2J8KA

Structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
181
structure length
181
Chain Sequence
VPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
molecule keywords NP275-NP276
total genus 79
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2j8kA01
2XT4A 2XTWA 2J8KA 2XTYA 2QYUA 2XTXA 4YCQA 2O6WA 3SY2A 3NAWA 4YDTA 3SQVA 4YEIA 3PSZA 4YC5A 5DNSA 3NB2A 2XT2A 4YFOA 2QZAA 3DU1X 3PSSA
chains in the Genus database with same CATH superfamily
2XT4A 2NT6A 2NZMA 2XTWA 4XNFA 2NTBA 2J8KA 4XKVA 1PE9A 2PYHA 2QYUA 1TYVA 4U4BA 1BN8A 1HF2A 4OM9A 2O6WA 4YCQA 1OFMA 2J8IA 2IQ7A 3JURA 4XLFA 4AVZA 3VSUA 1DBOA 4YDTA 2B0RA 2VJIA 3SQVA 1RMGA 3ZSCA 1AIRA 3VMVA 2VBMA 1QA2A 1EA0A 1JTAA 1H80A 4YC5A 2O17A 1OGOX 1K8FA 4NK6A 4XOPA 1LM1A 2NTPA 5DNSA 1LLWA 3T9GA 4OPWA 4EW9A 1XG2A 4XLHA 4YFOA 1O8HA 4XM3A 3DU1X 1O88A 3AK5A 3LMWA 5JLVC 4C2LA 1LLZA 2VFMA 1DABA 4W8TA 1PXZA 2QY1A 3UW0A 1KCDA 2XTXA 2F3LA 2NSPA 3N90A 3VSVA 2BM7A 1O8MA 2YUHA 4XKWA 3SY2A 2UVFA 3NAWA 2BX6A 1CZFA 4XLCA 4URRA 1WXRA 2UVEA 3GQ8A 2VFPA 2VBEA 2XC1A 3KRGA 2ODLA 1EE6A 4Z05A 3WWGA 1OFLA 4HWVA 1K5CA 1TYXA 2O04A 2XT2A 2W7ZA 3EQNA 1KTWA 4W8RA 1O8DA 2QZAA 1QA1A 4KH3A 4XOTA 4XN0A 2BM4A 4YZXA 1QRCA 3GRHA 3N6ZA 1O8KA 4XR6A 1IB4A 3PSSA 3SZEA 1WMRA 1IA5A 1TYUA 4V02C 2XTYA 1OOCA 2INVA 3SYJA 1KQ5A 4MXNA 2G0YA 1OGMX 1QA3A 1IDKA 3B90A 4JRAC 1BHEA 1DBGA 1O8EA 3BH7B 3PETA 3GQAA 1O8IA 4XN3A 4Z03A 5JMCB 3H09A 3EQOA 5C1EA 1OFDA 1IDJA 2VFOA 4U49A 3LYCA 4XORA 1JRGA 1RU4A 4W8QA 3VMWA 4XLAA 2VFNA 3NB2A 5C1CA 3P4GA 4I84A 5AMVA 3RIQA 1HG8A 1O8LA 4OZZA 4YZAA 1QCXA 1X0CA 2BSPA 1EZGA 2VJJA 1O8JA 4OZYA 1CLWA 3LJYA 3B8YA 2X6WA 2NSTA 3JX8A 4XLEA 3ZPPA 2Z8GA 4OJ6A 2VFQA 3FY3A 4YEJA 1QRBA 3VSTA 2IOUG 4XMYA 1O8FA 1O8GA 1VBLA 2O1DA 1PLUA 2NTQA 2QXZA 2X85A 3SUCA 1L1IA 2QX3A 4YEIA 2PYGA 3PSZA 2BM5A 1RWRA 1TYWA 1OFEA 3B4NA 4OJOA 4XQFA 2X6XA 2V5IA 3ML3A 4YZ0A 4OJ5A 2O0VA 4XL9A 4W8SA 3BH6B 2PECA 4XONA 2NT9A 4Z06A 3TH0A 1KCCA 2EWEA 4YZQA 2X6YA 4OJPA 1NHCA 4NK8A 1K4ZA 3GQ9A 4PMHA 4YELA 2O0WA 2X3HA 1GQ8A 1TSPA 2INUA 1QQ1A 4OJLA 1QJVA 3GQ7A 2BM6A 4MR0A 2VBKA
chains in the Genus database with same CATH topology
2XT4A 2XTWA 2J8KA 2XTYA 2QYUA 2XTXA 4YCQA 2O6WA 3SY2A 3NAWA 4YDTA 3SQVA 4YEIA 3PSZA 4YC5A 5DNSA 3NB2A 2XT2A 4YFOA 2QZAA 3DU1X 3PSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT4 A;  2XTW A;  2J8K A;  2XTY A;  2QYU A;  2XTX A;  4YCQ A;  2O6W A;  3SY2 A;  3NAW A;  4YDT A;  3SQV A;  4YEI A;  3PSZ A;  4YC5 A;  5DNS A;  3NB2 A;  2XT2 A;  4YFO A;  2QZA A;  3DU1 X;  3PSS A; 
#chains in the Genus database with same CATH topology
 2XT4 A;  2NT6 A;  2NZM A;  2XTW A;  4XNF A;  2NTB A;  2J8K A;  4XKV A;  1PE9 A;  2PYH A;  2QYU A;  1TYV A;  4U4B A;  1BN8 A;  1HF2 A;  4OM9 A;  2O6W A;  4YCQ A;  1OFM A;  2J8I A;  2IQ7 A;  3JUR A;  4XLF A;  4AVZ A;  3VSU A;  1DBO A;  4YDT A;  2B0R A;  2VJI A;  3SQV A;  1RMG A;  3ZSC A;  1AIR A;  3VMV A;  2VBM A;  1QA2 A;  1EA0 A;  1JTA A;  1H80 A;  4YC5 A;  2O17 A;  1OGO X;  1K8F A;  4NK6 A;  4XOP A;  1LM1 A;  2NTP A;  5DNS A;  1LLW A;  3T9G A;  4OPW A;  4EW9 A;  1XG2 A;  4XLH A;  4YFO A;  1O8H A;  4XM3 A;  3DU1 X;  1O88 A;  3AK5 A;  3LMW A;  5JLV C;  4C2L A;  1LLZ A;  2VFM A;  1DAB A;  4W8T A;  1PXZ A;  2QY1 A;  3UW0 A;  1KCD A;  2XTX A;  2F3L A;  2NSP A;  3N90 A;  3VSV A;  2BM7 A;  1O8M A;  2YUH A;  4XKW A;  3SY2 A;  2UVF A;  3NAW A;  2BX6 A;  1CZF A;  4XLC A;  4URR A;  1WXR A;  2UVE A;  3GQ8 A;  2VFP A;  2VBE A;  2XC1 A;  3KRG A;  2ODL A;  1EE6 A;  4Z05 A;  3WWG A;  1OFL A;  4HWV A;  1K5C A;  1TYX A;  2O04 A;  2XT2 A;  2W7Z A;  3EQN A;  1KTW A;  4W8R A;  1O8D A;  2QZA A;  1QA1 A;  4KH3 A;  4XOT A;  4XN0 A;  2BM4 A;  4YZX A;  1QRC A;  3GRH A;  3N6Z A;  1O8K A;  4XR6 A;  1IB4 A;  3PSS A;  3SZE A;  1WMR A;  1IA5 A;  1TYU A;  4V02 C;  2XTY A;  1OOC A;  2INV A;  3SYJ A;  1KQ5 A;  4MXN A;  2G0Y A;  1OGM X;  1QA3 A;  1IDK A;  3B90 A;  4JRA C;  1BHE A;  1DBG A;  1O8E A;  3BH7 B;  3PET A;  3GQA A;  1O8I A;  4XN3 A;  4Z03 A;  5JMC B;  3H09 A;  3EQO A;  5C1E A;  1OFD A;  1IDJ A;  2VFO A;  4U49 A;  3LYC A;  4XOR A;  1JRG A;  1RU4 A;  4W8Q A;  3VMW A;  4XLA A;  2VFN A;  3NB2 A;  5C1C A;  3P4G A;  4I84 A;  5AMV A;  3RIQ A;  1HG8 A;  1O8L A;  4OZZ A;  4YZA A;  1QCX A;  1X0C A;  2BSP A;  1EZG A;  2VJJ A;  1O8J A;  4OZY A;  1CLW A;  3LJY A;  3B8Y A;  2X6W A;  2NST A;  3JX8 A;  4XLE A;  3ZPP A;  2Z8G A;  4OJ6 A;  2VFQ A;  3FY3 A;  4YEJ A;  1QRB A;  3VST A;  2IOU G;  4XMY A;  1O8F A;  1O8G A;  1VBL A;  2O1D A;  1PLU A;  2NTQ A;  2QXZ A;  2X85 A;  3SUC A;  1L1I A;  2QX3 A;  4YEI A;  2PYG A;  3PSZ A;  2BM5 A;  1RWR A;  1TYW A;  1OFE A;  3B4N A;  4OJO A;  4XQF A;  2X6X A;  2V5I A;  3ML3 A;  4YZ0 A;  4OJ5 A;  2O0V A;  4XL9 A;  4W8S A;  3BH6 B;  2PEC A;  4XON A;  2NT9 A;  4Z06 A;  3TH0 A;  1KCC A;  2EWE A;  4YZQ A;  2X6Y A;  4OJP A;  1NHC A;  4NK8 A;  1K4Z A;  3GQ9 A;  4PMH A;  4YEL A;  2O0W A;  2X3H A;  1GQ8 A;  1TSP A;  2INU A;  1QQ1 A;  4OJL A;  1QJV A;  3GQ7 A;  2BM6 A;  4MR0 A;  2VBK A; 
#chains in the Genus database with same CATH homology
 2XT4 A;  2XTW A;  2J8K A;  2XTY A;  2QYU A;  2XTX A;  4YCQ A;  2O6W A;  3SY2 A;  3NAW A;  4YDT A;  3SQV A;  4YEI A;  3PSZ A;  4YC5 A;  5DNS A;  3NB2 A;  2XT2 A;  4YFO A;  2QZA A;  3DU1 X;  3PSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...