2J8KA

Structure of the fusion of np275 and np276, pentapeptide repeat proteins from nostoc punctiforme
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
181
structure length
181
Chain Sequence
b'VPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NP275-NP276
publication title Structural Characterization of the Fusion of Two Pentapeptide Repeat Proteins, Np275 and Np276, from Nostoc Punctiforme: Resurrection of an Ancestral Protein.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Toxin
total genus 79
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2006-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2j8kA01
2XTXA 3NAWA 2XTYA 2XT4A 3SY2A 3SQVA 2QZAA 3PSZA 4YCQA 4YC5A 2O6WA 5DNSA 3DU1X 3PSSA 2XTWA 4YDTA 4YFOA 2XT2A 3NB2A 4YEIA 2QYUA 2J8KA
chains in the Genus database with same CATH superfamily
1OGMX 4XMYA 3UW0A 1AIRA 4PMHA 1BN8A 1O8GA 1KQ5A 2NT6A 2XTYA 4XLEA 4YZAA 1DABA 1O8JA 1EE6A 3GRHA 2NTQA 4JRAC 1IDKA 4KH3A 3VMVA 2VJJA 2NSPA 4AVZA 5C1CA 4XKVA 2X6XA 5C1EA 1X0CA 1O8DA 1PE9A 1O8MA 2XC1A 2X6YA 2PECA 1VBLA 3EQOA 4OJ6A 4YZQA 1EZGA 4Z05A 4W8QA 2O0VA 3PSSA 1IB4A 4EW9A 3T9GA 4OJ5A 4YFOA 1IDJA 4MXNA 1K8FA 1RMGA 1LLZA 1PXZA 3RIQA 2O0WA 2J8KA 4XLHA 1OFDA 1O8IA 3AK5A 2B0RA 2F3LA 1HF2A 2NSTA 3FY3A 3NAWA 3VMWA 3P4GA 2BM4A 1QA3A 4YZ0A 3SZEA 1TYVA 1OGOX 1JTAA 3BH6B 4YELA 3SYJA 1KCCA 1QA2A 1EA0A 3SQVA 2QZAA 1OFEA 4MR0A 2X6WA 4YC5A 2VFQA 3GQAA 2EWEA 3SUCA 5JLVC 2BM5A 1LLWA 2QY1A 3LYCA 2PYHA 4YEJA 5DNSA 4OM9A 4U4BA 1TYWA 2QXZA 2X85A 1O88A 4XLCA 3VSVA 1L1IA 1RU4A 1OOCA 1O8EA 4YZXA 2VFNA 4XL9A 2BX6A 2XTXA 3B4NA 1QRBA 3ML3A 4Z03A 1RWRA 1TYUA 3ZPPA 2NZMA 2UVEA 4OZZA 2IOUG 2VBMA 2VBEA 4U49A 4W8RA 4OPWA 1DBOA 3GQ7A 2BM6A 4C2LA 5JMCB 4XR6A 2O17A 4XNFA 3PSZA 1XG2A 4YCQA 3TH0A 1QA1A 3GQ9A 1KCDA 4NK6A 1QJVA 3WWGA 4XLAA 2O1DA 4OZYA 2NT9A 1K4ZA 2YUHA 4XLFA 4XN0A 1OFMA 3BH7B 1NHCA 1K5CA 4XN3A 1WXRA 2VFPA 4XOPA 4OJLA 4I84A 3PETA 3NB2A 4W8TA 4YEIA 1O8FA 2QYUA 2VJIA 4W8SA 2UVFA 4XM3A 1IA5A 1CZFA 4HWVA 2NTBA 3ZSCA 2INUA 4Z06A 1JRGA 1GQ8A 2VFOA 2Z8GA 3KRGA 1KTWA 2BSPA 4XONA 3VSTA 1QQ1A 2V5IA 2XT4A 4URRA 1WMRA 3SY2A 4OJPA 1BHEA 2IQ7A 3JURA 2O04A 2ODLA 1HG8A 3B8YA 1H80A 2BM7A 2W7ZA 3EQNA 2VBKA 3GQ8A 1QRCA 3LMWA 1QCXA 1O8HA 1CLWA 1TYXA 3N90A 3JX8A 3VSUA 4XKWA 1OFLA 3LJYA 1DBGA 2G0YA 2O6WA 2VFMA 3DU1X 2J8IA 4XOTA 5AMVA 2XTWA 1PLUA 4OJOA 1TSPA 2X3HA 4V02C 2XT2A 4YDTA 3N6ZA 4XQFA 2INVA 1LM1A 4NK8A 1O8LA 3B90A 2NTPA 2QX3A 1O8KA 3H09A 2PYGA 4XORA
chains in the Genus database with same CATH topology
2XTXA 3NAWA 2XTYA 2XT4A 3SY2A 3SQVA 2QZAA 3PSZA 4YCQA 4YC5A 2O6WA 5DNSA 3DU1X 3PSSA 2XTWA 4YDTA 4YFOA 2XT2A 3NB2A 4YEIA 2QYUA 2J8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTX A;  3NAW A;  2XTY A;  2XT4 A;  3SY2 A;  3SQV A;  2QZA A;  3PSZ A;  4YCQ A;  4YC5 A;  2O6W A;  5DNS A;  3DU1 X;  3PSS A;  2XTW A;  4YDT A;  4YFO A;  2XT2 A;  3NB2 A;  4YEI A;  2QYU A;  2J8K A; 
#chains in the Genus database with same CATH topology
 1OGM X;  4XMY A;  3UW0 A;  1AIR A;  4PMH A;  1BN8 A;  1O8G A;  1KQ5 A;  2NT6 A;  2XTY A;  4XLE A;  4YZA A;  1DAB A;  1O8J A;  1EE6 A;  3GRH A;  2NTQ A;  4JRA C;  1IDK A;  4KH3 A;  3VMV A;  2VJJ A;  2NSP A;  4AVZ A;  5C1C A;  4XKV A;  2X6X A;  5C1E A;  1X0C A;  1O8D A;  1PE9 A;  1O8M A;  2XC1 A;  2X6Y A;  2PEC A;  1VBL A;  3EQO A;  4OJ6 A;  4YZQ A;  1EZG A;  4Z05 A;  4W8Q A;  2O0V A;  3PSS A;  1IB4 A;  4EW9 A;  3T9G A;  4OJ5 A;  4YFO A;  1IDJ A;  4MXN A;  1K8F A;  1RMG A;  1LLZ A;  1PXZ A;  3RIQ A;  2O0W A;  2J8K A;  4XLH A;  1OFD A;  1O8I A;  3AK5 A;  2B0R A;  2F3L A;  1HF2 A;  2NST A;  3FY3 A;  3NAW A;  3VMW A;  3P4G A;  2BM4 A;  1QA3 A;  4YZ0 A;  3SZE A;  1TYV A;  1OGO X;  1JTA A;  3BH6 B;  4YEL A;  3SYJ A;  1KCC A;  1QA2 A;  1EA0 A;  3SQV A;  2QZA A;  1OFE A;  4MR0 A;  2X6W A;  4YC5 A;  2VFQ A;  3GQA A;  2EWE A;  3SUC A;  5JLV C;  2BM5 A;  1LLW A;  2QY1 A;  3LYC A;  2PYH A;  4YEJ A;  5DNS A;  4OM9 A;  4U4B A;  1TYW A;  2QXZ A;  2X85 A;  1O88 A;  4XLC A;  3VSV A;  1L1I A;  1RU4 A;  1OOC A;  1O8E A;  4YZX A;  2VFN A;  4XL9 A;  2BX6 A;  2XTX A;  3B4N A;  1QRB A;  3ML3 A;  4Z03 A;  1RWR A;  1TYU A;  3ZPP A;  2NZM A;  2UVE A;  4OZZ A;  2IOU G;  2VBM A;  2VBE A;  4U49 A;  4W8R A;  4OPW A;  1DBO A;  3GQ7 A;  2BM6 A;  4C2L A;  5JMC B;  4XR6 A;  2O17 A;  4XNF A;  3PSZ A;  1XG2 A;  4YCQ A;  3TH0 A;  1QA1 A;  3GQ9 A;  1KCD A;  4NK6 A;  1QJV A;  3WWG A;  4XLA A;  2O1D A;  4OZY A;  2NT9 A;  1K4Z A;  2YUH A;  4XLF A;  4XN0 A;  1OFM A;  3BH7 B;  1NHC A;  1K5C A;  4XN3 A;  1WXR A;  2VFP A;  4XOP A;  4OJL A;  4I84 A;  3PET A;  3NB2 A;  4W8T A;  4YEI A;  1O8F A;  2QYU A;  2VJI A;  4W8S A;  2UVF A;  4XM3 A;  1IA5 A;  1CZF A;  4HWV A;  2NTB A;  3ZSC A;  2INU A;  4Z06 A;  1JRG A;  1GQ8 A;  2VFO A;  2Z8G A;  3KRG A;  1KTW A;  2BSP A;  4XON A;  3VST A;  1QQ1 A;  2V5I A;  2XT4 A;  4URR A;  1WMR A;  3SY2 A;  4OJP A;  1BHE A;  2IQ7 A;  3JUR A;  2O04 A;  2ODL A;  1HG8 A;  3B8Y A;  1H80 A;  2BM7 A;  2W7Z A;  3EQN A;  2VBK A;  3GQ8 A;  1QRC A;  3LMW A;  1QCX A;  1O8H A;  1CLW A;  1TYX A;  3N90 A;  3JX8 A;  3VSU A;  4XKW A;  1OFL A;  3LJY A;  1DBG A;  2G0Y A;  2O6W A;  2VFM A;  3DU1 X;  2J8I A;  4XOT A;  5AMV A;  2XTW A;  1PLU A;  4OJO A;  1TSP A;  2X3H A;  4V02 C;  2XT2 A;  4YDT A;  3N6Z A;  4XQF A;  2INV A;  1LM1 A;  4NK8 A;  1O8L A;  3B90 A;  2NTP A;  2QX3 A;  1O8K A;  3H09 A;  2PYG A;  4XOR A; 
#chains in the Genus database with same CATH homology
 2XTX A;  3NAW A;  2XTY A;  2XT4 A;  3SY2 A;  3SQV A;  2QZA A;  3PSZ A;  4YCQ A;  4YC5 A;  2O6W A;  5DNS A;  3DU1 X;  3PSS A;  2XTW A;  4YDT A;  4YFO A;  2XT2 A;  3NB2 A;  4YEI A;  2QYU A;  2J8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...