2V5IA

Structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
553
structure length
553
Chain Sequence
AAFRQEANKKFKYSVKLSDYSTLQDAVTDAVDGLLIDINYNFTDGESVDFXGKILTINCKAKFIGDGALIFNNMGPGSVINQPFMESKTTPWVIFPWDADGKWITDAALVAATLKQSKIEGYQPGVNDWVKFPGLEALLPQNVKDQHIAATLDIRSASRVEIRNAGGLMAAYLFRSCHHCKVIDSDSIIGGKDGIITFENLSGDWGLGNYVIGGRVHYGSGSGVQFLRNNGGESHNGGVIGVTSWRAGESGFKTYQGSVGGGTARNYNLQFRDSVALSPVWDGFDLGSDPGMAPEPDRPGDLPVSEYPFHQLPNNHLVDNILVMNSLGVGLGMDGSGGYVSNVTVQDCAGAGMLAHTYNRVFSNITVIDCNYLNFDSDQIIIIGDCIVNGIRAAGIKPQPSNGLVISAPNSTISGLVGNVPPDKILVGNLLDPVLGQSRVIGFNSDTAELALRINKLSATLDSGALRSHLNGYAGSGSAWTELTALSGSTPNAVSLKVNRGDYKTTEIPISGTVLPDEGVLDINTMSLYLDAGALWALIRLPDGSKTRMKLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Receptor-Binding Protein of Bacteriophage Det7: A Podoviral Tail Spike in a Myovirus.
pubmed doi rcsb
source organism Bacteriophage
molecule tags Viral protein
molecule keywords SALMONELLA TYPHIMURIUM DB7155 BACTERIOPHAGE DET7 TAILSPIKE
total genus 196
structure length 553
sequence length 553
ec nomenclature
pdb deposition date 2007-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2v5iA00
1QA1A 1CLWA 3AK5A 3ML3A 1TYVA 4KH3A 1QA3A 2VFPA 3H09A 1TYWA 1QRBA 1TYXA 2XC1A 2VFOA 1QRCA 1WXRA 1QQ1A 3SZEA 1TSPA 1DABA 3TH0A 2VFMA 2IOUG 3SYJA 3RIQA 1QA2A 2VFNA 4OM9A 2V5IA 2VFQA 1TYUA
chains in the Genus database with same CATH superfamily
1RMGA 2PECA 2VBEA 3SUCA 2QX3A 5AMVA 1QJVA 2UVFA 3B90A 3PSZA 4YFOA 4Z06A 1O8EA 2IQ7A 4XN3A 3H09A 1O88A 3NB2A 3GQAA 2NTQA 2BM5A 4JRAC 2NSPA 2O6WA 4URRA 3VSVA 2QYUA 3ZPPA 3EQNA 2VFOA 2Z8GA 2VJIA 1BHEA 4HWVA 4C2LA 2INUA 2EWEA 2X3HA 3KRGA 4OZYA 2X85A 4XOPA 4YCQA 1KCDA 1L1IA 1KQ5A 3SQVA 3WWGA 2W7ZA 4XONA 2VFMA 2XT4A 2IOUG 3VSUA 5JLVC 3DU1X 3PSSA 3RIQA 1QA2A 4OM9A 1AIRA 1BN8A 4YDTA 4XL9A 2O1DA 3GQ9A 2XTYA 2NTPA 1EA0A 2XTWA 1IB4A 1QA1A 1O8IA 1OFDA 1DBGA 5C1CA 1CLWA 2X6WA 3ML3A 4YEJA 4XM3A 1RWRA 3ZSCA 2J8KA 1KTWA 2X6YA 2O0WA 2NSTA 4EW9A 1TYXA 4XQFA 1O8MA 3VMWA 4I84A 4XORA 2NZMA 3PETA 1OOCA 1QRCA 2QZAA 2NTBA 1OFMA 2X6XA 3EQOA 3N90A 4OPWA 4OJ6A 4XLAA 1IDJA 3GQ7A 1WXRA 1LLWA 2B0RA 2QXZA 3SZEA 4OZZA 2INVA 1OGMX 2YUHA 1K4ZA 4Z03A 2XT2A 2VFNA 2VFQA 1CZFA 1JRGA 3SY2A 2G0YA 4XKWA 1O8FA 4XKVA 1LLZA 1VBLA 2XTXA 3AK5A 1PXZA 1TYVA 3LMWA 4XMYA 1QA3A 1O8JA 4YZAA 4YZQA 1XG2A 3NAWA 3P4GA 1QRBA 4XLFA 1RU4A 3LYCA 4PMHA 1KCCA 1IDKA 1OGOX 2XC1A 2BM4A 3BH6B 3GQ8A 2BSPA 3JX8A 4U49A 4U4BA 4OJPA 2NT6A 4YZXA 1HF2A 2NT9A 3GRHA 3B4NA 1TSPA 1PLUA 1DABA 1O8KA 2VBMA 1JTAA 4XN0A 4NK6A 5C1EA 3SYJA 1PE9A 1DBOA 4XOTA 2BX6A 4Z05A 4YZ0A 2PYHA 4XLHA 3B8YA 4MXNA 3VSTA 2J8IA 1WMRA 2O17A 4OJLA 4XNFA 5DNSA 1O8DA 4AVZA 4W8QA 3LJYA 1H80A 2PYGA 3BH7B 1QCXA 4OJ5A 4KH3A 2BM6A 3JURA 4XLCA 3VMVA 1O8LA 3N6ZA 2VFPA 4OJOA 4NK8A 1O8HA 1TYWA 4V02C 1LM1A 5JMCB 1EE6A 1O8GA 4W8TA 2QY1A 4W8RA 2BM7A 4XR6A 1OFLA 3UW0A 1HG8A 1OFEA 1K8FA 1EZGA 2ODLA 1GQ8A 1K5CA 1QQ1A 2VBKA 4W8SA 2F3LA 2UVEA 3TH0A 4MR0A 1NHCA 2O04A 3T9GA 4YELA 2VJJA 4YEIA 2V5IA 1IA5A 4XLEA 2O0VA 1X0CA 3FY3A 1TYUA 4YC5A
chains in the Genus database with same CATH topology
2J8IA 1QA1A 4OJLA 3LJYA 1CLWA 3BH7B 4OJ5A 3AK5A 3ML3A 1TYVA 2BM6A 4KH3A 1QA3A 3N6ZA 2VFPA 4OJOA 3H09A 4JRAC 2BM5A 3P4GA 1TYWA 1QRBA 4V02C 1TYXA 3LYCA 5JMCB 2XC1A 2BM4A 3BH6B 2BM7A 2VFOA 3PETA 1QRCA 3JX8A 4OPWA 4OJ6A 4OJPA 3N90A 1K8FA 1WXRA 1HF2A 2B0RA 1QQ1A 3SZEA 1KQ5A 1TSPA 2F3LA 2W7ZA 1DABA 2YUHA 3TH0A 2VFMA 1K4ZA 2IOUG 3SYJA 5JLVC 3RIQA 2BX6A 1QA2A 2VFNA 4OM9A 2V5IA 2VFQA 1TYUA 2G0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QA1 A;  1CLW A;  3AK5 A;  3ML3 A;  1TYV A;  4KH3 A;  1QA3 A;  2VFP A;  3H09 A;  1TYW A;  1QRB A;  1TYX A;  2XC1 A;  2VFO A;  1QRC A;  1WXR A;  1QQ1 A;  3SZE A;  1TSP A;  1DAB A;  3TH0 A;  2VFM A;  2IOU G;  3SYJ A;  3RIQ A;  1QA2 A;  2VFN A;  4OM9 A;  2V5I A;  2VFQ A;  1TYU A; 
#chains in the Genus database with same CATH topology
 1RMG A;  2PEC A;  2VBE A;  3SUC A;  2QX3 A;  5AMV A;  1QJV A;  2UVF A;  3B90 A;  3PSZ A;  4YFO A;  4Z06 A;  1O8E A;  2IQ7 A;  4XN3 A;  3H09 A;  1O88 A;  3NB2 A;  3GQA A;  2NTQ A;  2BM5 A;  4JRA C;  2NSP A;  2O6W A;  4URR A;  3VSV A;  2QYU A;  3ZPP A;  3EQN A;  2VFO A;  2Z8G A;  2VJI A;  1BHE A;  4HWV A;  4C2L A;  2INU A;  2EWE A;  2X3H A;  3KRG A;  4OZY A;  2X85 A;  4XOP A;  4YCQ A;  1KCD A;  1L1I A;  1KQ5 A;  3SQV A;  3WWG A;  2W7Z A;  4XON A;  2VFM A;  2XT4 A;  2IOU G;  3VSU A;  5JLV C;  3DU1 X;  3PSS A;  3RIQ A;  1QA2 A;  4OM9 A;  1AIR A;  1BN8 A;  4YDT A;  4XL9 A;  2O1D A;  3GQ9 A;  2XTY A;  2NTP A;  1EA0 A;  2XTW A;  1IB4 A;  1QA1 A;  1O8I A;  1OFD A;  1DBG A;  5C1C A;  1CLW A;  2X6W A;  3ML3 A;  4YEJ A;  4XM3 A;  1RWR A;  3ZSC A;  2J8K A;  1KTW A;  2X6Y A;  2O0W A;  2NST A;  4EW9 A;  1TYX A;  4XQF A;  1O8M A;  3VMW A;  4I84 A;  4XOR A;  2NZM A;  3PET A;  1OOC A;  1QRC A;  2QZA A;  2NTB A;  1OFM A;  2X6X A;  3EQO A;  3N90 A;  4OPW A;  4OJ6 A;  4XLA A;  1IDJ A;  3GQ7 A;  1WXR A;  1LLW A;  2B0R A;  2QXZ A;  3SZE A;  4OZZ A;  2INV A;  1OGM X;  2YUH A;  1K4Z A;  4Z03 A;  2XT2 A;  2VFN A;  2VFQ A;  1CZF A;  1JRG A;  3SY2 A;  2G0Y A;  4XKW A;  1O8F A;  4XKV A;  1LLZ A;  1VBL A;  2XTX A;  3AK5 A;  1PXZ A;  1TYV A;  3LMW A;  4XMY A;  1QA3 A;  1O8J A;  4YZA A;  4YZQ A;  1XG2 A;  3NAW A;  3P4G A;  1QRB A;  4XLF A;  1RU4 A;  3LYC A;  4PMH A;  1KCC A;  1IDK A;  1OGO X;  2XC1 A;  2BM4 A;  3BH6 B;  3GQ8 A;  2BSP A;  3JX8 A;  4U49 A;  4U4B A;  4OJP A;  2NT6 A;  4YZX A;  1HF2 A;  2NT9 A;  3GRH A;  3B4N A;  1TSP A;  1PLU A;  1DAB A;  1O8K A;  2VBM A;  1JTA A;  4XN0 A;  4NK6 A;  5C1E A;  3SYJ A;  1PE9 A;  1DBO A;  4XOT A;  2BX6 A;  4Z05 A;  4YZ0 A;  2PYH A;  4XLH A;  3B8Y A;  4MXN A;  3VST A;  2J8I A;  1WMR A;  2O17 A;  4OJL A;  4XNF A;  5DNS A;  1O8D A;  4AVZ A;  4W8Q A;  3LJY A;  1H80 A;  2PYG A;  3BH7 B;  1QCX A;  4OJ5 A;  4KH3 A;  2BM6 A;  3JUR A;  4XLC A;  3VMV A;  1O8L A;  3N6Z A;  2VFP A;  4OJO A;  4NK8 A;  1O8H A;  1TYW A;  4V02 C;  1LM1 A;  5JMC B;  1EE6 A;  1O8G A;  4W8T A;  2QY1 A;  4W8R A;  2BM7 A;  4XR6 A;  1OFL A;  3UW0 A;  1HG8 A;  1OFE A;  1K8F A;  1EZG A;  2ODL A;  1GQ8 A;  1K5C A;  1QQ1 A;  2VBK A;  4W8S A;  2F3L A;  2UVE A;  3TH0 A;  4MR0 A;  1NHC A;  2O04 A;  3T9G A;  4YEL A;  2VJJ A;  4YEI A;  2V5I A;  1IA5 A;  4XLE A;  2O0V A;  1X0C A;  3FY3 A;  1TYU A;  4YC5 A; 
#chains in the Genus database with same CATH homology
 2J8I A;  1QA1 A;  4OJL A;  3LJY A;  1CLW A;  3BH7 B;  4OJ5 A;  3AK5 A;  3ML3 A;  1TYV A;  2BM6 A;  4KH3 A;  1QA3 A;  3N6Z A;  2VFP A;  4OJO A;  3H09 A;  4JRA C;  2BM5 A;  3P4G A;  1TYW A;  1QRB A;  4V02 C;  1TYX A;  3LYC A;  5JMC B;  2XC1 A;  2BM4 A;  3BH6 B;  2BM7 A;  2VFO A;  3PET A;  1QRC A;  3JX8 A;  4OPW A;  4OJ6 A;  4OJP A;  3N90 A;  1K8F A;  1WXR A;  1HF2 A;  2B0R A;  1QQ1 A;  3SZE A;  1KQ5 A;  1TSP A;  2F3L A;  2W7Z A;  1DAB A;  2YUH A;  3TH0 A;  2VFM A;  1K4Z A;  2IOU G;  3SYJ A;  5JLV C;  3RIQ A;  2BX6 A;  1QA2 A;  2VFN A;  4OM9 A;  2V5I A;  2VFQ A;  1TYU A;  2G0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...