4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
3GQAA 2X6YA 2O0VA 4YZQA 1EE6A 3ZPPA 3VSVA 4XMYA 2Z8GA 1WMRA 1KCDA 1O8HA 1K5CA 5C1CA 4XKWA 1NHCA 3JURA 4XN3A 1KTWA 4OJ5A 4C2LA 1O8LA 4MXNA 4I84A 3VMWA 3EQOA 4URRA 4Z05A 4U49A 2QX3A 1O8EA 4AVZA 1OGOX 3EQNA 3GRHA 2O0WA 3VSUA 1JTAA 1PE9A 1PXZA 4OJ6A 1JRGA 4Z06A 3T9GA 4OZYA 3B4NA 2INUA 5C1EA 2X6WA 2PYHA 4HWVA 2NSPA 2NT9A 1VBLA 3B90A 4OZZA 1BHEA 1OGMX 2ODLA 3WWGA 1OOCA 3SUCA 4XOTA 4XM3A 1BN8A 1O8JA 2NSTA 2NZMA 1X0CA 1KCCA 4XLAA 1DBOA 4XR6A 4W8QA 1O88A 4XN0A 3FY3A 4YEJA 3GQ7A 1O8GA 3LMWA 1CZFA 1O8IA 4XLFA 4XLCA 2VBKA 1XG2A 4XQFA 2O04A 2UVFA 4XLEA 3VSTA 1QCXA 4YZXA 2VBEA 2EWEA 4Z03A 3KRGA 2VBMA 3ZSCA 2BSPA 2NTBA 4XKVA 1O8FA 3GQ9A 4W8SA 4XL9A 1OFMA 2X3HA 4XOPA 4XORA 1IDJA 4PMHA 1O8MA 1O8KA 4XONA 2PECA 4YZAA 2UVEA 2X6XA 4NK8A 3UW0A 4OJLA 1IB4A 4NK6A 5AMVA 2X85A 4XNFA 1O8DA 4YELA 4U4BA 1H80A 1RU4A 4W8TA 1IA5A 1AIRA 2INVA 2NTQA 1IDKA 4YZ0A 4OJPA 3VMVA 2PYGA 2VJJA 4XLHA 2IQ7A 1GQ8A 1QJVA 2NTPA 1PLUA 1RWRA 2QY1A 1RMGA 3GQ8A 1HG8A 4W8RA 2QXZA 2VJIA 1OFLA 4MR0A 3B8YA 4EW9A 2O17A 1DBGA 2O1DA 4OJOA 2NT6A
chains in the Genus database with same CATH superfamily
1SFOJ 1E79A 4PGOA 1TLHB 2H1LA 4QPQA 3O8GA 2CSOA 1KC8D 4XMYA 2GPJA 1WMRA 1QUFA 4AVPA 1D0XA 2XZLA 1AA7A 4LBVA 4EJVA 5GTIC 1V3FA 4QWQA 2FX3A 4OOVA 3VSKA 1YIJB 2K9LA 1OCOH 2DAOA 1VFCA 1ZH5A 3BZKA 4RPDA 1UD8A 3HZJA 3CJTB 1N06A 1J5YA 4FX4A 2L4AA 3HOSA 3MKWB 4TN1A 1BJKA 3TDZC 5EG0B 3SXYA 5AONA 1FP2A 3WBKA 2ECBA 5A2QK 2ZL7A 2QGUA 3ISXA 1COWA 3DBHB 4WQMA 1TTTA 2P6SA 2O0WA 1PXZA 2QZAA 4LIVA 1BOAA 2VXZA 2DA7A 1WFXA 2EBIA 3ASOH 4G8XA 4OMYA 1AKHA 2WAEA 2KISA 3IHUA 2CF4A 3ZQFA 3RSNA 2R92J 2PBIA 3L7WA 4ZDOA 2WV0A 4C2MJ 4WWCA 3VOEA 4M53A 4ZH4F 5BPDA 1BM9A 2HYGD 1Q81D 3WWGA 1M1EB 2K86A 2DETA 3ES9A 2ZJQF 3WNBA 3OW2B 1FWZA 3S14J 1IRFA 1EXMA 2M7BA 2H6BA 5L3CA 3KETA 2ZBVA 1Q9SA 1W7PD 4XN0A 1VQMI 3K2ZA 2Y9YA 2UZKA 5K7ZA 1MMGA 2QQ9A 2HVQA 5BOXA 2OCEA 3FWEA 3H09A 2PMZN 1STZA 2P5LC 3H9GA 1O8IA 5AIQA 1ZRFA 2XB5A 3G4SI 4JX4A 2IA1A 1OHHA 3MVPA 1IRZA 1TW2A 2E1RA 3CLQA 2O8XA 2VBEA 2X48A 1BIAA 1S4MA 4M73A 2BSPA 4D0PA 5J1YA 1GT0C 5AN9A 4V02C 2DCEA 3GQ9A 5BMZA 3HPGA 4ETSA 4NQWB 5FNZA 2CW0F 3I59A 1Z6TA 3FJOA 4KKSA 1WJAA 4L9VA 4PMHA 2X0LA 2MD0A 2PFBA 1TNSA 1B9NA 1IZ1A 1YLOA 4IKFA 4NK6A 2ID6A 2VLAA 1NBMA 3RZOJ 4AIHA 5HZAA 2X85A 3MZ8A 5IYBJ 3GTLJ 4KITB 5EF6A 4BJTA 1KU2A 3ZMZA 1K73D 5KK1A 4E7KA 1AIRA 3FIWA 2VNHA 4PFPA 4RB1A 2YWEA 1G3SA 3N05A 2R6HA 2BOLA 3G71B 3VMVA 2R7SA 3PUBA 5H2FC 1ZHFA 2M9HA 3D1NI 4EEFG 4HG2A 1DU6A 3CCMI 3ECHA 3FZVA 1PJ5A 1XDUA 1UD5A 1E3HA 4ABZA 4HE6A 4V19K 5F0CA 6PAXA 2QXZA 2KKOA 2QEXB 2R7OA 4H0EA 4A3JJ 4EW9A 3S16J 1W5SA 3CCMB 2O5RA 4AYBA 1HKSA 5ICFA 3HRSA 3S1RJ 2NT6A 3TGNA 4DOZA 5M5WJ 2ZXWH 4BHBA 4EJUA 1XCBA 3FXQA 3VO2A 3KPHA 1Y6IA 1ZQ3P 1Z3XA 1GVHA 4QVAA 4PUSA 1FDRA 4XICA 3L2QA 3ZZUA 2CGPA 1KMHA 1XX5A 3GUDA 1WSRA 3FK6A 1X1AA 4GCVA 2R5YB 1XG1A 2HDNB 4OPWA 1ELOA 1KK3A 2IAIA 2VFQA 1LKXA 3NEUA 4TKOB 1FMWA 1GVJA 4NDLA 3DU1X 3ZUGA 3CP2A 1HF0A 2V4JC 2OUMA 2DK8A 3PSIA 5DUIA 3BWGA 2EFWA 2Q2EB 3ASRA 3S2HJ 3HAGA 1AU7A 2ETHA 2ZMEB 1TVCA 1PE9A 1XS9A 1X3WB 3CMEB 3DEUA 1P7JA 2XNCA 2HOSA 1BI0A 3B4NA 1O57A 2QKMB 2X6WA 3CESA 3VWBA 3TOBA 1LFPA 4UZEA 2X3UA 2EZLA 1SMYF 4KDPA 2XAFA 2VBUA 2A61A 2AQEA 3ZPNA 1RETA 3KE2A 3IH4A 3Q0VA 4D1QA 1E1RA 2VB6A 3S32A 3CCJI 2BM5A 3RYRA 3J81K 1MBJA 2DOEA 2PN6A 3BZCA 4LOCA 4QUZA 5HXBA 5JBQA 4L0ZB 3H3UA 2HPIA 5HLHA 3BCBA 3AKZA 1QHHD 1MMDA 2ZKZA 3OR1C 1V5GA 3JRIA 4KH3A 2V6EA 5F4OA 3GFLA 4Z03A 2XUBA 3B8HA 2KDOA 1ZG1A 3KFWX 1I3AA 1JJ6C 2WZPP 2VC0A 1O8FA 2DMPA 2CH0A 3ZMDA 1H85A 2XHKA 4JX5A 4PC7A 2ID3A 4YFNF 2L5QA 1YW9A 4ENJA 4UUVA 4KNYA 3KP6A 2DT5A 3W6KB 2EIXA 4X7DA 1TZLA 3B6CA 3ELKA 1LE8B 2ZFUA 5HDGA 2BGIA 4M3EA 2GJKA 2L7MP 3ASSA 3BZ6A 2KRCA 1EWYA 1HA3A 1ZM4A 2WTEA 3PNVA 4WWVA 3P27A 1X19A 1ZGAA 5D4SA 3CUQB 1FOWA 5KAIC 1R5ID 4FQGA 1T98A 4NUBA 2XSJC 5LHHA 1XMKA 3V7SA 3D5LA 2C5HA 1MZBA 1QGZA 4M9ZA 1FTTA 2W82A 4JMQA 3SQNA 3E1YE 3V7AA 4Y7NJ 2DDBA 4Y4RA 1HF2A 1PLUA 2IXSA 2LDUA 3QU3A 5GPAA 2XKOA 4IQ4A 1WDTA 4G1VA 4LLLA 1VQMB 1LDJA 5IP9J 3OZVA 1Y1VJ 2CW7A 1VLOA 1X3UA 1YJ9I 1BI3A 1EKEA 3T5XA 3VNVA 3I5UA 3Q39A 1XTAA 3NWSA 2E35A 2AQFA 3DPUA 4F92B 1MABA 4M3DA 1JA1A 1K5CA 3R61A 4NCNA 5FB2A 4CCNA 3MCAA 4HNVA 3JU4A 2L02A 1T2KA 3SJPA 3EUHA 1W5CC 3GXOA 3G71I 5HS7A 2Y75A 4UB8C 3A01B 3GFMA 4I2OA 2R93J 4Y33A 1G8XA 1OGOX 3C2GA 1XD7A 4AF6A 1D0ZA 3H1CA 1YYVA 5FKOA 3OJWA 1K4SA 5FFZA 1X4OA 2A05A 4HF2A 2O0YA 1ETVA 3IRRA 3H3ZA 4P9UA 4TMZA 2CRGA 3OWTA 1CQTA 3DWLE 1IJEA 1FY7A 3TOAA 1D1BA 2PX9A 4BQQA 4YEIA 4ASNA 3ZN1A 4P55A 3IWZA 2GOMA 1QA6A 3BNWA 1I6HJ 4FTHA 1OGMX 5HNFA 2EFPA 1TQIA 1HC8A 5E20A 3T51B 4RD0A 2NSTA 3CUQC 1X0CA 1BMFA 2BV6A 3VMFA 4KKTA 3CPWB 1IUFA 3T8RA 2L9RA 5JLXA 2AO9A 5ILSA 2W7NA 1G7TA 4NB5A 2WJVA 3G4SB 2GXBA 3A0BC 5J6XA 2NV4A 2ZZGA 3OW7A 1I5ZA 4KN7X 2Z3YA 3FF5A 1EH7A 1S3JA 2JWTA 3MAJA 1F43A 4HIZA 1IJFA 4BL0B 3BG5A 3CC7B 1X3ZB 3GYHX 4Y9RA 4DK1A 1FBQA 3F8CA 3OIPA 5EEGA 2FBKA 3CLOA 1PVEA 3K70D 2NOJB 4UUSB 2NTBA 4FE7A 4I02A 5EYRA 3AVVA 5IPAA 1U9OA 3T0YA 4FETA 4BXFA 3ZP5A 4XORA 2VT3A 2EFGA 1I3QJ 2P5KA 4B4DA 1O8MA 2ZSHB 1YLFA 2IGMA 1VI0A 2W84A 2R4GA 1OFCX 4FXUA 1LM1A 4NK8A 3DF8A 3IV5A 2E5NA 4P12A 2LH9A 5BNGA 1ZG5A 2OCCH 1ZYRF 4HX8A 3A01A 5THXA 1R5GA 3RJPA 1BJAA 2Y48A 1KQSB 2BGCA 1JTYA 1NG7A 2JT1A 4BU2A 2EFQA 2I10A 4U0YA 2ZJ2A 3K4NA 2XDVA 3E6CC 2JPBA 3Q9VA 1SKQA 2TRTA 3MKLA 3CJQB 1V5VA 3VPRA 2LD5A 3EUHC 4OOIA 5J1UA 1N07A 2JUGA 1VQKI 1UFMA 2AXLA 1MDMB 3AL0C 2E2HJ 2VQLA 2XTXA 1DGWY 1GQ8A 2CQKA 3JRGA 1VJSA 2YWHA 1GAQA 1QJVA 2VFMA 4Z4VA 1RWRA 3HIFA 3SDGA 4XRSA 4Q5SF 4Y52J 4AF7A 3CCSI 1R1VA 3PO3J 3SEJA 1ETOA 5KNLA 2OTJB 2WADA 4FCYA 2ZFWA 4ZGQB 2W25A 1YS6A 2QSGX 2OTJI 3ABMH 4BQAA 4RB3C 3TO7A 3BT9A 4IHWA 1VHOA 1ZUNB 3B82A 2TDXA 2ZL6A 3CB4A 2DOGA 5F1RA 1T6YA 2C78A 2ESNA 1Y8QB 1U5TB 1WHUA 3DKXA 4MO7A 3J80K 2RREA 1ZLKA 1EFRA 1NHAA 1KK1A 2FXAA 2WC2A 4UVAA 5DCMB 4URRA 1QQIA 1XCVA 4PK4A 3NE5B 1V4RA 3ROUA 2WWYA 2HCJB 2HU9A 2LNBA 3L2RA 2YS9A 2XPUA 5K5RA 3JSPA 1AOYA 2IPQX 1SD4A 1H88C 4OJ6A 1PUEE 2V79A 2VN2A 3E5QA 2QE7A 2CG4A 2K9QA 3DCFA 1Q82D 3ML3A 4M1KA 1MDMA 5CJ9A 1BIBA 3C7JA 4IHSA 4GQNA 4D5CA 1C0WA 2F4NA 1ZGWA 2B9SA 3G73A 2CW8A 4X0GA 4QPOA 2G0YA 3EPZA 2EIJH 1ULYA 3ZOBA 1BN8A 4J19A 1IHMA 2CQXA 4RD3A 4Q4ZF 3QYFA 2ELHA 3V8KA 2GLOA 2V7QA 3BR2A 1X1PA 1HLVA 2EZIA 4M6XA 2KHMA 3VDXA 3N4MA 1WOPA 3BCAA 4CICA 4BYYA 2ICWG 2ZXHA 1POGA 3TDUC 3FX3A 5TY0A 1I50J 3GF2A 1OMIA 2V1DA 4UXNA 3GW2A 4ENKA 5FD5A 2ZB9A 3WTVC 3ZPLA 2XNDA 1WWXA 4UUSA 4XLEA 1EFCA 3IKVA 3S8PA 4W97A 2Q8KA 4DNTB 3BR1A 1FIAA 1VQNB 3K4MA 3IAM2 5IYRA 1YO5C 1BQEA 3RQIA 2QA4B 2Q1ZB 2R7DA 3I58A 4X05A 1QVTA 3N97A 1TTYA 1WGXA 5H20A 5D5UB 3CXCB 2X3HA 2OPTA 2DW4A 1Q86D 2OZ6A 4HPQA 4HRIA 4FWTA 2YUHA 2KRHA 2QENA 2J8IA 1FBSA 1ZG3A 4Y15A 5M5XJ 1J09A 1CGPA 2YX4A 5DCMA 1MRZA 1CLWA 4CZZA 1LEBA 2BHYA 5IT9Z 4HA8A 3SEZA 1ZREA 2V9VA 1OGIA 3VYUB 1O8DA 1JXSA 4YELA 1VNDA 2LK2A 1RIOH 1WRJA 3WBJA 4W8TA 2LKXA 3EDPA 2KIUA 4G7HF 2M8GX 4I7HA 2WAQN 1X1DA 2BXZA 2DU9A 1NB0A 2OV7A 2EA4A 2ZCWA 3H3VK 1YJNB 4RM2A 2F5VA 3GIRA 3A2KA 1MH4A 1X58A 2FMLA 3FKJA 4LFUA 1LFBA 1N75A 4LLNA 1LPQA 2GK6A 3W2FA 5E3OA 3MZHA 3A1PA 5GAHJ 1J9ZA 5A89A 2V5IA 2VKEA 1WVRA 3BLYA 4DZPA 1HW5A 3GSIA 2QUFA 2XIGA 3LJYA 4F3QA 1P4XA 1LDDA 3K4LA 2PJRA 2RVCA 2MABA 1XGNA 4CYCA 2R7ZJ 1WOOA 3HOYJ 3ZQQA 2O0VA 4YZQA 4BACA 2FJ1A 1FNCA 2QGGA 2COBA 1TWAJ 2DFEA 3A03A 2FX0A 4L9NA 4ZDLA 4Q7JB 5EZGA 3PUNA 3DKYA 1W36D 2ZO4A 2QSFX 3HB9A 5KHDA 1A36A 4YFXF 3SYTA 1JJ8C 1VHEA 4ZYEA 2D5VA 4LITA 3IH3A 4M3FA 1O8LA 3E6MA 3A02A 4MLOA 4XK4A 2V31A 3CZ6A 2MSYA 4IX7A 4TMTA 2DMUA 3PNTA 4N9IA 4RGRA 2XGDA 1SFUA 3T53B 3LAJA 4LMYA 2DPUA 3WXMA 3CMAB 3S3NA 4MTEA 1LJ9A 4HLXA 3CCUB 4M0LA 1F1ZA 4NC6A 2B63J 2PMHA 2IOUG 3RDIA 3TW6A 4BY1J 2BN4A 1JJ2B 1W5TA 2DY1A 2IEKA 4H9GA 2Q6OA 2L7FP 1U2RA 2DOFA 4ENMA 3OL3A 1FRQA 1X1CA 2DMQA 4DQLA 2KIQA 1YJWI 2YPRA 3PIOF 5CVVA 2HMAA 3SJZA 1IXCA 1OPCA 4OZZA 2VKHA 3NAUA 2A6HF 1UHSA 3F8NA 3JCUC 1V0FA 4P3IA 2RC4A 3S2WA 4XOTA 1IDZA 4QSHA 3SZPA 4XRFA 4A0YA 4QTRA 3PUMA 1KCCA 2GXAA 3RIQA 3ZQGA 3G05A 4LD5A 5LD2C 4N3NA 1OFEA 3LAPA 2QKLB 4AWXB 3CC7I 1T33A 5J4YA 5GV8A 2W24A 1FIPA 2HOTA 4LB6B 1K83J 5C4JJ 1H89C 1HCRA 4HBLA 5FKNA 4YIIA 3NARA 3GFJA 1I27A 2QM3A 2WSSA 4XSXF 4C43A 3QP5A 2IGOA 2KVOA 1FOYA 3FBIB 3BPXA 2E2JJ 4ESFA 4I6ZA 2CUFA 1A6QA 3OJXA 4AC0A 4YZXA 1FNBA 4UVCA 3F23A 1GUUA 3H0DA 4G7OF 5HS8A 3K6GA 3FK7A 3GZ5A 3DLAA 2JRTA 1D1AA 2WB1N 3DTEA 3U9GA 1T38A 1SD5A 4BE0A 5CVRA 1F5TA 3RI4A 2IS4A 2VOPA 4YZAA 4BEHB 2BE5F 5GAGJ 2ZTNA 4R71A 2JK3A 2XAQA 3WU0A 1A31A 3VYRB 3U21A 4N0BA 4PZJA 2VC1A 2YUSA 3ZMVA 1U3EM 3QPLA 3BTIA 3W2IA 1TYWA 3F9KA 5FKMA 1G4DA 1WCMJ 5J47A 2WB1A 2AHQA 1MBEA 2BM0A 1JKOC 2VJ5A 4BGDA 3TEDA 5J3OA 3QFTA 4ACBA 2RN7A 1P92A 5IK2A 3OYBA 1IXRC 3BY2A 1QRCA 2FEZA 3W2WA 4Q48A 1PDNC 4U87A 2KZVA 5CPRB 3HRMA 2D1VA 1IAWA 2VBXA 2Y30A 2A69F 2VE9A 2Z5UA 1TYVA 2IQ7A 2HWVA 1JKRC 2F2EA 4RAYA 2W85A 1JGSA 3CCRI 1IN5A 4A3BJ 2F3LA 1MKMA 4NBSA 4RDJA 4F52A 4CH7A 1FC3A 5JLWA 1OFLA 2OQGA 2LOOA 1K9MD 4LK1F 4HQMA 3GWZA 3ZQCA 1G3YA 1OCZH 1KTVA 2UUZA 1R5BA 1A6IA 3ASPA 4E7ZA 5K5QA 3HTUA 4PCQA 2P81A 3I4PA 2UXXA 4CA0A 2CK3A 3GQAA 1K8AD 3M8FA 1QGYA 2FVGA 2EV5A 3FM5A 1B9MA 2XPVA 1FSEA 4Z4WA 1BI2A 2VPRA 1Q1VA 4YDTA 1RC9A 2GM4A 2F1LA 5L46A 3C2HA 3TMOA 2MLKA 2FA5A 3CP8A 3J80Z 2VPLA 1GVDA 5HLGA 2BM1A 3H5AA 4KISA 2VFNA 3P4GA 3WY9A 1H9GA 2R7TA 4D9JA 4LG0B 2KT0A 1MMAA 2PMUA 1TLLA 1O8EA 4HX4A 1OQYA 1P4WA 1IV8A 3EUKL 2EB7A 4IF4A 4B44A 3EQNA 2H8WA 2BBYA 1LVAA 3Q0WA 5F08A 3QODA 3CCVI 3LL7A 3SZTA 1WQ2A 1JT6A 1W7PA 4Y13A 1S7EA 2E7XA 4OIRF 3T9GA 2L9VA 2RQQA 4G9YA 1W7PB 2E36A 4BHCA 1X2NA 4ZCMA 2INUA 1ODDA 1AIPA 1KU9A 1RQRA 3K9TA 4M3BA 4OPSA 4X7EA 5IP7J 2M4GA 5EEHA 2K02A 1IG7A 1VQ9I 3MKZA 3HL2A 3V7RA 4ZZDA 3KZYA 4JP0A 2XF6A 3FXJA 1SFEA 4RD2A 1YX3A 3MHPA 2VFPA 3CCUI 3LSPA 1R1UA 2P5VA 5F64A 4E7IA 3VNUA 3B02A 5GPCA 2JSPA 1R7JA 4M6YA 1K6YA 2LC2A 2RQPA 4MIMA 1EF4A 1YHQB 2V7FA 3JAMZ 1K28D 1H42A 4RD4A 1BOBA 2L54A 3QPTA 2XGJA 1RI7A 5DYMA 3CCEI 4XLFA 1GAWA 1Z67A 3GVJA 4P3YA 1VQ6B 2X1CA 5E79C 2K7LA 2XAJA 2IP2A 3I64A 2PLFA 1YRNA 4XLPF 1A5JA 4MEXF 1I6XA 4ITVA 1D1CA 1FX0A 1GO2A 2EWEA 3PVDA 1BW5A 3ML6A 4XSZF 4Z4RA 4PFOA 2I1LA 2E7WA 3FPPA 5DSZA 4I09A 1WZ2A 1UZCA 3ESWB 1P7IA 2KJBA 1XN7A 1QHGA 3OAAA 3LYCA 2JRMA 2M4KA 1EP1B 1X1BA 2FNAA 3IP4B 1EP2B 2V7VA 5BPIA 1QZYA 3CMYA 1DP3A 2NNNA 5ICGA 3KEWA 2C4UA 1IB4A 1I1GA 3GTPJ 1HW1A 2DA4A 1YQAA 1MNEA 1RU4A 3KEOA 4DQ2A 5F27A 3HRTA 2JN6A 1D2EA 3SDBA 1E3OC 3K1NA 5IP6A 2XAGA 4OAYA 1IDKA 1OB2A 3RPUA 3PENA 5E1XA 3BQZA 3PQKA 2K27A 4B1RA 1FBUA 1SFKA 2ZC2A 1OYWA 2Y2ZA 1VQ6I 3CCEB 4A12A 1OFDA 2QY1A 1BR4A 1O7FA 2M2EA 3CCVB 2F5EA 5KW9A 2GIVA 3L00A 3SZEA 1KQ5A 2VJIA 3WNCA 2BSAA 4P26A 1OGJA 3J81k 2HOAA 2F4MB 3FMSA 4ZYAA 1T6ZA 3S1QJ 4X6AJ 1WU8A 3EETA 3AVUA 4MNUA 4NNJA 3HOUJ 1KQ9A 5EJCA 2DI3A 1OISA 1IN7A 3G6EB 5IY5H 1OLTA 2DXIA 3TH0A 3KEYA 4ZGNB 1RUNA 3OYDA 1HKQA 2EZHA 1O8HA 4PGGA 1SFXA 5D5VB 1VQ4B 1TW3A 3DXJF 4L5IA 3DBRB 1FRNA 4RM0A 4HOBA 2XKPA 1RR8C 2E1OA 1J2XA 3VSLA 1K78B 4BBSJ 2EFOA 1MMSA 1XB2A 2HOEA 2OD5A 2LFBA 2JUCA 3HXLA 4MQVA 5D5XB 1S9HA 3I4NJ 1T0FC 2P0WA 4TV7A 1BX1A 4X7FA 1IN4A 2LRDA 1KQ0A 1XE1A 1LLWA 1MBFA 3I54A 3HOXJ 1J0RA 1YI2I 1N8RD 2HTJA 5HODA 3HPHA 1QA3A 2XC1A 2NSPA 1BX0A 3SKBA 4RCZA 3ONYA 5BS6A 3JQPA 3MMYB 1HKTA 4CCJA 4E70A 5FRMA 5JHUA 2KIMA 2FRHA 4OMZA 1Z77A 3BH4A 2NZMA 3HRUA 2QN6A 3ZQIA 1UD6A 1JTXA 3V8LA 3QSYA 3IH2A 5E3LA 3V76A 4B09A 2HVSA 1N0UA 2LF7A 4G6QA 3A3BA 1QO0D 3OMYA 1KRHA 4TT3A 3C2BA 4P96A 4EJOA 2GJPA 3LNQA 4AD9A 1YIJI 1SVMA 1TBXA 1YOVB 4DK0A 3DP7A 1IUYA 3R6SA 2VFOA 1MBKA 2L2OA 2LVSA 1ORKA 4XLCA 5IYCJ 3DFGA 5CVJA 4Q47A 5TRDA 3M1EA 1P6RA 1B4AA 2BVMA 5TR9A 2O8KA 4BH9A 1MJAA 3GTJJ 4BE1A 2ZBKA 2BW3B 4P5OA 4BEHA 1K8FA 5K7HA 3L1PA 1E3PA 3I55I 3WTWC 2LF8A 4XLNF 5LRRA 1HVXA 1HSTA 4C9YA 3J7ZI 4PC2A 3ZQ7A 2HDDA 2DQRA 5TJJA 3LSIA 2HVRA 3UKGA 2VBYA 3OZUA 4Y3OA 1I18A 4OM9A 1YX5A 2A07F 1E43A 5FO0A 4DNRB 3I53A 4LG0A 1R6RA 1KGSA 2I5UA 3LSTA 2R7UA 3DEWA 1K4TA 2L7KA 3S1MJ 4UY8I 4TMWA 5EEAA 1VQOI 1QUEA 2ECCA 3OYIA 2BM7A 4LLGF 1O3QA 2OBRA 1R00A 1X4PA 3E97A 1QBJA 5J8FA 2XEXA 1D5YA 3ZRGA 1TQPA 4A6DA 3CDLA 1FEXA 4G12A 1VLYA 2CS3A 2O7OA 2KMUA 3ABTA 1I8DA 3LFKA 2CRVA 2B7EA 4M9XA 3GTKJ 1Z3YA 2DQLA 2R7VA 4OOXA 3BTLA 2CQNA 1UCRA 3H35A 2GREA 2ISZA 4D7NA 2K9NA 2OBPA 3CMMA 1USTA 5F6FA 3OYNA 3GQ8A 3WGGA 3CTAA 4RMNA 5JVGF 2V4DA 2QQBA 2JN9A 5FL7A 3P26A 2VNJA 1NG6A 2VYQA 1YX2A 4I99C 4HF0A 3I55B 1J7KA 4II3A 4Z2YA 1YITI 1XC5A 2LBFB 2DO7A 3V42A 1DDIA 3P9KA 2BVLA 5GP9A 3M9AA 2YR2A 3VSVA 1UAAA 1Q7YD 4MHGA 2KFDA 1B1BA 2Y0MA 1V0EA 2BXYA 2VIXA 1HQCA 3I59B 4F91B 5ED4A 2WA0A 2M0CA 5JVTA 4YRVA 1JE8A 1WPCA 5H6RA 3OSGA 4ZTJA 2ZZEA 4XN3A 1VQ8I 3LSHA 2C6YA 2M8EA 5EZHA 2NRAC 3R4KA 1YG2A 2O61A 3P9IA 3WHBA 1E0EA 4P2NA 3U2QA 2HNHA 4IQJA 3ASTA 3OOCA 3MN2A 3RKQA 2COMA 1F20A 4F93B 2KRFA 3CMAI 1KU7A 1QU3A 3OYJA 4ZC3A 3ZN0A 2RV8A 2ZMEA 4IHVA 3WTZA 2BY0A 1BI1A 1G7CA 5HKKA 2ZNYA 4FE4A 1R9TJ 2STTA 2OK7A 3W6JB 3G2BA 4G7ZF 1Y8RB 3MWMA 1J9IA 2XT4A 1YJNI 4XKBA 3TQNA 5L3BA 2P7VB 4A3MJ 1A8PA 1N0VC 5DS9A 5LGUA 1RRJA 3OS0A 3V4GA 1SEUA 1U6GA 2F5FA 3E6BA 4PJNA 4P1VA 2DT7B 1QZEA 4OP7A 4P25A 1OCCH 1YITB 5JR3A 2PMZA 2M7AA 4WZKA 3W6VA 1MBHA 4DBQA 4Y9UA 2V9PA 3DLLF 5FIUA 4QLCU 1ERDA 2VBVA 5A88A 4W8QA 1S29A 3R60A 3T8TA 3FY3A 1GXPA 4X8IA 2DYSH 1S0UA 3ERED 1FYMA 1TT5B 5IYPA 4LBYA 2V1UA 4YFOA 3C18A 4WXHA 5TGTA 3OYLA 5DM6F 2ELJA 3QRFF 1FNDA 2JIZA 1ZK8A 2XAUA 2ZSIB 3QYEA 4U9UA 3F6OA 3LA2A 3BPVA 1XMXA 2XC7A 3NAWA 5EMNA 2L9NA 3AGQA 1SAUA 3JRCA 2D74A 3M8EA 5LHIA 5E3MA 2EZKA 5J4VA 4A3LJ 2EILH 4W8SA 2WPDA 2R7QA 2A5YB 1J59A 3O8HA 5FLVA 4E0FA 2W4SA 3OYKA 5KCMA 4ZV4A 2HQ5A 2KJCA 3OYEA 4PAAA 3H92A 1HDPA 3BDDA 4PJLA 3BY1A 2DFHA 5F0FA 3LOCA 5E18F 3E1SA 3E3VA 5AMVA 5L3EA 5J1RA 3HYIA 2R5ZA 4PABA 1M1KD 1NRKA 4M4SA 1YS7A 3R0JA 1UD3A 3OFNA 4QHYA 2L01A 1RKWA 1HXDA 3RKXA 3KP4A 3JW4A 1E3ZA 4FN5A 4QVJA 4YZ0A 1EV7A 3NWTA 4IRGA 3SFZA 1YE9A 3AAFA 3W2EA 4OU0A 5BQTA 4XLHA 3VB2A 4GFBA 1S7AA 2NTPA 2DBBA 5IT9K 2F43A 2XTWA 2JA8J 2Z2SB 5LBQA 1O7LA 2FQ4A 1ETQA 1PP7U 3PSFA 3J7YJ 4A0ZA 1YFHA 2V1XA 2CW5A 2PJPA 1Q1HA 1R23A 2IS2A 3IL2A 4L8JA 2HYJA 4MYTA 2HLDA 3ONUA 2O17A 2O1DA 3AG1H 2X6YA 1MJ9A 4G7XA 2G9WA 1IC8A 3PSSA 1TT0A 1MD0A 1V54H 1EZGA 3W5VA 5TISC 3RPQA 1UB9A 1QRBA 2GA1A 3W2AA 2ZXIA 3CD6I 1FTZA 1EH6A 3GTGJ 1H9TA 1A04A 3GMEA 2VBZA 5LGTA 3PL8A 2JA6J 2R3SA 4P6VF 1J75A 3HOVJ 4ESJA 4A3EJ 3MFKA 4Z05A 1R1TA 5FO5A 2QX3A 4KT6A 3S93A 3GRHA 5FLXK 3MZYA 2HS5A 4GGGA 1TWCJ 4S05A 4Z4ZA 3E0JB 5ILUA 4IVNA 5FKKA 4UV9A 1QPMA 2D9RA 1ENHA 4YFKF 1Y56A 2DODA 3BJ6A 2CV1A 2NOGA 5LLQA 4RLQA 2ISYA 1JT0A 4UZUA 3H9NA 2KZGA 4CHUA 4P22A 4TMVA 2J7KA 1MIJA 4YAUA 3U6KA 3TBIA 3WHCA 5LFAA 3F22A 4U7DA 1Y0NA 4P9FA 4H4KC 4HX7A 2OTLB 3KYLA 1XGSA 4ENNA 4OIPF 3DBLB 4JBAA 1UG0A 2QWWA 1JHHA 2HQRA 3OOPA 2X51A 4B3FX 1D3YA 2GJRA 3BR5A 3L09A 1WJDA 1A35A 3HHHA 2MFZA 3TP0A 1JHFA 2CFOA 2XZPA 1ON1A 1XG2A 3WG7H 3W2VA 4BXUA 1IGNA 4KA4A 1N05A 2VNIA 1ZM9A 2KIFA 1HA8A 3GFIA 3OYMA 3KZZA 1KYWA 1OYIA 1FNMA 2Z16A 2XASA 3FHNA 3LA7A 4M9SA 4Z6YA 3CJRB 1SANA 1E64A 3OOUA 1I7PA 2LLKA 4XONA 3ABLH 5B1BH 5CQGA 4B8XA 4D7MA 1RZ4A 4CQJA 4ZYHA 3AG2H 1UMQA 4AIDA 5DEQA 2Q6IA 1IB0A 4Z4TA 3RY8A 5IOYA 4YIRX 2QCOA 1WH5A 4HZFA 3G3ZA 3H36A 2HQNA 1GV2A 4Z4UA 2IGKA 1F4KA 3RPUD 3Q3SA 2AS5F 3F21A 2Z1DA 2HKXA 4IEJA 3KZIC 2LTPA 2PQ8A 1QX4A 4MQ9F 2JTVA 1JI8A 3S2DJ 1XDSA 4C2UA 2P6TA 2VL8A 4HW0A 2PYGA 4ZJZA 1KA8A 3GVKA 2DLLA 1SKYB 1FOKA 2F48A 1YJWB 3EQLF 4R8HA 2EIKH 3BC8A 3VYTB 1CF7A 3BCDA 2IW5A 4OOSA 4ZZLA 4LK0F 2NNYA 1LEAA 3LQQA 1FPQA 4DBRA 1DG1G 4LBWA 3QAHA 4U0WA 1BBYA 4QIWN 2YU9J 1RKTA 3ZXSA 1Y0YA 1TWHJ 1E62A 2E1MC 1VQLI 2EIMH 4S04A 1VQ7I 1WOSA 4PJMA 3LWFA 5AIPA 2V7WA 2M3AA 2Z8GA 2PEXA 1KCDA 4RGUA 4CYCB 2JJ7A 1R5OA 3HGYA 4XKWA 3CUOA 1IJWC 2MBFA 2WYRA 1FOXA 2Y0SN 4PC3A 4E4HA 5LMZA 1KTWA 2MA3A 5DN6A 4C2LA 2QBYB 3WYAA 2K5CA 5DTDA 1JUPA 3QOEA 5FLXZ 1AWCA 3EQOA 1NK3P 3VMWA 3OYCA 1R5HA 3JTGA 2BV3A 2CBXA 2JA5J 3QOPA 3OYFA 1T39A 3HM5A 4Z4SA 4C2TA 4Z4YA 4S0HB 3AVWA 1DU0A 4F7DA 2EK5A 2VE8A 3CF2A 4Z06A 3GZ6A 2BEOA 1Z0XA 3ONQA 2LKSA 2O6GE 4AIJA 2YX7A 1ZARA 5J3LA 3S3OA 1BPLA 1B8IB 3OS1A 4A3KJ 1VBLA 1L0OC 3CCJB 3CMEI 1CF7B 4DGWB 4EM0B 2W1OA 5K1YA 2XSDC 1KD1D 1BHEA 2RGVA 4EV0A 4LG3A 2CYYA 3PA1A 4HQEA 1T95A 3S3MA 1E2XA 2H8RA 3BH6B 1OR7C 3X2QH 4G6IA 3F3XA 1VQ5B 3WU2C 2WR8A 4HF1A 2OA4A 5HDKA 2FOKA 2RNJA 2VASA 1REPC 4YXWA 3TKYA 3ULQB 2L9SA 3O6BB 3ZR8X 1DUXC 2OYNA 2F1MA 4X06A 1OYYA 2UWMA 4UHTA 1VQ5I 2NVQJ 1MNMC 1E63A 2BY3A 3HOTA 1GJRA 4RM3A 3I9V2 4KMFA 2M34A 3GX4X 1RUOA 3DTIA 2DK5A 2ADUA 4RPBA 4BAYA 3O2PE 4KUMA 2BM4A 4AYBN 4E7HA 3SZGA 2QA4I 3JRDA 4L5JA 3ABKH 3HSFA 1SD6A 1ETXA 2HQAA 2ZNZA 3KLNA 3CCQI 1LQ1A 1BC7C 3OEEA 4M2LA 3UNGC 1O8KA 1Z21A 3AFHA 1FZPB 3I0TA 1W0JA 3ZBUA 3K4KA 2DTZA 1SC7A 3Q38A 4LJZF 3L9FA 3JREA 4OJLA 1TUIA 4TSFA 1SVOA 4IJAA 4NBQA 4RLFA 2OBSA 4HV6A 5B3SH 1VQOB 3M4OJ 4BQNA 1WI3A 2W7ZA 4IZZA 3H0GJ 2CV2A 4KT5C 4N9HA 2K3PA 3JQQA 2NTQA 3FMQA 1MGTA 1HDDC 1AKHB 1AMOA 2EQRA 4WX9A 3LMMA 2Y31A 2LSOA 4IOCF 3PA2A 3AVYA 3FKIJ 2NVXJ 2VOOA 1SMTA 1NDHA 5HLTA 3Q9SA 4BY7J 3BR0A 2B0LA 2L7ZA 2CU7A 3WGHA 3K4BA 3BG7A 2FBHA 4BQOA 1GXQA 3AVTA 2TCTA 2PI0A 4A3GJ 2A6EF 1R49A 3B8YA 4MR0A 2ZTGA 3KEQA 2DPDA 2DERA 4BXXJ 3G1OA 1QVUA 3HKZN 2G7HA 1ZRCA 2H27A 3BC9A 4ZCIA 2MGQA 3HUGA 2X1DA 4JX6A 4MFDA 3FISA 1QG0A 3VFZA 3PO2J 3D0SA 3GZNB 1MBGA 2C4TA 4V2FA 4GYGA 2V7XA 2I8DA 3T1BA 3GTQJ 3TL4X 4HDVA 4FASD 5LGNA 3SY2A 1DGRM 4IOAF 4BKXA 2JMWA 1W0TA 1JUSA 5B1AH 2VT2A 3KP3A 2K4BA 4UV8A 2DYRH 3RYPA 3CO7C 1M90D 2W48A 3M1CA 4DZJA 5M5YJ 2R7FA 3F72A 5F4JA 3QWLA 1QQ1A 4AVZA 2LYCA 4YIFA 1OJLA 3VSUA 1DQUA 2IBDA 5CYVA 4OINF 3E20A 4C3IJ 4FT8A 3VO1A 5L3FA 3P7NA 2XPWA 2BX6A 1KZLA 4YAFA 1VQNI 2CQQA 2FE3A 1ZR2A 2C5BA 2R9VA 2WAFA 5HOOA 1F60A 4L0YB 5DCFA 1N08A 4EGYA 3LQRA 3RKWA 2RNGA 5D5WB 3SHFA 2KDZA 1DDNA 5IT3A 2DJIA 2CQ7A 3FMRA 3OS2A 1LLZA 2ODLA 2JA2A 1G59A 1WTHD 2R7RA 1CQXA 1FLIA 3SUCA 3WG9A 4C3HJ 3WTUC 2MC3A 3KYCB 3K1PA 2R7XA 3D5RC 2DCUA 1DBOA 2XF5A 3C1DA 3P5JA 2XAHA 3P9CA 2E71A 3FDYA 2FD5A 3BOQA 4KJZA 3ZGKA 2QEXI 2JJ2A 5FO1A 4G1BA 2RAEA 3PQJA 1VTNC 3Q5FA 1D5VA 1VQLB 2JPCA 4G94A 3TO6A 1ZTRA 3HJEA 4XQFA 3VSTA 5A2QZ 3J81Z 4A3CJ 1W4MA 5TV2A 1VQ4I 5HLIA 3E7LA 3QU6A 1R4NB 3A35A 2K40A 4DJAA 3F0CA 5CQEA 4ZYGA 2ACJA 3ZMUA 4K2EA 3OY9A 3DDYA 2XTYA 2E60A 4I01A 2W6IA 3REOA 4M74A 2EV0A 4LC0A 1ZM2A 2UVEA 4A93J 3DU5A 3KP2A 1WSVA 2G0EA 2A6TA 2WV1A 3A0HC 3DKWA 2Z33A 4MEYF 2PG4A 2GXGA 4PDKA 3TO9A 2EINH 1WSUA 1UHWA 2DN0A 4IRHA 3M07A 2LZJA 2K9SA 2INVA 3K2AA 5LEKA 4HSTA 2X1EA 3BCFA 4ASUA 4PC1A 5HS9A 1NTCA 4C3JJ 5DUKA 1DP7P 2E2IJ 3IUOA 3IC7A 2F4OB 1Z6RA 2GAUA 1SAXA 4ZCLA 1PUFA 3NQOA 5HDNA 1HG8A 2CC2A 4EVIA 3G1LA 4F7ZA 3RZDJ 1W0UA 2OK8A 5DNSA 4E6KG 4V2GA 1NB9A 3FXOA 3UR3C 4WCGA 2VQGA 5EDNA 2ZBUA 2BM6A 3PFIA 3LA3A 1T6SA 4XRSG 5M3MJ 3H5NA 1U5TA 1EE6A 3ZPPA 1W1WE 4RJLA 2DFFA 2JZYA 3BQYA 2CNDA 2HTSA 4GYIA 4E7SA 4PGHA 3Q3AA 3ZMSA 3BY6A 4M3GA 2KL4A 3L2WA 2ZJRF 1KQ8A 2F4IA 2CUEA 1V5EA 3QPHA 2OTLI 1UMKA 5IYDJ 4X0CA 4I84A 2OAZA 3WQZA 2DOAA 4J00A 2LKPA 1TC3C 5K5OA 3FXUA 1HBXG 3OP1A 3K4CA 3H94A 3LO8A 5FKLA 2G7UA 3MEXA 4ROXA 2N8GA 2F6CA 4R79A 4RAZA 4CCLA 1S72I 2QTZA 1ZRDA 1G7RA 4UB6C 2OJED 1O4XA 1JRGA 1PJ6A 2HR3A 3ZZTA 1P4AA 2X0KA 2KPMA 3CCLI 2MH9A 1K79A 4Z1MA 3CCSB 2R0QC 1OB5A 2P3MA 5EGOB 1FX7A 3CCLB 5A8AA 3IWFA 3CRZA 3AK5A 1N25A 3HC7A 2R5ZB 1K4ZA 1R4MB 1R58A 2UXNA 2IS1A 3QQAA 1P2FA 2FMYA 4WF2A 3LSRA 4IO9F 4OIOF 1ONVA 2RDPA 2BZTA 4M71A 4RAGA 5HVQC 2ZZQA 3N6ZA 1O3SA 9ANTA 2FQ3A 2ZXJA 1DDGA 1B23P 1WJCA 2DDAA 1G2HA 1Y39A 4YEJA 4BBRJ 2IS6A 1FNNA 3JX8A 3IAS2 3JRBA 4XKCA 5KSWB 2LBFA 3F8FA 5M3FJ 1CZFA 3ZQLA 3B78A 3PNYA 2VBKA 2UVFA 1L1IA 1U9NA 4LGWA 2H6CA 4UUTA 3KP5A 1UHMA 1TL8A 1D8KA 2A3SA 1B6AA 3L2CA 2CV0A 2CJJA 1SM4A 1IN6A 1YI2B 1TSPA 4JYKA 3KRGA 3I3LA 2VODA 3CCRB 3ZIAA 3JRAA 4BE2A 1XSDA 5BSXA 1WXRA 3JRFA 2GOXB 5B5EC 4XL9A 1CNFA 1YIOA 4A5MA 2EFNA 4XOPA 4YC5A 3CJNA 2PECA 4WXCA 5F0HA 2JVGA 1QFZA 1WJFA 5H5JA 2X6XA 1ZR4A 2BGJA 1BW6A 3R6JA 1Y1WJ 5E3NA 2ZMEC 2MC4A 1YTYA 3W2GA 2YSRA 1G7SA 3RCOA 4AC9A 2V26A 4N4NB 4B4CA 3B73A 4A5NA 1B8IA 3ZCOA 4XNFA 2DFIA 1T6XA 1PKVA 3N90A 4U4BA 2X53S 2XGEA 4RGXA 4DYQA 5H59A 1IA5A 4UNOA 2ESHA 2E34A 2JA7J 3U1KA 5C3EJ 4ACAA 2VQHA 3OKXA 4GXOA 3IRQA 1G3WA 3PJRA 2FBIA 5J40A 1X2MA 1F9NA 3L2UA 2GQQA 4CCOA 3HSEA 3MMPA 3HEFA 4YALA 5H6QA 2BY1A 3QPSA 4YAWA 4KKUA 3LSGA 2VI6A 1O3RA 3FKSA 2RC5A 4QFMA 1TP4A 3LFUA 1FSHA 1HOMA 4XD7A 1VF7A 4X7CA 2LR8A 4HEA2 2VBSA 2EV6A 4CCMA 1NJID 3W2HA 1R22A 2NVYJ 4G6TB 1MJBA 4EGZA 3ASNH 3I56B 1NK2P 3WTSC 5LHGA 1U8RA 3R0AA 1IN8A 2GQFA 1HW2A 5GTHC 1FYKA 3VEPA 2GBYA 5KAFC 1W2BB 3ZZ0A 4HAMA 3K70C 2CMPA 2IVMA 2QVOA 2VONA 2Q0OA 3QFRA 2V6CA 3A4CA 3DU6A 1LFUP 3SEQA 3J7AO 1Y0RA 3LSMA 4MTDA 3A3GA 2J5PA 4FHTA 2X9DA 1AHDP 3RIRA 2LREA 4J0QA 4DYRA 3GTOJ 1W0KA 1D1NA 3C3WA 1JTAA 2CFXA 2QTLA 4ESBA 2WZNA 2OQRA 1USSA 1QGPA 2NT9A 1JA0A 3H9QA 1LB2A 1VQPB 2KQRA 1P4MA 3K0LA 3JR9A 2PLYA 1OOCA 1QA2A 4EATA 1JKQC 3OYHA 4XM3A 1GR1A 1O8JA 1XSXA 5CLSA 2NXNB 1KJZA 1VQ8B 5DS0A 2M1BA 5CVIA 1K61A 1SD7A 3ZC3A 1FJLA 4DIQA 4HLYA 3I1FA 2FF4A 1TYXA 2VBWA 4M72A 3GO5A 1VZ0A 3HUGB 1YRNB 1O8GA 3PUFA 4MYUA 2D45A 1B72B 3M7GA 3MCZA 4EH1A 2E1MB 3JTHA 3WE3A 1E17A 2FNPA 4XBFA 1QRYA 3TP3A 3V7CA 1DPUA 4KICA 4L9JA 2FU4A 3DPTA 2DYIA 2VBMA 2MD5A 4O6JA 4L18B 2J5OA 2BMWA 4IHXA 1TWFJ 1FP1D 3U6BA 2XVCA 1KONA 2XOKA 1F36A 3QFCA 4DNCA 3O3KA 1IDJA 2NS7A 2O3FA 3FM3A 2W6JA 3WU1B 1UJ8A 2ELKA 3CDHA 2IA0A 3Q6RA 4LBZA 2KP6A 2YWGA 2JVHA 3CUQA 1PJ7A 3GCMA 4C30A 3G1MA 1RPWA 4BUPA 4E7LA 1OCPA 4RA2A 3CC2I 2L4MA 1UD2A 3B6AA 3MD2A 5C4XJ 2LP0A 1H8HA 2EH3A 3CPXA 1VF9A 4CXFA 2B0RA 3WTXC 4L9TA 3WNDA 3LQEA 1SVLA 2HZTA 3KL9A 3ISPA 3CC2B 4KFCA 3BR6A 2QLZA 2LY9A 3EUAA 2HZDA 1GLNA 2WY8Q 4CYDA 3WTYC 4O3MA 1XQBA 1U78A 3BJAA 2LG4A 5D4RA 3AL0B 1BL0A 5DD4A 1HSJA 2UV1A 1Y0UA 3K1MA 5L3DA 5IYQA 2HFHA 3RQ4A 3IKTA 2O6WA 2DA6A 3CQZJ 4JK1X 5HZBA 2BPOA 5J8CA 1T5EA 2WBMA 1KYZA 2LMDA 3K10A 1EA0A 5CVUA 1BJZA 1NH3A 4HV5A 1MSFC 1W9XA 5DDGA 3PSZA 4CCKA 2HXIA 4MGRA 1ETYA 2E5ZA 4HDUA 2R7WA 1K78A 4XRMA 2HGCA 5L3GA 2EA2A 2O03A 3RTRA 1MW7A 2DMNA 2IGNA 1L3LA 1JB9A 4RDUA 4GRIA 3CDIA 1LE8A 1U8BA 1H8AC 2MW8A 5JI6A 3A8JA 3ASQA 1QGAA 3OE7A 4PC6A 2RC6A 1BN5A 1W34A 4CSWA 3EYYA 4CUGA 5C44J 3W5HA 2BY2A 4OJ5A 1G6NA 3M3YJ 3BG6A 1RNLA 2QF7A 1WJBA 1LNWA 2DA5A 3E6DA 1JNYA 2BHZA 2Q2EA 4OZYA 1IXSB 2HDCA 3TW7A 3BTJA 1JGGA 2MH2A 2GIZA 4WZLA 4ANJA 4RDLA 1ZELA 2XV4S 3B90A 3H9JA 4I0AA 3CF5F 1W35A 1RESA 1DPRA 4D5FA 1WORA 2QZ8A 4RAFA 1MH3A 3OIQA 5IOZA 1U2WA 2JSCA 1YJ9B 3BJOA 4N4OB 2W00A 4X07A 1GHCA 3F8MA 3AG3H 2NAZA 1EFTA 1KK2A 1S7OA 1N78A 2GK7A 1JUMA 2F5DA 2DIEA 4WK8F 2HEOA 1WI9A 1ZM3A 5CKTA 4A3DJ 3AGPA 2XGXA 3DPLC 2JQ7A 3LMWA 1BR2A 4BS9A 2OC6A 1PJRA 2BW3A 3D26A 4RLZA 4UAJA 1YHQI 2R5YA 1Z05A 1ZAOA 3BR3A 1APLC 2M5SA 3GQBA 5IYNA 5B6IA 2YWFA 4GDFA 1ITYA 1BA5A 5ILVA 5BSYA 3FXLA 2H94A 2VXDA 2QQ8A 3Q0UA 4IPAA 2K3FA 3K7AJ 2BVNA 2YU3A 5JLVC 1Z1DA 4IXAA 2K85A 2MG4A 2B7BA 3SQVA 1D0YA 5B66C 1VQPI 2DT6A 4G6DA 1LDKB 2EWNA 4OAZA 2PIAA 2B5OA 1T0FA 3F6VA 2H09A 2X4HA 5JFRA 3LVBA 3M8JA 1XFOA 2OZUA 2FSWA 3ZBTA 2C77A 3HHGA 4AUXA 3SLNA 3I71A 4BDYA 5JMCB 1QH0A 1LVKA 3MKYB 3S17J 5D8LB 4IL6C 4A3FJ 4OIQF 3ZMTA 4U88A 2NVTJ 1XB4A 4ZTFA 1IF1A 4KMUX 1QFJA 4OJPA 4G7WA 5FRNA 4B3GA 3CCQB 4I98B 3CW2A 1E1QA 3OPOA 2OU2A 1O3TA 3A8KA 3HBLA 1G3TA 2QDXA 1RMGA 1YW8A 1EJ9A 3SFIA 1IV6A 2DA2A 3ZQHA 2E1NA 3VR6A 1BC8C 2D3LA 4RDKA 2V1NA 2M0MA 1R5NA 1DBGA 2QYUA 1K6OA 1QPIA 3PIPF 4F55A 3OIOA 1B72A 2H1KA 2LY1A 4BJ6C 4ZDPA 2M5WA 3I4MJ 5K7FA 1S6LA 4L5EA 3GVAA 3CC4I 3E5XA 5FROA 5DV5A 1RQPA 5D8KB 3MQ0A 3NB2A 5DD8A 3ERMA 1NHCA 5FLMJ 5FD6A 3PFYA 2HXOA 2K9MA 3HDDA 2XF7A 4MXNA 4A2UA 2VZLA 5DM7F 4FX0A 3OSFA 5J35A 3OL4A 4U49A 3VYSB 4FISA 4G5GA 2K4JA 4PSXA 1OB0A 1D8JA 4P1WA 4M6VA 3ABUA 3OV8A 4Y17A 2ME0A 2ZZFA 1Z9CA 1Z91A 2ME6A 1R71A 1GDTA 3OYAA 2VUMJ 5C1EA 4CDGA 4EM1A 1I39A 2PYHA 2DA1A 1K7AA 4EJWA 3GEZA 3KP7A 3FHZA 2M45A 3SLDA 3CO6C 1PUFB 1XGOA 5E1ZB 3HTSB 1TQMA 1U0JA 4EQQA 3WTTC 2D2WA 5GADJ 1E3XA 3K4JA 1H8EA 1QVGB 4WXDA 3AG4H 4RCYA 2DTRA 4XLAA 4CZCA 2M87A 4OPVA 5CDFA 3K69A 4XR6A 3BP8A 2HPMA 3BG9A 1EFUA 1O88A 3RKYA 3U2RA 4PSWA 5E8IA 2Z6BD 4EJTA 2P8TA 4C0SA 1QVFB 3GQ7A 4RB2C 4O5VA 4IRIA 2ZITA 3T56B 4IHTA 2PMDA 1IO2A 4KIFA 2PJRB 4DYCA 1WKMA 2VNKA 1FYLA 5ICEA 4RD1A 4B3XA 2E19A 2W57A 5D6FA 4LB5A 2HI3A 1H0MA 1QCXA 3WODF 2IRFG 2J8KA 5GAEJ 2OF7A 2D3NA 2V7TA 2AXTC 4PJ0C 5ERIA 1XPXA 1DARA 2CUJA 3KCCA 2Q6LA 4JRAC 3ZSCA 1XSVA 4XKVA 3S15J 2CUZA 4P6YA 3HG9A 4AU7A 1ETWA 1WH7A 4P9SA 4WZTA 2XGCA 1QNTA 4E7JA 3GTMJ 1S5LC 4BNCA 2FOWA 2VKDA 2AHOA 2ZJPF 4DQKA 3CCYA 1XGMA 1IRXA 5EG0A 1WP6A 5IYWA 5LRSA 1CNEA 4EM2A 3HOWJ 3UW0A 3OYGA 3WGIA 2A5WA 4A69C 2QSHX 3OEHA 1JKPC 3L2VA 2F5CA 1H80A 3J7AY 4EMSA 3D5SC 3E5UA 3BQJA 3W5UA 1ZKGA 2D1HA 2GA2A 3KLOA 5FJ8J 4A3IJ 4II2A 5F4MA 3HGGA 2VQCA 2VJJA 1I1SA 1U5TC 1TWGJ 2P7CB 3CD6B 2VJ4A 3HKZA 1MMNA 2O9LA 2E1BA 1ETKA 4KIBA 4W8RA 2BF4A 2NS0A 3QYBA 3F8BA 5GV7A 1QFYA 2NPFA 1S8NA 2DJNA 4YAOA 3KIOA 3JRHA 3KYDB 2X8KA 2DEUA 2QQAA 3GVLA 1UG2A 4CGZA 3LNNA 1DABA 1ZN2A 1V5FA 2EJRA 4A0XA 4HNTA 4OWRB 5JHFA 2FUG2 3ECOA 5E8GA 3COAC 4FK8A 4YCQA 3FXKA 4R1HA 2CWEA 2KLOA 2PE3A 2XNJA 5C1CA 3PETA 2XB0X 2XROA 5E17F 3JURA 4J01A 1VQ7B 4MFEA 4WZEA 4N3GA 2NYXA 2C2WA 1QZZA 1FT9A 1N77A 3FBNB 4CO8A 1UELB 4QV2A 2WAQA 3DV8A 1Z7UA 4LIUA 1V55H 1TYUA 1UD4A 4W1UA 3JQRA 4Y7CA 5FA6A 2ZL5A 4ON0A 3W3CA 5ICCA 2JJ1A 3OR2C 2MYSA 2EPFA 4NC8A 1PYVA 4A6EA 1B2RA 3SYJA 2XZOA 1T56A 2A68F 5HNHA 2QYOA 3BG3A 4B47A 4BJ5C 3DTKA 1XMAA 4ZYDA 2STWA 3FPKA 4YG2F 3A8IA 5FGMA 2GWRA 4HWVA 3VODA 3BTCA 4BHPA 2M30A 2V9KA 3EYIA 3KX2A 1IDYA 3SJMA 4TMXA 3GLLA 3I56I 1KZHA 1RR7A 5D6EA 2Q6KA 1GV5A 4IHYA 4RBOA 3QFSA 2MLGA 3OZWA 1OCTC 1BR1A 4RS8A 2HKOA 2Z9OA 2Y69H 4B43A 4UVBA 3BROA 3FXRA 4I76A 4U7BA 2RKHA 1D8TA 1Z7LA 3NRVA 1BLIA 4BDZA 4X1EA 4DW6A 4AM3A 2WY7Q 3BH7B 2IJLA 1LUJB 2L3DA 4I0BA 2HYFA 4UZFA 1EA3A 2CO5A 4HNUA 4YHBA 4XIDA 2B7CA 2HDWA 1VQ9B 2DA3A 2XRNA 5FFXA 4HE5A 3CC4B 2QMUA 2NS8A 2O04A 4AIKA 5F04A 1W36C 1VQKB 1ON2A 2QBYA 1WJ5A 3JSOA 3R6KA 2L0KA 3HOZJ 4IW3B 4RGSA 1IW7F 1T08B 2DMTA 1W87A 2P4WA 4B3AA 1KU3A 1R36A 2VKVA 1TNTA 5E6TA 2X6OA 3DQVC 4GO1A 5E1WA 4BPRA 2IA2A 1MSEC 3S1NJ 1OFMA 1P9QC 2OBTA 3U1DA 3FXMA 4NQWA 4JOMA 2E1CA 4KYWA 1HZEA 1ZGJA 3A1YA 4JQFA 4OPOA 2WJYA 3WE2A 1OR7A 2JDIA 1FMVA 2XRLA 4NC7A 3QE2A 3QP6A 3LSKA 5F1JA 4KN4X 2VBTA 1T8IA 1EH8A 2V7UA 1QA1A 1ACIA 3PM1A 5EGOA 5LEJA 4B48A 2IT0A 4RB0A 1IRGA 3AVXA 3H5RA 2NVUB 3HSRA 2LY2A 2BYVE 2Z99A 1PP8F 1B59A 1WPKA 3GLXA 3LSJA 4NHJA 3Q6QA 4K1XA 1MNDA 4KIGA 3JAMK 5KVRA 2Y9ZA 1S72B 4HSRA 1WJEA 1YW7A 3LQ6A 1ZLJA 1OKRA 3DEEA 4PJJA 3G6EI 4HYEA 4RD6A 3V8JA 4U0VA 2XT2A 1OCRH 3GBGA 4OJOA 1KK0A 2GZWA 2Y0SA 1EP3B
chains in the Genus database with same CATH topology
4CCMA 2X6YA 1E79A 4G7XA 4G6TB 3ZQQA 2O0VA 4YZQA 4BACA 1TT0A 4QPQA 4XMYA 4ZDLA 1WMRA 3DKYA 1W36D 3W2AA 1D0XA 2ZXIA 5KHDA 2XZLA 1AA7A 3SYTA 4LITA 3VSKA 3K70C 3PL8A 2CMPA 2K9LA 1O8LA 1UD8A 4MLOA 3A4CA 3DU6A 4Z05A 2V31A 3SEQA 3HOSA 3CZ6A 3MKWB 4IX7A 3LSMA 2QX3A 3A3GA 3PNTA 4KT6A 3T53B 3S93A 3S3NA 1COWA 2O0WA 3GRHA 2LREA 1JTAA 1PXZA 1W0KA 4LIVA 2VXZA 3E0JB 1WFXA 2WAEA 1Y56A 3RSNA 3OL3A 2CV1A 4RLQA 1X1CA 4ZDOA 4UZUA 2NT9A 4P22A 3H9QA 2KQRA 4OZZA 2VKHA 3TBIA 3WWGA 1OOCA 1V0FA 4EATA 4XOTA 4XM3A 3OYHA 5LFAA 1O8JA 4H4KC 3KYLA 1KCCA 1UG0A 3G05A 2M7BA 5LD2C 2X51A 2QKLB 4DIQA 4B3FX 4XN0A 2GJRA 1MMGA 2HVQA 1VZ0A 1WJDA 3HUGB 1O8GA 2MFZA 2WSSA 1O8IA 3H9GA 2CFOA 2IGOA 2KVOA 2XZPA 2E1MB 1XG2A 3FBIB 3W2VA 1OHHA 4YZXA 2VBEA 1HA8A 3OYMA 3DPTA 2VBMA 3H0DA 2BSPA 2Z16A 3FHNA 2DCEA 3K6GA 3GQ9A 3HPGA 3CJRB 3DLAA 2XOKA 1D1AA 1KONA 3DTEA 4NQWB 4KKSA 1IDJA 3OOUA 1WJAA 4BE0A 4PMHA 4XONA 2IS4A 4YZAA 5CQGA 4BEHB 2MD0A 2W6JA 2ZTNA 2KP6A 3VYRB 4IKFA 3U21A 2JVHA 4C30A 4NK6A 2VLAA 3F9KA 4BUPA 1NBMA 4E7LA 2X85A 2WB1A 4KITB 2IGKA 1UD2A 3RPUD 3MD2A 4BJTA 2Z1DA 1H8HA 2VJ5A 4BGDA 4E7KA 5IK2A 1AIRA 4PFPA 3OYBA 3W2WA 3N05A 4U87A 2BOLA 2KZVA 5CPRB 2R7SA 3PUBA 1JI8A 3VMVA 4C2UA 2VL8A 2PYGA 3EUAA 4HG2A 4ZJZA 2IQ7A 2HZDA 1GLNA 3GVKA 1UD5A 1SKYB 2WY8Q 3BC8A 3VYTB 3BCDA 2LG4A 4F52A 2QXZA 4CH7A 3AL0B 1OFLA 2LOOA 2UV1A 2R7OA 4EW9A 2O5RA 4DBRA 4AYBA 2UUZA 3RQ4A 2NT6A 3ZXSA 4E7ZA 4DOZA 3GQAA 4CA0A 2E1MC 2CK3A 4PJMA 1T5EA 1Y6IA 2WBMA 1Z3XA 2M3AA 4PUSA 3K10A 2Z8GA 1KCDA 3L2QA 4XKWA 1W9XA 3C2HA 1KMHA 3TMOA 4CCKA 4E4HA 1X1AA 1KTWA 2VPLA 2E5ZA 3CP8A 5DN6A 2R7WA 4OJ5A 4C2LA 3H5AA 4KISA 1LKXA 2K5CA 1FMWA 2R7TA 3QOEA 4TKOB 3EQOA 3RTRA 3VMWA 1MW7A 4D9JA 2IGNA 3CP2A 3OYCA 4GRIA 1MMAA 1O8EA 2V4JC 2OUMA 3PSIA 3OYFA 3OE7A 3EUKL 2Q2EB 4B44A 3HAGA 4C2TA 3EQNA 4CSWA 4CUGA 1PE9A 3QODA 3LL7A 3BG6A 3T9GA 4Z06A 1WJBA 3CF2A 2RQQA 4OZYA 3B4NA 2INUA 2QKMB 3CESA 2X6WA 3ONQA 3VWBA 3S3OA 1LFPA 4ANJA 2M4GA 1BPLA 1ZELA 3OS1A 1VBLA 3B90A 3H9JA 3MKZA 3HL2A 2AQEA 4DGWB 2W1OA 1BHEA 3ZPNA 2XF6A 4LG3A 1YX3A 3OIQA 1T95A 4E7IA 3S3MA 4D1QA 4N4OB 2W00A 1E1RA 1OR7C 2VB6A 2JSPA 3S32A 4G6IA 1K6YA 2LC2A 1N78A 2GK7A 2DIEA 2V7FA 1K28D 2VASA 5CKTA 4YXWA 3DPLC 3LMWA 1BOBA 2XGJA 1BR2A 2L9SA 2HPIA 3ZR8X 4BS9A 2OC6A 1PJRA 2BW3A 3BCBA 1QHHD 3AKZA 4XLFA 2F1MA 2UWMA 3GVJA 1MMDA 2X1CA 3OR1C 1V5GA 2V6EA 2M5SA 3GQBA 3HOTA 4ITVA 1D1CA 3I9V2 4RM3A 1FX0A 2EWEA 4Z03A 2KDOA 3DTIA 4PFOA 2VXDA 2WZPP 3FPPA 4E7HA 1O8FA 3SZGA 2CH0A 1D0YA 2L5QA 2DT6A 1QHGA 2HQAA 3OAAA 1LDKB 4OAZA 3OEEA 1O8KA 3UNGC 1Z21A 2M4KA 3AFHA 1X1BA 3IP4B 1W0JA 1TZLA 3K4KA 1DP3A 2ZFUA 3KEWA 3M8JA 2GJKA 4OJLA 1IB4A 4TSFA 2KRCA 4RLFA 3PNVA 1X19A 4BDYA 4BQNA 1MNEA 1LVKA 4IZZA 3MKYB 1RU4A 4NUBA 2CV2A 3SDBA 2XSJC 2K3PA 3D5LA 4ZTFA 2NTQA 4OAYA 1IDKA 4OJPA 4G7WA 3LMMA 2W82A 4JMQA 5FRNA 4B3GA 1SFKA 5HLTA 1E1QA 3OPOA 4Y4RA 1PLUA 2IXSA 2QY1A 1BR4A 4IQ4A 1RMGA 4BQOA 3K4BA 3BG7A 3VR6A 2VJIA 4MR0A 2D3LA 3B8YA 2ZTGA 2V1NA 2CW7A 2M0MA 4ZYAA 1DBGA 3BC9A 4NNJA 2X1DA 4F55A 2LY1A 4BJ6C 4ZDPA 3NWSA 1OLTA 2DXIA 2AQFA 3KEYA 3DPUA 3OYDA 4F92B 1MABA 1O8HA 5FROA 2I8DA 1K5CA 3TL4X 1NHCA 4FASD 1DGRM 3PFYA 4CCNA 2K9MA 4MXNA 2XF7A 3JU4A 3VSLA 3M1CA 3OL4A 4U49A 3VYSB 4Y33A 1G8XA 2LYCA 3HXLA 3C2GA 4AVZA 4PSXA 1OB0A 1OGOX 1DQUA 4P1WA 1S9HA 1D0ZA 1T0FC 2P0WA 3VSUA 2ZZFA 2LRDA 1X4OA 3OYAA 1KZLA 3OWTA 5C1EA 3DWLE 3HPHA 2R9VA 2WAFA 5HOOA 2PYHA 2NSPA 1D1BA 4BQQA 2RNGA 2GOMA 3MMYB 2DJIA 1OGMX 3OS2A 2ODLA 4CCJA 2JA2A 5HNFA 1G59A 1WTHD 1U0JA 2R7RA 3SUCA 5FRMA 3T51B 3BH4A 1E3XA 3K4JA 1H8EA 2NSTA 2NZMA 1X0CA 1BMFA 2R7XA 1UD6A 4XLAA 4CZCA 4KKTA 3D5RC 5CDFA 1DBOA 2W7NA 2XF5A 2WJVA 4KJZA 4XR6A 2HPMA 2HVSA 3FDYA 3ZGKA 2JJ2A 3A3BA 1O88A 4PSWA 2Z6BD 3OMYA 3GQ7A 4TT3A 2ZZGA 3OW7A 2GJPA 3T56B 4DK0A 4HIZA 2PJRB 2L2OA 4XLCA 4XQFA 4BL0B 3VSTA 2BVMA 1QCXA 4B3XA 4DK1A 4BE1A 3OIPA 2BW3B 2D3NA 3A35A 4P5OA 4BEHA 3K70D 2CUJA 3ZSCA 2NOJB 2NTBA 4DJAA 1HVXA 4XKVA 5CQEA 2CUZA 3OY9A 3HG9A 4AU7A 4C9YA 4FETA 4BXFA 4XORA 3DDYA 4E7JA 3LSIA 2HVRA 2ZSHB 1O8MA 4Y3OA 2E60A 2IGMA 2W6IA 1YX5A 1E43A 2VKDA 4DNRB 2R4GA 1I18A 2UVEA 3DU5A 1R6RA 4FXUA 1WP6A 1IRXA 2A6TA 2E5NA 2R7UA 4NK8A 3UW0A 2L7KA 2LH9A 3OYGA 2A5WA 3OEHA 3L2VA 4BU2A 1NG7A 3OYIA 1H80A 3K4NA 1X4PA 2XDVA 3J7AY 3D5SC 2LZJA 3ZRGA 2INVA 1VLYA 2CS3A 3CJQB 2KMUA 4HSTA 1I8DA 3EUHC 2X1EA 2JUGA 3AL0C 4II2A 3BCFA 4ASUA 1Z3YA 2R7VA 2VQCA 2VQLA 2VJJA 1DGWY 3H35A 1GQ8A 1VJSA 3IUOA 1QJVA 2VJ4A 3HKZA 1RWRA 3CMMA 1MMNA 3OYNA 2E1BA 3GQ8A 1HG8A 4W8RA 4RMNA 2V4DA 5FL7A 3QYBA 1NG6A 5KNLA 2WADA 4E6KG 2X8KA 3GVLA 3UR3C 2VQGA 4II3A 3LNNA 1V5FA 2LBFB 3V42A 4HNTA 3H5NA 4OWRB 2BVLA 5JHFA 2FUG2 1EE6A 3VSVA 3ZPPA 1UAAA 4E7SA 1V0EA 2VIXA 2KLOA 4F91B 2WA0A 5C1CA 2KL4A 4YRVA 3L2WA 1WPCA 2ZZEA 4ZTJA 3JURA 3DKXA 4XN3A 4J01A 2F4IA 3LSHA 1V5EA 2RREA 1EFRA 4I84A 3WQZA 2DOAA 4J00A 1E0EA 4URRA 1N77A 3FBNB 4PK4A 1UELB 3NE5B 2HNHA 4IQJA 2WAQA 3OOCA 4LIUA 3K4CA 3H94A 2HU9A 1UD4A 4F93B 3L2RA 1QU3A 2F6CA 4R79A 3OYJA 3W3CA 2JJ1A 4ZC3A 3OR2C 2MYSA 4NC8A 4CCLA 1PYVA 4OJ6A 2XZOA 2QE7A 1JRGA 5HNHA 5HKKA 4B47A 4BJ5C 2KPMA 3DTKA 3G2BA 4Z1MA 4HWVA 4XKBA 4GQNA 2V9KA 3HC7A 3KX2A 3OS0A 2CW8A 2IS1A 4X0GA 4PJNA 4QPOA 2DT7B 3EPZA 1BR1A 1BN8A 2PMZA 2M7AA 2ZZQA 5HVQC 4B43A 4DBQA 3QYFA 4U7BA 1ERDA 2V7QA 1Z7LA 1BLIA 4BDZA 3VDXA 1WJCA 2KHMA 3FY3A 4W8QA 3BCAA 4YEJA 2IS6A 2WY7Q 2ZXHA 3IAS2 4XKCA 2LBFA 1CZFA 5TGTA 3OYLA 2ELJA 1EA3A 2JIZA 4HNUA 3PNYA 2HDWA 2XAUA 2ZSIB 3QYEA 2XNDA 2O04A 4XLEA 2UVFA 2VBKA 1W36C 3S8PA 2CV0A 2XC7A 1WJ5A 4DNTB 3KRGA 2L9NA 3K4MA 3I3LA 3IAM2 1SAUA 2Q1ZB 3ZIAA 4BE2A 3DQVC 4W8SA 2WPDA 2GOXB 2R7QA 4XL9A 1OFMA 2X3HA 4XOPA 4E0FA 1P9QC 2W4SA 3OYKA 5KCMA 4HPQA 4HRIA 4JOMA 2PECA 2KRHA 3OYEA 1HZEA 4JQFA 2JVGA 3A1YA 1WJFA 1J09A 2X6XA 2WJYA 4PJLA 2MC4A 2JDIA 3RCOA 2V26A 1FMVA 3E1SA 4N4NB 4NC7A 3SEZA 5AMVA 3ZCOA 4XNFA 3VYUB 3LSKA 1O8DA 4YELA 1PKVA 4U4BA 2X53S 1NRKA 4W8TA 1UD3A 3OFNA 4B48A 1IA5A 1X1DA 1E3ZA 2OV7A 2VQHA 4YZ0A 3H5RA 4RM2A 3NWTA 2LY2A 4HEA2 1YE9A 2F5VA 3PJRA 3A2KA 4XLHA 3FKJA 1N75A 3L2UA 1MNDA 2GK6A 2NTPA 4CCOA 2F43A 2Z2SB 4HSRA 1WJEA 3DEEA 4PJJA 3BLYA 3PSFA 3LSGA 3FKSA 4KKUA 4XD7A 2O17A 3LFUA 2IS2A 4L8JA 4F3QA 3GBGA 3K4LA 2HLDA 2O1DA 1VF7A 2PJRA 4OJOA 2Y0SA 2MABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQA A;  2X6Y A;  2O0V A;  4YZQ A;  1EE6 A;  3ZPP A;  3VSV A;  4XMY A;  2Z8G A;  1WMR A;  1KCD A;  1O8H A;  1K5C A;  5C1C A;  4XKW A;  1NHC A;  3JUR A;  4XN3 A;  1KTW A;  4OJ5 A;  4C2L A;  1O8L A;  4MXN A;  4I84 A;  3VMW A;  3EQO A;  4URR A;  4Z05 A;  4U49 A;  2QX3 A;  1O8E A;  4AVZ A;  1OGO X;  3EQN A;  3GRH A;  2O0W A;  3VSU A;  1JTA A;  1PE9 A;  1PXZ A;  4OJ6 A;  1JRG A;  4Z06 A;  3T9G A;  4OZY A;  3B4N A;  2INU A;  5C1E A;  2X6W A;  2PYH A;  4HWV A;  2NSP A;  2NT9 A;  1VBL A;  3B90 A;  4OZZ A;  1BHE A;  1OGM X;  2ODL A;  3WWG A;  1OOC A;  3SUC A;  4XOT A;  4XM3 A;  1BN8 A;  1O8J A;  2NST A;  2NZM A;  1X0C A;  1KCC A;  4XLA A;  1DBO A;  4XR6 A;  4W8Q A;  1O88 A;  4XN0 A;  3FY3 A;  4YEJ A;  3GQ7 A;  1O8G A;  3LMW A;  1CZF A;  1O8I A;  4XLF A;  4XLC A;  2VBK A;  1XG2 A;  4XQF A;  2O04 A;  2UVF A;  4XLE A;  3VST A;  1QCX A;  4YZX A;  2VBE A;  2EWE A;  4Z03 A;  3KRG A;  2VBM A;  3ZSC A;  2BSP A;  2NTB A;  4XKV A;  1O8F A;  3GQ9 A;  4W8S A;  4XL9 A;  1OFM A;  2X3H A;  4XOP A;  4XOR A;  1IDJ A;  4PMH A;  1O8M A;  1O8K A;  4XON A;  2PEC A;  4YZA A;  2UVE A;  2X6X A;  4NK8 A;  3UW0 A;  4OJL A;  1IB4 A;  4NK6 A;  5AMV A;  2X85 A;  4XNF A;  1O8D A;  4YEL A;  4U4B A;  1H80 A;  1RU4 A;  4W8T A;  1IA5 A;  1AIR A;  2INV A;  2NTQ A;  1IDK A;  4YZ0 A;  4OJP A;  3VMV A;  2PYG A;  2VJJ A;  4XLH A;  2IQ7 A;  1GQ8 A;  1QJV A;  2NTP A;  1PLU A;  1RWR A;  2QY1 A;  1RMG A;  3GQ8 A;  1HG8 A;  4W8R A;  2QXZ A;  2VJI A;  1OFL A;  4MR0 A;  3B8Y A;  4EW9 A;  2O17 A;  1DBG A;  2O1D A;  4OJO A;  2NT6 A; 
#chains in the Genus database with same CATH topology
 1SFO J;  1E79 A;  4PGO A;  1TLH B;  2H1L A;  4QPQ A;  3O8G A;  2CSO A;  1KC8 D;  4XMY A;  2GPJ A;  1WMR A;  1QUF A;  4AVP A;  1D0X A;  2XZL A;  1AA7 A;  4LBV A;  4EJV A;  5GTI C;  1V3F A;  4QWQ A;  2FX3 A;  4OOV A;  3VSK A;  1YIJ B;  2K9L A;  1OCO H;  2DAO A;  1VFC A;  1ZH5 A;  3BZK A;  4RPD A;  1UD8 A;  3HZJ A;  3CJT B;  1N06 A;  1J5Y A;  4FX4 A;  2L4A A;  3HOS A;  3MKW B;  4TN1 A;  1BJK A;  3TDZ C;  5EG0 B;  3SXY A;  5AON A;  1FP2 A;  3WBK A;  2ECB A;  5A2Q K;  2ZL7 A;  2QGU A;  3ISX A;  1COW A;  3DBH B;  4WQM A;  1TTT A;  2P6S A;  2O0W A;  1PXZ A;  2QZA A;  4LIV A;  1BOA A;  2VXZ A;  2DA7 A;  1WFX A;  2EBI A;  3ASO H;  4G8X A;  4OMY A;  1AKH A;  2WAE A;  2KIS A;  3IHU A;  2CF4 A;  3ZQF A;  3RSN A;  2R92 J;  2PBI A;  3L7W A;  4ZDO A;  2WV0 A;  4C2M J;  4WWC A;  3VOE A;  4M53 A;  4ZH4 F;  5BPD A;  1BM9 A;  2HYG D;  1Q81 D;  3WWG A;  1M1E B;  2K86 A;  2DET A;  3ES9 A;  2ZJQ F;  3WNB A;  3OW2 B;  1FWZ A;  3S14 J;  1IRF A;  1EXM A;  2M7B A;  2H6B A;  5L3C A;  3KET A;  2ZBV A;  1Q9S A;  1W7P D;  4XN0 A;  1VQM I;  3K2Z A;  2Y9Y A;  2UZK A;  5K7Z A;  1MMG A;  2QQ9 A;  2HVQ A;  5BOX A;  2OCE A;  3FWE A;  3H09 A;  2PMZ N;  1STZ A;  2P5L C;  3H9G A;  1O8I A;  5AIQ A;  1ZRF A;  2XB5 A;  3G4S I;  4JX4 A;  2IA1 A;  1OHH A;  3MVP A;  1IRZ A;  1TW2 A;  2E1R A;  3CLQ A;  2O8X A;  2VBE A;  2X48 A;  1BIA A;  1S4M A;  4M73 A;  2BSP A;  4D0P A;  5J1Y A;  1GT0 C;  5AN9 A;  4V02 C;  2DCE A;  3GQ9 A;  5BMZ A;  3HPG A;  4ETS A;  4NQW B;  5FNZ A;  2CW0 F;  3I59 A;  1Z6T A;  3FJO A;  4KKS A;  1WJA A;  4L9V A;  4PMH A;  2X0L A;  2MD0 A;  2PFB A;  1TNS A;  1B9N A;  1IZ1 A;  1YLO A;  4IKF A;  4NK6 A;  2ID6 A;  2VLA A;  1NBM A;  3RZO J;  4AIH A;  5HZA A;  2X85 A;  3MZ8 A;  5IYB J;  3GTL J;  4KIT B;  5EF6 A;  4BJT A;  1KU2 A;  3ZMZ A;  1K73 D;  5KK1 A;  4E7K A;  1AIR A;  3FIW A;  2VNH A;  4PFP A;  4RB1 A;  2YWE A;  1G3S A;  3N05 A;  2R6H A;  2BOL A;  3G71 B;  3VMV A;  2R7S A;  3PUB A;  5H2F C;  1ZHF A;  2M9H A;  3D1N I;  4EEF G;  4HG2 A;  1DU6 A;  3CCM I;  3ECH A;  3FZV A;  1PJ5 A;  1XDU A;  1UD5 A;  1E3H A;  4ABZ A;  4HE6 A;  4V19 K;  5F0C A;  6PAX A;  2QXZ A;  2KKO A;  2QEX B;  2R7O A;  4H0E A;  4A3J J;  4EW9 A;  3S16 J;  1W5S A;  3CCM B;  2O5R A;  4AYB A;  1HKS A;  5ICF A;  3HRS A;  3S1R J;  2NT6 A;  3TGN A;  4DOZ A;  5M5W J;  2ZXW H;  4BHB A;  4EJU A;  1XCB A;  3FXQ A;  3VO2 A;  3KPH A;  1Y6I A;  1ZQ3 P;  1Z3X A;  1GVH A;  4QVA A;  4PUS A;  1FDR A;  4XIC A;  3L2Q A;  3ZZU A;  2CGP A;  1KMH A;  1XX5 A;  3GUD A;  1WSR A;  3FK6 A;  1X1A A;  4GCV A;  2R5Y B;  1XG1 A;  2HDN B;  4OPW A;  1ELO A;  1KK3 A;  2IAI A;  2VFQ A;  1LKX A;  3NEU A;  4TKO B;  1FMW A;  1GVJ A;  4NDL A;  3DU1 X;  3ZUG A;  3CP2 A;  1HF0 A;  2V4J C;  2OUM A;  2DK8 A;  3PSI A;  5DUI A;  3BWG A;  2EFW A;  2Q2E B;  3ASR A;  3S2H J;  3HAG A;  1AU7 A;  2ETH A;  2ZME B;  1TVC A;  1PE9 A;  1XS9 A;  1X3W B;  3CME B;  3DEU A;  1P7J A;  2XNC A;  2HOS A;  1BI0 A;  3B4N A;  1O57 A;  2QKM B;  2X6W A;  3CES A;  3VWB A;  3TOB A;  1LFP A;  4UZE A;  2X3U A;  2EZL A;  1SMY F;  4KDP A;  2XAF A;  2VBU A;  2A61 A;  2AQE A;  3ZPN A;  1RET A;  3KE2 A;  3IH4 A;  3Q0V A;  4D1Q A;  1E1R A;  2VB6 A;  3S32 A;  3CCJ I;  2BM5 A;  3RYR A;  3J81 K;  1MBJ A;  2DOE A;  2PN6 A;  3BZC A;  4LOC A;  4QUZ A;  5HXB A;  5JBQ A;  4L0Z B;  3H3U A;  2HPI A;  5HLH A;  3BCB A;  3AKZ A;  1QHH D;  1MMD A;  2ZKZ A;  3OR1 C;  1V5G A;  3JRI A;  4KH3 A;  2V6E A;  5F4O A;  3GFL A;  4Z03 A;  2XUB A;  3B8H A;  2KDO A;  1ZG1 A;  3KFW X;  1I3A A;  1JJ6 C;  2WZP P;  2VC0 A;  1O8F A;  2DMP A;  2CH0 A;  3ZMD A;  1H85 A;  2XHK A;  4JX5 A;  4PC7 A;  2ID3 A;  4YFN F;  2L5Q A;  1YW9 A;  4ENJ A;  4UUV A;  4KNY A;  3KP6 A;  2DT5 A;  3W6K B;  2EIX A;  4X7D A;  1TZL A;  3B6C A;  3ELK A;  1LE8 B;  2ZFU A;  5HDG A;  2BGI A;  4M3E A;  2GJK A;  2L7M P;  3ASS A;  3BZ6 A;  2KRC A;  1EWY A;  1HA3 A;  1ZM4 A;  2WTE A;  3PNV A;  4WWV A;  3P27 A;  1X19 A;  1ZGA A;  5D4S A;  3CUQ B;  1FOW A;  5KAI C;  1R5I D;  4FQG A;  1T98 A;  4NUB A;  2XSJ C;  5LHH A;  1XMK A;  3V7S A;  3D5L A;  2C5H A;  1MZB A;  1QGZ A;  4M9Z A;  1FTT A;  2W82 A;  4JMQ A;  3SQN A;  3E1Y E;  3V7A A;  4Y7N J;  2DDB A;  4Y4R A;  1HF2 A;  1PLU A;  2IXS A;  2LDU A;  3QU3 A;  5GPA A;  2XKO A;  4IQ4 A;  1WDT A;  4G1V A;  4LLL A;  1VQM B;  1LDJ A;  5IP9 J;  3OZV A;  1Y1V J;  2CW7 A;  1VLO A;  1X3U A;  1YJ9 I;  1BI3 A;  1EKE A;  3T5X A;  3VNV A;  3I5U A;  3Q39 A;  1XTA A;  3NWS A;  2E35 A;  2AQF A;  3DPU A;  4F92 B;  1MAB A;  4M3D A;  1JA1 A;  1K5C A;  3R61 A;  4NCN A;  5FB2 A;  4CCN A;  3MCA A;  4HNV A;  3JU4 A;  2L02 A;  1T2K A;  3SJP A;  3EUH A;  1W5C C;  3GXO A;  3G71 I;  5HS7 A;  2Y75 A;  4UB8 C;  3A01 B;  3GFM A;  4I2O A;  2R93 J;  4Y33 A;  1G8X A;  1OGO X;  3C2G A;  1XD7 A;  4AF6 A;  1D0Z A;  3H1C A;  1YYV A;  5FKO A;  3OJW A;  1K4S A;  5FFZ A;  1X4O A;  2A05 A;  4HF2 A;  2O0Y A;  1ETV A;  3IRR A;  3H3Z A;  4P9U A;  4TMZ A;  2CRG A;  3OWT A;  1CQT A;  3DWL E;  1IJE A;  1FY7 A;  3TOA A;  1D1B A;  2PX9 A;  4BQQ A;  4YEI A;  4ASN A;  3ZN1 A;  4P55 A;  3IWZ A;  2GOM A;  1QA6 A;  3BNW A;  1I6H J;  4FTH A;  1OGM X;  5HNF A;  2EFP A;  1TQI A;  1HC8 A;  5E20 A;  3T51 B;  4RD0 A;  2NST A;  3CUQ C;  1X0C A;  1BMF A;  2BV6 A;  3VMF A;  4KKT A;  3CPW B;  1IUF A;  3T8R A;  2L9R A;  5JLX A;  2AO9 A;  5ILS A;  2W7N A;  1G7T A;  4NB5 A;  2WJV A;  3G4S B;  2GXB A;  3A0B C;  5J6X A;  2NV4 A;  2ZZG A;  3OW7 A;  1I5Z A;  4KN7 X;  2Z3Y A;  3FF5 A;  1EH7 A;  1S3J A;  2JWT A;  3MAJ A;  1F43 A;  4HIZ A;  1IJF A;  4BL0 B;  3BG5 A;  3CC7 B;  1X3Z B;  3GYH X;  4Y9R A;  4DK1 A;  1FBQ A;  3F8C A;  3OIP A;  5EEG A;  2FBK A;  3CLO A;  1PVE A;  3K70 D;  2NOJ B;  4UUS B;  2NTB A;  4FE7 A;  4I02 A;  5EYR A;  3AVV A;  5IPA A;  1U9O A;  3T0Y A;  4FET A;  4BXF A;  3ZP5 A;  4XOR A;  2VT3 A;  2EFG A;  1I3Q J;  2P5K A;  4B4D A;  1O8M A;  2ZSH B;  1YLF A;  2IGM A;  1VI0 A;  2W84 A;  2R4G A;  1OFC X;  4FXU A;  1LM1 A;  4NK8 A;  3DF8 A;  3IV5 A;  2E5N A;  4P12 A;  2LH9 A;  5BNG A;  1ZG5 A;  2OCC H;  1ZYR F;  4HX8 A;  3A01 A;  5THX A;  1R5G A;  3RJP A;  1BJA A;  2Y48 A;  1KQS B;  2BGC A;  1JTY A;  1NG7 A;  2JT1 A;  4BU2 A;  2EFQ A;  2I10 A;  4U0Y A;  2ZJ2 A;  3K4N A;  2XDV A;  3E6C C;  2JPB A;  3Q9V A;  1SKQ A;  2TRT A;  3MKL A;  3CJQ B;  1V5V A;  3VPR A;  2LD5 A;  3EUH C;  4OOI A;  5J1U A;  1N07 A;  2JUG A;  1VQK I;  1UFM A;  2AXL A;  1MDM B;  3AL0 C;  2E2H J;  2VQL A;  2XTX A;  1DGW Y;  1GQ8 A;  2CQK A;  3JRG A;  1VJS A;  2YWH A;  1GAQ A;  1QJV A;  2VFM A;  4Z4V A;  1RWR A;  3HIF A;  3SDG A;  4XRS A;  4Q5S F;  4Y52 J;  4AF7 A;  3CCS I;  1R1V A;  3PO3 J;  3SEJ A;  1ETO A;  5KNL A;  2OTJ B;  2WAD A;  4FCY A;  2ZFW A;  4ZGQ B;  2W25 A;  1YS6 A;  2QSG X;  2OTJ I;  3ABM H;  4BQA A;  4RB3 C;  3TO7 A;  3BT9 A;  4IHW A;  1VHO A;  1ZUN B;  3B82 A;  2TDX A;  2ZL6 A;  3CB4 A;  2DOG A;  5F1R A;  1T6Y A;  2C78 A;  2ESN A;  1Y8Q B;  1U5T B;  1WHU A;  3DKX A;  4MO7 A;  3J80 K;  2RRE A;  1ZLK A;  1EFR A;  1NHA A;  1KK1 A;  2FXA A;  2WC2 A;  4UVA A;  5DCM B;  4URR A;  1QQI A;  1XCV A;  4PK4 A;  3NE5 B;  1V4R A;  3ROU A;  2WWY A;  2HCJ B;  2HU9 A;  2LNB A;  3L2R A;  2YS9 A;  2XPU A;  5K5R A;  3JSP A;  1AOY A;  2IPQ X;  1SD4 A;  1H88 C;  4OJ6 A;  1PUE E;  2V79 A;  2VN2 A;  3E5Q A;  2QE7 A;  2CG4 A;  2K9Q A;  3DCF A;  1Q82 D;  3ML3 A;  4M1K A;  1MDM A;  5CJ9 A;  1BIB A;  3C7J A;  4IHS A;  4GQN A;  4D5C A;  1C0W A;  2F4N A;  1ZGW A;  2B9S A;  3G73 A;  2CW8 A;  4X0G A;  4QPO A;  2G0Y A;  3EPZ A;  2EIJ H;  1ULY A;  3ZOB A;  1BN8 A;  4J19 A;  1IHM A;  2CQX A;  4RD3 A;  4Q4Z F;  3QYF A;  2ELH A;  3V8K A;  2GLO A;  2V7Q A;  3BR2 A;  1X1P A;  1HLV A;  2EZI A;  4M6X A;  2KHM A;  3VDX A;  3N4M A;  1WOP A;  3BCA A;  4CIC A;  4BYY A;  2ICW G;  2ZXH A;  1POG A;  3TDU C;  3FX3 A;  5TY0 A;  1I50 J;  3GF2 A;  1OMI A;  2V1D A;  4UXN A;  3GW2 A;  4ENK A;  5FD5 A;  2ZB9 A;  3WTV C;  3ZPL A;  2XND A;  1WWX A;  4UUS A;  4XLE A;  1EFC A;  3IKV A;  3S8P A;  4W97 A;  2Q8K A;  4DNT B;  3BR1 A;  1FIA A;  1VQN B;  3K4M A;  3IAM 2;  5IYR A;  1YO5 C;  1BQE A;  3RQI A;  2QA4 B;  2Q1Z B;  2R7D A;  3I58 A;  4X05 A;  1QVT A;  3N97 A;  1TTY A;  1WGX A;  5H20 A;  5D5U B;  3CXC B;  2X3H A;  2OPT A;  2DW4 A;  1Q86 D;  2OZ6 A;  4HPQ A;  4HRI A;  4FWT A;  2YUH A;  2KRH A;  2QEN A;  2J8I A;  1FBS A;  1ZG3 A;  4Y15 A;  5M5X J;  1J09 A;  1CGP A;  2YX4 A;  5DCM A;  1MRZ A;  1CLW A;  4CZZ A;  1LEB A;  2BHY A;  5IT9 Z;  4HA8 A;  3SEZ A;  1ZRE A;  2V9V A;  1OGI A;  3VYU B;  1O8D A;  1JXS A;  4YEL A;  1VND A;  2LK2 A;  1RIO H;  1WRJ A;  3WBJ A;  4W8T A;  2LKX A;  3EDP A;  2KIU A;  4G7H F;  2M8G X;  4I7H A;  2WAQ N;  1X1D A;  2BXZ A;  2DU9 A;  1NB0 A;  2OV7 A;  2EA4 A;  2ZCW A;  3H3V K;  1YJN B;  4RM2 A;  2F5V A;  3GIR A;  3A2K A;  1MH4 A;  1X58 A;  2FML A;  3FKJ A;  4LFU A;  1LFB A;  1N75 A;  4LLN A;  1LPQ A;  2GK6 A;  3W2F A;  5E3O A;  3MZH A;  3A1P A;  5GAH J;  1J9Z A;  5A89 A;  2V5I A;  2VKE A;  1WVR A;  3BLY A;  4DZP A;  1HW5 A;  3GSI A;  2QUF A;  2XIG A;  3LJY A;  4F3Q A;  1P4X A;  1LDD A;  3K4L A;  2PJR A;  2RVC A;  2MAB A;  1XGN A;  4CYC A;  2R7Z J;  1WOO A;  3HOY J;  3ZQQ A;  2O0V A;  4YZQ A;  4BAC A;  2FJ1 A;  1FNC A;  2QGG A;  2COB A;  1TWA J;  2DFE A;  3A03 A;  2FX0 A;  4L9N A;  4ZDL A;  4Q7J B;  5EZG A;  3PUN A;  3DKY A;  1W36 D;  2ZO4 A;  2QSF X;  3HB9 A;  5KHD A;  1A36 A;  4YFX F;  3SYT A;  1JJ8 C;  1VHE A;  4ZYE A;  2D5V A;  4LIT A;  3IH3 A;  4M3F A;  1O8L A;  3E6M A;  3A02 A;  4MLO A;  4XK4 A;  2V31 A;  3CZ6 A;  2MSY A;  4IX7 A;  4TMT A;  2DMU A;  3PNT A;  4N9I A;  4RGR A;  2XGD A;  1SFU A;  3T53 B;  3LAJ A;  4LMY A;  2DPU A;  3WXM A;  3CMA B;  3S3N A;  4MTE A;  1LJ9 A;  4HLX A;  3CCU B;  4M0L A;  1F1Z A;  4NC6 A;  2B63 J;  2PMH A;  2IOU G;  3RDI A;  3TW6 A;  4BY1 J;  2BN4 A;  1JJ2 B;  1W5T A;  2DY1 A;  2IEK A;  4H9G A;  2Q6O A;  2L7F P;  1U2R A;  2DOF A;  4ENM A;  3OL3 A;  1FRQ A;  1X1C A;  2DMQ A;  4DQL A;  2KIQ A;  1YJW I;  2YPR A;  3PIO F;  5CVV A;  2HMA A;  3SJZ A;  1IXC A;  1OPC A;  4OZZ A;  2VKH A;  3NAU A;  2A6H F;  1UHS A;  3F8N A;  3JCU C;  1V0F A;  4P3I A;  2RC4 A;  3S2W A;  4XOT A;  1IDZ A;  4QSH A;  3SZP A;  4XRF A;  4A0Y A;  4QTR A;  3PUM A;  1KCC A;  2GXA A;  3RIQ A;  3ZQG A;  3G05 A;  4LD5 A;  5LD2 C;  4N3N A;  1OFE A;  3LAP A;  2QKL B;  4AWX B;  3CC7 I;  1T33 A;  5J4Y A;  5GV8 A;  2W24 A;  1FIP A;  2HOT A;  4LB6 B;  1K83 J;  5C4J J;  1H89 C;  1HCR A;  4HBL A;  5FKN A;  4YII A;  3NAR A;  3GFJ A;  1I27 A;  2QM3 A;  2WSS A;  4XSX F;  4C43 A;  3QP5 A;  2IGO A;  2KVO A;  1FOY A;  3FBI B;  3BPX A;  2E2J J;  4ESF A;  4I6Z A;  2CUF A;  1A6Q A;  3OJX A;  4AC0 A;  4YZX A;  1FNB A;  4UVC A;  3F23 A;  1GUU A;  3H0D A;  4G7O F;  5HS8 A;  3K6G A;  3FK7 A;  3GZ5 A;  3DLA A;  2JRT A;  1D1A A;  2WB1 N;  3DTE A;  3U9G A;  1T38 A;  1SD5 A;  4BE0 A;  5CVR A;  1F5T A;  3RI4 A;  2IS4 A;  2VOP A;  4YZA A;  4BEH B;  2BE5 F;  5GAG J;  2ZTN A;  4R71 A;  2JK3 A;  2XAQ A;  3WU0 A;  1A31 A;  3VYR B;  3U21 A;  4N0B A;  4PZJ A;  2VC1 A;  2YUS A;  3ZMV A;  1U3E M;  3QPL A;  3BTI A;  3W2I A;  1TYW A;  3F9K A;  5FKM A;  1G4D A;  1WCM J;  5J47 A;  2WB1 A;  2AHQ A;  1MBE A;  2BM0 A;  1JKO C;  2VJ5 A;  4BGD A;  3TED A;  5J3O A;  3QFT A;  4ACB A;  2RN7 A;  1P92 A;  5IK2 A;  3OYB A;  1IXR C;  3BY2 A;  1QRC A;  2FEZ A;  3W2W A;  4Q48 A;  1PDN C;  4U87 A;  2KZV A;  5CPR B;  3HRM A;  2D1V A;  1IAW A;  2VBX A;  2Y30 A;  2A69 F;  2VE9 A;  2Z5U A;  1TYV A;  2IQ7 A;  2HWV A;  1JKR C;  2F2E A;  4RAY A;  2W85 A;  1JGS A;  3CCR I;  1IN5 A;  4A3B J;  2F3L A;  1MKM A;  4NBS A;  4RDJ A;  4F52 A;  4CH7 A;  1FC3 A;  5JLW A;  1OFL A;  2OQG A;  2LOO A;  1K9M D;  4LK1 F;  4HQM A;  3GWZ A;  3ZQC A;  1G3Y A;  1OCZ H;  1KTV A;  2UUZ A;  1R5B A;  1A6I A;  3ASP A;  4E7Z A;  5K5Q A;  3HTU A;  4PCQ A;  2P81 A;  3I4P A;  2UXX A;  4CA0 A;  2CK3 A;  3GQA A;  1K8A D;  3M8F A;  1QGY A;  2FVG A;  2EV5 A;  3FM5 A;  1B9M A;  2XPV A;  1FSE A;  4Z4W A;  1BI2 A;  2VPR A;  1Q1V A;  4YDT A;  1RC9 A;  2GM4 A;  2F1L A;  5L46 A;  3C2H A;  3TMO A;  2MLK A;  2FA5 A;  3CP8 A;  3J80 Z;  2VPL A;  1GVD A;  5HLG A;  2BM1 A;  3H5A A;  4KIS A;  2VFN A;  3P4G A;  3WY9 A;  1H9G A;  2R7T A;  4D9J A;  4LG0 B;  2KT0 A;  1MMA A;  2PMU A;  1TLL A;  1O8E A;  4HX4 A;  1OQY A;  1P4W A;  1IV8 A;  3EUK L;  2EB7 A;  4IF4 A;  4B44 A;  3EQN A;  2H8W A;  2BBY A;  1LVA A;  3Q0W A;  5F08 A;  3QOD A;  3CCV I;  3LL7 A;  3SZT A;  1WQ2 A;  1JT6 A;  1W7P A;  4Y13 A;  1S7E A;  2E7X A;  4OIR F;  3T9G A;  2L9V A;  2RQQ A;  4G9Y A;  1W7P B;  2E36 A;  4BHC A;  1X2N A;  4ZCM A;  2INU A;  1ODD A;  1AIP A;  1KU9 A;  1RQR A;  3K9T A;  4M3B A;  4OPS A;  4X7E A;  5IP7 J;  2M4G A;  5EEH A;  2K02 A;  1IG7 A;  1VQ9 I;  3MKZ A;  3HL2 A;  3V7R A;  4ZZD A;  3KZY A;  4JP0 A;  2XF6 A;  3FXJ A;  1SFE A;  4RD2 A;  1YX3 A;  3MHP A;  2VFP A;  3CCU I;  3LSP A;  1R1U A;  2P5V A;  5F64 A;  4E7I A;  3VNU A;  3B02 A;  5GPC A;  2JSP A;  1R7J A;  4M6Y A;  1K6Y A;  2LC2 A;  2RQP A;  4MIM A;  1EF4 A;  1YHQ B;  2V7F A;  3JAM Z;  1K28 D;  1H42 A;  4RD4 A;  1BOB A;  2L54 A;  3QPT A;  2XGJ A;  1RI7 A;  5DYM A;  3CCE I;  4XLF A;  1GAW A;  1Z67 A;  3GVJ A;  4P3Y A;  1VQ6 B;  2X1C A;  5E79 C;  2K7L A;  2XAJ A;  2IP2 A;  3I64 A;  2PLF A;  1YRN A;  4XLP F;  1A5J A;  4MEX F;  1I6X A;  4ITV A;  1D1C A;  1FX0 A;  1GO2 A;  2EWE A;  3PVD A;  1BW5 A;  3ML6 A;  4XSZ F;  4Z4R A;  4PFO A;  2I1L A;  2E7W A;  3FPP A;  5DSZ A;  4I09 A;  1WZ2 A;  1UZC A;  3ESW B;  1P7I A;  2KJB A;  1XN7 A;  1QHG A;  3OAA A;  3LYC A;  2JRM A;  2M4K A;  1EP1 B;  1X1B A;  2FNA A;  3IP4 B;  1EP2 B;  2V7V A;  5BPI A;  1QZY A;  3CMY A;  1DP3 A;  2NNN A;  5ICG A;  3KEW A;  2C4U A;  1IB4 A;  1I1G A;  3GTP J;  1HW1 A;  2DA4 A;  1YQA A;  1MNE A;  1RU4 A;  3KEO A;  4DQ2 A;  5F27 A;  3HRT A;  2JN6 A;  1D2E A;  3SDB A;  1E3O C;  3K1N A;  5IP6 A;  2XAG A;  4OAY A;  1IDK A;  1OB2 A;  3RPU A;  3PEN A;  5E1X A;  3BQZ A;  3PQK A;  2K27 A;  4B1R A;  1FBU A;  1SFK A;  2ZC2 A;  1OYW A;  2Y2Z A;  1VQ6 I;  3CCE B;  4A12 A;  1OFD A;  2QY1 A;  1BR4 A;  1O7F A;  2M2E A;  3CCV B;  2F5E A;  5KW9 A;  2GIV A;  3L00 A;  3SZE A;  1KQ5 A;  2VJI A;  3WNC A;  2BSA A;  4P26 A;  1OGJ A;  3J81 k;  2HOA A;  2F4M B;  3FMS A;  4ZYA A;  1T6Z A;  3S1Q J;  4X6A J;  1WU8 A;  3EET A;  3AVU A;  4MNU A;  4NNJ A;  3HOU J;  1KQ9 A;  5EJC A;  2DI3 A;  1OIS A;  1IN7 A;  3G6E B;  5IY5 H;  1OLT A;  2DXI A;  3TH0 A;  3KEY A;  4ZGN B;  1RUN A;  3OYD A;  1HKQ A;  2EZH A;  1O8H A;  4PGG A;  1SFX A;  5D5V B;  1VQ4 B;  1TW3 A;  3DXJ F;  4L5I A;  3DBR B;  1FRN A;  4RM0 A;  4HOB A;  2XKP A;  1RR8 C;  2E1O A;  1J2X A;  3VSL A;  1K78 B;  4BBS J;  2EFO A;  1MMS A;  1XB2 A;  2HOE A;  2OD5 A;  2LFB A;  2JUC A;  3HXL A;  4MQV A;  5D5X B;  1S9H A;  3I4N J;  1T0F C;  2P0W A;  4TV7 A;  1BX1 A;  4X7F A;  1IN4 A;  2LRD A;  1KQ0 A;  1XE1 A;  1LLW A;  1MBF A;  3I54 A;  3HOX J;  1J0R A;  1YI2 I;  1N8R D;  2HTJ A;  5HOD A;  3HPH A;  1QA3 A;  2XC1 A;  2NSP A;  1BX0 A;  3SKB A;  4RCZ A;  3ONY A;  5BS6 A;  3JQP A;  3MMY B;  1HKT A;  4CCJ A;  4E70 A;  5FRM A;  5JHU A;  2KIM A;  2FRH A;  4OMZ A;  1Z77 A;  3BH4 A;  2NZM A;  3HRU A;  2QN6 A;  3ZQI A;  1UD6 A;  1JTX A;  3V8L A;  3QSY A;  3IH2 A;  5E3L A;  3V76 A;  4B09 A;  2HVS A;  1N0U A;  2LF7 A;  4G6Q A;  3A3B A;  1QO0 D;  3OMY A;  1KRH A;  4TT3 A;  3C2B A;  4P96 A;  4EJO A;  2GJP A;  3LNQ A;  4AD9 A;  1YIJ I;  1SVM A;  1TBX A;  1YOV B;  4DK0 A;  3DP7 A;  1IUY A;  3R6S A;  2VFO A;  1MBK A;  2L2O A;  2LVS A;  1ORK A;  4XLC A;  5IYC J;  3DFG A;  5CVJ A;  4Q47 A;  5TRD A;  3M1E A;  1P6R A;  1B4A A;  2BVM A;  5TR9 A;  2O8K A;  4BH9 A;  1MJA A;  3GTJ J;  4BE1 A;  2ZBK A;  2BW3 B;  4P5O A;  4BEH A;  1K8F A;  5K7H A;  3L1P A;  1E3P A;  3I55 I;  3WTW C;  2LF8 A;  4XLN F;  5LRR A;  1HVX A;  1HST A;  4C9Y A;  3J7Z I;  4PC2 A;  3ZQ7 A;  2HDD A;  2DQR A;  5TJJ A;  3LSI A;  2HVR A;  3UKG A;  2VBY A;  3OZU A;  4Y3O A;  1I18 A;  4OM9 A;  1YX5 A;  2A07 F;  1E43 A;  5FO0 A;  4DNR B;  3I53 A;  4LG0 A;  1R6R A;  1KGS A;  2I5U A;  3LST A;  2R7U A;  3DEW A;  1K4T A;  2L7K A;  3S1M J;  4UY8 I;  4TMW A;  5EEA A;  1VQO I;  1QUE A;  2ECC A;  3OYI A;  2BM7 A;  4LLG F;  1O3Q A;  2OBR A;  1R00 A;  1X4P A;  3E97 A;  1QBJ A;  5J8F A;  2XEX A;  1D5Y A;  3ZRG A;  1TQP A;  4A6D A;  3CDL A;  1FEX A;  4G12 A;  1VLY A;  2CS3 A;  2O7O A;  2KMU A;  3ABT A;  1I8D A;  3LFK A;  2CRV A;  2B7E A;  4M9X A;  3GTK J;  1Z3Y A;  2DQL A;  2R7V A;  4OOX A;  3BTL A;  2CQN A;  1UCR A;  3H35 A;  2GRE A;  2ISZ A;  4D7N A;  2K9N A;  2OBP A;  3CMM A;  1UST A;  5F6F A;  3OYN A;  3GQ8 A;  3WGG A;  3CTA A;  4RMN A;  5JVG F;  2V4D A;  2QQB A;  2JN9 A;  5FL7 A;  3P26 A;  2VNJ A;  1NG6 A;  2VYQ A;  1YX2 A;  4I99 C;  4HF0 A;  3I55 B;  1J7K A;  4II3 A;  4Z2Y A;  1YIT I;  1XC5 A;  2LBF B;  2DO7 A;  3V42 A;  1DDI A;  3P9K A;  2BVL A;  5GP9 A;  3M9A A;  2YR2 A;  3VSV A;  1UAA A;  1Q7Y D;  4MHG A;  2KFD A;  1B1B A;  2Y0M A;  1V0E A;  2BXY A;  2VIX A;  1HQC A;  3I59 B;  4F91 B;  5ED4 A;  2WA0 A;  2M0C A;  5JVT A;  4YRV A;  1JE8 A;  1WPC A;  5H6R A;  3OSG A;  4ZTJ A;  2ZZE A;  4XN3 A;  1VQ8 I;  3LSH A;  2C6Y A;  2M8E A;  5EZH A;  2NRA C;  3R4K A;  1YG2 A;  2O61 A;  3P9I A;  3WHB A;  1E0E A;  4P2N A;  3U2Q A;  2HNH A;  4IQJ A;  3AST A;  3OOC A;  3MN2 A;  3RKQ A;  2COM A;  1F20 A;  4F93 B;  2KRF A;  3CMA I;  1KU7 A;  1QU3 A;  3OYJ A;  4ZC3 A;  3ZN0 A;  2RV8 A;  2ZME A;  4IHV A;  3WTZ A;  2BY0 A;  1BI1 A;  1G7C A;  5HKK A;  2ZNY A;  4FE4 A;  1R9T J;  2STT A;  2OK7 A;  3W6J B;  3G2B A;  4G7Z F;  1Y8R B;  3MWM A;  1J9I A;  2XT4 A;  1YJN I;  4XKB A;  3TQN A;  5L3B A;  2P7V B;  4A3M J;  1A8P A;  1N0V C;  5DS9 A;  5LGU A;  1RRJ A;  3OS0 A;  3V4G A;  1SEU A;  1U6G A;  2F5F A;  3E6B A;  4PJN A;  4P1V A;  2DT7 B;  1QZE A;  4OP7 A;  4P25 A;  1OCC H;  1YIT B;  5JR3 A;  2PMZ A;  2M7A A;  4WZK A;  3W6V A;  1MBH A;  4DBQ A;  4Y9U A;  2V9P A;  3DLL F;  5FIU A;  4QLC U;  1ERD A;  2VBV A;  5A88 A;  4W8Q A;  1S29 A;  3R60 A;  3T8T A;  3FY3 A;  1GXP A;  4X8I A;  2DYS H;  1S0U A;  3ERE D;  1FYM A;  1TT5 B;  5IYP A;  4LBY A;  2V1U A;  4YFO A;  3C18 A;  4WXH A;  5TGT A;  3OYL A;  5DM6 F;  2ELJ A;  3QRF F;  1FND A;  2JIZ A;  1ZK8 A;  2XAU A;  2ZSI B;  3QYE A;  4U9U A;  3F6O A;  3LA2 A;  3BPV A;  1XMX A;  2XC7 A;  3NAW A;  5EMN A;  2L9N A;  3AGQ A;  1SAU A;  3JRC A;  2D74 A;  3M8E A;  5LHI A;  5E3M A;  2EZK A;  5J4V A;  4A3L J;  2EIL H;  4W8S A;  2WPD A;  2R7Q A;  2A5Y B;  1J59 A;  3O8H A;  5FLV A;  4E0F A;  2W4S A;  3OYK A;  5KCM A;  4ZV4 A;  2HQ5 A;  2KJC A;  3OYE A;  4PAA A;  3H92 A;  1HDP A;  3BDD A;  4PJL A;  3BY1 A;  2DFH A;  5F0F A;  3LOC A;  5E18 F;  3E1S A;  3E3V A;  5AMV A;  5L3E A;  5J1R A;  3HYI A;  2R5Z A;  4PAB A;  1M1K D;  1NRK A;  4M4S A;  1YS7 A;  3R0J A;  1UD3 A;  3OFN A;  4QHY A;  2L01 A;  1RKW A;  1HXD A;  3RKX A;  3KP4 A;  3JW4 A;  1E3Z A;  4FN5 A;  4QVJ A;  4YZ0 A;  1EV7 A;  3NWT A;  4IRG A;  3SFZ A;  1YE9 A;  3AAF A;  3W2E A;  4OU0 A;  5BQT A;  4XLH A;  3VB2 A;  4GFB A;  1S7A A;  2NTP A;  2DBB A;  5IT9 K;  2F43 A;  2XTW A;  2JA8 J;  2Z2S B;  5LBQ A;  1O7L A;  2FQ4 A;  1ETQ A;  1PP7 U;  3PSF A;  3J7Y J;  4A0Z A;  1YFH A;  2V1X A;  2CW5 A;  2PJP A;  1Q1H A;  1R23 A;  2IS2 A;  3IL2 A;  4L8J A;  2HYJ A;  4MYT A;  2HLD A;  3ONU A;  2O17 A;  2O1D A;  3AG1 H;  2X6Y A;  1MJ9 A;  4G7X A;  2G9W A;  1IC8 A;  3PSS A;  1TT0 A;  1MD0 A;  1V54 H;  1EZG A;  3W5V A;  5TIS C;  3RPQ A;  1UB9 A;  1QRB A;  2GA1 A;  3W2A A;  2ZXI A;  3CD6 I;  1FTZ A;  1EH6 A;  3GTG J;  1H9T A;  1A04 A;  3GME A;  2VBZ A;  5LGT A;  3PL8 A;  2JA6 J;  2R3S A;  4P6V F;  1J75 A;  3HOV J;  4ESJ A;  4A3E J;  3MFK A;  4Z05 A;  1R1T A;  5FO5 A;  2QX3 A;  4KT6 A;  3S93 A;  3GRH A;  5FLX K;  3MZY A;  2HS5 A;  4GGG A;  1TWC J;  4S05 A;  4Z4Z A;  3E0J B;  5ILU A;  4IVN A;  5FKK A;  4UV9 A;  1QPM A;  2D9R A;  1ENH A;  4YFK F;  1Y56 A;  2DOD A;  3BJ6 A;  2CV1 A;  2NOG A;  5LLQ A;  4RLQ A;  2ISY A;  1JT0 A;  4UZU A;  3H9N A;  2KZG A;  4CHU A;  4P22 A;  4TMV A;  2J7K A;  1MIJ A;  4YAU A;  3U6K A;  3TBI A;  3WHC A;  5LFA A;  3F22 A;  4U7D A;  1Y0N A;  4P9F A;  4H4K C;  4HX7 A;  2OTL B;  3KYL A;  1XGS A;  4ENN A;  4OIP F;  3DBL B;  4JBA A;  1UG0 A;  2QWW A;  1JHH A;  2HQR A;  3OOP A;  2X51 A;  4B3F X;  1D3Y A;  2GJR A;  3BR5 A;  3L09 A;  1WJD A;  1A35 A;  3HHH A;  2MFZ A;  3TP0 A;  1JHF A;  2CFO A;  2XZP A;  1ON1 A;  1XG2 A;  3WG7 H;  3W2V A;  4BXU A;  1IGN A;  4KA4 A;  1N05 A;  2VNI A;  1ZM9 A;  2KIF A;  1HA8 A;  3GFI A;  3OYM A;  3KZZ A;  1KYW A;  1OYI A;  1FNM A;  2Z16 A;  2XAS A;  3FHN A;  3LA7 A;  4M9S A;  4Z6Y A;  3CJR B;  1SAN A;  1E64 A;  3OOU A;  1I7P A;  2LLK A;  4XON A;  3ABL H;  5B1B H;  5CQG A;  4B8X A;  4D7M A;  1RZ4 A;  4CQJ A;  4ZYH A;  3AG2 H;  1UMQ A;  4AID A;  5DEQ A;  2Q6I A;  1IB0 A;  4Z4T A;  3RY8 A;  5IOY A;  4YIR X;  2QCO A;  1WH5 A;  4HZF A;  3G3Z A;  3H36 A;  2HQN A;  1GV2 A;  4Z4U A;  2IGK A;  1F4K A;  3RPU D;  3Q3S A;  2AS5 F;  3F21 A;  2Z1D A;  2HKX A;  4IEJ A;  3KZI C;  2LTP A;  2PQ8 A;  1QX4 A;  4MQ9 F;  2JTV A;  1JI8 A;  3S2D J;  1XDS A;  4C2U A;  2P6T A;  2VL8 A;  4HW0 A;  2PYG A;  4ZJZ A;  1KA8 A;  3GVK A;  2DLL A;  1SKY B;  1FOK A;  2F48 A;  1YJW B;  3EQL F;  4R8H A;  2EIK H;  3BC8 A;  3VYT B;  1CF7 A;  3BCD A;  2IW5 A;  4OOS A;  4ZZL A;  4LK0 F;  2NNY A;  1LEA A;  3LQQ A;  1FPQ A;  4DBR A;  1DG1 G;  4LBW A;  3QAH A;  4U0W A;  1BBY A;  4QIW N;  2YU9 J;  1RKT A;  3ZXS A;  1Y0Y A;  1TWH J;  1E62 A;  2E1M C;  1VQL I;  2EIM H;  4S04 A;  1VQ7 I;  1WOS A;  4PJM A;  3LWF A;  5AIP A;  2V7W A;  2M3A A;  2Z8G A;  2PEX A;  1KCD A;  4RGU A;  4CYC B;  2JJ7 A;  1R5O A;  3HGY A;  4XKW A;  3CUO A;  1IJW C;  2MBF A;  2WYR A;  1FOX A;  2Y0S N;  4PC3 A;  4E4H A;  5LMZ A;  1KTW A;  2MA3 A;  5DN6 A;  4C2L A;  2QBY B;  3WYA A;  2K5C A;  5DTD A;  1JUP A;  3QOE A;  5FLX Z;  1AWC A;  3EQO A;  1NK3 P;  3VMW A;  3OYC A;  1R5H A;  3JTG A;  2BV3 A;  2CBX A;  2JA5 J;  3QOP A;  3OYF A;  1T39 A;  3HM5 A;  4Z4S A;  4C2T A;  4Z4Y A;  4S0H B;  3AVW A;  1DU0 A;  4F7D A;  2EK5 A;  2VE8 A;  3CF2 A;  4Z06 A;  3GZ6 A;  2BEO A;  1Z0X A;  3ONQ A;  2LKS A;  2O6G E;  4AIJ A;  2YX7 A;  1ZAR A;  5J3L A;  3S3O A;  1BPL A;  1B8I B;  3OS1 A;  4A3K J;  1VBL A;  1L0O C;  3CCJ B;  3CME I;  1CF7 B;  4DGW B;  4EM0 B;  2W1O A;  5K1Y A;  2XSD C;  1KD1 D;  1BHE A;  2RGV A;  4EV0 A;  4LG3 A;  2CYY A;  3PA1 A;  4HQE A;  1T95 A;  3S3M A;  1E2X A;  2H8R A;  3BH6 B;  1OR7 C;  3X2Q H;  4G6I A;  3F3X A;  1VQ5 B;  3WU2 C;  2WR8 A;  4HF1 A;  2OA4 A;  5HDK A;  2FOK A;  2RNJ A;  2VAS A;  1REP C;  4YXW A;  3TKY A;  3ULQ B;  2L9S A;  3O6B B;  3ZR8 X;  1DUX C;  2OYN A;  2F1M A;  4X06 A;  1OYY A;  2UWM A;  4UHT A;  1VQ5 I;  2NVQ J;  1MNM C;  1E63 A;  2BY3 A;  3HOT A;  1GJR A;  4RM3 A;  3I9V 2;  4KMF A;  2M34 A;  3GX4 X;  1RUO A;  3DTI A;  2DK5 A;  2ADU A;  4RPB A;  4BAY A;  3O2P E;  4KUM A;  2BM4 A;  4AYB N;  4E7H A;  3SZG A;  2QA4 I;  3JRD A;  4L5J A;  3ABK H;  3HSF A;  1SD6 A;  1ETX A;  2HQA A;  2ZNZ A;  3KLN A;  3CCQ I;  1LQ1 A;  1BC7 C;  3OEE A;  4M2L A;  3UNG C;  1O8K A;  1Z21 A;  3AFH A;  1FZP B;  3I0T A;  1W0J A;  3ZBU A;  3K4K A;  2DTZ A;  1SC7 A;  3Q38 A;  4LJZ F;  3L9F A;  3JRE A;  4OJL A;  1TUI A;  4TSF A;  1SVO A;  4IJA A;  4NBQ A;  4RLF A;  2OBS A;  4HV6 A;  5B3S H;  1VQO B;  3M4O J;  4BQN A;  1WI3 A;  2W7Z A;  4IZZ A;  3H0G J;  2CV2 A;  4KT5 C;  4N9H A;  2K3P A;  3JQQ A;  2NTQ A;  3FMQ A;  1MGT A;  1HDD C;  1AKH B;  1AMO A;  2EQR A;  4WX9 A;  3LMM A;  2Y31 A;  2LSO A;  4IOC F;  3PA2 A;  3AVY A;  3FKI J;  2NVX J;  2VOO A;  1SMT A;  1NDH A;  5HLT A;  3Q9S A;  4BY7 J;  3BR0 A;  2B0L A;  2L7Z A;  2CU7 A;  3WGH A;  3K4B A;  3BG7 A;  2FBH A;  4BQO A;  1GXQ A;  3AVT A;  2TCT A;  2PI0 A;  4A3G J;  2A6E F;  1R49 A;  3B8Y A;  4MR0 A;  2ZTG A;  3KEQ A;  2DPD A;  2DER A;  4BXX J;  3G1O A;  1QVU A;  3HKZ N;  2G7H A;  1ZRC A;  2H27 A;  3BC9 A;  4ZCI A;  2MGQ A;  3HUG A;  2X1D A;  4JX6 A;  4MFD A;  3FIS A;  1QG0 A;  3VFZ A;  3PO2 J;  3D0S A;  3GZN B;  1MBG A;  2C4T A;  4V2F A;  4GYG A;  2V7X A;  2I8D A;  3T1B A;  3GTQ J;  3TL4 X;  4HDV A;  4FAS D;  5LGN A;  3SY2 A;  1DGR M;  4IOA F;  4BKX A;  2JMW A;  1W0T A;  1JUS A;  5B1A H;  2VT2 A;  3KP3 A;  2K4B A;  4UV8 A;  2DYR H;  3RYP A;  3CO7 C;  1M90 D;  2W48 A;  3M1C A;  4DZJ A;  5M5Y J;  2R7F A;  3F72 A;  5F4J A;  3QWL A;  1QQ1 A;  4AVZ A;  2LYC A;  4YIF A;  1OJL A;  3VSU A;  1DQU A;  2IBD A;  5CYV A;  4OIN F;  3E20 A;  4C3I J;  4FT8 A;  3VO1 A;  5L3F A;  3P7N A;  2XPW A;  2BX6 A;  1KZL A;  4YAF A;  1VQN I;  2CQQ A;  2FE3 A;  1ZR2 A;  2C5B A;  2R9V A;  2WAF A;  5HOO A;  1F60 A;  4L0Y B;  5DCF A;  1N08 A;  4EGY A;  3LQR A;  3RKW A;  2RNG A;  5D5W B;  3SHF A;  2KDZ A;  1DDN A;  5IT3 A;  2DJI A;  2CQ7 A;  3FMR A;  3OS2 A;  1LLZ A;  2ODL A;  2JA2 A;  1G59 A;  1WTH D;  2R7R A;  1CQX A;  1FLI A;  3SUC A;  3WG9 A;  4C3H J;  3WTU C;  2MC3 A;  3KYC B;  3K1P A;  2R7X A;  3D5R C;  2DCU A;  1DBO A;  2XF5 A;  3C1D A;  3P5J A;  2XAH A;  3P9C A;  2E71 A;  3FDY A;  2FD5 A;  3BOQ A;  4KJZ A;  3ZGK A;  2QEX I;  2JJ2 A;  5FO1 A;  4G1B A;  2RAE A;  3PQJ A;  1VTN C;  3Q5F A;  1D5V A;  1VQL B;  2JPC A;  4G94 A;  3TO6 A;  1ZTR A;  3HJE A;  4XQF A;  3VST A;  5A2Q Z;  3J81 Z;  4A3C J;  1W4M A;  5TV2 A;  1VQ4 I;  5HLI A;  3E7L A;  3QU6 A;  1R4N B;  3A35 A;  2K40 A;  4DJA A;  3F0C A;  5CQE A;  4ZYG A;  2ACJ A;  3ZMU A;  4K2E A;  3OY9 A;  3DDY A;  2XTY A;  2E60 A;  4I01 A;  2W6I A;  3REO A;  4M74 A;  2EV0 A;  4LC0 A;  1ZM2 A;  2UVE A;  4A93 J;  3DU5 A;  3KP2 A;  1WSV A;  2G0E A;  2A6T A;  2WV1 A;  3A0H C;  3DKW A;  2Z33 A;  4MEY F;  2PG4 A;  2GXG A;  4PDK A;  3TO9 A;  2EIN H;  1WSU A;  1UHW A;  2DN0 A;  4IRH A;  3M07 A;  2LZJ A;  2K9S A;  2INV A;  3K2A A;  5LEK A;  4HST A;  2X1E A;  3BCF A;  4ASU A;  4PC1 A;  5HS9 A;  1NTC A;  4C3J J;  5DUK A;  1DP7 P;  2E2I J;  3IUO A;  3IC7 A;  2F4O B;  1Z6R A;  2GAU A;  1SAX A;  4ZCL A;  1PUF A;  3NQO A;  5HDN A;  1HG8 A;  2CC2 A;  4EVI A;  3G1L A;  4F7Z A;  3RZD J;  1W0U A;  2OK8 A;  5DNS A;  4E6K G;  4V2G A;  1NB9 A;  3FXO A;  3UR3 C;  4WCG A;  2VQG A;  5EDN A;  2ZBU A;  2BM6 A;  3PFI A;  3LA3 A;  1T6S A;  4XRS G;  5M3M J;  3H5N A;  1U5T A;  1EE6 A;  3ZPP A;  1W1W E;  4RJL A;  2DFF A;  2JZY A;  3BQY A;  2CND A;  2HTS A;  4GYI A;  4E7S A;  4PGH A;  3Q3A A;  3ZMS A;  3BY6 A;  4M3G A;  2KL4 A;  3L2W A;  2ZJR F;  1KQ8 A;  2F4I A;  2CUE A;  1V5E A;  3QPH A;  2OTL I;  1UMK A;  5IYD J;  4X0C A;  4I84 A;  2OAZ A;  3WQZ A;  2DOA A;  4J00 A;  2LKP A;  1TC3 C;  5K5O A;  3FXU A;  1HBX G;  3OP1 A;  3K4C A;  3H94 A;  3LO8 A;  5FKL A;  2G7U A;  3MEX A;  4ROX A;  2N8G A;  2F6C A;  4R79 A;  4RAZ A;  4CCL A;  1S72 I;  2QTZ A;  1ZRD A;  1G7R A;  4UB6 C;  2OJE D;  1O4X A;  1JRG A;  1PJ6 A;  2HR3 A;  3ZZT A;  1P4A A;  2X0K A;  2KPM A;  3CCL I;  2MH9 A;  1K79 A;  4Z1M A;  3CCS B;  2R0Q C;  1OB5 A;  2P3M A;  5EGO B;  1FX7 A;  3CCL B;  5A8A A;  3IWF A;  3CRZ A;  3AK5 A;  1N25 A;  3HC7 A;  2R5Z B;  1K4Z A;  1R4M B;  1R58 A;  2UXN A;  2IS1 A;  3QQA A;  1P2F A;  2FMY A;  4WF2 A;  3LSR A;  4IO9 F;  4OIO F;  1ONV A;  2RDP A;  2BZT A;  4M71 A;  4RAG A;  5HVQ C;  2ZZQ A;  3N6Z A;  1O3S A;  9ANT A;  2FQ3 A;  2ZXJ A;  1DDG A;  1B23 P;  1WJC A;  2DDA A;  1G2H A;  1Y39 A;  4YEJ A;  4BBR J;  2IS6 A;  1FNN A;  3JX8 A;  3IAS 2;  3JRB A;  4XKC A;  5KSW B;  2LBF A;  3F8F A;  5M3F J;  1CZF A;  3ZQL A;  3B78 A;  3PNY A;  2VBK A;  2UVF A;  1L1I A;  1U9N A;  4LGW A;  2H6C A;  4UUT A;  3KP5 A;  1UHM A;  1TL8 A;  1D8K A;  2A3S A;  1B6A A;  3L2C A;  2CV0 A;  2CJJ A;  1SM4 A;  1IN6 A;  1YI2 B;  1TSP A;  4JYK A;  3KRG A;  3I3L A;  2VOD A;  3CCR B;  3ZIA A;  3JRA A;  4BE2 A;  1XSD A;  5BSX A;  1WXR A;  3JRF A;  2GOX B;  5B5E C;  4XL9 A;  1CNF A;  1YIO A;  4A5M A;  2EFN A;  4XOP A;  4YC5 A;  3CJN A;  2PEC A;  4WXC A;  5F0H A;  2JVG A;  1QFZ A;  1WJF A;  5H5J A;  2X6X A;  1ZR4 A;  2BGJ A;  1BW6 A;  3R6J A;  1Y1W J;  5E3N A;  2ZME C;  2MC4 A;  1YTY A;  3W2G A;  2YSR A;  1G7S A;  3RCO A;  4AC9 A;  2V26 A;  4N4N B;  4B4C A;  3B73 A;  4A5N A;  1B8I A;  3ZCO A;  4XNF A;  2DFI A;  1T6X A;  1PKV A;  3N90 A;  4U4B A;  2X53 S;  2XGE A;  4RGX A;  4DYQ A;  5H59 A;  1IA5 A;  4UNO A;  2ESH A;  2E34 A;  2JA7 J;  3U1K A;  5C3E J;  4ACA A;  2VQH A;  3OKX A;  4GXO A;  3IRQ A;  1G3W A;  3PJR A;  2FBI A;  5J40 A;  1X2M A;  1F9N A;  3L2U A;  2GQQ A;  4CCO A;  3HSE A;  3MMP A;  3HEF A;  4YAL A;  5H6Q A;  2BY1 A;  3QPS A;  4YAW A;  4KKU A;  3LSG A;  2VI6 A;  1O3R A;  3FKS A;  2RC5 A;  4QFM A;  1TP4 A;  3LFU A;  1FSH A;  1HOM A;  4XD7 A;  1VF7 A;  4X7C A;  2LR8 A;  4HEA 2;  2VBS A;  2EV6 A;  4CCM A;  1NJI D;  3W2H A;  1R22 A;  2NVY J;  4G6T B;  1MJB A;  4EGZ A;  3ASN H;  3I56 B;  1NK2 P;  3WTS C;  5LHG A;  1U8R A;  3R0A A;  1IN8 A;  2GQF A;  1HW2 A;  5GTH C;  1FYK A;  3VEP A;  2GBY A;  5KAF C;  1W2B B;  3ZZ0 A;  4HAM A;  3K70 C;  2CMP A;  2IVM A;  2QVO A;  2VON A;  2Q0O A;  3QFR A;  2V6C A;  3A4C A;  3DU6 A;  1LFU P;  3SEQ A;  3J7A O;  1Y0R A;  3LSM A;  4MTD A;  3A3G A;  2J5P A;  4FHT A;  2X9D A;  1AHD P;  3RIR A;  2LRE A;  4J0Q A;  4DYR A;  3GTO J;  1W0K A;  1D1N A;  3C3W A;  1JTA A;  2CFX A;  2QTL A;  4ESB A;  2WZN A;  2OQR A;  1USS A;  1QGP A;  2NT9 A;  1JA0 A;  3H9Q A;  1LB2 A;  1VQP B;  2KQR A;  1P4M A;  3K0L A;  3JR9 A;  2PLY A;  1OOC A;  1QA2 A;  4EAT A;  1JKQ C;  3OYH A;  4XM3 A;  1GR1 A;  1O8J A;  1XSX A;  5CLS A;  2NXN B;  1KJZ A;  1VQ8 B;  5DS0 A;  2M1B A;  5CVI A;  1K61 A;  1SD7 A;  3ZC3 A;  1FJL A;  4DIQ A;  4HLY A;  3I1F A;  2FF4 A;  1TYX A;  2VBW A;  4M72 A;  3GO5 A;  1VZ0 A;  3HUG B;  1YRN B;  1O8G A;  3PUF A;  4MYU A;  2D45 A;  1B72 B;  3M7G A;  3MCZ A;  4EH1 A;  2E1M B;  3JTH A;  3WE3 A;  1E17 A;  2FNP A;  4XBF A;  1QRY A;  3TP3 A;  3V7C A;  1DPU A;  4KIC A;  4L9J A;  2FU4 A;  3DPT A;  2DYI A;  2VBM A;  2MD5 A;  4O6J A;  4L18 B;  2J5O A;  2BMW A;  4IHX A;  1TWF J;  1FP1 D;  3U6B A;  2XVC A;  1KON A;  2XOK A;  1F36 A;  3QFC A;  4DNC A;  3O3K A;  1IDJ A;  2NS7 A;  2O3F A;  3FM3 A;  2W6J A;  3WU1 B;  1UJ8 A;  2ELK A;  3CDH A;  2IA0 A;  3Q6R A;  4LBZ A;  2KP6 A;  2YWG A;  2JVH A;  3CUQ A;  1PJ7 A;  3GCM A;  4C30 A;  3G1M A;  1RPW A;  4BUP A;  4E7L A;  1OCP A;  4RA2 A;  3CC2 I;  2L4M A;  1UD2 A;  3B6A A;  3MD2 A;  5C4X J;  2LP0 A;  1H8H A;  2EH3 A;  3CPX A;  1VF9 A;  4CXF A;  2B0R A;  3WTX C;  4L9T A;  3WND A;  3LQE A;  1SVL A;  2HZT A;  3KL9 A;  3ISP A;  3CC2 B;  4KFC A;  3BR6 A;  2QLZ A;  2LY9 A;  3EUA A;  2HZD A;  1GLN A;  2WY8 Q;  4CYD A;  3WTY C;  4O3M A;  1XQB A;  1U78 A;  3BJA A;  2LG4 A;  5D4R A;  3AL0 B;  1BL0 A;  5DD4 A;  1HSJ A;  2UV1 A;  1Y0U A;  3K1M A;  5L3D A;  5IYQ A;  2HFH A;  3RQ4 A;  3IKT A;  2O6W A;  2DA6 A;  3CQZ J;  4JK1 X;  5HZB A;  2BPO A;  5J8C A;  1T5E A;  2WBM A;  1KYZ A;  2LMD A;  3K10 A;  1EA0 A;  5CVU A;  1BJZ A;  1NH3 A;  4HV5 A;  1MSF C;  1W9X A;  5DDG A;  3PSZ A;  4CCK A;  2HXI A;  4MGR A;  1ETY A;  2E5Z A;  4HDU A;  2R7W A;  1K78 A;  4XRM A;  2HGC A;  5L3G A;  2EA2 A;  2O03 A;  3RTR A;  1MW7 A;  2DMN A;  2IGN A;  1L3L A;  1JB9 A;  4RDU A;  4GRI A;  3CDI A;  1LE8 A;  1U8B A;  1H8A C;  2MW8 A;  5JI6 A;  3A8J A;  3ASQ A;  1QGA A;  3OE7 A;  4PC6 A;  2RC6 A;  1BN5 A;  1W34 A;  4CSW A;  3EYY A;  4CUG A;  5C44 J;  3W5H A;  2BY2 A;  4OJ5 A;  1G6N A;  3M3Y J;  3BG6 A;  1RNL A;  2QF7 A;  1WJB A;  1LNW A;  2DA5 A;  3E6D A;  1JNY A;  2BHZ A;  2Q2E A;  4OZY A;  1IXS B;  2HDC A;  3TW7 A;  3BTJ A;  1JGG A;  2MH2 A;  2GIZ A;  4WZL A;  4ANJ A;  4RDL A;  1ZEL A;  2XV4 S;  3B90 A;  3H9J A;  4I0A A;  3CF5 F;  1W35 A;  1RES A;  1DPR A;  4D5F A;  1WOR A;  2QZ8 A;  4RAF A;  1MH3 A;  3OIQ A;  5IOZ A;  1U2W A;  2JSC A;  1YJ9 B;  3BJO A;  4N4O B;  2W00 A;  4X07 A;  1GHC A;  3F8M A;  3AG3 H;  2NAZ A;  1EFT A;  1KK2 A;  1S7O A;  1N78 A;  2GK7 A;  1JUM A;  2F5D A;  2DIE A;  4WK8 F;  2HEO A;  1WI9 A;  1ZM3 A;  5CKT A;  4A3D J;  3AGP A;  2XGX A;  3DPL C;  2JQ7 A;  3LMW A;  1BR2 A;  4BS9 A;  2OC6 A;  1PJR A;  2BW3 A;  3D26 A;  4RLZ A;  4UAJ A;  1YHQ I;  2R5Y A;  1Z05 A;  1ZAO A;  3BR3 A;  1APL C;  2M5S A;  3GQB A;  5IYN A;  5B6I A;  2YWF A;  4GDF A;  1ITY A;  1BA5 A;  5ILV A;  5BSY A;  3FXL A;  2H94 A;  2VXD A;  2QQ8 A;  3Q0U A;  4IPA A;  2K3F A;  3K7A J;  2BVN A;  2YU3 A;  5JLV C;  1Z1D A;  4IXA A;  2K85 A;  2MG4 A;  2B7B A;  3SQV A;  1D0Y A;  5B66 C;  1VQP I;  2DT6 A;  4G6D A;  1LDK B;  2EWN A;  4OAZ A;  2PIA A;  2B5O A;  1T0F A;  3F6V A;  2H09 A;  2X4H A;  5JFR A;  3LVB A;  3M8J A;  1XFO A;  2OZU A;  2FSW A;  3ZBT A;  2C77 A;  3HHG A;  4AUX A;  3SLN A;  3I71 A;  4BDY A;  5JMC B;  1QH0 A;  1LVK A;  3MKY B;  3S17 J;  5D8L B;  4IL6 C;  4A3F J;  4OIQ F;  3ZMT A;  4U88 A;  2NVT J;  1XB4 A;  4ZTF A;  1IF1 A;  4KMU X;  1QFJ A;  4OJP A;  4G7W A;  5FRN A;  4B3G A;  3CCQ B;  4I98 B;  3CW2 A;  1E1Q A;  3OPO A;  2OU2 A;  1O3T A;  3A8K A;  3HBL A;  1G3T A;  2QDX A;  1RMG A;  1YW8 A;  1EJ9 A;  3SFI A;  1IV6 A;  2DA2 A;  3ZQH A;  2E1N A;  3VR6 A;  1BC8 C;  2D3L A;  4RDK A;  2V1N A;  2M0M A;  1R5N A;  1DBG A;  2QYU A;  1K6O A;  1QPI A;  3PIP F;  4F55 A;  3OIO A;  1B72 A;  2H1K A;  2LY1 A;  4BJ6 C;  4ZDP A;  2M5W A;  3I4M J;  5K7F A;  1S6L A;  4L5E A;  3GVA A;  3CC4 I;  3E5X A;  5FRO A;  5DV5 A;  1RQP A;  5D8K B;  3MQ0 A;  3NB2 A;  5DD8 A;  3ERM A;  1NHC A;  5FLM J;  5FD6 A;  3PFY A;  2HXO A;  2K9M A;  3HDD A;  2XF7 A;  4MXN A;  4A2U A;  2VZL A;  5DM7 F;  4FX0 A;  3OSF A;  5J35 A;  3OL4 A;  4U49 A;  3VYS B;  4FIS A;  4G5G A;  2K4J A;  4PSX A;  1OB0 A;  1D8J A;  4P1W A;  4M6V A;  3ABU A;  3OV8 A;  4Y17 A;  2ME0 A;  2ZZF A;  1Z9C A;  1Z91 A;  2ME6 A;  1R71 A;  1GDT A;  3OYA A;  2VUM J;  5C1E A;  4CDG A;  4EM1 A;  1I39 A;  2PYH A;  2DA1 A;  1K7A A;  4EJW A;  3GEZ A;  3KP7 A;  3FHZ A;  2M45 A;  3SLD A;  3CO6 C;  1PUF B;  1XGO A;  5E1Z B;  3HTS B;  1TQM A;  1U0J A;  4EQQ A;  3WTT C;  2D2W A;  5GAD J;  1E3X A;  3K4J A;  1H8E A;  1QVG B;  4WXD A;  3AG4 H;  4RCY A;  2DTR A;  4XLA A;  4CZC A;  2M87 A;  4OPV A;  5CDF A;  3K69 A;  4XR6 A;  3BP8 A;  2HPM A;  3BG9 A;  1EFU A;  1O88 A;  3RKY A;  3U2R A;  4PSW A;  5E8I A;  2Z6B D;  4EJT A;  2P8T A;  4C0S A;  1QVF B;  3GQ7 A;  4RB2 C;  4O5V A;  4IRI A;  2ZIT A;  3T56 B;  4IHT A;  2PMD A;  1IO2 A;  4KIF A;  2PJR B;  4DYC A;  1WKM A;  2VNK A;  1FYL A;  5ICE A;  4RD1 A;  4B3X A;  2E19 A;  2W57 A;  5D6F A;  4LB5 A;  2HI3 A;  1H0M A;  1QCX A;  3WOD F;  2IRF G;  2J8K A;  5GAE J;  2OF7 A;  2D3N A;  2V7T A;  2AXT C;  4PJ0 C;  5ERI A;  1XPX A;  1DAR A;  2CUJ A;  3KCC A;  2Q6L A;  4JRA C;  3ZSC A;  1XSV A;  4XKV A;  3S15 J;  2CUZ A;  4P6Y A;  3HG9 A;  4AU7 A;  1ETW A;  1WH7 A;  4P9S A;  4WZT A;  2XGC A;  1QNT A;  4E7J A;  3GTM J;  1S5L C;  4BNC A;  2FOW A;  2VKD A;  2AHO A;  2ZJP F;  4DQK A;  3CCY A;  1XGM A;  1IRX A;  5EG0 A;  1WP6 A;  5IYW A;  5LRS A;  1CNE A;  4EM2 A;  3HOW J;  3UW0 A;  3OYG A;  3WGI A;  2A5W A;  4A69 C;  2QSH X;  3OEH A;  1JKP C;  3L2V A;  2F5C A;  1H80 A;  3J7A Y;  4EMS A;  3D5S C;  3E5U A;  3BQJ A;  3W5U A;  1ZKG A;  2D1H A;  2GA2 A;  3KLO A;  5FJ8 J;  4A3I J;  4II2 A;  5F4M A;  3HGG A;  2VQC A;  2VJJ A;  1I1S A;  1U5T C;  1TWG J;  2P7C B;  3CD6 B;  2VJ4 A;  3HKZ A;  1MMN A;  2O9L A;  2E1B A;  1ETK A;  4KIB A;  4W8R A;  2BF4 A;  2NS0 A;  3QYB A;  3F8B A;  5GV7 A;  1QFY A;  2NPF A;  1S8N A;  2DJN A;  4YAO A;  3KIO A;  3JRH A;  3KYD B;  2X8K A;  2DEU A;  2QQA A;  3GVL A;  1UG2 A;  4CGZ A;  3LNN A;  1DAB A;  1ZN2 A;  1V5F A;  2EJR A;  4A0X A;  4HNT A;  4OWR B;  5JHF A;  2FUG 2;  3ECO A;  5E8G A;  3COA C;  4FK8 A;  4YCQ A;  3FXK A;  4R1H A;  2CWE A;  2KLO A;  2PE3 A;  2XNJ A;  5C1C A;  3PET A;  2XB0 X;  2XRO A;  5E17 F;  3JUR A;  4J01 A;  1VQ7 B;  4MFE A;  4WZE A;  4N3G A;  2NYX A;  2C2W A;  1QZZ A;  1FT9 A;  1N77 A;  3FBN B;  4CO8 A;  1UEL B;  4QV2 A;  2WAQ A;  3DV8 A;  1Z7U A;  4LIU A;  1V55 H;  1TYU A;  1UD4 A;  4W1U A;  3JQR A;  4Y7C A;  5FA6 A;  2ZL5 A;  4ON0 A;  3W3C A;  5ICC A;  2JJ1 A;  3OR2 C;  2MYS A;  2EPF A;  4NC8 A;  1PYV A;  4A6E A;  1B2R A;  3SYJ A;  2XZO A;  1T56 A;  2A68 F;  5HNH A;  2QYO A;  3BG3 A;  4B47 A;  4BJ5 C;  3DTK A;  1XMA A;  4ZYD A;  2STW A;  3FPK A;  4YG2 F;  3A8I A;  5FGM A;  2GWR A;  4HWV A;  3VOD A;  3BTC A;  4BHP A;  2M30 A;  2V9K A;  3EYI A;  3KX2 A;  1IDY A;  3SJM A;  4TMX A;  3GLL A;  3I56 I;  1KZH A;  1RR7 A;  5D6E A;  2Q6K A;  1GV5 A;  4IHY A;  4RBO A;  3QFS A;  2MLG A;  3OZW A;  1OCT C;  1BR1 A;  4RS8 A;  2HKO A;  2Z9O A;  2Y69 H;  4B43 A;  4UVB A;  3BRO A;  3FXR A;  4I76 A;  4U7B A;  2RKH A;  1D8T A;  1Z7L A;  3NRV A;  1BLI A;  4BDZ A;  4X1E A;  4DW6 A;  4AM3 A;  2WY7 Q;  3BH7 B;  2IJL A;  1LUJ B;  2L3D A;  4I0B A;  2HYF A;  4UZF A;  1EA3 A;  2CO5 A;  4HNU A;  4YHB A;  4XID A;  2B7C A;  2HDW A;  1VQ9 B;  2DA3 A;  2XRN A;  5FFX A;  4HE5 A;  3CC4 B;  2QMU A;  2NS8 A;  2O04 A;  4AIK A;  5F04 A;  1W36 C;  1VQK B;  1ON2 A;  2QBY A;  1WJ5 A;  3JSO A;  3R6K A;  2L0K A;  3HOZ J;  4IW3 B;  4RGS A;  1IW7 F;  1T08 B;  2DMT A;  1W87 A;  2P4W A;  4B3A A;  1KU3 A;  1R36 A;  2VKV A;  1TNT A;  5E6T A;  2X6O A;  3DQV C;  4GO1 A;  5E1W A;  4BPR A;  2IA2 A;  1MSE C;  3S1N J;  1OFM A;  1P9Q C;  2OBT A;  3U1D A;  3FXM A;  4NQW A;  4JOM A;  2E1C A;  4KYW A;  1HZE A;  1ZGJ A;  3A1Y A;  4JQF A;  4OPO A;  2WJY A;  3WE2 A;  1OR7 A;  2JDI A;  1FMV A;  2XRL A;  4NC7 A;  3QE2 A;  3QP6 A;  3LSK A;  5F1J A;  4KN4 X;  2VBT A;  1T8I A;  1EH8 A;  2V7U A;  1QA1 A;  1ACI A;  3PM1 A;  5EGO A;  5LEJ A;  4B48 A;  2IT0 A;  4RB0 A;  1IRG A;  3AVX A;  3H5R A;  2NVU B;  3HSR A;  2LY2 A;  2BYV E;  2Z99 A;  1PP8 F;  1B59 A;  1WPK A;  3GLX A;  3LSJ A;  4NHJ A;  3Q6Q A;  4K1X A;  1MND A;  4KIG A;  3JAM K;  5KVR A;  2Y9Z A;  1S72 B;  4HSR A;  1WJE A;  1YW7 A;  3LQ6 A;  1ZLJ A;  1OKR A;  3DEE A;  4PJJ A;  3G6E I;  4HYE A;  4RD6 A;  3V8J A;  4U0V A;  2XT2 A;  1OCR H;  3GBG A;  4OJO A;  1KK0 A;  2GZW A;  2Y0S A;  1EP3 B; 
#chains in the Genus database with same CATH homology
 4CCM A;  2X6Y A;  1E79 A;  4G7X A;  4G6T B;  3ZQQ A;  2O0V A;  4YZQ A;  4BAC A;  1TT0 A;  4QPQ A;  4XMY A;  4ZDL A;  1WMR A;  3DKY A;  1W36 D;  3W2A A;  1D0X A;  2ZXI A;  5KHD A;  2XZL A;  1AA7 A;  3SYT A;  4LIT A;  3VSK A;  3K70 C;  3PL8 A;  2CMP A;  2K9L A;  1O8L A;  1UD8 A;  4MLO A;  3A4C A;  3DU6 A;  4Z05 A;  2V31 A;  3SEQ A;  3HOS A;  3CZ6 A;  3MKW B;  4IX7 A;  3LSM A;  2QX3 A;  3A3G A;  3PNT A;  4KT6 A;  3T53 B;  3S93 A;  3S3N A;  1COW A;  2O0W A;  3GRH A;  2LRE A;  1JTA A;  1PXZ A;  1W0K A;  4LIV A;  2VXZ A;  3E0J B;  1WFX A;  2WAE A;  1Y56 A;  3RSN A;  3OL3 A;  2CV1 A;  4RLQ A;  1X1C A;  4ZDO A;  4UZU A;  2NT9 A;  4P22 A;  3H9Q A;  2KQR A;  4OZZ A;  2VKH A;  3TBI A;  3WWG A;  1OOC A;  1V0F A;  4EAT A;  4XOT A;  4XM3 A;  3OYH A;  5LFA A;  1O8J A;  4H4K C;  3KYL A;  1KCC A;  1UG0 A;  3G05 A;  2M7B A;  5LD2 C;  2X51 A;  2QKL B;  4DIQ A;  4B3F X;  4XN0 A;  2GJR A;  1MMG A;  2HVQ A;  1VZ0 A;  1WJD A;  3HUG B;  1O8G A;  2MFZ A;  2WSS A;  1O8I A;  3H9G A;  2CFO A;  2IGO A;  2KVO A;  2XZP A;  2E1M B;  1XG2 A;  3FBI B;  3W2V A;  1OHH A;  4YZX A;  2VBE A;  1HA8 A;  3OYM A;  3DPT A;  2VBM A;  3H0D A;  2BSP A;  2Z16 A;  3FHN A;  2DCE A;  3K6G A;  3GQ9 A;  3HPG A;  3CJR B;  3DLA A;  2XOK A;  1D1A A;  1KON A;  3DTE A;  4NQW B;  4KKS A;  1IDJ A;  3OOU A;  1WJA A;  4BE0 A;  4PMH A;  4XON A;  2IS4 A;  4YZA A;  5CQG A;  4BEH B;  2MD0 A;  2W6J A;  2ZTN A;  2KP6 A;  3VYR B;  4IKF A;  3U21 A;  2JVH A;  4C30 A;  4NK6 A;  2VLA A;  3F9K A;  4BUP A;  1NBM A;  4E7L A;  2X85 A;  2WB1 A;  4KIT B;  2IGK A;  1UD2 A;  3RPU D;  3MD2 A;  4BJT A;  2Z1D A;  1H8H A;  2VJ5 A;  4BGD A;  4E7K A;  5IK2 A;  1AIR A;  4PFP A;  3OYB A;  3W2W A;  3N05 A;  4U87 A;  2BOL A;  2KZV A;  5CPR B;  2R7S A;  3PUB A;  1JI8 A;  3VMV A;  4C2U A;  2VL8 A;  2PYG A;  3EUA A;  4HG2 A;  4ZJZ A;  2IQ7 A;  2HZD A;  1GLN A;  3GVK A;  1UD5 A;  1SKY B;  2WY8 Q;  3BC8 A;  3VYT B;  3BCD A;  2LG4 A;  4F52 A;  2QXZ A;  4CH7 A;  3AL0 B;  1OFL A;  2LOO A;  2UV1 A;  2R7O A;  4EW9 A;  2O5R A;  4DBR A;  4AYB A;  2UUZ A;  3RQ4 A;  2NT6 A;  3ZXS A;  4E7Z A;  4DOZ A;  3GQA A;  4CA0 A;  2E1M C;  2CK3 A;  4PJM A;  1T5E A;  1Y6I A;  2WBM A;  1Z3X A;  2M3A A;  4PUS A;  3K10 A;  2Z8G A;  1KCD A;  3L2Q A;  4XKW A;  1W9X A;  3C2H A;  1KMH A;  3TMO A;  4CCK A;  4E4H A;  1X1A A;  1KTW A;  2VPL A;  2E5Z A;  3CP8 A;  5DN6 A;  2R7W A;  4OJ5 A;  4C2L A;  3H5A A;  4KIS A;  1LKX A;  2K5C A;  1FMW A;  2R7T A;  3QOE A;  4TKO B;  3EQO A;  3RTR A;  3VMW A;  1MW7 A;  4D9J A;  2IGN A;  3CP2 A;  3OYC A;  4GRI A;  1MMA A;  1O8E A;  2V4J C;  2OUM A;  3PSI A;  3OYF A;  3OE7 A;  3EUK L;  2Q2E B;  4B44 A;  3HAG A;  4C2T A;  3EQN A;  4CSW A;  4CUG A;  1PE9 A;  3QOD A;  3LL7 A;  3BG6 A;  3T9G A;  4Z06 A;  1WJB A;  3CF2 A;  2RQQ A;  4OZY A;  3B4N A;  2INU A;  2QKM B;  3CES A;  2X6W A;  3ONQ A;  3VWB A;  3S3O A;  1LFP A;  4ANJ A;  2M4G A;  1BPL A;  1ZEL A;  3OS1 A;  1VBL A;  3B90 A;  3H9J A;  3MKZ A;  3HL2 A;  2AQE A;  4DGW B;  2W1O A;  1BHE A;  3ZPN A;  2XF6 A;  4LG3 A;  1YX3 A;  3OIQ A;  1T95 A;  4E7I A;  3S3M A;  4D1Q A;  4N4O B;  2W00 A;  1E1R A;  1OR7 C;  2VB6 A;  2JSP A;  3S32 A;  4G6I A;  1K6Y A;  2LC2 A;  1N78 A;  2GK7 A;  2DIE A;  2V7F A;  1K28 D;  2VAS A;  5CKT A;  4YXW A;  3DPL C;  3LMW A;  1BOB A;  2XGJ A;  1BR2 A;  2L9S A;  2HPI A;  3ZR8 X;  4BS9 A;  2OC6 A;  1PJR A;  2BW3 A;  3BCB A;  1QHH D;  3AKZ A;  4XLF A;  2F1M A;  2UWM A;  3GVJ A;  1MMD A;  2X1C A;  3OR1 C;  1V5G A;  2V6E A;  2M5S A;  3GQB A;  3HOT A;  4ITV A;  1D1C A;  3I9V 2;  4RM3 A;  1FX0 A;  2EWE A;  4Z03 A;  2KDO A;  3DTI A;  4PFO A;  2VXD A;  2WZP P;  3FPP A;  4E7H A;  1O8F A;  3SZG A;  2CH0 A;  1D0Y A;  2L5Q A;  2DT6 A;  1QHG A;  2HQA A;  3OAA A;  1LDK B;  4OAZ A;  3OEE A;  1O8K A;  3UNG C;  1Z21 A;  2M4K A;  3AFH A;  1X1B A;  3IP4 B;  1W0J A;  1TZL A;  3K4K A;  1DP3 A;  2ZFU A;  3KEW A;  3M8J A;  2GJK A;  4OJL A;  1IB4 A;  4TSF A;  2KRC A;  4RLF A;  3PNV A;  1X19 A;  4BDY A;  4BQN A;  1MNE A;  1LVK A;  4IZZ A;  3MKY B;  1RU4 A;  4NUB A;  2CV2 A;  3SDB A;  2XSJ C;  2K3P A;  3D5L A;  4ZTF A;  2NTQ A;  4OAY A;  1IDK A;  4OJP A;  4G7W A;  3LMM A;  2W82 A;  4JMQ A;  5FRN A;  4B3G A;  1SFK A;  5HLT A;  1E1Q A;  3OPO A;  4Y4R A;  1PLU A;  2IXS A;  2QY1 A;  1BR4 A;  4IQ4 A;  1RMG A;  4BQO A;  3K4B A;  3BG7 A;  3VR6 A;  2VJI A;  4MR0 A;  2D3L A;  3B8Y A;  2ZTG A;  2V1N A;  2CW7 A;  2M0M A;  4ZYA A;  1DBG A;  3BC9 A;  4NNJ A;  2X1D A;  4F55 A;  2LY1 A;  4BJ6 C;  4ZDP A;  3NWS A;  1OLT A;  2DXI A;  2AQF A;  3KEY A;  3DPU A;  3OYD A;  4F92 B;  1MAB A;  1O8H A;  5FRO A;  2I8D A;  1K5C A;  3TL4 X;  1NHC A;  4FAS D;  1DGR M;  3PFY A;  4CCN A;  2K9M A;  4MXN A;  2XF7 A;  3JU4 A;  3VSL A;  3M1C A;  3OL4 A;  4U49 A;  3VYS B;  4Y33 A;  1G8X A;  2LYC A;  3HXL A;  3C2G A;  4AVZ A;  4PSX A;  1OB0 A;  1OGO X;  1DQU A;  4P1W A;  1S9H A;  1D0Z A;  1T0F C;  2P0W A;  3VSU A;  2ZZF A;  2LRD A;  1X4O A;  3OYA A;  1KZL A;  3OWT A;  5C1E A;  3DWL E;  3HPH A;  2R9V A;  2WAF A;  5HOO A;  2PYH A;  2NSP A;  1D1B A;  4BQQ A;  2RNG A;  2GOM A;  3MMY B;  2DJI A;  1OGM X;  3OS2 A;  2ODL A;  4CCJ A;  2JA2 A;  5HNF A;  1G59 A;  1WTH D;  1U0J A;  2R7R A;  3SUC A;  5FRM A;  3T51 B;  3BH4 A;  1E3X A;  3K4J A;  1H8E A;  2NST A;  2NZM A;  1X0C A;  1BMF A;  2R7X A;  1UD6 A;  4XLA A;  4CZC A;  4KKT A;  3D5R C;  5CDF A;  1DBO A;  2W7N A;  2XF5 A;  2WJV A;  4KJZ A;  4XR6 A;  2HPM A;  2HVS A;  3FDY A;  3ZGK A;  2JJ2 A;  3A3B A;  1O88 A;  4PSW A;  2Z6B D;  3OMY A;  3GQ7 A;  4TT3 A;  2ZZG A;  3OW7 A;  2GJP A;  3T56 B;  4DK0 A;  4HIZ A;  2PJR B;  2L2O A;  4XLC A;  4XQF A;  4BL0 B;  3VST A;  2BVM A;  1QCX A;  4B3X A;  4DK1 A;  4BE1 A;  3OIP A;  2BW3 B;  2D3N A;  3A35 A;  4P5O A;  4BEH A;  3K70 D;  2CUJ A;  3ZSC A;  2NOJ B;  2NTB A;  4DJA A;  1HVX A;  4XKV A;  5CQE A;  2CUZ A;  3OY9 A;  3HG9 A;  4AU7 A;  4C9Y A;  4FET A;  4BXF A;  4XOR A;  3DDY A;  4E7J A;  3LSI A;  2HVR A;  2ZSH B;  1O8M A;  4Y3O A;  2E60 A;  2IGM A;  2W6I A;  1YX5 A;  1E43 A;  2VKD A;  4DNR B;  2R4G A;  1I18 A;  2UVE A;  3DU5 A;  1R6R A;  4FXU A;  1WP6 A;  1IRX A;  2A6T A;  2E5N A;  2R7U A;  4NK8 A;  3UW0 A;  2L7K A;  2LH9 A;  3OYG A;  2A5W A;  3OEH A;  3L2V A;  4BU2 A;  1NG7 A;  3OYI A;  1H80 A;  3K4N A;  1X4P A;  2XDV A;  3J7A Y;  3D5S C;  2LZJ A;  3ZRG A;  2INV A;  1VLY A;  2CS3 A;  3CJQ B;  2KMU A;  4HST A;  1I8D A;  3EUH C;  2X1E A;  2JUG A;  3AL0 C;  4II2 A;  3BCF A;  4ASU A;  1Z3Y A;  2R7V A;  2VQC A;  2VQL A;  2VJJ A;  1DGW Y;  3H35 A;  1GQ8 A;  1VJS A;  3IUO A;  1QJV A;  2VJ4 A;  3HKZ A;  1RWR A;  3CMM A;  1MMN A;  3OYN A;  2E1B A;  3GQ8 A;  1HG8 A;  4W8R A;  4RMN A;  2V4D A;  5FL7 A;  3QYB A;  1NG6 A;  5KNL A;  2WAD A;  4E6K G;  2X8K A;  3GVL A;  3UR3 C;  2VQG A;  4II3 A;  3LNN A;  1V5F A;  2LBF B;  3V42 A;  4HNT A;  3H5N A;  4OWR B;  2BVL A;  5JHF A;  2FUG 2;  1EE6 A;  3VSV A;  3ZPP A;  1UAA A;  4E7S A;  1V0E A;  2VIX A;  2KLO A;  4F91 B;  2WA0 A;  5C1C A;  2KL4 A;  4YRV A;  3L2W A;  1WPC A;  2ZZE A;  4ZTJ A;  3JUR A;  3DKX A;  4XN3 A;  4J01 A;  2F4I A;  3LSH A;  1V5E A;  2RRE A;  1EFR A;  4I84 A;  3WQZ A;  2DOA A;  4J00 A;  1E0E A;  4URR A;  1N77 A;  3FBN B;  4PK4 A;  1UEL B;  3NE5 B;  2HNH A;  4IQJ A;  2WAQ A;  3OOC A;  4LIU A;  3K4C A;  3H94 A;  2HU9 A;  1UD4 A;  4F93 B;  3L2R A;  1QU3 A;  2F6C A;  4R79 A;  3OYJ A;  3W3C A;  2JJ1 A;  4ZC3 A;  3OR2 C;  2MYS A;  4NC8 A;  4CCL A;  1PYV A;  4OJ6 A;  2XZO A;  2QE7 A;  1JRG A;  5HNH A;  5HKK A;  4B47 A;  4BJ5 C;  2KPM A;  3DTK A;  3G2B A;  4Z1M A;  4HWV A;  4XKB A;  4GQN A;  2V9K A;  3HC7 A;  3KX2 A;  3OS0 A;  2CW8 A;  2IS1 A;  4X0G A;  4PJN A;  4QPO A;  2DT7 B;  3EPZ A;  1BR1 A;  1BN8 A;  2PMZ A;  2M7A A;  2ZZQ A;  5HVQ C;  4B43 A;  4DBQ A;  3QYF A;  4U7B A;  1ERD A;  2V7Q A;  1Z7L A;  1BLI A;  4BDZ A;  3VDX A;  1WJC A;  2KHM A;  3FY3 A;  4W8Q A;  3BCA A;  4YEJ A;  2IS6 A;  2WY7 Q;  2ZXH A;  3IAS 2;  4XKC A;  2LBF A;  1CZF A;  5TGT A;  3OYL A;  2ELJ A;  1EA3 A;  2JIZ A;  4HNU A;  3PNY A;  2HDW A;  2XAU A;  2ZSI B;  3QYE A;  2XND A;  2O04 A;  4XLE A;  2UVF A;  2VBK A;  1W36 C;  3S8P A;  2CV0 A;  2XC7 A;  1WJ5 A;  4DNT B;  3KRG A;  2L9N A;  3K4M A;  3I3L A;  3IAM 2;  1SAU A;  2Q1Z B;  3ZIA A;  4BE2 A;  3DQV C;  4W8S A;  2WPD A;  2GOX B;  2R7Q A;  4XL9 A;  1OFM A;  2X3H A;  4XOP A;  4E0F A;  1P9Q C;  2W4S A;  3OYK A;  5KCM A;  4HPQ A;  4HRI A;  4JOM A;  2PEC A;  2KRH A;  3OYE A;  1HZE A;  4JQF A;  2JVG A;  3A1Y A;  1WJF A;  1J09 A;  2X6X A;  2WJY A;  4PJL A;  2MC4 A;  2JDI A;  3RCO A;  2V26 A;  1FMV A;  3E1S A;  4N4N B;  4NC7 A;  3SEZ A;  5AMV A;  3ZCO A;  4XNF A;  3VYU B;  3LSK A;  1O8D A;  4YEL A;  1PKV A;  4U4B A;  2X53 S;  1NRK A;  4W8T A;  1UD3 A;  3OFN A;  4B48 A;  1IA5 A;  1X1D A;  1E3Z A;  2OV7 A;  2VQH A;  4YZ0 A;  3H5R A;  4RM2 A;  3NWT A;  2LY2 A;  4HEA 2;  1YE9 A;  2F5V A;  3PJR A;  3A2K A;  4XLH A;  3FKJ A;  1N75 A;  3L2U A;  1MND A;  2GK6 A;  2NTP A;  4CCO A;  2F43 A;  2Z2S B;  4HSR A;  1WJE A;  3DEE A;  4PJJ A;  3BLY A;  3PSF A;  3LSG A;  3FKS A;  4KKU A;  4XD7 A;  2O17 A;  3LFU A;  2IS2 A;  4L8J A;  4F3Q A;  3GBG A;  3K4L A;  2HLD A;  2O1D A;  1VF7 A;  2PJR A;  4OJO A;  2Y0S A;  2MAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...