4XKVA

Tailspike protein mutant d339n of e. coli bacteriophage hk620
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 217
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xkvA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xkvA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xkvA02
4XOTA 1O8HA 1PE9A 1BN8A 3B4NA 5C1EA 4URRA 2VBKA 1KCCA 2VBMA 4XM3A 1OOCA 4YEJA 1GQ8A 1KCDA 4XLAA 1O8EA 3ZPPA 4MXNA 4U4BA 4OJ5A 3LMWA 3EQOA 1O8DA 2X85A 1O8KA 3GQ9A 1K5CA 1DBOA 1HG8A 4OJOA 4Z05A 1XG2A 4XOPA 4XONA 4W8QA 1RU4A 4W8TA 2X6WA 2NSPA 3GQ8A 1WMRA 3GRHA 3UW0A 4YZQA 1RMGA 1OGMX 4NK8A 2Z8GA 2VJJA 2NT9A 4YZ0A 2O1DA 1O8IA 1O8FA 1JRGA 2NZMA 4YZXA 2VJIA 3B90A 1VBLA 2X6YA 1IA5A 4OJ6A 1DBGA 1X0CA 4OJPA 3VMWA 2BSPA 4XR6A 4XLCA 1EE6A 4PMHA 5C1CA 4Z03A 3EQNA 4YELA 4XNFA 3GQ7A 4NK6A 1O88A 1KTWA 4AVZA 5AMVA 1O8JA 4MR0A 3VSVA 4XMYA 4Z06A 4I84A 2PYHA 1OGOX 1JTAA 1IDKA 4XN3A 4XORA 1BHEA 1IB4A 3VMVA 1NHCA 4XLHA 4XL9A 2IQ7A 1PXZA 4HWVA 1O8LA 2NTPA 4XLEA 3VSTA 2NTQA 1IDJA 1CZFA 4U49A 3WWGA 3ZSCA 2INVA 2X3HA 1QCXA 2O04A 2PECA 4YZAA 1O8GA 3FY3A 1AIRA 4OJLA 3JURA 4EW9A 2UVEA 4OZZA 3GQAA 4OZYA 2NTBA 4XLFA 4W8SA 2EWEA 2QXZA 4W8RA 1OFMA 2QX3A 1OFLA 1QJVA 4XKVA 2ODLA 1H80A 4XN0A 2INUA 4XKWA 2X6XA 4C2LA 3B8YA 2O0WA 1O8MA 1PLUA 3KRGA 4XQFA 3SUCA 2O0VA 2VBEA 2NT6A 1RWRA 2O17A 2QY1A 2UVFA 2PYGA 3T9GA 2NSTA 3VSUA
chains in the Genus database with same CATH superfamily
2QQAA 4MFEA 2JJ7A 4RGUA 1YS6A 1KTVA 1KQ5A 1RR7A 2HZDA 5D6FA 5D5UB 2VLAA 2P7VB 2M30A 5IP9J 1KQ8A 2BVMA 4GDFA 4MFDA 4I01A 4X8IA 5GAHJ 2B0RA 3G1OA 3H35A 3ZMUA 5LHHA 4MXNA 2FEZA 4G6IA 3N05A 1DQUA 4AM3A 1EH6A 4KMFA 2G7UA 3LA3A 1QHHD 3F9KA 5FLVA 1IRFA 4Z05A 2BY2A 1TTTA 1OCOH 3AK5A 2OBTA 2ESHA 5LMZA 2LKXA 2M2EA 3ASPA 3CCQB 3GRHA 4LMYA 2VUMJ 3FPPA 3I4NJ 3UW0A 2X6OA 2IGOA 3L1PA 1U5TB 3FM3A 2MG4A 1JT0A 1TC3C 2BVNA 4RCYA 4AC9A 2PX9A 2P8TA 1FNMA 2F1MA 1KRHA 2JK3A 4U7BA 2CMPA 2Q2EB 1PJ5A 2A6HF 3PJRA 2AO9A 2VT3A 4EJTA 1MNDA 4LC0A 3HB9A 2RREA 1LUJB 1B1BA 3SFZA 2X6YA 4RLQA 2OCEA 3EYIA 5IYDJ 2XAFA 4P5OA 4A3BJ 3MCAA 2XPUA 3W2HA 3CP2A 1KK3A 1Q86D 3H09A 2ZMEA 1EE6A 3CCJI 1JUSA 3RDIA 2YWGA 5K7FA 1KA8A 2MYSA 3LSJA 4MQ9F 2DO7A 3WG9A 3BTJA 1V3FA 1FT9A 1QA6A 4HRIA 1XE1A 4RD0A 1HZEA 4WF2A 5CVVA 1QFYA 2BF4A 5J47A 2Y9YA 1WGXA 1JB9A 1IB0A 4CCMA 5DSZA 4EM0B 1BI3A 3SEZA 3BR0A 1EKEA 3E1YE 2L4AA 1A04A 1VF9A 4LOCA 4EM2A 1VQMI 2KJCA 2FMLA 4XLEA 1E43A 3LAPA 3ZQIA 5LRRA 1P7JA 2L9RA 2H6CA 4U0VA 1FNBA 4BACA 1W7PA 3EETA 3I71A 4WZEA 1LLWA 3DEEA 3O6BB 3RKYA 2BXZA 1DARA 2PECA 4IHSA 3ZCOA 1RIOH 5DS9A 1HKSA 2X51A 2BY0A 1YJWI 3ASNH 3I1FA 4JP0A 1R23A 1UJ8A 1VQOI 4KIFA 1BI0A 2CUEA 2DA1A 3I58A 3LQQA 1JNYA 4FT8A 1S72B 1V5GA 3LSGA 1F20A 2Y0SN 1ZAOA 3CCRI 1YIJI 1XGSA 5LGTA 2ZTGA 2NS8A 1OYIA 2QF7A 2VNIA 5AN9A 2W84A 5H6QA 2CGPA 3CMYA 4AYBN 3BLYA 1Z1DA 3OYGA 1DU0A 3ISXA 2E35A 3S2WA 1Z0XA 1PDNC 2VBXA 3E6MA 3HOSA 4FHTA 1KQ9A 1KONA 4EMSA 4E70A 2GXAA 4N9IA 1HKTA 2HFHA 1TQMA 2VT2A 2LY9A 3CDLA 4EH1A 2O17A 1BI1A 2GQFA 1EFTA 2RN7A 2M8GX 2L7KA 4IJAA 5K5OA 1YLOA 4GYIA 3TOAA 3JQRA 2WJVA 2PQ8A 3KZZA 3HXLA 2XIGA 2R5YA 2A68F 4EJUA 3OOPA 1ZG5A 5LHIA 1FRQA 2VFNA 1KCCA 1IDYA 2CRGA 4DBQA 4ZYHA 2PE3A 3ZMSA 2Q6IA 5LBQA 3KP3A 2XB5A 2W6JA 3S16J 2QKMB 2HNHA 3NAUA 1EFCA 2E5ZA 4E7KA 1QGAA 4F52A 2ME6A 3TMOA 4F93B 3W2AA 1IN6A 3IH2A 1U0JA 3T8TA 1W0KA 2BM5A 4OMYA 1VQ9I 3OYAA 4HAMA 1OCCH 1TWAJ 3O2PE 1NK3P 1Y0YA 4I76A 2CBXA 4I09A 2IRFG 4RD6A 1TQPA 5EG0A 4RAFA 2IOUG 4YZQA 1PUEE 4Z4ZA 4AF6A 5D5XB 1CF7B 1VQKB 4NK8A 3KX2A 1X2NA 1G7TA 3TDUC 2O1DA 1WFXA 4OU0A 1KK1A 1XMKA 1O3RA 2L02A 2OBPA 5TR9A 4O5VA 5FD6A 3CJTB 3MKYB 2IS1A 3QYEA 3TW7A 1MW7A 1Z6TA 4BJ5C 2R7RA 1T38A 1N05A 3V76A 3HL2A 4ANJA 4BXFA 1UHWA 2MC4A 1VHEA 2ZZEA 1S8NA 5GP9A 2BGJA 3FISA 1J09A 3CTAA 5FL7A 3DEWA 2HEOA 2BHYA 3PL8A 2CV0A 1XDUA 2QBYB 1ITYA 2CFXA 3QOPA 1O88A 1GVJA 2XHKA 1P4XA 2OZUA 2BXYA 3AVXA 1S5LC 4KIGA 3ZQLA 2F5VA 3PA2A 1Y1WJ 4LG3A 2GXBA 2CUZA 3Q9VA 3L2WA 3VMVA 2LDUA 3KEQA 1KU7A 4OPVA 4RJLA 4B8XA 2R7SA 3OPOA 3VB2A 2AHQA 3FKJA 4GXOA 1NHAA 4L0ZB 2R4GA 2KRFA 3TQNA 1IXSB 3IC7A 3P5JA 4ZZLA 4UNOA 3WTUC 1P6RA 3QYBA 2XROA 4XIDA 2CQXA 2IT0A 4N3NA 2XRLA 3ZQFA 4OPSA 3WQZA 4BHBA 1BN5A 1APLC 2GLOA 2R5ZB 3H0DA 1TW2A 4QSHA 2YUHA 3MD2A 1SD4A 2JMWA 2AS5F 4M3FA 3G05A 3MEXA 2A3SA 4A3IJ 2STTA 3I9V2 1V0FA 3SEQA 1ZK8A 2ODLA 4AC0A 4ZZDA 2PMZA 3BY1A 1ZM4A 4A12A 4BQQA 1SVMA 5IYQA 3B8YA 4YZXA 3B78A 3HG9A 1E2XA 1SFOJ 3CD6I 3K4BA 1CNFA 3KP4A 5EJCA 1XMXA 2E7WA 3BJ6A 2QDXA 3CC2B 3PSFA 4MEXF 1G7CA 2FBHA 3V7SA 3ZN0A 1RWRA 3DF8A 2OF7A 4IF4A 1BBYA 2LOOA 2WAQN 3RKQA 4S04A 1QUEA 3EDPA 5IK2A 1MSFC 4B48A 5EGOB 1F5TA 3BY2A 2KVOA 4ZH4F 4TT3A 3GWZA 1IGNA 1OHHA 1TYVA 2XNDA 4A69C 2XGEA 4JYKA 2Y0MA 2XZOA 2HVQA 3K4JA 1DDNA 1Z77A 3ZGKA 3JRBA 3BNWA 4UZFA 3QOEA 2M5WA 1ETKA 4CO8A 3Q6RA 4U4BA 1HSJA 2UV1A 1GXQA 1J2XA 1G4DA 3FXRA 1AOYA 2K9QA 2F4IA 1WU8A 4W1UA 3SYJA 2WBMA 5CVUA 3OYFA 2HCJB 3K10A 2JSPA 1N77A 4UZUA 5FIUA 4NHJA 2V7QA 5L3EA 1DG1G 2EZIA 1WZ2A 3Q38A 3CCVB 4Z4SA 4YDTA 5TJJA 4YAOA 4YZ0A 5BNGA 5HDGA 2VQGA 3ASSA 1MBEA 5LHGA 5HOOA 2GWRA 1XB2A 3JRCA 5DYMA 3CCJB 4S0HB 4ZCLA 3V42A 1VQPI 1FY7A 1Q9SA 3PSIA 4P1VA 2OQGA 3UKGA 1QU3A 2BPOA 3B8HA 4YC5A 2JT1A 3P4GA 2TDXA 4CYCA 1YHQI 4YFXF 1XCBA 4C3HJ 4Y9RA 5EGOA 4WK8F 2VI6A 1RQPA 3PSSA 3I54A 4IOCF 4N0BA 1A8PA 5J1UA 4BU2A 1Q81D 3E5UA 1MBJA 4CSWA 3VO1A 1LFUP 3RTRA 1N75A 1EF4A 1NK2P 1YJ9B 1J0RA 4ZDPA 1QBJA 4P3YA 3GMEA 3OIPA 2W7ZA 3C7JA 4I84A 3SJMA 3G1LA 1SAXA 2DY1A 1MNEA 3A8IA 5A89A 2YS9A 2CV1A 3D5RC 4KN7X 4RA2A 5H20A 3GFIA 4Z4RA 2HDCA 2KL4A 2IEKA 5LFAA 5TRDA 2VBZA 3ZPLA 2HI3A 1LE8A 3K4LA 2ZMEC 3FK6A 2DERA 1R5HA 2P5KA 4BBRJ 3D26A 5KW9A 4RLFA 2Q6KA 5L3DA 1BOBA 2EFNA 4DZPA 4TMWA 4I7HA 3OZVA 5DUKA 2WAFA 1BR4A 1SD7A 2DU9A 4Y13A 4TV7A 4Z2YA 4EGZA 2X3HA 1W2BB 2GZWA 1VQNI 3BDDA 1VQNB 3CF5F 4PSXA 3AAFA 1BC7C 3NB2A 4E4HA 3GZNB 2GJRA 4KT5C 1IN7A 2XSJC 4A0XA 3B6AA 1MMGA 4OZYA 1G3YA 2P0WA 1RRJA 3BZCA 5EDNA 2DYSH 1QA2A 1UFMA 1IV6A 1FSEA 5HLIA 1PJRA 3PENA 2DOEA 3DXJF 2VKEA 2X48A 1WH7A 2DMQA 2KKOA 2QQ8A 3EYYA 4XKVA 3JU4A 1W0UA 3PIPF 4BNCA 3PUBA 2OQRA 3WE3A 3Q3AA 3GFJA 2INUA 4C2LA 3LVBA 1IXCA 3DPLC 3NRVA 3IH3A 2IA0A 2EJRA 4IXAA 5HDNA 4LB6B 4KYWA 4DYCA 1B6AA 2Z6BD 4RD1A 3PSZA 2HVSA 4EJVA 3DTKA 5C1CA 2DOFA 3ZMZA 2KIFA 4EEFG 5H2FC 3CJRB 2O8XA 3Q6QA 4Z4VA 3V8JA 3DU5A 1XSVA 3JRGA 1QX4A 2C4TA 1YHQB 5B5EC 3PFIA 4M6YA 1BN8A 1WJBA 1P4WA 1B8IB 2ZBKA 2W85A 4E0FA 1U6GA 3S1RJ 2BM0A 2DA5A 3VYRB 3R6JA 2LZJA 2XT2A 1ELOA 2QE7A 3L2VA 1BX1A 3PUNA 2DMTA 4JOMA 3ZOBA 3EUHC 3BCDA 1W5TA 4A3JJ 2P3MA 1O8KA 1ETYA 2HQNA 5TY0A 2EINH 1HG8A 1O7LA 3K6GA 4XONA 1MJ9A 1RUOA 1B9NA 1RNLA 1USTA 4TMVA 2X6WA 4J01A 3FBIB 1GUUA 3QWLA 3VWBA 4TN1A 4ABZA 3OJWA 1A31A 1H8AC 1YW7A 1W4MA 2H8RA 2MH9A 4NC7A 3VMFA 3WODF 1TTYA 2QSFX 5CKTA 4D7NA 3RPUA 1KD1D 4G12A 1R5NA 2DLLA 2IVMA 3LAJA 1HLVA 1DDGA 3ZIAA 2XGCA 5JLXA 5JFRA 2MW8A 2X0KA 4II2A 3SZGA 3ZMTA 4BQAA 1GXPA 2PLYA 2OK7A 2F5EA 1EFUA 2E1OA 1H89C 3ABTA 2EFQA 3DTEA 5C4XJ 3W2FA 3OFNA 3PM1A 4XSXF 3VODA 4ZJZA 3W2GA 1OFDA 4X7EA 3DLAA 3ONYA 4G7XA 5F08A 2WZPP 3F0CA 4XLHA 1NHCA 1UD8A 1W5SA 2JPBA 2Y31A 2V4DA 2ME0A 4HDUA 4X7FA 3AG3H 3E3VA 4A2UA 3AG2H 4CICA 2BM1A 2DT7B 1QVGB 1FX0A 3OYCA 2CFOA 2RAEA 3QE2A 1FYMA 2VFMA 3F23A 1JKRC 1ZR2A 5KNLA 3GFLA 4LBYA 3QPSA 3BP8A 3GVKA 2ELHA 1XCVA 3B73A 1X1DA 4KKUA 4OOXA 4Z4UA 3MAJA 2VBWA 3ASRA 3DU6A 3OOCA 4ZTJA 5M5XJ 5L46A 4V2GA 3FM5A 4G1VA 4M0LA 4W8RA 2C78A 2F4OB 3CCUB 1WVRA 1PKVA 2YWHA 3S15J 2JRMA 5DN6A 2KIQA 4MNUA 3W2EA 2M4KA 4KISA 2QWWA 4EGYA 2RC6A 1BI2A 4GO1A 3JR9A 2IP2A 1CQXA 2M45A 1UG2A 1U8BA 3T51B 1IUYA 1PLUA 3SUCA 2Z1DA 4BE1A 3I56I 2GREA 4IO9F 5BPDA 4MLOA 5BSXA 1W35A 2CF4A 1V0EA 2D2WA 3KEYA 5H5JA 5ILVA 1YI2I 2KP6A 1H0MA 2IS4A 5J1RA 3OAAA 4DNTB 1O8HA 3QPHA 3S2DJ 3RZOJ 3CF2A 1I50J 1HKQA 5C1EA 4AD9A 5E8IA 1VQ6B 5K7HA 4NC6A 1ENHA 1E62A 5IYWA 1YLFA 1KGSA 1BX0A 1IZ1A 1YRNA 5E1XA 2CUFA 2XC7A 2VASA 1RR8C 1RQRA 3GTKJ 3OZUA 2FMYA 2OTJI 3BG3A 4MYTA 4A5NA 4HF2A 5A2QZ 3EQOA 1RUNA 1MD0A 1HW1A 3CCMB 2NAZA 1GJRA 2VN2A 4HYEA 2BE5F 2EFPA 5JMCB 1YX2A 2RQQA 3F8FA 1MBHA 4CYDA 3GZ5A 3G4SB 2H27A 1SKYB 2ZL6A 1FJLA 3GTPJ 3S8PA 1KK2A 1WI3A 4LBZA 2DMNA 1O3TA 4CA0A 2J7KA 1QPIA 4HE5A 1ZN2A 5DM7F 2J8KA 1FMWA 4EQQA 4CXFA 4NDLA 3ZQCA 1S3JA 1LLZA 1QZYA 1M1EB 1T2KA 4V02C 1X3WB 3M8JA 1TVCA 2JIZA 4P96A 2FBIA 5FKKA 1XFOA 5CVJA 2EZHA 3U2RA 5E1ZB 3TKYA 5F27A 4BJ6C 3I4PA 3ZZTA 3IL2A 4HIZA 3N90A 3JSPA 1LB2A 2XAHA 3HAGA 2LKPA 2Q1ZB 2JSCA 3OJXA 5TV2A 5LEKA 4UV8A 4ZGNB 2K5CA 1S72I 3F8BA 3G1MA 4XMYA 3T1BA 2VJ5A 4CUGA 2BGCA 3BG7A 4C3JJ 3KIOA 2D3LA 2OUMA 3W3CA 4YAFA 2HYJA 3J81k 3M1EA 1T98A 4XL9A 2X4HA 4NBQA 1D0YA 3HOXJ 1IJWC 2IQ7A 2VNKA 4A3FJ 3Q0VA 2JA7J 1NB9A 3IAS2 5LGNA 2BW3A 1NG6A 1SVLA 2PJPA 3FWEA 1E79A 3PA1A 1T6ZA 3GXOA 3N97A 5DNSA 2L9NA 1XDSA 3O8HA 3HRUA 1UD5A 4OOVA 2ZCWA 4OJLA 1JUPA 4U0WA 1G3WA 4KDPA 1RI7A 2HKXA 2JVGA 3GTGJ 2HOAA 1JGSA 4JX4A 3FBNB 4QVAA 1HW5A 1R49A 3IH4A 4V19K 3PO3J 1WORA 2BMWA 4FN5A 2RNGA 5LEJA 1WPKA 1JRGA 4YFKF 3F6OA 3P9CA 5KCMA 3PIOF 1K8FA 1LDKB 1VQPB 4MYUA 2ZFWA 5EZGA 1QO0D 3IRRA 1YJ9I 1E1QA 4CCOA 3OW2B 5K7ZA 1HDDC 3ZPNA 1STZA 1L0OC 1NRKA 2CW5A 1E63A 5L3FA 2IJLA 2HYGD 4IHTA 2NSTA 2DJIA 2HDNB 2HS5A 3T0YA 1WSRA 2YSRA 2Q6OA 3TEDA 3ZZUA 1PE9A 3CUQB 2LTPA 2VOPA 2JN6A 1O4XA 4RB3C 3F22A 3RKWA 3FXOA 4AIDA 4DBRA 4F91B 2OAZA 1Z7LA 2CRVA 2ZITA 3CPXA 2BVLA 4MHGA 2R7OA 2ZJRF 1O8EA 5E8GA 3FK7A 5K5QA 2D5VA 1FNCA 2XF6A 3RSNA 4LB5A 3AKZA 3CCQI 2CQ7A 5F1RA 2KDOA 4PGHA 3A8KA 1F36A 1KYZA 1UZCA 1DBOA 2ZO4A 2ZZGA 2ZNYA 2JJ2A 1VQ4B 1R1UA 5HODA 1TUIA 5EMNA 1T95A 3SZTA 2XAGA 1JHHA 3ZRGA 1E1RA 1T33A 1T6YA 1WMRA 3GQ8A 2CWEA 2DPDA 2XVCA 4CCJA 2DODA 2VKDA 3AGPA 4DZJA 3I55I 4BY7J 1PUFA 2E1NA 1UELB 5LD2C 1RMGA 1YYVA 4RBOA 3S1MJ 1MDMA 2P5VA 1ZLKA 1DUXC 2XPVA 2L9SA 5F0CA 1U78A 3CB4A 2GXGA 2B7CA 3MQ0A 2OZ6A 4G8XA 3WTSC 2ECBA 1SD5A 1P9QC 1XSXA 3R0AA 2HOSA 3GVLA 1X0CA 1QH0A 1K6YA 3OR2C 1MKMA 3OYEA 3QRFF 4XK4A 5ICCA 2JUCA 1QRBA 2HYFA 2L7FP 1JE8A 1MMDA 3K4CA 1KTWA 2V1NA 1ZRFA 3O8GA 2ELKA 1E3PA 4IHWA 1HF0A 2EPFA 1Z3YA 5FKNA 3ZMDA 4A93J 2ZZQA 4FX4A 4M9SA 4Q7JB 3BG5A 1V5EA 3ML6A 1QG0A 5J3OA 2X8KA 3LA2A 1OB5A 1T56A 4M73A 1N06A 1U5TA 3OKXA 4KJZA 2M0MA 2HDWA 3DKYA 1EP1B 3ASQA 4KKSA 3LNNA 3J7AY 2XZLA 3ASTA 2Q2EA 2L7MP 4F3QA 3FDYA 1QPMA 3ZQHA 2DW4A 2ZXJA 4OAYA 1NJID 1BOAA 5A88A 3ECOA 2NYXA 3OIQA 4M1KA 1R36A 1RKTA 5F1JA 1H8HA 4BH9A 2OJED 4FK8A 1IAWA 5HLTA 1AIRA 3U1KA 2WV1A 3HHHA 1J5YA 3K4KA 4LJZF 3RPQA 2KLOA 3GTOJ 2JWTA 2V9KA 2WC2A 3A4CA 4XLFA 2ZJPF 2R7XA 4Z4TA 1Q1VA 3L2RA 1UMQA 4CZZA 1OFLA 4JMQA 2GQQA 4IRGA 1OCTC 3P26A 3I59A 3SJZA 4DGWB 1S9HA 2DCUA 2XTXA 1MMAA 2IPQX 1JTXA 2E5NA 5B66C 4O3MA 3A2KA 4M6XA 4IRHA 2NNNA 3W6KB 2NOGA 4L0YB 1P4AA 1B8IA 2C6YA 2LF8A 2MSYA 1AWCA 1QNTA 3SLNA 2UWMA 3OYMA 1FYKA 3SEJA 2VC0A 1YIOA 2M7AA 1VQ6I 1W0JA 2XNJA 4ASUA 1Z6RA 2OC6A 1IV8A 4X7DA 3JX8A 1Y0NA 4FE7A 3P9KA 4M53A 3WBJA 2W48A 3HC7A 4XOTA 3BR3A 2IA1A 1R4MB 1NTCA 4AIKA 4FCYA 3R4KA 2V5IA 2BY1A 4HNTA 2K4JA 2V7WA 4G1BA 1X2MA 3VNUA 1TNTA 1BJAA 3ISPA 3CC4I 3SXYA 4P6VF 3KL9A 2L7ZA 3F8CA 1YX5A 4PFPA 4L9VA 3VYSB 1R5GA 4OPOA 2EQRA 3AFHA 3ZQ7A 2X3UA 2D1HA 1X1CA 4ZCMA 1VQMB 1AIPA 2QYOA 2VXZA 5ILUA 1Y8QB 2GAUA 4M3BA 4ZYGA 2K27A 4FX0A 1SFEA 5FLXK 1IUFA 3QP6A 2QTZA 2C2WA 3NARA 4HW0A 2XKPA 3G4SI 3WNDA 3HIFA 4AWXB 1YJNB 1TYUA 2Z33A 4HNUA 1RPWA 1TWGJ 3OYKA 1SVOA 2R6HA 4WWCA 2CW0F 2EIKH 3CCLB 1G7SA 2V31A 4P26A 4ZYEA 2O03A 1K73D 4KMUX 5BMZA 3TH0A 2H09A 2HQ5A 5FROA 3VPRA 3NE5B 2XTYA 3CCEI 1JJ2B 2CC2A 1P7IA 3OMYA 2LBFB 1UD3A 2FRHA 5C4JJ 4L5JA 3KLOA 4HG2A 5FLMJ 2C4UA 2YWFA 3LSPA 3IP4B 4DQLA 2ZFUA 1W0TA 4M74A 1W36D 5LRSA 1G3TA 4E7JA 4IHYA 3H9QA 1MZBA 1R00A 4HE6A 3S3NA 4DNRB 3I53A 4IQ4A 1A36A 3SLDA 4NUBA 5E79C 4QLCU 3A35A 1OCRH 2FSWA 2BM4A 4XORA 5BS6A 3Q0WA 2VC1A 3KETA 4AIHA 2W57A 1Z21A 2FXAA 3QU3A 5CQGA 2I8DA 2KFDA 4EVIA 4Y9UA 4UY8I 1WWXA 2DOAA 1ONVA 3L00A 4V2FA 3H5AA 5E17F 3QFRA 2E1MC 4DNCA 1X4OA 1MRZA 3CO6C 2M7BA 5F4JA 2R9VA 3WWGA 3ZSCA 3WGIA 4UUSA 3S17J 1F43A 1U8RA 1GO2A 2C5BA 2OYNA 5D5WB 1FOXA 2N8GA 2KZGA 3EUAA 4L8JA 1VZ0A 3OEHA 3PETA 3EQLF 3KEOA 4LIUA 4MO7A 4X0CA 1QZZA 4LLGF 3CCMI 1JHFA 4RMNA 3RQIA 4E7ZA 2E1BA 2CNDA 3BJAA 2BZTA 1MJAA 4NQWB 4BDZA 1I3QJ 3FKSA 4IPAA 3QPLA 4B09A 2ETHA 4WZLA 2IS6A 4XKWA 1QGPA 1Z7UA 2DYRH 1ETVA 5JHUA 3AL0B 1Y56A 2G0EA 3HOVJ 1EH7A 4D7MA 2V4JC 2X1EA 3V4GA 3OS0A 2KDZA 2V1UA 4BQNA 2CUJA 3L9FA 1X19A 2M9HA 4XICA 5FA6A 1FBSA 4PUSA 2QSHX 1QRCA 4YEIA 4YIFA 4BBSJ 2HTJA 4RM2A 3JRDA 3K2AA 2F6CA 2LKSA 4GGGA 3CUQA 2BYVE 1TL8A 3A8JA 3COAC 3FHZA 3FZVA 5FJ8J 4HNVA 2Y9ZA 3B4NA 3P9IA 1UHMA 2AQEA 2GPJA 4URRA 4ON0A 2M8EA 2PFBA 1E17A 3OL3A 2VBMA 3OL4A 4OIRF 5CPRB 4UUTA 2R3SA 4F55A 4M9ZA 1BIBA 2DT5A 4WCGA 1VQ5I 4HX8A 2DA4A 3AVVA 3S32A 1LNWA 4CGZA 4RGSA 4PFOA 3HSRA 2IGMA 2F5CA 1R22A 2OU2A 3KYDB 4A5MA 4BS9A 2GJPA 3ES9A 1H85A 3GX4X 3BT9A 1XG2A 1POGA 4BKXA 2FQ4A 1E3XA 4HV5A 1ULYA 2EIJH 5D4RA 4RD3A 2XTWA 3BTCA 1W7PD 2ID3A 3GLLA 4P6YA 1B23P 3MHPA 4YIIA 2W7NA 4M4SA 4ZTFA 1KU3A 4YALA 3BJOA 1A5JA 4BHCA 1EV7A 2F5FA 2B0LA 4M6VA 3LYCA 3HUGA 4OJ6A 2VKHA 4OJPA 1K7AA 2VNHA 1D1CA 3KPHA 1ZRCA 1TT0A 2VPRA 4D1QA 5IT9K 4HSRA 3W5VA 1VQKI 4C2MJ 5F64A 3TO6A 1CNEA 1XGOA 2XGDA 3CC2I 3JQQA 3CC7B 1W7PB 3TOBA 1MNMC 2OBSA 4YRVA 2LYCA 1JTAA 2MLKA 5FKOA 4UZEA 2TCTA 1JKPC 1UD4A 4BQOA 5HKKA 3MMYB 1IN5A 4L9JA 1K9MD 1BM9A 2DMPA 2VYQA 1ETOA 5EYRA 3SYTA 1T8IA 1GAWA 3W5UA 1D8KA 1VLYA 3SZEA 3S93A 1SC7A 2VJ4A 2XZPA 2COMA 2NVQJ 1IRZA 4XSZF 2XSDC 2E2JJ 1QCXA 4YZAA 4G7WA 1YRNB 1QA1A 3K4NA 1ZM3A 2A5YB 4DW6A 2J8IA 3OZWA 1MH3A 3X2QH 3PO2J 3ZZ0A 2UVEA 5GAGJ 1ZG3A 2E60A 2F1LA 2PMZN 2R5ZA 3VO2A 1UG0A 1VHOA 3KZYA 4YAWA 1P2FA 2Y2ZA 5GTHC 5B6IA 1VFCA 3QFSA 1XX5A 2IAIA 2M1BA 1EWYA 2P4WA 3ABKH 3ZQGA 5JI6A 2O0WA 3ABLH 4S05A 5BPIA 1BPLA 3KP6A 1BJZA 1K28D 2K3PA 1DPUA 1I6HJ 4U7DA 2UVFA 2LR8A 2PYGA 4PSWA 2P5LC 2R7WA 1PUFB 1R5BA 5L3CA 2IS2A 3SZPA 3V7CA 1DABA 4DOZA 3J7YJ 4J00A 3GEZA 5H6RA 2CU7A 1SM4A 1YQAA 2MD0A 3CC7I 4FASD 2E2HJ 1UB9A 1JKOC 4MEYF 1CGPA 3GTMJ 5K1YA 2FJ1A 4CDGA 1KCDA 3H5NA 2KMUA 4XRMA 5BOXA 2QQBA 5BSYA 1LEAA 4MQVA 2L4MA 1D1AA 2DPUA 1FRNA 5THXA 1ZARA 4XRSG 3CCUI 1HDPA 2IA2A 1FP1D 3DV8A 4BPRA 3BR2A 2CO5A 1MH4A 3K2ZA 2M3AA 4L5IA 4RB1A 1O3SA 1P4MA 4NCNA 2UXNA 1S29A 3I3LA 4L9TA 2W24A 2ZL5A 1JJ6C 1XPXA 3DTIA 4I99C 4JK1X 3ULQB 4WZKA 2X1DA 1YX3A 5ICFA 2NT9A 1XD7A 2IXSA 3F21A 1GAQA 2V26A 2R7TA 2BHZA 5IYCJ 2DT6A 2ZBUA 3TGNA 3HEFA 2BEOA 4PCQA 2B63J 2FVGA 3M1CA 4RLZA 4LITA 3A02A 1BW5A 3T53B 1VBLA 1IA5A 3SQVA 2QQ9A 2F5DA 3QP5A 4R79A 3BQJA 3VMWA 3RI4A 3RIQA 2Z5UA 4XR6A 1OLTA 2ZXHA 5TISC 1FTTA 1IW7F 4UHTA 2D3NA 4EV0A 1WJFA 3LQEA 2CG4A 2CW7A 3FKIJ 2RVCA 4F7ZA 1A6QA 3OYBA 4FISA 4QWQA 4BE0A 3MZHA 2EWNA 1OGIA 3GSIA 2XAJA 4A3LJ 3VSVA 3NQOA 4YHBA 2OTJB 2D74A 3WXMA 1H9TA 2EFWA 1OGOX 1H9GA 1RKWA 1X3ZB 1LE8B 2DEUA 1RC9A 1BHEA 2J5OA 4B43A 2DJNA 1CQTA 1IRXA 3K9TA 4KUMA 3DFGA 3DKXA 4L18B 3BC8A 1EA3A 2RC5A 3HRMA 5HNFA 4LLLA 2QLZA 4RPBA 3CZ6A 1VNDA 3IAM2 3JCUC 3NEUA 1TBXA 2F2EA 4EJOA 3L2CA 2MH2A 2PEXA 1S7EA 2G7HA 4OPWA 4DYQA 4BHPA 4RM0A 3CCSB 2NNYA 2FNPA 3FY3A 3H92A 2R7DA 4BE2A 2A61A 3PUFA 2FE3A 3H3UA 2M34A 2PMUA 2BOLA 1LDJA 3M7GA 4A3CJ 2L54A 3H5RA 2WA0A 1XSDA 4OIPF 1ERDA 1KYWA 1T0FC 5IP7J 1BQEA 3OEEA 3CQZJ 2NTBA 2KT0A 1TZLA 3NWTA 3K1PA 4C2UA 2DETA 1OFMA 3WU0A 2QXZA 2LLKA 1YFHA 1CLWA 2JRTA 2QN6A 1WHUA 2K86A 2QUFA 3WU2C 1OB0A 3GFMA 4H4KC 4PZJA 4P3IA 4OIOF 1WI9A 3F6VA 1NG7A 4E7HA 4RGXA 1WSUA 5KVRA 4KICA 1G3SA 2EV0A 5CVIA 2ISYA 3GZ6A 1KJZA 1VLOA 1WJDA 1O8MA 4FXUA 2L0KA 3I64A 2JDIA 4IHVA 2FOKA 1T6SA 3H36A 1TSPA 2LD5A 1MMNA 2WAQA 1SMTA 3QYFA 2PMDA 3WY9A 4X05A 1I27A 2BW3B 2ZTNA 5B1BH 3L09A 5E3LA 3DKWA 2VE9A 1AU7A 3HTUA 3LL7A 3ZMVA 5FLXZ 1W34A 1EH8A 2M0CA 4LBVA 2E34A 3DQVC 4ZYDA 2XGJA 1QQIA 1HW2A 3DWLE 3ZN1A 3S3MA 3OE7A 2KJBA 2LY1A 2UXXA 4P9UA 3S3OA 1JA1A 2IGKA 2GA2A 1KK0A 3UNGC 4XD7A 4HZFA 2DTRA 3HGYA 4OIQF 2PIAA 2D9RA 2R93J 3RKXA 1TWHJ 3CCLI 1OYYA 2HZTA 2QZ8A 5M5YJ 2WJYA 2Z2SB 4A0YA 4CH7A 3CCRB 4WXDA 3ONQA 2NSPA 1Q1HA 2W82A 4ZGQB 4BEHB 1R4NB 2F48A 4OINF 3OYHA 2VQHA 1YJNI 2OA4A 3H3VK 1KC8D 4LK1F 2VJJA 2V1XA 4Q47A 4QUZA 1LM1A 3BCBA 3A0HC 1WJAA 4U9UA 2JA5J 4QPOA 2JA8J 4A3GJ 2DYIA 1N8RD 1O8IA 1QVUA 2DAOA 3BR1A 5FKLA 2K4BA 2L5QA 4UVCA 4ZDLA 6PAXA 4YXWA 4LLNA 4ZYAA 5HXBA 4MTEA 1JJ8C 1FIPA 3I4MJ 3R6SA 3WTZA 2VBVA 2R5YB 3V7RA 1AKHA 1ZH5A 3C1DA 1BLIA 4ACAA 4F7DA 1ZHFA 4XNFA 4HDVA 4RCZA 1F1ZA 2BY3A 5FD5A 4G7HF 4TMXA 1O8JA 4Z06A 4YAUA 2CK3A 1QQ1A 3FXMA 1YE9A 2WB1N 4IL6C 3ZXSA 1DP7P 4UB8C 3DU1X 3MFKA 4CZCA 4U87A 2V7VA 3IKVA 2XGXA 2JTVA 1FOKA 4ROXA 4HV6A 4HLYA 2VKVA 4HWVA 2WSSA 4AU7A 2DFIA 3K7AJ 2CQQA 5A2QK 2HLDA 3DEUA 3Q0UA 3AVWA 3IWFA 2V9VA 3ESWB 1T39A 1UAAA 4NBSA 2QTLA 1OFCX 3SDBA 5J8CA 1XS9A 5FB2A 3ZC3A 3CMMA 4P25A 4ENJA 2TRTA 2GA1A 4HF0A 1ZELA 3QFCA 1ETWA 2VBSA 2W00A 3WTWC 3S1NJ 1VQ9B 4BGDA 1DPRA 1EP3B 2M87A 2XPWA 4HEA2 4Y15A 1K78A 3HOYJ 2QGGA 3LQ6A 3NAWA 2DQLA 1VJSA 2V9PA 2HKOA 1DGRM 1YJWB 3WE2A 4UUVA 4G7OF 2YU3A 3G3ZA 4WZTA 2OD5A 2RNJA 2O0VA 1F4KA 3G2BA 2GOXB 1OJLA 2YX4A 2DIEA 4A6EA 3AVYA 3LSHA 2QM3A 3S2HJ 3QSYA 1XTAA 1X1AA 5FGMA 4D5CA 4ENMA 1VQ8B 1YW8A 2H6BA 1D8JA 4PC2A 1ZREA 3CLOA 5ICEA 1EJ9A 3M3YJ 1R6RA 2BV6A 3PFYA 1O7FA 2NT6A 4M3EA 3L2QA 3CCSI 4EJWA 4X06A 2UZKA 3RJPA 3GBGA 5FFXA 4IW3B 3A03A 1U2WA 2VZLA 1VI0A 1FIAA 4UVBA 3GIRA 4WWVA 2CSOA 2RGVA 2COBA 1IJFA 4PJJA 5E18F 3J81K 2BV3A 2NVXJ 4M3GA 2DOGA 3I56B 5GAEJ 1HXDA 3U6KA 4B44A 3ROUA 1BW6A 2EFOA 1GQ8A 1N07A 3FXUA 2E1MB 3JQPA 3H9NA 2JPCA 3C3WA 3JAMZ 1Z9CA 2VBTA 1D0ZA 4RGRA 2KHMA 2GM4A 1VQ7I 3I5UA 3GF2A 2XT4A 2J5PA 1MABA 4XBFA 2PG4A 4L5EA 1OISA 1K5CA 4TMTA 3H9JA 2HU9A 3BQYA 2LSOA 2O6GE 2FQ3A 3E7LA 3KYCB 1WJEA 3O3KA 3TO9A 4ESFA 3HRSA 5HZBA 1YG2A 2I1LA 2O0YA 3K70C 5IYNA 4B3AA 1J59A 3PQKA 1VQ4I 2IGNA 5KK1A 1FC3A 2GOMA 2EH3A 2EILH 5M3MJ 4DQKA 4P2NA 3LA7A 3K0LA 3CCVI 4E7LA 1MIJA 3AL0C 1EZGA 4BUPA 1AA7A 1TQIA 2WY7Q 3FIWA 4GYGA 2GIZA 2FA5A 4BEHA 4YFNF 1TP4A 2QCOA 2BX6A 1O57A 2EV6A 3JRIA 4QVJA 5J40A 4BJTA 1G7RA 2ZZFA 5CYVA 1GV5A 3CUOA 3WHCA 2P81A 2RDPA 2V1DA 5GPAA 4ESBA 2R0QC 3HTSB 1QVTA 2V7TA 2K40A 4YELA 2L01A 2PJRB 2VQCA 5GADJ 4AVZA 4MR0A 1WRJA 2CJJA 3D5LA 3N4MA 3H94A 2WV0A 1YO5C 3ZUGA 1OYWA 3FXJA 4P12A 3LOCA 1S6LA 2ZC2A 3AG4H 2VIXA 3GCMA 4OAZA 1WSVA 1AMOA 1SAUA 1G6NA 2JZYA 4K1XA 5LLQA 3BR5A 2VBYA 9ANTA 1F60A 3A01B 1SFUA 3CMEB 4LG0A 5HS7A 1RZ4A 5KAFC 4RAGA 2VOOA 1HQCA 2V6CA 1VQOB 4LBWA 1ZG1A 1ZKGA 4XKBA 3RYPA 4M3DA 3W6VA 2INVA 4U49A 2Y30A 4Q5SF 1NH3A 3IRQA 4IHXA 5L3GA 4P22A 1FBUA 2Z99A 3L2UA 1ORKA 2W25A 3MZ8A 4M9XA 1FOYA 1ACIA 3I55B 2C5HA 1HA8A 4RB0A 2B9SA 3Q3SA 2BM6A 5FKMA 1IG7A 2HXOA 4CCLA 3FMSA 1V5VA 2EWEA 1K6OA 3R6KA 5J4YA 5DM6F 2WR8A 2GK7A 1EXMA 3DPTA 4QHYA 3ZBTA 3LFKA 4CCNA 4HBLA 1UHSA 5CVRA 5F0HA 4PJ0C 2X1CA 2E36A 5J8FA 4FQGA 5H59A 1BJKA 2VBEA 1XMAA 1IO2A 5JHFA 3HJEA 2Q8KA 4E7IA 2VONA 3OYLA 5DCMA 1J7KA 1V54H 4B47A 3WNCA 3A01A 4AF7A 5EEAA 3VSUA 4ENKA 1WJCA 1LVAA 2K9SA 4XRFA 4F92B 4N4OB 3MKZA 3ONUA 2HVRA 2K9NA 4MGRA 5TGTA 3LQRA 1R1TA 5DD8A 3MKLA 1W9XA 1HSTA 3E97A 3A3GA 2EIMH 3DBLB 3HPHA 4LIVA 3ML3A 1IF1A 4BYYA 2Z9OA 4OJ5A 1G2HA 3M07A 3I59B 5HNHA 2YX7A 3MWMA 5DDGA 2MGQA 4G6TB 4HPQA 4X1EA 3ZR8X 5EG0B 4NC8A 2HXIA 3LFUA 4X6AJ 3LMMA 2HQAA 3Q5FA 4IKFA 3WTYC 4RB2C 3C2BA 3E6BA 1A35A 2EBIA 2V79A 5L3BA 5F4MA 3K4MA 3HSEA 4PK4A 1FSHA 1OCPA 3ZBUA 1HVXA 2DDAA 2DBBA 1ZUNB 2YWEA 3BH6B 1QFJA 1IJEA 4ESJA 3B82A 5E1WA 1BL0A 2ICWG 3D0SA 2OTLB 1Z91A 1XGMA 2DN0A 3M8FA 1Y0RA 5AONA 3GQBA 4RDJA 3CP8A 2XOKA 1ON1A 2L2OA 4FE4A 3BOQA 1B72B 1QFZA 2QGUA 4IQJA 1S7AA 2QEXI 1VTNC 4PC1A 4U88A 3IWZA 2KISA 2G0YA 3DCFA 2OTLI 2LY2A 3VR6A 3F8MA 1ETQA 2Y48A 3REOA 4NK6A 3G6EB 3KE2A 4M72A 2H1LA 4OOIA 1N25A 3RZDJ 4TMZA 2OPTA 2K9LA 1OR7A 4LFUA 1Y8RB 2FUG2 3LSMA 1ZM2A 1M90D 4HQMA 1FBQA 3A1PA 5FNZA 4EW9A 3RPUD 1LQ1A 4K2EA 1J75A 4IOAF 2WPDA 3ABUA 1B9MA 2JVHA 3IHUA 3TP0A 1SEUA 1PXZA 3HM5A 2GBYA 2KRCA 3BR6A 1WOPA 4ITVA 3TL4X 1TT5B 4YIRX 4KKTA 5FO0A 2NTQA 1L1IA 3G71I 1WKMA 3CJQB 1IDJA 1FZPB 2DA6A 3HKZN 1Y39A 2LBFA 1NDHA 2ZKZA 3T8RA 3BCFA 5CLSA 1Q7YD 3OYIA 2XB0X 4A3EJ 4R71A 2K85A 4PJMA 2JQ7A 1E0EA 4QFMA 1OPCA 3M8EA 2XUBA 3ZQQA 5F0FA 1V4RA 1E3OC 1GVDA 1L3LA 2PJRA 1TNSA 4X07A 1U2RA 4G9YA 2MBFA 3SY2A 2QX3A 5D8LB 4FETA 1K83J 1FYLA 4RD2A 3BPXA 2NV4A 2R7UA 4YFOA 4Z4WA 2A6EF 2LVSA 3BZKA 3UR3C 3CRZA 2DK8A 1YIJB 2QA4I 1Z05A 2DA7A 4B3XA 3G6EI 1GVHA 1JUMA 1X1PA 1ZGJA 1ZYRF 3J80K 3HOUJ 4DYRA 1R1VA 4ZDOA 3RYRA 5IOYA 2RC4A 3T9GA 1GV2A 5FFZA 1YI2B 1I1SA 5CJ9A 1MDMB 2A07F 4RM3A 5D4SA 3GLXA 2AHOA 4UXNA 2ADUA 4AVPA 3D5SC 4ETSA 1T5EA 3TO7A 2K3FA 1S4MA 4QV2A 1W1WE 3RIRA 2HWVA 5EEGA 2HPMA 3E5XA 4E7SA 3CC4B 1B4AA 3JRFA 1XQBA 5FRMA 4P9FA 1OR7C 2PN6A 3CJNA 3E5QA 3HKZA 2WZNA 5DD4A 2Y75A 3DBHB 3G73A 3QPTA 1ON2A 3KCCA 3WNBA 4B3GA 1ZLJA 3J7AO 3Q9SA 3RCOA 1IRGA 3MZYA 3VYUB 3ZP5A 2B5OA 3AGQA 3SJPA 3M4OJ 4B4DA 4QIWN 4LD5A 4WX9A 5F04A 3CMAI 4ACBA 1RU4A 1R58A 2MFZA 2FF4A 4RDLA 3MN2A 3JREA 2EFGA 2W4SA 3HOZJ 4C43A 5E6TA 5ERIA 2HPIA 3QAHA 1QGZA 4Z4YA 5JLWA 3AVUA 1GHCA 1TW3A 4M2LA 3H0GJ 3EPZA 2CW8A 4WXHA 2NZMA 4Y33A 2DXIA 2VJIA 4YG2F 4X7CA 1Q82D 5J4VA 2R7ZJ 3LO8A 4N4NB 4Y17A 2O3FA 3BTLA 1Z67A 5EEHA 4A6DA 1K4SA 4KITB 3WGHA 1A6IA 3CDHA 1B59A 1JI8A 4DIQA 1J9ZA 4ZV4A 2O7OA 2BSPA 4HOBA 4JRAC 2HR3A 3JSOA 1Z3XA 2DA3A 1K61A 4QPQA 1PYVA 3CXCB 1XGNA 2ZSIB 3FMQA 4H9GA 3EQNA 4Z03A 4U0YA 2L3DA 2NVTJ 2P6SA 3TBIA 4AIJA 1YTYA 2A05A 4XN3A 1B72A 1IB4A 4LG0B 1N0UA 2KIMA 1S0UA 1JKQC 2HOEA 3WTTC 1IC8A 4R8HA 1D1NA 3PVDA 1BIAA 2I5UA 3U1DA 1N08A 1PJ7A 5HDKA 1S7OA 2VFPA 2F4NA 3VNVA 1WPCA 2YUSA 5M3FJ 3OR1C 5HS9A 2FX3A 2O6WA 1BR1A 3T56B 1K79A 1LPQA 3SKBA 2FD5A 1D8TA 3W2VA 3J7ZI 4KFCA 1O8GA 1WQ2A 4Y4RA 2IW5A 3W5HA 3TP3A 3JURA 2EK5A 3ECHA 5IP6A 1YITI 1BR2A 3IKTA 3HOTA 3M9AA 4B4CA 5B3SH 1H42A 4E6KG 4PC7A 3BC9A 2BN4A 5JLVC 1QHGA 2B7EA 2VPLA 2EV5A 1I39A 3WYAA 1J9IA 4M71A 3EUHA 3WGGA 2MABA 2RV8A 4JQFA 2KZVA 4PJLA 3C18A 4LGWA 5HS8A 3FX3A 1DU6A 1ZM9A 3GVJA 1WTHD 4G5GA 1OGMX 2NRAC 4C3IJ 5JR3A 1HOMA 5FO5A 1ODDA 1CF7A 1HA3A 1UMKA 4J0QA 3DLLF 1G8XA 2I10A 2O61A 4PAAA 3BH7B 1B2RA 1HCRA 3KRGA 3VYTB 4XQFA 4FTHA 2RQPA 3PNTA 1MBGA 3WTVC 4GRIA 4DQ2A 2LP0A 2D45A 1U9OA 2MLGA 4C9YA 5BQTA 1KMHA 2DFFA 2NXNB 2B7BA 3FJOA 5EZHA 5E3NA 2E71A 4P1WA 1V55H 4BAYA 2K02A 4Y7NJ 3DDYA 3E6CC 2R7QA 3HPGA 3I0TA 2VBKA 3PQJA 1HC8A 1SD6A 2LH9A 1H8EA 3LSIA 3Q39A 2HDDA 1OOCA 2HGCA 4YEJA 1ZRDA 2JA6J 2XDVA 5IOZA 4XLAA 3R61A 1D2EA 5AIQA 3BG6A 5ED4A 5D5VB 3LMWA 2E19A 3TDZC 4GFBA 1LDDA 5IYRA 2JUGA 1C0WA 1K8AD 1O8DA 2A6TA 2GJKA 2L9VA 3A1YA 2QMUA 2NPFA 2W6IA 4OJOA 5IPAA 4XOPA 2QVOA 2AXTC 4C0SA 2H94A 2FBKA 4CYCB 3FXKA 1REPC 1I18A 2NS0A 2WWYA 1FWZA 4KH3A 3FF5A 2X9DA 3E1SA 3HBLA 2ZJ2A 1GR1A 3ASOH 3F72A 3CW2A 4KT6A 3MMPA 1WOOA 3E0JB 2QEXB 2ZSHB 2HQRA 4RAZA 1UD2A 2WAEA 4H0EA 4BL0B 3FPKA 4A3KJ 4RPDA 2DI3A 3HSFA 3EUKL 1FTZA 1OGJA 1QA3A 1WJ5A 2V7FA 1SFKA 2RKHA 2EZLA 3BPVA 4XLCA 5GPCA 3JTGA 1PJ6A 2E1RA 4PABA 1I5ZA 2LK2A 3K1MA 3OIOA 2QYUA 4UB6C 3JAMK 1N0VC 4XRSA 3BY6A 2QZAA 4A3MJ 1QRYA 3K70D 2BGIA 1TLLA 2EB7A 2OK8A 3QU6A 4IX7A 4I6ZA 2ZJQF 3CUQC 4IEJA 3QODA 4P55A 3BQZA 3LSTA 4IZZA 2WYRA 3HYIA 1O8LA 1D1BA 3VFZA 3OYJA 2R92J 3LJYA 2VFOA 2DCEA 1GLNA 1ZGWA 1ZGAA 4RS8A 3OYNA 1OB2A 4A0ZA 2FNAA 2EA4A 1FEXA 3LWFA 3VSKA 2DFEA 1OFEA 1ETXA 1W87A 3BH4A 4X0GA 4OOSA 5DEQA 4HQEA 2DDBA 4Z6YA 3N6ZA 2Q6LA 4CCKA 2G9WA 3BCAA 5D6EA 3L7WA 1YW9A 5HVQC 1LVKA 1R7JA 1W5CC 1FX7A 2KPMA 2ZXIA 4UAJA 1WXRA 1BA5A 1FLIA 4BDYA 2EZKA 1D5YA 4B1RA 5IT9Z 2M5SA 1FPQA 2Y0SA 1Y6IA 1U3EM 3WU1B 2R7VA 2K7LA 2X6XA 3D1NI 2DA2A 3WTXC 5F6FA 5KHDA 3SFIA 2YU9J 1T6XA 3P27A 2CQKA 3B02A 5B1AH 1ZR4A 2LF7A 4AYBA 1LJ9A 5M5WJ 2QY1A 2AQFA 2NOJB 2W1OA 3CPWB 2LREA 4A3DJ 4WXCA 1X58A 1TYXA 1KZHA 3WHBA 2GK6A 1Y0UA 4HX7A 2P6TA 2H8WA 1LEBA 5F4OA 1JT6A 1PP7U 2Z16A 5HLGA 4DK0A 3TW6A 2YR2A 3FXLA 3MCZA 5IYBJ 5E3OA 2ACJA 2WADA 5C44J 2XEXA 3VOEA 2MC3A 4XM3A 4O6JA 1MSEC 3CD6B 5GTIC 4RD4A 5IT3A 2PI0A 4XLNF 3E6DA 1IN8A 4UV9A 3MVPA 5J6XA 4W97A 5EF6A 1I7PA 3OYDA 3CMEI 2LRDA 2BM7A 5LGUA 1VF7A 2DTZA 1WP6A 2NS7A 5DV5A 1YS7A 2XASA 1W36C 4I0AA 2LG4A 1MBFA 2NVUB 4KNYA 2EIXA 5E20A 1K4ZA 1BMFA 4W8TA 3OW7A 1AHDP 3H3ZA 1EFRA 2FU4A 3ELKA 2C77A 4HF1A 3NWSA 3A3BA 1LFPA 2OV7A 2DQRA 2Z8GA 2KIUA 3KEWA 3HGGA 2Y69H 4NB5A 1UD6A 3ERED 5FRNA 1D3YA 3IUOA 1O8FA 3CO7C 2Q0OA 2ZBVA 1KU9A 3SQNA 4HA8A 2DMUA 1TWFJ 4NQWA 2D1VA 1OCZH 1BC8C 1GDTA 4TKOB 2ECCA 4DK1A 1IHMA 3OY9A 4IVNA 2XAQA 4HLXA 2DFHA 3ABMH 3HZJA 4PMHA 3WG7H 3T5XA 1G59A 4CQJA 3OV8A 3GQ7A 1XB4A 2PBIA 3C2HA 4D9JA 1E3ZA 2QKLB 1QVFB 2KQRA 1P92A 4OWRB 2LMDA 5AIPA 2HOTA 3FXQA 3LNQA 2KRHA 5A8AA 2PYHA 5IY5H 3W6JB 4PC6A 4PGOA 3BZ6A 2XAUA 2VQLA 3QQAA 4I02A 3SDGA 3SHFA 1FOWA 3U9GA 3VDXA 4AUXA 3HRTA 5HLHA 2OBRA 3WBKA 2Z3YA 5DCMB 1JXSA 2IBDA 3GTQJ 2O5RA 4BXUA 1VQ7B 1SANA 1UCRA 2NTPA 4RDUA 1YITB 5ILSA 1KZLA 1CZFA 4C2TA 3U21A 2JJ1A 2GIVA 4ENNA 1MMSA 1D0XA 3H9GA 4GCVA 1NB0A 5JVGF 1KQSB 1VQLB 2XRNA 1MGTA 3E20A 3CLQA 5DUIA 4YCQA 3R0JA 5GV7A 2ZB9A 5C3EJ 1I8DA 5KSWB 4Z1MA 5J3LA 1R5ID 3GTJJ 3OSGA 1EP2B 2X0LA 3OS1A 4W8SA 3OWTA 3HDDA 4UVAA 2FOWA 3V8LA 2E2IJ 4CHUA 3LSRA 2AXLA 1I3AA 2ZNZA 3CESA 3FHNA 1DP3A 2VXDA 3IV5A 1COWA 1R5OA 3PUMA 1WDTA 4JX6A 3AVTA 3PNVA 1R71A 4II3A 3KZIC 5D8KB 1RETA 3CCYA 2O8KA 2PMHA 2YPRA 5GV8A 1QGYA 2VL8A 2JA2A 3DBRB 1JGGA 4RDKA 4N9HA 3K1NA 1MBKA 4FWTA 2F4MB 3B6CA 4PJNA 3K69A 2WB1A 3HUGB 4I0BA 3F3XA 4QTRA 4MTDA 1GT0C 4I98B 1USSA 2H1KA 2STWA 1M1KD 3F8NA 1JA0A 4TSFA 4D5FA 1KU2A 3KP7A 2CH0A 4KA4A 1PVEA 2WY8Q 4B3FX 4UUSB 3GVAA 1I6XA 3KP2A 1ZQ3P 3V8KA 2CYYA 2VE8A 4RAYA 2XF7A 3OS2A 2P7CB 1OMIA 4BXXJ 1WH5A 3LSKA 2XKOA 1E64A 3ZPPA 2ZMEB 3KYLA 2OCCH 1SMYF 3DPUA 3GUDA 1PP8F 2VBUA 3GO5A 2FX0A 4L9NA 3ERMA 2M4GA 3H1CA 1X1BA 3PNYA 2X85A 3OOUA 1YOVB 1XG1A 2UUZA 4JBAA 3GQ9A 4KN4X 1QZEA 5IYPA 4W8QA 1F9NA 1LKXA 5KAIC 2QSGX 1U5TC 2V7XA 1LFBA 4NNJA 2HMAA 3HHGA 1X4PA 5FO1A 2XV4S 1KQ0A 2ZXWH 3G71B 4Q48A 4KIBA 1E3HA 3W2WA 5E3MA 3KP5A 2V6EA 1OKRA 3VEPA 3CMAB 1T08B 1SFXA 1RESA 1MJBA 2ID6A 5DTDA 3RQ4A 3B90A 1FNNA 3JW4A 3BROA 3CDIA 3JTHA 3R60A 4XKCA 1AKHB 4N3GA 1DBGA 1WOSA 2HTSA 3U2QA 2MA3A 2CS3A 3JRHA 1FNDA 2LNBA 4G7ZF 1EA0A 1N78A 4OP7A 1DGWY 1FP2A 4LK0F 2CV2A 4PGGA 3MKWB 1FMVA 3BG9A 2EA2A 3KLNA 1IDZA 5DCFA 4Y52J 4GQNA 2X53S 4EATA 5AMVA 1V5FA 4P9SA 2K9MA 3VSLA 2ZL7A 3V7AA 2QA4B 2QBYA 4G6QA 4PC3A 3CCEB 1IDKA 1WCMJ 4G94A 3U6BA 4Q4ZF 3J80Z 2DK5A 2A69F 2LC2A 4ZC3A 5CDFA 5HZAA 1HF2A 2VFQA 3JRAA 5JVTA 1DDIA 1JTYA 1XC5A 3KFWX 3BTIA 2R7FA 4XLPF 1D5VA 1IXRC 2ISZA 4HX4A 3VSTA 3GYHX 2XF5A 1K4TA 5J35A 1TLHB 2E7XA 4OMZA 1HBXG 3W2IA 4J19A 3FMRA 4R1HA 1FDRA 2BSAA 3GTLJ 4BY1J 1XN7A 1O3QA 1TYWA 1X3UA 2MD5A 4DJAA 5ICGA 2E1CA 5JBQA 2O04A 1K78B 4D0PA 4HSTA 2NVYJ 2F43A 3BWGA 2F3LA 4OM9A 4ZCIA 1I1GA 5K5RA 1TWCJ 1NBMA 3QFTA 2VB6A 4IRIA 3HOWJ 4PDKA 1QUFA 4Y7CA 4OZZA 3GQAA 2CQNA 1VQ5B 1OQYA 1ZTRA 4EM1A 3RY8A 1VQLI 2XC1A 1IN4A 3S14J 1SKQA 3A0BC 3DP7A 1R9TJ 2ESNA 4ASNA 2V7UA 1QJVA 1T0FA 2PLFA 2LFBA 3OP1A 2QENA 3P7NA 4I2OA 1H80A 4JX5A 4XN0A 4C30A 5J1YA 2A5WA 3C2GA 4G6DA 3J81Z 2VNJA 5DS0A 3OSFA 3AG1H 4MIMA 1H88C 4Y3OA 4WQMA 3GW2A 2JN9A 5CQEA 1U9NA 2ELJA 1Y1VJ 2VODA 2BBYA 2WTEA 1VQ8I 3S1QJ 2O9LA 2XNCA
chains in the Genus database with same CATH topology
4DNTB 1O8HA 3D5SC 1T5EA 3CF2A 2MD0A 5C1EA 4FASD 2HZDA 2VLAA 2HPMA 4E7SA 2BVMA 5FRMA 1OR7C 2XC7A 3HKZA 1KCDA 2VASA 3H35A 3H5NA 2KMUA 4MXNA 4B3GA 4G6IA 3N05A 1DQUA 1D1AA 3RCOA 3EQOA 3VYUB 1QHHD 3F9KA 4Z05A 2M3AA 2RQQA 1RU4A 2MFZA 3I3LA 3GRHA 2W4SA 3DTIA 3FPPA 3UW0A 1SKYB 2IGOA 2X1DA 3S8PA 1YX3A 1OGMX 4CA0A 2HPIA 2NT9A 2IXSA 2F1MA 1FMWA 4U7BA 2CMPA 2Q2EB 2V26A 2R7TA 3EPZA 2CW8A 3PJRA 2DT6A 1JRGA 4Y33A 1MNDA 2VJIA 2DXIA 1VBLA 2NZMA 2RREA 3M1CA 4LITA 4YZXA 2X6YA 3M8JA 4RLQA 3T53B 2JIZA 4N4NB 4P5OA 1IA5A 4KITB 1JI8A 4DIQA 4R79A 3VMWA 3CP2A 2BSPA 4BJ6C 4XR6A 1OLTA 2ZXHA 2D3NA 1Z3XA 4HIZA 4QPQA 1EE6A 1PYVA 1WJFA 2ZSIB 5C1CA 2CW7A 2MYSA 3OYBA 4BE0A 3HAGA 2Q1ZB 3EQNA 4Z03A 2K5CA 4HRIA 3VSVA 1HZEA 4XMYA 2VJ5A 3TBIA 4CUGA 1OGOX 3BG7A 2D3LA 2OUMA 4XN3A 3W3CA 1BHEA 1IB4A 4B43A 1IRXA 4CCMA 4XL9A 3DKXA 3SEZA 1D0YA 3BC8A 1EA3A 2IQ7A 5HNFA 4XLEA 3IAS2 1E43A 2BW3A 1NG6A 3CZ6A 3IAM2 1WPCA 4BACA 3OR1C 3DEEA 1BR1A 2L9NA 2PECA 3T56B 3ZCOA 1O8GA 3W2VA 3FY3A 2X51A 1UD5A 4Y4RA 4BE2A 4OJLA 2BOLA 3JURA 4EW9A 3H5RA 1BR2A 2WA0A 3HOTA 1ERDA 1T0FC 4E6KG 3BC9A 3OEEA 1QHGA 1V5GA 3LSGA 2VPLA 2NTBA 1TZLA 2JVGA 3NWTA 2ZTGA 4C2UA 2QXZA 1OFMA 3FBNB 2MABA 4JQFA 3OYGA 2KZVA 3BLYA 4PJLA 3GVJA 1WTHD 1OB0A 2RNGA 4H4KC 3HOSA 1NG7A 5KCMA 4E7HA 1G8XA 1KONA 1LDKB 1O8MA 1WJDA 1E1QA 4CCOA 3KRGA 3VYTB 4XQFA 4FXUA 3ZPNA 3PNTA 2JDIA 2O17A 1NRKA 4GRIA 4C9YA 1KMHA 2NSTA 1MMNA 2WAQA 2DJIA 2L7KA 4P1WA 3QYFA 2WJVA 2BW3B 2ZTNA 1PE9A 3HXLA 3DDYA 2R7QA 3HPGA 2VBKA 1KCCA 3LL7A 4DBQA 2LH9A 4DBRA 4F91B 1H8EA 3LSIA 1Z7LA 3DQVC 2BVLA 2XGJA 2R7OA 4YEJA 1OOCA 2W6JA 2XDVA 4XLAA 2QKMB 2HNHA 3DWLE 1O8EA 3BG6A 2E5ZA 4E7KA 3S3MA 3OE7A 2LY1A 4F52A 3LMWA 2XF6A 3RSNA 2IGKA 3TMOA 4F93B 3AKZA 3UNGC 3S3OA 2JUGA 1U0JA 3W2AA 1W0KA 2KDOA 4XD7A 2A6TA 2GJKA 1O8DA 3A1YA 3OYAA 1DBOA 2W6IA 2ZZGA 4OJOA 4XOPA 2JJ2A 2WJYA 4J00A 1T95A 2Z2SB 4CH7A 3ZRGA 1E1RA 2NSPA 3ONQA 1WMRA 3GQ8A 2W82A 1I18A 4BEHB 4CCJA 2VQHA 2VKDA 3OYHA 4YZQA 3E1SA 1RMGA 4NK8A 5LD2C 1UELB 2VJJA 3KX2A 3BCBA 2O1DA 1WFXA 1WJAA 1O8IA 4QPOA 4KT6A 2L9SA 3E0JB 2ZSHB 1UD2A 3MKYB 2IS1A 2L5QA 3QYEA 1MW7A 4BJ5C 2WAEA 2R7RA 4BL0B 4ZDLA 4YXWA 1P9QC 4ZYAA 4ANJA 3HL2A 3EUKL 4BXFA 3GVLA 2MC4A 1X0CA 2ZZEA 5FL7A 1WJ5A 1K6YA 2V7FA 1J09A 3OR2C 3OYEA 1SFKA 4XLCA 1BLIA 3PL8A 2CV0A 4XNFA 1MMDA 1O88A 3K4CA 1KTWA 2V1NA 1O8JA 4Z06A 1Z3YA 2F5VA 2ZZQA 4LG3A 2CK3A 1YE9A 3ZXSA 3K70D 1V5EA 2CUZA 3L2WA 2X8KA 3VMVA 4IX7A 4CZCA 4U87A 3QODA 2R7SA 4KJZA 2M0MA 2HDWA 3DKYA 3OPOA 4KKSA 4IZZA 3FKJA 3J7AY 3LNNA 2XZLA 4HWVA 2R4GA 2WSSA 4AU7A 1O8LA 1D1BA 3OYJA 4F3QA 2HLDA 3FDYA 2DCEA 4OAYA 1GLNA 3QYBA 1UAAA 3SDBA 3OYNA 3OIQA 3CMMA 1H8HA 1ZELA 3VSKA 5HLTA 3WQZA 1AIRA 2W00A 3BH4A 4BGDA 4X0GA 4HEA2 3K4KA 3H0DA 2KLOA 2V9KA 3MD2A 4CCKA 3G05A 3A4CA 1VJSA 3BCAA 4XLFA 2R7XA 1DGRM 5HVQC 1LVKA 2KPMA 3L2RA 2ZXIA 1OFLA 4JMQA 3I9V2 4BDYA 4DGWB 3G2BA 1S9HA 2GOXB 3SEQA 2DIEA 2M5SA 2ODLA 1MMAA 1Y6IA 2Y0SA 2PMZA 3LSHA 2E5NA 3A2KA 2R7VA 4BQQA 2X6XA 1X1AA 3B8YA 5KHDA 3HG9A 3K4BA 2UWMA 1R6RA 3PSFA 3PFYA 4AYBA 3OYMA 2NT6A 3L2QA 1RWRA 2QY1A 2AQFA 2NOJB 2W1OA 3GBGA 2M7AA 1W0JA 4ASUA 2LREA 2OC6A 2LOOA 2GK6A 5IK2A 4B48A 3HC7A 4XOTA 2KVOA 4TT3A 2Z16A 4PJJA 1OHHA 2XNDA 4DK0A 2XZOA 2HVQA 4HNTA 3K4JA 2WADA 3ZGKA 4XM3A 4B44A 3QOEA 1GQ8A 2E1MB 1YX5A 4PFPA 4U4BA 3VYSB 1D0ZA 2UV1A 2KHMA 3AFHA 3OYDA 2LRDA 1X1CA 1MABA 1VF7A 1WP6A 2F4IA 2VXZA 2WBMA 1W36C 3OYFA 1K5CA 2LG4A 3H9JA 2HU9A 3K10A 2JSPA 1N77A 1BMFA 4UZUA 4W8TA 3OW7A 2V7QA 1WJEA 1EFRA 3NWSA 4HNUA 3A3BA 1LFPA 2OV7A 3OYKA 3K70C 2Z8GA 4YZ0A 3KEWA 2VQGA 1UD6A 5HOOA 2IGNA 5FRNA 2V31A 3IUOA 1O8FA 2GOMA 5FROA 3NE5B 3V42A 3PSIA 3OMYA 1QU3A 2LBFB 1UD3A 3AL0C 4E7LA 4TKOB 4HG2A 4BUPA 1AA7A 2WY7Q 4DK1A 4BEHA 3IP4B 3OY9A 4BJTA 2ZZFA 2ZFUA 4BU2A 4PMHA 4CSWA 1W36D 4E7JA 1G59A 4YELA 1N75A 3RTRA 3GQ7A 3H9QA 2VQCA 3C2HA 4ZDPA 4D9JA 4AVZA 2PJRB 2QKLB 1E3ZA 3OIPA 3S3NA 4DNRB 2KQRA 4MR0A 3D5LA 4IQ4A 4OWRB 3H94A 4I84A 2PYHA 2KRHA 1MNEA 4NUBA 3A35A 2CV1A 3D5RC 2XAUA 2VQLA 4XORA 3VDXA 1E79A 2VIXA 2KL4A 1VLYA 5LFAA 4OAZA 1Z21A 1SAUA 5CQGA 2I8DA 3K4LA 2O5RA 2DOAA 2NTPA 3H5AA 4RLFA 2E1MC 1BOBA 1X4OA 2M7BA 1KZLA 2R9VA 1CZFA 4XKBA 4C2TA 4U49A 2WAFA 1BR4A 3U21A 2JJ1A 2INVA 2X3HA 3WWGA 3ZSCA 1D0XA 3H9GA 3EUAA 4P22A 3L2UA 4L8JA 1VZ0A 3OEHA 4PSXA 4LIUA 4E4HA 2GJRA 4RMNA 4E7ZA 2XSJC 1HA8A 1I8DA 2E1BA 1MMGA 4Z1MA 4OZYA 2P0WA 4NQWB 3OS1A 4CCLA 4W8SA 2EWEA 4BDZA 1PJRA 3OWTA 3FKSA 3CESA 4XKVA 3DPTA 3FHNA 1DP3A 2GK7A 3JU4A 2VXDA 1COWA 3PUBA 4CCNA 2INUA 2IS6A 4XKWA 4C2LA 3DPLC 3PNVA 1Y56A 3AL0B 4II3A 2X1CA 2Z6BD 2V4JC 2X1EA 3OS0A 4BQNA 2CUJA 2O0VA 1X19A 2VL8A 2HVSA 2JA2A 2VBEA 3DTKA 4PUSA 5JHFA 4E7IA 4PJNA 3OYLA 4RM2A 3CJRB 2WB1A 3HUGB 2F6CA 4B47A 3DU5A 3VSUA 1WJCA 3MKZA 4F92B 4N4OB 4TSFA 1BN8A 3B4NA 2AQEA 4URRA 2HVRA 2CH0A 1WJBA 5TGTA 4B3FX 2WY8Q 3OL3A 4E0FA 1W9XA 2VBMA 1V0FA 3OL4A 3A3GA 3HPHA 3VYRB 2XF7A 4LIVA 5CPRB 3OS2A 2LZJA 3L2VA 2QE7A 3LSKA 3ZPPA 3OAAA 4F55A 4OJ5A 3KYLA 3DPUA 4JOMA 3EUHC 5HNHA 3BCDA 2M4GA 1X1BA 3PNYA 2X85A 4G6TB 3OOUA 4HPQA 3S32A 4PFOA 4BS9A 2IGMA 2GJPA 1O8KA 3GQ9A 2UUZA 3ZR8X 4NC8A 1HG8A 1XG2A 3K6GA 4XONA 4W8QA 3LFUA 1E3XA 3LMMA 1LKXA 2HQAA 2X6WA 4J01A 4IKFA 3FBIB 4NNJA 3VWBA 1X4PA 3K4MA 4PK4A 3W2WA 2W7NA 1HVXA 2V6EA 4ZTFA 4NC7A 5CKTA 3RQ4A 3B90A 3GQBA 3CP8A 4XKCA 2XOKA 2L2OA 3ZIAA 4OJ6A 2VKHA 1DBGA 4OJPA 4IQJA 2CS3A 1D1CA 1TT0A 4D1QA 1N78A 2LY2A 1DGWY 4II2A 4HSRA 3SZGA 3MKWB 2CV2A 1FMVA 3VR6A 4NK6A 4GQNA 2X53S 4EATA 5AMVA 1V5FA 2K9MA 2K9LA 3DTEA 3VSLA 3OFNA 4ZJZA 2FUG2 3LSMA 2LYCA 3DLAA 4YRVA 1IDKA 1JTAA 4G7XA 4ZC3A 2LC2A 3RPUD 5CDFA 2WZPP 4XLHA 2WPDA 1NHCA 1UD4A 4BQOA 2JVHA 1UD8A 3MMYB 5HKKA 2V4DA 1PXZA 2KRCA 3SYTA 4KKTA 4ITVA 2DT7B 2XF5A 3TL4X 2NTQA 3VSTA 1FX0A 3OYCA 3S93A 3CJQB 1IDJA 2CFOA 2VJ4A 2XZPA 2LBFA 1QCXA 2O04A 4DJAA 4YZAA 4G7WA 3BCFA 2F43A 4HSTA 3OYIA 3K4NA 5KNLA 4PJMA 1E0EA 3GVKA 1NBMA 2VB6A 1X1DA 3ZQQA 2UVEA 4KKUA 4OZZA 2E60A 3GQAA 3OOCA 3DU6A 2PJRA 4ZTJA 4W8RA 2QX3A 1UG0A 1PKVA 4FETA 1QJVA 5DN6A 2R7UA 3UR3C 2M4KA 4KISA 1H80A 4RM3A 4XN0A 4C30A 2A5WA 3C2GA 2O0WA 4B3XA 3T51B 4Y3OA 1PLUA 1BPLA 3SUCA 4ZDOA 2Z1DA 4BE1A 1K28D 2K3PA 5CQEA 2UVFA 2ELJA 2PYGA 4PSWA 3T9GA 2R7WA 4MLOA 2IS2A 1V0EA 3KEYA 4DOZA 2KP6A 2IS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOT A;  1O8H A;  1PE9 A;  1BN8 A;  3B4N A;  5C1E A;  4URR A;  2VBK A;  1KCC A;  2VBM A;  4XM3 A;  1OOC A;  4YEJ A;  1GQ8 A;  1KCD A;  4XLA A;  1O8E A;  3ZPP A;  4MXN A;  4U4B A;  4OJ5 A;  3LMW A;  3EQO A;  1O8D A;  2X85 A;  1O8K A;  3GQ9 A;  1K5C A;  1DBO A;  1HG8 A;  4OJO A;  4Z05 A;  1XG2 A;  4XOP A;  4XON A;  4W8Q A;  1RU4 A;  4W8T A;  2X6W A;  2NSP A;  3GQ8 A;  1WMR A;  3GRH A;  3UW0 A;  4YZQ A;  1RMG A;  1OGM X;  4NK8 A;  2Z8G A;  2VJJ A;  2NT9 A;  4YZ0 A;  2O1D A;  1O8I A;  1O8F A;  1JRG A;  2NZM A;  4YZX A;  2VJI A;  3B90 A;  1VBL A;  2X6Y A;  1IA5 A;  4OJ6 A;  1DBG A;  1X0C A;  4OJP A;  3VMW A;  2BSP A;  4XR6 A;  4XLC A;  1EE6 A;  4PMH A;  5C1C A;  4Z03 A;  3EQN A;  4YEL A;  4XNF A;  3GQ7 A;  4NK6 A;  1O88 A;  1KTW A;  4AVZ A;  5AMV A;  1O8J A;  4MR0 A;  3VSV A;  4XMY A;  4Z06 A;  4I84 A;  2PYH A;  1OGO X;  1JTA A;  1IDK A;  4XN3 A;  4XOR A;  1BHE A;  1IB4 A;  3VMV A;  1NHC A;  4XLH A;  4XL9 A;  2IQ7 A;  1PXZ A;  4HWV A;  1O8L A;  2NTP A;  4XLE A;  3VST A;  2NTQ A;  1IDJ A;  1CZF A;  4U49 A;  3WWG A;  3ZSC A;  2INV A;  2X3H A;  1QCX A;  2O04 A;  2PEC A;  4YZA A;  1O8G A;  3FY3 A;  1AIR A;  4OJL A;  3JUR A;  4EW9 A;  2UVE A;  4OZZ A;  3GQA A;  4OZY A;  2NTB A;  4XLF A;  4W8S A;  2EWE A;  2QXZ A;  4W8R A;  1OFM A;  2QX3 A;  1OFL A;  1QJV A;  4XKV A;  2ODL A;  1H80 A;  4XN0 A;  2INU A;  4XKW A;  2X6X A;  4C2L A;  3B8Y A;  2O0W A;  1O8M A;  1PLU A;  3KRG A;  4XQF A;  3SUC A;  2O0V A;  2VBE A;  2NT6 A;  1RWR A;  2O17 A;  2QY1 A;  2UVF A;  2PYG A;  3T9G A;  2NST A;  3VSU A; 
#chains in the Genus database with same CATH topology
 2QQA A;  4MFE A;  2JJ7 A;  4RGU A;  1YS6 A;  1KTV A;  1KQ5 A;  1RR7 A;  2HZD A;  5D6F A;  5D5U B;  2VLA A;  2P7V B;  2M30 A;  5IP9 J;  1KQ8 A;  2BVM A;  4GDF A;  4MFD A;  4I01 A;  4X8I A;  5GAH J;  2B0R A;  3G1O A;  3H35 A;  3ZMU A;  5LHH A;  4MXN A;  2FEZ A;  4G6I A;  3N05 A;  1DQU A;  4AM3 A;  1EH6 A;  4KMF A;  2G7U A;  3LA3 A;  1QHH D;  3F9K A;  5FLV A;  1IRF A;  4Z05 A;  2BY2 A;  1TTT A;  1OCO H;  3AK5 A;  2OBT A;  2ESH A;  5LMZ A;  2LKX A;  2M2E A;  3ASP A;  3CCQ B;  3GRH A;  4LMY A;  2VUM J;  3FPP A;  3I4N J;  3UW0 A;  2X6O A;  2IGO A;  3L1P A;  1U5T B;  3FM3 A;  2MG4 A;  1JT0 A;  1TC3 C;  2BVN A;  4RCY A;  4AC9 A;  2PX9 A;  2P8T A;  1FNM A;  2F1M A;  1KRH A;  2JK3 A;  4U7B A;  2CMP A;  2Q2E B;  1PJ5 A;  2A6H F;  3PJR A;  2AO9 A;  2VT3 A;  4EJT A;  1MND A;  4LC0 A;  3HB9 A;  2RRE A;  1LUJ B;  1B1B A;  3SFZ A;  2X6Y A;  4RLQ A;  2OCE A;  3EYI A;  5IYD J;  2XAF A;  4P5O A;  4A3B J;  3MCA A;  2XPU A;  3W2H A;  3CP2 A;  1KK3 A;  1Q86 D;  3H09 A;  2ZME A;  1EE6 A;  3CCJ I;  1JUS A;  3RDI A;  2YWG A;  5K7F A;  1KA8 A;  2MYS A;  3LSJ A;  4MQ9 F;  2DO7 A;  3WG9 A;  3BTJ A;  1V3F A;  1FT9 A;  1QA6 A;  4HRI A;  1XE1 A;  4RD0 A;  1HZE A;  4WF2 A;  5CVV A;  1QFY A;  2BF4 A;  5J47 A;  2Y9Y A;  1WGX A;  1JB9 A;  1IB0 A;  4CCM A;  5DSZ A;  4EM0 B;  1BI3 A;  3SEZ A;  3BR0 A;  1EKE A;  3E1Y E;  2L4A A;  1A04 A;  1VF9 A;  4LOC A;  4EM2 A;  1VQM I;  2KJC A;  2FML A;  4XLE A;  1E43 A;  3LAP A;  3ZQI A;  5LRR A;  1P7J A;  2L9R A;  2H6C A;  4U0V A;  1FNB A;  4BAC A;  1W7P A;  3EET A;  3I71 A;  4WZE A;  1LLW A;  3DEE A;  3O6B B;  3RKY A;  2BXZ A;  1DAR A;  2PEC A;  4IHS A;  3ZCO A;  1RIO H;  5DS9 A;  1HKS A;  2X51 A;  2BY0 A;  1YJW I;  3ASN H;  3I1F A;  4JP0 A;  1R23 A;  1UJ8 A;  1VQO I;  4KIF A;  1BI0 A;  2CUE A;  2DA1 A;  3I58 A;  3LQQ A;  1JNY A;  4FT8 A;  1S72 B;  1V5G A;  3LSG A;  1F20 A;  2Y0S N;  1ZAO A;  3CCR I;  1YIJ I;  1XGS A;  5LGT A;  2ZTG A;  2NS8 A;  1OYI A;  2QF7 A;  2VNI A;  5AN9 A;  2W84 A;  5H6Q A;  2CGP A;  3CMY A;  4AYB N;  3BLY A;  1Z1D A;  3OYG A;  1DU0 A;  3ISX A;  2E35 A;  3S2W A;  1Z0X A;  1PDN C;  2VBX A;  3E6M A;  3HOS A;  4FHT A;  1KQ9 A;  1KON A;  4EMS A;  4E70 A;  2GXA A;  4N9I A;  1HKT A;  2HFH A;  1TQM A;  2VT2 A;  2LY9 A;  3CDL A;  4EH1 A;  2O17 A;  1BI1 A;  2GQF A;  1EFT A;  2RN7 A;  2M8G X;  2L7K A;  4IJA A;  5K5O A;  1YLO A;  4GYI A;  3TOA A;  3JQR A;  2WJV A;  2PQ8 A;  3KZZ A;  3HXL A;  2XIG A;  2R5Y A;  2A68 F;  4EJU A;  3OOP A;  1ZG5 A;  5LHI A;  1FRQ A;  2VFN A;  1KCC A;  1IDY A;  2CRG A;  4DBQ A;  4ZYH A;  2PE3 A;  3ZMS A;  2Q6I A;  5LBQ A;  3KP3 A;  2XB5 A;  2W6J A;  3S16 J;  2QKM B;  2HNH A;  3NAU A;  1EFC A;  2E5Z A;  4E7K A;  1QGA A;  4F52 A;  2ME6 A;  3TMO A;  4F93 B;  3W2A A;  1IN6 A;  3IH2 A;  1U0J A;  3T8T A;  1W0K A;  2BM5 A;  4OMY A;  1VQ9 I;  3OYA A;  4HAM A;  1OCC H;  1TWA J;  3O2P E;  1NK3 P;  1Y0Y A;  4I76 A;  2CBX A;  4I09 A;  2IRF G;  4RD6 A;  1TQP A;  5EG0 A;  4RAF A;  2IOU G;  4YZQ A;  1PUE E;  4Z4Z A;  4AF6 A;  5D5X B;  1CF7 B;  1VQK B;  4NK8 A;  3KX2 A;  1X2N A;  1G7T A;  3TDU C;  2O1D A;  1WFX A;  4OU0 A;  1KK1 A;  1XMK A;  1O3R A;  2L02 A;  2OBP A;  5TR9 A;  4O5V A;  5FD6 A;  3CJT B;  3MKY B;  2IS1 A;  3QYE A;  3TW7 A;  1MW7 A;  1Z6T A;  4BJ5 C;  2R7R A;  1T38 A;  1N05 A;  3V76 A;  3HL2 A;  4ANJ A;  4BXF A;  1UHW A;  2MC4 A;  1VHE A;  2ZZE A;  1S8N A;  5GP9 A;  2BGJ A;  3FIS A;  1J09 A;  3CTA A;  5FL7 A;  3DEW A;  2HEO A;  2BHY A;  3PL8 A;  2CV0 A;  1XDU A;  2QBY B;  1ITY A;  2CFX A;  3QOP A;  1O88 A;  1GVJ A;  2XHK A;  1P4X A;  2OZU A;  2BXY A;  3AVX A;  1S5L C;  4KIG A;  3ZQL A;  2F5V A;  3PA2 A;  1Y1W J;  4LG3 A;  2GXB A;  2CUZ A;  3Q9V A;  3L2W A;  3VMV A;  2LDU A;  3KEQ A;  1KU7 A;  4OPV A;  4RJL A;  4B8X A;  2R7S A;  3OPO A;  3VB2 A;  2AHQ A;  3FKJ A;  4GXO A;  1NHA A;  4L0Z B;  2R4G A;  2KRF A;  3TQN A;  1IXS B;  3IC7 A;  3P5J A;  4ZZL A;  4UNO A;  3WTU C;  1P6R A;  3QYB A;  2XRO A;  4XID A;  2CQX A;  2IT0 A;  4N3N A;  2XRL A;  3ZQF A;  4OPS A;  3WQZ A;  4BHB A;  1BN5 A;  1APL C;  2GLO A;  2R5Z B;  3H0D A;  1TW2 A;  4QSH A;  2YUH A;  3MD2 A;  1SD4 A;  2JMW A;  2AS5 F;  4M3F A;  3G05 A;  3MEX A;  2A3S A;  4A3I J;  2STT A;  3I9V 2;  1V0F A;  3SEQ A;  1ZK8 A;  2ODL A;  4AC0 A;  4ZZD A;  2PMZ A;  3BY1 A;  1ZM4 A;  4A12 A;  4BQQ A;  1SVM A;  5IYQ A;  3B8Y A;  4YZX A;  3B78 A;  3HG9 A;  1E2X A;  1SFO J;  3CD6 I;  3K4B A;  1CNF A;  3KP4 A;  5EJC A;  1XMX A;  2E7W A;  3BJ6 A;  2QDX A;  3CC2 B;  3PSF A;  4MEX F;  1G7C A;  2FBH A;  3V7S A;  3ZN0 A;  1RWR A;  3DF8 A;  2OF7 A;  4IF4 A;  1BBY A;  2LOO A;  2WAQ N;  3RKQ A;  4S04 A;  1QUE A;  3EDP A;  5IK2 A;  1MSF C;  4B48 A;  5EGO B;  1F5T A;  3BY2 A;  2KVO A;  4ZH4 F;  4TT3 A;  3GWZ A;  1IGN A;  1OHH A;  1TYV A;  2XND A;  4A69 C;  2XGE A;  4JYK A;  2Y0M A;  2XZO A;  2HVQ A;  3K4J A;  1DDN A;  1Z77 A;  3ZGK A;  3JRB A;  3BNW A;  4UZF A;  3QOE A;  2M5W A;  1ETK A;  4CO8 A;  3Q6R A;  4U4B A;  1HSJ A;  2UV1 A;  1GXQ A;  1J2X A;  1G4D A;  3FXR A;  1AOY A;  2K9Q A;  2F4I A;  1WU8 A;  4W1U A;  3SYJ A;  2WBM A;  5CVU A;  3OYF A;  2HCJ B;  3K10 A;  2JSP A;  1N77 A;  4UZU A;  5FIU A;  4NHJ A;  2V7Q A;  5L3E A;  1DG1 G;  2EZI A;  1WZ2 A;  3Q38 A;  3CCV B;  4Z4S A;  4YDT A;  5TJJ A;  4YAO A;  4YZ0 A;  5BNG A;  5HDG A;  2VQG A;  3ASS A;  1MBE A;  5LHG A;  5HOO A;  2GWR A;  1XB2 A;  3JRC A;  5DYM A;  3CCJ B;  4S0H B;  4ZCL A;  3V42 A;  1VQP I;  1FY7 A;  1Q9S A;  3PSI A;  4P1V A;  2OQG A;  3UKG A;  1QU3 A;  2BPO A;  3B8H A;  4YC5 A;  2JT1 A;  3P4G A;  2TDX A;  4CYC A;  1YHQ I;  4YFX F;  1XCB A;  4C3H J;  4Y9R A;  5EGO A;  4WK8 F;  2VI6 A;  1RQP A;  3PSS A;  3I54 A;  4IOC F;  4N0B A;  1A8P A;  5J1U A;  4BU2 A;  1Q81 D;  3E5U A;  1MBJ A;  4CSW A;  3VO1 A;  1LFU P;  3RTR A;  1N75 A;  1EF4 A;  1NK2 P;  1YJ9 B;  1J0R A;  4ZDP A;  1QBJ A;  4P3Y A;  3GME A;  3OIP A;  2W7Z A;  3C7J A;  4I84 A;  3SJM A;  3G1L A;  1SAX A;  2DY1 A;  1MNE A;  3A8I A;  5A89 A;  2YS9 A;  2CV1 A;  3D5R C;  4KN7 X;  4RA2 A;  5H20 A;  3GFI A;  4Z4R A;  2HDC A;  2KL4 A;  2IEK A;  5LFA A;  5TRD A;  2VBZ A;  3ZPL A;  2HI3 A;  1LE8 A;  3K4L A;  2ZME C;  3FK6 A;  2DER A;  1R5H A;  2P5K A;  4BBR J;  3D26 A;  5KW9 A;  4RLF A;  2Q6K A;  5L3D A;  1BOB A;  2EFN A;  4DZP A;  4TMW A;  4I7H A;  3OZV A;  5DUK A;  2WAF A;  1BR4 A;  1SD7 A;  2DU9 A;  4Y13 A;  4TV7 A;  4Z2Y A;  4EGZ A;  2X3H A;  1W2B B;  2GZW A;  1VQN I;  3BDD A;  1VQN B;  3CF5 F;  4PSX A;  3AAF A;  1BC7 C;  3NB2 A;  4E4H A;  3GZN B;  2GJR A;  4KT5 C;  1IN7 A;  2XSJ C;  4A0X A;  3B6A A;  1MMG A;  4OZY A;  1G3Y A;  2P0W A;  1RRJ A;  3BZC A;  5EDN A;  2DYS H;  1QA2 A;  1UFM A;  1IV6 A;  1FSE A;  5HLI A;  1PJR A;  3PEN A;  2DOE A;  3DXJ F;  2VKE A;  2X48 A;  1WH7 A;  2DMQ A;  2KKO A;  2QQ8 A;  3EYY A;  4XKV A;  3JU4 A;  1W0U A;  3PIP F;  4BNC A;  3PUB A;  2OQR A;  3WE3 A;  3Q3A A;  3GFJ A;  2INU A;  4C2L A;  3LVB A;  1IXC A;  3DPL C;  3NRV A;  3IH3 A;  2IA0 A;  2EJR A;  4IXA A;  5HDN A;  4LB6 B;  4KYW A;  4DYC A;  1B6A A;  2Z6B D;  4RD1 A;  3PSZ A;  2HVS A;  4EJV A;  3DTK A;  5C1C A;  2DOF A;  3ZMZ A;  2KIF A;  4EEF G;  5H2F C;  3CJR B;  2O8X A;  3Q6Q A;  4Z4V A;  3V8J A;  3DU5 A;  1XSV A;  3JRG A;  1QX4 A;  2C4T A;  1YHQ B;  5B5E C;  3PFI A;  4M6Y A;  1BN8 A;  1WJB A;  1P4W A;  1B8I B;  2ZBK A;  2W85 A;  4E0F A;  1U6G A;  3S1R J;  2BM0 A;  2DA5 A;  3VYR B;  3R6J A;  2LZJ A;  2XT2 A;  1ELO A;  2QE7 A;  3L2V A;  1BX1 A;  3PUN A;  2DMT A;  4JOM A;  3ZOB A;  3EUH C;  3BCD A;  1W5T A;  4A3J J;  2P3M A;  1O8K A;  1ETY A;  2HQN A;  5TY0 A;  2EIN H;  1HG8 A;  1O7L A;  3K6G A;  4XON A;  1MJ9 A;  1RUO A;  1B9N A;  1RNL A;  1UST A;  4TMV A;  2X6W A;  4J01 A;  3FBI B;  1GUU A;  3QWL A;  3VWB A;  4TN1 A;  4ABZ A;  3OJW A;  1A31 A;  1H8A C;  1YW7 A;  1W4M A;  2H8R A;  2MH9 A;  4NC7 A;  3VMF A;  3WOD F;  1TTY A;  2QSF X;  5CKT A;  4D7N A;  3RPU A;  1KD1 D;  4G12 A;  1R5N A;  2DLL A;  2IVM A;  3LAJ A;  1HLV A;  1DDG A;  3ZIA A;  2XGC A;  5JLX A;  5JFR A;  2MW8 A;  2X0K A;  4II2 A;  3SZG A;  3ZMT A;  4BQA A;  1GXP A;  2PLY A;  2OK7 A;  2F5E A;  1EFU A;  2E1O A;  1H89 C;  3ABT A;  2EFQ A;  3DTE A;  5C4X J;  3W2F A;  3OFN A;  3PM1 A;  4XSX F;  3VOD A;  4ZJZ A;  3W2G A;  1OFD A;  4X7E A;  3DLA A;  3ONY A;  4G7X A;  5F08 A;  2WZP P;  3F0C A;  4XLH A;  1NHC A;  1UD8 A;  1W5S A;  2JPB A;  2Y31 A;  2V4D A;  2ME0 A;  4HDU A;  4X7F A;  3AG3 H;  3E3V A;  4A2U A;  3AG2 H;  4CIC A;  2BM1 A;  2DT7 B;  1QVG B;  1FX0 A;  3OYC A;  2CFO A;  2RAE A;  3QE2 A;  1FYM A;  2VFM A;  3F23 A;  1JKR C;  1ZR2 A;  5KNL A;  3GFL A;  4LBY A;  3QPS A;  3BP8 A;  3GVK A;  2ELH A;  1XCV A;  3B73 A;  1X1D A;  4KKU A;  4OOX A;  4Z4U A;  3MAJ A;  2VBW A;  3ASR A;  3DU6 A;  3OOC A;  4ZTJ A;  5M5X J;  5L46 A;  4V2G A;  3FM5 A;  4G1V A;  4M0L A;  4W8R A;  2C78 A;  2F4O B;  3CCU B;  1WVR A;  1PKV A;  2YWH A;  3S15 J;  2JRM A;  5DN6 A;  2KIQ A;  4MNU A;  3W2E A;  2M4K A;  4KIS A;  2QWW A;  4EGY A;  2RC6 A;  1BI2 A;  4GO1 A;  3JR9 A;  2IP2 A;  1CQX A;  2M45 A;  1UG2 A;  1U8B A;  3T51 B;  1IUY A;  1PLU A;  3SUC A;  2Z1D A;  4BE1 A;  3I56 I;  2GRE A;  4IO9 F;  5BPD A;  4MLO A;  5BSX A;  1W35 A;  2CF4 A;  1V0E A;  2D2W A;  3KEY A;  5H5J A;  5ILV A;  1YI2 I;  2KP6 A;  1H0M A;  2IS4 A;  5J1R A;  3OAA A;  4DNT B;  1O8H A;  3QPH A;  3S2D J;  3RZO J;  3CF2 A;  1I50 J;  1HKQ A;  5C1E A;  4AD9 A;  5E8I A;  1VQ6 B;  5K7H A;  4NC6 A;  1ENH A;  1E62 A;  5IYW A;  1YLF A;  1KGS A;  1BX0 A;  1IZ1 A;  1YRN A;  5E1X A;  2CUF A;  2XC7 A;  2VAS A;  1RR8 C;  1RQR A;  3GTK J;  3OZU A;  2FMY A;  2OTJ I;  3BG3 A;  4MYT A;  4A5N A;  4HF2 A;  5A2Q Z;  3EQO A;  1RUN A;  1MD0 A;  1HW1 A;  3CCM B;  2NAZ A;  1GJR A;  2VN2 A;  4HYE A;  2BE5 F;  2EFP A;  5JMC B;  1YX2 A;  2RQQ A;  3F8F A;  1MBH A;  4CYD A;  3GZ5 A;  3G4S B;  2H27 A;  1SKY B;  2ZL6 A;  1FJL A;  3GTP J;  3S8P A;  1KK2 A;  1WI3 A;  4LBZ A;  2DMN A;  1O3T A;  4CA0 A;  2J7K A;  1QPI A;  4HE5 A;  1ZN2 A;  5DM7 F;  2J8K A;  1FMW A;  4EQQ A;  4CXF A;  4NDL A;  3ZQC A;  1S3J A;  1LLZ A;  1QZY A;  1M1E B;  1T2K A;  4V02 C;  1X3W B;  3M8J A;  1TVC A;  2JIZ A;  4P96 A;  2FBI A;  5FKK A;  1XFO A;  5CVJ A;  2EZH A;  3U2R A;  5E1Z B;  3TKY A;  5F27 A;  4BJ6 C;  3I4P A;  3ZZT A;  3IL2 A;  4HIZ A;  3N90 A;  3JSP A;  1LB2 A;  2XAH A;  3HAG A;  2LKP A;  2Q1Z B;  2JSC A;  3OJX A;  5TV2 A;  5LEK A;  4UV8 A;  4ZGN B;  2K5C A;  1S72 I;  3F8B A;  3G1M A;  4XMY A;  3T1B A;  2VJ5 A;  4CUG A;  2BGC A;  3BG7 A;  4C3J J;  3KIO A;  2D3L A;  2OUM A;  3W3C A;  4YAF A;  2HYJ A;  3J81 k;  3M1E A;  1T98 A;  4XL9 A;  2X4H A;  4NBQ A;  1D0Y A;  3HOX J;  1IJW C;  2IQ7 A;  2VNK A;  4A3F J;  3Q0V A;  2JA7 J;  1NB9 A;  3IAS 2;  5LGN A;  2BW3 A;  1NG6 A;  1SVL A;  2PJP A;  3FWE A;  1E79 A;  3PA1 A;  1T6Z A;  3GXO A;  3N97 A;  5DNS A;  2L9N A;  1XDS A;  3O8H A;  3HRU A;  1UD5 A;  4OOV A;  2ZCW A;  4OJL A;  1JUP A;  4U0W A;  1G3W A;  4KDP A;  1RI7 A;  2HKX A;  2JVG A;  3GTG J;  2HOA A;  1JGS A;  4JX4 A;  3FBN B;  4QVA A;  1HW5 A;  1R49 A;  3IH4 A;  4V19 K;  3PO3 J;  1WOR A;  2BMW A;  4FN5 A;  2RNG A;  5LEJ A;  1WPK A;  1JRG A;  4YFK F;  3F6O A;  3P9C A;  5KCM A;  3PIO F;  1K8F A;  1LDK B;  1VQP B;  4MYU A;  2ZFW A;  5EZG A;  1QO0 D;  3IRR A;  1YJ9 I;  1E1Q A;  4CCO A;  3OW2 B;  5K7Z A;  1HDD C;  3ZPN A;  1STZ A;  1L0O C;  1NRK A;  2CW5 A;  1E63 A;  5L3F A;  2IJL A;  2HYG D;  4IHT A;  2NST A;  2DJI A;  2HDN B;  2HS5 A;  3T0Y A;  1WSR A;  2YSR A;  2Q6O A;  3TED A;  3ZZU A;  1PE9 A;  3CUQ B;  2LTP A;  2VOP A;  2JN6 A;  1O4X A;  4RB3 C;  3F22 A;  3RKW A;  3FXO A;  4AID A;  4DBR A;  4F91 B;  2OAZ A;  1Z7L A;  2CRV A;  2ZIT A;  3CPX A;  2BVL A;  4MHG A;  2R7O A;  2ZJR F;  1O8E A;  5E8G A;  3FK7 A;  5K5Q A;  2D5V A;  1FNC A;  2XF6 A;  3RSN A;  4LB5 A;  3AKZ A;  3CCQ I;  2CQ7 A;  5F1R A;  2KDO A;  4PGH A;  3A8K A;  1F36 A;  1KYZ A;  1UZC A;  1DBO A;  2ZO4 A;  2ZZG A;  2ZNY A;  2JJ2 A;  1VQ4 B;  1R1U A;  5HOD A;  1TUI A;  5EMN A;  1T95 A;  3SZT A;  2XAG A;  1JHH A;  3ZRG A;  1E1R A;  1T33 A;  1T6Y A;  1WMR A;  3GQ8 A;  2CWE A;  2DPD A;  2XVC A;  4CCJ A;  2DOD A;  2VKD A;  3AGP A;  4DZJ A;  3I55 I;  4BY7 J;  1PUF A;  2E1N A;  1UEL B;  5LD2 C;  1RMG A;  1YYV A;  4RBO A;  3S1M J;  1MDM A;  2P5V A;  1ZLK A;  1DUX C;  2XPV A;  2L9S A;  5F0C A;  1U78 A;  3CB4 A;  2GXG A;  2B7C A;  3MQ0 A;  2OZ6 A;  4G8X A;  3WTS C;  2ECB A;  1SD5 A;  1P9Q C;  1XSX A;  3R0A A;  2HOS A;  3GVL A;  1X0C A;  1QH0 A;  1K6Y A;  3OR2 C;  1MKM A;  3OYE A;  3QRF F;  4XK4 A;  5ICC A;  2JUC A;  1QRB A;  2HYF A;  2L7F P;  1JE8 A;  1MMD A;  3K4C A;  1KTW A;  2V1N A;  1ZRF A;  3O8G A;  2ELK A;  1E3P A;  4IHW A;  1HF0 A;  2EPF A;  1Z3Y A;  5FKN A;  3ZMD A;  4A93 J;  2ZZQ A;  4FX4 A;  4M9S A;  4Q7J B;  3BG5 A;  1V5E A;  3ML6 A;  1QG0 A;  5J3O A;  2X8K A;  3LA2 A;  1OB5 A;  1T56 A;  4M73 A;  1N06 A;  1U5T A;  3OKX A;  4KJZ A;  2M0M A;  2HDW A;  3DKY A;  1EP1 B;  3ASQ A;  4KKS A;  3LNN A;  3J7A Y;  2XZL A;  3AST A;  2Q2E A;  2L7M P;  4F3Q A;  3FDY A;  1QPM A;  3ZQH A;  2DW4 A;  2ZXJ A;  4OAY A;  1NJI D;  1BOA A;  5A88 A;  3ECO A;  2NYX A;  3OIQ A;  4M1K A;  1R36 A;  1RKT A;  5F1J A;  1H8H A;  4BH9 A;  2OJE D;  4FK8 A;  1IAW A;  5HLT A;  1AIR A;  3U1K A;  2WV1 A;  3HHH A;  1J5Y A;  3K4K A;  4LJZ F;  3RPQ A;  2KLO A;  3GTO J;  2JWT A;  2V9K A;  2WC2 A;  3A4C A;  4XLF A;  2ZJP F;  2R7X A;  4Z4T A;  1Q1V A;  3L2R A;  1UMQ A;  4CZZ A;  1OFL A;  4JMQ A;  2GQQ A;  4IRG A;  1OCT C;  3P26 A;  3I59 A;  3SJZ A;  4DGW B;  1S9H A;  2DCU A;  2XTX A;  1MMA A;  2IPQ X;  1JTX A;  2E5N A;  5B66 C;  4O3M A;  3A2K A;  4M6X A;  4IRH A;  2NNN A;  3W6K B;  2NOG A;  4L0Y B;  1P4A A;  1B8I A;  2C6Y A;  2LF8 A;  2MSY A;  1AWC A;  1QNT A;  3SLN A;  2UWM A;  3OYM A;  1FYK A;  3SEJ A;  2VC0 A;  1YIO A;  2M7A A;  1VQ6 I;  1W0J A;  2XNJ A;  4ASU A;  1Z6R A;  2OC6 A;  1IV8 A;  4X7D A;  3JX8 A;  1Y0N A;  4FE7 A;  3P9K A;  4M53 A;  3WBJ A;  2W48 A;  3HC7 A;  4XOT A;  3BR3 A;  2IA1 A;  1R4M B;  1NTC A;  4AIK A;  4FCY A;  3R4K A;  2V5I A;  2BY1 A;  4HNT A;  2K4J A;  2V7W A;  4G1B A;  1X2M A;  3VNU A;  1TNT A;  1BJA A;  3ISP A;  3CC4 I;  3SXY A;  4P6V F;  3KL9 A;  2L7Z A;  3F8C A;  1YX5 A;  4PFP A;  4L9V A;  3VYS B;  1R5G A;  4OPO A;  2EQR A;  3AFH A;  3ZQ7 A;  2X3U A;  2D1H A;  1X1C A;  4ZCM A;  1VQM B;  1AIP A;  2QYO A;  2VXZ A;  5ILU A;  1Y8Q B;  2GAU A;  4M3B A;  4ZYG A;  2K27 A;  4FX0 A;  1SFE A;  5FLX K;  1IUF A;  3QP6 A;  2QTZ A;  2C2W A;  3NAR A;  4HW0 A;  2XKP A;  3G4S I;  3WND A;  3HIF A;  4AWX B;  1YJN B;  1TYU A;  2Z33 A;  4HNU A;  1RPW A;  1TWG J;  3OYK A;  1SVO A;  2R6H A;  4WWC A;  2CW0 F;  2EIK H;  3CCL B;  1G7S A;  2V31 A;  4P26 A;  4ZYE A;  2O03 A;  1K73 D;  4KMU X;  5BMZ A;  3TH0 A;  2H09 A;  2HQ5 A;  5FRO A;  3VPR A;  3NE5 B;  2XTY A;  3CCE I;  1JJ2 B;  2CC2 A;  1P7I A;  3OMY A;  2LBF B;  1UD3 A;  2FRH A;  5C4J J;  4L5J A;  3KLO A;  4HG2 A;  5FLM J;  2C4U A;  2YWF A;  3LSP A;  3IP4 B;  4DQL A;  2ZFU A;  1W0T A;  4M74 A;  1W36 D;  5LRS A;  1G3T A;  4E7J A;  4IHY A;  3H9Q A;  1MZB A;  1R00 A;  4HE6 A;  3S3N A;  4DNR B;  3I53 A;  4IQ4 A;  1A36 A;  3SLD A;  4NUB A;  5E79 C;  4QLC U;  3A35 A;  1OCR H;  2FSW A;  2BM4 A;  4XOR A;  5BS6 A;  3Q0W A;  2VC1 A;  3KET A;  4AIH A;  2W57 A;  1Z21 A;  2FXA A;  3QU3 A;  5CQG A;  2I8D A;  2KFD A;  4EVI A;  4Y9U A;  4UY8 I;  1WWX A;  2DOA A;  1ONV A;  3L00 A;  4V2F A;  3H5A A;  5E17 F;  3QFR A;  2E1M C;  4DNC A;  1X4O A;  1MRZ A;  3CO6 C;  2M7B A;  5F4J A;  2R9V A;  3WWG A;  3ZSC A;  3WGI A;  4UUS A;  3S17 J;  1F43 A;  1U8R A;  1GO2 A;  2C5B A;  2OYN A;  5D5W B;  1FOX A;  2N8G A;  2KZG A;  3EUA A;  4L8J A;  1VZ0 A;  3OEH A;  3PET A;  3EQL F;  3KEO A;  4LIU A;  4MO7 A;  4X0C A;  1QZZ A;  4LLG F;  3CCM I;  1JHF A;  4RMN A;  3RQI A;  4E7Z A;  2E1B A;  2CND A;  3BJA A;  2BZT A;  1MJA A;  4NQW B;  4BDZ A;  1I3Q J;  3FKS A;  4IPA A;  3QPL A;  4B09 A;  2ETH A;  4WZL A;  2IS6 A;  4XKW A;  1QGP A;  1Z7U A;  2DYR H;  1ETV A;  5JHU A;  3AL0 B;  1Y56 A;  2G0E A;  3HOV J;  1EH7 A;  4D7M A;  2V4J C;  2X1E A;  3V4G A;  3OS0 A;  2KDZ A;  2V1U A;  4BQN A;  2CUJ A;  3L9F A;  1X19 A;  2M9H A;  4XIC A;  5FA6 A;  1FBS A;  4PUS A;  2QSH X;  1QRC A;  4YEI A;  4YIF A;  4BBS J;  2HTJ A;  4RM2 A;  3JRD A;  3K2A A;  2F6C A;  2LKS A;  4GGG A;  3CUQ A;  2BYV E;  1TL8 A;  3A8J A;  3COA C;  3FHZ A;  3FZV A;  5FJ8 J;  4HNV A;  2Y9Z A;  3B4N A;  3P9I A;  1UHM A;  2AQE A;  2GPJ A;  4URR A;  4ON0 A;  2M8E A;  2PFB A;  1E17 A;  3OL3 A;  2VBM A;  3OL4 A;  4OIR F;  5CPR B;  4UUT A;  2R3S A;  4F55 A;  4M9Z A;  1BIB A;  2DT5 A;  4WCG A;  1VQ5 I;  4HX8 A;  2DA4 A;  3AVV A;  3S32 A;  1LNW A;  4CGZ A;  4RGS A;  4PFO A;  3HSR A;  2IGM A;  2F5C A;  1R22 A;  2OU2 A;  3KYD B;  4A5M A;  4BS9 A;  2GJP A;  3ES9 A;  1H85 A;  3GX4 X;  3BT9 A;  1XG2 A;  1POG A;  4BKX A;  2FQ4 A;  1E3X A;  4HV5 A;  1ULY A;  2EIJ H;  5D4R A;  4RD3 A;  2XTW A;  3BTC A;  1W7P D;  2ID3 A;  3GLL A;  4P6Y A;  1B23 P;  3MHP A;  4YII A;  2W7N A;  4M4S A;  4ZTF A;  1KU3 A;  4YAL A;  3BJO A;  1A5J A;  4BHC A;  1EV7 A;  2F5F A;  2B0L A;  4M6V A;  3LYC A;  3HUG A;  4OJ6 A;  2VKH A;  4OJP A;  1K7A A;  2VNH A;  1D1C A;  3KPH A;  1ZRC A;  1TT0 A;  2VPR A;  4D1Q A;  5IT9 K;  4HSR A;  3W5V A;  1VQK I;  4C2M J;  5F64 A;  3TO6 A;  1CNE A;  1XGO A;  2XGD A;  3CC2 I;  3JQQ A;  3CC7 B;  1W7P B;  3TOB A;  1MNM C;  2OBS A;  4YRV A;  2LYC A;  1JTA A;  2MLK A;  5FKO A;  4UZE A;  2TCT A;  1JKP C;  1UD4 A;  4BQO A;  5HKK A;  3MMY B;  1IN5 A;  4L9J A;  1K9M D;  1BM9 A;  2DMP A;  2VYQ A;  1ETO A;  5EYR A;  3SYT A;  1T8I A;  1GAW A;  3W5U A;  1D8K A;  1VLY A;  3SZE A;  3S93 A;  1SC7 A;  2VJ4 A;  2XZP A;  2COM A;  2NVQ J;  1IRZ A;  4XSZ F;  2XSD C;  2E2J J;  1QCX A;  4YZA A;  4G7W A;  1YRN B;  1QA1 A;  3K4N A;  1ZM3 A;  2A5Y B;  4DW6 A;  2J8I A;  3OZW A;  1MH3 A;  3X2Q H;  3PO2 J;  3ZZ0 A;  2UVE A;  5GAG J;  1ZG3 A;  2E60 A;  2F1L A;  2PMZ N;  2R5Z A;  3VO2 A;  1UG0 A;  1VHO A;  3KZY A;  4YAW A;  1P2F A;  2Y2Z A;  5GTH C;  5B6I A;  1VFC A;  3QFS A;  1XX5 A;  2IAI A;  2M1B A;  1EWY A;  2P4W A;  3ABK H;  3ZQG A;  5JI6 A;  2O0W A;  3ABL H;  4S05 A;  5BPI A;  1BPL A;  3KP6 A;  1BJZ A;  1K28 D;  2K3P A;  1DPU A;  1I6H J;  4U7D A;  2UVF A;  2LR8 A;  2PYG A;  4PSW A;  2P5L C;  2R7W A;  1PUF B;  1R5B A;  5L3C A;  2IS2 A;  3SZP A;  3V7C A;  1DAB A;  4DOZ A;  3J7Y J;  4J00 A;  3GEZ A;  5H6R A;  2CU7 A;  1SM4 A;  1YQA A;  2MD0 A;  3CC7 I;  4FAS D;  2E2H J;  1UB9 A;  1JKO C;  4MEY F;  1CGP A;  3GTM J;  5K1Y A;  2FJ1 A;  4CDG A;  1KCD A;  3H5N A;  2KMU A;  4XRM A;  5BOX A;  2QQB A;  5BSY A;  1LEA A;  4MQV A;  2L4M A;  1D1A A;  2DPU A;  1FRN A;  5THX A;  1ZAR A;  4XRS G;  3CCU I;  1HDP A;  2IA2 A;  1FP1 D;  3DV8 A;  4BPR A;  3BR2 A;  2CO5 A;  1MH4 A;  3K2Z A;  2M3A A;  4L5I A;  4RB1 A;  1O3S A;  1P4M A;  4NCN A;  2UXN A;  1S29 A;  3I3L A;  4L9T A;  2W24 A;  2ZL5 A;  1JJ6 C;  1XPX A;  3DTI A;  4I99 C;  4JK1 X;  3ULQ B;  4WZK A;  2X1D A;  1YX3 A;  5ICF A;  2NT9 A;  1XD7 A;  2IXS A;  3F21 A;  1GAQ A;  2V26 A;  2R7T A;  2BHZ A;  5IYC J;  2DT6 A;  2ZBU A;  3TGN A;  3HEF A;  2BEO A;  4PCQ A;  2B63 J;  2FVG A;  3M1C A;  4RLZ A;  4LIT A;  3A02 A;  1BW5 A;  3T53 B;  1VBL A;  1IA5 A;  3SQV A;  2QQ9 A;  2F5D A;  3QP5 A;  4R79 A;  3BQJ A;  3VMW A;  3RI4 A;  3RIQ A;  2Z5U A;  4XR6 A;  1OLT A;  2ZXH A;  5TIS C;  1FTT A;  1IW7 F;  4UHT A;  2D3N A;  4EV0 A;  1WJF A;  3LQE A;  2CG4 A;  2CW7 A;  3FKI J;  2RVC A;  4F7Z A;  1A6Q A;  3OYB A;  4FIS A;  4QWQ A;  4BE0 A;  3MZH A;  2EWN A;  1OGI A;  3GSI A;  2XAJ A;  4A3L J;  3VSV A;  3NQO A;  4YHB A;  2OTJ B;  2D74 A;  3WXM A;  1H9T A;  2EFW A;  1OGO X;  1H9G A;  1RKW A;  1X3Z B;  1LE8 B;  2DEU A;  1RC9 A;  1BHE A;  2J5O A;  4B43 A;  2DJN A;  1CQT A;  1IRX A;  3K9T A;  4KUM A;  3DFG A;  3DKX A;  4L18 B;  3BC8 A;  1EA3 A;  2RC5 A;  3HRM A;  5HNF A;  4LLL A;  2QLZ A;  4RPB A;  3CZ6 A;  1VND A;  3IAM 2;  3JCU C;  3NEU A;  1TBX A;  2F2E A;  4EJO A;  3L2C A;  2MH2 A;  2PEX A;  1S7E A;  2G7H A;  4OPW A;  4DYQ A;  4BHP A;  4RM0 A;  3CCS B;  2NNY A;  2FNP A;  3FY3 A;  3H92 A;  2R7D A;  4BE2 A;  2A61 A;  3PUF A;  2FE3 A;  3H3U A;  2M34 A;  2PMU A;  2BOL A;  1LDJ A;  3M7G A;  4A3C J;  2L54 A;  3H5R A;  2WA0 A;  1XSD A;  4OIP F;  1ERD A;  1KYW A;  1T0F C;  5IP7 J;  1BQE A;  3OEE A;  3CQZ J;  2NTB A;  2KT0 A;  1TZL A;  3NWT A;  3K1P A;  4C2U A;  2DET A;  1OFM A;  3WU0 A;  2QXZ A;  2LLK A;  1YFH A;  1CLW A;  2JRT A;  2QN6 A;  1WHU A;  2K86 A;  2QUF A;  3WU2 C;  1OB0 A;  3GFM A;  4H4K C;  4PZJ A;  4P3I A;  4OIO F;  1WI9 A;  3F6V A;  1NG7 A;  4E7H A;  4RGX A;  1WSU A;  5KVR A;  4KIC A;  1G3S A;  2EV0 A;  5CVI A;  2ISY A;  3GZ6 A;  1KJZ A;  1VLO A;  1WJD A;  1O8M A;  4FXU A;  2L0K A;  3I64 A;  2JDI A;  4IHV A;  2FOK A;  1T6S A;  3H36 A;  1TSP A;  2LD5 A;  1MMN A;  2WAQ A;  1SMT A;  3QYF A;  2PMD A;  3WY9 A;  4X05 A;  1I27 A;  2BW3 B;  2ZTN A;  5B1B H;  3L09 A;  5E3L A;  3DKW A;  2VE9 A;  1AU7 A;  3HTU A;  3LL7 A;  3ZMV A;  5FLX Z;  1W34 A;  1EH8 A;  2M0C A;  4LBV A;  2E34 A;  3DQV C;  4ZYD A;  2XGJ A;  1QQI A;  1HW2 A;  3DWL E;  3ZN1 A;  3S3M A;  3OE7 A;  2KJB A;  2LY1 A;  2UXX A;  4P9U A;  3S3O A;  1JA1 A;  2IGK A;  2GA2 A;  1KK0 A;  3UNG C;  4XD7 A;  4HZF A;  2DTR A;  3HGY A;  4OIQ F;  2PIA A;  2D9R A;  2R93 J;  3RKX A;  1TWH J;  3CCL I;  1OYY A;  2HZT A;  2QZ8 A;  5M5Y J;  2WJY A;  2Z2S B;  4A0Y A;  4CH7 A;  3CCR B;  4WXD A;  3ONQ A;  2NSP A;  1Q1H A;  2W82 A;  4ZGQ B;  4BEH B;  1R4N B;  2F48 A;  4OIN F;  3OYH A;  2VQH A;  1YJN I;  2OA4 A;  3H3V K;  1KC8 D;  4LK1 F;  2VJJ A;  2V1X A;  4Q47 A;  4QUZ A;  1LM1 A;  3BCB A;  3A0H C;  1WJA A;  4U9U A;  2JA5 J;  4QPO A;  2JA8 J;  4A3G J;  2DYI A;  1N8R D;  1O8I A;  1QVU A;  2DAO A;  3BR1 A;  5FKL A;  2K4B A;  2L5Q A;  4UVC A;  4ZDL A;  6PAX A;  4YXW A;  4LLN A;  4ZYA A;  5HXB A;  4MTE A;  1JJ8 C;  1FIP A;  3I4M J;  3R6S A;  3WTZ A;  2VBV A;  2R5Y B;  3V7R A;  1AKH A;  1ZH5 A;  3C1D A;  1BLI A;  4ACA A;  4F7D A;  1ZHF A;  4XNF A;  4HDV A;  4RCZ A;  1F1Z A;  2BY3 A;  5FD5 A;  4G7H F;  4TMX A;  1O8J A;  4Z06 A;  4YAU A;  2CK3 A;  1QQ1 A;  3FXM A;  1YE9 A;  2WB1 N;  4IL6 C;  3ZXS A;  1DP7 P;  4UB8 C;  3DU1 X;  3MFK A;  4CZC A;  4U87 A;  2V7V A;  3IKV A;  2XGX A;  2JTV A;  1FOK A;  4ROX A;  4HV6 A;  4HLY A;  2VKV A;  4HWV A;  2WSS A;  4AU7 A;  2DFI A;  3K7A J;  2CQQ A;  5A2Q K;  2HLD A;  3DEU A;  3Q0U A;  3AVW A;  3IWF A;  2V9V A;  3ESW B;  1T39 A;  1UAA A;  4NBS A;  2QTL A;  1OFC X;  3SDB A;  5J8C A;  1XS9 A;  5FB2 A;  3ZC3 A;  3CMM A;  4P25 A;  4ENJ A;  2TRT A;  2GA1 A;  4HF0 A;  1ZEL A;  3QFC A;  1ETW A;  2VBS A;  2W00 A;  3WTW C;  3S1N J;  1VQ9 B;  4BGD A;  1DPR A;  1EP3 B;  2M87 A;  2XPW A;  4HEA 2;  4Y15 A;  1K78 A;  3HOY J;  2QGG A;  3LQ6 A;  3NAW A;  2DQL A;  1VJS A;  2V9P A;  2HKO A;  1DGR M;  1YJW B;  3WE2 A;  4UUV A;  4G7O F;  2YU3 A;  3G3Z A;  4WZT A;  2OD5 A;  2RNJ A;  2O0V A;  1F4K A;  3G2B A;  2GOX B;  1OJL A;  2YX4 A;  2DIE A;  4A6E A;  3AVY A;  3LSH A;  2QM3 A;  3S2H J;  3QSY A;  1XTA A;  1X1A A;  5FGM A;  4D5C A;  4ENM A;  1VQ8 B;  1YW8 A;  2H6B A;  1D8J A;  4PC2 A;  1ZRE A;  3CLO A;  5ICE A;  1EJ9 A;  3M3Y J;  1R6R A;  2BV6 A;  3PFY A;  1O7F A;  2NT6 A;  4M3E A;  3L2Q A;  3CCS I;  4EJW A;  4X06 A;  2UZK A;  3RJP A;  3GBG A;  5FFX A;  4IW3 B;  3A03 A;  1U2W A;  2VZL A;  1VI0 A;  1FIA A;  4UVB A;  3GIR A;  4WWV A;  2CSO A;  2RGV A;  2COB A;  1IJF A;  4PJJ A;  5E18 F;  3J81 K;  2BV3 A;  2NVX J;  4M3G A;  2DOG A;  3I56 B;  5GAE J;  1HXD A;  3U6K A;  4B44 A;  3ROU A;  1BW6 A;  2EFO A;  1GQ8 A;  1N07 A;  3FXU A;  2E1M B;  3JQP A;  3H9N A;  2JPC A;  3C3W A;  3JAM Z;  1Z9C A;  2VBT A;  1D0Z A;  4RGR A;  2KHM A;  2GM4 A;  1VQ7 I;  3I5U A;  3GF2 A;  2XT4 A;  2J5P A;  1MAB A;  4XBF A;  2PG4 A;  4L5E A;  1OIS A;  1K5C A;  4TMT A;  3H9J A;  2HU9 A;  3BQY A;  2LSO A;  2O6G E;  2FQ3 A;  3E7L A;  3KYC B;  1WJE A;  3O3K A;  3TO9 A;  4ESF A;  3HRS A;  5HZB A;  1YG2 A;  2I1L A;  2O0Y A;  3K70 C;  5IYN A;  4B3A A;  1J59 A;  3PQK A;  1VQ4 I;  2IGN A;  5KK1 A;  1FC3 A;  2GOM A;  2EH3 A;  2EIL H;  5M3M J;  4DQK A;  4P2N A;  3LA7 A;  3K0L A;  3CCV I;  4E7L A;  1MIJ A;  3AL0 C;  1EZG A;  4BUP A;  1AA7 A;  1TQI A;  2WY7 Q;  3FIW A;  4GYG A;  2GIZ A;  2FA5 A;  4BEH A;  4YFN F;  1TP4 A;  2QCO A;  2BX6 A;  1O57 A;  2EV6 A;  3JRI A;  4QVJ A;  5J40 A;  4BJT A;  1G7R A;  2ZZF A;  5CYV A;  1GV5 A;  3CUO A;  3WHC A;  2P81 A;  2RDP A;  2V1D A;  5GPA A;  4ESB A;  2R0Q C;  3HTS B;  1QVT A;  2V7T A;  2K40 A;  4YEL A;  2L01 A;  2PJR B;  2VQC A;  5GAD J;  4AVZ A;  4MR0 A;  1WRJ A;  2CJJ A;  3D5L A;  3N4M A;  3H94 A;  2WV0 A;  1YO5 C;  3ZUG A;  1OYW A;  3FXJ A;  4P12 A;  3LOC A;  1S6L A;  2ZC2 A;  3AG4 H;  2VIX A;  3GCM A;  4OAZ A;  1WSV A;  1AMO A;  1SAU A;  1G6N A;  2JZY A;  4K1X A;  5LLQ A;  3BR5 A;  2VBY A;  9ANT A;  1F60 A;  3A01 B;  1SFU A;  3CME B;  4LG0 A;  5HS7 A;  1RZ4 A;  5KAF C;  4RAG A;  2VOO A;  1HQC A;  2V6C A;  1VQO B;  4LBW A;  1ZG1 A;  1ZKG A;  4XKB A;  3RYP A;  4M3D A;  3W6V A;  2INV A;  4U49 A;  2Y30 A;  4Q5S F;  1NH3 A;  3IRQ A;  4IHX A;  5L3G A;  4P22 A;  1FBU A;  2Z99 A;  3L2U A;  1ORK A;  2W25 A;  3MZ8 A;  4M9X A;  1FOY A;  1ACI A;  3I55 B;  2C5H A;  1HA8 A;  4RB0 A;  2B9S A;  3Q3S A;  2BM6 A;  5FKM A;  1IG7 A;  2HXO A;  4CCL A;  3FMS A;  1V5V A;  2EWE A;  1K6O A;  3R6K A;  5J4Y A;  5DM6 F;  2WR8 A;  2GK7 A;  1EXM A;  3DPT A;  4QHY A;  3ZBT A;  3LFK A;  4CCN A;  4HBL A;  1UHS A;  5CVR A;  5F0H A;  4PJ0 C;  2X1C A;  2E36 A;  5J8F A;  4FQG A;  5H59 A;  1BJK A;  2VBE A;  1XMA A;  1IO2 A;  5JHF A;  3HJE A;  2Q8K A;  4E7I A;  2VON A;  3OYL A;  5DCM A;  1J7K A;  1V54 H;  4B47 A;  3WNC A;  3A01 A;  4AF7 A;  5EEA A;  3VSU A;  4ENK A;  1WJC A;  1LVA A;  2K9S A;  4XRF A;  4F92 B;  4N4O B;  3MKZ A;  3ONU A;  2HVR A;  2K9N A;  4MGR A;  5TGT A;  3LQR A;  1R1T A;  5DD8 A;  3MKL A;  1W9X A;  1HST A;  3E97 A;  3A3G A;  2EIM H;  3DBL B;  3HPH A;  4LIV A;  3ML3 A;  1IF1 A;  4BYY A;  2Z9O A;  4OJ5 A;  1G2H A;  3M07 A;  3I59 B;  5HNH A;  2YX7 A;  3MWM A;  5DDG A;  2MGQ A;  4G6T B;  4HPQ A;  4X1E A;  3ZR8 X;  5EG0 B;  4NC8 A;  2HXI A;  3LFU A;  4X6A J;  3LMM A;  2HQA A;  3Q5F A;  4IKF A;  3WTY C;  4RB2 C;  3C2B A;  3E6B A;  1A35 A;  2EBI A;  2V79 A;  5L3B A;  5F4M A;  3K4M A;  3HSE A;  4PK4 A;  1FSH A;  1OCP A;  3ZBU A;  1HVX A;  2DDA A;  2DBB A;  1ZUN B;  2YWE A;  3BH6 B;  1QFJ A;  1IJE A;  4ESJ A;  3B82 A;  5E1W A;  1BL0 A;  2ICW G;  3D0S A;  2OTL B;  1Z91 A;  1XGM A;  2DN0 A;  3M8F A;  1Y0R A;  5AON A;  3GQB A;  4RDJ A;  3CP8 A;  2XOK A;  1ON1 A;  2L2O A;  4FE4 A;  3BOQ A;  1B72 B;  1QFZ A;  2QGU A;  4IQJ A;  1S7A A;  2QEX I;  1VTN C;  4PC1 A;  4U88 A;  3IWZ A;  2KIS A;  2G0Y A;  3DCF A;  2OTL I;  2LY2 A;  3VR6 A;  3F8M A;  1ETQ A;  2Y48 A;  3REO A;  4NK6 A;  3G6E B;  3KE2 A;  4M72 A;  2H1L A;  4OOI A;  1N25 A;  3RZD J;  4TMZ A;  2OPT A;  2K9L A;  1OR7 A;  4LFU A;  1Y8R B;  2FUG 2;  3LSM A;  1ZM2 A;  1M90 D;  4HQM A;  1FBQ A;  3A1P A;  5FNZ A;  4EW9 A;  3RPU D;  1LQ1 A;  4K2E A;  1J75 A;  4IOA F;  2WPD A;  3ABU A;  1B9M A;  2JVH A;  3IHU A;  3TP0 A;  1SEU A;  1PXZ A;  3HM5 A;  2GBY A;  2KRC A;  3BR6 A;  1WOP A;  4ITV A;  3TL4 X;  1TT5 B;  4YIR X;  4KKT A;  5FO0 A;  2NTQ A;  1L1I A;  3G71 I;  1WKM A;  3CJQ B;  1IDJ A;  1FZP B;  2DA6 A;  3HKZ N;  1Y39 A;  2LBF A;  1NDH A;  2ZKZ A;  3T8R A;  3BCF A;  5CLS A;  1Q7Y D;  3OYI A;  2XB0 X;  4A3E J;  4R71 A;  2K85 A;  4PJM A;  2JQ7 A;  1E0E A;  4QFM A;  1OPC A;  3M8E A;  2XUB A;  3ZQQ A;  5F0F A;  1V4R A;  1E3O C;  1GVD A;  1L3L A;  2PJR A;  1TNS A;  4X07 A;  1U2R A;  4G9Y A;  2MBF A;  3SY2 A;  2QX3 A;  5D8L B;  4FET A;  1K83 J;  1FYL A;  4RD2 A;  3BPX A;  2NV4 A;  2R7U A;  4YFO A;  4Z4W A;  2A6E F;  2LVS A;  3BZK A;  3UR3 C;  3CRZ A;  2DK8 A;  1YIJ B;  2QA4 I;  1Z05 A;  2DA7 A;  4B3X A;  3G6E I;  1GVH A;  1JUM A;  1X1P A;  1ZGJ A;  1ZYR F;  3J80 K;  3HOU J;  4DYR A;  1R1V A;  4ZDO A;  3RYR A;  5IOY A;  2RC4 A;  3T9G A;  1GV2 A;  5FFZ A;  1YI2 B;  1I1S A;  5CJ9 A;  1MDM B;  2A07 F;  4RM3 A;  5D4S A;  3GLX A;  2AHO A;  4UXN A;  2ADU A;  4AVP A;  3D5S C;  4ETS A;  1T5E A;  3TO7 A;  2K3F A;  1S4M A;  4QV2 A;  1W1W E;  3RIR A;  2HWV A;  5EEG A;  2HPM A;  3E5X A;  4E7S A;  3CC4 B;  1B4A A;  3JRF A;  1XQB A;  5FRM A;  4P9F A;  1OR7 C;  2PN6 A;  3CJN A;  3E5Q A;  3HKZ A;  2WZN A;  5DD4 A;  2Y75 A;  3DBH B;  3G73 A;  3QPT A;  1ON2 A;  3KCC A;  3WNB A;  4B3G A;  1ZLJ A;  3J7A O;  3Q9S A;  3RCO A;  1IRG A;  3MZY A;  3VYU B;  3ZP5 A;  2B5O A;  3AGQ A;  3SJP A;  3M4O J;  4B4D A;  4QIW N;  4LD5 A;  4WX9 A;  5F04 A;  3CMA I;  4ACB A;  1RU4 A;  1R58 A;  2MFZ A;  2FF4 A;  4RDL A;  3MN2 A;  3JRE A;  2EFG A;  2W4S A;  3HOZ J;  4C43 A;  5E6T A;  5ERI A;  2HPI A;  3QAH A;  1QGZ A;  4Z4Y A;  5JLW A;  3AVU A;  1GHC A;  1TW3 A;  4M2L A;  3H0G J;  3EPZ A;  2CW8 A;  4WXH A;  2NZM A;  4Y33 A;  2DXI A;  2VJI A;  4YG2 F;  4X7C A;  1Q82 D;  5J4V A;  2R7Z J;  3LO8 A;  4N4N B;  4Y17 A;  2O3F A;  3BTL A;  1Z67 A;  5EEH A;  4A6D A;  1K4S A;  4KIT B;  3WGH A;  1A6I A;  3CDH A;  1B59 A;  1JI8 A;  4DIQ A;  1J9Z A;  4ZV4 A;  2O7O A;  2BSP A;  4HOB A;  4JRA C;  2HR3 A;  3JSO A;  1Z3X A;  2DA3 A;  1K61 A;  4QPQ A;  1PYV A;  3CXC B;  1XGN A;  2ZSI B;  3FMQ A;  4H9G A;  3EQN A;  4Z03 A;  4U0Y A;  2L3D A;  2NVT J;  2P6S A;  3TBI A;  4AIJ A;  1YTY A;  2A05 A;  4XN3 A;  1B72 A;  1IB4 A;  4LG0 B;  1N0U A;  2KIM A;  1S0U A;  1JKQ C;  2HOE A;  3WTT C;  1IC8 A;  4R8H A;  1D1N A;  3PVD A;  1BIA A;  2I5U A;  3U1D A;  1N08 A;  1PJ7 A;  5HDK A;  1S7O A;  2VFP A;  2F4N A;  3VNV A;  1WPC A;  2YUS A;  5M3F J;  3OR1 C;  5HS9 A;  2FX3 A;  2O6W A;  1BR1 A;  3T56 B;  1K79 A;  1LPQ A;  3SKB A;  2FD5 A;  1D8T A;  3W2V A;  3J7Z I;  4KFC A;  1O8G A;  1WQ2 A;  4Y4R A;  2IW5 A;  3W5H A;  3TP3 A;  3JUR A;  2EK5 A;  3ECH A;  5IP6 A;  1YIT I;  1BR2 A;  3IKT A;  3HOT A;  3M9A A;  4B4C A;  5B3S H;  1H42 A;  4E6K G;  4PC7 A;  3BC9 A;  2BN4 A;  5JLV C;  1QHG A;  2B7E A;  2VPL A;  2EV5 A;  1I39 A;  3WYA A;  1J9I A;  4M71 A;  3EUH A;  3WGG A;  2MAB A;  2RV8 A;  4JQF A;  2KZV A;  4PJL A;  3C18 A;  4LGW A;  5HS8 A;  3FX3 A;  1DU6 A;  1ZM9 A;  3GVJ A;  1WTH D;  4G5G A;  1OGM X;  2NRA C;  4C3I J;  5JR3 A;  1HOM A;  5FO5 A;  1ODD A;  1CF7 A;  1HA3 A;  1UMK A;  4J0Q A;  3DLL F;  1G8X A;  2I10 A;  2O61 A;  4PAA A;  3BH7 B;  1B2R A;  1HCR A;  3KRG A;  3VYT B;  4XQF A;  4FTH A;  2RQP A;  3PNT A;  1MBG A;  3WTV C;  4GRI A;  4DQ2 A;  2LP0 A;  2D45 A;  1U9O A;  2MLG A;  4C9Y A;  5BQT A;  1KMH A;  2DFF A;  2NXN B;  2B7B A;  3FJO A;  5EZH A;  5E3N A;  2E71 A;  4P1W A;  1V55 H;  4BAY A;  2K02 A;  4Y7N J;  3DDY A;  3E6C C;  2R7Q A;  3HPG A;  3I0T A;  2VBK A;  3PQJ A;  1HC8 A;  1SD6 A;  2LH9 A;  1H8E A;  3LSI A;  3Q39 A;  2HDD A;  1OOC A;  2HGC A;  4YEJ A;  1ZRD A;  2JA6 J;  2XDV A;  5IOZ A;  4XLA A;  3R61 A;  1D2E A;  5AIQ A;  3BG6 A;  5ED4 A;  5D5V B;  3LMW A;  2E19 A;  3TDZ C;  4GFB A;  1LDD A;  5IYR A;  2JUG A;  1C0W A;  1K8A D;  1O8D A;  2A6T A;  2GJK A;  2L9V A;  3A1Y A;  2QMU A;  2NPF A;  2W6I A;  4OJO A;  5IPA A;  4XOP A;  2QVO A;  2AXT C;  4C0S A;  2H94 A;  2FBK A;  4CYC B;  3FXK A;  1REP C;  1I18 A;  2NS0 A;  2WWY A;  1FWZ A;  4KH3 A;  3FF5 A;  2X9D A;  3E1S A;  3HBL A;  2ZJ2 A;  1GR1 A;  3ASO H;  3F72 A;  3CW2 A;  4KT6 A;  3MMP A;  1WOO A;  3E0J B;  2QEX B;  2ZSH B;  2HQR A;  4RAZ A;  1UD2 A;  2WAE A;  4H0E A;  4BL0 B;  3FPK A;  4A3K J;  4RPD A;  2DI3 A;  3HSF A;  3EUK L;  1FTZ A;  1OGJ A;  1QA3 A;  1WJ5 A;  2V7F A;  1SFK A;  2RKH A;  2EZL A;  3BPV A;  4XLC A;  5GPC A;  3JTG A;  1PJ6 A;  2E1R A;  4PAB A;  1I5Z A;  2LK2 A;  3K1M A;  3OIO A;  2QYU A;  4UB6 C;  3JAM K;  1N0V C;  4XRS A;  3BY6 A;  2QZA A;  4A3M J;  1QRY A;  3K70 D;  2BGI A;  1TLL A;  2EB7 A;  2OK8 A;  3QU6 A;  4IX7 A;  4I6Z A;  2ZJQ F;  3CUQ C;  4IEJ A;  3QOD A;  4P55 A;  3BQZ A;  3LST A;  4IZZ A;  2WYR A;  3HYI A;  1O8L A;  1D1B A;  3VFZ A;  3OYJ A;  2R92 J;  3LJY A;  2VFO A;  2DCE A;  1GLN A;  1ZGW A;  1ZGA A;  4RS8 A;  3OYN A;  1OB2 A;  4A0Z A;  2FNA A;  2EA4 A;  1FEX A;  3LWF A;  3VSK A;  2DFE A;  1OFE A;  1ETX A;  1W87 A;  3BH4 A;  4X0G A;  4OOS A;  5DEQ A;  4HQE A;  2DDB A;  4Z6Y A;  3N6Z A;  2Q6L A;  4CCK A;  2G9W A;  3BCA A;  5D6E A;  3L7W A;  1YW9 A;  5HVQ C;  1LVK A;  1R7J A;  1W5C C;  1FX7 A;  2KPM A;  2ZXI A;  4UAJ A;  1WXR A;  1BA5 A;  1FLI A;  4BDY A;  2EZK A;  1D5Y A;  4B1R A;  5IT9 Z;  2M5S A;  1FPQ A;  2Y0S A;  1Y6I A;  1U3E M;  3WU1 B;  2R7V A;  2K7L A;  2X6X A;  3D1N I;  2DA2 A;  3WTX C;  5F6F A;  5KHD A;  3SFI A;  2YU9 J;  1T6X A;  3P27 A;  2CQK A;  3B02 A;  5B1A H;  1ZR4 A;  2LF7 A;  4AYB A;  1LJ9 A;  5M5W J;  2QY1 A;  2AQF A;  2NOJ B;  2W1O A;  3CPW B;  2LRE A;  4A3D J;  4WXC A;  1X58 A;  1TYX A;  1KZH A;  3WHB A;  2GK6 A;  1Y0U A;  4HX7 A;  2P6T A;  2H8W A;  1LEB A;  5F4O A;  1JT6 A;  1PP7 U;  2Z16 A;  5HLG A;  4DK0 A;  3TW6 A;  2YR2 A;  3FXL A;  3MCZ A;  5IYB J;  5E3O A;  2ACJ A;  2WAD A;  5C44 J;  2XEX A;  3VOE A;  2MC3 A;  4XM3 A;  4O6J A;  1MSE C;  3CD6 B;  5GTI C;  4RD4 A;  5IT3 A;  2PI0 A;  4XLN F;  3E6D A;  1IN8 A;  4UV9 A;  3MVP A;  5J6X A;  4W97 A;  5EF6 A;  1I7P A;  3OYD A;  3CME I;  2LRD A;  2BM7 A;  5LGU A;  1VF7 A;  2DTZ A;  1WP6 A;  2NS7 A;  5DV5 A;  1YS7 A;  2XAS A;  1W36 C;  4I0A A;  2LG4 A;  1MBF A;  2NVU B;  4KNY A;  2EIX A;  5E20 A;  1K4Z A;  1BMF A;  4W8T A;  3OW7 A;  1AHD P;  3H3Z A;  1EFR A;  2FU4 A;  3ELK A;  2C77 A;  4HF1 A;  3NWS A;  3A3B A;  1LFP A;  2OV7 A;  2DQR A;  2Z8G A;  2KIU A;  3KEW A;  3HGG A;  2Y69 H;  4NB5 A;  1UD6 A;  3ERE D;  5FRN A;  1D3Y A;  3IUO A;  1O8F A;  3CO7 C;  2Q0O A;  2ZBV A;  1KU9 A;  3SQN A;  4HA8 A;  2DMU A;  1TWF J;  4NQW A;  2D1V A;  1OCZ H;  1BC8 C;  1GDT A;  4TKO B;  2ECC A;  4DK1 A;  1IHM A;  3OY9 A;  4IVN A;  2XAQ A;  4HLX A;  2DFH A;  3ABM H;  3HZJ A;  4PMH A;  3WG7 H;  3T5X A;  1G59 A;  4CQJ A;  3OV8 A;  3GQ7 A;  1XB4 A;  2PBI A;  3C2H A;  4D9J A;  1E3Z A;  2QKL B;  1QVF B;  2KQR A;  1P92 A;  4OWR B;  2LMD A;  5AIP A;  2HOT A;  3FXQ A;  3LNQ A;  2KRH A;  5A8A A;  2PYH A;  5IY5 H;  3W6J B;  4PC6 A;  4PGO A;  3BZ6 A;  2XAU A;  2VQL A;  3QQA A;  4I02 A;  3SDG A;  3SHF A;  1FOW A;  3U9G A;  3VDX A;  4AUX A;  3HRT A;  5HLH A;  2OBR A;  3WBK A;  2Z3Y A;  5DCM B;  1JXS A;  2IBD A;  3GTQ J;  2O5R A;  4BXU A;  1VQ7 B;  1SAN A;  1UCR A;  2NTP A;  4RDU A;  1YIT B;  5ILS A;  1KZL A;  1CZF A;  4C2T A;  3U21 A;  2JJ1 A;  2GIV A;  4ENN A;  1MMS A;  1D0X A;  3H9G A;  4GCV A;  1NB0 A;  5JVG F;  1KQS B;  1VQL B;  2XRN A;  1MGT A;  3E20 A;  3CLQ A;  5DUI A;  4YCQ A;  3R0J A;  5GV7 A;  2ZB9 A;  5C3E J;  1I8D A;  5KSW B;  4Z1M A;  5J3L A;  1R5I D;  3GTJ J;  3OSG A;  1EP2 B;  2X0L A;  3OS1 A;  4W8S A;  3OWT A;  3HDD A;  4UVA A;  2FOW A;  3V8L A;  2E2I J;  4CHU A;  3LSR A;  2AXL A;  1I3A A;  2ZNZ A;  3CES A;  3FHN A;  1DP3 A;  2VXD A;  3IV5 A;  1COW A;  1R5O A;  3PUM A;  1WDT A;  4JX6 A;  3AVT A;  3PNV A;  1R71 A;  4II3 A;  3KZI C;  5D8K B;  1RET A;  3CCY A;  2O8K A;  2PMH A;  2YPR A;  5GV8 A;  1QGY A;  2VL8 A;  2JA2 A;  3DBR B;  1JGG A;  4RDK A;  4N9H A;  3K1N A;  1MBK A;  4FWT A;  2F4M B;  3B6C A;  4PJN A;  3K69 A;  2WB1 A;  3HUG B;  4I0B A;  3F3X A;  4QTR A;  4MTD A;  1GT0 C;  4I98 B;  1USS A;  2H1K A;  2STW A;  1M1K D;  3F8N A;  1JA0 A;  4TSF A;  4D5F A;  1KU2 A;  3KP7 A;  2CH0 A;  4KA4 A;  1PVE A;  2WY8 Q;  4B3F X;  4UUS B;  3GVA A;  1I6X A;  3KP2 A;  1ZQ3 P;  3V8K A;  2CYY A;  2VE8 A;  4RAY A;  2XF7 A;  3OS2 A;  2P7C B;  1OMI A;  4BXX J;  1WH5 A;  3LSK A;  2XKO A;  1E64 A;  3ZPP A;  2ZME B;  3KYL A;  2OCC H;  1SMY F;  3DPU A;  3GUD A;  1PP8 F;  2VBU A;  3GO5 A;  2FX0 A;  4L9N A;  3ERM A;  2M4G A;  3H1C A;  1X1B A;  3PNY A;  2X85 A;  3OOU A;  1YOV B;  1XG1 A;  2UUZ A;  4JBA A;  3GQ9 A;  4KN4 X;  1QZE A;  5IYP A;  4W8Q A;  1F9N A;  1LKX A;  5KAI C;  2QSG X;  1U5T C;  2V7X A;  1LFB A;  4NNJ A;  2HMA A;  3HHG A;  1X4P A;  5FO1 A;  2XV4 S;  1KQ0 A;  2ZXW H;  3G71 B;  4Q48 A;  4KIB A;  1E3H A;  3W2W A;  5E3M A;  3KP5 A;  2V6E A;  1OKR A;  3VEP A;  3CMA B;  1T08 B;  1SFX A;  1RES A;  1MJB A;  2ID6 A;  5DTD A;  3RQ4 A;  3B90 A;  1FNN A;  3JW4 A;  3BRO A;  3CDI A;  3JTH A;  3R60 A;  4XKC A;  1AKH B;  4N3G A;  1DBG A;  1WOS A;  2HTS A;  3U2Q A;  2MA3 A;  2CS3 A;  3JRH A;  1FND A;  2LNB A;  4G7Z F;  1EA0 A;  1N78 A;  4OP7 A;  1DGW Y;  1FP2 A;  4LK0 F;  2CV2 A;  4PGG A;  3MKW B;  1FMV A;  3BG9 A;  2EA2 A;  3KLN A;  1IDZ A;  5DCF A;  4Y52 J;  4GQN A;  2X53 S;  4EAT A;  5AMV A;  1V5F A;  4P9S A;  2K9M A;  3VSL A;  2ZL7 A;  3V7A A;  2QA4 B;  2QBY A;  4G6Q A;  4PC3 A;  3CCE B;  1IDK A;  1WCM J;  4G94 A;  3U6B A;  4Q4Z F;  3J80 Z;  2DK5 A;  2A69 F;  2LC2 A;  4ZC3 A;  5CDF A;  5HZA A;  1HF2 A;  2VFQ A;  3JRA A;  5JVT A;  1DDI A;  1JTY A;  1XC5 A;  3KFW X;  3BTI A;  2R7F A;  4XLP F;  1D5V A;  1IXR C;  2ISZ A;  4HX4 A;  3VST A;  3GYH X;  2XF5 A;  1K4T A;  5J35 A;  1TLH B;  2E7X A;  4OMZ A;  1HBX G;  3W2I A;  4J19 A;  3FMR A;  4R1H A;  1FDR A;  2BSA A;  3GTL J;  4BY1 J;  1XN7 A;  1O3Q A;  1TYW A;  1X3U A;  2MD5 A;  4DJA A;  5ICG A;  2E1C A;  5JBQ A;  2O04 A;  1K78 B;  4D0P A;  4HST A;  2NVY J;  2F43 A;  3BWG A;  2F3L A;  4OM9 A;  4ZCI A;  1I1G A;  5K5R A;  1TWC J;  1NBM A;  3QFT A;  2VB6 A;  4IRI A;  3HOW J;  4PDK A;  1QUF A;  4Y7C A;  4OZZ A;  3GQA A;  2CQN A;  1VQ5 B;  1OQY A;  1ZTR A;  4EM1 A;  3RY8 A;  1VQL I;  2XC1 A;  1IN4 A;  3S14 J;  1SKQ A;  3A0B C;  3DP7 A;  1R9T J;  2ESN A;  4ASN A;  2V7U A;  1QJV A;  1T0F A;  2PLF A;  2LFB A;  3OP1 A;  2QEN A;  3P7N A;  4I2O A;  1H80 A;  4JX5 A;  4XN0 A;  4C30 A;  5J1Y A;  2A5W A;  3C2G A;  4G6D A;  3J81 Z;  2VNJ A;  5DS0 A;  3OSF A;  3AG1 H;  4MIM A;  1H88 C;  4Y3O A;  4WQM A;  3GW2 A;  2JN9 A;  5CQE A;  1U9N A;  2ELJ A;  1Y1V J;  2VOD A;  2BBY A;  2WTE A;  1VQ8 I;  3S1Q J;  2O9L A;  2XNC A; 
#chains in the Genus database with same CATH homology
 4DNT B;  1O8H A;  3D5S C;  1T5E A;  3CF2 A;  2MD0 A;  5C1E A;  4FAS D;  2HZD A;  2VLA A;  2HPM A;  4E7S A;  2BVM A;  5FRM A;  1OR7 C;  2XC7 A;  3HKZ A;  1KCD A;  2VAS A;  3H35 A;  3H5N A;  2KMU A;  4MXN A;  4B3G A;  4G6I A;  3N05 A;  1DQU A;  1D1A A;  3RCO A;  3EQO A;  3VYU B;  1QHH D;  3F9K A;  4Z05 A;  2M3A A;  2RQQ A;  1RU4 A;  2MFZ A;  3I3L A;  3GRH A;  2W4S A;  3DTI A;  3FPP A;  3UW0 A;  1SKY B;  2IGO A;  2X1D A;  3S8P A;  1YX3 A;  1OGM X;  4CA0 A;  2HPI A;  2NT9 A;  2IXS A;  2F1M A;  1FMW A;  4U7B A;  2CMP A;  2Q2E B;  2V26 A;  2R7T A;  3EPZ A;  2CW8 A;  3PJR A;  2DT6 A;  1JRG A;  4Y33 A;  1MND A;  2VJI A;  2DXI A;  1VBL A;  2NZM A;  2RRE A;  3M1C A;  4LIT A;  4YZX A;  2X6Y A;  3M8J A;  4RLQ A;  3T53 B;  2JIZ A;  4N4N B;  4P5O A;  1IA5 A;  4KIT B;  1JI8 A;  4DIQ A;  4R79 A;  3VMW A;  3CP2 A;  2BSP A;  4BJ6 C;  4XR6 A;  1OLT A;  2ZXH A;  2D3N A;  1Z3X A;  4HIZ A;  4QPQ A;  1EE6 A;  1PYV A;  1WJF A;  2ZSI B;  5C1C A;  2CW7 A;  2MYS A;  3OYB A;  4BE0 A;  3HAG A;  2Q1Z B;  3EQN A;  4Z03 A;  2K5C A;  4HRI A;  3VSV A;  1HZE A;  4XMY A;  2VJ5 A;  3TBI A;  4CUG A;  1OGO X;  3BG7 A;  2D3L A;  2OUM A;  4XN3 A;  3W3C A;  1BHE A;  1IB4 A;  4B43 A;  1IRX A;  4CCM A;  4XL9 A;  3DKX A;  3SEZ A;  1D0Y A;  3BC8 A;  1EA3 A;  2IQ7 A;  5HNF A;  4XLE A;  3IAS 2;  1E43 A;  2BW3 A;  1NG6 A;  3CZ6 A;  3IAM 2;  1WPC A;  4BAC A;  3OR1 C;  3DEE A;  1BR1 A;  2L9N A;  2PEC A;  3T56 B;  3ZCO A;  1O8G A;  3W2V A;  3FY3 A;  2X51 A;  1UD5 A;  4Y4R A;  4BE2 A;  4OJL A;  2BOL A;  3JUR A;  4EW9 A;  3H5R A;  1BR2 A;  2WA0 A;  3HOT A;  1ERD A;  1T0F C;  4E6K G;  3BC9 A;  3OEE A;  1QHG A;  1V5G A;  3LSG A;  2VPL A;  2NTB A;  1TZL A;  2JVG A;  3NWT A;  2ZTG A;  4C2U A;  2QXZ A;  1OFM A;  3FBN B;  2MAB A;  4JQF A;  3OYG A;  2KZV A;  3BLY A;  4PJL A;  3GVJ A;  1WTH D;  1OB0 A;  2RNG A;  4H4K C;  3HOS A;  1NG7 A;  5KCM A;  4E7H A;  1G8X A;  1KON A;  1LDK B;  1O8M A;  1WJD A;  1E1Q A;  4CCO A;  3KRG A;  3VYT B;  4XQF A;  4FXU A;  3ZPN A;  3PNT A;  2JDI A;  2O17 A;  1NRK A;  4GRI A;  4C9Y A;  1KMH A;  2NST A;  1MMN A;  2WAQ A;  2DJI A;  2L7K A;  4P1W A;  3QYF A;  2WJV A;  2BW3 B;  2ZTN A;  1PE9 A;  3HXL A;  3DDY A;  2R7Q A;  3HPG A;  2VBK A;  1KCC A;  3LL7 A;  4DBQ A;  2LH9 A;  4DBR A;  4F91 B;  1H8E A;  3LSI A;  1Z7L A;  3DQV C;  2BVL A;  2XGJ A;  2R7O A;  4YEJ A;  1OOC A;  2W6J A;  2XDV A;  4XLA A;  2QKM B;  2HNH A;  3DWL E;  1O8E A;  3BG6 A;  2E5Z A;  4E7K A;  3S3M A;  3OE7 A;  2LY1 A;  4F52 A;  3LMW A;  2XF6 A;  3RSN A;  2IGK A;  3TMO A;  4F93 B;  3AKZ A;  3UNG C;  3S3O A;  2JUG A;  1U0J A;  3W2A A;  1W0K A;  2KDO A;  4XD7 A;  2A6T A;  2GJK A;  1O8D A;  3A1Y A;  3OYA A;  1DBO A;  2W6I A;  2ZZG A;  4OJO A;  4XOP A;  2JJ2 A;  2WJY A;  4J00 A;  1T95 A;  2Z2S B;  4CH7 A;  3ZRG A;  1E1R A;  2NSP A;  3ONQ A;  1WMR A;  3GQ8 A;  2W82 A;  1I18 A;  4BEH B;  4CCJ A;  2VQH A;  2VKD A;  3OYH A;  4YZQ A;  3E1S A;  1RMG A;  4NK8 A;  5LD2 C;  1UEL B;  2VJJ A;  3KX2 A;  3BCB A;  2O1D A;  1WFX A;  1WJA A;  1O8I A;  4QPO A;  4KT6 A;  2L9S A;  3E0J B;  2ZSH B;  1UD2 A;  3MKY B;  2IS1 A;  2L5Q A;  3QYE A;  1MW7 A;  4BJ5 C;  2WAE A;  2R7R A;  4BL0 B;  4ZDL A;  4YXW A;  1P9Q C;  4ZYA A;  4ANJ A;  3HL2 A;  3EUK L;  4BXF A;  3GVL A;  2MC4 A;  1X0C A;  2ZZE A;  5FL7 A;  1WJ5 A;  1K6Y A;  2V7F A;  1J09 A;  3OR2 C;  3OYE A;  1SFK A;  4XLC A;  1BLI A;  3PL8 A;  2CV0 A;  4XNF A;  1MMD A;  1O88 A;  3K4C A;  1KTW A;  2V1N A;  1O8J A;  4Z06 A;  1Z3Y A;  2F5V A;  2ZZQ A;  4LG3 A;  2CK3 A;  1YE9 A;  3ZXS A;  3K70 D;  1V5E A;  2CUZ A;  3L2W A;  2X8K A;  3VMV A;  4IX7 A;  4CZC A;  4U87 A;  3QOD A;  2R7S A;  4KJZ A;  2M0M A;  2HDW A;  3DKY A;  3OPO A;  4KKS A;  4IZZ A;  3FKJ A;  3J7A Y;  3LNN A;  2XZL A;  4HWV A;  2R4G A;  2WSS A;  4AU7 A;  1O8L A;  1D1B A;  3OYJ A;  4F3Q A;  2HLD A;  3FDY A;  2DCE A;  4OAY A;  1GLN A;  3QYB A;  1UAA A;  3SDB A;  3OYN A;  3OIQ A;  3CMM A;  1H8H A;  1ZEL A;  3VSK A;  5HLT A;  3WQZ A;  1AIR A;  2W00 A;  3BH4 A;  4BGD A;  4X0G A;  4HEA 2;  3K4K A;  3H0D A;  2KLO A;  2V9K A;  3MD2 A;  4CCK A;  3G05 A;  3A4C A;  1VJS A;  3BCA A;  4XLF A;  2R7X A;  1DGR M;  5HVQ C;  1LVK A;  2KPM A;  3L2R A;  2ZXI A;  1OFL A;  4JMQ A;  3I9V 2;  4BDY A;  4DGW B;  3G2B A;  1S9H A;  2GOX B;  3SEQ A;  2DIE A;  2M5S A;  2ODL A;  1MMA A;  1Y6I A;  2Y0S A;  2PMZ A;  3LSH A;  2E5N A;  3A2K A;  2R7V A;  4BQQ A;  2X6X A;  1X1A A;  3B8Y A;  5KHD A;  3HG9 A;  3K4B A;  2UWM A;  1R6R A;  3PSF A;  3PFY A;  4AYB A;  3OYM A;  2NT6 A;  3L2Q A;  1RWR A;  2QY1 A;  2AQF A;  2NOJ B;  2W1O A;  3GBG A;  2M7A A;  1W0J A;  4ASU A;  2LRE A;  2OC6 A;  2LOO A;  2GK6 A;  5IK2 A;  4B48 A;  3HC7 A;  4XOT A;  2KVO A;  4TT3 A;  2Z16 A;  4PJJ A;  1OHH A;  2XND A;  4DK0 A;  2XZO A;  2HVQ A;  4HNT A;  3K4J A;  2WAD A;  3ZGK A;  4XM3 A;  4B44 A;  3QOE A;  1GQ8 A;  2E1M B;  1YX5 A;  4PFP A;  4U4B A;  3VYS B;  1D0Z A;  2UV1 A;  2KHM A;  3AFH A;  3OYD A;  2LRD A;  1X1C A;  1MAB A;  1VF7 A;  1WP6 A;  2F4I A;  2VXZ A;  2WBM A;  1W36 C;  3OYF A;  1K5C A;  2LG4 A;  3H9J A;  2HU9 A;  3K10 A;  2JSP A;  1N77 A;  1BMF A;  4UZU A;  4W8T A;  3OW7 A;  2V7Q A;  1WJE A;  1EFR A;  3NWS A;  4HNU A;  3A3B A;  1LFP A;  2OV7 A;  3OYK A;  3K70 C;  2Z8G A;  4YZ0 A;  3KEW A;  2VQG A;  1UD6 A;  5HOO A;  2IGN A;  5FRN A;  2V31 A;  3IUO A;  1O8F A;  2GOM A;  5FRO A;  3NE5 B;  3V42 A;  3PSI A;  3OMY A;  1QU3 A;  2LBF B;  1UD3 A;  3AL0 C;  4E7L A;  4TKO B;  4HG2 A;  4BUP A;  1AA7 A;  2WY7 Q;  4DK1 A;  4BEH A;  3IP4 B;  3OY9 A;  4BJT A;  2ZZF A;  2ZFU A;  4BU2 A;  4PMH A;  4CSW A;  1W36 D;  4E7J A;  1G59 A;  4YEL A;  1N75 A;  3RTR A;  3GQ7 A;  3H9Q A;  2VQC A;  3C2H A;  4ZDP A;  4D9J A;  4AVZ A;  2PJR B;  2QKL B;  1E3Z A;  3OIP A;  3S3N A;  4DNR B;  2KQR A;  4MR0 A;  3D5L A;  4IQ4 A;  4OWR B;  3H94 A;  4I84 A;  2PYH A;  2KRH A;  1MNE A;  4NUB A;  3A35 A;  2CV1 A;  3D5R C;  2XAU A;  2VQL A;  4XOR A;  3VDX A;  1E79 A;  2VIX A;  2KL4 A;  1VLY A;  5LFA A;  4OAZ A;  1Z21 A;  1SAU A;  5CQG A;  2I8D A;  3K4L A;  2O5R A;  2DOA A;  2NTP A;  3H5A A;  4RLF A;  2E1M C;  1BOB A;  1X4O A;  2M7B A;  1KZL A;  2R9V A;  1CZF A;  4XKB A;  4C2T A;  4U49 A;  2WAF A;  1BR4 A;  3U21 A;  2JJ1 A;  2INV A;  2X3H A;  3WWG A;  3ZSC A;  1D0X A;  3H9G A;  3EUA A;  4P22 A;  3L2U A;  4L8J A;  1VZ0 A;  3OEH A;  4PSX A;  4LIU A;  4E4H A;  2GJR A;  4RMN A;  4E7Z A;  2XSJ C;  1HA8 A;  1I8D A;  2E1B A;  1MMG A;  4Z1M A;  4OZY A;  2P0W A;  4NQW B;  3OS1 A;  4CCL A;  4W8S A;  2EWE A;  4BDZ A;  1PJR A;  3OWT A;  3FKS A;  3CES A;  4XKV A;  3DPT A;  3FHN A;  1DP3 A;  2GK7 A;  3JU4 A;  2VXD A;  1COW A;  3PUB A;  4CCN A;  2INU A;  2IS6 A;  4XKW A;  4C2L A;  3DPL C;  3PNV A;  1Y56 A;  3AL0 B;  4II3 A;  2X1C A;  2Z6B D;  2V4J C;  2X1E A;  3OS0 A;  4BQN A;  2CUJ A;  2O0V A;  1X19 A;  2VL8 A;  2HVS A;  2JA2 A;  2VBE A;  3DTK A;  4PUS A;  5JHF A;  4E7I A;  4PJN A;  3OYL A;  4RM2 A;  3CJR B;  2WB1 A;  3HUG B;  2F6C A;  4B47 A;  3DU5 A;  3VSU A;  1WJC A;  3MKZ A;  4F92 B;  4N4O B;  4TSF A;  1BN8 A;  3B4N A;  2AQE A;  4URR A;  2HVR A;  2CH0 A;  1WJB A;  5TGT A;  4B3F X;  2WY8 Q;  3OL3 A;  4E0F A;  1W9X A;  2VBM A;  1V0F A;  3OL4 A;  3A3G A;  3HPH A;  3VYR B;  2XF7 A;  4LIV A;  5CPR B;  3OS2 A;  2LZJ A;  3L2V A;  2QE7 A;  3LSK A;  3ZPP A;  3OAA A;  4F55 A;  4OJ5 A;  3KYL A;  3DPU A;  4JOM A;  3EUH C;  5HNH A;  3BCD A;  2M4G A;  1X1B A;  3PNY A;  2X85 A;  4G6T B;  3OOU A;  4HPQ A;  3S32 A;  4PFO A;  4BS9 A;  2IGM A;  2GJP A;  1O8K A;  3GQ9 A;  2UUZ A;  3ZR8 X;  4NC8 A;  1HG8 A;  1XG2 A;  3K6G A;  4XON A;  4W8Q A;  3LFU A;  1E3X A;  3LMM A;  1LKX A;  2HQA A;  2X6W A;  4J01 A;  4IKF A;  3FBI B;  4NNJ A;  3VWB A;  1X4P A;  3K4M A;  4PK4 A;  3W2W A;  2W7N A;  1HVX A;  2V6E A;  4ZTF A;  4NC7 A;  5CKT A;  3RQ4 A;  3B90 A;  3GQB A;  3CP8 A;  4XKC A;  2XOK A;  2L2O A;  3ZIA A;  4OJ6 A;  2VKH A;  1DBG A;  4OJP A;  4IQJ A;  2CS3 A;  1D1C A;  1TT0 A;  4D1Q A;  1N78 A;  2LY2 A;  1DGW Y;  4II2 A;  4HSR A;  3SZG A;  3MKW B;  2CV2 A;  1FMV A;  3VR6 A;  4NK6 A;  4GQN A;  2X53 S;  4EAT A;  5AMV A;  1V5F A;  2K9M A;  2K9L A;  3DTE A;  3VSL A;  3OFN A;  4ZJZ A;  2FUG 2;  3LSM A;  2LYC A;  3DLA A;  4YRV A;  1IDK A;  1JTA A;  4G7X A;  4ZC3 A;  2LC2 A;  3RPU D;  5CDF A;  2WZP P;  4XLH A;  2WPD A;  1NHC A;  1UD4 A;  4BQO A;  2JVH A;  1UD8 A;  3MMY B;  5HKK A;  2V4D A;  1PXZ A;  2KRC A;  3SYT A;  4KKT A;  4ITV A;  2DT7 B;  2XF5 A;  3TL4 X;  2NTQ A;  3VST A;  1FX0 A;  3OYC A;  3S93 A;  3CJQ B;  1IDJ A;  2CFO A;  2VJ4 A;  2XZP A;  2LBF A;  1QCX A;  2O04 A;  4DJA A;  4YZA A;  4G7W A;  3BCF A;  2F43 A;  4HST A;  3OYI A;  3K4N A;  5KNL A;  4PJM A;  1E0E A;  3GVK A;  1NBM A;  2VB6 A;  1X1D A;  3ZQQ A;  2UVE A;  4KKU A;  4OZZ A;  2E60 A;  3GQA A;  3OOC A;  3DU6 A;  2PJR A;  4ZTJ A;  4W8R A;  2QX3 A;  1UG0 A;  1PKV A;  4FET A;  1QJV A;  5DN6 A;  2R7U A;  3UR3 C;  2M4K A;  4KIS A;  1H80 A;  4RM3 A;  4XN0 A;  4C30 A;  2A5W A;  3C2G A;  2O0W A;  4B3X A;  3T51 B;  4Y3O A;  1PLU A;  1BPL A;  3SUC A;  4ZDO A;  2Z1D A;  4BE1 A;  1K28 D;  2K3P A;  5CQE A;  2UVF A;  2ELJ A;  2PYG A;  4PSW A;  3T9G A;  2R7W A;  4MLO A;  2IS2 A;  1V0E A;  3KEY A;  4DOZ A;  2KP6 A;  2IS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...