4XLCA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlcA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlcA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlcA02
2O04A 4NK8A 4YELA 3VSVA 2O0VA 4XLAA 1BHEA 4URRA 2IQ7A 2ODLA 1DBOA 3VMVA 4YZ0A 1O8GA 2NZMA 2QX3A 4NK6A 4OZZA 5AMVA 1RWRA 2NSPA 2NTPA 1BN8A 3VMWA 2EWEA 3UW0A 4AVZA 4W8TA 2INUA 1IDKA 4XMYA 3B8YA 4XONA 1JTAA 4OZYA 1X0CA 1OGMX 4MXNA 4XOPA 3GQAA 1O8MA 2NTQA 4YZXA 3T9GA 3VSUA 4Z03A 1CZFA 4XQFA 4EW9A 1QCXA 4U49A 3ZSCA 4XN3A 1EE6A 2NT6A 3FY3A 1OFMA 4YZQA 1O8KA 3LMWA 3GRHA 4C2LA 1O8LA 2NTBA 2UVEA 3GQ7A 2X6YA 1OGOX 4MR0A 2X85A 1O8JA 2O0WA 5C1EA 2NSTA 4OJOA 2PYHA 3SUCA 2VJJA 2VBMA 4I84A 4XNFA 1O8HA 1O88A 4YZAA 4XLFA 1AIRA 1O8IA 3EQOA 3JURA 4XM3A 4XN0A 3B90A 2NT9A 1OOCA 4XR6A 4XKWA 1VBLA 2X3HA 4XLCA 3EQNA 1O8EA 1GQ8A 1QJVA 1WMRA 2O1DA 1XG2A 1PXZA 1KCDA 2VBKA 4OJPA 1K5CA 4W8RA 3GQ8A 3VSTA 4XLHA 3GQ9A 4XORA 2VBEA 1O8DA 4XOTA 4Z06A 4OJLA 3B4NA 1KTWA 2BSPA 4XLEA 1PE9A 3KRGA 1KCCA 2X6XA 1HG8A 2X6WA 1RU4A 4W8QA 2VJIA 4OJ5A 1IA5A 2QXZA 4XKVA 2QY1A 5C1CA 1JRGA 4Z05A 2Z8GA 1O8FA 1DBGA 2UVFA 1NHCA 1PLUA 3ZPPA 3WWGA 1OFLA 4OJ6A 4PMHA 2PYGA 4U4BA 4W8SA 4HWVA 1IB4A 1H80A 1IDJA 1RMGA 4XL9A 2O17A 2INVA 4YEJA 2PECA
chains in the Genus database with same CATH superfamily
4JQFA 4YELA 1WOSA 1MNEA 3ABMH 4PFOA 3SEQA 3HXLA 4EVIA 1VQ7I 2Z9OA 2IQ7A 3I9V2 2ESHA 3HOWJ 3L9FA 4RD2A 4G5GA 4CZCA 2PN6A 1BW5A 1R5OA 4GYIA 4GXOA 2DA1A 2QKLB 3BZCA 2O6WA 3H5NA 3CCJB 2C5BA 3NWTA 5LD2C 1QA2A 4X8IA 2HGCA 3HEFA 5KVRA 2ADUA 2RDPA 2YU3A 3G1MA 3JTHA 2IA0A 4A3LJ 1T95A 1ZM4A 5H6RA 5EEAA 1X2MA 3KYDB 2FXAA 3WXMA 1OKRA 4AD9A 2NV4A 2GXAA 3CCUI 1OCPA 2Y2ZA 1MBKA 3G71I 1SKQA 3BG9A 4PJNA 1IXSB 2K7LA 2H6CA 2Q0OA 5GAHJ 1XDUA 4BNCA 1P2FA 3ONYA 1I1GA 5CJ9A 2OF7A 3A02A 3SDGA 4Y3OA 3TQNA 3OYDA 4BY7J 2DK5A 2OQRA 3HUGA 5HVQC 1BLIA 1QQ1A 3K1NA 2Y9YA 3ZR8X 2P5KA 5LFAA 2E2IJ 2XTYA 1KQ8A 2IXSA 2L01A 2MSYA 3TO6A 4F92B 2R0QC 3E6CC 2MC4A 3K1PA 4U49A 1WWXA 4BQNA 4CDGA 2V7UA 2IW5A 2NT6A 1EFCA 2VFOA 3BY1A 4CCOA 1TNTA 1O4XA 2NTBA 5J35A 1WGXA 2QQAA 1SAXA 1JKOC 4MR0A 4IX7A 2QQ8A 2L9VA 2O0WA 2P6TA 2P81A 3FXQA 3QFRA 3BZ6A 5HXBA 4IRGA 2NVYJ 4FISA 5E1WA 3W5VA 3FMRA 5FB2A 2V26A 3PSIA 2MLKA 2G7HA 1V5FA 3FDYA 4UZFA 3OYIA 1FNBA 4XN0A 3HRMA 3IP4B 4PJMA 3U9GA 1HXDA 2GREA 1TUIA 3ASSA 3MMPA 2W85A 2OTLB 4RPDA 3CMAB 1F60A 3FZVA 1SFEA 3BJ6A 5TGTA 2ZXHA 4H4KC 3AL0C 1BMFA 3PUNA 1RNLA 1D1AA 1LVKA 4C30A 2ZJRF 3CRZA 1WTHD 3RY8A 4U0VA 1WJEA 4Z4VA 2K9QA 5KHDA 2VB6A 3CMYA 2RC4A 3R0JA 4XLEA 1PE9A 3DPLC 3T56B 5KAIC 3AGQA 2X6WA 1BR1A 3I5UA 2BYVE 1FMVA 2WY8Q 2AS5F 1QGZA 1KU2A 4BEHA 4BHCA 3WHCA 2VBVA 2VBZA 3KEOA 2BM4A 2ICWG 5C1CA 3GF2A 2DI3A 2J5OA 4LFUA 2XGCA 3FHNA 2BY2A 3ZMTA 3GUDA 1V5GA 4QLCU 1VQ6I 3DFGA 4D9JA 3CO6C 3SYJA 1IXRC 1A31A 4RM2A 5F1RA 1G4DA 5LEKA 4DQ2A 3BG7A 3AL0B 1EA3A 2WJYA 1WXRA 4EQQA 1I3AA 2XC7A 5M5WJ 4CHUA 4UZUA 2W6IA 4C43A 4XL9A 2ELKA 2DT7B 3MVPA 3PUBA 2PECA 2J8IA 2KL4A 4LK0F 4BXXJ 2OUMA 4RAGA 4Z2YA 2HMAA 4X7EA 1JGSA 4C2MJ 2QBYA 3QP6A 1BHEA 1XGSA 2FQ3A 4AIJA 3H3VK 2OA4A 3GVJA 1MKMA 3DPTA 4XRSA 3F21A 4KMUX 3VR6A 1Y39A 2E7WA 2PMZN 3CF5F 1WZ2A 2OV7A 3KP4A 3QODA 4F7DA 3M1EA 2BOLA 3CD6B 1CNFA 5A2QZ 2NPFA 1RWRA 1MMGA 2CFOA 1R9TJ 1ZM3A 1H89C 3ZIAA 2EWEA 3SY2A 2M4KA 4OAZA 5K1YA 3G73A 3OZWA 1XMKA 1NDHA 3A3BA 5HZAA 4XMYA 4AM3A 1R36A 3O8GA 2J7KA 1X1DA 2JA6J 3ELKA 3TBIA 5FLMJ 3HJEA 2XZLA 5DM7F 2OBTA 1OMIA 3S2DJ 3CCQB 1Q1HA 1W5CC 3FF5A 4XLNF 1H8HA 3WTTC 3G2BA 3V76A 1K9MD 5DCMA 2QSFX 2GWRA 1HKQA 1X4PA 2NNNA 4HIZA 2C4TA 2M2EA 3H5AA 2ZXIA 4XICA 4CCMA 2HDNB 5IYRA 2F5VA 5TV2A 3DKYA 1NG6A 4M9SA 2A6TA 1T5EA 2F1MA 2BVNA 4ZGNB 1OFDA 4E7ZA 4ZYEA 2HZTA 3MKZA 3FKIJ 2WV1A 4G6TB 2BGIA 3M1CA 3SEZA 2ZFUA 1JNYA 2PMDA 4BE1A 1I6HJ 2R3SA 3N05A 1G7RA 3CCRB 1Q7YD 2V1DA 4RLQA 2XNJA 2XZOA 5E79C 1TVCA 1SMTA 2VKDA 1SVOA 4FE4A 2WBMA 2WWYA 2MYSA 1Q82D 1SMYF 3BC9A 3LOCA 3G3ZA 2ZJQF 1KYZA 3FM5A 5L3DA 1VQPI 3JRBA 2FUG2 4EJVA 4BKXA 3V8LA 2PIAA 3I0TA 4U87A 1BIBA 2HOAA 2L0KA 2ZZGA 4P22A 1VQ5B 3C7JA 2ZJ2A 5BPIA 4TMXA 4YFXF 5LHGA 2VQCA 1I5ZA 4BHBA 1YS7A 5K7ZA 2VXDA 4XRMA 1E0EA 1D0ZA 3G6EI 3LA2A 4RS8A 1NTCA 1SFUA 2JQ7A 2W84A 4MIMA 2NXNB 4LLNA 4EMSA 3OEEA 5AIPA 1K8FA 3PIOF 1EH6A 4HQEA 1LEAA 2WAQN 3FX3A 4W8QA 1XTAA 4OJ5A 2F4NA 1JTXA 4DNTB 2HQAA 3CMAI 4ZTFA 2BV3A 3MZ8A 3E5QA 3BJOA 2Z8GA 3H0DA 4N4NB 3ZZ0A 2FNPA 3F9KA 1Z0XA 4A3FJ 3W6VA 1WPCA 1KYWA 2K9SA 4FCYA 1O8FA 3PSFA 2D3LA 4WZLA 4AYBA 3ZMUA 5LHIA 1N07A 2B0RA 2FBKA 3SLDA 1HW1A 2HS5A 2HVRA 1XGNA 1E3ZA 1LQ1A 1D1NA 1H80A 4GDFA 2Y69H 1AIPA 1JB9A 1NG7A 4F7ZA 4HAMA 3P9KA 3OYLA 2CJJA 2HXIA 2X53S 2P7VB 4QVJA 2MC3A 1J9IA 3J7AO 4PJ0C 2O9LA 1KU7A 3P9IA 1YRNB 2XPWA 2ZNYA 3GX4X 4OM9A 3V42A 3GLXA 2KJBA 3GFLA 2CK3A 1WJDA 4M3FA 3K6GA 4YALA 2R7DA 1VQ9I 4RD0A 5GAEJ 3V7AA 2R7VA 2BW3A 2FVGA 2IAIA 1XSVA 1ZKGA 1G3SA 2FBHA 1WFXA 2BEOA 3TKYA 3AKZA 2ZL7A 2XTXA 3RIRA 4A0XA 3I4MJ 4BBRJ 1RUNA 2YUSA 3F8NA 4HX8A 3SJZA 3RYRA 3KLOA 3O8HA 2WJVA 1PJ6A 5J1YA 2XEXA 4BHPA 3GIRA 3LNNA 2PQ8A 3PSZA 3K4NA 3VB2A 3LQEA 1T0FC 1JHFA 4ABZA 4E7JA 4RB3C 3IH4A 4AIDA 1OHHA 2VFNA 1QFYA 2EFNA 3T9GA 1SKYB 4G8XA 4KUMA 2WADA 4IF4A 1XMXA 1AA7A 2H27A 2EPFA 1IRGA 1IV6A 2R7TA 2QEXI 4AIKA 1B72B 3FXMA 1T33A 1KK2A 3QYEA 2JA7J 1IB0A 5CVUA 2B7CA 2D5VA 4CXFA 1L0OC 1S9HA 2BM7A 1F5TA 2STTA 1KMHA 3N90A 3M3YJ 1FOKA 4ZC3A 2NSTA 3S1MJ 3BR3A 3F6OA 3RDIA 3IRRA 4CGZA 5CQEA 4EATA 3JR9A 2DN0A 3EQLF 3CCVI 5EDNA 2KLOA 3I53A 4G6DA 4KNYA 1O8IA 1JGGA 1M1KD 1N05A 3E1YE 3AVXA 1QZYA 4UNOA 2LBFB 1JA0A 5L3CA 1QH0A 2BXYA 4N3GA 2W57A 2W7ZA 1OCCH 4XLCA 1QVTA 1JA1A 2XVCA 2DPDA 2WSSA 5TR9A 1D0YA 4YFNF 3O3KA 4MHGA 4N4OB 5D5VB 4KMFA 3ZPNA 3PETA 1L3LA 5LRSA 2ZBKA 1W87A 4YFOA 2Z1DA 1ZGAA 3LA3A 2ZL6A 4WXDA 3M4OJ 1O57A 2YR2A 4H0EA 3Q9SA 4JP0A 1VQMB 3OV8A 1ZM2A 1F43A 1Z77A 4OPWA 1S3JA 3CUQA 2P7CB 3PJRA 1RI7A 3GVKA 3U6BA 3T8RA 1XFOA 2VYQA 3ERED 2X6XA 1H88C 4Y4RA 2DJNA 3MCAA 1ZELA 1HG8A 4ASNA 3GEZA 1ITYA 1OCZH 2DYIA 5FLXZ 2JRTA 1D5YA 1FZPB 3OSFA 2C2WA 1I1SA 3ASRA 4F3QA 4X05A 1YX5A 4LD5A 1UD4A 1ZR4A 4IXAA 4A3EJ 3KP6A 4LLGF 2KRHA 2L02A 4EM1A 2QF7A 4PC6A 1IXCA 3RKWA 1ZAOA 3DBRB 1TC3C 2R7UA 1TWGJ 2CG4A 2CRVA 4G7HF 2WTEA 4X7CA 1E17A 4BQAA 2DOFA 3MWMA 2QVOA 2GOXB 4XLAA 1YI2I 5HS8A 1LEBA 1FOXA 2JTVA 2YWEA 2CQXA 5K5QA 4KICA 3RI4A 4TKOB 1OQYA 5K7HA 1FBQA 1N06A 2WA0A 4NK6A 4ZZLA 3OIOA 2R7ZJ 3PIPF 1SD7A 4RM3A 3EETA 3CCSB 2PLFA 4ON0A 1JXSA 2NSPA 2NRAC 3NWSA 5ILSA 3VO1A 1JT0A 4OOSA 1G7TA 1V55H 5DDGA 2CW8A 3OYCA 5H5JA 1VNDA 1R6RA 3OMYA 5DTDA 1X19A 1SANA 2E34A 2E5NA 4KITB 3E5UA 5FO5A 1QA3A 5DV5A 1K79A 4HG2A 1B8IB 5FKLA 3WGIA 1CF7A 4RDJA 2HCJB 1XSDA 4BDYA 2XGJA 3DTEA 1VQOI 3CCYA 3E3VA 3DBHB 3FMQA 1CGPA 4HRIA 4G1VA 5B1BH 1OYYA 3ZZUA 2L7KA 3CF2A 4ZYAA 4L0YB 3W5UA 4E7KA 1GV5A 3PNTA 1TYXA 2ZSIB 1XB4A 2CW7A 1IZ1A 4G12A 4P12A 1TYWA 2IGKA 4KH3A 2V7WA 2H6BA 2KPMA 1IUYA 4XRSG 1OGOX 4B43A 4YAOA 1Q1VA 3OR1C 4WXCA 1SFKA 3C2HA 2E1NA 2G7UA 5IP9J 2XF7A 2VJJA 4HF0A 2HQNA 3W2AA 2PYHA 3CCMI 4L5EA 1GJRA 3LL7A 3I59B 3BOQA 2LY9A 4Y13A 4P6VF 1B9MA 3HKZA 2NAZA 4CCNA 3JX8A 3WNDA 3VSKA 2R7FA 3T1BA 1QGYA 5IT3A 1UD5A 1WRJA 5F64A 4KA4A 4IOAF 3OKXA 2OQGA 2R5ZB 4NC7A 1S6LA 1TZLA 1H0MA 4F55A 1N08A 1OCOH 3J7YJ 3JRFA 4DNCA 4A3KJ 1KCDA 1MJBA 1R5GA 1U5TA 3AG2H 2V5IA 3JQPA 2AQFA 2A05A 2O8XA 3BQYA 4Z6YA 3OZVA 4U9UA 4E0FA 4GGGA 1VF9A 2A68F 1U9NA 3RTRA 2QWWA 2YWHA 2DMPA 2JRMA 2M4GA 5HNFA 1DPRA 2LSOA 1Z1DA 2LY2A 2OD5A 4MQVA 3S15J 3G4SB 3B4NA 4DOZA 5IYDJ 5EMNA 1V3FA 1GVHA 3BCFA 4IHVA 2I8DA 3LMMA 2M34A 2FBIA 2QLZA 3DLAA 3OW7A 4PGOA 1V0EA 1CLWA 4M6YA 1OB0A 4WX9A 2QZ8A 1U6GA 1R5NA 2MG4A 2HEOA 4L8JA 4Y33A 3K69A 2EJRA 5GPAA 4P25A 5GPCA 1V5EA 4AYBN 2VBSA 2DDBA 3P4GA 2PJRA 1VQMI 1SVLA 2WY7Q 3MKLA 1L1IA 4QWQA 1VQ4B 1MBFA 1RETA 1ORKA 4NUBA 1SFOJ 1EF4A 3BH7B 2XDVA 3ZQLA 2VQHA 2Z33A 1OLTA 1K61A 3S1QJ 1XB2A 3WBJA 3MKYB 2TCTA 3HUGB 4UUVA 4IJAA 2PE3A 1R4NB 2IEKA 4CCJA 3OR2C 4RGUA 4PGGA 4I6ZA 2JMWA 1T0FA 3ZQFA 2XAGA 1E63A 1KGSA 3A0BC 1VQLI 4OMZA 1K83J 2JVHA 3OWTA 1E62A 3SKBA 4AVPA 4YAFA 1R5BA 3FXUA 3E7LA 3QYBA 4QVAA 2EV6A 2R5YA 3UW0A 2IGOA 1P9QC 2ZCWA 4L9JA 3FM3A 2VPLA 3ERMA 4HYEA 4HPQA 4RLZA 2FQ4A 2CU7A 1G8XA 3HRUA 3W2WA 1YLFA 1VLYA 4MXNA 1RQPA 1ZRFA 5CYVA 4U88A 4CICA 4KDPA 1G3YA 1BX1A 3DQVC 3J7AY 3PENA 4C2UA 2ZC2A 5FA6A 1W0KA 3J81k 5FKNA 4OIQF 1GVJA 4A69C 1U0JA 4DZJA 1UD3A 1GDTA 3ZXSA 2XF5A 2BMWA 3WG7H 2XZPA 3BPXA 4W1UA 1XE1A 4M3GA 3A8JA 1FBSA 4TN1A 2F5EA 5GV8A 2JSCA 1BJKA 2A6EF 1YJNB 5A89A 1C0WA 2LKPA 2IS6A 3PNVA 2F43A 4MEYF 2ACJA 3SUCA 2XAQA 3L2VA 4BACA 2ZZQA 4JX6A 2M45A 3E6BA 1RESA 2EH3A 4BXFA 4XLFA 5JHUA 5FO1A 2R7OA 2KMUA 3LSTA 1NH3A 4KKSA 2XT2A 4V2FA 4XM3A 3OJWA 1O3QA 3B90A 1TSPA 5BNGA 2D3NA 3H09A 2DJIA 3OYNA 2OK7A 1VBLA 2N8GA 3UNGC 4WCGA 1U9OA 3W6KB 3VOEA 2QKMB 1JI8A 1BR2A 2BY0A 2XKPA 4WZEA 1KQ9A 4XLPF 1X3ZB 1WSRA 1D8KA 4YC5A 2KVOA 4LBYA 1MH4A 2ZMEA 5L3EA 4V19K 1O3RA 2L3DA 1UMKA 3CCEI 3S1NJ 2ME6A 5J3LA 2ZTGA 3M8FA 5JFRA 2D74A 3Q3AA 1NK2P 3K4BA 2DODA 1R22A 2DMTA 1NB9A 2WAFA 1BQEA 4GFBA 5DSZA 5HDNA 2IA1A 5C4JJ 3I3LA 1BJAA 3HSFA 1XX5A 4D0PA 4A6EA 1QA1A 3WHBA 1FYLA 3BDDA 1YS6A 1K8AD 1IRXA 2ZKZA 3GTQJ 5J3OA 2ZXWH 3OYMA 5HODA 4NDLA 3TOAA 1JE8A 1B8IA 2W82A 5LRRA 3DEUA 4EEFG 2D9RA 1BIAA 1CQXA 3K4MA 1FNNA 1Y1WJ 1GLNA 2LH9A 3GCMA 1KJZA 1NHCA 1NBMA 1TQPA 4OJ6A 3MQ0A 1X1BA 4XK4A 1K6YA 2NNYA 2QA4I 1S72B 1YLOA 2E36A 3GTJJ 2P5VA 1V5VA 2O17A 2EZHA 1P4XA 4YEJA 2W7NA 5ILUA 2P3MA 3I71A 5DCMB 4BE0A 4I09A 1DPUA 5E8GA 3H36A 3AVTA 4P26A 2ZXJA 1YW7A 5EGOB 1FLIA 4P96A 3ZCOA 2F4IA 4BH9A 3VYTB 2FU4A 3LAJA 1RC9A 3NARA 1DBOA 1UHMA 4AU7A 2BX6A 1O8GA 1IW7F 3I59A 1FNDA 3CP2A 5AMVA 3GVLA 1ODDA 2VLAA 3OJXA 1LKXA 4MNUA 2OTJB 1MSEC 5D8LB 2JA8J 2Q6IA 4Y52J 2R5ZA 4ACBA 3RPUD 4M72A 5GAGJ 4XKCA 3IUOA 1XS9A 2K9NA 2C4UA 1UD2A 2DYRH 2Q6LA 3K4JA 3M7GA 2DA3A 2FA5A 4MYUA 4XOPA 3QQAA 2C5HA 2XTWA 1ETWA 3GTPJ 2EA4A 2JT1A 3VSUA 3OOCA 1OPCA 2LVSA 4Q47A 3TEDA 4P5OA 2EBIA 1X2NA 3NQOA 4D5CA 4CO8A 2CNDA 4TMVA 5L3BA 3SZPA 2RC6A 2V1XA 3I4PA 1WI3A 1IRZA 1P4WA 1BOAA 3WU1B 1HDDC 3CZ6A 1OGIA 1QUEA 1IDYA 3FXLA 2V9KA 4RMNA 1TLHB 2IP2A 2DXIA 3BR6A 4LBWA 1LPQA 1HVXA 3KP3A 4M3DA 4DW6A 2XAUA 2K9MA 5H20A 2Y0SN 4IRHA 4RAZA 3I55B 2OPTA 2HVQA 5LBQA 1VI0A 5LGUA 3E1SA 4X0GA 3EYIA 2HVSA 4YIFA 2XKOA 4FQGA 2V1UA 2VI6A 1GV2A 1MBEA 1UG2A 1T6YA 3ZUGA 4UY8I 4EM0B 1D5VA 1ZK8A 5GV7A 5THXA 2O1DA 4HV6A 4DYRA 5EEHA 1OCRH 1QNTA 3GW2A 2JJ2A 2VNHA 3A3GA 4OIOF 2M1BA 2XGEA 1DP3A 1PXZA 1LLZA 1QPIA 1FDRA 3SEJA 2ZZEA 1YJWB 4QPOA 4D5FA 1ETVA 3HB9A 5FRNA 1O8DA 2ZL5A 3WY9A 2X48A 3OAAA 1FC3A 1KTWA 4FHTA 1JJ8C 3Q6RA 1OISA 2RQQA 5B1AH 4G1BA 3D26A 1YW8A 3QPTA 3ZOBA 1Y0NA 4DQLA 3SDBA 1VQNI 2BW3B 1ERDA 3BG3A 1WSUA 1JRGA 3L00A 1QZEA 4ANJA 3A01A 1QRYA 1LDDA 2EINH 3RKYA 4Z4ZA 2UVFA 2DTRA 4HX7A 4HNVA 3WWGA 2GK7A 4PMHA 1B9NA 1EH8A 5D4RA 1K7AA 1P7JA 4B3XA 3W2EA 1FBUA 1YOVB 4PDKA 2M5SA 4D7MA 5C4XJ 2VNKA 1YJ9B 2PFBA 4KKTA 4FX0A 1DDNA 2COBA 2KT0A 1UMQA 3NEUA 4HNTA 2WC2A 3BT9A 4MGRA 2HQRA 2JJ7A 3B6CA 3HIFA 2XPVA 3OE7A 3VMWA 2XNDA 3NRVA 3PFIA 3B8HA 2QX3A 1P4AA 1YITI 5ERIA 3S8PA 1QRCA 4QFMA 2WR8A 1BN5A 4B4CA 2GK6A 2YUHA 4XBFA 2AHOA 1ZG3A 1UB9A 1S72I 4L5IA 3H9NA 2NTPA 4PCQA 1BN8A 4UV9A 3SFIA 3T53B 3CJNA 3AG4H 1AHDP 5IYPA 5H59A 3CUQC 2XPUA 2J5PA 3K10A 2O8KA 2QCOA 3GFJA 3DCFA 5LGNA 2V6CA 5D8KB 2RC5A 1I7PA 3LSRA 2XB5A 3GZNB 4BAYA 3K70C 2ESNA 3QOPA 1I3QJ 3H3ZA 2GA2A 5J40A 2DIEA 1MGTA 1FT9A 2CUZA 3S2WA 1J5YA 3FBIB 2DFIA 3Q0UA 2DETA 1A04A 2QM3A 4WWVA 1B59A 2EFGA 2ZFWA 3CC7B 2JSPA 1JKRC 5LMZA 2G0YA 4XN3A 2DT5A 2K86A 4LJZF 1B6AA 3OYFA 4ZYHA 4A93J 5CVIA 5EZHA 2DERA 5HOOA 3ZBTA 4PFPA 4I0BA 4OPOA 3CUQB 5B3SH 2VFPA 1HF2A 1X3UA 2BN4A 5ICGA 3VNVA 5CVVA 1BI3A 3SFZA 4L9VA 2CH0A 5KAFC 1IRFA 2E60A 2BM1A 3D5LA 4A0ZA 1PKVA 1VQKB 2E1BA 4HDVA 1MDMA 5M3MJ 4UHTA 3CCJI 4M2LA 3JSOA 5EGOA 2DQRA 4RPBA 5ICEA 1I6XA 2X3HA 1IGNA 3MN2A 1GQ8A 1HSTA 4CYCA 1UELB 2VBKA 5ED4A 2JVGA 5EG0A 4O3MA 4Z4UA 3GQ8A 1MNDA 2JA2A 3R0AA 3LNQA 3PQKA 3GQ9A 3H9JA 4RCZA 3JRHA 3ZBUA 3CXCB 1DU0A 1YIJB 2MA3A 1AWCA 2L2OA 3DP7A 1KCCA 3F6VA 4H9GA 3KRGA 3S1RJ 2GAUA 4XIDA 1TWFJ 3OYKA 3IAM2 4I01A 2XSDC 3E20A 4IZZA 3PO2J 2CUEA 1QUFA 2L7MP 4RD6A 3PA2A 3M8EA 5H2FC 1Q9SA 1VFCA 3EUKL 4D1QA 3KPHA 4RCYA 3BWGA 1D1BA 2PJPA 2EIMH 2X1DA 4LIUA 3ZPPA 1EKEA 1ACIA 1IN6A 1IN5A 3WG9A 3OS0A 3P9CA 2DW4A 1ZRDA 2V9VA 3FWEA 2FRHA 2VE9A 2VC1A 4OOIA 3GFMA 5BOXA 2CF4A 4RM0A 2XGDA 4YXWA 1RMGA 1IB4A 3K2ZA 1FPQA 4A3IJ 1GAWA 3BCDA 3OYGA 2F2EA 1CF7B 4OMYA 3GTLJ 4GQNA 1QHHD 2BBYA 1QZZA 4GYGA 3PSSA 4EJTA 3HDDA 3S17J 3BCAA 4YZ0A 2AHQA 2RKHA 2OTLI 2Z2SB 3BCBA 1U5TC 1ZGJA 1V54H 4A3DJ 4BL0B 1Y1VJ 2Y9ZA 3F3XA 3HTSB 2IS1A 3E5XA 2R7XA 2F5DA 3BROA 4DNRB 4YEIA 1ELOA 1EZGA 3SZEA 2Z3YA 3VYRB 5BQTA 2V7XA 5CVRA 5CKTA 2OU2A 5JMCB 4TT3A 1XMAA 2M87A 2HOEA 4OZYA 1ZARA 4MFEA 5FNZA 2X6OA 4R79A 2GQFA 3SYTA 4EM2A 2LKSA 4DBQA 1TWHJ 1R49A 2YPRA 3LQ6A 4HSRA 2JA5J 1R71A 3LSGA 5DM6F 4U7DA 4R8HA 1T38A 5L3GA 2CUJA 2VJ5A 4HA8A 4R1HA 2ZJPF 3F0CA 2L7FP 1FIAA 3CJRB 3IC7A 3QOEA 4G9YA 2VOOA 1U5TB 5DUKA 1ZTRA 4BDZA 3GTKJ 2RREA 4Y17A 5IOYA 1LLWA 2FJ1A 1JHHA 3W2IA 1Y0RA 2DA5A 1ETQA 4WK8F 4UB6C 2F6CA 1KZLA 4C2LA 3C1DA 2O3FA 4ETSA 1G3WA 3C3WA 3QU3A 3ZP5A 3ZC3A 3BJAA 4HEA2 1WJCA 2M8GX 3WTZA 4P9SA 4YZAA 4HZFA 2VPRA 2DPUA 1IN8A 2YX4A 1I39A 1Z6TA 2LNBA 1BPLA 1PYVA 3CC2B 1SD6A 3TL4X 1NRKA 3CD6I 1H9GA 3HGYA 3FBNB 1BL0A 1V0FA 2M0MA 2OZ6A 1TT5B 1LDKB 3D5RC 5ICFA 3N97A 2PJRB 3VFZA 1YYVA 1DDIA 4ZV4A 4ZDOA 1N78A 4LBVA 4W8RA 1Y0UA 2LRDA 2VODA 3NAWA 4N9IA 2PLYA 3HZJA 5HDGA 4RDLA 4J19A 5FIUA 2UUZA 3MKWB 1TWCJ 3CCQI 1EJ9A 3QP5A 1BI0A 2UXXA 1HW5A 2GA1A 3CW2A 4DQKA 4LB5A 4N3NA 4Q4ZF 4G6IA 2QZAA 2GIZA 3WE3A 1XGOA 1IA5A 4QHYA 3KZYA 3IL2A 2A07F 2WV0A 2QY1A 3M07A 3H9QA 5E3LA 5JI6A 3BP8A 4NC8A 3KYLA 1H8EA 3AK5A 2MBFA 3GFIA 1W34A 2NVXJ 2M5WA 4WZKA 3TH0A 2R7WA 5FD6A 2R5YB 2CGPA 4J0QA 2GZWA 3K9TA 4RGSA 5D4SA 1PLUA 4PJJA 3R60A 3ZQIA 3J80K 1KK3A 4OOXA 2CQQA 4TMWA 1TTYA 4AWXB 4ENMA 3K2AA 3CCRI 2OC6A 4YAWA 2XUBA 4A3CJ 5B5EC 3L2RA 2ZSHB 4PGHA 1KU3A 1GR1A 2LZJA 3U1DA 3CMEB 1BA5A 4A5NA 5FLVA 2BGCA 4PC7A 1ZREA 2XAFA 1Z67A 1IUFA 3L2CA 1N8RD 4CCLA 4NNJA 1SM4A 5IYWA 4CQJA 5HZBA 3WTYC 1VQ5I 3CPWB 3CC4B 1YE9A 1KTVA 3T51B 2V4JC 1Z21A 3HPGA 2ZMEC 2BHZA 3P5JA 2DLLA 1PJ7A 4NBSA 3Q3SA 1S29A 3JRCA 3OIPA 4X7FA 1FIPA 2K4JA 4LOCA 1FP1D 3OL3A 4AVZA 4JK1X 2IT0A 4YDTA 4ZYDA 4FASD 5F0CA 3WTSC 2UV1A 3I56B 1GHCA 4ZGQB 1TQIA 1COWA 2CQ7A 2R93J 4KJZA 4MQ9F 1W0TA 4R71A 3GTMJ 2Q1ZB 2QQ9A 2M30A 1A6IA 2Q8KA 1N0UA 2EK5A 5HNHA 4MTDA 4Z03A 1CZFA 3JW4A 1KQ0A 2WB1A 3JAMK 4BPRA 2WZNA 1MSFC 2K3FA 3K70D 4IQJA 3LVBA 1U3EM 1W35A 1OR7C 1JUSA 3K0LA 5E1ZB 3GZ5A 2OCCH 4M74A 4PABA 4DYCA 1QPMA 2VQLA 2ZMEB 1FY7A 3J81K 4M71A 1VHEA 5F0FA 4Y9RA 1E3HA 1EE6A 1JUPA 2HYGD 2E71A 5FD5A 4QIWN 3GRHA 4ZDLA 2HPMA 1EWYA 2OZUA 4MLOA 4BGDA 4UV8A 1KQ5A 2VUMJ 1M90D 2H8RA 2L9NA 4G94A 1R7JA 5D5XB 1XQBA 2EWNA 4JYKA 3WGGA 4KN4X 1V4RA 2P4WA 3GO5A 3SHFA 4I84A 5IOZA 1G6NA 1SVMA 2DMNA 2X51A 2H09A 1ON2A 1Z7LA 4NQWA 3IH2A 5DD8A 3S3OA 1IO2A 1F1ZA 5IYQA 4P55A 3LQQA 2VBTA 1F36A 2P0WA 5K5RA 1IN7A 4E7IA 2PI0A 4Q5SF 3HHHA 2JUCA 4XKWA 1YFHA 2XHKA 3BY6A 1S4MA 1AU7A 3SJPA 2W1OA 1U2WA 4I0AA 3BTLA 1TL8A 4OP7A 4G7OF 1N25A 1IHMA 4WXHA 3BR1A 3VSTA 2HI3A 1YHQB 1Y56A 4B09A 1H42A 1XDSA 2DA6A 2XAHA 4P2NA 2H8WA 4G7WA 5CQGA 3EUAA 2MFZA 3L2UA 5JR3A 4IEJA 4IOCF 4KKUA 1W5TA 2O6GE 4UAJA 1SFXA 3JQRA 3GTGJ 3Q6QA 4M4SA 3VYUB 3I1FA 1XCVA 5E1XA 1GO2A 2ZBUA 2LDUA 2DBBA 4RD3A 1RU4A 1OFEA 2V7VA 2VJIA 1HQCA 2DYSH 4IHWA 1OFCX 3RKQA 1QVFB 4PC2A 3G05A 5DS0A 1XPXA 4TSFA 3KLNA 4C3HJ 1ETXA 1ONVA 4XRFA 2IA2A 4YFKF 1BI2A 1Z3YA 5D6FA 3LAPA 3HL2A 2M7AA 4FX4A 1PP7U 2XOKA 1PJ5A 3Q38A 4K1XA 1VQ8B 4LGWA 2BPOA 4P3IA 2M3AA 5KW9A 1JJ6C 1UHWA 2EFQA 2VJ4A 2E1CA 1LVAA 4FN5A 1OB2A 3BR0A 4Q7JB 3KX2A 3CLQA 5JBQA 2EFPA 2LC2A 2O04A 5E18F 1VJSA 2OBPA 2LMDA 4UXNA 4Z4WA 3CCLB 4URRA 4CA0A 3TDUC 3R6KA 3WODF 3KL9A 1QVUA 4L18B 5EF6A 2CRGA 1A8PA 3UKGA 1J0RA 1QBJA 2KIUA 2Q2EA 4OZZA 2XIGA 1USTA 2M9HA 4WF2A 4AIHA 2BE5F 3ZN0A 4YHBA 3HOSA 4F93B 2L4AA 3DKWA 4TMTA 2IVMA 3H0GJ 2RAEA 2W4SA 5BSYA 4QUZA 1PP8F 1TYVA 3A2KA 4B3FX 1A6QA 1UD8A 4ENKA 3SQVA 5GP9A 3W2GA 3QAHA 2VN2A 2A3SA 2MD5A 5IT9K 1LJ9A 2KIQA 4OAYA 3T8TA 4CUGA 1STZA 2B0LA 1PUFB 1IG7A 1FX0A 3AG3H 4II3A 4L5JA 1WCMJ 4MTEA 1QCXA 3MZHA 2HKOA 2GPJA 3ZSCA 1ZGWA 3RIQA 4LB6B 2MABA 5L3FA 3HGGA 3FJOA 1BJZA 3FY3A 4XSZF 5CVJA 4M53A 4EH1A 2NVQJ 3B82A 3LMWA 2OCEA 4Z4YA 2X6YA 1G7SA 1U2RA 1WP6A 4WWCA 2KZVA 3W6JB 5TJJA 3JU4A 4F91B 2Z16A 4BJTA 2VBYA 2ZO4A 1HSJA 2Y31A 5J47A 1B1BA 3WU2C 2O7OA 1W7PA 2JK3A 3M9AA 1WHUA 4ZTJA 3JURA 3BTCA 4HV5A 1NJID 1RZ4A 1RPWA 2E7XA 3BLYA 3DXJF 3U2RA 1I8DA 2NT9A 4BYYA 1OOCA 3CCSI 2Z99A 1AKHA 1QFJA 1QX4A 1DQUA 3A01B 5HKKA 1VQ7B 3N6ZA 4Q48A 4RGRA 2LYCA 1O8EA 2O03A 2W25A 4LIVA 2QYUA 2HWVA 5IP6A 5CDFA 5KCMA 4OWRB 4A3JJ 1MMDA 2IGMA 2Y48A 3IHUA 1QO0D 1XC5A 4XLHA 1WH7A 3OYJA 4UUSA 1GUUA 1MJAA 2FD5A 3TO9A 4KFCA 4Z06A 2HQ5A 3KP2A 1QVGB 1J59A 2KP6A 3CCUB 3TDZC 1FP2A 2X9DA 2XF6A 2PMHA 3RYPA 2L9RA 4TMZA 1FSEA 1HF0A 3FXKA 3DLLF 1E64A 1QG0A 1RIOH 3SJMA 2RN7A 1UAAA 3BTJA 1IF1A 2PMZA 5IK2A 1GAQA 4DK0A 5K5OA 2LREA 1ZG1A 2ZTNA 3A4CA 4G6QA 3VPRA 1J9ZA 4DJAA 1DBGA 2BVMA 1H9TA 3GVAA 2QSGX 3E6DA 3OYBA 4PJLA 1OFLA 3ZMVA 4KISA 4I02A 3FKSA 2QYOA 3L7WA 4KIGA 4RB2C 2LF8A 3PNYA 1A36A 1IDJA 5KNLA 4M6XA 2YU9J 1X58A 4C9YA 2NS0A 3KEQA 1SD5A 3LA7A 3UR3C 4D7NA 1IAWA 3F8CA 3O6BB 3VSVA 2QGUA 1T2KA 2KIFA 3CTAA 2LG4A 3BH4A 1W2BB 5IY5H 1YW9A 3M8JA 3LFKA 2RGVA 3BQJA 1BR4A 3HRSA 4ZZDA 3ZQQA 1ZLKA 1YX3A 2XNCA 2OK8A 4B1RA 1WOPA 2VC0A 5J8FA 2MGQA 2CWEA 4LMYA 3SZGA 1WI9A 2K40A 5C3EJ 1W5SA 3ASTA 3AGPA 3ASNH 4BJ6C 5LHHA 2MLGA 1OR7A 1DARA 2P8TA 4B4DA 3G4SI 3LSMA 4UB8C 1KU9A 1FOYA 2RNGA 3Q9VA 4GRIA 5F04A 4E7SA 2DFEA 1HZEA 2LK2A 2TRTA 2QE7A 1EH7A 1JTYA 4BU2A 4II2A 1MDMB 3TW6A 3GQBA 4I7HA 2E35A 1VTNC 1TW2A 1ETYA 3I58A 3JREA 2WB1N 2W6JA 3JQQA 1P92A 2LF7A 3LWFA 3IAS2 2O5RA 3V8KA 2RV8A 4CYCB 2HNHA 5EG0B 2C77A 2CYYA 3HRTA 3ULQB 3K4KA 2E1MC 1BBYA 3PFYA 4P1VA 1VQ6B 2VL8A 1QRBA 1IV8A 3ABTA 2DA4A 3GLLA 3MZYA 2HTJA 1VQ4I 4I99C 3U6KA 4A3MJ 4PUSA 3OEHA 4M9ZA 2OBRA 2D45A 4PC3A 3ZQGA 1K4SA 2FMLA 4A5MA 1GXPA 4X0CA 1Q81D 5C1EA 3DWLE 3OYAA 1DABA 3EUHA 3I4NJ 3OP1A 1X3WB 2VBMA 1T6SA 3ABLH 4OINF 4KN7X 5F27A 3ONUA 3OL4A 1U78A 2L9SA 3H92A 2BM0A 3DTKA 2HTSA 4EV0A 2X1EA 3I64A 3V7RA 1SAUA 4IW3B 5AN9A 4XR6A 4A12A 3VSLA 1VF7A 2R7RA 5A2QK 4Z4TA 1QJVA 5F6FA 1KONA 4B3GA 5LLQA 3WBKA 2A6HF 4DIQA 3PL8A 1LUJB 5DUIA 4NBQA 2HKXA 2E1MB 3HOXJ 1D1CA 2X0KA 2FNAA 1K73D 3HSEA 2IS2A 2LY1A 2PEXA 4IHSA 3OPOA 2BXZA 4HF1A 2RQPA 2F1LA 2DT6A 2F4OB 1B2RA 1UG0A 1Y0YA 3VDXA 2ZBVA 2KJCA 1XCBA 2DA2A 2J8KA 2LOOA 3ZQHA 4ZCMA 4FXUA 4HLXA 1QHGA 1DG1G 5DN6A 2CS3A 3HKZN 1ZH5A 5M5XJ 4QPQA 2Q6OA 2QXZA 2IBDA 3DV8A 1U8RA 3C2GA 3V8JA 5J8CA 1ZR2A 6PAXA 4W97A 1MMSA 1D0XA 3MHPA 1MZBA 3CP8A 3NAUA 1ON1A 4RB0A 5HS9A 1DGWY 1PUFA 1E3XA 2UZKA 3R6JA 1VZ0A 1YJNI 1WVRA 4RAFA 4TV7A 4CYDA 1D3YA 3AG1H 3MFKA 2ZB9A 5DD4A 1G3TA 1TNSA 1WJFA 4RDKA 3KEWA 4ROXA 3K1MA 5TY0A 1LFUP 2DOAA 2Y30A 3QPHA 5BMZA 1E3PA 3PVDA 2INVA 3W2FA 2V4DA 3A35A 3FK7A 3KEYA 1T08B 5B6IA 1E1RA 4YAUA 3DU1X 1ENHA 3JRGA 2K85A 4CZZA 1R1VA 1QGPA 2HU9A 5A8AA 3LFUA 3D5SC 2X0LA 3IH3A 1R1TA 3S2HJ 3GYHX 3H3UA 1X4OA 2JZYA 2Q6KA 2KRFA 3LSHA 3F8FA 1HDPA 3MMYB 1DU6A 1VQPB 2ETHA 2O61A 2VQGA 1HCRA 3DF8A 2VONA 4IHTA 4ASUA 3HOTA 2BV6A 2NOJB 2Y0MA 4PK4A 2WPDA 2WZPP 3P7NA 1LE8A 2VIXA 4OU0A 4ESBA 1EP2B 1OGMX 3BG5A 1MBGA 3RPQA 3G6EB 3AAFA 1K4ZA 2V7TA 3EDPA 3HHGA 3U2QA 1S7AA 1BM9A 1NK3P 1KRHA 3C2BA 2CW5A 4I76A 3ISPA 3B78A 1R5HA 4U0WA 3TOBA 5J6XA 5HDKA 3EYYA 1FJLA 5AIQA 4KIBA 1T98A 2V79A 1DGRM 3WE2A 3ZN1A 2STWA 1O7LA 2EFWA 2MD0A 1P6RA 1U8BA 4FK8A 5L46A 2XRLA 2ZNZA 4DZPA 5B66C 2KFDA 5M5YJ 2UVEA 1ZLJA 2B63J 1YQAA 3DU5A 5D5WB 3IV5A 1N77A 2CV1A 5FFXA 2NVTJ 1FEXA 1Z7UA 5A88A 1P7IA 1MBJA 4U0YA 2A5WA 5HLHA 4E70A 1XD7A 3HM5A 1I18A 4JX5A 2VOPA 3PA1A 3WNCA 2KKOA 5IPAA 3QFCA 1TBXA 2O0YA 1BI1A 1Y8RB 2EB7A 1SD4A 1OYIA 2M7BA 2OTJI 3GWZA 1QQIA 4BXUA 3KCCA 2K27A 2XB0X 2EV5A 1QU3A 1ULYA 3BTIA 1UHSA 2QTZA 2BHYA 3ECHA 4WZTA 1VQ9B 3FHZA 3JSPA 3WNBA 3B73A 4AC0A 3OYEA 4XORA 3G1LA 3PM1A 4XOTA 5H6QA 3O2PE 2GJPA 5E3OA 1X1AA 1MRZA 1WDTA 5F4MA 2DMQA 2L4MA 2DO7A 5DCFA 3HOUJ 5BPDA 4HF2A 3FKJA 1Z91A 3VO2A 4HE6A 5EYRA 4WQMA 1USSA 2BVLA 3X2QH 1MJ9A 2R92J 4XKVA 4I2OA 3DKXA 1HC8A 5JVTA 5E8IA 2L54A 1PDNC 4M73A 4RB1A 2QTLA 4HE5A 1CQTA 3H9GA 2D1VA 5LGTA 3TW7A 4P3YA 1OYWA 2QEXB 4IKFA 4A3BJ 3IWZA 1RQRA 5FKKA 2DEUA 4MO7A 2IPQX 3OS2A 4HWVA 4LG0A 2M0CA 3I55I 4RD4A 4UUTA 4BUPA 4Y7NJ 4FETA 4EGZA 4JX4A 3D1NI 1OCTC 1OGJA 1PUEE 4MYTA 4M1KA 3FPPA 4NK8A 1MBHA 2XSJC 1YG2A 2O0VA 3QYFA 1TP4A 1WJBA 3C18A 1BW6A 3IKVA 3CPXA 3CCVB 3IWFA 1N0VC 3OZUA 4Z4SA 5TRDA 2VFQA 4LITA 2DA7A 3AFHA 4X1EA 2HDDA 2KRCA 2LD5A 1G2HA 1MABA 1MMNA 1TWAJ 4ZYGA 3ONQA 1YJWI 3QU6A 4EJUA 4ENJA 3F8MA 1RR7A 5E6TA 2JN6A 1EFTA 4P6YA 5FO0A 4OIPF 3B8YA 2JN9A 3R4KA 4JRAC 2KDZA 1X0CA 4IL6C 4NQWB 5D5UB 2I5UA 1E3OC 2HPIA 2KHMA 4U7BA 2JPCA 1O8MA 3T0YA 4KT5C 2ZITA 4V02C 4JMQA 3A03A 5LEJA 2EQRA 5IYNA 2IRFG 5FLXK 3TP0A 3B02A 3WTUC 3ABKH 3CESA 3FXJA 4BY1J 1W0JA 4NCNA 2GJKA 5IP7J 3JRDA 4IPAA 3ZMDA 1R4MB 4HBLA 3KETA 2F48A 2PMUA 1K78B 2FEZA 2HFHA 3F8BA 3AVVA 4JBAA 5JHFA 1YIOA 1LM1A 1YJ9I 1Y6IA 1O8JA 2E1RA 3DDYA 2XV4S 2B7EA 3WTVC 3S3MA 2E1OA 1UCRA 2YS9A 3BZKA 4XNFA 1N75A 2FX3A 5F08A 4IO9F 2ISZA 2QN6A 3DEEA 2GOMA 3H94A 1ZN2A 3BG6A 1FWZA 4ITVA 3S3NA 3LJYA 1YI2B 2BY3A 3HTUA 3I54A 4IRIA 3RZDJ 3FXOA 1HA3A 4HW0A 1EP1B 2VNIA 3QPSA 2ID3A 1YX2A 1XG2A 4K2EA 4A0YA 2M8EA 2WAEA 3OIQA 2XROA 4XSXF 3RQIA 1UJ8A 3QWLA 4C2TA 4LK1F 3G1OA 2B5OA 1YTYA 2EIJH 5KK1A 5E3MA 3RKXA 4OJLA 4KT6A 4QSHA 2GBYA 2AO9A 2K4BA 5HLTA 4G7ZF 1IJFA 2GM4A 4ENNA 2ISYA 2QMUA 3Q0WA 2FF4A 1EXMA 1CNEA 2ELHA 2Q2EB 5FROA 4ZH4F 2GLOA 2X3UA 3NB2A 3DU6A 1XGMA 3DEWA 3JCUC 2EZKA 3CC7I 4BBSJ 2OBSA 3BH6B 4O6JA 2DK8A 1ZRCA 2DQLA 2V6EA 1S7OA 4X06A 2QGGA 1KD1D 5FKOA 4EGYA 1HKSA 1VQOB 2KQRA 3ZRGA 3OY9A 3PO3J 1FOWA 2AXLA 2CC2A 2I10A 3ZPLA 4N0BA 5CLSA 4B48A 2F5FA 1E2XA 3LSKA 4L9TA 1E43A 1QGAA 5KSWB 3RQ4A 1VQKI 4UVAA 3AVUA 3KFWX 2F5CA 4BJ5C 1S7EA 3PUFA 3MAJA 1XSXA 4DGWB 4YG2F 1XG1A 3CCMB 3VYSB 4EJOA 1PJRA 3D0SA 1H8AC 3W5HA 2L7ZA 3OOPA 2A5YB 4J00A 1FRNA 5DEQA 5FL7A 3P26A 2GIVA 1TLLA 1DDGA 2FX0A 3AVWA 2KZGA 3OW2B 5ILVA 1W0UA 3GZ6A 1T8IA 2Z5UA 2DDAA 2OJED 2EIXA 1Y8QB 3A0HC 1YIJI 2OYNA 4RLFA 5FKMA 2V31A 1JKPC 3S93A 1ZM9A 2XAJA 2XRNA 3GXOA 3OOUA 3Q0VA 3OYHA 3JTGA 4ESJA 2X8KA 5JLVC 2R6HA 2VBXA 2VE8A 3A1PA 1W7PB 2EILH 4NC6A 5EJCA 4UZEA 1K4TA 4UVCA 1K28D 1MNMC 3ABUA 3A8IA 2FOWA 4AUXA 1WJ5A 1KK0A 3CDIA 4AF6A 1BX0A 4HDUA 1AKHB 2CO5A 2EFOA 3E0JB 1UFMA 3HOYJ 2V9PA 3DBLB 2QENA 4ZCIA 1ZHFA 2R7QA 1D2EA 4XQFA 4YRVA 1JUMA 3SQNA 5TISC 4A6DA 2R4GA 3HAGA 1T6ZA 4S04A 3WU0A 3F72A 3BPVA 1KK1A 1NHAA 3GTOJ 1EFUA 1RUOA 2BM5A 1K6OA 4UUSB 1OFMA 4YZQA 3DTIA 4E4HA 1VHOA 2ZZFA 3CJQB 1B4AA 3FPKA 2CMPA 2LP0A 2MH2A 3CQZJ 3PQJA 4LBZA 1JKQC 2HDWA 3LSPA 1H85A 2F3LA 2HOTA 1W4MA 2OAZA 2QUFA 2DY1A 1FMWA 3PUMA 3V7SA 1J09A 4RDUA 4QV2A 4DYQA 1O7FA 2EV0A 1TQMA 3HC7A 3L1PA 3KP5A 1YO5C 2D1HA 3LQRA 1FYMA 3OFNA 1T6XA 3BR5A 1B23P 2E2HJ 2VKHA 3K4LA 3LO8A 2GXGA 3J7ZI 1D8JA 1WMRA 3T5XA 2EIKH 5JLWA 1O3SA 5FGMA 1VQLB 3AVYA 4FWTA 4YCQA 1MH3A 5C44J 4G7XA 1LFBA 2JPBA 2NOGA 2UXNA 2DCEA 1KC8D 4DBRA 1RKWA 2EZLA 2BSPA 2GJRA 3QE2A 4N9HA 3TO7A 4Y9UA 4BE2A 3EPZA 1MIJA 2DFHA 3TGNA 3K4CA 2VT2A 4IQ4A 2AQEA 4CCKA 4QTRA 4X07A 4Z05A 2NYXA 1R58A 1WH5A 1W36C 3BQZA 4BQOA 2ECCA 3L2WA 3WQZA 1ZG5A 1VLOA 3ESWB 1X1PA 5E20A 1HBXG 4B8XA 1R1UA 1LNWA 1IC8A 2HDCA 2PX9A 3FXRA 5J4YA 1E1QA 3BY2A 4AC9A 3EUHC 1Z9CA 2EZIA 2ME0A 3L09A 3OSGA 1X1CA 1PVEA 2H1LA 4W8SA 3A8KA 1R5ID 2XGXA 3A1YA 4GCVA 1K78A 1TW3A 1GT0C 4I98B 3ML3A 3R61A 2IS4A 1T39A 1I27A 2JUGA 3CC2I 3LSJA 5GTIC 4S0HB 4E7LA 4RBOA 4IHYA 3KZIC 3ML6A 2PBIA 5F4JA 4OOVA 4M6VA 3OS1A 3VMVA 3U21A 3WYAA 2IGNA 2G0EA 1BC7C 1FTTA 5HLIA 2F4MB 2BY1A 2HYFA 1JT6A 1BOBA 2C6YA 4BQQA 3MEXA 3VODA 1MMAA 3RZOJ 4BS9A 1IN4A 2ELJA 1WOOA 3QRFF 2QQBA 1FYKA 2P6SA 1O3TA 3CJTB 4O5VA 4P9UA 1P4MA 2INUA 1J2XA 2B9SA 2GQQA 2VASA 4XONA 1LB2A 3FIWA 5AONA 2Y0SA 1F4KA 3CCEB 3ZQ7A 3R6SA 2E2JJ 1HKTA 3GQAA 2VKEA 1Z6RA 2NS7A 4HSTA 1APLC 3V7CA 2QDXA 3ZMZA 5F0HA 1YRNA 2UWMA 1EV7A 4PC1A 2K02A 4UVBA 4L9NA 1TYUA 2A61A 3TP3A 3SXYA 4Z4RA 5D6EA 2LR8A 3CDHA 1HW2A 1OB5A 2ECBA 2CW0F 4PZJA 4FTHA 1HA8A 3J80Z 3FISA 2CBXA 3P27A 1O8LA 3GQ7A 4Z1MA 2CSOA 2W48A 2VNJA 1AMOA 1DP7P 4M0LA 4C0SA 4OJOA 1JJ2B 3CMEI 3BNWA 2QA4B 4KYWA 2RVCA 1RRJA 1O8HA 1O88A 4Y15A 4RGXA 4C3JJ 1S5LC 3QFTA 2YWFA 4OPVA 2WYRA 1AIRA 4Y7CA 1TTTA 2DTZA 1FX7A 4EJWA 2DMUA 3CMMA 5K7FA 3CC4I 5FFZA 2BF4A 3Q39A 3VEPA 1G59A 4KIFA 3CO7C 2A69F 1R00A 3MD2A 4P1WA 1POGA 5J4VA 3Q5FA 1K5CA 4OJPA 1TT0A 4ESFA 2CFXA 3S32A 1B72A 4B44A 3SZTA 3I56I 3V4GA 4M3EA 4X7DA 2VBEA 2K5CA 3N4MA 3L2QA 1EFRA 3ZZTA 1W1WE 3S14J 3HBLA 4J01A 4LLLA 1QFZA 2Y75A 4MFDA 2HZDA 1UZCA 3RJPA 3CLOA 3QSYA 4B47A 3ZMSA 1WKMA 1F20A 2D2WA 2QSHX 1W9XA 1I50J 4S05A 2BSAA 3B6AA 3CB4A 3JAMZ 1KQSB 1WU8A 1HOMA 2LBFA 3JRAA 2LFBA 2YX7A 1XN7A 5FRMA 1Z3XA 2VT3A 4RJLA 5GTHC 3J81Z 1LE8B 2V1NA 2I1LA 3HYIA 3CDLA 4PSWA 2VBUA 3ISXA 5BSXA 4LG3A 1F9NA 5J1UA 4M3BA 2G9WA 4JOMA 2P5LC 4A3GJ 2KISA 1A35A 3KP7A 5DNSA 3WGHA 2DOEA 3ES9A 4OPSA 4A2UA 4ACAA 2K9LA 4DK1A 2X4HA 5J1RA 5E3NA 1RR8C 2R7SA 2JDIA 3KYCB 3BR2A 3G71B 1W7PD 2NS8A 4F52A 1D8TA 2JIZA 1FNMA 2ODLA 2FOKA 3VNUA 1EA0A 2HLDA 2NZMA 2HR3A 2KIMA 4CH7A 3F23A 2RNJA 4ZJZA 1IDZA 4IVNA 4E7HA 4LC0A 3DPUA 1REPC 3VWBA 3MCZA 2DAOA 4FT8A 5HS7A 1YHQI 3ASOH 2VZLA 4PAAA 3CUOA 3ECOA 5IYBJ 3JRIA 1FSHA 2W00A 3LSIA 4CSWA 2L5QA 3ZGKA 5JVGF 4W8TA 5DS9A 4HQMA 1WPKA 1FNCA 1IDKA 3ROUA 4AF7A 5GADJ 3QFSA 1JTAA 5F4OA 2FE3A 3F22A 1A5JA 2X1CA 4BEHB 2BM6A 2XC1A 1S0UA 1ZYRF 1FRQA 2EA2A 1ETKA 2NTQA 4HX4A 3KE2A 4YZXA 1QA6A 2DFFA 2MH9A 5JLXA 4X6AJ 2DCUA 1GVDA 2Z6BD 3RCOA 4XKBA 2NVUB 1J75A 1SEUA 4EW9A 4NB5A 4M9XA 4YIIA 5IYCJ 1DUXC 1BC8C 1VQNB 3FMSA 4OIRF 3E97A 3KIOA 3K7AJ 1VQ8I 1E79A 2XT4A 1G7CA 1WORA 4E6KG 1IJEA 1O8KA 2V7QA 2COMA 2LTPA 3HOZJ 1MW7A 2BZTA 3HSRA 5DYMA 1GXQA 2JWTA 2X85A 3FK6A 4NHJA 3W2HA 4P9FA 1WQ2A 5F1JA 3QPLA 1ZQ3P 1R23A 3CCLI 2QBYB 3WTWC 2GXBA 3SLNA 1Z05A 2VXZA 3GSIA 3NE5B 5ICCA 4ZCLA 2HXOA 2BGJA 3EQOA 3RSNA 1IJWC 5FJ8J 3S16J 4B3AA 1UD6A 4HNUA 2H1KA 1LDJA 1S8NA 2HYJA 4L0ZB 2IJLA 5M3FJ 3EQNA 2DOGA 9ANTA 1RKTA 1OJLA 2XASA 3E6MA 3H1CA 2FMYA 1KA8A 1YITB 3W3CA 1HLVA 1KZHA 3H35A 3RPUA 2ID6A 1M1EB 1ETOA 5HLGA 4HLYA 2W24A 3VMFA 2AXTC 4LG0B 5EZGA 2DU9A 2C78A 2R9VA 2VFMA 4PSXA 1LFPA 4GO1A 2LLKA 3GMEA 1AOYA 4RD1A 2VKVA 2KDOA 3GBGA 2H94A 3LYCA 2E19A 4MEXF 2CQNA 3REOA 2CUFA 1Q86D 5CPRB 3HPHA 1MD0A 4XD7A 2V7FA 3ASPA 2LKXA 3IKTA 4ZDPA 4IHXA 2WAQA 2CV2A 3ASQA 2FSWA 3TMOA 5IT9Z 1EP3B 4FE7A 3COAC 1SC7A 2PG4A 2VBWA 4C3IJ 2HOSA 3ZQCA 3HOVJ 1J7KA 1T56A 2YSRA 2E5ZA 4RAYA 1NB0A 1WSVA 2CV0A 2B7BA 4RA2A 2CQKA 3HG9A 2MW8A 1FTZA 1WJAA 2TDXA 3W2VA 5BS6A 3IRQA 3KZZA 1W36D 5E17F 2PYGA 4U4BA 3H5RA 2K3PA 4V2GA 5EEGA 3WTXC 2JJ1A 2IOUG 4HOBA 1ZUNB 3U1KA 4YIRX 2YWGA 3BC8A
chains in the Genus database with same CATH topology
2ZSHB 3MKYB 4JQFA 3HUGB 3FPPA 4YELA 2LZJA 3H94A 2XSJC 4CCJA 1MNEA 3OR2C 4PFOA 3SEQA 3HXLA 3QYFA 2O0VA 1WJBA 2IQ7A 3I9V2 4CZCA 4CCLA 4NNJA 4LITA 2QKLB 3AFHA 3H5NA 3NWTA 2KRCA 1YE9A 5LD2C 1MABA 1MMNA 3T51B 2JVHA 1Z21A 2V4JC 3HPGA 3OWTA 3ONQA 3QYBA 1T95A 3OIPA 3UW0A 3OL3A 2IGOA 1P9QC 4AVZA 2VPLA 4FASD 3B8YA 2UV1A 4HPQA 4PJNA 1X0CA 1COWA 1G8XA 3W2WA 4NQWB 4MXNA 1VLYA 4KJZA 2HPIA 2KHMA 2Q1ZB 4U7BA 1O8MA 3DQVC 3J7AY 5HNHA 4Y3OA 3OYDA 4C2UA 1W0KA 4JMQA 4BUPA 5HVQC 1BLIA 1CZFA 4Z03A 5LFAA 2WB1A 3ZR8X 1U0JA 2IXSA 4F92B 3CESA 3K70D 4IQJA 1W0JA 2GJKA 1UD3A 2MC4A 4U49A 1OR7C 3ZXSA 2XF5A 4BQNA 2VQLA 2XZPA 1EE6A 2NT6A 4CCOA 3GRHA 2NTBA 4ZDLA 2HPMA 4MLOA 4BGDA 5JHFA 2IS6A 1Y6IA 4IX7A 3PNVA 2L9NA 2F43A 1O8JA 3DDYA 2O0WA 4MR0A 3SUCA 3L2VA 4BACA 3S3MA 2ZZQA 4I84A 4XNFA 1N75A 4BXFA 2V26A 2X51A 3DEEA 1Z7LA 1V5FA 2GOMA 2KMUA 3FDYA 2R7OA 3PSIA 4XLFA 3BG6A 3OYIA 3S3OA 4XM3A 4KKSA 4XN0A 3S3NA 4ITVA 3IP4B 4PJMA 3B90A 2P0WA 4E7IA 2D3NA 2DJIA 3OYNA 4XKWA 1VBLA 3UNGC 2W1OA 2QKMB 1JI8A 1BR2A 1XG2A 5TGTA 3AL0C 2ZXHA 2WAEA 4H4KC 1BMFA 3OIQA 3VSTA 1D1AA 1Y56A 1LVKA 4C30A 4C2TA 2KVOA 4OJPA 1WTHD 4G7WA 5CQGA 3EUAA 2MFZA 3L2UA 1WJEA 2ZTGA 4KKUA 5KHDA 2VB6A 4KT6A 4OJLA 3K4BA 5HLTA 2WAFA 4XLEA 1PE9A 3DPLC 3T56B 3VYUB 2X6WA 1BR1A 3I3LA 1RU4A 1FMVA 2VJIA 2WY8Q 4BEHA 2Q2EB 5FROA 1IRXA 3DU6A 5C1CA 3OYMA 3G05A 2V6EA 2W82A 3FHNA 4TSFA 1V5GA 2KQRA 4D9JA 3ZRGA 3OY9A 3K4MA 1GLNA 2LH9A 4RM2A 1NHCA 1Z3YA 1NBMA 3BG7A 3HL2A 1EA3A 2M7AA 3AL0B 2WJYA 2XOKA 1X1BA 4OJ6A 1K6YA 2XC7A 4UZUA 2M3AA 4B48A 2W6IA 3LSKA 1E43A 2VJ4A 4XL9A 2O17A 2DT7B 3PUBA 2W7NA 3KX2A 4YEJA 3RQ4A 2PECA 4BJ5C 2KL4A 2LC2A 4BE0A 2OUMA 2O04A 1VJSA 4DGWB 1BHEA 4URRA 4CA0A 3ZCOA 2F4IA 3VYSB 3VYTB 1PJRA 1DBOA 4AU7A 3GVJA 1O8GA 3DPTA 3VR6A 3CP2A 4J00A 2OV7A 3QODA 4OZZA 2BOLA 5FL7A 5AMVA 3GVLA 2VLAA 1LKXA 1RWRA 1MMGA 2CFOA 3HOSA 3RPUD 4F93B 3VMWA 3ZIAA 2EWEA 4RLFA 2V31A 2M4KA 4OAZA 3S93A 4XKCA 3OOUA 3OYHA 3IUOA 2W4SA 2X8KA 4XMYA 3A3BA 1X1DA 1UD2A 3A2KA 4B3FX 3K4JA 3TBIA 1K28D 1UD8A 4XOPA 2XZLA 1WJ5A 1H8HA 3G2BA 3VSUA 3E0JB 3OOCA 4CUGA 4OAYA 4P5OA 1FX0A 1X4PA 2R7QA 4XQFA 4YRVA 4II3A 4HIZA 3H5AA 1QCXA 2ZXIA 4CCMA 2R4GA 3HAGA 2F5VA 3ZSCA 3DKYA 1NG6A 3CZ6A 2MABA 2A6TA 1T5EA 3FY3A 1OFMA 2F1MA 4YZQA 3DTIA 4E4HA 2ZZFA 3LMWA 4E7ZA 3CJQB 2V9KA 2X6YA 4RMNA 4G6TB 3MKZA 1WP6A 3M1CA 3SEZA 2CMPA 2DXIA 2ZFUA 2KZVA 3JU4A 1HVXA 2HDWA 4BE1A 4F91B 2Z16A 2XAUA 2K9MA 4BJTA 3N05A 1FMWA 1J09A 4RLQA 2XZOA 2HVQA 2VKDA 3E1SA 4X0GA 4ZTJA 3JURA 2WBMA 2MYSA 3BLYA 3HC7A 2HVSA 3BC9A 2NT9A 1I8DA 1OOCA 3OFNA 1DQUA 5HKKA 2FUG2 2VKHA 3K4LA 2LYCA 1O8EA 4U87A 1WMRA 3A3GA 2O1DA 2JJ2A 2ZZGA 4P22A 4LIVA 1PXZA 1DP3A 5CDFA 5KCMA 4OWRB 2VQCA 1MMDA 2IGMA 2ZZEA 4QPOA 4XLHA 4G7XA 2VXDA 5FRNA 3OYJA 1O8DA 1E0EA 1D0ZA 4Z06A 2DCEA 2KP6A 4DBRA 3OAAA 1KTWA 3OEEA 2BSPA 2GJRA 2XF6A 2RQQA 4BE2A 3EPZA 4W8QA 4OJ5A 3K4CA 4DNTB 4IQ4A 2AQEA 2HQAA 3SDBA 4CCKA 4ZTFA 1UAAA 4DK0A 2BW3B 2PMZA 1ERDA 5IK2A 2LREA 1JRGA 4Z05A 2Z8GA 3H0DA 1W36C 4BQOA 2ZTNA 4N4NB 3L2WA 4ANJA 3F9KA 3A4CA 1O8FA 1WPCA 3WQZA 1DBGA 4DJAA 3PSFA 2BVMA 2UVFA 2D3LA 1E1QA 4AYBA 3OYBA 1OFLA 4PJLA 3WWGA 3EUHC 4KISA 3FKSA 4PMHA 1X1CA 4W8SA 2HVRA 1E3ZA 3A1YA 3PNYA 1H80A 1IDJA 4B3XA 5KNLA 1NG7A 2IS4A 2M5SA 4C9YA 3OYLA 2JUGA 2X53S 3UR3C 4E7LA 4KKTA 3VSVA 2LG4A 4HNTA 3BH4A 3M8JA 3V42A 2CK3A 3VMVA 3OS1A 2XNDA 3U21A 1BR4A 2IGNA 2QX3A 1WJDA 3ZQQA 1YX3A 3K6GA 3S8PA 2GK6A 2R7VA 2BW3A 1BOBA 4BQQA 1MMAA 1WFXA 3AKZA 2NTPA 4BS9A 3SZGA 1BN8A 3T53B 2ELJA 4BJ6C 2WJVA 2INUA 3LSMA 3K10A 2VASA 4XONA 4GRIA 2RNGA 4E7SA 2GK7A 3LNNA 1HZEA 2QE7A 2Y0SA 3K4NA 4BU2A 4II2A 1T0FC 3GQBA 3GQAA 4E7JA 3K70C 1OHHA 4HSTA 3T9GA 1SKYB 2DIEA 2W6JA 2CUZA 2WADA 1AA7A 2UWMA 3FBIB 3IAS2 2O5RA 2HNHA 2R7TA 2JSPA 3K4KA 4XN3A 2E1MC 3PFYA 2VL8A 3OYFA 3QYEA 5HOOA 1HA8A 1O8LA 4PUSA 4PFPA 3OEHA 3GQ7A 1S9HA 4Z1MA 4NK8A 1KMHA 5C1EA 3DWLE 3OYAA 4ZC3A 2NSTA 4OJOA 2VBMA 5CQEA 4EATA 1O8HA 1O88A 2CH0A 2E60A 3OL4A 2KLOA 3D5LA 1AIRA 1PKVA 1O8IA 2E1BA 2L9SA 3DTKA 2X1EA 3CMMA 1SAUA 2LBFB 4XR6A 1G59A 3VSLA 2X3HA 4XLCA 2WSSA 1VF7A 3MD2A 4P1WA 2R7RA 1GQ8A 1QJVA 1KONA 1D0YA 4B3GA 4N4OB 1UELB 3ZPNA 4DIQA 3PL8A 3OE7A 2JVGA 2VBKA 1TT0A 2E1MB 3S32A 1D1CA 3GQ8A 1MNDA 4B44A 2JA2A 2IS2A 2LY1A 2Z1DA 3GQ9A 3H9JA 2VBEA 3OPOA 2K5CA 2DT6A 3L2QA 1UG0A 1EFRA 3VDXA 4J01A 2L2OA 3PJRA 2LOOA 1KCCA 3GVKA 3KRGA 4FXUA 2X6XA 1HG8A 4Y4RA 1QHGA 2HZDA 1ZELA 3OYKA 5DN6A 2CS3A 3IAM2 4QPQA 4B47A 2QXZA 4IZZA 1W9XA 3C2GA 1D0XA 2LBFA 3CP8A 4F3QA 1E3XA 1YX5A 1DGWY 1Z3XA 3EUKL 4D1QA 5FRMA 1UD4A 1VZ0A 1D1BA 2KRHA 2V1NA 2X1DA 4LIUA 4PSWA 3ZPPA 1WJFA 4LG3A 3OS0A 3KEWA 4JOMA 2R7UA 2DOAA 4YXWA 1IB4A 1RMGA 4DK1A 2K9LA 2INVA 3BCDA 2R7SA 3OYGA 2V4DA 2JDIA 4GQNA 3A35A 1QHHD 3KEYA 4XLAA 2GOXB 4F52A 1E1RA 2JIZA 2ODLA 4TKOB 2HU9A 3BCAA 3LFUA 4YZ0A 2HLDA 2NZMA 3D5SC 4CH7A 2WA0A 2Z2SB 3BCBA 4NK6A 4ZJZA 4BL0B 1X4OA 4RM3A 3LSHA 4E7HA 2R7XA 3DPUA 2IS1A 3VWBA 4DNRB 3MMYB 2NSPA 2VQGA 3NWSA 3VYRB 4ASUA 1K5CA 3HOTA 2W00A 3LSIA 4CSWA 2L5QA 2NOJB 5CKTA 3ZGKA 4PK4A 4TT3A 2WPDA 2WZPP 2CW8A 3OYCA 4W8TA 2VIXA 1R6RA 3OMYA 1IDKA 1X19A 1JTAA 4OZYA 2E5NA 4KITB 1OGMX 4R79A 2X1CA 4BEHB 3SYTA 4DBQA 4HSRA 2NTQA 3LSGA 4YZXA 4HG2A 2CUJA 2VJ5A 2Z6BD 4BDYA 3RCOA 3DTEA 2XGJA 3CJRB 4XKBA 3QOEA 4HRIA 4EW9A 4BDZA 2RREA 1DGRM 2L7KA 3CF2A 4ZYAA 4E7KA 3PNTA 1E79A 2MD0A 2ZSIB 2CW7A 2IGKA 4E6KG 2F6CA 1KZLA 1O8KA 2V7QA 2KPMA 4C2LA 2UVEA 1MW7A 1OGOX 4B43A 3DU5A 1N77A 2X85A 2CV1A 3OR1C 1SFKA 3C2HA 3W2AA 2PYHA 2XF7A 2VJJA 2A5WA 4HEA2 1WJCA 4YZAA 2VXZA 3NE5B 3LL7A 1I18A 3HKZA 1BPLA 3RSNA 3EQOA 1PYVA 4CCNA 1UD6A 3VSKA 3TL4X 4HNUA 1NRKA 2M7BA 1UD5A 3FBNB 1QU3A 1V0FA 3EQNA 4NC7A 1TZLA 2M0MA 4F55A 1LDKB 3D5RC 2PJRB 3W3CA 1KCDA 3H35A 4ZDOA 1N78A 4W8RA 2LRDA 2AQFA 4E0FA 3OYEA 4XORA 2R9VA 4XOTA 4PSXA 1LFPA 2GJPA 3RTRA 1X1AA 2KDOA 2UUZA 3GBGA 3MKWB 2M4GA 5HNFA 2LY2A 3B4NA 5CPRB 3FKJA 3HPHA 4DOZA 4XD7A 2V7FA 3BCFA 4ZDPA 4G6IA 2BVLA 2I8DA 2WAQA 3LMMA 2CV2A 3OW7A 3DLAA 1IA5A 1V0EA 4XKVA 3TMOA 2QY1A 1OB0A 3DKXA 3H9QA 3KYLA 1H8EA 4NC8A 4L8JA 4Y33A 3H9GA 2E5ZA 2R7WA 2CV0A 3HG9A 1V5EA 1WJAA 4PJJA 3W2VA 2PJRA 4IKFA 1PLUA 1W36D 2WY7Q 2PYGA 4U4BA 3H5RA 2K3PA 3OS2A 4HWVA 4NUBA 2OC6A 2JJ1A 2XDVA 2VQHA 1OLTA 4FETA 3L2RA 3BC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  4NK8 A;  4YEL A;  3VSV A;  2O0V A;  4XLA A;  1BHE A;  4URR A;  2IQ7 A;  2ODL A;  1DBO A;  3VMV A;  4YZ0 A;  1O8G A;  2NZM A;  2QX3 A;  4NK6 A;  4OZZ A;  5AMV A;  1RWR A;  2NSP A;  2NTP A;  1BN8 A;  3VMW A;  2EWE A;  3UW0 A;  4AVZ A;  4W8T A;  2INU A;  1IDK A;  4XMY A;  3B8Y A;  4XON A;  1JTA A;  4OZY A;  1X0C A;  1OGM X;  4MXN A;  4XOP A;  3GQA A;  1O8M A;  2NTQ A;  4YZX A;  3T9G A;  3VSU A;  4Z03 A;  1CZF A;  4XQF A;  4EW9 A;  1QCX A;  4U49 A;  3ZSC A;  4XN3 A;  1EE6 A;  2NT6 A;  3FY3 A;  1OFM A;  4YZQ A;  1O8K A;  3LMW A;  3GRH A;  4C2L A;  1O8L A;  2NTB A;  2UVE A;  3GQ7 A;  2X6Y A;  1OGO X;  4MR0 A;  2X85 A;  1O8J A;  2O0W A;  5C1E A;  2NST A;  4OJO A;  2PYH A;  3SUC A;  2VJJ A;  2VBM A;  4I84 A;  4XNF A;  1O8H A;  1O88 A;  4YZA A;  4XLF A;  1AIR A;  1O8I A;  3EQO A;  3JUR A;  4XM3 A;  4XN0 A;  3B90 A;  2NT9 A;  1OOC A;  4XR6 A;  4XKW A;  1VBL A;  2X3H A;  4XLC A;  3EQN A;  1O8E A;  1GQ8 A;  1QJV A;  1WMR A;  2O1D A;  1XG2 A;  1PXZ A;  1KCD A;  2VBK A;  4OJP A;  1K5C A;  4W8R A;  3GQ8 A;  3VST A;  4XLH A;  3GQ9 A;  4XOR A;  2VBE A;  1O8D A;  4XOT A;  4Z06 A;  4OJL A;  3B4N A;  1KTW A;  2BSP A;  4XLE A;  1PE9 A;  3KRG A;  1KCC A;  2X6X A;  1HG8 A;  2X6W A;  1RU4 A;  4W8Q A;  2VJI A;  4OJ5 A;  1IA5 A;  2QXZ A;  4XKV A;  2QY1 A;  5C1C A;  1JRG A;  4Z05 A;  2Z8G A;  1O8F A;  1DBG A;  2UVF A;  1NHC A;  1PLU A;  3ZPP A;  3WWG A;  1OFL A;  4OJ6 A;  4PMH A;  2PYG A;  4U4B A;  4W8S A;  4HWV A;  1IB4 A;  1H80 A;  1IDJ A;  1RMG A;  4XL9 A;  2O17 A;  2INV A;  4YEJ A;  2PEC A; 
#chains in the Genus database with same CATH topology
 4JQF A;  4YEL A;  1WOS A;  1MNE A;  3ABM H;  4PFO A;  3SEQ A;  3HXL A;  4EVI A;  1VQ7 I;  2Z9O A;  2IQ7 A;  3I9V 2;  2ESH A;  3HOW J;  3L9F A;  4RD2 A;  4G5G A;  4CZC A;  2PN6 A;  1BW5 A;  1R5O A;  4GYI A;  4GXO A;  2DA1 A;  2QKL B;  3BZC A;  2O6W A;  3H5N A;  3CCJ B;  2C5B A;  3NWT A;  5LD2 C;  1QA2 A;  4X8I A;  2HGC A;  3HEF A;  5KVR A;  2ADU A;  2RDP A;  2YU3 A;  3G1M A;  3JTH A;  2IA0 A;  4A3L J;  1T95 A;  1ZM4 A;  5H6R A;  5EEA A;  1X2M A;  3KYD B;  2FXA A;  3WXM A;  1OKR A;  4AD9 A;  2NV4 A;  2GXA A;  3CCU I;  1OCP A;  2Y2Z A;  1MBK A;  3G71 I;  1SKQ A;  3BG9 A;  4PJN A;  1IXS B;  2K7L A;  2H6C A;  2Q0O A;  5GAH J;  1XDU A;  4BNC A;  1P2F A;  3ONY A;  1I1G A;  5CJ9 A;  2OF7 A;  3A02 A;  3SDG A;  4Y3O A;  3TQN A;  3OYD A;  4BY7 J;  2DK5 A;  2OQR A;  3HUG A;  5HVQ C;  1BLI A;  1QQ1 A;  3K1N A;  2Y9Y A;  3ZR8 X;  2P5K A;  5LFA A;  2E2I J;  2XTY A;  1KQ8 A;  2IXS A;  2L01 A;  2MSY A;  3TO6 A;  4F92 B;  2R0Q C;  3E6C C;  2MC4 A;  3K1P A;  4U49 A;  1WWX A;  4BQN A;  4CDG A;  2V7U A;  2IW5 A;  2NT6 A;  1EFC A;  2VFO A;  3BY1 A;  4CCO A;  1TNT A;  1O4X A;  2NTB A;  5J35 A;  1WGX A;  2QQA A;  1SAX A;  1JKO C;  4MR0 A;  4IX7 A;  2QQ8 A;  2L9V A;  2O0W A;  2P6T A;  2P81 A;  3FXQ A;  3QFR A;  3BZ6 A;  5HXB A;  4IRG A;  2NVY J;  4FIS A;  5E1W A;  3W5V A;  3FMR A;  5FB2 A;  2V26 A;  3PSI A;  2MLK A;  2G7H A;  1V5F A;  3FDY A;  4UZF A;  3OYI A;  1FNB A;  4XN0 A;  3HRM A;  3IP4 B;  4PJM A;  3U9G A;  1HXD A;  2GRE A;  1TUI A;  3ASS A;  3MMP A;  2W85 A;  2OTL B;  4RPD A;  3CMA B;  1F60 A;  3FZV A;  1SFE A;  3BJ6 A;  5TGT A;  2ZXH A;  4H4K C;  3AL0 C;  1BMF A;  3PUN A;  1RNL A;  1D1A A;  1LVK A;  4C30 A;  2ZJR F;  3CRZ A;  1WTH D;  3RY8 A;  4U0V A;  1WJE A;  4Z4V A;  2K9Q A;  5KHD A;  2VB6 A;  3CMY A;  2RC4 A;  3R0J A;  4XLE A;  1PE9 A;  3DPL C;  3T56 B;  5KAI C;  3AGQ A;  2X6W A;  1BR1 A;  3I5U A;  2BYV E;  1FMV A;  2WY8 Q;  2AS5 F;  1QGZ A;  1KU2 A;  4BEH A;  4BHC A;  3WHC A;  2VBV A;  2VBZ A;  3KEO A;  2BM4 A;  2ICW G;  5C1C A;  3GF2 A;  2DI3 A;  2J5O A;  4LFU A;  2XGC A;  3FHN A;  2BY2 A;  3ZMT A;  3GUD A;  1V5G A;  4QLC U;  1VQ6 I;  3DFG A;  4D9J A;  3CO6 C;  3SYJ A;  1IXR C;  1A31 A;  4RM2 A;  5F1R A;  1G4D A;  5LEK A;  4DQ2 A;  3BG7 A;  3AL0 B;  1EA3 A;  2WJY A;  1WXR A;  4EQQ A;  1I3A A;  2XC7 A;  5M5W J;  4CHU A;  4UZU A;  2W6I A;  4C43 A;  4XL9 A;  2ELK A;  2DT7 B;  3MVP A;  3PUB A;  2PEC A;  2J8I A;  2KL4 A;  4LK0 F;  4BXX J;  2OUM A;  4RAG A;  4Z2Y A;  2HMA A;  4X7E A;  1JGS A;  4C2M J;  2QBY A;  3QP6 A;  1BHE A;  1XGS A;  2FQ3 A;  4AIJ A;  3H3V K;  2OA4 A;  3GVJ A;  1MKM A;  3DPT A;  4XRS A;  3F21 A;  4KMU X;  3VR6 A;  1Y39 A;  2E7W A;  2PMZ N;  3CF5 F;  1WZ2 A;  2OV7 A;  3KP4 A;  3QOD A;  4F7D A;  3M1E A;  2BOL A;  3CD6 B;  1CNF A;  5A2Q Z;  2NPF A;  1RWR A;  1MMG A;  2CFO A;  1R9T J;  1ZM3 A;  1H89 C;  3ZIA A;  2EWE A;  3SY2 A;  2M4K A;  4OAZ A;  5K1Y A;  3G73 A;  3OZW A;  1XMK A;  1NDH A;  3A3B A;  5HZA A;  4XMY A;  4AM3 A;  1R36 A;  3O8G A;  2J7K A;  1X1D A;  2JA6 J;  3ELK A;  3TBI A;  5FLM J;  3HJE A;  2XZL A;  5DM7 F;  2OBT A;  1OMI A;  3S2D J;  3CCQ B;  1Q1H A;  1W5C C;  3FF5 A;  4XLN F;  1H8H A;  3WTT C;  3G2B A;  3V76 A;  1K9M D;  5DCM A;  2QSF X;  2GWR A;  1HKQ A;  1X4P A;  2NNN A;  4HIZ A;  2C4T A;  2M2E A;  3H5A A;  2ZXI A;  4XIC A;  4CCM A;  2HDN B;  5IYR A;  2F5V A;  5TV2 A;  3DKY A;  1NG6 A;  4M9S A;  2A6T A;  1T5E A;  2F1M A;  2BVN A;  4ZGN B;  1OFD A;  4E7Z A;  4ZYE A;  2HZT A;  3MKZ A;  3FKI J;  2WV1 A;  4G6T B;  2BGI A;  3M1C A;  3SEZ A;  2ZFU A;  1JNY A;  2PMD A;  4BE1 A;  1I6H J;  2R3S A;  3N05 A;  1G7R A;  3CCR B;  1Q7Y D;  2V1D A;  4RLQ A;  2XNJ A;  2XZO A;  5E79 C;  1TVC A;  1SMT A;  2VKD A;  1SVO A;  4FE4 A;  2WBM A;  2WWY A;  2MYS A;  1Q82 D;  1SMY F;  3BC9 A;  3LOC A;  3G3Z A;  2ZJQ F;  1KYZ A;  3FM5 A;  5L3D A;  1VQP I;  3JRB A;  2FUG 2;  4EJV A;  4BKX A;  3V8L A;  2PIA A;  3I0T A;  4U87 A;  1BIB A;  2HOA A;  2L0K A;  2ZZG A;  4P22 A;  1VQ5 B;  3C7J A;  2ZJ2 A;  5BPI A;  4TMX A;  4YFX F;  5LHG A;  2VQC A;  1I5Z A;  4BHB A;  1YS7 A;  5K7Z A;  2VXD A;  4XRM A;  1E0E A;  1D0Z A;  3G6E I;  3LA2 A;  4RS8 A;  1NTC A;  1SFU A;  2JQ7 A;  2W84 A;  4MIM A;  2NXN B;  4LLN A;  4EMS A;  3OEE A;  5AIP A;  1K8F A;  3PIO F;  1EH6 A;  4HQE A;  1LEA A;  2WAQ N;  3FX3 A;  4W8Q A;  1XTA A;  4OJ5 A;  2F4N A;  1JTX A;  4DNT B;  2HQA A;  3CMA I;  4ZTF A;  2BV3 A;  3MZ8 A;  3E5Q A;  3BJO A;  2Z8G A;  3H0D A;  4N4N B;  3ZZ0 A;  2FNP A;  3F9K A;  1Z0X A;  4A3F J;  3W6V A;  1WPC A;  1KYW A;  2K9S A;  4FCY A;  1O8F A;  3PSF A;  2D3L A;  4WZL A;  4AYB A;  3ZMU A;  5LHI A;  1N07 A;  2B0R A;  2FBK A;  3SLD A;  1HW1 A;  2HS5 A;  2HVR A;  1XGN A;  1E3Z A;  1LQ1 A;  1D1N A;  1H80 A;  4GDF A;  2Y69 H;  1AIP A;  1JB9 A;  1NG7 A;  4F7Z A;  4HAM A;  3P9K A;  3OYL A;  2CJJ A;  2HXI A;  2X53 S;  2P7V B;  4QVJ A;  2MC3 A;  1J9I A;  3J7A O;  4PJ0 C;  2O9L A;  1KU7 A;  3P9I A;  1YRN B;  2XPW A;  2ZNY A;  3GX4 X;  4OM9 A;  3V42 A;  3GLX A;  2KJB A;  3GFL A;  2CK3 A;  1WJD A;  4M3F A;  3K6G A;  4YAL A;  2R7D A;  1VQ9 I;  4RD0 A;  5GAE J;  3V7A A;  2R7V A;  2BW3 A;  2FVG A;  2IAI A;  1XSV A;  1ZKG A;  1G3S A;  2FBH A;  1WFX A;  2BEO A;  3TKY A;  3AKZ A;  2ZL7 A;  2XTX A;  3RIR A;  4A0X A;  3I4M J;  4BBR J;  1RUN A;  2YUS A;  3F8N A;  4HX8 A;  3SJZ A;  3RYR A;  3KLO A;  3O8H A;  2WJV A;  1PJ6 A;  5J1Y A;  2XEX A;  4BHP A;  3GIR A;  3LNN A;  2PQ8 A;  3PSZ A;  3K4N A;  3VB2 A;  3LQE A;  1T0F C;  1JHF A;  4ABZ A;  4E7J A;  4RB3 C;  3IH4 A;  4AID A;  1OHH A;  2VFN A;  1QFY A;  2EFN A;  3T9G A;  1SKY B;  4G8X A;  4KUM A;  2WAD A;  4IF4 A;  1XMX A;  1AA7 A;  2H27 A;  2EPF A;  1IRG A;  1IV6 A;  2R7T A;  2QEX I;  4AIK A;  1B72 B;  3FXM A;  1T33 A;  1KK2 A;  3QYE A;  2JA7 J;  1IB0 A;  5CVU A;  2B7C A;  2D5V A;  4CXF A;  1L0O C;  1S9H A;  2BM7 A;  1F5T A;  2STT A;  1KMH A;  3N90 A;  3M3Y J;  1FOK A;  4ZC3 A;  2NST A;  3S1M J;  3BR3 A;  3F6O A;  3RDI A;  3IRR A;  4CGZ A;  5CQE A;  4EAT A;  3JR9 A;  2DN0 A;  3EQL F;  3CCV I;  5EDN A;  2KLO A;  3I53 A;  4G6D A;  4KNY A;  1O8I A;  1JGG A;  1M1K D;  1N05 A;  3E1Y E;  3AVX A;  1QZY A;  4UNO A;  2LBF B;  1JA0 A;  5L3C A;  1QH0 A;  2BXY A;  4N3G A;  2W57 A;  2W7Z A;  1OCC H;  4XLC A;  1QVT A;  1JA1 A;  2XVC A;  2DPD A;  2WSS A;  5TR9 A;  1D0Y A;  4YFN F;  3O3K A;  4MHG A;  4N4O B;  5D5V B;  4KMF A;  3ZPN A;  3PET A;  1L3L A;  5LRS A;  2ZBK A;  1W87 A;  4YFO A;  2Z1D A;  1ZGA A;  3LA3 A;  2ZL6 A;  4WXD A;  3M4O J;  1O57 A;  2YR2 A;  4H0E A;  3Q9S A;  4JP0 A;  1VQM B;  3OV8 A;  1ZM2 A;  1F43 A;  1Z77 A;  4OPW A;  1S3J A;  3CUQ A;  2P7C B;  3PJR A;  1RI7 A;  3GVK A;  3U6B A;  3T8R A;  1XFO A;  2VYQ A;  3ERE D;  2X6X A;  1H88 C;  4Y4R A;  2DJN A;  3MCA A;  1ZEL A;  1HG8 A;  4ASN A;  3GEZ A;  1ITY A;  1OCZ H;  2DYI A;  5FLX Z;  2JRT A;  1D5Y A;  1FZP B;  3OSF A;  2C2W A;  1I1S A;  3ASR A;  4F3Q A;  4X05 A;  1YX5 A;  4LD5 A;  1UD4 A;  1ZR4 A;  4IXA A;  4A3E J;  3KP6 A;  4LLG F;  2KRH A;  2L02 A;  4EM1 A;  2QF7 A;  4PC6 A;  1IXC A;  3RKW A;  1ZAO A;  3DBR B;  1TC3 C;  2R7U A;  1TWG J;  2CG4 A;  2CRV A;  4G7H F;  2WTE A;  4X7C A;  1E17 A;  4BQA A;  2DOF A;  3MWM A;  2QVO A;  2GOX B;  4XLA A;  1YI2 I;  5HS8 A;  1LEB A;  1FOX A;  2JTV A;  2YWE A;  2CQX A;  5K5Q A;  4KIC A;  3RI4 A;  4TKO B;  1OQY A;  5K7H A;  1FBQ A;  1N06 A;  2WA0 A;  4NK6 A;  4ZZL A;  3OIO A;  2R7Z J;  3PIP F;  1SD7 A;  4RM3 A;  3EET A;  3CCS B;  2PLF A;  4ON0 A;  1JXS A;  2NSP A;  2NRA C;  3NWS A;  5ILS A;  3VO1 A;  1JT0 A;  4OOS A;  1G7T A;  1V55 H;  5DDG A;  2CW8 A;  3OYC A;  5H5J A;  1VND A;  1R6R A;  3OMY A;  5DTD A;  1X19 A;  1SAN A;  2E34 A;  2E5N A;  4KIT B;  3E5U A;  5FO5 A;  1QA3 A;  5DV5 A;  1K79 A;  4HG2 A;  1B8I B;  5FKL A;  3WGI A;  1CF7 A;  4RDJ A;  2HCJ B;  1XSD A;  4BDY A;  2XGJ A;  3DTE A;  1VQO I;  3CCY A;  3E3V A;  3DBH B;  3FMQ A;  1CGP A;  4HRI A;  4G1V A;  5B1B H;  1OYY A;  3ZZU A;  2L7K A;  3CF2 A;  4ZYA A;  4L0Y B;  3W5U A;  4E7K A;  1GV5 A;  3PNT A;  1TYX A;  2ZSI B;  1XB4 A;  2CW7 A;  1IZ1 A;  4G12 A;  4P12 A;  1TYW A;  2IGK A;  4KH3 A;  2V7W A;  2H6B A;  2KPM A;  1IUY A;  4XRS G;  1OGO X;  4B43 A;  4YAO A;  1Q1V A;  3OR1 C;  4WXC A;  1SFK A;  3C2H A;  2E1N A;  2G7U A;  5IP9 J;  2XF7 A;  2VJJ A;  4HF0 A;  2HQN A;  3W2A A;  2PYH A;  3CCM I;  4L5E A;  1GJR A;  3LL7 A;  3I59 B;  3BOQ A;  2LY9 A;  4Y13 A;  4P6V F;  1B9M A;  3HKZ A;  2NAZ A;  4CCN A;  3JX8 A;  3WND A;  3VSK A;  2R7F A;  3T1B A;  1QGY A;  5IT3 A;  1UD5 A;  1WRJ A;  5F64 A;  4KA4 A;  4IOA F;  3OKX A;  2OQG A;  2R5Z B;  4NC7 A;  1S6L A;  1TZL A;  1H0M A;  4F55 A;  1N08 A;  1OCO H;  3J7Y J;  3JRF A;  4DNC A;  4A3K J;  1KCD A;  1MJB A;  1R5G A;  1U5T A;  3AG2 H;  2V5I A;  3JQP A;  2AQF A;  2A05 A;  2O8X A;  3BQY A;  4Z6Y A;  3OZV A;  4U9U A;  4E0F A;  4GGG A;  1VF9 A;  2A68 F;  1U9N A;  3RTR A;  2QWW A;  2YWH A;  2DMP A;  2JRM A;  2M4G A;  5HNF A;  1DPR A;  2LSO A;  1Z1D A;  2LY2 A;  2OD5 A;  4MQV A;  3S15 J;  3G4S B;  3B4N A;  4DOZ A;  5IYD J;  5EMN A;  1V3F A;  1GVH A;  3BCF A;  4IHV A;  2I8D A;  3LMM A;  2M34 A;  2FBI A;  2QLZ A;  3DLA A;  3OW7 A;  4PGO A;  1V0E A;  1CLW A;  4M6Y A;  1OB0 A;  4WX9 A;  2QZ8 A;  1U6G A;  1R5N A;  2MG4 A;  2HEO A;  4L8J A;  4Y33 A;  3K69 A;  2EJR A;  5GPA A;  4P25 A;  5GPC A;  1V5E A;  4AYB N;  2VBS A;  2DDB A;  3P4G A;  2PJR A;  1VQM I;  1SVL A;  2WY7 Q;  3MKL A;  1L1I A;  4QWQ A;  1VQ4 B;  1MBF A;  1RET A;  1ORK A;  4NUB A;  1SFO J;  1EF4 A;  3BH7 B;  2XDV A;  3ZQL A;  2VQH A;  2Z33 A;  1OLT A;  1K61 A;  3S1Q J;  1XB2 A;  3WBJ A;  3MKY B;  2TCT A;  3HUG B;  4UUV A;  4IJA A;  2PE3 A;  1R4N B;  2IEK A;  4CCJ A;  3OR2 C;  4RGU A;  4PGG A;  4I6Z A;  2JMW A;  1T0F A;  3ZQF A;  2XAG A;  1E63 A;  1KGS A;  3A0B C;  1VQL I;  4OMZ A;  1K83 J;  2JVH A;  3OWT A;  1E62 A;  3SKB A;  4AVP A;  4YAF A;  1R5B A;  3FXU A;  3E7L A;  3QYB A;  4QVA A;  2EV6 A;  2R5Y A;  3UW0 A;  2IGO A;  1P9Q C;  2ZCW A;  4L9J A;  3FM3 A;  2VPL A;  3ERM A;  4HYE A;  4HPQ A;  4RLZ A;  2FQ4 A;  2CU7 A;  1G8X A;  3HRU A;  3W2W A;  1YLF A;  1VLY A;  4MXN A;  1RQP A;  1ZRF A;  5CYV A;  4U88 A;  4CIC A;  4KDP A;  1G3Y A;  1BX1 A;  3DQV C;  3J7A Y;  3PEN A;  4C2U A;  2ZC2 A;  5FA6 A;  1W0K A;  3J81 k;  5FKN A;  4OIQ F;  1GVJ A;  4A69 C;  1U0J A;  4DZJ A;  1UD3 A;  1GDT A;  3ZXS A;  2XF5 A;  2BMW A;  3WG7 H;  2XZP A;  3BPX A;  4W1U A;  1XE1 A;  4M3G A;  3A8J A;  1FBS A;  4TN1 A;  2F5E A;  5GV8 A;  2JSC A;  1BJK A;  2A6E F;  1YJN B;  5A89 A;  1C0W A;  2LKP A;  2IS6 A;  3PNV A;  2F43 A;  4MEY F;  2ACJ A;  3SUC A;  2XAQ A;  3L2V A;  4BAC A;  2ZZQ A;  4JX6 A;  2M45 A;  3E6B A;  1RES A;  2EH3 A;  4BXF A;  4XLF A;  5JHU A;  5FO1 A;  2R7O A;  2KMU A;  3LST A;  1NH3 A;  4KKS A;  2XT2 A;  4V2F A;  4XM3 A;  3OJW A;  1O3Q A;  3B90 A;  1TSP A;  5BNG A;  2D3N A;  3H09 A;  2DJI A;  3OYN A;  2OK7 A;  1VBL A;  2N8G A;  3UNG C;  4WCG A;  1U9O A;  3W6K B;  3VOE A;  2QKM B;  1JI8 A;  1BR2 A;  2BY0 A;  2XKP A;  4WZE A;  1KQ9 A;  4XLP F;  1X3Z B;  1WSR A;  1D8K A;  4YC5 A;  2KVO A;  4LBY A;  1MH4 A;  2ZME A;  5L3E A;  4V19 K;  1O3R A;  2L3D A;  1UMK A;  3CCE I;  3S1N J;  2ME6 A;  5J3L A;  2ZTG A;  3M8F A;  5JFR A;  2D74 A;  3Q3A A;  1NK2 P;  3K4B A;  2DOD A;  1R22 A;  2DMT A;  1NB9 A;  2WAF A;  1BQE A;  4GFB A;  5DSZ A;  5HDN A;  2IA1 A;  5C4J J;  3I3L A;  1BJA A;  3HSF A;  1XX5 A;  4D0P A;  4A6E A;  1QA1 A;  3WHB A;  1FYL A;  3BDD A;  1YS6 A;  1K8A D;  1IRX A;  2ZKZ A;  3GTQ J;  5J3O A;  2ZXW H;  3OYM A;  5HOD A;  4NDL A;  3TOA A;  1JE8 A;  1B8I A;  2W82 A;  5LRR A;  3DEU A;  4EEF G;  2D9R A;  1BIA A;  1CQX A;  3K4M A;  1FNN A;  1Y1W J;  1GLN A;  2LH9 A;  3GCM A;  1KJZ A;  1NHC A;  1NBM A;  1TQP A;  4OJ6 A;  3MQ0 A;  1X1B A;  4XK4 A;  1K6Y A;  2NNY A;  2QA4 I;  1S72 B;  1YLO A;  2E36 A;  3GTJ J;  2P5V A;  1V5V A;  2O17 A;  2EZH A;  1P4X A;  4YEJ A;  2W7N A;  5ILU A;  2P3M A;  3I71 A;  5DCM B;  4BE0 A;  4I09 A;  1DPU A;  5E8G A;  3H36 A;  3AVT A;  4P26 A;  2ZXJ A;  1YW7 A;  5EGO B;  1FLI A;  4P96 A;  3ZCO A;  2F4I A;  4BH9 A;  3VYT B;  2FU4 A;  3LAJ A;  1RC9 A;  3NAR A;  1DBO A;  1UHM A;  4AU7 A;  2BX6 A;  1O8G A;  1IW7 F;  3I59 A;  1FND A;  3CP2 A;  5AMV A;  3GVL A;  1ODD A;  2VLA A;  3OJX A;  1LKX A;  4MNU A;  2OTJ B;  1MSE C;  5D8L B;  2JA8 J;  2Q6I A;  4Y52 J;  2R5Z A;  4ACB A;  3RPU D;  4M72 A;  5GAG J;  4XKC A;  3IUO A;  1XS9 A;  2K9N A;  2C4U A;  1UD2 A;  2DYR H;  2Q6L A;  3K4J A;  3M7G A;  2DA3 A;  2FA5 A;  4MYU A;  4XOP A;  3QQA A;  2C5H A;  2XTW A;  1ETW A;  3GTP J;  2EA4 A;  2JT1 A;  3VSU A;  3OOC A;  1OPC A;  2LVS A;  4Q47 A;  3TED A;  4P5O A;  2EBI A;  1X2N A;  3NQO A;  4D5C A;  4CO8 A;  2CND A;  4TMV A;  5L3B A;  3SZP A;  2RC6 A;  2V1X A;  3I4P A;  1WI3 A;  1IRZ A;  1P4W A;  1BOA A;  3WU1 B;  1HDD C;  3CZ6 A;  1OGI A;  1QUE A;  1IDY A;  3FXL A;  2V9K A;  4RMN A;  1TLH B;  2IP2 A;  2DXI A;  3BR6 A;  4LBW A;  1LPQ A;  1HVX A;  3KP3 A;  4M3D A;  4DW6 A;  2XAU A;  2K9M A;  5H20 A;  2Y0S N;  4IRH A;  4RAZ A;  3I55 B;  2OPT A;  2HVQ A;  5LBQ A;  1VI0 A;  5LGU A;  3E1S A;  4X0G A;  3EYI A;  2HVS A;  4YIF A;  2XKO A;  4FQG A;  2V1U A;  2VI6 A;  1GV2 A;  1MBE A;  1UG2 A;  1T6Y A;  3ZUG A;  4UY8 I;  4EM0 B;  1D5V A;  1ZK8 A;  5GV7 A;  5THX A;  2O1D A;  4HV6 A;  4DYR A;  5EEH A;  1OCR H;  1QNT A;  3GW2 A;  2JJ2 A;  2VNH A;  3A3G A;  4OIO F;  2M1B A;  2XGE A;  1DP3 A;  1PXZ A;  1LLZ A;  1QPI A;  1FDR A;  3SEJ A;  2ZZE A;  1YJW B;  4QPO A;  4D5F A;  1ETV A;  3HB9 A;  5FRN A;  1O8D A;  2ZL5 A;  3WY9 A;  2X48 A;  3OAA A;  1FC3 A;  1KTW A;  4FHT A;  1JJ8 C;  3Q6R A;  1OIS A;  2RQQ A;  5B1A H;  4G1B A;  3D26 A;  1YW8 A;  3QPT A;  3ZOB A;  1Y0N A;  4DQL A;  3SDB A;  1VQN I;  2BW3 B;  1ERD A;  3BG3 A;  1WSU A;  1JRG A;  3L00 A;  1QZE A;  4ANJ A;  3A01 A;  1QRY A;  1LDD A;  2EIN H;  3RKY A;  4Z4Z A;  2UVF A;  2DTR A;  4HX7 A;  4HNV A;  3WWG A;  2GK7 A;  4PMH A;  1B9N A;  1EH8 A;  5D4R A;  1K7A A;  1P7J A;  4B3X A;  3W2E A;  1FBU A;  1YOV B;  4PDK A;  2M5S A;  4D7M A;  5C4X J;  2VNK A;  1YJ9 B;  2PFB A;  4KKT A;  4FX0 A;  1DDN A;  2COB A;  2KT0 A;  1UMQ A;  3NEU A;  4HNT A;  2WC2 A;  3BT9 A;  4MGR A;  2HQR A;  2JJ7 A;  3B6C A;  3HIF A;  2XPV A;  3OE7 A;  3VMW A;  2XND A;  3NRV A;  3PFI A;  3B8H A;  2QX3 A;  1P4A A;  1YIT I;  5ERI A;  3S8P A;  1QRC A;  4QFM A;  2WR8 A;  1BN5 A;  4B4C A;  2GK6 A;  2YUH A;  4XBF A;  2AHO A;  1ZG3 A;  1UB9 A;  1S72 I;  4L5I A;  3H9N A;  2NTP A;  4PCQ A;  1BN8 A;  4UV9 A;  3SFI A;  3T53 B;  3CJN A;  3AG4 H;  1AHD P;  5IYP A;  5H59 A;  3CUQ C;  2XPU A;  2J5P A;  3K10 A;  2O8K A;  2QCO A;  3GFJ A;  3DCF A;  5LGN A;  2V6C A;  5D8K B;  2RC5 A;  1I7P A;  3LSR A;  2XB5 A;  3GZN B;  4BAY A;  3K70 C;  2ESN A;  3QOP A;  1I3Q J;  3H3Z A;  2GA2 A;  5J40 A;  2DIE A;  1MGT A;  1FT9 A;  2CUZ A;  3S2W A;  1J5Y A;  3FBI B;  2DFI A;  3Q0U A;  2DET A;  1A04 A;  2QM3 A;  4WWV A;  1B59 A;  2EFG A;  2ZFW A;  3CC7 B;  2JSP A;  1JKR C;  5LMZ A;  2G0Y A;  4XN3 A;  2DT5 A;  2K86 A;  4LJZ F;  1B6A A;  3OYF A;  4ZYH A;  4A93 J;  5CVI A;  5EZH A;  2DER A;  5HOO A;  3ZBT A;  4PFP A;  4I0B A;  4OPO A;  3CUQ B;  5B3S H;  2VFP A;  1HF2 A;  1X3U A;  2BN4 A;  5ICG A;  3VNV A;  5CVV A;  1BI3 A;  3SFZ A;  4L9V A;  2CH0 A;  5KAF C;  1IRF A;  2E60 A;  2BM1 A;  3D5L A;  4A0Z A;  1PKV A;  1VQK B;  2E1B A;  4HDV A;  1MDM A;  5M3M J;  4UHT A;  3CCJ I;  4M2L A;  3JSO A;  5EGO A;  2DQR A;  4RPB A;  5ICE A;  1I6X A;  2X3H A;  1IGN A;  3MN2 A;  1GQ8 A;  1HST A;  4CYC A;  1UEL B;  2VBK A;  5ED4 A;  2JVG A;  5EG0 A;  4O3M A;  4Z4U A;  3GQ8 A;  1MND A;  2JA2 A;  3R0A A;  3LNQ A;  3PQK A;  3GQ9 A;  3H9J A;  4RCZ A;  3JRH A;  3ZBU A;  3CXC B;  1DU0 A;  1YIJ B;  2MA3 A;  1AWC A;  2L2O A;  3DP7 A;  1KCC A;  3F6V A;  4H9G A;  3KRG A;  3S1R J;  2GAU A;  4XID A;  1TWF J;  3OYK A;  3IAM 2;  4I01 A;  2XSD C;  3E20 A;  4IZZ A;  3PO2 J;  2CUE A;  1QUF A;  2L7M P;  4RD6 A;  3PA2 A;  3M8E A;  5H2F C;  1Q9S A;  1VFC A;  3EUK L;  4D1Q A;  3KPH A;  4RCY A;  3BWG A;  1D1B A;  2PJP A;  2EIM H;  2X1D A;  4LIU A;  3ZPP A;  1EKE A;  1ACI A;  1IN6 A;  1IN5 A;  3WG9 A;  3OS0 A;  3P9C A;  2DW4 A;  1ZRD A;  2V9V A;  3FWE A;  2FRH A;  2VE9 A;  2VC1 A;  4OOI A;  3GFM A;  5BOX A;  2CF4 A;  4RM0 A;  2XGD A;  4YXW A;  1RMG A;  1IB4 A;  3K2Z A;  1FPQ A;  4A3I J;  1GAW A;  3BCD A;  3OYG A;  2F2E A;  1CF7 B;  4OMY A;  3GTL J;  4GQN A;  1QHH D;  2BBY A;  1QZZ A;  4GYG A;  3PSS A;  4EJT A;  3HDD A;  3S17 J;  3BCA A;  4YZ0 A;  2AHQ A;  2RKH A;  2OTL I;  2Z2S B;  3BCB A;  1U5T C;  1ZGJ A;  1V54 H;  4A3D J;  4BL0 B;  1Y1V J;  2Y9Z A;  3F3X A;  3HTS B;  2IS1 A;  3E5X A;  2R7X A;  2F5D A;  3BRO A;  4DNR B;  4YEI A;  1ELO A;  1EZG A;  3SZE A;  2Z3Y A;  3VYR B;  5BQT A;  2V7X A;  5CVR A;  5CKT A;  2OU2 A;  5JMC B;  4TT3 A;  1XMA A;  2M87 A;  2HOE A;  4OZY A;  1ZAR A;  4MFE A;  5FNZ A;  2X6O A;  4R79 A;  2GQF A;  3SYT A;  4EM2 A;  2LKS A;  4DBQ A;  1TWH J;  1R49 A;  2YPR A;  3LQ6 A;  4HSR A;  2JA5 J;  1R71 A;  3LSG A;  5DM6 F;  4U7D A;  4R8H A;  1T38 A;  5L3G A;  2CUJ A;  2VJ5 A;  4HA8 A;  4R1H A;  2ZJP F;  3F0C A;  2L7F P;  1FIA A;  3CJR B;  3IC7 A;  3QOE A;  4G9Y A;  2VOO A;  1U5T B;  5DUK A;  1ZTR A;  4BDZ A;  3GTK J;  2RRE A;  4Y17 A;  5IOY A;  1LLW A;  2FJ1 A;  1JHH A;  3W2I A;  1Y0R A;  2DA5 A;  1ETQ A;  4WK8 F;  4UB6 C;  2F6C A;  1KZL A;  4C2L A;  3C1D A;  2O3F A;  4ETS A;  1G3W A;  3C3W A;  3QU3 A;  3ZP5 A;  3ZC3 A;  3BJA A;  4HEA 2;  1WJC A;  2M8G X;  3WTZ A;  4P9S A;  4YZA A;  4HZF A;  2VPR A;  2DPU A;  1IN8 A;  2YX4 A;  1I39 A;  1Z6T A;  2LNB A;  1BPL A;  1PYV A;  3CC2 B;  1SD6 A;  3TL4 X;  1NRK A;  3CD6 I;  1H9G A;  3HGY A;  3FBN B;  1BL0 A;  1V0F A;  2M0M A;  2OZ6 A;  1TT5 B;  1LDK B;  3D5R C;  5ICF A;  3N97 A;  2PJR B;  3VFZ A;  1YYV A;  1DDI A;  4ZV4 A;  4ZDO A;  1N78 A;  4LBV A;  4W8R A;  1Y0U A;  2LRD A;  2VOD A;  3NAW A;  4N9I A;  2PLY A;  3HZJ A;  5HDG A;  4RDL A;  4J19 A;  5FIU A;  2UUZ A;  3MKW B;  1TWC J;  3CCQ I;  1EJ9 A;  3QP5 A;  1BI0 A;  2UXX A;  1HW5 A;  2GA1 A;  3CW2 A;  4DQK A;  4LB5 A;  4N3N A;  4Q4Z F;  4G6I A;  2QZA A;  2GIZ A;  3WE3 A;  1XGO A;  1IA5 A;  4QHY A;  3KZY A;  3IL2 A;  2A07 F;  2WV0 A;  2QY1 A;  3M07 A;  3H9Q A;  5E3L A;  5JI6 A;  3BP8 A;  4NC8 A;  3KYL A;  1H8E A;  3AK5 A;  2MBF A;  3GFI A;  1W34 A;  2NVX J;  2M5W A;  4WZK A;  3TH0 A;  2R7W A;  5FD6 A;  2R5Y B;  2CGP A;  4J0Q A;  2GZW A;  3K9T A;  4RGS A;  5D4S A;  1PLU A;  4PJJ A;  3R60 A;  3ZQI A;  3J80 K;  1KK3 A;  4OOX A;  2CQQ A;  4TMW A;  1TTY A;  4AWX B;  4ENM A;  3K2A A;  3CCR I;  2OC6 A;  4YAW A;  2XUB A;  4A3C J;  5B5E C;  3L2R A;  2ZSH B;  4PGH A;  1KU3 A;  1GR1 A;  2LZJ A;  3U1D A;  3CME B;  1BA5 A;  4A5N A;  5FLV A;  2BGC A;  4PC7 A;  1ZRE A;  2XAF A;  1Z67 A;  1IUF A;  3L2C A;  1N8R D;  4CCL A;  4NNJ A;  1SM4 A;  5IYW A;  4CQJ A;  5HZB A;  3WTY C;  1VQ5 I;  3CPW B;  3CC4 B;  1YE9 A;  1KTV A;  3T51 B;  2V4J C;  1Z21 A;  3HPG A;  2ZME C;  2BHZ A;  3P5J A;  2DLL A;  1PJ7 A;  4NBS A;  3Q3S A;  1S29 A;  3JRC A;  3OIP A;  4X7F A;  1FIP A;  2K4J A;  4LOC A;  1FP1 D;  3OL3 A;  4AVZ A;  4JK1 X;  2IT0 A;  4YDT A;  4ZYD A;  4FAS D;  5F0C A;  3WTS C;  2UV1 A;  3I56 B;  1GHC A;  4ZGQ B;  1TQI A;  1COW A;  2CQ7 A;  2R93 J;  4KJZ A;  4MQ9 F;  1W0T A;  4R71 A;  3GTM J;  2Q1Z B;  2QQ9 A;  2M30 A;  1A6I A;  2Q8K A;  1N0U A;  2EK5 A;  5HNH A;  4MTD A;  4Z03 A;  1CZF A;  3JW4 A;  1KQ0 A;  2WB1 A;  3JAM K;  4BPR A;  2WZN A;  1MSF C;  2K3F A;  3K70 D;  4IQJ A;  3LVB A;  1U3E M;  1W35 A;  1OR7 C;  1JUS A;  3K0L A;  5E1Z B;  3GZ5 A;  2OCC H;  4M74 A;  4PAB A;  4DYC A;  1QPM A;  2VQL A;  2ZME B;  1FY7 A;  3J81 K;  4M71 A;  1VHE A;  5F0F A;  4Y9R A;  1E3H A;  1EE6 A;  1JUP A;  2HYG D;  2E71 A;  5FD5 A;  4QIW N;  3GRH A;  4ZDL A;  2HPM A;  1EWY A;  2OZU A;  4MLO A;  4BGD A;  4UV8 A;  1KQ5 A;  2VUM J;  1M90 D;  2H8R A;  2L9N A;  4G94 A;  1R7J A;  5D5X B;  1XQB A;  2EWN A;  4JYK A;  3WGG A;  4KN4 X;  1V4R A;  2P4W A;  3GO5 A;  3SHF A;  4I84 A;  5IOZ A;  1G6N A;  1SVM A;  2DMN A;  2X51 A;  2H09 A;  1ON2 A;  1Z7L A;  4NQW A;  3IH2 A;  5DD8 A;  3S3O A;  1IO2 A;  1F1Z A;  5IYQ A;  4P55 A;  3LQQ A;  2VBT A;  1F36 A;  2P0W A;  5K5R A;  1IN7 A;  4E7I A;  2PI0 A;  4Q5S F;  3HHH A;  2JUC A;  4XKW A;  1YFH A;  2XHK A;  3BY6 A;  1S4M A;  1AU7 A;  3SJP A;  2W1O A;  1U2W A;  4I0A A;  3BTL A;  1TL8 A;  4OP7 A;  4G7O F;  1N25 A;  1IHM A;  4WXH A;  3BR1 A;  3VST A;  2HI3 A;  1YHQ B;  1Y56 A;  4B09 A;  1H42 A;  1XDS A;  2DA6 A;  2XAH A;  4P2N A;  2H8W A;  4G7W A;  5CQG A;  3EUA A;  2MFZ A;  3L2U A;  5JR3 A;  4IEJ A;  4IOC F;  4KKU A;  1W5T A;  2O6G E;  4UAJ A;  1SFX A;  3JQR A;  3GTG J;  3Q6Q A;  4M4S A;  3VYU B;  3I1F A;  1XCV A;  5E1X A;  1GO2 A;  2ZBU A;  2LDU A;  2DBB A;  4RD3 A;  1RU4 A;  1OFE A;  2V7V A;  2VJI A;  1HQC A;  2DYS H;  4IHW A;  1OFC X;  3RKQ A;  1QVF B;  4PC2 A;  3G05 A;  5DS0 A;  1XPX A;  4TSF A;  3KLN A;  4C3H J;  1ETX A;  1ONV A;  4XRF A;  2IA2 A;  4YFK F;  1BI2 A;  1Z3Y A;  5D6F A;  3LAP A;  3HL2 A;  2M7A A;  4FX4 A;  1PP7 U;  2XOK A;  1PJ5 A;  3Q38 A;  4K1X A;  1VQ8 B;  4LGW A;  2BPO A;  4P3I A;  2M3A A;  5KW9 A;  1JJ6 C;  1UHW A;  2EFQ A;  2VJ4 A;  2E1C A;  1LVA A;  4FN5 A;  1OB2 A;  3BR0 A;  4Q7J B;  3KX2 A;  3CLQ A;  5JBQ A;  2EFP A;  2LC2 A;  2O04 A;  5E18 F;  1VJS A;  2OBP A;  2LMD A;  4UXN A;  4Z4W A;  3CCL B;  4URR A;  4CA0 A;  3TDU C;  3R6K A;  3WOD F;  3KL9 A;  1QVU A;  4L18 B;  5EF6 A;  2CRG A;  1A8P A;  3UKG A;  1J0R A;  1QBJ A;  2KIU A;  2Q2E A;  4OZZ A;  2XIG A;  1UST A;  2M9H A;  4WF2 A;  4AIH A;  2BE5 F;  3ZN0 A;  4YHB A;  3HOS A;  4F93 B;  2L4A A;  3DKW A;  4TMT A;  2IVM A;  3H0G J;  2RAE A;  2W4S A;  5BSY A;  4QUZ A;  1PP8 F;  1TYV A;  3A2K A;  4B3F X;  1A6Q A;  1UD8 A;  4ENK A;  3SQV A;  5GP9 A;  3W2G A;  3QAH A;  2VN2 A;  2A3S A;  2MD5 A;  5IT9 K;  1LJ9 A;  2KIQ A;  4OAY A;  3T8T A;  4CUG A;  1STZ A;  2B0L A;  1PUF B;  1IG7 A;  1FX0 A;  3AG3 H;  4II3 A;  4L5J A;  1WCM J;  4MTE A;  1QCX A;  3MZH A;  2HKO A;  2GPJ A;  3ZSC A;  1ZGW A;  3RIQ A;  4LB6 B;  2MAB A;  5L3F A;  3HGG A;  3FJO A;  1BJZ A;  3FY3 A;  4XSZ F;  5CVJ A;  4M53 A;  4EH1 A;  2NVQ J;  3B82 A;  3LMW A;  2OCE A;  4Z4Y A;  2X6Y A;  1G7S A;  1U2R A;  1WP6 A;  4WWC A;  2KZV A;  3W6J B;  5TJJ A;  3JU4 A;  4F91 B;  2Z16 A;  4BJT A;  2VBY A;  2ZO4 A;  1HSJ A;  2Y31 A;  5J47 A;  1B1B A;  3WU2 C;  2O7O A;  1W7P A;  2JK3 A;  3M9A A;  1WHU A;  4ZTJ A;  3JUR A;  3BTC A;  4HV5 A;  1NJI D;  1RZ4 A;  1RPW A;  2E7X A;  3BLY A;  3DXJ F;  3U2R A;  1I8D A;  2NT9 A;  4BYY A;  1OOC A;  3CCS I;  2Z99 A;  1AKH A;  1QFJ A;  1QX4 A;  1DQU A;  3A01 B;  5HKK A;  1VQ7 B;  3N6Z A;  4Q48 A;  4RGR A;  2LYC A;  1O8E A;  2O03 A;  2W25 A;  4LIV A;  2QYU A;  2HWV A;  5IP6 A;  5CDF A;  5KCM A;  4OWR B;  4A3J J;  1MMD A;  2IGM A;  2Y48 A;  3IHU A;  1QO0 D;  1XC5 A;  4XLH A;  1WH7 A;  3OYJ A;  4UUS A;  1GUU A;  1MJA A;  2FD5 A;  3TO9 A;  4KFC A;  4Z06 A;  2HQ5 A;  3KP2 A;  1QVG B;  1J59 A;  2KP6 A;  3CCU B;  3TDZ C;  1FP2 A;  2X9D A;  2XF6 A;  2PMH A;  3RYP A;  2L9R A;  4TMZ A;  1FSE A;  1HF0 A;  3FXK A;  3DLL F;  1E64 A;  1QG0 A;  1RIO H;  3SJM A;  2RN7 A;  1UAA A;  3BTJ A;  1IF1 A;  2PMZ A;  5IK2 A;  1GAQ A;  4DK0 A;  5K5O A;  2LRE A;  1ZG1 A;  2ZTN A;  3A4C A;  4G6Q A;  3VPR A;  1J9Z A;  4DJA A;  1DBG A;  2BVM A;  1H9T A;  3GVA A;  2QSG X;  3E6D A;  3OYB A;  4PJL A;  1OFL A;  3ZMV A;  4KIS A;  4I02 A;  3FKS A;  2QYO A;  3L7W A;  4KIG A;  4RB2 C;  2LF8 A;  3PNY A;  1A36 A;  1IDJ A;  5KNL A;  4M6X A;  2YU9 J;  1X58 A;  4C9Y A;  2NS0 A;  3KEQ A;  1SD5 A;  3LA7 A;  3UR3 C;  4D7N A;  1IAW A;  3F8C A;  3O6B B;  3VSV A;  2QGU A;  1T2K A;  2KIF A;  3CTA A;  2LG4 A;  3BH4 A;  1W2B B;  5IY5 H;  1YW9 A;  3M8J A;  3LFK A;  2RGV A;  3BQJ A;  1BR4 A;  3HRS A;  4ZZD A;  3ZQQ A;  1ZLK A;  1YX3 A;  2XNC A;  2OK8 A;  4B1R A;  1WOP A;  2VC0 A;  5J8F A;  2MGQ A;  2CWE A;  4LMY A;  3SZG A;  1WI9 A;  2K40 A;  5C3E J;  1W5S A;  3AST A;  3AGP A;  3ASN H;  4BJ6 C;  5LHH A;  2MLG A;  1OR7 A;  1DAR A;  2P8T A;  4B4D A;  3G4S I;  3LSM A;  4UB8 C;  1KU9 A;  1FOY A;  2RNG A;  3Q9V A;  4GRI A;  5F04 A;  4E7S A;  2DFE A;  1HZE A;  2LK2 A;  2TRT A;  2QE7 A;  1EH7 A;  1JTY A;  4BU2 A;  4II2 A;  1MDM B;  3TW6 A;  3GQB A;  4I7H A;  2E35 A;  1VTN C;  1TW2 A;  1ETY A;  3I58 A;  3JRE A;  2WB1 N;  2W6J A;  3JQQ A;  1P92 A;  2LF7 A;  3LWF A;  3IAS 2;  2O5R A;  3V8K A;  2RV8 A;  4CYC B;  2HNH A;  5EG0 B;  2C77 A;  2CYY A;  3HRT A;  3ULQ B;  3K4K A;  2E1M C;  1BBY A;  3PFY A;  4P1V A;  1VQ6 B;  2VL8 A;  1QRB A;  1IV8 A;  3ABT A;  2DA4 A;  3GLL A;  3MZY A;  2HTJ A;  1VQ4 I;  4I99 C;  3U6K A;  4A3M J;  4PUS A;  3OEH A;  4M9Z A;  2OBR A;  2D45 A;  4PC3 A;  3ZQG A;  1K4S A;  2FML A;  4A5M A;  1GXP A;  4X0C A;  1Q81 D;  5C1E A;  3DWL E;  3OYA A;  1DAB A;  3EUH A;  3I4N J;  3OP1 A;  1X3W B;  2VBM A;  1T6S A;  3ABL H;  4OIN F;  4KN7 X;  5F27 A;  3ONU A;  3OL4 A;  1U78 A;  2L9S A;  3H92 A;  2BM0 A;  3DTK A;  2HTS A;  4EV0 A;  2X1E A;  3I64 A;  3V7R A;  1SAU A;  4IW3 B;  5AN9 A;  4XR6 A;  4A12 A;  3VSL A;  1VF7 A;  2R7R A;  5A2Q K;  4Z4T A;  1QJV A;  5F6F A;  1KON A;  4B3G A;  5LLQ A;  3WBK A;  2A6H F;  4DIQ A;  3PL8 A;  1LUJ B;  5DUI A;  4NBQ A;  2HKX A;  2E1M B;  3HOX J;  1D1C A;  2X0K A;  2FNA A;  1K73 D;  3HSE A;  2IS2 A;  2LY1 A;  2PEX A;  4IHS A;  3OPO A;  2BXZ A;  4HF1 A;  2RQP A;  2F1L A;  2DT6 A;  2F4O B;  1B2R A;  1UG0 A;  1Y0Y A;  3VDX A;  2ZBV A;  2KJC A;  1XCB A;  2DA2 A;  2J8K A;  2LOO A;  3ZQH A;  4ZCM A;  4FXU A;  4HLX A;  1QHG A;  1DG1 G;  5DN6 A;  2CS3 A;  3HKZ N;  1ZH5 A;  5M5X J;  4QPQ A;  2Q6O A;  2QXZ A;  2IBD A;  3DV8 A;  1U8R A;  3C2G A;  3V8J A;  5J8C A;  1ZR2 A;  6PAX A;  4W97 A;  1MMS A;  1D0X A;  3MHP A;  1MZB A;  3CP8 A;  3NAU A;  1ON1 A;  4RB0 A;  5HS9 A;  1DGW Y;  1PUF A;  1E3X A;  2UZK A;  3R6J A;  1VZ0 A;  1YJN I;  1WVR A;  4RAF A;  4TV7 A;  4CYD A;  1D3Y A;  3AG1 H;  3MFK A;  2ZB9 A;  5DD4 A;  1G3T A;  1TNS A;  1WJF A;  4RDK A;  3KEW A;  4ROX A;  3K1M A;  5TY0 A;  1LFU P;  2DOA A;  2Y30 A;  3QPH A;  5BMZ A;  1E3P A;  3PVD A;  2INV A;  3W2F A;  2V4D A;  3A35 A;  3FK7 A;  3KEY A;  1T08 B;  5B6I A;  1E1R A;  4YAU A;  3DU1 X;  1ENH A;  3JRG A;  2K85 A;  4CZZ A;  1R1V A;  1QGP A;  2HU9 A;  5A8A A;  3LFU A;  3D5S C;  2X0L A;  3IH3 A;  1R1T A;  3S2H J;  3GYH X;  3H3U A;  1X4O A;  2JZY A;  2Q6K A;  2KRF A;  3LSH A;  3F8F A;  1HDP A;  3MMY B;  1DU6 A;  1VQP B;  2ETH A;  2O61 A;  2VQG A;  1HCR A;  3DF8 A;  2VON A;  4IHT A;  4ASU A;  3HOT A;  2BV6 A;  2NOJ B;  2Y0M A;  4PK4 A;  2WPD A;  2WZP P;  3P7N A;  1LE8 A;  2VIX A;  4OU0 A;  4ESB A;  1EP2 B;  1OGM X;  3BG5 A;  1MBG A;  3RPQ A;  3G6E B;  3AAF A;  1K4Z A;  2V7T A;  3EDP A;  3HHG A;  3U2Q A;  1S7A A;  1BM9 A;  1NK3 P;  1KRH A;  3C2B A;  2CW5 A;  4I76 A;  3ISP A;  3B78 A;  1R5H A;  4U0W A;  3TOB A;  5J6X A;  5HDK A;  3EYY A;  1FJL A;  5AIQ A;  4KIB A;  1T98 A;  2V79 A;  1DGR M;  3WE2 A;  3ZN1 A;  2STW A;  1O7L A;  2EFW A;  2MD0 A;  1P6R A;  1U8B A;  4FK8 A;  5L46 A;  2XRL A;  2ZNZ A;  4DZP A;  5B66 C;  2KFD A;  5M5Y J;  2UVE A;  1ZLJ A;  2B63 J;  1YQA A;  3DU5 A;  5D5W B;  3IV5 A;  1N77 A;  2CV1 A;  5FFX A;  2NVT J;  1FEX A;  1Z7U A;  5A88 A;  1P7I A;  1MBJ A;  4U0Y A;  2A5W A;  5HLH A;  4E70 A;  1XD7 A;  3HM5 A;  1I18 A;  4JX5 A;  2VOP A;  3PA1 A;  3WNC A;  2KKO A;  5IPA A;  3QFC A;  1TBX A;  2O0Y A;  1BI1 A;  1Y8R B;  2EB7 A;  1SD4 A;  1OYI A;  2M7B A;  2OTJ I;  3GWZ A;  1QQI A;  4BXU A;  3KCC A;  2K27 A;  2XB0 X;  2EV5 A;  1QU3 A;  1ULY A;  3BTI A;  1UHS A;  2QTZ A;  2BHY A;  3ECH A;  4WZT A;  1VQ9 B;  3FHZ A;  3JSP A;  3WNB A;  3B73 A;  4AC0 A;  3OYE A;  4XOR A;  3G1L A;  3PM1 A;  4XOT A;  5H6Q A;  3O2P E;  2GJP A;  5E3O A;  1X1A A;  1MRZ A;  1WDT A;  5F4M A;  2DMQ A;  2L4M A;  2DO7 A;  5DCF A;  3HOU J;  5BPD A;  4HF2 A;  3FKJ A;  1Z91 A;  3VO2 A;  4HE6 A;  5EYR A;  4WQM A;  1USS A;  2BVL A;  3X2Q H;  1MJ9 A;  2R92 J;  4XKV A;  4I2O A;  3DKX A;  1HC8 A;  5JVT A;  5E8I A;  2L54 A;  1PDN C;  4M73 A;  4RB1 A;  2QTL A;  4HE5 A;  1CQT A;  3H9G A;  2D1V A;  5LGT A;  3TW7 A;  4P3Y A;  1OYW A;  2QEX B;  4IKF A;  4A3B J;  3IWZ A;  1RQR A;  5FKK A;  2DEU A;  4MO7 A;  2IPQ X;  3OS2 A;  4HWV A;  4LG0 A;  2M0C A;  3I55 I;  4RD4 A;  4UUT A;  4BUP A;  4Y7N J;  4FET A;  4EGZ A;  4JX4 A;  3D1N I;  1OCT C;  1OGJ A;  1PUE E;  4MYT A;  4M1K A;  3FPP A;  4NK8 A;  1MBH A;  2XSJ C;  1YG2 A;  2O0V A;  3QYF A;  1TP4 A;  1WJB A;  3C18 A;  1BW6 A;  3IKV A;  3CPX A;  3CCV B;  3IWF A;  1N0V C;  3OZU A;  4Z4S A;  5TRD A;  2VFQ A;  4LIT A;  2DA7 A;  3AFH A;  4X1E A;  2HDD A;  2KRC A;  2LD5 A;  1G2H A;  1MAB A;  1MMN A;  1TWA J;  4ZYG A;  3ONQ A;  1YJW I;  3QU6 A;  4EJU A;  4ENJ A;  3F8M A;  1RR7 A;  5E6T A;  2JN6 A;  1EFT A;  4P6Y A;  5FO0 A;  4OIP F;  3B8Y A;  2JN9 A;  3R4K A;  4JRA C;  2KDZ A;  1X0C A;  4IL6 C;  4NQW B;  5D5U B;  2I5U A;  1E3O C;  2HPI A;  2KHM A;  4U7B A;  2JPC A;  1O8M A;  3T0Y A;  4KT5 C;  2ZIT A;  4V02 C;  4JMQ A;  3A03 A;  5LEJ A;  2EQR A;  5IYN A;  2IRF G;  5FLX K;  3TP0 A;  3B02 A;  3WTU C;  3ABK H;  3CES A;  3FXJ A;  4BY1 J;  1W0J A;  4NCN A;  2GJK A;  5IP7 J;  3JRD A;  4IPA A;  3ZMD A;  1R4M B;  4HBL A;  3KET A;  2F48 A;  2PMU A;  1K78 B;  2FEZ A;  2HFH A;  3F8B A;  3AVV A;  4JBA A;  5JHF A;  1YIO A;  1LM1 A;  1YJ9 I;  1Y6I A;  1O8J A;  2E1R A;  3DDY A;  2XV4 S;  2B7E A;  3WTV C;  3S3M A;  2E1O A;  1UCR A;  2YS9 A;  3BZK A;  4XNF A;  1N75 A;  2FX3 A;  5F08 A;  4IO9 F;  2ISZ A;  2QN6 A;  3DEE A;  2GOM A;  3H94 A;  1ZN2 A;  3BG6 A;  1FWZ A;  4ITV A;  3S3N A;  3LJY A;  1YI2 B;  2BY3 A;  3HTU A;  3I54 A;  4IRI A;  3RZD J;  3FXO A;  1HA3 A;  4HW0 A;  1EP1 B;  2VNI A;  3QPS A;  2ID3 A;  1YX2 A;  1XG2 A;  4K2E A;  4A0Y A;  2M8E A;  2WAE A;  3OIQ A;  2XRO A;  4XSX F;  3RQI A;  1UJ8 A;  3QWL A;  4C2T A;  4LK1 F;  3G1O A;  2B5O A;  1YTY A;  2EIJ H;  5KK1 A;  5E3M A;  3RKX A;  4OJL A;  4KT6 A;  4QSH A;  2GBY A;  2AO9 A;  2K4B A;  5HLT A;  4G7Z F;  1IJF A;  2GM4 A;  4ENN A;  2ISY A;  2QMU A;  3Q0W A;  2FF4 A;  1EXM A;  1CNE A;  2ELH A;  2Q2E B;  5FRO A;  4ZH4 F;  2GLO A;  2X3U A;  3NB2 A;  3DU6 A;  1XGM A;  3DEW A;  3JCU C;  2EZK A;  3CC7 I;  4BBS J;  2OBS A;  3BH6 B;  4O6J A;  2DK8 A;  1ZRC A;  2DQL A;  2V6E A;  1S7O A;  4X06 A;  2QGG A;  1KD1 D;  5FKO A;  4EGY A;  1HKS A;  1VQO B;  2KQR A;  3ZRG A;  3OY9 A;  3PO3 J;  1FOW A;  2AXL A;  2CC2 A;  2I10 A;  3ZPL A;  4N0B A;  5CLS A;  4B48 A;  2F5F A;  1E2X A;  3LSK A;  4L9T A;  1E43 A;  1QGA A;  5KSW B;  3RQ4 A;  1VQK I;  4UVA A;  3AVU A;  3KFW X;  2F5C A;  4BJ5 C;  1S7E A;  3PUF A;  3MAJ A;  1XSX A;  4DGW B;  4YG2 F;  1XG1 A;  3CCM B;  3VYS B;  4EJO A;  1PJR A;  3D0S A;  1H8A C;  3W5H A;  2L7Z A;  3OOP A;  2A5Y B;  4J00 A;  1FRN A;  5DEQ A;  5FL7 A;  3P26 A;  2GIV A;  1TLL A;  1DDG A;  2FX0 A;  3AVW A;  2KZG A;  3OW2 B;  5ILV A;  1W0U A;  3GZ6 A;  1T8I A;  2Z5U A;  2DDA A;  2OJE D;  2EIX A;  1Y8Q B;  3A0H C;  1YIJ I;  2OYN A;  4RLF A;  5FKM A;  2V31 A;  1JKP C;  3S93 A;  1ZM9 A;  2XAJ A;  2XRN A;  3GXO A;  3OOU A;  3Q0V A;  3OYH A;  3JTG A;  4ESJ A;  2X8K A;  5JLV C;  2R6H A;  2VBX A;  2VE8 A;  3A1P A;  1W7P B;  2EIL H;  4NC6 A;  5EJC A;  4UZE A;  1K4T A;  4UVC A;  1K28 D;  1MNM C;  3ABU A;  3A8I A;  2FOW A;  4AUX A;  1WJ5 A;  1KK0 A;  3CDI A;  4AF6 A;  1BX0 A;  4HDU A;  1AKH B;  2CO5 A;  2EFO A;  3E0J B;  1UFM A;  3HOY J;  2V9P A;  3DBL B;  2QEN A;  4ZCI A;  1ZHF A;  2R7Q A;  1D2E A;  4XQF A;  4YRV A;  1JUM A;  3SQN A;  5TIS C;  4A6D A;  2R4G A;  3HAG A;  1T6Z A;  4S04 A;  3WU0 A;  3F72 A;  3BPV A;  1KK1 A;  1NHA A;  3GTO J;  1EFU A;  1RUO A;  2BM5 A;  1K6O A;  4UUS B;  1OFM A;  4YZQ A;  3DTI A;  4E4H A;  1VHO A;  2ZZF A;  3CJQ B;  1B4A A;  3FPK A;  2CMP A;  2LP0 A;  2MH2 A;  3CQZ J;  3PQJ A;  4LBZ A;  1JKQ C;  2HDW A;  3LSP A;  1H85 A;  2F3L A;  2HOT A;  1W4M A;  2OAZ A;  2QUF A;  2DY1 A;  1FMW A;  3PUM A;  3V7S A;  1J09 A;  4RDU A;  4QV2 A;  4DYQ A;  1O7F A;  2EV0 A;  1TQM A;  3HC7 A;  3L1P A;  3KP5 A;  1YO5 C;  2D1H A;  3LQR A;  1FYM A;  3OFN A;  1T6X A;  3BR5 A;  1B23 P;  2E2H J;  2VKH A;  3K4L A;  3LO8 A;  2GXG A;  3J7Z I;  1D8J A;  1WMR A;  3T5X A;  2EIK H;  5JLW A;  1O3S A;  5FGM A;  1VQL B;  3AVY A;  4FWT A;  4YCQ A;  1MH3 A;  5C44 J;  4G7X A;  1LFB A;  2JPB A;  2NOG A;  2UXN A;  2DCE A;  1KC8 D;  4DBR A;  1RKW A;  2EZL A;  2BSP A;  2GJR A;  3QE2 A;  4N9H A;  3TO7 A;  4Y9U A;  4BE2 A;  3EPZ A;  1MIJ A;  2DFH A;  3TGN A;  3K4C A;  2VT2 A;  4IQ4 A;  2AQE A;  4CCK A;  4QTR A;  4X07 A;  4Z05 A;  2NYX A;  1R58 A;  1WH5 A;  1W36 C;  3BQZ A;  4BQO A;  2ECC A;  3L2W A;  3WQZ A;  1ZG5 A;  1VLO A;  3ESW B;  1X1P A;  5E20 A;  1HBX G;  4B8X A;  1R1U A;  1LNW A;  1IC8 A;  2HDC A;  2PX9 A;  3FXR A;  5J4Y A;  1E1Q A;  3BY2 A;  4AC9 A;  3EUH C;  1Z9C A;  2EZI A;  2ME0 A;  3L09 A;  3OSG A;  1X1C A;  1PVE A;  2H1L A;  4W8S A;  3A8K A;  1R5I D;  2XGX A;  3A1Y A;  4GCV A;  1K78 A;  1TW3 A;  1GT0 C;  4I98 B;  3ML3 A;  3R61 A;  2IS4 A;  1T39 A;  1I27 A;  2JUG A;  3CC2 I;  3LSJ A;  5GTI C;  4S0H B;  4E7L A;  4RBO A;  4IHY A;  3KZI C;  3ML6 A;  2PBI A;  5F4J A;  4OOV A;  4M6V A;  3OS1 A;  3VMV A;  3U21 A;  3WYA A;  2IGN A;  2G0E A;  1BC7 C;  1FTT A;  5HLI A;  2F4M B;  2BY1 A;  2HYF A;  1JT6 A;  1BOB A;  2C6Y A;  4BQQ A;  3MEX A;  3VOD A;  1MMA A;  3RZO J;  4BS9 A;  1IN4 A;  2ELJ A;  1WOO A;  3QRF F;  2QQB A;  1FYK A;  2P6S A;  1O3T A;  3CJT B;  4O5V A;  4P9U A;  1P4M A;  2INU A;  1J2X A;  2B9S A;  2GQQ A;  2VAS A;  4XON A;  1LB2 A;  3FIW A;  5AON A;  2Y0S A;  1F4K A;  3CCE B;  3ZQ7 A;  3R6S A;  2E2J J;  1HKT A;  3GQA A;  2VKE A;  1Z6R A;  2NS7 A;  4HST A;  1APL C;  3V7C A;  2QDX A;  3ZMZ A;  5F0H A;  1YRN A;  2UWM A;  1EV7 A;  4PC1 A;  2K02 A;  4UVB A;  4L9N A;  1TYU A;  2A61 A;  3TP3 A;  3SXY A;  4Z4R A;  5D6E A;  2LR8 A;  3CDH A;  1HW2 A;  1OB5 A;  2ECB A;  2CW0 F;  4PZJ A;  4FTH A;  1HA8 A;  3J80 Z;  3FIS A;  2CBX A;  3P27 A;  1O8L A;  3GQ7 A;  4Z1M A;  2CSO A;  2W48 A;  2VNJ A;  1AMO A;  1DP7 P;  4M0L A;  4C0S A;  4OJO A;  1JJ2 B;  3CME I;  3BNW A;  2QA4 B;  4KYW A;  2RVC A;  1RRJ A;  1O8H A;  1O88 A;  4Y15 A;  4RGX A;  4C3J J;  1S5L C;  3QFT A;  2YWF A;  4OPV A;  2WYR A;  1AIR A;  4Y7C A;  1TTT A;  2DTZ A;  1FX7 A;  4EJW A;  2DMU A;  3CMM A;  5K7F A;  3CC4 I;  5FFZ A;  2BF4 A;  3Q39 A;  3VEP A;  1G59 A;  4KIF A;  3CO7 C;  2A69 F;  1R00 A;  3MD2 A;  4P1W A;  1POG A;  5J4V A;  3Q5F A;  1K5C A;  4OJP A;  1TT0 A;  4ESF A;  2CFX A;  3S32 A;  1B72 A;  4B44 A;  3SZT A;  3I56 I;  3V4G A;  4M3E A;  4X7D A;  2VBE A;  2K5C A;  3N4M A;  3L2Q A;  1EFR A;  3ZZT A;  1W1W E;  3S14 J;  3HBL A;  4J01 A;  4LLL A;  1QFZ A;  2Y75 A;  4MFD A;  2HZD A;  1UZC A;  3RJP A;  3CLO A;  3QSY A;  4B47 A;  3ZMS A;  1WKM A;  1F20 A;  2D2W A;  2QSH X;  1W9X A;  1I50 J;  4S05 A;  2BSA A;  3B6A A;  3CB4 A;  3JAM Z;  1KQS B;  1WU8 A;  1HOM A;  2LBF A;  3JRA A;  2LFB A;  2YX7 A;  1XN7 A;  5FRM A;  1Z3X A;  2VT3 A;  4RJL A;  5GTH C;  3J81 Z;  1LE8 B;  2V1N A;  2I1L A;  3HYI A;  3CDL A;  4PSW A;  2VBU A;  3ISX A;  5BSX A;  4LG3 A;  1F9N A;  5J1U A;  4M3B A;  2G9W A;  4JOM A;  2P5L C;  4A3G J;  2KIS A;  1A35 A;  3KP7 A;  5DNS A;  3WGH A;  2DOE A;  3ES9 A;  4OPS A;  4A2U A;  4ACA A;  2K9L A;  4DK1 A;  2X4H A;  5J1R A;  5E3N A;  1RR8 C;  2R7S A;  2JDI A;  3KYC B;  3BR2 A;  3G71 B;  1W7P D;  2NS8 A;  4F52 A;  1D8T A;  2JIZ A;  1FNM A;  2ODL A;  2FOK A;  3VNU A;  1EA0 A;  2HLD A;  2NZM A;  2HR3 A;  2KIM A;  4CH7 A;  3F23 A;  2RNJ A;  4ZJZ A;  1IDZ A;  4IVN A;  4E7H A;  4LC0 A;  3DPU A;  1REP C;  3VWB A;  3MCZ A;  2DAO A;  4FT8 A;  5HS7 A;  1YHQ I;  3ASO H;  2VZL A;  4PAA A;  3CUO A;  3ECO A;  5IYB J;  3JRI A;  1FSH A;  2W00 A;  3LSI A;  4CSW A;  2L5Q A;  3ZGK A;  5JVG F;  4W8T A;  5DS9 A;  4HQM A;  1WPK A;  1FNC A;  1IDK A;  3ROU A;  4AF7 A;  5GAD J;  3QFS A;  1JTA A;  5F4O A;  2FE3 A;  3F22 A;  1A5J A;  2X1C A;  4BEH B;  2BM6 A;  2XC1 A;  1S0U A;  1ZYR F;  1FRQ A;  2EA2 A;  1ETK A;  2NTQ A;  4HX4 A;  3KE2 A;  4YZX A;  1QA6 A;  2DFF A;  2MH9 A;  5JLX A;  4X6A J;  2DCU A;  1GVD A;  2Z6B D;  3RCO A;  4XKB A;  2NVU B;  1J75 A;  1SEU A;  4EW9 A;  4NB5 A;  4M9X A;  4YII A;  5IYC J;  1DUX C;  1BC8 C;  1VQN B;  3FMS A;  4OIR F;  3E97 A;  3KIO A;  3K7A J;  1VQ8 I;  1E79 A;  2XT4 A;  1G7C A;  1WOR A;  4E6K G;  1IJE A;  1O8K A;  2V7Q A;  2COM A;  2LTP A;  3HOZ J;  1MW7 A;  2BZT A;  3HSR A;  5DYM A;  1GXQ A;  2JWT A;  2X85 A;  3FK6 A;  4NHJ A;  3W2H A;  4P9F A;  1WQ2 A;  5F1J A;  3QPL A;  1ZQ3 P;  1R23 A;  3CCL I;  2QBY B;  3WTW C;  2GXB A;  3SLN A;  1Z05 A;  2VXZ A;  3GSI A;  3NE5 B;  5ICC A;  4ZCL A;  2HXO A;  2BGJ A;  3EQO A;  3RSN A;  1IJW C;  5FJ8 J;  3S16 J;  4B3A A;  1UD6 A;  4HNU A;  2H1K A;  1LDJ A;  1S8N A;  2HYJ A;  4L0Z B;  2IJL A;  5M3F J;  3EQN A;  2DOG A;  9ANT A;  1RKT A;  1OJL A;  2XAS A;  3E6M A;  3H1C A;  2FMY A;  1KA8 A;  1YIT B;  3W3C A;  1HLV A;  1KZH A;  3H35 A;  3RPU A;  2ID6 A;  1M1E B;  1ETO A;  5HLG A;  4HLY A;  2W24 A;  3VMF A;  2AXT C;  4LG0 B;  5EZG A;  2DU9 A;  2C78 A;  2R9V A;  2VFM A;  4PSX A;  1LFP A;  4GO1 A;  2LLK A;  3GME A;  1AOY A;  4RD1 A;  2VKV A;  2KDO A;  3GBG A;  2H94 A;  3LYC A;  2E19 A;  4MEX F;  2CQN A;  3REO A;  2CUF A;  1Q86 D;  5CPR B;  3HPH A;  1MD0 A;  4XD7 A;  2V7F A;  3ASP A;  2LKX A;  3IKT A;  4ZDP A;  4IHX A;  2WAQ A;  2CV2 A;  3ASQ A;  2FSW A;  3TMO A;  5IT9 Z;  1EP3 B;  4FE7 A;  3COA C;  1SC7 A;  2PG4 A;  2VBW A;  4C3I J;  2HOS A;  3ZQC A;  3HOV J;  1J7K A;  1T56 A;  2YSR A;  2E5Z A;  4RAY A;  1NB0 A;  1WSV A;  2CV0 A;  2B7B A;  4RA2 A;  2CQK A;  3HG9 A;  2MW8 A;  1FTZ A;  1WJA A;  2TDX A;  3W2V A;  5BS6 A;  3IRQ A;  3KZZ A;  1W36 D;  5E17 F;  2PYG A;  4U4B A;  3H5R A;  2K3P A;  4V2G A;  5EEG A;  3WTX C;  2JJ1 A;  2IOU G;  4HOB A;  1ZUN B;  3U1K A;  4YIR X;  2YWG A;  3BC8 A; 
#chains in the Genus database with same CATH homology
 2ZSH B;  3MKY B;  4JQF A;  3HUG B;  3FPP A;  4YEL A;  2LZJ A;  3H94 A;  2XSJ C;  4CCJ A;  1MNE A;  3OR2 C;  4PFO A;  3SEQ A;  3HXL A;  3QYF A;  2O0V A;  1WJB A;  2IQ7 A;  3I9V 2;  4CZC A;  4CCL A;  4NNJ A;  4LIT A;  2QKL B;  3AFH A;  3H5N A;  3NWT A;  2KRC A;  1YE9 A;  5LD2 C;  1MAB A;  1MMN A;  3T51 B;  2JVH A;  1Z21 A;  2V4J C;  3HPG A;  3OWT A;  3ONQ A;  3QYB A;  1T95 A;  3OIP A;  3UW0 A;  3OL3 A;  2IGO A;  1P9Q C;  4AVZ A;  2VPL A;  4FAS D;  3B8Y A;  2UV1 A;  4HPQ A;  4PJN A;  1X0C A;  1COW A;  1G8X A;  3W2W A;  4NQW B;  4MXN A;  1VLY A;  4KJZ A;  2HPI A;  2KHM A;  2Q1Z B;  4U7B A;  1O8M A;  3DQV C;  3J7A Y;  5HNH A;  4Y3O A;  3OYD A;  4C2U A;  1W0K A;  4JMQ A;  4BUP A;  5HVQ C;  1BLI A;  1CZF A;  4Z03 A;  5LFA A;  2WB1 A;  3ZR8 X;  1U0J A;  2IXS A;  4F92 B;  3CES A;  3K70 D;  4IQJ A;  1W0J A;  2GJK A;  1UD3 A;  2MC4 A;  4U49 A;  1OR7 C;  3ZXS A;  2XF5 A;  4BQN A;  2VQL A;  2XZP A;  1EE6 A;  2NT6 A;  4CCO A;  3GRH A;  2NTB A;  4ZDL A;  2HPM A;  4MLO A;  4BGD A;  5JHF A;  2IS6 A;  1Y6I A;  4IX7 A;  3PNV A;  2L9N A;  2F43 A;  1O8J A;  3DDY A;  2O0W A;  4MR0 A;  3SUC A;  3L2V A;  4BAC A;  3S3M A;  2ZZQ A;  4I84 A;  4XNF A;  1N75 A;  4BXF A;  2V26 A;  2X51 A;  3DEE A;  1Z7L A;  1V5F A;  2GOM A;  2KMU A;  3FDY A;  2R7O A;  3PSI A;  4XLF A;  3BG6 A;  3OYI A;  3S3O A;  4XM3 A;  4KKS A;  4XN0 A;  3S3N A;  4ITV A;  3IP4 B;  4PJM A;  3B90 A;  2P0W A;  4E7I A;  2D3N A;  2DJI A;  3OYN A;  4XKW A;  1VBL A;  3UNG C;  2W1O A;  2QKM B;  1JI8 A;  1BR2 A;  1XG2 A;  5TGT A;  3AL0 C;  2ZXH A;  2WAE A;  4H4K C;  1BMF A;  3OIQ A;  3VST A;  1D1A A;  1Y56 A;  1LVK A;  4C30 A;  4C2T A;  2KVO A;  4OJP A;  1WTH D;  4G7W A;  5CQG A;  3EUA A;  2MFZ A;  3L2U A;  1WJE A;  2ZTG A;  4KKU A;  5KHD A;  2VB6 A;  4KT6 A;  4OJL A;  3K4B A;  5HLT A;  2WAF A;  4XLE A;  1PE9 A;  3DPL C;  3T56 B;  3VYU B;  2X6W A;  1BR1 A;  3I3L A;  1RU4 A;  1FMV A;  2VJI A;  2WY8 Q;  4BEH A;  2Q2E B;  5FRO A;  1IRX A;  3DU6 A;  5C1C A;  3OYM A;  3G05 A;  2V6E A;  2W82 A;  3FHN A;  4TSF A;  1V5G A;  2KQR A;  4D9J A;  3ZRG A;  3OY9 A;  3K4M A;  1GLN A;  2LH9 A;  4RM2 A;  1NHC A;  1Z3Y A;  1NBM A;  3BG7 A;  3HL2 A;  1EA3 A;  2M7A A;  3AL0 B;  2WJY A;  2XOK A;  1X1B A;  4OJ6 A;  1K6Y A;  2XC7 A;  4UZU A;  2M3A A;  4B48 A;  2W6I A;  3LSK A;  1E43 A;  2VJ4 A;  4XL9 A;  2O17 A;  2DT7 B;  3PUB A;  2W7N A;  3KX2 A;  4YEJ A;  3RQ4 A;  2PEC A;  4BJ5 C;  2KL4 A;  2LC2 A;  4BE0 A;  2OUM A;  2O04 A;  1VJS A;  4DGW B;  1BHE A;  4URR A;  4CA0 A;  3ZCO A;  2F4I A;  3VYS B;  3VYT B;  1PJR A;  1DBO A;  4AU7 A;  3GVJ A;  1O8G A;  3DPT A;  3VR6 A;  3CP2 A;  4J00 A;  2OV7 A;  3QOD A;  4OZZ A;  2BOL A;  5FL7 A;  5AMV A;  3GVL A;  2VLA A;  1LKX A;  1RWR A;  1MMG A;  2CFO A;  3HOS A;  3RPU D;  4F93 B;  3VMW A;  3ZIA A;  2EWE A;  4RLF A;  2V31 A;  2M4K A;  4OAZ A;  3S93 A;  4XKC A;  3OOU A;  3OYH A;  3IUO A;  2W4S A;  2X8K A;  4XMY A;  3A3B A;  1X1D A;  1UD2 A;  3A2K A;  4B3F X;  3K4J A;  3TBI A;  1K28 D;  1UD8 A;  4XOP A;  2XZL A;  1WJ5 A;  1H8H A;  3G2B A;  3VSU A;  3E0J B;  3OOC A;  4CUG A;  4OAY A;  4P5O A;  1FX0 A;  1X4P A;  2R7Q A;  4XQF A;  4YRV A;  4II3 A;  4HIZ A;  3H5A A;  1QCX A;  2ZXI A;  4CCM A;  2R4G A;  3HAG A;  2F5V A;  3ZSC A;  3DKY A;  1NG6 A;  3CZ6 A;  2MAB A;  2A6T A;  1T5E A;  3FY3 A;  1OFM A;  2F1M A;  4YZQ A;  3DTI A;  4E4H A;  2ZZF A;  3LMW A;  4E7Z A;  3CJQ B;  2V9K A;  2X6Y A;  4RMN A;  4G6T B;  3MKZ A;  1WP6 A;  3M1C A;  3SEZ A;  2CMP A;  2DXI A;  2ZFU A;  2KZV A;  3JU4 A;  1HVX A;  2HDW A;  4BE1 A;  4F91 B;  2Z16 A;  2XAU A;  2K9M A;  4BJT A;  3N05 A;  1FMW A;  1J09 A;  4RLQ A;  2XZO A;  2HVQ A;  2VKD A;  3E1S A;  4X0G A;  4ZTJ A;  3JUR A;  2WBM A;  2MYS A;  3BLY A;  3HC7 A;  2HVS A;  3BC9 A;  2NT9 A;  1I8D A;  1OOC A;  3OFN A;  1DQU A;  5HKK A;  2FUG 2;  2VKH A;  3K4L A;  2LYC A;  1O8E A;  4U87 A;  1WMR A;  3A3G A;  2O1D A;  2JJ2 A;  2ZZG A;  4P22 A;  4LIV A;  1PXZ A;  1DP3 A;  5CDF A;  5KCM A;  4OWR B;  2VQC A;  1MMD A;  2IGM A;  2ZZE A;  4QPO A;  4XLH A;  4G7X A;  2VXD A;  5FRN A;  3OYJ A;  1O8D A;  1E0E A;  1D0Z A;  4Z06 A;  2DCE A;  2KP6 A;  4DBR A;  3OAA A;  1KTW A;  3OEE A;  2BSP A;  2GJR A;  2XF6 A;  2RQQ A;  4BE2 A;  3EPZ A;  4W8Q A;  4OJ5 A;  3K4C A;  4DNT B;  4IQ4 A;  2AQE A;  2HQA A;  3SDB A;  4CCK A;  4ZTF A;  1UAA A;  4DK0 A;  2BW3 B;  2PMZ A;  1ERD A;  5IK2 A;  2LRE A;  1JRG A;  4Z05 A;  2Z8G A;  3H0D A;  1W36 C;  4BQO A;  2ZTN A;  4N4N B;  3L2W A;  4ANJ A;  3F9K A;  3A4C A;  1O8F A;  1WPC A;  3WQZ A;  1DBG A;  4DJA A;  3PSF A;  2BVM A;  2UVF A;  2D3L A;  1E1Q A;  4AYB A;  3OYB A;  1OFL A;  4PJL A;  3WWG A;  3EUH C;  4KIS A;  3FKS A;  4PMH A;  1X1C A;  4W8S A;  2HVR A;  1E3Z A;  3A1Y A;  3PNY A;  1H80 A;  1IDJ A;  4B3X A;  5KNL A;  1NG7 A;  2IS4 A;  2M5S A;  4C9Y A;  3OYL A;  2JUG A;  2X53 S;  3UR3 C;  4E7L A;  4KKT A;  3VSV A;  2LG4 A;  4HNT A;  3BH4 A;  3M8J A;  3V42 A;  2CK3 A;  3VMV A;  3OS1 A;  2XND A;  3U21 A;  1BR4 A;  2IGN A;  2QX3 A;  1WJD A;  3ZQQ A;  1YX3 A;  3K6G A;  3S8P A;  2GK6 A;  2R7V A;  2BW3 A;  1BOB A;  4BQQ A;  1MMA A;  1WFX A;  3AKZ A;  2NTP A;  4BS9 A;  3SZG A;  1BN8 A;  3T53 B;  2ELJ A;  4BJ6 C;  2WJV A;  2INU A;  3LSM A;  3K10 A;  2VAS A;  4XON A;  4GRI A;  2RNG A;  4E7S A;  2GK7 A;  3LNN A;  1HZE A;  2QE7 A;  2Y0S A;  3K4N A;  4BU2 A;  4II2 A;  1T0F C;  3GQB A;  3GQA A;  4E7J A;  3K70 C;  1OHH A;  4HST A;  3T9G A;  1SKY B;  2DIE A;  2W6J A;  2CUZ A;  2WAD A;  1AA7 A;  2UWM A;  3FBI B;  3IAS 2;  2O5R A;  2HNH A;  2R7T A;  2JSP A;  3K4K A;  4XN3 A;  2E1M C;  3PFY A;  2VL8 A;  3OYF A;  3QYE A;  5HOO A;  1HA8 A;  1O8L A;  4PUS A;  4PFP A;  3OEH A;  3GQ7 A;  1S9H A;  4Z1M A;  4NK8 A;  1KMH A;  5C1E A;  3DWL E;  3OYA A;  4ZC3 A;  2NST A;  4OJO A;  2VBM A;  5CQE A;  4EAT A;  1O8H A;  1O88 A;  2CH0 A;  2E60 A;  3OL4 A;  2KLO A;  3D5L A;  1AIR A;  1PKV A;  1O8I A;  2E1B A;  2L9S A;  3DTK A;  2X1E A;  3CMM A;  1SAU A;  2LBF B;  4XR6 A;  1G59 A;  3VSL A;  2X3H A;  4XLC A;  2WSS A;  1VF7 A;  3MD2 A;  4P1W A;  2R7R A;  1GQ8 A;  1QJV A;  1KON A;  1D0Y A;  4B3G A;  4N4O B;  1UEL B;  3ZPN A;  4DIQ A;  3PL8 A;  3OE7 A;  2JVG A;  2VBK A;  1TT0 A;  2E1M B;  3S32 A;  1D1C A;  3GQ8 A;  1MND A;  4B44 A;  2JA2 A;  2IS2 A;  2LY1 A;  2Z1D A;  3GQ9 A;  3H9J A;  2VBE A;  3OPO A;  2K5C A;  2DT6 A;  3L2Q A;  1UG0 A;  1EFR A;  3VDX A;  4J01 A;  2L2O A;  3PJR A;  2LOO A;  1KCC A;  3GVK A;  3KRG A;  4FXU A;  2X6X A;  1HG8 A;  4Y4R A;  1QHG A;  2HZD A;  1ZEL A;  3OYK A;  5DN6 A;  2CS3 A;  3IAM 2;  4QPQ A;  4B47 A;  2QXZ A;  4IZZ A;  1W9X A;  3C2G A;  1D0X A;  2LBF A;  3CP8 A;  4F3Q A;  1E3X A;  1YX5 A;  1DGW Y;  1Z3X A;  3EUK L;  4D1Q A;  5FRM A;  1UD4 A;  1VZ0 A;  1D1B A;  2KRH A;  2V1N A;  2X1D A;  4LIU A;  4PSW A;  3ZPP A;  1WJF A;  4LG3 A;  3OS0 A;  3KEW A;  4JOM A;  2R7U A;  2DOA A;  4YXW A;  1IB4 A;  1RMG A;  4DK1 A;  2K9L A;  2INV A;  3BCD A;  2R7S A;  3OYG A;  2V4D A;  2JDI A;  4GQN A;  3A35 A;  1QHH D;  3KEY A;  4XLA A;  2GOX B;  4F52 A;  1E1R A;  2JIZ A;  2ODL A;  4TKO B;  2HU9 A;  3BCA A;  3LFU A;  4YZ0 A;  2HLD A;  2NZM A;  3D5S C;  4CH7 A;  2WA0 A;  2Z2S B;  3BCB A;  4NK6 A;  4ZJZ A;  4BL0 B;  1X4O A;  4RM3 A;  3LSH A;  4E7H A;  2R7X A;  3DPU A;  2IS1 A;  3VWB A;  4DNR B;  3MMY B;  2NSP A;  2VQG A;  3NWS A;  3VYR B;  4ASU A;  1K5C A;  3HOT A;  2W00 A;  3LSI A;  4CSW A;  2L5Q A;  2NOJ B;  5CKT A;  3ZGK A;  4PK4 A;  4TT3 A;  2WPD A;  2WZP P;  2CW8 A;  3OYC A;  4W8T A;  2VIX A;  1R6R A;  3OMY A;  1IDK A;  1X19 A;  1JTA A;  4OZY A;  2E5N A;  4KIT B;  1OGM X;  4R79 A;  2X1C A;  4BEH B;  3SYT A;  4DBQ A;  4HSR A;  2NTQ A;  3LSG A;  4YZX A;  4HG2 A;  2CUJ A;  2VJ5 A;  2Z6B D;  4BDY A;  3RCO A;  3DTE A;  2XGJ A;  3CJR B;  4XKB A;  3QOE A;  4HRI A;  4EW9 A;  4BDZ A;  2RRE A;  1DGR M;  2L7K A;  3CF2 A;  4ZYA A;  4E7K A;  3PNT A;  1E79 A;  2MD0 A;  2ZSI B;  2CW7 A;  2IGK A;  4E6K G;  2F6C A;  1KZL A;  1O8K A;  2V7Q A;  2KPM A;  4C2L A;  2UVE A;  1MW7 A;  1OGO X;  4B43 A;  3DU5 A;  1N77 A;  2X85 A;  2CV1 A;  3OR1 C;  1SFK A;  3C2H A;  3W2A A;  2PYH A;  2XF7 A;  2VJJ A;  2A5W A;  4HEA 2;  1WJC A;  4YZA A;  2VXZ A;  3NE5 B;  3LL7 A;  1I18 A;  3HKZ A;  1BPL A;  3RSN A;  3EQO A;  1PYV A;  4CCN A;  1UD6 A;  3VSK A;  3TL4 X;  4HNU A;  1NRK A;  2M7B A;  1UD5 A;  3FBN B;  1QU3 A;  1V0F A;  3EQN A;  4NC7 A;  1TZL A;  2M0M A;  4F55 A;  1LDK B;  3D5R C;  2PJR B;  3W3C A;  1KCD A;  3H35 A;  4ZDO A;  1N78 A;  4W8R A;  2LRD A;  2AQF A;  4E0F A;  3OYE A;  4XOR A;  2R9V A;  4XOT A;  4PSX A;  1LFP A;  2GJP A;  3RTR A;  1X1A A;  2KDO A;  2UUZ A;  3GBG A;  3MKW B;  2M4G A;  5HNF A;  2LY2 A;  3B4N A;  5CPR B;  3FKJ A;  3HPH A;  4DOZ A;  4XD7 A;  2V7F A;  3BCF A;  4ZDP A;  4G6I A;  2BVL A;  2I8D A;  2WAQ A;  3LMM A;  2CV2 A;  3OW7 A;  3DLA A;  1IA5 A;  1V0E A;  4XKV A;  3TMO A;  2QY1 A;  1OB0 A;  3DKX A;  3H9Q A;  3KYL A;  1H8E A;  4NC8 A;  4L8J A;  4Y33 A;  3H9G A;  2E5Z A;  2R7W A;  2CV0 A;  3HG9 A;  1V5E A;  1WJA A;  4PJJ A;  3W2V A;  2PJR A;  4IKF A;  1PLU A;  1W36 D;  2WY7 Q;  2PYG A;  4U4B A;  3H5R A;  2K3P A;  3OS2 A;  4HWV A;  4NUB A;  2OC6 A;  2JJ1 A;  2XDV A;  2VQH A;  1OLT A;  4FET A;  3L2R A;  3BC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...