4XLCA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlcA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlcA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlcA02
1O8IA 3EQOA 3GQ8A 3LMWA 1HG8A 2UVFA 2EWEA 4YZXA 3B90A 1CZFA 4YZQA 4U49A 1O8FA 2QX3A 2X6WA 2NT6A 3GRHA 3GQ7A 1OFMA 2O17A 1IA5A 1RU4A 3FY3A 1DBGA 4URRA 2X6YA 2NT9A 1OGOX 2NTBA 2INUA 1O8MA 2O04A 1KTWA 2QXZA 4XKVA 4OZYA 4YELA 1RMGA 4HWVA 1AIRA 2VBMA 3VSTA 4MR0A 4PMHA 1WMRA 1IB4A 4Z05A 1OOCA 2O0WA 4AVZA 2NSPA 4XLFA 2PECA 4XN0A 4XLHA 1VBLA 3JURA 4YZAA 4W8QA 1IDKA 4XOPA 1OFLA 2O0VA 4XLAA 2VJJA 2VJIA 1O8KA 4YEJA 1PLUA 1O8HA 4Z06A 4XNFA 3B8YA 4XR6A 1KCDA 2Z8GA 1BHEA 3GQAA 4XONA 2VBEA 2PYHA 4W8RA 4XN3A 2BSPA 4OJ6A 3WWGA 4W8TA 4W8SA 4C2LA 1JRGA 4OZZA 2NTQA 4I84A 1O8GA 4OJ5A 1EE6A 4U4BA 2QY1A 1O8DA 4XOTA 3KRGA 2X3HA 4YZ0A 1RWRA 3VMWA 3SUCA 1O8LA 1O88A 1PXZA 2X85A 2PYGA 1XG2A 1QCXA 4XLEA 4XKWA 3B4NA 4XL9A 3VSVA 5C1EA 2X6XA 1BN8A 2O1DA 4Z03A 4XLCA 4XORA 3VMVA 1PE9A 3GQ9A 2NZMA 2NTPA 2UVEA 4XMYA 1X0CA 5C1CA 1DBOA 1GQ8A 1OGMX 3VSUA 1IDJA 1KCCA 4XM3A 3T9GA 4NK8A 1O8JA 3ZPPA 1K5CA 4XQFA 2IQ7A 1H80A 1JTAA 2VBKA 1QJVA 4NK6A 2NSTA 3ZSCA 2ODLA 4EW9A 1O8EA 2INVA 4OJLA 4OJOA 3EQNA 4OJPA 4MXNA 5AMVA 1NHCA 3UW0A
chains in the Genus database with same CATH superfamily
3K4NA 1ETOA 2QM3A 4I0AA 3G71B 2DN0A 1W5SA 3Q3SA 5D6EA 4C9YA 4WZKA 2ZZEA 4DGWB 1WH7A 3V8JA 4BQOA 1X3ZB 4BQQA 3I9V2 1W0UA 1LE8B 2QYUA 4X0CA 1Y56A 2VKVA 1DP3A 2D1HA 2ESNA 3F3XA 4PC6A 1O8FA 2QSHX 5JHFA 3WG7H 1ON2A 1BJAA 1ETXA 2NVUB 1G7RA 2O17A 1T38A 5IT9K 4QV2A 1WDTA 1R6RA 2DETA 5KK1A 4A0ZA 2MC3A 2A07F 4QSHA 4QTRA 4P1WA 2W48A 3IC7A 1JB9A 3BQYA 4MYUA 1SD7A 2ZL7A 1X1BA 3CCQI 2M8GX 3CDIA 1QA6A 2WY8Q 1S5LC 3S1RJ 2QKMB 4CO8A 3GXOA 1J2XA 3W6VA 1ZLKA 1OOCA 3ZMTA 4F93B 3BC8A 3M9AA 3WBKA 3ONUA 1UHMA 4MTEA 1YYVA 3HGGA 3HIFA 4HYEA 3E5UA 2HOEA 4UUSA 3PIOF 2PJPA 5GTHC 3CC2I 2DO7A 1HOMA 1HKTA 1TVCA 2HI3A 4BHPA 1CF7B 2R93J 4X7DA 3D0SA 2YWHA 4B4DA 2AXTC 4ZZDA 3CCEI 4QFMA 4BXFA 4BY1J 2E19A 4XLAA 4Z1MA 2HYJA 1XC5A 2RQPA 3DPLC 3OSFA 1QUEA 2P3MA 4G1VA 2ME0A 4O5VA 1K6OA 1R5NA 4OIRF 1HF0A 1VLYA 4LBVA 3CCUB 1X1DA 5JLXA 2DY1A 2JRMA 4Y9RA 3A02A 3ECHA 3JRCA 2BSPA 2M4KA 3UKGA 4W8TA 3FMQA 2YU9J 3R6JA 1RESA 2EBIA 3DBRB 1WP6A 4DW6A 5IPAA 3AG4H 4WK8F 3E6MA 4I84A 3CPXA 1XE1A 5E17F 3R61A 3HOVJ 2MA3A 1T6ZA 2F4NA 3PSSA 2V31A 5F4JA 3VMWA 4YIRX 4PJLA 2CGPA 3ONYA 2OV7A 4KA4A 1FMVA 1WVRA 5FO5A 3OYFA 5ILSA 2BHYA 3HHGA 4F52A 4RD1A 5C1EA 3TP3A 3OYDA 3GLXA 2OQGA 4EJUA 1TWCJ 2IGNA 2Q2EA 2QZ8A 3QFRA 1JE8A 4ZH4F 1R4NB 1V0FA 1O3QA 2EFPA 3JRAA 3OJXA 3GVKA 3FXUA 2HQNA 3HTSB 4X1EA 3HKZN 4L9TA 4XICA 2NZMA 3DV8A 2XF7A 3AK5A 1DUXC 3F21A 3Q9VA 3F23A 2ZSIB 3B82A 3ECOA 1M1KD 1O8EA 4P2NA 4QVAA 1DGRM 2K3FA 1Z05A 2TRTA 3MFKA 4X7FA 2QGGA 1YIOA 1ERDA 3OR1C 3LQEA 1UG0A 2F5CA 3DF8A 2K9LA 2CJJA 1ZAOA 1RQRA 1U5TC 3BQZA 4HNTA 2ECBA 2BW3B 4MO7A 1N07A 2V5IA 1IC8A 3RY8A 5HS8A 5EF6A 2HKXA 3CCYA 3H3UA 2YUHA 3PQKA 3P7NA 4N0BA 1B8IB 4A3BJ 2ESHA 4AC0A 1QZZA 2HR3A 1WJFA 3KL9A 1E3PA 4I76A 2Y0MA 1YJNB 1TWGJ 2J5PA 5J1RA 2NTBA 4FWTA 1AMOA 1Q1HA 5JLVC 1YFHA 4OOIA 2ME6A 1FP2A 2HZTA 4DJAA 4LC0A 1O3TA 4Q48A 5E8GA 3ZXSA 4DZPA 3VSTA 4ZCLA 1Z21A 3AKZA 3G71I 3IV5A 1T0FC 3CZ6A 4NNJA 2O0WA 4B4CA 1T33A 4AVZA 3S1MJ 2XTWA 1Y8RB 3OYLA 4OIPF 4ESBA 3WGIA 2ZZFA 4GO1A 2L54A 2WAEA 2Y9ZA 3BG9A 3CF5F 3OZVA 3CF2A 2P5LC 5E3NA 1HW5A 2MH9A 2QA4I 1LDDA 1RUNA 1BMFA 3IL2A 1DDGA 2FBHA 2K40A 3FK6A 5EDNA 2XAQA 3PUBA 5FKOA 3OYMA 3IRRA 5IYQA 1OFLA 2VFQA 4YEJA 1OPCA 2FMLA 4A3EJ 1OCTC 4U7DA 5IYDJ 2CWEA 3VDXA 3T1BA 1H9GA 4HPQA 2VYQA 5HLTA 3WNDA 2CSOA 1F20A 3O8GA 2EZHA 1NG6A 2NV4A 2OTJB 3LSHA 4UVAA 2EA4A 4HAMA 4Y7CA 4UV9A 5FKKA 2O9LA 1JJ2B 3IWFA 3WU1B 3WTWC 1Y0NA 1BA5A 1JRGA 2V7WA 2JIZA 3JSOA 1WXRA 3M8JA 3ROUA 4X6AJ 2ZTGA 2E5ZA 2IRFG 4YFKF 1UHSA 4MYTA 3K2ZA 1I6HJ 1DDIA 1JA0A 3FBIB 3W2IA 4KYWA 3I4PA 1JJ6C 4F7DA 1O8LA 3Q9SA 3OE7A 2N8GA 4XRMA 3ZC3A 4TMWA 5LRRA 3CCUI 2LG4A 3CO7C 1T95A 1WH5A 5HXBA 1IRFA 1JTYA 3L9FA 3VYTB 1OB5A 2O1DA 5CPRB 3DP7A 1SVOA 1Z1DA 3BG7A 1D0XA 1BIBA 1RQPA 4AIDA 1XGMA 4PAAA 4Z4RA 3W5VA 4IL6C 1S7OA 3GQ9A 2VI6A 1N8RD 3AGQA 1WTHD 2QUFA 5TGTA 3TEDA 2XSDC 4MLOA 1VQ5B 1NG7A 2BY1A 2L01A 2BGJA 1FTZA 4B44A 3PNVA 2VFOA 2Z9OA 5IYNA 1MMSA 5L3GA 1JGGA 1IDJA 4A3LJ 3NQOA 3G4SB 1WSRA 1YIJB 4RLZA 3RKWA 4X0GA 5GTIC 5E20A 1R1VA 4OJLA 1WRJA 3OS1A 2GWRA 1PUFA 2JN6A 5CLSA 1MRZA 1WKMA 4A5NA 3SZPA 2XPWA 1BOAA 3CQZJ 2STWA 2GOMA 4YFXF 4DBQA 2KRFA 5HLHA 1VQMI 5FNZA 4F3QA 3CCVB 1QZEA 4JX4A 2XTXA 4E4HA 3F6VA 1YI2B 4GYIA 2DERA 4P5OA 4FK8A 1RKTA 4NCNA 3HJEA 3MD2A 1QA1A 4BACA 1V5FA 3BQJA 1BR2A 1CNFA 5J4VA 1IA5A 3K1PA 2AXLA 2BEOA 5A8AA 4PC1A 2NXNB 3ZMSA 4A69C 5M5YJ 1OGOX 3E20A 3MKYB 4KICA 2BM6A 2XZLA 4KKUA 4XKVA 4B8XA 3E97A 5GAHJ 3DTIA 3K4LA 1RMGA 3OY9A 5CDFA 4L18B 1V5EA 1YW7A 2NRAC 1QUFA 2CK3A 2H8RA 4FE4A 4I99C 3I1FA 3PA2A 1TQIA 1OGJA 2Y0SN 1FEXA 1YHQB 1IB4A 5D5WB 3TW7A 2IGKA 2H1KA 3KLOA 2FX0A 2XROA 1YX2A 4D7MA 3HOSA 4BS9A 2OTLB 3FMSA 2B7BA 3GFJA 2RNJA 2C4UA 4AU7A 4J0QA 3LFKA 1YJNI 5FB2A 2F5FA 1HCRA 1BI2A 1PJ6A 4ON0A 3VYSB 3SHFA 5LEKA 2EFNA 3WTXC 2VN2A 4Z06A 1D3YA 4XNFA 1FJLA 1MDMB 4NUBA 3F6OA 1XQBA 1NB9A 3E1YE 4BEHB 3GTMJ 1FSHA 3JRFA 3MQ0A 3DDYA 1WQ2A 1W0JA 2BGCA 3AVVA 4W8RA 5CVIA 3BC9A 3VMFA 3K69A 4OIOF 2OBSA 2LREA 2XPVA 4A3IJ 1S72B 3IKTA 1MIJA 1MMNA 3EYYA 3V7RA 2FOWA 3QU3A 4XRSA 4D5FA 3DU5A 2OCCH 4RAZA 2CMPA 1HF2A 2ELJA 1H8AC 2PLFA 3K2AA 3HUGB 1QQ1A 3ABTA 2CBXA 2VONA 2R7SA 1OCOH 2XAJA 3A1YA 3SZTA 3AL0B 3IAS2 1D1AA 3P4GA 3CMEB 3GZNB 3D5SC 3JW4A 1IRGA 2YX4A 2V79A 1EFCA 4FISA 4IXAA 5EYRA 3HPHA 3KRGA 2XGDA 3ZQLA 3SUCA 2CFXA 4ZV4A 3ZQFA 3V7CA 5HNHA 1RNLA 2IEKA 2A3SA 3IP4B 3NWSA 4N4NB 1E3HA 3J81Z 4IX7A 3AVWA 4FETA 1U9NA 3L2WA 2OTJI 2E1BA 5JBQA 3VNVA 3W3CA 3ZQHA 2JA6J 4P1VA 3PETA 3FX3A 1TW2A 3G1MA 4YAOA 4PJ0C 1JKQC 5BQTA 4OOVA 3R60A 1VQKB 1NB0A 3JRIA 1VQNI 2M7BA 3E6DA 5HZAA 1JHFA 2VBTA 4QPQA 1QNTA 5L46A 3W5HA 3A3GA 3OZWA 1OFCX 4G8XA 3KP5A 4KT6A 1TL8A 2W57A 1FLIA 3GQBA 3TOBA 4OAYA 5KAFC 3SDBA 2AO9A 1TTYA 3SLNA 4D1QA 4KITB 2V7VA 4DNTB 2HYFA 4EMSA 5M5XJ 1OYWA 1R71A 1QPIA 1JGSA 2TCTA 3L2VA 2V4DA 1ETVA 2XZPA 4ZJZA 4RLQA 4ZYGA 4JMQA 4JX5A 2P7CB 3PFYA 4BBSJ 1XGNA 2FRHA 4P3IA 1FT9A 2A68F 2CRGA 2JUGA 1ZG1A 4KIFA 1VQ5I 3H3VK 1NHAA 1ZH5A 1HXDA 1T08B 1ZKGA 4IQ4A 3WBJA 1N0VC 1QG0A 3O3KA 2WSSA 4JP0A 1YIJI 3PL8A 2KDZA 3GYHX 3H0GJ 3GVAA 3N4MA 1O3SA 1H85A 2F4OB 2V7XA 5KAIC 1U5TB 2VASA 3OKXA 1V55H 1J75A 4I2OA 2BM1A 2KL4A 4OP7A 3QFCA 2DA3A 4RGRA 4A93J 4LFUA 2NVYJ 2EQRA 2KIFA 3CCVI 2W00A 3WTZA 3ISPA 4KNYA 1IN7A 3H36A 1YI2I 3KFWX 2QVOA 4A0XA 2XGXA 3ZCOA 3J7ZI 2H6CA 1G6NA 4LBZA 4E7ZA 5DNSA 2Z5UA 1USTA 1COWA 2IJLA 2RVCA 4XIDA 1I8DA 1XDUA 3IAM2 4C3JJ 2PMUA 3U6KA 4F92B 1NH3A 5HDGA 1ZM9A 1MBKA 3QPHA 5CVJA 3EUKL 4YG2F 4MEXF 1KZLA 3VOEA 4QLCU 4I6ZA 1ORKA 2ZCWA 2IGOA 3TL4X 5LGTA 3S2DJ 3CCSI 1IZ1A 3OIOA 1XB2A 4BPRA 3K1NA 5GPAA 3F8NA 4KIGA 4CYCA 1R00A 3KZZA 1QBJA 4B3FX 2VXZA 1VQLB 1BHEA 1Z6RA 2BM7A 3DKYA 1YHQI 4BDZA 2QWWA 5C4JJ 1MH4A 3OYBA 5BPDA 1VJSA 4FN5A 1SKYB 2O6GE 5FLMJ 2ZXJA 3H9GA 5FLXZ 1G3WA 3HKZA 1P9QC 3JQPA 4JQFA 3PUNA 2XEXA 2X0LA 2HPMA 4RS8A 3ASSA 3SDGA 1WGXA 1LEAA 1EE6A 2MABA 4P55A 2FSWA 3W2GA 3CJRB 4YEIA 3DQVC 5DUIA 1T6XA 5CVUA 4IHTA 1HC8A 3W2VA 3AVYA 4I7HA 5F08A 1UMQA 4YIFA 3GWZA 2DLLA 2YU3A 1YLOA 2E36A 1GVHA 4G6IA 3MKWB 2A6TA 4UY8I 4M0LA 3NB2A 4NC6A 4W97A 2MW8A 2OJED 4Z03A 3QP5A 5IP9J 5DCMA 3L2QA 4C3IJ 1CQTA 3FXRA 4EEFG 2VBSA 1K28D 1VQ6B 1BI0A 2K9NA 3C2HA 1R1UA 1I6XA 2DOFA 1NBMA 2HMAA 4JRAC 4GGGA 4RJLA 3RDIA 2WWYA 1I27A 1MKMA 3PSZA 1K5CA 3CMEI 3MCAA 2K3PA 3SY2A 4DZJA 2AHOA 2KJBA 4ZTFA 2BOLA 1MBHA 3OIPA 4LJZF 5FRMA 2DOGA 3FJOA 3L2UA 5F64A 3U21A 1LNWA 2HGCA 3UW0A 3JRGA 4CDGA 5D5VB 2R7UA 1E79A 3QWLA 1W7PD 2VFPA 3ZRGA 1SC7A 4XLNF 4OINF 3LSIA 4R1HA 3BTIA 2R7TA 5CVVA 5DDGA 5THXA 1BN5A 2DXIA 2JSCA 3CXCB 3J80Z 2CF4A 2OPTA 4RDLA 1ETQA 3Q0UA 4EQQA 1VQKI 2NYXA 4LOCA 3GRHA 2YS9A 4H4KC 1D5YA 1XDSA 2CW8A 2DMUA 2XAUA 1P6RA 4RGUA 1WSUA 3DLAA 4FE7A 2E71A 2GLOA 1X1PA 1YRNA 1O8MA 2O04A 4DBRA 1XGSA 3I3LA 3OL3A 4OWRB 3FWEA 1KK1A 2WY7Q 2XRLA 4CCNA 1FZPB 4OZYA 1SD4A 2PMZA 4TMXA 4HZFA 2UV1A 3MMYB 4PJJA 2WJVA 2ZZQA 3CCJB 2R7VA 4PMHA 4PFOA 2ZMEC 4H0EA 2PQ8A 3OYEA 2X48A 2NSPA 4A2UA 1I3QJ 1L3LA 1EFRA 3KEQA 4RAYA 4ZDOA 1K78B 4U0YA 3BP8A 1ON1A 1VQ9B 2PN6A 2M34A 4BH9A 1N77A 2HCJB 2KIUA 4XOPA 3BZCA 3LYCA 1QVTA 3OJWA 2L02A 1HA8A 1WJCA 3RPUD 2DI3A 1IV6A 2HDCA 2DT5A 1V0EA 5K7HA 1R58A 3B6AA 5IK2A 2P4WA 1V5GA 4P12A 2Z8GA 2W1OA 1TLHB 3CP8A 3FZVA 2OK8A 4E7SA 4L8JA 4PCQA 2A6HF 2JA7J 4BHBA 3JU4A 4ZGQB 4UUTA 2M5WA 3I58A 4M3DA 3ONQA 3S14J 1NK2P 3EUAA 3HOXJ 1QGPA 2LR8A 1FOXA 1UB9A 1E1QA 2WAFA 2DCEA 2V9VA 2XTYA 3ABLH 2K85A 1MMAA 2MLGA 3VFZA 2JT1A 4EJVA 2QQBA 5IYCJ 1RPWA 3S3NA 1YO5C 3ZQ7A 2DA4A 1C0WA 1TNTA 2FUG2 2OUMA 4ENKA 3WTTC 3LFUA 2D3NA 4E7IA 3J7AO 4EJTA 4C43A 2GK6A 5M5WJ 2Q6LA 5K5RA 3FKSA 1Z7LA 4HSTA 4RM0A 1B1BA 2ZO4A 4A12A 2L9RA 2QGUA 4N9IA 1I5ZA 4PABA 1I50J 1JUMA 4UAJA 2LOOA 3SQVA 1GXQA 4B09A 5E1XA 2WV1A 2B7EA 4C0SA 1TZLA 2VBXA 4HV5A 4IRGA 3CW2A 2EJRA 3RZOJ 5TRDA 1EFTA 3E1SA 2ZBKA 4HNVA 4HEA2 5BPIA 1JHHA 3A2KA 1FNBA 2ZBUA 1DBOA 5IT3A 3VSUA 2L3DA 2MBFA 1IW7F 2IQ7A 2Z2SB 1KTVA 1H8HA 2CQKA 3Q39A 4D0PA 2INVA 2VJ4A 2AS5F 2CV0A 2W25A 3AGPA 4IRHA 4G94A 1EP2B 2HU9A 4M1KA 4Y15A 1OCZH 3HBLA 1CNEA 4JOMA 2GXAA 1JXSA 2R6HA 5TY0A 4ZGNB 3OAAA 3U2RA 3H5NA 3ULQB 3EQOA 2Y48A 1U8RA 2Y0SA 5E8IA 3O2PE 1KU2A 4LG3A 1FYLA 3OYGA 2CUFA 1BX0A 3ASPA 3O8HA 3W6KB 2EWEA 4Y4RA 3BY2A 1XGOA 3SZGA 1UAAA 2PX9A 2D74A 4KN7X 4M71A 2K9QA 3LMMA 4XBFA 1VQ6I 4Z6YA 1FNDA 2ZL5A 5J40A 1FX0A 3EUHC 4S0HB 2IS4A 3M7GA 2FEZA 4IQJA 3GVJA 4OMZA 3OL4A 4P9SA 2DA1A 2VT3A 1GHCA 5FIUA 5EZGA 4F55A 3V8KA 4UNOA 3CC4B 5EG0A 2W24A 4U7BA 2O8XA 2MC4A 1IXRC 2XC1A 3UR3C 4OOXA 3HRSA 3LA7A 5ICEA 4M3BA 1SMYF 5C4XJ 3GW2A 1DPUA 2XSJC 2KLOA 3ZGKA 5CVRA 4TMZA 3WNBA 5F0HA 1XX5A 1M1EB 3ZQQA 3Q6RA 3V7SA 2HNHA 3S32A 1A35A 1RUOA 1O7LA 2R5ZA 2WZPP 1VQPB 4YDTA 4ACAA 3V4GA 1BR1A 4YHBA 3BDDA 1EA3A 2VBYA 1LDJA 5M3MJ 1TYWA 2P81A 2ID3A 2LKPA 1ZM3A 1Z0XA 2KIMA 1R5ID 3DCFA 1WCMJ 4IOAF 3A3BA 2VC1A 1TTTA 3HC7A 2VBWA 4PFPA 1J9ZA 3L2CA 3RQ4A 1O8KA 3ZN0A 2WAQA 1XD7A 2M0CA 2RKHA 4U0VA 2VE8A 3RQIA 1LE8A 3GSIA 4Z4YA 1G3SA 4B3GA 1KU3A 2LVSA 4CICA 4B47A 2ELKA 1ZTRA 1S3JA 4XONA 3U9GA 3CCJI 2VKHA 3LNQA 2PYHA 4XN3A 3U1DA 1UZCA 2AQFA 4Q47A 5C3EJ 3COAC 2JSPA 3S3OA 3JAMZ 4TN1A 1YITI 3QYBA 2W7ZA 1E64A 1JNYA 2PJRB 2CFOA 4HNUA 4PC7A 2X53S 3B6CA 2R4GA 5DD4A 5F27A 3ZMUA 5E3OA 1K4TA 1QVUA 4FX0A 5DYMA 1QQIA 2QN6A 1UJ8A 1N05A 4UUSB 1P7JA 2IW5A 3Q0VA 3WE3A 4XOTA 4K1XA 3AVTA 1I1SA 2BV3A 2HVRA 2GXGA 1WPCA 1RKWA 2WYRA 1T56A 4A0YA 3CC7I 3WNCA 4UVBA 2DMPA 3AL0C 2JJ2A 4M2LA 3OR2C 1XN7A 4L0YB 1WI3A 1V3FA 2GK7A 2F48A 5F1JA 1BN8A 1S9HA 2VKDA 2DA2A 2F5VA 2V1DA 1CF7A 4O3MA 4ZYEA 2Z16A 3W2HA 3J81K 1YOVB 2X6OA 4RDUA 2X0KA 4BGDA 3HOWJ 1W9XA 3ZMZA 3GFMA 1BW6A 4R79A 4E7KA 4QWQA 4WWCA 2BM5A 4XMYA 5HOOA 3JX8A 3Q0WA 2EV5A 1GO2A 1MBEA 4C30A 2LMDA 5TISC 3RPQA 5LMZA 1XPXA 2WBMA 2NSTA 3RYPA 4HA8A 3EQNA 2EV0A 3PJRA 5CKTA 1FIPA 2CO5A 1J0RA 1ZR2A 2J5OA 3BG3A 1OISA 2HDDA 2FNPA 4L5IA 3RIQA 3HSFA 3PA1A 2WPDA 4OPSA 2HOSA 4QVJA 5D6FA 3LMWA 2GA1A 4BY7J 2L9NA 4AWXB 1Q81D 1PKVA 5D4SA 1TUIA 4MHGA 2XGEA 5CQGA 4HW0A 1FRQA 3Q3AA 5GV8A 2C5BA 2Q2EB 4NC7A 1USSA 3CUQA 3GTJJ 4BL0B 2X1DA 2Y9YA 3L7WA 3R6SA 4BUPA 4RB3C 2W6JA 3PO3J 3U1KA 2ZL6A 4ENNA 3FM5A 2HEOA 3OS0A 4HF0A 4CCLA 1VHOA 3MMPA 1IDYA 3DKXA 3Q5FA 2E7WA 2O7OA 4GQNA 1IDZA 1H88C 2HQRA 3WQZA 4X7EA 3MAJA 1KK2A 2DIEA 2OBRA 3H1CA 4HWVA 1EH7A 2R3SA 4M3FA 3BG5A 5F0CA 2L7FP 2M1BA 2PEXA 4AM3A 1ZGJA 3K0LA 3HTUA 4NC8A 4HE5A 1ZGAA 4NQWA 3H09A 1YG2A 3T8TA 5FKMA 2LZJA 1E2XA 2ADUA 3K10A 5J6XA 3QE2A 2XC7A 3B8HA 3KZIC 4ZC3A 1J5YA 1K73D 3RI4A 2OC6A 1XSDA 2NOJB 3K6GA 1A6IA 1PLUA 2DA5A 4ZYDA 5IY5H 3HYIA 2I10A 2X51A 4G6TB 4RA2A 2ZMEB 4F91B 4BQNA 3GTOJ 2M2EA 2C5HA 5B5EC 1QRYA 2X4HA 2FU4A 3VWBA 4WCGA 3A03A 3TOAA 1PJ7A 1SAUA 5E3LA 1P2FA 1D1CA 4CCKA 3QPTA 1DG1G 1OGIA 1RETA 1YS6A 2GA2A 2VPRA 2FD5A 4Y3OA 1R7JA 1J7KA 1VQPI 1Y39A 4IHXA 2O61A 1KJZA 4H9GA 3E5XA 1SKQA 2VOOA 1QH0A 3K1MA 4V2GA 5J3OA 2QEXB 4CCJA 3BH7B 2QTZA 4GYGA 5J1UA 2GM4A 4CGZA 1SEUA 2WTEA 1FYMA 1DDNA 4OPOA 5A88A 5GPCA 2OBTA 4MFEA 4PC2A 2BGIA 4PGHA 1W2BB 1VHEA 2DFEA 2VC0A 2IS1A 2BVMA 2M8EA 3QYFA 4RPBA 2NS0A 2V1XA 5C44J 2ZFUA 3TO9A 1T2KA 2YSRA 4BXUA 3ZP5A 4E7LA 4EM0B 2G7UA 4XRSG 3N90A 1I7PA 5JFRA 3P9IA 2IS6A 2FA5A 3BLYA 2LY9A 1EKEA 1FSEA 4AF7A 4ASUA 2HOAA 3BH4A 1JKPC 1V5VA 1WORA 4BQAA 5E6TA 2R7FA 1VQ7B 1S4MA 2L9SA 2NTPA 2UVEA 3K70C 2LK2A 4HF1A 1N0UA 3ASOH 1U2RA 2RAEA 1PP8F 1YJWB 4RD2A 1FC3A 4WXCA 2YUSA 2ZNYA 1FMWA 4EGZA 1H42A 2DYSH 2R7QA 3BTJA 1ZRCA 4B1RA 2XZOA 2ICWG 4D7NA 1SAXA 2KKOA 1GT0C 4RD4A 3CRZA 2P5VA 1GAQA 3OV8A 2KHMA 4I98B 2QCOA 4IJAA 4AVPA 1WFXA 5J4YA 4HDVA 2FNAA 3ABUA 3JQRA 1JTXA 1K6YA 5K5QA 1A36A 3GQ8A 2CUZA 4X8IA 2UVFA 2WB1N 3ZOBA 2BY2A 2LC2A 3N97A 4N3GA 1BC7C 4BYYA 2E7XA 3PIPF 5HKKA 3GF2A 3J7YJ 1G3YA 4EM2A 1D1NA 4ENJA 1RU4A 3J80K 1HQCA 1FRNA 2X6YA 5E18F 3OOUA 2R9VA 4RCZA 1GR1A 2OU2A 1XSVA 2W4SA 2QE7A 3V8LA 4GRIA 2W85A 3LAPA 3KYLA 3ASNH 1TWFJ 5FKNA 3BR2A 2CV1A 4BAYA 2C4TA 3JRBA 1APLC 4XKCA 1JKRC 3QFSA 4PDKA 1PUFB 3PM1A 4EGYA 3LJYA 4PSWA 5H6QA 2QQ9A 5DSZA 3HRTA 4V19K 3RTRA 2A6EF 2QYOA 4ETSA 3S8PA 4PK4A 3P27A 4XLHA 2A61A 1Z7UA 4RD6A 4E0FA 4KMFA 2Z1DA 1BLIA 3PSFA 3T56B 5DD8A 5IOYA 2PFBA 4XSZF 2A5WA 3H3ZA 1K61A 2EINH 3FDYA 1OB0A 3SKBA 2VJIA 1WOPA 1BPLA 3B8YA 4XR6A 2XKOA 4Z2YA 4U87A 3L1PA 5IYRA 2EFWA 1TYUA 4M4SA 3GQAA 4CSWA 4A3FJ 2E5NA 3TBIA 3HOZJ 1LFUP 5EGOA 3JQQA 3HL2A 1JA1A 1IRXA 5HVQC 3F0CA 4DNCA 2XNJA 5B1AH 1BM9A 1M90D 4UB8C 1AA7A 1ETYA 3IH3A 4G12A 2BY0A 1GV5A 2R0QC 4OU0A 2MFZA 4AYBA 1O8GA 4W1UA 3IRQA 4U4BA 3TO7A 1ZELA 2EFGA 1O8DA 1D8TA 2COMA 3WTVC 3AG3H 1LKXA 1OCCH 1Z91A 1H9TA 2CS3A 4ASNA 2JJ1A 3LL7A 2D2WA 1XG2A 2XNDA 2DDAA 2KRHA 2HWVA 1TYXA 5H2FC 1OR7C 5BMZA 3B4NA 2DODA 5M3FJ 3W2EA 3LQQA 2UZKA 1R9TJ 3TMOA 2KT0A 3OOPA 3OYIA 2I5UA 4RD0A 5FO1A 2DU9A 4FCYA 3CCRB 4IW3B 4L9VA 2VODA 5IT9Z 5J3LA 3T51B 1QHGA 1NRKA 2FBIA 5LHIA 2QF7A 1Q86D 3OSGA 3SFZA 1QGZA 1OGMX 1KGSA 3BY1A 4C2TA 3M07A 4NBQA 2IP2A 2EIJH 4BEHA 4CHUA 2B5OA 3CMAB 2B7CA 3UNGC 2E2IJ 2JK3A 1EXMA 2GREA 4ROXA 4P25A 4Z4SA 4HBLA 3QP6A 5LRSA 1V4RA 1HSJA 5F1RA 4RGSA 5ICCA 2Y31A 4ESFA 2XF6A 1PUEE 2DTZA 3SJPA 1HG8A 5EEGA 2KDOA 1OKRA 5J8FA 5BOXA 2HDWA 1P4MA 1AWCA 1W1WE 2LKSA 4P3YA 1W7PA 5HZBA 3V76A 3W2WA 1VQ7I 1G4DA 3CPWB 1ZN2A 4WZTA 3DFGA 3KYCB 1YJWI 1OB2A 1OYYA 4A5MA 2VIXA 2VL8A 2EH3A 3CD6B 4M9ZA 1MNEA 3NARA 2QQAA 3IUOA 3CESA 1SD5A 4MFDA 2BV6A 1U2WA 2F3LA 2B0RA 2R92J 3PSIA 2CQQA 2TDXA 3M1CA 3MVPA 2BZTA 1GXPA 2ISZA 1W0KA 1MZBA 5GAEJ 4M6YA 2F2EA 2HOTA 4R71A 1WHUA 2LY2A 3MKZA 2VQHA 3J81k 3PO2J 2PECA 1RC9A 2P6SA 3H92A 1VQOB 2XDVA 3KZYA 4A3KJ 1TNSA 1POGA 3WODF 2LF8A 3OYCA 1ZYRF 3CCLB 1VBLA 2CU7A 2DA7A 2NOGA 4G6DA 1EJ9A 2V7FA 2Y30A 3SEQA 2VE9A 3ZIAA 2LNBA 4OMYA 4E7JA 4HLYA 1UD5A 3G4SI 1IJEA 1W35A 1KU7A 4YAFA 4JK1X 2XAFA 2QBYA 5FL7A 2DQLA 3TQNA 2DT6A 2HS5A 3HRMA 5GV7A 3KPHA 1WJBA 1Y0YA 4KKTA 1BR4A 1B72A 2JMWA 2CW0F 2OQRA 5CQEA 3RPUA 4QHYA 4J00A 4UZUA 3ZZUA 4A6DA 4N3NA 1ETKA 2EZLA 3LSKA 3REOA 2WZNA 4F7ZA 2RV8A 5KSWB 3LSPA 2P8TA 2YX7A 4M6XA 2DFFA 2V1UA 3I55B 2KFDA 3RSNA 2R5YB 2K4BA 3JAMK 2GPJA 4P26A 1U5TA 3ELKA 5D8KB 1X2NA 4V2FA 2J8KA 3ZZ0A 1HDDC 4HSRA 1FNNA 2MG4A 2UXXA 1VZ0A 1Y1VJ 2KP6A 2ID6A 1X1CA 2G0YA 2PYGA 1MMDA 4CCOA 1FBQA 1B59A 3JRDA 2NVQJ 1LLWA 4DNRB 4EM1A 1Z9CA 5DM7F 4BDYA 1MSEC 6PAXA 1S29A 1SD6A 4WF2A 5D5UB 2C6YA 4HE6A 2LBFB 3ZBTA 1N78A 3SJZA 4CYCB 3GMEA 2CUJA 1TT0A 4HV6A 4LG0A 2Q6OA 4YIIA 3BY6A 1F9NA 3W5UA 1QRBA 4CCMA 4XD7A 2E35A 2OTLI 2MYSA 1F5TA 3NEUA 1T0FA 4BXXJ 1GQ8A 2IA2A 5K7FA 4ITVA 1T8IA 2O03A 3JTGA 3KE2A 4LLGF 1STZA 2EIMH 1NDHA 3BG6A 3OEHA 3L09A 2EPFA 4KISA 1MJAA 5E1WA 3OZUA 1QO0D 3CCMB 3R4KA 3I0TA 2UXNA 4ANJA 4UV8A 1LM1A 2Y2ZA 2C77A 1N75A 4YZQA 3I53A 3M8EA 1W36C 1S72I 2WC2A 5AONA 3GLLA 1KRHA 2CNDA 5AN9A 2V9PA 3DWLE 3ZBUA 3SQNA 1CGPA 4I02A 4RDKA 1KYWA 4HX4A 5EZHA 5FFXA 5IYWA 1FOWA 1J9IA 4GFBA 1R23A 5LEJA 4X07A 4J19A 3BR6A 5HDKA 3MN2A 1QVGB 3FKJA 3HM5A 5JHUA 3GBGA 3BOQA 1IO2A 2MLKA 5AIQA 4Q4ZF 1KQ0A 2JA8J 4Z05A 1WOOA 3H35A 1XB4A 2DPUA 1TYVA 1B9MA 3N6ZA 2HVSA 1G8XA 1EFUA 1LJ9A 1BW5A 1T39A 2CC2A 3CP2A 4Y7NJ 3EETA 5H20A 2OK7A 3GTQJ 4KIBA 5B6IA 3AG2H 3DPTA 3FXOA 2O0VA 1VQ4B 1ZREA 3CD6I 1FBSA 3P9KA 1XS9A 1KZHA 3TH0A 2Y69H 2A69F 2DYIA 2FJ1A 1KU9A 2K9MA 4UB6C 1S0UA 3G05A 4ZDLA 4CUGA 1QGAA 5ILUA 3WG9A 1TWHJ 3CO6C 3EPZA 2F4IA 4M9XA 5FLVA 2XGCA 3BCFA 2Z99A 2DBBA 3I59A 1R5OA 3MZ8A 3DU6A 2CG4A 3ZMVA 4LK0F 5H5JA 2DQRA 3CJQB 5J47A 2L7MP 3B02A 3QQAA 1VQOI 2PG4A 3EDPA 3BNWA 2XPUA 4IO9F 1N06A 3OYAA 2ZJPF 3PUMA 1VTNC 3LQRA 5D4RA 1QFYA 5TJJA 1P4WA 4TMTA 2V7TA 4B43A 1KONA 1L0OC 5FD5A 1MJ9A 2FOKA 3I64A 2H8WA 4BU2A 3A01B 3R0AA 1ZQ3P 1PP7U 4L0ZB 4IZZA 4P22A 2ZNZA 1ODDA 3W2AA 1ZM2A 1G2HA 5CYVA 2IPQX 3WTUC 1R22A 3C2GA 3FXJA 4X7CA 3KP4A 3BR1A 2WB1A 2OZ6A 2RDPA 4PZJA 4HX8A 4YFNF 4L5EA 2JVHA 2K9SA 4X05A 1LVKA 3TW6A 2V1NA 5LBQA 2RGVA 3LSRA 4DQ2A 3ML3A 2IXSA 3MEXA 1FYKA 3GCMA 1JUPA 3IWZA 1BQEA 9ANTA 1ZG5A 5IYPA 1WZ2A 4XM3A 3CJTB 2ZITA 2Q8KA 4NHJA 5GP9A 2JRTA 3WU0A 4Z4UA 3DTKA 1ZRDA 3A8JA 1DPRA 2DDBA 2Q1ZB 2HXOA 1Q1VA 4LB5A 3VO1A 3CJNA 1I39A 3HOYJ 3TDZC 2WJYA 3GIRA 1VQLI 1DARA 4LBYA 1IUFA 1MNMC 4YZXA 1O7FA 1ZLJA 1BJZA 3OIQA 4EV0A 2YWEA 4C2UA 2KISA 3AAFA 1ZGWA 1E3OC 3EYIA 2D9RA 2JA2A 1HVXA 2PE3A 2LLKA 2VZLA 1GVJA 4DQKA 2OZUA 3P9CA 1Z3YA 4GCVA 5CJ9A 3OP1A 4MTDA 3FY3A 1EA0A 3NAWA 1BIAA 2DJIA 4L9JA 2NT9A 3H9JA 3GUDA 2H6BA 2L7KA 1HA3A 4C3HJ 1XMKA 3DTEA 1ENHA 2IVMA 1PJRA 2DK8A 1B4AA 1IRZA 2IA1A 5D5XB 5K5OA 1QFZA 1UD3A 4UZFA 2VFNA 4N4OB 1AIRA 2NNYA 3LSJA 4QUZA 4AIJA 4Q7JB 4PJMA 4Y17A 2W6IA 5GAGJ 1T6SA 3H94A 3A4CA 2PI0A 2ACJA 1G3TA 3ZQGA 1FPQA 2M3AA 4XN0A 2J8IA 3NRVA 3BJOA 3F8FA 3FXQA 4L5JA 2KQRA 3I54A 1AKHA 2ISYA 2M4GA 2FXAA 1IDKA 1X3UA 2L2OA 1W5TA 1XTAA 3K70D 2Y75A 4DYRA 4P9FA 2CQ7A 3VO2A 1KC8D 2E1MB 3OYNA 4BJ5C 1RZ4A 1O8HA 5EJCA 2M30A 1NTCA 4WXDA 3AVXA 2IBDA 5EG0B 5FROA 2UUZA 3Q6QA 2E1RA 3R0JA 4BJ6C 4WZEA 2STTA 2O5RA 2VBEA 1GV2A 3V7AA 1XG1A 3M1EA 5B3SH 2VBZA 2R7XA 2ZSHB 2RNGA 2L0KA 4M74A 3D26A 3FM3A 4PUSA 3S2WA 3F72A 2H94A 5FD6A 3ZPLA 2JPCA 4YAWA 2E1CA 1RR8C 3KETA 1RIOH 2R5ZB 4OJ5A 1HSTA 5KHDA 2DK5A 4MEYF 2FF4A 5BS6A 4GDFA 2CYYA 3RKQA 4PSXA 2ZBVA 4YXWA 4OPVA 2X3HA 1RWRA 5LHGA 2E2JJ 1GVDA 3E3VA 4U9UA 2B0LA 1HLVA 3DEUA 2PMHA 3E6BA 3WU2C 2NVTJ 3TGNA 4J01A 1G59A 3NAUA 3SEZA 3KEWA 1U78A 3VSVA 4HX7A 2X6XA 1IN6A 3IH4A 3FISA 1SANA 1R5GA 5DTDA 2LH9A 1FNMA 3WXMA 2VQGA 3VYRB 4AIKA 1KQ8A 4XORA 1UG2A 4R8HA 4CYDA 1KA8A 2BBYA 2VNHA 3H0DA 2WR8A 2DT7B 1WJEA 1FY7A 4LLLA 4BHCA 3HZJA 1P4XA 3WHBA 3ZN1A 2QA4B 1VQ9I 2M87A 4KH3A 1L1IA 3A0HC 3T9GA 4NK8A 1KD1D 2Z33A 3FK7A 4S04A 1UD6A 3BCAA 2ODLA 3CTAA 4EJWA 4YAUA 4NBSA 1BOBA 4M3EA 4Z4WA 4IOCF 1S8NA 1WI9A 2E60A 3K4KA 4LB6B 3M3YJ 3ZZTA 2PJRA 1PDNC 1T98A 1Y6IA 1R36A 1VI0A 4V02C 4Z4TA 3HXLA 4E6KG 3L2RA 1CZFA 2LFBA 2XVCA 2QX3A 4RM2A 3FIWA 1N25A 5HS7A 2DCUA 2CRVA 5FJ8J 1Q82D 4HQMA 2BHZA 2VFMA 3JSPA 3PFIA 4MQVA 2QQ8A 2EV6A 4MIMA 2Q6IA 2EZIA 3FXKA 3H9QA 4BKXA 4A3DJ 1HZEA 1UFMA 3BZ6A 3DXJF 4WX9A 1VNDA 1WJ5A 2RREA 2Q6KA 3OFNA 1U0JA 4EVIA 2LSOA 2JDIA 2PBIA 3G2BA 1TBXA 1TW3A 3QOEA 1WMRA 3ERED 1GJRA 2DMNA 2KPMA 3LWFA 4XLFA 5EEHA 3JCUC 4BJTA 2QMUA 4WWVA 4RAFA 2DW4A 5JMCB 1IF1A 3LQ6A 3A35A 5FGMA 3B73A 4M72A 2KZVA 2JZYA 2X3UA 3KP7A 2LRDA 2ZJRF 5L3BA 3CUQB 5F6FA 3KP3A 4KN4X 5HLGA 3K4JA 1YX3A 2X9DA 5F4MA 1MBGA 3VODA 4DIQA 1HBXG 3I4MJ 1KCDA 2FBKA 3GTKJ 4DQLA 4Z4ZA 1VQMB 2KJCA 5E1ZB 2VT2A 4IHWA 2X1EA 3VYUB 2DOEA 4OJ6A 3QAHA 1U8BA 2X1CA 2O3FA 1J59A 1R5BA 3PENA 3L00A 4HLXA 3IKVA 3HG9A 4RB2C 3DKWA 4Y33A 3RCOA 3VPRA 5J8CA 1QGYA 3DU1X 5JVGF 2ZJQF 1TWAJ 5HODA 2HYGD 2OYNA 3LNNA 4LBWA 1OJLA 2D5VA 1FP1D 3QSYA 2EIXA 3S1NJ 4XK4A 4II3A 1B9NA 2JWTA 3HSRA 4NQWB 4IHYA 3T5XA 1JI8A 2I8DA 4Y9UA 5KNLA 3CC4I 4DK1A 1F1ZA 3KEYA 3KCCA 1W0TA 1Q7YD 2QKLB 3ASRA 4G5GA 2IGMA 2LP0A 1LEBA 1SFEA 2D1VA 1OFEA 2BW3A 2MH2A 1VF7A 4XLEA 1OHHA 4XKWA 2DFIA 2EK5A 4XL9A 2BN4A 5EEAA 4BE2A 2JJ7A 1AIPA 1GLNA 2BF4A 3OYJA 2B9SA 1B8IA 1S7AA 2COBA 4G7WA 1A04A 1KQSB 4WZLA 2XIGA 3C18A 1RR7A 2QSGX 1Y1WJ 2Q0OA 2BVLA 2RN7A 3KX2A 3SYJA 1BBYA 4A3CJ 1ZM4A 3QOPA 5FA6A 1X0CA 2G9WA 2YWFA 2DPDA 2ZMEA 1IJWC 1B2RA 1FX7A 1K7AA 2IS2A 5FRNA 5FLXK 1KCCA 2QENA 3LVBA 1H80A 5L3DA 1O57A 2B63J 1CLWA 1LLZA 3I71A 2K7LA 3MZYA 1IGNA 4B3AA 5IP6A 4OJPA 4MXNA 2BXZA 1UHWA 2XKPA 5KW9A 4RDJA 1YJ9B 3T53B 5K7ZA 1K4ZA 2JTVA 3M8FA 1I1GA 3G3ZA 4P6YA 4ZYAA 4PGOA 1MABA 1QX4A 1F36A 3GO5A 3BCBA 2P6TA 4DYCA 3OMYA 2VKEA 4RBOA 1K79A 2FX3A 1W5CC 4U49A 2NNNA 5LGNA 2E34A 4RPDA 2R7ZJ 1N08A 1K83J 4AIHA 2R7DA 2GJKA 4RGXA 2XB0X 2NT6A 3GQ7A 4UUVA 2GQQA 3BH6B 3FXLA 3K4BA 3H5AA 2VUMJ 4FASD 2JN9A 2CW7A 2NS8A 1FWZA 3RJPA 5JVTA 3ISXA 4ACBA 2DEUA 5J1YA 1X58A 3B78A 1EH8A 2PMZN 1OYIA 5F04A 4AD9A 1WWXA 3H5RA 3HOTA 1XFOA 2QDXA 5DN6A 3FPPA 2CW5A 2CQNA 4MGRA 4ENMA 1ZR4A 1TSPA 4MR0A 3SEJA 1X19A 3D5RC 2M9HA 1ACIA 4G9YA 4G7OF 3HB9A 1E0EA 3A8IA 1EH6A 1H89C 2BVNA 4QPOA 2O6WA 1KQ9A 1OFDA 1D5VA 4RMNA 3S2HJ 1VQNB 1XCVA 5DCFA 1ETWA 4W8QA 2HQ5A 1IUYA 1ONVA 3VSKA 1SFKA 3GTGJ 2L7ZA 4OIQF 2EFOA 1TC3C 2W82A 4UXNA 1K8AD 2V9KA 1X2MA 2XRNA 3DPUA 1DABA 1S6LA 1TQMA 5LFAA 1W4MA 2K27A 2GXBA 4XKBA 1XMXA 3BTCA 2OF7A 3CB4A 4ZYHA 5K1YA 1AHDP 1O3RA 3S3MA 1KQ5A 4DK0A 1I18A 3TDUC 3FXMA 3AFHA 1IV8A 1W36D 1D2EA 2VQLA 4OOSA 4U0WA 1P92A 1IN4A 3OYKA 4A3MJ 5D8LB 3I4NJ 4IKFA 3BT9A 1WJAA 4KT5C 1WPKA 4Z4VA 1VQ8B 4AC9A 2ZFWA 4YZ0A 3CLQA 1FTTA 3BR0A 4G1BA 1IN5A 2ECCA 3EUHA 1MD0A 3FF5A 2LDUA 4YFOA 3QRFF 2K02A 2OBPA 1SMTA 2F5EA 1HKQA 1PVEA 3BROA 2VXDA 3C7JA 1EZGA 1B6AA 1U3EM 2AHQA 4U88A 1MJBA 2XAHA 3P5JA 3DEWA 5A2QZ 2R7OA 1XMAA 5A89A 3CMMA 3OW2B 4XLCA 4UHTA 1IB0A 1SM4A 3HPGA 3VEPA 2HVQA 3BR5A 2NVXJ 2VBUA 3CDHA 3ML6A 5EGOB 3WGGA 3BTLA 3BPXA 3ZMDA 1U9OA 1WJDA 3PUFA 1YTYA 1NJID 2NPFA 4RAGA 1O8JA 2IOUG 2CV2A 4XQFA 2GJPA 2VBKA 4NK6A 1QJVA 1SFOJ 1Z67A 5L3CA 1GAWA 2V7QA 3CCSB 2GBYA 3F8CA 3G1LA 3D5LA 4B3XA 4Q5SF 4TMVA 4HQEA 4UVCA 2VOPA 4JBAA 1SFXA 1V54H 3BCDA 1O8IA 1YW9A 3CUOA 2YR2A 3KEOA 1D8KA 2G7HA 3U2QA 1F4KA 2E1OA 3KIOA 2PIAA 4GXOA 5DV5A 1R5HA 3OPOA 4II2A 3K4MA 5B1BH 4I0BA 3WE2A 3SXYA 4DOZA 4NDLA 1KMHA 1R1TA 4LITA 3ES9A 5HDNA 2QEXI 1DP7P 5L3FA 3QPLA 1VLOA 3VR6A 3LAJA 5HNFA 1REPC 3BPVA 2UWMA 3OS2A 4URRA 1MDMA 5JI6A 2EWNA 1ITYA 1DU6A 1IHMA 2VQCA 3HSEA 5KCMA 1YS7A 1KTWA 1OCPA 4TKOB 1VF9A 1OMIA 1FIAA 1T5EA 4M73A 4ZZLA 3S1QJ 4K2EA 1YJ9I 2VLAA 3GTLJ 1E17A 3MHPA 2BY3A 1E62A 1HDPA 1F60A 3K7AJ 5AIPA 5E79C 3HUGA 5LHHA 5ILVA 1JT6A 3ZR8X 2DTRA 2P5KA 3F8MA 3WYAA 4RLFA 4OPWA 3V42A 3G6EB 2A5YB 2OAZA 4UZEA 2GJRA 3JURA 3GFIA 2BM4A 4YALA 2ZXWH 1EP3B 2FVGA 1G7CA 2BXYA 2ZTNA 3GTPJ 5B66C 1ZG3A 1W7PB 2BE5F 2RQQA 2BPOA 4M53A 3ZUGA 2WAQN 5HLIA 2XT4A 2DAOA 4G7HF 1VFCA 3VNUA 3E7LA 2W84A 4HOBA 2C78A 2E1MC 2E2HJ 4Y52J 3ASQA 2OD5A 2EZKA 5TR9A 1BX1A 1EF4A 1LDKB 3SYTA 1EWYA 3FHZA 4XSXF 2VJ5A 2BSAA 3S16J 3KLNA 5LLQA 1AU7A 4FHTA 2BX6A 1GUUA 4P9UA 1AOYA 3ABKH 2FQ4A 2VNJA 4NB5A 1HW1A 5BNGA 1SVMA 2AQEA 2NTQA 2GZWA 2HTSA 2F1LA 3A1PA 1QA2A 2CUEA 2F6CA 3DEEA 1IAWA 1H0MA 1UD4A 5HS9A 2F4MB 2V6EA 2PMDA 4LMYA 1PXZA 2X85A 2HDNB 1CQXA 3LO8A 1QA3A 2MGQA 3J7AY 5ICGA 1MW7A 2EIKH 4KKSA 4CZCA 2QBYB 1TT5B 2V4JC 2V6CA 1EP1B 4XLPF 3P26A 1A8PA 5BSXA 3U6BA 3QFTA 2M0MA 3LOCA 1I3AA 2KRCA 2XB5A 5LD2C 3VMVA 4KUMA 4C2MJ 1B72B 3AVUA 1PE9A 1RI7A 1R49A 3ESWB 4RB1A 3HDDA 1FOYA 3BJAA 1Z3XA 4BE1A 3I56B 3BJ6A 3RZDJ 4D9JA 3VB2A 2Z3YA 3E0JB 1W87A 1A6QA 1U6GA 1R4MB 1FNCA 3ZSCA 5DS0A 1VQ8I 3O6BB 3PNYA 4LIUA 4OM9A 4BNCA 4IRIA 4HRIA 2HXIA 3QYEA 4HG2A 3QODA 5ICFA 1QZYA 3GFLA 3JREA 3LSMA 2R5YA 1IXSB 1MMGA 1QVFB 5F0FA 2IA0A 5IOZA 1WOSA 1D0YA 2XASA 1OLTA 2MD5A 1EV7A 2RC5A 2KZGA 2WA0A 4PGGA 1Z6TA 3OYHA 2ZXHA 2M45A 2XAGA 2WADA 1QHHD 1OFMA 3OEEA 3GVLA 2DJNA 2HQAA 2LYCA 2BM0A 4LG0B 1DBGA 3G73A 3D1NI 2DMTA 2D3LA 3LSTA 4IVNA 3KYDB 1UCRA 4M6VA 5LGUA 1QRCA 4FTHA 2LBFA 3BWGA 1JJ8C 1TP4A 2BMWA 2H1LA 1IG7A 3W6JB 3ERMA 3LA2A 3WY9A 2VBMA 5IYBJ 2H27A 2F5DA 3CDLA 2XF5A 4JX6A 2L9VA 2DYRH 3F22A 1G7SA 2ELHA 2HLDA 2GIVA 3MKLA 4I01A 2OCEA 3KP2A 1LPQA 2XNCA 3Q38A 2YWGA 4AUXA 3CCRI 2XT2A 3SZEA 3K9TA 2HFHA 2F43A 2HKOA 2HZDA 3K4CA 4YZAA 5KVRA 5DCMB 3F9KA 3M4OJ 1X3WB 3R6KA 3ZQIA 2XGJA 1BL0A 2I1LA 3RKXA 1LUJB 1S7EA 2RC4A 1F43A 3T8RA 4B48A 2XUBA 2M5SA 1JUSA 2VB6A 2BYVE 3CMAI 2R7RA 1J09A 3WGHA 5F4OA 4ZTJA 1ZARA 2V26A 1DGWY 5H6RA 4MNUA 3JRHA 4CQJA 1BC8C 3CUQC 1FDRA 3HEFA 4EJOA 4YC5A 1QFJA 4LLNA 4O6JA 4C2LA 3C3WA 3A0BC 2RC6A 5BSYA 2FE3A 2KMUA 3SFIA 2NS7A 5E3MA 2ZXIA 4I09A 3G6EI 1SFUA 2Z6BD 4CXFA 2K4JA 4IPAA 2VBVA 4AF6A 3RKYA 2L4MA 1LB2A 4G7ZF 2QY1A 2K86A 2LY1A 3I5UA 4M3GA 2C2WA 3TKYA 2ETHA 1O88A 2DOAA 1GDTA 1MSFC 1OCRH 2ZB9A 1TLLA 3FHNA 2QTLA 1QCXA 4LD5A 1BI1A 4EH1A 1UD8A 1ZHFA 5FKLA 2FMYA 2QZAA 4LIVA 4A6EA 1YRNB 4JYKA 1YX5A 4IF4A 3G1OA 4P96A 2D45A 1YW8A 1MH3A 4KMUX 1DQUA 3H9NA 1MBJA 1K8FA 4N9HA 4FX4A 4S05A 1X4PA 4TV7A 3PNTA 2WV0A 4LK1F 1T6YA 5TV2A 2L4AA 2NAZA 3I59B 1K4SA 4IHSA 1ZK8A 2H09A 3BZKA 3GZ5A 3CCLI 4HDUA 3T0YA 1FOKA 3S93A 4RD3A 2JA5J 4P6VF 3TO6A 4TT3A 1JT0A 1SVLA 5ERIA 1JTAA 2L5QA 2R7WA 4QIWN 1Q9SA 2QLZA 2M7AA 3GX4X 3S15J 2VNIA 2JVGA 5J35A 1P4AA 1PJ5A 4CZZA 1FBUA 1X4OA 3PVDA 5DEQA 1WU8A 4RM3A 1HW2A 3CCQB 1NHCA 5IP7J 3KP6A 5JLWA 2LD5A 4ZDPA 2PLYA 1XSXA 3QPSA 1RRJA 1XCBA 4Y13A 1K78A 3AG1H 5JR3A 2EILH 3ZQCA 4KFCA 1W34A 2P7VB 3DBHB 1A31A 1YITB 3FMRA 3A8KA 1ULYA 5ED4A 1DU0A 3IH2A 1KK0A 2MSYA 3GZ6A 2XOKA 3B90A 4RB0A 4L9NA 4WXHA 3CC2B 2CQXA 2JPBA 2X6WA 3A01A 3C2BA 1IJFA 3I55I 4FXUA 1KK3A 5EMNA 3I56I 2A05A 2VPLA 3SLDA 4ZCIA 3CCEB 3VSLA 1E43A 1KYZA 2MD0A 4A3GJ 3BR3A 4CA0A 1A5JA 2INUA 2CH0A 1G7TA 3WTYC 3CC7B 1P7IA 2ZKZA 1LVAA 3E5QA 3HGYA 3MZHA 2QXZA 4YELA 3ABMH 2LTPA 1NK3P 5DUKA 4OAZA 1TQPA 2V7UA 2IAIA 2YPRA 2HTJA 2KVOA 1D0ZA 3OWTA 2W7NA 1QPMA 1E1RA 3X2QH 4G6QA 4D5CA 2QSFX 4FQGA 1OR7A 2F1MA 3EQLF 2ZZGA 3WHCA 3RYRA 1YE9A 1X1AA 2J7KA 2KIQA 2ZC2A 1D8JA 2O0YA 2HPIA 4E70A 3JTHA 4EATA 5GADJ 1ELOA 2X8KA 3NE5B 4XRFA 1E63A 3LA3A 1YQAA 1E3ZA 2JQ7A 2VJJA 2ZJ2A 4YRVA 1IXCA 4DYQA 3CMYA 4BE0A 3ZPNA 3IHUA 4KJZA 3OW7A 2XV4S 1Y8QB 2G0EA 5L3EA 1E3XA 3N05A 1YLFA 3JR9A 3E6CC 2EB7A 2K5CA 4LGWA 2LKXA 4YCQA 1MNDA 2LF7A 2E1NA 3CCMI 1K9MD 4MQ9F 1O4XA 3PQJA 4E7HA 3WWGA 4W8SA 3F8BA 4M9SA 2IT0A 2GIZA 2JUCA 1JKOC 2FQ3A 3W2FA 2GOXB 1QU3A 3HRUA 4OZZA 4AYBN 1UELB 4HIZA 5DM6F 3GEZA 4KDPA 1LFPA 2GAUA 5FO0A 1AKHB 2DA6A 3CLOA 1ZUNB 2VNKA 3DLLF 4IHVA 3DBLB 3S17J 3HAGA 1LFBA 4ABZA 4A3JJ 5FFZA 4ESJA 1MBFA 1Y0RA 2EFQA 2P0WA 2EA2A 1HKSA 3TP0A 1OQYA 3C1DA 1WSVA 2XHKA 3HHHA 4PJNA 1LQ1A 4X06A 3ASTA 1UMKA 5H59A 1PYVA 4PC3A 4TSFA 4IEJA 3LSGA 3FKIJ 5A2QK 2O8KA 3WTSC 3HOUJ 4CH7A 3QU6A 2GQFA 5C1CA 3NWTA 1H8EA 3FBNB 3MWMA 1IN8A 3ZPPA 1Z77A 4BBRJ 2OA4A 4EW9A 1ZRFA 4FT8A 3RIRA 4G7XA 3FPKA 5DS9A 1D1BA 1B23P 1VQ4I 3OOCA 4OJOA 2DFHA 4RCYA 1UD2A 4HF2A 1BJKA 3MCZA 1BI3A 4ZCMA 1MGTA 1Y0UA 3SJMA 5AMVA 2DMQA 4WQMA
chains in the Genus database with same CATH topology
1E79A 3K4NA 3T53B 2XF6A 4C9YA 3ZRGA 4ZYAA 2ZZEA 1HG8A 4DGWB 3LSIA 2KDOA 4BQOA 4BQQA 2R7TA 3BCBA 3I9V2 1MABA 3OMYA 2DXIA 1Y56A 1DP3A 4U49A 1O8FA 2HDWA 5JHFA 3GQ7A 2GJKA 2NT6A 3GRHA 3W2WA 4H4KC 2O17A 2CW8A 2XAUA 1R6RA 3K4BA 2VIXA 2VL8A 3DLAA 3H5AA 4FASD 1O8MA 4P1WA 4DBRA 1MNEA 2CW7A 3I3LA 3IUOA 3CESA 3OL3A 4OWRB 2O04A 2WY7Q 4CCNA 4OZYA 1X1BA 3PSIA 3M1CA 2PMZA 2WY8Q 3HOTA 2UV1A 3H5RA 2QKMB 3MMYB 4PJJA 1W0KA 2WJVA 2ZZQA 3FPPA 2R7VA 5DN6A 4MR0A 4PMHA 4PFOA 2LY2A 1X19A 3MKZA 2VQHA 3D5RC 1OOCA 4F93B 3BC8A 3OYEA 2NSPA 1EFRA 2PECA 4QPOA 2XDVA 4ZDOA 4RMNA 3OYCA 1VBLA 4W8QA 1N77A 2V7FA 3SEQA 4XOPA 3ZIAA 4BXFA 3VSKA 4E7JA 1SFKA 1UD5A 4XLAA 1WJCA 3RPUD 1HA8A 4Z1MA 1V0EA 2W82A 3DPLC 5FL7A 5IK2A 1V5GA 2DT6A 2V9KA 1VLYA 3DPUA 2W1OA 2Z8GA 1X1DA 3CP8A 5LFAA 4E7SA 1WJBA 4XKBA 4KKTA 4L8JA 1BR4A 3JU4A 5CQEA 4UZUA 4J00A 2BSPA 3ONQA 3EUAA 2M4KA 3LSKA 3S3MA 4W8TA 1E1QA 2WAFA 4DK0A 1I18A 2DCEA 1WP6A 1MMAA 3AFHA 3RSNA 1W36D 2VQLA 3OYKA 4I84A 3S3NA 4IKFA 4HSRA 1WJAA 2FUG2 1VZ0A 2OUMA 2V31A 2KP6A 3VMWA 4YZ0A 1X1CA 3LFUA 4PJLA 1MMDA 2D3NA 4E7IA 2PYGA 4CCOA 2GK6A 2OV7A 3FKSA 1FMVA 1Z7LA 4HSTA 3OYFA 4DNRB 4F52A 5C1EA 2VXDA 3OYDA 4BDYA 2IGNA 2LOOA 2LBFB 1N78A 2R7OA 1V0FA 3CMMA 1TZLA 4XLCA 2CUJA 3GVKA 1TT0A 3HPGA 2HVQA 4CCMA 4XD7A 3E1SA 2NZMA 4HEA2 2MYSA 3A2KA 2XF7A 1DBOA 1GQ8A 1WJDA 3VSUA 1O8JA 2ZSIB 2CV2A 4XQFA 2GJPA 2Z2SB 4ITVA 2IQ7A 1H8HA 1QJVA 2VBKA 4NK6A 1O8EA 2INVA 2V7QA 2VJ4A 2CV0A 1DGRM 3BG6A 3D5LA 4B3XA 3OEHA 2HU9A 1ERDA 4JOMA 3OR1C 4KISA 1UG0A 3BCDA 3OAAA 1O8IA 2K9LA 3H5NA 3EQOA 2Y0SA 4HNTA 4ANJA 4LG3A 3OYGA 2BW3B 2EWEA 1N75A 4Y4RA 3OPOA 4II2A 3SZGA 1UAAA 3K4MA 4YZQA 3LMMA 1W36C 4DOZA 1KMHA 1FX0A 3EUHC 4LITA 2IS4A 3VR6A 1WJFA 3DWLE 5HNFA 4IQJA 3GVJA 3OL4A 2UWMA 3OS2A 4URRA 4F55A 4U7BA 2NTBA 2VQCA 2MC4A 5KCMA 3UR3C 1KTWA 4TKOB 1T5EA 4DJAA 2XSJC 3FKJA 2KLOA 3ZGKA 3ZXSA 2VLAA 3VSTA 1Z21A 3GBGA 3AKZA 3ZQQA 1T0FC 3CZ6A 2HNHA 4Z05A 3H35A 4NNJA 3S32A 2O0WA 4AVZA 3OYLA 2HVSA 2WZPP 2ZZFA 3ZR8X 1BR1A 1G8XA 2WAEA 4RLFA 3V42A 1EA3A 3JURA 2GJRA 3CF2A 1BMFA 3CP2A 2ZTNA 3A3BA 3OYMA 3HC7A 3DPTA 3PUBA 4PFPA 1OFLA 2O0VA 3RQ4A 2RQQA 1O8KA 4YEJA 2WAQA 3VDXA 4B3GA 2K9MA 3G05A 4HPQA 5HLTA 4ZDLA 4CUGA 4B47A 2E1MC 3EPZA 1NG6A 2F4IA 4XONA 3LSHA 3BCFA 2VKHA 2PYHA 4XN3A 1LDKB 2AQFA 3S3OA 3DU6A 3SYTA 2JSPA 2VJ5A 3QYBA 3CJQB 2PJRB 2CFOA 4HNUA 1JRGA 2X53S 2JIZA 2R4GA 3M8JA 2ZTGA 3OYAA 2E5ZA 2NTQA 2AQEA 2F6CA 3DEEA 4B43A 1KONA 3FBIB 1UD4A 4XOTA 4BU2A 2V6EA 2HVRA 1WPCA 1O8LA 4IZZA 4P22A 2X85A 1PXZA 3OE7A 3W2AA 3AL0C 2JJ2A 3J7AY 2LG4A 3OR2C 1MW7A 3C2GA 1T95A 4KKSA 2GK7A 4CZCA 3VYTB 2V4JC 1BN8A 1S9HA 2VKDA 2O1DA 2WB1A 5CPRB 2F5VA 3BG7A 1D0XA 2M0MA 2Z16A 2JVHA 2KRCA 5LD2C 1LVKA 3VMVA 4BGDA 2V1NA 1W9XA 1PE9A 3GQ9A 1WTHD 5TGTA 2IXSA 4R79A 4E7KA 4MLOA 1NG7A 1Z3XA 4BE1A 4XMYA 5HOOA 4B44A 3PNVA 4D9JA 1IDJA 3E0JB 4XM3A 4C30A 3ZSCA 2WBMA 4X0GA 2NSTA 4OJLA 4LIUA 3PNYA 3DTKA 3OS1A 3EQNA 3PJRA 2Q1ZB 5CKTA 4HRIA 3QYEA 4HG2A 3QODA 2GOMA 2WPDA 4DBQA 2WJYA 3LMWA 4F3QA 3LSMA 2L9NA 1MMGA 4E4HA 1PKVA 4P5OA 4YZXA 1D0YA 5CQGA 1OLTA 3OIQA 2Q2EB 2WA0A 3MD2A 4NC7A 3OYHA 2ZXHA 4C2UA 4BL0B 2JA2A 4BACA 1HVXA 1V5FA 1BR2A 2WADA 1QHHD 2X1DA 1Z3YA 3OEEA 1OFMA 4BUPA 2W6JA 2HQAA 3GVLA 3FY3A 1IA5A 2LYCA 1DBGA 3OS0A 2NT9A 2DJIA 4CCLA 2D3LA 1OGOX 3H9JA 3MKYB 3DKXA 2L7KA 2XZLA 4GQNA 3DTEA 4KKUA 4XKVA 2LBFA 1PJRA 3WQZA 1UD3A 3DTIA 3K4LA 1RMGA 3OY9A 2DIEA 5CDFA 4N4OB 4HWVA 1V5EA 2CK3A 1AIRA 2VBMA 2XF5A 4PJMA 2W6IA 1IB4A 3H94A 2HLDA 2IGKA 3A4CA 4NC8A 2M3AA 4XN0A 3HOSA 4BS9A 2LZJA 3K10A 2F43A 2HZDA 3K4CA 2KQRA 2XC7A 4YZAA 2M4GA 1IDKA 2L2OA 4ZC3A 4AU7A 3F9KA 3K70D 2XGJA 2OC6A 2NOJB 2E1MB 3K6GA 3VYSB 4B48A 3OYNA 2VB6A 4BJ5C 2R7RA 2M5SA 1PLUA 1O8HA 1J09A 4Z06A 4ZTJA 2V26A 2X51A 4G6TB 4XNFA 1DGWY 4F91B 4NUBA 4BQNA 5FROA 2UUZA 4BEHB 4BJ6C 2O5RA 3DDYA 1W0JA 2VBEA 3VWBA 4W8RA 3BC9A 1SAUA 4CCKA 1D1CA 2LREA 2R7XA 2ZSHB 4Y3OA 2RNGA 4C2LA 1MMNA 4PUSA 3DU5A 2KMUA 2XZOA 2CMPA 4CCJA 2Z6BD 2ELJA 2ZXIA 3HUGB 4OJ5A 2R7SA 3A1YA 5KHDA 3AL0B 3IAS2 2QY1A 1D1AA 4PSXA 2LY1A 3D5SC 4YXWA 3KRGA 2X3HA 1RWRA 3HPHA 3SUCA 1O88A 2DOAA 2IS1A 2BVMA 3QYFA 4J01A 3FHNA 1G59A 1QCXA 3SEZA 5HNHA 2ZFUA 3IP4B 3NWSA 1UD8A 4N4NB 4IX7A 3KEWA 4LIVA 2X6XA 3VSVA 4E7LA 4FETA 1YX5A 3L2WA 2LH9A 2E1BA 3W3CA 1DQUA 2VQGA 2IS6A 3VYRB 3BLYA 4XORA 4ASUA 1X4PA 3BH4A 3PNTA 3H0DA 2DT7B 1WJEA 2L9SA 2NTPA 2UVEA 3K70C 2M7BA 3S93A 4QPQA 4TT3A 3T9GA 3A3GA 4NK8A 1JTAA 2L5QA 2R7WA 1FMWA 1UD6A 3BCAA 2M7AA 4KT6A 2ODLA 2JVGA 2R7QA 3GQBA 1X4OA 1BOBA 4OAYA 3SDBA 4RM3A 1NHCA 3K4KA 2KHMA 2E60A 4KITB 4D1QA 4DNTB 1WFXA 4ZDPA 2PJRA 1Y6IA 3GQ8A 1K6YA 2CUZA 2UVFA 3L2VA 2V4DA 2LC2A 2XZPA 4ZJZA 4RLQA 4JMQA 3HXLA 4E6KG 2XOKA 3B90A 3L2RA 1CZFA 5HKKA 3PFYA 2QX3A 4RM2A 2X6WA 2JUGA 4FXUA 4IQ4A 2VPLA 1RU4A 3VSLA 1E43A 2X6YA 2R9VA 3OOUA 2MD0A 2WSSA 4CA0A 3PL8A 2INUA 2CH0A 2W4SA 2QE7A 3H9QA 4GRIA 2VASA 2QXZA 3KYLA 1HZEA 4YELA 2KL4A 2CV1A 1WJ5A 2RREA 3OFNA 1U0JA 4XKCA 2JDIA 4OAZA 3G2BA 3QOEA 2W00A 1WMRA 4PSWA 2KVOA 2KPMA 1D0ZA 3OWTA 4XLFA 3RTRA 4BJTA 2W7NA 1E1RA 3S8PA 4PK4A 3ZCOA 2F1MA 4XLHA 4E7ZA 1COWA 2ZZGA 4E0FA 1YE9A 1X1AA 2Z1DA 3PSFA 3IAM2 1BLIA 1I8DA 2KZVA 3A35A 3T56B 2A5WA 2HPIA 4F92B 2LRDA 4EATA 2X8KA 3NE5B 3EUKL 3FDYA 1KZLA 1E3ZA 1OB0A 2VJJA 2VJIA 4YRVA 3K4JA 2IGOA 3TL4X 4BE0A 1YX3A 3ZPNA 4KJZA 1BPLA 3B8YA 3OW7A 4XR6A 4DIQA 1KCDA 1E3XA 3N05A 4U87A 4B3FX 2K5CA 2VXZA 1BHEA 2X1EA 1MNDA 3GQAA 4CSWA 2E5NA 3DKYA 3TBIA 3VYUB 4OJ6A 4BDZA 2X1CA 3WWGA 4E7HA 3OYBA 1VJSA 3HL2A 1IRXA 3HG9A 5HVQC 4Y33A 3RCOA 1SKYB 4W8SA 3H9GA 3HKZA 3LNNA 1P9QC 2GOXB 4JQFA 1E0EA 1AA7A 1QU3A 4OZZA 2HPMA 4II3A 2MFZA 1UELB 4AYBA 4HIZA 1O8GA 1EE6A 2MABA 4NQWB 4U4BA 1JI8A 2I8DA 1ZELA 1LFPA 3CJRB 5KNLA 3DQVC 1O8DA 4DK1A 3KEYA 2JJ1A 1LKXA 3W2VA 2QKLB 2CS3A 2IGMA 3LL7A 1XG2A 2XNDA 3HAGA 2KRHA 2BW3A 1VF7A 4XLEA 1OHHA 1OR7C 4XKWA 3B4NA 2P0WA 4XL9A 4G6IA 4BE2A 3MKWB 2A6TA 1GLNA 4PJNA 3OYJA 3TMOA 4G7WA 4Z03A 1PYVA 3OYIA 3L2QA 4TSFA 1K28D 3T51B 3LSGA 2BVLA 3C2HA 1QHGA 3KX2A 1NRKA 4CH7A 1NBMA 1X0CA 5C1CA 3NWTA 1OGMX 1H8EA 3FBNB 2IS2A 4C2TA 1KCCA 5FRNA 3ZPPA 1K5CA 4BEHA 1H80A 4EW9A 2K3PA 3UNGC 4G7XA 4OJOA 1D1BA 4ZTFA 3OOCA 2BOLA 3OIPA 4OJPA 5FRMA 4MXNA 1UD2A 5AMVA 3L2UA 3U21A 3UW0A 2R7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8I A;  3EQO A;  3GQ8 A;  3LMW A;  1HG8 A;  2UVF A;  2EWE A;  4YZX A;  3B90 A;  1CZF A;  4YZQ A;  4U49 A;  1O8F A;  2QX3 A;  2X6W A;  2NT6 A;  3GRH A;  3GQ7 A;  1OFM A;  2O17 A;  1IA5 A;  1RU4 A;  3FY3 A;  1DBG A;  4URR A;  2X6Y A;  2NT9 A;  1OGO X;  2NTB A;  2INU A;  1O8M A;  2O04 A;  1KTW A;  2QXZ A;  4XKV A;  4OZY A;  4YEL A;  1RMG A;  4HWV A;  1AIR A;  2VBM A;  3VST A;  4MR0 A;  4PMH A;  1WMR A;  1IB4 A;  4Z05 A;  1OOC A;  2O0W A;  4AVZ A;  2NSP A;  4XLF A;  2PEC A;  4XN0 A;  4XLH A;  1VBL A;  3JUR A;  4YZA A;  4W8Q A;  1IDK A;  4XOP A;  1OFL A;  2O0V A;  4XLA A;  2VJJ A;  2VJI A;  1O8K A;  4YEJ A;  1PLU A;  1O8H A;  4Z06 A;  4XNF A;  3B8Y A;  4XR6 A;  1KCD A;  2Z8G A;  1BHE A;  3GQA A;  4XON A;  2VBE A;  2PYH A;  4W8R A;  4XN3 A;  2BSP A;  4OJ6 A;  3WWG A;  4W8T A;  4W8S A;  4C2L A;  1JRG A;  4OZZ A;  2NTQ A;  4I84 A;  1O8G A;  4OJ5 A;  1EE6 A;  4U4B A;  2QY1 A;  1O8D A;  4XOT A;  3KRG A;  2X3H A;  4YZ0 A;  1RWR A;  3VMW A;  3SUC A;  1O8L A;  1O88 A;  1PXZ A;  2X85 A;  2PYG A;  1XG2 A;  1QCX A;  4XLE A;  4XKW A;  3B4N A;  4XL9 A;  3VSV A;  5C1E A;  2X6X A;  1BN8 A;  2O1D A;  4Z03 A;  4XLC A;  4XOR A;  3VMV A;  1PE9 A;  3GQ9 A;  2NZM A;  2NTP A;  2UVE A;  4XMY A;  1X0C A;  5C1C A;  1DBO A;  1GQ8 A;  1OGM X;  3VSU A;  1IDJ A;  1KCC A;  4XM3 A;  3T9G A;  4NK8 A;  1O8J A;  3ZPP A;  1K5C A;  4XQF A;  2IQ7 A;  1H80 A;  1JTA A;  2VBK A;  1QJV A;  4NK6 A;  2NST A;  3ZSC A;  2ODL A;  4EW9 A;  1O8E A;  2INV A;  4OJL A;  4OJO A;  3EQN A;  4OJP A;  4MXN A;  5AMV A;  1NHC A;  3UW0 A; 
#chains in the Genus database with same CATH topology
 3K4N A;  1ETO A;  2QM3 A;  4I0A A;  3G71 B;  2DN0 A;  1W5S A;  3Q3S A;  5D6E A;  4C9Y A;  4WZK A;  2ZZE A;  4DGW B;  1WH7 A;  3V8J A;  4BQO A;  1X3Z B;  4BQQ A;  3I9V 2;  1W0U A;  1LE8 B;  2QYU A;  4X0C A;  1Y56 A;  2VKV A;  1DP3 A;  2D1H A;  2ESN A;  3F3X A;  4PC6 A;  1O8F A;  2QSH X;  5JHF A;  3WG7 H;  1ON2 A;  1BJA A;  1ETX A;  2NVU B;  1G7R A;  2O17 A;  1T38 A;  5IT9 K;  4QV2 A;  1WDT A;  1R6R A;  2DET A;  5KK1 A;  4A0Z A;  2MC3 A;  2A07 F;  4QSH A;  4QTR A;  4P1W A;  2W48 A;  3IC7 A;  1JB9 A;  3BQY A;  4MYU A;  1SD7 A;  2ZL7 A;  1X1B A;  3CCQ I;  2M8G X;  3CDI A;  1QA6 A;  2WY8 Q;  1S5L C;  3S1R J;  2QKM B;  4CO8 A;  3GXO A;  1J2X A;  3W6V A;  1ZLK A;  1OOC A;  3ZMT A;  4F93 B;  3BC8 A;  3M9A A;  3WBK A;  3ONU A;  1UHM A;  4MTE A;  1YYV A;  3HGG A;  3HIF A;  4HYE A;  3E5U A;  2HOE A;  4UUS A;  3PIO F;  2PJP A;  5GTH C;  3CC2 I;  2DO7 A;  1HOM A;  1HKT A;  1TVC A;  2HI3 A;  4BHP A;  1CF7 B;  2R93 J;  4X7D A;  3D0S A;  2YWH A;  4B4D A;  2AXT C;  4ZZD A;  3CCE I;  4QFM A;  4BXF A;  4BY1 J;  2E19 A;  4XLA A;  4Z1M A;  2HYJ A;  1XC5 A;  2RQP A;  3DPL C;  3OSF A;  1QUE A;  2P3M A;  4G1V A;  2ME0 A;  4O5V A;  1K6O A;  1R5N A;  4OIR F;  1HF0 A;  1VLY A;  4LBV A;  3CCU B;  1X1D A;  5JLX A;  2DY1 A;  2JRM A;  4Y9R A;  3A02 A;  3ECH A;  3JRC A;  2BSP A;  2M4K A;  3UKG A;  4W8T A;  3FMQ A;  2YU9 J;  3R6J A;  1RES A;  2EBI A;  3DBR B;  1WP6 A;  4DW6 A;  5IPA A;  3AG4 H;  4WK8 F;  3E6M A;  4I84 A;  3CPX A;  1XE1 A;  5E17 F;  3R61 A;  3HOV J;  2MA3 A;  1T6Z A;  2F4N A;  3PSS A;  2V31 A;  5F4J A;  3VMW A;  4YIR X;  4PJL A;  2CGP A;  3ONY A;  2OV7 A;  4KA4 A;  1FMV A;  1WVR A;  5FO5 A;  3OYF A;  5ILS A;  2BHY A;  3HHG A;  4F52 A;  4RD1 A;  5C1E A;  3TP3 A;  3OYD A;  3GLX A;  2OQG A;  4EJU A;  1TWC J;  2IGN A;  2Q2E A;  2QZ8 A;  3QFR A;  1JE8 A;  4ZH4 F;  1R4N B;  1V0F A;  1O3Q A;  2EFP A;  3JRA A;  3OJX A;  3GVK A;  3FXU A;  2HQN A;  3HTS B;  4X1E A;  3HKZ N;  4L9T A;  4XIC A;  2NZM A;  3DV8 A;  2XF7 A;  3AK5 A;  1DUX C;  3F21 A;  3Q9V A;  3F23 A;  2ZSI B;  3B82 A;  3ECO A;  1M1K D;  1O8E A;  4P2N A;  4QVA A;  1DGR M;  2K3F A;  1Z05 A;  2TRT A;  3MFK A;  4X7F A;  2QGG A;  1YIO A;  1ERD A;  3OR1 C;  3LQE A;  1UG0 A;  2F5C A;  3DF8 A;  2K9L A;  2CJJ A;  1ZAO A;  1RQR A;  1U5T C;  3BQZ A;  4HNT A;  2ECB A;  2BW3 B;  4MO7 A;  1N07 A;  2V5I A;  1IC8 A;  3RY8 A;  5HS8 A;  5EF6 A;  2HKX A;  3CCY A;  3H3U A;  2YUH A;  3PQK A;  3P7N A;  4N0B A;  1B8I B;  4A3B J;  2ESH A;  4AC0 A;  1QZZ A;  2HR3 A;  1WJF A;  3KL9 A;  1E3P A;  4I76 A;  2Y0M A;  1YJN B;  1TWG J;  2J5P A;  5J1R A;  2NTB A;  4FWT A;  1AMO A;  1Q1H A;  5JLV C;  1YFH A;  4OOI A;  2ME6 A;  1FP2 A;  2HZT A;  4DJA A;  4LC0 A;  1O3T A;  4Q48 A;  5E8G A;  3ZXS A;  4DZP A;  3VST A;  4ZCL A;  1Z21 A;  3AKZ A;  3G71 I;  3IV5 A;  1T0F C;  3CZ6 A;  4NNJ A;  2O0W A;  4B4C A;  1T33 A;  4AVZ A;  3S1M J;  2XTW A;  1Y8R B;  3OYL A;  4OIP F;  4ESB A;  3WGI A;  2ZZF A;  4GO1 A;  2L54 A;  2WAE A;  2Y9Z A;  3BG9 A;  3CF5 F;  3OZV A;  3CF2 A;  2P5L C;  5E3N A;  1HW5 A;  2MH9 A;  2QA4 I;  1LDD A;  1RUN A;  1BMF A;  3IL2 A;  1DDG A;  2FBH A;  2K40 A;  3FK6 A;  5EDN A;  2XAQ A;  3PUB A;  5FKO A;  3OYM A;  3IRR A;  5IYQ A;  1OFL A;  2VFQ A;  4YEJ A;  1OPC A;  2FML A;  4A3E J;  1OCT C;  4U7D A;  5IYD J;  2CWE A;  3VDX A;  3T1B A;  1H9G A;  4HPQ A;  2VYQ A;  5HLT A;  3WND A;  2CSO A;  1F20 A;  3O8G A;  2EZH A;  1NG6 A;  2NV4 A;  2OTJ B;  3LSH A;  4UVA A;  2EA4 A;  4HAM A;  4Y7C A;  4UV9 A;  5FKK A;  2O9L A;  1JJ2 B;  3IWF A;  3WU1 B;  3WTW C;  1Y0N A;  1BA5 A;  1JRG A;  2V7W A;  2JIZ A;  3JSO A;  1WXR A;  3M8J A;  3ROU A;  4X6A J;  2ZTG A;  2E5Z A;  2IRF G;  4YFK F;  1UHS A;  4MYT A;  3K2Z A;  1I6H J;  1DDI A;  1JA0 A;  3FBI B;  3W2I A;  4KYW A;  3I4P A;  1JJ6 C;  4F7D A;  1O8L A;  3Q9S A;  3OE7 A;  2N8G A;  4XRM A;  3ZC3 A;  4TMW A;  5LRR A;  3CCU I;  2LG4 A;  3CO7 C;  1T95 A;  1WH5 A;  5HXB A;  1IRF A;  1JTY A;  3L9F A;  3VYT B;  1OB5 A;  2O1D A;  5CPR B;  3DP7 A;  1SVO A;  1Z1D A;  3BG7 A;  1D0X A;  1BIB A;  1RQP A;  4AID A;  1XGM A;  4PAA A;  4Z4R A;  3W5V A;  4IL6 C;  1S7O A;  3GQ9 A;  2VI6 A;  1N8R D;  3AGQ A;  1WTH D;  2QUF A;  5TGT A;  3TED A;  2XSD C;  4MLO A;  1VQ5 B;  1NG7 A;  2BY1 A;  2L01 A;  2BGJ A;  1FTZ A;  4B44 A;  3PNV A;  2VFO A;  2Z9O A;  5IYN A;  1MMS A;  5L3G A;  1JGG A;  1IDJ A;  4A3L J;  3NQO A;  3G4S B;  1WSR A;  1YIJ B;  4RLZ A;  3RKW A;  4X0G A;  5GTI C;  5E20 A;  1R1V A;  4OJL A;  1WRJ A;  3OS1 A;  2GWR A;  1PUF A;  2JN6 A;  5CLS A;  1MRZ A;  1WKM A;  4A5N A;  3SZP A;  2XPW A;  1BOA A;  3CQZ J;  2STW A;  2GOM A;  4YFX F;  4DBQ A;  2KRF A;  5HLH A;  1VQM I;  5FNZ A;  4F3Q A;  3CCV B;  1QZE A;  4JX4 A;  2XTX A;  4E4H A;  3F6V A;  1YI2 B;  4GYI A;  2DER A;  4P5O A;  4FK8 A;  1RKT A;  4NCN A;  3HJE A;  3MD2 A;  1QA1 A;  4BAC A;  1V5F A;  3BQJ A;  1BR2 A;  1CNF A;  5J4V A;  1IA5 A;  3K1P A;  2AXL A;  2BEO A;  5A8A A;  4PC1 A;  2NXN B;  3ZMS A;  4A69 C;  5M5Y J;  1OGO X;  3E20 A;  3MKY B;  4KIC A;  2BM6 A;  2XZL A;  4KKU A;  4XKV A;  4B8X A;  3E97 A;  5GAH J;  3DTI A;  3K4L A;  1RMG A;  3OY9 A;  5CDF A;  4L18 B;  1V5E A;  1YW7 A;  2NRA C;  1QUF A;  2CK3 A;  2H8R A;  4FE4 A;  4I99 C;  3I1F A;  3PA2 A;  1TQI A;  1OGJ A;  2Y0S N;  1FEX A;  1YHQ B;  1IB4 A;  5D5W B;  3TW7 A;  2IGK A;  2H1K A;  3KLO A;  2FX0 A;  2XRO A;  1YX2 A;  4D7M A;  3HOS A;  4BS9 A;  2OTL B;  3FMS A;  2B7B A;  3GFJ A;  2RNJ A;  2C4U A;  4AU7 A;  4J0Q A;  3LFK A;  1YJN I;  5FB2 A;  2F5F A;  1HCR A;  1BI2 A;  1PJ6 A;  4ON0 A;  3VYS B;  3SHF A;  5LEK A;  2EFN A;  3WTX C;  2VN2 A;  4Z06 A;  1D3Y A;  4XNF A;  1FJL A;  1MDM B;  4NUB A;  3F6O A;  1XQB A;  1NB9 A;  3E1Y E;  4BEH B;  3GTM J;  1FSH A;  3JRF A;  3MQ0 A;  3DDY A;  1WQ2 A;  1W0J A;  2BGC A;  3AVV A;  4W8R A;  5CVI A;  3BC9 A;  3VMF A;  3K69 A;  4OIO F;  2OBS A;  2LRE A;  2XPV A;  4A3I J;  1S72 B;  3IKT A;  1MIJ A;  1MMN A;  3EYY A;  3V7R A;  2FOW A;  3QU3 A;  4XRS A;  4D5F A;  3DU5 A;  2OCC H;  4RAZ A;  2CMP A;  1HF2 A;  2ELJ A;  1H8A C;  2PLF A;  3K2A A;  3HUG B;  1QQ1 A;  3ABT A;  2CBX A;  2VON A;  2R7S A;  1OCO H;  2XAJ A;  3A1Y A;  3SZT A;  3AL0 B;  3IAS 2;  1D1A A;  3P4G A;  3CME B;  3GZN B;  3D5S C;  3JW4 A;  1IRG A;  2YX4 A;  2V79 A;  1EFC A;  4FIS A;  4IXA A;  5EYR A;  3HPH A;  3KRG A;  2XGD A;  3ZQL A;  3SUC A;  2CFX A;  4ZV4 A;  3ZQF A;  3V7C A;  5HNH A;  1RNL A;  2IEK A;  2A3S A;  3IP4 B;  3NWS A;  4N4N B;  1E3H A;  3J81 Z;  4IX7 A;  3AVW A;  4FET A;  1U9N A;  3L2W A;  2OTJ I;  2E1B A;  5JBQ A;  3VNV A;  3W3C A;  3ZQH A;  2JA6 J;  4P1V A;  3PET A;  3FX3 A;  1TW2 A;  3G1M A;  4YAO A;  4PJ0 C;  1JKQ C;  5BQT A;  4OOV A;  3R60 A;  1VQK B;  1NB0 A;  3JRI A;  1VQN I;  2M7B A;  3E6D A;  5HZA A;  1JHF A;  2VBT A;  4QPQ A;  1QNT A;  5L46 A;  3W5H A;  3A3G A;  3OZW A;  1OFC X;  4G8X A;  3KP5 A;  4KT6 A;  1TL8 A;  2W57 A;  1FLI A;  3GQB A;  3TOB A;  4OAY A;  5KAF C;  3SDB A;  2AO9 A;  1TTY A;  3SLN A;  4D1Q A;  4KIT B;  2V7V A;  4DNT B;  2HYF A;  4EMS A;  5M5X J;  1OYW A;  1R71 A;  1QPI A;  1JGS A;  2TCT A;  3L2V A;  2V4D A;  1ETV A;  2XZP A;  4ZJZ A;  4RLQ A;  4ZYG A;  4JMQ A;  4JX5 A;  2P7C B;  3PFY A;  4BBS J;  1XGN A;  2FRH A;  4P3I A;  1FT9 A;  2A68 F;  2CRG A;  2JUG A;  1ZG1 A;  4KIF A;  1VQ5 I;  3H3V K;  1NHA A;  1ZH5 A;  1HXD A;  1T08 B;  1ZKG A;  4IQ4 A;  3WBJ A;  1N0V C;  1QG0 A;  3O3K A;  2WSS A;  4JP0 A;  1YIJ I;  3PL8 A;  2KDZ A;  3GYH X;  3H0G J;  3GVA A;  3N4M A;  1O3S A;  1H85 A;  2F4O B;  2V7X A;  5KAI C;  1U5T B;  2VAS A;  3OKX A;  1V55 H;  1J75 A;  4I2O A;  2BM1 A;  2KL4 A;  4OP7 A;  3QFC A;  2DA3 A;  4RGR A;  4A93 J;  4LFU A;  2NVY J;  2EQR A;  2KIF A;  3CCV I;  2W00 A;  3WTZ A;  3ISP A;  4KNY A;  1IN7 A;  3H36 A;  1YI2 I;  3KFW X;  2QVO A;  4A0X A;  2XGX A;  3ZCO A;  3J7Z I;  2H6C A;  1G6N A;  4LBZ A;  4E7Z A;  5DNS A;  2Z5U A;  1UST A;  1COW A;  2IJL A;  2RVC A;  4XID A;  1I8D A;  1XDU A;  3IAM 2;  4C3J J;  2PMU A;  3U6K A;  4F92 B;  1NH3 A;  5HDG A;  1ZM9 A;  1MBK A;  3QPH A;  5CVJ A;  3EUK L;  4YG2 F;  4MEX F;  1KZL A;  3VOE A;  4QLC U;  4I6Z A;  1ORK A;  2ZCW A;  2IGO A;  3TL4 X;  5LGT A;  3S2D J;  3CCS I;  1IZ1 A;  3OIO A;  1XB2 A;  4BPR A;  3K1N A;  5GPA A;  3F8N A;  4KIG A;  4CYC A;  1R00 A;  3KZZ A;  1QBJ A;  4B3F X;  2VXZ A;  1VQL B;  1BHE A;  1Z6R A;  2BM7 A;  3DKY A;  1YHQ I;  4BDZ A;  2QWW A;  5C4J J;  1MH4 A;  3OYB A;  5BPD A;  1VJS A;  4FN5 A;  1SKY B;  2O6G E;  5FLM J;  2ZXJ A;  3H9G A;  5FLX Z;  1G3W A;  3HKZ A;  1P9Q C;  3JQP A;  4JQF A;  3PUN A;  2XEX A;  2X0L A;  2HPM A;  4RS8 A;  3ASS A;  3SDG A;  1WGX A;  1LEA A;  1EE6 A;  2MAB A;  4P55 A;  2FSW A;  3W2G A;  3CJR B;  4YEI A;  3DQV C;  5DUI A;  1T6X A;  5CVU A;  4IHT A;  1HC8 A;  3W2V A;  3AVY A;  4I7H A;  5F08 A;  1UMQ A;  4YIF A;  3GWZ A;  2DLL A;  2YU3 A;  1YLO A;  2E36 A;  1GVH A;  4G6I A;  3MKW B;  2A6T A;  4UY8 I;  4M0L A;  3NB2 A;  4NC6 A;  4W97 A;  2MW8 A;  2OJE D;  4Z03 A;  3QP5 A;  5IP9 J;  5DCM A;  3L2Q A;  4C3I J;  1CQT A;  3FXR A;  4EEF G;  2VBS A;  1K28 D;  1VQ6 B;  1BI0 A;  2K9N A;  3C2H A;  1R1U A;  1I6X A;  2DOF A;  1NBM A;  2HMA A;  4JRA C;  4GGG A;  4RJL A;  3RDI A;  2WWY A;  1I27 A;  1MKM A;  3PSZ A;  1K5C A;  3CME I;  3MCA A;  2K3P A;  3SY2 A;  4DZJ A;  2AHO A;  2KJB A;  4ZTF A;  2BOL A;  1MBH A;  3OIP A;  4LJZ F;  5FRM A;  2DOG A;  3FJO A;  3L2U A;  5F64 A;  3U21 A;  1LNW A;  2HGC A;  3UW0 A;  3JRG A;  4CDG A;  5D5V B;  2R7U A;  1E79 A;  3QWL A;  1W7P D;  2VFP A;  3ZRG A;  1SC7 A;  4XLN F;  4OIN F;  3LSI A;  4R1H A;  3BTI A;  2R7T A;  5CVV A;  5DDG A;  5THX A;  1BN5 A;  2DXI A;  2JSC A;  3CXC B;  3J80 Z;  2CF4 A;  2OPT A;  4RDL A;  1ETQ A;  3Q0U A;  4EQQ A;  1VQK I;  2NYX A;  4LOC A;  3GRH A;  2YS9 A;  4H4K C;  1D5Y A;  1XDS A;  2CW8 A;  2DMU A;  2XAU A;  1P6R A;  4RGU A;  1WSU A;  3DLA A;  4FE7 A;  2E71 A;  2GLO A;  1X1P A;  1YRN A;  1O8M A;  2O04 A;  4DBR A;  1XGS A;  3I3L A;  3OL3 A;  4OWR B;  3FWE A;  1KK1 A;  2WY7 Q;  2XRL A;  4CCN A;  1FZP B;  4OZY A;  1SD4 A;  2PMZ A;  4TMX A;  4HZF A;  2UV1 A;  3MMY B;  4PJJ A;  2WJV A;  2ZZQ A;  3CCJ B;  2R7V A;  4PMH A;  4PFO A;  2ZME C;  4H0E A;  2PQ8 A;  3OYE A;  2X48 A;  2NSP A;  4A2U A;  1I3Q J;  1L3L A;  1EFR A;  3KEQ A;  4RAY A;  4ZDO A;  1K78 B;  4U0Y A;  3BP8 A;  1ON1 A;  1VQ9 B;  2PN6 A;  2M34 A;  4BH9 A;  1N77 A;  2HCJ B;  2KIU A;  4XOP A;  3BZC A;  3LYC A;  1QVT A;  3OJW A;  2L02 A;  1HA8 A;  1WJC A;  3RPU D;  2DI3 A;  1IV6 A;  2HDC A;  2DT5 A;  1V0E A;  5K7H A;  1R58 A;  3B6A A;  5IK2 A;  2P4W A;  1V5G A;  4P12 A;  2Z8G A;  2W1O A;  1TLH B;  3CP8 A;  3FZV A;  2OK8 A;  4E7S A;  4L8J A;  4PCQ A;  2A6H F;  2JA7 J;  4BHB A;  3JU4 A;  4ZGQ B;  4UUT A;  2M5W A;  3I58 A;  4M3D A;  3ONQ A;  3S14 J;  1NK2 P;  3EUA A;  3HOX J;  1QGP A;  2LR8 A;  1FOX A;  1UB9 A;  1E1Q A;  2WAF A;  2DCE A;  2V9V A;  2XTY A;  3ABL H;  2K85 A;  1MMA A;  2MLG A;  3VFZ A;  2JT1 A;  4EJV A;  2QQB A;  5IYC J;  1RPW A;  3S3N A;  1YO5 C;  3ZQ7 A;  2DA4 A;  1C0W A;  1TNT A;  2FUG 2;  2OUM A;  4ENK A;  3WTT C;  3LFU A;  2D3N A;  4E7I A;  3J7A O;  4EJT A;  4C43 A;  2GK6 A;  5M5W J;  2Q6L A;  5K5R A;  3FKS A;  1Z7L A;  4HST A;  4RM0 A;  1B1B A;  2ZO4 A;  4A12 A;  2L9R A;  2QGU A;  4N9I A;  1I5Z A;  4PAB A;  1I50 J;  1JUM A;  4UAJ A;  2LOO A;  3SQV A;  1GXQ A;  4B09 A;  5E1X A;  2WV1 A;  2B7E A;  4C0S A;  1TZL A;  2VBX A;  4HV5 A;  4IRG A;  3CW2 A;  2EJR A;  3RZO J;  5TRD A;  1EFT A;  3E1S A;  2ZBK A;  4HNV A;  4HEA 2;  5BPI A;  1JHH A;  3A2K A;  1FNB A;  2ZBU A;  1DBO A;  5IT3 A;  3VSU A;  2L3D A;  2MBF A;  1IW7 F;  2IQ7 A;  2Z2S B;  1KTV A;  1H8H A;  2CQK A;  3Q39 A;  4D0P A;  2INV A;  2VJ4 A;  2AS5 F;  2CV0 A;  2W25 A;  3AGP A;  4IRH A;  4G94 A;  1EP2 B;  2HU9 A;  4M1K A;  4Y15 A;  1OCZ H;  3HBL A;  1CNE A;  4JOM A;  2GXA A;  1JXS A;  2R6H A;  5TY0 A;  4ZGN B;  3OAA A;  3U2R A;  3H5N A;  3ULQ B;  3EQO A;  2Y48 A;  1U8R A;  2Y0S A;  5E8I A;  3O2P E;  1KU2 A;  4LG3 A;  1FYL A;  3OYG A;  2CUF A;  1BX0 A;  3ASP A;  3O8H A;  3W6K B;  2EWE A;  4Y4R A;  3BY2 A;  1XGO A;  3SZG A;  1UAA A;  2PX9 A;  2D74 A;  4KN7 X;  4M71 A;  2K9Q A;  3LMM A;  4XBF A;  1VQ6 I;  4Z6Y A;  1FND A;  2ZL5 A;  5J40 A;  1FX0 A;  3EUH C;  4S0H B;  2IS4 A;  3M7G A;  2FEZ A;  4IQJ A;  3GVJ A;  4OMZ A;  3OL4 A;  4P9S A;  2DA1 A;  2VT3 A;  1GHC A;  5FIU A;  5EZG A;  4F55 A;  3V8K A;  4UNO A;  3CC4 B;  5EG0 A;  2W24 A;  4U7B A;  2O8X A;  2MC4 A;  1IXR C;  2XC1 A;  3UR3 C;  4OOX A;  3HRS A;  3LA7 A;  5ICE A;  4M3B A;  1SMY F;  5C4X J;  3GW2 A;  1DPU A;  2XSJ C;  2KLO A;  3ZGK A;  5CVR A;  4TMZ A;  3WNB A;  5F0H A;  1XX5 A;  1M1E B;  3ZQQ A;  3Q6R A;  3V7S A;  2HNH A;  3S32 A;  1A35 A;  1RUO A;  1O7L A;  2R5Z A;  2WZP P;  1VQP B;  4YDT A;  4ACA A;  3V4G A;  1BR1 A;  4YHB A;  3BDD A;  1EA3 A;  2VBY A;  1LDJ A;  5M3M J;  1TYW A;  2P81 A;  2ID3 A;  2LKP A;  1ZM3 A;  1Z0X A;  2KIM A;  1R5I D;  3DCF A;  1WCM J;  4IOA F;  3A3B A;  2VC1 A;  1TTT A;  3HC7 A;  2VBW A;  4PFP A;  1J9Z A;  3L2C A;  3RQ4 A;  1O8K A;  3ZN0 A;  2WAQ A;  1XD7 A;  2M0C A;  2RKH A;  4U0V A;  2VE8 A;  3RQI A;  1LE8 A;  3GSI A;  4Z4Y A;  1G3S A;  4B3G A;  1KU3 A;  2LVS A;  4CIC A;  4B47 A;  2ELK A;  1ZTR A;  1S3J A;  4XON A;  3U9G A;  3CCJ I;  2VKH A;  3LNQ A;  2PYH A;  4XN3 A;  3U1D A;  1UZC A;  2AQF A;  4Q47 A;  5C3E J;  3COA C;  2JSP A;  3S3O A;  3JAM Z;  4TN1 A;  1YIT I;  3QYB A;  2W7Z A;  1E64 A;  1JNY A;  2PJR B;  2CFO A;  4HNU A;  4PC7 A;  2X53 S;  3B6C A;  2R4G A;  5DD4 A;  5F27 A;  3ZMU A;  5E3O A;  1K4T A;  1QVU A;  4FX0 A;  5DYM A;  1QQI A;  2QN6 A;  1UJ8 A;  1N05 A;  4UUS B;  1P7J A;  2IW5 A;  3Q0V A;  3WE3 A;  4XOT A;  4K1X A;  3AVT A;  1I1S A;  2BV3 A;  2HVR A;  2GXG A;  1WPC A;  1RKW A;  2WYR A;  1T56 A;  4A0Y A;  3CC7 I;  3WNC A;  4UVB A;  2DMP A;  3AL0 C;  2JJ2 A;  4M2L A;  3OR2 C;  1XN7 A;  4L0Y B;  1WI3 A;  1V3F A;  2GK7 A;  2F48 A;  5F1J A;  1BN8 A;  1S9H A;  2VKD A;  2DA2 A;  2F5V A;  2V1D A;  1CF7 A;  4O3M A;  4ZYE A;  2Z16 A;  3W2H A;  3J81 K;  1YOV B;  2X6O A;  4RDU A;  2X0K A;  4BGD A;  3HOW J;  1W9X A;  3ZMZ A;  3GFM A;  1BW6 A;  4R79 A;  4E7K A;  4QWQ A;  4WWC A;  2BM5 A;  4XMY A;  5HOO A;  3JX8 A;  3Q0W A;  2EV5 A;  1GO2 A;  1MBE A;  4C30 A;  2LMD A;  5TIS C;  3RPQ A;  5LMZ A;  1XPX A;  2WBM A;  2NST A;  3RYP A;  4HA8 A;  3EQN A;  2EV0 A;  3PJR A;  5CKT A;  1FIP A;  2CO5 A;  1J0R A;  1ZR2 A;  2J5O A;  3BG3 A;  1OIS A;  2HDD A;  2FNP A;  4L5I A;  3RIQ A;  3HSF A;  3PA1 A;  2WPD A;  4OPS A;  2HOS A;  4QVJ A;  5D6F A;  3LMW A;  2GA1 A;  4BY7 J;  2L9N A;  4AWX B;  1Q81 D;  1PKV A;  5D4S A;  1TUI A;  4MHG A;  2XGE A;  5CQG A;  4HW0 A;  1FRQ A;  3Q3A A;  5GV8 A;  2C5B A;  2Q2E B;  4NC7 A;  1USS A;  3CUQ A;  3GTJ J;  4BL0 B;  2X1D A;  2Y9Y A;  3L7W A;  3R6S A;  4BUP A;  4RB3 C;  2W6J A;  3PO3 J;  3U1K A;  2ZL6 A;  4ENN A;  3FM5 A;  2HEO A;  3OS0 A;  4HF0 A;  4CCL A;  1VHO A;  3MMP A;  1IDY A;  3DKX A;  3Q5F A;  2E7W A;  2O7O A;  4GQN A;  1IDZ A;  1H88 C;  2HQR A;  3WQZ A;  4X7E A;  3MAJ A;  1KK2 A;  2DIE A;  2OBR A;  3H1C A;  4HWV A;  1EH7 A;  2R3S A;  4M3F A;  3BG5 A;  5F0C A;  2L7F P;  2M1B A;  2PEX A;  4AM3 A;  1ZGJ A;  3K0L A;  3HTU A;  4NC8 A;  4HE5 A;  1ZGA A;  4NQW A;  3H09 A;  1YG2 A;  3T8T A;  5FKM A;  2LZJ A;  1E2X A;  2ADU A;  3K10 A;  5J6X A;  3QE2 A;  2XC7 A;  3B8H A;  3KZI C;  4ZC3 A;  1J5Y A;  1K73 D;  3RI4 A;  2OC6 A;  1XSD A;  2NOJ B;  3K6G A;  1A6I A;  1PLU A;  2DA5 A;  4ZYD A;  5IY5 H;  3HYI A;  2I10 A;  2X51 A;  4G6T B;  4RA2 A;  2ZME B;  4F91 B;  4BQN A;  3GTO J;  2M2E A;  2C5H A;  5B5E C;  1QRY A;  2X4H A;  2FU4 A;  3VWB A;  4WCG A;  3A03 A;  3TOA A;  1PJ7 A;  1SAU A;  5E3L A;  1P2F A;  1D1C A;  4CCK A;  3QPT A;  1DG1 G;  1OGI A;  1RET A;  1YS6 A;  2GA2 A;  2VPR A;  2FD5 A;  4Y3O A;  1R7J A;  1J7K A;  1VQP I;  1Y39 A;  4IHX A;  2O61 A;  1KJZ A;  4H9G A;  3E5X A;  1SKQ A;  2VOO A;  1QH0 A;  3K1M A;  4V2G A;  5J3O A;  2QEX B;  4CCJ A;  3BH7 B;  2QTZ A;  4GYG A;  5J1U A;  2GM4 A;  4CGZ A;  1SEU A;  2WTE A;  1FYM A;  1DDN A;  4OPO A;  5A88 A;  5GPC A;  2OBT A;  4MFE A;  4PC2 A;  2BGI A;  4PGH A;  1W2B B;  1VHE A;  2DFE A;  2VC0 A;  2IS1 A;  2BVM A;  2M8E A;  3QYF A;  4RPB A;  2NS0 A;  2V1X A;  5C44 J;  2ZFU A;  3TO9 A;  1T2K A;  2YSR A;  4BXU A;  3ZP5 A;  4E7L A;  4EM0 B;  2G7U A;  4XRS G;  3N90 A;  1I7P A;  5JFR A;  3P9I A;  2IS6 A;  2FA5 A;  3BLY A;  2LY9 A;  1EKE A;  1FSE A;  4AF7 A;  4ASU A;  2HOA A;  3BH4 A;  1JKP C;  1V5V A;  1WOR A;  4BQA A;  5E6T A;  2R7F A;  1VQ7 B;  1S4M A;  2L9S A;  2NTP A;  2UVE A;  3K70 C;  2LK2 A;  4HF1 A;  1N0U A;  3ASO H;  1U2R A;  2RAE A;  1PP8 F;  1YJW B;  4RD2 A;  1FC3 A;  4WXC A;  2YUS A;  2ZNY A;  1FMW A;  4EGZ A;  1H42 A;  2DYS H;  2R7Q A;  3BTJ A;  1ZRC A;  4B1R A;  2XZO A;  2ICW G;  4D7N A;  1SAX A;  2KKO A;  1GT0 C;  4RD4 A;  3CRZ A;  2P5V A;  1GAQ A;  3OV8 A;  2KHM A;  4I98 B;  2QCO A;  4IJA A;  4AVP A;  1WFX A;  5J4Y A;  4HDV A;  2FNA A;  3ABU A;  3JQR A;  1JTX A;  1K6Y A;  5K5Q A;  1A36 A;  3GQ8 A;  2CUZ A;  4X8I A;  2UVF A;  2WB1 N;  3ZOB A;  2BY2 A;  2LC2 A;  3N97 A;  4N3G A;  1BC7 C;  4BYY A;  2E7X A;  3PIP F;  5HKK A;  3GF2 A;  3J7Y J;  1G3Y A;  4EM2 A;  1D1N A;  4ENJ A;  1RU4 A;  3J80 K;  1HQC A;  1FRN A;  2X6Y A;  5E18 F;  3OOU A;  2R9V A;  4RCZ A;  1GR1 A;  2OU2 A;  1XSV A;  2W4S A;  2QE7 A;  3V8L A;  4GRI A;  2W85 A;  3LAP A;  3KYL A;  3ASN H;  1TWF J;  5FKN A;  3BR2 A;  2CV1 A;  4BAY A;  2C4T A;  3JRB A;  1APL C;  4XKC A;  1JKR C;  3QFS A;  4PDK A;  1PUF B;  3PM1 A;  4EGY A;  3LJY A;  4PSW A;  5H6Q A;  2QQ9 A;  5DSZ A;  3HRT A;  4V19 K;  3RTR A;  2A6E F;  2QYO A;  4ETS A;  3S8P A;  4PK4 A;  3P27 A;  4XLH A;  2A61 A;  1Z7U A;  4RD6 A;  4E0F A;  4KMF A;  2Z1D A;  1BLI A;  3PSF A;  3T56 B;  5DD8 A;  5IOY A;  2PFB A;  4XSZ F;  2A5W A;  3H3Z A;  1K61 A;  2EIN H;  3FDY A;  1OB0 A;  3SKB A;  2VJI A;  1WOP A;  1BPL A;  3B8Y A;  4XR6 A;  2XKO A;  4Z2Y A;  4U87 A;  3L1P A;  5IYR A;  2EFW A;  1TYU A;  4M4S A;  3GQA A;  4CSW A;  4A3F J;  2E5N A;  3TBI A;  3HOZ J;  1LFU P;  5EGO A;  3JQQ A;  3HL2 A;  1JA1 A;  1IRX A;  5HVQ C;  3F0C A;  4DNC A;  2XNJ A;  5B1A H;  1BM9 A;  1M90 D;  4UB8 C;  1AA7 A;  1ETY A;  3IH3 A;  4G12 A;  2BY0 A;  1GV5 A;  2R0Q C;  4OU0 A;  2MFZ A;  4AYB A;  1O8G A;  4W1U A;  3IRQ A;  4U4B A;  3TO7 A;  1ZEL A;  2EFG A;  1O8D A;  1D8T A;  2COM A;  3WTV C;  3AG3 H;  1LKX A;  1OCC H;  1Z91 A;  1H9T A;  2CS3 A;  4ASN A;  2JJ1 A;  3LL7 A;  2D2W A;  1XG2 A;  2XND A;  2DDA A;  2KRH A;  2HWV A;  1TYX A;  5H2F C;  1OR7 C;  5BMZ A;  3B4N A;  2DOD A;  5M3F J;  3W2E A;  3LQQ A;  2UZK A;  1R9T J;  3TMO A;  2KT0 A;  3OOP A;  3OYI A;  2I5U A;  4RD0 A;  5FO1 A;  2DU9 A;  4FCY A;  3CCR B;  4IW3 B;  4L9V A;  2VOD A;  5IT9 Z;  5J3L A;  3T51 B;  1QHG A;  1NRK A;  2FBI A;  5LHI A;  2QF7 A;  1Q86 D;  3OSG A;  3SFZ A;  1QGZ A;  1OGM X;  1KGS A;  3BY1 A;  4C2T A;  3M07 A;  4NBQ A;  2IP2 A;  2EIJ H;  4BEH A;  4CHU A;  2B5O A;  3CMA B;  2B7C A;  3UNG C;  2E2I J;  2JK3 A;  1EXM A;  2GRE A;  4ROX A;  4P25 A;  4Z4S A;  4HBL A;  3QP6 A;  5LRS A;  1V4R A;  1HSJ A;  5F1R A;  4RGS A;  5ICC A;  2Y31 A;  4ESF A;  2XF6 A;  1PUE E;  2DTZ A;  3SJP A;  1HG8 A;  5EEG A;  2KDO A;  1OKR A;  5J8F A;  5BOX A;  2HDW A;  1P4M A;  1AWC A;  1W1W E;  2LKS A;  4P3Y A;  1W7P A;  5HZB A;  3V76 A;  3W2W A;  1VQ7 I;  1G4D A;  3CPW B;  1ZN2 A;  4WZT A;  3DFG A;  3KYC B;  1YJW I;  1OB2 A;  1OYY A;  4A5M A;  2VIX A;  2VL8 A;  2EH3 A;  3CD6 B;  4M9Z A;  1MNE A;  3NAR A;  2QQA A;  3IUO A;  3CES A;  1SD5 A;  4MFD A;  2BV6 A;  1U2W A;  2F3L A;  2B0R A;  2R92 J;  3PSI A;  2CQQ A;  2TDX A;  3M1C A;  3MVP A;  2BZT A;  1GXP A;  2ISZ A;  1W0K A;  1MZB A;  5GAE J;  4M6Y A;  2F2E A;  2HOT A;  4R71 A;  1WHU A;  2LY2 A;  3MKZ A;  2VQH A;  3J81 k;  3PO2 J;  2PEC A;  1RC9 A;  2P6S A;  3H92 A;  1VQO B;  2XDV A;  3KZY A;  4A3K J;  1TNS A;  1POG A;  3WOD F;  2LF8 A;  3OYC A;  1ZYR F;  3CCL B;  1VBL A;  2CU7 A;  2DA7 A;  2NOG A;  4G6D A;  1EJ9 A;  2V7F A;  2Y30 A;  3SEQ A;  2VE9 A;  3ZIA A;  2LNB A;  4OMY A;  4E7J A;  4HLY A;  1UD5 A;  3G4S I;  1IJE A;  1W35 A;  1KU7 A;  4YAF A;  4JK1 X;  2XAF A;  2QBY A;  5FL7 A;  2DQL A;  3TQN A;  2DT6 A;  2HS5 A;  3HRM A;  5GV7 A;  3KPH A;  1WJB A;  1Y0Y A;  4KKT A;  1BR4 A;  1B72 A;  2JMW A;  2CW0 F;  2OQR A;  5CQE A;  3RPU A;  4QHY A;  4J00 A;  4UZU A;  3ZZU A;  4A6D A;  4N3N A;  1ETK A;  2EZL A;  3LSK A;  3REO A;  2WZN A;  4F7Z A;  2RV8 A;  5KSW B;  3LSP A;  2P8T A;  2YX7 A;  4M6X A;  2DFF A;  2V1U A;  3I55 B;  2KFD A;  3RSN A;  2R5Y B;  2K4B A;  3JAM K;  2GPJ A;  4P26 A;  1U5T A;  3ELK A;  5D8K B;  1X2N A;  4V2F A;  2J8K A;  3ZZ0 A;  1HDD C;  4HSR A;  1FNN A;  2MG4 A;  2UXX A;  1VZ0 A;  1Y1V J;  2KP6 A;  2ID6 A;  1X1C A;  2G0Y A;  2PYG A;  1MMD A;  4CCO A;  1FBQ A;  1B59 A;  3JRD A;  2NVQ J;  1LLW A;  4DNR B;  4EM1 A;  1Z9C A;  5DM7 F;  4BDY A;  1MSE C;  6PAX A;  1S29 A;  1SD6 A;  4WF2 A;  5D5U B;  2C6Y A;  4HE6 A;  2LBF B;  3ZBT A;  1N78 A;  3SJZ A;  4CYC B;  3GME A;  2CUJ A;  1TT0 A;  4HV6 A;  4LG0 A;  2Q6O A;  4YII A;  3BY6 A;  1F9N A;  3W5U A;  1QRB A;  4CCM A;  4XD7 A;  2E35 A;  2OTL I;  2MYS A;  1F5T A;  3NEU A;  1T0F A;  4BXX J;  1GQ8 A;  2IA2 A;  5K7F A;  4ITV A;  1T8I A;  2O03 A;  3JTG A;  3KE2 A;  4LLG F;  1STZ A;  2EIM H;  1NDH A;  3BG6 A;  3OEH A;  3L09 A;  2EPF A;  4KIS A;  1MJA A;  5E1W A;  3OZU A;  1QO0 D;  3CCM B;  3R4K A;  3I0T A;  2UXN A;  4ANJ A;  4UV8 A;  1LM1 A;  2Y2Z A;  2C77 A;  1N75 A;  4YZQ A;  3I53 A;  3M8E A;  1W36 C;  1S72 I;  2WC2 A;  5AON A;  3GLL A;  1KRH A;  2CND A;  5AN9 A;  2V9P A;  3DWL E;  3ZBU A;  3SQN A;  1CGP A;  4I02 A;  4RDK A;  1KYW A;  4HX4 A;  5EZH A;  5FFX A;  5IYW A;  1FOW A;  1J9I A;  4GFB A;  1R23 A;  5LEJ A;  4X07 A;  4J19 A;  3BR6 A;  5HDK A;  3MN2 A;  1QVG B;  3FKJ A;  3HM5 A;  5JHU A;  3GBG A;  3BOQ A;  1IO2 A;  2MLK A;  5AIQ A;  4Q4Z F;  1KQ0 A;  2JA8 J;  4Z05 A;  1WOO A;  3H35 A;  1XB4 A;  2DPU A;  1TYV A;  1B9M A;  3N6Z A;  2HVS A;  1G8X A;  1EFU A;  1LJ9 A;  1BW5 A;  1T39 A;  2CC2 A;  3CP2 A;  4Y7N J;  3EET A;  5H20 A;  2OK7 A;  3GTQ J;  4KIB A;  5B6I A;  3AG2 H;  3DPT A;  3FXO A;  2O0V A;  1VQ4 B;  1ZRE A;  3CD6 I;  1FBS A;  3P9K A;  1XS9 A;  1KZH A;  3TH0 A;  2Y69 H;  2A69 F;  2DYI A;  2FJ1 A;  1KU9 A;  2K9M A;  4UB6 C;  1S0U A;  3G05 A;  4ZDL A;  4CUG A;  1QGA A;  5ILU A;  3WG9 A;  1TWH J;  3CO6 C;  3EPZ A;  2F4I A;  4M9X A;  5FLV A;  2XGC A;  3BCF A;  2Z99 A;  2DBB A;  3I59 A;  1R5O A;  3MZ8 A;  3DU6 A;  2CG4 A;  3ZMV A;  4LK0 F;  5H5J A;  2DQR A;  3CJQ B;  5J47 A;  2L7M P;  3B02 A;  3QQA A;  1VQO I;  2PG4 A;  3EDP A;  3BNW A;  2XPU A;  4IO9 F;  1N06 A;  3OYA A;  2ZJP F;  3PUM A;  1VTN C;  3LQR A;  5D4R A;  1QFY A;  5TJJ A;  1P4W A;  4TMT A;  2V7T A;  4B43 A;  1KON A;  1L0O C;  5FD5 A;  1MJ9 A;  2FOK A;  3I64 A;  2H8W A;  4BU2 A;  3A01 B;  3R0A A;  1ZQ3 P;  1PP7 U;  4L0Z B;  4IZZ A;  4P22 A;  2ZNZ A;  1ODD A;  3W2A A;  1ZM2 A;  1G2H A;  5CYV A;  2IPQ X;  3WTU C;  1R22 A;  3C2G A;  3FXJ A;  4X7C A;  3KP4 A;  3BR1 A;  2WB1 A;  2OZ6 A;  2RDP A;  4PZJ A;  4HX8 A;  4YFN F;  4L5E A;  2JVH A;  2K9S A;  4X05 A;  1LVK A;  3TW6 A;  2V1N A;  5LBQ A;  2RGV A;  3LSR A;  4DQ2 A;  3ML3 A;  2IXS A;  3MEX A;  1FYK A;  3GCM A;  1JUP A;  3IWZ A;  1BQE A;  9ANT A;  1ZG5 A;  5IYP A;  1WZ2 A;  4XM3 A;  3CJT B;  2ZIT A;  2Q8K A;  4NHJ A;  5GP9 A;  2JRT A;  3WU0 A;  4Z4U A;  3DTK A;  1ZRD A;  3A8J A;  1DPR A;  2DDB A;  2Q1Z B;  2HXO A;  1Q1V A;  4LB5 A;  3VO1 A;  3CJN A;  1I39 A;  3HOY J;  3TDZ C;  2WJY A;  3GIR A;  1VQL I;  1DAR A;  4LBY A;  1IUF A;  1MNM C;  4YZX A;  1O7F A;  1ZLJ A;  1BJZ A;  3OIQ A;  4EV0 A;  2YWE A;  4C2U A;  2KIS A;  3AAF A;  1ZGW A;  1E3O C;  3EYI A;  2D9R A;  2JA2 A;  1HVX A;  2PE3 A;  2LLK A;  2VZL A;  1GVJ A;  4DQK A;  2OZU A;  3P9C A;  1Z3Y A;  4GCV A;  5CJ9 A;  3OP1 A;  4MTD A;  3FY3 A;  1EA0 A;  3NAW A;  1BIA A;  2DJI A;  4L9J A;  2NT9 A;  3H9J A;  3GUD A;  2H6B A;  2L7K A;  1HA3 A;  4C3H J;  1XMK A;  3DTE A;  1ENH A;  2IVM A;  1PJR A;  2DK8 A;  1B4A A;  1IRZ A;  2IA1 A;  5D5X B;  5K5O A;  1QFZ A;  1UD3 A;  4UZF A;  2VFN A;  4N4O B;  1AIR A;  2NNY A;  3LSJ A;  4QUZ A;  4AIJ A;  4Q7J B;  4PJM A;  4Y17 A;  2W6I A;  5GAG J;  1T6S A;  3H94 A;  3A4C A;  2PI0 A;  2ACJ A;  1G3T A;  3ZQG A;  1FPQ A;  2M3A A;  4XN0 A;  2J8I A;  3NRV A;  3BJO A;  3F8F A;  3FXQ A;  4L5J A;  2KQR A;  3I54 A;  1AKH A;  2ISY A;  2M4G A;  2FXA A;  1IDK A;  1X3U A;  2L2O A;  1W5T A;  1XTA A;  3K70 D;  2Y75 A;  4DYR A;  4P9F A;  2CQ7 A;  3VO2 A;  1KC8 D;  2E1M B;  3OYN A;  4BJ5 C;  1RZ4 A;  1O8H A;  5EJC A;  2M30 A;  1NTC A;  4WXD A;  3AVX A;  2IBD A;  5EG0 B;  5FRO A;  2UUZ A;  3Q6Q A;  2E1R A;  3R0J A;  4BJ6 C;  4WZE A;  2STT A;  2O5R A;  2VBE A;  1GV2 A;  3V7A A;  1XG1 A;  3M1E A;  5B3S H;  2VBZ A;  2R7X A;  2ZSH B;  2RNG A;  2L0K A;  4M74 A;  3D26 A;  3FM3 A;  4PUS A;  3S2W A;  3F72 A;  2H94 A;  5FD6 A;  3ZPL A;  2JPC A;  4YAW A;  2E1C A;  1RR8 C;  3KET A;  1RIO H;  2R5Z B;  4OJ5 A;  1HST A;  5KHD A;  2DK5 A;  4MEY F;  2FF4 A;  5BS6 A;  4GDF A;  2CYY A;  3RKQ A;  4PSX A;  2ZBV A;  4YXW A;  4OPV A;  2X3H A;  1RWR A;  5LHG A;  2E2J J;  1GVD A;  3E3V A;  4U9U A;  2B0L A;  1HLV A;  3DEU A;  2PMH A;  3E6B A;  3WU2 C;  2NVT J;  3TGN A;  4J01 A;  1G59 A;  3NAU A;  3SEZ A;  3KEW A;  1U78 A;  3VSV A;  4HX7 A;  2X6X A;  1IN6 A;  3IH4 A;  3FIS A;  1SAN A;  1R5G A;  5DTD A;  2LH9 A;  1FNM A;  3WXM A;  2VQG A;  3VYR B;  4AIK A;  1KQ8 A;  4XOR A;  1UG2 A;  4R8H A;  4CYD A;  1KA8 A;  2BBY A;  2VNH A;  3H0D A;  2WR8 A;  2DT7 B;  1WJE A;  1FY7 A;  4LLL A;  4BHC A;  3HZJ A;  1P4X A;  3WHB A;  3ZN1 A;  2QA4 B;  1VQ9 I;  2M87 A;  4KH3 A;  1L1I A;  3A0H C;  3T9G A;  4NK8 A;  1KD1 D;  2Z33 A;  3FK7 A;  4S04 A;  1UD6 A;  3BCA A;  2ODL A;  3CTA A;  4EJW A;  4YAU A;  4NBS A;  1BOB A;  4M3E A;  4Z4W A;  4IOC F;  1S8N A;  1WI9 A;  2E60 A;  3K4K A;  4LB6 B;  3M3Y J;  3ZZT A;  2PJR A;  1PDN C;  1T98 A;  1Y6I A;  1R36 A;  1VI0 A;  4V02 C;  4Z4T A;  3HXL A;  4E6K G;  3L2R A;  1CZF A;  2LFB A;  2XVC A;  2QX3 A;  4RM2 A;  3FIW A;  1N25 A;  5HS7 A;  2DCU A;  2CRV A;  5FJ8 J;  1Q82 D;  4HQM A;  2BHZ A;  2VFM A;  3JSP A;  3PFI A;  4MQV A;  2QQ8 A;  2EV6 A;  4MIM A;  2Q6I A;  2EZI A;  3FXK A;  3H9Q A;  4BKX A;  4A3D J;  1HZE A;  1UFM A;  3BZ6 A;  3DXJ F;  4WX9 A;  1VND A;  1WJ5 A;  2RRE A;  2Q6K A;  3OFN A;  1U0J A;  4EVI A;  2LSO A;  2JDI A;  2PBI A;  3G2B A;  1TBX A;  1TW3 A;  3QOE A;  1WMR A;  3ERE D;  1GJR A;  2DMN A;  2KPM A;  3LWF A;  4XLF A;  5EEH A;  3JCU C;  4BJT A;  2QMU A;  4WWV A;  4RAF A;  2DW4 A;  5JMC B;  1IF1 A;  3LQ6 A;  3A35 A;  5FGM A;  3B73 A;  4M72 A;  2KZV A;  2JZY A;  2X3U A;  3KP7 A;  2LRD A;  2ZJR F;  5L3B A;  3CUQ B;  5F6F A;  3KP3 A;  4KN4 X;  5HLG A;  3K4J A;  1YX3 A;  2X9D A;  5F4M A;  1MBG A;  3VOD A;  4DIQ A;  1HBX G;  3I4M J;  1KCD A;  2FBK A;  3GTK J;  4DQL A;  4Z4Z A;  1VQM B;  2KJC A;  5E1Z B;  2VT2 A;  4IHW A;  2X1E A;  3VYU B;  2DOE A;  4OJ6 A;  3QAH A;  1U8B A;  2X1C A;  2O3F A;  1J59 A;  1R5B A;  3PEN A;  3L00 A;  4HLX A;  3IKV A;  3HG9 A;  4RB2 C;  3DKW A;  4Y33 A;  3RCO A;  3VPR A;  5J8C A;  1QGY A;  3DU1 X;  5JVG F;  2ZJQ F;  1TWA J;  5HOD A;  2HYG D;  2OYN A;  3LNN A;  4LBW A;  1OJL A;  2D5V A;  1FP1 D;  3QSY A;  2EIX A;  3S1N J;  4XK4 A;  4II3 A;  1B9N A;  2JWT A;  3HSR A;  4NQW B;  4IHY A;  3T5X A;  1JI8 A;  2I8D A;  4Y9U A;  5KNL A;  3CC4 I;  4DK1 A;  1F1Z A;  3KEY A;  3KCC A;  1W0T A;  1Q7Y D;  2QKL B;  3ASR A;  4G5G A;  2IGM A;  2LP0 A;  1LEB A;  1SFE A;  2D1V A;  1OFE A;  2BW3 A;  2MH2 A;  1VF7 A;  4XLE A;  1OHH A;  4XKW A;  2DFI A;  2EK5 A;  4XL9 A;  2BN4 A;  5EEA A;  4BE2 A;  2JJ7 A;  1AIP A;  1GLN A;  2BF4 A;  3OYJ A;  2B9S A;  1B8I A;  1S7A A;  2COB A;  4G7W A;  1A04 A;  1KQS B;  4WZL A;  2XIG A;  3C18 A;  1RR7 A;  2QSG X;  1Y1W J;  2Q0O A;  2BVL A;  2RN7 A;  3KX2 A;  3SYJ A;  1BBY A;  4A3C J;  1ZM4 A;  3QOP A;  5FA6 A;  1X0C A;  2G9W A;  2YWF A;  2DPD A;  2ZME A;  1IJW C;  1B2R A;  1FX7 A;  1K7A A;  2IS2 A;  5FRN A;  5FLX K;  1KCC A;  2QEN A;  3LVB A;  1H80 A;  5L3D A;  1O57 A;  2B63 J;  1CLW A;  1LLZ A;  3I71 A;  2K7L A;  3MZY A;  1IGN A;  4B3A A;  5IP6 A;  4OJP A;  4MXN A;  2BXZ A;  1UHW A;  2XKP A;  5KW9 A;  4RDJ A;  1YJ9 B;  3T53 B;  5K7Z A;  1K4Z A;  2JTV A;  3M8F A;  1I1G A;  3G3Z A;  4P6Y A;  4ZYA A;  4PGO A;  1MAB A;  1QX4 A;  1F36 A;  3GO5 A;  3BCB A;  2P6T A;  4DYC A;  3OMY A;  2VKE A;  4RBO A;  1K79 A;  2FX3 A;  1W5C C;  4U49 A;  2NNN A;  5LGN A;  2E34 A;  4RPD A;  2R7Z J;  1N08 A;  1K83 J;  4AIH A;  2R7D A;  2GJK A;  4RGX A;  2XB0 X;  2NT6 A;  3GQ7 A;  4UUV A;  2GQQ A;  3BH6 B;  3FXL A;  3K4B A;  3H5A A;  2VUM J;  4FAS D;  2JN9 A;  2CW7 A;  2NS8 A;  1FWZ A;  3RJP A;  5JVT A;  3ISX A;  4ACB A;  2DEU A;  5J1Y A;  1X58 A;  3B78 A;  1EH8 A;  2PMZ N;  1OYI A;  5F04 A;  4AD9 A;  1WWX A;  3H5R A;  3HOT A;  1XFO A;  2QDX A;  5DN6 A;  3FPP A;  2CW5 A;  2CQN A;  4MGR A;  4ENM A;  1ZR4 A;  1TSP A;  4MR0 A;  3SEJ A;  1X19 A;  3D5R C;  2M9H A;  1ACI A;  4G9Y A;  4G7O F;  3HB9 A;  1E0E A;  3A8I A;  1EH6 A;  1H89 C;  2BVN A;  4QPO A;  2O6W A;  1KQ9 A;  1OFD A;  1D5V A;  4RMN A;  3S2H J;  1VQN B;  1XCV A;  5DCF A;  1ETW A;  4W8Q A;  2HQ5 A;  1IUY A;  1ONV A;  3VSK A;  1SFK A;  3GTG J;  2L7Z A;  4OIQ F;  2EFO A;  1TC3 C;  2W82 A;  4UXN A;  1K8A D;  2V9K A;  1X2M A;  2XRN A;  3DPU A;  1DAB A;  1S6L A;  1TQM A;  5LFA A;  1W4M A;  2K27 A;  2GXB A;  4XKB A;  1XMX A;  3BTC A;  2OF7 A;  3CB4 A;  4ZYH A;  5K1Y A;  1AHD P;  1O3R A;  3S3M A;  1KQ5 A;  4DK0 A;  1I18 A;  3TDU C;  3FXM A;  3AFH A;  1IV8 A;  1W36 D;  1D2E A;  2VQL A;  4OOS A;  4U0W A;  1P92 A;  1IN4 A;  3OYK A;  4A3M J;  5D8L B;  3I4N J;  4IKF A;  3BT9 A;  1WJA A;  4KT5 C;  1WPK A;  4Z4V A;  1VQ8 B;  4AC9 A;  2ZFW A;  4YZ0 A;  3CLQ A;  1FTT A;  3BR0 A;  4G1B A;  1IN5 A;  2ECC A;  3EUH A;  1MD0 A;  3FF5 A;  2LDU A;  4YFO A;  3QRF F;  2K02 A;  2OBP A;  1SMT A;  2F5E A;  1HKQ A;  1PVE A;  3BRO A;  2VXD A;  3C7J A;  1EZG A;  1B6A A;  1U3E M;  2AHQ A;  4U88 A;  1MJB A;  2XAH A;  3P5J A;  3DEW A;  5A2Q Z;  2R7O A;  1XMA A;  5A89 A;  3CMM A;  3OW2 B;  4XLC A;  4UHT A;  1IB0 A;  1SM4 A;  3HPG A;  3VEP A;  2HVQ A;  3BR5 A;  2NVX J;  2VBU A;  3CDH A;  3ML6 A;  5EGO B;  3WGG A;  3BTL A;  3BPX A;  3ZMD A;  1U9O A;  1WJD A;  3PUF A;  1YTY A;  1NJI D;  2NPF A;  4RAG A;  1O8J A;  2IOU G;  2CV2 A;  4XQF A;  2GJP A;  2VBK A;  4NK6 A;  1QJV A;  1SFO J;  1Z67 A;  5L3C A;  1GAW A;  2V7Q A;  3CCS B;  2GBY A;  3F8C A;  3G1L A;  3D5L A;  4B3X A;  4Q5S F;  4TMV A;  4HQE A;  4UVC A;  2VOP A;  4JBA A;  1SFX A;  1V54 H;  3BCD A;  1O8I A;  1YW9 A;  3CUO A;  2YR2 A;  3KEO A;  1D8K A;  2G7H A;  3U2Q A;  1F4K A;  2E1O A;  3KIO A;  2PIA A;  4GXO A;  5DV5 A;  1R5H A;  3OPO A;  4II2 A;  3K4M A;  5B1B H;  4I0B A;  3WE2 A;  3SXY A;  4DOZ A;  4NDL A;  1KMH A;  1R1T A;  4LIT A;  3ES9 A;  5HDN A;  2QEX I;  1DP7 P;  5L3F A;  3QPL A;  1VLO A;  3VR6 A;  3LAJ A;  5HNF A;  1REP C;  3BPV A;  2UWM A;  3OS2 A;  4URR A;  1MDM A;  5JI6 A;  2EWN A;  1ITY A;  1DU6 A;  1IHM A;  2VQC A;  3HSE A;  5KCM A;  1YS7 A;  1KTW A;  1OCP A;  4TKO B;  1VF9 A;  1OMI A;  1FIA A;  1T5E A;  4M73 A;  4ZZL A;  3S1Q J;  4K2E A;  1YJ9 I;  2VLA A;  3GTL J;  1E17 A;  3MHP A;  2BY3 A;  1E62 A;  1HDP A;  1F60 A;  3K7A J;  5AIP A;  5E79 C;  3HUG A;  5LHH A;  5ILV A;  1JT6 A;  3ZR8 X;  2DTR A;  2P5K A;  3F8M A;  3WYA A;  4RLF A;  4OPW A;  3V42 A;  3G6E B;  2A5Y B;  2OAZ A;  4UZE A;  2GJR A;  3JUR A;  3GFI A;  2BM4 A;  4YAL A;  2ZXW H;  1EP3 B;  2FVG A;  1G7C A;  2BXY A;  2ZTN A;  3GTP J;  5B66 C;  1ZG3 A;  1W7P B;  2BE5 F;  2RQQ A;  2BPO A;  4M53 A;  3ZUG A;  2WAQ N;  5HLI A;  2XT4 A;  2DAO A;  4G7H F;  1VFC A;  3VNU A;  3E7L A;  2W84 A;  4HOB A;  2C78 A;  2E1M C;  2E2H J;  4Y52 J;  3ASQ A;  2OD5 A;  2EZK A;  5TR9 A;  1BX1 A;  1EF4 A;  1LDK B;  3SYT A;  1EWY A;  3FHZ A;  4XSX F;  2VJ5 A;  2BSA A;  3S16 J;  3KLN A;  5LLQ A;  1AU7 A;  4FHT A;  2BX6 A;  1GUU A;  4P9U A;  1AOY A;  3ABK H;  2FQ4 A;  2VNJ A;  4NB5 A;  1HW1 A;  5BNG A;  1SVM A;  2AQE A;  2NTQ A;  2GZW A;  2HTS A;  2F1L A;  3A1P A;  1QA2 A;  2CUE A;  2F6C A;  3DEE A;  1IAW A;  1H0M A;  1UD4 A;  5HS9 A;  2F4M B;  2V6E A;  2PMD A;  4LMY A;  1PXZ A;  2X85 A;  2HDN B;  1CQX A;  3LO8 A;  1QA3 A;  2MGQ A;  3J7A Y;  5ICG A;  1MW7 A;  2EIK H;  4KKS A;  4CZC A;  2QBY B;  1TT5 B;  2V4J C;  2V6C A;  1EP1 B;  4XLP F;  3P26 A;  1A8P A;  5BSX A;  3U6B A;  3QFT A;  2M0M A;  3LOC A;  1I3A A;  2KRC A;  2XB5 A;  5LD2 C;  3VMV A;  4KUM A;  4C2M J;  1B72 B;  3AVU A;  1PE9 A;  1RI7 A;  1R49 A;  3ESW B;  4RB1 A;  3HDD A;  1FOY A;  3BJA A;  1Z3X A;  4BE1 A;  3I56 B;  3BJ6 A;  3RZD J;  4D9J A;  3VB2 A;  2Z3Y A;  3E0J B;  1W87 A;  1A6Q A;  1U6G A;  1R4M B;  1FNC A;  3ZSC A;  5DS0 A;  1VQ8 I;  3O6B B;  3PNY A;  4LIU A;  4OM9 A;  4BNC A;  4IRI A;  4HRI A;  2HXI A;  3QYE A;  4HG2 A;  3QOD A;  5ICF A;  1QZY A;  3GFL A;  3JRE A;  3LSM A;  2R5Y A;  1IXS B;  1MMG A;  1QVF B;  5F0F A;  2IA0 A;  5IOZ A;  1WOS A;  1D0Y A;  2XAS A;  1OLT A;  2MD5 A;  1EV7 A;  2RC5 A;  2KZG A;  2WA0 A;  4PGG A;  1Z6T A;  3OYH A;  2ZXH A;  2M45 A;  2XAG A;  2WAD A;  1QHH D;  1OFM A;  3OEE A;  3GVL A;  2DJN A;  2HQA A;  2LYC A;  2BM0 A;  4LG0 B;  1DBG A;  3G73 A;  3D1N I;  2DMT A;  2D3L A;  3LST A;  4IVN A;  3KYD B;  1UCR A;  4M6V A;  5LGU A;  1QRC A;  4FTH A;  2LBF A;  3BWG A;  1JJ8 C;  1TP4 A;  2BMW A;  2H1L A;  1IG7 A;  3W6J B;  3ERM A;  3LA2 A;  3WY9 A;  2VBM A;  5IYB J;  2H27 A;  2F5D A;  3CDL A;  2XF5 A;  4JX6 A;  2L9V A;  2DYR H;  3F22 A;  1G7S A;  2ELH A;  2HLD A;  2GIV A;  3MKL A;  4I01 A;  2OCE A;  3KP2 A;  1LPQ A;  2XNC A;  3Q38 A;  2YWG A;  4AUX A;  3CCR I;  2XT2 A;  3SZE A;  3K9T A;  2HFH A;  2F43 A;  2HKO A;  2HZD A;  3K4C A;  4YZA A;  5KVR A;  5DCM B;  3F9K A;  3M4O J;  1X3W B;  3R6K A;  3ZQI A;  2XGJ A;  1BL0 A;  2I1L A;  3RKX A;  1LUJ B;  1S7E A;  2RC4 A;  1F43 A;  3T8R A;  4B48 A;  2XUB A;  2M5S A;  1JUS A;  2VB6 A;  2BYV E;  3CMA I;  2R7R A;  1J09 A;  3WGH A;  5F4O A;  4ZTJ A;  1ZAR A;  2V26 A;  1DGW Y;  5H6R A;  4MNU A;  3JRH A;  4CQJ A;  1BC8 C;  3CUQ C;  1FDR A;  3HEF A;  4EJO A;  4YC5 A;  1QFJ A;  4LLN A;  4O6J A;  4C2L A;  3C3W A;  3A0B C;  2RC6 A;  5BSY A;  2FE3 A;  2KMU A;  3SFI A;  2NS7 A;  5E3M A;  2ZXI A;  4I09 A;  3G6E I;  1SFU A;  2Z6B D;  4CXF A;  2K4J A;  4IPA A;  2VBV A;  4AF6 A;  3RKY A;  2L4M A;  1LB2 A;  4G7Z F;  2QY1 A;  2K86 A;  2LY1 A;  3I5U A;  4M3G A;  2C2W A;  3TKY A;  2ETH A;  1O88 A;  2DOA A;  1GDT A;  1MSF C;  1OCR H;  2ZB9 A;  1TLL A;  3FHN A;  2QTL A;  1QCX A;  4LD5 A;  1BI1 A;  4EH1 A;  1UD8 A;  1ZHF A;  5FKL A;  2FMY A;  2QZA A;  4LIV A;  4A6E A;  1YRN B;  4JYK A;  1YX5 A;  4IF4 A;  3G1O A;  4P96 A;  2D45 A;  1YW8 A;  1MH3 A;  4KMU X;  1DQU A;  3H9N A;  1MBJ A;  1K8F A;  4N9H A;  4FX4 A;  4S05 A;  1X4P A;  4TV7 A;  3PNT A;  2WV0 A;  4LK1 F;  1T6Y A;  5TV2 A;  2L4A A;  2NAZ A;  3I59 B;  1K4S A;  4IHS A;  1ZK8 A;  2H09 A;  3BZK A;  3GZ5 A;  3CCL I;  4HDU A;  3T0Y A;  1FOK A;  3S93 A;  4RD3 A;  2JA5 J;  4P6V F;  3TO6 A;  4TT3 A;  1JT0 A;  1SVL A;  5ERI A;  1JTA A;  2L5Q A;  2R7W A;  4QIW N;  1Q9S A;  2QLZ A;  2M7A A;  3GX4 X;  3S15 J;  2VNI A;  2JVG A;  5J35 A;  1P4A A;  1PJ5 A;  4CZZ A;  1FBU A;  1X4O A;  3PVD A;  5DEQ A;  1WU8 A;  4RM3 A;  1HW2 A;  3CCQ B;  1NHC A;  5IP7 J;  3KP6 A;  5JLW A;  2LD5 A;  4ZDP A;  2PLY A;  1XSX A;  3QPS A;  1RRJ A;  1XCB A;  4Y13 A;  1K78 A;  3AG1 H;  5JR3 A;  2EIL H;  3ZQC A;  4KFC A;  1W34 A;  2P7V B;  3DBH B;  1A31 A;  1YIT B;  3FMR A;  3A8K A;  1ULY A;  5ED4 A;  1DU0 A;  3IH2 A;  1KK0 A;  2MSY A;  3GZ6 A;  2XOK A;  3B90 A;  4RB0 A;  4L9N A;  4WXH A;  3CC2 B;  2CQX A;  2JPB A;  2X6W A;  3A01 A;  3C2B A;  1IJF A;  3I55 I;  4FXU A;  1KK3 A;  5EMN A;  3I56 I;  2A05 A;  2VPL A;  3SLD A;  4ZCI A;  3CCE B;  3VSL A;  1E43 A;  1KYZ A;  2MD0 A;  4A3G J;  3BR3 A;  4CA0 A;  1A5J A;  2INU A;  2CH0 A;  1G7T A;  3WTY C;  3CC7 B;  1P7I A;  2ZKZ A;  1LVA A;  3E5Q A;  3HGY A;  3MZH A;  2QXZ A;  4YEL A;  3ABM H;  2LTP A;  1NK3 P;  5DUK A;  4OAZ A;  1TQP A;  2V7U A;  2IAI A;  2YPR A;  2HTJ A;  2KVO A;  1D0Z A;  3OWT A;  2W7N A;  1QPM A;  1E1R A;  3X2Q H;  4G6Q A;  4D5C A;  2QSF X;  4FQG A;  1OR7 A;  2F1M A;  3EQL F;  2ZZG A;  3WHC A;  3RYR A;  1YE9 A;  1X1A A;  2J7K A;  2KIQ A;  2ZC2 A;  1D8J A;  2O0Y A;  2HPI A;  4E70 A;  3JTH A;  4EAT A;  5GAD J;  1ELO A;  2X8K A;  3NE5 B;  4XRF A;  1E63 A;  3LA3 A;  1YQA A;  1E3Z A;  2JQ7 A;  2VJJ A;  2ZJ2 A;  4YRV A;  1IXC A;  4DYQ A;  3CMY A;  4BE0 A;  3ZPN A;  3IHU A;  4KJZ A;  3OW7 A;  2XV4 S;  1Y8Q B;  2G0E A;  5L3E A;  1E3X A;  3N05 A;  1YLF A;  3JR9 A;  3E6C C;  2EB7 A;  2K5C A;  4LGW A;  2LKX A;  4YCQ A;  1MND A;  2LF7 A;  2E1N A;  3CCM I;  1K9M D;  4MQ9 F;  1O4X A;  3PQJ A;  4E7H A;  3WWG A;  4W8S A;  3F8B A;  4M9S A;  2IT0 A;  2GIZ A;  2JUC A;  1JKO C;  2FQ3 A;  3W2F A;  2GOX B;  1QU3 A;  3HRU A;  4OZZ A;  4AYB N;  1UEL B;  4HIZ A;  5DM6 F;  3GEZ A;  4KDP A;  1LFP A;  2GAU A;  5FO0 A;  1AKH B;  2DA6 A;  3CLO A;  1ZUN B;  2VNK A;  3DLL F;  4IHV A;  3DBL B;  3S17 J;  3HAG A;  1LFB A;  4ABZ A;  4A3J J;  5FFZ A;  4ESJ A;  1MBF A;  1Y0R A;  2EFQ A;  2P0W A;  2EA2 A;  1HKS A;  3TP0 A;  1OQY A;  3C1D A;  1WSV A;  2XHK A;  3HHH A;  4PJN A;  1LQ1 A;  4X06 A;  3AST A;  1UMK A;  5H59 A;  1PYV A;  4PC3 A;  4TSF A;  4IEJ A;  3LSG A;  3FKI J;  5A2Q K;  2O8K A;  3WTS C;  3HOU J;  4CH7 A;  3QU6 A;  2GQF A;  5C1C A;  3NWT A;  1H8E A;  3FBN B;  3MWM A;  1IN8 A;  3ZPP A;  1Z77 A;  4BBR J;  2OA4 A;  4EW9 A;  1ZRF A;  4FT8 A;  3RIR A;  4G7X A;  3FPK A;  5DS9 A;  1D1B A;  1B23 P;  1VQ4 I;  3OOC A;  4OJO A;  2DFH A;  4RCY A;  1UD2 A;  4HF2 A;  1BJK A;  3MCZ A;  1BI3 A;  4ZCM A;  1MGT A;  1Y0U A;  3SJM A;  5AMV A;  2DMQ A;  4WQM A; 
#chains in the Genus database with same CATH homology
 1E79 A;  3K4N A;  3T53 B;  2XF6 A;  4C9Y A;  3ZRG A;  4ZYA A;  2ZZE A;  1HG8 A;  4DGW B;  3LSI A;  2KDO A;  4BQO A;  4BQQ A;  2R7T A;  3BCB A;  3I9V 2;  1MAB A;  3OMY A;  2DXI A;  1Y56 A;  1DP3 A;  4U49 A;  1O8F A;  2HDW A;  5JHF A;  3GQ7 A;  2GJK A;  2NT6 A;  3GRH A;  3W2W A;  4H4K C;  2O17 A;  2CW8 A;  2XAU A;  1R6R A;  3K4B A;  2VIX A;  2VL8 A;  3DLA A;  3H5A A;  4FAS D;  1O8M A;  4P1W A;  4DBR A;  1MNE A;  2CW7 A;  3I3L A;  3IUO A;  3CES A;  3OL3 A;  4OWR B;  2O04 A;  2WY7 Q;  4CCN A;  4OZY A;  1X1B A;  3PSI A;  3M1C A;  2PMZ A;  2WY8 Q;  3HOT A;  2UV1 A;  3H5R A;  2QKM B;  3MMY B;  4PJJ A;  1W0K A;  2WJV A;  2ZZQ A;  3FPP A;  2R7V A;  5DN6 A;  4MR0 A;  4PMH A;  4PFO A;  2LY2 A;  1X19 A;  3MKZ A;  2VQH A;  3D5R C;  1OOC A;  4F93 B;  3BC8 A;  3OYE A;  2NSP A;  1EFR A;  2PEC A;  4QPO A;  2XDV A;  4ZDO A;  4RMN A;  3OYC A;  1VBL A;  4W8Q A;  1N77 A;  2V7F A;  3SEQ A;  4XOP A;  3ZIA A;  4BXF A;  3VSK A;  4E7J A;  1SFK A;  1UD5 A;  4XLA A;  1WJC A;  3RPU D;  1HA8 A;  4Z1M A;  1V0E A;  2W82 A;  3DPL C;  5FL7 A;  5IK2 A;  1V5G A;  2DT6 A;  2V9K A;  1VLY A;  3DPU A;  2W1O A;  2Z8G A;  1X1D A;  3CP8 A;  5LFA A;  4E7S A;  1WJB A;  4XKB A;  4KKT A;  4L8J A;  1BR4 A;  3JU4 A;  5CQE A;  4UZU A;  4J00 A;  2BSP A;  3ONQ A;  3EUA A;  2M4K A;  3LSK A;  3S3M A;  4W8T A;  1E1Q A;  2WAF A;  4DK0 A;  1I18 A;  2DCE A;  1WP6 A;  1MMA A;  3AFH A;  3RSN A;  1W36 D;  2VQL A;  3OYK A;  4I84 A;  3S3N A;  4IKF A;  4HSR A;  1WJA A;  2FUG 2;  1VZ0 A;  2OUM A;  2V31 A;  2KP6 A;  3VMW A;  4YZ0 A;  1X1C A;  3LFU A;  4PJL A;  1MMD A;  2D3N A;  4E7I A;  2PYG A;  4CCO A;  2GK6 A;  2OV7 A;  3FKS A;  1FMV A;  1Z7L A;  4HST A;  3OYF A;  4DNR B;  4F52 A;  5C1E A;  2VXD A;  3OYD A;  4BDY A;  2IGN A;  2LOO A;  2LBF B;  1N78 A;  2R7O A;  1V0F A;  3CMM A;  1TZL A;  4XLC A;  2CUJ A;  3GVK A;  1TT0 A;  3HPG A;  2HVQ A;  4CCM A;  4XD7 A;  3E1S A;  2NZM A;  4HEA 2;  2MYS A;  3A2K A;  2XF7 A;  1DBO A;  1GQ8 A;  1WJD A;  3VSU A;  1O8J A;  2ZSI B;  2CV2 A;  4XQF A;  2GJP A;  2Z2S B;  4ITV A;  2IQ7 A;  1H8H A;  1QJV A;  2VBK A;  4NK6 A;  1O8E A;  2INV A;  2V7Q A;  2VJ4 A;  2CV0 A;  1DGR M;  3BG6 A;  3D5L A;  4B3X A;  3OEH A;  2HU9 A;  1ERD A;  4JOM A;  3OR1 C;  4KIS A;  1UG0 A;  3BCD A;  3OAA A;  1O8I A;  2K9L A;  3H5N A;  3EQO A;  2Y0S A;  4HNT A;  4ANJ A;  4LG3 A;  3OYG A;  2BW3 B;  2EWE A;  1N75 A;  4Y4R A;  3OPO A;  4II2 A;  3SZG A;  1UAA A;  3K4M A;  4YZQ A;  3LMM A;  1W36 C;  4DOZ A;  1KMH A;  1FX0 A;  3EUH C;  4LIT A;  2IS4 A;  3VR6 A;  1WJF A;  3DWL E;  5HNF A;  4IQJ A;  3GVJ A;  3OL4 A;  2UWM A;  3OS2 A;  4URR A;  4F55 A;  4U7B A;  2NTB A;  2VQC A;  2MC4 A;  5KCM A;  3UR3 C;  1KTW A;  4TKO B;  1T5E A;  4DJA A;  2XSJ C;  3FKJ A;  2KLO A;  3ZGK A;  3ZXS A;  2VLA A;  3VST A;  1Z21 A;  3GBG A;  3AKZ A;  3ZQQ A;  1T0F C;  3CZ6 A;  2HNH A;  4Z05 A;  3H35 A;  4NNJ A;  3S32 A;  2O0W A;  4AVZ A;  3OYL A;  2HVS A;  2WZP P;  2ZZF A;  3ZR8 X;  1BR1 A;  1G8X A;  2WAE A;  4RLF A;  3V42 A;  1EA3 A;  3JUR A;  2GJR A;  3CF2 A;  1BMF A;  3CP2 A;  2ZTN A;  3A3B A;  3OYM A;  3HC7 A;  3DPT A;  3PUB A;  4PFP A;  1OFL A;  2O0V A;  3RQ4 A;  2RQQ A;  1O8K A;  4YEJ A;  2WAQ A;  3VDX A;  4B3G A;  2K9M A;  3G05 A;  4HPQ A;  5HLT A;  4ZDL A;  4CUG A;  4B47 A;  2E1M C;  3EPZ A;  1NG6 A;  2F4I A;  4XON A;  3LSH A;  3BCF A;  2VKH A;  2PYH A;  4XN3 A;  1LDK B;  2AQF A;  3S3O A;  3DU6 A;  3SYT A;  2JSP A;  2VJ5 A;  3QYB A;  3CJQ B;  2PJR B;  2CFO A;  4HNU A;  1JRG A;  2X53 S;  2JIZ A;  2R4G A;  3M8J A;  2ZTG A;  3OYA A;  2E5Z A;  2NTQ A;  2AQE A;  2F6C A;  3DEE A;  4B43 A;  1KON A;  3FBI B;  1UD4 A;  4XOT A;  4BU2 A;  2V6E A;  2HVR A;  1WPC A;  1O8L A;  4IZZ A;  4P22 A;  2X85 A;  1PXZ A;  3OE7 A;  3W2A A;  3AL0 C;  2JJ2 A;  3J7A Y;  2LG4 A;  3OR2 C;  1MW7 A;  3C2G A;  1T95 A;  4KKS A;  2GK7 A;  4CZC A;  3VYT B;  2V4J C;  1BN8 A;  1S9H A;  2VKD A;  2O1D A;  2WB1 A;  5CPR B;  2F5V A;  3BG7 A;  1D0X A;  2M0M A;  2Z16 A;  2JVH A;  2KRC A;  5LD2 C;  1LVK A;  3VMV A;  4BGD A;  2V1N A;  1W9X A;  1PE9 A;  3GQ9 A;  1WTH D;  5TGT A;  2IXS A;  4R79 A;  4E7K A;  4MLO A;  1NG7 A;  1Z3X A;  4BE1 A;  4XMY A;  5HOO A;  4B44 A;  3PNV A;  4D9J A;  1IDJ A;  3E0J B;  4XM3 A;  4C30 A;  3ZSC A;  2WBM A;  4X0G A;  2NST A;  4OJL A;  4LIU A;  3PNY A;  3DTK A;  3OS1 A;  3EQN A;  3PJR A;  2Q1Z B;  5CKT A;  4HRI A;  3QYE A;  4HG2 A;  3QOD A;  2GOM A;  2WPD A;  4DBQ A;  2WJY A;  3LMW A;  4F3Q A;  3LSM A;  2L9N A;  1MMG A;  4E4H A;  1PKV A;  4P5O A;  4YZX A;  1D0Y A;  5CQG A;  1OLT A;  3OIQ A;  2Q2E B;  2WA0 A;  3MD2 A;  4NC7 A;  3OYH A;  2ZXH A;  4C2U A;  4BL0 B;  2JA2 A;  4BAC A;  1HVX A;  1V5F A;  1BR2 A;  2WAD A;  1QHH D;  2X1D A;  1Z3Y A;  3OEE A;  1OFM A;  4BUP A;  2W6J A;  2HQA A;  3GVL A;  3FY3 A;  1IA5 A;  2LYC A;  1DBG A;  3OS0 A;  2NT9 A;  2DJI A;  4CCL A;  2D3L A;  1OGO X;  3H9J A;  3MKY B;  3DKX A;  2L7K A;  2XZL A;  4GQN A;  3DTE A;  4KKU A;  4XKV A;  2LBF A;  1PJR A;  3WQZ A;  1UD3 A;  3DTI A;  3K4L A;  1RMG A;  3OY9 A;  2DIE A;  5CDF A;  4N4O B;  4HWV A;  1V5E A;  2CK3 A;  1AIR A;  2VBM A;  2XF5 A;  4PJM A;  2W6I A;  1IB4 A;  3H94 A;  2HLD A;  2IGK A;  3A4C A;  4NC8 A;  2M3A A;  4XN0 A;  3HOS A;  4BS9 A;  2LZJ A;  3K10 A;  2F43 A;  2HZD A;  3K4C A;  2KQR A;  2XC7 A;  4YZA A;  2M4G A;  1IDK A;  2L2O A;  4ZC3 A;  4AU7 A;  3F9K A;  3K70 D;  2XGJ A;  2OC6 A;  2NOJ B;  2E1M B;  3K6G A;  3VYS B;  4B48 A;  3OYN A;  2VB6 A;  4BJ5 C;  2R7R A;  2M5S A;  1PLU A;  1O8H A;  1J09 A;  4Z06 A;  4ZTJ A;  2V26 A;  2X51 A;  4G6T B;  4XNF A;  1DGW Y;  4F91 B;  4NUB A;  4BQN A;  5FRO A;  2UUZ A;  4BEH B;  4BJ6 C;  2O5R A;  3DDY A;  1W0J A;  2VBE A;  3VWB A;  4W8R A;  3BC9 A;  1SAU A;  4CCK A;  1D1C A;  2LRE A;  2R7X A;  2ZSH B;  4Y3O A;  2RNG A;  4C2L A;  1MMN A;  4PUS A;  3DU5 A;  2KMU A;  2XZO A;  2CMP A;  4CCJ A;  2Z6B D;  2ELJ A;  2ZXI A;  3HUG B;  4OJ5 A;  2R7S A;  3A1Y A;  5KHD A;  3AL0 B;  3IAS 2;  2QY1 A;  1D1A A;  4PSX A;  2LY1 A;  3D5S C;  4YXW A;  3KRG A;  2X3H A;  1RWR A;  3HPH A;  3SUC A;  1O88 A;  2DOA A;  2IS1 A;  2BVM A;  3QYF A;  4J01 A;  3FHN A;  1G59 A;  1QCX A;  3SEZ A;  5HNH A;  2ZFU A;  3IP4 B;  3NWS A;  1UD8 A;  4N4N B;  4IX7 A;  3KEW A;  4LIV A;  2X6X A;  3VSV A;  4E7L A;  4FET A;  1YX5 A;  3L2W A;  2LH9 A;  2E1B A;  3W3C A;  1DQU A;  2VQG A;  2IS6 A;  3VYR B;  3BLY A;  4XOR A;  4ASU A;  1X4P A;  3BH4 A;  3PNT A;  3H0D A;  2DT7 B;  1WJE A;  2L9S A;  2NTP A;  2UVE A;  3K70 C;  2M7B A;  3S93 A;  4QPQ A;  4TT3 A;  3T9G A;  3A3G A;  4NK8 A;  1JTA A;  2L5Q A;  2R7W A;  1FMW A;  1UD6 A;  3BCA A;  2M7A A;  4KT6 A;  2ODL A;  2JVG A;  2R7Q A;  3GQB A;  1X4O A;  1BOB A;  4OAY A;  3SDB A;  4RM3 A;  1NHC A;  3K4K A;  2KHM A;  2E60 A;  4KIT B;  4D1Q A;  4DNT B;  1WFX A;  4ZDP A;  2PJR A;  1Y6I A;  3GQ8 A;  1K6Y A;  2CUZ A;  2UVF A;  3L2V A;  2V4D A;  2LC2 A;  2XZP A;  4ZJZ A;  4RLQ A;  4JMQ A;  3HXL A;  4E6K G;  2XOK A;  3B90 A;  3L2R A;  1CZF A;  5HKK A;  3PFY A;  2QX3 A;  4RM2 A;  2X6W A;  2JUG A;  4FXU A;  4IQ4 A;  2VPL A;  1RU4 A;  3VSL A;  1E43 A;  2X6Y A;  2R9V A;  3OOU A;  2MD0 A;  2WSS A;  4CA0 A;  3PL8 A;  2INU A;  2CH0 A;  2W4S A;  2QE7 A;  3H9Q A;  4GRI A;  2VAS A;  2QXZ A;  3KYL A;  1HZE A;  4YEL A;  2KL4 A;  2CV1 A;  1WJ5 A;  2RRE A;  3OFN A;  1U0J A;  4XKC A;  2JDI A;  4OAZ A;  3G2B A;  3QOE A;  2W00 A;  1WMR A;  4PSW A;  2KVO A;  2KPM A;  1D0Z A;  3OWT A;  4XLF A;  3RTR A;  4BJT A;  2W7N A;  1E1R A;  3S8P A;  4PK4 A;  3ZCO A;  2F1M A;  4XLH A;  4E7Z A;  1COW A;  2ZZG A;  4E0F A;  1YE9 A;  1X1A A;  2Z1D A;  3PSF A;  3IAM 2;  1BLI A;  1I8D A;  2KZV A;  3A35 A;  3T56 B;  2A5W A;  2HPI A;  4F92 B;  2LRD A;  4EAT A;  2X8K A;  3NE5 B;  3EUK L;  3FDY A;  1KZL A;  1E3Z A;  1OB0 A;  2VJJ A;  2VJI A;  4YRV A;  3K4J A;  2IGO A;  3TL4 X;  4BE0 A;  1YX3 A;  3ZPN A;  4KJZ A;  1BPL A;  3B8Y A;  3OW7 A;  4XR6 A;  4DIQ A;  1KCD A;  1E3X A;  3N05 A;  4U87 A;  4B3F X;  2K5C A;  2VXZ A;  1BHE A;  2X1E A;  1MND A;  3GQA A;  4CSW A;  2E5N A;  3DKY A;  3TBI A;  3VYU B;  4OJ6 A;  4BDZ A;  2X1C A;  3WWG A;  4E7H A;  3OYB A;  1VJS A;  3HL2 A;  1IRX A;  3HG9 A;  5HVQ C;  4Y33 A;  3RCO A;  1SKY B;  4W8S A;  3H9G A;  3HKZ A;  3LNN A;  1P9Q C;  2GOX B;  4JQF A;  1E0E A;  1AA7 A;  1QU3 A;  4OZZ A;  2HPM A;  4II3 A;  2MFZ A;  1UEL B;  4AYB A;  4HIZ A;  1O8G A;  1EE6 A;  2MAB A;  4NQW B;  4U4B A;  1JI8 A;  2I8D A;  1ZEL A;  1LFP A;  3CJR B;  5KNL A;  3DQV C;  1O8D A;  4DK1 A;  3KEY A;  2JJ1 A;  1LKX A;  3W2V A;  2QKL B;  2CS3 A;  2IGM A;  3LL7 A;  1XG2 A;  2XND A;  3HAG A;  2KRH A;  2BW3 A;  1VF7 A;  4XLE A;  1OHH A;  1OR7 C;  4XKW A;  3B4N A;  2P0W A;  4XL9 A;  4G6I A;  4BE2 A;  3MKW B;  2A6T A;  1GLN A;  4PJN A;  3OYJ A;  3TMO A;  4G7W A;  4Z03 A;  1PYV A;  3OYI A;  3L2Q A;  4TSF A;  1K28 D;  3T51 B;  3LSG A;  2BVL A;  3C2H A;  1QHG A;  3KX2 A;  1NRK A;  4CH7 A;  1NBM A;  1X0C A;  5C1C A;  3NWT A;  1OGM X;  1H8E A;  3FBN B;  2IS2 A;  4C2T A;  1KCC A;  5FRN A;  3ZPP A;  1K5C A;  4BEH A;  1H80 A;  4EW9 A;  2K3P A;  3UNG C;  4G7X A;  4OJO A;  1D1B A;  4ZTF A;  3OOC A;  2BOL A;  3OIP A;  4OJP A;  5FRM A;  4MXN A;  1UD2 A;  5AMV A;  3L2U A;  3U21 A;  3UW0 A;  2R7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...