4XLCA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlcA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlcA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlcA02
3B90A 1JTAA 2PYHA 1XG2A 2O0WA 4OJ6A 4EW9A 2X6YA 2UVEA 1RMGA 5C1EA 2QX3A 1IA5A 4Z03A 1OOCA 3JURA 2X85A 4XLAA 4XN0A 1O88A 2NT6A 3B4NA 3ZPPA 1PLUA 3ZSCA 1PXZA 1O8JA 4W8TA 4XOPA 4C2LA 2VJJA 4XL9A 3T9GA 3VSUA 4XORA 1AIRA 3VSTA 1RWRA 2VBMA 4OJOA 4XN3A 3EQOA 1OGOX 2NTBA 4NK8A 2INVA 1OGMX 1DBGA 2IQ7A 3FY3A 1O8FA 3KRGA 4MXNA 1X0CA 2EWEA 4XLHA 1JRGA 4XM3A 2NSTA 2INUA 3B8YA 1RU4A 4OJLA 1IB4A 1VBLA 1DBOA 1PE9A 3VSVA 4HWVA 1OFMA 1EE6A 4W8RA 4URRA 1GQ8A 3GRHA 2O04A 2X3HA 1HG8A 2PECA 4Z05A 1O8MA 2NZMA 2O0VA 1BN8A 1CZFA 4PMHA 2VBEA 4MR0A 1O8HA 4YELA 3VMWA 3WWGA 3UW0A 2NTPA 2O17A 2BSPA 3GQ9A 2UVFA 1O8DA 3GQ7A 2QY1A 4XONA 1KCCA 4YZQA 1IDKA 1QJVA 1O8GA 2QXZA 4XLCA 3GQAA 4YZ0A 2X6XA 4XQFA 1O8LA 4YZXA 5AMVA 2ODLA 4W8SA 1QCXA 2O1DA 2NT9A 4XKWA 1WMRA 4AVZA 4U4BA 3VMVA 5C1CA 4W8QA 2X6WA 1NHCA 4OZYA 3EQNA 2PYGA 4OJPA 1KTWA 1OFLA 4YEJA 4XNFA 4OZZA 4XOTA 4XMYA 1BHEA 2VBKA 3GQ8A 1K5CA 2VJIA 1O8KA 1O8EA 4YZAA 1KCDA 4XLFA 2NSPA 2Z8GA 4XR6A 4XKVA 2NTQA 3LMWA 4I84A 4Z06A 3SUCA 4XLEA 1H80A 4NK6A 4U49A 1O8IA 4OJ5A 1IDJA
chains in the Genus database with same CATH superfamily
3CPWB 3B90A 3HOVJ 1XG2A 3ERED 3S14J 3HGGA 1ZLJA 1Q82D 4ASUA 2VKDA 4L9TA 1HXDA 1SD6A 3CMMA 4KT6A 2CW5A 2CG4A 1BA5A 3JQPA 2ZBVA 1WOSA 5LHGA 4YHBA 2ELKA 1WGXA 2HDWA 2NRAC 5TR9A 2XNJA 5FFXA 3DKYA 4CYCA 3AAFA 3D5SC 1GDTA 2BPOA 1TYVA 1UD6A 3PIOF 3AVWA 3SJZA 4P9UA 4Y15A 3V8JA 3W2HA 2CW0F 5D6FA 4X7DA 2E1OA 2P5KA 1GV5A 4JQFA 1HZEA 2KLOA 2KIMA 1KGSA 2CRVA 2K85A 1P4WA 4A2UA 1WPCA 4AIDA 2Q6LA 1WJBA 3FK7A 3BH7B 1JKPC 3CCQI 4ESJA 1TWCJ 2O0YA 4H9GA 4QV2A 5EYRA 4PC1A 3BP8A 5E17F 2XGXA 3A0HC 3C2BA 1MBGA 2DERA 1E3PA 1PP7U 2RNJA 5IYRA 2ISYA 3KEQA 2VBEA 2M5WA 3K7AJ 4IQJA 4ON0A 1S7AA 1FIPA 3LAPA 3CUQB 3KP4A 4RA2A 4D7MA 3X2QH 3FKIJ 2O8XA 4XKCA 5CPRB 3OS0A 1SVOA 3DWLE 1CF7B 2HQRA 3LOCA 1OFMA 1EE6A 3GRHA 4GDFA 3NARA 3Q6QA 2VNIA 1ZG1A 3DBRB 5KCMA 3CDIA 5JHFA 1YE9A 2IBDA 1ZLKA 3IWZA 4YFNF 3GZ5A 2QKMB 4PMHA 1HC8A 2V7XA 1U5TC 4MR0A 1HSJA 1KYWA 1PUFB 3HEFA 3RZDJ 3HPHA 2VFNA 5F6FA 4U7BA 1LE8A 3LQEA 3VMWA 4C2UA 2GZWA 2JWTA 4PC7A 2HMAA 2W4SA 1IN7A 1GAQA 2UVFA 4G1BA 1O8DA 1BN5A 2IA0A 5ICEA 1K6OA 3OIPA 1H8EA 1OLTA 2HQNA 2GK7A 4V02C 1O8GA 1ERDA 2ADUA 2DTZA 4NC7A 4C43A 4BQOA 2XDVA 4IHXA 1WJAA 4KKTA 3L2UA 5A2QK 2JA2A 4RB1A 1E63A 5LGUA 1X1CA 3EYYA 4JOMA 1IV6A 2L0KA 3ZQIA 2BM5A 2O6GE 1QVUA 3JTHA 1TC3C 3DEEA 5A88A 4ZV4A 4M72A 3WTYC 3HOSA 2CV2A 3S1QJ 5HZBA 1QPIA 1KTWA 3M3YJ 5BQTA 3COAC 2R7ZJ 1VNDA 3H9JA 2BY3A 3FXJA 2UZKA 4RD6A 3LA2A 2TCTA 1G7CA 4B1RA 1H89C 1UFMA 2Q6OA 2QE7A 3TO6A 3B73A 1WI9A 2DA2A 1OR7C 4LGWA 2NPFA 3G6EB 2VFOA 1LDJA 2AO9A 2R3SA 3VFZA 5FO1A 3RSNA 2QSHX 2VODA 1MABA 1QGZA 3W2IA 2V7QA 1E2XA 3MZHA 2VXZA 2XAJA 1F36A 1O7LA 1SFXA 1B2RA 1U9NA 3JSPA 1T33A 1FNNA 2C5HA 1Q86D 4RAYA 3PQKA 1GAWA 1T6XA 1RMGA 2ZJQF 2FNPA 3HM5A 1OFEA 3MZYA 2AHQA 2QA4B 3DDYA 1Z1DA 1OB2A 2R0QC 4BXFA 1BR2A 2QENA 5FKMA 2M3AA 4II2A 1XCVA 3TW7A 1Z21A 2NS8A 2V6CA 2XUBA 1O8JA 2M7AA 3QYBA 2ZO4A 3DU6A 4LLLA 2W00A 1MNDA 2PMHA 3ABMH 1YJWI 4L0ZB 1N8RD 1G7RA 2LVSA 4EQQA 4LITA 1MMGA 1S7OA 4FQGA 1X2NA 3TDZC 1K28D 3CO7C 3AG3H 3IH2A 3U1KA 3ULQB 3AVTA 2XRLA 4UUTA 2QDXA 2JJ1A 3WNCA 5GTHC 1XG1A 5H2FC 3NAWA 4RGSA 4RDUA 4IXAA 4Z2YA 3I59A 3KRGA 2XPWA 5M5XJ 1YS7A 2OC6A 2LDUA 3REOA 2LKSA 3VEPA 4RDJA 3W5HA 2DFEA 2HXIA 5FKOA 2H6BA 2HR3A 3OYIA 1MMDA 5IP7J 1EFUA 3E6DA 3A8JA 4HQMA 1QH0A 3AGPA 2L9VA 3BDDA 4LFUA 4W8RA 3VO1A 4J00A 3ZQLA 5E3MA 2ZZFA 2HOAA 3NAUA 1TNSA 3QYEA 1X3WB 2V79A 3FM5A 4M6VA 1KU3A 3F8BA 2OTLI 3DTKA 3BJAA 4Z4YA 3M7GA 1ULYA 4XRSA 3UW0A 1CLWA 5KAFC 2ZNYA 3S32A 1FIAA 1W7PA 1YO5C 3L00A 3SDGA 2OQGA 1VQKB 2QY1A 3P5JA 4OU0A 5EJCA 4NUBA 2W24A 3ZXSA 3TL4X 2OTJI 1FNMA 4YIRX 3OSFA 1KK3A 2YR2A 2DK5A 2QTLA 2KL4A 1B59A 4HF0A 2RVCA 5IOZA 1QHGA 4OIPF 3Q39A 2M4GA 1WXRA 1HQCA 3ZIAA 5LBQA 5HLGA 2EFOA 1SEUA 1X19A 2NT9A 5ED4A 1FEXA 1I18A 1WJEA 1U2RA 3EQNA 4HDUA 2ZMEC 5GV8A 1OR7A 2QA4I 2BM0A 1JUMA 3SKBA 1ZRDA 1QQ1A 4WXCA 3DTEA 2ZB9A 3DF8A 3G73A 2LREA 1X1BA 1DDGA 1JJ8C 3FBNB 1JI8A 3GTGJ 1ENHA 3R60A 1SKQA 2L3DA 5B66C 2FQ3A 4V2FA 2DCEA 2JN6A 1R7JA 1PP8F 3Q6RA 1FMWA 2L9SA 2JVGA 2VNKA 2Z8GA 1V54H 2A68F 2H1LA 2W48A 4ZCIA 5FGMA 4NDLA 2BM6A 3RIQA 1YG2A 4M9ZA 3IRQA 1L3LA 3TKYA 5EEGA 2FOKA 4AYBA 3NEUA 4HE6A 3I56B 4Z4VA 5IT9Z 1O8IA 3TGNA 3G2BA 3SXYA 2KDZA 4EW9A 2V1DA 4ZTFA 4OIOF 2AS5F 5J8FA 1QVTA 2W25A 3BZCA 3H36A 4R79A 2AQFA 3VYRB 3ZMZA 1ONVA 1FRNA 2BXYA 1AIPA 3IC7A 1OOCA 4RM3A 2DMPA 4OOSA 1XGOA 2JVHA 3ES9A 4A3LJ 5J4VA 3WGIA 5E3OA 3QSYA 4XRFA 1XPXA 2L4MA 3ZPNA 4X7CA 3HPGA 4IEJA 1MBEA 4PJMA 1R1TA 3IH3A 2V9PA 2WC2A 2P81A 3U6KA 1WJ5A 3SEJA 3MMPA 2IGOA 3AG1H 1RR7A 4XLNF 1I50J 4ANJA 5HDGA 4KMFA 3CC2I 1YJNB 4NBSA 3F21A 2VNJA 3JTGA 4L9VA 2EIXA 4MTEA 5JLXA 4OJOA 1BW6A 4MQ9F 4EGYA 2P3MA 2QF7A 4QVAA 1R1UA 1G59A 3VB2A 1JHFA 1W0UA 3H5NA 4IOAF 2LBFA 2GOXB 4HV5A 5ICGA 1KK2A 3CD6B 4U9UA 2BX6A 5KVRA 5JFRA 2E35A 2HYFA 4I0BA 5DD4A 5IPAA 2GQFA 2DU9A 1NDHA 3I9V2 2V4DA 4N3NA 1RU4A 3E7LA 2FE3A 3K4JA 4X6AJ 1DABA 4ZYAA 2A05A 3KP7A 3WHBA 5EG0B 3SZTA 2HXOA 2Z33A 3CJRB 2R7SA 5L3EA 3N4MA 3ZQHA 3VNUA 3L9FA 2K27A 4KMUX 3MCZA 4OPVA 3HZJA 4UHTA 4MTDA 1RRJA 3QRFF 2QSGX 5FROA 5EF6A 3LQ6A 3CC7I 4I09A 1B4AA 1FP2A 4LD5A 3BROA 3CJNA 4TMXA 2QCOA 4A12A 3GW2A 4ZDLA 4XBFA 1XFOA 4CA0A 1NK2P 1R00A 1RESA 1Y8QB 2LG4A 3FMRA 1K8FA 3BTLA 2OCCH 4KT5C 4M9SA 5JI6A 2FMLA 4ZTJA 3S1NJ 1TNTA 2PX9A 1EFRA 1WOOA 2G7UA 3ABTA 2K9SA 5FFZA 5E18F 4OPWA 3FXUA 2I10A 3BCBA 5AONA 1Y0YA 5IYPA 4LJZF 2E1BA 1R49A 1UD8A 1MBFA 3EUHA 2ZFWA 1XB4A 4C3JJ 1T6YA 4TT3A 1R4NB 3CCLI 3JQRA 5KK1A 3DBLB 2DOAA 1MJBA 1FSEA 1LDDA 3FWEA 4OAZA 4R1HA 3F6VA 4NHJA 5ICCA 4RPDA 4U4BA 1TLLA 5DV5A 4BYYA 2H94A 3OPOA 1F43A 3KCCA 2DA3A 1XSXA 2VYQA 2DXIA 3F22A 1WPKA 4EEFG 2M9HA 4GYIA 3S1RJ 4EJTA 4IHYA 4ROXA 1EV7A 1OCZH 3WHCA 2QEXI 4OIRF 1XS9A 2VBSA 3K6GA 3GQ8A 2XB0X 1LM1A 4ZGQB 2D1HA 4PUSA 4DNCA 1SMTA 2MC4A 1BW5A 3CMEI 1NH3A 2L4AA 2NS0A 2X1DA 2XRNA 3GYHX 1U3EM 1DARA 4RD3A 3V7AA 5BSXA 3QWLA 3S17J 2WA0A 3V42A 2CH0A 3L2QA 2DJIA 4QTRA 2IA2A 3AKZA 1W7PD 1P7IA 4M0LA 4WWVA 5C44J 1FBSA 4XKBA 4EM1A 1VQ5B 5D5XB 5TGTA 3BG6A 1O4XA 4A6DA 4Y9RA 1DGWY 2D3LA 2JSCA 4PZJA 4IKFA 2CJJA 1WRJA 3SHFA 3W6KB 3MKZA 3K4MA 3TOBA 3RTRA 3GO5A 2FUG2 4UNOA 3JRCA 2DY1A 2NT6A 1IRFA 2ZZGA 2BSAA 1IRXA 2CQXA 2MD0A 4IVNA 4FN5A 4PJNA 2GOMA 3B6AA 1TWGJ 3QFCA 1VLYA 5DN6A 2OYNA 4RD4A 4TMVA 2VJ5A 3MEXA 4HNUA 1SC7A 3O2PE 3SZEA 1IXCA 3C1DA 1ZUNB 2DEUA 2IA1A 1QRYA 2WADA 2LZJA 4LB5A 3LQQA 2A3SA 2OF7A 2YUSA 2E2IJ 1OGOX 2P4WA 4C0SA 2IS1A 4NK8A 5JHUA 3O3KA 3IV5A 4E7LA 1H85A 1OPCA 1OISA 1S0UA 2WZNA 1YTYA 2WTEA 1A31A 1HOMA 4Y17A 1QFJA 3OW2B 3HGYA 2OBPA 4OAYA 2BVMA 6PAXA 5GP9A 4XRMA 1VBLA 4DBQA 1YHQI 4MYTA 1IGNA 3SYTA 4M6XA 4RB2C 2BY1A 2L02A 2QM3A 2R7OA 4I99C 4DOZA 2F4NA 1B9NA 2FF4A 3HHGA 4KN4X 1IZ1A 1TWAJ 3IKVA 3A01B 5L3CA 4X07A 4A5NA 4X7EA 2CRGA 2EB7A 2QLZA 5LD2C 4BY1J 1Y8RB 3E5QA 3PA1A 4P6VF 5B1AH 3U2RA 4RJLA 4WZKA 1ZM3A 2R5ZB 2LKXA 3S15J 3MMYB 3R0AA 5THXA 3S2WA 1OCPA 2VBXA 3PL8A 2JJ2A 4CHUA 2VBUA 1SFEA 2HQ5A 3OKXA 4BXUA 2W7NA 2AXTC 3T8TA 2EFNA 4RDLA 2NTPA 1G3YA 4WZTA 2QEXB 1YW7A 3BY2A 1FOYA 1X1PA 1Z67A 2XSJC 2K5CA 3UKGA 4PSXA 4A3GJ 3LNNA 1EZGA 2R7XA 1FWZA 1WFXA 3VSKA 2CFXA 4YZQA 2GM4A 5D5VB 1U5TA 2R5ZA 3K4NA 2OBTA 3QFTA 3CC4B 4DJAA 2QXZA 4WXDA 5F0HA 4ENMA 2FMYA 2H8WA 1R5BA 5AMVA 4N4NB 2KPMA 2DMNA 2Z3YA 3JR9A 3K4CA 4HAMA 3R6SA 3PFIA 1Y1WJ 1UG2A 3PQJA 2I1LA 2GA1A 3DEUA 4ZYDA 3BPVA 2OUMA 3UNGC 5KNLA 2PYGA 4ESBA 1LFPA 4A3DJ 4RCZA 3A8IA 1YJWB 4IHVA 1MSFC 2CYYA 5GAGJ 4B47A 2CS3A 2M30A 2HEOA 4OINF 5FRMA 1IRZA 4X7FA 5L3GA 4YXWA 2R93J 1YOVB 1JT0A 3EQLF 2OBSA 1JHHA 2FU4A 2NSPA 1SM4A 2HDCA 4YFXF 3LNQA 2VONA 4HPQA 1CNEA 3GSIA 3RYRA 2DIEA 3JCUC 4YIIA 4IPAA 5LGNA 1P7JA 5HS7A 2XROA 4CUGA 3OYMA 5CVJA 2KHMA 4RAZA 2ECBA 4NQWB 3RJPA 1HLVA 1LLWA 1GVDA 3LVBA 2C6YA 4BEHA 3QE2A 3G05A 2WAFA 4GGGA 1OMIA 2JTVA 1C0WA 1UJ8A 1OYIA 4XRSG 2L9NA 3JURA 4HF2A 2VZLA 1PLUA 3HSRA 3LFKA 1JKOC 1Q1HA 3A0BC 4B3XA 3JAMK 5J3OA 3E0JB 3DPLC 3K4LA 3E1SA 2HPMA 4NCNA 1KQSB 2HZTA 1K79A 2XT4A 3G71I 3PO2J 2F43A 3CC2B 4UUSB 1RUNA 2Y2ZA 3BR3A 3CRZA 1TWFJ 3FPKA 2BEOA 2EK5A 3MKYB 1D1NA 1AIRA 4CYDA 5DD8A 2HQAA 2X51A 3FMSA 2VBWA 4Z1MA 2BE5F 1XDSA 4RLFA 3JREA 3CXCB 2YWHA 3WODF 3MZ8A 4O6JA 3RZOJ 1NG7A 1U0JA 2F6CA 4HW0A 4AD9A 1VQ9B 5GADJ 4IO9F 2M5SA 2E1MB 1X0CA 3QU3A 1JRGA 2NSTA 1L0OC 1DDNA 1IB4A 5IYQA 3KPHA 2NVXJ 1MW7A 5JVGF 2BGCA 4HG2A 2ESNA 1Q81D 1E0EA 2HKOA 4G9YA 4JBAA 3CJTB 1CGPA 1YJNI 1Y0RA 2OCEA 1J2XA 1VQLI 4KKSA 4IRHA 2GXAA 4G6IA 4YC5A 2M34A 2XASA 2G0EA 2UV1A 2ZMEA 4E0FA 4P9FA 3WWGA 5E3NA 3OEHA 3JW4A 3V4GA 1CF7A 1W2BB 3PSFA 1HBXG 4D0PA 4Y7NJ 1EXMA 3IRRA 1BX1A 5E6TA 5IP6A 2XTXA 4KYWA 1TYWA 5EEAA 2ZMEB 2BVNA 1JT6A 4I02A 2LKPA 2YS9A 4JX4A 2XAQA 4KICA 1SFOJ 1ZN2A 1REPC 4Y9UA 1KQ5A 3H9QA 4A3CJ 4P3IA 2JUGA 2RC6A 4L8JA 4M6YA 4FT8A 3ZMUA 3R6JA 1IC8A 5ILVA 3H0GJ 2JRTA 2MH2A 5LMZA 2RQPA 2IS2A 5CDFA 3CC7B 2P7VB 3WTZA 1MJ9A 2L54A 4OMZA 1WSUA 4J0QA 1QA6A 3FXKA 4G7OF 1PKVA 2PMZN 4ZYHA 4BQAA 2RNGA 2MABA 4X06A 2XC1A 2M2EA 2BV3A 1U9OA 4GCVA 2C2WA 1MJAA 1OJLA 4XLEA 4BKXA 1VQ5I 1YX3A 3SUCA 2EZHA 1A5JA 4G6TB 2W57A 2VBZA 2DOGA 5M5YJ 2JA8J 3VYTB 4HSTA 4TKOB 2Q6KA 2R6HA 3CDLA 2V7VA 1FYLA 4F3QA 4CGZA 1J59A 3HC7A 3EYIA 2F5FA 5EEHA 5DCFA 4ABZA 5FB2A 4FTHA 4ASNA 4HX8A 4KNYA 5M3FJ 1AWCA 2XVCA 2ESHA 1WVRA 1UHWA 1Z91A 2IVMA 3I71A 4Q5SF 1JB9A 2K9MA 4IOCF 2NS7A 1N75A 4TN1A 1QVGB 3V7SA 4FX4A 1BQEA 1DQUA 3P9KA 2NVUB 3CMYA 1AHDP 1K4TA 3OWTA 3GTLJ 2E1CA 2VQCA 1ZGAA 4ZCMA 2KZVA 4D5CA 1R9TJ 2EIJH 2VBMA 1T2KA 1SKYB 1Z3YA 2VE8A 2DFIA 4M9XA 2JDIA 3W3CA 2DMQA 4BEHB 2HI3A 1GHCA 1DP3A 4P1VA 2MH9A 3K69A 4BGDA 2IJLA 3OS2A 3KZIC 2F5VA 2X48A 5B1BH 4ITVA 4I0AA 4U0VA 1BR4A 2E36A 1XGNA 4O3MA 1FOWA 3HL2A 1QO0D 2OZ6A 4YZAA 3HHHA 2CU7A 2XKPA 2DT6A 1MBJA 1XGSA 2YPRA 4L9JA 4UUSA 2M1BA 1EP1B 1IJWC 2ACJA 4U88A 1D8TA 2QGGA 3A03A 2DK8A 1BBYA 1SD5A 2B7CA 4RGXA 2K3FA 1GV2A 1KU9A 1WKMA 1SAXA 1O8MA 2QYUA 1V0EA 2BM4A 1KYZA 2K02A 3G1OA 1WJDA 2H8RA 4V19K 2A6HF 4UXNA 1HDDC 1FTZA 1K61A 4UV9A 2EWNA 3ZZ0A 3J7AY 1N77A 2DBBA 1EFCA 3VOEA 4BJTA 1ZGWA 3CP8A 2M0MA 3TBIA 3DKXA 3ZQQA 2JA5J 2HLDA 1JUPA 3WTSC 1A6IA 1BI1A 5K5QA 1QJVA 2EFWA 2E5ZA 1U5TB 3GLXA 3W2AA 3HOTA 3A8KA 2PMZA 3RQIA 3AG4H 1O8LA 3KLOA 2W6JA 1UAAA 4RD0A 3MAJA 4E7KA 1ZH5A 4MEXF 1O57A 2GLOA 1KK1A 4XKWA 1Z05A 4HDVA 1T39A 3OYCA 4BXXJ 4W8QA 5J4YA 2F5DA 1NK3P 1D1BA 1ZR2A 4PGGA 3ZZTA 3ISPA 3DQVC 2NNNA 3IAS2 2X0LA 3BTIA 3G1MA 1F60A 1IJFA 3M8FA 4FETA 1IV8A 3CESA 4BHCA 2NOJB 3HTUA 2L7FP 2WWYA 1BC8C 4S0HB 1W9XA 3NE5B 3HUGA 4Q47A 3IHUA 5HNHA 4B3FX 3OYKA 3OP1A 1TTTA 4HEA2 5HODA 1STZA 1BIBA 2GREA 1KZLA 4E7ZA 2CBXA 3LA7A 2LY1A 2OAZA 3JRBA 4LB6B 1T0FC 4BNCA 1JNYA 3GTMJ 5D4RA 2ZBKA 1FOKA 1H8AC 1ZK8A 3CCQB 2L2OA 1DG1G 3GFIA 2DMTA 1YLOA 2VOPA 4B44A 2O0WA 2Z99A 3TO9A 5DYMA 3ZMSA 2O8KA 1Y1VJ 3VYUB 1OYWA 2DMUA 1S5LC 3I55B 5C1EA 3S3NA 2QZ8A 1V5VA 3CTAA 4PCQA 2LBFB 4Z03A 2GJRA 1U6GA 4WZEA 3RY8A 2HGCA 3M07A 2BW3A 3JAMZ 2L7KA 3ASPA 3BR1A 1FC3A 2EQRA 5H6RA 3RCOA 2DETA 2E2HJ 2STWA 3R6KA 4LOCA 5IYDJ 4RGUA 1JGGA 3I4NJ 4ZYEA 3FXOA 1ODDA 3OOUA 1TBXA 2B0LA 4F91B 5L3FA 4C3HJ 1P4MA 5D5UB 3ASNH 4EJOA 3F6OA 3RKYA 1P2FA 1PJRA 1J7KA 5DS9A 5KAIC 3WTVC 4AM3A 3F9KA 1VQ7B 3WGGA 1E79A 1QPMA 2E1NA 2V6EA 2OD5A 1E17A 4Z4RA 2HOEA 1R71A 5HZAA 3CCEI 1JTYA 2Q2EA 4A93J 4XLPF 4O5VA 4IHTA 1SFKA 3PUNA 4S05A 3HIFA 4PJJA 4TV7A 1FSHA 1LNWA 2D2WA 1QHHD 3SQNA 4CXFA 4OJLA 2IW5A 1N05A 3AVUA 5J1RA 3EETA 1V5EA 3EUHC 4BE2A 4HBLA 1VQMI 4YDTA 2XZPA 5ILUA 3FKJA 4FE4A 1U78A 3FM3A 3WXMA 2CWEA 3OR2C 4OOVA 1XD7A 5LHIA 3S8PA 1TVCA 3KZYA 1W5SA 4P6YA 3SLDA 1POGA 1S3JA 2KIUA 1GVHA 4UAJA 1ZM2A 2ZL5A 2O3FA 3V8LA 1H8HA 2KRCA 4GYGA 5LRRA 2E1MC 2CUZA 1UB9A 1KQ0A 4BL0B 3U1DA 5DCMB 1OFDA 2BSPA 3GQ9A 3D1NI 1Y56A 1WZ2A 2XNDA 2JRMA 3O8GA 1E62A 3G6EI 3DPUA 1W36C 2CNDA 5E1WA 2CV0A 4R71A 4XICA 4YZ0A 1R6RA 3HSEA 2PE3A 2V5IA 3H3VK 2JPCA 2A6TA 4P22A 3M1CA 2JIZA 1I7PA 2LF7A 2VPRA 2VFPA 3Q38A 2MC3A 3RKWA 1W34A 4OM9A 2A69F 2CW7A 1HW1A 4FX0A 3A4CA 3CO6C 1F9NA 4I76A 1FBQA 2JPBA 3FZVA 2BM1A 4RPBA 4TMTA 4G7WA 2FOWA 1JKQC 3CLQA 2LP0A 3K1NA 3G71B 2JA6J 2XHKA 4EGZA 1Z6TA 3KX2A 5J8CA 1W1WE 1QNTA 1SVMA 1G7SA 4OPOA 1YS6A 3CCSB 3IWFA 4KDPA 3DU1X 1O8KA 2ZCWA 4C3IJ 1QFYA 5FD5A 2R7QA 3LSIA 2WPDA 1GO2A 3E1YE 3CF2A 1V0FA 3GXOA 4CICA 4Z06A 2NAZA 1ELOA 1TQIA 2DQLA 5ILSA 3CZ6A 3HRUA 3WU2C 2K4BA 3SZGA 1OYYA 3ASQA 4PABA 2PBIA 3A3GA 2D74A 2G9WA 4M53A 5TJJA 4UB6C 4F7DA 3OIOA 4DYCA 2EIMH 3MHPA 1WI3A 4S04A 1Z3XA 3CCMB 1YIJI 4RCYA 4KFCA 5KW9A 2DA1A 4BQQA 3CJQB 1FNBA 2X85A 2CO5A 3I0TA 5HNFA 3ZSCA 1D1CA 3CCJB 3AL0B 5B6IA 3J81Z 4J19A 4ZC3A 2DFFA 2YX7A 1SANA 2DOEA 1NBMA 2O6WA 3WTUC 1EFTA 2D3NA 3HOZJ 3RKQA 4PGHA 2DFHA 4D9JA 4A3FJ 1WJCA 3CCRB 1VQKI 2P7CB 1ZELA 3GZNB 3OS1A 2VC1A 4QLCU 1T5EA 5K7FA 2GXBA 1QZZA 3BQZA 5CQEA 3QPTA 2GJKA 1QBJA 2LYCA 3OZWA 3HOUJ 3KYDB 1V3FA 2MBFA 2I8DA 2INUA 4HV6A 4I01A 2YX4A 2OBRA 2D5VA 4ZDOA 3SLNA 2DN0A 2QSFX 2HDNB 3T51B 3DTIA 1IDJA 1JUSA 1WP6A 4DW6A 4DYQA 1LLZA 2X53S 3ASTA 2UUZA 5TRDA 3I3LA 2R7RA 1J9IA 3M8JA 3K2ZA 1MNMC 3WY9A 1HG8A 3S93A 2NVYJ 2NZMA 4A3JJ 1OCCH 3C3WA 2FX0A 4WWCA 4N0BA 1KK0A 2RGVA 3EDPA 3U6BA 3LSRA 1W0TA 1H9GA 1Z7UA 2JUCA 3H92A 3GF2A 3MVPA 2WBMA 2C77A 1EH6A 1EH8A 1RQPA 2WYRA 2RREA 2MG4A 3Q0WA 2A6EF 2PEXA 2R92J 1GR1A 4PSWA 1APLC 2NVQJ 1F20A 2O03A 3ZPLA 4QPOA 2FBIA 4MFDA 4RD1A 2Z2SB 1E3XA 2PQ8A 2LY9A 4HYEA 4BJ6C 3SJMA 1D5YA 2O1DA 1F1ZA 1Y0UA 4M3DA 1WH7A 2EV0A 1N06A 2BF4A 3W2GA 1G6NA 5F1RA 4HLXA 3GTOJ 4F93B 3OYLA 3VR6A 1W36D 4IHWA 1BI0A 2Q0OA 4CCLA 2BYVE 4F7ZA 3LSHA 3CC4I 4Z4TA 5KSWB 3KEWA 1VQ8I 4YEJA 4E70A 1WOPA 4M1KA 3TH0A 1S9HA 3T56B 4AF6A 3K2AA 1KMHA 1XMAA 3ZQGA 2EINH 4DQKA 1D8JA 1G4DA 1IDYA 4L5JA 2Y9ZA 4I2OA 2VJIA 2WR8A 3GVJA 4FXUA 2XAGA 3GIRA 4RBOA 4XLFA 1NG6A 3S1MJ 4CZCA 5K1YA 2KJBA 4YG2F 4D7NA 3FXMA 2O9LA 3L7WA 3H1CA 2Z16A 4LBVA 2OQRA 4A69C 3G4SB 1QFZA 2GJPA 3DLLF 4BQNA 3PETA 3FXQA 5F1JA 1T38A 3BTJA 5IT9K 1Q9SA 3QYFA 2X6YA 1UD3A 1EA3A 2OK8A 1ETWA 3FBIB 2FBHA 1TSPA 1QA3A 3F72A 5JR3A 3MN2A 5JVTA 3H09A 4DQ2A 5K7HA 1K83J 3SEQA 3OJWA 4EJVA 3CCMI 4YAOA 1ETXA 1XMKA 4LIUA 4MQVA 4WZLA 2BOLA 4MGRA 3EUAA 5TY0A 1PJ5A 3V8KA 1WHUA 5IP9J 3RPUA 2HCJB 3ISXA 4XSXF 3KLNA 1IUYA 4TMZA 2XAHA 1JE8A 3VWBA 5LLQA 2VB6A 3OY9A 4HNVA 5E20A 2BGJA 2VJJA 3T9GA 3O8HA 1MH4A 2VNHA 4OWRB 1MH3A 1FPQA 1BI3A 3DV8A 4Z4UA 1G3TA 1P92A 1WCMJ 3H0DA 3EQOA 2BBYA 1T6ZA 3P27A 3H9GA 1JJ2B 1DBGA 3IUOA 3KZZA 4RAGA 3J7YJ 2F1MA 2VQGA 1GJRA 2EIKH 5DM7F 1OB5A 3KP6A 3PM1A 3U21A 1IO2A 1XC5A 3BTCA 1NB0A 1VQOB 4XLHA 1VQPB 1WH5A 2WB1N 1IN4A 4CCNA 3J81K 1RQRA 4EJWA 2B63J 2CGPA 4BHBA 2CQQA 3M8EA 5J1UA 2MFZA 2ICWG 2FVGA 1E1QA 1Y0NA 2HS5A 2ZSIB 4PC6A 2XKOA 2XB5A 3QODA 1S8NA 2WV0A 4QSHA 2EZKA 3BQJA 4URRA 4M4SA 1RIOH 2Y69H 2K9QA 3K4KA 3T1BA 5D8LB 4BS9A 4CYCB 3GWZA 2EFGA 5F0FA 2ZZQA 1VQ7I 5JBQA 1COWA 1XTAA 2J8KA 4ENNA 1RKWA 1ZG5A 1I1SA 2X9DA 1YJ9I 3LFUA 1DPRA 3TQNA 2XAUA 4JP0A 2MW8A 2YWFA 1XB2A 1WDTA 3OYHA 5IYWA 4BJ5C 1FRQA 4B43A 1BOAA 2R7DA 3WTWC 1VHOA 4JRAC 3AL0C 3WU0A 3OOPA 4I6ZA 3GQAA 2X6XA 4C2MJ 3KFWX 1OCRH 2OK7A 1TZLA 4IQ4A 2LMDA 4EM0B 1HW2A 4YZXA 2XZOA 1RR8C 4FK8A 1USTA 4KISA 1MBHA 1ON2A 1P6RA 3P9IA 5BPIA 2O7OA 1FMVA 2X6WA 2YUHA 2JA7J 2OTLB 2LH9A 4MFEA 2XGEA 3PO3J 3Q3AA 2CUJA 4YAFA 2Y9YA 2V9VA 4BDYA 1LQ1A 1BJAA 2R7FA 1BC7C 1CNFA 2ZL7A 5GV7A 1RC9A 2QGUA 2IGKA 4W1UA 3Q5FA 2KFDA 3LA3A 3I56I 4E7JA 2ZXWH 1TW3A 2DPUA 2GPJA 1ORKA 1TT5B 4EMSA 2DPDA 2F48A 1XE1A 3ZUGA 5DNSA 3WYAA 1XX5A 2KP6A 3SY2A 1MNEA 2AXLA 1YI2B 1X1DA 3F8NA 4LMYA 1EF4A 1PVEA 4BACA 3ZP5A 1W0KA 1WORA 2PLFA 5BSYA 3JRGA 1ZRCA 3H35A 4XN0A 1O88A 3FPPA 1A35A 2VT3A 4HQEA 1YLFA 4DK0A 4ZZDA 4ACAA 5E3LA 4Z6YA 3GEZA 3S3OA 1QGPA 3FISA 2FQ4A 2RC4A 3EPZA 3F3XA 3GVLA 4XK4A 5TISC 3BH6B 3ZN1A 3FK6A 4XD7A 4N4OB 3NB2A 1XCBA 2QQBA 1AU7A 1GLNA 1NHAA 2LTPA 2P6TA 2Y0SN 3HOYJ 2ZL6A 4Y7CA 2DDAA 1ETQA 1LFUP 4Q4ZF 1F4KA 5FD6A 3A3BA 3O6BB 2F2EA 1P9QC 3Q0UA 3MCAA 3OEEA 3D26A 5AN9A 3PJRA 3ZN0A 1LE8B 2BN4A 2QBYA 1TQPA 1ACIA 2MD5A 1T08B 2LLKA 1XSVA 4Y33A 4Z4SA 3R61A 5CVIA 2H09A 4N3GA 1QRCA 4YEIA 1JXSA 2CC2A 2GWRA 4JYKA 2K9LA 4A3IJ 2COMA 2JQ7A 3A2KA 3R4KA 4A0ZA 5EGOA 2ME0A 1VQNI 5K7ZA 2RV8A 1GQ8A 1QA2A 3BJ6A 2R7VA 1K9MD 1VTNC 1FYMA 2ZXJA 1IRGA 3ZRGA 2MLKA 2KQRA 2VQLA 2QBYB 4Z05A 1R22A 3E5UA 3RDIA 1GXQA 4G7ZF 3I58A 2HOSA 2TDXA 2ZITA 4YELA 1QUEA 2A61A 2X4HA 4UVCA 3J7AO 2O61A 1BJKA 3U9GA 2BMWA 4TSFA 2E19A 1D3YA 3JRDA 4ACBA 2FD5A 2DOFA 3MQ0A 4II3A 2O17A 3TP0A 1FNCA 3HB9A 3SDBA 2V7UA 5J1YA 3W2EA 2PJRB 3ASOH 1AA7A 2HPIA 1E3OC 4N9HA 3F8CA 3ZGKA 3A1PA 3ASRA 5EDNA 4J01A 1BMFA 2VL8A 4HIZA 1TTYA 1Q7YD 5FLVA 4E7SA 1YJ9B 3BLYA 3A35A 2VE9A 1KQ9A 4D1QA 1W0JA 4W8SA 3RPQA 1OHHA 2HYJA 2ZNZA 2V4JC 3WG7H 2D45A 3E6BA 1ON1A 4UZUA 3OYNA 3BZKA 2HZDA 2ZTNA 3OZVA 3AGQA 2H27A 5A89A 3L2VA 3JX8A 1N25A 4OZZA 4W97A 4A0XA 1FYKA 1AKHA 4XMYA 2V7TA 4D5FA 3W5UA 3AG2H 5D8KB 5HDNA 2DQRA 3OYDA 3FXRA 3FJOA 1O8EA 2ELJA 3IP4B 2MLGA 1FOXA 2XGDA 3CUOA 1D2EA 4AYBN 4XR6A 2QUFA 3BT9A 4HNTA 1CQTA 1HVXA 4HE5A 1R1VA 2IEKA 3OJXA 3ZMTA 1YW9A 4HX4A 1QX4A 3DCFA 1VHEA 3B6CA 3K4BA 4CH7A 3SFIA 2BHYA 1V55H 3LYCA 4OOIA 3LSPA 1Z77A 3BY6A 1S29A 1NTCA 5HLHA 4G1VA 5HLIA 1YITB 1VQ6I 1ZRFA 3LSKA 3JU4A 4ZGNB 4DZJA 1TYXA 2VKHA 2KVOA 1ZG3A 3BR2A 3K1PA 3J7ZI 4Z4ZA 1WWXA 2F4MB 1ZKGA 3HRMA 4XLAA 4RM0A 5CJ9A 4HA8A 3HOWJ 1WJFA 1ZTRA 4RAFA 1PXZA 4W8TA 1QGYA 4B3GA 1BI2A 2BY0A 4XOPA 1X2MA 1FTTA 3CB4A 2IGMA 2QKLB 1JTXA 4A3BJ 3F8MA 3CCEB 4M73A 1IXSB 1G3WA 2L7ZA 5FLMJ 3WE2A 3KP2A 3CCVB 3VSUA 2JK3A 3FIWA 3A1YA 1Z0XA 1KC8D 3OSGA 1GT0C 4A6EA 1KCCA 2WY8Q 3AK5A 1YHQB 4AIHA 2HVRA 1KQ8A 4PGOA 4YAWA 5FNZA 2HTJA 3OMYA 1VQMB 1XSDA 2XZLA 3C2HA 3PIPF 5F08A 1VQOI 1O3RA 2WJVA 1X3UA 5FKLA 2P5VA 3K9TA 3W6JB 4ZZLA 2OU2A 1MDMB 1MRZA 3CPXA 4JX6A 4IX7A 2EWEA 2JJ7A 4BU2A 2B7EA 2EA2A 3A02A 3SJPA 5DUIA 4GFBA 2XSDC 4B4DA 4Y4RA 1ZGJA 2E7XA 2XV4S 5F04A 1PJ7A 2LF8A 2OTJB 4WQMA 4AF7A 4P2NA 2ELHA 1RKTA 5FO5A 1QQIA 2DA4A 1IB0A 2LSOA 2KJCA 4YCQA 1B23P 3I64A 2DYSH 1OCOH 2DW4A 3OL3A 4I98B 2P6SA 2DA6A 2RDPA 2DA7A 3DBHB 3ABUA 1VLOA 1T8IA 3WTTC 2VKVA 3MWMA 1E43A 1RNLA 1O8HA 4MYUA 2XEXA 4WK8F 1YYVA 4CCKA 3PFYA 3J80Z 1LKXA 3FX3A 2W82A 1EA0A 4BPRA 3LSJA 1J09A 4KIFA 2L7MP 1K4SA 5F27A 4L5IA 2WZPP 1JKRC 1J0RA 3GQ7A 2ECCA 3TEDA 1B8IA 3LJYA 4QWQA 3OV8A 2E71A 5BNGA 5L46A 1OCTC 1B8IB 2CFOA 5DSZA 1IDKA 5CVRA 3HBLA 2G0YA 2VFQA 2VKEA 1YRNA 4RB0A 5E8IA 5A2QZ 1Z7LA 4CZZA 1ETOA 1FBUA 1MD0A 3ELKA 2ID6A 3NWTA 3ASSA 2ODLA 5LRSA 1R5HA 2RKHA 1LEBA 2E1RA 3KP5A 1TYUA 5DCMA 3MFKA 4KKUA 1A04A 2LRDA 4AIJA 3ZC3A 3CCYA 1WMRA 5ICFA 5C1CA 4OZYA 2JMWA 1U8BA 5LGTA 1ITYA 2YU9J 2O5RA 3ZQFA 2ZZEA 4P9SA 3BR5A 4U7DA 3Q9VA 4YFOA 2EZLA 1UZCA 2L5QA 2C4UA 4XNFA 2NNYA 1N07A 2XTWA 2FNAA 5GTIC 1S72B 2QQ8A 3RI4A 3PVDA 1R5OA 2FXAA 2EBIA 3GVKA 1FX0A 3J81k 3QU6A 1J5YA 1KCDA 4IW3B 2GK6A 3JRAA 3GTKJ 3H9NA 2NTQA 1QZEA 2V7WA 2XTYA 5HKKA 3LMWA 2VC0A 1KTVA 2KIFA 4LG3A 2KRFA 3PENA 2IAIA 4LLNA 2FJ1A 1O3SA 5IYCJ 3OYJA 1IN6A 2GA2A 4G7XA 2NXNB 4YRVA 1LVKA 1OGIA 3IAM2 1L1IA 1V4RA 4AWXB 4E7HA 1GVJA 2EILH 4H0EA 2BZTA 1X4OA 4HSRA 4NC8A 4B4CA 5JLWA 2HFHA 1ETVA 3H3ZA 2GBYA 2ETHA 2L9RA 5EZGA 4AVPA 2A07F 2BW3B 4LIVA 1MZBA 3CUQA 2F5CA 4IF4A 4V2GA 3CCUB 1YITI 3LWFA 2MGQA 2IS6A 3PA2A 4ZYGA 1KJZA 2EH3A 2M87A 2NOGA 3E6MA 2Q6IA 3BQYA 5HS9A 3OYGA 2NVTJ 4C2LA 4XORA 2ZFUA 2LK2A 4E4HA 3GX4X 1WSRA 1KA8A 2E5NA 4MO7A 3KIOA 1R58A 2EPFA 1TWHJ 2CV1A 1YI2I 3U2QA 2NTBA 1IW7F 2DAOA 3DEWA 3K70D 1N78A 3I5UA 3GFMA 1K7AA 3J80K 1HCRA 3E20A 3FF5A 4XM3A 4BY7J 3ZZUA 2DTRA 2RAEA 5J35A 3WQZA 2R7WA 1SD4A 2VUMJ 4X0CA 3GFJA 2CQ7A 2XAFA 3BWGA 3H5AA 1K78A 1HF0A 2VFMA 2ZJ2A 3BOQA 1OB0A 2IS4A 2KDOA 3OOCA 5LEJA 2CSOA 3UR3C 3VSVA 2XC7A 5KHDA 1MSEC 3H5RA 2P0WA 4KA4A 1FJLA 2W85A 3ONQA 4DNTB 4A3MJ 2VPLA 1CZFA 1IF1A 4ZH4F 3WGHA 2V9KA 3F23A 4M3FA 2XF7A 3D0SA 3AVYA 2GIZA 3HDDA 1MMNA 3P26A 2XF5A 2FSWA 4RLQA 3HKZA 1F5TA 1FZPB 4WX9A 1E1RA 5ERIA 1P4XA 3HRSA 2V1UA 3HRTA 4HLYA 2Y48A 1R36A 3WBJA 1ZR4A 1TL8A 3I55I 1MKMA 2WB1A 1B9MA 4ETSA 4WXHA 3HUGB 5LFAA 1H0MA 1LEAA 2M8EA 3L2WA 1PDNC 3BG5A 1S4MA 3KL9A 1QCXA 4G6DA 3VO2A 1QUFA 5JLVC 1QZYA 4OJPA 4EM2A 2Z9OA 5CLSA 3WE3A 4A5MA 1R23A 3PSSA 4TMWA 2K9NA 3BG9A 4ENJA 2Z5UA 3G4SI 2KZGA 1KONA 5FKNA 2CQNA 3VYSB 3NRVA 4K2EA 1FLIA 1K73D 1ZREA 5HS8A 1OFCX 3Q9SA 2D1VA 2HVQA 1S72I 1UD4A 2W1OA 4L18B 3OYFA 1EKEA 3CMAB 2FA5A 4XKVA 1X4PA 3W2VA 1MMAA 2PLYA 2V7FA 1BX0A 4UV8A 3JQQA 1TW2A 3VNVA 1BM9A 2Q2EB 2XF6A 3SEZA 3W6VA 3WNDA 1QRBA 3WG9A 4U49A 1J75A 4UUVA 1ZARA 4P1WA 2E60A 3QOEA 1JTAA 3NQOA 3ZQCA 4EATA 1WQ2A 3BY1A 3CMEB 2PG4A 4U87A 1XMXA 2M7BA 5F64A 2UVEA 4NB5A 4DK1A 3AVXA 1IA5A 2BV6A 2IPQX 2W84A 3TMOA 2QTZA 4X05A 1KU2A 5K5OA 2ZJRF 4A3KJ 2H6CA 2VASA 5HVQC 3HSFA 3B4NA 2EJRA 4DBRA 3LSMA 4NNJA 3BNWA 4GXOA 3WBKA 2DJNA 5IOYA 1Q1VA 2KT0A 2F4IA 5D6EA 3ZCOA 1DU0A 4OMYA 1DPUA 5HDKA 2ZTGA 4IRGA 5LHHA 2PN6A 1X58A 1Z6RA 5M3MJ 2LY2A 1ZAOA 1I1GA 5EMNA 3BCFA 3GVAA 1AOYA 4KITB 2EFQA 3GTQJ 1SAUA 1W4MA 3DFGA 4XN3A 3E6CC 3LQRA 3AFHA 3B02A 1KU7A 2IQ7A 3E5XA 1IAWA 2EV6A 3PSIA 1O8FA 3FY3A 3IL2A 1M1EB 2K40A 3I59B 1K78B 1R5ID 3B8YA 4A0YA 2MSYA 2OJED 1XGMA 4HX7A 5EG0A 4XIDA 1GXPA 1HA3A 4LC0A 5GAHJ 2ME6A 2VBVA 2F4OB 2LFBA 5GPAA 4HWVA 1NRKA 1PJ6A 3CW2A 5L3BA 3QPLA 4FE7A 1RUOA 3S2DJ 3M9AA 2O04A 3CCVI 3QQAA 1HKTA 2E2JJ 3KE2A 4OP7A 1KD1D 1M90D 4RS8A 1BN8A 2J7KA 3ECHA 5IY5H 4BH9A 5HXBA 3E97A 1BOBA 3TOAA 2XGJA 1HW5A 3OAAA 3JSOA 3JRFA 5IK2A 2CUFA 3QP6A 1EJ9A 4RDKA 2R4GA 2Q8KA 1I6HJ 2JSPA 1YIOA 1ZYRF 4Y3OA 5L3DA 1I39A 1K6YA 2BGIA 1V5FA 4M3BA 4B09A 3TP3A 3KYLA 1K8AD 3GBGA 1SMYF 3WTXC 2KISA 3BG7A 3WU1B 3LMMA 4G8XA 3N97A 1D0ZA 3I4PA 1R5NA 4UZEA 3ABLH 2Y75A 5BS6A 4KUMA 2K4JA 2PIAA 3LO8A 3KETA 3GTPJ 2Q1ZB 1VJSA 5BMZA 5DM6F 2M8GX 1O3TA 3T0YA 4IRIA 2DA5A 2COBA 2IGNA 9ANTA 2A5YB 2YWEA 3FKSA 1OGJA 3ZBUA 2YSRA 1UG0A 2WAQA 1D0YA 3PNVA 4C30A 4MLOA 4AUXA 3W5VA 4DZPA 2UWMA 1K5CA 4MNUA 1VFCA 3V7RA 5BPDA 3CCSI 1QGAA 4P26A 3OIQA 3L09A 4BBRJ 1DGRM 3TO7A 4Y52J 4PDKA 2VBTA 1K4ZA 1H88C 2A5WA 4ZJZA 3P4GA 2XT2A 4I84A 2N8GA 4G12A 3T53B 2X6OA 3OE7A 3SYJA 1WTHD 1SFUA 3OZUA 1RZ4A 4K1XA 4Y13A 3ML3A 1T6SA 2IRFG 2PYHA 2JT1A 3GCMA 4RMNA 3TW6A 1JGSA 4EH1A 2VJ4A 2QX3A 1I5ZA 1U2WA 2DYRH 5AIQA 4L0YB 2K86A 1DU6A 1ZHFA 1XN7A 5F4MA 3ZPPA 1DDIA 4HOBA 2WAEA 1MIJA 3KP3A 2ZXIA 4FCYA 1GUUA 3FDYA 1O3QA 2WSSA 4FWTA 4B48A 2J8IA 3GFLA 4P55A 1G2HA 2FX3A 4FASD 3D5RC 5CVUA 4C2TA 2MA3A 1Y39A 5H59A 4IHSA 4XL9A 3ESWB 1TUIA 1OQYA 3A01A 1R4MB 2R7TA 4GO1A 1QU3A 4EVIA 1E3HA 2INVA 4M2LA 4QIWN 3E3VA 5C3EJ 1IHMA 2Z6BD 5F4JA 4KIGA 4MXNA 1EP2B 1LB2A 1UD5A 5IYNA 4PJ0C 3HAGA 5FL7A 3CF5F 1YQAA 3I1FA 3G3ZA 2PMUA 3DXJF 3M4OJ 2ZXHA 4CQJA 4G94A 2CQKA 1DBOA 1PE9A 1FY7A 3BC9A 2J5PA 4BDZA 1D0XA 1PUEE 3HG9A 5DS0A 5FIUA 5DUKA 2JN9A 2X8KA 1E3ZA 1VQ8B 5FLXK 4AC0A 1T95A 3RIRA 1YW8A 2Y0MA 4BE0A 4QPQA 4OIQF 3N90A 3ONUA 2VI6A 2VQHA 1FT9A 1AMOA 1I3QJ 3HYIA 1UHMA 2O0VA 1HF2A 2DLLA 5E79C 4M74A 4CSWA 3IH4A 1DP7P 2ZKZA 4YFKF 3L2RA 2BHZA 3I53A 1G3SA 5H20A 2Y31A 4OPSA 2KRHA 3BR6A 1T98A 4HZFA 4X1EA 4A3EJ 1ETYA 3KEOA 4G7HF 1ZM9A 3RQ4A 4UY8I 2QMUA 3WNBA 3BPXA 3Q3SA 3CQZJ 5GAEJ 2X3UA 2HVSA 3TDUC 3JRIA 1BPLA 2LD5A 2WAQN 2EZIA 1H9TA 1RPWA 4P3YA 2QQAA 4P5OA 3G1LA 4C9YA 2ZSHB 3BC8A 3H3UA 3KYCB 4DIQA 1X3ZB 4CCOA 5FRNA 4P12A 5D4SA 1UMKA 1TT0A 2KMUA 2PFBA 5A8AA 2CMPA 2HOTA 1YFHA 3ROUA 4AVZA 3SFZA 2D9RA 3VMVA 4GRIA 3MKWB 1RI7A 1TLHB 1QA1A 2OZUA 3CCUI 3OW7A 2RQQA 4P25A 2YU3A 4KIBA 3QAHA 2VBKA 4JK1X 4LBWA 2QZAA 4I7HA 3ZR8X 2ZJPF 3OL4A 3QP5A 4MEYF 4LK0F 3LSTA 4DYRA 2AQEA 1VQ6B 4RD2A 2IOUG 3VMFA 1LVAA 1D5VA 1PYVA 3L1PA 2XGCA 4CDGA 3S3MA 5FKKA 3HOXJ 1LDKB 1FP1D 3N05A 4NK6A 1LUJB 3QOPA 2LOOA 4LBYA 1VQ4B 1FNDA 3C2GA 4L5EA 3H94A 1YX5A 2XPUA 3OYBA 5B5EC 1UD2A 4RLZA 3CCJI 3I54A 4OJ6A 2VN2A 2R5YB 3PSZA 4PJLA 2C4TA 5HOOA 1A36A 2V1XA 3DP7A 2VT2A 1HKQA 3VSLA 3MD2A 4U0YA 1IG7A 1EH7A 3ZOBA 1VQPI 1UELB 5CYVA 4EV0A 2HKXA 2EFPA 3CCRI 3IKTA 4BBSJ 3PUMA 2BM7A 5DTDA 2ISZA 1JA0A 3GMEA 2ID3A 4AU7A 4U0WA 5J6XA 1IDZA 3DKWA 4LG0A 1S6LA 2H1KA 3CD6I 1N0VC 1BJZA 4F92B 3VPRA 2PJRA 3FMQA 1WU8A 4LBZA 1W87A 1IN5A 4YIFA 1RWRA 3VSTA 3LSGA 1OKRA 1YX2A 4IL6C 3SZPA 2FRHA 1VQ9I 2LNBA 5GPCA 1KZHA 2NV4A 4M3GA 2K7LA 3CP2A 5F4OA 1YIJB 2PJPA 1ETKA 2QWWA 5CQGA 1E64A 5J3LA 2EV5A 3B82A 5AIPA 2LC2A 3GUDA 1G8XA 2HTSA 2HYGD 2K3PA 3ECOA 5EGOB 1LFBA 2Z1DA 3QPSA 1I6XA 2UXXA 4RM2A 1CQXA 1MBKA 2I5UA 2MYSA 2JZYA 4PFPA 3HKZN 3ABKH 3BZ6A 3VDXA 2X1CA 1HDPA 4BHPA 4WF2A 5J40A 3S2HJ 2LR8A 5CVVA 5E1XA 4P96A 2DCUA 2HU9A 2IXSA 4BAYA 3GLLA 3K1MA 2E34A 4X8IA 1T56A 4Q48A 2AHOA 3CMAI 5IT3A 2F3LA 1X1AA 4CO8A 4X0GA 3HXLA 1MMSA 4M3EA 3BCDA 1XDUA 4KN7X 3F8FA 1HSTA 1BL0A 4E7IA 1LPQA 1HA8A 4PC3A 2QVOA 3V7CA 1QVFB 1VZ0A 4DQLA 4JMQA 4XONA 1UMQA 1VF9A 2Y0SA 3RYPA 4DNRB 3GZ6A 1YRNB 2R7UA 3BCAA 2GXGA 2KIQA 4AC9A 1B72A 4XLCA 5FLXZ 3T8RA 2Y30A 4E6KG 1B72B 1B1BA 5FA6A 3QPHA 5E8GA 2BXZA 2DT7B 2CK3A 2IP2A 2VXDA 3T5XA 1I8DA 2F1LA 2TRTA 3B8HA 4NC6A 3W2FA 4RGRA 1USSA 3V76A 1R5GA 1BLIA 3RPUD 5TV2A 1G7TA 2C78A 2VLAA 3S16J 1JJ6C 1OFLA 1MGTA 3CUQC 4HRIA 2NYXA 5IYBJ 4XOTA 2G7HA 1VF7A 3CCLB 4IJAA 4CCMA 2HNHA 1NB9A 2X1EA 1W5TA 3N6ZA 3HTSB 5B3SH 2VBYA 2F5EA 4EJUA 1W5CC 4B3AA 1D8KA 3BG3A 3BH4A 1ZM4A 1O7FA 3PNTA 1IUFA 2R5YA 5J47A 3FXLA 3PUFA 1FX7A 2OA4A 2QQ9A 1Z9CA 3FHNA 4LLGF 1A8PA 3QFSA 3CDHA 2RC5A 2GAUA 1FDRA 5DDGA 1I27A 2HWVA 3K10A 2DYIA 3BR0A 2EA4A 3F0CA 4N9IA 4NQWA 4PFOA 1S7EA 4UB8C 1KRHA 2YWGA 1VQNB 2CW8A 5D5WB 4QVJA 4F55A 2CF4A 1A6QA 5LEKA 1VQLB 3GQBA 4QHYA 1BR1A 2W7ZA 2J5OA 3AVVA 2M4KA 3C18A 5C4JJ 4QFMA 4XSZF 4QUZA 3PNYA 4NBQA 1DUXC 5HLTA 4LG0B 2XPVA 1P4AA 3GTJJ 2ZC2A 4WCGA 2WY7Q 4OOXA 2RN7A 5K5RA 2QN6A 3C7JA 2KKOA 4Z4WA 3ERMA 5H5JA 1OGMX 4M71A 1TQMA 5C4XJ 4CCJA 4UZFA 4ESFA 4IZZA 3HJEA 3DU5A 1W35A 3QFRA 2WV1A 3PUBA 1J9ZA 2OPTA 4JX5A 1N0UA 4FHTA 2FEZA 3KEYA 4AIKA 2M0CA 3VODA 4YALA 4YAUA 4FISA 1QG0A 3DLAA 3JRHA 2B9SA 5CKTA 2STTA 2BY2A 2XIGA 1SD7A 2E7WA 3M1EA 4BE1A 4RB3C 1EP3B 4LK1F 3ZMVA 2X3HA 2HDDA 1T0FA 3OR1C 5FJ8J 1AKHB 2PECA 2GQQA 3K70C 3W2WA 1UCRA 2XOKA 1U8RA 1SVLA 3K0LA 4KH3A 3RKXA 1MDMA 2DO7A 4KJZA 4ENKA 1PUFA 3SQVA 1UHSA 1EWYA 3NWSA 4F52A 3OYAA 4ZDPA 3DPTA 2DODA 4R8HA 2B7BA 3ZQ7A 2M45A 5H6QA 4DGWB 3D5LA 1XQBA 2BVLA 3BJOA 4UVBA 5M5WJ 4L9NA 4G5GA 3ZMDA 2DI3A 3L2CA 2OV7A 1VI0A 3I4MJ 1JA1A 4ZCLA 1Y6IA 3OYEA 5FO0A 2DT5A 4XQFA 2W6IA 2ZBUA 3OFNA 1IXRC 3P7NA 2V31A 5JMCB 1V5GA 2DDBA 3Q0VA 3ZBTA 2B0RA 1WSVA 1HKSA 3ONYA 5EZHA 1TP4A 1NHCA 2VOOA 2L01A 2IT0A 2VIXA 3MKLA 3ML6A 1RETA 2XNCA 2UXNA 1LJ9A 4Q7JB 2V26A 2P8TA 2P5LC 3LAJA 2B5OA 4MHGA 2R9VA 1BHEA 1IN8A 5DEQA 4HF1A 2X0KA 1I3AA 5E1ZB 2C5BA 2GIVA 3CLOA 4PC2A 2PI0A 1D1AA 1BIAA 2PMDA 4B8XA 4BUPA 1ZQ3P 5F0CA 3FHZA 2FBKA 4G6QA 4GQNA 1B6AA 4PAAA 1M1KD 1H80A 3EUKL 1VQ4I 1N08A 4MIMA 5BOXA 1IJEA 4H4KC 1NJID 2V1NA 3B78A 3LL7A 4UVAA 2CUEA 4OJ5A 1H42A 4PK4A 2QYOA 1W7PB 2WJYA 3P9CA 3R0JA
chains in the Genus database with same CATH topology
2E60A 3QOEA 1JTAA 3QYFA 1XG2A 3B90A 2X6YA 1UD3A 2KHMA 1EA3A 4NQWB 4EATA 3FBIB 2UVEA 4U87A 2M7BA 4ASUA 2VKDA 4BEHA 3G05A 4KT6A 3CMMA 2WAFA 4DK1A 1IA5A 3TMOA 3SEQA 2L9NA 3JURA 2VASA 4LIUA 5HVQC 3B4NA 2HDWA 2BOLA 4DBRA 3LSMA 1PLUA 4NNJA 3EUAA 3DKYA 3D5SC 4B3XA 3E0JB 3DPLC 3K4LA 3E1SA 3ZCOA 2F4IA 2HPMA 1UD6A 2ZTGA 2F43A 3VWBA 3OY9A 2VB6A 2LY2A 2VJJA 1HZEA 4JQFA 3T9GA 2KLOA 3MKYB 1AIRA 3BCFA 4OWRB 1WPCA 4KITB 1WJBA 2HQAA 1SAUA 2X51A 4XN3A 4Z1MA 3EQOA 3H0DA 3AFHA 3H9GA 4RLFA 2IQ7A 1DBGA 3IUOA 2F1MA 2VQGA 3PSIA 1O8FA 1NG7A 1U0JA 2F6CA 3FY3A 3U21A 2M5SA 2E1MB 1X0CA 4XLHA 4IQJA 1JRGA 2NSTA 3B8YA 4CCNA 1IB4A 2MFZA 1E1QA 4XKCA 1MW7A 5CPRB 2ZSIB 4HWVA 3QODA 4HG2A 3DWLE 3OS0A 1NRKA 1E0EA 1OFMA 1EE6A 4URRA 3GRHA 2O04A 5KCMA 5JHFA 1YE9A 4KKSA 4G6IA 2QKMB 1BN8A 3K4KA 4PMHA 2UV1A 4BS9A 2ZZQA 2VBEA 4MR0A 1COWA 3HPHA 4E0FA 4U7BA 3VMWA 3WWGA 1BOBA 4C2UA 3OEHA 3LFUA 2XGJA 2W4SA 2XAUA 3OAAA 2UVFA 3PSFA 5IK2A 1O8DA 3OYHA 4BJ5C 2R4GA 3OIPA 2JSPA 4B43A 4Y3OA 1H8EA 1OLTA 2GK7A 1K6YA 3AL0C 1V5FA 1O8GA 1ERDA 4NC7A 3KYLA 3GQAA 4BQOA 3GBGA 2X6XA 2XDVA 1WJAA 4KKTA 1TZLA 4IQ4A 3BG7A 4YZXA 3L2UA 2XZOA 3LMMA 2JA2A 1D0ZA 1X1CA 3H9QA 4JOMA 4KISA 2JUGA 1FMVA 2X6WA 4L8JA 2Q1ZB 1VJSA 3DEEA 2LH9A 3HOSA 1KTWA 2CV2A 2IGNA 3H9JA 2CUJA 4BDYA 3FKSA 2IS2A 5CDFA 1UG0A 2WAQA 1D0YA 3PNVA 4C30A 4MLOA 2QE7A 1K5CA 2UWMA 2IGKA 1OR7C 3OIQA 1PKVA 1DGRM 2RNGA 2MABA 4E7JA 2A5WA 3RSNA 4ZJZA 1MABA 4I84A 4XLEA 3SUCA 2V7QA 1YX3A 4G6TB 2VXZA 3T53B 3OE7A 1WTHD 3VYTB 4HSTA 4TKOB 2KP6A 2PYHA 1MNEA 4RMNA 1X1DA 4F3QA 1RMGA 2VJ4A 3HC7A 4BACA 2QX3A 1W0KA 3DDYA 3H35A 4XN0A 4BXFA 1O88A 3FPPA 1BR2A 3ZPPA 2WSSA 2M3AA 2WAEA 4II2A 2ZXIA 1Z21A 3FDYA 4DK0A 1O8JA 4B48A 2M7AA 3QYBA 2K9MA 3DU6A 3S3OA 3EPZA 1N75A 1MNDA 2W00A 4FASD 3D5RC 3GVLA 1DQUA 4C2TA 4LITA 3OWTA 4XL9A 1MMGA 2VQCA 4XD7A 2KZVA 4N4OB 1K28D 1GLNA 2R7TA 2VBMA 1QU3A 1SKYB 1Z3YA 2JDIA 2JJ1A 3W3CA 4BEHB 3A3BA 2INVA 1DP3A 2Z6BD 1P9QC 3OEEA 4BGDA 3KRGA 3PJRA 4MXNA 3OS2A 2OC6A 1UD5A 2F5VA 4ITVA 3HAGA 5FL7A 4Y33A 1BR4A 2ZXHA 3HL2A 3OYIA 1MMDA 1DBOA 2DT6A 1PE9A 3BC9A 2K9LA 1D0XA 4BDZA 3A2KA 3HG9A 4W8RA 2X8KA 1GQ8A 1E3ZA 4J00A 2R7VA 1T95A 4BE0A 2ZZFA 4QPQA 3ZRGA 2KQRA 2VQLA 2VQHA 3QYEA 4Z05A 1O8MA 2O0VA 1V0EA 4CSWA 1WJDA 3DTKA 4YELA 3L2RA 4TSFA 2KRHA 3UW0A 3J7AY 1N77A 3S32A 4II3A 2O17A 3RQ4A 4BJTA 3SDBA 3OYMA 3CP8A 2PJRB 2M0MA 3TBIA 2QY1A 3DKXA 3ZQQA 1AA7A 2HPIA 2HVSA 1BPLA 4NUBA 2HLDA 3ZGKA 3ZXSA 1QJVA 4P5OA 3TL4X 4J01A 1BMFA 2E5ZA 2VL8A 4C9YA 2ZSHB 3BC8A 4HIZA 3W2AA 4DIQA 2KL4A 3HOTA 4CCOA 4E7SA 5FRNA 3BLYA 2PMZA 3A35A 1QHGA 1O8LA 1TT0A 2KMUA 4D1QA 2M4GA 1W0JA 1UAAA 2W6JA 4W8SA 3ZIAA 4E7KA 1OHHA 2CMPA 2V4JC 1X19A 4XKWA 2NT9A 4AVZA 4UZUA 4GRIA 3OYCA 1WJEA 3OYNA 1I18A 4W8QA 3VMVA 3MKWB 3EQNA 1D1BA 2HZDA 2ZTNA 3OW7A 2RQQA 3DQVC 3L2VA 3DTEA 3IAS2 4OZZA 4XMYA 2LREA 4FETA 1X1BA 3CESA 1JI8A 2NOJB 3FBNB 2VBKA 3OYDA 3ZR8X 1W9XA 3NE5B 2ELJA 5HNHA 4B3FX 3OL4A 2DCEA 3IP4B 1O8EA 3OYKA 4YZAA 2AQEA 1FMWA 4HEA2 2L9SA 2JVGA 2Z8GA 1PYVA 4XR6A 4HNTA 1HVXA 1KZLA 3S3MA 4E7ZA 4AYBA 1LDKB 3N05A 2LY1A 4NK6A 1T0FC 2LOOA 3K4BA 4CH7A 1O8IA 3C2GA 3H94A 1YX5A 3G2BA 3OYBA 2L2OA 1UD2A 4B44A 2O0WA 4OJ6A 4EW9A 4PJLA 4ZTFA 5HOOA 3LSKA 4R79A 3VYUB 3JU4A 2VKHA 2AQFA 3VSLA 3MD2A 3VYRB 3S3NA 2KVOA 5C1EA 2LBFB 1OOCA 2GJRA 4RM3A 4Z03A 1UELB 2BW3A 4XLAA 2JVHA 2L7KA 1WJFA 3ZPNA 3RCOA 1PXZA 3HPGA 4W8TA 4B3GA 4PJMA 4XOPA 4AU7A 2IGMA 1WJ5A 2QKLB 3OOUA 2IGOA 4ANJA 4F91B 4F92B 2PJRA 3VSUA 3A1YA 3VSTA 1RWRA 1PJRA 2WY8Q 3LSGA 4OJOA 2HVRA 3F9KA 3OMYA 1G59A 1E79A 2V6EA 2XZLA 3C2HA 3H5NA 2LBFA 2GOXB 2WJVA 3CP2A 4IX7A 1SFKA 5CQGA 2EWEA 4PJJA 1QHHD 4BU2A 1RU4A 4OJLA 3I9V2 2V4DA 2LC2A 4Y4RA 1G8XA 2K3PA 3K4JA 1V5EA 3EUHC 4BE2A 2Z1DA 4ZYAA 2XZPA 4RM2A 3CJRB 3FKJA 2R7SA 2MYSA 3VDXA 4PFPA 2X1CA 3OR2C 3S8PA 5FROA 3OL3A 2HU9A 2IXSA 2KRCA 1E43A 1H8HA 1O8HA 4CCKA 3PFYA 1LKXA 2CUZA 2E1MC 4ZDLA 2W82A 4CA0A 4BL0B 1X1AA 2LG4A 1J09A 3HXLA 4X0GA 3BCDA 2BSPA 3GQ9A 1Y56A 4ZTJA 2XNDA 4E7IA 2WZPP 1HA8A 3GQ7A 1VZ0A 1EFRA 4JMQA 4XONA 2Y0SA 4DNRB 1KCCA 1IDKA 3BCBA 2CFOA 3DPUA 3BCAA 1W36C 2R7UA 2CV0A 2E1BA 1UD8A 4XLCA 4YZ0A 1R6RA 1Z7LA 4E6KG 4P22A 2A6TA 3M1CA 2JIZA 4TT3A 3NWTA 2ODLA 2DT7B 2CK3A 2VXDA 2CW7A 2DOAA 1I8DA 3A4CA 4KKUA 4OAZA 2LRDA 1WMRA 4U4BA 5C1CA 1BLIA 3RPUD 4OZYA 3OPOA 2O5RA 2ZZEA 4G7WA 2VLAA 2DXIA 1OFLA 2L5QA 4HRIA 4XNFA 4XOTA 1VF7A 3KX2A 4CCMA 2HNHA 3K6GA 3GQ8A 3GVKA 2X1EA 1O8KA 1FX0A 4PUSA 2R7QA 3LSIA 2WPDA 2MC4A 1KCDA 3CF2A 2GK6A 1V0FA 2X1DA 2NTQA 3LMWA 5HKKA 4Z06A 2WA0A 3V42A 2CH0A 3L2QA 2DJIA 3BH4A 4LG3A 3AKZA 3CZ6A 3PNTA 4XKBA 3SZGA 5TGTA 3BG6A 1DGWY 3FHNA 3OYJA 4IKFA 2D3LA 3A3GA 4G7XA 4YRVA 3MKZA 1LVKA 1Z3XA 3K10A 3K4MA 3IAM2 3RTRA 2FUG2 4PFOA 4BQQA 4E7HA 3CJQB 4HSRA 1X4OA 2CW8A 2X85A 4NC8A 5HNFA 2NT6A 2ZZGA 4F55A 1IRXA 2MD0A 3ZSCA 1D1CA 4PJNA 2GOMA 2BW3B 4LIVA 3AL0B 1VLYA 3GQBA 1BR1A 4ZC3A 5DN6A 2M4KA 1NBMA 2IS6A 2VJ5A 4HNUA 3PNYA 2D3NA 4C2LA 5HLTA 3OYGA 4XORA 2ZFUA 4D9JA 2WADA 2LZJA 2WY7Q 4E4HA 1WJCA 1ZELA 2E5NA 1OGOX 3OS1A 2NTBA 1T5EA 2CV1A 2IS1A 1OGMX 4NK8A 5CQEA 4CCJA 4E7LA 3K70D 2GJKA 2LYCA 4IZZA 1N78A 3DU5A 3PUBA 2I8DA 2INUA 4XM3A 4OAYA 3WQZA 2R7WA 2BVMA 3KEYA 4ZDOA 1VBLA 4DBQA 3H5AA 3SYTA 1OB0A 2IS4A 2KDOA 2R7OA 4DOZA 3OOCA 3UR3C 3DLAA 3DTIA 3T51B 5CKTA 5KHDA 2XC7A 3VSVA 3H5RA 1WP6A 2P0WA 2X53S 4BE1A 2UUZA 5LD2C 3I3LA 2R7RA 3M8JA 2X3HA 1HG8A 3ONQA 3OR1C 2PECA 3S93A 3K70C 4DNTB 3MMYB 2NZMA 3W2WA 2VPLA 1CZFA 3PL8A 2XOKA 2V9KA 2JJ2A 2XF7A 2W7NA 1MMNA 4KJZA 2NTPA 2WBMA 3NWSA 2XF5A 4F52A 2XSJC 4RLQA 2K5CA 3DPTA 3HKZA 4PSXA 4ZDPA 3OYAA 2RREA 3LNNA 2R7XA 1WFXA 3VSKA 4DGWB 3D5LA 4PSWA 1E1RA 2BVLA 4YZQA 3K4NA 4QPOA 4DJAA 2OV7A 2QXZA 1Y6IA 3OYEA 4XQFA 2W6IA 3OFNA 2Z2SB 2WB1A 1E3XA 5AMVA 4N4NB 2V31A 2KPMA 3HUGB 5LFAA 4BJ6C 1V5GA 3K4CA 3L2WA 1QCXA 2O1DA 1NHCA 4F93B 3OYLA 3VR6A 1W36D 2OUMA 3UNGC 4CCLA 5KNLA 2PYGA 4OJPA 2VIXA 3LSHA 3KEWA 4YEJA 1LFPA 1S9HA 3T56B 1KMHA 2V26A 2R9VA 4B47A 2CS3A 1BHEA 1KONA 5FRMA 3VYSB 2VJIA 3GVJA 4FXUA 4YXWA 1D1AA 2HVQA 1UD4A 2W1OA 4XLFA 4BUPA 2NSPA 1NG6A 4CZCA 3OYFA 4GQNA 4XKVA 4HPQA 1X4PA 3W2VA 1MMAA 2V7FA 2Z16A 1H80A 3EUKL 2DIEA 2Q2EB 4H4KC 2XF6A 3SEZA 2V1NA 3LL7A 4U49A 2GJPA 4OJ5A 4BQNA 1IDJA 4PK4A 4P1WA 2WJYA 4CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B90 A;  1JTA A;  2PYH A;  1XG2 A;  2O0W A;  4OJ6 A;  4EW9 A;  2X6Y A;  2UVE A;  1RMG A;  5C1E A;  2QX3 A;  1IA5 A;  4Z03 A;  1OOC A;  3JUR A;  2X85 A;  4XLA A;  4XN0 A;  1O88 A;  2NT6 A;  3B4N A;  3ZPP A;  1PLU A;  3ZSC A;  1PXZ A;  1O8J A;  4W8T A;  4XOP A;  4C2L A;  2VJJ A;  4XL9 A;  3T9G A;  3VSU A;  4XOR A;  1AIR A;  3VST A;  1RWR A;  2VBM A;  4OJO A;  4XN3 A;  3EQO A;  1OGO X;  2NTB A;  4NK8 A;  2INV A;  1OGM X;  1DBG A;  2IQ7 A;  3FY3 A;  1O8F A;  3KRG A;  4MXN A;  1X0C A;  2EWE A;  4XLH A;  1JRG A;  4XM3 A;  2NST A;  2INU A;  3B8Y A;  1RU4 A;  4OJL A;  1IB4 A;  1VBL A;  1DBO A;  1PE9 A;  3VSV A;  4HWV A;  1OFM A;  1EE6 A;  4W8R A;  4URR A;  1GQ8 A;  3GRH A;  2O04 A;  2X3H A;  1HG8 A;  2PEC A;  4Z05 A;  1O8M A;  2NZM A;  2O0V A;  1BN8 A;  1CZF A;  4PMH A;  2VBE A;  4MR0 A;  1O8H A;  4YEL A;  3VMW A;  3WWG A;  3UW0 A;  2NTP A;  2O17 A;  2BSP A;  3GQ9 A;  2UVF A;  1O8D A;  3GQ7 A;  2QY1 A;  4XON A;  1KCC A;  4YZQ A;  1IDK A;  1QJV A;  1O8G A;  2QXZ A;  4XLC A;  3GQA A;  4YZ0 A;  2X6X A;  4XQF A;  1O8L A;  4YZX A;  5AMV A;  2ODL A;  4W8S A;  1QCX A;  2O1D A;  2NT9 A;  4XKW A;  1WMR A;  4AVZ A;  4U4B A;  3VMV A;  5C1C A;  4W8Q A;  2X6W A;  1NHC A;  4OZY A;  3EQN A;  2PYG A;  4OJP A;  1KTW A;  1OFL A;  4YEJ A;  4XNF A;  4OZZ A;  4XOT A;  4XMY A;  1BHE A;  2VBK A;  3GQ8 A;  1K5C A;  2VJI A;  1O8K A;  1O8E A;  4YZA A;  1KCD A;  4XLF A;  2NSP A;  2Z8G A;  4XR6 A;  4XKV A;  2NTQ A;  3LMW A;  4I84 A;  4Z06 A;  3SUC A;  4XLE A;  1H80 A;  4NK6 A;  4U49 A;  1O8I A;  4OJ5 A;  1IDJ A; 
#chains in the Genus database with same CATH topology
 3CPW B;  3B90 A;  3HOV J;  1XG2 A;  3ERE D;  3S14 J;  3HGG A;  1ZLJ A;  1Q82 D;  4ASU A;  2VKD A;  4L9T A;  1HXD A;  1SD6 A;  3CMM A;  4KT6 A;  2CW5 A;  2CG4 A;  1BA5 A;  3JQP A;  2ZBV A;  1WOS A;  5LHG A;  4YHB A;  2ELK A;  1WGX A;  2HDW A;  2NRA C;  5TR9 A;  2XNJ A;  5FFX A;  3DKY A;  4CYC A;  3AAF A;  3D5S C;  1GDT A;  2BPO A;  1TYV A;  1UD6 A;  3PIO F;  3AVW A;  3SJZ A;  4P9U A;  4Y15 A;  3V8J A;  3W2H A;  2CW0 F;  5D6F A;  4X7D A;  2E1O A;  2P5K A;  1GV5 A;  4JQF A;  1HZE A;  2KLO A;  2KIM A;  1KGS A;  2CRV A;  2K85 A;  1P4W A;  4A2U A;  1WPC A;  4AID A;  2Q6L A;  1WJB A;  3FK7 A;  3BH7 B;  1JKP C;  3CCQ I;  4ESJ A;  1TWC J;  2O0Y A;  4H9G A;  4QV2 A;  5EYR A;  4PC1 A;  3BP8 A;  5E17 F;  2XGX A;  3A0H C;  3C2B A;  1MBG A;  2DER A;  1E3P A;  1PP7 U;  2RNJ A;  5IYR A;  2ISY A;  3KEQ A;  2VBE A;  2M5W A;  3K7A J;  4IQJ A;  4ON0 A;  1S7A A;  1FIP A;  3LAP A;  3CUQ B;  3KP4 A;  4RA2 A;  4D7M A;  3X2Q H;  3FKI J;  2O8X A;  4XKC A;  5CPR B;  3OS0 A;  1SVO A;  3DWL E;  1CF7 B;  2HQR A;  3LOC A;  1OFM A;  1EE6 A;  3GRH A;  4GDF A;  3NAR A;  3Q6Q A;  2VNI A;  1ZG1 A;  3DBR B;  5KCM A;  3CDI A;  5JHF A;  1YE9 A;  2IBD A;  1ZLK A;  3IWZ A;  4YFN F;  3GZ5 A;  2QKM B;  4PMH A;  1HC8 A;  2V7X A;  1U5T C;  4MR0 A;  1HSJ A;  1KYW A;  1PUF B;  3HEF A;  3RZD J;  3HPH A;  2VFN A;  5F6F A;  4U7B A;  1LE8 A;  3LQE A;  3VMW A;  4C2U A;  2GZW A;  2JWT A;  4PC7 A;  2HMA A;  2W4S A;  1IN7 A;  1GAQ A;  2UVF A;  4G1B A;  1O8D A;  1BN5 A;  2IA0 A;  5ICE A;  1K6O A;  3OIP A;  1H8E A;  1OLT A;  2HQN A;  2GK7 A;  4V02 C;  1O8G A;  1ERD A;  2ADU A;  2DTZ A;  4NC7 A;  4C43 A;  4BQO A;  2XDV A;  4IHX A;  1WJA A;  4KKT A;  3L2U A;  5A2Q K;  2JA2 A;  4RB1 A;  1E63 A;  5LGU A;  1X1C A;  3EYY A;  4JOM A;  1IV6 A;  2L0K A;  3ZQI A;  2BM5 A;  2O6G E;  1QVU A;  3JTH A;  1TC3 C;  3DEE A;  5A88 A;  4ZV4 A;  4M72 A;  3WTY C;  3HOS A;  2CV2 A;  3S1Q J;  5HZB A;  1QPI A;  1KTW A;  3M3Y J;  5BQT A;  3COA C;  2R7Z J;  1VND A;  3H9J A;  2BY3 A;  3FXJ A;  2UZK A;  4RD6 A;  3LA2 A;  2TCT A;  1G7C A;  4B1R A;  1H89 C;  1UFM A;  2Q6O A;  2QE7 A;  3TO6 A;  3B73 A;  1WI9 A;  2DA2 A;  1OR7 C;  4LGW A;  2NPF A;  3G6E B;  2VFO A;  1LDJ A;  2AO9 A;  2R3S A;  3VFZ A;  5FO1 A;  3RSN A;  2QSH X;  2VOD A;  1MAB A;  1QGZ A;  3W2I A;  2V7Q A;  1E2X A;  3MZH A;  2VXZ A;  2XAJ A;  1F36 A;  1O7L A;  1SFX A;  1B2R A;  1U9N A;  3JSP A;  1T33 A;  1FNN A;  2C5H A;  1Q86 D;  4RAY A;  3PQK A;  1GAW A;  1T6X A;  1RMG A;  2ZJQ F;  2FNP A;  3HM5 A;  1OFE A;  3MZY A;  2AHQ A;  2QA4 B;  3DDY A;  1Z1D A;  1OB2 A;  2R0Q C;  4BXF A;  1BR2 A;  2QEN A;  5FKM A;  2M3A A;  4II2 A;  1XCV A;  3TW7 A;  1Z21 A;  2NS8 A;  2V6C A;  2XUB A;  1O8J A;  2M7A A;  3QYB A;  2ZO4 A;  3DU6 A;  4LLL A;  2W00 A;  1MND A;  2PMH A;  3ABM H;  1YJW I;  4L0Z B;  1N8R D;  1G7R A;  2LVS A;  4EQQ A;  4LIT A;  1MMG A;  1S7O A;  4FQG A;  1X2N A;  3TDZ C;  1K28 D;  3CO7 C;  3AG3 H;  3IH2 A;  3U1K A;  3ULQ B;  3AVT A;  2XRL A;  4UUT A;  2QDX A;  2JJ1 A;  3WNC A;  5GTH C;  1XG1 A;  5H2F C;  3NAW A;  4RGS A;  4RDU A;  4IXA A;  4Z2Y A;  3I59 A;  3KRG A;  2XPW A;  5M5X J;  1YS7 A;  2OC6 A;  2LDU A;  3REO A;  2LKS A;  3VEP A;  4RDJ A;  3W5H A;  2DFE A;  2HXI A;  5FKO A;  2H6B A;  2HR3 A;  3OYI A;  1MMD A;  5IP7 J;  1EFU A;  3E6D A;  3A8J A;  4HQM A;  1QH0 A;  3AGP A;  2L9V A;  3BDD A;  4LFU A;  4W8R A;  3VO1 A;  4J00 A;  3ZQL A;  5E3M A;  2ZZF A;  2HOA A;  3NAU A;  1TNS A;  3QYE A;  1X3W B;  2V79 A;  3FM5 A;  4M6V A;  1KU3 A;  3F8B A;  2OTL I;  3DTK A;  3BJA A;  4Z4Y A;  3M7G A;  1ULY A;  4XRS A;  3UW0 A;  1CLW A;  5KAF C;  2ZNY A;  3S32 A;  1FIA A;  1W7P A;  1YO5 C;  3L00 A;  3SDG A;  2OQG A;  1VQK B;  2QY1 A;  3P5J A;  4OU0 A;  5EJC A;  4NUB A;  2W24 A;  3ZXS A;  3TL4 X;  2OTJ I;  1FNM A;  4YIR X;  3OSF A;  1KK3 A;  2YR2 A;  2DK5 A;  2QTL A;  2KL4 A;  1B59 A;  4HF0 A;  2RVC A;  5IOZ A;  1QHG A;  4OIP F;  3Q39 A;  2M4G A;  1WXR A;  1HQC A;  3ZIA A;  5LBQ A;  5HLG A;  2EFO A;  1SEU A;  1X19 A;  2NT9 A;  5ED4 A;  1FEX A;  1I18 A;  1WJE A;  1U2R A;  3EQN A;  4HDU A;  2ZME C;  5GV8 A;  1OR7 A;  2QA4 I;  2BM0 A;  1JUM A;  3SKB A;  1ZRD A;  1QQ1 A;  4WXC A;  3DTE A;  2ZB9 A;  3DF8 A;  3G73 A;  2LRE A;  1X1B A;  1DDG A;  1JJ8 C;  3FBN B;  1JI8 A;  3GTG J;  1ENH A;  3R60 A;  1SKQ A;  2L3D A;  5B66 C;  2FQ3 A;  4V2F A;  2DCE A;  2JN6 A;  1R7J A;  1PP8 F;  3Q6R A;  1FMW A;  2L9S A;  2JVG A;  2VNK A;  2Z8G A;  1V54 H;  2A68 F;  2H1L A;  2W48 A;  4ZCI A;  5FGM A;  4NDL A;  2BM6 A;  3RIQ A;  1YG2 A;  4M9Z A;  3IRQ A;  1L3L A;  3TKY A;  5EEG A;  2FOK A;  4AYB A;  3NEU A;  4HE6 A;  3I56 B;  4Z4V A;  5IT9 Z;  1O8I A;  3TGN A;  3G2B A;  3SXY A;  2KDZ A;  4EW9 A;  2V1D A;  4ZTF A;  4OIO F;  2AS5 F;  5J8F A;  1QVT A;  2W25 A;  3BZC A;  3H36 A;  4R79 A;  2AQF A;  3VYR B;  3ZMZ A;  1ONV A;  1FRN A;  2BXY A;  1AIP A;  3IC7 A;  1OOC A;  4RM3 A;  2DMP A;  4OOS A;  1XGO A;  2JVH A;  3ES9 A;  4A3L J;  5J4V A;  3WGI A;  5E3O A;  3QSY A;  4XRF A;  1XPX A;  2L4M A;  3ZPN A;  4X7C A;  3HPG A;  4IEJ A;  1MBE A;  4PJM A;  1R1T A;  3IH3 A;  2V9P A;  2WC2 A;  2P81 A;  3U6K A;  1WJ5 A;  3SEJ A;  3MMP A;  2IGO A;  3AG1 H;  1RR7 A;  4XLN F;  1I50 J;  4ANJ A;  5HDG A;  4KMF A;  3CC2 I;  1YJN B;  4NBS A;  3F21 A;  2VNJ A;  3JTG A;  4L9V A;  2EIX A;  4MTE A;  5JLX A;  4OJO A;  1BW6 A;  4MQ9 F;  4EGY A;  2P3M A;  2QF7 A;  4QVA A;  1R1U A;  1G59 A;  3VB2 A;  1JHF A;  1W0U A;  3H5N A;  4IOA F;  2LBF A;  2GOX B;  4HV5 A;  5ICG A;  1KK2 A;  3CD6 B;  4U9U A;  2BX6 A;  5KVR A;  5JFR A;  2E35 A;  2HYF A;  4I0B A;  5DD4 A;  5IPA A;  2GQF A;  2DU9 A;  1NDH A;  3I9V 2;  2V4D A;  4N3N A;  1RU4 A;  3E7L A;  2FE3 A;  3K4J A;  4X6A J;  1DAB A;  4ZYA A;  2A05 A;  3KP7 A;  3WHB A;  5EG0 B;  3SZT A;  2HXO A;  2Z33 A;  3CJR B;  2R7S A;  5L3E A;  3N4M A;  3ZQH A;  3VNU A;  3L9F A;  2K27 A;  4KMU X;  3MCZ A;  4OPV A;  3HZJ A;  4UHT A;  4MTD A;  1RRJ A;  3QRF F;  2QSG X;  5FRO A;  5EF6 A;  3LQ6 A;  3CC7 I;  4I09 A;  1B4A A;  1FP2 A;  4LD5 A;  3BRO A;  3CJN A;  4TMX A;  2QCO A;  4A12 A;  3GW2 A;  4ZDL A;  4XBF A;  1XFO A;  4CA0 A;  1NK2 P;  1R00 A;  1RES A;  1Y8Q B;  2LG4 A;  3FMR A;  1K8F A;  3BTL A;  2OCC H;  4KT5 C;  4M9S A;  5JI6 A;  2FML A;  4ZTJ A;  3S1N J;  1TNT A;  2PX9 A;  1EFR A;  1WOO A;  2G7U A;  3ABT A;  2K9S A;  5FFZ A;  5E18 F;  4OPW A;  3FXU A;  2I10 A;  3BCB A;  5AON A;  1Y0Y A;  5IYP A;  4LJZ F;  2E1B A;  1R49 A;  1UD8 A;  1MBF A;  3EUH A;  2ZFW A;  1XB4 A;  4C3J J;  1T6Y A;  4TT3 A;  1R4N B;  3CCL I;  3JQR A;  5KK1 A;  3DBL B;  2DOA A;  1MJB A;  1FSE A;  1LDD A;  3FWE A;  4OAZ A;  4R1H A;  3F6V A;  4NHJ A;  5ICC A;  4RPD A;  4U4B A;  1TLL A;  5DV5 A;  4BYY A;  2H94 A;  3OPO A;  1F43 A;  3KCC A;  2DA3 A;  1XSX A;  2VYQ A;  2DXI A;  3F22 A;  1WPK A;  4EEF G;  2M9H A;  4GYI A;  3S1R J;  4EJT A;  4IHY A;  4ROX A;  1EV7 A;  1OCZ H;  3WHC A;  2QEX I;  4OIR F;  1XS9 A;  2VBS A;  3K6G A;  3GQ8 A;  2XB0 X;  1LM1 A;  4ZGQ B;  2D1H A;  4PUS A;  4DNC A;  1SMT A;  2MC4 A;  1BW5 A;  3CME I;  1NH3 A;  2L4A A;  2NS0 A;  2X1D A;  2XRN A;  3GYH X;  1U3E M;  1DAR A;  4RD3 A;  3V7A A;  5BSX A;  3QWL A;  3S17 J;  2WA0 A;  3V42 A;  2CH0 A;  3L2Q A;  2DJI A;  4QTR A;  2IA2 A;  3AKZ A;  1W7P D;  1P7I A;  4M0L A;  4WWV A;  5C44 J;  1FBS A;  4XKB A;  4EM1 A;  1VQ5 B;  5D5X B;  5TGT A;  3BG6 A;  1O4X A;  4A6D A;  4Y9R A;  1DGW Y;  2D3L A;  2JSC A;  4PZJ A;  4IKF A;  2CJJ A;  1WRJ A;  3SHF A;  3W6K B;  3MKZ A;  3K4M A;  3TOB A;  3RTR A;  3GO5 A;  2FUG 2;  4UNO A;  3JRC A;  2DY1 A;  2NT6 A;  1IRF A;  2ZZG A;  2BSA A;  1IRX A;  2CQX A;  2MD0 A;  4IVN A;  4FN5 A;  4PJN A;  2GOM A;  3B6A A;  1TWG J;  3QFC A;  1VLY A;  5DN6 A;  2OYN A;  4RD4 A;  4TMV A;  2VJ5 A;  3MEX A;  4HNU A;  1SC7 A;  3O2P E;  3SZE A;  1IXC A;  3C1D A;  1ZUN B;  2DEU A;  2IA1 A;  1QRY A;  2WAD A;  2LZJ A;  4LB5 A;  3LQQ A;  2A3S A;  2OF7 A;  2YUS A;  2E2I J;  1OGO X;  2P4W A;  4C0S A;  2IS1 A;  4NK8 A;  5JHU A;  3O3K A;  3IV5 A;  4E7L A;  1H85 A;  1OPC A;  1OIS A;  1S0U A;  2WZN A;  1YTY A;  2WTE A;  1A31 A;  1HOM A;  4Y17 A;  1QFJ A;  3OW2 B;  3HGY A;  2OBP A;  4OAY A;  2BVM A;  6PAX A;  5GP9 A;  4XRM A;  1VBL A;  4DBQ A;  1YHQ I;  4MYT A;  1IGN A;  3SYT A;  4M6X A;  4RB2 C;  2BY1 A;  2L02 A;  2QM3 A;  2R7O A;  4I99 C;  4DOZ A;  2F4N A;  1B9N A;  2FF4 A;  3HHG A;  4KN4 X;  1IZ1 A;  1TWA J;  3IKV A;  3A01 B;  5L3C A;  4X07 A;  4A5N A;  4X7E A;  2CRG A;  2EB7 A;  2QLZ A;  5LD2 C;  4BY1 J;  1Y8R B;  3E5Q A;  3PA1 A;  4P6V F;  5B1A H;  3U2R A;  4RJL A;  4WZK A;  1ZM3 A;  2R5Z B;  2LKX A;  3S15 J;  3MMY B;  3R0A A;  5THX A;  3S2W A;  1OCP A;  2VBX A;  3PL8 A;  2JJ2 A;  4CHU A;  2VBU A;  1SFE A;  2HQ5 A;  3OKX A;  4BXU A;  2W7N A;  2AXT C;  3T8T A;  2EFN A;  4RDL A;  2NTP A;  1G3Y A;  4WZT A;  2QEX B;  1YW7 A;  3BY2 A;  1FOY A;  1X1P A;  1Z67 A;  2XSJ C;  2K5C A;  3UKG A;  4PSX A;  4A3G J;  3LNN A;  1EZG A;  2R7X A;  1FWZ A;  1WFX A;  3VSK A;  2CFX A;  4YZQ A;  2GM4 A;  5D5V B;  1U5T A;  2R5Z A;  3K4N A;  2OBT A;  3QFT A;  3CC4 B;  4DJA A;  2QXZ A;  4WXD A;  5F0H A;  4ENM A;  2FMY A;  2H8W A;  1R5B A;  5AMV A;  4N4N B;  2KPM A;  2DMN A;  2Z3Y A;  3JR9 A;  3K4C A;  4HAM A;  3R6S A;  3PFI A;  1Y1W J;  1UG2 A;  3PQJ A;  2I1L A;  2GA1 A;  3DEU A;  4ZYD A;  3BPV A;  2OUM A;  3UNG C;  5KNL A;  2PYG A;  4ESB A;  1LFP A;  4A3D J;  4RCZ A;  3A8I A;  1YJW B;  4IHV A;  1MSF C;  2CYY A;  5GAG J;  4B47 A;  2CS3 A;  2M30 A;  2HEO A;  4OIN F;  5FRM A;  1IRZ A;  4X7F A;  5L3G A;  4YXW A;  2R93 J;  1YOV B;  1JT0 A;  3EQL F;  2OBS A;  1JHH A;  2FU4 A;  2NSP A;  1SM4 A;  2HDC A;  4YFX F;  3LNQ A;  2VON A;  4HPQ A;  1CNE A;  3GSI A;  3RYR A;  2DIE A;  3JCU C;  4YII A;  4IPA A;  5LGN A;  1P7J A;  5HS7 A;  2XRO A;  4CUG A;  3OYM A;  5CVJ A;  2KHM A;  4RAZ A;  2ECB A;  4NQW B;  3RJP A;  1HLV A;  1LLW A;  1GVD A;  3LVB A;  2C6Y A;  4BEH A;  3QE2 A;  3G05 A;  2WAF A;  4GGG A;  1OMI A;  2JTV A;  1C0W A;  1UJ8 A;  1OYI A;  4XRS G;  2L9N A;  3JUR A;  4HF2 A;  2VZL A;  1PLU A;  3HSR A;  3LFK A;  1JKO C;  1Q1H A;  3A0B C;  4B3X A;  3JAM K;  5J3O A;  3E0J B;  3DPL C;  3K4L A;  3E1S A;  2HPM A;  4NCN A;  1KQS B;  2HZT A;  1K79 A;  2XT4 A;  3G71 I;  3PO2 J;  2F43 A;  3CC2 B;  4UUS B;  1RUN A;  2Y2Z A;  3BR3 A;  3CRZ A;  1TWF J;  3FPK A;  2BEO A;  2EK5 A;  3MKY B;  1D1N A;  1AIR A;  4CYD A;  5DD8 A;  2HQA A;  2X51 A;  3FMS A;  2VBW A;  4Z1M A;  2BE5 F;  1XDS A;  4RLF A;  3JRE A;  3CXC B;  2YWH A;  3WOD F;  3MZ8 A;  4O6J A;  3RZO J;  1NG7 A;  1U0J A;  2F6C A;  4HW0 A;  4AD9 A;  1VQ9 B;  5GAD J;  4IO9 F;  2M5S A;  2E1M B;  1X0C A;  3QU3 A;  1JRG A;  2NST A;  1L0O C;  1DDN A;  1IB4 A;  5IYQ A;  3KPH A;  2NVX J;  1MW7 A;  5JVG F;  2BGC A;  4HG2 A;  2ESN A;  1Q81 D;  1E0E A;  2HKO A;  4G9Y A;  4JBA A;  3CJT B;  1CGP A;  1YJN I;  1Y0R A;  2OCE A;  1J2X A;  1VQL I;  4KKS A;  4IRH A;  2GXA A;  4G6I A;  4YC5 A;  2M34 A;  2XAS A;  2G0E A;  2UV1 A;  2ZME A;  4E0F A;  4P9F A;  3WWG A;  5E3N A;  3OEH A;  3JW4 A;  3V4G A;  1CF7 A;  1W2B B;  3PSF A;  1HBX G;  4D0P A;  4Y7N J;  1EXM A;  3IRR A;  1BX1 A;  5E6T A;  5IP6 A;  2XTX A;  4KYW A;  1TYW A;  5EEA A;  2ZME B;  2BVN A;  1JT6 A;  4I02 A;  2LKP A;  2YS9 A;  4JX4 A;  2XAQ A;  4KIC A;  1SFO J;  1ZN2 A;  1REP C;  4Y9U A;  1KQ5 A;  3H9Q A;  4A3C J;  4P3I A;  2JUG A;  2RC6 A;  4L8J A;  4M6Y A;  4FT8 A;  3ZMU A;  3R6J A;  1IC8 A;  5ILV A;  3H0G J;  2JRT A;  2MH2 A;  5LMZ A;  2RQP A;  2IS2 A;  5CDF A;  3CC7 B;  2P7V B;  3WTZ A;  1MJ9 A;  2L54 A;  4OMZ A;  1WSU A;  4J0Q A;  1QA6 A;  3FXK A;  4G7O F;  1PKV A;  2PMZ N;  4ZYH A;  4BQA A;  2RNG A;  2MAB A;  4X06 A;  2XC1 A;  2M2E A;  2BV3 A;  1U9O A;  4GCV A;  2C2W A;  1MJA A;  1OJL A;  4XLE A;  4BKX A;  1VQ5 I;  1YX3 A;  3SUC A;  2EZH A;  1A5J A;  4G6T B;  2W57 A;  2VBZ A;  2DOG A;  5M5Y J;  2JA8 J;  3VYT B;  4HST A;  4TKO B;  2Q6K A;  2R6H A;  3CDL A;  2V7V A;  1FYL A;  4F3Q A;  4CGZ A;  1J59 A;  3HC7 A;  3EYI A;  2F5F A;  5EEH A;  5DCF A;  4ABZ A;  5FB2 A;  4FTH A;  4ASN A;  4HX8 A;  4KNY A;  5M3F J;  1AWC A;  2XVC A;  2ESH A;  1WVR A;  1UHW A;  1Z91 A;  2IVM A;  3I71 A;  4Q5S F;  1JB9 A;  2K9M A;  4IOC F;  2NS7 A;  1N75 A;  4TN1 A;  1QVG B;  3V7S A;  4FX4 A;  1BQE A;  1DQU A;  3P9K A;  2NVU B;  3CMY A;  1AHD P;  1K4T A;  3OWT A;  3GTL J;  2E1C A;  2VQC A;  1ZGA A;  4ZCM A;  2KZV A;  4D5C A;  1R9T J;  2EIJ H;  2VBM A;  1T2K A;  1SKY B;  1Z3Y A;  2VE8 A;  2DFI A;  4M9X A;  2JDI A;  3W3C A;  2DMQ A;  4BEH B;  2HI3 A;  1GHC A;  1DP3 A;  4P1V A;  2MH9 A;  3K69 A;  4BGD A;  2IJL A;  3OS2 A;  3KZI C;  2F5V A;  2X48 A;  5B1B H;  4ITV A;  4I0A A;  4U0V A;  1BR4 A;  2E36 A;  1XGN A;  4O3M A;  1FOW A;  3HL2 A;  1QO0 D;  2OZ6 A;  4YZA A;  3HHH A;  2CU7 A;  2XKP A;  2DT6 A;  1MBJ A;  1XGS A;  2YPR A;  4L9J A;  4UUS A;  2M1B A;  1EP1 B;  1IJW C;  2ACJ A;  4U88 A;  1D8T A;  2QGG A;  3A03 A;  2DK8 A;  1BBY A;  1SD5 A;  2B7C A;  4RGX A;  2K3F A;  1GV2 A;  1KU9 A;  1WKM A;  1SAX A;  1O8M A;  2QYU A;  1V0E A;  2BM4 A;  1KYZ A;  2K02 A;  3G1O A;  1WJD A;  2H8R A;  4V19 K;  2A6H F;  4UXN A;  1HDD C;  1FTZ A;  1K61 A;  4UV9 A;  2EWN A;  3ZZ0 A;  3J7A Y;  1N77 A;  2DBB A;  1EFC A;  3VOE A;  4BJT A;  1ZGW A;  3CP8 A;  2M0M A;  3TBI A;  3DKX A;  3ZQQ A;  2JA5 J;  2HLD A;  1JUP A;  3WTS C;  1A6I A;  1BI1 A;  5K5Q A;  1QJV A;  2EFW A;  2E5Z A;  1U5T B;  3GLX A;  3W2A A;  3HOT A;  3A8K A;  2PMZ A;  3RQI A;  3AG4 H;  1O8L A;  3KLO A;  2W6J A;  1UAA A;  4RD0 A;  3MAJ A;  4E7K A;  1ZH5 A;  4MEX F;  1O57 A;  2GLO A;  1KK1 A;  4XKW A;  1Z05 A;  4HDV A;  1T39 A;  3OYC A;  4BXX J;  4W8Q A;  5J4Y A;  2F5D A;  1NK3 P;  1D1B A;  1ZR2 A;  4PGG A;  3ZZT A;  3ISP A;  3DQV C;  2NNN A;  3IAS 2;  2X0L A;  3BTI A;  3G1M A;  1F60 A;  1IJF A;  3M8F A;  4FET A;  1IV8 A;  3CES A;  4BHC A;  2NOJ B;  3HTU A;  2L7F P;  2WWY A;  1BC8 C;  4S0H B;  1W9X A;  3NE5 B;  3HUG A;  4Q47 A;  3IHU A;  5HNH A;  4B3F X;  3OYK A;  3OP1 A;  1TTT A;  4HEA 2;  5HOD A;  1STZ A;  1BIB A;  2GRE A;  1KZL A;  4E7Z A;  2CBX A;  3LA7 A;  2LY1 A;  2OAZ A;  3JRB A;  4LB6 B;  1T0F C;  4BNC A;  1JNY A;  3GTM J;  5D4R A;  2ZBK A;  1FOK A;  1H8A C;  1ZK8 A;  3CCQ B;  2L2O A;  1DG1 G;  3GFI A;  2DMT A;  1YLO A;  2VOP A;  4B44 A;  2O0W A;  2Z99 A;  3TO9 A;  5DYM A;  3ZMS A;  2O8K A;  1Y1V J;  3VYU B;  1OYW A;  2DMU A;  1S5L C;  3I55 B;  5C1E A;  3S3N A;  2QZ8 A;  1V5V A;  3CTA A;  4PCQ A;  2LBF B;  4Z03 A;  2GJR A;  1U6G A;  4WZE A;  3RY8 A;  2HGC A;  3M07 A;  2BW3 A;  3JAM Z;  2L7K A;  3ASP A;  3BR1 A;  1FC3 A;  2EQR A;  5H6R A;  3RCO A;  2DET A;  2E2H J;  2STW A;  3R6K A;  4LOC A;  5IYD J;  4RGU A;  1JGG A;  3I4N J;  4ZYE A;  3FXO A;  1ODD A;  3OOU A;  1TBX A;  2B0L A;  4F91 B;  5L3F A;  4C3H J;  1P4M A;  5D5U B;  3ASN H;  4EJO A;  3F6O A;  3RKY A;  1P2F A;  1PJR A;  1J7K A;  5DS9 A;  5KAI C;  3WTV C;  4AM3 A;  3F9K A;  1VQ7 B;  3WGG A;  1E79 A;  1QPM A;  2E1N A;  2V6E A;  2OD5 A;  1E17 A;  4Z4R A;  2HOE A;  1R71 A;  5HZA A;  3CCE I;  1JTY A;  2Q2E A;  4A93 J;  4XLP F;  4O5V A;  4IHT A;  1SFK A;  3PUN A;  4S05 A;  3HIF A;  4PJJ A;  4TV7 A;  1FSH A;  1LNW A;  2D2W A;  1QHH D;  3SQN A;  4CXF A;  4OJL A;  2IW5 A;  1N05 A;  3AVU A;  5J1R A;  3EET A;  1V5E A;  3EUH C;  4BE2 A;  4HBL A;  1VQM I;  4YDT A;  2XZP A;  5ILU A;  3FKJ A;  4FE4 A;  1U78 A;  3FM3 A;  3WXM A;  2CWE A;  3OR2 C;  4OOV A;  1XD7 A;  5LHI A;  3S8P A;  1TVC A;  3KZY A;  1W5S A;  4P6Y A;  3SLD A;  1POG A;  1S3J A;  2KIU A;  1GVH A;  4UAJ A;  1ZM2 A;  2ZL5 A;  2O3F A;  3V8L A;  1H8H A;  2KRC A;  4GYG A;  5LRR A;  2E1M C;  2CUZ A;  1UB9 A;  1KQ0 A;  4BL0 B;  3U1D A;  5DCM B;  1OFD A;  2BSP A;  3GQ9 A;  3D1N I;  1Y56 A;  1WZ2 A;  2XND A;  2JRM A;  3O8G A;  1E62 A;  3G6E I;  3DPU A;  1W36 C;  2CND A;  5E1W A;  2CV0 A;  4R71 A;  4XIC A;  4YZ0 A;  1R6R A;  3HSE A;  2PE3 A;  2V5I A;  3H3V K;  2JPC A;  2A6T A;  4P22 A;  3M1C A;  2JIZ A;  1I7P A;  2LF7 A;  2VPR A;  2VFP A;  3Q38 A;  2MC3 A;  3RKW A;  1W34 A;  4OM9 A;  2A69 F;  2CW7 A;  1HW1 A;  4FX0 A;  3A4C A;  3CO6 C;  1F9N A;  4I76 A;  1FBQ A;  2JPB A;  3FZV A;  2BM1 A;  4RPB A;  4TMT A;  4G7W A;  2FOW A;  1JKQ C;  3CLQ A;  2LP0 A;  3K1N A;  3G71 B;  2JA6 J;  2XHK A;  4EGZ A;  1Z6T A;  3KX2 A;  5J8C A;  1W1W E;  1QNT A;  1SVM A;  1G7S A;  4OPO A;  1YS6 A;  3CCS B;  3IWF A;  4KDP A;  3DU1 X;  1O8K A;  2ZCW A;  4C3I J;  1QFY A;  5FD5 A;  2R7Q A;  3LSI A;  2WPD A;  1GO2 A;  3E1Y E;  3CF2 A;  1V0F A;  3GXO A;  4CIC A;  4Z06 A;  2NAZ A;  1ELO A;  1TQI A;  2DQL A;  5ILS A;  3CZ6 A;  3HRU A;  3WU2 C;  2K4B A;  3SZG A;  1OYY A;  3ASQ A;  4PAB A;  2PBI A;  3A3G A;  2D74 A;  2G9W A;  4M53 A;  5TJJ A;  4UB6 C;  4F7D A;  3OIO A;  4DYC A;  2EIM H;  3MHP A;  1WI3 A;  4S04 A;  1Z3X A;  3CCM B;  1YIJ I;  4RCY A;  4KFC A;  5KW9 A;  2DA1 A;  4BQQ A;  3CJQ B;  1FNB A;  2X85 A;  2CO5 A;  3I0T A;  5HNF A;  3ZSC A;  1D1C A;  3CCJ B;  3AL0 B;  5B6I A;  3J81 Z;  4J19 A;  4ZC3 A;  2DFF A;  2YX7 A;  1SAN A;  2DOE A;  1NBM A;  2O6W A;  3WTU C;  1EFT A;  2D3N A;  3HOZ J;  3RKQ A;  4PGH A;  2DFH A;  4D9J A;  4A3F J;  1WJC A;  3CCR B;  1VQK I;  2P7C B;  1ZEL A;  3GZN B;  3OS1 A;  2VC1 A;  4QLC U;  1T5E A;  5K7F A;  2GXB A;  1QZZ A;  3BQZ A;  5CQE A;  3QPT A;  2GJK A;  1QBJ A;  2LYC A;  3OZW A;  3HOU J;  3KYD B;  1V3F A;  2MBF A;  2I8D A;  2INU A;  4HV6 A;  4I01 A;  2YX4 A;  2OBR A;  2D5V A;  4ZDO A;  3SLN A;  2DN0 A;  2QSF X;  2HDN B;  3T51 B;  3DTI A;  1IDJ A;  1JUS A;  1WP6 A;  4DW6 A;  4DYQ A;  1LLZ A;  2X53 S;  3AST A;  2UUZ A;  5TRD A;  3I3L A;  2R7R A;  1J9I A;  3M8J A;  3K2Z A;  1MNM C;  3WY9 A;  1HG8 A;  3S93 A;  2NVY J;  2NZM A;  4A3J J;  1OCC H;  3C3W A;  2FX0 A;  4WWC A;  4N0B A;  1KK0 A;  2RGV A;  3EDP A;  3U6B A;  3LSR A;  1W0T A;  1H9G A;  1Z7U A;  2JUC A;  3H92 A;  3GF2 A;  3MVP A;  2WBM A;  2C77 A;  1EH6 A;  1EH8 A;  1RQP A;  2WYR A;  2RRE A;  2MG4 A;  3Q0W A;  2A6E F;  2PEX A;  2R92 J;  1GR1 A;  4PSW A;  1APL C;  2NVQ J;  1F20 A;  2O03 A;  3ZPL A;  4QPO A;  2FBI A;  4MFD A;  4RD1 A;  2Z2S B;  1E3X A;  2PQ8 A;  2LY9 A;  4HYE A;  4BJ6 C;  3SJM A;  1D5Y A;  2O1D A;  1F1Z A;  1Y0U A;  4M3D A;  1WH7 A;  2EV0 A;  1N06 A;  2BF4 A;  3W2G A;  1G6N A;  5F1R A;  4HLX A;  3GTO J;  4F93 B;  3OYL A;  3VR6 A;  1W36 D;  4IHW A;  1BI0 A;  2Q0O A;  4CCL A;  2BYV E;  4F7Z A;  3LSH A;  3CC4 I;  4Z4T A;  5KSW B;  3KEW A;  1VQ8 I;  4YEJ A;  4E70 A;  1WOP A;  4M1K A;  3TH0 A;  1S9H A;  3T56 B;  4AF6 A;  3K2A A;  1KMH A;  1XMA A;  3ZQG A;  2EIN H;  4DQK A;  1D8J A;  1G4D A;  1IDY A;  4L5J A;  2Y9Z A;  4I2O A;  2VJI A;  2WR8 A;  3GVJ A;  4FXU A;  2XAG A;  3GIR A;  4RBO A;  4XLF A;  1NG6 A;  3S1M J;  4CZC A;  5K1Y A;  2KJB A;  4YG2 F;  4D7N A;  3FXM A;  2O9L A;  3L7W A;  3H1C A;  2Z16 A;  4LBV A;  2OQR A;  4A69 C;  3G4S B;  1QFZ A;  2GJP A;  3DLL F;  4BQN A;  3PET A;  3FXQ A;  5F1J A;  1T38 A;  3BTJ A;  5IT9 K;  1Q9S A;  3QYF A;  2X6Y A;  1UD3 A;  1EA3 A;  2OK8 A;  1ETW A;  3FBI B;  2FBH A;  1TSP A;  1QA3 A;  3F72 A;  5JR3 A;  3MN2 A;  5JVT A;  3H09 A;  4DQ2 A;  5K7H A;  1K83 J;  3SEQ A;  3OJW A;  4EJV A;  3CCM I;  4YAO A;  1ETX A;  1XMK A;  4LIU A;  4MQV A;  4WZL A;  2BOL A;  4MGR A;  3EUA A;  5TY0 A;  1PJ5 A;  3V8K A;  1WHU A;  5IP9 J;  3RPU A;  2HCJ B;  3ISX A;  4XSX F;  3KLN A;  1IUY A;  4TMZ A;  2XAH A;  1JE8 A;  3VWB A;  5LLQ A;  2VB6 A;  3OY9 A;  4HNV A;  5E20 A;  2BGJ A;  2VJJ A;  3T9G A;  3O8H A;  1MH4 A;  2VNH A;  4OWR B;  1MH3 A;  1FPQ A;  1BI3 A;  3DV8 A;  4Z4U A;  1G3T A;  1P92 A;  1WCM J;  3H0D A;  3EQO A;  2BBY A;  1T6Z A;  3P27 A;  3H9G A;  1JJ2 B;  1DBG A;  3IUO A;  3KZZ A;  4RAG A;  3J7Y J;  2F1M A;  2VQG A;  1GJR A;  2EIK H;  5DM7 F;  1OB5 A;  3KP6 A;  3PM1 A;  3U21 A;  1IO2 A;  1XC5 A;  3BTC A;  1NB0 A;  1VQO B;  4XLH A;  1VQP B;  1WH5 A;  2WB1 N;  1IN4 A;  4CCN A;  3J81 K;  1RQR A;  4EJW A;  2B63 J;  2CGP A;  4BHB A;  2CQQ A;  3M8E A;  5J1U A;  2MFZ A;  2ICW G;  2FVG A;  1E1Q A;  1Y0N A;  2HS5 A;  2ZSI B;  4PC6 A;  2XKO A;  2XB5 A;  3QOD A;  1S8N A;  2WV0 A;  4QSH A;  2EZK A;  3BQJ A;  4URR A;  4M4S A;  1RIO H;  2Y69 H;  2K9Q A;  3K4K A;  3T1B A;  5D8L B;  4BS9 A;  4CYC B;  3GWZ A;  2EFG A;  5F0F A;  2ZZQ A;  1VQ7 I;  5JBQ A;  1COW A;  1XTA A;  2J8K A;  4ENN A;  1RKW A;  1ZG5 A;  1I1S A;  2X9D A;  1YJ9 I;  3LFU A;  1DPR A;  3TQN A;  2XAU A;  4JP0 A;  2MW8 A;  2YWF A;  1XB2 A;  1WDT A;  3OYH A;  5IYW A;  4BJ5 C;  1FRQ A;  4B43 A;  1BOA A;  2R7D A;  3WTW C;  1VHO A;  4JRA C;  3AL0 C;  3WU0 A;  3OOP A;  4I6Z A;  3GQA A;  2X6X A;  4C2M J;  3KFW X;  1OCR H;  2OK7 A;  1TZL A;  4IQ4 A;  2LMD A;  4EM0 B;  1HW2 A;  4YZX A;  2XZO A;  1RR8 C;  4FK8 A;  1UST A;  4KIS A;  1MBH A;  1ON2 A;  1P6R A;  3P9I A;  5BPI A;  2O7O A;  1FMV A;  2X6W A;  2YUH A;  2JA7 J;  2OTL B;  2LH9 A;  4MFE A;  2XGE A;  3PO3 J;  3Q3A A;  2CUJ A;  4YAF A;  2Y9Y A;  2V9V A;  4BDY A;  1LQ1 A;  1BJA A;  2R7F A;  1BC7 C;  1CNF A;  2ZL7 A;  5GV7 A;  1RC9 A;  2QGU A;  2IGK A;  4W1U A;  3Q5F A;  2KFD A;  3LA3 A;  3I56 I;  4E7J A;  2ZXW H;  1TW3 A;  2DPU A;  2GPJ A;  1ORK A;  1TT5 B;  4EMS A;  2DPD A;  2F48 A;  1XE1 A;  3ZUG A;  5DNS A;  3WYA A;  1XX5 A;  2KP6 A;  3SY2 A;  1MNE A;  2AXL A;  1YI2 B;  1X1D A;  3F8N A;  4LMY A;  1EF4 A;  1PVE A;  4BAC A;  3ZP5 A;  1W0K A;  1WOR A;  2PLF A;  5BSY A;  3JRG A;  1ZRC A;  3H35 A;  4XN0 A;  1O88 A;  3FPP A;  1A35 A;  2VT3 A;  4HQE A;  1YLF A;  4DK0 A;  4ZZD A;  4ACA A;  5E3L A;  4Z6Y A;  3GEZ A;  3S3O A;  1QGP A;  3FIS A;  2FQ4 A;  2RC4 A;  3EPZ A;  3F3X A;  3GVL A;  4XK4 A;  5TIS C;  3BH6 B;  3ZN1 A;  3FK6 A;  4XD7 A;  4N4O B;  3NB2 A;  1XCB A;  2QQB A;  1AU7 A;  1GLN A;  1NHA A;  2LTP A;  2P6T A;  2Y0S N;  3HOY J;  2ZL6 A;  4Y7C A;  2DDA A;  1ETQ A;  1LFU P;  4Q4Z F;  1F4K A;  5FD6 A;  3A3B A;  3O6B B;  2F2E A;  1P9Q C;  3Q0U A;  3MCA A;  3OEE A;  3D26 A;  5AN9 A;  3PJR A;  3ZN0 A;  1LE8 B;  2BN4 A;  2QBY A;  1TQP A;  1ACI A;  2MD5 A;  1T08 B;  2LLK A;  1XSV A;  4Y33 A;  4Z4S A;  3R61 A;  5CVI A;  2H09 A;  4N3G A;  1QRC A;  4YEI A;  1JXS A;  2CC2 A;  2GWR A;  4JYK A;  2K9L A;  4A3I J;  2COM A;  2JQ7 A;  3A2K A;  3R4K A;  4A0Z A;  5EGO A;  2ME0 A;  1VQN I;  5K7Z A;  2RV8 A;  1GQ8 A;  1QA2 A;  3BJ6 A;  2R7V A;  1K9M D;  1VTN C;  1FYM A;  2ZXJ A;  1IRG A;  3ZRG A;  2MLK A;  2KQR A;  2VQL A;  2QBY B;  4Z05 A;  1R22 A;  3E5U A;  3RDI A;  1GXQ A;  4G7Z F;  3I58 A;  2HOS A;  2TDX A;  2ZIT A;  4YEL A;  1QUE A;  2A61 A;  2X4H A;  4UVC A;  3J7A O;  2O61 A;  1BJK A;  3U9G A;  2BMW A;  4TSF A;  2E19 A;  1D3Y A;  3JRD A;  4ACB A;  2FD5 A;  2DOF A;  3MQ0 A;  4II3 A;  2O17 A;  3TP0 A;  1FNC A;  3HB9 A;  3SDB A;  2V7U A;  5J1Y A;  3W2E A;  2PJR B;  3ASO H;  1AA7 A;  2HPI A;  1E3O C;  4N9H A;  3F8C A;  3ZGK A;  3A1P A;  3ASR A;  5EDN A;  4J01 A;  1BMF A;  2VL8 A;  4HIZ A;  1TTY A;  1Q7Y D;  5FLV A;  4E7S A;  1YJ9 B;  3BLY A;  3A35 A;  2VE9 A;  1KQ9 A;  4D1Q A;  1W0J A;  4W8S A;  3RPQ A;  1OHH A;  2HYJ A;  2ZNZ A;  2V4J C;  3WG7 H;  2D45 A;  3E6B A;  1ON1 A;  4UZU A;  3OYN A;  3BZK A;  2HZD A;  2ZTN A;  3OZV A;  3AGQ A;  2H27 A;  5A89 A;  3L2V A;  3JX8 A;  1N25 A;  4OZZ A;  4W97 A;  4A0X A;  1FYK A;  1AKH A;  4XMY A;  2V7T A;  4D5F A;  3W5U A;  3AG2 H;  5D8K B;  5HDN A;  2DQR A;  3OYD A;  3FXR A;  3FJO A;  1O8E A;  2ELJ A;  3IP4 B;  2MLG A;  1FOX A;  2XGD A;  3CUO A;  1D2E A;  4AYB N;  4XR6 A;  2QUF A;  3BT9 A;  4HNT A;  1CQT A;  1HVX A;  4HE5 A;  1R1V A;  2IEK A;  3OJX A;  3ZMT A;  1YW9 A;  4HX4 A;  1QX4 A;  3DCF A;  1VHE A;  3B6C A;  3K4B A;  4CH7 A;  3SFI A;  2BHY A;  1V55 H;  3LYC A;  4OOI A;  3LSP A;  1Z77 A;  3BY6 A;  1S29 A;  1NTC A;  5HLH A;  4G1V A;  5HLI A;  1YIT B;  1VQ6 I;  1ZRF A;  3LSK A;  3JU4 A;  4ZGN B;  4DZJ A;  1TYX A;  2VKH A;  2KVO A;  1ZG3 A;  3BR2 A;  3K1P A;  3J7Z I;  4Z4Z A;  1WWX A;  2F4M B;  1ZKG A;  3HRM A;  4XLA A;  4RM0 A;  5CJ9 A;  4HA8 A;  3HOW J;  1WJF A;  1ZTR A;  4RAF A;  1PXZ A;  4W8T A;  1QGY A;  4B3G A;  1BI2 A;  2BY0 A;  4XOP A;  1X2M A;  1FTT A;  3CB4 A;  2IGM A;  2QKL B;  1JTX A;  4A3B J;  3F8M A;  3CCE B;  4M73 A;  1IXS B;  1G3W A;  2L7Z A;  5FLM J;  3WE2 A;  3KP2 A;  3CCV B;  3VSU A;  2JK3 A;  3FIW A;  3A1Y A;  1Z0X A;  1KC8 D;  3OSG A;  1GT0 C;  4A6E A;  1KCC A;  2WY8 Q;  3AK5 A;  1YHQ B;  4AIH A;  2HVR A;  1KQ8 A;  4PGO A;  4YAW A;  5FNZ A;  2HTJ A;  3OMY A;  1VQM B;  1XSD A;  2XZL A;  3C2H A;  3PIP F;  5F08 A;  1VQO I;  1O3R A;  2WJV A;  1X3U A;  5FKL A;  2P5V A;  3K9T A;  3W6J B;  4ZZL A;  2OU2 A;  1MDM B;  1MRZ A;  3CPX A;  4JX6 A;  4IX7 A;  2EWE A;  2JJ7 A;  4BU2 A;  2B7E A;  2EA2 A;  3A02 A;  3SJP A;  5DUI A;  4GFB A;  2XSD C;  4B4D A;  4Y4R A;  1ZGJ A;  2E7X A;  2XV4 S;  5F04 A;  1PJ7 A;  2LF8 A;  2OTJ B;  4WQM A;  4AF7 A;  4P2N A;  2ELH A;  1RKT A;  5FO5 A;  1QQI A;  2DA4 A;  1IB0 A;  2LSO A;  2KJC A;  4YCQ A;  1B23 P;  3I64 A;  2DYS H;  1OCO H;  2DW4 A;  3OL3 A;  4I98 B;  2P6S A;  2DA6 A;  2RDP A;  2DA7 A;  3DBH B;  3ABU A;  1VLO A;  1T8I A;  3WTT C;  2VKV A;  3MWM A;  1E43 A;  1RNL A;  1O8H A;  4MYU A;  2XEX A;  4WK8 F;  1YYV A;  4CCK A;  3PFY A;  3J80 Z;  1LKX A;  3FX3 A;  2W82 A;  1EA0 A;  4BPR A;  3LSJ A;  1J09 A;  4KIF A;  2L7M P;  1K4S A;  5F27 A;  4L5I A;  2WZP P;  1JKR C;  1J0R A;  3GQ7 A;  2ECC A;  3TED A;  1B8I A;  3LJY A;  4QWQ A;  3OV8 A;  2E71 A;  5BNG A;  5L46 A;  1OCT C;  1B8I B;  2CFO A;  5DSZ A;  1IDK A;  5CVR A;  3HBL A;  2G0Y A;  2VFQ A;  2VKE A;  1YRN A;  4RB0 A;  5E8I A;  5A2Q Z;  1Z7L A;  4CZZ A;  1ETO A;  1FBU A;  1MD0 A;  3ELK A;  2ID6 A;  3NWT A;  3ASS A;  2ODL A;  5LRS A;  1R5H A;  2RKH A;  1LEB A;  2E1R A;  3KP5 A;  1TYU A;  5DCM A;  3MFK A;  4KKU A;  1A04 A;  2LRD A;  4AIJ A;  3ZC3 A;  3CCY A;  1WMR A;  5ICF A;  5C1C A;  4OZY A;  2JMW A;  1U8B A;  5LGT A;  1ITY A;  2YU9 J;  2O5R A;  3ZQF A;  2ZZE A;  4P9S A;  3BR5 A;  4U7D A;  3Q9V A;  4YFO A;  2EZL A;  1UZC A;  2L5Q A;  2C4U A;  4XNF A;  2NNY A;  1N07 A;  2XTW A;  2FNA A;  5GTI C;  1S72 B;  2QQ8 A;  3RI4 A;  3PVD A;  1R5O A;  2FXA A;  2EBI A;  3GVK A;  1FX0 A;  3J81 k;  3QU6 A;  1J5Y A;  1KCD A;  4IW3 B;  2GK6 A;  3JRA A;  3GTK J;  3H9N A;  2NTQ A;  1QZE A;  2V7W A;  2XTY A;  5HKK A;  3LMW A;  2VC0 A;  1KTV A;  2KIF A;  4LG3 A;  2KRF A;  3PEN A;  2IAI A;  4LLN A;  2FJ1 A;  1O3S A;  5IYC J;  3OYJ A;  1IN6 A;  2GA2 A;  4G7X A;  2NXN B;  4YRV A;  1LVK A;  1OGI A;  3IAM 2;  1L1I A;  1V4R A;  4AWX B;  4E7H A;  1GVJ A;  2EIL H;  4H0E A;  2BZT A;  1X4O A;  4HSR A;  4NC8 A;  4B4C A;  5JLW A;  2HFH A;  1ETV A;  3H3Z A;  2GBY A;  2ETH A;  2L9R A;  5EZG A;  4AVP A;  2A07 F;  2BW3 B;  4LIV A;  1MZB A;  3CUQ A;  2F5C A;  4IF4 A;  4V2G A;  3CCU B;  1YIT I;  3LWF A;  2MGQ A;  2IS6 A;  3PA2 A;  4ZYG A;  1KJZ A;  2EH3 A;  2M87 A;  2NOG A;  3E6M A;  2Q6I A;  3BQY A;  5HS9 A;  3OYG A;  2NVT J;  4C2L A;  4XOR A;  2ZFU A;  2LK2 A;  4E4H A;  3GX4 X;  1WSR A;  1KA8 A;  2E5N A;  4MO7 A;  3KIO A;  1R58 A;  2EPF A;  1TWH J;  2CV1 A;  1YI2 I;  3U2Q A;  2NTB A;  1IW7 F;  2DAO A;  3DEW A;  3K70 D;  1N78 A;  3I5U A;  3GFM A;  1K7A A;  3J80 K;  1HCR A;  3E20 A;  3FF5 A;  4XM3 A;  4BY7 J;  3ZZU A;  2DTR A;  2RAE A;  5J35 A;  3WQZ A;  2R7W A;  1SD4 A;  2VUM J;  4X0C A;  3GFJ A;  2CQ7 A;  2XAF A;  3BWG A;  3H5A A;  1K78 A;  1HF0 A;  2VFM A;  2ZJ2 A;  3BOQ A;  1OB0 A;  2IS4 A;  2KDO A;  3OOC A;  5LEJ A;  2CSO A;  3UR3 C;  3VSV A;  2XC7 A;  5KHD A;  1MSE C;  3H5R A;  2P0W A;  4KA4 A;  1FJL A;  2W85 A;  3ONQ A;  4DNT B;  4A3M J;  2VPL A;  1CZF A;  1IF1 A;  4ZH4 F;  3WGH A;  2V9K A;  3F23 A;  4M3F A;  2XF7 A;  3D0S A;  3AVY A;  2GIZ A;  3HDD A;  1MMN A;  3P26 A;  2XF5 A;  2FSW A;  4RLQ A;  3HKZ A;  1F5T A;  1FZP B;  4WX9 A;  1E1R A;  5ERI A;  1P4X A;  3HRS A;  2V1U A;  3HRT A;  4HLY A;  2Y48 A;  1R36 A;  3WBJ A;  1ZR4 A;  1TL8 A;  3I55 I;  1MKM A;  2WB1 A;  1B9M A;  4ETS A;  4WXH A;  3HUG B;  5LFA A;  1H0M A;  1LEA A;  2M8E A;  3L2W A;  1PDN C;  3BG5 A;  1S4M A;  3KL9 A;  1QCX A;  4G6D A;  3VO2 A;  1QUF A;  5JLV C;  1QZY A;  4OJP A;  4EM2 A;  2Z9O A;  5CLS A;  3WE3 A;  4A5M A;  1R23 A;  3PSS A;  4TMW A;  2K9N A;  3BG9 A;  4ENJ A;  2Z5U A;  3G4S I;  2KZG A;  1KON A;  5FKN A;  2CQN A;  3VYS B;  3NRV A;  4K2E A;  1FLI A;  1K73 D;  1ZRE A;  5HS8 A;  1OFC X;  3Q9S A;  2D1V A;  2HVQ A;  1S72 I;  1UD4 A;  2W1O A;  4L18 B;  3OYF A;  1EKE A;  3CMA B;  2FA5 A;  4XKV A;  1X4P A;  3W2V A;  1MMA A;  2PLY A;  2V7F A;  1BX0 A;  4UV8 A;  3JQQ A;  1TW2 A;  3VNV A;  1BM9 A;  2Q2E B;  2XF6 A;  3SEZ A;  3W6V A;  3WND A;  1QRB A;  3WG9 A;  4U49 A;  1J75 A;  4UUV A;  1ZAR A;  4P1W A;  2E60 A;  3QOE A;  1JTA A;  3NQO A;  3ZQC A;  4EAT A;  1WQ2 A;  3BY1 A;  3CME B;  2PG4 A;  4U87 A;  1XMX A;  2M7B A;  5F64 A;  2UVE A;  4NB5 A;  4DK1 A;  3AVX A;  1IA5 A;  2BV6 A;  2IPQ X;  2W84 A;  3TMO A;  2QTZ A;  4X05 A;  1KU2 A;  5K5O A;  2ZJR F;  4A3K J;  2H6C A;  2VAS A;  5HVQ C;  3HSF A;  3B4N A;  2EJR A;  4DBR A;  3LSM A;  4NNJ A;  3BNW A;  4GXO A;  3WBK A;  2DJN A;  5IOY A;  1Q1V A;  2KT0 A;  2F4I A;  5D6E A;  3ZCO A;  1DU0 A;  4OMY A;  1DPU A;  5HDK A;  2ZTG A;  4IRG A;  5LHH A;  2PN6 A;  1X58 A;  1Z6R A;  5M3M J;  2LY2 A;  1ZAO A;  1I1G A;  5EMN A;  3BCF A;  3GVA A;  1AOY A;  4KIT B;  2EFQ A;  3GTQ J;  1SAU A;  1W4M A;  3DFG A;  4XN3 A;  3E6C C;  3LQR A;  3AFH A;  3B02 A;  1KU7 A;  2IQ7 A;  3E5X A;  1IAW A;  2EV6 A;  3PSI A;  1O8F A;  3FY3 A;  3IL2 A;  1M1E B;  2K40 A;  3I59 B;  1K78 B;  1R5I D;  3B8Y A;  4A0Y A;  2MSY A;  2OJE D;  1XGM A;  4HX7 A;  5EG0 A;  4XID A;  1GXP A;  1HA3 A;  4LC0 A;  5GAH J;  2ME6 A;  2VBV A;  2F4O B;  2LFB A;  5GPA A;  4HWV A;  1NRK A;  1PJ6 A;  3CW2 A;  5L3B A;  3QPL A;  4FE7 A;  1RUO A;  3S2D J;  3M9A A;  2O04 A;  3CCV I;  3QQA A;  1HKT A;  2E2J J;  3KE2 A;  4OP7 A;  1KD1 D;  1M90 D;  4RS8 A;  1BN8 A;  2J7K A;  3ECH A;  5IY5 H;  4BH9 A;  5HXB A;  3E97 A;  1BOB A;  3TOA A;  2XGJ A;  1HW5 A;  3OAA A;  3JSO A;  3JRF A;  5IK2 A;  2CUF A;  3QP6 A;  1EJ9 A;  4RDK A;  2R4G A;  2Q8K A;  1I6H J;  2JSP A;  1YIO A;  1ZYR F;  4Y3O A;  5L3D A;  1I39 A;  1K6Y A;  2BGI A;  1V5F A;  4M3B A;  4B09 A;  3TP3 A;  3KYL A;  1K8A D;  3GBG A;  1SMY F;  3WTX C;  2KIS A;  3BG7 A;  3WU1 B;  3LMM A;  4G8X A;  3N97 A;  1D0Z A;  3I4P A;  1R5N A;  4UZE A;  3ABL H;  2Y75 A;  5BS6 A;  4KUM A;  2K4J A;  2PIA A;  3LO8 A;  3KET A;  3GTP J;  2Q1Z B;  1VJS A;  5BMZ A;  5DM6 F;  2M8G X;  1O3T A;  3T0Y A;  4IRI A;  2DA5 A;  2COB A;  2IGN A;  9ANT A;  2A5Y B;  2YWE A;  3FKS A;  1OGJ A;  3ZBU A;  2YSR A;  1UG0 A;  2WAQ A;  1D0Y A;  3PNV A;  4C30 A;  4MLO A;  4AUX A;  3W5V A;  4DZP A;  2UWM A;  1K5C A;  4MNU A;  1VFC A;  3V7R A;  5BPD A;  3CCS I;  1QGA A;  4P26 A;  3OIQ A;  3L09 A;  4BBR J;  1DGR M;  3TO7 A;  4Y52 J;  4PDK A;  2VBT A;  1K4Z A;  1H88 C;  2A5W A;  4ZJZ A;  3P4G A;  2XT2 A;  4I84 A;  2N8G A;  4G12 A;  3T53 B;  2X6O A;  3OE7 A;  3SYJ A;  1WTH D;  1SFU A;  3OZU A;  1RZ4 A;  4K1X A;  4Y13 A;  3ML3 A;  1T6S A;  2IRF G;  2PYH A;  2JT1 A;  3GCM A;  4RMN A;  3TW6 A;  1JGS A;  4EH1 A;  2VJ4 A;  2QX3 A;  1I5Z A;  1U2W A;  2DYR H;  5AIQ A;  4L0Y B;  2K86 A;  1DU6 A;  1ZHF A;  1XN7 A;  5F4M A;  3ZPP A;  1DDI A;  4HOB A;  2WAE A;  1MIJ A;  3KP3 A;  2ZXI A;  4FCY A;  1GUU A;  3FDY A;  1O3Q A;  2WSS A;  4FWT A;  4B48 A;  2J8I A;  3GFL A;  4P55 A;  1G2H A;  2FX3 A;  4FAS D;  3D5R C;  5CVU A;  4C2T A;  2MA3 A;  1Y39 A;  5H59 A;  4IHS A;  4XL9 A;  3ESW B;  1TUI A;  1OQY A;  3A01 A;  1R4M B;  2R7T A;  4GO1 A;  1QU3 A;  4EVI A;  1E3H A;  2INV A;  4M2L A;  4QIW N;  3E3V A;  5C3E J;  1IHM A;  2Z6B D;  5F4J A;  4KIG A;  4MXN A;  1EP2 B;  1LB2 A;  1UD5 A;  5IYN A;  4PJ0 C;  3HAG A;  5FL7 A;  3CF5 F;  1YQA A;  3I1F A;  3G3Z A;  2PMU A;  3DXJ F;  3M4O J;  2ZXH A;  4CQJ A;  4G94 A;  2CQK A;  1DBO A;  1PE9 A;  1FY7 A;  3BC9 A;  2J5P A;  4BDZ A;  1D0X A;  1PUE E;  3HG9 A;  5DS0 A;  5FIU A;  5DUK A;  2JN9 A;  2X8K A;  1E3Z A;  1VQ8 B;  5FLX K;  4AC0 A;  1T95 A;  3RIR A;  1YW8 A;  2Y0M A;  4BE0 A;  4QPQ A;  4OIQ F;  3N90 A;  3ONU A;  2VI6 A;  2VQH A;  1FT9 A;  1AMO A;  1I3Q J;  3HYI A;  1UHM A;  2O0V A;  1HF2 A;  2DLL A;  5E79 C;  4M74 A;  4CSW A;  3IH4 A;  1DP7 P;  2ZKZ A;  4YFK F;  3L2R A;  2BHZ A;  3I53 A;  1G3S A;  5H20 A;  2Y31 A;  4OPS A;  2KRH A;  3BR6 A;  1T98 A;  4HZF A;  4X1E A;  4A3E J;  1ETY A;  3KEO A;  4G7H F;  1ZM9 A;  3RQ4 A;  4UY8 I;  2QMU A;  3WNB A;  3BPX A;  3Q3S A;  3CQZ J;  5GAE J;  2X3U A;  2HVS A;  3TDU C;  3JRI A;  1BPL A;  2LD5 A;  2WAQ N;  2EZI A;  1H9T A;  1RPW A;  4P3Y A;  2QQA A;  4P5O A;  3G1L A;  4C9Y A;  2ZSH B;  3BC8 A;  3H3U A;  3KYC B;  4DIQ A;  1X3Z B;  4CCO A;  5FRN A;  4P12 A;  5D4S A;  1UMK A;  1TT0 A;  2KMU A;  2PFB A;  5A8A A;  2CMP A;  2HOT A;  1YFH A;  3ROU A;  4AVZ A;  3SFZ A;  2D9R A;  3VMV A;  4GRI A;  3MKW B;  1RI7 A;  1TLH B;  1QA1 A;  2OZU A;  3CCU I;  3OW7 A;  2RQQ A;  4P25 A;  2YU3 A;  4KIB A;  3QAH A;  2VBK A;  4JK1 X;  4LBW A;  2QZA A;  4I7H A;  3ZR8 X;  2ZJP F;  3OL4 A;  3QP5 A;  4MEY F;  4LK0 F;  3LST A;  4DYR A;  2AQE A;  1VQ6 B;  4RD2 A;  2IOU G;  3VMF A;  1LVA A;  1D5V A;  1PYV A;  3L1P A;  2XGC A;  4CDG A;  3S3M A;  5FKK A;  3HOX J;  1LDK B;  1FP1 D;  3N05 A;  4NK6 A;  1LUJ B;  3QOP A;  2LOO A;  4LBY A;  1VQ4 B;  1FND A;  3C2G A;  4L5E A;  3H94 A;  1YX5 A;  2XPU A;  3OYB A;  5B5E C;  1UD2 A;  4RLZ A;  3CCJ I;  3I54 A;  4OJ6 A;  2VN2 A;  2R5Y B;  3PSZ A;  4PJL A;  2C4T A;  5HOO A;  1A36 A;  2V1X A;  3DP7 A;  2VT2 A;  1HKQ A;  3VSL A;  3MD2 A;  4U0Y A;  1IG7 A;  1EH7 A;  3ZOB A;  1VQP I;  1UEL B;  5CYV A;  4EV0 A;  2HKX A;  2EFP A;  3CCR I;  3IKT A;  4BBS J;  3PUM A;  2BM7 A;  5DTD A;  2ISZ A;  1JA0 A;  3GME A;  2ID3 A;  4AU7 A;  4U0W A;  5J6X A;  1IDZ A;  3DKW A;  4LG0 A;  1S6L A;  2H1K A;  3CD6 I;  1N0V C;  1BJZ A;  4F92 B;  3VPR A;  2PJR A;  3FMQ A;  1WU8 A;  4LBZ A;  1W87 A;  1IN5 A;  4YIF A;  1RWR A;  3VST A;  3LSG A;  1OKR A;  1YX2 A;  4IL6 C;  3SZP A;  2FRH A;  1VQ9 I;  2LNB A;  5GPC A;  1KZH A;  2NV4 A;  4M3G A;  2K7L A;  3CP2 A;  5F4O A;  1YIJ B;  2PJP A;  1ETK A;  2QWW A;  5CQG A;  1E64 A;  5J3L A;  2EV5 A;  3B82 A;  5AIP A;  2LC2 A;  3GUD A;  1G8X A;  2HTS A;  2HYG D;  2K3P A;  3ECO A;  5EGO B;  1LFB A;  2Z1D A;  3QPS A;  1I6X A;  2UXX A;  4RM2 A;  1CQX A;  1MBK A;  2I5U A;  2MYS A;  2JZY A;  4PFP A;  3HKZ N;  3ABK H;  3BZ6 A;  3VDX A;  2X1C A;  1HDP A;  4BHP A;  4WF2 A;  5J40 A;  3S2H J;  2LR8 A;  5CVV A;  5E1X A;  4P96 A;  2DCU A;  2HU9 A;  2IXS A;  4BAY A;  3GLL A;  3K1M A;  2E34 A;  4X8I A;  1T56 A;  4Q48 A;  2AHO A;  3CMA I;  5IT3 A;  2F3L A;  1X1A A;  4CO8 A;  4X0G A;  3HXL A;  1MMS A;  4M3E A;  3BCD A;  1XDU A;  4KN7 X;  3F8F A;  1HST A;  1BL0 A;  4E7I A;  1LPQ A;  1HA8 A;  4PC3 A;  2QVO A;  3V7C A;  1QVF B;  1VZ0 A;  4DQL A;  4JMQ A;  4XON A;  1UMQ A;  1VF9 A;  2Y0S A;  3RYP A;  4DNR B;  3GZ6 A;  1YRN B;  2R7U A;  3BCA A;  2GXG A;  2KIQ A;  4AC9 A;  1B72 A;  4XLC A;  5FLX Z;  3T8R A;  2Y30 A;  4E6K G;  1B72 B;  1B1B A;  5FA6 A;  3QPH A;  5E8G A;  2BXZ A;  2DT7 B;  2CK3 A;  2IP2 A;  2VXD A;  3T5X A;  1I8D A;  2F1L A;  2TRT A;  3B8H A;  4NC6 A;  3W2F A;  4RGR A;  1USS A;  3V76 A;  1R5G A;  1BLI A;  3RPU D;  5TV2 A;  1G7T A;  2C78 A;  2VLA A;  3S16 J;  1JJ6 C;  1OFL A;  1MGT A;  3CUQ C;  4HRI A;  2NYX A;  5IYB J;  4XOT A;  2G7H A;  1VF7 A;  3CCL B;  4IJA A;  4CCM A;  2HNH A;  1NB9 A;  2X1E A;  1W5T A;  3N6Z A;  3HTS B;  5B3S H;  2VBY A;  2F5E A;  4EJU A;  1W5C C;  4B3A A;  1D8K A;  3BG3 A;  3BH4 A;  1ZM4 A;  1O7F A;  3PNT A;  1IUF A;  2R5Y A;  5J47 A;  3FXL A;  3PUF A;  1FX7 A;  2OA4 A;  2QQ9 A;  1Z9C A;  3FHN A;  4LLG F;  1A8P A;  3QFS A;  3CDH A;  2RC5 A;  2GAU A;  1FDR A;  5DDG A;  1I27 A;  2HWV A;  3K10 A;  2DYI A;  3BR0 A;  2EA4 A;  3F0C A;  4N9I A;  4NQW A;  4PFO A;  1S7E A;  4UB8 C;  1KRH A;  2YWG A;  1VQN B;  2CW8 A;  5D5W B;  4QVJ A;  4F55 A;  2CF4 A;  1A6Q A;  5LEK A;  1VQL B;  3GQB A;  4QHY A;  1BR1 A;  2W7Z A;  2J5O A;  3AVV A;  2M4K A;  3C18 A;  5C4J J;  4QFM A;  4XSZ F;  4QUZ A;  3PNY A;  4NBQ A;  1DUX C;  5HLT A;  4LG0 B;  2XPV A;  1P4A A;  3GTJ J;  2ZC2 A;  4WCG A;  2WY7 Q;  4OOX A;  2RN7 A;  5K5R A;  2QN6 A;  3C7J A;  2KKO A;  4Z4W A;  3ERM A;  5H5J A;  1OGM X;  4M71 A;  1TQM A;  5C4X J;  4CCJ A;  4UZF A;  4ESF A;  4IZZ A;  3HJE A;  3DU5 A;  1W35 A;  3QFR A;  2WV1 A;  3PUB A;  1J9Z A;  2OPT A;  4JX5 A;  1N0U A;  4FHT A;  2FEZ A;  3KEY A;  4AIK A;  2M0C A;  3VOD A;  4YAL A;  4YAU A;  4FIS A;  1QG0 A;  3DLA A;  3JRH A;  2B9S A;  5CKT A;  2STT A;  2BY2 A;  2XIG A;  1SD7 A;  2E7W A;  3M1E A;  4BE1 A;  4RB3 C;  1EP3 B;  4LK1 F;  3ZMV A;  2X3H A;  2HDD A;  1T0F A;  3OR1 C;  5FJ8 J;  1AKH B;  2PEC A;  2GQQ A;  3K70 C;  3W2W A;  1UCR A;  2XOK A;  1U8R A;  1SVL A;  3K0L A;  4KH3 A;  3RKX A;  1MDM A;  2DO7 A;  4KJZ A;  4ENK A;  1PUF A;  3SQV A;  1UHS A;  1EWY A;  3NWS A;  4F52 A;  3OYA A;  4ZDP A;  3DPT A;  2DOD A;  4R8H A;  2B7B A;  3ZQ7 A;  2M45 A;  5H6Q A;  4DGW B;  3D5L A;  1XQB A;  2BVL A;  3BJO A;  4UVB A;  5M5W J;  4L9N A;  4G5G A;  3ZMD A;  2DI3 A;  3L2C A;  2OV7 A;  1VI0 A;  3I4M J;  1JA1 A;  4ZCL A;  1Y6I A;  3OYE A;  5FO0 A;  2DT5 A;  4XQF A;  2W6I A;  2ZBU A;  3OFN A;  1IXR C;  3P7N A;  2V31 A;  5JMC B;  1V5G A;  2DDB A;  3Q0V A;  3ZBT A;  2B0R A;  1WSV A;  1HKS A;  3ONY A;  5EZH A;  1TP4 A;  1NHC A;  2VOO A;  2L01 A;  2IT0 A;  2VIX A;  3MKL A;  3ML6 A;  1RET A;  2XNC A;  2UXN A;  1LJ9 A;  4Q7J B;  2V26 A;  2P8T A;  2P5L C;  3LAJ A;  2B5O A;  4MHG A;  2R9V A;  1BHE A;  1IN8 A;  5DEQ A;  4HF1 A;  2X0K A;  1I3A A;  5E1Z B;  2C5B A;  2GIV A;  3CLO A;  4PC2 A;  2PI0 A;  1D1A A;  1BIA A;  2PMD A;  4B8X A;  4BUP A;  1ZQ3 P;  5F0C A;  3FHZ A;  2FBK A;  4G6Q A;  4GQN A;  1B6A A;  4PAA A;  1M1K D;  1H80 A;  3EUK L;  1VQ4 I;  1N08 A;  4MIM A;  5BOX A;  1IJE A;  4H4K C;  1NJI D;  2V1N A;  3B78 A;  3LL7 A;  4UVA A;  2CUE A;  4OJ5 A;  1H42 A;  4PK4 A;  2QYO A;  1W7P B;  2WJY A;  3P9C A;  3R0J A; 
#chains in the Genus database with same CATH homology
 2E60 A;  3QOE A;  1JTA A;  3QYF A;  1XG2 A;  3B90 A;  2X6Y A;  1UD3 A;  2KHM A;  1EA3 A;  4NQW B;  4EAT A;  3FBI B;  2UVE A;  4U87 A;  2M7B A;  4ASU A;  2VKD A;  4BEH A;  3G05 A;  4KT6 A;  3CMM A;  2WAF A;  4DK1 A;  1IA5 A;  3TMO A;  3SEQ A;  2L9N A;  3JUR A;  2VAS A;  4LIU A;  5HVQ C;  3B4N A;  2HDW A;  2BOL A;  4DBR A;  3LSM A;  1PLU A;  4NNJ A;  3EUA A;  3DKY A;  3D5S C;  4B3X A;  3E0J B;  3DPL C;  3K4L A;  3E1S A;  3ZCO A;  2F4I A;  2HPM A;  1UD6 A;  2ZTG A;  2F43 A;  3VWB A;  3OY9 A;  2VB6 A;  2LY2 A;  2VJJ A;  1HZE A;  4JQF A;  3T9G A;  2KLO A;  3MKY B;  1AIR A;  3BCF A;  4OWR B;  1WPC A;  4KIT B;  1WJB A;  2HQA A;  1SAU A;  2X51 A;  4XN3 A;  4Z1M A;  3EQO A;  3H0D A;  3AFH A;  3H9G A;  4RLF A;  2IQ7 A;  1DBG A;  3IUO A;  2F1M A;  2VQG A;  3PSI A;  1O8F A;  1NG7 A;  1U0J A;  2F6C A;  3FY3 A;  3U21 A;  2M5S A;  2E1M B;  1X0C A;  4XLH A;  4IQJ A;  1JRG A;  2NST A;  3B8Y A;  4CCN A;  1IB4 A;  2MFZ A;  1E1Q A;  4XKC A;  1MW7 A;  5CPR B;  2ZSI B;  4HWV A;  3QOD A;  4HG2 A;  3DWL E;  3OS0 A;  1NRK A;  1E0E A;  1OFM A;  1EE6 A;  4URR A;  3GRH A;  2O04 A;  5KCM A;  5JHF A;  1YE9 A;  4KKS A;  4G6I A;  2QKM B;  1BN8 A;  3K4K A;  4PMH A;  2UV1 A;  4BS9 A;  2ZZQ A;  2VBE A;  4MR0 A;  1COW A;  3HPH A;  4E0F A;  4U7B A;  3VMW A;  3WWG A;  1BOB A;  4C2U A;  3OEH A;  3LFU A;  2XGJ A;  2W4S A;  2XAU A;  3OAA A;  2UVF A;  3PSF A;  5IK2 A;  1O8D A;  3OYH A;  4BJ5 C;  2R4G A;  3OIP A;  2JSP A;  4B43 A;  4Y3O A;  1H8E A;  1OLT A;  2GK7 A;  1K6Y A;  3AL0 C;  1V5F A;  1O8G A;  1ERD A;  4NC7 A;  3KYL A;  3GQA A;  4BQO A;  3GBG A;  2X6X A;  2XDV A;  1WJA A;  4KKT A;  1TZL A;  4IQ4 A;  3BG7 A;  4YZX A;  3L2U A;  2XZO A;  3LMM A;  2JA2 A;  1D0Z A;  1X1C A;  3H9Q A;  4JOM A;  4KIS A;  2JUG A;  1FMV A;  2X6W A;  4L8J A;  2Q1Z B;  1VJS A;  3DEE A;  2LH9 A;  3HOS A;  1KTW A;  2CV2 A;  2IGN A;  3H9J A;  2CUJ A;  4BDY A;  3FKS A;  2IS2 A;  5CDF A;  1UG0 A;  2WAQ A;  1D0Y A;  3PNV A;  4C30 A;  4MLO A;  2QE7 A;  1K5C A;  2UWM A;  2IGK A;  1OR7 C;  3OIQ A;  1PKV A;  1DGR M;  2RNG A;  2MAB A;  4E7J A;  2A5W A;  3RSN A;  4ZJZ A;  1MAB A;  4I84 A;  4XLE A;  3SUC A;  2V7Q A;  1YX3 A;  4G6T B;  2VXZ A;  3T53 B;  3OE7 A;  1WTH D;  3VYT B;  4HST A;  4TKO B;  2KP6 A;  2PYH A;  1MNE A;  4RMN A;  1X1D A;  4F3Q A;  1RMG A;  2VJ4 A;  3HC7 A;  4BAC A;  2QX3 A;  1W0K A;  3DDY A;  3H35 A;  4XN0 A;  4BXF A;  1O88 A;  3FPP A;  1BR2 A;  3ZPP A;  2WSS A;  2M3A A;  2WAE A;  4II2 A;  2ZXI A;  1Z21 A;  3FDY A;  4DK0 A;  1O8J A;  4B48 A;  2M7A A;  3QYB A;  2K9M A;  3DU6 A;  3S3O A;  3EPZ A;  1N75 A;  1MND A;  2W00 A;  4FAS D;  3D5R C;  3GVL A;  1DQU A;  4C2T A;  4LIT A;  3OWT A;  4XL9 A;  1MMG A;  2VQC A;  4XD7 A;  2KZV A;  4N4O B;  1K28 D;  1GLN A;  2R7T A;  2VBM A;  1QU3 A;  1SKY B;  1Z3Y A;  2JDI A;  2JJ1 A;  3W3C A;  4BEH B;  3A3B A;  2INV A;  1DP3 A;  2Z6B D;  1P9Q C;  3OEE A;  4BGD A;  3KRG A;  3PJR A;  4MXN A;  3OS2 A;  2OC6 A;  1UD5 A;  2F5V A;  4ITV A;  3HAG A;  5FL7 A;  4Y33 A;  1BR4 A;  2ZXH A;  3HL2 A;  3OYI A;  1MMD A;  1DBO A;  2DT6 A;  1PE9 A;  3BC9 A;  2K9L A;  1D0X A;  4BDZ A;  3A2K A;  3HG9 A;  4W8R A;  2X8K A;  1GQ8 A;  1E3Z A;  4J00 A;  2R7V A;  1T95 A;  4BE0 A;  2ZZF A;  4QPQ A;  3ZRG A;  2KQR A;  2VQL A;  2VQH A;  3QYE A;  4Z05 A;  1O8M A;  2O0V A;  1V0E A;  4CSW A;  1WJD A;  3DTK A;  4YEL A;  3L2R A;  4TSF A;  2KRH A;  3UW0 A;  3J7A Y;  1N77 A;  3S32 A;  4II3 A;  2O17 A;  3RQ4 A;  4BJT A;  3SDB A;  3OYM A;  3CP8 A;  2PJR B;  2M0M A;  3TBI A;  2QY1 A;  3DKX A;  3ZQQ A;  1AA7 A;  2HPI A;  2HVS A;  1BPL A;  4NUB A;  2HLD A;  3ZGK A;  3ZXS A;  1QJV A;  4P5O A;  3TL4 X;  4J01 A;  1BMF A;  2E5Z A;  2VL8 A;  4C9Y A;  2ZSH B;  3BC8 A;  4HIZ A;  3W2A A;  4DIQ A;  2KL4 A;  3HOT A;  4CCO A;  4E7S A;  5FRN A;  3BLY A;  2PMZ A;  3A35 A;  1QHG A;  1O8L A;  1TT0 A;  2KMU A;  4D1Q A;  2M4G A;  1W0J A;  1UAA A;  2W6J A;  4W8S A;  3ZIA A;  4E7K A;  1OHH A;  2CMP A;  2V4J C;  1X19 A;  4XKW A;  2NT9 A;  4AVZ A;  4UZU A;  4GRI A;  3OYC A;  1WJE A;  3OYN A;  1I18 A;  4W8Q A;  3VMV A;  3MKW B;  3EQN A;  1D1B A;  2HZD A;  2ZTN A;  3OW7 A;  2RQQ A;  3DQV C;  3L2V A;  3DTE A;  3IAS 2;  4OZZ A;  4XMY A;  2LRE A;  4FET A;  1X1B A;  3CES A;  1JI8 A;  2NOJ B;  3FBN B;  2VBK A;  3OYD A;  3ZR8 X;  1W9X A;  3NE5 B;  2ELJ A;  5HNH A;  4B3F X;  3OL4 A;  2DCE A;  3IP4 B;  1O8E A;  3OYK A;  4YZA A;  2AQE A;  1FMW A;  4HEA 2;  2L9S A;  2JVG A;  2Z8G A;  1PYV A;  4XR6 A;  4HNT A;  1HVX A;  1KZL A;  3S3M A;  4E7Z A;  4AYB A;  1LDK B;  3N05 A;  2LY1 A;  4NK6 A;  1T0F C;  2LOO A;  3K4B A;  4CH7 A;  1O8I A;  3C2G A;  3H94 A;  1YX5 A;  3G2B A;  3OYB A;  2L2O A;  1UD2 A;  4B44 A;  2O0W A;  4OJ6 A;  4EW9 A;  4PJL A;  4ZTF A;  5HOO A;  3LSK A;  4R79 A;  3VYU B;  3JU4 A;  2VKH A;  2AQF A;  3VSL A;  3MD2 A;  3VYR B;  3S3N A;  2KVO A;  5C1E A;  2LBF B;  1OOC A;  2GJR A;  4RM3 A;  4Z03 A;  1UEL B;  2BW3 A;  4XLA A;  2JVH A;  2L7K A;  1WJF A;  3ZPN A;  3RCO A;  1PXZ A;  3HPG A;  4W8T A;  4B3G A;  4PJM A;  4XOP A;  4AU7 A;  2IGM A;  1WJ5 A;  2QKL B;  3OOU A;  2IGO A;  4ANJ A;  4F91 B;  4F92 B;  2PJR A;  3VSU A;  3A1Y A;  3VST A;  1RWR A;  1PJR A;  2WY8 Q;  3LSG A;  4OJO A;  2HVR A;  3F9K A;  3OMY A;  1G59 A;  1E79 A;  2V6E A;  2XZL A;  3C2H A;  3H5N A;  2LBF A;  2GOX B;  2WJV A;  3CP2 A;  4IX7 A;  1SFK A;  5CQG A;  2EWE A;  4PJJ A;  1QHH D;  4BU2 A;  1RU4 A;  4OJL A;  3I9V 2;  2V4D A;  2LC2 A;  4Y4R A;  1G8X A;  2K3P A;  3K4J A;  1V5E A;  3EUH C;  4BE2 A;  2Z1D A;  4ZYA A;  2XZP A;  4RM2 A;  3CJR B;  3FKJ A;  2R7S A;  2MYS A;  3VDX A;  4PFP A;  2X1C A;  3OR2 C;  3S8P A;  5FRO A;  3OL3 A;  2HU9 A;  2IXS A;  2KRC A;  1E43 A;  1H8H A;  1O8H A;  4CCK A;  3PFY A;  1LKX A;  2CUZ A;  2E1M C;  4ZDL A;  2W82 A;  4CA0 A;  4BL0 B;  1X1A A;  2LG4 A;  1J09 A;  3HXL A;  4X0G A;  3BCD A;  2BSP A;  3GQ9 A;  1Y56 A;  4ZTJ A;  2XND A;  4E7I A;  2WZP P;  1HA8 A;  3GQ7 A;  1VZ0 A;  1EFR A;  4JMQ A;  4XON A;  2Y0S A;  4DNR B;  1KCC A;  1IDK A;  3BCB A;  2CFO A;  3DPU A;  3BCA A;  1W36 C;  2R7U A;  2CV0 A;  2E1B A;  1UD8 A;  4XLC A;  4YZ0 A;  1R6R A;  1Z7L A;  4E6K G;  4P22 A;  2A6T A;  3M1C A;  2JIZ A;  4TT3 A;  3NWT A;  2ODL A;  2DT7 B;  2CK3 A;  2VXD A;  2CW7 A;  2DOA A;  1I8D A;  3A4C A;  4KKU A;  4OAZ A;  2LRD A;  1WMR A;  4U4B A;  5C1C A;  1BLI A;  3RPU D;  4OZY A;  3OPO A;  2O5R A;  2ZZE A;  4G7W A;  2VLA A;  2DXI A;  1OFL A;  2L5Q A;  4HRI A;  4XNF A;  4XOT A;  1VF7 A;  3KX2 A;  4CCM A;  2HNH A;  3K6G A;  3GQ8 A;  3GVK A;  2X1E A;  1O8K A;  1FX0 A;  4PUS A;  2R7Q A;  3LSI A;  2WPD A;  2MC4 A;  1KCD A;  3CF2 A;  2GK6 A;  1V0F A;  2X1D A;  2NTQ A;  3LMW A;  5HKK A;  4Z06 A;  2WA0 A;  3V42 A;  2CH0 A;  3L2Q A;  2DJI A;  3BH4 A;  4LG3 A;  3AKZ A;  3CZ6 A;  3PNT A;  4XKB A;  3SZG A;  5TGT A;  3BG6 A;  1DGW Y;  3FHN A;  3OYJ A;  4IKF A;  2D3L A;  3A3G A;  4G7X A;  4YRV A;  3MKZ A;  1LVK A;  1Z3X A;  3K10 A;  3K4M A;  3IAM 2;  3RTR A;  2FUG 2;  4PFO A;  4BQQ A;  4E7H A;  3CJQ B;  4HSR A;  1X4O A;  2CW8 A;  2X85 A;  4NC8 A;  5HNF A;  2NT6 A;  2ZZG A;  4F55 A;  1IRX A;  2MD0 A;  3ZSC A;  1D1C A;  4PJN A;  2GOM A;  2BW3 B;  4LIV A;  3AL0 B;  1VLY A;  3GQB A;  1BR1 A;  4ZC3 A;  5DN6 A;  2M4K A;  1NBM A;  2IS6 A;  2VJ5 A;  4HNU A;  3PNY A;  2D3N A;  4C2L A;  5HLT A;  3OYG A;  4XOR A;  2ZFU A;  4D9J A;  2WAD A;  2LZJ A;  2WY7 Q;  4E4H A;  1WJC A;  1ZEL A;  2E5N A;  1OGO X;  3OS1 A;  2NTB A;  1T5E A;  2CV1 A;  2IS1 A;  1OGM X;  4NK8 A;  5CQE A;  4CCJ A;  4E7L A;  3K70 D;  2GJK A;  2LYC A;  4IZZ A;  1N78 A;  3DU5 A;  3PUB A;  2I8D A;  2INU A;  4XM3 A;  4OAY A;  3WQZ A;  2R7W A;  2BVM A;  3KEY A;  4ZDO A;  1VBL A;  4DBQ A;  3H5A A;  3SYT A;  1OB0 A;  2IS4 A;  2KDO A;  2R7O A;  4DOZ A;  3OOC A;  3UR3 C;  3DLA A;  3DTI A;  3T51 B;  5CKT A;  5KHD A;  2XC7 A;  3VSV A;  3H5R A;  1WP6 A;  2P0W A;  2X53 S;  4BE1 A;  2UUZ A;  5LD2 C;  3I3L A;  2R7R A;  3M8J A;  2X3H A;  1HG8 A;  3ONQ A;  3OR1 C;  2PEC A;  3S93 A;  3K70 C;  4DNT B;  3MMY B;  2NZM A;  3W2W A;  2VPL A;  1CZF A;  3PL8 A;  2XOK A;  2V9K A;  2JJ2 A;  2XF7 A;  2W7N A;  1MMN A;  4KJZ A;  2NTP A;  2WBM A;  3NWS A;  2XF5 A;  4F52 A;  2XSJ C;  4RLQ A;  2K5C A;  3DPT A;  3HKZ A;  4PSX A;  4ZDP A;  3OYA A;  2RRE A;  3LNN A;  2R7X A;  1WFX A;  3VSK A;  4DGW B;  3D5L A;  4PSW A;  1E1R A;  2BVL A;  4YZQ A;  3K4N A;  4QPO A;  4DJA A;  2OV7 A;  2QXZ A;  1Y6I A;  3OYE A;  4XQF A;  2W6I A;  3OFN A;  2Z2S B;  2WB1 A;  1E3X A;  5AMV A;  4N4N B;  2V31 A;  2KPM A;  3HUG B;  5LFA A;  4BJ6 C;  1V5G A;  3K4C A;  3L2W A;  1QCX A;  2O1D A;  1NHC A;  4F93 B;  3OYL A;  3VR6 A;  1W36 D;  2OUM A;  3UNG C;  4CCL A;  5KNL A;  2PYG A;  4OJP A;  2VIX A;  3LSH A;  3KEW A;  4YEJ A;  1LFP A;  1S9H A;  3T56 B;  1KMH A;  2V26 A;  2R9V A;  4B47 A;  2CS3 A;  1BHE A;  1KON A;  5FRM A;  3VYS B;  2VJI A;  3GVJ A;  4FXU A;  4YXW A;  1D1A A;  2HVQ A;  1UD4 A;  2W1O A;  4XLF A;  4BUP A;  2NSP A;  1NG6 A;  4CZC A;  3OYF A;  4GQN A;  4XKV A;  4HPQ A;  1X4P A;  3W2V A;  1MMA A;  2V7F A;  2Z16 A;  1H80 A;  3EUK L;  2DIE A;  2Q2E B;  4H4K C;  2XF6 A;  3SEZ A;  2V1N A;  3LL7 A;  4U49 A;  2GJP A;  4OJ5 A;  4BQN A;  1IDJ A;  4PK4 A;  4P1W A;  2WJY A;  4CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...