y A;  1LFP A;  3GFM A;  3K9T A;  4HW0 A;  3NRV A;  2HDC A;  1J09 A;  1Y8R B;  5KW9 A;  2NTB A;  3I59 A;  3RJP A;  1YHQ I;  4XNF A;  2J8K A;  2XAF A;  2BXZ A;  2H6C A;  3MKY B;  5DM7 F;  1STZ A;  4DW6 A;  1XG1 A;  4U88 A;  2WV1 A;  3KLN A;  3CES A;  4HX4 A;  4WK8 F;  5C4X J;  1MBF A;  2XAQ A;  1ZG1 A;  1IRX A;  2WAF A;  1N0U A;  1YTY A;  2CW7 A;  2DA4 A;  2OD5 A;  4FET A;  2YUH A;  1ZAO A;  3CCR I;  2D5V A;  4MNU A;  4ZYE A;  2EZK A;  4N4O B;  1PUE E;  3W2V A;  1LDK B;  4Z4T A;  3K10 A;  3ZZU A;  1TZL A;  3I5U A;  4KIC A;  2LY9 A;  3S2W A;  5F08 A;  4LG0 A;  3VFZ A;  4EVI A;  4XKV A;  3CCU I;  1JKQ C;  1VQ4 B;  2V9P A;  4IL6 C;  3R0J A;  3G1L A;  2A69 F;  2HOS A;  4OPS A;  4Z1M A;  1KQS B;  3GVK A;  4UNO A;  2VPR A;  3GVL A;  1ELO A;  3UW0 A;  1I8D A;  3G6E I;  2ECB A;  2BY2 A;  2MLK A;  3BG5 A;  4CYC A;  4AYB N;  1T08 B;  1ZGA A;  3H92 A;  3LMM A;  1TT5 B;  2KZV A;  4CQJ A;  2NSP A;  1TYU A;  1E3X A;  2UXN A;  3OYA A;  5FRO A;  2AXL A;  2R93 J;  3I4M J;  1V0F A;  3T8R A;  1D0Y A;  4D9J A;  2XPV A;  3QU3 A;  2ZBK A;  3VPR A;  4NDL A;  1XMK A;  1V0E A;  1WOO A;  1W0K A;  1XC5 A;  4ZZL A;  3HIF A;  5HLT A;  1I1S A;  3E0J B;  2FEZ A;  1AMO A;  3CZ6 A;  4QUZ A;  1U2W A;  1J2X A;  3GYH X;  1S7E A;  2JQ7 A;  4Q7J B;  1YW9 A;  2BM5 A;  4G7O F;  3H3Z A;  1K79 A;  4YRV A;  1W0T A;  3TP3 A;  1UG0 A;  2XRL A;  1JT6 A;  2R9V A;  4TKO B;  5FIU A;  2JA7 J;  1IUY A;  3QFT A;  2CS3 A;  5LGT A;  2X3U A;  3BPX A;  2ZJR F;  5JR3 A;  4CO8 A;  3LWF A;  2E5Z A;  2HR3 A;  2MC3 A;  2Q2E A;  3FDY A;  3PFI A;  4HNU A;  3KZY A;  5J3O A;  1ZAR A;  2DMP A;  1ZN2 A;  2QEX B;  1YS6 A;  2CUF A;  5FB2 A;  3S14 J;  1MGT A;  3IKV A;  3Q9S A;  2VOD A;  1T6Y A;  1PYV A;  1S5L C;  5AIP A;  1T39 A;  3JRB A;  4CYC B;  3GO5 A;  2HTJ A;  2R6H A;  3WTW C;  4UZE A;  1BJZ A;  4CH7 A;  4X7E A;  2K9M A;  3OYE A;  1IB4 A;  3OYL A;  4P3Y A;  1MH3 A;  4G6Q A;  1W0U A;  3BG6 A;  4FX4 A;  1K78 A;  3GTM J;  1PJ5 A;  1LDD A;  1WP6 A;  2DTR A;  3KEO A;  1XSD A;  4ABZ A;  4ROX A;  5ED4 A;  3LVB A;  4C0S A;  4XLC A;  2P0W A;  3CUO A;  2K4J A;  2D2W A;  4A3K J;  3W2F A;  1ZLJ A;  3HPG A;  1WKM A;  2VBS A;  1FYM A;  3CCQ B;  2IS4 A;  2YU3 A;  3FM3 A;  1YW8 A;  5FLX Z;  1M90 D;  2EBI A;  2PMU A;  3C2B A;  2BW3 A;  4DBQ A;  2JMW A;  1KU9 A;  4BAY A;  3A4C A;  1ZM9 A;  2B5O A;  5L3B A;  1UCR A;  4ZCL A;  2GJP A;  4B47 A;  2ZZG A;  4P12 A;  2F4O B;  4H0E A;  4IHY A;  2K9S A;  1SVL A;  2XGC A;  4PUS A;  4C3J J;  1EH8 A;  1RU4 A;  3PQJ A;  1BOB A;  2EQR A;  2EFO A;  2Q2E B;  5JLX A;  1BJA A;  4XRM A;  3NB2 A;  3HOS A;  3FX3 A;  5CVI A;  3DP7 A;  3KP2 A;  3OOP A;  1WJE A;  1U2R A;  1QVF B;  5DS0 A;  5JHU A;  2DW4 A;  4NHJ A;  4ZCM A;  2MAB A;  1CLW A;  3BH7 B;  3H5R A;  1JB9 A;  1W87 A;  2OAZ A;  1N77 A;  2Q6I A;  2MLG A;  2V7V A;  4N3N A;  2C2W A;  3OYG A;  2HGC A;  1TC3 C;  1XX5 A;  4PGO A;  2RC4 A;  1XD7 A;  1NB0 A;  1QVT A;  3PSI A;  4PZJ A;  2FF4 A;  3MN2 A;  1VHE A;  4GO1 A;  1K78 B;  4MLO A;  2P8T A;  4FCY A;  3SQN A;  3K69 A;  3HRM A;  1FIA A;  5EZH A;  3S1M J;  3ZQH A;  3TO9 A;  3E5X A;  5J35 A;  4EAT A;  4LIU A;  2BY1 A;  4F3Q A;  3CPX A;  2IP2 A;  4BH9 A;  1RZ4 A;  1DAB A;  1YIJ I;  5FNZ A;  3SLD A;  3JRI A;  1B8I B;  3IKT A;  3QFS A;  4HAM A;  2LRE A;  1SMY F;  4S05 A;  2OZU A;  3K1P A;  4XMY A;  2BW3 B;  4ASN A;  1P4A A;  2F5V A;  5L3D A;  2RC6 A;  1WJC A;  5K5Q A;  4I0B A;  4YEI A;  4M3D A;  1O57 A;  3FZV A;  4UB6 C;  4Z4U A;  3AVY A;  2GRE A;  4OM9 A;  2HOE A;  2INU A;  1ITY A;  5E3M A;  2UWM A;  2QYU A;  1LVK A;  1UD4 A;  5D4S A;  2HNH A;  3S93 A;  2LD5 A;  2KLO A;  2XEX A;  3AVV A;  3WG9 A;  4NK8 A;  2W7Z A;  1EE6 A;  5IYC J;  3M1E A;  2O1D A;  3V8J A;  2X48 A;  1KJZ A;  1NH3 A;  1AIP A;  4P96 A;  5M3M J;  1YJ9 I;  4AM3 A;  4Z4V A;  3G1O A;  1YS7 A;  4X7D A;  1F60 A;  3H9J A;  1EFR A;  1MW7 A;  2OC6 A;  1R5B A;  2ZZF A;  3JUR A;  2A6H F;  1Y0Y A;  1EZG A;  1V5F A;  2V7X A;  3F72 A;  4LB6 B;  2EFW A;  2AS5 F;  2M0C A;  1VQL B;  4IJA A;  3J80 K;  3J81 Z;  4ENM A;  1WHU A;  5JBQ A;  3WQZ A;  1XGS A;  4OJL A;  4RBO A;  5J47 A;  2XZP A;  1E62 A;  5DM6 F;  2AHO A;  3CCM B;  3TED A;  3B4N A;  5HOO A;  4A0Y A;  4AVP A;  1BQE A;  3FY3 A;  1U5T A;  4KIS A;  2O5R A;  3DKW A;  2K86 A;  4MIM A;  1XPX A;  1H42 A;  1FP1 D;  1GDT A;  3HKZ N;  5IP6 A;  5H5J A;  3ONY A;  2JA8 J;  2UVF A;  4TMZ A;  2BSA A;  1VQM B;  1WOS A;  3N90 A;  1IO2 A;  2R7Z J;  1MBH A;  3ZZT A;  2K7L A;  4Z4S A;  2CW5 A;  5EZG A;  5F4M A;  1QNT A;  3P7N A;  3FF5 A;  2O17 A;  2XV4 S;  4P9U A;  1U8B A;  2NTP A;  3I53 A;  3V76 A;  1K6Y A;  1YI2 I;  2F5F A;  1P9Q C;  3PJR A;  1LLZ A;  2DEU A;  2EZL A;  4MGR A;  3FBI B;  4TMW A;  4FX0 A;  5F0C A;  5FGM A;  4MYT A;  1EA0 A;  1Q81 D;  2QN6 A;  3QPS A;  1CZF A;  1VQP B;  4QWQ A;  4KIF A;  2KL4 A;  3CCE I;  1U5T C;  4OIR F;  1R36 A;  3B8H A;  1QGP A;  2BMW A;  2W6J A;  4LOC A;  5HDN A;  2LH9 A;  4XRF A;  1V5E A;  4AIJ A;  3OOC A;  2PMZ N;  2COM A;  2MBF A;  3HRS A;  3CCR B;  1LE8 A;  3LSI A;  5DTD A;  4XOR A;  1BW5 A;  2GZW A;  3RKX A;  5HLI A;  5THX A;  3ZC3 A;  4UV9 A;  1S72 B;  5FJ8 J;  2F5E A;  5JVT A;  2E2I J;  1TWA J;  3J7A O;  4ZGQ B;  1MMA A;  3WND A;  2WPD A;  2BX6 A;  4M9S A;  3CCU B;  4RD0 A;  2VYQ A;  4BY1 J;  2Z2S B;  1F4K A;  1OFL A;  5HKK A;  2ZL7 A;  3AVW A;  1NHA A;  1FZP B;  3VWB A;  1IZ1 A;  3T0Y A;  2DDB A;  4G12 A;  4GXO A;  2JDI A;  2GK7 A;  1T56 A;  1QA1 A;  3OS1 A;  3PSZ A;  2F43 A;  4JP0 A;  3G6E B;  1JUM A;  4CCN A;  4YFN F;  5IYP A;  1HA8 A;  2P6S A;  3O3K A;  3MZH A;  1YQA A;  5LHH A;  1PDN C;  1O8D A;  5LGU A;  2NTQ A;  3G71 I;  1JUP A;  2IA0 A;  2M87 A;  2MA3 A;  3CDI A;  3SZP A;  2W85 A;  5LFA A;  1DGW Y;  3OR1 C;  1QG0 A;  3VST A;  2XPW A;  4B8X A;  3W3C A;  1JKO C;  1B6A A;  2HU9 A;  3JRA A;  5FD6 A;  1LQ1 A;  4KT5 C;  3W5U A;  3I3L A;  1LLW A;  4BPR A;  4FN5 A;  2XTW A;  4HF0 A;  1T8I A;  2YX7 A;  3GZ6 A;  2XAS A;  2ME0 A;  5JVG F;  1VF7 A;  1O8F A;  2C5H A;  2XF7 A;  4BNC A;  4NC8 A;  3CC2 B;  1FMV A;  4NC6 A;  2R4G A;  1O3T A;  5L3C A;  4U4B A;  1UD6 A;  4U0W A;  3DLL F;  4EGY A;  3HAG A;  1S7O A;  3K1N A;  4DIQ A;  1N05 A;  4OJP A;  3V8K A;  4PAA A;  1KON A;  1XSV A;  4XM3 A;  3HHH A;  3WWG A;  4M53 A;  2IA2 A;  2MG4 A;  1X3Z B;  2DPD A;  4QPQ A;  4CCO A;  3ABK H;  4KIG A;  4HQM A;  4AD9 A;  2MH9 A;  2JA2 A;  3KZZ A;  5D6F A;  4PC6 A;  3QSY A;  1QVG B;  4RGX A;  3QOE A;  2VQG A;  3KFW X;  1UAA A;  1GO2 A;  1ETW A;  1W36 C;  1EFC A;  1FDR A;  1A04 A;  2P4W A;  4Y7C A;  1I27 A;  1V5G A;  4PJ0 C;  4A3M J;  5IPA A;  3BY6 A;  3RZO J;  4OIO F;  5TRD A;  4BJ5 C;  3G2B A;  3M8J A;  2L02 A;  1QZZ A;  4PGG A;  2JA5 J;  4BQA A;  4P2N A;  3VSV A;  3K4N A;  1R6R A;  1YJN I;  2BN4 A;  1MBG A;  1GV5 A;  2CYY A;  3BPV A;  1M1K D;  4M0L A;  2DCE A;  3R6K A;  3EUH A;  4BHP A;  5L3G A;  2BM7 A;  4M9Z A;  3Q6R A;  1PJR A;  5GP9 A;  3VOD A;  5DN6 A;  5CYV A;  4ZDP A;  2JWT A;  3QE2 A;  2WAD A;  3JAM K;  1YO5 C;  3F23 A;  3O8H A;  1WRJ A;  2M7B A;  1MAB A;  2NNN A;  4OMY A;  2XSJ C;  3TKY A;  1O8K A;  4D7M A;  2VXZ A;  3B73 A;  2PI0 A;  1KQ8 A;  2B7C A;  1IN4 A;  4BGD A;  4XRS G;  1OHH A;  4FE4 A;  3R61 A;  2WB1 N;  2XAJ A;  3WTX C;  1DP3 A;  5JI6 A;  1R58 A;  3CJQ B;  3IV5 A;  1QO0 D;  3DKY A;  1Z1D A;  1KYZ A;  3E97 A;  3WTZ A;  3OYK A;  2ICW G;  2K3P A;  5IT3 A;  4L9N A;  3FK7 A;  2OQR A;  1G3T A;  1R5G A;  2E2H J;  1OB0 A;  4MTD A;  2Q8K A;  2CND A;  3ZN1 A;  2P7V B;  4F93 B;  2PBI A;  4DOZ A;  5D5U B;  1VND A;  2C77 A;  3TGN A;  3A01 A;  1S4M A;  4RB1 A;  2V31 A;  4E7I A;  3E6B A;  4QTR A;  3BC9 A;  2PE3 A;  1BI1 A;  2YPR A;  3MMP A;  5JMC B;  4RGR A;  4G7W A;  2JJ2 A;  5B5E C;  4OZY A;  3S2D J;  3FKS A;  2NV4 A;  1VQ4 I;  4I84 A;  1FLI A;  2RQP A;  3F6O A;  4J0Q A;  2BVM A;  4XLN F;  3REO A;  3ROU A;  2D1H A;  3HOU J;  1VQ9 B;  5E8I A;  3Q5F A;  1HDD C;  2MD0 A;  1QH0 A;  4B43 A;  1OGI A;  1X3W B;  3WE3 A;  2HMA A;  3WGH A;  3VMF A;  2ADU A;  3JX8 A;  3T8T A;  1D1A A;  5HS7 A;  3F3X A;  5K5O A;  3AGQ A;  3GZ5 A;  4A3D J;  1QGA A;  1IN7 A;  2BY3 A;  4IPA A;  1MZB A;  5ERI A;  1I1G A;  1H80 A;  4G94 A;  1ZG3 A;  3T1B A;  4RD3 A;  1ZUN B;  4O6J A;  1LFU P;  1NG6 A;  4L5J A;  1W7P A;  4A3E J;  5A8A A;  1YIJ B;  4AWX B;  1O8E A;  3M8E A;  4M73 A;  1MBE A;  1K28 D;  3F8C A;  2O3F A;  1UB9 A;  2W1O A;  1V5V A;  4Z4Y A;  2DDA A;  5AIQ A;  3Q39 A;  3LQQ A;  3GWZ A;  4XR6 A;  3WU2 C;  3CP8 A;  3JRE A;  3CDH A;  5HS9 A;  1T6Z A;  2NOG A;  3GVJ A;  1PJ7 A;  4H9G A;  1Q86 D;  2JVG A;  2DMQ A;  4FTH A;  3T9G A;  4EQQ A;  2ZSI B;  1B9N A;  1K7A A;  1B1B A;  3RTR A;  4CYD A;  2E1R A;  4G6T B;  4PC7 A;  3A01 B;  1O8I A;  1VZ0 A;  2HXI A;  5GPC A;  3OJW A;  2CV1 A;  2FU4 A;  3ZXS A;  2HKO A;  4IRH A;  1YJ9 B;  2WBM A;  2R7W A;  2Y2Z A;  4KT6 A;  4AYB A;  4HLY A;  1L0O C;  4BE2 A;  2CF4 A;  1TYW A;  3C1D A;  3J80 Z;  3K4C A;  1KQ9 A;  4RGS A;  2DET A;  3O6B B;  3MHP A;  3RDI A;  3D1N I;  2XF5 A;  4YZX A;  5IYN A;  3U2Q A;  2ELJ A;  4BHC A;  4A3J J;  3B78 A;  4G5G A;  3U2R A;  2VFQ A;  2X6Y A;  2OTJ B;  1MD0 A;  3OWT A;  2CMP A;  2ZL6 A;  3LL7 A;  3Q38 A;  1IW7 F;  3WTY C;  2KQR A;  4YII A;  2DMN A;  3MQ0 A;  4UUV A;  4YDT A;  2ZBU A;  1ZHF A;  2V1N A;  1TW3 A;  2KRC A;  4IHS A;  2E1M B;  2R7S A;  4P3I A;  4DZP A;  2FRH A;  2R92 J;  5GV8 A;  2QSF X;  3GRH A;  2AQE A;  1QA2 A;  1G2H A;  1ZG5 A;  2QGU A;  3CO6 C;  2XZL A;  3H5N A;  4YIR X;  3GTQ J;  1LB2 A;  3RPQ A;  3EYI A;  4BEH A;  1RR7 A;  3Q9V A;  5J1Y A;  5DUI A;  4RM2 A;  4JX5 A;  4LBW A;  1FJL A;  1YI2 B;  4UB8 C;  3H36 A;  5DD4 A;  1U3E M;  3ML6 A;  4W8T A;  2CBX A;  3OIQ A;  2QTZ A;  2F1M A;  5E20 A;  3ZN0 A;  1H85 A;  2OJE D;  1T0F A;  3FXQ A;  2VZL A;  3PUB A;  3BCD A;  1PUF B;  1ONV A;  5FLX K;  1HZE A;  1SAX A;  3CCE B;  2QY1 A;  4Z03 A;  5B66 C;  3F21 A;  1DP7 P;  4BDZ A;  1D1B A;  1E64 A;  2RC5 A;  4HNT A;  4HE6 A;  5EF6 A;  1N78 A;  5C1C A;  1VQK I;  4M72 A;  4FE7 A;  3KIO A;  3LO8 A;  4Y9U A;  3L9F A;  4GDF A;  4M4S A;  1KTW A;  1OOC A;  4FIS A;  5E8G A;  2OBP A;  3CXC B;  4EJO A;  1GUU A;  5LEJ A;  3E6D A;  5E6T A;  4YEJ A;  3UNG C;  1OGJ A;  4RDU A;  3CMA I;  3HSR A;  1WI3 A;  2VQC A;  4B3A A;  2BM0 A;  2RKH A;  3QOP A;  1TQI A;  3BJO A;  4IX7 A;  1HOM A;  1K73 D;  5L46 A;  3BR0 A;  3WGG A;  3S1N J;  2L5Q A;  1FOX A;  2ZXJ A;  3B82 A;  1LNW A;  2L0K A;  1JJ2 B;  3AG3 H;  3G4S B;  5F4J A;  2V6C A;  2KFD A;  1IA5 A;  1D3Y A;  3ASO H;  5TIS C;  1D0X A;  4BEH B;  1FSE A;  4YFX F;  5ILU A;  2Z8G A;  1SFK A;  2QBY A;  4TMV A;  4E7K A;  2NPF A;  3F0C A;  3QAH A;  2QA4 I;  2DO7 A;  2FD5 A;  2VKD A;  3L00 A;  2XNC A;  1HC8 A;  3H35 A;  4ZCI A;  2ESH A;  1I3Q J;  3G71 B;  2DFI A;  2NS0 A;  2V1U A;  2B0L A;  3SXY A;  3BJ6 A;  2EFN A;  3FXM A;  1H8E A;  1E3O C;  2Y9Y A;  3LMW A;  2L9V A;  4WF2 A;  3JRF A;  4BJT A;  2A07 F;  2V9V A;  3BZC A;  1IRF A;  1U9O A;  3QFR A;  4RB3 C;  2VFP A;  2OU2 A;  4IQJ A;  1N8R D;  4ENJ A;  5H59 A;  2CUZ A;  2H09 A;  2DFE A;  3CCJ I;  1ENH A;  2PQ8 A;  4UVC A;  3E7L A;  1TQP A;  3PFY A;  3VOE A;  4HYE A;  3D26 A;  3KPH A;  3DTE A;  5TR9 A;  3K4J A;  2KKO A;  4GYI A;  2PG4 A;  1HBX G;  3LNN A;  3GF2 A;  2L9S A;  4WZT A;  1OCO H;  3JRD A;  2RNG A;  5CVV A;  1KCC A;  1GHC A;  1HST A;  4Y9R A;  2C6Y A;  1EWY A;  1GJR A;  4B09 A;  1BW6 A;  1D8K A;  4E7L A;  3VYT B;  3GQB A;  3BG3 A;  4DYR A;  3FHZ A;  4JOM A;  5L3E A;  2B0R A;  2ZTN A;  3K70 D;  5J6X A;  2M34 A;  3BTC A;  1VQL I;  4LG3 A;  4W97 A;  4B3F X;  3CLQ A;  1F20 A;  3RIQ A;  1RIO H;  2X8K A;  1XB4 A;  4IF4 A;  1CF7 A;  4YHB A;  3ZQC A;  2X6X A;  3JSO A;  1KC8 D;  2Z6B D;  4PC2 A;  5CQE A;  3PIO F;  2JIZ A;  1YRN A;  4KH3 A;  3NEU A;  2FNP A;  2JVH A;  3OIO A;  1IDY A;  2L3D A;  3L09 A;  4YG2 F;  4NBS A;  2IOU G;  2CFO A;  2N8G A;  5F04 A;  5B1A H;  3AL0 C;  2E36 A;  1GAW A;  3SJZ A;  1WTH D;  1GV2 A;  1F5T A;  1G8X A;  3J7Y J;  1FEX A;  2XAG A;  2XAH A;  3HRU A;  4FQG A;  3ABM H;  4L8J A;  2Y48 A;  3QP5 A;  1IF1 A;  4CDG A;  3JAM Z;  3P9I A;  4Z2Y A;  1F43 A;  2V1X A;  3PQK A;  1SFU A;  1BMF A;  1WCM J;  3N4M A;  2GK6 A;  2UUZ A;  3R6J A;  3GBG A;  4DNR B;  2AQF A;  3EPZ A;  3BT9 A;  2ME6 A;  1MRZ A;  2DJI A;  5EYR A;  2IEK A;  2PLY A;  1IC8 A;  4D7N A;  4IOA F;  1R49 A;  1BR1 A;  1O8H A;  4CZZ A;  3V8L A;  4TV7 A;  2BM6 A;  4XN0 A;  5GPA A;  2BE5 F;  1EV7 A;  4I2O A;  2XVC A;  3ASP A;  2IQ7 A;  3CPW B;  3ZPP A;  4R1H A;  2AHQ A;  2CH0 A;  3IWZ A;  3OIP A;  4M3B A;  3M8F A;  3U9G A;  1JT0 A;  5J40 A;  1I18 A;  4BS9 A;  1H0M A;  5FKN A;  2V7W A;  2QKL B;  2IS2 A;  2MC4 A;  4KKU A;  1OLT A;  1DPR A;  3LSM A;  4TSF A;  5AN9 A;  2BZT A;  4RD6 A;  1U8R A;  1P6R A;  3HKZ A;  3FWE A;  1S72 I;  2KZG A;  4X6A J;  1QJV A;  2J7K A;  4ZTF A;  3QPL A;  3HDD A;  3SZG A;  4KYW A;  2KVO A;  1CF7 B;  4DZJ A;  3PSS A;  2A61 A;  4D5C A;  3A8J A;  1FYL A;  3W2H A;  4OAZ A;  1YRN B;  1KCD A;  4HV6 A;  5K7Z A;  3VO1 A;  2EIN H;  1A6I A;  4XLP F;  1VF9 A;  1Y1W J;  2ACJ A;  2VNI A;  1BN5 A;  2O7O A;  3GSI A;  5H20 A;  5BOX A;  5FRN A;  3A35 A;  3DTI A;  3G3Z A;  4EJU A;  5CDF A;  4A3L J;  5F6F A;  5M5X J;  1QQI A;  4HBL A;  2BF4 A;  2DTZ A;  2K9Q A;  3GME A;  3MCZ A;  4A3G J;  3CRZ A;  4ETS A;  5GAE J;  5E17 F;  4L9V A;  2ZO4 A;  3M07 A;  1WPK A;  3EQL F;  4UV8 A;  2OK8 A;  3HHG A;  1OCT C;  1L1I A;  1WJD A;  4XID A;  4O5V A;  2IVM A;  5K5R A;  3OYH A;  2R5Y B;  4J01 A;  4A3C J;  5JHF A;  3FHN A;  1Y0U A;  2HXO A;  3MFK A;  3I59 B;  4N3G A;  1IAW A;  2VL8 A;  2R7Q A;  2Z99 A;  1YIT I;  1DDI A;  4XD7 A;  5CKT A;  2VJI A;  1RR8 C;  4Z4W A;  4KMF A;  1IJW C;  2LKS A;  2Y31 A;  3DDY A;  2BEO A;  3CC2 I;  4PJN A;  4XK4 A;  3SFZ A;  2DN0 A;  1SKY B;  1ZH5 A;  3QPH A;  5D5X B;  3QWL A;  4QVA A;  2VBM A;  4WZK A;  2LR8 A;  2VAS A;  1W35 A;  2C5B A;  2GAU A;  1OPC A;  3BG7 A;  1TVC A;  2GA1 A;  3NWT A;  1DU6 A;  3VR6 A;  3TQN A;  2XGJ A;  1FIP A;  1G7S A;  3OZU A;  1YW7 A;  1WXR A;  3A0B C;  1V4R A;  3ZQ7 A;  3ZQL A;  4AF7 A;  4LG0 B;  2JZY A;  3QRF F;  1MSE C;  3H0D A;  1R22 A;  2QCO A;  3KX2 A;  2JTV A;  3I64 A;  1WU8 A;  1LFB A;  2ID3 A;  3HUG A;  1D1C A;  3A1Y A;  3ZQQ A;  2EFP A;  4OOS A;  2XRN A;  3L7W A;  1E2X A;  1B59 A;  1U78 A;  1WOP A;  1AOY A;  5JLV C;  4XIC A;  1FOY A;  1HF0 A;  1QPI A;  2A5W A;  3WU1 B;  2WAQ N;  2RRE A;  4WZE A;  3GTP J;  1JNY A;  5BSY A;  1Y56 A;  3HTS B;  3BQZ A;  1RMG A;  4Q5S F;  4M1K A;  3B02 A;  2H1L A;  2R7U A;  3CF2 A;  2QF7 A;  4V19 K;  5B3S H;  3W2I A;  2RVC A;  3C2H A;  1DUX C;  2DA6 A;  3ES9 A;  1X4O A;  4KN7 X;  4BY7 J;  1NK3 P;  4HF1 A;  1NG7 A;  4HOB A;  3OW2 B;  2NZM A;  2M0M A;  2R7V A;  3GTL J;  3ISX A;  1Z3X A;  3FK6 A;  1MMS A;  5LHG A;  3MKW B;  2X53 S;  1Y0N A;  2BM1 A;  3RCO A;  2P5L C;  2F1L A;  2LK2 A;  1JHH A;  2X51 A;  1VLO A;  2EIJ H;  2JJ7 A;  2CO5 A;  4E7J A;  4A3I J;  4YC5 A;  4Y4R A;  2GWR A;  2DYS H;  2O0V A;  4G8X A;  3RYP A;  1S3J A;  1TTY A;  2KRH A;  4JK1 X;  1XE1 A;  4CCM A;  1RQP A;  3B6C A;  1G7C A;  4RGU A;  1KK0 A;  1Q82 D;  1IDJ A;  3ASN H;  3RKQ A;  1FND A;  2O8X A;  2Q6O A;  3HYI A;  2GIV A;  4QSH A;  3ZPN A;  1VQK B;  2YWE A;  3H9Q A;  2OBT A;  1T98 A;  1H9G A;  3HUG B;  2HDW A;  4EMS A;  1AIR A;  1OGO X;  2BHZ A;  5HNF A;  1XS9 A;  1N25 A;  3CP2 A;  3CQZ J;  2VNK A;  2Z3Y A;  3CMA B;  2PMD A;  4XRS A;  1IDZ A;  2XC1 A;  2VPL A;  3ZZ0 A;  2YR2 A;  3CW2 A;  1RC9 A;  3NQO A;  1VQ9 I;  3OKX A;  3TL4 X;  2OCE A;  5BSX A;  3MZ8 A;  3CF5 F;  1ZYR F;  4BHB A;  1G59 A;  4KDP A;  2GXG A;  3JRC A;  4H4K C;  4OZZ A;  2OUM A;  1ETV A;  4BKX A;  3LA2 A;  4WQM A;  2LDU A;  3SEJ A;  1B9M A;  2YX4 A;  2O8K A;  1TWC J;  4RAY A;  4PC3 A;  1IUF A;  2V5I A;  2LF8 A;  1OFM A;  4BQN A;  2BGJ A;  2QQ9 A;  2E19 A;  3LSJ A;  4RA2 A;  1EP2 B;  3E1Y E;  3GQ9 A;  4C2L A;  1KK1 A;  1Z3Y A;  4ACA A;  5C1E A;  3F8M A;  2QA4 B;  2VLA A;  2V9K A;  2R0Q C;  4G7Z F;  2CRV A;  3AKZ A;  2BYV E;  1WJ5 A;  3S8P A;  1TYX A;  1SFE A;  2XKO A;  3N6Z A;  4Z05 A;  4X0C A;  1DPU A;  4RD4 A;  1I5Z A;  4JYK A;  3B8Y A;  2ZCW A;  4X05 A;  1E1R A;  4HF2 A;  2GLO A;  3I1F A;  1G3Y A;  2JT1 A;  2E2J J;  2GA2 A;  3ZMS A;  3NAW A;  1TBX A;  2ZME C;  1P4W A;  2BOL A;  1HW5 A;  1KGS A;  2EV5 A;  3MKZ A;  3OY9 A;  4A0Z A;  1KU7 A;  2F4I A;  2VT3 A;  3CCJ B;  4YZ0 A;  4P5O A;  1IJE A;  1K6O A;  3MVP A;  1ZLK A;  2KT0 A;  1QHG A;  2JPB A;  2KJC A;  3IH2 A;  1Y39 A;  3PA2 A;  3U6B A;  2YWH A;  1O8L A;  4NQW A;  1WZ2 A;  4ZDO A;  2BV6 A;  2A6T A;  2FQ4 A;  5FKM A;  3CME I;  4P25 A;  1U9N A;  5GAH J;  1GAQ A;  3DPL C;  4NUB A;  3LQ6 A;  1Z7U A;  3QOD A;  4DBR A;  1KMH A;  1NTC A;  1IXR C;  1N07 A;  1O3Q A;  2OTJ I;  2M30 A;  5TV2 A;  3MAJ A;  1P2F A;  2QYO A;  3VO2 A;  4KUM A;  3DU1 X;  2OK7 A;  3LSH A;  4RAZ A;  3A8I A;  2FE3 A;  2DJN A;  3V7S A;  4YAU A;  4B1R A;  1A31 A;  2VBK A;  4EEF G;  3AGP A;  2VBW A;  4MFE A;  4QHY A;  2VBE A;  2ZIT A;  3RKW A;  1W5S A;  4LD5 A;  3ZQG A;  4ZGN B;  2DLL A;  4BYY A;  2YSR A;  3IP4 B;  4I6Z A;  3WOD F;  2VFN A;  3VSL A;  1EFT A;  3BTL A;  2FA5 A;  4WZL A;  1JXS A;  3GX4 X;  4P22 A;  2XPU A;  4EJT A;  3C3W A;  4BQO A;  1OYI A;  1B23 P;  3EUK L;  3SZT A;  2W57 A;  2NVX J;  3S15 J;  2ELK A;  1VQ8 I;  4OU0 A;  2H6B A;  2GQF A;  4OMZ A;  1ON2 A;  1I3A A;  4XLE A;  4PGH A;  5LGN A;  3F22 A;  2BGI A;  4L9T A;  1DG1 G;  4MEY F;  1E3Z A;  4GCV A;  4HWV A;  4NQW B;  4RB0 A;  1H9T A;  4Y52 J;  3I0T A;  3IHU A;  4I09 A;  3I71 A;  4G6I A;  1FX0 A;  2QM3 A;  4HLX A;  2E1C A;  2VNH A;  4JMQ A;  2CUJ A;  1O8J A;  1K4S A;  1IXS B;  3HPH A;  3PL8 A;  5DCF A;  4F92 B;  3LNQ A;  2M45 A;  1UMQ A;  1OCP A;  3TOB A;  4M2L A;  4HIZ A;  3HSE A;  3SJM A;  3FXL A;  2LKX A;  1E0E A;  4CSW A;  2O6G E;  3TO6 A;  1U5T B;  4PSW A;  1V3F A;  1TUI A;  5LHI A;  1QZE A;  4C2U A;  3NAU A;  3G4S I;  5E3O A;  5EEG A;  2HYJ A;  1R4M B;  5FO5 A;  2QLZ A;  1VQO I;  2BHY A;  1G7R A;  5IYB J;  5DYM A;  1BC7 C;  2WZN A;  3I56 I;  1RKW A;  4BAC A;  2L4M A;  4MXN A;  2G9W A;  3MMY B;  3PM1 A;  1SFO J;  5M3F J;  4LK1 F;  3OL3 A;  3PNT A;  3FMS A;  3HM5 A;  3QU6 A;  3L2Q A;  1ZR2 A;  1R5O A;  2QZA A;  1N75 A;  3I9V 2;  3W6J B;  4Q4Z F;  4ZYA A;  5F0H A;  1FNN A;  2KIU A;  2LYC A;  4HNV A;  3DQV C;  3HB9 A;  3RIR A;  4ZH4 F;  2EZI A;  2DQL A;  2VE9 A;  3JU4 A;  3CB4 A;  2VFO A;  5LLQ A;  1FRQ A;  1B4A A;  1O7F A;  2LBF A;  4W8R A;  4ZYD A;  2PJR A;  5J8F A;  3KZI C;  5F0F A;  1NJI D;  2FXA A;  2QVO A;  1YIT B;  1ZRC A;  2CQ7 A;  4BXU A;  2A05 A;  2YUS A;  2OPT A;  2L4A A;  3EDP A;  2VBT A;  1ZRF A;  5E3N A;  4G1B A;  2YS9 A;  3A1P A;  1LE8 B;  1U0J A;  2ID6 A;  2IBD A;  3HOW J;  4IO9 F;  1XB2 A;  4RLF A;  3CUQ A;  1VQ7 I;  2XNJ A;  1WSU A;  4FHT A;  3SQV A;  1KYW A;  1RQR A;  2DA7 A;  2E1O A;  2K9N A;  2ZKZ A;  4CIC A;  2LG4 A;  2DOE A;  2GOM A;  2VI6 A;  1IN6 A;  4ESB A;  3OJX A;  4DNT B;  3C7J A;  1X1P A;  2EB7 A;  1TQM A;  4ENK A;  3LSG A;  3HEF A;  2DT7 B;  2ETH A;  2MH2 A;  3IH3 A;  4B44 A;  4YFK F;  5TJJ A;  4E70 A;  1FOW A;  1ZM2 A;  1OYW A;  5BNG A;  3CJT B;  3F6V A;  4HQE A;  5KHD A;  1YFH A;  1OB2 A;  5DSZ A;  4LIT A;  2A3S A;  2CSO A;  2JUG A;  3CUQ C;  3WTS C;  4IHX A;  2EA2 A;  2QSG X;  1D2E A;  2ZC2 A;  3GFL A;  1UHS A;  1ZKG A;  1REP C;  2WJY A;  1ZQ3 P;  1P4X A;  3K4M A;  5F1R A;  2A68 F;  3ZR8 X;  1K8A D;  2QX3 A;  1WSV A;  1J5Y A;  1K4T A;  5EMN A;  2F2E A;  5AON A;  2LBF B;  1SD6 A;  1USS A;  2PJR B;  1XDS A;  3EET A;  5HZB A;  4A3B J;  1CNE A;  3OZW A;  3WHC A;  4P9S A;  4ESJ A;  2V79 A;  1LM1 A;  2UXX A;  1RUO A;  1Y8Q B;  2GIZ A;  5ICC A;  2D74 A;  2VBZ A;  3PUM A;  2ECC A;  4XLH A;  1V54 H;  3VYU B;  1NHC A;  4IEJ A;  2KRF A;  3F8F A;  2XKP A;  2X6O A;  4HSR A;  2FX3 A;  2Y75 A;  2ISZ A;  4YXW A;  4AVZ A;  3RPU A;  4E4H A;  1RRJ A;  3TH0 A;  3GTJ J;  2NS8 A;  3OP1 A;  3CUQ B;  1R9T J;  2CQK A;  1TWH J;  2VQL A;  4BBS J;  1DU0 A;  2M4K A;  1KK3 A;  2OV7 A;  1TP4 A;  1VFC A;  3C2G A;  4I98 B;  3F8N A;  1PLU A;  4DQ2 A;  1MIJ A;  2JPC A;  3OOU A;  4UZF A;  3HTU A;  3K7A J;  4BJ6 C;  1QGY A;  2ESN A;  4OP7 A;  2QQA A;  1S0U A;  3AG4 H;  1JTA A;  3QFC A;  1VBL A;  2QQB A;  1R00 A;  4YCQ A;  1FTT A;  5J4Y A;  2ZFW A;  4IVN A;  3OYC A;  5F4O A;  2UZK A;  2EWE A;  2HYF A;  3SYT A;  2CGP A;  1JKR C;  1SAU A;  1PP8 F;  3F8B A;  4BXX J;  3E5U A;  4RPD A;  4HV5 A;  4ASU A;  5A89 A;  3ZCO A;  4ON0 A;  1SM4 A;  4RPB A;  4DQK A;  2J5O A;  2ZZE A;  5IYQ A;  1FBS A;  1Z0X A;  1X1B A;  1UD8 A;  4X07 A;  2ZFU A;  1ZM4 A;  1HLV A;  4DGW B;  4I7H A;  5HDK A;  5BPD A;  2DFH A;  1EF4 A;  5K7H A;  3ERE D;  2PIA A;  5EGO A;  2PYH A;  4C3I J;  4BU2 A;  4R71 A;  1ULY A;  3PO2 J;  3RKY A;  4QLC U;  4CHU A;  2GJR A;  4EH1 A;  3GEZ A;  2KDZ A;  1BR2 A;  3IH4 A;  1MMG A;  3PEN A;  1TSP A;  1IXC A;  1HG8 A;  4N9H A;  5AMV A;  5GV7 A;  1JJ6 C;  4LK0 F;  3WHB A;  2I8D A;  3CJR B;  3ECO A;  3JSP A;  3ZQI A;  3T51 B;  3SHF A;  1Z6T A;  3WBJ A;  2HFH A;  3BQY A;  3SDG A;  3G73 A;  2ZTG A;  1Y1V J;  2FSW A;  4I02 A;  1W9X A;  3CMY A;  5FO0 A;  1I6H J;  3ZPL A;  1BN8 A;  2V7Q A;  2BBY A;  2HDD A;  4G7X A;  3D5S C;  3S17 J;  2LY2 A;  2Z16 A;  2NXN B;  3FXR A;  1G4D A;  1G7T A;  4LBV A;  2FBH A;  1TW2 A;  2XB0 X;  4LJZ F;  3KYD B;  4E0F A;  2G0Y A;  2VC1 A;  1P7J A;  3ZMT A;  5GAD J;  3BG9 A;  4JBA A;  3K4L A;  3W6V A;  3KLO A;  2ZJQ F;  5KVR A;  2FQ3 A;  2UVE A;  3U1D A;  1OFC X;  3LST A;  3CME B;  2IW5 A;  4I01 A;  4OIP F;  1DAR A;  4MHG A;  1VHO A;  4HST A;  3RQ4 A;  1UZC A;  4NK6 A;  4A5M A;  1HXD A;  1QA3 A;  3ONU A;  2GPJ A;  1JE8 A;  3BR3 A;  2ZB9 A;  2ZXI A;  3S32 A;  1JI8 A;  3ZOB A;  2A6E F;  3ZP5 A;  3LA7 A;  1TT0 A;  1T38 A;  5FD5 A;  5EGO B;  3HJE A;  4RD1 A;  2O6W A;  2NS7 A;  4HX8 A;  1MKM A;  3TOA A;  2V26 A;  1W36 D;  4Y3O A;  4LB5 A;  1E1Q A;  5J8C A;  4ZYH A;  3PET A;  2L2O A;  1H89 C;  4LGW A;  3QPT A;  2ISY A;  4HG2 A;  4C30 A;  2CFX A;  1QBJ A;  1RKT A;  1LEA A;  4N9I A;  1W7P B;  1PE9 A;  4TT3 A;  2WTE A;  3VYR B;  2DU9 A;  2E1B A;  3ABT A;  2XRO A;  2NT6 A;  1DQU A;  4A69 C;  3AAF A;  1D5Y A;  2DFF A;  2Z5U A;  2R7R A;  3Q0V A;  1LPQ A;  2P5V A;  1KQ5 A;  3BLY A;  2STW A;  3EUA A;  2LC2 A;  3KP6 A;  2O0Y A;  3QP6 A;  4UAJ A;  4G1V A;  4MTE A;  3LYC A;  5HVQ C;  3G05 A;  1ZK8 A;  5LMZ A;  4F91 B;  4B3G A;  5C3E J;  3WXM A;  2Q6K A;  1VQ8 B;  2WV0 A;  3EYY A;  5A2Q K;  1XQB A;  3OEH A;  2MYS A;  3HG9 A;  1PJ6 A;  2Y0S N;  3GQ7 A;  2YWG A;  1JGG A;  4BL0 B;  1UD5 A;  2RN7 A;  5CQG A;  2CJJ A;  1EP1 B;  3ZUG A;  3FXU A;  3CO7 C;  5D8K B;  4N4N B;  2QGG A;  2LY1 A;  4RD2 A;  1EKE A;  2OA4 A;  4GYG A;  1IJF A;  3BCF A;  2QE7 A;  3P4G A;  2DBB A;  1KQ0 A;  1TTT A;  1JKP C;  4G7H F;  3IAS 2;  2VN2 A;  1IRZ A;  1JGS A;  4J00 A;  4M71 A;  2HCJ B;  3H5A A;  4QPO A;  3ECH A;  5ICF A;  3U1K A;  2NVQ J;  3VSK A;  4A93 J;  2X85 A;  3O8G A;  2DYR H;  2EFQ A;  3NWS A;  5D5V B;  4FK8 A;  5TY0 A;  2O0W A;  1AKH A;  1YOV B;  5H6R A;  4U0V A;  3D5L A;  1IG7 A;  4LBY A;  3OYM A;  3K2A A;  3J7A Y;  1NRK A;  2QUF A;  1FTZ A;  1VI0 A;  2XGD A;  4KMU X;  1O3S A;  2EA4 A;  1HDP A;  4A3F J;  1VQO B;  4IRG A;  3COA C;  3BH4 A;  3H9G A;  3I56 B;  1ETK A;  5E1Z B;  1E17 A;  1J9Z A;  5IYR A;  2FMY A;  1POG A;  1YIO A;  3IAM 2;  1R4N B;  2JJ1 A;  3P5J A;  5LEK A;  5K1Y A;  1Q9S A;  4QFM A;  5J1R A;  1J0R A;  1GR1 A;  3AG1 H;  4XKW A;  3V7C A;  4RB2 C;  4OIN F;  3LFU A;  1TNS A;  2CRG A;  1SVO A;  4WXC A;  3ABU A;  2VBX A;  1HF2 A;  5H2F C;  2HQN A;  2MGQ A;  4WCG A;  1YG2 A;  3RSN A;  4NC7 A;  1HW2 A;  3OEE A;  2LF7 A;  1YLO A;  3P26 A;  2XF6 A;  3Q3A A;  1WWX A;  1A5J A;  1LUJ B;  3DLA A;  1O7L A;  3DWL E;  2EPF A;  2X0K A;  2DER A;  4DJA A;  2B7B A;  5D8L B;  1UEL B;  3CDL A;  2X1C A;  2NAZ A;  3WU0 A;  4A6D A;  5EDN A;  1CGP A;  1XFO A;  3GIR A;  4X8I A;  2IGO A;  1JTY A;  3LQR A;  2R5Z A;  3JW4 A;  4L18 B;  3AK5 A;  5ILS A;  3VB2 A;  3W2A A;  3JRG A;  4IHW A;  1VQ7 B;  4W1U A;  4AU7 A;  5FA6 A;  2M2E A;  3D0S A;  3P9C A;  4LLG F;  3DPU A;  1OFE A;  1MMN A;  1JTX A;  2EWN A;  1W7P D;  4P1W A;  4WWC A;  1R5H A;  1R1V A;  4RLQ A;  1I7P A;  1UFM A;  2GQQ A;  2AXT C;  4IZZ A;  4L5E A;  1D8J A;  4M6V A;  3OMY A;  1N08 A;  3LAP A;  2DA3 A;  4D1Q A;  2E35 A;  2BGC A;  2COB A;  1ETO A;  1X1A A;  2B7E A;  2G0E A;  3BRO A;  5HS8 A;  1O3R A;  1K9M D;  4XSX F;  3U21 A;  3OYI A;  5D5W B;  1OCZ H;  3N05 A;  1FC3 A;  4BE0 A;  2QBY B;  1VQ6 I;  2FVG A;  2YWF A;  1XMA A;  2W82 A;  2CQN A;  4EM1 A;  4L5I A;  4B4D A;  1O8G A;  4DK1 A;  1UHW A;  4CGZ A;  2MFZ A;  3TO7 A;  3IL2 A;  4JQF A;  3RZD J;  1APL C;  4UVA A;  4F55 A;  3E1S A;  3FJO A;  2CG4 A;  5K7F A;  3BZK A;  2HDN B;  2OBR A;  3CCS B;  2MD5 A;  3A03 A;  3ASQ A;  2HS5 A;  2GXB A;  1Q1V A;  1R5I D;  1MJ9 A;  2R7X A;  2WC2 A;  5FFZ A;  4XOP A;  2R3S A;  3RY8 A;  4RDJ A;  3JCU C;  1J75 A;  4R8H A;  4YFO A;  4NBQ A;  1ORK A;  2ZBV A;  3CD6 I;  3AL0 B;  4M74 A;  2E1N A;  3K0L A;  1NB9 A;  4CA0 A;  3GFI A;  1E63 A;  2WJV A;  3V42 A;  1W5T A;  4CCL A;  3SFI A;  1JA0 A;  1YLF A;  5F64 A;  1QX4 A;  1QQ1 A;  3ZRG A;  3J7Z I;  3DV8 A;  5BMZ A;  3R0A A;  2RDP A;  5CJ9 A;  1ETY A;  2M4G A;  2K27 A;  4CCJ A;  1K61 A;  3R6S A;  3GZN B;  1ACI A;  2VBU A;  1X58 A;  1H88 C;  2LOO A;  3E5Q A;  1KZH A;  3S3M A;  2PMH A;  1FBQ A;  1BHE A;  2D45 A;  2D3L A;  5KCM A;  1Q1H A;  2H1K A;  2DA5 A;  1BOA A;  5GAG J;  2BSP A;  1UMK A;  1S29 A;  3HGG A;  6PAX A;  3HOZ J;  5FL7 A;  2P7C B;  3HXL A;  1SD5 A;  1P4M A;  3FKJ A;  1W5C C;  2OZ6 A;  2OTL I;  2KIS A;  4M9X A;  2W00 A;  3R4K A;  3FBN B;  4M3G A;  5J1U A;  4RM3 A;  5CLS A;  3JQP A;  2W6I A;  5KK1 A;  3DBL B;  1MSF C;  1X3U A;  3PUF A;  4AF6 A;  4X1E A;  4YZA A;  3BP8 A;  4UZU A;  5F1J A;  2NRA C;  2DXI A;  3K4K A;  4YAW A;  1FPQ A;  2AO9 A;  2W48 A;  3SY2 A;  4CUG A;  5LD2 C;  1UHM A;  2EJR A;  1VQ5 I;  2L54 A;  4ITV A;  4ESF A;  1MH4 A;  1QU3 A;  2B63 J;  1QFJ A;  3VSU A;  2PMZ A;  4MEX F;  4IKF A;  4LIV A;  2FNA A;  3ZGK A;  1E43 A;  2WY8 Q;  5DD8 A;  2PEC A;  2MSY A;  3S1Q J;  1TWF J;  1S7A A;  2DI3 A;  3DPT A;  3TW6 A;  1EJ9 A;  2EV0 A;  2H8R A;  2E7W A;  2I5U A;  5IP7 J;  3B6A A;  2EZH A;  2FBI A;  3N97 A;  2VBV A;  3I4P A;  2F48 A;  2GBY A;  2RNJ A;  4HX7 A;  3GCM A;  1CQX A;  3ML3 A;  1HA3 A;  4U7B A;  2W25 A;  3OZV A;  1HKT A;  3KP4 A;  2LLK A;  1A8P A;  2XGE A;  5E79 C;  3Q6Q A;  1ON1 A;  3AG2 H;  2C4T A;  4XON A;  2RQQ A;  3TBI A;  1QRB A;  1K83 J;  2FJ1 A;  2Z33 A;  4MO7 A;  1OMI A;  1VQN I;  4C2M J;  1K5C A;  1Z67 A;  2H94 A;  1JRG A;  4U7D A;  2LRD A;  4BXF A;  5FLM J;  2UV1 A;  1YX3 A;  1M1E B;  4ZDL A;  2KJB A;  2JN6 A;  4M3E A;  3OYB A;  1TLH B;  1XGM A;  1XCV A;  3OSG A;  3SUC A;  4OOI A;  2DYI A;  3H3U A;  2WY7 Q;  4RCY A;  4NB5 A;  1ZEL A;  4GGG A;  2LP0 A;  1DDG A;  2NYX A;  3CCL I;  4C9Y A;  2K40 A;  2EFG A;  2EH3 A;  1JUS A;  5M5W J;  4IOC F;  3E3V A;  5DUK A;  2PN6 A;  3RYR A;  1B2R A;  1EH6 A;  1FNC A;  4OJ6 A;  4IQ4 A;  3SDB A;  4IXA A;  1RPW A;  4KKT A;  1FY7 A;  5FKO A;  4GQN A;  5IP9 J;  4OOV A;  1WVR A;  3BR6 A;  3WE2 A;  1ZRD A;  3ZBU A;  2DOA A;  5BQT A;  2RGV A;  3I55 I;  1PKV A;  5GTI C;  4HDU A;  5A2Q Z;  2X1E A;  1VTN C;  1XN7 A;  2QEN A;  3T53 B;  4XLA A;  4R79 A;  1A36 A;  3GTG J;  5EEH A;  1U6G A;  4X0G A;  2P3M A;  2DT6 A;  4B48 A;  3HZJ A;  1SVM A;  3LQE A;  3WGI A;  2WZP P;  2VON A;  1R1T A;  1OR7 A;  1TL8 A;  3H09 A;  3L1P A;  5H6Q A;  1OCC H;  1TNT A;  4O3M A;  2L7Z A;  2QQ8 A;  2M5S A;  2NT9 A;  1GVD A;  5CVJ A;  1S9H A;  1A35 A;  1IGN A;  1O4X A;  2LKP A;  3TMO A;  3OL4 A;  5F27 A;  1SKQ A;  2OCC H;  3F9K A;  4TMX A;  1JJ8 C;  2V7U A;  4PAB A;  2BPO A;  4LFU A;  1SD4 A;  3WNC A;  2H8W A;  4YZQ A;  1QCX A;  4P55 A;  4OPW A;  2X4H A;  3HOT A;  1B8I A;  3FXJ A;  4MYU A;  1F1Z A;  2OYN A;  1TWG J;  5E1X A;  3DCF A;  3BOQ A;  2WYR A;  2C4U A;  2W4S A;  3EQN A;  1OR7 C;  3Q0W A;  2L7M P;  4RMN A;  3OFN A;  3BR1 A;  5E3L A;  2LNB A;  1GLN A;  1OIS A;  3CC4 I;  4OIQ F;  2DK8 A;  4V02 C;  3BY1 A;  3R60 A;  3DBH B;  4YIF A;  4X06 A;  3BCB A;  1G3W A;  2BVN A;  3DBR B;  2ZME A;  4DYC A;  2XT4 A;  1T6S A;  3QQA A;  3V7R A;  1QRY A;  3QYF A;  3T56 B;  2IPQ X;  5GTH C;  2WB1 A;  3IWF A;  4E7Z A;  2ZNY A;  1HCR A;  2KHM A;  2P6T A;  1MNE A;  1X1D A;  2HVQ A;  1PXZ A;  3GLX A;  1WSR A;  2DT5 A;  3V4G A;  4Y13 A;  3D5R C;  2HTS A;  1Q7Y D;  1FT9 A;  2K5C A;  1OQY A;  3ULQ B;  4A12 A;  3M4O J;  2YU9 J;  4Q48 A;  5DV5 A;  2HVR A;  2VXD A;  1GXQ A;  2PFB A;  1HSJ A;  3KEQ A;  2F5C A;  2J5P A;  4MQV A;  4Q47 A;  3ESW B;  3WYA A;  1EA3 A;  1QA6 A;  3IRR A; 
#chains in the Genus database with same CATH homology
 1IRX A;  2WAF A;  3DEE A;  4BEH A;  2CW7 A;  4FET A;  4BQQ A;  2KPM A;  4URR A;  4RM2 A;  3LSG A;  4PFO A;  2DT7 B;  4B44 A;  4N4O B;  3W2V A;  2R7T A;  1LDK B;  3OAA A;  4B3X A;  3K10 A;  1TZL A;  4W8T A;  3OIQ A;  2F1M A;  5KHD A;  4LIT A;  2JUG A;  2VBK A;  3PUB A;  2WAE A;  2WJY A;  3BCD A;  4XKV A;  1HZE A;  2QY1 A;  4Z03 A;  3K4M A;  1Z21 A;  2V7F A;  3ZR8 X;  2QX3 A;  4BDZ A;  1D1B A;  1H8H A;  4HNT A;  4Z1M A;  2LBF B;  3GVK A;  1N78 A;  5C1C A;  1LKX A;  2PJR B;  1W0J A;  4C2T A;  3QYB A;  3GVL A;  1KTW A;  1O88 A;  1I8D A;  1OOC A;  1BR4 A;  4FAS D;  4OJO A;  5AMV A;  2M3A A;  1O8M A;  4XL9 A;  3LMM A;  4YEJ A;  3UNG C;  2KZV A;  2NSP A;  3VYS B;  2VQC A;  4XOT A;  1E3X A;  4XLH A;  3OYA A;  5FRO A;  3VYU B;  4IX7 A;  1DBG A;  1NHC A;  1ERD A;  4HSR A;  4YXW A;  1V0F A;  5CPR B;  2L5Q A;  1D0Y A;  4PJL A;  4AVZ A;  4D9J A;  4E4H A;  1V0E A;  3OYN A;  2VQL A;  1W0K A;  2M4K A;  4E7H A;  2OV7 A;  1YX5 A;  5HLT A;  3C2G A;  1PLU A;  2V6E A;  3E0J B;  3A3B A;  3CZ6 A;  3OOU A;  1IA5 A;  1X4P A;  1D0X A;  4BJ6 C;  4BEH B;  2NST A;  2Z8G A;  1SFK A;  3DKX A;  1X1C A;  1JTA A;  4E7S A;  4E7K A;  2QXZ A;  4YRV A;  1VBL A;  2VKD A;  2IS6 A;  1UG0 A;  3H35 A;  3OYC A;  1MMD A;  2R9V A;  4TKO B;  2EWE A;  1UD2 A;  3SYT A;  2IGK A;  1SAU A;  2CS3 A;  4PJM A;  4F52 A;  2HLD A;  1H8E A;  3A3G A;  4XKB A;  4ASU A;  3ZCO A;  4ANJ A;  1COW A;  3LMW A;  1WJB A;  4BJT A;  2ZZE A;  2E5Z A;  3FDY A;  1X1B A;  4HNU A;  1UD8 A;  2ZFU A;  4DGW B;  2IGN A;  4IQJ A;  2CUZ A;  2PYH A;  4BU2 A;  1T95 A;  1PYV A;  4HEA 2;  2DIE A;  2XND A;  3PFY A;  3NE5 B;  2GJR A;  3DTE A;  3K4J A;  4CH7 A;  1BR2 A;  2K9M A;  3OYE A;  3LNN A;  1IB4 A;  2L9S A;  3OYL A;  1MMG A;  2RNG A;  2GJK A;  1KCC A;  3BG6 A;  1HG8 A;  4E7L A;  3GQB A;  3VYT B;  2I8D A;  3CJR B;  1WP6 A;  1HVX A;  3T51 B;  1VLY A;  4JOM A;  2ZTN A;  3K70 D;  4B3F X;  4XLC A;  4LG3 A;  2ZTG A;  2P0W A;  1W9X A;  3IUO A;  2X8K A;  3HPG A;  2X6X A;  1BN8 A;  2V7Q A;  2Y0S A;  2Z6B D;  5CQE A;  2IS4 A;  2JIZ A;  4G7X A;  3D5S C;  2JVH A;  2LY2 A;  2Z16 A;  3DU5 A;  1IDK A;  2V4J C;  2KDO A;  2CFO A;  2WA0 A;  3AL0 C;  4E0F A;  2BW3 A;  4DBQ A;  2Z1D A;  3A4C A;  1WTH D;  3VDX A;  1G8X A;  3K4L A;  4II2 A;  4B47 A;  2GJP A;  2ZZQ A;  2ZZG A;  1UD3 A;  4L8J A;  2UVE A;  1D0Z A;  1X0C A;  1QHH D;  4PUS A;  1RU4 A;  4HST A;  3RQ4 A;  1BMF A;  2XZO A;  4NK6 A;  2GK6 A;  2UUZ A;  3GBG A;  1BOB A;  4PFP A;  4DNR B;  2AQF A;  3EPZ A;  4ZJZ A;  2Q2E B;  2DJI A;  3HOS A;  2ZXI A;  1BR1 A;  2M7A A;  3S32 A;  1JI8 A;  1O8H A;  1WJE A;  1TT0 A;  3OW7 A;  2HQA A;  2MAB A;  4XN0 A;  1W36 D;  3H5R A;  1E1Q A;  2V26 A;  2XDV A;  4Y3O A;  1N77 A;  2L2O A;  3GQA A;  3ZIA A;  2IQ7 A;  3ZPP A;  3OYG A;  4HG2 A;  4C30 A;  2CH0 A;  3OIP A;  4II3 A;  1PE9 A;  4TT3 A;  3VYR B;  3PSI A;  2E1B A;  1I18 A;  2NT6 A;  4BS9 A;  3OYD A;  2QKL B;  1DQU A;  4MLO A;  2IS2 A;  2XOK A;  1YE9 A;  2MC4 A;  4KKU A;  2R7R A;  1OLT A;  4TSF A;  3LSM A;  3UW0 A;  3BLY A;  3EUA A;  3QYE A;  2LC2 A;  3HKZ A;  4EAT A;  4LIU A;  5HVQ C;  3G05 A;  4ZTF A;  4B3G A;  4F3Q A;  3BCA A;  3SZG A;  4F91 B;  2KVO A;  1QJV A;  1BLI A;  4OAZ A;  3H94 A;  2E60 A;  1KCD A;  3OEH A;  2LRE A;  2KMU A;  2ZSH B;  4XMY A;  2BW3 B;  2L7K A;  2MYS A;  3HG9 A;  3ONQ A;  2F5V A;  1WJC A;  3K4B A;  3GQ7 A;  1UD5 A;  4BL0 B;  3HC7 A;  5CQG A;  2K9L A;  2V4D A;  3A35 A;  5FRN A;  2INU A;  3DTI A;  2UWM A;  4N4N B;  1LVK A;  1UD4 A;  2LY1 A;  5CDF A;  2HNH A;  3S93 A;  1GQ8 A;  2KLO A;  3BCF A;  2QE7 A;  1EE6 A;  2O1D A;  3IAS 2;  4J00 A;  3H5A A;  4QPO A;  3VSK A;  1WJD A;  2VJJ A;  2X85 A;  3OYH A;  4J01 A;  3NWS A;  2O0W A;  3H9J A;  5JHF A;  3FHN A;  4PJJ A;  4MR0 A;  3D5L A;  1EFR A;  1MW7 A;  2OC6 A;  2VL8 A;  3OYM A;  3J7A Y;  2R7Q A;  2ZZF A;  4XD7 A;  3JUR A;  1NRK A;  5CKT A;  2VJI A;  2VB6 A;  1V5F A;  3DDY A;  1SKY B;  4PJN A;  2BVL A;  4OJL A;  3WQZ A;  3BH4 A;  3H9G A;  2XZP A;  2GOX B;  2VBM A;  3IAM 2;  4KKS A;  2VJ5 A;  2VAS A;  3B4N A;  5HOO A;  2JJ1 A;  3FY3 A;  2VQH A;  3BG7 A;  4KIS A;  2O5R A;  3NWT A;  4XKW A;  3L2U A;  3VR6 A;  2XGJ A;  3EUH C;  3LFU A;  3B90 A;  3L2R A;  4HRI A;  3H0D A;  2HZD A;  3KX2 A;  3RSN A;  4NC7 A;  3OEE A;  2NTP A;  2QKM B;  2O17 A;  2XF6 A;  2FUG 2;  1Z7L A;  2XC7 A;  1K6Y A;  3PNV A;  4NNJ A;  3DLA A;  1D1C A;  1P9Q C;  3A1Y A;  3ZQQ A;  3DWL E;  4U87 A;  3PJR A;  3M1C A;  3FBI B;  4YEL A;  3A2K A;  4DJA A;  1XG2 A;  1UEL B;  2X1C A;  1CZF A;  4HPQ A;  3SEQ A;  2A5W A;  2IGO A;  3OR2 C;  2KL4 A;  3W2A A;  2RRE A;  4AU7 A;  2E5N A;  1Y56 A;  1RMG A;  3DPU A;  3DTK A;  1MMN A;  2W6J A;  4P1W A;  2R7U A;  3CF2 A;  2LH9 A;  4XQF A;  4KIT B;  3C2H A;  4XN3 A;  4RLQ A;  2WSS A;  1V5E A;  1X4O A;  2CW8 A;  3KEY A;  3OOC A;  1NG7 A;  5KNL A;  5FRM A;  4IZZ A;  2R7O A;  2NZM A;  3LSI A;  4XOR A;  3OMY A;  2M0M A;  2CV2 A;  2R7V A;  4D1Q A;  4DK0 A;  1Z3X A;  2CV0 A;  1X1A A;  3MKW B;  2X53 S;  3U21 A;  3RCO A;  3OYI A;  3N05 A;  4BE0 A;  1VJS A;  3GQ8 A;  5HNH A;  2X51 A;  2W82 A;  1MMA A;  1BPL A;  2WPD A;  1WMR A;  1O8G A;  4E7J A;  4DK1 A;  4Y4R A;  2MFZ A;  2Z2S B;  4GRI A;  4JQF A;  4CCK A;  5HKK A;  1OFL A;  2O0V A;  4F55 A;  2KRH A;  3E1S A;  3VWB A;  4CCM A;  2JDI A;  2GK7 A;  1IDJ A;  3OS1 A;  2HPM A;  1FMW A;  3ZPN A;  1AA7 A;  3S3N A;  2F43 A;  2R7X A;  4CCN A;  4XOP A;  3H9Q A;  4E6K G;  1HA8 A;  5IK2 A;  3HUG B;  3OS2 A;  2HDW A;  1AIR A;  1O8D A;  1OGO X;  5HNF A;  1WPC A;  2NTQ A;  2E1M C;  3CP2 A;  2XAU A;  4Y33 A;  3AL0 B;  5LFA A;  1DGW Y;  3OR1 C;  2VPL A;  3VST A;  3K70 C;  4CA0 A;  3W3C A;  3FPP A;  3TL4 X;  2HU9 A;  2WJV A;  3V42 A;  4CCL A;  1G59 A;  3VMW A;  3PNY A;  3ZRG A;  3I3L A;  4H4K C;  4OZZ A;  2OUM A;  2M4G A;  2HPI A;  4CCJ A;  1VF7 A;  1O8F A;  2LZJ A;  2XF7 A;  2LOO A;  4NC8 A;  3S3M A;  1OFM A;  4BQN A;  1FMV A;  1BHE A;  2R4G A;  4U4B A;  2F6C A;  3OS0 A;  1UD6 A;  3HAG A;  3GQ9 A;  2D3L A;  1Z3Y A;  4C2L A;  4DIQ A;  1WJF A;  5KCM A;  4OJP A;  2BSP A;  5C1E A;  1KON A;  2VLA A;  4ZC3 A;  2V9K A;  4XM3 A;  3L2W A;  3WWG A;  3AKZ A;  3L2V A;  5FL7 A;  1WJ5 A;  3S8P A;  3HXL A;  3FKJ A;  4Z05 A;  4QPQ A;  4CCO A;  3OPO A;  3EQO A;  2VIX A;  3B8Y A;  2JA2 A;  2IS1 A;  2W00 A;  3FBN B;  1E1R A;  4RM3 A;  1X19 A;  2W6I A;  2VKH A;  3QOE A;  2VQG A;  1UAA A;  4W8Q A;  2BOL A;  4PSX A;  1W36 C;  4YZA A;  4UZU A;  2WAQ A;  1V5G A;  3MKZ A;  3OY9 A;  2DXI A;  3K4K A;  2F4I A;  4KJZ A;  2O04 A;  4YZ0 A;  4P5O A;  4CUG A;  5LD2 C;  3LSK A;  4BJ5 C;  3G2B A;  3M8J A;  1QU3 A;  1QHG A;  4ITV A;  2HVS A;  1DBO A;  2INV A;  3VSV A;  3VSU A;  3K4N A;  1R6R A;  2PMZ A;  4IKF A;  4LIV A;  2DCE A;  1O8L A;  4ZDO A;  2W7N A;  2A6T A;  4BUP A;  3UR3 C;  3ZGK A;  3S3O A;  2WY8 Q;  1E43 A;  3KEW A;  2PEC A;  1PJR A;  5DN6 A;  2VJ4 A;  4EW9 A;  3DPL C;  4NUB A;  3OYF A;  3QOD A;  3DPT A;  4DBR A;  1KMH A;  1OGM X;  4ZDP A;  3RPU D;  4BDY A;  2WAD A;  1WFX A;  4U49 A;  2X6W A;  2ZXH A;  3K6G A;  2M7B A;  3HL2 A;  1MAB A;  2CK3 A;  2ODL A;  3LSH A;  4OJ5 A;  2L9N A;  2XSJ C;  1O8K A;  2VXZ A;  1E79 A;  4U7B A;  4CZC A;  4Z06 A;  4BGD A;  1OHH A;  2VBE A;  1DP3 A;  1T0F C;  3CJQ B;  4XON A;  2RQQ A;  3TBI A;  4W8S A;  3DKY A;  3OYK A;  2JSP A;  3CMM A;  3IP4 B;  3ZSC A;  2K3P A;  3VSL A;  1K5C A;  1MND A;  1JRG A;  4P22 A;  2LRD A;  4BXF A;  3OYB A;  2UV1 A;  1YX3 A;  4ZDL A;  1OB0 A;  4BQO A;  4F93 B;  4DOZ A;  3SUC A;  3EUK L;  2WY7 Q;  2V31 A;  4E7I A;  3OYJ A;  1ZEL A;  3BC9 A;  4FXU A;  2D3N A;  3KRG A;  4G7W A;  4C9Y A;  2JJ2 A;  3VMV A;  2IXS A;  4OZY A;  1WJA A;  3FKS A;  4XLE A;  4I84 A;  4BE1 A;  2BVM A;  4OJ6 A;  4IQ4 A;  3SDB A;  2Q1Z B;  4KKT A;  1E3Z A;  2MD0 A;  4HWV A;  4NQW B;  4B43 A;  4GQN A;  4PK4 A;  4OAY A;  2DOA A;  2KP6 A;  4G6I A;  1FX0 A;  1PKV A;  1D1A A;  2X1E A;  4JMQ A;  2CUJ A;  3T53 B;  4XLA A;  4R79 A;  1O8J A;  4X0G A;  3HPH A;  3PL8 A;  1NBM A;  4F92 B;  1H80 A;  2DT6 A;  4B48 A;  2IGM A;  5TGT A;  3MD2 A;  1NG6 A;  2PYG A;  4HIZ A;  2WZP P;  1O8E A;  1K28 D;  1E0E A;  4CSW A;  3AFH A;  4PSW A;  2M5S A;  3SEZ A;  2NT9 A;  2W1O A;  3PSF A;  1S9H A;  4C2U A;  1DGR M;  3TMO A;  3OL4 A;  4XLF A;  3CP8 A;  3F9K A;  4XR6 A;  4OWR B;  4BAC A;  3GVJ A;  4MXN A;  4YZQ A;  1QCX A;  3MMY B;  2JVG A;  4PMH A;  3T9G A;  3OL3 A;  3PNT A;  3L2Q A;  3HOT A;  2ZSI B;  3BC8 A;  1N75 A;  3OE7 A;  1Y6I A;  3RTR A;  3I9V 2;  4G6T B;  2X1D A;  1O8I A;  1VZ0 A;  4ZYA A;  2UVF A;  2LYC A;  3JU4 A;  3DQV C;  2CV1 A;  2W4S A;  3ZXS A;  4XKC A;  3EQN A;  1OR7 C;  2WBM A;  4RMN A;  2NOJ B;  4KT6 A;  4AYB A;  2LBF A;  2R7W A;  4BE2 A;  1T5E A;  1GLN A;  3OFN A;  4ZTJ A;  1RWR A;  4W8R A;  3K4C A;  2PJR A;  3W2W A;  3KYL A;  2X3H A;  3BCB A;  3DU6 A;  2XF5 A;  4YZX A;  2ELJ A;  3QYF A;  3T56 B;  2WB1 A;  2X6Y A;  4E7Z A;  1KZL A;  2KHM A;  3OWT A;  2CMP A;  3LL7 A;  1MNE A;  1X1D A;  2HVQ A;  2KQR A;  1PXZ A;  3D5R C;  1LFP A;  1U0J A;  2K5C A;  1J09 A;  2V1N A;  4RLF A;  2HVR A;  2KRC A;  2R7S A;  2E1M B;  2VXD A;  2NTB A;  4XNF A;  2AQE A;  3GRH A;  3MKY B;  2XZL A;  3H5N A;  4NK8 A;  2LG4 A;  3CES A;  1EA3 A;  2GOM A;  4DNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...