3BH7B

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
total genus 103
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh7B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh7B02
3PJ9A 4EK2A 4CP5A 3EVMA 3Q8YA 3VGUA 1BHNA 3ZTPA 1WKKA 3DDIA 1U8WA 1PKUA 2BX6A 1S57A 1MN7A 1PAEX 4WBFA 3EVOA 3Q83A 3NGUA 3R9LA 3VVTA 2DXEA 1NDCA 1K4ZA 2CWKA 3GPAA 3ZTQA 4W98A 5IOLA 3VGTA 1NSQA 4FKXA 1B99A 3B54A 4ANCA 4DZ6A 1NDLA 1NDKA 3ELHA 3FCWA 1HF2A 1W7WA 3L7UA 2HURA 1NPKA 1KQ5A 3ENAA 4C6AA 4O0NA 1K8FA 3G2XA 2BEFA 1HLWA 3FBCA 4ENOA 3JS9A 3GP9A 3BH6B 3EVWA 1HIYA 3FC9A 1HHQA 2VU5A 4V02C 1MN9A 1WKJA 3Q86A 3DKDA 5BXIA 3FCVA 3EE3A 2HVEA 2B8QA 3B6BA 1B4SA 3BBBA 1BE4A 1S5ZA 3FKBA 4KPCA 2DYAA 2DY9A 1LWXA 1WKLA 2YUHA 1NB2A 1VYAA 2DXDA 5CABA 3ZTSA 1NUEA 1F3FA 1EHWA 3VGVA 3ZTRA 3ZTOA 3EICA 3FBEA 4UOFA 3NGRA 3NGTA 4FKYA 1F6TA 3PRVA 1BUXA 4ANDA 3EM1A 3EMTA 1ZS6A 2B0RA 1UCNA 2HVDA 3EJMA 2NCKL 1JXVA 1NLKL 4F36A 3BBCA 3BBFA 1NSKL 3Q8UA 4DI6A 3BH7B 4ANEA 1XIQA 1XQIA 1NSPA 4DUTA 2ZUAA 1NDPA 5C7PA 2AZ1A 2AZ3A 3ETMA 3VVUA 1NHKL 3MPDA 4S0MA 3Q89A 3VGSA 3WX8A 3Q8VA 4F4AA 4UOGA 1LEOA 1NCLA 1S59A 3NGSA 3FBFA 2B8PA 1K44A 4HR2A 1KDNA 2DXFA 3FBBA 4UOHA 5CAAA
chains in the Genus database with same CATH superfamily
1R3NA 1TUGB 5KT4A 3EVMA 5DDPC 4OPWA 4F50A 4MAKA 3VGUA 4OJ6A 2FVQA 3HHEA 2XG8A 4RBVA 3ZSCA 2WVEA 2XMWA 3G6ES 2VQFJ 4WCEQ 1VQNS 3DDIA 5F8IA 5A0YA 4DL3A 4NLWA 5DG9A 2C28A 1H3DA 3WIUA 3RR8A 2KRBA 2QLBB 3CSKA 1S6UA 5JJBA 2BJEA 2V8VA 2R8KA 2NS1B 2M9KA 2Y0SD 4QQBA 1WEXA 2D69A 4ZMMA 1FXDA 2OPRB 3MM6A 3RU0A 2CPYA 5KFMA 2PSZA 4X65J 2MXYA 1SC6A 5JLVC 2E1AA 4NZ7A 4DSEA 4L72B 2K3IA 3UN2A 4DS5A 3RB4A 1LWCB 1L3UA 2HNZA 4ED1A 4YDTA 2KFNA 2FHJA 4URGA 2R7UA 2YWKA 4PR6A 2Q6BA 1SL1A 1JLEB 4USIA 3GPAA 2ZZMA 2H1YA 4YMEA 2CPXA 1T9XA 2HRYA 4ECQA 3VQTA 4C2LA 4LT6A 1BQNB 4Y0FA 4UZBA 1HQUB 2ZVIA 2ZBPA 1B99A 3I9V9 3R7BB 3M8YA 4MK8A 2OFHX 2QL9B 3B4DA 3D9BA 2N3LA 3BGRA 3EGWB 4CLFA 5HL7Q 1IR2A 2XCAA 4CLLA 1VRTA 3CJ0A 1HF2A 2FC8A 2G0JA 2CZ9A 1X4FA 3M8WA 2F8HA 1Q81T 4LRCA 3N6LA 2A18A 2QMWA 1IM6A 3D1HA 3O2IA 2Y1IA 3C3LA 1KNZA 1X9WA 2POKA 4IG0A 3MR2A 2RQ4A 4ELVA 1GQ8A 2IRUA 4DEZA 4DSJA 4HTJA 4V02C 1F9FA 5D3GB 4RNMA 1HNIB 3I96A 2JEJA 1QM9A 3C6UB 3VSTA 3HHNB 4XNFA 2OPSA 4OJGA 4P71A 1Y4ZB 3R5CA 3DM2A 2DNYA 9ATCB 2MHEA 2Z8QA 2HHSA 5E3AA 1U1KA 3C15A 3SQVA 4I2QB 4BWJA 2JFDA 1VHIA 3FKBA 3K59A 2DYAA 4Q2MA 3QSYB 4CNYA 2F4VJ 1S49A 2VG6A 3WZ0A 4ZIWA 3KLEB 4GVLA 1T9WA 1NJZA 4WWSA 1U1RA 3CULA 3KLHB 4GKKJ 4PZVA 4XKWA 1NUEA 3EXYA 4IFVA 2R8HA 2ILZA 4PKDB 3CPWR 5B7WA 4XONA 3GQ8A 2ATLA 1S97A 5HQ8A 2ROPA 1R0CB 3D54A 3CIMA 2P6TA 4OYPA 2MYFA 4EBEA 4JI0J 1N5VA 1TKTB 1K9MT 1E6VA 1WC6A 2J76E 5K8MA 3K5MA 1KEKA 1S76D 1WOSA 2DNNA 1BGXT 1Y00A 2BJDA 2DISA 1C1BA 2C2MB 3M4XA 1WEZA 1X4DA 1F9EB 1HBNB 1UCNA 2EPIA 2MQMA 2FTRA 2AYEA 5HSPA 4C0BA 2IQ7A 3PSSA 1WC5A 1SJQA 3M32A 3MFHA 2L9DA 2RQCA 4AXJA 1T05A 3DRPB 4I6WA 3VZIA 1DTTA 1O8MA 3C16A 3ITHB 4J7CA 4PQUA 4ZVPB 5KT2A 2GJ2A 2DRAA 4X66J 4I2QA 2IJFA 4OZ5A 2KI2A 2E5LF 4RLEA 4U8VA 4QYRA 3HT3A 1SKRA 3AOCA 3WC0A 4A48A 4DQQA 1V6HA 3SCIE 2HS3A 1U49A 2FY1A 2QE5A 2RKIB 2OKQA 2NSTA 1PC5A 3K5PA 5JVHQ 4ATNA 3JYTB 1FNOA 3GG1A 1NK9A 1Q86T 3FY3A 2E44A 3C14B 4IRCA 4N8NA 1Y11A 4XPCA 1IM4A 1REVA 3OSPA 1VC6A 1L3KA 3JXOA 4KH1B 3M9OB 1T05B 2VUGA 2H51B 1G4CA 4PYAA 2FHOB 3GV5B 2LXFA 4IG3A 3M8RA 5RUBA 2IA6A 5IXUA 4M5LA 3WDOA 5BJRA 2VOOA 2KXNB 4OZNA 2LQ5A 1TUWA 2SXLA 1W2BR 4OV1A 4LF5F 1QA1A 4C7QA 3VAMA 7AT1B 2OO4A 4PXBA 3DOLB 2V2QA 4USUA 1ZM9A 4C9DA 2UVWA 3QT7A 1XMQF 2AJ0A 4QR0A 3BSNA 3Q8QB 3KJVA 2BOAA 2VPXB 4BHQA 1AB8A 4RW9B 2VOPA 2B0GA 3OTCA 1PAEX 1PJ7A 4CO1A 4EO8A 3UQSA 4WKYA 5EX3A 3I5BA 1NK8A 3J7A1 4IR9A 1LM1A 3BKUA 1NDCA 1RAJA 2CJBA 3TAMA 3H4BA 4ED5A 1CLWA 2ZVSA 2MQPA 3VSVA 1RI7A 3CCTA 4ZVRB 4CM2A 1EKSA 5DGAA 3TA1A 4AQYJ 2HW3A 1PC4A 1NNDA 3EXCX 1EARA 3BM7A 4DR5J 1OWXA 1YHQS 1P9YA 5DDOC 2QX0A 1YJVA 1QAXA 1UJ5A 2CRLA 2AU0A 1QJVA 4JI6J 1HQUA 2J6TA 2XZWA 1X9SA 4JI3J 4UF4A 4DR7J 2BE7D 2BJ3A 1W7WA 2LKZA 2ODLA 4ED4A 1JNZB 3I55S 2RHQB 1QVFR 3HO1A 2OD4A 1S0VA 3DC2A 2YKQA 2KVQE 1S1WA 2AIRB 2W25A 3MR6A 4NYZA 2NR0A 1X4GA 4YC5A 3PDNA 4MK7A 2QX3A 5CD4A 1NK4A 1RWNB 1W26A 2IM3A 3W2VB 5KFQA 5D15A 2UXCF 1IA5A 1GXUA 1VRUB 3D68A 1T03B 1HHQA 2QA4S 1WKJA 3OVSA 1SQGA 2XYHB 1RBOB 4R8UA 3ZZUA 5T7LA 2XC9A 4NLSA 4UUWA 2AJQA 2MY7A 2CVIA 4LF7F 1BHEA 1DAXA 3HSGA 4OYZA 4P2MA 4XAKA 1BE4A 4I84A 2YX4A 1OGMX 3SCKE 5HN0A 3HMJG 3Q8PB 1VQ5S 4LF6F 1QY7A 1ZAVA 1HWIA 1AUSL 1S9GA 4B9MA 3X1LB 2GO9A 2FC9A 1EJ7L 2HHPA 1C1BB 3GG0A 1AZSB 4B02A 5L38A 2ZH3A 2VQEJ 1UKUA 1H7XA 2ZD1A 5IS2A 1HHTP 3LWLA 3HFKA 2XBPA 1S4FA 2ZDOA 2MQQA 3J81U 1MWQA 3NAWA 3BJYA 2Y1JA 2QRRA 3A13A 5D0HA 4X4RA 4F3MA 1N5YB 2FQQB 3T1YJ 1N0VC 3WHIA 3AA9A 1X7VA 1VIOA 1Y0HA 2XSJA 4CO4A 4WK1A 4PUOA 3H5XA 3TNVA 1UFWA 1Q8BA 2OPPA 4LF9F 4ZJOA 2BM4A 2KRRA 1FD8A 1WI6A 2F3JA 5CXTA 1ACMB 2IC3B 3B82A 4XM3A 4XDCA 3RRGA 2AGPA 4DL4A 1WHYA 4JBCA 4P7TA 4NCBA 3DRRA 1UPMB 3FJ2A 4H4KA 2XTXA 2KT2A 4JI5J 2UUBF 5IT4A 4ANEA 1HWUA 4LSNA 4MYUA 2BSPA 4WFBQ 3MZIA 2GVZB 3A3NB 5C42B 4A8FA 4TKTA 4QIFA 3TJ8A 4QCLA 1M1HA 3PX0A 2AZ1A 5J1PA 4ZP8A 3POTA 4OX9J 2HQIA 5AXNA 1RABB 1C0TB 2H4WB 4NL5A 1K73T 3T6BA 1XERA 1U0SA 2CJAA 1JLCA 1DQAA 2V94A 4KYZA 4RWXA 3S01A 1U0HB 3IR5B 1N4LA 4F4AA 2OH2A 1FRMA 4Q8EA 3DOKB 4FYWB 4DL2A 2YNIB 1NCLA 3A8EA 4CO0A 1Q82T 3SZ2A 4AD6A 4WFNQ 2WVBA 3CE8A 3PYFA 1EKRA 3Q2SC 5KFCA 4GC7A 3CW2C 2H48B 3NB2A 3AFGA 4ZN3A 5AXMA 4DG1A 2N7YA 4DSFA 2BM6A 3EDRB 3NBPB 4OJLA 1TL1B 2RS2A 5F8MA 2FJXA 1VQMS 2RE1A 2ABYA 1TV6A 1WF0A 2VD3A 3P8BB 4RW8B 4ZVQB 3HKWA 4JI8F 5AT1B 3SSRA 2GGPB 3P5BP 4X62F 4YR2A 2UU9F 4RW9A 2NPFA 2HHHF 2BACA 1GQEA 1LWEB 2FHKA 1F60B 2V4JA 3T5JA 3VAJA 2YNIA 1NJYA 3FFIB 2BJ9A 2UZAA 4LQ9A 3ML3A 4UY8T 3L7PA 3IRXB 4DR6J 4IUFA 3AH6A 4DQPA 4YFUA 2NZ4A 4JI3F 2Q3PA 1T9UA 3ISZA 2ZZNA 2CG8A 4XLEA 4PWUA 3T1YF 2J7UA 2WONA 2QMXA 5IM0A 4WU2A 2X6WA 2XZDB 4KGXB 1JTAA 1E6YA 3OR2A 4M94A 1RCOB 4CO5A 4QZVB 2VHGA 3QIPA 2VL1A 2Z58B 5IOLA 1A9NB 2BJ7A 1EB0A 2CWXA 5HI7A 1BLUA 2MQ8A 4LRAA 2BW2A 4P2XA 1MWYA 2MKIA 1GX6A 2VBWA 1VCTA 1SH0A 5D0RA 4AL5A 3TUZC 1CLFA 3N6NA 4PXDA 3GZ7A 2XY5A 3HJFA 2LXIA 2KM8C 2DVIA 9RUBA 2WBRA 2FHJD 1RDRA 3TA0A 2G2OA 2IRXA 2BE2A 3G2XA 1VRTB 2BV3A 2DR9A 4B3MF 1AFIA 3SSQA 7FDRA 1RU4A 4YN3B 1BY9A 1LWFB 1XR7A 2QMUB 4RW6A 1IQZA 2CYYA 2ADCA 3H0PA 1X4EA 2Z0GA 1ZM3A 5H1SV 3TARA 1D9FA 1N33F 1AROP 3DKDA 4X4SA 4CTAB 3GSDA 1Q7YT 4PYDA 1SJ4P 4P2SA 3CJ2A 3HJVA 4P75A 4CQ1A 2F7VA 1KLMA 3C19A 2IBOA 3V6KA 2AT1B 3BGOP 1YITS 2VQFF 1EE6A 4G6VB 3M2VB 1OY8A 4A8MP 3U1LA 3EUNA 1QQ1A 2FD2A 4NLPA 1JLAB 2K1RA 4USWA 4ZPBA 1B7FA 4OX7A 3HVRA 3C15B 1NZAA 3KDOA 4OLOA 1QAIA 3DM2B 3L9ZA 2HHHJ 4NYOA 4RUCA 4J90A 1DBGA 3ZTRA 2UV8G 3PIOQ 4DV0J 3GQCA 1OQ6A 1S7IA 2IA0A 3CCJS 1DZ5A 1IJFB 3U7JA 1L5UA 4UOFA 3O5TB 1Q95G 2ZH2A 3T6JA 3QWUA 5JXSA 1I94J 5FJ4A 1NHCA 3MURP 2ALZA 1DARA 2G0CA 2J7WA 3DMJB 4OJHA 2ZHBA 2G2YA 2OI2A 3KG1A 1VFJA 5HQLA 4DR2J 1YJ9S 1N36F 1VLOA 3PVXA 3CC4S 3IWNC 1TTHB 5GVQA 3KJVB 1ZTTA 3W5ZA 1FJGJ 2CNNB 1RTZA 3ADAC 1RE1B 2DCLA 3I82A 1NLKL 2Y8WA 4ZITA 4DPTA 3DRSA 3PR4A 1GMWD 3HD2A 1HI0P 3BS9A 4ZPWR 4CLPA 2R7VA 1G3OA 3ISNC 1WDDA 1XIQA 2B5JB 2AX1A 3LP0A 2GHVC 5KG6A 2PT0A 3TUIC 4L74A 4DN0A 4IOCQ 3HSDA 1HQEB 4Q2LA 2YY3A 4B3TJ 2XHCA 1RAFB 3VVUA 2VFOA 1QDUB 3OL9A 1G1XA 1XBWA 3ICLA 2PMZD 3TR5A 4N47A 4PQUB 2NT6A 1A7GE 1SQEA 1IN0A 3MECA 3Q89A 1J5OB 2IDEA 3VAKA 2MKHA 2DPIA 1RT5B 4G1QB 1FXRA 4YEAA 4IYQA 3BGLA 4TVAB 3RAQA 4LJMA 1UVMA 1SKSA 2VBYA 5IC4B 2M52A 3KG0A 3FBBA 4OJ5A 3HULA 3SCLE 3NRBA 1LWCA 2U2FA 2XTYA 2BUNA 3G71S 1IKXB 3DI6B 2IFXA 2C3UA 2GIFA 4L3NA 1DABA 3A1YG 2V5IA 4Z06A 2E29A 3QGHA 1YBTA 4EUVA 1HHSA 2FUG9 3DRSB 3BYRA 3GIRA 2GJFA 2VBXA 4AL7A 2J6UA 3V81B 4F02A 2R7XA 2DGSA 4O3QA 1NK0A 4MKYA 4TLRA 5LL6d 2ZNZA 4O3RA 1E6YB 3OR2B 3J81j 4DR1J 1FEHA 3M05A 3PNIA 2PECA 1C4CA 3HHLA 3KHHA 3HHDA 3EVOA 2QSFA 1EAYC 4FXVA 3R7NB 4NLDA 2F8MA 3MM7A 4E2FB 4UZCA 1TYWA 1VMBA 5DG7A 1RADB 4N8OA 4NCAA 1VOMA 2MKCA 1PG5B 2FJWA 3KJQB 2UUAJ 3LP1A 3HHKA 4AE5A 1XNQF 2D1CA 1DLOB 1PLUA 1NU4A 2DITA 2V63A 3CD7A 4F25A 2F1FA 3UCZP 4I2PB 4DCPB 1VQLS 3J7ZT 1LW2B 2XY6A 4X4VA 1SH3A 4ILRA 4YB1P 3KOAA 2QL7B 4FKXA 4CO3A 2J9DE 5A2QU 2DGXA 4C8MA 2DNQA 4IG0B 3OTEA 1WACA 4XQFA 1U09A 1RTJB 3PZPA 1HNZF 4JI6F 4ZVFA 1H2TZ 3FQLA 3C6UA 3ONQA 2LU1A 2YPYA 2ZHAA 5A8KB 1HLWA 4HDHA 3JQJA 4MFBA 1U1OA 1HBOB 2ZH1A 4F4XA 4WP9A 3QJJA 2U1AA 4IFYA 5IQ6A 3BO2A 1KRPA 4H54A 2VA2A 4ZJQA 3CGIA 4ED6A 4YEJA 2FYXA 1RWKB 2HIQA 3MM9B 1U48A 2G4BA 4PXEA 7FD1A 1VBXA 1TKTA 1RHRB 5K8NA 3ENQA 4V1Ak 2V67A 3RBXA 2CPFA 4TQSA 1UA0A 2EW9A 2OPRA 4RO0A 3RTVA 1QRCA 4IRKA 1K5CA 4NRTA 1CJKB 3V6JA 2XMMA 3LPEA 1NB2A 4LSLA 3MPUB 3PJWA 5FD1A 2ZBRA 3SV3A 4AL6A 3PW2A 4N76A 3FGVA 4U7CA 3W63A 2QLFB 1JLEA 4ZPVR 1S9GB 3OV7A 1WF2A 3VHQA 5H9FK 4PG4A 2UP1A 3R6GB 1O8EA 4KPYA 2DH9A 2ZWPA 2D3UA 2R3VA 4CIOA 1KTQA 5KG7A 2XGQA 3Q22A 3BGFA 2AYGA 4O3NA 2FVSA 2W2QP 1Y5NB 4K5RA 5I42B 3AK5A 1WMRA 4USVA 2R8GA 4YZAA 1ZPWX 2RVJA 3CCES 2C22A 1YKWA 5C25B 3KLVA 3G6YA 2ZBQA 4ITSA 5KFLA 1YGYA 2DR7A 4JI2F 1FDAA 1TR0A 5ETQA 4OZYA 4LSLB 2GMHA 3BDEA 3KLIB 5DM6Q 3B90A 1B70B 2GO8A 3BBCA 3AY0A 5H9EK 1QRBA 2W8LA 1U1QA 1RT5A 4ES1A 4F2RA 4J9NA 1IVZA 3A3OB 1F3VA 2DJWA 2EFGA 3HCXA 1WC0A 4XORA 1XJWB 1TYUA 1NSPA 1NDPA 1OY6A 1T9TA 3T19A 4WFYA 1EETA 5C24A 3OHBA 4AVZA 3QFHA 3JSRA 2PGCA 3OL7A 2JC0A 2GAGC 3IBWA 1NHKL 2AW0A 2WSCC 3H09A 4LSZB 4ZPCA 1S6QB 1KLNA 5KT7A 4RW7A 3Q8VA 2E5GA 4LBHA 5IC6B 2R2TA 1JNRB 1UEUA 5ITHA 3H2UB 1QVGR 2PDAA 4F4YA 4L3KA 2O1DA 3NNAA 4U6PA 2HBZB 4XO0A 3G8TA 1S1TA 4HR2A 2OSQA 5MAOA 4K0KJ 2C3YA 2HIYA 2VG5A 4OI6A 3M9MB 4B3SJ 3GYGA 2JNJA 4FS1A 1YRXA 2HQDA 3V6HA 4OZJA 5GAHU 3MM6B 3JSMA 2XS2A 1U7LA 2MKYA 3F73A 1EQMA 1S10A 2INVA 2EC0A 2XMAA 3MCSA 3HT0A 2VODA 4P6QA 1HNXJ 5ETOA 2YQ0A 1LK5A 4CLYA 3OTDA 1I3OB 3W65A 2KG0A 1VR6A 5ETKA 2KU7A 4ZCLA 1VQ9S 1R6VA 4LFAJ 3OLAA 1RWUA 2WTFA 4ZHRA 3ZXWA 5LMUF 1U1LA 2NUUG 3D0IE 1D8YA 5FIIA 3LAMA 4JI5F 4CLKA 3R9LA 3VVTA 5HLFA 1VQYA 2LFVA 4ED3A 1CULB 1V5IB 1G6BA 4X4OA 2FJBB 2H9ZA 1RSCA 2LEAA 3IG1A 4NEZA 4OZ2A 2ZHOA 4ID5A 1F5AA 1FX2A 2IJNA 3GJSB 3G86A 4EU0A 2DEIA 4YDDB 2O0VA 1CG2A 4DV1J 2MJNA 3OUYB 1M5PC 3AHPA 4JV5F 3HVWA 1H98A 1S1VB 2UUTA 4Z7YA 4CLZA 1HBOA 2OUGA 4HHUA 1S72S 3THPA 1QLNA 2WCXA 3PFEA 4EO6A 2HK3A 1R8HA 2L08A 5D78A 1IBLF 4O4GB 2BDPA 1R8AA 2UXBJ 3VMVA 4H4OB 4KGMA 1Q4RA 3SDEA 1ZYQA 3JAMU 4YHHJ 3KMQA 2DNRA 1KONA 2CQ4A 4XOTA 2CPJA 4C8OA 3QRPA 3PYEA 3GCXP 5CD4H 2L9WA 4K4TA 2JLEA 4WYLA 4CNZA 4ENOA 2J6SA 1ZM4A 4XIUA 1PCAA 2W4DA 1H73A 5DQHA 3IO1A 4ID5B 1EP4B 5GAEI 2AMCB 3NMAA 2XC1A 1U2CA 5H9EJ 1WOPA 3BZQA 3OT9A 4WFXA 5GADU 1B4SA 2WSEC 1RBAA 2HRTA 2DGQA 1YSJA 3RIQA 3CTRA 4P9SA 4AXIA 2OGUA 1N5YA 3CCMS 1TVRA 4K4YA 1SQFA 1U2RA 1JLQA 4JRAC 5ADZA 4Y00A 2LDYA 3QGIA 1JB0C 1HW8A 1R8BA 2OHDA 5K20B 5HMZA 2VBKA 1B0TA 1VYAA 1MG7A 4BCAA 1SUQB 4YZXA 1KHWA 2K7JA 3MMJA 2EBGA 1F3FA 1EHWA 2XTJP 4W8SA 5HANA 5DETA 5L1JA 2XLKA 2BQUA 3VZHA 4BS2A 3CD0A 5EGYA 4YQWA 2XLIA 5HATA 4NA1A 1YI2S 2F65A 3FVYA 3NGTA 2D3OR 2RU3A 3Q24A 3PRBA 1AT1B 3PW5A 2BVZA 1IDJA 2B51A 1PYTA 3VQSA 3FSYA 4KB7A 3OR1A 1RKJA 1KVIA 1RLCL 1H2VZ 2F9JA 4KV8B 1S48A 2VONA 5AE3A 3FZ2A 4M5JA 2NSCA 1VS3A 2OPQA 1YVFA 4B9SA 4ZVSB 3OFFA 4NLXA 5DDQC 3IP0A 3GR0A 3BBFA 4U8YA 1RGVA 3BH7B 3IR6B 5HJXA 2IVMA 3D1QA 1T9VA 4URRA 4H4MB 3VF0B 2M4MA 3NAIA 2BW7A 3AT1B 3TEHB 3BYPA 1KOOA 5C2CA 4PWDA 1TL5A 4MKVA 2PIIA 3P96A 3S8SA 3SMZA 2MQOA 1RUSA 4ECRA 3CDUA 4C4WA 1YLXA 2IAJB 1S9EA 2G9OA 4U4BA 4DQRA 3DLHA 1KN6A 4TU8A 3JYTA 4NXNF 4YY3J 4C11B 4N77A 2B8PA 3OXFA 5KFUA 4NXMF 4YP3A 3H42A 3GJRB 1Q79A 4C97A 2OSRA 1U24A 3LQVA 4DV2J 1VQ8S 2QXZA 2EI5A 1NM2A 4XN3A 1PJ5A 3PJ9A 5IWAJ 3IBFB 5EWEA 4EGLA 4ZLNA 1HA1A 2RAQA 4Y6IA 1U6FA 3H98A 3SFUA 4DMZA 1Q16B 2B6AA 5KOXA 3PM9A 4Q44A 3VALA 2FDNA 4L6V3 2YNGB 2HHUA 4DV5J 3TA2A 2ZH6A 2RQMA 1R89A 1RT6B 2A10A 2C2RA 2VFRA 5HROA 1WHWA 3AODA 3MTJA 5THWA 1QAYA 4QBUA 4ZCIA 1T9YA 4FPRA 3HXMA 2J9EA 2B7BB 1NJXA 2O3DA 1RJJA 2RHSB 3JTPA 4ZVHA 3TZZA 1QJHA 3M8ZA 4FF3A 2XO7A 4LFCF 3UW1A 2OMLA 2VF3A 2HEKA 3JSMB 1GXTA 4I67A 1P1TA 2CJYB 2DBBA 8RUCA 1FERA 1UPPA 1S1XB 2J0XA 3CO9A 2HQFA 3EQOA 5J1NA 4X4UA 4J5OA 3IS9B 3JSBA 2BE2B 1KBRA 2QLWA 4YB5A 2IVFB 4HYKA 1TKZB 1KQSR 3IGVA 4RW8A 4U7UD 4UQTA 1JKHB 3HVTA 2XO6A 1M1KT 1X4HA 2P5VA 2BKPA 4DG1B 4X4QA 2ZM6J 3DLEA 3FEXB 2E5IA 3L4BC 4WFAQ 1TAQA 4TU7A 2DNHA 3GRHA 3DRPA 2FB0A 1C0UB 3TW0A 3W61A 2DGWA 3HZGA 3PSZA 2GC8A 3LTOA 4J91A 3WX4A 2XB2D 2W8KA 2XCPA 4YFOA 2QY1A 3LF0A 1C4AA 3AXMA 4NMLA 1TYVA 3BGUA 4LREA 3X3UA 2MZRA 2O04A 2MMYA 2YNHA 2CVEA 1WELA 4EBDA 3ITHA 2J9DA 4DUZJ 4ER8A 3FNNA 1D9AA 2HAFA 1DQ9A 4M95A 1I1GA 3BR8A 3IRXA 3L95X 3MAAB 4ZVOB 4X4NA 3K0JA 3RJMB 2V9WA 2HFOA 1D8ZA 4KH0B 3MUTP 4PCQA 3W3SA 5IV3A 4A8SA 2WONB 2ZE2A 2JJ4D 4ZVGA 2GHWA 2YXLA 4IDKA 3UFCX 2XS5A 2IC3A 5I3PA 1RAHB 4TY8A 3PY8A 5LT5A 3HPOA 2YPZA 2YVSA 5KT3A 2ZOGA 4YDXA 4GRSA 5F8GA 2YH1A 3QJLA 3HX9A 3M7VA 1FI4A 2IPOB 2RSQA 2V8PA 4WPAA 1TFYA 2Y8YA 1LXNA 1FD2A 4W4MA 2OPSB 3UN5A 5I3QA 4ILMA 4QR1A 2HMIB 3FZBA 1HPZA 3GSIA 4IH5A 4KGVB 3BKTA 4O4RA 2DH7A 2PA3A 1D09B 4Y28C 5DZ6A 3POTB 4G1QA 1LK7A 2DEJA 4OYBA 5KFAA 4JV1A 2YKOA 2OTJS 2XI3A 2R4FA 2RF2A 2VJIA 4A4JA 1UFLA 4FYDA 2PA8D 4TXSA 3L7OA 1HWLA 2CQ2A 3DOKA 1YBUA 4FXDA 4WP8A 3UCUP 3DRRB 1NJIT 3KWMA 5U47A 1FRJA 3S7RA 2JEFA 3IG1B 2ZITA 4L75A 2I1RA 1SB6A 5C7PA 1XC9A 3CNQP 1MROA 3ETMA 4KQZA 4Y34A 4ZIVA 3ZZYA 4ZJLA 3F56A 3C6TB 3MMBA 4IOBA 1C0TA 3NCPA 3O44A 4ZPDA 5KTQA 3PW0A 2HS0A 5C24B 2VJUA 1S6QA 3FBFA 3L3CA 5LXRA 3CCLS 2FZGB 2DXFA 1QA2A 1H72C 1NPPA 2B4UA 2RH3A 2M5YA 3HHLB 4XPEA 2OP5A 3KK2A 2E5LJ 5KFFA 4ELUA 2XMVA 4N56A 1F9HA 4RW4B 4EW9A 5L1IA 1UZHA 3CC2S 4HH0A 3DGPA 4UTGA 2ZOFA 4KGZB 1DTQA 2ZKTA 3PHTA 4XTTA 1KTWA 1OGOX 3QRQA 3I5AA 3C66A 1U1NA 2B4VA 4QJVA 2NXNA 3SY2A 2CAJA 2KT5A 4A8YA 5GMKa 2VH7A 2QLJB 3DXBA 3CJRA 3FEYB 2AHOB 3T9GA 1YTYA 4RNFA 1PSDA 4HKQA 1LKZA 1UEVA 2HSEB 3TJAA 4QU7A 1NKBA 3RW7A 2J8KA 5SUHA 3CDEA 5DQGA 3TANA 1UVKA 4RW4A 1AZSA 1BQXA 2HBYB 3A8KA 3HVTB 4JP8A 4B9NA 1B7YB 2FIUA 3QFWA 4QW9A 1DTQB 1IXKA 2EG2A 5HBMB 3I4PA 5I4MA 1TMMA 4E98A 5CA5A 4WJBA 2EK1A 2YKAA 3ISND 4F4ZA 1RHQB 1KTVA 4K0KF 1JK9B 3BKFA 4ED7A 3ELHA 1N48A 5EX0A 4ZN1A 3M8PA 5C2GA 4U95A 4OL8A 3U1NA 5B09A 4IR1A 4ZP9A 3G6XA 4DJBA 2W24A 1FRIA 2GW8A 4K2XA 4OJPA 3AJ1A 3MMAA 1FDNA 3N28A 2VFNA 3D6TB 3Q23A 4NI2B 1Q7LB 1REGX 4UUXA 5KG4A 3O8WA 2K8GA 2D3ZA 1VBLA 4BC7A 1R8PA 4DUYF 2V68A 2OTLS 2HVEA 4DV0F 4DR7F 2FLNA 1UWBB 2M0GB 1IB4A 4UT4A 2GFFA 2O5DA 4NLUA 3UPFA 4Q43A 3IRWP 3ILLA 1XTZA 2B9YA 2LXUA 4DDFA 2V2ZA 5EN1A 2KH9A 2IBKA 2VIHA 3HP6A 2JFKA 4KR0B 2HMIA 2EVZA 5C5JA 2YKNA 4ZS6A 2MHNA 4O3PA 2PEBA 4FN5A 3VGVA 3VAIA 2E9ZA 1CQMA 1FNXH 2QJ3A 2MB0B 3QAUA 3R5AA 4LFAF 4A8KA 3EICA 2D7SA 2PMHA 4HL9A 1FE4A 4WIIA 5IT0A 2YNFB 3I0SA 3PRVA 5K14B 2W9CB 2Q1LA 5AE2A 2B4PA 5LSLA 2R2RA 3GQ7A 1RT7A 4X4TA 4DV1F 1RTJA 2ZOMA 1WHXA 1TQLA 5FDLB 1YRUA 1VI7A 2CPHA 1K1QA 1J2VA 2IM1A 3CCZA 3DRYA 4R0EA 4WK3A 2HGMA 2ZC4A 1NJWA 1IKVB 1B0VA 4ID8A 2RQKA 3BV8A 4DX8H 2DGVA 2RKIA 3LALA 1IBLJ 4DR4J 1SKUB 3D67A 1XMOF 4IG3B 4OFZA 3AQPA 2IIHA 3MD1A 3THTA 2B43A 2RDJA 4KHPF 1UP1A 4L73A 3T3FA 2FGCA 2JH3A 2OPQB 2LQJA 2BKNA 2WOMB 2VA3A 1EZZB 2BRLA 3MPDA 3TZXA 3GJTB 1OMSA 2HFUA 3D1OA 1EX8A 2XSFA 1PE9A 3FQKA 1RT7B 3VGSA 3WX8A 4RNNA 3PX6A 2KZZA 3BO4A 2FLLA 3TEGA 4ZKAA 3BREA 5LOQA 3N90A 2LYVA 3UDLA 2F3LA 1QTNB 2EFNA 3DLBA 1MU2A 3AJDA 4DFPA 1QE1B 5CYQB 3T1HF 1K44A 1O8LA 2RDDA 5KFOA 1R7IA 3AJ2A 3CT9A 3GFXA 3EPGA 4E8UA 1X5PA 4XKVA 4DV7F 2EG1A 5KFHA 5EWGA 3RB0A 4RU2A 4USMA 1SIWB 1UVIA 3P45B 3NG8A 2XGPA 3K5NA 3KNAA 5KFEA 2AF6A 4USHA 1CULA 5KFVA 2LA4A 2E9TA 2EKYA 4PG6A 2RUSA 3RAMA 2RRAA 4DBQA 3OUYA 1HBUA 2A0FB 1FKOA 1FX4A 3I4HX 4WFZA 4LFBJ 4FP9A 2VDHA 3RRKA 3PTWA 2WB1D 1S57A 1ZAWA 3GMGA 1M90T 4OX6A 1LXJA 1KSPA 2CQ0A 4K4VA 4Z05A 3CB4A 2WVCA 1B0PA 1MNEA 1KOHA 2XQCA 2HHXA 3MUMP 2M8HA 2B6AB 1FWKA 4U9RA 4Q5VA 3H5SA 1N34J 3GU0A 2DNPA 2UXDJ 3PIPQ 2BJ1A 1WG1A 1GAOA 3U27A 1UA1A 3DN9A 2FJVA 4HT7A 2W9BA 3NS6A 1DFDA 3CMQA 3IWXA 4TYAA 4KGKA 1NHUA 1V5VA 2WBMA 4KIAA 1BWVA 4CT8A 3VWSA 4F3QA 5HVHA 2VG5B 2VC1A 4F3OA 1NBEB 1J5EF 3DDNA 4U49A 3VGTA 1FJ7A 3MMAB 3EGZA 4DPWA 3BGRB 1HKAA 4NLTA 4ZPAA 2RIJA 1PIEA 3MPVA 2HYIB 3NNHA 4DU7A 4XMYA 1KVKA 4JV2A 1YG0A 3R27A 1U45A 1OYEA 4TLQA 3SFGA 2IVYA 3DGVA 2Z2LA 1F5BA 3AQOA 5DG8A 3M6VA 2Z8GA 1F1BB 1GT8A 3NCRA 1HL6A 4DL6A 3DLKB 2XWYA 1R0AA 1SV5B 4OZZA 2XHWA 3GQ9A 4C2MA 3SUCA 1O8JA 3TVKA 1BQNA 3IMQJ 3AA8A 2DNZA 1LFPA 2QYCA 4GC6A 3GV8B 2GIQA 4LRDA 5FLXU 4QPTA 3IS9A 4RUHA 1HNWJ 3I87A 4ZLLA 3N6MA 1RT2B 2CQBA 5E2QA 1RKIA 3MR5A 2E9RX 1FFWB 2QFJA 2R7TA 1X4BA 2AWZA 2W9AA 3OW2R 1R6YA 2CQ3A 3GQAA 1S1UA 4XLHA 2E66A 2JVOA 4DQSA 4EI2A 3W60A 1OPIA 1FRLA 5EDWA 2AD9A 2M88A 3DYAB 2V69A 3PEHA 3IBCB 3NY0A 2VFMA 3DLLQ 3TP2A 3JQKA 2HWHA 4NPOA 2KJVA 3DXSX 3LWMA 5F8LA 2VFSA 4WXOA 3RBEA 1B3TA 3T9NA 5KFDA 3B4NA 4ZVEA 2MPUA 5KFIA 1S4EA 1ZOTA 4C48A 1R27B 3DGPB 3FBEA 4OHWA 4RZRA 3LP2B 1KLMB 5T41A 2NSBA 8AT1B 3QGGA 4OJ3A 5ETMA 4K4SA 3GTYX 2JX2A 1P9QC 1J27A 2G0YA 1PGZA 3KLHA 2KG1A 3NAHA 5F0WA 2HNDB 2R2SA 4GKKF 4HVZA 2M70A 3AXKA 3HSZA 1K1SA 2DT9A 1RT2A 1TAUA 1YK9A 1O8HA 4C8ZA 1QD1A 1XMOJ 4W8QA 2V4RA 4NXNJ 4OYAA 5J2NB 4N5SA 4DSKA 2IDLA 2EXUA 5J2QB 1I6JA 2OLWA 3QT5A 4KKOA 1U26A 3NBPA 2INUA 3UD4P 1Y5IB 1KWMA 4ERDA 3CMAS 2GVDA 4NLGA 1UVLA 3KK3A 4LMZA 1N8RT 5KFWA 4Q0BB 3TAPA 4NX9A 1O8BA 1J5EJ 2RF2B 1FDBA 4EZ6A 1Y5LB 3K17A 4B9TA 2H65B 3CWJA 2V4JB 1NHVA 2CNLB 4IQMA 1IBKF 1OSCA 3MEDB 4RWWA 3PETA 2R7OA 3DOMA 2PMWA 2KXHA 4USJC 4DN9A 1RHJB 4NA2A 3J7YI 3VAGA 2PC6A 3LOUA 2NLWA 3NGKA 2CQPA 2G1DA 4PPDA 3UW0A 1TK8A 3J7AN 3BQ0A 4AT1B 2BANB 2DD8S 3MM5A 2AX0A 4XLCA 3D7SB 3OFHA 1NH8A 3R6LB 1WG4A 4HACA 4I69A 4QIEA 5IT9U 3EDQB 1RA6A 1T02A 3R97A 4ZHRB 2MSTA 3KHLA 3O6QA 4Z37A 2DRBA 2R8IA 1H7WA 4DR6F 4X64F 5HLFB 4KE5A 2MTLA 2NQPA 4I4BA 3UI3A 4C8YA 4W90B 5LMUJ 1FJEB 3KK3B 4FBTA 1N5TA 2JRSA 1X5SA 2UVEA 2Z4PA 4CH7A 3FRYA 3HZEA 4YB7A 4V19J 2P9EA 3DLEB 1JJ4A 2X6YA 2HGNA 5K8PA 2H3EB 1NO8A 2YWWA 5IV4A 1RXOB 3H40A 2ASDA 1JLBA 4Y2KA 1T0TV 3CJKB 1UJ4A 1KC8T 1KQFB 2DHGA 2MZSA 1X60A 3KLEA 1IKYA 1UW4A 3B54A 1S6PB 4ANCA 3ILIA 3H4DA 3TAQA 4G3IA 3W9IA 3G96A 1M0SA 2B3TB 5DLFA 1U4BA 3FCWA 3MEGB 2V2KA 3JURA 2FJDB 3L7UA 4I2PA 3W62A 4B3MJ 3M6UA 4NA3A 4DPOA 4LF8F 4B3OB 4YR0A 1APSA 2CFXA 3W2VA 2XMJA 4H4OA 4KT0C 3SDEB 1FJGF 3PV8A 2BEFA 1M5SA 4FZVA 5B08A 1UVJA 2WB4A 1RAOA 3G8QA 3JS9A 4I6AA 4OYOA 3NGDA 2P2CB 2W4CA 1OOCA 1YJ7A 2UUCJ 5E0OA 4O3SA 3TUJC 4F4WA 3KXDA 3NWGA 1JLBB 2HQ3A 2C3PA 3CJKA 4UQGA 3MMCB 1D9DA 4KTQA 4B9UA 1HNVB 1G7CB 2DNOA 3ENVA 3M2UA 1WWHA 3OPKA 3PEJA 3SQGB 3CC7S 2F63A 3JSYA 1ITPA 1OFMA 3EQNA 5KFXA 2QL5B 2YBVA 3QATA 2MGZA 3NXZA 4LR9A 4LVOP 1NH7A 1FVQA 2ZD1B 1JLQB 2XY7A 3V6DB 4OYIA 3ZZTA 3ZTSA 5T7LB 3T1AA 1FHTA 4B3RJ 5B0EA 4PXCA 4FF1A 4I0WA 3RW6A 4CWBA 1YIJS 1FO1A 2PO4A 5B0CA 3DMJA 4TN2A 3UR0A 1Y7PA 3VAHA 1HYSA 3JQMA 4Y2CA 1GH8A 1WC3A 1AUDA 1MMLA 4ICLB 2JEGA 4J9MA 1Z2LA 3WC2A 3KK1B 1FKPB 1WSRA 2RRBA 2LEPA 4A47A 4B3TF 1TSPA 2VFUA 2B0RA 4GO7X 1D0EA 2HNYA 4J9KA 3D4JA 4Q7AA 4K50A 4DQIA 1Q8IA 4FNIA 2NPIA 3HLUA 1OIAA 1OQ3A 5BR8J 1TL4A 3MPWA 1S9EB 1RA7A 4DI6A 1ULRA 2YQ1A 4R0JA 3IA0A 4F0KA 5GAEU 5C1CA 3C8YA 1M5KC 3FMWA 1KR4A 1XMBA 2UUBJ 4KHRA 1UTAA 3FK4A 3M1VA 4LR7A 4MK9A 3AAWB 3UDVA 3SI8A 2NTQA 1SIZA 4PWDB 5D8HB 3MEEB 5F9NA 3MM8B 1DURA 1UFKA 2NUHA 2W2PP 3KUHA 3TI0A 1HR0J 4I68A 1RTHA 4ZCMA 2HK2A 3H8YA 3GYXB 3U1MA 4UOGA 3PR5B 1JLGA 3QBCA 3LJYA 4C3MA 2RB7A 4Y2MA 5I3UB 2J0WA 3D0HE 4J9VA 4MIAA 5H9FJ 4LF7J 3CJ8A 3I9ZA 5DZ7A 3FUYA 5GADI 4MJKA 5KT6A 4K4XA 1BMQB 1FWLA 5A6WA 4DCOB 1N6QB 1T8EA 4FF4A 2W7PA 3MDFA 2WW4A 4DUYJ 2HHQA 3K58A 1H74A 4LQ3A 3QIDA 5DRKA 2HFVA 4OM9A 5JMNA 4CYUA 4UOCA 2CQDA 1Q5YA 3T1HJ 4WZMA 1Q0NA 1BQMA 1O8KA 5KFKA 1O8IA 3GFYA 1DLOA 2OEKA 3EWGA 3Q8RB 1U6ZA 3GFZA 4QWBA 4A8XA 3TUPA 4LF2A 1ICEB 1X8DA 3FFIA 1N33J 3JX8A 1QE1A 3I6PA 2BZ2A 2QZ8A 4NLRA 5CYQA 1OYDA 3SYZA 4QWAA 1KFDA 5J2MA 3P49B 1IUJA 3LAKA 4RBTA 1HBUB 2QA1A 3CEDA 1Q53A 1S1TB 1T11A 2J8AA 1OFEA 2QO3A 3OXGA 4MKAA 1VJQA 1VQSA 2AJFE 1S7HA 2P8IA 2D9PA 2GGPA 2V34A 4K4UA 1RT3B 1VQOS 2I9SA 1IDKA 4K4WA 1SUQA 2XZTB 2DR8A 2F5GA 1RT1A 2CWKA 4RR5A 3UD3P 3HSJA 4ED8A 2ZUGA 1CEZA 4XK8C 1MROB 2XTWA 2LA6A 4TQRA 1FXLA 5B0GA 2N3OA 4LF9J 2E5HA 4OMFG 2PI5A 4W98A 4URSA 1C0UA 3R7SB 3CJTA 3C6TA 3MMBB 3SBMA 2ZH9A 4M5KA 4LRFA 4DZ6A 2D74B 4ECWA 4MFBB 4P72A 3GILA 3OVBA 4B3OA 3MCOA 2MKSA 3D5MA 4K8RA 2YWGA 4FXWA 5IM0B 3ILJA 3CDAA 4NLYA 4XDDA 5HJYA 1LV5A 4JI1J 5E33A 1G2EA 4KC5A 3PW4A 1S0OA 3NEKA 3W5YA 2AGOA 2FLPA 1EZGA 1K8FA 4C8KA 5D3GA 1FEEA 1WORA 4X62J 2K7KA 4OX8A 3VCDA 5LMNJ 1PYOB 1HIYA 1CS4B 2GCFA 5A8WB 2QYUA 4YZQA 1AXQA 2A2DA 5BR8F 1JXLA 1HR0F 4B3SF 2LECA 2YKNB 3NS5A 2KO1A 2KYXA 4Q45A 2O1PA 2B8QA 4OI3A 3IXQA 2W9CA 1RB0A 4BLGA 4WKRA 2VG6B 3BBBA 1VC5A 4ZVUB 1RT1B 2IHR1 1RTIB 2I8EA 4HH1A 1FRKA 1N88A 1T94A 2Y3YA 2YWFA 1HNXF 2WVFA 4LSNB 1N32F 2FLOA 4ICLA 2GMJA 3QT6A 2VBEA 3WBZA 2MZTA 1XMQJ 4USKA 1P8GA 4NLQA 1X0CA 1LWXA 2YUHA 2AKWB 3M30A 3N01A 1PO6A 1CPZA 3OJUA 1WD6A 3T9ZA 3MEDA 2AGQA 2EWHA 5A6PA 1ZBTA 2FZKB 3BPSP 3BSCA 2V8GA 4IO1A 1JJ2R 4LFBF 2HBQB 4BBYA 1NEEA 4G1PA 3KUGA 3MAQA 4LF4F 2VFVA 5CCLA 4ANDA 5KFJA 2CDQA 3R3TA 5F9LA 1RWPB 4DR3J 3KG4A 4LF5J 1TKXB 1JLCB 2AYMA 2JZ5A 2WSFC 1UWAA 1IR0A 2GX8A 3TVYA 3UO0A 1MMNA 3PX4A 3NOGA 4NCGA 4WP3A 5E7OB 1EETB 2W01A 4BDPA 3J7YU 2FJEB 2JDJA 3TH0A 2Z57B 5F3ZA 4C0HA 1IBCB 5HVGA 2UUCF 2DIUA 4NI2A 1TUVA 4ZK7M 5HO4A 4KH3A 3HM9A 1XQIA 4W8RA 4NE9C 5GAGI 2ERRA 1YJUA 1MSWD 2I5JA 1D3WA 4OYMA 4DHVA 4DZDA 3MR3A 4KRWA 2C3OA 3ENWA 5D0EA 5DJBA 4F8RA 1KCCA 2RMLA 4ECZA 2G0IA 2JVRA 2PE8A 4S0MA 5J2NA 3J80U 1CJUA 5J2PB 4ZP6A 4QYZK 1PAUB 2HAIA 2VJVA 1TKZA 1RP5A 2V6AA 5DS7A 3T5HA 2W7ZA 1BWEA 2L48A 5LJ5Y 3I56S 4CH1A 4ECTA 2DHHA 1HW9A 2YKMB 1JJHA 4MIBA 3N6ZA 3DLJA 4P2FA 2MQLA 3CJ4A 2BMBA 3KTQA 1N32J 4ILLA 5CAAA 4DV3F 1CZFA 3GJQB 2MQNA 4P74A 4LVNP 2MY8A 3NCQA 1T3OA 2W9BB 1IQTA 2ACMA 2ZEJA 4IOAQ 4MXNA 2CNKB 3R2DJ 2A1BA 4Z03A 2E7WA 2L3MA 2YWEA 2M3DA 3QLHA 5CZVA 4GKJJ 2KTQA 4HTIA 1PXZA 3CMES 1RAGB 2CZ4A 2BX6A 3PRDA 3LGHA 4FYYB 4LF1A 2EBEA 4DV4J 3PHEA 4YR3A 2Q6CA 1C1CB 1XG2A 2RS8A 4CM0A 2M8DB 4U67Q 3DCAA 3GR1A 3K5OA 4WTYA 1NMEB 2MEWA 5ETLA 3DU1X 4L76A 2BANA 3MM5B 1U2FA 3I0RA 5ETSA 5G0RB 3DLKA 1AA1B 1R0AB 3F44A 2VV5A 1S0MA 2OFGX 3V4IA 3S6EA 3CCUS 1X5TA 3HHLD 1RTDB 2MLXA 4TY8B 1FA0A 5E3QA 2VQEF 2LU2A 2QV6A 3ET6A 1AIRA 1WSVA 2AEJA 3CCRS 5HP1A 1X0FA 5F0UA 4NEYA 4B9VA 1GK8A 3SQOP 1XNRF 3DDKA 3HDSA 3MHYA 2DK2A 2H5EA 1TL1A 1SC3B 4DR5F 3K89A 2PI4A 2AJ4A 4LF4J 3P3DA 1VC0A 3RGIA 2BR0A 1U8SA 4CO2A 4I56A 1SJFA 2ATCB 2M7SA 4IH7A 5KAKA 1FWPA 4M5DB 2CPDA 4DFJA 1CS4A 5L1KA 3IC1A 1U1MA 3CJ3A 2ZH7A 3FDSA 1CSJA 4QWEA 2UXCJ 1RAIB 4ALZA 1RT4B 5KFSA 2GHPA 4OQJA 4CRJA 5E41A 1KKHA 4OI2A 2HBRB 3OHAA 2XEXA 3HD1A 4EBCA 4PRFA 1HBMB 2GJIA 3Q86A 2KHCA 3W2WB 3C2PA 1H0HB 3N5FA 2BXJA 1NKEA 2PD1A 5CYMB 4GVBB 1OS5A 4DU8A 2UVVA 3MPYA 1BC6A 4PWWA 5F41A 1FVSA 2AEMA 2CQ1A 4CDIA 1IKWA 2KJWA 4YUDA 4J9RA 4RUBA 5BYQA 1FKAF 2ZJQQ 3MCNA 5L9NA 1RTIA 4C8LA 4NK6A 2CJ9A 2V5HG 3QZ7A 2C2NA 4DFMA 4OIXA 2HNDA 2HFZA 2OPPB 2V9KA 2MLYA 2Q66A 4E0DA 2W7OA 1WI8A 4R25A 1W25A 3M30B 4GKJF 4QYZJ 3UNYA 3DLGB 3PO5A 2BJ8A 4DR4F 1CJTB 2QGFB 4AUKA 4DR3F 1N54B 2LCWA 1F6TA 3WQPA 1BUXA 4MR0A 2QZAA 2F8EX 2VFTA 3N79A 3N4WA 1V3ZA 4RPFA 1RMGA 1UAWA 3UDCA 5GAGU 5L46A 3BQ2A 1NXIA 4KHPJ 3MECB 1IKWB 1SJRA 4NRUA 2KKHA 4OHVA 1BXNA 5E3RA 2N82B 5J2MB 3QRRA 4QU6A 2AJ2A 5AE1A 4BC9A 2QC3A 3OFEA 4YB6A 4JYAJ 2XMUA 3KLFB 1RHKB 2AP6A 3S1TA 2KL8A 3M6XA 2IJRA 1NSKL 2BRKA 2ILYA 4DL0C 3IGNA 3KRGA 3CJ5A 3BEGB 1HBNA 2GS8A 2J7KA 3EGVA 4FS2A 1M5OC 2PEHA 2BKOA 2HZCA 3ZZPA 1KVJA 1H6KX 2HKEA 5IWAF 3KMSA 4JI4F 1WHVA 2W2MP 3P4GA 2RILA 2WZ1A 1TMJA 3UWTA 4C11A 2DH8A 1O88A 3W8GA 4NXMJ 5AMVA 2WRMA 3LANA 3MF5A 5SZTA 2V4QA 3NGSA 3QJPA 5M2PA 2XWXA 4UW2A 1DQ8A 2CKWA 1YJRA 4U96A 3OVAA 2YNGA 2DO0A 4RL1A 1LNQA 1R43A 3MXHP 1ROFA 2QFIA 2B7CB 2KN4A 2ALYB 3R5BA 3AB4B 3K8WA 6FD1A 4X4PA 4U7UK 2HNZB 3T41A 1BHNA 3ZTPA 5G0RA 4HDGA 1WKKA 3PXGa 1PJ6A 1QSYA 1VK3A 2NXEA 3K57A 1C2PA 1QA3A 1GTHA 4PABA 3ZNJ1 3Q0AA 4Q0BA 5HP1B 1CC7A 2BE9B 1UWBA 1BQMB 4KV8A 4NLVA 1RWVB 3H90A 4EMDA 2R2UA 5EWFA 3CCVS 4WBFA 1ELOA 1YX2A 1PBAA 3TQ1A 3Q83A 2PFFB 4YELA 1RISA 1F2HA 1XK8A 4PQAA 3T5KA 2YTCA 2O0WA 4HHHA 5KG2A 2HQCA 3M9NB 2JWNA 1RLDA 2AJ1A 2RU9A 3CD6S 1FFGB 2H4YB 1IJEB 5GMEA 3V2UC 1Q1KA 1FKOB 2E7VA 3QAEA 4M5IA 1L1IA 4DF8A 1I94F 4JI2J 4K4ZA 3LPYA 2VDIA 4NK8A 3QO9B 2VBMA 5JVGQ 2OMOA 5LSOA 3D6MB 1N56A 3TVZA 3V5RA 3ZTQA 2QA4G 3H5YA 2B4OA 1VRQC 3SIPB 3TJ9A 4A8OA 3DFEA 4C0OC 2BOPA 2KB2A 1B64A 3GYNA 3OTOF 3E2EA 5FLXY 1F0XA 4XLAA 2IAJA 2ZWOA 1HFEL 1XWLA 1NDLA 1YDLA 4DL5A 2BQ3A 2WW8A 2F9DA 4CTAA 5EHHA 4YOEA 2EK6A 5LXYA 4DV7J 3SQGA 1SV5A 2KVIA 3FSIA 4OZ1A 1Z2ZA 3VV2B 4PEOA 4ZLJA 3MMCA 4QWCA 3GIMA 1I5OB 2ZNYA 4ELTA 2DCUB 1HARA 1HBMA 2FY8A 2G1HA 1HI1A 2J9CA 2V2VA 3MGJA 4FYVB 4JB8B 5D0GA 4BWMA 3K5LA 3KHRA 3B8HA 1R8CA 1JLFA 3D6FB 3SV4A 4X2BA 1K0TA 1U6BA 5HBMA 5ETVA 2VU5A 1V3RA 3QQCD 2HQGA 4Z2XA 1PYSB 4TU9A 3OL6A 3QGPA 2IYIA 4QIGA 3G4SS 2R8JA 5MLCV 3EE3A 2G2ZA 3CDBA 3B6BA 5I42A 1JLAA 2N4CA 2QLXA 3R5DA 4F04B 5M2RA 5KFPA 1KFSA 1CJTA 1V9OA 2DTJA 4HHJA 4EEYA 4CI0B 1E6VB 1L3TA 5KG1A 2DPJA 2Y9HA 1ZM2A 4ZP7A 1TYXA 3NS7B 1VJWA 4DR2F 3WIVA 1WKLA 4DSIA 2ZC3A 4QIWD 2DNGA 4FNHA 4A8WA 4HEA9 5KG0A 3JAMY 4J9OA 4DCJB 3NL0A 3GIJA 3IAM9 1HNWF 5HQMA 3CXCR 1HD1A 3JB9k 3SYJA 3W8PA 4C3KA 2W7AA 1YJNS 1FTCA 2GQ2A 2GQQA 2NXUA 5ETTA 4DR1F 1TV6B 2QN6B 4AFFA 5F8NA 3IFEA 3IM9A 3NGRA 2CDRB 2VPWB 3LGNA 1JX4A 4G65A 4AYBD 4JI1F 1VLYA 3AD9C 2VPZB 3I31A 3MCMA 2EFOA 2XT4A 4QW8A 3V4MA 4O0IA 1TFWA 2X6XA 1PILA 2WAQD 3CCSS 2OEMA 3MM9A 1XNQJ 4F7VA 4LR8A 1Y10A 5B0FA 4DLGA 2HZAA 4F36A 1KD1T 3MEEA 1REVB 2OAUA 2UVFA 5JUMA 3NP5A 3C14A 1CJVA 4DX5A 2QA2A 3BF4A 1HNIA 2GVDB 1HMVA 2JSXA 3RYLA 5K8OA 2YNHB 2CJXB 3NKYA 5IQQA 4R5PB 2UUAF 3BN4A 4G1IA 4KKOB 2O6WA 4M1KA 4MYTA 4W92B 2VPYB 3PW7A 5BYRA 4ZVTB 1H38A 1IBKJ 2VB6A 3CF5Q 3K8VA 2R7SA 4O3OA 4ETXA 1N52B 2VKRA 4KJIA 3B78A 2DHSA 3O1LA 4B08A 4KFBB 2RD5C 1VQ7S 2ZE2B 2B9XA 3BSOA 1GNKA 2DB1A 5HMYA 3AD7C 3D66A 4DX7A 1RT3A 2I5JB 4GO5X 1GX5A 4LIRA 4N41A 2M2BA 2HWTA 3RRHA 4PG8A 3V81A 1RACB 2JOQA 3MM7B 2EEYA 1Q5VA 1X5OA 4CP5A 1Z1ZA 2LMIA 4CLSA 1N5SA 4DV2F 3P6YC 2KFZA 2DIVA 2NREA 3CDWA 5HVFA 3RG6A 3DU6A 1U8WA 4NWBA 4ECYA 4PPZA 2L9NA 2RUGA 2Z2ZA 5GMDA 2IMWP 4YY3F 2VFPA 5HAOA 4KO0B 3G82A 5AXLA 3SSSA 2GA7A 3E8OA 4F26A 2VICA 1MN7A 2A2CA 4DV5F 1UMJA 3TWZA 3KUEA 2C2EA 2ZKUA 4HI2A 2K3KA 2QIFA 4JOUA 2BBEA 3QLHB 3NGUA 1Z4UA 1VBZA 3OFGA 1RQ0A 2FVRA 2BA9A 4TNOA 2KXFA 4ZLPA 4QPXA 1TK5A 1WXRA 1HNZJ 1OFDA 2XMTA 3AOAA 5IZHA 1S1WB 4RX6A 4LFCJ 1RT6A 5KG3A 4YZ0A 3CUNA 1RHMB 3HKZD 5KFTA 5C1EA 3CCWA 2C2ZB 4R8UB 5D6GA 1F2GA 2CXEA 2DR6A 3DYAA 2R42A 3RBZA 4IH6A 1JLFB 2KDOA 4ZPTR 1IBMJ 4EZ9A 1JLGB 2VBZA 5CYJA 5I3UA 2YKPA 4CYUB 1DBOA 5E5NA 3RZAA 2LDIA 2G13A 4MMOA 2QEXS 4FYXB 1TKDA 4DXLA 4CT9A 2ROGA 5HMXA 1NPKA 1XR6A 1N6QA 1VQ4S 4C6AA 1S1XA 1WNEA 3HI9A 2A6MA 2R7QA 2Y0BB 4O0NA 4C98A 3GE9A 2OJ3A 4LF6J 3D3CJ 2IOUG 2XNQA 3GONA 3W9HA 1IWAA 2W2NP 4RBUA 5L39A 3FBCA 3OL8A 1JWWA 3QIPB 3LUYA 3EX7B 3FC9A 3IM8A 3PO4A 1MN9A 1OSDA 1URRA 1BD6A 4B3RF 5BXIA 3MAHA 2HVZA 2NYIA 4OJ1A 3ILOA 3F0NA 4M5NA 1RWOB 4I6YA 3MOJB 3ULHA 1WOOA 2ZBCA 4F2SA 1KQKA 2E1RA 3MOZA 1TKXA 1FESA 2EFPA 1U02A 1EQ0A 1S5ZA 1O8GA 1XN9A 4OJOA 5GAHI 2MJUA 1CC8A 2O67A 1WF1A 4OYWA 2B56A 2KT3A 3TRGA 4DF4A 4KAIA 4WXWA 1SI9A 1NRKA 2NSPA 5CABA 5DLGA 1ZETA 2Z2MA 2NT9A 3PYDA 2HNYB 2NTPA 4IKAA 4CLUA 4FVCA 2JL9A 3IWLA 3R5JB 2J8SA 3DRXA 4WTOB 2F4FA 3E01A 2HG4A 2HPUA 3KK1A 1L3SA 5JMCB 2E1PA 3OBIA 4FKYA 4GMKA 4MTPA 3EGNA 3ZNUA 3LGMA 3KFWX 1JXEA 5E3CA 1QTMA 3H2LA 3F41A 3M2VA 1RAEB 5D4OA 2KYZA 5D4LA 3QSIA 4I7FA 1RCXB 1XEZA 2ZJRQ 2R7WA 3KJFB 2X1AA 3UN3A 2UV8A 4CCHA 4OX9F 2HLTA 4CZCA 4OI0A 2VG7A 2HHVA 2ZZTA 2YWHA 2HLUA 3QWPA 3QPIA 2FGOA 1SJ3P 1MWZA 2H54B 1ZA1B 3A8JA 1VHFA 2DHAA 3R5GA 4FDFA 4TYBA 1MMDA 4F67A 2DGTA 4X66F 4J9UE 3RB6A 1O6XA 2E1CA 1W2IA 2AQ4A 4P52A 3RR7A 2MZ1A 3LMWA 1R31A 2ACYA 1DTTB 3C16B 5G4DA 3C46A 3KNGA 4LIWA 4USTA 3KLFA 3CVKA 3J7Z5 3THVA 1QAJA 1MU2B 1Q78A 1VDHA 1RK8A 4J9LA 5CHCB 2MZQA 1SC1B 3AOBA 3NMRA 2F40A 3E51A 3OD2A 1WDTA 3OR1B 3SCJE 3RB3A 2UU9J 1KQGB 1UW9A 3W66A 2OEJA 2Z30B 3GIIA 1S6PA 4JV5J 3VAFA 4DPUA 3T5LA 2DRDA 1U25A 4O23A 4ECSA 2E7XA 2CQGA 3CO0P 3RAXA 4PUOB 4B17A 1A0OB 5CCMA 2DGOA 1LQ9A 2Y1RI 4C3LA 4RU9A 2V8DA 1FT8A 1N34F 2UXDF 2HGLA 2LP4A 3Q8YA 5L8RC 3EPIA 2P9CA 2YNFA 3H20A 3I0SB 5DQIA 3M2RB 2C2DA 4M5HA 1OPZA 4YEIA 1SH2A 1ZZFA 4JI7J 1PKUA 4A46A 4DS4A 3GFHA 1TL3B 1UEKA 2GMLA 3Q8SB 1DBDA 1RWXB 2AV5A 5BYSA 3ZC4A 4A8QA 2COLA 1FDDA 3NLCA 2VKZG 2YX7A 1ZA2B 2JLFA 2I6WA 1IKXA 3DI6A 4I64A 4LBIA 3SZEA 2A3JA 2DXEA 3SEOA 4YCQA 3EYZA 2IMOA 1U0HA 3CD5A 1M5VC 1F5CA 1UVNA 4UY85 2GQCA 5IT9Y 2K06A 1YZ7A 4PG5A 1WTBA 3M8SA 3KKFA 1OY9A 2AYBA 4Y65A 5LMNF 4M5DA 4ZOSA 2N7CA 3M8QA 5LJ3Y 3O3LA 4HACB 4HI1A 3G8SA 1FRXA 1NKCA 1ZH5A 2HVHA 2D41A 2DNLA 8ATCB 2J8IA 2LLZA 2VC0A 1GTEA 3FCHA 3MEKA 2CQCA 5A8WA 4XOPA 3LA0A 1RT4A 3PKYA 4DPXA 3KLGA 4FF2A 1S1VA 2XS7A 3R8YA 4WIQA 4JI4J 3UVJB 4H4KC 2DNMA 3HVAA 4WU3A 3ETOA 1JJCB 1UETA 1VGYA 2D9OA 1KQ5A 2NTBA 3FSXA 1NZ8A 3KJNB 4DV6F 4AQYF 4NASA 3ZO7A 4CH0S 4ECXA 5T14A 2DHXA 1M1GA 3HHLC 5CQGA 4JV0A 4D3GA 2MKKA 3HK2A 1HQ2A 4J9SA 2XYPB 3GP9A 5D4PA 1S0NA 1AYEA 3A4TA 2BM5A 3ZZOA 1TK0A 4DOZA 3QNWB 4DFKA 3MUVP 3R2CJ 1A6LA 2LQ8A 4XN0A 3V4IB 1RTDA 1C1CA 2V0NA 1X4CA 3A12A 3MEGA 2BYCA 4QR2A 3TX8A 3ZZRA 3GIKA 4YS2A 4ECVA 3E01B 2W1BA 5F8JA 3P4UB 1SCJB 3I0RB 1HG8A 2DY9A 3MR7A 1TZ0A 5B0BA 2WHOA 1IWGA 2MZJA 3RUBL 4IO9Q 2DXDA 2X3HA 2N4DA 1UL3A 1RWMB 1L3VA 2CADA 2ZDPA 2ZH8A 4NCGB 1HWKA 2RRNA 3Q2TC 1FJCA 1SVDA 3ZTOA 2CNOB 2RJZA 4NLOA 1DJ0A 1I51B 2C3MA 3CJSA 5J1EB 2MGZB 5IFMA 1WTFA 1OFLA 1TU0B 2IM2A 1CJKA 2DY1A 4O44A 3ZPPA 3ZZZA 4QIVA 1YJTA 2FHMA 1H2UX 1P27B 2EC2A 2W4PA 3EMTA 4M63A 2FVCA 2ASLA 1SKWA 1T7PA 4JYAF 4OYXA 1AFJA 4NOHA 5A8RA 5J2QA 4KO0A 4Y2IA 3BQ1A 1CVJA 2QYGA 3MI7X 5CH7B 1U1PA 4WZQA 2NCKL 3IN5A 4CLWA 2DR5A 1AW0A 1CJUB 5KFGA 5J2PA 2LQ9A 1S77D 3PKMA 2NXCA 4LBPA 3D2WA 2XI2A 1NK6A 4HT5A 2WOMA 3OTOJ 2ZM6F 2YQ3A 3K2YA 5C25A 4DUTA 2YKMA 3HFVA 4Q8FA 3FMBA 3AB2B 3B4MA 4F0HA 4H4MA 5HMWA 2ZH5A 4EYHB 1EIYB 4DSLA 1JRGA 3VR1A 3GLJA 4RNHA 2BM7A 1QUVA 2EFVA 3M32B 4J9PA 2P9GA 5J1EA 1XNRJ 2J5AA 2JHEA 1HMVB 1QUPA 4O4GA 3EZUA 2XMKA 2X7IA 1XR5A 2CQHA 2ZH4A 5HROB 4UOHA 3KYLA 2XT2A 2HFNA 2IYGA 1HPZB 1HWJA 3BPDA 3N5BA 5CZXA 4ES2A 1V3SA 4EWTA 4PAAA 2BM0A 3TO8A 3AD8C 2I0XA 4EK2A 4DX6A 3H59A 5A76A 2EWEA 3TX0A 2A6OA 3ZFVA 4V19X 4JI7F 4DPYA 1BN8A 2QTWA 2VZ9A 1LW2A 2HFSA 2HWIA 4X64J 2APOA 3R1LA 3PJXA 1JIHA 1M5HA 4KFBA 4J37A 3HFZB 3G6VA 4X65F 4K5SA 1DY3A 1CQNA 1LWEA 2DGUA 2OELA 1CBKA 2OD6A 4I1TA 2X51A 1S79A 3DHXA 1FTRA 3J80Y 2Z56B 2MLZA 2X3GA 4OZ0A 3TZYA 2ZBIA 3DOLA 5LSRA 5A2QY 4QWDA 3KK2B 2J0QD 1SJ1A 1HD0A 6FDRA 5ETNA 2XULA 3MD3A 5A8KA 1K4ZA 3H25A 1N5QA 2O01C 1QSSA 5DDRC 2UVUA 6AT1B 2X85A 2HRUA 3PFOA 5B0DA 5F8HA 4IFYB 2YH0A 3KLGB 1LLZA 1R0BG 2LVWA 4F0MA 5DM7Q 1NK5A 1NPRA 4KSEB 1OJ4A 2O66A 3M8QB 4RW6B 2FVPA 4JI0F 1EA0A 1KP6A 1NDKA 4K59A 5K5MA 1FCAA 3KDNA 4OHZA 2VJJA 3DHWC 1SL0A 1MW7A 3ENAA 2CJQA 1UJ6A 5LM7E 2GV1A 1JKHA 5KG5A 3CJQA 4DL7A 2PN6A 1WC4A 3J81Y 1RZMA 1VIXA 3SXLA 1RWRA 1TL7A 1TP7A 2IRYA 4K7QA 3B8YA 5AJ3F 3JTNA 2XM3A 4ZA1A 5FDLA 1IBMF 2CQIA 4NMXA 5L9XA 3I5CA 3FCVA 4DUZF 4D3HA 1K8AT 2BQRA 1Y3KA 2MKJA 1S9FA 4RNOA 5D77A 3BR9A 4IFVB 4NYPA 2F4VF 4OV6A 2X1BA 4DLEA 1T95A 4O44B 4JUZA 1WUUA 3N9UC 1LOUA 4MH8A 3UR3C 2IY5B 1YJWS 1FFSB 3D3BJ 4IRDA 3NWRA 1YZ6A 1VQKS 1JMTA 3QO9A 1PBUA 4W8TA 1GMWA 4GVBA 2BM1A 4OZLA 1FF2A 1VRUA 2NXJA 5DO2A 3RBDA 1T03A 1SL2A 5E3PA 3JTOA 1FKPA 5KFNA 5KOWA 4PG7A 3QMQA 2XNRA 1URNA 1IR1A 3QT8A 1P1LA 1TVRB 2C2OB 4M8LA 5DNSA 4Z7CA 3NOCA 4HWVA 2EKNA 4N7TA 4OHXA 3UDEA 3TZWA 1VBKA 1ZS6A 1HQEA 4B9LA 4FBUA 1YWXA 4WF9Q 1K47A 1SC4B 3OJSA 2EFQA 3K7RA 3H7HB 1T3NA 1OO0B 2GIRA 2MDAA 1FK9B 1ZTWA 3TQEA 3BO3A 1JXVA 4M5MA 4OZ3A 3W2WA 4FPIA 1RU2A 2ASYA 3WWGA 2Q79A 5ETRA 2VFQA 2B5JA 1WJ9A 1J5OA 1UZDA 3MM8A 4HLBA 2QG9B 3LO3A 1GEHA 2I2YA 1RTHB 3DNCA 4XLFA 1ZAXA 3D28A 4YHHF 3DU5A 2VG7B 3W5XA 3OSNA 3W64A 1O0PA 3GWCA 2CUYA 3W9JA 1ZPVA 3QZ8A 1VQPS 4RKUC 4I7FB 1HNVA 1VK8A 2C2KB 2GNKA 2CA9A 3ET6B 3M2UB 4EFAC 1FE0A 2Y1LB 2CG4A 2NYHA 1LW0B 2CPZA 2KM8B 2OIHA 1X9MA 3PACA 5D4NA 2JLGA 3TOQA 1FK9A 3GV7B 3BDPA 2X1FA 4URQU 1KDNA 2BABA 5AXKA 1RWWB 2D3O1 1VISA 2R9LA 3US5A 1RYSA 2JEIA 4ED0A 1HI8A 3NNCA 2J0SD 4RUAA 1HYSB 3TAMB 2K2PA 2X3DA 3PYGA 2GZOA 3UE2A 1WG5A 1IKVA 2H5JB 4P7VA 3OTBA 5L1LA 2L41A 1NAQA 2JC1A 3LP1B 2AEFA 5HK4A 3MTKA 2Z2YB 4MKBA 3G87A 4ZDNA 1N0UA 2IM0A 1SBRA 2DO4A 1O5JA 2Q43A 1LWFA 1X31C 2PYGA 2WK4A 3VTIA 5A0YB 2CIMA 1QCXA 3M2RA 4FVMA 4WYWA 3UD5A 2KFYA 1DRZA 1TELA 2P6SA 2CJKA 2UXBF 1RU1A 3KHGA 4M5GA 4RJVA 5KT5A 1SPBP 4F4KA 1GMVA 2E5JA 3G9CA 2CZVC 1DHMA 4ECUA 3IR7B 3DLGA 3LYCA 4Y3CA 5KFZA 1KCDA 3L09A 2PFDA 1NSQA 4ETZA 2CPIA 1Q8KA 4RW7B 3A3PB 1LFWA 3EZ5A 2DKOB 2FZCB 4KBIA 2C1EB 2KHDA 4TY9A 1FRHA 4MIWA 3HF5A 2HURA 4PMHA 4EYIB 1TL7B 2XLJA 1Y3JA 2B9WA 1LLWA 2V8HA 4ED2A 3E3XA 3UVJA 1X4AA 1S99A 3BB5A 5KFYA 3BH6B 1RAAB 2YX1A 1IKYB 3EVWA 3CCQS 1P6TA 4KHMA 4OI4A 3FRZA 4IQXA 1RBLA 4XL9A 4XR6A 3VMWA 1FNMA 3W7BA 1NSAA 2V50A 3I32A 4ZCKA 3LW5C 5AJ3J 4OHYA 2HHTA 3EZOA 3H2VE 2WVDA 2ZFHA 3G82B 4JI8J 1YBAA 2NZMA 1ZZNA 5F3TA 1GXLA 3R1HA 1KS2A 1YQHA 2XSJB 4KPCA 4KY3A 5K14A 1MLAA 3OQ2A 2FPHX 2B9EA 4CLTA 3A8IA 3QYYA 5CYMA 3ZZ0A 1H80A 5ETPA 4ES3A 2W2OP 1RYRA 3P5TL 3CIZA 1K0VA 1KHVA 4Y2AA 1NK7A 1QSLA 4OLPA 5KFBA 2UVRA 1O51A 2E1MC 2LQBA 1S6OA 3IAS9 5K9FA 3GCWP 2H5IB 2K1RB 2PYHA 3BN7A 3U02A 2XYGB 2I38A 2R7RA 5M2UA 1Q8LA 2GAHC 3D6HB 1SXLA 2RNEA 4WE1A 2HZVA 2O17A 3EM1A 3MAAA 4NZ0A 3D0GE 1VQ6S 1WC1A 1O8FA 1GMUA 1WEYA 2QT7A 3V6DA 3MWBA 4MT1A 3W1YC 2HVIA 4NZ6A 1EP4A 2GVZA 5C42A 4R5PA 2HVDA 4IDKB 4P10A 3EJMA 4DV4F 2ADBA 3OLBA 1LW0A 3MFIA 2LEBA 1RHUB 1CJVB 1S12A 2UUWA 3Q8UA 1YRTA 2HS4A 3DOMB 4C8NA 3UCGA 1U47A 1S1UB 3FEZA 3GB0A 3H5UA 3BSAA 2FJAB 2QSWA 3M1VB 3N0VA 1GFWB 5EUHA 2ZUAA 1JQGA 4J9QA 4DV6J 1VBYA 4LF8J 2ROEA 3PCOB 4OI1A 2AZ3A 4X84A 3TYTA 1Y9OA 3OXLA 1N36J 3VSUA 4K2JA 4WE1B 5A8RB 2C42A 1NB7A 2HHWA 2MSSA 3M6WA 4LRBA 2ZJPQ 2ASJA 4QOTA 1O8DA 3KLIA 2KZMA 3LP0B 4LUBA 5DGBA 4DWIA 2RDIA 1D1UA 1LEOA 1S59A 4P73A 5B0AA 2NZCA 3LP2A 1X0PA 3M8PB 3PG9A 4DV3J 3UNGC 2VASA 2CPEA 2X1GA 2RT3A 3LH2S 5KFRA 1TL3A 2DNKA
chains in the Genus database with same CATH topology
3PJ9A 4EK2A 4OM9A 4CP5A 1DABA 3EVMA 4OPWA 2V5IA 3Q8YA 3VGUA 4OJ6A 1BHNA 3ZTPA 1QA1A 1WKKA 1U8WA 3DDIA 1PKUA 2BX6A 1QA3A 2VFPA 3JX8A 1S57A 1MN7A 1PAEX 4WBFA 3EVOA 3ML3A 3Q83A 3NGUA 3R9LA 3VVTA 1TYWA 3SZEA 5JLVC 2DXEA 1NDCA 1CLWA 1WXRA 1K4ZA 2CWKA 3GPAA 3LYCA 3ZTQA 4W98A 5IOLA 3VGTA 1NSQA 4FKXA 2J8IA 1B99A 3B54A 4ANCA 4DZ6A 1NDLA 1NDKA 3ELHA 3FCWA 1HF2A 1W7WA 3L7UA 2HURA 1NPKA 1KQ5A 3ENAA 4C6AA 4O0NA 1K8FA 2IOUG 2BEFA 3G2XA 4OJPA 1HLWA 3FBCA 4ENOA 3JS9A 2VFNA 3GP9A 3BH6B 3EVWA 1HIYA 3FC9A 1HHQA 2VU5A 2BM5A 4V02C 1MN9A 1WKJA 2XC1A 3Q86A 1TYVA 3DKDA 5BXIA 3FCVA 3EE3A 2HVEA 2B8QA 3B6BA 1B4SA 3BBBA 3RIQA 1BE4A 1S5ZA 4JRAC 3FKBA 4KPCA 1TYXA 4OJOA 1QRCA 1QQ1A 2DYAA 2DY9A 1LWXA 1WKLA 2YUHA 1NB2A 1VYAA 2VFMA 2DXDA 5CABA 3ZTSA 1NUEA 1F3FA 1EHWA 3VGVA 3SYJA 3ZTRA 3ZTOA 3EICA 3FBEA 4UOFA 3NGRA 5JMCB 3NGTA 1F6TA 4FKYA 3PRVA 1BUXA 4ANDA 3AK5A 3EM1A 3EMTA 2G0YA 1ZS6A 1TSPA 2B0RA 2BM4A 1UCNA 2HVDA 3EJMA 1JXVA 2NCKL 1NLKL 3TH0A 4F36A 2VFQA 3BBCA 1QRBA 3BBFA 1NSKL 3Q8UA 4DI6A 3BH7B 4ANEA 4KH3A 1XIQA 1XQIA 1NSPA 4DUTA 1TYUA 2ZUAA 1NDPA 5C7PA 2AZ1A 2AZ3A 3ETMA 3VVUA 2VFOA 1NHKL 3MPDA 3H09A 3P4GA 4S0MA 3Q89A 3VGSA 3WX8A 2BM7A 3Q8VA 4F4AA 4UOGA 3LJYA 3N90A 1NCLA 2W7ZA 1LEOA 2F3LA 1S59A 3NGSA 3FBFA 2B8PA 1K44A 4HR2A 1KDNA 3N6ZA 3PETA 1QA2A 2DXFA 3FBBA 4OJ5A 4UOHA 2BM6A 5CAAA 4OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJ9 A;  4EK2 A;  4CP5 A;  3EVM A;  3Q8Y A;  3VGU A;  1BHN A;  3ZTP A;  1WKK A;  3DDI A;  1U8W A;  1PKU A;  2BX6 A;  1S57 A;  1MN7 A;  1PAE X;  4WBF A;  3EVO A;  3Q83 A;  3NGU A;  3R9L A;  3VVT A;  2DXE A;  1NDC A;  1K4Z A;  2CWK A;  3GPA A;  3ZTQ A;  4W98 A;  5IOL A;  3VGT A;  1NSQ A;  4FKX A;  1B99 A;  3B54 A;  4ANC A;  4DZ6 A;  1NDL A;  1NDK A;  3ELH A;  3FCW A;  1HF2 A;  1W7W A;  3L7U A;  2HUR A;  1NPK A;  1KQ5 A;  3ENA A;  4C6A A;  4O0N A;  1K8F A;  3G2X A;  2BEF A;  1HLW A;  3FBC A;  4ENO A;  3JS9 A;  3GP9 A;  3BH6 B;  3EVW A;  1HIY A;  3FC9 A;  1HHQ A;  2VU5 A;  4V02 C;  1MN9 A;  1WKJ A;  3Q86 A;  3DKD A;  5BXI A;  3FCV A;  3EE3 A;  2HVE A;  2B8Q A;  3B6B A;  1B4S A;  3BBB A;  1BE4 A;  1S5Z A;  3FKB A;  4KPC A;  2DYA A;  2DY9 A;  1LWX A;  1WKL A;  2YUH A;  1NB2 A;  1VYA A;  2DXD A;  5CAB A;  3ZTS A;  1NUE A;  1F3F A;  1EHW A;  3VGV A;  3ZTR A;  3ZTO A;  3EIC A;  3FBE A;  4UOF A;  3NGR A;  3NGT A;  4FKY A;  1F6T A;  3PRV A;  1BUX A;  4AND A;  3EM1 A;  3EMT A;  1ZS6 A;  2B0R A;  1UCN A;  2HVD A;  3EJM A;  2NCK L;  1JXV A;  1NLK L;  4F36 A;  3BBC A;  3BBF A;  1NSK L;  3Q8U A;  4DI6 A;  3BH7 B;  4ANE A;  1XIQ A;  1XQI A;  1NSP A;  4DUT A;  2ZUA A;  1NDP A;  5C7P A;  2AZ1 A;  2AZ3 A;  3ETM A;  3VVU A;  1NHK L;  3MPD A;  4S0M A;  3Q89 A;  3VGS A;  3WX8 A;  3Q8V A;  4F4A A;  4UOG A;  1LEO A;  1NCL A;  1S59 A;  3NGS A;  3FBF A;  2B8P A;  1K44 A;  4HR2 A;  1KDN A;  2DXF A;  3FBB A;  4UOH A;  5CAA A; 
#chains in the Genus database with same CATH topology
 1R3N A;  1TUG B;  5KT4 A;  3EVM A;  5DDP C;  4OPW A;  4F50 A;  4MAK A;  3VGU A;  4OJ6 A;  2FVQ A;  3HHE A;  2XG8 A;  4RBV A;  3ZSC A;  2WVE A;  2XMW A;  3G6E S;  2VQF J;  4WCE Q;  1VQN S;  3DDI A;  5F8I A;  5A0Y A;  4DL3 A;  4NLW A;  5DG9 A;  2C28 A;  1H3D A;  3WIU A;  3RR8 A;  2KRB A;  2QLB B;  3CSK A;  1S6U A;  5JJB A;  2BJE A;  2V8V A;  2R8K A;  2NS1 B;  2M9K A;  2Y0S D;  4QQB A;  1WEX A;  2D69 A;  4ZMM A;  1FXD A;  2OPR B;  3MM6 A;  3RU0 A;  2CPY A;  5KFM A;  2PSZ A;  4X65 J;  2MXY A;  1SC6 A;  5JLV C;  2E1A A;  4NZ7 A;  4DSE A;  4L72 B;  2K3I A;  3UN2 A;  4DS5 A;  3RB4 A;  1LWC B;  1L3U A;  2HNZ A;  4ED1 A;  4YDT A;  2KFN A;  2FHJ A;  4URG A;  2R7U A;  2YWK A;  4PR6 A;  2Q6B A;  1SL1 A;  1JLE B;  4USI A;  3GPA A;  2ZZM A;  2H1Y A;  4YME A;  2CPX A;  1T9X A;  2HRY A;  4ECQ A;  3VQT A;  4C2L A;  4LT6 A;  1BQN B;  4Y0F A;  4UZB A;  1HQU B;  2ZVI A;  2ZBP A;  1B99 A;  3I9V 9;  3R7B B;  3M8Y A;  4MK8 A;  2OFH X;  2QL9 B;  3B4D A;  3D9B A;  2N3L A;  3BGR A;  3EGW B;  4CLF A;  5HL7 Q;  1IR2 A;  2XCA A;  4CLL A;  1VRT A;  3CJ0 A;  1HF2 A;  2FC8 A;  2G0J A;  2CZ9 A;  1X4F A;  3M8W A;  2F8H A;  1Q81 T;  4LRC A;  3N6L A;  2A18 A;  2QMW A;  1IM6 A;  3D1H A;  3O2I A;  2Y1I A;  3C3L A;  1KNZ A;  1X9W A;  2POK A;  4IG0 A;  3MR2 A;  2RQ4 A;  4ELV A;  1GQ8 A;  2IRU A;  4DEZ A;  4DSJ A;  4HTJ A;  4V02 C;  1F9F A;  5D3G B;  4RNM A;  1HNI B;  3I96 A;  2JEJ A;  1QM9 A;  3C6U B;  3VST A;  3HHN B;  4XNF A;  2OPS A;  4OJG A;  4P71 A;  1Y4Z B;  3R5C A;  3DM2 A;  2DNY A;  9ATC B;  2MHE A;  2Z8Q A;  2HHS A;  5E3A A;  1U1K A;  3C15 A;  3SQV A;  4I2Q B;  4BWJ A;  2JFD A;  1VHI A;  3FKB A;  3K59 A;  2DYA A;  4Q2M A;  3QSY B;  4CNY A;  2F4V J;  1S49 A;  2VG6 A;  3WZ0 A;  4ZIW A;  3KLE B;  4GVL A;  1T9W A;  1NJZ A;  4WWS A;  1U1R A;  3CUL A;  3KLH B;  4GKK J;  4PZV A;  4XKW A;  1NUE A;  3EXY A;  4IFV A;  2R8H A;  2ILZ A;  4PKD B;  3CPW R;  5B7W A;  4XON A;  3GQ8 A;  2ATL A;  1S97 A;  5HQ8 A;  2ROP A;  1R0C B;  3D54 A;  3CIM A;  2P6T A;  4OYP A;  2MYF A;  4EBE A;  4JI0 J;  1N5V A;  1TKT B;  1K9M T;  1E6V A;  1WC6 A;  2J76 E;  5K8M A;  3K5M A;  1KEK A;  1S76 D;  1WOS A;  2DNN A;  1BGX T;  1Y00 A;  2BJD A;  2DIS A;  1C1B A;  2C2M B;  3M4X A;  1WEZ A;  1X4D A;  1F9E B;  1HBN B;  1UCN A;  2EPI A;  2MQM A;  2FTR A;  2AYE A;  5HSP A;  4C0B A;  2IQ7 A;  3PSS A;  1WC5 A;  1SJQ A;  3M32 A;  3MFH A;  2L9D A;  2RQC A;  4AXJ A;  1T05 A;  3DRP B;  4I6W A;  3VZI A;  1DTT A;  1O8M A;  3C16 A;  3ITH B;  4J7C A;  4PQU A;  4ZVP B;  5KT2 A;  2GJ2 A;  2DRA A;  4X66 J;  4I2Q A;  2IJF A;  4OZ5 A;  2KI2 A;  2E5L F;  4RLE A;  4U8V A;  4QYR A;  3HT3 A;  1SKR A;  3AOC A;  3WC0 A;  4A48 A;  4DQQ A;  1V6H A;  3SCI E;  2HS3 A;  1U49 A;  2FY1 A;  2QE5 A;  2RKI B;  2OKQ A;  2NST A;  1PC5 A;  3K5P A;  5JVH Q;  4ATN A;  3JYT B;  1FNO A;  3GG1 A;  1NK9 A;  1Q86 T;  3FY3 A;  2E44 A;  3C14 B;  4IRC A;  4N8N A;  1Y11 A;  4XPC A;  1IM4 A;  1REV A;  3OSP A;  1VC6 A;  1L3K A;  3JXO A;  4KH1 B;  3M9O B;  1T05 B;  2VUG A;  2H51 B;  1G4C A;  4PYA A;  2FHO B;  3GV5 B;  2LXF A;  4IG3 A;  3M8R A;  5RUB A;  2IA6 A;  5IXU A;  4M5L A;  3WDO A;  5BJR A;  2VOO A;  2KXN B;  4OZN A;  2LQ5 A;  1TUW A;  2SXL A;  1W2B R;  4OV1 A;  4LF5 F;  1QA1 A;  4C7Q A;  3VAM A;  7AT1 B;  2OO4 A;  4PXB A;  3DOL B;  2V2Q A;  4USU A;  1ZM9 A;  4C9D A;  2UVW A;  3QT7 A;  1XMQ F;  2AJ0 A;  4QR0 A;  3BSN A;  3Q8Q B;  3KJV A;  2BOA A;  2VPX B;  4BHQ A;  1AB8 A;  4RW9 B;  2VOP A;  2B0G A;  3OTC A;  1PAE X;  1PJ7 A;  4CO1 A;  4EO8 A;  3UQS A;  4WKY A;  5EX3 A;  3I5B A;  1NK8 A;  3J7A 1;  4IR9 A;  1LM1 A;  3BKU A;  1NDC A;  1RAJ A;  2CJB A;  3TAM A;  3H4B A;  4ED5 A;  1CLW A;  2ZVS A;  2MQP A;  3VSV A;  1RI7 A;  3CCT A;  4ZVR B;  4CM2 A;  1EKS A;  5DGA A;  3TA1 A;  4AQY J;  2HW3 A;  1PC4 A;  1NND A;  3EXC X;  1EAR A;  3BM7 A;  4DR5 J;  1OWX A;  1YHQ S;  1P9Y A;  5DDO C;  2QX0 A;  1YJV A;  1QAX A;  1UJ5 A;  2CRL A;  2AU0 A;  1QJV A;  4JI6 J;  1HQU A;  2J6T A;  2XZW A;  1X9S A;  4JI3 J;  4UF4 A;  4DR7 J;  2BE7 D;  2BJ3 A;  1W7W A;  2LKZ A;  2ODL A;  4ED4 A;  1JNZ B;  3I55 S;  2RHQ B;  1QVF R;  3HO1 A;  2OD4 A;  1S0V A;  3DC2 A;  2YKQ A;  2KVQ E;  1S1W A;  2AIR B;  2W25 A;  3MR6 A;  4NYZ A;  2NR0 A;  1X4G A;  4YC5 A;  3PDN A;  4MK7 A;  2QX3 A;  5CD4 A;  1NK4 A;  1RWN B;  1W26 A;  2IM3 A;  3W2V B;  5KFQ A;  5D15 A;  2UXC F;  1IA5 A;  1GXU A;  1VRU B;  3D68 A;  1T03 B;  1HHQ A;  2QA4 S;  1WKJ A;  3OVS A;  1SQG A;  2XYH B;  1RBO B;  4R8U A;  3ZZU A;  5T7L A;  2XC9 A;  4NLS A;  4UUW A;  2AJQ A;  2MY7 A;  2CVI A;  4LF7 F;  1BHE A;  1DAX A;  3HSG A;  4OYZ A;  4P2M A;  4XAK A;  1BE4 A;  4I84 A;  2YX4 A;  1OGM X;  3SCK E;  5HN0 A;  3HMJ G;  3Q8P B;  1VQ5 S;  4LF6 F;  1QY7 A;  1ZAV A;  1HWI A;  1AUS L;  1S9G A;  4B9M A;  3X1L B;  2GO9 A;  2FC9 A;  1EJ7 L;  2HHP A;  1C1B B;  3GG0 A;  1AZS B;  4B02 A;  5L38 A;  2ZH3 A;  2VQE J;  1UKU A;  1H7X A;  2ZD1 A;  5IS2 A;  1HHT P;  3LWL A;  3HFK A;  2XBP A;  1S4F A;  2ZDO A;  2MQQ A;  3J81 U;  1MWQ A;  3NAW A;  3BJY A;  2Y1J A;  2QRR A;  3A13 A;  5D0H A;  4X4R A;  4F3M A;  1N5Y B;  2FQQ B;  3T1Y J;  1N0V C;  3WHI A;  3AA9 A;  1X7V A;  1VIO A;  1Y0H A;  2XSJ A;  4CO4 A;  4WK1 A;  4PUO A;  3H5X A;  3TNV A;  1UFW A;  1Q8B A;  2OPP A;  4LF9 F;  4ZJO A;  2BM4 A;  2KRR A;  1FD8 A;  1WI6 A;  2F3J A;  5CXT A;  1ACM B;  2IC3 B;  3B82 A;  4XM3 A;  4XDC A;  3RRG A;  2AGP A;  4DL4 A;  1WHY A;  4JBC A;  4P7T A;  4NCB A;  3DRR A;  1UPM B;  3FJ2 A;  4H4K A;  2XTX A;  2KT2 A;  4JI5 J;  2UUB F;  5IT4 A;  4ANE A;  1HWU A;  4LSN A;  4MYU A;  2BSP A;  4WFB Q;  3MZI A;  2GVZ B;  3A3N B;  5C42 B;  4A8F A;  4TKT A;  4QIF A;  3TJ8 A;  4QCL A;  1M1H A;  3PX0 A;  2AZ1 A;  5J1P A;  4ZP8 A;  3POT A;  4OX9 J;  2HQI A;  5AXN A;  1RAB B;  1C0T B;  2H4W B;  4NL5 A;  1K73 T;  3T6B A;  1XER A;  1U0S A;  2CJA A;  1JLC A;  1DQA A;  2V94 A;  4KYZ A;  4RWX A;  3S01 A;  1U0H B;  3IR5 B;  1N4L A;  4F4A A;  2OH2 A;  1FRM A;  4Q8E A;  3DOK B;  4FYW B;  4DL2 A;  2YNI B;  1NCL A;  3A8E A;  4CO0 A;  1Q82 T;  3SZ2 A;  4AD6 A;  4WFN Q;  2WVB A;  3CE8 A;  3PYF A;  1EKR A;  3Q2S C;  5KFC A;  4GC7 A;  3CW2 C;  2H48 B;  3NB2 A;  3AFG A;  4ZN3 A;  5AXM A;  4DG1 A;  2N7Y A;  4DSF A;  2BM6 A;  3EDR B;  3NBP B;  4OJL A;  1TL1 B;  2RS2 A;  5F8M A;  2FJX A;  1VQM S;  2RE1 A;  2ABY A;  1TV6 A;  1WF0 A;  2VD3 A;  3P8B B;  4RW8 B;  4ZVQ B;  3HKW A;  4JI8 F;  5AT1 B;  3SSR A;  2GGP B;  3P5B P;  4X62 F;  4YR2 A;  2UU9 F;  4RW9 A;  2NPF A;  2HHH F;  2BAC A;  1GQE A;  1LWE B;  2FHK A;  1F60 B;  2V4J A;  3T5J A;  3VAJ A;  2YNI A;  1NJY A;  3FFI B;  2BJ9 A;  2UZA A;  4LQ9 A;  3ML3 A;  4UY8 T;  3L7P A;  3IRX B;  4DR6 J;  4IUF A;  3AH6 A;  4DQP A;  4YFU A;  2NZ4 A;  4JI3 F;  2Q3P A;  1T9U A;  3ISZ A;  2ZZN A;  2CG8 A;  4XLE A;  4PWU A;  3T1Y F;  2J7U A;  2WON A;  2QMX A;  5IM0 A;  4WU2 A;  2X6W A;  2XZD B;  4KGX B;  1JTA A;  1E6Y A;  3OR2 A;  4M94 A;  1RCO B;  4CO5 A;  4QZV B;  2VHG A;  3QIP A;  2VL1 A;  2Z58 B;  5IOL A;  1A9N B;  2BJ7 A;  1EB0 A;  2CWX A;  5HI7 A;  1BLU A;  2MQ8 A;  4LRA A;  2BW2 A;  4P2X A;  1MWY A;  2MKI A;  1GX6 A;  2VBW A;  1VCT A;  1SH0 A;  5D0R A;  4AL5 A;  3TUZ C;  1CLF A;  3N6N A;  4PXD A;  3GZ7 A;  2XY5 A;  3HJF A;  2LXI A;  2KM8 C;  2DVI A;  9RUB A;  2WBR A;  2FHJ D;  1RDR A;  3TA0 A;  2G2O A;  2IRX A;  2BE2 A;  3G2X A;  1VRT B;  2BV3 A;  2DR9 A;  4B3M F;  1AFI A;  3SSQ A;  7FDR A;  1RU4 A;  4YN3 B;  1BY9 A;  1LWF B;  1XR7 A;  2QMU B;  4RW6 A;  1IQZ A;  2CYY A;  2ADC A;  3H0P A;  1X4E A;  2Z0G A;  1ZM3 A;  5H1S V;  3TAR A;  1D9F A;  1N33 F;  1ARO P;  3DKD A;  4X4S A;  4CTA B;  3GSD A;  1Q7Y T;  4PYD A;  1SJ4 P;  4P2S A;  3CJ2 A;  3HJV A;  4P75 A;  4CQ1 A;  2F7V A;  1KLM A;  3C19 A;  2IBO A;  3V6K A;  2AT1 B;  3BGO P;  1YIT S;  2VQF F;  1EE6 A;  4G6V B;  3M2V B;  1OY8 A;  4A8M P;  3U1L A;  3EUN A;  1QQ1 A;  2FD2 A;  4NLP A;  1JLA B;  2K1R A;  4USW A;  4ZPB A;  1B7F A;  4OX7 A;  3HVR A;  3C15 B;  1NZA A;  3KDO A;  4OLO A;  1QAI A;  3DM2 B;  3L9Z A;  2HHH J;  4NYO A;  4RUC A;  4J90 A;  1DBG A;  3ZTR A;  2UV8 G;  3PIO Q;  4DV0 J;  3GQC A;  1OQ6 A;  1S7I A;  2IA0 A;  3CCJ S;  1DZ5 A;  1IJF B;  3U7J A;  1L5U A;  4UOF A;  3O5T B;  1Q95 G;  2ZH2 A;  3T6J A;  3QWU A;  5JXS A;  1I94 J;  5FJ4 A;  1NHC A;  3MUR P;  2ALZ A;  1DAR A;  2G0C A;  2J7W A;  3DMJ B;  4OJH A;  2ZHB A;  2G2Y A;  2OI2 A;  3KG1 A;  1VFJ A;  5HQL A;  4DR2 J;  1YJ9 S;  1N36 F;  1VLO A;  3PVX A;  3CC4 S;  3IWN C;  1TTH B;  5GVQ A;  3KJV B;  1ZTT A;  3W5Z A;  1FJG J;  2CNN B;  1RTZ A;  3ADA C;  1RE1 B;  2DCL A;  3I82 A;  1NLK L;  2Y8W A;  4ZIT A;  4DPT A;  3DRS A;  3PR4 A;  1GMW D;  3HD2 A;  1HI0 P;  3BS9 A;  4ZPW R;  4CLP A;  2R7V A;  1G3O A;  3ISN C;  1WDD A;  1XIQ A;  2B5J B;  2AX1 A;  3LP0 A;  2GHV C;  5KG6 A;  2PT0 A;  3TUI C;  4L74 A;  4DN0 A;  4IOC Q;  3HSD A;  1HQE B;  4Q2L A;  2YY3 A;  4B3T J;  2XHC A;  1RAF B;  3VVU A;  2VFO A;  1QDU B;  3OL9 A;  1G1X A;  1XBW A;  3ICL A;  2PMZ D;  3TR5 A;  4N47 A;  4PQU B;  2NT6 A;  1A7G E;  1SQE A;  1IN0 A;  3MEC A;  3Q89 A;  1J5O B;  2IDE A;  3VAK A;  2MKH A;  2DPI A;  1RT5 B;  4G1Q B;  1FXR A;  4YEA A;  4IYQ A;  3BGL A;  4TVA B;  3RAQ A;  4LJM A;  1UVM A;  1SKS A;  2VBY A;  5IC4 B;  2M52 A;  3KG0 A;  3FBB A;  4OJ5 A;  3HUL A;  3SCL E;  3NRB A;  1LWC A;  2U2F A;  2XTY A;  2BUN A;  3G71 S;  1IKX B;  3DI6 B;  2IFX A;  2C3U A;  2GIF A;  4L3N A;  1DAB A;  3A1Y G;  2V5I A;  4Z06 A;  2E29 A;  3QGH A;  1YBT A;  4EUV A;  1HHS A;  2FUG 9;  3DRS B;  3BYR A;  3GIR A;  2GJF A;  2VBX A;  4AL7 A;  2J6U A;  3V81 B;  4F02 A;  2R7X A;  2DGS A;  4O3Q A;  1NK0 A;  4MKY A;  4TLR A;  5LL6 d;  2ZNZ A;  4O3R A;  1E6Y B;  3OR2 B;  3J81 j;  4DR1 J;  1FEH A;  3M05 A;  3PNI A;  2PEC A;  1C4C A;  3HHL A;  3KHH A;  3HHD A;  3EVO A;  2QSF A;  1EAY C;  4FXV A;  3R7N B;  4NLD A;  2F8M A;  3MM7 A;  4E2F B;  4UZC A;  1TYW A;  1VMB A;  5DG7 A;  1RAD B;  4N8O A;  4NCA A;  1VOM A;  2MKC A;  1PG5 B;  2FJW A;  3KJQ B;  2UUA J;  3LP1 A;  3HHK A;  4AE5 A;  1XNQ F;  2D1C A;  1DLO B;  1PLU A;  1NU4 A;  2DIT A;  2V63 A;  3CD7 A;  4F25 A;  2F1F A;  3UCZ P;  4I2P B;  4DCP B;  1VQL S;  3J7Z T;  1LW2 B;  2XY6 A;  4X4V A;  1SH3 A;  4ILR A;  4YB1 P;  3KOA A;  2QL7 B;  4FKX A;  4CO3 A;  2J9D E;  5A2Q U;  2DGX A;  4C8M A;  2DNQ A;  4IG0 B;  3OTE A;  1WAC A;  4XQF A;  1U09 A;  1RTJ B;  3PZP A;  1HNZ F;  4JI6 F;  4ZVF A;  1H2T Z;  3FQL A;  3C6U A;  3ONQ A;  2LU1 A;  2YPY A;  2ZHA A;  5A8K B;  1HLW A;  4HDH A;  3JQJ A;  4MFB A;  1U1O A;  1HBO B;  2ZH1 A;  4F4X A;  4WP9 A;  3QJJ A;  2U1A A;  4IFY A;  5IQ6 A;  3BO2 A;  1KRP A;  4H54 A;  2VA2 A;  4ZJQ A;  3CGI A;  4ED6 A;  4YEJ A;  2FYX A;  1RWK B;  2HIQ A;  3MM9 B;  1U48 A;  2G4B A;  4PXE A;  7FD1 A;  1VBX A;  1TKT A;  1RHR B;  5K8N A;  3ENQ A;  4V1A k;  2V67 A;  3RBX A;  2CPF A;  4TQS A;  1UA0 A;  2EW9 A;  2OPR A;  4RO0 A;  3RTV A;  1QRC A;  4IRK A;  1K5C A;  4NRT A;  1CJK B;  3V6J A;  2XMM A;  3LPE A;  1NB2 A;  4LSL A;  3MPU B;  3PJW A;  5FD1 A;  2ZBR A;  3SV3 A;  4AL6 A;  3PW2 A;  4N76 A;  3FGV A;  4U7C A;  3W63 A;  2QLF B;  1JLE A;  4ZPV R;  1S9G B;  3OV7 A;  1WF2 A;  3VHQ A;  5H9F K;  4PG4 A;  2UP1 A;  3R6G B;  1O8E A;  4KPY A;  2DH9 A;  2ZWP A;  2D3U A;  2R3V A;  4CIO A;  1KTQ A;  5KG7 A;  2XGQ A;  3Q22 A;  3BGF A;  2AYG A;  4O3N A;  2FVS A;  2W2Q P;  1Y5N B;  4K5R A;  5I42 B;  3AK5 A;  1WMR A;  4USV A;  2R8G A;  4YZA A;  1ZPW X;  2RVJ A;  3CCE S;  2C22 A;  1YKW A;  5C25 B;  3KLV A;  3G6Y A;  2ZBQ A;  4ITS A;  5KFL A;  1YGY A;  2DR7 A;  4JI2 F;  1FDA A;  1TR0 A;  5ETQ A;  4OZY A;  4LSL B;  2GMH A;  3BDE A;  3KLI B;  5DM6 Q;  3B90 A;  1B70 B;  2GO8 A;  3BBC A;  3AY0 A;  5H9E K;  1QRB A;  2W8L A;  1U1Q A;  1RT5 A;  4ES1 A;  4F2R A;  4J9N A;  1IVZ A;  3A3O B;  1F3V A;  2DJW A;  2EFG A;  3HCX A;  1WC0 A;  4XOR A;  1XJW B;  1TYU A;  1NSP A;  1NDP A;  1OY6 A;  1T9T A;  3T19 A;  4WFY A;  1EET A;  5C24 A;  3OHB A;  4AVZ A;  3QFH A;  3JSR A;  2PGC A;  3OL7 A;  2JC0 A;  2GAG C;  3IBW A;  1NHK L;  2AW0 A;  2WSC C;  3H09 A;  4LSZ B;  4ZPC A;  1S6Q B;  1KLN A;  5KT7 A;  4RW7 A;  3Q8V A;  2E5G A;  4LBH A;  5IC6 B;  2R2T A;  1JNR B;  1UEU A;  5ITH A;  3H2U B;  1QVG R;  2PDA A;  4F4Y A;  4L3K A;  2O1D A;  3NNA A;  4U6P A;  2HBZ B;  4XO0 A;  3G8T A;  1S1T A;  4HR2 A;  2OSQ A;  5MAO A;  4K0K J;  2C3Y A;  2HIY A;  2VG5 A;  4OI6 A;  3M9M B;  4B3S J;  3GYG A;  2JNJ A;  4FS1 A;  1YRX A;  2HQD A;  3V6H A;  4OZJ A;  5GAH U;  3MM6 B;  3JSM A;  2XS2 A;  1U7L A;  2MKY A;  3F73 A;  1EQM A;  1S10 A;  2INV A;  2EC0 A;  2XMA A;  3MCS A;  3HT0 A;  2VOD A;  4P6Q A;  1HNX J;  5ETO A;  2YQ0 A;  1LK5 A;  4CLY A;  3OTD A;  1I3O B;  3W65 A;  2KG0 A;  1VR6 A;  5ETK A;  2KU7 A;  4ZCL A;  1VQ9 S;  1R6V A;  4LFA J;  3OLA A;  1RWU A;  2WTF A;  4ZHR A;  3ZXW A;  5LMU F;  1U1L A;  2NUU G;  3D0I E;  1D8Y A;  5FII A;  3LAM A;  4JI5 F;  4CLK A;  3R9L A;  3VVT A;  5HLF A;  1VQY A;  2LFV A;  4ED3 A;  1CUL B;  1V5I B;  1G6B A;  4X4O A;  2FJB B;  2H9Z A;  1RSC A;  2LEA A;  3IG1 A;  4NEZ A;  4OZ2 A;  2ZHO A;  4ID5 A;  1F5A A;  1FX2 A;  2IJN A;  3GJS B;  3G86 A;  4EU0 A;  2DEI A;  4YDD B;  2O0V A;  1CG2 A;  4DV1 J;  2MJN A;  3OUY B;  1M5P C;  3AHP A;  4JV5 F;  3HVW A;  1H98 A;  1S1V B;  2UUT A;  4Z7Y A;  4CLZ A;  1HBO A;  2OUG A;  4HHU A;  1S72 S;  3THP A;  1QLN A;  2WCX A;  3PFE A;  4EO6 A;  2HK3 A;  1R8H A;  2L08 A;  5D78 A;  1IBL F;  4O4G B;  2BDP A;  1R8A A;  2UXB J;  3VMV A;  4H4O B;  4KGM A;  1Q4R A;  3SDE A;  1ZYQ A;  3JAM U;  4YHH J;  3KMQ A;  2DNR A;  1KON A;  2CQ4 A;  4XOT A;  2CPJ A;  4C8O A;  3QRP A;  3PYE A;  3GCX P;  5CD4 H;  2L9W A;  4K4T A;  2JLE A;  4WYL A;  4CNZ A;  4ENO A;  2J6S A;  1ZM4 A;  4XIU A;  1PCA A;  2W4D A;  1H73 A;  5DQH A;  3IO1 A;  4ID5 B;  1EP4 B;  5GAE I;  2AMC B;  3NMA A;  2XC1 A;  1U2C A;  5H9E J;  1WOP A;  3BZQ A;  3OT9 A;  4WFX A;  5GAD U;  1B4S A;  2WSE C;  1RBA A;  2HRT A;  2DGQ A;  1YSJ A;  3RIQ A;  3CTR A;  4P9S A;  4AXI A;  2OGU A;  1N5Y A;  3CCM S;  1TVR A;  4K4Y A;  1SQF A;  1U2R A;  1JLQ A;  4JRA C;  5ADZ A;  4Y00 A;  2LDY A;  3QGI A;  1JB0 C;  1HW8 A;  1R8B A;  2OHD A;  5K20 B;  5HMZ A;  2VBK A;  1B0T A;  1VYA A;  1MG7 A;  4BCA A;  1SUQ B;  4YZX A;  1KHW A;  2K7J A;  3MMJ A;  2EBG A;  1F3F A;  1EHW A;  2XTJ P;  4W8S A;  5HAN A;  5DET A;  5L1J A;  2XLK A;  2BQU A;  3VZH A;  4BS2 A;  3CD0 A;  5EGY A;  4YQW A;  2XLI A;  5HAT A;  4NA1 A;  1YI2 S;  2F65 A;  3FVY A;  3NGT A;  2D3O R;  2RU3 A;  3Q24 A;  3PRB A;  1AT1 B;  3PW5 A;  2BVZ A;  1IDJ A;  2B51 A;  1PYT A;  3VQS A;  3FSY A;  4KB7 A;  3OR1 A;  1RKJ A;  1KVI A;  1RLC L;  1H2V Z;  2F9J A;  4KV8 B;  1S48 A;  2VON A;  5AE3 A;  3FZ2 A;  4M5J A;  2NSC A;  1VS3 A;  2OPQ A;  1YVF A;  4B9S A;  4ZVS B;  3OFF A;  4NLX A;  5DDQ C;  3IP0 A;  3GR0 A;  3BBF A;  4U8Y A;  1RGV A;  3BH7 B;  3IR6 B;  5HJX A;  2IVM A;  3D1Q A;  1T9V A;  4URR A;  4H4M B;  3VF0 B;  2M4M A;  3NAI A;  2BW7 A;  3AT1 B;  3TEH B;  3BYP A;  1KOO A;  5C2C A;  4PWD A;  1TL5 A;  4MKV A;  2PII A;  3P96 A;  3S8S A;  3SMZ A;  2MQO A;  1RUS A;  4ECR A;  3CDU A;  4C4W A;  1YLX A;  2IAJ B;  1S9E A;  2G9O A;  4U4B A;  4DQR A;  3DLH A;  1KN6 A;  4TU8 A;  3JYT A;  4NXN F;  4YY3 J;  4C11 B;  4N77 A;  2B8P A;  3OXF A;  5KFU A;  4NXM F;  4YP3 A;  3H42 A;  3GJR B;  1Q79 A;  4C97 A;  2OSR A;  1U24 A;  3LQV A;  4DV2 J;  1VQ8 S;  2QXZ A;  2EI5 A;  1NM2 A;  4XN3 A;  1PJ5 A;  3PJ9 A;  5IWA J;  3IBF B;  5EWE A;  4EGL A;  4ZLN A;  1HA1 A;  2RAQ A;  4Y6I A;  1U6F A;  3H98 A;  3SFU A;  4DMZ A;  1Q16 B;  2B6A A;  5KOX A;  3PM9 A;  4Q44 A;  3VAL A;  2FDN A;  4L6V 3;  2YNG B;  2HHU A;  4DV5 J;  3TA2 A;  2ZH6 A;  2RQM A;  1R89 A;  1RT6 B;  2A10 A;  2C2R A;  2VFR A;  5HRO A;  1WHW A;  3AOD A;  3MTJ A;  5THW A;  1QAY A;  4QBU A;  4ZCI A;  1T9Y A;  4FPR A;  3HXM A;  2J9E A;  2B7B B;  1NJX A;  2O3D A;  1RJJ A;  2RHS B;  3JTP A;  4ZVH A;  3TZZ A;  1QJH A;  3M8Z A;  4FF3 A;  2XO7 A;  4LFC F;  3UW1 A;  2OML A;  2VF3 A;  2HEK A;  3JSM B;  1GXT A;  4I67 A;  1P1T A;  2CJY B;  2DBB A;  8RUC A;  1FER A;  1UPP A;  1S1X B;  2J0X A;  3CO9 A;  2HQF A;  3EQO A;  5J1N A;  4X4U A;  4J5O A;  3IS9 B;  3JSB A;  2BE2 B;  1KBR A;  2QLW A;  4YB5 A;  2IVF B;  4HYK A;  1TKZ B;  1KQS R;  3IGV A;  4RW8 A;  4U7U D;  4UQT A;  1JKH B;  3HVT A;  2XO6 A;  1M1K T;  1X4H A;  2P5V A;  2BKP A;  4DG1 B;  4X4Q A;  2ZM6 J;  3DLE A;  3FEX B;  2E5I A;  3L4B C;  4WFA Q;  1TAQ A;  4TU7 A;  2DNH A;  3GRH A;  3DRP A;  2FB0 A;  1C0U B;  3TW0 A;  3W61 A;  2DGW A;  3HZG A;  3PSZ A;  2GC8 A;  3LTO A;  4J91 A;  3WX4 A;  2XB2 D;  2W8K A;  2XCP A;  4YFO A;  2QY1 A;  3LF0 A;  1C4A A;  3AXM A;  4NML A;  1TYV A;  3BGU A;  4LRE A;  3X3U A;  2MZR A;  2O04 A;  2MMY A;  2YNH A;  2CVE A;  1WEL A;  4EBD A;  3ITH A;  2J9D A;  4DUZ J;  4ER8 A;  3FNN A;  1D9A A;  2HAF A;  1DQ9 A;  4M95 A;  1I1G A;  3BR8 A;  3IRX A;  3L95 X;  3MAA B;  4ZVO B;  4X4N A;  3K0J A;  3RJM B;  2V9W A;  2HFO A;  1D8Z A;  4KH0 B;  3MUT P;  4PCQ A;  3W3S A;  5IV3 A;  4A8S A;  2WON B;  2ZE2 A;  2JJ4 D;  4ZVG A;  2GHW A;  2YXL A;  4IDK A;  3UFC X;  2XS5 A;  2IC3 A;  5I3P A;  1RAH B;  4TY8 A;  3PY8 A;  5LT5 A;  3HPO A;  2YPZ A;  2YVS A;  5KT3 A;  2ZOG A;  4YDX A;  4GRS A;  5F8G A;  2YH1 A;  3QJL A;  3HX9 A;  3M7V A;  1FI4 A;  2IPO B;  2RSQ A;  2V8P A;  4WPA A;  1TFY A;  2Y8Y A;  1LXN A;  1FD2 A;  4W4M A;  2OPS B;  3UN5 A;  5I3Q A;  4ILM A;  4QR1 A;  2HMI B;  3FZB A;  1HPZ A;  3GSI A;  4IH5 A;  4KGV B;  3BKT A;  4O4R A;  2DH7 A;  2PA3 A;  1D09 B;  4Y28 C;  5DZ6 A;  3POT B;  4G1Q A;  1LK7 A;  2DEJ A;  4OYB A;  5KFA A;  4JV1 A;  2YKO A;  2OTJ S;  2XI3 A;  2R4F A;  2RF2 A;  2VJI A;  4A4J A;  1UFL A;  4FYD A;  2PA8 D;  4TXS A;  3L7O A;  1HWL A;  2CQ2 A;  3DOK A;  1YBU A;  4FXD A;  4WP8 A;  3UCU P;  3DRR B;  1NJI T;  3KWM A;  5U47 A;  1FRJ A;  3S7R A;  2JEF A;  3IG1 B;  2ZIT A;  4L75 A;  2I1R A;  1SB6 A;  5C7P A;  1XC9 A;  3CNQ P;  1MRO A;  3ETM A;  4KQZ A;  4Y34 A;  4ZIV A;  3ZZY A;  4ZJL A;  3F56 A;  3C6T B;  3MMB A;  4IOB A;  1C0T A;  3NCP A;  3O44 A;  4ZPD A;  5KTQ A;  3PW0 A;  2HS0 A;  5C24 B;  2VJU A;  1S6Q A;  3FBF A;  3L3C A;  5LXR A;  3CCL S;  2FZG B;  2DXF A;  1QA2 A;  1H72 C;  1NPP A;  2B4U A;  2RH3 A;  2M5Y A;  3HHL B;  4XPE A;  2OP5 A;  3KK2 A;  2E5L J;  5KFF A;  4ELU A;  2XMV A;  4N56 A;  1F9H A;  4RW4 B;  4EW9 A;  5L1I A;  1UZH A;  3CC2 S;  4HH0 A;  3DGP A;  4UTG A;  2ZOF A;  4KGZ B;  1DTQ A;  2ZKT A;  3PHT A;  4XTT A;  1KTW A;  1OGO X;  3QRQ A;  3I5A A;  3C66 A;  1U1N A;  2B4V A;  4QJV A;  2NXN A;  3SY2 A;  2CAJ A;  2KT5 A;  4A8Y A;  5GMK a;  2VH7 A;  2QLJ B;  3DXB A;  3CJR A;  3FEY B;  2AHO B;  3T9G A;  1YTY A;  4RNF A;  1PSD A;  4HKQ A;  1LKZ A;  1UEV A;  2HSE B;  3TJA A;  4QU7 A;  1NKB A;  3RW7 A;  2J8K A;  5SUH A;  3CDE A;  5DQG A;  3TAN A;  1UVK A;  4RW4 A;  1AZS A;  1BQX A;  2HBY B;  3A8K A;  3HVT B;  4JP8 A;  4B9N A;  1B7Y B;  2FIU A;  3QFW A;  4QW9 A;  1DTQ B;  1IXK A;  2EG2 A;  5HBM B;  3I4P A;  5I4M A;  1TMM A;  4E98 A;  5CA5 A;  4WJB A;  2EK1 A;  2YKA A;  3ISN D;  4F4Z A;  1RHQ B;  1KTV A;  4K0K F;  1JK9 B;  3BKF A;  4ED7 A;  3ELH A;  1N48 A;  5EX0 A;  4ZN1 A;  3M8P A;  5C2G A;  4U95 A;  4OL8 A;  3U1N A;  5B09 A;  4IR1 A;  4ZP9 A;  3G6X A;  4DJB A;  2W24 A;  1FRI A;  2GW8 A;  4K2X A;  4OJP A;  3AJ1 A;  3MMA A;  1FDN A;  3N28 A;  2VFN A;  3D6T B;  3Q23 A;  4NI2 B;  1Q7L B;  1REG X;  4UUX A;  5KG4 A;  3O8W A;  2K8G A;  2D3Z A;  1VBL A;  4BC7 A;  1R8P A;  4DUY F;  2V68 A;  2OTL S;  2HVE A;  4DV0 F;  4DR7 F;  2FLN A;  1UWB B;  2M0G B;  1IB4 A;  4UT4 A;  2GFF A;  2O5D A;  4NLU A;  3UPF A;  4Q43 A;  3IRW P;  3ILL A;  1XTZ A;  2B9Y A;  2LXU A;  4DDF A;  2V2Z A;  5EN1 A;  2KH9 A;  2IBK A;  2VIH A;  3HP6 A;  2JFK A;  4KR0 B;  2HMI A;  2EVZ A;  5C5J A;  2YKN A;  4ZS6 A;  2MHN A;  4O3P A;  2PEB A;  4FN5 A;  3VGV A;  3VAI A;  2E9Z A;  1CQM A;  1FNX H;  2QJ3 A;  2MB0 B;  3QAU A;  3R5A A;  4LFA F;  4A8K A;  3EIC A;  2D7S A;  2PMH A;  4HL9 A;  1FE4 A;  4WII A;  5IT0 A;  2YNF B;  3I0S A;  3PRV A;  5K14 B;  2W9C B;  2Q1L A;  5AE2 A;  2B4P A;  5LSL A;  2R2R A;  3GQ7 A;  1RT7 A;  4X4T A;  4DV1 F;  1RTJ A;  2ZOM A;  1WHX A;  1TQL A;  5FDL B;  1YRU A;  1VI7 A;  2CPH A;  1K1Q A;  1J2V A;  2IM1 A;  3CCZ A;  3DRY A;  4R0E A;  4WK3 A;  2HGM A;  2ZC4 A;  1NJW A;  1IKV B;  1B0V A;  4ID8 A;  2RQK A;  3BV8 A;  4DX8 H;  2DGV A;  2RKI A;  3LAL A;  1IBL J;  4DR4 J;  1SKU B;  3D67 A;  1XMO F;  4IG3 B;  4OFZ A;  3AQP A;  2IIH A;  3MD1 A;  3THT A;  2B43 A;  2RDJ A;  4KHP F;  1UP1 A;  4L73 A;  3T3F A;  2FGC A;  2JH3 A;  2OPQ B;  2LQJ A;  2BKN A;  2WOM B;  2VA3 A;  1EZZ B;  2BRL A;  3MPD A;  3TZX A;  3GJT B;  1OMS A;  2HFU A;  3D1O A;  1EX8 A;  2XSF A;  1PE9 A;  3FQK A;  1RT7 B;  3VGS A;  3WX8 A;  4RNN A;  3PX6 A;  2KZZ A;  3BO4 A;  2FLL A;  3TEG A;  4ZKA A;  3BRE A;  5LOQ A;  3N90 A;  2LYV A;  3UDL A;  2F3L A;  1QTN B;  2EFN A;  3DLB A;  1MU2 A;  3AJD A;  4DFP A;  1QE1 B;  5CYQ B;  3T1H F;  1K44 A;  1O8L A;  2RDD A;  5KFO A;  1R7I A;  3AJ2 A;  3CT9 A;  3GFX A;  3EPG A;  4E8U A;  1X5P A;  4XKV A;  4DV7 F;  2EG1 A;  5KFH A;  5EWG A;  3RB0 A;  4RU2 A;  4USM A;  1SIW B;  1UVI A;  3P45 B;  3NG8 A;  2XGP A;  3K5N A;  3KNA A;  5KFE A;  2AF6 A;  4USH A;  1CUL A;  5KFV A;  2LA4 A;  2E9T A;  2EKY A;  4PG6 A;  2RUS A;  3RAM A;  2RRA A;  4DBQ A;  3OUY A;  1HBU A;  2A0F B;  1FKO A;  1FX4 A;  3I4H X;  4WFZ A;  4LFB J;  4FP9 A;  2VDH A;  3RRK A;  3PTW A;  2WB1 D;  1S57 A;  1ZAW A;  3GMG A;  1M90 T;  4OX6 A;  1LXJ A;  1KSP A;  2CQ0 A;  4K4V A;  4Z05 A;  3CB4 A;  2WVC A;  1B0P A;  1MNE A;  1KOH A;  2XQC A;  2HHX A;  3MUM P;  2M8H A;  2B6A B;  1FWK A;  4U9R A;  4Q5V A;  3H5S A;  1N34 J;  3GU0 A;  2DNP A;  2UXD J;  3PIP Q;  2BJ1 A;  1WG1 A;  1GAO A;  3U27 A;  1UA1 A;  3DN9 A;  2FJV A;  4HT7 A;  2W9B A;  3NS6 A;  1DFD A;  3CMQ A;  3IWX A;  4TYA A;  4KGK A;  1NHU A;  1V5V A;  2WBM A;  4KIA A;  1BWV A;  4CT8 A;  3VWS A;  4F3Q A;  5HVH A;  2VG5 B;  2VC1 A;  4F3O A;  1NBE B;  1J5E F;  3DDN A;  4U49 A;  3VGT A;  1FJ7 A;  3MMA B;  3EGZ A;  4DPW A;  3BGR B;  1HKA A;  4NLT A;  4ZPA A;  2RIJ A;  1PIE A;  3MPV A;  2HYI B;  3NNH A;  4DU7 A;  4XMY A;  1KVK A;  4JV2 A;  1YG0 A;  3R27 A;  1U45 A;  1OYE A;  4TLQ A;  3SFG A;  2IVY A;  3DGV A;  2Z2L A;  1F5B A;  3AQO A;  5DG8 A;  3M6V A;  2Z8G A;  1F1B B;  1GT8 A;  3NCR A;  1HL6 A;  4DL6 A;  3DLK B;  2XWY A;  1R0A A;  1SV5 B;  4OZZ A;  2XHW A;  3GQ9 A;  4C2M A;  3SUC A;  1O8J A;  3TVK A;  1BQN A;  3IMQ J;  3AA8 A;  2DNZ A;  1LFP A;  2QYC A;  4GC6 A;  3GV8 B;  2GIQ A;  4LRD A;  5FLX U;  4QPT A;  3IS9 A;  4RUH A;  1HNW J;  3I87 A;  4ZLL A;  3N6M A;  1RT2 B;  2CQB A;  5E2Q A;  1RKI A;  3MR5 A;  2E9R X;  1FFW B;  2QFJ A;  2R7T A;  1X4B A;  2AWZ A;  2W9A A;  3OW2 R;  1R6Y A;  2CQ3 A;  3GQA A;  1S1U A;  4XLH A;  2E66 A;  2JVO A;  4DQS A;  4EI2 A;  3W60 A;  1OPI A;  1FRL A;  5EDW A;  2AD9 A;  2M88 A;  3DYA B;  2V69 A;  3PEH A;  3IBC B;  3NY0 A;  2VFM A;  3DLL Q;  3TP2 A;  3JQK A;  2HWH A;  4NPO A;  2KJV A;  3DXS X;  3LWM A;  5F8L A;  2VFS A;  4WXO A;  3RBE A;  1B3T A;  3T9N A;  5KFD A;  3B4N A;  4ZVE A;  2MPU A;  5KFI A;  1S4E A;  1ZOT A;  4C48 A;  1R27 B;  3DGP B;  3FBE A;  4OHW A;  4RZR A;  3LP2 B;  1KLM B;  5T41 A;  2NSB A;  8AT1 B;  3QGG A;  4OJ3 A;  5ETM A;  4K4S A;  3GTY X;  2JX2 A;  1P9Q C;  1J27 A;  2G0Y A;  1PGZ A;  3KLH A;  2KG1 A;  3NAH A;  5F0W A;  2HND B;  2R2S A;  4GKK F;  4HVZ A;  2M70 A;  3AXK A;  3HSZ A;  1K1S A;  2DT9 A;  1RT2 A;  1TAU A;  1YK9 A;  1O8H A;  4C8Z A;  1QD1 A;  1XMO J;  4W8Q A;  2V4R A;  4NXN J;  4OYA A;  5J2N B;  4N5S A;  4DSK A;  2IDL A;  2EXU A;  5J2Q B;  1I6J A;  2OLW A;  3QT5 A;  4KKO A;  1U26 A;  3NBP A;  2INU A;  3UD4 P;  1Y5I B;  1KWM A;  4ERD A;  3CMA S;  2GVD A;  4NLG A;  1UVL A;  3KK3 A;  4LMZ A;  1N8R T;  5KFW A;  4Q0B B;  3TAP A;  4NX9 A;  1O8B A;  1J5E J;  2RF2 B;  1FDB A;  4EZ6 A;  1Y5L B;  3K17 A;  4B9T A;  2H65 B;  3CWJ A;  2V4J B;  1NHV A;  2CNL B;  4IQM A;  1IBK F;  1OSC A;  3MED B;  4RWW A;  3PET A;  2R7O A;  3DOM A;  2PMW A;  2KXH A;  4USJ C;  4DN9 A;  1RHJ B;  4NA2 A;  3J7Y I;  3VAG A;  2PC6 A;  3LOU A;  2NLW A;  3NGK A;  2CQP A;  2G1D A;  4PPD A;  3UW0 A;  1TK8 A;  3J7A N;  3BQ0 A;  4AT1 B;  2BAN B;  2DD8 S;  3MM5 A;  2AX0 A;  4XLC A;  3D7S B;  3OFH A;  1NH8 A;  3R6L B;  1WG4 A;  4HAC A;  4I69 A;  4QIE A;  5IT9 U;  3EDQ B;  1RA6 A;  1T02 A;  3R97 A;  4ZHR B;  2MST A;  3KHL A;  3O6Q A;  4Z37 A;  2DRB A;  2R8I A;  1H7W A;  4DR6 F;  4X64 F;  5HLF B;  4KE5 A;  2MTL A;  2NQP A;  4I4B A;  3UI3 A;  4C8Y A;  4W90 B;  5LMU J;  1FJE B;  3KK3 B;  4FBT A;  1N5T A;  2JRS A;  1X5S A;  2UVE A;  2Z4P A;  4CH7 A;  3FRY A;  3HZE A;  4YB7 A;  4V19 J;  2P9E A;  3DLE B;  1JJ4 A;  2X6Y A;  2HGN A;  5K8P A;  2H3E B;  1NO8 A;  2YWW A;  5IV4 A;  1RXO B;  3H40 A;  2ASD A;  1JLB A;  4Y2K A;  1T0T V;  3CJK B;  1UJ4 A;  1KC8 T;  1KQF B;  2DHG A;  2MZS A;  1X60 A;  3KLE A;  1IKY A;  1UW4 A;  3B54 A;  1S6P B;  4ANC A;  3ILI A;  3H4D A;  3TAQ A;  4G3I A;  3W9I A;  3G96 A;  1M0S A;  2B3T B;  5DLF A;  1U4B A;  3FCW A;  3MEG B;  2V2K A;  3JUR A;  2FJD B;  3L7U A;  4I2P A;  3W62 A;  4B3M J;  3M6U A;  4NA3 A;  4DPO A;  4LF8 F;  4B3O B;  4YR0 A;  1APS A;  2CFX A;  3W2V A;  2XMJ A;  4H4O A;  4KT0 C;  3SDE B;  1FJG F;  3PV8 A;  2BEF A;  1M5S A;  4FZV A;  5B08 A;  1UVJ A;  2WB4 A;  1RAO A;  3G8Q A;  3JS9 A;  4I6A A;  4OYO A;  3NGD A;  2P2C B;  2W4C A;  1OOC A;  1YJ7 A;  2UUC J;  5E0O A;  4O3S A;  3TUJ C;  4F4W A;  3KXD A;  3NWG A;  1JLB B;  2HQ3 A;  2C3P A;  3CJK A;  4UQG A;  3MMC B;  1D9D A;  4KTQ A;  4B9U A;  1HNV B;  1G7C B;  2DNO A;  3ENV A;  3M2U A;  1WWH A;  3OPK A;  3PEJ A;  3SQG B;  3CC7 S;  2F63 A;  3JSY A;  1ITP A;  1OFM A;  3EQN A;  5KFX A;  2QL5 B;  2YBV A;  3QAT A;  2MGZ A;  3NXZ A;  4LR9 A;  4LVO P;  1NH7 A;  1FVQ A;  2ZD1 B;  1JLQ B;  2XY7 A;  3V6D B;  4OYI A;  3ZZT A;  3ZTS A;  5T7L B;  3T1A A;  1FHT A;  4B3R J;  5B0E A;  4PXC A;  4FF1 A;  4I0W A;  3RW6 A;  4CWB A;  1YIJ S;  1FO1 A;  2PO4 A;  5B0C A;  3DMJ A;  4TN2 A;  3UR0 A;  1Y7P A;  3VAH A;  1HYS A;  3JQM A;  4Y2C A;  1GH8 A;  1WC3 A;  1AUD A;  1MML A;  4ICL B;  2JEG A;  4J9M A;  1Z2L A;  3WC2 A;  3KK1 B;  1FKP B;  1WSR A;  2RRB A;  2LEP A;  4A47 A;  4B3T F;  1TSP A;  2VFU A;  2B0R A;  4GO7 X;  1D0E A;  2HNY A;  4J9K A;  3D4J A;  4Q7A A;  4K50 A;  4DQI A;  1Q8I A;  4FNI A;  2NPI A;  3HLU A;  1OIA A;  1OQ3 A;  5BR8 J;  1TL4 A;  3MPW A;  1S9E B;  1RA7 A;  4DI6 A;  1ULR A;  2YQ1 A;  4R0J A;  3IA0 A;  4F0K A;  5GAE U;  5C1C A;  3C8Y A;  1M5K C;  3FMW A;  1KR4 A;  1XMB A;  2UUB J;  4KHR A;  1UTA A;  3FK4 A;  3M1V A;  4LR7 A;  4MK9 A;  3AAW B;  3UDV A;  3SI8 A;  2NTQ A;  1SIZ A;  4PWD B;  5D8H B;  3MEE B;  5F9N A;  3MM8 B;  1DUR A;  1UFK A;  2NUH A;  2W2P P;  3KUH A;  3TI0 A;  1HR0 J;  4I68 A;  1RTH A;  4ZCM A;  2HK2 A;  3H8Y A;  3GYX B;  3U1M A;  4UOG A;  3PR5 B;  1JLG A;  3QBC A;  3LJY A;  4C3M A;  2RB7 A;  4Y2M A;  5I3U B;  2J0W A;  3D0H E;  4J9V A;  4MIA A;  5H9F J;  4LF7 J;  3CJ8 A;  3I9Z A;  5DZ7 A;  3FUY A;  5GAD I;  4MJK A;  5KT6 A;  4K4X A;  1BMQ B;  1FWL A;  5A6W A;  4DCO B;  1N6Q B;  1T8E A;  4FF4 A;  2W7P A;  3MDF A;  2WW4 A;  4DUY J;  2HHQ A;  3K58 A;  1H74 A;  4LQ3 A;  3QID A;  5DRK A;  2HFV A;  4OM9 A;  5JMN A;  4CYU A;  4UOC A;  2CQD A;  1Q5Y A;  3T1H J;  4WZM A;  1Q0N A;  1BQM A;  1O8K A;  5KFK A;  1O8I A;  3GFY A;  1DLO A;  2OEK A;  3EWG A;  3Q8R B;  1U6Z A;  3GFZ A;  4QWB A;  4A8X A;  3TUP A;  4LF2 A;  1ICE B;  1X8D A;  3FFI A;  1N33 J;  3JX8 A;  1QE1 A;  3I6P A;  2BZ2 A;  2QZ8 A;  4NLR A;  5CYQ A;  1OYD A;  3SYZ A;  4QWA A;  1KFD A;  5J2M A;  3P49 B;  1IUJ A;  3LAK A;  4RBT A;  1HBU B;  2QA1 A;  3CED A;  1Q53 A;  1S1T B;  1T11 A;  2J8A A;  1OFE A;  2QO3 A;  3OXG A;  4MKA A;  1VJQ A;  1VQS A;  2AJF E;  1S7H A;  2P8I A;  2D9P A;  2GGP A;  2V34 A;  4K4U A;  1RT3 B;  1VQO S;  2I9S A;  1IDK A;  4K4W A;  1SUQ A;  2XZT B;  2DR8 A;  2F5G A;  1RT1 A;  2CWK A;  4RR5 A;  3UD3 P;  3HSJ A;  4ED8 A;  2ZUG A;  1CEZ A;  4XK8 C;  1MRO B;  2XTW A;  2LA6 A;  4TQR A;  1FXL A;  5B0G A;  2N3O A;  4LF9 J;  2E5H A;  4OMF G;  2PI5 A;  4W98 A;  4URS A;  1C0U A;  3R7S B;  3CJT A;  3C6T A;  3MMB B;  3SBM A;  2ZH9 A;  4M5K A;  4LRF A;  4DZ6 A;  2D74 B;  4ECW A;  4MFB B;  4P72 A;  3GIL A;  3OVB A;  4B3O A;  3MCO A;  2MKS A;  3D5M A;  4K8R A;  2YWG A;  4FXW A;  5IM0 B;  3ILJ A;  3CDA A;  4NLY A;  4XDD A;  5HJY A;  1LV5 A;  4JI1 J;  5E33 A;  1G2E A;  4KC5 A;  3PW4 A;  1S0O A;  3NEK A;  3W5Y A;  2AGO A;  2FLP A;  1EZG A;  1K8F A;  4C8K A;  5D3G A;  1FEE A;  1WOR A;  4X62 J;  2K7K A;  4OX8 A;  3VCD A;  5LMN J;  1PYO B;  1HIY A;  1CS4 B;  2GCF A;  5A8W B;  2QYU A;  4YZQ A;  1AXQ A;  2A2D A;  5BR8 F;  1JXL A;  1HR0 F;  4B3S F;  2LEC A;  2YKN B;  3NS5 A;  2KO1 A;  2KYX A;  4Q45 A;  2O1P A;  2B8Q A;  4OI3 A;  3IXQ A;  2W9C A;  1RB0 A;  4BLG A;  4WKR A;  2VG6 B;  3BBB A;  1VC5 A;  4ZVU B;  1RT1 B;  2IHR 1;  1RTI B;  2I8E A;  4HH1 A;  1FRK A;  1N88 A;  1T94 A;  2Y3Y A;  2YWF A;  1HNX F;  2WVF A;  4LSN B;  1N32 F;  2FLO A;  4ICL A;  2GMJ A;  3QT6 A;  2VBE A;  3WBZ A;  2MZT A;  1XMQ J;  4USK A;  1P8G A;  4NLQ A;  1X0C A;  1LWX A;  2YUH A;  2AKW B;  3M30 A;  3N01 A;  1PO6 A;  1CPZ A;  3OJU A;  1WD6 A;  3T9Z A;  3MED A;  2AGQ A;  2EWH A;  5A6P A;  1ZBT A;  2FZK B;  3BPS P;  3BSC A;  2V8G A;  4IO1 A;  1JJ2 R;  4LFB F;  2HBQ B;  4BBY A;  1NEE A;  4G1P A;  3KUG A;  3MAQ A;  4LF4 F;  2VFV A;  5CCL A;  4AND A;  5KFJ A;  2CDQ A;  3R3T A;  5F9L A;  1RWP B;  4DR3 J;  3KG4 A;  4LF5 J;  1TKX B;  1JLC B;  2AYM A;  2JZ5 A;  2WSF C;  1UWA A;  1IR0 A;  2GX8 A;  3TVY A;  3UO0 A;  1MMN A;  3PX4 A;  3NOG A;  4NCG A;  4WP3 A;  5E7O B;  1EET B;  2W01 A;  4BDP A;  3J7Y U;  2FJE B;  2JDJ A;  3TH0 A;  2Z57 B;  5F3Z A;  4C0H A;  1IBC B;  5HVG A;  2UUC F;  2DIU A;  4NI2 A;  1TUV A;  4ZK7 M;  5HO4 A;  4KH3 A;  3HM9 A;  1XQI A;  4W8R A;  4NE9 C;  5GAG I;  2ERR A;  1YJU A;  1MSW D;  2I5J A;  1D3W A;  4OYM A;  4DHV A;  4DZD A;  3MR3 A;  4KRW A;  2C3O A;  3ENW A;  5D0E A;  5DJB A;  4F8R A;  1KCC A;  2RML A;  4ECZ A;  2G0I A;  2JVR A;  2PE8 A;  4S0M A;  5J2N A;  3J80 U;  1CJU A;  5J2P B;  4ZP6 A;  4QYZ K;  1PAU B;  2HAI A;  2VJV A;  1TKZ A;  1RP5 A;  2V6A A;  5DS7 A;  3T5H A;  2W7Z A;  1BWE A;  2L48 A;  5LJ5 Y;  3I56 S;  4CH1 A;  4ECT A;  2DHH A;  1HW9 A;  2YKM B;  1JJH A;  4MIB A;  3N6Z A;  3DLJ A;  4P2F A;  2MQL A;  3CJ4 A;  2BMB A;  3KTQ A;  1N32 J;  4ILL A;  5CAA A;  4DV3 F;  1CZF A;  3GJQ B;  2MQN A;  4P74 A;  4LVN P;  2MY8 A;  3NCQ A;  1T3O A;  2W9B B;  1IQT A;  2ACM A;  2ZEJ A;  4IOA Q;  4MXN A;  2CNK B;  3R2D J;  2A1B A;  4Z03 A;  2E7W A;  2L3M A;  2YWE A;  2M3D A;  3QLH A;  5CZV A;  4GKJ J;  2KTQ A;  4HTI A;  1PXZ A;  3CME S;  1RAG B;  2CZ4 A;  2BX6 A;  3PRD A;  3LGH A;  4FYY B;  4LF1 A;  2EBE A;  4DV4 J;  3PHE A;  4YR3 A;  2Q6C A;  1C1C B;  1XG2 A;  2RS8 A;  4CM0 A;  2M8D B;  4U67 Q;  3DCA A;  3GR1 A;  3K5O A;  4WTY A;  1NME B;  2MEW A;  5ETL A;  3DU1 X;  4L76 A;  2BAN A;  3MM5 B;  1U2F A;  3I0R A;  5ETS A;  5G0R B;  3DLK A;  1AA1 B;  1R0A B;  3F44 A;  2VV5 A;  1S0M A;  2OFG X;  3V4I A;  3S6E A;  3CCU S;  1X5T A;  3HHL D;  1RTD B;  2MLX A;  4TY8 B;  1FA0 A;  5E3Q A;  2VQE F;  2LU2 A;  2QV6 A;  3ET6 A;  1AIR A;  1WSV A;  2AEJ A;  3CCR S;  5HP1 A;  1X0F A;  5F0U A;  4NEY A;  4B9V A;  1GK8 A;  3SQO P;  1XNR F;  3DDK A;  3HDS A;  3MHY A;  2DK2 A;  2H5E A;  1TL1 A;  1SC3 B;  4DR5 F;  3K89 A;  2PI4 A;  2AJ4 A;  4LF4 J;  3P3D A;  1VC0 A;  3RGI A;  2BR0 A;  1U8S A;  4CO2 A;  4I56 A;  1SJF A;  2ATC B;  2M7S A;  4IH7 A;  5KAK A;  1FWP A;  4M5D B;  2CPD A;  4DFJ A;  1CS4 A;  5L1K A;  3IC1 A;  1U1M A;  3CJ3 A;  2ZH7 A;  3FDS A;  1CSJ A;  4QWE A;  2UXC J;  1RAI B;  4ALZ A;  1RT4 B;  5KFS A;  2GHP A;  4OQJ A;  4CRJ A;  5E41 A;  1KKH A;  4OI2 A;  2HBR B;  3OHA A;  2XEX A;  3HD1 A;  4EBC A;  4PRF A;  1HBM B;  2GJI A;  3Q86 A;  2KHC A;  3W2W B;  3C2P A;  1H0H B;  3N5F A;  2BXJ A;  1NKE A;  2PD1 A;  5CYM B;  4GVB B;  1OS5 A;  4DU8 A;  2UVV A;  3MPY A;  1BC6 A;  4PWW A;  5F41 A;  1FVS A;  2AEM A;  2CQ1 A;  4CDI A;  1IKW A;  2KJW A;  4YUD A;  4J9R A;  4RUB A;  5BYQ A;  1FKA F;  2ZJQ Q;  3MCN A;  5L9N A;  1RTI A;  4C8L A;  4NK6 A;  2CJ9 A;  2V5H G;  3QZ7 A;  2C2N A;  4DFM A;  4OIX A;  2HND A;  2HFZ A;  2OPP B;  2V9K A;  2MLY A;  2Q66 A;  4E0D A;  2W7O A;  1WI8 A;  4R25 A;  1W25 A;  3M30 B;  4GKJ F;  4QYZ J;  3UNY A;  3DLG B;  3PO5 A;  2BJ8 A;  4DR4 F;  1CJT B;  2QGF B;  4AUK A;  4DR3 F;  1N54 B;  2LCW A;  1F6T A;  3WQP A;  1BUX A;  4MR0 A;  2QZA A;  2F8E X;  2VFT A;  3N79 A;  3N4W A;  1V3Z A;  4RPF A;  1RMG A;  1UAW A;  3UDC A;  5GAG U;  5L46 A;  3BQ2 A;  1NXI A;  4KHP J;  3MEC B;  1IKW B;  1SJR A;  4NRU A;  2KKH A;  4OHV A;  1BXN A;  5E3R A;  2N82 B;  5J2M B;  3QRR A;  4QU6 A;  2AJ2 A;  5AE1 A;  4BC9 A;  2QC3 A;  3OFE A;  4YB6 A;  4JYA J;  2XMU A;  3KLF B;  1RHK B;  2AP6 A;  3S1T A;  2KL8 A;  3M6X A;  2IJR A;  1NSK L;  2BRK A;  2ILY A;  4DL0 C;  3IGN A;  3KRG A;  3CJ5 A;  3BEG B;  1HBN A;  2GS8 A;  2J7K A;  3EGV A;  4FS2 A;  1M5O C;  2PEH A;  2BKO A;  2HZC A;  3ZZP A;  1KVJ A;  1H6K X;  2HKE A;  5IWA F;  3KMS A;  4JI4 F;  1WHV A;  2W2M P;  3P4G A;  2RIL A;  2WZ1 A;  1TMJ A;  3UWT A;  4C11 A;  2DH8 A;  1O88 A;  3W8G A;  4NXM J;  5AMV A;  2WRM A;  3LAN A;  3MF5 A;  5SZT A;  2V4Q A;  3NGS A;  3QJP A;  5M2P A;  2XWX A;  4UW2 A;  1DQ8 A;  2CKW A;  1YJR A;  4U96 A;  3OVA A;  2YNG A;  2DO0 A;  4RL1 A;  1LNQ A;  1R43 A;  3MXH P;  1ROF A;  2QFI A;  2B7C B;  2KN4 A;  2ALY B;  3R5B A;  3AB4 B;  3K8W A;  6FD1 A;  4X4P A;  4U7U K;  2HNZ B;  3T41 A;  1BHN A;  3ZTP A;  5G0R A;  4HDG A;  1WKK A;  3PXG a;  1PJ6 A;  1QSY A;  1VK3 A;  2NXE A;  3K57 A;  1C2P A;  1QA3 A;  1GTH A;  4PAB A;  3ZNJ 1;  3Q0A A;  4Q0B A;  5HP1 B;  1CC7 A;  2BE9 B;  1UWB A;  1BQM B;  4KV8 A;  4NLV A;  1RWV B;  3H90 A;  4EMD A;  2R2U A;  5EWF A;  3CCV S;  4WBF A;  1ELO A;  1YX2 A;  1PBA A;  3TQ1 A;  3Q83 A;  2PFF B;  4YEL A;  1RIS A;  1F2H A;  1XK8 A;  4PQA A;  3T5K A;  2YTC A;  2O0W A;  4HHH A;  5KG2 A;  2HQC A;  3M9N B;  2JWN A;  1RLD A;  2AJ1 A;  2RU9 A;  3CD6 S;  1FFG B;  2H4Y B;  1IJE B;  5GME A;  3V2U C;  1Q1K A;  1FKO B;  2E7V A;  3QAE A;  4M5I A;  1L1I A;  4DF8 A;  1I94 F;  4JI2 J;  4K4Z A;  3LPY A;  2VDI A;  4NK8 A;  3QO9 B;  2VBM A;  5JVG Q;  2OMO A;  5LSO A;  3D6M B;  1N56 A;  3TVZ A;  3V5R A;  3ZTQ A;  2QA4 G;  3H5Y A;  2B4O A;  1VRQ C;  3SIP B;  3TJ9 A;  4A8O A;  3DFE A;  4C0O C;  2BOP A;  2KB2 A;  1B64 A;  3GYN A;  3OTO F;  3E2E A;  5FLX Y;  1F0X A;  4XLA A;  2IAJ A;  2ZWO A;  1HFE L;  1XWL A;  1NDL A;  1YDL A;  4DL5 A;  2BQ3 A;  2WW8 A;  2F9D A;  4CTA A;  5EHH A;  4YOE A;  2EK6 A;  5LXY A;  4DV7 J;  3SQG A;  1SV5 A;  2KVI A;  3FSI A;  4OZ1 A;  1Z2Z A;  3VV2 B;  4PEO A;  4ZLJ A;  3MMC A;  4QWC A;  3GIM A;  1I5O B;  2ZNY A;  4ELT A;  2DCU B;  1HAR A;  1HBM A;  2FY8 A;  2G1H A;  1HI1 A;  2J9C A;  2V2V A;  3MGJ A;  4FYV B;  4JB8 B;  5D0G A;  4BWM A;  3K5L A;  3KHR A;  3B8H A;  1R8C A;  1JLF A;  3D6F B;  3SV4 A;  4X2B A;  1K0T A;  1U6B A;  5HBM A;  5ETV A;  2VU5 A;  1V3R A;  3QQC D;  2HQG A;  4Z2X A;  1PYS B;  4TU9 A;  3OL6 A;  3QGP A;  2IYI A;  4QIG A;  3G4S S;  2R8J A;  5MLC V;  3EE3 A;  2G2Z A;  3CDB A;  3B6B A;  5I42 A;  1JLA A;  2N4C A;  2QLX A;  3R5D A;  4F04 B;  5M2R A;  5KFP A;  1KFS A;  1CJT A;  1V9O A;  2DTJ A;  4HHJ A;  4EEY A;  4CI0 B;  1E6V B;  1L3T A;  5KG1 A;  2DPJ A;  2Y9H A;  1ZM2 A;  4ZP7 A;  1TYX A;  3NS7 B;  1VJW A;  4DR2 F;  3WIV A;  1WKL A;  4DSI A;  2ZC3 A;  4QIW D;  2DNG A;  4FNH A;  4A8W A;  4HEA 9;  5KG0 A;  3JAM Y;  4J9O A;  4DCJ B;  3NL0 A;  3GIJ A;  3IAM 9;  1HNW F;  5HQM A;  3CXC R;  1HD1 A;  3JB9 k;  3SYJ A;  3W8P A;  4C3K A;  2W7A A;  1YJN S;  1FTC A;  2GQ2 A;  2GQQ A;  2NXU A;  5ETT A;  4DR1 F;  1TV6 B;  2QN6 B;  4AFF A;  5F8N A;  3IFE A;  3IM9 A;  3NGR A;  2CDR B;  2VPW B;  3LGN A;  1JX4 A;  4G65 A;  4AYB D;  4JI1 F;  1VLY A;  3AD9 C;  2VPZ B;  3I31 A;  3MCM A;  2EFO A;  2XT4 A;  4QW8 A;  3V4M A;  4O0I A;  1TFW A;  2X6X A;  1PIL A;  2WAQ D;  3CCS S;  2OEM A;  3MM9 A;  1XNQ J;  4F7V A;  4LR8 A;  1Y10 A;  5B0F A;  4DLG A;  2HZA A;  4F36 A;  1KD1 T;  3MEE A;  1REV B;  2OAU A;  2UVF A;  5JUM A;  3NP5 A;  3C14 A;  1CJV A;  4DX5 A;  2QA2 A;  3BF4 A;  1HNI A;  2GVD B;  1HMV A;  2JSX A;  3RYL A;  5K8O A;  2YNH B;  2CJX B;  3NKY A;  5IQQ A;  4R5P B;  2UUA F;  3BN4 A;  4G1I A;  4KKO B;  2O6W A;  4M1K A;  4MYT A;  4W92 B;  2VPY B;  3PW7 A;  5BYR A;  4ZVT B;  1H38 A;  1IBK J;  2VB6 A;  3CF5 Q;  3K8V A;  2R7S A;  4O3O A;  4ETX A;  1N52 B;  2VKR A;  4KJI A;  3B78 A;  2DHS A;  3O1L A;  4B08 A;  4KFB B;  2RD5 C;  1VQ7 S;  2ZE2 B;  2B9X A;  3BSO A;  1GNK A;  2DB1 A;  5HMY A;  3AD7 C;  3D66 A;  4DX7 A;  1RT3 A;  2I5J B;  4GO5 X;  1GX5 A;  4LIR A;  4N41 A;  2M2B A;  2HWT A;  3RRH A;  4PG8 A;  3V81 A;  1RAC B;  2JOQ A;  3MM7 B;  2EEY A;  1Q5V A;  1X5O A;  4CP5 A;  1Z1Z A;  2LMI A;  4CLS A;  1N5S A;  4DV2 F;  3P6Y C;  2KFZ A;  2DIV A;  2NRE A;  3CDW A;  5HVF A;  3RG6 A;  3DU6 A;  1U8W A;  4NWB A;  4ECY A;  4PPZ A;  2L9N A;  2RUG A;  2Z2Z A;  5GMD A;  2IMW P;  4YY3 F;  2VFP A;  5HAO A;  4KO0 B;  3G82 A;  5AXL A;  3SSS A;  2GA7 A;  3E8O A;  4F26 A;  2VIC A;  1MN7 A;  2A2C A;  4DV5 F;  1UMJ A;  3TWZ A;  3KUE A;  2C2E A;  2ZKU A;  4HI2 A;  2K3K A;  2QIF A;  4JOU A;  2BBE A;  3QLH B;  3NGU A;  1Z4U A;  1VBZ A;  3OFG A;  1RQ0 A;  2FVR A;  2BA9 A;  4TNO A;  2KXF A;  4ZLP A;  4QPX A;  1TK5 A;  1WXR A;  1HNZ J;  1OFD A;  2XMT A;  3AOA A;  5IZH A;  1S1W B;  4RX6 A;  4LFC J;  1RT6 A;  5KG3 A;  4YZ0 A;  3CUN A;  1RHM B;  3HKZ D;  5KFT A;  5C1E A;  3CCW A;  2C2Z B;  4R8U B;  5D6G A;  1F2G A;  2CXE A;  2DR6 A;  3DYA A;  2R42 A;  3RBZ A;  4IH6 A;  1JLF B;  2KDO A;  4ZPT R;  1IBM J;  4EZ9 A;  1JLG B;  2VBZ A;  5CYJ A;  5I3U A;  2YKP A;  4CYU B;  1DBO A;  5E5N A;  3RZA A;  2LDI A;  2G13 A;  4MMO A;  2QEX S;  4FYX B;  1TKD A;  4DXL A;  4CT9 A;  2ROG A;  5HMX A;  1NPK A;  1XR6 A;  1N6Q A;  1VQ4 S;  4C6A A;  1S1X A;  1WNE A;  3HI9 A;  2A6M A;  2R7Q A;  2Y0B B;  4O0N A;  4C98 A;  3GE9 A;  2OJ3 A;  4LF6 J;  3D3C J;  2IOU G;  2XNQ A;  3GON A;  3W9H A;  1IWA A;  2W2N P;  4RBU A;  5L39 A;  3FBC A;  3OL8 A;  1JWW A;  3QIP B;  3LUY A;  3EX7 B;  3FC9 A;  3IM8 A;  3PO4 A;  1MN9 A;  1OSD A;  1URR A;  1BD6 A;  4B3R F;  5BXI A;  3MAH A;  2HVZ A;  2NYI A;  4OJ1 A;  3ILO A;  3F0N A;  4M5N A;  1RWO B;  4I6Y A;  3MOJ B;  3ULH A;  1WOO A;  2ZBC A;  4F2S A;  1KQK A;  2E1R A;  3MOZ A;  1TKX A;  1FES A;  2EFP A;  1U02 A;  1EQ0 A;  1S5Z A;  1O8G A;  1XN9 A;  4OJO A;  5GAH I;  2MJU A;  1CC8 A;  2O67 A;  1WF1 A;  4OYW A;  2B56 A;  2KT3 A;  3TRG A;  4DF4 A;  4KAI A;  4WXW A;  1SI9 A;  1NRK A;  2NSP A;  5CAB A;  5DLG A;  1ZET A;  2Z2M A;  2NT9 A;  3PYD A;  2HNY B;  2NTP A;  4IKA A;  4CLU A;  4FVC A;  2JL9 A;  3IWL A;  3R5J B;  2J8S A;  3DRX A;  4WTO B;  2F4F A;  3E01 A;  2HG4 A;  2HPU A;  3KK1 A;  1L3S A;  5JMC B;  2E1P A;  3OBI A;  4FKY A;  4GMK A;  4MTP A;  3EGN A;  3ZNU A;  3LGM A;  3KFW X;  1JXE A;  5E3C A;  1QTM A;  3H2L A;  3F41 A;  3M2V A;  1RAE B;  5D4O A;  2KYZ A;  5D4L A;  3QSI A;  4I7F A;  1RCX B;  1XEZ A;  2ZJR Q;  2R7W A;  3KJF B;  2X1A A;  3UN3 A;  2UV8 A;  4CCH A;  4OX9 F;  2HLT A;  4CZC A;  4OI0 A;  2VG7 A;  2HHV A;  2ZZT A;  2YWH A;  2HLU A;  3QWP A;  3QPI A;  2FGO A;  1SJ3 P;  1MWZ A;  2H54 B;  1ZA1 B;  3A8J A;  1VHF A;  2DHA A;  3R5G A;  4FDF A;  4TYB A;  1MMD A;  4F67 A;  2DGT A;  4X66 F;  4J9U E;  3RB6 A;  1O6X A;  2E1C A;  1W2I A;  2AQ4 A;  4P52 A;  3RR7 A;  2MZ1 A;  3LMW A;  1R31 A;  2ACY A;  1DTT B;  3C16 B;  5G4D A;  3C46 A;  3KNG A;  4LIW A;  4UST A;  3KLF A;  3CVK A;  3J7Z 5;  3THV A;  1QAJ A;  1MU2 B;  1Q78 A;  1VDH A;  1RK8 A;  4J9L A;  5CHC B;  2MZQ A;  1SC1 B;  3AOB A;  3NMR A;  2F40 A;  3E51 A;  3OD2 A;  1WDT A;  3OR1 B;  3SCJ E;  3RB3 A;  2UU9 J;  1KQG B;  1UW9 A;  3W66 A;  2OEJ A;  2Z30 B;  3GII A;  1S6P A;  4JV5 J;  3VAF A;  4DPU A;  3T5L A;  2DRD A;  1U25 A;  4O23 A;  4ECS A;  2E7X A;  2CQG A;  3CO0 P;  3RAX A;  4PUO B;  4B17 A;  1A0O B;  5CCM A;  2DGO A;  1LQ9 A;  2Y1R I;  4C3L A;  4RU9 A;  2V8D A;  1FT8 A;  1N34 F;  2UXD F;  2HGL A;  2LP4 A;  3Q8Y A;  5L8R C;  3EPI A;  2P9C A;  2YNF A;  3H20 A;  3I0S B;  5DQI A;  3M2R B;  2C2D A;  4M5H A;  1OPZ A;  4YEI A;  1SH2 A;  1ZZF A;  4JI7 J;  1PKU A;  4A46 A;  4DS4 A;  3GFH A;  1TL3 B;  1UEK A;  2GML A;  3Q8S B;  1DBD A;  1RWX B;  2AV5 A;  5BYS A;  3ZC4 A;  4A8Q A;  2COL A;  1FDD A;  3NLC A;  2VKZ G;  2YX7 A;  1ZA2 B;  2JLF A;  2I6W A;  1IKX A;  3DI6 A;  4I64 A;  4LBI A;  3SZE A;  2A3J A;  2DXE A;  3SEO A;  4YCQ A;  3EYZ A;  2IMO A;  1U0H A;  3CD5 A;  1M5V C;  1F5C A;  1UVN A;  4UY8 5;  2GQC A;  5IT9 Y;  2K06 A;  1YZ7 A;  4PG5 A;  1WTB A;  3M8S A;  3KKF A;  1OY9 A;  2AYB A;  4Y65 A;  5LMN F;  4M5D A;  4ZOS A;  2N7C A;  3M8Q A;  5LJ3 Y;  3O3L A;  4HAC B;  4HI1 A;  3G8S A;  1FRX A;  1NKC A;  1ZH5 A;  2HVH A;  2D41 A;  2DNL A;  8ATC B;  2J8I A;  2LLZ A;  2VC0 A;  1GTE A;  3FCH A;  3MEK A;  2CQC A;  5A8W A;  4XOP A;  3LA0 A;  1RT4 A;  3PKY A;  4DPX A;  3KLG A;  4FF2 A;  1S1V A;  2XS7 A;  3R8Y A;  4WIQ A;  4JI4 J;  3UVJ B;  4H4K C;  2DNM A;  3HVA A;  4WU3 A;  3ETO A;  1JJC B;  1UET A;  1VGY A;  2D9O A;  1KQ5 A;  2NTB A;  3FSX A;  1NZ8 A;  3KJN B;  4DV6 F;  4AQY F;  4NAS A;  3ZO7 A;  4CH0 S;  4ECX A;  5T14 A;  2DHX A;  1M1G A;  3HHL C;  5CQG A;  4JV0 A;  4D3G A;  2MKK A;  3HK2 A;  1HQ2 A;  4J9S A;  2XYP B;  3GP9 A;  5D4P A;  1S0N A;  1AYE A;  3A4T A;  2BM5 A;  3ZZO A;  1TK0 A;  4DOZ A;  3QNW B;  4DFK A;  3MUV P;  3R2C J;  1A6L A;  2LQ8 A;  4XN0 A;  3V4I B;  1RTD A;  1C1C A;  2V0N A;  1X4C A;  3A12 A;  3MEG A;  2BYC A;  4QR2 A;  3TX8 A;  3ZZR A;  3GIK A;  4YS2 A;  4ECV A;  3E01 B;  2W1B A;  5F8J A;  3P4U B;  1SCJ B;  3I0R B;  1HG8 A;  2DY9 A;  3MR7 A;  1TZ0 A;  5B0B A;  2WHO A;  1IWG A;  2MZJ A;  3RUB L;  4IO9 Q;  2DXD A;  2X3H A;  2N4D A;  1UL3 A;  1RWM B;  1L3V A;  2CAD A;  2ZDP A;  2ZH8 A;  4NCG B;  1HWK A;  2RRN A;  3Q2T C;  1FJC A;  1SVD A;  3ZTO A;  2CNO B;  2RJZ A;  4NLO A;  1DJ0 A;  1I51 B;  2C3M A;  3CJS A;  5J1E B;  2MGZ B;  5IFM A;  1WTF A;  1OFL A;  1TU0 B;  2IM2 A;  1CJK A;  2DY1 A;  4O44 A;  3ZPP A;  3ZZZ A;  4QIV A;  1YJT A;  2FHM A;  1H2U X;  1P27 B;  2EC2 A;  2W4P A;  3EMT A;  4M63 A;  2FVC A;  2ASL A;  1SKW A;  1T7P A;  4JYA F;  4OYX A;  1AFJ A;  4NOH A;  5A8R A;  5J2Q A;  4KO0 A;  4Y2I A;  3BQ1 A;  1CVJ A;  2QYG A;  3MI7 X;  5CH7 B;  1U1P A;  4WZQ A;  2NCK L;  3IN5 A;  4CLW A;  2DR5 A;  1AW0 A;  1CJU B;  5KFG A;  5J2P A;  2LQ9 A;  1S77 D;  3PKM A;  2NXC A;  4LBP A;  3D2W A;  2XI2 A;  1NK6 A;  4HT5 A;  2WOM A;  3OTO J;  2ZM6 F;  2YQ3 A;  3K2Y A;  5C25 A;  4DUT A;  2YKM A;  3HFV A;  4Q8F A;  3FMB A;  3AB2 B;  3B4M A;  4F0H A;  4H4M A;  5HMW A;  2ZH5 A;  4EYH B;  1EIY B;  4DSL A;  1JRG A;  3VR1 A;  3GLJ A;  4RNH A;  2BM7 A;  1QUV A;  2EFV A;  3M32 B;  4J9P A;  2P9G A;  5J1E A;  1XNR J;  2J5A A;  2JHE A;  1HMV B;  1QUP A;  4O4G A;  3EZU A;  2XMK A;  2X7I A;  1XR5 A;  2CQH A;  2ZH4 A;  5HRO B;  4UOH A;  3KYL A;  2XT2 A;  2HFN A;  2IYG A;  1HPZ B;  1HWJ A;  3BPD A;  3N5B A;  5CZX A;  4ES2 A;  1V3S A;  4EWT A;  4PAA A;  2BM0 A;  3TO8 A;  3AD8 C;  2I0X A;  4EK2 A;  4DX6 A;  3H59 A;  5A76 A;  2EWE A;  3TX0 A;  2A6O A;  3ZFV A;  4V19 X;  4JI7 F;  4DPY A;  1BN8 A;  2QTW A;  2VZ9 A;  1LW2 A;  2HFS A;  2HWI A;  4X64 J;  2APO A;  3R1L A;  3PJX A;  1JIH A;  1M5H A;  4KFB A;  4J37 A;  3HFZ B;  3G6V A;  4X65 F;  4K5S A;  1DY3 A;  1CQN A;  1LWE A;  2DGU A;  2OEL A;  1CBK A;  2OD6 A;  4I1T A;  2X51 A;  1S79 A;  3DHX A;  1FTR A;  3J80 Y;  2Z56 B;  2MLZ A;  2X3G A;  4OZ0 A;  3TZY A;  2ZBI A;  3DOL A;  5LSR A;  5A2Q Y;  4QWD A;  3KK2 B;  2J0Q D;  1SJ1 A;  1HD0 A;  6FDR A;  5ETN A;  2XUL A;  3MD3 A;  5A8K A;  1K4Z A;  3H25 A;  1N5Q A;  2O01 C;  1QSS A;  5DDR C;  2UVU A;  6AT1 B;  2X85 A;  2HRU A;  3PFO A;  5B0D A;  5F8H A;  4IFY B;  2YH0 A;  3KLG B;  1LLZ A;  1R0B G;  2LVW A;  4F0M A;  5DM7 Q;  1NK5 A;  1NPR A;  4KSE B;  1OJ4 A;  2O66 A;  3M8Q B;  4RW6 B;  2FVP A;  4JI0 F;  1EA0 A;  1KP6 A;  1NDK A;  4K59 A;  5K5M A;  1FCA A;  3KDN A;  4OHZ A;  2VJJ A;  3DHW C;  1SL0 A;  1MW7 A;  3ENA A;  2CJQ A;  1UJ6 A;  5LM7 E;  2GV1 A;  1JKH A;  5KG5 A;  3CJQ A;  4DL7 A;  2PN6 A;  1WC4 A;  3J81 Y;  1RZM A;  1VIX A;  3SXL A;  1RWR A;  1TL7 A;  1TP7 A;  2IRY A;  4K7Q A;  3B8Y A;  5AJ3 F;  3JTN A;  2XM3 A;  4ZA1 A;  5FDL A;  1IBM F;  2CQI A;  4NMX A;  5L9X A;  3I5C A;  3FCV A;  4DUZ F;  4D3H A;  1K8A T;  2BQR A;  1Y3K A;  2MKJ A;  1S9F A;  4RNO A;  5D77 A;  3BR9 A;  4IFV B;  4NYP A;  2F4V F;  4OV6 A;  2X1B A;  4DLE A;  1T95 A;  4O44 B;  4JUZ A;  1WUU A;  3N9U C;  1LOU A;  4MH8 A;  3UR3 C;  2IY5 B;  1YJW S;  1FFS B;  3D3B J;  4IRD A;  3NWR A;  1YZ6 A;  1VQK S;  1JMT A;  3QO9 A;  1PBU A;  4W8T A;  1GMW A;  4GVB A;  2BM1 A;  4OZL A;  1FF2 A;  1VRU A;  2NXJ A;  5DO2 A;  3RBD A;  1T03 A;  1SL2 A;  5E3P A;  3JTO A;  1FKP A;  5KFN A;  5KOW A;  4PG7 A;  3QMQ A;  2XNR A;  1URN A;  1IR1 A;  3QT8 A;  1P1L A;  1TVR B;  2C2O B;  4M8L A;  5DNS A;  4Z7C A;  3NOC A;  4HWV A;  2EKN A;  4N7T A;  4OHX A;  3UDE A;  3TZW A;  1VBK A;  1ZS6 A;  1HQE A;  4B9L A;  4FBU A;  1YWX A;  4WF9 Q;  1K47 A;  1SC4 B;  3OJS A;  2EFQ A;  3K7R A;  3H7H B;  1T3N A;  1OO0 B;  2GIR A;  2MDA A;  1FK9 B;  1ZTW A;  3TQE A;  3BO3 A;  1JXV A;  4M5M A;  4OZ3 A;  3W2W A;  4FPI A;  1RU2 A;  2ASY A;  3WWG A;  2Q79 A;  5ETR A;  2VFQ A;  2B5J A;  1WJ9 A;  1J5O A;  1UZD A;  3MM8 A;  4HLB A;  2QG9 B;  3LO3 A;  1GEH A;  2I2Y A;  1RTH B;  3DNC A;  4XLF A;  1ZAX A;  3D28 A;  4YHH F;  3DU5 A;  2VG7 B;  3W5X A;  3OSN A;  3W64 A;  1O0P A;  3GWC A;  2CUY A;  3W9J A;  1ZPV A;  3QZ8 A;  1VQP S;  4RKU C;  4I7F B;  1HNV A;  1VK8 A;  2C2K B;  2GNK A;  2CA9 A;  3ET6 B;  3M2U B;  4EFA C;  1FE0 A;  2Y1L B;  2CG4 A;  2NYH A;  1LW0 B;  2CPZ A;  2KM8 B;  2OIH A;  1X9M A;  3PAC A;  5D4N A;  2JLG A;  3TOQ A;  1FK9 A;  3GV7 B;  3BDP A;  2X1F A;  4URQ U;  1KDN A;  2BAB A;  5AXK A;  1RWW B;  2D3O 1;  1VIS A;  2R9L A;  3US5 A;  1RYS A;  2JEI A;  4ED0 A;  1HI8 A;  3NNC A;  2J0S D;  4RUA A;  1HYS B;  3TAM B;  2K2P A;  2X3D A;  3PYG A;  2GZO A;  3UE2 A;  1WG5 A;  1IKV A;  2H5J B;  4P7V A;  3OTB A;  5L1L A;  2L41 A;  1NAQ A;  2JC1 A;  3LP1 B;  2AEF A;  5HK4 A;  3MTK A;  2Z2Y B;  4MKB A;  3G87 A;  4ZDN A;  1N0U A;  2IM0 A;  1SBR A;  2DO4 A;  1O5J A;  2Q43 A;  1LWF A;  1X31 C;  2PYG A;  2WK4 A;  3VTI A;  5A0Y B;  2CIM A;  1QCX A;  3M2R A;  4FVM A;  4WYW A;  3UD5 A;  2KFY A;  1DRZ A;  1TEL A;  2P6S A;  2CJK A;  2UXB F;  1RU1 A;  3KHG A;  4M5G A;  4RJV A;  5KT5 A;  1SPB P;  4F4K A;  1GMV A;  2E5J A;  3G9C A;  2CZV C;  1DHM A;  4ECU A;  3IR7 B;  3DLG A;  3LYC A;  4Y3C A;  5KFZ A;  1KCD A;  3L09 A;  2PFD A;  1NSQ A;  4ETZ A;  2CPI A;  1Q8K A;  4RW7 B;  3A3P B;  1LFW A;  3EZ5 A;  2DKO B;  2FZC B;  4KBI A;  2C1E B;  2KHD A;  4TY9 A;  1FRH A;  4MIW A;  3HF5 A;  2HUR A;  4PMH A;  4EYI B;  1TL7 B;  2XLJ A;  1Y3J A;  2B9W A;  1LLW A;  2V8H A;  4ED2 A;  3E3X A;  3UVJ A;  1X4A A;  1S99 A;  3BB5 A;  5KFY A;  3BH6 B;  1RAA B;  2YX1 A;  1IKY B;  3EVW A;  3CCQ S;  1P6T A;  4KHM A;  4OI4 A;  3FRZ A;  4IQX A;  1RBL A;  4XL9 A;  4XR6 A;  3VMW A;  1FNM A;  3W7B A;  1NSA A;  2V50 A;  3I32 A;  4ZCK A;  3LW5 C;  5AJ3 J;  4OHY A;  2HHT A;  3EZO A;  3H2V E;  2WVD A;  2ZFH A;  3G82 B;  4JI8 J;  1YBA A;  2NZM A;  1ZZN A;  5F3T A;  1GXL A;  3R1H A;  1KS2 A;  1YQH A;  2XSJ B;  4KPC A;  4KY3 A;  5K14 A;  1MLA A;  3OQ2 A;  2FPH X;  2B9E A;  4CLT A;  3A8I A;  3QYY A;  5CYM A;  3ZZ0 A;  1H80 A;  5ETP A;  4ES3 A;  2W2O P;  1RYR A;  3P5T L;  3CIZ A;  1K0V A;  1KHV A;  4Y2A A;  1NK7 A;  1QSL A;  4OLP A;  5KFB A;  2UVR A;  1O51 A;  2E1M C;  2LQB A;  1S6O A;  3IAS 9;  5K9F A;  3GCW P;  2H5I B;  2K1R B;  2PYH A;  3BN7 A;  3U02 A;  2XYG B;  2I38 A;  2R7R A;  5M2U A;  1Q8L A;  2GAH C;  3D6H B;  1SXL A;  2RNE A;  4WE1 A;  2HZV A;  2O17 A;  3EM1 A;  3MAA A;  4NZ0 A;  3D0G E;  1VQ6 S;  1WC1 A;  1O8F A;  1GMU A;  1WEY A;  2QT7 A;  3V6D A;  3MWB A;  4MT1 A;  3W1Y C;  2HVI A;  4NZ6 A;  1EP4 A;  2GVZ A;  5C42 A;  4R5P A;  2HVD A;  4IDK B;  4P10 A;  3EJM A;  4DV4 F;  2ADB A;  3OLB A;  1LW0 A;  3MFI A;  2LEB A;  1RHU B;  1CJV B;  1S12 A;  2UUW A;  3Q8U A;  1YRT A;  2HS4 A;  3DOM B;  4C8N A;  3UCG A;  1U47 A;  1S1U B;  3FEZ A;  3GB0 A;  3H5U A;  3BSA A;  2FJA B;  2QSW A;  3M1V B;  3N0V A;  1GFW B;  5EUH A;  2ZUA A;  1JQG A;  4J9Q A;  4DV6 J;  1VBY A;  4LF8 J;  2ROE A;  3PCO B;  4OI1 A;  2AZ3 A;  4X84 A;  3TYT A;  1Y9O A;  3OXL A;  1N36 J;  3VSU A;  4K2J A;  4WE1 B;  5A8R B;  2C42 A;  1NB7 A;  2HHW A;  2MSS A;  3M6W A;  4LRB A;  2ZJP Q;  2ASJ A;  4QOT A;  1O8D A;  3KLI A;  2KZM A;  3LP0 B;  4LUB A;  5DGB A;  4DWI A;  2RDI A;  1D1U A;  1LEO A;  1S59 A;  4P73 A;  5B0A A;  2NZC A;  3LP2 A;  1X0P A;  3M8P B;  3PG9 A;  4DV3 J;  3UNG C;  2VAS A;  2CPE A;  2X1G A;  2RT3 A;  3LH2 S;  5KFR A;  1TL3 A;  2DNK A; 
#chains in the Genus database with same CATH homology
 3PJ9 A;  4EK2 A;  4OM9 A;  4CP5 A;  1DAB A;  3EVM A;  4OPW A;  2V5I A;  3Q8Y A;  3VGU A;  4OJ6 A;  1BHN A;  3ZTP A;  1QA1 A;  1WKK A;  1U8W A;  3DDI A;  1PKU A;  2BX6 A;  1QA3 A;  2VFP A;  3JX8 A;  1S57 A;  1MN7 A;  1PAE X;  4WBF A;  3EVO A;  3ML3 A;  3Q83 A;  3NGU A;  3R9L A;  3VVT A;  1TYW A;  3SZE A;  5JLV C;  2DXE A;  1NDC A;  1CLW A;  1WXR A;  1K4Z A;  2CWK A;  3GPA A;  3LYC A;  3ZTQ A;  4W98 A;  5IOL A;  3VGT A;  1NSQ A;  4FKX A;  2J8I A;  1B99 A;  3B54 A;  4ANC A;  4DZ6 A;  1NDL A;  1NDK A;  3ELH A;  3FCW A;  1HF2 A;  1W7W A;  3L7U A;  2HUR A;  1NPK A;  1KQ5 A;  3ENA A;  4C6A A;  4O0N A;  1K8F A;  2IOU G;  2BEF A;  3G2X A;  4OJP A;  1HLW A;  3FBC A;  4ENO A;  3JS9 A;  2VFN A;  3GP9 A;  3BH6 B;  3EVW A;  1HIY A;  3FC9 A;  1HHQ A;  2VU5 A;  2BM5 A;  4V02 C;  1MN9 A;  1WKJ A;  2XC1 A;  3Q86 A;  1TYV A;  3DKD A;  5BXI A;  3FCV A;  3EE3 A;  2HVE A;  2B8Q A;  3B6B A;  1B4S A;  3BBB A;  3RIQ A;  1BE4 A;  1S5Z A;  4JRA C;  3FKB A;  4KPC A;  1TYX A;  4OJO A;  1QRC A;  1QQ1 A;  2DYA A;  2DY9 A;  1LWX A;  1WKL A;  2YUH A;  1NB2 A;  1VYA A;  2VFM A;  2DXD A;  5CAB A;  3ZTS A;  1NUE A;  1F3F A;  1EHW A;  3VGV A;  3SYJ A;  3ZTR A;  3ZTO A;  3EIC A;  3FBE A;  4UOF A;  3NGR A;  5JMC B;  3NGT A;  1F6T A;  4FKY A;  3PRV A;  1BUX A;  4AND A;  3AK5 A;  3EM1 A;  3EMT A;  2G0Y A;  1ZS6 A;  1TSP A;  2B0R A;  2BM4 A;  1UCN A;  2HVD A;  3EJM A;  1JXV A;  2NCK L;  1NLK L;  3TH0 A;  4F36 A;  2VFQ A;  3BBC A;  1QRB A;  3BBF A;  1NSK L;  3Q8U A;  4DI6 A;  3BH7 B;  4ANE A;  4KH3 A;  1XIQ A;  1XQI A;  1NSP A;  4DUT A;  1TYU A;  2ZUA A;  1NDP A;  5C7P A;  2AZ1 A;  2AZ3 A;  3ETM A;  3VVU A;  2VFO A;  1NHK L;  3MPD A;  3H09 A;  3P4G A;  4S0M A;  3Q89 A;  3VGS A;  3WX8 A;  2BM7 A;  3Q8V A;  4F4A A;  4UOG A;  3LJY A;  3N90 A;  1NCL A;  2W7Z A;  1LEO A;  2F3L A;  1S59 A;  3NGS A;  3FBF A;  2B8P A;  1K44 A;  4HR2 A;  1KDN A;  3N6Z A;  3PET A;  1QA2 A;  2DXF A;  3FBB A;  4OJ5 A;  4UOH A;  2BM6 A;  5CAA A;  4OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...