3BH7B

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 103
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh7B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh7B02
4CP5A 4UOGA 3Q8VA 3EE3A 3PJ9A 1NSKL 4UOHA 1K4ZA 3Q86A 3Q83A 1F3FA 4DUTA 5CAAA 3EVWA 1EHWA 4HR2A 3Q89A 3R9LA 3VGVA 2HVEA 3EVMA 3NGSA 1PKUA 4DZ6A 3FBEA 3ZTOA 1W7WA 3Q8UA 4ANDA 1NLKL 1BHNA 1PAEX 1HF2A 3B54A 3GP9A 1BUXA 3WX8A 3ZTQA 3EICA 5BXIA 2DXFA 3ETMA 1WKKA 4F4AA 1ZS6A 1WKJA 3FBCA 3FBFA 3JS9A 1XIQA 2HURA 3BH7B 4UOFA 2DY9A 3FBBA 3VGTA 3VVUA 3NGUA 4DI6A 1B4SA 4C6AA 3EM1A 3EVOA 4FKYA 3ZTRA 1NDPA 1NHKL 2B8QA 1U8WA 3FCWA 1NPKA 1KQ5A 3ELHA 3B6BA 3ENAA 4W98A 2B0RA 1BE4A 4ANEA 3ZTPA 4V02C 3MPDA 2DYAA 5C7PA 3BH6B 1VYAA 2VU5A 4S0MA 2B8PA 1K44A 3FCVA 1F6TA 3DDIA 3FKBA 1NDKA 2BEFA 2AZ1A 2ZUAA 3VVTA 3BBFA 3L7UA 1UCNA 1NUEA 3NGRA 4KPCA 2HVDA 1NSPA 1JXVA 1LWXA 3NGTA 1NB2A 2DXEA 3EMTA 3Q8YA 5CABA 4FKXA 3VGUA 1S57A 1NSQA 1NDLA 2AZ3A 1S59A 1MN7A 3BBCA 1S5ZA 1NCLA 1NDCA 2CWKA 4O0NA 1MN9A 4EK2A 1LEOA 2YUHA 3G2XA 3EJMA 1XQIA 2DXDA 1WKLA 1HHQA 1HIYA 4ANCA 2NCKL 3ZTSA 2BX6A 1HLWA 3DKDA 5IOLA 3BBBA 4ENOA 1B99A 4WBFA 1K8FA 3VGSA 4F36A 3FC9A 1KDNA 3GPAA 3PRVA
chains in the Genus database with same CATH superfamily
3PJ9A 5M2PA 3H2UB 3GQAA 3CCTA 4GMKA 1IM6A 1ZPWX 2ZOMA 2B6AB 4RNFA 1S1XB 1T05A 5L9NA 1FX4A 3IC1A 2LLZA 5KT6A 4F02A 4PXCA 2HHPA 5DJBA 3GIMA 3FBCA 2KDOA 3QYYA 4ERDA 2V2ZA 4KGVB 4PWDA 1N34J 2E9RX 5DGBA 2GCFA 3H40A 4I69A 1IKVA 2FLPA 2VFPA 4WE1A 1BQXA 1JLCB 3AA9A 2FHJD 2DNQA 2L9DA 3LTOA 4I6WA 2DHHA 4YP3A 3TWZA 2NLWA 1HWJA 4QZVB 2BYCA 3W63A 2VICA 1BQNA 3DLKA 4A48A 1JLFA 4A4JA 1N36F 5AE3A 4I6YA 3IXQA 3GIKA 4KHPF 3CJQA 4PMHA 3C6TB 1TMJA 5D78A 4C2MA 4EK2A 3R5DA 5KFYA 3ZTSA 1HFEL 1JB0C 2MKCA 2MLYA 6FD1A 2VA2A 2IIHA 3UCUP 1RAOA 5DNSA 4RPFA 3Q8RB 4XNFA 1RTHB 2RS8A 1Q8BA 2E5JA 5G4DA 3KMQA 1EHWA 4GKJJ 4EBCA 3M1VA 4DR3F 4OHXA 1RTZA 1OQ3A 3AAWB 4HI1A 4DV5F 1T3OA 1QSSA 4WF9Q 3BSAA 2DBBA 2BRLA 2RQKA 2Z2LA 4JV2A 1B4SA 4ED6A 1SJ3P 3D1HA 4A8QA 1NPKA 1G2EA 3M4XA 3CMES 4LF7J 2C2KB 2IM1A 1X4BA 4USHA 5EWEA 4JBCA 4HYKA 2RDJA 5J2PA 3DMJB 4J9OA 2HQIA 4OHYA 2YH0A 2GS8A 1EQ0A 1H3DA 1JLAA 3W3SA 2CPHA 4C9DA 4CO2A 5HQ8A 1TYUA 4LRCA 4USIA 3G6XA 4PEOA 1RAHB 2R8IA 2DPIA 1TYVA 3MMAB 1RYSA 4JP8A 5IOLA 3HSGA 4K4UA 1H2VZ 1WOOA 3KG1A 2F8HA 4NLOA 1QJHA 3TOQA 2VFOA 1KC8T 1U1MA 4ELVA 5I42A 2A3JA 2GZOA 2DNKA 4K4SA 1YJ7A 2VOOA 4DSJA 4IYQA 2VFUA 2LQJA 4WFYA 2NXNA 1QE1B 2XMMA 1FCAA 4BLGA 2VF3A 1KHVA 2DRAA 1EX8A 5HMXA 1GH8A 1KVIA 3EICA 1IBLF 3KLHA 3SDEA 4JI4F 1B0TA 4C3KA 4URRA 1NHKL 3KJVA 3I9V9 4RKUC 3D5MA 2RUSA 3NGDA 3M8QA 4CTAB 1N8RT 4ANEA 3OVSA 4IDKA 2CJXB 2G1DA 4RNNA 4ATNA 2YNIB 3HD2A 4NXMJ 2EK6A 4J37A 3LAKA 4C0OC 3VALA 1FT8A 1QDUB 5GAGU 1TK0A 3L7OA 1VC6A 3FRYA 3KUEA 3QATA 2KJWA 2VPXB 4ZVUB 3T1YF 1RWOB 1RHKB 1NHUA 1GMVA 1VHIA 2VG6A 5E3RA 2NXEA 3GPAA 3HHNB 1EKSA 4HVZA 3D66A 4V1Ak 2W9BB 3E51A 4JYAF 2Q1LA 2RT3A 3EVWA 4WU3A 2W2MP 4PPDA 3GONA 2QO3A 4MMOA 2O66A 4AVZA 2VOPA 4DR5J 4KO0A 2J9CA 1HW9A 1I6JA 2PI4A 2CQHA 3PKMA 2IVMA 4NZ0A 3FEYB 2V2QA 4PRFA 4FYVB 1YZ7A 3NAHA 1YBTA 3OXGA 2EKYA 4H4KA 2ACYA 3SI8A 2NT6A 3I31A 5ADZA 1NEEA 5CZVA 4KBIA 5GADU 1VQ9S 2LVWA 2XWYA 1FRIA 1CJKB 1WC6A 4N41A 2EC2A 3NWRA 1KFSA 5DDPC 1K5CA 1NHVA 1LV5A 2NTBA 5DDOC 3FEXB 3A12A 4R0EA 1BMQB 2HRYA 2DO4A 3HVRA 2N4DA 2AEFA 2QZ8A 4HI2A 4YEAA 1FTRA 3V5RA 3BGFA 2UXBF 2JNJA 4CO0A 2FLLA 3DGVA 1DQAA 1WORA 2OH2A 1EETB 2HLUA 2K1RA 1YJNS 3IG1A 1JLEB 4B3RF 5HVGA 2EWHA 3BKUA 3JX8A 1SUQB 3P6YC 4CO5A 1PO6A 1MW7A 2IC3A 3KLEA 2H51B 2VC0A 3I0RA 2IDEA 4WP8A 2GQ2A 2VONA 5HJYA 1QY7A 3T9ZA 1DJ0A 1S6OA 1FK9B 4M95A 4K7QA 4DI6A 2XSFA 4RBUA 4ILMA 5FDLA 5KFXA 7FD1A 1VLYA 2OEKA 1QRCA 3ZNUA 1H2TZ 3OR2A 1LK7A 5HP1B 2DR5A 3IBFB 1RHRB 2MHNA 4OHZA 2OPSA 1RHUB 4PXBA 1BWEA 2XNRA 3MMAA 2ZUAA 2KKHA 2HWIA 4DX6A 5KFEA 1DURA 2IBOA 2KT3A 5DLFA 3HF5A 3ADAC 4L76A 2Y8YA 2X1FA 1HLWA 1JLGA 1WD6A 2F4VF 2VFRA 1S1VB 1X9WA 2F3LA 1PSDA 1S6PA 2HAFA 3DYAB 2RVJA 1GK8A 3EQNA 3L9ZA 2ZH7A 3CXCR 1R6YA 4Z7CA 1H2UX 3IBCB 2HNDA 1T9WA 1TVRA 5LSOA 3DLLQ 4DPYA 3AB4B 1M5VC 1TFYA 4JB8B 2VG7A 5CZXA 1IWAA 2JLFA 1VIOA 1TL3B 4WK3A 4DG1A 1K0TA 2M88A 2XMUA 1S7IA 4GVBB 1RWMB 4LF9F 3IWNC 2MLXA 1FO1A 3C6UA 4FNHA 4FYWB 2GGPB 2RRNA 1U1KA 2JVRA 2EFNA 1U1PA 1JLQB 1M5PC 4N8NA 1LXNA 3UVJA 5JMNA 1VQ7S 1RMGA 5IT0A 3CJ5A 2JH3A 5F3ZA 2DGWA 1HNWF 4K50A 1NDCA 1TL1B 1B64A 3KLVA 1YDLA 4LFCF 4ANCA 4F4WA 4PABA 2GO8A 2HGNA 5C5JA 3KHRA 2PO4A 4M5NA 3H5UA 2NTQA 2FY1A 2VJIA 3DOMA 1F0XA 4MIWA 4DFPA 2QMXA 2RKIA 4OMFG 1I1GA 1TMMA 1T9XA 4OZ5A 1WKKA 3MTKA 4PCQA 4MYTA 2EKNA 2V50A 4DL4A 1XR5A 3BGLA 2KXNB 1X7VA 3MPUB 2JEFA 2FLNA 1Y10A 1TK8A 1F60B 1F2GA 2BSPA 2R7SA 1NK4A 1APSA 2BW7A 5F9NA 5LMNJ 2W8LA 4U4BA 4H4MB 3EPIA 3TVYA 3OJSA 3JTOA 1HQ2A 5J1EB 3MGJA 2M4MA 3GCXP 1UFLA 1HWKA 4TYBA 5JLVC 2KU7A 2QA2A 3QWUA 2FQQB 3G87A 3HI9A 1KSPA 3KLGB 4XLEA 3BREA 1U4BA 2AJFE 2VBYA 4JI6F 4X4PA 4GO5X 4KKOB 5KFNA 1L3UA 3DOKA 3C8YA 3C2PA 1HYSB 4OLPA 4R8UA 3Q86A 1FK9A 3R5AA 5KFRA 3LW5C 4QWDA 3HHLD 5KG4A 1L5UA 3MM8B 4ZPDA 1ZBTA 1QTNB 2W7PA 3KJNB 4MFBB 2CZ9A 1RK8A 1Z2ZA 1RBOB 4F2RA 3WIUA 2V4RA 2RMLA 1I94F 2VV5A 1JK9B 3VHQA 1R8AA 3DLGB 2ZE2A 1WG1A 4G65A 1EJ7L 2PI5A 1E6VB 3W9JA 3TZYA 2VBXA 4M1KA 1H7XA 1Q8KA 1N5VA 2B4PA 4NXNJ 2YWHA 3HFVA 4QJVA 1U1RA 2V8GA 1VJWA 3DYAA 4O0NA 1F5BA 4ZP7A 1NJZA 2FJEB 3CVKA 3RAQA 2BW2A 1SQFA 2AJQA 5GAEU 3W2VA 2ASDA 2YNHA 4IR9A 1UP1A 1JRGA 4OX9F 1GTEA 1QVGR 2C3MA 3U27A 3VGSA 4ZMMA 2ZITA 3ENVA 4H4KC 3KFWX 1S6QA 3PKYA 1S4FA 4LIWA 3RRKA 1UFWA 2BKPA 1HD0A 4XO0A 2HVEA 1MSWD 3IO1A 4OI0A 2GC8A 1PLUA 2Y3YA 4DR6F 3LO3A 2ERRA 3B54A 3HHEA 1WHXA 1U8SA 3LGHA 1AFIA 2BM1A 2WB1D 2BE2A 2QSFA 1U1QA 1JJCB 1IA5A 1XMOJ 2P6TA 3JXOA 4R25A 3ZTPA 3I4HX 2UVRA 3IM9A 3EGZA 3CJKA 1VJQA 2YKAA 4HTIA 2OTLS 3MMBA 3UDEA 4Z7YA 4DR2F 3NGRA 2CQ3A 1Y5NB 3CCQS 2GJFA 4CH0S 3MAAA 4F4KA 1DABA 4P7TA 2FVPA 2IBKA 2MJNA 1VQ6S 5CHCB 2ATCB 3IAS9 4TU7A 2Z8QA 1FD8A 3LPEA 3MPVA 2IRUA 2DNRA 5B0DA 1OOCA 3M2VB 1HI0P 1A9NB 3ENWA 4DMZA 4KC5A 4DL5A 4W8SA 3POTB 4JV0A 1XJWB 5HVHA 4DV1F 1S79A 4L74A 2I1RA 2RE1A 2BVZA 1HWLA 3FFIB 2C2DA 5F3TA 4IO9Q 2JEGA 2QIFA 3K2YA 4J91A 2DGOA 2PFDA 1KRPA 2G0YA 3GYNA 1NK6A 2E7VA 4O3RA 1FFSB 4N56A 1XIQA 2UUAJ 3G6ES 1XBWA 4DBQA 4DQPA 1CLWA 4WP9A 1S1WB 5JXSA 2GVZA 1S97A 3N0VA 1RLCL 4ZITA 2EFOA 4C3MA 4DWIA 3QAUA 3DGPB 1ZM2A 3MEDB 1VQPS 2PFFB 3G82B 2YNFB 4RW6A 2CQPA 4F04B 4E98A 2XI2A 2RRBA 1YRTA 1VC0A 4YFOA 3K17A 2ZWPA 4OI6A 2Z2ZA 2QYUA 2E9ZA 2WRMA 3FSIA 1QA1A 2GJ2A 5LXYA 1YG0A 3SSSA 4DFMA 1IJFB 4DN0A 2APOA 4P7VA 3V4IB 1RWPB 3MUVP 3ZFVA 3LP0A 5IS2A 2QL7B 2DR9A 1TFWA 3IR6B 4WFAQ 5D8HB 5HO4A 3RR8A 4DV7F 1UVNA 3VSVA 3CWJA 1SB6A 1RT2B 4YZXA 2AGPA 4UOCA 5ETMA 2JWNA 1IBKJ 3PW5A 3UDLA 1EAYC 1FDNA 2WVEA 3QO9B 1HI1A 4J9QA 3OXFA 4F3MA 3B6BA 4OI1A 1AFJA 2GHWA 4WZMA 3DU1X 2K2PA 3KJQB 4IRDA 2DYAA 1FRKA 2E5HA 3QRRA 1Q78A 3DI6A 4P6QA 2XSJB 4IG0B 3RB6A 1S9FA 2PC6A 2XTXA 4WYWA 3Q8YA 2EXUA 2YTCA 4RU9A 3PJXA 4CO1A 2OLWA 2P5VA 2QLBB 1LEOA 1RT7A 5KT7A 3G2XA 4RW4B 4OZNA 1DTTA 1GT8A 1RTIA 2OMOA 2EFPA 4EI2A 2XS7A 3OD2A 1K8FA 2WONB 4C8KA 5DG9A 2FC9A 4M5GA 2VQEJ 4OJ1A 4OZ3A 5IWAJ 1Q5YA 4C3LA 3HULA 1NJIT 5F41A 3J7YU 1UEUA 4KRWA 3MHYA 4F4AA 2VC1A 1KN6A 4D3GA 2WBRA 1VRUA 4XPCA 1KQKA 2NPFA 4JI2J 2VZ9A 3PFOA 5DLGA 4KFBB 1RP5A 2QL5B 1KONA 1D9FA 4A8YA 1IXKA 1O0PA 3TW0A 4G3IA 3KUGA 2I0XA 2JLEA 1X9SA 1AXQA 1VBKA 4I67A 4X4RA 1O8FA 4LSZB 4JI3F 1PYOB 2VB6A 4MH8A 1D3WA 2M2BA 4ID5A 3GRHA 1YJ9S 1HBNB 4LBIA 3UD5A 2UP1A 2PD1A 3PXGa 1HNXJ 4DSLA 3EE3A 4KYZA 2RU9A 3UN5A 3ZZ0A 2LEBA 5ETVA 4NMLA 3RR7A 4PKDB 1VISA 3D54A 3Q8UA 4C8MA 1FFGB 5F8HA 2MQ8A 3WZ0A 2DIVA 5LJ3Y 1XERA 2GVDA 1MMNA 2VPZB 2ADCA 2G9OA 2FHJA 4HHUA 4WWSA 4TYAA 1T02A 3MEDA 4ZDNA 3WQPA 3K5LA 2UVFA 3FCWA 5B0CA 4KY3A 4DHVA 1SQGA 5A8WB 5T7LB 4WFXA 1U6ZA 4XQFA 4I64A 2KVQE 2WSCC 3QJPA 2RF2A 2UUWA 1Y3JA 2BANB 2UVVA 4OJGA 1NB2A 2L9WA 4B9NA 3AXMA 4CLPA 1TU0B 1V3ZA 2X1AA 3RZAA 3QT5A 1R7IA 3JSRA 1UWAA 1Q53A 2Q43A 3CB4A 4OZ0A 4LF4J 1LWEA 3CULA 2MB0B 3NKYA 3TH0A 4DV6J 1VOMA 1NH8A 4NI2B 4LJMA 4V19X 3B8YA 3G9CA 4K2XA 2E5LF 1D1UA 1RWUA 4LSNA 3BPSP 3OUYA 2RJZA 4OV1A 3M05A 3RIQA 1QAXA 3R2DJ 3E8OA 4B02A 2W2NP 1S1TB 1PXZA 3HSZA 9ATCB 4U8YA 2D69A 3M8YA 2CQDA 3PYGA 2ZDOA 1HNZJ 2U1AA 4E2FB 2R8GA 1OSCA 1RT3A 2PA8D 2X3DA 2YWWA 4DV3F 2MPUA 1DY3A 2ZVIA 2XTYA 3RBEA 2DK2A 4G1PA 2DHSA 1C0TA 2QMUB 3CCMS 2AYEA 4X2BA 4O4GA 4RUAA 2HBYB 2D3ZA 4I7FA 1RAEB 3CJ4A 5BYQA 3KWMA 4RUBA 1OYEA 4OZZA 4LFAF 4PG8A 2D3O1 2AEJA 3FK4A 3LGMA 2LFVA 2EG1A 4X4OA 4FDFA 5KG1A 4TQRA 2BX6A 3A13A 2E1CA 1N6QA 1N5YA 3CJ3A 1C4AA 1VQNS 2LP4A 5F8IA 3HVTA 2X1GA 3SQVA 2J9EA 4CT8A 4GVLA 4JRAC 2Y1IA 2KYZA 2HIQA 2I5JA 4OI3A 1GXLA 3FZBA 2QLXA 1EKRA 2F8EX 3I4PA 5A76A 5DG7A 4YB6A 2WBMA 3TJAA 2NYIA 5GAHU 3VVUA 3NGUA 1PG5B 4ECWA 5T14A 4ZA1A 3GLJA 2ZH9A 3ENAA 1S10A 2ZD1B 3GG0A 1J5OB 4HEA9 5DZ6A 2KI2A 3JQJA 1T9YA 4V19J 4JI8F 4WK1A 3MR7A 2E1RA 2DRDA 3T5KA 3BEGB 1SI9A 2B7BB 1Q4RA 3AH6A 5HJXA 2H1YA 1NAQA 5JVHQ 2G1HA 3QPIA 1FDDA 4Y34A 3GV5B 3J7A1 3CCLS 2VQFF 4RZRA 4C11B 1KVKA 1WUUA 4ZPCA 1NU4A 2CQ2A 3N79A 5JMCB 3HD1A 2V5HG 1CLFA 3BJYA 2E5IA 3MM9B 2Y1RI 2W2QP 3C16B 2ZZMA 4GRSA 3RAXA 1YJRA 1M1KT 2QYGA 4DFJA 4J9MA 1LWFB 4JI0F 3OL7A 2J5AA 2PIIA 3MURP 4IG3A 3I32A 3V6DA 4HT7A 1IN0A 4Z2XA 2PSZA 4ZHRB 1CULB 3HVAA 2FZGB 2XMWA 3N90A 3OTBA 2DCLA 1ZOTA 2N4CA 3KLFA 5FD1A 1N54B 4Q8EA 2HQDA 3M32B 3SXLA 2F63A 2B8QA 4QR1A 5K8PA 2F1FA 3PW4A 2KFZA 1U0SA 4EZ6A 5IT4A 1KLMB 4QCLA 2MJUA 1PJ6A 3TUIC 3ETOA 1AA1B 5AXNA 3IRXA 2W9CB 2ZM6J 1HR0F 3C15A 2ABYA 3L09A 1R31A 1DLOB 1E6YA 1RT1A 3JSMA 2PN6A 1HIYA 3DRRA 3W9HA 2HGLA 5AJ3F 4B9VA 2AJ0A 4L75A 2YQ3A 2VG5A 3NAWA 1B0PA 3BYRA 3ULHA 4J9VA 4DF8A 3PYDA 3BSNA 5I3UA 4KH3A 1HQEA 2GMLA 4DQRA 3OPKA 2QLWA 2KHDA 4PUOB 2R7RA 3CF5Q 1JX4A 3FSYA 2CXEA 3RJMB 3K57A 2V8VA 1WOPA 2WVFA 5IV4A 1B7YB 3T9GA 2ZFHA 5E3CA 1BN8A 1H74A 4DX7A 1XEZA 3QBCA 3ZZRA 3OHBA 2Y0SD 1RHMB 4B3TF 4XPEA 5M2UA 2DHAA 4YS2A 5G0RB 1VQ8S 1IR1A 2VBEA 5CD4H 4NRTA 2JRSA 4ZP8A 2LU1A 1FTCA 3FZ2A 1TKDA 4UZCA 1IKXA 3VAHA 3RRGA 3OLBA 2HKEA 4JI7F 5A8KA 1O88A 4OZ1A 3N6LA 3I6PA 4YZ0A 1FRMA 1Y0HA 4K4XA 2KFYA 3JYTB 3PIOQ 4IH5A 5DQGA 4DXLA 2K7KA 3H5SA 3VMWA 1REGX 2Z0GA 3Q8SB 3PRDA 1W7WA 3MAQA 3GYXB 4HHHA 1S49A 3TAMA 5HANA 2V4JA 3KUHA 3B78A 4WIIA 5A6PA 2ATLA 2UXCJ 1T9UA 3RBZA 7FDRA 2O67A 2QSWA 5IXUA 3RBDA 2LEPA 3CE8A 4B3SJ 4I6AA 2YWEA 1UL3A 1Q86T 5KFVA 3KK1A 4I2PB 2MQLA 4XOTA 3DOLB 2VHGA 1NMEB 3LMWA 1U0HB 2DCUB 3SQGB 1P1TA 4EWTA 3P3DA 3R1LA 3A3PB 1HBMA 5HLFB 3CD6S 2NSPA 1B99A 4Y6IA 4DV2J 3C14A 3OL9A 4QU7A 3MFIA 2JDJA 1KVJA 1CJTA 4OJHA 3NLCA 3PNIA 5LJ5Y 1J5EF 4U49A 4ZN3A 3GILA 4ZS6A 5LL6d 4FS2A 4DZ6A 4EBEA 4RX6A 2INVA 3TARA 1AUDA 3LUYA 4NRUA 4ZVGA 1GX5A 3D0HE 3M2RA 3M8WA 3QGGA 4AE5A 2E1MC 3J81j 1P1LA 2X3HA 5K9FA 4IQMA 4WFZA 2GJIA 3D3BJ 2XHCA 4BC7A 4K2JA 4DSEA 1S9GA 2DGSA 2DT9A 2V68A 4FNIA 4MKVA 4DOZA 2YKMA 4IR1A 2CNLB 4ZLJA 1KCDA 4ELUA 5L46A 2ASJA 3TR5A 1VQSA 4ZIWA 5E2QA 4JOUA 1T7PA 4DQSA 4CCHA 2V67A 4GKKF 3D4JA 2WTFA 4NLPA 2K06A 2AX1A 2HRUA 2BJDA 3AOCA 2HHXA 3HHLA 1VQLS 2G13A 3MM6A 3THPA 1N36J 1RHQB 4MT1A 4KHPJ 3MM7A 3VTIA 4NEYA 2E7XA 3Q89A 3C3LA 1W25A 2K3KA 1BHEA 2R7UA 1BHNA 2P2CB 2CQ4A 1RB0A 4L3NA 4P2MA 2AGOA 1B0VA 2C3PA 1QAYA 1OYDA 4CT9A 1HMVB 5K8NA 2B7CB 4P2FA 1VRTB 3LP2B 1DFDA 4P72A 3A8IA 3P4GA 3BYPA 4G1QB 1SH2A 1XTZA 2MQMA 3FBBA 3MR5A 4DR3J 1SC3B 5J2NB 4Q0BA 4DV4F 4DV5J 3WC0A 1O8DA 5KT3A 1O8GA 2CQGA 2C28A 5A0YB 4K4ZA 4WTOB 2VDIA 3QZ8A 4NLRA 2DXEA 4OX8A 5HMZA 5KFOA 1JJ4A 2CYYA 3I5AA 4O3SA 1UJ6A 3FY3A 2NUUG 1ZAVA 2LA4A 3AFGA 4G1IA 1MU2A 4C0HA 5H1SV 4DR4F 5D15A 1LK5A 5CA5A 5HROB 7AT1B 4YEIA 1TL7A 4XLCA 3B8HA 2DY1A 4G6VB 3ILLA 1GEHA 1M5HA 1TKZB 2NT9A 3Q83A 1EIYB 3VMVA 1JKHB 2XT2A 1JLBB 3VGVA 3MM5B 1FWPA 1NM2A 1SIZA 1TQLA 2XC9A 3CO0P 4N47A 2CNNB 3CCRS 2O0WA 2JHEA 1R0AB 5IV3A 1VBZA 4UW2A 2Q66A 5I4MA 3VGTA 3QQCD 5KFSA 4JV1A 3AQOA 4NYPA 4YZQA 5J2MB 2EC0A 1F9HA 3ELHA 3TVKA 2XWXA 1CQNA 2Q6CA 4XR6A 2IY5B 4O4RA 4ES3A 1IBLJ 1RKJA 3QFWA 3JAMU 1IBMF 3F44A 3PY8A 2HIYA 1WDTA 2BRKA 4XORA 2RDIA 3EXYA 4HACB 2NSCA 5B08A 4P10A 5A8RB 4YZAA 3OFHA 3VGUA 2HQGA 1UVIA 3HZGA 3OTCA 1PC4A 2IM0A 2UUBF 4FS1A 2Z2YB 3BV8A 1ZA2B 4WKRA 1P6TA 4O0IA 2R7TA 4ECVA 2U2FA 1KOOA 1RI7A 3GB0A 4DLGA 3T1YJ 1WHYA 4OLOA 2CFXA 1K8AT 1FKOA 2RHSB 2OPRA 1DQ8A 2MY8A 2OPQB 5B0BA 3M9NB 4A8XA 4BDPA 2HWHA 2FHMA 2ZNYA 3TP2A 5DETA 1RTDB 3NMRA 4JYAJ 5KFDA 5L38A 1YTYA 2RSQA 1WOSA 4O44A 4ILLA 4QQBA 1LXJA 1YIJS 5GAGI 4X4QA 1U45A 3OL8A 1KTVA 1DBDA 2B9WA 4OFZA 3I0SB 2W01A 1CPZA 1VYAA 3DM2A 1Y3KA 1IKWA 4NXMF 5J2QB 3TUZC 4EBDA 5KFIA 4Q44A 3EDQB 1FEHA 4FKXA 2IMOA 4NCGB 1YKWA 2W4CA 4PWWA 3T1HF 2B43A 3BO3A 1GXTA 2DISA 3V6HA 2V63A 2CDRB 2VJJA 1UKUA 1EARA 1ELOA 1HBOB 3ISND 4IQXA 4UQTA 5KFQA 4Y65A 2DJWA 5D77A 2YKOA 3LP2A 5ETSA 2FGCA 1T9VA 2MKJA 1SV5B 2UXBJ 4RR5A 1Z4UA 3N9UC 2CIMA 2R4FA 1TYXA 5GADI 3D6FB 5BXIA 2I9SA 2ILYA 4B3RJ 1S1UB 2BJ8A 3FUYA 4U8VA 2JC1A 5KG5A 1M1GA 3UO0A 2GQCA 2HRTA 4DCOB 2DNZA 3MTJA 3PX6A 3O2IA 5F8MA 4UUXA 2I38A 1W2IA 4X66F 1AIRA 4BS2A 1TL4A 3W7BA 2C2RA 2XEXA 3BR9A 2RNEA 3RW7A 1SKRA 3GSIA 4ER8A 2CWKA 3W2WA 1VC5A 2AKWB 4WIQA 2MSSA 4ECSA 1T03A 2PMHA 4F2SA 1RBLA 2ALYB 1QUPA 4AT1B 1IVZA 1SJ1A 3V6KA 4IFYB 4NZ6A 3DLBA 1Q7LB 1PJ7A 4JI1F 1HBUB 4OZ2A 1YHQS 2XY5A 2AYBA 1VK8A 1Y11A 4W8TA 1FWKA 1Y00A 2F4VJ 5EUHA 3R6LB 4X62J 2EEYA 3AOBA 3BDPA 4F0HA 3N6MA 2HAIA 3SYJA 4M5KA 2KTQA 5L39A 1OS5A 3PM9A 5KFCA 4FKYA 4M5DA 3HHKA 3HHLC 2IJRA 2WW8A 4ZCIA 3PW0A 3MPYA 2V6AA 1M0SA 2C2EA 4NPOA 2LU2A 2NZ4A 2WOMB 4N5SA 2ZBRA 4DZDA 8AT1B 2GHPA 3US5A 2ACMA 2XBPA 1P9QC 4N7TA 3MMCA 4XDCA 3LGNA 4LF9J 1SKWA 5C25B 2QG9B 4FYDA 1JWWA 5LMUF 1RT6B 4KTQA 1TELA 4OHVA 5A2QY 1JXEA 5CYQB 2NCKL 1U1LA 4LT6A 1FJGF 2HNYA 1HHTP 4LSLB 1H72C 5K14B 4N77A 2ZUGA 1HNWJ 3JB9k 4J9NA 3ILJA 3UNYA 2KL8A 3CC2S 2HFZA 4LFCJ 1PYSB 4KV8A 4LFBF 2B5JA 4ECUA 2COLA 5KFPA 4ANDA 1T05B 1UEVA 1RT5A 2VBKA 1S0MA 1BUXA 3QSIA 1G4CA 2AYGA 4YFUA 3NRBA 4PWDB 4MJKA 4KGMA 4Y2IA 4FXVA 4OHWA 1FNXH 1RU1A 3PX0A 2UVUA 5HBMA 2YXLA 1IKVB 2QA1A 4WE1B 4NCGA 4Y2MA 5U47A 1TAQA 3CJ2A 1Z1ZA 2HS4A 3THVA 2J9DA 2WHOA 3E3XA 1IKYA 1X4HA 5AT1B 5K20B 2Q79A 3I5BA 1BQNB 3DLKB 3P96A 4ES2A 1T3NA 1X4CA 1RZMA 2ZBPA 1NBEB 2LDIA 4DX8H 2ZBQA 3Q23A 3I87A 3GTYX 2R2UA 3HK2A 2HHUA 4DL0C 3DKDA 4C8NA 3NWGA 2H4WB 3GQ9A 2E1PA 3OLAA 4AD6A 4OYMA 1S1UA 2X6YA 3VZIA 4IO1A 1Q8LA 3M1VB 3PYFA 1RLDA 4LF6J 3I82A 3LWLA 2BACA 4JI6J 4IRCA 1A7GE 3N5BA 2QMWA 5EHHA 3PHEA 2XS2A 5DRKA 3T5JA 4TY8A 1U2RA 4YEJA 2DTJA 4F50A 2XTWA 1ACMB 1Q5VA 4ZLPA 1V6HA 3N6NA 3BZQA 3NS7B 1Y5IB 2G0CA 3CUNA 4FBUA 2DR8A 3PIPQ 3MCMA 5J2PB 3GWCA 4IH7A 4XTTA 2V8DA 4RBTA 5LMNF 2B4OA 3MF5A 4OX6A 1N52B 1O6XA 1NSPA 1JLAB 2E66A 3CDBA 3EGVA 1R8HA 4C97A 4DU8A 2W7ZA 2YX4A 1HNIA 4MIBA 1RWNB 1WKLA 2XO7A 2LEAA 2W2PP 1NXIA 4ETZA 4P2XA 4ECRA 2WZ1A 1M90T 3BQ0A 3FC9A 4BCAA 1MG7A 4FZVA 2JFDA 1WF0A 3PX4A 1OSDA 5I42B 2EG2A 3AJDA 4JV5F 1K0VA 2OELA 4OX9J 4OZYA 3M6WA 3ZTOA 1TKTA 2L41A 2XG8A 4PG4A 3ZTQA 2HG4A 4HDHA 4NCAA 3ZZOA 4TU9A 3KLHB 2GX8A 3SDEB 2A6OA 4W8RA 5D3GA 2HHWA 2MLZA 2X51A 1QAJA 3L7PA 2KO1A 3M7VA 1QUVA 4B08A 1VS3A 4DR6J 1YITS 4LF5F 2KXHA 4RL1A 3ITHA 2MQOA 3I5CA 3IS9A 3M8QB 1D0EA 1LLZA 4IDKB 2HQFA 3HCXA 4ED5A 4QWBA 3DU5A 1VQKS 1FDAA 1EA0A 2YKNA 1C0UA 4FBTA 1SPBP 3BBFA 4ED3A 4KE5A 1KS2A 4NXNF 5RUBA 4YELA 1PYTA 5B7WA 1O8IA 4EUVA 4P71A 3TNVA 2R7VA 3QLHA 2BUNA 3W8PA 2AT1B 2BJ9A 2CJBA 4AFFA 1YSJA 3KLIA 4LF1A 2VG6B 4MKYA 4J5OA 3D1QA 2PA3A 1V3SA 2X6WA 3SCKE 1GXUA 3OR1A 2FJWA 3LF0A 3ZZZA 2O6WA 2HNZA 3J80U 4KO0B 5IZHA 1HWUA 3UQSA 5KOWA 1J2VA 4DV1J 1BC6A 4DUYF 5E3AA 1CJVA 4XDDA 3DC2A 2LDYA 2QT7A 1RDRA 5KOXA 4B9UA 4QWCA 3U02A 5DGAA 1YVFA 4EGLA 1HWIA 3PO5A 3L7UA 4URSA 2INUA 4CQ1A 1KBRA 2R3VA 1U1NA 4ZPAA 4EYHB 1H73A 4DR7F 5LSLA 3HT3A 5B09A 2CPYA 2XLIA 3HP6A 2JZ5A 4ZVSB 1QVFR 3QGIA 4WFBQ 3NMAA 2CQ1A 4XMYA 2XGQA 2RQCA 2K1RB 3D7SB 3IG1B 1HG8A 3CGIA 4KB7A 2F4FA 3FBEA 2IC3B 3KLEB 2H5EA 2MKKA 3PW2A 2VBZA 2OHDA 3I0RB 2BQ3A 3H90A 4X64F 1ZZNA 3TI0A 1O8LA 3P49B 4ES1A 1VQ5S 1UAWA 3MEEA 3RU0A 4NLWA 5FDLB 3KMSA 2NZCA 4USTA 4XLAA 3TYTA 3OR2B 4F4XA 1OGOX 4DV7J 1LFPA 3M9OB 1XNRF 2Y8WA 2OPSB 4B9MA 2AZ1A 1OFMA 1XK8A 1NUEA 1VBLA 3Q22A 1VK3A 1TTHB 4Q2MA 1NCLA 3T41A 5E7OB 2W24A 1JLGB 2WB4A 2ROEA 2H3EB 1OPZA 4F26A 3CCES 1P9YA 5DO2A 2F9JA 3MAHA 4CP5A 2FYXA 4L73A 1S6PB 3IMQJ 3QNWB 3IM8A 2QC3A 1GQ8A 2VDHA 2HNDB 3FEZA 1TVRB 3NBPA 4X65F 3T5HA 3OSPA 2ZC4A 1S9EA 2WVBA 2XZTB 2AYMA 3BSCA 2VG7B 3SFGA 4OX7A 2MY7A 2QFIA 4DG1B 1JTAA 1TV6A 5CCMA 4B9TA 3KJFB 1N56A 1TSPA 4IKAA 1ZYQA 1S0NA 2OEJA 1CZFA 2YBVA 2NYHA 3GFZA 2Z56B 3UI3A 4F67A 2QRRA 3C6UB 1N5TA 3DHWC 2YKPA 2F3JA 4KPCA 2RU3A 2DHGA 1AUSL 4DCJB 1U47A 3UVJB 4FYYB 1S0OA 4U7CA 2AJ2A 4UTGA 3KHLA 2R8KA 4KT0C 5F8LA 2VBWA 3UNGC 3HSDA 1RWXB 3DXSX 2BQUA 2KH9A 2EFVA 3J7YI 1S12A 1MMDA 4XLHA 2HBRB 2O0VA 4DN9A 2LQ9A 4JI3J 2YNGA 3DOMB 5KG0A 4F4ZA 2CZ4A 1QLNA 2HZAA 1RA6A 2RKIB 1NKCA 5CYMB 1V9OA 3P8BB 3DLJA 1CBKA 4PQUA 2AHOB 5EGYA 4YDDB 4HH0A 4K4VA 2K7JA 2QXZA 2J8IA 3QJJA 1RAAB 2A6MA 2F8MA 1ZA1B 2P9CA 1S7HA 2A2DA 5KT4A 2JLGA 1RBAA 2P6SA 3G8QA 4NLUA 1N32F 2P9GA 3TRGA 2AU0A 2AD9A 5JVGQ 4CI0B 1MROA 3AK5A 1O8JA 4R5PA 3UDCA 3OJUA 1UVJA 2XMKA 4FF1A 5F8JA 2NR0A 3WDOA 1WEYA 3R2CJ 2OO4A 3D6TB 1HNVA 4QPTA 4K8RA 1TZ0A 2M9KA 4I2QB 2FVRA 3ET6A 2ZH8A 1ZETA 3LAMA 4DPOA 4NK8A 2IQ7A 1WC5A 3DOKB 1HNXF 1CS4A 5KFFA 1BXNA 4F25A 4R8UB 2XGPA 3R5JB 2X7IA 4WCEQ 2I2YA 3L3CA 1DAXA 4K0KF 3SZ2A 5CD4A 3OVBA 2Q6BA 2WSFC 2E5LJ 5KFWA 5DDRC 2NXUA 2O1DA 3FBFA 3D67A 3M8ZA 2HLTA 5L1JA 3V81A 3B4NA 1QRBA 1Q95G 2ZE2B 3HM9A 4RW9A 4W8QA 4CWBA 4FN5A 3QWPA 2HBZB 2YQ0A 4IOCQ 1JMTA 4PWUA 5C24B 2NSBA 3IA0A 2OEMA 4DV3J 2FTRA 1R43A 1NRKA 1SKUB 3DN9A 4GC7A 1GX6A 2UXDF 4FF2A 1VQOS 3W2VB 2QLFB 2YNHB 1V3RA 3O1LA 3S6EA 3KK2B 3U7JA 2HS3A 3LWMA 4WBFA 4I4BA 4LFAJ 5GMDA 1S6QB 2V34A 4DU7A 1WSRA 3VCDA 1VRQC 4MK9A 2KYXA 4YB5A 2MEWA 2BM0A 1W26A 2UUCJ 1FXLA 1D8ZA 1FDBA 1SH3A 3M30A 3J80Y 2HVZA 3K58A 1RISA 2BA9A 4I56A 2X3GA 1PAEX 2XMVA 2J7UA 2M8DB 3SQOP 3M2UA 2L3MA 4HDGA 1FKPA 3JTPA 2DNOA 1YX2A 3DXBA 2BE2B 4RLEA 5KT5A 3OSNA 2GV1A 2DITA 4H4OA 2L08A 2HMIA 4V02C 4ZPWR 4GC6A 2LECA 4ED4A 3IAM9 3CJKB 1R89A 3H20A 5CQGA 4L72B 3G71S 2LCWA 3MMBB 3FQLA 3SEOA 1L3SA 4XL9A 2NTPA 2MZSA 3KOAA 3H4BA 2DGXA 4ZPBA 3N4WA 1ZZFA 3MAAB 3EZOA 1NDLA 4OYOA 3T9NA 4JI8J 5LSRA 2SXLA 1RWWB 3KNGA 5CYMA 2IRYA 4OYIA 2PECA 4OQJA 1OMSA 6AT1B 2AP6A 3SCIE 4QBUA 1KD1T 1YZ6A 3GJRB 4WU2A 2VQFJ 5GAHI 4ZPVR 2MZTA 4B9LA 3KYLA 4CLTA 4NL5A 1HL6A 2XULA 1NK9A 4ZN1A 2RUGA 2ZZNA 2HQCA 3TVZA 2M0GB 5KT2A 2IYIA 1QQ1A 3H5XA 3HPOA 3W66A 2OPPA 3LP1B 3QAEA 1XMQJ 3MI7X 1WXRA 1NO8A 3GV7B 2GVZB 3V4MA 2ROPA 2FZKB 2R7QA 5HAOA 1MNEA 1SQEA 2DEJA 1F6TA 2CQBA 4XIUA 1O51A 4I2QA 2O5DA 1C1BA 2NUHA 3R5GA 3BQ2A 2G0JA 4RW6B 4I1TA 4UQGA 3LANA 1PBUA 2HQ3A 6FDRA 3M8SA 4N8OA 4CYUA 5FJ4A 1LW2A 2HHTA 2XCPA 1HR0J 1CSJA 1PE9A 1VR6A 4ZK7M 1BD6A 2EFQA 4F3OA 1JJHA 2JX2A 1REVA 5AJ3J 3B82A 3NOGA 2J6TA 3EVMA 2NPIA 3LP0B 3FNNA 3G6VA 1RAFB 4E0DA 4RW8A 4KH0B 4JI5F 1CQMA 2EI5A 4KGZB 1FXRA 2FY8A 4NYOA 4UT4A 5C24A 4L6V3 2HHQA 5AMVA 1WEZA 4CZCA 2MQQA 1LNQA 1T8EA 3HHDA 4OJOA 2G0IA 3HT0A 3AD9C 1AT1B 2LXIA 5F8GA 4TN2A 5A6WA 1FJEB 2MTLA 1U24A 3GIRA 2ASLA 1Q82T 3DI6B 2HGMA 3KK2A 1X9MA 3DLHA 3CIMA 4FVCA 3A8EA 4B3TJ 3P45B 1RT7B 4EFAC 1RTJA 1DTTB 4TY9A 4DL2A 1AZSA 1RTIB 2DH9A 3KDOA 5HI7A 2ZKTA 4EU0A 1TR0A 1ITPA 5THWA 4QIWD 1HQUA 1X5TA 2PYGA 4NLVA 4K5SA 4Y3CA 4JI7J 4RWXA 2R2SA 3LA0A 1YWXA 1NHCA 5K5MA 2V9WA 4J9UE 3M9MB 1NLKL 3HSJA 3M8RA 2KFNA 1LWCA 2EPIA 1L3TA 1HW8A 2J0WA 3W5ZA 1R0BG 1IR0A 1LKZA 2QL9B 5AXLA 1VRUB 4ZVPB 5J1PA 3Q24A 3HMJG 4AQYF 1VHFA 4IFVA 3WHIA 4UY8T 2VASA 2JEIA 3J7Z5 4Q8FA 3EX7B 1WTBA 2DGQA 5H9FJ 3D0GE 5DQIA 3GJTB 3BB5A 2F7VA 4B3OA 3AT1B 1U7LA 4I68A 4KIAA 2ROGA 4PZVA 4ID5B 4M63A 2VODA 3DRSA 1BQMA 1S99A 2PGCA 4OI2A 1RU4A 2DGTA 1R0CB 3MPWA 2A10A 4U7UK 3EWGA 2ALZA 1MWZA 3K5NA 1UA1A 1K47A 2JVOA 2HW3A 4WPAA 3CDAA 5HVFA 4XKVA 4U7UD 3OL6A 2KT2A 2VFMA 3LP1A 2CWXA 2B51A 1JJ2R 2KRRA 1RUSA 4CNYA 1M5OC 3CNQP 3R5CA 2GVDB 5IC6B 3FJ2A 4QPXA 3R8YA 1OFDA 2VBMA 2QJ3A 2IHR1 2YX1A 3JURA 3SCJE 1C4CA 3KNAA 1SVDA 4B3SF 2IAJA 2IVFB 3RTVA 3ENQA 2K8GA 1CJUA 2OFHX 4ZPTR 3A3NB 3TA0A 1CVJA 3CMAS 4MR0A 3BGRA 3HJFA 3TA1A 3K0JA 2RF2B 3O8WA 5D0EA 1KLNA 2KRBA 1QA3A 4OPWA 1R27B 5E3PA 2V5IA 1AB8A 1SBRA 2AZ3A 3MEGA 2AX0A 1DTQA 3C46A 2BM4A 4MK8A 4ZP6A 2DXDA 4HKQA 5SZTA 4EO6A 3ONQA 3OW2R 3ZSCA 1F3VA 3ZZPA 2POKA 1LWEB 1UVLA 3BGOP 5IQQA 3IGNA 4YHHF 4OL8A 4CRJA 2AV5A 4GKKJ 3MEKA 4ZVHA 1LLWA 2ZH4A 4ZJQA 1K4ZA 4LREA 3KXDA 4LSNB 1KQGB 3OUYB 1FWLA 2DNPA 2QN6B 2PMZD 3KKFA 1RWRA 3NGSA 1FJCA 2BDPA 2HK2A 3VSUA 1WNEA 3DDKA 5D0HA 5GMKa 3FVYA 2E29A 3KK3A 3F73A 5E0OA 2BQRA 2BZ2A 1U8WA 1RT3B 3G8SA 4DLEA 4USKA 1JQGA 4LF8F 5HN0A 2FJDB 1ZM4A 3M8PA 5IM0A 2KM8C 2MGZA 2J76E 1C0TB 3VR1A 4O4GB 1SL1A 3CT9A 4RU2A 4I7FB 4DV4J 1I5OB 1X4FA 1NK0A 3IBWA 1SL0A 2XMTA 1S57A 4MYUA 1MN9A 1GMUA 4RW7A 3RGIA 2G4BA 5EX3A 2YY3A 1N6QB 1N5YB 4F0KA 1CC7A 1QA2A 3QFHA 3HVTB 4BBYA 1NK7A 4A47A 4ZIVA 1QAIA 2GIFA 1UWBA 1NB7A 1NSKL 4O3OA 4FVMA 3NGKA 2XI3A 2I5JB 1R3NA 4LBHA 4CIOA 3AY0A 2ZH3A 4DR4J 3HJVA 2UZAA 3P5BP 3ETMA 3DRPA 3ISNC 4NA3A 5C42B 1VIXA 4UOFA 2R42A 2I6WA 2W7AA 4NCBA 1B3TA 3LQVA 1NK8A 2D9PA 4PPZA 5B0AA 5L9XA 3BO2A 1KP6A 5D4LA 3S8SA 1U2CA 1YQHA 2ZOGA 3RBXA 1RCOB 4EW9A 1RCXB 2C2OB 5IT9U 3UR0A 2BEFA 1IBCB 1ULRA 5BR8F 4L3KA 2JJ4D 1F5AA 1IJEB 4RNOA 1EP4A 4DSKA 1IBMJ 5KFBA 4K4TA 3HFZB 3KHGA 2BKOA 1LW0A 3PFEA 1FF2A 1PJ5A 3Q0AA 1Y7PA 3NNHA 1T11A 4UOHA 2UUBJ 4CLLA 4MAKA 2ZHBA 1N5QA 3GIIA 3HVWA 4RBVA 3NAIA 4IG3B 4EYIB 3V6DB 2DH7A 3JQKA 4OJLA 1FJ7A 3MECA 2CAJA 3CCWA 2G2ZA 1SC1B 4CO4A 3DLEA 3KLFB 4WTYA 1YJUA 2ZC3A 1WC3A 1G6BA 3NNAA 1OFLA 2FJBB 3IR7B 1UVKA 1FHTA 2BXJA 2ZH5A 3TANA 1TKXA 2MKSA 4KH1B 4AL5A 3WWGA 2DNNA 2QTWA 5AE1A 1SJRA 4C8YA 3S1TA 3PJWA 4C0BA 5F0WA 3IRXB 3C15B 2CQIA 3TEHB 1G1XA 3HKZD 4DUZF 4NOHA 2RD5C 3TAQA 2OIHA 1HD1A 1ZPVA 1E6YB 1F1BB 1RT1B 3JSMB 2UVEA 3TZXA 4X4VA 3DRRB 2CG8A 5IC4B 1HPZB 3UW0A 2VG5B 5K8OA 1MLAA 1KQSR 1RT4A 3OVAA 1RAIB 5I3UB 5L8RC 1HQEB 1M5SA 3AJ2A 4BWMA 3T1HJ 3B90A 1IQTA 3NCPA 4K5RA 4CM0A 2B6AA 3CPWR 1S1XA 3W9IA 1NKEA 4DL6A 4ZLNA 5C2GA 1OJ4A 4OYAA 3GP9A 2V4QA 4NLYA 2QV6A 3PHTA 3F56A 3NS6A 2DNYA 3KG4A 3OT9A 3VAMA 3C66A 4XN0A 3MR6A 1NDPA 1FRLA 1L1IA 2Q3PA 1JLCA 1ZH5A 2F9DA 4OYWA 4WP3A 4AL7A 4OJ6A 5M2RA 3SIPB 4CH7A 2MXYA 1YRXA 3CO9A 5E3QA 4UZBA 3VVTA 2CJKA 3R3TA 5MAOA 1LWXA 4K4YA 1IKXB 1DHMA 1RAJA 3C6TA 2ZH2A 1S5ZA 4X66J 1FE4A 2BKNA 5A8KB 2FJVA 5L1KA 1URNA 1P8GA 1U49A 2WSEC 5CH7B 2ZH1A 4M5IA 1NSAA 2LXUA 2HS0A 1QTMA 1WSVA 1R6VA 2CVIA 2MZQA 1O8HA 1RTHA 2YH1A 5C42A 3MOJB 1IWGA 4O23A 1N5SA 2ZNZA 3S01A 5MLCV 3HO1A 2AJ1A 3CDEA 3R27A 1RE1B 2EVZA 2B9EA 2OMLA 4YMEA 3H09A 3FSXA 4RO0A 5L1IA 4DV0F 4PYAA 1K9MT 2CQ0A 3TAMB 2RH3A 1SC6A 4JI1J 2V4JB 1Q16B 5EWFA 3HFKA 3CC4S 4DCPB 4DR1F 2YVSA 4PG5A 4C6AA 3TA2A 2IMWP 1X0FA 4ZKAA 2V2VA 2BV3A 4CO3A 2BJ1A 4DFKA 1RABB 2FVCA 2XTJP 3IWLA 3KK1B 4A8WA 1HARA 4USJC 2A18A 3DMJA 3DDIA 4FXWA 2AF6A 2Z30B 2NZMA 4FPIA 4DL7A 4UF4A 5DS7A 1U6FA 2W1BA 1O8KA 4LBPA 2MQNA 3KTQA 2HFUA 4QW9A 2FZCB 1HBMB 2A2CA 2HWTA 2VJVA 1FKAF 1KWMA 3CEDA 1X5SA 3C14B 3V2UC 4ED2A 2D41A 4DPXA 1CJTB 3CD7A 2DKOB 4CLYA 3O6QA 4J9RA 5LMUJ 1FEEA 3D6MB 5IFMA 1RWVB 4OJPA 2NQPA 3UWTA 1ZM3A 1FJGJ 4JUZA 3ICLA 5KFZA 1QE1A 4X62F 2EK1A 2UU9J 3DRYA 3OFGA 1UZDA 4WXOA 1VQMS 1OO0B 2EFGA 3CCJS 2IJNA 1PAUB 3M2RB 2KZZA 2J8AA 3ZZUA 2MYFA 2HURA 4LIRA 2NS1B 4IOAQ 4LFBJ 2BE7D 1WEXA 1EZZB 2HSEB 4C98A 1X5OA 2R9LA 1IM4A 1ICEB 5H9FK 5KFUA 4CTAA 3MCSA 1S9GB 1L3KA 4M5LA 4Z06A 4CLZA 4ALZA 3TX8A 2YKMB 1X0PA 2YNIA 4PQAA 2XY7A 1HPZA 4EEYA 2XO6A 4YQWA 4CLKA 3GQCA 1WI8A 2VFQA 4DF4A 3EZUA 4USMA 3K8VA 1NSQA 5F8NA 2NSTA 4KSEB 2N3LA 3O3LA 2C1EB 2V8PA 3BBBA 5HMYA 3HHLB 2XHWA 1XC9A 2QEXS 3MM6B 4LMZA 2RAQA 1NK5A 2FB0A 1SH0A 2H5JB 1LQ9A 3K5PA 2W9BA 2O3DA 4J7CA 2EBEA 4HWVA 2KZMA 3MM7B 5ETLA 5DG8A 3N01A 1BLUA 5HQLA 4C48A 2YWGA 1T94A 2C2MB 4NLDA 3KG0A 2DNGA 3Q8QB 1FVQA 2VFVA 1NNDA 2W8KA 1Q79A 2J8SA 4B3MF 1VDHA 2LQ5A 5BYSA 1VGYA 1N33J 2D3UA 2D9OA 1WHWA 4Q0BB 3UCZP 4USUA 5HSPA 1XNQF 2YPYA 3FCHA 2HFSA 5IT9Y 3M6UA 2RDDA 2E44A 3MPDA 2MKHA 2HHHF 3THTA 1CJKA 4ILRA 2BJ3A 3AA8A 3IP0A 4DSIA 2PEHA 4YY3J 3Q2SC 2W25A 4CNZA 4OV6A 2H54B 1KQFB 3RB3A 4AXJA 1MU2B 1FNMA 3DNCA 1Z2LA 1AYEA 3HXMA 1TL7B 1Q0NA 3UE2A 3Q8VA 1IDKA 4BHQA 1EETA 5EDWA 1JLEA 2XLJA 2CZVC 1SUQA 2DIUA 2Y1LB 2OP5A 4ZLLA 1PKUA 4LF6F 2MZJA 3B4MA 2FUG9 2H48B 3NB2A 2PE8A 4IOBA 1HKAA 1KCCA 2XYPB 4JV5J 2YQ1A 3X3UA 1VBXA 1RKIA 3OTOJ 4ZVFA 3QIDA 1UPPA 5CCLA 3W5XA 4BWJA 5HP1A 2R7XA 2ZBCA 4A8KA 5D0RA 1RXOB 3NCQA 3MWBA 3RUBL 3FKBA 3BPDA 1NDKA 2C3UA 2FJXA 3J7ZT 1K1SA 3K7RA 4LF5J 4YR0A 3TJ9A 3OV7A 1MN7A 3EUNA 2K3IA 2CPXA 3D6HB 1U09A 4YUDA 4P75A 1S1VA 4F36A 2XT4A 4W4MA 2ZHOA 1OFEA 2UV8A 2OUGA 2ZJQQ 4DUTA 1FKOB 1Y5LB 2OPRB 1YLXA 2CDQA 2RS2A 2KXFA 5K8MA 5F9LA 5DZ7A 5JJBA 1WKJA 3UPFA 4HH1A 1TL3A 4J9SA 1KEKA 4O44B 1W2BR 3KRGA 1ZAXA 4ZOSA 2D1CA 4GVBA 4DL3A 1P27B 4KHMA 4ZVOB 4N76A 4DUYJ 1LOUA 3FCVA 3DM2B 1IKWB 2GGPA 2IDLA 2MMYA 5A2QU 2C22A 2G2YA 1JLQA 4E8UA 1U25A 2C2NA 2RB7A 4ECZA 1MWQA 1PILA 1U6BA 2OI2A 1TL1A 4LR8A 1KTQA 4H54A 1HHQA 3L4BC 1VMBA 3PZPA 4U6PA 2CPZA 2XCAA 5KFMA 1PIEA 2MDAA 4NLXA 4AYBD 4DR7J 1U02A 3TUPA 2OAUA 3JSBA 3CD5A 4PXEA 2IJFA 3FQKA 1UW4A 2J6SA 1L3VA 1N34F 4K59A 1OIAA 2AWZA 1WDDA 3CCSS 5LXRA 2CRLA 2DRBA 3TQEA 2B56A 4QIGA 4ZCMA 3J81U 2VUGA 2J7KA 3NL0A 3CJTA 4MIAA 1ZAWA 4J9KA 1FXDA 2XQCA 4X64J 3W8GA 1U26A 4GO7X 3NCRA 2B8PA 4NEZA 3J7AN 4DQQA 4H4MA 4QR0A 3T5LA 4Q7AA 4O3QA 4Y2KA 5KG2A 5J1EA 4P9SA 4BC9A 2BOAA 1F9EB 3TZWA 1SXLA 3GFYA 5BJRA 1XNRJ 3A1YG 3EDRB 3W2WB 3KLGA 5GMEA 1YI2S 1T03B 4GKJF 4QYZJ 1IDJA 5AXMA 4KKOA 1NKBA 2M52A 3R7SB 3QT6A 1RADB 1SL2A 1HYSA 1V5VA 3MM8A 2FC8A 4YN3B 3DU6A 2Z2MA 2E1AA 2KT5A 4TXSA 4CM2A 1K73T 2R7OA 3IFEA 3ZO7A 4LF7F 4MFBA 2ZWOA 2DXFA 1RA7A 1UFKA 4JI4J 3RB4A 1FNOA 3KDNA 4M5DB 2WK4A 3GE9A 3FMBA 3DLGA 3DFEA 4X65J 5KFAA 3GJQB 3Q8PB 4DDFA 1E6VA 1XWLA 3NEKA 3CIZA 4QYRA 3K5OA 3W61A 5H9EJ 1UVMA 2BOPA 3WIVA 2QA4S 5DDQC 1ZTWA 4KAIA 4ELTA 3HLUA 5D0GA 5E5NA 3NGTA 3MMCB 3ILOA 3C19A 3X1LB 3EPGA 2QYCA 1YJVA 2L48A 3MUMP 4YCQA 1DBOA 4ZVTB 3MFHA 4NA1A 4Y0FA 3QJLA 3JQMA 2HNYB 5KFHA 4ZVRB 4CDIA 4AUKA 4ECYA 2GO9A 4LF2A 4DPWA 2UVWA 4O3NA 3ML3A 3I96A 1Q8IA 2V9KA 2J0QD 4KV8B 1SC4B 2B5JB 1UZHA 1K1QA 2QLJB 4DPTA 1RT5B 2HPUA 3AHPA 5CXTA 2OGUA 4F7VA 2AGQA 1O8MA 4AL6A 3PSZA 4A46A 4TU8A 1QJVA 5SUHA 2V0NA 4XONA 4Z05A 5HBMB 3GJSB 3U1MA 2BJEA 3AJ1A 2B0RA 5ETKA 5ETTA 4YR3A 1O8EA 2AQ4A 1XN9A 2VFSA 2W7OA 3G4SS 1A0OB 1J27A 1IKYB 4OZLA 4LRBA 3GIJA 3OFFA 1RHJB 2GNKA 3AXKA 1KOHA 5KFLA 4AXIA 1N32J 4KGXB 3ZZYA 2Z8GA 2ZVSA 2Y0BB 5B0EA 2MKIA 2X85A 3BGUA 1FD2A 4QIEA 5HK4A 1TL5A 3M2VA 2MKYA 2IA0A 4DR5F 2MZRA 2WAQD 3POTA 3NOCA 1UW9A 1RQ0A 2N7CA 3OHAA 4A8SA 2ZJPQ 1DQ9A 5DM6Q 1N0UA 3FFIA 4OIXA 4M94A 4OYPA 2DB1A 3ZZTA 2CPFA 1FRXA 1WG5A 4LRFA 4NX9A 4OJ3A 4ICLB 2MZ1A 5HATA 4X4UA 4TY8B 5EN1A 4QOTA 4K0KJ 2PT0A 1S1WA 4P73A 2OSQA 5KFKA 1N48A 2B3TB 3O5TB 5GVQA 4WJBA 3DGPA 5KFGA 3G82A 3AQPA 1D09B 2YNFA 1XR7A 5D4PA 2GHVC 2I8EA 1H6KX 1HNIB 3TZZA 3W64A 1KNZA 2EW9A 2CVEA 5AXKA 1X4EA 1WC1A 4I0WA 2FGOA 3E01B 2VPWB 3W1YC 1NZAA 3V4IA 2QGFB 4FYXB 1NPPA 2UXDJ 2RILA 2IM3A 4DS4A 1QSYA 4YOEA 2OFGX 4K4WA 3K89A 2D7SA 1TKTB 4YB1P 1YBAA 1VLOA 2VIHA 3MOZA 2YX7A 2A0FB 3MCNA 2KG0A 2Y1JA 3SSQA 1WC0A 4NLTA 1RT2A 3JS9A 5D3GB 5ETQA 1HHSA 3MXHP 4IRKA 2ZBIA 3LYCA 3QO9A 3RW6A 3OBIA 2R2TA 2HFNA 3PRBA 2GA7A 2DGUA 3ITHB 3N28A 3IS9B 2R7WA 3HX9A 4XAKA 3MZIA 2A1BA 2JFKA 4PR6A 4IH6A 2YKNB 5DQHA 1C0UB 2V94A 2XZDB 2XSJA 2BM5A 4IG0A 1WG4A 1ZTTA 1R8BA 4FF4A 3RB0A 4U96A 2HFOA 2GMJA 3QLHB 1PBAA 4RW4A 2ODLA 2QA4G 4MXNA 2KG1A 3KLIB 3MR3A 3H4DA 2WONA 1KDNA 2FHOB 3BS9A 1HA1A 3F0NA 2F65A 4RJVA 4HR2A 4X84A 3NP5A 3OR1B 2XZWA 3R9LA 1TUWA 2UUCF 4FF3A 3F41A 2B0GA 3RYLA 4LR7A 2HNZB 1HF2A 4QWAA 1TUVA 3EGNA 5T41A 1S6UA 3J81Y 5LM7E 8ATCB 2DNHA 2GAGC 1CJVB 2HHVA 1GMWD 3PEJA 3ZXWA 1T0TV 2GIQA 1Y4ZB 3I56S 3BSOA 4KFBA 4ECXA 3ISZA 1T95A 2WCXA 2IFXA 3UW1A 2H9ZA 3SFUA 1IUJA 3SY2A 2WVDA 2GIRA 1JXVA 2CA9A 2CUYA 3UN2A 3V6JA 4QIVA 3R97A 4C8OA 3DDNA 3CCVS 1QM9A 1VCTA 1EB0A 1UA0A 3FDSA 3VSTA 4DX5A 3GQ8A 1KFDA 1HBNA 4ENOA 2VH7A 1SIWB 1GFWB 4NK6A 2BABA 4YC5A 1FERA 4P52A 1WF2A 3L95X 1GAOA 4ICLA 4WFNQ 2MHEA 5L1LA 1O8BA 2ZDPA 4LR9A 3PCOB 4NLGA 1GTHA 4TKTA 2KN4A 5D4OA 3GYGA 4YDTA 3WX8A 4NA2A 1H98A 4XLFA 3T19A 5KFTA 1DRZA 2Y9HA 1JNZB 1I94J 3IWXA 3MEEB 3EM1A 2VFTA 2GAHC 2VKRA 4YR2A 1WTFA 1OY9A 2R8HA 1B70B 1XMQF 4JI5J 1LM1A 2VPYB 2CG4A 2LA6A 3NS5A 4ZVEA 1CC8A 3FGVA 4Q45A 5A8WA 5T7LA 1F2HA 3PR4A 2DR6A 3B4DA 1OGMX 1TAUA 1EE6A 3PSSA 1VBYA 3MDFA 1O5JA 2BANA 3GU0A 3U1NA 2EWEA 4DPUA 4LQ3A 3CTRA 1S59A 4ZJLA 1FX2A 3E01A 1NJWA 5ETRA 4ED0A 2NREA 4TNOA 2M70A 3PVXA 1VQ4S 1C1CB 3QZ7A 2KHCA 1URRA 3TUJC 4NI2A 3H2VE 3NNCA 1R8PA 2O04A 2J0SD 3EZ5A 3PACA 1N0VC 4OYZA 4XOPA 2J9DE 4U9RA 4ZJOA 4LUBA 3TAPA 1S1TA 1DZ5A 3NBPB 3G6YA 1S9EB 1VI7A 3VF0B 2DEIA 3D0IE 4TQSA 4LRDA 5GAEI 2H5IB 4PG7A 1TV6B 4KPYA 1WJ9A 3CJSA 1KQ5A 2YKQA 4W98A 3JSYA 4NMXA 1H38A 4O3PA 4R0JA 3H5YA 4I84A 1N4LA 3S7RA 4OI4A 3M6VA 4M5JA 1M1HA 2WVCA 4XM3A 4Y2CA 4DR2J 1FI4A 3WX4A 1UCNA 5ETOA 2RQ4A 5ETPA 3PR5B 2LXFA 3CMQA 4AQYJ 4U95A 4RWWA 2FJAB 2M3DA 4X4NA 1XG2A 4QYZK 2E5GA 4X4SA 1SCJB 1YK9A 2GW8A 2C42A 4CLWA 4TLRA 2XMJA 4WZQA 1UEKA 2CPJA 1S48A 3CSKA 3QRQA 4ED8A 4ITSA 2YNGB 2IOUG 3D28A 1FRHA 3MR2A 2X1BA 2RQMA 4PQUB 4B17A 4YB7A 2AEMA 1XMOF 3W65A 5HQMA 4XN3A 4MKBA 1CEZA 1X5PA 3EGWB 3QSYB 3PV8A 3EVOA 2VFNA 1UJ5A 5H9EK 2DVIA 2LQBA 3UDVA 3SYZA 2ZD1A 4OYXA 1X8DA 3BQ1A 4ETXA 1J5OA 5C7PA 2XNQA 1H0HB 1K44A 1MROB 2DPJA 4R5PB 4M5MA 3VV2B 4ID8A 4QW8A 4RNHA 2J8KA 2ZEJA 4QR2A 2QE5A 4ZCKA 1HNVB 1TYWA 1C2PA 4C11A 3D3CJ 3T1AA 3H25A 3OFEA 1OQ6A 3ET6B 3MUTP 3MM9A 2V2KA 1WACA 1CS4B 3C16A 3VWSA 1HI8A 1UTAA 2UUAF 2X6XA 1LWFA 3OXLA 3LJYA 3ZC4A 5BYRA 3PYEA 4YHHJ 3FRZA 3W60A 2DO0A 1F9FA 4ZHRA 1CULA 3WBZA 3ZPPA 2ASYA 3PEHA 3M32A 2W4DA 3V81B 3T3FA 4RNMA 2JEJA 3TX0A 3QIPB 1I51B 1BE4A 4RW9B 1YRUA 1KLMA 3QT7A 1IB4A 1C1CA 3QT8A 2W9CA 3LH2S 2E9TA 1RSCA 4LF8J 3H7HB 1DLOA 2Z57B 2R8JA 1EQMA 2QX0A 4HLBA 2P9EA 4U67Q 4LVOP 5C1CA 3NG8A 2PEBA 4F4YA 1RAGB 3R1HA 1YJTA 2B9XA 3BR8A 4PUOA 1NH7A 5F0UA 1I3OB 4Z37A 3M30B 1IBKF 3QRPA 4FXDA 3RG6A 2F40A 2CJYB 4Z03A 9RUBA 2DD8S 4Y28C 2XYHB 3M2UB 2HVIA 1ROFA 2O17A 3DRXA 1FKPB 1CG2A 3D9BA 1D9DA 5HMWA 4Q5VA 2BM6A 4P74A 3R7NB 3G86A 4A8OA 3LALA 4H4OB 4F3QA 1X31C 4NE9C 2XYGB 3A8JA 2UUTA 2HMIB 5G0RA 4OJ5A 4F8RA 1JXLA 2D3OR 2BBEA 3GZ7A 5ETNA 1IQZA 2PYHA 2JSXA 2DHXA 1FRJA 2HVDA 2CJ9A 5KFJA 1IR2A 3GFHA 1LFWA 3VAKA 2WW4A 2VQEF 5IWAF 2YUHA 4XKWA 3W62A 4WXWA 4FPRA 4Y2AA 5BR8J 3HDSA 2CPEA 2VD3A 3BKTA 4OZJA 3JYTA 2HFVA 2KM8B 2DGVA 1FA0A 3H98A 3MD3A 1KKHA 1OY6A 1WWHA 3BKFA 4NLSA 5DM7Q 1WHVA 5LOQA 2GMHA 3BF4A 3BM7A 4TLQA 1RACB 3CC7S 3SV3A 4JI2F 1H7WA 2UV8G 2HVHA 2QX3A 2NXJA 3TQ1A 2AW0A 1TP7A 4PYDA 3OTEA 3I55S 1AROP 3MMJA 2OPPB 2N3OA 3KHHA 2KVIA 2C2ZB 4I2PA 3BH6B 3IRWP 1QD1A 4ZCLA 4OYBA 3DOLA 5EWGA 5IQ6A 4CH1A 5E33A 3AOAA 1C1BB 1U0HA 5CABA 4NYZA 1RGVA 3R6GB 3VAFA 2DH8A 3SQGA 2CPDA 4CYUB 2O1PA 2FVSA 3D1OA 2CJQA 1LW2B 5HLFA 2XS5A 3QMQA 4C7QA 2AIRB 1M5KC 3RRHA 3A3OB 2PMWA 1EZGA 4DUZJ 5FLXU 3T6JA 3CDWA 4QIFA 2BE9B 2R2RA 2P8IA 3UD4P 1QSLA 1Q7YT 1REVB 3PDNA 3AD8C 1XMBA 1ZM9A 4RW8B 3QIPA 2F5GA 3SUCA 3FMWA 3IN5A 2JL9A 3DCAA 5KG7A 2IA6A 4NWBA 4KQZA 2DY9A 3BDEA 2D74B 4NLQA 3OTDA 2XMAA 2B4VA 3QGHA 4J9PA 4P2SA 2FLOA 4QWEA 1S72S 2FVQA 3T6BA 3H42A 1U48A 3A4TA 2VU5A 2OD6A 2M8HA 3AB2B 1RJJA 2ZZTA 3UN3A 3RAMA 4LF4F 2QY1A 3EMTA 4DV6F 5B0GA 4M8LA 3H0PA 3SBMA 4MK7A 3GFXA 1WI6A 5D6GA 3EJMA 1RTJB 2CJAA 2XB2D 4DQIA 1AZSB 2BM7A 2IRXA 3O44A 3CD0A 2LKZA 4PXDA 3UD3P 2DR7A 1WMRA 5I3QA 3ILIA 4WKYA 1HQUB 3PRVA 1TK5A 3GG1A 4X4TA 2B9YA 2FPHX 1HNZF 3E2EA 4KGKA 4CLFA 1BGXT 3A8KA 3CJ0A 3VAIA 2J0XA 1LWCB 4TVAB 1HMVA 1VRTA 3GCWP 1GNKA 5AE2A 2XY6A 1OPIA 3JTNA 4G1QA 3SV4A 2NXCA 1KR4A 3PTWA 3ZTRA 5J2NA 3IR5B 3NXZA 1XR6A 4IFVB 3P4UB 4DV0J 1YJWS 1PGZA 3GV8B 4HHJA 1UJ4A 2ZHAA 5A0YA 4ECQA 4DR1J 3QGPA 4QU6A 1S76D 4Q43A 2BR0A 4DSFA 2GFFA 3CDUA 1MWYA 1BWVA 4B3OB 1DBGA 3TJ8A 1S77D 4EO8A 2HZCA 2M7SA 3PO4A 2M5YA 1BQMB 3DRSB 1WC4A 3CJ8A 3K8WA 3SSRA 1FE0A 5HROA 4A8FA 4UOGA 4DS5A 2V69A 2LMIA 1TKZA 3EYZA 5C1EA 1F3FA 2C3OA 4KR0B 3IGVA 1JKHA 3LOUA 1JLBA 3MM5A 4NASA 4JI0J 3AODA 2XLKA 2JC0A 4IUFA 1WF1A 2VA3A 4PAAA 4EMDA 3MD1A 2KB2A 2QFJA 1R0AA 1X0CA 5KG6A 2OKQA 1S0VA 2IVYA 3D68A 3SCLE 5LT5A 1KTWA 4PG6A 2HK3A 5J2MA 1NJYA 1BY9A 1F5CA 1GQEA 1SJFA 2IAJB 3PW7A 2RRAA 1CJUB 1U1OA 4XK8C 3R7BB 3GQ7A 4S0MA 2XC1A 4YDXA 3BGRB 3SZEA 5JUMA 4HACA 2N7YA 4J90A 1VQYA 3OQ2A 5A8RA 2J6UA 4HL9A 1PCAA 1U2FA 3MEGB 2CQCA 1DTQB 1WELA 4Q2LA 2CNOB 3D2WA 3SMZA 4USVA 3NY0A 2MQPA 4URQU 4LQ9A 4D3HA 5KAKA 3GSDA 4LVNP 3K5MA 2IPOB 1R8CA 2FD2A 1SJQA 4KHRA 2FIUA 4MKAA 3AD7C 4C4WA 3BN4A 2XM3A 2OPQA 2LQ8A 3TO8A 3DHXA 2AJ4A 3CW2C 1NJXA 3U1LA 2UU9F 4URGA 1RTDA 2V8HA 1V5IB 2HBQB 3KK3B 1FESA 2W2OP 1B7FA 1JIHA 3MCOA 5D4NA 3Q2TC 2ZM6F 1G3OA 3I0SA 2YWFA 3VAGA 3M8PB 5IM0B 4B3MJ 3VQSA 2MGZB 3BN7A 4NZ7A 1S4EA 5J2QA 4C8LA 1PC5A 5HL7Q 1X60A 3H8YA 3TEGA 1XNQJ 3W5YA 3EQOA 2YPZA 2OD4A 3BO4A 2HHHJ 5FIIA 3LPYA 2HHSA 1QCXA 3CCUS 4KJIA 5J1NA 5EX0A 4RW7B 4ZVQB 1HBOA 2O01C 4OM9A 1JLFB 3P5TL 4HTJA 2ZH6A 1JNRB 1G7CB 1UWBB 2VKZG 2ZOFA 2L9NA 1SJ4P 4ED7A 4USWA 4Y00A 2OTJS 2Z58B 2H4YB 1UETA 4RUCA 2HYIB 1SV5A 2PDAA 4MTPA 2FHKA 4W90B 2VJUA 1UMJA 3VQTA 2KJVA 1YBUA 1T9TA 1FVSA 5ITHA 3WC2A 3DRPB 1ZS6A 2VL1A 1NZ8A 5I3PA 3HKWA 3BH7B 1H80A 4C2LA 1N33F 3N5FA 4HT5A 2YWKA 2ILZA 3G96A 2CPIA 4LRAA 2IM2A 2HEKA 2DNLA 2G2OA 2BJ7A 1Y9OA 1FFWB 3HZEA 3K59A 1TUGB 2N82B 3I9ZA 2J7WA 4C8ZA 5E41A 1AW0A 2C3YA 3M6XA 1N88A 2JOQA 1RWKB 1UPMB 1YGYA 2W9AA 4W92B 4B9SA 3N6ZA 3JAMY 1RYRA 4DEZA 5B0FA 1EP4B 4FP9A 4YY3F 1RU2A 1XQIA 2OSRA 3GR1A 2CKWA 3UFCX 1D8YA 8RUCA 5FLXY 1SKSA 4EZ9A 2E7WA 3CJRA 4IFYA 5C2CA 3PG9A 4ZP9A 1LW0B 5CYJA 2CADA 2OJ3A 3UR3C 1DARA 4ED1A 1NPRA 1J5EJ 2B4UA 1HBUA 5CAAA 2UXCF 4RUHA 3GMGA 1Q81T 2Z4PA 3G8TA 1OWXA 1GMWA 2RIJA 3MECB 4WYLA 2H65B 5KG3A 3DLEB 5KTQA 2MSTA 2IYGA 1Q1KA 4CLUA 2GQQA 2CNKB 1X4GA 3OTOF 1MMLA 1OY8A 3VAJA 1TKXB 4F0MA 1A6LA 1VFJA 2RHQB 2HZVA 1X4DA 2DNMA 2FDNA 1KHWA 4DJBA 1X4AA 2W4PA 2WOMA 4UY85 2LYVA 4UUWA 4A8MP 3KJVB 4DV2F 3VZHA 3EXCX 2ZJRQ 5C25A 3R5BA 3BBCA 2ZKUA 4CLSA 1RT6A 3PETA 2ADBA 2EBGA 2AMCB 4J9LA 5CYQA 3CCZA 3H59A 1D9AA 3H2LA 2QZAA 4LSLA 1RT4B 4M5HA 3GR0A 4ECTA 3UCGA 2BMBA 5K14A 3ZNJ1
chains in the Genus database with same CATH topology
4KH3A 4CP5A 4UOGA 3Q8VA 3EE3A 3PJ9A 1NSKL 4JRAC 4UOHA 1K4ZA 3Q86A 3Q83A 3ML3A 1F3FA 4DUTA 5CAAA 2IOUG 3JX8A 3EVWA 1EHWA 4HR2A 3Q89A 4OJPA 3R9LA 3VGVA 2HVEA 3EVMA 3NGSA 3RIQA 2VFMA 1PKUA 4DZ6A 3FBEA 3ZTOA 3LJYA 1W7WA 3Q8UA 4ANDA 1NLKL 1BHNA 1PAEX 1HF2A 3B54A 3GP9A 1BUXA 1TYXA 4OJLA 3H09A 3WX8A 3ZTQA 3EICA 2G0YA 5BXIA 2DXFA 3SYJA 3N90A 3ETMA 1WKKA 4F4AA 1ZS6A 1WKJA 1QQ1A 3FBCA 3P4GA 3FBFA 3JS9A 1XIQA 2HURA 2BM6A 3BH7B 2DY9A 3FBBA 2J8IA 4UOFA 3VGTA 3VVUA 3NGUA 4DI6A 1B4SA 4C6AA 3EM1A 3EVOA 4FKYA 2VFNA 3ZTRA 1NDPA 1NHKL 2B8QA 1U8WA 3FCWA 3LYCA 1QRBA 1CLWA 1NPKA 1KQ5A 1TSPA 4OJOA 1WXRA 3ELHA 1QRCA 3B6BA 3ENAA 4W98A 2B0RA 2VFPA 1BE4A 4ANEA 3ZTPA 4V02C 3MPDA 2DYAA 4OJ6A 5C7PA 3BH6B 1VYAA 2VU5A 4OJ5A 4S0MA 2B8PA 2XC1A 1K44A 3AK5A 1F6TA 3FCVA 3DDIA 3FKBA 1NDKA 2BEFA 2AZ1A 3SZEA 2ZUAA 3VVTA 3BBFA 3L7UA 1UCNA 1NUEA 2BM5A 3NGRA 4KPCA 2HVDA 1NSPA 1JXVA 1LWXA 1QA3A 3NGTA 1NB2A 4OPWA 2DXEA 3EMTA 2VFQA 2V5IA 3Q8YA 3N6ZA 5CABA 4FKXA 3VGUA 2W7ZA 1S57A 1NSQA 5JLVC 1NDLA 1S59A 2AZ3A 1DABA 1MN7A 1TYUA 1S5ZA 1NCLA 1NDCA 3BBCA 2CWKA 4O0NA 1MN9A 4EK2A 1LEOA 3PETA 2BM4A 2YUHA 3G2XA 3EJMA 1XQIA 2DXDA 1WKLA 1HHQA 1TYWA 1HIYA 4ANCA 2NCKL 1TYVA 3ZTSA 2BM7A 2BX6A 1HLWA 3DKDA 5IOLA 3BBBA 4ENOA 1B99A 1QA1A 4WBFA 1K8FA 3TH0A 2F3LA 1QA2A 3VGSA 2VFOA 4OM9A 4F36A 5JMCB 3FC9A 1KDNA 3GPAA 3PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CP5 A;  4UOG A;  3Q8V A;  3EE3 A;  3PJ9 A;  1NSK L;  4UOH A;  1K4Z A;  3Q86 A;  3Q83 A;  1F3F A;  4DUT A;  5CAA A;  3EVW A;  1EHW A;  4HR2 A;  3Q89 A;  3R9L A;  3VGV A;  2HVE A;  3EVM A;  3NGS A;  1PKU A;  4DZ6 A;  3FBE A;  3ZTO A;  1W7W A;  3Q8U A;  4AND A;  1NLK L;  1BHN A;  1PAE X;  1HF2 A;  3B54 A;  3GP9 A;  1BUX A;  3WX8 A;  3ZTQ A;  3EIC A;  5BXI A;  2DXF A;  3ETM A;  1WKK A;  4F4A A;  1ZS6 A;  1WKJ A;  3FBC A;  3FBF A;  3JS9 A;  1XIQ A;  2HUR A;  3BH7 B;  4UOF A;  2DY9 A;  3FBB A;  3VGT A;  3VVU A;  3NGU A;  4DI6 A;  1B4S A;  4C6A A;  3EM1 A;  3EVO A;  4FKY A;  3ZTR A;  1NDP A;  1NHK L;  2B8Q A;  1U8W A;  3FCW A;  1NPK A;  1KQ5 A;  3ELH A;  3B6B A;  3ENA A;  4W98 A;  2B0R A;  1BE4 A;  4ANE A;  3ZTP A;  4V02 C;  3MPD A;  2DYA A;  5C7P A;  3BH6 B;  1VYA A;  2VU5 A;  4S0M A;  2B8P A;  1K44 A;  3FCV A;  1F6T A;  3DDI A;  3FKB A;  1NDK A;  2BEF A;  2AZ1 A;  2ZUA A;  3VVT A;  3BBF A;  3L7U A;  1UCN A;  1NUE A;  3NGR A;  4KPC A;  2HVD A;  1NSP A;  1JXV A;  1LWX A;  3NGT A;  1NB2 A;  2DXE A;  3EMT A;  3Q8Y A;  5CAB A;  4FKX A;  3VGU A;  1S57 A;  1NSQ A;  1NDL A;  2AZ3 A;  1S59 A;  1MN7 A;  3BBC A;  1S5Z A;  1NCL A;  1NDC A;  2CWK A;  4O0N A;  1MN9 A;  4EK2 A;  1LEO A;  2YUH A;  3G2X A;  3EJM A;  1XQI A;  2DXD A;  1WKL A;  1HHQ A;  1HIY A;  4ANC A;  2NCK L;  3ZTS A;  2BX6 A;  1HLW A;  3DKD A;  5IOL A;  3BBB A;  4ENO A;  1B99 A;  4WBF A;  1K8F A;  3VGS A;  4F36 A;  3FC9 A;  1KDN A;  3GPA A;  3PRV A; 
#chains in the Genus database with same CATH topology
 3PJ9 A;  5M2P A;  3H2U B;  3GQA A;  3CCT A;  4GMK A;  1IM6 A;  1ZPW X;  2ZOM A;  2B6A B;  4RNF A;  1S1X B;  1T05 A;  5L9N A;  1FX4 A;  3IC1 A;  2LLZ A;  5KT6 A;  4F02 A;  4PXC A;  2HHP A;  5DJB A;  3GIM A;  3FBC A;  2KDO A;  3QYY A;  4ERD A;  2V2Z A;  4KGV B;  4PWD A;  1N34 J;  2E9R X;  5DGB A;  2GCF A;  3H40 A;  4I69 A;  1IKV A;  2FLP A;  2VFP A;  4WE1 A;  1BQX A;  1JLC B;  3AA9 A;  2FHJ D;  2DNQ A;  2L9D A;  3LTO A;  4I6W A;  2DHH A;  4YP3 A;  3TWZ A;  2NLW A;  1HWJ A;  4QZV B;  2BYC A;  3W63 A;  2VIC A;  1BQN A;  3DLK A;  4A48 A;  1JLF A;  4A4J A;  1N36 F;  5AE3 A;  4I6Y A;  3IXQ A;  3GIK A;  4KHP F;  3CJQ A;  4PMH A;  3C6T B;  1TMJ A;  5D78 A;  4C2M A;  4EK2 A;  3R5D A;  5KFY A;  3ZTS A;  1HFE L;  1JB0 C;  2MKC A;  2MLY A;  6FD1 A;  2VA2 A;  2IIH A;  3UCU P;  1RAO A;  5DNS A;  4RPF A;  3Q8R B;  4XNF A;  1RTH B;  2RS8 A;  1Q8B A;  2E5J A;  5G4D A;  3KMQ A;  1EHW A;  4GKJ J;  4EBC A;  3M1V A;  4DR3 F;  4OHX A;  1RTZ A;  1OQ3 A;  3AAW B;  4HI1 A;  4DV5 F;  1T3O A;  1QSS A;  4WF9 Q;  3BSA A;  2DBB A;  2BRL A;  2RQK A;  2Z2L A;  4JV2 A;  1B4S A;  4ED6 A;  1SJ3 P;  3D1H A;  4A8Q A;  1NPK A;  1G2E A;  3M4X A;  3CME S;  4LF7 J;  2C2K B;  2IM1 A;  1X4B A;  4USH A;  5EWE A;  4JBC A;  4HYK A;  2RDJ A;  5J2P A;  3DMJ B;  4J9O A;  2HQI A;  4OHY A;  2YH0 A;  2GS8 A;  1EQ0 A;  1H3D A;  1JLA A;  3W3S A;  2CPH A;  4C9D A;  4CO2 A;  5HQ8 A;  1TYU A;  4LRC A;  4USI A;  3G6X A;  4PEO A;  1RAH B;  2R8I A;  2DPI A;  1TYV A;  3MMA B;  1RYS A;  4JP8 A;  5IOL A;  3HSG A;  4K4U A;  1H2V Z;  1WOO A;  3KG1 A;  2F8H A;  4NLO A;  1QJH A;  3TOQ A;  2VFO A;  1KC8 T;  1U1M A;  4ELV A;  5I42 A;  2A3J A;  2GZO A;  2DNK A;  4K4S A;  1YJ7 A;  2VOO A;  4DSJ A;  4IYQ A;  2VFU A;  2LQJ A;  4WFY A;  2NXN A;  1QE1 B;  2XMM A;  1FCA A;  4BLG A;  2VF3 A;  1KHV A;  2DRA A;  1EX8 A;  5HMX A;  1GH8 A;  1KVI A;  3EIC A;  1IBL F;  3KLH A;  3SDE A;  4JI4 F;  1B0T A;  4C3K A;  4URR A;  1NHK L;  3KJV A;  3I9V 9;  4RKU C;  3D5M A;  2RUS A;  3NGD A;  3M8Q A;  4CTA B;  1N8R T;  4ANE A;  3OVS A;  4IDK A;  2CJX B;  2G1D A;  4RNN A;  4ATN A;  2YNI B;  3HD2 A;  4NXM J;  2EK6 A;  4J37 A;  3LAK A;  4C0O C;  3VAL A;  1FT8 A;  1QDU B;  5GAG U;  1TK0 A;  3L7O A;  1VC6 A;  3FRY A;  3KUE A;  3QAT A;  2KJW A;  2VPX B;  4ZVU B;  3T1Y F;  1RWO B;  1RHK B;  1NHU A;  1GMV A;  1VHI A;  2VG6 A;  5E3R A;  2NXE A;  3GPA A;  3HHN B;  1EKS A;  4HVZ A;  3D66 A;  4V1A k;  2W9B B;  3E51 A;  4JYA F;  2Q1L A;  2RT3 A;  3EVW A;  4WU3 A;  2W2M P;  4PPD A;  3GON A;  2QO3 A;  4MMO A;  2O66 A;  4AVZ A;  2VOP A;  4DR5 J;  4KO0 A;  2J9C A;  1HW9 A;  1I6J A;  2PI4 A;  2CQH A;  3PKM A;  2IVM A;  4NZ0 A;  3FEY B;  2V2Q A;  4PRF A;  4FYV B;  1YZ7 A;  3NAH A;  1YBT A;  3OXG A;  2EKY A;  4H4K A;  2ACY A;  3SI8 A;  2NT6 A;  3I31 A;  5ADZ A;  1NEE A;  5CZV A;  4KBI A;  5GAD U;  1VQ9 S;  2LVW A;  2XWY A;  1FRI A;  1CJK B;  1WC6 A;  4N41 A;  2EC2 A;  3NWR A;  1KFS A;  5DDP C;  1K5C A;  1NHV A;  1LV5 A;  2NTB A;  5DDO C;  3FEX B;  3A12 A;  4R0E A;  1BMQ B;  2HRY A;  2DO4 A;  3HVR A;  2N4D A;  2AEF A;  2QZ8 A;  4HI2 A;  4YEA A;  1FTR A;  3V5R A;  3BGF A;  2UXB F;  2JNJ A;  4CO0 A;  2FLL A;  3DGV A;  1DQA A;  1WOR A;  2OH2 A;  1EET B;  2HLU A;  2K1R A;  1YJN S;  3IG1 A;  1JLE B;  4B3R F;  5HVG A;  2EWH A;  3BKU A;  3JX8 A;  1SUQ B;  3P6Y C;  4CO5 A;  1PO6 A;  1MW7 A;  2IC3 A;  3KLE A;  2H51 B;  2VC0 A;  3I0R A;  2IDE A;  4WP8 A;  2GQ2 A;  2VON A;  5HJY A;  1QY7 A;  3T9Z A;  1DJ0 A;  1S6O A;  1FK9 B;  4M95 A;  4K7Q A;  4DI6 A;  2XSF A;  4RBU A;  4ILM A;  5FDL A;  5KFX A;  7FD1 A;  1VLY A;  2OEK A;  1QRC A;  3ZNU A;  1H2T Z;  3OR2 A;  1LK7 A;  5HP1 B;  2DR5 A;  3IBF B;  1RHR B;  2MHN A;  4OHZ A;  2OPS A;  1RHU B;  4PXB A;  1BWE A;  2XNR A;  3MMA A;  2ZUA A;  2KKH A;  2HWI A;  4DX6 A;  5KFE A;  1DUR A;  2IBO A;  2KT3 A;  5DLF A;  3HF5 A;  3ADA C;  4L76 A;  2Y8Y A;  2X1F A;  1HLW A;  1JLG A;  1WD6 A;  2F4V F;  2VFR A;  1S1V B;  1X9W A;  2F3L A;  1PSD A;  1S6P A;  2HAF A;  3DYA B;  2RVJ A;  1GK8 A;  3EQN A;  3L9Z A;  2ZH7 A;  3CXC R;  1R6Y A;  4Z7C A;  1H2U X;  3IBC B;  2HND A;  1T9W A;  1TVR A;  5LSO A;  3DLL Q;  4DPY A;  3AB4 B;  1M5V C;  1TFY A;  4JB8 B;  2VG7 A;  5CZX A;  1IWA A;  2JLF A;  1VIO A;  1TL3 B;  4WK3 A;  4DG1 A;  1K0T A;  2M88 A;  2XMU A;  1S7I A;  4GVB B;  1RWM B;  4LF9 F;  3IWN C;  2MLX A;  1FO1 A;  3C6U A;  4FNH A;  4FYW B;  2GGP B;  2RRN A;  1U1K A;  2JVR A;  2EFN A;  1U1P A;  1JLQ B;  1M5P C;  4N8N A;  1LXN A;  3UVJ A;  5JMN A;  1VQ7 S;  1RMG A;  5IT0 A;  3CJ5 A;  2JH3 A;  5F3Z A;  2DGW A;  1HNW F;  4K50 A;  1NDC A;  1TL1 B;  1B64 A;  3KLV A;  1YDL A;  4LFC F;  4ANC A;  4F4W A;  4PAB A;  2GO8 A;  2HGN A;  5C5J A;  3KHR A;  2PO4 A;  4M5N A;  3H5U A;  2NTQ A;  2FY1 A;  2VJI A;  3DOM A;  1F0X A;  4MIW A;  4DFP A;  2QMX A;  2RKI A;  4OMF G;  1I1G A;  1TMM A;  1T9X A;  4OZ5 A;  1WKK A;  3MTK A;  4PCQ A;  4MYT A;  2EKN A;  2V50 A;  4DL4 A;  1XR5 A;  3BGL A;  2KXN B;  1X7V A;  3MPU B;  2JEF A;  2FLN A;  1Y10 A;  1TK8 A;  1F60 B;  1F2G A;  2BSP A;  2R7S A;  1NK4 A;  1APS A;  2BW7 A;  5F9N A;  5LMN J;  2W8L A;  4U4B A;  4H4M B;  3EPI A;  3TVY A;  3OJS A;  3JTO A;  1HQ2 A;  5J1E B;  3MGJ A;  2M4M A;  3GCX P;  1UFL A;  1HWK A;  4TYB A;  5JLV C;  2KU7 A;  2QA2 A;  3QWU A;  2FQQ B;  3G87 A;  3HI9 A;  1KSP A;  3KLG B;  4XLE A;  3BRE A;  1U4B A;  2AJF E;  2VBY A;  4JI6 F;  4X4P A;  4GO5 X;  4KKO B;  5KFN A;  1L3U A;  3DOK A;  3C8Y A;  3C2P A;  1HYS B;  4OLP A;  4R8U A;  3Q86 A;  1FK9 A;  3R5A A;  5KFR A;  3LW5 C;  4QWD A;  3HHL D;  5KG4 A;  1L5U A;  3MM8 B;  4ZPD A;  1ZBT A;  1QTN B;  2W7P A;  3KJN B;  4MFB B;  2CZ9 A;  1RK8 A;  1Z2Z A;  1RBO B;  4F2R A;  3WIU A;  2V4R A;  2RML A;  1I94 F;  2VV5 A;  1JK9 B;  3VHQ A;  1R8A A;  3DLG B;  2ZE2 A;  1WG1 A;  4G65 A;  1EJ7 L;  2PI5 A;  1E6V B;  3W9J A;  3TZY A;  2VBX A;  4M1K A;  1H7X A;  1Q8K A;  1N5V A;  2B4P A;  4NXN J;  2YWH A;  3HFV A;  4QJV A;  1U1R A;  2V8G A;  1VJW A;  3DYA A;  4O0N A;  1F5B A;  4ZP7 A;  1NJZ A;  2FJE B;  3CVK A;  3RAQ A;  2BW2 A;  1SQF A;  2AJQ A;  5GAE U;  3W2V A;  2ASD A;  2YNH A;  4IR9 A;  1UP1 A;  1JRG A;  4OX9 F;  1GTE A;  1QVG R;  2C3M A;  3U27 A;  3VGS A;  4ZMM A;  2ZIT A;  3ENV A;  4H4K C;  3KFW X;  1S6Q A;  3PKY A;  1S4F A;  4LIW A;  3RRK A;  1UFW A;  2BKP A;  1HD0 A;  4XO0 A;  2HVE A;  1MSW D;  3IO1 A;  4OI0 A;  2GC8 A;  1PLU A;  2Y3Y A;  4DR6 F;  3LO3 A;  2ERR A;  3B54 A;  3HHE A;  1WHX A;  1U8S A;  3LGH A;  1AFI A;  2BM1 A;  2WB1 D;  2BE2 A;  2QSF A;  1U1Q A;  1JJC B;  1IA5 A;  1XMO J;  2P6T A;  3JXO A;  4R25 A;  3ZTP A;  3I4H X;  2UVR A;  3IM9 A;  3EGZ A;  3CJK A;  1VJQ A;  2YKA A;  4HTI A;  2OTL S;  3MMB A;  3UDE A;  4Z7Y A;  4DR2 F;  3NGR A;  2CQ3 A;  1Y5N B;  3CCQ S;  2GJF A;  4CH0 S;  3MAA A;  4F4K A;  1DAB A;  4P7T A;  2FVP A;  2IBK A;  2MJN A;  1VQ6 S;  5CHC B;  2ATC B;  3IAS 9;  4TU7 A;  2Z8Q A;  1FD8 A;  3LPE A;  3MPV A;  2IRU A;  2DNR A;  5B0D A;  1OOC A;  3M2V B;  1HI0 P;  1A9N B;  3ENW A;  4DMZ A;  4KC5 A;  4DL5 A;  4W8S A;  3POT B;  4JV0 A;  1XJW B;  5HVH A;  4DV1 F;  1S79 A;  4L74 A;  2I1R A;  2RE1 A;  2BVZ A;  1HWL A;  3FFI B;  2C2D A;  5F3T A;  4IO9 Q;  2JEG A;  2QIF A;  3K2Y A;  4J91 A;  2DGO A;  2PFD A;  1KRP A;  2G0Y A;  3GYN A;  1NK6 A;  2E7V A;  4O3R A;  1FFS B;  4N56 A;  1XIQ A;  2UUA J;  3G6E S;  1XBW A;  4DBQ A;  4DQP A;  1CLW A;  4WP9 A;  1S1W B;  5JXS A;  2GVZ A;  1S97 A;  3N0V A;  1RLC L;  4ZIT A;  2EFO A;  4C3M A;  4DWI A;  3QAU A;  3DGP B;  1ZM2 A;  3MED B;  1VQP S;  2PFF B;  3G82 B;  2YNF B;  4RW6 A;  2CQP A;  4F04 B;  4E98 A;  2XI2 A;  2RRB A;  1YRT A;  1VC0 A;  4YFO A;  3K17 A;  2ZWP A;  4OI6 A;  2Z2Z A;  2QYU A;  2E9Z A;  2WRM A;  3FSI A;  1QA1 A;  2GJ2 A;  5LXY A;  1YG0 A;  3SSS A;  4DFM A;  1IJF B;  4DN0 A;  2APO A;  4P7V A;  3V4I B;  1RWP B;  3MUV P;  3ZFV A;  3LP0 A;  5IS2 A;  2QL7 B;  2DR9 A;  1TFW A;  3IR6 B;  4WFA Q;  5D8H B;  5HO4 A;  3RR8 A;  4DV7 F;  1UVN A;  3VSV A;  3CWJ A;  1SB6 A;  1RT2 B;  4YZX A;  2AGP A;  4UOC A;  5ETM A;  2JWN A;  1IBK J;  3PW5 A;  3UDL A;  1EAY C;  1FDN A;  2WVE A;  3QO9 B;  1HI1 A;  4J9Q A;  3OXF A;  4F3M A;  3B6B A;  4OI1 A;  1AFJ A;  2GHW A;  4WZM A;  3DU1 X;  2K2P A;  3KJQ B;  4IRD A;  2DYA A;  1FRK A;  2E5H A;  3QRR A;  1Q78 A;  3DI6 A;  4P6Q A;  2XSJ B;  4IG0 B;  3RB6 A;  1S9F A;  2PC6 A;  2XTX A;  4WYW A;  3Q8Y A;  2EXU A;  2YTC A;  4RU9 A;  3PJX A;  4CO1 A;  2OLW A;  2P5V A;  2QLB B;  1LEO A;  1RT7 A;  5KT7 A;  3G2X A;  4RW4 B;  4OZN A;  1DTT A;  1GT8 A;  1RTI A;  2OMO A;  2EFP A;  4EI2 A;  2XS7 A;  3OD2 A;  1K8F A;  2WON B;  4C8K A;  5DG9 A;  2FC9 A;  4M5G A;  2VQE J;  4OJ1 A;  4OZ3 A;  5IWA J;  1Q5Y A;  4C3L A;  3HUL A;  1NJI T;  5F41 A;  3J7Y U;  1UEU A;  4KRW A;  3MHY A;  4F4A A;  2VC1 A;  1KN6 A;  4D3G A;  2WBR A;  1VRU A;  4XPC A;  1KQK A;  2NPF A;  4JI2 J;  2VZ9 A;  3PFO A;  5DLG A;  4KFB B;  1RP5 A;  2QL5 B;  1KON A;  1D9F A;  4A8Y A;  1IXK A;  1O0P A;  3TW0 A;  4G3I A;  3KUG A;  2I0X A;  2JLE A;  1X9S A;  1AXQ A;  1VBK A;  4I67 A;  4X4R A;  1O8F A;  4LSZ B;  4JI3 F;  1PYO B;  2VB6 A;  4MH8 A;  1D3W A;  2M2B A;  4ID5 A;  3GRH A;  1YJ9 S;  1HBN B;  4LBI A;  3UD5 A;  2UP1 A;  2PD1 A;  3PXG a;  1HNX J;  4DSL A;  3EE3 A;  4KYZ A;  2RU9 A;  3UN5 A;  3ZZ0 A;  2LEB A;  5ETV A;  4NML A;  3RR7 A;  4PKD B;  1VIS A;  3D54 A;  3Q8U A;  4C8M A;  1FFG B;  5F8H A;  2MQ8 A;  3WZ0 A;  2DIV A;  5LJ3 Y;  1XER A;  2GVD A;  1MMN A;  2VPZ B;  2ADC A;  2G9O A;  2FHJ A;  4HHU A;  4WWS A;  4TYA A;  1T02 A;  3MED A;  4ZDN A;  3WQP A;  3K5L A;  2UVF A;  3FCW A;  5B0C A;  4KY3 A;  4DHV A;  1SQG A;  5A8W B;  5T7L B;  4WFX A;  1U6Z A;  4XQF A;  4I64 A;  2KVQ E;  2WSC C;  3QJP A;  2RF2 A;  2UUW A;  1Y3J A;  2BAN B;  2UVV A;  4OJG A;  1NB2 A;  2L9W A;  4B9N A;  3AXM A;  4CLP A;  1TU0 B;  1V3Z A;  2X1A A;  3RZA A;  3QT5 A;  1R7I A;  3JSR A;  1UWA A;  1Q53 A;  2Q43 A;  3CB4 A;  4OZ0 A;  4LF4 J;  1LWE A;  3CUL A;  2MB0 B;  3NKY A;  3TH0 A;  4DV6 J;  1VOM A;  1NH8 A;  4NI2 B;  4LJM A;  4V19 X;  3B8Y A;  3G9C A;  4K2X A;  2E5L F;  1D1U A;  1RWU A;  4LSN A;  3BPS P;  3OUY A;  2RJZ A;  4OV1 A;  3M05 A;  3RIQ A;  1QAX A;  3R2D J;  3E8O A;  4B02 A;  2W2N P;  1S1T B;  1PXZ A;  3HSZ A;  9ATC B;  4U8Y A;  2D69 A;  3M8Y A;  2CQD A;  3PYG A;  2ZDO A;  1HNZ J;  2U1A A;  4E2F B;  2R8G A;  1OSC A;  1RT3 A;  2PA8 D;  2X3D A;  2YWW A;  4DV3 F;  2MPU A;  1DY3 A;  2ZVI A;  2XTY A;  3RBE A;  2DK2 A;  4G1P A;  2DHS A;  1C0T A;  2QMU B;  3CCM S;  2AYE A;  4X2B A;  4O4G A;  4RUA A;  2HBY B;  2D3Z A;  4I7F A;  1RAE B;  3CJ4 A;  5BYQ A;  3KWM A;  4RUB A;  1OYE A;  4OZZ A;  4LFA F;  4PG8 A;  2D3O 1;  2AEJ A;  3FK4 A;  3LGM A;  2LFV A;  2EG1 A;  4X4O A;  4FDF A;  5KG1 A;  4TQR A;  2BX6 A;  3A13 A;  2E1C A;  1N6Q A;  1N5Y A;  3CJ3 A;  1C4A A;  1VQN S;  2LP4 A;  5F8I A;  3HVT A;  2X1G A;  3SQV A;  2J9E A;  4CT8 A;  4GVL A;  4JRA C;  2Y1I A;  2KYZ A;  2HIQ A;  2I5J A;  4OI3 A;  1GXL A;  3FZB A;  2QLX A;  1EKR A;  2F8E X;  3I4P A;  5A76 A;  5DG7 A;  4YB6 A;  2WBM A;  3TJA A;  2NYI A;  5GAH U;  3VVU A;  3NGU A;  1PG5 B;  4ECW A;  5T14 A;  4ZA1 A;  3GLJ A;  2ZH9 A;  3ENA A;  1S10 A;  2ZD1 B;  3GG0 A;  1J5O B;  4HEA 9;  5DZ6 A;  2KI2 A;  3JQJ A;  1T9Y A;  4V19 J;  4JI8 F;  4WK1 A;  3MR7 A;  2E1R A;  2DRD A;  3T5K A;  3BEG B;  1SI9 A;  2B7B B;  1Q4R A;  3AH6 A;  5HJX A;  2H1Y A;  1NAQ A;  5JVH Q;  2G1H A;  3QPI A;  1FDD A;  4Y34 A;  3GV5 B;  3J7A 1;  3CCL S;  2VQF F;  4RZR A;  4C11 B;  1KVK A;  1WUU A;  4ZPC A;  1NU4 A;  2CQ2 A;  3N79 A;  5JMC B;  3HD1 A;  2V5H G;  1CLF A;  3BJY A;  2E5I A;  3MM9 B;  2Y1R I;  2W2Q P;  3C16 B;  2ZZM A;  4GRS A;  3RAX A;  1YJR A;  1M1K T;  2QYG A;  4DFJ A;  4J9M A;  1LWF B;  4JI0 F;  3OL7 A;  2J5A A;  2PII A;  3MUR P;  4IG3 A;  3I32 A;  3V6D A;  4HT7 A;  1IN0 A;  4Z2X A;  2PSZ A;  4ZHR B;  1CUL B;  3HVA A;  2FZG B;  2XMW A;  3N90 A;  3OTB A;  2DCL A;  1ZOT A;  2N4C A;  3KLF A;  5FD1 A;  1N54 B;  4Q8E A;  2HQD A;  3M32 B;  3SXL A;  2F63 A;  2B8Q A;  4QR1 A;  5K8P A;  2F1F A;  3PW4 A;  2KFZ A;  1U0S A;  4EZ6 A;  5IT4 A;  1KLM B;  4QCL A;  2MJU A;  1PJ6 A;  3TUI C;  3ETO A;  1AA1 B;  5AXN A;  3IRX A;  2W9C B;  2ZM6 J;  1HR0 F;  3C15 A;  2ABY A;  3L09 A;  1R31 A;  1DLO B;  1E6Y A;  1RT1 A;  3JSM A;  2PN6 A;  1HIY A;  3DRR A;  3W9H A;  2HGL A;  5AJ3 F;  4B9V A;  2AJ0 A;  4L75 A;  2YQ3 A;  2VG5 A;  3NAW A;  1B0P A;  3BYR A;  3ULH A;  4J9V A;  4DF8 A;  3PYD A;  3BSN A;  5I3U A;  4KH3 A;  1HQE A;  2GML A;  4DQR A;  3OPK A;  2QLW A;  2KHD A;  4PUO B;  2R7R A;  3CF5 Q;  1JX4 A;  3FSY A;  2CXE A;  3RJM B;  3K57 A;  2V8V A;  1WOP A;  2WVF A;  5IV4 A;  1B7Y B;  3T9G A;  2ZFH A;  5E3C A;  1BN8 A;  1H74 A;  4DX7 A;  1XEZ A;  3QBC A;  3ZZR A;  3OHB A;  2Y0S D;  1RHM B;  4B3T F;  4XPE A;  5M2U A;  2DHA A;  4YS2 A;  5G0R B;  1VQ8 S;  1IR1 A;  2VBE A;  5CD4 H;  4NRT A;  2JRS A;  4ZP8 A;  2LU1 A;  1FTC A;  3FZ2 A;  1TKD A;  4UZC A;  1IKX A;  3VAH A;  3RRG A;  3OLB A;  2HKE A;  4JI7 F;  5A8K A;  1O88 A;  4OZ1 A;  3N6L A;  3I6P A;  4YZ0 A;  1FRM A;  1Y0H A;  4K4X A;  2KFY A;  3JYT B;  3PIO Q;  4IH5 A;  5DQG A;  4DXL A;  2K7K A;  3H5S A;  3VMW A;  1REG X;  2Z0G A;  3Q8S B;  3PRD A;  1W7W A;  3MAQ A;  3GYX B;  4HHH A;  1S49 A;  3TAM A;  5HAN A;  2V4J A;  3KUH A;  3B78 A;  4WII A;  5A6P A;  2ATL A;  2UXC J;  1T9U A;  3RBZ A;  7FDR A;  2O67 A;  2QSW A;  5IXU A;  3RBD A;  2LEP A;  3CE8 A;  4B3S J;  4I6A A;  2YWE A;  1UL3 A;  1Q86 T;  5KFV A;  3KK1 A;  4I2P B;  2MQL A;  4XOT A;  3DOL B;  2VHG A;  1NME B;  3LMW A;  1U0H B;  2DCU B;  3SQG B;  1P1T A;  4EWT A;  3P3D A;  3R1L A;  3A3P B;  1HBM A;  5HLF B;  3CD6 S;  2NSP A;  1B99 A;  4Y6I A;  4DV2 J;  3C14 A;  3OL9 A;  4QU7 A;  3MFI A;  2JDJ A;  1KVJ A;  1CJT A;  4OJH A;  3NLC A;  3PNI A;  5LJ5 Y;  1J5E F;  4U49 A;  4ZN3 A;  3GIL A;  4ZS6 A;  5LL6 d;  4FS2 A;  4DZ6 A;  4EBE A;  4RX6 A;  2INV A;  3TAR A;  1AUD A;  3LUY A;  4NRU A;  4ZVG A;  1GX5 A;  3D0H E;  3M2R A;  3M8W A;  3QGG A;  4AE5 A;  2E1M C;  3J81 j;  1P1L A;  2X3H A;  5K9F A;  4IQM A;  4WFZ A;  2GJI A;  3D3B J;  2XHC A;  4BC7 A;  4K2J A;  4DSE A;  1S9G A;  2DGS A;  2DT9 A;  2V68 A;  4FNI A;  4MKV A;  4DOZ A;  2YKM A;  4IR1 A;  2CNL B;  4ZLJ A;  1KCD A;  4ELU A;  5L46 A;  2ASJ A;  3TR5 A;  1VQS A;  4ZIW A;  5E2Q A;  4JOU A;  1T7P A;  4DQS A;  4CCH A;  2V67 A;  4GKK F;  3D4J A;  2WTF A;  4NLP A;  2K06 A;  2AX1 A;  2HRU A;  2BJD A;  3AOC A;  2HHX A;  3HHL A;  1VQL S;  2G13 A;  3MM6 A;  3THP A;  1N36 J;  1RHQ B;  4MT1 A;  4KHP J;  3MM7 A;  3VTI A;  4NEY A;  2E7X A;  3Q89 A;  3C3L A;  1W25 A;  2K3K A;  1BHE A;  2R7U A;  1BHN A;  2P2C B;  2CQ4 A;  1RB0 A;  4L3N A;  4P2M A;  2AGO A;  1B0V A;  2C3P A;  1QAY A;  1OYD A;  4CT9 A;  1HMV B;  5K8N A;  2B7C B;  4P2F A;  1VRT B;  3LP2 B;  1DFD A;  4P72 A;  3A8I A;  3P4G A;  3BYP A;  4G1Q B;  1SH2 A;  1XTZ A;  2MQM A;  3FBB A;  3MR5 A;  4DR3 J;  1SC3 B;  5J2N B;  4Q0B A;  4DV4 F;  4DV5 J;  3WC0 A;  1O8D A;  5KT3 A;  1O8G A;  2CQG A;  2C28 A;  5A0Y B;  4K4Z A;  4WTO B;  2VDI A;  3QZ8 A;  4NLR A;  2DXE A;  4OX8 A;  5HMZ A;  5KFO A;  1JJ4 A;  2CYY A;  3I5A A;  4O3S A;  1UJ6 A;  3FY3 A;  2NUU G;  1ZAV A;  2LA4 A;  3AFG A;  4G1I A;  1MU2 A;  4C0H A;  5H1S V;  4DR4 F;  5D15 A;  1LK5 A;  5CA5 A;  5HRO B;  7AT1 B;  4YEI A;  1TL7 A;  4XLC A;  3B8H A;  2DY1 A;  4G6V B;  3ILL A;  1GEH A;  1M5H A;  1TKZ B;  2NT9 A;  3Q83 A;  1EIY B;  3VMV A;  1JKH B;  2XT2 A;  1JLB B;  3VGV A;  3MM5 B;  1FWP A;  1NM2 A;  1SIZ A;  1TQL A;  2XC9 A;  3CO0 P;  4N47 A;  2CNN B;  3CCR S;  2O0W A;  2JHE A;  1R0A B;  5IV3 A;  1VBZ A;  4UW2 A;  2Q66 A;  5I4M A;  3VGT A;  3QQC D;  5KFS A;  4JV1 A;  3AQO A;  4NYP A;  4YZQ A;  5J2M B;  2EC0 A;  1F9H A;  3ELH A;  3TVK A;  2XWX A;  1CQN A;  2Q6C A;  4XR6 A;  2IY5 B;  4O4R A;  4ES3 A;  1IBL J;  1RKJ A;  3QFW A;  3JAM U;  1IBM F;  3F44 A;  3PY8 A;  2HIY A;  1WDT A;  2BRK A;  4XOR A;  2RDI A;  3EXY A;  4HAC B;  2NSC A;  5B08 A;  4P10 A;  5A8R B;  4YZA A;  3OFH A;  3VGU A;  2HQG A;  1UVI A;  3HZG A;  3OTC A;  1PC4 A;  2IM0 A;  2UUB F;  4FS1 A;  2Z2Y B;  3BV8 A;  1ZA2 B;  4WKR A;  1P6T A;  4O0I A;  2R7T A;  4ECV A;  2U2F A;  1KOO A;  1RI7 A;  3GB0 A;  4DLG A;  3T1Y J;  1WHY A;  4OLO A;  2CFX A;  1K8A T;  1FKO A;  2RHS B;  2OPR A;  1DQ8 A;  2MY8 A;  2OPQ B;  5B0B A;  3M9N B;  4A8X A;  4BDP A;  2HWH A;  2FHM A;  2ZNY A;  3TP2 A;  5DET A;  1RTD B;  3NMR A;  4JYA J;  5KFD A;  5L38 A;  1YTY A;  2RSQ A;  1WOS A;  4O44 A;  4ILL A;  4QQB A;  1LXJ A;  1YIJ S;  5GAG I;  4X4Q A;  1U45 A;  3OL8 A;  1KTV A;  1DBD A;  2B9W A;  4OFZ A;  3I0S B;  2W01 A;  1CPZ A;  1VYA A;  3DM2 A;  1Y3K A;  1IKW A;  4NXM F;  5J2Q B;  3TUZ C;  4EBD A;  5KFI A;  4Q44 A;  3EDQ B;  1FEH A;  4FKX A;  2IMO A;  4NCG B;  1YKW A;  2W4C A;  4PWW A;  3T1H F;  2B43 A;  3BO3 A;  1GXT A;  2DIS A;  3V6H A;  2V63 A;  2CDR B;  2VJJ A;  1UKU A;  1EAR A;  1ELO A;  1HBO B;  3ISN D;  4IQX A;  4UQT A;  5KFQ A;  4Y65 A;  2DJW A;  5D77 A;  2YKO A;  3LP2 A;  5ETS A;  2FGC A;  1T9V A;  2MKJ A;  1SV5 B;  2UXB J;  4RR5 A;  1Z4U A;  3N9U C;  2CIM A;  2R4F A;  1TYX A;  5GAD I;  3D6F B;  5BXI A;  2I9S A;  2ILY A;  4B3R J;  1S1U B;  2BJ8 A;  3FUY A;  4U8V A;  2JC1 A;  5KG5 A;  1M1G A;  3UO0 A;  2GQC A;  2HRT A;  4DCO B;  2DNZ A;  3MTJ A;  3PX6 A;  3O2I A;  5F8M A;  4UUX A;  2I38 A;  1W2I A;  4X66 F;  1AIR A;  4BS2 A;  1TL4 A;  3W7B A;  2C2R A;  2XEX A;  3BR9 A;  2RNE A;  3RW7 A;  1SKR A;  3GSI A;  4ER8 A;  2CWK A;  3W2W A;  1VC5 A;  2AKW B;  4WIQ A;  2MSS A;  4ECS A;  1T03 A;  2PMH A;  4F2S A;  1RBL A;  2ALY B;  1QUP A;  4AT1 B;  1IVZ A;  1SJ1 A;  3V6K A;  4IFY B;  4NZ6 A;  3DLB A;  1Q7L B;  1PJ7 A;  4JI1 F;  1HBU B;  4OZ2 A;  1YHQ S;  2XY5 A;  2AYB A;  1VK8 A;  1Y11 A;  4W8T A;  1FWK A;  1Y00 A;  2F4V J;  5EUH A;  3R6L B;  4X62 J;  2EEY A;  3AOB A;  3BDP A;  4F0H A;  3N6M A;  2HAI A;  3SYJ A;  4M5K A;  2KTQ A;  5L39 A;  1OS5 A;  3PM9 A;  5KFC A;  4FKY A;  4M5D A;  3HHK A;  3HHL C;  2IJR A;  2WW8 A;  4ZCI A;  3PW0 A;  3MPY A;  2V6A A;  1M0S A;  2C2E A;  4NPO A;  2LU2 A;  2NZ4 A;  2WOM B;  4N5S A;  2ZBR A;  4DZD A;  8AT1 B;  2GHP A;  3US5 A;  2ACM A;  2XBP A;  1P9Q C;  4N7T A;  3MMC A;  4XDC A;  3LGN A;  4LF9 J;  1SKW A;  5C25 B;  2QG9 B;  4FYD A;  1JWW A;  5LMU F;  1RT6 B;  4KTQ A;  1TEL A;  4OHV A;  5A2Q Y;  1JXE A;  5CYQ B;  2NCK L;  1U1L A;  4LT6 A;  1FJG F;  2HNY A;  1HHT P;  4LSL B;  1H72 C;  5K14 B;  4N77 A;  2ZUG A;  1HNW J;  3JB9 k;  4J9N A;  3ILJ A;  3UNY A;  2KL8 A;  3CC2 S;  2HFZ A;  4LFC J;  1PYS B;  4KV8 A;  4LFB F;  2B5J A;  4ECU A;  2COL A;  5KFP A;  4AND A;  1T05 B;  1UEV A;  1RT5 A;  2VBK A;  1S0M A;  1BUX A;  3QSI A;  1G4C A;  2AYG A;  4YFU A;  3NRB A;  4PWD B;  4MJK A;  4KGM A;  4Y2I A;  4FXV A;  4OHW A;  1FNX H;  1RU1 A;  3PX0 A;  2UVU A;  5HBM A;  2YXL A;  1IKV B;  2QA1 A;  4WE1 B;  4NCG A;  4Y2M A;  5U47 A;  1TAQ A;  3CJ2 A;  1Z1Z A;  2HS4 A;  3THV A;  2J9D A;  2WHO A;  3E3X A;  1IKY A;  1X4H A;  5AT1 B;  5K20 B;  2Q79 A;  3I5B A;  1BQN B;  3DLK B;  3P96 A;  4ES2 A;  1T3N A;  1X4C A;  1RZM A;  2ZBP A;  1NBE B;  2LDI A;  4DX8 H;  2ZBQ A;  3Q23 A;  3I87 A;  3GTY X;  2R2U A;  3HK2 A;  2HHU A;  4DL0 C;  3DKD A;  4C8N A;  3NWG A;  2H4W B;  3GQ9 A;  2E1P A;  3OLA A;  4AD6 A;  4OYM A;  1S1U A;  2X6Y A;  3VZI A;  4IO1 A;  1Q8L A;  3M1V B;  3PYF A;  1RLD A;  4LF6 J;  3I82 A;  3LWL A;  2BAC A;  4JI6 J;  4IRC A;  1A7G E;  3N5B A;  2QMW A;  5EHH A;  3PHE A;  2XS2 A;  5DRK A;  3T5J A;  4TY8 A;  1U2R A;  4YEJ A;  2DTJ A;  4F50 A;  2XTW A;  1ACM B;  1Q5V A;  4ZLP A;  1V6H A;  3N6N A;  3BZQ A;  3NS7 B;  1Y5I B;  2G0C A;  3CUN A;  4FBU A;  2DR8 A;  3PIP Q;  3MCM A;  5J2P B;  3GWC A;  4IH7 A;  4XTT A;  2V8D A;  4RBT A;  5LMN F;  2B4O A;  3MF5 A;  4OX6 A;  1N52 B;  1O6X A;  1NSP A;  1JLA B;  2E66 A;  3CDB A;  3EGV A;  1R8H A;  4C97 A;  4DU8 A;  2W7Z A;  2YX4 A;  1HNI A;  4MIB A;  1RWN B;  1WKL A;  2XO7 A;  2LEA A;  2W2P P;  1NXI A;  4ETZ A;  4P2X A;  4ECR A;  2WZ1 A;  1M90 T;  3BQ0 A;  3FC9 A;  4BCA A;  1MG7 A;  4FZV A;  2JFD A;  1WF0 A;  3PX4 A;  1OSD A;  5I42 B;  2EG2 A;  3AJD A;  4JV5 F;  1K0V A;  2OEL A;  4OX9 J;  4OZY A;  3M6W A;  3ZTO A;  1TKT A;  2L41 A;  2XG8 A;  4PG4 A;  3ZTQ A;  2HG4 A;  4HDH A;  4NCA A;  3ZZO A;  4TU9 A;  3KLH B;  2GX8 A;  3SDE B;  2A6O A;  4W8R A;  5D3G A;  2HHW A;  2MLZ A;  2X51 A;  1QAJ A;  3L7P A;  2KO1 A;  3M7V A;  1QUV A;  4B08 A;  1VS3 A;  4DR6 J;  1YIT S;  4LF5 F;  2KXH A;  4RL1 A;  3ITH A;  2MQO A;  3I5C A;  3IS9 A;  3M8Q B;  1D0E A;  1LLZ A;  4IDK B;  2HQF A;  3HCX A;  4ED5 A;  4QWB A;  3DU5 A;  1VQK S;  1FDA A;  1EA0 A;  2YKN A;  1C0U A;  4FBT A;  1SPB P;  3BBF A;  4ED3 A;  4KE5 A;  1KS2 A;  4NXN F;  5RUB A;  4YEL A;  1PYT A;  5B7W A;  1O8I A;  4EUV A;  4P71 A;  3TNV A;  2R7V A;  3QLH A;  2BUN A;  3W8P A;  2AT1 B;  2BJ9 A;  2CJB A;  4AFF A;  1YSJ A;  3KLI A;  4LF1 A;  2VG6 B;  4MKY A;  4J5O A;  3D1Q A;  2PA3 A;  1V3S A;  2X6W A;  3SCK E;  1GXU A;  3OR1 A;  2FJW A;  3LF0 A;  3ZZZ A;  2O6W A;  2HNZ A;  3J80 U;  4KO0 B;  5IZH A;  1HWU A;  3UQS A;  5KOW A;  1J2V A;  4DV1 J;  1BC6 A;  4DUY F;  5E3A A;  1CJV A;  4XDD A;  3DC2 A;  2LDY A;  2QT7 A;  1RDR A;  5KOX A;  4B9U A;  4QWC A;  3U02 A;  5DGA A;  1YVF A;  4EGL A;  1HWI A;  3PO5 A;  3L7U A;  4URS A;  2INU A;  4CQ1 A;  1KBR A;  2R3V A;  1U1N A;  4ZPA A;  4EYH B;  1H73 A;  4DR7 F;  5LSL A;  3HT3 A;  5B09 A;  2CPY A;  2XLI A;  3HP6 A;  2JZ5 A;  4ZVS B;  1QVF R;  3QGI A;  4WFB Q;  3NMA A;  2CQ1 A;  4XMY A;  2XGQ A;  2RQC A;  2K1R B;  3D7S B;  3IG1 B;  1HG8 A;  3CGI A;  4KB7 A;  2F4F A;  3FBE A;  2IC3 B;  3KLE B;  2H5E A;  2MKK A;  3PW2 A;  2VBZ A;  2OHD A;  3I0R B;  2BQ3 A;  3H90 A;  4X64 F;  1ZZN A;  3TI0 A;  1O8L A;  3P49 B;  4ES1 A;  1VQ5 S;  1UAW A;  3MEE A;  3RU0 A;  4NLW A;  5FDL B;  3KMS A;  2NZC A;  4UST A;  4XLA A;  3TYT A;  3OR2 B;  4F4X A;  1OGO X;  4DV7 J;  1LFP A;  3M9O B;  1XNR F;  2Y8W A;  2OPS B;  4B9M A;  2AZ1 A;  1OFM A;  1XK8 A;  1NUE A;  1VBL A;  3Q22 A;  1VK3 A;  1TTH B;  4Q2M A;  1NCL A;  3T41 A;  5E7O B;  2W24 A;  1JLG B;  2WB4 A;  2ROE A;  2H3E B;  1OPZ A;  4F26 A;  3CCE S;  1P9Y A;  5DO2 A;  2F9J A;  3MAH A;  4CP5 A;  2FYX A;  4L73 A;  1S6P B;  3IMQ J;  3QNW B;  3IM8 A;  2QC3 A;  1GQ8 A;  2VDH A;  2HND B;  3FEZ A;  1TVR B;  3NBP A;  4X65 F;  3T5H A;  3OSP A;  2ZC4 A;  1S9E A;  2WVB A;  2XZT B;  2AYM A;  3BSC A;  2VG7 B;  3SFG A;  4OX7 A;  2MY7 A;  2QFI A;  4DG1 B;  1JTA A;  1TV6 A;  5CCM A;  4B9T A;  3KJF B;  1N56 A;  1TSP A;  4IKA A;  1ZYQ A;  1S0N A;  2OEJ A;  1CZF A;  2YBV A;  2NYH A;  3GFZ A;  2Z56 B;  3UI3 A;  4F67 A;  2QRR A;  3C6U B;  1N5T A;  3DHW C;  2YKP A;  2F3J A;  4KPC A;  2RU3 A;  2DHG A;  1AUS L;  4DCJ B;  1U47 A;  3UVJ B;  4FYY B;  1S0O A;  4U7C A;  2AJ2 A;  4UTG A;  3KHL A;  2R8K A;  4KT0 C;  5F8L A;  2VBW A;  3UNG C;  3HSD A;  1RWX B;  3DXS X;  2BQU A;  2KH9 A;  2EFV A;  3J7Y I;  1S12 A;  1MMD A;  4XLH A;  2HBR B;  2O0V A;  4DN9 A;  2LQ9 A;  4JI3 J;  2YNG A;  3DOM B;  5KG0 A;  4F4Z A;  2CZ4 A;  1QLN A;  2HZA A;  1RA6 A;  2RKI B;  1NKC A;  5CYM B;  1V9O A;  3P8B B;  3DLJ A;  1CBK A;  4PQU A;  2AHO B;  5EGY A;  4YDD B;  4HH0 A;  4K4V A;  2K7J A;  2QXZ A;  2J8I A;  3QJJ A;  1RAA B;  2A6M A;  2F8M A;  1ZA1 B;  2P9C A;  1S7H A;  2A2D A;  5KT4 A;  2JLG A;  1RBA A;  2P6S A;  3G8Q A;  4NLU A;  1N32 F;  2P9G A;  3TRG A;  2AU0 A;  2AD9 A;  5JVG Q;  4CI0 B;  1MRO A;  3AK5 A;  1O8J A;  4R5P A;  3UDC A;  3OJU A;  1UVJ A;  2XMK A;  4FF1 A;  5F8J A;  2NR0 A;  3WDO A;  1WEY A;  3R2C J;  2OO4 A;  3D6T B;  1HNV A;  4QPT A;  4K8R A;  1TZ0 A;  2M9K A;  4I2Q B;  2FVR A;  3ET6 A;  2ZH8 A;  1ZET A;  3LAM A;  4DPO A;  4NK8 A;  2IQ7 A;  1WC5 A;  3DOK B;  1HNX F;  1CS4 A;  5KFF A;  1BXN A;  4F25 A;  4R8U B;  2XGP A;  3R5J B;  2X7I A;  4WCE Q;  2I2Y A;  3L3C A;  1DAX A;  4K0K F;  3SZ2 A;  5CD4 A;  3OVB A;  2Q6B A;  2WSF C;  2E5L J;  5KFW A;  5DDR C;  2NXU A;  2O1D A;  3FBF A;  3D67 A;  3M8Z A;  2HLT A;  5L1J A;  3V81 A;  3B4N A;  1QRB A;  1Q95 G;  2ZE2 B;  3HM9 A;  4RW9 A;  4W8Q A;  4CWB A;  4FN5 A;  3QWP A;  2HBZ B;  2YQ0 A;  4IOC Q;  1JMT A;  4PWU A;  5C24 B;  2NSB A;  3IA0 A;  2OEM A;  4DV3 J;  2FTR A;  1R43 A;  1NRK A;  1SKU B;  3DN9 A;  4GC7 A;  1GX6 A;  2UXD F;  4FF2 A;  1VQO S;  3W2V B;  2QLF B;  2YNH B;  1V3R A;  3O1L A;  3S6E A;  3KK2 B;  3U7J A;  2HS3 A;  3LWM A;  4WBF A;  4I4B A;  4LFA J;  5GMD A;  1S6Q B;  2V34 A;  4DU7 A;  1WSR A;  3VCD A;  1VRQ C;  4MK9 A;  2KYX A;  4YB5 A;  2MEW A;  2BM0 A;  1W26 A;  2UUC J;  1FXL A;  1D8Z A;  1FDB A;  1SH3 A;  3M30 A;  3J80 Y;  2HVZ A;  3K58 A;  1RIS A;  2BA9 A;  4I56 A;  2X3G A;  1PAE X;  2XMV A;  2J7U A;  2M8D B;  3SQO P;  3M2U A;  2L3M A;  4HDG A;  1FKP A;  3JTP A;  2DNO A;  1YX2 A;  3DXB A;  2BE2 B;  4RLE A;  5KT5 A;  3OSN A;  2GV1 A;  2DIT A;  4H4O A;  2L08 A;  2HMI A;  4V02 C;  4ZPW R;  4GC6 A;  2LEC A;  4ED4 A;  3IAM 9;  3CJK B;  1R89 A;  3H20 A;  5CQG A;  4L72 B;  3G71 S;  2LCW A;  3MMB B;  3FQL A;  3SEO A;  1L3S A;  4XL9 A;  2NTP A;  2MZS A;  3KOA A;  3H4B A;  2DGX A;  4ZPB A;  3N4W A;  1ZZF A;  3MAA B;  3EZO A;  1NDL A;  4OYO A;  3T9N A;  4JI8 J;  5LSR A;  2SXL A;  1RWW B;  3KNG A;  5CYM A;  2IRY A;  4OYI A;  2PEC A;  4OQJ A;  1OMS A;  6AT1 B;  2AP6 A;  3SCI E;  4QBU A;  1KD1 T;  1YZ6 A;  3GJR B;  4WU2 A;  2VQF J;  5GAH I;  4ZPV R;  2MZT A;  4B9L A;  3KYL A;  4CLT A;  4NL5 A;  1HL6 A;  2XUL A;  1NK9 A;  4ZN1 A;  2RUG A;  2ZZN A;  2HQC A;  3TVZ A;  2M0G B;  5KT2 A;  2IYI A;  1QQ1 A;  3H5X A;  3HPO A;  3W66 A;  2OPP A;  3LP1 B;  3QAE A;  1XMQ J;  3MI7 X;  1WXR A;  1NO8 A;  3GV7 B;  2GVZ B;  3V4M A;  2ROP A;  2FZK B;  2R7Q A;  5HAO A;  1MNE A;  1SQE A;  2DEJ A;  1F6T A;  2CQB A;  4XIU A;  1O51 A;  4I2Q A;  2O5D A;  1C1B A;  2NUH A;  3R5G A;  3BQ2 A;  2G0J A;  4RW6 B;  4I1T A;  4UQG A;  3LAN A;  1PBU A;  2HQ3 A;  6FDR A;  3M8S A;  4N8O A;  4CYU A;  5FJ4 A;  1LW2 A;  2HHT A;  2XCP A;  1HR0 J;  1CSJ A;  1PE9 A;  1VR6 A;  4ZK7 M;  1BD6 A;  2EFQ A;  4F3O A;  1JJH A;  2JX2 A;  1REV A;  5AJ3 J;  3B82 A;  3NOG A;  2J6T A;  3EVM A;  2NPI A;  3LP0 B;  3FNN A;  3G6V A;  1RAF B;  4E0D A;  4RW8 A;  4KH0 B;  4JI5 F;  1CQM A;  2EI5 A;  4KGZ B;  1FXR A;  2FY8 A;  4NYO A;  4UT4 A;  5C24 A;  4L6V 3;  2HHQ A;  5AMV A;  1WEZ A;  4CZC A;  2MQQ A;  1LNQ A;  1T8E A;  3HHD A;  4OJO A;  2G0I A;  3HT0 A;  3AD9 C;  1AT1 B;  2LXI A;  5F8G A;  4TN2 A;  5A6W A;  1FJE B;  2MTL A;  1U24 A;  3GIR A;  2ASL A;  1Q82 T;  3DI6 B;  2HGM A;  3KK2 A;  1X9M A;  3DLH A;  3CIM A;  4FVC A;  3A8E A;  4B3T J;  3P45 B;  1RT7 B;  4EFA C;  1RTJ A;  1DTT B;  4TY9 A;  4DL2 A;  1AZS A;  1RTI B;  2DH9 A;  3KDO A;  5HI7 A;  2ZKT A;  4EU0 A;  1TR0 A;  1ITP A;  5THW A;  4QIW D;  1HQU A;  1X5T A;  2PYG A;  4NLV A;  4K5S A;  4Y3C A;  4JI7 J;  4RWX A;  2R2S A;  3LA0 A;  1YWX A;  1NHC A;  5K5M A;  2V9W A;  4J9U E;  3M9M B;  1NLK L;  3HSJ A;  3M8R A;  2KFN A;  1LWC A;  2EPI A;  1L3T A;  1HW8 A;  2J0W A;  3W5Z A;  1R0B G;  1IR0 A;  1LKZ A;  2QL9 B;  5AXL A;  1VRU B;  4ZVP B;  5J1P A;  3Q24 A;  3HMJ G;  4AQY F;  1VHF A;  4IFV A;  3WHI A;  4UY8 T;  2VAS A;  2JEI A;  3J7Z 5;  4Q8F A;  3EX7 B;  1WTB A;  2DGQ A;  5H9F J;  3D0G E;  5DQI A;  3GJT B;  3BB5 A;  2F7V A;  4B3O A;  3AT1 B;  1U7L A;  4I68 A;  4KIA A;  2ROG A;  4PZV A;  4ID5 B;  4M63 A;  2VOD A;  3DRS A;  1BQM A;  1S99 A;  2PGC A;  4OI2 A;  1RU4 A;  2DGT A;  1R0C B;  3MPW A;  2A10 A;  4U7U K;  3EWG A;  2ALZ A;  1MWZ A;  3K5N A;  1UA1 A;  1K47 A;  2JVO A;  2HW3 A;  4WPA A;  3CDA A;  5HVF A;  4XKV A;  4U7U D;  3OL6 A;  2KT2 A;  2VFM A;  3LP1 A;  2CWX A;  2B51 A;  1JJ2 R;  2KRR A;  1RUS A;  4CNY A;  1M5O C;  3CNQ P;  3R5C A;  2GVD B;  5IC6 B;  3FJ2 A;  4QPX A;  3R8Y A;  1OFD A;  2VBM A;  2QJ3 A;  2IHR 1;  2YX1 A;  3JUR A;  3SCJ E;  1C4C A;  3KNA A;  1SVD A;  4B3S F;  2IAJ A;  2IVF B;  3RTV A;  3ENQ A;  2K8G A;  1CJU A;  2OFH X;  4ZPT R;  3A3N B;  3TA0 A;  1CVJ A;  3CMA S;  4MR0 A;  3BGR A;  3HJF A;  3TA1 A;  3K0J A;  2RF2 B;  3O8W A;  5D0E A;  1KLN A;  2KRB A;  1QA3 A;  4OPW A;  1R27 B;  5E3P A;  2V5I A;  1AB8 A;  1SBR A;  2AZ3 A;  3MEG A;  2AX0 A;  1DTQ A;  3C46 A;  2BM4 A;  4MK8 A;  4ZP6 A;  2DXD A;  4HKQ A;  5SZT A;  4EO6 A;  3ONQ A;  3OW2 R;  3ZSC A;  1F3V A;  3ZZP A;  2POK A;  1LWE B;  1UVL A;  3BGO P;  5IQQ A;  3IGN A;  4YHH F;  4OL8 A;  4CRJ A;  2AV5 A;  4GKK J;  3MEK A;  4ZVH A;  1LLW A;  2ZH4 A;  4ZJQ A;  1K4Z A;  4LRE A;  3KXD A;  4LSN B;  1KQG B;  3OUY B;  1FWL A;  2DNP A;  2QN6 B;  2PMZ D;  3KKF A;  1RWR A;  3NGS A;  1FJC A;  2BDP A;  2HK2 A;  3VSU A;  1WNE A;  3DDK A;  5D0H A;  5GMK a;  3FVY A;  2E29 A;  3KK3 A;  3F73 A;  5E0O A;  2BQR A;  2BZ2 A;  1U8W A;  1RT3 B;  3G8S A;  4DLE A;  4USK A;  1JQG A;  4LF8 F;  5HN0 A;  2FJD B;  1ZM4 A;  3M8P A;  5IM0 A;  2KM8 C;  2MGZ A;  2J76 E;  1C0T B;  3VR1 A;  4O4G B;  1SL1 A;  3CT9 A;  4RU2 A;  4I7F B;  4DV4 J;  1I5O B;  1X4F A;  1NK0 A;  3IBW A;  1SL0 A;  2XMT A;  1S57 A;  4MYU A;  1MN9 A;  1GMU A;  4RW7 A;  3RGI A;  2G4B A;  5EX3 A;  2YY3 A;  1N6Q B;  1N5Y B;  4F0K A;  1CC7 A;  1QA2 A;  3QFH A;  3HVT B;  4BBY A;  1NK7 A;  4A47 A;  4ZIV A;  1QAI A;  2GIF A;  1UWB A;  1NB7 A;  1NSK L;  4O3O A;  4FVM A;  3NGK A;  2XI3 A;  2I5J B;  1R3N A;  4LBH A;  4CIO A;  3AY0 A;  2ZH3 A;  4DR4 J;  3HJV A;  2UZA A;  3P5B P;  3ETM A;  3DRP A;  3ISN C;  4NA3 A;  5C42 B;  1VIX A;  4UOF A;  2R42 A;  2I6W A;  2W7A A;  4NCB A;  1B3T A;  3LQV A;  1NK8 A;  2D9P A;  4PPZ A;  5B0A A;  5L9X A;  3BO2 A;  1KP6 A;  5D4L A;  3S8S A;  1U2C A;  1YQH A;  2ZOG A;  3RBX A;  1RCO B;  4EW9 A;  1RCX B;  2C2O B;  5IT9 U;  3UR0 A;  2BEF A;  1IBC B;  1ULR A;  5BR8 F;  4L3K A;  2JJ4 D;  1F5A A;  1IJE B;  4RNO A;  1EP4 A;  4DSK A;  1IBM J;  5KFB A;  4K4T A;  3HFZ B;  3KHG A;  2BKO A;  1LW0 A;  3PFE A;  1FF2 A;  1PJ5 A;  3Q0A A;  1Y7P A;  3NNH A;  1T11 A;  4UOH A;  2UUB J;  4CLL A;  4MAK A;  2ZHB A;  1N5Q A;  3GII A;  3HVW A;  4RBV A;  3NAI A;  4IG3 B;  4EYI B;  3V6D B;  2DH7 A;  3JQK A;  4OJL A;  1FJ7 A;  3MEC A;  2CAJ A;  3CCW A;  2G2Z A;  1SC1 B;  4CO4 A;  3DLE A;  3KLF B;  4WTY A;  1YJU A;  2ZC3 A;  1WC3 A;  1G6B A;  3NNA A;  1OFL A;  2FJB B;  3IR7 B;  1UVK A;  1FHT A;  2BXJ A;  2ZH5 A;  3TAN A;  1TKX A;  2MKS A;  4KH1 B;  4AL5 A;  3WWG A;  2DNN A;  2QTW A;  5AE1 A;  1SJR A;  4C8Y A;  3S1T A;  3PJW A;  4C0B A;  5F0W A;  3IRX B;  3C15 B;  2CQI A;  3TEH B;  1G1X A;  3HKZ D;  4DUZ F;  4NOH A;  2RD5 C;  3TAQ A;  2OIH A;  1HD1 A;  1ZPV A;  1E6Y B;  1F1B B;  1RT1 B;  3JSM B;  2UVE A;  3TZX A;  4X4V A;  3DRR B;  2CG8 A;  5IC4 B;  1HPZ B;  3UW0 A;  2VG5 B;  5K8O A;  1MLA A;  1KQS R;  1RT4 A;  3OVA A;  1RAI B;  5I3U B;  5L8R C;  1HQE B;  1M5S A;  3AJ2 A;  4BWM A;  3T1H J;  3B90 A;  1IQT A;  3NCP A;  4K5R A;  4CM0 A;  2B6A A;  3CPW R;  1S1X A;  3W9I A;  1NKE A;  4DL6 A;  4ZLN A;  5C2G A;  1OJ4 A;  4OYA A;  3GP9 A;  2V4Q A;  4NLY A;  2QV6 A;  3PHT A;  3F56 A;  3NS6 A;  2DNY A;  3KG4 A;  3OT9 A;  3VAM A;  3C66 A;  4XN0 A;  3MR6 A;  1NDP A;  1FRL A;  1L1I A;  2Q3P A;  1JLC A;  1ZH5 A;  2F9D A;  4OYW A;  4WP3 A;  4AL7 A;  4OJ6 A;  5M2R A;  3SIP B;  4CH7 A;  2MXY A;  1YRX A;  3CO9 A;  5E3Q A;  4UZB A;  3VVT A;  2CJK A;  3R3T A;  5MAO A;  1LWX A;  4K4Y A;  1IKX B;  1DHM A;  1RAJ A;  3C6T A;  2ZH2 A;  1S5Z A;  4X66 J;  1FE4 A;  2BKN A;  5A8K B;  2FJV A;  5L1K A;  1URN A;  1P8G A;  1U49 A;  2WSE C;  5CH7 B;  2ZH1 A;  4M5I A;  1NSA A;  2LXU A;  2HS0 A;  1QTM A;  1WSV A;  1R6V A;  2CVI A;  2MZQ A;  1O8H A;  1RTH A;  2YH1 A;  5C42 A;  3MOJ B;  1IWG A;  4O23 A;  1N5S A;  2ZNZ A;  3S01 A;  5MLC V;  3HO1 A;  2AJ1 A;  3CDE A;  3R27 A;  1RE1 B;  2EVZ A;  2B9E A;  2OML A;  4YME A;  3H09 A;  3FSX A;  4RO0 A;  5L1I A;  4DV0 F;  4PYA A;  1K9M T;  2CQ0 A;  3TAM B;  2RH3 A;  1SC6 A;  4JI1 J;  2V4J B;  1Q16 B;  5EWF A;  3HFK A;  3CC4 S;  4DCP B;  4DR1 F;  2YVS A;  4PG5 A;  4C6A A;  3TA2 A;  2IMW P;  1X0F A;  4ZKA A;  2V2V A;  2BV3 A;  4CO3 A;  2BJ1 A;  4DFK A;  1RAB B;  2FVC A;  2XTJ P;  3IWL A;  3KK1 B;  4A8W A;  1HAR A;  4USJ C;  2A18 A;  3DMJ A;  3DDI A;  4FXW A;  2AF6 A;  2Z30 B;  2NZM A;  4FPI A;  4DL7 A;  4UF4 A;  5DS7 A;  1U6F A;  2W1B A;  1O8K A;  4LBP A;  2MQN A;  3KTQ A;  2HFU A;  4QW9 A;  2FZC B;  1HBM B;  2A2C A;  2HWT A;  2VJV A;  1FKA F;  1KWM A;  3CED A;  1X5S A;  3C14 B;  3V2U C;  4ED2 A;  2D41 A;  4DPX A;  1CJT B;  3CD7 A;  2DKO B;  4CLY A;  3O6Q A;  4J9R A;  5LMU J;  1FEE A;  3D6M B;  5IFM A;  1RWV B;  4OJP A;  2NQP A;  3UWT A;  1ZM3 A;  1FJG J;  4JUZ A;  3ICL A;  5KFZ A;  1QE1 A;  4X62 F;  2EK1 A;  2UU9 J;  3DRY A;  3OFG A;  1UZD A;  4WXO A;  1VQM S;  1OO0 B;  2EFG A;  3CCJ S;  2IJN A;  1PAU B;  3M2R B;  2KZZ A;  2J8A A;  3ZZU A;  2MYF A;  2HUR A;  4LIR A;  2NS1 B;  4IOA Q;  4LFB J;  2BE7 D;  1WEX A;  1EZZ B;  2HSE B;  4C98 A;  1X5O A;  2R9L A;  1IM4 A;  1ICE B;  5H9F K;  5KFU A;  4CTA A;  3MCS A;  1S9G B;  1L3K A;  4M5L A;  4Z06 A;  4CLZ A;  4ALZ A;  3TX8 A;  2YKM B;  1X0P A;  2YNI A;  4PQA A;  2XY7 A;  1HPZ A;  4EEY A;  2XO6 A;  4YQW A;  4CLK A;  3GQC A;  1WI8 A;  2VFQ A;  4DF4 A;  3EZU A;  4USM A;  3K8V A;  1NSQ A;  5F8N A;  2NST A;  4KSE B;  2N3L A;  3O3L A;  2C1E B;  2V8P A;  3BBB A;  5HMY A;  3HHL B;  2XHW A;  1XC9 A;  2QEX S;  3MM6 B;  4LMZ A;  2RAQ A;  1NK5 A;  2FB0 A;  1SH0 A;  2H5J B;  1LQ9 A;  3K5P A;  2W9B A;  2O3D A;  4J7C A;  2EBE A;  4HWV A;  2KZM A;  3MM7 B;  5ETL A;  5DG8 A;  3N01 A;  1BLU A;  5HQL A;  4C48 A;  2YWG A;  1T94 A;  2C2M B;  4NLD A;  3KG0 A;  2DNG A;  3Q8Q B;  1FVQ A;  2VFV A;  1NND A;  2W8K A;  1Q79 A;  2J8S A;  4B3M F;  1VDH A;  2LQ5 A;  5BYS A;  1VGY A;  1N33 J;  2D3U A;  2D9O A;  1WHW A;  4Q0B B;  3UCZ P;  4USU A;  5HSP A;  1XNQ F;  2YPY A;  3FCH A;  2HFS A;  5IT9 Y;  3M6U A;  2RDD A;  2E44 A;  3MPD A;  2MKH A;  2HHH F;  3THT A;  1CJK A;  4ILR A;  2BJ3 A;  3AA8 A;  3IP0 A;  4DSI A;  2PEH A;  4YY3 J;  3Q2S C;  2W25 A;  4CNZ A;  4OV6 A;  2H54 B;  1KQF B;  3RB3 A;  4AXJ A;  1MU2 B;  1FNM A;  3DNC A;  1Z2L A;  1AYE A;  3HXM A;  1TL7 B;  1Q0N A;  3UE2 A;  3Q8V A;  1IDK A;  4BHQ A;  1EET A;  5EDW A;  1JLE A;  2XLJ A;  2CZV C;  1SUQ A;  2DIU A;  2Y1L B;  2OP5 A;  4ZLL A;  1PKU A;  4LF6 F;  2MZJ A;  3B4M A;  2FUG 9;  2H48 B;  3NB2 A;  2PE8 A;  4IOB A;  1HKA A;  1KCC A;  2XYP B;  4JV5 J;  2YQ1 A;  3X3U A;  1VBX A;  1RKI A;  3OTO J;  4ZVF A;  3QID A;  1UPP A;  5CCL A;  3W5X A;  4BWJ A;  5HP1 A;  2R7X A;  2ZBC A;  4A8K A;  5D0R A;  1RXO B;  3NCQ A;  3MWB A;  3RUB L;  3FKB A;  3BPD A;  1NDK A;  2C3U A;  2FJX A;  3J7Z T;  1K1S A;  3K7R A;  4LF5 J;  4YR0 A;  3TJ9 A;  3OV7 A;  1MN7 A;  3EUN A;  2K3I A;  2CPX A;  3D6H B;  1U09 A;  4YUD A;  4P75 A;  1S1V A;  4F36 A;  2XT4 A;  4W4M A;  2ZHO A;  1OFE A;  2UV8 A;  2OUG A;  2ZJQ Q;  4DUT A;  1FKO B;  1Y5L B;  2OPR B;  1YLX A;  2CDQ A;  2RS2 A;  2KXF A;  5K8M A;  5F9L A;  5DZ7 A;  5JJB A;  1WKJ A;  3UPF A;  4HH1 A;  1TL3 A;  4J9S A;  1KEK A;  4O44 B;  1W2B R;  3KRG A;  1ZAX A;  4ZOS A;  2D1C A;  4GVB A;  4DL3 A;  1P27 B;  4KHM A;  4ZVO B;  4N76 A;  4DUY J;  1LOU A;  3FCV A;  3DM2 B;  1IKW B;  2GGP A;  2IDL A;  2MMY A;  5A2Q U;  2C22 A;  2G2Y A;  1JLQ A;  4E8U A;  1U25 A;  2C2N A;  2RB7 A;  4ECZ A;  1MWQ A;  1PIL A;  1U6B A;  2OI2 A;  1TL1 A;  4LR8 A;  1KTQ A;  4H54 A;  1HHQ A;  3L4B C;  1VMB A;  3PZP A;  4U6P A;  2CPZ A;  2XCA A;  5KFM A;  1PIE A;  2MDA A;  4NLX A;  4AYB D;  4DR7 J;  1U02 A;  3TUP A;  2OAU A;  3JSB A;  3CD5 A;  4PXE A;  2IJF A;  3FQK A;  1UW4 A;  2J6S A;  1L3V A;  1N34 F;  4K59 A;  1OIA A;  2AWZ A;  1WDD A;  3CCS S;  5LXR A;  2CRL A;  2DRB A;  3TQE A;  2B56 A;  4QIG A;  4ZCM A;  3J81 U;  2VUG A;  2J7K A;  3NL0 A;  3CJT A;  4MIA A;  1ZAW A;  4J9K A;  1FXD A;  2XQC A;  4X64 J;  3W8G A;  1U26 A;  4GO7 X;  3NCR A;  2B8P A;  4NEZ A;  3J7A N;  4DQQ A;  4H4M A;  4QR0 A;  3T5L A;  4Q7A A;  4O3Q A;  4Y2K A;  5KG2 A;  5J1E A;  4P9S A;  4BC9 A;  2BOA A;  1F9E B;  3TZW A;  1SXL A;  3GFY A;  5BJR A;  1XNR J;  3A1Y G;  3EDR B;  3W2W B;  3KLG A;  5GME A;  1YI2 S;  1T03 B;  4GKJ F;  4QYZ J;  1IDJ A;  5AXM A;  4KKO A;  1NKB A;  2M52 A;  3R7S B;  3QT6 A;  1RAD B;  1SL2 A;  1HYS A;  1V5V A;  3MM8 A;  2FC8 A;  4YN3 B;  3DU6 A;  2Z2M A;  2E1A A;  2KT5 A;  4TXS A;  4CM2 A;  1K73 T;  2R7O A;  3IFE A;  3ZO7 A;  4LF7 F;  4MFB A;  2ZWO A;  2DXF A;  1RA7 A;  1UFK A;  4JI4 J;  3RB4 A;  1FNO A;  3KDN A;  4M5D B;  2WK4 A;  3GE9 A;  3FMB A;  3DLG A;  3DFE A;  4X65 J;  5KFA A;  3GJQ B;  3Q8P B;  4DDF A;  1E6V A;  1XWL A;  3NEK A;  3CIZ A;  4QYR A;  3K5O A;  3W61 A;  5H9E J;  1UVM A;  2BOP A;  3WIV A;  2QA4 S;  5DDQ C;  1ZTW A;  4KAI A;  4ELT A;  3HLU A;  5D0G A;  5E5N A;  3NGT A;  3MMC B;  3ILO A;  3C19 A;  3X1L B;  3EPG A;  2QYC A;  1YJV A;  2L48 A;  3MUM P;  4YCQ A;  1DBO A;  4ZVT B;  3MFH A;  4NA1 A;  4Y0F A;  3QJL A;  3JQM A;  2HNY B;  5KFH A;  4ZVR B;  4CDI A;  4AUK A;  4ECY A;  2GO9 A;  4LF2 A;  4DPW A;  2UVW A;  4O3N A;  3ML3 A;  3I96 A;  1Q8I A;  2V9K A;  2J0Q D;  4KV8 B;  1SC4 B;  2B5J B;  1UZH A;  1K1Q A;  2QLJ B;  4DPT A;  1RT5 B;  2HPU A;  3AHP A;  5CXT A;  2OGU A;  4F7V A;  2AGQ A;  1O8M A;  4AL6 A;  3PSZ A;  4A46 A;  4TU8 A;  1QJV A;  5SUH A;  2V0N A;  4XON A;  4Z05 A;  5HBM B;  3GJS B;  3U1M A;  2BJE A;  3AJ1 A;  2B0R A;  5ETK A;  5ETT A;  4YR3 A;  1O8E A;  2AQ4 A;  1XN9 A;  2VFS A;  2W7O A;  3G4S S;  1A0O B;  1J27 A;  1IKY B;  4OZL A;  4LRB A;  3GIJ A;  3OFF A;  1RHJ B;  2GNK A;  3AXK A;  1KOH A;  5KFL A;  4AXI A;  1N32 J;  4KGX B;  3ZZY A;  2Z8G A;  2ZVS A;  2Y0B B;  5B0E A;  2MKI A;  2X85 A;  3BGU A;  1FD2 A;  4QIE A;  5HK4 A;  1TL5 A;  3M2V A;  2MKY A;  2IA0 A;  4DR5 F;  2MZR A;  2WAQ D;  3POT A;  3NOC A;  1UW9 A;  1RQ0 A;  2N7C A;  3OHA A;  4A8S A;  2ZJP Q;  1DQ9 A;  5DM6 Q;  1N0U A;  3FFI A;  4OIX A;  4M94 A;  4OYP A;  2DB1 A;  3ZZT A;  2CPF A;  1FRX A;  1WG5 A;  4LRF A;  4NX9 A;  4OJ3 A;  4ICL B;  2MZ1 A;  5HAT A;  4X4U A;  4TY8 B;  5EN1 A;  4QOT A;  4K0K J;  2PT0 A;  1S1W A;  4P73 A;  2OSQ A;  5KFK A;  1N48 A;  2B3T B;  3O5T B;  5GVQ A;  4WJB A;  3DGP A;  5KFG A;  3G82 A;  3AQP A;  1D09 B;  2YNF A;  1XR7 A;  5D4P A;  2GHV C;  2I8E A;  1H6K X;  1HNI B;  3TZZ A;  3W64 A;  1KNZ A;  2EW9 A;  2CVE A;  5AXK A;  1X4E A;  1WC1 A;  4I0W A;  2FGO A;  3E01 B;  2VPW B;  3W1Y C;  1NZA A;  3V4I A;  2QGF B;  4FYX B;  1NPP A;  2UXD J;  2RIL A;  2IM3 A;  4DS4 A;  1QSY A;  4YOE A;  2OFG X;  4K4W A;  3K89 A;  2D7S A;  1TKT B;  4YB1 P;  1YBA A;  1VLO A;  2VIH A;  3MOZ A;  2YX7 A;  2A0F B;  3MCN A;  2KG0 A;  2Y1J A;  3SSQ A;  1WC0 A;  4NLT A;  1RT2 A;  3JS9 A;  5D3G B;  5ETQ A;  1HHS A;  3MXH P;  4IRK A;  2ZBI A;  3LYC A;  3QO9 A;  3RW6 A;  3OBI A;  2R2T A;  2HFN A;  3PRB A;  2GA7 A;  2DGU A;  3ITH B;  3N28 A;  3IS9 B;  2R7W A;  3HX9 A;  4XAK A;  3MZI A;  2A1B A;  2JFK A;  4PR6 A;  4IH6 A;  2YKN B;  5DQH A;  1C0U B;  2V94 A;  2XZD B;  2XSJ A;  2BM5 A;  4IG0 A;  1WG4 A;  1ZTT A;  1R8B A;  4FF4 A;  3RB0 A;  4U96 A;  2HFO A;  2GMJ A;  3QLH B;  1PBA A;  4RW4 A;  2ODL A;  2QA4 G;  4MXN A;  2KG1 A;  3KLI B;  3MR3 A;  3H4D A;  2WON A;  1KDN A;  2FHO B;  3BS9 A;  1HA1 A;  3F0N A;  2F65 A;  4RJV A;  4HR2 A;  4X84 A;  3NP5 A;  3OR1 B;  2XZW A;  3R9L A;  1TUW A;  2UUC F;  4FF3 A;  3F41 A;  2B0G A;  3RYL A;  4LR7 A;  2HNZ B;  1HF2 A;  4QWA A;  1TUV A;  3EGN A;  5T41 A;  1S6U A;  3J81 Y;  5LM7 E;  8ATC B;  2DNH A;  2GAG C;  1CJV B;  2HHV A;  1GMW D;  3PEJ A;  3ZXW A;  1T0T V;  2GIQ A;  1Y4Z B;  3I56 S;  3BSO A;  4KFB A;  4ECX A;  3ISZ A;  1T95 A;  2WCX A;  2IFX A;  3UW1 A;  2H9Z A;  3SFU A;  1IUJ A;  3SY2 A;  2WVD A;  2GIR A;  1JXV A;  2CA9 A;  2CUY A;  3UN2 A;  3V6J A;  4QIV A;  3R97 A;  4C8O A;  3DDN A;  3CCV S;  1QM9 A;  1VCT A;  1EB0 A;  1UA0 A;  3FDS A;  3VST A;  4DX5 A;  3GQ8 A;  1KFD A;  1HBN A;  4ENO A;  2VH7 A;  1SIW B;  1GFW B;  4NK6 A;  2BAB A;  4YC5 A;  1FER A;  4P52 A;  1WF2 A;  3L95 X;  1GAO A;  4ICL A;  4WFN Q;  2MHE A;  5L1L A;  1O8B A;  2ZDP A;  4LR9 A;  3PCO B;  4NLG A;  1GTH A;  4TKT A;  2KN4 A;  5D4O A;  3GYG A;  4YDT A;  3WX8 A;  4NA2 A;  1H98 A;  4XLF A;  3T19 A;  5KFT A;  1DRZ A;  2Y9H A;  1JNZ B;  1I94 J;  3IWX A;  3MEE B;  3EM1 A;  2VFT A;  2GAH C;  2VKR A;  4YR2 A;  1WTF A;  1OY9 A;  2R8H A;  1B70 B;  1XMQ F;  4JI5 J;  1LM1 A;  2VPY B;  2CG4 A;  2LA6 A;  3NS5 A;  4ZVE A;  1CC8 A;  3FGV A;  4Q45 A;  5A8W A;  5T7L A;  1F2H A;  3PR4 A;  2DR6 A;  3B4D A;  1OGM X;  1TAU A;  1EE6 A;  3PSS A;  1VBY A;  3MDF A;  1O5J A;  2BAN A;  3GU0 A;  3U1N A;  2EWE A;  4DPU A;  4LQ3 A;  3CTR A;  1S59 A;  4ZJL A;  1FX2 A;  3E01 A;  1NJW A;  5ETR A;  4ED0 A;  2NRE A;  4TNO A;  2M70 A;  3PVX A;  1VQ4 S;  1C1C B;  3QZ7 A;  2KHC A;  1URR A;  3TUJ C;  4NI2 A;  3H2V E;  3NNC A;  1R8P A;  2O04 A;  2J0S D;  3EZ5 A;  3PAC A;  1N0V C;  4OYZ A;  4XOP A;  2J9D E;  4U9R A;  4ZJO A;  4LUB A;  3TAP A;  1S1T A;  1DZ5 A;  3NBP B;  3G6Y A;  1S9E B;  1VI7 A;  3VF0 B;  2DEI A;  3D0I E;  4TQS A;  4LRD A;  5GAE I;  2H5I B;  4PG7 A;  1TV6 B;  4KPY A;  1WJ9 A;  3CJS A;  1KQ5 A;  2YKQ A;  4W98 A;  3JSY A;  4NMX A;  1H38 A;  4O3P A;  4R0J A;  3H5Y A;  4I84 A;  1N4L A;  3S7R A;  4OI4 A;  3M6V A;  4M5J A;  1M1H A;  2WVC A;  4XM3 A;  4Y2C A;  4DR2 J;  1FI4 A;  3WX4 A;  1UCN A;  5ETO A;  2RQ4 A;  5ETP A;  3PR5 B;  2LXF A;  3CMQ A;  4AQY J;  4U95 A;  4RWW A;  2FJA B;  2M3D A;  4X4N A;  1XG2 A;  4QYZ K;  2E5G A;  4X4S A;  1SCJ B;  1YK9 A;  2GW8 A;  2C42 A;  4CLW A;  4TLR A;  2XMJ A;  4WZQ A;  1UEK A;  2CPJ A;  1S48 A;  3CSK A;  3QRQ A;  4ED8 A;  4ITS A;  2YNG B;  2IOU G;  3D28 A;  1FRH A;  3MR2 A;  2X1B A;  2RQM A;  4PQU B;  4B17 A;  4YB7 A;  2AEM A;  1XMO F;  3W65 A;  5HQM A;  4XN3 A;  4MKB A;  1CEZ A;  1X5P A;  3EGW B;  3QSY B;  3PV8 A;  3EVO A;  2VFN A;  1UJ5 A;  5H9E K;  2DVI A;  2LQB A;  3UDV A;  3SYZ A;  2ZD1 A;  4OYX A;  1X8D A;  3BQ1 A;  4ETX A;  1J5O A;  5C7P A;  2XNQ A;  1H0H B;  1K44 A;  1MRO B;  2DPJ A;  4R5P B;  4M5M A;  3VV2 B;  4ID8 A;  4QW8 A;  4RNH A;  2J8K A;  2ZEJ A;  4QR2 A;  2QE5 A;  4ZCK A;  1HNV B;  1TYW A;  1C2P A;  4C11 A;  3D3C J;  3T1A A;  3H25 A;  3OFE A;  1OQ6 A;  3ET6 B;  3MUT P;  3MM9 A;  2V2K A;  1WAC A;  1CS4 B;  3C16 A;  3VWS A;  1HI8 A;  1UTA A;  2UUA F;  2X6X A;  1LWF A;  3OXL A;  3LJY A;  3ZC4 A;  5BYR A;  3PYE A;  4YHH J;  3FRZ A;  3W60 A;  2DO0 A;  1F9F A;  4ZHR A;  1CUL A;  3WBZ A;  3ZPP A;  2ASY A;  3PEH A;  3M32 A;  2W4D A;  3V81 B;  3T3F A;  4RNM A;  2JEJ A;  3TX0 A;  3QIP B;  1I51 B;  1BE4 A;  4RW9 B;  1YRU A;  1KLM A;  3QT7 A;  1IB4 A;  1C1C A;  3QT8 A;  2W9C A;  3LH2 S;  2E9T A;  1RSC A;  4LF8 J;  3H7H B;  1DLO A;  2Z57 B;  2R8J A;  1EQM A;  2QX0 A;  4HLB A;  2P9E A;  4U67 Q;  4LVO P;  5C1C A;  3NG8 A;  2PEB A;  4F4Y A;  1RAG B;  3R1H A;  1YJT A;  2B9X A;  3BR8 A;  4PUO A;  1NH7 A;  5F0U A;  1I3O B;  4Z37 A;  3M30 B;  1IBK F;  3QRP A;  4FXD A;  3RG6 A;  2F40 A;  2CJY B;  4Z03 A;  9RUB A;  2DD8 S;  4Y28 C;  2XYH B;  3M2U B;  2HVI A;  1ROF A;  2O17 A;  3DRX A;  1FKP B;  1CG2 A;  3D9B A;  1D9D A;  5HMW A;  4Q5V A;  2BM6 A;  4P74 A;  3R7N B;  3G86 A;  4A8O A;  3LAL A;  4H4O B;  4F3Q A;  1X31 C;  4NE9 C;  2XYG B;  3A8J A;  2UUT A;  2HMI B;  5G0R A;  4OJ5 A;  4F8R A;  1JXL A;  2D3O R;  2BBE A;  3GZ7 A;  5ETN A;  1IQZ A;  2PYH A;  2JSX A;  2DHX A;  1FRJ A;  2HVD A;  2CJ9 A;  5KFJ A;  1IR2 A;  3GFH A;  1LFW A;  3VAK A;  2WW4 A;  2VQE F;  5IWA F;  2YUH A;  4XKW A;  3W62 A;  4WXW A;  4FPR A;  4Y2A A;  5BR8 J;  3HDS A;  2CPE A;  2VD3 A;  3BKT A;  4OZJ A;  3JYT A;  2HFV A;  2KM8 B;  2DGV A;  1FA0 A;  3H98 A;  3MD3 A;  1KKH A;  1OY6 A;  1WWH A;  3BKF A;  4NLS A;  5DM7 Q;  1WHV A;  5LOQ A;  2GMH A;  3BF4 A;  3BM7 A;  4TLQ A;  1RAC B;  3CC7 S;  3SV3 A;  4JI2 F;  1H7W A;  2UV8 G;  2HVH A;  2QX3 A;  2NXJ A;  3TQ1 A;  2AW0 A;  1TP7 A;  4PYD A;  3OTE A;  3I55 S;  1ARO P;  3MMJ A;  2OPP B;  2N3O A;  3KHH A;  2KVI A;  2C2Z B;  4I2P A;  3BH6 B;  3IRW P;  1QD1 A;  4ZCL A;  4OYB A;  3DOL A;  5EWG A;  5IQ6 A;  4CH1 A;  5E33 A;  3AOA A;  1C1B B;  1U0H A;  5CAB A;  4NYZ A;  1RGV A;  3R6G B;  3VAF A;  2DH8 A;  3SQG A;  2CPD A;  4CYU B;  2O1P A;  2FVS A;  3D1O A;  2CJQ A;  1LW2 B;  5HLF A;  2XS5 A;  3QMQ A;  4C7Q A;  2AIR B;  1M5K C;  3RRH A;  3A3O B;  2PMW A;  1EZG A;  4DUZ J;  5FLX U;  3T6J A;  3CDW A;  4QIF A;  2BE9 B;  2R2R A;  2P8I A;  3UD4 P;  1QSL A;  1Q7Y T;  1REV B;  3PDN A;  3AD8 C;  1XMB A;  1ZM9 A;  4RW8 B;  3QIP A;  2F5G A;  3SUC A;  3FMW A;  3IN5 A;  2JL9 A;  3DCA A;  5KG7 A;  2IA6 A;  4NWB A;  4KQZ A;  2DY9 A;  3BDE A;  2D74 B;  4NLQ A;  3OTD A;  2XMA A;  2B4V A;  3QGH A;  4J9P A;  4P2S A;  2FLO A;  4QWE A;  1S72 S;  2FVQ A;  3T6B A;  3H42 A;  1U48 A;  3A4T A;  2VU5 A;  2OD6 A;  2M8H A;  3AB2 B;  1RJJ A;  2ZZT A;  3UN3 A;  3RAM A;  4LF4 F;  2QY1 A;  3EMT A;  4DV6 F;  5B0G A;  4M8L A;  3H0P A;  3SBM A;  4MK7 A;  3GFX A;  1WI6 A;  5D6G A;  3EJM A;  1RTJ B;  2CJA A;  2XB2 D;  4DQI A;  1AZS B;  2BM7 A;  2IRX A;  3O44 A;  3CD0 A;  2LKZ A;  4PXD A;  3UD3 P;  2DR7 A;  1WMR A;  5I3Q A;  3ILI A;  4WKY A;  1HQU B;  3PRV A;  1TK5 A;  3GG1 A;  4X4T A;  2B9Y A;  2FPH X;  1HNZ F;  3E2E A;  4KGK A;  4CLF A;  1BGX T;  3A8K A;  3CJ0 A;  3VAI A;  2J0X A;  1LWC B;  4TVA B;  1HMV A;  1VRT A;  3GCW P;  1GNK A;  5AE2 A;  2XY6 A;  1OPI A;  3JTN A;  4G1Q A;  3SV4 A;  2NXC A;  1KR4 A;  3PTW A;  3ZTR A;  5J2N A;  3IR5 B;  3NXZ A;  1XR6 A;  4IFV B;  3P4U B;  4DV0 J;  1YJW S;  1PGZ A;  3GV8 B;  4HHJ A;  1UJ4 A;  2ZHA A;  5A0Y A;  4ECQ A;  4DR1 J;  3QGP A;  4QU6 A;  1S76 D;  4Q43 A;  2BR0 A;  4DSF A;  2GFF A;  3CDU A;  1MWY A;  1BWV A;  4B3O B;  1DBG A;  3TJ8 A;  1S77 D;  4EO8 A;  2HZC A;  2M7S A;  3PO4 A;  2M5Y A;  1BQM B;  3DRS B;  1WC4 A;  3CJ8 A;  3K8W A;  3SSR A;  1FE0 A;  5HRO A;  4A8F A;  4UOG A;  4DS5 A;  2V69 A;  2LMI A;  1TKZ A;  3EYZ A;  5C1E A;  1F3F A;  2C3O A;  4KR0 B;  3IGV A;  1JKH A;  3LOU A;  1JLB A;  3MM5 A;  4NAS A;  4JI0 J;  3AOD A;  2XLK A;  2JC0 A;  4IUF A;  1WF1 A;  2VA3 A;  4PAA A;  4EMD A;  3MD1 A;  2KB2 A;  2QFJ A;  1R0A A;  1X0C A;  5KG6 A;  2OKQ A;  1S0V A;  2IVY A;  3D68 A;  3SCL E;  5LT5 A;  1KTW A;  4PG6 A;  2HK3 A;  5J2M A;  1NJY A;  1BY9 A;  1F5C A;  1GQE A;  1SJF A;  2IAJ B;  3PW7 A;  2RRA A;  1CJU B;  1U1O A;  4XK8 C;  3R7B B;  3GQ7 A;  4S0M A;  2XC1 A;  4YDX A;  3BGR B;  3SZE A;  5JUM A;  4HAC A;  2N7Y A;  4J90 A;  1VQY A;  3OQ2 A;  5A8R A;  2J6U A;  4HL9 A;  1PCA A;  1U2F A;  3MEG B;  2CQC A;  1DTQ B;  1WEL A;  4Q2L A;  2CNO B;  3D2W A;  3SMZ A;  4USV A;  3NY0 A;  2MQP A;  4URQ U;  4LQ9 A;  4D3H A;  5KAK A;  3GSD A;  4LVN P;  3K5M A;  2IPO B;  1R8C A;  2FD2 A;  1SJQ A;  4KHR A;  2FIU A;  4MKA A;  3AD7 C;  4C4W A;  3BN4 A;  2XM3 A;  2OPQ A;  2LQ8 A;  3TO8 A;  3DHX A;  2AJ4 A;  3CW2 C;  1NJX A;  3U1L A;  2UU9 F;  4URG A;  1RTD A;  2V8H A;  1V5I B;  2HBQ B;  3KK3 B;  1FES A;  2W2O P;  1B7F A;  1JIH A;  3MCO A;  5D4N A;  3Q2T C;  2ZM6 F;  1G3O A;  3I0S A;  2YWF A;  3VAG A;  3M8P B;  5IM0 B;  4B3M J;  3VQS A;  2MGZ B;  3BN7 A;  4NZ7 A;  1S4E A;  5J2Q A;  4C8L A;  1PC5 A;  5HL7 Q;  1X60 A;  3H8Y A;  3TEG A;  1XNQ J;  3W5Y A;  3EQO A;  2YPZ A;  2OD4 A;  3BO4 A;  2HHH J;  5FII A;  3LPY A;  2HHS A;  1QCX A;  3CCU S;  4KJI A;  5J1N A;  5EX0 A;  4RW7 B;  4ZVQ B;  1HBO A;  2O01 C;  4OM9 A;  1JLF B;  3P5T L;  4HTJ A;  2ZH6 A;  1JNR B;  1G7C B;  1UWB B;  2VKZ G;  2ZOF A;  2L9N A;  1SJ4 P;  4ED7 A;  4USW A;  4Y00 A;  2OTJ S;  2Z58 B;  2H4Y B;  1UET A;  4RUC A;  2HYI B;  1SV5 A;  2PDA A;  4MTP A;  2FHK A;  4W90 B;  2VJU A;  1UMJ A;  3VQT A;  2KJV A;  1YBU A;  1T9T A;  1FVS A;  5ITH A;  3WC2 A;  3DRP B;  1ZS6 A;  2VL1 A;  1NZ8 A;  5I3P A;  3HKW A;  3BH7 B;  1H80 A;  4C2L A;  1N33 F;  3N5F A;  4HT5 A;  2YWK A;  2ILZ A;  3G96 A;  2CPI A;  4LRA A;  2IM2 A;  2HEK A;  2DNL A;  2G2O A;  2BJ7 A;  1Y9O A;  1FFW B;  3HZE A;  3K59 A;  1TUG B;  2N82 B;  3I9Z A;  2J7W A;  4C8Z A;  5E41 A;  1AW0 A;  2C3Y A;  3M6X A;  1N88 A;  2JOQ A;  1RWK B;  1UPM B;  1YGY A;  2W9A A;  4W92 B;  4B9S A;  3N6Z A;  3JAM Y;  1RYR A;  4DEZ A;  5B0F A;  1EP4 B;  4FP9 A;  4YY3 F;  1RU2 A;  1XQI A;  2OSR A;  3GR1 A;  2CKW A;  3UFC X;  1D8Y A;  8RUC A;  5FLX Y;  1SKS A;  4EZ9 A;  2E7W A;  3CJR A;  4IFY A;  5C2C A;  3PG9 A;  4ZP9 A;  1LW0 B;  5CYJ A;  2CAD A;  2OJ3 A;  3UR3 C;  1DAR A;  4ED1 A;  1NPR A;  1J5E J;  2B4U A;  1HBU A;  5CAA A;  2UXC F;  4RUH A;  3GMG A;  1Q81 T;  2Z4P A;  3G8T A;  1OWX A;  1GMW A;  2RIJ A;  3MEC B;  4WYL A;  2H65 B;  5KG3 A;  3DLE B;  5KTQ A;  2MST A;  2IYG A;  1Q1K A;  4CLU A;  2GQQ A;  2CNK B;  1X4G A;  3OTO F;  1MML A;  1OY8 A;  3VAJ A;  1TKX B;  4F0M A;  1A6L A;  1VFJ A;  2RHQ B;  2HZV A;  1X4D A;  2DNM A;  2FDN A;  1KHW A;  4DJB A;  1X4A A;  2W4P A;  2WOM A;  4UY8 5;  2LYV A;  4UUW A;  4A8M P;  3KJV B;  4DV2 F;  3VZH A;  3EXC X;  2ZJR Q;  5C25 A;  3R5B A;  3BBC A;  2ZKU A;  4CLS A;  1RT6 A;  3PET A;  2ADB A;  2EBG A;  2AMC B;  4J9L A;  5CYQ A;  3CCZ A;  3H59 A;  1D9A A;  3H2L A;  2QZA A;  4LSL A;  1RT4 B;  4M5H A;  3GR0 A;  4ECT A;  3UCG A;  2BMB A;  5K14 A;  3ZNJ 1; 
#chains in the Genus database with same CATH homology
 4KH3 A;  4CP5 A;  4UOG A;  3Q8V A;  3EE3 A;  3PJ9 A;  1NSK L;  4JRA C;  4UOH A;  1K4Z A;  3Q86 A;  3Q83 A;  3ML3 A;  1F3F A;  4DUT A;  5CAA A;  2IOU G;  3JX8 A;  3EVW A;  1EHW A;  4HR2 A;  3Q89 A;  4OJP A;  3R9L A;  3VGV A;  2HVE A;  3EVM A;  3NGS A;  3RIQ A;  2VFM A;  1PKU A;  4DZ6 A;  3FBE A;  3ZTO A;  3LJY A;  1W7W A;  3Q8U A;  4AND A;  1NLK L;  1BHN A;  1PAE X;  1HF2 A;  3B54 A;  3GP9 A;  1BUX A;  1TYX A;  4OJL A;  3H09 A;  3WX8 A;  3ZTQ A;  3EIC A;  2G0Y A;  5BXI A;  2DXF A;  3SYJ A;  3N90 A;  3ETM A;  1WKK A;  4F4A A;  1ZS6 A;  1WKJ A;  1QQ1 A;  3FBC A;  3P4G A;  3FBF A;  3JS9 A;  1XIQ A;  2HUR A;  2BM6 A;  3BH7 B;  2DY9 A;  3FBB A;  2J8I A;  4UOF A;  3VGT A;  3VVU A;  3NGU A;  4DI6 A;  1B4S A;  4C6A A;  3EM1 A;  3EVO A;  4FKY A;  2VFN A;  3ZTR A;  1NDP A;  1NHK L;  2B8Q A;  1U8W A;  3FCW A;  3LYC A;  1QRB A;  1CLW A;  1NPK A;  1KQ5 A;  1TSP A;  4OJO A;  1WXR A;  3ELH A;  1QRC A;  3B6B A;  3ENA A;  4W98 A;  2B0R A;  2VFP A;  1BE4 A;  4ANE A;  3ZTP A;  4V02 C;  3MPD A;  2DYA A;  4OJ6 A;  5C7P A;  3BH6 B;  1VYA A;  2VU5 A;  4OJ5 A;  4S0M A;  2B8P A;  2XC1 A;  1K44 A;  3AK5 A;  1F6T A;  3FCV A;  3DDI A;  3FKB A;  1NDK A;  2BEF A;  2AZ1 A;  3SZE A;  2ZUA A;  3VVT A;  3BBF A;  3L7U A;  1UCN A;  1NUE A;  2BM5 A;  3NGR A;  4KPC A;  2HVD A;  1NSP A;  1JXV A;  1LWX A;  1QA3 A;  3NGT A;  1NB2 A;  4OPW A;  2DXE A;  3EMT A;  2VFQ A;  2V5I A;  3Q8Y A;  3N6Z A;  5CAB A;  4FKX A;  3VGU A;  2W7Z A;  1S57 A;  1NSQ A;  5JLV C;  1NDL A;  1S59 A;  2AZ3 A;  1DAB A;  1MN7 A;  1TYU A;  1S5Z A;  1NCL A;  1NDC A;  3BBC A;  2CWK A;  4O0N A;  1MN9 A;  4EK2 A;  1LEO A;  3PET A;  2BM4 A;  2YUH A;  3G2X A;  3EJM A;  1XQI A;  2DXD A;  1WKL A;  1HHQ A;  1TYW A;  1HIY A;  4ANC A;  2NCK L;  1TYV A;  3ZTS A;  2BM7 A;  2BX6 A;  1HLW A;  3DKD A;  5IOL A;  3BBB A;  4ENO A;  1B99 A;  1QA1 A;  4WBF A;  1K8F A;  3TH0 A;  2F3L A;  1QA2 A;  3VGS A;  2VFO A;  4OM9 A;  4F36 A;  5JMC B;  3FC9 A;  1KDN A;  3GPA A;  3PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...