2J8KA

Structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
181
structure length
181
Chain Sequence
VPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords NP275-NP276
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
total genus 79
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2j8kA01
2XTYA 2O6WA 3PSZA 4YC5A 2QZAA 3PSSA 3SY2A 4YDTA 3SQVA 2QYUA 2XT4A 2XTWA 3NAWA 4YCQA 2XT2A 3DU1X 4YFOA 4YEIA 2XTXA 5DNSA 2J8KA 3NB2A
chains in the Genus database with same CATH superfamily
1O8FA 1QA3A 4EW9A 1PXZA 2XTYA 3N6ZA 2IOUG 1EA0A 1OFEA 1QRBA 2O04A 3PSZA 4W8RA 3EQOA 1OFLA 4U4BA 2YUHA 2NT9A 1IDJA 4YC5A 1RWRA 2QZAA 1HG8A 2NTBA 1OFDA 2BSPA 4XL9A 2QX3A 1IA5A 3SQVA 2XT4A 2XTWA 2NZMA 1PE9A 3VMVA 4YCQA 4XKVA 4NK6A 3VMWA 1QCXA 2X6XA 2F3LA 2QY1A 1AIRA 1WMRA 3WWGA 2O17A 1PLUA 2G0YA 3GQ7A 3PETA 2NSTA 4OJLA 4W8TA 3AK5A 1O8MA 4KH3A 1TYWA 3BH6B 3ZSCA 4XNFA 4URRA 3SYJA 1GQ8A 5AMVA 1O8IA 1QQ1A 3VSUA 2VFPA 4C2LA 2NSPA 2INVA 1KCCA 2BX6A 1OFMA 3RIQA 4OPWA 3JURA 1H80A 1HF2A 1KTWA 2NT6A 2O0WA 4XN3A 1IDKA 1O8JA 1DBGA 3PSSA 4XLEA 1CZFA 2INUA 2QYUA 2UVFA 4W8SA 2BM7A 3NAWA 4YZ0A 2O1DA 4AVZA 1WXRA 1O88A 1JRGA 2PYGA 3UW0A 1O8DA 4MR0A 1K5CA 1EZGA 1OOCA 2B0RA 4OZYA 1O8HA 2X6YA 2VBKA 1BN8A 1DBOA 1OGOX 4XKWA 4XOPA 4HWVA 1LLZA 3B4NA 4OJOA 1IB4A 2J8IA 3GQ9A 1DABA 5C1CA 4XLHA 1VBLA 1RU4A 4W8QA 1QJVA 4YELA 2X3HA 1BHEA 1O8LA 2VJJA 3GQAA 2VFOA 4XLFA 1KCDA 2PYHA 1O8EA 3VSVA 4YZXA 4Z05A 2QXZA 2BM4A 4XMYA 5JLVC 4MXNA 3SZEA 3SY2A 2IQ7A 1TYVA 4YDTA 3GRHA 1KQ5A 1K4ZA 1L1IA 1TYUA 3P4GA 4OJPA 4YZAA 1EE6A 4NK8A 3T9GA 4YZQA 2VJIA 4Z03A 3TH0A 2XT2A 3BH7B 2X85A 1TSPA 2XC1A 4PMHA 4YFOA 1LLWA 1OGMX 1O8KA 2VBEA 4YEIA 4U49A 4V02C 4OZZA 1QRCA 4XLAA 1CLWA 5C1EA 2BM5A 2VFQA 5DNSA 2J8KA 1NHCA 2W7ZA 2VFNA 3JX8A 3NB2A 3SUCA 1RMGA 1QA2A 3ML3A 1X0CA 4XN0A 2O6WA 3ZPPA 2NTQA 3B90A 1QA1A 3GQ8A 2Z8GA 4XQFA 2O0VA 3KRGA 2ODLA 4XOTA 1JTAA 3LYCA 3VSTA 1TYXA 2X6WA 5JMCB 2UVEA 4XLCA 1XG2A 4YEJA 2BM6A 1O8GA 3N90A 3EQNA 4OJ5A 1K8FA 3DU1X 3LJYA 4XR6A 4OM9A 4XM3A 3LMWA 4OJ6A 4XONA 2VBMA 2XTXA 3B8YA 4Z06A 3H09A 2PECA 4XORA 2VFMA 2V5IA 4I84A 4JRAC 2EWEA 1LM1A 2NTPA 3FY3A
chains in the Genus database with same CATH topology
2XTYA 2O6WA 3PSZA 4YC5A 2QZAA 3PSSA 3SY2A 4YDTA 3SQVA 2QYUA 2XT4A 2XTWA 3NAWA 4YCQA 2XT2A 3DU1X 4YFOA 4YEIA 2XTXA 5DNSA 2J8KA 3NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTY A;  2O6W A;  3PSZ A;  4YC5 A;  2QZA A;  3PSS A;  3SY2 A;  4YDT A;  3SQV A;  2QYU A;  2XT4 A;  2XTW A;  3NAW A;  4YCQ A;  2XT2 A;  3DU1 X;  4YFO A;  4YEI A;  2XTX A;  5DNS A;  2J8K A;  3NB2 A; 
#chains in the Genus database with same CATH topology
 1O8F A;  1QA3 A;  4EW9 A;  1PXZ A;  2XTY A;  3N6Z A;  2IOU G;  1EA0 A;  1OFE A;  1QRB A;  2O04 A;  3PSZ A;  4W8R A;  3EQO A;  1OFL A;  4U4B A;  2YUH A;  2NT9 A;  1IDJ A;  4YC5 A;  1RWR A;  2QZA A;  1HG8 A;  2NTB A;  1OFD A;  2BSP A;  4XL9 A;  2QX3 A;  1IA5 A;  3SQV A;  2XT4 A;  2XTW A;  2NZM A;  1PE9 A;  3VMV A;  4YCQ A;  4XKV A;  4NK6 A;  3VMW A;  1QCX A;  2X6X A;  2F3L A;  2QY1 A;  1AIR A;  1WMR A;  3WWG A;  2O17 A;  1PLU A;  2G0Y A;  3GQ7 A;  3PET A;  2NST A;  4OJL A;  4W8T A;  3AK5 A;  1O8M A;  4KH3 A;  1TYW A;  3BH6 B;  3ZSC A;  4XNF A;  4URR A;  3SYJ A;  1GQ8 A;  5AMV A;  1O8I A;  1QQ1 A;  3VSU A;  2VFP A;  4C2L A;  2NSP A;  2INV A;  1KCC A;  2BX6 A;  1OFM A;  3RIQ A;  4OPW A;  3JUR A;  1H80 A;  1HF2 A;  1KTW A;  2NT6 A;  2O0W A;  4XN3 A;  1IDK A;  1O8J A;  1DBG A;  3PSS A;  4XLE A;  1CZF A;  2INU A;  2QYU A;  2UVF A;  4W8S A;  2BM7 A;  3NAW A;  4YZ0 A;  2O1D A;  4AVZ A;  1WXR A;  1O88 A;  1JRG A;  2PYG A;  3UW0 A;  1O8D A;  4MR0 A;  1K5C A;  1EZG A;  1OOC A;  2B0R A;  4OZY A;  1O8H A;  2X6Y A;  2VBK A;  1BN8 A;  1DBO A;  1OGO X;  4XKW A;  4XOP A;  4HWV A;  1LLZ A;  3B4N A;  4OJO A;  1IB4 A;  2J8I A;  3GQ9 A;  1DAB A;  5C1C A;  4XLH A;  1VBL A;  1RU4 A;  4W8Q A;  1QJV A;  4YEL A;  2X3H A;  1BHE A;  1O8L A;  2VJJ A;  3GQA A;  2VFO A;  4XLF A;  1KCD A;  2PYH A;  1O8E A;  3VSV A;  4YZX A;  4Z05 A;  2QXZ A;  2BM4 A;  4XMY A;  5JLV C;  4MXN A;  3SZE A;  3SY2 A;  2IQ7 A;  1TYV A;  4YDT A;  3GRH A;  1KQ5 A;  1K4Z A;  1L1I A;  1TYU A;  3P4G A;  4OJP A;  4YZA A;  1EE6 A;  4NK8 A;  3T9G A;  4YZQ A;  2VJI A;  4Z03 A;  3TH0 A;  2XT2 A;  3BH7 B;  2X85 A;  1TSP A;  2XC1 A;  4PMH A;  4YFO A;  1LLW A;  1OGM X;  1O8K A;  2VBE A;  4YEI A;  4U49 A;  4V02 C;  4OZZ A;  1QRC A;  4XLA A;  1CLW A;  5C1E A;  2BM5 A;  2VFQ A;  5DNS A;  2J8K A;  1NHC A;  2W7Z A;  2VFN A;  3JX8 A;  3NB2 A;  3SUC A;  1RMG A;  1QA2 A;  3ML3 A;  1X0C A;  4XN0 A;  2O6W A;  3ZPP A;  2NTQ A;  3B90 A;  1QA1 A;  3GQ8 A;  2Z8G A;  4XQF A;  2O0V A;  3KRG A;  2ODL A;  4XOT A;  1JTA A;  3LYC A;  3VST A;  1TYX A;  2X6W A;  5JMC B;  2UVE A;  4XLC A;  1XG2 A;  4YEJ A;  2BM6 A;  1O8G A;  3N90 A;  3EQN A;  4OJ5 A;  1K8F A;  3DU1 X;  3LJY A;  4XR6 A;  4OM9 A;  4XM3 A;  3LMW A;  4OJ6 A;  4XON A;  2VBM A;  2XTX A;  3B8Y A;  4Z06 A;  3H09 A;  2PEC A;  4XOR A;  2VFM A;  2V5I A;  4I84 A;  4JRA C;  2EWE A;  1LM1 A;  2NTP A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 2XTY A;  2O6W A;  3PSZ A;  4YC5 A;  2QZA A;  3PSS A;  3SY2 A;  4YDT A;  3SQV A;  2QYU A;  2XT4 A;  2XTW A;  3NAW A;  4YCQ A;  2XT2 A;  3DU1 X;  4YFO A;  4YEI A;  2XTX A;  5DNS A;  2J8K A;  3NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...