4XLCA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlcA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlcA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlcA02
4XONA 3JURA 4PMHA 1VBLA 4XOTA 1NHCA 1BN8A 1K5CA 2VBMA 3GQ9A 2BSPA 2NSTA 1HG8A 2O17A 1JRGA 3EQNA 1KTWA 4XLEA 1O8GA 2VBEA 3KRGA 1CZFA 1IDJA 1RU4A 1BHEA 1QCXA 3VMWA 1PLUA 1RWRA 2INVA 2NZMA 2QX3A 4URRA 2X3HA 1O8FA 1O8EA 3GRHA 3GQ8A 1GQ8A 4XN0A 2X85A 4W8SA 2NSPA 2UVEA 2NT6A 4XORA 4Z06A 4OJLA 4XKWA 2QY1A 4Z03A 3B8YA 4YELA 1RMGA 4W8TA 4C2LA 1IB4A 1EE6A 1OFMA 4XL9A 2O0WA 3T9GA 3SUCA 2O04A 2EWEA 4EW9A 4XN3A 3B90A 4XNFA 4XMYA 4XOPA 2VJJA 4OJ6A 4NK6A 1WMRA 2UVFA 2ODLA 2VJIA 4W8RA 3VSVA 1IA5A 1QJVA 3FY3A 4XQFA 3LMWA 2NT9A 4HWVA 3EQOA 1O8HA 2PYGA 4XR6A 1DBOA 4U49A 2QXZA 4MR0A 1JTAA 1O8JA 2X6WA 4XLFA 3GQ7A 1OGMX 1PXZA 4OJPA 1KCCA 2PECA 1O88A 1O8MA 3VSUA 4YEJA 4XLCA 2X6XA 2VBKA 4OZZA 5AMVA 4MXNA 1O8LA 1O8DA 1AIRA 1O8IA 4Z05A 4YZXA 4OZYA 1DBGA 4W8QA 1OOCA 1H80A 4U4BA 4NK8A 2NTPA 1KCDA 1OFLA 2X6YA 5C1CA 4YZ0A 2PYHA 4XLHA 3VMVA 3WWGA 3ZPPA 1IDKA 4YZAA 4I84A 3UW0A 3ZSCA 5C1EA 4XLAA 3B4NA 1XG2A 1X0CA 2NTBA 4AVZA 1O8KA 2Z8GA 2IQ7A 4OJ5A 4OJOA 4XM3A 2INUA 2O0VA 4XKVA 3GQAA 1OGOX 3VSTA 2NTQA 4YZQA 1PE9A 2O1DA
chains in the Genus database with same CATH superfamily
3R4KA 3VSKA 1PUEE 3TP0A 3CUQC 4RCYA 3SZTA 1JUMA 1XGSA 1YLFA 4CICA 2FEZA 2BOLA 3HGYA 4A3JJ 4TMVA 1R58A 2ECBA 3GVLA 2P7VB 3ELKA 4A5NA 3FMSA 2O6GE 1KA8A 4M71A 3FHNA 4YFOA 1R22A 4YHBA 1YOVB 2JZYA 3S3OA 3BTCA 1EWYA 3H5AA 3OS1A 2EIXA 4KT5C 2RQQA 2YX4A 2XTYA 6PAXA 4YFKF 4ENNA 3HOUJ 3I4NJ 1IN5A 2KT0A 3E3VA 5DDGA 4V02C 3A03A 3SYJA 2BVLA 5KCMA 1D0XA 5D5UB 3LVBA 3HOVJ 4QWQA 1A31A 2Y0MA 1QZYA 1YX3A 1R5NA 4G7WA 5FKLA 5FRMA 3WGIA 5F0CA 3DQVC 2FNPA 2DQLA 1E2XA 2QY1A 2F6CA 4BQOA 1ETKA 5AONA 4MYTA 4BJ6C 1FBSA 4PAAA 1F60A 2FX0A 4XBFA 5F4OA 3OAAA 1JE8A 2WB1N 5FFXA 2IJLA 3TP3A 4EGYA 3LYCA 1D8KA 3QAHA 2VBTA 3D5LA 4M6VA 3GQBA 3VSVA 3RZOJ 2LF7A 1QA2A 3K4KA 5TGTA 3IWZA 1U78A 1R36A 1KQ0A 2NT9A 1Z9CA 3KLNA 4HOBA 5F1RA 4IKFA 2XIGA 1AKHA 1QPIA 3V8LA 5CPRB 4IHVA 3WTTC 1K4SA 2XC1A 2JIZA 2E7WA 2UZKA 4XRSG 1G7CA 3KCCA 4XIDA 3L09A 1PXZA 2BEOA 1WJEA 4WWVA 4DQ2A 4OJPA 4E7SA 4Y15A 4AF6A 3TQNA 1OYYA 1QQ1A 2R7DA 3VOEA 4TMXA 3P9IA 2J5PA 2R9VA 5M5XJ 2GIZA 5BPDA 4AU7A 4KNYA 1QH0A 2XZPA 3WNDA 4EMSA 4A5MA 4U0YA 1WSRA 4RB1A 4OPVA 1G3YA 3I0TA 4ZGNB 2KQRA 4HF0A 5CDFA 1GJRA 2JPBA 5EMNA 1OFLA 1DG1G 3DTKA 4ASUA 1WJ5A 4B1RA 3OYHA 4RDKA 5FLXK 2K40A 1GR1A 2UUZA 2Z33A 3GZ6A 3OJXA 1UD2A 1ZLKA 3ASTA 1HA3A 4Y9UA 1ZG5A 3OSFA 3HOTA 2RC4A 4G1VA 4Z2YA 1K4TA 1BJKA 3SHFA 4AIDA 2JDIA 4GFBA 1Z21A 2L3DA 3BZKA 3U9GA 3DLLF 3S16J 4CCNA 4G12A 1O8KA 3FXRA 2DA7A 4EJTA 4NHJA 2X9DA 3HSRA 5B3SH 1ERDA 3ASSA 2V9PA 4XM3A 4RD3A 1FIAA 3G73A 3BTJA 4JQFA 1OGOX 1MJ9A 1BR4A 4ANJA 4A3GJ 1R1TA 5GADJ 1T38A 2DTZA 5JMCB 3BROA 2ZZQA 2Q8KA 3L00A 3CCQB 1P4XA 3IKVA 4MIMA 4ZCLA 1ENHA 4FT8A 1U2WA 3OYFA 1O57A 3ROUA 1R1VA 1J0RA 1HW5A 2VBSA 4GQNA 3TMOA 1E64A 2BN4A 1RZ4A 4M3GA 3SEQA 5BMZA 1G4DA 2XUBA 1CZFA 1WJFA 1RESA 2DERA 2HDWA 2IOUG 5C4JJ 2GPJA 3HHGA 3FPPA 3VMWA 2CO5A 2QGGA 3W2AA 1DDIA 4QSHA 1FRNA 3DKYA 3SDBA 3GO5A 3JCUC 5DYMA 4E70A 2V7FA 4W8SA 1UG2A 3TEDA 1MABA 2PBIA 3CCVI 3MZYA 2WADA 4UZEA 1XDSA 4X7DA 1X1BA 4M9SA 1VQ4I 1H85A 1V3FA 4K1XA 3F6OA 3WY9A 3BY1A 1TQIA 1X1AA 2V7WA 2NNYA 5IYWA 2ID3A 3J80K 4A3IJ 4BHBA 4FXUA 2E1RA 2NV4A 1R6RA 4B47A 1VQMB 5L46A 2VI6A 3O8GA 1EFRA 5IYCJ 1MZBA 4EM1A 2K7LA 1J2XA 4P22A 4LG0A 4W97A 1SFKA 2AHOA 1QZZA 2LREA 1HKQA 2CG4A 3F8NA 4MQ9F 2M5SA 1SVOA 4A3MJ 1FOXA 3HGGA 2X1EA 5A2QZ 2L7KA 2QMUA 4YFNF 5K5RA 3E7LA 2XZOA 3OL3A 2AXTC 1DBOA 3PFYA 4WF2A 2H1LA 1NBMA 2DMUA 3RQIA 3SQNA 3MZHA 3NWSA 3OWTA 3K69A 3PQKA 4ENKA 2L01A 4Y13A 2CU7A 3KP5A 2Y48A 3HZJA 3S1QJ 4Q47A 3TO7A 2M8EA 2JWTA 3CW2A 3OEHA 1N05A 4A3DJ 2Y69H 2EIJH 2X8KA 1O8MA 4DNTB 2VBKA 3HXLA 4ZC3A 3WHCA 1J7KA 1LQ1A 5C4XJ 3G6EI 1IRZA 1BLIA 1W35A 2XOKA 1O8IA 1LEAA 1E3PA 5KAIC 2FQ3A 2KL4A 4IOCF 2GXBA 3FXOA 2HVRA 2Q6IA 2BV6A 2B9SA 2R7SA 3PUMA 2PYHA 4EM2A 1GV5A 2QA4B 2ZXHA 3JRAA 3H9GA 1T6YA 2MW8A 1D1BA 2YUHA 4ZDLA 1RR8C 4E4HA 2JVGA 2OQGA 4B8XA 3JAMZ 5C1EA 1UHWA 2LF8A 1EFCA 3T0YA 1KD1D 4KN4X 2XAHA 3H94A 4D9JA 1R49A 1AKHB 1E63A 4QVJA 2YR2A 3ASQA 3CPXA 2XSJC 2A6HF 4MLOA 3QPLA 4U7DA 2DT5A 2E36A 2ZFWA 1FC3A 3C18A 5HLGA 4XONA 4M3FA 2NS7A 1TNTA 5IOYA 1CF7B 2M45A 4YIFA 2BY2A 3A1YA 2P6TA 3JTGA 5B6IA 2E7XA 4Z4WA 2OZUA 3IP4B 5JHFA 4BE2A 2PJRB 3E6DA 3ZGKA 3OIPA 2DA1A 1TWFJ 4PABA 3W5UA 1Y0RA 1ETOA 2DFIA 3FHZA 1YX5A 3I58A 1KZLA 1MBFA 2Y31A 4ESBA 2OBPA 5HS9A 3RI4A 2Z5UA 4W1UA 4AIJA 4H9GA 1A36A 3PJRA 4QTRA 2A6TA 4C3IJ 1KJZA 2BV3A 1Q86D 2K3PA 4IRIA 1KRHA 5J1YA 2V7UA 1EH7A 1I6XA 3J81K 2KIFA 1RWRA 1QA1A 2KRFA 1H9GA 4D1QA 1U6GA 1GQ8A 4XN0A 2A5YB 4NQWB 2CWEA 2RN7A 2W25A 1DGWY 4ZH4F 4AD9A 5GPAA 5FKKA 1Y0UA 2CUJA 2NOGA 3PIPF 4WZKA 3ZIAA 4C2UA 4JK1X 1BI3A 2XKOA 2JTVA 1SFXA 4HW0A 1WJBA 2DEUA 4I0BA 1IRXA 2ZO4A 5HDNA 2NAZA 1KYZA 2CQQA 1SAXA 2HYFA 3OV8A 1W2BB 5DM6F 1RR7A 1JT0A 1QA3A 4B48A 5FIUA 1FPQA 1LDJA 3R60A 2DCUA 3EETA 3FBIB 3OIOA 2W7NA 3DEWA 1S7OA 2OCEA 2IGMA 3FMRA 4D5CA 1HVXA 1MNMC 1VQ9B 2FBKA 1XS9A 2HOSA 2L9SA 4N3NA 3BY2A 2ZNZA 3L2CA 4MR0A 2Z2SB 1XG1A 2XGCA 4P3YA 3F3XA 2M4GA 5TR9A 1E0EA 3W5HA 1QNTA 2QSFX 3OYNA 5E17F 3BQYA 3WGHA 3CRZA 4IZZA 2VFPA 4Y9RA 1ETWA 1XDUA 4S0HB 3R6JA 2OA4A 2E5NA 2DN0A 2K3FA 2L9RA 2VC0A 4V2GA 5FFZA 4PJJA 5FJ8J 3HPHA 3V7CA 4QIWN 4WZLA 5THXA 3BH6B 4HQEA 4P12A 4MO7A 4DBQA 2NVUB 5LMZA 3SJZA 1XC5A 2WBMA 4P9FA 2P3MA 2M7BA 3WTYC 1FMWA 3HTSB 5IYQA 1YW8A 4BXUA 2YWEA 4NK8A 4TMWA 4ZCMA 3QFSA 4KIGA 4HIZA 2FUG2 3V76A 1U9NA 1BW6A 1CF7A 3OZUA 3RSNA 4LMYA 1WI9A 2FOKA 3DBHB 4L5JA 2X48A 4KISA 3WTSC 2JA2A 2QENA 3AAFA 4NUBA 3T8RA 4ESJA 2NTBA 4RDLA 5D5WB 2WZPP 2Z8GA 2AXLA 3CCQI 3K1PA 5EZHA 3H9NA 3MKYB 3K4NA 4TSFA 3S1RJ 1W34A 4KICA 3KIOA 3CCRI 4P2NA 4PSWA 4EQQA 1HA8A 2RGVA 1N25A 1LPQA 3JSPA 3H0GJ 4Y7CA 2RNGA 4A3CJ 1HCRA 1ULYA 2CFXA 4JYKA 2OD5A 3ZQCA 1IN7A 4UB6C 2OTJI 3RIRA 5LGNA 4JOMA 2ESNA 4B3XA 5L3FA 2VB6A 4PCQA 4M74A 2F4OB 3CJQB 3LSKA 4C2MJ 1H8AC 3WODF 2PMDA 2DMNA 4U0VA 3QYEA 1BX0A 3AG2H 2XB5A 5BSYA 1RU4A 1YITB 3C1DA 4QUZA 5E20A 3GTKJ 5FO1A 1XE1A 3RZDJ 1ZELA 1S0UA 2Y9YA 2A07F 4HA8A 1IDZA 3Q3SA 3CO7C 4G5GA 2X1DA 2GA2A 3BQZA 3GYHX 4HV6A 1B72B 1UD6A 3OW2B 1X2MA 3SZGA 3AK5A 5C3EJ 4WZTA 3HM5A 3S8PA 1PUFB 3JSOA 3B8YA 1FNMA 1MJAA 1SM4A 2PG4A 1YRNB 2EB7A 3G4SB 1EE6A 1IB4A 2KDZA 2BXZA 5J1UA 3OY9A 2XC7A 3K70D 4RAYA 5DUIA 2V1XA 3MZ8A 4MQVA 5DD8A 4RDUA 3B02A 2P4WA 3A0BC 3L2VA 3VO1A 3B90A 1GLNA 4XMYA 3T53B 1TQPA 4K2EA 1MH3A 1YS7A 3PSIA 5M5YJ 2XNJA 2QQ8A 5H5JA 2HNHA 1FY7A 3CMEI 1HOMA 1IA5A 3WU2C 1N08A 4UZUA 5EEHA 1XB4A 4KFCA 3JU4A 2M2EA 3F22A 3PA2A 2DLLA 2KPMA 3MAJA 5LHHA 3IV5A 3F23A 4RPBA 3BR6A 4G8XA 1I27A 2M34A 1WOSA 4YALA 4CDGA 3ZQFA 4G1BA 3ZMUA 4MTEA 3W6JB 3P26A 2L2OA 4TT3A 1O3RA 1H8EA 1JTAA 2VFOA 2ZTGA 3KEQA 3PUFA 3ESWB 4LD5A 3DDYA 4Z4ZA 2M7AA 1P4AA 4ZYAA 2ZJ2A 2RDPA 3LJYA 4P5OA 4IPAA 2J5OA 3OP1A 4A3FJ 1U9OA 2CQKA 4YC5A 3BC8A 4FX0A 1X3ZB 4JX6A 3BWGA 3G1LA 3C7JA 3HOWJ 4E7JA 2F4MB 1MBKA 2DTRA 3WNBA 1MMNA 1VF9A 2ISYA 2O5RA 4X7FA 5IYNA 5IYRA 3EYYA 1I5ZA 1KK0A 3Q3AA 5IYPA 1MMDA 1T2KA 5D5VB 4RB0A 1NG6A 4FQGA 1ZH5A 4TMZA 2XKPA 1XSVA 1P6RA 2F5CA 2KFDA 1RI7A 4XLHA 3FKIJ 4D0PA 4QLCU 1U8BA 1FNCA 3T8TA 2LBFB 2X0KA 3V42A 1LVAA 3OW7A 4X07A 1XCVA 1R4MB 2EK5A 1VQLB 3NQOA 3LSHA 2L5QA 4Z1MA 2HQRA 1SVLA 1K73D 2DBBA 2IGNA 4KJZA 2EJRA 3KEOA 3HSFA 4AVZA 2X53S 2L4AA 3CC7B 3OYIA 2ZBKA 2OTLB 1QHHD 3K1NA 1LM1A 4OM9A 4QHYA 1IC8A 5IOZA 4DQKA 4XKVA 1QRYA 2VONA 1FIPA 1ZM9A 1ETQA 1Z6TA 1MIJA 2FX3A 3JRDA 1Y1WJ 1S4MA 4A0XA 4MNUA 5FD5A 3M07A 4HAMA 4YAOA 3KETA 1GVJA 2DDBA 4BDZA 2UXNA 2IVMA 2PLYA 1NHCA 4BHCA 4XICA 2OC6A 1MRZA 1W4MA 1BIBA 2XSDC 2LD5A 1YJNI 4Q7JB 1JKRC 2V7QA 1Z05A 2IRFG 3NE5B 2F4IA 4LJZF 1XGOA 4OIPF 2ZTNA 2OZ6A 1I1SA 2KP6A 4BY7J 4HQMA 3RKXA 2COMA 3TDZC 4L9NA 3SXYA 2LTPA 3IAM2 4IF4A 1WWXA 4BQQA 4I02A 3AGPA 3CCUB 2KDOA 2R7TA 1IJEA 1OISA 1NH3A 5KHDA 1VQ9I 4XORA 3X2QH 1E79A 4RM2A 2MSYA 1N0UA 2BPOA 4BEHA 1A6QA 2F3LA 5E3NA 4E6KG 4EGZA 3QRFF 1EJ9A 1BL0A 4TKOB 3S1NJ 5EG0B 2GWRA 4BAYA 3R6SA 2Y0SA 1MJBA 3IRRA 3ASNH 3ZPLA 2KIQA 2GM4A 3IL2A 1VI0A 1QA6A 1SANA 3A3GA 3I5UA 2LVSA 4IL6C 5DCMA 4NK6A 2O0YA 2VNIA 2W82A 4F91B 3ZR8X 1GT0C 3PIOF 4XK4A 3CESA 3FWEA 2V26A 1ZGWA 4PGOA 1N77A 1QJVA 1RUNA 3G1MA 4FTHA 3I3LA 3E1SA 2HDDA 1TSPA 2MABA 4B43A 2X51A 2B5OA 4B4DA 1OJLA 2HOAA 3S2WA 5B1BH 2WAEA 1E3OC 2FQ4A 3AVUA 3BCBA 3A2KA 1SD7A 4DNCA 1VQNI 4A0YA 2YU9J 2CF4A 4LG0B 1ZREA 5HKKA 2PQ8A 2PX9A 2F48A 2X6WA 4BE1A 1V54H 1BR2A 1IDYA 1ZG1A 2OPTA 3G71I 2OCCH 3IAS2 1KQSB 1WJCA 4Y7NJ 2JSPA 3PSFA 1FRQA 2PIAA 4C43A 4HF2A 3WG9A 4X06A 2KJCA 1GAWA 1ZRDA 1EH8A 5CQGA 3FISA 1DDNA 1NJID 1I18A 2G0YA 3ZZUA 2D1HA 3L2UA 2OV7A 3HRSA 2E1CA 1BM9A 2RC5A 4V19K 4IHWA 3VMVA 5DUKA 1FP1D 2ADUA 1XPXA 5BSXA 3ZPPA 3BC9A 3QP6A 3S17J 2BX6A 4KKSA 4GYGA 5GAHJ 5KNLA 1FDRA 4QV2A 3OYKA 1WQ2A 2M9HA 2QM3A 4G6TB 4QPQA 2EV6A 3M1CA 4CCKA 4BDYA 4MEXF 4V2FA 2HEOA 1K8FA 3B4NA 4NC7A 4MGRA 1B8IB 2PJPA 5E3LA 1K4ZA 2LY1A 2N8GA 4CZZA 2R0QC 1ZM2A 1IAWA 1M1EB 3WE3A 1WORA 3GW2A 1Q7YD 1EFTA 5K7ZA 2W4SA 1MNDA 1TUIA 1Q1VA 2O0VA 3S93A 5DS9A 1LE8A 1MSFC 1AHDP 1UMKA 1XCBA 3DF8A 2D1VA 3ABMH 2OU2A 1O3QA 2W85A 1F5TA 2GIVA 2VFMA 2W00A 4BXFA 3GFJA 1FLIA 1MD0A 3JQRA 1YG2A 1X3WB 3A4CA 4NQWA 1FSEA 1R5ID 2QF7A 3K6GA 1XMKA 1ZTRA 4EM0B 1W36C 4FK8A 5B66C 2QTZA 2DK5A 4TV7A 1QUFA 3PUBA 1W5SA 3V8JA 5ILUA 1CNEA 1DUXC 2P5VA 3KP4A 2CQNA 3GTOJ 3OOUA 2FE3A 3TOAA 1OYIA 4AWXB 2E2JJ 5HLTA 3CC4B 1BC7C 4IHYA 1KTWA 3DCFA 1O8GA 1WCMJ 2IXSA 5E8GA 1QCXA 3OYMA 1AWCA 1T6SA 4IXAA 5A2QK 2INVA 2Q1ZB 3NARA 5H2FC 2KISA 1V0EA 1FSHA 4N3GA 2QX3A 2BYVE 1Y39A 3SEJA 3DTIA 5TRDA 2AQEA 4A3BJ 4KITB 4RA2A 4PJLA 4ZYDA 1Z0XA 2IEKA 3BG9A 5LEJA 4ZYEA 1G3TA 1FBQA 2HI3A 2JA6J 1B1BA 3AKZA 3WYAA 4P1VA 2WV0A 1WOPA 4HEA2 1WPCA 4G9YA 1B4AA 4IVNA 3FK6A 3AVVA 2O0WA 2R3SA 5KVRA 3L2QA 5GV7A 4MTDA 1PP7U 5F27A 4EW9A 3W6KB 1HXDA 4BJTA 5EYRA 4RD6A 4XOPA 4M3EA 1I39A 2ISZA 3TH0A 1I3AA 4JX4A 1TZLA 2V7XA 1VQKI 1OYWA 1VZ0A 1XMXA 4KYWA 2F1MA 4LFUA 5D4RA 2VOOA 5EEGA 4YAUA 1YE9A 1E3ZA 4UB8C 2XDVA 1LEBA 1JUSA 3N05A 4YIRX 3D5SC 2B7EA 4XR6A 2QZAA 2FRHA 3PETA 2FMYA 2Q2EA 1TLHB 3P9CA 5EGOB 2CJJA 2H8WA 1ZRFA 4XLFA 1ZN2A 2JN9A 4M1KA 3OKXA 1DP7P 1WH7A 2ZCWA 3SKBA 4Z6YA 1LKXA 2DFFA 3CZ6A 4BL0B 4KKTA 2ELJA 2P7CB 2HXOA 3BG5A 3ML6A 1W9XA 1D1CA 2HQAA 1P4MA 5CVUA 5M5WJ 2F5EA 3SLDA 3LNNA 3M8FA 2H1KA 3K4BA 3BZCA 3HRUA 1YLOA 1DBGA 3KZZA 3OPOA 3WTVC 5DNSA 4B3GA 4U4BA 4NC6A 2NTPA 2VQCA 1KU9A 3S1MJ 4H4KC 1QVTA 3E5UA 1W5CC 1KK2A 4YXWA 1WGXA 2CW0F 2JA5J 5LRSA 4UVAA 3KYCB 4YZAA 1DABA 4IRGA 1I6HJ 5CQEA 4HYEA 3ZSCA 3KZIC 2V6CA 3HRMA 2A05A 1XB2A 2RKHA 3WGGA 4P6YA 1VQ4B 4OIRF 2XRLA 3L1PA 5JLWA 1FNNA 2BXYA 5FLVA 2YWHA 5HDKA 2EWNA 5EZGA 3RPQA 1EF4A 4BYYA 2HZTA 5J6XA 4AC9A 1MMAA 1XMAA 2IGOA 4FETA 2VYQA 3U2RA 4S04A 2ZL6A 1K83J 2W48A 4Z4YA 2DY1A 3V7RA 1Z1DA 3ZQHA 3F72A 1R5BA 1PE9A 2XTWA 3A35A 3SJMA 5K5OA 2ZBUA 2IA0A 2F4NA 3GLXA 1G7TA 3Q9SA 5EG0A 1W0JA 2EFQA 2XRNA 3WE2A 5E3MA 2WAQN 2NSTA 2CW5A 1L3LA 3GBGA 2XAQA 2Y2ZA 3VO2A 2OTJB 1E3HA 1X3UA 3FJOA 3A01A 4M6XA 2DA6A 5FO5A 1YQAA 2ZBVA 1FP2A 3LSMA 4M6YA 4DBRA 2D3LA 3RTRA 5D8LB 3LSIA 2K86A 4AC0A 3MKWB 1LVKA 2QQ9A 1DGRM 1O8EA 3ZQLA 3OYEA 1Y6IA 1YJ9I 1QFZA 5JVGF 2X85A 1HDDC 2BMWA 3ZN1A 3W2EA 2XGXA 1WKMA 2DO7A 3D1NI 2D74A 4YCQA 1BI0A 1SMYF 3OR2C 4UUSA 5DSZA 3COAC 4RGSA 4RM3A 2VZLA 5CYVA 2RV8A 4M9ZA 3ML3A 2WB1A 1QPMA 4XRMA 3QWLA 4UAJA 3OYDA 4YIIA 1USTA 4PFOA 3CCJB 1OFMA 4YRVA 1FZPB 3SUCA 4CZCA 3W2VA 2D45A 1KK1A 2O04A 2EWEA 4KIBA 1VQOB 3WBKA 2EFOA 4XNFA 2KVOA 1T33A 1K8AD 2IS6A 3I1FA 3RCOA 1MKMA 5J47A 2DODA 3EPZA 3H36A 1JUPA 2EQRA 4FISA 3SZPA 4WWCA 3JR9A 3K70C 1OCTC 2J8IA 1X58A 3ZBUA 1ETXA 1Z7LA 3MWMA 5ICGA 3EQOA 3G3ZA 2X4HA 2RAEA 3CP2A 3S32A 2KRHA 2Z99A 2R5ZA 2H09A 2PYGA 3B8HA 4LBWA 3CCSB 5CVJA 2ZZEA 1VQ8I 4RCZA 3WG7H 4C30A 5B1AH 1N8RD 1E1RA 2QN6A 1ZAOA 1Z6RA 5FD6A 3WTWC 1S9HA 2R7OA 2Z6BD 3BR3A 3VYTB 1HW1A 2F2EA 1U5TB 2OBTA 1R5GA 4NBSA 4PC2A 3VSUA 4U88A 1T0FC 3GVKA 1VQ6I 2I8DA 2XT2A 2GOXB 4D5FA 2HYGD 2ID6A 5HLIA 1FX0A 2RREA 3VPRA 1GDTA 4OZYA 4GXOA 2YWGA 4ROXA 3CCMB 1B8IA 3MMPA 1IRGA 3FXQA 3VYUB 5LEKA 2ESHA 2FU4A 2XT4A 3GF2A 4X6AJ 5TJJA 1KCDA 2L4MA 4AYBA 1REPC 1R4NB 3OYGA 4RLZA 5TY0A 2VASA 4UVCA 4ITVA 5ICCA 1MSEC 4F92B 1UAAA 3HPGA 1RPWA 2EFNA 3RPUD 5KAFC 4X0CA 3A3BA 3UW0A 3HJEA 3OYBA 4CYCA 2M4KA 2ZJRF 3I56I 1LDKB 4XLAA 4IRHA 1W5TA 3OS0A 3CJNA 4A6EA 4CGZA 4DNRB 3RKQA 4CSWA 2LMDA 2DU9A 2VQLA 4OINF 4ESFA 3BR2A 2GXAA 4P25A 2IQ7A 4EJVA 1K78A 5FRNA 3DTEA 1ITYA 2B0LA 2TDXA 1GXPA 3CCYA 3I54A 5FKMA 5ILSA 1N06A 4ZYHA 1LLZA 1Y56A 4YAFA 2VFQA 2PLFA 4OOXA 3GXOA 3BOQA 2DJIA 3SFIA 4PMHA 5F04A 2DFEA 2WR8A 3NWTA 4N4OB 3H09A 1YI2B 3GCMA 1PJRA 1KONA 3DWLE 2KMUA 4IJAA 4L9VA 3GUDA 4EJWA 3EDPA 3U6KA 2VBMA 2BSPA 1R00A 3CUOA 2IP2A 4RS8A 3Q6QA 2F5VA 3I55B 4BY1J 3W6VA 2CK3A 3FXJA 3KYLA 3AG4H 5LLQA 1UMQA 4JBAA 4KMUX 4CYCB 4KMFA 4BQNA 4L5EA 3SFZA 1HZEA 3ZPNA 2ZKZA 3M8JA 1KZHA 4FHTA 2BVNA 3CC4I 1NDHA 4XKBA 3TO9A 5BOXA 3GRHA 3FZVA 4CCLA 2QEXB 3M8EA 2NT6A 1RC9A 2GAUA 3BP8A 4DQLA 1R23A 2BW3B 4E7IA 4OJLA 3ZUGA 1EFUA 1JHFA 4Z06A 2M30A 2Z3YA 3MMYB 3FBNB 1JKQC 2DQRA 2FSWA 1Y8QB 2M5WA 1RMGA 2VBUA 3ZMVA 2IW5A 1T6ZA 2JRTA 1WU8A 2IA2A 2PE3A 3B82A 4BBSJ 2DA2A 4XRFA 2K9NA 2QKLB 3BCFA 3HL2A 3DKXA 3RPUA 3FF5A 5FKOA 2FBIA 3TO6A 4RB3C 1PJ6A 3SJPA 1VF7A 2DPUA 1ZKGA 4R1HA 3AGQA 1LJ9A 4NBQA 3FY3A 5E1ZB 1IUYA 3PO2J 4EH1A 4FE4A 3NAWA 4UUTA 2FJ1A 3KP3A 4NCNA 2HQ5A 4Y52J 1TBXA 4F93B 4ENJA 1YIOA 2L9NA 3QP5A 4L0YB 3H92A 5DM7F 4Q5SF 4A3EJ 2JK3A 2D5VA 2VE9A 4P96A 4LB5A 3GTGJ 4HX7A 3WU0A 4U0WA 2VT3A 3K4CA 4M73A 4DYCA 3OJWA 5IK2A 4PFPA 4Y4RA 1KC8D 1MGTA 4ZTFA 3QPHA 1YRNA 4YEIA 1CNFA 2KZVA 2VBWA 3BPXA 3EUAA 4UVBA 1PUFA 3CD6I 3HOYJ 2M0MA 3E6BA 4YEJA 3VMFA 5AMVA 2XNCA 4PGHA 1K61A 3OIQA 1O8LA 1Y8RB 3AVXA 3ERMA 1JKOC 2JSCA 2ZL7A 3HEFA 4W8QA 2HDNB 4GYIA 2R92J 4II3A 3W2WA 5C1CA 1FTTA 2R7QA 4A12A 4YFXF 3OZWA 2NS8A 2KKOA 5HZAA 3OYLA 4MFEA 5GV8A 1WVRA 3GZ5A 3A0HC 4IQ4A 2ZJQF 1KTVA 4OPSA 2WYRA 3CPWB 5FGMA 4B09A 1PP8F 1E62A 1L0OC 3GTJJ 3RYPA 3D26A 2H6BA 2WV1A 3U6BA 3LFKA 1Y1VJ 3OE7A 2BY3A 3P9KA 2P81A 4AIKA 3A02A 3GZNB 1HKTA 1WFXA 3F0CA 5JLVC 3BG6A 1T08B 2OJED 3OR1C 3Q39A 3HOZJ 2WC2A 1F4KA 1U5TC 3FPKA 1MDMA 3BTIA 3H5RA 1XGMA 4XOTA 3AL0C 1GXQA 3ZC3A 1FYLA 1QZEA 1XN7A 4OPWA 3LSJA 1BBYA 1QQIA 4ACAA 2AS5F 2ELHA 2DOGA 3S2DJ 4OIQF 2EA2A 1VQ5B 2DI3A 1VQMI 1WTHD 1YJ9B 4RLFA 1T6XA 3LSTA 1YW9A 2VBXA 1XSDA 2JN6A 2EZHA 3B6CA 3BG7A 3SEZA 3LAJA 3KE2A 5LGTA 4FE7A 4CUGA 3DPUA 2O7OA 1LDDA 2V79A 1X4PA 2QCOA 4OOIA 2NVXJ 3U21A 2LY9A 3VODA 3NEUA 3GTLJ 1TVCA 3AG3H 4ON0A 4F55A 2PI0A 4XSZF 3VNVA 4LIVA 5IY5H 1SKYB 4ZTJA 5K7FA 2BHYA 3BR1A 2R4GA 3MN2A 5GAGJ 3N4MA 2K02A 3LFUA 2DA4A 1J09A 5D5XB 2WPDA 3FIWA 1I50J 5H20A 1D2EA 4PSXA 3B6AA 1VQLI 1RKTA 3CMMA 1STZA 3GTQJ 3QE2A 3ASRA 3ZMSA 4NDLA 2LLKA 2DOFA 3M1EA 2V4DA 3QU6A 3GFLA 3F21A 2V1UA 1MBJA 3GIRA 2FF4A 1A8PA 4DJAA 4I0AA 5L3BA 1U2RA 3JW4A 1WRJA 2GQQA 2WAQA 2DT7B 3VYSB 3LMWA 3ZBTA 1UD8A 3GSIA 4HDUA 2LKXA 1B9NA 2XTXA 2CGPA 2RQPA 2XF6A 4QVAA 1IN8A 4IQJA 1TYUA 3MD2A 2PMZN 5IYBJ 1SD4A 2ZJPF 4OU0A 1O8JA 1K6YA 3IHUA 3MFKA 4RJLA 1NG7A 4BQAA 4YAWA 2HZDA 3QU3A 1SD5A 1F1ZA 1IW7F 3I53A 3QOPA 2HDCA 4HG2A 1UD3A 5M3MJ 3CCSI 1QRBA 2HVSA 5IP7J 2P8TA 2VPLA 2D3NA 1POGA 1X19A 3MEXA 4ZV4A 2VPRA 3ZQQA 1VLYA 1V4RA 2R6HA 1XSXA 1BPLA 3TKYA 1TT5B 1QG0A 3G6EB 1EH6A 3G1OA 2O9LA 4YZXA 3L2WA 1C0WA 3BG3A 1OOCA 3CP8A 2HLDA 3K4LA 2EV0A 1USSA 4O3MA 1G3SA 3LMMA 3LQRA 3FM3A 4L9JA 4ZJZA 4X7CA 4LGWA 3LA3A 3JRIA 1IZ1A 1MW7A 2DCEA 4C3HJ 5IT9K 3FKSA 2A61A 2C5HA 1RQPA 2UWMA 3ZMZA 5F1JA 1B2RA 2A3SA 4PUSA 4G7HF 4PC7A 4II2A 1RNLA 4X8IA 1CGPA 4GCVA 4RMNA 2W6IA 1NB9A 3QYBA 3G2BA 1SKQA 5JFRA 4DOZA 4LLNA 1YFHA 1DPRA 1RKWA 2E5ZA 4OJOA 1ZK8A 5FROA 2F5FA 2INUA 1WJDA 2CUZA 1H0MA 2K9QA 2I1LA 4DYRA 3VDXA 5E8IA 2ZC2A 2QSHX 2NPFA 4E7ZA 3GMEA 4RB2C 2BZTA 4L5IA 2FD5A 4J0QA 3I55I 3CJTB 5F6FA 1IV6A 4HZFA 2FBHA 1F9NA 3K1MA 1WSUA 4OAZA 3J80Z 2HWVA 3WNCA 1JA1A 2VNKA 4P9SA 1HG8A 5FNZA 1SFUA 1RQRA 3WU1B 4HLYA 3HYIA 3SDGA 2GQFA 4WXDA 3PUNA 4M72A 3S3MA 2RVCA 2P6SA 2K27A 5E1XA 1U8RA 2JQ7A 1TWHJ 5BNGA 1UHSA 4URRA 3S14J 2DIEA 1O8FA 3U2QA 2DYIA 1ZGAA 4J01A 4XLPF 1R5OA 4R71A 2VFNA 2CNDA 2QYOA 1K78B 3QOEA 2KRCA 3E6MA 1QGPA 1G8XA 3ZRGA 1R71A 1HKSA 2OQRA 2OBSA 1H9TA 2MH2A 3MVPA 2CRVA 1QVGB 4LC0A 2CQXA 1ZQ3P 3D5RC 1RUOA 2V6EA 3T9GA 1QBJA 3N90A 1J9ZA 3TW7A 2IAIA 4P1WA 5JHUA 5M3FJ 4MFDA 4S05A 1G6NA 4R79A 2G7HA 1WSVA 3JRHA 2DMTA 1OCOH 2H6CA 3ERED 1QFJA 1YIJB 2VJIA 4HNTA 2VXDA 3ZP5A 2NRAC 1IG7A 4Z4TA 4UV8A 4A6DA 3BTLA 4NNJA 3Q38A 1OR7A 2XGJA 3JREA 1H8HA 5AN9A 4I7HA 1QRCA 1ELOA 4UZFA 4LBVA 4OMYA 2VBZA 3JX8A 2EPFA 4UUVA 1LLWA 2P5KA 2J8KA 3I4PA 4IW3B 2RNJA 2Q6OA 3VB2A 2VOPA 1BW5A 1LUJB 1V5FA 3OYAA 2PECA 4C3JJ 3EUHA 5JI6A 1P9QC 2JJ2A 4RAGA 2W6JA 3NRVA 3KEYA 2CFOA 4N9IA 4HX4A 4ASNA 1YX2A 3HOSA 2QE7A 2E1OA 1OGIA 1JHHA 3FM5A 2C77A 2M8GX 1H89C 2KIMA 2LKPA 4EEFG 2GK7A 5HZBA 1MMGA 4BU2A 4M3BA 2X6YA 5JLXA 1JXSA 2IA1A 2YU3A 1GV2A 1ZARA 1QGAA 2GREA 5LRRA 4QFMA 5A89A 2G7UA 1A35A 2BM6A 2CMPA 3PA1A 3NB2A 2XAFA 1T95A 5D6FA 3P27A 2BGCA 3VEPA 3QQAA 1IV8A 1TW2A 3CCEI 2UXXA 3CF2A 1VQ5I 1DP3A 3S2HJ 4NC8A 2XPUA 3CO6C 4I2OA 2MYSA 2Y0SN 2KJBA 4E7HA 4CYDA 3EQLF 5L3CA 2EV5A 3I64A 3PENA 3SYTA 9ANTA 2BM1A 5H6RA 3CCUI 3CJRB 3TL4X 3VSTA 2DA5A 5FB2A 3QPSA 2VLAA 2BM7A 2QVOA 2XPWA 3LA2A 5FO0A 2YWFA 3FXKA 4LIUA 1SVMA 1BR1A 4JMQA 4LBZA 3JURA 2O03A 2K9LA 2M3AA 3BH4A 1VQNB 3VSLA 2ELKA 4LLGF 4L8JA 2W84A 4JP0A 4X0GA 3P5JA 5KW9A 2CW8A 2DMQA 5IT3A 4KT6A 1MBGA 2HS5A 1FOKA 5IYDJ 1GUUA 3KRGA 1HBXG 4PDKA 5LHIA 3JAMK 3GFIA 2E1BA 1OB2A 2JUGA 1BHEA 3HIFA 3IUOA 3HKZA 3KP2A 4BACA 4WK8F 1BA5A 4ABZA 3M4OJ 1Z3YA 1D5YA 1ON2A 1T56A 1TLLA 2R5YB 2LZJA 2VNJA 2MFZA 1LNWA 2LBFA 1QVFB 2CW7A 4U87A 1APLC 2MLKA 3LQEA 4AM3A 3LA7A 4KDPA 4Z4RA 1UZCA 4XKWA 5JBQA 2YPRA 1IXCA 3AVTA 2Y30A 4YELA 3PNYA 3ZMTA 1PDNC 4RD4A 3CMEB 5BQTA 4C2LA 1LFBA 4XL9A 4PC1A 1QU3A 5HNHA 4CXFA 1JNYA 2E71A 4OMZA 2EFWA 2QWWA 2B7BA 3CC2B 5J35A 2KIUA 3H3VK 4P3IA 3DEEA 3VR6A 2CH0A 4RAFA 5F4MA 2G0EA 1SMTA 1SC7A 3HKZN 5C44J 1JJ2B 1ETYA 2K9SA 2R7FA 3ZQ7A 1O7FA 3E97A 3A01B 3H1CA 1CQTA 2XGDA 4ZDPA 3J81Z 1K28D 2BGIA 1MBHA 2QEXI 1R5HA 2LNBA 4D7MA 2M87A 4WCGA 2DW4A 5AIPA 4F7ZA 3JQQA 3T5XA 3OL4A 4AF7A 2O3FA 4CQJA 3BCDA 2XV4S 2XF7A 4ENMA 2B63J 1OPCA 1E17A 1BJZA 2UV1A 5DS0A 1KCCA 1FBUA 3LNQA 1NK3P 4BXXJ 4MHGA 5K1YA 3N97A 3F8FA 2HGCA 2GXGA 3BH7B 1NTCA 2K4JA 1Z7UA 2GZWA 3MHPA 1Z91A 1S8NA 5GAEJ 1SFOJ 1G2HA 3KFWX 5LFAA 3RIQA 3C2BA 4D7NA 3REOA 5GTHC 1N07A 3OZVA 4F3QA 4C2TA 1P4WA 4C9YA 4Z4UA 3CC2I 4UXNA 1N78A 4RBOA 3RYRA 3LSGA 2QUFA 1W0TA 2R7XA 1F43A 2ZITA 4M0LA 4LITA 4I84A 1D3YA 2C4UA 2IS2A 1S7AA 1V55H 2BM0A 2L0KA 2VE8A 1VQPI 4WQMA 3WQZA 4CCMA 1EV7A 3MKLA 1DQUA 5AIQA 2CRGA 1S72I 3BPVA 2IT0A 1X0CA 1OFCX 2YUSA 1ZG3A 2DYSH 4HNVA 2E1MB 3H9QA 1AOYA 2DK8A 2L54A 4EVIA 3W2HA 5GP9A 3HUGB 3QSYA 1UJ8A 3JTHA 2GA1A 1WP6A 2HTSA 4RGRA 2C2WA 2NTQA 1MDMB 2CBXA 4BE0A 2ZMEA 4PK4A 1QVUA 1TW3A 3Q6RA 3BJAA 1FNDA 2F5DA 3K4MA 4B3AA 3ZZTA 2WJVA 5LHGA 4L0ZB 1A5JA 1D8JA 3E1YE 1FOYA 2BY0A 2M0CA 3ASPA 2MBFA 3PNVA 4RGUA 4IEJA 3ZCOA 1SD6A 2EBIA 4TN1A 2O17A 3HUGA 1DU6A 1V5GA 3LSRA 2R93J 3EQNA 3RQ4A 2C5BA 4XLEA 3H35A 4GGGA 5EJCA 4ZCIA 4DK0A 4CCJA 2WSSA 4PJNA 2V7VA 4G7ZF 1ZLJA 5J8CA 1PLUA 1KU3A 1BOBA 2JVHA 4I76A 5GTIC 2HPIA 3C2HA 4FX4A 1FT9A 3CCLI 1B9MA 4IHXA 4FASD 2NOJB 4HE6A 2V1NA 1M90D 2HVQA 4I6ZA 1YHQB 1EKEA 2DT6A 5ED4A 3VNUA 1TWAJ 1ZRCA 1KQ9A 5FA6A 3DFGA 3KP6A 3I71A 5EEAA 2R7UA 2NYXA 4LG3A 1OHHA 2QDXA 3OFNA 1HF2A 1T8IA 4HX8A 3Q5FA 2JA8J 2O8XA 3HSEA 4LK1F 1KK3A 4I09A 5H59A 3TDUC 3BDDA 1HC8A 4A3LJ 2PEXA 3GX4X 1BC8C 2E2HJ 2GJPA 3K2AA 5TISC 3J7AY 2KHMA 4CO8A 4A0ZA 5HDGA 3IH2A 4KUMA 1UFMA 2COBA 3DV8A 1OKRA 1S7EA 4H0EA 4M53A 2CS3A 1WH5A 5CVRA 2VKVA 3BR0A 2PMZA 2F1LA 2GJKA 3C2GA 5D4SA 4XRSA 2C6YA 3OOCA 1BQEA 3A8JA 3WXMA 2R7VA 1IF1A 3DPLC 1X1PA 4Y33A 5E1WA 1G59A 3AL0B 1B59A 2JA7J 3GQ7A 2JUCA 4IX7A 1IJWC 1JKPC 4HV5A 1W7PB 1KYWA 3IKTA 5CVIA 2EZIA 3Q0UA 1O88A 5LGUA 1FYMA 2VUMJ 4HDVA 3LWFA 5IP6A 1W0KA 2VNHA 4RPDA 1QGYA 1Q1HA 1V5VA 1BI1A 3CCEB 3CUQA 2DPDA 1N0VC 2HQNA 2OF7A 2BW3A 1YJWB 4LLLA 1R1UA 1H88C 3DU6A 1I8DA 4YZ0A 1W7PA 2XASA 1XGNA 3FXUA 4OAYA 5K5QA 2Z9OA 1S3JA 1X4OA 3K10A 3HB9A 4IOAF 3KPHA 4EATA 4BS9A 3KYDB 2P0WA 1BN5A 3FXMA 1WDTA 2CQ7A 2XROA 2X0LA 3D0SA 2DAOA 2OYNA 2HU9A 3R0AA 3PVDA 1Y0YA 3E5QA 2NVQJ 2X1CA 1W1WE 2A69F 2TCTA 4BH9A 3HDDA 1Z77A 5ICFA 2X3UA 2HOEA 4OPOA 3CCRB 2ZZGA 1OCRH 5ICEA 1D1AA 1TYWA 1TC3C 4HBLA 2WA0A 2XEXA 3OSGA 3JRBA 4RDJA 3S15J 3F8CA 4P55A 1G3WA 4G6QA 2C78A 1CLWA 3CC7I 3GVAA 1OLTA 1ZYRF 3PSSA 1K5CA 1KU2A 2IGKA 3FMQA 1PJ7A 2XVCA 3PSZA 4L18B 3V4GA 1HLVA 1VLOA 5D8KB 2VBEA 1AIPA 1IDJA 4IO9F 2ME6A 1OMIA 3A8KA 2W1OA 2OK8A 1YITI 1ORKA 2WWYA 2RC6A 2PMUA 1ONVA 2WJYA 2DOAA 3UNGC 2YS9A 3GQ8A 4IHTA 4LBYA 3RDIA 3ZMDA 2CYYA 1FYKA 3PQJA 2BGJA 1I3QJ 5E3OA 4XLNF 2GBYA 1YW7A 3B73A 4LK0F 4B4CA 3BQJA 4U9UA 4DIQA 4E7LA 4WXCA 1JA0A 4OIOF 1S6LA 2VKHA 2HR3A 3ASOH 1O3SA 3ISPA 2AO9A 1HDPA 4X7EA 2STTA 1W7PD 2A5WA 2DJNA 1PVEA 3HC7A 1W0UA 4OWRB 4BNCA 2OBRA 1JTXA 1DPUA 4E7KA 2XZLA 4YG2F 2XB0X 2GLOA 2MG4A 2WZNA 4PJ0C 1F20A 4OJ6A 1UHMA 2UVFA 1JGSA 3CCMI 4KA4A 5BS6A 4W8RA 3FX3A 5L3GA 1K79A 3GVJA 4BPRA 2EIKH 1FOWA 2FOWA 4HNUA 3CDLA 4J19A 1UB9A 4HF1A 1VJSA 2ZZFA 1VHOA 4CH7A 5EDNA 5IT9Z 2VJ5A 1WZ2A 5HXBA 2A68F 3BJ6A 4Q4ZF 1DU0A 3KP7A 5LBQA 3LSPA 1SFEA 3DEUA 1TYVA 3Q0VA 3U1DA 3SY2A 5J4YA 3HOXJ 2CV0A 2EILH 4M2LA 3DLAA 4DYQA 2J7KA 1DDGA 2IS1A 3BR5A 1D1NA 1Y0NA 2NVYJ 3IWFA 4F52A 4DW6A 3GTMJ 3LQ6A 3TBIA 3G4SI 3OMYA 1TL8A 3JQPA 1UCRA 5E18F 4G6IA 2MC4A 1VQPB 5A8AA 2E60A 4UUSB 3VWBA 1LFPA 5JVTA 2QZ8A 2DOEA 2LK2A 1IB0A 2VIXA 1IN4A 2E2IJ 2H27A 3ABUA 1EP3B 3RJPA 2VN2A 1U3EM 3T51B 3BCAA 5CVVA 3ULQB 1G7SA 3SLNA 3CF5F 4ZDOA 5GPCA 1DARA 2O6WA 3P4GA 2LRDA 2QLZA 2P5LC 3M9AA 3ONUA 3AVWA 2VXZA 1QFYA 1AA7A 1P2FA 3WHBA 3IRQA 1XQBA 2EA4A 2HMAA 1XG2A 3MCZA 4N0BA 1IHMA 3H3ZA 4DZPA 1O3TA 1RETA 2HTJA 3I59B 2DXIA 2OAZA 4DGWB 3BT9A 5F64A 1UD5A 2TRTA 4P9UA 2V7TA 2DFHA 2V4JC 4JX5A 3I4MJ 1EXMA 1YS6A 2LH9A 1TT0A 2K4BA 2VBVA 3CCJI 1F36A 4ZGQB 1TP4A 2NS0A 2K5CA 5HLHA 1IJFA 1QGZA 2JJ1A 3ISXA 3V7AA 3G05A 2EFGA 1YHQI 1J9IA 1HSTA 1U0JA 4RM0A 1T5EA 2WY8Q 5J40A 2VQHA 3CCVB 2ME0A 5FL7A 3SQVA 3CCLB 2CSOA 5FLXZ 4PJMA 2VC1A 1VFCA 4ZZLA 5HODA 3TW6A 3E20A 1OFDA 1WXRA 3A8IA 2XAUA 3KLOA 5DV5A 1V5EA 2R5YA 2WAFA 3OYCA 3JRCA 2GOMA 4PZJA 3QFTA 3WTXC 4P6VF 3GFMA 4X1EA 3DBLB 3J7AO 2BM5A 4BKXA 1EA3A 4RD2A 3EUKL 1QO0D 1XX5A 3PFIA 2OTLI 3A1PA 3W5VA 5J3OA 3PM1A 2NSPA 3TOBA 2UVEA 2A6EF 5J4VA 1TTYA 4G94A 4HLXA 3N6ZA 2ECCA 5J3LA 2ZFUA 2DMPA 1BOAA 4CCOA 3CMYA 1TWCJ 2XGEA 4AVPA 1OFEA 4C0SA 4W8TA 2EFPA 4UNOA 1NK2P 3J7ZI 1SAUA 2Z1DA 1V0FA 2HFHA 2LKSA 1O7LA 2E35A 2W24A 3OYJA 5L3EA 2G9WA 3BY6A 1OCZH 3CUQB 3MKZA 2JRMA 1KQ8A 2LG4A 5DCFA 3DXJF 3FXLA 3H5NA 3VYRB 4A93J 3WTUC 4OP7A 1VQ8B 3L9FA 1J75A 2GK6A 2JPCA 3LAPA 4HSTA 5DEQA 3T1BA 1JJ8C 1GVHA 4UY8I 2MD5A 1JGGA 1D0YA 3I56B 1O8HA 5E79C 4EJOA 4QPOA 2E1MC 1HF0A 3AG1H 1U5TA 3DKWA 2QA4I 2PFBA 2F43A 4RGXA 1R9TJ 2LSOA 1JI8A 1WOOA 1OGMX 3LO8A 4EV0A 4Z4SA 1WPKA 4GRIA 2R7WA 2HKXA 4OOSA 2L7MP 3W2IA 4XLCA 4BGDA 1K7AA 4MXNA 3F8MA 4FCYA 4BHPA 5DN6A 3BNWA 2L9VA 5DD4A 1FX7A 1D8TA 1H42A 5KSWB 1ETVA 1GAQA 2OK7A 4M3DA 1LB2A 1FEXA 3KL9A 3G71B 2ETHA 2LC2A 4I01A 4GO1A 4ETSA 2R7ZJ 2ZXIA 2IPQX 1I1GA 1D0ZA 4O5VA 2CUFA 1CQXA 1I7PA 4R8HA 3BZ6A 1A6IA 1R7JA 2HKOA 3F9KA 3ZQIA 1YJWI 1EZGA 1MH4A 1OR7C 1L1IA 3HAGA 2PN6A 3VFZA 1YTYA 1B72A 3MCAA 4M4SA 3DU1X 1PJ5A 1HSJA 2C4TA 3ES9A 1Q81D 2EINH 1NB0A 1ZM4A 1TTTA 1PYVA 2IBDA 2D2WA 1T0FA 3B78A 3S3NA 1YI2I 2BHZA 4E0FA 5J8FA 2STWA 4XSXF 3QPTA 3IH3A 4MEYF 1TQMA 1X2NA 1EP1B 2ZMEC 1P7IA 2MD0A 2V9KA 1XTAA 4YZQA 3O8HA 2VQGA 3CXCB 3R0JA 5F08A 3WBJA 2L7ZA 4PGGA 3ZQGA 2D9RA 4XD7A 1EA0A 4P26A 2WTEA 2ZSIB 3J81k 4RD1A 4A3KJ 2BY1A 1FWZA 1LE8B 1QUEA 3W2GA 2LOOA 1X1DA 3H3UA 1COWA 3RKYA 2BE5F 2QTLA 3OOPA 5KK1A 1T39A 3OEEA 1KQ5A 2K9MA 2XF5A 2FXAA 1JRGA 3UR3C 1S72B 3SZEA 2JMWA 3IC7A 3AVYA 2DDAA 1IXRC 1T98A 1ZM3A 5F0FA 2Y75A 2DYRH 2O8KA 3E0JB 3AFHA 4ZZDA 3ONYA 3R61A 3Q9VA 3L2RA 1OCCH 2NZMA 2VJ4A 1JB9A 3LQQA 2X3HA 3BJOA 2B7CA 1G7RA 5FKNA 3HG9A 2Q0OA 1ZUNB 2JT1A 5B5EC 3JRGA 2KZGA 3I9V2 1WHUA 2KLOA 4Z03A 2LR8A 4RAZA 2LFBA 4HRIA 1KMHA 4FWTA 1IUFA 4GDFA 4WXHA 3CD6B 1IXSB 4CA0A 2QBYA 2I10A 1VNDA 2XAJA 2ACJA 5DTDA 2QSGX 4XN3A 2NNNA 3CB4A 4M9XA 1OB0A 2MH9A 4G7OF 1IRFA 2VL8A 3ONQA 1NHAA 3V8KA 2XHKA 2ZXJA 3GTPJ 2ODLA 2DETA 4XQFA 2R7RA 1JT6A 3QFRA 3W2FA 1N75A 4HWVA 2QBYB 3F8BA 2VT2A 2EZKA 3ZN0A 5HOOA 2BSAA 3CDIA 2MGQA 3FKJA 3KX2A 1YIJI 3MQ0A 1AU7A 1VHEA 1OQYA 3TGNA 2V9VA 3GEZA 2HPMA 2ICWG 3FDYA 3HTUA 2Z16A 3GWZA 2X6OA 3QODA 4HPQA 2NXNB 4DK1A 2W57A 3FK7A 2VKDA 2EZLA 4BJ5C 1RRJA 1FJLA 5CJ9A 4BBRJ 5F0HA 1QX4A 3DU5A 2Q2EB 1FMVA 4UV9A 5EGOA 2LY2A 4N4NB 1J5YA 2HYJA 2MC3A 3UKGA 5ERIA 1J59A 1BMFA 1E3XA 4G6DA 1RIOH 5CLSA 1O8DA 1AIRA 4Z05A 5CKTA 3K2ZA 1BIAA 5TV2A 2Q6LA 3M3YJ 3DBRB 2XAGA 1KU7A 3RY8A 2DA3A 3P7NA 2Y9ZA 1OCPA 2VKEA 1VQ7B 3Q0WA 4ACBA 3WWGA 3C3WA 4NB5A 5A88A 3OS2A 4YDTA 3O2PE 5IP9J 4IHSA 4DZJA 1O4XA 2VODA 5E6TA 3K4JA 5HS8A 1YO5C 5HVQC 2MLGA 3EYIA 1XFOA 4Y3OA 4B44A 2YSRA 4OOVA 1BJAA 2E34A 4EJUA 2PMHA 2QQAA 5ILVA 2HXIA 2QYUA 1Z3XA 1KGSA 4OJ5A 1P92A 1MMSA 2M1BA 1PKVA 3CLQA 3NAUA 3PNTA 1E1QA 5H6QA 4BUPA 1ZR4A 1IO2A 2PJRA 4XKCA 1ON1A 2GJRA 3R6KA 3QYFA 2I5UA 4WZEA 1IN6A 1S29A 1VBLA 1AMOA 3BLYA 4KN7X 4PC3A 5LD2C 2EIMH 2XPVA 4I98B 3CLOA 1BN8A 2FNAA 2QKMB 3GQ9A 2K85A 3EUHC 2CV1A 1TWGJ 1NRKA 2ZL5A 1X1CA 2EH3A 1ZHFA 4I99C 2BM4A 4AUXA 3KEWA 3RKWA 2W7ZA 3PL8A 4Y17A 1JTYA 3V7SA 1VTNC 1JJ6C 1QHGA 4LB6B 2FVGA 4FN5A 4J00A 3ABLH 3ECOA 1D5VA 5EF6A 1ZR2A 4RD0A 2ZXWH 1ODDA 2QQBA 3H0DA 2Q6KA 3I59A 3K7AJ 4A2UA 1W36D 3ECHA 5FLMJ 4KKUA 2B0RA 2FA5A 2QGUA 4L9TA 5HS7A 1GO2A 1P7JA 1IGNA 1OB5A 1XD7A 3E6CC 3ABKH 5K7HA 2AHQA 1MNEA 1WJAA 3HRTA 3LL7A 4Q48A 5J1RA 1SEUA 1B23P 1K6OA 2V1DA 1GHCA 2ZMEB 2LYCA 3O3KA 2O61A 3DPTA 3K9TA 1MBEA 2YX7A 2ZNYA 2JJ7A 1VQ7I 2WY7Q 1VQOI 1LFUP 3CDHA 2VJJA 1BI2A 4G7XA 4F7DA 3O6BB 2L02A 2ZSHB 4Z4VA 3HBLA 1WMRA 2OUMA 2R5ZB 1UELB 4X05A 1YYVA 2E19A 2NVTJ 2ZB9A 4HE5A 1A04A 4AIHA 3PO3J 3WTZA 1Q82D 2AQFA 3HHHA 3J7YJ 3CMAB 4ZYGA 3GLLA 3U1KA 1Q9SA 2QXZA 4A69C 2BF4A 1M1KD 5HNFA 1FTZA 3QFCA 4KH3A 3CMAI 3CQZJ 2V5IA 5L3DA 1HQCA 2L7FP 4HSRA 3ZXSA 3JRFA 5JR3A 1FNBA 3LOCA 1GVDA 2HCJB 4O6JA 2LDUA 2CC2A 1TYXA 2HOTA 3T56B 2X6XA 4OZZA 3W3CA 2H8RA 2LP0A 3ABTA 1VQ6B 5D6EA 2BBYA 5IPAA 1H80A 1E43A 3ZOBA 2BVMA 1ACIA 4CHUA 2CV2A 5F4JA 3KZYA 1OGJA 3CTAA 4LOCA 4AYBN 2H94A 4MYUA 4U7BA 1UD4A 2XNDA 2V31A 3F6VA 1IDKA 1BX1A 3IH4A 5DCMB 2IS4A 4TMTA 1K9MD 3H9JA 4BEHB 1WI3A 2E1NA 1YJNB 3K0LA 1TNSA 4JRAC 3DP7A 2CUEA 2FMLA 3M7GA 1Z67A 1S5LC 1ZGJA 1HW2A 5BPIA 3E5XA 3L7WA 2VBYA 4KIFA 1EP2B 3ZZ0A 4B3FX 4U49A 1VQKB 2MA3A 4RLQA 1UG0A 4WX9A 1W87A 4N9HA 3GQAA 4PC6A 1B6AA 4UHTA 2O1DA
chains in the Genus database with same CATH topology
2ZZGA 1D1AA 3VSKA 3OR1C 2WA0A 3H5RA 4XOTA 4BDZA 3AL0C 1NHCA 2OC6A 2BOLA 3GVLA 1OLTA 1K5CA 3FHNA 2V7QA 1WTHD 2IGKA 4RLFA 3NE5B 2F4IA 3S3OA 3BG7A 3H5AA 3SEZA 3OS1A 2ZTNA 2VBEA 1IDJA 2KP6A 2RQQA 2W1OA 4CUGA 3DPUA 3IAM2 2WJYA 4BQQA 1X4PA 2BVLA 1D0XA 2DOAA 5KCMA 3U21A 3UNGC 3GQ8A 2KDOA 1YX3A 2R7TA 4G7WA 5FRMA 4F55A 5KHDA 4XORA 1E79A 3DQVC 4LIVA 4RM2A 1SKYB 4ZTJA 4DIQA 2R4GA 4BEHA 4E7LA 2F6CA 4BQOA 2QY1A 3LFUA 4E6KG 1J09A 2VKHA 4BJ6C 2WPDA 4TKOB 2Y0SA 4PSXA 2A5WA 3CMMA 3HC7A 4OWRB 3OAAA 4E7KA 3A3GA 2XZLA 2V4DA 4NK6A 4OJ6A 2W82A 4F91B 2UVFA 3ZR8X 3D5LA 4W8RA 3GQBA 3VSVA 3CESA 4DJAA 2V26A 3K4KA 1N77A 1QJVA 3GVJA 2WAQA 2DT7B 5TGTA 3I3LA 3E1SA 3VYSB 3LMWA 2NT9A 2MABA 4B43A 2X51A 4HNUA 1UD8A 2ZZFA 4IKFA 1VJSA 4CH7A 2WAEA 5CPRB 2VJ5A 3BCBA 3A2KA 2XF6A 4IQJA 3MD2A 5HKKA 1O8JA 2JIZA 1K6YA 2X6WA 4BE1A 1BR2A 2CV0A 1NG7A 3DLAA 2HZDA 2IS1A 1PXZA 3IAS2 1WJEA 4HG2A 1UD3A 4OJPA 4E7SA 2HVSA 1WJCA 4F52A 2JSPA 2VPLA 3TBIA 3PSFA 1X19A 3OMYA 2D3NA 2R9VA 3ZQQA 4AU7A 1VLYA 2XZPA 1BPLA 4G6IA 2MC4A 5CQGA 4YZXA 3L2WA 1I18A 2KQRA 5CDFA 2E60A 1OOCA 3VWBA 1LFPA 3CP8A 3K4LA 2HLDA 3L2UA 2VIXA 2OV7A 1OFLA 3LMMA 4ZJZA 3DTKA 4ASUA 1WJ5A 3VMVA 3T51B 3BCAA 3OYHA 3ZPPA 3BC9A 1MW7A 2DCEA 2UUZA 4ZDOA 1UD2A 3FKSA 4KKSA 5KNLA 2LRDA 2UWMA 3OYKA 4G6TB 3HOTA 4QPQA 2VXZA 3M1CA 4PUSA 4CCKA 1AA7A 4II2A 4BDYA 3B4NA 4NC7A 1XG2A 4RMNA 2JDIA 1Z21A 2W6IA 3QYBA 4CCNA 3G2BA 2LY1A 1O8KA 4DOZA 2E5ZA 4OJOA 2DXIA 4DGWB 1ERDA 5FROA 4XM3A 2W4SA 1UD5A 1WJDA 1MNDA 2CUZA 2INUA 2V4JC 3S93A 2O0VA 4JQFA 3VDXA 1OGOX 2LH9A 4E7ZA 1BR4A 1TT0A 4ANJA 2W00A 4BXFA 2JJ1A 2K5CA 2ZZQA 3G05A 3A4CA 3K6GA 4OAZA 1W36C 1U0JA 3OYFA 3PUBA 2WY8Q 1T5EA 2VQHA 1HG8A 4GQNA 5FL7A 3TMOA 4PJMA 3OOUA 1KTWA 5HLTA 1O8GA 3SEQA 3S3MA 2IXSA 2XAUA 1CZFA 1V5EA 1WJFA 1QCXA 3OYMA 2HDWA 2WAFA 3OYCA 3FPPA 3VMWA 2GOMA 2INVA 2Q1ZB 3W2AA 1V0EA 2QX3A 3DKYA 4URRA 2DIEA 1O8FA 3SDBA 1EA3A 3DTIA 3EUKL 2V7FA 4J01A 4W8SA 2NSPA 2UVEA 2AQEA 4KITB 4PJLA 1MABA 3QOEA 2KRCA 2ZFUA 1G8XA 2WADA 3ZRGA 3AKZA 4CCOA 1X1BA 4HEA2 4W8TA 1WPCA 3D5RC 1SAUA 1X1AA 2Z1DA 2V6EA 1V0FA 2O0WA 3T9GA 4FXUA 4P1WA 3L2QA 3OYJA 3MKZA 4EW9A 1R6RA 4BJTA 4B47A 4R79A 2LG4A 4XOPA 1EFRA 3H5NA 1TZLA 3VYRB 2VJIA 1VZ0A 2VXDA 4HNTA 2F1MA 4P22A 2GK6A 1SFKA 4HSTA 2LREA 2M5SA 4NNJA 1D0YA 1YE9A 2L7KA 2X1EA 2XDVA 1E3ZA 3N05A 1H8HA 2XGJA 1O8HA 3D5SC 4XR6A 2XZOA 3OL3A 4QPOA 1DBOA 3PFYA 2E1MC 1NBMA 4XLFA 3NWSA 3OWTA 2F43A 1JI8A 1OGMX 1LKXA 1V5FA 3CZ6A 4GRIA 4BL0B 2ELJA 3OYAA 2R7WA 3OEHA 4KKTA 2PECA 2X8KA 2JJ2A 1P9QC 1D1CA 2HQAA 1W9XA 4DNTB 1O8MA 2W6JA 4XLCA 2VBKA 3KEYA 2CFOA 3HXLA 4ZC3A 4BGDA 1BLIA 3HOSA 2QE7A 3LNNA 4MXNA 2XOKA 3K4BA 5DN6A 1O8IA 1DBGA 3OPOA 2KL4A 4B3GA 4U4BA 2GK7A 2LC2A 1MMGA 2HVRA 2VQCA 4BU2A 2NTPA 2X6YA 4H4KC 2R7SA 2ZXIA 4YXWA 2PYHA 1D0ZA 2CMPA 2ZXHA 3H9GA 1T95A 4YZAA 3F9KA 1D1BA 5CQEA 4ZDLA 4E4HA 3ZSCA 2JVGA 5C1EA 1OR7C 3CF2A 1DP3A 3HAGA 4NC8A 2MYSA 1PYVA 3H94A 4D9JA 4E7HA 3S3NA 4E0FA 3SYTA 1MMAA 4FETA 2IGOA 2XSJC 4MLOA 3CJRB 3TL4X 3VSTA 2MD0A 2V9KA 4YZQA 2VLAA 2VQGA 1PE9A 4XONA 4LIUA 3A35A 4JMQA 1BR1A 3JURA 2K9LA 2M3AA 3BH4A 3A1YA 4XD7A 3VSLA 2ZSIB 1W0JA 4L8JA 2LOOA 1X1DA 3IP4B 5JHFA 4BE2A 2PJRB 1COWA 3ZGKA 3OIPA 2NSTA 3OEEA 4X0GA 3GBGA 2K9MA 2XF5A 1JRGA 2CW8A 1YX5A 3UR3C 1KZLA 4KT6A 3KRGA 3PJRA 2E1BA 2A6TA 1BHEA 2JUGA 2K3PA 3LSMA 3IUOA 3E0JB 3HKZA 4DBRA 4BACA 3AFHA 3RTRA 3LSIA 2D3LA 1Z3YA 1RWRA 3MKWB 1LVKA 3L2RA 2LZJA 2NZMA 2VJ4A 2X3HA 1DGRM 1O8EA 2MFZA 4D1QA 3OYEA 1Y6IA 1GQ8A 4XN0A 2X85A 3HG9A 4NQWB 2LBFA 2CW7A 1DGWY 4U87A 3OR2C 3I9V2 4RM3A 2KLOA 2CUJA 4XKWA 4Z03A 1KMHA 4HRIA 2WB1A 4YELA 3PNYA 3ZIAA 3OYDA 4C2LA 4CA0A 4C2UA 4PFOA 1OFMA 4XL9A 1WJBA 4YRVA 1QU3A 3SUCA 1IRXA 3W2VA 4CZCA 5HNHA 2O04A 2EWEA 4XN3A 4XNFA 1OB0A 3DEEA 3VR6A 2CH0A 2KVOA 3ONQA 2VL8A 4B48A 2ODLA 2IS6A 3RCOA 3EPZA 3K70C 4XQFA 2R7RA 3FBIB 4HWVA 1Z7LA 1N75A 2W7NA 4ZDPA 1HVXA 2IGMA 3EQOA 3CP2A 3S32A 5HOOA 1K28D 2KRHA 3FKJA 2L9SA 3KX2A 2PYGA 4MR0A 2Z2SB 2ZZEA 2HPMA 3FDYA 2M4GA 3OL4A 1E0EA 2Z16A 3OYNA 3QODA 4HPQA 4C30A 3BCDA 2XF7A 4IZZA 4DK1A 1E1RA 2VKDA 1S9HA 2UV1A 2R7OA 4BJ5C 2E5NA 2Z6BD 1KCCA 3DU5A 4PJJA 3HPHA 2Q2EB 1FMVA 3VYTB 2LY2A 4N4NB 1BMFA 3VSUA 4DBQA 1T0FC 3GVKA 1E3XA 2I8DA 2GOXB 2WBMA 1O8DA 1AIRA 1FX0A 2RREA 5CKTA 4OZYA 4Z05A 2M7BA 5LFAA 1FMWA 3VYUB 4NK8A 4F3QA 4C2TA 4C9YA 1KCDA 4AYBA 3OYGA 1N78A 2VASA 4ITVA 4F92B 4HIZA 3LSGA 2FUG2 1UAAA 2R7XA 3HPGA 3RPUD 3WWGA 3OS2A 4LITA 3RSNA 3A3BA 4I84A 3OYBA 3UW0A 3K4JA 5HVQC 2M4KA 2IS2A 4KISA 1LDKB 2JA2A 3WQZA 4Y3OA 4XLAA 4CCMA 4NUBA 4B44A 3OS0A 1DQUA 1X0CA 2NTBA 4DNRB 4CSWA 2WZPP 2VQLA 2Z8GA 1Z3XA 2E1MB 2IQ7A 4OJ5A 5FRNA 3DTEA 3H9QA 3MKYB 3K4NA 3HUGB 3PNTA 1E1QA 1PKVA 4TSFA 4BUPA 1WP6A 1Y56A 2NTQA 2PJRA 4PSWA 4XKCA 4BE0A 2GJRA 4PK4A 1HA8A 2DJIA 3QYFA 4PMHA 3K4MA 1VBLA 2RNGA 3NWTA 4N4OB 2WJVA 1PJRA 3BLYA 1KONA 5LD2C 3DWLE 2KMUA 1BN8A 2QKMB 2VBMA 3GQ9A 4JOMA 3PNVA 3ZCOA 3EUHC 4B3XA 2CV1A 2BSPA 1NRKA 2O17A 1X1CA 2VB6A 1V5GA 3KEWA 3CJQB 3EQNA 3LSKA 3RQ4A 3PL8A 4XLEA 2F5VA 3H35A 1QHGA 2CK3A 3QYEA 3KYLA 4DK0A 4CCJA 1RU4A 2WSSA 4PJNA 4BQNA 4J00A 1HZEA 3H0DA 3ZPNA 3M8JA 1BOBA 1PLUA 2JVHA 4XKBA 1ZELA 2HPIA 1W36D 3C2HA 3GRHA 4KKUA 4CCLA 4FASD 2X1DA 2NT6A 2NOJB 2BW3B 4E7IA 1UD6A 3SZGA 4OJLA 2V1NA 4Z06A 2HVQA 3S8PA 1MNEA 1WJAA 2DT6A 3LL7A 3MMYB 3B8YA 3FBNB 1RMGA 1IB4A 2R7UA 1OHHA 3OFNA 2LYCA 1EE6A 4LG3A 3OY9A 2XC7A 3K70D 3DPTA 2QKLB 2WY7Q 3BCFA 3HL2A 3L2VA 3DKXA 3B90A 1GLNA 4XMYA 3T53B 2VJJA 3PSIA 4G7XA 2ZSHB 1WMRA 2GJPA 2HNHA 2OUMA 1UELB 3J7AY 1VF7A 2KHMA 1IA5A 3FY3A 4UZUA 3JU4A 2KPMA 2CS3A 2AQFA 2PMZA 4F93B 2GJKA 2L9NA 3C2GA 3OOCA 2QXZA 4U49A 4TT3A 5HNFA 2L2OA 2R7VA 1JTAA 1H8EA 3DPLC 2ZTGA 4Y33A 1G59A 3DDYA 3AL0B 2M7AA 3K4CA 4ZYAA 4IX7A 4HSRA 3ZXSA 5IK2A 3GQ7A 4PFPA 4Y4RA 4ZTFA 4P5OA 2KZVA 3EUAA 3BC8A 1O88A 2M0MA 4YEJA 4E7JA 3T56B 2X6XA 4OZZA 1W0KA 5AMVA 3W3CA 3OIQA 1MMNA 2O5RA 1O8LA 1MMDA 4W8QA 2BW3A 1H80A 1E43A 1NG6A 2BVMA 4II3A 3W2WA 2CV2A 3DU6A 5C1CA 1I8DA 4YZ0A 2R7QA 4XLHA 4OAYA 2LBFB 3K10A 1X4OA 3V42A 4U7BA 1UD4A 2V31A 3OYLA 2XNDA 3OW7A 1IDKA 2IS4A 4IQ4A 3H9JA 4BEHB 3LSHA 4EATA 2L5QA 4BS9A 4Z1MA 2P0WA 2IGNA 4AVZA 4KJZA 2X53S 3OYIA 2HU9A 1QHHD 3OE7A 4B3FX 4RLQA 2X1CA 1UG0A 4XKVA 3GQAA 1WFXA 3BG6A 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XON A;  3JUR A;  4PMH A;  1VBL A;  4XOT A;  1NHC A;  1BN8 A;  1K5C A;  2VBM A;  3GQ9 A;  2BSP A;  2NST A;  1HG8 A;  2O17 A;  1JRG A;  3EQN A;  1KTW A;  4XLE A;  1O8G A;  2VBE A;  3KRG A;  1CZF A;  1IDJ A;  1RU4 A;  1BHE A;  1QCX A;  3VMW A;  1PLU A;  1RWR A;  2INV A;  2NZM A;  2QX3 A;  4URR A;  2X3H A;  1O8F A;  1O8E A;  3GRH A;  3GQ8 A;  1GQ8 A;  4XN0 A;  2X85 A;  4W8S A;  2NSP A;  2UVE A;  2NT6 A;  4XOR A;  4Z06 A;  4OJL A;  4XKW A;  2QY1 A;  4Z03 A;  3B8Y A;  4YEL A;  1RMG A;  4W8T A;  4C2L A;  1IB4 A;  1EE6 A;  1OFM A;  4XL9 A;  2O0W A;  3T9G A;  3SUC A;  2O04 A;  2EWE A;  4EW9 A;  4XN3 A;  3B90 A;  4XNF A;  4XMY A;  4XOP A;  2VJJ A;  4OJ6 A;  4NK6 A;  1WMR A;  2UVF A;  2ODL A;  2VJI A;  4W8R A;  3VSV A;  1IA5 A;  1QJV A;  3FY3 A;  4XQF A;  3LMW A;  2NT9 A;  4HWV A;  3EQO A;  1O8H A;  2PYG A;  4XR6 A;  1DBO A;  4U49 A;  2QXZ A;  4MR0 A;  1JTA A;  1O8J A;  2X6W A;  4XLF A;  3GQ7 A;  1OGM X;  1PXZ A;  4OJP A;  1KCC A;  2PEC A;  1O88 A;  1O8M A;  3VSU A;  4YEJ A;  4XLC A;  2X6X A;  2VBK A;  4OZZ A;  5AMV A;  4MXN A;  1O8L A;  1O8D A;  1AIR A;  1O8I A;  4Z05 A;  4YZX A;  4OZY A;  1DBG A;  4W8Q A;  1OOC A;  1H80 A;  4U4B A;  4NK8 A;  2NTP A;  1KCD A;  1OFL A;  2X6Y A;  5C1C A;  4YZ0 A;  2PYH A;  4XLH A;  3VMV A;  3WWG A;  3ZPP A;  1IDK A;  4YZA A;  4I84 A;  3UW0 A;  3ZSC A;  5C1E A;  4XLA A;  3B4N A;  1XG2 A;  1X0C A;  2NTB A;  4AVZ A;  1O8K A;  2Z8G A;  2IQ7 A;  4OJ5 A;  4OJO A;  4XM3 A;  2INU A;  2O0V A;  4XKV A;  3GQA A;  1OGO X;  3VST A;  2NTQ A;  4YZQ A;  1PE9 A;  2O1D A; 
#chains in the Genus database with same CATH topology
 3R4K A;  3VSK A;  1PUE E;  3TP0 A;  3CUQ C;  4RCY A;  3SZT A;  1JUM A;  1XGS A;  1YLF A;  4CIC A;  2FEZ A;  2BOL A;  3HGY A;  4A3J J;  4TMV A;  1R58 A;  2ECB A;  3GVL A;  2P7V B;  3ELK A;  4A5N A;  3FMS A;  2O6G E;  1KA8 A;  4M71 A;  3FHN A;  4YFO A;  1R22 A;  4YHB A;  1YOV B;  2JZY A;  3S3O A;  3BTC A;  1EWY A;  3H5A A;  3OS1 A;  2EIX A;  4KT5 C;  2RQQ A;  2YX4 A;  2XTY A;  6PAX A;  4YFK F;  4ENN A;  3HOU J;  3I4N J;  1IN5 A;  2KT0 A;  3E3V A;  5DDG A;  4V02 C;  3A03 A;  3SYJ A;  2BVL A;  5KCM A;  1D0X A;  5D5U B;  3LVB A;  3HOV J;  4QWQ A;  1A31 A;  2Y0M A;  1QZY A;  1YX3 A;  1R5N A;  4G7W A;  5FKL A;  5FRM A;  3WGI A;  5F0C A;  3DQV C;  2FNP A;  2DQL A;  1E2X A;  2QY1 A;  2F6C A;  4BQO A;  1ETK A;  5AON A;  4MYT A;  4BJ6 C;  1FBS A;  4PAA A;  1F60 A;  2FX0 A;  4XBF A;  5F4O A;  3OAA A;  1JE8 A;  2WB1 N;  5FFX A;  2IJL A;  3TP3 A;  4EGY A;  3LYC A;  1D8K A;  3QAH A;  2VBT A;  3D5L A;  4M6V A;  3GQB A;  3VSV A;  3RZO J;  2LF7 A;  1QA2 A;  3K4K A;  5TGT A;  3IWZ A;  1U78 A;  1R36 A;  1KQ0 A;  2NT9 A;  1Z9C A;  3KLN A;  4HOB A;  5F1R A;  4IKF A;  2XIG A;  1AKH A;  1QPI A;  3V8L A;  5CPR B;  4IHV A;  3WTT C;  1K4S A;  2XC1 A;  2JIZ A;  2E7W A;  2UZK A;  4XRS G;  1G7C A;  3KCC A;  4XID A;  3L09 A;  1PXZ A;  2BEO A;  1WJE A;  4WWV A;  4DQ2 A;  4OJP A;  4E7S A;  4Y15 A;  4AF6 A;  3TQN A;  1OYY A;  1QQ1 A;  2R7D A;  3VOE A;  4TMX A;  3P9I A;  2J5P A;  2R9V A;  5M5X J;  2GIZ A;  5BPD A;  4AU7 A;  4KNY A;  1QH0 A;  2XZP A;  3WND A;  4EMS A;  4A5M A;  4U0Y A;  1WSR A;  4RB1 A;  4OPV A;  1G3Y A;  3I0T A;  4ZGN B;  2KQR A;  4HF0 A;  5CDF A;  1GJR A;  2JPB A;  5EMN A;  1OFL A;  1DG1 G;  3DTK A;  4ASU A;  1WJ5 A;  4B1R A;  3OYH A;  4RDK A;  5FLX K;  2K40 A;  1GR1 A;  2UUZ A;  2Z33 A;  3GZ6 A;  3OJX A;  1UD2 A;  1ZLK A;  3AST A;  1HA3 A;  4Y9U A;  1ZG5 A;  3OSF A;  3HOT A;  2RC4 A;  4G1V A;  4Z2Y A;  1K4T A;  1BJK A;  3SHF A;  4AID A;  2JDI A;  4GFB A;  1Z21 A;  2L3D A;  3BZK A;  3U9G A;  3DLL F;  3S16 J;  4CCN A;  4G12 A;  1O8K A;  3FXR A;  2DA7 A;  4EJT A;  4NHJ A;  2X9D A;  3HSR A;  5B3S H;  1ERD A;  3ASS A;  2V9P A;  4XM3 A;  4RD3 A;  1FIA A;  3G73 A;  3BTJ A;  4JQF A;  1OGO X;  1MJ9 A;  1BR4 A;  4ANJ A;  4A3G J;  1R1T A;  5GAD J;  1T38 A;  2DTZ A;  5JMC B;  3BRO A;  2ZZQ A;  2Q8K A;  3L00 A;  3CCQ B;  1P4X A;  3IKV A;  4MIM A;  4ZCL A;  1ENH A;  4FT8 A;  1U2W A;  3OYF A;  1O57 A;  3ROU A;  1R1V A;  1J0R A;  1HW5 A;  2VBS A;  4GQN A;  3TMO A;  1E64 A;  2BN4 A;  1RZ4 A;  4M3G A;  3SEQ A;  5BMZ A;  1G4D A;  2XUB A;  1CZF A;  1WJF A;  1RES A;  2DER A;  2HDW A;  2IOU G;  5C4J J;  2GPJ A;  3HHG A;  3FPP A;  3VMW A;  2CO5 A;  2QGG A;  3W2A A;  1DDI A;  4QSH A;  1FRN A;  3DKY A;  3SDB A;  3GO5 A;  3JCU C;  5DYM A;  4E70 A;  2V7F A;  4W8S A;  1UG2 A;  3TED A;  1MAB A;  2PBI A;  3CCV I;  3MZY A;  2WAD A;  4UZE A;  1XDS A;  4X7D A;  1X1B A;  4M9S A;  1VQ4 I;  1H85 A;  1V3F A;  4K1X A;  3F6O A;  3WY9 A;  3BY1 A;  1TQI A;  1X1A A;  2V7W A;  2NNY A;  5IYW A;  2ID3 A;  3J80 K;  4A3I J;  4BHB A;  4FXU A;  2E1R A;  2NV4 A;  1R6R A;  4B47 A;  1VQM B;  5L46 A;  2VI6 A;  3O8G A;  1EFR A;  5IYC J;  1MZB A;  4EM1 A;  2K7L A;  1J2X A;  4P22 A;  4LG0 A;  4W97 A;  1SFK A;  2AHO A;  1QZZ A;  2LRE A;  1HKQ A;  2CG4 A;  3F8N A;  4MQ9 F;  2M5S A;  1SVO A;  4A3M J;  1FOX A;  3HGG A;  2X1E A;  5A2Q Z;  2L7K A;  2QMU A;  4YFN F;  5K5R A;  3E7L A;  2XZO A;  3OL3 A;  2AXT C;  1DBO A;  3PFY A;  4WF2 A;  2H1L A;  1NBM A;  2DMU A;  3RQI A;  3SQN A;  3MZH A;  3NWS A;  3OWT A;  3K69 A;  3PQK A;  4ENK A;  2L01 A;  4Y13 A;  2CU7 A;  3KP5 A;  2Y48 A;  3HZJ A;  3S1Q J;  4Q47 A;  3TO7 A;  2M8E A;  2JWT A;  3CW2 A;  3OEH A;  1N05 A;  4A3D J;  2Y69 H;  2EIJ H;  2X8K A;  1O8M A;  4DNT B;  2VBK A;  3HXL A;  4ZC3 A;  3WHC A;  1J7K A;  1LQ1 A;  5C4X J;  3G6E I;  1IRZ A;  1BLI A;  1W35 A;  2XOK A;  1O8I A;  1LEA A;  1E3P A;  5KAI C;  2FQ3 A;  2KL4 A;  4IOC F;  2GXB A;  3FXO A;  2HVR A;  2Q6I A;  2BV6 A;  2B9S A;  2R7S A;  3PUM A;  2PYH A;  4EM2 A;  1GV5 A;  2QA4 B;  2ZXH A;  3JRA A;  3H9G A;  1T6Y A;  2MW8 A;  1D1B A;  2YUH A;  4ZDL A;  1RR8 C;  4E4H A;  2JVG A;  2OQG A;  4B8X A;  3JAM Z;  5C1E A;  1UHW A;  2LF8 A;  1EFC A;  3T0Y A;  1KD1 D;  4KN4 X;  2XAH A;  3H94 A;  4D9J A;  1R49 A;  1AKH B;  1E63 A;  4QVJ A;  2YR2 A;  3ASQ A;  3CPX A;  2XSJ C;  2A6H F;  4MLO A;  3QPL A;  4U7D A;  2DT5 A;  2E36 A;  2ZFW A;  1FC3 A;  3C18 A;  5HLG A;  4XON A;  4M3F A;  2NS7 A;  1TNT A;  5IOY A;  1CF7 B;  2M45 A;  4YIF A;  2BY2 A;  3A1Y A;  2P6T A;  3JTG A;  5B6I A;  2E7X A;  4Z4W A;  2OZU A;  3IP4 B;  5JHF A;  4BE2 A;  2PJR B;  3E6D A;  3ZGK A;  3OIP A;  2DA1 A;  1TWF J;  4PAB A;  3W5U A;  1Y0R A;  1ETO A;  2DFI A;  3FHZ A;  1YX5 A;  3I58 A;  1KZL A;  1MBF A;  2Y31 A;  4ESB A;  2OBP A;  5HS9 A;  3RI4 A;  2Z5U A;  4W1U A;  4AIJ A;  4H9G A;  1A36 A;  3PJR A;  4QTR A;  2A6T A;  4C3I J;  1KJZ A;  2BV3 A;  1Q86 D;  2K3P A;  4IRI A;  1KRH A;  5J1Y A;  2V7U A;  1EH7 A;  1I6X A;  3J81 K;  2KIF A;  1RWR A;  1QA1 A;  2KRF A;  1H9G A;  4D1Q A;  1U6G A;  1GQ8 A;  4XN0 A;  2A5Y B;  4NQW B;  2CWE A;  2RN7 A;  2W25 A;  1DGW Y;  4ZH4 F;  4AD9 A;  5GPA A;  5FKK A;  1Y0U A;  2CUJ A;  2NOG A;  3PIP F;  4WZK A;  3ZIA A;  4C2U A;  4JK1 X;  1BI3 A;  2XKO A;  2JTV A;  1SFX A;  4HW0 A;  1WJB A;  2DEU A;  4I0B A;  1IRX A;  2ZO4 A;  5HDN A;  2NAZ A;  1KYZ A;  2CQQ A;  1SAX A;  2HYF A;  3OV8 A;  1W2B B;  5DM6 F;  1RR7 A;  1JT0 A;  1QA3 A;  4B48 A;  5FIU A;  1FPQ A;  1LDJ A;  3R60 A;  2DCU A;  3EET A;  3FBI B;  3OIO A;  2W7N A;  3DEW A;  1S7O A;  2OCE A;  2IGM A;  3FMR A;  4D5C A;  1HVX A;  1MNM C;  1VQ9 B;  2FBK A;  1XS9 A;  2HOS A;  2L9S A;  4N3N A;  3BY2 A;  2ZNZ A;  3L2C A;  4MR0 A;  2Z2S B;  1XG1 A;  2XGC A;  4P3Y A;  3F3X A;  2M4G A;  5TR9 A;  1E0E A;  3W5H A;  1QNT A;  2QSF X;  3OYN A;  5E17 F;  3BQY A;  3WGH A;  3CRZ A;  4IZZ A;  2VFP A;  4Y9R A;  1ETW A;  1XDU A;  4S0H B;  3R6J A;  2OA4 A;  2E5N A;  2DN0 A;  2K3F A;  2L9R A;  2VC0 A;  4V2G A;  5FFZ A;  4PJJ A;  5FJ8 J;  3HPH A;  3V7C A;  4QIW N;  4WZL A;  5THX A;  3BH6 B;  4HQE A;  4P12 A;  4MO7 A;  4DBQ A;  2NVU B;  5LMZ A;  3SJZ A;  1XC5 A;  2WBM A;  4P9F A;  2P3M A;  2M7B A;  3WTY C;  1FMW A;  3HTS B;  5IYQ A;  1YW8 A;  4BXU A;  2YWE A;  4NK8 A;  4TMW A;  4ZCM A;  3QFS A;  4KIG A;  4HIZ A;  2FUG 2;  3V76 A;  1U9N A;  1BW6 A;  1CF7 A;  3OZU A;  3RSN A;  4LMY A;  1WI9 A;  2FOK A;  3DBH B;  4L5J A;  2X48 A;  4KIS A;  3WTS C;  2JA2 A;  2QEN A;  3AAF A;  4NUB A;  3T8R A;  4ESJ A;  2NTB A;  4RDL A;  5D5W B;  2WZP P;  2Z8G A;  2AXL A;  3CCQ I;  3K1P A;  5EZH A;  3H9N A;  3MKY B;  3K4N A;  4TSF A;  3S1R J;  1W34 A;  4KIC A;  3KIO A;  3CCR I;  4P2N A;  4PSW A;  4EQQ A;  1HA8 A;  2RGV A;  1N25 A;  1LPQ A;  3JSP A;  3H0G J;  4Y7C A;  2RNG A;  4A3C J;  1HCR A;  1ULY A;  2CFX A;  4JYK A;  2OD5 A;  3ZQC A;  1IN7 A;  4UB6 C;  2OTJ I;  3RIR A;  5LGN A;  4JOM A;  2ESN A;  4B3X A;  5L3F A;  2VB6 A;  4PCQ A;  4M74 A;  2F4O B;  3CJQ B;  3LSK A;  4C2M J;  1H8A C;  3WOD F;  2PMD A;  2DMN A;  4U0V A;  3QYE A;  1BX0 A;  3AG2 H;  2XB5 A;  5BSY A;  1RU4 A;  1YIT B;  3C1D A;  4QUZ A;  5E20 A;  3GTK J;  5FO1 A;  1XE1 A;  3RZD J;  1ZEL A;  1S0U A;  2Y9Y A;  2A07 F;  4HA8 A;  1IDZ A;  3Q3S A;  3CO7 C;  4G5G A;  2X1D A;  2GA2 A;  3BQZ A;  3GYH X;  4HV6 A;  1B72 B;  1UD6 A;  3OW2 B;  1X2M A;  3SZG A;  3AK5 A;  5C3E J;  4WZT A;  3HM5 A;  3S8P A;  1PUF B;  3JSO A;  3B8Y A;  1FNM A;  1MJA A;  1SM4 A;  2PG4 A;  1YRN B;  2EB7 A;  3G4S B;  1EE6 A;  1IB4 A;  2KDZ A;  2BXZ A;  5J1U A;  3OY9 A;  2XC7 A;  3K70 D;  4RAY A;  5DUI A;  2V1X A;  3MZ8 A;  4MQV A;  5DD8 A;  4RDU A;  3B02 A;  2P4W A;  3A0B C;  3L2V A;  3VO1 A;  3B90 A;  1GLN A;  4XMY A;  3T53 B;  1TQP A;  4K2E A;  1MH3 A;  1YS7 A;  3PSI A;  5M5Y J;  2XNJ A;  2QQ8 A;  5H5J A;  2HNH A;  1FY7 A;  3CME I;  1HOM A;  1IA5 A;  3WU2 C;  1N08 A;  4UZU A;  5EEH A;  1XB4 A;  4KFC A;  3JU4 A;  2M2E A;  3F22 A;  3PA2 A;  2DLL A;  2KPM A;  3MAJ A;  5LHH A;  3IV5 A;  3F23 A;  4RPB A;  3BR6 A;  4G8X A;  1I27 A;  2M34 A;  1WOS A;  4YAL A;  4CDG A;  3ZQF A;  4G1B A;  3ZMU A;  4MTE A;  3W6J B;  3P26 A;  2L2O A;  4TT3 A;  1O3R A;  1H8E A;  1JTA A;  2VFO A;  2ZTG A;  3KEQ A;  3PUF A;  3ESW B;  4LD5 A;  3DDY A;  4Z4Z A;  2M7A A;  1P4A A;  4ZYA A;  2ZJ2 A;  2RDP A;  3LJY A;  4P5O A;  4IPA A;  2J5O A;  3OP1 A;  4A3F J;  1U9O A;  2CQK A;  4YC5 A;  3BC8 A;  4FX0 A;  1X3Z B;  4JX6 A;  3BWG A;  3G1L A;  3C7J A;  3HOW J;  4E7J A;  2F4M B;  1MBK A;  2DTR A;  3WNB A;  1MMN A;  1VF9 A;  2ISY A;  2O5R A;  4X7F A;  5IYN A;  5IYR A;  3EYY A;  1I5Z A;  1KK0 A;  3Q3A A;  5IYP A;  1MMD A;  1T2K A;  5D5V B;  4RB0 A;  1NG6 A;  4FQG A;  1ZH5 A;  4TMZ A;  2XKP A;  1XSV A;  1P6R A;  2F5C A;  2KFD A;  1RI7 A;  4XLH A;  3FKI J;  4D0P A;  4QLC U;  1U8B A;  1FNC A;  3T8T A;  2LBF B;  2X0K A;  3V42 A;  1LVA A;  3OW7 A;  4X07 A;  1XCV A;  1R4M B;  2EK5 A;  1VQL B;  3NQO A;  3LSH A;  2L5Q A;  4Z1M A;  2HQR A;  1SVL A;  1K73 D;  2DBB A;  2IGN A;  4KJZ A;  2EJR A;  3KEO A;  3HSF A;  4AVZ A;  2X53 S;  2L4A A;  3CC7 B;  3OYI A;  2ZBK A;  2OTL B;  1QHH D;  3K1N A;  1LM1 A;  4OM9 A;  4QHY A;  1IC8 A;  5IOZ A;  4DQK A;  4XKV A;  1QRY A;  2VON A;  1FIP A;  1ZM9 A;  1ETQ A;  1Z6T A;  1MIJ A;  2FX3 A;  3JRD A;  1Y1W J;  1S4M A;  4A0X A;  4MNU A;  5FD5 A;  3M07 A;  4HAM A;  4YAO A;  3KET A;  1GVJ A;  2DDB A;  4BDZ A;  2UXN A;  2IVM A;  2PLY A;  1NHC A;  4BHC A;  4XIC A;  2OC6 A;  1MRZ A;  1W4M A;  1BIB A;  2XSD C;  2LD5 A;  1YJN I;  4Q7J B;  1JKR C;  2V7Q A;  1Z05 A;  2IRF G;  3NE5 B;  2F4I A;  4LJZ F;  1XGO A;  4OIP F;  2ZTN A;  2OZ6 A;  1I1S A;  2KP6 A;  4BY7 J;  4HQM A;  3RKX A;  2COM A;  3TDZ C;  4L9N A;  3SXY A;  2LTP A;  3IAM 2;  4IF4 A;  1WWX A;  4BQQ A;  4I02 A;  3AGP A;  3CCU B;  2KDO A;  2R7T A;  1IJE A;  1OIS A;  1NH3 A;  5KHD A;  1VQ9 I;  4XOR A;  3X2Q H;  1E79 A;  4RM2 A;  2MSY A;  1N0U A;  2BPO A;  4BEH A;  1A6Q A;  2F3L A;  5E3N A;  4E6K G;  4EGZ A;  3QRF F;  1EJ9 A;  1BL0 A;  4TKO B;  3S1N J;  5EG0 B;  2GWR A;  4BAY A;  3R6S A;  2Y0S A;  1MJB A;  3IRR A;  3ASN H;  3ZPL A;  2KIQ A;  2GM4 A;  3IL2 A;  1VI0 A;  1QA6 A;  1SAN A;  3A3G A;  3I5U A;  2LVS A;  4IL6 C;  5DCM A;  4NK6 A;  2O0Y A;  2VNI A;  2W82 A;  4F91 B;  3ZR8 X;  1GT0 C;  3PIO F;  4XK4 A;  3CES A;  3FWE A;  2V26 A;  1ZGW A;  4PGO A;  1N77 A;  1QJV A;  1RUN A;  3G1M A;  4FTH A;  3I3L A;  3E1S A;  2HDD A;  1TSP A;  2MAB A;  4B43 A;  2X51 A;  2B5O A;  4B4D A;  1OJL A;  2HOA A;  3S2W A;  5B1B H;  2WAE A;  1E3O C;  2FQ4 A;  3AVU A;  3BCB A;  3A2K A;  1SD7 A;  4DNC A;  1VQN I;  4A0Y A;  2YU9 J;  2CF4 A;  4LG0 B;  1ZRE A;  5HKK A;  2PQ8 A;  2PX9 A;  2F48 A;  2X6W A;  4BE1 A;  1V54 H;  1BR2 A;  1IDY A;  1ZG1 A;  2OPT A;  3G71 I;  2OCC H;  3IAS 2;  1KQS B;  1WJC A;  4Y7N J;  2JSP A;  3PSF A;  1FRQ A;  2PIA A;  4C43 A;  4HF2 A;  3WG9 A;  4X06 A;  2KJC A;  1GAW A;  1ZRD A;  1EH8 A;  5CQG A;  3FIS A;  1DDN A;  1NJI D;  1I18 A;  2G0Y A;  3ZZU A;  2D1H A;  3L2U A;  2OV7 A;  3HRS A;  2E1C A;  1BM9 A;  2RC5 A;  4V19 K;  4IHW A;  3VMV A;  5DUK A;  1FP1 D;  2ADU A;  1XPX A;  5BSX A;  3ZPP A;  3BC9 A;  3QP6 A;  3S17 J;  2BX6 A;  4KKS A;  4GYG A;  5GAH J;  5KNL A;  1FDR A;  4QV2 A;  3OYK A;  1WQ2 A;  2M9H A;  2QM3 A;  4G6T B;  4QPQ A;  2EV6 A;  3M1C A;  4CCK A;  4BDY A;  4MEX F;  4V2F A;  2HEO A;  1K8F A;  3B4N A;  4NC7 A;  4MGR A;  1B8I B;  2PJP A;  5E3L A;  1K4Z A;  2LY1 A;  2N8G A;  4CZZ A;  2R0Q C;  1ZM2 A;  1IAW A;  1M1E B;  3WE3 A;  1WOR A;  3GW2 A;  1Q7Y D;  1EFT A;  5K7Z A;  2W4S A;  1MND A;  1TUI A;  1Q1V A;  2O0V A;  3S93 A;  5DS9 A;  1LE8 A;  1MSF C;  1AHD P;  1UMK A;  1XCB A;  3DF8 A;  2D1V A;  3ABM H;  2OU2 A;  1O3Q A;  2W85 A;  1F5T A;  2GIV A;  2VFM A;  2W00 A;  4BXF A;  3GFJ A;  1FLI A;  1MD0 A;  3JQR A;  1YG2 A;  1X3W B;  3A4C A;  4NQW A;  1FSE A;  1R5I D;  2QF7 A;  3K6G A;  1XMK A;  1ZTR A;  4EM0 B;  1W36 C;  4FK8 A;  5B66 C;  2QTZ A;  2DK5 A;  4TV7 A;  1QUF A;  3PUB A;  1W5S A;  3V8J A;  5ILU A;  1CNE A;  1DUX C;  2P5V A;  3KP4 A;  2CQN A;  3GTO J;  3OOU A;  2FE3 A;  3TOA A;  1OYI A;  4AWX B;  2E2J J;  5HLT A;  3CC4 B;  1BC7 C;  4IHY A;  1KTW A;  3DCF A;  1O8G A;  1WCM J;  2IXS A;  5E8G A;  1QCX A;  3OYM A;  1AWC A;  1T6S A;  4IXA A;  5A2Q K;  2INV A;  2Q1Z B;  3NAR A;  5H2F C;  2KIS A;  1V0E A;  1FSH A;  4N3G A;  2QX3 A;  2BYV E;  1Y39 A;  3SEJ A;  3DTI A;  5TRD A;  2AQE A;  4A3B J;  4KIT B;  4RA2 A;  4PJL A;  4ZYD A;  1Z0X A;  2IEK A;  3BG9 A;  5LEJ A;  4ZYE A;  1G3T A;  1FBQ A;  2HI3 A;  2JA6 J;  1B1B A;  3AKZ A;  3WYA A;  4P1V A;  2WV0 A;  1WOP A;  4HEA 2;  1WPC A;  4G9Y A;  1B4A A;  4IVN A;  3FK6 A;  3AVV A;  2O0W A;  2R3S A;  5KVR A;  3L2Q A;  5GV7 A;  4MTD A;  1PP7 U;  5F27 A;  4EW9 A;  3W6K B;  1HXD A;  4BJT A;  5EYR A;  4RD6 A;  4XOP A;  4M3E A;  1I39 A;  2ISZ A;  3TH0 A;  1I3A A;  4JX4 A;  1TZL A;  2V7X A;  1VQK I;  1OYW A;  1VZ0 A;  1XMX A;  4KYW A;  2F1M A;  4LFU A;  5D4R A;  2VOO A;  5EEG A;  4YAU A;  1YE9 A;  1E3Z A;  4UB8 C;  2XDV A;  1LEB A;  1JUS A;  3N05 A;  4YIR X;  3D5S C;  2B7E A;  4XR6 A;  2QZA A;  2FRH A;  3PET A;  2FMY A;  2Q2E A;  1TLH B;  3P9C A;  5EGO B;  2CJJ A;  2H8W A;  1ZRF A;  4XLF A;  1ZN2 A;  2JN9 A;  4M1K A;  3OKX A;  1DP7 P;  1WH7 A;  2ZCW A;  3SKB A;  4Z6Y A;  1LKX A;  2DFF A;  3CZ6 A;  4BL0 B;  4KKT A;  2ELJ A;  2P7C B;  2HXO A;  3BG5 A;  3ML6 A;  1W9X A;  1D1C A;  2HQA A;  1P4M A;  5CVU A;  5M5W J;  2F5E A;  3SLD A;  3LNN A;  3M8F A;  2H1K A;  3K4B A;  3BZC A;  3HRU A;  1YLO A;  1DBG A;  3KZZ A;  3OPO A;  3WTV C;  5DNS A;  4B3G A;  4U4B A;  4NC6 A;  2NTP A;  2VQC A;  1KU9 A;  3S1M J;  4H4K C;  1QVT A;  3E5U A;  1W5C C;  1KK2 A;  4YXW A;  1WGX A;  2CW0 F;  2JA5 J;  5LRS A;  4UVA A;  3KYC B;  4YZA A;  1DAB A;  4IRG A;  1I6H J;  5CQE A;  4HYE A;  3ZSC A;  3KZI C;  2V6C A;  3HRM A;  2A05 A;  1XB2 A;  2RKH A;  3WGG A;  4P6Y A;  1VQ4 B;  4OIR F;  2XRL A;  3L1P A;  5JLW A;  1FNN A;  2BXY A;  5FLV A;  2YWH A;  5HDK A;  2EWN A;  5EZG A;  3RPQ A;  1EF4 A;  4BYY A;  2HZT A;  5J6X A;  4AC9 A;  1MMA A;  1XMA A;  2IGO A;  4FET A;  2VYQ A;  3U2R A;  4S04 A;  2ZL6 A;  1K83 J;  2W48 A;  4Z4Y A;  2DY1 A;  3V7R A;  1Z1D A;  3ZQH A;  3F72 A;  1R5B A;  1PE9 A;  2XTW A;  3A35 A;  3SJM A;  5K5O A;  2ZBU A;  2IA0 A;  2F4N A;  3GLX A;  1G7T A;  3Q9S A;  5EG0 A;  1W0J A;  2EFQ A;  2XRN A;  3WE2 A;  5E3M A;  2WAQ N;  2NST A;  2CW5 A;  1L3L A;  3GBG A;  2XAQ A;  2Y2Z A;  3VO2 A;  2OTJ B;  1E3H A;  1X3U A;  3FJO A;  3A01 A;  4M6X A;  2DA6 A;  5FO5 A;  1YQA A;  2ZBV A;  1FP2 A;  3LSM A;  4M6Y A;  4DBR A;  2D3L A;  3RTR A;  5D8L B;  3LSI A;  2K86 A;  4AC0 A;  3MKW B;  1LVK A;  2QQ9 A;  1DGR M;  1O8E A;  3ZQL A;  3OYE A;  1Y6I A;  1YJ9 I;  1QFZ A;  5JVG F;  2X85 A;  1HDD C;  2BMW A;  3ZN1 A;  3W2E A;  2XGX A;  1WKM A;  2DO7 A;  3D1N I;  2D74 A;  4YCQ A;  1BI0 A;  1SMY F;  3OR2 C;  4UUS A;  5DSZ A;  3COA C;  4RGS A;  4RM3 A;  2VZL A;  5CYV A;  2RV8 A;  4M9Z A;  3ML3 A;  2WB1 A;  1QPM A;  4XRM A;  3QWL A;  4UAJ A;  3OYD A;  4YII A;  1UST A;  4PFO A;  3CCJ B;  1OFM A;  4YRV A;  1FZP B;  3SUC A;  4CZC A;  3W2V A;  2D45 A;  1KK1 A;  2O04 A;  2EWE A;  4KIB A;  1VQO B;  3WBK A;  2EFO A;  4XNF A;  2KVO A;  1T33 A;  1K8A D;  2IS6 A;  3I1F A;  3RCO A;  1MKM A;  5J47 A;  2DOD A;  3EPZ A;  3H36 A;  1JUP A;  2EQR A;  4FIS A;  3SZP A;  4WWC A;  3JR9 A;  3K70 C;  1OCT C;  2J8I A;  1X58 A;  3ZBU A;  1ETX A;  1Z7L A;  3MWM A;  5ICG A;  3EQO A;  3G3Z A;  2X4H A;  2RAE A;  3CP2 A;  3S32 A;  2KRH A;  2Z99 A;  2R5Z A;  2H09 A;  2PYG A;  3B8H A;  4LBW A;  3CCS B;  5CVJ A;  2ZZE A;  1VQ8 I;  4RCZ A;  3WG7 H;  4C30 A;  5B1A H;  1N8R D;  1E1R A;  2QN6 A;  1ZAO A;  1Z6R A;  5FD6 A;  3WTW C;  1S9H A;  2R7O A;  2Z6B D;  3BR3 A;  3VYT B;  1HW1 A;  2F2E A;  1U5T B;  2OBT A;  1R5G A;  4NBS A;  4PC2 A;  3VSU A;  4U88 A;  1T0F C;  3GVK A;  1VQ6 I;  2I8D A;  2XT2 A;  2GOX B;  4D5F A;  2HYG D;  2ID6 A;  5HLI A;  1FX0 A;  2RRE A;  3VPR A;  1GDT A;  4OZY A;  4GXO A;  2YWG A;  4ROX A;  3CCM B;  1B8I A;  3MMP A;  1IRG A;  3FXQ A;  3VYU B;  5LEK A;  2ESH A;  2FU4 A;  2XT4 A;  3GF2 A;  4X6A J;  5TJJ A;  1KCD A;  2L4M A;  4AYB A;  1REP C;  1R4N B;  3OYG A;  4RLZ A;  5TY0 A;  2VAS A;  4UVC A;  4ITV A;  5ICC A;  1MSE C;  4F92 B;  1UAA A;  3HPG A;  1RPW A;  2EFN A;  3RPU D;  5KAF C;  4X0C A;  3A3B A;  3UW0 A;  3HJE A;  3OYB A;  4CYC A;  2M4K A;  2ZJR F;  3I56 I;  1LDK B;  4XLA A;  4IRH A;  1W5T A;  3OS0 A;  3CJN A;  4A6E A;  4CGZ A;  4DNR B;  3RKQ A;  4CSW A;  2LMD A;  2DU9 A;  2VQL A;  4OIN F;  4ESF A;  3BR2 A;  2GXA A;  4P25 A;  2IQ7 A;  4EJV A;  1K78 A;  5FRN A;  3DTE A;  1ITY A;  2B0L A;  2TDX A;  1GXP A;  3CCY A;  3I54 A;  5FKM A;  5ILS A;  1N06 A;  4ZYH A;  1LLZ A;  1Y56 A;  4YAF A;  2VFQ A;  2PLF A;  4OOX A;  3GXO A;  3BOQ A;  2DJI A;  3SFI A;  4PMH A;  5F04 A;  2DFE A;  2WR8 A;  3NWT A;  4N4O B;  3H09 A;  1YI2 B;  3GCM A;  1PJR A;  1KON A;  3DWL E;  2KMU A;  4IJA A;  4L9V A;  3GUD A;  4EJW A;  3EDP A;  3U6K A;  2VBM A;  2BSP A;  1R00 A;  3CUO A;  2IP2 A;  4RS8 A;  3Q6Q A;  2F5V A;  3I55 B;  4BY1 J;  3W6V A;  2CK3 A;  3FXJ A;  3KYL A;  3AG4 H;  5LLQ A;  1UMQ A;  4JBA A;  4KMU X;  4CYC B;  4KMF A;  4BQN A;  4L5E A;  3SFZ A;  1HZE A;  3ZPN A;  2ZKZ A;  3M8J A;  1KZH A;  4FHT A;  2BVN A;  3CC4 I;  1NDH A;  4XKB A;  3TO9 A;  5BOX A;  3GRH A;  3FZV A;  4CCL A;  2QEX B;  3M8E A;  2NT6 A;  1RC9 A;  2GAU A;  3BP8 A;  4DQL A;  1R23 A;  2BW3 B;  4E7I A;  4OJL A;  3ZUG A;  1EFU A;  1JHF A;  4Z06 A;  2M30 A;  2Z3Y A;  3MMY B;  3FBN B;  1JKQ C;  2DQR A;  2FSW A;  1Y8Q B;  2M5W A;  1RMG A;  2VBU A;  3ZMV A;  2IW5 A;  1T6Z A;  2JRT A;  1WU8 A;  2IA2 A;  2PE3 A;  3B82 A;  4BBS J;  2DA2 A;  4XRF A;  2K9N A;  2QKL B;  3BCF A;  3HL2 A;  3DKX A;  3RPU A;  3FF5 A;  5FKO A;  2FBI A;  3TO6 A;  4RB3 C;  1PJ6 A;  3SJP A;  1VF7 A;  2DPU A;  1ZKG A;  4R1H A;  3AGQ A;  1LJ9 A;  4NBQ A;  3FY3 A;  5E1Z B;  1IUY A;  3PO2 J;  4EH1 A;  4FE4 A;  3NAW A;  4UUT A;  2FJ1 A;  3KP3 A;  4NCN A;  2HQ5 A;  4Y52 J;  1TBX A;  4F93 B;  4ENJ A;  1YIO A;  2L9N A;  3QP5 A;  4L0Y B;  3H92 A;  5DM7 F;  4Q5S F;  4A3E J;  2JK3 A;  2D5V A;  2VE9 A;  4P96 A;  4LB5 A;  3GTG J;  4HX7 A;  3WU0 A;  4U0W A;  2VT3 A;  3K4C A;  4M73 A;  4DYC A;  3OJW A;  5IK2 A;  4PFP A;  4Y4R A;  1KC8 D;  1MGT A;  4ZTF A;  3QPH A;  1YRN A;  4YEI A;  1CNF A;  2KZV A;  2VBW A;  3BPX A;  3EUA A;  4UVB A;  1PUF A;  3CD6 I;  3HOY J;  2M0M A;  3E6B A;  4YEJ A;  3VMF A;  5AMV A;  2XNC A;  4PGH A;  1K61 A;  3OIQ A;  1O8L A;  1Y8R B;  3AVX A;  3ERM A;  1JKO C;  2JSC A;  2ZL7 A;  3HEF A;  4W8Q A;  2HDN B;  4GYI A;  2R92 J;  4II3 A;  3W2W A;  5C1C A;  1FTT A;  2R7Q A;  4A12 A;  4YFX F;  3OZW A;  2NS8 A;  2KKO A;  5HZA A;  3OYL A;  4MFE A;  5GV8 A;  1WVR A;  3GZ5 A;  3A0H C;  4IQ4 A;  2ZJQ F;  1KTV A;  4OPS A;  2WYR A;  3CPW B;  5FGM A;  4B09 A;  1PP8 F;  1E62 A;  1L0O C;  3GTJ J;  3RYP A;  3D26 A;  2H6B A;  2WV1 A;  3U6B A;  3LFK A;  1Y1V J;  3OE7 A;  2BY3 A;  3P9K A;  2P81 A;  4AIK A;  3A02 A;  3GZN B;  1HKT A;  1WFX A;  3F0C A;  5JLV C;  3BG6 A;  1T08 B;  2OJE D;  3OR1 C;  3Q39 A;  3HOZ J;  2WC2 A;  1F4K A;  1U5T C;  3FPK A;  1MDM A;  3BTI A;  3H5R A;  1XGM A;  4XOT A;  3AL0 C;  1GXQ A;  3ZC3 A;  1FYL A;  1QZE A;  1XN7 A;  4OPW A;  3LSJ A;  1BBY A;  1QQI A;  4ACA A;  2AS5 F;  2ELH A;  2DOG A;  3S2D J;  4OIQ F;  2EA2 A;  1VQ5 B;  2DI3 A;  1VQM I;  1WTH D;  1YJ9 B;  4RLF A;  1T6X A;  3LST A;  1YW9 A;  2VBX A;  1XSD A;  2JN6 A;  2EZH A;  3B6C A;  3BG7 A;  3SEZ A;  3LAJ A;  3KE2 A;  5LGT A;  4FE7 A;  4CUG A;  3DPU A;  2O7O A;  1LDD A;  2V79 A;  1X4P A;  2QCO A;  4OOI A;  2NVX J;  3U21 A;  2LY9 A;  3VOD A;  3NEU A;  3GTL J;  1TVC A;  3AG3 H;  4ON0 A;  4F55 A;  2PI0 A;  4XSZ F;  3VNV A;  4LIV A;  5IY5 H;  1SKY B;  4ZTJ A;  5K7F A;  2BHY A;  3BR1 A;  2R4G A;  3MN2 A;  5GAG J;  3N4M A;  2K02 A;  3LFU A;  2DA4 A;  1J09 A;  5D5X B;  2WPD A;  3FIW A;  1I50 J;  5H20 A;  1D2E A;  4PSX A;  3B6A A;  1VQL I;  1RKT A;  3CMM A;  1STZ A;  3GTQ J;  3QE2 A;  3ASR A;  3ZMS A;  4NDL A;  2LLK A;  2DOF A;  3M1E A;  2V4D A;  3QU6 A;  3GFL A;  3F21 A;  2V1U A;  1MBJ A;  3GIR A;  2FF4 A;  1A8P A;  4DJA A;  4I0A A;  5L3B A;  1U2R A;  3JW4 A;  1WRJ A;  2GQQ A;  2WAQ A;  2DT7 B;  3VYS B;  3LMW A;  3ZBT A;  1UD8 A;  3GSI A;  4HDU A;  2LKX A;  1B9N A;  2XTX A;  2CGP A;  2RQP A;  2XF6 A;  4QVA A;  1IN8 A;  4IQJ A;  1TYU A;  3MD2 A;  2PMZ N;  5IYB J;  1SD4 A;  2ZJP F;  4OU0 A;  1O8J A;  1K6Y A;  3IHU A;  3MFK A;  4RJL A;  1NG7 A;  4BQA A;  4YAW A;  2HZD A;  3QU3 A;  1SD5 A;  1F1Z A;  1IW7 F;  3I53 A;  3QOP A;  2HDC A;  4HG2 A;  1UD3 A;  5M3M J;  3CCS I;  1QRB A;  2HVS A;  5IP7 J;  2P8T A;  2VPL A;  2D3N A;  1POG A;  1X19 A;  3MEX A;  4ZV4 A;  2VPR A;  3ZQQ A;  1VLY A;  1V4R A;  2R6H A;  1XSX A;  1BPL A;  3TKY A;  1TT5 B;  1QG0 A;  3G6E B;  1EH6 A;  3G1O A;  2O9L A;  4YZX A;  3L2W A;  1C0W A;  3BG3 A;  1OOC A;  3CP8 A;  2HLD A;  3K4L A;  2EV0 A;  1USS A;  4O3M A;  1G3S A;  3LMM A;  3LQR A;  3FM3 A;  4L9J A;  4ZJZ A;  4X7C A;  4LGW A;  3LA3 A;  3JRI A;  1IZ1 A;  1MW7 A;  2DCE A;  4C3H J;  5IT9 K;  3FKS A;  2A61 A;  2C5H A;  1RQP A;  2UWM A;  3ZMZ A;  5F1J A;  1B2R A;  2A3S A;  4PUS A;  4G7H F;  4PC7 A;  4II2 A;  1RNL A;  4X8I A;  1CGP A;  4GCV A;  4RMN A;  2W6I A;  1NB9 A;  3QYB A;  3G2B A;  1SKQ A;  5JFR A;  4DOZ A;  4LLN A;  1YFH A;  1DPR A;  1RKW A;  2E5Z A;  4OJO A;  1ZK8 A;  5FRO A;  2F5F A;  2INU A;  1WJD A;  2CUZ A;  1H0M A;  2K9Q A;  2I1L A;  4DYR A;  3VDX A;  5E8I A;  2ZC2 A;  2QSH X;  2NPF A;  4E7Z A;  3GME A;  4RB2 C;  2BZT A;  4L5I A;  2FD5 A;  4J0Q A;  3I55 I;  3CJT B;  5F6F A;  1IV6 A;  4HZF A;  2FBH A;  1F9N A;  3K1M A;  1WSU A;  4OAZ A;  3J80 Z;  2HWV A;  3WNC A;  1JA1 A;  2VNK A;  4P9S A;  1HG8 A;  5FNZ A;  1SFU A;  1RQR A;  3WU1 B;  4HLY A;  3HYI A;  3SDG A;  2GQF A;  4WXD A;  3PUN A;  4M72 A;  3S3M A;  2RVC A;  2P6S A;  2K27 A;  5E1X A;  1U8R A;  2JQ7 A;  1TWH J;  5BNG A;  1UHS A;  4URR A;  3S14 J;  2DIE A;  1O8F A;  3U2Q A;  2DYI A;  1ZGA A;  4J01 A;  4XLP F;  1R5O A;  4R71 A;  2VFN A;  2CND A;  2QYO A;  1K78 B;  3QOE A;  2KRC A;  3E6M A;  1QGP A;  1G8X A;  3ZRG A;  1R71 A;  1HKS A;  2OQR A;  2OBS A;  1H9T A;  2MH2 A;  3MVP A;  2CRV A;  1QVG B;  4LC0 A;  2CQX A;  1ZQ3 P;  3D5R C;  1RUO A;  2V6E A;  3T9G A;  1QBJ A;  3N90 A;  1J9Z A;  3TW7 A;  2IAI A;  4P1W A;  5JHU A;  5M3F J;  4MFD A;  4S05 A;  1G6N A;  4R79 A;  2G7H A;  1WSV A;  3JRH A;  2DMT A;  1OCO H;  2H6C A;  3ERE D;  1QFJ A;  1YIJ B;  2VJI A;  4HNT A;  2VXD A;  3ZP5 A;  2NRA C;  1IG7 A;  4Z4T A;  4UV8 A;  4A6D A;  3BTL A;  4NNJ A;  3Q38 A;  1OR7 A;  2XGJ A;  3JRE A;  1H8H A;  5AN9 A;  4I7H A;  1QRC A;  1ELO A;  4UZF A;  4LBV A;  4OMY A;  2VBZ A;  3JX8 A;  2EPF A;  4UUV A;  1LLW A;  2P5K A;  2J8K A;  3I4P A;  4IW3 B;  2RNJ A;  2Q6O A;  3VB2 A;  2VOP A;  1BW5 A;  1LUJ B;  1V5F A;  3OYA A;  2PEC A;  4C3J J;  3EUH A;  5JI6 A;  1P9Q C;  2JJ2 A;  4RAG A;  2W6J A;  3NRV A;  3KEY A;  2CFO A;  4N9I A;  4HX4 A;  4ASN A;  1YX2 A;  3HOS A;  2QE7 A;  2E1O A;  1OGI A;  1JHH A;  3FM5 A;  2C77 A;  2M8G X;  1H89 C;  2KIM A;  2LKP A;  4EEF G;  2GK7 A;  5HZB A;  1MMG A;  4BU2 A;  4M3B A;  2X6Y A;  5JLX A;  1JXS A;  2IA1 A;  2YU3 A;  1GV2 A;  1ZAR A;  1QGA A;  2GRE A;  5LRR A;  4QFM A;  5A89 A;  2G7U A;  1A35 A;  2BM6 A;  2CMP A;  3PA1 A;  3NB2 A;  2XAF A;  1T95 A;  5D6F A;  3P27 A;  2BGC A;  3VEP A;  3QQA A;  1IV8 A;  1TW2 A;  3CCE I;  2UXX A;  3CF2 A;  1VQ5 I;  1DP3 A;  3S2H J;  4NC8 A;  2XPU A;  3CO6 C;  4I2O A;  2MYS A;  2Y0S N;  2KJB A;  4E7H A;  4CYD A;  3EQL F;  5L3C A;  2EV5 A;  3I64 A;  3PEN A;  3SYT A;  9ANT A;  2BM1 A;  5H6R A;  3CCU I;  3CJR B;  3TL4 X;  3VST A;  2DA5 A;  5FB2 A;  3QPS A;  2VLA A;  2BM7 A;  2QVO A;  2XPW A;  3LA2 A;  5FO0 A;  2YWF A;  3FXK A;  4LIU A;  1SVM A;  1BR1 A;  4JMQ A;  4LBZ A;  3JUR A;  2O03 A;  2K9L A;  2M3A A;  3BH4 A;  1VQN B;  3VSL A;  2ELK A;  4LLG F;  4L8J A;  2W84 A;  4JP0 A;  4X0G A;  3P5J A;  5KW9 A;  2CW8 A;  2DMQ A;  5IT3 A;  4KT6 A;  1MBG A;  2HS5 A;  1FOK A;  5IYD J;  1GUU A;  3KRG A;  1HBX G;  4PDK A;  5LHI A;  3JAM K;  3GFI A;  2E1B A;  1OB2 A;  2JUG A;  1BHE A;  3HIF A;  3IUO A;  3HKZ A;  3KP2 A;  4BAC A;  4WK8 F;  1BA5 A;  4ABZ A;  3M4O J;  1Z3Y A;  1D5Y A;  1ON2 A;  1T56 A;  1TLL A;  2R5Y B;  2LZJ A;  2VNJ A;  2MFZ A;  1LNW A;  2LBF A;  1QVF B;  2CW7 A;  4U87 A;  1APL C;  2MLK A;  3LQE A;  4AM3 A;  3LA7 A;  4KDP A;  4Z4R A;  1UZC A;  4XKW A;  5JBQ A;  2YPR A;  1IXC A;  3AVT A;  2Y30 A;  4YEL A;  3PNY A;  3ZMT A;  1PDN C;  4RD4 A;  3CME B;  5BQT A;  4C2L A;  1LFB A;  4XL9 A;  4PC1 A;  1QU3 A;  5HNH A;  4CXF A;  1JNY A;  2E71 A;  4OMZ A;  2EFW A;  2QWW A;  2B7B A;  3CC2 B;  5J35 A;  2KIU A;  3H3V K;  4P3I A;  3DEE A;  3VR6 A;  2CH0 A;  4RAF A;  5F4M A;  2G0E A;  1SMT A;  1SC7 A;  3HKZ N;  5C44 J;  1JJ2 B;  1ETY A;  2K9S A;  2R7F A;  3ZQ7 A;  1O7F A;  3E97 A;  3A01 B;  3H1C A;  1CQT A;  2XGD A;  4ZDP A;  3J81 Z;  1K28 D;  2BGI A;  1MBH A;  2QEX I;  1R5H A;  2LNB A;  4D7M A;  2M87 A;  4WCG A;  2DW4 A;  5AIP A;  4F7Z A;  3JQQ A;  3T5X A;  3OL4 A;  4AF7 A;  2O3F A;  4CQJ A;  3BCD A;  2XV4 S;  2XF7 A;  4ENM A;  2B63 J;  1OPC A;  1E17 A;  1BJZ A;  2UV1 A;  5DS0 A;  1KCC A;  1FBU A;  3LNQ A;  1NK3 P;  4BXX J;  4MHG A;  5K1Y A;  3N97 A;  3F8F A;  2HGC A;  2GXG A;  3BH7 B;  1NTC A;  2K4J A;  1Z7U A;  2GZW A;  3MHP A;  1Z91 A;  1S8N A;  5GAE J;  1SFO J;  1G2H A;  3KFW X;  5LFA A;  3RIQ A;  3C2B A;  4D7N A;  3REO A;  5GTH C;  1N07 A;  3OZV A;  4F3Q A;  4C2T A;  1P4W A;  4C9Y A;  4Z4U A;  3CC2 I;  4UXN A;  1N78 A;  4RBO A;  3RYR A;  3LSG A;  2QUF A;  1W0T A;  2R7X A;  1F43 A;  2ZIT A;  4M0L A;  4LIT A;  4I84 A;  1D3Y A;  2C4U A;  2IS2 A;  1S7A A;  1V55 H;  2BM0 A;  2L0K A;  2VE8 A;  1VQP I;  4WQM A;  3WQZ A;  4CCM A;  1EV7 A;  3MKL A;  1DQU A;  5AIQ A;  2CRG A;  1S72 I;  3BPV A;  2IT0 A;  1X0C A;  1OFC X;  2YUS A;  1ZG3 A;  2DYS H;  4HNV A;  2E1M B;  3H9Q A;  1AOY A;  2DK8 A;  2L54 A;  4EVI A;  3W2H A;  5GP9 A;  3HUG B;  3QSY A;  1UJ8 A;  3JTH A;  2GA1 A;  1WP6 A;  2HTS A;  4RGR A;  2C2W A;  2NTQ A;  1MDM B;  2CBX A;  4BE0 A;  2ZME A;  4PK4 A;  1QVU A;  1TW3 A;  3Q6R A;  3BJA A;  1FND A;  2F5D A;  3K4M A;  4B3A A;  3ZZT A;  2WJV A;  5LHG A;  4L0Z B;  1A5J A;  1D8J A;  3E1Y E;  1FOY A;  2BY0 A;  2M0C A;  3ASP A;  2MBF A;  3PNV A;  4RGU A;  4IEJ A;  3ZCO A;  1SD6 A;  2EBI A;  4TN1 A;  2O17 A;  3HUG A;  1DU6 A;  1V5G A;  3LSR A;  2R93 J;  3EQN A;  3RQ4 A;  2C5B A;  4XLE A;  3H35 A;  4GGG A;  5EJC A;  4ZCI A;  4DK0 A;  4CCJ A;  2WSS A;  4PJN A;  2V7V A;  4G7Z F;  1ZLJ A;  5J8C A;  1PLU A;  1KU3 A;  1BOB A;  2JVH A;  4I76 A;  5GTI C;  2HPI A;  3C2H A;  4FX4 A;  1FT9 A;  3CCL I;  1B9M A;  4IHX A;  4FAS D;  2NOJ B;  4HE6 A;  2V1N A;  1M90 D;  2HVQ A;  4I6Z A;  1YHQ B;  1EKE A;  2DT6 A;  5ED4 A;  3VNU A;  1TWA J;  1ZRC A;  1KQ9 A;  5FA6 A;  3DFG A;  3KP6 A;  3I71 A;  5EEA A;  2R7U A;  2NYX A;  4LG3 A;  1OHH A;  2QDX A;  3OFN A;  1HF2 A;  1T8I A;  4HX8 A;  3Q5F A;  2JA8 J;  2O8X A;  3HSE A;  4LK1 F;  1KK3 A;  4I09 A;  5H59 A;  3TDU C;  3BDD A;  1HC8 A;  4A3L J;  2PEX A;  3GX4 X;  1BC8 C;  2E2H J;  2GJP A;  3K2A A;  5TIS C;  3J7A Y;  2KHM A;  4CO8 A;  4A0Z A;  5HDG A;  3IH2 A;  4KUM A;  1UFM A;  2COB A;  3DV8 A;  1OKR A;  1S7E A;  4H0E A;  4M53 A;  2CS3 A;  1WH5 A;  5CVR A;  2VKV A;  3BR0 A;  2PMZ A;  2F1L A;  2GJK A;  3C2G A;  5D4S A;  4XRS A;  2C6Y A;  3OOC A;  1BQE A;  3A8J A;  3WXM A;  2R7V A;  1IF1 A;  3DPL C;  1X1P A;  4Y33 A;  5E1W A;  1G59 A;  3AL0 B;  1B59 A;  2JA7 J;  3GQ7 A;  2JUC A;  4IX7 A;  1IJW C;  1JKP C;  4HV5 A;  1W7P B;  1KYW A;  3IKT A;  5CVI A;  2EZI A;  3Q0U A;  1O88 A;  5LGU A;  1FYM A;  2VUM J;  4HDV A;  3LWF A;  5IP6 A;  1W0K A;  2VNH A;  4RPD A;  1QGY A;  1Q1H A;  1V5V A;  1BI1 A;  3CCE B;  3CUQ A;  2DPD A;  1N0V C;  2HQN A;  2OF7 A;  2BW3 A;  1YJW B;  4LLL A;  1R1U A;  1H88 C;  3DU6 A;  1I8D A;  4YZ0 A;  1W7P A;  2XAS A;  1XGN A;  3FXU A;  4OAY A;  5K5Q A;  2Z9O A;  1S3J A;  1X4O A;  3K10 A;  3HB9 A;  4IOA F;  3KPH A;  4EAT A;  4BS9 A;  3KYD B;  2P0W A;  1BN5 A;  3FXM A;  1WDT A;  2CQ7 A;  2XRO A;  2X0L A;  3D0S A;  2DAO A;  2OYN A;  2HU9 A;  3R0A A;  3PVD A;  1Y0Y A;  3E5Q A;  2NVQ J;  2X1C A;  1W1W E;  2A69 F;  2TCT A;  4BH9 A;  3HDD A;  1Z77 A;  5ICF A;  2X3U A;  2HOE A;  4OPO A;  3CCR B;  2ZZG A;  1OCR H;  5ICE A;  1D1A A;  1TYW A;  1TC3 C;  4HBL A;  2WA0 A;  2XEX A;  3OSG A;  3JRB A;  4RDJ A;  3S15 J;  3F8C A;  4P55 A;  1G3W A;  4G6Q A;  2C78 A;  1CLW A;  3CC7 I;  3GVA A;  1OLT A;  1ZYR F;  3PSS A;  1K5C A;  1KU2 A;  2IGK A;  3FMQ A;  1PJ7 A;  2XVC A;  3PSZ A;  4L18 B;  3V4G A;  1HLV A;  1VLO A;  5D8K B;  2VBE A;  1AIP A;  1IDJ A;  4IO9 F;  2ME6 A;  1OMI A;  3A8K A;  2W1O A;  2OK8 A;  1YIT I;  1ORK A;  2WWY A;  2RC6 A;  2PMU A;  1ONV A;  2WJY A;  2DOA A;  3UNG C;  2YS9 A;  3GQ8 A;  4IHT A;  4LBY A;  3RDI A;  3ZMD A;  2CYY A;  1FYK A;  3PQJ A;  2BGJ A;  1I3Q J;  5E3O A;  4XLN F;  2GBY A;  1YW7 A;  3B73 A;  4LK0 F;  4B4C A;  3BQJ A;  4U9U A;  4DIQ A;  4E7L A;  4WXC A;  1JA0 A;  4OIO F;  1S6L A;  2VKH A;  2HR3 A;  3ASO H;  1O3S A;  3ISP A;  2AO9 A;  1HDP A;  4X7E A;  2STT A;  1W7P D;  2A5W A;  2DJN A;  1PVE A;  3HC7 A;  1W0U A;  4OWR B;  4BNC A;  2OBR A;  1JTX A;  1DPU A;  4E7K A;  2XZL A;  4YG2 F;  2XB0 X;  2GLO A;  2MG4 A;  2WZN A;  4PJ0 C;  1F20 A;  4OJ6 A;  1UHM A;  2UVF A;  1JGS A;  3CCM I;  4KA4 A;  5BS6 A;  4W8R A;  3FX3 A;  5L3G A;  1K79 A;  3GVJ A;  4BPR A;  2EIK H;  1FOW A;  2FOW A;  4HNU A;  3CDL A;  4J19 A;  1UB9 A;  4HF1 A;  1VJS A;  2ZZF A;  1VHO A;  4CH7 A;  5EDN A;  5IT9 Z;  2VJ5 A;  1WZ2 A;  5HXB A;  2A68 F;  3BJ6 A;  4Q4Z F;  1DU0 A;  3KP7 A;  5LBQ A;  3LSP A;  1SFE A;  3DEU A;  1TYV A;  3Q0V A;  3U1D A;  3SY2 A;  5J4Y A;  3HOX J;  2CV0 A;  2EIL H;  4M2L A;  3DLA A;  4DYQ A;  2J7K A;  1DDG A;  2IS1 A;  3BR5 A;  1D1N A;  1Y0N A;  2NVY J;  3IWF A;  4F52 A;  4DW6 A;  3GTM J;  3LQ6 A;  3TBI A;  3G4S I;  3OMY A;  1TL8 A;  3JQP A;  1UCR A;  5E18 F;  4G6I A;  2MC4 A;  1VQP B;  5A8A A;  2E60 A;  4UUS B;  3VWB A;  1LFP A;  5JVT A;  2QZ8 A;  2DOE A;  2LK2 A;  1IB0 A;  2VIX A;  1IN4 A;  2E2I J;  2H27 A;  3ABU A;  1EP3 B;  3RJP A;  2VN2 A;  1U3E M;  3T51 B;  3BCA A;  5CVV A;  3ULQ B;  1G7S A;  3SLN A;  3CF5 F;  4ZDO A;  5GPC A;  1DAR A;  2O6W A;  3P4G A;  2LRD A;  2QLZ A;  2P5L C;  3M9A A;  3ONU A;  3AVW A;  2VXZ A;  1QFY A;  1AA7 A;  1P2F A;  3WHB A;  3IRQ A;  1XQB A;  2EA4 A;  2HMA A;  1XG2 A;  3MCZ A;  4N0B A;  1IHM A;  3H3Z A;  4DZP A;  1O3T A;  1RET A;  2HTJ A;  3I59 B;  2DXI A;  2OAZ A;  4DGW B;  3BT9 A;  5F64 A;  1UD5 A;  2TRT A;  4P9U A;  2V7T A;  2DFH A;  2V4J C;  4JX5 A;  3I4M J;  1EXM A;  1YS6 A;  2LH9 A;  1TT0 A;  2K4B A;  2VBV A;  3CCJ I;  1F36 A;  4ZGQ B;  1TP4 A;  2NS0 A;  2K5C A;  5HLH A;  1IJF A;  1QGZ A;  2JJ1 A;  3ISX A;  3V7A A;  3G05 A;  2EFG A;  1YHQ I;  1J9I A;  1HST A;  1U0J A;  4RM0 A;  1T5E A;  2WY8 Q;  5J40 A;  2VQH A;  3CCV B;  2ME0 A;  5FL7 A;  3SQV A;  3CCL B;  2CSO A;  5FLX Z;  4PJM A;  2VC1 A;  1VFC A;  4ZZL A;  5HOD A;  3TW6 A;  3E20 A;  1OFD A;  1WXR A;  3A8I A;  2XAU A;  3KLO A;  5DV5 A;  1V5E A;  2R5Y A;  2WAF A;  3OYC A;  3JRC A;  2GOM A;  4PZJ A;  3QFT A;  3WTX C;  4P6V F;  3GFM A;  4X1E A;  3DBL B;  3J7A O;  2BM5 A;  4BKX A;  1EA3 A;  4RD2 A;  3EUK L;  1QO0 D;  1XX5 A;  3PFI A;  2OTL I;  3A1P A;  3W5V A;  5J3O A;  3PM1 A;  2NSP A;  3TOB A;  2UVE A;  2A6E F;  5J4V A;  1TTY A;  4G94 A;  4HLX A;  3N6Z A;  2ECC A;  5J3L A;  2ZFU A;  2DMP A;  1BOA A;  4CCO A;  3CMY A;  1TWC J;  2XGE A;  4AVP A;  1OFE A;  4C0S A;  4W8T A;  2EFP A;  4UNO A;  1NK2 P;  3J7Z I;  1SAU A;  2Z1D A;  1V0F A;  2HFH A;  2LKS A;  1O7L A;  2E35 A;  2W24 A;  3OYJ A;  5L3E A;  2G9W A;  3BY6 A;  1OCZ H;  3CUQ B;  3MKZ A;  2JRM A;  1KQ8 A;  2LG4 A;  5DCF A;  3DXJ F;  3FXL A;  3H5N A;  3VYR B;  4A93 J;  3WTU C;  4OP7 A;  1VQ8 B;  3L9F A;  1J75 A;  2GK6 A;  2JPC A;  3LAP A;  4HST A;  5DEQ A;  3T1B A;  1JJ8 C;  1GVH A;  4UY8 I;  2MD5 A;  1JGG A;  1D0Y A;  3I56 B;  1O8H A;  5E79 C;  4EJO A;  4QPO A;  2E1M C;  1HF0 A;  3AG1 H;  1U5T A;  3DKW A;  2QA4 I;  2PFB A;  2F43 A;  4RGX A;  1R9T J;  2LSO A;  1JI8 A;  1WOO A;  1OGM X;  3LO8 A;  4EV0 A;  4Z4S A;  1WPK A;  4GRI A;  2R7W A;  2HKX A;  4OOS A;  2L7M P;  3W2I A;  4XLC A;  4BGD A;  1K7A A;  4MXN A;  3F8M A;  4FCY A;  4BHP A;  5DN6 A;  3BNW A;  2L9V A;  5DD4 A;  1FX7 A;  1D8T A;  1H42 A;  5KSW B;  1ETV A;  1GAQ A;  2OK7 A;  4M3D A;  1LB2 A;  1FEX A;  3KL9 A;  3G71 B;  2ETH A;  2LC2 A;  4I01 A;  4GO1 A;  4ETS A;  2R7Z J;  2ZXI A;  2IPQ X;  1I1G A;  1D0Z A;  4O5V A;  2CUF A;  1CQX A;  1I7P A;  4R8H A;  3BZ6 A;  1A6I A;  1R7J A;  2HKO A;  3F9K A;  3ZQI A;  1YJW I;  1EZG A;  1MH4 A;  1OR7 C;  1L1I A;  3HAG A;  2PN6 A;  3VFZ A;  1YTY A;  1B72 A;  3MCA A;  4M4S A;  3DU1 X;  1PJ5 A;  1HSJ A;  2C4T A;  3ES9 A;  1Q81 D;  2EIN H;  1NB0 A;  1ZM4 A;  1TTT A;  1PYV A;  2IBD A;  2D2W A;  1T0F A;  3B78 A;  3S3N A;  1YI2 I;  2BHZ A;  4E0F A;  5J8F A;  2STW A;  4XSX F;  3QPT A;  3IH3 A;  4MEY F;  1TQM A;  1X2N A;  1EP1 B;  2ZME C;  1P7I A;  2MD0 A;  2V9K A;  1XTA A;  4YZQ A;  3O8H A;  2VQG A;  3CXC B;  3R0J A;  5F08 A;  3WBJ A;  2L7Z A;  4PGG A;  3ZQG A;  2D9R A;  4XD7 A;  1EA0 A;  4P26 A;  2WTE A;  2ZSI B;  3J81 k;  4RD1 A;  4A3K J;  2BY1 A;  1FWZ A;  1LE8 B;  1QUE A;  3W2G A;  2LOO A;  1X1D A;  3H3U A;  1COW A;  3RKY A;  2BE5 F;  2QTL A;  3OOP A;  5KK1 A;  1T39 A;  3OEE A;  1KQ5 A;  2K9M A;  2XF5 A;  2FXA A;  1JRG A;  3UR3 C;  1S72 B;  3SZE A;  2JMW A;  3IC7 A;  3AVY A;  2DDA A;  1IXR C;  1T98 A;  1ZM3 A;  5F0F A;  2Y75 A;  2DYR H;  2O8K A;  3E0J B;  3AFH A;  4ZZD A;  3ONY A;  3R61 A;  3Q9V A;  3L2R A;  1OCC H;  2NZM A;  2VJ4 A;  1JB9 A;  3LQQ A;  2X3H A;  3BJO A;  2B7C A;  1G7R A;  5FKN A;  3HG9 A;  2Q0O A;  1ZUN B;  2JT1 A;  5B5E C;  3JRG A;  2KZG A;  3I9V 2;  1WHU A;  2KLO A;  4Z03 A;  2LR8 A;  4RAZ A;  2LFB A;  4HRI A;  1KMH A;  4FWT A;  1IUF A;  4GDF A;  4WXH A;  3CD6 B;  1IXS B;  4CA0 A;  2QBY A;  2I10 A;  1VND A;  2XAJ A;  2ACJ A;  5DTD A;  2QSG X;  4XN3 A;  2NNN A;  3CB4 A;  4M9X A;  1OB0 A;  2MH9 A;  4G7O F;  1IRF A;  2VL8 A;  3ONQ A;  1NHA A;  3V8K A;  2XHK A;  2ZXJ A;  3GTP J;  2ODL A;  2DET A;  4XQF A;  2R7R A;  1JT6 A;  3QFR A;  3W2F A;  1N75 A;  4HWV A;  2QBY B;  3F8B A;  2VT2 A;  2EZK A;  3ZN0 A;  5HOO A;  2BSA A;  3CDI A;  2MGQ A;  3FKJ A;  3KX2 A;  1YIJ I;  3MQ0 A;  1AU7 A;  1VHE A;  1OQY A;  3TGN A;  2V9V A;  3GEZ A;  2HPM A;  2ICW G;  3FDY A;  3HTU A;  2Z16 A;  3GWZ A;  2X6O A;  3QOD A;  4HPQ A;  2NXN B;  4DK1 A;  2W57 A;  3FK7 A;  2VKD A;  2EZL A;  4BJ5 C;  1RRJ A;  1FJL A;  5CJ9 A;  4BBR J;  5F0H A;  1QX4 A;  3DU5 A;  2Q2E B;  1FMV A;  4UV9 A;  5EGO A;  2LY2 A;  4N4N B;  1J5Y A;  2HYJ A;  2MC3 A;  3UKG A;  5ERI A;  1J59 A;  1BMF A;  1E3X A;  4G6D A;  1RIO H;  5CLS A;  1O8D A;  1AIR A;  4Z05 A;  5CKT A;  3K2Z A;  1BIA A;  5TV2 A;  2Q6L A;  3M3Y J;  3DBR B;  2XAG A;  1KU7 A;  3RY8 A;  2DA3 A;  3P7N A;  2Y9Z A;  1OCP A;  2VKE A;  1VQ7 B;  3Q0W A;  4ACB A;  3WWG A;  3C3W A;  4NB5 A;  5A88 A;  3OS2 A;  4YDT A;  3O2P E;  5IP9 J;  4IHS A;  4DZJ A;  1O4X A;  2VOD A;  5E6T A;  3K4J A;  5HS8 A;  1YO5 C;  5HVQ C;  2MLG A;  3EYI A;  1XFO A;  4Y3O A;  4B44 A;  2YSR A;  4OOV A;  1BJA A;  2E34 A;  4EJU A;  2PMH A;  2QQA A;  5ILV A;  2HXI A;  2QYU A;  1Z3X A;  1KGS A;  4OJ5 A;  1P92 A;  1MMS A;  2M1B A;  1PKV A;  3CLQ A;  3NAU A;  3PNT A;  1E1Q A;  5H6Q A;  4BUP A;  1ZR4 A;  1IO2 A;  2PJR A;  4XKC A;  1ON1 A;  2GJR A;  3R6K A;  3QYF A;  2I5U A;  4WZE A;  1IN6 A;  1S29 A;  1VBL A;  1AMO A;  3BLY A;  4KN7 X;  4PC3 A;  5LD2 C;  2EIM H;  2XPV A;  4I98 B;  3CLO A;  1BN8 A;  2FNA A;  2QKM B;  3GQ9 A;  2K85 A;  3EUH C;  2CV1 A;  1TWG J;  1NRK A;  2ZL5 A;  1X1C A;  2EH3 A;  1ZHF A;  4I99 C;  2BM4 A;  4AUX A;  3KEW A;  3RKW A;  2W7Z A;  3PL8 A;  4Y17 A;  1JTY A;  3V7S A;  1VTN C;  1JJ6 C;  1QHG A;  4LB6 B;  2FVG A;  4FN5 A;  4J00 A;  3ABL H;  3ECO A;  1D5V A;  5EF6 A;  1ZR2 A;  4RD0 A;  2ZXW H;  1ODD A;  2QQB A;  3H0D A;  2Q6K A;  3I59 A;  3K7A J;  4A2U A;  1W36 D;  3ECH A;  5FLM J;  4KKU A;  2B0R A;  2FA5 A;  2QGU A;  4L9T A;  5HS7 A;  1GO2 A;  1P7J A;  1IGN A;  1OB5 A;  1XD7 A;  3E6C C;  3ABK H;  5K7H A;  2AHQ A;  1MNE A;  1WJA A;  3HRT A;  3LL7 A;  4Q48 A;  5J1R A;  1SEU A;  1B23 P;  1K6O A;  2V1D A;  1GHC A;  2ZME B;  2LYC A;  3O3K A;  2O61 A;  3DPT A;  3K9T A;  1MBE A;  2YX7 A;  2ZNY A;  2JJ7 A;  1VQ7 I;  2WY7 Q;  1VQO I;  1LFU P;  3CDH A;  2VJJ A;  1BI2 A;  4G7X A;  4F7D A;  3O6B B;  2L02 A;  2ZSH B;  4Z4V A;  3HBL A;  1WMR A;  2OUM A;  2R5Z B;  1UEL B;  4X05 A;  1YYV A;  2E19 A;  2NVT J;  2ZB9 A;  4HE5 A;  1A04 A;  4AIH A;  3PO3 J;  3WTZ A;  1Q82 D;  2AQF A;  3HHH A;  3J7Y J;  3CMA B;  4ZYG A;  3GLL A;  3U1K A;  1Q9S A;  2QXZ A;  4A69 C;  2BF4 A;  1M1K D;  5HNF A;  1FTZ A;  3QFC A;  4KH3 A;  3CMA I;  3CQZ J;  2V5I A;  5L3D A;  1HQC A;  2L7F P;  4HSR A;  3ZXS A;  3JRF A;  5JR3 A;  1FNB A;  3LOC A;  1GVD A;  2HCJ B;  4O6J A;  2LDU A;  2CC2 A;  1TYX A;  2HOT A;  3T56 B;  2X6X A;  4OZZ A;  3W3C A;  2H8R A;  2LP0 A;  3ABT A;  1VQ6 B;  5D6E A;  2BBY A;  5IPA A;  1H80 A;  1E43 A;  3ZOB A;  2BVM A;  1ACI A;  4CHU A;  2CV2 A;  5F4J A;  3KZY A;  1OGJ A;  3CTA A;  4LOC A;  4AYB N;  2H94 A;  4MYU A;  4U7B A;  1UD4 A;  2XND A;  2V31 A;  3F6V A;  1IDK A;  1BX1 A;  3IH4 A;  5DCM B;  2IS4 A;  4TMT A;  1K9M D;  3H9J A;  4BEH B;  1WI3 A;  2E1N A;  1YJN B;  3K0L A;  1TNS A;  4JRA C;  3DP7 A;  2CUE A;  2FML A;  3M7G A;  1Z67 A;  1S5L C;  1ZGJ A;  1HW2 A;  5BPI A;  3E5X A;  3L7W A;  2VBY A;  4KIF A;  1EP2 B;  3ZZ0 A;  4B3F X;  4U49 A;  1VQK B;  2MA3 A;  4RLQ A;  1UG0 A;  4WX9 A;  1W87 A;  4N9H A;  3GQA A;  4PC6 A;  1B6A A;  4UHT A;  2O1D A; 
#chains in the Genus database with same CATH homology
 2ZZG A;  1D1A A;  3VSK A;  3OR1 C;  2WA0 A;  3H5R A;  4XOT A;  4BDZ A;  3AL0 C;  1NHC A;  2OC6 A;  2BOL A;  3GVL A;  1OLT A;  1K5C A;  3FHN A;  2V7Q A;  1WTH D;  2IGK A;  4RLF A;  3NE5 B;  2F4I A;  3S3O A;  3BG7 A;  3H5A A;  3SEZ A;  3OS1 A;  2ZTN A;  2VBE A;  1IDJ A;  2KP6 A;  2RQQ A;  2W1O A;  4CUG A;  3DPU A;  3IAM 2;  2WJY A;  4BQQ A;  1X4P A;  2BVL A;  1D0X A;  2DOA A;  5KCM A;  3U21 A;  3UNG C;  3GQ8 A;  2KDO A;  1YX3 A;  2R7T A;  4G7W A;  5FRM A;  4F55 A;  5KHD A;  4XOR A;  1E79 A;  3DQV C;  4LIV A;  4RM2 A;  1SKY B;  4ZTJ A;  4DIQ A;  2R4G A;  4BEH A;  4E7L A;  2F6C A;  4BQO A;  2QY1 A;  3LFU A;  4E6K G;  1J09 A;  2VKH A;  4BJ6 C;  2WPD A;  4TKO B;  2Y0S A;  4PSX A;  2A5W A;  3CMM A;  3HC7 A;  4OWR B;  3OAA A;  4E7K A;  3A3G A;  2XZL A;  2V4D A;  4NK6 A;  4OJ6 A;  2W82 A;  4F91 B;  2UVF A;  3ZR8 X;  3D5L A;  4W8R A;  3GQB A;  3VSV A;  3CES A;  4DJA A;  2V26 A;  3K4K A;  1N77 A;  1QJV A;  3GVJ A;  2WAQ A;  2DT7 B;  5TGT A;  3I3L A;  3E1S A;  3VYS B;  3LMW A;  2NT9 A;  2MAB A;  4B43 A;  2X51 A;  4HNU A;  1UD8 A;  2ZZF A;  4IKF A;  1VJS A;  4CH7 A;  2WAE A;  5CPR B;  2VJ5 A;  3BCB A;  3A2K A;  2XF6 A;  4IQJ A;  3MD2 A;  5HKK A;  1O8J A;  2JIZ A;  1K6Y A;  2X6W A;  4BE1 A;  1BR2 A;  2CV0 A;  1NG7 A;  3DLA A;  2HZD A;  2IS1 A;  1PXZ A;  3IAS 2;  1WJE A;  4HG2 A;  1UD3 A;  4OJP A;  4E7S A;  2HVS A;  1WJC A;  4F52 A;  2JSP A;  2VPL A;  3TBI A;  3PSF A;  1X19 A;  3OMY A;  2D3N A;  2R9V A;  3ZQQ A;  4AU7 A;  1VLY A;  2XZP A;  1BPL A;  4G6I A;  2MC4 A;  5CQG A;  4YZX A;  3L2W A;  1I18 A;  2KQR A;  5CDF A;  2E60 A;  1OOC A;  3VWB A;  1LFP A;  3CP8 A;  3K4L A;  2HLD A;  3L2U A;  2VIX A;  2OV7 A;  1OFL A;  3LMM A;  4ZJZ A;  3DTK A;  4ASU A;  1WJ5 A;  3VMV A;  3T51 B;  3BCA A;  3OYH A;  3ZPP A;  3BC9 A;  1MW7 A;  2DCE A;  2UUZ A;  4ZDO A;  1UD2 A;  3FKS A;  4KKS A;  5KNL A;  2LRD A;  2UWM A;  3OYK A;  4G6T B;  3HOT A;  4QPQ A;  2VXZ A;  3M1C A;  4PUS A;  4CCK A;  1AA7 A;  4II2 A;  4BDY A;  3B4N A;  4NC7 A;  1XG2 A;  4RMN A;  2JDI A;  1Z21 A;  2W6I A;  3QYB A;  4CCN A;  3G2B A;  2LY1 A;  1O8K A;  4DOZ A;  2E5Z A;  4OJO A;  2DXI A;  4DGW B;  1ERD A;  5FRO A;  4XM3 A;  2W4S A;  1UD5 A;  1WJD A;  1MND A;  2CUZ A;  2INU A;  2V4J C;  3S93 A;  2O0V A;  4JQF A;  3VDX A;  1OGO X;  2LH9 A;  4E7Z A;  1BR4 A;  1TT0 A;  4ANJ A;  2W00 A;  4BXF A;  2JJ1 A;  2K5C A;  2ZZQ A;  3G05 A;  3A4C A;  3K6G A;  4OAZ A;  1W36 C;  1U0J A;  3OYF A;  3PUB A;  2WY8 Q;  1T5E A;  2VQH A;  1HG8 A;  4GQN A;  5FL7 A;  3TMO A;  4PJM A;  3OOU A;  1KTW A;  5HLT A;  1O8G A;  3SEQ A;  3S3M A;  2IXS A;  2XAU A;  1CZF A;  1V5E A;  1WJF A;  1QCX A;  3OYM A;  2HDW A;  2WAF A;  3OYC A;  3FPP A;  3VMW A;  2GOM A;  2INV A;  2Q1Z B;  3W2A A;  1V0E A;  2QX3 A;  3DKY A;  4URR A;  2DIE A;  1O8F A;  3SDB A;  1EA3 A;  3DTI A;  3EUK L;  2V7F A;  4J01 A;  4W8S A;  2NSP A;  2UVE A;  2AQE A;  4KIT B;  4PJL A;  1MAB A;  3QOE A;  2KRC A;  2ZFU A;  1G8X A;  2WAD A;  3ZRG A;  3AKZ A;  4CCO A;  1X1B A;  4HEA 2;  4W8T A;  1WPC A;  3D5R C;  1SAU A;  1X1A A;  2Z1D A;  2V6E A;  1V0F A;  2O0W A;  3T9G A;  4FXU A;  4P1W A;  3L2Q A;  3OYJ A;  3MKZ A;  4EW9 A;  1R6R A;  4BJT A;  4B47 A;  4R79 A;  2LG4 A;  4XOP A;  1EFR A;  3H5N A;  1TZL A;  3VYR B;  2VJI A;  1VZ0 A;  2VXD A;  4HNT A;  2F1M A;  4P22 A;  2GK6 A;  1SFK A;  4HST A;  2LRE A;  2M5S A;  4NNJ A;  1D0Y A;  1YE9 A;  2L7K A;  2X1E A;  2XDV A;  1E3Z A;  3N05 A;  1H8H A;  2XGJ A;  1O8H A;  3D5S C;  4XR6 A;  2XZO A;  3OL3 A;  4QPO A;  1DBO A;  3PFY A;  2E1M C;  1NBM A;  4XLF A;  3NWS A;  3OWT A;  2F43 A;  1JI8 A;  1OGM X;  1LKX A;  1V5F A;  3CZ6 A;  4GRI A;  4BL0 B;  2ELJ A;  3OYA A;  2R7W A;  3OEH A;  4KKT A;  2PEC A;  2X8K A;  2JJ2 A;  1P9Q C;  1D1C A;  2HQA A;  1W9X A;  4DNT B;  1O8M A;  2W6J A;  4XLC A;  2VBK A;  3KEY A;  2CFO A;  3HXL A;  4ZC3 A;  4BGD A;  1BLI A;  3HOS A;  2QE7 A;  3LNN A;  4MXN A;  2XOK A;  3K4B A;  5DN6 A;  1O8I A;  1DBG A;  3OPO A;  2KL4 A;  4B3G A;  4U4B A;  2GK7 A;  2LC2 A;  1MMG A;  2HVR A;  2VQC A;  4BU2 A;  2NTP A;  2X6Y A;  4H4K C;  2R7S A;  2ZXI A;  4YXW A;  2PYH A;  1D0Z A;  2CMP A;  2ZXH A;  3H9G A;  1T95 A;  4YZA A;  3F9K A;  1D1B A;  5CQE A;  4ZDL A;  4E4H A;  3ZSC A;  2JVG A;  5C1E A;  1OR7 C;  3CF2 A;  1DP3 A;  3HAG A;  4NC8 A;  2MYS A;  1PYV A;  3H94 A;  4D9J A;  4E7H A;  3S3N A;  4E0F A;  3SYT A;  1MMA A;  4FET A;  2IGO A;  2XSJ C;  4MLO A;  3CJR B;  3TL4 X;  3VST A;  2MD0 A;  2V9K A;  4YZQ A;  2VLA A;  2VQG A;  1PE9 A;  4XON A;  4LIU A;  3A35 A;  4JMQ A;  1BR1 A;  3JUR A;  2K9L A;  2M3A A;  3BH4 A;  3A1Y A;  4XD7 A;  3VSL A;  2ZSI B;  1W0J A;  4L8J A;  2LOO A;  1X1D A;  3IP4 B;  5JHF A;  4BE2 A;  2PJR B;  1COW A;  3ZGK A;  3OIP A;  2NST A;  3OEE A;  4X0G A;  3GBG A;  2K9M A;  2XF5 A;  1JRG A;  2CW8 A;  1YX5 A;  3UR3 C;  1KZL A;  4KT6 A;  3KRG A;  3PJR A;  2E1B A;  2A6T A;  1BHE A;  2JUG A;  2K3P A;  3LSM A;  3IUO A;  3E0J B;  3HKZ A;  4DBR A;  4BAC A;  3AFH A;  3RTR A;  3LSI A;  2D3L A;  1Z3Y A;  1RWR A;  3MKW B;  1LVK A;  3L2R A;  2LZJ A;  2NZM A;  2VJ4 A;  2X3H A;  1DGR M;  1O8E A;  2MFZ A;  4D1Q A;  3OYE A;  1Y6I A;  1GQ8 A;  4XN0 A;  2X85 A;  3HG9 A;  4NQW B;  2LBF A;  2CW7 A;  1DGW Y;  4U87 A;  3OR2 C;  3I9V 2;  4RM3 A;  2KLO A;  2CUJ A;  4XKW A;  4Z03 A;  1KMH A;  4HRI A;  2WB1 A;  4YEL A;  3PNY A;  3ZIA A;  3OYD A;  4C2L A;  4CA0 A;  4C2U A;  4PFO A;  1OFM A;  4XL9 A;  1WJB A;  4YRV A;  1QU3 A;  3SUC A;  1IRX A;  3W2V A;  4CZC A;  5HNH A;  2O04 A;  2EWE A;  4XN3 A;  4XNF A;  1OB0 A;  3DEE A;  3VR6 A;  2CH0 A;  2KVO A;  3ONQ A;  2VL8 A;  4B48 A;  2ODL A;  2IS6 A;  3RCO A;  3EPZ A;  3K70 C;  4XQF A;  2R7R A;  3FBI B;  4HWV A;  1Z7L A;  1N75 A;  2W7N A;  4ZDP A;  1HVX A;  2IGM A;  3EQO A;  3CP2 A;  3S32 A;  5HOO A;  1K28 D;  2KRH A;  3FKJ A;  2L9S A;  3KX2 A;  2PYG A;  4MR0 A;  2Z2S B;  2ZZE A;  2HPM A;  3FDY A;  2M4G A;  3OL4 A;  1E0E A;  2Z16 A;  3OYN A;  3QOD A;  4HPQ A;  4C30 A;  3BCD A;  2XF7 A;  4IZZ A;  4DK1 A;  1E1R A;  2VKD A;  1S9H A;  2UV1 A;  2R7O A;  4BJ5 C;  2E5N A;  2Z6B D;  1KCC A;  3DU5 A;  4PJJ A;  3HPH A;  2Q2E B;  1FMV A;  3VYT B;  2LY2 A;  4N4N B;  1BMF A;  3VSU A;  4DBQ A;  1T0F C;  3GVK A;  1E3X A;  2I8D A;  2GOX B;  2WBM A;  1O8D A;  1AIR A;  1FX0 A;  2RRE A;  5CKT A;  4OZY A;  4Z05 A;  2M7B A;  5LFA A;  1FMW A;  3VYU B;  4NK8 A;  4F3Q A;  4C2T A;  4C9Y A;  1KCD A;  4AYB A;  3OYG A;  1N78 A;  2VAS A;  4ITV A;  4F92 B;  4HIZ A;  3LSG A;  2FUG 2;  1UAA A;  2R7X A;  3HPG A;  3RPU D;  3WWG A;  3OS2 A;  4LIT A;  3RSN A;  3A3B A;  4I84 A;  3OYB A;  3UW0 A;  3K4J A;  5HVQ C;  2M4K A;  2IS2 A;  4KIS A;  1LDK B;  2JA2 A;  3WQZ A;  4Y3O A;  4XLA A;  4CCM A;  4NUB A;  4B44 A;  3OS0 A;  1DQU A;  1X0C A;  2NTB A;  4DNR B;  4CSW A;  2WZP P;  2VQL A;  2Z8G A;  1Z3X A;  2E1M B;  2IQ7 A;  4OJ5 A;  5FRN A;  3DTE A;  3H9Q A;  3MKY B;  3K4N A;  3HUG B;  3PNT A;  1E1Q A;  1PKV A;  4TSF A;  4BUP A;  1WP6 A;  1Y56 A;  2NTQ A;  2PJR A;  4PSW A;  4XKC A;  4BE0 A;  2GJR A;  4PK4 A;  1HA8 A;  2DJI A;  3QYF A;  4PMH A;  3K4M A;  1VBL A;  2RNG A;  3NWT A;  4N4O B;  2WJV A;  1PJR A;  3BLY A;  1KON A;  5LD2 C;  3DWL E;  2KMU A;  1BN8 A;  2QKM B;  2VBM A;  3GQ9 A;  4JOM A;  3PNV A;  3ZCO A;  3EUH C;  4B3X A;  2CV1 A;  2BSP A;  1NRK A;  2O17 A;  1X1C A;  2VB6 A;  1V5G A;  3KEW A;  3CJQ B;  3EQN A;  3LSK A;  3RQ4 A;  3PL8 A;  4XLE A;  2F5V A;  3H35 A;  1QHG A;  2CK3 A;  3QYE A;  3KYL A;  4DK0 A;  4CCJ A;  1RU4 A;  2WSS A;  4PJN A;  4BQN A;  4J00 A;  1HZE A;  3H0D A;  3ZPN A;  3M8J A;  1BOB A;  1PLU A;  2JVH A;  4XKB A;  1ZEL A;  2HPI A;  1W36 D;  3C2H A;  3GRH A;  4KKU A;  4CCL A;  4FAS D;  2X1D A;  2NT6 A;  2NOJ B;  2BW3 B;  4E7I A;  1UD6 A;  3SZG A;  4OJL A;  2V1N A;  4Z06 A;  2HVQ A;  3S8P A;  1MNE A;  1WJA A;  2DT6 A;  3LL7 A;  3MMY B;  3B8Y A;  3FBN B;  1RMG A;  1IB4 A;  2R7U A;  1OHH A;  3OFN A;  2LYC A;  1EE6 A;  4LG3 A;  3OY9 A;  2XC7 A;  3K70 D;  3DPT A;  2QKL B;  2WY7 Q;  3BCF A;  3HL2 A;  3L2V A;  3DKX A;  3B90 A;  1GLN A;  4XMY A;  3T53 B;  2VJJ A;  3PSI A;  4G7X A;  2ZSH B;  1WMR A;  2GJP A;  2HNH A;  2OUM A;  1UEL B;  3J7A Y;  1VF7 A;  2KHM A;  1IA5 A;  3FY3 A;  4UZU A;  3JU4 A;  2KPM A;  2CS3 A;  2AQF A;  2PMZ A;  4F93 B;  2GJK A;  2L9N A;  3C2G A;  3OOC A;  2QXZ A;  4U49 A;  4TT3 A;  5HNF A;  2L2O A;  2R7V A;  1JTA A;  1H8E A;  3DPL C;  2ZTG A;  4Y33 A;  1G59 A;  3DDY A;  3AL0 B;  2M7A A;  3K4C A;  4ZYA A;  4IX7 A;  4HSR A;  3ZXS A;  5IK2 A;  3GQ7 A;  4PFP A;  4Y4R A;  4ZTF A;  4P5O A;  2KZV A;  3EUA A;  3BC8 A;  1O88 A;  2M0M A;  4YEJ A;  4E7J A;  3T56 B;  2X6X A;  4OZZ A;  1W0K A;  5AMV A;  3W3C A;  3OIQ A;  1MMN A;  2O5R A;  1O8L A;  1MMD A;  4W8Q A;  2BW3 A;  1H80 A;  1E43 A;  1NG6 A;  2BVM A;  4II3 A;  3W2W A;  2CV2 A;  3DU6 A;  5C1C A;  1I8D A;  4YZ0 A;  2R7Q A;  4XLH A;  4OAY A;  2LBF B;  3K10 A;  1X4O A;  3V42 A;  4U7B A;  1UD4 A;  2V31 A;  3OYL A;  2XND A;  3OW7 A;  1IDK A;  2IS4 A;  4IQ4 A;  3H9J A;  4BEH B;  3LSH A;  4EAT A;  2L5Q A;  4BS9 A;  4Z1M A;  2P0W A;  2IGN A;  4AVZ A;  4KJZ A;  2X53 S;  3OYI A;  2HU9 A;  1QHH D;  3OE7 A;  4B3F X;  4RLQ A;  2X1C A;  1UG0 A;  4XKV A;  3GQA A;  1WFX A;  3BG6 A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...