3BH7B

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
total genus 103
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh7B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh7B02
3Q8YA 3VGSA 1WKJA 3ZTQA 1NCLA 5CAAA 4UOFA 1PAEX 2YUHA 3BH6B 1PKUA 4C6AA 1XQIA 4S0MA 1NB2A 1LEOA 3FC9A 1W7WA 3ZTOA 3VGTA 3EMTA 1NSPA 1NDCA 4DZ6A 1JXVA 2HVDA 3FBEA 3L7UA 4W98A 1HIYA 3FCVA 1BUXA 2B0RA 4DI6A 1NDPA 3FKBA 5CABA 1WKKA 2BX6A 3EVWA 3NGUA 3Q8VA 2BEFA 3G2XA 1LWXA 3DDIA 4CP5A 2AZ3A 1NDKA 1B99A 2DY9A 4HR2A 2NCKL 5C7PA 1KDNA 1HLWA 3EM1A 4UOHA 1F3FA 1U8WA 1UCNA 3ENAA 3Q89A 3MPDA 3VGVA 4F4AA 3ZTSA 3R9LA 3FBFA 3JS9A 2B8QA 3VGUA 1XIQA 3ZTPA 3Q8UA 3EVOA 4ANCA 3Q86A 1VYAA 1S57A 3NGRA 3EVMA 2DYAA 1F6TA 1K4ZA 3BH7B 5BXIA 1S59A 1MN7A 4O0NA 3NGSA 2CWKA 1K44A 2DXDA 3FBCA 4F36A 4ENOA 1BE4A 3ZTRA 1HF2A 1EHWA 1NUEA 3PJ9A 4FKXA 4ANEA 1NSKL 1NHKL 1NLKL 3PRVA 2DXFA 3BBBA 3B6BA 1NDLA 2HURA 5IOLA 1WKLA 4KPCA 3ETMA 1MN9A 1ZS6A 3ELHA 1B4SA 4UOGA 3FCWA 3Q83A 1S5ZA 1KQ5A 3DKDA 4V02C 3EICA 3NGTA 3B54A 2HVEA 4DUTA 3BBFA 1NSQA 1K8FA 2VU5A 3GP9A 1HHQA 4ANDA 3VVUA 3WX8A 1BHNA 3EJMA 3BBCA 2DXEA 4FKYA 3FBBA 4WBFA 4EK2A 3VVTA 3GPAA 2B8PA 2ZUAA 3EE3A 2AZ1A 1NPKA
chains in the Genus database with same CATH superfamily
5AMVA 5HP1A 2W8KA 4K4ZA 2FJBB 3W63A 2QN6B 1X5TA 2WZ1A 3D0IE 1XK8A 3QGHA 4WTOB 2ZH9A 3RG6A 3DLBA 3DXSX 4I2PA 2WOMA 4I0WA 4IUFA 3M2RA 5DLFA 3G2XA 2J7WA 4LR7A 4RUHA 5GMKa 4MH8A 4HR2A 1R8AA 4H4MB 3V6DB 1PXZA 1U0HB 1U1RA 2ZITA 1JLAA 3BDEA 4RW8B 3QO9A 1WEYA 1DFDA 1C2PA 3ZTPA 4ZPVR 1LNQA 3M1VB 3CD5A 3MM7B 1O6XA 1LQ9A 1T03A 4LBIA 5HROA 2JDJA 1X4DA 4XPCA 4NRUA 1U48A 4FNHA 5D4NA 3GIIA 5KT2A 2V8GA 3FQKA 2F8MA 4HDGA 1XG2A 2PMZD 4RWWA 3NP5A 3TI0A 2DO0A 4W8RA 3DRYA 3CT9A 1U6FA 3V4IA 1S0NA 3P8BB 1U2FA 4YC5A 2XZWA 2HNYA 1V3RA 3SQOP 3DRSB 2GS8A 3IRXA 2PECA 4ZVSB 3G6VA 1S1WB 2CAJA 3SZ2A 1H2UX 4K4WA 3MWBA 4DR3J 1U2CA 2WSCC 2KL8A 3S01A 1FKAF 3M6WA 2IOUG 1GXLA 4USHA 1HHSA 4K4UA 4N76A 3OXLA 5DDPC 1TVRA 3D3BJ 2NCKL 5F8LA 1JK9B 3B4MA 5LMNJ 1ZAVA 2ZKUA 4IH6A 2JH3A 1S1UA 1GAOA 3JS9A 5A6PA 2KKHA 1LV5A 5IC6B 4N56A 1RAGB 3DI6A 3KHHA 2B9EA 7FD1A 4FS2A 3AOAA 2XO7A 2RSQA 3EXCX 2PYGA 2HBRB 1S6PB 5LMNF 3V81B 1HNVA 3ZC4A 4AUKA 4TU8A 4DWIA 1QAJA 4KQZA 3ZFVA 1OSDA 2NSTA 3THTA 1F5BA 1FF2A 2MMYA 1PBAA 2KJWA 3BBFA 2ALYB 4I6AA 7AT1B 3O6QA 5KFRA 3AOBA 4IR1A 2GNKA 1GFWB 3N5BA 2MZ1A 5GMEA 3I4PA 1TL1A 1EIYB 1BY9A 1YJ7A 2EEYA 3CWJA 5DDOC 4CH0S 4DBQA 3RRGA 1KRPA 1Q5YA 4UUXA 3BZQA 1M5OC 4PZVA 2K1RA 1VOMA 3BDPA 2LFVA 4DHVA 4X4PA 3KHLA 2HMIA 4O4GA 3LA0A 2JEJA 2BJ7A 1U7LA 4ALZA 2HQ3A 3FZBA 2IM0A 4DX8H 1NDKA 1N32J 4Z7CA 1KCDA 4X4TA 4CDIA 1JLQA 4KAIA 2LDIA 3R3TA 1VLOA 1ZZNA 3CULA 1FERA 3ITHA 3SDEB 1UJ6A 3VR1A 4J5OA 4IDKB 1WG1A 3N6MA 4YR3A 1R89A 2NUUG 3N6NA 4EBDA 3FFIB 2RDDA 1N32F 1UAWA 1NXIA 4QU7A 3RJMB 3GLJA 4OYIA 2IMOA 4C98A 2X51A 4DQIA 4C8LA 3R97A 5C42A 3HT3A 1VS3A 3B8HA 2LEPA 3QLHB 1X8DA 4LF8J 4J7CA 2YX1A 4WXWA 2DHAA 4O3QA 1YJNS 1QSLA 2Y9HA 4K7QA 3I56S 4MKVA 3BSOA 3GB0A 2KZMA 2BX6A 1IKWA 2VFVA 1R27B 2BRLA 4HHUA 4K59A 2B5JA 4DPXA 1RYSA 2CQPA 1HKAA 1Z2ZA 1TUVA 1AW0A 2BOAA 3WBZA 3HT0A 1U1PA 4W4MA 1N54B 3QATA 3CSKA 1QRBA 4OX6A 4UZBA 1GMWA 4WP3A 3K17A 2QLBB 2VF3A 4G65A 5KFZA 5SUHA 1MMLA 2VJUA 2OSRA 2NSPA 4MK7A 8RUCA 2VFPA 2RQKA 3I32A 2VDIA 2XS7A 1O8BA 2RQCA 1S5ZA 4OX8A 3RZAA 3PW7A 4J9UE 1RWVB 1FRHA 2X6XA 3CC2S 3OVAA 5CYJA 4DV3J 1HWUA 2VBZA 4B3OA 2KFNA 4ZVGA 2VG5B 2POKA 1KFSA 4G1IA 3BO3A 4DCPB 2PD1A 1NB2A 1V9OA 2ZH4A 1NJZA 1WC4A 1YJVA 1O8DA 1NHVA 3CCMS 2QLXA 2IYIA 3CD7A 2I6WA 4CT8A 1UETA 1WSVA 2CPXA 5CABA 3QT5A 3GRHA 2D74B 4M94A 1VRUA 5EDWA 4XORA 3BGFA 1R8BA 3OUYB 5SZTA 2PFDA 5F8GA 5IT9Y 2BW2A 3VGVA 4PG5A 1S6OA 3CPWR 4LFBJ 3ISZA 2HBQB 2DGUA 2J9DE 1RWPB 2J76E 3D1OA 2KU7A 4WJBA 1EARA 2HNDA 1NSKL 2IJFA 1GT8A 4TN2A 4KGKA 3NEKA 3K5PA 4F2RA 2CJKA 3FCWA 2RVJA 1R3NA 4UTGA 3OL6A 4A48A 3OJUA 3R5GA 4YS2A 5ADZA 1JLFB 2B9XA 3VSTA 1EJ7L 3VVTA 2VOPA 4IOCQ 2LQJA 5GAGU 2G9OA 2ABYA 1S0OA 3BJYA 2JRSA 3PTWA 1ZETA 2M3DA 4UQGA 3W7BA 2BSPA 3DYAA 2Z57B 5ETPA 1HBNA 4KO0A 1ZAXA 3TWZA 2W2QP 3ETOA 3C14A 4IOAQ 3OLBA 1Y0HA 3N6LA 2F4FA 1HWKA 1OGOX 3N28A 1SJ4P 4ITSA 5HN0A 1G3OA 2CQ4A 3M05A 2FZCB 3M30B 3HJVA 1I5OB 2CQDA 2W2OP 3W5YA 4O3PA 4PKDB 4CLPA 1HF2A 1YJTA 2V2VA 4KH1B 1FRXA 3NGDA 4B9LA 4Y00A 3BGRB 2WB1D 3M7VA 3IFEA 2FYXA 2U1AA 3RRHA 2YKPA 1ZM9A 1GNKA 2MQNA 4C8NA 3TJ8A 4GC6A 2VJIA 3W62A 2QA2A 3TR5A 2AYEA 2LDYA 4QBUA 2N4CA 3Q8YA 3C6TA 1QDUB 4LSNB 4FXDA 2V2KA 2JC0A 4C6AA 2JHEA 3ICLA 3I0SB 2UVFA 3CCRS 1DHMA 1REVA 4YN3B 4GO5X 4ED1A 1WJ9A 5FIIA 5KFOA 5ETTA 3K89A 5LT5A 3AB4B 4FF1A 3ULHA 4JYAJ 4G1PA 2DH7A 2CPIA 1KHVA 1F5CA 4LQ9A 3ZTSA 3DLKB 2X6WA 2P9GA 3H2VE 4XQFA 3BR9A 1RT7B 2DNKA 2QX0A 3NRBA 2E44A 4IG0A 1R0AB 2P6SA 3AXMA 4OZ1A 2M8HA 3V2UC 1U09A 1LK5A 4ZVTB 4P74A 2Q43A 5DZ7A 4PUOB 1K1SA 1R7IA 5KFVA 1D9AA 2CNNB 4IQXA 1P9QC 4OJ5A 1N88A 3GE9A 3FEYB 5GAHI 4ZKAA 1SBRA 1XR7A 3HHNB 2QYGA 1S99A 1CVJA 4XM3A 5CYMB 3NS7B 1GK8A 1N5YB 2CWXA 4DG1B 1VQLS 5CAAA 2WVFA 4W92B 3VF0B 5HQLA 3HF5A 1BGXT 2V8PA 3VGTA 3VMWA 1XNQJ 2XY5A 2CVIA 3N9UC 2KH9A 4EW9A 4CLZA 5JUMA 2A2CA 2GFFA 3N5FA 3KLIB 1UFLA 1IR1A 2C3YA 1F2GA 2QSFA 2RF2A 3PW4A 5GAEI 2IBKA 3CCWA 1KTWA 4YB5A 5L1JA 2HGNA 3UW1A 3AD9C 1NEEA 3FZ2A 1MW7A 4GKJJ 1D9DA 1NJYA 4X66J 2RHQB 1XNRF 3FK4A 4F36A 2HRYA 2MKJA 2CJAA 3H59A 2HQIA 2RIJA 1RT1B 1L3TA 3ZZTA 4F50A 2X3GA 2N3LA 3D7SB 2G4BA 2DCLA 3WDOA 3GILA 1K8AT 2Y3YA 2IVYA 4GKJF 3BKFA 3AB2B 3HHLB 2IAJB 3PW5A 1XWLA 4I2QB 3PSZA 1HHQA 3IN5A 4O3NA 4X66F 3HD1A 4XLEA 4DPOA 3GCXP 1U4BA 3RB0A 2DNRA 5D4OA 2KM8C 5CCMA 1YGYA 5M2UA 1YKWA 3FY3A 3GYGA 5A8RB 1S9EA 3IWNC 1OFEA 2RS8A 5G0RA 2VQEJ 2R9LA 4K4SA 4K0KJ 2GO9A 2YVSA 1N5VA 1VQ4S 3UI3A 3GZ7A 4DUZF 1LFPA 4QIWD 3C2PA 5IC4B 1RE1B 1XMOF 4F4AA 2G1DA 2A18A 3HSZA 4USWA 4X4VA 2XY6A 1RHJB 1QM9A 5B0DA 1SKWA 4V1Ak 2C22A 3IS9B 4NLQA 4K0KF 4YQWA 1K4ZA 4KR0B 1N6QA 1VQPS 3QFWA 3DNCA 3BPDA 3WQPA 1PAUB 4PG4A 1OFLA 5DQGA 4LFAF 3QAUA 3LUYA 1B7FA 4DPWA 3MMAB 2MLZA 2X3DA 2XWYA 2L41A 2JLGA 1EP4A 3C16B 4YHHF 4EEYA 3TUZC 2J7UA 5KFCA 3ILLA 3NAHA 3DFEA 5BR8J 4M1KA 2QO3A 3MM5A 4DUYF 4HDHA 2UUBJ 2MEWA 4DEZA 2PYHA 4ZVOB 5IT4A 3OD2A 2D3ZA 2HVDA 2IFXA 2CFXA 3FRZA 3MPWA 2PSZA 1HHTP 2GHWA 1JLCA 2YNHA 4ZVPB 2BM7A 1Q8KA 1U8SA 5LMUF 4CNYA 4F02A 3KDNA 1WHXA 2OELA 4QR0A 1RGVA 3ZZYA 1J5OA 1NK0A 1S79A 3TUJC 2CWKA 4QWAA 1EKSA 3BGLA 4FKXA 4LFCJ 3NWGA 5KFAA 2F3JA 1LKZA 4RW9A 3EGWB 3MAAB 3CJ5A 2CUYA 2ZE2A 2CZ4A 4H4KA 1Q81T 3SXLA 2HKEA 3J80Y 1RMGA 2XNRA 3RW6A 1NZ8A 5LXRA 5A0YA 1FDBA 1WUUA 2AF6A 5D0HA 3KLGB 4LFCF 2CDRB 3HVTB 1P8GA 2MJUA 2A2DA 5DETA 5AT1B 1J5EJ 1OQ6A 2VASA 4NPOA 1YJ9S 1RTJB 4KY3A 1H74A 1FVQA 1N36J 3DU1X 3SFGA 5D6GA 4J9SA 4U8YA 2CADA 4X65J 2CYYA 2AEJA 2XLJA 2OD6A 3DOKB 2O5DA 3EVMA 2B4OA 4IOBA 4E0DA 1LWEB 4L6V3 1G6BA 3IAS9 1N36F 2FB0A 2QL9B 3E8OA 4UY85 2QMWA 2Y0SD 4DR4F 2HK3A 1QRCA 3D6TB 5D0EA 2YWEA 5HLFB 4QYRA 2ILZA 4X64J 2HHXA 4JB8B 2M2BA 1VDHA 4ZLLA 3MMCB 1WD6A 2ACMA 4OI4A 5KFHA 1SV5A 3CMAS 1T3NA 3TEGA 1SKSA 3GPAA 2O66A 2CA9A 2OPQB 3NBPB 2ZBIA 5C5JA 1S6UA 2BJDA 4LBHA 1CJVB 5C25B 1S48A 4R8UA 3HD2A 2Z8GA 2AIRB 3LPEA 4Y28C 1HNXF 2E9ZA 2F4VF 2X3HA 4I68A 4CCHA 4WE1A 2RKIB 1DJ0A 2A3JA 2F63A 4USMA 2OPPB 1TL3B 4RX6A 1IXKA 2VBMA 1FJEB 2AJ2A 4FVMA 4I6YA 4WK1A 3K8VA 3R1LA 4BC9A 2VJVA 2OMLA 3TX0A 1DTTA 4AE5A 1SJQA 1RKIA 4NLDA 1K44A 3E2EA 5L9NA 5KG2A 1WF0A 2QC3A 4CM2A 2MZTA 2ZVIA 1HBUA 2FY1A 4OHYA 4Y3CA 2VC1A 5IT0A 2DCUB 1MROB 2F8EX 3PEJA 4ANDA 2NZCA 3TUIC 1FT8A 2RB7A 3H5YA 4DFJA 1RWOB 2PA3A 1OFDA 4KIAA 2PO4A 1D3WA 4OIXA 1VQOS 3P5TL 4W8QA 5F0WA 1JQGA 3I9V9 4AQYF 4FN5A 1IDJA 4HTJA 4C11B 3N4WA 4DN0A 4N7TA 5IWAJ 4NA2A 1FK9B 2FVPA 4WPAA 1QVFR 1QAYA 3DRPB 3HFZB 2C28A 2DNQA 4XLFA 2VZ9A 4WIQA 1GX6A 1TK8A 3HJFA 2KFYA 1NKEA 4U8VA 1I1GA 1HQUA 1MN7A 1YSJA 1H7WA 2MKSA 3I0RA 4NCGA 1KC8T 1FJGJ 5HQMA 1QUVA 2YH0A 4QWEA 1G7CB 4DL6A 4MFBA 3GIRA 2YH1A 5DQIA 1NKCA 1NDLA 5M2PA 3GIMA 4NOHA 3NS5A 1W26A 2Z56B 1N34F 1ZZFA 3QZ7A 1R6VA 3AXKA 2ZC3A 1PYTA 3Q23A 2VC0A 3JYTB 2A6OA 1YJWS 1X4HA 1WORA 1VMBA 4DS4A 3G6XA 1Q86T 1KWMA 4A8WA 3KK1A 2Q79A 4PWWA 1VQ5S 3CNQP 2EFVA 5MAOA 2G13A 1RZMA 3MEKA 3MCOA 5IM0B 1TQLA 1WOOA 3M8QA 1JRGA 5F8IA 4A47A 4KPYA 3S7RA 4RW4A 3CC7S 4LMZA 4GRSA 4DV1F 1S0VA 3DOLB 1X0CA 3T5KA 3R2CJ 2E5JA 3H0PA 2ZH6A 1DTQA 1HQ2A 4XDDA 3OSNA 3BR8A 3AQPA 1TKZA 1Q7LB 4OLOA 1HD1A 1JJHA 2W2PP 3B82A 3DLGA 3VALA 3P3DA 4N8OA 2RUSA 3GMGA 1WG5A 4I84A 4XNFA 5KFTA 3DGPB 3UN2A 3RAXA 4W8TA 3JTNA 4QJVA 2AW0A 3TAMA 2GX8A 3GSDA 3PJWA 1HR0J 2H48B 1RLDA 2V4JB 4F25A 2QJ3A 2YWHA 4NLXA 3TARA 3OV7A 4KGMA 1QA2A 3KDOA 1T9XA 1FDAA 2BBEA 2W01A 4CZCA 2HNZB 2YWGA 3W8GA 1TUGB 3THPA 2MKCA 1WI8A 2UUCJ 3R5DA 1K47A 4ILRA 2OJ3A 3MECA 3M32A 1KOOA 2KRRA 2FTRA 1QD1A 4KT0C 2CIMA 2FHMA 2XBPA 3PHTA 3M9OB 1EKRA 2QV6A 4QPTA 5IQ6A 1OFMA 3L7OA 2G0JA 2J0XA 4ECXA 2ALZA 3MM6A 2UUCF 2FLOA 3KG4A 2RQ4A 5IXUA 4DV5F 3MD1A 5L9XA 1FXDA 4QR1A 4DU7A 1Y3KA 2GVZA 1RT4B 4PG6A 5ETOA 1YDLA 3HVWA 3DKDA 3G82A 1K8FA 4YZ0A 3EDQB 4IG3A 2J9CA 2VDHA 1N5QA 2AJFE 2NYIA 1TUWA 3G86A 1O0PA 4DSEA 5EN1A 1PC5A 3JSMB 1IR0A 1O8HA 3K0JA 4ZJOA 1BQNB 2W9BB 3FGVA 4DLEA 1HQEB 1MG7A 2OD4A 2L08A 4DZ6A 4XLAA 3FSXA 4M5LA 1RBOB 4L75A 2BM4A 4XO0A 2UXCF 4ZLPA 1FKOA 2JEFA 2FDNA 3NY0A 2RAQA 3QIPA 2UUTA 3MR2A 5LJ5Y 4CLTA 3PVXA 1RKJA 1A9NB 3K2YA 2L9DA 4G3IA 2OLWA 2H4WB 5A8WA 4RJVA 3GG1A 2FLNA 5T7LB 1RAJA 4JV5J 3PX0A 2FIUA 1HYSB 5C24B 4IRKA 3LP0B 3BO4A 1RT3B 1DLOB 4D3HA 3HO1A 5KOXA 4R5PB 4HVZA 2N4DA 2CQBA 2ZD1B 1X0PA 3G8SA 1QJHA 3CJSA 3LAKA 4KKOB 1OO0B 3SBMA 3POTA 1QCXA 1AB8A 3CCZA 3UCZP 1VR6A 5L39A 3FSIA 2ILYA 2FZGB 1KEKA 2G2ZA 1FXLA 3UFCX 1NBEB 2E9RX 2ZNYA 2AP6A 2Q1LA 2QE5A 3KTQA 4JI3J 3M1VA 1UWBA 1TAQA 2NXJA 5EX3A 2LP4A 4G1QB 5GMDA 1FE0A 3I96A 2YKMB 3CJTA 3K59A 1TFYA 3QJJA 1X4GA 1N5SA 4YDXA 1L3UA 2KJVA 4XR6A 1B7YB 1KTQA 4AFFA 4IH5A 2Z8QA 1RWRA 1NPPA 2QTWA 1CULB 3QJLA 4NA1A 2O67A 3BGOP 1U47A 3PM9A 1CQMA 3OTEA 3K5OA 4TY9A 4DN9A 3JX8A 3OT9A 2MKIA 2B8QA 3PETA 3DRSA 4O23A 1IBMJ 4FXVA 1VC6A 4QZVB 2ASDA 3Q2TC 1B3TA 1FESA 4AL5A 2HSEB 2HHWA 1OPZA 3J7ZT 1KQSR 4NCBA 1LOUA 1LM1A 5FLXY 1QAXA 3H20A 2XO6A 1B64A 3DM2B 3RB6A 2QLWA 1WC5A 4DV2J 4I69A 1SC1B 2H9ZA 2C2MB 2ATCB 1NPKA 2RRBA 5AXMA 1L1IA 4LT6A 4IH7A 3GQAA 3CCVS 1UKUA 6FDRA 4ZP8A 3EMTA 4KFBB 1EA0A 3JAMY 3L7UA 2MQPA 3AJ2A 5C1CA 3V81A 5J2NB 1WEXA 4WF9Q 3NAWA 4MMOA 1ZTWA 1BMQB 5BJRA 3ZZUA 1Q5VA 1UW4A 1UTAA 1UVNA 5H9EK 4HH0A 1FDNA 2AHOB 2OO4A 3DOMA 4RUCA 3UVJA 3P96A 3CIZA 1S59A 2G2YA 1IKYB 3N79A 4OM9A 2J5AA 2I1RA 3W5ZA 1JLGB 1LWCB 4CYUB 1K1QA 4A8FA 2DO4A 2IC3B 3SSQA 4F4KA 1VRTB 2LQ9A 1PLUA 2ZH1A 1OWXA 4H4KC 1FX4A 2DD8S 3B4DA 4H4OA 1BQXA 2B4VA 1SH2A 4WU2A 3UDLA 2YPYA 4UT4A 4IDKA 3MEDB 5J1NA 5KAKA 3BH6B 1DBDA 2HHVA 3VMVA 2CRLA 3EZOA 2B9WA 5KG3A 1AUDA 4J91A 3CD6S 2ZH3A 1OPIA 2M88A 1HNZF 2DIUA 1JLBB 1VIOA 2G0CA 1DQ8A 3J7A1 4OYWA 1M90T 4L72B 2FVQA 1RT2B 5DG7A 4LSLB 2LXIA 3QLHA 2DH9A 3PV8A 3WIVA 4CLYA 4BC7A 1W2BR 2BQ3A 4X4NA 1FFWB 1RTDB 2NQPA 4MKYA 4DR1J 3H7HB 2KZZA 1E6YB 2MPUA 1D8ZA 2I38A 2KHCA 2R7QA 2D1CA 4Y0FA 3RIQA 4A46A 2LXUA 1FRIA 3J7Z5 5HVGA 3THVA 1S4FA 2DNHA 1FNOA 4F0KA 2HAFA 3HI9A 3M8PB 3BBCA 3E01B 2AQ4A 1JKHB 4DXLA 2V8VA 3I4HX 2AZ1A 2DB1A 1WMRA 1VISA 5KFGA 3TNVA 2WRMA 2ZBCA 3OR2B 3AH6A 4TYAA 1CLFA 4KGXB 1FFGB 4J9PA 2VIHA 1EB0A 2WVBA 3BPSP 2G0IA 3R5CA 3LWMA 5FJ4A 3CF5Q 1NJIT 3EQNA 2BXJA 3TANA 3M8ZA 3DLJA 1S10A 3KK3A 4WXOA 4LRBA 4RO0A 2XGQA 2VPYB 2XG8A 4USIA 3PW0A 2VG5A 3CDAA 5BXIA 2VFOA 2C2NA 3OSPA 4FBTA 2OPSB 4PWDB 4ENOA 3MEEA 4NLGA 2OSQA 4NMLA 3KHGA 1KCCA 1I6JA 3LGNA 2EFNA 2BJ8A 2Y8WA 2J0WA 2HFZA 2D3UA 1KQ5A 2WONA 3OUYA 2WB4A 4P2SA 3TA0A 2BV3A 4GVBB 2WW8A 2FHJD 2EK6A 4TLRA 5I3UB 3D67A 4EMDA 4KGVB 2FLPA 1AYEA 3ZTOA 1IDKA 3PZPA 1IKVB 3B90A 3ET6A 2F40A 4AYBD 5D3GA 3KUHA 1P9YA 3MAHA 1FD8A 2GMHA 4LVNP 2BM1A 2B9YA 3B78A 3UO0A 2HHQA 1YG0A 2QX3A 1V5IB 3H09A 3VTIA 1GXUA 1JLFA 2XTWA 3FVYA 4HYKA 4QW9A 1BD6A 2HS3A 1BLUA 2AEFA 5B0FA 1T95A 4OLPA 3KJVB 2DGVA 1UEVA 3GR0A 5E7OB 4KH0B 5F3ZA 2VONA 1E6VB 1CJTA 1K0TA 4A4JA 3CC4S 2VD3A 4HWVA 1GQEA 4LF5J 3BQ2A 3A12A 4TQRA 1LXJA 2FJWA 1KLMA 4F67A 4RNOA 4CQ1A 4QIVA 3QAEA 2UU9J 1UJ5A 3HPOA 2PN6A 3RR8A 3AAWB 1BXNA 3R27A 2VH7A 3MF5A 2OTJS 4J9MA 2GAHC 2AMCB 1J2VA 1PKUA 3OQ2A 1HL6A 1NDCA 1VQYA 3CCTA 2ZOMA 1C4CA 2J8IA 2FJAB 2VODA 3QPIA 1S6QB 5HBMB 1IA5A 1N52B 3S6EA 1A0OB 4JI1F 4ZHRA 3DLEA 1N33J 2K7KA 2RH3A 3QFHA 3HK2A 2XLKA 1H72C 2GGPB 1WXRA 2QA4G 3N0VA 4YB7A 4NMXA 5IZHA 2ZOGA 3UD5A 1LWFB 2NUHA 2JNJA 2XSJB 2G1HA 2CQ0A 3NKYA 4LSNA 2A10A 2DEJA 3I0SA 3K7RA 1WDDA 5HVHA 1TL7B 1OY8A 1L3KA 2V94A 3H5UA 2KM8B 2HURA 1SUQA 3LP1B 1YJUA 4FS1A 5ETRA 4OYPA 4RW7B 5HP1B 1WOPA 1SQGA 4LF9J 4MYTA 1GMVA 3MCMA 2QFJA 5J1EB 2XI3A 2J0SD 4DPYA 4K8RA 2Z30B 4JI8J 3UD3P 1KVKA 2B7CB 2V67A 2Z2MA 4U7UK 2YPZA 2JWNA 3VHQA 4F4XA 3TVZA 1U02A 1SCJB 4J90A 1U45A 1R0AA 2P6TA 3KJQB 4V19X 3CVKA 2GIFA 1JLAB 3HHDA 4DL0C 3G4SS 3QO9B 4L74A 4LF9F 4FBUA 2C2KB 4PPDA 4ED6A 2R2SA 2E7WA 1T03B 5HROB 3OVSA 1V3ZA 2UVVA 1FWLA 1WC0A 1X4EA 1X9WA 2R7TA 1SI9A 5CYMA 1CEZA 2HQFA 4DLGA 1N5YA 1YRXA 2ZOFA 1RU4A 2AEMA 4NEZA 2VG7A 4O0NA 2XMJA 2MQLA 1WC3A 3KLHB 2QL5B 2DBBA 4JI0J 2MQQA 3PRVA 3LF0A 4MTPA 2VQFJ 2AYBA 3LGHA 5K8MA 1NH8A 2WVDA 3KLIA 2HNYB 3Q2SC 4NI2B 4QW8A 3IRXB 4NXNJ 3MEGA 1TYVA 4F8RA 2M9KA 5KT3A 2XMAA 4XL9A 1Q7YT 4NASA 2R8JA 4CO0A 1CJUB 4HI1A 3M9NB 4ZIWA 2AU0A 2NR0A 1UVKA 2E1PA 4CO1A 1WHVA 4FF3A 4YELA 1HA1A 1TVRB 4QIEA 1KTVA 1R43A 2QL7B 4XTTA 4WKRA 1RWUA 2K2PA 4NXNF 1RT1A 2BR0A 3T5JA 4JI5F 4UZCA 3DI6B 2AJ4A 5E3CA 5LOQA 3Q8VA 1IM6A 2GQ2A 1MNEA 2AJ0A 2DVIA 2VG6A 1FRMA 5JMCB 1Z4UA 1QSYA 2ZDPA 4Q45A 2HFNA 4TY8A 1HNVB 2DHHA 3W61A 4EYIB 1W25A 5KFMA 3E51A 2OHDA 3HP6A 4IKAA 3CUNA 5A8RA 1U1OA 3HZGA 3PYGA 3EUNA 1LW2B 2K3KA 4YMEA 2RD5C 5JLVC 5DRKA 3QWUA 3DU6A 1RI7A 4NLWA 4ELUA 1H7XA 5CHCB 1HD0A 3PX6A 1BHNA 3A8JA 2I5JA 1RSCA 4FYYB 2Y1IA 1EZZB 2MGZB 2HMIB 4O4GB 4DL3A 2VFRA 3IS9A 3P4UB 3U1MA 2RQMA 2DPIA 4P2FA 3NCPA 1JLQB 3W64A 4QWBA 4LIWA 4IYQA 3ITHB 4DV6J 4MK8A 5G4DA 3MMAA 2YTCA 3NCQA 2MQMA 3GCWP 3KG1A 2QRRA 4TU9A 1IR2A 2UUAJ 1N4LA 5JJBA 3IM8A 5E3AA 2EI5A 3GJSB 4K50A 1MU2B 2O3DA 4F7VA 1NSAA 4K2XA 2VPXB 5C42B 3NB2A 4F0HA 4C0HA 2XHCA 1NUEA 2M0GB 3C8YA 3U27A 3BEGB 4F4WA 1U6ZA 4BCAA 2YWWA 5IT9U 4E2FB 3HSGA 1EX8A 4OJLA 1ZOTA 5AE2A 4IFYB 2FJDB 2V4QA 1C1BB 1RAIB 2IRYA 2EC0A 5EWFA 3IGNA 2CQGA 3BQ1A 2F7VA 2R2UA 2X6YA 1KONA 1PGZA 3LH2S 1JB0C 1Q0NA 2MHEA 4YFUA 5E2QA 1C0UB 2JLFA 5HMWA 2MYFA 2B5JB 3MPYA 2DKOB 1I94J 1FI4A 4UF4A 5K8PA 1UFWA 3CJQA 2V34A 2J8KA 2CQCA 4CLWA 3TZYA 1NHCA 3MPUB 2R7UA 2A6MA 3GG0A 5F3TA 2E5LJ 1FD2A 3CCUS 2COLA 4I56A 3CJ4A 1FEHA 2CNOB 4LJMA 4J9NA 1I94F 2GO8A 2GIQA 3HVTA 2BJEA 4NLSA 2DRAA 3ZSCA 2PDAA 4PG7A 5D15A 3KWMA 3ZZ0A 3R7SB 5B0BA 3A3OB 3I5BA 3CJ0A 2E5LF 1SIWB 3PKYA 2QGFB 1RTJA 1Y4ZB 4QQBA 3IBCB 3ETMA 1C0TB 2IRUA 2BDPA 3UE2A 3MM9B 3U1NA 3HZEA 2VBYA 1QA1A 4C3MA 1KBRA 3NGTA 1X4FA 2BYCA 1JLEA 2CQ2A 5DGAA 5D4LA 2FJVA 1B70B 1REGX 2WW4A 3M8WA 2YY3A 4RU2A 1LWEA 4B9MA 4I1TA 3SYZA 4Q8FA 4XOPA 5HATA 4DV0F 2R4FA 4KH3A 2QLFB 4OPWA 5HVFA 2N7CA 2UXDF 5KFKA 5KFEA 1VK8A 4URGA 2YWFA 1HI0P 5LXYA 4NLVA 1WEZA 5HMXA 1HNIB 4I67A 1RADB 1FA0A 4OI2A 1XBWA 3UDVA 2CPEA 1TAUA 3MMCA 3JSRA 2RDJA 2E9TA 2GQQA 2V63A 4A8QA 3MMJA 3NBPA 4AXIA 4WKYA 3G6ES 3FBCA 3MUTP 4ZPDA 3ISND 1CJVA 3J7YI 2BQRA 4OYXA 1EZGA 4EO6A 4RW6A 4FP9A 3CEDA 5D0GA 4L73A 2RKIA 3DLLQ 4EBEA 4YY3J 1TL3A 4MIBA 2L48A 1NHUA 1F3VA 1JTAA 3W9HA 4OX9J 2B4PA 1X4BA 3GQ7A 1HBNB 2CPFA 2JC1A 3T5LA 2M70A 4QWDA 5K9FA 3SV3A 2E1MC 4DFMA 4ED7A 4M5GA 4IQMA 4FXWA 4OJ1A 4WP8A 4YY3F 4OYAA 1PG5B 3TA1A 2ZBPA 5DJBA 4OX9F 5FD1A 1XMBA 3P45B 3MGJA 1PJ5A 3FNNA 4CWBA 3CO0P 2NZ4A 5K5MA 1CC7A 1Q79A 2W9AA 2VV5A 1MROA 4UOHA 1F3FA 1XR6A 2ZFHA 3UN3A 5HO4A 4XIUA 5HAOA 3I5CA 1PYOB 4X4OA 2DHSA 4ECYA 3TO8A 3TAQA 3W8PA 4QOTA 4LF6J 5HJYA 1F5AA 3HSJA 1UL3A 3AJDA 3LGMA 2QY1A 3UQSA 2MZRA 4JBCA 4M5DA 4FPRA 3DHXA 1FK9A 3CE8A 4F3OA 1ZS6A 3VAFA 5H1SV 2IHR1 2EBEA 2YWKA 3RAMA 3DRPA 4C8KA 4W8SA 1NU4A 1RAFB 2WAQD 3GIKA 4LF6F 2ZUGA 4DZDA 1AZSA 2H5EA 1WKJA 4F3QA 2QMUB 5GAHU 1TKXB 1U26A 2QXZA 2YXLA 1HI8A 2UUWA 4DSLA 2XMWA 4ZVRB 4B9UA 2BANB 1J27A 4DCOB 2VFNA 2M4MA 3E3XA 4UOCA 1O88A 2MB0B 5F41A 1HLWA 1RA7A 4F2SA 1N8RT 2KFZA 2HQGA 4B3SF 8ATCB 2F5GA 2AGQA 4O44B 2FVRA 4WFZA 4LRDA 4ELTA 1S49A 3CD0A 5GAEU 4N41A 4USVA 2XMMA 3CCQS 1Q78A 5LL6d 1NNDA 1BE4A 3UW0A 3VQTA 1X31C 4ANEA 3D6MB 3RYLA 5IM0A 2I0XA 4ZP6A 3BGUA 5J1PA 3KG0A 3T1YJ 5B0GA 1YQHA 2BJ1A 4ED4A 1VJWA 3SUCA 2MSTA 4FYVB 3BB5A 4YDTA 1WACA 1R0BG 1RTHB 4K4XA 2YKNB 1MWQA 3M6VA 3IGVA 2FZKB 1QE1B 2RF2B 5DO2A 3T1YF 3NNAA 1L5UA 1S0MA 1IB4A 2QFIA 2X1AA 4I6WA 2SXLA 3H4BA 2J9EA 4B3TF 1BUXA 4KGZB 3DMJB 3UPFA 3P49B 1FJCA 1PSDA 2C3UA 1RJJA 5DDRC 4C3LA 5EUHA 4M95A 2FC8A 1TV6B 4LBPA 1CZFA 5J2PA 3DGPA 3QGIA 5DG9A 3FBFA 3T1AA 4WTYA 4JRAC 1K73T 1Q8BA 5BYRA 4W90B 5DGBA 2EC2A 5ETVA 2APOA 2HG4A 4AVZA 1SJRA 4YUDA 2BRKA 3T1HF 4U7UD 2CJYB 3L9ZA 2IPOB 1S77D 3G87A 2HNZA 2GAGC 3LP2B 3HULA 4TU7A 1YRUA 2IQ7A 4ZMMA 4P2XA 4FYDA 1VQ6S 2PC6A 3KLVA 2OIHA 5ITHA 1HG8A 2HAIA 2UVWA 1JMTA 2MZSA 4B9VA 2RMLA 1NK5A 2HLTA 3PY8A 4IR9A 3BN4A 1RABB 2FPHX 2OMOA 1BQMB 1SC3B 4AL7A 4GC7A 2C2ZB 2DR7A 3DRRB 2R8IA 3J80U 2C2OB 2XMVA 3T9NA 4F4YA 4P71A 1RT4A 4RBUA 3ZZOA 1N6QB 3W1YC 1YWXA 3NNCA 1ZPWX 2HVZA 1HW9A 2IJRA 1OYEA 4XDCA 1WC1A 4X84A 3HFKA 5DG8A 2BACA 1X0FA 2VBKA 4USTA 1R0CB 3JSMA 2CZ9A 3D54A 5J2MB 2W9BA 1EP4B 4GMKA 1HQEA 2EG2A 2W24A 1Y9OA 1WNEA 3B4NA 4GKKF 4OYBA 4QU6A 3I87A 2MLYA 4ZCIA 1RXOB 1P1TA 4DPUA 1FDDA 2B43A 2HRUA 3W65A 4X4SA 5IFMA 3OBIA 1QJVA 1UZDA 3W3SA 3T6JA 2VPWB 4ZLJA 4KHMA 1M5HA 2DPJA 1L3SA 1RTZA 2CJQA 2JEIA 3BSNA 3SY2A 3GFXA 5T7LA 3L95X 5CYQA 1XQIA 2Z2YB 1HYSA 1JLCB 5C24A 3OTBA 2HBYB 3LP0A 2ZH2A 1RT3A 5KT5A 4ICLA 1TU0B 4R5PA 1HIYA 2HIQA 2B0RA 2ZD1A 2E1RA 1F1BB 1VC0A 4KKOA 2BZ2A 3IR7B 3OJSA 3MM8B 3A8IA 2BM0A 1DBOA 2X1GA 5ETKA 2Q6BA 2HHTA 4KTQA 1TP7A 2HFOA 3QSIA 2PT0A 2QA4S 1SPBP 1Q1KA 4DOZA 3D2WA 1WI6A 2PGCA 2GJIA 2XCPA 3PJ9A 3EGVA 1N56A 4NLUA 4DDFA 3H42A 5A0YB 3FMBA 1FTRA 4ZVFA 1ITPA 3PFEA 2JJ4D 1GMUA 1UZHA 4Q44A 3ENWA 5KFUA 1CULA 4EYHB 1RU1A 1HARA 2HWTA 1YX2A 1R8PA 4OZLA 3W2VA 2V4RA 1IBKJ 2FLLA 4NYOA 3P4GA 5JXSA 4CI0B 4K4YA 3EE3A 3OTOJ 1CG2A 3OR1B 1JJCB 4ECZA 1NMEB 1ZAWA 1RB0A 1T9UA 2YBVA 3GONA 3AHPA 1IBKF 1CQNA 3MXHP 1RT5A 1GTEA 2ROPA 3JTOA 3OTOF 3EGNA 3ENAA 3JURA 1YVFA 3MPVA 3MZIA 1KN6A 4YZQA 3TRGA 3NGRA 1IKXA 2NTPA 4E98A 5E3QA 2CPHA 1SH0A 5ETNA 2XQCA 2F3LA 4KFBA 2P9CA 5EHHA 5DM6Q 4ZITA 3BQ0A 1U0SA 4P6QA 3EZUA 1U1LA 4ZDNA 2CKWA 2OPRA 5L1KA 2Y8YA 2QT7A 2KYXA 5I3QA 1M1HA 1M5PC 3DU5A 2XTJP 4CO4A 1XN9A 3PR4A 1Q82T 4R8UB 4ER8A 2HWHA 1KLNA 1T05A 3N90A 4WE1B 3NWRA 1BN8A 4ECTA 1KFDA 1I3OB 1IKYA 4DV7F 3KKFA 1QLNA 1JLGA 4TQSA 2RT3A 5GADU 3LALA 1B0TA 2IC3A 3HKWA 4DR5F 4DL7A 4CH7A 1OJ4A 4ES2A 1YBAA 3LAMA 4HTIA 2ASYA 3G71S 3FJ2A 2BJ3A 3CJRA 5KFJA 2IRXA 4HH1A 4DR2F 3QMQA 3IXQA 1Q16B 2INUA 3LTOA 3ML3A 3L4BC 4ZCKA 1JLBA 5ETQA 1XTZA 2E1AA 2FUG9 1AIRA 2KB2A 4HI2A 5K8OA 5KFQA 5RUBA 2AKWB 3HMJG 1OY9A 4CT9A 4YP3A 1RT2A 4LSLA 4ECUA 1VQMS 2VA3A 2NXNA 5J2QB 4YEJA 3I6PA 1RTDA 1XNRJ 1A6LA 3K8WA 4O3SA 3T19A 2KO1A 1M1KT 5E5NA 3GQCA 2RU3A 3PIPQ 4RL1A 2YNGA 1WHWA 4IFVB 3GFHA 3KLFA 3D6FB 3TOQA 2PEBA 3DDIA 2GW8A 3L3CA 3ZO7A 4DL5A 1NJXA 1HQUB 3GFYA 1ACMB 3I0RB 4NCGB 4HL9A 3D0HE 1IBCB 3SCJE 2W4PA 3MTKA 4DMZA 1JKHA 4U95A 2DYAA 1KSPA 4DL2A 3P5BP 5L1LA 5L46A 2YQ1A 4Z37A 1X9MA 4AXJA 3OR2A 1K0VA 1HNWF 1S4EA 4NXMJ 1YZ7A 4FYXB 4DUZJ 2RE1A 1VBLA 3C19A 4EZ9A 1DZ5A 5AE3A 1RAEB 2BOPA 2PA8D 3BYPA 3ELHA 1B4SA 3PYEA 4O0IA 4ATNA 3UNGC 1XMOJ 3RB3A 4ZPBA 4KB7A 3KK1B 4OJGA 1AROP 1U1NA 1O8FA 1T11A 2Z0GA 1LLWA 2NS1B 4TNOA 4NXMF 2BABA 2N3OA 2EKNA 1SL2A 2ZZMA 3PG9A 2BE2B 2E7VA 1VQ7S 2OPSA 3GJTB 4LFAJ 4RW4B 2MKYA 1TR0A 2LU2A 1HBMA 4YHHJ 1WKKA 4PQUB 1QAIA 4UY8T 1AFJA 4UUWA 3QGGA 4DUYJ 4Q7AA 1NM2A 2LLZA 1X5SA 4GVBA 3R7NB 4JP8A 3C15B 1H6KX 1RHUB 3A3NB 3PIOQ 4P10A 2OFGX 5AJ3J 1ZA1B 1IKVA 3TH0A 3CJ3A 2VUGA 1PILA 1BWVA 4B3RF 8AT1B 3CMES 2R7OA 2LA4A 4ZK7M 1P6TA 1OSCA 2HVHA 3D0GE 5LMUJ 1JXLA 2MSSA 1VK3A 4A8XA 2NZMA 5AJ3F 2IJNA 1WTFA 3V6HA 4YZXA 1L3VA 4RBTA 3ZXWA 4ZOSA 5A8KB 4K5RA 3S1TA 4KV8A 2ZJPQ 3MECB 2EXUA 2GJFA 3HXMA 4LREA 2NT9A 2F8HA 2V2QA 1SB6A 1SJ3P 4RR5A 3EVWA 2RJZA 4EWTA 2E5HA 1OY6A 4URSA 3CCJS 1BC6A 4PABA 2IY5B 3Q8QB 4QPXA 2YNIB 2FHOB 2ZH7A 1S9GB 2WK4A 3OHAA 3W60A 1S7HA 1HW8A 5L38A 1O8GA 4ID8A 4PWUA 4NRTA 4XPEA 4DSJA 3U7JA 4IG3B 3X1LB 3TEHB 3VAJA 4BLGA 1IN0A 4RNMA 1S6QA 3I5AA 2HS4A 1DQ9A 1ZA2B 3BF4A 4PYAA 3R5BA 3QQCD 1Y5NB 2DITA 2CPYA 3N6ZA 3VZIA 2P5VA 1SQFA 1LWFA 4B9TA 2O1PA 4XKVA 3P6YC 4ZN1A 4WIIA 1FKOB 3V6KA 2XSJA 1AT1B 2KG0A 4ZPAA 3G9CA 2HFUA 4DR4J 4DV4F 4X4RA 1TL7A 5FLXU 4HLBA 4XOTA 4C0BA 3Q0AA 4N8NA 4EGLA 3LP1A 4QIGA 2VFQA 2IDEA 4RWXA 1CPZA 2IM1A 2NYHA 2DIVA 1U24A 2R8GA 4Q0BB 5J1EA 4TKTA 1SL0A 3PJXA 2C3PA 2P9EA 3CB4A 3JAMU 2DT9A 3VSVA 5LSOA 1ROFA 1HNXJ 3POTB 2F4VJ 4QIFA 2HYIB 1K9MT 3RW7A 4USUA 5D8HB 2CG8A 3HVRA 2R2RA 5IOLA 1T0TV 2DNNA 4WU3A 3QT6A 1UWBB 4NLYA 3KOAA 3OXGA 2QZAA 3Q8RB 3ILIA 5A2QY 2XI2A 3RTVA 2I9SA 4BBYA 4RNFA 2ODLA 2HLUA 4ZLNA 2R42A 2VB6A 1EQ0A 3IR6B 2H4YB 2ADBA 5CQGA 1CJKA 4EO8A 2UV8A 3KLHA 4A8YA 2H5JB 9RUBA 3J81j 4RKUC 1TKTA 3QRPA 2CXEA 2BEFA 3TZXA 4DQSA 2BM5A 4NI2A 1TSPA 1WWHA 2NLWA 3H2UB 3JQMA 3MAQA 2XHWA 1G4CA 1CJUA 2GA7A 2R7SA 4O4RA 3SI8A 3SIPB 1KHWA 3KK2B 4AQYJ 1VHFA 5KT4A 1JIHA 2BVZA 3TW0A 2Q6CA 3IAM9 3HX9A 1LXNA 1IQTA 5BYQA 3MD3A 1FFSB 2AX1A 1N48A 2DGOA 2CPDA 1VIXA 4J9LA 4C8ZA 2KI2A 2MTLA 4U6PA 4DR3F 1ZTTA 2Y0BB 1NK4A 3QBCA 3M8YA 4JOUA 3DDNA 1VGYA 2CPJA 3M2VA 1QTNB 3W2WB 4FVCA 2ZNZA 2AWZA 3EJMA 2GVDB 5THWA 2A1BA 2B6AB 3D9BA 1V3SA 4CLLA 3KHRA 3CXCR 3T3FA 2W9CB 3UWTA 3KMQA 2DHXA 5D0RA 4FDFA 5C2CA 3PACA 1LW2A 4UQTA 3TA2A 1N34J 2ZEJA 1YITS 3FKBA 3VSUA 1R6YA 2KRBA 3DOMB 3M6UA 5JMNA 3UVJB 4I7FA 1M5SA 3X3UA 2JVOA 4J9QA 1GMWD 1EAYC 3FUYA 1LW0A 4XAKA 3BKUA 4ZP7A 1FNXH 2MGZA 3Q8PB 2BKNA 3CGIA 1N5TA 2DY1A 3U02A 3R5JB 2F1FA 1F9FA 4MAKA 1DABA 4P72A 3GJQB 2AGOA 4WZMA 3SQGB 4A8KA 1NLKL 4H4OB 4PR6A 1RP5A 2CQIA 1KD1T 4EU0A 3AK5A 4URRA 2ZKTA 1CS4B 1TYXA 1HWJA 2KT5A 4DV1J 1SC4B 1A7GE 2IA6A 3ZZRA 2ZC4A 2ATLA 2J9DA 5H9FK 2K3IA 3PKMA 1MU2A 1ULRA 3A8EA 3TAPA 4JI4J 4PG8A 1VCTA 5KG4A 5KFWA 4CLUA 3D28A 2R7RA 2HPUA 1C4AA 3FBEA 4ELVA 3IM9A 4ETZA 5HANA 4OJPA 2KT2A 2X1BA 3NXZA 2Q66A 4LF2A 3W9IA 4JUZA 1FVSA 1UVMA 2D69A 4IFYA 1G1XA 2DY9A 2PI5A 2KHDA 1RHQB 2W8LA 2PIIA 2FVSA 4L76A 1C1BA 4ED3A 4JI4F 2HEKA 1ELOA 2GJ2A 4GVLA 1I51B 4LF8F 3Q24A 5BYSA 3EQOA 3AD8C 3UN5A 1NO8A 2PFFB 4C97A 1H73A 1C0UA 1RT6B 1HMVB 4QYZK 2WSEC 3TVYA 5H9FJ 2QMXA 2DGTA 2DNMA 2HBZB 3CJKB 1QA3A 1O8IA 3IG1B 4KHPJ 1VLYA 3JSYA 4V02C 4H54A 1OIAA 3LOUA 1OYDA 4LF4J 3CJ2A 1TMMA 3IRWP 2XTXA 3LMWA 2XC1A 2M8DB 2ZHAA 1NZAA 2YUHA 5KFYA 2QEXS 4RNNA 4DV5J 2Q3PA 4OHWA 1YTYA 4KHPF 4CH1A 4ILMA 1N0UA 2UZAA 5DS7A 3KK3B 4OV1A 4CM0A 4PRFA 2XYPB 2OAUA 4NLRA 1ZM4A 3UDEA 1LWXA 3KRGA 1C0TA 4LF4F 4OZ5A 3MM9A 5I4MA 3J81Y 3O2IA 2ZH5A 5IQQA 4QYZJ 3H90A 3MEEB 1H2VZ 4WYLA 3DDKA 3TQ1A 5KT7A 4DV3F 4C7QA 1ZBTA 2GIRA 1F6TA 1CBKA 1F9EB 2VFMA 5FDLB 5HMYA 4MYUA 3TZWA 2WONB 2UXCJ 1X5PA 4HACA 1U1QA 3T41A 4P9SA 2E5IA 4QR2A 2DXFA 3SCLE 4ED5A 1ZPVA 1MN9A 1ICEB 4LRCA 1HNIA 1S1XB 4PXDA 2HZCA 2DNLA 4YEIA 1H0HB 3I31A 1TK5A 2GHPA 2DGQA 1SKUB 3ET6B 1UFKA 3R7BB 4NA3A 2NTQA 1RHKB 5D3GB 3ADAC 2DNGA 2KXFA 3SYJA 4LFBF 4XN0A 4YOEA 4M5KA 2EFQA 1S1TB 2GC8A 4KBIA 1PIEA 3VAKA 2XT2A 4MXNA 3PO4A 4HKQA 4RLEA 1V6HA 2CVEA 3DN9A 5C7PA 2XULA 1CJTB 3HKZD 3LWLA 3NCRA 3SFUA 3MURP 2V68A 2OKQA 2WBMA 3SSSA 3V6JA 3OFHA 1KLMB 4J9RA 4H4MA 3V6DA 2PMWA 1UW9A 1U0HA 5KG1A 4RW8A 3CW2C 3OW2R 3CO9A 2CNKB 4B9SA 1YBTA 4WFBQ 3MOJB 2G0YA 1HWIA 1JNRB 1RWKB 1UWAA 4Y2AA 3MM7A 3QNWB 1NK7A 2HRTA 4QCLA 2YQ0A 2P2CB 4K2JA 1C1CB 2YX4A 2AX0A 2KG1A 1KVIA 3O8WA 1H3DA 4O3RA 4NZ6A 3M2UB 1VQ8S 2PI4A 2KXHA 5LSLA 4J9VA 1S12A 2NXCA 3DXBA 3LANA 3NNHA 1TFWA 4ZHRB 3CTRA 4ID5B 1W7WA 3DLEB 1P27B 1TMJA 2M5YA 1LFWA 3OVBA 3WZ0A 3GV7B 3FCVA 2ZBQA 1H80A 2NSBA 4MR0A 3EXYA 2UVEA 2AZ3A 5D4PA 1S1WA 5KFFA 4CO3A 1RUSA 1RHMB 5CA5A 2V5HG 1WHYA 4PPZA 2ASJA 1SUQB 3KMSA 2XMUA 1FO1A 1XMQJ 2WHOA 3WWGA 1TKXA 4LF7J 3R1HA 1UP1A 4Z03A 1O8KA 4WK3A 3IC1A 2W2NP 2BANA 3H2LA 1D09B 2JLEA 4RUAA 2ZWOA 3MMBB 1O5JA 2BKPA 5K14B 3BS9A 4M5JA 4JYAF 1XMQF 1S6PA 5M2RA 4OHVA 4LF7F 4X4QA 4O44A 2O04A 4U67Q 1GQ8A 3LQVA 4XLCA 1YRTA 2H3EB 4DR7J 2BW7A 4JI7J 3PX4A 3KUGA 1NDPA 5DQHA 4CTAB 4WFNQ 4DR6J 1FWPA 5DDQC 4QWCA 1FE4A 2V8DA 2VG7B 3W66A 3DLHA 1D8YA 3Q89A 3SMZA 5MLCV 1RTHA 3UDCA 1PC4A 4P7VA 4DR7F 4OYMA 2YKNA 2O0WA 4JI7F 4ED2A 1NB7A 1TELA 1P1LA 1QE1A 4WWSA 1HNZJ 2Z58B 5E3RA 4ZPTR 4DR6F 2QYUA 3MEGB 2DRDA 5IV4A 3SDEA 3OXFA 1KP6A 3DMJA 1XNQF 1HBOB 3G96A 4WCEQ 2Z2LA 4A8SA 3HSDA 2HHUA 3PCOB 2EWHA 2CDQA 6FD1A 3FFIA 5H9EJ 1TV6A 2HS0A 2D41A 5K20B 1S72S 2J6SA 3JQJA 1X5OA 2OUGA 2NSCA 3RRKA 1FKPB 3BYRA 1RA6A 1TL5A 3AY0A 3GJRB 4NCAA 3ILJA 2VG6B 2V5IA 3W9JA 2HHSA 4LR8A 3LP2A 4Y34A 3IWXA 4TY8B 2HFSA 2AYGA 2XLIA 3T5HA 1VI7A 3BKTA 4C2LA 5JVHQ 3AA8A 2YKOA 3R9LA 1OQ3A 4Y65A 2X85A 4OHZA 1RTIB 2ZJRQ 4ANCA 3Q86A 2UP1A 4BDPA 4JV1A 2JOQA 3MR7A 2BQUA 2YNFB 3GIJA 3C6UB 4NWBA 4EBCA 3ZTRA 1RLCL 2H1YA 4YFOA 2FD2A 4BWMA 4X62J 3GFZA 1BQMA 2I5JB 3I82A 2VBEA 2DGSA 4PXCA 3GTYX 2CQ1A 3DRRA 3M4XA 2DR6A 2M52A 4OZJA 4OMFG 4N47A 4KPCA 2VQEF 5KG6A 4ZVEA 2JL9A 3R6GB 2H54B 2OEMA 4MK9A 5IS2A 3L7PA 2V0NA 3IMQJ 2DXEA 3JQKA 1JJ4A 4FKYA 4EI2A 1Y7PA 1YJRA 2V69A 4X62F 1HWLA 2CZVC 1NCLA 1VQ9S 3QT7A 2XC9A 5J2MA 4DCJB 3AQOA 1MWZA 4S0MA 4OX7A 3A13A 4KJIA 2Y1LB 1D9FA 2FVCA 1NJWA 4BWJA 4LIRA 1YBUA 3ZPPA 2LYVA 4NLOA 2R7XA 3LPYA 5DNSA 3C3LA 3RBDA 5BR8F 4JV0A 3U1LA 3MR6A 2UUBF 4IRCA 3MFIA 4M5HA 2OP5A 3ZNJ1 2D9OA 1S1VB 2NTBA 2C2RA 5GVQA 4TXSA 3MM8A 2QIFA 4OQJA 3GYNA 2XNQA 2K8GA 4Q8EA 3FCHA 1DBGA 2XZTB 1DQAA 1WF1A 3C46A 3FBBA 3H4DA 3NMAA 2O1DA 5T14A 2J6UA 2R7WA 2DGXA 1D1UA 1UVLA 2V9WA 5L1IA 2HHHJ 5AXLA 3WHIA 2C2EA 3CDEA 4Z06A 4DI6A 4ZPCA 3KLEB 4EFAC 2VICA 4OI6A 3H98A 2ACYA 2YKAA 2KDOA 4DFPA 2DR8A 1SJFA 2XS2A 3GV5B 1UEUA 1MMDA 1KOHA 4E8UA 4WFYA 2HHHF 1VYAA 1Q53A 2XYGB 4TYBA 4B08A 3R8YA 3OR1A 1SKRA 2N7YA 1U49A 1F0XA 3UD4P 3NOCA 2HQCA 3IP0A 4JI1J 3GWCA 1JLEB 4CO2A 2LECA 4K4VA 3M30A 1J5EF 4U9RA 5GAGI 2LVWA 5B09A 4C4WA 5T41A 3VV2B 5F8JA 3J7YU 1UVIA 4FF2A 4DFKA 4F4ZA 1RCXB 4P73A 3T9GA 2FGCA 2VFTA 3GR1A 2UXBJ 4MKBA 3BGRA 1YHQS 4X65F 3W5XA 3TX8A 4FYWB 3NLCA 4YR2A 4ZN3A 2JEGA 2JZ5A 1VBYA 2WVEA 4LSZB 3K5LA 4O3OA 2WVCA 2FHJA 4W98A 1M5VC 1SIZA 4WFAQ 1HPZB 2UXBF 5I42B 4X64F 1EETB 3JTPA 4NK8A 4RW6B 1RAOA 2EKYA 4Z05A 3Q8UA 2ZZNA 2DNPA 2RUGA 4DSKA 1NRKA 1XR5A 3DLKA 4ZA1A 2JVRA 3PYFA 2PMHA 4I2PB 1QUPA 3F44A 2WOMB 1YLXA 3M2RB 4OJHA 3MFHA 1RT7A 4RBVA 4NK6A 4TVAB 5KFPA 1MMNA 2F9DA 1VBKA 1JJ2R 1EE6A 5LJ3Y 4OV6A 4PUOA 4DQPA 4UOFA 2IDLA 5LM7E 3BSAA 5KFDA 4OZYA 2GMLA 2ZDOA 2O17A 3AT1B 5EWEA 1R8HA 2Y1RI 3H5SA 4DG1A 2I8EA 3NMRA 5GADI 1SQEA 2KVIA 2VHGA 4FF4A 1UJ4A 1RCOB 5LSRA 3V4IB 2W4CA 3SEOA 4ZCMA 4KHRA 5J2QA 1GX5A 2UV8G 5HK4A 2CNLB 3VWSA 3MUMP 4M5DB 1NKBA 1KQKA 5L8RC 1DARA 2MZJA 3NS6A 4JI5J 3EDRB 3A3PB 3S8SA 3QGPA 3PRDA 4IFVA 2NXEA 1AZSB 5U47A 3K57A 1U2RA 4OI3A 3QIDA 3QT8A 4ZS6A 5IWAF 2H5IB 4ECWA 3B54A 4AT1B 2VU5A 1QSSA 7FDRA 2OTLS 1S1UB 2HGMA 1RWNB 5KFSA 3H40A 3JXOA 2DHGA 3US5A 1NAQA 4B3MJ 4CNZA 3HHLA 2IAJA 3TYTA 3HCXA 3CDBA 3B8YA 4I2QA 2OI2A 4Q2MA 4ES1A 3J7AN 1FJGF 1IWAA 1ZYQA 3UCGA 3IBFB 3R6LB 4ED0A 2KT3A 4NYPA 3PFOA 2OGUA 3ZZPA 1T9YA 5HJXA 4Y2KA 3QRRA 3MTJA 1RK8A 4PCQA 9ATCB 2DK2A 2LQ5A 3RBZA 2GZOA 4B3MF 4OJ6A 1UVJA 1IM4A 1Y10A 2H51B 1TL1B 4J9OA 2M7SA 4U49A 3OPKA 1DURA 2K06A 3G8QA 1BHEA 2XS5A 3OFEA 1Y3JA 2BE2A 1FRLA 2GQCA 4U7CA 4GO7X 3VCDA 2K1RB 4PXEA 3M9MB 2ZVSA 4PQUA 1RACB 2DEIA 3KFWX 1WSRA 3MI7X 3MR5A 3KYLA 2IYGA 4C9DA 3VVUA 3TJAA 4DSIA 4P7TA 1T3OA 4F0MA 2B8PA 3BH7B 3EWGA 3H25A 3C15A 4C3KA 1RAHB 4PAAA 3C16A 2WBRA 1TYWA 2DTJA 1JXVA 3BM7A 5J2PB 2IBOA 5A76A 4OZ2A 3BREA 4WZQA 2HFVA 2YX7A 4CP5A 1RBLA 1PO6A 4ECVA 5KT6A 2WCXA 1Q4RA 3TUPA 1VQSA 2XSFA 5KFBA 5E41A 4ZIVA 1RHRB 4DL4A 2DNOA 2WTFA 2H65B 3PRBA 1T7PA 2J0QD 5A8KA 2KN4A 3EZ5A 1HR0F 3K5NA 1EHWA 2C3OA 1LK7A 4A8MP 1S7IA 2K7JA 3TZZA 1IKWB 4TLQA 3D1HA 1SL1A 2YNIA 1WDTA 1XEZA 2A0FB 1S9GA 2X7IA 2D3O1 3MAAA 2MLXA 4OFZA 2HZVA 5CH7B 4ZJLA 3MR3A 4IRDA 1O8MA 2MZQA 2V8HA 3BV8A 2EFGA 3FSYA 1T9TA 3KLGA 4XMYA 1T94A 4F26A 4ECQA 1S97A 3FRYA 3PW2A 5A6WA 2R8KA 3VAHA 2PEHA 2LEAA 4DX6A 3EX7B 3A1YG 1UEKA 4IO1A 2QG9B 1QTMA 4B3OB 4DV0J 5I3PA 3C66A 4JV2A 1F9HA 4DX5A 2UXDJ 2J7KA 1XC9A 1VRQC 2XEXA 2B4UA 4Q5VA 4I4BA 5HMZA 1RISA 1PJ6A 4JI2J 3IR5B 2DJWA 3DOKA 4OYZA 1VRUB 3MDFA 5CYQB 3OFFA 5JVGQ 2C42A 1M5KC 4LUBA 2JFDA 2RRNA 4Q0BA 4ICLB 1GTHA 4ETXA 2NT6A 1X7VA 4URQU 5HLFA 2N82B 4CIOA 2NPIA 4P52A 3PDNA 1BWEA 2RILA 1CSJA 2PE8A 4JI2F 3GU0A 3VAGA 2D3OR 3FC9A 2V2ZA 2B51A 1RWXB 4JV5F 2FY8A 1WELA 2HNDB 1GEHA 5CCLA 1IQZA 1XJWB 1U6BA 2OPQA 1ZM3A 4Y2CA 5F0UA 1QVGR 3NGUA 3D1QA 3Q22A 3OL9A 1KKHA 5C25A 1DY3A 2DR5A 3BN7A 4V19J 2OPPA 4CLSA 4PEOA 1W2IA 2E1CA 2DNYA 3DGVA 5CD4A 3NGSA 3O44A 2D7SA 5ETMA 4JI3F 2Z2ZA 2FJEB 3W2VB 3OL8A 3DYAB 1PBUA 1FTCA 4OI0A 1NHKL 4KO0B 2XYHB 2CG4A 3R5AA 1SC6A 1RQ0A 1FEEA 6AT1B 5F9LA 3M8RA 3Q83A 1N0VC 4M63A 1WTBA 3C14B 1YK9A 2DR9A 3JSBA 4B02A 4HEA9 3GSIA 2O0VA 2DISA 3SSRA 3TQEA 1RT5B 3KK2A 4RU9A 1U25A 2YKQA 2MHNA 3PYDA 2QSWA 5DM7Q 2L3MA 2LEBA 1IBMF 1F60B 2LQ8A 2XGPA 4MKAA 4LVOP 3FQLA 3KUEA 1IKXB 3QJPA 2NXUA 2ROGA 3L09A 4M8LA 3QYYA 4I64A 2DGWA 5DLGA 3ENQA 4PXBA 3MPDA 2EWEA 3W2WA 4C11A 2GVDA 4L3NA 2B6AA 1Z1ZA 2VPZB 5F8NA 3F73A 4OYOA 4XONA 4DV2F 2XY7A 3C6TB 2OPRB 5HQ8A 4EZ6A 3HHEA 3AFGA 2W9CA 2ZM6J 2B0GA 1REVB 2W4DA 3PSSA 1NPRA 2W7OA 4U4BA 2W1BA 3T9ZA 4D3GA 5CXTA 3LYCA 4OL8A 5D77A 2EBGA 1T05B 3F0NA 5AE1A 3G8TA 2LMIA 2AYMA 2JX2A 4ECRA 2YQ3A 2AD9A 4B3SJ 1H38A 1JWWA 2RRAA 3WX8A 4CLKA 2ZM6F 1MWYA 3DCAA 4EK2A 4KYZA 5EWGA 4Y2IA 4OZNA 4IG0B 1O51A 2E29A 2MY8A 1NSPA 1TK0A 3SQGA 3JYTA 1OOCA 5ETLA 2VOOA 1CS4A 4FNIA 4R0JA 3MCNA 2U2FA 1EQMA 1APSA 4AD6A 5K8NA 4ZCLA 5F9NA 3EPIA 1GH8A 2MXYA 3HHKA 5KFIA 2R2TA 4B3TJ 2JSXA 2DXDA 2G2OA 2MDAA 1K5CA 5HI7A 3CCLS 2CPZA 4OZ3A 1TKDA 3DOLA 1HI1A 4USJC 2B7BB 1KVJA 4NE9C 2HZAA 1Q8IA 1NK6A 2IM2A 4X4UA 1KQGB 4DUTA 4LRAA 2AGPA 1UPMB 2MQOA 2YNGB 2HWIA 4KSEB 3KLFB 3T1HJ 3HVAA 2CJ9A 3AD7C 3NOGA 4DU8A 2QYCA 1DAXA 1YIJS 2CJXB 1RT6A 3FDSA 2D9PA 1HMVA 4DR1F 3CCSS 5B0CA 3GV8B 4CLFA 2MJNA 2HIYA 4HT7A 2R8HA 1SJ1A 3LW5C 3CJKA 5F8MA 1FX2A 3IG1A 2V4JA 1YI2S 1WF2A 4OZ0A 2BA9A 3D6HB 3EM1A 2EVZA 1UCNA 1VFJA 2FGOA 1PJ7A 4R25A 3A4TA 2KYZA 5C2GA 3AJ1A 1OS5A 5CZXA 5B0AA 2C2DA 3UR0A 3SCIE 3K5MA 2LU1A 3SCKE 3RUBL 2HVIA 1NH7A 3V5RA 1S9EB 4DX7A 2GMJA 4NEYA 1OGMX 5G0RB 3HLUA 4J9KA 1VBXA 2GHVC 2FQQB 4Z2XA 4OZZA 2ZHOA 1RU2A 5B7WA 3T6BA 2IM3A 1VHIA 4ES3A 2XWXA 2BE9B 1VC5A 5KOWA 1HBMB 2BMBA 4GKKJ 2XT4A 3GQ8A 2OEKA 1R8CA 3ZTQA 2OH2A 1X60A 4A8OA 2VBWA 2ERRA 5FDLA 3ILOA 3FMWA 2NREA 3AA9A 3EPGA 2MY7A 3WIUA 1VQKS 3A8KA 4ZVUB 3CIMA 1T02A 4XKWA 1TL4A 2O01C 1F2HA 4DQRA 2HHPA 1BQNA 1IWGA 4DF8A 4Z7YA 2XCAA 1S1XA 2BKOA 3D68A 1B99A 4RZRA 4WYWA 3PR5B 2VFSA 2BE7D 4ED8A 3RB4A 3MM5B 3VGUA 3RAQA 4X2BA 2HK2A 2V9KA 1S76D 2B56A 4ZP9A 2XMKA 4G6VB 4XK8C 4DSFA 1S1TA 1DRZA 4C8MA 2ZHBA 1RBAA 2B3TB 2L9WA 1WKLA 1X4AA 2E7XA 1SXLA 4UOGA 3D66A 2YNHB 4KV8B 4Y2MA 1NSQA 1DLOA 4FZVA 3CDWA 1UA0A 1T9WA 4KE5A 1NK9A 3TVKA 4C8OA 4RPFA 1CC8A 3R2DJ 5KG5A 2W7PA 3H8YA 1J5OB 1B0PA 4USKA 1X9SA 4DQQA 1JX4A 3QSYB 3KXDA 1URNA 3HHLC 5B08A 2BM6A 3QZ8A 2ADCA 4EUVA 2EG1A 2AT1B 3G6YA 4RW9B 5A2QU 1Y5IB 2ZE2B 3MOZA 4J37A 1FRJA 4LF5F 4G1QA 2ZWPA 4C48A 2MKKA 3EGZA 1C1CA 3ZZZA 2YKMA 3JB9k 2RHSB 2UU9F 2VBXA 3M2UA 3PO5A 3VAIA 4HHHA 2KVQE 1KS2A 2MKHA 3NAIA 5AXKA 4YEAA 4B17A 4WFXA 4NX9A 2F9JA 4ID5A 3M8SA 3RGIA 4PMHA 4UW2A 3OTCA 3K58A 3BBBA 5E3PA 5EX0A 2KTQA 1PYSB 2HGLA 5F8HA 2CQHA 3IWLA 2C3MA 4LRFA 2E5GA 3O3LA 5DZ6A 1AFIA 1AXQA 2QA1A 1MLAA 1JXEA 1N33F 1M0SA 4F04B 3HFVA 2GCFA 1V5VA 3KNGA 3RBXA 4DS5A 1ZM2A 4NYZA 4M5NA 3O1LA 3PEHA 4C2MA 1PAEX 3DRXA 3F41A 1LEOA 2C1EB 3DM2A 2INVA 1S9FA 2XTYA 3HHLD 1U1MA 3I55S 1T9VA 3AODA 3HM9A 2VKZG 3RBEA 1QQ1A 5D78A 3FEXB 2QZ8A 3MMBA 2EK1A 1CLWA 5K14A 1Q8LA 1SV5B 2J6TA 4MIAA 4DJBA 1QY7A 2AV5A 5J2NA 2HW3A 3AOCA 2CJBA 2LA6A 4JI8F 4DV7J 1VBZA 5AXNA 3OHBA 1TYUA 2QLJB 3DC2A 2GV1A 1Z2LA 4DR5J 3I9ZA 4M5IA 3SV4A 1PCAA 4CTAA 4HHJA 3FEZA 4FPIA 3HDSA 3OLAA 2ZJQQ 1CJKB 5ETSA 4KRWA 3BSCA 1D0EA 1VJQA 2ZZTA 1TKTB 4WBFA 3WC0A 1LWCA 4CYUA 1DTTB 1O8LA 4DR2J 2VJJA 3VGSA 1URRA 3NGKA 1VRTA 4K4TA 2RS2A 4OI1A 5KFNA 1H98A 4NZ0A 1RDRA 4ERDA 3F56A 1TTHB 2IA0A 4Q43A 2XM3A 3UCUP 1HBOA 3MEDA 4JI0F 2MQ8A 1HBUB 3KNAA 3EYZA 3WX4A 3OFGA 2VQFF 4Q2LA 3ZNUA 2Z4PA 1KDNA 3PXGa 1O8EA 1G2EA 2EW9A 4HT5A 2ROEA 2IIHA 4DF4A 4B9NA 1GXTA 4ECSA 4NL5A 1FKPA 3VQSA 4AL6A 1S57A 5KG0A 1WC6A 1FNMA 2NPFA 4N77A 1VQNS 2X1FA 4LQ3A 3D3CJ 2BUNA 2DNZA 2J8SA 3M2VB 1T8EA 2Y1JA 4CO5A 4NLPA 5C1EA 5CZVA 4ZPWR 2LQBA 2L9NA 3EICA 1E6YA 5HL7Q 1IBLJ 3TP2A 4XN3A 4OHXA 3BO2A 1FHTA 3RU0A 1RTIA 2O6WA 3H5XA 2V50A 4I7FB 2YNFA 1HNWJ 4PQAA 3C6UA 1WOSA 4YB6A 3QWPA 1LW0B 3M8PA 3MUVP 2XZDB 4MFBB 1KNZA 1HFEL 3E01A 4C8YA 1IBLF 1RWWB 3KJFB 4ZVHA 1UPPA 2IMWP 1NK8A 1SH3A 1FRKA 4LF1A 2IVMA 1B0VA 3CJ8A 1Y00A 2FJXA 2F65A 3LO3A 2V6AA 3QRQA 1RAAB 4R0EA 4XLHA 1SVDA 2ZBRA 1OMSA 3CDUA 1XERA 3PNIA 4OJOA 3J81U 4P75A 4CRJA 2FC9A 3B6BA 1IVZA 3ONQA 4Y6IA 4OJ3A 4C0OC 2LXFA 4DPTA 2UVUA 3M8QB 4DV6F 2VA2A 1LLZA 1UA1A 1RWMB 2EPIA 3TJ9A 2EFPA 2AJ1A 2WSFC 4PWDA 3NL0A 2HVEA 1AUSL 2RU9A 3M6XA 3Q8SB 4BHQA 1IUJA 5E33A 1R31A 2R3VA 2UUAF 1FJ7A 1PE9A 1FCAA 4BS2A 1DTQB 3KJNB 4WP9A 4B3RJ 4ILLA 2JFKA 1TKZB 4MJKA 3NG8A 2XB2D 1JNZB 1AA1B 5IV3A 2RDIA 1S1VA 3DLGB 4P2MA 4ZVQB 5I3UA 5KFLA 4MT1A 3D5MA 3PHEA 1Y5LB 4KC5A 1UMJA 4LR9A 4RNHA 1TZ0A 3WC2A 3DHWC 3UNYA 3TAMB 2DRBA 1O8JA 5E0OA 2E66A 5B0EA 1IJEB 4YR0A 2W25A 5KG7A 5KTQA 2KXNB 2OFHX 3UR3C 4YCQA 3IA0A 3IBWA 3KLEA 2RNEA 1KQFB 3KJVA 2J8AA 3N01A 4PYDA 4K5SA 3D4JA 3VAMA 3RR7A 1E6VA 1M1GA 3ISNC 3SZEA 4YZAA 2IVFB 3M32B 3GP9A 2ZH8A 4JI6J 2OEJA 2DH8A 2LKZA 2VKRA 5KFXA 4RUBA 3V4MA 4L3KA 3MM6B 3O5TB 2LCWA 2HQDA 2ASLA 3OTDA 2W7ZA 2EFOA 1Q95G 4JI6F 5EGYA 4NZ7A 2GVZB 1YZ6A 5HSPA 2W2MP 4F3MA 3G82B 5CD4H 4HACB 1U8WA 2AJQA 4N5SA 4U96A 5HBMA 3CCES 1XIQA 3EVOA 1ZH5A 3VZHA 3SQVA 2P8IA 3CMQA 4DV4J 1FXRA 4M5MA 1H2TZ 2I2YA 1FWKA 4YDDB 2CQ3A 3MCSA 2FHKA 3IO1A 3GYXB 2VFUA 1Y11A 1RYRA 1U1KA 2GGPA 2W7AA 2UVRA 1IJFB 2BJ9A 1KR4A 1HPZA 4YB1P 4IO9Q 3QIPB 1WG4A 5I42A 2R7VA 1X4CA 2XMTA 1EETA 1MSWD 4ZJQA 2VL1A 4NLTA 3MHYA 3LJYA 3ENVA 3OL7A 5A8WB 3GQ9A 4MIWA 2ZUAA 4RW7A
chains in the Genus database with same CATH topology
2XC1A 3Q8YA 3VGSA 1WKJA 3ZTQA 1NCLA 5CAAA 4UOFA 1PAEX 2YUHA 3BH6B 3SYJA 1PKUA 1XQIA 4C6AA 1TYWA 1NB2A 1LEOA 3FC9A 1W7WA 4S0MA 3ZTOA 3VGTA 3EMTA 1NSPA 1NDCA 4DZ6A 1JXVA 4KH3A 2V5IA 1QA2A 2HVDA 3FBEA 3L7UA 2J8IA 4W98A 2BM6A 1HIYA 4OPWA 3FCVA 1BUXA 2BM4A 2B0RA 4DI6A 4OJPA 2W7ZA 1NDPA 3FKBA 5CABA 1WKKA 2VFQA 2BX6A 2IOUG 3EVWA 3NGUA 3Q8VA 2BEFA 3G2XA 1LWXA 1QQ1A 2BM5A 2VFNA 3DDIA 4CP5A 2AZ3A 1NDKA 1B99A 2DY9A 4HR2A 2NCKL 1TSPA 1CLWA 5C7PA 1KDNA 1HLWA 3EM1A 4UOHA 2BM7A 1F3FA 1U8WA 1UCNA 3ENAA 3H09A 3MPDA 3Q89A 5JMCB 3VGVA 4OJ6A 4F4AA 1WXRA 3ZTSA 3R9LA 3FBFA 4JRAC 3JX8A 3JS9A 2B8QA 3VGUA 3PETA 1XIQA 3ZTPA 1QRBA 3Q8UA 3EVOA 4ANCA 1NPKA 3Q86A 1VYAA 1S57A 3NGRA 3EVMA 2DYAA 1F6TA 1K4ZA 5BXIA 1S59A 2VFMA 2VFOA 1DABA 1MN7A 4O0NA 3NGSA 2CWKA 1K44A 2DXDA 3FBCA 4F36A 4ENOA 1BE4A 2F3LA 3ZTRA 1HF2A 1TYUA 4OJOA 1EHWA 1NUEA 3PJ9A 4FKXA 3TH0A 2VFPA 1NSKL 4ANEA 1QRCA 3LYCA 3ML3A 1NHKL 4OM9A 1NLKL 2G0YA 2DXFA 3PRVA 3BBBA 5JLVC 3B6BA 1NDLA 2HURA 5IOLA 3RIQA 1WKLA 4KPCA 4OJLA 3AK5A 3ETMA 1MN9A 1QA3A 1ZS6A 3ELHA 4OJ5A 1B4SA 4UOGA 1TYXA 3FCWA 3Q83A 1S5ZA 1KQ5A 3DKDA 1QA1A 4V02C 3EICA 3NGTA 3B54A 2HVEA 3SZEA 4DUTA 3BBFA 1NSQA 1TYVA 1K8FA 2VU5A 3GP9A 1HHQA 4ANDA 3VVUA 3WX8A 1BHNA 3N6ZA 3EJMA 3LJYA 3BBCA 2DXEA 4FKYA 3FBBA 4WBFA 4EK2A 3VVTA 3GPAA 3N90A 3P4GA 2B8PA 2ZUAA 3EE3A 2AZ1A 3BH7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8Y A;  3VGS A;  1WKJ A;  3ZTQ A;  1NCL A;  5CAA A;  4UOF A;  1PAE X;  2YUH A;  3BH6 B;  1PKU A;  4C6A A;  1XQI A;  4S0M A;  1NB2 A;  1LEO A;  3FC9 A;  1W7W A;  3ZTO A;  3VGT A;  3EMT A;  1NSP A;  1NDC A;  4DZ6 A;  1JXV A;  2HVD A;  3FBE A;  3L7U A;  4W98 A;  1HIY A;  3FCV A;  1BUX A;  2B0R A;  4DI6 A;  1NDP A;  3FKB A;  5CAB A;  1WKK A;  2BX6 A;  3EVW A;  3NGU A;  3Q8V A;  2BEF A;  3G2X A;  1LWX A;  3DDI A;  4CP5 A;  2AZ3 A;  1NDK A;  1B99 A;  2DY9 A;  4HR2 A;  2NCK L;  5C7P A;  1KDN A;  1HLW A;  3EM1 A;  4UOH A;  1F3F A;  1U8W A;  1UCN A;  3ENA A;  3Q89 A;  3MPD A;  3VGV A;  4F4A A;  3ZTS A;  3R9L A;  3FBF A;  3JS9 A;  2B8Q A;  3VGU A;  1XIQ A;  3ZTP A;  3Q8U A;  3EVO A;  4ANC A;  3Q86 A;  1VYA A;  1S57 A;  3NGR A;  3EVM A;  2DYA A;  1F6T A;  1K4Z A;  3BH7 B;  5BXI A;  1S59 A;  1MN7 A;  4O0N A;  3NGS A;  2CWK A;  1K44 A;  2DXD A;  3FBC A;  4F36 A;  4ENO A;  1BE4 A;  3ZTR A;  1HF2 A;  1EHW A;  1NUE A;  3PJ9 A;  4FKX A;  4ANE A;  1NSK L;  1NHK L;  1NLK L;  3PRV A;  2DXF A;  3BBB A;  3B6B A;  1NDL A;  2HUR A;  5IOL A;  1WKL A;  4KPC A;  3ETM A;  1MN9 A;  1ZS6 A;  3ELH A;  1B4S A;  4UOG A;  3FCW A;  3Q83 A;  1S5Z A;  1KQ5 A;  3DKD A;  4V02 C;  3EIC A;  3NGT A;  3B54 A;  2HVE A;  4DUT A;  3BBF A;  1NSQ A;  1K8F A;  2VU5 A;  3GP9 A;  1HHQ A;  4AND A;  3VVU A;  3WX8 A;  1BHN A;  3EJM A;  3BBC A;  2DXE A;  4FKY A;  3FBB A;  4WBF A;  4EK2 A;  3VVT A;  3GPA A;  2B8P A;  2ZUA A;  3EE3 A;  2AZ1 A;  1NPK A; 
#chains in the Genus database with same CATH topology
 5AMV A;  5HP1 A;  2W8K A;  4K4Z A;  2FJB B;  3W63 A;  2QN6 B;  1X5T A;  2WZ1 A;  3D0I E;  1XK8 A;  3QGH A;  4WTO B;  2ZH9 A;  3RG6 A;  3DLB A;  3DXS X;  4I2P A;  2WOM A;  4I0W A;  4IUF A;  3M2R A;  5DLF A;  3G2X A;  2J7W A;  4LR7 A;  4RUH A;  5GMK a;  4MH8 A;  4HR2 A;  1R8A A;  4H4M B;  3V6D B;  1PXZ A;  1U0H B;  1U1R A;  2ZIT A;  1JLA A;  3BDE A;  4RW8 B;  3QO9 A;  1WEY A;  1DFD A;  1C2P A;  3ZTP A;  4ZPV R;  1LNQ A;  3M1V B;  3CD5 A;  3MM7 B;  1O6X A;  1LQ9 A;  1T03 A;  4LBI A;  5HRO A;  2JDJ A;  1X4D A;  4XPC A;  4NRU A;  1U48 A;  4FNH A;  5D4N A;  3GII A;  5KT2 A;  2V8G A;  3FQK A;  2F8M A;  4HDG A;  1XG2 A;  2PMZ D;  4RWW A;  3NP5 A;  3TI0 A;  2DO0 A;  4W8R A;  3DRY A;  3CT9 A;  1U6F A;  3V4I A;  1S0N A;  3P8B B;  1U2F A;  4YC5 A;  2XZW A;  2HNY A;  1V3R A;  3SQO P;  3DRS B;  2GS8 A;  3IRX A;  2PEC A;  4ZVS B;  3G6V A;  1S1W B;  2CAJ A;  3SZ2 A;  1H2U X;  4K4W A;  3MWB A;  4DR3 J;  1U2C A;  2WSC C;  2KL8 A;  3S01 A;  1FKA F;  3M6W A;  2IOU G;  1GXL A;  4USH A;  1HHS A;  4K4U A;  4N76 A;  3OXL A;  5DDP C;  1TVR A;  3D3B J;  2NCK L;  5F8L A;  1JK9 B;  3B4M A;  5LMN J;  1ZAV A;  2ZKU A;  4IH6 A;  2JH3 A;  1S1U A;  1GAO A;  3JS9 A;  5A6P A;  2KKH A;  1LV5 A;  5IC6 B;  4N56 A;  1RAG B;  3DI6 A;  3KHH A;  2B9E A;  7FD1 A;  4FS2 A;  3AOA A;  2XO7 A;  2RSQ A;  3EXC X;  2PYG A;  2HBR B;  1S6P B;  5LMN F;  3V81 B;  1HNV A;  3ZC4 A;  4AUK A;  4TU8 A;  4DWI A;  1QAJ A;  4KQZ A;  3ZFV A;  1OSD A;  2NST A;  3THT A;  1F5B A;  1FF2 A;  2MMY A;  1PBA A;  2KJW A;  3BBF A;  2ALY B;  4I6A A;  7AT1 B;  3O6Q A;  5KFR A;  3AOB A;  4IR1 A;  2GNK A;  1GFW B;  3N5B A;  2MZ1 A;  5GME A;  3I4P A;  1TL1 A;  1EIY B;  1BY9 A;  1YJ7 A;  2EEY A;  3CWJ A;  5DDO C;  4CH0 S;  4DBQ A;  3RRG A;  1KRP A;  1Q5Y A;  4UUX A;  3BZQ A;  1M5O C;  4PZV A;  2K1R A;  1VOM A;  3BDP A;  2LFV A;  4DHV A;  4X4P A;  3KHL A;  2HMI A;  4O4G A;  3LA0 A;  2JEJ A;  2BJ7 A;  1U7L A;  4ALZ A;  2HQ3 A;  3FZB A;  2IM0 A;  4DX8 H;  1NDK A;  1N32 J;  4Z7C A;  1KCD A;  4X4T A;  4CDI A;  1JLQ A;  4KAI A;  2LDI A;  3R3T A;  1VLO A;  1ZZN A;  3CUL A;  1FER A;  3ITH A;  3SDE B;  1UJ6 A;  3VR1 A;  4J5O A;  4IDK B;  1WG1 A;  3N6M A;  4YR3 A;  1R89 A;  2NUU G;  3N6N A;  4EBD A;  3FFI B;  2RDD A;  1N32 F;  1UAW A;  1NXI A;  4QU7 A;  3RJM B;  3GLJ A;  4OYI A;  2IMO A;  4C98 A;  2X51 A;  4DQI A;  4C8L A;  3R97 A;  5C42 A;  3HT3 A;  1VS3 A;  3B8H A;  2LEP A;  3QLH B;  1X8D A;  4LF8 J;  4J7C A;  2YX1 A;  4WXW A;  2DHA A;  4O3Q A;  1YJN S;  1QSL A;  2Y9H A;  4K7Q A;  3I56 S;  4MKV A;  3BSO A;  3GB0 A;  2KZM A;  2BX6 A;  1IKW A;  2VFV A;  1R27 B;  2BRL A;  4HHU A;  4K59 A;  2B5J A;  4DPX A;  1RYS A;  2CQP A;  1HKA A;  1Z2Z A;  1TUV A;  1AW0 A;  2BOA A;  3WBZ A;  3HT0 A;  1U1P A;  4W4M A;  1N54 B;  3QAT A;  3CSK A;  1QRB A;  4OX6 A;  4UZB A;  1GMW A;  4WP3 A;  3K17 A;  2QLB B;  2VF3 A;  4G65 A;  5KFZ A;  5SUH A;  1MML A;  2VJU A;  2OSR A;  2NSP A;  4MK7 A;  8RUC A;  2VFP A;  2RQK A;  3I32 A;  2VDI A;  2XS7 A;  1O8B A;  2RQC A;  1S5Z A;  4OX8 A;  3RZA A;  3PW7 A;  4J9U E;  1RWV B;  1FRH A;  2X6X A;  3CC2 S;  3OVA A;  5CYJ A;  4DV3 J;  1HWU A;  2VBZ A;  4B3O A;  2KFN A;  4ZVG A;  2VG5 B;  2POK A;  1KFS A;  4G1I A;  3BO3 A;  4DCP B;  2PD1 A;  1NB2 A;  1V9O A;  2ZH4 A;  1NJZ A;  1WC4 A;  1YJV A;  1O8D A;  1NHV A;  3CCM S;  2QLX A;  2IYI A;  3CD7 A;  2I6W A;  4CT8 A;  1UET A;  1WSV A;  2CPX A;  5CAB A;  3QT5 A;  3GRH A;  2D74 B;  4M94 A;  1VRU A;  5EDW A;  4XOR A;  3BGF A;  1R8B A;  3OUY B;  5SZT A;  2PFD A;  5F8G A;  5IT9 Y;  2BW2 A;  3VGV A;  4PG5 A;  1S6O A;  3CPW R;  4LFB J;  3ISZ A;  2HBQ B;  2DGU A;  2J9D E;  1RWP B;  2J76 E;  3D1O A;  2KU7 A;  4WJB A;  1EAR A;  2HND A;  1NSK L;  2IJF A;  1GT8 A;  4TN2 A;  4KGK A;  3NEK A;  3K5P A;  4F2R A;  2CJK A;  3FCW A;  2RVJ A;  1R3N A;  4UTG A;  3OL6 A;  4A48 A;  3OJU A;  3R5G A;  4YS2 A;  5ADZ A;  1JLF B;  2B9X A;  3VST A;  1EJ7 L;  3VVT A;  2VOP A;  4IOC Q;  2LQJ A;  5GAG U;  2G9O A;  2ABY A;  1S0O A;  3BJY A;  2JRS A;  3PTW A;  1ZET A;  2M3D A;  4UQG A;  3W7B A;  2BSP A;  3DYA A;  2Z57 B;  5ETP A;  1HBN A;  4KO0 A;  1ZAX A;  3TWZ A;  2W2Q P;  3ETO A;  3C14 A;  4IOA Q;  3OLB A;  1Y0H A;  3N6L A;  2F4F A;  1HWK A;  1OGO X;  3N28 A;  1SJ4 P;  4ITS A;  5HN0 A;  1G3O A;  2CQ4 A;  3M05 A;  2FZC B;  3M30 B;  3HJV A;  1I5O B;  2CQD A;  2W2O P;  3W5Y A;  4O3P A;  4PKD B;  4CLP A;  1HF2 A;  1YJT A;  2V2V A;  4KH1 B;  1FRX A;  3NGD A;  4B9L A;  4Y00 A;  3BGR B;  2WB1 D;  3M7V A;  3IFE A;  2FYX A;  2U1A A;  3RRH A;  2YKP A;  1ZM9 A;  1GNK A;  2MQN A;  4C8N A;  3TJ8 A;  4GC6 A;  2VJI A;  3W62 A;  2QA2 A;  3TR5 A;  2AYE A;  2LDY A;  4QBU A;  2N4C A;  3Q8Y A;  3C6T A;  1QDU B;  4LSN B;  4FXD A;  2V2K A;  2JC0 A;  4C6A A;  2JHE A;  3ICL A;  3I0S B;  2UVF A;  3CCR S;  1DHM A;  1REV A;  4YN3 B;  4GO5 X;  4ED1 A;  1WJ9 A;  5FII A;  5KFO A;  5ETT A;  3K89 A;  5LT5 A;  3AB4 B;  4FF1 A;  3ULH A;  4JYA J;  4G1P A;  2DH7 A;  2CPI A;  1KHV A;  1F5C A;  4LQ9 A;  3ZTS A;  3DLK B;  2X6W A;  2P9G A;  3H2V E;  4XQF A;  3BR9 A;  1RT7 B;  2DNK A;  2QX0 A;  3NRB A;  2E44 A;  4IG0 A;  1R0A B;  2P6S A;  3AXM A;  4OZ1 A;  2M8H A;  3V2U C;  1U09 A;  1LK5 A;  4ZVT B;  4P74 A;  2Q43 A;  5DZ7 A;  4PUO B;  1K1S A;  1R7I A;  5KFV A;  1D9A A;  2CNN B;  4IQX A;  1P9Q C;  4OJ5 A;  1N88 A;  3GE9 A;  3FEY B;  5GAH I;  4ZKA A;  1SBR A;  1XR7 A;  3HHN B;  2QYG A;  1S99 A;  1CVJ A;  4XM3 A;  5CYM B;  3NS7 B;  1GK8 A;  1N5Y B;  2CWX A;  4DG1 B;  1VQL S;  5CAA A;  2WVF A;  4W92 B;  3VF0 B;  5HQL A;  3HF5 A;  1BGX T;  2V8P A;  3VGT A;  3VMW A;  1XNQ J;  2XY5 A;  2CVI A;  3N9U C;  2KH9 A;  4EW9 A;  4CLZ A;  5JUM A;  2A2C A;  2GFF A;  3N5F A;  3KLI B;  1UFL A;  1IR1 A;  2C3Y A;  1F2G A;  2QSF A;  2RF2 A;  3PW4 A;  5GAE I;  2IBK A;  3CCW A;  1KTW A;  4YB5 A;  5L1J A;  2HGN A;  3UW1 A;  3AD9 C;  1NEE A;  3FZ2 A;  1MW7 A;  4GKJ J;  1D9D A;  1NJY A;  4X66 J;  2RHQ B;  1XNR F;  3FK4 A;  4F36 A;  2HRY A;  2MKJ A;  2CJA A;  3H59 A;  2HQI A;  2RIJ A;  1RT1 B;  1L3T A;  3ZZT A;  4F50 A;  2X3G A;  2N3L A;  3D7S B;  2G4B A;  2DCL A;  3WDO A;  3GIL A;  1K8A T;  2Y3Y A;  2IVY A;  4GKJ F;  3BKF A;  3AB2 B;  3HHL B;  2IAJ B;  3PW5 A;  1XWL A;  4I2Q B;  3PSZ A;  1HHQ A;  3IN5 A;  4O3N A;  4X66 F;  3HD1 A;  4XLE A;  4DPO A;  3GCX P;  1U4B A;  3RB0 A;  2DNR A;  5D4O A;  2KM8 C;  5CCM A;  1YGY A;  5M2U A;  1YKW A;  3FY3 A;  3GYG A;  5A8R B;  1S9E A;  3IWN C;  1OFE A;  2RS8 A;  5G0R A;  2VQE J;  2R9L A;  4K4S A;  4K0K J;  2GO9 A;  2YVS A;  1N5V A;  1VQ4 S;  3UI3 A;  3GZ7 A;  4DUZ F;  1LFP A;  4QIW D;  3C2P A;  5IC4 B;  1RE1 B;  1XMO F;  4F4A A;  2G1D A;  2A18 A;  3HSZ A;  4USW A;  4X4V A;  2XY6 A;  1RHJ B;  1QM9 A;  5B0D A;  1SKW A;  4V1A k;  2C22 A;  3IS9 B;  4NLQ A;  4K0K F;  4YQW A;  1K4Z A;  4KR0 B;  1N6Q A;  1VQP S;  3QFW A;  3DNC A;  3BPD A;  3WQP A;  1PAU B;  4PG4 A;  1OFL A;  5DQG A;  4LFA F;  3QAU A;  3LUY A;  1B7F A;  4DPW A;  3MMA B;  2MLZ A;  2X3D A;  2XWY A;  2L41 A;  2JLG A;  1EP4 A;  3C16 B;  4YHH F;  4EEY A;  3TUZ C;  2J7U A;  5KFC A;  3ILL A;  3NAH A;  3DFE A;  5BR8 J;  4M1K A;  2QO3 A;  3MM5 A;  4DUY F;  4HDH A;  2UUB J;  2MEW A;  4DEZ A;  2PYH A;  4ZVO B;  5IT4 A;  3OD2 A;  2D3Z A;  2HVD A;  2IFX A;  2CFX A;  3FRZ A;  3MPW A;  2PSZ A;  1HHT P;  2GHW A;  1JLC A;  2YNH A;  4ZVP B;  2BM7 A;  1Q8K A;  1U8S A;  5LMU F;  4CNY A;  4F02 A;  3KDN A;  1WHX A;  2OEL A;  4QR0 A;  1RGV A;  3ZZY A;  1J5O A;  1NK0 A;  1S79 A;  3TUJ C;  2CWK A;  4QWA A;  1EKS A;  3BGL A;  4FKX A;  4LFC J;  3NWG A;  5KFA A;  2F3J A;  1LKZ A;  4RW9 A;  3EGW B;  3MAA B;  3CJ5 A;  2CUY A;  2ZE2 A;  2CZ4 A;  4H4K A;  1Q81 T;  3SXL A;  2HKE A;  3J80 Y;  1RMG A;  2XNR A;  3RW6 A;  1NZ8 A;  5LXR A;  5A0Y A;  1FDB A;  1WUU A;  2AF6 A;  5D0H A;  3KLG B;  4LFC F;  2CDR B;  3HVT B;  1P8G A;  2MJU A;  2A2D A;  5DET A;  5AT1 B;  1J5E J;  1OQ6 A;  2VAS A;  4NPO A;  1YJ9 S;  1RTJ B;  4KY3 A;  1H74 A;  1FVQ A;  1N36 J;  3DU1 X;  3SFG A;  5D6G A;  4J9S A;  4U8Y A;  2CAD A;  4X65 J;  2CYY A;  2AEJ A;  2XLJ A;  2OD6 A;  3DOK B;  2O5D A;  3EVM A;  2B4O A;  4IOB A;  4E0D A;  1LWE B;  4L6V 3;  1G6B A;  3IAS 9;  1N36 F;  2FB0 A;  2QL9 B;  3E8O A;  4UY8 5;  2QMW A;  2Y0S D;  4DR4 F;  2HK3 A;  1QRC A;  3D6T B;  5D0E A;  2YWE A;  5HLF B;  4QYR A;  2ILZ A;  4X64 J;  2HHX A;  4JB8 B;  2M2B A;  1VDH A;  4ZLL A;  3MMC B;  1WD6 A;  2ACM A;  4OI4 A;  5KFH A;  1SV5 A;  3CMA S;  1T3N A;  3TEG A;  1SKS A;  3GPA A;  2O66 A;  2CA9 A;  2OPQ B;  3NBP B;  2ZBI A;  5C5J A;  1S6U A;  2BJD A;  4LBH A;  1CJV B;  5C25 B;  1S48 A;  4R8U A;  3HD2 A;  2Z8G A;  2AIR B;  3LPE A;  4Y28 C;  1HNX F;  2E9Z A;  2F4V F;  2X3H A;  4I68 A;  4CCH A;  4WE1 A;  2RKI B;  1DJ0 A;  2A3J A;  2F63 A;  4USM A;  2OPP B;  1TL3 B;  4RX6 A;  1IXK A;  2VBM A;  1FJE B;  2AJ2 A;  4FVM A;  4I6Y A;  4WK1 A;  3K8V A;  3R1L A;  4BC9 A;  2VJV A;  2OML A;  3TX0 A;  1DTT A;  4AE5 A;  1SJQ A;  1RKI A;  4NLD A;  1K44 A;  3E2E A;  5L9N A;  5KG2 A;  1WF0 A;  2QC3 A;  4CM2 A;  2MZT A;  2ZVI A;  1HBU A;  2FY1 A;  4OHY A;  4Y3C A;  2VC1 A;  5IT0 A;  2DCU B;  1MRO B;  2F8E X;  3PEJ A;  4AND A;  2NZC A;  3TUI C;  1FT8 A;  2RB7 A;  3H5Y A;  4DFJ A;  1RWO B;  2PA3 A;  1OFD A;  4KIA A;  2PO4 A;  1D3W A;  4OIX A;  1VQO S;  3P5T L;  4W8Q A;  5F0W A;  1JQG A;  3I9V 9;  4AQY F;  4FN5 A;  1IDJ A;  4HTJ A;  4C11 B;  3N4W A;  4DN0 A;  4N7T A;  5IWA J;  4NA2 A;  1FK9 B;  2FVP A;  4WPA A;  1QVF R;  1QAY A;  3DRP B;  3HFZ B;  2C28 A;  2DNQ A;  4XLF A;  2VZ9 A;  4WIQ A;  1GX6 A;  1TK8 A;  3HJF A;  2KFY A;  1NKE A;  4U8V A;  1I1G A;  1HQU A;  1MN7 A;  1YSJ A;  1H7W A;  2MKS A;  3I0R A;  4NCG A;  1KC8 T;  1FJG J;  5HQM A;  1QUV A;  2YH0 A;  4QWE A;  1G7C B;  4DL6 A;  4MFB A;  3GIR A;  2YH1 A;  5DQI A;  1NKC A;  1NDL A;  5M2P A;  3GIM A;  4NOH A;  3NS5 A;  1W26 A;  2Z56 B;  1N34 F;  1ZZF A;  3QZ7 A;  1R6V A;  3AXK A;  2ZC3 A;  1PYT A;  3Q23 A;  2VC0 A;  3JYT B;  2A6O A;  1YJW S;  1X4H A;  1WOR A;  1VMB A;  4DS4 A;  3G6X A;  1Q86 T;  1KWM A;  4A8W A;  3KK1 A;  2Q79 A;  4PWW A;  1VQ5 S;  3CNQ P;  2EFV A;  5MAO A;  2G13 A;  1RZM A;  3MEK A;  3MCO A;  5IM0 B;  1TQL A;  1WOO A;  3M8Q A;  1JRG A;  5F8I A;  4A47 A;  4KPY A;  3S7R A;  4RW4 A;  3CC7 S;  4LMZ A;  4GRS A;  4DV1 F;  1S0V A;  3DOL B;  1X0C A;  3T5K A;  3R2C J;  2E5J A;  3H0P A;  2ZH6 A;  1DTQ A;  1HQ2 A;  4XDD A;  3OSN A;  3BR8 A;  3AQP A;  1TKZ A;  1Q7L B;  4OLO A;  1HD1 A;  1JJH A;  2W2P P;  3B82 A;  3DLG A;  3VAL A;  3P3D A;  4N8O A;  2RUS A;  3GMG A;  1WG5 A;  4I84 A;  4XNF A;  5KFT A;  3DGP B;  3UN2 A;  3RAX A;  4W8T A;  3JTN A;  4QJV A;  2AW0 A;  3TAM A;  2GX8 A;  3GSD A;  3PJW A;  1HR0 J;  2H48 B;  1RLD A;  2V4J B;  4F25 A;  2QJ3 A;  2YWH A;  4NLX A;  3TAR A;  3OV7 A;  4KGM A;  1QA2 A;  3KDO A;  1T9X A;  1FDA A;  2BBE A;  2W01 A;  4CZC A;  2HNZ B;  2YWG A;  3W8G A;  1TUG B;  3THP A;  2MKC A;  1WI8 A;  2UUC J;  3R5D A;  1K47 A;  4ILR A;  2OJ3 A;  3MEC A;  3M32 A;  1KOO A;  2KRR A;  2FTR A;  1QD1 A;  4KT0 C;  2CIM A;  2FHM A;  2XBP A;  3PHT A;  3M9O B;  1EKR A;  2QV6 A;  4QPT A;  5IQ6 A;  1OFM A;  3L7O A;  2G0J A;  2J0X A;  4ECX A;  2ALZ A;  3MM6 A;  2UUC F;  2FLO A;  3KG4 A;  2RQ4 A;  5IXU A;  4DV5 F;  3MD1 A;  5L9X A;  1FXD A;  4QR1 A;  4DU7 A;  1Y3K A;  2GVZ A;  1RT4 B;  4PG6 A;  5ETO A;  1YDL A;  3HVW A;  3DKD A;  3G82 A;  1K8F A;  4YZ0 A;  3EDQ B;  4IG3 A;  2J9C A;  2VDH A;  1N5Q A;  2AJF E;  2NYI A;  1TUW A;  3G86 A;  1O0P A;  4DSE A;  5EN1 A;  1PC5 A;  3JSM B;  1IR0 A;  1O8H A;  3K0J A;  4ZJO A;  1BQN B;  2W9B B;  3FGV A;  4DLE A;  1HQE B;  1MG7 A;  2OD4 A;  2L08 A;  4DZ6 A;  4XLA A;  3FSX A;  4M5L A;  1RBO B;  4L75 A;  2BM4 A;  4XO0 A;  2UXC F;  4ZLP A;  1FKO A;  2JEF A;  2FDN A;  3NY0 A;  2RAQ A;  3QIP A;  2UUT A;  3MR2 A;  5LJ5 Y;  4CLT A;  3PVX A;  1RKJ A;  1A9N B;  3K2Y A;  2L9D A;  4G3I A;  2OLW A;  2H4W B;  5A8W A;  4RJV A;  3GG1 A;  2FLN A;  5T7L B;  1RAJ A;  4JV5 J;  3PX0 A;  2FIU A;  1HYS B;  5C24 B;  4IRK A;  3LP0 B;  3BO4 A;  1RT3 B;  1DLO B;  4D3H A;  3HO1 A;  5KOX A;  4R5P B;  4HVZ A;  2N4D A;  2CQB A;  2ZD1 B;  1X0P A;  3G8S A;  1QJH A;  3CJS A;  3LAK A;  4KKO B;  1OO0 B;  3SBM A;  3POT A;  1QCX A;  1AB8 A;  3CCZ A;  3UCZ P;  1VR6 A;  5L39 A;  3FSI A;  2ILY A;  2FZG B;  1KEK A;  2G2Z A;  1FXL A;  3UFC X;  1NBE B;  2E9R X;  2ZNY A;  2AP6 A;  2Q1L A;  2QE5 A;  3KTQ A;  4JI3 J;  3M1V A;  1UWB A;  1TAQ A;  2NXJ A;  5EX3 A;  2LP4 A;  4G1Q B;  5GMD A;  1FE0 A;  3I96 A;  2YKM B;  3CJT A;  3K59 A;  1TFY A;  3QJJ A;  1X4G A;  1N5S A;  4YDX A;  1L3U A;  2KJV A;  4XR6 A;  1B7Y B;  1KTQ A;  4AFF A;  4IH5 A;  2Z8Q A;  1RWR A;  1NPP A;  2QTW A;  1CUL B;  3QJL A;  4NA1 A;  2O67 A;  3BGO P;  1U47 A;  3PM9 A;  1CQM A;  3OTE A;  3K5O A;  4TY9 A;  4DN9 A;  3JX8 A;  3OT9 A;  2MKI A;  2B8Q A;  3PET A;  3DRS A;  4O23 A;  1IBM J;  4FXV A;  1VC6 A;  4QZV B;  2ASD A;  3Q2T C;  1B3T A;  1FES A;  4AL5 A;  2HSE B;  2HHW A;  1OPZ A;  3J7Z T;  1KQS R;  4NCB A;  1LOU A;  1LM1 A;  5FLX Y;  1QAX A;  3H20 A;  2XO6 A;  1B64 A;  3DM2 B;  3RB6 A;  2QLW A;  1WC5 A;  4DV2 J;  4I69 A;  1SC1 B;  2H9Z A;  2C2M B;  2ATC B;  1NPK A;  2RRB A;  5AXM A;  1L1I A;  4LT6 A;  4IH7 A;  3GQA A;  3CCV S;  1UKU A;  6FDR A;  4ZP8 A;  3EMT A;  4KFB B;  1EA0 A;  3JAM Y;  3L7U A;  2MQP A;  3AJ2 A;  5C1C A;  3V81 A;  5J2N B;  1WEX A;  4WF9 Q;  3NAW A;  4MMO A;  1ZTW A;  1BMQ B;  5BJR A;  3ZZU A;  1Q5V A;  1UW4 A;  1UTA A;  1UVN A;  5H9E K;  4HH0 A;  1FDN A;  2AHO B;  2OO4 A;  3DOM A;  4RUC A;  3UVJ A;  3P96 A;  3CIZ A;  1S59 A;  2G2Y A;  1IKY B;  3N79 A;  4OM9 A;  2J5A A;  2I1R A;  3W5Z A;  1JLG B;  1LWC B;  4CYU B;  1K1Q A;  4A8F A;  2DO4 A;  2IC3 B;  3SSQ A;  4F4K A;  1VRT B;  2LQ9 A;  1PLU A;  2ZH1 A;  1OWX A;  4H4K C;  1FX4 A;  2DD8 S;  3B4D A;  4H4O A;  1BQX A;  2B4V A;  1SH2 A;  4WU2 A;  3UDL A;  2YPY A;  4UT4 A;  4IDK A;  3MED B;  5J1N A;  5KAK A;  3BH6 B;  1DBD A;  2HHV A;  3VMV A;  2CRL A;  3EZO A;  2B9W A;  5KG3 A;  1AUD A;  4J91 A;  3CD6 S;  2ZH3 A;  1OPI A;  2M88 A;  1HNZ F;  2DIU A;  1JLB B;  1VIO A;  2G0C A;  1DQ8 A;  3J7A 1;  4OYW A;  1M90 T;  4L72 B;  2FVQ A;  1RT2 B;  5DG7 A;  4LSL B;  2LXI A;  3QLH A;  2DH9 A;  3PV8 A;  3WIV A;  4CLY A;  4BC7 A;  1W2B R;  2BQ3 A;  4X4N A;  1FFW B;  1RTD B;  2NQP A;  4MKY A;  4DR1 J;  3H7H B;  2KZZ A;  1E6Y B;  2MPU A;  1D8Z A;  2I38 A;  2KHC A;  2R7Q A;  2D1C A;  4Y0F A;  3RIQ A;  4A46 A;  2LXU A;  1FRI A;  3J7Z 5;  5HVG A;  3THV A;  1S4F A;  2DNH A;  1FNO A;  4F0K A;  2HAF A;  3HI9 A;  3M8P B;  3BBC A;  3E01 B;  2AQ4 A;  1JKH B;  4DXL A;  2V8V A;  3I4H X;  2AZ1 A;  2DB1 A;  1WMR A;  1VIS A;  5KFG A;  3TNV A;  2WRM A;  2ZBC A;  3OR2 B;  3AH6 A;  4TYA A;  1CLF A;  4KGX B;  1FFG B;  4J9P A;  2VIH A;  1EB0 A;  2WVB A;  3BPS P;  2G0I A;  3R5C A;  3LWM A;  5FJ4 A;  3CF5 Q;  1NJI T;  3EQN A;  2BXJ A;  3TAN A;  3M8Z A;  3DLJ A;  1S10 A;  3KK3 A;  4WXO A;  4LRB A;  4RO0 A;  2XGQ A;  2VPY B;  2XG8 A;  4USI A;  3PW0 A;  2VG5 A;  3CDA A;  5BXI A;  2VFO A;  2C2N A;  3OSP A;  4FBT A;  2OPS B;  4PWD B;  4ENO A;  3MEE A;  4NLG A;  2OSQ A;  4NML A;  3KHG A;  1KCC A;  1I6J A;  3LGN A;  2EFN A;  2BJ8 A;  2Y8W A;  2J0W A;  2HFZ A;  2D3U A;  1KQ5 A;  2WON A;  3OUY A;  2WB4 A;  4P2S A;  3TA0 A;  2BV3 A;  4GVB B;  2WW8 A;  2FHJ D;  2EK6 A;  4TLR A;  5I3U B;  3D67 A;  4EMD A;  4KGV B;  2FLP A;  1AYE A;  3ZTO A;  1IDK A;  3PZP A;  1IKV B;  3B90 A;  3ET6 A;  2F40 A;  4AYB D;  5D3G A;  3KUH A;  1P9Y A;  3MAH A;  1FD8 A;  2GMH A;  4LVN P;  2BM1 A;  2B9Y A;  3B78 A;  3UO0 A;  2HHQ A;  1YG0 A;  2QX3 A;  1V5I B;  3H09 A;  3VTI A;  1GXU A;  1JLF A;  2XTW A;  3FVY A;  4HYK A;  4QW9 A;  1BD6 A;  2HS3 A;  1BLU A;  2AEF A;  5B0F A;  1T95 A;  4OLP A;  3KJV B;  2DGV A;  1UEV A;  3GR0 A;  5E7O B;  4KH0 B;  5F3Z A;  2VON A;  1E6V B;  1CJT A;  1K0T A;  4A4J A;  3CC4 S;  2VD3 A;  4HWV A;  1GQE A;  4LF5 J;  3BQ2 A;  3A12 A;  4TQR A;  1LXJ A;  2FJW A;  1KLM A;  4F67 A;  4RNO A;  4CQ1 A;  4QIV A;  3QAE A;  2UU9 J;  1UJ5 A;  3HPO A;  2PN6 A;  3RR8 A;  3AAW B;  1BXN A;  3R27 A;  2VH7 A;  3MF5 A;  2OTJ S;  4J9M A;  2GAH C;  2AMC B;  1J2V A;  1PKU A;  3OQ2 A;  1HL6 A;  1NDC A;  1VQY A;  3CCT A;  2ZOM A;  1C4C A;  2J8I A;  2FJA B;  2VOD A;  3QPI A;  1S6Q B;  5HBM B;  1IA5 A;  1N52 B;  3S6E A;  1A0O B;  4JI1 F;  4ZHR A;  3DLE A;  1N33 J;  2K7K A;  2RH3 A;  3QFH A;  3HK2 A;  2XLK A;  1H72 C;  2GGP B;  1WXR A;  2QA4 G;  3N0V A;  4YB7 A;  4NMX A;  5IZH A;  2ZOG A;  3UD5 A;  1LWF B;  2NUH A;  2JNJ A;  2XSJ B;  2G1H A;  2CQ0 A;  3NKY A;  4LSN A;  2A10 A;  2DEJ A;  3I0S A;  3K7R A;  1WDD A;  5HVH A;  1TL7 B;  1OY8 A;  1L3K A;  2V94 A;  3H5U A;  2KM8 B;  2HUR A;  1SUQ A;  3LP1 B;  1YJU A;  4FS1 A;  5ETR A;  4OYP A;  4RW7 B;  5HP1 B;  1WOP A;  1SQG A;  4LF9 J;  4MYT A;  1GMV A;  3MCM A;  2QFJ A;  5J1E B;  2XI3 A;  2J0S D;  4DPY A;  4K8R A;  2Z30 B;  4JI8 J;  3UD3 P;  1KVK A;  2B7C B;  2V67 A;  2Z2M A;  4U7U K;  2YPZ A;  2JWN A;  3VHQ A;  4F4X A;  3TVZ A;  1U02 A;  1SCJ B;  4J90 A;  1U45 A;  1R0A A;  2P6T A;  3KJQ B;  4V19 X;  3CVK A;  2GIF A;  1JLA B;  3HHD A;  4DL0 C;  3G4S S;  3QO9 B;  4L74 A;  4LF9 F;  4FBU A;  2C2K B;  4PPD A;  4ED6 A;  2R2S A;  2E7W A;  1T03 B;  5HRO B;  3OVS A;  1V3Z A;  2UVV A;  1FWL A;  1WC0 A;  1X4E A;  1X9W A;  2R7T A;  1SI9 A;  5CYM A;  1CEZ A;  2HQF A;  4DLG A;  1N5Y A;  1YRX A;  2ZOF A;  1RU4 A;  2AEM A;  4NEZ A;  2VG7 A;  4O0N A;  2XMJ A;  2MQL A;  1WC3 A;  3KLH B;  2QL5 B;  2DBB A;  4JI0 J;  2MQQ A;  3PRV A;  3LF0 A;  4MTP A;  2VQF J;  2AYB A;  3LGH A;  5K8M A;  1NH8 A;  2WVD A;  3KLI A;  2HNY B;  3Q2S C;  4NI2 B;  4QW8 A;  3IRX B;  4NXN J;  3MEG A;  1TYV A;  4F8R A;  2M9K A;  5KT3 A;  2XMA A;  4XL9 A;  1Q7Y T;  4NAS A;  2R8J A;  4CO0 A;  1CJU B;  4HI1 A;  3M9N B;  4ZIW A;  2AU0 A;  2NR0 A;  1UVK A;  2E1P A;  4CO1 A;  1WHV A;  4FF3 A;  4YEL A;  1HA1 A;  1TVR B;  4QIE A;  1KTV A;  1R43 A;  2QL7 B;  4XTT A;  4WKR A;  1RWU A;  2K2P A;  4NXN F;  1RT1 A;  2BR0 A;  3T5J A;  4JI5 F;  4UZC A;  3DI6 B;  2AJ4 A;  5E3C A;  5LOQ A;  3Q8V A;  1IM6 A;  2GQ2 A;  1MNE A;  2AJ0 A;  2DVI A;  2VG6 A;  1FRM A;  5JMC B;  1Z4U A;  1QSY A;  2ZDP A;  4Q45 A;  2HFN A;  4TY8 A;  1HNV B;  2DHH A;  3W61 A;  4EYI B;  1W25 A;  5KFM A;  3E51 A;  2OHD A;  3HP6 A;  4IKA A;  3CUN A;  5A8R A;  1U1O A;  3HZG A;  3PYG A;  3EUN A;  1LW2 B;  2K3K A;  4YME A;  2RD5 C;  5JLV C;  5DRK A;  3QWU A;  3DU6 A;  1RI7 A;  4NLW A;  4ELU A;  1H7X A;  5CHC B;  1HD0 A;  3PX6 A;  1BHN A;  3A8J A;  2I5J A;  1RSC A;  4FYY B;  2Y1I A;  1EZZ B;  2MGZ B;  2HMI B;  4O4G B;  4DL3 A;  2VFR A;  3IS9 A;  3P4U B;  3U1M A;  2RQM A;  2DPI A;  4P2F A;  3NCP A;  1JLQ B;  3W64 A;  4QWB A;  4LIW A;  4IYQ A;  3ITH B;  4DV6 J;  4MK8 A;  5G4D A;  3MMA A;  2YTC A;  3NCQ A;  2MQM A;  3GCW P;  3KG1 A;  2QRR A;  4TU9 A;  1IR2 A;  2UUA J;  1N4L A;  5JJB A;  3IM8 A;  5E3A A;  2EI5 A;  3GJS B;  4K50 A;  1MU2 B;  2O3D A;  4F7V A;  1NSA A;  4K2X A;  2VPX B;  5C42 B;  3NB2 A;  4F0H A;  4C0H A;  2XHC A;  1NUE A;  2M0G B;  3C8Y A;  3U27 A;  3BEG B;  4F4W A;  1U6Z A;  4BCA A;  2YWW A;  5IT9 U;  4E2F B;  3HSG A;  1EX8 A;  4OJL A;  1ZOT A;  5AE2 A;  4IFY B;  2FJD B;  2V4Q A;  1C1B B;  1RAI B;  2IRY A;  2EC0 A;  5EWF A;  3IGN A;  2CQG A;  3BQ1 A;  2F7V A;  2R2U A;  2X6Y A;  1KON A;  1PGZ A;  3LH2 S;  1JB0 C;  1Q0N A;  2MHE A;  4YFU A;  5E2Q A;  1C0U B;  2JLF A;  5HMW A;  2MYF A;  2B5J B;  3MPY A;  2DKO B;  1I94 J;  1FI4 A;  4UF4 A;  5K8P A;  1UFW A;  3CJQ A;  2V34 A;  2J8K A;  2CQC A;  4CLW A;  3TZY A;  1NHC A;  3MPU B;  2R7U A;  2A6M A;  3GG0 A;  5F3T A;  2E5L J;  1FD2 A;  3CCU S;  2COL A;  4I56 A;  3CJ4 A;  1FEH A;  2CNO B;  4LJM A;  4J9N A;  1I94 F;  2GO8 A;  2GIQ A;  3HVT A;  2BJE A;  4NLS A;  2DRA A;  3ZSC A;  2PDA A;  4PG7 A;  5D15 A;  3KWM A;  3ZZ0 A;  3R7S B;  5B0B A;  3A3O B;  3I5B A;  3CJ0 A;  2E5L F;  1SIW B;  3PKY A;  2QGF B;  1RTJ A;  1Y4Z B;  4QQB A;  3IBC B;  3ETM A;  1C0T B;  2IRU A;  2BDP A;  3UE2 A;  3MM9 B;  3U1N A;  3HZE A;  2VBY A;  1QA1 A;  4C3M A;  1KBR A;  3NGT A;  1X4F A;  2BYC A;  1JLE A;  2CQ2 A;  5DGA A;  5D4L A;  2FJV A;  1B70 B;  1REG X;  2WW4 A;  3M8W A;  2YY3 A;  4RU2 A;  1LWE A;  4B9M A;  4I1T A;  3SYZ A;  4Q8F A;  4XOP A;  5HAT A;  4DV0 F;  2R4F A;  4KH3 A;  2QLF B;  4OPW A;  5HVF A;  2N7C A;  2UXD F;  5KFK A;  5KFE A;  1VK8 A;  4URG A;  2YWF A;  1HI0 P;  5LXY A;  4NLV A;  1WEZ A;  5HMX A;  1HNI B;  4I67 A;  1RAD B;  1FA0 A;  4OI2 A;  1XBW A;  3UDV A;  2CPE A;  1TAU A;  3MMC A;  3JSR A;  2RDJ A;  2E9T A;  2GQQ A;  2V63 A;  4A8Q A;  3MMJ A;  3NBP A;  4AXI A;  4WKY A;  3G6E S;  3FBC A;  3MUT P;  4ZPD A;  3ISN D;  1CJV A;  3J7Y I;  2BQR A;  4OYX A;  1EZG A;  4EO6 A;  4RW6 A;  4FP9 A;  3CED A;  5D0G A;  4L73 A;  2RKI A;  3DLL Q;  4EBE A;  4YY3 J;  1TL3 A;  4MIB A;  2L48 A;  1NHU A;  1F3V A;  1JTA A;  3W9H A;  4OX9 J;  2B4P A;  1X4B A;  3GQ7 A;  1HBN B;  2CPF A;  2JC1 A;  3T5L A;  2M70 A;  4QWD A;  5K9F A;  3SV3 A;  2E1M C;  4DFM A;  4ED7 A;  4M5G A;  4IQM A;  4FXW A;  4OJ1 A;  4WP8 A;  4YY3 F;  4OYA A;  1PG5 B;  3TA1 A;  2ZBP A;  5DJB A;  4OX9 F;  5FD1 A;  1XMB A;  3P45 B;  3MGJ A;  1PJ5 A;  3FNN A;  4CWB A;  3CO0 P;  2NZ4 A;  5K5M A;  1CC7 A;  1Q79 A;  2W9A A;  2VV5 A;  1MRO A;  4UOH A;  1F3F A;  1XR6 A;  2ZFH A;  3UN3 A;  5HO4 A;  4XIU A;  5HAO A;  3I5C A;  1PYO B;  4X4O A;  2DHS A;  4ECY A;  3TO8 A;  3TAQ A;  3W8P A;  4QOT A;  4LF6 J;  5HJY A;  1F5A A;  3HSJ A;  1UL3 A;  3AJD A;  3LGM A;  2QY1 A;  3UQS A;  2MZR A;  4JBC A;  4M5D A;  4FPR A;  3DHX A;  1FK9 A;  3CE8 A;  4F3O A;  1ZS6 A;  3VAF A;  5H1S V;  2IHR 1;  2EBE A;  2YWK A;  3RAM A;  3DRP A;  4C8K A;  4W8S A;  1NU4 A;  1RAF B;  2WAQ D;  3GIK A;  4LF6 F;  2ZUG A;  4DZD A;  1AZS A;  2H5E A;  1WKJ A;  4F3Q A;  2QMU B;  5GAH U;  1TKX B;  1U26 A;  2QXZ A;  2YXL A;  1HI8 A;  2UUW A;  4DSL A;  2XMW A;  4ZVR B;  4B9U A;  2BAN B;  1J27 A;  4DCO B;  2VFN A;  2M4M A;  3E3X A;  4UOC A;  1O88 A;  2MB0 B;  5F41 A;  1HLW A;  1RA7 A;  4F2S A;  1N8R T;  2KFZ A;  2HQG A;  4B3S F;  8ATC B;  2F5G A;  2AGQ A;  4O44 B;  2FVR A;  4WFZ A;  4LRD A;  4ELT A;  1S49 A;  3CD0 A;  5GAE U;  4N41 A;  4USV A;  2XMM A;  3CCQ S;  1Q78 A;  5LL6 d;  1NND A;  1BE4 A;  3UW0 A;  3VQT A;  1X31 C;  4ANE A;  3D6M B;  3RYL A;  5IM0 A;  2I0X A;  4ZP6 A;  3BGU A;  5J1P A;  3KG0 A;  3T1Y J;  5B0G A;  1YQH A;  2BJ1 A;  4ED4 A;  1VJW A;  3SUC A;  2MST A;  4FYV B;  3BB5 A;  4YDT A;  1WAC A;  1R0B G;  1RTH B;  4K4X A;  2YKN B;  1MWQ A;  3M6V A;  3IGV A;  2FZK B;  1QE1 B;  2RF2 B;  5DO2 A;  3T1Y F;  3NNA A;  1L5U A;  1S0M A;  1IB4 A;  2QFI A;  2X1A A;  4I6W A;  2SXL A;  3H4B A;  2J9E A;  4B3T F;  1BUX A;  4KGZ B;  3DMJ B;  3UPF A;  3P49 B;  1FJC A;  1PSD A;  2C3U A;  1RJJ A;  5DDR C;  4C3L A;  5EUH A;  4M95 A;  2FC8 A;  1TV6 B;  4LBP A;  1CZF A;  5J2P A;  3DGP A;  3QGI A;  5DG9 A;  3FBF A;  3T1A A;  4WTY A;  4JRA C;  1K73 T;  1Q8B A;  5BYR A;  4W90 B;  5DGB A;  2EC2 A;  5ETV A;  2APO A;  2HG4 A;  4AVZ A;  1SJR A;  4YUD A;  2BRK A;  3T1H F;  4U7U D;  2CJY B;  3L9Z A;  2IPO B;  1S77 D;  3G87 A;  2HNZ A;  2GAG C;  3LP2 B;  3HUL A;  4TU7 A;  1YRU A;  2IQ7 A;  4ZMM A;  4P2X A;  4FYD A;  1VQ6 S;  2PC6 A;  3KLV A;  2OIH A;  5ITH A;  1HG8 A;  2HAI A;  2UVW A;  1JMT A;  2MZS A;  4B9V A;  2RML A;  1NK5 A;  2HLT A;  3PY8 A;  4IR9 A;  3BN4 A;  1RAB B;  2FPH X;  2OMO A;  1BQM B;  1SC3 B;  4AL7 A;  4GC7 A;  2C2Z B;  2DR7 A;  3DRR B;  2R8I A;  3J80 U;  2C2O B;  2XMV A;  3T9N A;  4F4Y A;  4P71 A;  1RT4 A;  4RBU A;  3ZZO A;  1N6Q B;  3W1Y C;  1YWX A;  3NNC A;  1ZPW X;  2HVZ A;  1HW9 A;  2IJR A;  1OYE A;  4XDC A;  1WC1 A;  4X84 A;  3HFK A;  5DG8 A;  2BAC A;  1X0F A;  2VBK A;  4UST A;  1R0C B;  3JSM A;  2CZ9 A;  3D54 A;  5J2M B;  2W9B A;  1EP4 B;  4GMK A;  1HQE A;  2EG2 A;  2W24 A;  1Y9O A;  1WNE A;  3B4N A;  4GKK F;  4OYB A;  4QU6 A;  3I87 A;  2MLY A;  4ZCI A;  1RXO B;  1P1T A;  4DPU A;  1FDD A;  2B43 A;  2HRU A;  3W65 A;  4X4S A;  5IFM A;  3OBI A;  1QJV A;  1UZD A;  3W3S A;  3T6J A;  2VPW B;  4ZLJ A;  4KHM A;  1M5H A;  2DPJ A;  1L3S A;  1RTZ A;  2CJQ A;  2JEI A;  3BSN A;  3SY2 A;  3GFX A;  5T7L A;  3L95 X;  5CYQ A;  1XQI A;  2Z2Y B;  1HYS A;  1JLC B;  5C24 A;  3OTB A;  2HBY B;  3LP0 A;  2ZH2 A;  1RT3 A;  5KT5 A;  4ICL A;  1TU0 B;  4R5P A;  1HIY A;  2HIQ A;  2B0R A;  2ZD1 A;  2E1R A;  1F1B B;  1VC0 A;  4KKO A;  2BZ2 A;  3IR7 B;  3OJS A;  3MM8 B;  3A8I A;  2BM0 A;  1DBO A;  2X1G A;  5ETK A;  2Q6B A;  2HHT A;  4KTQ A;  1TP7 A;  2HFO A;  3QSI A;  2PT0 A;  2QA4 S;  1SPB P;  1Q1K A;  4DOZ A;  3D2W A;  1WI6 A;  2PGC A;  2GJI A;  2XCP A;  3PJ9 A;  3EGV A;  1N56 A;  4NLU A;  4DDF A;  3H42 A;  5A0Y B;  3FMB A;  1FTR A;  4ZVF A;  1ITP A;  3PFE A;  2JJ4 D;  1GMU A;  1UZH A;  4Q44 A;  3ENW A;  5KFU A;  1CUL A;  4EYH B;  1RU1 A;  1HAR A;  2HWT A;  1YX2 A;  1R8P A;  4OZL A;  3W2V A;  2V4R A;  1IBK J;  2FLL A;  4NYO A;  3P4G A;  5JXS A;  4CI0 B;  4K4Y A;  3EE3 A;  3OTO J;  1CG2 A;  3OR1 B;  1JJC B;  4ECZ A;  1NME B;  1ZAW A;  1RB0 A;  1T9U A;  2YBV A;  3GON A;  3AHP A;  1IBK F;  1CQN A;  3MXH P;  1RT5 A;  1GTE A;  2ROP A;  3JTO A;  3OTO F;  3EGN A;  3ENA A;  3JUR A;  1YVF A;  3MPV A;  3MZI A;  1KN6 A;  4YZQ A;  3TRG A;  3NGR A;  1IKX A;  2NTP A;  4E98 A;  5E3Q A;  2CPH A;  1SH0 A;  5ETN A;  2XQC A;  2F3L A;  4KFB A;  2P9C A;  5EHH A;  5DM6 Q;  4ZIT A;  3BQ0 A;  1U0S A;  4P6Q A;  3EZU A;  1U1L A;  4ZDN A;  2CKW A;  2OPR A;  5L1K A;  2Y8Y A;  2QT7 A;  2KYX A;  5I3Q A;  1M1H A;  1M5P C;  3DU5 A;  2XTJ P;  4CO4 A;  1XN9 A;  3PR4 A;  1Q82 T;  4R8U B;  4ER8 A;  2HWH A;  1KLN A;  1T05 A;  3N90 A;  4WE1 B;  3NWR A;  1BN8 A;  4ECT A;  1KFD A;  1I3O B;  1IKY A;  4DV7 F;  3KKF A;  1QLN A;  1JLG A;  4TQS A;  2RT3 A;  5GAD U;  3LAL A;  1B0T A;  2IC3 A;  3HKW A;  4DR5 F;  4DL7 A;  4CH7 A;  1OJ4 A;  4ES2 A;  1YBA A;  3LAM A;  4HTI A;  2ASY A;  3G71 S;  3FJ2 A;  2BJ3 A;  3CJR A;  5KFJ A;  2IRX A;  4HH1 A;  4DR2 F;  3QMQ A;  3IXQ A;  1Q16 B;  2INU A;  3LTO A;  3ML3 A;  3L4B C;  4ZCK A;  1JLB A;  5ETQ A;  1XTZ A;  2E1A A;  2FUG 9;  1AIR A;  2KB2 A;  4HI2 A;  5K8O A;  5KFQ A;  5RUB A;  2AKW B;  3HMJ G;  1OY9 A;  4CT9 A;  4YP3 A;  1RT2 A;  4LSL A;  4ECU A;  1VQM S;  2VA3 A;  2NXN A;  5J2Q B;  4YEJ A;  3I6P A;  1RTD A;  1XNR J;  1A6L A;  3K8W A;  4O3S A;  3T19 A;  2KO1 A;  1M1K T;  5E5N A;  3GQC A;  2RU3 A;  3PIP Q;  4RL1 A;  2YNG A;  1WHW A;  4IFV B;  3GFH A;  3KLF A;  3D6F B;  3TOQ A;  2PEB A;  3DDI A;  2GW8 A;  3L3C A;  3ZO7 A;  4DL5 A;  1NJX A;  1HQU B;  3GFY A;  1ACM B;  3I0R B;  4NCG B;  4HL9 A;  3D0H E;  1IBC B;  3SCJ E;  2W4P A;  3MTK A;  4DMZ A;  1JKH A;  4U95 A;  2DYA A;  1KSP A;  4DL2 A;  3P5B P;  5L1L A;  5L46 A;  2YQ1 A;  4Z37 A;  1X9M A;  4AXJ A;  3OR2 A;  1K0V A;  1HNW F;  1S4E A;  4NXM J;  1YZ7 A;  4FYX B;  4DUZ J;  2RE1 A;  1VBL A;  3C19 A;  4EZ9 A;  1DZ5 A;  5AE3 A;  1RAE B;  2BOP A;  2PA8 D;  3BYP A;  3ELH A;  1B4S A;  3PYE A;  4O0I A;  4ATN A;  3UNG C;  1XMO J;  3RB3 A;  4ZPB A;  4KB7 A;  3KK1 B;  4OJG A;  1ARO P;  1U1N A;  1O8F A;  1T11 A;  2Z0G A;  1LLW A;  2NS1 B;  4TNO A;  4NXM F;  2BAB A;  2N3O A;  2EKN A;  1SL2 A;  2ZZM A;  3PG9 A;  2BE2 B;  2E7V A;  1VQ7 S;  2OPS A;  3GJT B;  4LFA J;  4RW4 B;  2MKY A;  1TR0 A;  2LU2 A;  1HBM A;  4YHH J;  1WKK A;  4PQU B;  1QAI A;  4UY8 T;  1AFJ A;  4UUW A;  3QGG A;  4DUY J;  4Q7A A;  1NM2 A;  2LLZ A;  1X5S A;  4GVB A;  3R7N B;  4JP8 A;  3C15 B;  1H6K X;  1RHU B;  3A3N B;  3PIO Q;  4P10 A;  2OFG X;  5AJ3 J;  1ZA1 B;  1IKV A;  3TH0 A;  3CJ3 A;  2VUG A;  1PIL A;  1BWV A;  4B3R F;  8AT1 B;  3CME S;  2R7O A;  2LA4 A;  4ZK7 M;  1P6T A;  1OSC A;  2HVH A;  3D0G E;  5LMU J;  1JXL A;  2MSS A;  1VK3 A;  4A8X A;  2NZM A;  5AJ3 F;  2IJN A;  1WTF A;  3V6H A;  4YZX A;  1L3V A;  4RBT A;  3ZXW A;  4ZOS A;  5A8K B;  4K5R A;  3S1T A;  4KV8 A;  2ZJP Q;  3MEC B;  2EXU A;  2GJF A;  3HXM A;  4LRE A;  2NT9 A;  2F8H A;  2V2Q A;  1SB6 A;  1SJ3 P;  4RR5 A;  3EVW A;  2RJZ A;  4EWT A;  2E5H A;  1OY6 A;  4URS A;  3CCJ S;  1BC6 A;  4PAB A;  2IY5 B;  3Q8Q B;  4QPX A;  2YNI B;  2FHO B;  2ZH7 A;  1S9G B;  2WK4 A;  3OHA A;  3W60 A;  1S7H A;  1HW8 A;  5L38 A;  1O8G A;  4ID8 A;  4PWU A;  4NRT A;  4XPE A;  4DSJ A;  3U7J A;  4IG3 B;  3X1L B;  3TEH B;  3VAJ A;  4BLG A;  1IN0 A;  4RNM A;  1S6Q A;  3I5A A;  2HS4 A;  1DQ9 A;  1ZA2 B;  3BF4 A;  4PYA A;  3R5B A;  3QQC D;  1Y5N B;  2DIT A;  2CPY A;  3N6Z A;  3VZI A;  2P5V A;  1SQF A;  1LWF A;  4B9T A;  2O1P A;  4XKV A;  3P6Y C;  4ZN1 A;  4WII A;  1FKO B;  3V6K A;  2XSJ A;  1AT1 B;  2KG0 A;  4ZPA A;  3G9C A;  2HFU A;  4DR4 J;  4DV4 F;  4X4R A;  1TL7 A;  5FLX U;  4HLB A;  4XOT A;  4C0B A;  3Q0A A;  4N8N A;  4EGL A;  3LP1 A;  4QIG A;  2VFQ A;  2IDE A;  4RWX A;  1CPZ A;  2IM1 A;  2NYH A;  2DIV A;  1U24 A;  2R8G A;  4Q0B B;  5J1E A;  4TKT A;  1SL0 A;  3PJX A;  2C3P A;  2P9E A;  3CB4 A;  3JAM U;  2DT9 A;  3VSV A;  5LSO A;  1ROF A;  1HNX J;  3POT B;  2F4V J;  4QIF A;  2HYI B;  1K9M T;  3RW7 A;  4USU A;  5D8H B;  2CG8 A;  3HVR A;  2R2R A;  5IOL A;  1T0T V;  2DNN A;  4WU3 A;  3QT6 A;  1UWB B;  4NLY A;  3KOA A;  3OXG A;  2QZA A;  3Q8R B;  3ILI A;  5A2Q Y;  2XI2 A;  3RTV A;  2I9S A;  4BBY A;  4RNF A;  2ODL A;  2HLU A;  4ZLN A;  2R42 A;  2VB6 A;  1EQ0 A;  3IR6 B;  2H4Y B;  2ADB A;  5CQG A;  1CJK A;  4EO8 A;  2UV8 A;  3KLH A;  4A8Y A;  2H5J B;  9RUB A;  3J81 j;  4RKU C;  1TKT A;  3QRP A;  2CXE A;  2BEF A;  3TZX A;  4DQS A;  2BM5 A;  4NI2 A;  1TSP A;  1WWH A;  2NLW A;  3H2U B;  3JQM A;  3MAQ A;  2XHW A;  1G4C A;  1CJU A;  2GA7 A;  2R7S A;  4O4R A;  3SI8 A;  3SIP B;  1KHW A;  3KK2 B;  4AQY J;  1VHF A;  5KT4 A;  1JIH A;  2BVZ A;  3TW0 A;  2Q6C A;  3IAM 9;  3HX9 A;  1LXN A;  1IQT A;  5BYQ A;  3MD3 A;  1FFS B;  2AX1 A;  1N48 A;  2DGO A;  2CPD A;  1VIX A;  4J9L A;  4C8Z A;  2KI2 A;  2MTL A;  4U6P A;  4DR3 F;  1ZTT A;  2Y0B B;  1NK4 A;  3QBC A;  3M8Y A;  4JOU A;  3DDN A;  1VGY A;  2CPJ A;  3M2V A;  1QTN B;  3W2W B;  4FVC A;  2ZNZ A;  2AWZ A;  3EJM A;  2GVD B;  5THW A;  2A1B A;  2B6A B;  3D9B A;  1V3S A;  4CLL A;  3KHR A;  3CXC R;  3T3F A;  2W9C B;  3UWT A;  3KMQ A;  2DHX A;  5D0R A;  4FDF A;  5C2C A;  3PAC A;  1LW2 A;  4UQT A;  3TA2 A;  1N34 J;  2ZEJ A;  1YIT S;  3FKB A;  3VSU A;  1R6Y A;  2KRB A;  3DOM B;  3M6U A;  5JMN A;  3UVJ B;  4I7F A;  1M5S A;  3X3U A;  2JVO A;  4J9Q A;  1GMW D;  1EAY C;  3FUY A;  1LW0 A;  4XAK A;  3BKU A;  4ZP7 A;  1FNX H;  2MGZ A;  3Q8P B;  2BKN A;  3CGI A;  1N5T A;  2DY1 A;  3U02 A;  3R5J B;  2F1F A;  1F9F A;  4MAK A;  1DAB A;  4P72 A;  3GJQ B;  2AGO A;  4WZM A;  3SQG B;  4A8K A;  1NLK L;  4H4O B;  4PR6 A;  1RP5 A;  2CQI A;  1KD1 T;  4EU0 A;  3AK5 A;  4URR A;  2ZKT A;  1CS4 B;  1TYX A;  1HWJ A;  2KT5 A;  4DV1 J;  1SC4 B;  1A7G E;  2IA6 A;  3ZZR A;  2ZC4 A;  2ATL A;  2J9D A;  5H9F K;  2K3I A;  3PKM A;  1MU2 A;  1ULR A;  3A8E A;  3TAP A;  4JI4 J;  4PG8 A;  1VCT A;  5KG4 A;  5KFW A;  4CLU A;  3D28 A;  2R7R A;  2HPU A;  1C4A A;  3FBE A;  4ELV A;  3IM9 A;  4ETZ A;  5HAN A;  4OJP A;  2KT2 A;  2X1B A;  3NXZ A;  2Q66 A;  4LF2 A;  3W9I A;  4JUZ A;  1FVS A;  1UVM A;  2D69 A;  4IFY A;  1G1X A;  2DY9 A;  2PI5 A;  2KHD A;  1RHQ B;  2W8L A;  2PII A;  2FVS A;  4L76 A;  1C1B A;  4ED3 A;  4JI4 F;  2HEK A;  1ELO A;  2GJ2 A;  4GVL A;  1I51 B;  4LF8 F;  3Q24 A;  5BYS A;  3EQO A;  3AD8 C;  3UN5 A;  1NO8 A;  2PFF B;  4C97 A;  1H73 A;  1C0U A;  1RT6 B;  1HMV B;  4QYZ K;  2WSE C;  3TVY A;  5H9F J;  2QMX A;  2DGT A;  2DNM A;  2HBZ B;  3CJK B;  1QA3 A;  1O8I A;  3IG1 B;  4KHP J;  1VLY A;  3JSY A;  4V02 C;  4H54 A;  1OIA A;  3LOU A;  1OYD A;  4LF4 J;  3CJ2 A;  1TMM A;  3IRW P;  2XTX A;  3LMW A;  2XC1 A;  2M8D B;  2ZHA A;  1NZA A;  2YUH A;  5KFY A;  2QEX S;  4RNN A;  4DV5 J;  2Q3P A;  4OHW A;  1YTY A;  4KHP F;  4CH1 A;  4ILM A;  1N0U A;  2UZA A;  5DS7 A;  3KK3 B;  4OV1 A;  4CM0 A;  4PRF A;  2XYP B;  2OAU A;  4NLR A;  1ZM4 A;  3UDE A;  1LWX A;  3KRG A;  1C0T A;  4LF4 F;  4OZ5 A;  3MM9 A;  5I4M A;  3J81 Y;  3O2I A;  2ZH5 A;  5IQQ A;  4QYZ J;  3H90 A;  3MEE B;  1H2V Z;  4WYL A;  3DDK A;  3TQ1 A;  5KT7 A;  4DV3 F;  4C7Q A;  1ZBT A;  2GIR A;  1F6T A;  1CBK A;  1F9E B;  2VFM A;  5FDL B;  5HMY A;  4MYU A;  3TZW A;  2WON B;  2UXC J;  1X5P A;  4HAC A;  1U1Q A;  3T41 A;  4P9S A;  2E5I A;  4QR2 A;  2DXF A;  3SCL E;  4ED5 A;  1ZPV A;  1MN9 A;  1ICE B;  4LRC A;  1HNI A;  1S1X B;  4PXD A;  2HZC A;  2DNL A;  4YEI A;  1H0H B;  3I31 A;  1TK5 A;  2GHP A;  2DGQ A;  1SKU B;  3ET6 B;  1UFK A;  3R7B B;  4NA3 A;  2NTQ A;  1RHK B;  5D3G B;  3ADA C;  2DNG A;  2KXF A;  3SYJ A;  4LFB F;  4XN0 A;  4YOE A;  4M5K A;  2EFQ A;  1S1T B;  2GC8 A;  4KBI A;  1PIE A;  3VAK A;  2XT2 A;  4MXN A;  3PO4 A;  4HKQ A;  4RLE A;  1V6H A;  2CVE A;  3DN9 A;  5C7P A;  2XUL A;  1CJT B;  3HKZ D;  3LWL A;  3NCR A;  3SFU A;  3MUR P;  2V68 A;  2OKQ A;  2WBM A;  3SSS A;  3V6J A;  3OFH A;  1KLM B;  4J9R A;  4H4M A;  3V6D A;  2PMW A;  1UW9 A;  1U0H A;  5KG1 A;  4RW8 A;  3CW2 C;  3OW2 R;  3CO9 A;  2CNK B;  4B9S A;  1YBT A;  4WFB Q;  3MOJ B;  2G0Y A;  1HWI A;  1JNR B;  1RWK B;  1UWA A;  4Y2A A;  3MM7 A;  3QNW B;  1NK7 A;  2HRT A;  4QCL A;  2YQ0 A;  2P2C B;  4K2J A;  1C1C B;  2YX4 A;  2AX0 A;  2KG1 A;  1KVI A;  3O8W A;  1H3D A;  4O3R A;  4NZ6 A;  3M2U B;  1VQ8 S;  2PI4 A;  2KXH A;  5LSL A;  4J9V A;  1S12 A;  2NXC A;  3DXB A;  3LAN A;  3NNH A;  1TFW A;  4ZHR B;  3CTR A;  4ID5 B;  1W7W A;  3DLE B;  1P27 B;  1TMJ A;  2M5Y A;  1LFW A;  3OVB A;  3WZ0 A;  3GV7 B;  3FCV A;  2ZBQ A;  1H80 A;  2NSB A;  4MR0 A;  3EXY A;  2UVE A;  2AZ3 A;  5D4P A;  1S1W A;  5KFF A;  4CO3 A;  1RUS A;  1RHM B;  5CA5 A;  2V5H G;  1WHY A;  4PPZ A;  2ASJ A;  1SUQ B;  3KMS A;  2XMU A;  1FO1 A;  1XMQ J;  2WHO A;  3WWG A;  1TKX A;  4LF7 J;  3R1H A;  1UP1 A;  4Z03 A;  1O8K A;  4WK3 A;  3IC1 A;  2W2N P;  2BAN A;  3H2L A;  1D09 B;  2JLE A;  4RUA A;  2ZWO A;  3MMB B;  1O5J A;  2BKP A;  5K14 B;  3BS9 A;  4M5J A;  4JYA F;  1XMQ F;  1S6P A;  5M2R A;  4OHV A;  4LF7 F;  4X4Q A;  4O44 A;  2O04 A;  4U67 Q;  1GQ8 A;  3LQV A;  4XLC A;  1YRT A;  2H3E B;  4DR7 J;  2BW7 A;  4JI7 J;  3PX4 A;  3KUG A;  1NDP A;  5DQH A;  4CTA B;  4WFN Q;  4DR6 J;  1FWP A;  5DDQ C;  4QWC A;  1FE4 A;  2V8D A;  2VG7 B;  3W66 A;  3DLH A;  1D8Y A;  3Q89 A;  3SMZ A;  5MLC V;  1RTH A;  3UDC A;  1PC4 A;  4P7V A;  4DR7 F;  4OYM A;  2YKN A;  2O0W A;  4JI7 F;  4ED2 A;  1NB7 A;  1TEL A;  1P1L A;  1QE1 A;  4WWS A;  1HNZ J;  2Z58 B;  5E3R A;  4ZPT R;  4DR6 F;  2QYU A;  3MEG B;  2DRD A;  5IV4 A;  3SDE A;  3OXF A;  1KP6 A;  3DMJ A;  1XNQ F;  1HBO B;  3G96 A;  4WCE Q;  2Z2L A;  4A8S A;  3HSD A;  2HHU A;  3PCO B;  2EWH A;  2CDQ A;  6FD1 A;  3FFI A;  5H9E J;  1TV6 A;  2HS0 A;  2D41 A;  5K20 B;  1S72 S;  2J6S A;  3JQJ A;  1X5O A;  2OUG A;  2NSC A;  3RRK A;  1FKP B;  3BYR A;  1RA6 A;  1TL5 A;  3AY0 A;  3GJR B;  4NCA A;  3ILJ A;  2VG6 B;  2V5I A;  3W9J A;  2HHS A;  4LR8 A;  3LP2 A;  4Y34 A;  3IWX A;  4TY8 B;  2HFS A;  2AYG A;  2XLI A;  3T5H A;  1VI7 A;  3BKT A;  4C2L A;  5JVH Q;  3AA8 A;  2YKO A;  3R9L A;  1OQ3 A;  4Y65 A;  2X85 A;  4OHZ A;  1RTI B;  2ZJR Q;  4ANC A;  3Q86 A;  2UP1 A;  4BDP A;  4JV1 A;  2JOQ A;  3MR7 A;  2BQU A;  2YNF B;  3GIJ A;  3C6U B;  4NWB A;  4EBC A;  3ZTR A;  1RLC L;  2H1Y A;  4YFO A;  2FD2 A;  4BWM A;  4X62 J;  3GFZ A;  1BQM A;  2I5J B;  3I82 A;  2VBE A;  2DGS A;  4PXC A;  3GTY X;  2CQ1 A;  3DRR A;  3M4X A;  2DR6 A;  2M52 A;  4OZJ A;  4OMF G;  4N47 A;  4KPC A;  2VQE F;  5KG6 A;  4ZVE A;  2JL9 A;  3R6G B;  2H54 B;  2OEM A;  4MK9 A;  5IS2 A;  3L7P A;  2V0N A;  3IMQ J;  2DXE A;  3JQK A;  1JJ4 A;  4FKY A;  4EI2 A;  1Y7P A;  1YJR A;  2V69 A;  4X62 F;  1HWL A;  2CZV C;  1NCL A;  1VQ9 S;  3QT7 A;  2XC9 A;  5J2M A;  4DCJ B;  3AQO A;  1MWZ A;  4S0M A;  4OX7 A;  3A13 A;  4KJI A;  2Y1L B;  1D9F A;  2FVC A;  1NJW A;  4BWJ A;  4LIR A;  1YBU A;  3ZPP A;  2LYV A;  4NLO A;  2R7X A;  3LPY A;  5DNS A;  3C3L A;  3RBD A;  5BR8 F;  4JV0 A;  3U1L A;  3MR6 A;  2UUB F;  4IRC A;  3MFI A;  4M5H A;  2OP5 A;  3ZNJ 1;  2D9O A;  1S1V B;  2NTB A;  2C2R A;  5GVQ A;  4TXS A;  3MM8 A;  2QIF A;  4OQJ A;  3GYN A;  2XNQ A;  2K8G A;  4Q8E A;  3FCH A;  1DBG A;  2XZT B;  1DQA A;  1WF1 A;  3C46 A;  3FBB A;  3H4D A;  3NMA A;  2O1D A;  5T14 A;  2J6U A;  2R7W A;  2DGX A;  1D1U A;  1UVL A;  2V9W A;  5L1I A;  2HHH J;  5AXL A;  3WHI A;  2C2E A;  3CDE A;  4Z06 A;  4DI6 A;  4ZPC A;  3KLE B;  4EFA C;  2VIC A;  4OI6 A;  3H98 A;  2ACY A;  2YKA A;  2KDO A;  4DFP A;  2DR8 A;  1SJF A;  2XS2 A;  3GV5 B;  1UEU A;  1MMD A;  1KOH A;  4E8U A;  4WFY A;  2HHH F;  1VYA A;  1Q53 A;  2XYG B;  4TYB A;  4B08 A;  3R8Y A;  3OR1 A;  1SKR A;  2N7Y A;  1U49 A;  1F0X A;  3UD4 P;  3NOC A;  2HQC A;  3IP0 A;  4JI1 J;  3GWC A;  1JLE B;  4CO2 A;  2LEC A;  4K4V A;  3M30 A;  1J5E F;  4U9R A;  5GAG I;  2LVW A;  5B09 A;  4C4W A;  5T41 A;  3VV2 B;  5F8J A;  3J7Y U;  1UVI A;  4FF2 A;  4DFK A;  4F4Z A;  1RCX B;  4P73 A;  3T9G A;  2FGC A;  2VFT A;  3GR1 A;  2UXB J;  4MKB A;  3BGR A;  1YHQ S;  4X65 F;  3W5X A;  3TX8 A;  4FYW B;  3NLC A;  4YR2 A;  4ZN3 A;  2JEG A;  2JZ5 A;  1VBY A;  2WVE A;  4LSZ B;  3K5L A;  4O3O A;  2WVC A;  2FHJ A;  4W98 A;  1M5V C;  1SIZ A;  4WFA Q;  1HPZ B;  2UXB F;  5I42 B;  4X64 F;  1EET B;  3JTP A;  4NK8 A;  4RW6 B;  1RAO A;  2EKY A;  4Z05 A;  3Q8U A;  2ZZN A;  2DNP A;  2RUG A;  4DSK A;  1NRK A;  1XR5 A;  3DLK A;  4ZA1 A;  2JVR A;  3PYF A;  2PMH A;  4I2P B;  1QUP A;  3F44 A;  2WOM B;  1YLX A;  3M2R B;  4OJH A;  3MFH A;  1RT7 A;  4RBV A;  4NK6 A;  4TVA B;  5KFP A;  1MMN A;  2F9D A;  1VBK A;  1JJ2 R;  1EE6 A;  5LJ3 Y;  4OV6 A;  4PUO A;  4DQP A;  4UOF A;  2IDL A;  5LM7 E;  3BSA A;  5KFD A;  4OZY A;  2GML A;  2ZDO A;  2O17 A;  3AT1 B;  5EWE A;  1R8H A;  2Y1R I;  3H5S A;  4DG1 A;  2I8E A;  3NMR A;  5GAD I;  1SQE A;  2KVI A;  2VHG A;  4FF4 A;  1UJ4 A;  1RCO B;  5LSR A;  3V4I B;  2W4C A;  3SEO A;  4ZCM A;  4KHR A;  5J2Q A;  1GX5 A;  2UV8 G;  5HK4 A;  2CNL B;  3VWS A;  3MUM P;  4M5D B;  1NKB A;  1KQK A;  5L8R C;  1DAR A;  2MZJ A;  3NS6 A;  4JI5 J;  3EDR B;  3A3P B;  3S8S A;  3QGP A;  3PRD A;  4IFV A;  2NXE A;  1AZS B;  5U47 A;  3K57 A;  1U2R A;  4OI3 A;  3QID A;  3QT8 A;  4ZS6 A;  5IWA F;  2H5I B;  4ECW A;  3B54 A;  4AT1 B;  2VU5 A;  1QSS A;  7FDR A;  2OTL S;  1S1U B;  2HGM A;  1RWN B;  5KFS A;  3H40 A;  3JXO A;  2DHG A;  3US5 A;  1NAQ A;  4B3M J;  4CNZ A;  3HHL A;  2IAJ A;  3TYT A;  3HCX A;  3CDB A;  3B8Y A;  4I2Q A;  2OI2 A;  4Q2M A;  4ES1 A;  3J7A N;  1FJG F;  1IWA A;  1ZYQ A;  3UCG A;  3IBF B;  3R6L B;  4ED0 A;  2KT3 A;  4NYP A;  3PFO A;  2OGU A;  3ZZP A;  1T9Y A;  5HJX A;  4Y2K A;  3QRR A;  3MTJ A;  1RK8 A;  4PCQ A;  9ATC B;  2DK2 A;  2LQ5 A;  3RBZ A;  2GZO A;  4B3M F;  4OJ6 A;  1UVJ A;  1IM4 A;  1Y10 A;  2H51 B;  1TL1 B;  4J9O A;  2M7S A;  4U49 A;  3OPK A;  1DUR A;  2K06 A;  3G8Q A;  1BHE A;  2XS5 A;  3OFE A;  1Y3J A;  2BE2 A;  1FRL A;  2GQC A;  4U7C A;  4GO7 X;  3VCD A;  2K1R B;  4PXE A;  3M9M B;  2ZVS A;  4PQU A;  1RAC B;  2DEI A;  3KFW X;  1WSR A;  3MI7 X;  3MR5 A;  3KYL A;  2IYG A;  4C9D A;  3VVU A;  3TJA A;  4DSI A;  4P7T A;  1T3O A;  4F0M A;  2B8P A;  3BH7 B;  3EWG A;  3H25 A;  3C15 A;  4C3K A;  1RAH B;  4PAA A;  3C16 A;  2WBR A;  1TYW A;  2DTJ A;  1JXV A;  3BM7 A;  5J2P B;  2IBO A;  5A76 A;  4OZ2 A;  3BRE A;  4WZQ A;  2HFV A;  2YX7 A;  4CP5 A;  1RBL A;  1PO6 A;  4ECV A;  5KT6 A;  2WCX A;  1Q4R A;  3TUP A;  1VQS A;  2XSF A;  5KFB A;  5E41 A;  4ZIV A;  1RHR B;  4DL4 A;  2DNO A;  2WTF A;  2H65 B;  3PRB A;  1T7P A;  2J0Q D;  5A8K A;  2KN4 A;  3EZ5 A;  1HR0 F;  3K5N A;  1EHW A;  2C3O A;  1LK7 A;  4A8M P;  1S7I A;  2K7J A;  3TZZ A;  1IKW B;  4TLQ A;  3D1H A;  1SL1 A;  2YNI A;  1WDT A;  1XEZ A;  2A0F B;  1S9G A;  2X7I A;  2D3O 1;  3MAA A;  2MLX A;  4OFZ A;  2HZV A;  5CH7 B;  4ZJL A;  3MR3 A;  4IRD A;  1O8M A;  2MZQ A;  2V8H A;  3BV8 A;  2EFG A;  3FSY A;  1T9T A;  3KLG A;  4XMY A;  1T94 A;  4F26 A;  4ECQ A;  1S97 A;  3FRY A;  3PW2 A;  5A6W A;  2R8K A;  3VAH A;  2PEH A;  2LEA A;  4DX6 A;  3EX7 B;  3A1Y G;  1UEK A;  4IO1 A;  2QG9 B;  1QTM A;  4B3O B;  4DV0 J;  5I3P A;  3C66 A;  4JV2 A;  1F9H A;  4DX5 A;  2UXD J;  2J7K A;  1XC9 A;  1VRQ C;  2XEX A;  2B4U A;  4Q5V A;  4I4B A;  5HMZ A;  1RIS A;  1PJ6 A;  4JI2 J;  3IR5 B;  2DJW A;  3DOK A;  4OYZ A;  1VRU B;  3MDF A;  5CYQ B;  3OFF A;  5JVG Q;  2C42 A;  1M5K C;  4LUB A;  2JFD A;  2RRN A;  4Q0B A;  4ICL B;  1GTH A;  4ETX A;  2NT6 A;  1X7V A;  4URQ U;  5HLF A;  2N82 B;  4CIO A;  2NPI A;  4P52 A;  3PDN A;  1BWE A;  2RIL A;  1CSJ A;  2PE8 A;  4JI2 F;  3GU0 A;  3VAG A;  2D3O R;  3FC9 A;  2V2Z A;  2B51 A;  1RWX B;  4JV5 F;  2FY8 A;  1WEL A;  2HND B;  1GEH A;  5CCL A;  1IQZ A;  1XJW B;  1U6B A;  2OPQ A;  1ZM3 A;  4Y2C A;  5F0U A;  1QVG R;  3NGU A;  3D1Q A;  3Q22 A;  3OL9 A;  1KKH A;  5C25 A;  1DY3 A;  2DR5 A;  3BN7 A;  4V19 J;  2OPP A;  4CLS A;  4PEO A;  1W2I A;  2E1C A;  2DNY A;  3DGV A;  5CD4 A;  3NGS A;  3O44 A;  2D7S A;  5ETM A;  4JI3 F;  2Z2Z A;  2FJE B;  3W2V B;  3OL8 A;  3DYA B;  1PBU A;  1FTC A;  4OI0 A;  1NHK L;  4KO0 B;  2XYH B;  2CG4 A;  3R5A A;  1SC6 A;  1RQ0 A;  1FEE A;  6AT1 B;  5F9L A;  3M8R A;  3Q83 A;  1N0V C;  4M63 A;  1WTB A;  3C14 B;  1YK9 A;  2DR9 A;  3JSB A;  4B02 A;  4HEA 9;  3GSI A;  2O0V A;  2DIS A;  3SSR A;  3TQE A;  1RT5 B;  3KK2 A;  4RU9 A;  1U25 A;  2YKQ A;  2MHN A;  3PYD A;  2QSW A;  5DM7 Q;  2L3M A;  2LEB A;  1IBM F;  1F60 B;  2LQ8 A;  2XGP A;  4MKA A;  4LVO P;  3FQL A;  3KUE A;  1IKX B;  3QJP A;  2NXU A;  2ROG A;  3L09 A;  4M8L A;  3QYY A;  4I64 A;  2DGW A;  5DLG A;  3ENQ A;  4PXB A;  3MPD A;  2EWE A;  3W2W A;  4C11 A;  2GVD A;  4L3N A;  2B6A A;  1Z1Z A;  2VPZ B;  5F8N A;  3F73 A;  4OYO A;  4XON A;  4DV2 F;  2XY7 A;  3C6T B;  2OPR B;  5HQ8 A;  4EZ6 A;  3HHE A;  3AFG A;  2W9C A;  2ZM6 J;  2B0G A;  1REV B;  2W4D A;  3PSS A;  1NPR A;  2W7O A;  4U4B A;  2W1B A;  3T9Z A;  4D3G A;  5CXT A;  3LYC A;  4OL8 A;  5D77 A;  2EBG A;  1T05 B;  3F0N A;  5AE1 A;  3G8T A;  2LMI A;  2AYM A;  2JX2 A;  4ECR A;  2YQ3 A;  2AD9 A;  4B3S J;  1H38 A;  1JWW A;  2RRA A;  3WX8 A;  4CLK A;  2ZM6 F;  1MWY A;  3DCA A;  4EK2 A;  4KYZ A;  5EWG A;  4Y2I A;  4OZN A;  4IG0 B;  1O51 A;  2E29 A;  2MY8 A;  1NSP A;  1TK0 A;  3SQG A;  3JYT A;  1OOC A;  5ETL A;  2VOO A;  1CS4 A;  4FNI A;  4R0J A;  3MCN A;  2U2F A;  1EQM A;  1APS A;  4AD6 A;  5K8N A;  4ZCL A;  5F9N A;  3EPI A;  1GH8 A;  2MXY A;  3HHK A;  5KFI A;  2R2T A;  4B3T J;  2JSX A;  2DXD A;  2G2O A;  2MDA A;  1K5C A;  5HI7 A;  3CCL S;  2CPZ A;  4OZ3 A;  1TKD A;  3DOL A;  1HI1 A;  4USJ C;  2B7B B;  1KVJ A;  4NE9 C;  2HZA A;  1Q8I A;  1NK6 A;  2IM2 A;  4X4U A;  1KQG B;  4DUT A;  4LRA A;  2AGP A;  1UPM B;  2MQO A;  2YNG B;  2HWI A;  4KSE B;  3KLF B;  3T1H J;  3HVA A;  2CJ9 A;  3AD7 C;  3NOG A;  4DU8 A;  2QYC A;  1DAX A;  1YIJ S;  2CJX B;  1RT6 A;  3FDS A;  2D9P A;  1HMV A;  4DR1 F;  3CCS S;  5B0C A;  3GV8 B;  4CLF A;  2MJN A;  2HIY A;  4HT7 A;  2R8H A;  1SJ1 A;  3LW5 C;  3CJK A;  5F8M A;  1FX2 A;  3IG1 A;  2V4J A;  1YI2 S;  1WF2 A;  4OZ0 A;  2BA9 A;  3D6H B;  3EM1 A;  2EVZ A;  1UCN A;  1VFJ A;  2FGO A;  1PJ7 A;  4R25 A;  3A4T A;  2KYZ A;  5C2G A;  3AJ1 A;  1OS5 A;  5CZX A;  5B0A A;  2C2D A;  3UR0 A;  3SCI E;  3K5M A;  2LU1 A;  3SCK E;  3RUB L;  2HVI A;  1NH7 A;  3V5R A;  1S9E B;  4DX7 A;  2GMJ A;  4NEY A;  1OGM X;  5G0R B;  3HLU A;  4J9K A;  1VBX A;  2GHV C;  2FQQ B;  4Z2X A;  4OZZ A;  2ZHO A;  1RU2 A;  5B7W A;  3T6B A;  2IM3 A;  1VHI A;  4ES3 A;  2XWX A;  2BE9 B;  1VC5 A;  5KOW A;  1HBM B;  2BMB A;  4GKK J;  2XT4 A;  3GQ8 A;  2OEK A;  1R8C A;  3ZTQ A;  2OH2 A;  1X60 A;  4A8O A;  2VBW A;  2ERR A;  5FDL A;  3ILO A;  3FMW A;  2NRE A;  3AA9 A;  3EPG A;  2MY7 A;  3WIU A;  1VQK S;  3A8K A;  4ZVU B;  3CIM A;  1T02 A;  4XKW A;  1TL4 A;  2O01 C;  1F2H A;  4DQR A;  2HHP A;  1BQN A;  1IWG A;  4DF8 A;  4Z7Y A;  2XCA A;  1S1X A;  2BKO A;  3D68 A;  1B99 A;  4RZR A;  4WYW A;  3PR5 B;  2VFS A;  2BE7 D;  4ED8 A;  3RB4 A;  3MM5 B;  3VGU A;  3RAQ A;  4X2B A;  2HK2 A;  2V9K A;  1S76 D;  2B56 A;  4ZP9 A;  2XMK A;  4G6V B;  4XK8 C;  4DSF A;  1S1T A;  1DRZ A;  4C8M A;  2ZHB A;  1RBA A;  2B3T B;  2L9W A;  1WKL A;  1X4A A;  2E7X A;  1SXL A;  4UOG A;  3D66 A;  2YNH B;  4KV8 B;  4Y2M A;  1NSQ A;  1DLO A;  4FZV A;  3CDW A;  1UA0 A;  1T9W A;  4KE5 A;  1NK9 A;  3TVK A;  4C8O A;  4RPF A;  1CC8 A;  3R2D J;  5KG5 A;  2W7P A;  3H8Y A;  1J5O B;  1B0P A;  4USK A;  1X9S A;  4DQQ A;  1JX4 A;  3QSY B;  3KXD A;  1URN A;  3HHL C;  5B08 A;  2BM6 A;  3QZ8 A;  2ADC A;  4EUV A;  2EG1 A;  2AT1 B;  3G6Y A;  4RW9 B;  5A2Q U;  1Y5I B;  2ZE2 B;  3MOZ A;  4J37 A;  1FRJ A;  4LF5 F;  4G1Q A;  2ZWP A;  4C48 A;  2MKK A;  3EGZ A;  1C1C A;  3ZZZ A;  2YKM A;  3JB9 k;  2RHS B;  2UU9 F;  2VBX A;  3M2U A;  3PO5 A;  3VAI A;  4HHH A;  2KVQ E;  1KS2 A;  2MKH A;  3NAI A;  5AXK A;  4YEA A;  4B17 A;  4WFX A;  4NX9 A;  2F9J A;  4ID5 A;  3M8S A;  3RGI A;  4PMH A;  4UW2 A;  3OTC A;  3K58 A;  3BBB A;  5E3P A;  5EX0 A;  2KTQ A;  1PYS B;  2HGL A;  5F8H A;  2CQH A;  3IWL A;  2C3M A;  4LRF A;  2E5G A;  3O3L A;  5DZ6 A;  1AFI A;  1AXQ A;  2QA1 A;  1MLA A;  1JXE A;  1N33 F;  1M0S A;  4F04 B;  3HFV A;  2GCF A;  1V5V A;  3KNG A;  3RBX A;  4DS5 A;  1ZM2 A;  4NYZ A;  4M5N A;  3O1L A;  3PEH A;  4C2M A;  1PAE X;  3DRX A;  3F41 A;  1LEO A;  2C1E B;  3DM2 A;  2INV A;  1S9F A;  2XTY A;  3HHL D;  1U1M A;  3I55 S;  1T9V A;  3AOD A;  3HM9 A;  2VKZ G;  3RBE A;  1QQ1 A;  5D78 A;  3FEX B;  2QZ8 A;  3MMB A;  2EK1 A;  1CLW A;  5K14 A;  1Q8L A;  1SV5 B;  2J6T A;  4MIA A;  4DJB A;  1QY7 A;  2AV5 A;  5J2N A;  2HW3 A;  3AOC A;  2CJB A;  2LA6 A;  4JI8 F;  4DV7 J;  1VBZ A;  5AXN A;  3OHB A;  1TYU A;  2QLJ B;  3DC2 A;  2GV1 A;  1Z2L A;  4DR5 J;  3I9Z A;  4M5I A;  3SV4 A;  1PCA A;  4CTA A;  4HHJ A;  3FEZ A;  4FPI A;  3HDS A;  3OLA A;  2ZJQ Q;  1CJK B;  5ETS A;  4KRW A;  3BSC A;  1D0E A;  1VJQ A;  2ZZT A;  1TKT B;  4WBF A;  3WC0 A;  1LWC A;  4CYU A;  1DTT B;  1O8L A;  4DR2 J;  2VJJ A;  3VGS A;  1URR A;  3NGK A;  1VRT A;  4K4T A;  2RS2 A;  4OI1 A;  5KFN A;  1H98 A;  4NZ0 A;  1RDR A;  4ERD A;  3F56 A;  1TTH B;  2IA0 A;  4Q43 A;  2XM3 A;  3UCU P;  1HBO A;  3MED A;  4JI0 F;  2MQ8 A;  1HBU B;  3KNA A;  3EYZ A;  3WX4 A;  3OFG A;  2VQF F;  4Q2L A;  3ZNU A;  2Z4P A;  1KDN A;  3PXG a;  1O8E A;  1G2E A;  2EW9 A;  4HT5 A;  2ROE A;  2IIH A;  4DF4 A;  4B9N A;  1GXT A;  4ECS A;  4NL5 A;  1FKP A;  3VQS A;  4AL6 A;  1S57 A;  5KG0 A;  1WC6 A;  1FNM A;  2NPF A;  4N77 A;  1VQN S;  2X1F A;  4LQ3 A;  3D3C J;  2BUN A;  2DNZ A;  2J8S A;  3M2V B;  1T8E A;  2Y1J A;  4CO5 A;  4NLP A;  5C1E A;  5CZV A;  4ZPW R;  2LQB A;  2L9N A;  3EIC A;  1E6Y A;  5HL7 Q;  1IBL J;  3TP2 A;  4XN3 A;  4OHX A;  3BO2 A;  1FHT A;  3RU0 A;  1RTI A;  2O6W A;  3H5X A;  2V50 A;  4I7F B;  2YNF A;  1HNW J;  4PQA A;  3C6U A;  1WOS A;  4YB6 A;  3QWP A;  1LW0 B;  3M8P A;  3MUV P;  2XZD B;  4MFB B;  1KNZ A;  1HFE L;  3E01 A;  4C8Y A;  1IBL F;  1RWW B;  3KJF B;  4ZVH A;  1UPP A;  2IMW P;  1NK8 A;  1SH3 A;  1FRK A;  4LF1 A;  2IVM A;  1B0V A;  3CJ8 A;  1Y00 A;  2FJX A;  2F65 A;  3LO3 A;  2V6A A;  3QRQ A;  1RAA B;  4R0E A;  4XLH A;  1SVD A;  2ZBR A;  1OMS A;  3CDU A;  1XER A;  3PNI A;  4OJO A;  3J81 U;  4P75 A;  4CRJ A;  2FC9 A;  3B6B A;  1IVZ A;  3ONQ A;  4Y6I A;  4OJ3 A;  4C0O C;  2LXF A;  4DPT A;  2UVU A;  3M8Q B;  4DV6 F;  2VA2 A;  1LLZ A;  1UA1 A;  1RWM B;  2EPI A;  3TJ9 A;  2EFP A;  2AJ1 A;  2WSF C;  4PWD A;  3NL0 A;  2HVE A;  1AUS L;  2RU9 A;  3M6X A;  3Q8S B;  4BHQ A;  1IUJ A;  5E33 A;  1R31 A;  2R3V A;  2UUA F;  1FJ7 A;  1PE9 A;  1FCA A;  4BS2 A;  1DTQ B;  3KJN B;  4WP9 A;  4B3R J;  4ILL A;  2JFK A;  1TKZ B;  4MJK A;  3NG8 A;  2XB2 D;  1JNZ B;  1AA1 B;  5IV3 A;  2RDI A;  1S1V A;  3DLG B;  4P2M A;  4ZVQ B;  5I3U A;  5KFL A;  4MT1 A;  3D5M A;  3PHE A;  1Y5L B;  4KC5 A;  1UMJ A;  4LR9 A;  4RNH A;  1TZ0 A;  3WC2 A;  3DHW C;  3UNY A;  3TAM B;  2DRB A;  1O8J A;  5E0O A;  2E66 A;  5B0E A;  1IJE B;  4YR0 A;  2W25 A;  5KG7 A;  5KTQ A;  2KXN B;  2OFH X;  3UR3 C;  4YCQ A;  3IA0 A;  3IBW A;  3KLE A;  2RNE A;  1KQF B;  3KJV A;  2J8A A;  3N01 A;  4PYD A;  4K5S A;  3D4J A;  3VAM A;  3RR7 A;  1E6V A;  1M1G A;  3ISN C;  3SZE A;  4YZA A;  2IVF B;  3M32 B;  3GP9 A;  2ZH8 A;  4JI6 J;  2OEJ A;  2DH8 A;  2LKZ A;  2VKR A;  5KFX A;  4RUB A;  3V4M A;  4L3K A;  3MM6 B;  3O5T B;  2LCW A;  2HQD A;  2ASL A;  3OTD A;  2W7Z A;  2EFO A;  1Q95 G;  4JI6 F;  5EGY A;  4NZ7 A;  2GVZ B;  1YZ6 A;  5HSP A;  2W2M P;  4F3M A;  3G82 B;  5CD4 H;  4HAC B;  1U8W A;  2AJQ A;  4N5S A;  4U96 A;  5HBM A;  3CCE S;  1XIQ A;  3EVO A;  1ZH5 A;  3VZH A;  3SQV A;  2P8I A;  3CMQ A;  4DV4 J;  1FXR A;  4M5M A;  1H2T Z;  2I2Y A;  1FWK A;  4YDD B;  2CQ3 A;  3MCS A;  2FHK A;  3IO1 A;  3GYX B;  2VFU A;  1Y11 A;  1RYR A;  1U1K A;  2GGP A;  2W7A A;  2UVR A;  1IJF B;  2BJ9 A;  1KR4 A;  1HPZ A;  4YB1 P;  4IO9 Q;  3QIP B;  1WG4 A;  5I42 A;  2R7V A;  1X4C A;  2XMT A;  1EET A;  1MSW D;  4ZJQ A;  2VL1 A;  4NLT A;  3MHY A;  3LJY A;  3ENV A;  3OL7 A;  5A8W B;  3GQ9 A;  4MIW A;  2ZUA A;  4RW7 A; 
#chains in the Genus database with same CATH homology
 2XC1 A;  3Q8Y A;  3VGS A;  1WKJ A;  3ZTQ A;  1NCL A;  5CAA A;  4UOF A;  1PAE X;  2YUH A;  3BH6 B;  3SYJ A;  1PKU A;  1XQI A;  4C6A A;  1TYW A;  1NB2 A;  1LEO A;  3FC9 A;  1W7W A;  4S0M A;  3ZTO A;  3VGT A;  3EMT A;  1NSP A;  1NDC A;  4DZ6 A;  1JXV A;  4KH3 A;  2V5I A;  1QA2 A;  2HVD A;  3FBE A;  3L7U A;  2J8I A;  4W98 A;  2BM6 A;  1HIY A;  4OPW A;  3FCV A;  1BUX A;  2BM4 A;  2B0R A;  4DI6 A;  4OJP A;  2W7Z A;  1NDP A;  3FKB A;  5CAB A;  1WKK A;  2VFQ A;  2BX6 A;  2IOU G;  3EVW A;  3NGU A;  3Q8V A;  2BEF A;  3G2X A;  1LWX A;  1QQ1 A;  2BM5 A;  2VFN A;  3DDI A;  4CP5 A;  2AZ3 A;  1NDK A;  1B99 A;  2DY9 A;  4HR2 A;  2NCK L;  1TSP A;  1CLW A;  5C7P A;  1KDN A;  1HLW A;  3EM1 A;  4UOH A;  2BM7 A;  1F3F A;  1U8W A;  1UCN A;  3ENA A;  3H09 A;  3MPD A;  3Q89 A;  5JMC B;  3VGV A;  4OJ6 A;  4F4A A;  1WXR A;  3ZTS A;  3R9L A;  3FBF A;  4JRA C;  3JX8 A;  3JS9 A;  2B8Q A;  3VGU A;  3PET A;  1XIQ A;  3ZTP A;  1QRB A;  3Q8U A;  3EVO A;  4ANC A;  1NPK A;  3Q86 A;  1VYA A;  1S57 A;  3NGR A;  3EVM A;  2DYA A;  1F6T A;  1K4Z A;  5BXI A;  1S59 A;  2VFM A;  2VFO A;  1DAB A;  1MN7 A;  4O0N A;  3NGS A;  2CWK A;  1K44 A;  2DXD A;  3FBC A;  4F36 A;  4ENO A;  1BE4 A;  2F3L A;  3ZTR A;  1HF2 A;  1TYU A;  4OJO A;  1EHW A;  1NUE A;  3PJ9 A;  4FKX A;  3TH0 A;  2VFP A;  1NSK L;  4ANE A;  1QRC A;  3LYC A;  3ML3 A;  1NHK L;  4OM9 A;  1NLK L;  2G0Y A;  2DXF A;  3PRV A;  3BBB A;  5JLV C;  3B6B A;  1NDL A;  2HUR A;  5IOL A;  3RIQ A;  1WKL A;  4KPC A;  4OJL A;  3AK5 A;  3ETM A;  1MN9 A;  1QA3 A;  1ZS6 A;  3ELH A;  4OJ5 A;  1B4S A;  4UOG A;  1TYX A;  3FCW A;  3Q83 A;  1S5Z A;  1KQ5 A;  3DKD A;  1QA1 A;  4V02 C;  3EIC A;  3NGT A;  3B54 A;  2HVE A;  3SZE A;  4DUT A;  3BBF A;  1NSQ A;  1TYV A;  1K8F A;  2VU5 A;  3GP9 A;  1HHQ A;  4AND A;  3VVU A;  3WX8 A;  1BHN A;  3N6Z A;  3EJM A;  3LJY A;  3BBC A;  2DXE A;  4FKY A;  3FBB A;  4WBF A;  4EK2 A;  3VVT A;  3GPA A;  3N90 A;  3P4G A;  2B8P A;  2ZUA A;  3EE3 A;  2AZ1 A;  3BH7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...