2J8KA

Structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
181
structure length
181
Chain Sequence
VPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NP275-NP276
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
total genus 79
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2j8kA01
3SY2A 3NB2A 3SQVA 2J8KA 3DU1X 2O6WA 4YC5A 3PSSA 2XTWA 2QYUA 4YEIA 2XT2A 3NAWA 4YFOA 2QZAA 4YCQA 2XTYA 5DNSA 2XTXA 4YDTA 3PSZA 2XT4A
chains in the Genus database with same CATH superfamily
1WMRA 3SUCA 3EQOA 1K8FA 1K4ZA 2QX3A 2X3HA 4YZAA 3RIQA 3BH6B 1QA1A 2NSTA 3NB2A 1TYXA 1O8EA 2NT6A 3B4NA 2X6WA 2BX6A 3VSUA 3GQ8A 4EW9A 2X85A 1HF2A 1LLZA 2BM6A 4YEJA 3SQVA 2O6WA 2IQ7A 5JMCB 3PSSA 4Z03A 2VBEA 4OPWA 1TSPA 3N6ZA 3ZPPA 4AVZA 4C2LA 3ZSCA 4XN0A 3VSTA 1AIRA 1O8LA 1QRBA 3SYJA 4XQFA 3B8YA 2NSPA 1O88A 1O8IA 2BSPA 2QY1A 3FY3A 2QXZA 1KTWA 2XT4A 4MXNA 1OOCA 4XOPA 1HG8A 3SY2A 2NZMA 2O0WA 4I84A 2YUHA 1JRGA 1RU4A 1TYVA 1EA0A 4YELA 2NTQA 3SZEA 1IDKA 1QRCA 2VFNA 3JURA 1OFEA 4OZZA 4W8RA 1OGOX 4XLEA 1QCXA 2VJIA 2VFQA 4OJ6A 1O8KA 2O1DA 4OJLA 1QQ1A 2VJJA 4YZQA 1OFMA 2BM5A 1KQ5A 4W8SA 4YC5A 1QA3A 1O8FA 1O8GA 4XKWA 2QYUA 4XLAA 3NAWA 4W8QA 4OM9A 1BHEA 1PLUA 2ODLA 4YFOA 2INUA 4YCQA 2O0VA 1OGMX 1O8MA 2VBMA 4YDTA 1IB4A 2X6YA 3PSZA 4XL9A 1BN8A 4OJ5A 4NK6A 4XN3A 5JLVC 3TH0A 3VSVA 4Z06A 3LMWA 4XLHA 2BM7A 1OFLA 3P4GA 4XONA 2VFOA 4MR0A 2PECA 1IA5A 3GQ9A 2O04A 1RMGA 5AMVA 3KRGA 1CLWA 1RWRA 2BM4A 4U4BA 4KH3A 4XOTA 2J8KA 1L1IA 1LM1A 2O17A 2UVFA 3GQAA 2INVA 3BH7B 4PMHA 2VFMA 3VMVA 5C1CA 1LLWA 4OJPA 4XLFA 2Z8GA 3EQNA 4JRAC 1JTAA 2V5IA 1EE6A 4XNFA 1WXRA 3T9GA 1QJVA 1O8JA 1IDJA 2QZAA 2NTBA 3LYCA 4OZYA 2XTXA 1DBOA 1VBLA 3B90A 1XG2A 3GRHA 4XMYA 1CZFA 5DNSA 3PETA 2VBKA 2G0YA 3AK5A 2IOUG 1QA2A 1K5CA 4XORA 4YZ0A 3JX8A 4URRA 4YZXA 4XLCA 4Z05A 1GQ8A 1H80A 1O8HA 1OFDA 2PYGA 3H09A 4W8TA 1X0CA 1O8DA 2X6XA 3ML3A 4OJOA 3N90A 1NHCA 2J8IA 2EWEA 4XKVA 2UVEA 3DU1X 4V02C 1DBGA 2XC1A 2PYHA 3VMWA 2VFPA 2W7ZA 2NT9A 2B0RA 2XTWA 3GQ7A 1DABA 1PE9A 1TYUA 4YEIA 2XT2A 2NTPA 3UW0A 4HWVA 1EZGA 5C1EA 2XTYA 1PXZA 4XM3A 3LJYA 1TYWA 2F3LA 3WWGA 1KCCA 4U49A 1KCDA 4XR6A 4NK8A
chains in the Genus database with same CATH topology
3SY2A 3NB2A 3SQVA 2J8KA 3DU1X 2O6WA 4YC5A 3PSSA 2XTWA 2QYUA 4YEIA 2XT2A 3NAWA 4YFOA 2QZAA 4YCQA 2XTYA 5DNSA 2XTXA 4YDTA 3PSZA 2XT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  3NB2 A;  3SQV A;  2J8K A;  3DU1 X;  2O6W A;  4YC5 A;  3PSS A;  2XTW A;  2QYU A;  4YEI A;  2XT2 A;  3NAW A;  4YFO A;  2QZA A;  4YCQ A;  2XTY A;  5DNS A;  2XTX A;  4YDT A;  3PSZ A;  2XT4 A; 
#chains in the Genus database with same CATH topology
 1WMR A;  3SUC A;  3EQO A;  1K8F A;  1K4Z A;  2QX3 A;  2X3H A;  4YZA A;  3RIQ A;  3BH6 B;  1QA1 A;  2NST A;  3NB2 A;  1TYX A;  1O8E A;  2NT6 A;  3B4N A;  2X6W A;  2BX6 A;  3VSU A;  3GQ8 A;  4EW9 A;  2X85 A;  1HF2 A;  1LLZ A;  2BM6 A;  4YEJ A;  3SQV A;  2O6W A;  2IQ7 A;  5JMC B;  3PSS A;  4Z03 A;  2VBE A;  4OPW A;  1TSP A;  3N6Z A;  3ZPP A;  4AVZ A;  4C2L A;  3ZSC A;  4XN0 A;  3VST A;  1AIR A;  1O8L A;  1QRB A;  3SYJ A;  4XQF A;  3B8Y A;  2NSP A;  1O88 A;  1O8I A;  2BSP A;  2QY1 A;  3FY3 A;  2QXZ A;  1KTW A;  2XT4 A;  4MXN A;  1OOC A;  4XOP A;  1HG8 A;  3SY2 A;  2NZM A;  2O0W A;  4I84 A;  2YUH A;  1JRG A;  1RU4 A;  1TYV A;  1EA0 A;  4YEL A;  2NTQ A;  3SZE A;  1IDK A;  1QRC A;  2VFN A;  3JUR A;  1OFE A;  4OZZ A;  4W8R A;  1OGO X;  4XLE A;  1QCX A;  2VJI A;  2VFQ A;  4OJ6 A;  1O8K A;  2O1D A;  4OJL A;  1QQ1 A;  2VJJ A;  4YZQ A;  1OFM A;  2BM5 A;  1KQ5 A;  4W8S A;  4YC5 A;  1QA3 A;  1O8F A;  1O8G A;  4XKW A;  2QYU A;  4XLA A;  3NAW A;  4W8Q A;  4OM9 A;  1BHE A;  1PLU A;  2ODL A;  4YFO A;  2INU A;  4YCQ A;  2O0V A;  1OGM X;  1O8M A;  2VBM A;  4YDT A;  1IB4 A;  2X6Y A;  3PSZ A;  4XL9 A;  1BN8 A;  4OJ5 A;  4NK6 A;  4XN3 A;  5JLV C;  3TH0 A;  3VSV A;  4Z06 A;  3LMW A;  4XLH A;  2BM7 A;  1OFL A;  3P4G A;  4XON A;  2VFO A;  4MR0 A;  2PEC A;  1IA5 A;  3GQ9 A;  2O04 A;  1RMG A;  5AMV A;  3KRG A;  1CLW A;  1RWR A;  2BM4 A;  4U4B A;  4KH3 A;  4XOT A;  2J8K A;  1L1I A;  1LM1 A;  2O17 A;  2UVF A;  3GQA A;  2INV A;  3BH7 B;  4PMH A;  2VFM A;  3VMV A;  5C1C A;  1LLW A;  4OJP A;  4XLF A;  2Z8G A;  3EQN A;  4JRA C;  1JTA A;  2V5I A;  1EE6 A;  4XNF A;  1WXR A;  3T9G A;  1QJV A;  1O8J A;  1IDJ A;  2QZA A;  2NTB A;  3LYC A;  4OZY A;  2XTX A;  1DBO A;  1VBL A;  3B90 A;  1XG2 A;  3GRH A;  4XMY A;  1CZF A;  5DNS A;  3PET A;  2VBK A;  2G0Y A;  3AK5 A;  2IOU G;  1QA2 A;  1K5C A;  4XOR A;  4YZ0 A;  3JX8 A;  4URR A;  4YZX A;  4XLC A;  4Z05 A;  1GQ8 A;  1H80 A;  1O8H A;  1OFD A;  2PYG A;  3H09 A;  4W8T A;  1X0C A;  1O8D A;  2X6X A;  3ML3 A;  4OJO A;  3N90 A;  1NHC A;  2J8I A;  2EWE A;  4XKV A;  2UVE A;  3DU1 X;  4V02 C;  1DBG A;  2XC1 A;  2PYH A;  3VMW A;  2VFP A;  2W7Z A;  2NT9 A;  2B0R A;  2XTW A;  3GQ7 A;  1DAB A;  1PE9 A;  1TYU A;  4YEI A;  2XT2 A;  2NTP A;  3UW0 A;  4HWV A;  1EZG A;  5C1E A;  2XTY A;  1PXZ A;  4XM3 A;  3LJY A;  1TYW A;  2F3L A;  3WWG A;  1KCC A;  4U49 A;  1KCD A;  4XR6 A;  4NK8 A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  3NB2 A;  3SQV A;  2J8K A;  3DU1 X;  2O6W A;  4YC5 A;  3PSS A;  2XTW A;  2QYU A;  4YEI A;  2XT2 A;  3NAW A;  4YFO A;  2QZA A;  4YCQ A;  2XTY A;  5DNS A;  2XTX A;  4YDT A;  3PSZ A;  2XT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...