4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
3GQ7A 1DBGA 4XLFA 2VBKA 4W8TA 3GQ9A 2X3HA 2VBEA 4XL9A 4Z06A 1KTWA 1OGOX 5C1CA 1O8MA 2NSPA 2X6XA 1JTAA 1OFMA 1O8LA 4XM3A 1QJVA 3SUCA 4U4BA 1OFLA 1HG8A 5C1EA 1O8FA 2QY1A 3B8YA 1QCXA 1GQ8A 4XMYA 3GRHA 4XQFA 2VJJA 2PYHA 1O8GA 3B4NA 1K5CA 2NSTA 3GQAA 3VMWA 4NK8A 4OJPA 3UW0A 3EQOA 2VBMA 4OJ6A 1RMGA 1IDKA 3FY3A 4XLCA 1O8DA 2NZMA 1DBOA 1VBLA 2NT9A 1PE9A 1OGMX 1JRGA 1RU4A 4YZAA 4YZQA 2O04A 4Z03A 2O0VA 3EQNA 4I84A 4PMHA 4YZXA 1PLUA 4NK6A 2UVEA 4YEJA 2X6WA 2NT6A 4HWVA 1O8IA 1KCDA 4OJLA 4EW9A 3B90A 3LMWA 1EE6A 4YELA 1XG2A 4W8RA 1BN8A 2INUA 4W8SA 2UVFA 3KRGA 4XKVA 1O8JA 4XR6A 3WWGA 4XLAA 2Z8GA 4XORA 1AIRA 2INVA 4OJOA 2O17A 3T9GA 3VSVA 4Z05A 2IQ7A 1O8HA 2NTQA 4MR0A 2NTPA 5AMVA 2PYGA 4W8QA 4AVZA 4C2LA 4XOPA 1RWRA 1O8KA 2QX3A 4OJ5A 1KCCA 4XN3A 1O88A 3JURA 1IB4A 2O1DA 3VMVA 1NHCA 3ZPPA 1X0CA 4U49A 4XNFA 4XLHA 4XONA 1CZFA 2QXZA 4OZZA 4YZ0A 2X85A 1O8EA 3VSTA 2VJIA 4XKWA 3GQ8A 2X6YA 2ODLA 4MXNA 4XOTA 3ZSCA 3VSUA 4OZYA 4URRA 2NTBA 1OOCA 2O0WA 1PXZA 1BHEA 2PECA 2BSPA 2EWEA 1IDJA 1IA5A 4XLEA 1WMRA 4XN0A 1H80A
chains in the Genus database with same CATH superfamily
1D5YA 4RLZA 2DDBA 3X2QH 1A31A 1UD2A 3IHUA 3BROA 3FHNA 2PEXA 2BVMA 3CMMA 4FE7A 3DEUA 4PCQA 5GTIC 1BA5A 4BJTA 2F4IA 4OU0A 1VQ7I 2IA0A 4RAZA 4P3IA 2BX6A 3PSZA 4H4KC 5DYMA 2MYSA 3V7AA 3LL7A 4PFPA 2AXLA 5J6XA 3TEDA 3NAWA 1MNEA 1U2WA 3A01A 2XPUA 2F1LA 2ZZGA 1K73D 2EFGA 3L2CA 2Z6BD 2ZZFA 1EH6A 3B8YA 1FRNA 4HRIA 3BG3A 1T38A 2HXOA 1T56A 1WFXA 2ZZEA 2ZZQA 4BDYA 2DA5A 3KZZA 1BMFA 3G2BA 1QNTA 4JX5A 3HG9A 2Q2EA 3JRAA 1VQ7B 4KMUX 1UG0A 1IXRC 1XCVA 4MIMA 1KU9A 3GZ6A 1QZZA 5F4OA 1U8BA 1P7JA 4E0FA 3JTGA 2DMUA 1B59A 3MZ8A 2PJRB 1QQIA 2KIUA 3I1FA 4HNTA 4XK4A 3F6OA 3AVYA 4BHBA 3HM5A 3U1DA 5GAHJ 3OSGA 2BY1A 1PLUA 1Y6IA 2G7HA 3TW6A 1UMQA 1YI2I 3OYJA 4P6YA 3HPGA 4ZTFA 2D5VA 3S8PA 2IW5A 5EG0B 4ABZA 1GXPA 1EWYA 3S2WA 2CW5A 2LDUA 3CCSB 3CD6I 5BSYA 4MQVA 4J19A 4M9XA 4OIRF 3R6SA 3AAFA 3AFHA 3E5XA 2OF7A 4MHGA 2MBFA 4JOMA 1FOKA 1CNEA 2ZXIA 3TOBA 2OZUA 4CCOA 2GLOA 2BOLA 4RGXA 3ES9A 2RV8A 4HYEA 2F3LA 2QKLB 1O8HA 1IUFA 5ICCA 4UV8A 2X48A 4B48A 2KVOA 4MTDA 1S72B 4CQJA 1CNFA 3TDUC 1QUEA 1QVTA 3RQ4A 2V1XA 2IGKA 3JQQA 5CVUA 1JNYA 3OYFA 1O3SA 2XIGA 3ABTA 1KMHA 2KT0A 4KMFA 3H9JA 3S93A 2OQRA 2LLKA 4CA0A 4XONA 2R5ZB 2COMA 1K4TA 5DM6F 4HX8A 2K4BA 2W7NA 3QSYA 1TW3A 3E5UA 1TBXA 4AD9A 1BX1A 4YZ0A 4BQAA 2VJIA 5ERIA 1R1UA 2IBDA 4CCNA 5D6EA 2F6CA 1LEAA 3DBRB 2NVTJ 4NBSA 1R23A 4YXWA 3VYRB 4N4NB 4M3BA 5J8CA 1YW7A 1NTCA 4P9SA 2GK7A 3FF5A 1V0FA 1FIPA 1V5VA 3HJEA 4DYCA 1FNMA 1IRXA 2A3SA 5HS7A 3JSPA 1IAWA 2O0WA 5J1UA 3W6KB 5D5UB 5E3NA 1LB2A 5LGTA 3BJOA 2Q8KA 3NE5B 2OCCH 2Z9OA 1PDNC 4A3KJ 1TP4A 4WXHA 2Y9ZA 3G1LA 2HQAA 2OPTA 1ERDA 4GYIA 3ASPA 4RD6A 5FJ8J 1N0UA 2ZITA 3WG7H 5K7FA 1D1NA 5LGUA 4RB0A 2X8KA 3WG9A 3RCOA 2WSSA 3EPZA 3I4PA 5D5WB 3FXLA 1OHHA 1UELB 1OFMA 1ZARA 3FDYA 1R1VA 4FASD 3VO2A 1P4MA 4X07A 5C1EA 3L7WA 2DO7A 5DSZA 2DA1A 2XAFA 3H0DA 4I6ZA 2EV0A 2R93J 3LJYA 4HX7A 5IYNA 1QA2A 2KHMA 1YHQB 3BTIA 2BPOA 3ERMA 5M3FJ 1OB5A 1AKHB 2QEXI 4ZGNB 4GGGA 1SFUA 1VQ8B 1S7AA 2TDXA 4A6EA 2V7XA 4DBRA 2P3MA 4RDLA 3HDDA 2FE3A 3R0JA 2R6HA 4J00A 3MHPA 3GTQJ 1KZLA 1VHOA 5JVTA 4PC1A 4BHPA 1PP7U 2X1DA 1T39A 4LFUA 5TY0A 1QVFB 3ABKH 5IYWA 3A01B 5M5WJ 3J7YJ 5FO0A 1VQPB 2E1OA 1YLFA 5DTDA 3H9NA 1ZR2A 3PETA 2RGVA 2HKOA 1MRZA 1HF0A 2HOTA 2HR3A 3PFYA 1ETOA 2CSOA 3LAPA 4CH7A 4XRSG 4OAYA 2IRFG 3V7SA 1UMKA 3CW2A 1YIJI 4W8SA 3K1NA 3OZVA 1RKTA 3G4SB 5EEGA 3WGHA 3N4MA 3L09A 2E7XA 3WWGA 4XR6A 3F8CA 2K3FA 4XKBA 2OTLB 2D45A 5IT9K 2LTPA 3H5NA 3BQZA 3LAJA 3DLLF 2M9HA 1B9MA 2HI3A 4V19K 2UUZA 1I6HJ 3VEPA 5K7ZA 1O3RA 2R7UA 2QEXB 4QPOA 2XAUA 2QZAA 5F0FA 3N6ZA 3BG6A 3Q9SA 4LG3A 5LEJA 2EIMH 4UUVA 2QMUA 4HNVA 2CMPA 1K61A 3BY1A 1Q1VA 2K9QA 3IWZA 2QBYB 2FX3A 4XN3A 2KKOA 2KIMA 3BR0A 3S2DJ 3DP7A 2L54A 3U21A 1XCBA 1Y8RB 3NWSA 4RLQA 4DYRA 5FKMA 3GVLA 3ZBUA 3JCUC 1X1DA 4Q47A 1H0MA 3ZBTA 2QA4I 1NH3A 2ZXWH 1XN7A 3JW4A 2KJCA 4P9FA 3K1PA 3T5XA 1XDSA 3IKVA 2ECCA 4AM3A 3K70D 5B1AH 3MKYB 4ZV4A 2L3DA 1FBQA 1WCMJ 5DCMB 4HG2A 4C30A 2O6WA 4S0HB 3T8RA 5B3SH 3K7AJ 3CDLA 5KAFC 4HIZA 3HOUJ 4B8XA 1G2HA 1P4XA 2CQ7A 4RM3A 3T8TA 3NQOA 4GRIA 3CO6C 1PXZA 3J7AY 3RI4A 4KYWA 3SHFA 2QTLA 2UVFA 3KPHA 3FKJA 1VQOB 2HQRA 1FT9A 1JKRC 1BC8C 2L4MA 3ZCOA 4CGZA 1D3YA 1JHHA 2A68F 3IH3A 1BLIA 2VBKA 2VFQA 5IK2A 4ZYGA 5FLMJ 2DY1A 2O3FA 5HDKA 2R0QC 2XNJA 1KQ8A 2EZIA 1YRNA 3GSIA 3H9QA 2HZTA 5E20A 3K69A 3TW7A 4ANJA 2ID6A 2FBHA 4B3FX 4A93J 3PA2A 4AC0A 2DK8A 1VFCA 2E1MC 4LC0A 1H88C 1QPIA 3P9CA 2DOFA 2VPRA 3BR6A 3CP8A 2BSAA 4ZH4F 3ASRA 3CCVI 1Q81D 4DJAA 1HLVA 3A0BC 1BI2A 2WAEA 4FHTA 3QU6A 4KA4A 4EH1A 2LREA 1OQYA 4WQMA 1D8TA 5FL7A 1JGGA 1RETA 3J80Z 4A69C 3JQRA 4XLCA 1HC8A 3CD6B 5HS8A 5F4MA 2PMUA 2G9WA 3MKWB 2XGEA 2ZXJA 1MDMA 4BQNA 4OAZA 1JRGA 1R5NA 4YZAA 1EXMA 3LSGA 4YEIA 4M2LA 3GTOJ 5FRNA 2O04A 4L5JA 4LIUA 3LSPA 1XFOA 1U9NA 3CCYA 3RKYA 2LY1A 5CVIA 2O5RA 3CZ6A 1MD0A 3CJRB 3H9GA 3DKYA 1P9QC 3B6AA 3G73A 1R58A 3I59A 4BE2A 2JJ7A 2VKDA 4L18B 5JBQA 3W2HA 1DABA 2Z33A 1KYWA 3ONYA 5H6QA 2CW7A 3LQQA 4S04A 1SFOJ 1OR7A 1V5EA 2BV6A 2WBMA 1DGRM 3EQLF 5ILSA 3SXYA 1ZRCA 2IGMA 2LMDA 2RREA 2JA7J 1W35A 4UUTA 2X9DA 4YAFA 3AG1H 3ERED 2OU2A 4IHXA 4IOAF 4RD4A 5KCMA 3K4MA 5DEQA 3V8JA 2MC4A 1MJ9A 2Q6IA 2GQQA 1FDRA 5FLXK 4UY8I 2OBTA 3HHGA 2E5ZA 2HWVA 3F3XA 3WHBA 1V55H 1BM9A 2OZ6A 1PJ6A 4TT3A 3QAHA 1IN8A 4F7DA 2BM7A 3U9GA 1UD8A 1EA0A 1KCCA 2DYIA 1IF1A 4KH3A 3KYCB 1IB4A 3BTCA 4G7OF 3OS0A 1VF7A 2QZ8A 3DBLB 4II2A 2FF4A 3FXOA 4U9UA 3QRFF 4JMQA 2DODA 4UHTA 1G3TA 3ZMSA 4YIRX 3SZGA 4BBSJ 2FBKA 3OPOA 2PQ8A 2JK3A 4Y17A 1KZHA 3T56B 2R7FA 2VXZA 4Z4UA 1HSTA 1LQ1A 2RQPA 4IZZA 3SLDA 1GV2A 5CDFA 3OSFA 1HVXA 3JRBA 2DERA 2AXTC 1OFEA 2D3LA 1GT0C 1EFUA 5DDGA 3PNYA 5TGTA 3I0TA 3IRRA 3ECHA 4E4HA 1G7SA 3OL4A 3WXMA 1Z0XA 3RDIA 1KK0A 3JTHA 3B8HA 2ME0A 3HKZA 4AYBN 1BOBA 2DCEA 1W36D 2XGJA 4AIDA 1AA7A 3CO7C 2XKOA 3IH4A 2Q1ZB 3PFIA 4U7BA 3G6EB 2N8GA 2Y0MA 5CJ9A 2DFHA 3GQBA 3PUNA 1Q9SA 1PYVA 3CC2B 4Z06A 1W36C 3WBKA 3E1SA 1R5BA 1TWGJ 1WHUA 4YRVA 4W8TA 1FX0A 1T5EA 1Y1WJ 2DN0A 2XVCA 3DFGA 3LMMA 2DBBA 2VE8A 3MFKA 4P5OA 1HCRA 2JJ2A 1OPCA 2CQKA 3KIOA 1K6OA 4IRIA 3HZJA 4BJ5C 4Q4ZF 1LDDA 5GADJ 4XM3A 4ON0A 1ZM9A 5A89A 3SUCA 3L2QA 1BI0A 1HG8A 1O8FA 2MD0A 5CVJA 1K4SA 5HDNA 2BGCA 1I8DA 1IB0A 5HVQC 1VQ6I 1GQ8A 4FT8A 2E5NA 2DOAA 4PJ0C 5H6RA 3OYIA 2MD5A 4WWVA 2OD5A 4R71A 2JA6J 1D5VA 1VQNB 5K5RA 2E1MB 3GCMA 4UB8C 4I09A 3HGYA 4I99C 2EA4A 1FNBA 3A8JA 2ZBUA 4HQMA 4HX4A 4B47A 4Z4WA 1OB2A 3UW0A 2FX0A 4RDUA 1RMGA 2VQGA 4ZYDA 2HLDA 5EGOA 2NZMA 1IXSB 3VYSB 2O03A 4PAAA 3GX4X 5IYDJ 2EIKH 1HW1A 2HNHA 5IOZA 1N8RD 3P9IA 2WB1N 5L3FA 2J7KA 2V7TA 1XSVA 3FX3A 4HDUA 2C4UA 3A3GA 3OJWA 3FMSA 1YJWI 4UNOA 3DTKA 1ENHA 1G7RA 5CVVA 1QRBA 4EJWA 2CC2A 4CYCA 3PO2J 1KQ0A 5K5OA 1O8IA 2BY0A 2NOJB 4OJLA 5H2FC 1BR2A 4IEJA 4W8RA 2INUA 5HNHA 1IN6A 1SMTA 4E7SA 4BQQA 1JKPC 5AIPA 2WJYA 1WPCA 2JSPA 3BG9A 4XLAA 1R4MB 1X3ZB 2EA2A 1FP1D 3HSFA 1IDZA 1S5LC 1STZA 2PBIA 2ZC2A 3ECOA 1H42A 1AIRA 4RD0A 1W0KA 4PZJA 3W2AA 1ACIA 4X0GA 4E7IA 3LNNA 2PYGA 4C43A 4ZDPA 3WHCA 1R6RA 2LP0A 5LEKA 5DD4A 2RNGA 2CU7A 2LYCA 1JTXA 2ZB9A 5FNZA 1VQMI 3U2RA 3KEOA 1SKQA 4X8IA 2CV2A 4PFOA 5J3LA 4ACBA 4CICA 2ME6A 1D0XA 1S0UA 2LOOA 2XASA 1BJZA 1E3HA 4GO1A 2HOEA 5BSXA 1L1IA 3CCEI 1D1BA 4ZCIA 3U6KA 1QUFA 1BL0A 3CC2I 5J40A 2LKSA 3FKIJ 3OR1C 2R5ZA 1E0EA 3RPQA 1QU3A 3K4LA 1J0RA 3NWTA 1KA8A 4M3GA 1AHDP 3L2RA 5FKOA 2M0MA 3F23A 1YJ9B 5LGNA 1KONA 1RESA 3BY6A 1BBYA 3NAUA 4UXNA 4WWCA 4BS9A 4Y52J 3H3VK 2J5OA 4HBLA 1ZM4A 3K4CA 3BR5A 3AVWA 2LF7A 3C1DA 3TO9A 3HSEA 4ROXA 1L0OC 2DT7B 3DLAA 4DQKA 3ABMH 2BZTA 1U9OA 1TYVA 2H1LA 2HDDA 1DBGA 4XIDA 1S7EA 3VOEA 1DPUA 2B7BA 2K9LA 1JE8A 2TRTA 2X3HA 2OK8A 1X4OA 2X53S 4XL9A 3K6GA 2UV1A 4BKXA 5HXBA 1OFDA 5ICFA 2X6XA 2LKPA 1I6XA 1XDUA 2XSJC 2BY3A 1YX2A 1K28D 5AIQA 2P8TA 3FXKA 2VFOA 1QCXA 5H59A 2BXZA 1TT5B 3NARA 4QWQA 4XMYA 5J1YA 2J8KA 3SQVA 4XQFA 2BM0A 3KCCA 1UD3A 4HSRA 3FZVA 3F0CA 2PJRA 2V1DA 5BQTA 1XSXA 2DTRA 5ILUA 1WJCA 1CF7A 4KISA 2E1BA 3GZNB 2ZCWA 3C2HA 1DUXC 3PENA 3P26A 2ZFUA 2LZJA 4D5FA 3ZOBA 3OYDA 2NT9A 3ELKA 1OGMX 4WX9A 5J4VA 4WK8F 3BY2A 1IV8A 1D8KA 2M0CA 3ZMTA 1JUSA 2L9RA 1GV5A 3CP2A 4DOZA 3L2VA 3DTIA 1QBJA 2CNDA 1VNDA 2FSWA 3KLNA 5EG0A 3SLNA 4YEJA 2X6WA 5EEHA 4HNUA 3LSRA 5D4RA 4A3LJ 1SKYB 1FIAA 3UR3C 2MH2A 5F6FA 3ZQIA 1QH0A 1I3AA 1P2FA 2MW8A 3LSIA 3AVVA 1BN8A 1DG1G 5FGMA 4G7HF 2GZWA 3D5LA 2VJ4A 3ULQB 3C18A 3HOWJ 4XORA 3K10A 2MLGA 3W2EA 2IQ7A 3ZQCA 1Q86D 3CCJB 1TWHJ 3SYJA 1MDMB 4OP7A 2VI6A 5AMVA 3CQZJ 1ZAOA 2WC2A 4D9JA 3GYHX 3OJXA 4DNRB 3H09A 3LA3A 1FPQA 1XMAA 4QLCU 2BXYA 2IVMA 2V9KA 2CW8A 1WZ2A 4C9YA 3RYRA 1OYIA 3M8EA 1FC3A 1XC5A 3LQRA 2BYVE 2QXZA 1OCRH 2R5YB 1QFJA 3QYBA 1X1AA 3E7LA 1B4AA 4L9NA 1OYWA 1FLIA 3CCQB 1O8EA 1IDYA 4PSXA 1VQOI 3A8IA 3QYFA 2L7KA 2X6YA 2X3UA 4IW3B 3SJPA 1Q82D 3KP4A 2D2WA 2F4OB 2DMPA 2ZJPF 4FX0A 4DW6A 4R1HA 4YFXF 4B4CA 1WORA 3DWLE 2OYNA 1GO2A 2F5FA 2C4TA 4HW0A 3QPHA 3HHHA 1OR7C 3HRTA 4YCQA 2ZMEC 3DU6A 2M34A 3CRZA 5D5XB 4WZLA 2LH9A 2IGNA 5FO1A 3BZKA 3GVKA 1I27A 3CC7B 5LMZA 2KQRA 3TOAA 3EUHC 4RD2A 3ZIAA 1XG1A 2XKPA 1IZ1A 4XN0A 3HOXJ 4PK4A 2GA2A 1HSJA 3GQ7A 3WTXC 1OMIA 3GLLA 3G4SI 2VQLA 3GQ9A 3M4OJ 1X1CA 2LR8A 3AG4H 1APLC 2QA4B 1H89C 2W7ZA 5KAIC 2WB1A 2WYRA 3ONQA 2P5KA 3J81K 2CUJA 3IL2A 1ZRFA 1SANA 4FISA 4Y7NJ 1IRGA 4N3NA 1UZCA 1UCRA 2QQBA 3RPUA 2A61A 4FETA 3KP3A 2D74A 1T95A 3SJMA 4XICA 3S32A 2R7SA 3COAC 1FY7A 5FKLA 4JQFA 3RZDJ 3KYLA 3AGPA 5HZBA 4L5IA 1X2NA 4Y9UA 2R7RA 2MG4A 4GFBA 1X1PA 4RCYA 4JP0A 1SM4A 3OW7A 2XV4S 3IP4B 2KIFA 1LVAA 4RAYA 1VQ9I 1QG0A 2ELHA 1YIOA 4JX6A 2Z16A 1NBMA 1TT0A 4G6DA 1A8PA 5EZGA 1GLNA 2YUSA 4NC7A 3G1MA 1VQ4I 1W0JA 5DN6A 4AUXA 1YHQI 2A6HF 3WNDA 2IA2A 2F43A 2RVCA 3WTTC 4F7ZA 2PMZA 2IS6A 3WNCA 2B7CA 3SJZA 2VFNA 4L8JA 4NK6A 4TMWA 1BR1A 3AL0C 1DU6A 4HWVA 3R6KA 5K1YA 4LBWA 4LG0A 3BCDA 3PQKA 3SDBA 3V8LA 1VF9A 2ID3A 1OCTC 1NB9A 1USTA 4CO8A 2MH9A 1EE6A 4UZUA 4P22A 2ELKA 5IT9Z 1FTTA 3BJAA 5E17F 5ED4A 1W7PB 4AF6A 4RGSA 4ENMA 2DJIA 3O8HA 2LRDA 2E2HJ 2M2EA 4M6VA 3WTUC 1AIPA 5DV5A 1XQBA 2QTZA 1T0FA 3VSVA 4Z05A 3ZQGA 2VIXA 2ZJRF 1FNCA 2NTQA 2NTPA 5LHGA 2CFOA 4KT5C 2ICWG 3CCRI 1Z3XA 4DYQA 1I7PA 3FJOA 4RA2A 2VOOA 4XOPA 3OY9A 2LFBA 4Z4TA 1M1EB 3RTRA 2V9PA 2VBZA 2DJNA 4FK8A 5DNSA 4NB5A 4MEXF 3D5SC 2XGXA 4HF0A 1LPQA 2I5UA 4IVNA 2P5VA 1JI8A 4U88A 2DOGA 4D5CA 1UFMA 4BYYA 2OTJI 1DP7P 3MN2A 4M3EA 4F91B 1VQNI 2DAOA 1VZ0A 1OYYA 3DF8A 4FQGA 2QN6A 3CDIA 3MMPA 1AOYA 3N05A 3JRDA 2RC4A 2VJ5A 3ZSCA 3HOSA 4KITB 4ACAA 3CMEB 1EP3B 1QGYA 1A6QA 4HEA2 2PN6A 2XZOA 3ZRGA 3V4GA 1TC3C 2VUMJ 2WZPP 2DA3A 5HZAA 3A02A 1PUFB 2RNJA 3C7JA 4Y15A 4HE6A 1BHEA 3M7GA 2ZMEB 4M72A 3LWFA 2R7ZJ 1U5TA 4CXFA 1WMRA 2GOMA 5D6FA 4HAMA 4PDKA 6PAXA 2CK3A 3H36A 2FRHA 2K3PA 4EMSA 3JSOA 3G6EI 3CCUI 4KNYA 2OUMA 3RIQA 3KLOA 2RN7A 5B6IA 1LLWA 4DNCA 2QLZA 2R7XA 1FZPB 1ZG1A 4F93B 4PGHA 3GUDA 5AN9A 1WJDA 4PC2A 2L0KA 4XSZF 4B4DA 2ECBA 2Q6OA 3RPUD 3W6VA 1R71A 4BL0B 3GVAA 1PJ7A 5TV2A 3QPTA 3O8GA 4RM2A 2XZLA 3CF5F 1SD7A 2I8DA 1E64A 1RRJA 1WJBA 5E3MA 2V4DA 3KETA 4U0VA 2GK6A 2FMLA 2ZL6A 3A4CA 1PUFA 2DW4A 2E60A 3CESA 4BEHB 3JREA 2VB6A 4BQOA 4R79A 2NNYA 1X3WB 5F1RA 2IP2A 5L3CA 4E6KG 3IC7A 3PQJA 4ZJZA 5GPCA 3OYKA 4OJ6A 2M5SA 3MD2A 4Y7CA 1TLHB 3CUQC 4NC8A 1A36A 4IKFA 1YO5C 1OJLA 2QUFA 2LKXA 2XT2A 3EDPA 1H85A 3GFMA 3Q39A 1FEXA 4WZTA 2O7OA 2GA1A 4FE4A 3I5UA 1GVHA 4PABA 1FWZA 4LBYA 2Y31A 1S8NA 4TSFA 5L3DA 2W82A 1E3OC 5IYQA 2AHOA 2ZJ2A 3E97A 1TNTA 4PMHA 5DUIA 5JLWA 1SD4A 3WTWC 3OAAA 1Z21A 5BPIA 3E5QA 1UD6A 3GXOA 1B8IB 3LOCA 3HOZJ 2FNAA 4IRHA 1O4XA 3KRGA 5FLVA 1QHHD 1SVLA 3P7NA 3KP2A 1O8JA 3Q9VA 1WWXA 2HYFA 4Y13A 2Z8GA 2BM5A 1IJEA 3ZR8X 1LFBA 2IS1A 1MSFC 1MMNA 3BP8A 2M1BA 1X2MA 3WU1B 5JI6A 5KHDA 2IOUG 2OA4A 1J7KA 2H27A 3FBIB 3I58A 2NS8A 3ZQFA 3GLXA 1JKOC 1XMKA 4ETSA 5IYPA 2PFBA 5F4JA 4I98B 2HPIA 2ADUA 1MBGA 2F5VA 4TMTA 3L9FA 1YYVA 3PNTA 3IV5A 1XS9A 1F20A 1TYUA 1F5TA 1NHCA 3ZPPA 5ILVA 5IPAA 2M4KA 2EFPA 1ZREA 1FSEA 3C2BA 1VQLI 2O8KA 5CPRB 1RR7A 1HKSA 2CJJA 3MZYA 3BCFA 1EH8A 1LFPA 2BBYA 2QSHX 2F1MA 3TH0A 2BF4A 4YALA 3G05A 4W1UA 1LNWA 3R60A 3M8FA 1CF7B 1WKMA 1ETYA 4G7XA 3K1MA 2Y30A 4M9SA 2VKVA 2V26A 3CXCB 4OZYA 2QCOA 4URRA 3CUQA 2DQRA 2OQGA 3LNQA 2Y69H 4OOSA 3WBJA 3ZGKA 1ULYA 1F43A 3HRMA 3EUKL 2VKHA 4EEFG 3CCMB 5E1WA 2VQCA 3GVJA 3CCUB 1COWA 1J59A 3N97A 3M9AA 2X0LA 3O2PE 3QPSA 3E6CC 3K9TA 4M71A 3HGGA 4OPOA 4ZCLA 4W97A 4BUPA 4DNTB 1WOOA 4EJOA 4HDVA 3LQ6A 1A5JA 2R7TA 3S15J 3FXQA 4ZDLA 2B9SA 4Z1MA 5C1CA 1POGA 4NC6A 2IPQX 2VKEA 4D0PA 2C78A 2VZLA 3BNWA 3J81k 1JTAA 3DEEA 1YITB 3GTKJ 5LFAA 3HRUA 4RD3A 4U4BA 1OFLA 4UVAA 2JQ7A 4HOBA 3FXUA 3KZYA 2EINH 3S1RJ 2KPMA 2HXIA 4G5GA 1H9TA 4TN1A 1BIAA 3SDGA 3T1BA 2VJJA 3HKZN 3VSLA 2FVGA 1TWAJ 4UUSB 1I18A 1U5TC 2HOAA 4M6XA 1W5CC 2ZFWA 4RAGA 2CV1A 4P3YA 3GW2A 2CG4A 4LBVA 3FMQA 2XROA 2M87A 3VMWA 5LRRA 1R5GA 2W24A 3OYMA 5E1ZB 3I54A 2K02A 4IF4A 4C3HJ 2W6JA 3BR2A 1BJKA 1SD6A 2IS2A 3W5VA 3SQNA 4CDGA 2V1UA 1S7OA 4PC6A 4MTEA 2F4NA 3I55I 1IJFA 3EQNA 1H9GA 3BR1A 1EFCA 1UAAA 3B02A 4AYBA 5JLVC 4RDKA 3E1YE 1D2EA 4NCNA 3L00A 1P4WA 3FM3A 4P55A 2GBYA 1R1TA 2L7ZA 2B63J 4BXXJ 2JJ1A 4UZFA 3IAS2 4KUMA 4XRFA 5KK1A 3PUMA 3FPPA 3WE2A 2HPMA 3ONUA 1I5ZA 4A12A 1FJLA 1E43A 1EV7A 2VN2A 1TTTA 3HEFA 1QFYA 1HKTA 2Z5UA 4EQQA 1HA3A 3BC8A 4RDJA 2EZKA 4GYGA 1TYXA 1ITYA 4PJNA 2LSOA 4EVIA 3T9GA 1VQPI 1OGJA 1Z1DA 1XGNA 2X1EA 1LE8A 1N06A 1YJNB 1ZGAA 1IRFA 1Z91A 5L3EA 4A3JJ 3LYCA 2CS3A 4CYCB 2E34A 5JMCB 1DU0A 1WVRA 4Z4YA 5FKNA 1KU2A 1O88A 4P26A 2RC5A 2YR2A 2YWFA 1SC7A 3BCAA 3VDXA 3WE3A 1RR8C 1OCZH 2IS4A 3FKSA 3VMVA 3BH7B 1ZN2A 3HRSA 3K4KA 1T98A 3WU2C 3JQPA 1TWCJ 2AHQA 2QWWA 5CKTA 3ZQLA 2PLYA 2GIZA 1BN5A 1FYMA 2QYOA 4NNJA 1T6XA 4HF1A 2IAIA 5EZHA 3T53B 2K27A 1V4RA 2YUHA 3GQ8A 4DIQA 1F36A 4GXOA 2D3NA 2XSDC 4L0YB 4M4SA 4O5VA 4OMZA 2P5LC 4N0BA 3H92A 5C3EJ 1FRQA 5IYRA 2CUEA 3KEQA 4TMZA 3QYEA 4P1WA 2DFIA 1A04A 2G0EA 3I3LA 4X7EA 1W9XA 5IP6A 2V6EA 4OPWA 1B8IA 1WH7A 2XC1A 3SEJA 2WR8A 4QIWN 4YIFA 2D9RA 3VR6A 4IQ4A 1MBJA 4XD7A 2JRTA 3IAM2 2NVYJ 3SZEA 4A0ZA 2JT1A 3FHZA 2DA2A 1VHEA 4C2TA 1D1AA 5HS9A 2KDZA 1QFZA 2VBEA 2HDCA 3FIWA 5B5EC 1MBHA 3AKZA 3L2UA 1LE8B 3I4MJ 2WADA 2QVOA 3JU4A 1V0EA 1Y39A 3OOCA 3W5UA 1PP8F 4XLNF 1LDJA 1OFCX 3PNVA 1VQ5B 3FXRA 2DA4A 1DDIA 2DFFA 4I0AA 1UB9A 4I76A 4G7ZF 3H5RA 3W2FA 2ZL7A 2IEKA 4ZYHA 4GQNA 4LG0B 3OWTA 2JWTA 4IO9F 4RB1A 2P7CB 3PIPF 5A2QK 2K7LA 3EUHA 4B43A 3ZMZA 2UXXA 1REPC 1CQXA 5F0CA 1K78A 4K2EA 4A3FJ 4MFEA 1ETVA 3KZIC 3OIOA 3VYUB 1KK2A 1QVGB 1EFRA 4L9VA 5L3BA 4LB5A 3H3UA 4EV0A 2D1VA 4YZQA 2K5CA 1X1BA 4OINF 2RAEA 1X4PA 2CGPA 4HV6A 3S1NJ 2LBFA 2NXNB 3GFJA 3H1CA 3RKWA 1C0WA 2XTYA 4LLLA 2CO5A 2OBPA 4BY7J 3HOYJ 2ZTNA 5E1XA 3AG2H 3TQNA 4EW9A 4MFDA 3B90A 3A1PA 3WTYC 3S3MA 1W34A 2MABA 2O6GE 1XG2A 2RQQA 3SZPA 3C2GA 2DEUA 2H6CA 3MVPA 2HVRA 1ETWA 1ETQA 1T6SA 2LY9A 3OYCA 2DMQA 3OYLA 1E1QA 3WQZA 1DP3A 1I39A 5J35A 4P9UA 2IA1A 3CJTB 1G6NA 2A69F 1ETKA 3VMFA 3CCEB 4OJOA 1WSRA 2XNCA 3JR9A 1HW5A 1PKVA 4RBOA 1EZGA 3CPXA 1MKMA 1KYZA 1UJ8A 2AO9A 2MFZA 5FFZA 4A5NA 2VPLA 3ZPLA 5M5XJ 1WI3A 3LSMA 1KU3A 4LD5A 4Y33A 4F3QA 2MGQA 4IHWA 4A3DJ 4RB2C 1RQPA 3H3ZA 2P6SA 3R61A 1WP6A 2QDXA 3HXLA 1WJAA 1YE9A 3C3WA 3CC4I 1KC8D 3SKBA 3S3NA 2JDIA 4MGRA 2L9NA 4XLHA 4LLGF 3B78A 2X85A 3W5HA 4LK1F 2FNPA 3OEHA 2HOSA 2BM4A 3IRQA 2O0YA 1LKXA 1GDTA 3I53A 4MO7A 2PE3A 2HYJA 1WJEA 2FOKA 4E7KA 2VFMA 1JT6A 1R7JA 4YG2F 3A35A 1Q1HA 4E7JA 4YIIA 4A3IJ 1J2XA 4ASUA 2G0YA 1QHGA 2EIJH 4E70A 5TR9A 5HLTA 5DS9A 1R22A 4CZZA 5GAGJ 5K5QA 3CMEI 4AF7A 5BMZA 1FYKA 2EZLA 2HEOA 4EJUA 3A1YA 1Z7LA 4B1RA 3HUGB 1MW7A 2JPBA 3K2AA 4HA8A 4AU7A 1E63A 3Q38A 2BN4A 5GAEJ 4RMNA 2OTLI 1NG6A 1YRNB 2E19A 2X0KA 1N0VC 4U0WA 2HDNB 4RM0A 1F9NA 5IY5H 1OCCH 1E3PA 1Z77A 1YW9A 3PIOF 4BBRJ 4TMXA 5IYCJ 1LVKA 2VASA 1WJFA 2EJRA 2O8XA 3RKXA 1AWCA 1W87A 1LJ9A 4ASNA 1XX5A 3LVBA 3FM5A 1O8MA 2XT4A 4E7ZA 2ISYA 1YJ9I 1IRZA 1HW2A 1QJVA 2DETA 3IUOA 4FX4A 5GP9A 2QY1A 2JSCA 2MLKA 5ICEA 1F60A 1Q7YD 4MNUA 2V9VA 5JLXA 2VFPA 5K7HA 5FIUA 4GCVA 5FB2A 2XZPA 5ICGA 2CV0A 4LJZF 1LFUP 2VNIA 3PUBA 1K5CA 1MH4A 2XNDA 2YX4A 4PGGA 3TO7A 1YTYA 5L3GA 2FUG2 2WTEA 5HDGA 4Z6YA 4OJPA 1YW8A 1GUUA 3ZXSA 1S29A 1XGOA 3QU3A 4WF2A 5IP9J 4OIPF 1VQ8I 4U87A 5E8IA 3OV8A 4EGZA 1ZR4A 1YQAA 2Q6LA 2EFQA 3ESWB 2H8RA 4RD1A 5IOYA 4A3BJ 1BX0A 3ISXA 1RU4A 5F08A 4I84A 1ONVA 2HTSA 2FA5A 4KIBA 4A6DA 2B5OA 3FK6A 3OL3A 3JAMK 2W1OA 3F22A 2R92J 2OBSA 3PSFA 2NYXA 2CRGA 2VL8A 1FNDA 4RJLA 1ZKGA 1T8IA 2HKXA 2FEZA 3GTJJ 1NHAA 2ACJA 2CBXA 5LLQA 2HU9A 5D8LB 4NDLA 2ZO4A 1TW2A 2DIEA 2VBYA 3E6MA 3OYAA 2ZL5A 1R5ID 2KRHA 3JRIA 2VYQA 4XKVA 2KLOA 2XEXA 3U2QA 5DD8A 4IPAA 3ZZUA 2STTA 5GV7A 1MBKA 2DT6A 1DGWY 1SAUA 1SFEA 1WRJA 4Z4SA 3LSHA 3ASNH 3NEUA 1YJWB 4BE0A 4MR0A 1B72B 2B7EA 3DV8A 2BVLA 3FPKA 3KE2A 3VPRA 1QGPA 2K9SA 1HDPA 5CYVA 5FO5A 4JBAA 1R5OA 1OCOH 2TCTA 3OS2A 5FKKA 3GIRA 3MKLA 1BR4A 1MSEC 5D4SA 3JURA 1O57A 3A2KA 1N78A 2R7QA 3EYIA 2R9VA 4FN5A 5LHHA 5BPDA 2NV4A 4A2UA 2EIXA 2KIQA 4XNFA 3CCQI 1EP2B 4HLXA 4OZZA 4FXUA 3W3CA 5DCFA 2UZKA 4M0LA 4M1KA 3CJQB 4XKWA 2QQAA 2X51A 3QP5A 1HDDC 1MBEA 3ZMDA 1U3EM 1BI1A 1HBXG 3I4NJ 2GOXB 3ASQA 3QQAA 1JB9A 2FBIA 1FOWA 3QPLA 4ESFA 2EH3A 1V54H 2E1CA 2E2IJ 5C44J 5J8FA 1TLLA 2BW3A 2J5PA 1VLOA 4Z4RA 5IT3A 4LB6B 1QO0D 2STWA 1QGAA 1UD5A 2ZSHB 4J01A 2CUFA 2BVNA 3RQIA 2V7VA 3MCAA 3CF2A 1QA6A 5M5YJ 2BSPA 3GTLJ 1Y56A 1T6ZA 1IDJA 1IA5A 5FA6A 5HLHA 4XLEA 1IN7A 3KP5A 4BNCA 1KGSA 2BE5F 3WGIA 2W57A 1QRYA 2KRCA 3ZN0A 4HQEA 3TL4X 1K78B 3DKWA 1ZLKA 1G3SA 5LHIA 1ZH5A 4XLFA 3KYDB 4XSXF 3AVXA 3CCSI 3HIFA 2C6YA 2P0WA 4K1XA 2E1NA 2CFXA 3OZUA 4PGOA 1N05A 2BEOA 1ZUNB 1FOYA 2I1LA 4XKCA 3WODF 1I1GA 4G1BA 4HF2A 4CUGA 1ODDA 2CWEA 4BPRA 5J4YA 5JHFA 4DBQA 2JPCA 4IXAA 2UWMA 1WTHD 3LQEA 4Y4RA 1BI3A 1S6LA 2QQ9A 3GBGA 1W0UA 4CCKA 1O8GA 3GTMJ 2PMDA 2IXSA 1VQLB 1IW7F 1MGTA 3E6DA 2XTWA 1XB2A 1V3FA 4NK8A 1QVUA 2BW3B 2E36A 3BDDA 4M9ZA 2LD5A 1XMXA 1ZG3A 3FY3A 2L9VA 2DDAA 5CQGA 4IL6C 4OMYA 1I1SA 5CVRA 2V7UA 1D0ZA 1ETXA 4MLOA 1E3XA 3A0HC 3LA7A 4HLYA 1Z9CA 2C2WA 1WOPA 1JGSA 1TL8A 2V7QA 1N08A 1GJRA 3RSNA 4DK1A 1JUMA 1W2BB 1IC8A 4EM0B 1FP2A 3S3OA 2WJVA 2V6CA 1UHSA 2Y75A 3PO3J 1T6YA 1R5HA 1XB4A 4DK0A 2HGCA 1SEUA 4G6QA 2VONA 1J09A 3O6BB 1MJBA 1KCDA 1Z7UA 3R6JA 1ZGJA 3I59B 3QOPA 4JX4A 5D8KB 2A6EF 1Y8QB 3OR2C 3AL0B 5FROA 3RZOJ 2QE7A 2OAZA 3WNBA 1KD1D 1ON1A 2XRNA 5FFXA 1FMVA 4YAOA 2Y2ZA 2M45A 1K8AD 1WH5A 1O7LA 2NVXJ 4YHBA 3OFNA 3OIQA 4OPSA 3K4NA 4ENNA 3ZQHA 1WU8A 4P6VF 4N9HA 2DFEA 4H9GA 1RWRA 2F4MB 4LBZA 1O7FA 1X58A 3J81Z 2ELJA 3PJRA 5EEAA 4ZYAA 1S3JA 2V4JC 1K9MD 4X7CA 4EGYA 2L9SA 4B3GA 1U0JA 5A88A 2JA2A 2L5QA 4OIQF 3NB2A 4IHYA 3CLQA 3CCVB 3LA2A 4B44A 5CLSA 3RKQA 4KKTA 3DDYA 2FQ4A 3FWEA 1FSHA 3K4JA 1FYLA 3BPXA 4CYDA 3GFLA 2A6TA 3PUFA 2Y0SN 2RC6A 1VQMB 4GDFA 4PC3A 4OOIA 4NHJA 1HA8A 1NJID 3E20A 3A03A 3BG7A 4M3DA 1YLOA 1JTYA 3T51B 2JZYA 1ZYRF 2DTZA 1B1BA 3AG3H 1BW5A 1SVMA 2COBA 3I64A 2R5YA 1H8HA 1XE1A 4BU2A 3S14J 2KISA 4I01A 2BGIA 1M1KD 2M8EA 5HOOA 4QTRA 3H35A 3KP7A 3R0AA 2F5EA 1H80A 1W7PD 2WAQN 4HPQA 4YC5A 1RPWA 2JVGA 3HAGA 3OEEA 1FX7A 5GTHC 1RUNA 1O3QA 1B23P 1QPMA 2FMYA 3GZ5A 2M7BA 3FBNB 1Z67A 4L5EA 5B1BH 4FCYA 1YG2A 1SVOA 2NSPA 1E79A 2ESNA 5IP7J 4Y3OA 1RIOH 1MBFA 2K86A 2XHKA 2CRVA 1IG7A 3BT9A 2EWNA 2EQRA 1XPXA 3CPWB 2NRAC 3HYIA 3GMEA 1EJ9A 3I55B 3GRHA 4U0YA 1YJNI 3CCLI 5LBQA 1UHMA 3B4NA 1HKQA 4CCMA 2OTJB 4UV9A 3DU5A 2O9LA 3SEQA 1N07A 3FISA 5HLIA 1TZLA 1U2RA 5TISC 3F8NA 3ZZTA 2D1HA 1WXRA 4UB6C 4A0YA 2C5BA 2Z99A 3DTEA 2ZBVA 1N25A 1O8DA 1NDHA 2EV6A 2WPDA 1NG7A 2XF7A 4E7HA 1YX5A 4ENKA 2XAJA 2UXNA 3CUQB 5THXA 2ZJQF 3MQ0A 3TO6A 3F72A 3CC7I 1DARA 2VT3A 3UKGA 4MYTA 4V2GA 1RZ4A 2UVEA 3BH6B 2ZSIB 4DZJA 3G71I 4DQ2A 2IGOA 2P6TA 1JJ8C 1B6AA 1K79A 3S17J 1DQUA 2JUGA 3ZUGA 1D0YA 3IH2A 1FMWA 1Y0YA 2F5DA 1TNSA 4UAJA 4A3CJ 3QODA 4V02C 4KKUA 4ITVA 1ZM2A 2FQ3A 4UZEA 4ZGQB 3SFZA 1MMGA 4WZKA 2XF5A 3GEZA 5E79C 1T2KA 2AQFA 3DKXA 5F04A 2XF6A 2PI0A 4X06A 3GTPJ 3AVTA 1OISA 5EMNA 3SYTA 2Z3YA 1BJAA 4X0CA 1MNDA 2OK7A 1XTAA 2H8WA 4H0EA 1UD4A 2DA6A 3JRHA 1O8KA 2VC1A 3QFSA 4RGUA 2LNBA 4KICA 1ZRDA 4I02A 1R4NB 4RLFA 2ZTGA 1PUEE 2E2JJ 5BNGA 1VQ9B 3S1QJ 1J75A 4X6AJ 3W2GA 2VC0A 1MJAA 1E62A 1BPLA 3BTJA 4AC9A 1WSUA 4DGWB 4HE5A 2W48A 3VNUA 2CW0F 1RUOA 2M7AA 1KJZA 4OM9A 3VSTA 4RPDA 2KP6A 2CF4A 1OLTA 3ZMUA 3ZZ0A 1MMAA 4KKSA 2GQFA 2L7FP 1FBUA 2K9NA 3M1CA 4KN4X 3SZTA 3VODA 4EJTA 1S4MA 1K4ZA 4YFOA 4RS8A 1U78A 1T08B 1XSDA 3PM1A 4Z2YA 5DS0A 2GXAA 3FXJA 2X4HA 2IJLA 4A0XA 5DUKA 2PECA 5JFRA 1R9TJ 2GAUA 1SMYF 3E6BA 3LFKA 1DBOA 1W7PA 1UHWA 3J7ZI 2Z1DA 3MWMA 1VQKB 2K4JA 1AMOA 1F1ZA 2XGCA 4C2MJ 2H09A 2E1RA 1OCPA 2JMWA 3OYNA 4ZTJA 2QYUA 2W85A 4B3AA 2BV3A 2OBRA 2GXGA 3FXMA 4LOCA 4BHCA 4B3XA 1O8LA 2E35A 1JHFA 2L7MP 1KRHA 1TSPA 2M5WA 3HTUA 2IT0A 3JAMZ 3A8KA 3W6JB 5FRMA 1W5TA 2P4WA 3GO5A 4J0QA 1E3ZA 4NQWA 3SEZA 3JRFA 2WAFA 1A6IA 2OV7A 3ZN1A 2HDWA 1EH7A 3S2HJ 1OKRA 3H0GJ 2DT5A 3GQAA 2ZBKA 3N90A 1DDNA 4LGWA 3HL2A 3HTSB 1QGZA 5HODA 3LFUA 3BTLA 3ABUA 3D1NI 3CC4B 1U5TB 1G3WA 3UNGC 5BS6A 4KT6A 2GIVA 2NNNA 1EA3A 3L1PA 3O3KA 3VYTB 4C3IJ 1WGXA 3DPTA 1S72I 5IYBJ 4BAYA 4JYKA 1TQIA 3VSKA 4M53A 1JJ6C 3D26A 4YZXA 1RKWA 1IJWC 1KQ9A 4G9YA 1PJRA 2PLFA 4HSTA 2QSFX 1H8AC 5E6TA 3I56I 2VBSA 1OGIA 2NOGA 2GXBA 1FOXA 2XC7A 2DXIA 1WDTA 4C0SA 2W00A 1TTYA 2O61A 3VNVA 2QKMB 2JN6A 2ZKZA 2WZNA 5H5JA 5E3OA 2QGGA 4P25A 2OC6A 1ORKA 3F8MA 1IV6A 2XGDA 3H94A 2Y0SA 1NK3P 2INVA 4NQWB 2YSRA 3DQVC 3EYYA 4BE1A 3KFWX 2HVQA 4IHSA 5HKKA 4O3MA 1R49A 2Q6KA 4W8QA 4YAWA 3DCFA 2QENA 3D5RC 3GWZA 2QX3A 1WPKA 2EFOA 3G3ZA 4OJ5A 1Z05A 4RCZA 5J1RA 4YAUA 1YX3A 1JJ2B 4G94A 1ZG5A 5J3OA 2DYRH 1B2RA 1KK3A 1WI9A 3OYGA 3ASOH 3FK7A 2NPFA 1TUIA 1CZFA 2HQNA 4F55A 4IHVA 1DDGA 4WCGA 2GREA 5E3LA 4MEYF 2XPVA 2A5WA 3DPLC 1PJ5A 2Q0OA 3OMYA 2BM6A 2R7OA 2QSGX 2K9MA 4BGDA 3F8BA 3OS1A 4P12A 2WY7Q 5B66C 3VFZA 1VQ5I 4BEHA 3CMAB 1GR1A 3VSUA 2VBWA 2ZXHA 2NS0A 3BZCA 3G1OA 3F8FA 1SFXA 3JRCA 1E17A 3AK5A 3IKTA 4G12A 2EV5A 4LMYA 1RQRA 1GAQA 2BHYA 3PSIA 2DK5A 2HZDA 1KU7A 4Y9RA 4RAFA 4AIJA 1FNNA 4OIOF 3OP1A 2JIZA 4YFNF 3KL9A 3OOPA 4UVCA 4O6JA 4AWXB 1L3LA 2WV0A 5FD6A 2ISZA 2W4SA 1ELOA 3MMYB 2ZMEA 2JN9A 4WZEA 1JKQC 3KX2A 3R4KA 1CQTA 3PA1A 2DYSH 2W6IA 1YIJB 2YU3A 1SAXA 1HF2A 2L02A 2XB0X 4P96A 3EUAA 1O3TA 3PVDA 4CZCA 1G7CA 2HVSA 1GVDA 3LSJA 2VBUA 4IOCF 1QZEA 3MKZA 2DLLA 5FD5A 5A8AA 2XDVA 2LC2A 1E1RA 3W2IA 3BOQA 5F27A 5LD2C 1VLYA 3CCRB 4ZDOA 3BC9A 5KW9A 2OCEA 5FLXZ 1BC7C 1J9ZA 4G6IA 4JK1X 1AU7A 5JHUA 3HOTA 2AS5F 5LRSA 5EDNA 1BQEA 5F1JA 1D1CA 3LO8A 4CCJA 4G1VA 3TP3A 3HPHA 1TQMA 4QPQA 4ZCMA 3ZQ7A 2M8GX 2R7WA 3M3YJ 1VBLA 3M07A 1NK2P 3BR3A 4XRMA 1QRCA 2M4GA 1YS7A 2KRFA 3CJNA 4UUSA 2GJRA 5JVGF 2VXDA 1J9IA 2F48A 2Q2EB 3ZPNA 5GPAA 2WY8Q 3CCMI 3WTZA 1NB0A 2NT6A 1K6YA 3LMWA 1MMDA 4BJ6C 1K7AA 2EILH 1EF4A 4L9JA 4Z4VA 2HYGD 4EM2A 2DMTA 2PMHA 1LUJB 3WGGA 1VTNC 1U8RA 2JA5J 1EFTA 1T33A 3BWGA 3SFIA 1TYWA 1P4AA 4OOXA 4I2OA 3F9KA 1XGMA 3I71A 4KJZA 3J80K 1XD7A 1GXQA 2DMNA 4QVAA 1ZQ3P 2GM4A 2ESHA 3PL8A 4IQJA 2LK2A 4P1VA 3PSSA 2FOWA 2A07F 2VLAA 4IX7A 1WJ5A 2H6BA 2R7DA 1N75A 3REOA 3MAJA 2EZHA 5HNFA 1I50J 2WWYA 1JXSA 5KSWB 2VNKA 3B82A 2A5YB 4P2NA 4TV7A 2GPJA 1HZEA 4HZFA 1LDKB 3BJ6A 1F4KA 3JRGA 3RY8A 4JRAC 1YS6A 2R7VA 2DU9A 1Z3YA 1X0CA 1Z6RA 4U49A 1KQ5A 3KEWA 3QP6A 3MEXA 2EK5A 4KFCA 2LF8A 1ZHFA 2BMWA 4M3FA 1T0FC 3HOVJ 3IWFA 2QQ8A 3RIRA 5E18F 1WQ2A 1ON2A 3WTSC 2G7UA 4KIFA 3OYBA 5DCMA 5F0HA 4MXNA 3WYAA 1Y1VJ 3TGNA 4BXUA 1TWFJ 2X6OA 2P81A 4D7NA 3D0SA 4NUBA 1YITI 1G4DA 2NTBA 4WXCA 1P7IA 5EGOB 5C4JJ 5D5VB 4LIVA 1EP1B 4IJAA 1OOCA 2KL4A 3ZQQA 3V8KA 4F52A 4QSHA 1OB0A 2CUZA 4MQ9F 2AQEA 3QWLA 1BOAA 1HOMA 2NVUB 4AIHA 1NRKA 2VNJA 3HUGA 4EATA 2FU4A 2LBFB 2VBVA 2XB5A 2CH0A 4KIGA 3K0LA 3TBIA 2XUBA 1P92A 5DM7F 2JA8J 1HQCA 3QFRA 3E3VA 1UG2A 1QA3A 1P6RA 2XAHA 3P27A 3TMOA 3I56B 3S16J 4MYUA 3MZHA 2FD5A 2M30A 4N9IA 1JA1A 2BGJA 2VBXA 3BZ6A 4KDPA 1WSVA 4G7WA 1X3UA 2NS7A 3OE7A 5EF6A 2QF7A 3CCJI 3P9KA 1G3YA 3F6VA 2ETHA 4YDTA 1KK1A 2NSTA 1MZBA 1K8FA 3BLYA 4ZZLA 4YFKF 4KN7X 5KVRA 5H20A 4AVPA 2YU9J 1GVJA 3CDHA 5HLGA 4BY1J 3EQOA 2VBMA 2H94A 3M8JA 1MH3A 1A35A 2KFDA 3OZWA 3Q0VA 3AVUA 4L9TA 2E71A 2BM1A 4RPBA 4OWRB 2YX7A 2V7WA 4M6YA 1Y0UA 2XRLA 4U7DA 2F2EA 3A3BA 2K85A 1YI2B 1IXCA 1M90D 2L01A 2O0VA 5KNLA 4ZYEA 3HBLA 3K4BA 4G6TB 1YFHA 3CUOA 3K2ZA 2R4GA 2CQXA 1MABA 2KJBA 4D1QA 4A3MJ 3J7AO 1IUYA 2A05A 3TDZC 2QM3A 4X05A 1B9NA 4M74A 2LG4A 2BY2A 1D8JA 1J5YA 1ZTRA 1QA1A 3GTGJ 1R00A 1U6GA 4A3GJ 1Y0RA 3QFTA 1TQPA 1FTZA 2YWGA 1ZLJA 4I0BA 4X1EA 3OYHA 3EETA 3Q3AA 4BDZA 2B0RA 2YWEA 3OW2B 2V7FA 4R8HA 1XGSA 1N77A 3H5AA 2I10A 2C5HA 3I9V2 1CGPA 4EJVA 4ESJA 3QE2A 2VT2A 4Q48A 4C2LA 4AVZA 2FJ1A 3BQJA 1JT0A 4PJLA 3M1EA 4FWTA 1LM1A 2EFNA 4LK0F 3TKYA 2CYYA 2W84A 1RI7A 4D7MA 4V2FA 5AONA 5EJCA 1MNMC 2V31A 2DQLA 5F64A 4G8XA 2W25A 4CCLA 1IN5A 3HB9A 3VWBA 4LLNA 3DU1X 1HXDA 2CQNA 3U6BA 1VI0A 2GWRA 2ZNYA 4PJMA 3RJPA 4AIKA 1RNLA 3BQYA 2DPDA 1FBSA 2DCUA 1VQKI 3Q0UA 2GJPA 2EPFA 2JUCA 1E2XA 4BACA 3NRVA 5A2QZ 3CLOA 3OKXA 1CLWA 2M3AA 4F92B 4XLPF 1ZK8A 3HC7A 4XOTA 3OYEA 3Q0WA 2HFHA 1H8EA 4NBQA 1MMSA 4E7LA 3MCZA 1V5FA 4DQLA 2Y9YA 5J47A 2VOPA 3OOUA 1LLZA 2V79A 3CB4A 3V7CA 3QFCA 2V1NA 1Z6TA 5E8GA 2PJPA 4CSWA 1IO2A 2DOEA 3B73A 1BW6A 1SFKA 4QVJA 2Z2SB 5GV8A 1JA0A 1W5SA 1G8XA 3ISPA 1VJSA 3OIPA 2L4AA 4FTHA 5TRDA 1KQSB 2JVHA 1GHCA 2OJED 2XOKA 3Q3SA 4IRGA 1G7TA 2FXAA 1KTWA 4II3A 1OGOX 2MA3A 4RB3C 1KTVA 1G59A 2WA0A 2EB7A 4ENJA 4OPVA 1USSA 1ZM3A 1IN4A 3K70C 2VBTA 3T0YA 1B72A 4QHYA 4B09A 1I3QJ 2R3SA 3BPVA 4A5MA 2YS9A 4N4OB 3V42A 2KZVA 3L2WA 1V5GA 2B0LA 2PYHA 1IGNA 3AGQA 5JR3A 1R36A 4X7DA 3LSTA 2NAZA 2YWHA 1JUPA 4XBFA 4QFMA 2KZGA 4BH9A 3CTAA 5C4XJ 3BCBA 1IDKA 2XTXA 4XRSA 3B6CA 2VQHA 2HTJA 3U1KA 1RC9A 3FMRA 2BHZA 4UVBA 4A3EJ 1LEBA 1PE9A 3ABLH 1IHMA 3LSKA 1X19A 1W0TA 2EFWA 2H1KA 1ZELA 3CCLB 2J8IA 2PIAA 3DXJF 4ZZDA 3ZC3A 3V7RA 4Z03A 3G71B 1VQ6B 1TVCA 4PUSA 4L0ZB 4C2UA 2MSYA 3DEWA 3Q6RA 3TP0A 9ANTA 2CQQA 1MIJA 1PVEA 3SY2A 2WV1A 3RYPA 4PC7A 4DZPA 5BOXA 4TMVA 3JX8A 2JTVA 1EKEA 4YELA 4I7HA 2WAQA 3W2WA 3ASSA 4M73A 3V76A 2DA7A 1W4MA 2C77A 3CMAI 2VE9A 3E0JB 3KP6A 3ML6A 2LY2A 1YOVB 2QBYA 2PG4A 1QX4A 2HCJB 2QGUA 4IHTA 4ESBA 2KDOA 3BG5A 2F5CA 2DPUA 1WOSA 2O17A 2MC3A 2L2OA 2K40A 3VB2A 3W2VA 1GAWA 2HMAA 3WY9A 4QUZA 3QOEA 2XAQA 5CQEA 4Z4ZA 2Y48A 2EBIA 1VQ4B 4PSWA 4N3GA 2P7VB 4BXFA 4TKOB 3Q5FA 3ML3A 2O1DA 4X7FA 3WU0A 3GF2A 3CMYA 4QV2A 1QZYA 5L46A 1QQ1A 1S9HA 2VODA 3ASTA 4Q7JB 2XAGA 4RGRA 5EYRA 1W1WE 1DPRA 2X1CA 3HSRA 3KEYA 2HS5A 4HV5A 3ROUA 5M3MJ 1BIBA 2RKHA 2NVQJ 2PX9A 3WTVC 3VO1A 4C3JJ 1SD5A 2LVSA 1K83J 2HQ5A 3GFIA 2GJKA 2ZNZA 3DPUA 3F21A 3BH4A 2ODLA 2V5IA 3P4GA 3Q6QA 2KMUA 5TJJA 4OOVA 2PMZN 4CHUA 2VNHA 4S05A 3ZMVA 4ZC3A 3S1MJ 4EM1A 2XPWA 4LITA 4PJJA 3P5JA 2DI3A 1Y0NA 4Q5SF 3ZP5A 2EWEA 2YPRA 1ZGWA 2E7WA 1AKHA 2RDPA 4WXDA 2JRMA 3DBHB
chains in the Genus database with same CATH topology
2Z1DA 1DBGA 1UD2A 3FHNA 4C2TA 2BVMA 3CMMA 2K9LA 1D1AA 2X3HA 3OYNA 4ZTJA 1X4OA 2X53S 2VBEA 4XL9A 3K6GA 2UV1A 4BJTA 2F4IA 3AKZA 3L2UA 2WADA 2X6XA 4B3XA 4H4KC 2MYSA 3JU4A 1V0EA 1O8LA 2XSJC 3LL7A 4PFPA 3OOCA 1MNEA 3PNVA 1K28D 2ZZGA 2Z6BD 2ZZFA 3B8YA 5FRMA 1QCXA 4HRIA 3H5RA 4XMYA 1E3ZA 4XQFA 3SEZA 4GQNA 2WAFA 3OWTA 2OV7A 4HSRA 1WFXA 2HDWA 1UD3A 2ZZQA 2PJRA 4BDYA 1BMFA 2ZZEA 3G2BA 4B43A 1WJCA 3HG9A 3GQAA 3HL2A 4KISA 2E1BA 3C2HA 3LFUA 3VYUB 1UG0A 2ZFUA 3UNGC 2LZJA 3OYDA 2NT9A 4KT6A 1EFRA 1OGMX 1EA3A 3VYTB 4E0FA 3DPTA 4YZQA 2K5CA 1X1BA 3CP2A 4DOZA 2PJRB 3L2VA 1X4PA 4HNTA 3DTIA 3VSKA 2LBFA 4YZXA 1PLUA 1Y6IA 2ZTNA 1PJRA 4YEJA 2X6WA 4HSTA 4HNUA 1SKYB 3OYJA 4EW9A 3HPGA 3UR3C 4ZTFA 3B90A 2XC7A 3S3MA 3LSIA 2MABA 2DXIA 1XG2A 2W00A 2RQQA 3S8PA 3C2GA 1BN8A 2QKMB 2HVRA 3D5LA 3OYCA 2VJ4A 3OYLA 1E1QA 2OC6A 3WQZA 4XORA 1DP3A 3AFHA 3H94A 4JOMA 3K10A 2Y0SA 2ZXIA 2INVA 4CCOA 4OJOA 4NQWB 2BOLA 1PKVA 3DQVC 2IQ7A 2QKLB 4BE1A 1O8HA 2HVQA 2MFZA 4B48A 5HKKA 5AMVA 2KVOA 4D9JA 2VPLA 4W8QA 4DNRB 3RQ4A 3D5RC 3LSMA 2IGKA 2QX3A 4F3QA 4Y33A 4OJ5A 3OYFA 1YX3A 1KMHA 2V9KA 2CW8A 1WP6A 3HXLA 4C9YA 1WJAA 3H9JA 1YE9A 3OYGA 3S93A 3S3NA 2JDIA 4CA0A 2L9NA 4XLHA 4XONA 4F55A 1CZFA 2QXZA 2W7NA 4YZ0A 2X85A 3QYBA 1X1AA 1O8EA 2VJIA 4CCNA 2A5WA 3DPLC 4PSXA 2F6CA 3OEHA 3QYFA 2L7KA 2X6YA 4YXWA 1LKXA 3OMYA 2R7OA 3VYRB 2K9MA 4BGDA 1WJEA 4N4NB 3OS1A 4E7KA 2WY7Q 4BEHA 3DWLE 1V0FA 2GK7A 3A35A 3VSUA 4E7JA 2ZXHA 4ASUA 1QHGA 1IRXA 1OR7C 5HLTA 2O0WA 3DU6A 2LH9A 2IGNA 3NE5B 3A1YA 3GVKA 1Z7LA 3PSIA 3HUGB 1MW7A 2KQRA 4AU7A 3EUHC 3ZIAA 2HZDA 4XN0A 4PK4A 4RMNA 3GQ7A 1NG6A 2HQAA 2JIZA 1ERDA 2VQLA 2W4SA 3MMYB 3GQ9A 1X1CA 3KX2A 2W6IA 2WB1A 1LVKA 2VASA 1WJFA 2X8KA 3RCOA 3ONQA 2WSSA 1O8MA 3EPZA 1OHHA 2CUJA 3EUAA 1UELB 4E7ZA 4CZCA 3FDYA 1OFMA 2HVSA 4FASD 1QJVA 3IUOA 5C1EA 3MKZA 2QY1A 3H0DA 4FETA 2XDVA 2LC2A 1T95A 1E1RA 5LD2C 3S32A 1VLYA 2KHMA 2XZPA 4ZDOA 2CV0A 3BC9A 2R7SA 4JQFA 3PUBA 3KYLA 4G6IA 1K5CA 2XNDA 3HOTA 2R7RA 2FUG2 4DBRA 4OJPA 1D1CA 3OW7A 4CCJA 3IP4B 3HPHA 4QPQA 3ZXSA 4J00A 2R7WA 2Z16A 1VBLA 1KZLA 1NBMA 1TT0A 4U87A 1GLNA 4NC7A 2X1DA 1RU4A 2M4GA 1W0JA 5DN6A 2F43A 4I84A 2GJRA 2VXDA 2PMZA 3OL3A 2IS6A 2Q2EB 3ZPNA 2W1OA 2WY8Q 4L8JA 4NK6A 1BR1A 3PSFA 3AL0C 2VL8A 1K6YA 3PFYA 2NT6A 4HWVA 4CH7A 3BCDA 4OAYA 1MMDA 3SDBA 4BJ6C 1EE6A 3LMWA 2HU9A 4UZUA 4W8SA 2DIEA 4P22A 3OYAA 2KRHA 4XKVA 3F9KA 2KLOA 4KJZA 4XR6A 3WWGA 2DJIA 4XKBA 2LRDA 4IQJA 3H5NA 3PL8A 2DT6A 2R7UA 1DGWY 2UUZA 2VLAA 1SAUA 4QPOA 4IX7A 1WJ5A 2XAUA 3LSHA 3VSVA 4Z05A 3BG6A 1N75A 4LG3A 2VIXA 4BE0A 2NTQA 4MR0A 2NTPA 2CFOA 5HNFA 1Z3XA 2BVLA 2CMPA 4XOPA 3OY9A 3RTRA 4XN3A 3OS2A 1HZEA 1LDKB 1BR4A 2R7VA 3U21A 3A2KA 1N78A 2R7QA 3NWSA 4RLQA 3D5SC 2R9VA 3JURA 3GVLA 1Z3YA 1JI8A 1X0CA 4U49A 4XNFA 1X1DA 3KEWA 4OZZA 4FXUA 3W3CA 4F91B 1T0FC 1VZ0A 3CJQB 4XKWA 2X51A 3N05A 3OYBA 3K70D 3MKYB 4MXNA 2GOXB 2VJ5A 3ZSCA 4HG2A 4KITB 4C30A 3HOSA 2BW3A 4HIZA 4NUBA 4HEA2 2XZOA 3ZRGA 2WZPP 2NTBA 4LIVA 4RM3A 1UD5A 1OOCA 2KL4A 2ZSHB 3ZQQA 4J01A 4GRIA 3CF2A 4F52A 3J7AY 1OB0A 1BHEA 1PXZA 2BSPA 2CUZA 1Y56A 1IDJA 1IA5A 2AQEA 1NRKA 4XLEA 1WMRA 2GOMA 2UVFA 3FKJA 4EATA 2LBFB 2V7QA 2KRCA 2CK3A 3TL4X 2K3PA 3ZCOA 1BLIA 2CH0A 4XLFA 2VBKA 2OUMA 5IK2A 3TBIA 2P0WA 2R7XA 4F93B 3H9QA 4XKCA 3TMOA 1WJDA 4ANJA 4CUGA 3RPUD 4B3FX 4BL0B 5JHFA 4DBQA 2UWMA 1WTHD 2E1MC 4RM2A 4G7WA 2XZLA 3OE7A 2I8DA 4Y4RA 3GBGA 3CP8A 1WJBA 4CCKA 2V4DA 1O8GA 2GK6A 4DJAA 2WAEA 3A4CA 2IXSA 2NSTA 2E60A 3BLYA 2LREA 3CESA 2VB6A 4BEHB 4BQOA 4R79A 4E6KG 5FL7A 4NK8A 3EQOA 2VBMA 3M8JA 2BW3B 3OYKA 4ZJZA 4OJ6A 3FY3A 4XLCA 5CQGA 2M5SA 3MD2A 1D0ZA 4IKFA 4MLOA 4NC8A 4OWRB 3MKWB 1E3XA 1JRGA 4BQNA 4OAZA 4YZAA 3LSGA 3A3BA 2O04A 5FRNA 3RSNA 4DK1A 2O0VA 5KNLA 3K4BA 4G6TB 4LIUA 4TSFA 2LY1A 2W82A 3S3OA 2O5RA 2R4GA 3CZ6A 2WJVA 4PMHA 3CJRB 3H9GA 3DKYA 3OAAA 4DK0A 1P9QC 1KCDA 4D1QA 1J09A 1Z21A 4BE2A 2VKDA 1UD6A 2LG4A 2CW7A 3AL0B 3OR2C 1V5EA 5FROA 2WBMA 1DGRM 2QE7A 2IGMA 2RREA 3KRGA 1QHHD 1O8JA 1FMVA 2Z8GA 3OYHA 3ZR8X 5KCMA 2IS1A 3K4MA 4BDZA 2MC4A 1MMNA 2V7FA 5KHDA 3OFNA 1N77A 3OIQA 3H5AA 2E5ZA 3I9V2 3K4NA 3FBIB 4TT3A 4C2LA 4AVZA 1UD8A 1RWRA 1KCCA 4PJLA 2HPIA 2F5VA 2ELJA 3PNTA 2V31A 1IB4A 3OS0A 3PJRA 1VF7A 1NHCA 4ZYAA 4II2A 3ZPPA 2V4JC 4CCLA 4JMQA 3VWBA 2M4KA 2L9SA 4B3GA 1U0JA 2JA2A 3SZGA 2L5QA 3OPOA 4PJMA 5CPRB 3T56B 4B44A 3BCFA 2VXZA 4KKTA 2GJPA 1LFPA 4IZZA 3DDYA 4BACA 2F1MA 5CDFA 3K4JA 3G05A 2M3AA 4F92B 1HVXA 2A6TA 3HC7A 4XOTA 3OYEA 2D3LA 1H8EA 4G7XA 3PNYA 5TGTA 4E4HA 2V26A 1HA8A 4OZYA 4E7LA 4URRA 3BG7A 3OL4A 3T51B 1V5FA 3HKZA 3OOUA 3ZGKA 1BOBA 2DCEA 1W36D 1H8HA 4BU2A 2XGJA 3EUKL 2VKHA 1AA7A 2V1NA 2VQCA 5HOOA 4U7BA 3GVJA 2Q1ZB 1COWA 3H35A 4CSWA 3GQBA 1SFKA 2Z2SB 1PYVA 1H80A 4Z06A 1W36C 4HPQA 2JVGA 1VJSA 1G8XA 3E1SA 3HAGA 3OEEA 4BUPA 3OIPA 4DNTB 4YRVA 4W8TA 1FX0A 1T5EA 2JVHA 2R7TA 3LMMA 2M7BA 3FBNB 2XOKA 4ZDLA 4P5OA 2JJ2A 4Z1MA 1KTWA 4II3A 1OGOX 5C1CA 4BJ5C 1G59A 2NSPA 2WA0A 1E79A 3DEEA 1JTAA 4XM3A 5LFAA 3SUCA 4U4BA 1OFLA 3L2QA 4Y3OA 3K70C 1HG8A 1O8FA 2MD0A 1I8DA 2KPMA 5HVQC 1GQ8A 2E5NA 2DOAA 4N4OB 3V42A 3OYIA 2KZVA 3L2WA 3GRHA 1V5GA 2VJJA 3VSLA 2PYHA 3B4NA 2E1MB 4CCMA 1I18A 3DU5A 2CV1A 3SEQA 1TZLA 4B47A 3VMWA 3UW0A 3DTEA 3OYMA 3BCBA 2VQGA 1RMGA 1IDKA 2HLDA 1MABA 2VQHA 1O8DA 2NZMA 3VYSB 2W6JA 2WPDA 1PE9A 1NG7A 2XF7A 2IS2A 4E7HA 1YX5A 3LSKA 1X19A 2HNHA 1ZELA 4Z03A 3EQNA 3A3GA 1UAAA 4AYBA 3DTKA 4PUSA 4C2UA 2UVEA 2ZSIB 2JJ1A 1O8IA 2NOJB 4OJLA 2IGOA 1BR2A 3IAS2 4YELA 2WAQA 3W2WA 2INUA 4W8RA 5HNHA 3FPPA 1DQUA 2HPMA 2JUGA 4E7SA 3E0JB 4BQQA 1E43A 2LY2A 1D0YA 2WJYA 1FMWA 2JSPA 4XLAA 1WPCA 3QODA 3BC8A 4KKUA 4ITVA 1AIRA 2KDOA 1MMGA 2O17A 1W0KA 2XF5A 4PJNA 2AQFA 2L2OA 3W2AA 3DKXA 3T9GA 2XF6A 4X0GA 4E7IA 2X1EA 3LNNA 3W2VA 3SYTA 2PYGA 1MNDA 4ZDPA 1R6RA 2CS3A 3QOEA 5CQEA 1UD4A 2RNGA 1O8KA 2LYCA 4PSWA 4RLFA 2ZTGA 4BXFA 4TKOB 1O88A 2O1DA 3VMVA 3BCAA 3VDXA 2CV2A 2IS4A 3FKSA 4PFOA 1S9HA 3K4KA 1BPLA 1D0XA 2LOOA 5CKTA 2X1CA 4DGWB 3KEYA 2M7AA 3VSTA 1D1BA 4NNJA 2KP6A 3T53B 1OLTA 3GQ8A 4DIQA 1MMAA 3DPUA 3OR1C 1E0EA 2D3NA 1QU3A 2GJKA 3BH4A 4KKSA 2ODLA 3K4LA 3NWTA 2KMUA 3M1CA 3L2RA 2M0MA 3QYEA 4P1WA 4ZC3A 1KONA 4LITA 3I3LA 4PJJA 1W9XA 4BS9A 2V6EA 3K4CA 2PECA 2EWEA 3VR6A 4IQ4A 2DT7B 4XD7A 3IAM2 3DLAA 1DBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  1DBG A;  4XLF A;  2VBK A;  4W8T A;  3GQ9 A;  2X3H A;  2VBE A;  4XL9 A;  4Z06 A;  1KTW A;  1OGO X;  5C1C A;  1O8M A;  2NSP A;  2X6X A;  1JTA A;  1OFM A;  1O8L A;  4XM3 A;  1QJV A;  3SUC A;  4U4B A;  1OFL A;  1HG8 A;  5C1E A;  1O8F A;  2QY1 A;  3B8Y A;  1QCX A;  1GQ8 A;  4XMY A;  3GRH A;  4XQF A;  2VJJ A;  2PYH A;  1O8G A;  3B4N A;  1K5C A;  2NST A;  3GQA A;  3VMW A;  4NK8 A;  4OJP A;  3UW0 A;  3EQO A;  2VBM A;  4OJ6 A;  1RMG A;  1IDK A;  3FY3 A;  4XLC A;  1O8D A;  2NZM A;  1DBO A;  1VBL A;  2NT9 A;  1PE9 A;  1OGM X;  1JRG A;  1RU4 A;  4YZA A;  4YZQ A;  2O04 A;  4Z03 A;  2O0V A;  3EQN A;  4I84 A;  4PMH A;  4YZX A;  1PLU A;  4NK6 A;  2UVE A;  4YEJ A;  2X6W A;  2NT6 A;  4HWV A;  1O8I A;  1KCD A;  4OJL A;  4EW9 A;  3B90 A;  3LMW A;  1EE6 A;  4YEL A;  1XG2 A;  4W8R A;  1BN8 A;  2INU A;  4W8S A;  2UVF A;  3KRG A;  4XKV A;  1O8J A;  4XR6 A;  3WWG A;  4XLA A;  2Z8G A;  4XOR A;  1AIR A;  2INV A;  4OJO A;  2O17 A;  3T9G A;  3VSV A;  4Z05 A;  2IQ7 A;  1O8H A;  2NTQ A;  4MR0 A;  2NTP A;  5AMV A;  2PYG A;  4W8Q A;  4AVZ A;  4C2L A;  4XOP A;  1RWR A;  1O8K A;  2QX3 A;  4OJ5 A;  1KCC A;  4XN3 A;  1O88 A;  3JUR A;  1IB4 A;  2O1D A;  3VMV A;  1NHC A;  3ZPP A;  1X0C A;  4U49 A;  4XNF A;  4XLH A;  4XON A;  1CZF A;  2QXZ A;  4OZZ A;  4YZ0 A;  2X85 A;  1O8E A;  3VST A;  2VJI A;  4XKW A;  3GQ8 A;  2X6Y A;  2ODL A;  4MXN A;  4XOT A;  3ZSC A;  3VSU A;  4OZY A;  4URR A;  2NTB A;  1OOC A;  2O0W A;  1PXZ A;  1BHE A;  2PEC A;  2BSP A;  2EWE A;  1IDJ A;  1IA5 A;  4XLE A;  1WMR A;  4XN0 A;  1H80 A; 
#chains in the Genus database with same CATH topology
 1D5Y A;  4RLZ A;  2DDB A;  3X2Q H;  1A31 A;  1UD2 A;  3IHU A;  3BRO A;  3FHN A;  2PEX A;  2BVM A;  3CMM A;  4FE7 A;  3DEU A;  4PCQ A;  5GTI C;  1BA5 A;  4BJT A;  2F4I A;  4OU0 A;  1VQ7 I;  2IA0 A;  4RAZ A;  4P3I A;  2BX6 A;  3PSZ A;  4H4K C;  5DYM A;  2MYS A;  3V7A A;  3LL7 A;  4PFP A;  2AXL A;  5J6X A;  3TED A;  3NAW A;  1MNE A;  1U2W A;  3A01 A;  2XPU A;  2F1L A;  2ZZG A;  1K73 D;  2EFG A;  3L2C A;  2Z6B D;  2ZZF A;  1EH6 A;  3B8Y A;  1FRN A;  4HRI A;  3BG3 A;  1T38 A;  2HXO A;  1T56 A;  1WFX A;  2ZZE A;  2ZZQ A;  4BDY A;  2DA5 A;  3KZZ A;  1BMF A;  3G2B A;  1QNT A;  4JX5 A;  3HG9 A;  2Q2E A;  3JRA A;  1VQ7 B;  4KMU X;  1UG0 A;  1IXR C;  1XCV A;  4MIM A;  1KU9 A;  3GZ6 A;  1QZZ A;  5F4O A;  1U8B A;  1P7J A;  4E0F A;  3JTG A;  2DMU A;  1B59 A;  3MZ8 A;  2PJR B;  1QQI A;  2KIU A;  3I1F A;  4HNT A;  4XK4 A;  3F6O A;  3AVY A;  4BHB A;  3HM5 A;  3U1D A;  5GAH J;  3OSG A;  2BY1 A;  1PLU A;  1Y6I A;  2G7H A;  3TW6 A;  1UMQ A;  1YI2 I;  3OYJ A;  4P6Y A;  3HPG A;  4ZTF A;  2D5V A;  3S8P A;  2IW5 A;  5EG0 B;  4ABZ A;  1GXP A;  1EWY A;  3S2W A;  2CW5 A;  2LDU A;  3CCS B;  3CD6 I;  5BSY A;  4MQV A;  4J19 A;  4M9X A;  4OIR F;  3R6S A;  3AAF A;  3AFH A;  3E5X A;  2OF7 A;  4MHG A;  2MBF A;  4JOM A;  1FOK A;  1CNE A;  2ZXI A;  3TOB A;  2OZU A;  4CCO A;  2GLO A;  2BOL A;  4RGX A;  3ES9 A;  2RV8 A;  4HYE A;  2F3L A;  2QKL B;  1O8H A;  1IUF A;  5ICC A;  4UV8 A;  2X48 A;  4B48 A;  2KVO A;  4MTD A;  1S72 B;  4CQJ A;  1CNF A;  3TDU C;  1QUE A;  1QVT A;  3RQ4 A;  2V1X A;  2IGK A;  3JQQ A;  5CVU A;  1JNY A;  3OYF A;  1O3S A;  2XIG A;  3ABT A;  1KMH A;  2KT0 A;  4KMF A;  3H9J A;  3S93 A;  2OQR A;  2LLK A;  4CA0 A;  4XON A;  2R5Z B;  2COM A;  1K4T A;  5DM6 F;  4HX8 A;  2K4B A;  2W7N A;  3QSY A;  1TW3 A;  3E5U A;  1TBX A;  4AD9 A;  1BX1 A;  4YZ0 A;  4BQA A;  2VJI A;  5ERI A;  1R1U A;  2IBD A;  4CCN A;  5D6E A;  2F6C A;  1LEA A;  3DBR B;  2NVT J;  4NBS A;  1R23 A;  4YXW A;  3VYR B;  4N4N B;  4M3B A;  5J8C A;  1YW7 A;  1NTC A;  4P9S A;  2GK7 A;  3FF5 A;  1V0F A;  1FIP A;  1V5V A;  3HJE A;  4DYC A;  1FNM A;  1IRX A;  2A3S A;  5HS7 A;  3JSP A;  1IAW A;  2O0W A;  5J1U A;  3W6K B;  5D5U B;  5E3N A;  1LB2 A;  5LGT A;  3BJO A;  2Q8K A;  3NE5 B;  2OCC H;  2Z9O A;  1PDN C;  4A3K J;  1TP4 A;  4WXH A;  2Y9Z A;  3G1L A;  2HQA A;  2OPT A;  1ERD A;  4GYI A;  3ASP A;  4RD6 A;  5FJ8 J;  1N0U A;  2ZIT A;  3WG7 H;  5K7F A;  1D1N A;  5LGU A;  4RB0 A;  2X8K A;  3WG9 A;  3RCO A;  2WSS A;  3EPZ A;  3I4P A;  5D5W B;  3FXL A;  1OHH A;  1UEL B;  1OFM A;  1ZAR A;  3FDY A;  1R1V A;  4FAS D;  3VO2 A;  1P4M A;  4X07 A;  5C1E A;  3L7W A;  2DO7 A;  5DSZ A;  2DA1 A;  2XAF A;  3H0D A;  4I6Z A;  2EV0 A;  2R93 J;  3LJY A;  4HX7 A;  5IYN A;  1QA2 A;  2KHM A;  1YHQ B;  3BTI A;  2BPO A;  3ERM A;  5M3F J;  1OB5 A;  1AKH B;  2QEX I;  4ZGN B;  4GGG A;  1SFU A;  1VQ8 B;  1S7A A;  2TDX A;  4A6E A;  2V7X A;  4DBR A;  2P3M A;  4RDL A;  3HDD A;  2FE3 A;  3R0J A;  2R6H A;  4J00 A;  3MHP A;  3GTQ J;  1KZL A;  1VHO A;  5JVT A;  4PC1 A;  4BHP A;  1PP7 U;  2X1D A;  1T39 A;  4LFU A;  5TY0 A;  1QVF B;  3ABK H;  5IYW A;  3A01 B;  5M5W J;  3J7Y J;  5FO0 A;  1VQP B;  2E1O A;  1YLF A;  5DTD A;  3H9N A;  1ZR2 A;  3PET A;  2RGV A;  2HKO A;  1MRZ A;  1HF0 A;  2HOT A;  2HR3 A;  3PFY A;  1ETO A;  2CSO A;  3LAP A;  4CH7 A;  4XRS G;  4OAY A;  2IRF G;  3V7S A;  1UMK A;  3CW2 A;  1YIJ I;  4W8S A;  3K1N A;  3OZV A;  1RKT A;  3G4S B;  5EEG A;  3WGH A;  3N4M A;  3L09 A;  2E7X A;  3WWG A;  4XR6 A;  3F8C A;  2K3F A;  4XKB A;  2OTL B;  2D45 A;  5IT9 K;  2LTP A;  3H5N A;  3BQZ A;  3LAJ A;  3DLL F;  2M9H A;  1B9M A;  2HI3 A;  4V19 K;  2UUZ A;  1I6H J;  3VEP A;  5K7Z A;  1O3R A;  2R7U A;  2QEX B;  4QPO A;  2XAU A;  2QZA A;  5F0F A;  3N6Z A;  3BG6 A;  3Q9S A;  4LG3 A;  5LEJ A;  2EIM H;  4UUV A;  2QMU A;  4HNV A;  2CMP A;  1K61 A;  3BY1 A;  1Q1V A;  2K9Q A;  3IWZ A;  2QBY B;  2FX3 A;  4XN3 A;  2KKO A;  2KIM A;  3BR0 A;  3S2D J;  3DP7 A;  2L54 A;  3U21 A;  1XCB A;  1Y8R B;  3NWS A;  4RLQ A;  4DYR A;  5FKM A;  3GVL A;  3ZBU A;  3JCU C;  1X1D A;  4Q47 A;  1H0M A;  3ZBT A;  2QA4 I;  1NH3 A;  2ZXW H;  1XN7 A;  3JW4 A;  2KJC A;  4P9F A;  3K1P A;  3T5X A;  1XDS A;  3IKV A;  2ECC A;  4AM3 A;  3K70 D;  5B1A H;  3MKY B;  4ZV4 A;  2L3D A;  1FBQ A;  1WCM J;  5DCM B;  4HG2 A;  4C30 A;  2O6W A;  4S0H B;  3T8R A;  5B3S H;  3K7A J;  3CDL A;  5KAF C;  4HIZ A;  3HOU J;  4B8X A;  1G2H A;  1P4X A;  2CQ7 A;  4RM3 A;  3T8T A;  3NQO A;  4GRI A;  3CO6 C;  1PXZ A;  3J7A Y;  3RI4 A;  4KYW A;  3SHF A;  2QTL A;  2UVF A;  3KPH A;  3FKJ A;  1VQO B;  2HQR A;  1FT9 A;  1JKR C;  1BC8 C;  2L4M A;  3ZCO A;  4CGZ A;  1D3Y A;  1JHH A;  2A68 F;  3IH3 A;  1BLI A;  2VBK A;  2VFQ A;  5IK2 A;  4ZYG A;  5FLM J;  2DY1 A;  2O3F A;  5HDK A;  2R0Q C;  2XNJ A;  1KQ8 A;  2EZI A;  1YRN A;  3GSI A;  3H9Q A;  2HZT A;  5E20 A;  3K69 A;  3TW7 A;  4ANJ A;  2ID6 A;  2FBH A;  4B3F X;  4A93 J;  3PA2 A;  4AC0 A;  2DK8 A;  1VFC A;  2E1M C;  4LC0 A;  1H88 C;  1QPI A;  3P9C A;  2DOF A;  2VPR A;  3BR6 A;  3CP8 A;  2BSA A;  4ZH4 F;  3ASR A;  3CCV I;  1Q81 D;  4DJA A;  1HLV A;  3A0B C;  1BI2 A;  2WAE A;  4FHT A;  3QU6 A;  4KA4 A;  4EH1 A;  2LRE A;  1OQY A;  4WQM A;  1D8T A;  5FL7 A;  1JGG A;  1RET A;  3J80 Z;  4A69 C;  3JQR A;  4XLC A;  1HC8 A;  3CD6 B;  5HS8 A;  5F4M A;  2PMU A;  2G9W A;  3MKW B;  2XGE A;  2ZXJ A;  1MDM A;  4BQN A;  4OAZ A;  1JRG A;  1R5N A;  4YZA A;  1EXM A;  3LSG A;  4YEI A;  4M2L A;  3GTO J;  5FRN A;  2O04 A;  4L5J A;  4LIU A;  3LSP A;  1XFO A;  1U9N A;  3CCY A;  3RKY A;  2LY1 A;  5CVI A;  2O5R A;  3CZ6 A;  1MD0 A;  3CJR B;  3H9G A;  3DKY A;  1P9Q C;  3B6A A;  3G73 A;  1R58 A;  3I59 A;  4BE2 A;  2JJ7 A;  2VKD A;  4L18 B;  5JBQ A;  3W2H A;  1DAB A;  2Z33 A;  1KYW A;  3ONY A;  5H6Q A;  2CW7 A;  3LQQ A;  4S04 A;  1SFO J;  1OR7 A;  1V5E A;  2BV6 A;  2WBM A;  1DGR M;  3EQL F;  5ILS A;  3SXY A;  1ZRC A;  2IGM A;  2LMD A;  2RRE A;  2JA7 J;  1W35 A;  4UUT A;  2X9D A;  4YAF A;  3AG1 H;  3ERE D;  2OU2 A;  4IHX A;  4IOA F;  4RD4 A;  5KCM A;  3K4M A;  5DEQ A;  3V8J A;  2MC4 A;  1MJ9 A;  2Q6I A;  2GQQ A;  1FDR A;  5FLX K;  4UY8 I;  2OBT A;  3HHG A;  2E5Z A;  2HWV A;  3F3X A;  3WHB A;  1V55 H;  1BM9 A;  2OZ6 A;  1PJ6 A;  4TT3 A;  3QAH A;  1IN8 A;  4F7D A;  2BM7 A;  3U9G A;  1UD8 A;  1EA0 A;  1KCC A;  2DYI A;  1IF1 A;  4KH3 A;  3KYC B;  1IB4 A;  3BTC A;  4G7O F;  3OS0 A;  1VF7 A;  2QZ8 A;  3DBL B;  4II2 A;  2FF4 A;  3FXO A;  4U9U A;  3QRF F;  4JMQ A;  2DOD A;  4UHT A;  1G3T A;  3ZMS A;  4YIR X;  3SZG A;  4BBS J;  2FBK A;  3OPO A;  2PQ8 A;  2JK3 A;  4Y17 A;  1KZH A;  3T56 B;  2R7F A;  2VXZ A;  4Z4U A;  1HST A;  1LQ1 A;  2RQP A;  4IZZ A;  3SLD A;  1GV2 A;  5CDF A;  3OSF A;  1HVX A;  3JRB A;  2DER A;  2AXT C;  1OFE A;  2D3L A;  1GT0 C;  1EFU A;  5DDG A;  3PNY A;  5TGT A;  3I0T A;  3IRR A;  3ECH A;  4E4H A;  1G7S A;  3OL4 A;  3WXM A;  1Z0X A;  3RDI A;  1KK0 A;  3JTH A;  3B8H A;  2ME0 A;  3HKZ A;  4AYB N;  1BOB A;  2DCE A;  1W36 D;  2XGJ A;  4AID A;  1AA7 A;  3CO7 C;  2XKO A;  3IH4 A;  2Q1Z B;  3PFI A;  4U7B A;  3G6E B;  2N8G A;  2Y0M A;  5CJ9 A;  2DFH A;  3GQB A;  3PUN A;  1Q9S A;  1PYV A;  3CC2 B;  4Z06 A;  1W36 C;  3WBK A;  3E1S A;  1R5B A;  1TWG J;  1WHU A;  4YRV A;  4W8T A;  1FX0 A;  1T5E A;  1Y1W J;  2DN0 A;  2XVC A;  3DFG A;  3LMM A;  2DBB A;  2VE8 A;  3MFK A;  4P5O A;  1HCR A;  2JJ2 A;  1OPC A;  2CQK A;  3KIO A;  1K6O A;  4IRI A;  3HZJ A;  4BJ5 C;  4Q4Z F;  1LDD A;  5GAD J;  4XM3 A;  4ON0 A;  1ZM9 A;  5A89 A;  3SUC A;  3L2Q A;  1BI0 A;  1HG8 A;  1O8F A;  2MD0 A;  5CVJ A;  1K4S A;  5HDN A;  2BGC A;  1I8D A;  1IB0 A;  5HVQ C;  1VQ6 I;  1GQ8 A;  4FT8 A;  2E5N A;  2DOA A;  4PJ0 C;  5H6R A;  3OYI A;  2MD5 A;  4WWV A;  2OD5 A;  4R71 A;  2JA6 J;  1D5V A;  1VQN B;  5K5R A;  2E1M B;  3GCM A;  4UB8 C;  4I09 A;  3HGY A;  4I99 C;  2EA4 A;  1FNB A;  3A8J A;  2ZBU A;  4HQM A;  4HX4 A;  4B47 A;  4Z4W A;  1OB2 A;  3UW0 A;  2FX0 A;  4RDU A;  1RMG A;  2VQG A;  4ZYD A;  2HLD A;  5EGO A;  2NZM A;  1IXS B;  3VYS B;  2O03 A;  4PAA A;  3GX4 X;  5IYD J;  2EIK H;  1HW1 A;  2HNH A;  5IOZ A;  1N8R D;  3P9I A;  2WB1 N;  5L3F A;  2J7K A;  2V7T A;  1XSV A;  3FX3 A;  4HDU A;  2C4U A;  3A3G A;  3OJW A;  3FMS A;  1YJW I;  4UNO A;  3DTK A;  1ENH A;  1G7R A;  5CVV A;  1QRB A;  4EJW A;  2CC2 A;  4CYC A;  3PO2 J;  1KQ0 A;  5K5O A;  1O8I A;  2BY0 A;  2NOJ B;  4OJL A;  5H2F C;  1BR2 A;  4IEJ A;  4W8R A;  2INU A;  5HNH A;  1IN6 A;  1SMT A;  4E7S A;  4BQQ A;  1JKP C;  5AIP A;  2WJY A;  1WPC A;  2JSP A;  3BG9 A;  4XLA A;  1R4M B;  1X3Z B;  2EA2 A;  1FP1 D;  3HSF A;  1IDZ A;  1S5L C;  1STZ A;  2PBI A;  2ZC2 A;  3ECO A;  1H42 A;  1AIR A;  4RD0 A;  1W0K A;  4PZJ A;  3W2A A;  1ACI A;  4X0G A;  4E7I A;  3LNN A;  2PYG A;  4C43 A;  4ZDP A;  3WHC A;  1R6R A;  2LP0 A;  5LEK A;  5DD4 A;  2RNG A;  2CU7 A;  2LYC A;  1JTX A;  2ZB9 A;  5FNZ A;  1VQM I;  3U2R A;  3KEO A;  1SKQ A;  4X8I A;  2CV2 A;  4PFO A;  5J3L A;  4ACB A;  4CIC A;  2ME6 A;  1D0X A;  1S0U A;  2LOO A;  2XAS A;  1BJZ A;  1E3H A;  4GO1 A;  2HOE A;  5BSX A;  1L1I A;  3CCE I;  1D1B A;  4ZCI A;  3U6K A;  1QUF A;  1BL0 A;  3CC2 I;  5J40 A;  2LKS A;  3FKI J;  3OR1 C;  2R5Z A;  1E0E A;  3RPQ A;  1QU3 A;  3K4L A;  1J0R A;  3NWT A;  1KA8 A;  4M3G A;  1AHD P;  3L2R A;  5FKO A;  2M0M A;  3F23 A;  1YJ9 B;  5LGN A;  1KON A;  1RES A;  3BY6 A;  1BBY A;  3NAU A;  4UXN A;  4WWC A;  4BS9 A;  4Y52 J;  3H3V K;  2J5O A;  4HBL A;  1ZM4 A;  3K4C A;  3BR5 A;  3AVW A;  2LF7 A;  3C1D A;  3TO9 A;  3HSE A;  4ROX A;  1L0O C;  2DT7 B;  3DLA A;  4DQK A;  3ABM H;  2BZT A;  1U9O A;  1TYV A;  2H1L A;  2HDD A;  1DBG A;  4XID A;  1S7E A;  3VOE A;  1DPU A;  2B7B A;  2K9L A;  1JE8 A;  2TRT A;  2X3H A;  2OK8 A;  1X4O A;  2X53 S;  4XL9 A;  3K6G A;  2UV1 A;  4BKX A;  5HXB A;  1OFD A;  5ICF A;  2X6X A;  2LKP A;  1I6X A;  1XDU A;  2XSJ C;  2BY3 A;  1YX2 A;  1K28 D;  5AIQ A;  2P8T A;  3FXK A;  2VFO A;  1QCX A;  5H59 A;  2BXZ A;  1TT5 B;  3NAR A;  4QWQ A;  4XMY A;  5J1Y A;  2J8K A;  3SQV A;  4XQF A;  2BM0 A;  3KCC A;  1UD3 A;  4HSR A;  3FZV A;  3F0C A;  2PJR A;  2V1D A;  5BQT A;  1XSX A;  2DTR A;  5ILU A;  1WJC A;  1CF7 A;  4KIS A;  2E1B A;  3GZN B;  2ZCW A;  3C2H A;  1DUX C;  3PEN A;  3P26 A;  2ZFU A;  2LZJ A;  4D5F A;  3ZOB A;  3OYD A;  2NT9 A;  3ELK A;  1OGM X;  4WX9 A;  5J4V A;  4WK8 F;  3BY2 A;  1IV8 A;  1D8K A;  2M0C A;  3ZMT A;  1JUS A;  2L9R A;  1GV5 A;  3CP2 A;  4DOZ A;  3L2V A;  3DTI A;  1QBJ A;  2CND A;  1VND A;  2FSW A;  3KLN A;  5EG0 A;  3SLN A;  4YEJ A;  2X6W A;  5EEH A;  4HNU A;  3LSR A;  5D4R A;  4A3L J;  1SKY B;  1FIA A;  3UR3 C;  2MH2 A;  5F6F A;  3ZQI A;  1QH0 A;  1I3A A;  1P2F A;  2MW8 A;  3LSI A;  3AVV A;  1BN8 A;  1DG1 G;  5FGM A;  4G7H F;  2GZW A;  3D5L A;  2VJ4 A;  3ULQ B;  3C18 A;  3HOW J;  4XOR A;  3K10 A;  2MLG A;  3W2E A;  2IQ7 A;  3ZQC A;  1Q86 D;  3CCJ B;  1TWH J;  3SYJ A;  1MDM B;  4OP7 A;  2VI6 A;  5AMV A;  3CQZ J;  1ZAO A;  2WC2 A;  4D9J A;  3GYH X;  3OJX A;  4DNR B;  3H09 A;  3LA3 A;  1FPQ A;  1XMA A;  4QLC U;  2BXY A;  2IVM A;  2V9K A;  2CW8 A;  1WZ2 A;  4C9Y A;  3RYR A;  1OYI A;  3M8E A;  1FC3 A;  1XC5 A;  3LQR A;  2BYV E;  2QXZ A;  1OCR H;  2R5Y B;  1QFJ A;  3QYB A;  1X1A A;  3E7L A;  1B4A A;  4L9N A;  1OYW A;  1FLI A;  3CCQ B;  1O8E A;  1IDY A;  4PSX A;  1VQO I;  3A8I A;  3QYF A;  2L7K A;  2X6Y A;  2X3U A;  4IW3 B;  3SJP A;  1Q82 D;  3KP4 A;  2D2W A;  2F4O B;  2DMP A;  2ZJP F;  4FX0 A;  4DW6 A;  4R1H A;  4YFX F;  4B4C A;  1WOR A;  3DWL E;  2OYN A;  1GO2 A;  2F5F A;  2C4T A;  4HW0 A;  3QPH A;  3HHH A;  1OR7 C;  3HRT A;  4YCQ A;  2ZME C;  3DU6 A;  2M34 A;  3CRZ A;  5D5X B;  4WZL A;  2LH9 A;  2IGN A;  5FO1 A;  3BZK A;  3GVK A;  1I27 A;  3CC7 B;  5LMZ A;  2KQR A;  3TOA A;  3EUH C;  4RD2 A;  3ZIA A;  1XG1 A;  2XKP A;  1IZ1 A;  4XN0 A;  3HOX J;  4PK4 A;  2GA2 A;  1HSJ A;  3GQ7 A;  3WTX C;  1OMI A;  3GLL A;  3G4S I;  2VQL A;  3GQ9 A;  3M4O J;  1X1C A;  2LR8 A;  3AG4 H;  1APL C;  2QA4 B;  1H89 C;  2W7Z A;  5KAI C;  2WB1 A;  2WYR A;  3ONQ A;  2P5K A;  3J81 K;  2CUJ A;  3IL2 A;  1ZRF A;  1SAN A;  4FIS A;  4Y7N J;  1IRG A;  4N3N A;  1UZC A;  1UCR A;  2QQB A;  3RPU A;  2A61 A;  4FET A;  3KP3 A;  2D74 A;  1T95 A;  3SJM A;  4XIC A;  3S32 A;  2R7S A;  3COA C;  1FY7 A;  5FKL A;  4JQF A;  3RZD J;  3KYL A;  3AGP A;  5HZB A;  4L5I A;  1X2N A;  4Y9U A;  2R7R A;  2MG4 A;  4GFB A;  1X1P A;  4RCY A;  4JP0 A;  1SM4 A;  3OW7 A;  2XV4 S;  3IP4 B;  2KIF A;  1LVA A;  4RAY A;  1VQ9 I;  1QG0 A;  2ELH A;  1YIO A;  4JX6 A;  2Z16 A;  1NBM A;  1TT0 A;  4G6D A;  1A8P A;  5EZG A;  1GLN A;  2YUS A;  4NC7 A;  3G1M A;  1VQ4 I;  1W0J A;  5DN6 A;  4AUX A;  1YHQ I;  2A6H F;  3WND A;  2IA2 A;  2F43 A;  2RVC A;  3WTT C;  4F7Z A;  2PMZ A;  2IS6 A;  3WNC A;  2B7C A;  3SJZ A;  2VFN A;  4L8J A;  4NK6 A;  4TMW A;  1BR1 A;  3AL0 C;  1DU6 A;  4HWV A;  3R6K A;  5K1Y A;  4LBW A;  4LG0 A;  3BCD A;  3PQK A;  3SDB A;  3V8L A;  1VF9 A;  2ID3 A;  1OCT C;  1NB9 A;  1UST A;  4CO8 A;  2MH9 A;  1EE6 A;  4UZU A;  4P22 A;  2ELK A;  5IT9 Z;  1FTT A;  3BJA A;  5E17 F;  5ED4 A;  1W7P B;  4AF6 A;  4RGS A;  4ENM A;  2DJI A;  3O8H A;  2LRD A;  2E2H J;  2M2E A;  4M6V A;  3WTU C;  1AIP A;  5DV5 A;  1XQB A;  2QTZ A;  1T0F A;  3VSV A;  4Z05 A;  3ZQG A;  2VIX A;  2ZJR F;  1FNC A;  2NTQ A;  2NTP A;  5LHG A;  2CFO A;  4KT5 C;  2ICW G;  3CCR I;  1Z3X A;  4DYQ A;  1I7P A;  3FJO A;  4RA2 A;  2VOO A;  4XOP A;  3OY9 A;  2LFB A;  4Z4T A;  1M1E B;  3RTR A;  2V9P A;  2VBZ A;  2DJN A;  4FK8 A;  5DNS A;  4NB5 A;  4MEX F;  3D5S C;  2XGX A;  4HF0 A;  1LPQ A;  2I5U A;  4IVN A;  2P5V A;  1JI8 A;  4U88 A;  2DOG A;  4D5C A;  1UFM A;  4BYY A;  2OTJ I;  1DP7 P;  3MN2 A;  4M3E A;  4F91 B;  1VQN I;  2DAO A;  1VZ0 A;  1OYY A;  3DF8 A;  4FQG A;  2QN6 A;  3CDI A;  3MMP A;  1AOY A;  3N05 A;  3JRD A;  2RC4 A;  2VJ5 A;  3ZSC A;  3HOS A;  4KIT B;  4ACA A;  3CME B;  1EP3 B;  1QGY A;  1A6Q A;  4HEA 2;  2PN6 A;  2XZO A;  3ZRG A;  3V4G A;  1TC3 C;  2VUM J;  2WZP P;  2DA3 A;  5HZA A;  3A02 A;  1PUF B;  2RNJ A;  3C7J A;  4Y15 A;  4HE6 A;  1BHE A;  3M7G A;  2ZME B;  4M72 A;  3LWF A;  2R7Z J;  1U5T A;  4CXF A;  1WMR A;  2GOM A;  5D6F A;  4HAM A;  4PDK A;  6PAX A;  2CK3 A;  3H36 A;  2FRH A;  2K3P A;  4EMS A;  3JSO A;  3G6E I;  3CCU I;  4KNY A;  2OUM A;  3RIQ A;  3KLO A;  2RN7 A;  5B6I A;  1LLW A;  4DNC A;  2QLZ A;  2R7X A;  1FZP B;  1ZG1 A;  4F93 B;  4PGH A;  3GUD A;  5AN9 A;  1WJD A;  4PC2 A;  2L0K A;  4XSZ F;  4B4D A;  2ECB A;  2Q6O A;  3RPU D;  3W6V A;  1R71 A;  4BL0 B;  3GVA A;  1PJ7 A;  5TV2 A;  3QPT A;  3O8G A;  4RM2 A;  2XZL A;  3CF5 F;  1SD7 A;  2I8D A;  1E64 A;  1RRJ A;  1WJB A;  5E3M A;  2V4D A;  3KET A;  4U0V A;  2GK6 A;  2FML A;  2ZL6 A;  3A4C A;  1PUF A;  2DW4 A;  2E60 A;  3CES A;  4BEH B;  3JRE A;  2VB6 A;  4BQO A;  4R79 A;  2NNY A;  1X3W B;  5F1R A;  2IP2 A;  5L3C A;  4E6K G;  3IC7 A;  3PQJ A;  4ZJZ A;  5GPC A;  3OYK A;  4OJ6 A;  2M5S A;  3MD2 A;  4Y7C A;  1TLH B;  3CUQ C;  4NC8 A;  1A36 A;  4IKF A;  1YO5 C;  1OJL A;  2QUF A;  2LKX A;  2XT2 A;  3EDP A;  1H85 A;  3GFM A;  3Q39 A;  1FEX A;  4WZT A;  2O7O A;  2GA1 A;  4FE4 A;  3I5U A;  1GVH A;  4PAB A;  1FWZ A;  4LBY A;  2Y31 A;  1S8N A;  4TSF A;  5L3D A;  2W82 A;  1E3O C;  5IYQ A;  2AHO A;  2ZJ2 A;  3E97 A;  1TNT A;  4PMH A;  5DUI A;  5JLW A;  1SD4 A;  3WTW C;  3OAA A;  1Z21 A;  5BPI A;  3E5Q A;  1UD6 A;  3GXO A;  1B8I B;  3LOC A;  3HOZ J;  2FNA A;  4IRH A;  1O4X A;  3KRG A;  5FLV A;  1QHH D;  1SVL A;  3P7N A;  3KP2 A;  1O8J A;  3Q9V A;  1WWX A;  2HYF A;  4Y13 A;  2Z8G A;  2BM5 A;  1IJE A;  3ZR8 X;  1LFB A;  2IS1 A;  1MSF C;  1MMN A;  3BP8 A;  2M1B A;  1X2M A;  3WU1 B;  5JI6 A;  5KHD A;  2IOU G;  2OA4 A;  1J7K A;  2H27 A;  3FBI B;  3I58 A;  2NS8 A;  3ZQF A;  3GLX A;  1JKO C;  1XMK A;  4ETS A;  5IYP A;  2PFB A;  5F4J A;  4I98 B;  2HPI A;  2ADU A;  1MBG A;  2F5V A;  4TMT A;  3L9F A;  1YYV A;  3PNT A;  3IV5 A;  1XS9 A;  1F20 A;  1TYU A;  1F5T A;  1NHC A;  3ZPP A;  5ILV A;  5IPA A;  2M4K A;  2EFP A;  1ZRE A;  1FSE A;  3C2B A;  1VQL I;  2O8K A;  5CPR B;  1RR7 A;  1HKS A;  2CJJ A;  3MZY A;  3BCF A;  1EH8 A;  1LFP A;  2BBY A;  2QSH X;  2F1M A;  3TH0 A;  2BF4 A;  4YAL A;  3G05 A;  4W1U A;  1LNW A;  3R60 A;  3M8F A;  1CF7 B;  1WKM A;  1ETY A;  4G7X A;  3K1M A;  2Y30 A;  4M9S A;  2VKV A;  2V26 A;  3CXC B;  4OZY A;  2QCO A;  4URR A;  3CUQ A;  2DQR A;  2OQG A;  3LNQ A;  2Y69 H;  4OOS A;  3WBJ A;  3ZGK A;  1ULY A;  1F43 A;  3HRM A;  3EUK L;  2VKH A;  4EEF G;  3CCM B;  5E1W A;  2VQC A;  3GVJ A;  3CCU B;  1COW A;  1J59 A;  3N97 A;  3M9A A;  2X0L A;  3O2P E;  3QPS A;  3E6C C;  3K9T A;  4M71 A;  3HGG A;  4OPO A;  4ZCL A;  4W97 A;  4BUP A;  4DNT B;  1WOO A;  4EJO A;  4HDV A;  3LQ6 A;  1A5J A;  2R7T A;  3S15 J;  3FXQ A;  4ZDL A;  2B9S A;  4Z1M A;  5C1C A;  1POG A;  4NC6 A;  2IPQ X;  2VKE A;  4D0P A;  2C78 A;  2VZL A;  3BNW A;  3J81 k;  1JTA A;  3DEE A;  1YIT B;  3GTK J;  5LFA A;  3HRU A;  4RD3 A;  4U4B A;  1OFL A;  4UVA A;  2JQ7 A;  4HOB A;  3FXU A;  3KZY A;  2EIN H;  3S1R J;  2KPM A;  2HXI A;  4G5G A;  1H9T A;  4TN1 A;  1BIA A;  3SDG A;  3T1B A;  2VJJ A;  3HKZ N;  3VSL A;  2FVG A;  1TWA J;  4UUS B;  1I18 A;  1U5T C;  2HOA A;  4M6X A;  1W5C C;  2ZFW A;  4RAG A;  2CV1 A;  4P3Y A;  3GW2 A;  2CG4 A;  4LBV A;  3FMQ A;  2XRO A;  2M87 A;  3VMW A;  5LRR A;  1R5G A;  2W24 A;  3OYM A;  5E1Z B;  3I54 A;  2K02 A;  4IF4 A;  4C3H J;  2W6J A;  3BR2 A;  1BJK A;  1SD6 A;  2IS2 A;  3W5V A;  3SQN A;  4CDG A;  2V1U A;  1S7O A;  4PC6 A;  4MTE A;  2F4N A;  3I55 I;  1IJF A;  3EQN A;  1H9G A;  3BR1 A;  1EFC A;  1UAA A;  3B02 A;  4AYB A;  5JLV C;  4RDK A;  3E1Y E;  1D2E A;  4NCN A;  3L00 A;  1P4W A;  3FM3 A;  4P55 A;  2GBY A;  1R1T A;  2L7Z A;  2B63 J;  4BXX J;  2JJ1 A;  4UZF A;  3IAS 2;  4KUM A;  4XRF A;  5KK1 A;  3PUM A;  3FPP A;  3WE2 A;  2HPM A;  3ONU A;  1I5Z A;  4A12 A;  1FJL A;  1E43 A;  1EV7 A;  2VN2 A;  1TTT A;  3HEF A;  1QFY A;  1HKT A;  2Z5U A;  4EQQ A;  1HA3 A;  3BC8 A;  4RDJ A;  2EZK A;  4GYG A;  1TYX A;  1ITY A;  4PJN A;  2LSO A;  4EVI A;  3T9G A;  1VQP I;  1OGJ A;  1Z1D A;  1XGN A;  2X1E A;  1LE8 A;  1N06 A;  1YJN B;  1ZGA A;  1IRF A;  1Z91 A;  5L3E A;  4A3J J;  3LYC A;  2CS3 A;  4CYC B;  2E34 A;  5JMC B;  1DU0 A;  1WVR A;  4Z4Y A;  5FKN A;  1KU2 A;  1O88 A;  4P26 A;  2RC5 A;  2YR2 A;  2YWF A;  1SC7 A;  3BCA A;  3VDX A;  3WE3 A;  1RR8 C;  1OCZ H;  2IS4 A;  3FKS A;  3VMV A;  3BH7 B;  1ZN2 A;  3HRS A;  3K4K A;  1T98 A;  3WU2 C;  3JQP A;  1TWC J;  2AHQ A;  2QWW A;  5CKT A;  3ZQL A;  2PLY A;  2GIZ A;  1BN5 A;  1FYM A;  2QYO A;  4NNJ A;  1T6X A;  4HF1 A;  2IAI A;  5EZH A;  3T53 B;  2K27 A;  1V4R A;  2YUH A;  3GQ8 A;  4DIQ A;  1F36 A;  4GXO A;  2D3N A;  2XSD C;  4L0Y B;  4M4S A;  4O5V A;  4OMZ A;  2P5L C;  4N0B A;  3H92 A;  5C3E J;  1FRQ A;  5IYR A;  2CUE A;  3KEQ A;  4TMZ A;  3QYE A;  4P1W A;  2DFI A;  1A04 A;  2G0E A;  3I3L A;  4X7E A;  1W9X A;  5IP6 A;  2V6E A;  4OPW A;  1B8I A;  1WH7 A;  2XC1 A;  3SEJ A;  2WR8 A;  4QIW N;  4YIF A;  2D9R A;  3VR6 A;  4IQ4 A;  1MBJ A;  4XD7 A;  2JRT A;  3IAM 2;  2NVY J;  3SZE A;  4A0Z A;  2JT1 A;  3FHZ A;  2DA2 A;  1VHE A;  4C2T A;  1D1A A;  5HS9 A;  2KDZ A;  1QFZ A;  2VBE A;  2HDC A;  3FIW A;  5B5E C;  1MBH A;  3AKZ A;  3L2U A;  1LE8 B;  3I4M J;  2WAD A;  2QVO A;  3JU4 A;  1V0E A;  1Y39 A;  3OOC A;  3W5U A;  1PP8 F;  4XLN F;  1LDJ A;  1OFC X;  3PNV A;  1VQ5 B;  3FXR A;  2DA4 A;  1DDI A;  2DFF A;  4I0A A;  1UB9 A;  4I76 A;  4G7Z F;  3H5R A;  3W2F A;  2ZL7 A;  2IEK A;  4ZYH A;  4GQN A;  4LG0 B;  3OWT A;  2JWT A;  4IO9 F;  4RB1 A;  2P7C B;  3PIP F;  5A2Q K;  2K7L A;  3EUH A;  4B43 A;  3ZMZ A;  2UXX A;  1REP C;  1CQX A;  5F0C A;  1K78 A;  4K2E A;  4A3F J;  4MFE A;  1ETV A;  3KZI C;  3OIO A;  3VYU B;  1KK2 A;  1QVG B;  1EFR A;  4L9V A;  5L3B A;  4LB5 A;  3H3U A;  4EV0 A;  2D1V A;  4YZQ A;  2K5C A;  1X1B A;  4OIN F;  2RAE A;  1X4P A;  2CGP A;  4HV6 A;  3S1N J;  2LBF A;  2NXN B;  3GFJ A;  3H1C A;  3RKW A;  1C0W A;  2XTY A;  4LLL A;  2CO5 A;  2OBP A;  4BY7 J;  3HOY J;  2ZTN A;  5E1X A;  3AG2 H;  3TQN A;  4EW9 A;  4MFD A;  3B90 A;  3A1P A;  3WTY C;  3S3M A;  1W34 A;  2MAB A;  2O6G E;  1XG2 A;  2RQQ A;  3SZP A;  3C2G A;  2DEU A;  2H6C A;  3MVP A;  2HVR A;  1ETW A;  1ETQ A;  1T6S A;  2LY9 A;  3OYC A;  2DMQ A;  3OYL A;  1E1Q A;  3WQZ A;  1DP3 A;  1I39 A;  5J35 A;  4P9U A;  2IA1 A;  3CJT B;  1G6N A;  2A69 F;  1ETK A;  3VMF A;  3CCE B;  4OJO A;  1WSR A;  2XNC A;  3JR9 A;  1HW5 A;  1PKV A;  4RBO A;  1EZG A;  3CPX A;  1MKM A;  1KYZ A;  1UJ8 A;  2AO9 A;  2MFZ A;  5FFZ A;  4A5N A;  2VPL A;  3ZPL A;  5M5X J;  1WI3 A;  3LSM A;  1KU3 A;  4LD5 A;  4Y33 A;  4F3Q A;  2MGQ A;  4IHW A;  4A3D J;  4RB2 C;  1RQP A;  3H3Z A;  2P6S A;  3R61 A;  1WP6 A;  2QDX A;  3HXL A;  1WJA A;  1YE9 A;  3C3W A;  3CC4 I;  1KC8 D;  3SKB A;  3S3N A;  2JDI A;  4MGR A;  2L9N A;  4XLH A;  4LLG F;  3B78 A;  2X85 A;  3W5H A;  4LK1 F;  2FNP A;  3OEH A;  2HOS A;  2BM4 A;  3IRQ A;  2O0Y A;  1LKX A;  1GDT A;  3I53 A;  4MO7 A;  2PE3 A;  2HYJ A;  1WJE A;  2FOK A;  4E7K A;  2VFM A;  1JT6 A;  1R7J A;  4YG2 F;  3A35 A;  1Q1H A;  4E7J A;  4YII A;  4A3I J;  1J2X A;  4ASU A;  2G0Y A;  1QHG A;  2EIJ H;  4E70 A;  5TR9 A;  5HLT A;  5DS9 A;  1R22 A;  4CZZ A;  5GAG J;  5K5Q A;  3CME I;  4AF7 A;  5BMZ A;  1FYK A;  2EZL A;  2HEO A;  4EJU A;  3A1Y A;  1Z7L A;  4B1R A;  3HUG B;  1MW7 A;  2JPB A;  3K2A A;  4HA8 A;  4AU7 A;  1E63 A;  3Q38 A;  2BN4 A;  5GAE J;  4RMN A;  2OTL I;  1NG6 A;  1YRN B;  2E19 A;  2X0K A;  1N0V C;  4U0W A;  2HDN B;  4RM0 A;  1F9N A;  5IY5 H;  1OCC H;  1E3P A;  1Z77 A;  1YW9 A;  3PIO F;  4BBR J;  4TMX A;  5IYC J;  1LVK A;  2VAS A;  1WJF A;  2EJR A;  2O8X A;  3RKX A;  1AWC A;  1W87 A;  1LJ9 A;  4ASN A;  1XX5 A;  3LVB A;  3FM5 A;  1O8M A;  2XT4 A;  4E7Z A;  2ISY A;  1YJ9 I;  1IRZ A;  1HW2 A;  1QJV A;  2DET A;  3IUO A;  4FX4 A;  5GP9 A;  2QY1 A;  2JSC A;  2MLK A;  5ICE A;  1F60 A;  1Q7Y D;  4MNU A;  2V9V A;  5JLX A;  2VFP A;  5K7H A;  5FIU A;  4GCV A;  5FB2 A;  2XZP A;  5ICG A;  2CV0 A;  4LJZ F;  1LFU P;  2VNI A;  3PUB A;  1K5C A;  1MH4 A;  2XND A;  2YX4 A;  4PGG A;  3TO7 A;  1YTY A;  5L3G A;  2FUG 2;  2WTE A;  5HDG A;  4Z6Y A;  4OJP A;  1YW8 A;  1GUU A;  3ZXS A;  1S29 A;  1XGO A;  3QU3 A;  4WF2 A;  5IP9 J;  4OIP F;  1VQ8 I;  4U87 A;  5E8I A;  3OV8 A;  4EGZ A;  1ZR4 A;  1YQA A;  2Q6L A;  2EFQ A;  3ESW B;  2H8R A;  4RD1 A;  5IOY A;  4A3B J;  1BX0 A;  3ISX A;  1RU4 A;  5F08 A;  4I84 A;  1ONV A;  2HTS A;  2FA5 A;  4KIB A;  4A6D A;  2B5O A;  3FK6 A;  3OL3 A;  3JAM K;  2W1O A;  3F22 A;  2R92 J;  2OBS A;  3PSF A;  2NYX A;  2CRG A;  2VL8 A;  1FND A;  4RJL A;  1ZKG A;  1T8I A;  2HKX A;  2FEZ A;  3GTJ J;  1NHA A;  2ACJ A;  2CBX A;  5LLQ A;  2HU9 A;  5D8L B;  4NDL A;  2ZO4 A;  1TW2 A;  2DIE A;  2VBY A;  3E6M A;  3OYA A;  2ZL5 A;  1R5I D;  2KRH A;  3JRI A;  2VYQ A;  4XKV A;  2KLO A;  2XEX A;  3U2Q A;  5DD8 A;  4IPA A;  3ZZU A;  2STT A;  5GV7 A;  1MBK A;  2DT6 A;  1DGW Y;  1SAU A;  1SFE A;  1WRJ A;  4Z4S A;  3LSH A;  3ASN H;  3NEU A;  1YJW B;  4BE0 A;  4MR0 A;  1B72 B;  2B7E A;  3DV8 A;  2BVL A;  3FPK A;  3KE2 A;  3VPR A;  1QGP A;  2K9S A;  1HDP A;  5CYV A;  5FO5 A;  4JBA A;  1R5O A;  1OCO H;  2TCT A;  3OS2 A;  5FKK A;  3GIR A;  3MKL A;  1BR4 A;  1MSE C;  5D4S A;  3JUR A;  1O57 A;  3A2K A;  1N78 A;  2R7Q A;  3EYI A;  2R9V A;  4FN5 A;  5LHH A;  5BPD A;  2NV4 A;  4A2U A;  2EIX A;  2KIQ A;  4XNF A;  3CCQ I;  1EP2 B;  4HLX A;  4OZZ A;  4FXU A;  3W3C A;  5DCF A;  2UZK A;  4M0L A;  4M1K A;  3CJQ B;  4XKW A;  2QQA A;  2X51 A;  3QP5 A;  1HDD C;  1MBE A;  3ZMD A;  1U3E M;  1BI1 A;  1HBX G;  3I4N J;  2GOX B;  3ASQ A;  3QQA A;  1JB9 A;  2FBI A;  1FOW A;  3QPL A;  4ESF A;  2EH3 A;  1V54 H;  2E1C A;  2E2I J;  5C44 J;  5J8F A;  1TLL A;  2BW3 A;  2J5P A;  1VLO A;  4Z4R A;  5IT3 A;  4LB6 B;  1QO0 D;  2STW A;  1QGA A;  1UD5 A;  2ZSH B;  4J01 A;  2CUF A;  2BVN A;  3RQI A;  2V7V A;  3MCA A;  3CF2 A;  1QA6 A;  5M5Y J;  2BSP A;  3GTL J;  1Y56 A;  1T6Z A;  1IDJ A;  1IA5 A;  5FA6 A;  5HLH A;  4XLE A;  1IN7 A;  3KP5 A;  4BNC A;  1KGS A;  2BE5 F;  3WGI A;  2W57 A;  1QRY A;  2KRC A;  3ZN0 A;  4HQE A;  3TL4 X;  1K78 B;  3DKW A;  1ZLK A;  1G3S A;  5LHI A;  1ZH5 A;  4XLF A;  3KYD B;  4XSX F;  3AVX A;  3CCS I;  3HIF A;  2C6Y A;  2P0W A;  4K1X A;  2E1N A;  2CFX A;  3OZU A;  4PGO A;  1N05 A;  2BEO A;  1ZUN B;  1FOY A;  2I1L A;  4XKC A;  3WOD F;  1I1G A;  4G1B A;  4HF2 A;  4CUG A;  1ODD A;  2CWE A;  4BPR A;  5J4Y A;  5JHF A;  4DBQ A;  2JPC A;  4IXA A;  2UWM A;  1WTH D;  3LQE A;  4Y4R A;  1BI3 A;  1S6L A;  2QQ9 A;  3GBG A;  1W0U A;  4CCK A;  1O8G A;  3GTM J;  2PMD A;  2IXS A;  1VQL B;  1IW7 F;  1MGT A;  3E6D A;  2XTW A;  1XB2 A;  1V3F A;  4NK8 A;  1QVU A;  2BW3 B;  2E36 A;  3BDD A;  4M9Z A;  2LD5 A;  1XMX A;  1ZG3 A;  3FY3 A;  2L9V A;  2DDA A;  5CQG A;  4IL6 C;  4OMY A;  1I1S A;  5CVR A;  2V7U A;  1D0Z A;  1ETX A;  4MLO A;  1E3X A;  3A0H C;  3LA7 A;  4HLY A;  1Z9C A;  2C2W A;  1WOP A;  1JGS A;  1TL8 A;  2V7Q A;  1N08 A;  1GJR A;  3RSN A;  4DK1 A;  1JUM A;  1W2B B;  1IC8 A;  4EM0 B;  1FP2 A;  3S3O A;  2WJV A;  2V6C A;  1UHS A;  2Y75 A;  3PO3 J;  1T6Y A;  1R5H A;  1XB4 A;  4DK0 A;  2HGC A;  1SEU A;  4G6Q A;  2VON A;  1J09 A;  3O6B B;  1MJB A;  1KCD A;  1Z7U A;  3R6J A;  1ZGJ A;  3I59 B;  3QOP A;  4JX4 A;  5D8K B;  2A6E F;  1Y8Q B;  3OR2 C;  3AL0 B;  5FRO A;  3RZO J;  2QE7 A;  2OAZ A;  3WNB A;  1KD1 D;  1ON1 A;  2XRN A;  5FFX A;  1FMV A;  4YAO A;  2Y2Z A;  2M45 A;  1K8A D;  1WH5 A;  1O7L A;  2NVX J;  4YHB A;  3OFN A;  3OIQ A;  4OPS A;  3K4N A;  4ENN A;  3ZQH A;  1WU8 A;  4P6V F;  4N9H A;  2DFE A;  4H9G A;  1RWR A;  2F4M B;  4LBZ A;  1O7F A;  1X58 A;  3J81 Z;  2ELJ A;  3PJR A;  5EEA A;  4ZYA A;  1S3J A;  2V4J C;  1K9M D;  4X7C A;  4EGY A;  2L9S A;  4B3G A;  1U0J A;  5A88 A;  2JA2 A;  2L5Q A;  4OIQ F;  3NB2 A;  4IHY A;  3CLQ A;  3CCV B;  3LA2 A;  4B44 A;  5CLS A;  3RKQ A;  4KKT A;  3DDY A;  2FQ4 A;  3FWE A;  1FSH A;  3K4J A;  1FYL A;  3BPX A;  4CYD A;  3GFL A;  2A6T A;  3PUF A;  2Y0S N;  2RC6 A;  1VQM B;  4GDF A;  4PC3 A;  4OOI A;  4NHJ A;  1HA8 A;  1NJI D;  3E20 A;  3A03 A;  3BG7 A;  4M3D A;  1YLO A;  1JTY A;  3T51 B;  2JZY A;  1ZYR F;  2DTZ A;  1B1B A;  3AG3 H;  1BW5 A;  1SVM A;  2COB A;  3I64 A;  2R5Y A;  1H8H A;  1XE1 A;  4BU2 A;  3S14 J;  2KIS A;  4I01 A;  2BGI A;  1M1K D;  2M8E A;  5HOO A;  4QTR A;  3H35 A;  3KP7 A;  3R0A A;  2F5E A;  1H80 A;  1W7P D;  2WAQ N;  4HPQ A;  4YC5 A;  1RPW A;  2JVG A;  3HAG A;  3OEE A;  1FX7 A;  5GTH C;  1RUN A;  1O3Q A;  1B23 P;  1QPM A;  2FMY A;  3GZ5 A;  2M7B A;  3FBN B;  1Z67 A;  4L5E A;  5B1B H;  4FCY A;  1YG2 A;  1SVO A;  2NSP A;  1E79 A;  2ESN A;  5IP7 J;  4Y3O A;  1RIO H;  1MBF A;  2K86 A;  2XHK A;  2CRV A;  1IG7 A;  3BT9 A;  2EWN A;  2EQR A;  1XPX A;  3CPW B;  2NRA C;  3HYI A;  3GME A;  1EJ9 A;  3I55 B;  3GRH A;  4U0Y A;  1YJN I;  3CCL I;  5LBQ A;  1UHM A;  3B4N A;  1HKQ A;  4CCM A;  2OTJ B;  4UV9 A;  3DU5 A;  2O9L A;  3SEQ A;  1N07 A;  3FIS A;  5HLI A;  1TZL A;  1U2R A;  5TIS C;  3F8N A;  3ZZT A;  2D1H A;  1WXR A;  4UB6 C;  4A0Y A;  2C5B A;  2Z99 A;  3DTE A;  2ZBV A;  1N25 A;  1O8D A;  1NDH A;  2EV6 A;  2WPD A;  1NG7 A;  2XF7 A;  4E7H A;  1YX5 A;  4ENK A;  2XAJ A;  2UXN A;  3CUQ B;  5THX A;  2ZJQ F;  3MQ0 A;  3TO6 A;  3F72 A;  3CC7 I;  1DAR A;  2VT3 A;  3UKG A;  4MYT A;  4V2G A;  1RZ4 A;  2UVE A;  3BH6 B;  2ZSI B;  4DZJ A;  3G71 I;  4DQ2 A;  2IGO A;  2P6T A;  1JJ8 C;  1B6A A;  1K79 A;  3S17 J;  1DQU A;  2JUG A;  3ZUG A;  1D0Y A;  3IH2 A;  1FMW A;  1Y0Y A;  2F5D A;  1TNS A;  4UAJ A;  4A3C J;  3QOD A;  4V02 C;  4KKU A;  4ITV A;  1ZM2 A;  2FQ3 A;  4UZE A;  4ZGQ B;  3SFZ A;  1MMG A;  4WZK A;  2XF5 A;  3GEZ A;  5E79 C;  1T2K A;  2AQF A;  3DKX A;  5F04 A;  2XF6 A;  2PI0 A;  4X06 A;  3GTP J;  3AVT A;  1OIS A;  5EMN A;  3SYT A;  2Z3Y A;  1BJA A;  4X0C A;  1MND A;  2OK7 A;  1XTA A;  2H8W A;  4H0E A;  1UD4 A;  2DA6 A;  3JRH A;  1O8K A;  2VC1 A;  3QFS A;  4RGU A;  2LNB A;  4KIC A;  1ZRD A;  4I02 A;  1R4N B;  4RLF A;  2ZTG A;  1PUE E;  2E2J J;  5BNG A;  1VQ9 B;  3S1Q J;  1J75 A;  4X6A J;  3W2G A;  2VC0 A;  1MJA A;  1E62 A;  1BPL A;  3BTJ A;  4AC9 A;  1WSU A;  4DGW B;  4HE5 A;  2W48 A;  3VNU A;  2CW0 F;  1RUO A;  2M7A A;  1KJZ A;  4OM9 A;  3VST A;  4RPD A;  2KP6 A;  2CF4 A;  1OLT A;  3ZMU A;  3ZZ0 A;  1MMA A;  4KKS A;  2GQF A;  2L7F P;  1FBU A;  2K9N A;  3M1C A;  4KN4 X;  3SZT A;  3VOD A;  4EJT A;  1S4M A;  1K4Z A;  4YFO A;  4RS8 A;  1U78 A;  1T08 B;  1XSD A;  3PM1 A;  4Z2Y A;  5DS0 A;  2GXA A;  3FXJ A;  2X4H A;  2IJL A;  4A0X A;  5DUK A;  2PEC A;  5JFR A;  1R9T J;  2GAU A;  1SMY F;  3E6B A;  3LFK A;  1DBO A;  1W7P A;  1UHW A;  3J7Z I;  2Z1D A;  3MWM A;  1VQK B;  2K4J A;  1AMO A;  1F1Z A;  2XGC A;  4C2M J;  2H09 A;  2E1R A;  1OCP A;  2JMW A;  3OYN A;  4ZTJ A;  2QYU A;  2W85 A;  4B3A A;  2BV3 A;  2OBR A;  2GXG A;  3FXM A;  4LOC A;  4BHC A;  4B3X A;  1O8L A;  2E35 A;  1JHF A;  2L7M P;  1KRH A;  1TSP A;  2M5W A;  3HTU A;  2IT0 A;  3JAM Z;  3A8K A;  3W6J B;  5FRM A;  1W5T A;  2P4W A;  3GO5 A;  4J0Q A;  1E3Z A;  4NQW A;  3SEZ A;  3JRF A;  2WAF A;  1A6I A;  2OV7 A;  3ZN1 A;  2HDW A;  1EH7 A;  3S2H J;  1OKR A;  3H0G J;  2DT5 A;  3GQA A;  2ZBK A;  3N90 A;  1DDN A;  4LGW A;  3HL2 A;  3HTS B;  1QGZ A;  5HOD A;  3LFU A;  3BTL A;  3ABU A;  3D1N I;  3CC4 B;  1U5T B;  1G3W A;  3UNG C;  5BS6 A;  4KT6 A;  2GIV A;  2NNN A;  1EA3 A;  3L1P A;  3O3K A;  3VYT B;  4C3I J;  1WGX A;  3DPT A;  1S72 I;  5IYB J;  4BAY A;  4JYK A;  1TQI A;  3VSK A;  4M53 A;  1JJ6 C;  3D26 A;  4YZX A;  1RKW A;  1IJW C;  1KQ9 A;  4G9Y A;  1PJR A;  2PLF A;  4HST A;  2QSF X;  1H8A C;  5E6T A;  3I56 I;  2VBS A;  1OGI A;  2NOG A;  2GXB A;  1FOX A;  2XC7 A;  2DXI A;  1WDT A;  4C0S A;  2W00 A;  1TTY A;  2O61 A;  3VNV A;  2QKM B;  2JN6 A;  2ZKZ A;  2WZN A;  5H5J A;  5E3O A;  2QGG A;  4P25 A;  2OC6 A;  1ORK A;  3F8M A;  1IV6 A;  2XGD A;  3H94 A;  2Y0S A;  1NK3 P;  2INV A;  4NQW B;  2YSR A;  3DQV C;  3EYY A;  4BE1 A;  3KFW X;  2HVQ A;  4IHS A;  5HKK A;  4O3M A;  1R49 A;  2Q6K A;  4W8Q A;  4YAW A;  3DCF A;  2QEN A;  3D5R C;  3GWZ A;  2QX3 A;  1WPK A;  2EFO A;  3G3Z A;  4OJ5 A;  1Z05 A;  4RCZ A;  5J1R A;  4YAU A;  1YX3 A;  1JJ2 B;  4G94 A;  1ZG5 A;  5J3O A;  2DYR H;  1B2R A;  1KK3 A;  1WI9 A;  3OYG A;  3ASO H;  3FK7 A;  2NPF A;  1TUI A;  1CZF A;  2HQN A;  4F55 A;  4IHV A;  1DDG A;  4WCG A;  2GRE A;  5E3L A;  4MEY F;  2XPV A;  2A5W A;  3DPL C;  1PJ5 A;  2Q0O A;  3OMY A;  2BM6 A;  2R7O A;  2QSG X;  2K9M A;  4BGD A;  3F8B A;  3OS1 A;  4P12 A;  2WY7 Q;  5B66 C;  3VFZ A;  1VQ5 I;  4BEH A;  3CMA B;  1GR1 A;  3VSU A;  2VBW A;  2ZXH A;  2NS0 A;  3BZC A;  3G1O A;  3F8F A;  1SFX A;  3JRC A;  1E17 A;  3AK5 A;  3IKT A;  4G12 A;  2EV5 A;  4LMY A;  1RQR A;  1GAQ A;  2BHY A;  3PSI A;  2DK5 A;  2HZD A;  1KU7 A;  4Y9R A;  4RAF A;  4AIJ A;  1FNN A;  4OIO F;  3OP1 A;  2JIZ A;  4YFN F;  3KL9 A;  3OOP A;  4UVC A;  4O6J A;  4AWX B;  1L3L A;  2WV0 A;  5FD6 A;  2ISZ A;  2W4S A;  1ELO A;  3MMY B;  2ZME A;  2JN9 A;  4WZE A;  1JKQ C;  3KX2 A;  3R4K A;  1CQT A;  3PA1 A;  2DYS H;  2W6I A;  1YIJ B;  2YU3 A;  1SAX A;  1HF2 A;  2L02 A;  2XB0 X;  4P96 A;  3EUA A;  1O3T A;  3PVD A;  4CZC A;  1G7C A;  2HVS A;  1GVD A;  3LSJ A;  2VBU A;  4IOC F;  1QZE A;  3MKZ A;  2DLL A;  5FD5 A;  5A8A A;  2XDV A;  2LC2 A;  1E1R A;  3W2I A;  3BOQ A;  5F27 A;  5LD2 C;  1VLY A;  3CCR B;  4ZDO A;  3BC9 A;  5KW9 A;  2OCE A;  5FLX Z;  1BC7 C;  1J9Z A;  4G6I A;  4JK1 X;  1AU7 A;  5JHU A;  3HOT A;  2AS5 F;  5LRS A;  5EDN A;  1BQE A;  5F1J A;  1D1C A;  3LO8 A;  4CCJ A;  4G1V A;  3TP3 A;  3HPH A;  1TQM A;  4QPQ A;  4ZCM A;  3ZQ7 A;  2M8G X;  2R7W A;  3M3Y J;  1VBL A;  3M07 A;  1NK2 P;  3BR3 A;  4XRM A;  1QRC A;  2M4G A;  1YS7 A;  2KRF A;  3CJN A;  4UUS A;  2GJR A;  5JVG F;  2VXD A;  1J9I A;  2F48 A;  2Q2E B;  3ZPN A;  5GPA A;  2WY8 Q;  3CCM I;  3WTZ A;  1NB0 A;  2NT6 A;  1K6Y A;  3LMW A;  1MMD A;  4BJ6 C;  1K7A A;  2EIL H;  1EF4 A;  4L9J A;  4Z4V A;  2HYG D;  4EM2 A;  2DMT A;  2PMH A;  1LUJ B;  3WGG A;  1VTN C;  1U8R A;  2JA5 J;  1EFT A;  1T33 A;  3BWG A;  3SFI A;  1TYW A;  1P4A A;  4OOX A;  4I2O A;  3F9K A;  1XGM A;  3I71 A;  4KJZ A;  3J80 K;  1XD7 A;  1GXQ A;  2DMN A;  4QVA A;  1ZQ3 P;  2GM4 A;  2ESH A;  3PL8 A;  4IQJ A;  2LK2 A;  4P1V A;  3PSS A;  2FOW A;  2A07 F;  2VLA A;  4IX7 A;  1WJ5 A;  2H6B A;  2R7D A;  1N75 A;  3REO A;  3MAJ A;  2EZH A;  5HNF A;  1I50 J;  2WWY A;  1JXS A;  5KSW B;  2VNK A;  3B82 A;  2A5Y B;  4P2N A;  4TV7 A;  2GPJ A;  1HZE A;  4HZF A;  1LDK B;  3BJ6 A;  1F4K A;  3JRG A;  3RY8 A;  4JRA C;  1YS6 A;  2R7V A;  2DU9 A;  1Z3Y A;  1X0C A;  1Z6R A;  4U49 A;  1KQ5 A;  3KEW A;  3QP6 A;  3MEX A;  2EK5 A;  4KFC A;  2LF8 A;  1ZHF A;  2BMW A;  4M3F A;  1T0F C;  3HOV J;  3IWF A;  2QQ8 A;  3RIR A;  5E18 F;  1WQ2 A;  1ON2 A;  3WTS C;  2G7U A;  4KIF A;  3OYB A;  5DCM A;  5F0H A;  4MXN A;  3WYA A;  1Y1V J;  3TGN A;  4BXU A;  1TWF J;  2X6O A;  2P81 A;  4D7N A;  3D0S A;  4NUB A;  1YIT I;  1G4D A;  2NTB A;  4WXC A;  1P7I A;  5EGO B;  5C4J J;  5D5V B;  4LIV A;  1EP1 B;  4IJA A;  1OOC A;  2KL4 A;  3ZQQ A;  3V8K A;  4F52 A;  4QSH A;  1OB0 A;  2CUZ A;  4MQ9 F;  2AQE A;  3QWL A;  1BOA A;  1HOM A;  2NVU B;  4AIH A;  1NRK A;  2VNJ A;  3HUG A;  4EAT A;  2FU4 A;  2LBF B;  2VBV A;  2XB5 A;  2CH0 A;  4KIG A;  3K0L A;  3TBI A;  2XUB A;  1P92 A;  5DM7 F;  2JA8 J;  1HQC A;  3QFR A;  3E3V A;  1UG2 A;  1QA3 A;  1P6R A;  2XAH A;  3P27 A;  3TMO A;  3I56 B;  3S16 J;  4MYU A;  3MZH A;  2FD5 A;  2M30 A;  4N9I A;  1JA1 A;  2BGJ A;  2VBX A;  3BZ6 A;  4KDP A;  1WSV A;  4G7W A;  1X3U A;  2NS7 A;  3OE7 A;  5EF6 A;  2QF7 A;  3CCJ I;  3P9K A;  1G3Y A;  3F6V A;  2ETH A;  4YDT A;  1KK1 A;  2NST A;  1MZB A;  1K8F A;  3BLY A;  4ZZL A;  4YFK F;  4KN7 X;  5KVR A;  5H20 A;  4AVP A;  2YU9 J;  1GVJ A;  3CDH A;  5HLG A;  4BY1 J;  3EQO A;  2VBM A;  2H94 A;  3M8J A;  1MH3 A;  1A35 A;  2KFD A;  3OZW A;  3Q0V A;  3AVU A;  4L9T A;  2E71 A;  2BM1 A;  4RPB A;  4OWR B;  2YX7 A;  2V7W A;  4M6Y A;  1Y0U A;  2XRL A;  4U7D A;  2F2E A;  3A3B A;  2K85 A;  1YI2 B;  1IXC A;  1M90 D;  2L01 A;  2O0V A;  5KNL A;  4ZYE A;  3HBL A;  3K4B A;  4G6T B;  1YFH A;  3CUO A;  3K2Z A;  2R4G A;  2CQX A;  1MAB A;  2KJB A;  4D1Q A;  4A3M J;  3J7A O;  1IUY A;  2A05 A;  3TDZ C;  2QM3 A;  4X05 A;  1B9N A;  4M74 A;  2LG4 A;  2BY2 A;  1D8J A;  1J5Y A;  1ZTR A;  1QA1 A;  3GTG J;  1R00 A;  1U6G A;  4A3G J;  1Y0R A;  3QFT A;  1TQP A;  1FTZ A;  2YWG A;  1ZLJ A;  4I0B A;  4X1E A;  3OYH A;  3EET A;  3Q3A A;  4BDZ A;  2B0R A;  2YWE A;  3OW2 B;  2V7F A;  4R8H A;  1XGS A;  1N77 A;  3H5A A;  2I10 A;  2C5H A;  3I9V 2;  1CGP A;  4EJV A;  4ESJ A;  3QE2 A;  2VT2 A;  4Q48 A;  4C2L A;  4AVZ A;  2FJ1 A;  3BQJ A;  1JT0 A;  4PJL A;  3M1E A;  4FWT A;  1LM1 A;  2EFN A;  4LK0 F;  3TKY A;  2CYY A;  2W84 A;  1RI7 A;  4D7M A;  4V2F A;  5AON A;  5EJC A;  1MNM C;  2V31 A;  2DQL A;  5F64 A;  4G8X A;  2W25 A;  4CCL A;  1IN5 A;  3HB9 A;  3VWB A;  4LLN A;  3DU1 X;  1HXD A;  2CQN A;  3U6B A;  1VI0 A;  2GWR A;  2ZNY A;  4PJM A;  3RJP A;  4AIK A;  1RNL A;  3BQY A;  2DPD A;  1FBS A;  2DCU A;  1VQK I;  3Q0U A;  2GJP A;  2EPF A;  2JUC A;  1E2X A;  4BAC A;  3NRV A;  5A2Q Z;  3CLO A;  3OKX A;  1CLW A;  2M3A A;  4F92 B;  4XLP F;  1ZK8 A;  3HC7 A;  4XOT A;  3OYE A;  3Q0W A;  2HFH A;  1H8E A;  4NBQ A;  1MMS A;  4E7L A;  3MCZ A;  1V5F A;  4DQL A;  2Y9Y A;  5J47 A;  2VOP A;  3OOU A;  1LLZ A;  2V79 A;  3CB4 A;  3V7C A;  3QFC A;  2V1N A;  1Z6T A;  5E8G A;  2PJP A;  4CSW A;  1IO2 A;  2DOE A;  3B73 A;  1BW6 A;  1SFK A;  4QVJ A;  2Z2S B;  5GV8 A;  1JA0 A;  1W5S A;  1G8X A;  3ISP A;  1VJS A;  3OIP A;  2L4A A;  4FTH A;  5TRD A;  1KQS B;  2JVH A;  1GHC A;  2OJE D;  2XOK A;  3Q3S A;  4IRG A;  1G7T A;  2FXA A;  1KTW A;  4II3 A;  1OGO X;  2MA3 A;  4RB3 C;  1KTV A;  1G59 A;  2WA0 A;  2EB7 A;  4ENJ A;  4OPV A;  1USS A;  1ZM3 A;  1IN4 A;  3K70 C;  2VBT A;  3T0Y A;  1B72 A;  4QHY A;  4B09 A;  1I3Q J;  2R3S A;  3BPV A;  4A5M A;  2YS9 A;  4N4O B;  3V42 A;  2KZV A;  3L2W A;  1V5G A;  2B0L A;  2PYH A;  1IGN A;  3AGQ A;  5JR3 A;  1R36 A;  4X7D A;  3LST A;  2NAZ A;  2YWH A;  1JUP A;  4XBF A;  4QFM A;  2KZG A;  4BH9 A;  3CTA A;  5C4X J;  3BCB A;  1IDK A;  2XTX A;  4XRS A;  3B6C A;  2VQH A;  2HTJ A;  3U1K A;  1RC9 A;  3FMR A;  2BHZ A;  4UVB A;  4A3E J;  1LEB A;  1PE9 A;  3ABL H;  1IHM A;  3LSK A;  1X19 A;  1W0T A;  2EFW A;  2H1K A;  1ZEL A;  3CCL B;  2J8I A;  2PIA A;  3DXJ F;  4ZZD A;  3ZC3 A;  3V7R A;  4Z03 A;  3G71 B;  1VQ6 B;  1TVC A;  4PUS A;  4L0Z B;  4C2U A;  2MSY A;  3DEW A;  3Q6R A;  3TP0 A;  9ANT A;  2CQQ A;  1MIJ A;  1PVE A;  3SY2 A;  2WV1 A;  3RYP A;  4PC7 A;  4DZP A;  5BOX A;  4TMV A;  3JX8 A;  2JTV A;  1EKE A;  4YEL A;  4I7H A;  2WAQ A;  3W2W A;  3ASS A;  4M73 A;  3V76 A;  2DA7 A;  1W4M A;  2C77 A;  3CMA I;  2VE9 A;  3E0J B;  3KP6 A;  3ML6 A;  2LY2 A;  1YOV B;  2QBY A;  2PG4 A;  1QX4 A;  2HCJ B;  2QGU A;  4IHT A;  4ESB A;  2KDO A;  3BG5 A;  2F5C A;  2DPU A;  1WOS A;  2O17 A;  2MC3 A;  2L2O A;  2K40 A;  3VB2 A;  3W2V A;  1GAW A;  2HMA A;  3WY9 A;  4QUZ A;  3QOE A;  2XAQ A;  5CQE A;  4Z4Z A;  2Y48 A;  2EBI A;  1VQ4 B;  4PSW A;  4N3G A;  2P7V B;  4BXF A;  4TKO B;  3Q5F A;  3ML3 A;  2O1D A;  4X7F A;  3WU0 A;  3GF2 A;  3CMY A;  4QV2 A;  1QZY A;  5L46 A;  1QQ1 A;  1S9H A;  2VOD A;  3AST A;  4Q7J B;  2XAG A;  4RGR A;  5EYR A;  1W1W E;  1DPR A;  2X1C A;  3HSR A;  3KEY A;  2HS5 A;  4HV5 A;  3ROU A;  5M3M J;  1BIB A;  2RKH A;  2NVQ J;  2PX9 A;  3WTV C;  3VO1 A;  4C3J J;  1SD5 A;  2LVS A;  1K83 J;  2HQ5 A;  3GFI A;  2GJK A;  2ZNZ A;  3DPU A;  3F21 A;  3BH4 A;  2ODL A;  2V5I A;  3P4G A;  3Q6Q A;  2KMU A;  5TJJ A;  4OOV A;  2PMZ N;  4CHU A;  2VNH A;  4S05 A;  3ZMV A;  4ZC3 A;  3S1M J;  4EM1 A;  2XPW A;  4LIT A;  4PJJ A;  3P5J A;  2DI3 A;  1Y0N A;  4Q5S F;  3ZP5 A;  2EWE A;  2YPR A;  1ZGW A;  2E7W A;  1AKH A;  2RDP A;  4WXD A;  2JRM A;  3DBH B; 
#chains in the Genus database with same CATH homology
 2Z1D A;  1DBG A;  1UD2 A;  3FHN A;  4C2T A;  2BVM A;  3CMM A;  2K9L A;  1D1A A;  2X3H A;  3OYN A;  4ZTJ A;  1X4O A;  2X53 S;  2VBE A;  4XL9 A;  3K6G A;  2UV1 A;  4BJT A;  2F4I A;  3AKZ A;  3L2U A;  2WAD A;  2X6X A;  4B3X A;  4H4K C;  2MYS A;  3JU4 A;  1V0E A;  1O8L A;  2XSJ C;  3LL7 A;  4PFP A;  3OOC A;  1MNE A;  3PNV A;  1K28 D;  2ZZG A;  2Z6B D;  2ZZF A;  3B8Y A;  5FRM A;  1QCX A;  4HRI A;  3H5R A;  4XMY A;  1E3Z A;  4XQF A;  3SEZ A;  4GQN A;  2WAF A;  3OWT A;  2OV7 A;  4HSR A;  1WFX A;  2HDW A;  1UD3 A;  2ZZQ A;  2PJR A;  4BDY A;  1BMF A;  2ZZE A;  3G2B A;  4B43 A;  1WJC A;  3HG9 A;  3GQA A;  3HL2 A;  4KIS A;  2E1B A;  3C2H A;  3LFU A;  3VYU B;  1UG0 A;  2ZFU A;  3UNG C;  2LZJ A;  3OYD A;  2NT9 A;  4KT6 A;  1EFR A;  1OGM X;  1EA3 A;  3VYT B;  4E0F A;  3DPT A;  4YZQ A;  2K5C A;  1X1B A;  3CP2 A;  4DOZ A;  2PJR B;  3L2V A;  1X4P A;  4HNT A;  3DTI A;  3VSK A;  2LBF A;  4YZX A;  1PLU A;  1Y6I A;  2ZTN A;  1PJR A;  4YEJ A;  2X6W A;  4HST A;  4HNU A;  1SKY B;  3OYJ A;  4EW9 A;  3HPG A;  3UR3 C;  4ZTF A;  3B90 A;  2XC7 A;  3S3M A;  3LSI A;  2MAB A;  2DXI A;  1XG2 A;  2W00 A;  2RQQ A;  3S8P A;  3C2G A;  1BN8 A;  2QKM B;  2HVR A;  3D5L A;  3OYC A;  2VJ4 A;  3OYL A;  1E1Q A;  2OC6 A;  3WQZ A;  4XOR A;  1DP3 A;  3AFH A;  3H94 A;  4JOM A;  3K10 A;  2Y0S A;  2ZXI A;  2INV A;  4CCO A;  4OJO A;  4NQW B;  2BOL A;  1PKV A;  3DQV C;  2IQ7 A;  2QKL B;  4BE1 A;  1O8H A;  2HVQ A;  2MFZ A;  4B48 A;  5HKK A;  5AMV A;  2KVO A;  4D9J A;  2VPL A;  4W8Q A;  4DNR B;  3RQ4 A;  3D5R C;  3LSM A;  2IGK A;  2QX3 A;  4F3Q A;  4Y33 A;  4OJ5 A;  3OYF A;  1YX3 A;  1KMH A;  2V9K A;  2CW8 A;  1WP6 A;  3HXL A;  4C9Y A;  1WJA A;  3H9J A;  1YE9 A;  3OYG A;  3S93 A;  3S3N A;  2JDI A;  4CA0 A;  2L9N A;  4XLH A;  4XON A;  4F55 A;  1CZF A;  2QXZ A;  2W7N A;  4YZ0 A;  2X85 A;  3QYB A;  1X1A A;  1O8E A;  2VJI A;  4CCN A;  2A5W A;  3DPL C;  4PSX A;  2F6C A;  3OEH A;  3QYF A;  2L7K A;  2X6Y A;  4YXW A;  1LKX A;  3OMY A;  2R7O A;  3VYR B;  2K9M A;  4BGD A;  1WJE A;  4N4N B;  3OS1 A;  4E7K A;  2WY7 Q;  4BEH A;  3DWL E;  1V0F A;  2GK7 A;  3A35 A;  3VSU A;  4E7J A;  2ZXH A;  4ASU A;  1QHG A;  1IRX A;  1OR7 C;  5HLT A;  2O0W A;  3DU6 A;  2LH9 A;  2IGN A;  3NE5 B;  3A1Y A;  3GVK A;  1Z7L A;  3PSI A;  3HUG B;  1MW7 A;  2KQR A;  4AU7 A;  3EUH C;  3ZIA A;  2HZD A;  4XN0 A;  4PK4 A;  4RMN A;  3GQ7 A;  1NG6 A;  2HQA A;  2JIZ A;  1ERD A;  2VQL A;  2W4S A;  3MMY B;  3GQ9 A;  1X1C A;  3KX2 A;  2W6I A;  2WB1 A;  1LVK A;  2VAS A;  1WJF A;  2X8K A;  3RCO A;  3ONQ A;  2WSS A;  1O8M A;  3EPZ A;  1OHH A;  2CUJ A;  3EUA A;  1UEL B;  4E7Z A;  4CZC A;  3FDY A;  1OFM A;  2HVS A;  4FAS D;  1QJV A;  3IUO A;  5C1E A;  3MKZ A;  2QY1 A;  3H0D A;  4FET A;  2XDV A;  2LC2 A;  1T95 A;  1E1R A;  5LD2 C;  3S32 A;  1VLY A;  2KHM A;  2XZP A;  4ZDO A;  2CV0 A;  3BC9 A;  2R7S A;  4JQF A;  3PUB A;  3KYL A;  4G6I A;  1K5C A;  2XND A;  3HOT A;  2R7R A;  2FUG 2;  4DBR A;  4OJP A;  1D1C A;  3OW7 A;  4CCJ A;  3IP4 B;  3HPH A;  4QPQ A;  3ZXS A;  4J00 A;  2R7W A;  2Z16 A;  1VBL A;  1KZL A;  1NBM A;  1TT0 A;  4U87 A;  1GLN A;  4NC7 A;  2X1D A;  1RU4 A;  2M4G A;  1W0J A;  5DN6 A;  2F43 A;  4I84 A;  2GJR A;  2VXD A;  2PMZ A;  3OL3 A;  2IS6 A;  2Q2E B;  3ZPN A;  2W1O A;  2WY8 Q;  4L8J A;  4NK6 A;  1BR1 A;  3PSF A;  3AL0 C;  2VL8 A;  1K6Y A;  3PFY A;  2NT6 A;  4HWV A;  4CH7 A;  3BCD A;  4OAY A;  1MMD A;  3SDB A;  4BJ6 C;  1EE6 A;  3LMW A;  2HU9 A;  4UZU A;  4W8S A;  2DIE A;  4P22 A;  3OYA A;  2KRH A;  4XKV A;  3F9K A;  2KLO A;  4KJZ A;  4XR6 A;  3WWG A;  2DJI A;  4XKB A;  2LRD A;  4IQJ A;  3H5N A;  3PL8 A;  2DT6 A;  2R7U A;  1DGW Y;  2UUZ A;  2VLA A;  1SAU A;  4QPO A;  4IX7 A;  1WJ5 A;  2XAU A;  3LSH A;  3VSV A;  4Z05 A;  3BG6 A;  1N75 A;  4LG3 A;  2VIX A;  4BE0 A;  2NTQ A;  4MR0 A;  2NTP A;  2CFO A;  5HNF A;  1Z3X A;  2BVL A;  2CMP A;  4XOP A;  3OY9 A;  3RTR A;  4XN3 A;  3OS2 A;  1HZE A;  1LDK B;  1BR4 A;  2R7V A;  3U21 A;  3A2K A;  1N78 A;  2R7Q A;  3NWS A;  4RLQ A;  3D5S C;  2R9V A;  3JUR A;  3GVL A;  1Z3Y A;  1JI8 A;  1X0C A;  4U49 A;  4XNF A;  1X1D A;  3KEW A;  4OZZ A;  4FXU A;  3W3C A;  4F91 B;  1T0F C;  1VZ0 A;  3CJQ B;  4XKW A;  2X51 A;  3N05 A;  3OYB A;  3K70 D;  3MKY B;  4MXN A;  2GOX B;  2VJ5 A;  3ZSC A;  4HG2 A;  4KIT B;  4C30 A;  3HOS A;  2BW3 A;  4HIZ A;  4NUB A;  4HEA 2;  2XZO A;  3ZRG A;  2WZP P;  2NTB A;  4LIV A;  4RM3 A;  1UD5 A;  1OOC A;  2KL4 A;  2ZSH B;  3ZQQ A;  4J01 A;  4GRI A;  3CF2 A;  4F52 A;  3J7A Y;  1OB0 A;  1BHE A;  1PXZ A;  2BSP A;  2CUZ A;  1Y56 A;  1IDJ A;  1IA5 A;  2AQE A;  1NRK A;  4XLE A;  1WMR A;  2GOM A;  2UVF A;  3FKJ A;  4EAT A;  2LBF B;  2V7Q A;  2KRC A;  2CK3 A;  3TL4 X;  2K3P A;  3ZCO A;  1BLI A;  2CH0 A;  4XLF A;  2VBK A;  2OUM A;  5IK2 A;  3TBI A;  2P0W A;  2R7X A;  4F93 B;  3H9Q A;  4XKC A;  3TMO A;  1WJD A;  4ANJ A;  4CUG A;  3RPU D;  4B3F X;  4BL0 B;  5JHF A;  4DBQ A;  2UWM A;  1WTH D;  2E1M C;  4RM2 A;  4G7W A;  2XZL A;  3OE7 A;  2I8D A;  4Y4R A;  3GBG A;  3CP8 A;  1WJB A;  4CCK A;  2V4D A;  1O8G A;  2GK6 A;  4DJA A;  2WAE A;  3A4C A;  2IXS A;  2NST A;  2E60 A;  3BLY A;  2LRE A;  3CES A;  2VB6 A;  4BEH B;  4BQO A;  4R79 A;  4E6K G;  5FL7 A;  4NK8 A;  3EQO A;  2VBM A;  3M8J A;  2BW3 B;  3OYK A;  4ZJZ A;  4OJ6 A;  3FY3 A;  4XLC A;  5CQG A;  2M5S A;  3MD2 A;  1D0Z A;  4IKF A;  4MLO A;  4NC8 A;  4OWR B;  3MKW B;  1E3X A;  1JRG A;  4BQN A;  4OAZ A;  4YZA A;  3LSG A;  3A3B A;  2O04 A;  5FRN A;  3RSN A;  4DK1 A;  2O0V A;  5KNL A;  3K4B A;  4G6T B;  4LIU A;  4TSF A;  2LY1 A;  2W82 A;  3S3O A;  2O5R A;  2R4G A;  3CZ6 A;  2WJV A;  4PMH A;  3CJR B;  3H9G A;  3DKY A;  3OAA A;  4DK0 A;  1P9Q C;  1KCD A;  4D1Q A;  1J09 A;  1Z21 A;  4BE2 A;  2VKD A;  1UD6 A;  2LG4 A;  2CW7 A;  3AL0 B;  3OR2 C;  1V5E A;  5FRO A;  2WBM A;  1DGR M;  2QE7 A;  2IGM A;  2RRE A;  3KRG A;  1QHH D;  1O8J A;  1FMV A;  2Z8G A;  3OYH A;  3ZR8 X;  5KCM A;  2IS1 A;  3K4M A;  4BDZ A;  2MC4 A;  1MMN A;  2V7F A;  5KHD A;  3OFN A;  1N77 A;  3OIQ A;  3H5A A;  2E5Z A;  3I9V 2;  3K4N A;  3FBI B;  4TT3 A;  4C2L A;  4AVZ A;  1UD8 A;  1RWR A;  1KCC A;  4PJL A;  2HPI A;  2F5V A;  2ELJ A;  3PNT A;  2V31 A;  1IB4 A;  3OS0 A;  3PJR A;  1VF7 A;  1NHC A;  4ZYA A;  4II2 A;  3ZPP A;  2V4J C;  4CCL A;  4JMQ A;  3VWB A;  2M4K A;  2L9S A;  4B3G A;  1U0J A;  2JA2 A;  3SZG A;  2L5Q A;  3OPO A;  4PJM A;  5CPR B;  3T56 B;  4B44 A;  3BCF A;  2VXZ A;  4KKT A;  2GJP A;  1LFP A;  4IZZ A;  3DDY A;  4BAC A;  2F1M A;  5CDF A;  3K4J A;  3G05 A;  2M3A A;  4F92 B;  1HVX A;  2A6T A;  3HC7 A;  4XOT A;  3OYE A;  2D3L A;  1H8E A;  4G7X A;  3PNY A;  5TGT A;  4E4H A;  2V26 A;  1HA8 A;  4OZY A;  4E7L A;  4URR A;  3BG7 A;  3OL4 A;  3T51 B;  1V5F A;  3HKZ A;  3OOU A;  3ZGK A;  1BOB A;  2DCE A;  1W36 D;  1H8H A;  4BU2 A;  2XGJ A;  3EUK L;  2VKH A;  1AA7 A;  2V1N A;  2VQC A;  5HOO A;  4U7B A;  3GVJ A;  2Q1Z B;  1COW A;  3H35 A;  4CSW A;  3GQB A;  1SFK A;  2Z2S B;  1PYV A;  1H80 A;  4Z06 A;  1W36 C;  4HPQ A;  2JVG A;  1VJS A;  1G8X A;  3E1S A;  3HAG A;  3OEE A;  4BUP A;  3OIP A;  4DNT B;  4YRV A;  4W8T A;  1FX0 A;  1T5E A;  2JVH A;  2R7T A;  3LMM A;  2M7B A;  3FBN B;  2XOK A;  4ZDL A;  4P5O A;  2JJ2 A;  4Z1M A;  1KTW A;  4II3 A;  1OGO X;  5C1C A;  4BJ5 C;  1G59 A;  2NSP A;  2WA0 A;  1E79 A;  3DEE A;  1JTA A;  4XM3 A;  5LFA A;  3SUC A;  4U4B A;  1OFL A;  3L2Q A;  4Y3O A;  3K70 C;  1HG8 A;  1O8F A;  2MD0 A;  1I8D A;  2KPM A;  5HVQ C;  1GQ8 A;  2E5N A;  2DOA A;  4N4O B;  3V42 A;  3OYI A;  2KZV A;  3L2W A;  3GRH A;  1V5G A;  2VJJ A;  3VSL A;  2PYH A;  3B4N A;  2E1M B;  4CCM A;  1I18 A;  3DU5 A;  2CV1 A;  3SEQ A;  1TZL A;  4B47 A;  3VMW A;  3UW0 A;  3DTE A;  3OYM A;  3BCB A;  2VQG A;  1RMG A;  1IDK A;  2HLD A;  1MAB A;  2VQH A;  1O8D A;  2NZM A;  3VYS B;  2W6J A;  2WPD A;  1PE9 A;  1NG7 A;  2XF7 A;  2IS2 A;  4E7H A;  1YX5 A;  3LSK A;  1X19 A;  2HNH A;  1ZEL A;  4Z03 A;  3EQN A;  3A3G A;  1UAA A;  4AYB A;  3DTK A;  4PUS A;  4C2U A;  2UVE A;  2ZSI B;  2JJ1 A;  1O8I A;  2NOJ B;  4OJL A;  2IGO A;  1BR2 A;  3IAS 2;  4YEL A;  2WAQ A;  3W2W A;  2INU A;  4W8R A;  5HNH A;  3FPP A;  1DQU A;  2HPM A;  2JUG A;  4E7S A;  3E0J B;  4BQQ A;  1E43 A;  2LY2 A;  1D0Y A;  2WJY A;  1FMW A;  2JSP A;  4XLA A;  1WPC A;  3QOD A;  3BC8 A;  4KKU A;  4ITV A;  1AIR A;  2KDO A;  1MMG A;  2O17 A;  1W0K A;  2XF5 A;  4PJN A;  2AQF A;  2L2O A;  3W2A A;  3DKX A;  3T9G A;  2XF6 A;  4X0G A;  4E7I A;  2X1E A;  3LNN A;  3W2V A;  3SYT A;  2PYG A;  1MND A;  4ZDP A;  1R6R A;  2CS3 A;  3QOE A;  5CQE A;  1UD4 A;  2RNG A;  1O8K A;  2LYC A;  4PSW A;  4RLF A;  2ZTG A;  4BXF A;  4TKO B;  1O88 A;  2O1D A;  3VMV A;  3BCA A;  3VDX A;  2CV2 A;  2IS4 A;  3FKS A;  4PFO A;  1S9H A;  3K4K A;  1BPL A;  1D0X A;  2LOO A;  5CKT A;  2X1C A;  4DGW B;  3KEY A;  2M7A A;  3VST A;  1D1B A;  4NNJ A;  2KP6 A;  3T53 B;  1OLT A;  3GQ8 A;  4DIQ A;  1MMA A;  3DPU A;  3OR1 C;  1E0E A;  2D3N A;  1QU3 A;  2GJK A;  3BH4 A;  4KKS A;  2ODL A;  3K4L A;  3NWT A;  2KMU A;  3M1C A;  3L2R A;  2M0M A;  3QYE A;  4P1W A;  4ZC3 A;  1KON A;  4LIT A;  3I3L A;  4PJJ A;  1W9X A;  4BS9 A;  2V6E A;  3K4C A;  2PEC A;  2EWE A;  3VR6 A;  4IQ4 A;  2DT7 B;  4XD7 A;  3IAM 2;  3DLA A;  1DBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...