3BH7B

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
total genus 103
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh7B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh7B02
3FCWA 3BBCA 4UOHA 3ZTRA 1MN7A 2DXFA 4O0NA 1PKUA 4S0MA 3FCVA 3BH7B 1NSPA 1HLWA 4C6AA 1NLKL 2HVDA 3PJ9A 1BHNA 1NUEA 3DDIA 4FKYA 4EK2A 3Q8YA 3MPDA 1WKLA 1UCNA 1NDKA 1XIQA 1B4SA 3R9LA 4WBFA 3VGVA 4DZ6A 1VYAA 3BH6B 1NDLA 1WKJA 5IOLA 1HIYA 4UOGA 2DYAA 3NGUA 3FBBA 3ZTSA 2HVEA 3ETMA 1U8WA 3EICA 3EMTA 2CWKA 4DUTA 1S5ZA 2DXDA 2B0RA 2B8QA 5BXIA 1K4ZA 3EVWA 3ENAA 5C7PA 4W98A 1NB2A 3EVOA 3JS9A 2ZUAA 1K44A 1NDCA 2NCKL 3ZTOA 3FBFA 3Q83A 3B6BA 3FBCA 4DI6A 4ENOA 4CP5A 3BBFA 1HF2A 3GPAA 3VGSA 3ELHA 3G2XA 1NSQA 1NHKL 1XQIA 1JXVA 3B54A 3EM1A 3NGTA 3ZTPA 4F36A 4UOFA 1B99A 1K8FA 3VVTA 4FKXA 1KQ5A 3Q86A 3NGRA 1F6TA 1ZS6A 1S57A 3WX8A 3EE3A 3Q8UA 3FBEA 5CAAA 2HURA 4V02C 4HR2A 3NGSA 4ANCA 1NCLA 1BUXA 1MN9A 2VU5A 3FKBA 3GP9A 1LWXA 1NPKA 1W7WA 2AZ3A 2DY9A 1LEOA 2BX6A 4ANEA 3VGTA 1PAEX 3BBBA 4F4AA 3VVUA 1KDNA 1HHQA 1EHWA 3FC9A 4KPCA 1BE4A 4ANDA 5CABA 2BEFA 2YUHA 1S59A 3EVMA 1NSKL 3PRVA 3Q8VA 1WKKA 2DXEA 2B8PA 1F3FA 3VGUA 3L7UA 2AZ1A 3DKDA 3EJMA 3ZTQA 3Q89A 1NDPA
chains in the Genus database with same CATH superfamily
5DLFA 3QATA 3BO3A 1FWLA 4RLEA 2RT3A 4O4RA 5LJ3Y 2MKKA 3NGDA 3Q24A 2UUCJ 5KFEA 2HHQA 2VL1A 3R5BA 1MN7A 4KY3A 4MH8A 4BC9A 2OTLS 5HANA 4WCEQ 3LOUA 4I2PB 1DRZA 4NCGB 3IRXA 1U1NA 3PSZA 1BHNA 3SY2A 3VV2B 4JI8F 3CCWA 4XN0A 2K1RB 1TR0A 3EWGA 2CPXA 4CT8A 2PD1A 1QVGR 2FVQA 2CQPA 2GIRA 1RWXB 3GSDA 1RAJA 2FB0A 1OQ3A 1KQFB 4DPWA 4DQSA 1N6QB 2HHHF 2CPIA 2BMBA 2X3HA 3M8QB 4IH6A 4NLQA 1OYEA 3OFHA 3QFWA 4P74A 4QJVA 4EYIB 3NB2A 3LPEA 2RS8A 1WHXA 3KLFA 1VQMS 1U24A 1KHVA 4J9VA 2PIIA 1LFWA 2PI5A 1S0OA 5A8KA 1IBKF 5AE2A 3ETMA 2J8KA 3KLFB 1U1MA 5CYQA 4IOAQ 4PEOA 3W9HA 2HYIB 4N7TA 3Q2TC 1NJYA 3KYLA 2G13A 4IOCQ 1DLOA 5DRKA 4BCAA 2FJAB 5B08A 4YY3F 2VFUA 3KK1B 3MURP 2ASDA 4XLEA 1PC4A 3KOAA 1RU4A 1F9EB 2BQ3A 1KC8T 2FC8A 4NLTA 2POKA 4E8UA 3RW6A 1HI8A 3CGIA 1K44A 4R25A 1RAIB 1TL5A 5KFFA 2R8HA 1KQSR 2DGOA 4G1PA 3H5XA 1FDBA 1U09A 4ITSA 4ECZA 2C2NA 4HT5A 3TW0A 4DI6A 4F0MA 4G1QA 3O3LA 4P2XA 4CP5A 1SB6A 2BANB 4DHVA 4RUCA 1L3TA 2EFPA 3DLGA 5L1JA 4X4VA 3WQPA 1APSA 2OPPB 4R8UA 1WF2A 4Y65A 3TANA 3MR6A 1JX4A 2LDIA 3LAMA 2DNLA 3N90A 2MZTA 1NJIT 2DR7A 2K3KA 2Y8WA 3QLHA 4OJGA 2AYGA 1ZM3A 1AFIA 1C1BB 2DHSA 3QRQA 4PXBA 3EQNA 1NH7A 5E3RA 4RU9A 4NLWA 1N36F 4KKOB 2VJJA 4KGKA 4AXIA 4F36A 3C15A 4LBIA 4DL5A 1M5SA 4OZ2A 4ZCKA 4OHXA 3LALA 1LWCB 2CQBA 2GHPA 2QMUB 3NGRA 2UUBJ 4YR0A 5KFVA 4LRCA 4ZLNA 2ZEJA 1DTTA 2ZWOA 2F8MA 5D15A 1H7WA 4KKOA 4M5JA 4FF2A 1JJCB 1Y11A 3PG9A 5J2QB 2MQNA 4JI0F 1KLMB 2ZH7A 1O8LA 4OX6A 3TNVA 4PCQA 3MUTP 4J9SA 1T03B 1WG1A 3MEGA 1XMBA 2ZHOA 5D0EA 4ZIVA 2DGUA 3CPWR 5ETSA 4LSZB 3RAXA 4JI5F 2RU3A 5LMUF 4EUVA 4OYOA 2DY9A 3CD5A 5EX3A 2I8EA 2QX0A 2W9BA 4CLYA 3RB4A 3L7OA 4W8TA 4IOBA 4NYZA 1T9UA 4K8RA 4PG7A 4L72B 5HJYA 2KYXA 2XS5A 4ILMA 2PT0A 4DV6J 3KUGA 2BQRA 2B56A 2YWFA 1RAOA 4NLYA 5I3UB 3HM9A 1ZTWA 3B90A 4RBVA 2VJUA 1RHJB 5F8JA 2JEJA 3QSYB 2W8LA 2LP4A 2O1PA 3UD4P 3PNIA 5EWGA 3GIMA 2YXLA 1SUQB 5A6WA 1RTIB 2VG6A 5EUHA 3IBFB 3QWPA 2INVA 1M1GA 2QFJA 3BSNA 4EBDA 2ACMA 3QWUA 1D1UA 1S48A 3ENWA 5CD4H 2R2TA 4QWCA 5HLFA 1MWYA 2CVEA 3M8QA 5D78A 5LM7E 3OTEA 2GHWA 2DXFA 3GMGA 4KC5A 4RBTA 1N6QA 4YZXA 3M2UB 2EG1A 1F5AA 4IYQA 4F67A 3CMQA 1HLWA 3A8KA 1N5SA 4RO0A 4DV4F 4C0OC 3PJ9A 4B3TF 4LFBF 1DJ0A 1UZHA 2DGWA 3W62A 4QWBA 4FF1A 3Q8PB 4J90A 1N5YB 4U8YA 1N34J 2X7IA 1IUJA 1KVKA 2MKCA 3HDSA 4MIBA 4P7VA 3M9OB 1S1TA 5C24A 5HATA 4OHVA 3BH6B 3OSPA 1UVMA 2B9YA 1WKJA 4RW7A 4ZVUB 3AB4B 3KLHA 2YH1A 5ADZA 2MQQA 1GXUA 3DHWC 1IR2A 4XORA 1HIYA 2DRDA 2MLZA 3LGHA 1RGVA 3NL0A 4RW8A 1JLBB 2R7RA 3BGOP 2GIFA 4EGLA 3NG8A 1S79A 5AXMA 1PJ5A 2IIHA 1B0PA 2MQLA 4XKWA 1FI4A 4KE5A 1JLEB 3MOZA 3P8BB 4KGMA 2ZJPQ 2Q3PA 4MJKA 3RB3A 1QSYA 1SC4B 2EKNA 2KFZA 1FXRA 1U7LA 4XM3A 2XSJA 4RW4A 4XR6A 3UW1A 3JSMB 2G0JA 2BKOA 4WZQA 1TL1A 2ASYA 3VSUA 3WWGA 1RTJB 1YVFA 1VRQC 3N9UC 2DNRA 2CJQA 2LXIA 1MMLA 2ZOFA 3S01A 1XNRJ 3RYLA 3NLCA 1YX2A 5B0AA 3W2VB 3JSYA 2F3JA 1BY9A 2XYHB 1XJWB 3B6BA 3AD9C 3S1TA 1U1OA 2CZ4A 2Q6CA 4AE5A 2DHXA 1KCCA 1WD6A 2OD4A 4F4KA 5DG9A 2WB1D 1RA7A 2GVDA 1OQ6A 2FVPA 3IAS9 1NHKL 1RT6A 3A3NB 2RNEA 2JFDA 3VQTA 1WF1A 4QIGA 4NMLA 4PZVA 3AHPA 4NYPA 3HHLB 3W2WA 5GMDA 2B0GA 3BJYA 1IBKJ 1X5TA 1SCJB 3CDEA 3CJ2A 3CJ0A 4X4RA 4LF6F 4WYWA 2HBQB 2AX1A 2B43A 5FDLB 5HROA 4MFBA 1VQKS 1VQOS 4OX9J 1TQLA 1R3NA 2Z8QA 1RAHB 1IKXB 2VONA 3QJLA 3HI9A 2ZBPA 2LQ8A 2XBPA 2V94A 3HD2A 3OXLA 2QLJB 3CDBA 4ZN3A 2E5IA 4DR1J 4NXMF 1CBKA 4ZOSA 3L9ZA 1T94A 1F1BB 1G3OA 2YKMA 1RKIA 2CYYA 4F3QA 7FDRA 2XNRA 4DQQA 3DLLQ 2XY6A 1SI9A 1R8HA 2MPUA 2NYHA 3D6HB 3PX0A 3DFEA 2G2ZA 3MTKA 2OPPA 4R8UB 1T02A 1VQNS 4PXEA 3CJ3A 2BJ9A 2V68A 5F8HA 1S4EA 3QGPA 3D68A 4MK9A 5F3ZA 2XO6A 3SEOA 2HFVA 2XMJA 3A8JA 4Y28C 5KG3A 3FKBA 2HW3A 4Z7CA 2NQPA 3ILOA 1VQSA 1XMOJ 1M1KT 4Z37A 1W26A 4DFPA 2H5JB 5KFUA 4DLGA 3N6NA 3HHLD 4B9SA 3GG1A 2W9CA 2DGTA 5C25A 1U48A 1SVDA 4DR4J 1S0VA 2HWHA 2J9DA 3NOCA 2E5GA 1O8FA 1DLOB 2CADA 4I1TA 4DV1J 1VQYA 4CO2A 5JVHQ 1HBMB 1H7XA 1D9DA 2HMIA 3EZ5A 3WZ0A 4WK1A 1Q95G 4HHUA 2GQ2A 4HYKA 2X6XA 1Q8BA 3IGNA 4ZPTR 2YUHA 1OFEA 3DRPB 3SI8A 4CNYA 2UVRA 2QO3A 5IT9Y 1WKKA 4P6QA 5EHHA 1F3FA 3VGUA 2QT7A 4DR7F 1WOSA 2AZ1A 1T0TV 2JOQA 4DR7J 2CNOB 1HQUA 1UVLA 2FUG9 4TU8A 4A48A 1V3ZA 1FD2A 5CQGA 3V81B 3ICLA 2UXDJ 2GHVC 3AXMA 1LW2A 1WOPA 3G8TA 1QTNB 5D77A 4KGVB 3BR8A 2VBKA 1JLFB 4YELA 1SPBP 2KT5A 4AL5A 2GVZA 4DQPA 4LF2A 3I32A 3K5OA 3LW5C 1XC9A 1L3UA 2IBKA 4KO0A 1CJKB 1WELA 2CQGA 2OPSB 1MMNA 3HZGA 4P7TA 3QT6A 3TA2A 4DZDA 4ED7A 4LFCJ 1X5OA 4QPXA 1TL7B 3IAM9 5HSPA 2FVRA 2LEPA 2EPIA 5KFDA 4A8SA 4O23A 5HN0A 4XQFA 2D74B 3EDRB 2KG1A 1HNWF 3MR7A 1NK8A 1RYRA 2ZM6J 2KM8B 2J9EA 5T41A 2EXUA 2KN4A 2KYZA 2VFMA 1FKOB 5KFMA 4B9NA 2FHJD 2BM4A 3THTA 4WTOB 2ZH6A 2HPUA 2YWHA 3C66A 3VHQA 1UVJA 1TV6A 3AOBA 4RW6A 4LF7F 1G1XA 4JBCA 4KGZB 4YFOA 2Z2LA 2FLPA 5GAHI 1SKUB 2N7YA 4HI1A 4PG4A 3UDVA 4B3SJ 5IM0A 2A0FB 2VBWA 2OKQA 4FXVA 2QFIA 5IC4B 3G96A 4J9KA 4UUWA 5HMXA 4DV7F 2YBVA 1FVQA 1M5VC 4FDFA 3T5JA 3BYRA 4EWTA 4PYDA 1JLGA 1Q79A 2OSQA 4DPTA 1F5CA 3CJQA 1FXLA 1HNWJ 2V8HA 2JHEA 3H5YA 4LF6J 4A46A 1R0BG 5HP1B 1N52B 2NUHA 4ALZA 4NYOA 4ECQA 1RCOB 4OM9A 3GB0A 2VQEJ 1Q78A 3FDSA 1TKTA 2B7BB 3QRRA 1LV5A 2HFOA 3LMWA 4NEZA 4B9VA 2VPYB 2J7UA 1C0TB 2Q1LA 3BZQA 5THWA 4GC6A 4CT9A 3SZ2A 1A0OB 5IFMA 3PVXA 3QGHA 1FXDA 4MT1A 4FNHA 4EW9A 3DOMA 4DUZJ 2G4BA 4MAKA 1OJ4A 5HMWA 3BEGB 3O2IA 2DEIA 2BW7A 1DTQA 2IM0A 1MWZA 2JSXA 3VVTA 2WK4A 2PFFB 2XS7A 3NBPA 1UW9A 3PV8A 1KQ5A 3K0JA 5K8NA 3M30B 4LJMA 2ZJRQ 1D8YA 3H20A 2NR0A 1ZS6A 1R0AB 2GW8A 3C15B 3PYGA 3S8SA 3R97A 3C3LA 5KG7A 1G2EA 1TZ0A 3GFXA 3OL8A 4NMXA 1RT6B 4ECRA 2J6UA 2QL7B 3CDAA 4YN3B 3VAKA 4K4TA 3W8GA 2F3LA 2B4PA 1N0VC 1JRGA 3N6LA 4AT1B 1S9GB 2KHDA 4BHQA 2MEWA 5GAGU 3ISZA 4LF4J 4ICLA 2FGCA 1Q82T 1FRIA 1CS4A 3DOKB 2P6SA 3TVYA 4A8YA 1RQ0A 2KRBA 1GH8A 2BJ3A 2OSRA 1IQTA 1AZSB 4XN3A 2DGVA 2NXJA 1BXNA 1V5IB 1CJTB 1Q5VA 3G82A 5HJXA 4ANEA 2Y1LB 1CQMA 3SDEB 1Y3JA 3DRSB 3POTB 4UQTA 3ZZPA 4YDXA 2KH9A 3GIJA 3GRHA 4MXNA 3CCRS 1Q81T 1VBKA 2MSSA 2C3YA 2Z0GA 4URRA 3PHTA 4O0IA 3OJUA 1DQAA 3CVKA 2IM3A 4DV4J 4LFBJ 1IKVA 3BQ0A 1YZ7A 3J80U 2UVFA 4B08A 1HHSA 1U1LA 4CTAB 2UXCJ 2CQCA 3MCMA 4M5DA 1CPZA 3J7ZT 2FIUA 3BV8A 4ZLJA 2MZ1A 4QWAA 2M70A 1HQ2A 3T5KA 2J7WA 1CJVA 3TYTA 3JAMY 4XONA 1V6HA 2IQ7A 3DYAA 1F9HA 4WIQA 1I6JA 2UUBF 3V4MA 5G0RB 4PG8A 2WBRA 4IG3B 4IFYB 2YVSA 4HACB 1HYSB 5ETQA 1QAIA 2DHGA 2MTLA 4KQZA 2ZC3A 3QGGA 5B0FA 2N4CA 4DV3J 1DZ5A 1BWEA 1LW0B 4FN5A 4B9UA 3CULA 1VS3A 2OPQB 4HL9A 1X4CA 3SFGA 1NKBA 3DOKA 1CS4B 1YKWA 2RDJA 2JEGA 4KFBB 2DNPA 4ES1A 2GO9A 2G0YA 4XLFA 1NUEA 2H65B 2JVOA 4OHZA 4RUAA 1PIEA 1RTZA 1SJQA 2FVCA 2OPRB 3PSSA 1ZM9A 2CKWA 2HWIA 2N7CA 1DBGA 2LQ5A 5HO4A 2VD3A 2J0SD 3JAMU 3NP5A 4WTYA 2LDYA 5I4MA 1QY7A 1QM9A 4M5KA 5DQGA 1N54B 3HJVA 1XTZA 3GWCA 2W7PA 5HMZA 2QSFA 2Z58B 2ASJA 2FC9A 3PRDA 1S97A 1K47A 3MMAB 2DYAA 2APOA 2A18A 2G1DA 4L3KA 1DTQB 4PXCA 2D3OR 3OFGA 4OYPA 2H9ZA 2H4WB 2RHQB 4H4MA 2NXNA 3UVJB 4K4XA 2CUYA 1KQGB 1T9WA 2YKPA 5L38A 3BGRA 3N6ZA 1S5ZA 1P1TA 3ITHB 3CJKB 1FEHA 4KIAA 1ZAWA 4UOCA 4OJOA 2IJFA 3MEKA 1DBOA 2H3EB 2XEXA 3ENAA 3PFOA 3LP1B 1C0TA 4M5NA 1YQHA 2DH7A 3CCQS 1QUVA 4RKUC 1PYOB 3OTBA 5EWFA 3EPGA 1HNZF 3VSTA 1VCTA 1YK9A 2VASA 1UFLA 2LXFA 2QG9B 2VBYA 1BN8A 1U0HB 1NPRA 2WONB 2ZUAA 4K5SA 4Y2MA 4ED3A 2QE5A 5HI7A 4OFZA 5LSRA 3K17A 2GQQA 4I69A 3CD6S 4JV5F 1Q4RA 4TLRA 3TVZA 1GMWA 1F5BA 4LT6A 7FD1A 4CQ1A 3T3FA 2ZOMA 3BBFA 2BSPA 1EETA 2VKZG 3A8EA 4J9MA 4Z05A 1TUVA 2G2OA 4Y2CA 2W2QP 5IM0B 2Q6BA 3G2XA 4F3OA 5J2PA 5J2QA 4WFAQ 3FK4A 2VC1A 2BZ2A 3M8WA 3RRKA 3GTYX 4L3NA 2A2DA 2HAIA 3OR2B 3LP2B 2R42A 4NRUA 2F4FA 4CLFA 2GMJA 3NGTA 2E1PA 3GLJA 3QAEA 4LVOP 3GFZA 4DV1F 4NZ0A 1WG5A 2M3DA 3W9JA 3PR4A 2VA3A 1U2FA 1S0NA 2BJ8A 1IQZA 2Z2MA 4ZN1A 5KFPA 4ECUA 4Q8FA 3IC1A 4YR2A 1CVJA 1S1XB 4YY3J 4PR6A 2FHKA 3AT1B 3QJJA 1O88A 3EGWB 2VFPA 2QMXA 4DL3A 5K20B 2E5JA 2VDIA 3MM8A 4ZPBA 5LSLA 3J7Z5 1C1BA 2YQ3A 3MZIA 3M8YA 1LQ9A 2YNGB 2LU1A 3PW2A 4OYZA 5E3AA 5A8RB 4CZCA 3H2LA 4RUHA 2WBMA 1FK9A 3DLGB 4OJLA 2KVIA 2F5GA 3NWGA 2P8IA 2RD5C 4I2QA 4YHHJ 2XMAA 3ZZYA 2ZE2B 3TAMB 1IKWA 1LW2B 1R8BA 2OH2A 5ETVA 2C3MA 3R3TA 2NLWA 2O6WA 1S9EA 4DX7A 4NXNF 2MGZA 5F9LA 2ZHAA 1S6QA 3MCSA 2W7OA 5FIIA 5L1KA 2IA6A 2AJ2A 3EXYA 1J2VA 1IKYA 4MTPA 4WE1A 1F0XA 4OZJA 1LWFB 2J6SA 2HNDA 1KN6A 5K8OA 3SSSA 3AODA 4RNFA 4YDDB 4ECWA 1NJWA 1MROA 5DDQC 4PQUB 1WC1A 1KFDA 1D09B 1WG4A 4ZLPA 1IKYB 2EFOA 1D0EA 2B8PA 2I2YA 2UVVA 2AJ0A 3KKFA 3KNAA 3EJMA 1RI7A 4LF9F 2RAQA 1RSCA 3GR0A 4ETXA 3UCZP 4DR6F 2CQDA 1OFLA 4EK2A 4X65F 4LSNB 5HK4A 4CLTA 1X7VA 3TUPA 4I67A 3MD3A 3B4NA 4XKVA 1EZZB 2NXEA 3HSJA 3KLEA 1WSRA 3GONA 4NZ6A 2ROEA 3IGVA 3I56S 4JI4J 3GV8B 2PN6A 3TJ8A 3DM2A 4IFVA 3D54A 2GJ2A 3SSQA 2Y8YA 2Y9HA 2RRNA 3OFFA 2X51A 1PSDA 2B6AB 2F40A 4NK6A 2AGQA 5RUBA 3DU6A 2DNMA 1IJFB 4YZAA 5KFXA 2XY5A 2B4OA 4JV5J 4EMDA 2PDAA 1QJVA 2JX2A 2XC9A 1B7YB 1AROP 2XWXA 3GYXB 2FZKB 3TZWA 5I3PA 2CIMA 5CCLA 2W4PA 2MQOA 4DLEA 3QGIA 1UA0A 2RILA 3MDFA 2DBBA 3US5A 3TX0A 4ECVA 3LP1A 3NGUA 1VQ7S 4JI7F 1UVKA 4CLUA 1LNQA 2WVDA 1Q5YA 1FRHA 4B3MF 4XDCA 2MMYA 3NY0A 5HBMB 1U8WA 1UW4A 1YJTA 2I5JA 4P72A 4X64F 1RHQB 1D8ZA 3KK3A 4DL4A 1VBZA 3GQ9A 3MXHP 1C4AA 4DDFA 4JI6J 5JLVC 2P2CB 3F56A 2C2KB 3DLJA 3QPIA 4RX6A 5GMKa 3A3OB 4XPCA 2W8KA 3QRPA 2GS8A 1IWGA 2ABYA 5A76A 3G6ES 2R9LA 3J81U 2ILZA 3HX9A 4PUOB 4FPIA 2VBEA 1RBLA 1TYVA 2CDQA 1TL3A 2I9SA 5DS7A 1X9WA 1TU0B 3HSGA 4O3RA 5L9XA 5ETRA 5AT1B 4CM2A 3DRRB 4DX6A 4OI0A 9ATCB 3NS5A 4M63A 1AB8A 1GNKA 2RVJA 1RUSA 2MY7A 3TH0A 2FTRA 4C0HA 3N28A 4CYUA 4WZMA 3HHDA 4LUBA 2A6OA 1MNEA 4KGXB 5FD1A 2VKRA 3NCPA 3JQJA 4UOFA 4Y00A 3K8WA 1V9OA 3SFUA 1FKPA 4FKXA 2HVZA 2QZ8A 3SCKE 1Y0HA 2V8GA 4F25A 4X62J 1KVJA 1NK9A 4YEJA 4ZPCA 3CCES 1RT2A 1YTYA 3M8RA 4EZ9A 2ODLA 2Q66A 3KJVB 2O04A 2MZRA 5KFOA 4K4VA 1SKWA 1ZAXA 2IM2A 4M5DB 4ZVOB 1BMQB 5L1LA 3VAHA 1TFWA 2NT9A 3ILLA 5K14B 4HWVA 2OP5A 2DTJA 3MMBA 4V1Ak 4E2FB 5CAAA 2B7CB 3K59A 3BO2A 2XLIA 1QA1A 4WKRA 3SV4A 3H42A 3DDKA 2MSTA 2YY3A 3UD3P 2BW2A 3SCJE 1S1VA 1NCLA 3MWBA 4MYUA 2ZNZA 2L08A 3BREA 4A8QA 2JEIA 4RNMA 3HFKA 3KG1A 1LEOA 1A6LA 2BX6A 1KOOA 3MPYA 4ZLLA 7AT1B 3PM9A 3RBDA 3QIDA 2QA1A 2HRUA 2FD2A 4HHJA 4YP3A 2AHOB 3AA9A 1X4AA 2RU9A 3TARA 2AQ4A 2RQMA 1S6OA 2CPZA 2VFSA 3NNHA 2HHPA 2K06A 1VQLS 4RW9A 3CDUA 1HHQA 5EDWA 2RQCA 1RT4A 4Z7YA 2YNIB 3DLKA 1TMJA 4JI8J 1OSCA 1F2GA 4DU7A 2AV5A 4J37A 2GZOA 5D4LA 2HIYA 4I84A 4UZBA 3W5ZA 1QA3A 4B3MJ 1RT7A 1YRUA 2O01C 1RWUA 2XMTA 4O4GA 5AXLA 2PI4A 1JNZB 2DNHA 2QLWA 2DIVA 3B4DA 4XLCA 3GIRA 3L7UA 4WFXA 3DKDA 4ZVHA 2F8EX 3VCDA 2QLBB 4QR0A 3SDEA 3WC0A 1NDPA 3MAAA 4Q5VA 3QZ7A 4OL8A 1JJ4A 2BOPA 2DGQA 1H0HB 4PWWA 2DCUB 3CIZA 3MM9B 3OTOF 4O0NA 4L75A 4S0MA 1LK5A 3FCVA 4USVA 5CCMA 4GVBA 3RJMB 2COLA 5E5NA 2XULA 3PJWA 4USHA 4ELTA 2MZSA 1X4BA 4ELVA 1Q0NA 1X0FA 1T9YA 2YPZA 3DDIA 3UW0A 1KLMA 2AX0A 4FKYA 1TKTB 4JI4F 3O1LA 2BE2A 1ZM4A 4UY8T 4Q0BA 3W5XA 5IQQA 3FMBA 1EB0A 1VMBA 3TAPA 2QYUA 4WBFA 1M1HA 2ZKUA 1DTTB 6AT1B 3OPKA 4DR5J 4LSNA 1S72S 3BF4A 4DSEA 2JVRA 4BS2A 4Q0BB 2L9DA 1KBRA 3N4WA 3PW5A 1DQ8A 5GVQA 1YJ7A 1FNXH 4WXOA 3ZZTA 1HNZJ 5I42B 4H4OA 2FY1A 1UKUA 1C0UA 1FE0A 3N5FA 3QNWB 2CJ9A 1WTBA 4W8QA 4DFKA 3V6KA 4M8LA 2E7WA 3UN3A 3UDEA 2FVSA 5H9FK 1HR0J 4JI3F 2DHAA 1ICEB 2VBZA 2IYGA 4NK8A 1FFSB 5A8KB 1CEZA 2G1HA 3NMRA 4ER8A 1GAOA 4RWXA 1LKZA 1FWKA 2CQHA 1SC1B 4G65A 1PJ6A 1WHWA 2GC8A 5L8RC 4ZJLA 4W98A 4EO8A 1H80A 4DCJB 5IWAJ 3VAGA 4C8LA 1JLQB 4U6PA 2YNFB 3GIIA 1TVRB 1HWUA 4JV0A 1ZOTA 2H4YB 3FQLA 3WBZA 2IBOA 5LXRA 5C1EA 3Q83A 3R6GB 3A13A 1KRPA 1VBXA 2LU2A 1TKZA 2R3VA 1J5EJ 2DR8A 4A8FA 3GQAA 1I5OB 1CJKA 2W1BA 3QT5A 1YZ6A 1RAFB 2BKNA 4ZMMA 4DV0F 2J0QD 4LSLB 2CQIA 3I31A 4OJ3A 1NSQA 3BQ1A 1RWKB 1UA1A 4ID5A 1JXVA 1I1GA 2C2EA 2XLJA 4LFAF 4DR2J 3PW0A 4EI2A 1TV6B 2YWWA 3EM1A 5H9EK 2Y1RI 3EGNA 5KFSA 4YR3A 3FRYA 2LA6A 5FLXY 2DGSA 3FNNA 5JXSA 1GX6A 3SQVA 5IQ6A 4XPEA 4HVZA 2WW4A 2OUGA 4F2SA 4JYAJ 1GQ8A 2VDHA 1RISA 4TQRA 1HL6A 4WFYA 1H6KX 1NPPA 5GAEU 1QAXA 3JQKA 3OW2R 4N41A 2R7SA 3RB0A 3DDNA 2HHVA 1C1CA 1Y4ZB 4XL9A 2EFNA 4ZVTB 3N6MA 2IJNA 2RMLA 3JX8A 4CYUB 2XI2A 3AA8A 3WDOA 1IBLJ 5KT4A 1KFSA 5J2PB 3Q22A 4JI1J 4FYVB 4KO0B 4QYRA 1XBWA 2V8VA 4NCGA 4EO6A 1WMRA 4YDTA 2E9ZA 2WZ1A 4KV8B 1KR4A 4C8MA 4DMZA 5LSOA 1TL3B 2DRAA 3GP9A 3MEDB 1LWXA 5GAEI 4HTJA 1U8SA 4I68A 2DK2A 2QYCA 3FSYA 2FY8A 3DOLB 2CPEA 1TKXB 4HT7A 4CDIA 2CNNB 1VIOA 3PTWA 3TRGA 2J8AA 4A8XA 4DV7J 3T1HF 1OO0B 3JXOA 3W66A 2UV8G 1H2UX 1DAXA 2BA9A 5D8HB 1JNRB 4DCOB 4N56A 1LXNA 3VTIA 4QW9A 4UY85 2EEYA 2NPIA 2N82B 2M2BA 3HXMA 1L3SA 1VHFA 4O3PA 4P75A 3UCUP 5BYRA 2V0NA 1N5VA 1HNVA 1SJ1A 2ZBCA 4H4MB 5JJBA 5T14A 1EIYB 1C0UB 1MSWD 3KJNB 1U2CA 2DH8A 2DXEA 1UMJA 2CPHA 4TYBA 2F7VA 5EGYA 1U6ZA 3DRYA 2HQ3A 1N0UA 2C3UA 2J8SA 4FXWA 6FD1A 4V19J 2EBGA 1YSJA 5DZ6A 5KG1A 3D1QA 3R1LA 3ML3A 4MIWA 4IR1A 1UAWA 2J0WA 1QE1B 4ZCLA 2ILYA 3W9IA 4MK8A 2IFXA 1RKJA 3LWLA 1QSSA 1PKUA 1UJ5A 2OPRA 3DGVA 4M95A 1UWBA 2V34A 3MF5A 1WF0A 3D0IE 3PYEA 4DV0J 5IXUA 4K4WA 5CYMA 1YG0A 1Z4UA 2CWXA 1NK4A 4KB7A 1LOUA 1WEXA 2OPQA 2VQEF 1B4SA 4URQU 2XI3A 4P2MA 1PC5A 2VJIA 4PPDA 3C6TA 1NDLA 4MKAA 4RWWA 3DU5A 2ACYA 4M5GA 5C2GA 1N88A 1T9XA 2DO0A 2C22A 1T05B 1IVZA 1KNZA 2BM5A 3O6QA 4UQGA 1N5TA 2HFUA 2XSJB 1VC5A 5GADI 3TVKA 3HP6A 1HNVB 3GCXP 4TNOA 4CO0A 4B3SF 1DABA 2DNYA 2BRKA 1XN9A 2CWKA 2DXDA 4DUTA 2VG5A 2Z57B 2B8QA 2RUSA 1JQGA 2ZKTA 4CTAA 4CLZA 4K0KF 4QW8A 2BM0A 2D7SA 1Y00A 4OZNA 2E5LF 1HFEL 1BWVA 2MZJA 4G3IA 1OGOX 2BQUA 3M4XA 1T3NA 3HO1A 2KL8A 2MGZB 1R6VA 2IRUA 5GADU 1TUGB 1WC4A 3DOLA 3V4IA 2WRMA 4YB5A 2NCKL 3CMAS 1SH2A 5DM7Q 1CJTA 1BGXT 1FNOA 1O8IA 1GTHA 1SQGA 1EA0A 5IZHA 1FWPA 5J2MB 1AZSA 1D9FA 4J9LA 2DR9A 1RA6A 3CE8A 2AGPA 1NK6A 3KHRA 2XMVA 3I9V9 5DZ7A 4RW4B 4K50A 1RTDA 2C3PA 5A8RA 3NXZA 4XAKA 2XT2A 2LQJA 1DARA 2EFGA 3JYTB 1OGMX 5KFKA 4LR9A 1HBOA 1KP6A 1NH8A 1S1WB 1SH0A 2CFXA 1SH3A 5G4DA 3GILA 2E44A 1PCAA 1QVFR 5HLFB 4C8OA 5GAGI 3NGKA 2YWGA 5KFRA 1UPPA 3QAUA 4NL5A 1Y3KA 1SUQA 3A4TA 3OL7A 2R7TA 3U27A 3T6BA 5E2QA 1I51B 3G6YA 4YOEA 4NLSA 2PFDA 4RNHA 3LUYA 4WXWA 3LGNA 4PWUA 4NEYA 4XNFA 2B3TB 1PGZA 1WWHA 2HZCA 4QBUA 1L3VA 2NTQA 3D4JA 1RU2A 2CJBA 1FERA 4F2RA 5DM6Q 4B3OA 4PG5A 5U47A 3Q8SB 1HBNA 3NGSA 2WVCA 4NLOA 2BUNA 3TUIC 2NXCA 4DEZA 1M5PC 3QZ8A 2J6TA 3KTQA 2HKEA 1J5EF 3PKMA 4OV6A 3C16A 4CO3A 3GG0A 1SL0A 4QPTA 2AJQA 2OEMA 1R27B 1RLDA 2HVIA 5KFHA 1TVRA 1XMOF 2HLTA 2K7JA 2GMHA 2W2NP 5A2QY 4FF3A 1FJGJ 4JI2J 4FPRA 2MQ8A 4PRFA 2ERRA 1VK8A 3BBBA 4C0BA 1UJ4A 3TZXA 2R8IA 3PR5B 2VZ9A 2CPYA 2Z56B 3VMWA 1KDNA 2DPIA 4B9TA 3GQ7A 4LF8J 2ZD1A 1T9VA 4NLGA 4OPWA 3CJKA 3OLAA 2VF3A 3SSRA 4OMFG 1U1QA 1U1PA 2LMIA 4JI0J 4KHPJ 4F4XA 3OHBA 5HQ8A 1YBAA 4RW6B 4OZYA 3ZPPA 5B0GA 1WHVA 1H98A 4X66J 3PKYA 1XR6A 2IVYA 3Q8VA 1R7IA 4K2JA 5AJ3F 1TK8A 2PGCA 1MLAA 3G87A 4I6YA 3UDCA 2YTCA 8ATCB 1NKCA 2DO4A 3DHXA 2IA0A 1VIXA 2RB7A 3C2PA 1XERA 4X4NA 4WIIA 3FZ2A 2JNJA 1YITS 2M9KA 2XCAA 1N36J 3MR5A 1Y9OA 2O0WA 2GNKA 3M32B 1PXZA 3R5AA 5DQHA 3QLHB 2AU0A 3BH7B 2DRBA 1B64A 2HAFA 2DISA 2HEKA 1HBNB 2GQCA 2HVDA 3MGJA 4GRSA 4OX8A 4U7UK 2YQ0A 2QX3A 3KRGA 2B51A 5L39A 2VQFJ 5KT3A 4P2FA 2BANA 2J76E 1R0CB 2NZMA 1R43A 1WDDA 5ETMA 1NDKA 1LW0A 2LLZA 2VFVA 2WSFC 3MPWA 4K2XA 4KHMA 3AJDA 3M6VA 4LR8A 4RR5A 1N33J 1RT3A 2W7ZA 1Y7PA 4DOZA 3FFIA 3ULHA 3VR1A 1D3WA 4QWEA 2AEFA 2KO1A 4IG3A 4Y2AA 2HFNA 3H0PA 2I6WA 1PYSB 5J1PA 4D3HA 1RBAA 2M88A 5AE3A 5CZVA 5AXNA 4KAIA 4NI2A 2HNZA 1X4FA 3UQSA 4ES3A 1U47A 1YWXA 3VSVA 4EFAC 4DQRA 1MROB 3LP0B 1WORA 2PMWA 3UN5A 4W8RA 2E7VA 1IKVB 1JK9B 1YBUA 2C2ZB 3NCQA 4HH0A 4J5OA 1S99A 3QT7A 5ETTA 4XLHA 4QR1A 5F41A 4C3MA 4USMA 5C7PA 5D3GB 1ZETA 3ZZZA 2IPOB 1F60B 3GYGA 2QA4S 2AJFE 4NLUA 4DR4F 3LQVA 1TYWA 2XZWA 4L76A 1S9EB 3C6TB 2LEAA 1SJRA 3HHLC 1WI6A 1WC0A 1IM6A 1IKWB 2BKPA 2IVMA 2ZZTA 3CTRA 3I5CA 5HMYA 1N34F 1WC3A 2LA4A 4C2LA 4JI5J 4W90B 1KHWA 1RWNB 1FRXA 5F0WA 3KJQB 4WWSA 1YI2S 3AXKA 3GPAA 5KFYA 3FEXB 2P9GA 1RWWB 3MMBB 3RAQA 1Q7YT 1KD1T 5KG2A 4K0KJ 3KG0A 4USUA 8AT1B 2F9JA 2VG5B 1U2RA 2PEHA 1RHMB 1RB0A 2DNNA 2CJYB 3AD7C 2L9NA 3HF5A 3CCMS 2OGUA 1FX4A 1NJZA 4B3RF 1P6TA 3LH2S 1H2VZ 2HK2A 4H54A 5HVHA 4CIOA 3I5AA 1VR6A 4ZHRB 4OJ5A 5MAOA 4MFBB 3V6HA 3QFHA 2MQMA 2YNHA 3GQ8A 4OZZA 4OJPA 1Q86T 2FJVA 2V8PA 4KJIA 2GA7A 1RWOB 3WX8A 3QYYA 3CCJS 3W2WB 3CT9A 1YLXA 4IDKB 4LIWA 3K5MA 1HNIA 3KLVA 4JV2A 2QL5B 3R2DJ 4DXLA 4QIFA 5CYMB 1U02A 1T95A 2QGFB 4IKAA 4O3SA 2OLWA 1XK8A 5HVFA 3T1YF 3B8HA 1AT1B 1JLAA 2XWYA 1V3SA 1BUXA 1NO8A 4ZPDA 1N8RT 1VQPS 1R6YA 3DN9A 1Q8LA 2V5HG 2LECA 2IMOA 3R1HA 2QJ3A 2AZ3A 3VMVA 5FLXU 4XOPA 3CF5Q 3R2CJ 1UPMB 3T19A 3CCZA 4QWDA 2NSPA 3FRZA 2VV5A 2QLFB 4ID8A 4KV8A 5LOQA 1RAEB 2DNGA 3NAHA 3HD1A 4URSA 3H59A 3D0HE 1SQFA 4JI6F 2Z4PA 4ECYA 4DR3J 3OQ2A 3EX7B 1HNIB 2I5JB 3OVBA 4DL2A 2XZDB 3KLIA 3EZUA 3OV7A 1IA5A 2VJVA 3EVMA 5BYSA 3HZEA 1P9YA 1FKOA 3FVYA 3BKFA 4ED4A 1FJCA 4KH3A 1M5HA 2HLUA 3CC4S 3HT0A 2NUUG 2AWZA 1L3KA 4PWDB 1QAYA 2IC3B 1TKXA 3CEDA 2GFFA 5KG5A 1S1UA 2V4QA 2HHHJ 3MMCB 1IBMJ 3IA0A 4DX5A 5IV3A 2AKWB 1HPZB 2XMKA 4DPYA 2OPSA 2ZH1A 1GT8A 1NSPA 4DR3F 1N48A 5E0OA 3GU0A 2NTBA 3MECB 4FVCA 2XQCA 1AW0A 3G86A 3DC2A 4FBTA 2R8JA 2CPJA 4AVZA 2E1MC 4CRJA 4U49A 1RBOB 1YJRA 2BVZA 1X5PA 3RU0A 2CQ0A 5L1IA 1JXLA 2IAJB 3CW2C 1VRTA 2F65A 1RE1B 3K89A 1FNMA 4Z03A 1E6VB 2RDIA 1HG8A 2D3ZA 2HZAA 4IRDA 3X1LB 5G0RA 4C7QA 2DNOA 3NWRA 4TY8B 1B0TA 4G1IA 4PPZA 1LLWA 2QL9B 3BPSP 4KPYA 1K1SA 4ELUA 4Y6IA 5K8MA 1ZM2A 3BM7A 3ONQA 5LXYA 4FBUA 3PO5A 2O0VA 5IV4A 1FTCA 3D5MA 4FYXB 2JEFA 1ZYQA 2AP6A 2R8KA 5I3UA 3P3DA 2J8IA 1AUSL 3BS9A 3W3SA 4DQIA 4Q2MA 5I42A 3PEHA 4PABA 1SXLA 2CNLB 2OO4A 2N3OA 4TLQA 3ZNJ1 1S6QB 2QA2A 5D0GA 2VA2A 1XNQF 2DGXA 2W9BB 3H09A 4XLAA 3G82B 3UR3C 4I6WA 2X6YA 2O67A 3P4GA 2G9OA 2YNFA 3BN7A 3GJSB 1OY6A 1IB4A 2OFHX 2OHDA 4OYMA 4P10A 4ERDA 1PLUA 4DCPB 3Q0AA 3M2VB 5J1EB 1M0SA 1XR7A 3VGSA 3EXCX 4V19X 2X6WA 1O8GA 2UUAJ 5D3GA 1HR0F 1BD6A 2ZJQQ 4FNIA 1KEKA 3PIOQ 4XDDA 3LP0A 1K5CA 4DJBA 4F0KA 4X64J 2UUCF 4OLOA 4FVMA 1FDAA 3CD7A 3VF0B 3NNAA 9RUBA 2L41A 1R0AA 2YKAA 2E7XA 2HNZB 2P5VA 2RH3A 5T7LB 4W8SA 1FFWB 2MZQA 4LVNP 1JMTA 4OJ6A 2EC2A 2EG2A 4Y2IA 2FJDB 2KVQE 3GIKA 5E3PA 2DJWA 5FDLA 3W64A 2UUTA 2XCPA 1JXEA 1RT7B 3AOAA 4ZJQA 8RUCA 3W60A 3B8YA 3FGVA 3L4BC 4OIXA 3UPFA 1XG2A 4U8VA 4X4QA 3LP2A 1YJNS 3MI7X 1M5OC 4D3GA 1Q1KA 1EQMA 2OELA 3UE2A 2ADCA 1AA1B 1O8HA 4RL1A 4J9QA 2ZD1B 4QR2A 4URGA 1X4HA 3JTPA 2J9CA 2XS2A 3IR7B 4LF1A 3KK2A 1MG7A 1FT8A 3HSDA 4G1QB 4L74A 1MN9A 2VU5A 2BJDA 3GJQB 4MKVA 1S76D 3RTVA 5ITHA 4F26A 3C19A 2OFGX 4F7VA 4B02A 2MKYA 4EZ6A 1HNXJ 3MPUB 4KHRA 4JRAC 1RTJA 2QSWA 3IFEA 2IHR1 4CNZA 1TL1B 2MKIA 1RT1A 4USJC 2FPHX 3DLHA 4LREA 5E3QA 3BSOA 1NU4A 1QD1A 2BE9B 2CJAA 2WVBA 2UV8A 3WHIA 2ALZA 5DNSA 2C42A 2KZMA 1EHWA 2LKZA 3QSIA 3SZEA 4W4MA 4KPCA 2OIHA 1PILA 3ITHA 3BGRB 5ETNA 4CO5A 5BR8F 3NRBA 3U7JA 5A8WB 3BGFA 5M2RA 1UVNA 1S4FA 4RW8B 1NSKL 2W4DA 4Z06A 4XTTA 3TZZA 1YJWS 2U1AA 1K73T 1EJ7L 1X4DA 3AAWB 2MJUA 3RW7A 3CCLS 5MLCV 3J7YU 4YB6A 4DL0C 3J81Y 4RZRA 5J2NA 3TAQA 1O8MA 1CZFA 4U67Q 4B17A 2KT2A 3NS6A 3F73A 3NAIA 2HHWA 1WJ9A 1KCDA 5C5JA 1HBUB 3DI6B 3OR1A 1RMGA 4UT4A 1N5YA 3V6JA 4ECSA 4IR9A 1GFWB 2GV1A 2J5AA 3RIQA 2V9KA 4CCHA 2RQKA 2HBRB 2YX7A 4HDGA 1YBTA 1RHRB 4C6AA 1GMWD 4YZQA 4Q7AA 2WVFA 3T9ZA 3PIPQ 4AL6A 3TA0A 1U49A 1T8EA 5K14A 2L9WA 2OI2A 3L95X 1HPZA 4ZS6A 1U25A 2QZAA 4EEYA 5B0BA 5J2MA 3BKUA 1V3RA 2AGOA 1TFYA 1FJGF 2K3IA 4A8MP 2VFRA 1S6PB 1REGX 1HYSA 1RT2B 2M5YA 3NS7B 5IOLA 4BLGA 4IH5A 3X3UA 2E1AA 5CYJA 2XGPA 4NE9C 4FYWB 3F0NA 1TYUA 4YEIA 1NHUA 1OFMA 5JMCB 4ILRA 4M94A 4IG0B 2DEJA 2V2ZA 2HRYA 2QLXA 3EICA 2VUGA 5HBMA 2PA8D 3JYTA 2UXCF 1SC3B 2ALYB 3DLEB 1O0PA 1Q7LB 1K4ZA 1YRTA 2RF2A 3CJTA 2F4VJ 3ADAC 3H90A 1UWAA 1WTFA 3I9ZA 1H2TZ 1IWAA 2VFTA 2YKNA 3N01A 1T05A 4USKA 3EVOA 3TJAA 3DLBA 2ZDOA 5KAKA 2M8HA 2FLOA 4ZIWA 2CJXB 1YGYA 4YHHF 4ZITA 1FRJA 3D7SB 2J0XA 1VRUA 4TYAA 1X60A 4DV2J 1XNQJ 1EP4B 4I7FB 2G0CA 4CO1A 3A12A 5DDPC 3OL6A 2HHTA 4UZCA 1CJUA 1VQ9S 5ETOA 3MTJA 5DJBA 3VALA 3FJ2A 3TP2A 4QIVA 2NZ4A 2VFOA 3GJTB 4UTGA 3CC7S 1TMMA 3RUBL 4DV5F 4IDKA 2IRYA 1L5UA 3TA1A 2KFNA 1RWPB 3D0GE 1Y5IB 2V2KA 5A0YA 4F4YA 1RACB 4QIEA 3R7NB 1C4CA 5L9NA 4USWA 2XNQA 4F50A 1QTMA 2R7OA 3K8VA 5GMEA 4BWJA 3W61A 1BC6A 1EKSA 2ZFHA 4PXDA 3DXBA 1AYEA 2K7KA 2ASLA 3EE3A 4DUZF 2B6AA 2AEJA 3CJSA 2BXJA 5B0DA 1LWFA 2HBYB 4NLPA 2DR6A 1KS2A 5DG8A 3KNGA 1EARA 2VOPA 1RXOB 3AH6A 1CJUB 2HS0A 1UWBB 1K0TA 3OFEA 3VAFA 1HI1A 1RHKB 2HHSA 2ZZNA 3JQMA 3KHLA 1FF2A 3BYPA 3KLEB 1UFWA 2UU9F 2YX4A 2O5DA 3D67A 3V5RA 1T9TA 4CO4A 5M2UA 4NA2A 1SL2A 4F04B 1Q8IA 4K59A 1W2BR 1KLNA 5IT0A 4I2QB 4CI0B 2R2RA 5E3CA 2KZZA 3C46A 1UEVA 4PQAA 1WI8A 2VC0A 3TOQA 3CO0P 2HQFA 4BC7A 1FK9B 1EQ0A 4F4AA 3IBWA 5KFQA 2M0GB 5KOXA 2RE1A 2L3MA 3EYZA 4X4OA 3AFGA 4DL6A 3BO4A 2EWHA 5F8LA 1BE4A 3KUHA 1CSJA 4MK7A 2MY8A 4M5HA 4KHPF 2V4RA 2CPFA 3IG1A 4X2BA 1H74A 1S59A 2HHXA 2YWEA 1WC6A 2QY1A 3SCLE 4N8OA 2ZBQA 4NI2B 1U45A 2J9DE 3VAMA 1H72C 3HKWA 4X4UA 1CC7A 3A1YG 3K5LA 3E2EA 4XOTA 2CG8A 4JI2F 1E6VA 4DPUA 1SIZA 3AQOA 3M8PA 3HT3A 1JTAA 1S6PA 1S1TB 2IAJA 2AT1B 2LVWA 1V5VA 2RRBA 4OZLA 5C24B 5HVGA 3NKYA 3PXGa 3ZNUA 4ED8A 3ENQA 1HA1A 5CXTA 2KKHA 4L73A 2YWKA 3P45B 4LSLA 2K1RA 3W8PA 1YIJS 2FJWA 2VIHA 3D3CJ 1SJFA 2OJ3A 2IY5B 1KWMA 3LPYA 5CH7B 4J9RA 4EBCA 1R31A 2BJEA 3RB6A 2YKOA 3QO9B 1RHUB 4NRTA 5E7OB 2IVFB 2XMUA 4C2MA 2PC6A 3HVRA 3M8PB 4Z2XA 4ZK7M 2KDOA 3W63A 1PO6A 4YFUA 3I96A 2IC3A 1S7HA 3G71S 2Z30B 1X5SA 4NLVA 3D6TB 2F9DA 2WTFA 4LRBA 3TEGA 3CCSS 3PRBA 2HFZA 1N5QA 4B9LA 1IDJA 2DCLA 4MR0A 2QN6B 3IG1B 4BWMA 3S6EA 4DFMA 4WF9Q 1LWEA 1FEEA 1UP1A 3QIPA 5EN1A 1G4CA 4USIA 3K5NA 4FYDA 3OHAA 3AY0A 1YRXA 3NEKA 3UVJA 1I3OB 2CZ9A 2IJRA 4P71A 5KG6A 1VHIA 5K8PA 4IQXA 3TUJC 4DUYJ 2PYHA 4GKKJ 4IO1A 1TKZB 5C25B 3ET6B 1RT1B 1VJWA 3FZBA 1UEUA 3D1HA 5JUMA 3H5UA 2X1BA 2A6MA 1UL3A 1VQ4S 1XR5A 4ZPVR 1YJVA 1X31C 1KSPA 3FEYB 1TK0A 4RNNA 4DR2F 2XHCA 2EKYA 3CJ5A 3SQOP 4XMYA 3MM7A 3N5BA 5DGAA 1S77D 1I94J 2NSTA 2BM1A 4K4YA 3QJPA 3UI3A 3PW7A 2BV3A 1FHTA 2GJIA 1QRCA 4X66F 1U6FA 1WOOA 4X4PA 3J80Y 3MCNA 4ECXA 3CC2S 3SYZA 1BQMB 3NOGA 1ZA1B 5SUHA 1KVIA 2B5JB 4FS2A 2NTPA 3MEEA 2B9XA 2YNHB 4WP3A 4R5PB 3H4DA 3GV5B 3M2RB 4XK8C 4DR1F 4Y2KA 1YJ9S 2AIRB 5BYQA 2OMOA 3OTDA 3J81j 3TX8A 4YB1P 2LQ9A 3LYCA 2BBEA 4QZVB 4FZVA 4LIRA 3CCUS 4K4UA 3O44A 4JI3J 2N3LA 1N33F 1OIAA 1WEYA 1WACA 2CA9A 1MU2A 2H5IB 2HWTA 3RG6A 5IT4A 2QA4G 1VJQA 2EFQA 1WNEA 4A8WA 2C2MB 4KFBA 4V02C 4HR2A 5C42A 5H1SV 2MHNA 2C2DA 5FJ4A 1GX5A 3RGIA 5B7WA 2WOMB 1SL1A 2JL9A 3O8WA 1VRUB 2NZCA 1RZMA 2I1RA 1F3VA 1CQNA 4OYBA 3HJFA 4OJHA 4W92B 4NASA 1NPKA 1W7WA 2ATLA 2ATCB 2PEBA 2HS4A 2Y1IA 3A3PB 4NLXA 2BDPA 3IM8A 1SC6A 2FDNA 4HACA 2HNYA 1S1VB 1DBDA 2VPWB 4OV1A 2C2RA 3JSMA 1RAGB 1HWKA 1NZ8A 2LQBA 2ROPA 2IM1A 3C6UA 3DYAB 3IM9A 4TXSA 1X4EA 3KK1A 3PX4A 2E5HA 4JOUA 4M5MA 4ZCIA 1WEZA 4R0EA 3V2UC 2HHUA 5CYQB 1NZAA 4ANDA 2VB6A 1OFDA 2DKOB 3CCTA 4IG0A 2ZH8A 3ILIA 2BEFA 4LF8F 4A4JA 5KFIA 3M9NB 4NA1A 4RW9B 4ZVRB 1VC0A 3T1HJ 4AUKA 5DG7A 1H73A 2GGPA 1TTHB 3N0VA 4LBPA 3MUMP 1Z2LA 1NJXA 1W25A 2DH9A 2V69A 3A8IA 3QT8A 3SIPB 5HQMA 3Q89A 4RW7B 1FJ7A 3Q23A 1NSAA 1SJ4P 4MYTA 1RT3B 1RYSA 1GXTA 1A9NB 4BBYA 3AJ2A 4PMHA 2CVIA 4DV5J 1N56A 4DSFA 2ZZMA 3WIUA 3H98A 3R7SB 1T7PA 3HHEA 3D2WA 2FHJA 5C42B 4DUYF 5KFBA 4B3TJ 4C8NA 3GCWP 4WK3A 2FZCB 2VG7B 3MM7B 3SMZA 3PACA 1WKLA 1IBLF 4AL7A 2DY1A 3OR1B 2HFSA 1QE1A 4DPXA 3DMJA 5SZTA 3PY8A 4DZ6A 2UXDF 1VYAA 2PSZA 2ROGA 4HLBA 3T5LA 4BDPA 3J7AN 4RPFA 3P5TL 4HTIA 5B09A 3ET6A 4PG6A 3DCAA 3ZFVA 1J5OB 2CZVC 4OYAA 4DS5A 3D6MB 3LO3A 5DQIA 4R5PA 3MM6A 2F4VF 4KTQA 3ZZOA 2B5JA 3M8ZA 1MWQA 3R27A 3KK3B 3J7YI 4WJBA 3AOCA 4KR0B 5D6GA 4QIWD 2QIFA 4WP8A 4DV6F 2X1GA 4DPOA 2ZOGA 3HKZD 3DRRA 3RZAA 3JB9k 4ZDNA 1X9MA 4OI4A 2GMLA 1IM4A 1OS5A 4MIAA 2LFVA 5JMNA 1FESA 4LQ3A 3MOJB 1BLUA 2WW8A 4OZ3A 1SBRA 4ZP6A 4PAAA 3I55S 1XNRF 2XMWA 1MW7A 1OOCA 2VPXB 3E8OA 3FBFA 4UW2A 1VISA 2MB0B 3FBCA 4A47A 3OTCA 3R6LB 2ZWPA 4OHWA 2GJFA 3ZZ0A 1ZZNA 1G7CB 2YQ1A 1JLCA 3M05A 1VK3A 3EGVA 3LAKA 3VZIA 2D3O1 4ED6A 1T03A 4LF5J 3HK2A 3NMAA 3DM2B 3FQKA 4IFVB 4WKYA 2AJ4A 2VH7A 4XIUA 1XQIA 4TU7A 4DU8A 4OZ1A 3NNCA 4DF4A 1RT5B 1ZPVA 1HQEB 2NYIA 2XYGB 3CUNA 1EZGA 3GFHA 2XLKA 4NXMJ 4H4KC 2IDLA 2V67A 3CSKA 2PYGA 2CQ4A 4ZVSB 4YUDA 3CCVS 2RRAA 3Q86A 4OX9F 2MJNA 1JWWA 2RKIB 2G0IA 5T7LA 3K2YA 3ZXWA 3OVSA 2RS2A 1F6TA 1DFDA 2ZVSA 2JJ4D 4ZP9A 3GV7B 1VDHA 3M6XA 1IN0A 3IS9B 2M7SA 2MKHA 5BR8J 1M90T 1O5JA 3ETOA 5CZXA 2E1RA 5DO2A 1HBMA 2MYFA 3FBEA 3GE9A 3H2UB 1RTHA 4XO0A 3L3CA 1RTDB 2VODA 3HLUA 4I64A 2NPFA 1IR1A 1NB7A 3R5GA 2XM3A 1S9FA 1QA2A 3RR8A 4DX8H 1WXRA 2KG0A 3W1YC 2W9CB 1TSPA 4O3NA 2BM7A 3IR5B 1BQNA 2KI2A 3FUYA 2XHWA 4FP9A 2VFQA 3LA0A 5KG4A 3ZC4A 1AFJA 1KTWA 2ZE2A 3TAMA 2E1CA 2F8HA 3VGTA 2WCXA 3EPIA 1JLQA 2ZC4A 2HBZB 3E3XA 2ZH9A 3G9CA 3I0SB 1R89A 4JYAF 2KTQA 1UETA 1BQXA 2HGNA 1KQKA 4NWBA 2X3DA 4M5LA 4ATNA 3FC9A 4YQWA 4RU2A 3MR2A 1NKEA 4OQJA 3N79A 1OSDA 4PQUA 1JJHA 4CM0A 1IBMF 3CMES 1QLNA 3IS9A 1WHYA 5AMVA 4UF4A 4OYXA 4LQ9A 3UWTA 2W9AA 5I3QA 1U26A 1M5KC 3WC2A 2VICA 3KJFB 4CLPA 4LF9J 4ZJOA 5GAHU 2I38A 4YCQA 1P8GA 1UFKA 1FDDA 3LANA 4ZPWR 4X4SA 4DV2F 3D3BJ 2W25A 1U1KA 1VRTB 2EC0A 3L09A 4WFNQ 5DDRC 5ETKA 4C8KA 4MKYA 4GKJF 3ZTRA 1RP5A 1ZA2B 1HW9A 2GAGC 2C1EB 5IWAF 3K57A 3UDLA 1Z1ZA 2CAJA 4GMKA 1T3OA 5DLGA 2X85A 3PW4A 4ETZA 3T6JA 3EDQB 1P27B 3IRXB 2ZBRA 2R7VA 2B4UA 5E33A 1RWMB 3OBIA 4A8OA 4I7FA 1QUPA 5DDOC 1SKRA 5KFJA 2BACA 2Y0BB 3Q8YA 4G6VB 1Q53A 1UCNA 2JC0A 2KJWA 1VOMA 3VGVA 4TY9A 2AJ1A 4YMEA 5B0CA 3RBEA 2XB2D 3QMQA 2JFKA 4C11A 3H25A 5HL7Q 3ZZRA 2ZH5A 5ETPA 4ILLA 3TZYA 4LMZA 2KRRA 2O1DA 1SJ3P 2ZNYA 1HWLA 1TAQA 3CDWA 1CG2A 4H4KA 4DS4A 4GO7X 3NCRA 4LFAJ 4O3QA 2B9EA 3F41A 3OVAA 4C3KA 3D6FB 2FZGB 2D41A 2W01A 5F8NA 1QQ1A 2YNIA 3DLKB 3MM6B 5LL6d 1Y5NB 2QXZA 2NXUA 4OYWA 5C2CA 2MQPA 5EWEA 4OYIA 3D66A 2E9TA 3ENVA 3P49B 1S10A 1EETB 5F3TA 2O66A 2PMZD 1O6XA 3H5SA 1EP4A 1NB2A 3GSIA 5HQLA 2HG4A 2MKJA 3JS9A 5H9EJ 1PE9A 3JSBA 3TWZA 4ZVPB 1NM2A 3IWNC 3DMJB 1S49A 1B3TA 1QRBA 3ZTOA 1VI7A 4OX7A 2VOOA 1AIRA 1PBAA 3MEDA 3E01A 4ED2A 2VG7A 3MCOA 2YKNB 5CA5A 2DVIA 4CLKA 2BYCA 2U2FA 2BOAA 5J1NA 2W24A 2VHGA 3I0RA 2IOUG 3ELHA 3LJYA 2DNKA 3DLEA 4JP8A 5LT5A 2AYBA 1ZTTA 2H51B 3M9MB 3C8YA 4WU3A 1C1CB 3PZPA 5IS2A 1LM1A 1HBUA 2K8GA 3DI6A 1HI0P 3F44A 1EE6A 3OXGA 2IDEA 3LF0A 4O44B 5B0EA 1IJEB 4K5RA 1IR0A 4CWBA 4L6V3 4IFYA 4DFJA 1RU1A 5D4OA 4AQYJ 4AQYF 5KFAA 4KRWA 2HQGA 3VZHA 5C1CA 1KONA 2RHSB 4Q45A 5AJ3J 1URNA 4DR5F 4F02A 3BN4A 2BJ1A 1NK7A 1S7IA 3IP0A 3BGLA 5KFLA 5KFWA 2EWEA 5A8WA 5KOWA 1HBOB 3GZ7A 4ZVQB 3Q8RB 3GQCA 2UVUA 3KDNA 4K4SA 2QMWA 2CXEA 1ROFA 2BRLA 5KT7A 1DHMA 3G6VA 2Y0SD 2JWNA 3I0RB 1Q16B 3ISND 1YHQS 2XSFA 4DG1A 3C6UB 2V4JB 2PE8A 4QYZJ 2Y1JA 3IWXA 3U1LA 3OTOJ 5KFCA 1SIWB 2FLNA 2N4DA 3E01B 4NCBA 3RAMA 4IH7A 1E6YA 3JTNA 4J9OA 3HVWA 3DGPA 2UUWA 1T11A 1UTAA 4NPOA 1PAEX 2IRXA 3QQCD 1VFJA 4F0HA 2WOMA 4CH0S 4F4ZA 3V4IB 2GGPB 2H48B 4NCAA 2EBEA 4K4ZA 1L1IA 2GO8A 5JVGQ 1S9GA 2VQFF 2NSBA 3NAWA 4DSLA 1R8CA 3T9NA 2RSQA 4C3LA 5F9NA 4USTA 3DRXA 5KFNA 3CXCR 1FKAF 1NBEB 2FJXA 5D0RA 5CABA 4Q8EA 3KMSA 3T41A 3DU1X 4C97A 2LEBA 4DV3F 4OI1A 1A7GE 5L46A 1F2HA 1RABB 2GIQA 3DXSX 4H4OB 1NAQA 2CG4A 3JURA 5LMNF 4LR7A 2Y3YA 3M30A 1YDLA 3VAJA 3PYFA 4OI2A 3NBPB 1GEHA 1CULA 3DRSA 3POTA 4WU2A 3BDEA 3E51A 3FFIB 4C11B 5AE1A 5KTQA 2BM6A 4CLLA 2AYMA 4EU0A 4U96A 5LMUJ 3TO8A 2KXFA 4X84A 1VGYA 2A2CA 3KFWX 3THVA 1K0VA 1GTEA 4NA3A 1WDTA 1F9FA 3Q2SC 1Z2ZA 2EW9A 4ICLB 2JLFA 2XO7A 1NLKL 3PJXA 4GKJJ 2V5IA 2GX8A 3FSIA 3KLGA 3CWJA 3ISNC 5J1EA 1TELA 4J9PA 4C4WA 1VQ6S 3M32A 1LXJA 3I82A 4TKTA 2EFVA 1EKRA 3BGUA 3EZOA 4Q2LA 1O51A 3W65A 1JB0C 4QU7A 1FD8A 1XEZA 4WYLA 3VAIA 2X3GA 4M1KA 1R8PA 1O8EA 1JLGB 4P73A 3UCGA 1R8AA 2LXUA 3MUVP 1ZAVA 2A1BA 2AEMA 2F1FA 3K7RA 4UOGA 1W2IA 5LJ5Y 4IUFA 1OMSA 3R7BB 2MLYA 3AD8C 1SV5B 2HVEA 3MEEB 2KJVA 2CPDA 1LFPA 2RIJA 4C48A 1VBLA 4C8ZA 1FX2A 2FHOB 3ZO7A 1LLZA 1ELOA 1GXLA 2JLGA 5BXIA 5IT9U 1NK5A 2HNDB 3IBCB 5KT5A 4OZ5A 1KTQA 2DT9A 4WE1B 4J7CA 5CHCB 3KUEA 4N77A 1OPZA 1UZDA 3I0SA 3S7RA 2DHHA 4WFBQ 4TVAB 1IDKA 1RCXB 1UJ6A 5A2QU 2HVHA 1NDCA 2FHMA 5KT6A 2AMCB 2YPYA 3U1NA 5KFTA 3IN5A 3IO1A 1BQNB 3H40A 3PYDA 1NHVA 2MLXA 2PA3A 4OJ1A 4RJVA 5D4NA 4DSJA 2H1YA 2V4JA 1XMQF 1HF2A 3MECA 4YS2A 4ZVFA 2GVZB 2EK6A 4F3MA 2XTWA 3SBMA 3C14B 6FDRA 3Q8QB 4U4BA 4U7UD 2WSEC 1B0VA 1S1UB 2VFNA 1LWEB 1X8DA 3B54A 3MM8B 2V2QA 2KXHA 3G4SS 2FLLA 1ACMB 2QYGA 4RNOA 1WUUA 1K8FA 1B99A 2XTXA 4KSEB 2C3OA 4ZVGA 2CQ1A 1NEEA 3MAHA 2DIUA 4LRAA 4QYZK 4NOHA 4U7CA 1RJJA 3HULA 2V9WA 4NXNJ 3TJ9A 3MFIA 2R8GA 1OY9A 1GMVA 4KT0C 3SYJA 1P1LA 1RWVB 1S1WA 1VQ5S 4QCLA 3I87A 3FSXA 3QO9A 2NT6A 2XTYA 3EQOA 2I0XA 3MM5B 2HMIB 4LF7J 4ID5B 4HEA9 3T1YJ 2BE7D 1K8AT 1QSLA 3TEHB 2FJEB 4LF5F 2Q43A 1REVB 3TI0A 3D9BA 3FY3A 4HKQA 2DR5A 1N4LA 2G2YA 2V2VA 4YB7A 1HMVA 4O3OA 2ZM6F 3PETA 1I94F 1VQ8S 2B9WA 2QV6A 3L7PA 4ZCMA 1P9QC 4X65J 2OD6A 3QBCA 3U1MA 4K7QA 2LCWA 2UU9J 1HQUB 2E29A 1JLAB 2D1CA 3HVAA 2MKSA 2UZAA 3GFYA 2MDAA 3BR9A 3GJRB 2DPJA 4CH1A 4GKKF 4B3RJ 1NXIA 4GO5X 2VBMA 5K5MA 4J9NA 1PYTA 3KLIB 2GAHC 4DL7A 4I0WA 3PO4A 4J9UE 3I4PA 2R7QA 3SCIE 4QQBA 2R2SA 1X0PA 2BJ7A 3M1VB 3JTOA 4OI6A 1SV5A 1CC8A 3PHEA 3R8YA 2HQCA 2BR0A 1IKXA 1FRMA 1Q8KA 2OEJA 3KWMA 4HHHA 5D0HA 2HRTA 2P6TA 3HCXA 1O8DA 2KHCA 2OMLA 3ZTQA 1CLWA 3VQSA 5HROB 4C9DA 1O8JA 2QC3A 2HS3A 4F8RA 4NZ7A 2FQQB 5CD4A 4F4WA 1DQ9A 2QEXS 3THPA 1ITPA 4I4BA 1UEKA 1NMEB 2GVDB 2HGMA 1IXKA 1FDNA 2C2OB 2FGOA 3B82A 4NLDA 2AYEA 4DWIA 2AD9A 2X1FA 2R7XA 3RBZA 1DURA 4Y0FA 2JH3A 4U9RA 1OYDA 3MPDA 4JUZA 1XIQA 4WFZA 2YKMB 4OLPA 3FMWA 2UXBJ 2OTJS 4KH1B 2E66A 3AQPA 2D9PA 1K1QA 4MKBA 3SQGB 1O8KA 1DY3A 3PEJA 1CULB 3HVTB 4GVLA 2Z2ZA 3P5BP 4ZHRA 2XYPB 3V6DB 2ZH4A 1FFGB 1OPIA 4LRDA 4I56A 2XMMA 2JLEA 4JI1F 4LRFA 1CJVB 3ZTSA 5A0YB 2V8DA 5H9FJ 1NHCA 1KTVA 3MFHA 3HHLA 1ZBTA 5ETLA 3CB4A 3H7HB 3MHYA 2B0RA 4KBIA 1FCAA 3T1AA 1S12A 1HARA 3TQEA 3ZSCA 1RT4B 2XZTB 1JLBA 3EGZA 4C98A 4MMOA 1PBUA 2ZHBA 3AJ1A 2ZDPA 3IXQA 5K9FA 4N5SA 2DNQA 3M8SA 2O17A 1N32F 3BPDA 4UUXA 2JZ5A 1PG5B 3BKTA 2CQ3A 2M52A 2OAUA 3DGPB 3DNCA 4CLSA 4TU9A 1SKSA 1QAJA 5F8MA 2P9EA 1E6YB 3OLBA 4Q43A 1SQEA 1RAAB 1HMVB 4ENOA 3OUYB 3R5CA 4HH1A 2WVEA 1C2PA 4FYYB 2EVZA 2LYVA 2Z2YB 2XT4A 4ECTA 3OL9A 1B70B 4DG1B 3H2VE 1RTHB 2W2MP 2AF6A 4HI2A 4WPAA 5AXKA 3M6WA 3M2UA 4U95A 1JLEA 1O8BA 4HDHA 3P96A 1MU2B 4WP9A 2DD8S 5D4PA 4FF4A 4TN2A 3I5BA 3CO9A 3ZTPA 3SXLA 4DN9A 1QCXA 1S1XA 1AXQA 2OEKA 1VC6A 1GK8A 4CH7A 4B9MA 3KDOA 4P2SA 4IRKA 3VWSA 5J2NB 4EYHB 1FKPB 3IRWP 1HHTP 3KLHB 3M2RA 2NS1B 3PFEA 1HQEA 3FCHA 2WAQD 4Y3CA 1JIHA 1FTRA 1RT5A 2GCFA 4E98A 2UVWA 2FJBB 4Q44A 2W2PP 3AK5A 3DOMB 2WSCC 3C14A 1BQMA 4N76A 5F8IA 3HMJG 3TR5A 2C28A 2W7AA 2HURA 2ZVIA 3R5JB 1JLCB 4ANCA 2KM8C 2FYXA 1XMQJ 4C8YA 3CD0A 2R7UA 2HQIA 2YX1A 4OZ0A 1U4BA 1ULRA 2V6AA 4DSKA 3LTOA 1KKHA 3G8SA 1IBCB 3OT9A 5HP1A 3BQ2A 1HNXF 1D9AA 4PUOA 2A3JA 1U0HA 2KT3A 1EX8A 1PJ7A 2WONA 3CNQP 2MXYA 3K58A 3J7A1 1B7FA 2SXLA 3M6UA 3KK2B 2XTJP 2JDJA 4R0JA 5DGBA 1RTIA 2VG6B 1QDUB 1FRKA 3PDNA 3MEGB 3VVUA 4TQSA 2R7WA 2HIQA 4JV1A 3CJ4A 3LGMA 4B3OB 4AFFA 3RBXA 3KHGA 2RUGA 4RUBA 1VLOA 5KFGA 2D69A 3UNGC 2D3UA 2VPZB 2YKQA 3B4MA 2WHOA 3HHKA 3PCOB 3QIPB 5HAOA 3B78A 2PECA 2XY7A 3T9GA 2MHEA 2PMHA 2V50A 3UR0A 2CNKB 1J5OA 1FO1A 1LWCA 3I6PA 4J91A 2HQDA 4Y34A 2PO4A 2ZUGA 4ES2A 2XC1A 2XGQA 3IMQJ 3FCWA 4NX9A 2L48A 1NNDA 4LBHA 2UP1A 4P52A 3BBCA 4UOHA 3MD1A 1FVSA 3UD5A 5BJRA 1JJ2R 3OD2A 2BE2B 3H4BA 2DITA 1TL7A 3C16B 3MMJA 3W7BA 1RK8A 3D1OA 4AD6A 3KLGB 4P9SA 4FS1A 2CJKA 1TL4A 4LF4F 2E5LJ 1CLFA 2RJZA 2ZITA 2UUAF 4I6AA 4GVBB 3WIVA 3M2VA 4EBEA 2F63A 4ED1A 1OY8A 3GR1A 1S6UA 3MM9A 1JLFA 3OUYA 1TK5A 3IR6B 1J27A 3R9LA 3KXDA 4RBUA 2H54B 2KU7A 3MAAB 1AUDA 1FRLA 3FEZA 3IWLA 3V81A 2ADBA 3UFCX 1WSVA 3MR3A 2UVEA 3JSRA 5A6PA 4A8KA 1RDRA 2EI5A 1H3DA 1RADB 4O4GB 3MAQA 3SV3A 3BDPA 1TYXA 1FE4A 2HGLA 3FBBA 4GC7A 3DRPA 4DBQA 1KOHA 3W5YA 4IO9Q 3P6YC 2P9CA 3EMTA 4AYBD 1VLYA 2D9OA 4JB8B 5EX0A 2W2OP 1S0MA 1NK0A 3CJRA 1BHEA 3UO0A 3EVWA 3WX4A 5E41A 3UNYA 4JI7J 5KG0A 3V6DA 4FXDA 2HNYB 3CIMA 1OWXA 3I4HX 4ZP8A 3RRGA 4X62F 3BSAA 1X0CA 2INUA 5F0UA 1TP7A 3SQGA 3OSNA 3T5HA 1X9SA 4M5IA 3KMQA 2CRLA 2M8DB 1Y10A 1N32J 4YC5A 4OI3A 3HHNB 3HFVA 2R4FA 2R2UA 2BABA 1HW8A 3OJSA 2NREA 2H5EA 2KB2A 3G8QA 3R5DA 4I2PA 3UN2A 4CLWA 1HD0A 1GMUA 1HWIA 2YNGA 1GQEA 3MMCA 3G6XA 3BSCA 5M2PA 2B4VA 3KJVA 1UVIA 4ED0A 1NRKA 3H8YA 2QRRA 1HKAA 2VBXA 1G6BA 3BB5A 1URRA 2Z8GA 3K5PA 4QOTA 4AXJA 4X4TA 4QU6A 2YH0A 4TY8A 3M7VA 4OHYA 2RKIA 3ZZUA 4DN0A 4DR6J 3GYNA 3HVTA 2ZBIA 2DNZA 1RWRA 4ZVEA 5KFZA 4E0DA 2X1AA 4KH0B 3U02A 3ILJA 4N8NA 4O44A 3LWMA 2A10A 3M1VA 1U1RA 4ED5A 1RLCL 1S57A 1TKDA 2UXBF 2IMWP 3Q8UA 1K9MT 3AB2B 2JRSA 4LFCF 3OR2A 2NSCA 3HSZA 3HFZB 2RDDA 2HSEB 1HD1A 4ZPAA 4ZKAA 1VBYA 2M4MA 2CDRB 3P4UB 2JC1A 4DSIA 3O5TB 3RRHA 4IRCA 3SUCA 1TAUA 1WC5A 3W2VA 2HZVA 1ZPWX 2XG8A 2E9RX 2CQ2A 2RQ4A 2AW0A 3D28A 1XWLA 2EK1A 2DB1A 2O3DA 2WB4A 4IQMA 5KT2A 2Q79A 1H38A 4PWDA 1FA0A 1YJUA 4PYAA 4DF8A 3PX6A 1Y5LB 1REVA 1JKHB 2HK3A 2K2PA 5LMNJ 1X4GA 3TUZC 3OXFA 5IC6B 2RF2B 1PAUB 1U0SA 2ZH3A 3MPVA 4N47A 4YEAA 5F8GA 3RR7A 3MM5A 3KG4A 3CJ8A 2KXNB 2KFYA 1EAYC 4YZ0A 1LK7A 2W4CA 3KHHA 2ZH2A 1FJEB 1ZH5A 2IYIA 4PKDB 2J7KA 2V63A 3PRVA 1HWJA 4ZA1A 3HPOA 1JKHA 4ZP7A 1QJHA 3MMAA 1U6BA 1TUWA 2QTWA 4KYZA 4NLRA 5DETA 3EUNA 3TQ1A 1MMDA 1ZZFA
chains in the Genus database with same CATH topology
3FCWA 2BM6A 3ML3A 3BBCA 4UOHA 3ZTRA 1MN7A 2DXFA 4O0NA 1PKUA 4S0MA 3FCVA 3BH7B 3RIQA 1NSPA 1HLWA 4C6AA 1NLKL 2HVDA 3PJ9A 2V5IA 1BHNA 2G0YA 1NUEA 3DDIA 4FKYA 4EK2A 3Q8YA 3MPDA 1WKLA 1UCNA 1NDKA 1XIQA 1B4SA 3R9LA 4WBFA 3VGVA 2W7ZA 1VYAA 3BH6B 1NDLA 4DZ6A 1WKJA 5IOLA 1HIYA 2BM5A 4UOGA 2DYAA 2VFMA 1TYUA 1TYXA 2BM4A 3NGUA 3FBBA 5JMCB 3ZTSA 2HVEA 3ETMA 1DABA 1U8WA 3EICA 3EMTA 2CWKA 3N6ZA 1S5ZA 2DXDA 2B0RA 4DUTA 2B8QA 1QQ1A 4OJOA 5BXIA 1K4ZA 2J8IA 3EVWA 3ENAA 5JLVC 5C7PA 4W98A 1NB2A 3EVOA 3ZTQA 1TYWA 3JS9A 2ZUAA 3H09A 1K44A 1NDCA 2NCKL 1QRBA 3ZTOA 1TYVA 3P4GA 3FBFA 4OM9A 3Q83A 3B6BA 3FBCA 4DI6A 4ENOA 4CP5A 3BBFA 1HF2A 3GPAA 1QRCA 3VGSA 2IOUG 3N90A 3LJYA 3ELHA 3G2XA 1NSQA 1NHKL 2VFOA 1XQIA 3TH0A 1JXVA 2VFNA 3B54A 3EM1A 3NGTA 3ZTPA 4F36A 4UOFA 1K8FA 1B99A 3VVTA 4FKXA 4OJ6A 1KQ5A 3Q86A 4OJ5A 3NGRA 1F6TA 1ZS6A 3LYCA 4OJPA 3SYJA 2VFPA 1S57A 3WX8A 3EE3A 3Q8UA 3AK5A 3JX8A 3FBEA 2F3LA 5CAAA 2HURA 4V02C 1QA1A 3NGSA 4HR2A 4ANCA 4OJLA 1QA2A 1NCLA 1WXRA 1BUXA 3PETA 1TSPA 1MN9A 2VU5A 3FKBA 2BM7A 1LWXA 3GP9A 2VFQA 1NPKA 1W7WA 2AZ3A 2DY9A 1LEOA 2BX6A 4ANEA 4JRAC 3VGTA 1PAEX 3BBBA 4F4AA 3VVUA 1KDNA 1HHQA 1EHWA 3FC9A 3SZEA 4OPWA 4KPCA 1BE4A 4ANDA 5CABA 2BEFA 1QA3A 2YUHA 1S59A 3EVMA 1NSKL 3PRVA 3Q8VA 1WKKA 2DXEA 4KH3A 2B8PA 1F3FA 3VGUA 3L7UA 2AZ1A 3DKDA 3EJMA 2XC1A 3Q89A 1NDPA 1CLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCW A;  3BBC A;  4UOH A;  3ZTR A;  1MN7 A;  2DXF A;  4O0N A;  1PKU A;  4S0M A;  3FCV A;  3BH7 B;  1NSP A;  1HLW A;  4C6A A;  1NLK L;  2HVD A;  3PJ9 A;  1BHN A;  1NUE A;  3DDI A;  4FKY A;  4EK2 A;  3Q8Y A;  3MPD A;  1WKL A;  1UCN A;  1NDK A;  1XIQ A;  1B4S A;  3R9L A;  4WBF A;  3VGV A;  4DZ6 A;  1VYA A;  3BH6 B;  1NDL A;  1WKJ A;  5IOL A;  1HIY A;  4UOG A;  2DYA A;  3NGU A;  3FBB A;  3ZTS A;  2HVE A;  3ETM A;  1U8W A;  3EIC A;  3EMT A;  2CWK A;  4DUT A;  1S5Z A;  2DXD A;  2B0R A;  2B8Q A;  5BXI A;  1K4Z A;  3EVW A;  3ENA A;  5C7P A;  4W98 A;  1NB2 A;  3EVO A;  3JS9 A;  2ZUA A;  1K44 A;  1NDC A;  2NCK L;  3ZTO A;  3FBF A;  3Q83 A;  3B6B A;  3FBC A;  4DI6 A;  4ENO A;  4CP5 A;  3BBF A;  1HF2 A;  3GPA A;  3VGS A;  3ELH A;  3G2X A;  1NSQ A;  1NHK L;  1XQI A;  1JXV A;  3B54 A;  3EM1 A;  3NGT A;  3ZTP A;  4F36 A;  4UOF A;  1B99 A;  1K8F A;  3VVT A;  4FKX A;  1KQ5 A;  3Q86 A;  3NGR A;  1F6T A;  1ZS6 A;  1S57 A;  3WX8 A;  3EE3 A;  3Q8U A;  3FBE A;  5CAA A;  2HUR A;  4V02 C;  4HR2 A;  3NGS A;  4ANC A;  1NCL A;  1BUX A;  1MN9 A;  2VU5 A;  3FKB A;  3GP9 A;  1LWX A;  1NPK A;  1W7W A;  2AZ3 A;  2DY9 A;  1LEO A;  2BX6 A;  4ANE A;  3VGT A;  1PAE X;  3BBB A;  4F4A A;  3VVU A;  1KDN A;  1HHQ A;  1EHW A;  3FC9 A;  4KPC A;  1BE4 A;  4AND A;  5CAB A;  2BEF A;  2YUH A;  1S59 A;  3EVM A;  1NSK L;  3PRV A;  3Q8V A;  1WKK A;  2DXE A;  2B8P A;  1F3F A;  3VGU A;  3L7U A;  2AZ1 A;  3DKD A;  3EJM A;  3ZTQ A;  3Q89 A;  1NDP A; 
#chains in the Genus database with same CATH topology
 5DLF A;  3QAT A;  3BO3 A;  1FWL A;  4RLE A;  2RT3 A;  4O4R A;  5LJ3 Y;  2MKK A;  3NGD A;  3Q24 A;  2UUC J;  5KFE A;  2HHQ A;  2VL1 A;  3R5B A;  1MN7 A;  4KY3 A;  4MH8 A;  4BC9 A;  2OTL S;  5HAN A;  4WCE Q;  3LOU A;  4I2P B;  1DRZ A;  4NCG B;  3IRX A;  1U1N A;  3PSZ A;  1BHN A;  3SY2 A;  3VV2 B;  4JI8 F;  3CCW A;  4XN0 A;  2K1R B;  1TR0 A;  3EWG A;  2CPX A;  4CT8 A;  2PD1 A;  1QVG R;  2FVQ A;  2CQP A;  2GIR A;  1RWX B;  3GSD A;  1RAJ A;  2FB0 A;  1OQ3 A;  1KQF B;  4DPW A;  4DQS A;  1N6Q B;  2HHH F;  2CPI A;  2BMB A;  2X3H A;  3M8Q B;  4IH6 A;  4NLQ A;  1OYE A;  3OFH A;  3QFW A;  4P74 A;  4QJV A;  4EYI B;  3NB2 A;  3LPE A;  2RS8 A;  1WHX A;  3KLF A;  1VQM S;  1U24 A;  1KHV A;  4J9V A;  2PII A;  1LFW A;  2PI5 A;  1S0O A;  5A8K A;  1IBK F;  5AE2 A;  3ETM A;  2J8K A;  3KLF B;  1U1M A;  5CYQ A;  4IOA Q;  4PEO A;  3W9H A;  2HYI B;  4N7T A;  3Q2T C;  1NJY A;  3KYL A;  2G13 A;  4IOC Q;  1DLO A;  5DRK A;  4BCA A;  2FJA B;  5B08 A;  4YY3 F;  2VFU A;  3KK1 B;  3MUR P;  2ASD A;  4XLE A;  1PC4 A;  3KOA A;  1RU4 A;  1F9E B;  2BQ3 A;  1KC8 T;  2FC8 A;  4NLT A;  2POK A;  4E8U A;  3RW6 A;  1HI8 A;  3CGI A;  1K44 A;  4R25 A;  1RAI B;  1TL5 A;  5KFF A;  2R8H A;  1KQS R;  2DGO A;  4G1P A;  3H5X A;  1FDB A;  1U09 A;  4ITS A;  4ECZ A;  2C2N A;  4HT5 A;  3TW0 A;  4DI6 A;  4F0M A;  4G1Q A;  3O3L A;  4P2X A;  4CP5 A;  1SB6 A;  2BAN B;  4DHV A;  4RUC A;  1L3T A;  2EFP A;  3DLG A;  5L1J A;  4X4V A;  3WQP A;  1APS A;  2OPP B;  4R8U A;  1WF2 A;  4Y65 A;  3TAN A;  3MR6 A;  1JX4 A;  2LDI A;  3LAM A;  2DNL A;  3N90 A;  2MZT A;  1NJI T;  2DR7 A;  2K3K A;  2Y8W A;  3QLH A;  4OJG A;  2AYG A;  1ZM3 A;  1AFI A;  1C1B B;  2DHS A;  3QRQ A;  4PXB A;  3EQN A;  1NH7 A;  5E3R A;  4RU9 A;  4NLW A;  1N36 F;  4KKO B;  2VJJ A;  4KGK A;  4AXI A;  4F36 A;  3C15 A;  4LBI A;  4DL5 A;  1M5S A;  4OZ2 A;  4ZCK A;  4OHX A;  3LAL A;  1LWC B;  2CQB A;  2GHP A;  2QMU B;  3NGR A;  2UUB J;  4YR0 A;  5KFV A;  4LRC A;  4ZLN A;  2ZEJ A;  1DTT A;  2ZWO A;  2F8M A;  5D15 A;  1H7W A;  4KKO A;  4M5J A;  4FF2 A;  1JJC B;  1Y11 A;  3PG9 A;  5J2Q B;  2MQN A;  4JI0 F;  1KLM B;  2ZH7 A;  1O8L A;  4OX6 A;  3TNV A;  4PCQ A;  3MUT P;  4J9S A;  1T03 B;  1WG1 A;  3MEG A;  1XMB A;  2ZHO A;  5D0E A;  4ZIV A;  2DGU A;  3CPW R;  5ETS A;  4LSZ B;  3RAX A;  4JI5 F;  2RU3 A;  5LMU F;  4EUV A;  4OYO A;  2DY9 A;  3CD5 A;  5EX3 A;  2I8E A;  2QX0 A;  2W9B A;  4CLY A;  3RB4 A;  3L7O A;  4W8T A;  4IOB A;  4NYZ A;  1T9U A;  4K8R A;  4PG7 A;  4L72 B;  5HJY A;  2KYX A;  2XS5 A;  4ILM A;  2PT0 A;  4DV6 J;  3KUG A;  2BQR A;  2B56 A;  2YWF A;  1RAO A;  4NLY A;  5I3U B;  3HM9 A;  1ZTW A;  3B90 A;  4RBV A;  2VJU A;  1RHJ B;  5F8J A;  2JEJ A;  3QSY B;  2W8L A;  2LP4 A;  2O1P A;  3UD4 P;  3PNI A;  5EWG A;  3GIM A;  2YXL A;  1SUQ B;  5A6W A;  1RTI B;  2VG6 A;  5EUH A;  3IBF B;  3QWP A;  2INV A;  1M1G A;  2QFJ A;  3BSN A;  4EBD A;  2ACM A;  3QWU A;  1D1U A;  1S48 A;  3ENW A;  5CD4 H;  2R2T A;  4QWC A;  5HLF A;  1MWY A;  2CVE A;  3M8Q A;  5D78 A;  5LM7 E;  3OTE A;  2GHW A;  2DXF A;  3GMG A;  4KC5 A;  4RBT A;  1N6Q A;  4YZX A;  3M2U B;  2EG1 A;  1F5A A;  4IYQ A;  4F67 A;  3CMQ A;  1HLW A;  3A8K A;  1N5S A;  4RO0 A;  4DV4 F;  4C0O C;  3PJ9 A;  4B3T F;  4LFB F;  1DJ0 A;  1UZH A;  2DGW A;  3W62 A;  4QWB A;  4FF1 A;  3Q8P B;  4J90 A;  1N5Y B;  4U8Y A;  1N34 J;  2X7I A;  1IUJ A;  1KVK A;  2MKC A;  3HDS A;  4MIB A;  4P7V A;  3M9O B;  1S1T A;  5C24 A;  5HAT A;  4OHV A;  3BH6 B;  3OSP A;  1UVM A;  2B9Y A;  1WKJ A;  4RW7 A;  4ZVU B;  3AB4 B;  3KLH A;  2YH1 A;  5ADZ A;  2MQQ A;  1GXU A;  3DHW C;  1IR2 A;  4XOR A;  1HIY A;  2DRD A;  2MLZ A;  3LGH A;  1RGV A;  3NL0 A;  4RW8 A;  1JLB B;  2R7R A;  3BGO P;  2GIF A;  4EGL A;  3NG8 A;  1S79 A;  5AXM A;  1PJ5 A;  2IIH A;  1B0P A;  2MQL A;  4XKW A;  1FI4 A;  4KE5 A;  1JLE B;  3MOZ A;  3P8B B;  4KGM A;  2ZJP Q;  2Q3P A;  4MJK A;  3RB3 A;  1QSY A;  1SC4 B;  2EKN A;  2KFZ A;  1FXR A;  1U7L A;  4XM3 A;  2XSJ A;  4RW4 A;  4XR6 A;  3UW1 A;  3JSM B;  2G0J A;  2BKO A;  4WZQ A;  1TL1 A;  2ASY A;  3VSU A;  3WWG A;  1RTJ B;  1YVF A;  1VRQ C;  3N9U C;  2DNR A;  2CJQ A;  2LXI A;  1MML A;  2ZOF A;  3S01 A;  1XNR J;  3RYL A;  3NLC A;  1YX2 A;  5B0A A;  3W2V B;  3JSY A;  2F3J A;  1BY9 A;  2XYH B;  1XJW B;  3B6B A;  3AD9 C;  3S1T A;  1U1O A;  2CZ4 A;  2Q6C A;  4AE5 A;  2DHX A;  1KCC A;  1WD6 A;  2OD4 A;  4F4K A;  5DG9 A;  2WB1 D;  1RA7 A;  2GVD A;  1OQ6 A;  2FVP A;  3IAS 9;  1NHK L;  1RT6 A;  3A3N B;  2RNE A;  2JFD A;  3VQT A;  1WF1 A;  4QIG A;  4NML A;  4PZV A;  3AHP A;  4NYP A;  3HHL B;  3W2W A;  5GMD A;  2B0G A;  3BJY A;  1IBK J;  1X5T A;  1SCJ B;  3CDE A;  3CJ2 A;  3CJ0 A;  4X4R A;  4LF6 F;  4WYW A;  2HBQ B;  2AX1 A;  2B43 A;  5FDL B;  5HRO A;  4MFB A;  1VQK S;  1VQO S;  4OX9 J;  1TQL A;  1R3N A;  2Z8Q A;  1RAH B;  1IKX B;  2VON A;  3QJL A;  3HI9 A;  2ZBP A;  2LQ8 A;  2XBP A;  2V94 A;  3HD2 A;  3OXL A;  2QLJ B;  3CDB A;  4ZN3 A;  2E5I A;  4DR1 J;  4NXM F;  1CBK A;  4ZOS A;  3L9Z A;  1T94 A;  1F1B B;  1G3O A;  2YKM A;  1RKI A;  2CYY A;  4F3Q A;  7FDR A;  2XNR A;  4DQQ A;  3DLL Q;  2XY6 A;  1SI9 A;  1R8H A;  2MPU A;  2NYH A;  3D6H B;  3PX0 A;  3DFE A;  2G2Z A;  3MTK A;  2OPP A;  4R8U B;  1T02 A;  1VQN S;  4PXE A;  3CJ3 A;  2BJ9 A;  2V68 A;  5F8H A;  1S4E A;  3QGP A;  3D68 A;  4MK9 A;  5F3Z A;  2XO6 A;  3SEO A;  2HFV A;  2XMJ A;  3A8J A;  4Y28 C;  5KG3 A;  3FKB A;  2HW3 A;  4Z7C A;  2NQP A;  3ILO A;  1VQS A;  1XMO J;  1M1K T;  4Z37 A;  1W26 A;  4DFP A;  2H5J B;  5KFU A;  4DLG A;  3N6N A;  3HHL D;  4B9S A;  3GG1 A;  2W9C A;  2DGT A;  5C25 A;  1U48 A;  1SVD A;  4DR4 J;  1S0V A;  2HWH A;  2J9D A;  3NOC A;  2E5G A;  1O8F A;  1DLO B;  2CAD A;  4I1T A;  4DV1 J;  1VQY A;  4CO2 A;  5JVH Q;  1HBM B;  1H7X A;  1D9D A;  2HMI A;  3EZ5 A;  3WZ0 A;  4WK1 A;  1Q95 G;  4HHU A;  2GQ2 A;  4HYK A;  2X6X A;  1Q8B A;  3IGN A;  4ZPT R;  2YUH A;  1OFE A;  3DRP B;  3SI8 A;  4CNY A;  2UVR A;  2QO3 A;  5IT9 Y;  1WKK A;  4P6Q A;  5EHH A;  1F3F A;  3VGU A;  2QT7 A;  4DR7 F;  1WOS A;  2AZ1 A;  1T0T V;  2JOQ A;  4DR7 J;  2CNO B;  1HQU A;  1UVL A;  2FUG 9;  4TU8 A;  4A48 A;  1V3Z A;  1FD2 A;  5CQG A;  3V81 B;  3ICL A;  2UXD J;  2GHV C;  3AXM A;  1LW2 A;  1WOP A;  3G8T A;  1QTN B;  5D77 A;  4KGV B;  3BR8 A;  2VBK A;  1JLF B;  4YEL A;  1SPB P;  2KT5 A;  4AL5 A;  2GVZ A;  4DQP A;  4LF2 A;  3I32 A;  3K5O A;  3LW5 C;  1XC9 A;  1L3U A;  2IBK A;  4KO0 A;  1CJK B;  1WEL A;  2CQG A;  2OPS B;  1MMN A;  3HZG A;  4P7T A;  3QT6 A;  3TA2 A;  4DZD A;  4ED7 A;  4LFC J;  1X5O A;  4QPX A;  1TL7 B;  3IAM 9;  5HSP A;  2FVR A;  2LEP A;  2EPI A;  5KFD A;  4A8S A;  4O23 A;  5HN0 A;  4XQF A;  2D74 B;  3EDR B;  2KG1 A;  1HNW F;  3MR7 A;  1NK8 A;  1RYR A;  2ZM6 J;  2KM8 B;  2J9E A;  5T41 A;  2EXU A;  2KN4 A;  2KYZ A;  2VFM A;  1FKO B;  5KFM A;  4B9N A;  2FHJ D;  2BM4 A;  3THT A;  4WTO B;  2ZH6 A;  2HPU A;  2YWH A;  3C66 A;  3VHQ A;  1UVJ A;  1TV6 A;  3AOB A;  4RW6 A;  4LF7 F;  1G1X A;  4JBC A;  4KGZ B;  4YFO A;  2Z2L A;  2FLP A;  5GAH I;  1SKU B;  2N7Y A;  4HI1 A;  4PG4 A;  3UDV A;  4B3S J;  5IM0 A;  2A0F B;  2VBW A;  2OKQ A;  4FXV A;  2QFI A;  5IC4 B;  3G96 A;  4J9K A;  4UUW A;  5HMX A;  4DV7 F;  2YBV A;  1FVQ A;  1M5V C;  4FDF A;  3T5J A;  3BYR A;  4EWT A;  4PYD A;  1JLG A;  1Q79 A;  2OSQ A;  4DPT A;  1F5C A;  3CJQ A;  1FXL A;  1HNW J;  2V8H A;  2JHE A;  3H5Y A;  4LF6 J;  4A46 A;  1R0B G;  5HP1 B;  1N52 B;  2NUH A;  4ALZ A;  4NYO A;  4ECQ A;  1RCO B;  4OM9 A;  3GB0 A;  2VQE J;  1Q78 A;  3FDS A;  1TKT A;  2B7B B;  3QRR A;  1LV5 A;  2HFO A;  3LMW A;  4NEZ A;  4B9V A;  2VPY B;  2J7U A;  1C0T B;  2Q1L A;  3BZQ A;  5THW A;  4GC6 A;  4CT9 A;  3SZ2 A;  1A0O B;  5IFM A;  3PVX A;  3QGH A;  1FXD A;  4MT1 A;  4FNH A;  4EW9 A;  3DOM A;  4DUZ J;  2G4B A;  4MAK A;  1OJ4 A;  5HMW A;  3BEG B;  3O2I A;  2DEI A;  2BW7 A;  1DTQ A;  2IM0 A;  1MWZ A;  2JSX A;  3VVT A;  2WK4 A;  2PFF B;  2XS7 A;  3NBP A;  1UW9 A;  3PV8 A;  1KQ5 A;  3K0J A;  5K8N A;  3M30 B;  4LJM A;  2ZJR Q;  1D8Y A;  3H20 A;  2NR0 A;  1ZS6 A;  1R0A B;  2GW8 A;  3C15 B;  3PYG A;  3S8S A;  3R97 A;  3C3L A;  5KG7 A;  1G2E A;  1TZ0 A;  3GFX A;  3OL8 A;  4NMX A;  1RT6 B;  4ECR A;  2J6U A;  2QL7 B;  3CDA A;  4YN3 B;  3VAK A;  4K4T A;  3W8G A;  2F3L A;  2B4P A;  1N0V C;  1JRG A;  3N6L A;  4AT1 B;  1S9G B;  2KHD A;  4BHQ A;  2MEW A;  5GAG U;  3ISZ A;  4LF4 J;  4ICL A;  2FGC A;  1Q82 T;  1FRI A;  1CS4 A;  3DOK B;  2P6S A;  3TVY A;  4A8Y A;  1RQ0 A;  2KRB A;  1GH8 A;  2BJ3 A;  2OSR A;  1IQT A;  1AZS B;  4XN3 A;  2DGV A;  2NXJ A;  1BXN A;  1V5I B;  1CJT B;  1Q5V A;  3G82 A;  5HJX A;  4ANE A;  2Y1L B;  1CQM A;  3SDE B;  1Y3J A;  3DRS B;  3POT B;  4UQT A;  3ZZP A;  4YDX A;  2KH9 A;  3GIJ A;  3GRH A;  4MXN A;  3CCR S;  1Q81 T;  1VBK A;  2MSS A;  2C3Y A;  2Z0G A;  4URR A;  3PHT A;  4O0I A;  3OJU A;  1DQA A;  3CVK A;  2IM3 A;  4DV4 J;  4LFB J;  1IKV A;  3BQ0 A;  1YZ7 A;  3J80 U;  2UVF A;  4B08 A;  1HHS A;  1U1L A;  4CTA B;  2UXC J;  2CQC A;  3MCM A;  4M5D A;  1CPZ A;  3J7Z T;  2FIU A;  3BV8 A;  4ZLJ A;  2MZ1 A;  4QWA A;  2M70 A;  1HQ2 A;  3T5K A;  2J7W A;  1CJV A;  3TYT A;  3JAM Y;  4XON A;  1V6H A;  2IQ7 A;  3DYA A;  1F9H A;  4WIQ A;  1I6J A;  2UUB F;  3V4M A;  5G0R B;  4PG8 A;  2WBR A;  4IG3 B;  4IFY B;  2YVS A;  4HAC B;  1HYS B;  5ETQ A;  1QAI A;  2DHG A;  2MTL A;  4KQZ A;  2ZC3 A;  3QGG A;  5B0F A;  2N4C A;  4DV3 J;  1DZ5 A;  1BWE A;  1LW0 B;  4FN5 A;  4B9U A;  3CUL A;  1VS3 A;  2OPQ B;  4HL9 A;  1X4C A;  3SFG A;  1NKB A;  3DOK A;  1CS4 B;  1YKW A;  2RDJ A;  2JEG A;  4KFB B;  2DNP A;  4ES1 A;  2GO9 A;  2G0Y A;  4XLF A;  1NUE A;  2H65 B;  2JVO A;  4OHZ A;  4RUA A;  1PIE A;  1RTZ A;  1SJQ A;  2FVC A;  2OPR B;  3PSS A;  1ZM9 A;  2CKW A;  2HWI A;  2N7C A;  1DBG A;  2LQ5 A;  5HO4 A;  2VD3 A;  2J0S D;  3JAM U;  3NP5 A;  4WTY A;  2LDY A;  5I4M A;  1QY7 A;  1QM9 A;  4M5K A;  5DQG A;  1N54 B;  3HJV A;  1XTZ A;  3GWC A;  2W7P A;  5HMZ A;  2QSF A;  2Z58 B;  2ASJ A;  2FC9 A;  3PRD A;  1S97 A;  1K47 A;  3MMA B;  2DYA A;  2APO A;  2A18 A;  2G1D A;  4L3K A;  1DTQ B;  4PXC A;  2D3O R;  3OFG A;  4OYP A;  2H9Z A;  2H4W B;  2RHQ B;  4H4M A;  2NXN A;  3UVJ B;  4K4X A;  2CUY A;  1KQG B;  1T9W A;  2YKP A;  5L38 A;  3BGR A;  3N6Z A;  1S5Z A;  1P1T A;  3ITH B;  3CJK B;  1FEH A;  4KIA A;  1ZAW A;  4UOC A;  4OJO A;  2IJF A;  3MEK A;  1DBO A;  2H3E B;  2XEX A;  3ENA A;  3PFO A;  3LP1 B;  1C0T A;  4M5N A;  1YQH A;  2DH7 A;  3CCQ S;  1QUV A;  4RKU C;  1PYO B;  3OTB A;  5EWF A;  3EPG A;  1HNZ F;  3VST A;  1VCT A;  1YK9 A;  2VAS A;  1UFL A;  2LXF A;  2QG9 B;  2VBY A;  1BN8 A;  1U0H B;  1NPR A;  2WON B;  2ZUA A;  4K5S A;  4Y2M A;  4ED3 A;  2QE5 A;  5HI7 A;  4OFZ A;  5LSR A;  3K17 A;  2GQQ A;  4I69 A;  3CD6 S;  4JV5 F;  1Q4R A;  4TLR A;  3TVZ A;  1GMW A;  1F5B A;  4LT6 A;  7FD1 A;  4CQ1 A;  3T3F A;  2ZOM A;  3BBF A;  2BSP A;  1EET A;  2VKZ G;  3A8E A;  4J9M A;  4Z05 A;  1TUV A;  2G2O A;  4Y2C A;  2W2Q P;  5IM0 B;  2Q6B A;  3G2X A;  4F3O A;  5J2P A;  5J2Q A;  4WFA Q;  3FK4 A;  2VC1 A;  2BZ2 A;  3M8W A;  3RRK A;  3GTY X;  4L3N A;  2A2D A;  2HAI A;  3OR2 B;  3LP2 B;  2R42 A;  4NRU A;  2F4F A;  4CLF A;  2GMJ A;  3NGT A;  2E1P A;  3GLJ A;  3QAE A;  4LVO P;  3GFZ A;  4DV1 F;  4NZ0 A;  1WG5 A;  2M3D A;  3W9J A;  3PR4 A;  2VA3 A;  1U2F A;  1S0N A;  2BJ8 A;  1IQZ A;  2Z2M A;  4ZN1 A;  5KFP A;  4ECU A;  4Q8F A;  3IC1 A;  4YR2 A;  1CVJ A;  1S1X B;  4YY3 J;  4PR6 A;  2FHK A;  3AT1 B;  3QJJ A;  1O88 A;  3EGW B;  2VFP A;  2QMX A;  4DL3 A;  5K20 B;  2E5J A;  2VDI A;  3MM8 A;  4ZPB A;  5LSL A;  3J7Z 5;  1C1B A;  2YQ3 A;  3MZI A;  3M8Y A;  1LQ9 A;  2YNG B;  2LU1 A;  3PW2 A;  4OYZ A;  5E3A A;  5A8R B;  4CZC A;  3H2L A;  4RUH A;  2WBM A;  1FK9 A;  3DLG B;  4OJL A;  2KVI A;  2F5G A;  3NWG A;  2P8I A;  2RD5 C;  4I2Q A;  4YHH J;  2XMA A;  3ZZY A;  2ZE2 B;  3TAM B;  1IKW A;  1LW2 B;  1R8B A;  2OH2 A;  5ETV A;  2C3M A;  3R3T A;  2NLW A;  2O6W A;  1S9E A;  4DX7 A;  4NXN F;  2MGZ A;  5F9L A;  2ZHA A;  1S6Q A;  3MCS A;  2W7O A;  5FII A;  5L1K A;  2IA6 A;  2AJ2 A;  3EXY A;  1J2V A;  1IKY A;  4MTP A;  4WE1 A;  1F0X A;  4OZJ A;  1LWF B;  2J6S A;  2HND A;  1KN6 A;  5K8O A;  3SSS A;  3AOD A;  4RNF A;  4YDD B;  4ECW A;  1NJW A;  1MRO A;  5DDQ C;  4PQU B;  1WC1 A;  1KFD A;  1D09 B;  1WG4 A;  4ZLP A;  1IKY B;  2EFO A;  1D0E A;  2B8P A;  2I2Y A;  2UVV A;  2AJ0 A;  3KKF A;  3KNA A;  3EJM A;  1RI7 A;  4LF9 F;  2RAQ A;  1RSC A;  3GR0 A;  4ETX A;  3UCZ P;  4DR6 F;  2CQD A;  1OFL A;  4EK2 A;  4X65 F;  4LSN B;  5HK4 A;  4CLT A;  1X7V A;  3TUP A;  4I67 A;  3MD3 A;  3B4N A;  4XKV A;  1EZZ B;  2NXE A;  3HSJ A;  3KLE A;  1WSR A;  3GON A;  4NZ6 A;  2ROE A;  3IGV A;  3I56 S;  4JI4 J;  3GV8 B;  2PN6 A;  3TJ8 A;  3DM2 A;  4IFV A;  3D54 A;  2GJ2 A;  3SSQ A;  2Y8Y A;  2Y9H A;  2RRN A;  3OFF A;  2X51 A;  1PSD A;  2B6A B;  2F40 A;  4NK6 A;  2AGQ A;  5RUB A;  3DU6 A;  2DNM A;  1IJF B;  4YZA A;  5KFX A;  2XY5 A;  2B4O A;  4JV5 J;  4EMD A;  2PDA A;  1QJV A;  2JX2 A;  2XC9 A;  1B7Y B;  1ARO P;  2XWX A;  3GYX B;  2FZK B;  3TZW A;  5I3P A;  2CIM A;  5CCL A;  2W4P A;  2MQO A;  4DLE A;  3QGI A;  1UA0 A;  2RIL A;  3MDF A;  2DBB A;  3US5 A;  3TX0 A;  4ECV A;  3LP1 A;  3NGU A;  1VQ7 S;  4JI7 F;  1UVK A;  4CLU A;  1LNQ A;  2WVD A;  1Q5Y A;  1FRH A;  4B3M F;  4XDC A;  2MMY A;  3NY0 A;  5HBM B;  1U8W A;  1UW4 A;  1YJT A;  2I5J A;  4P72 A;  4X64 F;  1RHQ B;  1D8Z A;  3KK3 A;  4DL4 A;  1VBZ A;  3GQ9 A;  3MXH P;  1C4A A;  4DDF A;  4JI6 J;  5JLV C;  2P2C B;  3F56 A;  2C2K B;  3DLJ A;  3QPI A;  4RX6 A;  5GMK a;  3A3O B;  4XPC A;  2W8K A;  3QRP A;  2GS8 A;  1IWG A;  2ABY A;  5A76 A;  3G6E S;  2R9L A;  3J81 U;  2ILZ A;  3HX9 A;  4PUO B;  4FPI A;  2VBE A;  1RBL A;  1TYV A;  2CDQ A;  1TL3 A;  2I9S A;  5DS7 A;  1X9W A;  1TU0 B;  3HSG A;  4O3R A;  5L9X A;  5ETR A;  5AT1 B;  4CM2 A;  3DRR B;  4DX6 A;  4OI0 A;  9ATC B;  3NS5 A;  4M63 A;  1AB8 A;  1GNK A;  2RVJ A;  1RUS A;  2MY7 A;  3TH0 A;  2FTR A;  4C0H A;  3N28 A;  4CYU A;  4WZM A;  3HHD A;  4LUB A;  2A6O A;  1MNE A;  4KGX B;  5FD1 A;  2VKR A;  3NCP A;  3JQJ A;  4UOF A;  4Y00 A;  3K8W A;  1V9O A;  3SFU A;  1FKP A;  4FKX A;  2HVZ A;  2QZ8 A;  3SCK E;  1Y0H A;  2V8G A;  4F25 A;  4X62 J;  1KVJ A;  1NK9 A;  4YEJ A;  4ZPC A;  3CCE S;  1RT2 A;  1YTY A;  3M8R A;  4EZ9 A;  2ODL A;  2Q66 A;  3KJV B;  2O04 A;  2MZR A;  5KFO A;  4K4V A;  1SKW A;  1ZAX A;  2IM2 A;  4M5D B;  4ZVO B;  1BMQ B;  5L1L A;  3VAH A;  1TFW A;  2NT9 A;  3ILL A;  5K14 B;  4HWV A;  2OP5 A;  2DTJ A;  3MMB A;  4V1A k;  4E2F B;  5CAA A;  2B7C B;  3K59 A;  3BO2 A;  2XLI A;  1QA1 A;  4WKR A;  3SV4 A;  3H42 A;  3DDK A;  2MST A;  2YY3 A;  3UD3 P;  2BW2 A;  3SCJ E;  1S1V A;  1NCL A;  3MWB A;  4MYU A;  2ZNZ A;  2L08 A;  3BRE A;  4A8Q A;  2JEI A;  4RNM A;  3HFK A;  3KG1 A;  1LEO A;  1A6L A;  2BX6 A;  1KOO A;  3MPY A;  4ZLL A;  7AT1 B;  3PM9 A;  3RBD A;  3QID A;  2QA1 A;  2HRU A;  2FD2 A;  4HHJ A;  4YP3 A;  2AHO B;  3AA9 A;  1X4A A;  2RU9 A;  3TAR A;  2AQ4 A;  2RQM A;  1S6O A;  2CPZ A;  2VFS A;  3NNH A;  2HHP A;  2K06 A;  1VQL S;  4RW9 A;  3CDU A;  1HHQ A;  5EDW A;  2RQC A;  1RT4 A;  4Z7Y A;  2YNI B;  3DLK A;  1TMJ A;  4JI8 J;  1OSC A;  1F2G A;  4DU7 A;  2AV5 A;  4J37 A;  2GZO A;  5D4L A;  2HIY A;  4I84 A;  4UZB A;  3W5Z A;  1QA3 A;  4B3M J;  1RT7 A;  1YRU A;  2O01 C;  1RWU A;  2XMT A;  4O4G A;  5AXL A;  2PI4 A;  1JNZ B;  2DNH A;  2QLW A;  2DIV A;  3B4D A;  4XLC A;  3GIR A;  3L7U A;  4WFX A;  3DKD A;  4ZVH A;  2F8E X;  3VCD A;  2QLB B;  4QR0 A;  3SDE A;  3WC0 A;  1NDP A;  3MAA A;  4Q5V A;  3QZ7 A;  4OL8 A;  1JJ4 A;  2BOP A;  2DGQ A;  1H0H B;  4PWW A;  2DCU B;  3CIZ A;  3MM9 B;  3OTO F;  4O0N A;  4L75 A;  4S0M A;  1LK5 A;  3FCV A;  4USV A;  5CCM A;  4GVB A;  3RJM B;  2COL A;  5E5N A;  2XUL A;  3PJW A;  4USH A;  4ELT A;  2MZS A;  1X4B A;  4ELV A;  1Q0N A;  1X0F A;  1T9Y A;  2YPZ A;  3DDI A;  3UW0 A;  1KLM A;  2AX0 A;  4FKY A;  1TKT B;  4JI4 F;  3O1L A;  2BE2 A;  1ZM4 A;  4UY8 T;  4Q0B A;  3W5X A;  5IQQ A;  3FMB A;  1EB0 A;  1VMB A;  3TAP A;  2QYU A;  4WBF A;  1M1H A;  2ZKU A;  1DTT B;  6AT1 B;  3OPK A;  4DR5 J;  4LSN A;  1S72 S;  3BF4 A;  4DSE A;  2JVR A;  4BS2 A;  4Q0B B;  2L9D A;  1KBR A;  3N4W A;  3PW5 A;  1DQ8 A;  5GVQ A;  1YJ7 A;  1FNX H;  4WXO A;  3ZZT A;  1HNZ J;  5I42 B;  4H4O A;  2FY1 A;  1UKU A;  1C0U A;  1FE0 A;  3N5F A;  3QNW B;  2CJ9 A;  1WTB A;  4W8Q A;  4DFK A;  3V6K A;  4M8L A;  2E7W A;  3UN3 A;  3UDE A;  2FVS A;  5H9F K;  1HR0 J;  4JI3 F;  2DHA A;  1ICE B;  2VBZ A;  2IYG A;  4NK8 A;  1FFS B;  5A8K B;  1CEZ A;  2G1H A;  3NMR A;  4ER8 A;  1GAO A;  4RWX A;  1LKZ A;  1FWK A;  2CQH A;  1SC1 B;  4G65 A;  1PJ6 A;  1WHW A;  2GC8 A;  5L8R C;  4ZJL A;  4W98 A;  4EO8 A;  1H80 A;  4DCJ B;  5IWA J;  3VAG A;  4C8L A;  1JLQ B;  4U6P A;  2YNF B;  3GII A;  1TVR B;  1HWU A;  4JV0 A;  1ZOT A;  2H4Y B;  3FQL A;  3WBZ A;  2IBO A;  5LXR A;  5C1E A;  3Q83 A;  3R6G B;  3A13 A;  1KRP A;  1VBX A;  2LU2 A;  1TKZ A;  2R3V A;  1J5E J;  2DR8 A;  4A8F A;  3GQA A;  1I5O B;  1CJK A;  2W1B A;  3QT5 A;  1YZ6 A;  1RAF B;  2BKN A;  4ZMM A;  4DV0 F;  2J0Q D;  4LSL B;  2CQI A;  3I31 A;  4OJ3 A;  1NSQ A;  3BQ1 A;  1RWK B;  1UA1 A;  4ID5 A;  1JXV A;  1I1G A;  2C2E A;  2XLJ A;  4LFA F;  4DR2 J;  3PW0 A;  4EI2 A;  1TV6 B;  2YWW A;  3EM1 A;  5H9E K;  2Y1R I;  3EGN A;  5KFS A;  4YR3 A;  3FRY A;  2LA6 A;  5FLX Y;  2DGS A;  3FNN A;  5JXS A;  1GX6 A;  3SQV A;  5IQ6 A;  4XPE A;  4HVZ A;  2WW4 A;  2OUG A;  4F2S A;  4JYA J;  1GQ8 A;  2VDH A;  1RIS A;  4TQR A;  1HL6 A;  4WFY A;  1H6K X;  1NPP A;  5GAE U;  1QAX A;  3JQK A;  3OW2 R;  4N41 A;  2R7S A;  3RB0 A;  3DDN A;  2HHV A;  1C1C A;  1Y4Z B;  4XL9 A;  2EFN A;  4ZVT B;  3N6M A;  2IJN A;  2RML A;  3JX8 A;  4CYU B;  2XI2 A;  3AA8 A;  3WDO A;  1IBL J;  5KT4 A;  1KFS A;  5J2P B;  3Q22 A;  4JI1 J;  4FYV B;  4KO0 B;  4QYR A;  1XBW A;  2V8V A;  4NCG A;  4EO6 A;  1WMR A;  4YDT A;  2E9Z A;  2WZ1 A;  4KV8 B;  1KR4 A;  4C8M A;  4DMZ A;  5LSO A;  1TL3 B;  2DRA A;  3GP9 A;  3MED B;  1LWX A;  5GAE I;  4HTJ A;  1U8S A;  4I68 A;  2DK2 A;  2QYC A;  3FSY A;  2FY8 A;  3DOL B;  2CPE A;  1TKX B;  4HT7 A;  4CDI A;  2CNN B;  1VIO A;  3PTW A;  3TRG A;  2J8A A;  4A8X A;  4DV7 J;  3T1H F;  1OO0 B;  3JXO A;  3W66 A;  2UV8 G;  1H2U X;  1DAX A;  2BA9 A;  5D8H B;  1JNR B;  4DCO B;  4N56 A;  1LXN A;  3VTI A;  4QW9 A;  4UY8 5;  2EEY A;  2NPI A;  2N82 B;  2M2B A;  3HXM A;  1L3S A;  1VHF A;  4O3P A;  4P75 A;  3UCU P;  5BYR A;  2V0N A;  1N5V A;  1HNV A;  1SJ1 A;  2ZBC A;  4H4M B;  5JJB A;  5T14 A;  1EIY B;  1C0U B;  1MSW D;  3KJN B;  1U2C A;  2DH8 A;  2DXE A;  1UMJ A;  2CPH A;  4TYB A;  2F7V A;  5EGY A;  1U6Z A;  3DRY A;  2HQ3 A;  1N0U A;  2C3U A;  2J8S A;  4FXW A;  6FD1 A;  4V19 J;  2EBG A;  1YSJ A;  5DZ6 A;  5KG1 A;  3D1Q A;  3R1L A;  3ML3 A;  4MIW A;  4IR1 A;  1UAW A;  2J0W A;  1QE1 B;  4ZCL A;  2ILY A;  3W9I A;  4MK8 A;  2IFX A;  1RKJ A;  3LWL A;  1QSS A;  1PKU A;  1UJ5 A;  2OPR A;  3DGV A;  4M95 A;  1UWB A;  2V34 A;  3MF5 A;  1WF0 A;  3D0I E;  3PYE A;  4DV0 J;  5IXU A;  4K4W A;  5CYM A;  1YG0 A;  1Z4U A;  2CWX A;  1NK4 A;  4KB7 A;  1LOU A;  1WEX A;  2OPQ A;  2VQE F;  1B4S A;  4URQ U;  2XI3 A;  4P2M A;  1PC5 A;  2VJI A;  4PPD A;  3C6T A;  1NDL A;  4MKA A;  4RWW A;  3DU5 A;  2ACY A;  4M5G A;  5C2G A;  1N88 A;  1T9X A;  2DO0 A;  2C22 A;  1T05 B;  1IVZ A;  1KNZ A;  2BM5 A;  3O6Q A;  4UQG A;  1N5T A;  2HFU A;  2XSJ B;  1VC5 A;  5GAD I;  3TVK A;  3HP6 A;  1HNV B;  3GCX P;  4TNO A;  4CO0 A;  4B3S F;  1DAB A;  2DNY A;  2BRK A;  1XN9 A;  2CWK A;  2DXD A;  4DUT A;  2VG5 A;  2Z57 B;  2B8Q A;  2RUS A;  1JQG A;  2ZKT A;  4CTA A;  4CLZ A;  4K0K F;  4QW8 A;  2BM0 A;  2D7S A;  1Y00 A;  4OZN A;  2E5L F;  1HFE L;  1BWV A;  2MZJ A;  4G3I A;  1OGO X;  2BQU A;  3M4X A;  1T3N A;  3HO1 A;  2KL8 A;  2MGZ B;  1R6V A;  2IRU A;  5GAD U;  1TUG B;  1WC4 A;  3DOL A;  3V4I A;  2WRM A;  4YB5 A;  2NCK L;  3CMA S;  1SH2 A;  5DM7 Q;  1CJT A;  1BGX T;  1FNO A;  1O8I A;  1GTH A;  1SQG A;  1EA0 A;  5IZH A;  1FWP A;  5J2M B;  1AZS A;  1D9F A;  4J9L A;  2DR9 A;  1RA6 A;  3CE8 A;  2AGP A;  1NK6 A;  3KHR A;  2XMV A;  3I9V 9;  5DZ7 A;  4RW4 B;  4K50 A;  1RTD A;  2C3P A;  5A8R A;  3NXZ A;  4XAK A;  2XT2 A;  2LQJ A;  1DAR A;  2EFG A;  3JYT B;  1OGM X;  5KFK A;  4LR9 A;  1HBO A;  1KP6 A;  1NH8 A;  1S1W B;  1SH0 A;  2CFX A;  1SH3 A;  5G4D A;  3GIL A;  2E44 A;  1PCA A;  1QVF R;  5HLF B;  4C8O A;  5GAG I;  3NGK A;  2YWG A;  5KFR A;  1UPP A;  3QAU A;  4NL5 A;  1Y3K A;  1SUQ A;  3A4T A;  3OL7 A;  2R7T A;  3U27 A;  3T6B A;  5E2Q A;  1I51 B;  3G6Y A;  4YOE A;  4NLS A;  2PFD A;  4RNH A;  3LUY A;  4WXW A;  3LGN A;  4PWU A;  4NEY A;  4XNF A;  2B3T B;  1PGZ A;  1WWH A;  2HZC A;  4QBU A;  1L3V A;  2NTQ A;  3D4J A;  1RU2 A;  2CJB A;  1FER A;  4F2R A;  5DM6 Q;  4B3O A;  4PG5 A;  5U47 A;  3Q8S B;  1HBN A;  3NGS A;  2WVC A;  4NLO A;  2BUN A;  3TUI C;  2NXC A;  4DEZ A;  1M5P C;  3QZ8 A;  2J6T A;  3KTQ A;  2HKE A;  1J5E F;  3PKM A;  4OV6 A;  3C16 A;  4CO3 A;  3GG0 A;  1SL0 A;  4QPT A;  2AJQ A;  2OEM A;  1R27 B;  1RLD A;  2HVI A;  5KFH A;  1TVR A;  1XMO F;  2HLT A;  2K7J A;  2GMH A;  2W2N P;  5A2Q Y;  4FF3 A;  1FJG J;  4JI2 J;  4FPR A;  2MQ8 A;  4PRF A;  2ERR A;  1VK8 A;  3BBB A;  4C0B A;  1UJ4 A;  3TZX A;  2R8I A;  3PR5 B;  2VZ9 A;  2CPY A;  2Z56 B;  3VMW A;  1KDN A;  2DPI A;  4B9T A;  3GQ7 A;  4LF8 J;  2ZD1 A;  1T9V A;  4NLG A;  4OPW A;  3CJK A;  3OLA A;  2VF3 A;  3SSR A;  4OMF G;  1U1Q A;  1U1P A;  2LMI A;  4JI0 J;  4KHP J;  4F4X A;  3OHB A;  5HQ8 A;  1YBA A;  4RW6 B;  4OZY A;  3ZPP A;  5B0G A;  1WHV A;  1H98 A;  4X66 J;  3PKY A;  1XR6 A;  2IVY A;  3Q8V A;  1R7I A;  4K2J A;  5AJ3 F;  1TK8 A;  2PGC A;  1MLA A;  3G87 A;  4I6Y A;  3UDC A;  2YTC A;  8ATC B;  1NKC A;  2DO4 A;  3DHX A;  2IA0 A;  1VIX A;  2RB7 A;  3C2P A;  1XER A;  4X4N A;  4WII A;  3FZ2 A;  2JNJ A;  1YIT S;  2M9K A;  2XCA A;  1N36 J;  3MR5 A;  1Y9O A;  2O0W A;  2GNK A;  3M32 B;  1PXZ A;  3R5A A;  5DQH A;  3QLH B;  2AU0 A;  3BH7 B;  2DRB A;  1B64 A;  2HAF A;  2DIS A;  2HEK A;  1HBN B;  2GQC A;  2HVD A;  3MGJ A;  4GRS A;  4OX8 A;  4U7U K;  2YQ0 A;  2QX3 A;  3KRG A;  2B51 A;  5L39 A;  2VQF J;  5KT3 A;  4P2F A;  2BAN A;  2J76 E;  1R0C B;  2NZM A;  1R43 A;  1WDD A;  5ETM A;  1NDK A;  1LW0 A;  2LLZ A;  2VFV A;  2WSF C;  3MPW A;  4K2X A;  4KHM A;  3AJD A;  3M6V A;  4LR8 A;  4RR5 A;  1N33 J;  1RT3 A;  2W7Z A;  1Y7P A;  4DOZ A;  3FFI A;  3ULH A;  3VR1 A;  1D3W A;  4QWE A;  2AEF A;  2KO1 A;  4IG3 A;  4Y2A A;  2HFN A;  3H0P A;  2I6W A;  1PYS B;  5J1P A;  4D3H A;  1RBA A;  2M88 A;  5AE3 A;  5CZV A;  5AXN A;  4KAI A;  4NI2 A;  2HNZ A;  1X4F A;  3UQS A;  4ES3 A;  1U47 A;  1YWX A;  3VSV A;  4EFA C;  4DQR A;  1MRO B;  3LP0 B;  1WOR A;  2PMW A;  3UN5 A;  4W8R A;  2E7V A;  1IKV B;  1JK9 B;  1YBU A;  2C2Z B;  3NCQ A;  4HH0 A;  4J5O A;  1S99 A;  3QT7 A;  5ETT A;  4XLH A;  4QR1 A;  5F41 A;  4C3M A;  4USM A;  5C7P A;  5D3G B;  1ZET A;  3ZZZ A;  2IPO B;  1F60 B;  3GYG A;  2QA4 S;  2AJF E;  4NLU A;  4DR4 F;  3LQV A;  1TYW A;  2XZW A;  4L76 A;  1S9E B;  3C6T B;  2LEA A;  1SJR A;  3HHL C;  1WI6 A;  1WC0 A;  1IM6 A;  1IKW B;  2BKP A;  2IVM A;  2ZZT A;  3CTR A;  3I5C A;  5HMY A;  1N34 F;  1WC3 A;  2LA4 A;  4C2L A;  4JI5 J;  4W90 B;  1KHW A;  1RWN B;  1FRX A;  5F0W A;  3KJQ B;  4WWS A;  1YI2 S;  3AXK A;  3GPA A;  5KFY A;  3FEX B;  2P9G A;  1RWW B;  3MMB B;  3RAQ A;  1Q7Y T;  1KD1 T;  5KG2 A;  4K0K J;  3KG0 A;  4USU A;  8AT1 B;  2F9J A;  2VG5 B;  1U2R A;  2PEH A;  1RHM B;  1RB0 A;  2DNN A;  2CJY B;  3AD7 C;  2L9N A;  3HF5 A;  3CCM S;  2OGU A;  1FX4 A;  1NJZ A;  4B3R F;  1P6T A;  3LH2 S;  1H2V Z;  2HK2 A;  4H54 A;  5HVH A;  4CIO A;  3I5A A;  1VR6 A;  4ZHR B;  4OJ5 A;  5MAO A;  4MFB B;  3V6H A;  3QFH A;  2MQM A;  2YNH A;  3GQ8 A;  4OZZ A;  4OJP A;  1Q86 T;  2FJV A;  2V8P A;  4KJI A;  2GA7 A;  1RWO B;  3WX8 A;  3QYY A;  3CCJ S;  3W2W B;  3CT9 A;  1YLX A;  4IDK B;  4LIW A;  3K5M A;  1HNI A;  3KLV A;  4JV2 A;  2QL5 B;  3R2D J;  4DXL A;  4QIF A;  5CYM B;  1U02 A;  1T95 A;  2QGF B;  4IKA A;  4O3S A;  2OLW A;  1XK8 A;  5HVF A;  3T1Y F;  3B8H A;  1AT1 B;  1JLA A;  2XWY A;  1V3S A;  1BUX A;  1NO8 A;  4ZPD A;  1N8R T;  1VQP S;  1R6Y A;  3DN9 A;  1Q8L A;  2V5H G;  2LEC A;  2IMO A;  3R1H A;  2QJ3 A;  2AZ3 A;  3VMV A;  5FLX U;  4XOP A;  3CF5 Q;  3R2C J;  1UPM B;  3T19 A;  3CCZ A;  4QWD A;  2NSP A;  3FRZ A;  2VV5 A;  2QLF B;  4ID8 A;  4KV8 A;  5LOQ A;  1RAE B;  2DNG A;  3NAH A;  3HD1 A;  4URS A;  3H59 A;  3D0H E;  1SQF A;  4JI6 F;  2Z4P A;  4ECY A;  4DR3 J;  3OQ2 A;  3EX7 B;  1HNI B;  2I5J B;  3OVB A;  4DL2 A;  2XZD B;  3KLI A;  3EZU A;  3OV7 A;  1IA5 A;  2VJV A;  3EVM A;  5BYS A;  3HZE A;  1P9Y A;  1FKO A;  3FVY A;  3BKF A;  4ED4 A;  1FJC A;  4KH3 A;  1M5H A;  2HLU A;  3CC4 S;  3HT0 A;  2NUU G;  2AWZ A;  1L3K A;  4PWD B;  1QAY A;  2IC3 B;  1TKX A;  3CED A;  2GFF A;  5KG5 A;  1S1U A;  2V4Q A;  2HHH J;  3MMC B;  1IBM J;  3IA0 A;  4DX5 A;  5IV3 A;  2AKW B;  1HPZ B;  2XMK A;  4DPY A;  2OPS A;  2ZH1 A;  1GT8 A;  1NSP A;  4DR3 F;  1N48 A;  5E0O A;  3GU0 A;  2NTB A;  3MEC B;  4FVC A;  2XQC A;  1AW0 A;  3G86 A;  3DC2 A;  4FBT A;  2R8J A;  2CPJ A;  4AVZ A;  2E1M C;  4CRJ A;  4U49 A;  1RBO B;  1YJR A;  2BVZ A;  1X5P A;  3RU0 A;  2CQ0 A;  5L1I A;  1JXL A;  2IAJ B;  3CW2 C;  1VRT A;  2F65 A;  1RE1 B;  3K89 A;  1FNM A;  4Z03 A;  1E6V B;  2RDI A;  1HG8 A;  2D3Z A;  2HZA A;  4IRD A;  3X1L B;  5G0R A;  4C7Q A;  2DNO A;  3NWR A;  4TY8 B;  1B0T A;  4G1I A;  4PPZ A;  1LLW A;  2QL9 B;  3BPS P;  4KPY A;  1K1S A;  4ELU A;  4Y6I A;  5K8M A;  1ZM2 A;  3BM7 A;  3ONQ A;  5LXY A;  4FBU A;  3PO5 A;  2O0V A;  5IV4 A;  1FTC A;  3D5M A;  4FYX B;  2JEF A;  1ZYQ A;  2AP6 A;  2R8K A;  5I3U A;  3P3D A;  2J8I A;  1AUS L;  3BS9 A;  3W3S A;  4DQI A;  4Q2M A;  5I42 A;  3PEH A;  4PAB A;  1SXL A;  2CNL B;  2OO4 A;  2N3O A;  4TLQ A;  3ZNJ 1;  1S6Q B;  2QA2 A;  5D0G A;  2VA2 A;  1XNQ F;  2DGX A;  2W9B B;  3H09 A;  4XLA A;  3G82 B;  3UR3 C;  4I6W A;  2X6Y A;  2O67 A;  3P4G A;  2G9O A;  2YNF A;  3BN7 A;  3GJS B;  1OY6 A;  1IB4 A;  2OFH X;  2OHD A;  4OYM A;  4P10 A;  4ERD A;  1PLU A;  4DCP B;  3Q0A A;  3M2V B;  5J1E B;  1M0S A;  1XR7 A;  3VGS A;  3EXC X;  4V19 X;  2X6W A;  1O8G A;  2UUA J;  5D3G A;  1HR0 F;  1BD6 A;  2ZJQ Q;  4FNI A;  1KEK A;  3PIO Q;  4XDD A;  3LP0 A;  1K5C A;  4DJB A;  4F0K A;  4X64 J;  2UUC F;  4OLO A;  4FVM A;  1FDA A;  3CD7 A;  3VF0 B;  3NNA A;  9RUB A;  2L41 A;  1R0A A;  2YKA A;  2E7X A;  2HNZ B;  2P5V A;  2RH3 A;  5T7L B;  4W8S A;  1FFW B;  2MZQ A;  4LVN P;  1JMT A;  4OJ6 A;  2EC2 A;  2EG2 A;  4Y2I A;  2FJD B;  2KVQ E;  3GIK A;  5E3P A;  2DJW A;  5FDL A;  3W64 A;  2UUT A;  2XCP A;  1JXE A;  1RT7 B;  3AOA A;  4ZJQ A;  8RUC A;  3W60 A;  3B8Y A;  3FGV A;  3L4B C;  4OIX A;  3UPF A;  1XG2 A;  4U8V A;  4X4Q A;  3LP2 A;  1YJN S;  3MI7 X;  1M5O C;  4D3G A;  1Q1K A;  1EQM A;  2OEL A;  3UE2 A;  2ADC A;  1AA1 B;  1O8H A;  4RL1 A;  4J9Q A;  2ZD1 B;  4QR2 A;  4URG A;  1X4H A;  3JTP A;  2J9C A;  2XS2 A;  3IR7 B;  4LF1 A;  3KK2 A;  1MG7 A;  1FT8 A;  3HSD A;  4G1Q B;  4L74 A;  1MN9 A;  2VU5 A;  2BJD A;  3GJQ B;  4MKV A;  1S76 D;  3RTV A;  5ITH A;  4F26 A;  3C19 A;  2OFG X;  4F7V A;  4B02 A;  2MKY A;  4EZ6 A;  1HNX J;  3MPU B;  4KHR A;  4JRA C;  1RTJ A;  2QSW A;  3IFE A;  2IHR 1;  4CNZ A;  1TL1 B;  2MKI A;  1RT1 A;  4USJ C;  2FPH X;  3DLH A;  4LRE A;  5E3Q A;  3BSO A;  1NU4 A;  1QD1 A;  2BE9 B;  2CJA A;  2WVB A;  2UV8 A;  3WHI A;  2ALZ A;  5DNS A;  2C42 A;  2KZM A;  1EHW A;  2LKZ A;  3QSI A;  3SZE A;  4W4M A;  4KPC A;  2OIH A;  1PIL A;  3ITH A;  3BGR B;  5ETN A;  4CO5 A;  5BR8 F;  3NRB A;  3U7J A;  5A8W B;  3BGF A;  5M2R A;  1UVN A;  1S4F A;  4RW8 B;  1NSK L;  2W4D A;  4Z06 A;  4XTT A;  3TZZ A;  1YJW S;  2U1A A;  1K73 T;  1EJ7 L;  1X4D A;  3AAW B;  2MJU A;  3RW7 A;  3CCL S;  5MLC V;  3J7Y U;  4YB6 A;  4DL0 C;  3J81 Y;  4RZR A;  5J2N A;  3TAQ A;  1O8M A;  1CZF A;  4U67 Q;  4B17 A;  2KT2 A;  3NS6 A;  3F73 A;  3NAI A;  2HHW A;  1WJ9 A;  1KCD A;  5C5J A;  1HBU B;  3DI6 B;  3OR1 A;  1RMG A;  4UT4 A;  1N5Y A;  3V6J A;  4ECS A;  4IR9 A;  1GFW B;  2GV1 A;  2J5A A;  3RIQ A;  2V9K A;  4CCH A;  2RQK A;  2HBR B;  2YX7 A;  4HDG A;  1YBT A;  1RHR B;  4C6A A;  1GMW D;  4YZQ A;  4Q7A A;  2WVF A;  3T9Z A;  3PIP Q;  4AL6 A;  3TA0 A;  1U49 A;  1T8E A;  5K14 A;  2L9W A;  2OI2 A;  3L95 X;  1HPZ A;  4ZS6 A;  1U25 A;  2QZA A;  4EEY A;  5B0B A;  5J2M A;  3BKU A;  1V3R A;  2AGO A;  1TFY A;  1FJG F;  2K3I A;  4A8M P;  2VFR A;  1S6P B;  1REG X;  1HYS A;  1RT2 B;  2M5Y A;  3NS7 B;  5IOL A;  4BLG A;  4IH5 A;  3X3U A;  2E1A A;  5CYJ A;  2XGP A;  4NE9 C;  4FYW B;  3F0N A;  1TYU A;  4YEI A;  1NHU A;  1OFM A;  5JMC B;  4ILR A;  4M94 A;  4IG0 B;  2DEJ A;  2V2Z A;  2HRY A;  2QLX A;  3EIC A;  2VUG A;  5HBM A;  2PA8 D;  3JYT A;  2UXC F;  1SC3 B;  2ALY B;  3DLE B;  1O0P A;  1Q7L B;  1K4Z A;  1YRT A;  2RF2 A;  3CJT A;  2F4V J;  3ADA C;  3H90 A;  1UWA A;  1WTF A;  3I9Z A;  1H2T Z;  1IWA A;  2VFT A;  2YKN A;  3N01 A;  1T05 A;  4USK A;  3EVO A;  3TJA A;  3DLB A;  2ZDO A;  5KAK A;  2M8H A;  2FLO A;  4ZIW A;  2CJX B;  1YGY A;  4YHH F;  4ZIT A;  1FRJ A;  3D7S B;  2J0X A;  1VRU A;  4TYA A;  1X60 A;  4DV2 J;  1XNQ J;  1EP4 B;  4I7F B;  2G0C A;  4CO1 A;  3A12 A;  5DDP C;  3OL6 A;  2HHT A;  4UZC A;  1CJU A;  1VQ9 S;  5ETO A;  3MTJ A;  5DJB A;  3VAL A;  3FJ2 A;  3TP2 A;  4QIV A;  2NZ4 A;  2VFO A;  3GJT B;  4UTG A;  3CC7 S;  1TMM A;  3RUB L;  4DV5 F;  4IDK A;  2IRY A;  1L5U A;  3TA1 A;  2KFN A;  1RWP B;  3D0G E;  1Y5I B;  2V2K A;  5A0Y A;  4F4Y A;  1RAC B;  4QIE A;  3R7N B;  1C4C A;  5L9N A;  4USW A;  2XNQ A;  4F50 A;  1QTM A;  2R7O A;  3K8V A;  5GME A;  4BWJ A;  3W61 A;  1BC6 A;  1EKS A;  2ZFH A;  4PXD A;  3DXB A;  1AYE A;  2K7K A;  2ASL A;  3EE3 A;  4DUZ F;  2B6A A;  2AEJ A;  3CJS A;  2BXJ A;  5B0D A;  1LWF A;  2HBY B;  4NLP A;  2DR6 A;  1KS2 A;  5DG8 A;  3KNG A;  1EAR A;  2VOP A;  1RXO B;  3AH6 A;  1CJU B;  2HS0 A;  1UWB B;  1K0T A;  3OFE A;  3VAF A;  1HI1 A;  1RHK B;  2HHS A;  2ZZN A;  3JQM A;  3KHL A;  1FF2 A;  3BYP A;  3KLE B;  1UFW A;  2UU9 F;  2YX4 A;  2O5D A;  3D67 A;  3V5R A;  1T9T A;  4CO4 A;  5M2U A;  4NA2 A;  1SL2 A;  4F04 B;  1Q8I A;  4K59 A;  1W2B R;  1KLN A;  5IT0 A;  4I2Q B;  4CI0 B;  2R2R A;  5E3C A;  2KZZ A;  3C46 A;  1UEV A;  4PQA A;  1WI8 A;  2VC0 A;  3TOQ A;  3CO0 P;  2HQF A;  4BC7 A;  1FK9 B;  1EQ0 A;  4F4A A;  3IBW A;  5KFQ A;  2M0G B;  5KOX A;  2RE1 A;  2L3M A;  3EYZ A;  4X4O A;  3AFG A;  4DL6 A;  3BO4 A;  2EWH A;  5F8L A;  1BE4 A;  3KUH A;  1CSJ A;  4MK7 A;  2MY8 A;  4M5H A;  4KHP F;  2V4R A;  2CPF A;  3IG1 A;  4X2B A;  1H74 A;  1S59 A;  2HHX A;  2YWE A;  1WC6 A;  2QY1 A;  3SCL E;  4N8O A;  2ZBQ A;  4NI2 B;  1U45 A;  2J9D E;  3VAM A;  1H72 C;  3HKW A;  4X4U A;  1CC7 A;  3A1Y G;  3K5L A;  3E2E A;  4XOT A;  2CG8 A;  4JI2 F;  1E6V A;  4DPU A;  1SIZ A;  3AQO A;  3M8P A;  3HT3 A;  1JTA A;  1S6P A;  1S1T B;  2IAJ A;  2AT1 B;  2LVW A;  1V5V A;  2RRB A;  4OZL A;  5C24 B;  5HVG A;  3NKY A;  3PXG a;  3ZNU A;  4ED8 A;  3ENQ A;  1HA1 A;  5CXT A;  2KKH A;  4L73 A;  2YWK A;  3P45 B;  4LSL A;  2K1R A;  3W8P A;  1YIJ S;  2FJW A;  2VIH A;  3D3C J;  1SJF A;  2OJ3 A;  2IY5 B;  1KWM A;  3LPY A;  5CH7 B;  4J9R A;  4EBC A;  1R31 A;  2BJE A;  3RB6 A;  2YKO A;  3QO9 B;  1RHU B;  4NRT A;  5E7O B;  2IVF B;  2XMU A;  4C2M A;  2PC6 A;  3HVR A;  3M8P B;  4Z2X A;  4ZK7 M;  2KDO A;  3W63 A;  1PO6 A;  4YFU A;  3I96 A;  2IC3 A;  1S7H A;  3G71 S;  2Z30 B;  1X5S A;  4NLV A;  3D6T B;  2F9D A;  2WTF A;  4LRB A;  3TEG A;  3CCS S;  3PRB A;  2HFZ A;  1N5Q A;  4B9L A;  1IDJ A;  2DCL A;  4MR0 A;  2QN6 B;  3IG1 B;  4BWM A;  3S6E A;  4DFM A;  4WF9 Q;  1LWE A;  1FEE A;  1UP1 A;  3QIP A;  5EN1 A;  1G4C A;  4USI A;  3K5N A;  4FYD A;  3OHA A;  3AY0 A;  1YRX A;  3NEK A;  3UVJ A;  1I3O B;  2CZ9 A;  2IJR A;  4P71 A;  5KG6 A;  1VHI A;  5K8P A;  4IQX A;  3TUJ C;  4DUY J;  2PYH A;  4GKK J;  4IO1 A;  1TKZ B;  5C25 B;  3ET6 B;  1RT1 B;  1VJW A;  3FZB A;  1UEU A;  3D1H A;  5JUM A;  3H5U A;  2X1B A;  2A6M A;  1UL3 A;  1VQ4 S;  1XR5 A;  4ZPV R;  1YJV A;  1X31 C;  1KSP A;  3FEY B;  1TK0 A;  4RNN A;  4DR2 F;  2XHC A;  2EKY A;  3CJ5 A;  3SQO P;  4XMY A;  3MM7 A;  3N5B A;  5DGA A;  1S77 D;  1I94 J;  2NST A;  2BM1 A;  4K4Y A;  3QJP A;  3UI3 A;  3PW7 A;  2BV3 A;  1FHT A;  2GJI A;  1QRC A;  4X66 F;  1U6F A;  1WOO A;  4X4P A;  3J80 Y;  3MCN A;  4ECX A;  3CC2 S;  3SYZ A;  1BQM B;  3NOG A;  1ZA1 B;  5SUH A;  1KVI A;  2B5J B;  4FS2 A;  2NTP A;  3MEE A;  2B9X A;  2YNH B;  4WP3 A;  4R5P B;  3H4D A;  3GV5 B;  3M2R B;  4XK8 C;  4DR1 F;  4Y2K A;  1YJ9 S;  2AIR B;  5BYQ A;  2OMO A;  3OTD A;  3J81 j;  3TX8 A;  4YB1 P;  2LQ9 A;  3LYC A;  2BBE A;  4QZV B;  4FZV A;  4LIR A;  3CCU S;  4K4U A;  3O44 A;  4JI3 J;  2N3L A;  1N33 F;  1OIA A;  1WEY A;  1WAC A;  2CA9 A;  1MU2 A;  2H5I B;  2HWT A;  3RG6 A;  5IT4 A;  2QA4 G;  1VJQ A;  2EFQ A;  1WNE A;  4A8W A;  2C2M B;  4KFB A;  4V02 C;  4HR2 A;  5C42 A;  5H1S V;  2MHN A;  2C2D A;  5FJ4 A;  1GX5 A;  3RGI A;  5B7W A;  2WOM B;  1SL1 A;  2JL9 A;  3O8W A;  1VRU B;  2NZC A;  1RZM A;  2I1R A;  1F3V A;  1CQN A;  4OYB A;  3HJF A;  4OJH A;  4W92 B;  4NAS A;  1NPK A;  1W7W A;  2ATL A;  2ATC B;  2PEB A;  2HS4 A;  2Y1I A;  3A3P B;  4NLX A;  2BDP A;  3IM8 A;  1SC6 A;  2FDN A;  4HAC A;  2HNY A;  1S1V B;  1DBD A;  2VPW B;  4OV1 A;  2C2R A;  3JSM A;  1RAG B;  1HWK A;  1NZ8 A;  2LQB A;  2ROP A;  2IM1 A;  3C6U A;  3DYA B;  3IM9 A;  4TXS A;  1X4E A;  3KK1 A;  3PX4 A;  2E5H A;  4JOU A;  4M5M A;  4ZCI A;  1WEZ A;  4R0E A;  3V2U C;  2HHU A;  5CYQ B;  1NZA A;  4AND A;  2VB6 A;  1OFD A;  2DKO B;  3CCT A;  4IG0 A;  2ZH8 A;  3ILI A;  2BEF A;  4LF8 F;  4A4J A;  5KFI A;  3M9N B;  4NA1 A;  4RW9 B;  4ZVR B;  1VC0 A;  3T1H J;  4AUK A;  5DG7 A;  1H73 A;  2GGP A;  1TTH B;  3N0V A;  4LBP A;  3MUM P;  1Z2L A;  1NJX A;  1W25 A;  2DH9 A;  2V69 A;  3A8I A;  3QT8 A;  3SIP B;  5HQM A;  3Q89 A;  4RW7 B;  1FJ7 A;  3Q23 A;  1NSA A;  1SJ4 P;  4MYT A;  1RT3 B;  1RYS A;  1GXT A;  1A9N B;  4BBY A;  3AJ2 A;  4PMH A;  2CVI A;  4DV5 J;  1N56 A;  4DSF A;  2ZZM A;  3WIU A;  3H98 A;  3R7S B;  1T7P A;  3HHE A;  3D2W A;  2FHJ A;  5C42 B;  4DUY F;  5KFB A;  4B3T J;  4C8N A;  3GCW P;  4WK3 A;  2FZC B;  2VG7 B;  3MM7 B;  3SMZ A;  3PAC A;  1WKL A;  1IBL F;  4AL7 A;  2DY1 A;  3OR1 B;  2HFS A;  1QE1 A;  4DPX A;  3DMJ A;  5SZT A;  3PY8 A;  4DZ6 A;  2UXD F;  1VYA A;  2PSZ A;  2ROG A;  4HLB A;  3T5L A;  4BDP A;  3J7A N;  4RPF A;  3P5T L;  4HTI A;  5B09 A;  3ET6 A;  4PG6 A;  3DCA A;  3ZFV A;  1J5O B;  2CZV C;  4OYA A;  4DS5 A;  3D6M B;  3LO3 A;  5DQI A;  4R5P A;  3MM6 A;  2F4V F;  4KTQ A;  3ZZO A;  2B5J A;  3M8Z A;  1MWQ A;  3R27 A;  3KK3 B;  3J7Y I;  4WJB A;  3AOC A;  4KR0 B;  5D6G A;  4QIW D;  2QIF A;  4WP8 A;  4DV6 F;  2X1G A;  4DPO A;  2ZOG A;  3HKZ D;  3DRR A;  3RZA A;  3JB9 k;  4ZDN A;  1X9M A;  4OI4 A;  2GML A;  1IM4 A;  1OS5 A;  4MIA A;  2LFV A;  5JMN A;  1FES A;  4LQ3 A;  3MOJ B;  1BLU A;  2WW8 A;  4OZ3 A;  1SBR A;  4ZP6 A;  4PAA A;  3I55 S;  1XNR F;  2XMW A;  1MW7 A;  1OOC A;  2VPX B;  3E8O A;  3FBF A;  4UW2 A;  1VIS A;  2MB0 B;  3FBC A;  4A47 A;  3OTC A;  3R6L B;  2ZWP A;  4OHW A;  2GJF A;  3ZZ0 A;  1ZZN A;  1G7C B;  2YQ1 A;  1JLC A;  3M05 A;  1VK3 A;  3EGV A;  3LAK A;  3VZI A;  2D3O 1;  4ED6 A;  1T03 A;  4LF5 J;  3HK2 A;  3NMA A;  3DM2 B;  3FQK A;  4IFV B;  4WKY A;  2AJ4 A;  2VH7 A;  4XIU A;  1XQI A;  4TU7 A;  4DU8 A;  4OZ1 A;  3NNC A;  4DF4 A;  1RT5 B;  1ZPV A;  1HQE B;  2NYI A;  2XYG B;  3CUN A;  1EZG A;  3GFH A;  2XLK A;  4NXM J;  4H4K C;  2IDL A;  2V67 A;  3CSK A;  2PYG A;  2CQ4 A;  4ZVS B;  4YUD A;  3CCV S;  2RRA A;  3Q86 A;  4OX9 F;  2MJN A;  1JWW A;  2RKI B;  2G0I A;  5T7L A;  3K2Y A;  3ZXW A;  3OVS A;  2RS2 A;  1F6T A;  1DFD A;  2ZVS A;  2JJ4 D;  4ZP9 A;  3GV7 B;  1VDH A;  3M6X A;  1IN0 A;  3IS9 B;  2M7S A;  2MKH A;  5BR8 J;  1M90 T;  1O5J A;  3ETO A;  5CZX A;  2E1R A;  5DO2 A;  1HBM A;  2MYF A;  3FBE A;  3GE9 A;  3H2U B;  1RTH A;  4XO0 A;  3L3C A;  1RTD B;  2VOD A;  3HLU A;  4I64 A;  2NPF A;  1IR1 A;  1NB7 A;  3R5G A;  2XM3 A;  1S9F A;  1QA2 A;  3RR8 A;  4DX8 H;  1WXR A;  2KG0 A;  3W1Y C;  2W9C B;  1TSP A;  4O3N A;  2BM7 A;  3IR5 B;  1BQN A;  2KI2 A;  3FUY A;  2XHW A;  4FP9 A;  2VFQ A;  3LA0 A;  5KG4 A;  3ZC4 A;  1AFJ A;  1KTW A;  2ZE2 A;  3TAM A;  2E1C A;  2F8H A;  3VGT A;  2WCX A;  3EPI A;  1JLQ A;  2ZC4 A;  2HBZ B;  3E3X A;  2ZH9 A;  3G9C A;  3I0S B;  1R89 A;  4JYA F;  2KTQ A;  1UET A;  1BQX A;  2HGN A;  1KQK A;  4NWB A;  2X3D A;  4M5L A;  4ATN A;  3FC9 A;  4YQW A;  4RU2 A;  3MR2 A;  1NKE A;  4OQJ A;  3N79 A;  1OSD A;  4PQU A;  1JJH A;  4CM0 A;  1IBM F;  3CME S;  1QLN A;  3IS9 A;  1WHY A;  5AMV A;  4UF4 A;  4OYX A;  4LQ9 A;  3UWT A;  2W9A A;  5I3Q A;  1U26 A;  1M5K C;  3WC2 A;  2VIC A;  3KJF B;  4CLP A;  4LF9 J;  4ZJO A;  5GAH U;  2I38 A;  4YCQ A;  1P8G A;  1UFK A;  1FDD A;  3LAN A;  4ZPW R;  4X4S A;  4DV2 F;  3D3B J;  2W25 A;  1U1K A;  1VRT B;  2EC0 A;  3L09 A;  4WFN Q;  5DDR C;  5ETK A;  4C8K A;  4MKY A;  4GKJ F;  3ZTR A;  1RP5 A;  1ZA2 B;  1HW9 A;  2GAG C;  2C1E B;  5IWA F;  3K57 A;  3UDL A;  1Z1Z A;  2CAJ A;  4GMK A;  1T3O A;  5DLG A;  2X85 A;  3PW4 A;  4ETZ A;  3T6J A;  3EDQ B;  1P27 B;  3IRX B;  2ZBR A;  2R7V A;  2B4U A;  5E33 A;  1RWM B;  3OBI A;  4A8O A;  4I7F A;  1QUP A;  5DDO C;  1SKR A;  5KFJ A;  2BAC A;  2Y0B B;  3Q8Y A;  4G6V B;  1Q53 A;  1UCN A;  2JC0 A;  2KJW A;  1VOM A;  3VGV A;  4TY9 A;  2AJ1 A;  4YME A;  5B0C A;  3RBE A;  2XB2 D;  3QMQ A;  2JFK A;  4C11 A;  3H25 A;  5HL7 Q;  3ZZR A;  2ZH5 A;  5ETP A;  4ILL A;  3TZY A;  4LMZ A;  2KRR A;  2O1D A;  1SJ3 P;  2ZNY A;  1HWL A;  1TAQ A;  3CDW A;  1CG2 A;  4H4K A;  4DS4 A;  4GO7 X;  3NCR A;  4LFA J;  4O3Q A;  2B9E A;  3F41 A;  3OVA A;  4C3K A;  3D6F B;  2FZG B;  2D41 A;  2W01 A;  5F8N A;  1QQ1 A;  2YNI A;  3DLK B;  3MM6 B;  5LL6 d;  1Y5N B;  2QXZ A;  2NXU A;  4OYW A;  5C2C A;  2MQP A;  5EWE A;  4OYI A;  3D66 A;  2E9T A;  3ENV A;  3P49 B;  1S10 A;  1EET B;  5F3T A;  2O66 A;  2PMZ D;  1O6X A;  3H5S A;  1EP4 A;  1NB2 A;  3GSI A;  5HQL A;  2HG4 A;  2MKJ A;  3JS9 A;  5H9E J;  1PE9 A;  3JSB A;  3TWZ A;  4ZVP B;  1NM2 A;  3IWN C;  3DMJ B;  1S49 A;  1B3T A;  1QRB A;  3ZTO A;  1VI7 A;  4OX7 A;  2VOO A;  1AIR A;  1PBA A;  3MED A;  3E01 A;  4ED2 A;  2VG7 A;  3MCO A;  2YKN B;  5CA5 A;  2DVI A;  4CLK A;  2BYC A;  2U2F A;  2BOA A;  5J1N A;  2W24 A;  2VHG A;  3I0R A;  2IOU G;  3ELH A;  3LJY A;  2DNK A;  3DLE A;  4JP8 A;  5LT5 A;  2AYB A;  1ZTT A;  2H51 B;  3M9M B;  3C8Y A;  4WU3 A;  1C1C B;  3PZP A;  5IS2 A;  1LM1 A;  1HBU A;  2K8G A;  3DI6 A;  1HI0 P;  3F44 A;  1EE6 A;  3OXG A;  2IDE A;  3LF0 A;  4O44 B;  5B0E A;  1IJE B;  4K5R A;  1IR0 A;  4CWB A;  4L6V 3;  4IFY A;  4DFJ A;  1RU1 A;  5D4O A;  4AQY J;  4AQY F;  5KFA A;  4KRW A;  2HQG A;  3VZH A;  5C1C A;  1KON A;  2RHS B;  4Q45 A;  5AJ3 J;  1URN A;  4DR5 F;  4F02 A;  3BN4 A;  2BJ1 A;  1NK7 A;  1S7I A;  3IP0 A;  3BGL A;  5KFL A;  5KFW A;  2EWE A;  5A8W A;  5KOW A;  1HBO B;  3GZ7 A;  4ZVQ B;  3Q8R B;  3GQC A;  2UVU A;  3KDN A;  4K4S A;  2QMW A;  2CXE A;  1ROF A;  2BRL A;  5KT7 A;  1DHM A;  3G6V A;  2Y0S D;  2JWN A;  3I0R B;  1Q16 B;  3ISN D;  1YHQ S;  2XSF A;  4DG1 A;  3C6U B;  2V4J B;  2PE8 A;  4QYZ J;  2Y1J A;  3IWX A;  3U1L A;  3OTO J;  5KFC A;  1SIW B;  2FLN A;  2N4D A;  3E01 B;  4NCB A;  3RAM A;  4IH7 A;  1E6Y A;  3JTN A;  4J9O A;  3HVW A;  3DGP A;  2UUW A;  1T11 A;  1UTA A;  4NPO A;  1PAE X;  2IRX A;  3QQC D;  1VFJ A;  4F0H A;  2WOM A;  4CH0 S;  4F4Z A;  3V4I B;  2GGP B;  2H48 B;  4NCA A;  2EBE A;  4K4Z A;  1L1I A;  2GO8 A;  5JVG Q;  1S9G A;  2VQF F;  2NSB A;  3NAW A;  4DSL A;  1R8C A;  3T9N A;  2RSQ A;  4C3L A;  5F9N A;  4UST A;  3DRX A;  5KFN A;  3CXC R;  1FKA F;  1NBE B;  2FJX A;  5D0R A;  5CAB A;  4Q8E A;  3KMS A;  3T41 A;  3DU1 X;  4C97 A;  2LEB A;  4DV3 F;  4OI1 A;  1A7G E;  5L46 A;  1F2H A;  1RAB B;  2GIQ A;  3DXS X;  4H4O B;  1NAQ A;  2CG4 A;  3JUR A;  5LMN F;  4LR7 A;  2Y3Y A;  3M30 A;  1YDL A;  3VAJ A;  3PYF A;  4OI2 A;  3NBP B;  1GEH A;  1CUL A;  3DRS A;  3POT A;  4WU2 A;  3BDE A;  3E51 A;  3FFI B;  4C11 B;  5AE1 A;  5KTQ A;  2BM6 A;  4CLL A;  2AYM A;  4EU0 A;  4U96 A;  5LMU J;  3TO8 A;  2KXF A;  4X84 A;  1VGY A;  2A2C A;  3KFW X;  3THV A;  1K0V A;  1GTE A;  4NA3 A;  1WDT A;  1F9F A;  3Q2S C;  1Z2Z A;  2EW9 A;  4ICL B;  2JLF A;  2XO7 A;  1NLK L;  3PJX A;  4GKJ J;  2V5I A;  2GX8 A;  3FSI A;  3KLG A;  3CWJ A;  3ISN C;  5J1E A;  1TEL A;  4J9P A;  4C4W A;  1VQ6 S;  3M32 A;  1LXJ A;  3I82 A;  4TKT A;  2EFV A;  1EKR A;  3BGU A;  3EZO A;  4Q2L A;  1O51 A;  3W65 A;  1JB0 C;  4QU7 A;  1FD8 A;  1XEZ A;  4WYL A;  3VAI A;  2X3G A;  4M1K A;  1R8P A;  1O8E A;  1JLG B;  4P73 A;  3UCG A;  1R8A A;  2LXU A;  3MUV P;  1ZAV A;  2A1B A;  2AEM A;  2F1F A;  3K7R A;  4UOG A;  1W2I A;  5LJ5 Y;  4IUF A;  1OMS A;  3R7B B;  2MLY A;  3AD8 C;  1SV5 B;  2HVE A;  3MEE B;  2KJV A;  2CPD A;  1LFP A;  2RIJ A;  4C48 A;  1VBL A;  4C8Z A;  1FX2 A;  2FHO B;  3ZO7 A;  1LLZ A;  1ELO A;  1GXL A;  2JLG A;  5BXI A;  5IT9 U;  1NK5 A;  2HND B;  3IBC B;  5KT5 A;  4OZ5 A;  1KTQ A;  2DT9 A;  4WE1 B;  4J7C A;  5CHC B;  3KUE A;  4N77 A;  1OPZ A;  1UZD A;  3I0S A;  3S7R A;  2DHH A;  4WFB Q;  4TVA B;  1IDK A;  1RCX B;  1UJ6 A;  5A2Q U;  2HVH A;  1NDC A;  2FHM A;  5KT6 A;  2AMC B;  2YPY A;  3U1N A;  5KFT A;  3IN5 A;  3IO1 A;  1BQN B;  3H40 A;  3PYD A;  1NHV A;  2MLX A;  2PA3 A;  4OJ1 A;  4RJV A;  5D4N A;  4DSJ A;  2H1Y A;  2V4J A;  1XMQ F;  1HF2 A;  3MEC A;  4YS2 A;  4ZVF A;  2GVZ B;  2EK6 A;  4F3M A;  2XTW A;  3SBM A;  3C14 B;  6FDR A;  3Q8Q B;  4U4B A;  4U7U D;  2WSE C;  1B0V A;  1S1U B;  2VFN A;  1LWE B;  1X8D A;  3B54 A;  3MM8 B;  2V2Q A;  2KXH A;  3G4S S;  2FLL A;  1ACM B;  2QYG A;  4RNO A;  1WUU A;  1K8F A;  1B99 A;  2XTX A;  4KSE B;  2C3O A;  4ZVG A;  2CQ1 A;  1NEE A;  3MAH A;  2DIU A;  4LRA A;  4QYZ K;  4NOH A;  4U7C A;  1RJJ A;  3HUL A;  2V9W A;  4NXN J;  3TJ9 A;  3MFI A;  2R8G A;  1OY9 A;  1GMV A;  4KT0 C;  3SYJ A;  1P1L A;  1RWV B;  1S1W A;  1VQ5 S;  4QCL A;  3I87 A;  3FSX A;  3QO9 A;  2NT6 A;  2XTY A;  3EQO A;  2I0X A;  3MM5 B;  2HMI B;  4LF7 J;  4ID5 B;  4HEA 9;  3T1Y J;  2BE7 D;  1K8A T;  1QSL A;  3TEH B;  2FJE B;  4LF5 F;  2Q43 A;  1REV B;  3TI0 A;  3D9B A;  3FY3 A;  4HKQ A;  2DR5 A;  1N4L A;  2G2Y A;  2V2V A;  4YB7 A;  1HMV A;  4O3O A;  2ZM6 F;  3PET A;  1I94 F;  1VQ8 S;  2B9W A;  2QV6 A;  3L7P A;  4ZCM A;  1P9Q C;  4X65 J;  2OD6 A;  3QBC A;  3U1M A;  4K7Q A;  2LCW A;  2UU9 J;  1HQU B;  2E29 A;  1JLA B;  2D1C A;  3HVA A;  2MKS A;  2UZA A;  3GFY A;  2MDA A;  3BR9 A;  3GJR B;  2DPJ A;  4CH1 A;  4GKK F;  4B3R J;  1NXI A;  4GO5 X;  2VBM A;  5K5M A;  4J9N A;  1PYT A;  3KLI B;  2GAH C;  4DL7 A;  4I0W A;  3PO4 A;  4J9U E;  3I4P A;  2R7Q A;  3SCI E;  4QQB A;  2R2S A;  1X0P A;  2BJ7 A;  3M1V B;  3JTO A;  4OI6 A;  1SV5 A;  1CC8 A;  3PHE A;  3R8Y A;  2HQC A;  2BR0 A;  1IKX A;  1FRM A;  1Q8K A;  2OEJ A;  3KWM A;  4HHH A;  5D0H A;  2HRT A;  2P6T A;  3HCX A;  1O8D A;  2KHC A;  2OML A;  3ZTQ A;  1CLW A;  3VQS A;  5HRO B;  4C9D A;  1O8J A;  2QC3 A;  2HS3 A;  4F8R A;  4NZ7 A;  2FQQ B;  5CD4 A;  4F4W A;  1DQ9 A;  2QEX S;  3THP A;  1ITP A;  4I4B A;  1UEK A;  1NME B;  2GVD B;  2HGM A;  1IXK A;  1FDN A;  2C2O B;  2FGO A;  3B82 A;  4NLD A;  2AYE A;  4DWI A;  2AD9 A;  2X1F A;  2R7X A;  3RBZ A;  1DUR A;  4Y0F A;  2JH3 A;  4U9R A;  1OYD A;  3MPD A;  4JUZ A;  1XIQ A;  4WFZ A;  2YKM B;  4OLP A;  3FMW A;  2UXB J;  2OTJ S;  4KH1 B;  2E66 A;  3AQP A;  2D9P A;  1K1Q A;  4MKB A;  3SQG B;  1O8K A;  1DY3 A;  3PEJ A;  1CUL B;  3HVT B;  4GVL A;  2Z2Z A;  3P5B P;  4ZHR A;  2XYP B;  3V6D B;  2ZH4 A;  1FFG B;  1OPI A;  4LRD A;  4I56 A;  2XMM A;  2JLE A;  4JI1 F;  4LRF A;  1CJV B;  3ZTS A;  5A0Y B;  2V8D A;  5H9F J;  1NHC A;  1KTV A;  3MFH A;  3HHL A;  1ZBT A;  5ETL A;  3CB4 A;  3H7H B;  3MHY A;  2B0R A;  4KBI A;  1FCA A;  3T1A A;  1S12 A;  1HAR A;  3TQE A;  3ZSC A;  1RT4 B;  2XZT B;  1JLB A;  3EGZ A;  4C98 A;  4MMO A;  1PBU A;  2ZHB A;  3AJ1 A;  2ZDP A;  3IXQ A;  5K9F A;  4N5S A;  2DNQ A;  3M8S A;  2O17 A;  1N32 F;  3BPD A;  4UUX A;  2JZ5 A;  1PG5 B;  3BKT A;  2CQ3 A;  2M52 A;  2OAU A;  3DGP B;  3DNC A;  4CLS A;  4TU9 A;  1SKS A;  1QAJ A;  5F8M A;  2P9E A;  1E6Y B;  3OLB A;  4Q43 A;  1SQE A;  1RAA B;  1HMV B;  4ENO A;  3OUY B;  3R5C A;  4HH1 A;  2WVE A;  1C2P A;  4FYY B;  2EVZ A;  2LYV A;  2Z2Y B;  2XT4 A;  4ECT A;  3OL9 A;  1B70 B;  4DG1 B;  3H2V E;  1RTH B;  2W2M P;  2AF6 A;  4HI2 A;  4WPA A;  5AXK A;  3M6W A;  3M2U A;  4U95 A;  1JLE A;  1O8B A;  4HDH A;  3P96 A;  1MU2 B;  4WP9 A;  2DD8 S;  5D4P A;  4FF4 A;  4TN2 A;  3I5B A;  3CO9 A;  3ZTP A;  3SXL A;  4DN9 A;  1QCX A;  1S1X A;  1AXQ A;  2OEK A;  1VC6 A;  1GK8 A;  4CH7 A;  4B9M A;  3KDO A;  4P2S A;  4IRK A;  3VWS A;  5J2N B;  4EYH B;  1FKP B;  3IRW P;  1HHT P;  3KLH B;  3M2R A;  2NS1 B;  3PFE A;  1HQE A;  3FCH A;  2WAQ D;  4Y3C A;  1JIH A;  1FTR A;  1RT5 A;  2GCF A;  4E98 A;  2UVW A;  2FJB B;  4Q44 A;  2W2P P;  3AK5 A;  3DOM B;  2WSC C;  3C14 A;  1BQM A;  4N76 A;  5F8I A;  3HMJ G;  3TR5 A;  2C28 A;  2W7A A;  2HUR A;  2ZVI A;  3R5J B;  1JLC B;  4ANC A;  2KM8 C;  2FYX A;  1XMQ J;  4C8Y A;  3CD0 A;  2R7U A;  2HQI A;  2YX1 A;  4OZ0 A;  1U4B A;  1ULR A;  2V6A A;  4DSK A;  3LTO A;  1KKH A;  3G8S A;  1IBC B;  3OT9 A;  5HP1 A;  3BQ2 A;  1HNX F;  1D9A A;  4PUO A;  2A3J A;  1U0H A;  2KT3 A;  1EX8 A;  1PJ7 A;  2WON A;  3CNQ P;  2MXY A;  3K58 A;  3J7A 1;  1B7F A;  2SXL A;  3M6U A;  3KK2 B;  2XTJ P;  2JDJ A;  4R0J A;  5DGB A;  1RTI A;  2VG6 B;  1QDU B;  1FRK A;  3PDN A;  3MEG B;  3VVU A;  4TQS A;  2R7W A;  2HIQ A;  4JV1 A;  3CJ4 A;  3LGM A;  4B3O B;  4AFF A;  3RBX A;  3KHG A;  2RUG A;  4RUB A;  1VLO A;  5KFG A;  2D69 A;  3UNG C;  2D3U A;  2VPZ B;  2YKQ A;  3B4M A;  2WHO A;  3HHK A;  3PCO B;  3QIP B;  5HAO A;  3B78 A;  2PEC A;  2XY7 A;  3T9G A;  2MHE A;  2PMH A;  2V50 A;  3UR0 A;  2CNK B;  1J5O A;  1FO1 A;  1LWC A;  3I6P A;  4J91 A;  2HQD A;  4Y34 A;  2PO4 A;  2ZUG A;  4ES2 A;  2XC1 A;  2XGQ A;  3IMQ J;  3FCW A;  4NX9 A;  2L48 A;  1NND A;  4LBH A;  2UP1 A;  4P52 A;  3BBC A;  4UOH A;  3MD1 A;  1FVS A;  3UD5 A;  5BJR A;  1JJ2 R;  3OD2 A;  2BE2 B;  3H4B A;  2DIT A;  1TL7 A;  3C16 B;  3MMJ A;  3W7B A;  1RK8 A;  3D1O A;  4AD6 A;  3KLG B;  4P9S A;  4FS1 A;  2CJK A;  1TL4 A;  4LF4 F;  2E5L J;  1CLF A;  2RJZ A;  2ZIT A;  2UUA F;  4I6A A;  4GVB B;  3WIV A;  3M2V A;  4EBE A;  2F63 A;  4ED1 A;  1OY8 A;  3GR1 A;  1S6U A;  3MM9 A;  1JLF A;  3OUY A;  1TK5 A;  3IR6 B;  1J27 A;  3R9L A;  3KXD A;  4RBU A;  2H54 B;  2KU7 A;  3MAA B;  1AUD A;  1FRL A;  3FEZ A;  3IWL A;  3V81 A;  2ADB A;  3UFC X;  1WSV A;  3MR3 A;  2UVE A;  3JSR A;  5A6P A;  4A8K A;  1RDR A;  2EI5 A;  1H3D A;  1RAD B;  4O4G B;  3MAQ A;  3SV3 A;  3BDP A;  1TYX A;  1FE4 A;  2HGL A;  3FBB A;  4GC7 A;  3DRP A;  4DBQ A;  1KOH A;  3W5Y A;  4IO9 Q;  3P6Y C;  2P9C A;  3EMT A;  4AYB D;  1VLY A;  2D9O A;  4JB8 B;  5EX0 A;  2W2O P;  1S0M A;  1NK0 A;  3CJR A;  1BHE A;  3UO0 A;  3EVW A;  3WX4 A;  5E41 A;  3UNY A;  4JI7 J;  5KG0 A;  3V6D A;  4FXD A;  2HNY B;  3CIM A;  1OWX A;  3I4H X;  4ZP8 A;  3RRG A;  4X62 F;  3BSA A;  1X0C A;  2INU A;  5F0U A;  1TP7 A;  3SQG A;  3OSN A;  3T5H A;  1X9S A;  4M5I A;  3KMQ A;  2CRL A;  2M8D B;  1Y10 A;  1N32 J;  4YC5 A;  4OI3 A;  3HHN B;  3HFV A;  2R4F A;  2R2U A;  2BAB A;  1HW8 A;  3OJS A;  2NRE A;  2H5E A;  2KB2 A;  3G8Q A;  3R5D A;  4I2P A;  3UN2 A;  4CLW A;  1HD0 A;  1GMU A;  1HWI A;  2YNG A;  1GQE A;  3MMC A;  3G6X A;  3BSC A;  5M2P A;  2B4V A;  3KJV A;  1UVI A;  4ED0 A;  1NRK A;  3H8Y A;  2QRR A;  1HKA A;  2VBX A;  1G6B A;  3BB5 A;  1URR A;  2Z8G A;  3K5P A;  4QOT A;  4AXJ A;  4X4T A;  4QU6 A;  2YH0 A;  4TY8 A;  3M7V A;  4OHY A;  2RKI A;  3ZZU A;  4DN0 A;  4DR6 J;  3GYN A;  3HVT A;  2ZBI A;  2DNZ A;  1RWR A;  4ZVE A;  5KFZ A;  4E0D A;  2X1A A;  4KH0 B;  3U02 A;  3ILJ A;  4N8N A;  4O44 A;  3LWM A;  2A10 A;  3M1V A;  1U1R A;  4ED5 A;  1RLC L;  1S57 A;  1TKD A;  2UXB F;  2IMW P;  3Q8U A;  1K9M T;  3AB2 B;  2JRS A;  4LFC F;  3OR2 A;  2NSC A;  3HSZ A;  3HFZ B;  2RDD A;  2HSE B;  1HD1 A;  4ZPA A;  4ZKA A;  1VBY A;  2M4M A;  2CDR B;  3P4U B;  2JC1 A;  4DSI A;  3O5T B;  3RRH A;  4IRC A;  3SUC A;  1TAU A;  1WC5 A;  3W2V A;  2HZV A;  1ZPW X;  2XG8 A;  2E9R X;  2CQ2 A;  2RQ4 A;  2AW0 A;  3D28 A;  1XWL A;  2EK1 A;  2DB1 A;  2O3D A;  2WB4 A;  4IQM A;  5KT2 A;  2Q79 A;  1H38 A;  4PWD A;  1FA0 A;  1YJU A;  4PYA A;  4DF8 A;  3PX6 A;  1Y5L B;  1REV A;  1JKH B;  2HK3 A;  2K2P A;  5LMN J;  1X4G A;  3TUZ C;  3OXF A;  5IC6 B;  2RF2 B;  1PAU B;  1U0S A;  2ZH3 A;  3MPV A;  4N47 A;  4YEA A;  5F8G A;  3RR7 A;  3MM5 A;  3KG4 A;  3CJ8 A;  2KXN B;  2KFY A;  1EAY C;  4YZ0 A;  1LK7 A;  2W4C A;  3KHH A;  2ZH2 A;  1FJE B;  1ZH5 A;  2IYI A;  4PKD B;  2J7K A;  2V63 A;  3PRV A;  1HWJ A;  4ZA1 A;  3HPO A;  1JKH A;  4ZP7 A;  1QJH A;  3MMA A;  1U6B A;  1TUW A;  2QTW A;  4KYZ A;  4NLR A;  5DET A;  3EUN A;  3TQ1 A;  1MMD A;  1ZZF A; 
#chains in the Genus database with same CATH homology
 3FCW A;  2BM6 A;  3ML3 A;  3BBC A;  4UOH A;  3ZTR A;  1MN7 A;  2DXF A;  4O0N A;  1PKU A;  4S0M A;  3FCV A;  3BH7 B;  3RIQ A;  1NSP A;  1HLW A;  4C6A A;  1NLK L;  2HVD A;  3PJ9 A;  2V5I A;  1BHN A;  2G0Y A;  1NUE A;  3DDI A;  4FKY A;  4EK2 A;  3Q8Y A;  3MPD A;  1WKL A;  1UCN A;  1NDK A;  1XIQ A;  1B4S A;  3R9L A;  4WBF A;  3VGV A;  2W7Z A;  1VYA A;  3BH6 B;  1NDL A;  4DZ6 A;  1WKJ A;  5IOL A;  1HIY A;  2BM5 A;  4UOG A;  2DYA A;  2VFM A;  1TYU A;  1TYX A;  2BM4 A;  3NGU A;  3FBB A;  5JMC B;  3ZTS A;  2HVE A;  3ETM A;  1DAB A;  1U8W A;  3EIC A;  3EMT A;  2CWK A;  3N6Z A;  1S5Z A;  2DXD A;  2B0R A;  4DUT A;  2B8Q A;  1QQ1 A;  4OJO A;  5BXI A;  1K4Z A;  2J8I A;  3EVW A;  3ENA A;  5JLV C;  5C7P A;  4W98 A;  1NB2 A;  3EVO A;  3ZTQ A;  1TYW A;  3JS9 A;  2ZUA A;  3H09 A;  1K44 A;  1NDC A;  2NCK L;  1QRB A;  3ZTO A;  1TYV A;  3P4G A;  3FBF A;  4OM9 A;  3Q83 A;  3B6B A;  3FBC A;  4DI6 A;  4ENO A;  4CP5 A;  3BBF A;  1HF2 A;  3GPA A;  1QRC A;  3VGS A;  2IOU G;  3N90 A;  3LJY A;  3ELH A;  3G2X A;  1NSQ A;  1NHK L;  2VFO A;  1XQI A;  3TH0 A;  1JXV A;  2VFN A;  3B54 A;  3EM1 A;  3NGT A;  3ZTP A;  4F36 A;  4UOF A;  1K8F A;  1B99 A;  3VVT A;  4FKX A;  4OJ6 A;  1KQ5 A;  3Q86 A;  4OJ5 A;  3NGR A;  1F6T A;  1ZS6 A;  3LYC A;  4OJP A;  3SYJ A;  2VFP A;  1S57 A;  3WX8 A;  3EE3 A;  3Q8U A;  3AK5 A;  3JX8 A;  3FBE A;  2F3L A;  5CAA A;  2HUR A;  4V02 C;  1QA1 A;  3NGS A;  4HR2 A;  4ANC A;  4OJL A;  1QA2 A;  1NCL A;  1WXR A;  1BUX A;  3PET A;  1TSP A;  1MN9 A;  2VU5 A;  3FKB A;  2BM7 A;  1LWX A;  3GP9 A;  2VFQ A;  1NPK A;  1W7W A;  2AZ3 A;  2DY9 A;  1LEO A;  2BX6 A;  4ANE A;  4JRA C;  3VGT A;  1PAE X;  3BBB A;  4F4A A;  3VVU A;  1KDN A;  1HHQ A;  1EHW A;  3FC9 A;  3SZE A;  4OPW A;  4KPC A;  1BE4 A;  4AND A;  5CAB A;  2BEF A;  1QA3 A;  2YUH A;  1S59 A;  3EVM A;  1NSK L;  3PRV A;  3Q8V A;  1WKK A;  2DXE A;  4KH3 A;  2B8P A;  1F3F A;  3VGU A;  3L7U A;  2AZ1 A;  3DKD A;  3EJM A;  2XC1 A;  3Q89 A;  1NDP A;  1CLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...