4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
1GQ8A 2X6YA 2PECA 1RWRA 2X6XA 1DBOA 4XKVA 4NK6A 1EE6A 1KCCA 3ZSCA 1O8MA 3VMWA 4U49A 1WMRA 3LMWA 1OFMA 3T9GA 2INUA 1OGMX 1QCXA 2VBKA 5AMVA 2ODLA 2PYHA 4XKWA 2NSPA 4Z06A 4XR6A 2QXZA 3EQOA 3FY3A 4URRA 1BN8A 1PLUA 1OGOX 3SUCA 3GQAA 1JRGA 4C2LA 1DBGA 1BHEA 1IB4A 1PE9A 1O8IA 1O8EA 2EWEA 1RMGA 3KRGA 1XG2A 2X3HA 4YZQA 1K5CA 4XN3A 1O8LA 2INVA 3UW0A 1H80A 1O8JA 3B90A 1IDKA 1AIRA 1QJVA 4PMHA 4I84A 2O04A 1OFLA 4YZAA 1KTWA 1O8GA 3VSTA 1KCDA 1PXZA 4MR0A 5C1CA 4W8RA 3VMVA 2O1DA 4XORA 4Z05A 2NSTA 4YEJA 1VBLA 3EQNA 4MXNA 4XLAA 4U4BA 2NZMA 2QX3A 3WWGA 4XOTA 4XNFA 2IQ7A 3B8YA 2VJIA 1O88A 4XOPA 2UVEA 4XM3A 4OZZA 1OOCA 4NK8A 3JURA 3GQ9A 1RU4A 2NTPA 2BSPA 3GRHA 1O8HA 4EW9A 1X0CA 2NTQA 2Z8GA 1IA5A 4OJ6A 4OZYA 4OJOA 1O8DA 3B4NA 3ZPPA 1CZFA 4W8SA 4XLFA 2X6WA 3GQ8A 2NT9A 2VBMA 4OJLA 1O8FA 4OJPA 2O17A 4YZ0A 4OJ5A 4XL9A 4YELA 4W8QA 1IDJA 3VSVA 2O0WA 1HG8A 2UVFA 4W8TA 1JTAA 2X85A 4AVZA 4XMYA 4XLEA 2NTBA 2VBEA 4XLCA 4Z03A 2NT6A 3VSUA 4HWVA 5C1EA 4XLHA 2O0VA 3GQ7A 1O8KA 4XN0A 4XQFA 4YZXA 2VJJA 1NHCA 4XONA 2QY1A 2PYGA
chains in the Genus database with same CATH superfamily
2BN4A 3GSIA 3EUKL 1ETOA 5A2QK 5DV5A 2YUHA 1E63A 3TOAA 3D0SA 1ZM4A 1JE8A 3LFKA 4F92B 5E18F 4X7CA 1SD5A 2KHMA 2K9QA 3H1CA 2MABA 3H5NA 2ZC2A 1O8MA 3BQZA 1KK2A 5E3MA 2G7HA 4PJNA 4C2MJ 1WI9A 4PSWA 1L0OC 1I7PA 1F1ZA 3I56B 3T1BA 4D5CA 1U8RA 1VTNC 4M3BA 1E3HA 2DU9A 3HSRA 3GLLA 1VQMI 2DOAA 2PMZN 4LD5A 5CVJA 2VQGA 2JUCA 5CJ9A 1T98A 2DK5A 4KICA 3E6CC 2C6YA 3B82A 2X0KA 1OGOX 3GCMA 1Z67A 1V0FA 5BQTA 2XGCA 1JRGA 3HJEA 3LQEA 2PN6A 2EINH 2NVYJ 3CZ6A 5FKMA 3CP2A 5BOXA 1FMWA 1UD2A 3S2DJ 1O8EA 1BIAA 3ERED 3S93A 1W5SA 5LRRA 2X3HA 2QE7A 1EWYA 1N06A 5DM7F 3HHHA 1FC3A 2I5UA 3M8EA 3QODA 2VKHA 2R9VA 5GV8A 1H80A 2AQEA 3R61A 1HSTA 1EA0A 2BXYA 1OQYA 2YPRA 3ZQIA 2E2IJ 1P2FA 5FO0A 3Q0WA 3A3GA 4OAZA 4YZAA 1KTWA 3T0YA 3GVJA 2GK6A 2PX9A 2X3UA 4MR0A 1QRCA 2V4JC 2A3SA 5IOZA 2H8RA 1D2EA 1DGWY 1X19A 2D1VA 4XRSG 1KU7A 2BV3A 3EUHC 3LQQA 1RZ4A 4MFEA 2WV1A 3K70D 4DK0A 2JA2A 1NTCA 1VQOI 2H6BA 1S7OA 5J6XA 3CCEI 1B9MA 3H9NA 1MJBA 2GXBA 4OP7A 5JLXA 1IXRC 2XPVA 4C3IJ 1YIJB 2F5EA 4LLLA 3JQQA 3NE5B 3IH3A 4OZZA 1BI0A 3K6GA 4RD1A 1RNLA 3GTKJ 2CG4A 3AGPA 3CDIA 5JMCB 5IYRA 4EQQA 1T38A 3SFZA 4O5VA 2EPFA 2UUZA 2ZMEB 1ZYRF 2VONA 2K3FA 2NVTJ 5DCMB 5HS8A 3ZZTA 2QTLA 4F7DA 4GDFA 2ZTGA 2FE3A 1O8DA 4W8SA 4A3JJ 4DJAA 2Q2EA 2IGKA 2GM4A 1FOKA 2C5BA 4BNCA 1QU3A 2GJKA 5J1UA 4TV7A 4BE0A 4PGOA 3CC2B 2O17A 3WTSC 5GAHJ 4XBFA 4JQFA 4F93B 3OYKA 3C18A 4FCYA 3MCAA 5J3OA 1IXCA 3CCVI 5DDGA 3E1SA 1J0RA 4UV8A 3ZN0A 1W0JA 1IRGA 1N75A 3NAUA 2E2JJ 3EUHA 4NHJA 2IW5A 1HC8A 1CQXA 2HI3A 2JRMA 2ELHA 2LC2A 3JRGA 4PCQA 1W1WE 5TY0A 5L3GA 1WKMA 3I71A 4HZFA 1KK0A 4KMFA 2DPUA 4RA2A 2JVHA 1ETWA 2PMUA 2QQ9A 3IAM2 3PO2J 3C2BA 1SMYF 2EFQA 2HTSA 2KP6A 4QWQA 1BR2A 2PIAA 1DBOA 2FBIA 2X1EA 1Z7LA 3W2WA 2ZXHA 2AXTC 2LDUA 1ZARA 2QQBA 3ZPLA 3N05A 1VQLI 4C3HJ 4RAZA 2XF5A 3I64A 3TDUC 5LLQA 2RC6A 1U9OA 2LLKA 3AGQA 4N3GA 1GR1A 4P12A 2CUJA 2Y2ZA 3WTUC 4PC1A 1FRQA 1KU9A 4RAGA 2MH2A 5EEGA 2VJ5A 1LDJA 1OYYA 4L8JA 1HLVA 4RM0A 2K27A 3S1QJ 5FLXK 2M9HA 2WADA 3L00A 1NG6A 1BHEA 3DTKA 1RQPA 4RS8A 1CZFA 2EWNA 2P3MA 1LE8B 4RB0A 4PFOA 4PUSA 1ZG1A 5LGTA 5JLWA 3H9JA 3A2KA 2WYRA 1V0EA 2W84A 5JHUA 1W0TA 3S3MA 2FRHA 1A6QA 3W2HA 3FK7A 2INVA 3UW0A 5EEAA 4KA4A 2HOEA 3F6VA 4Z2YA 1OGIA 1VQ4B 3F8CA 1Z6TA 2WPDA 2DA2A 1OCCH 3GVLA 4M4SA 3J81K 3NARA 2JVGA 2M8GX 5GTHC 3HOVJ 1SVMA 2JJ1A 3N90A 4AC0A 2DFEA 4IQJA 4GFBA 1WORA 1VQ8B 2ZMEA 5HNHA 4P22A 4ZCLA 3OL4A 5JR3A 2I8DA 1XE1A 5DCMA 3H0GJ 1A31A 1BN5A 2P5LC 1GAWA 5JVTA 1GLNA 3BJOA 2NZMA 4Q5SF 2IS4A 3GMEA 2K85A 1R71A 3ABKH 1DP3A 3FXKA 1FJLA 2PI0A 5ILVA 4LITA 3PIPF 3F8BA 3WG9A 1ZG5A 4HX8A 3I55I 3TO7A 1Z0XA 3WE3A 1KZLA 4F3QA 1VQPI 2ELJA 1TSPA 1YOVB 2R7QA 2CBXA 3FKJA 1TBXA 1TYVA 5KSWB 3S16J 1MH4A 2ADUA 4ASNA 3OYIA 4IO9F 1F20A 2ZB9A 4G94A 4EW9A 2NNYA 2Y9ZA 1MABA 3BTJA 4YHBA 1IA5A 2GLOA 1RKTA 2VXZA 3HIFA 3R4KA 4PC2A 4C0SA 4DZPA 1MNDA 2DEUA 4BQQA 2ZTNA 1T95A 4EJOA 4HNUA 5FO5A 1EP1B 1IB0A 2VASA 2OD5A 4KKTA 4AC9A 2IVMA 4UXNA 2VBMA 4KH3A 1O7FA 1WSUA 1DG1G 3DKYA 4UZFA 4G7OF 2FA5A 1T6SA 1BW6A 4BUPA 2XTYA 3KP3A 2OYNA 3U1KA 1E1RA 2E1RA 2O0WA 4RPBA 1FX7A 4ASUA 1VNDA 5FFXA 3GWZA 2HYGD 3HRMA 3QOEA 1J59A 3O8HA 2IEKA 4CO8A 1G4DA 2NT6A 4RDUA 2JT1A 4A0YA 5EEHA 4EM1A 1Y6IA 3LMMA 4RM2A 4HSTA 5AIQA 5FRNA 2BMWA 4RDLA 1M90D 3VYSB 4XIDA 1YX5A 4YZXA 2ZZQA 2IXSA 1MDMB 2UXXA 3KEYA 1GUUA 2DMQA 3CCYA 2F5FA 5IYCJ 3ONYA 1Q7YD 5IYPA 1IV6A 3M1EA 1YI2B 3K4LA 5A89A 2ZXWH 4CZCA 1HW2A 1ZM2A 2WB1A 4BJ5C 1AKHB 4NK6A 2KVOA 2ZL5A 2XC1A 1LE8A 1I6XA 3H35A 1HF0A 4DQKA 2PJPA 4R1HA 4U49A 3S8PA 2FEZA 2PG4A 1I1SA 2XPWA 2DT7B 2OBRA 1UHSA 5K7FA 1VF7A 2W7ZA 3WGGA 4MNUA 2VUMJ 4P5OA 5L3EA 1QA1A 2XGDA 3BPVA 3P9CA 4L9TA 3ONQA 4KT5C 2J7KA 3FY3A 2JTVA 5J1YA 1OFEA 4ZC3A 3K2ZA 3HEFA 5D5XB 5LBQA 1WTHD 2PBIA 4I6ZA 2CW7A 2FD5A 3BJ6A 2DA1A 2K4JA 2LZJA 3DPTA 3OAAA 2MSYA 4ZJZA 2BBYA 4RLZA 2HQ5A 2H8WA 3X2QH 1GVHA 1YG2A 2EIMH 3KRGA 4GRIA 4Q47A 2QGGA 2EZIA 1AA7A 4WX9A 1FNNA 3EDPA 4CCOA 4CCKA 3CCUI 4X05A 5DCFA 4Z4SA 3J81k 2R7DA 4UNOA 4QSHA 1X3WB 4EEFG 2JSPA 3RPQA 5HOOA 2BEOA 1Y0UA 3CC4B 2JWTA 5ILSA 2COBA 2TRTA 1FNCA 4W8RA 2RGVA 3MQ0A 3J80Z 2D3NA 2R7TA 3SY2A 4YEJA 3RSNA 4FHTA 4HE5A 1GV2A 1P4MA 5J35A 2CV2A 2LMDA 1EP3B 2Y9YA 2YX7A 3BZKA 3M9AA 1FSEA 1IN4A 1ZGAA 2ZXJA 3WU0A 1XPXA 3V76A 2HNHA 1QUFA 2FBHA 3LSJA 4FE7A 3SLNA 1R6RA 3PO3J 3DXJF 3E6MA 3CPXA 3SJMA 5E3OA 4FXUA 4RD2A 5M5WJ 3Q6RA 1WJ5A 2ME6A 2KIQA 2Z1DA 3DF8A 3Q39A 1BQEA 4LC0A 1KONA 1R4NB 1PJRA 5B66C 4OJ6A 3ZZ0A 2W25A 4OZYA 2QQ8A 4KKUA 1MMNA 2DO7A 4YAUA 3IKVA 3C1DA 2A5YB 4XLFA 3JRFA 2NVXJ 2KPMA 5BS6A 3FPKA 2X6WA 3GFMA 4EGYA 4A3FJ 2XASA 3A0BC 4L9JA 3ASQA 3P9IA 4ON0A 4IRHA 1MDMA 3AVXA 2BVMA 4W1UA 1QVGB 1O57A 4W8QA 1SFXA 1QZEA 4UVBA 3F8MA 4OOIA 3GFJA 2E5ZA 4CSWA 1PVEA 3H3UA 1HVXA 3WTYC 1IRZA 3SDBA 1AKHA 3ZMVA 4ENJA 1KA8A 2FSWA 3H09A 4ENKA 2V7QA 1Y0NA 2NPFA 4JX5A 2OTJB 2XF7A 1BC8C 3U2RA 3AL0C 5KAIC 4IF4A 4E70A 3WNBA 4WF2A 3DWLE 2X51A 4BDYA 1WQ2A 2LR8A 2VJJA 3N97A 3SQVA 5KAFC 1AMOA 1E1QA 2COMA 1K83J 1FNBA 1X58A 2X6XA 3MEXA 3VSKA 3V8KA 4HEA2 3I53A 5IP9J 5HXBA 4PJLA 1KGSA 3TGNA 4ENNA 1VQ7I 3DEEA 2P5VA 1RESA 2QGUA 2EFNA 3GZ5A 4TSFA 1FTZA 3HM5A 2R0QC 4EJTA 2MC3A 2MYSA 3ZMSA 1EFRA 5K7HA 1K78B 3V42A 4ABZA 1YJ9I 5J8FA 2NSPA 4Z06A 3DU6A 2JN9A 3E0JB 1OCOH 2R5ZB 5HODA 1S7EA 3F72A 5ICCA 2HKXA 2F5DA 3DP7A 2E34A 2RC4A 3Q9VA 2KLOA 3IHUA 2BY3A 2DETA 4LIUA 2O03A 3GXOA 4MEYF 3FISA 2BM6A 2KKOA 3HGGA 4KIFA 4ZGQB 2IPQX 3OZWA 2VN2A 4YDTA 3S15J 2CSOA 5H20A 2F1LA 2E71A 2LYCA 1LQ1A 3BY1A 1BL0A 1UB9A 3KL9A 1XGMA 4RD3A 3JAMZ 2BHYA 1S7AA 1AIRA 4KMUX 1E3OC 2O04A 4RCYA 1OFLA 1TYUA 4U7BA 3VSTA 1U2RA 1ZH5A 3WTWC 5C1CA 1MMSA 3VMVA 1V5FA 2O1DA 4KN7X 1WU8A 4ZZDA 4P26A 5KW9A 3S1NJ 2DMPA 2M2EA 2DOFA 3M1CA 4MFDA 4HF2A 1JKOC 4G7XA 2YWGA 2JPCA 3WTXC 3L09A 1Y1VJ 3O3KA 3ZIAA 4YAFA 5HLGA 3CCMB 2QSFX 3K0LA 1QFZA 3HG9A 2ETHA 1AU7A 2D3LA 1O3QA 4N9IA 2H6CA 2QTZA 1OOCA 1Q81D 3KZZA 4UUSB 1B72B 4RM3A 1D0XA 2KQRA 2L01A 3CJTB 3NWTA 4CICA 4AM3A 5C4JJ 1X1CA 1QVFB 1C0WA 2DFIA 3H5RA 1LVKA 3JRHA 2LK2A 3BZ6A 3ROUA 5BNGA 3MKWB 2VODA 5E3LA 4EMSA 4HPQA 2Z8GA 2WBMA 3ZQ7A 1LFUP 3IWFA 2A6HF 1VQKI 2FX0A 2LKSA 3LQ6A 1OMIA 4Z4TA 2IOUG 1IAWA 2V31A 3AKZA 5D8LB 3U9GA 3G71I 3OE7A 4OJLA 2QQAA 4J0QA 1JA1A 3E20A 2QLZA 5FO1A 1G3YA 1I6HJ 1HKTA 1V5GA 4A2UA 3CMEI 4NNJA 3E6DA 1OCZH 3R6SA 1GO2A 2OZUA 2QF7A 1USSA 3M3YJ 2F4NA 1WJDA 5BMZA 1Z1DA 2EIKH 5IYDJ 4ESFA 2PLYA 2VZLA 3GYHX 2QSHX 1MBKA 3T8TA 2VFQA 3WG7H 4HLXA 4GYIA 3V7RA 1K78A 2CV0A 2O5RA 2CV1A 4QV2A 3WQZA 1Y39A 2XAUA 2R5ZA 4FASD 3KZIC 2EZHA 5TRDA 2VOPA 4BDZA 4M1KA 4Z4ZA 5CVRA 3CCLI 3RPUA 1H9TA 1S4MA 4RD4A 3PSZA 3HKZA 1F9NA 1FIAA 1QPIA 2RVCA 3OKXA 1W5CC 3HRTA 4ESJA 1J9IA 5IYNA 1J75A 2EH3A 4A5NA 3BR2A 5K5OA 4CQJA 2INUA 3TH0A 3DBRB 1R23A 1Q9SA 3LL7A 3LO8A 4G7HF 4M3FA 3CF5F 3PSFA 4XKWA 2PJRB 3S14J 2V7UA 3ISXA 4P1VA 1K4TA 1LM1A 3BC9A 1E3PA 3BROA 3P9KA 1F43A 3F8NA 2YUSA 3QYEA 1OR7C 4J19A 1ZKGA 2QZAA 4UZUA 2HVQA 4YFKF 4X1EA 3CC7I 1T2KA 9ANTA 3CO6C 2R7OA 5E3NA 1XG2A 1QGAA 1SEUA 3S32A 4HNVA 3CD6B 3EYYA 2B63J 1GVJA 4TMVA 3BY2A 1PJ5A 3I4MJ 2L4AA 5DM6F 2DQLA 2RQPA 2OA4A 3AFHA 5CPRB 1EH6A 1ZLJA 1YITI 5FL7A 1WJFA 4LLGF 2L9NA 4BL0B 2A6TA 3AG1H 1SC7A 1H89C 4XK4A 2P4WA 4L5JA 2RAEA 3MD2A 4UUSA 1B72A 5H5JA 3HOZJ 2OU2A 2FVGA 1HKQA 3RKYA 1J9ZA 2L7FP 4XLAA 2JDIA 3M4OJ 2VE8A 4HIZA 1JXSA 4LMYA 1UD5A 3QYFA 2EFOA 3TEDA 1P4AA 1X3ZB 1SVLA 3MN2A 1YO5C 2YU3A 1FDRA 4OOSA 1FP2A 2F2EA 3MZHA 4M9ZA 2RREA 3HRUA 1NK2P 3PENA 4QFMA 5F64A 1XSVA 3L2UA 2R4GA 2QA4I 5LFAA 3SEJA 2NTPA 4KUMA 4TMTA 1LFPA 2M1BA 1B9NA 2DDAA 3HOXJ 1ZM3A 2BVLA 4I09A 2DA6A 1YJWI 3TO9A 2BE5F 4ZDOA 3K4KA 4Z4WA 2MD0A 3A02A 3B02A 3L9FA 3U6BA 1CQTA 3VYTB 5CDFA 1E43A 2X0LA 3AVYA 2BYVE 1U5TB 2VBZA 1YYVA 2FXAA 2J5OA 4G6QA 1OJLA 1YW8A 4F7ZA 4XL9A 3SZEA 3HOWJ 1VQ5I 4QIWN 1GXPA 1YHQI 4LK0F 2VQLA 1RC9A 2VBSA 1WH7A 3ASSA 2IA1A 1EFTA 2LP0A 2DFFA 2X85A 2XAFA 5M5YJ 2B5OA 2M45A 3ABUA 4XMYA 2KRFA 3BQJA 2FOKA 1E79A 2VBVA 2ZKZA 3H36A 4XLHA 5IYBJ 3A4CA 4I76A 4FT8A 3OYBA 4D9JA 1WFXA 3DTEA 2UWMA 2B9SA 2X9DA 3QPHA 2PJRA 2ESNA 4XONA 2E1MC 2QCOA 3OYGA 1XC5A 5C3EJ 2WSSA 1EFUA 3RZOJ 1MKMA 2XPUA 2IA0A 1N78A 4U0VA 1GV5A 4M3DA 5FA6A 1KCCA 1UG0A 3CMAI 1YW9A 3F22A 2O61A 3E3VA 1NHAA 3GUDA 3LA7A 1OFMA 1G2HA 3JX8A 1VQOB 1YS7A 4EJWA 3DEUA 3CCJB 1OB2A 2XRNA 3D5RC 2B7BA 2R7VA 2XGXA 3ECHA 4URRA 3PVDA 2JJ2A 2RN7A 3OYEA 2DQRA 3NRVA 2GJRA 3GQAA 1DBGA 1TWFJ 4TMZA 1IG7A 1UHWA 4Y17A 1OGJA 4KT6A 2V7TA 1RR7A 2W1OA 4LGWA 3TBIA 4P6YA 3AK5A 4P9SA 2EV6A 4QPOA 4PK4A 1K6YA 1G8XA 1YIOA 1DUXC 4HAMA 1D1CA 2HDDA 3OW2B 4IW3B 1B6AA 1U9NA 3J7YJ 1J09A 4FX0A 5TGTA 2DMUA 3TP3A 1WSVA 4AF7A 2WAQA 4AIHA 1R9TJ 1PP8F 3ZMUA 1ZK8A 4M3GA 2K40A 2VKEA 3BCAA 3MVPA 4RGXA 3OYLA 1X2MA 3LYCA 5F1RA 2LREA 3W2FA 1U8BA 3Q9SA 2E1NA 4FX4A 3A3BA 1Z3XA 3CCVB 1IW7F 1YX3A 1T08B 2HDWA 4NQWB 3RKXA 5GTIC 1IJWC 3ZQGA 2DCUA 1ZELA 1FY7A 5EYRA 1RRJA 2GREA 4B47A 4HV6A 1JKQC 5GAGJ 3VO1A 3WBJA 4MIMA 3O2PE 4RAFA 2XTWA 4HOBA 1JB9A 1E62A 1R5NA 2XOKA 2BVNA 4XD7A 1U5TA 1YLOA 1FYMA 1T33A 5EG0B 3GVKA 1EJ9A 5M5XJ 4NK8A 1LDKB 3FHNA 3CDLA 4C2TA 1N0UA 3SFIA 4P3IA 3S17J 1S5LC 3ZQFA 1RU4A 2RNGA 5FD5A 2VNJA 1G3SA 2XTXA 3MKYB 2CYYA 2JK3A 4UB8C 3C2HA 3BR1A 2ECBA 5LGUA 2NOJB 3DDYA 2L5QA 2XAJA 3OIOA 2DK8A 1ZUNB 3FBNB 3QFCA 4IPAA 2D9RA 3ZPNA 1NK3P 3GQBA 3F8FA 1G3TA 4BE1A 4JBAA 2WB1N 4CHUA 1HA8A 5FIUA 1KQ8A 3PNVA 1S72B 3OL3A 3VFZA 1D1BA 3CP8A 2W57A 4CCMA 1N77A 2F1MA 4KKSA 4IJAA 3PUBA 3V7CA 4EATA 1O3RA 1YS6A 1V55H 1H8EA 2L2OA 3BH6B 1XGOA 2ICWG 4XLEA 1QH0A 2VLAA 2LY9A 2O0VA 3W3CA 1QRBA 3GQ7A 3IWZA 2A68F 2LVSA 5HNFA 1RUOA 1JJ6C 5F1JA 4X8IA 2O9LA 2KFDA 2BM4A 2ME0A 1K7AA 1ULYA 1Q1VA 5LEJA 4X7DA 2VC0A 3K4JA 2DOEA 2Y0MA 1E17A 4K1XA 1EXMA 4WZLA 2VIXA 2XB0X 2STWA 1R5HA 3HC7A 5DD8A 1KJZA 1ELOA 2F5VA 4CXFA 2B7CA 4YFNF 3K69A 3G4SI 2V1XA 3VMWA 1QNTA 3RQIA 2VNIA 3FZVA 1W7PD 4Y7NJ 1QVUA 4TT3A 1ON1A 2HWVA 5DTDA 2YWFA 5K5QA 1LJ9A 2KJCA 2ZFUA 5D5UB 1Z9CA 1CGPA 2DW4A 1LLZA 1ZLKA 3F6OA 4MGRA 3I55B 3BR6A 1JGSA 1VQPB 3CLOA 4DYRA 4L0ZB 4H4KC 3I56I 4U0YA 4OOVA 2DLLA 2GA2A 1K73D 3ASRA 2DA3A 3CRZA 5CVVA 3QP6A 2ZMEC 3BG7A 3CCRI 4X7EA 1QVTA 1A8PA 1DABA 6PAXA 2J8IA 5J4VA 4NQWA 3C2GA 3S2WA 3PUFA 1DARA 3ZMTA 2L9VA 1ETXA 4BQAA 3VNVA 4IHSA 2GIZA 1UJ8A 2F3LA 3K4BA 1CNEA 2EB7A 2K3PA 2LFBA 2V1NA 3QU3A 3IC7A 3QPLA 2LTPA 2FUG2 1O8GA 1FT9A 1WCMJ 2OK7A 4IOCF 5EG0A 4JX6A 4HX4A 4I02A 1WI3A 2HPIA 3ZR8X 4YG2F 2DFHA 3K4NA 3IV5A 1GAQA 4YAWA 3SJZA 4Z05A 3I58A 1ZREA 4AU7A 1F60A 5CVUA 4XNFA 3BY6A 4PGGA 5IT9K 2K5CA 3LSKA 3DKXA 5BPDA 1IF1A 1MBJA 1R7JA 4G1BA 5EZHA 1HSJA 2BY1A 4Q4ZF 2ZL6A 3FDYA 4B3AA 4AIJA 1GT0C 4DK1A 1QGPA 3M7GA 2UV1A 3QPSA 3OYAA 4BHCA 1XX5A 5LHHA 3VB2A 3GZNB 4Z6YA 2UZKA 2JA5J 5HLIA 3BG6A 4B48A 1IXSB 4A3CJ 1JHHA 1ZAOA 3W5UA 4E0FA 2NTQA 1P4WA 3CB4A 2BV6A 1IHMA 2RQQA 4OJOA 3LWFA 4F52A 3S1MJ 3QU6A 3P27A 4B3GA 2AO9A 1B59A 1ZRCA 4E7ZA 1BIBA 1XB2A 2J8KA 3LA2A 3W2EA 3J81Z 2MGQA 4C9YA 3MHPA 3K70C 2R7RA 4E4HA 5EMNA 2WAEA 1IDJA 2EJRA 3BR3A 3VDXA 3LSMA 3H5AA 2CUZA 3MZYA 3ZCOA 3RY8A 3JTHA 2JZYA 4FK8A 2O6WA 4EM0B 3DEWA 3JSPA 3FPPA 3JRCA 1BI1A 4Y52J 5HS9A 1RETA 3KP7A 3LSTA 2VBEA 2CO5A 3W6JB 3VSUA 5D4RA 1T6YA 3SEQA 5FKLA 4HV5A 4AIDA 2L4MA 1REPC 3A8IA 1JUPA 4XQFA 1STZA 1IN8A 3QSYA 1PUFB 1NHCA 4I7HA 2OJED 5L3CA 2WV0A 1VI0A 3VR6A 1ZR4A 4A3LJ 1JT0A 4HW0A 2K9NA 3DLAA 4A3EJ 1HBXG 1OCPA 2MD5A 4L9VA 3OYCA 3IRRA 1GVDA 5D4SA 2BZTA 2Y75A 3GF2A 4NBQA 2NVUB 1R1UA 3NAWA 2PFBA 4RBOA 2JN6A 3LSPA 1TLLA 2GOXB 1OCTC 1K8FA 5KVRA 1S8NA 1N0VC 1OGMX 2VFPA 4G12A 1BJAA 1R22A 3BOQA 2CGPA 3QFRA 5LRSA 2PMZA 1MSEC 1WSRA 2XT2A 3EQOA 3HUGB 3BH7B 4C43A 2XZLA 1JTYA 3GBGA 4A3KJ 3WNDA 3JRIA 5LD2C 2GXGA 2Y69H 1K4ZA 1B8IB 1A6IA 4P6VF 2PMHA 2EA4A 1JHFA 3P4GA 1V5EA 3GTOJ 2VBUA 2P7VB 3VWBA 1BPLA 4JP0A 2HVRA 3CESA 1ORKA 2G0EA 4ESBA 3DBLB 4P1WA 3CMMA 1LFBA 2XC7A 1TWGJ 4PMHA 1KD1D 1ETQA 4BHPA 1Z3YA 3FXUA 2Z33A 3GIRA 2C4TA 2CFXA 3RYPA 3JU4A 4FE4A 2BOLA 2V9VA 2FMYA 1KCDA 2OPTA 1X4OA 1DPRA 2HQNA 1AIPA 1DDNA 5ILUA 3CQZJ 1OHHA 1UG2A 3HAGA 4KIGA 4FTHA 2DOGA 3A0HC 3FF5A 1LLWA 4XOTA 2OTLI 2R3SA 2DJNA 4RGSA 5ICFA 4UAJA 2BGJA 2HMAA 5F4JA 3CJQB 4M74A 2UVEA 3ECOA 1SMTA 2KDOA 1PDNC 1IV8A 2M7AA 1QZZA 3PSIA 2V9KA 4JRAC 3Q6QA 1XCVA 4U87A 1UD8A 1R00A 5LHGA 3OSGA 2BX6A 1IRXA 3K7AJ 3I4NJ 2ZJPF 2P8TA 5CKTA 3PQJA 3A1PA 5E6TA 1D1AA 4L18B 1HW5A 1PJ6A 3BCFA 4E7LA 2ZITA 1KU3A 3B4NA 2X4HA 2M3AA 3FMQA 3K4MA 5LEKA 4UV9A 2C4UA 1YJ9B 1PUFA 2EBIA 1XFOA 4YELA 1OLTA 2JA8J 3ABTA 5TISC 5KCMA 2ACJA 1OB5A 4XICA 5BSYA 1W34A 1TWCJ 4IHWA 3ZUGA 3T51B 3FM5A 1HDPA 4M53A 1ZTRA 3W5VA 4NUBA 4BKXA 5FKOA 1EP2B 2ZZEA 4M0LA 5C1EA 3CJRB 4BXUA 1J5YA 3WGHA 2EV0A 1G59A 3HOYJ 2V1DA 4PC7A 1F36A 1WJEA 2M34A 1T56A 2V6EA 5D5VB 4HQEA 4B43A 1ERDA 3HUGA 1VQ9B 2XGJA 4HF1A 3EUAA 1QHGA 1LPQA 5CQEA 3EQLF 4NC8A 2M8EA 2K9SA 3DQVC 1CF7B 1B8IA 3PUMA 5E20A 5JBQA 3DPLC 2KDZA 1MJAA 3SZGA 2J5PA 2LY1A 1WMRA 2WWYA 4V02C 3HPHA 2EFPA 4DIQA 1ACIA 2YS9A 1IDYA 4WQMA 1RR8C 4DYQA 4G6DA 2DT5A 2E1CA 1GDTA 3ASOH 4NC7A 2QYUA 2O3FA 4GYGA 3B73A 1TW2A 1PKVA 1OB0A 1WGXA 4HF0A 4N9HA 1T5EA 4L0YB 1IB4A 2MLGA 1A04A 4EV0A 3GVAA 4JMQA 2O8XA 3ISPA 2CS3A 3FXMA 4UUVA 3K1NA 2H94A 3VSLA 1Y0YA 2Z6BD 2IP2A 2W85A 1AOYA 4OPOA 4YZQA 1WWXA 2MA3A 2LKXA 2LH9A 2O0YA 4F55A 1KYWA 3FM3A 4KISA 3PNYA 1VQKB 2M0CA 3QFSA 3Q5FA 2X48A 5K7ZA 2L3DA 3MCZA 1USTA 3G71B 3AVUA 3HSFA 1MH3A 4BEHB 3CLQA 3I3LA 3E5UA 2DA7A 1E3XA 1R36A 4J01A 2ISYA 3PIOF 1SKQA 4AUXA 2D1HA 3CMEB 3IL2A 5ED4A 3JRDA 1WP6A 3K9TA 2M30A 4KITB 4CDGA 1DDIA 2CUFA 2JSCA 1KQ9A 2EFGA 2XZOA 4DNTB 2ESHA 1EFCA 4G6TB 2M5WA 4WZTA 4KIBA 4X0GA 4WWVA 1D8TA 3SZTA 1MJ9A 2XVCA 2ZNZA 4P55A 1D5YA 2VBTA 4TMXA 3G6EB 4RB2C 4D0PA 3V7AA 1BX0A 1IZ1A 3LSHA 3WBKA 4EH1A 2E1BA 3OR1C 1MBHA 1TT5B 3CCLB 1TP4A 3KEQA 3L2RA 3CPWB 3GW2A 1W36C 1OKRA 2GJPA 2VJ4A 2QDXA 1D1NA 2CQXA 2HGCA 3JAMK 3Q3SA 4FETA 2KRCA 4PAAA 2LNBA 2XROA 1TZLA 4OJPA 3BQYA 2HQAA 4QUZA 1TYWA 1LNWA 3WHCA 1SD7A 5FD6A 4OMYA 1OFCX 5HS7A 4RB1A 1HDDC 2M0MA 3HOSA 2BM0A 2P81A 2HS5A 4E7JA 3CC7B 1HG8A 1H8AC 1CF7A 2OBTA 1JTAA 2IS2A 4BPRA 4IOAF 4YFOA 1R58A 4ZTFA 2VI6A 4A3BJ 1VQ6B 3KP4A 2JQ7A 3GTPJ 1SANA 4XN0A 3U1DA 4KYWA 1MD0A 4WZKA 4Y15A 4V2FA 5TV2A 4M6YA 4G7WA 3LSGA 4J00A 3W5HA 4YXWA 2QM3A 1MW7A 4I0AA 5HLTA 3QAHA 5EGOB 5FB2A 2P6TA 2TDXA 4RMNA 1SFUA 2X8KA 4RB3C 2DBBA 4UHTA 3JCUC 2IGMA 5JI6A 4NDLA 1OYIA 3A8KA 2VC1A 2ZXIA 3ELKA 1GHCA 3B6CA 2QEXB 2FQ4A 1B1BA 4OWRB 3T9GA 1E3ZA 5CLSA 1LUJB 2DAOA 4MLOA 2LF7A 5HZAA 1QCXA 4S0HB 4A3MJ 3TKYA 5FROA 3OY9A 3VPRA 2FU4A 4Y13A 2P7CB 3K4CA 4O6JA 2HZDA 4DBRA 1HKSA 2F43A 1QHHD 1KQSB 4BEHA 5DS9A 2XT4A 1X4PA 2W00A 2BY0A 3MKLA 4K2EA 1P9QC 5FNZA 2KIMA 3BC8A 5CYVA 3P5JA 2QA4B 3H94A 5F0HA 1IO2A 4WXCA 1E0EA 3OFNA 4LLNA 1VQLB 3WYAA 2DMTA 1YJNB 4ZYDA 3ZBUA 3KPHA 2IBDA 2XB5A 3SQNA 3W6KB 2OZ6A 2HDCA 1IDKA 2CQQA 1T6XA 4ZTJA 2FNAA 4UVAA 3CCSB 1PYVA 3CMYA 3CCQB 1D0ZA 1I3QJ 1I50J 2KJBA 4MTDA 4MEXF 2GQFA 2VE9A 1XSDA 1VQ5B 2VPRA 5D6EA 1YHQB 1XTAA 4RDJA 4I2OA 2R7WA 1G7RA 4A69C 3PUNA 1LVAA 2AXLA 1HZEA 3QQAA 1N8RD 3WWGA 3Q0VA 1W4MA 4A3DJ 2CMPA 3SYTA 2IAIA 1HA3A 2X1CA 5E8IA 1RIOH 3IP4B 4M6XA 2ELKA 5BPIA 1WZ2A 1JJ2B 4CH7A 5F4OA 3LAPA 1V3FA 5IOYA 4UVCA 4OMZA 4AVPA 3S3OA 3H0DA 5DUIA 3BP8A 3FJOA 3KE2A 5GPCA 4PDKA 4E7SA 2R7FA 1OCRH 3KFWX 2CW5A 2DA4A 1BOBA 3CDHA 3CMAB 1QA3A 4I99C 3I5UA 2FNPA 4ZYEA 4KJZA 2I1LA 1ETKA 1FP1D 2QVOA 3KCCA 4YEIA 5L46A 3RKQA 4OPWA 4QHYA 1WXRA 4RD6A 4MQ9F 3GQ8A 4WXDA 4LB6B 3HRSA 4X6AJ 2DTRA 4CCLA 3D5SC 4JYKA 2ZBUA 2F4OB 2ZL7A 5GV7A 1U2WA 3A8JA 2Z9OA 5EGOA 4QVJA 2CW8A 4N0BA 2UVFA 4ITVA 3QYBA 3NWSA 4M73A 2OV7A 3OYDA 5K1YA 3FBIB 3E5XA 3OEEA 1O3SA 4RCZA 4HG2A 4G9YA 1TQPA 1X2NA 4KFCA 2Y48A 3IAS2 3KIOA 1DU6A 1K4SA 4B4DA 2QSGX 2CW0F 3VYRB 1ZN2A 4GO1A 2ZNYA 2UXNA 3QRFF 2PYGA 4ZCIA 2QY1A 1G6NA 3LOCA 3L2CA 1I27A 2X6YA 5HDKA 3R0AA 1RWRA 1UCRA 4A3GJ 1MMGA 3SJPA 1YRNB 1VQMB 2KT0A 2L02A 1X1PA 2WA0A 2MC4A 1V5VA 4BAYA 5KNLA 4DQLA 3RKWA 2R5YB 3T5XA 4C30A 1ODDA 2H1LA 3D1NI 2OQGA 3BG3A 5D6FA 1COWA 3TMOA 1FRNA 1CNFA 2VBKA 4HDUA 4P9UA 1U3EM 2CRVA 4LBWA 3W2GA 3DBHB 3HB9A 2GXAA 2AQFA 2ODLA 2K4BA 1YLFA 3H9GA 4Y3OA 1JJ8C 2XUBA 1BN8A 3EPZA 3VEPA 1I8DA 2FBKA 1A35A 2HVSA 4BE2A 2DJIA 2QN6A 5DS0A 3CUOA 1MNMC 1T0FC 4L9NA 5J3LA 2N8GA 2NS7A 4CUGA 2LF8A 3OYJA 1HF2A 4AF6A 5AN9A 3WXMA 2JUGA 2XV4S 1LKXA 4JOMA 3OYFA 1A5JA 3I9V2 2HKOA 2L7KA 2MW8A 3O8GA 5F04A 5FRMA 2ID3A 3TW7A 4V19K 3B90A 3C7JA 2ZZFA 1HW1A 3QE2A 2KZVA 2DYSH 1KMHA 2PLFA 3MMPA 3AAFA 1VHOA 1U5TC 2DODA 5JFRA 4LBVA 5DN6A 3CCEB 1KQ0A 3BR5A 2QYOA 4QLCU 1QQIA 1F5TA 1N07A 2V6CA 2R93J 1TL8A 1NJID 1D3YA 3DPUA 1TTTA 2MG4A 1N05A 3EQNA 4DNCA 1TNTA 1U78A 3Q38A 3F9KA 4KN4X 1FOWA 4M9XA 1MIJA 4DW6A 3HOTA 5IP7J 1BX1A 3ABMH 3D26A 2IQ7A 4BQNA 1OFDA 1G7SA 3TQNA 3MAJA 3KX2A 1WDTA 4M3EA 3NB2A 5E79C 1A36A 3J7ZI 3SZPA 2BPOA 2DMNA 4QPQA 1VFCA 4OIOF 1BA5A 4CCNA 1KK3A 4XKBA 5HDNA 2QKMB 2L0KA 5FLMJ 1JA0A 3CXCB 4D7NA 5A2QZ 4HA8A 3OEHA 4II2A 5B1AH 5B1BH 4HRIA 3GRHA 1PP7U 1HOMA 5F0FA 3WODF 1BOAA 1MGTA 1T0FA 3G4SB 4S05A 2YR2A 1D8KA 1Z05A 3W2AA 5IY5H 4IHXA 2FF4A 4RAYA 3KYLA 3ERMA 1FYLA 4A12A 5KHDA 2Z99A 4B09A 3J7AY 2EIJH 3HXLA 1R1TA 4IHYA 3UNGC 3KLOA 2C5HA 2AS5F 2M5SA 2K7LA 2PMDA 2V7FA 4LJZF 2HEOA 1D8JA 4XLNF 2V1UA 2XF6A 2OBPA 1YRNA 3HL2A 2R7UA 2QZ8A 3A03A 2OK8A 3CCRB 3MFKA 2R5YA 2C2WA 4XLCA 3OPOA 4U4BA 2O8KA 4HX7A 3OYNA 2D45A 2PE3A 2ID6A 4M72A 3ASTA 4X06A 2OBSA 5HLHA 4ZYGA 5D5WB 2A6EF 2WZPP 4LBYA 3LSIA 1XCBA 1O7LA 3FXRA 4PZJA 2XDVA 4NC6A 2XNJA 4V2GA 5LGNA 3U21A 2CF4A 4IRGA 4IQ4A 2XNDA 4HDVA 1GQ8A 3GTQJ 4MQVA 2IGOA 1QGYA 4ETSA 2R7SA 1R5GA 4Z4RA 1EA3A 1R4MB 2O7OA 4AYBA 1QO0D 4ZDPA 1YQAA 1BI3A 4ANJA 3Q0UA 3HDDA 1R5BA 1XDUA 3RJPA 1DDGA 2C77A 2DY1A 3REOA 1ZRFA 2MH9A 4O3MA 1UMQA 3T8RA 1BW5A 4X7FA 2EK5A 5J40A 3DTIA 1ENHA 3RCOA 1N25A 3LJYA 3PETA 3GO5A 2CU7A 3IH4A 5EDNA 5C44J 1BLIA 2QUFA 2W82A 5KK1A 1VQNI 1POGA 4ZH4F 5B6IA 3CCJI 4M2LA 4YALA 2Z3YA 3BG9A 1FTTA 2NV4A 4AIKA 1QBJA 2BF4A 3TDZC 5JVGF 5H6RA 4E7KA 4KDPA 3BTCA 1QFJA 5L3DA 3PNTA 4PGHA 4YIFA 3ML3A 3OOCA 2HR3A 3GZ6A 3M07A 2AHOA 1MBEA 1O8JA 2JA7J 1LEAA 1W0UA 1RQRA 1QJVA 2K02A 2DCEA 1JI8A 3I54A 1S0UA 2BGCA 1TQIA 3BTIA 3SEZA 3ZQCA 2QMUA 2FMLA 2W24A 2W6JA 4HSRA 1H0MA 3KZYA 2Y0SA 5FKKA 1QZYA 2GBYA 1IN6A 2NS8A 2O6GE 4JK1X 2H1KA 1SFEA 1ZGWA 2K86A 3B6AA 1NBMA 1BR4A 1FBUA 1SD4A 2M87A 4C3JJ 1WJAA 2HZTA 3JW4A 1IJFA 3QPTA 3DU1X 3E5QA 3BG5A 3ZQHA 2FX3A 2BW3B 3W2VA 4JX4A 4BJ6C 2JIZA 4XM3A 4BS9A 1ZM9A 3BH4A 1XDSA 1PJ7A 3M8FA 2STTA 1KC8D 3JURA 5DYMA 4BGDA 5J1RA 2VT3A 3A1YA 4MYUA 5IP6A 4P25A 4U9UA 4ZZLA 1VLOA 5BSXA 1O8HA 3M8JA 1TC3C 1B4AA 1IN5A 1UZCA 3R0JA 3U2QA 2V5IA 2DN0A 4CCJA 2DIEA 3L2QA 2PQ8A 2DA5A 4Z4VA 4CYCB 1W5TA 2WJVA 1APLC 3OV8A 4D5FA 2X1DA 2YU9J 1ZRDA 4G5GA 1S9HA 3G1LA 5FLVA 3CF2A 2YWHA 1SAXA 1D0YA 1TWAJ 3A35A 3OZUA 5CVIA 1L3LA 1BJZA 4MTEA 3SHFA 1Z7UA 5FLXZ 3GFLA 1QA2A 2QBYB 4OPSA 4HYEA 2D74A 5AIPA 2HYFA 5E1XA 1WPKA 3IH2A 4BYYA 1VHEA 1SFOJ 4RPDA 2HTJA 1ON2A 3AG4H 5IT9Z 1LDDA 1P4XA 1S72I 4WZEA 4HWVA 4ZYHA 3IKTA 2XRLA 3O6BB 1YIJI 3KYCB 1MSFC 4TMWA 1JKPC 1M1EB 2V26A 4L5IA 5GP9A 1T8IA 1K28D 4Z4YA 2VKDA 2VFOA 1TLHB 2VBYA 1E64A 3VNUA 3LA3A 3W6VA 3HOUJ 4M6VA 3FMSA 2CFOA 2PECA 2Y31A 3Q3AA 2W7NA 4BJTA 2TCTA 1W7PB 2F48A 3E1YE 1BMFA 4G8XA 3I4PA 2CNDA 4LG3A 3QWLA 2XKPA 1FMVA 2Q6KA 1X3UA 5D8KB 3PJRA 5IYQA 2HXIA 1SD6A 4I98B 2HOTA 1Q82D 5DNSA 4MYTA 2V7WA 1GJRA 1ETVA 1L1IA 2OTLB 2PYHA 3CC2I 3I59B 5JHFA 2IA2A 3CO7C 1TT0A 2F6CA 4W97A 2V9PA 5H2FC 4C2UA 4ZCMA 4GXOA 1IUYA 2E1OA 3L7WA 4F91B 2WTEA 1I3AA 2RKHA 3RZDJ 4LG0B 1ITYA 1NDHA 3CCUB 1U0JA 5EF6A 4NCNA 2EWEA 1JNYA 4DZJA 1MRZA 3LNNA 1R5OA 1FWZA 3JTGA 1JUMA 2ZO4A 2PEXA 1K6OA 2EA2A 1IJEA 3BNWA 1HXDA 4PC3A 4XN3A 2VQHA 1XS9A 3OYMA 3WNCA 1KK1A 1T6ZA 2BW3A 3BJAA 4DYCA 4I84A 4IX7A 1UELB 1G3WA 2E2HJ 4HNTA 1EH7A 3OP1A 1Z77A 4RLFA 1PXZA 2OF7A 2XAHA 3PM1A 2V79A 1X1AA 2Q0OA 4II3A 4R8HA 4LOCA 2HOSA 4AWXB 4YFXF 1G7TA 2FJ1A 3NQOA 1VBLA 1SAUA 4BXXJ 2BXZA 3IRQA 1UD4A 1DP7P 1OISA 2LBFB 5B5EC 2C78A 4X0CA 4GQNA 2HYJA 1RPWA 4CYCA 5F6FA 5AONA 4UY8I 2YWEA 1O88A 1FYKA 1B23P 3P7NA 2BGIA 3K1MA 2HFHA 4N4NB 3KP6A 5DUKA 1FEXA 2BM7A 3GQ9A 1K79A 2HOAA 4RJLA 2F5CA 1DQUA 3BZCA 4A6EA 4EM2A 1ETYA 5J47A 4U7DA 4ACAA 5HDGA 2QBYA 1R1VA 3ZBTA 2L9SA 3WY9A 1BI2A 1TQMA 1X0CA 2WJYA 3AG2H 3HTSB 1FNMA 1TWHJ 1V4RA 4PFPA 4HQMA 2XGEA 1VQ4I 1AHDP 3A01B 2CQNA 3H92A 4A5MA 4UB6C 4DOZA 2EQRA 2VNKA 3PA2A 1O8FA 1TYXA 1Z6RA 4OJ5A 4M71A 3OW7A 3VSVA 4G6IA 2OAZA 4PC6A 2E36A 2HU9A 3CUQB 1VJSA 3R6JA 3GTLJ 1VQ8I 5THXA 5H59A 2R7ZJ 1T39A 1P7JA 4BBRJ 1X1DA 1W7PA 4E7IA 4M9SA 3KEOA 2LD5A 2NTBA 2RNJA 3S2HJ 4Y9UA 2LSOA 5FKNA 3JSOA 4DQ2A 1RUNA 5HZBA 1W35A 5TJJA 1BC7C 1EZGA 4Y4RA 4I01A 5FGMA 2ISZA 3S1RJ 2VBXA 2JPBA 1O8KA 2D2WA 4I0BA 3QFTA 1VLYA 4A6DA 4GGGA 4Q48A 4Q7JB 1VQ7B 3ZP5A 3I59A 1R5ID 2BHZA 2KZGA 2Q8KA 4XKCA 5L3BA 5FJ8J 1IGNA 1O3TA 2L7ZA 1SM4A 4FQGA 1JGGA 3DKWA 1Z21A 2WY8Q 3OWTA 4XKVA 3HKZN 3AG3H 4LG0A 4H9GA 3ASNH 3BLYA 4BY7J 2CH0A 3J80K 2Z2SB 3LVBA 1W36D 1HCRA 1KYZA 3WE2A 3JQPA 1JT6A 3WTVC 3LMWA 4MO7A 4D7MA 1MZBA 5CQGA 4A3IJ 2VBWA 4IL6C 1QA6A 5TR9A 1XMKA 2GPJA 5E17F 2XEXA 2VPLA 3W2IA 2QXZA 4BQOA 4R79A 1SKYB 3CUQC 3OMYA 5F0CA 4CYDA 4PABA 1S6LA 3SYJA 1JTXA 3SUCA 4BY1J 4CA0A 3GFIA 4UZEA 2CUEA 1K61A 4C2LA 1I39A 1NB9A 3RPUD 3TOBA 1FOYA 2P5KA 1YFHA 1PE9A 4B8XA 2E19A 4ZV4A 2G7UA 3B78A 2CQKA 1K5CA 3RYRA 2CWEA 4A0XA 3AL0B 3EETA 2LBFA 3KYDB 2BSAA 1WH5A 3KLNA 1OYWA 2W48A 4WWCA 4IEJA 2BY2A 2GA1A 5HKKA 1GXQA 1YI2I 2LRDA 2XAGA 3ESWB 4IHVA 4XORA 1FBSA 1I18A 1EKEA 2F4IA 5LHIA 2OUMA 1QRYA 3ONUA 4QTRA 3OJXA 1UAAA 3AVTA 3IUOA 1FNDA 3F23A 3RIRA 5K5RA 1R49A 1H42A 1KTVA 4B1RA 1NB0A 3JQRA 4ACBA 1UHMA 1WHUA 2A69F 3BCBA 4IRIA 1QUEA 3ABLH 3FXOA 2VOOA 1KQ5A 2ZJQF 3FWEA 4WXHA 2CC2A 3B8YA 3GTJJ 2X6OA 3A01A 1WVRA 1YW7A 1E2XA 1MNEA 2B7EA 1FBQA 3ZMDA 1QGZA 2E60A 3ZZUA 3H9QA 4UUTA 1QFYA 4P96A 3AVWA 3CUQA 3F3XA 2G9WA 2DI3A 2X53S 4BU2A 4ROXA 1XGSA 1W87A 1CLWA 1XMAA 4HE6A 2BSPA 2KISA 3JRAA 4P9FA 4YAOA 2KMUA 5EJCA 1BM9A 2DPDA 2M7BA 4BH9A 2JA6J 3FKSA 4FN5A 1XGNA 1IDZA 1BR1A 4IXAA 3WU2C 5ICEA 1FX0A 5EZGA 2VB6A 3JRBA 3E7LA 2D5VA 3CC4I 2RV8A 4XSZF 1OPCA 4YZ0A 1XMXA 2RDPA 3DLLF 2XIGA 3C3WA 1MBGA 4OM9A 2IS1A 3G1OA 2RC5A 1D5VA 2A5WA 3FMRA 4D1QA 2BM5A 2L54A 4NBSA 4AVZA 4G7ZF 1J2XA 4B3XA 2GIVA 3SKBA 4OIPF 3ULQB 2IRFG 3V7SA 2EV5A 3OS2A 3N6ZA 3PL8A 5A8AA 2XKOA 4LB5A 3QP5A 1XG1A 1W9XA 2XHKA 3RTRA 4DGWB 1XQBA 2V7VA 4IKFA 4AD9A 1ZGJA 4IVNA 3RI4A 2VT2A 5GPAA 3ZQQA 2WC2A 1ONVA 5DSZA 1TNSA 1O4XA 3ZMZA 1EE6A 3ZSCA 1WJCA 3GX4X 4OIQF 4TN1A 3HSEA 1N08A 1Y0RA 4IZZA 1S29A 2IGNA 4RGRA 4DBQA 1VQ9I 1XB4A 5DD4A 2P6SA 4N3NA 4E7HA 2NAZA 4B44A 1H9GA 1Y56A 2JJ7A 3CTAA 4P2NA 5AMVA 3OYHA 1H88C 2XAQA 1FOXA 1Z91A 2FOWA 2EILH 5M3MJ 3MKZA 2ZJ2A 2NRAC 3OS0A 3R6KA 2Q1ZB 3G2BA 5IPAA 2KRHA 5F08A 3OZVA 1YE9A 3KEWA 4OAYA 4ENMA 2Y30A 5E1WA 1ZQ3P 2K9MA 2KL4A 5HVQC 2W6IA 5C4XJ 4RD0A 1RKWA 1WOSA 2IJLA 1YITB 2OCEA 3DV8A 3J7AO 1F4KA 1Q1HA 1TW3A 1Y8RB 3RQ4A 3UKGA 2B0LA 2OTJI 4RGUA 5GADJ 1QX4A 2HDNB 4YC5A 4PSXA 4U88A 1QG0A 4R71A 1VF9A 2JMWA 4HLYA 3OJWA 4A93J 1NG7A 4X07A 1WJBA 2VL8A 5E1ZB 3GEZA 4ZYAA 2WAQN 4TKOB 3CJNA 2Z5UA 3PFIA 2HPMA 1UD3A 3COAC 1NH3A 2YX4A 3FX3A 5L3FA 2HLDA 5H6QA 5A88A 3L1PA 3EYIA 3ASPA 2BM1A 2M4KA 4Z1MA 4LIVA 3LSRA 3K2AA 2E5NA 4CZZA 1YTYA 2G0YA 4MXNA 5F27A 2DXIA 3DFGA 2WAFA 4YRVA 4H0EA 2IT0A 2DYIA 4P3YA 2ZCWA 2F4MB 4WK8F 5E8GA 3SLDA 4BXFA 2L7MP 1KZHA 3HTUA 2GOMA 2V7XA 1QQ1A 3H3VK 1NRKA 3FXQA 4OU0A 4PJ0C 3WU1B 2Z16A 1YJWB 3HBLA 3S3NA 1EV7A 5B3SH 2R6HA 3RIQA 4IHTA 1KU2A 1K8AD 2MFZA 2LOOA 3ZXSA 4LBZA 4YIRX 2CK3A 2EZLA 1JKRC 3AVVA 5IK2A 2E35A 3F21A 4QVAA 3FXJA 3G6EI 2QKLB 3OSFA 3FXLA 3TP0A 1Q86D 3ZPPA 3E6BA 1MMDA 2XSDC 4Y7CA 3MMYB 4B4CA 3SXYA 4DNRB 3V8JA 1MBFA 3G1MA 3VMFA 4Y33A 1XN7A 5J8CA 3MWMA 2VFNA 3TO6A 3F0CA 3K10A 3OOPA 1IC8A 1IUFA 4AYBN 1EH8A 1BBYA 2A07F 3G3ZA 2OC6A 3K1PA 2AHQA 2HQRA 4OINF 3V4GA 2ZJRF 2IS6A 5IYWA 4W8TA 1I1GA 4EVIA 4HBLA 4WCGA 3DU5A 3PQKA 1SFKA 2MLKA 2ZSHB 4XSXF 2ZBKA 1H85A 3CCMI 2MBFA 2DYRH 2HCJB 4YIIA 3WTZA 1HQCA 3L2WA 3BDDA 1MMAA 3FHZA 3HYIA 2VXDA 3E97A 3ZRGA 3OS1A 1WOPA 3FKIJ 3B8HA 2Q6LA 2KIUA 1VZ0A 1I5ZA 2Q6OA 1VQ6I 4XRSA 4XRFA 1DPUA 3G73A 3ZOBA 4A0ZA 1WRJA 1EF4A 5J4YA 4E6KG 2NNNA 2H09A 3CW2A 4OOXA 3U6KA 2CRGA 3BTLA 2QENA 3LNQA 2DDBA 4OPVA 3JR9A 3NEUA 1UD6A 4GCVA 2EZKA 3KETA 1TVCA 2FQ3A 2P0WA 3MZ8A 1JUSA 4XR6A 2Y0SN 4N4OB 1RI7A 4BACA 1DU0A 2QWWA 1PLUA 3HHGA 2VYQA 2QEXI 2YSRA 3GTMJ 2E7XA 3BPXA 2DTZA 1QPMA 3HGYA 2HXOA 4S04A 2JRTA 2OCCH 2W4SA 2GWRA 4KNYA 1O8IA 4FWTA 1RMGA 3BCDA 2NS0A 3OR2C 3TW6A 2M4GA 3GLXA 3LAJA 2EIXA 1Y1WJ 3H3ZA 2GAUA 5LMZA 4L5EA 1K9MD 1O8LA 2VQCA 1WOOA 4FISA 1LB2A 4PJJA 3GTGJ 2LKPA 1YX2A 1Y8QB 3I0TA 3RDIA 2E1MB 3HZJA 3KP2A 3OIPA 3QOPA 4NB5A 1LEBA 1B2RA 4RLQA 3WGIA 1UMKA 3VOEA 1OR7A 4XLPF 1IRFA 2WZNA 4ZGNB 2ZFWA 3ZC3A 2I10A 2LY2A 5DEQA 2NYXA 3LFUA 3HPGA 2KIFA 1UFMA 3PFYA 3SDGA 4BHBA 1ZHFA 1YJNI 4YCQA 3ZGKA 4EJUA 2EFWA 1ZR2A 2NSTA 2OQRA 4B3FX 4OIRF 4EJVA 4PJMA 3CCSI 2DT6A 5FFZA 3ZQLA 2ECCA 5F4MA 2QX3A 3LQRA 3CCQI 4Z4UA 1P6RA 1M1KD 2R92J 3PSSA 2VJIA 2H27A 5IT3A 4XOPA 4LK1F 2V4DA 3BR0A 1FPQA 4XRMA 2A05A 2ZZGA 4BBSJ 4MHGA 2B0RA 3TL4X 1BJKA 5GAEJ 4LFUA 2DERA 1TTYA 2L9RA 3L2VA 1XSXA 2R7XA 1P92A 1X1BA 3PA1A 4EGZA 3R60A 3DCFA 3VYUB 5M3FJ 1FIPA 3V8LA 3WTTC 2NVQJ 3CD6I 3BWGA 2LG4A 3T56B 1P7IA 3T53B 3KP5A 2NOGA 4ZDLA 2E7WA 3OIQA 1ZG3A 3FIWA 3ZN1A 1IN7A 2WY7Q 3ML6A 2NXNB 3VODA 4RDKA 2ZSIB 2VNHA 2NT9A 2CJJA 1PUEE 1WPCA 2GK7A 2GZWA 3JREA 2WR8A 1H8HA 1XD7A 4CGZA 1FZPB 4U0WA 2XNCA 1W0KA 3BT9A 3P26A 2XZPA 2ZBVA 3UR3C 2XSJC 2CQ7A 1DGRM 2VKVA 3D5LA 3ES9A 1G7CA 1FSHA 3I1FA 1VQNB 2Q6IA 4Z03A 3OOUA 2A61A 2GQQA 3WHBA 4Y9RA 5ICGA 1SVOA 1AWCA 3G05A 1S3JA 2Q2EB 3FK6A 1FLIA 4G1VA 2K9LA 5JLVC 1KRHA 5ERIA 1W2BB 1U6GA 3N4MA 2VFMA 1J7KA 1V54H 3VO2A 1TUIA
chains in the Genus database with same CATH topology
4FASD 3EUAA 1QHGA 4BDZA 3EUKL 5CQEA 2PECA 2CFOA 4NC8A 3DQVC 4F92B 2W7NA 3HKZA 2KHMA 4BJTA 1BMFA 2MABA 3H5NA 3DPLC 4LG3A 1O8MA 1FMVA 3SZGA 3PJRA 2LY1A 4PJNA 1WMRA 4PSWA 3HPHA 2INUA 4DIQA 3LL7A 2PYHA 3PSFA 4XKWA 2PJRB 2DOAA 2VQGA 5JHFA 3BC9A 1TT0A 4NC7A 2F6CA 1PKVA 3QYEA 1OR7C 1OB0A 1OGOX 4C2UA 4UZUA 1V0FA 2HVQA 4F91B 1T5EA 1JRGA 1IB4A 3CZ6A 1U0JA 3CP2A 1FMWA 1UD2A 4JMQA 1O8EA 2EWEA 3LNNA 2CS3A 2R7OA 3VSLA 2Z6BD 3S93A 1XG2A 2X3HA 4YZQA 2QE7A 3S32A 2LH9A 4XN3A 2VQHA 4F55A 3QODA 2VKHA 4KISA 3PNYA 2R9VA 2AQEA 3OYMA 1H80A 3AFHA 5CPRB 2BW3A 4I84A 4IX7A 1UELB 3A3GA 4OAZA 1WJFA 4YZAA 1KTWA 2L9NA 4HNTA 3GVJA 4BEHB 4BL0B 2A6TA 4RLFA 2GK6A 1PXZA 3I3LA 4MR0A 2V4JC 1E3XA 3MD2A 1DGWY 4J01A 1X1AA 4II3A 1X19A 3EUHC 3K70D 1VBLA 1WP6A 1SAUA 4XLAA 2JDIA 4DK0A 2JA2A 1UD4A 4KITB 4HIZA 1UD5A 2LBFB 3QYFA 4GQNA 2XZOA 4DNTB 4G6TB 1O88A 4X0GA 3NE5B 4OZZA 3K6GA 2UVEA 2RREA 4N4NB 3LSHA 3GQ9A 3L2UA 2R4GA 2NTPA 5LFAA 1DQUA 3OR1C 2E1BA 2UUZA 3L2RA 1LFPA 1W36C 2L9SA 2GJPA 1X0CA 2BVLA 2WJYA 2VJ4A 2ZTGA 4ZDOA 3K4KA 1O8DA 2MD0A 4PFPA 4FETA 2KRCA 4W8SA 3VYTB 4DJAA 1E43A 2IGKA 5CDFA 4DOZA 1QU3A 2GJKA 1TZLA 4BE0A 1O8FA 4OJPA 2O17A 2HQAA 4OJ5A 4XL9A 3OW7A 3VSVA 4JQFA 4G6IA 4F93B 3OYKA 2HU9A 1VJSA 2M0MA 3HOSA 2VQLA 4E7JA 1HG8A 1X1DA 3E1SA 1JTAA 4E7IA 2X85A 2IS2A 4ZTFA 4XMYA 1W0JA 2NTBA 1E79A 1N75A 4XLHA 3A4CA 3OYBA 4Y4RA 4D9JA 1WFXA 2LC2A 3DTEA 2UWMA 4XN0A 1O8KA 1VLYA 2PJRA 4G7WA 4XONA 3OYGA 2JVHA 2E1MC 3LSGA 4XKCA 4J00A 3IAM2 2WSSA 4YXWA 1MW7A 1Z21A 2KP6A 1BR2A 5HLTA 2WY8Q 3OWTA 4XKVA 1N78A 1DBOA 2X1EA 1Z7LA 4RMNA 1UG0A 2X8KA 3W2WA 2ZXHA 1KCCA 3BLYA 2IGMA 2CH0A 2ZXIA 3N05A 2Z2SB 1W36D 4OWRB 3LMWA 2XF5A 1OFMA 1E3ZA 3T9GA 5CQGA 1QCXA 4MLOA 2CUJA 3OY9A 5FROA 2VPLA 4BQOA 2QXZA 3D5RC 4R79A 2R7VA 1SKYB 3OMYA 4URRA 3K4CA 2HZDA 2VJ5A 4DBRA 4L8JA 2JJ2A 3SUCA 2F43A 1QHHD 4BEHA 3OYEA 4CA0A 2WADA 3GQAA 1X4PA 1NG6A 2GJRA 2W00A 4C2LA 1BHEA 3DTKA 1DBGA 1P9QC 1PE9A 3BC8A 3RPUD 4PFOA 4PUSA 4KT6A 2W1OA 3TBIA 3H94A 3H9JA 3A2KA 1E0EA 1V0EA 4QPOA 4PK4A 1K6YA 3OFNA 1G8XA 3S3MA 1K5CA 1D1CA 2INVA 3AL0B 3UW0A 2LBFA 1J09A 1IDKA 5TGTA 4ZTJA 2WAQA 5HKKA 1PYVA 2WPDA 2LRDA 3GVLA 1D0ZA 3BCAA 3OYLA 2JVGA 2JJ1A 4XORA 1I18A 2LREA 4IQJA 2F4IA 2OUMA 5HNHA 2R7WA 3A3BA 1Z3XA 3OL4A 1UAAA 4P22A 1YX3A 2I8DA 2HDWA 3IUOA 4NQWB 3JU4A 5FL7A 1HZEA 2NZMA 1GLNA 3WWGA 1ZELA 2IS4A 3BCBA 4B47A 2CMPA 3SYTA 1DP3A 3B8YA 2X1CA 4LITA 2XOKA 3WQZA 3IP4B 4XD7A 1MNEA 1KZLA 3GVKA 4F3QA 2ELJA 4CH7A 4NK8A 1LDKB 2E60A 2R7QA 3FHNA 3H9QA 4C2TA 3FKJA 1RU4A 2RNGA 3S3OA 3OYIA 3H0DA 2X53S 4BU2A 2BSPA 3MKYB 4E7SA 3C2HA 4EW9A 1MABA 2KMUA 1BOBA 1IA5A 2NOJB 2M7BA 2VXZA 3FKSA 3DDYA 4KJZA 2L5QA 1BR1A 1MNDA 1FX0A 4BQQA 2ZTNA 1T95A 3FBNB 4HNUA 1CZFA 2VB6A 4KKTA 2VASA 3ZPNA 3GQBA 3GQ8A 2VBMA 4BE1A 1HA8A 3DKYA 4YZ0A 3PNVA 4CCLA 3D5SC 3OL3A 1D1BA 3CP8A 4BUPA 4CCMA 1N77A 4KKSA 2F1MA 2IS1A 2O0WA 3PUBA 1E1RA 4ASUA 2CW8A 2A5WA 4EATA 2UVFA 4ITVA 3QYBA 3NWSA 4D1QA 2OV7A 3QOEA 4AVZA 3FBIB 3OYDA 1H8EA 2L2OA 4B3XA 4XLEA 3OEEA 4HG2A 2NT6A 2VLAA 1Y6IA 3LMMA 4RM2A 4HSTA 3W3CA 3OS2A 5FRNA 2O0VA 3GQ7A 3PL8A 3IAS2 5HNFA 3VYSB 1YX5A 4YZXA 3VYRB 2ZZQA 2IXSA 1W9XA 3KEYA 3RTRA 4DGWB 2QY1A 2PYGA 4IKFA 3K4JA 2X6YA 3K4LA 3ZQQA 4CZCA 1RWRA 2VIXA 1MMGA 2WB1A 3HC7A 4BJ5C 4NK6A 2F5VA 2KVOA 1EE6A 2WA0A 2MC4A 1WJCA 3ZSCA 5KNLA 3VMWA 3H35A 4U49A 4IZZA 2IGNA 3S8PA 4DBQA 2DT7B 4C30A 1COWA 1VF7A 3TMOA 4E7HA 4B44A 4TT3A 2VBKA 1Y56A 4P5OA 5AMVA 2ODLA 2AQFA 3OYHA 3MKZA 3ONQA 2ZFUA 3OS0A 3FY3A 3H9GA 4Y3OA 2XGJA 4ZC3A 2Q1ZB 1BN8A 3G2BA 3EPZA 1I8DA 2KRHA 1WTHD 2HVSA 1YE9A 2CW7A 2DJIA 4BE2A 3KEWA 4OAYA 1T0FC 4H4KC 2K9MA 2KL4A 5HVQC 2LZJA 3DPTA 4CUGA 2W6IA 4ZJZA 3OYJA 3OAAA 3BG7A 2JUGA 1LKXA 4JOMA 3RQ4A 3OYFA 3KRGA 4GRIA 3I9V2 3C2GA 2L7KA 4PSXA 5FRMA 1AA7A 3B90A 2ZZFA 1NG7A 2KZVA 1KMHA 4CCOA 1WJBA 2VL8A 3K4BA 4CCKA 2K3PA 2V1NA 4ZYAA 4TKOB 2FUG2 1O8GA 2JSPA 5HOOA 5DN6A 2HPMA 1UD3A 2HLDA 4W8RA 2HPIA 2M4KA 3ZR8X 3K4NA 2D3NA 4Z05A 2R7TA 4Z1MA 3DPUA 4YEJA 4LIVA 3RSNA 3EQNA 2E5NA 4MXNA 3F9KA 4U4BA 2DXIA 2CV2A 2WAFA 4YRVA 3HOTA 4AU7A 4XNFA 2IQ7A 4BQNA 2HNHA 4BXFA 3KX2A 2GOMA 1NRKA 2K5CA 3LSKA 3DKXA 2Z16A 1R6RA 4QPQA 3S3NA 3FDYA 4DK1A 4CCNA 2UV1A 3OYAA 2MFZA 4XKBA 4FXUA 2QKMB 2LOOA 3ZXSA 3OEHA 1WJ5A 4II2A 2CK3A 4HRIA 2Z1DA 3GRHA 3BG6A 4B48A 5IK2A 4E0FA 1KONA 1PJRA 2NTQA 4OJ6A 4OZYA 2QKLB 4KKUA 1MMNA 2RQQA 4OJOA 3W2AA 4F52A 3ZPPA 4B3GA 1MMDA 4XLFA 3KYLA 2KPMA 2X6WA 4E7ZA 3MMYB 5KHDA 4DNRB 4C9YA 3J7AY 4Y33A 3K70C 3HXLA 4E4HA 2R7RA 2BVMA 4W8QA 2WAEA 3UNGC 1IDJA 3K10A 3VDXA 3LSMA 3H5AA 2CUZA 3ZCOA 2M5SA 2V7FA 2E5ZA 4CSWA 1HVXA 2OC6A 2XF6A 3SDBA 2IS6A 3HL2A 3FPPA 4W8TA 2R7UA 3DU5A 2VBEA 2V7QA 1SFKA 2ZSHB 4XLCA 3OPOA 3OYNA 3VSUA 3SEQA 2XF7A 2WZPP 3AL0C 4XQFA 3LSIA 3L2WA 3DWLE 2X51A 1MMAA 2XDVA 2VJJA 2VXDA 3ZRGA 4BDYA 3OS1A 1NHCA 3U21A 2XNDA 4IQ4A 3VR6A 1VZ0A 1E1QA 1GQ8A 2IGOA 3DLAA 2X6XA 3VSKA 2R7SA 1EA3A 4HEA2 3OYCA 4E6KG 4PJLA 4AYBA 3DEEA 4TSFA 4ZDPA 4ANJA 2GOXB 2MYSA 1UD6A 1OGMX 1EFRA 2P0WA 3V42A 2NSPA 4Z06A 4XR6A 4N4OB 2PMZA 3DU6A 3EQOA 3HUGB 4BACA 3E0JB 2XZLA 1PLUA 3RCOA 3DTIA 3GBGA 5LD2C 2KLOA 1BLIA 2W4SA 2W82A 4LIUA 1O8IA 1RMGA 3BCDA 1V5EA 3OR2C 3VWBA 2M4GA 4E7KA 1BPLA 2LYCA 2HVRA 3CESA 3PNTA 1O8LA 2VQCA 3OOCA 1O8JA 4PJJA 4P1WA 3CMMA 2XC7A 1AIRA 1QJVA 4PMHA 1Z3YA 2DCEA 2E1MB 3OIPA 2O04A 1JI8A 1OFLA 4RLQA 4U7BA 3SEZA 2W6JA 3VSTA 2BOLA 1KCDA 4HSRA 1X4OA 2LY2A 5C1CA 2Y0SA 3LFUA 3HPGA 3PFYA 3VMVA 1V5FA 2O1DA 3ZGKA 2NSTA 4B3FX 4PJMA 1OHHA 3M1CA 3HAGA 1NBMA 1BR4A 2DT6A 4G7XA 2QX3A 1WJAA 4XOTA 3ZIAA 3CJQB 2BW3B 3W2VA 2VJIA 4XOPA 4BJ6C 3HG9A 4XM3A 4BS9A 2JIZA 2KDOA 2V4DA 2D3LA 3BH4A 2M7AA 3PSIA 2V9KA 1OOCA 2ZZGA 3JURA 4BGDA 4U87A 1UD8A 3A1YA 4RM3A 1D0XA 2KQRA 3NWTA 3TL4X 1IRXA 1X1CA 2R7XA 3L2VA 3H5RA 1LVKA 1O8HA 1X1BA 3M8JA 3MKWB 5CKTA 4HPQA 1D1AA 3VYUB 3BCFA 2WBMA 4E7LA 3T56B 4CCJA 3T53B 2DIEA 2LG4A 2Z8GA 3L2QA 4ZDLA 3OIQA 3B4NA 2M3AA 2WY7Q 2WJVA 3K4MA 3AKZA 2V31A 2X1DA 2ZSIB 2NT9A 3OE7A 4OJLA 1S9HA 3CF2A 1WPCA 2GK7A 4YELA 1D0YA 1OLTA 3A35A 1H8HA 1V5GA 5KCMA 1W0KA 2XZPA 3UR3C 2XSJC 4NNJA 1DGRM 3D5LA 3T51B 4Z03A 3OOUA 1WJDA 4NUBA 2ZZEA 4HWVA 5C1EA 3G05A 2Q2EB 3CJRB 2K9LA 1G59A 2V26A 1K28D 2CV0A 2O5RA 1WJEA 2V6EA 2CV1A 2VKDA 4B43A 1ERDA 2XAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ8 A;  2X6Y A;  2PEC A;  1RWR A;  2X6X A;  1DBO A;  4XKV A;  4NK6 A;  1EE6 A;  1KCC A;  3ZSC A;  1O8M A;  3VMW A;  4U49 A;  1WMR A;  3LMW A;  1OFM A;  3T9G A;  2INU A;  1OGM X;  1QCX A;  2VBK A;  5AMV A;  2ODL A;  2PYH A;  4XKW A;  2NSP A;  4Z06 A;  4XR6 A;  2QXZ A;  3EQO A;  3FY3 A;  4URR A;  1BN8 A;  1PLU A;  1OGO X;  3SUC A;  3GQA A;  1JRG A;  4C2L A;  1DBG A;  1BHE A;  1IB4 A;  1PE9 A;  1O8I A;  1O8E A;  2EWE A;  1RMG A;  3KRG A;  1XG2 A;  2X3H A;  4YZQ A;  1K5C A;  4XN3 A;  1O8L A;  2INV A;  3UW0 A;  1H80 A;  1O8J A;  3B90 A;  1IDK A;  1AIR A;  1QJV A;  4PMH A;  4I84 A;  2O04 A;  1OFL A;  4YZA A;  1KTW A;  1O8G A;  3VST A;  1KCD A;  1PXZ A;  4MR0 A;  5C1C A;  4W8R A;  3VMV A;  2O1D A;  4XOR A;  4Z05 A;  2NST A;  4YEJ A;  1VBL A;  3EQN A;  4MXN A;  4XLA A;  4U4B A;  2NZM A;  2QX3 A;  3WWG A;  4XOT A;  4XNF A;  2IQ7 A;  3B8Y A;  2VJI A;  1O88 A;  4XOP A;  2UVE A;  4XM3 A;  4OZZ A;  1OOC A;  4NK8 A;  3JUR A;  3GQ9 A;  1RU4 A;  2NTP A;  2BSP A;  3GRH A;  1O8H A;  4EW9 A;  1X0C A;  2NTQ A;  2Z8G A;  1IA5 A;  4OJ6 A;  4OZY A;  4OJO A;  1O8D A;  3B4N A;  3ZPP A;  1CZF A;  4W8S A;  4XLF A;  2X6W A;  3GQ8 A;  2NT9 A;  2VBM A;  4OJL A;  1O8F A;  4OJP A;  2O17 A;  4YZ0 A;  4OJ5 A;  4XL9 A;  4YEL A;  4W8Q A;  1IDJ A;  3VSV A;  2O0W A;  1HG8 A;  2UVF A;  4W8T A;  1JTA A;  2X85 A;  4AVZ A;  4XMY A;  4XLE A;  2NTB A;  2VBE A;  4XLC A;  4Z03 A;  2NT6 A;  3VSU A;  4HWV A;  5C1E A;  4XLH A;  2O0V A;  3GQ7 A;  1O8K A;  4XN0 A;  4XQF A;  4YZX A;  2VJJ A;  1NHC A;  4XON A;  2QY1 A;  2PYG A; 
#chains in the Genus database with same CATH topology
 2BN4 A;  3GSI A;  3EUK L;  1ETO A;  5A2Q K;  5DV5 A;  2YUH A;  1E63 A;  3TOA A;  3D0S A;  1ZM4 A;  1JE8 A;  3LFK A;  4F92 B;  5E18 F;  4X7C A;  1SD5 A;  2KHM A;  2K9Q A;  3H1C A;  2MAB A;  3H5N A;  2ZC2 A;  1O8M A;  3BQZ A;  1KK2 A;  5E3M A;  2G7H A;  4PJN A;  4C2M J;  1WI9 A;  4PSW A;  1L0O C;  1I7P A;  1F1Z A;  3I56 B;  3T1B A;  4D5C A;  1U8R A;  1VTN C;  4M3B A;  1E3H A;  2DU9 A;  3HSR A;  3GLL A;  1VQM I;  2DOA A;  2PMZ N;  4LD5 A;  5CVJ A;  2VQG A;  2JUC A;  5CJ9 A;  1T98 A;  2DK5 A;  4KIC A;  3E6C C;  2C6Y A;  3B82 A;  2X0K A;  1OGO X;  3GCM A;  1Z67 A;  1V0F A;  5BQT A;  2XGC A;  1JRG A;  3HJE A;  3LQE A;  2PN6 A;  2EIN H;  2NVY J;  3CZ6 A;  5FKM A;  3CP2 A;  5BOX A;  1FMW A;  1UD2 A;  3S2D J;  1O8E A;  1BIA A;  3ERE D;  3S93 A;  1W5S A;  5LRR A;  2X3H A;  2QE7 A;  1EWY A;  1N06 A;  5DM7 F;  3HHH A;  1FC3 A;  2I5U A;  3M8E A;  3QOD A;  2VKH A;  2R9V A;  5GV8 A;  1H80 A;  2AQE A;  3R61 A;  1HST A;  1EA0 A;  2BXY A;  1OQY A;  2YPR A;  3ZQI A;  2E2I J;  1P2F A;  5FO0 A;  3Q0W A;  3A3G A;  4OAZ A;  4YZA A;  1KTW A;  3T0Y A;  3GVJ A;  2GK6 A;  2PX9 A;  2X3U A;  4MR0 A;  1QRC A;  2V4J C;  2A3S A;  5IOZ A;  2H8R A;  1D2E A;  1DGW Y;  1X19 A;  2D1V A;  4XRS G;  1KU7 A;  2BV3 A;  3EUH C;  3LQQ A;  1RZ4 A;  4MFE A;  2WV1 A;  3K70 D;  4DK0 A;  2JA2 A;  1NTC A;  1VQO I;  2H6B A;  1S7O A;  5J6X A;  3CCE I;  1B9M A;  3H9N A;  1MJB A;  2GXB A;  4OP7 A;  5JLX A;  1IXR C;  2XPV A;  4C3I J;  1YIJ B;  2F5E A;  4LLL A;  3JQQ A;  3NE5 B;  3IH3 A;  4OZZ A;  1BI0 A;  3K6G A;  4RD1 A;  1RNL A;  3GTK J;  2CG4 A;  3AGP A;  3CDI A;  5JMC B;  5IYR A;  4EQQ A;  1T38 A;  3SFZ A;  4O5V A;  2EPF A;  2UUZ A;  2ZME B;  1ZYR F;  2VON A;  2K3F A;  2NVT J;  5DCM B;  5HS8 A;  3ZZT A;  2QTL A;  4F7D A;  4GDF A;  2ZTG A;  2FE3 A;  1O8D A;  4W8S A;  4A3J J;  4DJA A;  2Q2E A;  2IGK A;  2GM4 A;  1FOK A;  2C5B A;  4BNC A;  1QU3 A;  2GJK A;  5J1U A;  4TV7 A;  4BE0 A;  4PGO A;  3CC2 B;  2O17 A;  3WTS C;  5GAH J;  4XBF A;  4JQF A;  4F93 B;  3OYK A;  3C18 A;  4FCY A;  3MCA A;  5J3O A;  1IXC A;  3CCV I;  5DDG A;  3E1S A;  1J0R A;  4UV8 A;  3ZN0 A;  1W0J A;  1IRG A;  1N75 A;  3NAU A;  2E2J J;  3EUH A;  4NHJ A;  2IW5 A;  1HC8 A;  1CQX A;  2HI3 A;  2JRM A;  2ELH A;  2LC2 A;  3JRG A;  4PCQ A;  1W1W E;  5TY0 A;  5L3G A;  1WKM A;  3I71 A;  4HZF A;  1KK0 A;  4KMF A;  2DPU A;  4RA2 A;  2JVH A;  1ETW A;  2PMU A;  2QQ9 A;  3IAM 2;  3PO2 J;  3C2B A;  1SMY F;  2EFQ A;  2HTS A;  2KP6 A;  4QWQ A;  1BR2 A;  2PIA A;  1DBO A;  2FBI A;  2X1E A;  1Z7L A;  3W2W A;  2ZXH A;  2AXT C;  2LDU A;  1ZAR A;  2QQB A;  3ZPL A;  3N05 A;  1VQL I;  4C3H J;  4RAZ A;  2XF5 A;  3I64 A;  3TDU C;  5LLQ A;  2RC6 A;  1U9O A;  2LLK A;  3AGQ A;  4N3G A;  1GR1 A;  4P12 A;  2CUJ A;  2Y2Z A;  3WTU C;  4PC1 A;  1FRQ A;  1KU9 A;  4RAG A;  2MH2 A;  5EEG A;  2VJ5 A;  1LDJ A;  1OYY A;  4L8J A;  1HLV A;  4RM0 A;  2K27 A;  3S1Q J;  5FLX K;  2M9H A;  2WAD A;  3L00 A;  1NG6 A;  1BHE A;  3DTK A;  1RQP A;  4RS8 A;  1CZF A;  2EWN A;  2P3M A;  1LE8 B;  4RB0 A;  4PFO A;  4PUS A;  1ZG1 A;  5LGT A;  5JLW A;  3H9J A;  3A2K A;  2WYR A;  1V0E A;  2W84 A;  5JHU A;  1W0T A;  3S3M A;  2FRH A;  1A6Q A;  3W2H A;  3FK7 A;  2INV A;  3UW0 A;  5EEA A;  4KA4 A;  2HOE A;  3F6V A;  4Z2Y A;  1OGI A;  1VQ4 B;  3F8C A;  1Z6T A;  2WPD A;  2DA2 A;  1OCC H;  3GVL A;  4M4S A;  3J81 K;  3NAR A;  2JVG A;  2M8G X;  5GTH C;  3HOV J;  1SVM A;  2JJ1 A;  3N90 A;  4AC0 A;  2DFE A;  4IQJ A;  4GFB A;  1WOR A;  1VQ8 B;  2ZME A;  5HNH A;  4P22 A;  4ZCL A;  3OL4 A;  5JR3 A;  2I8D A;  1XE1 A;  5DCM A;  3H0G J;  1A31 A;  1BN5 A;  2P5L C;  1GAW A;  5JVT A;  1GLN A;  3BJO A;  2NZM A;  4Q5S F;  2IS4 A;  3GME A;  2K85 A;  1R71 A;  3ABK H;  1DP3 A;  3FXK A;  1FJL A;  2PI0 A;  5ILV A;  4LIT A;  3PIP F;  3F8B A;  3WG9 A;  1ZG5 A;  4HX8 A;  3I55 I;  3TO7 A;  1Z0X A;  3WE3 A;  1KZL A;  4F3Q A;  1VQP I;  2ELJ A;  1TSP A;  1YOV B;  2R7Q A;  2CBX A;  3FKJ A;  1TBX A;  1TYV A;  5KSW B;  3S16 J;  1MH4 A;  2ADU A;  4ASN A;  3OYI A;  4IO9 F;  1F20 A;  2ZB9 A;  4G94 A;  4EW9 A;  2NNY A;  2Y9Z A;  1MAB A;  3BTJ A;  4YHB A;  1IA5 A;  2GLO A;  1RKT A;  2VXZ A;  3HIF A;  3R4K A;  4PC2 A;  4C0S A;  4DZP A;  1MND A;  2DEU A;  4BQQ A;  2ZTN A;  1T95 A;  4EJO A;  4HNU A;  5FO5 A;  1EP1 B;  1IB0 A;  2VAS A;  2OD5 A;  4KKT A;  4AC9 A;  2IVM A;  4UXN A;  2VBM A;  4KH3 A;  1O7F A;  1WSU A;  1DG1 G;  3DKY A;  4UZF A;  4G7O F;  2FA5 A;  1T6S A;  1BW6 A;  4BUP A;  2XTY A;  3KP3 A;  2OYN A;  3U1K A;  1E1R A;  2E1R A;  2O0W A;  4RPB A;  1FX7 A;  4ASU A;  1VND A;  5FFX A;  3GWZ A;  2HYG D;  3HRM A;  3QOE A;  1J59 A;  3O8H A;  2IEK A;  4CO8 A;  1G4D A;  2NT6 A;  4RDU A;  2JT1 A;  4A0Y A;  5EEH A;  4EM1 A;  1Y6I A;  3LMM A;  4RM2 A;  4HST A;  5AIQ A;  5FRN A;  2BMW A;  4RDL A;  1M90 D;  3VYS B;  4XID A;  1YX5 A;  4YZX A;  2ZZQ A;  2IXS A;  1MDM B;  2UXX A;  3KEY A;  1GUU A;  2DMQ A;  3CCY A;  2F5F A;  5IYC J;  3ONY A;  1Q7Y D;  5IYP A;  1IV6 A;  3M1E A;  1YI2 B;  3K4L A;  5A89 A;  2ZXW H;  4CZC A;  1HW2 A;  1ZM2 A;  2WB1 A;  4BJ5 C;  1AKH B;  4NK6 A;  2KVO A;  2ZL5 A;  2XC1 A;  1LE8 A;  1I6X A;  3H35 A;  1HF0 A;  4DQK A;  2PJP A;  4R1H A;  4U49 A;  3S8P A;  2FEZ A;  2PG4 A;  1I1S A;  2XPW A;  2DT7 B;  2OBR A;  1UHS A;  5K7F A;  1VF7 A;  2W7Z A;  3WGG A;  4MNU A;  2VUM J;  4P5O A;  5L3E A;  1QA1 A;  2XGD A;  3BPV A;  3P9C A;  4L9T A;  3ONQ A;  4KT5 C;  2J7K A;  3FY3 A;  2JTV A;  5J1Y A;  1OFE A;  4ZC3 A;  3K2Z A;  3HEF A;  5D5X B;  5LBQ A;  1WTH D;  2PBI A;  4I6Z A;  2CW7 A;  2FD5 A;  3BJ6 A;  2DA1 A;  2K4J A;  2LZJ A;  3DPT A;  3OAA A;  2MSY A;  4ZJZ A;  2BBY A;  4RLZ A;  2HQ5 A;  2H8W A;  3X2Q H;  1GVH A;  1YG2 A;  2EIM H;  3KRG A;  4GRI A;  4Q47 A;  2QGG A;  2EZI A;  1AA7 A;  4WX9 A;  1FNN A;  3EDP A;  4CCO A;  4CCK A;  3CCU I;  4X05 A;  5DCF A;  4Z4S A;  3J81 k;  2R7D A;  4UNO A;  4QSH A;  1X3W B;  4EEF G;  2JSP A;  3RPQ A;  5HOO A;  2BEO A;  1Y0U A;  3CC4 B;  2JWT A;  5ILS A;  2COB A;  2TRT A;  1FNC A;  4W8R A;  2RGV A;  3MQ0 A;  3J80 Z;  2D3N A;  2R7T A;  3SY2 A;  4YEJ A;  3RSN A;  4FHT A;  4HE5 A;  1GV2 A;  1P4M A;  5J35 A;  2CV2 A;  2LMD A;  1EP3 B;  2Y9Y A;  2YX7 A;  3BZK A;  3M9A A;  1FSE A;  1IN4 A;  1ZGA A;  2ZXJ A;  3WU0 A;  1XPX A;  3V76 A;  2HNH A;  1QUF A;  2FBH A;  3LSJ A;  4FE7 A;  3SLN A;  1R6R A;  3PO3 J;  3DXJ F;  3E6M A;  3CPX A;  3SJM A;  5E3O A;  4FXU A;  4RD2 A;  5M5W J;  3Q6R A;  1WJ5 A;  2ME6 A;  2KIQ A;  2Z1D A;  3DF8 A;  3Q39 A;  1BQE A;  4LC0 A;  1KON A;  1R4N B;  1PJR A;  5B66 C;  4OJ6 A;  3ZZ0 A;  2W25 A;  4OZY A;  2QQ8 A;  4KKU A;  1MMN A;  2DO7 A;  4YAU A;  3IKV A;  3C1D A;  2A5Y B;  4XLF A;  3JRF A;  2NVX J;  2KPM A;  5BS6 A;  3FPK A;  2X6W A;  3GFM A;  4EGY A;  4A3F J;  2XAS A;  3A0B C;  4L9J A;  3ASQ A;  3P9I A;  4ON0 A;  4IRH A;  1MDM A;  3AVX A;  2BVM A;  4W1U A;  1QVG B;  1O57 A;  4W8Q A;  1SFX A;  1QZE A;  4UVB A;  3F8M A;  4OOI A;  3GFJ A;  2E5Z A;  4CSW A;  1PVE A;  3H3U A;  1HVX A;  3WTY C;  1IRZ A;  3SDB A;  1AKH A;  3ZMV A;  4ENJ A;  1KA8 A;  2FSW A;  3H09 A;  4ENK A;  2V7Q A;  1Y0N A;  2NPF A;  4JX5 A;  2OTJ B;  2XF7 A;  1BC8 C;  3U2R A;  3AL0 C;  5KAI C;  4IF4 A;  4E70 A;  3WNB A;  4WF2 A;  3DWL E;  2X51 A;  4BDY A;  1WQ2 A;  2LR8 A;  2VJJ A;  3N97 A;  3SQV A;  5KAF C;  1AMO A;  1E1Q A;  2COM A;  1K83 J;  1FNB A;  1X58 A;  2X6X A;  3MEX A;  3VSK A;  3V8K A;  4HEA 2;  3I53 A;  5IP9 J;  5HXB A;  4PJL A;  1KGS A;  3TGN A;  4ENN A;  1VQ7 I;  3DEE A;  2P5V A;  1RES A;  2QGU A;  2EFN A;  3GZ5 A;  4TSF A;  1FTZ A;  3HM5 A;  2R0Q C;  4EJT A;  2MC3 A;  2MYS A;  3ZMS A;  1EFR A;  5K7H A;  1K78 B;  3V42 A;  4ABZ A;  1YJ9 I;  5J8F A;  2NSP A;  4Z06 A;  3DU6 A;  2JN9 A;  3E0J B;  1OCO H;  2R5Z B;  5HOD A;  1S7E A;  3F72 A;  5ICC A;  2HKX A;  2F5D A;  3DP7 A;  2E34 A;  2RC4 A;  3Q9V A;  2KLO A;  3IHU A;  2BY3 A;  2DET A;  4LIU A;  2O03 A;  3GXO A;  4MEY F;  3FIS A;  2BM6 A;  2KKO A;  3HGG A;  4KIF A;  4ZGQ B;  2IPQ X;  3OZW A;  2VN2 A;  4YDT A;  3S15 J;  2CSO A;  5H20 A;  2F1L A;  2E71 A;  2LYC A;  1LQ1 A;  3BY1 A;  1BL0 A;  1UB9 A;  3KL9 A;  1XGM A;  4RD3 A;  3JAM Z;  2BHY A;  1S7A A;  1AIR A;  4KMU X;  1E3O C;  2O04 A;  4RCY A;  1OFL A;  1TYU A;  4U7B A;  3VST A;  1U2R A;  1ZH5 A;  3WTW C;  5C1C A;  1MMS A;  3VMV A;  1V5F A;  2O1D A;  4KN7 X;  1WU8 A;  4ZZD A;  4P26 A;  5KW9 A;  3S1N J;  2DMP A;  2M2E A;  2DOF A;  3M1C A;  4MFD A;  4HF2 A;  1JKO C;  4G7X A;  2YWG A;  2JPC A;  3WTX C;  3L09 A;  1Y1V J;  3O3K A;  3ZIA A;  4YAF A;  5HLG A;  3CCM B;  2QSF X;  3K0L A;  1QFZ A;  3HG9 A;  2ETH A;  1AU7 A;  2D3L A;  1O3Q A;  4N9I A;  2H6C A;  2QTZ A;  1OOC A;  1Q81 D;  3KZZ A;  4UUS B;  1B72 B;  4RM3 A;  1D0X A;  2KQR A;  2L01 A;  3CJT B;  3NWT A;  4CIC A;  4AM3 A;  5C4J J;  1X1C A;  1QVF B;  1C0W A;  2DFI A;  3H5R A;  1LVK A;  3JRH A;  2LK2 A;  3BZ6 A;  3ROU A;  5BNG A;  3MKW B;  2VOD A;  5E3L A;  4EMS A;  4HPQ A;  2Z8G A;  2WBM A;  3ZQ7 A;  1LFU P;  3IWF A;  2A6H F;  1VQK I;  2FX0 A;  2LKS A;  3LQ6 A;  1OMI A;  4Z4T A;  2IOU G;  1IAW A;  2V31 A;  3AKZ A;  5D8L B;  3U9G A;  3G71 I;  3OE7 A;  4OJL A;  2QQA A;  4J0Q A;  1JA1 A;  3E20 A;  2QLZ A;  5FO1 A;  1G3Y A;  1I6H J;  1HKT A;  1V5G A;  4A2U A;  3CME I;  4NNJ A;  3E6D A;  1OCZ H;  3R6S A;  1GO2 A;  2OZU A;  2QF7 A;  1USS A;  3M3Y J;  2F4N A;  1WJD A;  5BMZ A;  1Z1D A;  2EIK H;  5IYD J;  4ESF A;  2PLY A;  2VZL A;  3GYH X;  2QSH X;  1MBK A;  3T8T A;  2VFQ A;  3WG7 H;  4HLX A;  4GYI A;  3V7R A;  1K78 A;  2CV0 A;  2O5R A;  2CV1 A;  4QV2 A;  3WQZ A;  1Y39 A;  2XAU A;  2R5Z A;  4FAS D;  3KZI C;  2EZH A;  5TRD A;  2VOP A;  4BDZ A;  4M1K A;  4Z4Z A;  5CVR A;  3CCL I;  3RPU A;  1H9T A;  1S4M A;  4RD4 A;  3PSZ A;  3HKZ A;  1F9N A;  1FIA A;  1QPI A;  2RVC A;  3OKX A;  1W5C C;  3HRT A;  4ESJ A;  1J9I A;  5IYN A;  1J75 A;  2EH3 A;  4A5N A;  3BR2 A;  5K5O A;  4CQJ A;  2INU A;  3TH0 A;  3DBR B;  1R23 A;  1Q9S A;  3LL7 A;  3LO8 A;  4G7H F;  4M3F A;  3CF5 F;  3PSF A;  4XKW A;  2PJR B;  3S14 J;  2V7U A;  3ISX A;  4P1V A;  1K4T A;  1LM1 A;  3BC9 A;  1E3P A;  3BRO A;  3P9K A;  1F43 A;  3F8N A;  2YUS A;  3QYE A;  1OR7 C;  4J19 A;  1ZKG A;  2QZA A;  4UZU A;  2HVQ A;  4YFK F;  4X1E A;  3CC7 I;  1T2K A;  9ANT A;  3CO6 C;  2R7O A;  5E3N A;  1XG2 A;  1QGA A;  1SEU A;  3S32 A;  4HNV A;  3CD6 B;  3EYY A;  2B63 J;  1GVJ A;  4TMV A;  3BY2 A;  1PJ5 A;  3I4M J;  2L4A A;  5DM6 F;  2DQL A;  2RQP A;  2OA4 A;  3AFH A;  5CPR B;  1EH6 A;  1ZLJ A;  1YIT I;  5FL7 A;  1WJF A;  4LLG F;  2L9N A;  4BL0 B;  2A6T A;  3AG1 H;  1SC7 A;  1H89 C;  4XK4 A;  2P4W A;  4L5J A;  2RAE A;  3MD2 A;  4UUS A;  1B72 A;  5H5J A;  3HOZ J;  2OU2 A;  2FVG A;  1HKQ A;  3RKY A;  1J9Z A;  2L7F P;  4XLA A;  2JDI A;  3M4O J;  2VE8 A;  4HIZ A;  1JXS A;  4LMY A;  1UD5 A;  3QYF A;  2EFO A;  3TED A;  1P4A A;  1X3Z B;  1SVL A;  3MN2 A;  1YO5 C;  2YU3 A;  1FDR A;  4OOS A;  1FP2 A;  2F2E A;  3MZH A;  4M9Z A;  2RRE A;  3HRU A;  1NK2 P;  3PEN A;  4QFM A;  5F64 A;  1XSV A;  3L2U A;  2R4G A;  2QA4 I;  5LFA A;  3SEJ A;  2NTP A;  4KUM A;  4TMT A;  1LFP A;  2M1B A;  1B9N A;  2DDA A;  3HOX J;  1ZM3 A;  2BVL A;  4I09 A;  2DA6 A;  1YJW I;  3TO9 A;  2BE5 F;  4ZDO A;  3K4K A;  4Z4W A;  2MD0 A;  3A02 A;  3B02 A;  3L9F A;  3U6B A;  1CQT A;  3VYT B;  5CDF A;  1E43 A;  2X0L A;  3AVY A;  2BYV E;  1U5T B;  2VBZ A;  1YYV A;  2FXA A;  2J5O A;  4G6Q A;  1OJL A;  1YW8 A;  4F7Z A;  4XL9 A;  3SZE A;  3HOW J;  1VQ5 I;  4QIW N;  1GXP A;  1YHQ I;  4LK0 F;  2VQL A;  1RC9 A;  2VBS A;  1WH7 A;  3ASS A;  2IA1 A;  1EFT A;  2LP0 A;  2DFF A;  2X85 A;  2XAF A;  5M5Y J;  2B5O A;  2M45 A;  3ABU A;  4XMY A;  2KRF A;  3BQJ A;  2FOK A;  1E79 A;  2VBV A;  2ZKZ A;  3H36 A;  4XLH A;  5IYB J;  3A4C A;  4I76 A;  4FT8 A;  3OYB A;  4D9J A;  1WFX A;  3DTE A;  2UWM A;  2B9S A;  2X9D A;  3QPH A;  2PJR A;  2ESN A;  4XON A;  2E1M C;  2QCO A;  3OYG A;  1XC5 A;  5C3E J;  2WSS A;  1EFU A;  3RZO J;  1MKM A;  2XPU A;  2IA0 A;  1N78 A;  4U0V A;  1GV5 A;  4M3D A;  5FA6 A;  1KCC A;  1UG0 A;  3CMA I;  1YW9 A;  3F22 A;  2O61 A;  3E3V A;  1NHA A;  3GUD A;  3LA7 A;  1OFM A;  1G2H A;  3JX8 A;  1VQO B;  1YS7 A;  4EJW A;  3DEU A;  3CCJ B;  1OB2 A;  2XRN A;  3D5R C;  2B7B A;  2R7V A;  2XGX A;  3ECH A;  4URR A;  3PVD A;  2JJ2 A;  2RN7 A;  3OYE A;  2DQR A;  3NRV A;  2GJR A;  3GQA A;  1DBG A;  1TWF J;  4TMZ A;  1IG7 A;  1UHW A;  4Y17 A;  1OGJ A;  4KT6 A;  2V7T A;  1RR7 A;  2W1O A;  4LGW A;  3TBI A;  4P6Y A;  3AK5 A;  4P9S A;  2EV6 A;  4QPO A;  4PK4 A;  1K6Y A;  1G8X A;  1YIO A;  1DUX C;  4HAM A;  1D1C A;  2HDD A;  3OW2 B;  4IW3 B;  1B6A A;  1U9N A;  3J7Y J;  1J09 A;  4FX0 A;  5TGT A;  2DMU A;  3TP3 A;  1WSV A;  4AF7 A;  2WAQ A;  4AIH A;  1R9T J;  1PP8 F;  3ZMU A;  1ZK8 A;  4M3G A;  2K40 A;  2VKE A;  3BCA A;  3MVP A;  4RGX A;  3OYL A;  1X2M A;  3LYC A;  5F1R A;  2LRE A;  3W2F A;  1U8B A;  3Q9S A;  2E1N A;  4FX4 A;  3A3B A;  1Z3X A;  3CCV B;  1IW7 F;  1YX3 A;  1T08 B;  2HDW A;  4NQW B;  3RKX A;  5GTI C;  1IJW C;  3ZQG A;  2DCU A;  1ZEL A;  1FY7 A;  5EYR A;  1RRJ A;  2GRE A;  4B47 A;  4HV6 A;  1JKQ C;  5GAG J;  3VO1 A;  3WBJ A;  4MIM A;  3O2P E;  4RAF A;  2XTW A;  4HOB A;  1JB9 A;  1E62 A;  1R5N A;  2XOK A;  2BVN A;  4XD7 A;  1U5T A;  1YLO A;  1FYM A;  1T33 A;  5EG0 B;  3GVK A;  1EJ9 A;  5M5X J;  4NK8 A;  1LDK B;  3FHN A;  3CDL A;  4C2T A;  1N0U A;  3SFI A;  4P3I A;  3S17 J;  1S5L C;  3ZQF A;  1RU4 A;  2RNG A;  5FD5 A;  2VNJ A;  1G3S A;  2XTX A;  3MKY B;  2CYY A;  2JK3 A;  4UB8 C;  3C2H A;  3BR1 A;  2ECB A;  5LGU A;  2NOJ B;  3DDY A;  2L5Q A;  2XAJ A;  3OIO A;  2DK8 A;  1ZUN B;  3FBN B;  3QFC A;  4IPA A;  2D9R A;  3ZPN A;  1NK3 P;  3GQB A;  3F8F A;  1G3T A;  4BE1 A;  4JBA A;  2WB1 N;  4CHU A;  1HA8 A;  5FIU A;  1KQ8 A;  3PNV A;  1S72 B;  3OL3 A;  3VFZ A;  1D1B A;  3CP8 A;  2W57 A;  4CCM A;  1N77 A;  2F1M A;  4KKS A;  4IJA A;  3PUB A;  3V7C A;  4EAT A;  1O3R A;  1YS6 A;  1V55 H;  1H8E A;  2L2O A;  3BH6 B;  1XGO A;  2ICW G;  4XLE A;  1QH0 A;  2VLA A;  2LY9 A;  2O0V A;  3W3C A;  1QRB A;  3GQ7 A;  3IWZ A;  2A68 F;  2LVS A;  5HNF A;  1RUO A;  1JJ6 C;  5F1J A;  4X8I A;  2O9L A;  2KFD A;  2BM4 A;  2ME0 A;  1K7A A;  1ULY A;  1Q1V A;  5LEJ A;  4X7D A;  2VC0 A;  3K4J A;  2DOE A;  2Y0M A;  1E17 A;  4K1X A;  1EXM A;  4WZL A;  2VIX A;  2XB0 X;  2STW A;  1R5H A;  3HC7 A;  5DD8 A;  1KJZ A;  1ELO A;  2F5V A;  4CXF A;  2B7C A;  4YFN F;  3K69 A;  3G4S I;  2V1X A;  3VMW A;  1QNT A;  3RQI A;  2VNI A;  3FZV A;  1W7P D;  4Y7N J;  1QVU A;  4TT3 A;  1ON1 A;  2HWV A;  5DTD A;  2YWF A;  5K5Q A;  1LJ9 A;  2KJC A;  2ZFU A;  5D5U B;  1Z9C A;  1CGP A;  2DW4 A;  1LLZ A;  1ZLK A;  3F6O A;  4MGR A;  3I55 B;  3BR6 A;  1JGS A;  1VQP B;  3CLO A;  4DYR A;  4L0Z B;  4H4K C;  3I56 I;  4U0Y A;  4OOV A;  2DLL A;  2GA2 A;  1K73 D;  3ASR A;  2DA3 A;  3CRZ A;  5CVV A;  3QP6 A;  2ZME C;  3BG7 A;  3CCR I;  4X7E A;  1QVT A;  1A8P A;  1DAB A;  6PAX A;  2J8I A;  5J4V A;  4NQW A;  3C2G A;  3S2W A;  3PUF A;  1DAR A;  3ZMT A;  2L9V A;  1ETX A;  4BQA A;  3VNV A;  4IHS A;  2GIZ A;  1UJ8 A;  2F3L A;  3K4B A;  1CNE A;  2EB7 A;  2K3P A;  2LFB A;  2V1N A;  3QU3 A;  3IC7 A;  3QPL A;  2LTP A;  2FUG 2;  1O8G A;  1FT9 A;  1WCM J;  2OK7 A;  4IOC F;  5EG0 A;  4JX6 A;  4HX4 A;  4I02 A;  1WI3 A;  2HPI A;  3ZR8 X;  4YG2 F;  2DFH A;  3K4N A;  3IV5 A;  1GAQ A;  4YAW A;  3SJZ A;  4Z05 A;  3I58 A;  1ZRE A;  4AU7 A;  1F60 A;  5CVU A;  4XNF A;  3BY6 A;  4PGG A;  5IT9 K;  2K5C A;  3LSK A;  3DKX A;  5BPD A;  1IF1 A;  1MBJ A;  1R7J A;  4G1B A;  5EZH A;  1HSJ A;  2BY1 A;  4Q4Z F;  2ZL6 A;  3FDY A;  4B3A A;  4AIJ A;  1GT0 C;  4DK1 A;  1QGP A;  3M7G A;  2UV1 A;  3QPS A;  3OYA A;  4BHC A;  1XX5 A;  5LHH A;  3VB2 A;  3GZN B;  4Z6Y A;  2UZK A;  2JA5 J;  5HLI A;  3BG6 A;  4B48 A;  1IXS B;  4A3C J;  1JHH A;  1ZAO A;  3W5U A;  4E0F A;  2NTQ A;  1P4W A;  3CB4 A;  2BV6 A;  1IHM A;  2RQQ A;  4OJO A;  3LWF A;  4F52 A;  3S1M J;  3QU6 A;  3P27 A;  4B3G A;  2AO9 A;  1B59 A;  1ZRC A;  4E7Z A;  1BIB A;  1XB2 A;  2J8K A;  3LA2 A;  3W2E A;  3J81 Z;  2MGQ A;  4C9Y A;  3MHP A;  3K70 C;  2R7R A;  4E4H A;  5EMN A;  2WAE A;  1IDJ A;  2EJR A;  3BR3 A;  3VDX A;  3LSM A;  3H5A A;  2CUZ A;  3MZY A;  3ZCO A;  3RY8 A;  3JTH A;  2JZY A;  4FK8 A;  2O6W A;  4EM0 B;  3DEW A;  3JSP A;  3FPP A;  3JRC A;  1BI1 A;  4Y52 J;  5HS9 A;  1RET A;  3KP7 A;  3LST A;  2VBE A;  2CO5 A;  3W6J B;  3VSU A;  5D4R A;  1T6Y A;  3SEQ A;  5FKL A;  4HV5 A;  4AID A;  2L4M A;  1REP C;  3A8I A;  1JUP A;  4XQF A;  1STZ A;  1IN8 A;  3QSY A;  1PUF B;  1NHC A;  4I7H A;  2OJE D;  5L3C A;  2WV0 A;  1VI0 A;  3VR6 A;  1ZR4 A;  4A3L J;  1JT0 A;  4HW0 A;  2K9N A;  3DLA A;  4A3E J;  1HBX G;  1OCP A;  2MD5 A;  4L9V A;  3OYC A;  3IRR A;  1GVD A;  5D4S A;  2BZT A;  2Y75 A;  3GF2 A;  4NBQ A;  2NVU B;  1R1U A;  3NAW A;  2PFB A;  4RBO A;  2JN6 A;  3LSP A;  1TLL A;  2GOX B;  1OCT C;  1K8F A;  5KVR A;  1S8N A;  1N0V C;  1OGM X;  2VFP A;  4G12 A;  1BJA A;  1R22 A;  3BOQ A;  2CGP A;  3QFR A;  5LRS A;  2PMZ A;  1MSE C;  1WSR A;  2XT2 A;  3EQO A;  3HUG B;  3BH7 B;  4C43 A;  2XZL A;  1JTY A;  3GBG A;  4A3K J;  3WND A;  3JRI A;  5LD2 C;  2GXG A;  2Y69 H;  1K4Z A;  1B8I B;  1A6I A;  4P6V F;  2PMH A;  2EA4 A;  1JHF A;  3P4G A;  1V5E A;  3GTO J;  2VBU A;  2P7V B;  3VWB A;  1BPL A;  4JP0 A;  2HVR A;  3CES A;  1ORK A;  2G0E A;  4ESB A;  3DBL B;  4P1W A;  3CMM A;  1LFB A;  2XC7 A;  1TWG J;  4PMH A;  1KD1 D;  1ETQ A;  4BHP A;  1Z3Y A;  3FXU A;  2Z33 A;  3GIR A;  2C4T A;  2CFX A;  3RYP A;  3JU4 A;  4FE4 A;  2BOL A;  2V9V A;  2FMY A;  1KCD A;  2OPT A;  1X4O A;  1DPR A;  2HQN A;  1AIP A;  1DDN A;  5ILU A;  3CQZ J;  1OHH A;  1UG2 A;  3HAG A;  4KIG A;  4FTH A;  2DOG A;  3A0H C;  3FF5 A;  1LLW A;  4XOT A;  2OTL I;  2R3S A;  2DJN A;  4RGS A;  5ICF A;  4UAJ A;  2BGJ A;  2HMA A;  5F4J A;  3CJQ B;  4M74 A;  2UVE A;  3ECO A;  1SMT A;  2KDO A;  1PDN C;  1IV8 A;  2M7A A;  1QZZ A;  3PSI A;  2V9K A;  4JRA C;  3Q6Q A;  1XCV A;  4U87 A;  1UD8 A;  1R00 A;  5LHG A;  3OSG A;  2BX6 A;  1IRX A;  3K7A J;  3I4N J;  2ZJP F;  2P8T A;  5CKT A;  3PQJ A;  3A1P A;  5E6T A;  1D1A A;  4L18 B;  1HW5 A;  1PJ6 A;  3BCF A;  4E7L A;  2ZIT A;  1KU3 A;  3B4N A;  2X4H A;  2M3A A;  3FMQ A;  3K4M A;  5LEK A;  4UV9 A;  2C4U A;  1YJ9 B;  1PUF A;  2EBI A;  1XFO A;  4YEL A;  1OLT A;  2JA8 J;  3ABT A;  5TIS C;  5KCM A;  2ACJ A;  1OB5 A;  4XIC A;  5BSY A;  1W34 A;  1TWC J;  4IHW A;  3ZUG A;  3T51 B;  3FM5 A;  1HDP A;  4M53 A;  1ZTR A;  3W5V A;  4NUB A;  4BKX A;  5FKO A;  1EP2 B;  2ZZE A;  4M0L A;  5C1E A;  3CJR B;  4BXU A;  1J5Y A;  3WGH A;  2EV0 A;  1G59 A;  3HOY J;  2V1D A;  4PC7 A;  1F36 A;  1WJE A;  2M34 A;  1T56 A;  2V6E A;  5D5V B;  4HQE A;  4B43 A;  1ERD A;  3HUG A;  1VQ9 B;  2XGJ A;  4HF1 A;  3EUA A;  1QHG A;  1LPQ A;  5CQE A;  3EQL F;  4NC8 A;  2M8E A;  2K9S A;  3DQV C;  1CF7 B;  1B8I A;  3PUM A;  5E20 A;  5JBQ A;  3DPL C;  2KDZ A;  1MJA A;  3SZG A;  2J5P A;  2LY1 A;  1WMR A;  2WWY A;  4V02 C;  3HPH A;  2EFP A;  4DIQ A;  1ACI A;  2YS9 A;  1IDY A;  4WQM A;  1RR8 C;  4DYQ A;  4G6D A;  2DT5 A;  2E1C A;  1GDT A;  3ASO H;  4NC7 A;  2QYU A;  2O3F A;  4GYG A;  3B73 A;  1TW2 A;  1PKV A;  1OB0 A;  1WGX A;  4HF0 A;  4N9H A;  1T5E A;  4L0Y B;  1IB4 A;  2MLG A;  1A04 A;  4EV0 A;  3GVA A;  4JMQ A;  2O8X A;  3ISP A;  2CS3 A;  3FXM A;  4UUV A;  3K1N A;  2H94 A;  3VSL A;  1Y0Y A;  2Z6B D;  2IP2 A;  2W85 A;  1AOY A;  4OPO A;  4YZQ A;  1WWX A;  2MA3 A;  2LKX A;  2LH9 A;  2O0Y A;  4F55 A;  1KYW A;  3FM3 A;  4KIS A;  3PNY A;  1VQK B;  2M0C A;  3QFS A;  3Q5F A;  2X48 A;  5K7Z A;  2L3D A;  3MCZ A;  1UST A;  3G71 B;  3AVU A;  3HSF A;  1MH3 A;  4BEH B;  3CLQ A;  3I3L A;  3E5U A;  2DA7 A;  1E3X A;  1R36 A;  4J01 A;  2ISY A;  3PIO F;  1SKQ A;  4AUX A;  2D1H A;  3CME B;  3IL2 A;  5ED4 A;  3JRD A;  1WP6 A;  3K9T A;  2M30 A;  4KIT B;  4CDG A;  1DDI A;  2CUF A;  2JSC A;  1KQ9 A;  2EFG A;  2XZO A;  4DNT B;  2ESH A;  1EFC A;  4G6T B;  2M5W A;  4WZT A;  4KIB A;  4X0G A;  4WWV A;  1D8T A;  3SZT A;  1MJ9 A;  2XVC A;  2ZNZ A;  4P55 A;  1D5Y A;  2VBT A;  4TMX A;  3G6E B;  4RB2 C;  4D0P A;  3V7A A;  1BX0 A;  1IZ1 A;  3LSH A;  3WBK A;  4EH1 A;  2E1B A;  3OR1 C;  1MBH A;  1TT5 B;  3CCL B;  1TP4 A;  3KEQ A;  3L2R A;  3CPW B;  3GW2 A;  1W36 C;  1OKR A;  2GJP A;  2VJ4 A;  2QDX A;  1D1N A;  2CQX A;  2HGC A;  3JAM K;  3Q3S A;  4FET A;  2KRC A;  4PAA A;  2LNB A;  2XRO A;  1TZL A;  4OJP A;  3BQY A;  2HQA A;  4QUZ A;  1TYW A;  1LNW A;  3WHC A;  1SD7 A;  5FD6 A;  4OMY A;  1OFC X;  5HS7 A;  4RB1 A;  1HDD C;  2M0M A;  3HOS A;  2BM0 A;  2P81 A;  2HS5 A;  4E7J A;  3CC7 B;  1HG8 A;  1H8A C;  1CF7 A;  2OBT A;  1JTA A;  2IS2 A;  4BPR A;  4IOA F;  4YFO A;  1R58 A;  4ZTF A;  2VI6 A;  4A3B J;  1VQ6 B;  3KP4 A;  2JQ7 A;  3GTP J;  1SAN A;  4XN0 A;  3U1D A;  4KYW A;  1MD0 A;  4WZK A;  4Y15 A;  4V2F A;  5TV2 A;  4M6Y A;  4G7W A;  3LSG A;  4J00 A;  3W5H A;  4YXW A;  2QM3 A;  1MW7 A;  4I0A A;  5HLT A;  3QAH A;  5EGO B;  5FB2 A;  2P6T A;  2TDX A;  4RMN A;  1SFU A;  2X8K A;  4RB3 C;  2DBB A;  4UHT A;  3JCU C;  2IGM A;  5JI6 A;  4NDL A;  1OYI A;  3A8K A;  2VC1 A;  2ZXI A;  3ELK A;  1GHC A;  3B6C A;  2QEX B;  2FQ4 A;  1B1B A;  4OWR B;  3T9G A;  1E3Z A;  5CLS A;  1LUJ B;  2DAO A;  4MLO A;  2LF7 A;  5HZA A;  1QCX A;  4S0H B;  4A3M J;  3TKY A;  5FRO A;  3OY9 A;  3VPR A;  2FU4 A;  4Y13 A;  2P7C B;  3K4C A;  4O6J A;  2HZD A;  4DBR A;  1HKS A;  2F43 A;  1QHH D;  1KQS B;  4BEH A;  5DS9 A;  2XT4 A;  1X4P A;  2W00 A;  2BY0 A;  3MKL A;  4K2E A;  1P9Q C;  5FNZ A;  2KIM A;  3BC8 A;  5CYV A;  3P5J A;  2QA4 B;  3H94 A;  5F0H A;  1IO2 A;  4WXC A;  1E0E A;  3OFN A;  4LLN A;  1VQL B;  3WYA A;  2DMT A;  1YJN B;  4ZYD A;  3ZBU A;  3KPH A;  2IBD A;  2XB5 A;  3SQN A;  3W6K B;  2OZ6 A;  2HDC A;  1IDK A;  2CQQ A;  1T6X A;  4ZTJ A;  2FNA A;  4UVA A;  3CCS B;  1PYV A;  3CMY A;  3CCQ B;  1D0Z A;  1I3Q J;  1I50 J;  2KJB A;  4MTD A;  4MEX F;  2GQF A;  2VE9 A;  1XSD A;  1VQ5 B;  2VPR A;  5D6E A;  1YHQ B;  1XTA A;  4RDJ A;  4I2O A;  2R7W A;  1G7R A;  4A69 C;  3PUN A;  1LVA A;  2AXL A;  1HZE A;  3QQA A;  1N8R D;  3WWG A;  3Q0V A;  1W4M A;  4A3D J;  2CMP A;  3SYT A;  2IAI A;  1HA3 A;  2X1C A;  5E8I A;  1RIO H;  3IP4 B;  4M6X A;  2ELK A;  5BPI A;  1WZ2 A;  1JJ2 B;  4CH7 A;  5F4O A;  3LAP A;  1V3F A;  5IOY A;  4UVC A;  4OMZ A;  4AVP A;  3S3O A;  3H0D A;  5DUI A;  3BP8 A;  3FJO A;  3KE2 A;  5GPC A;  4PDK A;  4E7S A;  2R7F A;  1OCR H;  3KFW X;  2CW5 A;  2DA4 A;  1BOB A;  3CDH A;  3CMA B;  1QA3 A;  4I99 C;  3I5U A;  2FNP A;  4ZYE A;  4KJZ A;  2I1L A;  1ETK A;  1FP1 D;  2QVO A;  3KCC A;  4YEI A;  5L46 A;  3RKQ A;  4OPW A;  4QHY A;  1WXR A;  4RD6 A;  4MQ9 F;  3GQ8 A;  4WXD A;  4LB6 B;  3HRS A;  4X6A J;  2DTR A;  4CCL A;  3D5S C;  4JYK A;  2ZBU A;  2F4O B;  2ZL7 A;  5GV7 A;  1U2W A;  3A8J A;  2Z9O A;  5EGO A;  4QVJ A;  2CW8 A;  4N0B A;  2UVF A;  4ITV A;  3QYB A;  3NWS A;  4M73 A;  2OV7 A;  3OYD A;  5K1Y A;  3FBI B;  3E5X A;  3OEE A;  1O3S A;  4RCZ A;  4HG2 A;  4G9Y A;  1TQP A;  1X2N A;  4KFC A;  2Y48 A;  3IAS 2;  3KIO A;  1DU6 A;  1K4S A;  4B4D A;  2QSG X;  2CW0 F;  3VYR B;  1ZN2 A;  4GO1 A;  2ZNY A;  2UXN A;  3QRF F;  2PYG A;  4ZCI A;  2QY1 A;  1G6N A;  3LOC A;  3L2C A;  1I27 A;  2X6Y A;  5HDK A;  3R0A A;  1RWR A;  1UCR A;  4A3G J;  1MMG A;  3SJP A;  1YRN B;  1VQM B;  2KT0 A;  2L02 A;  1X1P A;  2WA0 A;  2MC4 A;  1V5V A;  4BAY A;  5KNL A;  4DQL A;  3RKW A;  2R5Y B;  3T5X A;  4C30 A;  1ODD A;  2H1L A;  3D1N I;  2OQG A;  3BG3 A;  5D6F A;  1COW A;  3TMO A;  1FRN A;  1CNF A;  2VBK A;  4HDU A;  4P9U A;  1U3E M;  2CRV A;  4LBW A;  3W2G A;  3DBH B;  3HB9 A;  2GXA A;  2AQF A;  2ODL A;  2K4B A;  1YLF A;  3H9G A;  4Y3O A;  1JJ8 C;  2XUB A;  1BN8 A;  3EPZ A;  3VEP A;  1I8D A;  2FBK A;  1A35 A;  2HVS A;  4BE2 A;  2DJI A;  2QN6 A;  5DS0 A;  3CUO A;  1MNM C;  1T0F C;  4L9N A;  5J3L A;  2N8G A;  2NS7 A;  4CUG A;  2LF8 A;  3OYJ A;  1HF2 A;  4AF6 A;  5AN9 A;  3WXM A;  2JUG A;  2XV4 S;  1LKX A;  4JOM A;  3OYF A;  1A5J A;  3I9V 2;  2HKO A;  2L7K A;  2MW8 A;  3O8G A;  5F04 A;  5FRM A;  2ID3 A;  3TW7 A;  4V19 K;  3B90 A;  3C7J A;  2ZZF A;  1HW1 A;  3QE2 A;  2KZV A;  2DYS H;  1KMH A;  2PLF A;  3MMP A;  3AAF A;  1VHO A;  1U5T C;  2DOD A;  5JFR A;  4LBV A;  5DN6 A;  3CCE B;  1KQ0 A;  3BR5 A;  2QYO A;  4QLC U;  1QQI A;  1F5T A;  1N07 A;  2V6C A;  2R93 J;  1TL8 A;  1NJI D;  1D3Y A;  3DPU A;  1TTT A;  2MG4 A;  1N05 A;  3EQN A;  4DNC A;  1TNT A;  1U78 A;  3Q38 A;  3F9K A;  4KN4 X;  1FOW A;  4M9X A;  1MIJ A;  4DW6 A;  3HOT A;  5IP7 J;  1BX1 A;  3ABM H;  3D26 A;  2IQ7 A;  4BQN A;  1OFD A;  1G7S A;  3TQN A;  3MAJ A;  3KX2 A;  1WDT A;  4M3E A;  3NB2 A;  5E79 C;  1A36 A;  3J7Z I;  3SZP A;  2BPO A;  2DMN A;  4QPQ A;  1VFC A;  4OIO F;  1BA5 A;  4CCN A;  1KK3 A;  4XKB A;  5HDN A;  2QKM B;  2L0K A;  5FLM J;  1JA0 A;  3CXC B;  4D7N A;  5A2Q Z;  4HA8 A;  3OEH A;  4II2 A;  5B1A H;  5B1B H;  4HRI A;  3GRH A;  1PP7 U;  1HOM A;  5F0F A;  3WOD F;  1BOA A;  1MGT A;  1T0F A;  3G4S B;  4S05 A;  2YR2 A;  1D8K A;  1Z05 A;  3W2A A;  5IY5 H;  4IHX A;  2FF4 A;  4RAY A;  3KYL A;  3ERM A;  1FYL A;  4A12 A;  5KHD A;  2Z99 A;  4B09 A;  3J7A Y;  2EIJ H;  3HXL A;  1R1T A;  4IHY A;  3UNG C;  3KLO A;  2C5H A;  2AS5 F;  2M5S A;  2K7L A;  2PMD A;  2V7F A;  4LJZ F;  2HEO A;  1D8J A;  4XLN F;  2V1U A;  2XF6 A;  2OBP A;  1YRN A;  3HL2 A;  2R7U A;  2QZ8 A;  3A03 A;  2OK8 A;  3CCR B;  3MFK A;  2R5Y A;  2C2W A;  4XLC A;  3OPO A;  4U4B A;  2O8K A;  4HX7 A;  3OYN A;  2D45 A;  2PE3 A;  2ID6 A;  4M72 A;  3AST A;  4X06 A;  2OBS A;  5HLH A;  4ZYG A;  5D5W B;  2A6E F;  2WZP P;  4LBY A;  3LSI A;  1XCB A;  1O7L A;  3FXR A;  4PZJ A;  2XDV A;  4NC6 A;  2XNJ A;  4V2G A;  5LGN A;  3U21 A;  2CF4 A;  4IRG A;  4IQ4 A;  2XND A;  4HDV A;  1GQ8 A;  3GTQ J;  4MQV A;  2IGO A;  1QGY A;  4ETS A;  2R7S A;  1R5G A;  4Z4R A;  1EA3 A;  1R4M B;  2O7O A;  4AYB A;  1QO0 D;  4ZDP A;  1YQA A;  1BI3 A;  4ANJ A;  3Q0U A;  3HDD A;  1R5B A;  1XDU A;  3RJP A;  1DDG A;  2C77 A;  2DY1 A;  3REO A;  1ZRF A;  2MH9 A;  4O3M A;  1UMQ A;  3T8R A;  1BW5 A;  4X7F A;  2EK5 A;  5J40 A;  3DTI A;  1ENH A;  3RCO A;  1N25 A;  3LJY A;  3PET A;  3GO5 A;  2CU7 A;  3IH4 A;  5EDN A;  5C44 J;  1BLI A;  2QUF A;  2W82 A;  5KK1 A;  1VQN I;  1POG A;  4ZH4 F;  5B6I A;  3CCJ I;  4M2L A;  4YAL A;  2Z3Y A;  3BG9 A;  1FTT A;  2NV4 A;  4AIK A;  1QBJ A;  2BF4 A;  3TDZ C;  5JVG F;  5H6R A;  4E7K A;  4KDP A;  3BTC A;  1QFJ A;  5L3D A;  3PNT A;  4PGH A;  4YIF A;  3ML3 A;  3OOC A;  2HR3 A;  3GZ6 A;  3M07 A;  2AHO A;  1MBE A;  1O8J A;  2JA7 J;  1LEA A;  1W0U A;  1RQR A;  1QJV A;  2K02 A;  2DCE A;  1JI8 A;  3I54 A;  1S0U A;  2BGC A;  1TQI A;  3BTI A;  3SEZ A;  3ZQC A;  2QMU A;  2FML A;  2W24 A;  2W6J A;  4HSR A;  1H0M A;  3KZY A;  2Y0S A;  5FKK A;  1QZY A;  2GBY A;  1IN6 A;  2NS8 A;  2O6G E;  4JK1 X;  2H1K A;  1SFE A;  1ZGW A;  2K86 A;  3B6A A;  1NBM A;  1BR4 A;  1FBU A;  1SD4 A;  2M87 A;  4C3J J;  1WJA A;  2HZT A;  3JW4 A;  1IJF A;  3QPT A;  3DU1 X;  3E5Q A;  3BG5 A;  3ZQH A;  2FX3 A;  2BW3 B;  3W2V A;  4JX4 A;  4BJ6 C;  2JIZ A;  4XM3 A;  4BS9 A;  1ZM9 A;  3BH4 A;  1XDS A;  1PJ7 A;  3M8F A;  2STT A;  1KC8 D;  3JUR A;  5DYM A;  4BGD A;  5J1R A;  2VT3 A;  3A1Y A;  4MYU A;  5IP6 A;  4P25 A;  4U9U A;  4ZZL A;  1VLO A;  5BSX A;  1O8H A;  3M8J A;  1TC3 C;  1B4A A;  1IN5 A;  1UZC A;  3R0J A;  3U2Q A;  2V5I A;  2DN0 A;  4CCJ A;  2DIE A;  3L2Q A;  2PQ8 A;  2DA5 A;  4Z4V A;  4CYC B;  1W5T A;  2WJV A;  1APL C;  3OV8 A;  4D5F A;  2X1D A;  2YU9 J;  1ZRD A;  4G5G A;  1S9H A;  3G1L A;  5FLV A;  3CF2 A;  2YWH A;  1SAX A;  1D0Y A;  1TWA J;  3A35 A;  3OZU A;  5CVI A;  1L3L A;  1BJZ A;  4MTE A;  3SHF A;  1Z7U A;  5FLX Z;  3GFL A;  1QA2 A;  2QBY B;  4OPS A;  4HYE A;  2D74 A;  5AIP A;  2HYF A;  5E1X A;  1WPK A;  3IH2 A;  4BYY A;  1VHE A;  1SFO J;  4RPD A;  2HTJ A;  1ON2 A;  3AG4 H;  5IT9 Z;  1LDD A;  1P4X A;  1S72 I;  4WZE A;  4HWV A;  4ZYH A;  3IKT A;  2XRL A;  3O6B B;  1YIJ I;  3KYC B;  1MSF C;  4TMW A;  1JKP C;  1M1E B;  2V26 A;  4L5I A;  5GP9 A;  1T8I A;  1K28 D;  4Z4Y A;  2VKD A;  2VFO A;  1TLH B;  2VBY A;  1E64 A;  3VNU A;  3LA3 A;  3W6V A;  3HOU J;  4M6V A;  3FMS A;  2CFO A;  2PEC A;  2Y31 A;  3Q3A A;  2W7N A;  4BJT A;  2TCT A;  1W7P B;  2F48 A;  3E1Y E;  1BMF A;  4G8X A;  3I4P A;  2CND A;  4LG3 A;  3QWL A;  2XKP A;  1FMV A;  2Q6K A;  1X3U A;  5D8K B;  3PJR A;  5IYQ A;  2HXI A;  1SD6 A;  4I98 B;  2HOT A;  1Q82 D;  5DNS A;  4MYT A;  2V7W A;  1GJR A;  1ETV A;  1L1I A;  2OTL B;  2PYH A;  3CC2 I;  3I59 B;  5JHF A;  2IA2 A;  3CO7 C;  1TT0 A;  2F6C A;  4W97 A;  2V9P A;  5H2F C;  4C2U A;  4ZCM A;  4GXO A;  1IUY A;  2E1O A;  3L7W A;  4F91 B;  2WTE A;  1I3A A;  2RKH A;  3RZD J;  4LG0 B;  1ITY A;  1NDH A;  3CCU B;  1U0J A;  5EF6 A;  4NCN A;  2EWE A;  1JNY A;  4DZJ A;  1MRZ A;  3LNN A;  1R5O A;  1FWZ A;  3JTG A;  1JUM A;  2ZO4 A;  2PEX A;  1K6O A;  2EA2 A;  1IJE A;  3BNW A;  1HXD A;  4PC3 A;  4XN3 A;  2VQH A;  1XS9 A;  3OYM A;  3WNC A;  1KK1 A;  1T6Z A;  2BW3 A;  3BJA A;  4DYC A;  4I84 A;  4IX7 A;  1UEL B;  1G3W A;  2E2H J;  4HNT A;  1EH7 A;  3OP1 A;  1Z77 A;  4RLF A;  1PXZ A;  2OF7 A;  2XAH A;  3PM1 A;  2V79 A;  1X1A A;  2Q0O A;  4II3 A;  4R8H A;  4LOC A;  2HOS A;  4AWX B;  4YFX F;  1G7T A;  2FJ1 A;  3NQO A;  1VBL A;  1SAU A;  4BXX J;  2BXZ A;  3IRQ A;  1UD4 A;  1DP7 P;  1OIS A;  2LBF B;  5B5E C;  2C78 A;  4X0C A;  4GQN A;  2HYJ A;  1RPW A;  4CYC A;  5F6F A;  5AON A;  4UY8 I;  2YWE A;  1O88 A;  1FYK A;  1B23 P;  3P7N A;  2BGI A;  3K1M A;  2HFH A;  4N4N B;  3KP6 A;  5DUK A;  1FEX A;  2BM7 A;  3GQ9 A;  1K79 A;  2HOA A;  4RJL A;  2F5C A;  1DQU A;  3BZC A;  4A6E A;  4EM2 A;  1ETY A;  5J47 A;  4U7D A;  4ACA A;  5HDG A;  2QBY A;  1R1V A;  3ZBT A;  2L9S A;  3WY9 A;  1BI2 A;  1TQM A;  1X0C A;  2WJY A;  3AG2 H;  3HTS B;  1FNM A;  1TWH J;  1V4R A;  4PFP A;  4HQM A;  2XGE A;  1VQ4 I;  1AHD P;  3A01 B;  2CQN A;  3H92 A;  4A5M A;  4UB6 C;  4DOZ A;  2EQR A;  2VNK A;  3PA2 A;  1O8F A;  1TYX A;  1Z6R A;  4OJ5 A;  4M71 A;  3OW7 A;  3VSV A;  4G6I A;  2OAZ A;  4PC6 A;  2E36 A;  2HU9 A;  3CUQ B;  1VJS A;  3R6J A;  3GTL J;  1VQ8 I;  5THX A;  5H59 A;  2R7Z J;  1T39 A;  1P7J A;  4BBR J;  1X1D A;  1W7P A;  4E7I A;  4M9S A;  3KEO A;  2LD5 A;  2NTB A;  2RNJ A;  3S2H J;  4Y9U A;  2LSO A;  5FKN A;  3JSO A;  4DQ2 A;  1RUN A;  5HZB A;  1W35 A;  5TJJ A;  1BC7 C;  1EZG A;  4Y4R A;  4I01 A;  5FGM A;  2ISZ A;  3S1R J;  2VBX A;  2JPB A;  1O8K A;  2D2W A;  4I0B A;  3QFT A;  1VLY A;  4A6D A;  4GGG A;  4Q48 A;  4Q7J B;  1VQ7 B;  3ZP5 A;  3I59 A;  1R5I D;  2BHZ A;  2KZG A;  2Q8K A;  4XKC A;  5L3B A;  5FJ8 J;  1IGN A;  1O3T A;  2L7Z A;  1SM4 A;  4FQG A;  1JGG A;  3DKW A;  1Z21 A;  2WY8 Q;  3OWT A;  4XKV A;  3HKZ N;  3AG3 H;  4LG0 A;  4H9G A;  3ASN H;  3BLY A;  4BY7 J;  2CH0 A;  3J80 K;  2Z2S B;  3LVB A;  1W36 D;  1HCR A;  1KYZ A;  3WE2 A;  3JQP A;  1JT6 A;  3WTV C;  3LMW A;  4MO7 A;  4D7M A;  1MZB A;  5CQG A;  4A3I J;  2VBW A;  4IL6 C;  1QA6 A;  5TR9 A;  1XMK A;  2GPJ A;  5E17 F;  2XEX A;  2VPL A;  3W2I A;  2QXZ A;  4BQO A;  4R79 A;  1SKY B;  3CUQ C;  3OMY A;  5F0C A;  4CYD A;  4PAB A;  1S6L A;  3SYJ A;  1JTX A;  3SUC A;  4BY1 J;  4CA0 A;  3GFI A;  4UZE A;  2CUE A;  1K61 A;  4C2L A;  1I39 A;  1NB9 A;  3RPU D;  3TOB A;  1FOY A;  2P5K A;  1YFH A;  1PE9 A;  4B8X A;  2E19 A;  4ZV4 A;  2G7U A;  3B78 A;  2CQK A;  1K5C A;  3RYR A;  2CWE A;  4A0X A;  3AL0 B;  3EET A;  2LBF A;  3KYD B;  2BSA A;  1WH5 A;  3KLN A;  1OYW A;  2W48 A;  4WWC A;  4IEJ A;  2BY2 A;  2GA1 A;  5HKK A;  1GXQ A;  1YI2 I;  2LRD A;  2XAG A;  3ESW B;  4IHV A;  4XOR A;  1FBS A;  1I18 A;  1EKE A;  2F4I A;  5LHI A;  2OUM A;  1QRY A;  3ONU A;  4QTR A;  3OJX A;  1UAA A;  3AVT A;  3IUO A;  1FND A;  3F23 A;  3RIR A;  5K5R A;  1R49 A;  1H42 A;  1KTV A;  4B1R A;  1NB0 A;  3JQR A;  4ACB A;  1UHM A;  1WHU A;  2A69 F;  3BCB A;  4IRI A;  1QUE A;  3ABL H;  3FXO A;  2VOO A;  1KQ5 A;  2ZJQ F;  3FWE A;  4WXH A;  2CC2 A;  3B8Y A;  3GTJ J;  2X6O A;  3A01 A;  1WVR A;  1YW7 A;  1E2X A;  1MNE A;  2B7E A;  1FBQ A;  3ZMD A;  1QGZ A;  2E60 A;  3ZZU A;  3H9Q A;  4UUT A;  1QFY A;  4P96 A;  3AVW A;  3CUQ A;  3F3X A;  2G9W A;  2DI3 A;  2X53 S;  4BU2 A;  4ROX A;  1XGS A;  1W87 A;  1CLW A;  1XMA A;  4HE6 A;  2BSP A;  2KIS A;  3JRA A;  4P9F A;  4YAO A;  2KMU A;  5EJC A;  1BM9 A;  2DPD A;  2M7B A;  4BH9 A;  2JA6 J;  3FKS A;  4FN5 A;  1XGN A;  1IDZ A;  1BR1 A;  4IXA A;  3WU2 C;  5ICE A;  1FX0 A;  5EZG A;  2VB6 A;  3JRB A;  3E7L A;  2D5V A;  3CC4 I;  2RV8 A;  4XSZ F;  1OPC A;  4YZ0 A;  1XMX A;  2RDP A;  3DLL F;  2XIG A;  3C3W A;  1MBG A;  4OM9 A;  2IS1 A;  3G1O A;  2RC5 A;  1D5V A;  2A5W A;  3FMR A;  4D1Q A;  2BM5 A;  2L54 A;  4NBS A;  4AVZ A;  4G7Z F;  1J2X A;  4B3X A;  2GIV A;  3SKB A;  4OIP F;  3ULQ B;  2IRF G;  3V7S A;  2EV5 A;  3OS2 A;  3N6Z A;  3PL8 A;  5A8A A;  2XKO A;  4LB5 A;  3QP5 A;  1XG1 A;  1W9X A;  2XHK A;  3RTR A;  4DGW B;  1XQB A;  2V7V A;  4IKF A;  4AD9 A;  1ZGJ A;  4IVN A;  3RI4 A;  2VT2 A;  5GPA A;  3ZQQ A;  2WC2 A;  1ONV A;  5DSZ A;  1TNS A;  1O4X A;  3ZMZ A;  1EE6 A;  3ZSC A;  1WJC A;  3GX4 X;  4OIQ F;  4TN1 A;  3HSE A;  1N08 A;  1Y0R A;  4IZZ A;  1S29 A;  2IGN A;  4RGR A;  4DBQ A;  1VQ9 I;  1XB4 A;  5DD4 A;  2P6S A;  4N3N A;  4E7H A;  2NAZ A;  4B44 A;  1H9G A;  1Y56 A;  2JJ7 A;  3CTA A;  4P2N A;  5AMV A;  3OYH A;  1H88 C;  2XAQ A;  1FOX A;  1Z91 A;  2FOW A;  2EIL H;  5M3M J;  3MKZ A;  2ZJ2 A;  2NRA C;  3OS0 A;  3R6K A;  2Q1Z B;  3G2B A;  5IPA A;  2KRH A;  5F08 A;  3OZV A;  1YE9 A;  3KEW A;  4OAY A;  4ENM A;  2Y30 A;  5E1W A;  1ZQ3 P;  2K9M A;  2KL4 A;  5HVQ C;  2W6I A;  5C4X J;  4RD0 A;  1RKW A;  1WOS A;  2IJL A;  1YIT B;  2OCE A;  3DV8 A;  3J7A O;  1F4K A;  1Q1H A;  1TW3 A;  1Y8R B;  3RQ4 A;  3UKG A;  2B0L A;  2OTJ I;  4RGU A;  5GAD J;  1QX4 A;  2HDN B;  4YC5 A;  4PSX A;  4U88 A;  1QG0 A;  4R71 A;  1VF9 A;  2JMW A;  4HLY A;  3OJW A;  4A93 J;  1NG7 A;  4X07 A;  1WJB A;  2VL8 A;  5E1Z B;  3GEZ A;  4ZYA A;  2WAQ N;  4TKO B;  3CJN A;  2Z5U A;  3PFI A;  2HPM A;  1UD3 A;  3COA C;  1NH3 A;  2YX4 A;  3FX3 A;  5L3F A;  2HLD A;  5H6Q A;  5A88 A;  3L1P A;  3EYI A;  3ASP A;  2BM1 A;  2M4K A;  4Z1M A;  4LIV A;  3LSR A;  3K2A A;  2E5N A;  4CZZ A;  1YTY A;  2G0Y A;  4MXN A;  5F27 A;  2DXI A;  3DFG A;  2WAF A;  4YRV A;  4H0E A;  2IT0 A;  2DYI A;  4P3Y A;  2ZCW A;  2F4M B;  4WK8 F;  5E8G A;  3SLD A;  4BXF A;  2L7M P;  1KZH A;  3HTU A;  2GOM A;  2V7X A;  1QQ1 A;  3H3V K;  1NRK A;  3FXQ A;  4OU0 A;  4PJ0 C;  3WU1 B;  2Z16 A;  1YJW B;  3HBL A;  3S3N A;  1EV7 A;  5B3S H;  2R6H A;  3RIQ A;  4IHT A;  1KU2 A;  1K8A D;  2MFZ A;  2LOO A;  3ZXS A;  4LBZ A;  4YIR X;  2CK3 A;  2EZL A;  1JKR C;  3AVV A;  5IK2 A;  2E35 A;  3F21 A;  4QVA A;  3FXJ A;  3G6E I;  2QKL B;  3OSF A;  3FXL A;  3TP0 A;  1Q86 D;  3ZPP A;  3E6B A;  1MMD A;  2XSD C;  4Y7C A;  3MMY B;  4B4C A;  3SXY A;  4DNR B;  3V8J A;  1MBF A;  3G1M A;  3VMF A;  4Y33 A;  1XN7 A;  5J8C A;  3MWM A;  2VFN A;  3TO6 A;  3F0C A;  3K10 A;  3OOP A;  1IC8 A;  1IUF A;  4AYB N;  1EH8 A;  1BBY A;  2A07 F;  3G3Z A;  2OC6 A;  3K1P A;  2AHQ A;  2HQR A;  4OIN F;  3V4G A;  2ZJR F;  2IS6 A;  5IYW A;  4W8T A;  1I1G A;  4EVI A;  4HBL A;  4WCG A;  3DU5 A;  3PQK A;  1SFK A;  2MLK A;  2ZSH B;  4XSX F;  2ZBK A;  1H85 A;  3CCM I;  2MBF A;  2DYR H;  2HCJ B;  4YII A;  3WTZ A;  1HQC A;  3L2W A;  3BDD A;  1MMA A;  3FHZ A;  3HYI A;  2VXD A;  3E97 A;  3ZRG A;  3OS1 A;  1WOP A;  3FKI J;  3B8H A;  2Q6L A;  2KIU A;  1VZ0 A;  1I5Z A;  2Q6O A;  1VQ6 I;  4XRS A;  4XRF A;  1DPU A;  3G73 A;  3ZOB A;  4A0Z A;  1WRJ A;  1EF4 A;  5J4Y A;  4E6K G;  2NNN A;  2H09 A;  3CW2 A;  4OOX A;  3U6K A;  2CRG A;  3BTL A;  2QEN A;  3LNQ A;  2DDB A;  4OPV A;  3JR9 A;  3NEU A;  1UD6 A;  4GCV A;  2EZK A;  3KET A;  1TVC A;  2FQ3 A;  2P0W A;  3MZ8 A;  1JUS A;  4XR6 A;  2Y0S N;  4N4O B;  1RI7 A;  4BAC A;  1DU0 A;  2QWW A;  1PLU A;  3HHG A;  2VYQ A;  2QEX I;  2YSR A;  3GTM J;  2E7X A;  3BPX A;  2DTZ A;  1QPM A;  3HGY A;  2HXO A;  4S04 A;  2JRT A;  2OCC H;  2W4S A;  2GWR A;  4KNY A;  1O8I A;  4FWT A;  1RMG A;  3BCD A;  2NS0 A;  3OR2 C;  3TW6 A;  2M4G A;  3GLX A;  3LAJ A;  2EIX A;  1Y1W J;  3H3Z A;  2GAU A;  5LMZ A;  4L5E A;  1K9M D;  1O8L A;  2VQC A;  1WOO A;  4FIS A;  1LB2 A;  4PJJ A;  3GTG J;  2LKP A;  1YX2 A;  1Y8Q B;  3I0T A;  3RDI A;  2E1M B;  3HZJ A;  3KP2 A;  3OIP A;  3QOP A;  4NB5 A;  1LEB A;  1B2R A;  4RLQ A;  3WGI A;  1UMK A;  3VOE A;  1OR7 A;  4XLP F;  1IRF A;  2WZN A;  4ZGN B;  2ZFW A;  3ZC3 A;  2I10 A;  2LY2 A;  5DEQ A;  2NYX A;  3LFU A;  3HPG A;  2KIF A;  1UFM A;  3PFY A;  3SDG A;  4BHB A;  1ZHF A;  1YJN I;  4YCQ A;  3ZGK A;  4EJU A;  2EFW A;  1ZR2 A;  2NST A;  2OQR A;  4B3F X;  4OIR F;  4EJV A;  4PJM A;  3CCS I;  2DT6 A;  5FFZ A;  3ZQL A;  2ECC A;  5F4M A;  2QX3 A;  3LQR A;  3CCQ I;  4Z4U A;  1P6R A;  1M1K D;  2R92 J;  3PSS A;  2VJI A;  2H27 A;  5IT3 A;  4XOP A;  4LK1 F;  2V4D A;  3BR0 A;  1FPQ A;  4XRM A;  2A05 A;  2ZZG A;  4BBS J;  4MHG A;  2B0R A;  3TL4 X;  1BJK A;  5GAE J;  4LFU A;  2DER A;  1TTY A;  2L9R A;  3L2V A;  1XSX A;  2R7X A;  1P92 A;  1X1B A;  3PA1 A;  4EGZ A;  3R60 A;  3DCF A;  3VYU B;  5M3F J;  1FIP A;  3V8L A;  3WTT C;  2NVQ J;  3CD6 I;  3BWG A;  2LG4 A;  3T56 B;  1P7I A;  3T53 B;  3KP5 A;  2NOG A;  4ZDL A;  2E7W A;  3OIQ A;  1ZG3 A;  3FIW A;  3ZN1 A;  1IN7 A;  2WY7 Q;  3ML6 A;  2NXN B;  3VOD A;  4RDK A;  2ZSI B;  2VNH A;  2NT9 A;  2CJJ A;  1PUE E;  1WPC A;  2GK7 A;  2GZW A;  3JRE A;  2WR8 A;  1H8H A;  1XD7 A;  4CGZ A;  1FZP B;  4U0W A;  2XNC A;  1W0K A;  3BT9 A;  3P26 A;  2XZP A;  2ZBV A;  3UR3 C;  2XSJ C;  2CQ7 A;  1DGR M;  2VKV A;  3D5L A;  3ES9 A;  1G7C A;  1FSH A;  3I1F A;  1VQN B;  2Q6I A;  4Z03 A;  3OOU A;  2A61 A;  2GQQ A;  3WHB A;  4Y9R A;  5ICG A;  1SVO A;  1AWC A;  3G05 A;  1S3J A;  2Q2E B;  3FK6 A;  1FLI A;  4G1V A;  2K9L A;  5JLV C;  1KRH A;  5ERI A;  1W2B B;  1U6G A;  3N4M A;  2VFM A;  1J7K A;  1V54 H;  3VO2 A;  1TUI A; 
#chains in the Genus database with same CATH homology
 4FAS D;  3EUA A;  1QHG A;  4BDZ A;  3EUK L;  5CQE A;  2PEC A;  2CFO A;  4NC8 A;  3DQV C;  4F92 B;  2W7N A;  3HKZ A;  2KHM A;  4BJT A;  1BMF A;  2MAB A;  3H5N A;  3DPL C;  4LG3 A;  1O8M A;  1FMV A;  3SZG A;  3PJR A;  2LY1 A;  4PJN A;  1WMR A;  4PSW A;  3HPH A;  2INU A;  4DIQ A;  3LL7 A;  2PYH A;  3PSF A;  4XKW A;  2PJR B;  2DOA A;  2VQG A;  5JHF A;  3BC9 A;  1TT0 A;  4NC7 A;  2F6C A;  1PKV A;  3QYE A;  1OR7 C;  1OB0 A;  1OGO X;  4C2U A;  4UZU A;  1V0F A;  2HVQ A;  4F91 B;  1T5E A;  1JRG A;  1IB4 A;  3CZ6 A;  1U0J A;  3CP2 A;  1FMW A;  1UD2 A;  4JMQ A;  1O8E A;  2EWE A;  3LNN A;  2CS3 A;  2R7O A;  3VSL A;  2Z6B D;  3S93 A;  1XG2 A;  2X3H A;  4YZQ A;  2QE7 A;  3S32 A;  2LH9 A;  4XN3 A;  2VQH A;  4F55 A;  3QOD A;  2VKH A;  4KIS A;  3PNY A;  2R9V A;  2AQE A;  3OYM A;  1H80 A;  3AFH A;  5CPR B;  2BW3 A;  4I84 A;  4IX7 A;  1UEL B;  3A3G A;  4OAZ A;  1WJF A;  4YZA A;  1KTW A;  2L9N A;  4HNT A;  3GVJ A;  4BEH B;  4BL0 B;  2A6T A;  4RLF A;  2GK6 A;  1PXZ A;  3I3L A;  4MR0 A;  2V4J C;  1E3X A;  3MD2 A;  1DGW Y;  4J01 A;  1X1A A;  4II3 A;  1X19 A;  3EUH C;  3K70 D;  1VBL A;  1WP6 A;  1SAU A;  4XLA A;  2JDI A;  4DK0 A;  2JA2 A;  1UD4 A;  4KIT B;  4HIZ A;  1UD5 A;  2LBF B;  3QYF A;  4GQN A;  2XZO A;  4DNT B;  4G6T B;  1O88 A;  4X0G A;  3NE5 B;  4OZZ A;  3K6G A;  2UVE A;  2RRE A;  4N4N B;  3LSH A;  3GQ9 A;  3L2U A;  2R4G A;  2NTP A;  5LFA A;  1DQU A;  3OR1 C;  2E1B A;  2UUZ A;  3L2R A;  1LFP A;  1W36 C;  2L9S A;  2GJP A;  1X0C A;  2BVL A;  2WJY A;  2VJ4 A;  2ZTG A;  4ZDO A;  3K4K A;  1O8D A;  2MD0 A;  4PFP A;  4FET A;  2KRC A;  4W8S A;  3VYT B;  4DJA A;  1E43 A;  2IGK A;  5CDF A;  4DOZ A;  1QU3 A;  2GJK A;  1TZL A;  4BE0 A;  1O8F A;  4OJP A;  2O17 A;  2HQA A;  4OJ5 A;  4XL9 A;  3OW7 A;  3VSV A;  4JQF A;  4G6I A;  4F93 B;  3OYK A;  2HU9 A;  1VJS A;  2M0M A;  3HOS A;  2VQL A;  4E7J A;  1HG8 A;  1X1D A;  3E1S A;  1JTA A;  4E7I A;  2X85 A;  2IS2 A;  4ZTF A;  4XMY A;  1W0J A;  2NTB A;  1E79 A;  1N75 A;  4XLH A;  3A4C A;  3OYB A;  4Y4R A;  4D9J A;  1WFX A;  2LC2 A;  3DTE A;  2UWM A;  4XN0 A;  1O8K A;  1VLY A;  2PJR A;  4G7W A;  4XON A;  3OYG A;  2JVH A;  2E1M C;  3LSG A;  4XKC A;  4J00 A;  3IAM 2;  2WSS A;  4YXW A;  1MW7 A;  1Z21 A;  2KP6 A;  1BR2 A;  5HLT A;  2WY8 Q;  3OWT A;  4XKV A;  1N78 A;  1DBO A;  2X1E A;  1Z7L A;  4RMN A;  1UG0 A;  2X8K A;  3W2W A;  2ZXH A;  1KCC A;  3BLY A;  2IGM A;  2CH0 A;  2ZXI A;  3N05 A;  2Z2S B;  1W36 D;  4OWR B;  3LMW A;  2XF5 A;  1OFM A;  1E3Z A;  3T9G A;  5CQG A;  1QCX A;  4MLO A;  2CUJ A;  3OY9 A;  5FRO A;  2VPL A;  4BQO A;  2QXZ A;  3D5R C;  4R79 A;  2R7V A;  1SKY B;  3OMY A;  4URR A;  3K4C A;  2HZD A;  2VJ5 A;  4DBR A;  4L8J A;  2JJ2 A;  3SUC A;  2F43 A;  1QHH D;  4BEH A;  3OYE A;  4CA0 A;  2WAD A;  3GQA A;  1X4P A;  1NG6 A;  2GJR A;  2W00 A;  4C2L A;  1BHE A;  3DTK A;  1DBG A;  1P9Q C;  1PE9 A;  3BC8 A;  3RPU D;  4PFO A;  4PUS A;  4KT6 A;  2W1O A;  3TBI A;  3H94 A;  3H9J A;  3A2K A;  1E0E A;  1V0E A;  4QPO A;  4PK4 A;  1K6Y A;  3OFN A;  1G8X A;  3S3M A;  1K5C A;  1D1C A;  2INV A;  3AL0 B;  3UW0 A;  2LBF A;  1J09 A;  1IDK A;  5TGT A;  4ZTJ A;  2WAQ A;  5HKK A;  1PYV A;  2WPD A;  2LRD A;  3GVL A;  1D0Z A;  3BCA A;  3OYL A;  2JVG A;  2JJ1 A;  4XOR A;  1I18 A;  2LRE A;  4IQJ A;  2F4I A;  2OUM A;  5HNH A;  2R7W A;  3A3B A;  1Z3X A;  3OL4 A;  1UAA A;  4P22 A;  1YX3 A;  2I8D A;  2HDW A;  3IUO A;  4NQW B;  3JU4 A;  5FL7 A;  1HZE A;  2NZM A;  1GLN A;  3WWG A;  1ZEL A;  2IS4 A;  3BCB A;  4B47 A;  2CMP A;  3SYT A;  1DP3 A;  3B8Y A;  2X1C A;  4LIT A;  2XOK A;  3WQZ A;  3IP4 B;  4XD7 A;  1MNE A;  1KZL A;  3GVK A;  4F3Q A;  2ELJ A;  4CH7 A;  4NK8 A;  1LDK B;  2E60 A;  2R7Q A;  3FHN A;  3H9Q A;  4C2T A;  3FKJ A;  1RU4 A;  2RNG A;  3S3O A;  3OYI A;  3H0D A;  2X53 S;  4BU2 A;  2BSP A;  3MKY B;  4E7S A;  3C2H A;  4EW9 A;  1MAB A;  2KMU A;  1BOB A;  1IA5 A;  2NOJ B;  2M7B A;  2VXZ A;  3FKS A;  3DDY A;  4KJZ A;  2L5Q A;  1BR1 A;  1MND A;  1FX0 A;  4BQQ A;  2ZTN A;  1T95 A;  3FBN B;  4HNU A;  1CZF A;  2VB6 A;  4KKT A;  2VAS A;  3ZPN A;  3GQB A;  3GQ8 A;  2VBM A;  4BE1 A;  1HA8 A;  3DKY A;  4YZ0 A;  3PNV A;  4CCL A;  3D5S C;  3OL3 A;  1D1B A;  3CP8 A;  4BUP A;  4CCM A;  1N77 A;  4KKS A;  2F1M A;  2IS1 A;  2O0W A;  3PUB A;  1E1R A;  4ASU A;  2CW8 A;  2A5W A;  4EAT A;  2UVF A;  4ITV A;  3QYB A;  3NWS A;  4D1Q A;  2OV7 A;  3QOE A;  4AVZ A;  3FBI B;  3OYD A;  1H8E A;  2L2O A;  4B3X A;  4XLE A;  3OEE A;  4HG2 A;  2NT6 A;  2VLA A;  1Y6I A;  3LMM A;  4RM2 A;  4HST A;  3W3C A;  3OS2 A;  5FRN A;  2O0V A;  3GQ7 A;  3PL8 A;  3IAS 2;  5HNF A;  3VYS B;  1YX5 A;  4YZX A;  3VYR B;  2ZZQ A;  2IXS A;  1W9X A;  3KEY A;  3RTR A;  4DGW B;  2QY1 A;  2PYG A;  4IKF A;  3K4J A;  2X6Y A;  3K4L A;  3ZQQ A;  4CZC A;  1RWR A;  2VIX A;  1MMG A;  2WB1 A;  3HC7 A;  4BJ5 C;  4NK6 A;  2F5V A;  2KVO A;  1EE6 A;  2WA0 A;  2MC4 A;  1WJC A;  3ZSC A;  5KNL A;  3VMW A;  3H35 A;  4U49 A;  4IZZ A;  2IGN A;  3S8P A;  4DBQ A;  2DT7 B;  4C30 A;  1COW A;  1VF7 A;  3TMO A;  4E7H A;  4B44 A;  4TT3 A;  2VBK A;  1Y56 A;  4P5O A;  5AMV A;  2ODL A;  2AQF A;  3OYH A;  3MKZ A;  3ONQ A;  2ZFU A;  3OS0 A;  3FY3 A;  3H9G A;  4Y3O A;  2XGJ A;  4ZC3 A;  2Q1Z B;  1BN8 A;  3G2B A;  3EPZ A;  1I8D A;  2KRH A;  1WTH D;  2HVS A;  1YE9 A;  2CW7 A;  2DJI A;  4BE2 A;  3KEW A;  4OAY A;  1T0F C;  4H4K C;  2K9M A;  2KL4 A;  5HVQ C;  2LZJ A;  3DPT A;  4CUG A;  2W6I A;  4ZJZ A;  3OYJ A;  3OAA A;  3BG7 A;  2JUG A;  1LKX A;  4JOM A;  3RQ4 A;  3OYF A;  3KRG A;  4GRI A;  3I9V 2;  3C2G A;  2L7K A;  4PSX A;  5FRM A;  1AA7 A;  3B90 A;  2ZZF A;  1NG7 A;  2KZV A;  1KMH A;  4CCO A;  1WJB A;  2VL8 A;  3K4B A;  4CCK A;  2K3P A;  2V1N A;  4ZYA A;  4TKO B;  2FUG 2;  1O8G A;  2JSP A;  5HOO A;  5DN6 A;  2HPM A;  1UD3 A;  2HLD A;  4W8R A;  2HPI A;  2M4K A;  3ZR8 X;  3K4N A;  2D3N A;  4Z05 A;  2R7T A;  4Z1M A;  3DPU A;  4YEJ A;  4LIV A;  3RSN A;  3EQN A;  2E5N A;  4MXN A;  3F9K A;  4U4B A;  2DXI A;  2CV2 A;  2WAF A;  4YRV A;  3HOT A;  4AU7 A;  4XNF A;  2IQ7 A;  4BQN A;  2HNH A;  4BXF A;  3KX2 A;  2GOM A;  1NRK A;  2K5C A;  3LSK A;  3DKX A;  2Z16 A;  1R6R A;  4QPQ A;  3S3N A;  3FDY A;  4DK1 A;  4CCN A;  2UV1 A;  3OYA A;  2MFZ A;  4XKB A;  4FXU A;  2QKM B;  2LOO A;  3ZXS A;  3OEH A;  1WJ5 A;  4II2 A;  2CK3 A;  4HRI A;  2Z1D A;  3GRH A;  3BG6 A;  4B48 A;  5IK2 A;  4E0F A;  1KON A;  1PJR A;  2NTQ A;  4OJ6 A;  4OZY A;  2QKL B;  4KKU A;  1MMN A;  2RQQ A;  4OJO A;  3W2A A;  4F52 A;  3ZPP A;  4B3G A;  1MMD A;  4XLF A;  3KYL A;  2KPM A;  2X6W A;  4E7Z A;  3MMY B;  5KHD A;  4DNR B;  4C9Y A;  3J7A Y;  4Y33 A;  3K70 C;  3HXL A;  4E4H A;  2R7R A;  2BVM A;  4W8Q A;  2WAE A;  3UNG C;  1IDJ A;  3K10 A;  3VDX A;  3LSM A;  3H5A A;  2CUZ A;  3ZCO A;  2M5S A;  2V7F A;  2E5Z A;  4CSW A;  1HVX A;  2OC6 A;  2XF6 A;  3SDB A;  2IS6 A;  3HL2 A;  3FPP A;  4W8T A;  2R7U A;  3DU5 A;  2VBE A;  2V7Q A;  1SFK A;  2ZSH B;  4XLC A;  3OPO A;  3OYN A;  3VSU A;  3SEQ A;  2XF7 A;  2WZP P;  3AL0 C;  4XQF A;  3LSI A;  3L2W A;  3DWL E;  2X51 A;  1MMA A;  2XDV A;  2VJJ A;  2VXD A;  3ZRG A;  4BDY A;  3OS1 A;  1NHC A;  3U21 A;  2XND A;  4IQ4 A;  3VR6 A;  1VZ0 A;  1E1Q A;  1GQ8 A;  2IGO A;  3DLA A;  2X6X A;  3VSK A;  2R7S A;  1EA3 A;  4HEA 2;  3OYC A;  4E6K G;  4PJL A;  4AYB A;  3DEE A;  4TSF A;  4ZDP A;  4ANJ A;  2GOX B;  2MYS A;  1UD6 A;  1OGM X;  1EFR A;  2P0W A;  3V42 A;  2NSP A;  4Z06 A;  4XR6 A;  4N4O B;  2PMZ A;  3DU6 A;  3EQO A;  3HUG B;  4BAC A;  3E0J B;  2XZL A;  1PLU A;  3RCO A;  3DTI A;  3GBG A;  5LD2 C;  2KLO A;  1BLI A;  2W4S A;  2W82 A;  4LIU A;  1O8I A;  1RMG A;  3BCD A;  1V5E A;  3OR2 C;  3VWB A;  2M4G A;  4E7K A;  1BPL A;  2LYC A;  2HVR A;  3CES A;  3PNT A;  1O8L A;  2VQC A;  3OOC A;  1O8J A;  4PJJ A;  4P1W A;  3CMM A;  2XC7 A;  1AIR A;  1QJV A;  4PMH A;  1Z3Y A;  2DCE A;  2E1M B;  3OIP A;  2O04 A;  1JI8 A;  1OFL A;  4RLQ A;  4U7B A;  3SEZ A;  2W6J A;  3VST A;  2BOL A;  1KCD A;  4HSR A;  1X4O A;  2LY2 A;  5C1C A;  2Y0S A;  3LFU A;  3HPG A;  3PFY A;  3VMV A;  1V5F A;  2O1D A;  3ZGK A;  2NST A;  4B3F X;  4PJM A;  1OHH A;  3M1C A;  3HAG A;  1NBM A;  1BR4 A;  2DT6 A;  4G7X A;  2QX3 A;  1WJA A;  4XOT A;  3ZIA A;  3CJQ B;  2BW3 B;  3W2V A;  2VJI A;  4XOP A;  4BJ6 C;  3HG9 A;  4XM3 A;  4BS9 A;  2JIZ A;  2KDO A;  2V4D A;  2D3L A;  3BH4 A;  2M7A A;  3PSI A;  2V9K A;  1OOC A;  2ZZG A;  3JUR A;  4BGD A;  4U87 A;  1UD8 A;  3A1Y A;  4RM3 A;  1D0X A;  2KQR A;  3NWT A;  3TL4 X;  1IRX A;  1X1C A;  2R7X A;  3L2V A;  3H5R A;  1LVK A;  1O8H A;  1X1B A;  3M8J A;  3MKW B;  5CKT A;  4HPQ A;  1D1A A;  3VYU B;  3BCF A;  2WBM A;  4E7L A;  3T56 B;  4CCJ A;  3T53 B;  2DIE A;  2LG4 A;  2Z8G A;  3L2Q A;  4ZDL A;  3OIQ A;  3B4N A;  2M3A A;  2WY7 Q;  2WJV A;  3K4M A;  3AKZ A;  2V31 A;  2X1D A;  2ZSI B;  2NT9 A;  3OE7 A;  4OJL A;  1S9H A;  3CF2 A;  1WPC A;  2GK7 A;  4YEL A;  1D0Y A;  1OLT A;  3A35 A;  1H8H A;  1V5G A;  5KCM A;  1W0K A;  2XZP A;  3UR3 C;  2XSJ C;  4NNJ A;  1DGR M;  3D5L A;  3T51 B;  4Z03 A;  3OOU A;  1WJD A;  4NUB A;  2ZZE A;  4HWV A;  5C1E A;  3G05 A;  2Q2E B;  3CJR B;  2K9L A;  1G59 A;  2V26 A;  1K28 D;  2CV0 A;  2O5R A;  1WJE A;  2V6E A;  2CV1 A;  2VKD A;  4B43 A;  1ERD A;  2XAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...