4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
4XLCA 4I84A 4NK8A 1O8MA 4XL9A 2NTBA 3GQ8A 2ODLA 4W8SA 4YZQA 2O0VA 1XG2A 4XN0A 3FY3A 1BHEA 5AMVA 4YEJA 2O1DA 2NT6A 1JRGA 3GQ7A 3GRHA 4XKWA 1O8KA 4YELA 2NSTA 2NTPA 2VJIA 1O88A 3GQAA 1OGOX 1K5CA 4OJ5A 4HWVA 1O8EA 4YZ0A 2EWEA 2X3HA 4XN3A 4XLFA 4XNFA 1OOCA 3B90A 1KCCA 1JTAA 1O8IA 4OZYA 1IA5A 1RU4A 4NK6A 1VBLA 2O0WA 3VMVA 1O8HA 4EW9A 4OJ6A 4XLHA 3JURA 4URRA 2X6XA 4U49A 4MXNA 3KRGA 1GQ8A 4XORA 4W8TA 1O8LA 4Z06A 1BN8A 2UVFA 4C2LA 4PMHA 2O17A 1O8JA 1OFLA 1RMGA 4OJLA 1RWRA 3B8YA 1NHCA 4XONA 1IDKA 1PXZA 4XQFA 1DBGA 1WMRA 4XLEA 4W8RA 3UW0A 2X85A 2X6WA 2VBMA 4YZAA 1KCDA 4XR6A 4XM3A 2NT9A 3LMWA 4XMYA 1DBOA 2UVEA 4XOPA 2QX3A 3VSVA 2NZMA 3EQNA 1PE9A 1PLUA 2PYGA 1O8DA 2VBEA 2Z8GA 1QJVA 4YZXA 1O8FA 3ZSCA 1H80A 3T9GA 2IQ7A 2NTQA 4OZZA 4W8QA 4Z05A 3ZPPA 1HG8A 1CZFA 1EE6A 2O04A 2INVA 3VMWA 3EQOA 2X6YA 1AIRA 4MR0A 5C1EA 4XKVA 2VJJA 2QXZA 3GQ9A 3WWGA 4XLAA 3VSUA 2NSPA 3SUCA 1QCXA 2QY1A 5C1CA 2VBKA 4OJOA 4AVZA 1OFMA 1KTWA 1OGMX 2PECA 4Z03A 3VSTA 4XOTA 1IDJA 2INUA 3B4NA 2PYHA 1IB4A 4OJPA 4U4BA 2BSPA 1O8GA 1X0CA
chains in the Genus database with same CATH superfamily
2HLDA 3OSGA 2VPLA 3H94A 1WI9A 1JI8A 1WGXA 2ZTGA 2IA1A 1MDMA 4TKOB 3OP1A 3OY9A 2W4SA 2M87A 1BN5A 4AWXB 1B4AA 3BR3A 1R58A 1ZR2A 4PJ0C 2B0LA 1NHAA 3D1NI 1VI0A 2O1DA 5EEHA 1U3EM 2QN6A 3RIRA 2LSOA 1W0KA 3DQVC 2R7DA 2OYNA 4AU7A 4RGUA 4MQ9F 2FQ3A 3LSHA 4IHWA 2V6CA 2CW5A 1KRHA 1Q9SA 2VBUA 1QVTA 2LTPA 4Y7CA 3PM1A 3CCRB 5K7HA 1BW6A 2L7ZA 3CDLA 3V76A 3A4CA 2NVQJ 3EPZA 4Y13A 2R6HA 4U9UA 4U87A 3ZMVA 2Q1ZB 3KP7A 1I3AA 3K0LA 5D5XB 1YHQI 3BTCA 1F60A 5FD6A 3NRVA 3MN2A 3PUNA 2DERA 5A2QZ 4XLFA 5GAHJ 1WORA 4C2TA 2W6IA 1FLIA 2BBYA 3CDHA 4CCMA 1X1DA 3V7SA 2ZB9A 2LNBA 1XCBA 3GZNB 5EJCA 1FOKA 5GV8A 2VB6A 2CNDA 3F8FA 2ECBA 2IP2A 1B9MA 1TW3A 4OPWA 3E6CC 3KETA 3CO6C 4X8IA 1KQ5A 1ZUNB 1R9TJ 2J5OA 3FM5A 2DJIA 5JHFA 1X2MA 2M9HA 2MD0A 3JAMZ 5JI6A 2ZZGA 3F8NA 5FRNA 3H09A 2P6TA 2V26A 3RKWA 3LSRA 2YWFA 2ISYA 2GXGA 3DU5A 2V31A 4B43A 4H9GA 4CHUA 4ZTJA 1ZREA 3GTPJ 1IJEA 5FNZA 4M74A 5J8FA 2ETHA 4DQKA 3OIOA 3KLNA 2J5PA 3ML3A 3JSOA 3GFMA 4UB6C 4G94A 3FXUA 1ON2A 3R61A 4G12A 4Z6YA 5H20A 4PK4A 3PIOF 4OMYA 4YZAA 3BTJA 4E0FA 1S5LC 1FYKA 1VF7A 2RVCA 1J75A 2CRVA 3J81Z 2ZMEB 4M6XA 4RPDA 1R49A 2R7OA 4DNCA 2JJ7A 3QP6A 1YX3A 1IXRC 1RI7A 4A93J 2M0CA 3E1SA 3HSEA 5JLXA 4Y33A 4CCLA 3OYKA 4W8QA 4E4HA 3M07A 2F4NA 3BT9A 2BY2A 3BH6B 3BLYA 4QVAA 3T51B 1DP3A 3CUQC 3BJ6A 2GBYA 3QP5A 2YSRA 1ERDA 2AQEA 4BUPA 2F2EA 2B7EA 3H1CA 4QPQA 3ELKA 2OU2A 5JLWA 3A2KA 4RDKA 5DTDA 1LB2A 2CQXA 1VHEA 2EA4A 4CZCA 4E7HA 1QUFA 3G2BA 2XVCA 3V7CA 2IXSA 2O5RA 3ZGKA 4A5NA 2XGXA 2INUA 3ISXA 3H5AA 1QGPA 3GBGA 4ZYDA 1MMNA 1OYYA 1HF0A 2VUMJ 3LSIA 4WWVA 1R1VA 4RAGA 3T53B 1ETWA 2HQNA 4UVCA 3BZCA 1UELB 2ELHA 3D5LA 4CCNA 3N90A 2R7QA 2ZXJA 5HS8A 2ZKZA 1SD5A 4FXUA 3J81k 4Y9UA 3LA2A 5FO1A 5HZBA 2BVNA 1YG2A 1FBUA 3KX2A 3TW7A 4RB3C 2VKEA 4DZPA 1VJSA 2GK6A 5D5UB 3TO9A 3NE5B 1QBJA 4I0BA 2LREA 2L4MA 2CV1A 1UB9A 3VNUA 3I64A 1VFCA 2XAJA 3V8LA 2GXAA 2DA7A 1U2WA 3SLDA 3NAWA 3OYFA 4JX4A 4GFBA 3SJZA 2EINH 1Z7UA 4TSFA 2E19A 3HOTA 1NK2P 5E1WA 3GRHA 1VQKI 1DPRA 1EH6A 3PUFA 2OZUA 1U5TB 3M7GA 2DDAA 2XF5A 3OIQA 2V9KA 1QNTA 2A6EF 3TP3A 4XLNF 1IN8A 2IT0A 2V6EA 2FMYA 2HQRA 2X3HA 5IYQA 2LR8A 2V1XA 5E18F 2QQBA 2A68F 3QPHA 2BMWA 3HIFA 4M3GA 2DA1A 3QPTA 2KDOA 2K9LA 3TH0A 2GJPA 3CCJB 4X7CA 2DBBA 1VBLA 3MVPA 4LG3A 1T39A 2QBYB 1I8DA 4AYBN 3RPQA 5J3OA 4OJ6A 2IAIA 3WTVC 3L2UA 1S3JA 3JRFA 2OUMA 2Z1DA 3VO1A 1VLYA 3LJYA 1GQ8A 4YG2F 1KGSA 1PJ5A 3E20A 1B9NA 3KZYA 3RKYA 4DYQA 2ZMEA 1ULYA 4HX4A 4Z06A 1XN7A 2RAEA 3TL4X 3HRSA 4HPQA 3MHPA 2FRHA 2R7RA 4PMHA 3KP6A 3A0HC 1ZAOA 1W5TA 3OOPA 3AL0C 3CD6B 5BPIA 4L5EA 2H1LA 1QHHD 3KFWX 5KHDA 3BY2A 4YAUA 2XNJA 4D5FA 1LLZA 4DYRA 1QVUA 3QAHA 3PSFA 3PUBA 2CRGA 4DBRA 2G7UA 3MMYB 1FSEA 3CCSI 1W36C 2W6JA 3DLLF 4EJUA 4M3FA 3CCJI 3OFNA 3FPPA 2XKPA 3QFCA 2Z9OA 3EDPA 3IC7A 2D45A 1NJID 3CJQB 1XS9A 1RKTA 1OJLA 1PE9A 3AG1H 2IQ7A 1BM9A 4KT5C 3R6JA 2JJ2A 1GO2A 4BXXJ 2ME0A 2JWTA 3IL2A 3S14J 4WZKA 4OZZA 3TO6A 2DMTA 1KQ8A 3TBIA 1N06A 1RRJA 4RB0A 1TLLA 4M53A 2R7FA 1PKVA 2CS3A 3EETA 2XRLA 1HXDA 1R5GA 3LA3A 4HSRA 2OV7A 5FFZA 5EGOA 1O3QA 3M8EA 4HOBA 3M8FA 3GVAA 3AGQA 3CP8A 2XT2A 1J5YA 2DI3A 4XLAA 3OS2A 3Q6RA 1BW5A 5DCMB 5C1CA 5E8IA 1UD5A 1S29A 4RMNA 4S05A 3B8HA 4HQMA 1GLNA 2AHQA 4E7KA 2HQ5A 2MC3A 3JTGA 4XOTA 1IDJA 2YX7A 5HXBA 2PYHA 4AC9A 2M5WA 1SMYF 3CCUI 2BM1A 2BY0A 1M1EB 2DYRH 2KMUA 4C0SA 5JVTA 3X2QH 1HOMA 2ID3A 4B1RA 3VYUB 5BPDA 2M30A 3OKXA 1XMXA 1U5TA 3HZJA 3TQNA 4UUTA 1KQ0A 3ZR8X 4EV0A 1IB0A 1JJ2B 3CCMB 1T6XA 1TQMA 1XG2A 3H9JA 4Y7NJ 3CCLI 1SD4A 4P5OA 5BSYA 1WFXA 5K5QA 5AMVA 4FISA 2ZZEA 3U1DA 3JU4A 5IYCJ 2DOEA 2RQQA 1BMFA 2YUHA 3CZ6A 1NG6A 2W00A 2LKXA 5FFXA 2VFNA 1H8HA 1UZCA 5CQGA 4CH7A 4CXFA 1WTHD 2ZO4A 4XKWA 1IRGA 3SKBA 1O8KA 2VBZA 5KCMA 3HPHA 5GPCA 1OYIA 4B48A 3S1RJ 1SKYB 1ZG3A 3FK6A 1A5JA 3HUGA 4HWVA 1REPC 1XSDA 2YU9J 4P55A 4I99C 1KK2A 5C3EJ 2DPUA 3JQPA 1O3SA 3C7JA 1QGYA 2R3SA 1N07A 1IN4A 9ANTA 3U6BA 4C3IJ 4OZYA 3OL4A 2DQLA 2DFIA 3K2ZA 2UWMA 1FIAA 2W7ZA 1IJFA 1WP6A 3DCFA 4YC5A 2QYUA 1LDJA 2X1EA 1QRBA 4A6EA 5FIUA 3RYRA 5FLXZ 2AS5F 3QRFF 4CCJA 2HGCA 4HSTA 5CPRB 2X6XA 3FHNA 4KFCA 2VNIA 4UZEA 3ZQCA 1N0VC 3CC7B 4XORA 1Z3YA 1OB5A 4CO8A 5KNLA 3PVDA 3EUHC 3RY8A 3W5HA 2WC2A 3I5UA 3LSGA 4LLGF 3JX8A 2Y9YA 2P5LC 5HDKA 4B4CA 1QQ1A 1Z91A 1RWRA 1Y8QB 2VXZA 1K8AD 4ASNA 3CCEI 3CC2I 2DMQA 2AHOA 2Q6OA 4KIFA 3ULQB 4W8RA 2LMDA 2P5KA 2E2JJ 2XZPA 3N6ZA 4XOPA 5CVJA 2P3MA 2NZMA 4FASD 2KP6A 5TJJA 4J0QA 2O6GE 1O8FA 4P9SA 3OZVA 2EQRA 1R00A 2W48A 5JVGF 1XMKA 4A0XA 2MC4A 2L5QA 1T6SA 3I0TA 1MBKA 3ES9A 2LC2A 5A88A 2YUSA 4AIJA 1EFRA 1T33A 3ASTA 2K3FA 3TP0A 4OOSA 3LL7A 2MSYA 5BQTA 2RGVA 4RAZA 3ZZUA 1G7SA 2INVA 3IAM2 3S1NJ 1FNMA 2K9MA 3GTGJ 1LFBA 4RS8A 2ESNA 2IJLA 4I0AA 1JJ8C 2EBIA 3PSIA 4FX0A 2NPFA 2O61A 1PVEA 4B44A 3GQ9A 5HKKA 2UUZA 1QA3A 3NEUA 4GCVA 4AF7A 3LQEA 3PETA 2EZHA 3JRCA 4B8XA 2FUG2 4F55A 3U2RA 3OYBA 3J7AY 5A8AA 1LDDA 4XRSG 1GR1A 1S8NA 3T8RA 1JKRC 3VSTA 1UD6A 1FOWA 1TC3C 2XRNA 3EUAA 3AVXA 5FROA 1USSA 1TYUA 2XNCA 1IDKA 1K83J 3SZEA 3VYSB 2WV0A 2VE8A 4HE5A 1XCVA 2CW8A 5DS9A 2V1DA 3W2GA 1JTXA 1MJ9A 2QEXB 3FXOA 1FNBA 2X1CA 1EZGA 1JGSA 2JUGA 1LVAA 2FOWA 2KHMA 4PSXA 2DFEA 5F4OA 2VPRA 5BMZA 2VFOA 3N05A 2F43A 2ZNZA 3GO5A 3HM5A 2EB7A 3WTUC 1VTNC 4RGSA 1FOXA 1BLIA 4BPRA 4Y4RA 2CQ7A 1JJ6C 3JTHA 5GADJ 1DUXC 4ZDLA 2KJCA 2ZITA 3P9KA 4YRVA 1IRZA 5GTHC 3T5XA 1K28D 2OZ6A 2Q6IA 3A1PA 4X07A 5J1RA 1QZZA 2PJPA 3ABUA 5H2FC 4RD1A 3FMSA 2JZYA 1V4RA 1D8TA 3OYGA 4NC6A 1OOCA 4ESJA 2VNHA 2LDUA 4V2GA 2EFNA 1KCCA 4Z4RA 3SY2A 2QQ8A 1GXQA 1EKEA 5GTIC 1K6OA 1SEUA 1YJNB 2O0WA 3BZ6A 4CCOA 4RM0A 1WVRA 4JX5A 3IWZA 4LBZA 2NRAC 3ASNH 2LK2A 5ILVA 5J35A 3IKTA 3GEZA 4D1QA 3PA1A 3L2WA 5E1XA 2E1OA 2V7UA 3ZUGA 3JRDA 3WTXC 1W0UA 4IXAA 4LIUA 4OPVA 1XGSA 2JPBA 4DYCA 5J1UA 2JN6A 3QSYA 2DT7B 1Z05A 1YS7A 1S9HA 4TN1A 3WODF 2XROA 2FVGA 3GMEA 4L9JA 2R7TA 3CF2A 2RN7A 3GTOJ 1MJAA 4ACBA 2Y0SN 4ZCMA 1QUEA 2K86A 1HBXG 1DBGA 2LKPA 3OYLA 5F0FA 2OTJB 5DCFA 4NB5A 4Q47A 4RA2A 3D26A 1M90D 4A3FJ 3BG6A 3VODA 2YS9A 4S0HB 5FKMA 1LEAA 3DXJF 4YZXA 4YXWA 5DS0A 4F52A 1RETA 2E71A 4H4KC 1BOAA 5ICFA 3ZQQA 4NHJA 2QF7A 4AD9A 1FDRA 3GFIA 2BGCA 3ESWB 1E79A 1QRCA 1BA5A 3D5SC 4QLCU 2DYIA 5E3OA 3HL2A 1B59A 1GT0C 5E8GA 4U7BA 3J7AO 2NXNB 4I98B 3H3UA 1WPKA 3ZCOA 2MBFA 1RNLA 1ETYA 4BHPA 1TBXA 1P6RA 2L7KA 3MZYA 1DQUA 3HRUA 3QQAA 1T2KA 3DV8A 1ZQ3P 1R5NA 3I71A 3V42A 1HKSA 4A2UA 3FMRA 4LIVA 2NVYJ 2X0LA 2V7TA 2D1HA 3BNWA 3BC9A 1VQ5B 5BS6A 1GJRA 2Y0MA 1PUFA 1IO2A 1UMQA 3RJPA 1S72I 1L0OC 2QVOA 4HV6A 3WNCA 2KT0A 1D1NA 2XAUA 5DYMA 2DXIA 4XSXF 2BVLA 2ODLA 2W24A 3F8CA 2IW5A 3QOPA 3ZQ7A 4JMQA 4EM0B 1VNDA 2MYSA 1Y0NA 3LAJA 5F04A 1UD8A 3ONUA 2XTXA 3QU3A 3PNYA 4WZLA 1H9TA 2CSOA 2Z16A 4JYKA 4YEJA 4DQ2A 1KQ9A 5GAGJ 5J4YA 4MTDA 4CICA 2RC4A 3K1PA 5J1YA 3GTLJ 3CTAA 3DLAA 4L5JA 4XK4A 4BQQA 4ENMA 3L00A 1W4MA 4C2MJ 2VFPA 3MD2A 4A3KJ 4MYUA 2VE9A 1UFMA 3C2BA 3R60A 3GVJA 3HAGA 4O5VA 3DU1X 1P4AA 1Y56A 3FMQA 2CV0A 2VZLA 1V54H 2L9SA 1OFDA 3MCZA 2EIMH 2X6OA 4LBVA 2R5ZA 1ZELA 2GIZA 2L9VA 4XKBA 5TGTA 4L0ZB 3D0SA 5C44J 1KK0A 2DPDA 4I6ZA 6PAXA 3ISPA 3CUOA 5FD5A 4F93B 3KL9A 3H5RA 2H6BA 2NVTJ 4UUSB 4RPBA 4HBLA 2ZMEC 4HV5A 3I9V2 3OOUA 2JA6J 2YWGA 3ZBUA 2MFZA 4BDZA 4HQEA 1ON1A 1FP2A 1R1TA 3G4SI 3Q3SA 3CJTB 1HDPA 2DMNA 4A6DA 3KIOA 2QSFX 1A36A 2JK3A 2IGMA 1O8LA 1W7PD 2V1NA 4IW3B 1R22A 5H6QA 4D7NA 2XPVA 5KAFC 4RB2C 1MDMB 2NVXJ 3SLNA 3CCQB 1BN8A 4MLOA 4CUGA 3MKWB 3CLQA 5CVUA 1D5YA 2ZCWA 2LY9A 1E3HA 3CQZJ 4KIGA 4OJLA 4LBYA 4LB6B 1COWA 2CW0F 5HLTA 2R0QC 1DDGA 4XONA 1B72A 5F4JA 5FO5A 2XGEA 3MMPA 1WMRA 2M4KA 4L9VA 5DDGA 3V7AA 2CQNA 4XSZF 2X6WA 3FPKA 4XM3A 2NT9A 4XMYA 1H8AC 2QX3A 1TP4A 3LFUA 1DU0A 2OBTA 1G3WA 4KKSA 2C4TA 4ITVA 2YPRA 5BOXA 2H1KA 1H80A 3BG7A 3F9KA 2VBWA 3LA7A 3K6GA 4LLLA 1YLOA 4G6QA 3ZPPA 1HG8A 1R36A 2ZSHB 4KIBA 3DF8A 5DSZA 1X1AA 4HG2A 2KISA 5E1ZB 5F08A 3I55I 1H9GA 3MKYB 3LQRA 3VSUA 4FE7A 4DBQA 1CNFA 3S32A 2DFHA 4HZFA 5HS9A 2BV6A 1UHWA 3AVYA 2OCEA 1KTWA 1J7KA 4WXHA 1R5ID 1XGMA 4A0YA 3Q0VA 5B1AH 3KYLA 3OIPA 4PJNA 4YDTA 5ILUA 3O8HA 1U5TC 1FT9A 1WJCA 2RREA 1FX0A 1ZKGA 2Q8KA 1HKTA 2BOLA 1RIOH 2F6CA 2JSCA 1Z6RA 1Y8RB 3ABLH 4GYIA 1RUOA 2HMAA 3PA2A 1SAUA 4F92B 2BSPA 2DA6A 4S04A 5K5OA 4XRMA 1AMOA 3A8JA 5LGTA 5D5WB 2K3PA 2PMZN 2LBFA 3GXOA 5FO0A 1L3LA 5GP9A 4ZZDA 2KDZA 4UY8I 1Y39A 4HYEA 3PQJA 4BACA 2OC6A 1G59A 4FE4A 2OTLI 1SM4A 1D3YA 1WOPA 1JUSA 2IOUG 1R71A 1K4ZA 2H09A 4RAFA 1ENHA 1MIJA 2BXZA 3Q39A 1OLTA 4NCNA 3GTKJ 3ZSCA 2DJNA 2QWWA 3K4MA 1T5EA 4CGZA 4PC1A 1TYVA 4YELA 1K78A 4RB1A 4LK0F 5HDNA 1OYWA 2DMUA 2B63J 1FBQA 3BPXA 4Q4ZF 2IA0A 2XV4S 3OYAA 2JRMA 4OIOF 1YHQB 2TDXA 2ZSIB 3VSKA 2QMUA 3OPOA 1HSJA 4L5IA 4WXDA 4AC0A 1EH8A 3QE2A 4AYBA 1XX5A 2AXTC 3F21A 3MZHA 4X06A 4LG0A 1IDZA 1KMHA 2R92J 1BJAA 5BSXA 2B0RA 4LD5A 2QSGX 3HOVJ 4A3LJ 2E35A 4U49A 4G7XA 4XD7A 3WBKA 4MXNA 1P2FA 1SVLA 1NTCA 4OM9A 2K27A 3DBLB 4GO1A 1VQLI 1R6RA 1TVCA 2FF4A 3GYHX 1G7RA 4U0VA 1I6HJ 1XQBA 2JA2A 1TZLA 2KIMA 5CYVA 1BI2A 1WCMJ 2HTJA 3F72A 2VQGA 4N3NA 2QLZA 1OCOH 1YX2A 2X85A 1B2RA 4WZEA 2EWNA 4YFOA 1WOSA 4YIFA 5FLMJ 3BCDA 3H5NA 5J6XA 2VYQA 1A6IA 2P5VA 1I27A 4WWCA 2NAZA 2VBEA 2VQHA 1O8DA 3JQQA 2I8DA 1TTTA 1GV2A 3WQZA 3F6VA 1K61A 5DM7F 1E43A 1ZM2A 3RPUD 2I5UA 5ILSA 4HW0A 4CZZA 4OJPA 1G8XA 4WCGA 1LQ1A 3COAC 3OMYA 1XGOA 5LHGA 4ENKA 4R1HA 4UZUA 4DW6A 3OZUA 3ZZTA 1FBSA 4MQVA 5C1EA 3CPXA 2VL8A 3IH4A 3A3GA 1QA6A 5LGUA 3LVBA 4P6VF 2WAEA 2RC6A 1R1UA 1E3XA 2VNJA 1XFOA 4NQWA 2QY1A 2QSHX 1I3QJ 4ASUA 1QPMA 1E17A 3BTLA 4MTEA 1Y1WJ 3DBHB 4RLQA 2F5DA 1MBGA 4Y52J 2BM6A 1YJ9I 2Z5UA 5E3LA 2R7WA 2OK7A 2CG4A 2L9RA 2XSDC 2R7SA 1B6AA 2IGNA 3FIWA 1VLOA 2WZPP 1RR7A 2DTRA 2X53S 4MFEA 4IVNA 1S7OA 4L9NA 4XLCA 1MABA 1IC8A 2GREA 5GV7A 3FXJA 4BE1A 4FX4A 2G0EA 3LSKA 5HDGA 1GAWA 1EH7A 2MH2A 2E1BA 4FT8A 4ZGNB 1AU7A 2R7VA 4XN0A 4KKUA 4NUBA 1E0EA 5L3DA 2V7WA 2EV6A 2V9VA 4B09A 1FY7A 3ZRGA 5IOYA 2K9NA 1OCPA 4P2NA 1VQKB 3HGYA 4YIRX 4TV7A 4WK8F 1WOOA 3OW7A 3P5JA 1YIJI 4QVJA 2JVHA 1WSRA 4P22A 2P4WA 3MFKA 1ZRDA 4ESBA 4F7ZA 1OPCA 1PJ7A 4I01A 1K5CA 2K9SA 1YITI 5EGOB 2VIXA 3E5QA 1ELOA 2MGQA 3ZMSA 1VHOA 4HNTA 2GAUA 2P81A 2XZLA 2H94A 1VQOI 1KU7A 1IJWC 3LOCA 1YW8A 1RKWA 1WDTA 2XF7A 1YX5A 3RQIA 2M34A 1BX0A 1HQCA 5LRSA 1JHFA 2KKOA 3A8IA 2EZKA 2LF7A 4W8TA 4O3MA 2XZOA 2P7CB 1JT6A 2DOFA 2EZLA 3ZQHA 5EDNA 1XMAA 3CCYA 2R4GA 4H0EA 1SFOJ 2LY1A 2Y2ZA 2BE5F 2O17A 5FKKA 4GQNA 2DU9A 1MRZA 1GUUA 2A61A 3CRZA 2RQPA 4U88A 3BJAA 1ACIA 4ABZA 4KNYA 5IP6A 1EP1B 2VBTA 4HIZA 3CCSB 3K69A 3UW0A 3ZOBA 5EEGA 3Q6QA 2E1MB 4MIMA 5ERIA 5LEJA 2UXNA 4IOCF 1VQ4I 3H0GJ 4X05A 2KPMA 3LMWA 4DK0A 2O03A 1D1CA 2CJJA 2Z8GA 2E7XA 3JRBA 3L2QA 2R5YA 3F22A 5IT9K 4LITA 4MGRA 4Y17A 4C9YA 3HUGB 2VC1A 4AM3A 3BCFA 3T9GA 3S2HJ 2GPJA 1JTYA 3RTRA 1IW7F 2KRFA 2EILH 1HCRA 1BI0A 2WB1N 3I59A 2WAFA 4PZJA 2D9RA 3IV5A 1G3YA 1ZTRA 1SAXA 5D8KB 4MNUA 2Z2SB 1YE9A 2XIGA 3G1MA 3BR6A 1XGNA 4NC8A 2OBPA 2H8WA 2BEOA 3HSRA 2VJJA 3WWGA 5DD4A 4PJLA 2F4MB 2BZTA 1UG0A 3GTJJ 2TRTA 4N4OB 4IPAA 1IUFA 1HC8A 2C2WA 3WU2C 3U6KA 3DDYA 2BX6A 4Z03A 1S7AA 3FZVA 3OYIA 3CCUB 3BOQA 5AIPA 1OKRA 3BCBA 3BP8A 2QA4I 3ASPA 5HVQC 1IRXA 4N0BA 4F3QA 3DPLC 1WKMA 3VSLA 5CJ9A 2QZAA 1HW5A 1YTYA 1Z9CA 5DV5A 4EJOA 2DAOA 4J19A 5B1BH 4OOVA 2HI3A 3CCLB 5HZAA 3H35A 2W82A 1ZR4A 3ECOA 4BEHA 2CF4A 4HDVA 1BHEA 1RPWA 4C43A 2NT6A 3FKJA 2GIVA 1WH5A 3JW4A 2E2IJ 5LMZA 5L3EA 2HWVA 1KU2A 2IVMA 3O6BB 2E1RA 2VT3A 2XF6A 3VMFA 1J9IA 3KE2A 5M5WJ 1CF7A 5H6RA 2PBIA 3PNVA 1BI3A 1TLHB 1MMGA 3GLLA 1IZ1A 2E7WA 1AHDP 2Z33A 1QG0A 5CLSA 1T0FA 3BPVA 3SXYA 3BR2A 3T0YA 4GRIA 2H6CA 2QUFA 3LMMA 2JDIA 3A35A 1VQ7I 3W5VA 4CQJA 2BY1A 2IPQX 5D4SA 1ZRFA 4ZYGA 1UCRA 1QA1A 3VMVA 1N25A 2OBRA 4IRHA 1BBYA 4L8JA 3OZWA 1B1BA 1SVOA 2FNAA 4F91B 3JURA 2F3LA 3M1EA 2HDCA 3HRMA 1EXMA 4LC0A 1EV7A 3G73A 3HPGA 5CVVA 3VEPA 3MQ0A 4FHTA 5IP9J 1Z1DA 3I54A 4KICA 3PO3J 3C1DA 2HYFA 5TISC 2FQ4A 2DDBA 3HOSA 4G6DA 2Y0SA 1R5HA 4PUSA 3WE2A 1IF1A 2W85A 4M6VA 3FWEA 1F9NA 1ZM3A 2P6SA 4FQGA 3TDUC 3G6EB 1RQPA 3CCEB 3QPSA 4LK1F 1W35A 2EIKH 5THXA 3CC2B 1MBEA 1PXZA 1OCRH 1ETXA 2LD5A 4WX9A 1O57A 2JUCA 4XLEA 1A35A 3O2PE 1HA3A 1K6YA 2DY1A 1OFCX 3BG5A 4BQAA 2OCCH 4EM1A 4E7IA 4J00A 3QFRA 3W2WA 5EG0B 4N4NB 1MMSA 1TNSA 2VQCA 2CU7A 3DKWA 3HGGA 2YWHA 1WH7A 4CYCA 2Q2EA 4DNRB 4X0CA 2E2HJ 1WI3A 3DPUA 1AKHA 1B8IA 1Z77A 2Q0OA 1WJAA 3M3YJ 1U6GA 2ZC2A 1LPQA 1TWCJ 3HRTA 3WGHA 5E6TA 2F48A 2NS8A 2VJ4A 2ICWG 3G6EI 4QIWN 2KRCA 2KRHA 2X1DA 5EYRA 5BNGA 5HOOA 4IHSA 2X3UA 3GF2A 5JBQA 1WJEA 2LF8A 4QPOA 4BHBA 4BGDA 2VBKA 1X58A 3ABKH 5F27A 4HLXA 1D5VA 1R5OA 2M5SA 1OFMA 4EVIA 2YU3A 2PMUA 1YRNA 4KITB 3MAJA 1T8IA 3HTSB 2D3NA 2P8TA 3WTZA 1XB2A 1IB4A 4D5CA 3VPRA 4XKCA 1G7TA 2XAGA 1CNEA 1E1QA 2EFGA 1BC7C 2M2EA 1UHSA 3OW2B 3K70C 2KZGA 5F0CA 5DD8A 4RD3A 1OR7C 4BU2A 3L1PA 4ZTFA 2B7CA 3F6OA 3E5UA 3ONQA 4G8XA 1Z0XA 1UAAA 2KFDA 4YZQA 4WQMA 1N0UA 2O9LA 1E3ZA 2FA5A 4G5GA 3SFZA 3GW2A 3ZXSA 2WJVA 4QHYA 1W34A 2BGJA 2CUZA 1VF9A 1H89C 4EQQA 4E6KG 3PUMA 2G9WA 2M45A 4P9UA 4IHXA 4Z2YA 3CJNA 3I58A 3WY9A 4X1EA 5EF6A 1GAQA 1V5VA 2VKVA 3TGNA 3OOCA 4ZYEA 4BHCA 3K4KA 3A3BA 4OAYA 4EM2A 3CMAB 4M3EA 4XICA 4P25A 4JX6A 4PFPA 2FJ1A 3SYJA 2M7BA 4M1KA 1YJWB 2VJ5A 4D7MA 3E6DA 4AIHA 3HJEA 3BJOA 2JRTA 3DPTA 2H8RA 4RM2A 1IA5A 5CDFA 5E20A 4RD6A 2E34A 2BM7A 2PJRA 4BBRJ 3DEWA 3I4PA 4II2A 5LRRA 3KZZA 2BM4A 1D0XA 3JRHA 2BM5A 3ZQLA 2BF4A 3I3LA 5EZGA 1P7IA 2JA7J 3JR9A 1ETKA 1PUFB 4FK8A 2EIJH 3BG3A 1G3SA 5K7FA 1QQIA 5EG0A 1WWXA 1OFEA 2BVMA 1U2RA 2KJBA 4TMVA 2E1CA 5CKTA 3PJRA 1OQYA 2NOJB 4K2EA 1WPCA 3FX3A 3I56I 3RDIA 2O6WA 5HLHA 3CMAI 1VQMI 2CWEA 2A5WA 1SFXA 3QWLA 1YJWI 2CC2A 3GVLA 2Z6BD 1P7JA 2Y30A 4P3IA 1BQEA 3K4BA 1MNDA 4QUZA 4YAFA 5E3MA 3BWGA 4LJZF 3CUQA 2V7FA 3SZGA 4P12A 1G3TA 2PMHA 3ZMUA 3IWFA 4NBQA 1FSHA 3KLOA 3HXLA 2STWA 3C18A 1VQ9B 4BY1J 1HSTA 4ZJZA 2PLFA 3QYFA 2FU4A 5IYPA 1D0YA 2HZTA 4I09A 1U78A 3AKZA 3M8JA 1QVGB 4J01A 2WY7Q 3ML6A 2GLOA 2NS7A 2R5ZB 2V5IA 2IS2A 1IDYA 4C3JJ 4Y3OA 4XIDA 1HDDC 3SFIA 3PO2J 3B82A 1XTAA 4I02A 4P6YA 1WHUA 3HSFA 2CUFA 2F1LA 3CXCB 4KMFA 4MR0A 2CO5A 3DBRB 3V8KA 2NV4A 1IXCA 3VDXA 4BNCA 2IEKA 4HAMA 3AG4H 4BL0B 2WYRA 2ZBVA 4N9IA 2XAFA 1HVXA 2V1UA 4Z4VA 1L1IA 2QQAA 3BC8A 3KEQA 1RR8C 3J80K 2V4DA 3GIRA 4EGYA 1KTVA 1QX4A 2NYXA 1VQ9I 2WWYA 1ZGWA 2FD5A 4ESFA 1H8EA 4IHTA 2ADUA 1MBFA 3WNBA 2DOAA 3ZC3A 3KZIC 1ZGAA 2PMZA 2W57A 2IGKA 1I1GA 3FDYA 4QTRA 3A01B 4RDJA 1S72B 1O7LA 2L9NA 1YIOA 3S1QJ 4QFMA 4A3JJ 5IK2A 1B72B 3KEWA 1YOVB 4L18B 2M1BA 4W8SA 1GXPA 2HKOA 3DFGA 4MEXF 1UD4A 4YEIA 1RQRA 4X7FA 4HLYA 4QSHA 4C3HJ 3MKZA 2VFQA 2HOAA 1FPQA 1EP2B 3RKXA 3U9GA 2EZIA 4U0WA 2MW8A 1GHCA 2OJED 4AIKA 2HTSA 3GQ7A 2X4HA 4IL6C 5KW9A 2PQ8A 4FCYA 5E17F 2VC0A 1S4MA 3ASSA 2E60A 1XE1A 2ZTNA 3P26A 2KQRA 4Z4YA 3GQAA 5IYWA 4YIIA 5JMCB 1OGOX 4ZH4F 2DT5A 1QZYA 2I10A 5HODA 3S3MA 3JRAA 2Y9ZA 1FRQA 5GPAA 3GQBA 3O3KA 3JSPA 4XN3A 3FF5A 4BXFA 4UZFA 2NOGA 3L2RA 4U7DA 3FBNB 2JN9A 2R7XA 4YALA 4M73A 4LLNA 3T56B 1RU4A 2DA5A 2DEUA 1J09A 4Z4WA 3J7ZI 1TWFJ 3W3CA 3VO2A 4A12A 1PJRA 2WSSA 1OB2A 3IUOA 4DJAA 1K8FA 5FJ8J 1X4OA 2VN2A 3BCAA 4JP0A 3G4SB 2EK5A 3SQNA 1Y0RA 4IF4A 1X1BA 3RKQA 1HLVA 1P4WA 3ROUA 2LBFB 4MEYF 3V4GA 4O6JA 4PCQA 1CLWA 3SQVA 1UD2A 1RC9A 2FBIA 3WHBA 4ZDPA 2HOTA 1XSVA 2KIUA 2DIEA 4KUMA 1IN7A 3S2DJ 5J8CA 4ENNA 4BBSJ 3BY1A 4YAOA 3RI4A 3NB2A 5LGNA 4RLZA 1ETOA 2ZL7A 1I6XA 2VBMA 3HHGA 3TDZC 3ERED 2PEXA 3KYCB 5C4XJ 4BS9A 1NB9A 4IEJA 3HKZN 4UXNA 4XLPF 1K78B 1BL0A 1KK3A 3SZPA 1Y0YA 4BY7J 1JE8A 3KCCA 4G7HF 4Z4UA 5CVRA 1FZPB 1KC8D 4Z4ZA 1I50J 3ABMH 1TW2A 1CGPA 1E1RA 4RCYA 3GCMA 2GA2A 2L3DA 2GQQA 1QFJA 2BY3A 3Q0UA 1X4PA 3S3OA 3AVWA 3CJRB 4A3CJ 4G6IA 3OEEA 3A01A 2O04A 5D4RA 3OWTA 2X6YA 1Z6TA 2HXIA 4LG0B 1QGAA 1XSXA 4Z4TA 4CYDA 2BYVE 3I55B 2C77A 2VKHA 4L9TA 4AVZA 1UJ8A 3WGIA 3UNGC 3VB2A 3DTEA 2MH9A 4I76A 2M8EA 4IX7A 4B3AA 1QFZA 3B4NA 4HA8A 3ABTA 3W2FA 2XAHA 3G1OA 3F0CA 1HF2A 1LM1A 2L02A 2WAQN 4P26A 2CMPA 2QDXA 2DLLA 3C2HA 1O3RA 4Q7JB 3W6VA 5KK1A 2XOKA 1APLC 1DPUA 4RM3A 1Z21A 2XKOA 4BQOA 5FB2A 2HYJA 1WSUA 1DG1G 1YYVA 1IV8A 1OCZH 2MG4A 1IXSB 2Q6LA 1B23P 3GQ8A 2JMWA 2ELJA 1ONVA 3F8MA 3NARA 1JKOC 2OTLB 2O0VA 1WJBA 2V9PA 1TQPA 5DUIA 2RC5A 3DEUA 3VWBA 3QFSA 4AVPA 1X19A 4KN7X 2L01A 4V19K 3CPWB 2NVUB 4X7DA 4B4DA 1P9QC 2IBDA 4LBWA 1W2BB 3HB9A 2A07F 1VQNB 1T6YA 3QPLA 2M7AA 2NSTA 2VJIA 1QU3A 4KMUX 1FMVA 3REOA 5A2QK 4A69C 4OMZA 1EFTA 3HC7A 3B78A 2VOOA 5DNSA 2DTZA 3OYEA 1M1KD 3GTMJ 4Y15A 2PN6A 1F4KA 3AAFA 3EUHA 2XC7A 4M9XA 4OP7A 2XUBA 4NQWB 4UHTA 3ECHA 2DCEA 2E1MC 4RBOA 2GJRA 2HCJB 4AUXA 4KT6A 1UG2A 4RLFA 4ZC3A 4OPSA 1FNNA 1E3OC 1LVKA 3M4OJ 4YFXF 2PG4A 2M8GX 2WTEA 3JAMK 5D8LB 4IRGA 1SFUA 1A31A 2AQFA 2CUJA 1LKXA 3IRQA 1T98A 4IHYA 1A6QA 4NC7A 2IGOA 3S93A 1VQNI 1H85A 1OISA 2Y75A 2COBA 3K70D 5H59A 2L7FP 4ETSA 1VQLB 1YQAA 1NBMA 2A05A 2WY8Q 2ME6A 3LNNA 3OEHA 1O8JA 1JUMA 2ISZA 1RMGA 1UD3A 2FNPA 4MFDA 3EYIA 3RCOA 1J0RA 2VKDA 2FXAA 3NWTA 4ZGQB 2PX9A 4XQFA 5F1JA 1SANA 1WZ2A 2QGGA 2VNKA 3FKIJ 2HU9A 3VOEA 3J81K 1XB4A 4P1VA 1AIPA 1VQ6I 1MNEA 2DQRA 2PLYA 3HTUA 1W5SA 3VYRB 1DBOA 2WZNA 5HNHA 3GSIA 4JRAC 3VSVA 2HPMA 4C2UA 3ZBTA 5LHHA 4JOMA 1FNDA 2WB1A 2NTQA 3SHFA 1XPXA 3S8PA 2CH0A 1DDNA 1BJKA 3OS0A 4HDUA 2VBSA 1V3FA 3LSJA 2EPFA 3Q9SA 1CZFA 4A3MJ 4HEA2 3KP4A 1U9NA 5TRDA 4MYTA 4K1XA 2RKHA 4DNTB 2ZL5A 2VOPA 3G71I 3CMEI 2QXZA 4BDYA 1Q7YD 5IYRA 5F64A 2Z3YA 4G1BA 4DZJA 5ICCA 4EJTA 1SFKA 1NDHA 2COMA 4PGOA 4EH1A 2GXBA 1YJ9B 3OYHA 1RZ4A 2TCTA 1LEBA 2K9QA 3WTSC 1DARA 2C5HA 1R23A 2X51A 2FMLA 4UVAA 3CCVI 2XDVA 2JT1A 2QENA 5IT3A 1ZG5A 1EP3B 1ZRCA 3GVKA 4UV9A 2QTLA 1O8MA 2M4GA 2LKSA 5HS7A 1ZLKA 1QZEA 1Q86D 1T6ZA 3ZPNA 3DWLE 4LGWA 3KP5A 3ZMZA 5L3CA 2CV2A 2M0MA 4X6AJ 2L4AA 3RPUA 5J4VA 5FKOA 4CDGA 1ODDA 4M71A 4PJJA 1TT5B 1T38A 4JQFA 5JHUA 2OF7A 3S3NA 3IKVA 2R5YB 3PENA 3B02A 2D5VA 2XHKA 1BC8C 1WU8A 1J9ZA 2JA5J 3HHHA 2E5ZA 1K73D 3CCRI 3I59B 3AGPA 1YIJB 2VFMA 2NTPA 1O88A 2QKLB 2LP0A 2W1OA 3CLOA 3HOXJ 2QZ8A 4XBFA 1EF4A 1IRFA 2QYOA 1YITB 4YZ0A 1RUNA 2CQKA 3LWFA 2BM0A 1BPLA 5AONA 2V7XA 1OCTC 1GV5A 4WF2A 3WTTC 3KEYA 3N4MA 2R9VA 3HDDA 1FTZA 2ZZQA 3ZN0A 1VQOB 3CW2A 2GJKA 3H3ZA 1KD1D 1QA2A 4B3FX 3TOBA 3N97A 3S1MJ 1MSEC 1FIPA 5EMNA 3GFLA 5E3NA 4CA0A 2PIAA 3QOEA 2RV8A 2XEXA 2O3FA 1FNCA 1HW2A 4YFKF 2BW3A 1Z67A 1QPIA 3L7WA 3PL8A 4IQJA 3QFTA 3AVTA 1V55H 1FYLA 3KRGA 1N77A 1TTYA 2ZBKA 3HBLA 5IY5H 4XRSA 1IHMA 4F7DA 4BE0A 3K4JA 2HKXA 1WQ2A 5L3BA 2OAZA 2WADA 4UVBA 2WR8A 2K7LA 4IZZA 1CQTA 3L2CA 1S0UA 1G2HA 1K9MD 4Z1MA 3DEEA 1OFLA 1JHHA 1Q1HA 5D5VB 3H36A 4DIQA 3W6JB 1F43A 2EFPA 4XRFA 3B8YA 3S2WA 4BEHB 2KVOA 3ONYA 2STTA 1UMKA 2JTVA 4G6TB 4ANJA 5FGMA 2JIZA 3WYAA 3U1KA 1O7FA 4BE2A 1UHMA 2AO9A 3OYMA 2XTYA 4Q5SF 5LHIA 4M6YA 1VQ4B 2A6HF 2UVEA 1GVDA 2HDNB 3W2VA 3GTQJ 1MJBA 1CF7B 3WU0A 2XGCA 1EFUA 2R7UA 3MCAA 2BXYA 1K79A 1ZM4A 3E3VA 1MKMA 3JCUC 3NQOA 2ZXWH 2K40A 2CK3A 2LOOA 2Y31A 3CDIA 3RIQA 3FXQA 4A3DJ 2XAQA 1JB9A 1ZG1A 4UV8A 3DKYA 2IS6A 4JBAA 3MKLA 2HYGD 4KYWA 4IOAF 4ACAA 1XDSA 2GWRA 2NS0A 1HZEA 1U8RA 2V79A 3CF5F 1TYXA 2ESHA 2IA2A 2F4OB 4OU0A 5F1RA 3B6CA 3ZQGA 5IOZA 5LD2C 4UAJA 1MSFC 4ROXA 2K4JA 2B5OA 1J59A 4IKFA 1MW7A 3WU1B 2HS5A 4ON0A 1LE8B 1OGMX 4M4SA 1X2NA 3RQ4A 1SMTA 3ZMDA 2KZVA 3BTIA 1ZARA 4NBSA 4E70A 1P4XA 3MZ8A 2VLAA 1W0JA 2BGIA 2QA4B 2ZJRF 3DP7A 4LFUA 4A3IJ 1KK1A 5EZHA 2WV1A 4OIQF 1BR1A 2PI0A 3QODA 3WTWC 3OYDA 4FTHA 3BG9A 3LSMA 1POGA 1ZK8A 4A5MA 3MEXA 3RYPA 3KEOA 2WA0A 3FJOA 1I5ZA 3FY3A 2XT4A 1T95A 2K5CA 1I18A 3W2AA 1FMWA 2VXDA 3F3XA 1V5FA 5J3LA 3LQ6A 4IJAA 1G7CA 4P9FA 4RD2A 4CYCB 1W1WE 2Q2EB 2V7QA 4B3XA 4M0LA 2LLKA 2HEOA 1AKHB 1WJFA 1B8IB 3V8JA 3ZQFA 4ZDOA 2O7OA 2VBYA 3ZQIA 1TL8A 3TEDA 1NRKA 1I39A 3BY6A 2QQ9A 3D5RC 1PDNC 2O8KA 2YWEA 1N05A 1VZ0A 3FXLA 4YCQA 4RCZA 5DN6A 1O8EA 2V4JC 5B3SH 5K7ZA 2B9SA 4TT3A 5A89A 3FISA 3B90A 1GDTA 4C30A 1VQ7B 1JTAA 1IN6A 2HZDA 1MD0A 4ZYHA 2GM4A 3AVUA 2VT2A 3PNTA 5FLXK 4KJZA 2KL4A 3RZDJ 4BKXA 2W84A 1GVHA 1YRNB 2A3SA 4II3A 1F5TA 3RZOJ 5IPAA 2R93J 4OIRF 4G7OF 1W9XA 1X3ZB 2WBMA 1W5CC 3PFIA 2ECCA 4KN4X 4HF2A 1WJDA 2VI6A 5JR3A 1FJLA 4G1VA 1FRNA 1BI1A 3EYYA 3GZ5A 3BZKA 1ZN2A 3WG7H 3ZMTA 3E0JB 4RD4A 4RGXA 1JUPA 4AF6A 1SD6A 3BR1A 4PFOA 2BHYA 2PFBA 1V0EA 1W87A 3E1YE 1D0ZA 4E7JA 1EJ9A 3CD6I 3AG3H 4PABA 1TWHJ 3E7LA 1KU3A 3E5XA 5M3MJ 1O3TA 1AA7A 3IH3A 1DABA 3L9FA 5J40A 3JREA 1XD7A 1XDUA 2YR2A 1DU6A 1DGWY 2FBKA 3CB4A 2G7HA 3TOAA 4PGGA 4D9JA 5J47A 4KA4A 1V5EA 1J2XA 3IP4B 1EFCA 5H5JA 5F4MA 3R4KA 3BR5A 3I4MJ 2XTWA 3EQNA 1X1PA 4ZV4A 4FWTA 1SD7A 3Q0WA 1RESA 4BAYA 4CSWA 5M5XJ 4ZYAA 2CFXA 3JRGA 1LE8A 1Y6IA 4A0ZA 1T56A 2GK7A 3W2IA 1IN5A 5IT9Z 1MMAA 1F20A 1Q1VA 3BQYA 1ZYRF 5FL7A 1R4NB 4QV2A 1U0JA 4TMWA 3VMWA 3CP2A 4E7ZA 2M3AA 1H0MA 4M3DA 2OBSA 5D6FA 3LFKA 2J8KA 4IRIA 2QGUA 2PJRB 1N08A 4PDKA 2HNHA 5HLIA 1ZH5A 1QGZA 4DOZA 3PIPF 2NNNA 3VYTB 3FHZA 1QCXA 2E36A 3WNDA 1SC7A 3FM3A 3BH7B 5ED4A 1MBJA 3HEFA 3WXMA 2QBYA 4M9SA 1T08B 2X48A 4JK1X 2A6TA 4ZZLA 2DA4A 2F4IA 2F5VA 3W6KB 4UNOA 4CCKA 4U4BA 3Q38A 2D1VA 1OB0A 3BH4A 4PJMA 1EA0A 1BR4A 1E64A 5DUKA 2V7VA 4XL9A 4GXOA 3CMYA 1MH3A 1Y0UA 5F0HA 1JT0A 3U2QA 5FKNA 5C4JJ 3FKSA 2P7VB 2J7KA 3KP3A 5FRMA 2RDPA 4B47A 1YI2B 3CCMI 1D8KA 4BJ5C 2QM3A 4HX8A 1PUEE 4OIPF 4Y9RA 3CUQB 5FA6A 5ICEA 5AN9A 3QYBA 1DP7P 1LUJB 3S16J 4RDUA 3A1YA 2FX0A 1USTA 2Y69H 3G1LA 2Q6KA 5TV2A 2VASA 2DCUA 5LBQA 3A03A 3IAS2 3ZN1A 2BN4A 1KQSB 2I1LA 1JA0A 2MLKA 2VQLA 3J7YJ 5IYNA 4FETA 3Q3AA 4OJ5A 3A02A 2D3LA 4N9HA 2F5FA 3ASOH 1R5BA 2C78A 2CFOA 2UXXA 2ZFWA 2IS4A 4QWQA 4XNFA 1YI2I 1QH0A 3LAPA 1LNWA 3K1NA 4ZCIA 3OJWA 2C5BA 4HNUA 4NK6A 3PSZA 1EA3A 1X3WB 3W2EA 2GZWA 1O8HA 4EW9A 2HOSA 2L54A 2JSPA 2CW7A 1X1CA 3H92A 4XLHA 5DCMA 3ZPLA 2EA2A 1XC5A 4Z4SA 3CC7I 1I7PA 4I7HA 2X0KA 4TMXA 1MMDA 1QHGA 1YW9A 2FOKA 2JJ1A 1ITYA 2HDWA 2NNYA 1LFUP 3F23A 5LEKA 4DGWB 1WXRA 3I56B 4MHGA 2UV1A 1W0TA 4EEFG 3OYCA 3GZ6A 2DFFA 1VQMB 2ZJ2A 4LB5A 2WJYA 3AG2H 3A8KA 3H9QA 4OINF 3G3ZA 3W5UA 4RJLA 2EH3A 4OOXA 4A3GJ 1MZBA 3HKZA 1TUIA 3L09A 3C3WA 3C2GA 1O4XA 4XR6A 2ID6A 4OWRB 2X9DA 2DW4A 3QYEA 2XGDA 3IH2A 3O8GA 1PLUA 5DM6F 2F5EA 3OR1C 1QJVA 4PC7A 3K2AA 3F8BA 2OD5A 3BR0A 5M5YJ 3VNVA 1YO5C 3EQLF 4WZTA 4IQ4A 2KIQA 3P27A 5KVRA 1YFHA 2XC1A 5B66C 1KA8A 1N8RD 2DETA 3EQOA 4EJWA 1NG7A 3ZZ0A 4A3EJ 1F1ZA 2PE3A 4TMZA 3AL0B 3OL3A 5TR9A 1S6LA 2MD5A 1WJ5A 3DU6A 1PJ6A 1OGIA 1A04A 4HNVA 2OK8A 3H3VK 1DGRM 2DO7A 4R79A 2PMDA 3SEJA 4OJOA 1DDIA 5TY0A 4KDPA 2LVSA 2XGJA 3SJMA 2K4BA 1TSPA 3G05A 2GOMA 1R7JA 1U9OA 2WAQA 3R6SA 2VONA 1TNTA 2LYCA 1D2EA 4WXCA 4HF1A 1FTTA 3BROA 4DK1A 2IS1A 1K4TA 1X0CA 4NK8A 2HFHA 2FSWA 3CMMA 1NH3A 2FBHA 3SYTA 2UZKA 4IO9F 3HYIA 4P3YA 3WHCA 4EMSA 3PSSA 5HNFA 2QEXI 2QKMB 3CC4B 1KYWA 1U8BA 1IGNA 1JKPC 2G0YA 2VBXA 3OJXA 2CBXA 2RNJA 4EJVA 4HRIA 3KYDB 4IHVA 4I2OA 4EATA 4W97A 3UR3C 2L7MP 3PQKA 2HPIA 4L0YB 4E7SA 5IYBJ 3ASRA 5CVIA 1A8PA 3S17J 2ZJPF 2CYYA 2E5NA 1QO0D 2L2OA 4X0GA 5F6FA 2Z99A 1CQXA 3P7NA 2K85A 3GFJA 1FX7A 5D6EA 2D2WA 5CQEA 1W7PB 2EWEA 3E6MA 3E97A 3FBIB 4OOIA 2HVRA 3ASQA 3GWZA 2HXOA 3BDDA 3DTIA 5FKLA 2EJRA 3W2HA 1TYWA 3CC4I 1YJNI 1IUYA 4U0YA 1JKQC 4YFNF 4UUVA 3MWMA 3K1MA 3ZIAA 1Q81D 5JLVC 5L3FA 1E63A 4GGGA 1G4DA 4ZCLA 3OAAA 1FYMA 1EWYA 2DYSH 4BJ6C 4RDLA 4YAWA 1QRYA 1D1BA 2FX3A 5L46A 1FP1D 5B6IA 2LZJA 1N75A 3OYNA 2QE7A 2HR3A 1ZLJA 3LSTA 4RD0A 1QFYA 4R71A 1OMIA 1Z3XA 1D1AA 4KKTA 1NB0A 2F1MA 3SDGA 1D8JA 1ETQA 2JPCA 2A69F 3T1BA 2BSAA 3QU6A 1E62A 5K5RA 2Y48A 2LY2A 1HKQA 2XB0X 3SJPA 1SFEA 1K4SA 3PFYA 4M9ZA 1KJZA 3WBJA 2EFOA 1TWAJ 5JFRA 3P4GA 1KCDA 1TWGJ 3B6AA 3OS1A 2OTJI 3H9GA 2F5CA 4G9YA 4AIDA 4E7LA 3M9AA 1R4MB 4D0PA 2HVQA 3K9TA 1BIAA 3RSNA 3OYJA 3LSPA 1HW1A 1AOYA 5ICGA 4KISA 1VQPB 1KONA 4G7ZF 4M72A 4PC2A 4Z05A 1BR2A 1GVJA 2DMPA 3OR2C 1LDKB 3WG9A 3TMOA 1EE6A 1YLFA 4NNJA 5E79C 3TO7A 1JGGA 1MH4A 1AIRA 3ERMA 1W36D 1SKQA 1IV6A 4XKVA 2ACJA 2R7ZJ 2ZZFA 2YX4A 3SUCA 5AIQA 1XG1A 1YS6A 1KU9A 1BIBA 4YHBA 3HOZJ 2N8GA 3SZTA 2LG4A 1WSVA 1P92A 1YW7A 2K02A 3M1CA 3SDBA 1LJ9A 3A0BC 3CO7C 3HG9A 1VQ5I 4PSWA 3J80Z 1P4MA 2OQRA 2P0WA 3TKYA 3WTYC 1PP8F 2VBVA 4PAAA 3U21A 1VQPI 1JA1A 4RGRA 1NK3P 1MNMC 3Q9VA 2JA8J 4URRA 3T8TA 4I84A 1KYZA 1V5GA 1WRJA 3TW6A 1FWZA 2W7NA 2NTBA 4TMTA 2C4UA 2IRFG 3BQJA 2QCOA 3OSFA 3NWSA 4EGZA 1KZLA 3R6KA 1OGJA 2DA2A 2OQGA 4LOCA 5HLGA 1FOYA 4P96A 1VQ8B 2J8IA 1W7PA 4PGHA 2E1NA 3ZP5A 2JVGA 1JXSA 2WPDA 3R0JA 4HE6A 3Q5FA 3DTKA 4G7WA 1JRGA 4BH9A 1QVFB 3K4LA 3IHUA 3IRRA 5B5EC 2B7BA 2EIXA 3FXMA 5FLVA 5LLQA 3V7RA 4N3GA 3JRIA 1E3PA 2L0KA 1AWCA 3UKGA 1OHHA 1TQIA 3KPHA 4PC6A 1MGTA 4NDLA 4UB8C 4PC3A 2OA4A 1HA8A 4OPOA 2MA3A 1LFPA 5K1YA 2EFQA 1ZGJA 2XPUA 4BJTA 2KLOA 3VFZA 2D74A 4A3BJ 4B3GA 1K7AA 1TT0A 3LNQA 1O8IA 1SVMA 1PP7U 3B73A 2RNGA 3FK7A 2ZJQF 1VQ8I 3NAUA 1H42A 4FN5A 2OPTA 4M3BA 2EFWA 2LRDA 4RAYA 3DKXA 3SEQA 3GX4X 2GA1A 2ZNYA 1PYVA 4M2LA 2CUEA 2ZXHA 2JQ7A 5DEQA 4GYGA 4BQNA 2XB5A 5L3GA 4MO7A 1T0FC 1Y1VJ 2A5YB 5M3FJ 4Q48A 2DT6A 3BQZA 4OAZA 3CCQI 4BXUA 2QTZA 2DK5A 2UVFA 3FXKA 2X8KA 2BHZA 3HOWJ 3I1FA 4C2LA 2EV5A 1Z7LA 3GLXA 4BYYA 4P1WA 1FEXA 4V02C 1JNYA 2HQAA 5EEAA 1NHCA 5KSWB 3R0AA 2HOEA 2DOGA 2ZBUA 3P9CA 1E2XA 4V2FA 3H0DA 4DQLA 1IG7A 3KP2A 2DN0A 3EUKL 3L2VA 2HVSA 2VODA 1VQ6B 1ORKA 2BPOA 3SEZA 1IAWA 2DA3A 3I4NJ 2O8XA 3P9IA 4HX7A 3LO8A 1Q82D 1X3UA 1H88C 2C6YA 2PYGA 1BOBA 4R8HA 2MLGA 2GOXB 4ENJA 4GDFA 2DK8A 4X7EA 1BJZA 3HOUJ 2AXLA 1S7EA 2XASA 1FC3A 2XPWA 4W1UA 3K10A 3E6BA 1LLWA 3AK5A 2FEZA 1BX1A 1KZHA 3K7AJ 2ZL6A 3WGGA 2W25A 1F36A 1G6NA 2EV0A 1STZA 3AFHA 3OV8A 4LMYA 3H9NA 3AVVA 2LH9A 3GUDA 3G71B 3CMEB 3K4NA 1OCCH 2ZFUA 5GAEJ 2FE3A 1MBHA 1V0FA 3VR6A 1C0WA 5IYDJ 2NSPA 2MABA 1OR7A 3FXRA 2BW3B 3LQQA 3S15J 3WE3A 3OE7A 2ELKA 5IP7J 2DODA 5KAIC 2XNDA 2O0YA 1ETVA 2CQQA 2LFBA 5LFAA 2PECA 4UUSA 2ZXIA 1I1SA 2KIFA 3K4CA 2GQFA 3I53A 2XSJC 2CGPA 1ZHFA 2H27A 4KH3A 1ZM9A 3CESA 3JQRA 3HOYJ 3LYCA 3CCVB 2HDDA 4HF0A 1N78A 1O8GA 2BV3A
chains in the Genus database with same CATH topology
2HLDA 2VPLA 3H94A 2XAUA 1JI8A 2ZTGA 2DXIA 4TKOB 1BR1A 1OR7C 4BU2A 4ZTFA 3QODA 3OY9A 2BVLA 2W4SA 3ONQA 3OYDA 4JMQA 1UAAA 2ODLA 4YZQA 2MYSA 3LSMA 1UD8A 3FY3A 2WA0A 1E3ZA 3PNYA 1T95A 2K5CA 2Z16A 4YEJA 3ZXSA 1FMWA 2VXDA 3W2AA 1V5FA 2WJVA 1I18A 2O1DA 2CUZA 1W0KA 3DQVC 2Q2EB 4E6KG 2V7QA 4B3XA 4AU7A 1WJFA 3LSHA 3DLAA 4ZDOA 4BQQA 1NRKA 3D5RC 3MD2A 3A4CA 1VZ0A 3GVJA 3OOCA 3HAGA 3EPZA 5DN6A 1O8EA 1Y56A 2V4JC 3K4KA 4U87A 4OAYA 2CV0A 2Q1ZB 3A3BA 4TT3A 2L9SA 4PFPA 2M7BA 1ZELA 4XKBA 2VJ5A 4XLFA 5TGTA 2W6IA 4C2TA 3B90A 4C30A 4CCMA 1JTAA 1X1DA 2HZDA 3DPTA 4RM2A 1IA5A 3PNTA 5CDFA 4KJZA 2KL4A 4F93B 2VB6A 3H5RA 4II3A 2PJRA 1W9XA 4II2A 1D0XA 3I9V2 3OOUA 2WBMA 3I3LA 2MFZA 4BDZA 1WJDA 2DJIA 5JHFA 2MD0A 2ZZGA 2BVMA 2IGMA 1O8LA 2V1NA 3E0JB 5FRNA 1BN8A 5CKTA 3PJRA 2NOJB 2V26A 4PFOA 1V0EA 4MLOA 4CUGA 3MKWB 1WPCA 2V31A 3DU5A 1D0ZA 4E7JA 4OJLA 4B43A 4ZTJA 1COWA 2A5WA 5HLTA 4XONA 3GVLA 2Z6BD 1AA7A 1WMRA 2M4KA 2X6WA 3K4BA 1DGWY 1MNDA 4YZAA 4PK4A 4D9JA 4XM3A 2NT9A 2V7FA 4XMYA 1V5EA 3IP4B 3SZGA 1VF7A 4E0FA 2QX3A 3HXLA 3EQNA 3LFUA 4KKSA 4ITVA 2R7OA 1H80A 3BG7A 3F9KA 4ZJZA 4CSWA 3QYFA 4ZYAA 2GK7A 1D0YA 1Y6IA 1YX3A 3K6GA 3AKZA 3M8JA 3E1SA 3OYKA 4W8QA 4Y33A 4CCLA 2WY7Q 1MMAA 4E4HA 4J01A 1HG8A 3ZPPA 5FL7A 2IS2A 2ZSHB 4Y3OA 1U0JA 3BLYA 3VMWA 3CP2A 4E7ZA 2M3AA 3T51B 1DP3A 1X1AA 4HG2A 4MR0A 1ERDA 2PJRB 2AQEA 3VDXA 4BUPA 3MKYB 2HNHA 4QPQA 4BL0B 4DOZA 4DBQA 1QCXA 3VYTB 3S32A 1HVXA 3VSUA 3A2KA 3BC8A 2V4DA 1KTWA 4CZCA 4E7HA 3G2BA 3KYLA 3OIPA 4PJNA 2IXSA 2O5RA 3ZGKA 1FX0A 2RREA 1WJCA 2INUA 2A6TA 1H8EA 3H5AA 2BOLA 2DOAA 3GBGA 2F4IA 2F5VA 2F6CA 1MMNA 2PMZA 3T53B 2IGKA 1SAUA 3FDYA 3LSIA 4CCKA 4F92B 4U4BA 2BSPA 1OB0A 3BH4A 2L9NA 4PJMA 1UELB 1BR4A 3D5LA 4CCNA 2K3PA 4XL9A 2R7QA 2LBFA 5IK2A 3FKSA 4FXUA 5FRMA 3KEWA 4B47A 4W8SA 4BJ5C 1G59A 4BACA 2OC6A 3KX2A 1UD4A 1VJSA 2GK6A 3NE5B 2LREA 3QYBA 3MKZA 2CV1A 1OLTA 3A1YA 3K4MA 3OYFA 2VASA 1T5EA 3GQ7A 4TSFA 3IAS2 3HOTA 3GRHA 4YELA 2VQLA 2E60A 2ZTNA 4FETA 2KQRA 2XF5A 3GQAA 3OIQA 1OGOX 2V9KA 4OJ5A 2D3LA 3S3MA 3OYAA 2ZSIB 2V6EA 2CFOA 3VSKA 2X3HA 3GQBA 2IS4A 4XN3A 4BXFA 4XNFA 3OPOA 3L2RA 3FBNB 4AYBA 2R7XA 2KDOA 2K9LA 2GJPA 4HNUA 3T56B 1RU4A 4NK6A 1VBLA 1J09A 1EA3A 4LG3A 1O8HA 4EW9A 1I8DA 3W3CA 1KMHA 1PJRA 2JSPA 2WSSA 3IUOA 4DJAA 2CW7A 1X1CA 4XLHA 4OJ6A 1X4OA 3BCAA 3L2UA 4U49A 4G7XA 2OUMA 2Z1DA 4XD7A 1VLYA 4MXNA 1GQ8A 1MMDA 1QHGA 1X1BA 2JJ1A 2LBFB 1R6RA 4Z06A 2HDWA 3TL4X 4HPQA 1UD2A 2R7RA 4DGWB 4PMHA 4ZDPA 2UV1A 3OYCA 2JA2A 3AL0C 1TZLA 5KHDA 1QHHD 2DIEA 2WJYA 3H9QA 3PSFA 2VQGA 3PUBA 4DBRA 1W36C 3MMYB 2W6JA 2X85A 3HKZA 3OFNA 2VBMA 3C2GA 3FPPA 4XR6A 3BCDA 3H5NA 4OWRB 3QYEA 4BS9A 3CJQB 1PE9A 1PLUA 2VQHA 1O8DA 2VBEA 2I8DA 1QJVA 3OR1C 3WQZA 2IQ7A 1E43A 2JJ2A 3RPUD 1E1RA 4IQ4A 4OZZA 1G8XA 3S3OA 1X4PA 3OMYA 3CJRB 3TBIA 4G6IA 1PKVA 3OEEA 2CS3A 4UZUA 2O04A 3EQOA 1NG7A 3OWTA 4HSRA 2OV7A 2X6YA 5C1EA 2VL8A 3AL0B 3OL3A 3A3GA 3CP8A 2WAEA 3OS2A 1WJ5A 3DU6A 2VKHA 4XLAA 1E3XA 5C1CA 2QY1A 4OJOA 1DGRM 4AVZA 4R79A 4RMNA 1UD5A 4ASUA 3UNGC 3DTEA 1GLNA 4RLQA 2XGJA 4E7KA 4IX7A 3G05A 2GOMA 2WAQA 4XOTA 1IDJA 3B4NA 2PYHA 2R7WA 2LYCA 2KMUA 2R7SA 2IGNA 2WZPP 4DK1A 2IS1A 2X53S 3VYUB 2CMPA 1X0CA 4XLCA 1MABA 4NK8A 3C2HA 2XOKA 4BE1A 3CMMA 4RM3A 1Z21A 4BQOA 3LSKA 3SYTA 3GQ8A 3ZR8X 5HNFA 2ELJA 2QKMB 2E1BA 2O0VA 2R7VA 1XG2A 3H9JA 4XN0A 4P5OA 1WFXA 1WJBA 4KKUA 4NUBA 1E0EA 5AMVA 3VWBA 2ZZEA 3JU4A 4HRIA 2RQQA 1X19A 4EATA 3CZ6A 1NG6A 1BMFA 3ZRGA 3UR3C 2W00A 2HPIA 1H8HA 5CQGA 4CH7A 1WTHD 4E7SA 1P9QC 4XKWA 1O8KA 5KCMA 3OW7A 2M7AA 3HPHA 2NSTA 4B48A 2E5NA 2JVHA 2VJIA 2L2OA 4X0GA 1QU3A 1SKYB 4P22A 1FMVA 1K5CA 4HWVA 2VIXA 3HC7A 5CQEA 3OYEA 2EWEA 4HNTA 3FBIB 2HVRA 2XC7A 3DTIA 2XZLA 4NQWB 4OZYA 3OL4A 2DCEA 2E1MC 2GJRA 2UWMA 4KT6A 4RLFA 4ZC3A 1WP6A 3ZIAA 1LVKA 1YX5A 2X1EA 2XF7A 4CCJA 3OAAA 2AQFA 4BJ6C 4HSTA 5CPRB 2X6XA 2CUJA 3FHNA 1LKXA 1D1BA 4XORA 4W8TA 1Z3YA 4NC7A 2IGOA 3S93A 2XZOA 5KNLA 3EUHC 3K70D 2LZJA 1N75A 1NBMA 2R4GA 3LSGA 3OYNA 2QE7A 2LY1A 2WY8Q 3OEHA 3LNNA 2O17A 1O8JA 4GQNA 1RMGA 1Z3XA 1UD3A 1D1AA 4KKTA 3RCOA 1RWRA 2VXZA 2VKDA 3NWTA 2F1MA 4XQFA 2LY2A 4HIZA 4W8RA 2HU9A 3PFYA 3UW0A 1KCDA 1MNEA 2E1MB 3OS1A 3H9GA 3LMWA 3VYRB 1DBOA 2KPMA 4E7LA 2XZPA 4XOPA 5HNHA 4DK0A 3VSVA 2NZMA 1D1CA 4FASD 2KP6A 2HVQA 2HPMA 4C2UA 3L2QA 2Z8GA 1O8FA 4JOMA 3ZSCA 4LITA 3T9GA 3RSNA 4C9YA 2WB1A 3HUGB 3OYJA 3BCFA 2NTQA 3S8PA 2CH0A 4KISA 3OS0A 1KONA 2MC4A 2L5QA 3RTRA 4Z05A 1BR2A 2LC2A 1EFRA 1CZFA 2WAFA 3OR2C 1LDKB 4HEA2 3LL7A 3TMOA 1EE6A 4NNJA 2Z2SB 1YE9A 2INVA 3IAM2 2K9MA 1AIRA 4NC8A 4DNTB 1W36D 4XKVA 3PSIA 2ZZFA 2VJJA 2QXZA 4B44A 3GQ9A 5HKKA 2UUZA 4PJLA 3WWGA 4BDYA 1UG0A 3SUCA 2FUG2 4N4OB 4F55A 3OYBA 3J7AY 1SFKA 2LG4A 3DDYA 3M1CA 4Z03A 3SDBA 3VSTA 1UD6A 3OYHA 3HG9A 3OYIA 4PSWA 3EUAA 3BCBA 5FROA 2P0WA 1O8GA 2X51A 4OJPA 3U21A 2XDVA 5HVQC 3GVKA 4URRA 1IRXA 1IDKA 4I84A 4F3QA 3DPLC 1V5GA 2M4GA 3VYSB 1O8MA 3VSLA 2CW8A 2W7NA 2NTBA 3ZPNA 3DWLE 3NWSA 1KZLA 2X1CA 2M0MA 2CV2A 2JUGA 3H35A 2KHMA 4PSXA 2W82A 4BEHA 1BHEA 4PJJA 3N05A 2F43A 2JVGA 4JQFA 3S3NA 1BLIA 3FKJA 2WPDA 2NT6A 4Y4RA 3DTKA 4G7WA 1JRGA 4ZDLA 3K4LA 4YRVA 2XF6A 2E5ZA 1OHHA 2NTPA 1O88A 1K28D 3PNVA 2QKLB 2W1OA 1HA8A 1MMGA 1LFPA 4YZ0A 1BPLA 4BJTA 2KLOA 4GRIA 3OYGA 3KEYA 3LMMA 1OOCA 2JDIA 2R9VA 2ZZQA 4B3GA 3A35A 1KCCA 1TT0A 2GJKA 1O8IA 2RNGA 4B3FX 3VMVA 2O0WA 4CCOA 2LRDA 4L8JA 4CA0A 3DKXA 3SEQA 3QOEA 4F91B 3JURA 1PYVA 2BW3A 4D1QA 3PL8A 3L2WA 2ZXHA 4IQJA 3KRGA 3HPGA 1N77A 4BQNA 1T0FC 4LIUA 4BE0A 3K4JA 2DT6A 4OAZA 2DT7B 2WADA 2UVFA 4IZZA 3HOSA 2X8KA 2Y0SA 4C2LA 1S9HA 4Z1MA 3DEEA 4PUSA 1OFLA 1Z7LA 4P1WA 4DIQA 2R7TA 3CF2A 2HQAA 3B8YA 1NHCA 2KVOA 4BEHB 2JIZA 4G6TB 4ANJA 1PXZA 4BE2A 1DBGA 4XLEA 3OYMA 3H0DA 3OYLA 1K6YA 3EUKL 3L2VA 2HVSA 4E7IA 3SEZA 4J00A 2UVEA 3W2WA 4N4NB 3W2VA 3BG6A 2VQCA 2PYGA 1BOBA 2R7UA 4YZXA 2GOXB 4YXWA 4DNRB 2CK3A 4F52A 3DPUA 2LOOA 4H4KC 1WJAA 3ZQQA 3DKYA 3K10A 2IS6A 1E79A 3D5SC 1HZEA 2VJ4A 3AFHA 3HL2A 4U7BA 2LH9A 2KRCA 2KRHA 2X1DA 3K4NA 3ZCOA 2ZFUA 5HOOA 1V0FA 1WJEA 3VR6A 2L7KA 5LD2C 1DQUA 2MABA 2NSPA 4QPOA 4BGDA 2VBKA 2BW3B 2M5SA 1OFMA 3OE7A 4IKFA 3V42A 1MW7A 2XNDA 1OGMX 5LFAA 4LIVA 3RQ4A 2PECA 2ZXIA 4KITB 3K4CA 2D3NA 2KZVA 3BC9A 2XSJC 1IB4A 4XKCA 3CESA 2VLAA 1E1QA 1W0JA 1N78A 3K70C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  4I84 A;  4NK8 A;  1O8M A;  4XL9 A;  2NTB A;  3GQ8 A;  2ODL A;  4W8S A;  4YZQ A;  2O0V A;  1XG2 A;  4XN0 A;  3FY3 A;  1BHE A;  5AMV A;  4YEJ A;  2O1D A;  2NT6 A;  1JRG A;  3GQ7 A;  3GRH A;  4XKW A;  1O8K A;  4YEL A;  2NST A;  2NTP A;  2VJI A;  1O88 A;  3GQA A;  1OGO X;  1K5C A;  4OJ5 A;  4HWV A;  1O8E A;  4YZ0 A;  2EWE A;  2X3H A;  4XN3 A;  4XLF A;  4XNF A;  1OOC A;  3B90 A;  1KCC A;  1JTA A;  1O8I A;  4OZY A;  1IA5 A;  1RU4 A;  4NK6 A;  1VBL A;  2O0W A;  3VMV A;  1O8H A;  4EW9 A;  4OJ6 A;  4XLH A;  3JUR A;  4URR A;  2X6X A;  4U49 A;  4MXN A;  3KRG A;  1GQ8 A;  4XOR A;  4W8T A;  1O8L A;  4Z06 A;  1BN8 A;  2UVF A;  4C2L A;  4PMH A;  2O17 A;  1O8J A;  1OFL A;  1RMG A;  4OJL A;  1RWR A;  3B8Y A;  1NHC A;  4XON A;  1IDK A;  1PXZ A;  4XQF A;  1DBG A;  1WMR A;  4XLE A;  4W8R A;  3UW0 A;  2X85 A;  2X6W A;  2VBM A;  4YZA A;  1KCD A;  4XR6 A;  4XM3 A;  2NT9 A;  3LMW A;  4XMY A;  1DBO A;  2UVE A;  4XOP A;  2QX3 A;  3VSV A;  2NZM A;  3EQN A;  1PE9 A;  1PLU A;  2PYG A;  1O8D A;  2VBE A;  2Z8G A;  1QJV A;  4YZX A;  1O8F A;  3ZSC A;  1H80 A;  3T9G A;  2IQ7 A;  2NTQ A;  4OZZ A;  4W8Q A;  4Z05 A;  3ZPP A;  1HG8 A;  1CZF A;  1EE6 A;  2O04 A;  2INV A;  3VMW A;  3EQO A;  2X6Y A;  1AIR A;  4MR0 A;  5C1E A;  4XKV A;  2VJJ A;  2QXZ A;  3GQ9 A;  3WWG A;  4XLA A;  3VSU A;  2NSP A;  3SUC A;  1QCX A;  2QY1 A;  5C1C A;  2VBK A;  4OJO A;  4AVZ A;  1OFM A;  1KTW A;  1OGM X;  2PEC A;  4Z03 A;  3VST A;  4XOT A;  1IDJ A;  2INU A;  3B4N A;  2PYH A;  1IB4 A;  4OJP A;  4U4B A;  2BSP A;  1O8G A;  1X0C A; 
#chains in the Genus database with same CATH topology
 2HLD A;  3OSG A;  2VPL A;  3H94 A;  1WI9 A;  1JI8 A;  1WGX A;  2ZTG A;  2IA1 A;  1MDM A;  4TKO B;  3OP1 A;  3OY9 A;  2W4S A;  2M87 A;  1BN5 A;  4AWX B;  1B4A A;  3BR3 A;  1R58 A;  1ZR2 A;  4PJ0 C;  2B0L A;  1NHA A;  3D1N I;  1VI0 A;  2O1D A;  5EEH A;  1U3E M;  2QN6 A;  3RIR A;  2LSO A;  1W0K A;  3DQV C;  2R7D A;  2OYN A;  4AU7 A;  4RGU A;  4MQ9 F;  2FQ3 A;  3LSH A;  4IHW A;  2V6C A;  2CW5 A;  1KRH A;  1Q9S A;  2VBU A;  1QVT A;  2LTP A;  4Y7C A;  3PM1 A;  3CCR B;  5K7H A;  1BW6 A;  2L7Z A;  3CDL A;  3V76 A;  3A4C A;  2NVQ J;  3EPZ A;  4Y13 A;  2R6H A;  4U9U A;  4U87 A;  3ZMV A;  2Q1Z B;  3KP7 A;  1I3A A;  3K0L A;  5D5X B;  1YHQ I;  3BTC A;  1F60 A;  5FD6 A;  3NRV A;  3MN2 A;  3PUN A;  2DER A;  5A2Q Z;  4XLF A;  5GAH J;  1WOR A;  4C2T A;  2W6I A;  1FLI A;  2BBY A;  3CDH A;  4CCM A;  1X1D A;  3V7S A;  2ZB9 A;  2LNB A;  1XCB A;  3GZN B;  5EJC A;  1FOK A;  5GV8 A;  2VB6 A;  2CND A;  3F8F A;  2ECB A;  2IP2 A;  1B9M A;  1TW3 A;  4OPW A;  3E6C C;  3KET A;  3CO6 C;  4X8I A;  1KQ5 A;  1ZUN B;  1R9T J;  2J5O A;  3FM5 A;  2DJI A;  5JHF A;  1X2M A;  2M9H A;  2MD0 A;  3JAM Z;  5JI6 A;  2ZZG A;  3F8N A;  5FRN A;  3H09 A;  2P6T A;  2V26 A;  3RKW A;  3LSR A;  2YWF A;  2ISY A;  2GXG A;  3DU5 A;  2V31 A;  4B43 A;  4H9G A;  4CHU A;  4ZTJ A;  1ZRE A;  3GTP J;  1IJE A;  5FNZ A;  4M74 A;  5J8F A;  2ETH A;  4DQK A;  3OIO A;  3KLN A;  2J5P A;  3ML3 A;  3JSO A;  3GFM A;  4UB6 C;  4G94 A;  3FXU A;  1ON2 A;  3R61 A;  4G12 A;  4Z6Y A;  5H20 A;  4PK4 A;  3PIO F;  4OMY A;  4YZA A;  3BTJ A;  4E0F A;  1S5L C;  1FYK A;  1VF7 A;  2RVC A;  1J75 A;  2CRV A;  3J81 Z;  2ZME B;  4M6X A;  4RPD A;  1R49 A;  2R7O A;  4DNC A;  2JJ7 A;  3QP6 A;  1YX3 A;  1IXR C;  1RI7 A;  4A93 J;  2M0C A;  3E1S A;  3HSE A;  5JLX A;  4Y33 A;  4CCL A;  3OYK A;  4W8Q A;  4E4H A;  3M07 A;  2F4N A;  3BT9 A;  2BY2 A;  3BH6 B;  3BLY A;  4QVA A;  3T51 B;  1DP3 A;  3CUQ C;  3BJ6 A;  2GBY A;  3QP5 A;  2YSR A;  1ERD A;  2AQE A;  4BUP A;  2F2E A;  2B7E A;  3H1C A;  4QPQ A;  3ELK A;  2OU2 A;  5JLW A;  3A2K A;  4RDK A;  5DTD A;  1LB2 A;  2CQX A;  1VHE A;  2EA4 A;  4CZC A;  4E7H A;  1QUF A;  3G2B A;  2XVC A;  3V7C A;  2IXS A;  2O5R A;  3ZGK A;  4A5N A;  2XGX A;  2INU A;  3ISX A;  3H5A A;  1QGP A;  3GBG A;  4ZYD A;  1MMN A;  1OYY A;  1HF0 A;  2VUM J;  3LSI A;  4WWV A;  1R1V A;  4RAG A;  3T53 B;  1ETW A;  2HQN A;  4UVC A;  3BZC A;  1UEL B;  2ELH A;  3D5L A;  4CCN A;  3N90 A;  2R7Q A;  2ZXJ A;  5HS8 A;  2ZKZ A;  1SD5 A;  4FXU A;  3J81 k;  4Y9U A;  3LA2 A;  5FO1 A;  5HZB A;  2BVN A;  1YG2 A;  1FBU A;  3KX2 A;  3TW7 A;  4RB3 C;  2VKE A;  4DZP A;  1VJS A;  2GK6 A;  5D5U B;  3TO9 A;  3NE5 B;  1QBJ A;  4I0B A;  2LRE A;  2L4M A;  2CV1 A;  1UB9 A;  3VNU A;  3I64 A;  1VFC A;  2XAJ A;  3V8L A;  2GXA A;  2DA7 A;  1U2W A;  3SLD A;  3NAW A;  3OYF A;  4JX4 A;  4GFB A;  3SJZ A;  2EIN H;  1Z7U A;  4TSF A;  2E19 A;  3HOT A;  1NK2 P;  5E1W A;  3GRH A;  1VQK I;  1DPR A;  1EH6 A;  3PUF A;  2OZU A;  1U5T B;  3M7G A;  2DDA A;  2XF5 A;  3OIQ A;  2V9K A;  1QNT A;  2A6E F;  3TP3 A;  4XLN F;  1IN8 A;  2IT0 A;  2V6E A;  2FMY A;  2HQR A;  2X3H A;  5IYQ A;  2LR8 A;  2V1X A;  5E18 F;  2QQB A;  2A68 F;  3QPH A;  2BMW A;  3HIF A;  4M3G A;  2DA1 A;  3QPT A;  2KDO A;  2K9L A;  3TH0 A;  2GJP A;  3CCJ B;  4X7C A;  2DBB A;  1VBL A;  3MVP A;  4LG3 A;  1T39 A;  2QBY B;  1I8D A;  4AYB N;  3RPQ A;  5J3O A;  4OJ6 A;  2IAI A;  3WTV C;  3L2U A;  1S3J A;  3JRF A;  2OUM A;  2Z1D A;  3VO1 A;  1VLY A;  3LJY A;  1GQ8 A;  4YG2 F;  1KGS A;  1PJ5 A;  3E20 A;  1B9N A;  3KZY A;  3RKY A;  4DYQ A;  2ZME A;  1ULY A;  4HX4 A;  4Z06 A;  1XN7 A;  2RAE A;  3TL4 X;  3HRS A;  4HPQ A;  3MHP A;  2FRH A;  2R7R A;  4PMH A;  3KP6 A;  3A0H C;  1ZAO A;  1W5T A;  3OOP A;  3AL0 C;  3CD6 B;  5BPI A;  4L5E A;  2H1L A;  1QHH D;  3KFW X;  5KHD A;  3BY2 A;  4YAU A;  2XNJ A;  4D5F A;  1LLZ A;  4DYR A;  1QVU A;  3QAH A;  3PSF A;  3PUB A;  2CRG A;  4DBR A;  2G7U A;  3MMY B;  1FSE A;  3CCS I;  1W36 C;  2W6J A;  3DLL F;  4EJU A;  4M3F A;  3CCJ I;  3OFN A;  3FPP A;  2XKP A;  3QFC A;  2Z9O A;  3EDP A;  3IC7 A;  2D45 A;  1NJI D;  3CJQ B;  1XS9 A;  1RKT A;  1OJL A;  1PE9 A;  3AG1 H;  2IQ7 A;  1BM9 A;  4KT5 C;  3R6J A;  2JJ2 A;  1GO2 A;  4BXX J;  2ME0 A;  2JWT A;  3IL2 A;  3S14 J;  4WZK A;  4OZZ A;  3TO6 A;  2DMT A;  1KQ8 A;  3TBI A;  1N06 A;  1RRJ A;  4RB0 A;  1TLL A;  4M53 A;  2R7F A;  1PKV A;  2CS3 A;  3EET A;  2XRL A;  1HXD A;  1R5G A;  3LA3 A;  4HSR A;  2OV7 A;  5FFZ A;  5EGO A;  1O3Q A;  3M8E A;  4HOB A;  3M8F A;  3GVA A;  3AGQ A;  3CP8 A;  2XT2 A;  1J5Y A;  2DI3 A;  4XLA A;  3OS2 A;  3Q6R A;  1BW5 A;  5DCM B;  5C1C A;  5E8I A;  1UD5 A;  1S29 A;  4RMN A;  4S05 A;  3B8H A;  4HQM A;  1GLN A;  2AHQ A;  4E7K A;  2HQ5 A;  2MC3 A;  3JTG A;  4XOT A;  1IDJ A;  2YX7 A;  5HXB A;  2PYH A;  4AC9 A;  2M5W A;  1SMY F;  3CCU I;  2BM1 A;  2BY0 A;  1M1E B;  2DYR H;  2KMU A;  4C0S A;  5JVT A;  3X2Q H;  1HOM A;  2ID3 A;  4B1R A;  3VYU B;  5BPD A;  2M30 A;  3OKX A;  1XMX A;  1U5T A;  3HZJ A;  3TQN A;  4UUT A;  1KQ0 A;  3ZR8 X;  4EV0 A;  1IB0 A;  1JJ2 B;  3CCM B;  1T6X A;  1TQM A;  1XG2 A;  3H9J A;  4Y7N J;  3CCL I;  1SD4 A;  4P5O A;  5BSY A;  1WFX A;  5K5Q A;  5AMV A;  4FIS A;  2ZZE A;  3U1D A;  3JU4 A;  5IYC J;  2DOE A;  2RQQ A;  1BMF A;  2YUH A;  3CZ6 A;  1NG6 A;  2W00 A;  2LKX A;  5FFX A;  2VFN A;  1H8H A;  1UZC A;  5CQG A;  4CH7 A;  4CXF A;  1WTH D;  2ZO4 A;  4XKW A;  1IRG A;  3SKB A;  1O8K A;  2VBZ A;  5KCM A;  3HPH A;  5GPC A;  1OYI A;  4B48 A;  3S1R J;  1SKY B;  1ZG3 A;  3FK6 A;  1A5J A;  3HUG A;  4HWV A;  1REP C;  1XSD A;  2YU9 J;  4P55 A;  4I99 C;  1KK2 A;  5C3E J;  2DPU A;  3JQP A;  1O3S A;  3C7J A;  1QGY A;  2R3S A;  1N07 A;  1IN4 A;  9ANT A;  3U6B A;  4C3I J;  4OZY A;  3OL4 A;  2DQL A;  2DFI A;  3K2Z A;  2UWM A;  1FIA A;  2W7Z A;  1IJF A;  1WP6 A;  3DCF A;  4YC5 A;  2QYU A;  1LDJ A;  2X1E A;  1QRB A;  4A6E A;  5FIU A;  3RYR A;  5FLX Z;  2AS5 F;  3QRF F;  4CCJ A;  2HGC A;  4HST A;  5CPR B;  2X6X A;  3FHN A;  4KFC A;  2VNI A;  4UZE A;  3ZQC A;  1N0V C;  3CC7 B;  4XOR A;  1Z3Y A;  1OB5 A;  4CO8 A;  5KNL A;  3PVD A;  3EUH C;  3RY8 A;  3W5H A;  2WC2 A;  3I5U A;  3LSG A;  4LLG F;  3JX8 A;  2Y9Y A;  2P5L C;  5HDK A;  4B4C A;  1QQ1 A;  1Z91 A;  1RWR A;  1Y8Q B;  2VXZ A;  1K8A D;  4ASN A;  3CCE I;  3CC2 I;  2DMQ A;  2AHO A;  2Q6O A;  4KIF A;  3ULQ B;  4W8R A;  2LMD A;  2P5K A;  2E2J J;  2XZP A;  3N6Z A;  4XOP A;  5CVJ A;  2P3M A;  2NZM A;  4FAS D;  2KP6 A;  5TJJ A;  4J0Q A;  2O6G E;  1O8F A;  4P9S A;  3OZV A;  2EQR A;  1R00 A;  2W48 A;  5JVG F;  1XMK A;  4A0X A;  2MC4 A;  2L5Q A;  1T6S A;  3I0T A;  1MBK A;  3ES9 A;  2LC2 A;  5A88 A;  2YUS A;  4AIJ A;  1EFR A;  1T33 A;  3AST A;  2K3F A;  3TP0 A;  4OOS A;  3LL7 A;  2MSY A;  5BQT A;  2RGV A;  4RAZ A;  3ZZU A;  1G7S A;  2INV A;  3IAM 2;  3S1N J;  1FNM A;  2K9M A;  3GTG J;  1LFB A;  4RS8 A;  2ESN A;  2IJL A;  4I0A A;  1JJ8 C;  2EBI A;  3PSI A;  4FX0 A;  2NPF A;  2O61 A;  1PVE A;  4B44 A;  3GQ9 A;  5HKK A;  2UUZ A;  1QA3 A;  3NEU A;  4GCV A;  4AF7 A;  3LQE A;  3PET A;  2EZH A;  3JRC A;  4B8X A;  2FUG 2;  4F55 A;  3U2R A;  3OYB A;  3J7A Y;  5A8A A;  1LDD A;  4XRS G;  1GR1 A;  1S8N A;  3T8R A;  1JKR C;  3VST A;  1UD6 A;  1FOW A;  1TC3 C;  2XRN A;  3EUA A;  3AVX A;  5FRO A;  1USS A;  1TYU A;  2XNC A;  1IDK A;  1K83 J;  3SZE A;  3VYS B;  2WV0 A;  2VE8 A;  4HE5 A;  1XCV A;  2CW8 A;  5DS9 A;  2V1D A;  3W2G A;  1JTX A;  1MJ9 A;  2QEX B;  3FXO A;  1FNB A;  2X1C A;  1EZG A;  1JGS A;  2JUG A;  1LVA A;  2FOW A;  2KHM A;  4PSX A;  2DFE A;  5F4O A;  2VPR A;  5BMZ A;  2VFO A;  3N05 A;  2F43 A;  2ZNZ A;  3GO5 A;  3HM5 A;  2EB7 A;  3WTU C;  1VTN C;  4RGS A;  1FOX A;  1BLI A;  4BPR A;  4Y4R A;  2CQ7 A;  1JJ6 C;  3JTH A;  5GAD J;  1DUX C;  4ZDL A;  2KJC A;  2ZIT A;  3P9K A;  4YRV A;  1IRZ A;  5GTH C;  3T5X A;  1K28 D;  2OZ6 A;  2Q6I A;  3A1P A;  4X07 A;  5J1R A;  1QZZ A;  2PJP A;  3ABU A;  5H2F C;  4RD1 A;  3FMS A;  2JZY A;  1V4R A;  1D8T A;  3OYG A;  4NC6 A;  1OOC A;  4ESJ A;  2VNH A;  2LDU A;  4V2G A;  2EFN A;  1KCC A;  4Z4R A;  3SY2 A;  2QQ8 A;  1GXQ A;  1EKE A;  5GTI C;  1K6O A;  1SEU A;  1YJN B;  2O0W A;  3BZ6 A;  4CCO A;  4RM0 A;  1WVR A;  4JX5 A;  3IWZ A;  4LBZ A;  2NRA C;  3ASN H;  2LK2 A;  5ILV A;  5J35 A;  3IKT A;  3GEZ A;  4D1Q A;  3PA1 A;  3L2W A;  5E1X A;  2E1O A;  2V7U A;  3ZUG A;  3JRD A;  3WTX C;  1W0U A;  4IXA A;  4LIU A;  4OPV A;  1XGS A;  2JPB A;  4DYC A;  5J1U A;  2JN6 A;  3QSY A;  2DT7 B;  1Z05 A;  1YS7 A;  1S9H A;  4TN1 A;  3WOD F;  2XRO A;  2FVG A;  3GME A;  4L9J A;  2R7T A;  3CF2 A;  2RN7 A;  3GTO J;  1MJA A;  4ACB A;  2Y0S N;  4ZCM A;  1QUE A;  2K86 A;  1HBX G;  1DBG A;  2LKP A;  3OYL A;  5F0F A;  2OTJ B;  5DCF A;  4NB5 A;  4Q47 A;  4RA2 A;  3D26 A;  1M90 D;  4A3F J;  3BG6 A;  3VOD A;  2YS9 A;  4S0H B;  5FKM A;  1LEA A;  3DXJ F;  4YZX A;  4YXW A;  5DS0 A;  4F52 A;  1RET A;  2E71 A;  4H4K C;  1BOA A;  5ICF A;  3ZQQ A;  4NHJ A;  2QF7 A;  4AD9 A;  1FDR A;  3GFI A;  2BGC A;  3ESW B;  1E79 A;  1QRC A;  1BA5 A;  3D5S C;  4QLC U;  2DYI A;  5E3O A;  3HL2 A;  1B59 A;  1GT0 C;  5E8G A;  4U7B A;  3J7A O;  2NXN B;  4I98 B;  3H3U A;  1WPK A;  3ZCO A;  2MBF A;  1RNL A;  1ETY A;  4BHP A;  1TBX A;  1P6R A;  2L7K A;  3MZY A;  1DQU A;  3HRU A;  3QQA A;  1T2K A;  3DV8 A;  1ZQ3 P;  1R5N A;  3I71 A;  3V42 A;  1HKS A;  4A2U A;  3FMR A;  4LIV A;  2NVY J;  2X0L A;  2V7T A;  2D1H A;  3BNW A;  3BC9 A;  1VQ5 B;  5BS6 A;  1GJR A;  2Y0M A;  1PUF A;  1IO2 A;  1UMQ A;  3RJP A;  1S72 I;  1L0O C;  2QVO A;  4HV6 A;  3WNC A;  2KT0 A;  1D1N A;  2XAU A;  5DYM A;  2DXI A;  4XSX F;  2BVL A;  2ODL A;  2W24 A;  3F8C A;  2IW5 A;  3QOP A;  3ZQ7 A;  4JMQ A;  4EM0 B;  1VND A;  2MYS A;  1Y0N A;  3LAJ A;  5F04 A;  1UD8 A;  3ONU A;  2XTX A;  3QU3 A;  3PNY A;  4WZL A;  1H9T A;  2CSO A;  2Z16 A;  4JYK A;  4YEJ A;  4DQ2 A;  1KQ9 A;  5GAG J;  5J4Y A;  4MTD A;  4CIC A;  2RC4 A;  3K1P A;  5J1Y A;  3GTL J;  3CTA A;  3DLA A;  4L5J A;  4XK4 A;  4BQQ A;  4ENM A;  3L00 A;  1W4M A;  4C2M J;  2VFP A;  3MD2 A;  4A3K J;  4MYU A;  2VE9 A;  1UFM A;  3C2B A;  3R60 A;  3GVJ A;  3HAG A;  4O5V A;  3DU1 X;  1P4A A;  1Y56 A;  3FMQ A;  2CV0 A;  2VZL A;  1V54 H;  2L9S A;  1OFD A;  3MCZ A;  2EIM H;  2X6O A;  4LBV A;  2R5Z A;  1ZEL A;  2GIZ A;  2L9V A;  4XKB A;  5TGT A;  4L0Z B;  3D0S A;  5C44 J;  1KK0 A;  2DPD A;  4I6Z A;  6PAX A;  3ISP A;  3CUO A;  5FD5 A;  4F93 B;  3KL9 A;  3H5R A;  2H6B A;  2NVT J;  4UUS B;  4RPB A;  4HBL A;  2ZME C;  4HV5 A;  3I9V 2;  3OOU A;  2JA6 J;  2YWG A;  3ZBU A;  2MFZ A;  4BDZ A;  4HQE A;  1ON1 A;  1FP2 A;  1R1T A;  3G4S I;  3Q3S A;  3CJT B;  1HDP A;  2DMN A;  4A6D A;  3KIO A;  2QSF X;  1A36 A;  2JK3 A;  2IGM A;  1O8L A;  1W7P D;  2V1N A;  4IW3 B;  1R22 A;  5H6Q A;  4D7N A;  2XPV A;  5KAF C;  4RB2 C;  1MDM B;  2NVX J;  3SLN A;  3CCQ B;  1BN8 A;  4MLO A;  4CUG A;  3MKW B;  3CLQ A;  5CVU A;  1D5Y A;  2ZCW A;  2LY9 A;  1E3H A;  3CQZ J;  4KIG A;  4OJL A;  4LBY A;  4LB6 B;  1COW A;  2CW0 F;  5HLT A;  2R0Q C;  1DDG A;  4XON A;  1B72 A;  5F4J A;  5FO5 A;  2XGE A;  3MMP A;  1WMR A;  2M4K A;  4L9V A;  5DDG A;  3V7A A;  2CQN A;  4XSZ F;  2X6W A;  3FPK A;  4XM3 A;  2NT9 A;  4XMY A;  1H8A C;  2QX3 A;  1TP4 A;  3LFU A;  1DU0 A;  2OBT A;  1G3W A;  4KKS A;  2C4T A;  4ITV A;  2YPR A;  5BOX A;  2H1K A;  1H80 A;  3BG7 A;  3F9K A;  2VBW A;  3LA7 A;  3K6G A;  4LLL A;  1YLO A;  4G6Q A;  3ZPP A;  1HG8 A;  1R36 A;  2ZSH B;  4KIB A;  3DF8 A;  5DSZ A;  1X1A A;  4HG2 A;  2KIS A;  5E1Z B;  5F08 A;  3I55 I;  1H9G A;  3MKY B;  3LQR A;  3VSU A;  4FE7 A;  4DBQ A;  1CNF A;  3S32 A;  2DFH A;  4HZF A;  5HS9 A;  2BV6 A;  1UHW A;  3AVY A;  2OCE A;  1KTW A;  1J7K A;  4WXH A;  1R5I D;  1XGM A;  4A0Y A;  3Q0V A;  5B1A H;  3KYL A;  3OIP A;  4PJN A;  4YDT A;  5ILU A;  3O8H A;  1U5T C;  1FT9 A;  1WJC A;  2RRE A;  1FX0 A;  1ZKG A;  2Q8K A;  1HKT A;  2BOL A;  1RIO H;  2F6C A;  2JSC A;  1Z6R A;  1Y8R B;  3ABL H;  4GYI A;  1RUO A;  2HMA A;  3PA2 A;  1SAU A;  4F92 B;  2BSP A;  2DA6 A;  4S04 A;  5K5O A;  4XRM A;  1AMO A;  3A8J A;  5LGT A;  5D5W B;  2K3P A;  2PMZ N;  2LBF A;  3GXO A;  5FO0 A;  1L3L A;  5GP9 A;  4ZZD A;  2KDZ A;  4UY8 I;  1Y39 A;  4HYE A;  3PQJ A;  4BAC A;  2OC6 A;  1G59 A;  4FE4 A;  2OTL I;  1SM4 A;  1D3Y A;  1WOP A;  1JUS A;  2IOU G;  1R71 A;  1K4Z A;  2H09 A;  4RAF A;  1ENH A;  1MIJ A;  2BXZ A;  3Q39 A;  1OLT A;  4NCN A;  3GTK J;  3ZSC A;  2DJN A;  2QWW A;  3K4M A;  1T5E A;  4CGZ A;  4PC1 A;  1TYV A;  4YEL A;  1K78 A;  4RB1 A;  4LK0 F;  5HDN A;  1OYW A;  2DMU A;  2B63 J;  1FBQ A;  3BPX A;  4Q4Z F;  2IA0 A;  2XV4 S;  3OYA A;  2JRM A;  4OIO F;  1YHQ B;  2TDX A;  2ZSI B;  3VSK A;  2QMU A;  3OPO A;  1HSJ A;  4L5I A;  4WXD A;  4AC0 A;  1EH8 A;  3QE2 A;  4AYB A;  1XX5 A;  2AXT C;  3F21 A;  3MZH A;  4X06 A;  4LG0 A;  1IDZ A;  1KMH A;  2R92 J;  1BJA A;  5BSX A;  2B0R A;  4LD5 A;  2QSG X;  3HOV J;  4A3L J;  2E35 A;  4U49 A;  4G7X A;  4XD7 A;  3WBK A;  4MXN A;  1P2F A;  1SVL A;  1NTC A;  4OM9 A;  2K27 A;  3DBL B;  4GO1 A;  1VQL I;  1R6R A;  1TVC A;  2FF4 A;  3GYH X;  1G7R A;  4U0V A;  1I6H J;  1XQB A;  2JA2 A;  1TZL A;  2KIM A;  5CYV A;  1BI2 A;  1WCM J;  2HTJ A;  3F72 A;  2VQG A;  4N3N A;  2QLZ A;  1OCO H;  1YX2 A;  2X85 A;  1B2R A;  4WZE A;  2EWN A;  4YFO A;  1WOS A;  4YIF A;  5FLM J;  3BCD A;  3H5N A;  5J6X A;  2VYQ A;  1A6I A;  2P5V A;  1I27 A;  4WWC A;  2NAZ A;  2VBE A;  2VQH A;  1O8D A;  3JQQ A;  2I8D A;  1TTT A;  1GV2 A;  3WQZ A;  3F6V A;  1K61 A;  5DM7 F;  1E43 A;  1ZM2 A;  3RPU D;  2I5U A;  5ILS A;  4HW0 A;  4CZZ A;  4OJP A;  1G8X A;  4WCG A;  1LQ1 A;  3COA C;  3OMY A;  1XGO A;  5LHG A;  4ENK A;  4R1H A;  4UZU A;  4DW6 A;  3OZU A;  3ZZT A;  1FBS A;  4MQV A;  5C1E A;  3CPX A;  2VL8 A;  3IH4 A;  3A3G A;  1QA6 A;  5LGU A;  3LVB A;  4P6V F;  2WAE A;  2RC6 A;  1R1U A;  1E3X A;  2VNJ A;  1XFO A;  4NQW A;  2QY1 A;  2QSH X;  1I3Q J;  4ASU A;  1QPM A;  1E17 A;  3BTL A;  4MTE A;  1Y1W J;  3DBH B;  4RLQ A;  2F5D A;  1MBG A;  4Y52 J;  2BM6 A;  1YJ9 I;  2Z5U A;  5E3L A;  2R7W A;  2OK7 A;  2CG4 A;  2L9R A;  2XSD C;  2R7S A;  1B6A A;  2IGN A;  3FIW A;  1VLO A;  2WZP P;  1RR7 A;  2DTR A;  2X53 S;  4MFE A;  4IVN A;  1S7O A;  4L9N A;  4XLC A;  1MAB A;  1IC8 A;  2GRE A;  5GV7 A;  3FXJ A;  4BE1 A;  4FX4 A;  2G0E A;  3LSK A;  5HDG A;  1GAW A;  1EH7 A;  2MH2 A;  2E1B A;  4FT8 A;  4ZGN B;  1AU7 A;  2R7V A;  4XN0 A;  4KKU A;  4NUB A;  1E0E A;  5L3D A;  2V7W A;  2EV6 A;  2V9V A;  4B09 A;  1FY7 A;  3ZRG A;  5IOY A;  2K9N A;  1OCP A;  4P2N A;  1VQK B;  3HGY A;  4YIR X;  4TV7 A;  4WK8 F;  1WOO A;  3OW7 A;  3P5J A;  1YIJ I;  4QVJ A;  2JVH A;  1WSR A;  4P22 A;  2P4W A;  3MFK A;  1ZRD A;  4ESB A;  4F7Z A;  1OPC A;  1PJ7 A;  4I01 A;  1K5C A;  2K9S A;  1YIT I;  5EGO B;  2VIX A;  3E5Q A;  1ELO A;  2MGQ A;  3ZMS A;  1VHO A;  4HNT A;  2GAU A;  2P81 A;  2XZL A;  2H94 A;  1VQO I;  1KU7 A;  1IJW C;  3LOC A;  1YW8 A;  1RKW A;  1WDT A;  2XF7 A;  1YX5 A;  3RQI A;  2M34 A;  1BX0 A;  1HQC A;  5LRS A;  1JHF A;  2KKO A;  3A8I A;  2EZK A;  2LF7 A;  4W8T A;  4O3M A;  2XZO A;  2P7C B;  1JT6 A;  2DOF A;  2EZL A;  3ZQH A;  5EDN A;  1XMA A;  3CCY A;  2R4G A;  4H0E A;  1SFO J;  2LY1 A;  2Y2Z A;  2BE5 F;  2O17 A;  5FKK A;  4GQN A;  2DU9 A;  1MRZ A;  1GUU A;  2A61 A;  3CRZ A;  2RQP A;  4U88 A;  3BJA A;  1ACI A;  4ABZ A;  4KNY A;  5IP6 A;  1EP1 B;  2VBT A;  4HIZ A;  3CCS B;  3K69 A;  3UW0 A;  3ZOB A;  5EEG A;  3Q6Q A;  2E1M B;  4MIM A;  5ERI A;  5LEJ A;  2UXN A;  4IOC F;  1VQ4 I;  3H0G J;  4X05 A;  2KPM A;  3LMW A;  4DK0 A;  2O03 A;  1D1C A;  2CJJ A;  2Z8G A;  2E7X A;  3JRB A;  3L2Q A;  2R5Y A;  3F22 A;  5IT9 K;  4LIT A;  4MGR A;  4Y17 A;  4C9Y A;  3HUG B;  2VC1 A;  4AM3 A;  3BCF A;  3T9G A;  3S2H J;  2GPJ A;  1JTY A;  3RTR A;  1IW7 F;  2KRF A;  2EIL H;  1HCR A;  1BI0 A;  2WB1 N;  3I59 A;  2WAF A;  4PZJ A;  2D9R A;  3IV5 A;  1G3Y A;  1ZTR A;  1SAX A;  5D8K B;  4MNU A;  2Z2S B;  1YE9 A;  2XIG A;  3G1M A;  3BR6 A;  1XGN A;  4NC8 A;  2OBP A;  2H8W A;  2BEO A;  3HSR A;  2VJJ A;  3WWG A;  5DD4 A;  4PJL A;  2F4M B;  2BZT A;  1UG0 A;  3GTJ J;  2TRT A;  4N4O B;  4IPA A;  1IUF A;  1HC8 A;  2C2W A;  3WU2 C;  3U6K A;  3DDY A;  2BX6 A;  4Z03 A;  1S7A A;  3FZV A;  3OYI A;  3CCU B;  3BOQ A;  5AIP A;  1OKR A;  3BCB A;  3BP8 A;  2QA4 I;  3ASP A;  5HVQ C;  1IRX A;  4N0B A;  4F3Q A;  3DPL C;  1WKM A;  3VSL A;  5CJ9 A;  2QZA A;  1HW5 A;  1YTY A;  1Z9C A;  5DV5 A;  4EJO A;  2DAO A;  4J19 A;  5B1B H;  4OOV A;  2HI3 A;  3CCL B;  5HZA A;  3H35 A;  2W82 A;  1ZR4 A;  3ECO A;  4BEH A;  2CF4 A;  4HDV A;  1BHE A;  1RPW A;  4C43 A;  2NT6 A;  3FKJ A;  2GIV A;  1WH5 A;  3JW4 A;  2E2I J;  5LMZ A;  5L3E A;  2HWV A;  1KU2 A;  2IVM A;  3O6B B;  2E1R A;  2VT3 A;  2XF6 A;  3VMF A;  1J9I A;  3KE2 A;  5M5W J;  1CF7 A;  5H6R A;  2PBI A;  3PNV A;  1BI3 A;  1TLH B;  1MMG A;  3GLL A;  1IZ1 A;  2E7W A;  1AHD P;  2Z33 A;  1QG0 A;  5CLS A;  1T0F A;  3BPV A;  3SXY A;  3BR2 A;  3T0Y A;  4GRI A;  2H6C A;  2QUF A;  3LMM A;  2JDI A;  3A35 A;  1VQ7 I;  3W5V A;  4CQJ A;  2BY1 A;  2IPQ X;  5D4S A;  1ZRF A;  4ZYG A;  1UCR A;  1QA1 A;  3VMV A;  1N25 A;  2OBR A;  4IRH A;  1BBY A;  4L8J A;  3OZW A;  1B1B A;  1SVO A;  2FNA A;  4F91 B;  3JUR A;  2F3L A;  3M1E A;  2HDC A;  3HRM A;  1EXM A;  4LC0 A;  1EV7 A;  3G73 A;  3HPG A;  5CVV A;  3VEP A;  3MQ0 A;  4FHT A;  5IP9 J;  1Z1D A;  3I54 A;  4KIC A;  3PO3 J;  3C1D A;  2HYF A;  5TIS C;  2FQ4 A;  2DDB A;  3HOS A;  4G6D A;  2Y0S A;  1R5H A;  4PUS A;  3WE2 A;  1IF1 A;  2W85 A;  4M6V A;  3FWE A;  1F9N A;  1ZM3 A;  2P6S A;  4FQG A;  3TDU C;  3G6E B;  1RQP A;  3CCE B;  3QPS A;  4LK1 F;  1W35 A;  2EIK H;  5THX A;  3CC2 B;  1MBE A;  1PXZ A;  1OCR H;  1ETX A;  2LD5 A;  4WX9 A;  1O57 A;  2JUC A;  4XLE A;  1A35 A;  3O2P E;  1HA3 A;  1K6Y A;  2DY1 A;  1OFC X;  3BG5 A;  4BQA A;  2OCC H;  4EM1 A;  4E7I A;  4J00 A;  3QFR A;  3W2W A;  5EG0 B;  4N4N B;  1MMS A;  1TNS A;  2VQC A;  2CU7 A;  3DKW A;  3HGG A;  2YWH A;  1WH7 A;  4CYC A;  2Q2E A;  4DNR B;  4X0C A;  2E2H J;  1WI3 A;  3DPU A;  1AKH A;  1B8I A;  1Z77 A;  2Q0O A;  1WJA A;  3M3Y J;  1U6G A;  2ZC2 A;  1LPQ A;  1TWC J;  3HRT A;  3WGH A;  5E6T A;  2F48 A;  2NS8 A;  2VJ4 A;  2ICW G;  3G6E I;  4QIW N;  2KRC A;  2KRH A;  2X1D A;  5EYR A;  5BNG A;  5HOO A;  4IHS A;  2X3U A;  3GF2 A;  5JBQ A;  1WJE A;  2LF8 A;  4QPO A;  4BHB A;  4BGD A;  2VBK A;  1X58 A;  3ABK H;  5F27 A;  4HLX A;  1D5V A;  1R5O A;  2M5S A;  1OFM A;  4EVI A;  2YU3 A;  2PMU A;  1YRN A;  4KIT B;  3MAJ A;  1T8I A;  3HTS B;  2D3N A;  2P8T A;  3WTZ A;  1XB2 A;  1IB4 A;  4D5C A;  3VPR A;  4XKC A;  1G7T A;  2XAG A;  1CNE A;  1E1Q A;  2EFG A;  1BC7 C;  2M2E A;  1UHS A;  3OW2 B;  3K70 C;  2KZG A;  5F0C A;  5DD8 A;  4RD3 A;  1OR7 C;  4BU2 A;  3L1P A;  4ZTF A;  2B7C A;  3F6O A;  3E5U A;  3ONQ A;  4G8X A;  1Z0X A;  1UAA A;  2KFD A;  4YZQ A;  4WQM A;  1N0U A;  2O9L A;  1E3Z A;  2FA5 A;  4G5G A;  3SFZ A;  3GW2 A;  3ZXS A;  2WJV A;  4QHY A;  1W34 A;  2BGJ A;  2CUZ A;  1VF9 A;  1H89 C;  4EQQ A;  4E6K G;  3PUM A;  2G9W A;  2M45 A;  4P9U A;  4IHX A;  4Z2Y A;  3CJN A;  3I58 A;  3WY9 A;  4X1E A;  5EF6 A;  1GAQ A;  1V5V A;  2VKV A;  3TGN A;  3OOC A;  4ZYE A;  4BHC A;  3K4K A;  3A3B A;  4OAY A;  4EM2 A;  3CMA B;  4M3E A;  4XIC A;  4P25 A;  4JX6 A;  4PFP A;  2FJ1 A;  3SYJ A;  2M7B A;  4M1K A;  1YJW B;  2VJ5 A;  4D7M A;  3E6D A;  4AIH A;  3HJE A;  3BJO A;  2JRT A;  3DPT A;  2H8R A;  4RM2 A;  1IA5 A;  5CDF A;  5E20 A;  4RD6 A;  2E34 A;  2BM7 A;  2PJR A;  4BBR J;  3DEW A;  3I4P A;  4II2 A;  5LRR A;  3KZZ A;  2BM4 A;  1D0X A;  3JRH A;  2BM5 A;  3ZQL A;  2BF4 A;  3I3L A;  5EZG A;  1P7I A;  2JA7 J;  3JR9 A;  1ETK A;  1PUF B;  4FK8 A;  2EIJ H;  3BG3 A;  1G3S A;  5K7F A;  1QQI A;  5EG0 A;  1WWX A;  1OFE A;  2BVM A;  1U2R A;  2KJB A;  4TMV A;  2E1C A;  5CKT A;  3PJR A;  1OQY A;  2NOJ B;  4K2E A;  1WPC A;  3FX3 A;  3I56 I;  3RDI A;  2O6W A;  5HLH A;  3CMA I;  1VQM I;  2CWE A;  2A5W A;  1SFX A;  3QWL A;  1YJW I;  2CC2 A;  3GVL A;  2Z6B D;  1P7J A;  2Y30 A;  4P3I A;  1BQE A;  3K4B A;  1MND A;  4QUZ A;  4YAF A;  5E3M A;  3BWG A;  4LJZ F;  3CUQ A;  2V7F A;  3SZG A;  4P12 A;  1G3T A;  2PMH A;  3ZMU A;  3IWF A;  4NBQ A;  1FSH A;  3KLO A;  3HXL A;  2STW A;  3C18 A;  1VQ9 B;  4BY1 J;  1HST A;  4ZJZ A;  2PLF A;  3QYF A;  2FU4 A;  5IYP A;  1D0Y A;  2HZT A;  4I09 A;  1U78 A;  3AKZ A;  3M8J A;  1QVG B;  4J01 A;  2WY7 Q;  3ML6 A;  2GLO A;  2NS7 A;  2R5Z B;  2V5I A;  2IS2 A;  1IDY A;  4C3J J;  4Y3O A;  4XID A;  1HDD C;  3SFI A;  3PO2 J;  3B82 A;  1XTA A;  4I02 A;  4P6Y A;  1WHU A;  3HSF A;  2CUF A;  2F1L A;  3CXC B;  4KMF A;  4MR0 A;  2CO5 A;  3DBR B;  3V8K A;  2NV4 A;  1IXC A;  3VDX A;  4BNC A;  2IEK A;  4HAM A;  3AG4 H;  4BL0 B;  2WYR A;  2ZBV A;  4N9I A;  2XAF A;  1HVX A;  2V1U A;  4Z4V A;  1L1I A;  2QQA A;  3BC8 A;  3KEQ A;  1RR8 C;  3J80 K;  2V4D A;  3GIR A;  4EGY A;  1KTV A;  1QX4 A;  2NYX A;  1VQ9 I;  2WWY A;  1ZGW A;  2FD5 A;  4ESF A;  1H8E A;  4IHT A;  2ADU A;  1MBF A;  3WNB A;  2DOA A;  3ZC3 A;  3KZI C;  1ZGA A;  2PMZ A;  2W57 A;  2IGK A;  1I1G A;  3FDY A;  4QTR A;  3A01 B;  4RDJ A;  1S72 B;  1O7L A;  2L9N A;  1YIO A;  3S1Q J;  4QFM A;  4A3J J;  5IK2 A;  1B72 B;  3KEW A;  1YOV B;  4L18 B;  2M1B A;  4W8S A;  1GXP A;  2HKO A;  3DFG A;  4MEX F;  1UD4 A;  4YEI A;  1RQR A;  4X7F A;  4HLY A;  4QSH A;  4C3H J;  3MKZ A;  2VFQ A;  2HOA A;  1FPQ A;  1EP2 B;  3RKX A;  3U9G A;  2EZI A;  4U0W A;  2MW8 A;  1GHC A;  2OJE D;  4AIK A;  2HTS A;  3GQ7 A;  2X4H A;  4IL6 C;  5KW9 A;  2PQ8 A;  4FCY A;  5E17 F;  2VC0 A;  1S4M A;  3ASS A;  2E60 A;  1XE1 A;  2ZTN A;  3P26 A;  2KQR A;  4Z4Y A;  3GQA A;  5IYW A;  4YII A;  5JMC B;  1OGO X;  4ZH4 F;  2DT5 A;  1QZY A;  2I10 A;  5HOD A;  3S3M A;  3JRA A;  2Y9Z A;  1FRQ A;  5GPA A;  3GQB A;  3O3K A;  3JSP A;  4XN3 A;  3FF5 A;  4BXF A;  4UZF A;  2NOG A;  3L2R A;  4U7D A;  3FBN B;  2JN9 A;  2R7X A;  4YAL A;  4M73 A;  4LLN A;  3T56 B;  1RU4 A;  2DA5 A;  2DEU A;  1J09 A;  4Z4W A;  3J7Z I;  1TWF J;  3W3C A;  3VO2 A;  4A12 A;  1PJR A;  2WSS A;  1OB2 A;  3IUO A;  4DJA A;  1K8F A;  5FJ8 J;  1X4O A;  2VN2 A;  3BCA A;  4JP0 A;  3G4S B;  2EK5 A;  3SQN A;  1Y0R A;  4IF4 A;  1X1B A;  3RKQ A;  1HLV A;  1P4W A;  3ROU A;  2LBF B;  4MEY F;  3V4G A;  4O6J A;  4PCQ A;  1CLW A;  3SQV A;  1UD2 A;  1RC9 A;  2FBI A;  3WHB A;  4ZDP A;  2HOT A;  1XSV A;  2KIU A;  2DIE A;  4KUM A;  1IN7 A;  3S2D J;  5J8C A;  4ENN A;  4BBS J;  3BY1 A;  4YAO A;  3RI4 A;  3NB2 A;  5LGN A;  4RLZ A;  1ETO A;  2ZL7 A;  1I6X A;  2VBM A;  3HHG A;  3TDZ C;  3ERE D;  2PEX A;  3KYC B;  5C4X J;  4BS9 A;  1NB9 A;  4IEJ A;  3HKZ N;  4UXN A;  4XLP F;  1K78 B;  1BL0 A;  1KK3 A;  3SZP A;  1Y0Y A;  4BY7 J;  1JE8 A;  3KCC A;  4G7H F;  4Z4U A;  5CVR A;  1FZP B;  1KC8 D;  4Z4Z A;  1I50 J;  3ABM H;  1TW2 A;  1CGP A;  1E1R A;  4RCY A;  3GCM A;  2GA2 A;  2L3D A;  2GQQ A;  1QFJ A;  2BY3 A;  3Q0U A;  1X4P A;  3S3O A;  3AVW A;  3CJR B;  4A3C J;  4G6I A;  3OEE A;  3A01 A;  2O04 A;  5D4R A;  3OWT A;  2X6Y A;  1Z6T A;  2HXI A;  4LG0 B;  1QGA A;  1XSX A;  4Z4T A;  4CYD A;  2BYV E;  3I55 B;  2C77 A;  2VKH A;  4L9T A;  4AVZ A;  1UJ8 A;  3WGI A;  3UNG C;  3VB2 A;  3DTE A;  2MH9 A;  4I76 A;  2M8E A;  4IX7 A;  4B3A A;  1QFZ A;  3B4N A;  4HA8 A;  3ABT A;  3W2F A;  2XAH A;  3G1O A;  3F0C A;  1HF2 A;  1LM1 A;  2L02 A;  2WAQ N;  4P26 A;  2CMP A;  2QDX A;  2DLL A;  3C2H A;  1O3R A;  4Q7J B;  3W6V A;  5KK1 A;  2XOK A;  1APL C;  1DPU A;  4RM3 A;  1Z21 A;  2XKO A;  4BQO A;  5FB2 A;  2HYJ A;  1WSU A;  1DG1 G;  1YYV A;  1IV8 A;  1OCZ H;  2MG4 A;  1IXS B;  2Q6L A;  1B23 P;  3GQ8 A;  2JMW A;  2ELJ A;  1ONV A;  3F8M A;  3NAR A;  1JKO C;  2OTL B;  2O0V A;  1WJB A;  2V9P A;  1TQP A;  5DUI A;  2RC5 A;  3DEU A;  3VWB A;  3QFS A;  4AVP A;  1X19 A;  4KN7 X;  2L01 A;  4V19 K;  3CPW B;  2NVU B;  4X7D A;  4B4D A;  1P9Q C;  2IBD A;  4LBW A;  1W2B B;  3HB9 A;  2A07 F;  1VQN B;  1T6Y A;  3QPL A;  2M7A A;  2NST A;  2VJI A;  1QU3 A;  4KMU X;  1FMV A;  3REO A;  5A2Q K;  4A69 C;  4OMZ A;  1EFT A;  3HC7 A;  3B78 A;  2VOO A;  5DNS A;  2DTZ A;  3OYE A;  1M1K D;  3GTM J;  4Y15 A;  2PN6 A;  1F4K A;  3AAF A;  3EUH A;  2XC7 A;  4M9X A;  4OP7 A;  2XUB A;  4NQW B;  4UHT A;  3ECH A;  2DCE A;  2E1M C;  4RBO A;  2GJR A;  2HCJ B;  4AUX A;  4KT6 A;  1UG2 A;  4RLF A;  4ZC3 A;  4OPS A;  1FNN A;  1E3O C;  1LVK A;  3M4O J;  4YFX F;  2PG4 A;  2M8G X;  2WTE A;  3JAM K;  5D8L B;  4IRG A;  1SFU A;  1A31 A;  2AQF A;  2CUJ A;  1LKX A;  3IRQ A;  1T98 A;  4IHY A;  1A6Q A;  4NC7 A;  2IGO A;  3S93 A;  1VQN I;  1H85 A;  1OIS A;  2Y75 A;  2COB A;  3K70 D;  5H59 A;  2L7F P;  4ETS A;  1VQL B;  1YQA A;  1NBM A;  2A05 A;  2WY8 Q;  2ME6 A;  3LNN A;  3OEH A;  1O8J A;  1JUM A;  2ISZ A;  1RMG A;  1UD3 A;  2FNP A;  4MFD A;  3EYI A;  3RCO A;  1J0R A;  2VKD A;  2FXA A;  3NWT A;  4ZGQ B;  2PX9 A;  4XQF A;  5F1J A;  1SAN A;  1WZ2 A;  2QGG A;  2VNK A;  3FKI J;  2HU9 A;  3VOE A;  3J81 K;  1XB4 A;  4P1V A;  1AIP A;  1VQ6 I;  1MNE A;  2DQR A;  2PLY A;  3HTU A;  1W5S A;  3VYR B;  1DBO A;  2WZN A;  5HNH A;  3GSI A;  4JRA C;  3VSV A;  2HPM A;  4C2U A;  3ZBT A;  5LHH A;  4JOM A;  1FND A;  2WB1 A;  2NTQ A;  3SHF A;  1XPX A;  3S8P A;  2CH0 A;  1DDN A;  1BJK A;  3OS0 A;  4HDU A;  2VBS A;  1V3F A;  3LSJ A;  2EPF A;  3Q9S A;  1CZF A;  4A3M J;  4HEA 2;  3KP4 A;  1U9N A;  5TRD A;  4MYT A;  4K1X A;  2RKH A;  4DNT B;  2ZL5 A;  2VOP A;  3G71 I;  3CME I;  2QXZ A;  4BDY A;  1Q7Y D;  5IYR A;  5F64 A;  2Z3Y A;  4G1B A;  4DZJ A;  5ICC A;  4EJT A;  1SFK A;  1NDH A;  2COM A;  4PGO A;  4EH1 A;  2GXB A;  1YJ9 B;  3OYH A;  1RZ4 A;  2TCT A;  1LEB A;  2K9Q A;  3WTS C;  1DAR A;  2C5H A;  1R23 A;  2X51 A;  2FML A;  4UVA A;  3CCV I;  2XDV A;  2JT1 A;  2QEN A;  5IT3 A;  1ZG5 A;  1EP3 B;  1ZRC A;  3GVK A;  4UV9 A;  2QTL A;  1O8M A;  2M4G A;  2LKS A;  5HS7 A;  1ZLK A;  1QZE A;  1Q86 D;  1T6Z A;  3ZPN A;  3DWL E;  4LGW A;  3KP5 A;  3ZMZ A;  5L3C A;  2CV2 A;  2M0M A;  4X6A J;  2L4A A;  3RPU A;  5J4V A;  5FKO A;  4CDG A;  1ODD A;  4M71 A;  4PJJ A;  1TT5 B;  1T38 A;  4JQF A;  5JHU A;  2OF7 A;  3S3N A;  3IKV A;  2R5Y B;  3PEN A;  3B02 A;  2D5V A;  2XHK A;  1BC8 C;  1WU8 A;  1J9Z A;  2JA5 J;  3HHH A;  2E5Z A;  1K73 D;  3CCR I;  3I59 B;  3AGP A;  1YIJ B;  2VFM A;  2NTP A;  1O88 A;  2QKL B;  2LP0 A;  2W1O A;  3CLO A;  3HOX J;  2QZ8 A;  4XBF A;  1EF4 A;  1IRF A;  2QYO A;  1YIT B;  4YZ0 A;  1RUN A;  2CQK A;  3LWF A;  2BM0 A;  1BPL A;  5AON A;  2V7X A;  1OCT C;  1GV5 A;  4WF2 A;  3WTT C;  3KEY A;  3N4M A;  2R9V A;  3HDD A;  1FTZ A;  2ZZQ A;  3ZN0 A;  1VQO B;  3CW2 A;  2GJK A;  3H3Z A;  1KD1 D;  1QA2 A;  4B3F X;  3TOB A;  3N97 A;  3S1M J;  1MSE C;  1FIP A;  5EMN A;  3GFL A;  5E3N A;  4CA0 A;  2PIA A;  3QOE A;  2RV8 A;  2XEX A;  2O3F A;  1FNC A;  1HW2 A;  4YFK F;  2BW3 A;  1Z67 A;  1QPI A;  3L7W A;  3PL8 A;  4IQJ A;  3QFT A;  3AVT A;  1V55 H;  1FYL A;  3KRG A;  1N77 A;  1TTY A;  2ZBK A;  3HBL A;  5IY5 H;  4XRS A;  1IHM A;  4F7D A;  4BE0 A;  3K4J A;  2HKX A;  1WQ2 A;  5L3B A;  2OAZ A;  2WAD A;  4UVB A;  2WR8 A;  2K7L A;  4IZZ A;  1CQT A;  3L2C A;  1S0U A;  1G2H A;  1K9M D;  4Z1M A;  3DEE A;  1OFL A;  1JHH A;  1Q1H A;  5D5V B;  3H36 A;  4DIQ A;  3W6J B;  1F43 A;  2EFP A;  4XRF A;  3B8Y A;  3S2W A;  4BEH B;  2KVO A;  3ONY A;  2STT A;  1UMK A;  2JTV A;  4G6T B;  4ANJ A;  5FGM A;  2JIZ A;  3WYA A;  3U1K A;  1O7F A;  4BE2 A;  1UHM A;  2AO9 A;  3OYM A;  2XTY A;  4Q5S F;  5LHI A;  4M6Y A;  1VQ4 B;  2A6H F;  2UVE A;  1GVD A;  2HDN B;  3W2V A;  3GTQ J;  1MJB A;  1CF7 B;  3WU0 A;  2XGC A;  1EFU A;  2R7U A;  3MCA A;  2BXY A;  1K79 A;  1ZM4 A;  3E3V A;  1MKM A;  3JCU C;  3NQO A;  2ZXW H;  2K40 A;  2CK3 A;  2LOO A;  2Y31 A;  3CDI A;  3RIQ A;  3FXQ A;  4A3D J;  2XAQ A;  1JB9 A;  1ZG1 A;  4UV8 A;  3DKY A;  2IS6 A;  4JBA A;  3MKL A;  2HYG D;  4KYW A;  4IOA F;  4ACA A;  1XDS A;  2GWR A;  2NS0 A;  1HZE A;  1U8R A;  2V79 A;  3CF5 F;  1TYX A;  2ESH A;  2IA2 A;  2F4O B;  4OU0 A;  5F1R A;  3B6C A;  3ZQG A;  5IOZ A;  5LD2 C;  4UAJ A;  1MSF C;  4ROX A;  2K4J A;  2B5O A;  1J59 A;  4IKF A;  1MW7 A;  3WU1 B;  2HS5 A;  4ON0 A;  1LE8 B;  1OGM X;  4M4S A;  1X2N A;  3RQ4 A;  1SMT A;  3ZMD A;  2KZV A;  3BTI A;  1ZAR A;  4NBS A;  4E70 A;  1P4X A;  3MZ8 A;  2VLA A;  1W0J A;  2BGI A;  2QA4 B;  2ZJR F;  3DP7 A;  4LFU A;  4A3I J;  1KK1 A;  5EZH A;  2WV1 A;  4OIQ F;  1BR1 A;  2PI0 A;  3QOD A;  3WTW C;  3OYD A;  4FTH A;  3BG9 A;  3LSM A;  1POG A;  1ZK8 A;  4A5M A;  3MEX A;  3RYP A;  3KEO A;  2WA0 A;  3FJO A;  1I5Z A;  3FY3 A;  2XT4 A;  1T95 A;  2K5C A;  1I18 A;  3W2A A;  1FMW A;  2VXD A;  3F3X A;  1V5F A;  5J3L A;  3LQ6 A;  4IJA A;  1G7C A;  4P9F A;  4RD2 A;  4CYC B;  1W1W E;  2Q2E B;  2V7Q A;  4B3X A;  4M0L A;  2LLK A;  2HEO A;  1AKH B;  1WJF A;  1B8I B;  3V8J A;  3ZQF A;  4ZDO A;  2O7O A;  2VBY A;  3ZQI A;  1TL8 A;  3TED A;  1NRK A;  1I39 A;  3BY6 A;  2QQ9 A;  3D5R C;  1PDN C;  2O8K A;  2YWE A;  1N05 A;  1VZ0 A;  3FXL A;  4YCQ A;  4RCZ A;  5DN6 A;  1O8E A;  2V4J C;  5B3S H;  5K7Z A;  2B9S A;  4TT3 A;  5A89 A;  3FIS A;  3B90 A;  1GDT A;  4C30 A;  1VQ7 B;  1JTA A;  1IN6 A;  2HZD A;  1MD0 A;  4ZYH A;  2GM4 A;  3AVU A;  2VT2 A;  3PNT A;  5FLX K;  4KJZ A;  2KL4 A;  3RZD J;  4BKX A;  2W84 A;  1GVH A;  1YRN B;  2A3S A;  4II3 A;  1F5T A;  3RZO J;  5IPA A;  2R93 J;  4OIR F;  4G7O F;  1W9X A;  1X3Z B;  2WBM A;  1W5C C;  3PFI A;  2ECC A;  4KN4 X;  4HF2 A;  1WJD A;  2VI6 A;  5JR3 A;  1FJL A;  4G1V A;  1FRN A;  1BI1 A;  3EYY A;  3GZ5 A;  3BZK A;  1ZN2 A;  3WG7 H;  3ZMT A;  3E0J B;  4RD4 A;  4RGX A;  1JUP A;  4AF6 A;  1SD6 A;  3BR1 A;  4PFO A;  2BHY A;  2PFB A;  1V0E A;  1W87 A;  3E1Y E;  1D0Z A;  4E7J A;  1EJ9 A;  3CD6 I;  3AG3 H;  4PAB A;  1TWH J;  3E7L A;  1KU3 A;  3E5X A;  5M3M J;  1O3T A;  1AA7 A;  3IH3 A;  1DAB A;  3L9F A;  5J40 A;  3JRE A;  1XD7 A;  1XDU A;  2YR2 A;  1DU6 A;  1DGW Y;  2FBK A;  3CB4 A;  2G7H A;  3TOA A;  4PGG A;  4D9J A;  5J47 A;  4KA4 A;  1V5E A;  1J2X A;  3IP4 B;  1EFC A;  5H5J A;  5F4M A;  3R4K A;  3BR5 A;  3I4M J;  2XTW A;  3EQN A;  1X1P A;  4ZV4 A;  4FWT A;  1SD7 A;  3Q0W A;  1RES A;  4BAY A;  4CSW A;  5M5X J;  4ZYA A;  2CFX A;  3JRG A;  1LE8 A;  1Y6I A;  4A0Z A;  1T56 A;  2GK7 A;  3W2I A;  1IN5 A;  5IT9 Z;  1MMA A;  1F20 A;  1Q1V A;  3BQY A;  1ZYR F;  5FL7 A;  1R4N B;  4QV2 A;  1U0J A;  4TMW A;  3VMW A;  3CP2 A;  4E7Z A;  2M3A A;  1H0M A;  4M3D A;  2OBS A;  5D6F A;  3LFK A;  2J8K A;  4IRI A;  2QGU A;  2PJR B;  1N08 A;  4PDK A;  2HNH A;  5HLI A;  1ZH5 A;  1QGZ A;  4DOZ A;  3PIP F;  2NNN A;  3VYT B;  3FHZ A;  1QCX A;  2E36 A;  3WND A;  1SC7 A;  3FM3 A;  3BH7 B;  5ED4 A;  1MBJ A;  3HEF A;  3WXM A;  2QBY A;  4M9S A;  1T08 B;  2X48 A;  4JK1 X;  2A6T A;  4ZZL A;  2DA4 A;  2F4I A;  2F5V A;  3W6K B;  4UNO A;  4CCK A;  4U4B A;  3Q38 A;  2D1V A;  1OB0 A;  3BH4 A;  4PJM A;  1EA0 A;  1BR4 A;  1E64 A;  5DUK A;  2V7V A;  4XL9 A;  4GXO A;  3CMY A;  1MH3 A;  1Y0U A;  5F0H A;  1JT0 A;  3U2Q A;  5FKN A;  5C4J J;  3FKS A;  2P7V B;  2J7K A;  3KP3 A;  5FRM A;  2RDP A;  4B47 A;  1YI2 B;  3CCM I;  1D8K A;  4BJ5 C;  2QM3 A;  4HX8 A;  1PUE E;  4OIP F;  4Y9R A;  3CUQ B;  5FA6 A;  5ICE A;  5AN9 A;  3QYB A;  1DP7 P;  1LUJ B;  3S16 J;  4RDU A;  3A1Y A;  2FX0 A;  1UST A;  2Y69 H;  3G1L A;  2Q6K A;  5TV2 A;  2VAS A;  2DCU A;  5LBQ A;  3A03 A;  3IAS 2;  3ZN1 A;  2BN4 A;  1KQS B;  2I1L A;  1JA0 A;  2MLK A;  2VQL A;  3J7Y J;  5IYN A;  4FET A;  3Q3A A;  4OJ5 A;  3A02 A;  2D3L A;  4N9H A;  2F5F A;  3ASO H;  1R5B A;  2C78 A;  2CFO A;  2UXX A;  2ZFW A;  2IS4 A;  4QWQ A;  4XNF A;  1YI2 I;  1QH0 A;  3LAP A;  1LNW A;  3K1N A;  4ZCI A;  3OJW A;  2C5B A;  4HNU A;  4NK6 A;  3PSZ A;  1EA3 A;  1X3W B;  3W2E A;  2GZW A;  1O8H A;  4EW9 A;  2HOS A;  2L54 A;  2JSP A;  2CW7 A;  1X1C A;  3H92 A;  4XLH A;  5DCM A;  3ZPL A;  2EA2 A;  1XC5 A;  4Z4S A;  3CC7 I;  1I7P A;  4I7H A;  2X0K A;  4TMX A;  1MMD A;  1QHG A;  1YW9 A;  2FOK A;  2JJ1 A;  1ITY A;  2HDW A;  2NNY A;  1LFU P;  3F23 A;  5LEK A;  4DGW B;  1WXR A;  3I56 B;  4MHG A;  2UV1 A;  1W0T A;  4EEF G;  3OYC A;  3GZ6 A;  2DFF A;  1VQM B;  2ZJ2 A;  4LB5 A;  2WJY A;  3AG2 H;  3A8K A;  3H9Q A;  4OIN F;  3G3Z A;  3W5U A;  4RJL A;  2EH3 A;  4OOX A;  4A3G J;  1MZB A;  3HKZ A;  1TUI A;  3L09 A;  3C3W A;  3C2G A;  1O4X A;  4XR6 A;  2ID6 A;  4OWR B;  2X9D A;  2DW4 A;  3QYE A;  2XGD A;  3IH2 A;  3O8G A;  1PLU A;  5DM6 F;  2F5E A;  3OR1 C;  1QJV A;  4PC7 A;  3K2A A;  3F8B A;  2OD5 A;  3BR0 A;  5M5Y J;  3VNV A;  1YO5 C;  3EQL F;  4WZT A;  4IQ4 A;  2KIQ A;  3P27 A;  5KVR A;  1YFH A;  2XC1 A;  5B66 C;  1KA8 A;  1N8R D;  2DET A;  3EQO A;  4EJW A;  1NG7 A;  3ZZ0 A;  4A3E J;  1F1Z A;  2PE3 A;  4TMZ A;  3AL0 B;  3OL3 A;  5TR9 A;  1S6L A;  2MD5 A;  1WJ5 A;  3DU6 A;  1PJ6 A;  1OGI A;  1A04 A;  4HNV A;  2OK8 A;  3H3V K;  1DGR M;  2DO7 A;  4R79 A;  2PMD A;  3SEJ A;  4OJO A;  1DDI A;  5TY0 A;  4KDP A;  2LVS A;  2XGJ A;  3SJM A;  2K4B A;  1TSP A;  3G05 A;  2GOM A;  1R7J A;  1U9O A;  2WAQ A;  3R6S A;  2VON A;  1TNT A;  2LYC A;  1D2E A;  4WXC A;  4HF1 A;  1FTT A;  3BRO A;  4DK1 A;  2IS1 A;  1K4T A;  1X0C A;  4NK8 A;  2HFH A;  2FSW A;  3CMM A;  1NH3 A;  2FBH A;  3SYT A;  2UZK A;  4IO9 F;  3HYI A;  4P3Y A;  3WHC A;  4EMS A;  3PSS A;  5HNF A;  2QEX I;  2QKM B;  3CC4 B;  1KYW A;  1U8B A;  1IGN A;  1JKP C;  2G0Y A;  2VBX A;  3OJX A;  2CBX A;  2RNJ A;  4EJV A;  4HRI A;  3KYD B;  4IHV A;  4I2O A;  4EAT A;  4W97 A;  3UR3 C;  2L7M P;  3PQK A;  2HPI A;  4L0Y B;  4E7S A;  5IYB J;  3ASR A;  5CVI A;  1A8P A;  3S17 J;  2ZJP F;  2CYY A;  2E5N A;  1QO0 D;  2L2O A;  4X0G A;  5F6F A;  2Z99 A;  1CQX A;  3P7N A;  2K85 A;  3GFJ A;  1FX7 A;  5D6E A;  2D2W A;  5CQE A;  1W7P B;  2EWE A;  3E6M A;  3E97 A;  3FBI B;  4OOI A;  2HVR A;  3ASQ A;  3GWZ A;  2HXO A;  3BDD A;  3DTI A;  5FKL A;  2EJR A;  3W2H A;  1TYW A;  3CC4 I;  1YJN I;  1IUY A;  4U0Y A;  1JKQ C;  4YFN F;  4UUV A;  3MWM A;  3K1M A;  3ZIA A;  1Q81 D;  5JLV C;  5L3F A;  1E63 A;  4GGG A;  1G4D A;  4ZCL A;  3OAA A;  1FYM A;  1EWY A;  2DYS H;  4BJ6 C;  4RDL A;  4YAW A;  1QRY A;  1D1B A;  2FX3 A;  5L46 A;  1FP1 D;  5B6I A;  2LZJ A;  1N75 A;  3OYN A;  2QE7 A;  2HR3 A;  1ZLJ A;  3LST A;  4RD0 A;  1QFY A;  4R71 A;  1OMI A;  1Z3X A;  1D1A A;  4KKT A;  1NB0 A;  2F1M A;  3SDG A;  1D8J A;  1ETQ A;  2JPC A;  2A69 F;  3T1B A;  2BSA A;  3QU6 A;  1E62 A;  5K5R A;  2Y48 A;  2LY2 A;  1HKQ A;  2XB0 X;  3SJP A;  1SFE A;  1K4S A;  3PFY A;  4M9Z A;  1KJZ A;  3WBJ A;  2EFO A;  1TWA J;  5JFR A;  3P4G A;  1KCD A;  1TWG J;  3B6A A;  3OS1 A;  2OTJ I;  3H9G A;  2F5C A;  4G9Y A;  4AID A;  4E7L A;  3M9A A;  1R4M B;  4D0P A;  2HVQ A;  3K9T A;  1BIA A;  3RSN A;  3OYJ A;  3LSP A;  1HW1 A;  1AOY A;  5ICG A;  4KIS A;  1VQP B;  1KON A;  4G7Z F;  4M72 A;  4PC2 A;  4Z05 A;  1BR2 A;  1GVJ A;  2DMP A;  3OR2 C;  1LDK B;  3WG9 A;  3TMO A;  1EE6 A;  1YLF A;  4NNJ A;  5E79 C;  3TO7 A;  1JGG A;  1MH4 A;  1AIR A;  3ERM A;  1W36 D;  1SKQ A;  1IV6 A;  4XKV A;  2ACJ A;  2R7Z J;  2ZZF A;  2YX4 A;  3SUC A;  5AIQ A;  1XG1 A;  1YS6 A;  1KU9 A;  1BIB A;  4YHB A;  3HOZ J;  2N8G A;  3SZT A;  2LG4 A;  1WSV A;  1P92 A;  1YW7 A;  2K02 A;  3M1C A;  3SDB A;  1LJ9 A;  3A0B C;  3CO7 C;  3HG9 A;  1VQ5 I;  4PSW A;  3J80 Z;  1P4M A;  2OQR A;  2P0W A;  3TKY A;  3WTY C;  1PP8 F;  2VBV A;  4PAA A;  3U21 A;  1VQP I;  1JA1 A;  4RGR A;  1NK3 P;  1MNM C;  3Q9V A;  2JA8 J;  4URR A;  3T8T A;  4I84 A;  1KYZ A;  1V5G A;  1WRJ A;  3TW6 A;  1FWZ A;  2W7N A;  2NTB A;  4TMT A;  2C4U A;  2IRF G;  3BQJ A;  2QCO A;  3OSF A;  3NWS A;  4EGZ A;  1KZL A;  3R6K A;  1OGJ A;  2DA2 A;  2OQG A;  4LOC A;  5HLG A;  1FOY A;  4P96 A;  1VQ8 B;  2J8I A;  1W7P A;  4PGH A;  2E1N A;  3ZP5 A;  2JVG A;  1JXS A;  2WPD A;  3R0J A;  4HE6 A;  3Q5F A;  3DTK A;  4G7W A;  1JRG A;  4BH9 A;  1QVF B;  3K4L A;  3IHU A;  3IRR A;  5B5E C;  2B7B A;  2EIX A;  3FXM A;  5FLV A;  5LLQ A;  3V7R A;  4N3G A;  3JRI A;  1E3P A;  2L0K A;  1AWC A;  3UKG A;  1OHH A;  1TQI A;  3KPH A;  4PC6 A;  1MGT A;  4NDL A;  4UB8 C;  4PC3 A;  2OA4 A;  1HA8 A;  4OPO A;  2MA3 A;  1LFP A;  5K1Y A;  2EFQ A;  1ZGJ A;  2XPU A;  4BJT A;  2KLO A;  3VFZ A;  2D74 A;  4A3B J;  4B3G A;  1K7A A;  1TT0 A;  3LNQ A;  1O8I A;  1SVM A;  1PP7 U;  3B73 A;  2RNG A;  3FK7 A;  2ZJQ F;  1VQ8 I;  3NAU A;  1H42 A;  4FN5 A;  2OPT A;  4M3B A;  2EFW A;  2LRD A;  4RAY A;  3DKX A;  3SEQ A;  3GX4 X;  2GA1 A;  2ZNY A;  1PYV A;  4M2L A;  2CUE A;  2ZXH A;  2JQ7 A;  5DEQ A;  4GYG A;  4BQN A;  2XB5 A;  5L3G A;  4MO7 A;  1T0F C;  1Y1V J;  2A5Y B;  5M3F J;  4Q48 A;  2DT6 A;  3BQZ A;  4OAZ A;  3CCQ I;  4BXU A;  2QTZ A;  2DK5 A;  2UVF A;  3FXK A;  2X8K A;  2BHZ A;  3HOW J;  3I1F A;  4C2L A;  2EV5 A;  1Z7L A;  3GLX A;  4BYY A;  4P1W A;  1FEX A;  4V02 C;  1JNY A;  2HQA A;  5EEA A;  1NHC A;  5KSW B;  3R0A A;  2HOE A;  2DOG A;  2ZBU A;  3P9C A;  1E2X A;  4V2F A;  3H0D A;  4DQL A;  1IG7 A;  3KP2 A;  2DN0 A;  3EUK L;  3L2V A;  2HVS A;  2VOD A;  1VQ6 B;  1ORK A;  2BPO A;  3SEZ A;  1IAW A;  2DA3 A;  3I4N J;  2O8X A;  3P9I A;  4HX7 A;  3LO8 A;  1Q82 D;  1X3U A;  1H88 C;  2C6Y A;  2PYG A;  1BOB A;  4R8H A;  2MLG A;  2GOX B;  4ENJ A;  4GDF A;  2DK8 A;  4X7E A;  1BJZ A;  3HOU J;  2AXL A;  1S7E A;  2XAS A;  1FC3 A;  2XPW A;  4W1U A;  3K10 A;  3E6B A;  1LLW A;  3AK5 A;  2FEZ A;  1BX1 A;  1KZH A;  3K7A J;  2ZL6 A;  3WGG A;  2W25 A;  1F36 A;  1G6N A;  2EV0 A;  1STZ A;  3AFH A;  3OV8 A;  4LMY A;  3H9N A;  3AVV A;  2LH9 A;  3GUD A;  3G71 B;  3CME B;  3K4N A;  1OCC H;  2ZFU A;  5GAE J;  2FE3 A;  1MBH A;  1V0F A;  3VR6 A;  1C0W A;  5IYD J;  2NSP A;  2MAB A;  1OR7 A;  3FXR A;  2BW3 B;  3LQQ A;  3S15 J;  3WE3 A;  3OE7 A;  2ELK A;  5IP7 J;  2DOD A;  5KAI C;  2XND A;  2O0Y A;  1ETV A;  2CQQ A;  2LFB A;  5LFA A;  2PEC A;  4UUS A;  2ZXI A;  1I1S A;  2KIF A;  3K4C A;  2GQF A;  3I53 A;  2XSJ C;  2CGP A;  1ZHF A;  2H27 A;  4KH3 A;  1ZM9 A;  3CES A;  3JQR A;  3HOY J;  3LYC A;  3CCV B;  2HDD A;  4HF0 A;  1N78 A;  1O8G A;  2BV3 A; 
#chains in the Genus database with same CATH homology
 2HLD A;  2VPL A;  3H94 A;  2XAU A;  1JI8 A;  2ZTG A;  2DXI A;  4TKO B;  1BR1 A;  1OR7 C;  4BU2 A;  4ZTF A;  3QOD A;  3OY9 A;  2BVL A;  2W4S A;  3ONQ A;  3OYD A;  4JMQ A;  1UAA A;  2ODL A;  4YZQ A;  2MYS A;  3LSM A;  1UD8 A;  3FY3 A;  2WA0 A;  1E3Z A;  3PNY A;  1T95 A;  2K5C A;  2Z16 A;  4YEJ A;  3ZXS A;  1FMW A;  2VXD A;  3W2A A;  1V5F A;  2WJV A;  1I18 A;  2O1D A;  2CUZ A;  1W0K A;  3DQV C;  2Q2E B;  4E6K G;  2V7Q A;  4B3X A;  4AU7 A;  1WJF A;  3LSH A;  3DLA A;  4ZDO A;  4BQQ A;  1NRK A;  3D5R C;  3MD2 A;  3A4C A;  1VZ0 A;  3GVJ A;  3OOC A;  3HAG A;  3EPZ A;  5DN6 A;  1O8E A;  1Y56 A;  2V4J C;  3K4K A;  4U87 A;  4OAY A;  2CV0 A;  2Q1Z B;  3A3B A;  4TT3 A;  2L9S A;  4PFP A;  2M7B A;  1ZEL A;  4XKB A;  2VJ5 A;  4XLF A;  5TGT A;  2W6I A;  4C2T A;  3B90 A;  4C30 A;  4CCM A;  1JTA A;  1X1D A;  2HZD A;  3DPT A;  4RM2 A;  1IA5 A;  3PNT A;  5CDF A;  4KJZ A;  2KL4 A;  4F93 B;  2VB6 A;  3H5R A;  4II3 A;  2PJR A;  1W9X A;  4II2 A;  1D0X A;  3I9V 2;  3OOU A;  2WBM A;  3I3L A;  2MFZ A;  4BDZ A;  1WJD A;  2DJI A;  5JHF A;  2MD0 A;  2ZZG A;  2BVM A;  2IGM A;  1O8L A;  2V1N A;  3E0J B;  5FRN A;  1BN8 A;  5CKT A;  3PJR A;  2NOJ B;  2V26 A;  4PFO A;  1V0E A;  4MLO A;  4CUG A;  3MKW B;  1WPC A;  2V31 A;  3DU5 A;  1D0Z A;  4E7J A;  4OJL A;  4B43 A;  4ZTJ A;  1COW A;  2A5W A;  5HLT A;  4XON A;  3GVL A;  2Z6B D;  1AA7 A;  1WMR A;  2M4K A;  2X6W A;  3K4B A;  1DGW Y;  1MND A;  4YZA A;  4PK4 A;  4D9J A;  4XM3 A;  2NT9 A;  2V7F A;  4XMY A;  1V5E A;  3IP4 B;  3SZG A;  1VF7 A;  4E0F A;  2QX3 A;  3HXL A;  3EQN A;  3LFU A;  4KKS A;  4ITV A;  2R7O A;  1H80 A;  3BG7 A;  3F9K A;  4ZJZ A;  4CSW A;  3QYF A;  4ZYA A;  2GK7 A;  1D0Y A;  1Y6I A;  1YX3 A;  3K6G A;  3AKZ A;  3M8J A;  3E1S A;  3OYK A;  4W8Q A;  4Y33 A;  4CCL A;  2WY7 Q;  1MMA A;  4E4H A;  4J01 A;  1HG8 A;  3ZPP A;  5FL7 A;  2IS2 A;  2ZSH B;  4Y3O A;  1U0J A;  3BLY A;  3VMW A;  3CP2 A;  4E7Z A;  2M3A A;  3T51 B;  1DP3 A;  1X1A A;  4HG2 A;  4MR0 A;  1ERD A;  2PJR B;  2AQE A;  3VDX A;  4BUP A;  3MKY B;  2HNH A;  4QPQ A;  4BL0 B;  4DOZ A;  4DBQ A;  1QCX A;  3VYT B;  3S32 A;  1HVX A;  3VSU A;  3A2K A;  3BC8 A;  2V4D A;  1KTW A;  4CZC A;  4E7H A;  3G2B A;  3KYL A;  3OIP A;  4PJN A;  2IXS A;  2O5R A;  3ZGK A;  1FX0 A;  2RRE A;  1WJC A;  2INU A;  2A6T A;  1H8E A;  3H5A A;  2BOL A;  2DOA A;  3GBG A;  2F4I A;  2F5V A;  2F6C A;  1MMN A;  2PMZ A;  3T53 B;  2IGK A;  1SAU A;  3FDY A;  3LSI A;  4CCK A;  4F92 B;  4U4B A;  2BSP A;  1OB0 A;  3BH4 A;  2L9N A;  4PJM A;  1UEL B;  1BR4 A;  3D5L A;  4CCN A;  2K3P A;  4XL9 A;  2R7Q A;  2LBF A;  5IK2 A;  3FKS A;  4FXU A;  5FRM A;  3KEW A;  4B47 A;  4W8S A;  4BJ5 C;  1G59 A;  4BAC A;  2OC6 A;  3KX2 A;  1UD4 A;  1VJS A;  2GK6 A;  3NE5 B;  2LRE A;  3QYB A;  3MKZ A;  2CV1 A;  1OLT A;  3A1Y A;  3K4M A;  3OYF A;  2VAS A;  1T5E A;  3GQ7 A;  4TSF A;  3IAS 2;  3HOT A;  3GRH A;  4YEL A;  2VQL A;  2E60 A;  2ZTN A;  4FET A;  2KQR A;  2XF5 A;  3GQA A;  3OIQ A;  1OGO X;  2V9K A;  4OJ5 A;  2D3L A;  3S3M A;  3OYA A;  2ZSI B;  2V6E A;  2CFO A;  3VSK A;  2X3H A;  3GQB A;  2IS4 A;  4XN3 A;  4BXF A;  4XNF A;  3OPO A;  3L2R A;  3FBN B;  4AYB A;  2R7X A;  2KDO A;  2K9L A;  2GJP A;  4HNU A;  3T56 B;  1RU4 A;  4NK6 A;  1VBL A;  1J09 A;  1EA3 A;  4LG3 A;  1O8H A;  4EW9 A;  1I8D A;  3W3C A;  1KMH A;  1PJR A;  2JSP A;  2WSS A;  3IUO A;  4DJA A;  2CW7 A;  1X1C A;  4XLH A;  4OJ6 A;  1X4O A;  3BCA A;  3L2U A;  4U49 A;  4G7X A;  2OUM A;  2Z1D A;  4XD7 A;  1VLY A;  4MXN A;  1GQ8 A;  1MMD A;  1QHG A;  1X1B A;  2JJ1 A;  2LBF B;  1R6R A;  4Z06 A;  2HDW A;  3TL4 X;  4HPQ A;  1UD2 A;  2R7R A;  4DGW B;  4PMH A;  4ZDP A;  2UV1 A;  3OYC A;  2JA2 A;  3AL0 C;  1TZL A;  5KHD A;  1QHH D;  2DIE A;  2WJY A;  3H9Q A;  3PSF A;  2VQG A;  3PUB A;  4DBR A;  1W36 C;  3MMY B;  2W6J A;  2X85 A;  3HKZ A;  3OFN A;  2VBM A;  3C2G A;  3FPP A;  4XR6 A;  3BCD A;  3H5N A;  4OWR B;  3QYE A;  4BS9 A;  3CJQ B;  1PE9 A;  1PLU A;  2VQH A;  1O8D A;  2VBE A;  2I8D A;  1QJV A;  3OR1 C;  3WQZ A;  2IQ7 A;  1E43 A;  2JJ2 A;  3RPU D;  1E1R A;  4IQ4 A;  4OZZ A;  1G8X A;  3S3O A;  1X4P A;  3OMY A;  3CJR B;  3TBI A;  4G6I A;  1PKV A;  3OEE A;  2CS3 A;  4UZU A;  2O04 A;  3EQO A;  1NG7 A;  3OWT A;  4HSR A;  2OV7 A;  2X6Y A;  5C1E A;  2VL8 A;  3AL0 B;  3OL3 A;  3A3G A;  3CP8 A;  2WAE A;  3OS2 A;  1WJ5 A;  3DU6 A;  2VKH A;  4XLA A;  1E3X A;  5C1C A;  2QY1 A;  4OJO A;  1DGR M;  4AVZ A;  4R79 A;  4RMN A;  1UD5 A;  4ASU A;  3UNG C;  3DTE A;  1GLN A;  4RLQ A;  2XGJ A;  4E7K A;  4IX7 A;  3G05 A;  2GOM A;  2WAQ A;  4XOT A;  1IDJ A;  3B4N A;  2PYH A;  2R7W A;  2LYC A;  2KMU A;  2R7S A;  2IGN A;  2WZP P;  4DK1 A;  2IS1 A;  2X53 S;  3VYU B;  2CMP A;  1X0C A;  4XLC A;  1MAB A;  4NK8 A;  3C2H A;  2XOK A;  4BE1 A;  3CMM A;  4RM3 A;  1Z21 A;  4BQO A;  3LSK A;  3SYT A;  3GQ8 A;  3ZR8 X;  5HNF A;  2ELJ A;  2QKM B;  2E1B A;  2O0V A;  2R7V A;  1XG2 A;  3H9J A;  4XN0 A;  4P5O A;  1WFX A;  1WJB A;  4KKU A;  4NUB A;  1E0E A;  5AMV A;  3VWB A;  2ZZE A;  3JU4 A;  4HRI A;  2RQQ A;  1X19 A;  4EAT A;  3CZ6 A;  1NG6 A;  1BMF A;  3ZRG A;  3UR3 C;  2W00 A;  2HPI A;  1H8H A;  5CQG A;  4CH7 A;  1WTH D;  4E7S A;  1P9Q C;  4XKW A;  1O8K A;  5KCM A;  3OW7 A;  2M7A A;  3HPH A;  2NST A;  4B48 A;  2E5N A;  2JVH A;  2VJI A;  2L2O A;  4X0G A;  1QU3 A;  1SKY B;  4P22 A;  1FMV A;  1K5C A;  4HWV A;  2VIX A;  3HC7 A;  5CQE A;  3OYE A;  2EWE A;  4HNT A;  3FBI B;  2HVR A;  2XC7 A;  3DTI A;  2XZL A;  4NQW B;  4OZY A;  3OL4 A;  2DCE A;  2E1M C;  2GJR A;  2UWM A;  4KT6 A;  4RLF A;  4ZC3 A;  1WP6 A;  3ZIA A;  1LVK A;  1YX5 A;  2X1E A;  2XF7 A;  4CCJ A;  3OAA A;  2AQF A;  4BJ6 C;  4HST A;  5CPR B;  2X6X A;  2CUJ A;  3FHN A;  1LKX A;  1D1B A;  4XOR A;  4W8T A;  1Z3Y A;  4NC7 A;  2IGO A;  3S93 A;  2XZO A;  5KNL A;  3EUH C;  3K70 D;  2LZJ A;  1N75 A;  1NBM A;  2R4G A;  3LSG A;  3OYN A;  2QE7 A;  2LY1 A;  2WY8 Q;  3OEH A;  3LNN A;  2O17 A;  1O8J A;  4GQN A;  1RMG A;  1Z3X A;  1UD3 A;  1D1A A;  4KKT A;  3RCO A;  1RWR A;  2VXZ A;  2VKD A;  3NWT A;  2F1M A;  4XQF A;  2LY2 A;  4HIZ A;  4W8R A;  2HU9 A;  3PFY A;  3UW0 A;  1KCD A;  1MNE A;  2E1M B;  3OS1 A;  3H9G A;  3LMW A;  3VYR B;  1DBO A;  2KPM A;  4E7L A;  2XZP A;  4XOP A;  5HNH A;  4DK0 A;  3VSV A;  2NZM A;  1D1C A;  4FAS D;  2KP6 A;  2HVQ A;  2HPM A;  4C2U A;  3L2Q A;  2Z8G A;  1O8F A;  4JOM A;  3ZSC A;  4LIT A;  3T9G A;  3RSN A;  4C9Y A;  2WB1 A;  3HUG B;  3OYJ A;  3BCF A;  2NTQ A;  3S8P A;  2CH0 A;  4KIS A;  3OS0 A;  1KON A;  2MC4 A;  2L5Q A;  3RTR A;  4Z05 A;  1BR2 A;  2LC2 A;  1EFR A;  1CZF A;  2WAF A;  3OR2 C;  1LDK B;  4HEA 2;  3LL7 A;  3TMO A;  1EE6 A;  4NNJ A;  2Z2S B;  1YE9 A;  2INV A;  3IAM 2;  2K9M A;  1AIR A;  4NC8 A;  4DNT B;  1W36 D;  4XKV A;  3PSI A;  2ZZF A;  2VJJ A;  2QXZ A;  4B44 A;  3GQ9 A;  5HKK A;  2UUZ A;  4PJL A;  3WWG A;  4BDY A;  1UG0 A;  3SUC A;  2FUG 2;  4N4O B;  4F55 A;  3OYB A;  3J7A Y;  1SFK A;  2LG4 A;  3DDY A;  3M1C A;  4Z03 A;  3SDB A;  3VST A;  1UD6 A;  3OYH A;  3HG9 A;  3OYI A;  4PSW A;  3EUA A;  3BCB A;  5FRO A;  2P0W A;  1O8G A;  2X51 A;  4OJP A;  3U21 A;  2XDV A;  5HVQ C;  3GVK A;  4URR A;  1IRX A;  1IDK A;  4I84 A;  4F3Q A;  3DPL C;  1V5G A;  2M4G A;  3VYS B;  1O8M A;  3VSL A;  2CW8 A;  2W7N A;  2NTB A;  3ZPN A;  3DWL E;  3NWS A;  1KZL A;  2X1C A;  2M0M A;  2CV2 A;  2JUG A;  3H35 A;  2KHM A;  4PSX A;  2W82 A;  4BEH A;  1BHE A;  4PJJ A;  3N05 A;  2F43 A;  2JVG A;  4JQF A;  3S3N A;  1BLI A;  3FKJ A;  2WPD A;  2NT6 A;  4Y4R A;  3DTK A;  4G7W A;  1JRG A;  4ZDL A;  3K4L A;  4YRV A;  2XF6 A;  2E5Z A;  1OHH A;  2NTP A;  1O88 A;  1K28 D;  3PNV A;  2QKL B;  2W1O A;  1HA8 A;  1MMG A;  1LFP A;  4YZ0 A;  1BPL A;  4BJT A;  2KLO A;  4GRI A;  3OYG A;  3KEY A;  3LMM A;  1OOC A;  2JDI A;  2R9V A;  2ZZQ A;  4B3G A;  3A35 A;  1KCC A;  1TT0 A;  2GJK A;  1O8I A;  2RNG A;  4B3F X;  3VMV A;  2O0W A;  4CCO A;  2LRD A;  4L8J A;  4CA0 A;  3DKX A;  3SEQ A;  3QOE A;  4F91 B;  3JUR A;  1PYV A;  2BW3 A;  4D1Q A;  3PL8 A;  3L2W A;  2ZXH A;  4IQJ A;  3KRG A;  3HPG A;  1N77 A;  4BQN A;  1T0F C;  4LIU A;  4BE0 A;  3K4J A;  2DT6 A;  4OAZ A;  2DT7 B;  2WAD A;  2UVF A;  4IZZ A;  3HOS A;  2X8K A;  2Y0S A;  4C2L A;  1S9H A;  4Z1M A;  3DEE A;  4PUS A;  1OFL A;  1Z7L A;  4P1W A;  4DIQ A;  2R7T A;  3CF2 A;  2HQA A;  3B8Y A;  1NHC A;  2KVO A;  4BEH B;  2JIZ A;  4G6T B;  4ANJ A;  1PXZ A;  4BE2 A;  1DBG A;  4XLE A;  3OYM A;  3H0D A;  3OYL A;  1K6Y A;  3EUK L;  3L2V A;  2HVS A;  4E7I A;  3SEZ A;  4J00 A;  2UVE A;  3W2W A;  4N4N B;  3W2V A;  3BG6 A;  2VQC A;  2PYG A;  1BOB A;  2R7U A;  4YZX A;  2GOX B;  4YXW A;  4DNR B;  2CK3 A;  4F52 A;  3DPU A;  2LOO A;  4H4K C;  1WJA A;  3ZQQ A;  3DKY A;  3K10 A;  2IS6 A;  1E79 A;  3D5S C;  1HZE A;  2VJ4 A;  3AFH A;  3HL2 A;  4U7B A;  2LH9 A;  2KRC A;  2KRH A;  2X1D A;  3K4N A;  3ZCO A;  2ZFU A;  5HOO A;  1V0F A;  1WJE A;  3VR6 A;  2L7K A;  5LD2 C;  1DQU A;  2MAB A;  2NSP A;  4QPO A;  4BGD A;  2VBK A;  2BW3 B;  2M5S A;  1OFM A;  3OE7 A;  4IKF A;  3V42 A;  1MW7 A;  2XND A;  1OGM X;  5LFA A;  4LIV A;  3RQ4 A;  2PEC A;  2ZXI A;  4KIT B;  3K4C A;  2D3N A;  2KZV A;  3BC9 A;  2XSJ C;  1IB4 A;  4XKC A;  3CES A;  2VLA A;  1E1Q A;  1W0J A;  1N78 A;  3K70 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...