4XLCA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlcA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlcA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlcA02
1DBGA 3EQOA 4I84A 4U49A 3GQ9A 2NTQA 2UVEA 2VBMA 3EQNA 3VSTA 1K5CA 3GQAA 2Z8GA 1PLUA 4MR0A 1X0CA 2VBKA 2INUA 2NSTA 1RU4A 3VSUA 1O8JA 2O04A 3B90A 1GQ8A 3T9GA 3VSVA 2NT6A 1VBLA 4XKWA 4Z05A 1O8LA 3VMWA 1O8FA 4NK8A 1JTAA 2INVA 2X6WA 1OFLA 2NSPA 2NTBA 2ODLA 4W8SA 1OGMX 4YZAA 1CZFA 1OGOX 1H80A 4Z06A 2PYHA 2PECA 4OZZA 4W8QA 4NK6A 4XOTA 1PE9A 1WMRA 2QXZA 2EWEA 4XR6A 1QCXA 4XLHA 4OZYA 4OJ6A 4XN0A 4XLEA 4XQFA 4XONA 2X6YA 4OJ5A 1O8HA 2PYGA 1O8MA 1RWRA 5C1EA 5C1CA 2X3HA 1O88A 4XORA 1AIRA 3VMVA 1HG8A 2O0WA 2VJJA 4OJOA 4EW9A 4XL9A 4Z03A 4XOPA 4XLCA 4W8RA 2QX3A 3LMWA 1IDJA 4YZXA 2VJIA 1O8GA 1IB4A 2X6XA 4URRA 1IDKA 1KCCA 4XMYA 2VBEA 4YEJA 1OFMA 3WWGA 4MXNA 2X85A 1DBOA 3B4NA 1XG2A 4PMHA 2O0VA 1RMGA 1KCDA 2O17A 2QY1A 4XN3A 3JURA 4YELA 4OJPA 3GQ8A 1PXZA 3UW0A 1O8KA 1QJVA 3FY3A 4AVZA 2BSPA 1O8DA 4C2LA 1KTWA 1BHEA 1OOCA 1EE6A 2UVFA 4U4BA 4XM3A 2NZMA 3SUCA 3ZPPA 1O8EA 2NT9A 4HWVA 1BN8A 5AMVA 1JRGA 4XKVA 3GQ7A 4YZ0A 4W8TA 4YZQA 3ZSCA 4XLFA 2O1DA 3KRGA 3GRHA 3B8YA 1NHCA 2NTPA 1IA5A 2IQ7A 4OJLA 4XLAA 1O8IA 4XNFA
chains in the Genus database with same CATH superfamily
1IV6A 4M6VA 2BVLA 1J2XA 2VC1A 3GBGA 3O3KA 3P9IA 2NTQA 2LDUA 3CUQA 3IWZA 2KVOA 3KEWA 1SFUA 3PFIA 1D1NA 3Q39A 4UY8I 1OB5A 4A2UA 2V6CA 1H88C 4MFEA 2CFXA 4IKFA 2VFQA 1LFPA 2E1BA 4WQMA 5M3MJ 3HG9A 5FB2A 2PJRA 4ZGQB 2AQEA 1WPCA 4PC6A 3K70D 1ETYA 4NC8A 3V7SA 2M9HA 1ZK8A 2D3NA 2NPFA 3CD6B 1OGIA 4MHGA 4B48A 3DEUA 3OL4A 1O57A 2OF7A 2M7BA 2VXDA 4L5EA 3TEDA 4A3JJ 1VTNC 2X1EA 4PC2A 1ZM9A 2ODLA 2EK5A 2P7VB 4JK1X 3FXJA 2A69F 3S3MA 2QQ9A 1R4NB 1Z9CA 4IHWA 4ACAA 2Q1ZB 3BJ6A 1WSVA 2OK7A 2RN7A 3ZMVA 2V7VA 2QYUA 2AQFA 5BQTA 2X53S 4ENMA 2ZXJA 2HXIA 3OYEA 5IT9K 4A0XA 5LHGA 2KDOA 2NS8A 4L5IA 1JT0A 1YQAA 3QYBA 4EM0B 3WTWC 4QV2A 4XN0A 5GV7A 2LLKA 1DUXC 2F43A 2DIEA 1POGA 1IO2A 3WBKA 2C77A 1I3AA 3QPHA 2EWNA 5F27A 3ZBUA 1YS6A 2IS1A 2Z99A 4X1EA 5KAIC 3PL8A 2DMQA 1Z3XA 2GQFA 3U9GA 3BZKA 2YUSA 2WBMA 1MBHA 2W24A 4Z03A 4I09A 3DKYA 1T5EA 4BDYA 2EFPA 4P9UA 1OKRA 2BN4A 4YEIA 1JXSA 1FIAA 3OOUA 3I59A 3NQOA 2E1CA 1TYUA 9ANTA 2WV1A 2OA4A 3DLAA 4MO7A 3ASQA 2CUZA 4RDLA 2Z1DA 3HM5A 3VSLA 3WTSC 4P25A 2P5KA 1K73D 3H9GA 2OCEA 3OP1A 4HV6A 1CF7A 3KYLA 4XKBA 1X1CA 2G9WA 1R5OA 4EMSA 1E0EA 2AHOA 2XGCA 1O3RA 1FT9A 3BCAA 1B2RA 2X1DA 3L9FA 1RMGA 1W0KA 5HVQC 3M3YJ 4LIVA 2XGJA 2KFDA 3DTIA 4Y17A 4M9XA 4MNUA 2GXBA 1Y1VJ 4XD7A 3MN2A 4RAZA 2X0KA 3IL2A 3UW0A 1EZGA 3SZPA 5F4OA 2BGCA 2QWWA 4A3KJ 4EM1A 4M6XA 2EBIA 2BOLA 2HVSA 3OJWA 1X4PA 1KTWA 4C2LA 2Q8KA 4TMVA 4I76A 3E0JB 2LNBA 3BDDA 3RPUD 2UVFA 3TDZC 3WHBA 5F04A 3JSPA 3CCQI 1IUYA 2VKEA 2PLYA 3GTGJ 2FJ1A 1TYWA 2GIVA 4F52A 1DP7P 2A3SA 1KK1A 4RGUA 2BM7A 4U87A 2DK5A 1ZM3A 3PQJA 2K02A 1B4AA 3H94A 4DJAA 2H1LA 2OBSA 3S3NA 3KRGA 2BV6A 4Y3OA 1E79A 4XNFA 3IH2A 5FKOA 3LNQA 2LFBA 1JGSA 3GQ9A 4DNRB 2ZXIA 2BEOA 1Q82D 4HNVA 2ZZFA 1Z0XA 3QU6A 1N05A 2VOOA 2MSYA 4KFCA 1NG7A 5THXA 2EZIA 1YIJI 1RPWA 2Q0OA 2DEUA 2VE8A 4WZTA 2P6SA 4GO1A 3VNVA 2X9DA 2DI3A 3VEPA 1RZ4A 3BPXA 2COBA 3K4KA 4KICA 2JRTA 2W25A 2GK6A 1RQPA 1JUPA 2R7DA 2CW7A 1K6YA 2XIGA 3T1BA 2E1OA 1H80A 4BBSJ 1G59A 3OJXA 2C78A 3SZTA 1QVFB 5DTDA 4OIRF 3IHUA 2M2EA 4LIUA 1RNLA 1FNBA 1RKTA 3ABTA 2HDNB 5CDFA 2BX6A 4CUGA 3OYGA 1X4OA 2R7XA 3HJEA 3WG7H 2EV0A 1D2EA 2C4TA 3CCQB 5E6TA 1QGYA 3K1PA 2R7WA 1MABA 3GFJA 1YOVB 3CUOA 2ETHA 3IUOA 4MTDA 4A93J 2XNCA 2R0QC 2ZSIB 2QLZA 4E4HA 3G1MA 3FWEA 4ETSA 2V1XA 4OAZA 4AVPA 1ZH5A 4Q5SF 4WZKA 3WNBA 1VHEA 4E7LA 4BQQA 1S3JA 1MW7A 5JFRA 4HE5A 2M30A 1O3SA 2XT2A 2O03A 3KETA 2RKHA 1LFBA 3HYIA 3OMYA 2IS2A 2W6IA 3CPWB 1GXPA 3EUKL 4U9UA 2BXZA 1TW2A 1XG1A 3QU3A 1QA6A 4XMYA 5DD8A 4YEJA 2D74A 3PVDA 4IEJA 3J81K 2VBYA 3ROUA 2DMTA 3BNWA 2BXYA 2CWEA 2BV3A 1YIJB 3C1DA 4HSRA 2XZOA 3CCUI 4B3GA 1BR2A 3DV8A 1TLHB 4M72A 2GWRA 3RY8A 5EG0A 3AGQA 2BE5F 5A89A 2L7KA 4Z4YA 4IL6C 1WJBA 2H6BA 1R49A 3FPPA 4G8XA 2OYNA 1QRBA 2CBXA 3PSFA 4XLNF 3J81k 4YELA 3TMOA 2LY2A 3CJQB 3I71A 3OYBA 3JQQA 3X2QH 1MDMB 3OPOA 1WH7A 3AG4H 1PXZA 3ONQA 4DNCA 1RESA 3HRTA 1N25A 2DPDA 2VNKA 2KRCA 2L9SA 1E1QA 1BJZA 1DDNA 4XRMA 5CVRA 4F92B 3O6BB 1UG2A 1VNDA 1FMVA 3KLOA 3OR2C 3S1RJ 3G73A 1ZG1A 5HZAA 2GOMA 2VOPA 1XMXA 4X7DA 3DU6A 2JQ7A 1DABA 4D5CA 3ZXSA 2L9VA 3ML3A 3JW4A 1YI2I 2CUFA 2MLGA 2JVGA 1U3EM 1LDKB 1WORA 5FO0A 4UVAA 2CU7A 3Q0WA 1N0UA 2JA7J 1Q7YD 3JRGA 2BM0A 4QVJA 5FGMA 3B02A 5BSXA 5TGTA 4BY1J 1T6XA 4D7NA 3NRVA 3I53A 2FU4A 1TYVA 4DYRA 3BH4A 2MD5A 5D6FA 4WZEA 2GBYA 4U49A 3FMRA 4D7MA 5DEQA 1Z21A 3LA2A 3TOAA 2PMUA 2K9SA 3F8CA 1FJLA 1GO2A 1XGNA 3CCRI 1IN6A 2O04A 1WWXA 1W87A 1LQ1A 3HPGA 1OYIA 2IGKA 3WTUC 2W4SA 3RTRA 3LJYA 4OJPA 1ZUNB 4TMTA 5EJCA 3MMYB 3FXRA 1B9NA 3EETA 1EH8A 3CCUB 3BZ6A 4BHPA 3H5NA 5HXBA 2HTSA 2WZPP 4WXCA 2XV4S 4A3EJ 3F8NA 4HDUA 1K79A 2GOXB 1SVLA 2V1UA 2PYHA 2XAJA 4LG3A 2WY7Q 2CC2A 4Z4TA 4AIDA 2PMZA 3PETA 1QHGA 4JX4A 1JTYA 1IJEA 2HDWA 1W5TA 4DIQA 3OYAA 2WA0A 5ERIA 3MZ8A 3ZIAA 4IRHA 2D45A 4NBQA 3CO7C 4XLHA 4OJ6A 4XQFA 3DEEA 4XLEA 2XGDA 1TP4A 2CMPA 1ZG3A 4RB3C 3FK7A 1RKWA 1FMWA 1E3OC 2CV1A 1MH3A 3K10A 2J5OA 1YI2B 4XBFA 1E2XA 1EV7A 3WTZA 1BMFA 5TV2A 3BJOA 1K28D 3KEQA 3H0DA 3E6MA 2FQ3A 1W0UA 2O0WA 1YS7A 3CCEI 4OWRB 3FISA 2JN6A 2V1DA 1N07A 3SLDA 2M34A 3H3VK 5H59A 4UUSA 3HHGA 2CQXA 1QVGB 4I7HA 3SQVA 1B8IB 1N08A 5B1BH 5A8AA 4LOCA 2FMLA 1VQPI 1UD5A 1IB0A 2LBFB 1X3WB 3A2KA 2XOKA 3CCRB 4UVBA 2V7TA 3IV5A 1D0YA 3TKYA 3DKXA 5E8IA 2WAEA 2ZL6A 2PE3A 4FQGA 1TTYA 2F4NA 2DQLA 3C2BA 4M3FA 2VONA 1FBSA 3F8FA 3P9CA 3H3UA 3AVUA 2NV4A 4U7BA 5AIQA 2P4WA 2OPTA 5EZHA 5F6FA 2KIFA 2C6YA 5E8GA 1Z91A 2JTVA 3E5XA 5K5QA 3GCMA 2CK3A 1EH7A 1BX1A 4RCYA 4BQOA 3NAUA 1OYYA 1UHMA 2VFMA 3DF8A 3L09A 2YU3A 2ID6A 4CCKA 4I0BA 3CLQA 2EINH 2ELHA 2KHMA 2TRTA 5F08A 1BM9A 2VBSA 3BY2A 3V7CA 1KQ5A 4YZQA 3CUQB 1JUSA 1KQ0A 3R60A 2FMYA 2Y2ZA 5ILSA 3S1MJ 4WXHA 4RBOA 2RV8A 4IRIA 2FQ4A 2QSFX 2F5FA 5L3CA 1B23P 4EVIA 1F1ZA 2IXSA 1QFZA 1DBGA 1XSVA 3CCEB 2ZJ2A 3FX3A 2PJRB 1R23A 2XTXA 3CMEI 1ZG5A 4YDTA 4XSXF 3CRZA 5CPRB 3ABUA 2Z8GA 3FXKA 1WDTA 4IX7A 1KA8A 2HQNA 4XSZF 3RJPA 3C3WA 3FXMA 4GDFA 5JI6A 3M8JA 1X0CA 2WYRA 3A35A 1R9TJ 4DNTB 1F5TA 2H27A 1P9QC 1IJWC 2BY2A 2DA2A 3OW7A 4BS9A 1VQPB 2AXLA 3HB9A 1AA7A 4HA8A 1YX2A 5TRDA 1FTZA 1U6GA 5LD2C 2D1HA 3JRDA 2IS6A 1VBLA 4Z05A 1FOYA 1XGSA 2OQGA 2MFZA 3PNVA 4CO8A 4ZJZA 3GTQJ 1MMSA 4V2GA 4YZAA 3ZQCA 5FLXZ 4ZCMA 1OGMX 4V02C 2DDAA 1I6HJ 1CZFA 1Z77A 4N3NA 2BW3A 4YIRX 2QZ8A 1BW5A 2KMUA 2MYSA 3S1NJ 2HVQA 3TO9A 2P5LC 1JUMA 2M8GX 1KZLA 2HYGD 5F1JA 4Z1MA 3ZMTA 1HKQA 4BAYA 5J1YA 1WU8A 2RNJA 5GPAA 2VBUA 1WJ5A 5HNFA 1ZRDA 1W7PD 4KNYA 1GLNA 4PGOA 3DFGA 3DPLC 1YO5C 4Z4RA 1AMOA 3G2BA 2XASA 2LKSA 2FF4A 2NVQJ 1ERDA 5B5EC 2ZTNA 3ZQGA 3C7JA 2Y31A 3EUAA 1MZBA 2KISA 1AIRA 5J4VA 5JHFA 1W36C 1V5VA 5FD5A 2LMDA 3TGNA 4XL9A 2PX9A 3BTJA 1XFOA 5DS0A 1BJAA 3FXUA 4ZTFA 3OL3A 4RM3A 1K7AA 4JMQA 1CF7B 3AGPA 1QZYA 3CMEB 2DA5A 4RPDA 1HXDA 1EA0A 1IRFA 2VKHA 4JP0A 4CSWA 5GP9A 2D9RA 4ZC3A 3QPLA 3ZC3A 1QFJA 1U2WA 2CF4A 2NVXJ 1LEAA 1EP2B 4QTRA 2K4BA 5LHIA 3NEUA 3ERMA 4PMHA 1L1IA 2TDXA 2HYFA 4DOZA 1E62A 1YIOA 5FIUA 3ZQHA 4M2LA 4NDLA 5D8KB 2V9VA 2RC6A 2IOUG 2ZCWA 5F1RA 4OOXA 1DP3A 3SYTA 4ACBA 3RZOJ 4UV9A 1T6ZA 4LBVA 5HNHA 3KP4A 3KX2A 4AVZA 3V76A 2F2EA 4M71A 3BG6A 1O8DA 1G8XA 1G2HA 1OPCA 4HX4A 4M53A 2WZNA 4M74A 4HNUA 3HGYA 2C2WA 2R7QA 1VI0A 1SFOJ 4H4KC 2I1LA 4JX5A 5FKMA 4AD9A 1SMYF 2NAZA 2VQHA 2A6TA 2MGQA 5CQEA 5TISC 2Z9OA 1A6IA 1Y1WJ 1G7CA 2MC4A 4RAYA 4TMZA 2Y30A 3HDDA 1IW7F 1QVUA 4LB5A 4RLZA 1G3YA 5K5RA 3WTVC 2IQ7A 4RD0A 5JLXA 1SKQA 4ZDOA 3BCFA 3DKWA 3CCMI 3WQZA 3EQOA 4I84A 2IW5A 2ZNYA 1OB0A 1WRJA 4A3LJ 4HX7A 4GRIA 3BTLA 5K7FA 5J8FA 3AG1H 5KCMA 5BNGA 2Q6IA 4EH1A 4IHXA 3IKTA 2OU2A 1X58A 5HS9A 3VR6A 1ELOA 3LSMA 3ZMSA 3L2RA 2CQQA 1NK3P 3FF5A 2GK7A 1R5GA 4CZZA 5GV8A 2J8KA 3E97A 1R1VA 3VSKA 2V79A 3P4GA 2Y0SA 4ON0A 2HOSA 2FX3A 1I1GA 3AFHA 2GPJA 2GREA 2B0RA 1VQNI 4KN7X 5DCMA 5HS7A 4Y52J 1TSPA 2FBIA 3CJTB 5D8LB 1TWAJ 3KP3A 4ENNA 3VMWA 3HOTA 1HW2A 2X6WA 3LFUA 1YW8A 3MKWB 3D0SA 1EKEA 2ZXHA 3GMEA 3I4MJ 1V0FA 1KGSA 5L3GA 2ZO4A 3B82A 3QAHA 2XTYA 2DETA 2IPQX 4PJNA 3W5UA 4W8QA 2E5NA 3GZNB 3VYRB 3E3VA 4YAWA 3L2UA 1Y6IA 5CVIA 1MJAA 3C18A 2ZMEC 2BYVE 5FJ8J 2L7FP 3ASRA 3ZPNA 2HPIA 4LBZA 4GYIA 2ISYA 5GAEJ 5BPDA 3IWFA 4JYKA 4JBAA 2ZJRF 1N78A 1UD8A 3JAMK 5EEAA 1B6AA 3TP0A 4Y15A 1FYMA 1EP1B 1DGRM 3FBIB 3QWLA 1JJ2B 3HOYJ 2K86A 1FBUA 2E2JJ 4Z2YA 4DQKA 2VN2A 1O88A 1EH6A 5BSYA 2VNIA 5K7HA 2BY1A 4CYDA 5FL7A 3HGGA 3U2QA 1FX0A 1OB2A 3R61A 2EQRA 4KMFA 1UELB 3H0GJ 1VQLI 2QVOA 3G3ZA 4PJJA 3HL2A 4L9JA 1HW1A 3CCMB 4CCNA 2CH0A 2BM6A 1SVOA 1ETOA 4RGSA 4BE2A 3L2VA 1A8PA 4DGWB 4XK4A 4LMYA 5TR9A 4PJMA 1KCCA 5EG0B 5LFAA 1E17A 1FEXA 2Y9ZA 4EQQA 1BX0A 1WGXA 2GJRA 5IYNA 1RR8C 2PLFA 3SEZA 3PUMA 2XF5A 1AWCA 3OS0A 3OOCA 1HC8A 4CGZA 3W2VA 3PSIA 1KCDA 4ZDLA 1VQNB 1KQ9A 1WCMJ 3OIQA 2HYJA 3TQNA 2DT6A 3ZN0A 2ZBUA 1QVTA 2E35A 4U0VA 4Z4WA 3N90A 2F4OB 4MLOA 3RYRA 4AIHA 2L0KA 5CVUA 4QVAA 3QP5A 2DPUA 1ZR4A 1OFCX 2XROA 2DT5A 2DLLA 4A69C 4S04A 2F5VA 4BQAA 2FOWA 4Z4UA 2ZB9A 1W2BB 4U4BA 4XIDA 2B7BA 4ROXA 1NDHA 5E79C 4C30A 3HSEA 3PUBA 1VJSA 4RDKA 2XPVA 2E7XA 3D5LA 3D26A 3OEHA 2WB1A 2W82A 5E1WA 1RETA 1S6LA 4LLLA 2BVNA 1QRYA 3A3GA 3MKLA 2W57A 1JNYA 2O1DA 1K61A 3JRAA 4P6YA 4HSTA 1N75A 3QE2A 3OS1A 1LVKA 1QHHD 3G6EI 4DQ2A 2HKOA 3L2CA 2MBFA 1BC8C 4P1VA 4QSHA 4BHBA 1AU7A 4M1KA 1VQLB 4BUPA 3M7GA 1QQIA 5AN9A 4RGXA 4AUXA 4KH3A 2NS0A 1V55H 2V7WA 5EZGA 4H0EA 1QGPA 1UMKA 2FA5A 4D5FA 4P96A 1J0RA 4DK0A 1ETWA 3GEZA 3LSRA 2DA4A 1JJ6C 3VWBA 1KC8D 4QLCU 1R58A 3OZUA 2DQRA 3BR3A 3E1YE 3BY1A 4BH9A 2ZFWA 1IXRC 2KJBA 5K1YA 3WTTC 2QA4I 4QPOA 4MIMA 5B66C 4KIBA 3ZBTA 5IOYA 2R7TA 4F7ZA 3I5UA 1K8FA 5EEGA 2ICWG 3GXOA 1H89C 2JSPA 2XF7A 2ZXWH 1J59A 1P4MA 3QP6A 1IDZA 1TT0A 2WTEA 1IXSB 2QEXI 3A1YA 1MJBA 2KJCA 4PSXA 3AVTA 3Q3AA 1XMAA 3K1MA 3E6CC 4RDJA 3FKIJ 1XS9A 1DQUA 1LNWA 1ZRFA 4X7FA 2V4JC 2DY1A 5JR3A 4P26A 3NAWA 3H9QA 3A1PA 2K9QA 3DDYA 1O7FA 2F5EA 1VQMI 2CFOA 1P92A 3JCUC 1Q86D 3GO5A 4UUSB 4G7HF 4A0ZA 2H8WA 3ABMH 3BWGA 2R7SA 1A31A 2C5HA 1UG0A 4LFUA 4C43A 2MD0A 2R7VA 2FBHA 2B5OA 3C2GA 4R8HA 4UHTA 4ZYHA 2ZZGA 2K3PA 2VB6A 2XSDC 1GDTA 3LNNA 2JA6J 3G6EB 4U0WA 2R3SA 1IDJA 2KQRA 3NE5B 1IB4A 2PG4A 3HKZN 5JHUA 1V5FA 2HLDA 5D4SA 4BGDA 1IDKA 5C4XJ 2OTJI 1A5JA 1UD6A 4KKSA 3BR0A 5J40A 2XZLA 1EJ9A 2AO9A 2JJ7A 3V7AA 4C2TA 2YX7A 4P3YA 1DBOA 2Y0SN 3QPTA 2V7QA 3O2PE 1M90D 1SANA 3MVPA 4RDUA 1W1WE 2K27A 5KVRA 4NCNA 3SZEA 4UV8A 2QA4B 3EYYA 4G12A 4IHSA 3GQ8A 3ZN1A 1R7JA 1OCZH 2NS7A 2QQBA 5IOZA 1X2MA 5HS8A 3HRUA 1UD2A 3M9AA 5EF6A 2DMPA 1XCVA 3W6KB 4NHJA 4G6IA 1HKSA 3BQYA 1UCRA 2CRGA 2QEXB 2K40A 3GZ6A 2GA1A 5J3LA 3BG5A 3PIPF 3PNTA 4DZJA 2JT1A 4XM3A 2Z33A 3SUCA 3HOZJ 1ORKA 2EB7A 1YX3A 3KP7A 1MNMC 4ESJA 4YAOA 3AG2H 4F91B 1XD7A 1XE1A 4W8TA 3LSGA 4B3XA 4C3JJ 1K83J 1VQMB 3K70C 5HKKA 1E3HA 3CF5F 1TNTA 2L3DA 5BMZA 3HOSA 3W2WA 2LKXA 3LYCA 2XHKA 5E3LA 4UZUA 4C3IJ 5C3EJ 2BY0A 4KMUX 3R4KA 4II3A 4QPQA 4E0FA 3AKZA 3J80K 1N0VC 1IAWA 5LGTA 1D1BA 4TV7A 4A6EA 1ZRCA 3MZYA 3U1KA 2E1NA 1WXRA 1PLUA 3BQJA 4RLQA 1FY7A 4E7IA 4AWXB 2K7LA 4YRVA 4RD3A 4LBYA 5FD6A 4A5MA 1NB0A 1R1UA 2P6TA 2OTJB 1P4AA 3T0YA 3DWLE 1BI2A 2LP0A 2JA5J 3SJZA 2DODA 1Y8QB 2VJ5A 2BW3B 3A03A 4KIGA 1O8LA 3RPUA 1S0UA 3RIRA 1H85A 4MQ9F 3QFSA 5JLWA 4DK1A 3OR1C 1ZREA 1JTAA 2INVA 2RGVA 1I1SA 2HNHA 3J7ZI 2OUMA 3IRRA 2PJPA 3K4LA 4IZZA 4F55A 4P1WA 2OBRA 1GAWA 1CNEA 2XGEA 1R36A 1MGTA 1GVDA 2L02A 4FE4A 1MNEA 2XKOA 2CV2A 1BR1A 3QYEA 3ZGKA 4ZZLA 4S0HB 1FRNA 4OZYA 2DFIA 1L0OC 4Z4ZA 3CDIA 2HXOA 3T5XA 1O8HA 1LPQA 5CVJA 3W5VA 2PYGA 2STWA 3CESA 1U2RA 3H1CA 2B63J 3I4NJ 2HMAA 2CW0F 1ITYA 3RKYA 1T95A 3G1LA 2X3HA 3ISXA 4FETA 3TDUC 4RJLA 4N0BA 3HUGA 4RB0A 1D1CA 3HRMA 4OPVA 4GQNA 2E2HJ 4P5OA 4ZYGA 3MMPA 5CQGA 3WU2C 2F1MA 4IO9F 2EIXA 3QOPA 1JA0A 4AU7A 2HOAA 1Z67A 1YRNA 4UUTA 3K4CA 2AHQA 5IYDJ 3WTYC 4R1HA 4MTEA 3JX8A 2EFNA 2VE9A 3I58A 2QYOA 4GYGA 1GR1A 3K4NA 4I01A 2FSWA 3H09A 3V8JA 5JMCB 1XG2A 1KQ8A 4CH7A 1XGMA 4A3GJ 1IGNA 2LH9A 1J9IA 1I5ZA 2LY1A 2W7NA 4J00A 2AS5F 3LOCA 4E7SA 5HLHA 2C4UA 4J01A 3S17J 1FLIA 3EDPA 2PIAA 4A5NA 1LKXA 3F3XA 4KKUA 2K9LA 4TMXA 2MLKA 1I50J 2KIMA 3JTHA 1S7EA 3VO2A 1J75A 4BACA 4YFOA 1ONVA 4TT3A 1FC3A 2H8RA 3CDLA 3O8GA 4EGYA 1PDNC 4UXNA 1VFCA 2QBYA 5L3FA 4KN4X 4WCGA 2DOEA 2WADA 2KP6A 3PA2A 3B6AA 3RI4A 3D5RC 1Y39A 4G1BA 4HWVA 3KE2A 4C2UA 4A3IJ 1BN8A 3V8KA 5J3OA 2VBVA 2LYCA 2DOAA 2HI3A 2X8KA 2VLAA 2F3LA 1XX5A 2E60A 3GRHA 4B44A 3Q9SA 1XTAA 3BY6A 2KL4A 4A0YA 3BC8A 3MCZA 4Z6YA 5J35A 1PVEA 4OINF 5LEKA 5FRNA 2HPMA 3S93A 2VKVA 1S8NA 2DU9A 1V3FA 2QENA 2Z6BD 5DCMB 4L9TA 1QPIA 3ECOA 4KT6A 1D0XA 2DFEA 2R7OA 1UJ8A 2E7WA 2BZTA 4NBSA 3HEFA 1RRJA 1MRZA 1WJDA 1TQPA 3ZMDA 1U8RA 2NT6A 3Q0UA 3R6JA 2V31A 2Q2EA 3HOVJ 4BXXJ 3VB2A 3WU0A 3L2WA 1MMAA 1IRZA 1OFLA 2NSPA 4LITA 2ELKA 2IJLA 1JHHA 3F8BA 2QQAA 3JQPA 3KL9A 4HBLA 5EYRA 3E5QA 3FJOA 5AIPA 1ZQ3P 3IP4B 2G7UA 3OEEA 2F5CA 3HHHA 3PSSA 1Y8RB 3OOPA 1WMRA 1ZAOA 2XGXA 3P9KA 4RD4A 1OYWA 4FTHA 1PJ5A 1WOPA 1PYVA 2G0EA 2HS5A 2HZTA 2IEKA 3IAM2 4LJZF 1J9ZA 3O8HA 3BT9A 3RZDJ 1OCOH 1W35A 2XAHA 2DA6A 4YC5A 1U9NA 2XB0X 4U88A 4KIFA 3WYAA 1U8BA 1R6RA 3OYFA 1JB9A 1E63A 2UXXA 1TT5B 1NK2P 3Q0VA 2HEOA 4QIWN 1WZ2A 3BQZA 4IHTA 3TO6A 2CG4A 4NUBA 2K5CA 1E1RA 1SFEA 5E20A 3E7LA 1RUOA 3I56B 2JWTA 3TW6A 2EIJH 3JRBA 2EILH 1SAUA 3EUHA 3S2DJ 2FVGA 5A2QZ 3I0TA 3NWSA 4HF2A 3A4CA 2HDDA 5HDGA 1BBYA 4M9ZA 3GIRA 3BR6A 1AKHA 2HWVA 4FCYA 2LSOA 2EIKH 3LSKA 3PENA 2LZJA 2NYXA 2M87A 5LGNA 3FM5A 4DYQA 2EH3A 2ZKZA 2QKLB 1TWGJ 2QN6A 3A3BA 2DA3A 5M5WJ 1ZGWA 4FXUA 2KPMA 3I9V2 4AC9A 3FDYA 1W4MA 2QY1A 4A3BJ 4RA2A 3W6JB 3JURA 1X1DA 1J5YA 1Y0NA 1ZLKA 3FPKA 5DN6A 3ZQIA 2DFHA 2HDCA 2M7AA 2VBXA 2QF7A 4YALA 4FWTA 2FEZA 3OYKA 3I1FA 5KW9A 2H09A 2QKMB 1HQCA 1QJVA 4CICA 3FY3A 4WWVA 2WAFA 5LBQA 5L46A 2QGUA 4YFKF 1CQXA 3WXMA 4E70A 3WNCA 5IYCJ 1TQIA 5EDNA 5C4JJ 5KHDA 3WGIA 4X06A 1G4DA 3N05A 3SJMA 1QFYA 3H35A 3LQ6A 3LSJA 3QRFF 1O8EA 1B72A 1F4KA 2ZL7A 1HW5A 2HU9A 1FOXA 1E3PA 3OYHA 2C5BA 1IUFA 2DYRH 5ICGA 1HKTA 1WFXA 3FM3A 2EFOA 3PUFA 1KK0A 3VMFA 1SFXA 4G7OF 4O6JA 4HLXA 1Z6TA 3EUHC 4WWCA 4V19K 3HAGA 3JU4A 3BG7A 1H42A 4PGGA 4UZEA 5IT9Z 2K3FA 2WY8Q 4K1XA 3WBJA 3I3LA 4RGRA 1G3TA 5IP7J 1ZM4A 1ZARA 4MQVA 2NSTA 3JTGA 2FNAA 4DBRA 4O5VA 4CCLA 3B90A 4TKOB 3F6VA 4Z4SA 4ZYAA 3T9GA 1UB9A 4LC0A 4HG2A 1OCPA 4C3HJ 2PI0A 3E20A 2LTPA 4B47A 3OYDA 2RQQA 5A88A 3LAPA 3AL0C 5F0FA 2VBWA 3JR9A 4NK8A 3FXQA 4JOMA 4OAYA 2ZTGA 5FA6A 3H9JA 4B43A 2DMNA 3T8TA 3PO2J 1USSA 3QOEA 5F0CA 1V4RA 3CP2A 2FBKA 1G7SA 1PE9A 3Q38A 2DT7B 1UAAA 4AF6A 3CC2I 3CTAA 2DTZA 2YUHA 1OISA 3PSZA 4M4SA 3P7NA 3QFRA 1FIPA 3H5RA 3SKBA 1A04A 4I99C 1YE9A 3SEQA 3U1DA 1FNMA 3RKQA 3Q6QA 3DU5A 4PJ0C 3GTOJ 1E3XA 3LSTA 4OOSA 2EV5A 4Y7CA 2X0LA 4XORA 2JZYA 4IOCF 2GZWA 3WHCA 2IGMA 1FP1D 2VJJA 2KIQA 3MEXA 1KMHA 3A8JA 1A6QA 1M1KD 2P3MA 1Z1DA 4YG2F 4Y33A 4UB8C 1T2KA 1FWZA 2XKPA 1YLOA 3ZQQA 2JJ2A 1KONA 3RDIA 4OIQF 1OFEA 5D5WB 2I5UA 3LO8A 2IGNA 3DTKA 4CA0A 4FHTA 1UD4A 4BQNA 3GVJA 3PNYA 1YW9A 3SYJA 1SFKA 3B4NA 1S29A 1ZHFA 2A6EF 5K7ZA 1W0TA 4YIFA 2J8IA 2IA2A 3CC4I 2OZ6A 1VQ5I 1QH0A 3ASNH 3PJRA 5KNLA 1W7PA 2BBYA 1X1AA 2DJIA 5JVGF 3P27A 4P2NA 1ZR2A 1IC8A 1BI3A 2QUFA 4FASD 2GJKA 4P3IA 1F20A 2P0WA 3OAAA 2O0YA 1JKQC 3AVXA 4X7CA 4E7JA 3WE3A 1XSDA 1VZ0A 4G6TB 1I39A 3S2WA 3GVLA 3OSFA 3SXYA 5ICCA 3ASPA 3VO1A 3VNUA 3TO7A 4RB1A 2VIXA 1T39A 3CC2B 1R22A 5AONA 2STTA 2GA2A 3KP5A 4DYCA 2LK2A 1GHCA 1RI7A 1WOSA 3GWZA 2IRFG 1JA1A 2NZMA 4MEYF 4OU0A 1VF9A 3BR2A 2NT9A 4QUZA 1WSRA 4NQWA 2OCCH 1Y0YA 1OCRH 1QNTA 1JRGA 4XKVA 4HQEA 1EP3B 3FMSA 1DGWY 4JRAC 3LSPA 1XB4A 5CLSA 3QSYA 2OJED 1BIBA 5LRRA 3RCOA 3OWTA 4GCVA 1EFCA 3L00A 5HLGA 1DG1G 4FN5A 4D9JA 3K4JA 2V9PA 1BI0A 2DJNA 2VBMA 1R5ID 1JJ8C 3ECHA 3COAC 2HR3A 2VPLA 2PMZN 1DPRA 1T56A 4B4CA 4PABA 1WPKA 4M6YA 3FXOA 2M4GA 1R5HA 2XPUA 1T38A 1HZEA 2F4MB 1ZLJA 1O8JA 3WY9A 4LB6B 2DCEA 2ZMEA 4RAGA 1WJCA 2QGGA 2CSOA 4WZLA 4IOAF 2YX4A 3SY2A 1FRQA 3VSVA 3HTSB 2X48A 1X3UA 2V9KA 2RNGA 4G6DA 1D5VA 1IN8A 1J09A 2CUJA 2JUGA 2LREA 1X19A 3CC4B 1VQ5B 2FD5A 1NBMA 2W1OA 3VODA 4IVNA 4UUVA 2JN9A 2P81A 4L0ZB 3GVKA 5DM6F 4KDPA 5FO5A 2K85A 4XICA 2IAIA 3BG9A 5BS6A 2LF8A 1P4XA 3KYDB 1WJAA 3V4GA 3LL7A 4DZPA 1QRCA 5GAHJ 1BPLA 2XTWA 1WHUA 2QM3A 3K9TA 3U6BA 3I64A 2XAUA 1WQ2A 2GQQA 3JRIA 4EJUA 1VQKI 1KU2A 4XONA 1U9OA 4ZDPA 3OKXA 2L7ZA 3B6CA 3HUGB 3M07A 1JGGA 1QG0A 1QUEA 1KU7A 1W0JA 2XZPA 5IK2A 5IYQA 3U21A 1IJFA 2DK8A 2ZBVA 2ECCA 2JRMA 2XSJC 4RS8A 1LFUP 2HGCA 4RCZA 1YRNB 4EJOA 2EZKA 1FSEA 3ABLH 4R79A 4BJ6C 2XVCA 1FZPB 1LLWA 2BPOA 4XOPA 3S15J 1OMIA 2VPRA 5HDKA 4BNCA 2XUBA 2R7RA 2HOTA 1YW7A 1K6OA 2OAZA 1FOWA 1Z6RA 2VJIA 2VYQA 3CJNA 2YS9A 2E71A 1MKMA 2DBBA 1ETXA 2IP2A 5L3DA 3BTCA 1QX4A 3DQVC 3IKVA 1NRKA 1HDPA 4K2EA 4CCJA 3SFIA 1OFMA 4MXNA 2F4IA 2Q6LA 1KD1D 1D8TA 4PC7A 1PUFA 1Z05A 3M8EA 3S32A 2R5ZA 3FKJA 4ZH4F 3TW7A 4EATA 4IJAA 1XN7A 1ZGAA 2KT0A 3GUDA 4YFXF 4KISA 4RD6A 4G6QA 2DOGA 5FFZA 3N6ZA 2XB5A 2BHZA 2M45A 3KZYA 1JE8A 4UNOA 1OCCH 3LA7A 4RLFA 1Y56A 2NVYJ 2QBYB 2R7ZJ 1G7TA 1Y0RA 2ZZEA 1W5CC 1W5SA 4XRSA 1T6SA 2DCUA 4B4DA 1ACIA 1O4XA 3PA1A 5GPCA 1BHEA 4ZYDA 2M5WA 2CNDA 4FT8A 3CB4A 1QU3A 4KJZA 1OJLA 3SFZA 2BMWA 1VQKB 2FX0A 2YU9J 4B09A 1R5BA 1XDSA 1BA5A 1S72I 4LG0B 2VFPA 2O8KA 3JRFA 1L3LA 1S4MA 2R93J 2IS4A 2L4MA 3GVAA 2ZL5A 4CQJA 2EA2A 3TL4X 1QA1A 1EFUA 2Y75A 4MYTA 3IRQA 3SDBA 4J0QA 2OV7A 1GT0C 1KK2A 4M3GA 4RMNA 1VQ8I 4CDGA 2VQCA 3FK6A 2WAQA 4DW6A 1COWA 3W2FA 2DERA 5DUIA 2KDZA 1FOKA 4HRIA 4EJWA 3S16J 4N9IA 4X0GA 2L5QA 3T56B 4Y7NJ 3K0LA 4HNTA 3MCAA 3GFMA 1LB2A 3KZZA 2Z3YA 1NJID 2VC0A 3OIPA 4M3DA 2Y69H 2INUA 4FK8A 2Q2EB 1XB2A 1I27A 4X0CA 2WSSA 2BF4A 2PFBA 1UFMA 3ELKA 1D1AA 5DCFA 3BPVA 5D5UB 4Y13A 5DV5A 3TH0A 5KSWB 1BI1A 4XKWA 2OK8A 1DU6A 5HZBA 2BGIA 2EJRA 3K69A 3VDXA 1WSUA 4G9YA 1VQOI 1RIOH 1CGPA 5JVTA 1AHDP 4CHUA 2A68F 1BLIA 3RSNA 2CYYA 1HVXA 1OGJA 3W2GA 2B7EA 3CP8A 4HDVA 1SVMA 1BQEA 3QFCA 5E3OA 3AVVA 2ID3A 3FHZA 1JKRC 4NK6A 4XOTA 2VT3A 2PN6A 3OYMA 3DBRB 3L7WA 2E34A 1V5EA 4BEHA 2QTLA 2EWEA 2QXZA 2D1VA 2EV6A 4A12A 2HVRA 4OIPF 5H6RA 5FLMJ 5ILVA 1VQ6I 4MYUA 3FHNA 3A8IA 2RDPA 3UNGC 3S14J 1DPUA 1K4ZA 2QMUA 2BGJA 5E18F 3BH6B 1KU3A 5C1EA 2F5DA 1S72B 1QZZA 5FRMA 3ZZUA 2WR8A 5DYMA 1JKOC 2O61A 4P6VF 5FNZA 2K4JA 3HIFA 3K4MA 1M1EB 2BM5A 4FE7A 4W97A 1FPQA 2MA3A 1AKHB 3UKGA 1K78A 4XLCA 1Q9SA 3L2QA 4P12A 2ME6A 1VQ8B 1YFHA 2MH9A 3B8HA 3R6KA 5E1XA 3JSOA 3HC7A 2X6XA 4TSFA 4X05A 2DFFA 3OYCA 3ZQLA 5CKTA 2NVTJ 4YXWA 3WGGA 4AIJA 3HSFA 1HOMA 1SC7A 4HPQA 3M4OJ 4XKCA 5LGUA 2ZJQF 1EF4A 3ZZTA 2DOFA 1REPC 4WXDA 1K9MD 1SD6A 2CS3A 3F72A 1Q81D 2IVMA 2GXAA 1PP8F 2O17A 3I4PA 4XN3A 5H6QA 4G7WA 4EEFG 2JVHA 3J7YJ 2DO7A 3CCJI 2CJJA 3HBLA 4HQMA 4HW0A 2H1KA 3EYIA 1VQOB 3AVWA 3OZWA 3ZZ0A 3S1QJ 2ADUA 3ONYA 1I18A 1UHSA 5IPAA 3ABKH 4ITVA 2NVUB 3OYLA 1ZM2A 1B72B 2BSPA 2CUEA 1OR7C 3ML6A 1RR7A 3ZUGA 3F21A 4LGWA 5FKKA 1SD5A 5HLTA 5D4RA 4Q48A 1QQ1A 3BTIA 4HAMA 4II2A 2G7HA 3A01A 2WJVA 3GTMJ 3CQZJ 1VQ6B 3CCVI 2AXTC 3ONUA 3RYPA 3GLXA 1MBJA 3H3ZA 2W48A 1UHWA 1NHCA 4A3MJ 2UV1A 1P2FA 4XLAA 3SJPA 4G94A 3V7RA 3VPRA 5LEJA 2O8XA 3VSTA 1ETQA 3KZIC 3GQAA 1XGOA 3BG3A 1VLOA 2L9RA 4YIIA 3SLNA 5FLVA 2Z2SB 2QCOA 4BXUA 1U5TC 3CJRB 3KEYA 1HDDC 2W6JA 1C0WA 2M0CA 4OPSA 2VBKA 1RU4A 6PAXA 2D2WA 3FIWA 4BYYA 2EFQA 3E6DA 3M8FA 1YG2A 3Q5FA 3CO6C 3P5JA 1QO0D 1O3TA 2O6GE 1AIPA 1YHQI 4AF7A 1CLWA 3AK5A 2WWYA 1HSTA 4OPOA 1MD0A 3MWMA 2R9VA 3BR5A 1KK3A 4XRSG 3BP8A 5FFXA 3CMYA 2HQAA 3CUQC 2ZNZA 2ZJPF 4N4NB 4N9HA 4CYCA 2LD5A 1GV5A 3CCJB 3LSHA 2DMUA 5H20A 1R5NA 4PGHA 3KCCA 4NB5A 3RKXA 1GJRA 1CNFA 2CQKA 4M3BA 1KZHA 2VQLA 4BDZA 2QSHX 4YAUA 3GFLA 3OY9A 2VKDA 1XQBA 4B3AA 1VQ7I 1T33A 2H6CA 4BE1A 2VNHA 2JMWA 2HCJB 1TC3C 4V2FA 3LFKA 1B59A 2JK3A 2A5YB 2WV0A 5J4YA 2D5VA 1TBXA 1KU9A 2ZSHB 3GSIA 3S2HJ 4I2OA 1RWRA 3GTLJ 1USTA 1ZN2A 3CCVB 1XC5A 3S8PA 1IXCA 1WKMA 1E64A 1IRXA 2O6WA 2BM1A 5CJ9A 4Y4RA 4BHCA 3OYIA 1NG6A 2Q6KA 2J5PA 4EW9A 2ME0A 1UD3A 5FLXK 2WAQN 2Z5UA 4YZXA 2F1LA 4BJTA 5EGOA 1VF7A 4URRA 2ZFUA 1GVHA 2KRHA 4QWQA 3GX4X 1WTHD 3CXCB 2ESHA 3MKZA 4J19A 1W7PB 3FXLA 3VOEA 3WE2A 1G6NA 4I0AA 1R4MB 2OBPA 2LKPA 4C0SA 2IA1A 4ASNA 3BROA 3TOBA 2O0VA 1LE8A 2RREA 2WB1N 5HODA 4TMWA 1OQYA 1YHQB 3H9NA 4YCQA 3R6SA 4OOIA 2VBTA 1I8DA 1MJ9A 1QGZA 2XAGA 3DXJF 3F6OA 3DBLB 1R1TA 2PQ8A 1LEBA 4YFNF 1X1PA 1H0MA 1IRGA 1P6RA 2LVSA 2L9NA 3HOXJ 4NQWB 4I6ZA 2BM4A 4DQLA 2V7FA 4AIKA 2O7OA 1TZLA 2GXGA 2X51A 1VQ7B 1EA3A 2XC1A 4GGGA 1S5LC 4JX6A 1TYXA 3OV8A 3PUNA 1A35A 4HEA2 2VL8A 1V54H 2H94A 1BC7C 3J7AY 2JPCA 1NB9A 3GTJJ 3NARA 3ZMZA 2QE7A 3WODF 4BKXA 2VFOA 2I8DA 2CQ7A 3F23A 4OJLA 1E3ZA 5M5XJ 2JJ1A 1W9XA 1O8IA 1H9GA 1ZELA 1IZ1A 3KP2A 3Q6RA 3W2EA 2ZMEB 5F4MA 2LF7A 2COMA 1QBJA 1K4TA 2OTLI 4O3MA 3BCDA 1F43A 1ON1A 3VSUA 1N77A 3SEJA 3T53B 1K4SA 3JAMZ 1BL0A 1EFRA 4QHYA 1LM1A 3V8LA 5DNSA 4AYBA 2PEXA 3LQRA 5FKNA 1A36A 2V5IA 2V1NA 5LLQA 5J6XA 1YJ9I 2JIZA 2K9NA 1EFTA 3WGHA 1U78A 1P7JA 1O8FA 1FX7A 3WTXC 3ERED 3ZP5A 1IN4A 3UR3C 3CPXA 5DS9A 1VLYA 3CC7I 1S9HA 2RAEA 3G05A 2XNDA 4F7DA 4LG0A 3R0JA 1VQ4I 1PUEE 4B8XA 3GF2A 3DPUA 3H36A 3T51B 1VQ9I 1TTTA 2YR2A 2CGPA 1QCXA 3ASSA 2XNJA 2X6YA 4KUMA 4OOVA 1PJ7A 3GTKJ 4ESFA 2E19A 2IBDA 4U0YA 1H8HA 1JTXA 1O8MA 5C1CA 3DBHB 2IA0A 1O3QA 5M5YJ 1VHOA 1KYWA 1RC9A 1MIJA 2R6HA 1HG8A 1GXQA 4X6AJ 4OJOA 5LRSA 3HTUA 4LLGF 2KKOA 4H9GA 4YHBA 3NB2A 5H2FC 1Z7UA 3IAS2 1SMTA 4IRGA 5F64A 2CW8A 2W00A 2YWFA 2YSRA 4PJLA 4HYEA 4RB2C 1PUFB 1HSJA 2KZVA 3D5SC 2E1MC 2R5ZB 1TW3A 4HE6A 4L9NA 4X07A 4CCMA 1DU0A 3BC9A 2OTLB 4AM3A 1ZKGA 1T98A 3L1PA 2QZAA 4G1VA 5HLIA 4KT5C 3W3CA 1D8JA 4X8IA 2DW4A 4RPBA 1MBGA 3DU1X 2NNNA 2DTRA 3P26A 1G7RA 2MW8A 1WI3A 1R00A 2M0MA 4PDKA 4NC7A 1MMDA 4CXFA 1YITI 1YJ9B 3CF2A 3Q9VA 4L9VA 4A6DA 1R71A 2IT0A 1TNSA 4HV5A 4M73A 5J8CA 3JRCA 3KLNA 1SD4A 2NRAC 4ZZDA 1F36A 2VODA 2DYIA 2EFGA 5ICEA 5FO1A 3CC7B 3G1OA 3LWFA 3BH7B 3RIQA 3ASTA 1VQ4B 1FYLA 4Q4ZF 1CQTA 4F3QA 1YTYA 1MBFA 2X1CA 2W7ZA 1BR4A 4DBQA 1EE6A 5B3SH 1VQ9B 1LLZA 5LMZA 3LAJA 3CCLI 3ZPPA 3K1NA 3ESWB 1ZTRA 3OYJA 2ZITA 3MD2A 1T8IA 4PFPA 1OHHA 4U7DA 3KPHA 1S7OA 3REOA 3B78A 5F4JA 4ZCIA 1TWHJ 2HOEA 1HF2A 4BL0B 3PIOF 4ASUA 1IA5A 2CO5A 3GYHX 4L0YB 4ABZA 3B73A 2R7UA 1MSEC 1WI9A 1Z7LA 3PFYA 2UVEA 3EQNA 4RM2A 1WP6A 1H8AC 4UVCA 4WX9A 1PJ6A 3MQ0A 4MR0A 2X4HA 2LG4A 2E36A 5M3FJ 4G7ZF 2BVMA 3BOQA 1U0JA 3NWTA 5D6EA 3FZVA 2KRFA 1TWCJ 3FBNB 3TBIA 3U2RA 5CYVA 5GTHC 3LSIA 4P22A 1GQ8A 3BCBA 3CMMA 4R71A 1FP2A 2ZBKA 5JBQA 1P4WA 2GIZA 3M1CA 2XC7A 4FX4A 2UZKA 4UZFA 1IN7A 3MFKA 4CCOA 2CRVA 4PC1A 2ESNA 5H5JA 1T08B 4BEHB 1ENHA 2ISZA 1YITB 4Z06A 1YJNI 1T6YA 1W34A 2B0LA 4UAJA 4OMYA 4A3DJ 4GFBA 1ODDA 2P8TA 2R5YB 2GAUA 2HQ5A 2W84A 2VUMJ 5L3BA 2FXAA 2FRHA 2L4AA 4Q47A 2ECBA 1KJZA 3MAJA 4HIZA 2XRLA 4OIOF 3KFWX 4M0LA 3CCLB 2NNYA 3JQRA 2HQRA 2JA8J 3W5HA 3VFZA 4D0PA 1K78B 5FKLA 3K6GA 3CW2A 1IHMA 3VMVA 2PMDA 3AG3H 3N4MA 2FE3A 5JLVC 2X6OA 5DM7F 3PQKA 4E7HA 2UXNA 1U5TB 2DN0A 3LMWA 3DEWA 4S05A 5J1UA 1H8EA 1UMQA 4IF4A 3CCSI 1HLVA 2HFHA 1G3WA 2XAQA 3ZR8X 3G4SI 1KRHA 3K4BA 3W2IA 1SAXA 2I10A 4ZYEA 2VBEA 1Z3YA 1ZGJA 1MBKA 3CDHA 1LVAA 2EPFA 3GW2A 4I02A 1PJRA 1Q1VA 1SM4A 4C9YA 1ON2A 2Y9YA 4W1UA 3QYFA 1DDIA 1STZA 4AYBN 1W36D 5F0HA 1YYVA 3MZHA 2L54A 1BOBA 1NH3A 1APLC 4BE0A 1FNNA 5GAGJ 3G71I 3HSRA 4MEXF 1IF1A 1SKYB 2QQ8A 3F9KA 4EM2A 4I98B 4IHYA 1BOAA 2W85A 2R4GA 3J80Z 4KYWA 5TJJA 3A01B 1YJNB 3WG9A 3ZMUA 3LVBA 1LJ9A 2G0YA 2XRNA 1QA2A 4PC3A 1ZYRF 4IW3B 3WNDA 3PM1A 3A0HC 2O9LA 2UUZA 3ZOBA 2O5RA 5IYPA 2OQRA 1J7KA 1N8RD 4BPRA 1YX5A 5E3NA 2P5VA 1SEUA 2GJPA 3AAFA 4PZJA 4MGRA 4ANJA 4IQ4A 1GUUA 3GQ7A 2Z16A 4BBRJ 4D1QA 2DA7A 4BXFA 3ZSCA 4XLFA 1YLFA 4E6KG 3S3OA 4OPWA 2KLOA 2UWMA 2NOJB 1MMNA 3CMAI 2NTPA 2Q6OA 5IYWA 3CZ6A 5C44J 2M4KA 3OFNA 1IV8A 4PFOA 2J7KA 1K5CA 1XPXA 3DLLF 3J7AO 1B9MA 3K2AA 3VYUB 2E5ZA 2OZUA 1FBQA 2FUG2 4ZCLA 3CCSB 2V4DA 3G4SB 1XCBA 2JUCA 3Q3SA 3RPQA 4ZTJA 5IP9J 3SZGA 1XDUA 3OZVA 2JSCA 4RM0A 5LHHA 1TLLA 3OSGA 1BJKA 2B7CA 4CYCB 5L3EA 3I59B 3AVYA 5J1RA 3JRHA 3OW2B 1YJWI 4QFMA 5DDGA 5DSZA 1MSFC 5E1ZB 4RD2A 5BPIA 1FYKA 5TY0A 5IYRA 2NTBA 3HOWJ 3A0BC 1IDYA 1JT6A 2YWGA 3G71B 2K9MA 1D0ZA 5J47A 5CVVA 1NHAA 3ZQFA 5ICFA 5HOOA 2FNPA 3F22A 3SHFA 4Y9RA 3SQNA 1V5GA 4Z4VA 4CZCA 2N8GA 1QUFA 3LMMA 2EFWA 5ILUA 3HPHA 4HZFA 1TWFJ 3CCYA 2ACJA 1GAQA 2A05A 4RD1A 3VYTB 5B6IA 2DDBA 2VI6A 1V0EA 3BZCA 2L7MP 3I54A 2WC2A 3N97A 4L18B 2E1RA 5EGOB 3U6KA 3PO3J 3ZCOA 1Y0UA 2L2OA 2QDXA 3CMAB 4NNJA 3SDGA 4W8RA 1D3YA 2EIMH 3KEOA 2QX3A 4LD5A 4HLYA 1BW6A 2F6CA 2OC6A 1G3SA 2XDVA 3BJAA 4A3FJ 2CQNA 1LE8B 1JI8A 3J81Z 2D3LA 4EJVA 1FNDA 2LC2A 4HX8A 4L8JA 3WWGA 5IY5H 3K7AJ 2MABA 4RAFA 2TCTA 3KYCB 5ED4A 3DPTA 3JREA 1GVJA 2YPRA 2LR8A 4LBWA 2EA4A 1DARA 1P7IA 4WK8F 2MC3A 3A8KA 5BOXA 4N4OB 1OFDA 4UB6C 1WJFA 5DD4A 2PBIA 1YJWB 3DTEA 4OP7A 5D5XB 4PCQA 3E1SA 2F48A 1O8KA 1I7PA 4NC6A 2VZLA 1SD7A 3HKZA 3M1EA 3H92A 4BJ5C 1UZCA 2VJ4A 2BHYA 3BR1A 4PSWA 1HA3A 4N3GA 1MDMA 2VXZA 2Y0MA 1OOCA 3DCFA 1MMGA 2M1BA 2XEXA 4G7XA 1LDJA 2RC5A 4KKTA 3MHPA 4M9SA 2JA2A 4LLNA 2DA1A 2KIUA 3FMQA 1F9NA 1I6XA 1LUJB 2VASA 2BSAA 3ASOH 2RC4A 4E7KA 3WU1B 4AC0A 1HF0A 4PK4A 4BU2A 3ISPA 1ULYA 4XLPF 5E17F 4B3FX 3W2AA 2R92J 3KIOA 2LOOA 3BLYA 5FROA 4MFDA 1X3ZB 3B8YA 2V7UA 2XT4A 4X7EA 2HTJA 2R7FA 1QA3A 2CV0A 2E1MB 2A07F 3OIOA 4EGZA 4A3CJ 4Q7JB 3HXLA 3QQAA 3LQQA 1D8KA 4P55A 2YWHA 2P7CB 1KQSB 4ENKA 1IN5A 3HRSA 3ZRGA 2KZGA 5IP6A 3VYSB 1KTVA 1TVCA 2DAOA 2M8EA 1K8AD 1HBXG 3RQ4A 1XMKA 2EZLA 4C2MJ 1O7LA 2B9SA 3ES9A 2DYSH 2O3FA 2DXIA 3QPSA 4OMZA 3RKWA 4KA4A 3IH4A 5IT3A 4EJTA 3FKSA 2BY3A 1EXMA 3TP3A 1X2NA 3ULQB 2OBTA 4W8SA 4BY7J 1BN5A 2XF6A 2M3AA 3IH3A 4ENJA 5KAFC 3DP7A 4G5GA 1OGOX 2PECA 3GQBA 2A6HF 2OD5A 4OZZA 4IPAA 1WVRA 3HZJA 5EEHA 2WJYA 1FSHA 3LA3A 3C2HA 2HKXA 2NOGA 2QTZA 3F8MA 1WOOA 4XR6A 1ETVA 2V26A 1JHFA 1BIAA 2MH2A 3R0AA 5GADJ 3E5UA 3I56I 1FNCA 4YAFA 2ELJA 4KITB 2X3UA 2NXNB 4OJ5A 3MKYB 2CW5A 5IYBJ 2WPDA 1QZEA 1KYZA 3E6BA 4IQJA 2LY9A 3T8RA 1IG7A 3RQIA 4IHVA 5KK1A 1ETKA 1QGAA 3I55I 2V6EA 3LQEA 4F93B 2XPWA 2EZHA 2PMHA 2JPBA 4GXOA 2VFNA 1T0FA 1OLTA 1TUIA 5HDNA 3ZPLA 1FTTA 3GLLA 1PKVA 4Y9UA 2E2IJ 2YWEA 4P9FA 3GTPJ 3OS2A 2JDIA 1O8GA 1JKPC 4PAAA 2V7XA 3QFTA 4EV0A 3OE7A 3A02A 1DDGA 1NTCA 3W6VA 2RQPA 1E43A 1OR7A 1N06A 2GM4A 4ZGNB 1MH4A 1QPMA 2X85A 2VQGA 4WF2A 1H9TA 3CD6I 5K5OA 2R5YA 1B8IA 4TN1A 4P9SA 4B1RA 1MNDA 5GTIC 4HF1A 2ZZQA 2LBFA 1I3QJ 3EQLF 3EPZA 1X1BA 4E7ZA 1AOYA 1F60A 1HCRA 3IC7A 4HOBA 4PUSA 2Y48A 1WJEA 4OM9A 5E3MA 2VBZA 2GLOA 1S7AA 2FOKA 4FISA 1XSXA 4LK1F 1RUNA 2XAFA 2HZDA 2M5SA 2ZC2A 3W2HA 1OCTC 1B1BA 5B1AH 4FX0A 3H5AA 5A2QK 3OYNA 1LDDA 3GFIA 2VNJA 4L5JA 2VT2A 1EWYA 1D5YA 5EMNA 1U5TA 1FDRA 2A5WA 3V42A 1MBEA 2LRDA 1RQRA 4ZV4A 3HOUJ 4HF0A 3CLOA 2MG4A 1PP7U 3AL0B 4ESBA 1TL8A 1WH5A 3KP6A 4LK0F 5DUKA 3ZQ7A 2IGOA 1Q1HA 2A61A 2RVCA 3GZ5A 4XRFA 3D1NI 5AMVA 4YZ0A 1GV2A 4IXAA 2QSGX 5D5VB 4M3EA 3F0CA 3K2ZA 1TQMA 1T0FC 3QODA 4JQFA 2L01A 3I55B 1HA8A
chains in the Genus database with same CATH topology
3WQZA 3EQOA 4I84A 1ZELA 2BVLA 3EUHC 3GBGA 1OB0A 2NTQA 3KEWA 4GRIA 3HAGA 3JU4A 3BG7A 5KCMA 2WY8Q 3VR6A 3I3LA 3BCDA 3LSMA 4IKFA 1LFPA 3L2RA 2E1BA 2NSTA 3VSUA 2PJRA 3HG9A 4DBRA 1N77A 2GK7A 4CCLA 2AQEA 4TKOB 1WPCA 3T53B 1EFRA 3B90A 3VSKA 3K70D 4ZYAA 2Y0SA 4AYBA 3T9GA 3AFHA 4NC8A 4HG2A 2V1NA 2D3NA 4B47A 3OYDA 2RQQA 2JIZA 4B48A 3AL0C 3VMWA 3OL4A 1O8FA 4NK8A 3HOTA 4JOMA 3UR3C 2M7BA 2VXDA 2X6WA 4OAYA 2ZTGA 3LFUA 2X1EA 2ODLA 3H9JA 4B43A 3MKWB 1VLYA 2ZXHA 1S9HA 3G05A 1V0FA 2XNDA 3S3MA 3QOEA 4W8QA 4PJNA 2Q1ZB 3CP2A 3DPUA 2E5NA 1PE9A 2AQFA 2DT7B 3VYRB 1UAAA 2X53S 3L2UA 1Y6IA 3T51B 3OYEA 2KDOA 3ZPNA 1QCXA 3QYBA 2HPIA 4XN0A 2X6YA 2F43A 2DIEA 3H5RA 1N78A 1UD8A 3SEQA 1YE9A 1DGRM 3FBIB 1H8HA 1O8MA 2IS1A 5C1CA 3DU5A 1E3XA 1O88A 3PL8A 4XORA 1Z3XA 5FL7A 1HG8A 1FX0A 2IGMA 2VJJA 2WBMA 4OJOA 1KMHA 4Z03A 1UELB 3DKYA 3IAS2 1T5EA 4BDYA 4PJJA 2CW8A 2W00A 4Y33A 3HL2A 4PJLA 3OOUA 2CH0A 4CCNA 3ZQQA 2JJ2A 1KONA 2KZVA 4BE2A 3DLAA 3D5SC 3L2VA 2CUZA 2E1MC 4DGWB 2Z1DA 4PJMA 1KCCA 3VSLA 4CCMA 2IGNA 5LFAA 3BC9A 3DTKA 4CA0A 3H9GA 1UD4A 4BQNA 3GVJA 3PNYA 3KYLA 2GJRA 4XKBA 1X1CA 1SFKA 3SEZA 3B4NA 3W3CA 1E0EA 2XF5A 3OS0A 3OOCA 3BCAA 2X1DA 1RMGA 3W2VA 3PSIA 1W0KA 2M0MA 4ZDLA 3PJRA 4NC7A 5HVQC 5KNLA 1KCDA 1MMDA 1X1AA 2DJIA 3OIQA 4LIVA 2XGJA 2DT6A 3CF2A 3DTIA 4FASD 2GJKA 4OJPA 2P0WA 3OAAA 4XD7A 4MLOA 3UW0A 4E7JA 1VZ0A 4G6TB 4F3QA 2BOLA 2HVSA 3GVLA 1X4PA 1KTWA 2X1CA 4C2LA 1BR4A 2VIXA 3E0JB 2F5VA 4DBQA 3RPUD 1EE6A 2UVFA 4U4BA 2NZMA 3ZPPA 4C30A 3PUBA 1VJSA 2NT9A 3OYJA 3D5LA 3MD2A 3OEHA 2WB1A 4F52A 2W82A 1JRGA 4PFPA 4XKVA 1OHHA 1DGWY 3A3GA 4U87A 2O1DA 4HSTA 1N75A 4BL0B 3H94A 4ASUA 3RCOA 3OWTA 4DJAA 3OS1A 3S3NA 3KRGA 1IA5A 4Y3OA 2R7UA 1E79A 1Z7LA 4XNFA 1LVKA 1QHHD 4D9JA 3K4JA 3PFYA 3GQ9A 2UVEA 4DNRB 2ZXIA 4RM2A 2VBMA 1WP6A 3EQNA 2VPLA 4BUPA 2ZZFA 4MR0A 2LG4A 2M4GA 1NG7A 2BVMA 1U0JA 3NWTA 1HZEA 1O8JA 3FBNB 3TBIA 2DCEA 3BCFA 1WJCA 4DK0A 3LSIA 4P22A 1GQ8A 3BCBA 3CMMA 3K4KA 3VWBA 3VSVA 3M1CA 2XC7A 2V9KA 2RNGA 1J09A 2CUJA 2JUGA 2LREA 1X19A 2GK6A 4CCOA 4QPOA 1NBMA 2CW7A 2W1OA 1K6YA 2R7TA 3GVKA 4BEHB 1H80A 4Z06A 2JSPA 1G59A 2XF7A 1WJAA 3LL7A 1TT0A 3A1YA 4PSXA 1BPLA 4LIUA 2XAUA 1DQUA 2V4JC 4XONA 5CDFA 4ZDPA 3H9QA 4CUGA 3OYGA 3HUGB 1X4OA 2R7XA 1W0JA 2XZPA 3DDYA 4HIZA 5IK2A 3U21A 2R7WA 1MABA 2CFOA 3IUOA 2XSJC 2ZSIB 3K6GA 4E4HA 3VMVA 4OAZA 2R7SA 4R79A 4E7LA 1UG0A 4BJ6C 1MW7A 2MD0A 4BQQA 4E7HA 2R7VA 4XOPA 3C2GA 2ZZGA 2K3PA 2VB6A 3OMYA 2IS2A 2R7RA 3LNNA 2W6IA 3LMWA 3EUKL 1IDJA 2VJIA 1H8EA 2KQRA 3NE5B 1IB4A 1V5FA 2HLDA 3ZR8X 3K4BA 4BGDA 1IDKA 3DQVC 4XMYA 1Z3YA 4YEJA 1UD6A 1NRKA 4KKSA 2XZLA 2VBEA 4CCJA 1OFMA 1PJRA 4MXNA 2F4IA 4C9YA 4C2TA 3QYFA 4HSRA 1DBOA 1W36D 2V7QA 3S32A 1BR2A 2XZOA 4B3GA 3FKJA 2L7KA 4EATA 1BOBA 1WJBA 3FPPA 4BE0A 4KISA 3PSFA 1SKYB 4YELA 3F9KA 3TMOA 2LY2A 3CJQB 3OYBA 3GQ8A 3OPOA 1PXZA 2R4GA 3ONQA 1Y56A 4RLFA 2ZZEA 1UD2A 2KRCA 2L9SA 1E1QA 4G6IA 4F92B 1BHEA 1FMVA 3OR2C 2UUZA 2O5RA 2GOMA 3PNTA 3DU6A 4XM3A 1YX5A 1QU3A 3SUCA 4KJZA 3ZXSA 2GJPA 4ANJA 1YX3A 4IQ4A 2JVGA 1LDKB 3GQ7A 4F91B 2Z16A 4D1QA 3LSGA 4W8TA 4BXFA 4B3XA 3ZSCA 4XLFA 3S3OA 4E6KG 2IS4A 3K70C 5HKKA 5TGTA 2KLOA 3TL4X 2UWMA 2NOJB 1MMNA 2NTPA 3SDBA 3CZ6A 2OV7A 3W2WA 3HOSA 2M4KA 3BH4A 3OFNA 4RMNA 4UZUA 4E0FA 2VQCA 2WAQA 4II3A 4QPQA 1COWA 4PFOA 4U49A 3AKZA 1K5CA 4HRIA 1D1BA 4X0GA 2L5QA 1Z21A 3T56B 4HNTA 1PLUA 3VYUB 4RLQA 4E7IA 2E5ZA 4YRVA 3OIPA 2FUG2 2INUA 2V4DA 2Q2EB 2O04A 4ZTJA 3HPGA 2IGKA 3DWLE 3SZGA 2W4SA 3RTRA 2WSSA 1D1AA 3MMYB 2VJ5A 4XKWA 2BW3B 1O8LA 3H5NA 3VDXA 2WZPP 4DK1A 1JTAA 3OR1C 2INVA 1BLIA 2NTBA 2GOXB 3RSNA 1HVXA 2HNHA 2OUMA 2PYHA 2K9MA 1D0ZA 3CP8A 2WY7Q 3K4LA 4LG3A 4IZZA 4F55A 2PMZA 4P1WA 5HOOA 4NK6A 4XOTA 1QHGA 3OYMA 2HDWA 4DIQA 3OYAA 2WA0A 3ZIAA 1MNEA 2CV2A 1V5EA 4BEHA 1V5GA 1BR1A 3QYEA 3ZGKA 2EWEA 2JJ1A 2QXZA 2HVRA 4OZYA 4CZCA 4XLHA 4OJ6A 3LMMA 4XQFA 3DEEA 4XLEA 3HPHA 2CMPA 3FHNA 1FMWA 1O8HA 2CV1A 3K10A 3UNGC 2PYGA 3CESA 3VYTB 5C1EA 1T95A 1V0EA 2X3HA 4FETA 5FRMA 1BMFA 1K28D 3H0DA 1D1CA 2O0WA 4GQNA 3K4MA 3ZCOA 4P5OA 4OWRB 2L2OA 5CQGA 4NNJA 4XLCA 4W8RA 3L2QA 2F1MA 2QX3A 4AU7A 2F6CA 3HC7A 2X6XA 2OC6A 3K4CA 4TSFA 3OYCA 2XDVA 5CKTA 4YXWA 1JI8A 1UD5A 2LBFB 2D3LA 4HPQA 4L8JA 2LC2A 3K4NA 3WWGA 4XKCA 3A2KA 2XOKA 2MABA 1XG2A 1D0YA 3DKXA 3DPTA 2WAEA 4CH7A 2CS3A 2LH9A 2O17A 2LY1A 4N4OB 4XN3A 2W7NA 4J00A 4G7WA 4E7SA 2JVHA 4J01A 1WJFA 3DTEA 1LKXA 4U7BA 4KKUA 2K9LA 3E1SA 1I18A 1O8KA 3HKZA 4ITVA 3OYLA 4BACA 2BSPA 4BJ5C 1OR7C 4TT3A 2VJ4A 2CK3A 4PSWA 5HLTA 1OOCA 2VXZA 4BQOA 1MMGA 1O8IA 4II2A 4G7XA 2WJVA 4KKTA 4CCKA 2JA2A 2WADA 2KP6A 3D5RC 2VASA 4HWVA 4C2UA 1BN8A 2KHMA 2LYCA 2DOAA 4E7KA 2X8KA 2VLAA 4YZQA 4PK4A 4BU2A 4B3FX 2E60A 3W2AA 3B8YA 5FROA 2LOOA 3BLYA 3GRHA 4B44A 1NHCA 2UV1A 4XLAA 2IXSA 2KL4A 2CV0A 1DBGA 2E1MB 2PJRB 3VSTA 3BC8A 3GQAA 5CPRB 5FRNA 2HPMA 3S93A 2Z8GA 3HXLA 2Z2SB 4IX7A 3CJRB 3KEYA 2W6JA 2Z6BD 3M8JA 1X0CA 2VBKA 3A35A 3ZRGA 1RU4A 4DNTB 3VYSB 4KT6A 1D0XA 1P9QC 3OW7A 2R7OA 4BS9A 1AA7A 3RQ4A 5LD2C 1WJDA 2IS6A 2NT6A 1VBLA 4Z05A 2DXIA 2V31A 2MFZA 3PNVA 2R9VA 3FKSA 3L2WA 1MMAA 4ZJZA 1OFLA 2HQAA 2NSPA 4W8SA 4LITA 1OGMX 4YZAA 1CZFA 1OGOX 2XF6A 2M3AA 4N4NB 2PECA 2BW3A 3IP4B 3LSHA 3GQBA 3OEEA 4OZZA 2KMUA 2MYSA 2HVQA 2WJYA 1KZLA 4BDZA 1WMRA 2VQLA 3C2HA 4Z1MA 3OY9A 2VKDA 4BE1A 1PYVA 3IAM2 4XR6A 1WJ5A 5HNFA 2V26A 1GLNA 3DPLC 2ELJA 3G2BA 4KITB 4OJ5A 3MKYB 2ZSHB 1ERDA 2WPDA 1R6RA 3OYFA 2ZTNA 4IQJA 1RWRA 3EUAA 3S8PA 1AIRA 1IRXA 2V6EA 4NUBA 5JHFA 2K5CA 4Y4RA 4F93B 3OYIA 1NG6A 1W36C 1E1RA 4EW9A 4XL9A 1UD3A 1OLTA 4ZTFA 3OL3A 4RM3A 4JMQA 1PKVA 1SAUA 4YZXA 3NWSA 3OS2A 4BJTA 1VF7A 2JDIA 1O8GA 4URRA 2ZFUA 3A4CA 3OE7A 2KRHA 2VKHA 1E43A 4CSWA 1WTHD 4ZC3A 3MKZA 3LSKA 2LZJA 2X85A 2VQGA 4PMHA 1MNDA 2QKLB 2O0VA 3A3BA 2ZZQA 4FXUA 2RREA 2LBFA 4DOZA 2KPMA 3I9V2 4E7ZA 3EPZA 1X1BA 3FDYA 2QY1A 3JURA 1X1DA 1I8DA 4PUSA 5DN6A 2M7AA 1WJEA 3OYKA 1DP3A 3SYTA 2QKMB 1QJVA 5HNHA 2HZDA 2M5SA 3FY3A 2L9NA 2WAFA 3KX2A 4AVZA 1O8DA 3BG6A 1G8XA 3H5AA 4NQWB 3OYNA 2V7FA 5KHDA 1TZLA 2X51A 4HNUA 3N05A 2R7QA 1EA3A 2A5WA 4H4KC 3V42A 2LRDA 3H35A 2VQHA 1O8EA 2A6TA 5CQEA 3AL0B 2HU9A 2MC4A 2KVOA 4HEA2 2VL8A 2IGOA 3OYHA 3J7AY 5AMVA 4YZ0A 1WFXA 2QE7A 2I8DA 1T0FC 3QODA 4JQFA 2IQ7A 4OJLA 1HA8A 1E3ZA 4ZDOA 1W9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBG A;  3EQO A;  4I84 A;  4U49 A;  3GQ9 A;  2NTQ A;  2UVE A;  2VBM A;  3EQN A;  3VST A;  1K5C A;  3GQA A;  2Z8G A;  1PLU A;  4MR0 A;  1X0C A;  2VBK A;  2INU A;  2NST A;  1RU4 A;  3VSU A;  1O8J A;  2O04 A;  3B90 A;  1GQ8 A;  3T9G A;  3VSV A;  2NT6 A;  1VBL A;  4XKW A;  4Z05 A;  1O8L A;  3VMW A;  1O8F A;  4NK8 A;  1JTA A;  2INV A;  2X6W A;  1OFL A;  2NSP A;  2NTB A;  2ODL A;  4W8S A;  1OGM X;  4YZA A;  1CZF A;  1OGO X;  1H80 A;  4Z06 A;  2PYH A;  2PEC A;  4OZZ A;  4W8Q A;  4NK6 A;  4XOT A;  1PE9 A;  1WMR A;  2QXZ A;  2EWE A;  4XR6 A;  1QCX A;  4XLH A;  4OZY A;  4OJ6 A;  4XN0 A;  4XLE A;  4XQF A;  4XON A;  2X6Y A;  4OJ5 A;  1O8H A;  2PYG A;  1O8M A;  1RWR A;  5C1E A;  5C1C A;  2X3H A;  1O88 A;  4XOR A;  1AIR A;  3VMV A;  1HG8 A;  2O0W A;  2VJJ A;  4OJO A;  4EW9 A;  4XL9 A;  4Z03 A;  4XOP A;  4XLC A;  4W8R A;  2QX3 A;  3LMW A;  1IDJ A;  4YZX A;  2VJI A;  1O8G A;  1IB4 A;  2X6X A;  4URR A;  1IDK A;  1KCC A;  4XMY A;  2VBE A;  4YEJ A;  1OFM A;  3WWG A;  4MXN A;  2X85 A;  1DBO A;  3B4N A;  1XG2 A;  4PMH A;  2O0V A;  1RMG A;  1KCD A;  2O17 A;  2QY1 A;  4XN3 A;  3JUR A;  4YEL A;  4OJP A;  3GQ8 A;  1PXZ A;  3UW0 A;  1O8K A;  1QJV A;  3FY3 A;  4AVZ A;  2BSP A;  1O8D A;  4C2L A;  1KTW A;  1BHE A;  1OOC A;  1EE6 A;  2UVF A;  4U4B A;  4XM3 A;  2NZM A;  3SUC A;  3ZPP A;  1O8E A;  2NT9 A;  4HWV A;  1BN8 A;  5AMV A;  1JRG A;  4XKV A;  3GQ7 A;  4YZ0 A;  4W8T A;  4YZQ A;  3ZSC A;  4XLF A;  2O1D A;  3KRG A;  3GRH A;  3B8Y A;  1NHC A;  2NTP A;  1IA5 A;  2IQ7 A;  4OJL A;  4XLA A;  1O8I A;  4XNF A; 
#chains in the Genus database with same CATH topology
 1IV6 A;  4M6V A;  2BVL A;  1J2X A;  2VC1 A;  3GBG A;  3O3K A;  3P9I A;  2NTQ A;  2LDU A;  3CUQ A;  3IWZ A;  2KVO A;  3KEW A;  1SFU A;  3PFI A;  1D1N A;  3Q39 A;  4UY8 I;  1OB5 A;  4A2U A;  2V6C A;  1H88 C;  4MFE A;  2CFX A;  4IKF A;  2VFQ A;  1LFP A;  2E1B A;  4WQM A;  5M3M J;  3HG9 A;  5FB2 A;  2PJR A;  4ZGQ B;  2AQE A;  1WPC A;  4PC6 A;  3K70 D;  1ETY A;  4NC8 A;  3V7S A;  2M9H A;  1ZK8 A;  2D3N A;  2NPF A;  3CD6 B;  1OGI A;  4MHG A;  4B48 A;  3DEU A;  3OL4 A;  1O57 A;  2OF7 A;  2M7B A;  2VXD A;  4L5E A;  3TED A;  4A3J J;  1VTN C;  2X1E A;  4PC2 A;  1ZM9 A;  2ODL A;  2EK5 A;  2P7V B;  4JK1 X;  3FXJ A;  2A69 F;  3S3M A;  2QQ9 A;  1R4N B;  1Z9C A;  4IHW A;  4ACA A;  2Q1Z B;  3BJ6 A;  1WSV A;  2OK7 A;  2RN7 A;  3ZMV A;  2V7V A;  2QYU A;  2AQF A;  5BQT A;  2X53 S;  4ENM A;  2ZXJ A;  2HXI A;  3OYE A;  5IT9 K;  4A0X A;  5LHG A;  2KDO A;  2NS8 A;  4L5I A;  1JT0 A;  1YQA A;  3QYB A;  4EM0 B;  3WTW C;  4QV2 A;  4XN0 A;  5GV7 A;  2LLK A;  1DUX C;  2F43 A;  2DIE A;  1POG A;  1IO2 A;  3WBK A;  2C77 A;  1I3A A;  3QPH A;  2EWN A;  5F27 A;  3ZBU A;  1YS6 A;  2IS1 A;  2Z99 A;  4X1E A;  5KAI C;  3PL8 A;  2DMQ A;  1Z3X A;  2GQF A;  3U9G A;  3BZK A;  2YUS A;  2WBM A;  1MBH A;  2W24 A;  4Z03 A;  4I09 A;  3DKY A;  1T5E A;  4BDY A;  2EFP A;  4P9U A;  1OKR A;  2BN4 A;  4YEI A;  1JXS A;  1FIA A;  3OOU A;  3I59 A;  3NQO A;  2E1C A;  1TYU A;  9ANT A;  2WV1 A;  2OA4 A;  3DLA A;  4MO7 A;  3ASQ A;  2CUZ A;  4RDL A;  2Z1D A;  3HM5 A;  3VSL A;  3WTS C;  4P25 A;  2P5K A;  1K73 D;  3H9G A;  2OCE A;  3OP1 A;  4HV6 A;  1CF7 A;  3KYL A;  4XKB A;  1X1C A;  2G9W A;  1R5O A;  4EMS A;  1E0E A;  2AHO A;  2XGC A;  1O3R A;  1FT9 A;  3BCA A;  1B2R A;  2X1D A;  3L9F A;  1RMG A;  1W0K A;  5HVQ C;  3M3Y J;  4LIV A;  2XGJ A;  2KFD A;  3DTI A;  4Y17 A;  4M9X A;  4MNU A;  2GXB A;  1Y1V J;  4XD7 A;  3MN2 A;  4RAZ A;  2X0K A;  3IL2 A;  3UW0 A;  1EZG A;  3SZP A;  5F4O A;  2BGC A;  2QWW A;  4A3K J;  4EM1 A;  4M6X A;  2EBI A;  2BOL A;  2HVS A;  3OJW A;  1X4P A;  1KTW A;  4C2L A;  2Q8K A;  4TMV A;  4I76 A;  3E0J B;  2LNB A;  3BDD A;  3RPU D;  2UVF A;  3TDZ C;  3WHB A;  5F04 A;  3JSP A;  3CCQ I;  1IUY A;  2VKE A;  2PLY A;  3GTG J;  2FJ1 A;  1TYW A;  2GIV A;  4F52 A;  1DP7 P;  2A3S A;  1KK1 A;  4RGU A;  2BM7 A;  4U87 A;  2DK5 A;  1ZM3 A;  3PQJ A;  2K02 A;  1B4A A;  3H94 A;  4DJA A;  2H1L A;  2OBS A;  3S3N A;  3KRG A;  2BV6 A;  4Y3O A;  1E79 A;  4XNF A;  3IH2 A;  5FKO A;  3LNQ A;  2LFB A;  1JGS A;  3GQ9 A;  4DNR B;  2ZXI A;  2BEO A;  1Q82 D;  4HNV A;  2ZZF A;  1Z0X A;  3QU6 A;  1N05 A;  2VOO A;  2MSY A;  4KFC A;  1NG7 A;  5THX A;  2EZI A;  1YIJ I;  1RPW A;  2Q0O A;  2DEU A;  2VE8 A;  4WZT A;  2P6S A;  4GO1 A;  3VNV A;  2X9D A;  2DI3 A;  3VEP A;  1RZ4 A;  3BPX A;  2COB A;  3K4K A;  4KIC A;  2JRT A;  2W25 A;  2GK6 A;  1RQP A;  1JUP A;  2R7D A;  2CW7 A;  1K6Y A;  2XIG A;  3T1B A;  2E1O A;  1H80 A;  4BBS J;  1G59 A;  3OJX A;  2C78 A;  3SZT A;  1QVF B;  5DTD A;  4OIR F;  3IHU A;  2M2E A;  4LIU A;  1RNL A;  1FNB A;  1RKT A;  3ABT A;  2HDN B;  5CDF A;  2BX6 A;  4CUG A;  3OYG A;  1X4O A;  2R7X A;  3HJE A;  3WG7 H;  2EV0 A;  1D2E A;  2C4T A;  3CCQ B;  5E6T A;  1QGY A;  3K1P A;  2R7W A;  1MAB A;  3GFJ A;  1YOV B;  3CUO A;  2ETH A;  3IUO A;  4MTD A;  4A93 J;  2XNC A;  2R0Q C;  2ZSI B;  2QLZ A;  4E4H A;  3G1M A;  3FWE A;  4ETS A;  2V1X A;  4OAZ A;  4AVP A;  1ZH5 A;  4Q5S F;  4WZK A;  3WNB A;  1VHE A;  4E7L A;  4BQQ A;  1S3J A;  1MW7 A;  5JFR A;  4HE5 A;  2M30 A;  1O3S A;  2XT2 A;  2O03 A;  3KET A;  2RKH A;  1LFB A;  3HYI A;  3OMY A;  2IS2 A;  2W6I A;  3CPW B;  1GXP A;  3EUK L;  4U9U A;  2BXZ A;  1TW2 A;  1XG1 A;  3QU3 A;  1QA6 A;  4XMY A;  5DD8 A;  4YEJ A;  2D74 A;  3PVD A;  4IEJ A;  3J81 K;  2VBY A;  3ROU A;  2DMT A;  3BNW A;  2BXY A;  2CWE A;  2BV3 A;  1YIJ B;  3C1D A;  4HSR A;  2XZO A;  3CCU I;  4B3G A;  1BR2 A;  3DV8 A;  1TLH B;  4M72 A;  2GWR A;  3RY8 A;  5EG0 A;  3AGQ A;  2BE5 F;  5A89 A;  2L7K A;  4Z4Y A;  4IL6 C;  1WJB A;  2H6B A;  1R49 A;  3FPP A;  4G8X A;  2OYN A;  1QRB A;  2CBX A;  3PSF A;  4XLN F;  3J81 k;  4YEL A;  3TMO A;  2LY2 A;  3CJQ B;  3I71 A;  3OYB A;  3JQQ A;  3X2Q H;  1MDM B;  3OPO A;  1WH7 A;  3AG4 H;  1PXZ A;  3ONQ A;  4DNC A;  1RES A;  3HRT A;  1N25 A;  2DPD A;  2VNK A;  2KRC A;  2L9S A;  1E1Q A;  1BJZ A;  1DDN A;  4XRM A;  5CVR A;  4F92 B;  3O6B B;  1UG2 A;  1VND A;  1FMV A;  3KLO A;  3OR2 C;  3S1R J;  3G73 A;  1ZG1 A;  5HZA A;  2GOM A;  2VOP A;  1XMX A;  4X7D A;  3DU6 A;  2JQ7 A;  1DAB A;  4D5C A;  3ZXS A;  2L9V A;  3ML3 A;  3JW4 A;  1YI2 I;  2CUF A;  2MLG A;  2JVG A;  1U3E M;  1LDK B;  1WOR A;  5FO0 A;  4UVA A;  2CU7 A;  3Q0W A;  1N0U A;  2JA7 J;  1Q7Y D;  3JRG A;  2BM0 A;  4QVJ A;  5FGM A;  3B02 A;  5BSX A;  5TGT A;  4BY1 J;  1T6X A;  4D7N A;  3NRV A;  3I53 A;  2FU4 A;  1TYV A;  4DYR A;  3BH4 A;  2MD5 A;  5D6F A;  4WZE A;  2GBY A;  4U49 A;  3FMR A;  4D7M A;  5DEQ A;  1Z21 A;  3LA2 A;  3TOA A;  2PMU A;  2K9S A;  3F8C A;  1FJL A;  1GO2 A;  1XGN A;  3CCR I;  1IN6 A;  2O04 A;  1WWX A;  1W87 A;  1LQ1 A;  3HPG A;  1OYI A;  2IGK A;  3WTU C;  2W4S A;  3RTR A;  3LJY A;  4OJP A;  1ZUN B;  4TMT A;  5EJC A;  3MMY B;  3FXR A;  1B9N A;  3EET A;  1EH8 A;  3CCU B;  3BZ6 A;  4BHP A;  3H5N A;  5HXB A;  2HTS A;  2WZP P;  4WXC A;  2XV4 S;  4A3E J;  3F8N A;  4HDU A;  1K79 A;  2GOX B;  1SVL A;  2V1U A;  2PYH A;  2XAJ A;  4LG3 A;  2WY7 Q;  2CC2 A;  4Z4T A;  4AID A;  2PMZ A;  3PET A;  1QHG A;  4JX4 A;  1JTY A;  1IJE A;  2HDW A;  1W5T A;  4DIQ A;  3OYA A;  2WA0 A;  5ERI A;  3MZ8 A;  3ZIA A;  4IRH A;  2D45 A;  4NBQ A;  3CO7 C;  4XLH A;  4OJ6 A;  4XQF A;  3DEE A;  4XLE A;  2XGD A;  1TP4 A;  2CMP A;  1ZG3 A;  4RB3 C;  3FK7 A;  1RKW A;  1FMW A;  1E3O C;  2CV1 A;  1MH3 A;  3K10 A;  2J5O A;  1YI2 B;  4XBF A;  1E2X A;  1EV7 A;  3WTZ A;  1BMF A;  5TV2 A;  3BJO A;  1K28 D;  3KEQ A;  3H0D A;  3E6M A;  2FQ3 A;  1W0U A;  2O0W A;  1YS7 A;  3CCE I;  4OWR B;  3FIS A;  2JN6 A;  2V1D A;  1N07 A;  3SLD A;  2M34 A;  3H3V K;  5H59 A;  4UUS A;  3HHG A;  2CQX A;  1QVG B;  4I7H A;  3SQV A;  1B8I B;  1N08 A;  5B1B H;  5A8A A;  4LOC A;  2FML A;  1VQP I;  1UD5 A;  1IB0 A;  2LBF B;  1X3W B;  3A2K A;  2XOK A;  3CCR B;  4UVB A;  2V7T A;  3IV5 A;  1D0Y A;  3TKY A;  3DKX A;  5E8I A;  2WAE A;  2ZL6 A;  2PE3 A;  4FQG A;  1TTY A;  2F4N A;  2DQL A;  3C2B A;  4M3F A;  2VON A;  1FBS A;  3F8F A;  3P9C A;  3H3U A;  3AVU A;  2NV4 A;  4U7B A;  5AIQ A;  2P4W A;  2OPT A;  5EZH A;  5F6F A;  2KIF A;  2C6Y A;  5E8G A;  1Z91 A;  2JTV A;  3E5X A;  5K5Q A;  3GCM A;  2CK3 A;  1EH7 A;  1BX1 A;  4RCY A;  4BQO A;  3NAU A;  1OYY A;  1UHM A;  2VFM A;  3DF8 A;  3L09 A;  2YU3 A;  2ID6 A;  4CCK A;  4I0B A;  3CLQ A;  2EIN H;  2ELH A;  2KHM A;  2TRT A;  5F08 A;  1BM9 A;  2VBS A;  3BY2 A;  3V7C A;  1KQ5 A;  4YZQ A;  3CUQ B;  1JUS A;  1KQ0 A;  3R60 A;  2FMY A;  2Y2Z A;  5ILS A;  3S1M J;  4WXH A;  4RBO A;  2RV8 A;  4IRI A;  2FQ4 A;  2QSF X;  2F5F A;  5L3C A;  1B23 P;  4EVI A;  1F1Z A;  2IXS A;  1QFZ A;  1DBG A;  1XSV A;  3CCE B;  2ZJ2 A;  3FX3 A;  2PJR B;  1R23 A;  2XTX A;  3CME I;  1ZG5 A;  4YDT A;  4XSX F;  3CRZ A;  5CPR B;  3ABU A;  2Z8G A;  3FXK A;  1WDT A;  4IX7 A;  1KA8 A;  2HQN A;  4XSZ F;  3RJP A;  3C3W A;  3FXM A;  4GDF A;  5JI6 A;  3M8J A;  1X0C A;  2WYR A;  3A35 A;  1R9T J;  4DNT B;  1F5T A;  2H27 A;  1P9Q C;  1IJW C;  2BY2 A;  2DA2 A;  3OW7 A;  4BS9 A;  1VQP B;  2AXL A;  3HB9 A;  1AA7 A;  4HA8 A;  1YX2 A;  5TRD A;  1FTZ A;  1U6G A;  5LD2 C;  2D1H A;  3JRD A;  2IS6 A;  1VBL A;  4Z05 A;  1FOY A;  1XGS A;  2OQG A;  2MFZ A;  3PNV A;  4CO8 A;  4ZJZ A;  3GTQ J;  1MMS A;  4V2G A;  4YZA A;  3ZQC A;  5FLX Z;  4ZCM A;  1OGM X;  4V02 C;  2DDA A;  1I6H J;  1CZF A;  1Z77 A;  4N3N A;  2BW3 A;  4YIR X;  2QZ8 A;  1BW5 A;  2KMU A;  2MYS A;  3S1N J;  2HVQ A;  3TO9 A;  2P5L C;  1JUM A;  2M8G X;  1KZL A;  2HYG D;  5F1J A;  4Z1M A;  3ZMT A;  1HKQ A;  4BAY A;  5J1Y A;  1WU8 A;  2RNJ A;  5GPA A;  2VBU A;  1WJ5 A;  5HNF A;  1ZRD A;  1W7P D;  4KNY A;  1GLN A;  4PGO A;  3DFG A;  3DPL C;  1YO5 C;  4Z4R A;  1AMO A;  3G2B A;  2XAS A;  2LKS A;  2FF4 A;  2NVQ J;  1ERD A;  5B5E C;  2ZTN A;  3ZQG A;  3C7J A;  2Y31 A;  3EUA A;  1MZB A;  2KIS A;  1AIR A;  5J4V A;  5JHF A;  1W36 C;  1V5V A;  5FD5 A;  2LMD A;  3TGN A;  4XL9 A;  2PX9 A;  3BTJ A;  1XFO A;  5DS0 A;  1BJA A;  3FXU A;  4ZTF A;  3OL3 A;  4RM3 A;  1K7A A;  4JMQ A;  1CF7 B;  3AGP A;  1QZY A;  3CME B;  2DA5 A;  4RPD A;  1HXD A;  1EA0 A;  1IRF A;  2VKH A;  4JP0 A;  4CSW A;  5GP9 A;  2D9R A;  4ZC3 A;  3QPL A;  3ZC3 A;  1QFJ A;  1U2W A;  2CF4 A;  2NVX J;  1LEA A;  1EP2 B;  4QTR A;  2K4B A;  5LHI A;  3NEU A;  3ERM A;  4PMH A;  1L1I A;  2TDX A;  2HYF A;  4DOZ A;  1E62 A;  1YIO A;  5FIU A;  3ZQH A;  4M2L A;  4NDL A;  5D8K B;  2V9V A;  2RC6 A;  2IOU G;  2ZCW A;  5F1R A;  4OOX A;  1DP3 A;  3SYT A;  4ACB A;  3RZO J;  4UV9 A;  1T6Z A;  4LBV A;  5HNH A;  3KP4 A;  3KX2 A;  4AVZ A;  3V76 A;  2F2E A;  4M71 A;  3BG6 A;  1O8D A;  1G8X A;  1G2H A;  1OPC A;  4HX4 A;  4M53 A;  2WZN A;  4M74 A;  4HNU A;  3HGY A;  2C2W A;  2R7Q A;  1VI0 A;  1SFO J;  4H4K C;  2I1L A;  4JX5 A;  5FKM A;  4AD9 A;  1SMY F;  2NAZ A;  2VQH A;  2A6T A;  2MGQ A;  5CQE A;  5TIS C;  2Z9O A;  1A6I A;  1Y1W J;  1G7C A;  2MC4 A;  4RAY A;  4TMZ A;  2Y30 A;  3HDD A;  1IW7 F;  1QVU A;  4LB5 A;  4RLZ A;  1G3Y A;  5K5R A;  3WTV C;  2IQ7 A;  4RD0 A;  5JLX A;  1SKQ A;  4ZDO A;  3BCF A;  3DKW A;  3CCM I;  3WQZ A;  3EQO A;  4I84 A;  2IW5 A;  2ZNY A;  1OB0 A;  1WRJ A;  4A3L J;  4HX7 A;  4GRI A;  3BTL A;  5K7F A;  5J8F A;  3AG1 H;  5KCM A;  5BNG A;  2Q6I A;  4EH1 A;  4IHX A;  3IKT A;  2OU2 A;  1X58 A;  5HS9 A;  3VR6 A;  1ELO A;  3LSM A;  3ZMS A;  3L2R A;  2CQQ A;  1NK3 P;  3FF5 A;  2GK7 A;  1R5G A;  4CZZ A;  5GV8 A;  2J8K A;  3E97 A;  1R1V A;  3VSK A;  2V79 A;  3P4G A;  2Y0S A;  4ON0 A;  2HOS A;  2FX3 A;  1I1G A;  3AFH A;  2GPJ A;  2GRE A;  2B0R A;  1VQN I;  4KN7 X;  5DCM A;  5HS7 A;  4Y52 J;  1TSP A;  2FBI A;  3CJT B;  5D8L B;  1TWA J;  3KP3 A;  4ENN A;  3VMW A;  3HOT A;  1HW2 A;  2X6W A;  3LFU A;  1YW8 A;  3MKW B;  3D0S A;  1EKE A;  2ZXH A;  3GME A;  3I4M J;  1V0F A;  1KGS A;  5L3G A;  2ZO4 A;  3B82 A;  3QAH A;  2XTY A;  2DET A;  2IPQ X;  4PJN A;  3W5U A;  4W8Q A;  2E5N A;  3GZN B;  3VYR B;  3E3V A;  4YAW A;  3L2U A;  1Y6I A;  5CVI A;  1MJA A;  3C18 A;  2ZME C;  2BYV E;  5FJ8 J;  2L7F P;  3ASR A;  3ZPN A;  2HPI A;  4LBZ A;  4GYI A;  2ISY A;  5GAE J;  5BPD A;  3IWF A;  4JYK A;  4JBA A;  2ZJR F;  1N78 A;  1UD8 A;  3JAM K;  5EEA A;  1B6A A;  3TP0 A;  4Y15 A;  1FYM A;  1EP1 B;  1DGR M;  3FBI B;  3QWL A;  1JJ2 B;  3HOY J;  2K86 A;  1FBU A;  2E2J J;  4Z2Y A;  4DQK A;  2VN2 A;  1O88 A;  1EH6 A;  5BSY A;  2VNI A;  5K7H A;  2BY1 A;  4CYD A;  5FL7 A;  3HGG A;  3U2Q A;  1FX0 A;  1OB2 A;  3R61 A;  2EQR A;  4KMF A;  1UEL B;  3H0G J;  1VQL I;  2QVO A;  3G3Z A;  4PJJ A;  3HL2 A;  4L9J A;  1HW1 A;  3CCM B;  4CCN A;  2CH0 A;  2BM6 A;  1SVO A;  1ETO A;  4RGS A;  4BE2 A;  3L2V A;  1A8P A;  4DGW B;  4XK4 A;  4LMY A;  5TR9 A;  4PJM A;  1KCC A;  5EG0 B;  5LFA A;  1E17 A;  1FEX A;  2Y9Z A;  4EQQ A;  1BX0 A;  1WGX A;  2GJR A;  5IYN A;  1RR8 C;  2PLF A;  3SEZ A;  3PUM A;  2XF5 A;  1AWC A;  3OS0 A;  3OOC A;  1HC8 A;  4CGZ A;  3W2V A;  3PSI A;  1KCD A;  4ZDL A;  1VQN B;  1KQ9 A;  1WCM J;  3OIQ A;  2HYJ A;  3TQN A;  2DT6 A;  3ZN0 A;  2ZBU A;  1QVT A;  2E35 A;  4U0V A;  4Z4W A;  3N90 A;  2F4O B;  4MLO A;  3RYR A;  4AIH A;  2L0K A;  5CVU A;  4QVA A;  3QP5 A;  2DPU A;  1ZR4 A;  1OFC X;  2XRO A;  2DT5 A;  2DLL A;  4A69 C;  4S04 A;  2F5V A;  4BQA A;  2FOW A;  4Z4U A;  2ZB9 A;  1W2B B;  4U4B A;  4XID A;  2B7B A;  4ROX A;  1NDH A;  5E79 C;  4C30 A;  3HSE A;  3PUB A;  1VJS A;  4RDK A;  2XPV A;  2E7X A;  3D5L A;  3D26 A;  3OEH A;  2WB1 A;  2W82 A;  5E1W A;  1RET A;  1S6L A;  4LLL A;  2BVN A;  1QRY A;  3A3G A;  3MKL A;  2W57 A;  1JNY A;  2O1D A;  1K61 A;  3JRA A;  4P6Y A;  4HST A;  1N75 A;  3QE2 A;  3OS1 A;  1LVK A;  1QHH D;  3G6E I;  4DQ2 A;  2HKO A;  3L2C A;  2MBF A;  1BC8 C;  4P1V A;  4QSH A;  4BHB A;  1AU7 A;  4M1K A;  1VQL B;  4BUP A;  3M7G A;  1QQI A;  5AN9 A;  4RGX A;  4AUX A;  4KH3 A;  2NS0 A;  1V55 H;  2V7W A;  5EZG A;  4H0E A;  1QGP A;  1UMK A;  2FA5 A;  4D5F A;  4P96 A;  1J0R A;  4DK0 A;  1ETW A;  3GEZ A;  3LSR A;  2DA4 A;  1JJ6 C;  3VWB A;  1KC8 D;  4QLC U;  1R58 A;  3OZU A;  2DQR A;  3BR3 A;  3E1Y E;  3BY1 A;  4BH9 A;  2ZFW A;  1IXR C;  2KJB A;  5K1Y A;  3WTT C;  2QA4 I;  4QPO A;  4MIM A;  5B66 C;  4KIB A;  3ZBT A;  5IOY A;  2R7T A;  4F7Z A;  3I5U A;  1K8F A;  5EEG A;  2ICW G;  3GXO A;  1H89 C;  2JSP A;  2XF7 A;  2ZXW H;  1J59 A;  1P4M A;  3QP6 A;  1IDZ A;  1TT0 A;  2WTE A;  1IXS B;  2QEX I;  3A1Y A;  1MJB A;  2KJC A;  4PSX A;  3AVT A;  3Q3A A;  1XMA A;  3K1M A;  3E6C C;  4RDJ A;  3FKI J;  1XS9 A;  1DQU A;  1LNW A;  1ZRF A;  4X7F A;  2V4J C;  2DY1 A;  5JR3 A;  4P26 A;  3NAW A;  3H9Q A;  3A1P A;  2K9Q A;  3DDY A;  1O7F A;  2F5E A;  1VQM I;  2CFO A;  1P92 A;  3JCU C;  1Q86 D;  3GO5 A;  4UUS B;  4G7H F;  4A0Z A;  2H8W A;  3ABM H;  3BWG A;  2R7S A;  1A31 A;  2C5H A;  1UG0 A;  4LFU A;  4C43 A;  2MD0 A;  2R7V A;  2FBH A;  2B5O A;  3C2G A;  4R8H A;  4UHT A;  4ZYH A;  2ZZG A;  2K3P A;  2VB6 A;  2XSD C;  1GDT A;  3LNN A;  2JA6 J;  3G6E B;  4U0W A;  2R3S A;  1IDJ A;  2KQR A;  3NE5 B;  1IB4 A;  2PG4 A;  3HKZ N;  5JHU A;  1V5F A;  2HLD A;  5D4S A;  4BGD A;  1IDK A;  5C4X J;  2OTJ I;  1A5J A;  1UD6 A;  4KKS A;  3BR0 A;  5J40 A;  2XZL A;  1EJ9 A;  2AO9 A;  2JJ7 A;  3V7A A;  4C2T A;  2YX7 A;  4P3Y A;  1DBO A;  2Y0S N;  3QPT A;  2V7Q A;  3O2P E;  1M90 D;  1SAN A;  3MVP A;  4RDU A;  1W1W E;  2K27 A;  5KVR A;  4NCN A;  3SZE A;  4UV8 A;  2QA4 B;  3EYY A;  4G12 A;  4IHS A;  3GQ8 A;  3ZN1 A;  1R7J A;  1OCZ H;  2NS7 A;  2QQB A;  5IOZ A;  1X2M A;  5HS8 A;  3HRU A;  1UD2 A;  3M9A A;  5EF6 A;  2DMP A;  1XCV A;  3W6K B;  4NHJ A;  4G6I A;  1HKS A;  3BQY A;  1UCR A;  2CRG A;  2QEX B;  2K40 A;  3GZ6 A;  2GA1 A;  5J3L A;  3BG5 A;  3PIP F;  3PNT A;  4DZJ A;  2JT1 A;  4XM3 A;  2Z33 A;  3SUC A;  3HOZ J;  1ORK A;  2EB7 A;  1YX3 A;  3KP7 A;  1MNM C;  4ESJ A;  4YAO A;  3AG2 H;  4F91 B;  1XD7 A;  1XE1 A;  4W8T A;  3LSG A;  4B3X A;  4C3J J;  1K83 J;  1VQM B;  3K70 C;  5HKK A;  1E3H A;  3CF5 F;  1TNT A;  2L3D A;  5BMZ A;  3HOS A;  3W2W A;  2LKX A;  3LYC A;  2XHK A;  5E3L A;  4UZU A;  4C3I J;  5C3E J;  2BY0 A;  4KMU X;  3R4K A;  4II3 A;  4QPQ A;  4E0F A;  3AKZ A;  3J80 K;  1N0V C;  1IAW A;  5LGT A;  1D1B A;  4TV7 A;  4A6E A;  1ZRC A;  3MZY A;  3U1K A;  2E1N A;  1WXR A;  1PLU A;  3BQJ A;  4RLQ A;  1FY7 A;  4E7I A;  4AWX B;  2K7L A;  4YRV A;  4RD3 A;  4LBY A;  5FD6 A;  4A5M A;  1NB0 A;  1R1U A;  2P6T A;  2OTJ B;  1P4A A;  3T0Y A;  3DWL E;  1BI2 A;  2LP0 A;  2JA5 J;  3SJZ A;  2DOD A;  1Y8Q B;  2VJ5 A;  2BW3 B;  3A03 A;  4KIG A;  1O8L A;  3RPU A;  1S0U A;  3RIR A;  1H85 A;  4MQ9 F;  3QFS A;  5JLW A;  4DK1 A;  3OR1 C;  1ZRE A;  1JTA A;  2INV A;  2RGV A;  1I1S A;  2HNH A;  3J7Z I;  2OUM A;  3IRR A;  2PJP A;  3K4L A;  4IZZ A;  4F55 A;  4P1W A;  2OBR A;  1GAW A;  1CNE A;  2XGE A;  1R36 A;  1MGT A;  1GVD A;  2L02 A;  4FE4 A;  1MNE A;  2XKO A;  2CV2 A;  1BR1 A;  3QYE A;  3ZGK A;  4ZZL A;  4S0H B;  1FRN A;  4OZY A;  2DFI A;  1L0O C;  4Z4Z A;  3CDI A;  2HXO A;  3T5X A;  1O8H A;  1LPQ A;  5CVJ A;  3W5V A;  2PYG A;  2STW A;  3CES A;  1U2R A;  3H1C A;  2B63 J;  3I4N J;  2HMA A;  2CW0 F;  1ITY A;  3RKY A;  1T95 A;  3G1L A;  2X3H A;  3ISX A;  4FET A;  3TDU C;  4RJL A;  4N0B A;  3HUG A;  4RB0 A;  1D1C A;  3HRM A;  4OPV A;  4GQN A;  2E2H J;  4P5O A;  4ZYG A;  3MMP A;  5CQG A;  3WU2 C;  2F1M A;  4IO9 F;  2EIX A;  3QOP A;  1JA0 A;  4AU7 A;  2HOA A;  1Z67 A;  1YRN A;  4UUT A;  3K4C A;  2AHQ A;  5IYD J;  3WTY C;  4R1H A;  4MTE A;  3JX8 A;  2EFN A;  2VE9 A;  3I58 A;  2QYO A;  4GYG A;  1GR1 A;  3K4N A;  4I01 A;  2FSW A;  3H09 A;  3V8J A;  5JMC B;  1XG2 A;  1KQ8 A;  4CH7 A;  1XGM A;  4A3G J;  1IGN A;  2LH9 A;  1J9I A;  1I5Z A;  2LY1 A;  2W7N A;  4J00 A;  2AS5 F;  3LOC A;  4E7S A;  5HLH A;  2C4U A;  4J01 A;  3S17 J;  1FLI A;  3EDP A;  2PIA A;  4A5N A;  1LKX A;  3F3X A;  4KKU A;  2K9L A;  4TMX A;  2MLK A;  1I50 J;  2KIM A;  3JTH A;  1S7E A;  3VO2 A;  1J75 A;  4BAC A;  4YFO A;  1ONV A;  4TT3 A;  1FC3 A;  2H8R A;  3CDL A;  3O8G A;  4EGY A;  1PDN C;  4UXN A;  1VFC A;  2QBY A;  5L3F A;  4KN4 X;  4WCG A;  2DOE A;  2WAD A;  2KP6 A;  3PA2 A;  3B6A A;  3RI4 A;  3D5R C;  1Y39 A;  4G1B A;  4HWV A;  3KE2 A;  4C2U A;  4A3I J;  1BN8 A;  3V8K A;  5J3O A;  2VBV A;  2LYC A;  2DOA A;  2HI3 A;  2X8K A;  2VLA A;  2F3L A;  1XX5 A;  2E60 A;  3GRH A;  4B44 A;  3Q9S A;  1XTA A;  3BY6 A;  2KL4 A;  4A0Y A;  3BC8 A;  3MCZ A;  4Z6Y A;  5J35 A;  1PVE A;  4OIN F;  5LEK A;  5FRN A;  2HPM A;  3S93 A;  2VKV A;  1S8N A;  2DU9 A;  1V3F A;  2QEN A;  2Z6B D;  5DCM B;  4L9T A;  1QPI A;  3ECO A;  4KT6 A;  1D0X A;  2DFE A;  2R7O A;  1UJ8 A;  2E7W A;  2BZT A;  4NBS A;  3HEF A;  1RRJ A;  1MRZ A;  1WJD A;  1TQP A;  3ZMD A;  1U8R A;  2NT6 A;  3Q0U A;  3R6J A;  2V31 A;  2Q2E A;  3HOV J;  4BXX J;  3VB2 A;  3WU0 A;  3L2W A;  1MMA A;  1IRZ A;  1OFL A;  2NSP A;  4LIT A;  2ELK A;  2IJL A;  1JHH A;  3F8B A;  2QQA A;  3JQP A;  3KL9 A;  4HBL A;  5EYR A;  3E5Q A;  3FJO A;  5AIP A;  1ZQ3 P;  3IP4 B;  2G7U A;  3OEE A;  2F5C A;  3HHH A;  3PSS A;  1Y8R B;  3OOP A;  1WMR A;  1ZAO A;  2XGX A;  3P9K A;  4RD4 A;  1OYW A;  4FTH A;  1PJ5 A;  1WOP A;  1PYV A;  2G0E A;  2HS5 A;  2HZT A;  2IEK A;  3IAM 2;  4LJZ F;  1J9Z A;  3O8H A;  3BT9 A;  3RZD J;  1OCO H;  1W35 A;  2XAH A;  2DA6 A;  4YC5 A;  1U9N A;  2XB0 X;  4U88 A;  4KIF A;  3WYA A;  1U8B A;  1R6R A;  3OYF A;  1JB9 A;  1E63 A;  2UXX A;  1TT5 B;  1NK2 P;  3Q0V A;  2HEO A;  4QIW N;  1WZ2 A;  3BQZ A;  4IHT A;  3TO6 A;  2CG4 A;  4NUB A;  2K5C A;  1E1R A;  1SFE A;  5E20 A;  3E7L A;  1RUO A;  3I56 B;  2JWT A;  3TW6 A;  2EIJ H;  3JRB A;  2EIL H;  1SAU A;  3EUH A;  3S2D J;  2FVG A;  5A2Q Z;  3I0T A;  3NWS A;  4HF2 A;  3A4C A;  2HDD A;  5HDG A;  1BBY A;  4M9Z A;  3GIR A;  3BR6 A;  1AKH A;  2HWV A;  4FCY A;  2LSO A;  2EIK H;  3LSK A;  3PEN A;  2LZJ A;  2NYX A;  2M87 A;  5LGN A;  3FM5 A;  4DYQ A;  2EH3 A;  2ZKZ A;  2QKL B;  1TWG J;  2QN6 A;  3A3B A;  2DA3 A;  5M5W J;  1ZGW A;  4FXU A;  2KPM A;  3I9V 2;  4AC9 A;  3FDY A;  1W4M A;  2QY1 A;  4A3B J;  4RA2 A;  3W6J B;  3JUR A;  1X1D A;  1J5Y A;  1Y0N A;  1ZLK A;  3FPK A;  5DN6 A;  3ZQI A;  2DFH A;  2HDC A;  2M7A A;  2VBX A;  2QF7 A;  4YAL A;  4FWT A;  2FEZ A;  3OYK A;  3I1F A;  5KW9 A;  2H09 A;  2QKM B;  1HQC A;  1QJV A;  4CIC A;  3FY3 A;  4WWV A;  2WAF A;  5LBQ A;  5L46 A;  2QGU A;  4YFK F;  1CQX A;  3WXM A;  4E70 A;  3WNC A;  5IYC J;  1TQI A;  5EDN A;  5C4J J;  5KHD A;  3WGI A;  4X06 A;  1G4D A;  3N05 A;  3SJM A;  1QFY A;  3H35 A;  3LQ6 A;  3LSJ A;  3QRF F;  1O8E A;  1B72 A;  1F4K A;  2ZL7 A;  1HW5 A;  2HU9 A;  1FOX A;  1E3P A;  3OYH A;  2C5B A;  1IUF A;  2DYR H;  5ICG A;  1HKT A;  1WFX A;  3FM3 A;  2EFO A;  3PUF A;  1KK0 A;  3VMF A;  1SFX A;  4G7O F;  4O6J A;  4HLX A;  1Z6T A;  3EUH C;  4WWC A;  4V19 K;  3HAG A;  3JU4 A;  3BG7 A;  1H42 A;  4PGG A;  4UZE A;  5IT9 Z;  2K3F A;  2WY8 Q;  4K1X A;  3WBJ A;  3I3L A;  4RGR A;  1G3T A;  5IP7 J;  1ZM4 A;  1ZAR A;  4MQV A;  2NST A;  3JTG A;  2FNA A;  4DBR A;  4O5V A;  4CCL A;  3B90 A;  4TKO B;  3F6V A;  4Z4S A;  4ZYA A;  3T9G A;  1UB9 A;  4LC0 A;  4HG2 A;  1OCP A;  4C3H J;  2PI0 A;  3E20 A;  2LTP A;  4B47 A;  3OYD A;  2RQQ A;  5A88 A;  3LAP A;  3AL0 C;  5F0F A;  2VBW A;  3JR9 A;  4NK8 A;  3FXQ A;  4JOM A;  4OAY A;  2ZTG A;  5FA6 A;  3H9J A;  4B43 A;  2DMN A;  3T8T A;  3PO2 J;  1USS A;  3QOE A;  5F0C A;  1V4R A;  3CP2 A;  2FBK A;  1G7S A;  1PE9 A;  3Q38 A;  2DT7 B;  1UAA A;  4AF6 A;  3CC2 I;  3CTA A;  2DTZ A;  2YUH A;  1OIS A;  3PSZ A;  4M4S A;  3P7N A;  3QFR A;  1FIP A;  3H5R A;  3SKB A;  1A04 A;  4I99 C;  1YE9 A;  3SEQ A;  3U1D A;  1FNM A;  3RKQ A;  3Q6Q A;  3DU5 A;  4PJ0 C;  3GTO J;  1E3X A;  3LST A;  4OOS A;  2EV5 A;  4Y7C A;  2X0L A;  4XOR A;  2JZY A;  4IOC F;  2GZW A;  3WHC A;  2IGM A;  1FP1 D;  2VJJ A;  2KIQ A;  3MEX A;  1KMH A;  3A8J A;  1A6Q A;  1M1K D;  2P3M A;  1Z1D A;  4YG2 F;  4Y33 A;  4UB8 C;  1T2K A;  1FWZ A;  2XKP A;  1YLO A;  3ZQQ A;  2JJ2 A;  1KON A;  3RDI A;  4OIQ F;  1OFE A;  5D5W B;  2I5U A;  3LO8 A;  2IGN A;  3DTK A;  4CA0 A;  4FHT A;  1UD4 A;  4BQN A;  3GVJ A;  3PNY A;  1YW9 A;  3SYJ A;  1SFK A;  3B4N A;  1S29 A;  1ZHF A;  2A6E F;  5K7Z A;  1W0T A;  4YIF A;  2J8I A;  2IA2 A;  3CC4 I;  2OZ6 A;  1VQ5 I;  1QH0 A;  3ASN H;  3PJR A;  5KNL A;  1W7P A;  2BBY A;  1X1A A;  2DJI A;  5JVG F;  3P27 A;  4P2N A;  1ZR2 A;  1IC8 A;  1BI3 A;  2QUF A;  4FAS D;  2GJK A;  4P3I A;  1F20 A;  2P0W A;  3OAA A;  2O0Y A;  1JKQ C;  3AVX A;  4X7C A;  4E7J A;  3WE3 A;  1XSD A;  1VZ0 A;  4G6T B;  1I39 A;  3S2W A;  3GVL A;  3OSF A;  3SXY A;  5ICC A;  3ASP A;  3VO1 A;  3VNU A;  3TO7 A;  4RB1 A;  2VIX A;  1T39 A;  3CC2 B;  1R22 A;  5AON A;  2STT A;  2GA2 A;  3KP5 A;  4DYC A;  2LK2 A;  1GHC A;  1RI7 A;  1WOS A;  3GWZ A;  2IRF G;  1JA1 A;  2NZM A;  4MEY F;  4OU0 A;  1VF9 A;  3BR2 A;  2NT9 A;  4QUZ A;  1WSR A;  4NQW A;  2OCC H;  1Y0Y A;  1OCR H;  1QNT A;  1JRG A;  4XKV A;  4HQE A;  1EP3 B;  3FMS A;  1DGW Y;  4JRA C;  3LSP A;  1XB4 A;  5CLS A;  3QSY A;  2OJE D;  1BIB A;  5LRR A;  3RCO A;  3OWT A;  4GCV A;  1EFC A;  3L00 A;  5HLG A;  1DG1 G;  4FN5 A;  4D9J A;  3K4J A;  2V9P A;  1BI0 A;  2DJN A;  2VBM A;  1R5I D;  1JJ8 C;  3ECH A;  3COA C;  2HR3 A;  2VPL A;  2PMZ N;  1DPR A;  1T56 A;  4B4C A;  4PAB A;  1WPK A;  4M6Y A;  3FXO A;  2M4G A;  1R5H A;  2XPU A;  1T38 A;  1HZE A;  2F4M B;  1ZLJ A;  1O8J A;  3WY9 A;  4LB6 B;  2DCE A;  2ZME A;  4RAG A;  1WJC A;  2QGG A;  2CSO A;  4WZL A;  4IOA F;  2YX4 A;  3SY2 A;  1FRQ A;  3VSV A;  3HTS B;  2X48 A;  1X3U A;  2V9K A;  2RNG A;  4G6D A;  1D5V A;  1IN8 A;  1J09 A;  2CUJ A;  2JUG A;  2LRE A;  1X19 A;  3CC4 B;  1VQ5 B;  2FD5 A;  1NBM A;  2W1O A;  3VOD A;  4IVN A;  4UUV A;  2JN9 A;  2P81 A;  4L0Z B;  3GVK A;  5DM6 F;  4KDP A;  5FO5 A;  2K85 A;  4XIC A;  2IAI A;  3BG9 A;  5BS6 A;  2LF8 A;  1P4X A;  3KYD B;  1WJA A;  3V4G A;  3LL7 A;  4DZP A;  1QRC A;  5GAH J;  1BPL A;  2XTW A;  1WHU A;  2QM3 A;  3K9T A;  3U6B A;  3I64 A;  2XAU A;  1WQ2 A;  2GQQ A;  3JRI A;  4EJU A;  1VQK I;  1KU2 A;  4XON A;  1U9O A;  4ZDP A;  3OKX A;  2L7Z A;  3B6C A;  3HUG B;  3M07 A;  1JGG A;  1QG0 A;  1QUE A;  1KU7 A;  1W0J A;  2XZP A;  5IK2 A;  5IYQ A;  3U21 A;  1IJF A;  2DK8 A;  2ZBV A;  2ECC A;  2JRM A;  2XSJ C;  4RS8 A;  1LFU P;  2HGC A;  4RCZ A;  1YRN B;  4EJO A;  2EZK A;  1FSE A;  3ABL H;  4R79 A;  4BJ6 C;  2XVC A;  1FZP B;  1LLW A;  2BPO A;  4XOP A;  3S15 J;  1OMI A;  2VPR A;  5HDK A;  4BNC A;  2XUB A;  2R7R A;  2HOT A;  1YW7 A;  1K6O A;  2OAZ A;  1FOW A;  1Z6R A;  2VJI A;  2VYQ A;  3CJN A;  2YS9 A;  2E71 A;  1MKM A;  2DBB A;  1ETX A;  2IP2 A;  5L3D A;  3BTC A;  1QX4 A;  3DQV C;  3IKV A;  1NRK A;  1HDP A;  4K2E A;  4CCJ A;  3SFI A;  1OFM A;  4MXN A;  2F4I A;  2Q6L A;  1KD1 D;  1D8T A;  4PC7 A;  1PUF A;  1Z05 A;  3M8E A;  3S32 A;  2R5Z A;  3FKJ A;  4ZH4 F;  3TW7 A;  4EAT A;  4IJA A;  1XN7 A;  1ZGA A;  2KT0 A;  3GUD A;  4YFX F;  4KIS A;  4RD6 A;  4G6Q A;  2DOG A;  5FFZ A;  3N6Z A;  2XB5 A;  2BHZ A;  2M45 A;  3KZY A;  1JE8 A;  4UNO A;  1OCC H;  3LA7 A;  4RLF A;  1Y56 A;  2NVY J;  2QBY B;  2R7Z J;  1G7T A;  1Y0R A;  2ZZE A;  1W5C C;  1W5S A;  4XRS A;  1T6S A;  2DCU A;  4B4D A;  1ACI A;  1O4X A;  3PA1 A;  5GPC A;  1BHE A;  4ZYD A;  2M5W A;  2CND A;  4FT8 A;  3CB4 A;  1QU3 A;  4KJZ A;  1OJL A;  3SFZ A;  2BMW A;  1VQK B;  2FX0 A;  2YU9 J;  4B09 A;  1R5B A;  1XDS A;  1BA5 A;  1S72 I;  4LG0 B;  2VFP A;  2O8K A;  3JRF A;  1L3L A;  1S4M A;  2R93 J;  2IS4 A;  2L4M A;  3GVA A;  2ZL5 A;  4CQJ A;  2EA2 A;  3TL4 X;  1QA1 A;  1EFU A;  2Y75 A;  4MYT A;  3IRQ A;  3SDB A;  4J0Q A;  2OV7 A;  1GT0 C;  1KK2 A;  4M3G A;  4RMN A;  1VQ8 I;  4CDG A;  2VQC A;  3FK6 A;  2WAQ A;  4DW6 A;  1COW A;  3W2F A;  2DER A;  5DUI A;  2KDZ A;  1FOK A;  4HRI A;  4EJW A;  3S16 J;  4N9I A;  4X0G A;  2L5Q A;  3T56 B;  4Y7N J;  3K0L A;  4HNT A;  3MCA A;  3GFM A;  1LB2 A;  3KZZ A;  2Z3Y A;  1NJI D;  2VC0 A;  3OIP A;  4M3D A;  2Y69 H;  2INU A;  4FK8 A;  2Q2E B;  1XB2 A;  1I27 A;  4X0C A;  2WSS A;  2BF4 A;  2PFB A;  1UFM A;  3ELK A;  1D1A A;  5DCF A;  3BPV A;  5D5U B;  4Y13 A;  5DV5 A;  3TH0 A;  5KSW B;  1BI1 A;  4XKW A;  2OK8 A;  1DU6 A;  5HZB A;  2BGI A;  2EJR A;  3K69 A;  3VDX A;  1WSU A;  4G9Y A;  1VQO I;  1RIO H;  1CGP A;  5JVT A;  1AHD P;  4CHU A;  2A68 F;  1BLI A;  3RSN A;  2CYY A;  1HVX A;  1OGJ A;  3W2G A;  2B7E A;  3CP8 A;  4HDV A;  1SVM A;  1BQE A;  3QFC A;  5E3O A;  3AVV A;  2ID3 A;  3FHZ A;  1JKR C;  4NK6 A;  4XOT A;  2VT3 A;  2PN6 A;  3OYM A;  3DBR B;  3L7W A;  2E34 A;  1V5E A;  4BEH A;  2QTL A;  2EWE A;  2QXZ A;  2D1V A;  2EV6 A;  4A12 A;  2HVR A;  4OIP F;  5H6R A;  5FLM J;  5ILV A;  1VQ6 I;  4MYU A;  3FHN A;  3A8I A;  2RDP A;  3UNG C;  3S14 J;  1DPU A;  1K4Z A;  2QMU A;  2BGJ A;  5E18 F;  3BH6 B;  1KU3 A;  5C1E A;  2F5D A;  1S72 B;  1QZZ A;  5FRM A;  3ZZU A;  2WR8 A;  5DYM A;  1JKO C;  2O61 A;  4P6V F;  5FNZ A;  2K4J A;  3HIF A;  3K4M A;  1M1E B;  2BM5 A;  4FE7 A;  4W97 A;  1FPQ A;  2MA3 A;  1AKH B;  3UKG A;  1K78 A;  4XLC A;  1Q9S A;  3L2Q A;  4P12 A;  2ME6 A;  1VQ8 B;  1YFH A;  2MH9 A;  3B8H A;  3R6K A;  5E1X A;  3JSO A;  3HC7 A;  2X6X A;  4TSF A;  4X05 A;  2DFF A;  3OYC A;  3ZQL A;  5CKT A;  2NVT J;  4YXW A;  3WGG A;  4AIJ A;  3HSF A;  1HOM A;  1SC7 A;  4HPQ A;  3M4O J;  4XKC A;  5LGU A;  2ZJQ F;  1EF4 A;  3ZZT A;  2DOF A;  1REP C;  4WXD A;  1K9M D;  1SD6 A;  2CS3 A;  3F72 A;  1Q81 D;  2IVM A;  2GXA A;  1PP8 F;  2O17 A;  3I4P A;  4XN3 A;  5H6Q A;  4G7W A;  4EEF G;  2JVH A;  3J7Y J;  2DO7 A;  3CCJ I;  2CJJ A;  3HBL A;  4HQM A;  4HW0 A;  2H1K A;  3EYI A;  1VQO B;  3AVW A;  3OZW A;  3ZZ0 A;  3S1Q J;  2ADU A;  3ONY A;  1I18 A;  1UHS A;  5IPA A;  3ABK H;  4ITV A;  2NVU B;  3OYL A;  1ZM2 A;  1B72 B;  2BSP A;  2CUE A;  1OR7 C;  3ML6 A;  1RR7 A;  3ZUG A;  3F21 A;  4LGW A;  5FKK A;  1SD5 A;  5HLT A;  5D4R A;  4Q48 A;  1QQ1 A;  3BTI A;  4HAM A;  4II2 A;  2G7H A;  3A01 A;  2WJV A;  3GTM J;  3CQZ J;  1VQ6 B;  3CCV I;  2AXT C;  3ONU A;  3RYP A;  3GLX A;  1MBJ A;  3H3Z A;  2W48 A;  1UHW A;  1NHC A;  4A3M J;  2UV1 A;  1P2F A;  4XLA A;  3SJP A;  4G94 A;  3V7R A;  3VPR A;  5LEJ A;  2O8X A;  3VST A;  1ETQ A;  3KZI C;  3GQA A;  1XGO A;  3BG3 A;  1VLO A;  2L9R A;  4YII A;  3SLN A;  5FLV A;  2Z2S B;  2QCO A;  4BXU A;  1U5T C;  3CJR B;  3KEY A;  1HDD C;  2W6J A;  1C0W A;  2M0C A;  4OPS A;  2VBK A;  1RU4 A;  6PAX A;  2D2W A;  3FIW A;  4BYY A;  2EFQ A;  3E6D A;  3M8F A;  1YG2 A;  3Q5F A;  3CO6 C;  3P5J A;  1QO0 D;  1O3T A;  2O6G E;  1AIP A;  1YHQ I;  4AF7 A;  1CLW A;  3AK5 A;  2WWY A;  1HST A;  4OPO A;  1MD0 A;  3MWM A;  2R9V A;  3BR5 A;  1KK3 A;  4XRS G;  3BP8 A;  5FFX A;  3CMY A;  2HQA A;  3CUQ C;  2ZNZ A;  2ZJP F;  4N4N B;  4N9H A;  4CYC A;  2LD5 A;  1GV5 A;  3CCJ B;  3LSH A;  2DMU A;  5H20 A;  1R5N A;  4PGH A;  3KCC A;  4NB5 A;  3RKX A;  1GJR A;  1CNF A;  2CQK A;  4M3B A;  1KZH A;  2VQL A;  4BDZ A;  2QSH X;  4YAU A;  3GFL A;  3OY9 A;  2VKD A;  1XQB A;  4B3A A;  1VQ7 I;  1T33 A;  2H6C A;  4BE1 A;  2VNH A;  2JMW A;  2HCJ B;  1TC3 C;  4V2F A;  3LFK A;  1B59 A;  2JK3 A;  2A5Y B;  2WV0 A;  5J4Y A;  2D5V A;  1TBX A;  1KU9 A;  2ZSH B;  3GSI A;  3S2H J;  4I2O A;  1RWR A;  3GTL J;  1UST A;  1ZN2 A;  3CCV B;  1XC5 A;  3S8P A;  1IXC A;  1WKM A;  1E64 A;  1IRX A;  2O6W A;  2BM1 A;  5CJ9 A;  4Y4R A;  4BHC A;  3OYI A;  1NG6 A;  2Q6K A;  2J5P A;  4EW9 A;  2ME0 A;  1UD3 A;  5FLX K;  2WAQ N;  2Z5U A;  4YZX A;  2F1L A;  4BJT A;  5EGO A;  1VF7 A;  4URR A;  2ZFU A;  1GVH A;  2KRH A;  4QWQ A;  3GX4 X;  1WTH D;  3CXC B;  2ESH A;  3MKZ A;  4J19 A;  1W7P B;  3FXL A;  3VOE A;  3WE2 A;  1G6N A;  4I0A A;  1R4M B;  2OBP A;  2LKP A;  4C0S A;  2IA1 A;  4ASN A;  3BRO A;  3TOB A;  2O0V A;  1LE8 A;  2RRE A;  2WB1 N;  5HOD A;  4TMW A;  1OQY A;  1YHQ B;  3H9N A;  4YCQ A;  3R6S A;  4OOI A;  2VBT A;  1I8D A;  1MJ9 A;  1QGZ A;  2XAG A;  3DXJ F;  3F6O A;  3DBL B;  1R1T A;  2PQ8 A;  1LEB A;  4YFN F;  1X1P A;  1H0M A;  1IRG A;  1P6R A;  2LVS A;  2L9N A;  3HOX J;  4NQW B;  4I6Z A;  2BM4 A;  4DQL A;  2V7F A;  4AIK A;  2O7O A;  1TZL A;  2GXG A;  2X51 A;  1VQ7 B;  1EA3 A;  2XC1 A;  4GGG A;  1S5L C;  4JX6 A;  1TYX A;  3OV8 A;  3PUN A;  1A35 A;  4HEA 2;  2VL8 A;  1V54 H;  2H94 A;  1BC7 C;  3J7A Y;  2JPC A;  1NB9 A;  3GTJ J;  3NAR A;  3ZMZ A;  2QE7 A;  3WOD F;  4BKX A;  2VFO A;  2I8D A;  2CQ7 A;  3F23 A;  4OJL A;  1E3Z A;  5M5X J;  2JJ1 A;  1W9X A;  1O8I A;  1H9G A;  1ZEL A;  1IZ1 A;  3KP2 A;  3Q6R A;  3W2E A;  2ZME B;  5F4M A;  2LF7 A;  2COM A;  1QBJ A;  1K4T A;  2OTL I;  4O3M A;  3BCD A;  1F43 A;  1ON1 A;  3VSU A;  1N77 A;  3SEJ A;  3T53 B;  1K4S A;  3JAM Z;  1BL0 A;  1EFR A;  4QHY A;  1LM1 A;  3V8L A;  5DNS A;  4AYB A;  2PEX A;  3LQR A;  5FKN A;  1A36 A;  2V5I A;  2V1N A;  5LLQ A;  5J6X A;  1YJ9 I;  2JIZ A;  2K9N A;  1EFT A;  3WGH A;  1U78 A;  1P7J A;  1O8F A;  1FX7 A;  3WTX C;  3ERE D;  3ZP5 A;  1IN4 A;  3UR3 C;  3CPX A;  5DS9 A;  1VLY A;  3CC7 I;  1S9H A;  2RAE A;  3G05 A;  2XND A;  4F7D A;  4LG0 A;  3R0J A;  1VQ4 I;  1PUE E;  4B8X A;  3GF2 A;  3DPU A;  3H36 A;  3T51 B;  1VQ9 I;  1TTT A;  2YR2 A;  2CGP A;  1QCX A;  3ASS A;  2XNJ A;  2X6Y A;  4KUM A;  4OOV A;  1PJ7 A;  3GTK J;  4ESF A;  2E19 A;  2IBD A;  4U0Y A;  1H8H A;  1JTX A;  1O8M A;  5C1C A;  3DBH B;  2IA0 A;  1O3Q A;  5M5Y J;  1VHO A;  1KYW A;  1RC9 A;  1MIJ A;  2R6H A;  1HG8 A;  1GXQ A;  4X6A J;  4OJO A;  5LRS A;  3HTU A;  4LLG F;  2KKO A;  4H9G A;  4YHB A;  3NB2 A;  5H2F C;  1Z7U A;  3IAS 2;  1SMT A;  4IRG A;  5F64 A;  2CW8 A;  2W00 A;  2YWF A;  2YSR A;  4PJL A;  4HYE A;  4RB2 C;  1PUF B;  1HSJ A;  2KZV A;  3D5S C;  2E1M C;  2R5Z B;  1TW3 A;  4HE6 A;  4L9N A;  4X07 A;  4CCM A;  1DU0 A;  3BC9 A;  2OTL B;  4AM3 A;  1ZKG A;  1T98 A;  3L1P A;  2QZA A;  4G1V A;  5HLI A;  4KT5 C;  3W3C A;  1D8J A;  4X8I A;  2DW4 A;  4RPB A;  1MBG A;  3DU1 X;  2NNN A;  2DTR A;  3P26 A;  1G7R A;  2MW8 A;  1WI3 A;  1R00 A;  2M0M A;  4PDK A;  4NC7 A;  1MMD A;  4CXF A;  1YIT I;  1YJ9 B;  3CF2 A;  3Q9V A;  4L9V A;  4A6D A;  1R71 A;  2IT0 A;  1TNS A;  4HV5 A;  4M73 A;  5J8C A;  3JRC A;  3KLN A;  1SD4 A;  2NRA C;  4ZZD A;  1F36 A;  2VOD A;  2DYI A;  2EFG A;  5ICE A;  5FO1 A;  3CC7 B;  3G1O A;  3LWF A;  3BH7 B;  3RIQ A;  3AST A;  1VQ4 B;  1FYL A;  4Q4Z F;  1CQT A;  4F3Q A;  1YTY A;  1MBF A;  2X1C A;  2W7Z A;  1BR4 A;  4DBQ A;  1EE6 A;  5B3S H;  1VQ9 B;  1LLZ A;  5LMZ A;  3LAJ A;  3CCL I;  3ZPP A;  3K1N A;  3ESW B;  1ZTR A;  3OYJ A;  2ZIT A;  3MD2 A;  1T8I A;  4PFP A;  1OHH A;  4U7D A;  3KPH A;  1S7O A;  3REO A;  3B78 A;  5F4J A;  4ZCI A;  1TWH J;  2HOE A;  1HF2 A;  4BL0 B;  3PIO F;  4ASU A;  1IA5 A;  2CO5 A;  3GYH X;  4L0Y B;  4ABZ A;  3B73 A;  2R7U A;  1MSE C;  1WI9 A;  1Z7L A;  3PFY A;  2UVE A;  3EQN A;  4RM2 A;  1WP6 A;  1H8A C;  4UVC A;  4WX9 A;  1PJ6 A;  3MQ0 A;  4MR0 A;  2X4H A;  2LG4 A;  2E36 A;  5M3F J;  4G7Z F;  2BVM A;  3BOQ A;  1U0J A;  3NWT A;  5D6E A;  3FZV A;  2KRF A;  1TWC J;  3FBN B;  3TBI A;  3U2R A;  5CYV A;  5GTH C;  3LSI A;  4P22 A;  1GQ8 A;  3BCB A;  3CMM A;  4R71 A;  1FP2 A;  2ZBK A;  5JBQ A;  1P4W A;  2GIZ A;  3M1C A;  2XC7 A;  4FX4 A;  2UZK A;  4UZF A;  1IN7 A;  3MFK A;  4CCO A;  2CRV A;  4PC1 A;  2ESN A;  5H5J A;  1T08 B;  4BEH B;  1ENH A;  2ISZ A;  1YIT B;  4Z06 A;  1YJN I;  1T6Y A;  1W34 A;  2B0L A;  4UAJ A;  4OMY A;  4A3D J;  4GFB A;  1ODD A;  2P8T A;  2R5Y B;  2GAU A;  2HQ5 A;  2W84 A;  2VUM J;  5L3B A;  2FXA A;  2FRH A;  2L4A A;  4Q47 A;  2ECB A;  1KJZ A;  3MAJ A;  4HIZ A;  2XRL A;  4OIO F;  3KFW X;  4M0L A;  3CCL B;  2NNY A;  3JQR A;  2HQR A;  2JA8 J;  3W5H A;  3VFZ A;  4D0P A;  1K78 B;  5FKL A;  3K6G A;  3CW2 A;  1IHM A;  3VMV A;  2PMD A;  3AG3 H;  3N4M A;  2FE3 A;  5JLV C;  2X6O A;  5DM7 F;  3PQK A;  4E7H A;  2UXN A;  1U5T B;  2DN0 A;  3LMW A;  3DEW A;  4S05 A;  5J1U A;  1H8E A;  1UMQ A;  4IF4 A;  3CCS I;  1HLV A;  2HFH A;  1G3W A;  2XAQ A;  3ZR8 X;  3G4S I;  1KRH A;  3K4B A;  3W2I A;  1SAX A;  2I10 A;  4ZYE A;  2VBE A;  1Z3Y A;  1ZGJ A;  1MBK A;  3CDH A;  1LVA A;  2EPF A;  3GW2 A;  4I02 A;  1PJR A;  1Q1V A;  1SM4 A;  4C9Y A;  1ON2 A;  2Y9Y A;  4W1U A;  3QYF A;  1DDI A;  1STZ A;  4AYB N;  1W36 D;  5F0H A;  1YYV A;  3MZH A;  2L54 A;  1BOB A;  1NH3 A;  1APL C;  4BE0 A;  1FNN A;  5GAG J;  3G71 I;  3HSR A;  4MEX F;  1IF1 A;  1SKY B;  2QQ8 A;  3F9K A;  4EM2 A;  4I98 B;  4IHY A;  1BOA A;  2W85 A;  2R4G A;  3J80 Z;  4KYW A;  5TJJ A;  3A01 B;  1YJN B;  3WG9 A;  3ZMU A;  3LVB A;  1LJ9 A;  2G0Y A;  2XRN A;  1QA2 A;  4PC3 A;  1ZYR F;  4IW3 B;  3WND A;  3PM1 A;  3A0H C;  2O9L A;  2UUZ A;  3ZOB A;  2O5R A;  5IYP A;  2OQR A;  1J7K A;  1N8R D;  4BPR A;  1YX5 A;  5E3N A;  2P5V A;  1SEU A;  2GJP A;  3AAF A;  4PZJ A;  4MGR A;  4ANJ A;  4IQ4 A;  1GUU A;  3GQ7 A;  2Z16 A;  4BBR J;  4D1Q A;  2DA7 A;  4BXF A;  3ZSC A;  4XLF A;  1YLF A;  4E6K G;  3S3O A;  4OPW A;  2KLO A;  2UWM A;  2NOJ B;  1MMN A;  3CMA I;  2NTP A;  2Q6O A;  5IYW A;  3CZ6 A;  5C44 J;  2M4K A;  3OFN A;  1IV8 A;  4PFO A;  2J7K A;  1K5C A;  1XPX A;  3DLL F;  3J7A O;  1B9M A;  3K2A A;  3VYU B;  2E5Z A;  2OZU A;  1FBQ A;  2FUG 2;  4ZCL A;  3CCS B;  2V4D A;  3G4S B;  1XCB A;  2JUC A;  3Q3S A;  3RPQ A;  4ZTJ A;  5IP9 J;  3SZG A;  1XDU A;  3OZV A;  2JSC A;  4RM0 A;  5LHH A;  1TLL A;  3OSG A;  1BJK A;  2B7C A;  4CYC B;  5L3E A;  3I59 B;  3AVY A;  5J1R A;  3JRH A;  3OW2 B;  1YJW I;  4QFM A;  5DDG A;  5DSZ A;  1MSF C;  5E1Z B;  4RD2 A;  5BPI A;  1FYK A;  5TY0 A;  5IYR A;  2NTB A;  3HOW J;  3A0B C;  1IDY A;  1JT6 A;  2YWG A;  3G71 B;  2K9M A;  1D0Z A;  5J47 A;  5CVV A;  1NHA A;  3ZQF A;  5ICF A;  5HOO A;  2FNP A;  3F22 A;  3SHF A;  4Y9R A;  3SQN A;  1V5G A;  4Z4V A;  4CZC A;  2N8G A;  1QUF A;  3LMM A;  2EFW A;  5ILU A;  3HPH A;  4HZF A;  1TWF J;  3CCY A;  2ACJ A;  1GAQ A;  2A05 A;  4RD1 A;  3VYT B;  5B6I A;  2DDB A;  2VI6 A;  1V0E A;  3BZC A;  2L7M P;  3I54 A;  2WC2 A;  3N97 A;  4L18 B;  2E1R A;  5EGO B;  3U6K A;  3PO3 J;  3ZCO A;  1Y0U A;  2L2O A;  2QDX A;  3CMA B;  4NNJ A;  3SDG A;  4W8R A;  1D3Y A;  2EIM H;  3KEO A;  2QX3 A;  4LD5 A;  4HLY A;  1BW6 A;  2F6C A;  2OC6 A;  1G3S A;  2XDV A;  3BJA A;  4A3F J;  2CQN A;  1LE8 B;  1JI8 A;  3J81 Z;  2D3L A;  4EJV A;  1FND A;  2LC2 A;  4HX8 A;  4L8J A;  3WWG A;  5IY5 H;  3K7A J;  2MAB A;  4RAF A;  2TCT A;  3KYC B;  5ED4 A;  3DPT A;  3JRE A;  1GVJ A;  2YPR A;  2LR8 A;  4LBW A;  2EA4 A;  1DAR A;  1P7I A;  4WK8 F;  2MC3 A;  3A8K A;  5BOX A;  4N4O B;  1OFD A;  4UB6 C;  1WJF A;  5DD4 A;  2PBI A;  1YJW B;  3DTE A;  4OP7 A;  5D5X B;  4PCQ A;  3E1S A;  2F48 A;  1O8K A;  1I7P A;  4NC6 A;  2VZL A;  1SD7 A;  3HKZ A;  3M1E A;  3H92 A;  4BJ5 C;  1UZC A;  2VJ4 A;  2BHY A;  3BR1 A;  4PSW A;  1HA3 A;  4N3G A;  1MDM A;  2VXZ A;  2Y0M A;  1OOC A;  3DCF A;  1MMG A;  2M1B A;  2XEX A;  4G7X A;  1LDJ A;  2RC5 A;  4KKT A;  3MHP A;  4M9S A;  2JA2 A;  4LLN A;  2DA1 A;  2KIU A;  3FMQ A;  1F9N A;  1I6X A;  1LUJ B;  2VAS A;  2BSA A;  3ASO H;  2RC4 A;  4E7K A;  3WU1 B;  4AC0 A;  1HF0 A;  4PK4 A;  4BU2 A;  3ISP A;  1ULY A;  4XLP F;  5E17 F;  4B3F X;  3W2A A;  2R92 J;  3KIO A;  2LOO A;  3BLY A;  5FRO A;  4MFD A;  1X3Z B;  3B8Y A;  2V7U A;  2XT4 A;  4X7E A;  2HTJ A;  2R7F A;  1QA3 A;  2CV0 A;  2E1M B;  2A07 F;  3OIO A;  4EGZ A;  4A3C J;  4Q7J B;  3HXL A;  3QQA A;  3LQQ A;  1D8K A;  4P55 A;  2YWH A;  2P7C B;  1KQS B;  4ENK A;  1IN5 A;  3HRS A;  3ZRG A;  2KZG A;  5IP6 A;  3VYS B;  1KTV A;  1TVC A;  2DAO A;  2M8E A;  1K8A D;  1HBX G;  3RQ4 A;  1XMK A;  2EZL A;  4C2M J;  1O7L A;  2B9S A;  3ES9 A;  2DYS H;  2O3F A;  2DXI A;  3QPS A;  4OMZ A;  3RKW A;  4KA4 A;  3IH4 A;  5IT3 A;  4EJT A;  3FKS A;  2BY3 A;  1EXM A;  3TP3 A;  1X2N A;  3ULQ B;  2OBT A;  4W8S A;  4BY7 J;  1BN5 A;  2XF6 A;  2M3A A;  3IH3 A;  4ENJ A;  5KAF C;  3DP7 A;  4G5G A;  1OGO X;  2PEC A;  3GQB A;  2A6H F;  2OD5 A;  4OZZ A;  4IPA A;  1WVR A;  3HZJ A;  5EEH A;  2WJY A;  1FSH A;  3LA3 A;  3C2H A;  2HKX A;  2NOG A;  2QTZ A;  3F8M A;  1WOO A;  4XR6 A;  1ETV A;  2V26 A;  1JHF A;  1BIA A;  2MH2 A;  3R0A A;  5GAD J;  3E5U A;  3I56 I;  1FNC A;  4YAF A;  2ELJ A;  4KIT B;  2X3U A;  2NXN B;  4OJ5 A;  3MKY B;  2CW5 A;  5IYB J;  2WPD A;  1QZE A;  1KYZ A;  3E6B A;  4IQJ A;  2LY9 A;  3T8R A;  1IG7 A;  3RQI A;  4IHV A;  5KK1 A;  1ETK A;  1QGA A;  3I55 I;  2V6E A;  3LQE A;  4F93 B;  2XPW A;  2EZH A;  2PMH A;  2JPB A;  4GXO A;  2VFN A;  1T0F A;  1OLT A;  1TUI A;  5HDN A;  3ZPL A;  1FTT A;  3GLL A;  1PKV A;  4Y9U A;  2E2I J;  2YWE A;  4P9F A;  3GTP J;  3OS2 A;  2JDI A;  1O8G A;  1JKP C;  4PAA A;  2V7X A;  3QFT A;  4EV0 A;  3OE7 A;  3A02 A;  1DDG A;  1NTC A;  3W6V A;  2RQP A;  1E43 A;  1OR7 A;  1N06 A;  2GM4 A;  4ZGN B;  1MH4 A;  1QPM A;  2X85 A;  2VQG A;  4WF2 A;  1H9T A;  3CD6 I;  5K5O A;  2R5Y A;  1B8I A;  4TN1 A;  4P9S A;  4B1R A;  1MND A;  5GTI C;  4HF1 A;  2ZZQ A;  2LBF A;  1I3Q J;  3EQL F;  3EPZ A;  1X1B A;  4E7Z A;  1AOY A;  1F60 A;  1HCR A;  3IC7 A;  4HOB A;  4PUS A;  2Y48 A;  1WJE A;  4OM9 A;  5E3M A;  2VBZ A;  2GLO A;  1S7A A;  2FOK A;  4FIS A;  1XSX A;  4LK1 F;  1RUN A;  2XAF A;  2HZD A;  2M5S A;  2ZC2 A;  3W2H A;  1OCT C;  1B1B A;  5B1A H;  4FX0 A;  3H5A A;  5A2Q K;  3OYN A;  1LDD A;  3GFI A;  2VNJ A;  4L5J A;  2VT2 A;  1EWY A;  1D5Y A;  5EMN A;  1U5T A;  1FDR A;  2A5W A;  3V42 A;  1MBE A;  2LRD A;  1RQR A;  4ZV4 A;  3HOU J;  4HF0 A;  3CLO A;  2MG4 A;  1PP7 U;  3AL0 B;  4ESB A;  1TL8 A;  1WH5 A;  3KP6 A;  4LK0 F;  5DUK A;  3ZQ7 A;  2IGO A;  1Q1H A;  2A61 A;  2RVC A;  3GZ5 A;  4XRF A;  3D1N I;  5AMV A;  4YZ0 A;  1GV2 A;  4IXA A;  2QSG X;  5D5V B;  4M3E A;  3F0C A;  3K2Z A;  1TQM A;  1T0F C;  3QOD A;  4JQF A;  2L01 A;  3I55 B;  1HA8 A; 
#chains in the Genus database with same CATH homology
 3WQZ A;  3EQO A;  4I84 A;  1ZEL A;  2BVL A;  3EUH C;  3GBG A;  1OB0 A;  2NTQ A;  3KEW A;  4GRI A;  3HAG A;  3JU4 A;  3BG7 A;  5KCM A;  2WY8 Q;  3VR6 A;  3I3L A;  3BCD A;  3LSM A;  4IKF A;  1LFP A;  3L2R A;  2E1B A;  2NST A;  3VSU A;  2PJR A;  3HG9 A;  4DBR A;  1N77 A;  2GK7 A;  4CCL A;  2AQE A;  4TKO B;  1WPC A;  3T53 B;  1EFR A;  3B90 A;  3VSK A;  3K70 D;  4ZYA A;  2Y0S A;  4AYB A;  3T9G A;  3AFH A;  4NC8 A;  4HG2 A;  2V1N A;  2D3N A;  4B47 A;  3OYD A;  2RQQ A;  2JIZ A;  4B48 A;  3AL0 C;  3VMW A;  3OL4 A;  1O8F A;  4NK8 A;  3HOT A;  4JOM A;  3UR3 C;  2M7B A;  2VXD A;  2X6W A;  4OAY A;  2ZTG A;  3LFU A;  2X1E A;  2ODL A;  3H9J A;  4B43 A;  3MKW B;  1VLY A;  2ZXH A;  1S9H A;  3G05 A;  1V0F A;  2XND A;  3S3M A;  3QOE A;  4W8Q A;  4PJN A;  2Q1Z B;  3CP2 A;  3DPU A;  2E5N A;  1PE9 A;  2AQF A;  2DT7 B;  3VYR B;  1UAA A;  2X53 S;  3L2U A;  1Y6I A;  3T51 B;  3OYE A;  2KDO A;  3ZPN A;  1QCX A;  3QYB A;  2HPI A;  4XN0 A;  2X6Y A;  2F43 A;  2DIE A;  3H5R A;  1N78 A;  1UD8 A;  3SEQ A;  1YE9 A;  1DGR M;  3FBI B;  1H8H A;  1O8M A;  2IS1 A;  5C1C A;  3DU5 A;  1E3X A;  1O88 A;  3PL8 A;  4XOR A;  1Z3X A;  5FL7 A;  1HG8 A;  1FX0 A;  2IGM A;  2VJJ A;  2WBM A;  4OJO A;  1KMH A;  4Z03 A;  1UEL B;  3DKY A;  3IAS 2;  1T5E A;  4BDY A;  4PJJ A;  2CW8 A;  2W00 A;  4Y33 A;  3HL2 A;  4PJL A;  3OOU A;  2CH0 A;  4CCN A;  3ZQQ A;  2JJ2 A;  1KON A;  2KZV A;  4BE2 A;  3DLA A;  3D5S C;  3L2V A;  2CUZ A;  2E1M C;  4DGW B;  2Z1D A;  4PJM A;  1KCC A;  3VSL A;  4CCM A;  2IGN A;  5LFA A;  3BC9 A;  3DTK A;  4CA0 A;  3H9G A;  1UD4 A;  4BQN A;  3GVJ A;  3PNY A;  3KYL A;  2GJR A;  4XKB A;  1X1C A;  1SFK A;  3SEZ A;  3B4N A;  3W3C A;  1E0E A;  2XF5 A;  3OS0 A;  3OOC A;  3BCA A;  2X1D A;  1RMG A;  3W2V A;  3PSI A;  1W0K A;  2M0M A;  4ZDL A;  3PJR A;  4NC7 A;  5HVQ C;  5KNL A;  1KCD A;  1MMD A;  1X1A A;  2DJI A;  3OIQ A;  4LIV A;  2XGJ A;  2DT6 A;  3CF2 A;  3DTI A;  4FAS D;  2GJK A;  4OJP A;  2P0W A;  3OAA A;  4XD7 A;  4MLO A;  3UW0 A;  4E7J A;  1VZ0 A;  4G6T B;  4F3Q A;  2BOL A;  2HVS A;  3GVL A;  1X4P A;  1KTW A;  2X1C A;  4C2L A;  1BR4 A;  2VIX A;  3E0J B;  2F5V A;  4DBQ A;  3RPU D;  1EE6 A;  2UVF A;  4U4B A;  2NZM A;  3ZPP A;  4C30 A;  3PUB A;  1VJS A;  2NT9 A;  3OYJ A;  3D5L A;  3MD2 A;  3OEH A;  2WB1 A;  4F52 A;  2W82 A;  1JRG A;  4PFP A;  4XKV A;  1OHH A;  1DGW Y;  3A3G A;  4U87 A;  2O1D A;  4HST A;  1N75 A;  4BL0 B;  3H94 A;  4ASU A;  3RCO A;  3OWT A;  4DJA A;  3OS1 A;  3S3N A;  3KRG A;  1IA5 A;  4Y3O A;  2R7U A;  1E79 A;  1Z7L A;  4XNF A;  1LVK A;  1QHH D;  4D9J A;  3K4J A;  3PFY A;  3GQ9 A;  2UVE A;  4DNR B;  2ZXI A;  4RM2 A;  2VBM A;  1WP6 A;  3EQN A;  2VPL A;  4BUP A;  2ZZF A;  4MR0 A;  2LG4 A;  2M4G A;  1NG7 A;  2BVM A;  1U0J A;  3NWT A;  1HZE A;  1O8J A;  3FBN B;  3TBI A;  2DCE A;  3BCF A;  1WJC A;  4DK0 A;  3LSI A;  4P22 A;  1GQ8 A;  3BCB A;  3CMM A;  3K4K A;  3VWB A;  3VSV A;  3M1C A;  2XC7 A;  2V9K A;  2RNG A;  1J09 A;  2CUJ A;  2JUG A;  2LRE A;  1X19 A;  2GK6 A;  4CCO A;  4QPO A;  1NBM A;  2CW7 A;  2W1O A;  1K6Y A;  2R7T A;  3GVK A;  4BEH B;  1H80 A;  4Z06 A;  2JSP A;  1G59 A;  2XF7 A;  1WJA A;  3LL7 A;  1TT0 A;  3A1Y A;  4PSX A;  1BPL A;  4LIU A;  2XAU A;  1DQU A;  2V4J C;  4XON A;  5CDF A;  4ZDP A;  3H9Q A;  4CUG A;  3OYG A;  3HUG B;  1X4O A;  2R7X A;  1W0J A;  2XZP A;  3DDY A;  4HIZ A;  5IK2 A;  3U21 A;  2R7W A;  1MAB A;  2CFO A;  3IUO A;  2XSJ C;  2ZSI B;  3K6G A;  4E4H A;  3VMV A;  4OAZ A;  2R7S A;  4R79 A;  4E7L A;  1UG0 A;  4BJ6 C;  1MW7 A;  2MD0 A;  4BQQ A;  4E7H A;  2R7V A;  4XOP A;  3C2G A;  2ZZG A;  2K3P A;  2VB6 A;  3OMY A;  2IS2 A;  2R7R A;  3LNN A;  2W6I A;  3LMW A;  3EUK L;  1IDJ A;  2VJI A;  1H8E A;  2KQR A;  3NE5 B;  1IB4 A;  1V5F A;  2HLD A;  3ZR8 X;  3K4B A;  4BGD A;  1IDK A;  3DQV C;  4XMY A;  1Z3Y A;  4YEJ A;  1UD6 A;  1NRK A;  4KKS A;  2XZL A;  2VBE A;  4CCJ A;  1OFM A;  1PJR A;  4MXN A;  2F4I A;  4C9Y A;  4C2T A;  3QYF A;  4HSR A;  1DBO A;  1W36 D;  2V7Q A;  3S32 A;  1BR2 A;  2XZO A;  4B3G A;  3FKJ A;  2L7K A;  4EAT A;  1BOB A;  1WJB A;  3FPP A;  4BE0 A;  4KIS A;  3PSF A;  1SKY B;  4YEL A;  3F9K A;  3TMO A;  2LY2 A;  3CJQ B;  3OYB A;  3GQ8 A;  3OPO A;  1PXZ A;  2R4G A;  3ONQ A;  1Y56 A;  4RLF A;  2ZZE A;  1UD2 A;  2KRC A;  2L9S A;  1E1Q A;  4G6I A;  4F92 B;  1BHE A;  1FMV A;  3OR2 C;  2UUZ A;  2O5R A;  2GOM A;  3PNT A;  3DU6 A;  4XM3 A;  1YX5 A;  1QU3 A;  3SUC A;  4KJZ A;  3ZXS A;  2GJP A;  4ANJ A;  1YX3 A;  4IQ4 A;  2JVG A;  1LDK B;  3GQ7 A;  4F91 B;  2Z16 A;  4D1Q A;  3LSG A;  4W8T A;  4BXF A;  4B3X A;  3ZSC A;  4XLF A;  3S3O A;  4E6K G;  2IS4 A;  3K70 C;  5HKK A;  5TGT A;  2KLO A;  3TL4 X;  2UWM A;  2NOJ B;  1MMN A;  2NTP A;  3SDB A;  3CZ6 A;  2OV7 A;  3W2W A;  3HOS A;  2M4K A;  3BH4 A;  3OFN A;  4RMN A;  4UZU A;  4E0F A;  2VQC A;  2WAQ A;  4II3 A;  4QPQ A;  1COW A;  4PFO A;  4U49 A;  3AKZ A;  1K5C A;  4HRI A;  1D1B A;  4X0G A;  2L5Q A;  1Z21 A;  3T56 B;  4HNT A;  1PLU A;  3VYU B;  4RLQ A;  4E7I A;  2E5Z A;  4YRV A;  3OIP A;  2FUG 2;  2INU A;  2V4D A;  2Q2E B;  2O04 A;  4ZTJ A;  3HPG A;  2IGK A;  3DWL E;  3SZG A;  2W4S A;  3RTR A;  2WSS A;  1D1A A;  3MMY B;  2VJ5 A;  4XKW A;  2BW3 B;  1O8L A;  3H5N A;  3VDX A;  2WZP P;  4DK1 A;  1JTA A;  3OR1 C;  2INV A;  1BLI A;  2NTB A;  2GOX B;  3RSN A;  1HVX A;  2HNH A;  2OUM A;  2PYH A;  2K9M A;  1D0Z A;  3CP8 A;  2WY7 Q;  3K4L A;  4LG3 A;  4IZZ A;  4F55 A;  2PMZ A;  4P1W A;  5HOO A;  4NK6 A;  4XOT A;  1QHG A;  3OYM A;  2HDW A;  4DIQ A;  3OYA A;  2WA0 A;  3ZIA A;  1MNE A;  2CV2 A;  1V5E A;  4BEH A;  1V5G A;  1BR1 A;  3QYE A;  3ZGK A;  2EWE A;  2JJ1 A;  2QXZ A;  2HVR A;  4OZY A;  4CZC A;  4XLH A;  4OJ6 A;  3LMM A;  4XQF A;  3DEE A;  4XLE A;  3HPH A;  2CMP A;  3FHN A;  1FMW A;  1O8H A;  2CV1 A;  3K10 A;  3UNG C;  2PYG A;  3CES A;  3VYT B;  5C1E A;  1T95 A;  1V0E A;  2X3H A;  4FET A;  5FRM A;  1BMF A;  1K28 D;  3H0D A;  1D1C A;  2O0W A;  4GQN A;  3K4M A;  3ZCO A;  4P5O A;  4OWR B;  2L2O A;  5CQG A;  4NNJ A;  4XLC A;  4W8R A;  3L2Q A;  2F1M A;  2QX3 A;  4AU7 A;  2F6C A;  3HC7 A;  2X6X A;  2OC6 A;  3K4C A;  4TSF A;  3OYC A;  2XDV A;  5CKT A;  4YXW A;  1JI8 A;  1UD5 A;  2LBF B;  2D3L A;  4HPQ A;  4L8J A;  2LC2 A;  3K4N A;  3WWG A;  4XKC A;  3A2K A;  2XOK A;  2MAB A;  1XG2 A;  1D0Y A;  3DKX A;  3DPT A;  2WAE A;  4CH7 A;  2CS3 A;  2LH9 A;  2O17 A;  2LY1 A;  4N4O B;  4XN3 A;  2W7N A;  4J00 A;  4G7W A;  4E7S A;  2JVH A;  4J01 A;  1WJF A;  3DTE A;  1LKX A;  4U7B A;  4KKU A;  2K9L A;  3E1S A;  1I18 A;  1O8K A;  3HKZ A;  4ITV A;  3OYL A;  4BAC A;  2BSP A;  4BJ5 C;  1OR7 C;  4TT3 A;  2VJ4 A;  2CK3 A;  4PSW A;  5HLT A;  1OOC A;  2VXZ A;  4BQO A;  1MMG A;  1O8I A;  4II2 A;  4G7X A;  2WJV A;  4KKT A;  4CCK A;  2JA2 A;  2WAD A;  2KP6 A;  3D5R C;  2VAS A;  4HWV A;  4C2U A;  1BN8 A;  2KHM A;  2LYC A;  2DOA A;  4E7K A;  2X8K A;  2VLA A;  4YZQ A;  4PK4 A;  4BU2 A;  4B3F X;  2E60 A;  3W2A A;  3B8Y A;  5FRO A;  2LOO A;  3BLY A;  3GRH A;  4B44 A;  1NHC A;  2UV1 A;  4XLA A;  2IXS A;  2KL4 A;  2CV0 A;  1DBG A;  2E1M B;  2PJR B;  3VST A;  3BC8 A;  3GQA A;  5CPR B;  5FRN A;  2HPM A;  3S93 A;  2Z8G A;  3HXL A;  2Z2S B;  4IX7 A;  3CJR B;  3KEY A;  2W6J A;  2Z6B D;  3M8J A;  1X0C A;  2VBK A;  3A35 A;  3ZRG A;  1RU4 A;  4DNT B;  3VYS B;  4KT6 A;  1D0X A;  1P9Q C;  3OW7 A;  2R7O A;  4BS9 A;  1AA7 A;  3RQ4 A;  5LD2 C;  1WJD A;  2IS6 A;  2NT6 A;  1VBL A;  4Z05 A;  2DXI A;  2V31 A;  2MFZ A;  3PNV A;  2R9V A;  3FKS A;  3L2W A;  1MMA A;  4ZJZ A;  1OFL A;  2HQA A;  2NSP A;  4W8S A;  4LIT A;  1OGM X;  4YZA A;  1CZF A;  1OGO X;  2XF6 A;  2M3A A;  4N4N B;  2PEC A;  2BW3 A;  3IP4 B;  3LSH A;  3GQB A;  3OEE A;  4OZZ A;  2KMU A;  2MYS A;  2HVQ A;  2WJY A;  1KZL A;  4BDZ A;  1WMR A;  2VQL A;  3C2H A;  4Z1M A;  3OY9 A;  2VKD A;  4BE1 A;  1PYV A;  3IAM 2;  4XR6 A;  1WJ5 A;  5HNF A;  2V26 A;  1GLN A;  3DPL C;  2ELJ A;  3G2B A;  4KIT B;  4OJ5 A;  3MKY B;  2ZSH B;  1ERD A;  2WPD A;  1R6R A;  3OYF A;  2ZTN A;  4IQJ A;  1RWR A;  3EUA A;  3S8P A;  1AIR A;  1IRX A;  2V6E A;  4NUB A;  5JHF A;  2K5C A;  4Y4R A;  4F93 B;  3OYI A;  1NG6 A;  1W36 C;  1E1R A;  4EW9 A;  4XL9 A;  1UD3 A;  1OLT A;  4ZTF A;  3OL3 A;  4RM3 A;  4JMQ A;  1PKV A;  1SAU A;  4YZX A;  3NWS A;  3OS2 A;  4BJT A;  1VF7 A;  2JDI A;  1O8G A;  4URR A;  2ZFU A;  3A4C A;  3OE7 A;  2KRH A;  2VKH A;  1E43 A;  4CSW A;  1WTH D;  4ZC3 A;  3MKZ A;  3LSK A;  2LZJ A;  2X85 A;  2VQG A;  4PMH A;  1MND A;  2QKL B;  2O0V A;  3A3B A;  2ZZQ A;  4FXU A;  2RRE A;  2LBF A;  4DOZ A;  2KPM A;  3I9V 2;  4E7Z A;  3EPZ A;  1X1B A;  3FDY A;  2QY1 A;  3JUR A;  1X1D A;  1I8D A;  4PUS A;  5DN6 A;  2M7A A;  1WJE A;  3OYK A;  1DP3 A;  3SYT A;  2QKM B;  1QJV A;  5HNH A;  2HZD A;  2M5S A;  3FY3 A;  2L9N A;  2WAF A;  3KX2 A;  4AVZ A;  1O8D A;  3BG6 A;  1G8X A;  3H5A A;  4NQW B;  3OYN A;  2V7F A;  5KHD A;  1TZL A;  2X51 A;  4HNU A;  3N05 A;  2R7Q A;  1EA3 A;  2A5W A;  4H4K C;  3V42 A;  2LRD A;  3H35 A;  2VQH A;  1O8E A;  2A6T A;  5CQE A;  3AL0 B;  2HU9 A;  2MC4 A;  2KVO A;  4HEA 2;  2VL8 A;  2IGO A;  3OYH A;  3J7A Y;  5AMV A;  4YZ0 A;  1WFX A;  2QE7 A;  2I8D A;  1T0F C;  3QOD A;  4JQF A;  2IQ7 A;  4OJL A;  1HA8 A;  1E3Z A;  4ZDO A;  1W9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...