3BH7B

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
314
Chain Sequence
b'PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 103
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh7B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh7B02
4UOFA 1S5ZA 4FKXA 4WBFA 3BH6B 1WKLA 3ETMA 3EVWA 3Q8YA 1NCLA 2YUHA 3L7UA 1MN9A 3EJMA 2AZ3A 3B54A 2DYAA 1B99A 3G2XA 1NDKA 3FBCA 1WKKA 3B6BA 3GPAA 4S0MA 3NGRA 3NGSA 3FC9A 3Q8VA 5CABA 1HIYA 1NDPA 4ANCA 4ANDA 1JXVA 3FBFA 1PAEX 3BBCA 1F6TA 4W98A 1K8FA 5BXIA 3BBBA 1F3FA 1NSPA 4UOHA 3VVTA 5IOLA 2B0RA 4HR2A 3ZTSA 1K4ZA 3DKDA 3ENAA 1KQ5A 1UCNA 2CWKA 1NHKL 2DXFA 3VVUA 2VU5A 2HVEA 1XIQA 3FCVA 2BX6A 4CP5A 4UOGA 3EE3A 4F4AA 4KPCA 3NGUA 5CAAA 1MN7A 4V02C 2B8QA 1EHWA 3VGTA 1S57A 2BEFA 2DY9A 2B8PA 3BBFA 1NSQA 3FBEA 1NPKA 3Q8UA 2DXDA 1ZS6A 3BH7B 1BUXA 1NLKL 3FKBA 2DXEA 3Q83A 4ENOA 3Q86A 3PRVA 1WKJA 1NDLA 3EMTA 2AZ1A 3R9LA 4C6AA 1BE4A 3DDIA 3ZTPA 1PKUA 1S59A 3Q89A 3VGSA 4DUTA 1NDCA 1HHQA 3ZTQA 1B4SA 3ZTOA 4O0NA 3FCWA 3FBBA 3WX8A 3VGUA 4DZ6A 3ZTRA 1LEOA 1K44A 3PJ9A 4ANEA 4EK2A 4F36A 3NGTA 3EM1A 1HLWA 3EVMA 1HF2A 3MPDA 3ELHA 1NSKL 1XQIA 1NUEA 3EICA 2ZUAA 3GP9A 3VGVA 1U8WA 2NCKL 3EVOA 3JS9A 4FKYA 1BHNA 2HURA 1NB2A 1KDNA 1LWXA 5C7PA 1W7WA 1VYAA 2HVDA 4DI6A
chains in the Genus database with same CATH superfamily
3IBCB 4MXNA 3RBZA 1XNRJ 1WTFA 4X4SA 4NEZA 2CZVC 5A6WA 3B4MA 4KO0A 1T95A 1O8BA 1WSVA 4R0JA 2MXYA 3Q8RB 3NNHA 5ETPA 4IQXA 3VSVA 1VFJA 3R7SB 4DDFA 3MURP 3RR7A 2VG6A 2CKWA 2EC0A 1FX4A 3JB9k 1VQ6S 3E51A 5DDRC 1QAXA 3LGHA 4DL6A 2ZBQA 1REVB 2RQMA 1E6VB 1TU0B 4DFKA 3GYXB 3WC0A 4HYKA 1NM2A 5JXSA 1N8RT 4PWDB 3TX0A 3QSYB 3IR6B 3DGPA 1QQ1A 3MM9A 4RW6A 3UNYA 4ECTA 3GFHA 3H5SA 4EEYA 2W2OP 2HBYB 2HG4A 4N5SA 2BM4A 3FY3A 5LXYA 3UD3P 5D15A 3IBWA 1RWNB 1IXKA 2DNZA 4M5HA 3DRRA 5IT9U 2X1FA 1SBRA 3UW1A 3D5MA 2ZOGA 3L09A 4CWBA 1WKKA 4M5KA 4MIWA 3M30B 1APSA 2CQGA 5FLXY 5H9EK 4MIBA 2EWEA 1NRKA 4HR2A 2OPSB 5EHHA 4LBHA 5GAHU 1KQ5A 4Y2IA 2BM6A 5J1EB 5HBMB 3I0SA 4M95A 3VF0B 4EUVA 3PYEA 3MEEB 3FFIB 1RDRA 1LWCB 3Q86A 5KFGA 2NSBA 5HN0A 2E5LF 3FCHA 2B0GA 1JLBB 2CPXA 3O5TB 2OO4A 1RI7A 3HHEA 4CLPA 1OSCA 1LW2A 4XN0A 2BDPA 3ONQA 2UP1A 1MW7A 2VODA 1Z2LA 2NT9A 1HF2A 1BY9A 3H2UB 3NS7B 2UXBJ 2NCKL 5KFJA 1IWAA 4WIIA 4DR4J 2A10A 3H42A 1S6UA 2IDEA 2R8KA 2F1FA 1GNKA 4OZLA 2VJVA 1AIRA 1WKLA 1M5OC 1VHIA 3IGVA 2IYIA 1NDKA 1A6LA 5BYSA 5M2UA 4ILMA 1M5VC 1X9MA 2VQFJ 3MMJA 3JXOA 4MKAA 4ID5B 1ZYQA 5FDLB 1JIHA 3BDEA 3T5LA 1U09A 3EQNA 1NK5A 4FYXB 4CLUA 1NSQA 4OYAA 4URQU 4NZ6A 4PABA 3HFVA 4DSKA 4B3OA 2G0CA 2RILA 1NK8A 1S4FA 4QU6A 2AYEA 1TMJA 4FBTA 4FF2A 1F2HA 2KFZA 5EGYA 3VAHA 1IBMF 1SXLA 2R3VA 3PJ9A 1KQKA 1NO8A 2B9EA 5KFFA 1JJ4A 1VQOS 1RK8A 1S6PB 2FJAB 1WSRA 4OI1A 4NI2B 3IWNC 1JKHB 5EWGA 3HMJG 4K5RA 1MWZA 3FK4A 1HQ2A 4B3TF 1FD8A 4K4WA 2MQLA 2LQ5A 3BYRA 1FI4A 4AFFA 2IJRA 3X3UA 2HHVA 4OZJA 2LU1A 4QOTA 2MKHA 2QLJB 2KI2A 4CTAB 4OZ3A 4IDKB 1J5OA 3W66A 5BXIA 4F8RA 3UR3C 2V94A 2QSWA 4CIOA 2DR8A 3EGVA 1QVGR 4WYLA 1HNZJ 1RTJA 2LEAA 3DRPA 2GHWA 5CA5A 1SV5B 5M2RA 4MR0A 2J8KA 2HFZA 3MMCA 2DXEA 1H80A 4OX7A 3QLHB 1IUJA 1DARA 2JEGA 2ZD1A 1SUQB 2GHPA 4YMEA 4ZVOB 4XLAA 3BN4A 2HQFA 3H40A 3VHQA 3R2CJ 3Q0AA 2X3HA 3W5ZA 1Q7YT 3QIPA 3PO4A 4XIUA 1KLMA 2YX7A 2DBBA 4QBUA 2UUCF 4P7TA 2EFGA 2YWFA 2Y1IA 4CZCA 3A8IA 4BC7A 1C0TA 1WJ9A 4USMA 3UCGA 3HPOA 4UTGA 3VZIA 3W1YC 4RO0A 2PFFB 3BM7A 2HFNA 1BWEA 3HT3A 1OY9A 1URNA 2MGZA 1H3DA 1SH2A 5H9FK 1S9EA 2PDAA 4OI2A 2RMLA 3F56A 3AA9A 1WXRA 4MAKA 3CJ3A 4H4OB 3FBEA 4EWTA 4E2FB 3MM6A 3KLEA 2J6TA 1EETB 3PDNA 3M2UB 1C0UB 4PWUA 3RW7A 1ZTTA 2X6YA 4DUTA 2MSSA 1MMNA 2ABYA 4A8OA 4DQQA 2XLIA 4PR6A 2VFMA 4NPOA 3KLIA 4I2QB 5J2PB 2G0YA 2IMOA 2ZJQQ 3DLEA 2GS8A 1RBOB 2LXIA 1DQ8A 1T9XA 3NG8A 1GXUA 4Q0BB 3RG6A 3EZUA 2HBQB 2E5IA 4KIAA 4F2RA 1CQNA 1HFEL 5C42B 3DYAB 5HO4A 3A3NB 3B6BA 3I5CA 3OJUA 1UVKA 5HK4A 1UA1A 3TI0A 4BHQA 2ZE2A 2Q79A 3CJ2A 3GJQB 3KNGA 2V8VA 4L75A 1I3OB 4Z06A 3WIVA 1OOCA 1B7FA 2MZQA 4QWAA 4XORA 3CUNA 1FNOA 4C3MA 5IC6B 1RZMA 4ERDA 1LWFA 1MWQA 1L3TA 2FJEB 3EGNA 3MM5B 3KK3B 5B0GA 1S1UB 3DHWC 2ZNZA 3FGVA 2G2ZA 2V67A 2QZ8A 3B8HA 2QRRA 3KJNB 3D9BA 3SV4A 3P6YC 3WX8A 2CVEA 5LJ5Y 2R7OA 1V3SA 1F3VA 4O23A 4ED5A 3ITHA 2OEMA 2E5GA 4O3OA 1QD1A 1HPZB 5AE2A 1XC9A 3HVTB 4F26A 5IM0B 3S1TA 1FFSB 8ATCB 1X4DA 4FF4A 4QPTA 3PM9A 3KLGB 1X4AA 1WDTA 4HVZA 3UR0A 5CABA 4ANCA 2LEBA 4IR1A 3MMBA 1XMQF 1XG2A 2RS8A 2OGUA 1LK7A 1YBTA 3G87A 1Y10A 3ILIA 1XERA 2DR9A 4X62J 4ZVEA 4C2MA 1TVRB 2ZM6F 2XS2A 3CCVS 5IT4A 1SJRA 5KFWA 4AVZA 2CDQA 5L46A 1K0VA 3D0IE 4ZDNA 3LUYA 3CDUA 3PETA 4HH0A 1B4SA 1RHUB 5E5NA 2HQIA 3TUIC 2RS2A 4K4TA 2R8IA 2IIHA 4HT7A 1AYEA 2DITA 2E1MC 2Z57B 5EX0A 4A8XA 3GP9A 5ADZA 3V81B 4WFAQ 2FJDB 2FJXA 4HLBA 2XTXA 2HEKA 3CVKA 4YEJA 1RTIB 1U7LA 1N34J 2GJ2A 1RAGB 2I2YA 1U1RA 1WI8A 5K20B 2QT7A 2VJUA 4DLEA 1VC5A 1S9GA 4OZ1A 1F6TA 3OVSA 4I69A 1XR7A 3RRKA 2CQ1A 2R7UA 5C25A 1IR2A 1RISA 3JAMU 4G6VB 2B56A 2LP4A 3W9JA 2W9CB 4J9LA 3A8JA 4C3LA 1FKPA 5L9NA 4USKA 2UVUA 4I1TA 3G96A 3Q83A 1U2RA 4XLCA 4OYOA 4OHXA 4UY8T 4DPYA 2XMWA 2DRDA 5I3UA 1ELOA 3I5AA 2VKRA 4AXIA 1KQFB 2DB1A 4KHRA 2HHXA 4LSNB 1AFIA 4JI8J 4DV7J 1U2FA 1REVA 2QMUB 4DJBA 3QQCD 3M9MB 1E6VA 2RUGA 5DO2A 3RB0A 4N8OA 3JURA 4DBQA 2JVOA 2LQ8A 2VFUA 3CEDA 4PWDA 2VHGA 4DR3J 4W8TA 5I4MA 1U47A 2HGNA 3TNVA 5DLGA 5D4OA 3H90A 5KTQA 5LT5A 2KZMA 4LBIA 2GQQA 4ILLA 5K8NA 4NLDA 1UETA 2LQ9A 1EKSA 3PYFA 2BOPA 4Y65A 4UOCA 1V6HA 1ACMB 3IGNA 4CP5A 4NCAA 3TP2A 2ZWPA 1VS3A 4UUXA 1TMMA 4DOZA 1FHTA 2UUWA 1WHWA 1VHFA 3BO2A 1JXEA 2ATCB 1YJUA 3B4NA 1CJVB 2XM3A 3PSZA 1RCOB 2OPSA 3DOMA 5B0EA 2GIQA 4XDCA 2RHSB 3VSTA 1QAJA 4A8WA 3B8YA 2R4FA 1KCCA 5KFDA 1ZM2A 3I9V9 4Q2MA 1TL7A 2LMIA 1N6QB 4LR8A 5BJRA 3MEEA 4ANEA 4OI3A 1JJ2R 1KQGB 1LWCA 2HNDB 3HT0A 4FS1A 4DG1A 1VLOA 4Y2AA 4LBPA 1Y7PA 3DMJB 1N5YA 2NSCA 2K8GA 3M1VA 4DF8A 3VALA 4F0HA 3CCZA 5AJ3F 1IBKJ 5GADI 4J9RA 2DYAA 4ECYA 3J81Y 3HLUA 2V2QA 1TUGB 4CLWA 3ZPPA 2BBEA 4IKAA 4LFCJ 2DRBA 3M2RA 1RWKB 4ZVRB 3THVA 1J5EJ 3N0VA 5KFUA 2HLTA 3R1LA 2OP5A 1NJZA 2HLUA 3R5JB 4OZ2A 4LF8F 1CJTA 3KG1A 4LVOP 4GC7A 4ZITA 4IG3B 2JC1A 1YBUA 3D6MB 4EZ6A 4IO9Q 3BGOP 4MK7A 1O8MA 2ZBPA 2GVDB 3PIPQ 3Q24A 2DK2A 2R42A 3RBXA 1ZTWA 5DM7Q 4OI6A 3GV7B 2Z0GA 2IC3B 3QIDA 2CNLB 4OHYA 2KN4A 2JFKA 2RF2B 2W1BA 3BO3A 3EICA 4U7UK 4DQIA 3AHPA 2M88A 3A13A 2B7BB 4JI3F 4TYAA 3TJ9A 2UU9J 4JUZA 3MUVP 2FC8A 1ZAXA 4PYDA 1K1SA 2KXHA 3IM9A 1RWVB 4LT6A 4YZ0A 2NZCA 4I6AA 3FMWA 4EU0A 4NI2A 1KVKA 1JKHA 4YDTA 2X51A 3CMES 2DIVA 2D3O1 3ENAA 1YRXA 2DEIA 1Y11A 1GH8A 4A46A 2OMLA 5DZ6A 3U1NA 1PIEA 4JYAF 3AA8A 2EWHA 4CTAA 1RT5B 3QAUA 3SZEA 3UI3A 3CMAS 4X4NA 2YX1A 2WOMA 4NLGA 2BANA 3FKBA 3LP1B 3NWRA 1VBXA 5KFYA 1X4CA 3ET6A 2ZNYA 1RU1A 4NXNF 3DDIA 4TYBA 1ZZFA 4F0MA 2XYHB 2YH0A 1G1XA 1FRXA 5F41A 1IM4A 2F8HA 1WF2A 3R3TA 5IFMA 4X62F 2IJNA 2KJVA 2K3IA 1S77D 4N7TA 2OI2A 5IQ6A 3ZZRA 3QLHA 2VF3A 4QR0A 2MQ8A 1SUQA 4CLFA 4Y0FA 1UFLA 3N28A 3I82A 4YB6A 2CADA 3BH6B 3GMGA 1Q53A 3MUMP 1IQTA 5LSRA 4URRA 1C2PA 1WG5A 3QRQA 5AE3A 4DSLA 2ALYB 2XULA 1PGZA 2CPYA 2FHJA 3PEJA 2BOAA 2OPQB 3KTQA 1D8ZA 3CD5A 4KHMA 2DR6A 3KG4A 4X66J 1N34F 3ZXWA 1SQEA 1EHWA 1RT7A 2CPZA 2PO4A 1UW9A 8AT1B 4OZYA 4NLSA 3WZ0A 1UVMA 2C1EB 2EKNA 2QFIA 1YTYA 4U95A 4TQSA 2BM5A 5HJYA 4TU7A 1HI8A 3RB4A 2O1DA 2PT0A 2C2NA 5BR8J 1EQ0A 3N5BA 1YWXA 4F36A 4H4OA 2UVVA 4YY3J 2HHHF 1FRJA 4W4MA 3CCMS 2FPHX 2GO9A 3HHLB 1EETA 2G2YA 2K3KA 3M2UA 1FKOA 2HAIA 1HNVB 4RW4B 3NCQA 4EGLA 3ZSCA 1OSDA 3W65A 3K8VA 3L9ZA 2XTWA 3BKTA 3AH6A 4WF9Q 4E0DA 3VAGA 4YFUA 3NGSA 4JI8F 2G1DA 4GVBA 2B9YA 2VONA 4Q0BA 3MECB 4ED6A 3UN3A 2VG7B 5LMUF 1PC5A 2UXCF 4N8NA 4GKKF 4F7VA 4OI0A 2CWKA 3KLHA 1ZM3A 4F4ZA 2D7SA 4X4OA 3CIZA 4A8MP 3CE8A 4JI7F 4Y2KA 4UUWA 4NLUA 5HLFB 3R5DA 3LMWA 4DR3F 3QWPA 2FY1A 1RHKB 1RE1B 3FRZA 1FXDA 3DRYA 1SJFA 4MFBB 2CJYB 2FHOB 3TEGA 3NMAA 3MMAB 3UE2A 5IS2A 1F5CA 3GILA 4XOPA 4WYWA 4CT9A 3MEGA 3KK3A 4RNMA 3NOCA 1DTQB 2L9DA 1H72C 1TQLA 2YKNB 2M3DA 1NHVA 3O2IA 5IV4A 2Z8QA 2C3OA 3BKFA 3L7PA 1TSPA 3MEKA 5DQIA 4ZPTR 4QW8A 2DD8S 1LXJA 2P5VA 3NCRA 2DHXA 2KDOA 4WBFA 3KRGA 1YJTA 3J80Y 3Q8YA 2DGVA 3DOLB 3R97A 3RB6A 3CJSA 4YOEA 1HPZA 3BGRA 5LL6d 1N5SA 3HVTA 2YY3A 5IM0A 2I6WA 5CD4A 2QTWA 4IFYA 2V4QA 4ECWA 4F4WA 4U7UD 3BO4A 4B08A 3DI6A 1H38A 3KLGA 1IBKF 3IRXB 4PCQA 1WC6A 2B5JB 5E3QA 2QV6A 1TAUA 1V5IB 2RRBA 1JK9B 1RT6A 2XMKA 3LANA 1YHQS 4Y00A 2NXNA 3V6KA 5B0DA 1KKHA 3QZ7A 2OKQA 3TX8A 5LM7E 3TAMB 4Q45A 4KH3A 3HO1A 3HF5A 3GTYX 3W8PA 1CULA 4WP3A 4ED4A 2J0SD 2Z2LA 2CQ3A 3PTWA 4DV5J 1EX8A 2E66A 5ETVA 1NUEA 4R8UB 1XNQJ 4Z03A 4ZVGA 1HKAA 4AD6A 1CSJA 1X4HA 2IRYA 2MQPA 2GMJA 4NX9A 1NJXA 4ELVA 1O8LA 2OMOA 4B3SF 3RJMB 3LGNA 2JLGA 2M7SA 3AXMA 1UJ5A 4OJ1A 2GJIA 3V81A 2AF6A 2EW9A 2W01A 2AEFA 2HK2A 4FYVB 1EJ7L 4KY3A 4L3NA 1N52B 1UWBB 2Z2YB 5SUHA 3OL9A 2ZOMA 1XR5A 2R7SA 2ZH5A 4X4RA 5E3CA 5HJXA 3T41A 2KFYA 2NSTA 2ZC3A 1Q86T 3KLFB 3PW2A 3CW2C 2B8PA 3OT9A 5HAOA 1JLEA 1XEZA 1BUXA 2J0WA 2VPWB 5E3AA 3BGUA 3KUEA 4N47A 3TYTA 4JV5F 3PRVA 1JJHA 2LXUA 4UZCA 5MAOA 1S6OA 1F9FA 1Y00A 3GQ9A 2Y3YA 4MT1A 1LM1A 4DXLA 2V2KA 2W9AA 2YXLA 3PYGA 4A48A 2VFQA 3F73A 2F4VF 5AXMA 4C8ZA 3AD9C 2GO8A 3X1LB 4NZ0A 3CNQP 2XTJP 2JOQA 1J2VA 4JBCA 2DNGA 1QJHA 2IHR1 5KFMA 1HW9A 3IFEA 2GQCA 3ENVA 3W5YA 1RT2B 1GTHA 4LSNA 1RUSA 3M4XA 3W64A 1FESA 5CQGA 3RTVA 3LALA 1K8FA 1TKXB 5DRKA 2KU7A 3DN9A 4ZVSB 1JLQB 2Y8WA 3Q8SB 1CBKA 3KUHA 4KHPJ 4JI2F 3UW0A 2NR0A 4HH1A 2O17A 1CG2A 3QT5A 5CZXA 2ZH4A 4MH8A 1D9AA 3K5NA 1B7YB 1HHSA 3R6GB 1CQMA 2MMYA 1S9FA 2F3JA 4XK8C 2MKIA 3AB4B 2HQGA 4DR7J 1QSLA 1M90T 2HNZA 2DEJA 4B17A 4D3GA 3P96A 4I2PA 2WW4A 4IH7A 2AZ1A 2O0WA 3KJQB 2Q66A 3MM7B 2BKPA 2XC9A 3RB3A 5JMNA 3P4UB 1UJ6A 2OPRA 3H5XA 1SJQA 4NLTA 3R7NB 4X66F 1CJVA 3M7VA 5AXKA 1HD0A 5HQLA 4DV2J 2FHMA 3BR9A 1D8YA 2Z56B 2A2DA 1HMVB 4DV1F 4G65A 4YB5A 2RHQB 1CJKB 4C8MA 4KH1B 3QRPA 3H2LA 1G6BA 4NLOA 5AXNA 4RZRA 1N6QA 2P9GA 1YRUA 2RB7A 2AX1A 2CPFA 4IH6A 4RL1A 1NKBA 3MCOA 4XKWA 1N0VC 1N32F 1R6YA 4O3PA 2BM1A 4HDGA 3HFZB 2PSZA 3OFFA 5IQQA 1S0OA 4ES1A 3C15B 5B0FA 2CPDA 3KXDA 3AD8C 3MTKA 2ZFHA 1CZFA 3L7OA 4HTJA 1HQUB 4KBIA 4U8VA 1YJRA 5GAEI 1RBLA 2XT2A 1Y9OA 2NS1B 4NLXA 4C9DA 3BQ1A 3OV7A 4JI5F 2W4PA 4G1PA 1VQLS 2CPIA 3M9OB 4CO3A 1IKYB 2YNIA 5E3RA 2CQPA 3BEGB 3QSIA 4IG3A 3P5TL 1T9WA 1FKAF 4H54A 2FHJD 2WTFA 5K14B 2G2OA 1VBKA 2BMBA 3QRRA 3MOZA 1RA7A 1NZAA 2W4CA 2GVDA 4MKVA 2QYUA 4Y3CA 4GRSA 1R0BG 2IC3A 2V9KA 2F8MA 4M5IA 4PMHA 5KFIA 3MI7X 2NTQA 1ROFA 4X4PA 1URRA 3KYLA 4X4VA 1LW0A 1R8HA 5E7OB 1JB0C 1QSSA 1M5PC 5AE1A 2CG4A 3GJTB 3BJYA 3AJ2A 4DL7A 3LJYA 3RIQA 4NRTA 2IRXA 2KG0A 1JXLA 4CCHA 3NS6A 1Q1KA 4CM2A 1H6KX 3O1LA 2K7JA 1FDAA 1BMQB 1T3NA 2R8JA 2VJJA 3W5XA 2AV5A 4DV6J 3CWJA 3H7HB 3I31A 3VV2B 3EDQB 4V19J 1UVJA 3RAQA 3NGKA 1N0UA 4YB1P 2X1AA 3LP1A 1LV5A 2E1RA 4O0IA 4HTIA 2INVA 1S7IA 9ATCB 2DNKA 5A6PA 3J7YI 2DHSA 1B0VA 1HG8A 2GMHA 4P9SA 2DRAA 4NWBA 1NK4A 4UY85 4DX7A 4LR7A 3NWGA 1RJJA 4KSEB 2KKHA 1R27B 2VZ9A 3D2WA 2KYZA 3IRWP 2PYGA 3WBZA 2XCAA 3KK2B 3ZZ0A 3MGJA 2XMVA 1HNIB 1AXQA 4YHHJ 1O8IA 1UL3A 4J9VA 1YJ7A 3AT1B 3PEHA 1O88A 1N33J 1S6QB 4HKQA 5IT0A 3DFEA 2JH3A 3GWCA 3PNIA 4KGVB 3GFZA 3PR5B 3KFWX 3GIRA 2PEBA 1QRCA 1R89A 2ZC4A 4BWMA 5KFTA 2PMZD 1TK0A 3HSJA 1HHQA 4NLRA 3FBBA 2HS0A 2MHEA 1KRPA 4CLSA 1YGYA 2CNKB 4P2FA 3F44A 3R5BA 1S1XB 3MDFA 1DABA 2VC0A 2R9LA 2HIYA 4CLYA 4ED1A 1S1VB 4J7CA 1R31A 1TKTB 2MTLA 1M1GA 1HQEB 3HX9A 4LSLB 5GAGI 1CJUB 2XMJA 1P9YA 5ETRA 2ZWOA 2XS5A 3QO9B 2VOOA 4RW4A 2BJ7A 4X64F 4GO5X 5AMVA 2VPYB 3C14B 3AJ1A 5AXLA 5B08A 2M2BA 1DURA 1W25A 4C98A 1Z1ZA 2YKOA 1HR0J 2MDAA 3D54A 3IR7B 2UUAF 1ZS6A 2ZJPQ 4WKRA 2BW7A 3TVZA 1DQ9A 1HI0P 4QWDA 1X7VA 3M8WA 3B4DA 2QYCA 4LFBJ 4KHPF 2LKZA 3BQ0A 3HCXA 1AW0A 3NMRA 1GXTA 2PI4A 4Q43A 2PI5A 4F25A 3GONA 5GMEA 3MEDB 2B3TB 3R5CA 3ZZZA 2K1RB 2VQEJ 4YP3A 3IS9A 3T1AA 4UF4A 3OHAA 3FVYA 1DTQA 2YKNA 3DM2A 1FT8A 4LVNP 3Q8QB 3BN7A 1KHWA 3BBCA 2UUBJ 3MM8A 3JSMB 2E1CA 4LRAA 3GG0A 2J9DA 2OEJA 2RDJA 3DOLA 5A8WB 4EFAC 4JI4J 2XO6A 1MN7A 4TLQA 5DM6Q 1KFDA 3CJRA 4PXCA 2XG8A 5E41A 4NYOA 4OV1A 1B64A 2XY5A 4YELA 1FDNA 3V4MA 1DY3A 2KT5A 2FLNA 4LF5J 3NBPA 4G1QA 4N76A 5U47A 1O8HA 3SXLA 2B5JA 2EEYA 1ZZNA 4RBVA 2MZSA 3VWSA 1AUDA 2AJ2A 5CZVA 2ZUAA 2C2RA 2FVPA 1VRUB 2CQIA 3N6LA 5C7PA 2IFXA 3CJKB 3TAMA 3ZNUA 1SC3B 3DLJA 1PAUB 4OJOA 2H54B 1AT1B 3G86A 2VBMA 2VD3A 1U1OA 3I5BA 5F3TA 3EJMA 2B7CB 3QJLA 2J9DE 5ETQA 2HZCA 3OTEA 4ZK7M 4Q5VA 1MLAA 1NDPA 3W2VA 2VICA 3LWLA 5HROB 2XC1A 1WHVA 2YQ0A 3VQSA 2B0RA 4DSIA 5B0AA 4CO0A 3LP2B 1XIQA 3T9ZA 4K4VA 2VOPA 2NZMA 4F3MA 2BM0A 3OXFA 3V6DB 1N36F 5LXRA 4AQYJ 1U1LA 1RTDB 4EZ9A 5KFAA 4CO2A 4CI0B 2VL1A 1KEKA 4CLZA 1P1LA 2HWIA 3CCUS 1XR6A 4O44B 4OHZA 3U27A 4JI0F 1FX2A 4DFPA 3ZTPA 2QYGA 3KNAA 3KHLA 5J2QA 3NRBA 3NP5A 3KLFA 5E0OA 4L3KA 2PGCA 3DLGB 2V4JB 1EAYC 1RT3B 3HHDA 1QRBA 4P7VA 4RU9A 1OPZA 2XS7A 5A0YB 4RBUA 4RJVA 2C42A 2HIQA 3GQCA 2DGOA 4MJKA 3GRHA 1U24A 2RD5C 5HMZA 1OQ6A 4BCAA 3SFGA 2BE9B 4RR5A 2NUUG 1U8SA 3PW5A 4PWWA 4X65J 2W25A 2H3EB 4P52A 3NAIA 3WHIA 4C97A 3KJVB 2ZH9A 2BYCA 5CH7B 2HAFA 1RT2A 4QWEA 4EBDA 5FIIA 2LA4A 3UDEA 1UMJA 2CNNB 2NXUA 3IAM9 1NPKA 3QZ8A 4CQ1A 1JLQA 2YWGA 1TR0A 4DUZJ 5J1NA 4Z37A 4U4BA 1SJ1A 2V5HG 2GVZB 1BQNB 3LO3A 1VQ8S 1X31C 1I1GA 2IBOA 5JVHQ 5DGAA 3KDOA 1N33F 1U6ZA 4ZA1A 7FD1A 2YNFB 1W7WA 3G9CA 3CSKA 3MZIA 4NK8A 4NYZA 4WFNQ 3OTOJ 4W8SA 5D0EA 3P8BB 1OPIA 3UN2A 4KJIA 4WTYA 4ALZA 2R2RA 1YI2S 1U0SA 3SDEA 1YJWS 2W7ZA 4W92B 4CO4A 1FEHA 3OHBA 1TTHB 4QPXA 3POTB 1RAJA 3KDNA 3EYZA 2MQQA 1UA0A 4QQBA 1NJWA 1C1BA 4NXMJ 3C15A 2JWNA 4TY9A 1B70B 2IYGA 3LQVA 5I3QA 3MUTP 1V9OA 2O0VA 4FP9A 4ES3A 3D67A 4EO8A 1HQUA 4GMKA 4DCOB 5IWAJ 4LRCA 5HVFA 2DGQA 5EX3A 3VGSA 2QGFB 4Z05A 1JLFA 4KB7A 3IM8A 1HLWA 3DRSB 4ZVUB 1KN6A 4FYDA 1TL1B 3K5LA 3OBIA 3G82A 3O3LA 2CPJA 4WFBQ 1H98A 1HHTP 2IY5B 2XMMA 2CJXB 1JLCB 3J81U 2PA3A 1Q8KA 4KRWA 5K14A 4M5GA 3Q8VA 3CDBA 1PXZA 5KG7A 3A1YG 1HA1A 2A6OA 3PO5A 3PX6A 2VQEF 4XPEA 1U1PA 3M2VA 3UO0A 3EZOA 2RQCA 1VGYA 4BWJA 3VAIA 2DNMA 2VC1A 2AX0A 5HL7Q 1G3OA 1R0AA 2G9OA 4OYWA 1Q81T 4R5PA 2PMWA 4DR2F 4OMFG 4RNHA 3H5YA 2OTLS 1N5QA 2D41A 5EDWA 3M8SA 4HI2A 5K8OA 2BE7D 2WVBA 2OD6A 3SCLE 2YQ3A 3W2WB 2BA9A 2UVFA 2C3MA 4JI4F 4XLHA 3W60A 3RBEA 4QIEA 4OJ6A 4YEIA 1FJGF 4F4KA 1BQXA 2BKNA 2MKKA 1S49A 5KT3A 2HFSA 1YDLA 3U1MA 4IYQA 2WBRA 1NCLA 3G6VA 4K5SA 2GCFA 7FDRA 3O44A 1I94F 1HNWJ 2BRKA 5DETA 2BQ3A 4RNFA 3FJ2A 1VJWA 3DXBA 3MPVA 3BSNA 3OW2R 4ED2A 4LIRA 1HYSA 5HMYA 3FMBA 2O6WA 2QG9B 2I8EA 2AJ1A 3TA2A 2RE1A 2VFOA 3GJRB 1HBMB 1ZAWA 3KWMA 1RGVA 4B9VA 1S0NA 2IM1A 2ZZMA 4L72B 1WOPA 2YKQA 4Z7CA 3M6VA 3BV8A 4J90A 5KG1A 2NPIA 3D3CJ 4YN3B 4R0EA 2CJKA 4ELUA 3LP0B 2EBEA 1O8KA 3JTOA 4ZP7A 3MFIA 1HNXF 4YDXA 3J7AN 2W7PA 1WF1A 4RWWA 2ZUGA 4DN9A 4C7QA 1UVLA 2W7AA 2QC3A 1XQIA 3ZZPA 3HVAA 4UOFA 4ICLB 4WFXA 3E8OA 4EI2A 1HBOA 3C16B 3A12A 1VRQC 3ZZUA 3VZHA 5I42B 2BQRA 2ILYA 2OEKA 4NMLA 2QLFB 3S8SA 4J37A 3FBCA 1HW8A 4S0MA 1S1XA 1O5JA 3SYZA 3JSYA 2ZHOA 6AT1B 3ILOA 3FDSA 3BBBA 2YNGA 1S1VA 1TKTA 2L41A 2XGQA 2PA8D 4WP9A 4LSLA 5ETKA 5CAAA 1X5OA 1SC4B 4TQRA 4JI1J 1IKWA 1RWOB 1LWEA 3M32B 2XWYA 2B9XA 1RWMB 2HYIB 2AKWB 5D0HA 3BPSP 2NZ4A 1N54B 2WVFA 1C1CA 4OIXA 1V3ZA 3T19A 3SBMA 1OFMA 1TYXA 1NDLA 2M5YA 4ZN1A 3C14A 2I1RA 2QLXA 4DU7A 2JX2A 1S99A 2DY1A 2DR7A 1VIXA 1TK8A 4AE5A 4V19X 1NHUA 3CDWA 1AZSA 3AY0A 2GC8A 1N56A 3PW4A 3OTDA 3J7YU 3BYPA 2JC0A 4DSEA 1FDBA 3ZFVA 3QAEA 4LF9F 2OPPA 2LDIA 5A2QU 4M5DB 4DPTA 2FHKA 4ZKAA 3R6LB 4I6YA 5T7LB 3OR2B 2HSEB 3CCJS 3G2XA 3DC2A 4A4JA 5L1JA 2WONB 2Q6BA 1S1TB 3QPIA 5CYQA 4ANDA 3MEDA 4M5LA 5KFVA 4CH0S 2J7KA 2Y1JA 5LMNF 3KK1A 5EWEA 2CDRB 4I56A 4K2XA 2A0FB 1O8DA 2PC6A 3PJXA 1FJEB 3UDLA 4AL5A 2EK1A 2UUTA 4H4MB 3OTOF 4XKVA 1SJ3P 2BRLA 3IAS9 2X7IA 1IBLF 4C8KA 2MEWA 3UCZP 1WC3A 4KGXB 4PZVA 5D4NA 2H9ZA 3PW0A 7AT1B 4ZJQA 4BS2A 1IKVB 3EMTA 5D6GA 4DUYF 1SVDA 3JSBA 3BSOA 1X5TA 2B4OA 2KT3A 4LQ9A 4DSFA 3DLLQ 3CF5Q 1K44A 2W8KA 4B3MF 1TYVA 3IMQJ 3NS5A 2WB4A 4CM0A 3GR1A 4DN0A 3MPDA 4H4KA 3VQTA 2V68A 3R8YA 3TVYA 2YBVA 5C1EA 5D3GB 2DH8A 4ECVA 1E6YB 3HHLC 2HVDA 4C8YA 4CH7A 2CQ0A 2AGOA 4ZHRA 2FIUA 5F8IA 4IRCA 2H5JB 4C11A 2QA4S 4QCLA 3K89A 4MKYA 1RXOB 2P9EA 3D66A 1D9DA 3T5JA 3A3OB 2J9EA 4K0KJ 2V2ZA 4RW7B 1Y4ZB 2J7UA 5C5JA 5KFZA 2WZ1A 1LKZA 1L3VA 4PG5A 2EPIA 2OUGA 3T1YJ 1NKEA 1T05A 5HROA 4CYUB 4WPAA 4ZPBA 2HS3A 2RQKA 5KOWA 3T6JA 3LP2A 3R9LA 4PEOA 5J2NB 3RZAA 1RTDA 4OX9F 4GKJF 4F0KA 8RUCA 2HNYA 4OPWA 1TL3B 2W2QP 4NLQA 3W3SA 2M8DB 2VPXB 2HHQA 2I5JB 3T1HF 3C2PA 2W9BB 1ZPVA 2BJ8A 3PYDA 4Z7YA 1NK7A 1VQSA 4P72A 1U6FA 1V5VA 2L9NA 4USHA 1SCJB 5ITHA 5F8LA 3PY8A 3DLGA 2V4JA 3VR1A 3Q2TC 1RU4A 3KHHA 1RT3A 4FXDA 4A8SA 1UEKA 2DNYA 3DCAA 3LPYA 4P73A 3QGGA 3BF4A 3C6TA 4DX8H 5DG8A 2BJ3A 4K4YA 1CC8A 1Q4RA 1TV6B 4NLPA 1IDKA 2GAHC 5D77A 4LF6F 1IKXB 1HARA 4NE9C 1VQPS 2X85A 2XMAA 4NA1A 1HBUB 4RWXA 2VFNA 2ZZNA 4A8FA 1FK9B 4OX8A 4P74A 1PC4A 2AEJA 2X3DA 1M1HA 1T03B 2IM3A 3TA0A 4OX6A 1FNXH 1VCTA 3JAMY 1UTAA 1S12A 3VGUA 3M8QA 4C48A 3FNNA 5KT6A 2PMHA 4FXVA 3R5GA 2D74B 3W9HA 3IXQA 3CCQS 3P49B 1RT1A 5L1IA 2XY7A 5D8HB 5HMWA 1RAOA 1WUUA 2FVCA 4NLVA 2GVZA 4QWBA 4DHVA 3G8QA 4NEYA 4KO0B 1EP4A 2ZH8A 4OZNA 5T41A 3ZC4A 1Y5LB 3UWTA 3FEXB 1S0MA 2HRUA 3DU5A 1K1QA 3GCWP 1Y5NB 2FGCA 2F9JA 1MROA 1K4ZA 3ISNC 1R43A 3MAHA 3NGUA 2LYVA 4DV0F 5HQ8A 2BJ1A 3VTIA 4DV4F 2DCUB 4J5OA 4KKOA 1RLCL 4AUKA 3JTNA 4L73A 3OL7A 3C6UB 1DLOA 2X6WA 2V69A 3IO1A 3ZO7A 2KVQE 1YG0A 1B0TA 3ZTQA 4XM3A 4CDIA 2IMWP 1RWPB 1IR0A 4ZMMA 3RBDA 2PFDA 2VH7A 5ETOA 5RUBA 5DDQC 1KHVA 2CQCA 4JI1F 3AJDA 2G13A 4C8NA 1N5VA 1B0PA 3GU0A 1RQ0A 2AJFE 2FVRA 3CB4A 3GG1A 3RUBL 1N5TA 2FUG9 2CVIA 4XTTA 3TRGA 4LF4F 1RSCA 3CMQA 2BVZA 3WX4A 4MMOA 5CHCB 4BDPA 2RSQA 1TL1A 3BGFA 1XNRF 3TAPA 4KTQA 4NZ7A 2X3GA 1S1WA 1L3SA 4WU2A 2NPFA 1QVFR 4K7QA 1NEEA 3I0SB 2OTJS 2WSEC 4WFYA 2IPOB 3N5FA 4ZVHA 4RUAA 5L9XA 3NAHA 4IOCQ 3GQAA 2ZH3A 4J9QA 2RAQA 4M5NA 2G0IA 4XLFA 4FYWB 3DOKA 3OQ2A 1TL5A 3QFHA 2XSJA 2R2SA 1WEXA 5KFEA 1JLGB 3QJJA 2MLYA 3D6FB 2R2TA 3EVOA 3D6TB 3H2VE 5D0RA 3RW6A 1KP6A 4LJMA 2YWEA 1RTHA 2L08A 4FKXA 2NXCA 5F8JA 4YR2A 2GQ2A 3N01A 2XZDB 1FE0A 1MU2A 1Q8BA 3EXYA 3W2WA 3QYYA 2KXNB 3ZZYA 5HP1A 2YNHA 4J9PA 2VA3A 2AYBA 1AA1B 1SQGA 3W63A 1F3FA 2Y0BB 3W8GA 2I0XA 4LF7J 1FD2A 1SC6A 2B4PA 2JEIA 4OHWA 4F4AA 2B8QA 2ZDOA 5EN1A 4JV1A 4B3OB 2DNRA 1SH3A 2P8IA 2HHUA 3HZEA 3MHYA 3HJFA 1FDDA 3UVJA 1U49A 4LIWA 3PXGa 1GXLA 4ZN3A 4K0KF 1PYSB 2GX8A 4WU3A 3K17A 4ED3A 4F3QA 3DU1X 1QA3A 2VG5A 5F8GA 2EG1A 1Y3JA 1UZDA 3T1YF 3LP0A 4RUHA 1VK3A 2GGPA 2HMIB 3GE9A 1A9NB 2R7RA 2B6AB 2UXBF 3ILLA 2J0QD 2FGOA 2HFOA 4TVAB 4DR4F 3OUYB 1B99A 2FTRA 3PACA 3V4IA 1J27A 4Y2MA 4K4XA 3C16A 4LF2A 1T94A 1WD6A 3VCDA 5I42A 4FDFA 3DRPB 3I56S 2JLFA 4F4XA 3BPDA 1PILA 3QGIA 4TY8B 2AJ4A 2VQFF 2N3LA 5B0BA 2XLKA 3MMCB 2KJWA 4ZVTB 1KVJA 1UPPA 3PVXA 1AFJA 2HVIA 2ZD1B 4FN5A 4ZCIA 5J2MB 4WXOA 2ERRA 1KLNA 4O0NA 2V8PA 2Z30B 3M6WA 4KV8A 1YVFA 2MQNA 3M32A 1PO6A 1WI6A 2WB1D 3JTPA 5F8HA 1RLDA 1RBAA 3L95X 2NUHA 2R7TA 2EK6A 3EM1A 3KOAA 5FD1A 4EBEA 1JLAA 5KFKA 1NB2A 3TZWA 3TZXA 3KLVA 2XBPA 3BREA 3QGPA 1T9YA 3HVWA 2VA2A 3GCXP 3OLAA 3TA1A 2Q6CA 1YBAA 1C0TB 4DU8A 1YLXA 3MTJA 5F9NA 3PIOQ 1NH7A 2DHAA 4TN2A 2AGQA 4RLEA 4ATNA 4M5DA 1NK6A 4WZMA 2H1YA 5T7LA 3I96A 4L76A 1S9EB 1YJNS 4AYBD 2AIRB 1BGXT 2GA7A 2PECA 1RAIB 1Q16B 4YFOA 1OFDA 1DJ0A 2N7CA 3VSUA 1SL2A 4FBUA 1SL1A 1HNZF 3QGHA 1PJ7A 1PSDA 3NY0A 4P2MA 1EQMA 1W2BR 3K58A 3CD6S 2RU9A 2KYXA 4ZVPB 2JEJA 2BACA 4DMZA 1LK5A 3SQOP 1IM6A 4DCPB 4B9TA 2DJWA 3OVAA 3K59A 3KLIB 3JQKA 2HRYA 1MWYA 2C2KB 3DLEB 1IKVA 3G4SS 3TJAA 1KTQA 1CVJA 4Z2XA 3JX8A 3HD2A 2E9RX 3TO8A 1X4EA 2KZZA 3L3CA 2BR0A 3U1LA 3I4PA 1KCDA 2LLZA 2QL5B 2VB6A 3FSXA 2HFVA 2YWKA 1CPZA 4ID8A 3C46A 3HULA 3M30A 1U2CA 4LR9A 1SPBP 2V50A 3MPWA 2WSFC 2UZAA 2KB2A 2AJQA 4I4BA 4KAIA 2O1PA 3EPIA 2IA6A 1X0PA 5J1EA 5HBMA 1LWFB 3MR3A 2ALZA 2P6SA 3DU6A 2F63A 5KAKA 2HK3A 3FFIA 3IC1A 2LDYA 4OZ0A 3F0NA 2Y9HA 2IAJB 1O8GA 1D9FA 4ZLJA 4W90B 1VBZA 1JLBA 2FJWA 4HACB 2HZVA 2QL7B 3AQPA 3ITHB 4LRDA 2NYIA 3DHXA 4CYUA 1X9SA 1TELA 4B3TJ 1DFDA 1CLFA 5K9FA 2QIFA 2QEXS 1NXIA 2YUHA 1JNZB 1WC0A 4USUA 5IXUA 3RGIA 4USTA 2BE2B 2XCPA 4PQUB 1GMWD 2VIHA 1BWVA 5T14A 3GLJA 3CCRS 2W4DA 2W2NP 4FVCA 1JXVA 1QE1B 2VFTA 1VDHA 2W9BA 4AXJA 1SIZA 5CCMA 1S0VA 1N88A 1M5HA 3I32A 1S7HA 3D3BJ 3T5HA 1KTWA 2XZTB 1RHRB 4ID5A 5FDLA 1KS2A 2XO7A 4ZP8A 4B9UA 5KG2A 2WRMA 1Q8LA 2VDHA 1U1NA 1RABB 3KG0A 1QUPA 1TV6A 1YX2A 5A8RB 4NOHA 1IKXA 3P45B 5F9LA 3MCMA 2AWZA 3HK2A 4ED8A 3TUPA 2V9WA 1KNZA 2HZAA 3ELHA 1T03A 3MR5A 2LXFA 2UUCJ 2H65B 4X4UA 3PZPA 1S6PA 5C2CA 4DX5A 4OHVA 2KTQA 1IDJA 4PXDA 3HFKA 3H4DA 1O8JA 1SKUB 1DZ5A 3NOGA 4ITSA 2CQBA 4IDKA 4M5JA 2AYMA 1SKSA 4PRFA 2MKCA 5C25B 2IA0A 4OJHA 2BABA 2P6TA 1VRTB 1U0HB 1T3OA 1KC8T 4KE5A 4V02C 1FKPB 2JHEA 5E3PA 1SV5A 1NAQA 1IR1A 1F1BB 4ZS6A 1AB8A 4B9MA 4KGZB 1LLZA 2DIUA 3OXLA 4TNOA 1DHMA 2MZJA 5I3UB 1RKIA 1TFWA 4DPOA 1ZA1B 1OGOX 2ZKTA 5IV3A 3OJSA 1U1KA 4XONA 3NNCA 1NU4A 1KFSA 1DQAA 2MKYA 3EVMA 2ACYA 2HVHA 2E29A 4N56A 3C6UA 4EO6A 2KG1A 1U26A 4DQSA 3GFYA 1FVQA 4DQPA 5J1PA 3SCKE 2FVSA 1MSWD 3B54A 2K7KA 2D1CA 2O04A 3NGDA 4ZPWR 3QJPA 4ZPCA 4KC5A 2C22A 3KUGA 4J9MA 4ES2A 2HFUA 1FXRA 5HATA 2QA4G 1EIYB 5DG9A 1RYRA 4OQJA 4P2SA 5KG3A 3PKYA 4DSJA 1WOSA 2J7WA 4HHHA 1T11A 2DY9A 3CO9A 1RWXB 1TK5A 2V8HA 4QIWD 2WBMA 2OFHX 2J0XA 4GVLA 3DOMB 1C0UA 2CYYA 4PKDB 5D4LA 1G4CA 2Y1RI 4IG0B 3NB2A 2A1BA 1TL7B 1LEOA 1Q78A 1H74A 2O01C 3C3LA 3NGTA 3SYJA 1PBAA 3ENQA 4ZOSA 3TUJC 2IQ7A 4DG1B 3CCWA 2VFRA 4I2QA 4ZJLA 3M1VB 1N5YB 5J2PA 4ZCKA 4DV7F 5KFBA 3HSDA 1SJ4P 2PIIA 1RHQB 3PSSA 1JLGA 1X0FA 4KQZA 3CD0A 5C42A 2LECA 3DYAA 1XMQJ 3IG1B 2OH2A 3BKUA 1RAFB 3M2RB 3EDRB 4GO7X 1NPPA 1UVNA 2F65A 2D3UA 2ZM6J 2BZ2A 2QMWA 2Y8YA 4I68A 1H73A 3FCVA 5KG0A 4KPYA 3ADAC 4YR3A 2JZ5A 1CJTB 2QSFA 5LJ3Y 1K9MT 3TZZA 3VGTA 2BEFA 3MR7A 3MM5A 4ELTA 2QMXA 3CC4S 1RHMB 2DGUA 3ML3A 1S1UA 2CQ2A 2OHDA 1YRTA 3GSDA 4CO5A 1OIAA 3D7SB 3TUZC 2H51B 3OPKA 4C6AA 1HWKA 2F4FA 3HP6A 2EVZA 1FRHA 2AU0A 2A3JA 2XY6A 3P3DA 1PJ6A 3SI8A 5KFCA 2FJBB 1M1KT 1C4CA 1KSPA 3IBFB 5F8MA 1KD1T 2HQ3A 4JV2A 3IN5A 2R7VA 4FVMA 2N82B 2CPEA 4YZXA 2GZOA 1UAWA 2N3OA 5DS7A 3SCJE 2MYFA 3JQMA 3MOJB 3SSRA 2FZGB 3N79A 1YITS 3PHEA 2J76E 5JUMA 3HVRA 2HMIA 3T5KA 2B51A 2B6AA 1UVIA 5KG6A 2RIJA 3D6HB 3I87A 2DXFA 4LFCF 3OUYA 2QLBB 2QXZA 1OMSA 4URGA 1HBNB 4F4YA 2E9TA 2EC2A 1J5EF 5SZTA 3H20A 1TVRA 2WOMB 3HXMA 5F8NA 2BANB 4P10A 5IC4B 2RDIA 4P2XA 4OZZA 3ET6B 1RACB 2X6XA 3OSNA 1PBUA 1P6TA 3K8WA 3GIIA 2XNRA 4O3NA 3K5MA 4ED7A 3HHKA 4DLGA 4QYZJ 1YQHA 3JYTB 4TY8A 4X4TA 2MQOA 1ULRA 2J9CA 2L9WA 4CLKA 2FD2A 2UVEA 1S72S 4DI6A 3PG9A 2F3LA 3H5UA 2HGLA 3RAMA 5J2MA 4ZCMA 3ENWA 1RTIA 2CIMA 1FRKA 2OAUA 5CYMB 2GW8A 5KT2A 2UU9F 2J6UA 1QY7A 1YZ7A 2EFQA 5KFXA 2FQQB 3PJWA 2E1PA 3VAFA 4W8QA 2CXEA 2ZITA 1QLNA 2DNOA 3M8YA 2W9CA 3TAQA 1RT7B 4YC5A 1H0HB 4DL5A 5ETLA 5H1SV 5KT4A 4OJLA 2D3ZA 3W62A 2IVYA 2L48A 3N9UC 4CLLA 2KXFA 4NL5A 4J9OA 1EZGA 2VFPA 4GC6A 1RHJB 1WG1A 1Q5YA 2BJEA 2KRRA 4DPUA 3D68A 1QCXA 5AJ3J 3VGVA 2FDNA 3N4WA 1FKOB 3SV3A 4B9NA 4KH0B 3AOBA 4XN3A 1WC4A 5CD4H 3OXGA 3O8WA 1LFWA 4DWIA 2A6MA 1T7PA 4WE1B 1VQKS 1FFWB 1MG7A 3CJ8A 1WACA 4WP8A 1KOHA 4GVBB 2EXUA 1TYWA 2NSPA 1D0EA 3GV5B 2AGPA 2M9KA 3CGIA 4LF8J 1IBCB 2GFFA 2YWWA 3CJ0A 3VVTA 1A0OB 2INUA 3UDVA 2C2DA 2AYGA 3FRYA 3KLHB 1UCNA 4C0BA 4G1IA 3QWUA 5EUHA 2DNQA 2MHNA 5DZ7A 3AODA 2ZEJA 2DXDA 2VBKA 1QTMA 3FSYA 2ROEA 3Q23A 2M0GB 2CZ9A 5DQGA 1BE4A 4P75A 4ILRA 1OQ3A 1LQ9A 2DTJA 3G8SA 2Q43A 2KH9A 3SZ2A 3FCWA 2GIFA 3MEGB 2GMLA 3PRBA 1GX5A 2K06A 1VLYA 4JI3J 4DFMA 2HNDA 5BR8F 3GSIA 4QR2A 5C2GA 2YKMB 2M52A 3GZ7A 1VQ7S 5FLXU 3BSCA 2IAJA 5G0RB 1FNMA 2JRSA 4OYMA 2O66A 4YY3F 3DMJA 1H7WA 1ZH5A 5ETSA 1GQEA 3SQGB 2QZAA 4HACA 3EQOA 2HBRB 4HI1A 3THTA 3GIKA 1NMEB 3DNCA 3BGRB 4V1Ak 2KM8B 2XLJA 4XOTA 2QFJA 3D1HA 3LGMA 4IFYB 4JYAJ 3S7RA 3CULA 4WK3A 3CD7A 2F8EX 1VMBA 2BE2A 4PQUA 3DI6B 3MF5A 1TL4A 2CAJA 4WTOB 1QAYA 3EE3A 1FCAA 2AW0A 3HKZD 4OYPA 3ZZTA 2HBZB 4NXNJ 1RT6B 1QE1A 1AUSL 4ZP6A 2C2EA 1S79A 4ENOA 1ZOTA 1Q8IA 2QN6B 1XJWB 3DDNA 3M9NB 5BYRA 2ATLA 1WORA 3NAWA 1KBRA 1NJYA 2C3YA 4MTPA 1XTZA 1UJ4A 1VC0A 1CULB 1RWUA 3ZTRA 2V4RA 3L4BC 1FE4A 2HW3A 2ZBCA 4OYXA 3NCPA 2RF2A 3FEZA 2ASDA 3EGWB 3ILJA 5A8RA 2ZBRA 4ZIVA 3HSGA 4D3HA 3H25A 3RU0A 3KMQA 2J8SA 4J9KA 4Y6IA 4X84A 4A8YA 3A8EA 2MY7A 3CDAA 4IQMA 1WEYA 1NKCA 1PAEX 4HHJA 3N6ZA 3P5BP 2M8HA 2HRTA 4ZIWA 1HWIA 3OD2A 5L1KA 4RPFA 1FFGB 3MFHA 5KFLA 4C3KA 2C3PA 2ASJA 1SC1B 4E98A 1JLEB 1RT5A 5B0CA 1UP1A 2A18A 1NPRA 2APOA 1T9UA 4JB8B 2OELA 4N77A 5KOXA 1H2UX 2CRLA 5GADU 4ECUA 2HHHJ 1VRTA 1U0HA 3CTRA 3J7A1 4N41A 2IJFA 3TVKA 4OJGA 3PX0A 4K4UA 5DDOC 2M4MA 1ZPWX 5DGBA 2AMCB 4XQFA 2XMUA 1L3UA 5IZHA 2HURA 1RTZA 2XT4A 1L3KA 2DO4A 4U6PA 4DV5F 4ZLLA 3G6ES 3N6MA 2NREA 4TU8A 1XNQF 5MLCV 1NZ8A 1IJFB 3K7RA 1RB0A 3GPAA 1WWHA 4B3RJ 5LMUJ 4K59A 2YPYA 1UPMB 2UXCJ 4GKKJ 1ZBTA 3FZ2A 2OD4A 3DLBA 2ZJRQ 3TR5A 4JI7J 1T0TV 3US5A 2OPQA 5KFHA 1R7IA 3MPUB 2ADBA 2WVDA 2MZ1A 3J7ZT 2HHPA 1T02A 5K8PA 2VBWA 3BBFA 2KRBA 3GYGA 4I0WA 3BH7B 3BGLA 2CZ4A 2HNZB 1VISA 4I2PB 3TQEA 2ZVIA 1NHCA 2PE8A 4B9SA 2IBKA 1S59A 4G3IA 1WC1A 3R27A 2OPRB 1D09B 2EG2A 5JLVC 4FNIA 2JFDA 4PAAA 2G4BA 5EWFA 5D4PA 3PR4A 3HHLA 1LWXA 4WFZA 1HNVA 4IG0A 2EFPA 4QU7A 2YX4A 6FDRA 2ACMA 2CPHA 1X0CA 4P71A 2NXJA 2JNJA 1P27B 1U6BA 5KFNA 2CNOB 4RUCA 4RNNA 4WCEQ 3MECA 2VG7A 2V63A 3MCNA 3QNWB 3CIMA 1FO1A 1BXNA 3WC2A 3VVUA 2BX6A 4C4WA 3LPEA 4C0HA 3SQVA 3IG1A 4MYTA 1S57A 4IFVB 1K73T 5K8MA 5HLFA 2Z8GA 4F3OA 1UKUA 1EE6A 4RBTA 2Y1LB 2MSTA 1HD1A 3H09A 2Z4PA 3OFGA 2YNIB 1TFYA 2VBZA 4OFZA 4MFBA 3ZTOA 4DR7F 2FYXA 1WC5A 2UV8A 1I51B 3MMAA 3ULHA 4PXEA 4PG4A 1GAOA 3ISZA 2KHCA 4QJVA 4ECSA 2AT1B 3KHRA 4B3SJ 1X8DA 4JP8A 2YKPA 2MY8A 2IDLA 5CXTA 1WMRA 4YB7A 2BXJA 1X5SA 4DV2F 2C2ZB 4O3QA 3PX4A 2IM2A 2V8GA 3PW7A 2DVIA 4O4GB 4H4KC 3NEKA 5HQMA 1ZETA 1LW0B 2FLPA 2GAGC 3HM9A 1OY8A 2JEFA 1TKZB 3GV8B 4ETXA 4O3RA 4ZPDA 1SI9A 4JV5J 3HJVA 3R1HA 3IRXA 1WHYA 2VBYA 3LYCA 1FWLA 1U1MA 3LW5C 4OJ3A 4YZAA 2ZH1A 1CEZA 1BD6A 6FD1A 3BSAA 3O6QA 4UQGA 2HKEA 2F4VJ 4OYBA 2LVWA 1PKUA 3K5PA 2N4CA 4Y28C 1GEHA 1LNQA 1HBNA 1FRLA 3VAMA 2ZKUA 3PRDA 1S48A 2D9PA 2E5JA 3NLCA 1ITPA 1RKJA 1VK8A 5HI7A 2QJ3A 1X5PA 3S6EA 4R8UA 2CJBA 1VI7A 4NCGB 4CLTA 2EI5A 4J9UE 3JYTA 3MCSA 3ETMA 2QL9B 3CPWR 1M5SA 4CNZA 1NK9A 1RU2A 1ZAVA 3S01A 2ZOFA 2LFVA 2YPZA 4FYYB 1BQMB 1HIYA 2DH9A 4JI2J 2XWXA 2XYGB 2YQ1A 3UPFA 1FRIA 4RUBA 1VQ9S 1Y5IB 2XZWA 3ZNJ1 1GQ8A 1UWBA 2XB2D 3WDOA 2H48B 2EFOA 2C2MB 3CXCR 3WWGA 5CYMA 3H0PA 2FZCB 4I7FB 1WHXA 4DCJB 5HSPA 1KQSR 1VQ4S 4QIVA 4USWA 2X1GA 3CCSS 2XI3A 4MYUA 2HGMA 1H2TZ 2XNQA 2MJUA 1I6JA 3DLKB 2JVRA 4DX6A 1JWWA 4DV1J 4DV6F 4I6WA 4WWSA 2EFNA 2H5EA 4QR1A 1LOUA 1AROP 1U8WA 2BJ9A 1T9TA 3JS9A 3LA0A 2BKOA 4FS2A 2Z58B 1DBDA 1N32J 3EGZA 2VASA 4QZVB 3LAMA 4DL3A 4K2JA 2OJ3A 1XBWA 3OR1B 1FERA 1JMTA 3TJ8A 3LF0A 3M6UA 2IVFB 3SY2A 4Q44A 2QY1A 4DR5J 1RP5A 4USJC 1TKXA 4YCQA 2V0NA 1WNEA 2UVWA 5A2QY 2ILZA 1VJQA 4IO1A 4KPCA 1CC7A 2N7YA 4JI5J 4WE1A 2G0JA 2QX0A 2WSCC 4K50A 4B3RF 4YHHF 2RDDA 4LSZB 2E7VA 1O51A 2JJ4D 3MM7A 5ETMA 2CJAA 1FRMA 3E3XA 2KFNA 1WDDA 3RRHA 4TLRA 1RA6A 2LCWA 3NXZA 4RW8B 2FY8A 4FKYA 2YVSA 1HMVA 3OL6A 3IS9B 1S5ZA 2FLLA 1CJKA 4HHUA 2MQMA 4A47A 2E44A 3VAKA 5IT9Y 2DCLA 2RKIB 4NLYA 3DM2B 2NXEA 3T9NA 3NNAA 4F04B 2G1HA 2F7VA 2NLWA 2WW8A 1Q7LB 2YKMA 2B4VA 4XO0A 3MM8B 3N6NA 4FPIA 3QATA 5G0RA 2P9CA 1QA1A 2R7XA 4ETZA 1QUVA 3OTCA 4Y34A 3RR8A 3SQGA 4DV3J 1O6XA 5DG7A 4QWCA 1TYUA 4WK1A 4F2SA 2LU2A 2AP6A 4LF1A 1VC6A 4U9RA 3D1OA 3LOUA 3U7JA 4BLGA 1HR0F 1XWLA 3NBPB 4G1QB 3EXCX 3TARA 4O3SA 3T6BA 1IKYA 3DLHA 2R2UA 4Q8EA 1S10A 1BLUA 1DTTB 2HQDA 3QBCA 2MKJA 1EARA 1UEUA 1TKDA 1D3WA 3PFOA 4LFBF 4WZQA 3ZZOA 1JTAA 5THWA 1GFWB 3I6PA 1RT4B 1SH0A 1YKWA 3HHNB 2UVRA 2JLEA 3MWBA 5KFRA 4DR1J 2I9SA 3EZ5A 4ZCLA 2O67A 2ZH2A 1OWXA 1NJIT 3JSRA 2HHTA 2D9OA 1F9HA 4C8OA 3VMWA 4EYHB 2J8IA 1VQNS 3W2VB 1OJ4A 2KVIA 4DS5A 3EX7B 3H8YA 5DNSA 2RQ4A 3ZTSA 3T3FA 1PLUA 3WIUA 3MAAB 2B4UA 4OYZA 2DT9A 2UUBF 3Q8PB 3IA0A 1QAIA 2RVJA 4AT1B 2V34A 2MZTA 3LAKA 2KO1A 2FLOA 4IRKA 2E1AA 3MD3A 4WIQA 3HHLD 3RAXA 3R7BB 4HEA9 3BR8A 4OLOA 1UWAA 4JOUA 4PG6A 5H9EJ 3E2EA 4FNHA 1S4EA 1FTCA 1OYEA 4OJ5A 3M05A 5J2QB 2CQDA 3UDCA 1O8FA 2OIHA 4LREA 1ICEB 3U02A 2DGXA 4LF5F 2RUSA 1GT8A 1MMLA 2OSQA 2XI2A 1SKWA 3Q2SC 4U8YA 3OLBA 3I55S 2POKA 2DGSA 4ECRA 5GAEU 2AZ3A 1F5BA 4WKYA 2CA9A 4X64J 4W8RA 1OGMX 3NGRA 4NASA 3W7BA 3SFUA 1QTNB 4FF3A 2YKAA 2IRUA 1NSPA 4F02A 2RT3A 1F0XA 4FPRA 3KK2A 2XGPA 4ZPAA 2ZVSA 2UUAJ 4A8KA 1HNIA 1RCXB 1R8CA 2VBXA 4J9NA 2VKZG 1S6QA 1WELA 1U1QA 1K8AT 4AQYF 4EYIB 3AK5A 2YTCA 2F9DA 2JDJA 2VBEA 1KWMA 3V6HA 4DZ6A 1F60B 1QA2A 2YH1A 2HS4A 2R7QA 1JX4A 5ETTA 1I5OB 4O4RA 3SSQA 3IP0A 2ZHAA 4CNYA 3GB0A 1C4AA 3E01B 4LQ3A 5A8KB 2XEXA 3OVBA 3DGVA 3B90A 2QX3A 5CCLA 4DQRA 4U7CA 1HQEA 2CQHA 2MZRA 3CO0P 1CJUA 2WCXA 3AQOA 3FBFA 1SIWB 1U02A 2ASLA 3SDEB 3QO9A 3TW0A 2AQ4A 4C2LA 5L38A 4NA3A 3DKDA 5HMXA 4X65F 2VV5A 1F5AA 2LEPA 3AD7C 3SIPB 3I4HX 3KMSA 1Z2ZA 2P2CB 1C1BB 5DDPC 2DHGA 3MAQA 1ZM4A 1RWRA 2Z2MA 2XHWA 2NTPA 3IR5B 3G71S 2GIRA 5C1CA 4DR5F 1WTBA 2ZH7A 4UW2A 2GNKA 1JLFB 1O0PA 4URSA 2R7WA 4ZLPA 1EZZB 2SXLA 3G6YA 4IFVA 4MKBA 5E2QA 4DUZF 3IWXA 1RYSA 2WK4A 2K2PA 3P4GA 4TU9A 3PCOB 5F0WA 1MMDA 4J9SA 4QW9A 1V3RA 1JNRB 4YUDA 4ZVFA 3JQJA 3G82B 5L8RC 3ISND 3NL0A 3MR2A 2K1RA 1WEZA 1NNDA 2YWHA 5KG4A 3W9IA 3CJ4A 5KFPA 2BSPA 1L5UA 1YJVA 2ZDPA 4K4ZA 2KL8A 3EPGA 1GK8A 2E7WA 1M5KC 3I0RB 2WHOA 4YR0A 1X4FA 1SB6A 4C8LA 1N36J 5G4DA 3JSMA 4LFAJ 5C24B 3SMZA 2W7OA 4O4GA 1WOOA 3M2VB 1CS4B 4QYZK 5A8WA 3H4BA 4YQWA 5L1LA 4EMDA 2DNLA 4JI0J 1R0AB 2MJNA 4R5PB 3DXSX 1TKZA 2XQCA 5B09A 2N4DA 1PG5B 1A7GE 5E33A 2Z2ZA 3HKWA 1R8BA 2VFVA 4NXMF 3J80U 5H9FJ 1H2VZ 1XMOJ 1UFWA 5GAGU 2FC9A 4DV3F 4K8RA 1BN8A 5GVQA 2FJVA 3OL8A 1VIOA 5IWAF 3GQ8A 2DGWA 1JQGA 5GMKa 1EKRA 2UV8G 1VRUA 1KDNA 1X4BA 4IOBA 4RW9B 2H4WB 4DL4A 2BUNA 2HHSA 2MLZA 4X4QA 4EW9A 1QM9A 4HL9A 3CJKA 1RAAB 4DEZA 5BYQA 1K5CA 2CWXA 4AL7A 2UXDJ 3KKFA 1NK0A 2COLA 2AJ0A 2BJDA 2RU3A 4J91A 1HYSB 2W8LA 4NCGA 4OLPA 1U48A 3D1QA 1BC6A 5D78A 3BB5A 2VDIA 2VU5A 1VBLA 3CDEA 3MD1A 4DR1F 1BQMA 2V5IA 3V6DA 4QIGA 4WXWA 1FJCA 1YK9A 4XNFA 3MR6A 2WAQD 4ECQA 1REGX 3FSIA 1YJ9S 2BQUA 1G2EA 4O44A 3TWZA 3M8PB 5KT5A 1W2IA 4I84A 4XMYA 1LXNA 2ZBIA 4I7FA 2FB0A 4EK2A 3FQLA 1FWKA 4BBYA 3B78A 4ZJOA 2HVZA 1PYOB 2B9WA 1ZA2B 1XN9A 5A0YA 1BHNA 3H98A 2J5AA 2CJ9A 3J7Z5 1HBOB 3SCIE 1KONA 3DLKA 3UCUP 5GMDA 3D0GE 2BW2A 1IVZA 4KFBB 1DRZA 4DR6J 1PCAA 1VR6A 1X60A 2YNGB 4W98A 2NYHA 5LOQA 1HNWF 4HWVA 1VQ5S 2XYPB 3KJVA 2EFVA 4XDDA 3K5OA 3OR1A 4CH1A 5GAHI 3FZBA 1IKWB 2KHDA 1LWEB 4ZLNA 2H5IB 1Z4UA 3V5RA 4L6V3 3UFCX 3A3PB 1C1CB 3AXKA 1P9QC 5I3PA 1TUVA 2LA6A 4PUOB 2JL9A 2PYHA 3MXHP 1FWPA 4L74A 3V2UC 2QA1A 3Q89A 2IVMA 4NK6A 4NA2A 2DO0A 1BQNA 1TP7A 4F67A 4DPXA 2DR5A 2O5DA 1AZSB 1FEEA 4OL8A 4M63A 4QYRA 1NSKL 1K0TA 2YNFA 3H59A 3CT9A 2OPPB 2X1BA 2AEMA 1DAXA 3G8TA 4M94A 2VG6B 2VJIA 3L7UA 2VUGA 4LRBA 4RW8A 1LFPA 2DNPA 2NTBA 5CYQB 3WQPA 9RUBA 2ADCA 1Q79A 2ZZTA 1GMWA 3KK1B 4JI6J 2V8DA 4NLWA 2CUYA 2WVCA 4ZVQB 2DNHA 2RKIA 3GIJA 2LQBA 3VAJA 1P1TA 3POTA 4DR2J 3DGPB 3MM9B 4RW6B 5DLFA 1EA0A 1UFKA 3K2YA 4B02A 2L3MA 2O3DA 4LMZA 4U49A 4Q2LA 2VPZB 1Y3KA 4UQTA 2ZH6A 1FTRA 4PPDA 3DRRB 4RKUC 4KGKA 4P6QA 1FJGJ 1O8EA 4OM9A 1Q82T 2XMTA 3DRSA 2EBGA 5HANA 4YEAA 5KFSA 1I94J 1DTTA 4ZHRB 2W2PP 2HWTA 2FZKB 2OFGX 1JLCA 4C11B 4JV0A 3QT6A 1OO0B 1HWLA 4AL6A 2HHWA 3FEYB 2QLWA 2GJFA 3BQ2A 1OS5A 1RT4A 3Q22A 4IR9A 2MPUA 1JRGA 1XMBA 1U4BA 3IWLA 1KTVA 2JSXA 4USVA 3UD5A 4OJPA 4UOGA 1KOOA 3CCES 4U67Q 4FXWA 1LW2B 1NSAA 1T05B 1UEVA 5ETNA 4C0OC 3C66A 3QMQA 1HNXJ 1FVSA 2GV1A 4BC9A 3MAAA 3EWGA 4PG7A 5F3ZA 3N90A 3KJFB 4Q8FA 4I67A 4LFAF 2CG8A 4DFJA 5LSOA 2HNYB 1NH8A 3R2DJ 1Q5VA 4NYPA 3OSPA 3C8YA 3KHGA 1K47A 1IA5A 3EVWA 4IOAQ 4M5MA 1MN9A 5M2PA 4Y2CA 1XMOF 1EB0A 3C6TB 4OI4A 4MK8A 3M8RA 3CCTA 2KM8C 1TUWA 3DRXA 4F50A 3SSSA 2C2OB 3M6XA 4KGMA 5KFQA 1IN0A 2GHVC 5HVGA 2F5GA 4HT5A 1HBMA 2CFXA 4RU2A 1IJEB 2OLWA 4X2BA 2I38A 4TXSA 1VBYA 2UXDF 3PV8A 1T8EA 3OTBA 4WJBA 3F41A 1R8AA 5DJBA 3TEHB 3G6XA 2BV3A 4PQAA 1S97A 3CC7S 4U96A 4DL2A 3BS9A 3MPYA 2E5HA 1M0SA 1T9VA 4PYAA 3M8QB 1BHEA 4LF9J 3RRGA 1RT1B 1RMGA 3BDPA 2NT6A 1J5OB 4IRDA 1PE9A 2PEHA 1X9WA 4A8QA 2E9ZA 4ICLA 4I64A 1HL6A 2XTYA 4ED0A 1EP4B 1F9EB 5JJBA 1RTJB 4TKTA 2V2VA 2V6AA 4YDDB 5LMNJ 1L1IA 3PFEA 2DGTA 2KT2A 1X4GA 2AD9A 4DF4A 1MROB 2NQPA 1SQFA 3BZQA 3HZGA 2DPIA 3E01A 4PXBA 5D0GA 5A8KA 2W2MP 5IOLA 1IBLJ 2J6SA 4OZ5A 4XLEA 3A4TA 1W26A 3NKYA 2F40A 1QDUB 4NMXA 3AOAA 4CT8A 4DL0C 2DH7A 3HDSA 4LUBA 2HWHA 2C28A 4DZDA 4DUYJ 4PG8A 4IUFA 4KKOB 4LRFA 1U25A 2J8AA 3Q8UA 4UT4A 2RNEA 4DR6F 5A76A 2PN6A 1OFLA 4B3MJ 1WKJA 4MK9A 1DLOB 2HPUA 3QIPB 1NBEB 3DDKA 1NDCA 1H7XA 3EUNA 1RAEB 1KLMB 3FQKA 3SEOA 1YSJA 1CLWA 2XSFA 2HQCA 4EBCA 2Q3PA 5KT7A 4DPWA 3T9GA 1KVIA 5LSLA 5B7WA 1WG4A 2IM0A 1ZM9A 4B9LA 4USIA 1FF2A 4M1KA 5K5MA 3TANA 1GMVA 4NRUA 4ZPVR 2MGZB 3OFEA 3AFGA 3K0JA 3OR2A 4K4SA 5FJ4A 2ROGA 2FVQA 3D4JA 2BM7A 1JJCB 2WONA 3A8KA 3C19A 2D69A 3FC9A 1S1TA 2E5LJ 3V6JA 2VFSA 2IOUG 3MM6B 1S1WB 1R8PA 3KLEB 3PKMA 4UOHA 4UZBA 3AOCA 1NHKL 2HVEA 3ICLA 4QIFA 4H4MA 4R25A 3AAWB 2QA2A 1R6VA 3I0RA 3QT7A 1G7CB 1VOMA 1VQMS 3D0HE 4PPZA 3FUYA 5C24A 2RRNA 3DOKB 4OX9J 2MB0B 1YIJS 4GKJJ 2XSJB 3GQ7A 4JI6F 3TZYA 1CS4A 3QT8A 4KYZA 4XL9A 1OFEA 3GYNA 3UD4P 1RADB 4OYIA 2E7XA 2ASYA 1DBOA 3T1HJ 2CQ4A 4YS2A 4M8LA 2C3UA 4XAKA 5D3GA 3OFHA 1RTHB 1QJVA 1E6YA 1VYAA 1XK8A 1HI1A 4ZP9A 2ZE2B 2DISA 1OYDA 2MKSA 2XHCA 1YZ6A 1MU2B 1D1UA 1GX6A 3RYLA 5JMCB 3TOQA 5HP1B 2YNHB 1TZ0A 5L39A 5AT1B 1OY6A 1GMUA 2W24A 4MIAA 4RW9A 3CJ5A 3D28A 5CYJA 3B82A 4LF6J 2ODLA 2EKYA 4YZQA 2WVEA 2ROPA 4RX6A 4IH5A 2Q1LA 4NCBA 4FZVA 1IBMJ 2DHHA 4RNOA 4RW7A 1U45A 2RH3A 3GJSB 1N4LA 3SUCA 1MNEA 2QE5A 4HDHA 4KR0B 4E8UA 3HI9A 3UVJB 3LTOA 4ER8A 5KG5A 1FA0A 2DPJA 1SKRA 1IQZA 1P8GA 1B3TA 4CRJA 5J2NA 1Y0HA 1R3NA 4CO1A 3LWMA 1S76D 1HWJA 1DBGA 1WF0A 2DKOB 1FXLA 3TH0A 2VG5B 2CJQA 3CJQA 1UZHA 2RJZA 1TL3A 5DQHA 4ECZA 3UQSA 2MLXA 3M8PA 2GGPB 3CCLS 2R8HA 1HWUA 3UN5A 2OSRA 2I5JA 3MMBB 1GTEA 1Q0NA 2DNNA 2LQJA 4Q7AA 2QO3A 3ETOA 4KT0C 3I9ZA 3CC2S 1IWGA 3CJTA 3THPA 2U1AA 2U2FA 3J81j 1Q95G 1RWWB 1PYTA 3TQ1A 3HD1A 1VQYA 4JRAC 2AHOB 3V4IB 1F2GA 1N48A 2H4YB 3GIMA 5HVHA 4ECXA 4DV0J 4XR6A 4DV4J 3UNGC 3M8ZA 1QSYA 2R8GA 3QFWA 4KFBA 4LF7F 1HBUA 1R0CB 2ZHBA 4OV6A 3K57A 4XPCA 1FK9A 1NLKL 2Y0SD 4FF1A 3HSZA 1NB7A 2A2CA 3LH2S 3AB2B 1LLWA 1KR4A 1RAHB 4DS4A 2RRAA 4KV8B 3R5AA 2M70A 5F0UA 5KFOA 2PD1A 1UW4A 2D3OR 2B43A 3VMVA 5JVGQ 1IB4A 3GFXA 1JLAB 3PHTA 1SL0A 3GR0A 1FJ7A 1PJ5A 4PUOA 3W61A 4LF4J 1S9GB 1TAQA
chains in the Genus database with same CATH topology
2F3LA 4UOFA 3JX8A 1S5ZA 4OJOA 4FKXA 4WBFA 3BH6B 1WKLA 3ETMA 3EVWA 3Q8YA 1NCLA 3L7UA 1MN9A 5JMCB 2AZ3A 3EJMA 3B54A 2DYAA 1B99A 3G2XA 1NDKA 3FBCA 1WKKA 3B6BA 3GPAA 4JRAC 4S0MA 2J8IA 3NGRA 2BM7A 3NGSA 3FC9A 3Q8VA 5CABA 1HIYA 1NDPA 4ANCA 4ANDA 1JXVA 3FBFA 1TYWA 1PAEX 3BBCA 1F6TA 4W98A 1K8FA 3N6ZA 5BXIA 1QA1A 2IOUG 3BBBA 1F3FA 2W7ZA 2XC1A 1NSPA 4UOHA 3VVTA 5IOLA 2B0RA 4HR2A 3ZTSA 1K4ZA 3DKDA 3ENAA 1KQ5A 1UCNA 2VFOA 2CWKA 1NHKL 2DXFA 3VVUA 4OJPA 2HVEA 1XIQA 2VU5A 2BX6A 3FCVA 4CP5A 4UOGA 3EE3A 4F4AA 4KPCA 2BM6A 3NGUA 1TYUA 5CAAA 1MN7A 3LJYA 3RIQA 4V02C 1EHWA 2V5IA 2B8QA 3VGTA 1S57A 2BEFA 2DY9A 1WXRA 3SZEA 2B8PA 3BBFA 1NSQA 3LYCA 3FBEA 2VFNA 1NPKA 3Q8UA 2DXDA 1ZS6A 3BH7B 1BUXA 1NLKL 3ML3A 2DXEA 3FKBA 4OJLA 3Q83A 3Q86A 4ENOA 3PRVA 3H09A 1WKJA 1TYXA 3AK5A 1NDLA 1QRCA 3EMTA 2AZ1A 3R9LA 3N90A 4C6AA 1BE4A 3DDIA 3ZTPA 1PKUA 1S59A 4OJ5A 2VFPA 2BM5A 3Q89A 3PETA 4KH3A 3VGSA 4DUTA 1HHQA 1NDCA 3ZTQA 1B4SA 3ZTOA 4O0NA 3FCWA 3FBBA 3WX8A 3VGUA 4DZ6A 3ZTRA 2VFQA 1K44A 1LEOA 3PJ9A 1TYVA 1CLWA 1QQ1A 4ANEA 5JLVC 4EK2A 4F36A 1QA2A 2HVDA 2VFMA 3TH0A 4OM9A 3NGTA 3EM1A 4OPWA 3P4GA 1HLWA 1QA3A 3SYJA 1QRBA 1HF2A 3EVMA 3ELHA 3MPDA 1NSKL 1XQIA 1NUEA 3EICA 2ZUAA 3GP9A 3VGVA 1U8WA 4OJ6A 2NCKL 3EVOA 3JS9A 2BM4A 4FKYA 1BHNA 2HURA 1NB2A 1TSPA 1KDNA 2G0YA 1LWXA 5C7PA 1DABA 1W7WA 1VYAA 2YUHA 4DI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOF A;  1S5Z A;  4FKX A;  4WBF A;  3BH6 B;  1WKL A;  3ETM A;  3EVW A;  3Q8Y A;  1NCL A;  2YUH A;  3L7U A;  1MN9 A;  3EJM A;  2AZ3 A;  3B54 A;  2DYA A;  1B99 A;  3G2X A;  1NDK A;  3FBC A;  1WKK A;  3B6B A;  3GPA A;  4S0M A;  3NGR A;  3NGS A;  3FC9 A;  3Q8V A;  5CAB A;  1HIY A;  1NDP A;  4ANC A;  4AND A;  1JXV A;  3FBF A;  1PAE X;  3BBC A;  1F6T A;  4W98 A;  1K8F A;  5BXI A;  3BBB A;  1F3F A;  1NSP A;  4UOH A;  3VVT A;  5IOL A;  2B0R A;  4HR2 A;  3ZTS A;  1K4Z A;  3DKD A;  3ENA A;  1KQ5 A;  1UCN A;  2CWK A;  1NHK L;  2DXF A;  3VVU A;  2VU5 A;  2HVE A;  1XIQ A;  3FCV A;  2BX6 A;  4CP5 A;  4UOG A;  3EE3 A;  4F4A A;  4KPC A;  3NGU A;  5CAA A;  1MN7 A;  4V02 C;  2B8Q A;  1EHW A;  3VGT A;  1S57 A;  2BEF A;  2DY9 A;  2B8P A;  3BBF A;  1NSQ A;  3FBE A;  1NPK A;  3Q8U A;  2DXD A;  1ZS6 A;  3BH7 B;  1BUX A;  1NLK L;  3FKB A;  2DXE A;  3Q83 A;  4ENO A;  3Q86 A;  3PRV A;  1WKJ A;  1NDL A;  3EMT A;  2AZ1 A;  3R9L A;  4C6A A;  1BE4 A;  3DDI A;  3ZTP A;  1PKU A;  1S59 A;  3Q89 A;  3VGS A;  4DUT A;  1NDC A;  1HHQ A;  3ZTQ A;  1B4S A;  3ZTO A;  4O0N A;  3FCW A;  3FBB A;  3WX8 A;  3VGU A;  4DZ6 A;  3ZTR A;  1LEO A;  1K44 A;  3PJ9 A;  4ANE A;  4EK2 A;  4F36 A;  3NGT A;  3EM1 A;  1HLW A;  3EVM A;  1HF2 A;  3MPD A;  3ELH A;  1NSK L;  1XQI A;  1NUE A;  3EIC A;  2ZUA A;  3GP9 A;  3VGV A;  1U8W A;  2NCK L;  3EVO A;  3JS9 A;  4FKY A;  1BHN A;  2HUR A;  1NB2 A;  1KDN A;  1LWX A;  5C7P A;  1W7W A;  1VYA A;  2HVD A;  4DI6 A; 
#chains in the Genus database with same CATH topology
 3IBC B;  4MXN A;  3RBZ A;  1XNR J;  1WTF A;  4X4S A;  4NEZ A;  2CZV C;  5A6W A;  3B4M A;  4KO0 A;  1T95 A;  1O8B A;  1WSV A;  4R0J A;  2MXY A;  3Q8R B;  3NNH A;  5ETP A;  4IQX A;  3VSV A;  1VFJ A;  3R7S B;  4DDF A;  3MUR P;  3RR7 A;  2VG6 A;  2CKW A;  2EC0 A;  1FX4 A;  3JB9 k;  1VQ6 S;  3E51 A;  5DDR C;  1QAX A;  3LGH A;  4DL6 A;  2ZBQ A;  1REV B;  2RQM A;  1E6V B;  1TU0 B;  4DFK A;  3GYX B;  3WC0 A;  4HYK A;  1NM2 A;  5JXS A;  1N8R T;  4PWD B;  3TX0 A;  3QSY B;  3IR6 B;  3DGP A;  1QQ1 A;  3MM9 A;  4RW6 A;  3UNY A;  4ECT A;  3GFH A;  3H5S A;  4EEY A;  2W2O P;  2HBY B;  2HG4 A;  4N5S A;  2BM4 A;  3FY3 A;  5LXY A;  3UD3 P;  5D15 A;  3IBW A;  1RWN B;  1IXK A;  2DNZ A;  4M5H A;  3DRR A;  5IT9 U;  2X1F A;  1SBR A;  3UW1 A;  3D5M A;  2ZOG A;  3L09 A;  4CWB A;  1WKK A;  4M5K A;  4MIW A;  3M30 B;  1APS A;  2CQG A;  5FLX Y;  5H9E K;  4MIB A;  2EWE A;  1NRK A;  4HR2 A;  2OPS B;  5EHH A;  4LBH A;  5GAH U;  1KQ5 A;  4Y2I A;  2BM6 A;  5J1E B;  5HBM B;  3I0S A;  4M95 A;  3VF0 B;  4EUV A;  3PYE A;  3MEE B;  3FFI B;  1RDR A;  1LWC B;  3Q86 A;  5KFG A;  2NSB A;  5HN0 A;  2E5L F;  3FCH A;  2B0G A;  1JLB B;  2CPX A;  3O5T B;  2OO4 A;  1RI7 A;  3HHE A;  4CLP A;  1OSC A;  1LW2 A;  4XN0 A;  2BDP A;  3ONQ A;  2UP1 A;  1MW7 A;  2VOD A;  1Z2L A;  2NT9 A;  1HF2 A;  1BY9 A;  3H2U B;  3NS7 B;  2UXB J;  2NCK L;  5KFJ A;  1IWA A;  4WII A;  4DR4 J;  2A10 A;  3H42 A;  1S6U A;  2IDE A;  2R8K A;  2F1F A;  1GNK A;  4OZL A;  2VJV A;  1AIR A;  1WKL A;  1M5O C;  1VHI A;  3IGV A;  2IYI A;  1NDK A;  1A6L A;  5BYS A;  5M2U A;  4ILM A;  1M5V C;  1X9M A;  2VQF J;  3MMJ A;  3JXO A;  4MKA A;  4ID5 B;  1ZYQ A;  5FDL B;  1JIH A;  3BDE A;  3T5L A;  1U09 A;  3EQN A;  1NK5 A;  4FYX B;  4CLU A;  1NSQ A;  4OYA A;  4URQ U;  4NZ6 A;  4PAB A;  3HFV A;  4DSK A;  4B3O A;  2G0C A;  2RIL A;  1NK8 A;  1S4F A;  4QU6 A;  2AYE A;  1TMJ A;  4FBT A;  4FF2 A;  1F2H A;  2KFZ A;  5EGY A;  3VAH A;  1IBM F;  1SXL A;  2R3V A;  3PJ9 A;  1KQK A;  1NO8 A;  2B9E A;  5KFF A;  1JJ4 A;  1VQO S;  1RK8 A;  1S6P B;  2FJA B;  1WSR A;  4OI1 A;  4NI2 B;  3IWN C;  1JKH B;  5EWG A;  3HMJ G;  4K5R A;  1MWZ A;  3FK4 A;  1HQ2 A;  4B3T F;  1FD8 A;  4K4W A;  2MQL A;  2LQ5 A;  3BYR A;  1FI4 A;  4AFF A;  2IJR A;  3X3U A;  2HHV A;  4OZJ A;  2LU1 A;  4QOT A;  2MKH A;  2QLJ B;  2KI2 A;  4CTA B;  4OZ3 A;  4IDK B;  1J5O A;  3W66 A;  5BXI A;  4F8R A;  3UR3 C;  2V94 A;  2QSW A;  4CIO A;  2DR8 A;  3EGV A;  1QVG R;  4WYL A;  1HNZ J;  1RTJ A;  2LEA A;  3DRP A;  2GHW A;  5CA5 A;  1SV5 B;  5M2R A;  4MR0 A;  2J8K A;  2HFZ A;  3MMC A;  2DXE A;  1H80 A;  4OX7 A;  3QLH B;  1IUJ A;  1DAR A;  2JEG A;  2ZD1 A;  1SUQ B;  2GHP A;  4YME A;  4ZVO B;  4XLA A;  3BN4 A;  2HQF A;  3H40 A;  3VHQ A;  3R2C J;  3Q0A A;  2X3H A;  3W5Z A;  1Q7Y T;  3QIP A;  3PO4 A;  4XIU A;  1KLM A;  2YX7 A;  2DBB A;  4QBU A;  2UUC F;  4P7T A;  2EFG A;  2YWF A;  2Y1I A;  4CZC A;  3A8I A;  4BC7 A;  1C0T A;  1WJ9 A;  4USM A;  3UCG A;  3HPO A;  4UTG A;  3VZI A;  3W1Y C;  4RO0 A;  2PFF B;  3BM7 A;  2HFN A;  1BWE A;  3HT3 A;  1OY9 A;  1URN A;  2MGZ A;  1H3D A;  1SH2 A;  5H9F K;  1S9E A;  2PDA A;  4OI2 A;  2RML A;  3F56 A;  3AA9 A;  1WXR A;  4MAK A;  3CJ3 A;  4H4O B;  3FBE A;  4EWT A;  4E2F B;  3MM6 A;  3KLE A;  2J6T A;  1EET B;  3PDN A;  3M2U B;  1C0U B;  4PWU A;  3RW7 A;  1ZTT A;  2X6Y A;  4DUT A;  2MSS A;  1MMN A;  2ABY A;  4A8O A;  4DQQ A;  2XLI A;  4PR6 A;  2VFM A;  4NPO A;  3KLI A;  4I2Q B;  5J2P B;  2G0Y A;  2IMO A;  2ZJQ Q;  3DLE A;  2GS8 A;  1RBO B;  2LXI A;  1DQ8 A;  1T9X A;  3NG8 A;  1GXU A;  4Q0B B;  3RG6 A;  3EZU A;  2HBQ B;  2E5I A;  4KIA A;  4F2R A;  1CQN A;  1HFE L;  5C42 B;  3DYA B;  5HO4 A;  3A3N B;  3B6B A;  3I5C A;  3OJU A;  1UVK A;  5HK4 A;  1UA1 A;  3TI0 A;  4BHQ A;  2ZE2 A;  2Q79 A;  3CJ2 A;  3GJQ B;  3KNG A;  2V8V A;  4L75 A;  1I3O B;  4Z06 A;  3WIV A;  1OOC A;  1B7F A;  2MZQ A;  4QWA A;  4XOR A;  3CUN A;  1FNO A;  4C3M A;  5IC6 B;  1RZM A;  4ERD A;  1LWF A;  1MWQ A;  1L3T A;  2FJE B;  3EGN A;  3MM5 B;  3KK3 B;  5B0G A;  1S1U B;  3DHW C;  2ZNZ A;  3FGV A;  2G2Z A;  2V67 A;  2QZ8 A;  3B8H A;  2QRR A;  3KJN B;  3D9B A;  3SV4 A;  3P6Y C;  3WX8 A;  2CVE A;  5LJ5 Y;  2R7O A;  1V3S A;  1F3V A;  4O23 A;  4ED5 A;  3ITH A;  2OEM A;  2E5G A;  4O3O A;  1QD1 A;  1HPZ B;  5AE2 A;  1XC9 A;  3HVT B;  4F26 A;  5IM0 B;  3S1T A;  1FFS B;  8ATC B;  1X4D A;  4FF4 A;  4QPT A;  3PM9 A;  3KLG B;  1X4A A;  1WDT A;  4HVZ A;  3UR0 A;  5CAB A;  4ANC A;  2LEB A;  4IR1 A;  3MMB A;  1XMQ F;  1XG2 A;  2RS8 A;  2OGU A;  1LK7 A;  1YBT A;  3G87 A;  1Y10 A;  3ILI A;  1XER A;  2DR9 A;  4X62 J;  4ZVE A;  4C2M A;  1TVR B;  2ZM6 F;  2XS2 A;  3CCV S;  5IT4 A;  1SJR A;  5KFW A;  4AVZ A;  2CDQ A;  5L46 A;  1K0V A;  3D0I E;  4ZDN A;  3LUY A;  3CDU A;  3PET A;  4HH0 A;  1B4S A;  1RHU B;  5E5N A;  2HQI A;  3TUI C;  2RS2 A;  4K4T A;  2R8I A;  2IIH A;  4HT7 A;  1AYE A;  2DIT A;  2E1M C;  2Z57 B;  5EX0 A;  4A8X A;  3GP9 A;  5ADZ A;  3V81 B;  4WFA Q;  2FJD B;  2FJX A;  4HLB A;  2XTX A;  2HEK A;  3CVK A;  4YEJ A;  1RTI B;  1U7L A;  1N34 J;  2GJ2 A;  1RAG B;  2I2Y A;  1U1R A;  1WI8 A;  5K20 B;  2QT7 A;  2VJU A;  4DLE A;  1VC5 A;  1S9G A;  4OZ1 A;  1F6T A;  3OVS A;  4I69 A;  1XR7 A;  3RRK A;  2CQ1 A;  2R7U A;  5C25 A;  1IR2 A;  1RIS A;  3JAM U;  4G6V B;  2B56 A;  2LP4 A;  3W9J A;  2W9C B;  4J9L A;  3A8J A;  4C3L A;  1FKP A;  5L9N A;  4USK A;  2UVU A;  4I1T A;  3G96 A;  3Q83 A;  1U2R A;  4XLC A;  4OYO A;  4OHX A;  4UY8 T;  4DPY A;  2XMW A;  2DRD A;  5I3U A;  1ELO A;  3I5A A;  2VKR A;  4AXI A;  1KQF B;  2DB1 A;  4KHR A;  2HHX A;  4LSN B;  1AFI A;  4JI8 J;  4DV7 J;  1U2F A;  1REV A;  2QMU B;  4DJB A;  3QQC D;  3M9M B;  1E6V A;  2RUG A;  5DO2 A;  3RB0 A;  4N8O A;  3JUR A;  4DBQ A;  2JVO A;  2LQ8 A;  2VFU A;  3CED A;  4PWD A;  2VHG A;  4DR3 J;  4W8T A;  5I4M A;  1U47 A;  2HGN A;  3TNV A;  5DLG A;  5D4O A;  3H90 A;  5KTQ A;  5LT5 A;  2KZM A;  4LBI A;  2GQQ A;  4ILL A;  5K8N A;  4NLD A;  1UET A;  2LQ9 A;  1EKS A;  3PYF A;  2BOP A;  4Y65 A;  4UOC A;  1V6H A;  1ACM B;  3IGN A;  4CP5 A;  4NCA A;  3TP2 A;  2ZWP A;  1VS3 A;  4UUX A;  1TMM A;  4DOZ A;  1FHT A;  2UUW A;  1WHW A;  1VHF A;  3BO2 A;  1JXE A;  2ATC B;  1YJU A;  3B4N A;  1CJV B;  2XM3 A;  3PSZ A;  1RCO B;  2OPS A;  3DOM A;  5B0E A;  2GIQ A;  4XDC A;  2RHS B;  3VST A;  1QAJ A;  4A8W A;  3B8Y A;  2R4F A;  1KCC A;  5KFD A;  1ZM2 A;  3I9V 9;  4Q2M A;  1TL7 A;  2LMI A;  1N6Q B;  4LR8 A;  5BJR A;  3MEE A;  4ANE A;  4OI3 A;  1JJ2 R;  1KQG B;  1LWC A;  2HND B;  3HT0 A;  4FS1 A;  4DG1 A;  1VLO A;  4Y2A A;  4LBP A;  1Y7P A;  3DMJ B;  1N5Y A;  2NSC A;  2K8G A;  3M1V A;  4DF8 A;  3VAL A;  4F0H A;  3CCZ A;  5AJ3 F;  1IBK J;  5GAD I;  4J9R A;  2DYA A;  4ECY A;  3J81 Y;  3HLU A;  2V2Q A;  1TUG B;  4CLW A;  3ZPP A;  2BBE A;  4IKA A;  4LFC J;  2DRB A;  3M2R A;  1RWK B;  4ZVR B;  3THV A;  1J5E J;  3N0V A;  5KFU A;  2HLT A;  3R1L A;  2OP5 A;  1NJZ A;  2HLU A;  3R5J B;  4OZ2 A;  4LF8 F;  1CJT A;  3KG1 A;  4LVO P;  4GC7 A;  4ZIT A;  4IG3 B;  2JC1 A;  1YBU A;  3D6M B;  4EZ6 A;  4IO9 Q;  3BGO P;  4MK7 A;  1O8M A;  2ZBP A;  2GVD B;  3PIP Q;  3Q24 A;  2DK2 A;  2R42 A;  3RBX A;  1ZTW A;  5DM7 Q;  4OI6 A;  3GV7 B;  2Z0G A;  2IC3 B;  3QID A;  2CNL B;  4OHY A;  2KN4 A;  2JFK A;  2RF2 B;  2W1B A;  3BO3 A;  3EIC A;  4U7U K;  4DQI A;  3AHP A;  2M88 A;  3A13 A;  2B7B B;  4JI3 F;  4TYA A;  3TJ9 A;  2UU9 J;  4JUZ A;  3MUV P;  2FC8 A;  1ZAX A;  4PYD A;  1K1S A;  2KXH A;  3IM9 A;  1RWV B;  4LT6 A;  4YZ0 A;  2NZC A;  4I6A A;  3FMW A;  4EU0 A;  4NI2 A;  1KVK A;  1JKH A;  4YDT A;  2X51 A;  3CME S;  2DIV A;  2D3O 1;  3ENA A;  1YRX A;  2DEI A;  1Y11 A;  1GH8 A;  4A46 A;  2OML A;  5DZ6 A;  3U1N A;  1PIE A;  4JYA F;  3AA8 A;  2EWH A;  4CTA A;  1RT5 B;  3QAU A;  3SZE A;  3UI3 A;  3CMA S;  4X4N A;  2YX1 A;  2WOM A;  4NLG A;  2BAN A;  3FKB A;  3LP1 B;  3NWR A;  1VBX A;  5KFY A;  1X4C A;  3ET6 A;  2ZNY A;  1RU1 A;  4NXN F;  3DDI A;  4TYB A;  1ZZF A;  4F0M A;  2XYH B;  2YH0 A;  1G1X A;  1FRX A;  5F41 A;  1IM4 A;  2F8H A;  1WF2 A;  3R3T A;  5IFM A;  4X62 F;  2IJN A;  2KJV A;  2K3I A;  1S77 D;  4N7T A;  2OI2 A;  5IQ6 A;  3ZZR A;  3QLH A;  2VF3 A;  4QR0 A;  2MQ8 A;  1SUQ A;  4CLF A;  4Y0F A;  1UFL A;  3N28 A;  3I82 A;  4YB6 A;  2CAD A;  3BH6 B;  3GMG A;  1Q53 A;  3MUM P;  1IQT A;  5LSR A;  4URR A;  1C2P A;  1WG5 A;  3QRQ A;  5AE3 A;  4DSL A;  2ALY B;  2XUL A;  1PGZ A;  2CPY A;  2FHJ A;  3PEJ A;  2BOA A;  2OPQ B;  3KTQ A;  1D8Z A;  3CD5 A;  4KHM A;  2DR6 A;  3KG4 A;  4X66 J;  1N34 F;  3ZXW A;  1SQE A;  1EHW A;  1RT7 A;  2CPZ A;  2PO4 A;  1UW9 A;  8AT1 B;  4OZY A;  4NLS A;  3WZ0 A;  1UVM A;  2C1E B;  2EKN A;  2QFI A;  1YTY A;  4U95 A;  4TQS A;  2BM5 A;  5HJY A;  4TU7 A;  1HI8 A;  3RB4 A;  2O1D A;  2PT0 A;  2C2N A;  5BR8 J;  1EQ0 A;  3N5B A;  1YWX A;  4F36 A;  4H4O A;  2UVV A;  4YY3 J;  2HHH F;  1FRJ A;  4W4M A;  3CCM S;  2FPH X;  2GO9 A;  3HHL B;  1EET A;  2G2Y A;  2K3K A;  3M2U A;  1FKO A;  2HAI A;  1HNV B;  4RW4 B;  3NCQ A;  4EGL A;  3ZSC A;  1OSD A;  3W65 A;  3K8V A;  3L9Z A;  2XTW A;  3BKT A;  3AH6 A;  4WF9 Q;  4E0D A;  3VAG A;  4YFU A;  3NGS A;  4JI8 F;  2G1D A;  4GVB A;  2B9Y A;  2VON A;  4Q0B A;  3MEC B;  4ED6 A;  3UN3 A;  2VG7 B;  5LMU F;  1PC5 A;  2UXC F;  4N8N A;  4GKK F;  4F7V A;  4OI0 A;  2CWK A;  3KLH A;  1ZM3 A;  4F4Z A;  2D7S A;  4X4O A;  3CIZ A;  4A8M P;  3CE8 A;  4JI7 F;  4Y2K A;  4UUW A;  4NLU A;  5HLF B;  3R5D A;  3LMW A;  4DR3 F;  3QWP A;  2FY1 A;  1RHK B;  1RE1 B;  3FRZ A;  1FXD A;  3DRY A;  1SJF A;  4MFB B;  2CJY B;  2FHO B;  3TEG A;  3NMA A;  3MMA B;  3UE2 A;  5IS2 A;  1F5C A;  3GIL A;  4XOP A;  4WYW A;  4CT9 A;  3MEG A;  3KK3 A;  4RNM A;  3NOC A;  1DTQ B;  2L9D A;  1H72 C;  1TQL A;  2YKN B;  2M3D A;  1NHV A;  3O2I A;  5IV4 A;  2Z8Q A;  2C3O A;  3BKF A;  3L7P A;  1TSP A;  3MEK A;  5DQI A;  4ZPT R;  4QW8 A;  2DD8 S;  1LXJ A;  2P5V A;  3NCR A;  2DHX A;  2KDO A;  4WBF A;  3KRG A;  1YJT A;  3J80 Y;  3Q8Y A;  2DGV A;  3DOL B;  3R97 A;  3RB6 A;  3CJS A;  4YOE A;  1HPZ A;  3BGR A;  5LL6 d;  1N5S A;  3HVT A;  2YY3 A;  5IM0 A;  2I6W A;  5CD4 A;  2QTW A;  4IFY A;  2V4Q A;  4ECW A;  4F4W A;  4U7U D;  3BO4 A;  4B08 A;  3DI6 A;  1H38 A;  3KLG A;  1IBK F;  3IRX B;  4PCQ A;  1WC6 A;  2B5J B;  5E3Q A;  2QV6 A;  1TAU A;  1V5I B;  2RRB A;  1JK9 B;  1RT6 A;  2XMK A;  3LAN A;  1YHQ S;  4Y00 A;  2NXN A;  3V6K A;  5B0D A;  1KKH A;  3QZ7 A;  2OKQ A;  3TX8 A;  5LM7 E;  3TAM B;  4Q45 A;  4KH3 A;  3HO1 A;  3HF5 A;  3GTY X;  3W8P A;  1CUL A;  4WP3 A;  4ED4 A;  2J0S D;  2Z2L A;  2CQ3 A;  3PTW A;  4DV5 J;  1EX8 A;  2E66 A;  5ETV A;  1NUE A;  4R8U B;  1XNQ J;  4Z03 A;  4ZVG A;  1HKA A;  4AD6 A;  1CSJ A;  1X4H A;  2IRY A;  2MQP A;  2GMJ A;  4NX9 A;  1NJX A;  4ELV A;  1O8L A;  2OMO A;  4B3S F;  3RJM B;  3LGN A;  2JLG A;  2M7S A;  3AXM A;  1UJ5 A;  4OJ1 A;  2GJI A;  3V81 A;  2AF6 A;  2EW9 A;  2W01 A;  2AEF A;  2HK2 A;  4FYV B;  1EJ7 L;  4KY3 A;  4L3N A;  1N52 B;  1UWB B;  2Z2Y B;  5SUH A;  3OL9 A;  2ZOM A;  1XR5 A;  2R7S A;  2ZH5 A;  4X4R A;  5E3C A;  5HJX A;  3T41 A;  2KFY A;  2NST A;  2ZC3 A;  1Q86 T;  3KLF B;  3PW2 A;  3CW2 C;  2B8P A;  3OT9 A;  5HAO A;  1JLE A;  1XEZ A;  1BUX A;  2J0W A;  2VPW B;  5E3A A;  3BGU A;  3KUE A;  4N47 A;  3TYT A;  4JV5 F;  3PRV A;  1JJH A;  2LXU A;  4UZC A;  5MAO A;  1S6O A;  1F9F A;  1Y00 A;  3GQ9 A;  2Y3Y A;  4MT1 A;  1LM1 A;  4DXL A;  2V2K A;  2W9A A;  2YXL A;  3PYG A;  4A48 A;  2VFQ A;  3F73 A;  2F4V F;  5AXM A;  4C8Z A;  3AD9 C;  2GO8 A;  3X1L B;  4NZ0 A;  3CNQ P;  2XTJ P;  2JOQ A;  1J2V A;  4JBC A;  2DNG A;  1QJH A;  2IHR 1;  5KFM A;  1HW9 A;  3IFE A;  2GQC A;  3ENV A;  3W5Y A;  1RT2 B;  1GTH A;  4LSN A;  1RUS A;  3M4X A;  3W64 A;  1FES A;  5CQG A;  3RTV A;  3LAL A;  1K8F A;  1TKX B;  5DRK A;  2KU7 A;  3DN9 A;  4ZVS B;  1JLQ B;  2Y8W A;  3Q8S B;  1CBK A;  3KUH A;  4KHP J;  4JI2 F;  3UW0 A;  2NR0 A;  4HH1 A;  2O17 A;  1CG2 A;  3QT5 A;  5CZX A;  2ZH4 A;  4MH8 A;  1D9A A;  3K5N A;  1B7Y B;  1HHS A;  3R6G B;  1CQM A;  2MMY A;  1S9F A;  2F3J A;  4XK8 C;  2MKI A;  3AB4 B;  2HQG A;  4DR7 J;  1QSL A;  1M90 T;  2HNZ A;  2DEJ A;  4B17 A;  4D3G A;  3P96 A;  4I2P A;  2WW4 A;  4IH7 A;  2AZ1 A;  2O0W A;  3KJQ B;  2Q66 A;  3MM7 B;  2BKP A;  2XC9 A;  3RB3 A;  5JMN A;  3P4U B;  1UJ6 A;  2OPR A;  3H5X A;  1SJQ A;  4NLT A;  3R7N B;  4X66 F;  1CJV A;  3M7V A;  5AXK A;  1HD0 A;  5HQL A;  4DV2 J;  2FHM A;  3BR9 A;  1D8Y A;  2Z56 B;  2A2D A;  1HMV B;  4DV1 F;  4G65 A;  4YB5 A;  2RHQ B;  1CJK B;  4C8M A;  4KH1 B;  3QRP A;  3H2L A;  1G6B A;  4NLO A;  5AXN A;  4RZR A;  1N6Q A;  2P9G A;  1YRU A;  2RB7 A;  2AX1 A;  2CPF A;  4IH6 A;  4RL1 A;  1NKB A;  3MCO A;  4XKW A;  1N0V C;  1N32 F;  1R6Y A;  4O3P A;  2BM1 A;  4HDG A;  3HFZ B;  2PSZ A;  3OFF A;  5IQQ A;  1S0O A;  4ES1 A;  3C15 B;  5B0F A;  2CPD A;  3KXD A;  3AD8 C;  3MTK A;  2ZFH A;  1CZF A;  3L7O A;  4HTJ A;  1HQU B;  4KBI A;  4U8V A;  1YJR A;  5GAE I;  1RBL A;  2XT2 A;  1Y9O A;  2NS1 B;  4NLX A;  4C9D A;  3BQ1 A;  3OV7 A;  4JI5 F;  2W4P A;  4G1P A;  1VQL S;  2CPI A;  3M9O B;  4CO3 A;  1IKY B;  2YNI A;  5E3R A;  2CQP A;  3BEG B;  3QSI A;  4IG3 A;  3P5T L;  1T9W A;  1FKA F;  4H54 A;  2FHJ D;  2WTF A;  5K14 B;  2G2O A;  1VBK A;  2BMB A;  3QRR A;  3MOZ A;  1RA7 A;  1NZA A;  2W4C A;  2GVD A;  4MKV A;  2QYU A;  4Y3C A;  4GRS A;  1R0B G;  2IC3 A;  2V9K A;  2F8M A;  4M5I A;  4PMH A;  5KFI A;  3MI7 X;  2NTQ A;  1ROF A;  4X4P A;  1URR A;  3KYL A;  4X4V A;  1LW0 A;  1R8H A;  5E7O B;  1JB0 C;  1QSS A;  1M5P C;  5AE1 A;  2CG4 A;  3GJT B;  3BJY A;  3AJ2 A;  4DL7 A;  3LJY A;  3RIQ A;  4NRT A;  2IRX A;  2KG0 A;  1JXL A;  4CCH A;  3NS6 A;  1Q1K A;  4CM2 A;  1H6K X;  3O1L A;  2K7J A;  1FDA A;  1BMQ B;  1T3N A;  2R8J A;  2VJJ A;  3W5X A;  2AV5 A;  4DV6 J;  3CWJ A;  3H7H B;  3I31 A;  3VV2 B;  3EDQ B;  4V19 J;  1UVJ A;  3RAQ A;  3NGK A;  1N0U A;  4YB1 P;  2X1A A;  3LP1 A;  1LV5 A;  2E1R A;  4O0I A;  4HTI A;  2INV A;  1S7I A;  9ATC B;  2DNK A;  5A6P A;  3J7Y I;  2DHS A;  1B0V A;  1HG8 A;  2GMH A;  4P9S A;  2DRA A;  4NWB A;  1NK4 A;  4UY8 5;  4DX7 A;  4LR7 A;  3NWG A;  1RJJ A;  4KSE B;  2KKH A;  1R27 B;  2VZ9 A;  3D2W A;  2KYZ A;  3IRW P;  2PYG A;  3WBZ A;  2XCA A;  3KK2 B;  3ZZ0 A;  3MGJ A;  2XMV A;  1HNI B;  1AXQ A;  4YHH J;  1O8I A;  1UL3 A;  4J9V A;  1YJ7 A;  3AT1 B;  3PEH A;  1O88 A;  1N33 J;  1S6Q B;  4HKQ A;  5IT0 A;  3DFE A;  2JH3 A;  3GWC A;  3PNI A;  4KGV B;  3GFZ A;  3PR5 B;  3KFW X;  3GIR A;  2PEB A;  1QRC A;  1R89 A;  2ZC4 A;  4BWM A;  5KFT A;  2PMZ D;  1TK0 A;  3HSJ A;  1HHQ A;  4NLR A;  3FBB A;  2HS0 A;  2MHE A;  1KRP A;  4CLS A;  1YGY A;  2CNK B;  4P2F A;  3F44 A;  3R5B A;  1S1X B;  3MDF A;  1DAB A;  2VC0 A;  2R9L A;  2HIY A;  4CLY A;  4ED1 A;  1S1V B;  4J7C A;  1R31 A;  1TKT B;  2MTL A;  1M1G A;  1HQE B;  3HX9 A;  4LSL B;  5GAG I;  1CJU B;  2XMJ A;  1P9Y A;  5ETR A;  2ZWO A;  2XS5 A;  3QO9 B;  2VOO A;  4RW4 A;  2BJ7 A;  4X64 F;  4GO5 X;  5AMV A;  2VPY B;  3C14 B;  3AJ1 A;  5AXL A;  5B08 A;  2M2B A;  1DUR A;  1W25 A;  4C98 A;  1Z1Z A;  2YKO A;  1HR0 J;  2MDA A;  3D54 A;  3IR7 B;  2UUA F;  1ZS6 A;  2ZJP Q;  4WKR A;  2BW7 A;  3TVZ A;  1DQ9 A;  1HI0 P;  4QWD A;  1X7V A;  3M8W A;  3B4D A;  2QYC A;  4LFB J;  4KHP F;  2LKZ A;  3BQ0 A;  3HCX A;  1AW0 A;  3NMR A;  1GXT A;  2PI4 A;  4Q43 A;  2PI5 A;  4F25 A;  3GON A;  5GME A;  3MED B;  2B3T B;  3R5C A;  3ZZZ A;  2K1R B;  2VQE J;  4YP3 A;  3IS9 A;  3T1A A;  4UF4 A;  3OHA A;  3FVY A;  1DTQ A;  2YKN A;  3DM2 A;  1FT8 A;  4LVN P;  3Q8Q B;  3BN7 A;  1KHW A;  3BBC A;  2UUB J;  3MM8 A;  3JSM B;  2E1C A;  4LRA A;  3GG0 A;  2J9D A;  2OEJ A;  2RDJ A;  3DOL A;  5A8W B;  4EFA C;  4JI4 J;  2XO6 A;  1MN7 A;  4TLQ A;  5DM6 Q;  1KFD A;  3CJR A;  4PXC A;  2XG8 A;  5E41 A;  4NYO A;  4OV1 A;  1B64 A;  2XY5 A;  4YEL A;  1FDN A;  3V4M A;  1DY3 A;  2KT5 A;  2FLN A;  4LF5 J;  3NBP A;  4G1Q A;  4N76 A;  5U47 A;  1O8H A;  3SXL A;  2B5J A;  2EEY A;  1ZZN A;  4RBV A;  2MZS A;  3VWS A;  1AUD A;  2AJ2 A;  5CZV A;  2ZUA A;  2C2R A;  2FVP A;  1VRU B;  2CQI A;  3N6L A;  5C7P A;  2IFX A;  3CJK B;  3TAM A;  3ZNU A;  1SC3 B;  3DLJ A;  1PAU B;  4OJO A;  2H54 B;  1AT1 B;  3G86 A;  2VBM A;  2VD3 A;  1U1O A;  3I5B A;  5F3T A;  3EJM A;  2B7C B;  3QJL A;  2J9D E;  5ETQ A;  2HZC A;  3OTE A;  4ZK7 M;  4Q5V A;  1MLA A;  1NDP A;  3W2V A;  2VIC A;  3LWL A;  5HRO B;  2XC1 A;  1WHV A;  2YQ0 A;  3VQS A;  2B0R A;  4DSI A;  5B0A A;  4CO0 A;  3LP2 B;  1XIQ A;  3T9Z A;  4K4V A;  2VOP A;  2NZM A;  4F3M A;  2BM0 A;  3OXF A;  3V6D B;  1N36 F;  5LXR A;  4AQY J;  1U1L A;  1RTD B;  4EZ9 A;  5KFA A;  4CO2 A;  4CI0 B;  2VL1 A;  1KEK A;  4CLZ A;  1P1L A;  2HWI A;  3CCU S;  1XR6 A;  4O44 B;  4OHZ A;  3U27 A;  4JI0 F;  1FX2 A;  4DFP A;  3ZTP A;  2QYG A;  3KNA A;  3KHL A;  5J2Q A;  3NRB A;  3NP5 A;  3KLF A;  5E0O A;  4L3K A;  2PGC A;  3DLG B;  2V4J B;  1EAY C;  1RT3 B;  3HHD A;  1QRB A;  4P7V A;  4RU9 A;  1OPZ A;  2XS7 A;  5A0Y B;  4RBU A;  4RJV A;  2C42 A;  2HIQ A;  3GQC A;  2DGO A;  4MJK A;  3GRH A;  1U24 A;  2RD5 C;  5HMZ A;  1OQ6 A;  4BCA A;  3SFG A;  2BE9 B;  4RR5 A;  2NUU G;  1U8S A;  3PW5 A;  4PWW A;  4X65 J;  2W25 A;  2H3E B;  4P52 A;  3NAI A;  3WHI A;  4C97 A;  3KJV B;  2ZH9 A;  2BYC A;  5CH7 B;  2HAF A;  1RT2 A;  4QWE A;  4EBD A;  5FII A;  2LA4 A;  3UDE A;  1UMJ A;  2CNN B;  2NXU A;  3IAM 9;  1NPK A;  3QZ8 A;  4CQ1 A;  1JLQ A;  2YWG A;  1TR0 A;  4DUZ J;  5J1N A;  4Z37 A;  4U4B A;  1SJ1 A;  2V5H G;  2GVZ B;  1BQN B;  3LO3 A;  1VQ8 S;  1X31 C;  1I1G A;  2IBO A;  5JVH Q;  5DGA A;  3KDO A;  1N33 F;  1U6Z A;  4ZA1 A;  7FD1 A;  2YNF B;  1W7W A;  3G9C A;  3CSK A;  3MZI A;  4NK8 A;  4NYZ A;  4WFN Q;  3OTO J;  4W8S A;  5D0E A;  3P8B B;  1OPI A;  3UN2 A;  4KJI A;  4WTY A;  4ALZ A;  2R2R A;  1YI2 S;  1U0S A;  3SDE A;  1YJW S;  2W7Z A;  4W92 B;  4CO4 A;  1FEH A;  3OHB A;  1TTH B;  4QPX A;  3POT B;  1RAJ A;  3KDN A;  3EYZ A;  2MQQ A;  1UA0 A;  4QQB A;  1NJW A;  1C1B A;  4NXM J;  3C15 A;  2JWN A;  4TY9 A;  1B70 B;  2IYG A;  3LQV A;  5I3Q A;  3MUT P;  1V9O A;  2O0V A;  4FP9 A;  4ES3 A;  3D67 A;  4EO8 A;  1HQU A;  4GMK A;  4DCO B;  5IWA J;  4LRC A;  5HVF A;  2DGQ A;  5EX3 A;  3VGS A;  2QGF B;  4Z05 A;  1JLF A;  4KB7 A;  3IM8 A;  1HLW A;  3DRS B;  4ZVU B;  1KN6 A;  4FYD A;  1TL1 B;  3K5L A;  3OBI A;  3G82 A;  3O3L A;  2CPJ A;  4WFB Q;  1H98 A;  1HHT P;  2IY5 B;  2XMM A;  2CJX B;  1JLC B;  3J81 U;  2PA3 A;  1Q8K A;  4KRW A;  5K14 A;  4M5G A;  3Q8V A;  3CDB A;  1PXZ A;  5KG7 A;  3A1Y G;  1HA1 A;  2A6O A;  3PO5 A;  3PX6 A;  2VQE F;  4XPE A;  1U1P A;  3M2V A;  3UO0 A;  3EZO A;  2RQC A;  1VGY A;  4BWJ A;  3VAI A;  2DNM A;  2VC1 A;  2AX0 A;  5HL7 Q;  1G3O A;  1R0A A;  2G9O A;  4OYW A;  1Q81 T;  4R5P A;  2PMW A;  4DR2 F;  4OMF G;  4RNH A;  3H5Y A;  2OTL S;  1N5Q A;  2D41 A;  5EDW A;  3M8S A;  4HI2 A;  5K8O A;  2BE7 D;  2WVB A;  2OD6 A;  3SCL E;  2YQ3 A;  3W2W B;  2BA9 A;  2UVF A;  2C3M A;  4JI4 F;  4XLH A;  3W60 A;  3RBE A;  4QIE A;  4OJ6 A;  4YEI A;  1FJG F;  4F4K A;  1BQX A;  2BKN A;  2MKK A;  1S49 A;  5KT3 A;  2HFS A;  1YDL A;  3U1M A;  4IYQ A;  2WBR A;  1NCL A;  3G6V A;  4K5S A;  2GCF A;  7FDR A;  3O44 A;  1I94 F;  1HNW J;  2BRK A;  5DET A;  2BQ3 A;  4RNF A;  3FJ2 A;  1VJW A;  3DXB A;  3MPV A;  3BSN A;  3OW2 R;  4ED2 A;  4LIR A;  1HYS A;  5HMY A;  3FMB A;  2O6W A;  2QG9 B;  2I8E A;  2AJ1 A;  3TA2 A;  2RE1 A;  2VFO A;  3GJR B;  1HBM B;  1ZAW A;  3KWM A;  1RGV A;  4B9V A;  1S0N A;  2IM1 A;  2ZZM A;  4L72 B;  1WOP A;  2YKQ A;  4Z7C A;  3M6V A;  3BV8 A;  4J90 A;  5KG1 A;  2NPI A;  3D3C J;  4YN3 B;  4R0E A;  2CJK A;  4ELU A;  3LP0 B;  2EBE A;  1O8K A;  3JTO A;  4ZP7 A;  3MFI A;  1HNX F;  4YDX A;  3J7A N;  2W7P A;  1WF1 A;  4RWW A;  2ZUG A;  4DN9 A;  4C7Q A;  1UVL A;  2W7A A;  2QC3 A;  1XQI A;  3ZZP A;  3HVA A;  4UOF A;  4ICL B;  4WFX A;  3E8O A;  4EI2 A;  1HBO A;  3C16 B;  3A12 A;  1VRQ C;  3ZZU A;  3VZH A;  5I42 B;  2BQR A;  2ILY A;  2OEK A;  4NML A;  2QLF B;  3S8S A;  4J37 A;  3FBC A;  1HW8 A;  4S0M A;  1S1X A;  1O5J A;  3SYZ A;  3JSY A;  2ZHO A;  6AT1 B;  3ILO A;  3FDS A;  3BBB A;  2YNG A;  1S1V A;  1TKT A;  2L41 A;  2XGQ A;  2PA8 D;  4WP9 A;  4LSL A;  5ETK A;  5CAA A;  1X5O A;  1SC4 B;  4TQR A;  4JI1 J;  1IKW A;  1RWO B;  1LWE A;  3M32 B;  2XWY A;  2B9X A;  1RWM B;  2HYI B;  2AKW B;  5D0H A;  3BPS P;  2NZ4 A;  1N54 B;  2WVF A;  1C1C A;  4OIX A;  1V3Z A;  3T19 A;  3SBM A;  1OFM A;  1TYX A;  1NDL A;  2M5Y A;  4ZN1 A;  3C14 A;  2I1R A;  2QLX A;  4DU7 A;  2JX2 A;  1S99 A;  2DY1 A;  2DR7 A;  1VIX A;  1TK8 A;  4AE5 A;  4V19 X;  1NHU A;  3CDW A;  1AZS A;  3AY0 A;  2GC8 A;  1N56 A;  3PW4 A;  3OTD A;  3J7Y U;  3BYP A;  2JC0 A;  4DSE A;  1FDB A;  3ZFV A;  3QAE A;  4LF9 F;  2OPP A;  2LDI A;  5A2Q U;  4M5D B;  4DPT A;  2FHK A;  4ZKA A;  3R6L B;  4I6Y A;  5T7L B;  3OR2 B;  2HSE B;  3CCJ S;  3G2X A;  3DC2 A;  4A4J A;  5L1J A;  2WON B;  2Q6B A;  1S1T B;  3QPI A;  5CYQ A;  4AND A;  3MED A;  4M5L A;  5KFV A;  4CH0 S;  2J7K A;  2Y1J A;  5LMN F;  3KK1 A;  5EWE A;  2CDR B;  4I56 A;  4K2X A;  2A0F B;  1O8D A;  2PC6 A;  3PJX A;  1FJE B;  3UDL A;  4AL5 A;  2EK1 A;  2UUT A;  4H4M B;  3OTO F;  4XKV A;  1SJ3 P;  2BRL A;  3IAS 9;  2X7I A;  1IBL F;  4C8K A;  2MEW A;  3UCZ P;  1WC3 A;  4KGX B;  4PZV A;  5D4N A;  2H9Z A;  3PW0 A;  7AT1 B;  4ZJQ A;  4BS2 A;  1IKV B;  3EMT A;  5D6G A;  4DUY F;  1SVD A;  3JSB A;  3BSO A;  1X5T A;  2B4O A;  2KT3 A;  4LQ9 A;  4DSF A;  3DLL Q;  3CF5 Q;  1K44 A;  2W8K A;  4B3M F;  1TYV A;  3IMQ J;  3NS5 A;  2WB4 A;  4CM0 A;  3GR1 A;  4DN0 A;  3MPD A;  4H4K A;  3VQT A;  2V68 A;  3R8Y A;  3TVY A;  2YBV A;  5C1E A;  5D3G B;  2DH8 A;  4ECV A;  1E6Y B;  3HHL C;  2HVD A;  4C8Y A;  4CH7 A;  2CQ0 A;  2AGO A;  4ZHR A;  2FIU A;  5F8I A;  4IRC A;  2H5J B;  4C11 A;  2QA4 S;  4QCL A;  3K89 A;  4MKY A;  1RXO B;  2P9E A;  3D66 A;  1D9D A;  3T5J A;  3A3O B;  2J9E A;  4K0K J;  2V2Z A;  4RW7 B;  1Y4Z B;  2J7U A;  5C5J A;  5KFZ A;  2WZ1 A;  1LKZ A;  1L3V A;  4PG5 A;  2EPI A;  2OUG A;  3T1Y J;  1NKE A;  1T05 A;  5HRO A;  4CYU B;  4WPA A;  4ZPB A;  2HS3 A;  2RQK A;  5KOW A;  3T6J A;  3LP2 A;  3R9L A;  4PEO A;  5J2N B;  3RZA A;  1RTD A;  4OX9 F;  4GKJ F;  4F0K A;  8RUC A;  2HNY A;  4OPW A;  1TL3 B;  2W2Q P;  4NLQ A;  3W3S A;  2M8D B;  2VPX B;  2HHQ A;  2I5J B;  3T1H F;  3C2P A;  2W9B B;  1ZPV A;  2BJ8 A;  3PYD A;  4Z7Y A;  1NK7 A;  1VQS A;  4P72 A;  1U6F A;  1V5V A;  2L9N A;  4USH A;  1SCJ B;  5ITH A;  5F8L A;  3PY8 A;  3DLG A;  2V4J A;  3VR1 A;  3Q2T C;  1RU4 A;  3KHH A;  1RT3 A;  4FXD A;  4A8S A;  1UEK A;  2DNY A;  3DCA A;  3LPY A;  4P73 A;  3QGG A;  3BF4 A;  3C6T A;  4DX8 H;  5DG8 A;  2BJ3 A;  4K4Y A;  1CC8 A;  1Q4R A;  1TV6 B;  4NLP A;  1IDK A;  2GAH C;  5D77 A;  4LF6 F;  1IKX B;  1HAR A;  4NE9 C;  1VQP S;  2X85 A;  2XMA A;  4NA1 A;  1HBU B;  4RWX A;  2VFN A;  2ZZN A;  4A8F A;  1FK9 B;  4OX8 A;  4P74 A;  1PC4 A;  2AEJ A;  2X3D A;  1M1H A;  1T03 B;  2IM3 A;  3TA0 A;  4OX6 A;  1FNX H;  1VCT A;  3JAM Y;  1UTA A;  1S12 A;  3VGU A;  3M8Q A;  4C48 A;  3FNN A;  5KT6 A;  2PMH A;  4FXV A;  3R5G A;  2D74 B;  3W9H A;  3IXQ A;  3CCQ S;  3P49 B;  1RT1 A;  5L1I A;  2XY7 A;  5D8H B;  5HMW A;  1RAO A;  1WUU A;  2FVC A;  4NLV A;  2GVZ A;  4QWB A;  4DHV A;  3G8Q A;  4NEY A;  4KO0 B;  1EP4 A;  2ZH8 A;  4OZN A;  5T41 A;  3ZC4 A;  1Y5L B;  3UWT A;  3FEX B;  1S0M A;  2HRU A;  3DU5 A;  1K1Q A;  3GCW P;  1Y5N B;  2FGC A;  2F9J A;  1MRO A;  1K4Z A;  3ISN C;  1R43 A;  3MAH A;  3NGU A;  2LYV A;  4DV0 F;  5HQ8 A;  2BJ1 A;  3VTI A;  4DV4 F;  2DCU B;  4J5O A;  4KKO A;  1RLC L;  4AUK A;  3JTN A;  4L73 A;  3OL7 A;  3C6U B;  1DLO A;  2X6W A;  2V69 A;  3IO1 A;  3ZO7 A;  2KVQ E;  1YG0 A;  1B0T A;  3ZTQ A;  4XM3 A;  4CDI A;  2IMW P;  1RWP B;  1IR0 A;  4ZMM A;  3RBD A;  2PFD A;  2VH7 A;  5ETO A;  5RUB A;  5DDQ C;  1KHV A;  2CQC A;  4JI1 F;  3AJD A;  2G13 A;  4C8N A;  1N5V A;  1B0P A;  3GU0 A;  1RQ0 A;  2AJF E;  2FVR A;  3CB4 A;  3GG1 A;  3RUB L;  1N5T A;  2FUG 9;  2CVI A;  4XTT A;  3TRG A;  4LF4 F;  1RSC A;  3CMQ A;  2BVZ A;  3WX4 A;  4MMO A;  5CHC B;  4BDP A;  2RSQ A;  1TL1 A;  3BGF A;  1XNR F;  3TAP A;  4KTQ A;  4NZ7 A;  2X3G A;  1S1W A;  1L3S A;  4WU2 A;  2NPF A;  1QVF R;  4K7Q A;  1NEE A;  3I0S B;  2OTJ S;  2WSE C;  4WFY A;  2IPO B;  3N5F A;  4ZVH A;  4RUA A;  5L9X A;  3NAH A;  4IOC Q;  3GQA A;  2ZH3 A;  4J9Q A;  2RAQ A;  4M5N A;  2G0I A;  4XLF A;  4FYW B;  3DOK A;  3OQ2 A;  1TL5 A;  3QFH A;  2XSJ A;  2R2S A;  1WEX A;  5KFE A;  1JLG B;  3QJJ A;  2MLY A;  3D6F B;  2R2T A;  3EVO A;  3D6T B;  3H2V E;  5D0R A;  3RW6 A;  1KP6 A;  4LJM A;  2YWE A;  1RTH A;  2L08 A;  4FKX A;  2NXC A;  5F8J A;  4YR2 A;  2GQ2 A;  3N01 A;  2XZD B;  1FE0 A;  1MU2 A;  1Q8B A;  3EXY A;  3W2W A;  3QYY A;  2KXN B;  3ZZY A;  5HP1 A;  2YNH A;  4J9P A;  2VA3 A;  2AYB A;  1AA1 B;  1SQG A;  3W63 A;  1F3F A;  2Y0B B;  3W8G A;  2I0X A;  4LF7 J;  1FD2 A;  1SC6 A;  2B4P A;  2JEI A;  4OHW A;  4F4A A;  2B8Q A;  2ZDO A;  5EN1 A;  4JV1 A;  4B3O B;  2DNR A;  1SH3 A;  2P8I A;  2HHU A;  3HZE A;  3MHY A;  3HJF A;  1FDD A;  3UVJ A;  1U49 A;  4LIW A;  3PXG a;  1GXL A;  4ZN3 A;  4K0K F;  1PYS B;  2GX8 A;  4WU3 A;  3K17 A;  4ED3 A;  4F3Q A;  3DU1 X;  1QA3 A;  2VG5 A;  5F8G A;  2EG1 A;  1Y3J A;  1UZD A;  3T1Y F;  3LP0 A;  4RUH A;  1VK3 A;  2GGP A;  2HMI B;  3GE9 A;  1A9N B;  2R7R A;  2B6A B;  2UXB F;  3ILL A;  2J0Q D;  2FGO A;  2HFO A;  4TVA B;  4DR4 F;  3OUY B;  1B99 A;  2FTR A;  3PAC A;  3V4I A;  1J27 A;  4Y2M A;  4K4X A;  3C16 A;  4LF2 A;  1T94 A;  1WD6 A;  3VCD A;  5I42 A;  4FDF A;  3DRP B;  3I56 S;  2JLF A;  4F4X A;  3BPD A;  1PIL A;  3QGI A;  4TY8 B;  2AJ4 A;  2VQF F;  2N3L A;  5B0B A;  2XLK A;  3MMC B;  2KJW A;  4ZVT B;  1KVJ A;  1UPP A;  3PVX A;  1AFJ A;  2HVI A;  2ZD1 B;  4FN5 A;  4ZCI A;  5J2M B;  4WXO A;  2ERR A;  1KLN A;  4O0N A;  2V8P A;  2Z30 B;  3M6W A;  4KV8 A;  1YVF A;  2MQN A;  3M32 A;  1PO6 A;  1WI6 A;  2WB1 D;  3JTP A;  5F8H A;  1RLD A;  1RBA A;  3L95 X;  2NUH A;  2R7T A;  2EK6 A;  3EM1 A;  3KOA A;  5FD1 A;  4EBE A;  1JLA A;  5KFK A;  1NB2 A;  3TZW A;  3TZX A;  3KLV A;  2XBP A;  3BRE A;  3QGP A;  1T9Y A;  3HVW A;  2VA2 A;  3GCX P;  3OLA A;  3TA1 A;  2Q6C A;  1YBA A;  1C0T B;  4DU8 A;  1YLX A;  3MTJ A;  5F9N A;  3PIO Q;  1NH7 A;  2DHA A;  4TN2 A;  2AGQ A;  4RLE A;  4ATN A;  4M5D A;  1NK6 A;  4WZM A;  2H1Y A;  5T7L A;  3I96 A;  4L76 A;  1S9E B;  1YJN S;  4AYB D;  2AIR B;  1BGX T;  2GA7 A;  2PEC A;  1RAI B;  1Q16 B;  4YFO A;  1OFD A;  1DJ0 A;  2N7C A;  3VSU A;  1SL2 A;  4FBU A;  1SL1 A;  1HNZ F;  3QGH A;  1PJ7 A;  1PSD A;  3NY0 A;  4P2M A;  1EQM A;  1W2B R;  3K58 A;  3CD6 S;  2RU9 A;  2KYX A;  4ZVP B;  2JEJ A;  2BAC A;  4DMZ A;  1LK5 A;  3SQO P;  1IM6 A;  4DCP B;  4B9T A;  2DJW A;  3OVA A;  3K59 A;  3KLI B;  3JQK A;  2HRY A;  1MWY A;  2C2K B;  3DLE B;  1IKV A;  3G4S S;  3TJA A;  1KTQ A;  1CVJ A;  4Z2X A;  3JX8 A;  3HD2 A;  2E9R X;  3TO8 A;  1X4E A;  2KZZ A;  3L3C A;  2BR0 A;  3U1L A;  3I4P A;  1KCD A;  2LLZ A;  2QL5 B;  2VB6 A;  3FSX A;  2HFV A;  2YWK A;  1CPZ A;  4ID8 A;  3C46 A;  3HUL A;  3M30 A;  1U2C A;  4LR9 A;  1SPB P;  2V50 A;  3MPW A;  2WSF C;  2UZA A;  2KB2 A;  2AJQ A;  4I4B A;  4KAI A;  2O1P A;  3EPI A;  2IA6 A;  1X0P A;  5J1E A;  5HBM A;  1LWF B;  3MR3 A;  2ALZ A;  2P6S A;  3DU6 A;  2F63 A;  5KAK A;  2HK3 A;  3FFI A;  3IC1 A;  2LDY A;  4OZ0 A;  3F0N A;  2Y9H A;  2IAJ B;  1O8G A;  1D9F A;  4ZLJ A;  4W90 B;  1VBZ A;  1JLB A;  2FJW A;  4HAC B;  2HZV A;  2QL7 B;  3AQP A;  3ITH B;  4LRD A;  2NYI A;  3DHX A;  4CYU A;  1X9S A;  1TEL A;  4B3T J;  1DFD A;  1CLF A;  5K9F A;  2QIF A;  2QEX S;  1NXI A;  2YUH A;  1JNZ B;  1WC0 A;  4USU A;  5IXU A;  3RGI A;  4UST A;  2BE2 B;  2XCP A;  4PQU B;  1GMW D;  2VIH A;  1BWV A;  5T14 A;  3GLJ A;  3CCR S;  2W4D A;  2W2N P;  4FVC A;  1JXV A;  1QE1 B;  2VFT A;  1VDH A;  2W9B A;  4AXJ A;  1SIZ A;  5CCM A;  1S0V A;  1N88 A;  1M5H A;  3I32 A;  1S7H A;  3D3B J;  3T5H A;  1KTW A;  2XZT B;  1RHR B;  4ID5 A;  5FDL A;  1KS2 A;  2XO7 A;  4ZP8 A;  4B9U A;  5KG2 A;  2WRM A;  1Q8L A;  2VDH A;  1U1N A;  1RAB B;  3KG0 A;  1QUP A;  1TV6 A;  1YX2 A;  5A8R B;  4NOH A;  1IKX A;  3P45 B;  5F9L A;  3MCM A;  2AWZ A;  3HK2 A;  4ED8 A;  3TUP A;  2V9W A;  1KNZ A;  2HZA A;  3ELH A;  1T03 A;  3MR5 A;  2LXF A;  2UUC J;  2H65 B;  4X4U A;  3PZP A;  1S6P A;  5C2C A;  4DX5 A;  4OHV A;  2KTQ A;  1IDJ A;  4PXD A;  3HFK A;  3H4D A;  1O8J A;  1SKU B;  1DZ5 A;  3NOG A;  4ITS A;  2CQB A;  4IDK A;  4M5J A;  2AYM A;  1SKS A;  4PRF A;  2MKC A;  5C25 B;  2IA0 A;  4OJH A;  2BAB A;  2P6T A;  1VRT B;  1U0H B;  1T3O A;  1KC8 T;  4KE5 A;  4V02 C;  1FKP B;  2JHE A;  5E3P A;  1SV5 A;  1NAQ A;  1IR1 A;  1F1B B;  4ZS6 A;  1AB8 A;  4B9M A;  4KGZ B;  1LLZ A;  2DIU A;  3OXL A;  4TNO A;  1DHM A;  2MZJ A;  5I3U B;  1RKI A;  1TFW A;  4DPO A;  1ZA1 B;  1OGO X;  2ZKT A;  5IV3 A;  3OJS A;  1U1K A;  4XON A;  3NNC A;  1NU4 A;  1KFS A;  1DQA A;  2MKY A;  3EVM A;  2ACY A;  2HVH A;  2E29 A;  4N56 A;  3C6U A;  4EO6 A;  2KG1 A;  1U26 A;  4DQS A;  3GFY A;  1FVQ A;  4DQP A;  5J1P A;  3SCK E;  2FVS A;  1MSW D;  3B54 A;  2K7K A;  2D1C A;  2O04 A;  3NGD A;  4ZPW R;  3QJP A;  4ZPC A;  4KC5 A;  2C22 A;  3KUG A;  4J9M A;  4ES2 A;  2HFU A;  1FXR A;  5HAT A;  2QA4 G;  1EIY B;  5DG9 A;  1RYR A;  4OQJ A;  4P2S A;  5KG3 A;  3PKY A;  4DSJ A;  1WOS A;  2J7W A;  4HHH A;  1T11 A;  2DY9 A;  3CO9 A;  1RWX B;  1TK5 A;  2V8H A;  4QIW D;  2WBM A;  2OFH X;  2J0X A;  4GVL A;  3DOM B;  1C0U A;  2CYY A;  4PKD B;  5D4L A;  1G4C A;  2Y1R I;  4IG0 B;  3NB2 A;  2A1B A;  1TL7 B;  1LEO A;  1Q78 A;  1H74 A;  2O01 C;  3C3L A;  3NGT A;  3SYJ A;  1PBA A;  3ENQ A;  4ZOS A;  3TUJ C;  2IQ7 A;  4DG1 B;  3CCW A;  2VFR A;  4I2Q A;  4ZJL A;  3M1V B;  1N5Y B;  5J2P A;  4ZCK A;  4DV7 F;  5KFB A;  3HSD A;  1SJ4 P;  2PII A;  1RHQ B;  3PSS A;  1JLG A;  1X0F A;  4KQZ A;  3CD0 A;  5C42 A;  2LEC A;  3DYA A;  1XMQ J;  3IG1 B;  2OH2 A;  3BKU A;  1RAF B;  3M2R B;  3EDR B;  4GO7 X;  1NPP A;  1UVN A;  2F65 A;  2D3U A;  2ZM6 J;  2BZ2 A;  2QMW A;  2Y8Y A;  4I68 A;  1H73 A;  3FCV A;  5KG0 A;  4KPY A;  3ADA C;  4YR3 A;  2JZ5 A;  1CJT B;  2QSF A;  5LJ3 Y;  1K9M T;  3TZZ A;  3VGT A;  2BEF A;  3MR7 A;  3MM5 A;  4ELT A;  2QMX A;  3CC4 S;  1RHM B;  2DGU A;  3ML3 A;  1S1U A;  2CQ2 A;  2OHD A;  1YRT A;  3GSD A;  4CO5 A;  1OIA A;  3D7S B;  3TUZ C;  2H51 B;  3OPK A;  4C6A A;  1HWK A;  2F4F A;  3HP6 A;  2EVZ A;  1FRH A;  2AU0 A;  2A3J A;  2XY6 A;  3P3D A;  1PJ6 A;  3SI8 A;  5KFC A;  2FJB B;  1M1K T;  1C4C A;  1KSP A;  3IBF B;  5F8M A;  1KD1 T;  2HQ3 A;  4JV2 A;  3IN5 A;  2R7V A;  4FVM A;  2N82 B;  2CPE A;  4YZX A;  2GZO A;  1UAW A;  2N3O A;  5DS7 A;  3SCJ E;  2MYF A;  3JQM A;  3MOJ B;  3SSR A;  2FZG B;  3N79 A;  1YIT S;  3PHE A;  2J76 E;  5JUM A;  3HVR A;  2HMI A;  3T5K A;  2B51 A;  2B6A A;  1UVI A;  5KG6 A;  2RIJ A;  3D6H B;  3I87 A;  2DXF A;  4LFC F;  3OUY A;  2QLB B;  2QXZ A;  1OMS A;  4URG A;  1HBN B;  4F4Y A;  2E9T A;  2EC2 A;  1J5E F;  5SZT A;  3H20 A;  1TVR A;  2WOM B;  3HXM A;  5F8N A;  2BAN B;  4P10 A;  5IC4 B;  2RDI A;  4P2X A;  4OZZ A;  3ET6 B;  1RAC B;  2X6X A;  3OSN A;  1PBU A;  1P6T A;  3K8W A;  3GII A;  2XNR A;  4O3N A;  3K5M A;  4ED7 A;  3HHK A;  4DLG A;  4QYZ J;  1YQH A;  3JYT B;  4TY8 A;  4X4T A;  2MQO A;  1ULR A;  2J9C A;  2L9W A;  4CLK A;  2FD2 A;  2UVE A;  1S72 S;  4DI6 A;  3PG9 A;  2F3L A;  3H5U A;  2HGL A;  3RAM A;  5J2M A;  4ZCM A;  3ENW A;  1RTI A;  2CIM A;  1FRK A;  2OAU A;  5CYM B;  2GW8 A;  5KT2 A;  2UU9 F;  2J6U A;  1QY7 A;  1YZ7 A;  2EFQ A;  5KFX A;  2FQQ B;  3PJW A;  2E1P A;  3VAF A;  4W8Q A;  2CXE A;  2ZIT A;  1QLN A;  2DNO A;  3M8Y A;  2W9C A;  3TAQ A;  1RT7 B;  4YC5 A;  1H0H B;  4DL5 A;  5ETL A;  5H1S V;  5KT4 A;  4OJL A;  2D3Z A;  3W62 A;  2IVY A;  2L48 A;  3N9U C;  4CLL A;  2KXF A;  4NL5 A;  4J9O A;  1EZG A;  2VFP A;  4GC6 A;  1RHJ B;  1WG1 A;  1Q5Y A;  2BJE A;  2KRR A;  4DPU A;  3D68 A;  1QCX A;  5AJ3 J;  3VGV A;  2FDN A;  3N4W A;  1FKO B;  3SV3 A;  4B9N A;  4KH0 B;  3AOB A;  4XN3 A;  1WC4 A;  5CD4 H;  3OXG A;  3O8W A;  1LFW A;  4DWI A;  2A6M A;  1T7P A;  4WE1 B;  1VQK S;  1FFW B;  1MG7 A;  3CJ8 A;  1WAC A;  4WP8 A;  1KOH A;  4GVB B;  2EXU A;  1TYW A;  2NSP A;  1D0E A;  3GV5 B;  2AGP A;  2M9K A;  3CGI A;  4LF8 J;  1IBC B;  2GFF A;  2YWW A;  3CJ0 A;  3VVT A;  1A0O B;  2INU A;  3UDV A;  2C2D A;  2AYG A;  3FRY A;  3KLH B;  1UCN A;  4C0B A;  4G1I A;  3QWU A;  5EUH A;  2DNQ A;  2MHN A;  5DZ7 A;  3AOD A;  2ZEJ A;  2DXD A;  2VBK A;  1QTM A;  3FSY A;  2ROE A;  3Q23 A;  2M0G B;  2CZ9 A;  5DQG A;  1BE4 A;  4P75 A;  4ILR A;  1OQ3 A;  1LQ9 A;  2DTJ A;  3G8S A;  2Q43 A;  2KH9 A;  3SZ2 A;  3FCW A;  2GIF A;  3MEG B;  2GML A;  3PRB A;  1GX5 A;  2K06 A;  1VLY A;  4JI3 J;  4DFM A;  2HND A;  5BR8 F;  3GSI A;  4QR2 A;  5C2G A;  2YKM B;  2M52 A;  3GZ7 A;  1VQ7 S;  5FLX U;  3BSC A;  2IAJ A;  5G0R B;  1FNM A;  2JRS A;  4OYM A;  2O66 A;  4YY3 F;  3DMJ A;  1H7W A;  1ZH5 A;  5ETS A;  1GQE A;  3SQG B;  2QZA A;  4HAC A;  3EQO A;  2HBR B;  4HI1 A;  3THT A;  3GIK A;  1NME B;  3DNC A;  3BGR B;  4V1A k;  2KM8 B;  2XLJ A;  4XOT A;  2QFJ A;  3D1H A;  3LGM A;  4IFY B;  4JYA J;  3S7R A;  3CUL A;  4WK3 A;  3CD7 A;  2F8E X;  1VMB A;  2BE2 A;  4PQU A;  3DI6 B;  3MF5 A;  1TL4 A;  2CAJ A;  4WTO B;  1QAY A;  3EE3 A;  1FCA A;  2AW0 A;  3HKZ D;  4OYP A;  3ZZT A;  2HBZ B;  4NXN J;  1RT6 B;  1QE1 A;  1AUS L;  4ZP6 A;  2C2E A;  1S79 A;  4ENO A;  1ZOT A;  1Q8I A;  2QN6 B;  1XJW B;  3DDN A;  3M9N B;  5BYR A;  2ATL A;  1WOR A;  3NAW A;  1KBR A;  1NJY A;  2C3Y A;  4MTP A;  1XTZ A;  1UJ4 A;  1VC0 A;  1CUL B;  1RWU A;  3ZTR A;  2V4R A;  3L4B C;  1FE4 A;  2HW3 A;  2ZBC A;  4OYX A;  3NCP A;  2RF2 A;  3FEZ A;  2ASD A;  3EGW B;  3ILJ A;  5A8R A;  2ZBR A;  4ZIV A;  3HSG A;  4D3H A;  3H25 A;  3RU0 A;  3KMQ A;  2J8S A;  4J9K A;  4Y6I A;  4X84 A;  4A8Y A;  3A8E A;  2MY7 A;  3CDA A;  4IQM A;  1WEY A;  1NKC A;  1PAE X;  4HHJ A;  3N6Z A;  3P5B P;  2M8H A;  2HRT A;  4ZIW A;  1HWI A;  3OD2 A;  5L1K A;  4RPF A;  1FFG B;  3MFH A;  5KFL A;  4C3K A;  2C3P A;  2ASJ A;  1SC1 B;  4E98 A;  1JLE B;  1RT5 A;  5B0C A;  1UP1 A;  2A18 A;  1NPR A;  2APO A;  1T9U A;  4JB8 B;  2OEL A;  4N77 A;  5KOX A;  1H2U X;  2CRL A;  5GAD U;  4ECU A;  2HHH J;  1VRT A;  1U0H A;  3CTR A;  3J7A 1;  4N41 A;  2IJF A;  3TVK A;  4OJG A;  3PX0 A;  4K4U A;  5DDO C;  2M4M A;  1ZPW X;  5DGB A;  2AMC B;  4XQF A;  2XMU A;  1L3U A;  5IZH A;  2HUR A;  1RTZ A;  2XT4 A;  1L3K A;  2DO4 A;  4U6P A;  4DV5 F;  4ZLL A;  3G6E S;  3N6M A;  2NRE A;  4TU8 A;  1XNQ F;  5MLC V;  1NZ8 A;  1IJF B;  3K7R A;  1RB0 A;  3GPA A;  1WWH A;  4B3R J;  5LMU J;  4K59 A;  2YPY A;  1UPM B;  2UXC J;  4GKK J;  1ZBT A;  3FZ2 A;  2OD4 A;  3DLB A;  2ZJR Q;  3TR5 A;  4JI7 J;  1T0T V;  3US5 A;  2OPQ A;  5KFH A;  1R7I A;  3MPU B;  2ADB A;  2WVD A;  2MZ1 A;  3J7Z T;  2HHP A;  1T02 A;  5K8P A;  2VBW A;  3BBF A;  2KRB A;  3GYG A;  4I0W A;  3BH7 B;  3BGL A;  2CZ4 A;  2HNZ B;  1VIS A;  4I2P B;  3TQE A;  2ZVI A;  1NHC A;  2PE8 A;  4B9S A;  2IBK A;  1S59 A;  4G3I A;  1WC1 A;  3R27 A;  2OPR B;  1D09 B;  2EG2 A;  5JLV C;  4FNI A;  2JFD A;  4PAA A;  2G4B A;  5EWF A;  5D4P A;  3PR4 A;  3HHL A;  1LWX A;  4WFZ A;  1HNV A;  4IG0 A;  2EFP A;  4QU7 A;  2YX4 A;  6FDR A;  2ACM A;  2CPH A;  1X0C A;  4P71 A;  2NXJ A;  2JNJ A;  1P27 B;  1U6B A;  5KFN A;  2CNO B;  4RUC A;  4RNN A;  4WCE Q;  3MEC A;  2VG7 A;  2V63 A;  3MCN A;  3QNW B;  3CIM A;  1FO1 A;  1BXN A;  3WC2 A;  3VVU A;  2BX6 A;  4C4W A;  3LPE A;  4C0H A;  3SQV A;  3IG1 A;  4MYT A;  1S57 A;  4IFV B;  1K73 T;  5K8M A;  5HLF A;  2Z8G A;  4F3O A;  1UKU A;  1EE6 A;  4RBT A;  2Y1L B;  2MST A;  1HD1 A;  3H09 A;  2Z4P A;  3OFG A;  2YNI B;  1TFY A;  2VBZ A;  4OFZ A;  4MFB A;  3ZTO A;  4DR7 F;  2FYX A;  1WC5 A;  2UV8 A;  1I51 B;  3MMA A;  3ULH A;  4PXE A;  4PG4 A;  1GAO A;  3ISZ A;  2KHC A;  4QJV A;  4ECS A;  2AT1 B;  3KHR A;  4B3S J;  1X8D A;  4JP8 A;  2YKP A;  2MY8 A;  2IDL A;  5CXT A;  1WMR A;  4YB7 A;  2BXJ A;  1X5S A;  4DV2 F;  2C2Z B;  4O3Q A;  3PX4 A;  2IM2 A;  2V8G A;  3PW7 A;  2DVI A;  4O4G B;  4H4K C;  3NEK A;  5HQM A;  1ZET A;  1LW0 B;  2FLP A;  2GAG C;  3HM9 A;  1OY8 A;  2JEF A;  1TKZ B;  3GV8 B;  4ETX A;  4O3R A;  4ZPD A;  1SI9 A;  4JV5 J;  3HJV A;  3R1H A;  3IRX A;  1WHY A;  2VBY A;  3LYC A;  1FWL A;  1U1M A;  3LW5 C;  4OJ3 A;  4YZA A;  2ZH1 A;  1CEZ A;  1BD6 A;  6FD1 A;  3BSA A;  3O6Q A;  4UQG A;  2HKE A;  2F4V J;  4OYB A;  2LVW A;  1PKU A;  3K5P A;  2N4C A;  4Y28 C;  1GEH A;  1LNQ A;  1HBN A;  1FRL A;  3VAM A;  2ZKU A;  3PRD A;  1S48 A;  2D9P A;  2E5J A;  3NLC A;  1ITP A;  1RKJ A;  1VK8 A;  5HI7 A;  2QJ3 A;  1X5P A;  3S6E A;  4R8U A;  2CJB A;  1VI7 A;  4NCG B;  4CLT A;  2EI5 A;  4J9U E;  3JYT A;  3MCS A;  3ETM A;  2QL9 B;  3CPW R;  1M5S A;  4CNZ A;  1NK9 A;  1RU2 A;  1ZAV A;  3S01 A;  2ZOF A;  2LFV A;  2YPZ A;  4FYY B;  1BQM B;  1HIY A;  2DH9 A;  4JI2 J;  2XWX A;  2XYG B;  2YQ1 A;  3UPF A;  1FRI A;  4RUB A;  1VQ9 S;  1Y5I B;  2XZW A;  3ZNJ 1;  1GQ8 A;  1UWB A;  2XB2 D;  3WDO A;  2H48 B;  2EFO A;  2C2M B;  3CXC R;  3WWG A;  5CYM A;  3H0P A;  2FZC B;  4I7F B;  1WHX A;  4DCJ B;  5HSP A;  1KQS R;  1VQ4 S;  4QIV A;  4USW A;  2X1G A;  3CCS S;  2XI3 A;  4MYU A;  2HGM A;  1H2T Z;  2XNQ A;  2MJU A;  1I6J A;  3DLK B;  2JVR A;  4DX6 A;  1JWW A;  4DV1 J;  4DV6 F;  4I6W A;  4WWS A;  2EFN A;  2H5E A;  4QR1 A;  1LOU A;  1ARO P;  1U8W A;  2BJ9 A;  1T9T A;  3JS9 A;  3LA0 A;  2BKO A;  4FS2 A;  2Z58 B;  1DBD A;  1N32 J;  3EGZ A;  2VAS A;  4QZV B;  3LAM A;  4DL3 A;  4K2J A;  2OJ3 A;  1XBW A;  3OR1 B;  1FER A;  1JMT A;  3TJ8 A;  3LF0 A;  3M6U A;  2IVF B;  3SY2 A;  4Q44 A;  2QY1 A;  4DR5 J;  1RP5 A;  4USJ C;  1TKX A;  4YCQ A;  2V0N A;  1WNE A;  2UVW A;  5A2Q Y;  2ILZ A;  1VJQ A;  4IO1 A;  4KPC A;  1CC7 A;  2N7Y A;  4JI5 J;  4WE1 A;  2G0J A;  2QX0 A;  2WSC C;  4K50 A;  4B3R F;  4YHH F;  2RDD A;  4LSZ B;  2E7V A;  1O51 A;  2JJ4 D;  3MM7 A;  5ETM A;  2CJA A;  1FRM A;  3E3X A;  2KFN A;  1WDD A;  3RRH A;  4TLR A;  1RA6 A;  2LCW A;  3NXZ A;  4RW8 B;  2FY8 A;  4FKY A;  2YVS A;  1HMV A;  3OL6 A;  3IS9 B;  1S5Z A;  2FLL A;  1CJK A;  4HHU A;  2MQM A;  4A47 A;  2E44 A;  3VAK A;  5IT9 Y;  2DCL A;  2RKI B;  4NLY A;  3DM2 B;  2NXE A;  3T9N A;  3NNA A;  4F04 B;  2G1H A;  2F7V A;  2NLW A;  2WW8 A;  1Q7L B;  2YKM A;  2B4V A;  4XO0 A;  3MM8 B;  3N6N A;  4FPI A;  3QAT A;  5G0R A;  2P9C A;  1QA1 A;  2R7X A;  4ETZ A;  1QUV A;  3OTC A;  4Y34 A;  3RR8 A;  3SQG A;  4DV3 J;  1O6X A;  5DG7 A;  4QWC A;  1TYU A;  4WK1 A;  4F2S A;  2LU2 A;  2AP6 A;  4LF1 A;  1VC6 A;  4U9R A;  3D1O A;  3LOU A;  3U7J A;  4BLG A;  1HR0 F;  1XWL A;  3NBP B;  4G1Q B;  3EXC X;  3TAR A;  4O3S A;  3T6B A;  1IKY A;  3DLH A;  2R2U A;  4Q8E A;  1S10 A;  1BLU A;  1DTT B;  2HQD A;  3QBC A;  2MKJ A;  1EAR A;  1UEU A;  1TKD A;  1D3W A;  3PFO A;  4LFB F;  4WZQ A;  3ZZO A;  1JTA A;  5THW A;  1GFW B;  3I6P A;  1RT4 B;  1SH0 A;  1YKW A;  3HHN B;  2UVR A;  2JLE A;  3MWB A;  5KFR A;  4DR1 J;  2I9S A;  3EZ5 A;  4ZCL A;  2O67 A;  2ZH2 A;  1OWX A;  1NJI T;  3JSR A;  2HHT A;  2D9O A;  1F9H A;  4C8O A;  3VMW A;  4EYH B;  2J8I A;  1VQN S;  3W2V B;  1OJ4 A;  2KVI A;  4DS5 A;  3EX7 B;  3H8Y A;  5DNS A;  2RQ4 A;  3ZTS A;  3T3F A;  1PLU A;  3WIU A;  3MAA B;  2B4U A;  4OYZ A;  2DT9 A;  2UUB F;  3Q8P B;  3IA0 A;  1QAI A;  2RVJ A;  4AT1 B;  2V34 A;  2MZT A;  3LAK A;  2KO1 A;  2FLO A;  4IRK A;  2E1A A;  3MD3 A;  4WIQ A;  3HHL D;  3RAX A;  3R7B B;  4HEA 9;  3BR8 A;  4OLO A;  1UWA A;  4JOU A;  4PG6 A;  5H9E J;  3E2E A;  4FNH A;  1S4E A;  1FTC A;  1OYE A;  4OJ5 A;  3M05 A;  5J2Q B;  2CQD A;  3UDC A;  1O8F A;  2OIH A;  4LRE A;  1ICE B;  3U02 A;  2DGX A;  4LF5 F;  2RUS A;  1GT8 A;  1MML A;  2OSQ A;  2XI2 A;  1SKW A;  3Q2S C;  4U8Y A;  3OLB A;  3I55 S;  2POK A;  2DGS A;  4ECR A;  5GAE U;  2AZ3 A;  1F5B A;  4WKY A;  2CA9 A;  4X64 J;  4W8R A;  1OGM X;  3NGR A;  4NAS A;  3W7B A;  3SFU A;  1QTN B;  4FF3 A;  2YKA A;  2IRU A;  1NSP A;  4F02 A;  2RT3 A;  1F0X A;  4FPR A;  3KK2 A;  2XGP A;  4ZPA A;  2ZVS A;  2UUA J;  4A8K A;  1HNI A;  1RCX B;  1R8C A;  2VBX A;  4J9N A;  2VKZ G;  1S6Q A;  1WEL A;  1U1Q A;  1K8A T;  4AQY F;  4EYI B;  3AK5 A;  2YTC A;  2F9D A;  2JDJ A;  2VBE A;  1KWM A;  3V6H A;  4DZ6 A;  1F60 B;  1QA2 A;  2YH1 A;  2HS4 A;  2R7Q A;  1JX4 A;  5ETT A;  1I5O B;  4O4R A;  3SSQ A;  3IP0 A;  2ZHA A;  4CNY A;  3GB0 A;  1C4A A;  3E01 B;  4LQ3 A;  5A8K B;  2XEX A;  3OVB A;  3DGV A;  3B90 A;  2QX3 A;  5CCL A;  4DQR A;  4U7C A;  1HQE A;  2CQH A;  2MZR A;  3CO0 P;  1CJU A;  2WCX A;  3AQO A;  3FBF A;  1SIW B;  1U02 A;  2ASL A;  3SDE B;  3QO9 A;  3TW0 A;  2AQ4 A;  4C2L A;  5L38 A;  4NA3 A;  3DKD A;  5HMX A;  4X65 F;  2VV5 A;  1F5A A;  2LEP A;  3AD7 C;  3SIP B;  3I4H X;  3KMS A;  1Z2Z A;  2P2C B;  1C1B B;  5DDP C;  2DHG A;  3MAQ A;  1ZM4 A;  1RWR A;  2Z2M A;  2XHW A;  2NTP A;  3IR5 B;  3G71 S;  2GIR A;  5C1C A;  4DR5 F;  1WTB A;  2ZH7 A;  4UW2 A;  2GNK A;  1JLF B;  1O0P A;  4URS A;  2R7W A;  4ZLP A;  1EZZ B;  2SXL A;  3G6Y A;  4IFV A;  4MKB A;  5E2Q A;  4DUZ F;  3IWX A;  1RYS A;  2WK4 A;  2K2P A;  3P4G A;  4TU9 A;  3PCO B;  5F0W A;  1MMD A;  4J9S A;  4QW9 A;  1V3R A;  1JNR B;  4YUD A;  4ZVF A;  3JQJ A;  3G82 B;  5L8R C;  3ISN D;  3NL0 A;  3MR2 A;  2K1R A;  1WEZ A;  1NND A;  2YWH A;  5KG4 A;  3W9I A;  3CJ4 A;  5KFP A;  2BSP A;  1L5U A;  1YJV A;  2ZDP A;  4K4Z A;  2KL8 A;  3EPG A;  1GK8 A;  2E7W A;  1M5K C;  3I0R B;  2WHO A;  4YR0 A;  1X4F A;  1SB6 A;  4C8L A;  1N36 J;  5G4D A;  3JSM A;  4LFA J;  5C24 B;  3SMZ A;  2W7O A;  4O4G A;  1WOO A;  3M2V B;  1CS4 B;  4QYZ K;  5A8W A;  3H4B A;  4YQW A;  5L1L A;  4EMD A;  2DNL A;  4JI0 J;  1R0A B;  2MJN A;  4R5P B;  3DXS X;  1TKZ A;  2XQC A;  5B09 A;  2N4D A;  1PG5 B;  1A7G E;  5E33 A;  2Z2Z A;  3HKW A;  1R8B A;  2VFV A;  4NXM F;  3J80 U;  5H9F J;  1H2V Z;  1XMO J;  1UFW A;  5GAG U;  2FC9 A;  4DV3 F;  4K8R A;  1BN8 A;  5GVQ A;  2FJV A;  3OL8 A;  1VIO A;  5IWA F;  3GQ8 A;  2DGW A;  1JQG A;  5GMK a;  1EKR A;  2UV8 G;  1VRU A;  1KDN A;  1X4B A;  4IOB A;  4RW9 B;  2H4W B;  4DL4 A;  2BUN A;  2HHS A;  2MLZ A;  4X4Q A;  4EW9 A;  1QM9 A;  4HL9 A;  3CJK A;  1RAA B;  4DEZ A;  5BYQ A;  1K5C A;  2CWX A;  4AL7 A;  2UXD J;  3KKF A;  1NK0 A;  2COL A;  2AJ0 A;  2BJD A;  2RU3 A;  4J91 A;  1HYS B;  2W8L A;  4NCG A;  4OLP A;  1U48 A;  3D1Q A;  1BC6 A;  5D78 A;  3BB5 A;  2VDI A;  2VU5 A;  1VBL A;  3CDE A;  3MD1 A;  4DR1 F;  1BQM A;  2V5I A;  3V6D A;  4QIG A;  4WXW A;  1FJC A;  1YK9 A;  4XNF A;  3MR6 A;  2WAQ D;  4ECQ A;  1REG X;  3FSI A;  1YJ9 S;  2BQU A;  1G2E A;  4O44 A;  3TWZ A;  3M8P B;  5KT5 A;  1W2I A;  4I84 A;  4XMY A;  1LXN A;  2ZBI A;  4I7F A;  2FB0 A;  4EK2 A;  3FQL A;  1FWK A;  4BBY A;  3B78 A;  4ZJO A;  2HVZ A;  1PYO B;  2B9W A;  1ZA2 B;  1XN9 A;  5A0Y A;  1BHN A;  3H98 A;  2J5A A;  2CJ9 A;  3J7Z 5;  1HBO B;  3SCI E;  1KON A;  3DLK A;  3UCU P;  5GMD A;  3D0G E;  2BW2 A;  1IVZ A;  4KFB B;  1DRZ A;  4DR6 J;  1PCA A;  1VR6 A;  1X60 A;  2YNG B;  4W98 A;  2NYH A;  5LOQ A;  1HNW F;  4HWV A;  1VQ5 S;  2XYP B;  3KJV A;  2EFV A;  4XDD A;  3K5O A;  3OR1 A;  4CH1 A;  5GAH I;  3FZB A;  1IKW B;  2KHD A;  1LWE B;  4ZLN A;  2H5I B;  1Z4U A;  3V5R A;  4L6V 3;  3UFC X;  3A3P B;  1C1C B;  3AXK A;  1P9Q C;  5I3P A;  1TUV A;  2LA6 A;  4PUO B;  2JL9 A;  2PYH A;  3MXH P;  1FWP A;  4L74 A;  3V2U C;  2QA1 A;  3Q89 A;  2IVM A;  4NK6 A;  4NA2 A;  2DO0 A;  1BQN A;  1TP7 A;  4F67 A;  4DPX A;  2DR5 A;  2O5D A;  1AZS B;  1FEE A;  4OL8 A;  4M63 A;  4QYR A;  1NSK L;  1K0T A;  2YNF A;  3H59 A;  3CT9 A;  2OPP B;  2X1B A;  2AEM A;  1DAX A;  3G8T A;  4M94 A;  2VG6 B;  2VJI A;  3L7U A;  2VUG A;  4LRB A;  4RW8 A;  1LFP A;  2DNP A;  2NTB A;  5CYQ B;  3WQP A;  9RUB A;  2ADC A;  1Q79 A;  2ZZT A;  1GMW A;  3KK1 B;  4JI6 J;  2V8D A;  4NLW A;  2CUY A;  2WVC A;  4ZVQ B;  2DNH A;  2RKI A;  3GIJ A;  2LQB A;  3VAJ A;  1P1T A;  3POT A;  4DR2 J;  3DGP B;  3MM9 B;  4RW6 B;  5DLF A;  1EA0 A;  1UFK A;  3K2Y A;  4B02 A;  2L3M A;  2O3D A;  4LMZ A;  4U49 A;  4Q2L A;  2VPZ B;  1Y3K A;  4UQT A;  2ZH6 A;  1FTR A;  4PPD A;  3DRR B;  4RKU C;  4KGK A;  4P6Q A;  1FJG J;  1O8E A;  4OM9 A;  1Q82 T;  2XMT A;  3DRS A;  2EBG A;  5HAN A;  4YEA A;  5KFS A;  1I94 J;  1DTT A;  4ZHR B;  2W2P P;  2HWT A;  2FZK B;  2OFG X;  1JLC A;  4C11 B;  4JV0 A;  3QT6 A;  1OO0 B;  1HWL A;  4AL6 A;  2HHW A;  3FEY B;  2QLW A;  2GJF A;  3BQ2 A;  1OS5 A;  1RT4 A;  3Q22 A;  4IR9 A;  2MPU A;  1JRG A;  1XMB A;  1U4B A;  3IWL A;  1KTV A;  2JSX A;  4USV A;  3UD5 A;  4OJP A;  4UOG A;  1KOO A;  3CCE S;  4U67 Q;  4FXW A;  1LW2 B;  1NSA A;  1T05 B;  1UEV A;  5ETN A;  4C0O C;  3C66 A;  3QMQ A;  1HNX J;  1FVS A;  2GV1 A;  4BC9 A;  3MAA A;  3EWG A;  4PG7 A;  5F3Z A;  3N90 A;  3KJF B;  4Q8F A;  4I67 A;  4LFA F;  2CG8 A;  4DFJ A;  5LSO A;  2HNY B;  1NH8 A;  3R2D J;  1Q5V A;  4NYP A;  3OSP A;  3C8Y A;  3KHG A;  1K47 A;  1IA5 A;  3EVW A;  4IOA Q;  4M5M A;  1MN9 A;  5M2P A;  4Y2C A;  1XMO F;  1EB0 A;  3C6T B;  4OI4 A;  4MK8 A;  3M8R A;  3CCT A;  2KM8 C;  1TUW A;  3DRX A;  4F50 A;  3SSS A;  2C2O B;  3M6X A;  4KGM A;  5KFQ A;  1IN0 A;  2GHV C;  5HVG A;  2F5G A;  4HT5 A;  1HBM A;  2CFX A;  4RU2 A;  1IJE B;  2OLW A;  4X2B A;  2I38 A;  4TXS A;  1VBY A;  2UXD F;  3PV8 A;  1T8E A;  3OTB A;  4WJB A;  3F41 A;  1R8A A;  5DJB A;  3TEH B;  3G6X A;  2BV3 A;  4PQA A;  1S97 A;  3CC7 S;  4U96 A;  4DL2 A;  3BS9 A;  3MPY A;  2E5H A;  1M0S A;  1T9V A;  4PYA A;  3M8Q B;  1BHE A;  4LF9 J;  3RRG A;  1RT1 B;  1RMG A;  3BDP A;  2NT6 A;  1J5O B;  4IRD A;  1PE9 A;  2PEH A;  1X9W A;  4A8Q A;  2E9Z A;  4ICL A;  4I64 A;  1HL6 A;  2XTY A;  4ED0 A;  1EP4 B;  1F9E B;  5JJB A;  1RTJ B;  4TKT A;  2V2V A;  2V6A A;  4YDD B;  5LMN J;  1L1I A;  3PFE A;  2DGT A;  2KT2 A;  1X4G A;  2AD9 A;  4DF4 A;  1MRO B;  2NQP A;  1SQF A;  3BZQ A;  3HZG A;  2DPI A;  3E01 A;  4PXB A;  5D0G A;  5A8K A;  2W2M P;  5IOL A;  1IBL J;  2J6S A;  4OZ5 A;  4XLE A;  3A4T A;  1W26 A;  3NKY A;  2F40 A;  1QDU B;  4NMX A;  3AOA A;  4CT8 A;  4DL0 C;  2DH7 A;  3HDS A;  4LUB A;  2HWH A;  2C28 A;  4DZD A;  4DUY J;  4PG8 A;  4IUF A;  4KKO B;  4LRF A;  1U25 A;  2J8A A;  3Q8U A;  4UT4 A;  2RNE A;  4DR6 F;  5A76 A;  2PN6 A;  1OFL A;  4B3M J;  1WKJ A;  4MK9 A;  1DLO B;  2HPU A;  3QIP B;  1NBE B;  3DDK A;  1NDC A;  1H7X A;  3EUN A;  1RAE B;  1KLM B;  3FQK A;  3SEO A;  1YSJ A;  1CLW A;  2XSF A;  2HQC A;  4EBC A;  2Q3P A;  5KT7 A;  4DPW A;  3T9G A;  1KVI A;  5LSL A;  5B7W A;  1WG4 A;  2IM0 A;  1ZM9 A;  4B9L A;  4USI A;  1FF2 A;  4M1K A;  5K5M A;  3TAN A;  1GMV A;  4NRU A;  4ZPV R;  2MGZ B;  3OFE A;  3AFG A;  3K0J A;  3OR2 A;  4K4S A;  5FJ4 A;  2ROG A;  2FVQ A;  3D4J A;  2BM7 A;  1JJC B;  2WON A;  3A8K A;  3C19 A;  2D69 A;  3FC9 A;  1S1T A;  2E5L J;  3V6J A;  2VFS A;  2IOU G;  3MM6 B;  1S1W B;  1R8P A;  3KLE B;  3PKM A;  4UOH A;  4UZB A;  3AOC A;  1NHK L;  2HVE A;  3ICL A;  4QIF A;  4H4M A;  4R25 A;  3AAW B;  2QA2 A;  1R6V A;  3I0R A;  3QT7 A;  1G7C B;  1VOM A;  1VQM S;  3D0H E;  4PPZ A;  3FUY A;  5C24 A;  2RRN A;  3DOK B;  4OX9 J;  2MB0 B;  1YIJ S;  4GKJ J;  2XSJ B;  3GQ7 A;  4JI6 F;  3TZY A;  1CS4 A;  3QT8 A;  4KYZ A;  4XL9 A;  1OFE A;  3GYN A;  3UD4 P;  1RAD B;  4OYI A;  2E7X A;  2ASY A;  1DBO A;  3T1H J;  2CQ4 A;  4YS2 A;  4M8L A;  2C3U A;  4XAK A;  5D3G A;  3OFH A;  1RTH B;  1QJV A;  1E6Y A;  1VYA A;  1XK8 A;  1HI1 A;  4ZP9 A;  2ZE2 B;  2DIS A;  1OYD A;  2MKS A;  2XHC A;  1YZ6 A;  1MU2 B;  1D1U A;  1GX6 A;  3RYL A;  5JMC B;  3TOQ A;  5HP1 B;  2YNH B;  1TZ0 A;  5L39 A;  5AT1 B;  1OY6 A;  1GMU A;  2W24 A;  4MIA A;  4RW9 A;  3CJ5 A;  3D28 A;  5CYJ A;  3B82 A;  4LF6 J;  2ODL A;  2EKY A;  4YZQ A;  2WVE A;  2ROP A;  4RX6 A;  4IH5 A;  2Q1L A;  4NCB A;  4FZV A;  1IBM J;  2DHH A;  4RNO A;  4RW7 A;  1U45 A;  2RH3 A;  3GJS B;  1N4L A;  3SUC A;  1MNE A;  2QE5 A;  4HDH A;  4KR0 B;  4E8U A;  3HI9 A;  3UVJ B;  3LTO A;  4ER8 A;  5KG5 A;  1FA0 A;  2DPJ A;  1SKR A;  1IQZ A;  1P8G A;  1B3T A;  4CRJ A;  5J2N A;  1Y0H A;  1R3N A;  4CO1 A;  3LWM A;  1S76 D;  1HWJ A;  1DBG A;  1WF0 A;  2DKO B;  1FXL A;  3TH0 A;  2VG5 B;  2CJQ A;  3CJQ A;  1UZH A;  2RJZ A;  1TL3 A;  5DQH A;  4ECZ A;  3UQS A;  2MLX A;  3M8P A;  2GGP B;  3CCL S;  2R8H A;  1HWU A;  3UN5 A;  2OSR A;  2I5J A;  3MMB B;  1GTE A;  1Q0N A;  2DNN A;  2LQJ A;  4Q7A A;  2QO3 A;  3ETO A;  4KT0 C;  3I9Z A;  3CC2 S;  1IWG A;  3CJT A;  3THP A;  2U1A A;  2U2F A;  3J81 j;  1Q95 G;  1RWW B;  1PYT A;  3TQ1 A;  3HD1 A;  1VQY A;  4JRA C;  2AHO B;  3V4I B;  1F2G A;  1N48 A;  2H4Y B;  3GIM A;  5HVH A;  4ECX A;  4DV0 J;  4XR6 A;  4DV4 J;  3UNG C;  3M8Z A;  1QSY A;  2R8G A;  3QFW A;  4KFB A;  4LF7 F;  1HBU A;  1R0C B;  2ZHB A;  4OV6 A;  3K57 A;  4XPC A;  1FK9 A;  1NLK L;  2Y0S D;  4FF1 A;  3HSZ A;  1NB7 A;  2A2C A;  3LH2 S;  3AB2 B;  1LLW A;  1KR4 A;  1RAH B;  4DS4 A;  2RRA A;  4KV8 B;  3R5A A;  2M70 A;  5F0U A;  5KFO A;  2PD1 A;  1UW4 A;  2D3O R;  2B43 A;  3VMV A;  5JVG Q;  1IB4 A;  3GFX A;  1JLA B;  3PHT A;  1SL0 A;  3GR0 A;  1FJ7 A;  1PJ5 A;  4PUO A;  3W61 A;  4LF4 J;  1S9G B;  1TAQ A; 
#chains in the Genus database with same CATH homology
 2F3L A;  4UOF A;  3JX8 A;  1S5Z A;  4OJO A;  4FKX A;  4WBF A;  3BH6 B;  1WKL A;  3ETM A;  3EVW A;  3Q8Y A;  1NCL A;  3L7U A;  1MN9 A;  5JMC B;  2AZ3 A;  3EJM A;  3B54 A;  2DYA A;  1B99 A;  3G2X A;  1NDK A;  3FBC A;  1WKK A;  3B6B A;  3GPA A;  4JRA C;  4S0M A;  2J8I A;  3NGR A;  2BM7 A;  3NGS A;  3FC9 A;  3Q8V A;  5CAB A;  1HIY A;  1NDP A;  4ANC A;  4AND A;  1JXV A;  3FBF A;  1TYW A;  1PAE X;  3BBC A;  1F6T A;  4W98 A;  1K8F A;  3N6Z A;  5BXI A;  1QA1 A;  2IOU G;  3BBB A;  1F3F A;  2W7Z A;  2XC1 A;  1NSP A;  4UOH A;  3VVT A;  5IOL A;  2B0R A;  4HR2 A;  3ZTS A;  1K4Z A;  3DKD A;  3ENA A;  1KQ5 A;  1UCN A;  2VFO A;  2CWK A;  1NHK L;  2DXF A;  3VVU A;  4OJP A;  2HVE A;  1XIQ A;  2VU5 A;  2BX6 A;  3FCV A;  4CP5 A;  4UOG A;  3EE3 A;  4F4A A;  4KPC A;  2BM6 A;  3NGU A;  1TYU A;  5CAA A;  1MN7 A;  3LJY A;  3RIQ A;  4V02 C;  1EHW A;  2V5I A;  2B8Q A;  3VGT A;  1S57 A;  2BEF A;  2DY9 A;  1WXR A;  3SZE A;  2B8P A;  3BBF A;  1NSQ A;  3LYC A;  3FBE A;  2VFN A;  1NPK A;  3Q8U A;  2DXD A;  1ZS6 A;  3BH7 B;  1BUX A;  1NLK L;  3ML3 A;  2DXE A;  3FKB A;  4OJL A;  3Q83 A;  3Q86 A;  4ENO A;  3PRV A;  3H09 A;  1WKJ A;  1TYX A;  3AK5 A;  1NDL A;  1QRC A;  3EMT A;  2AZ1 A;  3R9L A;  3N90 A;  4C6A A;  1BE4 A;  3DDI A;  3ZTP A;  1PKU A;  1S59 A;  4OJ5 A;  2VFP A;  2BM5 A;  3Q89 A;  3PET A;  4KH3 A;  3VGS A;  4DUT A;  1HHQ A;  1NDC A;  3ZTQ A;  1B4S A;  3ZTO A;  4O0N A;  3FCW A;  3FBB A;  3WX8 A;  3VGU A;  4DZ6 A;  3ZTR A;  2VFQ A;  1K44 A;  1LEO A;  3PJ9 A;  1TYV A;  1CLW A;  1QQ1 A;  4ANE A;  5JLV C;  4EK2 A;  4F36 A;  1QA2 A;  2HVD A;  2VFM A;  3TH0 A;  4OM9 A;  3NGT A;  3EM1 A;  4OPW A;  3P4G A;  1HLW A;  1QA3 A;  3SYJ A;  1QRB A;  1HF2 A;  3EVM A;  3ELH A;  3MPD A;  1NSK L;  1XQI A;  1NUE A;  3EIC A;  2ZUA A;  3GP9 A;  3VGV A;  1U8W A;  4OJ6 A;  2NCK L;  3EVO A;  3JS9 A;  2BM4 A;  4FKY A;  1BHN A;  2HUR A;  1NB2 A;  1TSP A;  1KDN A;  2G0Y A;  1LWX A;  5C7P A;  1DAB A;  1W7W A;  1VYA A;  2YUH A;  4DI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...