4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
1EE6A 2QX3A 4I84A 2NZMA 4W8RA 1GQ8A 3GQ8A 4XN0A 4YZXA 4XLCA 3KRGA 2X6WA 2VJJA 2NTPA 2X3HA 3GQ7A 4W8SA 4Z05A 1O8DA 2PYHA 4OJPA 2NTQA 1KCDA 1PLUA 2NSPA 2VBMA 4URRA 4XKWA 1O8HA 3ZPPA 1O88A 4AVZA 1XG2A 2NSTA 2EWEA 2BSPA 2PECA 2NT6A 1OFLA 4XM3A 2O0VA 4YZ0A 1K5CA 3VSUA 1HG8A 3EQNA 4YEJA 1O8FA 2NT9A 2IQ7A 2UVFA 4XLEA 3GRHA 1KCCA 3VMWA 1OOCA 4XKVA 3FY3A 4XLAA 4OJ6A 2O1DA 1IA5A 4XLHA 3VMVA 4XONA 1AIRA 4MR0A 1X0CA 1KTWA 1IDJA 4XOTA 3B4NA 3EQOA 3VSVA 4XNFA 4PMHA 2INVA 4XQFA 1JTAA 4U4BA 4W8QA 4NK6A 4YZAA 1RU4A 2QXZA 4OJLA 5AMVA 2ODLA 3UW0A 1O8LA 1PE9A 4OZYA 1O8MA 4XOPA 4OJ5A 4EW9A 4Z03A 3GQ9A 3JURA 1O8KA 1CZFA 3LMWA 4C2LA 1OGOX 2O04A 2VBKA 1RWRA 4XR6A 1DBGA 4XMYA 4XL9A 2PYGA 2VJIA 2QY1A 1O8IA 3WWGA 1O8EA 2X85A 1RMGA 3ZSCA 4NK8A 2NTBA 4OJOA 4XLFA 1VBLA 2VBEA 4YZQA 1O8JA 4XORA 1OFMA 2UVEA 4HWVA 1O8GA 2INUA 1QCXA 3B90A 1DBOA 1JRGA 4Z06A 1QJVA 5C1CA 4XN3A 5C1EA 2Z8GA 1BN8A 1IDKA 2X6YA 1BHEA 1WMRA 3VSTA 3B8YA 1NHCA 2X6XA 3SUCA 1H80A 4U49A 1IB4A 1PXZA 3GQAA 2O17A 4OZZA 4W8TA 3T9GA 4MXNA 4YELA 1OGMX 2O0WA
chains in the Genus database with same CATH superfamily
1EP1B 1WZ2A 2OTLI 1HW5A 2M8GX 1B59A 3KLOA 4P9UA 2ISZA 1GR1A 3WTTC 1MABA 3SJMA 4ITVA 2O0YA 4KDPA 4OPWA 1R5GA 2GREA 1IG7A 1RR8C 2W6JA 1KYZA 3I55B 3PIOF 3ZPNA 2R7XA 1QRYA 5HLIA 2IP2A 5K5OA 2JWTA 4IW3B 5LGTA 2VBMA 4URRA 1XDUA 3DPUA 1JHHA 4X07A 1QHGA 2D1HA 1UD8A 1VQMB 1O88A 3BC8A 1VF7A 3HTUA 3BR2A 2IPQX 2VE9A 4KNYA 3WNDA 4AVPA 1T98A 3HM5A 1ZELA 4GYIA 2FQ4A 3KLNA 2PMHA 2KDZA 4EJVA 4YAWA 4KYWA 1SKYB 1SKQA 2IQ7A 2E5NA 4QPQA 5DCMB 3L2VA 1OLTA 2KQRA 3FK7A 3BQJA 3M8EA 4FCYA 1N08A 2LC2A 3GLXA 3PL8A 1OCOH 2BX6A 1Z7UA 4PJNA 1G3YA 1B72A 4KMUX 4RDKA 1ETYA 4G94A 2K5CA 3HC7A 4CHUA 2W4SA 3OSGA 1A6QA 3W5VA 1TQIA 3HOZJ 3JRIA 5EZHA 4YZAA 1Q86D 2D3NA 1J7KA 3IUOA 5FO5A 3JREA 2A6EF 1FOYA 3ABMH 1OYIA 1JJ2B 3ABLH 1X4OA 1TNSA 2O5RA 2XPVA 4QLCU 1OKRA 2L02A 1IXRC 4RD6A 3GTKJ 2Q6KA 1W7PD 2LF7A 4OAZA 4OZYA 2VBZA 2QQAA 2R7VA 5HZAA 2V1DA 3DTEA 3AG4H 2QKLB 3CCQI 3HPHA 3AL0C 5H5JA 4HX8A 2ZMEA 2ADUA 1APLC 5CQEA 1PJ7A 1BR1A 1Z77A 1VQ8B 1WQ2A 2VBKA 1X1DA 1L0OC 2L9VA 5F4MA 2VBSA 4PABA 1BA5A 4HZFA 4L0ZB 4CGZA 4HIZA 2DFFA 4AF6A 4BE1A 1O8EA 2CQQA 1VZ0A 1B4AA 4I02A 3PVDA 2NTBA 2W6IA 2EINH 2XT2A 4P22A 2FMLA 2QE7A 3GVKA 3A4CA 1SD5A 4XORA 5L3BA 1UFMA 4DYCA 2O3FA 1MMNA 1WJ5A 2DT6A 2L7KA 3MWMA 2XUBA 2XVCA 4XRFA 2L3DA 4L9NA 5DCFA 1FTTA 1E3XA 2CRVA 1YYVA 3DU5A 3OIQA 2R3SA 4HDVA 1BC7C 3KEOA 1XB4A 1FY7A 2DT5A 2M45A 3HRMA 2GK7A 3FBNB 1MBEA 4P9SA 3OIPA 4BY7J 5K7ZA 2BN4A 5FGMA 1LPQA 2FEZA 4JK1X 2DODA 4M1KA 5DTDA 3DPLC 5EYRA 3QU3A 3DU1X 2WJVA 3LA2A 5E1XA 2WC2A 3HUGB 2ESHA 1K61A 3ZQGA 3CC4B 1XQBA 1XSVA 3WHBA 1F4KA 4RB1A 2XC7A 4X05A 1UD2A 4X7EA 2FBKA 1B72B 2JMWA 2VLAA 3CCUI 2VB6A 3BH4A 4XRSA 2XTXA 1GXQA 1R23A 3A02A 3PSSA 1IGNA 5GPAA 1XB2A 1BR2A 1D1AA 3CCMI 4NC6A 5D5VB 2VASA 2STWA 5TR9A 1UG0A 2H1LA 5ERIA 2LK2A 2Y69H 4LBZA 1TC3C 3NAWA 2KIFA 4HX4A 4HV5A 1YJWI 1N07A 1Z1DA 2DW4A 4RLZA 3OL3A 2CFOA 2X53S 1RKWA 3Q9VA 4XKWA 3KZYA 1GLNA 1X2NA 4IRIA 1VQ5B 2LMDA 3C1DA 4Y15A 2F3LA 1R5ID 4NQWA 1UHSA 3CDHA 2JN9A 3EUHC 3CC4I 2CK3A 2ZMEB 2YU9J 4MLOA 3RZOJ 2VI6A 3CCLI 5K5RA 1F9NA 3KYLA 4I2OA 5H59A 3V8JA 2DA7A 3Q6QA 1WSVA 1UHMA 1K79A 2BF4A 2XSJC 2VUMJ 2JK3A 3OIOA 2BVMA 4TMTA 4YFXF 5FLVA 2I5UA 1AWCA 5AIQA 1XS9A 3AGQA 2BM4A 2K9SA 3OV8A 4CDGA 2PJPA 1GAQA 5F4OA 3OYDA 1J9ZA 1K4ZA 2EFPA 1AHDP 2HDCA 3H3UA 2ZJRF 3SFIA 5JBQA 1SVOA 2DQLA 1HKSA 4RAGA 3J81Z 2LY2A 4WXHA 2WY8Q 3Q0UA 1V5FA 1FBQA 4D5CA 2VBUA 4ZDPA 2O6WA 1IN7A 2CO5A 1ON2A 4MFEA 1D0ZA 3KETA 2OZUA 3CP8A 2OJED 4NB5A 1SFOJ 3JRGA 2JRTA 3HRSA 1UD3A 4LB6B 4U9UA 4UZEA 1ZGJA 2CUEA 4U7BA 3ULQB 4H9GA 3ABUA 3GYHX 3CPWB 1YI2I 2CUFA 2TCTA 4XR6A 4BACA 1WH7A 5E6TA 1J0RA 1ZKGA 3C3WA 1VQPB 3KYCB 4XIDA 5AONA 1SMTA 2G0EA 4FE7A 4RM3A 3J7ZI 3OOCA 3DKWA 3FPKA 1GV2A 3SQNA 4LIVA 1KRHA 2BV3A 4EATA 3UNGC 2GIZA 4WZTA 1MSEC 2LP0A 3OL4A 3WHCA 4S0HB 4ZJZA 4TV7A 3OOUA 4PC1A 2DA1A 1LEBA 2HZDA 2EFGA 2QGGA 4BBRJ 3BOQA 1D2EA 3VYSB 3N97A 2HDDA 3FDYA 4E7KA 4D1QA 4RDJA 4LG3A 2QSGX 5HVQC 2ZTNA 1MMSA 2M7AA 2MABA 2XB0X 3HEFA 4RGXA 1BQEA 2RKHA 2KJBA 1CQTA 4IHSA 2W57A 1QGYA 2UXNA 3DLAA 1BM9A 5FB2A 2FVGA 3W5HA 1BHEA 2E1RA 1SAXA 1HW1A 3JRBA 3SZEA 1DPUA 2OU2A 4ENJA 1WJAA 3DU6A 1JKOC 4YAUA 4YFOA 3LSHA 4EVIA 1NK2P 1TNTA 3GO5A 4W8TA 1MNMC 1LNWA 1NB9A 5L46A 2W84A 4B1RA 4FETA 3I4MJ 4AM3A 3KYDB 5E3LA 4YZXA 3F0CA 3EQLF 1K78A 1E1RA 3LAPA 5L3EA 3FKSA 4UY8I 4B4CA 3OMYA 2R9VA 3W6KB 5D5WB 1CF7A 3R6KA 2DPUA 1KQ9A 3ZMTA 4OJPA 2KDOA 2V9VA 1N75A 3MKYB 3ROUA 2BGIA 1UMKA 2EV5A 4DBQA 2ACJA 1KZLA 4CZZA 5E3NA 2XRLA 4ZZDA 1E17A 3LNQA 4P2NA 4PUSA 4RLQA 3ZPPA 3GZ5A 3OJXA 1MNEA 4KA4A 2JQ7A 4XKBA 1R7JA 2ZTGA 4U0WA 5LBQA 2LOOA 3Q9SA 1FBUA 2K02A 4GGGA 2E1CA 2VXZA 2CNDA 5BOXA 3S1MJ 1YQAA 4TMXA 3G1OA 4OMYA 4UUVA 2C77A 2MBFA 2Z5UA 3GTGJ 2UVFA 3OS2A 2XROA 1V0EA 3A8JA 1VLOA 2XB5A 2HNHA 2LDUA 3IH4A 2V5IA 2HYJA 5GAGJ 3GLLA 5CVUA 2OCEA 3HSFA 1V54H 1H0MA 4HW0A 2QA4B 1F20A 1NB0A 2OD5A 1AIRA 2AXTC 3QFCA 3W3CA 2VBYA 4M6XA 3FM5A 2XOKA 4ASUA 5GAHJ 4BXUA 2V9KA 2V7UA 1HDPA 3DBRB 1YIJI 1FRQA 2HS5A 3B02A 1R6RA 4NBSA 3SXYA 2J8KA 5D5UB 1MKMA 1GV5A 3BG3A 4M9ZA 4D5FA 3K70D 4C43A 2XKPA 4ENMA 1MBFA 1JUMA 2ZKZA 1HVXA 4C2LA 1S6LA 4G6IA 3VO1A 1Z67A 3D5SC 2W7NA 1I1SA 1BOAA 2AQFA 1IC8A 5LGNA 5J4VA 2OBTA 2Q6OA 2BBYA 4PSXA 1TWFJ 5LRRA 3ZQQA 4KKSA 5F6FA 2VNIA 1K78B 1UD5A 3ONQA 5GP9A 3E6MA 1CF7B 1A31A 5CPRB 2E1NA 2G7HA 2Q2EA 3BCBA 5GV7A 1OFMA 3BJAA 3JAMZ 3DXJF 1GVDA 2KKOA 3LL7A 1FX0A 2E36A 2ZFWA 1ZLJA 1QCXA 2P6SA 2QSFX 2ZB9A 2KPMA 3BG6A 3ZIAA 1VHOA 4OWRB 3RZDJ 1YLOA 2AO9A 4JOMA 4KKTA 4F7ZA 1VQ6I 2IW5A 3VSKA 5DDGA 3O8GA 3A2KA 1TZLA 2E2HJ 3WTSC 4YCQA 2CMPA 4DOZA 2EFOA 5LEJA 1T6ZA 5HS9A 1F5TA 1HF0A 3U2RA 2E2IJ 3S3MA 2G9WA 4I0BA 1OISA 4HA8A 1PXZA 3LSRA 1CLWA 2O17A 1QNTA 1HA8A 4MXNA 2O8KA 1HCRA 1TQMA 5IP7J 1U6GA 2DTRA 3CZ6A 2TRTA 3HYIA 3IP4B 1KZHA 1QZYA 3K4MA 4C0SA 1JA1A 2PX9A 2FMYA 2Y30A 4CCJA 1FZPB 3CPXA 4I84A 1DDNA 2X6WA 4B3FX 4V19K 1KK0A 4V2FA 3LFUA 3HPGA 3KCCA 1EFTA 1U8BA 1ODDA 3J81k 3GUDA 2RV8A 2B7BA 2K85A 1ZGWA 5A2QK 2EA4A 2ETHA 5E18F 2Y0SN 2XNDA 2ZJQF 1AMOA 1CQXA 1FRNA 3AVXA 2WR8A 3BP8A 2QSHX 1JKQC 2DA2A 2BY2A 3SHFA 3K1PA 3TDUC 1N25A 3G3ZA 1JT0A 1IF1A 1J09A 3OS1A 3PA1A 2O8XA 1JTXA 1VQ9I 5IYDJ 1FP2A 3DFGA 1QA3A 3X2QH 1W87A 3R61A 4P55A 4DBRA 4L9JA 2VC1A 2HQNA 4ZYAA 3S1NJ 3V4GA 2VQLA 5EF6A 3LNNA 1JTYA 1MBGA 2QKMB 2FF4A 3PFYA 4WXCA 1TT0A 4HQMA 1TWHJ 1P92A 2EZKA 2P3MA 4RBOA 4KMFA 1W35A 1B8IB 4MNUA 1DDGA 4UZUA 3QSYA 3RY8A 1O7LA 4WZKA 4KN7X 1X0CA 3EQOA 3QFRA 3SQVA 3KEQA 2LNBA 1IAWA 4NNJA 4WZEA 2VNKA 3VO2A 1R5NA 2IS4A 1FP1D 1RR7A 4G9YA 4R1HA 5JVGF 2YS9A 4N3NA 3Q39A 1BIAA 3BTCA 2F48A 5BPIA 5E1WA 5IT9Z 2HVQA 4BQAA 1TQPA 4PJMA 2BPOA 1B23P 1WI3A 3MD2A 1ETKA 1O8LA 3MCZA 4M3EA 4XOPA 4B3AA 4C9YA 4OJ5A 2CQXA 1XDSA 1T39A 2M4GA 1IJFA 3HZJA 1O8KA 3LMWA 3FXOA 1Y8RB 2OUMA 3ZXSA 1LE8A 1PDNC 4AYBN 2A61A 1G3WA 5D6EA 4MTEA 3GX4X 1EXMA 4KKUA 2YR2A 2PG4A 4X6AJ 4XL9A 1TT5B 2JT1A 3RQ4A 2FXAA 3MEXA 3CCRI 5EEGA 3FXLA 4HE5A 2AHOA 3RKWA 2OZ6A 2PEXA 1LEAA 3L2WA 2FX3A 1WJCA 4D7NA 4E0FA 3FMRA 3S2HJ 5JMCB 4M6YA 4BU2A 2KRHA 4A3MJ 3CJQB 1T33A 3O2PE 1JE8A 2V79A 1XD7A 3C18A 2A6TA 4Z06A 4JX6A 3SKBA 3WGHA 3DKXA 2LZJA 2H6CA 2V26A 2PMDA 4ZCIA 2LG4A 3B6CA 1ZHFA 2D3LA 3BJOA 4OIRF 4QV2A 3CD6I 1ZUNB 2VBVA 4OOVA 1R00A 2NNYA 4J0QA 4PC2A 4BQOA 4TMWA 2L9RA 1QA6A 3I9V2 3VYUB 2Y75A 1S72I 3K4CA 2Y0SA 2KFDA 5K7FA 3RDIA 1L3LA 2JJ1A 3A0BC 3HKZA 4P5OA 3AKZA 1EZGA 2X48A 3J80Z 3B73A 1ZRDA 2J7KA 2KJCA 3HAGA 5CJ9A 2BM6A 3NWTA 3F8CA 1IXSB 5IP6A 1HOMA 1T5EA 3OEEA 5FA6A 4EH1A 2I8DA 1WXRA 2EB7A 3L2QA 2FSWA 3GXOA 4PDKA 1I6XA 4CZCA 4UUSA 1B9NA 1R4NB 4XD7A 4RMNA 4RS8A 3WY9A 2DDBA 4YIFA 1W4MA 4J00A 4LLLA 1LFPA 5FIUA 2W85A 1YO5C 1DARA 4BUPA 1YG2A 3ABTA 4MHGA 4AF7A 3ML6A 3S8PA 3U6BA 5CKTA 3TOBA 3HTSB 3A3GA 2B0RA 3E3VA 3G1LA 4II2A 2VL8A 2LFBA 4ENKA 4JBAA 1JJ6C 2R4GA 1X4PA 3S93A 2QZAA 1GVJA 2NSTA 1BR4A 1S7AA 1VF9A 2EQRA 4QVJA 1OYYA 3LAJA 3MQ0A 2L4AA 2DT7B 2DBBA 4UB8C 4UXNA 2MC4A 1VNDA 4Q4ZF 2GOXB 2EIKH 4WXDA 3BY6A 4A3IJ 3S1RJ 1YHQI 3DBHB 1HG8A 2HWVA 2YSRA 1J9IA 2BE5F 3JQPA 5CVJA 1IXCA 1NHAA 5E3MA 2CV2A 2QBYA 1VQKB 2A5WA 3AL0B 3WBKA 1PVEA 1RETA 1GT0C 3RPUA 4BJTA 2EV6A 3H94A 2L2OA 2OF7A 2CRGA 3E6DA 3SZGA 5BS6A 3A01A 1GUUA 2ELJA 1TW3A 1ZRCA 3FMQA 2L5QA 3CCVB 2RNGA 5TISC 1V5VA 1AKHA 3DLLF 3BZCA 2OTJB 3ASSA 2LREA 4IOCF 4TN1A 2F5EA 4RB2C 1SVLA 1YX5A 5JHUA 3CMMA 1R36A 2CQNA 4ZYEA 5FJ8J 2CFXA 3GTQJ 1SMYF 2CW5A 1KK3A 1G7RA 2GK6A 1MBJA 5IOZA 1FIPA 1JT6A 2FBIA 4MQVA 4BEHA 1ZREA 3FKIJ 3OR2C 3G2BA 1VHEA 3P9IA 4E70A 1VQ7I 4WQMA 4LJZF 4MEYF 2C2WA 2XNCA 2BSAA 4IRHA 4IHTA 2BHYA 2XZLA 3QU6A 4GYGA 4N4OB 5FLXK 2Y2ZA 4C30A 4JX5A 1LFBA 1E3HA 4M9SA 3I56I 4U7DA 3N6ZA 3BROA 1T38A 4GXOA 3WWGA 2VPRA 4OOIA 4UUSB 1RUNA 1J75A 4Y52J 1Y0RA 5ILUA 2VBEA 3K4JA 2RDPA 3VYRB 3KP7A 3BJ6A 2Y0MA 2IGNA 3KP6A 2VJ5A 3ASOH 3H9QA 2LF8A 1T95A 4Z4TA 1YRNA 1G7TA 3QAHA 2HOAA 4HLXA 5J8CA 1UD6A 1RNLA 1H8EA 2DOFA 3K10A 3G71I 1K4SA 4DQ2A 4A2UA 3VEPA 1XGNA 1E0EA 3DPTA 4M3BA 4I6ZA 4E7IA 3ZN0A 3PFIA 4RGRA 3V8KA 1EP3B 2EV0A 5DCMA 1U2RA 4B48A 2KRFA 1RKTA 3K1NA 2LYCA 3HRUA 1Y6IA 2DQRA 1W5CC 3FXMA 4YFNF 3GTLJ 4Y7CA 3KZIC 2CS3A 3ISXA 1QGZA 3AG2H 1ETVA 1KU2A 1I27A 3NARA 3RQIA 3A01B 2UV1A 3EDPA 3GFJA 5FKKA 1DPRA 2X3HA 1RESA 2EILH 2HKXA 4X7FA 1AKHB 2A69F 2EK5A 2KHMA 2K9QA 2GPJA 2NVQJ 2CBXA 4N9HA 1PLUA 5H2FC 1BI2A 4Q48A 3L2CA 1Q7YD 4FX4A 4Z4UA 4A3JJ 1DGRM 3CMYA 2IS2A 2BGJA 4BKXA 4CCLA 1RZ4A 4DIQA 1AA7A 4BEHB 1HZEA 1TYVA 1BBYA 2XDVA 2FUG2 1SEUA 3TMOA 2F1MA 3OY9A 4BE2A 3S14J 2O0VA 1MW7A 4P96A 3TL4X 5D8KB 3M7GA 1AIPA 3OYHA 1O57A 4LBYA 5B6IA 2CWEA 3EQNA 4YEJA 4R8HA 2BZTA 1BC8C 3H36A 4BBSJ 2ZXJA 3HOYJ 3QYEA 5DEQA 3TP0A 3E0JB 1HQCA 1P4WA 2CUJA 2L54A 3QPSA 1KK2A 4IO9F 4OJ6A 2CGPA 1W34A 3IAM2 3G4SI 3ZP5A 3SLDA 2E2JJ 2LKPA 3VSVA 3MZYA 3F6VA 5KAIC 3HSRA 1SD4A 3O3KA 1D1BA 3F3XA 3AG1H 2GBYA 4XQFA 4Y9UA 4Z4YA 5J4YA 1XC5A 1YRNB 2RVCA 4PFOA 2MD5A 1Y0YA 3OJWA 5K5QA 4M72A 3VNVA 2X51A 5BQTA 4G7HF 3HUGA 3ASTA 1U0JA 3CRZA 2W7ZA 4Z03A 3K9TA 1YITB 3LSPA 2R7TA 3WU0A 1BMFA 3ZZUA 2WV1A 3QFSA 3SDGA 1HC8A 4L0YB 1OHHA 2C6YA 3K4BA 5IYRA 3PSFA 3QFTA 2V1XA 1OPCA 4II3A 3I55I 3PUNA 4A3EJ 1FDRA 2L0KA 3HOWJ 5CVRA 3R0JA 3DCFA 1EP2B 3W2HA 2M3AA 2CV1A 2DYRH 2HOEA 4L5JA 3OYIA 2X1DA 2DOAA 2C4UA 3QE2A 2XT4A 4NK8A 3VFZA 3S2WA 1W36C 3OE7A 1VQMI 3HGGA 4J19A 1CNEA 1N0VC 3KL9A 4LC0A 4Z1MA 2Q1ZB 4AU7A 3CCEB 1OB0A 1H42A 1QFYA 1SM4A 1VBLA 1E3ZA 3CDLA 3RKYA 1TYWA 4BHPA 5KAFC 4Z4RA 3RPUD 2LY9A 4P6VF 3B90A 2JVGA 5DYMA 4HE6A 2H1KA 2BM1A 1QJVA 2DI3A 2BOLA 3M1CA 2VBXA 2X0KA 4GFBA 2BVLA 2RREA 2IJLA 5B1BH 4DYRA 4YG2F 3PNVA 3VWBA 1B1BA 4AUXA 2VQGA 5KNLA 2VKVA 3COAC 4UVAA 1DP3A 1FNMA 1O3RA 3K6GA 2JA2A 3OW2B 3VR6A 4KJZA 2MYSA 2IRFG 1EFUA 5HLGA 2K9LA 3I5UA 3PJRA 3WGGA 4JP0A 4U0VA 4UZFA 5KW9A 1R1UA 3CCSB 1X19A 3ZZTA 3LSTA 1NRKA 5A8AA 4IHYA 1XMXA 2O0WA 3Q3SA 2J5PA 3Q0VA 1STZA 1IUFA 1VQLB 2WZNA 3Q6RA 2J5OA 2E7WA 3E5XA 3TH0A 2OA4A 2FOKA 1OR7C 4NC8A 4PC6A 3WTVC 1P2FA 5BMZA 2XTYA 3P4GA 1WPCA 4G1BA 4W1UA 2X1CA 5J47A 2L4MA 3KP2A 1KCDA 1SANA 2E5ZA 3A03A 3IRQA 2KMUA 2PBIA 4MEXF 5M5YJ 1QVUA 1T08B 1VQ8I 2XF6A 3K4NA 5HOOA 5HDKA 2P6TA 3EYIA 4G7OF 3ZQFA 2M1BA 3V42A 1QFJA 3MMPA 4GO1A 2EWEA 3W2EA 2OAZA 3MKZA 1G7SA 2NOGA 3IWZA 3CTAA 1Q1VA 2EJRA 1YX2A 1NG6A 2KLOA 1NH3A 3ZMUA 1J59A 1JXSA 4AIDA 4HV6A 4RDUA 1IDYA 3SZPA 4EGZA 5HNFA 1H88C 2VQCA 2FE3A 4QTRA 3PA2A 2KVOA 2R7FA 2OBSA 3ASNH 4G12A 3BY1A 2JA6J 2X1EA 4H4KC 3PIPF 4FE4A 1YTYA 4CYCB 3VMVA 4LIUA 2VT2A 1FC3A 5B66C 1ZG3A 1EH6A 4G1VA 2FU4A 3SYTA 3T56B 2P81A 3P5JA 4ACBA 4W8QA 1I39A 2BY3A 2PLFA 1ZTRA 2V7VA 3ZR8X 4ZH4F 3PM1A 4KIFA 2V1NA 1HLVA 4OJLA 3CESA 2P8TA 2QQ9A 4XRSG 4HLYA 3ZMZA 3CXCB 1PE9A 1O8MA 2XGXA 4X0GA 1FJLA 4XKCA 3GTOJ 1Y0UA 5D6FA 1KMHA 3GQ9A 1OYWA 2KZGA 1V0FA 4NCNA 1FNNA 4F91B 3ERED 1VTNC 1MDMA 1QA2A 3L7WA 4OAYA 4BS9A 4XSZF 4A5NA 3TW6A 5FFXA 3BY2A 1IN4A 1FOWA 5DD8A 4OIQF 1IUYA 4FWTA 1BX1A 3T8TA 2CF4A 3NAUA 5GTIC 5FKMA 4XRMA 1Y1WJ 1LB2A 4IVNA 1GVHA 1H8HA 1IN5A 1VQ5I 3EPZA 5FRMA 3FXUA 1WSRA 2ZITA 3T8RA 1LDJA 3K1MA 3I4PA 3OZVA 2PI0A 3QP6A 2GIVA 1J2XA 3RSNA 5CQGA 2BW3A 1D8JA 4RD2A 1GHCA 2EA2A 3BCFA 2ZO4A 4RD4A 1X1CA 2WYRA 3L00A 5LLQA 4XN3A 1QQIA 2WAQN 5ED4A 2Z8GA 5EGOB 1ETWA 3TBIA 1Z9CA 4IJAA 2HPMA 5GTHC 3VSTA 2XSDC 3IL2A 4YAFA 2KT0A 1WJEA 1ZG5A 2NV4A 3A8IA 4YXWA 3VNUA 1IB4A 1TLLA 4N3GA 2MC3A 5ICEA 4A12A 1B6AA 5F0FA 4W97A 4O6JA 2F5FA 2GJPA 4JX4A 3L2UA 1JGGA 1H9GA 1WWXA 3LSJA 4DW6A 2V7WA 3OW7A 2QX3A 4M2LA 1MZBA 2DO7A 4BY1J 3NB2A 2BY0A 2ID3A 3V8LA 3GFMA 2DA6A 1VQNB 3OKXA 1W0KA 1W9XA 2MG4A 3SEJA 3LYCA 2KIUA 3ZMVA 2HOSA 5EJCA 2IEKA 1X1AA 2PE3A 1ELOA 3BPVA 1NTCA 4LMYA 4UV8A 2B0LA 2V4JC 1DU0A 2RQPA 1HDDC 4M0LA 2YWFA 1O8HA 1KGSA 1M1KD 3HB9A 1MGTA 3M9AA 2EIJH 1T0FC 3AK5A 4AVZA 1VQPI 1XG2A 1BJKA 2L01A 1YJNB 3B82A 1ORKA 2BSPA 2VE8A 1JGSA 2BY1A 1K9MD 2F6CA 4C3HJ 3S32A 1XTAA 1MDMB 1S8NA 3CC2B 2R7QA 3T51B 3QQAA 1ZGAA 2F4IA 2VBWA 1LLZA 1WPKA 4P1WA 2RC4A 3OYNA 1BW5A 3AVTA 3IRRA 5B5EC 2X8KA 5J40A 1ERDA 1IZ1A 3LFKA 4CSWA 4RD1A 4WWVA 3NWSA 3JTHA 2DDAA 2O1DA 1SVMA 4XLHA 5IYCJ 3E20A 4AC0A 1LVKA 3B8HA 3CMAB 3F22A 5D5XB 2M8EA 4BHBA 2JSCA 3H1CA 2H94A 2JSPA 1EFRA 2BW3B 1I7PA 4U4BA 3ABKH 3TKYA 2K4BA 1FOKA 3OFNA 1COWA 4QUZA 4PJLA 5AMVA 2WY7Q 4OP7A 3JTGA 3HOSA 5IT3A 3MZHA 2F1LA 1RUOA 3S16J 1G4DA 1S9HA 2XAJA 3VSLA 2CQKA 3AVVA 2LRDA 2VFQA 3D5RC 4PAAA 2GOMA 1BN5A 4XMYA 2PIAA 2WAQA 3ZC3A 1CNFA 2IS6A 1IDZA 1QGPA 3A1YA 1UMQA 2E1BA 1XPXA 4IQ4A 3ZQCA 3FX3A 2ZBKA 3F72A 4HQEA 1MSFC 2UXXA 4YZQA 2B7EA 1QO0D 5IYNA 1UELB 3L1PA 1EJ9A 1QH0A 1X58A 2IA2A 4G6DA 2FJ1A 3W2AA 1REPC 2L9SA 3ASQA 3G6EB 2Y48A 1VQ4B 3A8KA 1QA1A 2V6EA 3ONYA 3OYBA 3E6CC 2DOEA 2ME6A 3BH7B 3U21A 2QA4I 2BXZA 2NAZA 2Q8KA 2QCOA 3C2GA 4I01A 2BEOA 3JQRA 2XZPA 2CV0A 2FQ3A 2VKHA 3FISA 1OGMX 1B8IA 5L3GA 1RQRA 2Z3YA 4D7MA 4IEJA 3L2RA 4MGRA 1T6SA 3E5UA 1ZR2A 3ZOBA 4OIPF 4DZPA 1EE6A 4W8RA 2IBDA 2PQ8A 1FWZA 1U78A 3V7CA 2MLGA 3IKTA 1O3QA 4ACAA 3OR1C 1WDTA 3B78A 4Z4WA 4WF2A 1C0WA 2YUHA 2HGCA 4IX7A 2M0MA 3ECHA 4ROXA 3LA3A 4B43A 2XF5A 3GTJJ 4Y3OA 1LDDA 3N4MA 2M34A 4K2EA 1I5ZA 2ZXIA 4HNUA 3C2BA 3QODA 4Y4RA 5L3CA 1T6YA 3CMEB 2R0QC 5DS9A 3TGNA 1JUPA 2H6BA 2WADA 1FTZA 3LQRA 2UZKA 2Y9YA 3G1MA 1O8FA 1YS6A 2BMWA 2NNNA 2JZYA 4I7HA 3TOAA 2PLYA 3KP5A 2YU3A 2YX4A 4P9FA 5E17F 3HL2A 3AFHA 1MMAA 1U8RA 1HBXG 3BT9A 5DSZA 3GWZA 1N06A 3OYFA 3HKZN 2HMAA 4LG0A 2LTPA 4OOXA 4LK0F 2NVUB 4RA2A 3CC7B 4G6QA 2STTA 4F93B 3BTIA 2JA5J 2KISA 1FMVA 2XIGA 2CQ7A 1H85A 3HXLA 4E4HA 5E3OA 3UW0A 5M3FJ 3KP4A 2E34A 4L9TA 3JSPA 1BW6A 2E71A 1WFXA 3HHGA 3BR3A 2Z99A 2GM4A 2NRAC 4U0YA 2NS8A 4L9VA 4KN4X 2BHZA 1Z3YA 1FSEA 2O04A 2QN6A 3GTPJ 2COMA 3LQEA 1WSUA 3FZVA 3A35A 1ZM2A 4WCGA 3PSZA 2H8WA 2OPTA 2EZLA 1YOVB 3F21A 1USTA 2E19A 2O9LA 1XCBA 1MJ9A 3CLQA 5ICCA 4WWCA 4BDYA 9ANTA 2QF7A 4M3GA 1P9QC 2D74A 4ESJA 3FMSA 1R1TA 4MTDA 2VT3A 3R4KA 2XASA 4XSXF 5EEHA 2PJRB 3FM3A 1WCMJ 4X06A 1PYVA 1N05A 3CP2A 1OCCH 3A3BA 1RC9A 1F60A 2C5HA 3LSMA 2EFNA 4RPDA 1R49A 5E8GA 1RQPA 2R92J 1EWYA 3FKJA 4YHBA 1JA0A 3K4KA 5CVIA 3SUCA 4BAYA 2BGCA 2QTZA 4WK8F 1QUEA 3FWEA 2Z33A 4X8IA 3T9GA 3RKXA 4CO8A 1FEXA 1UG2A 3K2AA 2W48A 4F7DA 2Z16A 5FLMJ 1G3SA 3JRDA 1LQ1A 1SFEA 3K69A 2GJKA 2XAUA 2E1MC 2DFEA 2QENA 4HDUA 3GQ7A 4LG0B 2BYVE 3AVYA 4W8SA 1PUEE 2C78A 4KT6A 4DGWB 1W5TA 2EFQA 2P4WA 3QWLA 1SC7A 1UB9A 2MLKA 1QHHD 2NTQA 2XC1A 4C2MJ 3FHZA 4J01A 3VPRA 2I1LA 2HPIA 2ZZFA 2O7OA 3LQ6A 3KIOA 1D5YA 1H8AC 3CW2A 1QVTA 1OR7A 2ZJPF 1U5TB 4A3KJ 1Z6TA 2Y31A 2EPFA 1NBMA 3Q38A 1D3YA 2YWGA 3ESWB 4I99C 2X3UA 4RB3C 3S2DJ 4P26A 2HU9A 3PNTA 1FBSA 3DWLE 3J81K 3MN2A 2C4TA 2V7XA 4OOSA 2CJJA 2NT9A 4OU0A 3KE2A 4XLEA 3T53B 4A0YA 2YWEA 2HCJB 2A68F 2R7SA 3QPHA 3H92A 3R6SA 4B4DA 4B3GA 3PUMA 1NJID 1UD4A 2FBHA 1D5VA 1L1IA 2A3SA 2XTWA 1SAUA 5HZBA 3D0SA 3WTUC 3E6BA 2O61A 2TDXA 1WJFA 4LOCA 4ESFA 2F5CA 5H6RA 2LBFB 4XNFA 3PSIA 4RLFA 3CF2A 1YJ9B 3OYMA 1JHFA 1M90D 1TL8A 1SFXA 1X3UA 3ECOA 3WE2A 5A88A 4IPAA 4MIMA 5LRSA 4OM9A 2J8IA 1Y8QB 3T1BA 4DNCA 4ZCLA 3HG9A 1BJZA 1D0YA 2D45A 2JRMA 3BR5A 1JKRC 4I98B 4HF2A 3OYAA 2V6CA 1UAAA 5EZGA 4P6YA 2ZL5A 1MMGA 1X3ZB 4UAJA 4YRVA 1OQYA 1R1VA 3U2QA 3NEUA 4EM2A 3OYJA 4RCZA 3EUHA 4N0BA 1NDHA 2OQRA 3A1PA 4DZJA 3QP5A 2M5WA 3FBIB 3SLNA 2DERA 4M3FA 1RIOH 3HRTA 2QEXB 2PYGA 1FMWA 3K7AJ 5BSYA 1YE9A 2ZXHA 2X85A 3ZSCA 1HKQA 1XG1A 3BQYA 3RCOA 1P7JA 4A6EA 4E6KG 1PUFA 2WZPP 3M8FA 1E3PA 3PO2J 2DMUA 2NOJB 1ZM4A 3GSIA 4TSFA 2XNJA 5FL7A 3L9FA 3RIRA 2R5YA 1S7OA 4PZJA 4HSTA 2XHKA 2DLLA 3I64A 2QVOA 4JQFA 4PC7A 4DNRB 1X1PA 3GZ6A 1PP8F 2P7VB 3ZMDA 4B8XA 3GW2A 4EM0B 4YIRX 5IYWA 1IN8A 2ZFUA 1TWCJ 4ON0A 1R5OA 1YS7A 2QDXA 3PNYA 1W7PA 4F55A 1VQKI 4EMSA 2ZCWA 2HYFA 1BN8A 2CU7A 4YC5A 1XSXA 4YIIA 1QGAA 4DK0A 5BNGA 4A0XA 1DDIA 3ASRA 2HVSA 1YW8A 2L7FP 2HXOA 3W6JB 4A3LJ 2B5OA 3GZNB 2QEXI 3CCVI 3WNCA 1XE1A 4Y33A 2V9PA 4N4NB 4PC3A 5LHGA 2OTJI 2DMTA 5JR3A 2M87A 4M74A 3OZUA 2WAEA 5TRDA 4RAZA 4BGDA 3R60A 1O4XA 4M4SA 4XN0A 2LD5A 2JPCA 2B63J 5J3OA 3J7AY 2L7ZA 3C7JA 4AIJA 2XGJA 1MJBA 1YFHA 1O8DA 2K4JA 1N77A 1QRBA 4BXXJ 2HZTA 1KQ8A 2EBIA 2XKOA 2B9SA 2EWNA 2R7OA 3DF8A 3BNWA 3ZUGA 2ZNYA 3ES9A 3LO8A 3E1YE 2ECCA 4CXFA 2R5ZB 1R5HA 1QBJA 1WOSA 4PGOA 3PO3J 2K9NA 3CCJB 3LOCA 4GCVA 4XM3A 4EGYA 4OMZA 2D2WA 1ZK8A 4I76A 2DYSH 2HVRA 1T0FA 1R5BA 2FD5A 1X3WB 4L5EA 1DG1G 2HQ5A 2IA1A 3S3OA 3VMWA 1VQOB 2NPFA 4EJTA 2IGOA 4XLAA 1MMDA 3OPOA 1W2BB 4CUGA 3CB4A 1WJBA 1PUFB 5JVTA 2FNPA 3WG9A 2M30A 3MCAA 1XN7A 4BL0B 2FA5A 2IA0A 4PGHA 4U88A 4F3QA 2R5YB 2H8RA 3LJYA 3CCYA 4FISA 2CUZA 1RU4A 4Q7JB 3CJRB 5LHHA 3WTYC 2OTLB 2QXZA 1WTHD 3KX2A 2RGVA 1EA3A 5K1YA 1WOOA 1W7PB 1AOYA 2M4KA 1ACIA 3GMEA 4HSRA 1R58A 1U2WA 1V5EA 2DK8A 2QGUA 3SFZA 1FNBA 1GAWA 2WB1N 1DGWY 4PJJA 3KPHA 3AGPA 4P1VA 1S3JA 4FQGA 3JAMK 4EW9A 2CSOA 3S3NA 1W0JA 4BXFA 3V7RA 2WV0A 4G6TB 1I50J 1P7IA 1JB9A 1KK1A 5KSWB 1D1NA 2PN6A 3E7LA 2W24A 1DBGA 2CG4A 2DA3A 3BR1A 1U5TC 1K73D 4RD3A 2IT0A 2VQHA 4CCOA 1X1BA 2MSYA 4PK4A 3TO7A 3VYTB 2CW0F 3DP7A 1WJDA 3ELKA 4EM1A 2GQQA 2RN7A 4E7LA 4QVAA 2A5YB 3TO9A 2PMZA 3BZ6A 1QUFA 3QOPA 1A6IA 4GRIA 5HLTA 4TKOB 3W2FA 3ZPLA 2PMUA 2ZJ2A 2BXYA 1WORA 2P7CB 2IOUG 4LK1F 5EG0B 4KFCA 2XAFA 1HKTA 2ZSHB 1HA3A 2ZBVA 4G5GA 5IYPA 4JYKA 2MFZA 4M71A 1IJWC 4K1XA 2YX7A 4EJOA 1V4RA 5FRNA 2F4MB 4M53A 1I18A 4C3IJ 1IRXA 2OCCH 2JIZA 2VZLA 1TTTA 1EA0A 5FKOA 1Z21A 3GCMA 1IO2A 2HTSA 4RD0A 3BTJA 3W2GA 2DJIA 2GLOA 1TWGJ 1ETOA 3H9GA 5FO1A 1G6NA 5DM6F 3HJEA 3QPLA 4CYCA 3G05A 1XMKA 2ZZEA 4IKFA 1MRZA 4KISA 3DV8A 2IS1A 2XF7A 5J35A 2DA4A 1UZCA 1I8DA 1BI3A 2GAUA 3CCQB 1A04A 2NZMA 3F9KA 4XLCA 1LJ9A 2VJJA 2LKSA 4C3JJ 2Y9ZA 3KRGA 1J5YA 2NTPA 4RPBA 1Z3XA 3H5RA 1ZM3A 4LGWA 3KP3A 3CO6C 3O6BB 3WTZA 3BLYA 2HEOA 4YAOA 1YITI 4CQJA 3WTWC 1I3AA 5JLXA 4B44A 3HOXJ 2XV4S 2KL4A 3TP3A 3R0AA 1BIBA 4B47A 1G59A 3GVJA 1GO2A 3DTKA 1IV6A 3P27A 3SEQA 2H27A 4LBWA 3T0YA 3WTXC 1ETXA 2NVYJ 2DETA 4PJ0C 5GV8A 1D1CA 2KIQA 4HEA2 4CYDA 1W0TA 5DS0A 1XFOA 3CUOA 3GBGA 4IOAF 3CCEI 3CF5F 5IT9K 4A93J 5HS7A 2AXLA 2GA1A 3VDXA 3QYFA 5D4RA 5A2QZ 3VB2A 4IL6C 1K4TA 1OOCA 4LD5A 4Q47A 4YFKF 3JR9A 3WXMA 2WB1A 4F92B 2GJRA 2BV6A 3JCUC 4A3GJ 2RC5A 1PP7U 2HFHA 1TW2A 2MW8A 4XOTA 2YWHA 3JRFA 3B4NA 1O7FA 3FK6A 4N9IA 3RIQA 3AAFA 2DPDA 2R7UA 2M9HA 2B7CA 4NK6A 3OP1A 4Y7NJ 3GFLA 4E7ZA 1QZZA 5EGOA 1DABA 1KONA 4AD9A 1KA8A 3V7AA 3OYCA 3HDDA 1WVRA 3IH3A 4DJAA 3CCSI 5BPDA 3CCUB 2RQQA 2DCEA 4D9JA 1UHWA 3JX8A 4MQ9F 4X7CA 3I3LA 3CCMB 2K7LA 5M5XJ 5L3FA 3LMMA 4EQQA 3W2IA 1FIAA 1VQLI 2HR3A 1ZARA 3MZ8A 4KIGA 2DU9A 1K8AD 4BH9A 3GIRA 1YJWB 1N8RD 3KZZA 4DYQA 1CGPA 1EH8A 1OGOX 1IW7F 1FYMA 1RWRA 1Z05A 3JRAA 1MIJA 3ZQ7A 4A0ZA 5CYVA 3U1DA 2AS5F 1OGIA 2JJ7A 5HODA 1OCTC 4RGUA 2LKXA 5IK2A 2HQAA 3WU1B 1QRCA 1Q82D 5L3DA 2RNJA 1HSJA 3CCLB 4OJOA 3SYJA 4I0AA 2CYYA 2WBMA 1KQ5A 2VNJA 3J80K 1N0UA 1T56A 3OEHA 5EMNA 4Z4VA 1TBXA 4FX0A 5H20A 1OCPA 1TLHB 1TVCA 4A3CJ 1DBOA 4O5VA 2ZSIB 1HXDA 4GDFA 1VI0A 5IP9J 3PQJA 3R6JA 1ON1A 1IJEA 2WJYA 4L8JA 3I4NJ 4G7ZF 2VODA 3F8BA 4X0CA 2JN6A 2V4DA 1KU7A 3TDZC 2X6YA 1K6OA 3ZN1A 5TGTA 1IV8A 4BNCA 3OOPA 4Y13A 3RPQA 2R7ZJ 3CUQC 5HKKA 1MD0A 2X6XA 5LHIA 2ZNZA 1ZQ3P 1H80A 3F8MA 3GQAA 3QYBA 3MVPA 2OV7A 1WI9A 3E1SA 3MAJA 1OCZH 4ZDOA 1KJZA 1IB0A 2XAQA 5HS8A 1BI1A 4HAMA 4PCQA 1E43A 3WBJA 2QUFA 4BPRA 2VFOA 1MH4A 2L9NA 4RGSA 4S04A 4P25A 3FXRA 5LFAA 3OSFA 3IWFA 2VPLA 4BQNA 1FSHA 4P3IA 5HDGA 3MMYB 1G3TA 1S29A 1YI2B 4CCNA 2QTLA 4R79A 1FNDA 4L5IA 5GAEJ 4QWQA 3SEZA 2D9RA 1D0XA 4IQJA 1JKPC 2BM0A 2ZXWH 1PJ5A 2MA3A 3CJNA 3MFKA 4Y17A 3BH6B 5DM7F 1FT9A 4FTHA 5LMZA 2VJ4A 5K7HA 4RCYA 1G2HA 1NG7A 2IVMA 1QVFB 4PSWA 1F43A 2F2EA 5LEKA 3GFIA 2G0YA 3FXKA 5H6QA 3ZBTA 2DMPA 2NYXA 1OFLA 2OQGA 4E7HA 1Z0XA 1XMAA 3FF5A 4YZ0A 2VBTA 3K4LA 5B3SH 3K2ZA 3I71A 3PUFA 3CJTB 4FXUA 1MBHA 2W82A 1KCCA 1XGSA 1OFCX 1TYXA 2RC6A 5F27A 4Z4SA 5FKLA 2YPRA 4CA0A 4G7WA 3B6AA 2ECBA 5KCMA 3M07A 1XCVA 3RKQA 5J8FA 3P26A 1XX5A 2W00A 5FROA 1LKXA 3HOVJ 3SZTA 2XZOA 3SDBA 4AWXB 4BYYA 3ZQIA 3ZQHA 2L7MP 4Z2YA 4HNVA 2Q0OA 3H0GJ 1LFUP 4IHWA 2VNHA 2WPDA 1BL0A 2NVXJ 4YEIA 5JFRA 2D1VA 2QYOA 4ABZA 1SD6A 1WHUA 2JUGA 1A8PA 3OYLA 1HW2A 1OGJA 4CH7A 1JUSA 4EV0A 3ZGKA 4QIWN 3BG7A 2G7UA 2HOTA 3GTMJ 2F5DA 1LUJB 3SJZA 4NQWB 1U9OA 1VQNI 2LLKA 4V2GA 1D8TA 3OWTA 3H35A 4IHXA 2E35A 5J1UA 1DUXC 3H3VK 1BLIA 2MGQA 4QPOA 2LVSA 2HDNB 2ISYA 2F4NA 5AN9A 2F43A 1QPIA 4L18B 4XLFA 4ESBA 3F6OA 1EV7A 2Z1DA 1OCRH 5DV5A 2DY1A 3D26A 1YJNI 1POGA 3OAAA 4LFUA 1O8JA 1E1QA 4X7DA 2HXIA 2QM3A 2NS7A 2LSOA 5F0HA 5ICFA 3CC2I 3V76A 1KYWA 3QPTA 2E1MB 2X9DA 5FLXZ 1G8XA 4PGGA 3I54A 1TTYA 1R71A 5C1EA 3MKLA 1ZG1A 4O3MA 3JQQA 4ZTFA 2XPUA 1DP7P 4FN5A 2VOPA 5TY0A 3BG5A 3CMAI 2OK7A 3IH2A 3NRVA 2KIMA 2Z6BD 4U49A 1HSTA 5IYBJ 2PFBA 2KZVA 2JPBA 1G7CA 1WP6A 4OZZA 1YIJB 1TYUA 2NVTJ 4YELA 3BG9A 3ZMSA 2DJNA 3WE3A 3RTRA 5ILVA 2DMNA 5C44J 2CW7A 3DEWA 3H9NA 3H3ZA 5J6XA 1B9MA 4UHTA 4CCKA 1WOPA 3TQNA 3OS0A 2K40A 1KQSB 3P7NA 1R9TJ 2KP6A 4DK1A 3ASPA 4ZGNB 3D5LA 3V7SA 5FO0A 4Z05A 3K0LA 2GWRA 2EIXA 2AHQA 2WA0A 1VLYA 1KC8D 1LVAA 3KFWX 4HG2A 3J7AO 3BWGA 4ANJA 2X4HA 3U9GA 1YX3A 2FNAA 4WX9A 3T5XA 2P5VA 4NHJA 3UR3C 2R6HA 3ML3A 5E1ZB 3GVLA 3AG3H 1OB2A 1H89C 1OFDA 4YDTA 1TP4A 4G8XA 1HF2A 1Y0NA 2K86A 5THXA 2XRNA 4E7SA 2M7BA 5ICGA 2PECA 4A6DA 5ILSA 4OPOA 2BM7A 5F08A 1P4MA 2HYGD 1GJRA 4ZYHA 3Q3AA 3S1QJ 4QSHA 4IXAA 3BCDA 3WYAA 1IN6A 4C2UA 2DTZA 2HQRA 2E60A 1JNYA 2V31A 4YALA 4DNTB 3VOEA 4XICA 4A69C 1T8IA 1N78A 1VQ6B 3GRHA 1VFCA 3VMFA 4XKVA 2UUZA 3OYEA 4E7JA 1GXPA 2GQFA 3FJOA 4IRGA 3H0DA 3H5AA 3BC9A 3LQQA 4Z4ZA 2P0WA 4I09A 5EEAA 3G6EI 3OYKA 1U3EM 4HPQA 2DMQA 4QHYA 4MR0A 1VQ4I 3H09A 3BDDA 2N8GA 1IHMA 1DQUA 1OMIA 1T6XA 5FFZA 2RAEA 4ETSA 2PJRA 5HXBA 2VN2A 1O3TA 5C4JJ 3JSOA 4CICA 3LA7A 2ZMEC 4ZTJA 4ZC3A 5M3MJ 2WAFA 3CO7C 4KIBA 2BM5A 1KU3A 1TWAJ 3EUAA 2BVNA 3BCAA 3QOEA 3RYPA 2VXDA 1LLWA 5M5WJ 1E2XA 2K3PA 5KK1A 4RAYA 2EFWA 2JUCA 3BQZA 3CQZJ 4HOBA 5KVRA 1OFEA 2Z2SB 4RB0A 4F52A 2GXBA 1E62A 2OYNA 4PFPA 3FXJA 1PKVA 3JU4A 1LM1A 1ENHA 1F36A 1V55H 3I59A 3F8NA 5BSXA 1YIOA 2XAHA 1Y39A 3J7YJ 2VJIA 5E20A 3H9JA 2QZ8A 3BR6A 2A05A 5J3LA 1DU6A 1O8IA 3EYYA 1R22A 2R7DA 4HNTA 1RMGA 2K27A 1VQ9B 5J1RA 3JRHA 4ZDLA 1UJ8A 3U1KA 2M0CA 5DUIA 4S05A 2A07F 3CLOA 3W6VA 4GQNA 1LDKB 4FK8A 3ZZ0A 4BHCA 1YLFA 2VC0A 2IGMA 5IOYA 4HX7A 2FRHA 3RI4A 3TEDA 1ETQA 4XLNF 3G73A 3HOTA 3CMEI 2INUA 1KU9A 1U5TA 5TJJA 3S15J 1JRGA 1ZYRF 4A3BJ 5F4JA 4JMQA 1IRZA 5C1CA 2XAGA 1NK3P 3MHPA 2V7FA 5D8LB 2JJ2A 2MD0A 2CH0A 1K8FA 1FNCA 2ZBUA 2K3FA 3Q0WA 1IRGA 1MBKA 3GQBA 5E79C 1IDKA 1ZH5A 3ZQLA 2GXAA 2VYQA 3B8YA 1I3QJ 2DOGA 5HDNA 4M73A 2ELKA 2K9MA 4RJLA 1SD7A 1W0UA 1RPWA 3E5QA 3W2WA 4UV9A 3FPPA 4HRIA 3ERMA 5F04A 4Y9RA 3LVBA 4UB6C 2QWWA 1JI8A 3WGIA 3CC7I 2LH9A 2ZC2A 1JJ8C 1YW7A 4P3YA 2VFMA 2LBFA 5HLHA 2W1OA 1V5GA 4BQQA 1GQ8A 2V7QA 4BJ6C 4UVBA 2R7RA 2VIXA 3K70C 2M5SA 3WU2C 1K7AA 2PYHA 2HKOA 1BI0A 2Q6IA 2E1OA 3HBLA 3REOA 1FLIA 4RM2A 3FIWA 2IXSA 1M1EB 2GA2A 2Q2EB 2NSPA 1I1GA 2D5VA 2Z9OA 3TW7A 3CCRB 3RJPA 3UKGA 4RAFA 4OIOF 2DFIA 2FX0A 2NS0A 1ZLKA 4NC7A 4D0PA 2HI3A 2HLDA 4OPSA 1Q1HA 2EZHA 5IYQA 2X0LA 2NT6A 4A3DJ 4AIHA 1FPQA 5CLSA 3QRFF 2DN0A 2R93J 4IZZA 1X2MA 3VODA 4Q5SF 3VSUA 1MJAA 5DUKA 1K5CA 3IV5A 1QPMA 1XGMA 3OYGA 3M1EA 3AVUA 3I59B 3DBLB 1WH5A 5GPCA 1K83J 1YW9A 2EZIA 5JLVC 5JLWA 4IF4A 4TMZA 4X1EA 3CD6B 1IA5A 4RDLA 5E8IA 4RM0A 4M6VA 4XONA 4B3XA 2O6GE 5FD6A 2ZZGA 1S72B 3GEZA 1Z7LA 4IHVA 3M3YJ 3ONUA 1ZRFA 3W5UA 2LR8A 4PMHA 1JTAA 3F23A 4BJ5C 3HOUJ 2VKDA 2CW8A 3LWFA 4EJWA 2JDIA 5J1YA 1H9TA 2OK8A 2UWMA 3WQZA 1MH3A 1USSA 1ZAOA 3EETA 4UVCA 4EJUA 5LD2C 1QFZA 1BJAA 4C2TA 5TV2A 3ZCOA 1R4MB 3ZBUA 3MKWB 3GVAA 4CCMA 2P5KA 2DXIA 2I10A 4XLPF 1ZN2A 1CZFA 4WZLA 4KT5C 1Z91A 3BTLA 1ULYA 1OJLA 3Q5FA 3PETA 4M3DA 1RI7A 1ONVA 2F5VA 1W1WE 2ESNA 2ID6A 3RYRA 2ZZQA 1WGXA 2QY1A 6PAXA 1P6RA 5CVVA 2C5BA 3KEWA 4TMVA 4NDLA 4LB5A 1S7EA 2OC6A 3I1FA 3DKYA 2VOOA 1YHQB 1W5SA 2H09A 4ASNA 4KICA 3BZKA 4FT8A 3W2VA 3S17J 3IC7A 4BE0A 2F4OB 2OBPA 2UVEA 2JTVA 1O8GA 1Q81D 4Z6YA 1QQ1A 1Z6RA 1KQ0A 5AIPA 1B2RA 1FYLA 1KTVA 1IRFA 4XBFA 5F1RA 1TUIA 4AIKA 2R5ZA 4MYTA 2IAIA 4KUMA 3EUKL 3TO6A 4ENNA 2NXNB 1ZR4A 3PQKA 3JW4A 1V3FA 2GXGA 5GADJ 1GDTA 2DA5A 4ZCMA 1T2KA 1D8KA 3O8HA 2QQBA 4HBLA 1BPLA 3HGYA 2ZL7A 3NE5B 2W25A 1XGOA 3CDIA 5IY5H 2DCUA 1YJ9I 3JRCA 3L09A 1S4MA 1P4XA 4ZZLA 1LE8B 1A36A 3LSKA 2QYUA 2DYIA 2Q6LA 1VQ7B 2COBA 1A5JA 3CUQA 3DQVC 5B1AH 5F1JA 3GQ8A 2JA8J 1WKMA 2VONA 2FOWA 4H0EA 4HF1A 3N90A 3IAS2 3WNBA 1QZEA 4A3FJ 2DK5A 1Y1VJ 5F0CA 4DQLA 3PENA 2MH2A 1BOBA 2KRCA 3FXQA 1FYKA 2X6OA 5FD5A 3I56B 3C2HA 3H5NA 1MNDA 3HIFA 2ME0A 1EKEA 2IGKA 4A5MA 3FHNA 2DFHA 1FOXA 2OBRA 4AYBA 1QG0A 4P12A 2PMZN 1E79A 5FNZA 1FX7A 3KEYA 4BDZA 2DEUA 4XK4A 3D1NI 4EEFG 1S5LC 1P4AA 3LSGA 4HF0A 1A35A 4NUBA 5F64A 4KH3A 2M2EA 4TT3A 1E64A 1BX0A 2VKEA 2WTEA 1EFCA 3G71B 4LLGF 2XPWA 1PJRA 1K28D 4MFDA 2XGDA 2ELHA 3P9CA 1Q9SA 1QVGB 3FY3A 4UNOA 3DEEA 3I53A 3SY2A 3A0HC 4OINF 5DNSA 2O03A 1K6YA 3N05A 1E3OC 3BPXA 3ISPA 1IDJA 1KTWA 1SFKA 3NQOA 5EG0A 2INVA 2VFNA 2EIMH 2HTJA 5CDFA 2E7XA 4ZYDA 2EH3A 1ITYA 4FHTA 5DD4A 3WG7H 2AQEA 1EH7A 2XGEA 4FASD 1W36D 2ODLA 1O3SA 4KITB 1WRJA 3WODF 5JI6A 2GZWA 2P5LC 1KD1D 2HDWA 2WSSA 3IKVA 2A6HF 3I58A 5LGUA 1ZM9A 4ZV4A 1I6HJ 1Y56A 5C4XJ 4LITA 3GF2A 1EF4A 2CC2A 3JURA 3E97A 1VJSA 3DDYA 2JVHA 5JHFA 4OPVA 2LY1A 5DN6A 2MH9A 2ZL6A 4DQKA 2WWYA 3I0TA 3CUQB 3IHUA 5IPAA 1S0UA 3AVWA 5EDNA 2XGCA 1OB5A 5D4SA 1XSDA 1WU8A 1RRJA 2QBYB 3HSEA 3F8FA 4NBQA 3M4OJ 4QFMA 3SJPA 4G7XA 4HYEA 3OZWA 4LBVA 4MYUA 2V1UA 1UCRA 1U9NA 3CCJI 4HWVA 1PJ6A 4MO7A 4B09A 3HHHA 3P9KA 2ICWG 4ZYGA 4LLNA 2JA7J 3M8JA 1QU3A 2VFPA 1TSPA 4JRAC 5C3EJ 5KHDA 1SFUA 4V02C 1E63A 3G4SB 2XEXA 3U6KA 3ZRGA 5FKNA 4R71A 2YUSA 4ZGQB 1VQOI 1QX4A 2R7WA 1WMRA 3PUBA 2QLZA 1NHCA 2QQ8A 3DEUA 3DTIA 2QMUA 4AC9A 4UUTA 3LSIA 5HNHA 2DIEA 5A89A 4M9XA 1F1ZA 3BR0A 4U87A 1AU7A 2V7TA 2DAOA
chains in the Genus database with same CATH topology
3OEEA 3L2RA 1MABA 1T5EA 2I8DA 1EE6A 3L2QA 1E43A 4W8RA 4CZCA 2L9NA 4ITVA 4XD7A 4RMNA 5LFAA 3OR1C 2VPLA 4BQNA 2W6JA 3MMYB 4J00A 1LFPA 3ZPNA 4CCNA 2R7XA 4R79A 4IX7A 4BUPA 3SEZA 2M0MA 3S8PA 1D0XA 5CKTA 4IQJA 3A3GA 2VBMA 4II2A 4URRA 2VL8A 4B43A 3DPUA 2XF5A 4Y3OA 1QHGA 1UD8A 2R4GA 1X4PA 3S93A 2VJ4A 1O88A 3BC8A 2NSTA 1BR4A 1NG7A 1VF7A 2ZXIA 4HNUA 4PSWA 3QODA 4Y4RA 2DT7B 1OFLA 2MC4A 1ZELA 4E7HA 4YZ0A 2GOXB 3K4LA 1HG8A 2WADA 1SKYB 1O8FA 2IQ7A 4FXUA 2E5NA 4QPQA 2W82A 2CV2A 1KCCA 3L2VA 1OLTA 2A5WA 2KQRA 3AL0B 4CA0A 2LC2A 3AFHA 1MMAA 3PL8A 5KCMA 4BJTA 2L2OA 3HL2A 4PJNA 3SZGA 3H94A 2ELJA 3OYFA 2K5CA 2L5QA 2W00A 2RNGA 2W4SA 3HC7A 1LKXA 5FROA 2XZOA 3SDBA 2LREA 4YZAA 2D3NA 1YX5A 4F93B 3CMMA 3IUOA 1FMVA 1X4OA 2WPDA 3HXLA 2O5RA 4E4HA 2GK6A 3UW0A 4BEHA 3OR2C 3G2BA 4OAZA 4OZYA 2JUGA 1WFXA 3OYLA 2R7VA 3DTEA 4CH7A 2QKLB 3HPHA 3AL0C 3ZGKA 3BG7A 5CQEA 2XZLA 4NQWB 1BR1A 1Z3YA 4N4OB 2O04A 2VBKA 1X1DA 3OWTA 3H35A 4C30A 3A35A 4HIZA 1BLIA 3WWGA 4QPOA 4BE1A 1O8EA 1VZ0A 2NTBA 2W6IA 2F43A 4XLFA 4P22A 2VBEA 2Z1DA 3K4JA 3OAAA 2QE7A 3VYRB 3A4CA 3GVKA 4XORA 1E1QA 1O8JA 2IGNA 4BDYA 1MMNA 1P9QC 1WJ5A 2DT6A 2L7KA 2VJ5A 3H9QA 1E3XA 1T95A 3DU5A 3OIQA 1UD6A 2E1MB 1H8EA 1G8XA 2PJRB 5C1EA 2GK7A 1PYVA 3FBNB 3CP2A 3K10A 3OIPA 3A3BA 3LSMA 1E0EA 4ZTFA 3DPTA 3FKJA 4E7IA 3DPLC 3K4KA 2WJVA 3SUCA 2Z6BD 4B48A 4U49A 3HUGB 2KZVA 1WP6A 4OZZA 2LYCA 3T9GA 4YELA 1Y6IA 2XC7A 3RTRA 1UD2A 2CW7A 2CS3A 4CCKA 2Z16A 3OS0A 2VLAA 2UV1A 2VB6A 2GJKA 3BH4A 2KP6A 2XAUA 4DK1A 2X3HA 2E1MC 3GQ7A 3D5LA 4W8SA 1BR2A 1D1AA 4Z05A 2WA0A 1VLYA 2KHMA 2VASA 4KT6A 4DGWB 1UG0A 4HG2A 2NTQA 1QHHD 4ANJA 1YX3A 4J01A 1PLUA 2HPIA 2ZZFA 3OL3A 2CFOA 3UR3C 1DGRM 2X53S 4XKWA 3GVLA 2IS2A 1GLNA 4CCLA 4DIQA 1AA7A 4BEHB 1HZEA 1NBMA 4E7SA 2M7BA 2PECA 2XDVA 2FUG2 3EUHC 2CK3A 2HU9A 4MLOA 3PNTA 3TMOA 3OY9A 4BE2A 2F1MA 1MW7A 3TL4X 2O0VA 3DWLE 3OYHA 3KYLA 3BCDA 4C2UA 3EQNA 4YEJA 2E60A 2NT9A 2V31A 4DNTB 4XLEA 3T53B 1N78A 3QYEA 3GRHA 3E0JB 2CUJA 2R7SA 2XSJC 4XKVA 2UUZA 3OYEA 4E7JA 4B3GA 4OJ6A 2BVMA 3H0DA 3H5AA 3BC9A 1UD4A 2P0WA 3IAM2 3OYKA 1SAUA 4HPQA 4MR0A 1WJFA 3VSVA 2LBFB 3OYDA 4XNFA 1DQUA 3PSIA 1D1BA 3CF2A 4RLFA 4XQFA 3OYMA 2PJRA 4PFOA 2LY2A 4ZTJA 4ZC3A 2WY8Q 3HG9A 1V5FA 2WAFA 1D0YA 2X51A 3EUAA 3BCAA 3OYAA 4ZDPA 3QOEA 1UAAA 2VXDA 1U0JA 1MMGA 2K3PA 4Z03A 1D0ZA 4YRVA 2R7TA 3CP8A 1BMFA 3OYJA 1UD3A 2Z2SB 4F52A 1OHHA 3K4BA 4U7BA 3PSFA 4PFPA 1PKVA 4II3A 3JU4A 3FBIB 4XR6A 4BACA 2PYGA 1FMWA 2VJIA 3H9JA 1O8IA 1YE9A 2M3AA 2ZXHA 2CV1A 4RM3A 4HNTA 2X85A 1RMGA 3OYIA 3ZSCA 2X1DA 2DOAA 3RCOA 4NK8A 3OOCA 4E6KG 4ZDLA 3OE7A 1W36C 4LIVA 2WZPP 4Z1MA 4GQNA 1LDKB 2NOJB 2Q1ZB 3UNGC 4AU7A 4EATA 1OB0A 1VBLA 4TSFA 1E3ZA 3OL4A 4ZJZA 2IGMA 5FL7A 3OOUA 2HZDA 4HSTA 3RPUD 2INUA 3HOTA 4JQFA 2JVGA 3VYSB 3B90A 3FDYA 4E7KA 4D1QA 1JRGA 4LG3A 1QJVA 4JMQA 5C1CA 2BOLA 2ZFUA 3M1CA 5HVQC 2ZTNA 2M7AA 2BVLA 2MABA 2V7FA 3PNYA 4F55A 2MD0A 2RREA 2CH0A 2JJ2A 1BN8A 3PNVA 3VWBA 3GQBA 3DLAA 2VQGA 5KNLA 4DK0A 1BHEA 1IDKA 1DP3A 3B8YA 2HVSA 3K6GA 2JA2A 3VR6A 4KJZA 2MYSA 1WJAA 2K9LA 2K9MA 3DU6A 3W2WA 3PJRA 3FPPA 3LSHA 4HRIA 4Y33A 4N4NB 4W8TA 1X19A 2WAEA 1JI8A 1NRKA 2O0WA 2LH9A 4FETA 4BGDA 2LBFA 2W1OA 1V5GA 4BQQA 1GQ8A 4XN0A 4YZXA 1E1RA 2V7QA 4BJ6C 2R7RA 3J7AY 3FKSA 2VIXA 2XGJA 1OR7C 3OMYA 4NC8A 3K70C 2M5SA 2R9VA 1WPCA 1O8DA 2PYHA 2KDOA 2X1CA 4OJPA 1KCDA 1N75A 3MKYB 4RM2A 1N77A 2E5ZA 2IXSA 2KMUA 4DBQA 2NSPA 1KZLA 2Q2EB 2R7OA 2XF6A 3K4NA 5HOOA 4PUSA 4RLQA 3ZPPA 1MNEA 3V42A 4NC7A 4G7WA 4XKBA 2HLDA 2ZTGA 2EWEA 2LOOA 3MKZA 2NT6A 2VXZA 1NG6A 4XM3A 2KLOA 4IZZA 3VSUA 1K5CA 3OYGA 5HNFA 2HVRA 2VQCA 2UVFA 3OS2A 1V0EA 2KVOA 3VMWA 3S3OA 2HNHA 2X1EA 4H4KC 2IGOA 4XLAA 1MMDA 3OPOA 4CUGA 1WJBA 1IA5A 3VMVA 4LIUA 4XONA 4B3XA 1AIRA 2ZZGA 1Z7LA 4U87A 4BL0B 3W3CA 3SYTA 4F3QA 3T56B 4PMHA 1JTAA 4W8QA 4BJ5C 2XOKA 2CUZA 1RU4A 4ASUA 2VKDA 3CJRB 2QXZA 2CW8A 2JDIA 1WTHD 2V9KA 3KX2A 3ZR8X 2UWMA 1EA3A 3WQZA 2V1NA 2M4KA 4OJLA 1R6RA 3CESA 4HSRA 1V5EA 5LD2C 4C2TA 1DGWY 1PE9A 3ZCOA 1O8MA 4PJJA 4EW9A 4X0GA 3MKWB 4XKCA 3GQ9A 4CCMA 2DXIA 1KMHA 3S3NA 1V0FA 1W0JA 4BXFA 3K70D 1CZFA 4F91B 4G6TB 4OAYA 4BS9A 1HVXA 4C2LA 2ZZQA 4G6IA 2F5VA 3D5SC 2W7NA 1DBGA 2AQFA 2QY1A 3KEWA 4PSXA 3ZQQA 4KKSA 2VQHA 4CCOA 1X1BA 2OC6A 4PK4A 1H8HA 3DKYA 3VYTB 1UD5A 3ONQA 1WJDA 3EPZA 5FRMA 5CPRB 3BCBA 3W2VA 4BE0A 4E7LA 3RSNA 1OFMA 2PMZA 5CQGA 2UVEA 5HLTA 4GRIA 4TKOB 2BW3A 1O8GA 3LL7A 1FX0A 1QCXA 3BG6A 2KPMA 3BCFA 3ZIAA 1X1CA 2ZSHB 4XN3A 4OWRB 4KKTA 2MFZA 4JOMA 3EUKL 2Z8GA 3TBIA 3VSKA 3A2KA 1TZLA 5FRNA 1I18A 2CMPA 4DOZA 2HPMA 3VSTA 1IRXA 2JIZA 3NE5B 1BPLA 1Z21A 3S3MA 1WJEA 4YXWA 2DJIA 1IB4A 1PXZA 2O17A 3H9GA 1HA8A 4MXNA 3G05A 2GJPA 2ZZEA 3L2UA 4IKFA 3CZ6A 4KISA 2IS1A 3IP4B 3LSKA 2XF7A 1I8DA 3OW7A 3K4MA 3DQVC 2QX3A 4I84A 4CCJA 2NZMA 3GQ8A 3F9KA 4XLCA 3KRGA 2VJJA 2X6WA 4B3FX 2NTPA 3LFUA 3HPGA 1Z3XA 3H5RA 3IAS2 1W0KA 3BLYA 1W9XA 1BOBA 2KRCA 2XNDA 1X1AA 4B44A 3C2HA 2KL4A 2V4JC 1MNDA 3H5NA 4B47A 1G59A 3GVJA 1O8HA 3DTKA 2IGKA 3FHNA 3SEQA 4AYBA 1T0FC 4AVZA 1XG2A 1E79A 2BSPA 1D1CA 3KEYA 4BDZA 4HEA2 1J09A 3OS1A 3LSGA 2F6CA 3S32A 2R7QA 4NUBA 3T51B 3GBGA 4DBRA 2F4IA 4P1WA 4TT3A 4ZYAA 3OYNA 3VDXA 2VQLA 3QYFA 3LNNA 1K28D 1PJRA 2QKMB 3PFYA 2X8KA 1ERDA 1OOCA 3FY3A 4CSWA 1TT0A 3DEEA 3NWSA 2WB1A 4F92B 2O1DA 4XLHA 2GJRA 1LVKA 4UZUA 1K6YA 3N05A 1X0CA 1KTWA 1IDJA 4XOTA 3B4NA 3EQOA 1SFKA 2JSPA 2INVA 4NNJA 1EFRA 2BW3B 2R7UA 4U4BA 5CDFA 4NK6A 2IS4A 4E7ZA 1KONA 3OFNA 3OYCA 2AQEA 2HVQA 4DJAA 4FASD 1COWA 4PJLA 5AMVA 4PJMA 2WY7Q 2RQQA 2DCEA 4D9JA 4KITB 1W36D 2ODLA 3I3LA 3MD2A 1O8LA 3HOSA 2HDWA 4XOPA 3LMMA 4C9YA 2WSSA 4OJ5A 2M4GA 1Y56A 4LITA 1O8KA 3JURA 3LMWA 2OUMA 3ZXSA 1VJSA 1S9HA 3DDYA 3VSLA 1OGOX 2JVHA 2LRDA 5JHFA 1RWRA 4KKUA 3D5RC 2GOMA 2LY1A 5DN6A 4XMYA 4XL9A 2WAQA 3RQ4A 2IS6A 3A1YA 2E1BA 5IK2A 2HQAA 4OJOA 4IQ4A 4G7XA 3L2WA 4YZQA 2WBMA 1WJCA 4E0FA 1UELB 3OEHA 4HWVA 4BU2A 2KRHA 3CJQB 3W2AA 1DBOA 3M8JA 2ZSIB 1QU3A 2A6TA 2L9SA 4Z06A 5KHDA 3DKXA 4L8JA 2LZJA 2WJYA 2V26A 3ZRGA 2LG4A 2V6EA 2D3LA 2V4DA 3OYBA 2R7WA 2X6YA 1WMRA 5TGTA 3PUBA 3U21A 1NHCA 5HKKA 4BQOA 2X6XA 3DTIA 3I9V2 3VYUB 4DNRB 3LSIA 3C2GA 2Y0SA 3K4CA 1H80A 2JJ1A 5HNHA 2DIEA 2XZPA 3HKZA 3QYBA 4P5OA 3AKZA 3GQAA 2CV0A 3HAGA 2VKHA 2OV7A 3E1SA 1OGMX 3NWTA 4ZDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE6 A;  2QX3 A;  4I84 A;  2NZM A;  4W8R A;  1GQ8 A;  3GQ8 A;  4XN0 A;  4YZX A;  4XLC A;  3KRG A;  2X6W A;  2VJJ A;  2NTP A;  2X3H A;  3GQ7 A;  4W8S A;  4Z05 A;  1O8D A;  2PYH A;  4OJP A;  2NTQ A;  1KCD A;  1PLU A;  2NSP A;  2VBM A;  4URR A;  4XKW A;  1O8H A;  3ZPP A;  1O88 A;  4AVZ A;  1XG2 A;  2NST A;  2EWE A;  2BSP A;  2PEC A;  2NT6 A;  1OFL A;  4XM3 A;  2O0V A;  4YZ0 A;  1K5C A;  3VSU A;  1HG8 A;  3EQN A;  4YEJ A;  1O8F A;  2NT9 A;  2IQ7 A;  2UVF A;  4XLE A;  3GRH A;  1KCC A;  3VMW A;  1OOC A;  4XKV A;  3FY3 A;  4XLA A;  4OJ6 A;  2O1D A;  1IA5 A;  4XLH A;  3VMV A;  4XON A;  1AIR A;  4MR0 A;  1X0C A;  1KTW A;  1IDJ A;  4XOT A;  3B4N A;  3EQO A;  3VSV A;  4XNF A;  4PMH A;  2INV A;  4XQF A;  1JTA A;  4U4B A;  4W8Q A;  4NK6 A;  4YZA A;  1RU4 A;  2QXZ A;  4OJL A;  5AMV A;  2ODL A;  3UW0 A;  1O8L A;  1PE9 A;  4OZY A;  1O8M A;  4XOP A;  4OJ5 A;  4EW9 A;  4Z03 A;  3GQ9 A;  3JUR A;  1O8K A;  1CZF A;  3LMW A;  4C2L A;  1OGO X;  2O04 A;  2VBK A;  1RWR A;  4XR6 A;  1DBG A;  4XMY A;  4XL9 A;  2PYG A;  2VJI A;  2QY1 A;  1O8I A;  3WWG A;  1O8E A;  2X85 A;  1RMG A;  3ZSC A;  4NK8 A;  2NTB A;  4OJO A;  4XLF A;  1VBL A;  2VBE A;  4YZQ A;  1O8J A;  4XOR A;  1OFM A;  2UVE A;  4HWV A;  1O8G A;  2INU A;  1QCX A;  3B90 A;  1DBO A;  1JRG A;  4Z06 A;  1QJV A;  5C1C A;  4XN3 A;  5C1E A;  2Z8G A;  1BN8 A;  1IDK A;  2X6Y A;  1BHE A;  1WMR A;  3VST A;  3B8Y A;  1NHC A;  2X6X A;  3SUC A;  1H80 A;  4U49 A;  1IB4 A;  1PXZ A;  3GQA A;  2O17 A;  4OZZ A;  4W8T A;  3T9G A;  4MXN A;  4YEL A;  1OGM X;  2O0W A; 
#chains in the Genus database with same CATH topology
 1EP1 B;  1WZ2 A;  2OTL I;  1HW5 A;  2M8G X;  1B59 A;  3KLO A;  4P9U A;  2ISZ A;  1GR1 A;  3WTT C;  1MAB A;  3SJM A;  4ITV A;  2O0Y A;  4KDP A;  4OPW A;  1R5G A;  2GRE A;  1IG7 A;  1RR8 C;  2W6J A;  1KYZ A;  3I55 B;  3PIO F;  3ZPN A;  2R7X A;  1QRY A;  5HLI A;  2IP2 A;  5K5O A;  2JWT A;  4IW3 B;  5LGT A;  2VBM A;  4URR A;  1XDU A;  3DPU A;  1JHH A;  4X07 A;  1QHG A;  2D1H A;  1UD8 A;  1VQM B;  1O88 A;  3BC8 A;  1VF7 A;  3HTU A;  3BR2 A;  2IPQ X;  2VE9 A;  4KNY A;  3WND A;  4AVP A;  1T98 A;  3HM5 A;  1ZEL A;  4GYI A;  2FQ4 A;  3KLN A;  2PMH A;  2KDZ A;  4EJV A;  4YAW A;  4KYW A;  1SKY B;  1SKQ A;  2IQ7 A;  2E5N A;  4QPQ A;  5DCM B;  3L2V A;  1OLT A;  2KQR A;  3FK7 A;  3BQJ A;  3M8E A;  4FCY A;  1N08 A;  2LC2 A;  3GLX A;  3PL8 A;  1OCO H;  2BX6 A;  1Z7U A;  4PJN A;  1G3Y A;  1B72 A;  4KMU X;  4RDK A;  1ETY A;  4G94 A;  2K5C A;  3HC7 A;  4CHU A;  2W4S A;  3OSG A;  1A6Q A;  3W5V A;  1TQI A;  3HOZ J;  3JRI A;  5EZH A;  4YZA A;  1Q86 D;  2D3N A;  1J7K A;  3IUO A;  5FO5 A;  3JRE A;  2A6E F;  1FOY A;  3ABM H;  1OYI A;  1JJ2 B;  3ABL H;  1X4O A;  1TNS A;  2O5R A;  2XPV A;  4QLC U;  1OKR A;  2L02 A;  1IXR C;  4RD6 A;  3GTK J;  2Q6K A;  1W7P D;  2LF7 A;  4OAZ A;  4OZY A;  2VBZ A;  2QQA A;  2R7V A;  5HZA A;  2V1D A;  3DTE A;  3AG4 H;  2QKL B;  3CCQ I;  3HPH A;  3AL0 C;  5H5J A;  4HX8 A;  2ZME A;  2ADU A;  1APL C;  5CQE A;  1PJ7 A;  1BR1 A;  1Z77 A;  1VQ8 B;  1WQ2 A;  2VBK A;  1X1D A;  1L0O C;  2L9V A;  5F4M A;  2VBS A;  4PAB A;  1BA5 A;  4HZF A;  4L0Z B;  4CGZ A;  4HIZ A;  2DFF A;  4AF6 A;  4BE1 A;  1O8E A;  2CQQ A;  1VZ0 A;  1B4A A;  4I02 A;  3PVD A;  2NTB A;  2W6I A;  2EIN H;  2XT2 A;  4P22 A;  2FML A;  2QE7 A;  3GVK A;  3A4C A;  1SD5 A;  4XOR A;  5L3B A;  1UFM A;  4DYC A;  2O3F A;  1MMN A;  1WJ5 A;  2DT6 A;  2L7K A;  3MWM A;  2XUB A;  2XVC A;  4XRF A;  2L3D A;  4L9N A;  5DCF A;  1FTT A;  1E3X A;  2CRV A;  1YYV A;  3DU5 A;  3OIQ A;  2R3S A;  4HDV A;  1BC7 C;  3KEO A;  1XB4 A;  1FY7 A;  2DT5 A;  2M45 A;  3HRM A;  2GK7 A;  3FBN B;  1MBE A;  4P9S A;  3OIP A;  4BY7 J;  5K7Z A;  2BN4 A;  5FGM A;  1LPQ A;  2FEZ A;  4JK1 X;  2DOD A;  4M1K A;  5DTD A;  3DPL C;  5EYR A;  3QU3 A;  3DU1 X;  2WJV A;  3LA2 A;  5E1X A;  2WC2 A;  3HUG B;  2ESH A;  1K61 A;  3ZQG A;  3CC4 B;  1XQB A;  1XSV A;  3WHB A;  1F4K A;  4RB1 A;  2XC7 A;  4X05 A;  1UD2 A;  4X7E A;  2FBK A;  1B72 B;  2JMW A;  2VLA A;  3CCU I;  2VB6 A;  3BH4 A;  4XRS A;  2XTX A;  1GXQ A;  1R23 A;  3A02 A;  3PSS A;  1IGN A;  5GPA A;  1XB2 A;  1BR2 A;  1D1A A;  3CCM I;  4NC6 A;  5D5V B;  2VAS A;  2STW A;  5TR9 A;  1UG0 A;  2H1L A;  5ERI A;  2LK2 A;  2Y69 H;  4LBZ A;  1TC3 C;  3NAW A;  2KIF A;  4HX4 A;  4HV5 A;  1YJW I;  1N07 A;  1Z1D A;  2DW4 A;  4RLZ A;  3OL3 A;  2CFO A;  2X53 S;  1RKW A;  3Q9V A;  4XKW A;  3KZY A;  1GLN A;  1X2N A;  4IRI A;  1VQ5 B;  2LMD A;  3C1D A;  4Y15 A;  2F3L A;  1R5I D;  4NQW A;  1UHS A;  3CDH A;  2JN9 A;  3EUH C;  3CC4 I;  2CK3 A;  2ZME B;  2YU9 J;  4MLO A;  3RZO J;  2VI6 A;  3CCL I;  5K5R A;  1F9N A;  3KYL A;  4I2O A;  5H59 A;  3V8J A;  2DA7 A;  3Q6Q A;  1WSV A;  1UHM A;  1K79 A;  2BF4 A;  2XSJ C;  2VUM J;  2JK3 A;  3OIO A;  2BVM A;  4TMT A;  4YFX F;  5FLV A;  2I5U A;  1AWC A;  5AIQ A;  1XS9 A;  3AGQ A;  2BM4 A;  2K9S A;  3OV8 A;  4CDG A;  2PJP A;  1GAQ A;  5F4O A;  3OYD A;  1J9Z A;  1K4Z A;  2EFP A;  1AHD P;  2HDC A;  3H3U A;  2ZJR F;  3SFI A;  5JBQ A;  1SVO A;  2DQL A;  1HKS A;  4RAG A;  3J81 Z;  2LY2 A;  4WXH A;  2WY8 Q;  3Q0U A;  1V5F A;  1FBQ A;  4D5C A;  2VBU A;  4ZDP A;  2O6W A;  1IN7 A;  2CO5 A;  1ON2 A;  4MFE A;  1D0Z A;  3KET A;  2OZU A;  3CP8 A;  2OJE D;  4NB5 A;  1SFO J;  3JRG A;  2JRT A;  3HRS A;  1UD3 A;  4LB6 B;  4U9U A;  4UZE A;  1ZGJ A;  2CUE A;  4U7B A;  3ULQ B;  4H9G A;  3ABU A;  3GYH X;  3CPW B;  1YI2 I;  2CUF A;  2TCT A;  4XR6 A;  4BAC A;  1WH7 A;  5E6T A;  1J0R A;  1ZKG A;  3C3W A;  1VQP B;  3KYC B;  4XID A;  5AON A;  1SMT A;  2G0E A;  4FE7 A;  4RM3 A;  3J7Z I;  3OOC A;  3DKW A;  3FPK A;  1GV2 A;  3SQN A;  4LIV A;  1KRH A;  2BV3 A;  4EAT A;  3UNG C;  2GIZ A;  4WZT A;  1MSE C;  2LP0 A;  3OL4 A;  3WHC A;  4S0H B;  4ZJZ A;  4TV7 A;  3OOU A;  4PC1 A;  2DA1 A;  1LEB A;  2HZD A;  2EFG A;  2QGG A;  4BBR J;  3BOQ A;  1D2E A;  3VYS B;  3N97 A;  2HDD A;  3FDY A;  4E7K A;  4D1Q A;  4RDJ A;  4LG3 A;  2QSG X;  5HVQ C;  2ZTN A;  1MMS A;  2M7A A;  2MAB A;  2XB0 X;  3HEF A;  4RGX A;  1BQE A;  2RKH A;  2KJB A;  1CQT A;  4IHS A;  2W57 A;  1QGY A;  2UXN A;  3DLA A;  1BM9 A;  5FB2 A;  2FVG A;  3W5H A;  1BHE A;  2E1R A;  1SAX A;  1HW1 A;  3JRB A;  3SZE A;  1DPU A;  2OU2 A;  4ENJ A;  1WJA A;  3DU6 A;  1JKO C;  4YAU A;  4YFO A;  3LSH A;  4EVI A;  1NK2 P;  1TNT A;  3GO5 A;  4W8T A;  1MNM C;  1LNW A;  1NB9 A;  5L46 A;  2W84 A;  4B1R A;  4FET A;  3I4M J;  4AM3 A;  3KYD B;  5E3L A;  4YZX A;  3F0C A;  3EQL F;  1K78 A;  1E1R A;  3LAP A;  5L3E A;  3FKS A;  4UY8 I;  4B4C A;  3OMY A;  2R9V A;  3W6K B;  5D5W B;  1CF7 A;  3R6K A;  2DPU A;  1KQ9 A;  3ZMT A;  4OJP A;  2KDO A;  2V9V A;  1N75 A;  3MKY B;  3ROU A;  2BGI A;  1UMK A;  2EV5 A;  4DBQ A;  2ACJ A;  1KZL A;  4CZZ A;  5E3N A;  2XRL A;  4ZZD A;  1E17 A;  3LNQ A;  4P2N A;  4PUS A;  4RLQ A;  3ZPP A;  3GZ5 A;  3OJX A;  1MNE A;  4KA4 A;  2JQ7 A;  4XKB A;  1R7J A;  2ZTG A;  4U0W A;  5LBQ A;  2LOO A;  3Q9S A;  1FBU A;  2K02 A;  4GGG A;  2E1C A;  2VXZ A;  2CND A;  5BOX A;  3S1M J;  1YQA A;  4TMX A;  3G1O A;  4OMY A;  4UUV A;  2C77 A;  2MBF A;  2Z5U A;  3GTG J;  2UVF A;  3OS2 A;  2XRO A;  1V0E A;  3A8J A;  1VLO A;  2XB5 A;  2HNH A;  2LDU A;  3IH4 A;  2V5I A;  2HYJ A;  5GAG J;  3GLL A;  5CVU A;  2OCE A;  3HSF A;  1V54 H;  1H0M A;  4HW0 A;  2QA4 B;  1F20 A;  1NB0 A;  2OD5 A;  1AIR A;  2AXT C;  3QFC A;  3W3C A;  2VBY A;  4M6X A;  3FM5 A;  2XOK A;  4ASU A;  5GAH J;  4BXU A;  2V9K A;  2V7U A;  1HDP A;  3DBR B;  1YIJ I;  1FRQ A;  2HS5 A;  3B02 A;  1R6R A;  4NBS A;  3SXY A;  2J8K A;  5D5U B;  1MKM A;  1GV5 A;  3BG3 A;  4M9Z A;  4D5F A;  3K70 D;  4C43 A;  2XKP A;  4ENM A;  1MBF A;  1JUM A;  2ZKZ A;  1HVX A;  4C2L A;  1S6L A;  4G6I A;  3VO1 A;  1Z67 A;  3D5S C;  2W7N A;  1I1S A;  1BOA A;  2AQF A;  1IC8 A;  5LGN A;  5J4V A;  2OBT A;  2Q6O A;  2BBY A;  4PSX A;  1TWF J;  5LRR A;  3ZQQ A;  4KKS A;  5F6F A;  2VNI A;  1K78 B;  1UD5 A;  3ONQ A;  5GP9 A;  3E6M A;  1CF7 B;  1A31 A;  5CPR B;  2E1N A;  2G7H A;  2Q2E A;  3BCB A;  5GV7 A;  1OFM A;  3BJA A;  3JAM Z;  3DXJ F;  1GVD A;  2KKO A;  3LL7 A;  1FX0 A;  2E36 A;  2ZFW A;  1ZLJ A;  1QCX A;  2P6S A;  2QSF X;  2ZB9 A;  2KPM A;  3BG6 A;  3ZIA A;  1VHO A;  4OWR B;  3RZD J;  1YLO A;  2AO9 A;  4JOM A;  4KKT A;  4F7Z A;  1VQ6 I;  2IW5 A;  3VSK A;  5DDG A;  3O8G A;  3A2K A;  1TZL A;  2E2H J;  3WTS C;  4YCQ A;  2CMP A;  4DOZ A;  2EFO A;  5LEJ A;  1T6Z A;  5HS9 A;  1F5T A;  1HF0 A;  3U2R A;  2E2I J;  3S3M A;  2G9W A;  4I0B A;  1OIS A;  4HA8 A;  1PXZ A;  3LSR A;  1CLW A;  2O17 A;  1QNT A;  1HA8 A;  4MXN A;  2O8K A;  1HCR A;  1TQM A;  5IP7 J;  1U6G A;  2DTR A;  3CZ6 A;  2TRT A;  3HYI A;  3IP4 B;  1KZH A;  1QZY A;  3K4M A;  4C0S A;  1JA1 A;  2PX9 A;  2FMY A;  2Y30 A;  4CCJ A;  1FZP B;  3CPX A;  4I84 A;  1DDN A;  2X6W A;  4B3F X;  4V19 K;  1KK0 A;  4V2F A;  3LFU A;  3HPG A;  3KCC A;  1EFT A;  1U8B A;  1ODD A;  3J81 k;  3GUD A;  2RV8 A;  2B7B A;  2K85 A;  1ZGW A;  5A2Q K;  2EA4 A;  2ETH A;  5E18 F;  2Y0S N;  2XND A;  2ZJQ F;  1AMO A;  1CQX A;  1FRN A;  3AVX A;  2WR8 A;  3BP8 A;  2QSH X;  1JKQ C;  2DA2 A;  2BY2 A;  3SHF A;  3K1P A;  3TDU C;  1N25 A;  3G3Z A;  1JT0 A;  1IF1 A;  1J09 A;  3OS1 A;  3PA1 A;  2O8X A;  1JTX A;  1VQ9 I;  5IYD J;  1FP2 A;  3DFG A;  1QA3 A;  3X2Q H;  1W87 A;  3R61 A;  4P55 A;  4DBR A;  4L9J A;  2VC1 A;  2HQN A;  4ZYA A;  3S1N J;  3V4G A;  2VQL A;  5EF6 A;  3LNN A;  1JTY A;  1MBG A;  2QKM B;  2FF4 A;  3PFY A;  4WXC A;  1TT0 A;  4HQM A;  1TWH J;  1P92 A;  2EZK A;  2P3M A;  4RBO A;  4KMF A;  1W35 A;  1B8I B;  4MNU A;  1DDG A;  4UZU A;  3QSY A;  3RY8 A;  1O7L A;  4WZK A;  4KN7 X;  1X0C A;  3EQO A;  3QFR A;  3SQV A;  3KEQ A;  2LNB A;  1IAW A;  4NNJ A;  4WZE A;  2VNK A;  3VO2 A;  1R5N A;  2IS4 A;  1FP1 D;  1RR7 A;  4G9Y A;  4R1H A;  5JVG F;  2YS9 A;  4N3N A;  3Q39 A;  1BIA A;  3BTC A;  2F48 A;  5BPI A;  5E1W A;  5IT9 Z;  2HVQ A;  4BQA A;  1TQP A;  4PJM A;  2BPO A;  1B23 P;  1WI3 A;  3MD2 A;  1ETK A;  1O8L A;  3MCZ A;  4M3E A;  4XOP A;  4B3A A;  4C9Y A;  4OJ5 A;  2CQX A;  1XDS A;  1T39 A;  2M4G A;  1IJF A;  3HZJ A;  1O8K A;  3LMW A;  3FXO A;  1Y8R B;  2OUM A;  3ZXS A;  1LE8 A;  1PDN C;  4AYB N;  2A61 A;  1G3W A;  5D6E A;  4MTE A;  3GX4 X;  1EXM A;  4KKU A;  2YR2 A;  2PG4 A;  4X6A J;  4XL9 A;  1TT5 B;  2JT1 A;  3RQ4 A;  2FXA A;  3MEX A;  3CCR I;  5EEG A;  3FXL A;  4HE5 A;  2AHO A;  3RKW A;  2OZ6 A;  2PEX A;  1LEA A;  3L2W A;  2FX3 A;  1WJC A;  4D7N A;  4E0F A;  3FMR A;  3S2H J;  5JMC B;  4M6Y A;  4BU2 A;  2KRH A;  4A3M J;  3CJQ B;  1T33 A;  3O2P E;  1JE8 A;  2V79 A;  1XD7 A;  3C18 A;  2A6T A;  4Z06 A;  4JX6 A;  3SKB A;  3WGH A;  3DKX A;  2LZJ A;  2H6C A;  2V26 A;  2PMD A;  4ZCI A;  2LG4 A;  3B6C A;  1ZHF A;  2D3L A;  3BJO A;  4OIR F;  4QV2 A;  3CD6 I;  1ZUN B;  2VBV A;  4OOV A;  1R00 A;  2NNY A;  4J0Q A;  4PC2 A;  4BQO A;  4TMW A;  2L9R A;  1QA6 A;  3I9V 2;  3VYU B;  2Y75 A;  1S72 I;  3K4C A;  2Y0S A;  2KFD A;  5K7F A;  3RDI A;  1L3L A;  2JJ1 A;  3A0B C;  3HKZ A;  4P5O A;  3AKZ A;  1EZG A;  2X48 A;  3J80 Z;  3B73 A;  1ZRD A;  2J7K A;  2KJC A;  3HAG A;  5CJ9 A;  2BM6 A;  3NWT A;  3F8C A;  1IXS B;  5IP6 A;  1HOM A;  1T5E A;  3OEE A;  5FA6 A;  4EH1 A;  2I8D A;  1WXR A;  2EB7 A;  3L2Q A;  2FSW A;  3GXO A;  4PDK A;  1I6X A;  4CZC A;  4UUS A;  1B9N A;  1R4N B;  4XD7 A;  4RMN A;  4RS8 A;  3WY9 A;  2DDB A;  4YIF A;  1W4M A;  4J00 A;  4LLL A;  1LFP A;  5FIU A;  2W85 A;  1YO5 C;  1DAR A;  4BUP A;  1YG2 A;  3ABT A;  4MHG A;  4AF7 A;  3ML6 A;  3S8P A;  3U6B A;  5CKT A;  3TOB A;  3HTS B;  3A3G A;  2B0R A;  3E3V A;  3G1L A;  4II2 A;  2VL8 A;  2LFB A;  4ENK A;  4JBA A;  1JJ6 C;  2R4G A;  1X4P A;  3S93 A;  2QZA A;  1GVJ A;  2NST A;  1BR4 A;  1S7A A;  1VF9 A;  2EQR A;  4QVJ A;  1OYY A;  3LAJ A;  3MQ0 A;  2L4A A;  2DT7 B;  2DBB A;  4UB8 C;  4UXN A;  2MC4 A;  1VND A;  4Q4Z F;  2GOX B;  2EIK H;  4WXD A;  3BY6 A;  4A3I J;  3S1R J;  1YHQ I;  3DBH B;  1HG8 A;  2HWV A;  2YSR A;  1J9I A;  2BE5 F;  3JQP A;  5CVJ A;  1IXC A;  1NHA A;  5E3M A;  2CV2 A;  2QBY A;  1VQK B;  2A5W A;  3AL0 B;  3WBK A;  1PVE A;  1RET A;  1GT0 C;  3RPU A;  4BJT A;  2EV6 A;  3H94 A;  2L2O A;  2OF7 A;  2CRG A;  3E6D A;  3SZG A;  5BS6 A;  3A01 A;  1GUU A;  2ELJ A;  1TW3 A;  1ZRC A;  3FMQ A;  2L5Q A;  3CCV B;  2RNG A;  5TIS C;  1V5V A;  1AKH A;  3DLL F;  3BZC A;  2OTJ B;  3ASS A;  2LRE A;  4IOC F;  4TN1 A;  2F5E A;  4RB2 C;  1SVL A;  1YX5 A;  5JHU A;  3CMM A;  1R36 A;  2CQN A;  4ZYE A;  5FJ8 J;  2CFX A;  3GTQ J;  1SMY F;  2CW5 A;  1KK3 A;  1G7R A;  2GK6 A;  1MBJ A;  5IOZ A;  1FIP A;  1JT6 A;  2FBI A;  4MQV A;  4BEH A;  1ZRE A;  3FKI J;  3OR2 C;  3G2B A;  1VHE A;  3P9I A;  4E70 A;  1VQ7 I;  4WQM A;  4LJZ F;  4MEY F;  2C2W A;  2XNC A;  2BSA A;  4IRH A;  4IHT A;  2BHY A;  2XZL A;  3QU6 A;  4GYG A;  4N4O B;  5FLX K;  2Y2Z A;  4C30 A;  4JX5 A;  1LFB A;  1E3H A;  4M9S A;  3I56 I;  4U7D A;  3N6Z A;  3BRO A;  1T38 A;  4GXO A;  3WWG A;  2VPR A;  4OOI A;  4UUS B;  1RUN A;  1J75 A;  4Y52 J;  1Y0R A;  5ILU A;  2VBE A;  3K4J A;  2RDP A;  3VYR B;  3KP7 A;  3BJ6 A;  2Y0M A;  2IGN A;  3KP6 A;  2VJ5 A;  3ASO H;  3H9Q A;  2LF8 A;  1T95 A;  4Z4T A;  1YRN A;  1G7T A;  3QAH A;  2HOA A;  4HLX A;  5J8C A;  1UD6 A;  1RNL A;  1H8E A;  2DOF A;  3K10 A;  3G71 I;  1K4S A;  4DQ2 A;  4A2U A;  3VEP A;  1XGN A;  1E0E A;  3DPT A;  4M3B A;  4I6Z A;  4E7I A;  3ZN0 A;  3PFI A;  4RGR A;  3V8K A;  1EP3 B;  2EV0 A;  5DCM A;  1U2R A;  4B48 A;  2KRF A;  1RKT A;  3K1N A;  2LYC A;  3HRU A;  1Y6I A;  2DQR A;  1W5C C;  3FXM A;  4YFN F;  3GTL J;  4Y7C A;  3KZI C;  2CS3 A;  3ISX A;  1QGZ A;  3AG2 H;  1ETV A;  1KU2 A;  1I27 A;  3NAR A;  3RQI A;  3A01 B;  2UV1 A;  3EDP A;  3GFJ A;  5FKK A;  1DPR A;  2X3H A;  1RES A;  2EIL H;  2HKX A;  4X7F A;  1AKH B;  2A69 F;  2EK5 A;  2KHM A;  2K9Q A;  2GPJ A;  2NVQ J;  2CBX A;  4N9H A;  1PLU A;  5H2F C;  1BI2 A;  4Q48 A;  3L2C A;  1Q7Y D;  4FX4 A;  4Z4U A;  4A3J J;  1DGR M;  3CMY A;  2IS2 A;  2BGJ A;  4BKX A;  4CCL A;  1RZ4 A;  4DIQ A;  1AA7 A;  4BEH B;  1HZE A;  1TYV A;  1BBY A;  2XDV A;  2FUG 2;  1SEU A;  3TMO A;  2F1M A;  3OY9 A;  4BE2 A;  3S14 J;  2O0V A;  1MW7 A;  4P96 A;  3TL4 X;  5D8K B;  3M7G A;  1AIP A;  3OYH A;  1O57 A;  4LBY A;  5B6I A;  2CWE A;  3EQN A;  4YEJ A;  4R8H A;  2BZT A;  1BC8 C;  3H36 A;  4BBS J;  2ZXJ A;  3HOY J;  3QYE A;  5DEQ A;  3TP0 A;  3E0J B;  1HQC A;  1P4W A;  2CUJ A;  2L54 A;  3QPS A;  1KK2 A;  4IO9 F;  4OJ6 A;  2CGP A;  1W34 A;  3IAM 2;  3G4S I;  3ZP5 A;  3SLD A;  2E2J J;  2LKP A;  3VSV A;  3MZY A;  3F6V A;  5KAI C;  3HSR A;  1SD4 A;  3O3K A;  1D1B A;  3F3X A;  3AG1 H;  2GBY A;  4XQF A;  4Y9U A;  4Z4Y A;  5J4Y A;  1XC5 A;  1YRN B;  2RVC A;  4PFO A;  2MD5 A;  1Y0Y A;  3OJW A;  5K5Q A;  4M72 A;  3VNV A;  2X51 A;  5BQT A;  4G7H F;  3HUG A;  3AST A;  1U0J A;  3CRZ A;  2W7Z A;  4Z03 A;  3K9T A;  1YIT B;  3LSP A;  2R7T A;  3WU0 A;  1BMF A;  3ZZU A;  2WV1 A;  3QFS A;  3SDG A;  1HC8 A;  4L0Y B;  1OHH A;  2C6Y A;  3K4B A;  5IYR A;  3PSF A;  3QFT A;  2V1X A;  1OPC A;  4II3 A;  3I55 I;  3PUN A;  4A3E J;  1FDR A;  2L0K A;  3HOW J;  5CVR A;  3R0J A;  3DCF A;  1EP2 B;  3W2H A;  2M3A A;  2CV1 A;  2DYR H;  2HOE A;  4L5J A;  3OYI A;  2X1D A;  2DOA A;  2C4U A;  3QE2 A;  2XT4 A;  4NK8 A;  3VFZ A;  3S2W A;  1W36 C;  3OE7 A;  1VQM I;  3HGG A;  4J19 A;  1CNE A;  1N0V C;  3KL9 A;  4LC0 A;  4Z1M A;  2Q1Z B;  4AU7 A;  3CCE B;  1OB0 A;  1H42 A;  1QFY A;  1SM4 A;  1VBL A;  1E3Z A;  3CDL A;  3RKY A;  1TYW A;  4BHP A;  5KAF C;  4Z4R A;  3RPU D;  2LY9 A;  4P6V F;  3B90 A;  2JVG A;  5DYM A;  4HE6 A;  2H1K A;  2BM1 A;  1QJV A;  2DI3 A;  2BOL A;  3M1C A;  2VBX A;  2X0K A;  4GFB A;  2BVL A;  2RRE A;  2IJL A;  5B1B H;  4DYR A;  4YG2 F;  3PNV A;  3VWB A;  1B1B A;  4AUX A;  2VQG A;  5KNL A;  2VKV A;  3COA C;  4UVA A;  1DP3 A;  1FNM A;  1O3R A;  3K6G A;  2JA2 A;  3OW2 B;  3VR6 A;  4KJZ A;  2MYS A;  2IRF G;  1EFU A;  5HLG A;  2K9L A;  3I5U A;  3PJR A;  3WGG A;  4JP0 A;  4U0V A;  4UZF A;  5KW9 A;  1R1U A;  3CCS B;  1X19 A;  3ZZT A;  3LST A;  1NRK A;  5A8A A;  4IHY A;  1XMX A;  2O0W A;  3Q3S A;  2J5P A;  3Q0V A;  1STZ A;  1IUF A;  1VQL B;  2WZN A;  3Q6R A;  2J5O A;  2E7W A;  3E5X A;  3TH0 A;  2OA4 A;  2FOK A;  1OR7 C;  4NC8 A;  4PC6 A;  3WTV C;  1P2F A;  5BMZ A;  2XTY A;  3P4G A;  1WPC A;  4G1B A;  4W1U A;  2X1C A;  5J47 A;  2L4M A;  3KP2 A;  1KCD A;  1SAN A;  2E5Z A;  3A03 A;  3IRQ A;  2KMU A;  2PBI A;  4MEX F;  5M5Y J;  1QVU A;  1T08 B;  1VQ8 I;  2XF6 A;  3K4N A;  5HOO A;  5HDK A;  2P6T A;  3EYI A;  4G7O F;  3ZQF A;  2M1B A;  3V42 A;  1QFJ A;  3MMP A;  4GO1 A;  2EWE A;  3W2E A;  2OAZ A;  3MKZ A;  1G7S A;  2NOG A;  3IWZ A;  3CTA A;  1Q1V A;  2EJR A;  1YX2 A;  1NG6 A;  2KLO A;  1NH3 A;  3ZMU A;  1J59 A;  1JXS A;  4AID A;  4HV6 A;  4RDU A;  1IDY A;  3SZP A;  4EGZ A;  5HNF A;  1H88 C;  2VQC A;  2FE3 A;  4QTR A;  3PA2 A;  2KVO A;  2R7F A;  2OBS A;  3ASN H;  4G12 A;  3BY1 A;  2JA6 J;  2X1E A;  4H4K C;  3PIP F;  4FE4 A;  1YTY A;  4CYC B;  3VMV A;  4LIU A;  2VT2 A;  1FC3 A;  5B66 C;  1ZG3 A;  1EH6 A;  4G1V A;  2FU4 A;  3SYT A;  3T56 B;  2P81 A;  3P5J A;  4ACB A;  4W8Q A;  1I39 A;  2BY3 A;  2PLF A;  1ZTR A;  2V7V A;  3ZR8 X;  4ZH4 F;  3PM1 A;  4KIF A;  2V1N A;  1HLV A;  4OJL A;  3CES A;  2P8T A;  2QQ9 A;  4XRS G;  4HLY A;  3ZMZ A;  3CXC B;  1PE9 A;  1O8M A;  2XGX A;  4X0G A;  1FJL A;  4XKC A;  3GTO J;  1Y0U A;  5D6F A;  1KMH A;  3GQ9 A;  1OYW A;  2KZG A;  1V0F A;  4NCN A;  1FNN A;  4F91 B;  3ERE D;  1VTN C;  1MDM A;  1QA2 A;  3L7W A;  4OAY A;  4BS9 A;  4XSZ F;  4A5N A;  3TW6 A;  5FFX A;  3BY2 A;  1IN4 A;  1FOW A;  5DD8 A;  4OIQ F;  1IUY A;  4FWT A;  1BX1 A;  3T8T A;  2CF4 A;  3NAU A;  5GTI C;  5FKM A;  4XRM A;  1Y1W J;  1LB2 A;  4IVN A;  1GVH A;  1H8H A;  1IN5 A;  1VQ5 I;  3EPZ A;  5FRM A;  3FXU A;  1WSR A;  2ZIT A;  3T8R A;  1LDJ A;  3K1M A;  3I4P A;  3OZV A;  2PI0 A;  3QP6 A;  2GIV A;  1J2X A;  3RSN A;  5CQG A;  2BW3 A;  1D8J A;  4RD2 A;  1GHC A;  2EA2 A;  3BCF A;  2ZO4 A;  4RD4 A;  1X1C A;  2WYR A;  3L00 A;  5LLQ A;  4XN3 A;  1QQI A;  2WAQ N;  5ED4 A;  2Z8G A;  5EGO B;  1ETW A;  3TBI A;  1Z9C A;  4IJA A;  2HPM A;  5GTH C;  3VST A;  2XSD C;  3IL2 A;  4YAF A;  2KT0 A;  1WJE A;  1ZG5 A;  2NV4 A;  3A8I A;  4YXW A;  3VNU A;  1IB4 A;  1TLL A;  4N3G A;  2MC3 A;  5ICE A;  4A12 A;  1B6A A;  5F0F A;  4W97 A;  4O6J A;  2F5F A;  2GJP A;  4JX4 A;  3L2U A;  1JGG A;  1H9G A;  1WWX A;  3LSJ A;  4DW6 A;  2V7W A;  3OW7 A;  2QX3 A;  4M2L A;  1MZB A;  2DO7 A;  4BY1 J;  3NB2 A;  2BY0 A;  2ID3 A;  3V8L A;  3GFM A;  2DA6 A;  1VQN B;  3OKX A;  1W0K A;  1W9X A;  2MG4 A;  3SEJ A;  3LYC A;  2KIU A;  3ZMV A;  2HOS A;  5EJC A;  2IEK A;  1X1A A;  2PE3 A;  1ELO A;  3BPV A;  1NTC A;  4LMY A;  4UV8 A;  2B0L A;  2V4J C;  1DU0 A;  2RQP A;  1HDD C;  4M0L A;  2YWF A;  1O8H A;  1KGS A;  1M1K D;  3HB9 A;  1MGT A;  3M9A A;  2EIJ H;  1T0F C;  3AK5 A;  4AVZ A;  1VQP I;  1XG2 A;  1BJK A;  2L01 A;  1YJN B;  3B82 A;  1ORK A;  2BSP A;  2VE8 A;  1JGS A;  2BY1 A;  1K9M D;  2F6C A;  4C3H J;  3S32 A;  1XTA A;  1MDM B;  1S8N A;  3CC2 B;  2R7Q A;  3T51 B;  3QQA A;  1ZGA A;  2F4I A;  2VBW A;  1LLZ A;  1WPK A;  4P1W A;  2RC4 A;  3OYN A;  1BW5 A;  3AVT A;  3IRR A;  5B5E C;  2X8K A;  5J40 A;  1ERD A;  1IZ1 A;  3LFK A;  4CSW A;  4RD1 A;  4WWV A;  3NWS A;  3JTH A;  2DDA A;  2O1D A;  1SVM A;  4XLH A;  5IYC J;  3E20 A;  4AC0 A;  1LVK A;  3B8H A;  3CMA B;  3F22 A;  5D5X B;  2M8E A;  4BHB A;  2JSC A;  3H1C A;  2H94 A;  2JSP A;  1EFR A;  2BW3 B;  1I7P A;  4U4B A;  3ABK H;  3TKY A;  2K4B A;  1FOK A;  3OFN A;  1COW A;  4QUZ A;  4PJL A;  5AMV A;  2WY7 Q;  4OP7 A;  3JTG A;  3HOS A;  5IT3 A;  3MZH A;  2F1L A;  1RUO A;  3S16 J;  1G4D A;  1S9H A;  2XAJ A;  3VSL A;  2CQK A;  3AVV A;  2LRD A;  2VFQ A;  3D5R C;  4PAA A;  2GOM A;  1BN5 A;  4XMY A;  2PIA A;  2WAQ A;  3ZC3 A;  1CNF A;  2IS6 A;  1IDZ A;  1QGP A;  3A1Y A;  1UMQ A;  2E1B A;  1XPX A;  4IQ4 A;  3ZQC A;  3FX3 A;  2ZBK A;  3F72 A;  4HQE A;  1MSF C;  2UXX A;  4YZQ A;  2B7E A;  1QO0 D;  5IYN A;  1UEL B;  3L1P A;  1EJ9 A;  1QH0 A;  1X58 A;  2IA2 A;  4G6D A;  2FJ1 A;  3W2A A;  1REP C;  2L9S A;  3ASQ A;  3G6E B;  2Y48 A;  1VQ4 B;  3A8K A;  1QA1 A;  2V6E A;  3ONY A;  3OYB A;  3E6C C;  2DOE A;  2ME6 A;  3BH7 B;  3U21 A;  2QA4 I;  2BXZ A;  2NAZ A;  2Q8K A;  2QCO A;  3C2G A;  4I01 A;  2BEO A;  3JQR A;  2XZP A;  2CV0 A;  2FQ3 A;  2VKH A;  3FIS A;  1OGM X;  1B8I A;  5L3G A;  1RQR A;  2Z3Y A;  4D7M A;  4IEJ A;  3L2R A;  4MGR A;  1T6S A;  3E5U A;  1ZR2 A;  3ZOB A;  4OIP F;  4DZP A;  1EE6 A;  4W8R A;  2IBD A;  2PQ8 A;  1FWZ A;  1U78 A;  3V7C A;  2MLG A;  3IKT A;  1O3Q A;  4ACA A;  3OR1 C;  1WDT A;  3B78 A;  4Z4W A;  4WF2 A;  1C0W A;  2YUH A;  2HGC A;  4IX7 A;  2M0M A;  3ECH A;  4ROX A;  3LA3 A;  4B43 A;  2XF5 A;  3GTJ J;  4Y3O A;  1LDD A;  3N4M A;  2M34 A;  4K2E A;  1I5Z A;  2ZXI A;  4HNU A;  3C2B A;  3QOD A;  4Y4R A;  5L3C A;  1T6Y A;  3CME B;  2R0Q C;  5DS9 A;  3TGN A;  1JUP A;  2H6B A;  2WAD A;  1FTZ A;  3LQR A;  2UZK A;  2Y9Y A;  3G1M A;  1O8F A;  1YS6 A;  2BMW A;  2NNN A;  2JZY A;  4I7H A;  3TOA A;  2PLY A;  3KP5 A;  2YU3 A;  2YX4 A;  4P9F A;  5E17 F;  3HL2 A;  3AFH A;  1MMA A;  1U8R A;  1HBX G;  3BT9 A;  5DSZ A;  3GWZ A;  1N06 A;  3OYF A;  3HKZ N;  2HMA A;  4LG0 A;  2LTP A;  4OOX A;  4LK0 F;  2NVU B;  4RA2 A;  3CC7 B;  4G6Q A;  2STT A;  4F93 B;  3BTI A;  2JA5 J;  2KIS A;  1FMV A;  2XIG A;  2CQ7 A;  1H85 A;  3HXL A;  4E4H A;  5E3O A;  3UW0 A;  5M3F J;  3KP4 A;  2E34 A;  4L9T A;  3JSP A;  1BW6 A;  2E71 A;  1WFX A;  3HHG A;  3BR3 A;  2Z99 A;  2GM4 A;  2NRA C;  4U0Y A;  2NS8 A;  4L9V A;  4KN4 X;  2BHZ A;  1Z3Y A;  1FSE A;  2O04 A;  2QN6 A;  3GTP J;  2COM A;  3LQE A;  1WSU A;  3FZV A;  3A35 A;  1ZM2 A;  4WCG A;  3PSZ A;  2H8W A;  2OPT A;  2EZL A;  1YOV B;  3F21 A;  1UST A;  2E19 A;  2O9L A;  1XCB A;  1MJ9 A;  3CLQ A;  5ICC A;  4WWC A;  4BDY A;  9ANT A;  2QF7 A;  4M3G A;  1P9Q C;  2D74 A;  4ESJ A;  3FMS A;  1R1T A;  4MTD A;  2VT3 A;  3R4K A;  2XAS A;  4XSX F;  5EEH A;  2PJR B;  3FM3 A;  1WCM J;  4X06 A;  1PYV A;  1N05 A;  3CP2 A;  1OCC H;  3A3B A;  1RC9 A;  1F60 A;  2C5H A;  3LSM A;  2EFN A;  4RPD A;  1R49 A;  5E8G A;  1RQP A;  2R92 J;  1EWY A;  3FKJ A;  4YHB A;  1JA0 A;  3K4K A;  5CVI A;  3SUC A;  4BAY A;  2BGC A;  2QTZ A;  4WK8 F;  1QUE A;  3FWE A;  2Z33 A;  4X8I A;  3T9G A;  3RKX A;  4CO8 A;  1FEX A;  1UG2 A;  3K2A A;  2W48 A;  4F7D A;  2Z16 A;  5FLM J;  1G3S A;  3JRD A;  1LQ1 A;  1SFE A;  3K69 A;  2GJK A;  2XAU A;  2E1M C;  2DFE A;  2QEN A;  4HDU A;  3GQ7 A;  4LG0 B;  2BYV E;  3AVY A;  4W8S A;  1PUE E;  2C78 A;  4KT6 A;  4DGW B;  1W5T A;  2EFQ A;  2P4W A;  3QWL A;  1SC7 A;  1UB9 A;  2MLK A;  1QHH D;  2NTQ A;  2XC1 A;  4C2M J;  3FHZ A;  4J01 A;  3VPR A;  2I1L A;  2HPI A;  2ZZF A;  2O7O A;  3LQ6 A;  3KIO A;  1D5Y A;  1H8A C;  3CW2 A;  1QVT A;  1OR7 A;  2ZJP F;  1U5T B;  4A3K J;  1Z6T A;  2Y31 A;  2EPF A;  1NBM A;  3Q38 A;  1D3Y A;  2YWG A;  3ESW B;  4I99 C;  2X3U A;  4RB3 C;  3S2D J;  4P26 A;  2HU9 A;  3PNT A;  1FBS A;  3DWL E;  3J81 K;  3MN2 A;  2C4T A;  2V7X A;  4OOS A;  2CJJ A;  2NT9 A;  4OU0 A;  3KE2 A;  4XLE A;  3T53 B;  4A0Y A;  2YWE A;  2HCJ B;  2A68 F;  2R7S A;  3QPH A;  3H92 A;  3R6S A;  4B4D A;  4B3G A;  3PUM A;  1NJI D;  1UD4 A;  2FBH A;  1D5V A;  1L1I A;  2A3S A;  2XTW A;  1SAU A;  5HZB A;  3D0S A;  3WTU C;  3E6B A;  2O61 A;  2TDX A;  1WJF A;  4LOC A;  4ESF A;  2F5C A;  5H6R A;  2LBF B;  4XNF A;  3PSI A;  4RLF A;  3CF2 A;  1YJ9 B;  3OYM A;  1JHF A;  1M90 D;  1TL8 A;  1SFX A;  1X3U A;  3ECO A;  3WE2 A;  5A88 A;  4IPA A;  4MIM A;  5LRS A;  4OM9 A;  2J8I A;  1Y8Q B;  3T1B A;  4DNC A;  4ZCL A;  3HG9 A;  1BJZ A;  1D0Y A;  2D45 A;  2JRM A;  3BR5 A;  1JKR C;  4I98 B;  4HF2 A;  3OYA A;  2V6C A;  1UAA A;  5EZG A;  4P6Y A;  2ZL5 A;  1MMG A;  1X3Z B;  4UAJ A;  4YRV A;  1OQY A;  1R1V A;  3U2Q A;  3NEU A;  4EM2 A;  3OYJ A;  4RCZ A;  3EUH A;  4N0B A;  1NDH A;  2OQR A;  3A1P A;  4DZJ A;  3QP5 A;  2M5W A;  3FBI B;  3SLN A;  2DER A;  4M3F A;  1RIO H;  3HRT A;  2QEX B;  2PYG A;  1FMW A;  3K7A J;  5BSY A;  1YE9 A;  2ZXH A;  2X85 A;  3ZSC A;  1HKQ A;  1XG1 A;  3BQY A;  3RCO A;  1P7J A;  4A6E A;  4E6K G;  1PUF A;  2WZP P;  3M8F A;  1E3P A;  3PO2 J;  2DMU A;  2NOJ B;  1ZM4 A;  3GSI A;  4TSF A;  2XNJ A;  5FL7 A;  3L9F A;  3RIR A;  2R5Y A;  1S7O A;  4PZJ A;  4HST A;  2XHK A;  2DLL A;  3I64 A;  2QVO A;  4JQF A;  4PC7 A;  4DNR B;  1X1P A;  3GZ6 A;  1PP8 F;  2P7V B;  3ZMD A;  4B8X A;  3GW2 A;  4EM0 B;  4YIR X;  5IYW A;  1IN8 A;  2ZFU A;  1TWC J;  4ON0 A;  1R5O A;  1YS7 A;  2QDX A;  3PNY A;  1W7P A;  4F55 A;  1VQK I;  4EMS A;  2ZCW A;  2HYF A;  1BN8 A;  2CU7 A;  4YC5 A;  1XSX A;  4YII A;  1QGA A;  4DK0 A;  5BNG A;  4A0X A;  1DDI A;  3ASR A;  2HVS A;  1YW8 A;  2L7F P;  2HXO A;  3W6J B;  4A3L J;  2B5O A;  3GZN B;  2QEX I;  3CCV I;  3WNC A;  1XE1 A;  4Y33 A;  2V9P A;  4N4N B;  4PC3 A;  5LHG A;  2OTJ I;  2DMT A;  5JR3 A;  2M87 A;  4M74 A;  3OZU A;  2WAE A;  5TRD A;  4RAZ A;  4BGD A;  3R60 A;  1O4X A;  4M4S A;  4XN0 A;  2LD5 A;  2JPC A;  2B63 J;  5J3O A;  3J7A Y;  2L7Z A;  3C7J A;  4AIJ A;  2XGJ A;  1MJB A;  1YFH A;  1O8D A;  2K4J A;  1N77 A;  1QRB A;  4BXX J;  2HZT A;  1KQ8 A;  2EBI A;  2XKO A;  2B9S A;  2EWN A;  2R7O A;  3DF8 A;  3BNW A;  3ZUG A;  2ZNY A;  3ES9 A;  3LO8 A;  3E1Y E;  2ECC A;  4CXF A;  2R5Z B;  1R5H A;  1QBJ A;  1WOS A;  4PGO A;  3PO3 J;  2K9N A;  3CCJ B;  3LOC A;  4GCV A;  4XM3 A;  4EGY A;  4OMZ A;  2D2W A;  1ZK8 A;  4I76 A;  2DYS H;  2HVR A;  1T0F A;  1R5B A;  2FD5 A;  1X3W B;  4L5E A;  1DG1 G;  2HQ5 A;  2IA1 A;  3S3O A;  3VMW A;  1VQO B;  2NPF A;  4EJT A;  2IGO A;  4XLA A;  1MMD A;  3OPO A;  1W2B B;  4CUG A;  3CB4 A;  1WJB A;  1PUF B;  5JVT A;  2FNP A;  3WG9 A;  2M30 A;  3MCA A;  1XN7 A;  4BL0 B;  2FA5 A;  2IA0 A;  4PGH A;  4U88 A;  4F3Q A;  2R5Y B;  2H8R A;  3LJY A;  3CCY A;  4FIS A;  2CUZ A;  1RU4 A;  4Q7J B;  3CJR B;  5LHH A;  3WTY C;  2OTL B;  2QXZ A;  1WTH D;  3KX2 A;  2RGV A;  1EA3 A;  5K1Y A;  1WOO A;  1W7P B;  1AOY A;  2M4K A;  1ACI A;  3GME A;  4HSR A;  1R58 A;  1U2W A;  1V5E A;  2DK8 A;  2QGU A;  3SFZ A;  1FNB A;  1GAW A;  2WB1 N;  1DGW Y;  4PJJ A;  3KPH A;  3AGP A;  4P1V A;  1S3J A;  4FQG A;  3JAM K;  4EW9 A;  2CSO A;  3S3N A;  1W0J A;  4BXF A;  3V7R A;  2WV0 A;  4G6T B;  1I50 J;  1P7I A;  1JB9 A;  1KK1 A;  5KSW B;  1D1N A;  2PN6 A;  3E7L A;  2W24 A;  1DBG A;  2CG4 A;  2DA3 A;  3BR1 A;  1U5T C;  1K73 D;  4RD3 A;  2IT0 A;  2VQH A;  4CCO A;  1X1B A;  2MSY A;  4PK4 A;  3TO7 A;  3VYT B;  2CW0 F;  3DP7 A;  1WJD A;  3ELK A;  4EM1 A;  2GQQ A;  2RN7 A;  4E7L A;  4QVA A;  2A5Y B;  3TO9 A;  2PMZ A;  3BZ6 A;  1QUF A;  3QOP A;  1A6I A;  4GRI A;  5HLT A;  4TKO B;  3W2F A;  3ZPL A;  2PMU A;  2ZJ2 A;  2BXY A;  1WOR A;  2P7C B;  2IOU G;  4LK1 F;  5EG0 B;  4KFC A;  2XAF A;  1HKT A;  2ZSH B;  1HA3 A;  2ZBV A;  4G5G A;  5IYP A;  4JYK A;  2MFZ A;  4M71 A;  1IJW C;  4K1X A;  2YX7 A;  4EJO A;  1V4R A;  5FRN A;  2F4M B;  4M53 A;  1I18 A;  4C3I J;  1IRX A;  2OCC H;  2JIZ A;  2VZL A;  1TTT A;  1EA0 A;  5FKO A;  1Z21 A;  3GCM A;  1IO2 A;  2HTS A;  4RD0 A;  3BTJ A;  3W2G A;  2DJI A;  2GLO A;  1TWG J;  1ETO A;  3H9G A;  5FO1 A;  1G6N A;  5DM6 F;  3HJE A;  3QPL A;  4CYC A;  3G05 A;  1XMK A;  2ZZE A;  4IKF A;  1MRZ A;  4KIS A;  3DV8 A;  2IS1 A;  2XF7 A;  5J35 A;  2DA4 A;  1UZC A;  1I8D A;  1BI3 A;  2GAU A;  3CCQ B;  1A04 A;  2NZM A;  3F9K A;  4XLC A;  1LJ9 A;  2VJJ A;  2LKS A;  4C3J J;  2Y9Z A;  3KRG A;  1J5Y A;  2NTP A;  4RPB A;  1Z3X A;  3H5R A;  1ZM3 A;  4LGW A;  3KP3 A;  3CO6 C;  3O6B B;  3WTZ A;  3BLY A;  2HEO A;  4YAO A;  1YIT I;  4CQJ A;  3WTW C;  1I3A A;  5JLX A;  4B44 A;  3HOX J;  2XV4 S;  2KL4 A;  3TP3 A;  3R0A A;  1BIB A;  4B47 A;  1G59 A;  3GVJ A;  1GO2 A;  3DTK A;  1IV6 A;  3P27 A;  3SEQ A;  2H27 A;  4LBW A;  3T0Y A;  3WTX C;  1ETX A;  2NVY J;  2DET A;  4PJ0 C;  5GV8 A;  1D1C A;  2KIQ A;  4HEA 2;  4CYD A;  1W0T A;  5DS0 A;  1XFO A;  3CUO A;  3GBG A;  4IOA F;  3CCE I;  3CF5 F;  5IT9 K;  4A93 J;  5HS7 A;  2AXL A;  2GA1 A;  3VDX A;  3QYF A;  5D4R A;  5A2Q Z;  3VB2 A;  4IL6 C;  1K4T A;  1OOC A;  4LD5 A;  4Q47 A;  4YFK F;  3JR9 A;  3WXM A;  2WB1 A;  4F92 B;  2GJR A;  2BV6 A;  3JCU C;  4A3G J;  2RC5 A;  1PP7 U;  2HFH A;  1TW2 A;  2MW8 A;  4XOT A;  2YWH A;  3JRF A;  3B4N A;  1O7F A;  3FK6 A;  4N9I A;  3RIQ A;  3AAF A;  2DPD A;  2R7U A;  2M9H A;  2B7C A;  4NK6 A;  3OP1 A;  4Y7N J;  3GFL A;  4E7Z A;  1QZZ A;  5EGO A;  1DAB A;  1KON A;  4AD9 A;  1KA8 A;  3V7A A;  3OYC A;  3HDD A;  1WVR A;  3IH3 A;  4DJA A;  3CCS I;  5BPD A;  3CCU B;  2RQQ A;  2DCE A;  4D9J A;  1UHW A;  3JX8 A;  4MQ9 F;  4X7C A;  3I3L A;  3CCM B;  2K7L A;  5M5X J;  5L3F A;  3LMM A;  4EQQ A;  3W2I A;  1FIA A;  1VQL I;  2HR3 A;  1ZAR A;  3MZ8 A;  4KIG A;  2DU9 A;  1K8A D;  4BH9 A;  3GIR A;  1YJW B;  1N8R D;  3KZZ A;  4DYQ A;  1CGP A;  1EH8 A;  1OGO X;  1IW7 F;  1FYM A;  1RWR A;  1Z05 A;  3JRA A;  1MIJ A;  3ZQ7 A;  4A0Z A;  5CYV A;  3U1D A;  2AS5 F;  1OGI A;  2JJ7 A;  5HOD A;  1OCT C;  4RGU A;  2LKX A;  5IK2 A;  2HQA A;  3WU1 B;  1QRC A;  1Q82 D;  5L3D A;  2RNJ A;  1HSJ A;  3CCL B;  4OJO A;  3SYJ A;  4I0A A;  2CYY A;  2WBM A;  1KQ5 A;  2VNJ A;  3J80 K;  1N0U A;  1T56 A;  3OEH A;  5EMN A;  4Z4V A;  1TBX A;  4FX0 A;  5H20 A;  1OCP A;  1TLH B;  1TVC A;  4A3C J;  1DBO A;  4O5V A;  2ZSI B;  1HXD A;  4GDF A;  1VI0 A;  5IP9 J;  3PQJ A;  3R6J A;  1ON1 A;  1IJE A;  2WJY A;  4L8J A;  3I4N J;  4G7Z F;  2VOD A;  3F8B A;  4X0C A;  2JN6 A;  2V4D A;  1KU7 A;  3TDZ C;  2X6Y A;  1K6O A;  3ZN1 A;  5TGT A;  1IV8 A;  4BNC A;  3OOP A;  4Y13 A;  3RPQ A;  2R7Z J;  3CUQ C;  5HKK A;  1MD0 A;  2X6X A;  5LHI A;  2ZNZ A;  1ZQ3 P;  1H80 A;  3F8M A;  3GQA A;  3QYB A;  3MVP A;  2OV7 A;  1WI9 A;  3E1S A;  3MAJ A;  1OCZ H;  4ZDO A;  1KJZ A;  1IB0 A;  2XAQ A;  5HS8 A;  1BI1 A;  4HAM A;  4PCQ A;  1E43 A;  3WBJ A;  2QUF A;  4BPR A;  2VFO A;  1MH4 A;  2L9N A;  4RGS A;  4S04 A;  4P25 A;  3FXR A;  5LFA A;  3OSF A;  3IWF A;  2VPL A;  4BQN A;  1FSH A;  4P3I A;  5HDG A;  3MMY B;  1G3T A;  1S29 A;  1YI2 B;  4CCN A;  2QTL A;  4R79 A;  1FND A;  4L5I A;  5GAE J;  4QWQ A;  3SEZ A;  2D9R A;  1D0X A;  4IQJ A;  1JKP C;  2BM0 A;  2ZXW H;  1PJ5 A;  2MA3 A;  3CJN A;  3MFK A;  4Y17 A;  3BH6 B;  5DM7 F;  1FT9 A;  4FTH A;  5LMZ A;  2VJ4 A;  5K7H A;  4RCY A;  1G2H A;  1NG7 A;  2IVM A;  1QVF B;  4PSW A;  1F43 A;  2F2E A;  5LEK A;  3GFI A;  2G0Y A;  3FXK A;  5H6Q A;  3ZBT A;  2DMP A;  2NYX A;  1OFL A;  2OQG A;  4E7H A;  1Z0X A;  1XMA A;  3FF5 A;  4YZ0 A;  2VBT A;  3K4L A;  5B3S H;  3K2Z A;  3I71 A;  3PUF A;  3CJT B;  4FXU A;  1MBH A;  2W82 A;  1KCC A;  1XGS A;  1OFC X;  1TYX A;  2RC6 A;  5F27 A;  4Z4S A;  5FKL A;  2YPR A;  4CA0 A;  4G7W A;  3B6A A;  2ECB A;  5KCM A;  3M07 A;  1XCV A;  3RKQ A;  5J8F A;  3P26 A;  1XX5 A;  2W00 A;  5FRO A;  1LKX A;  3HOV J;  3SZT A;  2XZO A;  3SDB A;  4AWX B;  4BYY A;  3ZQI A;  3ZQH A;  2L7M P;  4Z2Y A;  4HNV A;  2Q0O A;  3H0G J;  1LFU P;  4IHW A;  2VNH A;  2WPD A;  1BL0 A;  2NVX J;  4YEI A;  5JFR A;  2D1V A;  2QYO A;  4ABZ A;  1SD6 A;  1WHU A;  2JUG A;  1A8P A;  3OYL A;  1HW2 A;  1OGJ A;  4CH7 A;  1JUS A;  4EV0 A;  3ZGK A;  4QIW N;  3BG7 A;  2G7U A;  2HOT A;  3GTM J;  2F5D A;  1LUJ B;  3SJZ A;  4NQW B;  1U9O A;  1VQN I;  2LLK A;  4V2G A;  1D8T A;  3OWT A;  3H35 A;  4IHX A;  2E35 A;  5J1U A;  1DUX C;  3H3V K;  1BLI A;  2MGQ A;  4QPO A;  2LVS A;  2HDN B;  2ISY A;  2F4N A;  5AN9 A;  2F43 A;  1QPI A;  4L18 B;  4XLF A;  4ESB A;  3F6O A;  1EV7 A;  2Z1D A;  1OCR H;  5DV5 A;  2DY1 A;  3D26 A;  1YJN I;  1POG A;  3OAA A;  4LFU A;  1O8J A;  1E1Q A;  4X7D A;  2HXI A;  2QM3 A;  2NS7 A;  2LSO A;  5F0H A;  5ICF A;  3CC2 I;  3V76 A;  1KYW A;  3QPT A;  2E1M B;  2X9D A;  5FLX Z;  1G8X A;  4PGG A;  3I54 A;  1TTY A;  1R71 A;  5C1E A;  3MKL A;  1ZG1 A;  4O3M A;  3JQQ A;  4ZTF A;  2XPU A;  1DP7 P;  4FN5 A;  2VOP A;  5TY0 A;  3BG5 A;  3CMA I;  2OK7 A;  3IH2 A;  3NRV A;  2KIM A;  2Z6B D;  4U49 A;  1HST A;  5IYB J;  2PFB A;  2KZV A;  2JPB A;  1G7C A;  1WP6 A;  4OZZ A;  1YIJ B;  1TYU A;  2NVT J;  4YEL A;  3BG9 A;  3ZMS A;  2DJN A;  3WE3 A;  3RTR A;  5ILV A;  2DMN A;  5C44 J;  2CW7 A;  3DEW A;  3H9N A;  3H3Z A;  5J6X A;  1B9M A;  4UHT A;  4CCK A;  1WOP A;  3TQN A;  3OS0 A;  2K40 A;  1KQS B;  3P7N A;  1R9T J;  2KP6 A;  4DK1 A;  3ASP A;  4ZGN B;  3D5L A;  3V7S A;  5FO0 A;  4Z05 A;  3K0L A;  2GWR A;  2EIX A;  2AHQ A;  2WA0 A;  1VLY A;  1KC8 D;  1LVA A;  3KFW X;  4HG2 A;  3J7A O;  3BWG A;  4ANJ A;  2X4H A;  3U9G A;  1YX3 A;  2FNA A;  4WX9 A;  3T5X A;  2P5V A;  4NHJ A;  3UR3 C;  2R6H A;  3ML3 A;  5E1Z B;  3GVL A;  3AG3 H;  1OB2 A;  1H89 C;  1OFD A;  4YDT A;  1TP4 A;  4G8X A;  1HF2 A;  1Y0N A;  2K86 A;  5THX A;  2XRN A;  4E7S A;  2M7B A;  5ICG A;  2PEC A;  4A6D A;  5ILS A;  4OPO A;  2BM7 A;  5F08 A;  1P4M A;  2HYG D;  1GJR A;  4ZYH A;  3Q3A A;  3S1Q J;  4QSH A;  4IXA A;  3BCD A;  3WYA A;  1IN6 A;  4C2U A;  2DTZ A;  2HQR A;  2E60 A;  1JNY A;  2V31 A;  4YAL A;  4DNT B;  3VOE A;  4XIC A;  4A69 C;  1T8I A;  1N78 A;  1VQ6 B;  3GRH A;  1VFC A;  3VMF A;  4XKV A;  2UUZ A;  3OYE A;  4E7J A;  1GXP A;  2GQF A;  3FJO A;  4IRG A;  3H0D A;  3H5A A;  3BC9 A;  3LQQ A;  4Z4Z A;  2P0W A;  4I09 A;  5EEA A;  3G6E I;  3OYK A;  1U3E M;  4HPQ A;  2DMQ A;  4QHY A;  4MR0 A;  1VQ4 I;  3H09 A;  3BDD A;  2N8G A;  1IHM A;  1DQU A;  1OMI A;  1T6X A;  5FFZ A;  2RAE A;  4ETS A;  2PJR A;  5HXB A;  2VN2 A;  1O3T A;  5C4J J;  3JSO A;  4CIC A;  3LA7 A;  2ZME C;  4ZTJ A;  4ZC3 A;  5M3M J;  2WAF A;  3CO7 C;  4KIB A;  2BM5 A;  1KU3 A;  1TWA J;  3EUA A;  2BVN A;  3BCA A;  3QOE A;  3RYP A;  2VXD A;  1LLW A;  5M5W J;  1E2X A;  2K3P A;  5KK1 A;  4RAY A;  2EFW A;  2JUC A;  3BQZ A;  3CQZ J;  4HOB A;  5KVR A;  1OFE A;  2Z2S B;  4RB0 A;  4F52 A;  2GXB A;  1E62 A;  2OYN A;  4PFP A;  3FXJ A;  1PKV A;  3JU4 A;  1LM1 A;  1ENH A;  1F36 A;  1V55 H;  3I59 A;  3F8N A;  5BSX A;  1YIO A;  2XAH A;  1Y39 A;  3J7Y J;  2VJI A;  5E20 A;  3H9J A;  2QZ8 A;  3BR6 A;  2A05 A;  5J3L A;  1DU6 A;  1O8I A;  3EYY A;  1R22 A;  2R7D A;  4HNT A;  1RMG A;  2K27 A;  1VQ9 B;  5J1R A;  3JRH A;  4ZDL A;  1UJ8 A;  3U1K A;  2M0C A;  5DUI A;  4S05 A;  2A07 F;  3CLO A;  3W6V A;  4GQN A;  1LDK B;  4FK8 A;  3ZZ0 A;  4BHC A;  1YLF A;  2VC0 A;  2IGM A;  5IOY A;  4HX7 A;  2FRH A;  3RI4 A;  3TED A;  1ETQ A;  4XLN F;  3G73 A;  3HOT A;  3CME I;  2INU A;  1KU9 A;  1U5T A;  5TJJ A;  3S15 J;  1JRG A;  1ZYR F;  4A3B J;  5F4J A;  4JMQ A;  1IRZ A;  5C1C A;  2XAG A;  1NK3 P;  3MHP A;  2V7F A;  5D8L B;  2JJ2 A;  2MD0 A;  2CH0 A;  1K8F A;  1FNC A;  2ZBU A;  2K3F A;  3Q0W A;  1IRG A;  1MBK A;  3GQB A;  5E79 C;  1IDK A;  1ZH5 A;  3ZQL A;  2GXA A;  2VYQ A;  3B8Y A;  1I3Q J;  2DOG A;  5HDN A;  4M73 A;  2ELK A;  2K9M A;  4RJL A;  1SD7 A;  1W0U A;  1RPW A;  3E5Q A;  3W2W A;  4UV9 A;  3FPP A;  4HRI A;  3ERM A;  5F04 A;  4Y9R A;  3LVB A;  4UB6 C;  2QWW A;  1JI8 A;  3WGI A;  3CC7 I;  2LH9 A;  2ZC2 A;  1JJ8 C;  1YW7 A;  4P3Y A;  2VFM A;  2LBF A;  5HLH A;  2W1O A;  1V5G A;  4BQQ A;  1GQ8 A;  2V7Q A;  4BJ6 C;  4UVB A;  2R7R A;  2VIX A;  3K70 C;  2M5S A;  3WU2 C;  1K7A A;  2PYH A;  2HKO A;  1BI0 A;  2Q6I A;  2E1O A;  3HBL A;  3REO A;  1FLI A;  4RM2 A;  3FIW A;  2IXS A;  1M1E B;  2GA2 A;  2Q2E B;  2NSP A;  1I1G A;  2D5V A;  2Z9O A;  3TW7 A;  3CCR B;  3RJP A;  3UKG A;  4RAF A;  4OIO F;  2DFI A;  2FX0 A;  2NS0 A;  1ZLK A;  4NC7 A;  4D0P A;  2HI3 A;  2HLD A;  4OPS A;  1Q1H A;  2EZH A;  5IYQ A;  2X0L A;  2NT6 A;  4A3D J;  4AIH A;  1FPQ A;  5CLS A;  3QRF F;  2DN0 A;  2R93 J;  4IZZ A;  1X2M A;  3VOD A;  4Q5S F;  3VSU A;  1MJA A;  5DUK A;  1K5C A;  3IV5 A;  1QPM A;  1XGM A;  3OYG A;  3M1E A;  3AVU A;  3I59 B;  3DBL B;  1WH5 A;  5GPC A;  1K83 J;  1YW9 A;  2EZI A;  5JLV C;  5JLW A;  4IF4 A;  4TMZ A;  4X1E A;  3CD6 B;  1IA5 A;  4RDL A;  5E8I A;  4RM0 A;  4M6V A;  4XON A;  4B3X A;  2O6G E;  5FD6 A;  2ZZG A;  1S72 B;  3GEZ A;  1Z7L A;  4IHV A;  3M3Y J;  3ONU A;  1ZRF A;  3W5U A;  2LR8 A;  4PMH A;  1JTA A;  3F23 A;  4BJ5 C;  3HOU J;  2VKD A;  2CW8 A;  3LWF A;  4EJW A;  2JDI A;  5J1Y A;  1H9T A;  2OK8 A;  2UWM A;  3WQZ A;  1MH3 A;  1USS A;  1ZAO A;  3EET A;  4UVC A;  4EJU A;  5LD2 C;  1QFZ A;  1BJA A;  4C2T A;  5TV2 A;  3ZCO A;  1R4M B;  3ZBU A;  3MKW B;  3GVA A;  4CCM A;  2P5K A;  2DXI A;  2I10 A;  4XLP F;  1ZN2 A;  1CZF A;  4WZL A;  4KT5 C;  1Z91 A;  3BTL A;  1ULY A;  1OJL A;  3Q5F A;  3PET A;  4M3D A;  1RI7 A;  1ONV A;  2F5V A;  1W1W E;  2ESN A;  2ID6 A;  3RYR A;  2ZZQ A;  1WGX A;  2QY1 A;  6PAX A;  1P6R A;  5CVV A;  2C5B A;  3KEW A;  4TMV A;  4NDL A;  4LB5 A;  1S7E A;  2OC6 A;  3I1F A;  3DKY A;  2VOO A;  1YHQ B;  1W5S A;  2H09 A;  4ASN A;  4KIC A;  3BZK A;  4FT8 A;  3W2V A;  3S17 J;  3IC7 A;  4BE0 A;  2F4O B;  2OBP A;  2UVE A;  2JTV A;  1O8G A;  1Q81 D;  4Z6Y A;  1QQ1 A;  1Z6R A;  1KQ0 A;  5AIP A;  1B2R A;  1FYL A;  1KTV A;  1IRF A;  4XBF A;  5F1R A;  1TUI A;  4AIK A;  2R5Z A;  4MYT A;  2IAI A;  4KUM A;  3EUK L;  3TO6 A;  4ENN A;  2NXN B;  1ZR4 A;  3PQK A;  3JW4 A;  1V3F A;  2GXG A;  5GAD J;  1GDT A;  2DA5 A;  4ZCM A;  1T2K A;  1D8K A;  3O8H A;  2QQB A;  4HBL A;  1BPL A;  3HGY A;  2ZL7 A;  3NE5 B;  2W25 A;  1XGO A;  3CDI A;  5IY5 H;  2DCU A;  1YJ9 I;  3JRC A;  3L09 A;  1S4M A;  1P4X A;  4ZZL A;  1LE8 B;  1A36 A;  3LSK A;  2QYU A;  2DYI A;  2Q6L A;  1VQ7 B;  2COB A;  1A5J A;  3CUQ A;  3DQV C;  5B1A H;  5F1J A;  3GQ8 A;  2JA8 J;  1WKM A;  2VON A;  2FOW A;  4H0E A;  4HF1 A;  3N90 A;  3IAS 2;  3WNB A;  1QZE A;  4A3F J;  2DK5 A;  1Y1V J;  5F0C A;  4DQL A;  3PEN A;  2MH2 A;  1BOB A;  2KRC A;  3FXQ A;  1FYK A;  2X6O A;  5FD5 A;  3I56 B;  3C2H A;  3H5N A;  1MND A;  3HIF A;  2ME0 A;  1EKE A;  2IGK A;  4A5M A;  3FHN A;  2DFH A;  1FOX A;  2OBR A;  4AYB A;  1QG0 A;  4P12 A;  2PMZ N;  1E79 A;  5FNZ A;  1FX7 A;  3KEY A;  4BDZ A;  2DEU A;  4XK4 A;  3D1N I;  4EEF G;  1S5L C;  1P4A A;  3LSG A;  4HF0 A;  1A35 A;  4NUB A;  5F64 A;  4KH3 A;  2M2E A;  4TT3 A;  1E64 A;  1BX0 A;  2VKE A;  2WTE A;  1EFC A;  3G71 B;  4LLG F;  2XPW A;  1PJR A;  1K28 D;  4MFD A;  2XGD A;  2ELH A;  3P9C A;  1Q9S A;  1QVG B;  3FY3 A;  4UNO A;  3DEE A;  3I53 A;  3SY2 A;  3A0H C;  4OIN F;  5DNS A;  2O03 A;  1K6Y A;  3N05 A;  1E3O C;  3BPX A;  3ISP A;  1IDJ A;  1KTW A;  1SFK A;  3NQO A;  5EG0 A;  2INV A;  2VFN A;  2EIM H;  2HTJ A;  5CDF A;  2E7X A;  4ZYD A;  2EH3 A;  1ITY A;  4FHT A;  5DD4 A;  3WG7 H;  2AQE A;  1EH7 A;  2XGE A;  4FAS D;  1W36 D;  2ODL A;  1O3S A;  4KIT B;  1WRJ A;  3WOD F;  5JI6 A;  2GZW A;  2P5L C;  1KD1 D;  2HDW A;  2WSS A;  3IKV A;  2A6H F;  3I58 A;  5LGU A;  1ZM9 A;  4ZV4 A;  1I6H J;  1Y56 A;  5C4X J;  4LIT A;  3GF2 A;  1EF4 A;  2CC2 A;  3JUR A;  3E97 A;  1VJS A;  3DDY A;  2JVH A;  5JHF A;  4OPV A;  2LY1 A;  5DN6 A;  2MH9 A;  2ZL6 A;  4DQK A;  2WWY A;  3I0T A;  3CUQ B;  3IHU A;  5IPA A;  1S0U A;  3AVW A;  5EDN A;  2XGC A;  1OB5 A;  5D4S A;  1XSD A;  1WU8 A;  1RRJ A;  2QBY B;  3HSE A;  3F8F A;  4NBQ A;  3M4O J;  4QFM A;  3SJP A;  4G7X A;  4HYE A;  3OZW A;  4LBV A;  4MYU A;  2V1U A;  1UCR A;  1U9N A;  3CCJ I;  4HWV A;  1PJ6 A;  4MO7 A;  4B09 A;  3HHH A;  3P9K A;  2ICW G;  4ZYG A;  4LLN A;  2JA7 J;  3M8J A;  1QU3 A;  2VFP A;  1TSP A;  4JRA C;  5C3E J;  5KHD A;  1SFU A;  4V02 C;  1E63 A;  3G4S B;  2XEX A;  3U6K A;  3ZRG A;  5FKN A;  4R71 A;  2YUS A;  4ZGQ B;  1VQO I;  1QX4 A;  2R7W A;  1WMR A;  3PUB A;  2QLZ A;  1NHC A;  2QQ8 A;  3DEU A;  3DTI A;  2QMU A;  4AC9 A;  4UUT A;  3LSI A;  5HNH A;  2DIE A;  5A89 A;  4M9X A;  1F1Z A;  3BR0 A;  4U87 A;  1AU7 A;  2V7T A;  2DAO A; 
#chains in the Genus database with same CATH homology
 3OEE A;  3L2R A;  1MAB A;  1T5E A;  2I8D A;  1EE6 A;  3L2Q A;  1E43 A;  4W8R A;  4CZC A;  2L9N A;  4ITV A;  4XD7 A;  4RMN A;  5LFA A;  3OR1 C;  2VPL A;  4BQN A;  2W6J A;  3MMY B;  4J00 A;  1LFP A;  3ZPN A;  4CCN A;  2R7X A;  4R79 A;  4IX7 A;  4BUP A;  3SEZ A;  2M0M A;  3S8P A;  1D0X A;  5CKT A;  4IQJ A;  3A3G A;  2VBM A;  4II2 A;  4URR A;  2VL8 A;  4B43 A;  3DPU A;  2XF5 A;  4Y3O A;  1QHG A;  1UD8 A;  2R4G A;  1X4P A;  3S93 A;  2VJ4 A;  1O88 A;  3BC8 A;  2NST A;  1BR4 A;  1NG7 A;  1VF7 A;  2ZXI A;  4HNU A;  4PSW A;  3QOD A;  4Y4R A;  2DT7 B;  1OFL A;  2MC4 A;  1ZEL A;  4E7H A;  4YZ0 A;  2GOX B;  3K4L A;  1HG8 A;  2WAD A;  1SKY B;  1O8F A;  2IQ7 A;  4FXU A;  2E5N A;  4QPQ A;  2W82 A;  2CV2 A;  1KCC A;  3L2V A;  1OLT A;  2A5W A;  2KQR A;  3AL0 B;  4CA0 A;  2LC2 A;  3AFH A;  1MMA A;  3PL8 A;  5KCM A;  4BJT A;  2L2O A;  3HL2 A;  4PJN A;  3SZG A;  3H94 A;  2ELJ A;  3OYF A;  2K5C A;  2L5Q A;  2W00 A;  2RNG A;  2W4S A;  3HC7 A;  1LKX A;  5FRO A;  2XZO A;  3SDB A;  2LRE A;  4YZA A;  2D3N A;  1YX5 A;  4F93 B;  3CMM A;  3IUO A;  1FMV A;  1X4O A;  2WPD A;  3HXL A;  2O5R A;  4E4H A;  2GK6 A;  3UW0 A;  4BEH A;  3OR2 C;  3G2B A;  4OAZ A;  4OZY A;  2JUG A;  1WFX A;  3OYL A;  2R7V A;  3DTE A;  4CH7 A;  2QKL B;  3HPH A;  3AL0 C;  3ZGK A;  3BG7 A;  5CQE A;  2XZL A;  4NQW B;  1BR1 A;  1Z3Y A;  4N4O B;  2O04 A;  2VBK A;  1X1D A;  3OWT A;  3H35 A;  4C30 A;  3A35 A;  4HIZ A;  1BLI A;  3WWG A;  4QPO A;  4BE1 A;  1O8E A;  1VZ0 A;  2NTB A;  2W6I A;  2F43 A;  4XLF A;  4P22 A;  2VBE A;  2Z1D A;  3K4J A;  3OAA A;  2QE7 A;  3VYR B;  3A4C A;  3GVK A;  4XOR A;  1E1Q A;  1O8J A;  2IGN A;  4BDY A;  1MMN A;  1P9Q C;  1WJ5 A;  2DT6 A;  2L7K A;  2VJ5 A;  3H9Q A;  1E3X A;  1T95 A;  3DU5 A;  3OIQ A;  1UD6 A;  2E1M B;  1H8E A;  1G8X A;  2PJR B;  5C1E A;  2GK7 A;  1PYV A;  3FBN B;  3CP2 A;  3K10 A;  3OIP A;  3A3B A;  3LSM A;  1E0E A;  4ZTF A;  3DPT A;  3FKJ A;  4E7I A;  3DPL C;  3K4K A;  2WJV A;  3SUC A;  2Z6B D;  4B48 A;  4U49 A;  3HUG B;  2KZV A;  1WP6 A;  4OZZ A;  2LYC A;  3T9G A;  4YEL A;  1Y6I A;  2XC7 A;  3RTR A;  1UD2 A;  2CW7 A;  2CS3 A;  4CCK A;  2Z16 A;  3OS0 A;  2VLA A;  2UV1 A;  2VB6 A;  2GJK A;  3BH4 A;  2KP6 A;  2XAU A;  4DK1 A;  2X3H A;  2E1M C;  3GQ7 A;  3D5L A;  4W8S A;  1BR2 A;  1D1A A;  4Z05 A;  2WA0 A;  1VLY A;  2KHM A;  2VAS A;  4KT6 A;  4DGW B;  1UG0 A;  4HG2 A;  2NTQ A;  1QHH D;  4ANJ A;  1YX3 A;  4J01 A;  1PLU A;  2HPI A;  2ZZF A;  3OL3 A;  2CFO A;  3UR3 C;  1DGR M;  2X53 S;  4XKW A;  3GVL A;  2IS2 A;  1GLN A;  4CCL A;  4DIQ A;  1AA7 A;  4BEH B;  1HZE A;  1NBM A;  4E7S A;  2M7B A;  2PEC A;  2XDV A;  2FUG 2;  3EUH C;  2CK3 A;  2HU9 A;  4MLO A;  3PNT A;  3TMO A;  3OY9 A;  4BE2 A;  2F1M A;  1MW7 A;  3TL4 X;  2O0V A;  3DWL E;  3OYH A;  3KYL A;  3BCD A;  4C2U A;  3EQN A;  4YEJ A;  2E60 A;  2NT9 A;  2V31 A;  4DNT B;  4XLE A;  3T53 B;  1N78 A;  3QYE A;  3GRH A;  3E0J B;  2CUJ A;  2R7S A;  2XSJ C;  4XKV A;  2UUZ A;  3OYE A;  4E7J A;  4B3G A;  4OJ6 A;  2BVM A;  3H0D A;  3H5A A;  3BC9 A;  1UD4 A;  2P0W A;  3IAM 2;  3OYK A;  1SAU A;  4HPQ A;  4MR0 A;  1WJF A;  3VSV A;  2LBF B;  3OYD A;  4XNF A;  1DQU A;  3PSI A;  1D1B A;  3CF2 A;  4RLF A;  4XQF A;  3OYM A;  2PJR A;  4PFO A;  2LY2 A;  4ZTJ A;  4ZC3 A;  2WY8 Q;  3HG9 A;  1V5F A;  2WAF A;  1D0Y A;  2X51 A;  3EUA A;  3BCA A;  3OYA A;  4ZDP A;  3QOE A;  1UAA A;  2VXD A;  1U0J A;  1MMG A;  2K3P A;  4Z03 A;  1D0Z A;  4YRV A;  2R7T A;  3CP8 A;  1BMF A;  3OYJ A;  1UD3 A;  2Z2S B;  4F52 A;  1OHH A;  3K4B A;  4U7B A;  3PSF A;  4PFP A;  1PKV A;  4II3 A;  3JU4 A;  3FBI B;  4XR6 A;  4BAC A;  2PYG A;  1FMW A;  2VJI A;  3H9J A;  1O8I A;  1YE9 A;  2M3A A;  2ZXH A;  2CV1 A;  4RM3 A;  4HNT A;  2X85 A;  1RMG A;  3OYI A;  3ZSC A;  2X1D A;  2DOA A;  3RCO A;  4NK8 A;  3OOC A;  4E6K G;  4ZDL A;  3OE7 A;  1W36 C;  4LIV A;  2WZP P;  4Z1M A;  4GQN A;  1LDK B;  2NOJ B;  2Q1Z B;  3UNG C;  4AU7 A;  4EAT A;  1OB0 A;  1VBL A;  4TSF A;  1E3Z A;  3OL4 A;  4ZJZ A;  2IGM A;  5FL7 A;  3OOU A;  2HZD A;  4HST A;  3RPU D;  2INU A;  3HOT A;  4JQF A;  2JVG A;  3VYS B;  3B90 A;  3FDY A;  4E7K A;  4D1Q A;  1JRG A;  4LG3 A;  1QJV A;  4JMQ A;  5C1C A;  2BOL A;  2ZFU A;  3M1C A;  5HVQ C;  2ZTN A;  2M7A A;  2BVL A;  2MAB A;  2V7F A;  3PNY A;  4F55 A;  2MD0 A;  2RRE A;  2CH0 A;  2JJ2 A;  1BN8 A;  3PNV A;  3VWB A;  3GQB A;  3DLA A;  2VQG A;  5KNL A;  4DK0 A;  1BHE A;  1IDK A;  1DP3 A;  3B8Y A;  2HVS A;  3K6G A;  2JA2 A;  3VR6 A;  4KJZ A;  2MYS A;  1WJA A;  2K9L A;  2K9M A;  3DU6 A;  3W2W A;  3PJR A;  3FPP A;  3LSH A;  4HRI A;  4Y33 A;  4N4N B;  4W8T A;  1X19 A;  2WAE A;  1JI8 A;  1NRK A;  2O0W A;  2LH9 A;  4FET A;  4BGD A;  2LBF A;  2W1O A;  1V5G A;  4BQQ A;  1GQ8 A;  4XN0 A;  4YZX A;  1E1R A;  2V7Q A;  4BJ6 C;  2R7R A;  3J7A Y;  3FKS A;  2VIX A;  2XGJ A;  1OR7 C;  3OMY A;  4NC8 A;  3K70 C;  2M5S A;  2R9V A;  1WPC A;  1O8D A;  2PYH A;  2KDO A;  2X1C A;  4OJP A;  1KCD A;  1N75 A;  3MKY B;  4RM2 A;  1N77 A;  2E5Z A;  2IXS A;  2KMU A;  4DBQ A;  2NSP A;  1KZL A;  2Q2E B;  2R7O A;  2XF6 A;  3K4N A;  5HOO A;  4PUS A;  4RLQ A;  3ZPP A;  1MNE A;  3V42 A;  4NC7 A;  4G7W A;  4XKB A;  2HLD A;  2ZTG A;  2EWE A;  2LOO A;  3MKZ A;  2NT6 A;  2VXZ A;  1NG6 A;  4XM3 A;  2KLO A;  4IZZ A;  3VSU A;  1K5C A;  3OYG A;  5HNF A;  2HVR A;  2VQC A;  2UVF A;  3OS2 A;  1V0E A;  2KVO A;  3VMW A;  3S3O A;  2HNH A;  2X1E A;  4H4K C;  2IGO A;  4XLA A;  1MMD A;  3OPO A;  4CUG A;  1WJB A;  1IA5 A;  3VMV A;  4LIU A;  4XON A;  4B3X A;  1AIR A;  2ZZG A;  1Z7L A;  4U87 A;  4BL0 B;  3W3C A;  3SYT A;  4F3Q A;  3T56 B;  4PMH A;  1JTA A;  4W8Q A;  4BJ5 C;  2XOK A;  2CUZ A;  1RU4 A;  4ASU A;  2VKD A;  3CJR B;  2QXZ A;  2CW8 A;  2JDI A;  1WTH D;  2V9K A;  3KX2 A;  3ZR8 X;  2UWM A;  1EA3 A;  3WQZ A;  2V1N A;  2M4K A;  4OJL A;  1R6R A;  3CES A;  4HSR A;  1V5E A;  5LD2 C;  4C2T A;  1DGW Y;  1PE9 A;  3ZCO A;  1O8M A;  4PJJ A;  4EW9 A;  4X0G A;  3MKW B;  4XKC A;  3GQ9 A;  4CCM A;  2DXI A;  1KMH A;  3S3N A;  1V0F A;  1W0J A;  4BXF A;  3K70 D;  1CZF A;  4F91 B;  4G6T B;  4OAY A;  4BS9 A;  1HVX A;  4C2L A;  2ZZQ A;  4G6I A;  2F5V A;  3D5S C;  2W7N A;  1DBG A;  2AQF A;  2QY1 A;  3KEW A;  4PSX A;  3ZQQ A;  4KKS A;  2VQH A;  4CCO A;  1X1B A;  2OC6 A;  4PK4 A;  1H8H A;  3DKY A;  3VYT B;  1UD5 A;  3ONQ A;  1WJD A;  3EPZ A;  5FRM A;  5CPR B;  3BCB A;  3W2V A;  4BE0 A;  4E7L A;  3RSN A;  1OFM A;  2PMZ A;  5CQG A;  2UVE A;  5HLT A;  4GRI A;  4TKO B;  2BW3 A;  1O8G A;  3LL7 A;  1FX0 A;  1QCX A;  3BG6 A;  2KPM A;  3BCF A;  3ZIA A;  1X1C A;  2ZSH B;  4XN3 A;  4OWR B;  4KKT A;  2MFZ A;  4JOM A;  3EUK L;  2Z8G A;  3TBI A;  3VSK A;  3A2K A;  1TZL A;  5FRN A;  1I18 A;  2CMP A;  4DOZ A;  2HPM A;  3VST A;  1IRX A;  2JIZ A;  3NE5 B;  1BPL A;  1Z21 A;  3S3M A;  1WJE A;  4YXW A;  2DJI A;  1IB4 A;  1PXZ A;  2O17 A;  3H9G A;  1HA8 A;  4MXN A;  3G05 A;  2GJP A;  2ZZE A;  3L2U A;  4IKF A;  3CZ6 A;  4KIS A;  2IS1 A;  3IP4 B;  3LSK A;  2XF7 A;  1I8D A;  3OW7 A;  3K4M A;  3DQV C;  2QX3 A;  4I84 A;  4CCJ A;  2NZM A;  3GQ8 A;  3F9K A;  4XLC A;  3KRG A;  2VJJ A;  2X6W A;  4B3F X;  2NTP A;  3LFU A;  3HPG A;  1Z3X A;  3H5R A;  3IAS 2;  1W0K A;  3BLY A;  1W9X A;  1BOB A;  2KRC A;  2XND A;  1X1A A;  4B44 A;  3C2H A;  2KL4 A;  2V4J C;  1MND A;  3H5N A;  4B47 A;  1G59 A;  3GVJ A;  1O8H A;  3DTK A;  2IGK A;  3FHN A;  3SEQ A;  4AYB A;  1T0F C;  4AVZ A;  1XG2 A;  1E79 A;  2BSP A;  1D1C A;  3KEY A;  4BDZ A;  4HEA 2;  1J09 A;  3OS1 A;  3LSG A;  2F6C A;  3S32 A;  2R7Q A;  4NUB A;  3T51 B;  3GBG A;  4DBR A;  2F4I A;  4P1W A;  4TT3 A;  4ZYA A;  3OYN A;  3VDX A;  2VQL A;  3QYF A;  3LNN A;  1K28 D;  1PJR A;  2QKM B;  3PFY A;  2X8K A;  1ERD A;  1OOC A;  3FY3 A;  4CSW A;  1TT0 A;  3DEE A;  3NWS A;  2WB1 A;  4F92 B;  2O1D A;  4XLH A;  2GJR A;  1LVK A;  4UZU A;  1K6Y A;  3N05 A;  1X0C A;  1KTW A;  1IDJ A;  4XOT A;  3B4N A;  3EQO A;  1SFK A;  2JSP A;  2INV A;  4NNJ A;  1EFR A;  2BW3 B;  2R7U A;  4U4B A;  5CDF A;  4NK6 A;  2IS4 A;  4E7Z A;  1KON A;  3OFN A;  3OYC A;  2AQE A;  2HVQ A;  4DJA A;  4FAS D;  1COW A;  4PJL A;  5AMV A;  4PJM A;  2WY7 Q;  2RQQ A;  2DCE A;  4D9J A;  4KIT B;  1W36 D;  2ODL A;  3I3L A;  3MD2 A;  1O8L A;  3HOS A;  2HDW A;  4XOP A;  3LMM A;  4C9Y A;  2WSS A;  4OJ5 A;  2M4G A;  1Y56 A;  4LIT A;  1O8K A;  3JUR A;  3LMW A;  2OUM A;  3ZXS A;  1VJS A;  1S9H A;  3DDY A;  3VSL A;  1OGO X;  2JVH A;  2LRD A;  5JHF A;  1RWR A;  4KKU A;  3D5R C;  2GOM A;  2LY1 A;  5DN6 A;  4XMY A;  4XL9 A;  2WAQ A;  3RQ4 A;  2IS6 A;  3A1Y A;  2E1B A;  5IK2 A;  2HQA A;  4OJO A;  4IQ4 A;  4G7X A;  3L2W A;  4YZQ A;  2WBM A;  1WJC A;  4E0F A;  1UEL B;  3OEH A;  4HWV A;  4BU2 A;  2KRH A;  3CJQ B;  3W2A A;  1DBO A;  3M8J A;  2ZSI B;  1QU3 A;  2A6T A;  2L9S A;  4Z06 A;  5KHD A;  3DKX A;  4L8J A;  2LZJ A;  2WJY A;  2V26 A;  3ZRG A;  2LG4 A;  2V6E A;  2D3L A;  2V4D A;  3OYB A;  2R7W A;  2X6Y A;  1WMR A;  5TGT A;  3PUB A;  3U21 A;  1NHC A;  5HKK A;  4BQO A;  2X6X A;  3DTI A;  3I9V 2;  3VYU B;  4DNR B;  3LSI A;  3C2G A;  2Y0S A;  3K4C A;  1H80 A;  2JJ1 A;  5HNH A;  2DIE A;  2XZP A;  3HKZ A;  3QYB A;  4P5O A;  3AKZ A;  3GQA A;  2CV0 A;  3HAG A;  2VKH A;  2OV7 A;  3E1S A;  1OGM X;  3NWT A;  4ZDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...