4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
2NTPA 1OGOX 4OJPA 4XLHA 1CZFA 4XKWA 1PE9A 2NSTA 2X6XA 2PECA 2O0WA 1IDKA 4Z03A 2BSPA 1RMGA 4I84A 4XN0A 4XONA 3WWGA 4MR0A 2NZMA 4YZQA 1O8HA 2IQ7A 2NTQA 2X6WA 3VMWA 4XL9A 1O8JA 4YZ0A 3GQ7A 1DBOA 4XORA 1O8DA 4XQFA 1K5CA 4XN3A 2X6YA 2NT6A 1DBGA 1RWRA 5C1CA 2Z8GA 1O8LA 3JURA 4XM3A 2UVFA 4W8TA 2O0VA 4Z05A 2INUA 1AIRA 3VSVA 2QXZA 2QX3A 2VJIA 4OJLA 2VBEA 1OFLA 2VBMA 4YZXA 3VSUA 2INVA 1OGMX 3LMWA 3EQNA 1KCDA 1WMRA 5AMVA 1O8IA 1O8GA 1EE6A 1O8EA 1O88A 4EW9A 4XLFA 1PLUA 4MXNA 2EWEA 3FY3A 3SUCA 4U4BA 1BN8A 3T9GA 1VBLA 4Z06A 1OOCA 1H80A 1O8KA 2O17A 1RU4A 1O8MA 2UVEA 4YEJA 2O04A 1PXZA 4NK6A 4YZAA 3GQAA 1O8FA 4XNFA 3B8YA 4W8QA 1QJVA 2NT9A 4OZZA 4XOPA 3B4NA 2X85A 5C1EA 4HWVA 1IB4A 3UW0A 4URRA 4OZYA 1KTWA 4U49A 4XLCA 2VBKA 1HG8A 4XLAA 1NHCA 3KRGA 4OJ5A 2NSPA 4PMHA 1GQ8A 4XMYA 3GQ8A 1JRGA 2O1DA 4C2LA 3GRHA 3VMVA 1IDJA 4W8SA 2PYHA 2ODLA 3GQ9A 3ZPPA 3EQOA 1OFMA 4W8RA 4XOTA 1X0CA 4NK8A 1XG2A 4OJ6A 1IA5A 4OJOA 2NTBA 4XLEA 2PYGA 1KCCA 4YELA 3ZSCA 4AVZA 3B90A 1JTAA 3VSTA 2VJJA 1BHEA 2QY1A 4XR6A 1QCXA 2X3HA 4XKVA
chains in the Genus database with same CATH superfamily
3E97A 4E7KA 4ZYEA 3CF5F 4FCYA 2VNIA 4CUGA 3LNNA 5F27A 3HEFA 4G6DA 1E3PA 4A3GJ 4X1EA 4ZZDA 1V54H 3F9KA 1OGJA 3SLNA 5IYRA 3BQJA 3F8CA 4TT3A 3J7YJ 1VLOA 1BR1A 3CCRB 4DK0A 1BR4A 4PGGA 4EATA 3CCMI 5D6EA 5H59A 3VNUA 5DCMB 2WY8Q 1BC8C 2NTQA 5BS6A 2E36A 3ZCOA 1K8FA 4P55A 5HOOA 1TWAJ 1E2XA 4KIBA 3K10A 3TBIA 1FNNA 5J8FA 3SYJA 2XV4S 4Y3OA 4I09A 3OWTA 1IN5A 3HTUA 4M3EA 2L9NA 5BSYA 4XM3A 1J75A 2A6HF 4Z1MA 2R5YA 2XTWA 4Z2YA 4HRIA 1QH0A 1BBYA 3J7AO 4RAGA 2P81A 5FKNA 1S72I 1DDIA 2QQ8A 3M8EA 2XIGA 3IH3A 1NBMA 5FD5A 3GZNB 1AMOA 4LFUA 3E3VA 3H92A 1JA0A 2VFQA 3DCFA 3Q9VA 1ODDA 3QE2A 2X48A 5IYBJ 5LGNA 2E71A 3A03A 4X0CA 1VFCA 3OMYA 5FFXA 3CLQA 1J7KA 1V0EA 4RD2A 2WC2A 3L2RA 2XAJA 2MYSA 2VZLA 1T2KA 3KP2A 1IN4A 3W2AA 4B1RA 4EM2A 2HLDA 4WQMA 3FIWA 2BGCA 2OA4A 3SQVA 3OYAA 2ZJQF 3K4JA 4X06A 3CCJB 2PJPA 5GAHJ 2BMWA 4AIKA 2DDBA 3G73A 1R71A 1D1CA 4BEHB 2GWRA 3KYLA 3CPWB 4KUMA 1DDNA 2ZKZA 5EJCA 2FE3A 3AKZA 5IT9Z 3QODA 2D3LA 1ZG3A 2LR8A 1OCTC 3B4NA 1MJAA 4R1HA 3WHCA 3Q6QA 4X6AJ 1U9OA 2HOSA 2EINH 1A31A 4FASD 5CVVA 1JHFA 3V7CA 2P6SA 4WZTA 1VZ0A 3ZIAA 1I3AA 3NQOA 2ESNA 2O7OA 4BY1J 2VPLA 3KRGA 4OJ5A 2VFOA 4XMYA 5D8LB 3QP5A 4IHTA 3WE3A 3M7GA 3V76A 1WPKA 2VOOA 4DGWB 4HAMA 2RKHA 3IUOA 2XGXA 3ZGKA 2PYHA 1Z3XA 2ESHA 3EYYA 1LJ9A 2QEXI 4HQEA 3ZPPA 1N06A 2W7NA 2MD0A 5FRNA 3ZPNA 2IGMA 2WV1A 3FPKA 4FTHA 2QF7A 4Y7NJ 1T5EA 2HOAA 3H5NA 1O3RA 3BC8A 3M1CA 4ZYAA 3J80K 2CW5A 3GIRA 1HSJA 2BHZA 2HKXA 2A68F 3AGPA 2HXIA 3DKWA 3OEEA 3DTKA 2ZMEC 3CQZJ 4OOVA 2H1LA 3ML6A 1ZLKA 1C0WA 3K1MA 2CQNA 3M9AA 4YIIA 2HXOA 4Q5SF 3MCAA 2V5IA 4KT5C 5IYWA 1IN7A 1TQIA 4XKBA 1SVLA 2JN6A 1ZYRF 3ECHA 1WJBA 2E34A 3VSLA 1BC7C 4LLNA 1F20A 2LFBA 3T8RA 1V0FA 1YJ9B 2HR3A 2NV4A 2NSTA 2X6XA 4YAUA 1IDYA 1IDKA 1H8EA 2GK6A 4LBWA 4S0HB 2GA2A 1IV8A 5JHFA 1FZPB 3LOCA 1CQXA 1G3SA 2V4DA 3PETA 2C5HA 1ETOA 1T56A 3HXLA 3BJAA 2K9NA 4DNRB 1NG6A 2JUCA 5E6TA 4IOCF 2R9VA 3BNWA 4PFOA 3ZZ0A 3HOXJ 5J8CA 3FX3A 5EF6A 3IKTA 1DBOA 1FYKA 1GVHA 2CUFA 2LD5A 2BGIA 3LO8A 2NT6A 2M87A 3LAPA 1BN5A 4NHJA 5B6IA 2IGKA 3V8JA 2CUJA 3BY2A 4UAJA 1ETVA 3BPVA 3L1PA 3GMEA 5HDGA 4ZCIA 3P5JA 4KITB 3OOCA 2O0VA 2QX3A 4RLQA 2VBEA 2K40A 4P26A 2R7QA 2FOWA 3VSUA 2XPUA 2LSOA 1JGSA 4IZZA 3ZMZA 1H89C 2WAFA 4NC6A 4EM1A 4ENJA 2WYRA 4DNTB 1STZA 2O6WA 2JJ1A 4NBSA 3I4NJ 1G59A 2A3SA 1HKQA 3H3UA 2IAIA 1FP1D 4XLFA 1MSEC 1U5TC 2DOGA 2EIXA 4PC1A 1PLUA 2VQGA 5F4OA 4R71A 5AIQA 4NNJA 4KIFA 1WHUA 2JIZA 3FKIJ 4PAAA 2EV0A 3PL8A 4P96A 5KHDA 1DPUA 1B9MA 1IXSB 1XE1A 1BJAA 1IUFA 3ZQLA 1QFZA 3PSIA 3T8TA 2EFPA 2XF7A 2UUZA 5F0HA 4DNCA 5IP9J 1FRQA 1QG0A 1QGZA 1SAUA 2OK8A 4RBOA 2RNJA 3MEXA 1BW5A 4B4CA 4Y9RA 1MGTA 2STWA 1RPWA 5EDNA 3OYIA 5CYVA 4HX7A 1VJSA 2RC5A 1EFTA 2WPDA 3H9QA 2LRDA 1S72B 2KLOA 3K4CA 2DMUA 4UVAA 1B9NA 2B7CA 3DEWA 3WGIA 3OYNA 1VHOA 4X7CA 2DK8A 3P26A 3HGYA 1T0FA 4I0BA 2UXNA 5GV8A 2DERA 1IRGA 1MMGA 1V55H 1JJ6C 2OQGA 3AG4H 3FKSA 2VC1A 2R93J 3A3GA 2V7WA 4PGOA 3I55I 1JNYA 2F5FA 2HQRA 3SEQA 4ACBA 4YDTA 1SVMA 4B47A 1OJLA 3NEUA 4L0ZB 1UD5A 3EUAA 4BU2A 3FM3A 4Y4RA 2YR2A 3MCZA 1U78A 3BCAA 3QOPA 2HOEA 4OIRF 4YRVA 3RTRA 1FNCA 1FIPA 2HGCA 4IJAA 5DUIA 3CCRI 2WV0A 1T33A 3EQLF 3S1NJ 4AIDA 3GTQJ 1KTVA 1KU2A 4NK8A 2Q1ZB 4RCYA 2ZXHA 4QPOA 1FLIA 5HNFA 4M3BA 1TVCA 5K5OA 1FT9A 3KP3A 1PJ6A 3VYRB 3JREA 1MMSA 4J0QA 2KIMA 2L7KA 3A02A 1ON2A 3AG1H 2W48A 5F08A 3WNCA 1WOOA 4XR6A 3BG6A 3QYEA 5DTDA 3SZGA 3RZOJ 4FE4A 2AS5F 2EFOA 3QYBA 4RAYA 3WTUC 2M1BA 2L2OA 3U1KA 1NJID 1E62A 3OEHA 2L7FP 4U0WA 4M53A 4F7ZA 4A3DJ 5FGMA 3JTHA 3OYEA 3A2KA 2P5VA 1G3TA 1O7FA 2FOKA 2ZMEB 2QMUA 5F4JA 2H1KA 3WGGA 2DOFA 5F0CA 2H8RA 1BOBA 1XFOA 4MIMA 2KRFA 2VT2A 4OINF 3ZRGA 3ZN0A 5JLWA 3HRSA 3P27A 4DQ2A 1OCZH 3QRFF 3LFKA 3TH0A 2K86A 2LREA 2UV1A 1ZRFA 3JRDA 2QE7A 3BG5A 1UD3A 2B0LA 2QLZA 2RC4A 4A5NA 1JKPC 1POGA 4ZDLA 5D5UB 2FEZA 2DW4A 2OTJB 3LSIA 4XSZF 2F4NA 4F93B 3G1MA 3QPLA 2GK7A 3W5UA 1O8LA 3E6BA 1OGIA 2HTSA 4A3KJ 2PMZA 1SD6A 3N4MA 2XOKA 1M1KD 1D3YA 5HKKA 2PN6A 3VEPA 3HJEA 2DXIA 3OYHA 2JA2A 2GZWA 5EGOB 1MDMB 5J6XA 4I02A 4PJMA 5C4XJ 2QDXA 4N3NA 1TNSA 4I76A 3MKZA 2HOTA 3OL4A 1VQNI 1QUEA 2JPCA 3ZQFA 1E64A 3P9CA 2P3MA 5F4MA 1B1BA 4RD6A 4CCMA 2H6BA 3CC7I 2BXYA 2GOXB 4AF7A 3BTLA 1OR7A 1Z7UA 1YJ9I 3P9IA 1K61A 4X0GA 1N0UA 1VTNC 4GDFA 5D8KB 1XMKA 2M4GA 4MO7A 2HU9A 3UR3C 1CNEA 2A69F 4BQAA 1W1WE 1WDTA 4IHVA 4TMVA 2XRLA 4M2LA 5GP9A 3BR3A 3GUDA 1OB0A 4YHBA 5IYNA 4HNUA 4UUTA 2E2IJ 3DDYA 4L5EA 3OIOA 2Q8KA 4FK8A 2HDWA 2OUMA 1IXRC 4YFXF 2EPFA 4EVIA 1AHDP 3GLXA 5HZBA 1P6RA 3KPHA 1JKOC 1R23A 4PJNA 2D1HA 2BPOA 4OP7A 2UXXA 4CYCB 2VQCA 3QFRA 2QEXB 1N8RD 3BT9A 4WF2A 3ESWB 1NHCA 2JSCA 4DOZA 2DA5A 2W6JA 3WXMA 2MGQA 3KIOA 1RC9A 2TDXA 1NTCA 2MH2A 2YU3A 1PDNC 3GQ8A 4C3JJ 4E7JA 9ANTA 1KK1A 4RB1A 5FKKA 3SDBA 1ZRDA 3I71A 3HHGA 2LC2A 4ZYDA 1FYMA 3I64A 2LDUA 1YW9A 4HX8A 4OOSA 2C4TA 4CCKA 1FDRA 2GPJA 4IXAA 3N05A 1S7EA 5L3FA 2X4HA 2QA4B 5DM7F 2OU2A 3LQRA 3OYBA 1FSHA 1U6GA 1YX5A 3DEEA 1FC3A 1XGMA 3BZ6A 4EJVA 4L9TA 3J7AY 3GVKA 4XRFA 1VQPB 1ONVA 1Y8RB 4AWXB 5JHUA 4TN1A 1DABA 2J5PA 2LF7A 5ICEA 4E70A 3ERED 1KA8A 4NQWA 5FLVA 1E3ZA 3OE7A 3IAS2 2MSYA 2WAEA 3CCJI 1D8TA 3AFHA 3GVJA 1KU3A 3Q5FA 2VNKA 2ZITA 3MWMA 2ZFWA 3CJQB 1F4KA 1XSVA 1OGOX 3HOVJ 2DN0A 3RYRA 2DCUA 1FBSA 1I50J 3ZQIA 3OS0A 2W6IA 4DK1A 3B02A 1K6OA 1RZ4A 2B5OA 3CPXA 1G2HA 1MNDA 1UD2A 1S4MA 2COMA 4MR0A 3FXUA 5FIUA 3U6BA 2PG4A 1O8JA 4Q48A 3CZ6A 1E17A 4OPWA 4BDYA 2DU9A 2K4JA 3RPUA 1VQ5I 3C2HA 4MNUA 4RD4A 3T51B 3G1LA 4BY7J 2XKPA 1FNDA 5L3CA 5IK2A 1BPLA 1WSRA 4TMWA 2X51A 1SANA 4M73A 4NB5A 3T56B 1MD0A 3M8JA 3JRCA 1F60A 3K1PA 4HBLA 4H9GA 4BYYA 3TOBA 2R7WA 1R4NB 1PUEE 1R5BA 5JMCB 3B8HA 5IYCJ 2HYGD 5J1YA 3WBJA 3T5XA 4F91B 3EQNA 1KCDA 5M5YJ 3KP6A 1W35A 1MBKA 4CXFA 2DEUA 3CCMB 1J5YA 2WADA 4HSRA 2CW8A 3BR6A 5J3LA 5TV2A 1Z77A 5CLSA 5F1RA 4QVAA 4KMUX 4U4BA 1X2NA 3TW7A 2RC6A 1QA2A 3BR1A 1IN8A 5D5XB 2UVEA 2E35A 2ICWG 2XF5A 2WTEA 3V8LA 3WNBA 1KYZA 1S7AA 3I3LA 1WKMA 4XLNF 2G0YA 2XC1A 1MBHA 2LY9A 3S14J 2V79A 2VB6A 5E8IA 1IGNA 3PSSA 2QYOA 1EH7A 2L7MP 4N9HA 4DBQA 2F4IA 1YRNA 4W8QA 2H09A 2C78A 2NVUB 3PENA 5H20A 4N3GA 1ZGAA 3H94A 1KQ0A 2BZTA 5GTIC 1IXCA 1ZR4A 4KYWA 2L9RA 1YI2I 2UWMA 2AHOA 1WQ2A 3HDDA 2XB5A 1VQ4I 1W34A 1OISA 1TQMA 1S5LC 1Y6IA 3SKBA 2P8TA 2QENA 4FQGA 1W4MA 2C6YA 4Z4SA 1T6ZA 1EP2B 4W97A 1ETXA 2A61A 3G1OA 1UAAA 1VQOB 4GYIA 1YHQI 1XX5A 3BROA 1UB9A 2ZZEA 1RKTA 4C2LA 1RI7A 2HKOA 4HYEA 1Y0RA 3L2WA 2ZL6A 3N90A 1W7PA 3B73A 1ETQA 4WWVA 2D2WA 2O5RA 4NC8A 4B3XA 1XMXA 3JSPA 1IRFA 1MBGA 2XUBA 4UV9A 2O8KA 4KKSA 4XLEA 3PIOF 1G3WA 2XDVA 5B66C 3S17J 3QWLA 1EXMA 4CQJA 2ZJ2A 3B90A 3GTKJ 4WX9A 4I6ZA 2M0MA 5DD4A 5FJ8J 1H8AC 2JA8J 1F1ZA 3DV8A 1IUYA 2KQRA 1EFRA 2R3SA 2NNNA 3U2QA 1OQYA 1K8AD 3RYPA 1ZM9A 2AXTC 1ZG1A 1YLOA 5GPCA 1CNFA 2NPFA 1BQEA 1PUFB 5EMNA 1FPQA 2LBFA 4HX4A 3FK7A 2AQFA 5FO0A 3WWGA 3BZKA 1P4WA 2M5WA 1D1NA 1B6AA 4RS8A 1PVEA 1YOVB 3WTSC 1AA7A 3CB4A 3OPOA 4RLFA 1FBUA 2VFMA 2GM4A 5H6QA 4EJWA 4PC3A 2OF7A 3GW2A 2XAUA 3VYUB 3ISXA 4UNOA 1MIJA 1E43A 3GVLA 2YSRA 1ZK8A 2R7FA 1I1GA 4QIWN 5K1YA 3CO7C 2ZSIB 2VKVA 1QVFB 1L0OC 2XF6A 1H88C 2DOAA 4ITVA 1VQLI 3HIFA 5D4SA 3BG9A 1FOWA 1QQ1A 3V8KA 2R7VA 3CCUB 2NVQJ 4RCZA 3HPGA 3PO2J 1UCRA 1U5TB 3HUGA 4F3QA 1FBQA 2E1MB 4A3MJ 2XGEA 5FFZA 3BTIA 4HDUA 4IHSA 5E3OA 5FRMA 3FKJA 1HF0A 4YAOA 2YX4A 2PLYA 2YUSA 2TCTA 3V7AA 3TW6A 1W5CC 1TSPA 3WTYC 1K4SA 2FX3A 3PIPF 5JR3A 1JGGA 3T9GA 4N4OB 4HF0A 3ASTA 4X07A 3A4CA 4S04A 1YYVA 4BXXJ 1VBLA 4IRIA 1SKYB 5IP6A 4OMYA 3ASNH 1SAXA 2RN7A 4YEJA 4JBAA 4KMFA 2X8KA 4D5FA 3CC2B 3GX4X 3NWSA 3CCSI 1LDKB 2WAQN 3HC7A 2DMPA 3A0HC 1PXZA 3ECOA 3GZ5A 3HGGA 3LSRA 3D5SC 3BJOA 5JLXA 1G4DA 4A93J 2B7BA 3H3VK 2BN4A 2XAHA 1QJVA 3GO5A 4PGHA 4JP0A 4XOPA 4P5OA 1MNMC 3A1PA 3W2VA 3W2IA 1X4OA 3PNTA 3PUNA 2Y75A 4KJZA 2D5VA 3CMMA 2BV6A 3ASRA 4ON0A 4D7MA 3SLDA 2DA3A 2CF4A 4JX6A 1OMIA 3E6MA 3E5UA 1D8KA 4I0AA 1T38A 3WY9A 2Z5UA 4HQMA 4YXWA 3HM5A 3VWBA 1FX7A 3KEOA 4UUSB 3J81Z 4ASUA 2IA1A 1RETA 1K28D 2ELKA 4ZDOA 1IW7F 3DPUA 2DJNA 5TGTA 1Q82D 4JK1X 2QQAA 4G7OF 2BSAA 3OW7A 3CCLI 3B78A 1Z7LA 2EV6A 2M8GX 4TKOB 4YCQA 4LB5A 1TBXA 4IQ4A 4V02C 4W8RA 2BOLA 2CMPA 3K2AA 1FP2A 4XSXF 4CDGA 1XD7A 1XG2A 1D0ZA 3EDPA 2XVCA 4RB3C 2VKEA 3FHZA 3ZXSA 1FTZA 2VNHA 3KZZA 4QSHA 3M3YJ 1FNBA 1KK0A 4OPVA 4AVZA 1VQ5B 2ZNYA 4HV5A 2A6EF 2LTPA 3G2BA 3NARA 2Y0MA 3M4OJ 2QY1A 2ZZGA 3J7ZI 3CUQB 3OR1C 3LYCA 4XKCA 3CC4I 3IRQA 1DARA 3WTZA 2QZAA 4LC0A 3ASQA 5HDKA 4ACAA 1MMDA 3JRHA 3BDDA 4PUSA 3VYTB 3GTLJ 1NRKA 1FEXA 2L02A 2O8XA 2QSFX 4XKWA 2LBFB 2B0RA 4KH3A 3DXJF 1SFEA 2DFHA 2I8DA 1JXSA 2DBBA 3I9V2 4LD5A 3W6JB 4GFBA 3PUFA 4B8XA 5IYPA 1EH6A 3I56B 4UV8A 1XTAA 1JKQC 2K27A 3EYIA 1Y0NA 1UELB 2K9QA 4KICA 1TL8A 2FX0A 4A69C 1MBEA 3EPZA 4J19A 4CCNA 3BR5A 2BM5A 1GAWA 3NAUA 3W5VA 1DBGA 5HDNA 1MBJA 3E1YE 2Z8GA 3OYMA 3G6EB 4JQFA 5JLVC 1TWCJ 4ESJA 1KZHA 3S32A 5M5WJ 2KIQA 4FISA 2BM1A 4KN7X 1N07A 4ROXA 3K4KA 4M0LA 2V1UA 3ZC3A 1PP7U 1F36A 1NG7A 2E1NA 3BP8A 2HPMA 3D1NI 3JX8A 5H6RA 4CO8A 3PFYA 1QZZA 4NQWB 2IGOA 1XPXA 3ZN1A 3DP7A 4C9YA 4J01A 5IT9K 4EW9A 3GTPJ 4FE7A 3QSYA 1QHGA 4ENNA 3FMQA 2X6OA 5GAGJ 4LG0B 5E3MA 2W25A 4L9VA 2EIMH 3GBGA 3L7WA 5DCFA 4LLLA 3VOEA 3SFIA 3PVDA 2O04A 3CD6I 2R7TA 3H3ZA 1HW1A 2VFNA 3MN2A 3IAM2 1YJWI 2CO5A 3O8GA 2XTXA 4CCJA 3HTSB 3FXMA 4LLGF 3OV8A 4EEFG 3VFZA 3WHBA 3ZQ7A 3DF8A 1E79A 4LK1F 2A5YB 2CQKA 1FSEA 4JX5A 2IP2A 2OV7A 3JRAA 3A0BC 4PSWA 4A3EJ 3P7NA 2HQAA 1BI2A 4U49A 2CG4A 2VBKA 3CJRB 3OFNA 4B3FX 1H0MA 4KNYA 4D5CA 1ELOA 2Y9ZA 4A3CJ 2IA2A 3CC7B 2LKSA 5E8GA 2CWEA 4MHGA 3I1FA 5D5WB 1KU9A 2CQ7A 3CTAA 4Z4TA 1WOPA 1ETYA 1UMQA 3CUOA 3QPTA 3E5QA 1KMHA 5ILUA 1U3EM 2ZSHB 2VXZA 2HCJB 1I8DA 1X58A 4RJLA 4RM2A 3EUHC 3BQYA 1UZCA 2Y2ZA 3WE2A 4AIHA 4CCLA 3SDGA 5ICCA 3A3BA 1R6RA 3JU4A 1YIJB 3EQOA 4M6VA 2VT3A 3MVPA 1MNEA 1MBFA 1DP3A 2B63J 1W36D 2VBXA 2XSJC 1DG1G 4OOXA 3E6CC 3DU6A 3KZYA 2ZBVA 3DBLB 4NUBA 5J4YA 2G9WA 5K5RA 3OSGA 4QUZA 2Z3YA 4O6JA 2E1CA 3L2QA 4A12A 1LFBA 1RRJA 1NB0A 2GOMA 1E3XA 3VSTA 3COAC 2E1RA 1X1AA 4F52A 2Q6LA 3FXOA 4U88A 5C4JJ 3F8BA 2Y30A 3NWTA 1SC7A 1I27A 1X3ZB 4P9UA 5TRDA 4KFCA 4OJPA 3AVVA 2BY2A 5J4VA 5LFAA 4IOAF 1IHMA 3NE5B 2M7AA 3DBRB 2E7XA 1MKMA 3WG9A 1GVJA 2PX9A 3PM1A 3B82A 2IEKA 4I84A 4XN0A 2PJRB 4F92B 1T39A 5DNSA 2V6CA 4WCGA 3KEQA 3MKYB 1EV7A 5F0FA 2NNYA 2K7LA 2HWVA 2QGGA 3DTIA 3GFLA 3BH4A 2H94A 1UG0A 2XPWA 3RKQA 4QV2A 3QU3A 1O8DA 3GQBA 3DWLE 2DA1A 3CMYA 2R92J 1HXDA 2P5LC 3K0LA 1ZELA 3KETA 5DN6A 2RVCA 5HXBA 4G7ZF 2D9RA 1XN7A 3JURA 1SD4A 3H0GJ 1G8XA 5HODA 2O9LA 2CSOA 4UHTA 4EQQA 1ZARA 1LDJA 2K9MA 3PO3J 1E1QA 3A01B 2IBDA 3ZQGA 1N78A 4B3AA 3ZBTA 2V7FA 2OJED 3OL3A 4ZZLA 2DK5A 1N05A 2JZYA 2R7SA 1VQ9B 2NVYJ 3TKYA 2CUZA 3BCBA 4BACA 3HPHA 4UZUA 3S1MJ 2MLGA 5CQEA 3WTXC 2DQLA 1GXQA 2HPIA 3JSOA 2RV8A 4J00A 2L9VA 1SMTA 3IHUA 2FA5A 2I10A 4Z06A 2HYJA 4M9XA 2HVQA 1TWHJ 4I7HA 1VF7A 4RMNA 2XASA 4PFPA 3F6VA 2FXAA 2M0CA 1EF4A 3JR9A 1XS9A 1QVGB 1TLLA 1OCCH 5DM6F 4OPOA 1U2WA 4NK6A 4YZAA 2R5ZA 3LSKA 2Z33A 2CU7A 1A35A 2KZVA 4UB6C 4OAYA 1TYWA 3B8YA 4LIVA 3IWZA 3T0YA 3BH6B 3BR0A 2IPQX 2WBMA 3CCYA 1YX3A 4YAFA 2V6EA 2ZC2A 1Z05A 3IH4A 1AOYA 4HLYA 1HVXA 1ZM3A 2QVOA 4XLAA 2Z99A 5E17F 3HOWJ 3CESA 2FBKA 3BCFA 1WH7A 3LFUA 2ZZFA 4CYCA 3WTTC 1WI9A 3LSTA 4U7DA 2CV0A 3PQKA 3K2ZA 2O03A 1LLZA 4L9NA 1R4MB 3Q39A 2W57A 3L9FA 1P7JA 1X1PA 1TWFJ 2K02A 4PSXA 1TC3C 3IH2A 4E4HA 1SFXA 3KCCA 2RAEA 3HZJA 3ISPA 4GO1A 2ZL5A 5EYRA 3RI4A 4QHYA 3VMVA 3O2PE 3ZZUA 4ZGQB 4KKTA 4RGUA 2PMHA 1CGPA 2OK7A 2CBXA 5CDFA 4G1VA 1KQ9A 1Q1VA 1QHHD 4XOTA 1FNMA 2H8WA 2VQLA 2G7UA 1WH5A 1P4XA 4G6QA 1KYWA 2NTBA 4A3LJ 2W24A 1YLFA 4HLXA 4Q47A 4UZFA 3QAHA 1P9QC 2JRTA 5JBQA 4LK0F 1QA6A 1TYXA 4UXNA 4ETSA 4XLPF 1Z1DA 1DDGA 1BMFA 1K7AA 2B7EA 1S8NA 1MABA 1GO2A 2DIEA 5LRRA 1T98A 4XLHA 4M6XA 1DPRA 1YW8A 1FWZA 5LHIA 2QBYB 4B09A 2WA0A 3JQPA 2DT5A 3BG3A 4E7SA 5JFRA 3QFSA 5ICFA 2KP6A 3KLOA 5B5EC 4JMQA 1BJKA 2XEXA 1HDPA 4WXCA 1I1SA 1FY7A 3HB9A 2PMUA 5LHHA 2X6WA 3FMSA 1SMYF 3GVAA 2FQ3A 2Z16A 3GEZA 4XL9A 1XB4A 4IEJA 3H1CA 2V7XA 2DOEA 4YZ0A 4IO9F 3IC7A 1PJ7A 2WZPP 3K69A 4XN3A 2DMTA 1V3FA 3AAFA 4M74A 3EETA 3D5LA 3OYCA 1TW3A 4G8XA 1BOAA 3SHFA 1HLVA 2UVFA 1IC8A 3ABMH 1X1DA 4W8TA 1AIRA 1REPC 3TO7A 2QXZA 4HE5A 1VQ7I 1NB9A 3CP2A 1T08B 2EIJH 2GXGA 2EZHA 1OGMX 3O3KA 3TDZC 4DBRA 1YFHA 4LOCA 3I0TA 4N4NB 2P7CB 2ZCWA 3OOUA 3M8FA 4OOIA 1SD7A 3BPXA 5IYDJ 2KRCA 1O8EA 2M8EA 3PQJA 4LG0A 2QM3A 3SJPA 4P6YA 4E6KG 4E7LA 2XGJA 4V2GA 4UZEA 4C43A 3W2HA 3KP4A 4KISA 4MGRA 4A0XA 4FHTA 1KJZA 4BXUA 1XGOA 5D6FA 2Q6KA 1R5ID 3OS2A 2O3FA 3BJ6A 1ZG5A 2DA2A 3F21A 1HA8A 1LQ1A 3BCDA 2W82A 3KZIC 4FX0A 1YRNB 1GV2A 2VBTA 1XGSA 2EWNA 1ZTRA 2K4BA 5K7FA 1VQ8I 5ILSA 1P4MA 5DSZA 4OWRB 2LYCA 3P4GA 4U7BA 2DI3A 4RAZA 3WTWC 3DLAA 3LSHA 1B59A 3ZMVA 1PYVA 3V7SA 4HSTA 4WZLA 1R58A 3WQZA 1I6XA 1LEAA 1OLTA 5C1EA 3BLYA 1A5JA 3MMYB 1AKHB 4IW3B 2JWTA 3GCMA 1R00A 3PA2A 1B23P 5DCMA 4BAYA 4M3DA 4GRIA 1XCVA 3F72A 2LF8A 5F64A 5AONA 1YJWB 2FUG2 3C7JA 4BXFA 2R7XA 3JCUC 3F22A 2FNAA 1I7PA 4W8SA 3A8JA 4EMSA 3CP8A 1Z21A 3ABLH 4L18B 4P1VA 3ZQHA 1MMAA 4CYDA 1VQKI 2WSSA 3GTOJ 1R9TJ 3ONQA 3Q0WA 5LGUA 5FLXZ 1F43A 2F5DA 4ZTFA 2PE3A 4V19K 1L1IA 5CVUA 1HKSA 3VODA 1PKVA 2OAZA 1K78A 5FROA 2FRHA 3LNQA 1MH3A 5KK1A 3IV5A 3DU5A 2YWEA 2J7KA 5KNLA 4XIDA 3SYTA 2X3HA 3BY1A 1GV5A 3HSEA 2D3NA 5L3GA 3RKXA 3FJOA 3E1SA 3G4SI 1W0KA 4X8IA 2XRNA 5A8AA 3K4MA 1TTYA 3VSKA 3S2WA 2OBPA 4PJJA 2KL4A 5LBQA 2PECA 5CKTA 5TY0A 5HS7A 1W36C 3GTMJ 2Z2SB 1W0TA 1W9XA 1WU8A 1QRYA 3SEZA 2R0QC 1B8IB 5IOYA 5K5QA 3EUHA 2MA3A 1GVDA 3TP3A 3Q6RA 5BMZA 3CCQB 1X2MA 3LL7A 2FF4A 1T0FC 1R49A 5M3FJ 3JAMK 4LITA 5F6FA 1QFJA 2WAQA 3R0AA 2EA4A 3H5RA 1E63A 2NXNB 5E20A 2BVNA 2XSDC 2Q6IA 4P1WA 5C1CA 1RR8C 1LNWA 2EA2A 3I59B 2QQ9A 1K79A 3OR2C 2WZNA 1TTTA 3FXJA 4EJUA 2BW3B 3HBLA 3HSFA 1P92A 2JQ7A 2B9SA 1V5EA 1F9NA 2GREA 4IRGA 2PLFA 2JJ2A 2INVA 4X7DA 1MH4A 3ZMSA 5AMVA 1WP6A 2E5ZA 4G6IA 1EFCA 1O8GA 5BPDA 5EG0A 2LP0A 3DQVC 1V4RA 5K7HA 1JJ8C 2XT2A 5J1RA 2IS1A 1UD6A 1I18A 1I3QJ 4RGSA 2QZ8A 2JA5J 6PAXA 2M3AA 3SUCA 1IAWA 4IPAA 1TT0A 1SKQA 4YG2F 5TR9A 2V26A 5FKMA 4A3FJ 5L46A 1QZEA 5FO5A 5KAFC 2LVSA 2ZXWH 1UHMA 2NS0A 5FKLA 3RJPA 3CUQC 3F23A 3IKVA 1VQMB 2V9KA 3RIRA 3K70C 2QSHX 3LMMA 1EP1B 1Z3YA 4YIRX 1O3TA 4RA2A 3JTGA 2NT9A 5CVJA 2FJ1A 4I99C 1D0XA 3F6OA 1LFPA 3TO9A 1AWCA 1USSA 4RM0A 4A6DA 4A3IJ 2V9PA 1Q86D 3E20A 4M3FA 2OBSA 2YPRA 2AO9A 4ZCMA 3QU6A 1CF7B 2RQQA 1UJ8A 5AIPA 5EZHA 4EJOA 1D0YA 3W3CA 1FX0A 1ZUNB 4P25A 2XROA 5KW9A 2DAOA 3H9NA 2E19A 2NVTJ 1VQ6I 1A6QA 2AXLA 2KMUA 4HF1A 1TYUA 3WNDA 1OFDA 2DA4A 3LJYA 1G7SA 3CCSB 4AU7A 5F04A 3H35A 2GQFA 3JQQA 2P5KA 2L0KA 2VXDA 3OYFA 1GLNA 3BC9A 1J2XA 1P4AA 5FB2A 4DQKA 3Q3SA 2JK3A 3ONYA 5CVIA 2DA7A 3ZMDA 2YWHA 2R7DA 4HDVA 1BI3A 3FISA 1S6LA 3E6DA 4G9YA 4JYKA 4QVJA 1OFEA 4Z4VA 1JTYA 1OCPA 2L3DA 2NYXA 3KFWX 2WWYA 4S05A 3CCVB 2A6TA 1FYLA 4RD3A 1UHSA 4IRHA 1IO2A 3WU0A 3CDHA 1QVUA 1TNTA 2R5ZB 3PA1A 1WWXA 1QCXA 3W6KB 5GV7A 1QA1A 2D1VA 4ESBA 1VF9A 1RESA 2EIKH 3M1EA 4IL6C 1ZQ3P 3CCUI 3CUQA 1JTXA 2L9SA 2OCEA 5HVQC 4BQQA 1KQ8A 2JN9A 3ABUA 1DGWY 1W0JA 3CDIA 1R1UA 3OZVA 4YALA 3HRMA 5LEJA 2W84A 1SFUA 1K83J 1I39A 3KX2A 1Q9SA 2ME6A 5LGTA 4EV0A 3VR6A 3K4NA 2IQ7A 2Q2EB 4YC5A 2RREA 1G7TA 3OZWA 1QGYA 1KGSA 1XQBA 3VMWA 1GT0C 1BW6A 4PABA 4C2TA 2QKMB 4E7ZA 1QQIA 5E18F 5DS9A 1T6SA 2F5CA 1BR2A 2BVLA 2RDPA 3R0JA 3S3NA 1ZM2A 1X19A 5FO1A 1IG7A 2BM0A 3DU1X 1VHEA 2KFDA 3PSZA 3DKXA 1EWYA 2AHQA 3VSVA 4OJLA 1LPQA 1YO5C 5A88A 4OIOF 3CMEB 2MC3A 4JX4A 2FSWA 5C44J 1WJFA 3R4KA 3DLLF 2VJ5A 1EJ9A 3T53B 4CGZA 2QKLB 5J1UA 3O8HA 4PZJA 3RPUD 1U8RA 5ILVA 4NCNA 2ZBUA 1BI0A 2A07F 5J40A 3DKYA 2AQEA 2XAQA 1WJEA 2COBA 4R8HA 1GHCA 4BL0B 2DPUA 1UMKA 2DYSH 4BNCA 2IOUG 4FX4A 1P2FA 2XTYA 1HSTA 1YQAA 1P7IA 4GXOA 2ZL7A 3RQIA 4NBQA 2UZKA 4HIZA 3AL0C 3OSFA 3KLNA 3TQNA 2Y69H 5HLTA 3OS1A 5THXA 3OYGA 2OPTA 1IB0A 2OBRA 1U8BA 1YHQB 1IZ1A 3AVWA 1MJBA 2R7OA 4AF6A 2ZB9A 5HNHA 3IP4B 1TT5B 1LEBA 1IDZA 2XC7A 4Y52J 3AL0B 2XZOA 1W5TA 1BX1A 4G7HF 3GF2A 3CCEB 1IB4A 4URRA 4OZYA 4Y33A 4U87A 3ZQQA 4EH1A 4AD9A 2EZIA 2LG4A 2ACJA 2ZXJA 2VE9A 1QUFA 1EH8A 4HNTA 1KRHA 3WTVC 2NSPA 4HEA2 1XG1A 2FBIA 3FWEA 3UKGA 2GLOA 2LOOA 3CCQI 1UFMA 3FXLA 1UD8A 1XGNA 2VN2A 4TMTA 3QPHA 4LB6B 2ZBKA 1QVTA 1SFOJ 2QUFA 4A2UA 2ISYA 3TDUC 3LSMA 4OMZA 3RIQA 3DBHB 1BIBA 3S8PA 1LE8B 2YUHA 2L54A 2PFBA 4AC0A 3CCEI 1FIAA 1TUIA 4OJ6A 2HQ5A 3F3XA 1FJLA 3G4SB 2GIZA 2JRMA 2VC0A 5GAEJ 3ZMTA 3JRIA 1YX2A 3FHNA 3B6AA 1JTAA 5ICGA 1TYVA 1FMWA 3BH7B 3OJXA 2G0EA 4DYRA 3U6KA 4MEYF 3B6CA 4D7NA 4IHWA 2VASA 3AK5A 2C77A 2FMLA 3N6ZA 1LUJB 1E1RA 2IS6A 3EUKL 1VLYA 2VBVA 2RGVA 1DP7P 2QBYA 4RPDA 3WBKA 2LLKA 5FA6A 1PE9A 3FDYA 1O3SA 2E1MC 4RD1A 1WFXA 3OIQA 5FD6A 1T6XA 5D4RA 2BSPA 2RQPA 1VQKB 2MBFA 4XONA 4IVNA 4P12A 3LQQA 3ROUA 2EJRA 3MKWB 2PI0A 2DA6A 1OYWA 2D45A 3CMEI 4IQJA 3VDXA 2X6YA 4L9JA 3OOPA 3SY2A 1ZN2A 3BQZA 2XZPA 2M30A 1QRBA 4L5JA 2CV1A 3H9JA 3BTCA 2DPDA 1QU3A 3C3WA 4QPQA 1MW7A 1QPMA 2M9HA 4KIGA 1O57A 3PNVA 4N9IA 2VJIA 4M3GA 2K3FA 4RDUA 2X1CA 3HOZJ 5DEQA 2LKXA 3REOA 2YWGA 3Q38A 3RPQA 3S2DJ 2V7VA 1O8IA 2YX7A 4HZFA 5HZAA 1XSDA 4H4KC 1VQ8B 5KVRA 1O88A 4CZCA 4U9UA 4HF2A 3KYDB 1ETKA 2L4AA 1B72B 1KQSB 1VQPI 3W2EA 2EWEA 3FY3A 4OPSA 3U1DA 1JHHA 2CRGA 4C2UA 3OP1A 3GSIA 1ORKA 4CZZA 4CA0A 1ZHFA 2IT0A 3J80Z 4KKUA 1G7RA 1BI1A 1USTA 2XAFA 1BA5A 1Z67A 4LGWA 4ZH4F 3JAMZ 3LSPA 1NHAA 3HYIA 3KL9A 4HOBA 1V5VA 2I1LA 1NH3A 3I58A 5KSWB 2R7UA 5BPIA 3CCVI 2CFXA 1CF7A 4G6TB 4HWVA 3WGHA 3F8MA 3ULQB 2IVMA 3E7LA 3CJNA 2VOPA 3NAWA 4B48A 4I98B 3CMAI 3J81K 5FKOA 3ZOBA 4YFKF 3TL4X 3RZDJ 2KIUA 4B4DA 3Q0UA 5HLHA 2DODA 4DW6A 1O4XA 1VQ6B 5E1ZB 4HNVA 2O1DA 1JKRC 2NRAC 3AG3H 5CQGA 1TQPA 4BJTA 1Z6RA 2V1XA 3LA7A 4N0BA 3PNYA 2FQ4A 4LJZF 4RM3A 3L2CA 2ELHA 4HW0A 3QFTA 2ODLA 1ZGJA 2R7ZJ 5FLXK 3U2RA 1OFMA 1Y56A 1YJNB 3KYCB 5B1BH 2KISA 2WB1N 3IL2A 2BV3A 3AGQA 2BHYA 2BF4A 4E0FA 5D5VB 1FRNA 3FXKA 4GCVA 4MQ9F 4Y7CA 3GXOA 3HHHA 5J35A 2KVOA 4TSFA 4ZYGA 1VQNB 1VQMI 4DIQA 1BHEA 1CQTA 1HC8A 3AVTA 1ZREA 2QTLA 2CUEA 4QFMA 2F3LA 2Z6BD 2KZGA 4WWCA 3CXCB 2L7ZA 3ONUA 4A3BJ 2P4WA 1WSUA 3ABKH 1FOXA 4EM0B 2ECBA 3V4GA 2DFIA 1Y1WJ 4QTRA 4P6VF 5J3OA 1A6IA 3DFGA 4U0YA 1QBJA 1XSXA 3RY8A 3AVXA 2OC6A 5DD8A 1AIPA 2HZTA 5M3MJ 3OY9A 4UY8I 4M6YA 3GZ6A 3ASSA 1ZAOA 2VKDA 4Q7JB 3VB2A 3L2VA 1HW5A 1OPCA 3SZTA 1VI0A 3E5XA 3MMPA 2HEOA 2BBYA 1UG2A 4YIFA 5CJ9A 1RWRA 5ERIA 4U0VA 3Q0VA 1RUNA 2VIXA 2JTVA 3MAJA 1E3OC 2HTJA 4UVBA 3PJRA 2R7RA 1D5YA 2HFHA 5LMZA 1EZGA 2OTLI 2NS7A 1A36A 1DQUA 1XDUA 1WXRA 2O0YA 4V2FA 2F6CA 2VLAA 2F1LA 3ERMA 2DCEA 3FM5A 1OYYA 3FPPA 1ITYA 4IF4A 1QGAA 3A1YA 1EE6A 4MYTA 1Q81D 1G6NA 2E2HJ 5DS0A 3RDIA 2VBSA 1BM9A 4EGYA 3PUBA 5FNZA 3DEUA 2GJRA 5LD2C 1T6YA 1O8KA 1QRCA 2O17A 1ACIA 2CH0A 4PDKA 1O8MA 2OCCH 1WVRA 4WXDA 3I54A 3LWFA 3R60A 4X7FA 1JUPA 1YE9A 2MLKA 5HS9A 3ASOH 3JQRA 4XNFA 2LZJA 4ZGNB 3V7RA 3I55B 1B4AA 4MQVA 3FBNB 3KEYA 4XD7A 4ESFA 4YFOA 3JW4A 1JI8A 2VBUA 5BQTA 4BS9A 2KDZA 4KDPA 2LY2A 1OB2A 1OFCX 3K4BA 2CNDA 4LBZA 3VO1A 3MZ8A 2BEOA 4EJTA 2PJRA 5DV5A 2VBYA 4FETA 1WTHD 2KKOA 1XDSA 5HLGA 5IOZA 4B44A 2VUMJ 2GQQA 1HQCA 1R1VA 4KT6A 4ENKA 3S93A 4Z4RA 1ETWA 2F4OB 3ZBUA 5C3EJ 4AYBA 3OIPA 1COWA 3GYHX 3TMOA 4LG3A 4JOMA 4YFNF 1F5TA 5KCMA 1WJDA 3L00A 1APLC 3BG7A 3ZMUA 1K78B 4YAWA 4GGGA 3QFCA 3CJTB 2PYGA 2R6HA 1RQPA 1KCCA 2CW0F 2ZO4A 1N0VC 3CRZA 4X05A 2K85A 2C2WA 3FBIB 3HL2A 1YW7A 5A89A 5GPAA 4IX7A 5IP7J 3G71I 1Z9CA 2V1NA 4Y17A 4XRSG 4XKVA 3C2GA 2QSGX 3I4MJ 1UD4A 4W1UA 1K4TA 2QN6A 1R7JA 1Y8QB 3HKZN 3WG7H 5FLMJ 1Y39A 2KIFA 4RB2C 3JRFA 1M1EB 2V1DA 1H85A 4P2NA 2V7QA 4Z03A 2JUGA 4UVCA 4BHBA 4RDKA 2BM7A 2NAZA 1YIJI 2DTZA 1BJZA 3G71B 5F1JA 4YZQA 1Q1HA 1O8HA 2XNCA 2X1DA 3TOAA 2CC2A 3F8NA 3ZZTA 4O3MA 3GQ7A 1W7PD 3NB2A 4XORA 1OKRA 2VYQA 4ANJA 5ED4A 2E1OA 1VQ7B 5JVGF 2X1EA 3S3MA 5E79C 2H27A 1EFUA 2VKHA 4ABZA 3V42A 1X4PA 4OM9A 2J8KA 2ID3A 2VQHA 2ME0A 4MEXF 4QWQA 1Z0XA 3GLLA 1BIAA 2CQXA 1X3WB 1FOYA 2HQNA 3ASPA 1CLWA 1T95A 2C4UA 4G1BA 1WI3A 2WJYA 1WOSA 2VFPA 2V4JC 2DFFA 2K9SA 2BXZA 2PBIA 2QCOA 2R5YB 4BJ6C 3S2HJ 3VO2A 2GBYA 1FMVA 4RAFA 3OYJA 2J8IA 2JDIA 2DT7B 1IJEA 4AVPA 3CD6B 4Z4WA 3RKWA 1M90D 2F5EA 2P7VB 4C2MJ 4CSWA 3H5AA 4PJ0C 3TP0A 4RGXA 2BM4A 1YIOA 4DYQA 5EG0B 4BPRA 4BBRJ 4Z4ZA 2OZ6A 5AN9A 2MG4A 1AU7A 4CH7A 2ZMEA 2KDOA 5HLIA 2N8GA 1QZYA 1HBXG 2VJ4A 2E1BA 1S0UA 1LE8A 2KT0A 2V31A 2XNJA 2YWFA 3SJZA 2QGUA 1FTTA 3GQAA 3TEDA 1O8FA 4FWTA 3MZYA 1HKTA 3H0DA 3CW2A 4RGRA 1R1TA 2FU4A 4XRMA 3OKXA 4F7DA 1XC5A 4PK4A 3E0JB 1D5VA 4UB8C 1HDDC 4M9SA 3LQEA 5DUKA 3RCOA 5E3NA 3K7AJ 4KA4A 1RR7A 2OQRA 1KTWA 4OU0A 4ZC3A 3IRRA 3ZPLA 4A5MA 1PP8F 2HMAA 2VBWA 4WZEA 5L3BA 4M9ZA 4HA8A 3D5RC 1SVOA 1GQ8A 4TMZA 1DUXC 4Q4ZF 2BX6A 4AYBN 4YEIA 4M1KA 3KEWA 1WRJA 3FMRA 4ZDPA 1J9ZA 4P3YA 2O6GE 3I56I 2L4MA 2OD5A 1N08A 4BJ5C 1GJRA 2P0WA 3I4PA 1A04A 2LMDA 2OTLB 2HDDA 2DMNA 1ZM4A 2A5WA 1NK3P 5IY5H 2X3UA 2V9VA 3S1RJ 1ULYA 3SZPA 4OJOA 1DU0A 2Y0SA 3LQ6A 3U21A 1H8HA 2E5NA 3L2UA 4MTDA 2EZLA 3N97A 1OCOH 3WU2C 2ZTGA 2VJJA 3PUMA 2EB7A 2OBTA 1OB5A 2ZXIA 4BHCA 1RKWA 1V5GA 2FMYA 4DQLA 2V7UA 2NTPA 4PCQA 5H2FC 1ERDA 1PUFA 2GXBA 2GJKA 3HRTA 2BYVE 1CZFA 2W4SA 2DQRA 4M71A 3U9GA 2E2JJ 1BX0A 3R6JA 4RPBA 5IYQA 2O0WA 4HPQA 2CYYA 5TISC 5LHGA 2MC4A 3LAJA 3HOSA 5HS8A 2W85A 2YS9A 3CCLB 1JUSA 4QLCU 4HV6A 2L01A 1VQ9I 3K1NA 4FN5A 1PJ5A 1LKXA 3LSJA 1IJFA 4L0YB 3AVUA 2M7BA 4PC6A 4UUSA 2Y9YA 2IRFG 1B2RA 2Q2EA 2DYIA 1TZLA 2JPBA 4P9FA 3OYKA 3CMAB 1MMNA 3H36A 4AC9A 3J81k 2DY1A 3W6VA 3W2FA 1AKHA 3GWZA 1HCRA 5JI6A 4G7XA 1MZBA 2DLLA 2ZJRF 1YJNI 2EFNA 2ZNZA 1JT6A 4WK8F 1EP3B 2FBHA 1K4ZA 3PFIA 1YS6A 4O5VA 5LRSA 2IXSA 3GTJJ 4LBVA 2YU9J 4G94A 1X1CA 3OYDA 2O61A 4P3IA 2DYRH 2KRHA 4K1XA 4Y9UA 4D1QA 3A8IA 4BHPA 2G7HA 2VNJA 4MTEA 4AM3A 1LVKA 1BN8A 3ELKA 4FT8A 1KK3A 1OOCA 1H80A 2VI6A 2VL8A 3FF5A 3OAAA 3MKLA 4BUPA 2DT6A 3MFKA 2STTA 4IHYA 1RU4A 1IN6A 2XGDA 2BGJA 2DMQA 4X7EA 2KPMA 1K73D 1WSVA 4XK4A 2EH3A 1S29A 4CCOA 2H6CA 1GAQA 2FNPA 1Y0YA 4MFEA 2QYUA 2CV2A 1WJ5A 4OZZA 1IRXA 2BY3A 2I5UA 2K9LA 4TV7A 3GFMA 1DU6A 4II3A 2ZJPF 1U9NA 2X85A 3KP7A 2ETHA 3LSGA 1UHWA 5IPAA 2QWWA 3HOYJ 4PC7A 1OHHA 1ENHA 5IT3A 2BVMA 2GIVA 3SFZA 3CLOA 1D1AA 1Z6TA 4I01A 3VMFA 3F8FA 2JA7J 2IW5A 2JMWA 4MLOA 1RIOH 1JJ2B 1KU7A 1GUUA 3C2BA 1YS7A 1W7PB 2JSPA 2JVGA 3C18A 1QPIA 2CQQA 4BE2A 3PSFA 1IDJA 2EK5A 4H0EA 2MH9A 2Y0SN 2CFOA 2IA0A 3GQ9A 1HZEA 3HOUJ 2MD5A 4ENMA 2HNHA 1I6HJ 3BWGA 1RNLA 4BKXA 2VONA 2XT4A 1EA0A 2P6TA 3H09A 3ML3A 2EBIA 3AG2H 1E3HA 1IA5A 1MJ9A 3K9TA 3QP6A 1EKEA 4BQNA 4MYUA 1WPCA 4A0ZA 3OZUA 4M4SA 5GTHC 1VNDA 1X3UA 3RSNA 5TJJA 1ZKGA 2LK2A 1QO0D 2Z1DA 1KZLA 4D9JA 4DZPA 5M5XJ 2LKPA 1T8IA 2HDCA 3HG9A 3RQ4A 3SQNA 2QTZA 2DFEA 4GYGA 4LIUA 4CICA 2M4KA 2JA6J 2VPRA 2F5VA 1NDHA 4ZCLA 1QGPA 3K4LA 4ZTJA 5H5JA 3VNVA 2DETA 1G7CA 2L5QA 1N77A 2J5OA 1U2RA 4WZKA 5L3DA 3DPTA 1WJCA 2W1OA 3K6GA 2ECCA 5JVTA 1XB2A 2XPVA 3ES9A 1Q7YD 4BE1A 1B8IA 1N75A 4BQOA 1IF1A 1D8JA 4HE6A 3ZUGA 4XQFA 1VQOI 2FVGA 1QFYA 4M72A 3S3OA 2DTRA 2XB0X 2LNBA 3G6EI 2MFZA 2Q0OA 2Z9OA 2PQ8A 4A3JJ 1D2EA 1VQ4B 1JA1A 3ABTA 3OW2B 1K6YA 4Y15A 4PC2A 2INUA 4Z05A 3MZHA 1YI2B 4NDLA 4P9SA 3FZVA 2X0LA 1OFLA 2GXAA 3ZP5A 1Y0UA 2EFGA 4YZXA 2VBZA 3C1DA 3QOEA 2E7WA 4C0SA 1HW2A 2CGPA 3HSRA 1GDTA 2K3PA 3LMWA 2LY1A 4GQNA 1KONA 1SD5A 4BDZA 1B72A 2W7ZA 2IS4A 2XNDA 4L5IA 5L3EA 2A05A 3M07A 3HOTA 2PMDA 3FXQA 1J09A 2Q6OA 1QX4A 2MABA 1ZGWA 1H42A 2WR8A 4MXNA 4BH9A 1BLIA 2XKOA 1SM4A 4RDJA 1O3QA 2NOGA 4ZJZA 2X0KA 2ZFUA 2V7TA 1WORA 1H9TA 2BY1A 2HI3A 3T1BA 4IKFA 5DDGA 3FXRA 3MHPA 1J0RA 3CC4B 1YITB 1R22A 3BZCA 3I53A 2XGCA 5E1WA 4WXHA 4OIPF 3S1QJ 2F1MA 4PJLA 1U0JA 2HYFA 2WB1A 2M34A 3BR2A 3GFJA 1XCBA 4BBSJ 2PIAA 2EILH 3OJWA 2E60A 2XAGA 4IHXA 1A8PA 1IRZA 1V5FA 4CHUA 1JT0A 4I2OA 1JUMA 3UW0A 2KJBA 2HVRA 2F43A 3RKYA 4G7WA 5J47A 1RUOA 1HG8A 1ZR2A 3SXYA 1N25A 1G3YA 2M45A 4PMHA 3F0CA 3OYLA 2W00A 1R5NA 1WCMJ 1JB9A 1OYIA 1QNTA 5CVRA 1MRZA 2M2EA 3ZQCA 4D0PA 1IJWC 3QYFA 4OIQF 1YITI 3CF2A 4RLZA 5B3SH 5EEHA 3QQAA 1JE8A 2K5CA 3BY6A 3QPSA 2EQRA 3NRVA 4E7HA 1Z91A 2BM6A 2GAUA 5KAIC 1S9HA 4EGZA 4G5GA 2C5BA 1YTYA 2WY7Q 1PJRA 3A35A 4AIJA 3K70D 3P9KA 1EA3A 5EEAA 5A2QZ 4YELA 4Z4UA 3ZR8X 1Y1VJ 3KE2A 4ZYHA 3R6KA 1ON1A 3SZEA 2BY0A 5E3LA 3A01A 1MSFC 3WYAA 1TWGJ 3DPLC 4C3HJ 3CC2I 3Q3AA 4TMXA 1RQRA 1QA3A 2EFWA 2EV5A 2XHKA 1LM1A 1L3LA 4XICA 1SEUA 1J9IA 2OYNA 2QA4I 4B43A 5CPRB 1RMGA 4KN4X 2Y48A 4MFDA 4C3IJ 1HF2A 1KQ5A 4ASNA 2DO7A 2CK3A 1K9MD 2JJ7A 2NZMA 4K2EA 4BGDA 4DJAA 2VE8A 1J59A 5A2QK 1TLHB 1LB2A 4BE0A 1W2BB 4G12A 2PMZN 5K7ZA 3TO6A 3UNGC 4RB0A 3WU1B 3L09A 3S15J 1LLWA 4NC7A 1X1BA 4Z6YA 3AVYA 1K5CA 4HG2A 4XRSA 1HOMA 1I5ZA 2EZKA 3G3ZA 3VYSB 1E0EA 4JRAC 1KC8D 5LLQA 4DZJA 5B1AH 1VQLB 1SFKA 3DTEA 2ZZQA 5BSXA 1KK2A 1WJAA 2MW8A 2LH9A 1U5TA 3HUGB 3KP5A 3BOQA 2EFQA 1GR1A 3JRBA 2VBMA 2ELJA 2WJVA 4ZV4A 3I5UA 2CS3A 2F2EA 3X2QH 4E7IA 5EGOA 1ZLJA 1MDMA 3TGNA 1R5GA 1WMRA 1R5OA 2JT1A 5LEKA 1TW2A 2KJCA 2NVXJ 2M5SA 2ISZA 2NOJB 3IWFA 2RNGA 2X9DA 2GJPA 3R6SA 3CO6C 3A8KA 3D0SA 1S7OA 2TRTA 4Y13A 2GA1A 2IGNA 3O6BB 3LVBA 3W5HA 1H9GA 2CW7A 2HS5A 1OCRH 1R36A 1TP4A 3WODF 2VODA 2QQBA 2IS2A 2DJIA 2F4MB 1ZRCA 2XZLA 3VPRA 2IJLA 4A6EA 5GADJ 1ZH5A 3W2GA 3LA2A 3LA3A 1W87A 3SJMA 2PEXA 4RDLA 2FD5A 1LDDA 3S16J 2DDAA 3I59A 1GXPA 2HDNB 4P22A 4BEHA 5E1XA 2BW3A 3H9GA 2ADUA 3JRGA 4L8JA 2KHMA 4Z4YA 1LFUP 3R61A 4DYCA 4XLCA 1O7LA 2OZUA 3W2WA 5FL7A 2CJJA 4LBYA 3HRUA 2OTJI 4II2A 3CDLA 1FOKA 4A0YA 1XMAA 3HKZA 2R4GA 3MD2A 3HAGA 1JRGA 4RD0A 1W5SA 3FK6A 3GTGJ 4F55A 3GRHA 3BTJA 5BNGA 3SEJA 4C30A 1LVAA 2ID6A 1WGXA 5EZGA 1HA3A 2BE5F 1X0CA 2JVHA 2D74A 1WZ2A 2NS8A 3Q9SA 5EEGA 4AUXA 1W0UA 1NK2P 1D1BA 1R5HA 4FXUA 2F48A 4OAZA 4R79A 3GFIA 3ZSCA 1S3JA 1OR7C 4LMYA 1IV6A 1DGRM 2X53S 5DYMA 2HVSA 4UUVA 4B3GA 2HZDA 3MQ0A 4XBFA 1BL0A 1YG2A 3D26A 2CRVA 2ZTNA 3G05A 1KD1D 2Y31A 5BOXA
chains in the Genus database with same CATH topology
3E1SA 1W0KA 4E7KA 3LNNA 3K4MA 3VSKA 4CUGA 4PJJA 3F9KA 2KL4A 2PECA 5CKTA 4TT3A 2V7QA 1W36C 2JUGA 1BR1A 2LBFA 2Z2SB 2AQFA 1W9XA 4DK0A 1BR4A 3WWGA 4EATA 3SEZA 4YZQA 2WY8Q 1O8HA 2X1DA 2NTQA 3OPOA 1AA7A 3LL7A 3ZCOA 4RLFA 1T0FC 5HOOA 3GQ7A 4XORA 3K10A 4LITA 3TBIA 2XAUA 3VYUB 4ANJA 2X1EA 3S3MA 1E43A 3GVLA 2WAQA 4Y3OA 3H5RA 2ZSIB 2VKHA 3OWTA 3V42A 2L9NA 1X4PA 2DOAA 2XF6A 4ITVA 2VQHA 4P1WA 5C1CA 4XM3A 3OR2C 4Z1MA 2BW3B 4HRIA 2R7VA 1V5EA 1T95A 3HPGA 2WJYA 4XKVA 2V4JC 1NBMA 1UD4A 2JJ2A 2INVA 4BJ6C 4F3QA 2E1MB 5FRMA 1FMVA 3OYJA 5AMVA 2JDIA 1WP6A 2E5ZA 3FKJA 4G6IA 2DT7B 1O8GA 3DQVC 3OMYA 1UD6A 2IS1A 1I18A 1V0EA 4CSWA 3H5AA 3L2RA 2MYSA 2M3AA 3SUCA 3W2AA 1TT0A 4N4OB 3T9GA 1VBLA 3A4CA 2V26A 4CH7A 1SKYB 2HLDA 2KDOA 2X8KA 4YEJA 2VJ4A 2E1BA 3OYAA 3NWSA 1LDKB 3HC7A 3K4JA 2V31A 1PXZA 2V9KA 3GQAA 3D5SC 3K70C 1D1CA 1O8FA 4BEHB 3KYLA 3LMMA 3H0DA 1Z3YA 1QJVA 4PK4A 3E0JB 3QODA 3AKZA 2D3LA 2NT9A 1D0XA 4XOPA 4P5OA 1LFPA 3B4NA 3RCOA 3W2VA 1X4OA 3PNTA 4KJZA 3CMMA 1KTWA 4FASD 4ZC3A 2RQQA 1VZ0A 3ZIAA 2VPLA 1D0YA 3D5RC 3W3CA 1FX0A 3KRGA 4OJ5A 4YXWA 1GQ8A 3VWBA 4XMYA 4ASUA 4Z03A 3KEWA 1K28D 4ZDOA 2KMUA 4ZDPA 5TGTA 3DPUA 4DGWB 3IUOA 3ZGKA 3OW7A 4AU7A 3T51B 3H35A 1Z3XA 4BJ5C 1Z7LA 2VXDA 1GLNA 3OYFA 3BC9A 2P0WA 2W7NA 4TKOB 2MD0A 5FRNA 3ZPPA 4IQ4A 3ZPNA 2IGMA 4W8RA 2A5WA 2BOLA 2CMPA 1T5EA 1XG2A 1D0ZA 3H5NA 3BC8A 2Y0SA 4OJOA 3U21A 3M1CA 1H8HA 2E5NA 3ZXSA 3L2UA 4ZYAA 2A6TA 4AVZA 3G2BA 2ZTGA 2VJJA 3OEEA 3DTKA 2QY1A 2ZZGA 1QCXA 2ZXIA 3OR1C 4XKCA 1V5GA 2NTPA 1ERDA 1MMDA 4XKBA 2GJKA 4PUSA 2L9SA 1WJBA 3VYTB 3VSLA 4BQQA 2LBFB 2W4SA 4XKWA 5HVQC 1DGWY 1NRKA 1V0FA 1W0JA 1CZFA 2NSTA 2X6XA 1EFRA 2I8DA 2O0WA 1IDKA 1H8EA 4HPQA 2GK6A 2MC4A 3I9V2 5JHFA 3HOSA 2V4DA 3KX2A 3HXLA 4DNRB 3VR6A 1NG6A 3K4NA 2Q2EB 1LKXA 2RREA 2IQ7A 3VMWA 2M7BA 2R9VA 1UELB 4PFOA 4C2TA 2QKMB 1DBOA 4E7ZA 3EPZA 4CCNA 1TZLA 3OYKA 2NT6A 1MMNA 1BR2A 2BVLA 1DBGA 3S3NA 2IGKA 4G7XA 1X19A 2CUJA 3OYMA 2XZOA 2Z8GA 4JQFA 3S32A 3DKXA 2O0VA 4KITB 3OOCA 3VSVA 2QX3A 4OJLA 4RLQA 2VBEA 3K4KA 2R7QA 3VSUA 1NG7A 2IXSA 4IZZA 2HPMA 1X1CA 2WAFA 1WJFA 3OYDA 2VJ5A 4DNTB 3PFYA 4NQWB 3T53B 2IGOA 2KRHA 2QKLB 4C9YA 4J01A 4D1QA 2JJ1A 4EW9A 3RPUD 1G59A 4XLFA 1PLUA 1QHGA 2VQGA 3DKYA 2AQEA 1LVKA 1WJEA 4NNJA 2JIZA 1BN8A 3PL8A 4BL0B 5KHDA 1H80A 1OOCA 2VL8A 3GBGA 3OAAA 4BUPA 1RU4A 2DT6A 3PSIA 2O04A 2KPMA 2XF7A 2UUZA 4HIZA 3AL0C 2R7TA 1SAUA 4CCOA 5HLTA 3OS1A 3OYGA 3IAM2 4CCJA 3OYIA 2CV2A 1WJ5A 2R7OA 1VJSA 4OZZA 2WPDA 1IRXA 5HNHA 3IP4B 2K9LA 3H9QA 1E79A 2LRDA 4II3A 2KLOA 2X85A 3K4CA 2XC7A 3LSGA 3AL0B 4E0FA 3OYNA 1OHHA 1IB4A 2BVMA 2OV7A 4OZYA 4PSWA 4URRA 4U49A 4Y33A 2HQAA 4U87A 3ZQQA 1D1AA 1MMGA 2LG4A 3CJRB 3OFNA 4B3FX 2VBKA 3FKSA 4MLOA 4HNTA 3A3GA 2NSPA 4HEA2 1KMHA 3SEQA 2JSPA 2LOOA 2ZSHB 2JVGA 4B47A 1UD5A 3EUAA 4BU2A 4Y4RA 4BE2A 2VXZA 3PSFA 1UD8A 1IDJA 1I8DA 4RM2A 3BCAA 3EUHC 4YRVA 3A3BA 3RTRA 2CFOA 4CCLA 3GQ9A 1HZEA 1R6RA 3JU4A 3EQOA 2HNHA 3LSMA 1MNEA 3S8PA 1DP3A 1W36D 2XSJC 4NK8A 4OJ6A 2Q1ZB 1IA5A 3DU6A 4BQNA 2ZXHA 1WPCA 4NUBA 4QPOA 5HNFA 3L2QA 3RSNA 3FHNA 3VYRB 1JTAA 2GOMA 1E3XA 1FMWA 2L7KA 3VSTA 1X1AA 2Z1DA 4F52A 1KZLA 4D9JA 4XR6A 3BG6A 3QYEA 2VASA 3HG9A 3RQ4A 3SZGA 4LIUA 3QYBA 1E1RA 2L2OA 2IS6A 2M4KA 3EUKL 3NWTA 1VLYA 4OJPA 3OEHA 2F5VA 5LFAA 3OYEA 3A2KA 3K4LA 4ZTJA 3NE5B 2M7AA 1PE9A 3FDYA 2E1MC 1WFXA 2L5QA 1BOBA 3OIQA 1N77A 2BSPA 3ZRGA 4I84A 4XN0A 4XONA 2PJRB 3DPTA 4F92B 1WJCA 2LREA 2W1OA 2UV1A 3K6GA 3MKWB 3MKYB 3DTIA 4BE1A 3BH4A 2QE7A 1N75A 1UG0A 1UD3A 4BQOA 1O8DA 3GQBA 4XQFA 4ZDLA 3DWLE 3VDXA 2X6YA 4IQJA 3S3OA 1ZELA 3LSIA 5DN6A 2XZPA 4F93B 2GK7A 2CV1A 3H9JA 1O8LA 2MFZA 3JURA 2XOKA 2PMZA 1QU3A 1G8XA 4QPQA 1MW7A 1K6YA 5HKKA 4Z05A 2INUA 3PNVA 2K9MA 2VJIA 1E1QA 2DXIA 2X1CA 2JA2A 3OYHA 1OFLA 4PJMA 1N78A 4YZXA 3QOEA 2V7FA 3MKZA 2K3PA 3LMWA 2LY1A 3OL3A 4GQNA 3OL4A 1KONA 4BDZA 2R7SA 1O8IA 2CUZA 2IS4A 2XNDA 3HOTA 4H4KC 4CCMA 1J09A 3BCBA 3HPHA 4CZCA 4BACA 4UZUA 2GOXB 2MABA 5CQEA 1O88A 2HPIA 4J00A 4MXNA 1BLIA 2EWEA 3FY3A 4X0GA 4Z06A 4ZJZA 4C2UA 2HVQA 2M4GA 2ZFUA 1VF7A 2HU9A 3UR3C 4RMNA 4CA0A 4PFPA 4IKFA 4KKUA 1OB0A 4HNUA 4NK6A 4YZAA 3DDYA 2F1MA 3LSKA 4PJLA 1U0JA 2KZVA 2WB1A 4OAYA 3B8YA 2R7UA 4LIVA 2HDWA 2OUMA 2E60A 1V5FA 4G6TB 2WBMA 4PJNA 4HWVA 1YX3A 3UW0A 2HVRA 2F43A 2V6EA 4G7WA 1HG8A 2VQCA 1HVXA 4B48A 4XLAA 3BCFA 3CESA 1NHCA 3TL4X 3LFUA 2ZZFA 4DOZA 2W6JA 4PMHA 3OYLA 2CV0A 2W00A 3GQ8A 4E7JA 4PSXA 3SDBA 2O1DA 2LC2A 4E4HA 3VMVA 5CQGA 3QYFA 4BJTA 3CF2A 4RM3A 4CCKA 2PYHA 2ODLA 3N05A 3PNYA 4KKTA 5CDFA 2K5CA 4E7HA 3OYBA 1QHHD 1OFMA 4XOTA 1Y56A 1S9HA 1YX5A 3DEEA 2VQLA 3J7AY 3GVKA 2WY7Q 1PJRA 2NTBA 3A35A 3K70D 1EA3A 4YELA 1P9QC 3ZR8X 2KVOA 4TSFA 1E3ZA 3OE7A 3IAS2 4DIQA 1BHEA 2WAEA 3AFHA 3GVJA 3DPLC 2Z6BD 1BMFA 3CJQB 1MABA 1OGOX 2DIEA 3OS0A 4DK1A 2W6IA 4XLHA 2WA0A 1MNDA 4E7SA 1RMGA 1UD2A 4B43A 2KP6A 5CPRB 4JMQA 2OC6A 4MR0A 2CK3A 2NZMA 3OY9A 4BGDA 4DJAA 2X6WA 2Z16A 2VKDA 4XL9A 1O8JA 4YZ0A 3CZ6A 4BE0A 3L2VA 4BDYA 3UNGC 3C2HA 2WZPP 4NC7A 1X1BA 1K5CA 4XN3A 4HG2A 3VYSB 1E0EA 1RWRA 2VIXA 3D5LA 3OYCA 5IK2A 3PJRA 1BPLA 1SFKA 2R7RA 3DTEA 2UVFA 1X1DA 4W8TA 2X51A 2ZZQA 3T56B 1AIRA 1WJAA 3M8JA 2QXZA 2LH9A 1DQUA 3HUGB 2R7WA 2VBMA 2F6CA 2VLAA 2DCEA 2ELJA 3CP2A 2WJVA 1OGMX 2CS3A 4DBRA 3FPPA 4E7IA 4N4NB 4F91B 3EQNA 1KCDA 1WMRA 3OOUA 3A1YA 2M5SA 2WADA 2KRCA 2NOJB 2RNGA 4HSRA 2GJPA 2CW8A 1EE6A 1O8EA 4E6KG 2IGNA 4E7LA 2XGJA 2CW7A 3PUBA 4KISA 4U4BA 2GJRA 5LD2C 1O8KA 3OS2A 2O17A 2CH0A 1O8MA 2UVEA 2IS2A 2DJIA 2XF5A 1HA8A 3BCDA 3I3LA 2XZLA 2W82A 1YE9A 2VB6A 4OWRB 2LYCA 4DBQA 4XNFA 2F4IA 4U7BA 2LZJA 4W8QA 3FBNB 3KEYA 4BEHA 4P22A 4XD7A 2BW3A 3DLAA 3LSHA 3WQZA 3H94A 1PYVA 3H9GA 4HSTA 1JI8A 4L8JA 2UWMA 2KHMA 4BS9A 1OLTA 5C1EA 2LY2A 3K4BA 3BLYA 3MMYB 4XLCA 5FL7A 3W2WA 2PJRA 1Y6IA 1WTHD 4FETA 4II2A 4GRIA 1UAAA 4B44A 2R4GA 3HKZA 3MD2A 2FUG2 3HAGA 2ZZEA 4BXFA 2R7XA 1JRGA 4C2LA 4KT6A 4F55A 3GRHA 3L2WA 3S93A 4W8SA 4C30A 3CP8A 1Z21A 2O5RA 1MMAA 4AYBA 3OIPA 2WSSA 4NC8A 4B3XA 3ONQA 1COWA 3TMOA 1X0CA 2JVHA 4LG3A 4JOMA 5KCMA 1WJDA 4ZTFA 3BG7A 4KKSA 4XLEA 1D1BA 4FXUA 2XDVA 1PKVA 2PYGA 1KCCA 4OAZA 4R79A 3ZSCA 3B90A 1OR7C 4B3GA 1DGRM 2X53S 5FROA 2M0MA 2HVSA 2HZDA 3FBIB 3HL2A 3DU5A 5KNLA 4IX7A 3SYTA 2X3HA 2V1NA 2ZTNA 3G05A 2KQRA 3C2GA 2D3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTP A;  1OGO X;  4OJP A;  4XLH A;  1CZF A;  4XKW A;  1PE9 A;  2NST A;  2X6X A;  2PEC A;  2O0W A;  1IDK A;  4Z03 A;  2BSP A;  1RMG A;  4I84 A;  4XN0 A;  4XON A;  3WWG A;  4MR0 A;  2NZM A;  4YZQ A;  1O8H A;  2IQ7 A;  2NTQ A;  2X6W A;  3VMW A;  4XL9 A;  1O8J A;  4YZ0 A;  3GQ7 A;  1DBO A;  4XOR A;  1O8D A;  4XQF A;  1K5C A;  4XN3 A;  2X6Y A;  2NT6 A;  1DBG A;  1RWR A;  5C1C A;  2Z8G A;  1O8L A;  3JUR A;  4XM3 A;  2UVF A;  4W8T A;  2O0V A;  4Z05 A;  2INU A;  1AIR A;  3VSV A;  2QXZ A;  2QX3 A;  2VJI A;  4OJL A;  2VBE A;  1OFL A;  2VBM A;  4YZX A;  3VSU A;  2INV A;  1OGM X;  3LMW A;  3EQN A;  1KCD A;  1WMR A;  5AMV A;  1O8I A;  1O8G A;  1EE6 A;  1O8E A;  1O88 A;  4EW9 A;  4XLF A;  1PLU A;  4MXN A;  2EWE A;  3FY3 A;  3SUC A;  4U4B A;  1BN8 A;  3T9G A;  1VBL A;  4Z06 A;  1OOC A;  1H80 A;  1O8K A;  2O17 A;  1RU4 A;  1O8M A;  2UVE A;  4YEJ A;  2O04 A;  1PXZ A;  4NK6 A;  4YZA A;  3GQA A;  1O8F A;  4XNF A;  3B8Y A;  4W8Q A;  1QJV A;  2NT9 A;  4OZZ A;  4XOP A;  3B4N A;  2X85 A;  5C1E A;  4HWV A;  1IB4 A;  3UW0 A;  4URR A;  4OZY A;  1KTW A;  4U49 A;  4XLC A;  2VBK A;  1HG8 A;  4XLA A;  1NHC A;  3KRG A;  4OJ5 A;  2NSP A;  4PMH A;  1GQ8 A;  4XMY A;  3GQ8 A;  1JRG A;  2O1D A;  4C2L A;  3GRH A;  3VMV A;  1IDJ A;  4W8S A;  2PYH A;  2ODL A;  3GQ9 A;  3ZPP A;  3EQO A;  1OFM A;  4W8R A;  4XOT A;  1X0C A;  4NK8 A;  1XG2 A;  4OJ6 A;  1IA5 A;  4OJO A;  2NTB A;  4XLE A;  2PYG A;  1KCC A;  4YEL A;  3ZSC A;  4AVZ A;  3B90 A;  1JTA A;  3VST A;  2VJJ A;  1BHE A;  2QY1 A;  4XR6 A;  1QCX A;  2X3H A;  4XKV A; 
#chains in the Genus database with same CATH topology
 3E97 A;  4E7K A;  4ZYE A;  3CF5 F;  4FCY A;  2VNI A;  4CUG A;  3LNN A;  5F27 A;  3HEF A;  4G6D A;  1E3P A;  4A3G J;  4X1E A;  4ZZD A;  1V54 H;  3F9K A;  1OGJ A;  3SLN A;  5IYR A;  3BQJ A;  3F8C A;  4TT3 A;  3J7Y J;  1VLO A;  1BR1 A;  3CCR B;  4DK0 A;  1BR4 A;  4PGG A;  4EAT A;  3CCM I;  5D6E A;  5H59 A;  3VNU A;  5DCM B;  2WY8 Q;  1BC8 C;  2NTQ A;  5BS6 A;  2E36 A;  3ZCO A;  1K8F A;  4P55 A;  5HOO A;  1TWA J;  1E2X A;  4KIB A;  3K10 A;  3TBI A;  1FNN A;  5J8F A;  3SYJ A;  2XV4 S;  4Y3O A;  4I09 A;  3OWT A;  1IN5 A;  3HTU A;  4M3E A;  2L9N A;  5BSY A;  4XM3 A;  1J75 A;  2A6H F;  4Z1M A;  2R5Y A;  2XTW A;  4Z2Y A;  4HRI A;  1QH0 A;  1BBY A;  3J7A O;  4RAG A;  2P81 A;  5FKN A;  1S72 I;  1DDI A;  2QQ8 A;  3M8E A;  2XIG A;  3IH3 A;  1NBM A;  5FD5 A;  3GZN B;  1AMO A;  4LFU A;  3E3V A;  3H92 A;  1JA0 A;  2VFQ A;  3DCF A;  3Q9V A;  1ODD A;  3QE2 A;  2X48 A;  5IYB J;  5LGN A;  2E71 A;  3A03 A;  4X0C A;  1VFC A;  3OMY A;  5FFX A;  3CLQ A;  1J7K A;  1V0E A;  4RD2 A;  2WC2 A;  3L2R A;  2XAJ A;  2MYS A;  2VZL A;  1T2K A;  3KP2 A;  1IN4 A;  3W2A A;  4B1R A;  4EM2 A;  2HLD A;  4WQM A;  3FIW A;  2BGC A;  2OA4 A;  3SQV A;  3OYA A;  2ZJQ F;  3K4J A;  4X06 A;  3CCJ B;  2PJP A;  5GAH J;  2BMW A;  4AIK A;  2DDB A;  3G73 A;  1R71 A;  1D1C A;  4BEH B;  2GWR A;  3KYL A;  3CPW B;  4KUM A;  1DDN A;  2ZKZ A;  5EJC A;  2FE3 A;  3AKZ A;  5IT9 Z;  3QOD A;  2D3L A;  1ZG3 A;  2LR8 A;  1OCT C;  3B4N A;  1MJA A;  4R1H A;  3WHC A;  3Q6Q A;  4X6A J;  1U9O A;  2HOS A;  2EIN H;  1A31 A;  4FAS D;  5CVV A;  1JHF A;  3V7C A;  2P6S A;  4WZT A;  1VZ0 A;  3ZIA A;  1I3A A;  3NQO A;  2ESN A;  2O7O A;  4BY1 J;  2VPL A;  3KRG A;  4OJ5 A;  2VFO A;  4XMY A;  5D8L B;  3QP5 A;  4IHT A;  3WE3 A;  3M7G A;  3V76 A;  1WPK A;  2VOO A;  4DGW B;  4HAM A;  2RKH A;  3IUO A;  2XGX A;  3ZGK A;  2PYH A;  1Z3X A;  2ESH A;  3EYY A;  1LJ9 A;  2QEX I;  4HQE A;  3ZPP A;  1N06 A;  2W7N A;  2MD0 A;  5FRN A;  3ZPN A;  2IGM A;  2WV1 A;  3FPK A;  4FTH A;  2QF7 A;  4Y7N J;  1T5E A;  2HOA A;  3H5N A;  1O3R A;  3BC8 A;  3M1C A;  4ZYA A;  3J80 K;  2CW5 A;  3GIR A;  1HSJ A;  2BHZ A;  2HKX A;  2A68 F;  3AGP A;  2HXI A;  3DKW A;  3OEE A;  3DTK A;  2ZME C;  3CQZ J;  4OOV A;  2H1L A;  3ML6 A;  1ZLK A;  1C0W A;  3K1M A;  2CQN A;  3M9A A;  4YII A;  2HXO A;  4Q5S F;  3MCA A;  2V5I A;  4KT5 C;  5IYW A;  1IN7 A;  1TQI A;  4XKB A;  1SVL A;  2JN6 A;  1ZYR F;  3ECH A;  1WJB A;  2E34 A;  3VSL A;  1BC7 C;  4LLN A;  1F20 A;  2LFB A;  3T8R A;  1V0F A;  1YJ9 B;  2HR3 A;  2NV4 A;  2NST A;  2X6X A;  4YAU A;  1IDY A;  1IDK A;  1H8E A;  2GK6 A;  4LBW A;  4S0H B;  2GA2 A;  1IV8 A;  5JHF A;  1FZP B;  3LOC A;  1CQX A;  1G3S A;  2V4D A;  3PET A;  2C5H A;  1ETO A;  1T56 A;  3HXL A;  3BJA A;  2K9N A;  4DNR B;  1NG6 A;  2JUC A;  5E6T A;  4IOC F;  2R9V A;  3BNW A;  4PFO A;  3ZZ0 A;  3HOX J;  5J8C A;  3FX3 A;  5EF6 A;  3IKT A;  1DBO A;  1FYK A;  1GVH A;  2CUF A;  2LD5 A;  2BGI A;  3LO8 A;  2NT6 A;  2M87 A;  3LAP A;  1BN5 A;  4NHJ A;  5B6I A;  2IGK A;  3V8J A;  2CUJ A;  3BY2 A;  4UAJ A;  1ETV A;  3BPV A;  3L1P A;  3GME A;  5HDG A;  4ZCI A;  3P5J A;  4KIT B;  3OOC A;  2O0V A;  2QX3 A;  4RLQ A;  2VBE A;  2K40 A;  4P26 A;  2R7Q A;  2FOW A;  3VSU A;  2XPU A;  2LSO A;  1JGS A;  4IZZ A;  3ZMZ A;  1H89 C;  2WAF A;  4NC6 A;  4EM1 A;  4ENJ A;  2WYR A;  4DNT B;  1STZ A;  2O6W A;  2JJ1 A;  4NBS A;  3I4N J;  1G59 A;  2A3S A;  1HKQ A;  3H3U A;  2IAI A;  1FP1 D;  4XLF A;  1MSE C;  1U5T C;  2DOG A;  2EIX A;  4PC1 A;  1PLU A;  2VQG A;  5F4O A;  4R71 A;  5AIQ A;  4NNJ A;  4KIF A;  1WHU A;  2JIZ A;  3FKI J;  4PAA A;  2EV0 A;  3PL8 A;  4P96 A;  5KHD A;  1DPU A;  1B9M A;  1IXS B;  1XE1 A;  1BJA A;  1IUF A;  3ZQL A;  1QFZ A;  3PSI A;  3T8T A;  2EFP A;  2XF7 A;  2UUZ A;  5F0H A;  4DNC A;  5IP9 J;  1FRQ A;  1QG0 A;  1QGZ A;  1SAU A;  2OK8 A;  4RBO A;  2RNJ A;  3MEX A;  1BW5 A;  4B4C A;  4Y9R A;  1MGT A;  2STW A;  1RPW A;  5EDN A;  3OYI A;  5CYV A;  4HX7 A;  1VJS A;  2RC5 A;  1EFT A;  2WPD A;  3H9Q A;  2LRD A;  1S72 B;  2KLO A;  3K4C A;  2DMU A;  4UVA A;  1B9N A;  2B7C A;  3DEW A;  3WGI A;  3OYN A;  1VHO A;  4X7C A;  2DK8 A;  3P26 A;  3HGY A;  1T0F A;  4I0B A;  2UXN A;  5GV8 A;  2DER A;  1IRG A;  1MMG A;  1V55 H;  1JJ6 C;  2OQG A;  3AG4 H;  3FKS A;  2VC1 A;  2R93 J;  3A3G A;  2V7W A;  4PGO A;  3I55 I;  1JNY A;  2F5F A;  2HQR A;  3SEQ A;  4ACB A;  4YDT A;  1SVM A;  4B47 A;  1OJL A;  3NEU A;  4L0Z B;  1UD5 A;  3EUA A;  4BU2 A;  3FM3 A;  4Y4R A;  2YR2 A;  3MCZ A;  1U78 A;  3BCA A;  3QOP A;  2HOE A;  4OIR F;  4YRV A;  3RTR A;  1FNC A;  1FIP A;  2HGC A;  4IJA A;  5DUI A;  3CCR I;  2WV0 A;  1T33 A;  3EQL F;  3S1N J;  4AID A;  3GTQ J;  1KTV A;  1KU2 A;  4NK8 A;  2Q1Z B;  4RCY A;  2ZXH A;  4QPO A;  1FLI A;  5HNF A;  4M3B A;  1TVC A;  5K5O A;  1FT9 A;  3KP3 A;  1PJ6 A;  3VYR B;  3JRE A;  1MMS A;  4J0Q A;  2KIM A;  2L7K A;  3A02 A;  1ON2 A;  3AG1 H;  2W48 A;  5F08 A;  3WNC A;  1WOO A;  4XR6 A;  3BG6 A;  3QYE A;  5DTD A;  3SZG A;  3RZO J;  4FE4 A;  2AS5 F;  2EFO A;  3QYB A;  4RAY A;  3WTU C;  2M1B A;  2L2O A;  3U1K A;  1NJI D;  1E62 A;  3OEH A;  2L7F P;  4U0W A;  4M53 A;  4F7Z A;  4A3D J;  5FGM A;  3JTH A;  3OYE A;  3A2K A;  2P5V A;  1G3T A;  1O7F A;  2FOK A;  2ZME B;  2QMU A;  5F4J A;  2H1K A;  3WGG A;  2DOF A;  5F0C A;  2H8R A;  1BOB A;  1XFO A;  4MIM A;  2KRF A;  2VT2 A;  4OIN F;  3ZRG A;  3ZN0 A;  5JLW A;  3HRS A;  3P27 A;  4DQ2 A;  1OCZ H;  3QRF F;  3LFK A;  3TH0 A;  2K86 A;  2LRE A;  2UV1 A;  1ZRF A;  3JRD A;  2QE7 A;  3BG5 A;  1UD3 A;  2B0L A;  2QLZ A;  2RC4 A;  4A5N A;  1JKP C;  1POG A;  4ZDL A;  5D5U B;  2FEZ A;  2DW4 A;  2OTJ B;  3LSI A;  4XSZ F;  2F4N A;  4F93 B;  3G1M A;  3QPL A;  2GK7 A;  3W5U A;  1O8L A;  3E6B A;  1OGI A;  2HTS A;  4A3K J;  2PMZ A;  1SD6 A;  3N4M A;  2XOK A;  1M1K D;  1D3Y A;  5HKK A;  2PN6 A;  3VEP A;  3HJE A;  2DXI A;  3OYH A;  2JA2 A;  2GZW A;  5EGO B;  1MDM B;  5J6X A;  4I02 A;  4PJM A;  5C4X J;  2QDX A;  4N3N A;  1TNS A;  4I76 A;  3MKZ A;  2HOT A;  3OL4 A;  1VQN I;  1QUE A;  2JPC A;  3ZQF A;  1E64 A;  3P9C A;  2P3M A;  5F4M A;  1B1B A;  4RD6 A;  4CCM A;  2H6B A;  3CC7 I;  2BXY A;  2GOX B;  4AF7 A;  3BTL A;  1OR7 A;  1Z7U A;  1YJ9 I;  3P9I A;  1K61 A;  4X0G A;  1N0U A;  1VTN C;  4GDF A;  5D8K B;  1XMK A;  2M4G A;  4MO7 A;  2HU9 A;  3UR3 C;  1CNE A;  2A69 F;  4BQA A;  1W1W E;  1WDT A;  4IHV A;  4TMV A;  2XRL A;  4M2L A;  5GP9 A;  3BR3 A;  3GUD A;  1OB0 A;  4YHB A;  5IYN A;  4HNU A;  4UUT A;  2E2I J;  3DDY A;  4L5E A;  3OIO A;  2Q8K A;  4FK8 A;  2HDW A;  2OUM A;  1IXR C;  4YFX F;  2EPF A;  4EVI A;  1AHD P;  3GLX A;  5HZB A;  1P6R A;  3KPH A;  1JKO C;  1R23 A;  4PJN A;  2D1H A;  2BPO A;  4OP7 A;  2UXX A;  4CYC B;  2VQC A;  3QFR A;  2QEX B;  1N8R D;  3BT9 A;  4WF2 A;  3ESW B;  1NHC A;  2JSC A;  4DOZ A;  2DA5 A;  2W6J A;  3WXM A;  2MGQ A;  3KIO A;  1RC9 A;  2TDX A;  1NTC A;  2MH2 A;  2YU3 A;  1PDN C;  3GQ8 A;  4C3J J;  4E7J A;  9ANT A;  1KK1 A;  4RB1 A;  5FKK A;  3SDB A;  1ZRD A;  3I71 A;  3HHG A;  2LC2 A;  4ZYD A;  1FYM A;  3I64 A;  2LDU A;  1YW9 A;  4HX8 A;  4OOS A;  2C4T A;  4CCK A;  1FDR A;  2GPJ A;  4IXA A;  3N05 A;  1S7E A;  5L3F A;  2X4H A;  2QA4 B;  5DM7 F;  2OU2 A;  3LQR A;  3OYB A;  1FSH A;  1U6G A;  1YX5 A;  3DEE A;  1FC3 A;  1XGM A;  3BZ6 A;  4EJV A;  4L9T A;  3J7A Y;  3GVK A;  4XRF A;  1VQP B;  1ONV A;  1Y8R B;  4AWX B;  5JHU A;  4TN1 A;  1DAB A;  2J5P A;  2LF7 A;  5ICE A;  4E70 A;  3ERE D;  1KA8 A;  4NQW A;  5FLV A;  1E3Z A;  3OE7 A;  3IAS 2;  2MSY A;  2WAE A;  3CCJ I;  1D8T A;  3AFH A;  3GVJ A;  1KU3 A;  3Q5F A;  2VNK A;  2ZIT A;  3MWM A;  2ZFW A;  3CJQ B;  1F4K A;  1XSV A;  1OGO X;  3HOV J;  2DN0 A;  3RYR A;  2DCU A;  1FBS A;  1I50 J;  3ZQI A;  3OS0 A;  2W6I A;  4DK1 A;  3B02 A;  1K6O A;  1RZ4 A;  2B5O A;  3CPX A;  1G2H A;  1MND A;  1UD2 A;  1S4M A;  2COM A;  4MR0 A;  3FXU A;  5FIU A;  3U6B A;  2PG4 A;  1O8J A;  4Q48 A;  3CZ6 A;  1E17 A;  4OPW A;  4BDY A;  2DU9 A;  2K4J A;  3RPU A;  1VQ5 I;  3C2H A;  4MNU A;  4RD4 A;  3T51 B;  3G1L A;  4BY7 J;  2XKP A;  1FND A;  5L3C A;  5IK2 A;  1BPL A;  1WSR A;  4TMW A;  2X51 A;  1SAN A;  4M73 A;  4NB5 A;  3T56 B;  1MD0 A;  3M8J A;  3JRC A;  1F60 A;  3K1P A;  4HBL A;  4H9G A;  4BYY A;  3TOB A;  2R7W A;  1R4N B;  1PUE E;  1R5B A;  5JMC B;  3B8H A;  5IYC J;  2HYG D;  5J1Y A;  3WBJ A;  3T5X A;  4F91 B;  3EQN A;  1KCD A;  5M5Y J;  3KP6 A;  1W35 A;  1MBK A;  4CXF A;  2DEU A;  3CCM B;  1J5Y A;  2WAD A;  4HSR A;  2CW8 A;  3BR6 A;  5J3L A;  5TV2 A;  1Z77 A;  5CLS A;  5F1R A;  4QVA A;  4KMU X;  4U4B A;  1X2N A;  3TW7 A;  2RC6 A;  1QA2 A;  3BR1 A;  1IN8 A;  5D5X B;  2UVE A;  2E35 A;  2ICW G;  2XF5 A;  2WTE A;  3V8L A;  3WNB A;  1KYZ A;  1S7A A;  3I3L A;  1WKM A;  4XLN F;  2G0Y A;  2XC1 A;  1MBH A;  2LY9 A;  3S14 J;  2V79 A;  2VB6 A;  5E8I A;  1IGN A;  3PSS A;  2QYO A;  1EH7 A;  2L7M P;  4N9H A;  4DBQ A;  2F4I A;  1YRN A;  4W8Q A;  2H09 A;  2C78 A;  2NVU B;  3PEN A;  5H20 A;  4N3G A;  1ZGA A;  3H94 A;  1KQ0 A;  2BZT A;  5GTI C;  1IXC A;  1ZR4 A;  4KYW A;  2L9R A;  1YI2 I;  2UWM A;  2AHO A;  1WQ2 A;  3HDD A;  2XB5 A;  1VQ4 I;  1W34 A;  1OIS A;  1TQM A;  1S5L C;  1Y6I A;  3SKB A;  2P8T A;  2QEN A;  4FQG A;  1W4M A;  2C6Y A;  4Z4S A;  1T6Z A;  1EP2 B;  4W97 A;  1ETX A;  2A61 A;  3G1O A;  1UAA A;  1VQO B;  4GYI A;  1YHQ I;  1XX5 A;  3BRO A;  1UB9 A;  2ZZE A;  1RKT A;  4C2L A;  1RI7 A;  2HKO A;  4HYE A;  1Y0R A;  3L2W A;  2ZL6 A;  3N90 A;  1W7P A;  3B73 A;  1ETQ A;  4WWV A;  2D2W A;  2O5R A;  4NC8 A;  4B3X A;  1XMX A;  3JSP A;  1IRF A;  1MBG A;  2XUB A;  4UV9 A;  2O8K A;  4KKS A;  4XLE A;  3PIO F;  1G3W A;  2XDV A;  5B66 C;  3S17 J;  3QWL A;  1EXM A;  4CQJ A;  2ZJ2 A;  3B90 A;  3GTK J;  4WX9 A;  4I6Z A;  2M0M A;  5DD4 A;  5FJ8 J;  1H8A C;  2JA8 J;  1F1Z A;  3DV8 A;  1IUY A;  2KQR A;  1EFR A;  2R3S A;  2NNN A;  3U2Q A;  1OQY A;  1K8A D;  3RYP A;  1ZM9 A;  2AXT C;  1ZG1 A;  1YLO A;  5GPC A;  1CNF A;  2NPF A;  1BQE A;  1PUF B;  5EMN A;  1FPQ A;  2LBF A;  4HX4 A;  3FK7 A;  2AQF A;  5FO0 A;  3WWG A;  3BZK A;  1P4W A;  2M5W A;  1D1N A;  1B6A A;  4RS8 A;  1PVE A;  1YOV B;  3WTS C;  1AA7 A;  3CB4 A;  3OPO A;  4RLF A;  1FBU A;  2VFM A;  2GM4 A;  5H6Q A;  4EJW A;  4PC3 A;  2OF7 A;  3GW2 A;  2XAU A;  3VYU B;  3ISX A;  4UNO A;  1MIJ A;  1E43 A;  3GVL A;  2YSR A;  1ZK8 A;  2R7F A;  1I1G A;  4QIW N;  5K1Y A;  3CO7 C;  2ZSI B;  2VKV A;  1QVF B;  1L0O C;  2XF6 A;  1H88 C;  2DOA A;  4ITV A;  1VQL I;  3HIF A;  5D4S A;  3BG9 A;  1FOW A;  1QQ1 A;  3V8K A;  2R7V A;  3CCU B;  2NVQ J;  4RCZ A;  3HPG A;  3PO2 J;  1UCR A;  1U5T B;  3HUG A;  4F3Q A;  1FBQ A;  2E1M B;  4A3M J;  2XGE A;  5FFZ A;  3BTI A;  4HDU A;  4IHS A;  5E3O A;  5FRM A;  3FKJ A;  1HF0 A;  4YAO A;  2YX4 A;  2PLY A;  2YUS A;  2TCT A;  3V7A A;  3TW6 A;  1W5C C;  1TSP A;  3WTY C;  1K4S A;  2FX3 A;  3PIP F;  5JR3 A;  1JGG A;  3T9G A;  4N4O B;  4HF0 A;  3AST A;  4X07 A;  3A4C A;  4S04 A;  1YYV A;  4BXX J;  1VBL A;  4IRI A;  1SKY B;  5IP6 A;  4OMY A;  3ASN H;  1SAX A;  2RN7 A;  4YEJ A;  4JBA A;  4KMF A;  2X8K A;  4D5F A;  3CC2 B;  3GX4 X;  3NWS A;  3CCS I;  1LDK B;  2WAQ N;  3HC7 A;  2DMP A;  3A0H C;  1PXZ A;  3ECO A;  3GZ5 A;  3HGG A;  3LSR A;  3D5S C;  3BJO A;  5JLX A;  1G4D A;  4A93 J;  2B7B A;  3H3V K;  2BN4 A;  2XAH A;  1QJV A;  3GO5 A;  4PGH A;  4JP0 A;  4XOP A;  4P5O A;  1MNM C;  3A1P A;  3W2V A;  3W2I A;  1X4O A;  3PNT A;  3PUN A;  2Y75 A;  4KJZ A;  2D5V A;  3CMM A;  2BV6 A;  3ASR A;  4ON0 A;  4D7M A;  3SLD A;  2DA3 A;  2CF4 A;  4JX6 A;  1OMI A;  3E6M A;  3E5U A;  1D8K A;  4I0A A;  1T38 A;  3WY9 A;  2Z5U A;  4HQM A;  4YXW A;  3HM5 A;  3VWB A;  1FX7 A;  3KEO A;  4UUS B;  3J81 Z;  4ASU A;  2IA1 A;  1RET A;  1K28 D;  2ELK A;  4ZDO A;  1IW7 F;  3DPU A;  2DJN A;  5TGT A;  1Q82 D;  4JK1 X;  2QQA A;  4G7O F;  2BSA A;  3OW7 A;  3CCL I;  3B78 A;  1Z7L A;  2EV6 A;  2M8G X;  4TKO B;  4YCQ A;  4LB5 A;  1TBX A;  4IQ4 A;  4V02 C;  4W8R A;  2BOL A;  2CMP A;  3K2A A;  1FP2 A;  4XSX F;  4CDG A;  1XD7 A;  1XG2 A;  1D0Z A;  3EDP A;  2XVC A;  4RB3 C;  2VKE A;  3FHZ A;  3ZXS A;  1FTZ A;  2VNH A;  3KZZ A;  4QSH A;  3M3Y J;  1FNB A;  1KK0 A;  4OPV A;  4AVZ A;  1VQ5 B;  2ZNY A;  4HV5 A;  2A6E F;  2LTP A;  3G2B A;  3NAR A;  2Y0M A;  3M4O J;  2QY1 A;  2ZZG A;  3J7Z I;  3CUQ B;  3OR1 C;  3LYC A;  4XKC A;  3CC4 I;  3IRQ A;  1DAR A;  3WTZ A;  2QZA A;  4LC0 A;  3ASQ A;  5HDK A;  4ACA A;  1MMD A;  3JRH A;  3BDD A;  4PUS A;  3VYT B;  3GTL J;  1NRK A;  1FEX A;  2L02 A;  2O8X A;  2QSF X;  4XKW A;  2LBF B;  2B0R A;  4KH3 A;  3DXJ F;  1SFE A;  2DFH A;  2I8D A;  1JXS A;  2DBB A;  3I9V 2;  4LD5 A;  3W6J B;  4GFB A;  3PUF A;  4B8X A;  5IYP A;  1EH6 A;  3I56 B;  4UV8 A;  1XTA A;  1JKQ C;  2K27 A;  3EYI A;  1Y0N A;  1UEL B;  2K9Q A;  4KIC A;  1TL8 A;  2FX0 A;  4A69 C;  1MBE A;  3EPZ A;  4J19 A;  4CCN A;  3BR5 A;  2BM5 A;  1GAW A;  3NAU A;  3W5V A;  1DBG A;  5HDN A;  1MBJ A;  3E1Y E;  2Z8G A;  3OYM A;  3G6E B;  4JQF A;  5JLV C;  1TWC J;  4ESJ A;  1KZH A;  3S32 A;  5M5W J;  2KIQ A;  4FIS A;  2BM1 A;  4KN7 X;  1N07 A;  4ROX A;  3K4K A;  4M0L A;  2V1U A;  3ZC3 A;  1PP7 U;  1F36 A;  1NG7 A;  2E1N A;  3BP8 A;  2HPM A;  3D1N I;  3JX8 A;  5H6R A;  4CO8 A;  3PFY A;  1QZZ A;  4NQW B;  2IGO A;  1XPX A;  3ZN1 A;  3DP7 A;  4C9Y A;  4J01 A;  5IT9 K;  4EW9 A;  3GTP J;  4FE7 A;  3QSY A;  1QHG A;  4ENN A;  3FMQ A;  2X6O A;  5GAG J;  4LG0 B;  5E3M A;  2W25 A;  4L9V A;  2EIM H;  3GBG A;  3L7W A;  5DCF A;  4LLL A;  3VOE A;  3SFI A;  3PVD A;  2O04 A;  3CD6 I;  2R7T A;  3H3Z A;  1HW1 A;  2VFN A;  3MN2 A;  3IAM 2;  1YJW I;  2CO5 A;  3O8G A;  2XTX A;  4CCJ A;  3HTS B;  3FXM A;  4LLG F;  3OV8 A;  4EEF G;  3VFZ A;  3WHB A;  3ZQ7 A;  3DF8 A;  1E79 A;  4LK1 F;  2A5Y B;  2CQK A;  1FSE A;  4JX5 A;  2IP2 A;  2OV7 A;  3JRA A;  3A0B C;  4PSW A;  4A3E J;  3P7N A;  2HQA A;  1BI2 A;  4U49 A;  2CG4 A;  2VBK A;  3CJR B;  3OFN A;  4B3F X;  1H0M A;  4KNY A;  4D5C A;  1ELO A;  2Y9Z A;  4A3C J;  2IA2 A;  3CC7 B;  2LKS A;  5E8G A;  2CWE A;  4MHG A;  3I1F A;  5D5W B;  1KU9 A;  2CQ7 A;  3CTA A;  4Z4T A;  1WOP A;  1ETY A;  1UMQ A;  3CUO A;  3QPT A;  3E5Q A;  1KMH A;  5ILU A;  1U3E M;  2ZSH B;  2VXZ A;  2HCJ B;  1I8D A;  1X58 A;  4RJL A;  4RM2 A;  3EUH C;  3BQY A;  1UZC A;  2Y2Z A;  3WE2 A;  4AIH A;  4CCL A;  3SDG A;  5ICC A;  3A3B A;  1R6R A;  3JU4 A;  1YIJ B;  3EQO A;  4M6V A;  2VT3 A;  3MVP A;  1MNE A;  1MBF A;  1DP3 A;  2B63 J;  1W36 D;  2VBX A;  2XSJ C;  1DG1 G;  4OOX A;  3E6C C;  3DU6 A;  3KZY A;  2ZBV A;  3DBL B;  4NUB A;  5J4Y A;  2G9W A;  5K5R A;  3OSG A;  4QUZ A;  2Z3Y A;  4O6J A;  2E1C A;  3L2Q A;  4A12 A;  1LFB A;  1RRJ A;  1NB0 A;  2GOM A;  1E3X A;  3VST A;  3COA C;  2E1R A;  1X1A A;  4F52 A;  2Q6L A;  3FXO A;  4U88 A;  5C4J J;  3F8B A;  2Y30 A;  3NWT A;  1SC7 A;  1I27 A;  1X3Z B;  4P9U A;  5TRD A;  4KFC A;  4OJP A;  3AVV A;  2BY2 A;  5J4V A;  5LFA A;  4IOA F;  1IHM A;  3NE5 B;  2M7A A;  3DBR B;  2E7X A;  1MKM A;  3WG9 A;  1GVJ A;  2PX9 A;  3PM1 A;  3B82 A;  2IEK A;  4I84 A;  4XN0 A;  2PJR B;  4F92 B;  1T39 A;  5DNS A;  2V6C A;  4WCG A;  3KEQ A;  3MKY B;  1EV7 A;  5F0F A;  2NNY A;  2K7L A;  2HWV A;  2QGG A;  3DTI A;  3GFL A;  3BH4 A;  2H94 A;  1UG0 A;  2XPW A;  3RKQ A;  4QV2 A;  3QU3 A;  1O8D A;  3GQB A;  3DWL E;  2DA1 A;  3CMY A;  2R92 J;  1HXD A;  2P5L C;  3K0L A;  1ZEL A;  3KET A;  5DN6 A;  2RVC A;  5HXB A;  4G7Z F;  2D9R A;  1XN7 A;  3JUR A;  1SD4 A;  3H0G J;  1G8X A;  5HOD A;  2O9L A;  2CSO A;  4UHT A;  4EQQ A;  1ZAR A;  1LDJ A;  2K9M A;  3PO3 J;  1E1Q A;  3A01 B;  2IBD A;  3ZQG A;  1N78 A;  4B3A A;  3ZBT A;  2V7F A;  2OJE D;  3OL3 A;  4ZZL A;  2DK5 A;  1N05 A;  2JZY A;  2R7S A;  1VQ9 B;  2NVY J;  3TKY A;  2CUZ A;  3BCB A;  4BAC A;  3HPH A;  4UZU A;  3S1M J;  2MLG A;  5CQE A;  3WTX C;  2DQL A;  1GXQ A;  2HPI A;  3JSO A;  2RV8 A;  4J00 A;  2L9V A;  1SMT A;  3IHU A;  2FA5 A;  2I10 A;  4Z06 A;  2HYJ A;  4M9X A;  2HVQ A;  1TWH J;  4I7H A;  1VF7 A;  4RMN A;  2XAS A;  4PFP A;  3F6V A;  2FXA A;  2M0C A;  1EF4 A;  3JR9 A;  1XS9 A;  1QVG B;  1TLL A;  1OCC H;  5DM6 F;  4OPO A;  1U2W A;  4NK6 A;  4YZA A;  2R5Z A;  3LSK A;  2Z33 A;  2CU7 A;  1A35 A;  2KZV A;  4UB6 C;  4OAY A;  1TYW A;  3B8Y A;  4LIV A;  3IWZ A;  3T0Y A;  3BH6 B;  3BR0 A;  2IPQ X;  2WBM A;  3CCY A;  1YX3 A;  4YAF A;  2V6E A;  2ZC2 A;  1Z05 A;  3IH4 A;  1AOY A;  4HLY A;  1HVX A;  1ZM3 A;  2QVO A;  4XLA A;  2Z99 A;  5E17 F;  3HOW J;  3CES A;  2FBK A;  3BCF A;  1WH7 A;  3LFU A;  2ZZF A;  4CYC A;  3WTT C;  1WI9 A;  3LST A;  4U7D A;  2CV0 A;  3PQK A;  3K2Z A;  2O03 A;  1LLZ A;  4L9N A;  1R4M B;  3Q39 A;  2W57 A;  3L9F A;  1P7J A;  1X1P A;  1TWF J;  2K02 A;  4PSX A;  1TC3 C;  3IH2 A;  4E4H A;  1SFX A;  3KCC A;  2RAE A;  3HZJ A;  3ISP A;  4GO1 A;  2ZL5 A;  5EYR A;  3RI4 A;  4QHY A;  3VMV A;  3O2P E;  3ZZU A;  4ZGQ B;  4KKT A;  4RGU A;  2PMH A;  1CGP A;  2OK7 A;  2CBX A;  5CDF A;  4G1V A;  1KQ9 A;  1Q1V A;  1QHH D;  4XOT A;  1FNM A;  2H8W A;  2VQL A;  2G7U A;  1WH5 A;  1P4X A;  4G6Q A;  1KYW A;  2NTB A;  4A3L J;  2W24 A;  1YLF A;  4HLX A;  4Q47 A;  4UZF A;  3QAH A;  1P9Q C;  2JRT A;  5JBQ A;  4LK0 F;  1QA6 A;  1TYX A;  4UXN A;  4ETS A;  4XLP F;  1Z1D A;  1DDG A;  1BMF A;  1K7A A;  2B7E A;  1S8N A;  1MAB A;  1GO2 A;  2DIE A;  5LRR A;  1T98 A;  4XLH A;  4M6X A;  1DPR A;  1YW8 A;  1FWZ A;  5LHI A;  2QBY B;  4B09 A;  2WA0 A;  3JQP A;  2DT5 A;  3BG3 A;  4E7S A;  5JFR A;  3QFS A;  5ICF A;  2KP6 A;  3KLO A;  5B5E C;  4JMQ A;  1BJK A;  2XEX A;  1HDP A;  4WXC A;  1I1S A;  1FY7 A;  3HB9 A;  2PMU A;  5LHH A;  2X6W A;  3FMS A;  1SMY F;  3GVA A;  2FQ3 A;  2Z16 A;  3GEZ A;  4XL9 A;  1XB4 A;  4IEJ A;  3H1C A;  2V7X A;  2DOE A;  4YZ0 A;  4IO9 F;  3IC7 A;  1PJ7 A;  2WZP P;  3K69 A;  4XN3 A;  2DMT A;  1V3F A;  3AAF A;  4M74 A;  3EET A;  3D5L A;  3OYC A;  1TW3 A;  4G8X A;  1BOA A;  3SHF A;  1HLV A;  2UVF A;  1IC8 A;  3ABM H;  1X1D A;  4W8T A;  1AIR A;  1REP C;  3TO7 A;  2QXZ A;  4HE5 A;  1VQ7 I;  1NB9 A;  3CP2 A;  1T08 B;  2EIJ H;  2GXG A;  2EZH A;  1OGM X;  3O3K A;  3TDZ C;  4DBR A;  1YFH A;  4LOC A;  3I0T A;  4N4N B;  2P7C B;  2ZCW A;  3OOU A;  3M8F A;  4OOI A;  1SD7 A;  3BPX A;  5IYD J;  2KRC A;  1O8E A;  2M8E A;  3PQJ A;  4LG0 A;  2QM3 A;  3SJP A;  4P6Y A;  4E6K G;  4E7L A;  2XGJ A;  4V2G A;  4UZE A;  4C43 A;  3W2H A;  3KP4 A;  4KIS A;  4MGR A;  4A0X A;  4FHT A;  1KJZ A;  4BXU A;  1XGO A;  5D6F A;  2Q6K A;  1R5I D;  3OS2 A;  2O3F A;  3BJ6 A;  1ZG5 A;  2DA2 A;  3F21 A;  1HA8 A;  1LQ1 A;  3BCD A;  2W82 A;  3KZI C;  4FX0 A;  1YRN B;  1GV2 A;  2VBT A;  1XGS A;  2EWN A;  1ZTR A;  2K4B A;  5K7F A;  1VQ8 I;  5ILS A;  1P4M A;  5DSZ A;  4OWR B;  2LYC A;  3P4G A;  4U7B A;  2DI3 A;  4RAZ A;  3WTW C;  3DLA A;  3LSH A;  1B59 A;  3ZMV A;  1PYV A;  3V7S A;  4HST A;  4WZL A;  1R58 A;  3WQZ A;  1I6X A;  1LEA A;  1OLT A;  5C1E A;  3BLY A;  1A5J A;  3MMY B;  1AKH B;  4IW3 B;  2JWT A;  3GCM A;  1R00 A;  3PA2 A;  1B23 P;  5DCM A;  4BAY A;  4M3D A;  4GRI A;  1XCV A;  3F72 A;  2LF8 A;  5F64 A;  5AON A;  1YJW B;  2FUG 2;  3C7J A;  4BXF A;  2R7X A;  3JCU C;  3F22 A;  2FNA A;  1I7P A;  4W8S A;  3A8J A;  4EMS A;  3CP8 A;  1Z21 A;  3ABL H;  4L18 B;  4P1V A;  3ZQH A;  1MMA A;  4CYD A;  1VQK I;  2WSS A;  3GTO J;  1R9T J;  3ONQ A;  3Q0W A;  5LGU A;  5FLX Z;  1F43 A;  2F5D A;  4ZTF A;  2PE3 A;  4V19 K;  1L1I A;  5CVU A;  1HKS A;  3VOD A;  1PKV A;  2OAZ A;  1K78 A;  5FRO A;  2FRH A;  3LNQ A;  1MH3 A;  5KK1 A;  3IV5 A;  3DU5 A;  2YWE A;  2J7K A;  5KNL A;  4XID A;  3SYT A;  2X3H A;  3BY1 A;  1GV5 A;  3HSE A;  2D3N A;  5L3G A;  3RKX A;  3FJO A;  3E1S A;  3G4S I;  1W0K A;  4X8I A;  2XRN A;  5A8A A;  3K4M A;  1TTY A;  3VSK A;  3S2W A;  2OBP A;  4PJJ A;  2KL4 A;  5LBQ A;  2PEC A;  5CKT A;  5TY0 A;  5HS7 A;  1W36 C;  3GTM J;  2Z2S B;  1W0T A;  1W9X A;  1WU8 A;  1QRY A;  3SEZ A;  2R0Q C;  1B8I B;  5IOY A;  5K5Q A;  3EUH A;  2MA3 A;  1GVD A;  3TP3 A;  3Q6R A;  5BMZ A;  3CCQ B;  1X2M A;  3LL7 A;  2FF4 A;  1T0F C;  1R49 A;  5M3F J;  3JAM K;  4LIT A;  5F6F A;  1QFJ A;  2WAQ A;  3R0A A;  2EA4 A;  3H5R A;  1E63 A;  2NXN B;  5E20 A;  2BVN A;  2XSD C;  2Q6I A;  4P1W A;  5C1C A;  1RR8 C;  1LNW A;  2EA2 A;  3I59 B;  2QQ9 A;  1K79 A;  3OR2 C;  2WZN A;  1TTT A;  3FXJ A;  4EJU A;  2BW3 B;  3HBL A;  3HSF A;  1P92 A;  2JQ7 A;  2B9S A;  1V5E A;  1F9N A;  2GRE A;  4IRG A;  2PLF A;  2JJ2 A;  2INV A;  4X7D A;  1MH4 A;  3ZMS A;  5AMV A;  1WP6 A;  2E5Z A;  4G6I A;  1EFC A;  1O8G A;  5BPD A;  5EG0 A;  2LP0 A;  3DQV C;  1V4R A;  5K7H A;  1JJ8 C;  2XT2 A;  5J1R A;  2IS1 A;  1UD6 A;  1I18 A;  1I3Q J;  4RGS A;  2QZ8 A;  2JA5 J;  6PAX A;  2M3A A;  3SUC A;  1IAW A;  4IPA A;  1TT0 A;  1SKQ A;  4YG2 F;  5TR9 A;  2V26 A;  5FKM A;  4A3F J;  5L46 A;  1QZE A;  5FO5 A;  5KAF C;  2LVS A;  2ZXW H;  1UHM A;  2NS0 A;  5FKL A;  3RJP A;  3CUQ C;  3F23 A;  3IKV A;  1VQM B;  2V9K A;  3RIR A;  3K70 C;  2QSH X;  3LMM A;  1EP1 B;  1Z3Y A;  4YIR X;  1O3T A;  4RA2 A;  3JTG A;  2NT9 A;  5CVJ A;  2FJ1 A;  4I99 C;  1D0X A;  3F6O A;  1LFP A;  3TO9 A;  1AWC A;  1USS A;  4RM0 A;  4A6D A;  4A3I J;  2V9P A;  1Q86 D;  3E20 A;  4M3F A;  2OBS A;  2YPR A;  2AO9 A;  4ZCM A;  3QU6 A;  1CF7 B;  2RQQ A;  1UJ8 A;  5AIP A;  5EZH A;  4EJO A;  1D0Y A;  3W3C A;  1FX0 A;  1ZUN B;  4P25 A;  2XRO A;  5KW9 A;  2DAO A;  3H9N A;  2E19 A;  2NVT J;  1VQ6 I;  1A6Q A;  2AXL A;  2KMU A;  4HF1 A;  1TYU A;  3WND A;  1OFD A;  2DA4 A;  3LJY A;  1G7S A;  3CCS B;  4AU7 A;  5F04 A;  3H35 A;  2GQF A;  3JQQ A;  2P5K A;  2L0K A;  2VXD A;  3OYF A;  1GLN A;  3BC9 A;  1J2X A;  1P4A A;  5FB2 A;  4DQK A;  3Q3S A;  2JK3 A;  3ONY A;  5CVI A;  2DA7 A;  3ZMD A;  2YWH A;  2R7D A;  4HDV A;  1BI3 A;  3FIS A;  1S6L A;  3E6D A;  4G9Y A;  4JYK A;  4QVJ A;  1OFE A;  4Z4V A;  1JTY A;  1OCP A;  2L3D A;  2NYX A;  3KFW X;  2WWY A;  4S05 A;  3CCV B;  2A6T A;  1FYL A;  4RD3 A;  1UHS A;  4IRH A;  1IO2 A;  3WU0 A;  3CDH A;  1QVU A;  1TNT A;  2R5Z B;  3PA1 A;  1WWX A;  1QCX A;  3W6K B;  5GV7 A;  1QA1 A;  2D1V A;  4ESB A;  1VF9 A;  1RES A;  2EIK H;  3M1E A;  4IL6 C;  1ZQ3 P;  3CCU I;  3CUQ A;  1JTX A;  2L9S A;  2OCE A;  5HVQ C;  4BQQ A;  1KQ8 A;  2JN9 A;  3ABU A;  1DGW Y;  1W0J A;  3CDI A;  1R1U A;  3OZV A;  4YAL A;  3HRM A;  5LEJ A;  2W84 A;  1SFU A;  1K83 J;  1I39 A;  3KX2 A;  1Q9S A;  2ME6 A;  5LGT A;  4EV0 A;  3VR6 A;  3K4N A;  2IQ7 A;  2Q2E B;  4YC5 A;  2RRE A;  1G7T A;  3OZW A;  1QGY A;  1KGS A;  1XQB A;  3VMW A;  1GT0 C;  1BW6 A;  4PAB A;  4C2T A;  2QKM B;  4E7Z A;  1QQI A;  5E18 F;  5DS9 A;  1T6S A;  2F5C A;  1BR2 A;  2BVL A;  2RDP A;  3R0J A;  3S3N A;  1ZM2 A;  1X19 A;  5FO1 A;  1IG7 A;  2BM0 A;  3DU1 X;  1VHE A;  2KFD A;  3PSZ A;  3DKX A;  1EWY A;  2AHQ A;  3VSV A;  4OJL A;  1LPQ A;  1YO5 C;  5A88 A;  4OIO F;  3CME B;  2MC3 A;  4JX4 A;  2FSW A;  5C44 J;  1WJF A;  3R4K A;  3DLL F;  2VJ5 A;  1EJ9 A;  3T53 B;  4CGZ A;  2QKL B;  5J1U A;  3O8H A;  4PZJ A;  3RPU D;  1U8R A;  5ILV A;  4NCN A;  2ZBU A;  1BI0 A;  2A07 F;  5J40 A;  3DKY A;  2AQE A;  2XAQ A;  1WJE A;  2COB A;  4R8H A;  1GHC A;  4BL0 B;  2DPU A;  1UMK A;  2DYS H;  4BNC A;  2IOU G;  4FX4 A;  1P2F A;  2XTY A;  1HST A;  1YQA A;  1P7I A;  4GXO A;  2ZL7 A;  3RQI A;  4NBQ A;  2UZK A;  4HIZ A;  3AL0 C;  3OSF A;  3KLN A;  3TQN A;  2Y69 H;  5HLT A;  3OS1 A;  5THX A;  3OYG A;  2OPT A;  1IB0 A;  2OBR A;  1U8B A;  1YHQ B;  1IZ1 A;  3AVW A;  1MJB A;  2R7O A;  4AF6 A;  2ZB9 A;  5HNH A;  3IP4 B;  1TT5 B;  1LEB A;  1IDZ A;  2XC7 A;  4Y52 J;  3AL0 B;  2XZO A;  1W5T A;  1BX1 A;  4G7H F;  3GF2 A;  3CCE B;  1IB4 A;  4URR A;  4OZY A;  4Y33 A;  4U87 A;  3ZQQ A;  4EH1 A;  4AD9 A;  2EZI A;  2LG4 A;  2ACJ A;  2ZXJ A;  2VE9 A;  1QUF A;  1EH8 A;  4HNT A;  1KRH A;  3WTV C;  2NSP A;  4HEA 2;  1XG1 A;  2FBI A;  3FWE A;  3UKG A;  2GLO A;  2LOO A;  3CCQ I;  1UFM A;  3FXL A;  1UD8 A;  1XGN A;  2VN2 A;  4TMT A;  3QPH A;  4LB6 B;  2ZBK A;  1QVT A;  1SFO J;  2QUF A;  4A2U A;  2ISY A;  3TDU C;  3LSM A;  4OMZ A;  3RIQ A;  3DBH B;  1BIB A;  3S8P A;  1LE8 B;  2YUH A;  2L54 A;  2PFB A;  4AC0 A;  3CCE I;  1FIA A;  1TUI A;  4OJ6 A;  2HQ5 A;  3F3X A;  1FJL A;  3G4S B;  2GIZ A;  2JRM A;  2VC0 A;  5GAE J;  3ZMT A;  3JRI A;  1YX2 A;  3FHN A;  3B6A A;  1JTA A;  5ICG A;  1TYV A;  1FMW A;  3BH7 B;  3OJX A;  2G0E A;  4DYR A;  3U6K A;  4MEY F;  3B6C A;  4D7N A;  4IHW A;  2VAS A;  3AK5 A;  2C77 A;  2FML A;  3N6Z A;  1LUJ B;  1E1R A;  2IS6 A;  3EUK L;  1VLY A;  2VBV A;  2RGV A;  1DP7 P;  2QBY A;  4RPD A;  3WBK A;  2LLK A;  5FA6 A;  1PE9 A;  3FDY A;  1O3S A;  2E1M C;  4RD1 A;  1WFX A;  3OIQ A;  5FD6 A;  1T6X A;  5D4R A;  2BSP A;  2RQP A;  1VQK B;  2MBF A;  4XON A;  4IVN A;  4P12 A;  3LQQ A;  3ROU A;  2EJR A;  3MKW B;  2PI0 A;  2DA6 A;  1OYW A;  2D45 A;  3CME I;  4IQJ A;  3VDX A;  2X6Y A;  4L9J A;  3OOP A;  3SY2 A;  1ZN2 A;  3BQZ A;  2XZP A;  2M30 A;  1QRB A;  4L5J A;  2CV1 A;  3H9J A;  3BTC A;  2DPD A;  1QU3 A;  3C3W A;  4QPQ A;  1MW7 A;  1QPM A;  2M9H A;  4KIG A;  1O57 A;  3PNV A;  4N9I A;  2VJI A;  4M3G A;  2K3F A;  4RDU A;  2X1C A;  3HOZ J;  5DEQ A;  2LKX A;  3REO A;  2YWG A;  3Q38 A;  3RPQ A;  3S2D J;  2V7V A;  1O8I A;  2YX7 A;  4HZF A;  5HZA A;  1XSD A;  4H4K C;  1VQ8 B;  5KVR A;  1O88 A;  4CZC A;  4U9U A;  4HF2 A;  3KYD B;  1ETK A;  2L4A A;  1B72 B;  1KQS B;  1VQP I;  3W2E A;  2EWE A;  3FY3 A;  4OPS A;  3U1D A;  1JHH A;  2CRG A;  4C2U A;  3OP1 A;  3GSI A;  1ORK A;  4CZZ A;  4CA0 A;  1ZHF A;  2IT0 A;  3J80 Z;  4KKU A;  1G7R A;  1BI1 A;  1UST A;  2XAF A;  1BA5 A;  1Z67 A;  4LGW A;  4ZH4 F;  3JAM Z;  3LSP A;  1NHA A;  3HYI A;  3KL9 A;  4HOB A;  1V5V A;  2I1L A;  1NH3 A;  3I58 A;  5KSW B;  2R7U A;  5BPI A;  3CCV I;  2CFX A;  1CF7 A;  4G6T B;  4HWV A;  3WGH A;  3F8M A;  3ULQ B;  2IVM A;  3E7L A;  3CJN A;  2VOP A;  3NAW A;  4B48 A;  4I98 B;  3CMA I;  3J81 K;  5FKO A;  3ZOB A;  4YFK F;  3TL4 X;  3RZD J;  2KIU A;  4B4D A;  3Q0U A;  5HLH A;  2DOD A;  4DW6 A;  1O4X A;  1VQ6 B;  5E1Z B;  4HNV A;  2O1D A;  1JKR C;  2NRA C;  3AG3 H;  5CQG A;  1TQP A;  4BJT A;  1Z6R A;  2V1X A;  3LA7 A;  4N0B A;  3PNY A;  2FQ4 A;  4LJZ F;  4RM3 A;  3L2C A;  2ELH A;  4HW0 A;  3QFT A;  2ODL A;  1ZGJ A;  2R7Z J;  5FLX K;  3U2R A;  1OFM A;  1Y56 A;  1YJN B;  3KYC B;  5B1B H;  2KIS A;  2WB1 N;  3IL2 A;  2BV3 A;  3AGQ A;  2BHY A;  2BF4 A;  4E0F A;  5D5V B;  1FRN A;  3FXK A;  4GCV A;  4MQ9 F;  4Y7C A;  3GXO A;  3HHH A;  5J35 A;  2KVO A;  4TSF A;  4ZYG A;  1VQN B;  1VQM I;  4DIQ A;  1BHE A;  1CQT A;  1HC8 A;  3AVT A;  1ZRE A;  2QTL A;  2CUE A;  4QFM A;  2F3L A;  2Z6B D;  2KZG A;  4WWC A;  3CXC B;  2L7Z A;  3ONU A;  4A3B J;  2P4W A;  1WSU A;  3ABK H;  1FOX A;  4EM0 B;  2ECB A;  3V4G A;  2DFI A;  1Y1W J;  4QTR A;  4P6V F;  5J3O A;  1A6I A;  3DFG A;  4U0Y A;  1QBJ A;  1XSX A;  3RY8 A;  3AVX A;  2OC6 A;  5DD8 A;  1AIP A;  2HZT A;  5M3M J;  3OY9 A;  4UY8 I;  4M6Y A;  3GZ6 A;  3ASS A;  1ZAO A;  2VKD A;  4Q7J B;  3VB2 A;  3L2V A;  1HW5 A;  1OPC A;  3SZT A;  1VI0 A;  3E5X A;  3MMP A;  2HEO A;  2BBY A;  1UG2 A;  4YIF A;  5CJ9 A;  1RWR A;  5ERI A;  4U0V A;  3Q0V A;  1RUN A;  2VIX A;  2JTV A;  3MAJ A;  1E3O C;  2HTJ A;  4UVB A;  3PJR A;  2R7R A;  1D5Y A;  2HFH A;  5LMZ A;  1EZG A;  2OTL I;  2NS7 A;  1A36 A;  1DQU A;  1XDU A;  1WXR A;  2O0Y A;  4V2F A;  2F6C A;  2VLA A;  2F1L A;  3ERM A;  2DCE A;  3FM5 A;  1OYY A;  3FPP A;  1ITY A;  4IF4 A;  1QGA A;  3A1Y A;  1EE6 A;  4MYT A;  1Q81 D;  1G6N A;  2E2H J;  5DS0 A;  3RDI A;  2VBS A;  1BM9 A;  4EGY A;  3PUB A;  5FNZ A;  3DEU A;  2GJR A;  5LD2 C;  1T6Y A;  1O8K A;  1QRC A;  2O17 A;  1ACI A;  2CH0 A;  4PDK A;  1O8M A;  2OCC H;  1WVR A;  4WXD A;  3I54 A;  3LWF A;  3R60 A;  4X7F A;  1JUP A;  1YE9 A;  2MLK A;  5HS9 A;  3ASO H;  3JQR A;  4XNF A;  2LZJ A;  4ZGN B;  3V7R A;  3I55 B;  1B4A A;  4MQV A;  3FBN B;  3KEY A;  4XD7 A;  4ESF A;  4YFO A;  3JW4 A;  1JI8 A;  2VBU A;  5BQT A;  4BS9 A;  2KDZ A;  4KDP A;  2LY2 A;  1OB2 A;  1OFC X;  3K4B A;  2CND A;  4LBZ A;  3VO1 A;  3MZ8 A;  2BEO A;  4EJT A;  2PJR A;  5DV5 A;  2VBY A;  4FET A;  1WTH D;  2KKO A;  1XDS A;  5HLG A;  5IOZ A;  4B44 A;  2VUM J;  2GQQ A;  1HQC A;  1R1V A;  4KT6 A;  4ENK A;  3S93 A;  4Z4R A;  1ETW A;  2F4O B;  3ZBU A;  5C3E J;  4AYB A;  3OIP A;  1COW A;  3GYH X;  3TMO A;  4LG3 A;  4JOM A;  4YFN F;  1F5T A;  5KCM A;  1WJD A;  3L00 A;  1APL C;  3BG7 A;  3ZMU A;  1K78 B;  4YAW A;  4GGG A;  3QFC A;  3CJT B;  2PYG A;  2R6H A;  1RQP A;  1KCC A;  2CW0 F;  2ZO4 A;  1N0V C;  3CRZ A;  4X05 A;  2K85 A;  2C2W A;  3FBI B;  3HL2 A;  1YW7 A;  5A89 A;  5GPA A;  4IX7 A;  5IP7 J;  3G71 I;  1Z9C A;  2V1N A;  4Y17 A;  4XRS G;  4XKV A;  3C2G A;  2QSG X;  3I4M J;  1UD4 A;  4W1U A;  1K4T A;  2QN6 A;  1R7J A;  1Y8Q B;  3HKZ N;  3WG7 H;  5FLM J;  1Y39 A;  2KIF A;  4RB2 C;  3JRF A;  1M1E B;  2V1D A;  1H85 A;  4P2N A;  2V7Q A;  4Z03 A;  2JUG A;  4UVC A;  4BHB A;  4RDK A;  2BM7 A;  2NAZ A;  1YIJ I;  2DTZ A;  1BJZ A;  3G71 B;  5F1J A;  4YZQ A;  1Q1H A;  1O8H A;  2XNC A;  2X1D A;  3TOA A;  2CC2 A;  3F8N A;  3ZZT A;  4O3M A;  3GQ7 A;  1W7P D;  3NB2 A;  4XOR A;  1OKR A;  2VYQ A;  4ANJ A;  5ED4 A;  2E1O A;  1VQ7 B;  5JVG F;  2X1E A;  3S3M A;  5E79 C;  2H27 A;  1EFU A;  2VKH A;  4ABZ A;  3V42 A;  1X4P A;  4OM9 A;  2J8K A;  2ID3 A;  2VQH A;  2ME0 A;  4MEX F;  4QWQ A;  1Z0X A;  3GLL A;  1BIA A;  2CQX A;  1X3W B;  1FOY A;  2HQN A;  3ASP A;  1CLW A;  1T95 A;  2C4U A;  4G1B A;  1WI3 A;  2WJY A;  1WOS A;  2VFP A;  2V4J C;  2DFF A;  2K9S A;  2BXZ A;  2PBI A;  2QCO A;  2R5Y B;  4BJ6 C;  3S2H J;  3VO2 A;  2GBY A;  1FMV A;  4RAF A;  3OYJ A;  2J8I A;  2JDI A;  2DT7 B;  1IJE A;  4AVP A;  3CD6 B;  4Z4W A;  3RKW A;  1M90 D;  2F5E A;  2P7V B;  4C2M J;  4CSW A;  3H5A A;  4PJ0 C;  3TP0 A;  4RGX A;  2BM4 A;  1YIO A;  4DYQ A;  5EG0 B;  4BPR A;  4BBR J;  4Z4Z A;  2OZ6 A;  5AN9 A;  2MG4 A;  1AU7 A;  4CH7 A;  2ZME A;  2KDO A;  5HLI A;  2N8G A;  1QZY A;  1HBX G;  2VJ4 A;  2E1B A;  1S0U A;  1LE8 A;  2KT0 A;  2V31 A;  2XNJ A;  2YWF A;  3SJZ A;  2QGU A;  1FTT A;  3GQA A;  3TED A;  1O8F A;  4FWT A;  3MZY A;  1HKT A;  3H0D A;  3CW2 A;  4RGR A;  1R1T A;  2FU4 A;  4XRM A;  3OKX A;  4F7D A;  1XC5 A;  4PK4 A;  3E0J B;  1D5V A;  4UB8 C;  1HDD C;  4M9S A;  3LQE A;  5DUK A;  3RCO A;  5E3N A;  3K7A J;  4KA4 A;  1RR7 A;  2OQR A;  1KTW A;  4OU0 A;  4ZC3 A;  3IRR A;  3ZPL A;  4A5M A;  1PP8 F;  2HMA A;  2VBW A;  4WZE A;  5L3B A;  4M9Z A;  4HA8 A;  3D5R C;  1SVO A;  1GQ8 A;  4TMZ A;  1DUX C;  4Q4Z F;  2BX6 A;  4AYB N;  4YEI A;  4M1K A;  3KEW A;  1WRJ A;  3FMR A;  4ZDP A;  1J9Z A;  4P3Y A;  2O6G E;  3I56 I;  2L4M A;  2OD5 A;  1N08 A;  4BJ5 C;  1GJR A;  2P0W A;  3I4P A;  1A04 A;  2LMD A;  2OTL B;  2HDD A;  2DMN A;  1ZM4 A;  2A5W A;  1NK3 P;  5IY5 H;  2X3U A;  2V9V A;  3S1R J;  1ULY A;  3SZP A;  4OJO A;  1DU0 A;  2Y0S A;  3LQ6 A;  3U21 A;  1H8H A;  2E5N A;  3L2U A;  4MTD A;  2EZL A;  3N97 A;  1OCO H;  3WU2 C;  2ZTG A;  2VJJ A;  3PUM A;  2EB7 A;  2OBT A;  1OB5 A;  2ZXI A;  4BHC A;  1RKW A;  1V5G A;  2FMY A;  4DQL A;  2V7U A;  2NTP A;  4PCQ A;  5H2F C;  1ERD A;  1PUF A;  2GXB A;  2GJK A;  3HRT A;  2BYV E;  1CZF A;  2W4S A;  2DQR A;  4M71 A;  3U9G A;  2E2J J;  1BX0 A;  3R6J A;  4RPB A;  5IYQ A;  2O0W A;  4HPQ A;  2CYY A;  5TIS C;  5LHG A;  2MC4 A;  3LAJ A;  3HOS A;  5HS8 A;  2W85 A;  2YS9 A;  3CCL B;  1JUS A;  4QLC U;  4HV6 A;  2L01 A;  1VQ9 I;  3K1N A;  4FN5 A;  1PJ5 A;  1LKX A;  3LSJ A;  1IJF A;  4L0Y B;  3AVU A;  2M7B A;  4PC6 A;  4UUS A;  2Y9Y A;  2IRF G;  1B2R A;  2Q2E A;  2DYI A;  1TZL A;  2JPB A;  4P9F A;  3OYK A;  3CMA B;  1MMN A;  3H36 A;  4AC9 A;  3J81 k;  2DY1 A;  3W6V A;  3W2F A;  1AKH A;  3GWZ A;  1HCR A;  5JI6 A;  4G7X A;  1MZB A;  2DLL A;  2ZJR F;  1YJN I;  2EFN A;  2ZNZ A;  1JT6 A;  4WK8 F;  1EP3 B;  2FBH A;  1K4Z A;  3PFI A;  1YS6 A;  4O5V A;  5LRS A;  2IXS A;  3GTJ J;  4LBV A;  2YU9 J;  4G94 A;  1X1C A;  3OYD A;  2O61 A;  4P3I A;  2DYR H;  2KRH A;  4K1X A;  4Y9U A;  4D1Q A;  3A8I A;  4BHP A;  2G7H A;  2VNJ A;  4MTE A;  4AM3 A;  1LVK A;  1BN8 A;  3ELK A;  4FT8 A;  1KK3 A;  1OOC A;  1H80 A;  2VI6 A;  2VL8 A;  3FF5 A;  3OAA A;  3MKL A;  4BUP A;  2DT6 A;  3MFK A;  2STT A;  4IHY A;  1RU4 A;  1IN6 A;  2XGD A;  2BGJ A;  2DMQ A;  4X7E A;  2KPM A;  1K73 D;  1WSV A;  4XK4 A;  2EH3 A;  1S29 A;  4CCO A;  2H6C A;  1GAQ A;  2FNP A;  1Y0Y A;  4MFE A;  2QYU A;  2CV2 A;  1WJ5 A;  4OZZ A;  1IRX A;  2BY3 A;  2I5U A;  2K9L A;  4TV7 A;  3GFM A;  1DU6 A;  4II3 A;  2ZJP F;  1U9N A;  2X85 A;  3KP7 A;  2ETH A;  3LSG A;  1UHW A;  5IPA A;  2QWW A;  3HOY J;  4PC7 A;  1OHH A;  1ENH A;  5IT3 A;  2BVM A;  2GIV A;  3SFZ A;  3CLO A;  1D1A A;  1Z6T A;  4I01 A;  3VMF A;  3F8F A;  2JA7 J;  2IW5 A;  2JMW A;  4MLO A;  1RIO H;  1JJ2 B;  1KU7 A;  1GUU A;  3C2B A;  1YS7 A;  1W7P B;  2JSP A;  2JVG A;  3C18 A;  1QPI A;  2CQQ A;  4BE2 A;  3PSF A;  1IDJ A;  2EK5 A;  4H0E A;  2MH9 A;  2Y0S N;  2CFO A;  2IA0 A;  3GQ9 A;  1HZE A;  3HOU J;  2MD5 A;  4ENM A;  2HNH A;  1I6H J;  3BWG A;  1RNL A;  4BKX A;  2VON A;  2XT4 A;  1EA0 A;  2P6T A;  3H09 A;  3ML3 A;  2EBI A;  3AG2 H;  1E3H A;  1IA5 A;  1MJ9 A;  3K9T A;  3QP6 A;  1EKE A;  4BQN A;  4MYU A;  1WPC A;  4A0Z A;  3OZU A;  4M4S A;  5GTH C;  1VND A;  1X3U A;  3RSN A;  5TJJ A;  1ZKG A;  2LK2 A;  1QO0 D;  2Z1D A;  1KZL A;  4D9J A;  4DZP A;  5M5X J;  2LKP A;  1T8I A;  2HDC A;  3HG9 A;  3RQ4 A;  3SQN A;  2QTZ A;  2DFE A;  4GYG A;  4LIU A;  4CIC A;  2M4K A;  2JA6 J;  2VPR A;  2F5V A;  1NDH A;  4ZCL A;  1QGP A;  3K4L A;  4ZTJ A;  5H5J A;  3VNV A;  2DET A;  1G7C A;  2L5Q A;  1N77 A;  2J5O A;  1U2R A;  4WZK A;  5L3D A;  3DPT A;  1WJC A;  2W1O A;  3K6G A;  2ECC A;  5JVT A;  1XB2 A;  2XPV A;  3ES9 A;  1Q7Y D;  4BE1 A;  1B8I A;  1N75 A;  4BQO A;  1IF1 A;  1D8J A;  4HE6 A;  3ZUG A;  4XQF A;  1VQO I;  2FVG A;  1QFY A;  4M72 A;  3S3O A;  2DTR A;  2XB0 X;  2LNB A;  3G6E I;  2MFZ A;  2Q0O A;  2Z9O A;  2PQ8 A;  4A3J J;  1D2E A;  1VQ4 B;  1JA1 A;  3ABT A;  3OW2 B;  1K6Y A;  4Y15 A;  4PC2 A;  2INU A;  4Z05 A;  3MZH A;  1YI2 B;  4NDL A;  4P9S A;  3FZV A;  2X0L A;  1OFL A;  2GXA A;  3ZP5 A;  1Y0U A;  2EFG A;  4YZX A;  2VBZ A;  3C1D A;  3QOE A;  2E7W A;  4C0S A;  1HW2 A;  2CGP A;  3HSR A;  1GDT A;  2K3P A;  3LMW A;  2LY1 A;  4GQN A;  1KON A;  1SD5 A;  4BDZ A;  1B72 A;  2W7Z A;  2IS4 A;  2XND A;  4L5I A;  5L3E A;  2A05 A;  3M07 A;  3HOT A;  2PMD A;  3FXQ A;  1J09 A;  2Q6O A;  1QX4 A;  2MAB A;  1ZGW A;  1H42 A;  2WR8 A;  4MXN A;  4BH9 A;  1BLI A;  2XKO A;  1SM4 A;  4RDJ A;  1O3Q A;  2NOG A;  4ZJZ A;  2X0K A;  2ZFU A;  2V7T A;  1WOR A;  1H9T A;  2BY1 A;  2HI3 A;  3T1B A;  4IKF A;  5DDG A;  3FXR A;  3MHP A;  1J0R A;  3CC4 B;  1YIT B;  1R22 A;  3BZC A;  3I53 A;  2XGC A;  5E1W A;  4WXH A;  4OIP F;  3S1Q J;  2F1M A;  4PJL A;  1U0J A;  2HYF A;  2WB1 A;  2M34 A;  3BR2 A;  3GFJ A;  1XCB A;  4BBS J;  2PIA A;  2EIL H;  3OJW A;  2E60 A;  2XAG A;  4IHX A;  1A8P A;  1IRZ A;  1V5F A;  4CHU A;  1JT0 A;  4I2O A;  1JUM A;  3UW0 A;  2KJB A;  2HVR A;  2F43 A;  3RKY A;  4G7W A;  5J47 A;  1RUO A;  1HG8 A;  1ZR2 A;  3SXY A;  1N25 A;  1G3Y A;  2M45 A;  4PMH A;  3F0C A;  3OYL A;  2W00 A;  1R5N A;  1WCM J;  1JB9 A;  1OYI A;  1QNT A;  5CVR A;  1MRZ A;  2M2E A;  3ZQC A;  4D0P A;  1IJW C;  3QYF A;  4OIQ F;  1YIT I;  3CF2 A;  4RLZ A;  5B3S H;  5EEH A;  3QQA A;  1JE8 A;  2K5C A;  3BY6 A;  3QPS A;  2EQR A;  3NRV A;  4E7H A;  1Z91 A;  2BM6 A;  2GAU A;  5KAI C;  1S9H A;  4EGZ A;  4G5G A;  2C5B A;  1YTY A;  2WY7 Q;  1PJR A;  3A35 A;  4AIJ A;  3K70 D;  3P9K A;  1EA3 A;  5EEA A;  5A2Q Z;  4YEL A;  4Z4U A;  3ZR8 X;  1Y1V J;  3KE2 A;  4ZYH A;  3R6K A;  1ON1 A;  3SZE A;  2BY0 A;  5E3L A;  3A01 A;  1MSF C;  3WYA A;  1TWG J;  3DPL C;  4C3H J;  3CC2 I;  3Q3A A;  4TMX A;  1RQR A;  1QA3 A;  2EFW A;  2EV5 A;  2XHK A;  1LM1 A;  1L3L A;  4XIC A;  1SEU A;  1J9I A;  2OYN A;  2QA4 I;  4B43 A;  5CPR B;  1RMG A;  4KN4 X;  2Y48 A;  4MFD A;  4C3I J;  1HF2 A;  1KQ5 A;  4ASN A;  2DO7 A;  2CK3 A;  1K9M D;  2JJ7 A;  2NZM A;  4K2E A;  4BGD A;  4DJA A;  2VE8 A;  1J59 A;  5A2Q K;  1TLH B;  1LB2 A;  4BE0 A;  1W2B B;  4G12 A;  2PMZ N;  5K7Z A;  3TO6 A;  3UNG C;  4RB0 A;  3WU1 B;  3L09 A;  3S15 J;  1LLW A;  4NC7 A;  1X1B A;  4Z6Y A;  3AVY A;  1K5C A;  4HG2 A;  4XRS A;  1HOM A;  1I5Z A;  2EZK A;  3G3Z A;  3VYS B;  1E0E A;  4JRA C;  1KC8 D;  5LLQ A;  4DZJ A;  5B1A H;  1VQL B;  1SFK A;  3DTE A;  2ZZQ A;  5BSX A;  1KK2 A;  1WJA A;  2MW8 A;  2LH9 A;  1U5T A;  3HUG B;  3KP5 A;  3BOQ A;  2EFQ A;  1GR1 A;  3JRB A;  2VBM A;  2ELJ A;  2WJV A;  4ZV4 A;  3I5U A;  2CS3 A;  2F2E A;  3X2Q H;  4E7I A;  5EGO A;  1ZLJ A;  1MDM A;  3TGN A;  1R5G A;  1WMR A;  1R5O A;  2JT1 A;  5LEK A;  1TW2 A;  2KJC A;  2NVX J;  2M5S A;  2ISZ A;  2NOJ B;  3IWF A;  2RNG A;  2X9D A;  2GJP A;  3R6S A;  3CO6 C;  3A8K A;  3D0S A;  1S7O A;  2TRT A;  4Y13 A;  2GA1 A;  2IGN A;  3O6B B;  3LVB A;  3W5H A;  1H9G A;  2CW7 A;  2HS5 A;  1OCR H;  1R36 A;  1TP4 A;  3WOD F;  2VOD A;  2QQB A;  2IS2 A;  2DJI A;  2F4M B;  1ZRC A;  2XZL A;  3VPR A;  2IJL A;  4A6E A;  5GAD J;  1ZH5 A;  3W2G A;  3LA2 A;  3LA3 A;  1W87 A;  3SJM A;  2PEX A;  4RDL A;  2FD5 A;  1LDD A;  3S16 J;  2DDA A;  3I59 A;  1GXP A;  2HDN B;  4P22 A;  4BEH A;  5E1X A;  2BW3 A;  3H9G A;  2ADU A;  3JRG A;  4L8J A;  2KHM A;  4Z4Y A;  1LFU P;  3R61 A;  4DYC A;  4XLC A;  1O7L A;  2OZU A;  3W2W A;  5FL7 A;  2CJJ A;  4LBY A;  3HRU A;  2OTJ I;  4II2 A;  3CDL A;  1FOK A;  4A0Y A;  1XMA A;  3HKZ A;  2R4G A;  3MD2 A;  3HAG A;  1JRG A;  4RD0 A;  1W5S A;  3FK6 A;  3GTG J;  4F55 A;  3GRH A;  3BTJ A;  5BNG A;  3SEJ A;  4C30 A;  1LVA A;  2ID6 A;  1WGX A;  5EZG A;  1HA3 A;  2BE5 F;  1X0C A;  2JVH A;  2D74 A;  1WZ2 A;  2NS8 A;  3Q9S A;  5EEG A;  4AUX A;  1W0U A;  1NK2 P;  1D1B A;  1R5H A;  4FXU A;  2F48 A;  4OAZ A;  4R79 A;  3GFI A;  3ZSC A;  1S3J A;  1OR7 C;  4LMY A;  1IV6 A;  1DGR M;  2X53 S;  5DYM A;  2HVS A;  4UUV A;  4B3G A;  2HZD A;  3MQ0 A;  4XBF A;  1BL0 A;  1YG2 A;  3D26 A;  2CRV A;  2ZTN A;  3G05 A;  1KD1 D;  2Y31 A;  5BOX A; 
#chains in the Genus database with same CATH homology
 3E1S A;  1W0K A;  4E7K A;  3LNN A;  3K4M A;  3VSK A;  4CUG A;  4PJJ A;  3F9K A;  2KL4 A;  2PEC A;  5CKT A;  4TT3 A;  2V7Q A;  1W36 C;  2JUG A;  1BR1 A;  2LBF A;  2Z2S B;  2AQF A;  1W9X A;  4DK0 A;  1BR4 A;  3WWG A;  4EAT A;  3SEZ A;  4YZQ A;  2WY8 Q;  1O8H A;  2X1D A;  2NTQ A;  3OPO A;  1AA7 A;  3LL7 A;  3ZCO A;  4RLF A;  1T0F C;  5HOO A;  3GQ7 A;  4XOR A;  3K10 A;  4LIT A;  3TBI A;  2XAU A;  3VYU B;  4ANJ A;  2X1E A;  3S3M A;  1E43 A;  3GVL A;  2WAQ A;  4Y3O A;  3H5R A;  2ZSI B;  2VKH A;  3OWT A;  3V42 A;  2L9N A;  1X4P A;  2DOA A;  2XF6 A;  4ITV A;  2VQH A;  4P1W A;  5C1C A;  4XM3 A;  3OR2 C;  4Z1M A;  2BW3 B;  4HRI A;  2R7V A;  1V5E A;  1T95 A;  3HPG A;  2WJY A;  4XKV A;  2V4J C;  1NBM A;  1UD4 A;  2JJ2 A;  2INV A;  4BJ6 C;  4F3Q A;  2E1M B;  5FRM A;  1FMV A;  3OYJ A;  5AMV A;  2JDI A;  1WP6 A;  2E5Z A;  3FKJ A;  4G6I A;  2DT7 B;  1O8G A;  3DQV C;  3OMY A;  1UD6 A;  2IS1 A;  1I18 A;  1V0E A;  4CSW A;  3H5A A;  3L2R A;  2MYS A;  2M3A A;  3SUC A;  3W2A A;  1TT0 A;  4N4O B;  3T9G A;  1VBL A;  3A4C A;  2V26 A;  4CH7 A;  1SKY B;  2HLD A;  2KDO A;  2X8K A;  4YEJ A;  2VJ4 A;  2E1B A;  3OYA A;  3NWS A;  1LDK B;  3HC7 A;  3K4J A;  2V31 A;  1PXZ A;  2V9K A;  3GQA A;  3D5S C;  3K70 C;  1D1C A;  1O8F A;  4BEH B;  3KYL A;  3LMM A;  3H0D A;  1Z3Y A;  1QJV A;  4PK4 A;  3E0J B;  3QOD A;  3AKZ A;  2D3L A;  2NT9 A;  1D0X A;  4XOP A;  4P5O A;  1LFP A;  3B4N A;  3RCO A;  3W2V A;  1X4O A;  3PNT A;  4KJZ A;  3CMM A;  1KTW A;  4FAS D;  4ZC3 A;  2RQQ A;  1VZ0 A;  3ZIA A;  2VPL A;  1D0Y A;  3D5R C;  3W3C A;  1FX0 A;  3KRG A;  4OJ5 A;  4YXW A;  1GQ8 A;  3VWB A;  4XMY A;  4ASU A;  4Z03 A;  3KEW A;  1K28 D;  4ZDO A;  2KMU A;  4ZDP A;  5TGT A;  3DPU A;  4DGW B;  3IUO A;  3ZGK A;  3OW7 A;  4AU7 A;  3T51 B;  3H35 A;  1Z3X A;  4BJ5 C;  1Z7L A;  2VXD A;  1GLN A;  3OYF A;  3BC9 A;  2P0W A;  2W7N A;  4TKO B;  2MD0 A;  5FRN A;  3ZPP A;  4IQ4 A;  3ZPN A;  2IGM A;  4W8R A;  2A5W A;  2BOL A;  2CMP A;  1T5E A;  1XG2 A;  1D0Z A;  3H5N A;  3BC8 A;  2Y0S A;  4OJO A;  3U21 A;  3M1C A;  1H8H A;  2E5N A;  3ZXS A;  3L2U A;  4ZYA A;  2A6T A;  4AVZ A;  3G2B A;  2ZTG A;  2VJJ A;  3OEE A;  3DTK A;  2QY1 A;  2ZZG A;  1QCX A;  2ZXI A;  3OR1 C;  4XKC A;  1V5G A;  2NTP A;  1ERD A;  1MMD A;  4XKB A;  2GJK A;  4PUS A;  2L9S A;  1WJB A;  3VYT B;  3VSL A;  4BQQ A;  2LBF B;  2W4S A;  4XKW A;  5HVQ C;  1DGW Y;  1NRK A;  1V0F A;  1W0J A;  1CZF A;  2NST A;  2X6X A;  1EFR A;  2I8D A;  2O0W A;  1IDK A;  1H8E A;  4HPQ A;  2GK6 A;  2MC4 A;  3I9V 2;  5JHF A;  3HOS A;  2V4D A;  3KX2 A;  3HXL A;  4DNR B;  3VR6 A;  1NG6 A;  3K4N A;  2Q2E B;  1LKX A;  2RRE A;  2IQ7 A;  3VMW A;  2M7B A;  2R9V A;  1UEL B;  4PFO A;  4C2T A;  2QKM B;  1DBO A;  4E7Z A;  3EPZ A;  4CCN A;  1TZL A;  3OYK A;  2NT6 A;  1MMN A;  1BR2 A;  2BVL A;  1DBG A;  3S3N A;  2IGK A;  4G7X A;  1X19 A;  2CUJ A;  3OYM A;  2XZO A;  2Z8G A;  4JQF A;  3S32 A;  3DKX A;  2O0V A;  4KIT B;  3OOC A;  3VSV A;  2QX3 A;  4OJL A;  4RLQ A;  2VBE A;  3K4K A;  2R7Q A;  3VSU A;  1NG7 A;  2IXS A;  4IZZ A;  2HPM A;  1X1C A;  2WAF A;  1WJF A;  3OYD A;  2VJ5 A;  4DNT B;  3PFY A;  4NQW B;  3T53 B;  2IGO A;  2KRH A;  2QKL B;  4C9Y A;  4J01 A;  4D1Q A;  2JJ1 A;  4EW9 A;  3RPU D;  1G59 A;  4XLF A;  1PLU A;  1QHG A;  2VQG A;  3DKY A;  2AQE A;  1LVK A;  1WJE A;  4NNJ A;  2JIZ A;  1BN8 A;  3PL8 A;  4BL0 B;  5KHD A;  1H80 A;  1OOC A;  2VL8 A;  3GBG A;  3OAA A;  4BUP A;  1RU4 A;  2DT6 A;  3PSI A;  2O04 A;  2KPM A;  2XF7 A;  2UUZ A;  4HIZ A;  3AL0 C;  2R7T A;  1SAU A;  4CCO A;  5HLT A;  3OS1 A;  3OYG A;  3IAM 2;  4CCJ A;  3OYI A;  2CV2 A;  1WJ5 A;  2R7O A;  1VJS A;  4OZZ A;  2WPD A;  1IRX A;  5HNH A;  3IP4 B;  2K9L A;  3H9Q A;  1E79 A;  2LRD A;  4II3 A;  2KLO A;  2X85 A;  3K4C A;  2XC7 A;  3LSG A;  3AL0 B;  4E0F A;  3OYN A;  1OHH A;  1IB4 A;  2BVM A;  2OV7 A;  4OZY A;  4PSW A;  4URR A;  4U49 A;  4Y33 A;  2HQA A;  4U87 A;  3ZQQ A;  1D1A A;  1MMG A;  2LG4 A;  3CJR B;  3OFN A;  4B3F X;  2VBK A;  3FKS A;  4MLO A;  4HNT A;  3A3G A;  2NSP A;  4HEA 2;  1KMH A;  3SEQ A;  2JSP A;  2LOO A;  2ZSH B;  2JVG A;  4B47 A;  1UD5 A;  3EUA A;  4BU2 A;  4Y4R A;  4BE2 A;  2VXZ A;  3PSF A;  1UD8 A;  1IDJ A;  1I8D A;  4RM2 A;  3BCA A;  3EUH C;  4YRV A;  3A3B A;  3RTR A;  2CFO A;  4CCL A;  3GQ9 A;  1HZE A;  1R6R A;  3JU4 A;  3EQO A;  2HNH A;  3LSM A;  1MNE A;  3S8P A;  1DP3 A;  1W36 D;  2XSJ C;  4NK8 A;  4OJ6 A;  2Q1Z B;  1IA5 A;  3DU6 A;  4BQN A;  2ZXH A;  1WPC A;  4NUB A;  4QPO A;  5HNF A;  3L2Q A;  3RSN A;  3FHN A;  3VYR B;  1JTA A;  2GOM A;  1E3X A;  1FMW A;  2L7K A;  3VST A;  1X1A A;  2Z1D A;  4F52 A;  1KZL A;  4D9J A;  4XR6 A;  3BG6 A;  3QYE A;  2VAS A;  3HG9 A;  3RQ4 A;  3SZG A;  4LIU A;  3QYB A;  1E1R A;  2L2O A;  2IS6 A;  2M4K A;  3EUK L;  3NWT A;  1VLY A;  4OJP A;  3OEH A;  2F5V A;  5LFA A;  3OYE A;  3A2K A;  3K4L A;  4ZTJ A;  3NE5 B;  2M7A A;  1PE9 A;  3FDY A;  2E1M C;  1WFX A;  2L5Q A;  1BOB A;  3OIQ A;  1N77 A;  2BSP A;  3ZRG A;  4I84 A;  4XN0 A;  4XON A;  2PJR B;  3DPT A;  4F92 B;  1WJC A;  2LRE A;  2W1O A;  2UV1 A;  3K6G A;  3MKW B;  3MKY B;  3DTI A;  4BE1 A;  3BH4 A;  2QE7 A;  1N75 A;  1UG0 A;  1UD3 A;  4BQO A;  1O8D A;  3GQB A;  4XQF A;  4ZDL A;  3DWL E;  3VDX A;  2X6Y A;  4IQJ A;  3S3O A;  1ZEL A;  3LSI A;  5DN6 A;  2XZP A;  4F93 B;  2GK7 A;  2CV1 A;  3H9J A;  1O8L A;  2MFZ A;  3JUR A;  2XOK A;  2PMZ A;  1QU3 A;  1G8X A;  4QPQ A;  1MW7 A;  1K6Y A;  5HKK A;  4Z05 A;  2INU A;  3PNV A;  2K9M A;  2VJI A;  1E1Q A;  2DXI A;  2X1C A;  2JA2 A;  3OYH A;  1OFL A;  4PJM A;  1N78 A;  4YZX A;  3QOE A;  2V7F A;  3MKZ A;  2K3P A;  3LMW A;  2LY1 A;  3OL3 A;  4GQN A;  3OL4 A;  1KON A;  4BDZ A;  2R7S A;  1O8I A;  2CUZ A;  2IS4 A;  2XND A;  3HOT A;  4H4K C;  4CCM A;  1J09 A;  3BCB A;  3HPH A;  4CZC A;  4BAC A;  4UZU A;  2GOX B;  2MAB A;  5CQE A;  1O88 A;  2HPI A;  4J00 A;  4MXN A;  1BLI A;  2EWE A;  3FY3 A;  4X0G A;  4Z06 A;  4ZJZ A;  4C2U A;  2HVQ A;  2M4G A;  2ZFU A;  1VF7 A;  2HU9 A;  3UR3 C;  4RMN A;  4CA0 A;  4PFP A;  4IKF A;  4KKU A;  1OB0 A;  4HNU A;  4NK6 A;  4YZA A;  3DDY A;  2F1M A;  3LSK A;  4PJL A;  1U0J A;  2KZV A;  2WB1 A;  4OAY A;  3B8Y A;  2R7U A;  4LIV A;  2HDW A;  2OUM A;  2E60 A;  1V5F A;  4G6T B;  2WBM A;  4PJN A;  4HWV A;  1YX3 A;  3UW0 A;  2HVR A;  2F43 A;  2V6E A;  4G7W A;  1HG8 A;  2VQC A;  1HVX A;  4B48 A;  4XLA A;  3BCF A;  3CES A;  1NHC A;  3TL4 X;  3LFU A;  2ZZF A;  4DOZ A;  2W6J A;  4PMH A;  3OYL A;  2CV0 A;  2W00 A;  3GQ8 A;  4E7J A;  4PSX A;  3SDB A;  2O1D A;  2LC2 A;  4E4H A;  3VMV A;  5CQG A;  3QYF A;  4BJT A;  3CF2 A;  4RM3 A;  4CCK A;  2PYH A;  2ODL A;  3N05 A;  3PNY A;  4KKT A;  5CDF A;  2K5C A;  4E7H A;  3OYB A;  1QHH D;  1OFM A;  4XOT A;  1Y56 A;  1S9H A;  1YX5 A;  3DEE A;  2VQL A;  3J7A Y;  3GVK A;  2WY7 Q;  1PJR A;  2NTB A;  3A35 A;  3K70 D;  1EA3 A;  4YEL A;  1P9Q C;  3ZR8 X;  2KVO A;  4TSF A;  1E3Z A;  3OE7 A;  3IAS 2;  4DIQ A;  1BHE A;  2WAE A;  3AFH A;  3GVJ A;  3DPL C;  2Z6B D;  1BMF A;  3CJQ B;  1MAB A;  1OGO X;  2DIE A;  3OS0 A;  4DK1 A;  2W6I A;  4XLH A;  2WA0 A;  1MND A;  4E7S A;  1RMG A;  1UD2 A;  4B43 A;  2KP6 A;  5CPR B;  4JMQ A;  2OC6 A;  4MR0 A;  2CK3 A;  2NZM A;  3OY9 A;  4BGD A;  4DJA A;  2X6W A;  2Z16 A;  2VKD A;  4XL9 A;  1O8J A;  4YZ0 A;  3CZ6 A;  4BE0 A;  3L2V A;  4BDY A;  3UNG C;  3C2H A;  2WZP P;  4NC7 A;  1X1B A;  1K5C A;  4XN3 A;  4HG2 A;  3VYS B;  1E0E A;  1RWR A;  2VIX A;  3D5L A;  3OYC A;  5IK2 A;  3PJR A;  1BPL A;  1SFK A;  2R7R A;  3DTE A;  2UVF A;  1X1D A;  4W8T A;  2X51 A;  2ZZQ A;  3T56 B;  1AIR A;  1WJA A;  3M8J A;  2QXZ A;  2LH9 A;  1DQU A;  3HUG B;  2R7W A;  2VBM A;  2F6C A;  2VLA A;  2DCE A;  2ELJ A;  3CP2 A;  2WJV A;  1OGM X;  2CS3 A;  4DBR A;  3FPP A;  4E7I A;  4N4N B;  4F91 B;  3EQN A;  1KCD A;  1WMR A;  3OOU A;  3A1Y A;  2M5S A;  2WAD A;  2KRC A;  2NOJ B;  2RNG A;  4HSR A;  2GJP A;  2CW8 A;  1EE6 A;  1O8E A;  4E6K G;  2IGN A;  4E7L A;  2XGJ A;  2CW7 A;  3PUB A;  4KIS A;  4U4B A;  2GJR A;  5LD2 C;  1O8K A;  3OS2 A;  2O17 A;  2CH0 A;  1O8M A;  2UVE A;  2IS2 A;  2DJI A;  2XF5 A;  1HA8 A;  3BCD A;  3I3L A;  2XZL A;  2W82 A;  1YE9 A;  2VB6 A;  4OWR B;  2LYC A;  4DBQ A;  4XNF A;  2F4I A;  4U7B A;  2LZJ A;  4W8Q A;  3FBN B;  3KEY A;  4BEH A;  4P22 A;  4XD7 A;  2BW3 A;  3DLA A;  3LSH A;  3WQZ A;  3H94 A;  1PYV A;  3H9G A;  4HST A;  1JI8 A;  4L8J A;  2UWM A;  2KHM A;  4BS9 A;  1OLT A;  5C1E A;  2LY2 A;  3K4B A;  3BLY A;  3MMY B;  4XLC A;  5FL7 A;  3W2W A;  2PJR A;  1Y6I A;  1WTH D;  4FET A;  4II2 A;  4GRI A;  1UAA A;  4B44 A;  2R4G A;  3HKZ A;  3MD2 A;  2FUG 2;  3HAG A;  2ZZE A;  4BXF A;  2R7X A;  1JRG A;  4C2L A;  4KT6 A;  4F55 A;  3GRH A;  3L2W A;  3S93 A;  4W8S A;  4C30 A;  3CP8 A;  1Z21 A;  2O5R A;  1MMA A;  4AYB A;  3OIP A;  2WSS A;  4NC8 A;  4B3X A;  3ONQ A;  1COW A;  3TMO A;  1X0C A;  2JVH A;  4LG3 A;  4JOM A;  5KCM A;  1WJD A;  4ZTF A;  3BG7 A;  4KKS A;  4XLE A;  1D1B A;  4FXU A;  2XDV A;  1PKV A;  2PYG A;  1KCC A;  4OAZ A;  4R79 A;  3ZSC A;  3B90 A;  1OR7 C;  4B3G A;  1DGR M;  2X53 S;  5FRO A;  2M0M A;  2HVS A;  2HZD A;  3FBI B;  3HL2 A;  3DU5 A;  5KNL A;  4IX7 A;  3SYT A;  2X3H A;  2V1N A;  2ZTN A;  3G05 A;  2KQR A;  3C2G A;  2D3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...