4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
4MR0A 4XLFA 4XM3A 2X85A 5C1CA 1GQ8A 2NT9A 5AMVA 2QXZA 1KCDA 1O88A 2Z8GA 1HG8A 1CZFA 1DBOA 4YZ0A 4PMHA 4XLHA 1IDKA 4W8SA 1VBLA 1IB4A 4W8TA 1JTAA 1WMRA 1X0CA 2NSPA 4EW9A 4NK6A 1JRGA 3ZPPA 2NTQA 4XORA 1K5CA 4Z06A 4XLEA 1O8LA 1O8JA 4Z03A 2PYGA 4OJ5A 3GRHA 3FY3A 3GQAA 2BSPA 4AVZA 4OZZA 3GQ8A 4XOPA 2VJIA 4YELA 1RU4A 4OJ6A 2VBMA 2ODLA 3EQOA 3GQ7A 2X3HA 1O8FA 1O8EA 1KTWA 4MXNA 4XR6A 2EWEA 1BHEA 2NZMA 2X6XA 2VBKA 4XLCA 4OJLA 3B4NA 3B8YA 4U49A 4HWVA 3UW0A 2O0WA 3SUCA 3VSVA 1PLUA 4C2LA 2NSTA 1XG2A 2O1DA 4YZQA 1PE9A 4W8RA 4OJOA 1RMGA 4YZAA 3T9GA 2NT6A 1OFMA 2NTBA 2PYHA 1QJVA 3VMVA 1NHCA 2X6YA 1QCXA 1O8GA 1PXZA 1DBGA 3ZSCA 3EQNA 2INVA 2O04A 1OGMX 4XN0A 3LMWA 1RWRA 4U4BA 4XL9A 1O8DA 1H80A 4YEJA 1O8HA 2O0VA 4XQFA 2UVFA 4XN3A 2VJJA 1O8IA 2IQ7A 1OOCA 1IA5A 4W8QA 3VMWA 2PECA 4I84A 3B90A 1EE6A 1OFLA 1OGOX 2UVEA 4OZYA 1AIRA 1KCCA 3VSUA 1IDJA 4NK8A 5C1EA 4YZXA 3VSTA 4XOTA 1O8MA 2QX3A 4XKVA 2O17A 3GQ9A 4XKWA 3WWGA 1O8KA 4XMYA 4XNFA 3JURA 2VBEA 4Z05A 4XLAA 1BN8A 2NTPA 2QY1A 3KRGA 4OJPA 4URRA 2INUA 4XONA 2X6WA
chains in the Genus database with same CATH superfamily
3MAJA 3SQNA 3ZQGA 2CF4A 4P2NA 2ZFUA 3BH4A 1QA2A 3GVKA 1TSPA 2V7UA 5C1CA 5HDGA 5E3OA 1YIJI 1BC7C 3J7AY 2ZL6A 3J80K 3OZWA 5ILSA 1WU8A 4YIRX 1T8IA 2OTLB 4NQWB 1R5NA 1BI3A 1DPUA 3W6KB 2ZZEA 2JZYA 4XRSA 4EQQA 4QTRA 5DUKA 2IRFG 2EZKA 3WTWC 3PVDA 2IVMA 4HQEA 2W7NA 2E1MC 1TWCJ 3HRTA 1ZM3A 1ZG5A 2NTQA 2QYOA 3WTZA 1IN4A 3TW6A 3M1EA 1U3EM 1N07A 3BR1A 2YWHA 3BDDA 4EATA 3CCSI 5JFRA 2CV1A 3ZMVA 1UD3A 2FXAA 5TV2A 4YELA 2RNJA 4OJ6A 3OW2B 2KZVA 1OCRH 4PGGA 5E1WA 4H0EA 3I54A 3CCMB 2VKEA 3CC4B 4C30A 4AIKA 4YCQA 4RAGA 1AA7A 2F2EA 4M3BA 3TW7A 2PMZA 2HOSA 1FOYA 4QWQA 1XFOA 1XQBA 3RQ4A 2JK3A 1BA5A 1GXPA 2EWEA 5FKKA 1RZ4A 1MH3A 2FRHA 5CQGA 2H94A 5BSYA 3HSRA 2UV1A 3BJ6A 5EG0B 3UW0A 3QPLA 1JKPC 3SUCA 3BCBA 1Q82D 5F0HA 2QENA 4YFNF 3S3NA 4UNOA 2VE9A 4LK0F 3JQRA 3KP4A 4M1KA 1K8FA 1TLHB 3SZPA 2R92J 4RD0A 4QHYA 4BHBA 2EIKH 2QA4I 2L7KA 4BJTA 3O8HA 4DYRA 2NOJB 3OYBA 2ME0A 4PC2A 1U8RA 4CZCA 3PQKA 3MZYA 1MD0A 2WC2A 5HNFA 1VTNC 1VQ7B 1JXSA 2G7UA 3ZQLA 4HEA2 1NHCA 2L3DA 1ZLJA 1WVRA 4M9ZA 2NVTJ 1YIOA 2R7SA 2Q1ZB 3CCEB 3ZZTA 2WSSA 2QVOA 4ZDPA 1T2KA 1H8EA 2O04A 2ZJPF 3RKQA 5HXBA 3ZQ7A 4IHWA 3HPGA 4M71A 3CMAI 3HEFA 1JKOC 4RD2A 4DZPA 3Q9SA 5FLVA 2LG4A 4W1UA 4O3MA 3JRCA 2DK8A 3P27A 3HPHA 4AF6A 1IA5A 1FDRA 1VQMI 1B23P 2J8KA 2MW8A 4I84A 4BGDA 1Q7YD 3A3BA 4FE4A 4MHGA 3L2RA 2DT5A 3OIPA 3IWZA 3N05A 5IT3A 1T5EA 4OIRF 5K5RA 2IA2A 5GADJ 1ETYA 4XOTA 4FWTA 4UUSA 1IDYA 2CO5A 1R7JA 2EZIA 3DPUA 4I09A 1YS6A 4XKWA 1ON1A 3MKZA 1YTYA 2RVCA 3CO6C 1WSVA 2DOEA 2OQGA 1H8HA 2L4MA 3ZIAA 4XLNF 5DD4A 2V7VA 4TMXA 4L5JA 1TNTA 3RPUA 5DM6F 1WI9A 3CC7B 3QPHA 2EFQA 1S8NA 4N9IA 3TOBA 1PVEA 5GAEJ 2QQ8A 4HZFA 3S2HJ 3SDBA 1GQ8A 2BVLA 4KFCA 1XD7A 2K3PA 3Q6QA 2IBDA 3IL2A 3HZJA 4BKXA 4PC1A 3ZUGA 1CZFA 1W0KA 2XAQA 5FLXZ 5CVJA 3S2DJ 4HNUA 4WXDA 4ZH4F 1EP2B 1E62A 4P9FA 2TDXA 4LJZF 3J81Z 4IRIA 2CW0F 3QFRA 4NK6A 3BCDA 2BM6A 1J9ZA 4HF2A 1SANA 1OFCX 2BZTA 1VQKI 3NEUA 3CCUI 1SFEA 2K27A 4UVAA 5JI6A 4LLGF 2Z9OA 4NHJA 1BI0A 2ZNZA 3DLAA 4BQOA 4RDUA 3LSMA 1OJLA 2DA3A 1FY7A 3MMYB 5JHFA 4E7LA 1NK3P 3W2VA 1IUFA 5FD5A 2X3HA 3TQNA 1X1DA 2EIMH 2EH3A 4E0FA 1H85A 2DDAA 2IAIA 2OF7A 4HG2A 2DPUA 2A3SA 2LLKA 1I3AA 3MWMA 1FYKA 1N25A 2OTLI 3CPXA 4C2MJ 4ON0A 2X6OA 3K9TA 3I3LA 2L9NA 1I18A 2QQ9A 1LQ1A 2GJKA 4ZDOA 1KU3A 2VN2A 2VIXA 4HAMA 5DCFA 3BY6A 3IH2A 5F6FA 5GPAA 4G7OF 1W5CC 1K8AD 3OYNA 1A6QA 4XSZF 5IT9K 4ENKA 2RC6A 1RMGA 3JQPA 4I0AA 3T0YA 5CPRB 1A36A 1U5TC 1Q86D 4X1EA 5DSZA 2DTZA 1ERDA 2L7FP 3ZQQA 4FTHA 3BLYA 2F6CA 1W0TA 1BC8C 3CLQA 3KP7A 5FGMA 2XV4S 3LNQA 1PDNC 2ELJA 4IHYA 3F21A 4KN4X 3BG5A 3P5JA 5CVRA 5EF6A 4ZCMA 1LDKB 1YW9A 5LD2C 2X48A 3LMWA 4Z4ZA 4OMZA 2R7ZJ 4A3CJ 2VFPA 4P3YA 1H80A 3RIRA 3CQZJ 3DU6A 1V54H 3FM5A 2QZAA 1FOKA 3W6JB 4U0WA 3DBHB 2IQ7A 4U9UA 2LY2A 2CV2A 5D5VB 3DEUA 1BJZA 2K9MA 4KIBA 3LL7A 3OSFA 5FKOA 1DP7P 3K2ZA 3VYSB 3OPOA 4D0PA 2QTLA 1R23A 2KRCA 3K4LA 4JX6A 3JRGA 2C5BA 1Z9CA 3DEEA 1ZARA 3IKVA 2QA4B 3BH7B 5J1YA 1JT0A 1QVGB 1KZHA 2V31A 3F8CA 3Q3SA 3QE2A 3H3ZA 2O6WA 4EM0B 2BVMA 3FXMA 2HXOA 4HNVA 2V4DA 4PK4A 2A5WA 2M3AA 2PG4A 2QMUA 4A3FJ 3DU5A 1LE8B 2X8KA 4KIGA 2MA3A 2FX0A 2FNPA 4KN7X 3JURA 1MH4A 1O3RA 1VQPB 4X06A 5L3BA 2VFOA 1OYYA 1GVDA 2A5YB 1GV2A 4ETSA 3JRDA 1XCBA 1YQAA 3GBGA 3JCUC 1RUNA 1Y0RA 1BIAA 2M8EA 2OD5A 3CJRB 4XM3A 1F5TA 3G4SB 4V2GA 1K78B 1BX0A 3OEHA 4DK1A 4LC0A 1Z1DA 2GOXB 5AMVA 3DP7A 3C3WA 3T8TA 1WJCA 2JA2A 5J3OA 1FOWA 4V2FA 2CRVA 4HPQA 4JK1X 2DI3A 3DTIA 4YZ0A 1REPC 5CVIA 2PFBA 1LEBA 1EFCA 1I6XA 2DU9A 1HVXA 1T98A 1GAQA 4KUMA 1JTAA 2VQCA 2XAFA 4IHSA 2E71A 3WBJA 1SMTA 1JJ8C 2X9DA 3QYBA 1JGGA 2DMQA 3CO7C 5IYNA 4CA0A 2O8KA 3WG7H 4P12A 3PM1A 3KEWA 1T38A 3ZZ0A 1MMDA 5A2QZ 1K5CA 2W1OA 4PJMA 1B4AA 5IY5H 3LSPA 1W87A 2BSPA 2OJED 4P1WA 5BNGA 1F43A 4G1BA 2YWGA 2Z99A 3JSOA 4ZDLA 1U78A 1JGSA 5DUIA 1WJBA 3AGPA 2ZJ2A 4KMFA 4ACBA 3WU2C 3RJPA 4ZYAA 4ZTJA 1VQ6I 1FBQA 4L18B 3HHGA 2KT0A 2WADA 3HOSA 1U2WA 2VLAA 4RD3A 2X3UA 4X07A 2ETHA 5D4RA 3IRRA 4PJJA 2STWA 1YX2A 5CKTA 3G71I 2BW3A 1E3ZA 5HS8A 1R5ID 1RC9A 3GMEA 3MCAA 4JQFA 2ZBVA 1MDMA 2GZWA 2OQRA 4ESBA 2CQ7A 2HZTA 2CMPA 4YZQA 4D7MA 4BHPA 1VQ4B 5KAFC 3JRHA 2LTPA 1WJAA 3A03A 4A6DA 4CCMA 2BPOA 4GGGA 1KU2A 1YITB 2KL4A 4RLQA 2RQQA 1QCXA 1XMAA 1KQ0A 5J1UA 2ADUA 1QRCA 1A04A 3CCLI 1LFPA 2A6TA 1X1AA 3DTEA 1Z6TA 2X51A 3QOPA 2F3LA 2X1DA 3LAPA 5DTDA 3CF2A 4BXUA 3LVBA 2FA5A 1PJ7A 4QPQA 2M2EA 1AWCA 1E43A 4OIPF 3CCQI 3RCOA 1DUXC 1D2EA 1N06A 1QQIA 2HXIA 1EXMA 5C3EJ 3WYAA 3GLLA 4WF2A 4O5VA 5HLGA 3H5RA 2WV1A 1KJZA 4OM9A 3RQIA 1IXSB 2QUFA 4UV9A 1E0EA 3PENA 2F5FA 1V55H 4UY8I 1MBEA 4N3NA 3JRAA 4RM2A 2GLOA 2DMNA 1WOPA 1O8MA 1IZ1A 1BL0A 4KNYA 2V6EA 3HGYA 3AG1H 2L4AA 1TYXA 3EUHA 3K4BA 4IRGA 1QU3A 2HOTA 2VBTA 4BY1J 4XMYA 1NK2P 2HQ5A 4RCZA 3HKZN 2UWMA 1BR2A 1XDUA 2CH0A 5HOOA 4OIQF 1IJFA 2B7CA 3GUDA 4E70A 5HNHA 1QRBA 2LDUA 3CDHA 3VFZA 3VNVA 1TYVA 1WWXA 4FISA 2MLKA 4DQKA 4FXUA 1G7CA 2NVQJ 4QVAA 2QSHX 3WBKA 4MR0A 3PSIA 3K70D 2DOGA 1VZ0A 3DEWA 3ISPA 2CFXA 3J80Z 1E3OC 1OFDA 1VQ8I 3HOWJ 3FKJA 1KCDA 1XS9A 3KLNA 2OA4A 2OYNA 1OCOH 1ZGWA 1DG1G 4MYUA 4LG0A 4AVPA 3JSPA 4PMHA 2JA6J 3DTKA 2H1LA 3ZC3A 3SXYA 2WTEA 2UXXA 2MD5A 3ZN0A 4ZV4A 1WMRA 3M8JA 2F4OB 5CJ9A 2GPJA 5AN9A 1BR4A 2EQRA 2I8DA 1QPMA 3BR2A 1B1BA 3D5SC 3KEYA 3MZHA 1MJAA 4J00A 2HDCA 2EV5A 1BPLA 4KA4A 4Z03A 1GVHA 4Q47A 5E3LA 4G8XA 5DD8A 5IYRA 3GRHA 2GBYA 4AVZA 4X8IA 4OZZA 1VQLI 5FRNA 3ABLH 3L1PA 2HWVA 3BPXA 1W5SA 2ID6A 3GQ8A 4PC6A 3GVAA 1G3YA 5LGNA 5JHUA 2W6JA 2JVHA 1VQOB 1QHGA 1CNFA 3K69A 4DZJA 2C4UA 1TUIA 1O8EA 3LA2A 4M3GA 5A89A 3I1FA 4RJLA 1M90D 2LKPA 2P7VB 2R7OA 4RLZA 5EGOA 3M8FA 3TKYA 2J7KA 2NS0A 1BHEA 2W4SA 2MC4A 2X6XA 3HYIA 4OJLA 1YX5A 4W97A 1JUSA 4BUPA 2BM5A 4HE5A 1TLLA 3ZQIA 5EG0A 2VFNA 1L1IA 2W24A 2B63J 4X6AJ 1UMKA 2A6HF 1FTTA 3J7AO 1FP2A 5CVUA 1G6NA 3IAM2 3OIQA 4JX5A 1HKTA 4CYDA 2HQNA 1B72A 1SVMA 3OW7A 3OZUA 2HDNB 3GVJA 3BPVA 3D0SA 3KETA 2E2HJ 2M4GA 2WJYA 2IS4A 1V5GA 1N08A 4BQAA 3GO5A 3GSIA 1X1CA 1MNDA 4BNCA 1EFRA 5HDKA 4CCLA 5IK2A 3M8EA 4RD1A 4EM1A 2XGDA 2PEXA 4HYEA 1E79A 1WQ2A 3LQRA 3OKXA 2JIZA 4C43A 1P7JA 2E1MB 2RREA 1EFTA 1QO0D 4HDUA 3M9AA 4ESJA 3HAGA 4N9HA 1B9MA 3K1NA 3AL0C 3BQYA 1WH7A 3ZXSA 1LPQA 2KPMA 2FBKA 4YEIA 2XAGA 5JLXA 4BH9A 1HW5A 4J0QA 2BM1A 3SEQA 1HKSA 3NQOA 4ZCLA 1RI7A 3MZ8A 1OGOX 3E6CC 5F0FA 5KSWB 3A2KA 1P6RA 5E18F 5FIUA 4D5FA 4NK8A 2VQHA 2HPIA 2QX3A 1YJWI 1A6IA 1SVLA 4E7ZA 2QTZA 2FF4A 1R71A 1EV7A 2E7WA 1ZM4A 1FBUA 1YYVA 1ZGAA 1D1AA 2JRTA 2XC1A 1PYVA 3H9GA 4ANJA 4CUGA 1FLIA 3PIOF 1OCPA 1MNMC 2H1KA 1Z7UA 4LG3A 1H9TA 4JMQA 1Z05A 2E2IJ 3RZOJ 4RA2A 4ENMA 2EFGA 2PN6A 1TL8A 4II2A 3H0GJ 1VHOA 2DOFA 1BX1A 1BI1A 4MEXF 2V9VA 4DJAA 1STZA 1XMKA 3NWSA 3KPHA 3WU0A 1BJAA 3FK6A 1O88A 4K1XA 4G7HF 2IXSA 4X0CA 4DNRB 4W8SA 1KQ9A 4W8TA 4IL6C 3J81K 2VNKA 2KDZA 2PJRA 4I01A 4A3KJ 4A3BJ 2ISYA 2M34A 4LIVA 3T56B 4FN5A 5LBQA 5HKKA 2DFFA 3W3CA 1EP3B 4G7ZF 4M4SA 5M5WJ 3BG9A 3ES9A 3H0DA 3OWTA 1G3WA 1TZLA 3ZPNA 1TBXA 5DV5A 5KCMA 2HYJA 3AG2H 5FKLA 1Q9SA 4MFEA 4QV2A 1ZYRF 2AQFA 3HL2A 2IP2A 3HXLA 3R60A 3GZ6A 3OV8A 2CYYA 1E3XA 4RAFA 3J7ZI 5M5YJ 2XKOA 4M2LA 3W2FA 1K4TA 1ZRDA 4EJWA 4HF1A 4AU7A 4Y33A 2KJBA 1YW8A 4BACA 2BHYA 4V19K 3AAFA 2I5UA 4UUTA 2WR8A 2VBKA 2ZSHB 4DK0A 2BVNA 4HLYA 3WHCA 3VSVA 1X4PA 3HB9A 4A0XA 2O8XA 3DXJF 3IUOA 4L0YB 3H09A 1FRQA 1VFCA 3KE2A 3QP6A 4RLFA 1RKTA 2IS6A 3MVPA 1WRJA 1T56A 2NSTA 3ZQHA 2C77A 1QZYA 3BR0A 3QFCA 3JRIA 1UD2A 2RN7A 3V8LA 3TO9A 2CSOA 2ECBA 3WQZA 5B1BH 4OPSA 2NVXJ 2ZTNA 3RPQA 4E7HA 2B9SA 3FPKA 2TCTA 3ASQA 3BC8A 2IA1A 4GYGA 2Y75A 2FE3A 3VEPA 3DWLE 1ETXA 1USSA 2V1UA 2DIEA 1BMFA 1FEXA 2CW7A 1UG0A 3FHZA 3HUGA 1J7KA 1DGRM 5LHIA 4U4BA 2BX6A 4YEJA 2H27A 3RSNA 3J81k 4EJTA 2RC4A 5HLTA 3K4CA 1UZCA 2IS2A 2XNDA 1K7AA 4NC8A 3VMFA 1K6OA 5IYQA 4OOVA 3VNUA 1D1BA 2E5NA 4YDTA 4JP0A 3E1SA 3O8GA 2MC3A 1P92A 1W5TA 2EA4A 2XGJA 1HF2A 1AIRA 3EUKL 5IOYA 1MBGA 1XGMA 1TYUA 2K3FA 4OOIA 1E3HA 3REOA 1KRHA 1IO2A 5ILUA 4A5MA 2DN0A 5C44J 2HOAA 2VPRA 4HV5A 2W25A 1GVJA 4BDZA 1OGIA 4HLXA 1V0FA 3OEEA 1OCTC 3LO8A 4IOAF 1JUMA 2DA6A 2ZKZA 2VNHA 1MBHA 1NHAA 1O4XA 5K7HA 2FOKA 1XGNA 1P7IA 5DCMB 3TOAA 2DY1A 1HSJA 5FLXK 3VO2A 3L09A 3W6VA 3ML3A 2HTJA 4GO1A 2HDDA 4AIDA 5E8GA 2G0EA 1TW3A 3B6AA 4RBOA 2JDIA 2DMUA 3WY9A 2VC0A 3CMEB 4C3JJ 4M6YA 1E1RA 4I7HA 1IDKA 5KHDA 2L02A 5CVVA 2XNCA 2CQXA 3K2AA 3G6EI 3N6ZA 1ETQA 1FWZA 2B7BA 4RS8A 1CQTA 1DQUA 2W7ZA 1Z3YA 2WBMA 4QIWN 1TQMA 4HV6A 2K5CA 5ICGA 5D5WB 1VQ5I 1BIBA 2DBBA 2K9SA 3U21A 3GQAA 3I59A 1LKXA 4AF7A 5FJ8J 5L3GA 3IV5A 4PABA 3W2IA 2W82A 3MD2A 3T53B 3HGGA 3W5HA 2OTJB 2VBMA 4C2UA 2ZJQF 1O3TA 1EF4A 3EQOA 4NCNA 4BBRJ 1W36D 4RD6A 2ZXJA 1SD5A 3G4SI 5TRDA 3ZMSA 2EZLA 2VL8A 3DBLB 3IH3A 2Y2ZA 2LBFA 4XR6A 4RPDA 2WAEA 1IJEA 4L0ZB 3CC2B 2QKLB 2ZSIB 2HU9A 3MKYB 1N8RD 3FKSA 3TBIA 2A6EF 4U49A 4HWVA 3SYJA 1ORKA 5DYMA 2CUJA 3SJMA 2F48A 1BLIA 2KIQA 3WNCA 4CCKA 5L3EA 2XOKA 1SAXA 2CS3A 1TVCA 3F6OA 3KX2A 2DAOA 1WZ2A 4TKOB 1LLZA 4DIQA 5FKMA 1PUEE 3PSSA 2DA4A 3CUQC 1F36A 3FXLA 3D5RC 2V7QA 2VFQA 2OK7A 2DFHA 3KYLA 5LHGA 2MSYA 2Y31A 5GP9A 1Y8RB 3I4NJ 2KMUA 4HA8A 3L2UA 2CV0A 1LVKA 1VI0A 3C7JA 3S15J 2HDWA 3BT9A 3K4KA 2BEOA 2WYRA 4U7DA 4WQMA 4PJNA 2D45A 3BR6A 2STTA 1RQPA 5E20A 2LD5A 1LDJA 2XT4A 5J3LA 3P26A 3ASNH 2LKXA 1J59A 4OPWA 3E97A 1X3WB 1ZELA 5K7ZA 2M87A 3CCYA 3ABTA 4Z4WA 1WOOA 5L3FA 2NRAC 3MMPA 2DOAA 4Q4ZF 2NS7A 2OZ6A 4D5CA 1EE6A 2FBHA 1ZKGA 1NG6A 4Z2YA 1B6AA 2MBFA 5FRMA 3WNDA 5JR3A 1KC8D 4DQ2A 3HRMA 3ASPA 3ABMH 4LB5A 4G6TB 4XD7A 3C2BA 1Z67A 2CNDA 4XKVA 4CSWA 1QVTA 2VZLA 3BCAA 1MSEC 1I7PA 2BSAA 2E1RA 5AONA 1XCVA 2IGMA 4I02A 1DARA 2VBEA 3Q6RA 3KEQA 4LG0B 1DDIA 1BN8A 3IKTA 2NTPA 2QY1A 1U8BA 1H88C 1ITYA 4MIMA 2JRMA 3SZGA 5K1YA 1EP1B 2F5EA 4B47A 2EB7A 2X6WA 2WV0A 3BOQA 3VODA 3PETA 1BOBA 4YIFA 1MDMB 4CYCB 4IX7A 4IQJA 4RDJA 2L7MP 2M1BA 4A3JJ 2XZPA 3IAS2 2P8TA 5THXA 3I59B 3TO6A 1HF0A 1HSTA 3M07A 2XAUA 3EUHC 3LSTA 3PA1A 4TN1A 1DBOA 1T6XA 3JU4A 3GWZA 3QODA 3ZMTA 2FQ4A 3V7CA 1YLFA 1J75A 1ZREA 1F4KA 2Y48A 3QP5A 1MSFC 1X0CA 2MYSA 2PE3A 4EH1A 1Y0UA 2KKOA 2ZMEB 4HE6A 4R1HA 3BTCA 3V7AA 3U9GA 2L9SA 3PL8A 1R5GA 2C4TA 4Z06A 2XEXA 1MJ9A 2QYUA 1XX5A 4I98B 4IHXA 5DN6A 4R8HA 3VB2A 5ICCA 1GLNA 2DFEA 3D5LA 5TISC 4LGWA 1K83J 4EEFG 5CYVA 2X0KA 1WCMJ 1MBFA 5DDGA 4IKFA 4YFKF 2XC7A 2ZXWH 1VLYA 2IGOA 1WHUA 2KLOA 3PA2A 4QFMA 1Y1VJ 2DT6A 1VQ8B 1TWFJ 2K02A 2CRGA 1H9GA 4MNUA 3GFIA 3NAWA 3CB4A 4UUVA 4L8JA 1S7OA 1TWGJ 1Z6RA 3WHBA 4GDFA 3QU6A 4KH3A 3UR3C 2N8GA 3G6EB 2ZITA 3CMYA 3VSLA 4Y13A 2HYGD 4CXFA 2FNAA 2BXZA 1OLTA 1IC8A 2ZZQA 2R7TA 2AS5F 3SJZA 3RI4A 2X1EA 4W8RA 2V6CA 4F55A 2YWFA 2DYRH 4PGHA 3ZR8X 4YZAA 4LMYA 2VUMJ 2XASA 1DDNA 1D5YA 4X7CA 2KVOA 5DNSA 3VMVA 1I6HJ 4F93B 2OTJI 3DU1X 3GW2A 1QA1A 3ZSCA 2LNBA 4OP7A 1T39A 2XHKA 3LSRA 2V5IA 5CLSA 5EEGA 5KVRA 2PJPA 4F91B 1XN7A 5HZAA 2GIZA 3ZCOA 2R93J 4YFOA 4XN3A 5AIQA 5ERIA 1JUPA 1OB2A 2M5SA 2MH9A 1PP8F 4W8QA 1SD6A 3BQJA 2C78A 3BTJA 3HSEA 2GIVA 3RKXA 5F0CA 5M5XJ 1OFLA 2DPDA 4DNTB 1FC3A 4Y3OA 2VNJA 4FHTA 2X4HA 2D74A 1SD7A 2IGKA 2DLLA 3Q5FA 9ANTA 4CZZA 1COWA 2GOMA 1LB2A 1WKMA 3A8KA 1Y0NA 4CH7A 3EPZA 1O8KA 1T0FC 2HQRA 2XVCA 2OK8A 1OB5A 1EA3A 2JSPA 2LBFB 5FROA 1V3FA 2GA1A 2LFBA 4LITA 4BE2A 2O6GE 2F5DA 2Y9ZA 3LSKA 1FNMA 4B4DA 2L9RA 3CCSB 3DPLC 2BYVE 2VNIA 2Q0OA 1BQEA 1ZR4A 1J9IA 2ICWG 1OYIA 2GQQA 4XRFA 3V7RA 4XRSG 1O3SA 5LGUA 1BJKA 3JQQA 2VXZA 2X85A 4YFXF 3OE7A 1QFZA 4YHBA 1VQ6B 3LA7A 1I5ZA 2ELKA 2OCEA 4EJVA 3TDZC 1YW7A 1KTVA 3KP3A 2J5PA 2JUGA 1DABA 5LMZA 3I56B 2HQAA 1CGPA 2BF4A 5C4XJ 1SKYB 3Q0UA 3OYJA 4RM3A 4E7IA 2VKVA 5E1ZB 2XRLA 4QPOA 4EGYA 2PLFA 1X58A 2DETA 2JA8J 2FX3A 2GA2A 2F1MA 2P5VA 3P9CA 2R7FA 4JOMA 3K70C 4ZCIA 3HOTA 5B3SH 4XICA 2ZJRF 2VBVA 3FY3A 2QBYA 1X2NA 3O6BB 1WH5A 4KICA 1VQ7I 1F60A 2A07F 4G9YA 1W2BB 2XKPA 2R7DA 1RU4A 1B8IA 1GAWA 4GRIA 2INUA 3GZNB 3U6BA 1EH8A 2K9NA 3ZMZA 3MFKA 3CCVI 2R5YB 3SLDA 4RGRA 1F1ZA 4UXNA 3CMAB 1HZEA 3QFSA 2QLZA 1XSXA 3BZCA 4E7SA 1JJ2B 2DA2A 5KW9A 2ESNA 3E5XA 1G3TA 3ECHA 2FEZA 3WTVC 4BE0A 4KKTA 4XIDA 3NB2A 1Z7LA 3WE2A 5BMZA 3BP8A 3CUQB 2P5LC 3EDPA 4U88A 3D26A 5DCMA 4EJUA 4RD4A 2M45A 3V4GA 2WA0A 2X1CA 3OFNA 2NTBA 3U1KA 1QJVA 1JA1A 1L3LA 3R0JA 1OQYA 1SEUA 3SFZA 4DW6A 2V79A 4BE1A 4F7ZA 3MHPA 3PSZA 3FX3A 1R49A 4P6VF 5HS9A 5A2QK 1ZLKA 3CTAA 1PJ5A 1AKHA 1QVFB 4WK8F 3SQVA 4BQQA 3PSFA 1UD4A 2J8IA 2UVFA 4F7DA 2GK7A 2WJVA 2MD0A 1E3PA 5D6EA 1ZG1A 2VASA 1EJ9A 3CCRB 4EV0A 3KYDB 5IP6A 4RGUA 2BGCA 4OZYA 1EH7A 5KAIC 1SC7A 3SLNA 1OISA 4EGZA 4UB6C 5J40A 2ZBUA 2NPFA 3COAC 3BG6A 3P9KA 1FTZA 5FL7A 3KZIC 4O6JA 1D3YA 3OS0A 1QGYA 1EH6A 3S93A 4IJAA 2O7OA 1OR7C 1LUJB 2HKOA 2E19A 1K9MD 3QAHA 3WTUC 4B3GA 1JNYA 2BM4A 2M7AA 4BYYA 4M0LA 3H1CA 2VFMA 4BS9A 2G7HA 1JHHA 2QSFX 1QGPA 3B73A 1TTTA 2JUCA 3EYIA 4Q7JB 3QFTA 3SZEA 2LSOA 4YAOA 2GM4A 1XC5A 3E3VA 4PC7A 3SJPA 4DYCA 2R5ZB 3GTGJ 1FT9A 4P3IA 3LSJA 1ULYA 3ZQCA 3S3OA 4A93J 3LQQA 2QBYB 4RGXA 1U6GA 4GQNA 5F1RA 3W2HA 2OV7A 3H5AA 3G3ZA 3KP5A 4XLHA 4CDGA 5H5JA 1I1GA 1FSEA 4ZZDA 2D3NA 4AC9A 3FXRA 1H0MA 5JBQA 4N3GA 1N75A 1D8JA 1E63A 2C5HA 1IB0A 2A05A 1JKRC 5DS9A 2XPUA 2P6TA 3ERED 4H9GA 1I27A 3VYTB 3L2WA 4HX4A 2QSGX 4LK1F 2FSWA 3ONUA 2XF7A 5J8FA 3HKZA 4YRVA 1NBMA 4OINF 3BY2A 3JX8A 3S8PA 3FHNA 1A35A 3OR1C 1TNSA 4IRHA 4A3EJ 2HMAA 4A3GJ 3AK5A 4Y52J 2CQKA 3FMSA 3CUQA 5EZGA 2XAHA 2XSDC 1Q81D 3AVUA 2ZNYA 4QLCU 5L3CA 1FNCA 1YI2B 4KJZA 1KTWA 3P4GA 1RQRA 2IT0A 4YG2F 4YXWA 2EIJH 3CZ6A 5HVQC 1Z21A 1QHHD 2P81A 3BR5A 2C2WA 2R9VA 2LKSA 2VJ5A 2WWYA 2W48A 1R1UA 1GJRA 3Q38A 4M6XA 4A2UA 3H9JA 4I2OA 1RESA 4Y7CA 2FU4A 5D5UB 2Z2SB 4A6EA 4C3HJ 3SDGA 2RDPA 2P3MA 4M3FA 4A5NA 4FCYA 2XGCA 3G1MA 4S04A 2M8GX 4ZC3A 4OAYA 2VKDA 1U5TB 5F04A 3F23A 1WDTA 3OOCA 4JRAC 4S05A 2E36A 2R0QC 4LOCA 3FPPA 3F72A 1EZGA 3EQNA 4X7DA 3WXMA 3VPRA 1VQPI 1NG7A 3KZZA 3QPTA 2DODA 2XUBA 4Y17A 2I1LA 2LP0A 2EFOA 3GTKJ 3M4OJ 3AKZA 3NWTA 4Z1MA 2OC6A 2BV3A 2FQ3A 2ZMEC 2RGVA 5D5XB 2ZC2A 1SMYF 2OPTA 3S1QJ 1QFYA 2EZHA 3HBLA 2V7TA 1TWHJ 3KP6A 1ZRCA 3GQBA 2ZFWA 1OOCA 2F43A 4ASUA 1W34A 4IHVA 4QUZA 2PECA 3I53A 2Z3YA 2FJ1A 3C2GA 4WZTA 2WZNA 2VPLA 3KP2A 2D1HA 1B2RA 1SAUA 1ZM9A 1IDJA 1HA8A 3S32A 2DCUA 1BW6A 4PFOA 2NAZA 3RKWA 4OOSA 3G2BA 4MFDA 3DF8A 3VDXA 5FFXA 2O17A 1MABA 1ZTRA 2BM0A 2ZXIA 1KK1A 2Q8KA 3ZBUA 3QQAA 2VONA 5H6QA 4CO8A 5IYDJ 3HIFA 3WTXC 2HVSA 4NQWA 4ITVA 4WZLA 2CG4A 3CD6B 3KRGA 1VF9A 1SFOJ 2KZGA 1YS7A 1QGAA 4Z4SA 1MGTA 2JN9A 4B3FX 3ESWB 3V76A 3FBNB 1KZLA 1UG2A 4XKBA 4AIHA 5GAHJ 1IAWA 4LBZA 1MMAA 2M7BA 4UHTA 4RB3C 3B78A 3RZDJ 4NC6A 2Z8GA 5FKNA 1X2MA 1YX3A 2BHZA 3BZ6A 3F8MA 3K4MA 1Q1HA 3BY1A 1IB4A 2CQNA 3DBRB 3K4NA 4BL0B 3X2QH 1OCZH 4Z4YA 2CUFA 5HS7A 2NSPA 1UHWA 3K4JA 1WSRA 3F8BA 4EW9A 4XK4A 1SD4A 3ZPPA 3A02A 3HRUA 2WZPP 1YJNB 4G5GA 1D8KA 3K7AJ 2LH9A 1CF7B 1K61A 1NB0A 3JTHA 3R0AA 4KIFA 2PYGA 3V42A 3MCZA 1FNDA 3FMRA 5FO5A 2E7XA 2BN4A 1WSUA 2VOOA 1BBYA 4B44A 1GUUA 2L5QA 1P2FA 1NH3A 1P4AA 5FO0A 1I3QJ 4X7FA 3CCLB 2K9LA 4RB2C 1QA6A 3BJOA 3OSGA 3B8HA 2NVYJ 2DFIA 3BC9A 3H5NA 2Y69H 4J19A 1OPCA 1D5VA 1TYWA 3OS2A 3D1NI 3GVLA 5IYPA 4DGWB 2O0YA 1N78A 3GFMA 5ED4A 5B6IA 3B8YA 5IOZA 3W2WA 3PNVA 3CCQB 1LFBA 2W6IA 1W0UA 3ZGKA 4M74A 1W1WE 4UV8A 1ACIA 3GIRA 3BJAA 3KCCA 2H6BA 2HVQA 2KP6A 3C1DA 4C2LA 2YSRA 5D6FA 4OJOA 3OOPA 2KRFA 1K28D 5BOXA 3GTOJ 1WJDA 3JAMZ 1CNEA 4ZJZA 4Z4TA 2VBWA 1LEAA 4D1QA 3BNWA 2AHQA 1ZR2A 2O5RA 2KDOA 2QN6A 3Q3AA 1FYMA 1ZN2A 3U2QA 4Z4VA 1FX7A 4MO7A 3H94A 4RDLA 2X6YA 3EYYA 3P7NA 4PDKA 5FA6A 3VWBA 1XSVA 5EEHA 3CC4I 1U9OA 1YHQB 1O8GA 1QUFA 3CUOA 1FSHA 2VT3A 2DERA 2K85A 2V9KA 2AO9A 4KMUX 4RM0A 5JLVC 3HTUA 3GFLA 2BOLA 1VF7A 3I55B 5F27A 1FIPA 2NS8A 1D0YA 1ZG3A 1AIPA 1O8DA 2HFHA 3LJYA 5F08A 2VJJA 1O8IA 5LLQA 2BY0A 4M72A 2JVGA 1KYWA 3CMEI 2OU2A 2CC2A 5C4JJ 3QSYA 1QRYA 2LYCA 2QKMB 4CGZA 1O57A 4P55A 2E2JJ 2QM3A 3NARA 3OL3A 3VSUA 2W85A 1HC8A 2K4JA 3ZN1A 3LFKA 4YALA 2ZMEA 4C0SA 3F6VA 1ODDA 2L2OA 4BPRA 1IRXA 2QF7A 2GJRA 2JJ2A 4DBRA 2EFPA 1VJSA 1FNBA 3WGGA 1HA3A 3CCEI 2YU9J 2EILH 4P96A 1IUYA 2NVUB 1VQNB 4OJPA 4L9TA 3TP3A 3LAJA 1UD6A 4JBAA 2HOEA 4JX4A 2JA5J 2YPRA 3ONQA 4V02C 4XKCA 2VT2A 4G6IA 3FIWA 4FE7A 1WI3A 3I71A 1R22A 3K6GA 4RMNA 2VOPA 2IEKA 1SVOA 4U0VA 3GLXA 3T5XA 3E7LA 1X1BA 5HODA 1DU6A 3A01A 2P7CB 1WGXA 3IH4A 2A69F 3GTPJ 3N4MA 3H35A 3W5VA 2V1XA 4FETA 1O7LA 3WTYC 4OMYA 1UHSA 1KYZA 3BCFA 1JRGA 2OZUA 1ZHFA 2CQQA 3GFJA 5GPCA 2V1NA 1ETKA 4PFPA 1J5YA 4IXAA 4XLEA 1GHCA 2CGPA 4L9NA 3ERMA 2F4MB 2V26A 4AYBA 2YUSA 1X19A 1W0JA 2BV6A 4ABZA 4XOPA 1F20A 3U1DA 4BHCA 1FX0A 2ODLA 3HOUJ 1C0WA 1MNEA 2PI0A 4BXXJ 2J5OA 2WAQN 2LY9A 3JTGA 3VR6A 1NB9A 1T0FA 2KQRA 1RETA 3E6MA 3ZP5A 1R1VA 4K2EA 2KJCA 3QYFA 3VSKA 1K79A 1FPQA 2MFZA 1R4MB 2DA5A 2G9WA 1IGNA 3LNNA 1ETOA 3WGHA 4AD9A 1R58A 2BY2A 4UUSB 4TSFA 1PLUA 1NTCA 4WWCA 2W84A 4UZUA 4CCOA 2QEXB 3SKBA 2O1DA 1HW2A 1YJNI 3RPUD 1BW5A 1APLC 1IW7F 3N97A 1X4OA 1T6ZA 3Q9VA 3LFUA 1KONA 2R7XA 1MMSA 3TL4X 1HOMA 4IPAA 1W9XA 5KK1A 3WNBA 1YJWB 3T9GA 2R7WA 2JPCA 3TGNA 3OYEA 2IOUG 3H36A 3S2WA 4PAAA 3DFGA 1OFEA 2NXNB 1UAAA 1IDZA 2OBTA 2DQRA 5B1AH 1FRNA 1MRZA 4A12A 1OR7A 5H2FC 4RB1A 4EJOA 1G8XA 4E4HA 1RWRA 4XL9A 1FOXA 4BDYA 1QG0A 3TMOA 3AG4H 3AVVA 1HQCA 2HTSA 4HDVA 3FXJA 4I76A 4YAWA 1MBJA 1G2HA 2COMA 4A3DJ 5L3DA 2M0CA 5B5EC 4LLLA 1R5OA 1KA8A 1AKHB 4PJLA 5LRRA 4HIZA 1S72B 2ID3A 5IP7J 2ISZA 2UVEA 1IRGA 4A3MJ 5BPIA 1JHFA 4P6YA 1WJEA 3JR9A 1Z3XA 2GXGA 5LHHA 1QVUA 4TMZA 1N05A 1UHMA 4C3IJ 3EETA 3LSGA 3GQ9A 1MJBA 2Q2EB 4CICA 3HM5A 4U7BA 1Y56A 5E6TA 1YHQI 1JA0A 4XLPF 5EZHA 4ENNA 3M3YJ 2HKXA 2Q2EA 3LSIA 4XLAA 4URRA 2PMZN 1B72B 5E3NA 3HDDA 2V4JC 3CDLA 3HOXJ 1YJ9I 1XDSA 2CFOA 1Y39A 4BBSJ 1ON2A 3ASRA 4NNJA 3QRFF 5JVGF 4M73A 4YAUA 3A8JA 2ZTGA 2LF8A 4LB6B 5HDNA 3A1YA 2NT9A 2XT2A 2FUG2 1KQSB 3OYFA 1VBLA 1P4WA 4PUSA 5H20A 1S29A 3BQZA 1S4MA 2D9RA 3B82A 3F0CA 4KKUA 4HNTA 6PAXA 4MEYF 1Z0XA 4E6KG 4KT5C 4X0GA 1JJ6C 1HKQA 5F1JA 2ECCA 1E64A 1LJ9A 2G0YA 2EV0A 5J35A 3FM3A 4HF0A 5HZBA 1V4RA 3H92A 2JJ1A 2XAJA 1KK3A 1PJRA 2DQLA 4Q5SF 3CXCB 4OJ5A 3E5QA 1TC3C 2PMDA 2RKHA 2DJNA 2WB1N 1G7RA 1IN6A 2LK2A 2K86A 3NRVA 1UD8A 3DCFA 1GO2A 1S0UA 1WPCA 4A3IJ 4BAYA 1T08B 2P0WA 5J6XA 3OP1A 1KK2A 4XBFA 2PMUA 1V5FA 3R6KA 1YIJB 4HX8A 3UKGA 2F4IA 1S9HA 1W36C 2D3LA 1D1CA 3ASOH 2KIUA 2ZO4A 1R1TA 3DPTA 3V7SA 4BXFA 3AVYA 3KZYA 3B4NA 1P9QC 2PX9A 2DJIA 3MN2A 2KIFA 1KD1D 1DP3A 4OIOF 3PUMA 2MGQA 4KITB 5KNLA 1EKEA 1F9NA 2V7FA 4CYCA 3BZKA 2AXTC 2E1BA 1T6YA 2Q6KA 3ZRGA 3ABUA 3LQEA 3GYHX 1OGJA 2P5KA 3OYIA 4LLNA 2M30A 3SFIA 3CCJI 2O9LA 1E1QA 3GTMJ 2O3FA 3B6CA 4ZZLA 3I5UA 2CW8A 5LFAA 5GTIC 4E7JA 4DOZA 5TGTA 4F92B 4HOBA 4YC5A 3RTRA 4RAYA 1OYWA 1DBGA 2VXDA 2XIGA 3OOUA 2YX7A 4NBQA 3PFYA 3U2RA 2I10A 2VC1A 1QX4A 1R5BA 1Z77A 2EK5A 2LVSA 2VBYA 2E60A 2NOGA 1DU0A 3DKXA 3I9V2 1RR7A 5D8KB 4AWXB 2JT1A 5CQEA 5ICEA 3F3XA 3PUFA 1O8HA 2KHMA 3OR2C 2IJLA 2DMPA 2WAQA 3K1MA 4ACAA 2EINH 4M6VA 3OYLA 2CU7A 2HS5A 1FMWA 4UVBA 4RPBA 3DQVC 1XE1A 4PGOA 2VBXA 3RDIA 4FX4A 1S6LA 2EV6A 1ZRFA 1OKRA 5M3FJ 1M1KD 3ZQFA 1LNWA 1T6SA 2HYFA 3CESA 1WFXA 3Q0VA 3ZPLA 4TMTA 1IXRC 3H3VK 2DW4A 2BGJA 5F4OA 4ZYDA 4P22A 3O2PE 2Y0SA 2VI6A 4UVCA 3F8FA 1IXCA 1VQ5B 4RGSA 3A01B 1L0OC 2VQLA 3I4MJ 2F1LA 2Y30A 3HTSB 2ZL7A 3KYCB 1H42A 1IV6A 4MQVA 3BG3A 2ZXHA 2YX4A 3BG7A 1TT0A 2QCOA 4IQ4A 1RIOH 3CW2A 4MGRA 5E8IA 1GR1A 3CRZA 4OPVA 1V5VA 3CPWB 4MQ9F 3CJNA 3VYRB 2R7RA 3R6SA 1WJ5A 1JTYA 5FFZA 4A69C 1MMGA 1VQMB 2HI3A 5FNZA 1VLOA 2X53S 5H59A 5J4YA 2UXNA 4ZYHA 4LFUA 4U87A 1UD5A 5BSXA 3E6BA 4ZYGA 2HLDA 2E1OA 3DV8A 4D9JA 3SYTA 3K1PA 1XGSA 4RB0A 5A8AA 2LY1A 3FISA 2B5OA 1UJ8A 2B0RA 3OS1A 4IHTA 2E5ZA 2ZZGA 4AIJA 3FF5A 3AVTA 1J2XA 3AL0B 3AGQA 3FDYA 5IPAA 1OCCH 1KQ8A 2CUEA 1K6YA 4B3XA 3VYUB 2QQBA 1HDPA 3EQLF 3OYGA 3L2VA 4FQGA 4DQLA 2YUHA 3GQ7A 2Z16A 4WXCA 1GT0C 1V5EA 3DKWA 3LMMA 1UMQA 1ZQ3P 3BTLA 2MLGA 4A0ZA 1JB9A 3CP2A 1OHHA 3N90A 2BY1A 4LD5A 1D0ZA 2R7UA 2PBIA 4CCNA 1E2XA 1ZH5A 4QVJA 2DDBA 2NZMA 3W5UA 3ROUA 3U6KA 2FD5A 2QZ8A 4P25A 1HCRA 3H9QA 2AQEA 1R9TJ 4IEJA 3W2GA 1EWYA 2P4WA 4L9VA 1XG2A 4AC0A 4B09A 1PE9A 3JAMK 1W7PB 1LLWA 3CCUB 1HW1A 4LBVA 2HVRA 1VNDA 2NT6A 3R4KA 1MZBA 2EBIA 4IOCF 2VKHA 3L9FA 3FJOA 1G7SA 1XB2A 4HSTA 1I39A 1ZUNB 4LBYA 2L0KA 5EJCA 3TH0A 2JN6A 3CDIA 2K9QA 1YO5C 2ESHA 1KK0A 1PKVA 1Q1VA 1FIAA 1Y6IA 4G12A 1QUEA 2OBSA 4YAFA 2BBYA 3E20A 1KMHA 2GWRA 3KL9A 1CQXA 1JI8A 2NYXA 2DYIA 2LR8A 2K7LA 4XN0A 5EEAA 5FD6A 1QBJA 2ZZFA 3BH6B 4WWVA 3CJQB 3LA3A 3M7GA 4WXHA 3TEDA 3PUBA 2MH2A 3GEZA 1PUFB 1G4DA 1UFMA 1RKWA 2DEUA 3E0JB 4WZKA 5IP9J 2EFWA 1HXDA 3B90A 3SHFA 5GTHC 2UUZA 3S17J 3GX4X 5TR9A 1G3SA 3AVXA 4PJ0C 5C1EA 2A61A 2WY7Q 2UZKA 1R36A 1O3QA 3KLOA 4I0BA 1FYLA 1EFUA 1UCRA 4ENJA 3G05A 4EMSA 4WZEA 1KGSA 1H89C 1BN5A 4A0YA 2X0LA 2DXIA 5J4VA 3UNGC 3WWGA 2XF5A 1RNLA 2OAZA 2R7VA 4IZZA 1IG7A 2GK6A 3A1PA 3JW4A 2PIAA 4RAZA 2FOWA 2V1DA 2QE7A 3K0LA 4HX7A 3BR3A 5H6RA 2GJPA 2DYSH 3FKIJ 3JREA 2CW5A 2HCJB 3GCMA 4II3A 3WGIA 4XLFA 2NNYA 1B9NA 3A8IA 1SFUA 2EJRA 2Z6BD 2H6CA 1ZK8A 1S7AA 2VB6A 4G1VA 5JMCB 4B1RA 4Z6YA 1S7EA 1XG1A 3ONYA 1J09A 5DEQA 4PSXA 4EVIA 4GXOA 1ZGJA 2KFDA 2L54A 2ELHA 2PQ8A 2EPFA 4IF4A 2Q6IA 3I4PA 1BOAA 2CUZA 2ME6A 2XGEA 3H9NA 1SFXA 1XPXA 2XF6A 3ISXA 1HBXG 3BROA 5F64A 5L46A 4Y9RA 4C9YA 1HDDC 3B02A 4XORA 1BM9A 4I99C 1IRZA 1ELOA 2L9VA 4ZGQB 1OB0A 5FLMJ 2LREA 1TP4A 3R61A 4S0HB 1T33A 5IYBJ 4OPOA 1QZEA 2Y0SN 3RIQA 1P4XA 2OUMA 2VJIA 1VQNI 3PO3J 1FP1D 3KFWX 4EM2A 2GAUA 1AHDP 1XTAA 1U2RA 1WPKA 1HLVA 2Z33A 3E6DA 3C18A 1BI2A 4GFBA 2LMDA 4P9SA 4XRMA 1IHMA 4UZFA 5K5QA 4LBWA 2JTVA 3EUAA 2RNGA 1NJID 1XSDA 3FXKA 4FT8A 2KIMA 4B43A 5BPDA 4TMVA 3C2HA 4PCQA 4XLCA 1ZM2A 3VO1A 2XTYA 4DBQA 2F4NA 2DMTA 3HRSA 1R6RA 5J47A 3R6JA 2YU3A 4CHUA 3S14J 1I8DA 1R5HA 4M53A 3LWFA 4D7NA 2WY8Q 2R5ZA 1ENHA 3OYKA 1D8TA 4NBSA 1YOVB 2XTWA 1X1PA 1W7PD 4PSWA 2JA7J 1PP7U 3S1MJ 2BM7A 1ETWA 3PNTA 5LEKA 4AM3A 4QSHA 3V8KA 3F22A 1LE8A 3DDYA 3T8RA 4P5OA 4MLOA 4G7WA 2XTXA 3ZMDA 1G7TA 4NC7A 3O3KA 3S1NJ 2LZJA 1U0JA 4PZJA 1OGMX 2NNNA 3CD6I 2KISA 2Z5UA 3ZBTA 3A0HC 2EA2A 2GQFA 5EMNA 2O0VA 3FXUA 3CC7I 2JMWA 1YRNA 2ACJA 5FB2A 3OY9A 3L7WA 2OCCH 3QWLA 2FVGA 2W57A 5E79C 3OJXA 3G71B 3HSFA 2YS9A 2VE8A 1QNTA 2ZBKA 4G7XA 3IHUA 2XGXA 3TDUC 4F52A 3L2QA 1K4SA 1TT5B 1YRNB 1VQLB 2MABA 3FZVA 3P9IA 1QGZA 1Y0YA 3I56I 3Q39A 2RC5A 2XDVA 1VQ4I 2F5CA 1JTXA 3OZVA 2DO7A 3FK7A 3H3UA 3IC7A 4YZXA 3VSTA 4IO9F 3QYEA 2XROA 2HEOA 4P1VA 3GXOA 4U0YA 1XMXA 1FZPB 2JSCA 3QPSA 1CLWA 1DGWY 4X05A 2BE5F 3DLLF 3OYAA 2FBIA 1YG2A 1SKQA 4Z05A 3OYCA 1SM4A 1A31A 5BS6A 4J01A 3RYRA 3HG9A 1GV5A 1IN7A 4NB5A 2FMLA 2JJ7A 2YR2A 1O7FA 1S5LC 4XONA 3MKWB 2E1CA 2WPDA 4MYTA 5GV7A 3GZ5A 1B8IB 1QQ1A 2LF7A 2Q6OA 2HZDA 3CCVB 1IN8A 3FWEA 5F4JA 3HC7A 4DNCA 2QXZA 5D8LB 3ML6A 3BWGA 5TJJA 4A3LJ 2C6YA 4YIIA 2VODA 1V0EA 1S72I 4Q48A 2O61A 2H8WA 1K73D 2XPWA 3IWFA 3LSHA 3ZMUA 3LYCA 5LRSA 3GTLJ 5LEJA 3HOZJ 5AIPA 1QFJA 4KKSA 3HUGB 4KISA 1A5JA 2V7XA 3SEJA 1O8LA 1O8JA 4BEHB 5GV8A 1WORA 2E35A 2NV4A 5EYRA 1MKMA 2PMHA 2EIXA 1RR8C 4WCGA 1I50J 3MEXA 2JWTA 4RCYA 1USTA 5JLWA 4TT3A 4BU2A 3T51B 5E17F 4KDPA 1XB4A 4FASD 4F3QA 4I6ZA 3ASSA 4B3AA 1K4ZA 1R4NB 1TQIA 3HHHA 3A4CA 4ZYEA 3SZTA 3I55I 2ZCWA 3AG3H 3ELKA 4MXNA 5IT9Z 4Z4RA 1RPWA 4FX0A 3SY2A 2Q6LA 5E1XA 4M9SA 4L9JA 1IJWC 1JT6A 2W00A 2GXAA 2QWWA 2EFNA 1KQ5A 4CCJA 2BGIA 1N77A 1UELB 1W4MA 3CCRI 3ZOBA 1X3UA 3ECOA 4HSRA 2LRDA 2E34A 3PO2J 4FK8A 4RDKA 5BQTA 1MIJA 2R5YA 1XGOA 2LC2A 3G1OA 1PJ6A 2Y0MA 1ETVA 1T95A 2IS1A 5DM7F 1Y1WJ 3QOEA 4X7EA 4UB8C 1N0VC 2M0MA 5K5OA 2QDXA 2PYHA 2DK5A 5TY0A 1VQ9I 2VBZA 4ESFA 4HBLA 3A3GA 3E1YE 1VQOI 4B48A 2ZL5A 1LM1A 1E17A 2V7WA 2XB0X 2EWNA 3ASTA 2INVA 3OYMA 5K7FA 1DDGA 1U9NA 3CC2I 1NRKA 4UAJA 2E1NA 3VOEA 5IYCJ 4HW0A 5DS0A 4G6DA 2V9PA 2RQPA 3S16J 3DKYA 3S1RJ 1FNNA 3QU3A 3PQJA 3RY8A 3VMWA 3WTSC 1I1SA 3WU1B 2RAEA 1S3JA 4NUBA 2VQGA 2BY3A 1W7PA 2GXBA 2R4GA 1AMOA 4UZEA 4BEHA 3CP8A 4BJ6C 3OL4A 5ICFA 4KYWA 3CCJB 4GCVA 2R6HA 3E5UA 2YWEA 4AUXA 3GTQJ 1IN5A 1Z91A 1GXQA 2B7EA 3LOCA 3MQ0A 4OWRB 3RKYA 4PC3A 4NDLA 1X3ZB 1IRFA 3AVWA 2F5VA 1FMVA 4AYBN 5J1RA 2PJRB 1FBSA 2K4BA 4IVNA 3WG9A 3NAUA 3I64A 3PIPF 2XPVA 1SFKA 4M9XA 2CBXA 4B4CA 3F9KA 1MW7A 3F8NA 3MKLA 4Y4RA 2M4KA 3CCMI 2AHOA 5A88A 4WX9A 3L2CA 2DTRA 2R3SA 3L00A 3SEZA 1BR1A 4M3DA 2D5VA 1AOYA 1YI2I 5IYWA 2HGCA 3GTJJ 3OMYA 4L5EA 4CQJA 1HG8A 3PFIA 1AU7A 1DPRA 2DT7B 3IRQA 3BTIA 1N0UA 5B66C 1TW2A 1IV8A 2P6SA 2H09A 1JKQC 1TQPA 2OBPA 5D4SA 3FBIB 3W2AA 1J0RA 1TTYA 3FMQA 3NE5B 2COBA 1D1NA 2QGGA 1H8AC 2L7ZA 3V8JA 2HR3A 3PUNA 3CF5F 2QEXI 4BJ5C 1LVAA 1RUOA 5FO1A 1WXRA 3A0BC 3CJTB 2XSJC 4ASNA 3WTTC 4TMWA 1VHEA 1WTHD 3TP0A 4Y7NJ 4N4NB 4Y9UA 4R79A 4ZGNB 2PLYA 1LDDA 2DA1A 2XB5A 2Y9YA 1IF1A 3CLOA 3K10A 1ONVA 4XSXF 2IA0A 2M5WA 1YITI 1QPIA 3PJRA 5GAGJ 2VYQA 3FXOA 4M3EA 2AXLA 2DCEA 3M1CA 1WP6A 3I0TA 3WODF 5ILVA 1WOSA 1POGA 3OYDA 2IGNA 4B8XA 4LIUA 2HPMA 2OBRA 3ABKH 2A68F 4Y15A 1O8FA 1ZAOA 2QGUA 3PNYA 3G73A 3HOVJ 5F4MA 1MBKA 4BY7J 2O03A 4G6QA 2WB1A 3RYPA 1P4MA 2VBSA 3LQ6A 3TO7A 2BXYA 4N4OB 3GF2A 4R71A 2O0WA 5J8CA 2WAFA 3OYHA 3FXQA 2ZB9A 1K78A 5EGOB 2GREA 1EA0A 4OOXA 3HOYJ 5JVTA 1YLOA 2CWEA 3IP4B 1G59A 1RRJA 2IW5A 3OAAA 3KEOA 3HJEA 5M3MJ 1KU7A 3OIOA 3KIOA 2R7QA 5EDNA 1A8PA 2LOOA 2TRTA 1PUFA 5E3MA 1OFMA 4HQMA 4P9UA 1B59A 2JQ7A 3ZZUA 2HNHA 2KRHA 4KT6A 4TV7A 1PXZA 2CJJA 1YFHA 1CF7A 3W2EA 4BQNA 2VBUA 3G1LA 4ZTFA 2D1VA 2XRNA 1LFUP 4ROXA 1YJ9B 1MMNA 4G94A 2XNJA 4Z4UA 1JE8A 1KU9A 2L01A 4DYQA 1R00A 1UB9A 3WE3A 4XQFA 4C2TA 3A35A 2BMWA 1TWAJ 1U5TA 4GYIA 4L5IA 1NDHA 3ULQB 2D2WA 4OU0A 3CMMA 2QQAA 2M9HA 1OMIA 2B0LA 2RV8A 3T1BA 4IW3B 1FJLA 4HRIA 1QZZA 1KCCA 4MTEA 2MG4A 3OJWA 2DA7A 4OAZA 2XZOA 4N0BA 1D0XA 4JYKA 1WJFA 2BW3B 2CK3A 1QH0A 2Z1DA 1Y8QB 2H8RA 1M1EB 2VJ4A 3JRFA 4P26A 4H4KC 5CDFA 1VQ9B 3Q0WA 4XNFA 1VQKB 3I58A 5HLIA 1GDTA 1QA3A 2K40A 3J7YJ 2JPBA 1YE9A 4E7KA 3JRBA 3S3MA 5HLHA 4MTDA 2XZLA 2FMYA 2IPQX 1W35A 5LGTA 3AFHA
chains in the Genus database with same CATH topology
4II2A 2ZFUA 3BH4A 3VYRB 2R7RA 3GVKA 1WJ5A 4DJAA 3NWSA 5C1CA 3S3OA 1MMGA 3J7AY 2X53S 1O88A 4GQNA 2IXSA 2OV7A 4DNRB 3H5AA 4NQWB 4XLHA 4U87A 4W8SA 1UD5A 4W8TA 2PJRA 2HLDA 2ZZEA 2D3NA 4LIVA 4D9JA 3T56B 3SYTA 1N75A 2W7NA 2E1MC 2LY1A 5HKKA 3W3CA 2NTQA 3OS1A 2E5ZA 2ZZGA 3H0DA 3AL0B 3OWTA 1TZLA 3FDYA 3ZPNA 3VYTB 5KCMA 3L2WA 2XF7A 4EATA 3HKZA 4YRVA 2CV1A 1NBMA 4B3XA 1K6YA 2AQFA 3HL2A 4YELA 3VYUB 3S8PA 3FHNA 3HXLA 3OR1C 3OYGA 3L2VA 2KZVA 4OJ6A 1E3XA 3GQ7A 2Z16A 1V5EA 3LMMA 4C30A 1OHHA 1AA7A 3CP2A 2PMZA 3RQ4A 1D0ZA 4AU7A 2R7UA 4Y33A 1KTWA 4KJZA 2EWEA 4BACA 4CCNA 4YXWA 3CZ6A 5CQGA 5HVQC 1Z21A 2NZMA 2UV1A 1QHHD 2ZSHB 4DK0A 2VBKA 3UW0A 2R9VA 3VSVA 3SUCA 3BCBA 1X4PA 3H9QA 2VJ5A 2AQEA 3S3NA 3IUOA 3H9JA 4RLFA 2IS6A 2NSTA 1XG2A 1PE9A 2Z2SB 1UD2A 2L7KA 4BJTA 2HVRA 3WQZA 2NOJB 4ZC3A 4OAYA 2VKDA 3OYBA 2NT6A 2ZTNA 4CZCA 3OOCA 2VKHA 5HNFA 4E7HA 4HSTA 4HEA2 1NHCA 3BC8A 1PKVA 3FPPA 3DWLE 1Y6IA 3EQNA 2R7SA 2Q1ZB 2DIEA 1NG7A 1BMFA 1KMHA 2WSSA 2CW7A 4ZDPA 2O04A 1UG0A 1H8EA 1JI8A 4XN0A 1DGRM 3HPGA 3AKZA 3NWTA 4Z1MA 4U4BA 2OC6A 2LG4A 4YEJA 3RSNA 2ZZFA 3CJQB 5HLTA 3GQBA 1OOCA 3PUBA 2F43A 3HPHA 3K4CA 4ASUA 1IA5A 2IS2A 2XNDA 4NC8A 3E0JB 2PECA 4I84A 1D1BA 2E5NA 4BGDA 3C2GA 3B90A 3E1SA 3A3BA 2XGJA 2VPLA 3L2RA 2UUZA 3OIPA 1AIRA 3EUKL 1SAUA 3N05A 1IDJA 1HA8A 3S32A 1T5EA 5C1EA 2WY7Q 4PFOA 4XOTA 3G2BA 3G05A 3VDXA 2O17A 1MABA 3DPUA 3MKZA 4XKWA 1V0FA 4BDZA 3OEEA 2ZXIA 2DXIA 3UNGC 3WWGA 2XF5A 1H8HA 2R7VA 3ZIAA 4IZZA 2GK6A 2HVSA 4ITVA 2QE7A 3KRGA 2GJPA 4II3A 4B3FX 4XLFA 2Z6BD 3FBNB 1KZLA 2VB6A 4XKBA 2JDIA 1MMAA 2M7BA 3SDBA 1J09A 2BVLA 1GQ8A 4PSXA 2K3PA 2Z8GA 1E1RA 1CZFA 1YX3A 1W0KA 3K4MA 5KHDA 1IDKA 1IB4A 2CUZA 3K4NA 4BL0B 4HNUA 2XF6A 2NSPA 3K4JA 4EW9A 1DQUA 4NK6A 3BCDA 4C9YA 3ZPPA 2WZPP 1Z3YA 4XORA 2WBMA 2LH9A 1OB0A 2K5CA 2PYGA 2LREA 3U21A 3GQAA 1LKXA 3V42A 2OUMA 2VJIA 3DLAA 4BQOA 4E7LA 3LSMA 5JHFA 3MMYB 2W82A 3MD2A 4B44A 3T53B 2L5QA 3W2VA 2VBMA 4C2UA 3EQOA 2X3HA 2K9LA 1X1DA 1W36D 4E0FA 2VL8A 4HG2A 3BC9A 3H5NA 3EUAA 2LBFA 2RNGA 4XR6A 2WAEA 3OS2A 2QKLB 3GVLA 2ZSIB 2HU9A 4DGWB 3MKYB 1N78A 4B43A 3FKSA 3TBIA 3C2HA 4XLCA 3B8YA 3W2WA 4DBQA 4HWVA 3PNVA 4U49A 2W6IA 1R6RA 1I8DA 2CUJA 3ZGKA 2WY8Q 3I3LA 2L9NA 1I18A 1BLIA 2GJKA 4CCKA 2HVQA 2KP6A 4ZDOA 3OYKA 2VIXA 4C2LA 2CS3A 3KX2A 4TKOB 3OYNA 4OJOA 4DIQA 1RMGA 1K28D 4PSWA 5CPRB 1WJDA 4ZJZA 4D1QA 1ERDA 3ZQQA 3PNTA 3BLYA 2F6CA 2O5RA 3D5RC 2V7QA 2KDOA 3KYLA 3H94A 3DDYA 4P5OA 2X6YA 2KMUA 2CV0A 4MLOA 3L2UA 3VWBA 2ELJA 1O8GA 1LVKA 4G7WA 4NC7A 2HDWA 2V9KA 3K4KA 1U0JA 2LZJA 1OGMX 2BOLA 1VF7A 1LDKB 4PJNA 5LD2C 3LMWA 1D0YA 1O8DA 1H80A 2O0VA 3DU6A 3OY9A 2VJJA 1ZELA 1O8IA 2IQ7A 2JVGA 2LY2A 2CV2A 2DOAA 4G7XA 3L2QA 4F52A 2LYCA 2K9MA 2QKMB 4JMQA 3LL7A 2MABA 1EE6A 3VYSB 3OPOA 2KRCA 1NG6A 3K4LA 3DEEA 2XDVA 5FRMA 1TT0A 3OL3A 3VSUA 2V31A 4XD7A 4YZXA 4G6TB 3VSTA 3QYEA 4XKVA 4CSWA 2BVMA 3BCAA 2L2OA 2V4DA 1IRXA 2A5WA 2M3AA 4PK4A 2GJRA 2JJ2A 1DGWY 3DU5A 4DBRA 2X8KA 1VJSA 2IGMA 3OYAA 3JURA 2VBEA 4Z05A 3OYCA 1BN8A 4J01A 3HG9A 2NTPA 2QY1A 4OJPA 3MKWB 3SZGA 2WPDA 1UD6A 4XONA 4B47A 3GBGA 2X6WA 3ONQA 4XM3A 3CJRB 2HZDA 1BOBA 4XKCA 4IX7A 4IQJA 3OEHA 4G6IA 4DK1A 2XZPA 3IAS2 3HC7A 2GOXB 5AMVA 3K6GA 4RMNA 2QXZA 1WJCA 2JA2A 4HPQA 2XAUA 3EUHC 1DBOA 3DTIA 1X1BA 1V0EA 4YZ0A 3JU4A 1HVXA 3QODA 1JTAA 2VQCA 3H35A 3LSHA 1X0CA 2MYSA 3QYBA 4FETA 1JRGA 3BCFA 4CA0A 4KKSA 3HUGB 2L9SA 4KISA 3PL8A 3KEWA 1K5CA 1MMDA 2V1NA 4PFPA 4XLEA 4Z06A 1O8LA 1O8JA 4BEHB 2W1OA 4PJMA 5DN6A 2BSPA 2V26A 1GLNA 4P1WA 4AYBA 1X19A 3D5LA 1W0JA 4XOPA 4TT3A 3T51B 4BU2A 4ZDLA 1FX0A 4FASD 4F3QA 4IKFA 1WJBA 2XC7A 2ODLA 1VLYA 1MNEA 2IGOA 2KLOA 3A4CA 2DT6A 4ZYAA 4ZTJA 3VR6A 4MXNA 2KQRA 3HOSA 2WADA 2VLAA 1UD3A 4L8JA 3QYFA 3VSKA 3LNNA 2MFZA 2W00A 3UR3C 4PJJA 4CCJA 5CKTA 1E3ZA 2BW3A 4TSFA 1N77A 3VSLA 4JQFA 1PLUA 1UELB 1OLTA 2ZZQA 4HSRA 4CCOA 2R7TA 2LRDA 4UZUA 2O1DA 2CMPA 4YZQA 4W8RA 2X1EA 3RPUD 4F55A 1X4OA 2LC2A 3ZR8X 1WJAA 1T95A 1KONA 3LFUA 2IS1A 3TL4X 4CCMA 2R7XA 1W9XA 4YZAA 3T9GA 3QOEA 2M0MA 2R7WA 3OYEA 2KVOA 2KL4A 4RLQA 2PYHA 3VMVA 4F93B 2RQQA 3A3GA 1QCXA 3ZSCA 4B48A 1LFPA 1UAAA 2A6TA 1X1AA 3DTEA 2INVA 3OYMA 2X51A 1G8XA 4E4HA 1RWRA 2X1DA 4XL9A 4F91B 3CF2A 1NRKA 4BDYA 3TMOA 3ZCOA 4XN3A 4QPQA 1E43A 3DKYA 3RCOA 2M5SA 4W8QA 3VMWA 4NUBA 2VQGA 3H5RA 1OFLA 4PJLA 4HIZA 4DNTB 2R4GA 2UVEA 4BEHA 3CP8A 4Y3OA 4BJ6C 1E0EA 3OL4A 1WJEA 1Z3XA 4RM2A 2IGKA 1O8MA 1COWA 2V6EA 2GOMA 4OWRB 3GQ9A 3LSGA 3K4BA 4CH7A 1QU3A 3EPZA 2Q2EB 4U7BA 2F5VA 1FMVA 1Y56A 4XMYA 1T0FC 1O8KA 2PJRB 1EA3A 2UWMA 1BR2A 2JSPA 2CH0A 2LBFB 5FROA 5HOOA 1SFKA 4LITA 4XLAA 5HNHA 3LSIA 4BE2A 3LSKA 4URRA 3F9KA 1MW7A 3DPLC 2V4JC 4FXUA 4Y4RA 2M4KA 4MR0A 2CFOA 3PSIA 3K70D 4NNJA 1VZ0A 3SEZA 2ZTGA 2VXZA 2X85A 1BR1A 3OE7A 3A1YA 3FKJA 2NT9A 1KCDA 3OMYA 2FUG2 1HG8A 3OYFA 4PMHA 2DT7B 2JUGA 1VBLA 3DTKA 4PUSA 2HQAA 3FBIB 3W2AA 1SKYB 3NE5B 1WMRA 3OYJA 4RM3A 3M8JA 4HNTA 4KKUA 4E7IA 4E6KG 4QPOA 4X0GA 1BR4A 2I8DA 4BJ5C 3D5SC 3KEYA 2F1MA 4J00A 4JOMA 3K70C 2XSJC 1BPLA 2JJ1A 3HOTA 1PJRA 4Z03A 1WTHD 4OJ5A 3GRHA 4N4NB 3FY3A 4R79A 4AVZA 4OZZA 5FRNA 3GQ8A 3K10A 1UD8A 3PJRA 1RU4A 2DCEA 4GRIA 3M1CA 1WPCA 1WP6A 2P0WA 2W6JA 2JVHA 1QHGA 3OYDA 2IGNA 2HPMA 4LIUA 1O8FA 1V5FA 1O8EA 3PNYA 2F4IA 1S9HA 2R7OA 1W36C 1HZEA 2WB1A 2D3LA 1D1CA 1BHEA 4N4OB 3DPTA 2W4SA 2MC4A 2X6XA 4BXFA 1YX5A 3B4NA 4E7SA 4OJLA 4BUPA 1P9QC 2O0WA 2DJIA 2WAFA 3OYHA 1DP3A 4KITB 5KNLA 4KKTA 2V7FA 4BE0A 2E1BA 1Z7LA 3IP4B 3ZRGA 1G59A 3OAAA 3IAM2 3OIQA 3OW7A 3OYIA 2R7QA 2WJYA 3GVJA 1E1QA 2M4GA 2IS4A 2LOOA 1V5GA 2WA0A 2CW8A 1X1CA 5LFAA 1MNDA 1EFRA 1OFMA 4CCLA 2X1CA 3OFNA 2NTBA 5IK2A 4E7JA 4DOZA 5TGTA 1E79A 2HNHA 2KRHA 4F92B 1QJVA 4KT6A 1PXZA 3RTRA 1DBGA 2VXDA 3OOUA 2XOKA 2JIZA 3PFYA 4BQNA 2E1MB 2RREA 2E60A 4BE1A 4ZTFA 3DKXA 3I9V2 5CQEA 3HAGA 1MMNA 1O8HA 2KHMA 3AL0C 4XQFA 3OR2C 4BQQA 3PSFA 3ZXSA 4C2TA 2KPMA 2WAQA 1UD4A 3OYLA 3A35A 2UVFA 1FMWA 2GK7A 2WJVA 3DQVC 2MD0A 3SEQA 3CMMA 2VASA 1OGOX 4HRIA 4OZYA 3A2KA 1KCCA 4NK8A 3CESA 5FL7A 1WFXA 3BG6A 4OAZA 2VQHA 2XZOA 2HPIA 1D0XA 2QX3A 1WJFA 2BW3B 4E7ZA 2CK3A 3OS0A 4P22A 2Z1DA 3S93A 2Y0SA 1OR7C 1D1AA 2VJ4A 4H4KC 5CDFA 1PYVA 3H9GA 4XNFA 4ANJA 4CUGA 4B3GA 2VQLA 2M7AA 1YE9A 4E7KA 4BS9A 3S3MA 2XZLA 4LG3A 2INUA 2ZXHA 3BG7A 4IQ4A 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR0 A;  4XLF A;  4XM3 A;  2X85 A;  5C1C A;  1GQ8 A;  2NT9 A;  5AMV A;  2QXZ A;  1KCD A;  1O88 A;  2Z8G A;  1HG8 A;  1CZF A;  1DBO A;  4YZ0 A;  4PMH A;  4XLH A;  1IDK A;  4W8S A;  1VBL A;  1IB4 A;  4W8T A;  1JTA A;  1WMR A;  1X0C A;  2NSP A;  4EW9 A;  4NK6 A;  1JRG A;  3ZPP A;  2NTQ A;  4XOR A;  1K5C A;  4Z06 A;  4XLE A;  1O8L A;  1O8J A;  4Z03 A;  2PYG A;  4OJ5 A;  3GRH A;  3FY3 A;  3GQA A;  2BSP A;  4AVZ A;  4OZZ A;  3GQ8 A;  4XOP A;  2VJI A;  4YEL A;  1RU4 A;  4OJ6 A;  2VBM A;  2ODL A;  3EQO A;  3GQ7 A;  2X3H A;  1O8F A;  1O8E A;  1KTW A;  4MXN A;  4XR6 A;  2EWE A;  1BHE A;  2NZM A;  2X6X A;  2VBK A;  4XLC A;  4OJL A;  3B4N A;  3B8Y A;  4U49 A;  4HWV A;  3UW0 A;  2O0W A;  3SUC A;  3VSV A;  1PLU A;  4C2L A;  2NST A;  1XG2 A;  2O1D A;  4YZQ A;  1PE9 A;  4W8R A;  4OJO A;  1RMG A;  4YZA A;  3T9G A;  2NT6 A;  1OFM A;  2NTB A;  2PYH A;  1QJV A;  3VMV A;  1NHC A;  2X6Y A;  1QCX A;  1O8G A;  1PXZ A;  1DBG A;  3ZSC A;  3EQN A;  2INV A;  2O04 A;  1OGM X;  4XN0 A;  3LMW A;  1RWR A;  4U4B A;  4XL9 A;  1O8D A;  1H80 A;  4YEJ A;  1O8H A;  2O0V A;  4XQF A;  2UVF A;  4XN3 A;  2VJJ A;  1O8I A;  2IQ7 A;  1OOC A;  1IA5 A;  4W8Q A;  3VMW A;  2PEC A;  4I84 A;  3B90 A;  1EE6 A;  1OFL A;  1OGO X;  2UVE A;  4OZY A;  1AIR A;  1KCC A;  3VSU A;  1IDJ A;  4NK8 A;  5C1E A;  4YZX A;  3VST A;  4XOT A;  1O8M A;  2QX3 A;  4XKV A;  2O17 A;  3GQ9 A;  4XKW A;  3WWG A;  1O8K A;  4XMY A;  4XNF A;  3JUR A;  2VBE A;  4Z05 A;  4XLA A;  1BN8 A;  2NTP A;  2QY1 A;  3KRG A;  4OJP A;  4URR A;  2INU A;  4XON A;  2X6W A; 
#chains in the Genus database with same CATH topology
 3MAJ A;  3SQN A;  3ZQG A;  2CF4 A;  4P2N A;  2ZFU A;  3BH4 A;  1QA2 A;  3GVK A;  1TSP A;  2V7U A;  5C1C A;  5HDG A;  5E3O A;  1YIJ I;  1BC7 C;  3J7A Y;  2ZL6 A;  3J80 K;  3OZW A;  5ILS A;  1WU8 A;  4YIR X;  1T8I A;  2OTL B;  4NQW B;  1R5N A;  1BI3 A;  1DPU A;  3W6K B;  2ZZE A;  2JZY A;  4XRS A;  4EQQ A;  4QTR A;  5DUK A;  2IRF G;  2EZK A;  3WTW C;  3PVD A;  2IVM A;  4HQE A;  2W7N A;  2E1M C;  1TWC J;  3HRT A;  1ZM3 A;  1ZG5 A;  2NTQ A;  2QYO A;  3WTZ A;  1IN4 A;  3TW6 A;  3M1E A;  1U3E M;  1N07 A;  3BR1 A;  2YWH A;  3BDD A;  4EAT A;  3CCS I;  5JFR A;  2CV1 A;  3ZMV A;  1UD3 A;  2FXA A;  5TV2 A;  4YEL A;  2RNJ A;  4OJ6 A;  3OW2 B;  2KZV A;  1OCR H;  4PGG A;  5E1W A;  4H0E A;  3I54 A;  3CCM B;  2VKE A;  3CC4 B;  4C30 A;  4AIK A;  4YCQ A;  4RAG A;  1AA7 A;  2F2E A;  4M3B A;  3TW7 A;  2PMZ A;  2HOS A;  1FOY A;  4QWQ A;  1XFO A;  1XQB A;  3RQ4 A;  2JK3 A;  1BA5 A;  1GXP A;  2EWE A;  5FKK A;  1RZ4 A;  1MH3 A;  2FRH A;  5CQG A;  2H94 A;  5BSY A;  3HSR A;  2UV1 A;  3BJ6 A;  5EG0 B;  3UW0 A;  3QPL A;  1JKP C;  3SUC A;  3BCB A;  1Q82 D;  5F0H A;  2QEN A;  4YFN F;  3S3N A;  4UNO A;  2VE9 A;  4LK0 F;  3JQR A;  3KP4 A;  4M1K A;  1K8F A;  1TLH B;  3SZP A;  2R92 J;  4RD0 A;  4QHY A;  4BHB A;  2EIK H;  2QA4 I;  2L7K A;  4BJT A;  3O8H A;  4DYR A;  2NOJ B;  3OYB A;  2ME0 A;  4PC2 A;  1U8R A;  4CZC A;  3PQK A;  3MZY A;  1MD0 A;  2WC2 A;  5HNF A;  1VTN C;  1VQ7 B;  1JXS A;  2G7U A;  3ZQL A;  4HEA 2;  1NHC A;  2L3D A;  1ZLJ A;  1WVR A;  4M9Z A;  2NVT J;  1YIO A;  2R7S A;  2Q1Z B;  3CCE B;  3ZZT A;  2WSS A;  2QVO A;  4ZDP A;  1T2K A;  1H8E A;  2O04 A;  2ZJP F;  3RKQ A;  5HXB A;  3ZQ7 A;  4IHW A;  3HPG A;  4M71 A;  3CMA I;  3HEF A;  1JKO C;  4RD2 A;  4DZP A;  3Q9S A;  5FLV A;  2LG4 A;  4W1U A;  4O3M A;  3JRC A;  2DK8 A;  3P27 A;  3HPH A;  4AF6 A;  1IA5 A;  1FDR A;  1VQM I;  1B23 P;  2J8K A;  2MW8 A;  4I84 A;  4BGD A;  1Q7Y D;  3A3B A;  4FE4 A;  4MHG A;  3L2R A;  2DT5 A;  3OIP A;  3IWZ A;  3N05 A;  5IT3 A;  1T5E A;  4OIR F;  5K5R A;  2IA2 A;  5GAD J;  1ETY A;  4XOT A;  4FWT A;  4UUS A;  1IDY A;  2CO5 A;  1R7J A;  2EZI A;  3DPU A;  4I09 A;  1YS6 A;  4XKW A;  1ON1 A;  3MKZ A;  1YTY A;  2RVC A;  3CO6 C;  1WSV A;  2DOE A;  2OQG A;  1H8H A;  2L4M A;  3ZIA A;  4XLN F;  5DD4 A;  2V7V A;  4TMX A;  4L5J A;  1TNT A;  3RPU A;  5DM6 F;  1WI9 A;  3CC7 B;  3QPH A;  2EFQ A;  1S8N A;  4N9I A;  3TOB A;  1PVE A;  5GAE J;  2QQ8 A;  4HZF A;  3S2H J;  3SDB A;  1GQ8 A;  2BVL A;  4KFC A;  1XD7 A;  2K3P A;  3Q6Q A;  2IBD A;  3IL2 A;  3HZJ A;  4BKX A;  4PC1 A;  3ZUG A;  1CZF A;  1W0K A;  2XAQ A;  5FLX Z;  5CVJ A;  3S2D J;  4HNU A;  4WXD A;  4ZH4 F;  1EP2 B;  1E62 A;  4P9F A;  2TDX A;  4LJZ F;  3J81 Z;  4IRI A;  2CW0 F;  3QFR A;  4NK6 A;  3BCD A;  2BM6 A;  1J9Z A;  4HF2 A;  1SAN A;  1OFC X;  2BZT A;  1VQK I;  3NEU A;  3CCU I;  1SFE A;  2K27 A;  4UVA A;  5JI6 A;  4LLG F;  2Z9O A;  4NHJ A;  1BI0 A;  2ZNZ A;  3DLA A;  4BQO A;  4RDU A;  3LSM A;  1OJL A;  2DA3 A;  1FY7 A;  3MMY B;  5JHF A;  4E7L A;  1NK3 P;  3W2V A;  1IUF A;  5FD5 A;  2X3H A;  3TQN A;  1X1D A;  2EIM H;  2EH3 A;  4E0F A;  1H85 A;  2DDA A;  2IAI A;  2OF7 A;  4HG2 A;  2DPU A;  2A3S A;  2LLK A;  1I3A A;  3MWM A;  1FYK A;  1N25 A;  2OTL I;  3CPX A;  4C2M J;  4ON0 A;  2X6O A;  3K9T A;  3I3L A;  2L9N A;  1I18 A;  2QQ9 A;  1LQ1 A;  2GJK A;  4ZDO A;  1KU3 A;  2VN2 A;  2VIX A;  4HAM A;  5DCF A;  3BY6 A;  3IH2 A;  5F6F A;  5GPA A;  4G7O F;  1W5C C;  1K8A D;  3OYN A;  1A6Q A;  4XSZ F;  5IT9 K;  4ENK A;  2RC6 A;  1RMG A;  3JQP A;  4I0A A;  3T0Y A;  5CPR B;  1A36 A;  1U5T C;  1Q86 D;  4X1E A;  5DSZ A;  2DTZ A;  1ERD A;  2L7F P;  3ZQQ A;  4FTH A;  3BLY A;  2F6C A;  1W0T A;  1BC8 C;  3CLQ A;  3KP7 A;  5FGM A;  2XV4 S;  3LNQ A;  1PDN C;  2ELJ A;  4IHY A;  3F21 A;  4KN4 X;  3BG5 A;  3P5J A;  5CVR A;  5EF6 A;  4ZCM A;  1LDK B;  1YW9 A;  5LD2 C;  2X48 A;  3LMW A;  4Z4Z A;  4OMZ A;  2R7Z J;  4A3C J;  2VFP A;  4P3Y A;  1H80 A;  3RIR A;  3CQZ J;  3DU6 A;  1V54 H;  3FM5 A;  2QZA A;  1FOK A;  3W6J B;  4U0W A;  3DBH B;  2IQ7 A;  4U9U A;  2LY2 A;  2CV2 A;  5D5V B;  3DEU A;  1BJZ A;  2K9M A;  4KIB A;  3LL7 A;  3OSF A;  5FKO A;  1DP7 P;  3K2Z A;  3VYS B;  3OPO A;  4D0P A;  2QTL A;  1R23 A;  2KRC A;  3K4L A;  4JX6 A;  3JRG A;  2C5B A;  1Z9C A;  3DEE A;  1ZAR A;  3IKV A;  2QA4 B;  3BH7 B;  5J1Y A;  1JT0 A;  1QVG B;  1KZH A;  2V31 A;  3F8C A;  3Q3S A;  3QE2 A;  3H3Z A;  2O6W A;  4EM0 B;  2BVM A;  3FXM A;  2HXO A;  4HNV A;  2V4D A;  4PK4 A;  2A5W A;  2M3A A;  2PG4 A;  2QMU A;  4A3F J;  3DU5 A;  1LE8 B;  2X8K A;  4KIG A;  2MA3 A;  2FX0 A;  2FNP A;  4KN7 X;  3JUR A;  1MH4 A;  1O3R A;  1VQP B;  4X06 A;  5L3B A;  2VFO A;  1OYY A;  1GVD A;  2A5Y B;  1GV2 A;  4ETS A;  3JRD A;  1XCB A;  1YQA A;  3GBG A;  3JCU C;  1RUN A;  1Y0R A;  1BIA A;  2M8E A;  2OD5 A;  3CJR B;  4XM3 A;  1F5T A;  3G4S B;  4V2G A;  1K78 B;  1BX0 A;  3OEH A;  4DK1 A;  4LC0 A;  1Z1D A;  2GOX B;  5AMV A;  3DP7 A;  3C3W A;  3T8T A;  1WJC A;  2JA2 A;  5J3O A;  1FOW A;  4V2F A;  2CRV A;  4HPQ A;  4JK1 X;  2DI3 A;  3DTI A;  4YZ0 A;  1REP C;  5CVI A;  2PFB A;  1LEB A;  1EFC A;  1I6X A;  2DU9 A;  1HVX A;  1T98 A;  1GAQ A;  4KUM A;  1JTA A;  2VQC A;  2XAF A;  4IHS A;  2E71 A;  3WBJ A;  1SMT A;  1JJ8 C;  2X9D A;  3QYB A;  1JGG A;  2DMQ A;  3CO7 C;  5IYN A;  4CA0 A;  2O8K A;  3WG7 H;  4P12 A;  3PM1 A;  3KEW A;  1T38 A;  3ZZ0 A;  1MMD A;  5A2Q Z;  1K5C A;  2W1O A;  4PJM A;  1B4A A;  5IY5 H;  3LSP A;  1W87 A;  2BSP A;  2OJE D;  4P1W A;  5BNG A;  1F43 A;  4G1B A;  2YWG A;  2Z99 A;  3JSO A;  4ZDL A;  1U78 A;  1JGS A;  5DUI A;  1WJB A;  3AGP A;  2ZJ2 A;  4KMF A;  4ACB A;  3WU2 C;  3RJP A;  4ZYA A;  4ZTJ A;  1VQ6 I;  1FBQ A;  4L18 B;  3HHG A;  2KT0 A;  2WAD A;  3HOS A;  1U2W A;  2VLA A;  4RD3 A;  2X3U A;  4X07 A;  2ETH A;  5D4R A;  3IRR A;  4PJJ A;  2STW A;  1YX2 A;  5CKT A;  3G71 I;  2BW3 A;  1E3Z A;  5HS8 A;  1R5I D;  1RC9 A;  3GME A;  3MCA A;  4JQF A;  2ZBV A;  1MDM A;  2GZW A;  2OQR A;  4ESB A;  2CQ7 A;  2HZT A;  2CMP A;  4YZQ A;  4D7M A;  4BHP A;  1VQ4 B;  5KAF C;  3JRH A;  2LTP A;  1WJA A;  3A03 A;  4A6D A;  4CCM A;  2BPO A;  4GGG A;  1KU2 A;  1YIT B;  2KL4 A;  4RLQ A;  2RQQ A;  1QCX A;  1XMA A;  1KQ0 A;  5J1U A;  2ADU A;  1QRC A;  1A04 A;  3CCL I;  1LFP A;  2A6T A;  1X1A A;  3DTE A;  1Z6T A;  2X51 A;  3QOP A;  2F3L A;  2X1D A;  3LAP A;  5DTD A;  3CF2 A;  4BXU A;  3LVB A;  2FA5 A;  1PJ7 A;  4QPQ A;  2M2E A;  1AWC A;  1E43 A;  4OIP F;  3CCQ I;  3RCO A;  1DUX C;  1D2E A;  1N06 A;  1QQI A;  2HXI A;  1EXM A;  5C3E J;  3WYA A;  3GLL A;  4WF2 A;  4O5V A;  5HLG A;  3H5R A;  2WV1 A;  1KJZ A;  4OM9 A;  3RQI A;  1IXS B;  2QUF A;  4UV9 A;  1E0E A;  3PEN A;  2F5F A;  1V55 H;  4UY8 I;  1MBE A;  4N3N A;  3JRA A;  4RM2 A;  2GLO A;  2DMN A;  1WOP A;  1O8M A;  1IZ1 A;  1BL0 A;  4KNY A;  2V6E A;  3HGY A;  3AG1 H;  2L4A A;  1TYX A;  3EUH A;  3K4B A;  4IRG A;  1QU3 A;  2HOT A;  2VBT A;  4BY1 J;  4XMY A;  1NK2 P;  2HQ5 A;  4RCZ A;  3HKZ N;  2UWM A;  1BR2 A;  1XDU A;  2CH0 A;  5HOO A;  4OIQ F;  1IJF A;  2B7C A;  3GUD A;  4E70 A;  5HNH A;  1QRB A;  2LDU A;  3CDH A;  3VFZ A;  3VNV A;  1TYV A;  1WWX A;  4FIS A;  2MLK A;  4DQK A;  4FXU A;  1G7C A;  2NVQ J;  4QVA A;  2QSH X;  3WBK A;  4MR0 A;  3PSI A;  3K70 D;  2DOG A;  1VZ0 A;  3DEW A;  3ISP A;  2CFX A;  3J80 Z;  1E3O C;  1OFD A;  1VQ8 I;  3HOW J;  3FKJ A;  1KCD A;  1XS9 A;  3KLN A;  2OA4 A;  2OYN A;  1OCO H;  1ZGW A;  1DG1 G;  4MYU A;  4LG0 A;  4AVP A;  3JSP A;  4PMH A;  2JA6 J;  3DTK A;  2H1L A;  3ZC3 A;  3SXY A;  2WTE A;  2UXX A;  2MD5 A;  3ZN0 A;  4ZV4 A;  1WMR A;  3M8J A;  2F4O B;  5CJ9 A;  2GPJ A;  5AN9 A;  1BR4 A;  2EQR A;  2I8D A;  1QPM A;  3BR2 A;  1B1B A;  3D5S C;  3KEY A;  3MZH A;  1MJA A;  4J00 A;  2HDC A;  2EV5 A;  1BPL A;  4KA4 A;  4Z03 A;  1GVH A;  4Q47 A;  5E3L A;  4G8X A;  5DD8 A;  5IYR A;  3GRH A;  2GBY A;  4AVZ A;  4X8I A;  4OZZ A;  1VQL I;  5FRN A;  3ABL H;  3L1P A;  2HWV A;  3BPX A;  1W5S A;  2ID6 A;  3GQ8 A;  4PC6 A;  3GVA A;  1G3Y A;  5LGN A;  5JHU A;  2W6J A;  2JVH A;  1VQO B;  1QHG A;  1CNF A;  3K69 A;  4DZJ A;  2C4U A;  1TUI A;  1O8E A;  3LA2 A;  4M3G A;  5A89 A;  3I1F A;  4RJL A;  1M90 D;  2LKP A;  2P7V B;  2R7O A;  4RLZ A;  5EGO A;  3M8F A;  3TKY A;  2J7K A;  2NS0 A;  1BHE A;  2W4S A;  2MC4 A;  2X6X A;  3HYI A;  4OJL A;  1YX5 A;  4W97 A;  1JUS A;  4BUP A;  2BM5 A;  4HE5 A;  1TLL A;  3ZQI A;  5EG0 A;  2VFN A;  1L1I A;  2W24 A;  2B63 J;  4X6A J;  1UMK A;  2A6H F;  1FTT A;  3J7A O;  1FP2 A;  5CVU A;  1G6N A;  3IAM 2;  3OIQ A;  4JX5 A;  1HKT A;  4CYD A;  2HQN A;  1B72 A;  1SVM A;  3OW7 A;  3OZU A;  2HDN B;  3GVJ A;  3BPV A;  3D0S A;  3KET A;  2E2H J;  2M4G A;  2WJY A;  2IS4 A;  1V5G A;  1N08 A;  4BQA A;  3GO5 A;  3GSI A;  1X1C A;  1MND A;  4BNC A;  1EFR A;  5HDK A;  4CCL A;  5IK2 A;  3M8E A;  4RD1 A;  4EM1 A;  2XGD A;  2PEX A;  4HYE A;  1E79 A;  1WQ2 A;  3LQR A;  3OKX A;  2JIZ A;  4C43 A;  1P7J A;  2E1M B;  2RRE A;  1EFT A;  1QO0 D;  4HDU A;  3M9A A;  4ESJ A;  3HAG A;  4N9H A;  1B9M A;  3K1N A;  3AL0 C;  3BQY A;  1WH7 A;  3ZXS A;  1LPQ A;  2KPM A;  2FBK A;  4YEI A;  2XAG A;  5JLX A;  4BH9 A;  1HW5 A;  4J0Q A;  2BM1 A;  3SEQ A;  1HKS A;  3NQO A;  4ZCL A;  1RI7 A;  3MZ8 A;  1OGO X;  3E6C C;  5F0F A;  5KSW B;  3A2K A;  1P6R A;  5E18 F;  5FIU A;  4D5F A;  4NK8 A;  2VQH A;  2HPI A;  2QX3 A;  1YJW I;  1A6I A;  1SVL A;  4E7Z A;  2QTZ A;  2FF4 A;  1R71 A;  1EV7 A;  2E7W A;  1ZM4 A;  1FBU A;  1YYV A;  1ZGA A;  1D1A A;  2JRT A;  2XC1 A;  1PYV A;  3H9G A;  4ANJ A;  4CUG A;  1FLI A;  3PIO F;  1OCP A;  1MNM C;  2H1K A;  1Z7U A;  4LG3 A;  1H9T A;  4JMQ A;  1Z05 A;  2E2I J;  3RZO J;  4RA2 A;  4ENM A;  2EFG A;  2PN6 A;  1TL8 A;  4II2 A;  3H0G J;  1VHO A;  2DOF A;  1BX1 A;  1BI1 A;  4MEX F;  2V9V A;  4DJA A;  1STZ A;  1XMK A;  3NWS A;  3KPH A;  3WU0 A;  1BJA A;  3FK6 A;  1O88 A;  4K1X A;  4G7H F;  2IXS A;  4X0C A;  4DNR B;  4W8S A;  1KQ9 A;  4W8T A;  4IL6 C;  3J81 K;  2VNK A;  2KDZ A;  2PJR A;  4I01 A;  4A3K J;  4A3B J;  2ISY A;  2M34 A;  4LIV A;  3T56 B;  4FN5 A;  5LBQ A;  5HKK A;  2DFF A;  3W3C A;  1EP3 B;  4G7Z F;  4M4S A;  5M5W J;  3BG9 A;  3ES9 A;  3H0D A;  3OWT A;  1G3W A;  1TZL A;  3ZPN A;  1TBX A;  5DV5 A;  5KCM A;  2HYJ A;  3AG2 H;  5FKL A;  1Q9S A;  4MFE A;  4QV2 A;  1ZYR F;  2AQF A;  3HL2 A;  2IP2 A;  3HXL A;  3R60 A;  3GZ6 A;  3OV8 A;  2CYY A;  1E3X A;  4RAF A;  3J7Z I;  5M5Y J;  2XKO A;  4M2L A;  3W2F A;  1K4T A;  1ZRD A;  4EJW A;  4HF1 A;  4AU7 A;  4Y33 A;  2KJB A;  1YW8 A;  4BAC A;  2BHY A;  4V19 K;  3AAF A;  2I5U A;  4UUT A;  2WR8 A;  2VBK A;  2ZSH B;  4DK0 A;  2BVN A;  4HLY A;  3WHC A;  3VSV A;  1X4P A;  3HB9 A;  4A0X A;  2O8X A;  3DXJ F;  3IUO A;  4L0Y B;  3H09 A;  1FRQ A;  1VFC A;  3KE2 A;  3QP6 A;  4RLF A;  1RKT A;  2IS6 A;  3MVP A;  1WRJ A;  1T56 A;  2NST A;  3ZQH A;  2C77 A;  1QZY A;  3BR0 A;  3QFC A;  3JRI A;  1UD2 A;  2RN7 A;  3V8L A;  3TO9 A;  2CSO A;  2ECB A;  3WQZ A;  5B1B H;  4OPS A;  2NVX J;  2ZTN A;  3RPQ A;  4E7H A;  2B9S A;  3FPK A;  2TCT A;  3ASQ A;  3BC8 A;  2IA1 A;  4GYG A;  2Y75 A;  2FE3 A;  3VEP A;  3DWL E;  1ETX A;  1USS A;  2V1U A;  2DIE A;  1BMF A;  1FEX A;  2CW7 A;  1UG0 A;  3FHZ A;  3HUG A;  1J7K A;  1DGR M;  5LHI A;  4U4B A;  2BX6 A;  4YEJ A;  2H27 A;  3RSN A;  3J81 k;  4EJT A;  2RC4 A;  5HLT A;  3K4C A;  1UZC A;  2IS2 A;  2XND A;  1K7A A;  4NC8 A;  3VMF A;  1K6O A;  5IYQ A;  4OOV A;  3VNU A;  1D1B A;  2E5N A;  4YDT A;  4JP0 A;  3E1S A;  3O8G A;  2MC3 A;  1P92 A;  1W5T A;  2EA4 A;  2XGJ A;  1HF2 A;  1AIR A;  3EUK L;  5IOY A;  1MBG A;  1XGM A;  1TYU A;  2K3F A;  4OOI A;  1E3H A;  3REO A;  1KRH A;  1IO2 A;  5ILU A;  4A5M A;  2DN0 A;  5C44 J;  2HOA A;  2VPR A;  4HV5 A;  2W25 A;  1GVJ A;  4BDZ A;  1OGI A;  4HLX A;  1V0F A;  3OEE A;  1OCT C;  3LO8 A;  4IOA F;  1JUM A;  2DA6 A;  2ZKZ A;  2VNH A;  1MBH A;  1NHA A;  1O4X A;  5K7H A;  2FOK A;  1XGN A;  1P7I A;  5DCM B;  3TOA A;  2DY1 A;  1HSJ A;  5FLX K;  3VO2 A;  3L09 A;  3W6V A;  3ML3 A;  2HTJ A;  4GO1 A;  2HDD A;  4AID A;  5E8G A;  2G0E A;  1TW3 A;  3B6A A;  4RBO A;  2JDI A;  2DMU A;  3WY9 A;  2VC0 A;  3CME B;  4C3J J;  4M6Y A;  1E1R A;  4I7H A;  1IDK A;  5KHD A;  2L02 A;  5CVV A;  2XNC A;  2CQX A;  3K2A A;  3G6E I;  3N6Z A;  1ETQ A;  1FWZ A;  2B7B A;  4RS8 A;  1CQT A;  1DQU A;  2W7Z A;  1Z3Y A;  2WBM A;  4QIW N;  1TQM A;  4HV6 A;  2K5C A;  5ICG A;  5D5W B;  1VQ5 I;  1BIB A;  2DBB A;  2K9S A;  3U21 A;  3GQA A;  3I59 A;  1LKX A;  4AF7 A;  5FJ8 J;  5L3G A;  3IV5 A;  4PAB A;  3W2I A;  2W82 A;  3MD2 A;  3T53 B;  3HGG A;  3W5H A;  2OTJ B;  2VBM A;  4C2U A;  2ZJQ F;  1O3T A;  1EF4 A;  3EQO A;  4NCN A;  4BBR J;  1W36 D;  4RD6 A;  2ZXJ A;  1SD5 A;  3G4S I;  5TRD A;  3ZMS A;  2EZL A;  2VL8 A;  3DBL B;  3IH3 A;  2Y2Z A;  2LBF A;  4XR6 A;  4RPD A;  2WAE A;  1IJE A;  4L0Z B;  3CC2 B;  2QKL B;  2ZSI B;  2HU9 A;  3MKY B;  1N8R D;  3FKS A;  3TBI A;  2A6E F;  4U49 A;  4HWV A;  3SYJ A;  1ORK A;  5DYM A;  2CUJ A;  3SJM A;  2F48 A;  1BLI A;  2KIQ A;  3WNC A;  4CCK A;  5L3E A;  2XOK A;  1SAX A;  2CS3 A;  1TVC A;  3F6O A;  3KX2 A;  2DAO A;  1WZ2 A;  4TKO B;  1LLZ A;  4DIQ A;  5FKM A;  1PUE E;  3PSS A;  2DA4 A;  3CUQ C;  1F36 A;  3FXL A;  3D5R C;  2V7Q A;  2VFQ A;  2OK7 A;  2DFH A;  3KYL A;  5LHG A;  2MSY A;  2Y31 A;  5GP9 A;  1Y8R B;  3I4N J;  2KMU A;  4HA8 A;  3L2U A;  2CV0 A;  1LVK A;  1VI0 A;  3C7J A;  3S15 J;  2HDW A;  3BT9 A;  3K4K A;  2BEO A;  2WYR A;  4U7D A;  4WQM A;  4PJN A;  2D45 A;  3BR6 A;  2STT A;  1RQP A;  5E20 A;  2LD5 A;  1LDJ A;  2XT4 A;  5J3L A;  3P26 A;  3ASN H;  2LKX A;  1J59 A;  4OPW A;  3E97 A;  1X3W B;  1ZEL A;  5K7Z A;  2M87 A;  3CCY A;  3ABT A;  4Z4W A;  1WOO A;  5L3F A;  2NRA C;  3MMP A;  2DOA A;  4Q4Z F;  2NS7 A;  2OZ6 A;  4D5C A;  1EE6 A;  2FBH A;  1ZKG A;  1NG6 A;  4Z2Y A;  1B6A A;  2MBF A;  5FRM A;  3WND A;  5JR3 A;  1KC8 D;  4DQ2 A;  3HRM A;  3ASP A;  3ABM H;  4LB5 A;  4G6T B;  4XD7 A;  3C2B A;  1Z67 A;  2CND A;  4XKV A;  4CSW A;  1QVT A;  2VZL A;  3BCA A;  1MSE C;  1I7P A;  2BSA A;  2E1R A;  5AON A;  1XCV A;  2IGM A;  4I02 A;  1DAR A;  2VBE A;  3Q6R A;  3KEQ A;  4LG0 B;  1DDI A;  1BN8 A;  3IKT A;  2NTP A;  2QY1 A;  1U8B A;  1H88 C;  1ITY A;  4MIM A;  2JRM A;  3SZG A;  5K1Y A;  1EP1 B;  2F5E A;  4B47 A;  2EB7 A;  2X6W A;  2WV0 A;  3BOQ A;  3VOD A;  3PET A;  1BOB A;  4YIF A;  1MDM B;  4CYC B;  4IX7 A;  4IQJ A;  4RDJ A;  2L7M P;  2M1B A;  4A3J J;  2XZP A;  3IAS 2;  2P8T A;  5THX A;  3I59 B;  3TO6 A;  1HF0 A;  1HST A;  3M07 A;  2XAU A;  3EUH C;  3LST A;  3PA1 A;  4TN1 A;  1DBO A;  1T6X A;  3JU4 A;  3GWZ A;  3QOD A;  3ZMT A;  2FQ4 A;  3V7C A;  1YLF A;  1J75 A;  1ZRE A;  1F4K A;  2Y48 A;  3QP5 A;  1MSF C;  1X0C A;  2MYS A;  2PE3 A;  4EH1 A;  1Y0U A;  2KKO A;  2ZME B;  4HE6 A;  4R1H A;  3BTC A;  3V7A A;  3U9G A;  2L9S A;  3PL8 A;  1R5G A;  2C4T A;  4Z06 A;  2XEX A;  1MJ9 A;  2QYU A;  1XX5 A;  4I98 B;  4IHX A;  5DN6 A;  4R8H A;  3VB2 A;  5ICC A;  1GLN A;  2DFE A;  3D5L A;  5TIS C;  4LGW A;  1K83 J;  4EEF G;  5CYV A;  2X0K A;  1WCM J;  1MBF A;  5DDG A;  4IKF A;  4YFK F;  2XC7 A;  2ZXW H;  1VLY A;  2IGO A;  1WHU A;  2KLO A;  3PA2 A;  4QFM A;  1Y1V J;  2DT6 A;  1VQ8 B;  1TWF J;  2K02 A;  2CRG A;  1H9G A;  4MNU A;  3GFI A;  3NAW A;  3CB4 A;  4UUV A;  4L8J A;  1S7O A;  1TWG J;  1Z6R A;  3WHB A;  4GDF A;  3QU6 A;  4KH3 A;  3UR3 C;  2N8G A;  3G6E B;  2ZIT A;  3CMY A;  3VSL A;  4Y13 A;  2HYG D;  4CXF A;  2FNA A;  2BXZ A;  1OLT A;  1IC8 A;  2ZZQ A;  2R7T A;  2AS5 F;  3SJZ A;  3RI4 A;  2X1E A;  4W8R A;  2V6C A;  4F55 A;  2YWF A;  2DYR H;  4PGH A;  3ZR8 X;  4YZA A;  4LMY A;  2VUM J;  2XAS A;  1DDN A;  1D5Y A;  4X7C A;  2KVO A;  5DNS A;  3VMV A;  1I6H J;  4F93 B;  2OTJ I;  3DU1 X;  3GW2 A;  1QA1 A;  3ZSC A;  2LNB A;  4OP7 A;  1T39 A;  2XHK A;  3LSR A;  2V5I A;  5CLS A;  5EEG A;  5KVR A;  2PJP A;  4F91 B;  1XN7 A;  5HZA A;  2GIZ A;  3ZCO A;  2R93 J;  4YFO A;  4XN3 A;  5AIQ A;  5ERI A;  1JUP A;  1OB2 A;  2M5S A;  2MH9 A;  1PP8 F;  4W8Q A;  1SD6 A;  3BQJ A;  2C78 A;  3BTJ A;  3HSE A;  2GIV A;  3RKX A;  5F0C A;  5M5X J;  1OFL A;  2DPD A;  4DNT B;  1FC3 A;  4Y3O A;  2VNJ A;  4FHT A;  2X4H A;  2D74 A;  1SD7 A;  2IGK A;  2DLL A;  3Q5F A;  9ANT A;  4CZZ A;  1COW A;  2GOM A;  1LB2 A;  1WKM A;  3A8K A;  1Y0N A;  4CH7 A;  3EPZ A;  1O8K A;  1T0F C;  2HQR A;  2XVC A;  2OK8 A;  1OB5 A;  1EA3 A;  2JSP A;  2LBF B;  5FRO A;  1V3F A;  2GA1 A;  2LFB A;  4LIT A;  4BE2 A;  2O6G E;  2F5D A;  2Y9Z A;  3LSK A;  1FNM A;  4B4D A;  2L9R A;  3CCS B;  3DPL C;  2BYV E;  2VNI A;  2Q0O A;  1BQE A;  1ZR4 A;  1J9I A;  2ICW G;  1OYI A;  2GQQ A;  4XRF A;  3V7R A;  4XRS G;  1O3S A;  5LGU A;  1BJK A;  3JQQ A;  2VXZ A;  2X85 A;  4YFX F;  3OE7 A;  1QFZ A;  4YHB A;  1VQ6 B;  3LA7 A;  1I5Z A;  2ELK A;  2OCE A;  4EJV A;  3TDZ C;  1YW7 A;  1KTV A;  3KP3 A;  2J5P A;  2JUG A;  1DAB A;  5LMZ A;  3I56 B;  2HQA A;  1CGP A;  2BF4 A;  5C4X J;  1SKY B;  3Q0U A;  3OYJ A;  4RM3 A;  4E7I A;  2VKV A;  5E1Z B;  2XRL A;  4QPO A;  4EGY A;  2PLF A;  1X58 A;  2DET A;  2JA8 J;  2FX3 A;  2GA2 A;  2F1M A;  2P5V A;  3P9C A;  2R7F A;  4JOM A;  3K70 C;  4ZCI A;  3HOT A;  5B3S H;  4XIC A;  2ZJR F;  2VBV A;  3FY3 A;  2QBY A;  1X2N A;  3O6B B;  1WH5 A;  4KIC A;  1VQ7 I;  1F60 A;  2A07 F;  4G9Y A;  1W2B B;  2XKP A;  2R7D A;  1RU4 A;  1B8I A;  1GAW A;  4GRI A;  2INU A;  3GZN B;  3U6B A;  1EH8 A;  2K9N A;  3ZMZ A;  3MFK A;  3CCV I;  2R5Y B;  3SLD A;  4RGR A;  1F1Z A;  4UXN A;  3CMA B;  1HZE A;  3QFS A;  2QLZ A;  1XSX A;  3BZC A;  4E7S A;  1JJ2 B;  2DA2 A;  5KW9 A;  2ESN A;  3E5X A;  1G3T A;  3ECH A;  2FEZ A;  3WTV C;  4BE0 A;  4KKT A;  4XID A;  3NB2 A;  1Z7L A;  3WE2 A;  5BMZ A;  3BP8 A;  3CUQ B;  2P5L C;  3EDP A;  4U88 A;  3D26 A;  5DCM A;  4EJU A;  4RD4 A;  2M45 A;  3V4G A;  2WA0 A;  2X1C A;  3OFN A;  2NTB A;  3U1K A;  1QJV A;  1JA1 A;  1L3L A;  3R0J A;  1OQY A;  1SEU A;  3SFZ A;  4DW6 A;  2V79 A;  4BE1 A;  4F7Z A;  3MHP A;  3PSZ A;  3FX3 A;  1R49 A;  4P6V F;  5HS9 A;  5A2Q K;  1ZLK A;  3CTA A;  1PJ5 A;  1AKH A;  1QVF B;  4WK8 F;  3SQV A;  4BQQ A;  3PSF A;  1UD4 A;  2J8I A;  2UVF A;  4F7D A;  2GK7 A;  2WJV A;  2MD0 A;  1E3P A;  5D6E A;  1ZG1 A;  2VAS A;  1EJ9 A;  3CCR B;  4EV0 A;  3KYD B;  5IP6 A;  4RGU A;  2BGC A;  4OZY A;  1EH7 A;  5KAI C;  1SC7 A;  3SLN A;  1OIS A;  4EGZ A;  4UB6 C;  5J40 A;  2ZBU A;  2NPF A;  3COA C;  3BG6 A;  3P9K A;  1FTZ A;  5FL7 A;  3KZI C;  4O6J A;  1D3Y A;  3OS0 A;  1QGY A;  1EH6 A;  3S93 A;  4IJA A;  2O7O A;  1OR7 C;  1LUJ B;  2HKO A;  2E19 A;  1K9M D;  3QAH A;  3WTU C;  4B3G A;  1JNY A;  2BM4 A;  2M7A A;  4BYY A;  4M0L A;  3H1C A;  2VFM A;  4BS9 A;  2G7H A;  1JHH A;  2QSF X;  1QGP A;  3B73 A;  1TTT A;  2JUC A;  3EYI A;  4Q7J B;  3QFT A;  3SZE A;  2LSO A;  4YAO A;  2GM4 A;  1XC5 A;  3E3V A;  4PC7 A;  3SJP A;  4DYC A;  2R5Z B;  3GTG J;  1FT9 A;  4P3I A;  3LSJ A;  1ULY A;  3ZQC A;  3S3O A;  4A93 J;  3LQQ A;  2QBY B;  4RGX A;  1U6G A;  4GQN A;  5F1R A;  3W2H A;  2OV7 A;  3H5A A;  3G3Z A;  3KP5 A;  4XLH A;  4CDG A;  5H5J A;  1I1G A;  1FSE A;  4ZZD A;  2D3N A;  4AC9 A;  3FXR A;  1H0M A;  5JBQ A;  4N3G A;  1N75 A;  1D8J A;  1E63 A;  2C5H A;  1IB0 A;  2A05 A;  1JKR C;  5DS9 A;  2XPU A;  2P6T A;  3ERE D;  4H9G A;  1I27 A;  3VYT B;  3L2W A;  4HX4 A;  2QSG X;  4LK1 F;  2FSW A;  3ONU A;  2XF7 A;  5J8F A;  3HKZ A;  4YRV A;  1NBM A;  4OIN F;  3BY2 A;  3JX8 A;  3S8P A;  3FHN A;  1A35 A;  3OR1 C;  1TNS A;  4IRH A;  4A3E J;  2HMA A;  4A3G J;  3AK5 A;  4Y52 J;  2CQK A;  3FMS A;  3CUQ A;  5EZG A;  2XAH A;  2XSD C;  1Q81 D;  3AVU A;  2ZNY A;  4QLC U;  5L3C A;  1FNC A;  1YI2 B;  4KJZ A;  1KTW A;  3P4G A;  1RQR A;  2IT0 A;  4YG2 F;  4YXW A;  2EIJ H;  3CZ6 A;  5HVQ C;  1Z21 A;  1QHH D;  2P81 A;  3BR5 A;  2C2W A;  2R9V A;  2LKS A;  2VJ5 A;  2WWY A;  2W48 A;  1R1U A;  1GJR A;  3Q38 A;  4M6X A;  4A2U A;  3H9J A;  4I2O A;  1RES A;  4Y7C A;  2FU4 A;  5D5U B;  2Z2S B;  4A6E A;  4C3H J;  3SDG A;  2RDP A;  2P3M A;  4M3F A;  4A5N A;  4FCY A;  2XGC A;  3G1M A;  4S04 A;  2M8G X;  4ZC3 A;  4OAY A;  2VKD A;  1U5T B;  5F04 A;  3F23 A;  1WDT A;  3OOC A;  4JRA C;  4S05 A;  2E36 A;  2R0Q C;  4LOC A;  3FPP A;  3F72 A;  1EZG A;  3EQN A;  4X7D A;  3WXM A;  3VPR A;  1VQP I;  1NG7 A;  3KZZ A;  3QPT A;  2DOD A;  2XUB A;  4Y17 A;  2I1L A;  2LP0 A;  2EFO A;  3GTK J;  3M4O J;  3AKZ A;  3NWT A;  4Z1M A;  2OC6 A;  2BV3 A;  2FQ3 A;  2ZME C;  2RGV A;  5D5X B;  2ZC2 A;  1SMY F;  2OPT A;  3S1Q J;  1QFY A;  2EZH A;  3HBL A;  2V7T A;  1TWH J;  3KP6 A;  1ZRC A;  3GQB A;  2ZFW A;  1OOC A;  2F43 A;  4ASU A;  1W34 A;  4IHV A;  4QUZ A;  2PEC A;  3I53 A;  2Z3Y A;  2FJ1 A;  3C2G A;  4WZT A;  2WZN A;  2VPL A;  3KP2 A;  2D1H A;  1B2R A;  1SAU A;  1ZM9 A;  1IDJ A;  1HA8 A;  3S32 A;  2DCU A;  1BW6 A;  4PFO A;  2NAZ A;  3RKW A;  4OOS A;  3G2B A;  4MFD A;  3DF8 A;  3VDX A;  5FFX A;  2O17 A;  1MAB A;  1ZTR A;  2BM0 A;  2ZXI A;  1KK1 A;  2Q8K A;  3ZBU A;  3QQA A;  2VON A;  5H6Q A;  4CO8 A;  5IYD J;  3HIF A;  3WTX C;  2HVS A;  4NQW A;  4ITV A;  4WZL A;  2CG4 A;  3CD6 B;  3KRG A;  1VF9 A;  1SFO J;  2KZG A;  1YS7 A;  1QGA A;  4Z4S A;  1MGT A;  2JN9 A;  4B3F X;  3ESW B;  3V76 A;  3FBN B;  1KZL A;  1UG2 A;  4XKB A;  4AIH A;  5GAH J;  1IAW A;  4LBZ A;  1MMA A;  2M7B A;  4UHT A;  4RB3 C;  3B78 A;  3RZD J;  4NC6 A;  2Z8G A;  5FKN A;  1X2M A;  1YX3 A;  2BHZ A;  3BZ6 A;  3F8M A;  3K4M A;  1Q1H A;  3BY1 A;  1IB4 A;  2CQN A;  3DBR B;  3K4N A;  4BL0 B;  3X2Q H;  1OCZ H;  4Z4Y A;  2CUF A;  5HS7 A;  2NSP A;  1UHW A;  3K4J A;  1WSR A;  3F8B A;  4EW9 A;  4XK4 A;  1SD4 A;  3ZPP A;  3A02 A;  3HRU A;  2WZP P;  1YJN B;  4G5G A;  1D8K A;  3K7A J;  2LH9 A;  1CF7 B;  1K61 A;  1NB0 A;  3JTH A;  3R0A A;  4KIF A;  2PYG A;  3V42 A;  3MCZ A;  1FND A;  3FMR A;  5FO5 A;  2E7X A;  2BN4 A;  1WSU A;  2VOO A;  1BBY A;  4B44 A;  1GUU A;  2L5Q A;  1P2F A;  1NH3 A;  1P4A A;  5FO0 A;  1I3Q J;  4X7F A;  3CCL B;  2K9L A;  4RB2 C;  1QA6 A;  3BJO A;  3OSG A;  3B8H A;  2NVY J;  2DFI A;  3BC9 A;  3H5N A;  2Y69 H;  4J19 A;  1OPC A;  1D5V A;  1TYW A;  3OS2 A;  3D1N I;  3GVL A;  5IYP A;  4DGW B;  2O0Y A;  1N78 A;  3GFM A;  5ED4 A;  5B6I A;  3B8Y A;  5IOZ A;  3W2W A;  3PNV A;  3CCQ B;  1LFB A;  2W6I A;  1W0U A;  3ZGK A;  4M74 A;  1W1W E;  4UV8 A;  1ACI A;  3GIR A;  3BJA A;  3KCC A;  2H6B A;  2HVQ A;  2KP6 A;  3C1D A;  4C2L A;  2YSR A;  5D6F A;  4OJO A;  3OOP A;  2KRF A;  1K28 D;  5BOX A;  3GTO J;  1WJD A;  3JAM Z;  1CNE A;  4ZJZ A;  4Z4T A;  2VBW A;  1LEA A;  4D1Q A;  3BNW A;  2AHQ A;  1ZR2 A;  2O5R A;  2KDO A;  2QN6 A;  3Q3A A;  1FYM A;  1ZN2 A;  3U2Q A;  4Z4V A;  1FX7 A;  4MO7 A;  3H94 A;  4RDL A;  2X6Y A;  3EYY A;  3P7N A;  4PDK A;  5FA6 A;  3VWB A;  1XSV A;  5EEH A;  3CC4 I;  1U9O A;  1YHQ B;  1O8G A;  1QUF A;  3CUO A;  1FSH A;  2VT3 A;  2DER A;  2K85 A;  2V9K A;  2AO9 A;  4KMU X;  4RM0 A;  5JLV C;  3HTU A;  3GFL A;  2BOL A;  1VF7 A;  3I55 B;  5F27 A;  1FIP A;  2NS8 A;  1D0Y A;  1ZG3 A;  1AIP A;  1O8D A;  2HFH A;  3LJY A;  5F08 A;  2VJJ A;  1O8I A;  5LLQ A;  2BY0 A;  4M72 A;  2JVG A;  1KYW A;  3CME I;  2OU2 A;  2CC2 A;  5C4J J;  3QSY A;  1QRY A;  2LYC A;  2QKM B;  4CGZ A;  1O57 A;  4P55 A;  2E2J J;  2QM3 A;  3NAR A;  3OL3 A;  3VSU A;  2W85 A;  1HC8 A;  2K4J A;  3ZN1 A;  3LFK A;  4YAL A;  2ZME A;  4C0S A;  3F6V A;  1ODD A;  2L2O A;  4BPR A;  1IRX A;  2QF7 A;  2GJR A;  2JJ2 A;  4DBR A;  2EFP A;  1VJS A;  1FNB A;  3WGG A;  1HA3 A;  3CCE I;  2YU9 J;  2EIL H;  4P96 A;  1IUY A;  2NVU B;  1VQN B;  4OJP A;  4L9T A;  3TP3 A;  3LAJ A;  1UD6 A;  4JBA A;  2HOE A;  4JX4 A;  2JA5 J;  2YPR A;  3ONQ A;  4V02 C;  4XKC A;  2VT2 A;  4G6I A;  3FIW A;  4FE7 A;  1WI3 A;  3I71 A;  1R22 A;  3K6G A;  4RMN A;  2VOP A;  2IEK A;  1SVO A;  4U0V A;  3GLX A;  3T5X A;  3E7L A;  1X1B A;  5HOD A;  1DU6 A;  3A01 A;  2P7C B;  1WGX A;  3IH4 A;  2A69 F;  3GTP J;  3N4M A;  3H35 A;  3W5V A;  2V1X A;  4FET A;  1O7L A;  3WTY C;  4OMY A;  1UHS A;  1KYZ A;  3BCF A;  1JRG A;  2OZU A;  1ZHF A;  2CQQ A;  3GFJ A;  5GPC A;  2V1N A;  1ETK A;  4PFP A;  1J5Y A;  4IXA A;  4XLE A;  1GHC A;  2CGP A;  4L9N A;  3ERM A;  2F4M B;  2V26 A;  4AYB A;  2YUS A;  1X19 A;  1W0J A;  2BV6 A;  4ABZ A;  4XOP A;  1F20 A;  3U1D A;  4BHC A;  1FX0 A;  2ODL A;  3HOU J;  1C0W A;  1MNE A;  2PI0 A;  4BXX J;  2J5O A;  2WAQ N;  2LY9 A;  3JTG A;  3VR6 A;  1NB9 A;  1T0F A;  2KQR A;  1RET A;  3E6M A;  3ZP5 A;  1R1V A;  4K2E A;  2KJC A;  3QYF A;  3VSK A;  1K79 A;  1FPQ A;  2MFZ A;  1R4M B;  2DA5 A;  2G9W A;  1IGN A;  3LNN A;  1ETO A;  3WGH A;  4AD9 A;  1R58 A;  2BY2 A;  4UUS B;  4TSF A;  1PLU A;  1NTC A;  4WWC A;  2W84 A;  4UZU A;  4CCO A;  2QEX B;  3SKB A;  2O1D A;  1HW2 A;  1YJN I;  3RPU D;  1BW5 A;  1APL C;  1IW7 F;  3N97 A;  1X4O A;  1T6Z A;  3Q9V A;  3LFU A;  1KON A;  2R7X A;  1MMS A;  3TL4 X;  1HOM A;  4IPA A;  1W9X A;  5KK1 A;  3WNB A;  1YJW B;  3T9G A;  2R7W A;  2JPC A;  3TGN A;  3OYE A;  2IOU G;  3H36 A;  3S2W A;  4PAA A;  3DFG A;  1OFE A;  2NXN B;  1UAA A;  1IDZ A;  2OBT A;  2DQR A;  5B1A H;  1FRN A;  1MRZ A;  4A12 A;  1OR7 A;  5H2F C;  4RB1 A;  4EJO A;  1G8X A;  4E4H A;  1RWR A;  4XL9 A;  1FOX A;  4BDY A;  1QG0 A;  3TMO A;  3AG4 H;  3AVV A;  1HQC A;  2HTS A;  4HDV A;  3FXJ A;  4I76 A;  4YAW A;  1MBJ A;  1G2H A;  2COM A;  4A3D J;  5L3D A;  2M0C A;  5B5E C;  4LLL A;  1R5O A;  1KA8 A;  1AKH B;  4PJL A;  5LRR A;  4HIZ A;  1S72 B;  2ID3 A;  5IP7 J;  2ISZ A;  2UVE A;  1IRG A;  4A3M J;  5BPI A;  1JHF A;  4P6Y A;  1WJE A;  3JR9 A;  1Z3X A;  2GXG A;  5LHH A;  1QVU A;  4TMZ A;  1N05 A;  1UHM A;  4C3I J;  3EET A;  3LSG A;  3GQ9 A;  1MJB A;  2Q2E B;  4CIC A;  3HM5 A;  4U7B A;  1Y56 A;  5E6T A;  1YHQ I;  1JA0 A;  4XLP F;  5EZH A;  4ENN A;  3M3Y J;  2HKX A;  2Q2E A;  3LSI A;  4XLA A;  4URR A;  2PMZ N;  1B72 B;  5E3N A;  3HDD A;  2V4J C;  3CDL A;  3HOX J;  1YJ9 I;  1XDS A;  2CFO A;  1Y39 A;  4BBS J;  1ON2 A;  3ASR A;  4NNJ A;  3QRF F;  5JVG F;  4M73 A;  4YAU A;  3A8J A;  2ZTG A;  2LF8 A;  4LB6 B;  5HDN A;  3A1Y A;  2NT9 A;  2XT2 A;  2FUG 2;  1KQS B;  3OYF A;  1VBL A;  1P4W A;  4PUS A;  5H20 A;  1S29 A;  3BQZ A;  1S4M A;  2D9R A;  3B82 A;  3F0C A;  4KKU A;  4HNT A;  6PAX A;  4MEY F;  1Z0X A;  4E6K G;  4KT5 C;  4X0G A;  1JJ6 C;  1HKQ A;  5F1J A;  2ECC A;  1E64 A;  1LJ9 A;  2G0Y A;  2EV0 A;  5J35 A;  3FM3 A;  4HF0 A;  5HZB A;  1V4R A;  3H92 A;  2JJ1 A;  2XAJ A;  1KK3 A;  1PJR A;  2DQL A;  4Q5S F;  3CXC B;  4OJ5 A;  3E5Q A;  1TC3 C;  2PMD A;  2RKH A;  2DJN A;  2WB1 N;  1G7R A;  1IN6 A;  2LK2 A;  2K86 A;  3NRV A;  1UD8 A;  3DCF A;  1GO2 A;  1S0U A;  1WPC A;  4A3I J;  4BAY A;  1T08 B;  2P0W A;  5J6X A;  3OP1 A;  1KK2 A;  4XBF A;  2PMU A;  1V5F A;  3R6K A;  1YIJ B;  4HX8 A;  3UKG A;  2F4I A;  1S9H A;  1W36 C;  2D3L A;  1D1C A;  3ASO H;  2KIU A;  2ZO4 A;  1R1T A;  3DPT A;  3V7S A;  4BXF A;  3AVY A;  3KZY A;  3B4N A;  1P9Q C;  2PX9 A;  2DJI A;  3MN2 A;  2KIF A;  1KD1 D;  1DP3 A;  4OIO F;  3PUM A;  2MGQ A;  4KIT B;  5KNL A;  1EKE A;  1F9N A;  2V7F A;  4CYC A;  3BZK A;  2AXT C;  2E1B A;  1T6Y A;  2Q6K A;  3ZRG A;  3ABU A;  3LQE A;  3GYH X;  1OGJ A;  2P5K A;  3OYI A;  4LLN A;  2M30 A;  3SFI A;  3CCJ I;  2O9L A;  1E1Q A;  3GTM J;  2O3F A;  3B6C A;  4ZZL A;  3I5U A;  2CW8 A;  5LFA A;  5GTI C;  4E7J A;  4DOZ A;  5TGT A;  4F92 B;  4HOB A;  4YC5 A;  3RTR A;  4RAY A;  1OYW A;  1DBG A;  2VXD A;  2XIG A;  3OOU A;  2YX7 A;  4NBQ A;  3PFY A;  3U2R A;  2I10 A;  2VC1 A;  1QX4 A;  1R5B A;  1Z77 A;  2EK5 A;  2LVS A;  2VBY A;  2E60 A;  2NOG A;  1DU0 A;  3DKX A;  3I9V 2;  1RR7 A;  5D8K B;  4AWX B;  2JT1 A;  5CQE A;  5ICE A;  3F3X A;  3PUF A;  1O8H A;  2KHM A;  3OR2 C;  2IJL A;  2DMP A;  2WAQ A;  3K1M A;  4ACA A;  2EIN H;  4M6V A;  3OYL A;  2CU7 A;  2HS5 A;  1FMW A;  4UVB A;  4RPB A;  3DQV C;  1XE1 A;  4PGO A;  2VBX A;  3RDI A;  4FX4 A;  1S6L A;  2EV6 A;  1ZRF A;  1OKR A;  5M3F J;  1M1K D;  3ZQF A;  1LNW A;  1T6S A;  2HYF A;  3CES A;  1WFX A;  3Q0V A;  3ZPL A;  4TMT A;  1IXR C;  3H3V K;  2DW4 A;  2BGJ A;  5F4O A;  4ZYD A;  4P22 A;  3O2P E;  2Y0S A;  2VI6 A;  4UVC A;  3F8F A;  1IXC A;  1VQ5 B;  4RGS A;  3A01 B;  1L0O C;  2VQL A;  3I4M J;  2F1L A;  2Y30 A;  3HTS B;  2ZL7 A;  3KYC B;  1H42 A;  1IV6 A;  4MQV A;  3BG3 A;  2ZXH A;  2YX4 A;  3BG7 A;  1TT0 A;  2QCO A;  4IQ4 A;  1RIO H;  3CW2 A;  4MGR A;  5E8I A;  1GR1 A;  3CRZ A;  4OPV A;  1V5V A;  3CPW B;  4MQ9 F;  3CJN A;  3VYR B;  2R7R A;  3R6S A;  1WJ5 A;  1JTY A;  5FFZ A;  4A69 C;  1MMG A;  1VQM B;  2HI3 A;  5FNZ A;  1VLO A;  2X53 S;  5H59 A;  5J4Y A;  2UXN A;  4ZYH A;  4LFU A;  4U87 A;  1UD5 A;  5BSX A;  3E6B A;  4ZYG A;  2HLD A;  2E1O A;  3DV8 A;  4D9J A;  3SYT A;  3K1P A;  1XGS A;  4RB0 A;  5A8A A;  2LY1 A;  3FIS A;  2B5O A;  1UJ8 A;  2B0R A;  3OS1 A;  4IHT A;  2E5Z A;  2ZZG A;  4AIJ A;  3FF5 A;  3AVT A;  1J2X A;  3AL0 B;  3AGQ A;  3FDY A;  5IPA A;  1OCC H;  1KQ8 A;  2CUE A;  1K6Y A;  4B3X A;  3VYU B;  2QQB A;  1HDP A;  3EQL F;  3OYG A;  3L2V A;  4FQG A;  4DQL A;  2YUH A;  3GQ7 A;  2Z16 A;  4WXC A;  1GT0 C;  1V5E A;  3DKW A;  3LMM A;  1UMQ A;  1ZQ3 P;  3BTL A;  2MLG A;  4A0Z A;  1JB9 A;  3CP2 A;  1OHH A;  3N90 A;  2BY1 A;  4LD5 A;  1D0Z A;  2R7U A;  2PBI A;  4CCN A;  1E2X A;  1ZH5 A;  4QVJ A;  2DDB A;  2NZM A;  3W5U A;  3ROU A;  3U6K A;  2FD5 A;  2QZ8 A;  4P25 A;  1HCR A;  3H9Q A;  2AQE A;  1R9T J;  4IEJ A;  3W2G A;  1EWY A;  2P4W A;  4L9V A;  1XG2 A;  4AC0 A;  4B09 A;  1PE9 A;  3JAM K;  1W7P B;  1LLW A;  3CCU B;  1HW1 A;  4LBV A;  2HVR A;  1VND A;  2NT6 A;  3R4K A;  1MZB A;  2EBI A;  4IOC F;  2VKH A;  3L9F A;  3FJO A;  1G7S A;  1XB2 A;  4HST A;  1I39 A;  1ZUN B;  4LBY A;  2L0K A;  5EJC A;  3TH0 A;  2JN6 A;  3CDI A;  2K9Q A;  1YO5 C;  2ESH A;  1KK0 A;  1PKV A;  1Q1V A;  1FIA A;  1Y6I A;  4G12 A;  1QUE A;  2OBS A;  4YAF A;  2BBY A;  3E20 A;  1KMH A;  2GWR A;  3KL9 A;  1CQX A;  1JI8 A;  2NYX A;  2DYI A;  2LR8 A;  2K7L A;  4XN0 A;  5EEA A;  5FD6 A;  1QBJ A;  2ZZF A;  3BH6 B;  4WWV A;  3CJQ B;  3LA3 A;  3M7G A;  4WXH A;  3TED A;  3PUB A;  2MH2 A;  3GEZ A;  1PUF B;  1G4D A;  1UFM A;  1RKW A;  2DEU A;  3E0J B;  4WZK A;  5IP9 J;  2EFW A;  1HXD A;  3B90 A;  3SHF A;  5GTH C;  2UUZ A;  3S17 J;  3GX4 X;  5TR9 A;  1G3S A;  3AVX A;  4PJ0 C;  5C1E A;  2A61 A;  2WY7 Q;  2UZK A;  1R36 A;  1O3Q A;  3KLO A;  4I0B A;  1FYL A;  1EFU A;  1UCR A;  4ENJ A;  3G05 A;  4EMS A;  4WZE A;  1KGS A;  1H89 C;  1BN5 A;  4A0Y A;  2X0L A;  2DXI A;  5J4V A;  3UNG C;  3WWG A;  2XF5 A;  1RNL A;  2OAZ A;  2R7V A;  4IZZ A;  1IG7 A;  2GK6 A;  3A1P A;  3JW4 A;  2PIA A;  4RAZ A;  2FOW A;  2V1D A;  2QE7 A;  3K0L A;  4HX7 A;  3BR3 A;  5H6R A;  2GJP A;  2DYS H;  3FKI J;  3JRE A;  2CW5 A;  2HCJ B;  3GCM A;  4II3 A;  3WGI A;  4XLF A;  2NNY A;  1B9N A;  3A8I A;  1SFU A;  2EJR A;  2Z6B D;  2H6C A;  1ZK8 A;  1S7A A;  2VB6 A;  4G1V A;  5JMC B;  4B1R A;  4Z6Y A;  1S7E A;  1XG1 A;  3ONY A;  1J09 A;  5DEQ A;  4PSX A;  4EVI A;  4GXO A;  1ZGJ A;  2KFD A;  2L54 A;  2ELH A;  2PQ8 A;  2EPF A;  4IF4 A;  2Q6I A;  3I4P A;  1BOA A;  2CUZ A;  2ME6 A;  2XGE A;  3H9N A;  1SFX A;  1XPX A;  2XF6 A;  3ISX A;  1HBX G;  3BRO A;  5F64 A;  5L46 A;  4Y9R A;  4C9Y A;  1HDD C;  3B02 A;  4XOR A;  1BM9 A;  4I99 C;  1IRZ A;  1ELO A;  2L9V A;  4ZGQ B;  1OB0 A;  5FLM J;  2LRE A;  1TP4 A;  3R61 A;  4S0H B;  1T33 A;  5IYB J;  4OPO A;  1QZE A;  2Y0S N;  3RIQ A;  1P4X A;  2OUM A;  2VJI A;  1VQN I;  3PO3 J;  1FP1 D;  3KFW X;  4EM2 A;  2GAU A;  1AHD P;  1XTA A;  1U2R A;  1WPK A;  1HLV A;  2Z33 A;  3E6D A;  3C18 A;  1BI2 A;  4GFB A;  2LMD A;  4P9S A;  4XRM A;  1IHM A;  4UZF A;  5K5Q A;  4LBW A;  2JTV A;  3EUA A;  2RNG A;  1NJI D;  1XSD A;  3FXK A;  4FT8 A;  2KIM A;  4B43 A;  5BPD A;  4TMV A;  3C2H A;  4PCQ A;  4XLC A;  1ZM2 A;  3VO1 A;  2XTY A;  4DBQ A;  2F4N A;  2DMT A;  3HRS A;  1R6R A;  5J47 A;  3R6J A;  2YU3 A;  4CHU A;  3S14 J;  1I8D A;  1R5H A;  4M53 A;  3LWF A;  4D7N A;  2WY8 Q;  2R5Z A;  1ENH A;  3OYK A;  1D8T A;  4NBS A;  1YOV B;  2XTW A;  1X1P A;  1W7P D;  4PSW A;  2JA7 J;  1PP7 U;  3S1M J;  2BM7 A;  1ETW A;  3PNT A;  5LEK A;  4AM3 A;  4QSH A;  3V8K A;  3F22 A;  1LE8 A;  3DDY A;  3T8R A;  4P5O A;  4MLO A;  4G7W A;  2XTX A;  3ZMD A;  1G7T A;  4NC7 A;  3O3K A;  3S1N J;  2LZJ A;  1U0J A;  4PZJ A;  1OGM X;  2NNN A;  3CD6 I;  2KIS A;  2Z5U A;  3ZBT A;  3A0H C;  2EA2 A;  2GQF A;  5EMN A;  2O0V A;  3FXU A;  3CC7 I;  2JMW A;  1YRN A;  2ACJ A;  5FB2 A;  3OY9 A;  3L7W A;  2OCC H;  3QWL A;  2FVG A;  2W57 A;  5E79 C;  3OJX A;  3G71 B;  3HSF A;  2YS9 A;  2VE8 A;  1QNT A;  2ZBK A;  4G7X A;  3IHU A;  2XGX A;  3TDU C;  4F52 A;  3L2Q A;  1K4S A;  1TT5 B;  1YRN B;  1VQL B;  2MAB A;  3FZV A;  3P9I A;  1QGZ A;  1Y0Y A;  3I56 I;  3Q39 A;  2RC5 A;  2XDV A;  1VQ4 I;  2F5C A;  1JTX A;  3OZV A;  2DO7 A;  3FK7 A;  3H3U A;  3IC7 A;  4YZX A;  3VST A;  4IO9 F;  3QYE A;  2XRO A;  2HEO A;  4P1V A;  3GXO A;  4U0Y A;  1XMX A;  1FZP B;  2JSC A;  3QPS A;  1CLW A;  1DGW Y;  4X05 A;  2BE5 F;  3DLL F;  3OYA A;  2FBI A;  1YG2 A;  1SKQ A;  4Z05 A;  3OYC A;  1SM4 A;  1A31 A;  5BS6 A;  4J01 A;  3RYR A;  3HG9 A;  1GV5 A;  1IN7 A;  4NB5 A;  2FML A;  2JJ7 A;  2YR2 A;  1O7F A;  1S5L C;  4XON A;  3MKW B;  2E1C A;  2WPD A;  4MYT A;  5GV7 A;  3GZ5 A;  1B8I B;  1QQ1 A;  2LF7 A;  2Q6O A;  2HZD A;  3CCV B;  1IN8 A;  3FWE A;  5F4J A;  3HC7 A;  4DNC A;  2QXZ A;  5D8L B;  3ML6 A;  3BWG A;  5TJJ A;  4A3L J;  2C6Y A;  4YII A;  2VOD A;  1V0E A;  1S72 I;  4Q48 A;  2O61 A;  2H8W A;  1K73 D;  2XPW A;  3IWF A;  3LSH A;  3ZMU A;  3LYC A;  5LRS A;  3GTL J;  5LEJ A;  3HOZ J;  5AIP A;  1QFJ A;  4KKS A;  3HUG B;  4KIS A;  1A5J A;  2V7X A;  3SEJ A;  1O8L A;  1O8J A;  4BEH B;  5GV8 A;  1WOR A;  2E35 A;  2NV4 A;  5EYR A;  1MKM A;  2PMH A;  2EIX A;  1RR8 C;  4WCG A;  1I50 J;  3MEX A;  2JWT A;  4RCY A;  1UST A;  5JLW A;  4TT3 A;  4BU2 A;  3T51 B;  5E17 F;  4KDP A;  1XB4 A;  4FAS D;  4F3Q A;  4I6Z A;  3ASS A;  4B3A A;  1K4Z A;  1R4N B;  1TQI A;  3HHH A;  3A4C A;  4ZYE A;  3SZT A;  3I55 I;  2ZCW A;  3AG3 H;  3ELK A;  4MXN A;  5IT9 Z;  4Z4R A;  1RPW A;  4FX0 A;  3SY2 A;  2Q6L A;  5E1X A;  4M9S A;  4L9J A;  1IJW C;  1JT6 A;  2W00 A;  2GXA A;  2QWW A;  2EFN A;  1KQ5 A;  4CCJ A;  2BGI A;  1N77 A;  1UEL B;  1W4M A;  3CCR I;  3ZOB A;  1X3U A;  3ECO A;  4HSR A;  2LRD A;  2E34 A;  3PO2 J;  4FK8 A;  4RDK A;  5BQT A;  1MIJ A;  2R5Y A;  1XGO A;  2LC2 A;  3G1O A;  1PJ6 A;  2Y0M A;  1ETV A;  1T95 A;  2IS1 A;  5DM7 F;  1Y1W J;  3QOE A;  4X7E A;  4UB8 C;  1N0V C;  2M0M A;  5K5O A;  2QDX A;  2PYH A;  2DK5 A;  5TY0 A;  1VQ9 I;  2VBZ A;  4ESF A;  4HBL A;  3A3G A;  3E1Y E;  1VQO I;  4B48 A;  2ZL5 A;  1LM1 A;  1E17 A;  2V7W A;  2XB0 X;  2EWN A;  3AST A;  2INV A;  3OYM A;  5K7F A;  1DDG A;  1U9N A;  3CC2 I;  1NRK A;  4UAJ A;  2E1N A;  3VOE A;  5IYC J;  4HW0 A;  5DS0 A;  4G6D A;  2V9P A;  2RQP A;  3S16 J;  3DKY A;  3S1R J;  1FNN A;  3QU3 A;  3PQJ A;  3RY8 A;  3VMW A;  3WTS C;  1I1S A;  3WU1 B;  2RAE A;  1S3J A;  4NUB A;  2VQG A;  2BY3 A;  1W7P A;  2GXB A;  2R4G A;  1AMO A;  4UZE A;  4BEH A;  3CP8 A;  4BJ6 C;  3OL4 A;  5ICF A;  4KYW A;  3CCJ B;  4GCV A;  2R6H A;  3E5U A;  2YWE A;  4AUX A;  3GTQ J;  1IN5 A;  1Z91 A;  1GXQ A;  2B7E A;  3LOC A;  3MQ0 A;  4OWR B;  3RKY A;  4PC3 A;  4NDL A;  1X3Z B;  1IRF A;  3AVW A;  2F5V A;  1FMV A;  4AYB N;  5J1R A;  2PJR B;  1FBS A;  2K4B A;  4IVN A;  3WG9 A;  3NAU A;  3I64 A;  3PIP F;  2XPV A;  1SFK A;  4M9X A;  2CBX A;  4B4C A;  3F9K A;  1MW7 A;  3F8N A;  3MKL A;  4Y4R A;  2M4K A;  3CCM I;  2AHO A;  5A88 A;  4WX9 A;  3L2C A;  2DTR A;  2R3S A;  3L00 A;  3SEZ A;  1BR1 A;  4M3D A;  2D5V A;  1AOY A;  1YI2 I;  5IYW A;  2HGC A;  3GTJ J;  3OMY A;  4L5E A;  4CQJ A;  1HG8 A;  3PFI A;  1AU7 A;  1DPR A;  2DT7 B;  3IRQ A;  3BTI A;  1N0U A;  5B66 C;  1TW2 A;  1IV8 A;  2P6S A;  2H09 A;  1JKQ C;  1TQP A;  2OBP A;  5D4S A;  3FBI B;  3W2A A;  1J0R A;  1TTY A;  3FMQ A;  3NE5 B;  2COB A;  1D1N A;  2QGG A;  1H8A C;  2L7Z A;  3V8J A;  2HR3 A;  3PUN A;  3CF5 F;  2QEX I;  4BJ5 C;  1LVA A;  1RUO A;  5FO1 A;  1WXR A;  3A0B C;  3CJT B;  2XSJ C;  4ASN A;  3WTT C;  4TMW A;  1VHE A;  1WTH D;  3TP0 A;  4Y7N J;  4N4N B;  4Y9U A;  4R79 A;  4ZGN B;  2PLY A;  1LDD A;  2DA1 A;  2XB5 A;  2Y9Y A;  1IF1 A;  3CLO A;  3K10 A;  1ONV A;  4XSX F;  2IA0 A;  2M5W A;  1YIT I;  1QPI A;  3PJR A;  5GAG J;  2VYQ A;  3FXO A;  4M3E A;  2AXL A;  2DCE A;  3M1C A;  1WP6 A;  3I0T A;  3WOD F;  5ILV A;  1WOS A;  1POG A;  3OYD A;  2IGN A;  4B8X A;  4LIU A;  2HPM A;  2OBR A;  3ABK H;  2A68 F;  4Y15 A;  1O8F A;  1ZAO A;  2QGU A;  3PNY A;  3G73 A;  3HOV J;  5F4M A;  1MBK A;  4BY7 J;  2O03 A;  4G6Q A;  2WB1 A;  3RYP A;  1P4M A;  2VBS A;  3LQ6 A;  3TO7 A;  2BXY A;  4N4O B;  3GF2 A;  4R71 A;  2O0W A;  5J8C A;  2WAF A;  3OYH A;  3FXQ A;  2ZB9 A;  1K78 A;  5EGO B;  2GRE A;  1EA0 A;  4OOX A;  3HOY J;  5JVT A;  1YLO A;  2CWE A;  3IP4 B;  1G59 A;  1RRJ A;  2IW5 A;  3OAA A;  3KEO A;  3HJE A;  5M3M J;  1KU7 A;  3OIO A;  3KIO A;  2R7Q A;  5EDN A;  1A8P A;  2LOO A;  2TRT A;  1PUF A;  5E3M A;  1OFM A;  4HQM A;  4P9U A;  1B59 A;  2JQ7 A;  3ZZU A;  2HNH A;  2KRH A;  4KT6 A;  4TV7 A;  1PXZ A;  2CJJ A;  1YFH A;  1CF7 A;  3W2E A;  4BQN A;  2VBU A;  3G1L A;  4ZTF A;  2D1V A;  2XRN A;  1LFU P;  4ROX A;  1YJ9 B;  1MMN A;  4G94 A;  2XNJ A;  4Z4U A;  1JE8 A;  1KU9 A;  2L01 A;  4DYQ A;  1R00 A;  1UB9 A;  3WE3 A;  4XQF A;  4C2T A;  3A35 A;  2BMW A;  1TWA J;  1U5T A;  4GYI A;  4L5I A;  1NDH A;  3ULQ B;  2D2W A;  4OU0 A;  3CMM A;  2QQA A;  2M9H A;  1OMI A;  2B0L A;  2RV8 A;  3T1B A;  4IW3 B;  1FJL A;  4HRI A;  1QZZ A;  1KCC A;  4MTE A;  2MG4 A;  3OJW A;  2DA7 A;  4OAZ A;  2XZO A;  4N0B A;  1D0X A;  4JYK A;  1WJF A;  2BW3 B;  2CK3 A;  1QH0 A;  2Z1D A;  1Y8Q B;  2H8R A;  1M1E B;  2VJ4 A;  3JRF A;  4P26 A;  4H4K C;  5CDF A;  1VQ9 B;  3Q0W A;  4XNF A;  1VQK B;  3I58 A;  5HLI A;  1GDT A;  1QA3 A;  2K40 A;  3J7Y J;  2JPB A;  1YE9 A;  4E7K A;  3JRB A;  3S3M A;  5HLH A;  4MTD A;  2XZL A;  2FMY A;  2IPQ X;  1W35 A;  5LGT A;  3AFH A; 
#chains in the Genus database with same CATH homology
 4II2 A;  2ZFU A;  3BH4 A;  3VYR B;  2R7R A;  3GVK A;  1WJ5 A;  4DJA A;  3NWS A;  5C1C A;  3S3O A;  1MMG A;  3J7A Y;  2X53 S;  1O88 A;  4GQN A;  2IXS A;  2OV7 A;  4DNR B;  3H5A A;  4NQW B;  4XLH A;  4U87 A;  4W8S A;  1UD5 A;  4W8T A;  2PJR A;  2HLD A;  2ZZE A;  2D3N A;  4LIV A;  4D9J A;  3T56 B;  3SYT A;  1N75 A;  2W7N A;  2E1M C;  2LY1 A;  5HKK A;  3W3C A;  2NTQ A;  3OS1 A;  2E5Z A;  2ZZG A;  3H0D A;  3AL0 B;  3OWT A;  1TZL A;  3FDY A;  3ZPN A;  3VYT B;  5KCM A;  3L2W A;  2XF7 A;  4EAT A;  3HKZ A;  4YRV A;  2CV1 A;  1NBM A;  4B3X A;  1K6Y A;  2AQF A;  3HL2 A;  4YEL A;  3VYU B;  3S8P A;  3FHN A;  3HXL A;  3OR1 C;  3OYG A;  3L2V A;  2KZV A;  4OJ6 A;  1E3X A;  3GQ7 A;  2Z16 A;  1V5E A;  3LMM A;  4C30 A;  1OHH A;  1AA7 A;  3CP2 A;  2PMZ A;  3RQ4 A;  1D0Z A;  4AU7 A;  2R7U A;  4Y33 A;  1KTW A;  4KJZ A;  2EWE A;  4BAC A;  4CCN A;  4YXW A;  3CZ6 A;  5CQG A;  5HVQ C;  1Z21 A;  2NZM A;  2UV1 A;  1QHH D;  2ZSH B;  4DK0 A;  2VBK A;  3UW0 A;  2R9V A;  3VSV A;  3SUC A;  3BCB A;  1X4P A;  3H9Q A;  2VJ5 A;  2AQE A;  3S3N A;  3IUO A;  3H9J A;  4RLF A;  2IS6 A;  2NST A;  1XG2 A;  1PE9 A;  2Z2S B;  1UD2 A;  2L7K A;  4BJT A;  2HVR A;  3WQZ A;  2NOJ B;  4ZC3 A;  4OAY A;  2VKD A;  3OYB A;  2NT6 A;  2ZTN A;  4CZC A;  3OOC A;  2VKH A;  5HNF A;  4E7H A;  4HST A;  4HEA 2;  1NHC A;  3BC8 A;  1PKV A;  3FPP A;  3DWL E;  1Y6I A;  3EQN A;  2R7S A;  2Q1Z B;  2DIE A;  1NG7 A;  1BMF A;  1KMH A;  2WSS A;  2CW7 A;  4ZDP A;  2O04 A;  1UG0 A;  1H8E A;  1JI8 A;  4XN0 A;  1DGR M;  3HPG A;  3AKZ A;  3NWT A;  4Z1M A;  4U4B A;  2OC6 A;  2LG4 A;  4YEJ A;  3RSN A;  2ZZF A;  3CJQ B;  5HLT A;  3GQB A;  1OOC A;  3PUB A;  2F43 A;  3HPH A;  3K4C A;  4ASU A;  1IA5 A;  2IS2 A;  2XND A;  4NC8 A;  3E0J B;  2PEC A;  4I84 A;  1D1B A;  2E5N A;  4BGD A;  3C2G A;  3B90 A;  3E1S A;  3A3B A;  2XGJ A;  2VPL A;  3L2R A;  2UUZ A;  3OIP A;  1AIR A;  3EUK L;  1SAU A;  3N05 A;  1IDJ A;  1HA8 A;  3S32 A;  1T5E A;  5C1E A;  2WY7 Q;  4PFO A;  4XOT A;  3G2B A;  3G05 A;  3VDX A;  2O17 A;  1MAB A;  3DPU A;  3MKZ A;  4XKW A;  1V0F A;  4BDZ A;  3OEE A;  2ZXI A;  2DXI A;  3UNG C;  3WWG A;  2XF5 A;  1H8H A;  2R7V A;  3ZIA A;  4IZZ A;  2GK6 A;  2HVS A;  4ITV A;  2QE7 A;  3KRG A;  2GJP A;  4II3 A;  4B3F X;  4XLF A;  2Z6B D;  3FBN B;  1KZL A;  2VB6 A;  4XKB A;  2JDI A;  1MMA A;  2M7B A;  3SDB A;  1J09 A;  2BVL A;  1GQ8 A;  4PSX A;  2K3P A;  2Z8G A;  1E1R A;  1CZF A;  1YX3 A;  1W0K A;  3K4M A;  5KHD A;  1IDK A;  1IB4 A;  2CUZ A;  3K4N A;  4BL0 B;  4HNU A;  2XF6 A;  2NSP A;  3K4J A;  4EW9 A;  1DQU A;  4NK6 A;  3BCD A;  4C9Y A;  3ZPP A;  2WZP P;  1Z3Y A;  4XOR A;  2WBM A;  2LH9 A;  1OB0 A;  2K5C A;  2PYG A;  2LRE A;  3U21 A;  3GQA A;  1LKX A;  3V42 A;  2OUM A;  2VJI A;  3DLA A;  4BQO A;  4E7L A;  3LSM A;  5JHF A;  3MMY B;  2W82 A;  3MD2 A;  4B44 A;  3T53 B;  2L5Q A;  3W2V A;  2VBM A;  4C2U A;  3EQO A;  2X3H A;  2K9L A;  1X1D A;  1W36 D;  4E0F A;  2VL8 A;  4HG2 A;  3BC9 A;  3H5N A;  3EUA A;  2LBF A;  2RNG A;  4XR6 A;  2WAE A;  3OS2 A;  2QKL B;  3GVL A;  2ZSI B;  2HU9 A;  4DGW B;  3MKY B;  1N78 A;  4B43 A;  3FKS A;  3TBI A;  3C2H A;  4XLC A;  3B8Y A;  3W2W A;  4DBQ A;  4HWV A;  3PNV A;  4U49 A;  2W6I A;  1R6R A;  1I8D A;  2CUJ A;  3ZGK A;  2WY8 Q;  3I3L A;  2L9N A;  1I18 A;  1BLI A;  2GJK A;  4CCK A;  2HVQ A;  2KP6 A;  4ZDO A;  3OYK A;  2VIX A;  4C2L A;  2CS3 A;  3KX2 A;  4TKO B;  3OYN A;  4OJO A;  4DIQ A;  1RMG A;  1K28 D;  4PSW A;  5CPR B;  1WJD A;  4ZJZ A;  4D1Q A;  1ERD A;  3ZQQ A;  3PNT A;  3BLY A;  2F6C A;  2O5R A;  3D5R C;  2V7Q A;  2KDO A;  3KYL A;  3H94 A;  3DDY A;  4P5O A;  2X6Y A;  2KMU A;  2CV0 A;  4MLO A;  3L2U A;  3VWB A;  2ELJ A;  1O8G A;  1LVK A;  4G7W A;  4NC7 A;  2HDW A;  2V9K A;  3K4K A;  1U0J A;  2LZJ A;  1OGM X;  2BOL A;  1VF7 A;  1LDK B;  4PJN A;  5LD2 C;  3LMW A;  1D0Y A;  1O8D A;  1H80 A;  2O0V A;  3DU6 A;  3OY9 A;  2VJJ A;  1ZEL A;  1O8I A;  2IQ7 A;  2JVG A;  2LY2 A;  2CV2 A;  2DOA A;  4G7X A;  3L2Q A;  4F52 A;  2LYC A;  2K9M A;  2QKM B;  4JMQ A;  3LL7 A;  2MAB A;  1EE6 A;  3VYS B;  3OPO A;  2KRC A;  1NG6 A;  3K4L A;  3DEE A;  2XDV A;  5FRM A;  1TT0 A;  3OL3 A;  3VSU A;  2V31 A;  4XD7 A;  4YZX A;  4G6T B;  3VST A;  3QYE A;  4XKV A;  4CSW A;  2BVM A;  3BCA A;  2L2O A;  2V4D A;  1IRX A;  2A5W A;  2M3A A;  4PK4 A;  2GJR A;  2JJ2 A;  1DGW Y;  3DU5 A;  4DBR A;  2X8K A;  1VJS A;  2IGM A;  3OYA A;  3JUR A;  2VBE A;  4Z05 A;  3OYC A;  1BN8 A;  4J01 A;  3HG9 A;  2NTP A;  2QY1 A;  4OJP A;  3MKW B;  3SZG A;  2WPD A;  1UD6 A;  4XON A;  4B47 A;  3GBG A;  2X6W A;  3ONQ A;  4XM3 A;  3CJR B;  2HZD A;  1BOB A;  4XKC A;  4IX7 A;  4IQJ A;  3OEH A;  4G6I A;  4DK1 A;  2XZP A;  3IAS 2;  3HC7 A;  2GOX B;  5AMV A;  3K6G A;  4RMN A;  2QXZ A;  1WJC A;  2JA2 A;  4HPQ A;  2XAU A;  3EUH C;  1DBO A;  3DTI A;  1X1B A;  1V0E A;  4YZ0 A;  3JU4 A;  1HVX A;  3QOD A;  1JTA A;  2VQC A;  3H35 A;  3LSH A;  1X0C A;  2MYS A;  3QYB A;  4FET A;  1JRG A;  3BCF A;  4CA0 A;  4KKS A;  3HUG B;  2L9S A;  4KIS A;  3PL8 A;  3KEW A;  1K5C A;  1MMD A;  2V1N A;  4PFP A;  4XLE A;  4Z06 A;  1O8L A;  1O8J A;  4BEH B;  2W1O A;  4PJM A;  5DN6 A;  2BSP A;  2V26 A;  1GLN A;  4P1W A;  4AYB A;  1X19 A;  3D5L A;  1W0J A;  4XOP A;  4TT3 A;  3T51 B;  4BU2 A;  4ZDL A;  1FX0 A;  4FAS D;  4F3Q A;  4IKF A;  1WJB A;  2XC7 A;  2ODL A;  1VLY A;  1MNE A;  2IGO A;  2KLO A;  3A4C A;  2DT6 A;  4ZYA A;  4ZTJ A;  3VR6 A;  4MXN A;  2KQR A;  3HOS A;  2WAD A;  2VLA A;  1UD3 A;  4L8J A;  3QYF A;  3VSK A;  3LNN A;  2MFZ A;  2W00 A;  3UR3 C;  4PJJ A;  4CCJ A;  5CKT A;  1E3Z A;  2BW3 A;  4TSF A;  1N77 A;  3VSL A;  4JQF A;  1PLU A;  1UEL B;  1OLT A;  2ZZQ A;  4HSR A;  4CCO A;  2R7T A;  2LRD A;  4UZU A;  2O1D A;  2CMP A;  4YZQ A;  4W8R A;  2X1E A;  3RPU D;  4F55 A;  1X4O A;  2LC2 A;  3ZR8 X;  1WJA A;  1T95 A;  1KON A;  3LFU A;  2IS1 A;  3TL4 X;  4CCM A;  2R7X A;  1W9X A;  4YZA A;  3T9G A;  3QOE A;  2M0M A;  2R7W A;  3OYE A;  2KVO A;  2KL4 A;  4RLQ A;  2PYH A;  3VMV A;  4F93 B;  2RQQ A;  3A3G A;  1QCX A;  3ZSC A;  4B48 A;  1LFP A;  1UAA A;  2A6T A;  1X1A A;  3DTE A;  2INV A;  3OYM A;  2X51 A;  1G8X A;  4E4H A;  1RWR A;  2X1D A;  4XL9 A;  4F91 B;  3CF2 A;  1NRK A;  4BDY A;  3TMO A;  3ZCO A;  4XN3 A;  4QPQ A;  1E43 A;  3DKY A;  3RCO A;  2M5S A;  4W8Q A;  3VMW A;  4NUB A;  2VQG A;  3H5R A;  1OFL A;  4PJL A;  4HIZ A;  4DNT B;  2R4G A;  2UVE A;  4BEH A;  3CP8 A;  4Y3O A;  4BJ6 C;  1E0E A;  3OL4 A;  1WJE A;  1Z3X A;  4RM2 A;  2IGK A;  1O8M A;  1COW A;  2V6E A;  2GOM A;  4OWR B;  3GQ9 A;  3LSG A;  3K4B A;  4CH7 A;  1QU3 A;  3EPZ A;  2Q2E B;  4U7B A;  2F5V A;  1FMV A;  1Y56 A;  4XMY A;  1T0F C;  1O8K A;  2PJR B;  1EA3 A;  2UWM A;  1BR2 A;  2JSP A;  2CH0 A;  2LBF B;  5FRO A;  5HOO A;  1SFK A;  4LIT A;  4XLA A;  5HNH A;  3LSI A;  4BE2 A;  3LSK A;  4URR A;  3F9K A;  1MW7 A;  3DPL C;  2V4J C;  4FXU A;  4Y4R A;  2M4K A;  4MR0 A;  2CFO A;  3PSI A;  3K70 D;  4NNJ A;  1VZ0 A;  3SEZ A;  2ZTG A;  2VXZ A;  2X85 A;  1BR1 A;  3OE7 A;  3A1Y A;  3FKJ A;  2NT9 A;  1KCD A;  3OMY A;  2FUG 2;  1HG8 A;  3OYF A;  4PMH A;  2DT7 B;  2JUG A;  1VBL A;  3DTK A;  4PUS A;  2HQA A;  3FBI B;  3W2A A;  1SKY B;  3NE5 B;  1WMR A;  3OYJ A;  4RM3 A;  3M8J A;  4HNT A;  4KKU A;  4E7I A;  4E6K G;  4QPO A;  4X0G A;  1BR4 A;  2I8D A;  4BJ5 C;  3D5S C;  3KEY A;  2F1M A;  4J00 A;  4JOM A;  3K70 C;  2XSJ C;  1BPL A;  2JJ1 A;  3HOT A;  1PJR A;  4Z03 A;  1WTH D;  4OJ5 A;  3GRH A;  4N4N B;  3FY3 A;  4R79 A;  4AVZ A;  4OZZ A;  5FRN A;  3GQ8 A;  3K10 A;  1UD8 A;  3PJR A;  1RU4 A;  2DCE A;  4GRI A;  3M1C A;  1WPC A;  1WP6 A;  2P0W A;  2W6J A;  2JVH A;  1QHG A;  3OYD A;  2IGN A;  2HPM A;  4LIU A;  1O8F A;  1V5F A;  1O8E A;  3PNY A;  2F4I A;  1S9H A;  2R7O A;  1W36 C;  1HZE A;  2WB1 A;  2D3L A;  1D1C A;  1BHE A;  4N4O B;  3DPT A;  2W4S A;  2MC4 A;  2X6X A;  4BXF A;  1YX5 A;  3B4N A;  4E7S A;  4OJL A;  4BUP A;  1P9Q C;  2O0W A;  2DJI A;  2WAF A;  3OYH A;  1DP3 A;  4KIT B;  5KNL A;  4KKT A;  2V7F A;  4BE0 A;  2E1B A;  1Z7L A;  3IP4 B;  3ZRG A;  1G59 A;  3OAA A;  3IAM 2;  3OIQ A;  3OW7 A;  3OYI A;  2R7Q A;  2WJY A;  3GVJ A;  1E1Q A;  2M4G A;  2IS4 A;  2LOO A;  1V5G A;  2WA0 A;  2CW8 A;  1X1C A;  5LFA A;  1MND A;  1EFR A;  1OFM A;  4CCL A;  2X1C A;  3OFN A;  2NTB A;  5IK2 A;  4E7J A;  4DOZ A;  5TGT A;  1E79 A;  2HNH A;  2KRH A;  4F92 B;  1QJV A;  4KT6 A;  1PXZ A;  3RTR A;  1DBG A;  2VXD A;  3OOU A;  2XOK A;  2JIZ A;  3PFY A;  4BQN A;  2E1M B;  2RRE A;  2E60 A;  4BE1 A;  4ZTF A;  3DKX A;  3I9V 2;  5CQE A;  3HAG A;  1MMN A;  1O8H A;  2KHM A;  3AL0 C;  4XQF A;  3OR2 C;  4BQQ A;  3PSF A;  3ZXS A;  4C2T A;  2KPM A;  2WAQ A;  1UD4 A;  3OYL A;  3A35 A;  2UVF A;  1FMW A;  2GK7 A;  2WJV A;  3DQV C;  2MD0 A;  3SEQ A;  3CMM A;  2VAS A;  1OGO X;  4HRI A;  4OZY A;  3A2K A;  1KCC A;  4NK8 A;  3CES A;  5FL7 A;  1WFX A;  3BG6 A;  4OAZ A;  2VQH A;  2XZO A;  2HPI A;  1D0X A;  2QX3 A;  1WJF A;  2BW3 B;  4E7Z A;  2CK3 A;  3OS0 A;  4P22 A;  2Z1D A;  3S93 A;  2Y0S A;  1OR7 C;  1D1A A;  2VJ4 A;  4H4K C;  5CDF A;  1PYV A;  3H9G A;  4XNF A;  4ANJ A;  4CUG A;  4B3G A;  2VQL A;  2M7A A;  1YE9 A;  4E7K A;  4BS9 A;  3S3M A;  2XZL A;  4LG3 A;  2INU A;  2ZXH A;  3BG7 A;  4IQ4 A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...