2J8KA

Structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
181
structure length
181
Chain Sequence
VPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
molecule keywords NP275-NP276
total genus 79
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2j8kA01
3SQVA 4YFOA 4YC5A 2QYUA 2XTWA 4YDTA 3PSZA 2XT2A 5DNSA 3NAWA 4YEIA 4YCQA 3PSSA 3NB2A 2QZAA 2J8KA 3DU1X 2O6WA 3SY2A 2XTYA 2XT4A 2XTXA
chains in the Genus database with same CATH superfamily
1DABA 4YZ0A 1DBOA 4XLCA 1RWRA 4XLEA 2O17A 2ODLA 1KQ5A 2J8IA 3BH7B 4XL9A 1QRCA 2W7ZA 3BH6B 4XN3A 4YELA 5DNSA 4YZAA 3VSTA 4W8SA 4XLHA 1TYUA 5JLVC 1O88A 4MXNA 2V5IA 3LJYA 1QRBA 2O1DA 2QXZA 4YCQA 5AMVA 1AIRA 3GQ9A 3VMVA 3JURA 2VFOA 4OZYA 4OJ6A 4XMYA 1NHCA 2INVA 3DU1X 4OPWA 3ZSCA 1JTAA 2XTYA 3RIQA 4U4BA 3EQOA 2NTQA 2VBMA 3LYCA 2VFMA 3ML3A 4NK6A 2BX6A 3GQAA 1DBGA 2X6YA 1QJVA 1LLWA 3ZPPA 5JMCB 4YZXA 1PE9A 1BN8A 2QYUA 2F3LA 4OJPA 4Z03A 1WMRA 1IDKA 1OGMX 1RU4A 3B8YA 4PMHA 1QA2A 1O8DA 2XT2A 1OFDA 2QX3A 4OJLA 4XONA 4MR0A 3GRHA 1O8KA 4U49A 4V02C 4XLFA 1HF2A 3WWGA 4I84A 1LM1A 1O8LA 2BSPA 3LMWA 4Z05A 2O04A 3NB2A 3SYJA 1K8FA 1O8EA 2BM4A 4OJOA 1IB4A 2J8KA 1QCXA 2VFQA 3VMWA 1BHEA 4YZQA 4Z06A 4W8RA 2XT4A 2NT6A 1EZGA 4XNFA 3B90A 1JRGA 1LLZA 3B4NA 3SQVA 1RMGA 4YFOA 4XN0A 1TYXA 2VJIA 2PYHA 2VBKA 4YEJA 4YC5A 4XKWA 2XTWA 3N6ZA 1QA1A 1TYWA 4YDTA 1VBLA 3SZEA 2X6XA 3PSZA 4XM3A 1O8JA 1OFMA 2VJJA 3KRGA 4W8QA 3VSUA 2IQ7A 1CLWA 2B0RA 2O0WA 2NTBA 3NAWA 3P4GA 4OJ5A 1CZFA 4XKVA 4XOTA 1QA3A 1PLUA 4OZZA 1O8HA 4XLAA 2UVEA 3PSSA 4KH3A 1X0CA 2QZAA 2NSTA 1TYVA 2G0YA 1GQ8A 2INUA 3EQNA 1OFEA 1QQ1A 2IOUG 4OM9A 2O6WA 2YUHA 1H80A 3GQ7A 2BM7A 4XR6A 4URRA 4XOPA 3AK5A 3UW0A 4JRAC 1PXZA 1OGOX 1O8IA 4AVZA 1IA5A 1L1IA 1KCCA 3T9GA 4HWVA 1IDJA 4XQFA 4C2LA 1K4ZA 1OFLA 2NT9A 3N90A 2NTPA 2PYGA 2X6WA 2X3HA 2EWEA 3PETA 4NK8A 2BM6A 4XORA 5C1EA 1KCDA 2VFNA 1XG2A 3SUCA 3VSVA 1EE6A 3GQ8A 2UVFA 5C1CA 2PECA 4YEIA 1K5CA 1TSPA 2X85A 2BM5A 2NZMA 1O8FA 1KTWA 2XC1A 3SY2A 3TH0A 1WXRA 1EA0A 2O0VA 3H09A 3JX8A 4W8TA 1O8MA 4EW9A 1HG8A 1OOCA 2Z8GA 2NSPA 2QY1A 1O8GA 2VFPA 2XTXA 3FY3A 2VBEA
chains in the Genus database with same CATH topology
3SQVA 4YFOA 4YC5A 2QYUA 2XTWA 4YDTA 3PSZA 2XT2A 5DNSA 3NAWA 4YEIA 4YCQA 3PSSA 3NB2A 2QZAA 2J8KA 3DU1X 2O6WA 3SY2A 2XTYA 2XT4A 2XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQV A;  4YFO A;  4YC5 A;  2QYU A;  2XTW A;  4YDT A;  3PSZ A;  2XT2 A;  5DNS A;  3NAW A;  4YEI A;  4YCQ A;  3PSS A;  3NB2 A;  2QZA A;  2J8K A;  3DU1 X;  2O6W A;  3SY2 A;  2XTY A;  2XT4 A;  2XTX A; 
#chains in the Genus database with same CATH topology
 1DAB A;  4YZ0 A;  1DBO A;  4XLC A;  1RWR A;  4XLE A;  2O17 A;  2ODL A;  1KQ5 A;  2J8I A;  3BH7 B;  4XL9 A;  1QRC A;  2W7Z A;  3BH6 B;  4XN3 A;  4YEL A;  5DNS A;  4YZA A;  3VST A;  4W8S A;  4XLH A;  1TYU A;  5JLV C;  1O88 A;  4MXN A;  2V5I A;  3LJY A;  1QRB A;  2O1D A;  2QXZ A;  4YCQ A;  5AMV A;  1AIR A;  3GQ9 A;  3VMV A;  3JUR A;  2VFO A;  4OZY A;  4OJ6 A;  4XMY A;  1NHC A;  2INV A;  3DU1 X;  4OPW A;  3ZSC A;  1JTA A;  2XTY A;  3RIQ A;  4U4B A;  3EQO A;  2NTQ A;  2VBM A;  3LYC A;  2VFM A;  3ML3 A;  4NK6 A;  2BX6 A;  3GQA A;  1DBG A;  2X6Y A;  1QJV A;  1LLW A;  3ZPP A;  5JMC B;  4YZX A;  1PE9 A;  1BN8 A;  2QYU A;  2F3L A;  4OJP A;  4Z03 A;  1WMR A;  1IDK A;  1OGM X;  1RU4 A;  3B8Y A;  4PMH A;  1QA2 A;  1O8D A;  2XT2 A;  1OFD A;  2QX3 A;  4OJL A;  4XON A;  4MR0 A;  3GRH A;  1O8K A;  4U49 A;  4V02 C;  4XLF A;  1HF2 A;  3WWG A;  4I84 A;  1LM1 A;  1O8L A;  2BSP A;  3LMW A;  4Z05 A;  2O04 A;  3NB2 A;  3SYJ A;  1K8F A;  1O8E A;  2BM4 A;  4OJO A;  1IB4 A;  2J8K A;  1QCX A;  2VFQ A;  3VMW A;  1BHE A;  4YZQ A;  4Z06 A;  4W8R A;  2XT4 A;  2NT6 A;  1EZG A;  4XNF A;  3B90 A;  1JRG A;  1LLZ A;  3B4N A;  3SQV A;  1RMG A;  4YFO A;  4XN0 A;  1TYX A;  2VJI A;  2PYH A;  2VBK A;  4YEJ A;  4YC5 A;  4XKW A;  2XTW A;  3N6Z A;  1QA1 A;  1TYW A;  4YDT A;  1VBL A;  3SZE A;  2X6X A;  3PSZ A;  4XM3 A;  1O8J A;  1OFM A;  2VJJ A;  3KRG A;  4W8Q A;  3VSU A;  2IQ7 A;  1CLW A;  2B0R A;  2O0W A;  2NTB A;  3NAW A;  3P4G A;  4OJ5 A;  1CZF A;  4XKV A;  4XOT A;  1QA3 A;  1PLU A;  4OZZ A;  1O8H A;  4XLA A;  2UVE A;  3PSS A;  4KH3 A;  1X0C A;  2QZA A;  2NST A;  1TYV A;  2G0Y A;  1GQ8 A;  2INU A;  3EQN A;  1OFE A;  1QQ1 A;  2IOU G;  4OM9 A;  2O6W A;  2YUH A;  1H80 A;  3GQ7 A;  2BM7 A;  4XR6 A;  4URR A;  4XOP A;  3AK5 A;  3UW0 A;  4JRA C;  1PXZ A;  1OGO X;  1O8I A;  4AVZ A;  1IA5 A;  1L1I A;  1KCC A;  3T9G A;  4HWV A;  1IDJ A;  4XQF A;  4C2L A;  1K4Z A;  1OFL A;  2NT9 A;  3N90 A;  2NTP A;  2PYG A;  2X6W A;  2X3H A;  2EWE A;  3PET A;  4NK8 A;  2BM6 A;  4XOR A;  5C1E A;  1KCD A;  2VFN A;  1XG2 A;  3SUC A;  3VSV A;  1EE6 A;  3GQ8 A;  2UVF A;  5C1C A;  2PEC A;  4YEI A;  1K5C A;  1TSP A;  2X85 A;  2BM5 A;  2NZM A;  1O8F A;  1KTW A;  2XC1 A;  3SY2 A;  3TH0 A;  1WXR A;  1EA0 A;  2O0V A;  3H09 A;  3JX8 A;  4W8T A;  1O8M A;  4EW9 A;  1HG8 A;  1OOC A;  2Z8G A;  2NSP A;  2QY1 A;  1O8G A;  2VFP A;  2XTX A;  3FY3 A;  2VBE A; 
#chains in the Genus database with same CATH homology
 3SQV A;  4YFO A;  4YC5 A;  2QYU A;  2XTW A;  4YDT A;  3PSZ A;  2XT2 A;  5DNS A;  3NAW A;  4YEI A;  4YCQ A;  3PSS A;  3NB2 A;  2QZA A;  2J8K A;  3DU1 X;  2O6W A;  3SY2 A;  2XTY A;  2XT4 A;  2XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...