2V5IA

Structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
553
structure length
553
Chain Sequence
AAFRQEANKKFKYSVKLSDYSTLQDAVTDAVDGLLIDINYNFTDGESVDFXGKILTINCKAKFIGDGALIFNNMGPGSVINQPFMESKTTPWVIFPWDADGKWITDAALVAATLKQSKIEGYQPGVNDWVKFPGLEALLPQNVKDQHIAATLDIRSASRVEIRNAGGLMAAYLFRSCHHCKVIDSDSIIGGKDGIITFENLSGDWGLGNYVIGGRVHYGSGSGVQFLRNNGGESHNGGVIGVTSWRAGESGFKTYQGSVGGGTARNYNLQFRDSVALSPVWDGFDLGSDPGMAPEPDRPGDLPVSEYPFHQLPNNHLVDNILVMNSLGVGLGMDGSGGYVSNVTVQDCAGAGMLAHTYNRVFSNITVIDCNYLNFDSDQIIIIGDCIVNGIRAAGIKPQPSNGLVISAPNSTISGLVGNVPPDKILVGNLLDPVLGQSRVIGFNSDTAELALRINKLSATLDSGALRSHLNGYAGSGSAWTELTALSGSTPNAVSLKVNRGDYKTTEIPISGTVLPDEGVLDINTMSLYLDAGALWALIRLPDGSKTRMKLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords SALMONELLA TYPHIMURIUM DB7155 BACTERIOPHAGE DET7 TAILSPIKE
publication title Structure of the Receptor-Binding Protein of Bacteriophage Det7: A Podoviral Tail Spike in a Myovirus.
pubmed doi rcsb
source organism Bacteriophage
total genus 196
structure length 553
sequence length 553
ec nomenclature
pdb deposition date 2007-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2v5iA00
2VFOA 3H09A 1QA3A 3TH0A 2VFQA 3AK5A 1QQ1A 1TSPA 1QA2A 1TYUA 3RIQA 1TYWA 1DABA 1CLWA 1QA1A 4KH3A 2IOUG 2VFNA 1QRCA 4OM9A 2XC1A 3ML3A 2VFMA 3SZEA 3SYJA 1TYVA 1QRBA 2VFPA 2V5IA 1TYXA 1WXRA
chains in the Genus database with same CATH superfamily
2VFOA 2BX6A 3DU1X 2X3HA 1HF2A 2X6YA 4V02C 1QA3A 3TH0A 4I84A 4MR0A 4OJOA 1QQ1A 3GQ7A 4AVZA 3GQ9A 1QA2A 4EW9A 4XKWA 2EWEA 1TYWA 2NZMA 2J8IA 2XTYA 2UVEA 1O8EA 4XR6A 4XM3A 4YFOA 3B4NA 3VSVA 3VSTA 1CLWA 2PYHA 2ODLA 4W8QA 2INUA 2VBMA 2BM6A 4XOPA 1AIRA 4NK6A 4XL9A 1PE9A 3VMVA 1KTWA 1QRCA 1GQ8A 3LMWA 4Z03A 3GQ8A 3ML3A 4OJ5A 1OFEA 2QX3A 4YELA 2BM4A 1IDJA 5DNSA 4OPWA 4XOTA 1PLUA 1DBOA 2O1DA 2O6WA 2V5IA 1TYXA 4YEIA 4OJ6A 3LYCA 2QZAA 1LLZA 1O8FA 4OJPA 4YDTA 1WXRA 1JRGA 2X85A 3UW0A 4XONA 5C1CA 1O8LA 2QYUA 3GQAA 2BSPA 3SUCA 1IB4A 3LJYA 2NTPA 3N90A 4XLHA 1TSPA 1K8FA 1OFLA 1O8KA 1OFDA 3ZPPA 1QCXA 3RIQA 1BN8A 2PYGA 4OJLA 2X6XA 2VBKA 1QA1A 4U4BA 1O8IA 1OFMA 1O88A 1KCDA 1O8DA 1NHCA 2QXZA 2VFNA 3WWGA 4OM9A 1EZGA 3SQVA 3GRHA 4JRAC 3SZEA 1X0CA 1DBGA 2G0YA 3SYJA 4HWVA 3NB2A 1RU4A 3BH7B 2NSPA 1K5CA 2XTWA 1QRBA 2VFPA 3P4GA 3VMWA 3KRGA 3JX8A 4XN3A 3VSUA 4YEJA 3AK5A 1OGOX 4YZAA 1O8HA 4URRA 3PSZA 2XT2A 2O0WA 2NT9A 1L1IA 2J8KA 4W8RA 3JURA 4XLEA 1O8JA 1H80A 3N6ZA 3NAWA 3SY2A 1DABA 1O8MA 1BHEA 4W8SA 4W8TA 1LM1A 1RMGA 4Z06A 1LLWA 2BM5A 1RWRA 2VBEA 1IA5A 4XMYA 4XQFA 2O04A 2W7ZA 4OZYA 5C1EA 3ZSCA 2INVA 2XT4A 2O0VA 1IDKA 2B0RA 1WMRA 4MXNA 2VJIA 2NTBA 1XG2A 3B8YA 4XLFA 1EE6A 4YZ0A 4PMHA 4YZXA 3T9GA 3H09A 3FY3A 2YUHA 4XNFA 2VFQA 5JLVC 2NTQA 2QY1A 1HG8A 1TYUA 3EQOA 1OGMX 1PXZA 4U49A 4Z05A 2BM7A 2Z8GA 1KCCA 1K4ZA 1KQ5A 4NK8A 1EA0A 4OZZA 5JMCB 3PETA 4KH3A 5AMVA 2IOUG 4XN0A 2NT6A 2PECA 2VJJA 2F3LA 4XLAA 2UVFA 1CZFA 2IQ7A 4XKVA 2XC1A 4XORA 3BH6B 1O8GA 4YC5A 1OOCA 4YZQA 2XTXA 3EQNA 3PSSA 2O17A 2NSTA 2VFMA 2X6WA 4XLCA 4YCQA 1TYVA 1QJVA 1JTAA 4C2LA 3B90A 1VBLA
chains in the Genus database with same CATH topology
2VFOA 3JX8A 3H09A 2BX6A 4OJPA 1HF2A 2YUHA 4V02C 1QA3A 3TH0A 2VFQA 5JLVC 4OJOA 3AK5A 1QQ1A 3LJYA 3N90A 1TSPA 1K8FA 1QA2A 1TYUA 3RIQA 1TYWA 2BM7A 2J8IA 3N6ZA 1DABA 4OJLA 1KQ5A 1K4ZA 1CLWA 5JMCB 1QA1A 3PETA 4KH3A 2BM5A 2IOUG 2BM6A 2F3LA 2VFNA 1QRCA 2W7ZA 4OM9A 2XC1A 3BH6B 1WXRA 3ML3A 4JRAC 2VFMA 4OJ5A 3SZEA 2B0RA 2G0YA 3SYJA 1TYVA 2BM4A 3BH7B 4OPWA 1QRBA 2VFPA 3P4GA 2V5IA 1TYXA 4OJ6A 3LYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFO A;  3H09 A;  1QA3 A;  3TH0 A;  2VFQ A;  3AK5 A;  1QQ1 A;  1TSP A;  1QA2 A;  1TYU A;  3RIQ A;  1TYW A;  1DAB A;  1CLW A;  1QA1 A;  4KH3 A;  2IOU G;  2VFN A;  1QRC A;  4OM9 A;  2XC1 A;  3ML3 A;  2VFM A;  3SZE A;  3SYJ A;  1TYV A;  1QRB A;  2VFP A;  2V5I A;  1TYX A;  1WXR A; 
#chains in the Genus database with same CATH topology
 2VFO A;  2BX6 A;  3DU1 X;  2X3H A;  1HF2 A;  2X6Y A;  4V02 C;  1QA3 A;  3TH0 A;  4I84 A;  4MR0 A;  4OJO A;  1QQ1 A;  3GQ7 A;  4AVZ A;  3GQ9 A;  1QA2 A;  4EW9 A;  4XKW A;  2EWE A;  1TYW A;  2NZM A;  2J8I A;  2XTY A;  2UVE A;  1O8E A;  4XR6 A;  4XM3 A;  4YFO A;  3B4N A;  3VSV A;  3VST A;  1CLW A;  2PYH A;  2ODL A;  4W8Q A;  2INU A;  2VBM A;  2BM6 A;  4XOP A;  1AIR A;  4NK6 A;  4XL9 A;  1PE9 A;  3VMV A;  1KTW A;  1QRC A;  1GQ8 A;  3LMW A;  4Z03 A;  3GQ8 A;  3ML3 A;  4OJ5 A;  1OFE A;  2QX3 A;  4YEL A;  2BM4 A;  1IDJ A;  5DNS A;  4OPW A;  4XOT A;  1PLU A;  1DBO A;  2O1D A;  2O6W A;  2V5I A;  1TYX A;  4YEI A;  4OJ6 A;  3LYC A;  2QZA A;  1LLZ A;  1O8F A;  4OJP A;  4YDT A;  1WXR A;  1JRG A;  2X85 A;  3UW0 A;  4XON A;  5C1C A;  1O8L A;  2QYU A;  3GQA A;  2BSP A;  3SUC A;  1IB4 A;  3LJY A;  2NTP A;  3N90 A;  4XLH A;  1TSP A;  1K8F A;  1OFL A;  1O8K A;  1OFD A;  3ZPP A;  1QCX A;  3RIQ A;  1BN8 A;  2PYG A;  4OJL A;  2X6X A;  2VBK A;  1QA1 A;  4U4B A;  1O8I A;  1OFM A;  1O88 A;  1KCD A;  1O8D A;  1NHC A;  2QXZ A;  2VFN A;  3WWG A;  4OM9 A;  1EZG A;  3SQV A;  3GRH A;  4JRA C;  3SZE A;  1X0C A;  1DBG A;  2G0Y A;  3SYJ A;  4HWV A;  3NB2 A;  1RU4 A;  3BH7 B;  2NSP A;  1K5C A;  2XTW A;  1QRB A;  2VFP A;  3P4G A;  3VMW A;  3KRG A;  3JX8 A;  4XN3 A;  3VSU A;  4YEJ A;  3AK5 A;  1OGO X;  4YZA A;  1O8H A;  4URR A;  3PSZ A;  2XT2 A;  2O0W A;  2NT9 A;  1L1I A;  2J8K A;  4W8R A;  3JUR A;  4XLE A;  1O8J A;  1H80 A;  3N6Z A;  3NAW A;  3SY2 A;  1DAB A;  1O8M A;  1BHE A;  4W8S A;  4W8T A;  1LM1 A;  1RMG A;  4Z06 A;  1LLW A;  2BM5 A;  1RWR A;  2VBE A;  1IA5 A;  4XMY A;  4XQF A;  2O04 A;  2W7Z A;  4OZY A;  5C1E A;  3ZSC A;  2INV A;  2XT4 A;  2O0V A;  1IDK A;  2B0R A;  1WMR A;  4MXN A;  2VJI A;  2NTB A;  1XG2 A;  3B8Y A;  4XLF A;  1EE6 A;  4YZ0 A;  4PMH A;  4YZX A;  3T9G A;  3H09 A;  3FY3 A;  2YUH A;  4XNF A;  2VFQ A;  5JLV C;  2NTQ A;  2QY1 A;  1HG8 A;  1TYU A;  3EQO A;  1OGM X;  1PXZ A;  4U49 A;  4Z05 A;  2BM7 A;  2Z8G A;  1KCC A;  1K4Z A;  1KQ5 A;  4NK8 A;  1EA0 A;  4OZZ A;  5JMC B;  3PET A;  4KH3 A;  5AMV A;  2IOU G;  4XN0 A;  2NT6 A;  2PEC A;  2VJJ A;  2F3L A;  4XLA A;  2UVF A;  1CZF A;  2IQ7 A;  4XKV A;  2XC1 A;  4XOR A;  3BH6 B;  1O8G A;  4YC5 A;  1OOC A;  4YZQ A;  2XTX A;  3EQN A;  3PSS A;  2O17 A;  2NST A;  2VFM A;  2X6W A;  4XLC A;  4YCQ A;  1TYV A;  1QJV A;  1JTA A;  4C2L A;  3B90 A;  1VBL A; 
#chains in the Genus database with same CATH homology
 2VFO A;  3JX8 A;  3H09 A;  2BX6 A;  4OJP A;  1HF2 A;  2YUH A;  4V02 C;  1QA3 A;  3TH0 A;  2VFQ A;  5JLV C;  4OJO A;  3AK5 A;  1QQ1 A;  3LJY A;  3N90 A;  1TSP A;  1K8F A;  1QA2 A;  1TYU A;  3RIQ A;  1TYW A;  2BM7 A;  2J8I A;  3N6Z A;  1DAB A;  4OJL A;  1KQ5 A;  1K4Z A;  1CLW A;  5JMC B;  1QA1 A;  3PET A;  4KH3 A;  2BM5 A;  2IOU G;  2BM6 A;  2F3L A;  2VFN A;  1QRC A;  2W7Z A;  4OM9 A;  2XC1 A;  3BH6 B;  1WXR A;  3ML3 A;  4JRA C;  2VFM A;  4OJ5 A;  3SZE A;  2B0R A;  2G0Y A;  3SYJ A;  1TYV A;  2BM4 A;  3BH7 B;  4OPW A;  1QRB A;  2VFP A;  3P4G A;  2V5I A;  1TYX A;  4OJ6 A;  3LYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...