2V5IA

Structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
553
structure length
553
Chain Sequence
b'AAFRQEANKKFKYSVKLSDYSTLQDAVTDAVDGLLIDINYNFTDGESVDFXGKILTINCKAKFIGDGALIFNNMGPGSVINQPFMESKTTPWVIFPWDADGKWITDAALVAATLKQSKIEGYQPGVNDWVKFPGLEALLPQNVKDQHIAATLDIRSASRVEIRNAGGLMAAYLFRSCHHCKVIDSDSIIGGKDGIITFENLSGDWGLGNYVIGGRVHYGSGSGVQFLRNNGGESHNGGVIGVTSWRAGESGFKTYQGSVGGGTARNYNLQFRDSVALSPVWDGFDLGSDPGMAPEPDRPGDLPVSEYPFHQLPNNHLVDNILVMNSLGVGLGMDGSGGYVSNVTVQDCAGAGMLAHTYNRVFSNITVIDCNYLNFDSDQIIIIGDCIVNGIRAAGIKPQPSNGLVISAPNSTISGLVGNVPPDKILVGNLLDPVLGQSRVIGFNSDTAELALRINKLSATLDSGALRSHLNGYAGSGSAWTELTALSGSTPNAVSLKVNRGDYKTTEIPISGTVLPDEGVLDINTMSLYLDAGALWALIRLPDGSKTRMKLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Receptor-Binding Protein of Bacteriophage Det7: A Podoviral Tail Spike in a Myovirus.
pubmed doi rcsb
molecule keywords SALMONELLA TYPHIMURIUM DB7155 BACTERIOPHAGE DET7 TAILSPIKE
source organism Bacteriophage
molecule tags Viral protein
total genus 196
structure length 553
sequence length 553
ec nomenclature
pdb deposition date 2007-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2v5iA00
1QA3A 2VFPA 1QRCA 2VFNA 3TH0A 3AK5A 1TYWA 1QA2A 3SYJA 1QRBA 2XC1A 4KH3A 3H09A 4OM9A 1CLWA 3RIQA 1QA1A 1QQ1A 1DABA 2VFMA 1WXRA 1TSPA 1TYXA 2V5IA 1TYUA 2VFQA 2VFOA 1TYVA 3SZEA 3ML3A 2IOUG
chains in the Genus database with same CATH superfamily
2BM5A 2EWEA 3EQNA 2XTYA 1PE9A 3GQ9A 4U4BA 4XN3A 3SUCA 4XLEA 4YZQA 4XORA 1LLZA 1BN8A 3NAWA 4XNFA 4MXNA 1OFLA 4C2LA 1LM1A 1OFEA 4EW9A 1AIRA 5C1EA 4XLHA 1OGMX 1IDKA 4XLFA 3UW0A 2XC1A 1RU4A 4OZYA 4NK8A 3SQVA 3RIQA 2NTBA 4OJPA 1O8IA 2VFMA 4XMYA 2BX6A 3JURA 1QJVA 2XT2A 1XG2A 2X3HA 4XONA 4XOTA 1OFMA 1O8LA 2PYHA 2O0VA 4YFOA 2YUHA 2BM4A 2X6WA 3T9GA 4YELA 1HG8A 4OJOA 3ZPPA 1O8KA 4OJ6A 2IOUG 4YC5A 4YZ0A 1O8FA 1OOCA 1K5CA 2ODLA 4YCQA 2VFNA 1KQ5A 4AVZA 1KCCA 3GQAA 4V02C 4W8QA 2NT9A 1VBLA 5JMCB 2VJIA 1DBOA 4OJLA 4Z06A 2XTWA 1K8FA 1GQ8A 1EA0A 4HWVA 2BSPA 1JTAA 1WXRA 3JX8A 4KH3A 1PXZA 2QZAA 4OPWA 4Z03A 4OM9A 3SY2A 4XL9A 2X85A 4OJ5A 1QQ1A 1WMRA 4PMHA 3GQ8A 5C1CA 2B0RA 2QXZA 4XR6A 2F3LA 2VFQA 1O8JA 4W8SA 1RMGA 1LLWA 2VFOA 4XN0A 1DABA 4JRAC 2NZMA 2QX3A 4XKVA 1TYVA 3WWGA 4XQFA 2O04A 2QY1A 4OZZA 2O17A 1IDJA 1OGOX 1OFDA 1QRCA 2VFPA 4XM3A 4XLCA 3N6ZA 4YEIA 4XKWA 2G0YA 3GQ7A 4U49A 1EE6A 2NT6A 1TYWA 1IA5A 3PETA 2INUA 4YDTA 5AMVA 1QA2A 3AK5A 2VBEA 1KTWA 1RWRA 3N90A 4YZXA 2O0WA 2INVA 3FY3A 4MR0A 1O8DA 1PLUA 2NTPA 5DNSA 2VBMA 1QA1A 1JRGA 1TYXA 3VMWA 2UVEA 1TYUA 4YZAA 2PYGA 1KCDA 3LYCA 1X0CA 1O88A 4I84A 2XT4A 2J8IA 3KRGA 4W8TA 1DBGA 2BM6A 3VSUA 1O8HA 2Z8GA 1CZFA 1IB4A 3DU1X 2IQ7A 3VMVA 4YEJA 2UVFA 1QA3A 1H80A 3B8YA 3GRHA 3P4GA 2NSTA 2O6WA 3TH0A 1O8GA 1L1IA 2XTXA 2NSPA 3LJYA 3VSTA 1EZGA 2QYUA 1O8EA 3SYJA 2BM7A 1QRBA 3B90A 3H09A 5JLVC 1CLWA 3PSZA 3LMWA 3BH6B 2PECA 1QCXA 2J8KA 3EQOA 3NB2A 4NK6A 1K4ZA 1TSPA 4W8RA 1O8MA 3B4NA 4XLAA 1HF2A 2W7ZA 3VSVA 2V5IA 2VBKA 2O1DA 3BH7B 3ZSCA 2X6YA 1BHEA 2NTQA 4URRA 1NHCA 2VJJA 3SZEA 3ML3A 4XOPA 4Z05A 2X6XA 3PSSA
chains in the Genus database with same CATH topology
2BM5A 1QA3A 2VFPA 1QRCA 1KQ5A 2VFNA 3P4GA 3N6ZA 3TH0A 4V02C 2G0YA 3LJYA 5JMCB 3AK5A 1TYWA 4OJLA 3PETA 1QA2A 1K8FA 3N90A 3SYJA 2BM7A 1QRBA 2XC1A 3JX8A 4KH3A 4OPWA 3H09A 4OM9A 1CLWA 3RIQA 5JLVC 3BH6B 1QA1A 4OJ5A 4OJPA 1QQ1A 1DABA 2VFMA 1K4ZA 1TSPA 2BX6A 1WXRA 1TYXA 2B0RA 1HF2A 2W7ZA 2V5IA 3BH7B 1TYUA 2F3LA 2VFQA 3LYCA 2VFOA 2YUHA 2BM4A 2J8IA 4JRAC 2BM6A 4OJOA 1TYVA 3SZEA 3ML3A 4OJ6A 2IOUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QA3 A;  2VFP A;  1QRC A;  2VFN A;  3TH0 A;  3AK5 A;  1TYW A;  1QA2 A;  3SYJ A;  1QRB A;  2XC1 A;  4KH3 A;  3H09 A;  4OM9 A;  1CLW A;  3RIQ A;  1QA1 A;  1QQ1 A;  1DAB A;  2VFM A;  1WXR A;  1TSP A;  1TYX A;  2V5I A;  1TYU A;  2VFQ A;  2VFO A;  1TYV A;  3SZE A;  3ML3 A;  2IOU G; 
#chains in the Genus database with same CATH topology
 2BM5 A;  2EWE A;  3EQN A;  2XTY A;  1PE9 A;  3GQ9 A;  4U4B A;  4XN3 A;  3SUC A;  4XLE A;  4YZQ A;  4XOR A;  1LLZ A;  1BN8 A;  3NAW A;  4XNF A;  4MXN A;  1OFL A;  4C2L A;  1LM1 A;  1OFE A;  4EW9 A;  1AIR A;  5C1E A;  4XLH A;  1OGM X;  1IDK A;  4XLF A;  3UW0 A;  2XC1 A;  1RU4 A;  4OZY A;  4NK8 A;  3SQV A;  3RIQ A;  2NTB A;  4OJP A;  1O8I A;  2VFM A;  4XMY A;  2BX6 A;  3JUR A;  1QJV A;  2XT2 A;  1XG2 A;  2X3H A;  4XON A;  4XOT A;  1OFM A;  1O8L A;  2PYH A;  2O0V A;  4YFO A;  2YUH A;  2BM4 A;  2X6W A;  3T9G A;  4YEL A;  1HG8 A;  4OJO A;  3ZPP A;  1O8K A;  4OJ6 A;  2IOU G;  4YC5 A;  4YZ0 A;  1O8F A;  1OOC A;  1K5C A;  2ODL A;  4YCQ A;  2VFN A;  1KQ5 A;  4AVZ A;  1KCC A;  3GQA A;  4V02 C;  4W8Q A;  2NT9 A;  1VBL A;  5JMC B;  2VJI A;  1DBO A;  4OJL A;  4Z06 A;  2XTW A;  1K8F A;  1GQ8 A;  1EA0 A;  4HWV A;  2BSP A;  1JTA A;  1WXR A;  3JX8 A;  4KH3 A;  1PXZ A;  2QZA A;  4OPW A;  4Z03 A;  4OM9 A;  3SY2 A;  4XL9 A;  2X85 A;  4OJ5 A;  1QQ1 A;  1WMR A;  4PMH A;  3GQ8 A;  5C1C A;  2B0R A;  2QXZ A;  4XR6 A;  2F3L A;  2VFQ A;  1O8J A;  4W8S A;  1RMG A;  1LLW A;  2VFO A;  4XN0 A;  1DAB A;  4JRA C;  2NZM A;  2QX3 A;  4XKV A;  1TYV A;  3WWG A;  4XQF A;  2O04 A;  2QY1 A;  4OZZ A;  2O17 A;  1IDJ A;  1OGO X;  1OFD A;  1QRC A;  2VFP A;  4XM3 A;  4XLC A;  3N6Z A;  4YEI A;  4XKW A;  2G0Y A;  3GQ7 A;  4U49 A;  1EE6 A;  2NT6 A;  1TYW A;  1IA5 A;  3PET A;  2INU A;  4YDT A;  5AMV A;  1QA2 A;  3AK5 A;  2VBE A;  1KTW A;  1RWR A;  3N90 A;  4YZX A;  2O0W A;  2INV A;  3FY3 A;  4MR0 A;  1O8D A;  1PLU A;  2NTP A;  5DNS A;  2VBM A;  1QA1 A;  1JRG A;  1TYX A;  3VMW A;  2UVE A;  1TYU A;  4YZA A;  2PYG A;  1KCD A;  3LYC A;  1X0C A;  1O88 A;  4I84 A;  2XT4 A;  2J8I A;  3KRG A;  4W8T A;  1DBG A;  2BM6 A;  3VSU A;  1O8H A;  2Z8G A;  1CZF A;  1IB4 A;  3DU1 X;  2IQ7 A;  3VMV A;  4YEJ A;  2UVF A;  1QA3 A;  1H80 A;  3B8Y A;  3GRH A;  3P4G A;  2NST A;  2O6W A;  3TH0 A;  1O8G A;  1L1I A;  2XTX A;  2NSP A;  3LJY A;  3VST A;  1EZG A;  2QYU A;  1O8E A;  3SYJ A;  2BM7 A;  1QRB A;  3B90 A;  3H09 A;  5JLV C;  1CLW A;  3PSZ A;  3LMW A;  3BH6 B;  2PEC A;  1QCX A;  2J8K A;  3EQO A;  3NB2 A;  4NK6 A;  1K4Z A;  1TSP A;  4W8R A;  1O8M A;  3B4N A;  4XLA A;  1HF2 A;  2W7Z A;  3VSV A;  2V5I A;  2VBK A;  2O1D A;  3BH7 B;  3ZSC A;  2X6Y A;  1BHE A;  2NTQ A;  4URR A;  1NHC A;  2VJJ A;  3SZE A;  3ML3 A;  4XOP A;  4Z05 A;  2X6X A;  3PSS A; 
#chains in the Genus database with same CATH homology
 2BM5 A;  1QA3 A;  2VFP A;  1QRC A;  1KQ5 A;  2VFN A;  3P4G A;  3N6Z A;  3TH0 A;  4V02 C;  2G0Y A;  3LJY A;  5JMC B;  3AK5 A;  1TYW A;  4OJL A;  3PET A;  1QA2 A;  1K8F A;  3N90 A;  3SYJ A;  2BM7 A;  1QRB A;  2XC1 A;  3JX8 A;  4KH3 A;  4OPW A;  3H09 A;  4OM9 A;  1CLW A;  3RIQ A;  5JLV C;  3BH6 B;  1QA1 A;  4OJ5 A;  4OJP A;  1QQ1 A;  1DAB A;  2VFM A;  1K4Z A;  1TSP A;  2BX6 A;  1WXR A;  1TYX A;  2B0R A;  1HF2 A;  2W7Z A;  2V5I A;  3BH7 B;  1TYU A;  2F3L A;  2VFQ A;  3LYC A;  2VFO A;  2YUH A;  2BM4 A;  2J8I A;  4JRA C;  2BM6 A;  4OJO A;  1TYV A;  3SZE A;  3ML3 A;  4OJ6 A;  2IOU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...