4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
4PMHA 4XKVA 5C1CA 3B8YA 1CZFA 4XR6A 4U4BA 1PXZA 4NK6A 1OOCA 1DBOA 2NTQA 4EW9A 1O8HA 1BN8A 4W8SA 2NTBA 4XOTA 5AMVA 1EE6A 4OZZA 3B90A 3EQOA 3GQ7A 4OJPA 1PE9A 1IA5A 1NHCA 4MXNA 4OJOA 4MR0A 2PYHA 4XQFA 3VMVA 4XL9A 1JTAA 2INUA 4YZQA 1RMGA 1H80A 2O1DA 2X6WA 1O8KA 3KRGA 2O0VA 3EQNA 4C2LA 2UVFA 1IB4A 2QX3A 1O8IA 1KTWA 3UW0A 1O88A 1RU4A 1BHEA 4W8TA 4AVZA 1DBGA 2VBMA 4XMYA 4XKWA 1GQ8A 2NT9A 2INVA 3B4NA 4URRA 4XLFA 2NSTA 2PECA 3ZPPA 2BSPA 4W8QA 3VSVA 3WWGA 4Z05A 3GRHA 3GQ8A 1X0CA 4U49A 2O0WA 2VBEA 2NSPA 1JRGA 1OGMX 4YZAA 1XG2A 4YELA 2O04A 3SUCA 1KCCA 1WMRA 4XNFA 4NK8A 1QCXA 1O8EA 4YZ0A 1RWRA 1KCDA 2IQ7A 1O8GA 5C1EA 4OJ6A 4XN0A 4XONA 1QJVA 3VSUA 2EWEA 4YZXA 2NT6A 3T9GA 4OZYA 1O8MA 3FY3A 2QY1A 2O17A 2VBKA 1OGOX 4HWVA 1O8DA 2X85A 2X6YA 2Z8GA 1PLUA 3ZSCA 2UVEA 2VJJA 4Z03A 4Z06A 4XLAA 4YEJA 2PYGA 4W8RA 1IDJA 3JURA 4XLEA 1O8FA 1OFLA 3GQAA 4OJ5A 2QXZA 4XLCA 4OJLA 1HG8A 4I84A 4XORA 1O8LA 1OFMA 2ODLA 2VJIA 2X6XA 1IDKA 1K5CA 3LMWA 4XLHA 4XOPA 1AIRA 2X3HA 4XN3A 1VBLA 4XM3A 2NTPA 1O8JA 2NZMA 3GQ9A 3VSTA 3VMWA
chains in the Genus database with same CATH superfamily
1QPMA 2HQRA 1RNLA 1K73D 3A35A 1EP2B 4IL6C 4W1UA 3OR2C 4IHTA 1D1CA 5BSXA 1PXZA 1YJ9I 2R7RA 1OOCA 3JRCA 2W25A 1QZEA 5LGNA 4MGRA 3I4NJ 4RCYA 2OCEA 2DIEA 3DQVC 1LE8A 3EYYA 3OYLA 1YI2I 3R60A 2ZL6A 2CQXA 2NTBA 5JLVC 2J8IA 4P9FA 1MH3A 4PCQA 2LZJA 4H9GA 2K3FA 2BHYA 5GADJ 4OJPA 4JOMA 1JJ8C 4JX5A 1I3AA 1SKYB 2CNDA 3CMMA 2HDNB 4MXNA 1ETVA 4I02A 3GVLA 2YSRA 3DBLB 1OKRA 3Q6QA 1I27A 2JUGA 2EZIA 2DI3A 2Q2EA 3FXRA 3LOCA 4BHBA 1D5YA 4P2NA 3BG3A 4EM0B 3FPPA 1QRCA 2GZWA 3PM1A 1QA6A 3ZN0A 2V7UA 1OCPA 2BOLA 3KFWX 2X6WA 3KP5A 3HSRA 1VFCA 1VQ8I 1UMKA 2OPTA 1I18A 1MH4A 4YFKF 1B9NA 4D7NA 3CCJI 3CCUB 1H9GA 4KT6A 3FXJA 4OAYA 5TJJA 2JZYA 2C6YA 4X05A 1ZLJA 2XTYA 1VQ8B 1QA1A 3MKLA 1VJSA 5HLIA 3FIWA 2I5UA 3CUOA 4DQ2A 1KU2A 2DAOA 3L00A 1T38A 2E2IJ 1IG7A 2IS4A 3AVWA 2EK5A 3OR1C 1TL8A 1IV8A 4B4CA 1UELB 3QAHA 3GO5A 2BYVE 3AAFA 1BOBA 3BR5A 1BMFA 2GJPA 2IRFG 2ZSHB 3A8KA 5K1YA 1U5TB 2ZCWA 4IHYA 2V9PA 1XG2A 2PEXA 4YRVA 2LRDA 3U1KA 2XAUA 1VQ4B 4NK8A 3ABLH 3AVVA 1WJCA 4XKCA 4CCKA 2CV2A 4NQWA 1WCMJ 4LK0F 3QPLA 4LLNA 2B0LA 2MGQA 1P4WA 3SDGA 2ZFUA 4AC9A 1RR8C 2BXZA 1OCTC 2ZNZA 3O3KA 4HEA2 4RGUA 3PA1A 1U9OA 3H9JA 1X1CA 1QRYA 4NUBA 2EA4A 2FF4A 3KEQA 2VE8A 4B44A 1DPRA 4CICA 4QLCU 5LGTA 3BNWA 3ZUGA 2CU7A 1KQ8A 3BDDA 2MW8A 3FY3A 4HSRA 3ASQA 4EJUA 3UNGC 4DK0A 1GJRA 1O3TA 3J81Z 3LSHA 4OOIA 1EJ9A 4HW0A 1R5NA 2YWFA 4RBOA 4LK1F 5TRDA 2ZBKA 5LHGA 2J8KA 2HKOA 4RD2A 4H4KC 1DP3A 3PJRA 1S3JA 1E3OC 4X7EA 1FSHA 2XGCA 1SFEA 1XDSA 2P5LC 2E71A 1VQMI 4JBAA 1HC8A 1OFMA 4J00A 4BE2A 3NWTA 2K5CA 4HRIA 2ESHA 2DDAA 3IRRA 5IYWA 5JVTA 4G1VA 1XMAA 1X3WB 4DGWB 1MBJA 3CCQI 1YOVB 1ZARA 2KISA 1CQXA 3QP5A 4DOZA 4YG2F 2KMUA 3GCMA 5J3LA 1YITI 4DNRB 3DU1X 3CP8A 3QSYA 1JA0A 2VNHA 4XSXF 4IOCF 2B63J 1I5ZA 1YJ9B 2ZBUA 3K4CA 2VFOA 2GIVA 2QZ8A 3CCLI 3K4KA 2EV0A 4HAMA 2O9LA 2M2EA 5CVIA 1GV5A 1MD0A 1ON1A 2MD5A 5BQTA 3FKIJ 2ISYA 2FJ1A 4W8SA 5A89A 1T5EA 4HV6A 2EV5A 2WR8A 4MIMA 4P12A 1Q1VA 1Y1WJ 1WOPA 1XB2A 3CC2B 4X7FA 1VQLB 1PP8F 1NHCA 2COBA 1USTA 4CA0A 4IHSA 4EJWA 3A3BA 2PBIA 3QOEA 2TDXA 1AWCA 2V9VA 1FNDA 1YE9A 3LSKA 1V5GA 5FRMA 2KHMA 4YZQA 4HQMA 1VQLI 3W3CA 2K02A 2WAQA 5E8IA 4OOVA 3OE7A 4BPRA 5KSWB 3CCVB 1U78A 2WV1A 2HYFA 2Y69H 5E3MA 3DPTA 3PQJA 1FJLA 4G9YA 2FNAA 2WV0A 4RAFA 3VOEA 1BPLA 3HIFA 1WFXA 4XKWA 5JI6A 3OYAA 3L2VA 3PFIA 4QTRA 2F48A 4G7HF 4ANJA 2QBYB 3Q9VA 4CQJA 1IHMA 1EH8A 3WBJA 2DCEA 3OJXA 3ZBTA 3D0SA 4G6IA 1ELOA 4PJNA 1R6RA 1PP7U 3SHFA 1FYMA 4UB8C 2X0LA 1J75A 1UFMA 1G3WA 4NCNA 1UHSA 1YLFA 2L9NA 2RNJA 2V7FA 3F8CA 3IC7A 2LKSA 4WQMA 1OR7C 3TO9A 2HZTA 1RZ4A 2L5QA 2UV1A 2VXDA 2PMDA 4YAFA 2LVSA 3TGNA 1I50J 4S04A 4RM0A 1V3FA 4L18B 1HOMA 1TUIA 1OYWA 2IA0A 2DYSH 1D1BA 5KCMA 2RV8A 3WHBA 2KZGA 4DNCA 3LAJA 1A31A 3H3VK 2VBWA 3ONYA 3C2HA 3OAAA 2OD5A 5E3OA 1NTCA 3ZBUA 2FXAA 2NNNA 5C1EA 2DFHA 1MJBA 1NBMA 4O3MA 1WSVA 4XONA 3D5SC 2OBRA 2EWEA 1LUJB 2CS3A 1ULYA 2OQGA 2ZJPF 2XTXA 1FZPB 4UHTA 1OGOX 1K6OA 4DBQA 2X85A 1S6LA 2L54A 2A3SA 4ENJA 2E1RA 2IEKA 2UVEA 4X0CA 2RN7A 3CCVI 3GSIA 1NK2P 4TN1A 4M6VA 2LY9A 5JMCB 4XLEA 5EEGA 1ETKA 4E7KA 2D74A 3B02A 3S2WA 2QQAA 2BW3A 4M71A 1JJ6C 3MD2A 2LLKA 1QGAA 4XORA 2XASA 5GPCA 3PIOF 2ZJRF 2STWA 1E63A 2LH9A 2HFHA 2QGGA 4X1EA 2QA4I 2ACJA 2VIXA 1IJWC 3S2DJ 3ASNH 1OFCX 2AXTC 2AHOA 1UG0A 2CK3A 2M0CA 5DS9A 1P92A 5LRRA 3ZQQA 1APLC 2CSOA 4ZCLA 3GQ9A 3H1CA 1IAWA 1OYYA 1KMHA 3CPXA 3LA7A 2LYCA 4E7LA 4N3NA 4YHBA 2E35A 5E18F 3JQRA 1BIAA 3LL7A 3CQZJ 3DEWA 3HSFA 2X1EA 3TBIA 1DBOA 4AC0A 1O8HA 1MRZA 2F4OB 1N07A 4A6DA 2H8RA 2CC2A 5THXA 2R93J 1OCZH 1U6GA 2DA2A 2E2JJ 1HA3A 3I56B 1EXMA 2R7WA 2QWWA 2BM6A 1JI8A 1Q7YD 1N25A 5CKTA 3HG9A 2QSFX 4YAUA 3JTHA 3PNYA 3TW6A 2AXLA 5FA6A 1VHEA 1ZM9A 3M3YJ 3HGGA 2ZZEA 3CCEB 1G7RA 2ZC2A 1KQ0A 1B72B 3LA3A 1XTAA 4LGWA 2XVCA 2M34A 1DG1G 2KIQA 4A0XA 3GZ6A 5E17F 1O8KA 5H6QA 3LWFA 4N0BA 1XC5A 4EM1A 4GQNA 3EUHA 3RKYA 4DK1A 2XSJC 5K5RA 2INVA 4URRA 4I76A 2Y48A 1FP2A 1XPXA 3WTZA 2XF7A 1ZG3A 2YX7A 4F91B 1LJ9A 4FE4A 2JN9A 2Q6LA 3GBGA 2BSPA 1RETA 3LNNA 4ZDLA 1ONVA 1H88C 5D4SA 3FWEA 1LDDA 1F36A 5F0HA 1M1EB 4YAOA 4M73A 2ICWG 2DA1A 3IUOA 2PLYA 2R92J 4AYBA 3ZP5A 1UD3A 3BG5A 1VF9A 1KU7A 2O0WA 2JVHA 2K85A 2JJ1A 2L02A 1K9MD 3ZQHA 3BCDA 1ZM3A 4M3GA 3CUQB 2DK5A 4Z4SA 2CUZA 2GWRA 2G7UA 3PQKA 4IQJA 2O04A 1KCCA 2JIZA 1ZREA 3OYDA 2F4IA 3I53A 4FK8A 2OTJB 1BR1A 2DXIA 3Q3SA 3HC7A 1M1KD 4E7SA 1QHGA 5GPAA 3G71I 3I55B 2DA7A 2Y9YA 1MNMC 1SVLA 4AF6A 2QENA 4RJLA 1OB0A 3V7AA 1OPCA 5B1BH 4Y9RA 2B9SA 1QZZA 1Z1DA 4ZYAA 1V5VA 4RD1A 1FRQA 1PJ7A 3NAUA 1KK0A 3FXQA 2FNPA 5CQGA 2FMLA 2QKLB 3A01A 3EDPA 5J35A 1W0JA 2X53S 2WC2A 5IK2A 1X3UA 3UR3C 2OUMA 4QPQA 1DDGA 4Z03A 3DF8A 3FKSA 2XNCA 1XGNA 1P2FA 3N05A 4B3AA 4IXAA 2IA2A 2IGKA 2EILH 4E7HA 2IGNA 4QFMA 2Y0MA 4AIDA 3DEEA 2ZZFA 4OJ5A 4CYCA 2X6OA 4MFDA 2NNYA 3PUMA 3OOPA 2XZOA 2NOJB 3DBRB 2PG4A 3GYHX 4U88A 2DN0A 4JX6A 4ZH4F 3F0CA 4L5EA 1W36D 1OR7A 4PDKA 2GXGA 2B0RA 4AIHA 4XD7A 4AF7A 1X2NA 4FASD 2W6IA 3AGPA 4HX4A 3WGGA 4M6YA 5TV2A 5LMZA 3CJNA 3VSKA 4HQEA 3SQNA 3VMWA 1SD7A 3H0GJ 3OS0A 1G3TA 4XR6A 1JHHA 3ZMDA 1YJNI 3HJEA 1FTTA 4R1HA 3GLXA 1RESA 2R7OA 2XDVA 3BC8A 2KIUA 1VQOI 1HSJA 3PO2J 2XGJA 4RGRA 1T39A 1VI0A 1N75A 3HXLA 5L3CA 2VUMJ 3BOQA 3KCCA 3ULQB 4IZZA 1DDNA 2HNHA 2RDPA 3EETA 1EZGA 3JRIA 1TNTA 1QVTA 4A3DJ 1E43A 3N90A 4B48A 2Q6OA 1S7OA 4FN5A 1Z05A 3ONQA 2CW5A 3ML6A 1PE9A 1CF7B 1ETWA 3C2GA 2QBYA 3WNDA 4TMVA 2AQFA 1W36C 1HLVA 1IJFA 5BS6A 4A6EA 4ZZDA 3ZC3A 2R7QA 5ICEA 4AIJA 2F5CA 4A69C 4CCJA 4X0GA 1TNSA 1IC8A 4UZFA 3G4SB 5DDGA 5GTHC 3G2BA 2WSSA 5JBQA 2MA3A 1Y0UA 1XG1A 4I0BA 3QFSA 5FJ8J 1K61A 1B59A 1G3YA 2FU4A 3RPUA 2X4HA 4CGZA 3E1YE 4PC7A 2WB1N 3DLAA 3L2QA 3BZCA 1R5GA 4M4SA 3O8HA 5E6TA 2R7UA 2I8DA 4U0WA 2EIKH 3M9AA 3OIQA 2VFQA 2NSTA 2G7HA 2KIFA 4UVAA 1KRHA 2GOMA 3RKWA 5K7ZA 2I1LA 3PUFA 1VQ9B 1Z21A 2AS5F 2BE5F 4PC6A 1Z3XA 2P6SA 1R71A 3IL2A 1IUFA 1HQCA 4M2LA 1MZBA 3W2EA 2O0YA 4A0ZA 1QRBA 5KW9A 3I71A 3S8PA 1L1IA 2HWVA 4BYYA 1SEUA 5FLXZ 2KT0A 3CCYA 3ZOBA 1ZHFA 2OTJI 5FIUA 1YJNB 3QOPA 4LG0A 1Q82D 3HPHA 3T56B 3BQYA 4FT8A 1BLIA 2RAEA 1VQ7B 4TMZA 1E3HA 4BBSJ 4YEIA 4UY8I 1GVHA 3KEYA 3WTWC 1NDHA 4ENKA 1Z6TA 4CUGA 2DEUA 1AKHA 5H5JA 4QPOA 3GTMJ 1ORKA 1UD8A 3PUBA 2XPWA 4I09A 5CPRB 4BXUA 3VFZA 4CDGA 4HNUA 4RDUA 3VODA 3LQRA 5BOXA 5C4XJ 2R6HA 1GVJA 3EUHC 2QSHX 2JRMA 3IAS2 3J80Z 3I56I 2O7OA 4YEJA 2DLLA 5HODA 4HV5A 3CCSI 3BZKA 5IYNA 1XCVA 2L7KA 4YIFA 1GT0C 3J81k 4ZDPA 1GDTA 4CCNA 2UUZA 2HQ5A 2HOSA 2VKDA 4P96A 1IN5A 2M5WA 2VJIA 2XPUA 3V7CA 1WI9A 5A2QZ 2ZO4A 4HLXA 4M9XA 3SYTA 4WZEA 3BLYA 1P9QC 4XN3A 4XM3A 3WODF 1FNMA 2KJBA 1ZN2A 2XB0X 3MMPA 2Z99A 2UWMA 3IH2A 4G94A 5C1CA 1N78A 3TOBA 2JA6J 5DCFA 1QA3A 4G7ZF 1MMNA 3ERMA 3K4NA 5DD4A 3J7AY 3ASPA 3DU5A 1MSEC 3GZNB 4IO9F 2FQ4A 2CV0A 3BR3A 4KMFA 4KICA 2OV7A 4WF2A 4EVIA 2AHQA 2Y75A 3BWGA 2EBIA 4ETSA 2F5VA 1HW1A 3ZQ7A 1WPCA 5E8GA 4YFOA 3Q0VA 3LQ6A 1JUSA 4I2OA 4HYEA 3WTTC 3G73A 1QBJA 5CVVA 5J40A 1BQEA 4R79A 3AG4H 3F8BA 2PYHA 1R1TA 1ZGJA 2F6CA 2EFQA 3KP7A 3W2FA 3RZDJ 3V76A 4OIPF 3WU1B 3QFRA 1BW6A 1S8NA 2DBBA 2VOOA 4AWXB 4A3CJ 3DV8A 4IF4A 1F20A 1WP6A 2F1MA 4C9YA 2KRFA 1TQMA 4PFOA 3H5RA 1WZ2A 3C18A 1NG6A 4I99C 4Y4RA 5EMNA 3BT9A 2VBMA 3BR2A 3OIOA 1W87A 4ACAA 2VQCA 1A35A 2BM7A 4HX8A 1TZLA 2HTJA 1TT5B 4ZGNB 2B7EA 4EMSA 2JWTA 2JA7J 3OZVA 2KJCA 1UAAA 3TDUC 1KYZA 1BJAA 4E7IA 1XQBA 1QO0D 3SYJA 4W8QA 3E1SA 3MZ8A 5B1AH 3GQ8A 5M3FJ 2BM5A 2K9QA 1BI2A 4C2UA 5CQEA 2DT7B 1P7IA 3DTEA 3K1MA 2FOKA 3PO3J 2KDOA 1OGIA 3W2IA 4JK1X 3AGQA 4RGSA 1PJ5A 2O6WA 3OSFA 3GWZA 1JRGA 1GR1A 1LFUP 1Q81D 2C5BA 2NRAC 3HKZA 3OJWA 3MHPA 3FM5A 2M0MA 1X1BA 4MTDA 3CO6C 4AIKA 1RRJA 3FPKA 4HE5A 4LOCA 1O8EA 1KCDA 3JRBA 3E6CC 3BG6A 1RPWA 3DPLC 4XRSA 4XN0A 2CFOA 5ED4A 2KPMA 2XPVA 4NC6A 2V4DA 3VSUA 3BZ6A 1FNCA 1MABA 2PMHA 3AVXA 3VPRA 3QU6A 1QUFA 1V5EA 4WK8F 1T6XA 2VN2A 4X07A 4Z1MA 1UHMA 1OYIA 2DTRA 2DQRA 2BVMA 2ELHA 2OZ6A 2UXXA 5D4RA 1H42A 2MBFA 4ROXA 2BX6A 3ZSCA 3D5RC 1QUEA 3CCSB 1Z67A 2F4MB 1Y6IA 5J3OA 4E0FA 3KX2A 3GFMA 3ZQLA 2LG4A 1FMVA 4PSWA 1GV2A 1IDJA 4BE1A 4XICA 1A8PA 1LQ1A 1ON2A 4B3XA 5BPDA 2QGUA 5FO0A 3SZTA 4QVJA 3GUDA 1O8LA 3IWFA 3ISXA 1GXQA 1OISA 4N9HA 4BY1J 1SD6A 3L7WA 3VDXA 2DJIA 3FHNA 3VYRB 4CYDA 2OBPA 3TQNA 3WG9A 2V1UA 4RB1A 2IGMA 2QEXI 3LMWA 4DQKA 2NTPA 2Z2SB 1O8JA 2E1OA 4YIIA 2HR3A 3OS1A 2XF5A 1QX4A 2OTLB 1YHQB 1XGMA 4ZV4A 3I59B 1G6NA 4Z4YA 2ZMEA 3KPHA 4M9SA 5ILVA 2JJ7A 1TTTA 4UUSB 2GJKA 3W6VA 2MH2A 2KRCA 1O7FA 2FE3A 3F8MA 4L9VA 1FDRA 1XSXA 5F4OA 3KEWA 4MEYF 3H92A 2MLGA 1YLOA 3MEXA 4HF0A 3GTJJ 4A3FJ 3H9QA 1U0JA 2VKEA 2QQ9A 2W6JA 5B5EC 2DFIA 2VYQA 1S72B 1YFHA 2GBYA 4GYGA 2HLDA 1EE6A 4JRAC 3AG3H 5EEAA 3CDIA 4YIRX 4RAGA 3OL4A 3NB2A 2HYJA 2LF8A 4V19K 4XQFA 4IW3B 1FEXA 1VQNB 2Z16A 1FLIA 2X9DA 3JRAA 4IHWA 1D5VA 5D8KB 1EA0A 2OA4A 4D0PA 1U2RA 5A2QK 2F4NA 5FFZA 4C2LA 2CUFA 3TMOA 1A04A 1WJAA 4U0VA 5JHUA 1O88A 3BCFA 2DK8A 4PJJA 1UD6A 2OK7A 2J5OA 2DMTA 3E6DA 3K2AA 1WVRA 5E79C 2DA6A 1SM4A 2K86A 2DMUA 4WCGA 1WU8A 2NYXA 1REPC 4FQGA 1PJRA 1KZHA 2K9LA 2BGJA 5ICFA 3CF2A 3I54A 1BW5A 1RQPA 3BCBA 4A93J 1P4MA 4CCMA 2GK7A 2QEXB 3TP3A 5LLQA 1WJEA 5LRSA 3LQEA 3P26A 3L2WA 4TMXA 2WA0A 4ZJZA 1TT0A 1SVOA 2BY2A 4RD3A 2GAUA 3KE2A 2E2HJ 3DKYA 3MKWB 4XRFA 1I6XA 2IGOA 2R3SA 4L0ZB 2OBSA 4ENNA 3SXYA 1AU7A 3DBHB 4Z4VA 2FUG2 1CNFA 4PGOA 1IN6A 2E1NA 2LY2A 2XF6A 1MSFC 1QH0A 3P27A 1ETYA 2JA2A 2XAJA 1ETQA 1V5FA 2NT6A 3KZZA 3TOAA 3S32A 4Z6YA 2HMAA 3RZOJ 2V7XA 2RREA 4G7XA 3ZMZA 2L9RA 1QVGB 4E6KG 1HBXG 3VNUA 4Z4RA 3MCZA 4K1XA 1F60A 1FT9A 5KVRA 1G7CA 2VKVA 4C3HJ 1Z6RA 1LFBA 3M8FA 1D2EA 2M87A 4OP7A 5HDGA 3LSRA 2XGDA 1WSRA 3GVJA 3CC7B 3HEFA 2VT3A 5CVUA 5AONA 4LBZA 3GQAA 1IUYA 1WTHD 3RSNA 1IN8A 5EG0A 3AVYA 4RDLA 2F3LA 3TEDA 3RYPA 2R7TA 3LVBA 1WPKA 2ELKA 2E34A 3RKXA 2HDCA 1BC8C 2ZTGA 3DKXA 3DKWA 3VMFA 1AIRA 1KU9A 3CDHA 2OTLI 4EJTA 2M4KA 1Z7UA 5ERIA 1IN7A 4P6YA 3JX8A 2V9KA 4QUZA 1VQPB 2VT2A 3M7GA 1T6ZA 2QA4B 2H27A 2OK8A 2WZNA 1CZFA 1YS6A 2VQGA 2IS1A 4ZCMA 4PC2A 4ZYDA 4OPVA 4BKXA 2JSCA 4II2A 5GV7A 3RTRA 5IOZA 1E3XA 3K4LA 4TSFA 1FC3A 1G8XA 3I3LA 2ZJQF 1YX5A 1FYKA 3B90A 1ZRDA 3CMEB 3AL0B 1OB5A 3I4MJ 1QGYA 5KHDA 2DFEA 5DYMA 2LSOA 3S1RJ 4TKOB 4V2FA 3TL4X 2VNJA 3EUAA 3ZCOA 2W85A 3BQJA 4IPAA 2FA5A 3H36A 2NS7A 1JTAA 3B73A 2DYIA 1HDPA 5HDNA 1R5OA 2XSDC 4KYWA 4RD4A 1MBEA 2ETHA 2GOXB 4N4OB 1ZRFA 2O0VA 2LMDA 1DU6A 1NG7A 2UVFA 4MTEA 4YAWA 1N0UA 1IB4A 1BHEA 3N4MA 1J59A 4HX7A 4KIFA 4BEHB 4L9NA 2TCTA 1DU0A 3B4NA 1V54H 2D45A 2Q0OA 2VBUA 2XNDA 3ZPPA 3G4SI 4RAYA 3MWMA 3KL9A 4OOSA 1BA5A 2V5IA 2JRTA 3WHCA 3BTLA 1R1VA 1WJFA 3GRHA 3CMYA 3ZPNA 3TO6A 5L46A 1YX2A 1JGGA 2M8GX 1K28D 4CH7A 5TGTA 2K9SA 4OZYA 1ZR2A 1H8EA 2VBEA 4RM2A 5A88A 5HS9A 2NSPA 2XT4A 5DCMA 3OV8A 4DYCA 4YZAA 3LA2A 4Q48A 4UUTA 4IRHA 3SFIA 3ASSA 3RKQA 3DU6A 4Z4ZA 4Z2YA 3M07A 3P5JA 4KMUX 1UD2A 2FEZA 3CD6I 3MKZA 3FK6A 2VC1A 1BI3A 3HRTA 1GXPA 2OQRA 3V7RA 2XV4S 2Z1DA 2ZL5A 3U1DA 2DMQA 2WAEA 3CC4I 1C0WA 2D9RA 3HOZJ 1Y0NA 4MFEA 2X51A 2HS5A 5J47A 3G71B 2FSWA 4F93B 3LSTA 4PJMA 3E3VA 1XD7A 2WJVA 3DP7A 1OCCH 2ZXIA 2MYSA 2DFFA 5J6XA 5LBQA 5FLMJ 2P8TA 1BC7C 5TR9A 1KYWA 1KK3A 2CW7A 1LM1A 1PLUA 2Z8GA 2VFNA 3SEJA 2JMWA 4OM9A 1KONA 3J80K 5IYRA 3ZZTA 2L9VA 1YRNA 2DMPA 2ZMEB 1FOYA 2XIGA 1T56A 3L9FA 4UUSA 1SAXA 3OPOA 1SVMA 3I59A 4XRSG 3B78A 4Y17A 3LSIA 4AM3A 3TP0A 2LK2A 4F55A 3GIRA 4I84A 1JKRC 1B9MA 2VZLA 1D1NA 4MEXF 2D1HA 1FTZA 2LBFA 4ZYGA 5FO5A 5HKKA 4OIOF 3PFYA 3S3NA 4XOPA 2HQAA 2PN6A 1VBLA 1K4TA 3VYSB 4NC7A 3GTKJ 1WDTA 2D3LA 2A07F 2HOEA 5F1RA 5ICGA 1IXCA 4BY7J 4FWTA 3F9KA 4G5GA 2E5ZA 1Y1VJ 3Q0WA 2IW5A 2LKPA 2TRTA 1E3PA 1CNEA 3DDYA 3SDBA 5B3SH 3AG2H 4U87A 3I58A 4Z4TA 3ZMUA 2NVUB 5AMVA 1I39A 5DD8A 4O5VA 3QP6A 4ABZA 5JFRA 3I55I 3EQOA 5E1WA 3C1DA 5EDNA 2DPDA 4HDVA 5HDKA 3DEUA 2PQ8A 1BIBA 1WKMA 1QNTA 4B1RA 2FBKA 1TC3C 3GTQJ 3QFCA 4ESJA 2H94A 3QYFA 3VMVA 3WTSC 3I64A 1FIAA 4BHPA 2A5YB 1O7LA 2NOGA 4A5NA 4BH9A 2KP6A 1B72A 5ICCA 1L0OC 3NAWA 3ZMVA 1JTXA 3K4BA 2W7NA 2VASA 4CO8A 1IZ1A 2R5YA 1ETOA 2E7WA 1KA8A 2A61A 3TKYA 4BUPA 4M1KA 3F22A 4OINF 2GREA 3CCLB 1BL0A 1RU4A 2P5VA 4XMYA 4L9JA 3ABMH 2MLKA 1D3YA 3ZQIA 3A8IA 3T0YA 5ILUA 4RPDA 2YUSA 3O8GA 3JREA 4UUVA 4WXHA 3X2QH 2K9NA 3BJAA 1JXSA 1T8IA 2BV3A 2PE3A 2DT5A 3U6KA 3GVKA 2VFPA 4NB5A 1AOYA 3LSGA 2LTPA 2BW3B 2O03A 4JX4A 2WJYA 3ZIAA 1VQ5B 2V7VA 1RC9A 4LG3A 3P9CA 1MJ9A 2X1CA 1XS9A 2XKOA 4W8TA 4NBQA 3T5XA 3OYKA 4W97A 3BQZA 1ZGAA 3FISA 3HRUA 5M5WJ 2RGVA 5LD2C 2BPOA 3KP2A 3VSLA 5LHIA 3NEUA 2GK6A 1T6SA 2DT6A 2MD0A 1ZM2A 2VBTA 1G3SA 4A3JJ 4M53A 3F8FA 4FX0A 2V7WA 1W9XA 2M3AA 3MCAA 1Y8RB 4Z4WA 2P6TA 3BCAA 1QFYA 5IY5H 4A12A 1O4XA 1PVEA 4OJ6A 1YTYA 3G1MA 2IP2A 2XOKA 3D1NI 1ETXA 1SD5A 3ABTA 3WE3A 1CLWA 2I10A 2V1NA 1U9NA 2NPFA 3H5NA 4YZXA 2QCOA 5K7HA 2QY1A 3HOXJ 2RNGA 1E2XA 1O8DA 4G8XA 1YYVA 5EYRA 4CZZA 2JSPA 2CFXA 4YALA 4GGGA 2XRNA 1LB2A 1EFCA 5F0CA 3DXJF 1LEAA 2DCUA 2GA2A 4XLAA 4UZEA 3K2ZA 3ZQFA 4OIRF 2YR2A 5HOOA 2O61A 2Q1ZB 1IRGA 1SANA 4S0HB 1DGRM 1HW5A 3UKGA 5FROA 4GYIA 3BTCA 1QGPA 1XSVA 3ABUA 2N8GA 4BGDA 2WY8Q 5L3EA 1HSTA 2L3DA 1BR4A 3JR9A 3ASRA 1U5TA 3JCUC 1K5CA 4Y52J 1RKTA 3EQLF 3ZZ0A 3J7YJ 1MDMB 5DCMB 2X3HA 2DERA 2A5WA 2LF7A 3OWTA 4DIQA 5HNHA 5FGMA 2KZVA 2W82A 4U0YA 3T53B 3FXOA 1YW7A 2LREA 1IDYA 1YHQI 1FOKA 2OZUA 4O6JA 3TDZC 2JA5J 2WAFA 3K1PA 3A3GA 3B82A 2WWYA 3HKZN 3CCMB 4NK6A 5DS0A 4PUSA 2Y9ZA 1BJZA 2QN6A 3QPTA 2H6CA 3ZGKA 3T1BA 3TH0A 1KQ5A 4Y15A 4E4HA 2XC7A 1F1ZA 4BEHA 5A8AA 2DA5A 3I1FA 3K70C 5F04A 4WX9A 1S72I 4M3BA 3F21A 4MNUA 2M7BA 5JR3A 2E60A 3W2GA 1TLLA 3K9TA 2BGCA 4D1QA 4XL9A 3ISPA 4X06A 4TMTA 5LFAA 2A6TA 1FOWA 3VNVA 2V6CA 1R49A 3LQQA 5C3EJ 4M74A 2DYRH 3H35A 1I1SA 3HTUA 2BM1A 1W7PD 2LBFB 2DU9A 3H5AA 1R4NB 3ZRGA 1KU3A 4LFUA 3FM3A 1YI2B 2ZL7A 3V8JA 1NRKA 1J5YA 2CRGA 1GQ8A 3OYFA 3ASOH 3OYJA 3GW2A 5C44J 1PDNC 1RUNA 4HBLA 4DNTB 4B3GA 4X7DA 2VNIA 2HPMA 2FVGA 1Y39A 5KK1A 5CVJA 2C78A 4N9IA 4OMZA 3RQ4A 1X1AA 3FXLA 3KEOA 4XKBA 1SFUA 3KP4A 4DZPA 1AIPA 3CTAA 4U49A 1VLYA 3SZEA 4A5MA 5C4JJ 3ECHA 2QYUA 3ZMTA 3WTUC 5AIQA 1T33A 1X58A 4M3FA 1S5LC 2BHZA 2JVGA 1YO5C 5L3DA 1ZELA 2J5PA 4YELA 3JU4A 2E7XA 3OOUA 5FFXA 3U2QA 2BGIA 2ZB9A 3A0BC 5L3FA 3SUCA 3GVAA 3ERED 4H0EA 1OB2A 2QMUA 2LNBA 4U7BA 1FNNA 2BSAA 2W1OA 4MHGA 3FXUA 4OIQF 4KKTA 2W00A 1Y8QB 2BBYA 5E3NA 2KLOA 1HA8A 2ADUA 3FBNB 3VYUB 1WQ2A 3DWLE 5BNGA 3ZR8X 1E17A 1OFEA 1TWGJ 2MSYA 2JDIA 2R5YB 3V8KA 5D6FA 3GFIA 1K8AD 2CRVA 3GF2A 4HWVA 3QRFF 3SEZA 1LKXA 1ZK8A 4RDJA 3RYRA 3WQZA 3OYEA 4M0LA 2D2WA 3LJYA 4LD5A 1CF7A 1HVXA 1COWA 4DZJA 4EEFG 3SLNA 3U21A 5D5VB 2GA1A 2YU3A 1O8FA 1OFLA 4F3QA 3OSGA 1TLHB 2E1BA 4XRMA 4RAZA 2MC3A 1CQTA 4B3FX 1IN4A 4V2GA 4LITA 1RKWA 4PAAA 4RDKA 5DN6A 2P81A 4M6XA 5FD5A 1B4AA 4CZCA 3G6EI 2V31A 2VKHA 4IRIA 2X3UA 2K3PA 4ACBA 4XLNF 1ZH5A 1EP1B 1Y0RA 4WXCA 4ASNA 2XC1A 3C3WA 4ZZLA 3HOUJ 4DYRA 1VQ6I 1UCRA 3CCMI 1Z9CA 4RD0A 3F8NA 3WG7H 2BVLA 2CO5A 1YIOA 1DUXC 3R0JA 3CLOA 4G12A 1POGA 4A3BJ 1OJLA 2ECCA 4E7JA 4HOBA 3DFGA 4XOTA 2KL4A 3BPVA 1XDUA 3NWSA 1HKSA 1FPQA 3S3MA 3K6GA 1TSPA 2EFWA 4JP0A 3K10A 3LYCA 4MR0A 1O3SA 3W5VA 1WXRA 4JYKA 2O8XA 3OOCA 1GO2A 2OBTA 1K6YA 1W7PA 4MLOA 3OZWA 4QIWN 2D5VA 5D5UB 3BY1A 3U6BA 2O1DA 3W2VA 2VBZA 2C2WA 3QPHA 4DYQA 3A2KA 3E6BA 3IRQA 2XZPA 4M72A 3E5XA 4GCVA 3HL2A 2PIAA 1TYWA 4BAYA 2EZHA 4OMYA 4XLFA 4D9JA 2Y31A 4X6AJ 3A8JA 4PGHA 1D8JA 3IAM2 4EH1A 5LEJA 5DUKA 2F2EA 1B6AA 1DDIA 1E1QA 3V7SA 1VF7A 5EJCA 1VQNI 4NDLA 3RIRA 1XB4A 4RGXA 2M4GA 2YS9A 4MO7A 2ZXJA 2ID3A 2COMA 2VQHA 2FQ3A 5J4YA 3GTLJ 3MAJA 4RLZA 5IP9J 1R9TJ 3GZ5A 4IJAA 5DEQA 3ONUA 4LBYA 1YQAA 3ZQCA 3RQIA 2M5SA 2ZTNA 3BR0A 3U9GA 2WPDA 1YIJB 2CQNA 5TY0A 1WMRA 5DSZA 5J4VA 4BHCA 3RI4A 2H1LA 1YJWI 4IEJA 1K7AA 1IGNA 2K27A 5IOYA 3HOSA 4KUMA 1O8GA 3IKTA 1PUEE 1E1RA 2DDBA 4P1WA 2EIXA 4QVAA 2W48A 1WJ5A 3K70D 2VJ5A 3GTOJ 1BI0A 1MMGA 2CQ7A 3ZZUA 4L8JA 2Q8KA 2NVQJ 4KITB 1G7TA 1X3ZB 2M1BA 3CCRB 1W0KA 1O8MA 1A5JA 3FMRA 2BEOA 3HTSB 1MBHA 1W1WE 2HVRA 1KZLA 2HU9A 1UG2A 2QLZA 4G6DA 3HUGA 2NAZA 3BJOA 1PYVA 5GV8A 2VNKA 1IXSB 5J1UA 4LMYA 2ELJA 1J7KA 1LFPA 2J7KA 3BH7B 5DNSA 3QQAA 5K5OA 1VQKI 2R4GA 2YWEA 2A6EF 4UB6C 5FKLA 3SJMA 4RD6A 4OJLA 3W2HA 5D5XB 3E5QA 1K4SA 4KDPA 3FK7A 5GTIC 2VFMA 1QG0A 4P55A 2HOTA 4KKSA 2QKMB 1GUUA 3PA2A 1TQPA 2CW0F 3G1LA 5E1ZB 5DUIA 5CVRA 3RJPA 4DBRA 3JAMZ 3PVDA 3MMYB 1SAUA 3B8YA 2VBSA 4BQQA 4HF1A 2YX4A 2ME0A 2XKPA 4HNTA 3KZYA 2CYYA 2CGPA 3KIOA 2O8KA 1IXRC 5B6IA 1BJKA 3VO1A 1WORA 2DMNA 2ZBVA 2W84A 1D0XA 3G1OA 1OQYA 4L9TA 4RLFA 4C3JJ 5L3BA 2G0EA 5J8CA 4J01A 4FHTA 4BU2A 1YW8A 4KIGA 2CV1A 2QTZA 1LDJA 1ODDA 1DQUA 1EWYA 4G7WA 1QZYA 2P4WA 1O3RA 2BVNA 4GFBA 2EV6A 3P7NA 4QV2A 1VQOB 3RIQA 5IT9K 1MIJA 4CSWA 1RR7A 3OYMA 3E7LA 2CMPA 3SEQA 3KLOA 3Q3AA 2ESNA 2IVMA 1RMGA 4A3EJ 1V4RA 3J81K 4IX7A 1WWXA 2HDDA 1KD1D 4EGYA 4DJAA 3S93A 2ZITA 2KRHA 1ZQ3P 2XAHA 5J1YA 5H2FC 3PNVA 3QYBA 1IRZA 5CLSA 2X8KA 1VQKB 1F9NA 3CMEI 3V42A 2E1CA 3L09A 2PI0A 4NBSA 3O6BB 1DP7P 1I6HJ 2VC0A 2WTEA 2VJ4A 3M8EA 1NB9A 3CDLA 1MJAA 1JGSA 3Q0UA 4D7MA 1V0FA 5FB2A 1X0CA 2JJ2A 1D0YA 4NHJA 3LAPA 1E0EA 2YWGA 1TWFJ 3T8TA 3TW7A 3CMAB 3GFJA 5FRNA 5F64A 1QVFB 4WXDA 1J0RA 3KLNA 5KAFC 2W4SA 4RB3C 1O57A 3IV5A 2F5DA 2B7CA 1AA7A 2IS2A 4CHUA 1TQIA 3CO7C 2QZAA 1EFRA 3REOA 4LB5A 3LSMA 2Z6BD 1QCXA 4YDTA 4YZ0A 1B8IB 1TWAJ 4UV9A 3CJTB 4PZJA 3LNQA 4C3IJ 4BQAA 2FX3A 5JLXA 2K7LA 3F3XA 3ZQGA 1XCBA 3FF5A 1VQ6B 1ZAOA 4ZTJA 1VNDA 2ZSIB 2XEXA 3E97A 5DTDA 2HPIA 4FE7A 3W6JB 2JA8J 5CDFA 4LLLA 3EYIA 4OPOA 1QGZA 3CCJB 1A6QA 3L2RA 4IVNA 2XB5A 1XMXA 1UMQA 5D8LB 1LNWA 4TV7A 3JSOA 3GTGJ 2XTWA 5M3MJ 2E1MB 3LO8A 2RQPA 1S29A 1WH5A 1EF4A 4TMWA 4YXWA 3OW2B 4I0AA 2EQRA 2XROA 3Q39A 4CYCB 4KNYA 4N3GA 1JUMA 4FCYA 3CP2A 2QXZA 2VPRA 4D5FA 2XAQA 3J7ZI 5L3GA 1AHDP 2V7TA 1XSDA 2JUCA 2ODLA 2A6HF 2JPBA 2L4AA 1J2XA 2B7BA 4UZUA 2FBIA 2NVXJ 1NB0A 2DOFA 1SFKA 4ZYHA 1ZYRF 5M5XJ 4Q5SF 2LDUA 2D3NA 1XX5A 2AQEA 2V79A 2K9MA 4YFNF 2Q6IA 1BM9A 2DA4A 2VB6A 1JTYA 1TTYA 2IS6A 4KA4A 5DV5A 3KETA 4FETA 2R7SA 3AFHA 5FD6A 2EA2A 4U4BA 3BY6A 1R23A 3FXKA 2IBDA 4OWRB 4EW9A 1EKEA 3VYTB 3E5UA 2ZMEC 3HM5A 4RLQA 1IF1A 3N6ZA 2LR8A 1MGTA 2ZXWH 3MZYA 1E79A 4EJOA 1LE8B 3OKXA 1EH7A 3H3UA 3KZIC 2GM4A 2K4JA 3CUQA 4AUXA 1MW7A 2FRHA 2EWNA 4WWVA 3QODA 3DLLF 3JRHA 1KK2A 1KJZA 4OJOA 2EIJH 4CCLA 3Q9SA 1TVCA 2DTZA 1XGSA 1GAWA 4UNOA 2Q6KA 2L7ZA 2NVYJ 1T08B 1W0UA 1G7SA 3LMMA 3BJ6A 2XZLA 1F4KA 5FKMA 3B8HA 4OPWA 1EFUA 2MFZA 2W7ZA 2GIZA 1W5CC 1YS7A 2R7XA 4P26A 3G05A 2Z33A 2EIMH 3BG7A 2LKXA 3BH6B 2NT9A 2A69F 3H09A 3ZN1A 4Y7CA 3MFKA 1Z91A 5D5WB 1N0VC 1G4DA 3FMSA 2ID6A 5JHFA 2RC4A 3OS2A 1OHHA 1TP4A 3QU3A 1OCOH 1IJEA 4FXUA 3OYBA 5KNLA 3PNTA 3HRMA 3JRDA 2JK3A 1W34A 2BY0A 5FKKA 3J7AO 3JQQA 2HQNA 4RB2C 5EG0B 1JA1A 2E5NA 4NC8A 1I1GA 2YWHA 1W4MA 5KAIC 3G3ZA 1EP3B 5E1XA 1U3EM 5FLVA 2VBVA 2V1XA 2CJJA 1ZKGA 3JAMK 2WZPP 1MMAA 2FX0A 1N05A 4GDFA 3SLDA 2RQQA 4BJ6C 1USSA 2AO9A 2KKOA 3H0DA 3HPGA 4HG2A 1GAQA 1R1UA 2OC6A 3QPSA 3OW7A 2F5EA 1W5SA 1S9HA 3MVPA 4Q47A 4LLGF 2BV6A 2R9VA 2DO7A 1VQPI 1U5TC 2KVOA 3FBIB 3M4OJ 5F1JA 3AVUA 5IT9Z 4QSHA 4HF2A 4BJ5C 2YPRA 1UJ8A 3CCQB 3H9GA 2XHKA 3GEZA 2DOGA 3B6AA 4L5JA 3CCUI 3NE5B 1FX7A 1D8KA 4RA2A 2V26A 4F7ZA 2P3MA 3LSJA 1HF2A 1BBYA 3S15J 2E1MC 3RY8A 2DOAA 4ON0A 3L2UA 2ZFWA 1JKOC 1K83J 2CUEA 4I6ZA 1BX1A 2K4BA 4LB6B 1E64A 2ZZGA 4CXFA 3PSZA 2OJED 2WYRA 2HYGD 1S4MA 3ASTA 4PK4A 3JRGA 1QVUA 1F5TA 3VSTA 4G7OF 3KP3A 4RCZA 3BR6A 5FKOA 2JT1A 3IP4B 4Q4ZF 4E70A 4PMHA 3HHGA 5IT3A 1B1BA 2L7MP 2VOPA 1QU3A 3BPXA 1YX3A 5FKNA 3I9V2 3I5UA 2Y0SN 3SY2A 4HPQA 4LC0A 1R5HA 4P1VA 2RVCA 3S1QJ 2QYOA 1NK3P 1MBGA 4BXXJ 4HE6A 3D5LA 1YG2A 2HCJB 4X8IA 2BN4A 2DPUA 4KISA 4OZZA 3CMAI 3HZJA 2HEOA 5K5QA 1BR2A 2JTVA 2QUFA 3K0LA 2R5ZA 1PKVA 3GMEA 1DARA 1WRJA 3WXMA 1Z7LA 4RPBA 3QYEA 1H8AC 1IDZA 2INUA 2ZNYA 4PC3A 4HZFA 3CC4B 3WBKA 1LLWA 2G9WA 4UVBA 1MNEA 1AKHB 3KRGA 1HKTA 1IRFA 1I3QJ 3RCOA 5HS8A 5TISC 2FOWA 4A3GJ 5IYPA 1U2WA 3CJQB 4BS9A 3OY9A 3VB2A 2QM3A 3K7AJ 3R6SA 2H1KA 2BY1A 2EH3A 2EINH 4U7DA 4PFPA 4OU0A 4UVCA 4XK4A 5E20A 2QSGX 1JT0A 4ZDOA 3Q6RA 3OP1A 4G6QA 1T95A 3WGIA 3JW4A 3E0JB 2VQLA 5BPIA 2PMZN 1F43A 2M7AA 3ROUA 3CB4A 1S7AA 1T98A 3K1NA 4A3LJ 1I7PA 5F0FA 2WAQN 1VQ7I 3LFUA 4Y13A 4IHVA 1TYXA 2GQFA 3BR1A 4WZLA 2DW4A 4CCOA 4ZGQB 2C4TA 4WZKA 3FZVA 3C2BA 2DY1A 1LLZA 3CZ6A 3CCEI 4EGZA 1WOOA 2XGXA 3GXOA 4RM3A 3S17J 2X0KA 1SD4A 3OL3A 4XNFA 4BL0B 2WBMA 4ESBA 1B8IA 4F52A 2L9SA 1YJWB 3E20A 1RWRA 3A4CA 2V6EA 3A02A 2EB7A 1VQMB 4BDZA 2XNJA 5HLHA 2CG4A 1P4AA 2PFBA 2MC4A 1FRNA 1FYLA 1QJVA 2EFNA 1H89C 5F08A 4XSZF 3T9GA 3SZGA 1RIOH 1FIPA 4G6TB 3PIPF 3JRFA 3GQBA 1P7JA 3QFTA 4P6VF 4EV0A 4KFCA 3A1YA 3KYCB 2O17A 4DQLA 3WGHA 2L4MA 3KP6A 2V4JC 4BJTA 1B2RA 3OFNA 2H6BA 1J9ZA 1X4OA 3VR6A 4Z06A 3P4GA 3NRVA 4F92B 2BF4A 2PX9A 3R4KA 3JSPA 1BN5A 4YFXF 3OYIA 4LIUA 4XLCA 1H85A 3EUKL 4FTHA 2F1LA 1RQRA 3HOYJ 2O5RA 3CCRI 3BG9A 2Y30A 2JPCA 4M9ZA 2P7CB 5B66C 4FX4A 2GLOA 1WH7A 5FLXK 1QA2A 3MQ0A 3HDDA 1Q86D 1XMKA 3Q38A 2HVSA 1ENHA 3S1MJ 5FL7A 1JKQC 2CQQA 4B09A 3L2CA 3N97A 3IWZA 1W2BB 2LY1A 2VI6A 3K4MA 3G6EB 2Z9OA 2M45A 5K7FA 3ECOA 3FX3A 1K78B 1W35A 4S05A 2YUHA 2R7FA 3F72A 2IOUG 2LFBA 2IT0A 1XFOA 3PL8A 4KH3A 4AYBN 2HDWA 2QVOA 3WTYC 5GP9A 3L1PA 5EGOA 4N4NB 3DCFA 2W24A 4Y3OA 1TW2A 2VL8A 3A01B 4QHYA 4JMQA 3HOVJ 1VTNC 1D1AA 4ZC3A 4RMNA 1X1DA 5FO1A 3B6CA 3WYAA 3TO7A 1EFTA 2QQBA 4J0QA 1Z3YA 4WWCA 3W5UA 5IPAA 1D0ZA 5CYVA 1PUFB 4ZCIA 5IYCJ 1LDKB 1IO2A 1X2MA 1N06A 3SJPA 1MMDA 4DW6A 1VQ5I 1UD4A 3COAC 4P9SA 2PMUA 1HZEA 4MQVA 1JUPA 3R6JA 4IKFA 4C0SA 1LVAA 2HGCA 1H80A 1JHFA 4HNVA 3H3ZA 1SFXA 3P9KA 2H8WA 5HVQC 5D6EA 2MG4A 1V0EA 1Q9SA 1R4MB 3UW0A 3GFLA 2ZZQA 4HA8A 4BDYA 2PJRB 3WTVC 3M1CA 1RI7A 5EEHA 4A2UA 2O3FA 4EJVA 5LGUA 2NVTJ 3AL0C 2R5ZB 2YU9J 1O3QA 3MKYB 3CJRB 4PC1A 1KK1A 4BACA 4RB0A 1KQ9A 2PECA 1A36A 1VQ4I 3S3OA 2L01A 4PJ0C 1FX0A 3QE2A 3W6KB 3WWGA 4Z05A 2QE7A 1X4PA 1L3LA 2GQQA 2XAFA 3T8RA 4UXNA 1S0UA 3RPQA 3ES9A 3H94A 1QFJA 1DGWY 1HXDA 4UV8A 5J1RA 3GX4X 2EFOA 4IQ4A 1SC7A 2A68F 4TT3A 2NV4A 1FBUA 1QHHD 2CQKA 2XRLA 3SKBA 1N8RD 1OGMX 3VWBA 2OCCH 3FDYA 2VE9A 5H6RA 4GXOA 4F7DA 2K40A 3ABKH 1FBSA 5IYQA 1HCRA 3GTPJ 2M8EA 2X48A 4EM2A 2CF4A 4GRIA 4PABA 3ESWB 1QQ1A 3F6VA 3ZPLA 3JTGA 2ZXHA 4J19A 4Y9UA 2IQ7A 3FXMA 1UB9A 1W7PB 3BTJA 1YIJI 4KIBA 2QF7A 3AG1H 1WJBA 2P0WA 4B43A 1W0TA 2L7FP 1N08A 1GLNA 4YCQA 4HLYA 2OAZA 1JB9A 2DETA 1U8BA 1U8RA 1MBFA 2VBKA 4MQ9F 3ML3A 3HOWJ 5HXBA 2NXNB 2X6YA 3VEPA 3OEHA 3OEEA 4ASUA 4A3MJ 2DA3A 1BI1A 2LD5A 1WSUA 5IYBJ 2B5OA 4XBFA 5DM6F 5BSYA 1YITB 1W5TA 1NJID 4V02C 4GO1A 4BQOA 4P3IA 2EFPA 4D5CA 2FD5A 2L2OA 1NH3A 2EZLA 4ZYEA 1WOSA 3CRZA 3DPUA 1TW3A 4UAJA 3H9NA 2C4UA 3OZUA 1ZTRA 2Y2ZA 2GXAA 2UZKA 1IDKA 2W57A 1V55H 2XAGA 3OYHA 1ZLKA 1BX0A 5HZAA 5J8FA 1WJDA 1Y0YA 5GAGJ 4BNCA 2PJPA 5EF6A 2R0QC 2NS0A 3CC2I 1FMWA 2IAIA 1UZCA 3FHZA 1R58A 1FWZA 2IXSA 2WB1A 2XT2A 4LJZF 4MYUA 4B4DA 1EH6A 4IRGA 1TWCJ 3QWLA 1KC8D 2MABA 3ELKA 5F6FA 1OCRH 1R7JA 2BM4A 1IRXA 2VPLA 3R0AA 2A05A 2GPJA 2KDZA 2KIMA 5IP7J 4P3YA 1CGPA 3R61A 1P6RA 2LP0A 2R7ZJ 2HTSA 1IA5A 1SMYF 1KGSA 2VBXA 3HUGB 1HF0A 2Z3YA 2M9HA 3CW2A 1JKPC 2PLFA 3OYNA 3F23A 2GJRA 1MKMA 3P9IA 2C5HA 1R00A 2HVQA 3RPUD 3BY2A 4EATA 3C7JA 5DM7F 3MZHA 3OYCA 2L0KA 1HKQA 4I98B 3EQNA 4K2EA 1X1PA 4EQQA 2EPFA 2R7VA 4HSTA 1KTVA 1TWHJ 5IP6A 5LHHA 9ANTA 4OAZA 3E6MA 2FMYA 3O2PE 4AVZA 1DBGA 3V4GA 2Z5UA 1EV7A 3W5HA 3M8JA 2D1VA 5F27A 2NTQA 3PUNA 3CXCB 2BXYA 3U2RA 4M3EA 4LBVA 1TYVA 1D8TA 4BQNA 1WHUA 3WNBA 2ISZA 5ILSA 1EA3A 3A1PA 3IKVA 2PJRA 2CUJA 1QFZA 1ZM4A 1T0FA 4C2MJ 1K79A 6PAXA 1ITYA 1FNBA 1JNYA 4Q7JB 1R5ID 1OMIA 3CF5F 3FMQA 2VONA 4ENMA 4C30A 1YW9A 3I0TA 3W2AA 4JQFA 1G59A 4B47A 1PUFA 2DOEA 2O6GE 2FBHA 3SZPA 1Q1HA 4NQWB 1RUOA 2HKXA 3AK5A 1QPIA 4R71A 4PJLA 1LVKA 5EZHA 2BY3A 3CLQA 4KN4X 1M90D 1ZG1A 3M1EA 3S16J 1OGJA 3SFZA 2QDXA 1PJ6A 3BH4A 3HBLA 4LG0B 1FBQA 3IHUA 3HSEA 3GLLA 4AU7A 1JE8A 3VO2A 1R36A 2NS8A 2VJJA 3WU2C 2R7DA 4FISA 1IW7F 1TBXA 4X7CA 1K78A 3IH3A 2Q2EB 2DJNA 4L0YB 2MH9A 4HIZA 3CPWB 1DABA 3SQVA 1E3ZA 3D26A 3WTXC 2LOOA 2JN6A 3DTIA 2ME6A 1VQ9I 1ZGWA 2HXOA 5EZGA 5GAHJ 5EGOB 2P7VB 1XE1A 4C43A 4AD9A 2X6XA 2DQLA 4P9UA 2DODA 1ZRCA 1GHCA 4A3IJ 1FOXA 1SKQA 4I01A 3HRSA 2KQRA 2NZMA 1MNDA 1FP1D 2OF7A 4PGGA 1SFOJ 1G2HA 4XKVA 5JLWA 2P5KA 3WU0A 4BE0A 2E36A 3ZXSA 4A0YA 1J09A 1LPQA 2BZTA 3CESA 2HZDA 2IA1A 4L5IA 3I4PA 3OMYA 4BBRJ 1T2KA 1OLTA 4KT5C 3S1NJ 4KKUA 4HDUA 4KN7X 1BN8A 2OU2A 5AN9A 5AIPA 2IJLA 3S2HJ 2C77A 3A03A 4Z4UA 1X19A 3LFKA 1H8HA 3T51B 3AVTA 2STTA 3GQ7A 4I7HA 3K4JA 2ZJ2A 2OYNA 5HS7A 4B8XA 4WZTA 3MN2A 1XGOA 2M30A 4XIDA 5F4MA 1MBKA 1H0MA 1N77A 2RC6A 1VHOA 1QQIA 3PSSA 1WGXA 1ZUNB 1R22A 3F6OA 2EZKA 4MYTA 2CW8A 3PSIA 5CJ9A 1KQSB 1FY7A 2E19A 2HI3A 3PSFA 2VLAA 3WY9A 3S14J 2LC2A 3HYIA 3NARA 4A3KJ 3LSPA 2QX3A 3V8LA 1J9IA 1KTWA 1O8IA 4BXFA 1IV6A 3EPZA 2V7QA 3CUQC 5GAEJ 4OPSA 2IPQX 3FJOA 2H09A 1FSEA 3OYGA 1GVDA 2UXNA 3Q5FA 1JT6A 1YRNB 1UHWA 2PMZA 3W2WA 2BMWA 4RS8A 4NNJA 3VSVA 4P25A 3A0HC 4ESFA 5JVGF 2F43A 3CD6B 4M3DA 2KFDA 2CH0A 5HZBA 1K8FA 1NHAA 1E62A 4IOAF 1HW2A 3ZMSA 5LEKA 1ZR4A 1IB0A 2WADA 2CBXA 4PSXA 1Z77A 1T6YA 1T0FC 4LBWA 2EFGA 2EJRA 2VBYA 1I8DA 4G1BA 1A6IA 3IH4A 2G0YA 3AKZA 1VZ0A 2V1DA 3CC7I 5IYDJ 1VLOA 3PENA 1B23P 3HOTA 3K69A 1S7EA 2HOAA 3NQOA 4Y33A 4Y7NJ 4P5OA 5HLTA 5F4JA 5H59A 5E3LA 3BP8A 4IHXA 1WI3A 3R6KA 1H9TA 1UD5A 3HGYA 3WE2A 4P22A 3JQPA 1BOAA 3BTIA 1Z0XA 5HNFA 4KJZA 1R5BA 3FKJA 1HDDC 2QQ8A 2F5FA 1STZA 5BMZA 2GXBA 1XN7A 2VODA 4ZTFA 2BM0A 5FNZA 1MMSA 2RC5A 1OFDA 3RDIA 1ZG5A 3PETA 1AMOA 1P4XA 3SJZA 2CWEA 2JQ7A 4AVPA 4QWQA 3HAGA 2PYGA 1ERDA 4W8RA 3JURA 5HLGA 2XUBA 3HB9A 3BC9A 2X1DA 3BROA 4II3A 3OIPA 2Y0SA 4U9UA 1HG8A 2VXZA 5H20A 2HXIA 1LEBA 1K4ZA 1TYUA 2RKHA 4R8HA 1ACIA 4YC5A 4LIVA 2WY7Q 1DPUA 4OOXA 3KYDB 5M5YJ 2ECBA 4E7ZA 3KYLA 1MDMA 1JJ2B 1Y56A 2ZKZA 4XLHA 3WNCA 4XLPF 4C2TA 3HHHA 2XGEA 1SMTA 2QTLA 4ITVA 3DTKA
chains in the Genus database with same CATH topology
3IP4B 4PMHA 5C1CA 1N78A 2WAFA 3A35A 1MMNA 3K4NA 1QU3A 3A3GA 1YX3A 3OR2C 1D1CA 3J7AY 3DU5A 3I9V2 2R7RA 1OOCA 4PUSA 1PXZA 4NK6A 4HPQA 2CV0A 2OV7A 2DIEA 3DQVC 2F5VA 3D5LA 3ZGKA 3OYLA 1WPCA 2NTBA 4E4HA 2XC7A 4KISA 4BEHA 4OZZA 2LZJA 3K70C 4OJPA 4JOMA 1SKYB 2M7BA 3CMMA 2E60A 4MXNA 1BR2A 4R79A 3GVLA 1PKVA 2PYHA 2F6CA 4D1QA 2JUGA 4XL9A 1Z7LA 3QYEA 2INUA 5LFAA 1WP6A 3FPPA 2A6TA 2F1MA 4C9YA 2BOLA 2X6WA 3H35A 1MNEA 4PFOA 3H5RA 3KRGA 1NG6A 3RCOA 1I18A 2LBFB 3H5AA 3CJQB 4Y4RA 4BS9A 3OY9A 3ZRGA 2VBMA 1NRKA 1GQ8A 4KT6A 4OAYA 3OYFA 3OYJA 2VQCA 1TZLA 4PFPA 4ZDOA 1VJSA 4DNTB 4B3GA 1UAAA 1T95A 2HPMA 3E0JB 2VQLA 4E7IA 2IS4A 2M7AA 4W8QA 3E1SA 3RQ4A 1X1AA 3OR1C 3GQ8A 3LFUA 4C2UA 4XKBA 5CQEA 2DT7B 1UELB 3DTEA 4CCOA 1VLYA 4U49A 1BMFA 2GJPA 1BOBA 2KDOA 2ZSHB 3CZ6A 4RM3A 2JVGA 1JRGA 3OL3A 1XG2A 1ZELA 4YELA 3JU4A 3OOUA 3SUCA 4YRVA 2LRDA 2XAUA 4XNFA 4BL0B 2WBMA 4NK8A 3HKZA 1WJCA 4XKCA 4CCKA 2M0MA 1X1BA 2CV2A 4F52A 2L9SA 4U7BA 1O8EA 1RWRA 1KCDA 2W1OA 3A4CA 2V6EA 2ZFUA 4KKTA 3BG6A 2W00A 3DPLC 2KLOA 4HEA2 4BDZA 1HA8A 3FBNB 4XN0A 2CFOA 2MC4A 3VYUB 3DWLE 3ZR8X 2KPMA 3H9JA 3T53B 1QJVA 1X1CA 4NUBA 2V4DA 3VSUA 2JDIA 4B44A 3T9GA 3SZGA 1MABA 4G6TB 3GQBA 3FY3A 4OZYA 4HSRA 2O17A 3A1YA 1V5EA 3UNGC 4HWVA 4Z1MA 3SEZA 4DK0A 1LKXA 2BVMA 2V4JC 3LSHA 4BJTA 3OYEA 3OFNA 3WQZA 3D5RC 3ZSCA 1X4OA 3VR6A 1HVXA 1Y6IA 4Z06A 4F92B 4E0FA 3KX2A 1COWA 2LG4A 1FMVA 4H4KC 4PSWA 3U21A 4BE1A 1DP3A 1IDJA 1O8FA 1OFLA 3PJRA 3OYIA 4B3XA 4LIUA 4XLCA 4F3QA 2E1BA 3EUKL 1O8LA 1OFMA 2O5RA 4J00A 4BE2A 4B3FX 3NWTA 4LITA 5DN6A 2K5CA 3VDXA 3VYRB 4HRIA 2DJIA 3FHNA 4CZCA 2V31A 3LMWA 2IGMA 2VKHA 4DGWB 2K3PA 4DOZA 2NTPA 2Z2SB 2KMUA 1O8JA 2HVSA 4DNRB 3OS1A 2XF5A 5FL7A 3CP8A 2LY1A 3K4MA 2GJKA 3K4CA 2KRCA 3PL8A 3K4KA 2HDWA 2BVLA 3KEWA 4N4NB 3H9QA 4Y3OA 1U0JA 2W6JA 4W8SA 2VL8A 1T5EA 4E7JA 4JMQA 4XOTA 1EE6A 2HLDA 2KL4A 1D1AA 3NWSA 4ZC3A 4RMNA 3S3MA 1X1DA 3K6GA 1NHCA 4CA0A 3K10A 4MR0A 1Z3YA 3OL4A 3A3BA 1D0ZA 4XQFA 3QOEA 1LDKB 1YE9A 3OOCA 3LSKA 1MMDA 1V5GA 2Z16A 1K6YA 4MLOA 2KHMA 5FRMA 1HZEA 1UD4A 4YZQA 4IKFA 3W3CA 1H80A 2WAQA 2O1DA 3W2VA 3OE7A 5HVQC 3A2KA 4C2LA 3DPTA 3TMOA 1V0EA 2XZPA 1WJAA 3UW0A 3HL2A 2ZZQA 3BCDA 2PJRB 4BDYA 1BPLA 3AL0C 3M1CA 3BCFA 4PJJA 1UD6A 4W8TA 1WFXA 4XKWA 3OYAA 3L2VA 4XLFA 4D9JA 3MKYB 3CJRB 3IAM2 4BACA 4ANJA 2PECA 1PJRA 2K9LA 3S3OA 1FX0A 1E1QA 2DCEA 3CF2A 3WWGA 1VF7A 4G6IA 4Z05A 3BCBA 4PJNA 1R6RA 4CCMA 2GK7A 2QE7A 1X4PA 1WJEA 2L9NA 2V7FA 2M4GA 3L2WA 2WA0A 4ZJZA 1OR7C 2VQHA 3H94A 1DGWY 2L5QA 1TT0A 2UV1A 2VXDA 4IQ4A 3DKYA 3MKWB 4TT3A 1OGMX 1QHHD 2IGOA 2M5SA 2ZTNA 2WPDA 3VWBA 3FDYA 1WMRA 1D1BA 4GRIA 5KCMA 2FUG2 2ZXHA 3HOSA 3C2HA 3OAAA 2IQ7A 1O8GA 1E1RA 2LY2A 5C1EA 2XF6A 4P1WA 1WJBA 2P0WA 4B43A 1WJ5A 2JA2A 3K70D 1NBMA 2VJ5A 1MMGA 1V5FA 4XONA 1GLNA 3D5SC 2EWEA 2NT6A 2CS3A 4L8JA 3S32A 4KITB 4G7XA 2RREA 1O8MA 1W0KA 2VBKA 4E6KG 1OGOX 4DBQA 2HVRA 2X85A 1KZLA 2X6YA 2HU9A 3OEHA 3OEEA 4ASUA 2UVEA 1PYVA 4BQOA 2ELJA 4XLEA 1LFPA 3GVJA 4E7KA 3GQAA 2L2OA 2R4GA 4OJLA 1WTHD 3RSNA 2BW3A 3MD2A 3DPUA 4XORA 2LH9A 2R7TA 4KKSA 1IDKA 2ZTGA 3OYHA 2QKMB 3DKXA 2VIXA 1AIRA 1WJDA 1UG0A 2CK3A 2M4KA 3ZQQA 4DBRA 2V9KA 3GQ9A 3MMYB 1KMHA 1SAUA 1FMWA 2LYCA 3B8YA 4E7LA 2IXSA 1CZFA 2WB1A 4BQQA 2VQGA 3LL7A 4HNTA 2X1EA 2IS1A 3TBIA 1DBOA 2MABA 1O8HA 4II2A 1IRXA 2VPLA 1D0XA 3RTRA 1E3XA 3K4LA 4RLFA 4TSFA 3I3LA 1G8XA 4J01A 1YX5A 4BU2A 2R7WA 3B90A 2CV1A 3AL0B 5KHDA 1DQUA 4G7WA 1JI8A 4TKOB 1IA5A 3HUGB 5CKTA 3TL4X 3HG9A 3EUAA 3ZCOA 3PNYA 3OYNA 2GJRA 1JTAA 2ZZEA 2HVQA 3RPUD 4CSWA 4EATA 3OYMA 3SEQA 2CMPA 1RMGA 3OYCA 4N4OB 2GOXB 4IX7A 1O8KA 2O0VA 3EQNA 4DJAA 1NG7A 3S93A 2R7VA 4HSTA 2UVFA 1IB4A 4OAZA 1BHEA 2KRHA 4AVZA 4GQNA 1DBGA 4BEHB 4DK1A 2XSJC 3PNVA 3QYBA 2INVA 3B4NA 4URRA 3M8JA 2X8KA 3V42A 2XF7A 4F91B 2XNDA 2NTQA 3ZPPA 3GBGA 2VJ4A 2BSPA 3LNNA 4ZDLA 1V0FA 1WJFA 4BQNA 3GRHA 1X0CA 2JJ2A 3ZPNA 1D0YA 1EA3A 3IUOA 1E0EA 4AYBA 1K28D 4CH7A 2PJRA 1UD3A 2CUJA 2JVHA 5TGTA 2O0WA 2JJ1A 5FRNA 1H8EA 2VBEA 4RM2A 2W4SA 2NSPA 1AA7A 2CUZA 4YZAA 2IS2A 2O04A 4IQJA 1KCCA 2JIZA 3DU6A 4C30A 2F4IA 3OYDA 1EFRA 3W2AA 1BR1A 4JQFA 1G59A 3HC7A 3LSMA 4B47A 1QHGA 4E7SA 2DXIA 3MKZA 1UD2A 2Z6BD 1QCXA 4NQWB 4YZ0A 1OB0A 2Z1DA 4PJLA 1LVKA 2WAEA 4ZTJA 2X51A 4ZYAA 2ZSIB 4F93B 2HPIA 5CDFA 4PJMA 5CQGA 2QKLB 3BH4A 1W0JA 2WJVA 2X53S 2ZXIA 2MYSA 3L2RA 5IK2A 3UR3C 2CW7A 2Z8GA 1PLUA 2OUMA 4AU7A 1KONA 4QPQA 2VJJA 4Z03A 3FKSA 2E1MB 4YXWA 3OPOA 3N05A 4E7HA 2IGKA 2Q2EB 2IGNA 2ZZFA 4HIZA 3DEEA 4OJ5A 3LSIA 3CP2A 1E3ZA 2QXZA 4F55A 2LOOA 2XZOA 2NOJB 3DTIA 4I84A 2ODLA 1W36D 5HKKA 2LBFA 2X6XA 4UZUA 3PFYA 3S3NA 4XOPA 1SFKA 2HQAA 1VBLA 3VYSB 4NC7A 4XD7A 4FASD 2D3LA 2D3NA 2KQRA 2W6IA 2NZMA 1MNDA 2AQEA 2K9MA 3VSKA 2VB6A 3VMWA 3F9KA 2IS6A 4XKVA 4BE0A 3OS0A 4XR6A 2E5ZA 4FETA 3ZXSA 1J09A 3AFHA 2R7SA 4U4BA 2HZDA 2R7OA 2XDVA 3BC8A 3CESA 3OMYA 4OWRB 4KKUA 3DDYA 1OLTA 2XGJA 3HXLA 1N75A 3VYTB 4RLQA 1BN8A 3SDBA 1E79A 4IZZA 2HNHA 4U87A 1E43A 5AMVA 4B48A 1X19A 1H8HA 3T51B 1MW7A 3EQOA 3GQ7A 3ONQA 3K4JA 3QODA 1PE9A 4OJOA 3C2GA 4CCLA 2AQFA 1W36C 3QYFA 3VMVA 2R7QA 4X0GA 4CCJA 1N77A 1O88A 2WSSA 3G2BA 3LMMA 2CW8A 3PSIA 2KP6A 2VLAA 3PSFA 2XZLA 2LC2A 2MFZA 3K4BA 2W7NA 2VASA 2QX3A 1O8IA 1KTWA 2R7XA 4BXFA 3DLAA 4BUPA 1RU4A 3EPZA 3L2QA 3G05A 2V7QA 3BG7A 4XMYA 2NT9A 2R7UA 3OYGA 2I8DA 3OIQA 2NSTA 5JHFA 3OS2A 1OHHA 2PMZA 2GOMA 3W2WA 4FXUA 1Z21A 3OYBA 5KNLA 4NNJA 3VSVA 3PNTA 1Z3XA 3GVKA 2F43A 2CH0A 3LSGA 2BW3B 2E5NA 4NC8A 2WADA 2WJYA 3S8PA 4PSXA 3ZIAA 1T0FC 4LG3A 2X1CA 3OYKA 1I8DA 3AKZA 1VZ0A 5LD2C 3HOTA 3VSLA 2GK6A 3HPHA 2DT6A 2MD0A 1MMAA 4Y33A 2WZPP 3T56B 1BLIA 4P5OA 5HLTA 2RQQA 4BJ6C 3H0DA 1W9XA 2M3AA 3HPGA 4HG2A 2OC6A 3KEYA 4EW9A 3BCAA 4OJ6A 1UD5A 3OW7A 4P22A 4CUGA 2XOKA 1S9HA 4QPOA 2V1NA 4YZXA 3H5NA 5HNFA 3PUBA 4KJZA 5CPRB 1UD8A 2R9VA 3FKJA 4HNUA 2KVOA 2QY1A 3FBIB 4ZTFA 2RNGA 3EUHC 1O8DA 4BJ5C 2JSPA 3IAS2 3H9GA 4XLAA 4YEJA 5HOOA 3HAGA 2PYGA 1ERDA 2Q1ZB 3NE5B 3JURA 4W8RA 2V26A 3BC9A 2X1DA 2L7KA 4II3A 1DGRM 3OIPA 2Y0SA 5FROA 4ZDPA 1HG8A 2VXZA 4CCNA 2E1MC 4BGDA 2DOAA 2UUZA 2WY8Q 3L2UA 4LIVA 1BR4A 2VKDA 2VJIA 2WY7Q 3KYLA 4E7ZA 1K5CA 1Y56A 4XLHA 3SYTA 3BLYA 2ZZGA 2X3HA 1P9QC 4XN3A 4XM3A 4C2TA 2A5WA 3OWTA 4PK4A 4DIQA 5HNHA 2KZVA 2W82A 3VSTA 4ITVA 3DTKA 2UWMA 2LREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMH A;  4XKV A;  5C1C A;  3B8Y A;  1CZF A;  4XR6 A;  4U4B A;  1PXZ A;  4NK6 A;  1OOC A;  1DBO A;  2NTQ A;  4EW9 A;  1O8H A;  1BN8 A;  4W8S A;  2NTB A;  4XOT A;  5AMV A;  1EE6 A;  4OZZ A;  3B90 A;  3EQO A;  3GQ7 A;  4OJP A;  1PE9 A;  1IA5 A;  1NHC A;  4MXN A;  4OJO A;  4MR0 A;  2PYH A;  4XQF A;  3VMV A;  4XL9 A;  1JTA A;  2INU A;  4YZQ A;  1RMG A;  1H80 A;  2O1D A;  2X6W A;  1O8K A;  3KRG A;  2O0V A;  3EQN A;  4C2L A;  2UVF A;  1IB4 A;  2QX3 A;  1O8I A;  1KTW A;  3UW0 A;  1O88 A;  1RU4 A;  1BHE A;  4W8T A;  4AVZ A;  1DBG A;  2VBM A;  4XMY A;  4XKW A;  1GQ8 A;  2NT9 A;  2INV A;  3B4N A;  4URR A;  4XLF A;  2NST A;  2PEC A;  3ZPP A;  2BSP A;  4W8Q A;  3VSV A;  3WWG A;  4Z05 A;  3GRH A;  3GQ8 A;  1X0C A;  4U49 A;  2O0W A;  2VBE A;  2NSP A;  1JRG A;  1OGM X;  4YZA A;  1XG2 A;  4YEL A;  2O04 A;  3SUC A;  1KCC A;  1WMR A;  4XNF A;  4NK8 A;  1QCX A;  1O8E A;  4YZ0 A;  1RWR A;  1KCD A;  2IQ7 A;  1O8G A;  5C1E A;  4OJ6 A;  4XN0 A;  4XON A;  1QJV A;  3VSU A;  2EWE A;  4YZX A;  2NT6 A;  3T9G A;  4OZY A;  1O8M A;  3FY3 A;  2QY1 A;  2O17 A;  2VBK A;  1OGO X;  4HWV A;  1O8D A;  2X85 A;  2X6Y A;  2Z8G A;  1PLU A;  3ZSC A;  2UVE A;  2VJJ A;  4Z03 A;  4Z06 A;  4XLA A;  4YEJ A;  2PYG A;  4W8R A;  1IDJ A;  3JUR A;  4XLE A;  1O8F A;  1OFL A;  3GQA A;  4OJ5 A;  2QXZ A;  4XLC A;  4OJL A;  1HG8 A;  4I84 A;  4XOR A;  1O8L A;  1OFM A;  2ODL A;  2VJI A;  2X6X A;  1IDK A;  1K5C A;  3LMW A;  4XLH A;  4XOP A;  1AIR A;  2X3H A;  4XN3 A;  1VBL A;  4XM3 A;  2NTP A;  1O8J A;  2NZM A;  3GQ9 A;  3VST A;  3VMW A; 
#chains in the Genus database with same CATH topology
 1QPM A;  2HQR A;  1RNL A;  1K73 D;  3A35 A;  1EP2 B;  4IL6 C;  4W1U A;  3OR2 C;  4IHT A;  1D1C A;  5BSX A;  1PXZ A;  1YJ9 I;  2R7R A;  1OOC A;  3JRC A;  2W25 A;  1QZE A;  5LGN A;  4MGR A;  3I4N J;  4RCY A;  2OCE A;  2DIE A;  3DQV C;  1LE8 A;  3EYY A;  3OYL A;  1YI2 I;  3R60 A;  2ZL6 A;  2CQX A;  2NTB A;  5JLV C;  2J8I A;  4P9F A;  1MH3 A;  4PCQ A;  2LZJ A;  4H9G A;  2K3F A;  2BHY A;  5GAD J;  4OJP A;  4JOM A;  1JJ8 C;  4JX5 A;  1I3A A;  1SKY B;  2CND A;  3CMM A;  2HDN B;  4MXN A;  1ETV A;  4I02 A;  3GVL A;  2YSR A;  3DBL B;  1OKR A;  3Q6Q A;  1I27 A;  2JUG A;  2EZI A;  2DI3 A;  2Q2E A;  3FXR A;  3LOC A;  4BHB A;  1D5Y A;  4P2N A;  3BG3 A;  4EM0 B;  3FPP A;  1QRC A;  2GZW A;  3PM1 A;  1QA6 A;  3ZN0 A;  2V7U A;  1OCP A;  2BOL A;  3KFW X;  2X6W A;  3KP5 A;  3HSR A;  1VFC A;  1VQ8 I;  1UMK A;  2OPT A;  1I18 A;  1MH4 A;  4YFK F;  1B9N A;  4D7N A;  3CCJ I;  3CCU B;  1H9G A;  4KT6 A;  3FXJ A;  4OAY A;  5TJJ A;  2JZY A;  2C6Y A;  4X05 A;  1ZLJ A;  2XTY A;  1VQ8 B;  1QA1 A;  3MKL A;  1VJS A;  5HLI A;  3FIW A;  2I5U A;  3CUO A;  4DQ2 A;  1KU2 A;  2DAO A;  3L00 A;  1T38 A;  2E2I J;  1IG7 A;  2IS4 A;  3AVW A;  2EK5 A;  3OR1 C;  1TL8 A;  1IV8 A;  4B4C A;  1UEL B;  3QAH A;  3GO5 A;  2BYV E;  3AAF A;  1BOB A;  3BR5 A;  1BMF A;  2GJP A;  2IRF G;  2ZSH B;  3A8K A;  5K1Y A;  1U5T B;  2ZCW A;  4IHY A;  2V9P A;  1XG2 A;  2PEX A;  4YRV A;  2LRD A;  3U1K A;  2XAU A;  1VQ4 B;  4NK8 A;  3ABL H;  3AVV A;  1WJC A;  4XKC A;  4CCK A;  2CV2 A;  4NQW A;  1WCM J;  4LK0 F;  3QPL A;  4LLN A;  2B0L A;  2MGQ A;  1P4W A;  3SDG A;  2ZFU A;  4AC9 A;  1RR8 C;  2BXZ A;  1OCT C;  2ZNZ A;  3O3K A;  4HEA 2;  4RGU A;  3PA1 A;  1U9O A;  3H9J A;  1X1C A;  1QRY A;  4NUB A;  2EA4 A;  2FF4 A;  3KEQ A;  2VE8 A;  4B44 A;  1DPR A;  4CIC A;  4QLC U;  5LGT A;  3BNW A;  3ZUG A;  2CU7 A;  1KQ8 A;  3BDD A;  2MW8 A;  3FY3 A;  4HSR A;  3ASQ A;  4EJU A;  3UNG C;  4DK0 A;  1GJR A;  1O3T A;  3J81 Z;  3LSH A;  4OOI A;  1EJ9 A;  4HW0 A;  1R5N A;  2YWF A;  4RBO A;  4LK1 F;  5TRD A;  2ZBK A;  5LHG A;  2J8K A;  2HKO A;  4RD2 A;  4H4K C;  1DP3 A;  3PJR A;  1S3J A;  1E3O C;  4X7E A;  1FSH A;  2XGC A;  1SFE A;  1XDS A;  2P5L C;  2E71 A;  1VQM I;  4JBA A;  1HC8 A;  1OFM A;  4J00 A;  4BE2 A;  3NWT A;  2K5C A;  4HRI A;  2ESH A;  2DDA A;  3IRR A;  5IYW A;  5JVT A;  4G1V A;  1XMA A;  1X3W B;  4DGW B;  1MBJ A;  3CCQ I;  1YOV B;  1ZAR A;  2KIS A;  1CQX A;  3QP5 A;  4DOZ A;  4YG2 F;  2KMU A;  3GCM A;  5J3L A;  1YIT I;  4DNR B;  3DU1 X;  3CP8 A;  3QSY A;  1JA0 A;  2VNH A;  4XSX F;  4IOC F;  2B63 J;  1I5Z A;  1YJ9 B;  2ZBU A;  3K4C A;  2VFO A;  2GIV A;  2QZ8 A;  3CCL I;  3K4K A;  2EV0 A;  4HAM A;  2O9L A;  2M2E A;  5CVI A;  1GV5 A;  1MD0 A;  1ON1 A;  2MD5 A;  5BQT A;  3FKI J;  2ISY A;  2FJ1 A;  4W8S A;  5A89 A;  1T5E A;  4HV6 A;  2EV5 A;  2WR8 A;  4MIM A;  4P12 A;  1Q1V A;  1Y1W J;  1WOP A;  1XB2 A;  3CC2 B;  4X7F A;  1VQL B;  1PP8 F;  1NHC A;  2COB A;  1UST A;  4CA0 A;  4IHS A;  4EJW A;  3A3B A;  2PBI A;  3QOE A;  2TDX A;  1AWC A;  2V9V A;  1FND A;  1YE9 A;  3LSK A;  1V5G A;  5FRM A;  2KHM A;  4YZQ A;  4HQM A;  1VQL I;  3W3C A;  2K02 A;  2WAQ A;  5E8I A;  4OOV A;  3OE7 A;  4BPR A;  5KSW B;  3CCV B;  1U78 A;  2WV1 A;  2HYF A;  2Y69 H;  5E3M A;  3DPT A;  3PQJ A;  1FJL A;  4G9Y A;  2FNA A;  2WV0 A;  4RAF A;  3VOE A;  1BPL A;  3HIF A;  1WFX A;  4XKW A;  5JI6 A;  3OYA A;  3L2V A;  3PFI A;  4QTR A;  2F48 A;  4G7H F;  4ANJ A;  2QBY B;  3Q9V A;  4CQJ A;  1IHM A;  1EH8 A;  3WBJ A;  2DCE A;  3OJX A;  3ZBT A;  3D0S A;  4G6I A;  1ELO A;  4PJN A;  1R6R A;  1PP7 U;  3SHF A;  1FYM A;  4UB8 C;  2X0L A;  1J75 A;  1UFM A;  1G3W A;  4NCN A;  1UHS A;  1YLF A;  2L9N A;  2RNJ A;  2V7F A;  3F8C A;  3IC7 A;  2LKS A;  4WQM A;  1OR7 C;  3TO9 A;  2HZT A;  1RZ4 A;  2L5Q A;  2UV1 A;  2VXD A;  2PMD A;  4YAF A;  2LVS A;  3TGN A;  1I50 J;  4S04 A;  4RM0 A;  1V3F A;  4L18 B;  1HOM A;  1TUI A;  1OYW A;  2IA0 A;  2DYS H;  1D1B A;  5KCM A;  2RV8 A;  3WHB A;  2KZG A;  4DNC A;  3LAJ A;  1A31 A;  3H3V K;  2VBW A;  3ONY A;  3C2H A;  3OAA A;  2OD5 A;  5E3O A;  1NTC A;  3ZBU A;  2FXA A;  2NNN A;  5C1E A;  2DFH A;  1MJB A;  1NBM A;  4O3M A;  1WSV A;  4XON A;  3D5S C;  2OBR A;  2EWE A;  1LUJ B;  2CS3 A;  1ULY A;  2OQG A;  2ZJP F;  2XTX A;  1FZP B;  4UHT A;  1OGO X;  1K6O A;  4DBQ A;  2X85 A;  1S6L A;  2L54 A;  2A3S A;  4ENJ A;  2E1R A;  2IEK A;  2UVE A;  4X0C A;  2RN7 A;  3CCV I;  3GSI A;  1NK2 P;  4TN1 A;  4M6V A;  2LY9 A;  5JMC B;  4XLE A;  5EEG A;  1ETK A;  4E7K A;  2D74 A;  3B02 A;  3S2W A;  2QQA A;  2BW3 A;  4M71 A;  1JJ6 C;  3MD2 A;  2LLK A;  1QGA A;  4XOR A;  2XAS A;  5GPC A;  3PIO F;  2ZJR F;  2STW A;  1E63 A;  2LH9 A;  2HFH A;  2QGG A;  4X1E A;  2QA4 I;  2ACJ A;  2VIX A;  1IJW C;  3S2D J;  3ASN H;  1OFC X;  2AXT C;  2AHO A;  1UG0 A;  2CK3 A;  2M0C A;  5DS9 A;  1P92 A;  5LRR A;  3ZQQ A;  1APL C;  2CSO A;  4ZCL A;  3GQ9 A;  3H1C A;  1IAW A;  1OYY A;  1KMH A;  3CPX A;  3LA7 A;  2LYC A;  4E7L A;  4N3N A;  4YHB A;  2E35 A;  5E18 F;  3JQR A;  1BIA A;  3LL7 A;  3CQZ J;  3DEW A;  3HSF A;  2X1E A;  3TBI A;  1DBO A;  4AC0 A;  1O8H A;  1MRZ A;  2F4O B;  1N07 A;  4A6D A;  2H8R A;  2CC2 A;  5THX A;  2R93 J;  1OCZ H;  1U6G A;  2DA2 A;  2E2J J;  1HA3 A;  3I56 B;  1EXM A;  2R7W A;  2QWW A;  2BM6 A;  1JI8 A;  1Q7Y D;  1N25 A;  5CKT A;  3HG9 A;  2QSF X;  4YAU A;  3JTH A;  3PNY A;  3TW6 A;  2AXL A;  5FA6 A;  1VHE A;  1ZM9 A;  3M3Y J;  3HGG A;  2ZZE A;  3CCE B;  1G7R A;  2ZC2 A;  1KQ0 A;  1B72 B;  3LA3 A;  1XTA A;  4LGW A;  2XVC A;  2M34 A;  1DG1 G;  2KIQ A;  4A0X A;  3GZ6 A;  5E17 F;  1O8K A;  5H6Q A;  3LWF A;  4N0B A;  1XC5 A;  4EM1 A;  4GQN A;  3EUH A;  3RKY A;  4DK1 A;  2XSJ C;  5K5R A;  2INV A;  4URR A;  4I76 A;  2Y48 A;  1FP2 A;  1XPX A;  3WTZ A;  2XF7 A;  1ZG3 A;  2YX7 A;  4F91 B;  1LJ9 A;  4FE4 A;  2JN9 A;  2Q6L A;  3GBG A;  2BSP A;  1RET A;  3LNN A;  4ZDL A;  1ONV A;  1H88 C;  5D4S A;  3FWE A;  1LDD A;  1F36 A;  5F0H A;  1M1E B;  4YAO A;  4M73 A;  2ICW G;  2DA1 A;  3IUO A;  2PLY A;  2R92 J;  4AYB A;  3ZP5 A;  1UD3 A;  3BG5 A;  1VF9 A;  1KU7 A;  2O0W A;  2JVH A;  2K85 A;  2JJ1 A;  2L02 A;  1K9M D;  3ZQH A;  3BCD A;  1ZM3 A;  4M3G A;  3CUQ B;  2DK5 A;  4Z4S A;  2CUZ A;  2GWR A;  2G7U A;  3PQK A;  4IQJ A;  2O04 A;  1KCC A;  2JIZ A;  1ZRE A;  3OYD A;  2F4I A;  3I53 A;  4FK8 A;  2OTJ B;  1BR1 A;  2DXI A;  3Q3S A;  3HC7 A;  1M1K D;  4E7S A;  1QHG A;  5GPA A;  3G71 I;  3I55 B;  2DA7 A;  2Y9Y A;  1MNM C;  1SVL A;  4AF6 A;  2QEN A;  4RJL A;  1OB0 A;  3V7A A;  1OPC A;  5B1B H;  4Y9R A;  2B9S A;  1QZZ A;  1Z1D A;  4ZYA A;  1V5V A;  4RD1 A;  1FRQ A;  1PJ7 A;  3NAU A;  1KK0 A;  3FXQ A;  2FNP A;  5CQG A;  2FML A;  2QKL B;  3A01 A;  3EDP A;  5J35 A;  1W0J A;  2X53 S;  2WC2 A;  5IK2 A;  1X3U A;  3UR3 C;  2OUM A;  4QPQ A;  1DDG A;  4Z03 A;  3DF8 A;  3FKS A;  2XNC A;  1XGN A;  1P2F A;  3N05 A;  4B3A A;  4IXA A;  2IA2 A;  2IGK A;  2EIL H;  4E7H A;  2IGN A;  4QFM A;  2Y0M A;  4AID A;  3DEE A;  2ZZF A;  4OJ5 A;  4CYC A;  2X6O A;  4MFD A;  2NNY A;  3PUM A;  3OOP A;  2XZO A;  2NOJ B;  3DBR B;  2PG4 A;  3GYH X;  4U88 A;  2DN0 A;  4JX6 A;  4ZH4 F;  3F0C A;  4L5E A;  1W36 D;  1OR7 A;  4PDK A;  2GXG A;  2B0R A;  4AIH A;  4XD7 A;  4AF7 A;  1X2N A;  4FAS D;  2W6I A;  3AGP A;  4HX4 A;  3WGG A;  4M6Y A;  5TV2 A;  5LMZ A;  3CJN A;  3VSK A;  4HQE A;  3SQN A;  3VMW A;  1SD7 A;  3H0G J;  3OS0 A;  1G3T A;  4XR6 A;  1JHH A;  3ZMD A;  1YJN I;  3HJE A;  1FTT A;  4R1H A;  3GLX A;  1RES A;  2R7O A;  2XDV A;  3BC8 A;  2KIU A;  1VQO I;  1HSJ A;  3PO2 J;  2XGJ A;  4RGR A;  1T39 A;  1VI0 A;  1N75 A;  3HXL A;  5L3C A;  2VUM J;  3BOQ A;  3KCC A;  3ULQ B;  4IZZ A;  1DDN A;  2HNH A;  2RDP A;  3EET A;  1EZG A;  3JRI A;  1TNT A;  1QVT A;  4A3D J;  1E43 A;  3N90 A;  4B48 A;  2Q6O A;  1S7O A;  4FN5 A;  1Z05 A;  3ONQ A;  2CW5 A;  3ML6 A;  1PE9 A;  1CF7 B;  1ETW A;  3C2G A;  2QBY A;  3WND A;  4TMV A;  2AQF A;  1W36 C;  1HLV A;  1IJF A;  5BS6 A;  4A6E A;  4ZZD A;  3ZC3 A;  2R7Q A;  5ICE A;  4AIJ A;  2F5C A;  4A69 C;  4CCJ A;  4X0G A;  1TNS A;  1IC8 A;  4UZF A;  3G4S B;  5DDG A;  5GTH C;  3G2B A;  2WSS A;  5JBQ A;  2MA3 A;  1Y0U A;  1XG1 A;  4I0B A;  3QFS A;  5FJ8 J;  1K61 A;  1B59 A;  1G3Y A;  2FU4 A;  3RPU A;  2X4H A;  4CGZ A;  3E1Y E;  4PC7 A;  2WB1 N;  3DLA A;  3L2Q A;  3BZC A;  1R5G A;  4M4S A;  3O8H A;  5E6T A;  2R7U A;  2I8D A;  4U0W A;  2EIK H;  3M9A A;  3OIQ A;  2VFQ A;  2NST A;  2G7H A;  2KIF A;  4UVA A;  1KRH A;  2GOM A;  3RKW A;  5K7Z A;  2I1L A;  3PUF A;  1VQ9 B;  1Z21 A;  2AS5 F;  2BE5 F;  4PC6 A;  1Z3X A;  2P6S A;  1R71 A;  3IL2 A;  1IUF A;  1HQC A;  4M2L A;  1MZB A;  3W2E A;  2O0Y A;  4A0Z A;  1QRB A;  5KW9 A;  3I71 A;  3S8P A;  1L1I A;  2HWV A;  4BYY A;  1SEU A;  5FLX Z;  2KT0 A;  3CCY A;  3ZOB A;  1ZHF A;  2OTJ I;  5FIU A;  1YJN B;  3QOP A;  4LG0 A;  1Q82 D;  3HPH A;  3T56 B;  3BQY A;  4FT8 A;  1BLI A;  2RAE A;  1VQ7 B;  4TMZ A;  1E3H A;  4BBS J;  4YEI A;  4UY8 I;  1GVH A;  3KEY A;  3WTW C;  1NDH A;  4ENK A;  1Z6T A;  4CUG A;  2DEU A;  1AKH A;  5H5J A;  4QPO A;  3GTM J;  1ORK A;  1UD8 A;  3PUB A;  2XPW A;  4I09 A;  5CPR B;  4BXU A;  3VFZ A;  4CDG A;  4HNU A;  4RDU A;  3VOD A;  3LQR A;  5BOX A;  5C4X J;  2R6H A;  1GVJ A;  3EUH C;  2QSH X;  2JRM A;  3IAS 2;  3J80 Z;  3I56 I;  2O7O A;  4YEJ A;  2DLL A;  5HOD A;  4HV5 A;  3CCS I;  3BZK A;  5IYN A;  1XCV A;  2L7K A;  4YIF A;  1GT0 C;  3J81 k;  4ZDP A;  1GDT A;  4CCN A;  2UUZ A;  2HQ5 A;  2HOS A;  2VKD A;  4P96 A;  1IN5 A;  2M5W A;  2VJI A;  2XPU A;  3V7C A;  1WI9 A;  5A2Q Z;  2ZO4 A;  4HLX A;  4M9X A;  3SYT A;  4WZE A;  3BLY A;  1P9Q C;  4XN3 A;  4XM3 A;  3WOD F;  1FNM A;  2KJB A;  1ZN2 A;  2XB0 X;  3MMP A;  2Z99 A;  2UWM A;  3IH2 A;  4G94 A;  5C1C A;  1N78 A;  3TOB A;  2JA6 J;  5DCF A;  1QA3 A;  4G7Z F;  1MMN A;  3ERM A;  3K4N A;  5DD4 A;  3J7A Y;  3ASP A;  3DU5 A;  1MSE C;  3GZN B;  4IO9 F;  2FQ4 A;  2CV0 A;  3BR3 A;  4KMF A;  4KIC A;  2OV7 A;  4WF2 A;  4EVI A;  2AHQ A;  2Y75 A;  3BWG A;  2EBI A;  4ETS A;  2F5V A;  1HW1 A;  3ZQ7 A;  1WPC A;  5E8G A;  4YFO A;  3Q0V A;  3LQ6 A;  1JUS A;  4I2O A;  4HYE A;  3WTT C;  3G73 A;  1QBJ A;  5CVV A;  5J40 A;  1BQE A;  4R79 A;  3AG4 H;  3F8B A;  2PYH A;  1R1T A;  1ZGJ A;  2F6C A;  2EFQ A;  3KP7 A;  3W2F A;  3RZD J;  3V76 A;  4OIP F;  3WU1 B;  3QFR A;  1BW6 A;  1S8N A;  2DBB A;  2VOO A;  4AWX B;  4A3C J;  3DV8 A;  4IF4 A;  1F20 A;  1WP6 A;  2F1M A;  4C9Y A;  2KRF A;  1TQM A;  4PFO A;  3H5R A;  1WZ2 A;  3C18 A;  1NG6 A;  4I99 C;  4Y4R A;  5EMN A;  3BT9 A;  2VBM A;  3BR2 A;  3OIO A;  1W87 A;  4ACA A;  2VQC A;  1A35 A;  2BM7 A;  4HX8 A;  1TZL A;  2HTJ A;  1TT5 B;  4ZGN B;  2B7E A;  4EMS A;  2JWT A;  2JA7 J;  3OZV A;  2KJC A;  1UAA A;  3TDU C;  1KYZ A;  1BJA A;  4E7I A;  1XQB A;  1QO0 D;  3SYJ A;  4W8Q A;  3E1S A;  3MZ8 A;  5B1A H;  3GQ8 A;  5M3F J;  2BM5 A;  2K9Q A;  1BI2 A;  4C2U A;  5CQE A;  2DT7 B;  1P7I A;  3DTE A;  3K1M A;  2FOK A;  3PO3 J;  2KDO A;  1OGI A;  3W2I A;  4JK1 X;  3AGQ A;  4RGS A;  1PJ5 A;  2O6W A;  3OSF A;  3GWZ A;  1JRG A;  1GR1 A;  1LFU P;  1Q81 D;  2C5B A;  2NRA C;  3HKZ A;  3OJW A;  3MHP A;  3FM5 A;  2M0M A;  1X1B A;  4MTD A;  3CO6 C;  4AIK A;  1RRJ A;  3FPK A;  4HE5 A;  4LOC A;  1O8E A;  1KCD A;  3JRB A;  3E6C C;  3BG6 A;  1RPW A;  3DPL C;  4XRS A;  4XN0 A;  2CFO A;  5ED4 A;  2KPM A;  2XPV A;  4NC6 A;  2V4D A;  3VSU A;  3BZ6 A;  1FNC A;  1MAB A;  2PMH A;  3AVX A;  3VPR A;  3QU6 A;  1QUF A;  1V5E A;  4WK8 F;  1T6X A;  2VN2 A;  4X07 A;  4Z1M A;  1UHM A;  1OYI A;  2DTR A;  2DQR A;  2BVM A;  2ELH A;  2OZ6 A;  2UXX A;  5D4R A;  1H42 A;  2MBF A;  4ROX A;  2BX6 A;  3ZSC A;  3D5R C;  1QUE A;  3CCS B;  1Z67 A;  2F4M B;  1Y6I A;  5J3O A;  4E0F A;  3KX2 A;  3GFM A;  3ZQL A;  2LG4 A;  1FMV A;  4PSW A;  1GV2 A;  1IDJ A;  4BE1 A;  4XIC A;  1A8P A;  1LQ1 A;  1ON2 A;  4B3X A;  5BPD A;  2QGU A;  5FO0 A;  3SZT A;  4QVJ A;  3GUD A;  1O8L A;  3IWF A;  3ISX A;  1GXQ A;  1OIS A;  4N9H A;  4BY1 J;  1SD6 A;  3L7W A;  3VDX A;  2DJI A;  3FHN A;  3VYR B;  4CYD A;  2OBP A;  3TQN A;  3WG9 A;  2V1U A;  4RB1 A;  2IGM A;  2QEX I;  3LMW A;  4DQK A;  2NTP A;  2Z2S B;  1O8J A;  2E1O A;  4YII A;  2HR3 A;  3OS1 A;  2XF5 A;  1QX4 A;  2OTL B;  1YHQ B;  1XGM A;  4ZV4 A;  3I59 B;  1G6N A;  4Z4Y A;  2ZME A;  3KPH A;  4M9S A;  5ILV A;  2JJ7 A;  1TTT A;  4UUS B;  2GJK A;  3W6V A;  2MH2 A;  2KRC A;  1O7F A;  2FE3 A;  3F8M A;  4L9V A;  1FDR A;  1XSX A;  5F4O A;  3KEW A;  4MEY F;  3H92 A;  2MLG A;  1YLO A;  3MEX A;  4HF0 A;  3GTJ J;  4A3F J;  3H9Q A;  1U0J A;  2VKE A;  2QQ9 A;  2W6J A;  5B5E C;  2DFI A;  2VYQ A;  1S72 B;  1YFH A;  2GBY A;  4GYG A;  2HLD A;  1EE6 A;  4JRA C;  3AG3 H;  5EEA A;  3CDI A;  4YIR X;  4RAG A;  3OL4 A;  3NB2 A;  2HYJ A;  2LF8 A;  4V19 K;  4XQF A;  4IW3 B;  1FEX A;  1VQN B;  2Z16 A;  1FLI A;  2X9D A;  3JRA A;  4IHW A;  1D5V A;  5D8K B;  1EA0 A;  2OA4 A;  4D0P A;  1U2R A;  5A2Q K;  2F4N A;  5FFZ A;  4C2L A;  2CUF A;  3TMO A;  1A04 A;  1WJA A;  4U0V A;  5JHU A;  1O88 A;  3BCF A;  2DK8 A;  4PJJ A;  1UD6 A;  2OK7 A;  2J5O A;  2DMT A;  3E6D A;  3K2A A;  1WVR A;  5E79 C;  2DA6 A;  1SM4 A;  2K86 A;  2DMU A;  4WCG A;  1WU8 A;  2NYX A;  1REP C;  4FQG A;  1PJR A;  1KZH A;  2K9L A;  2BGJ A;  5ICF A;  3CF2 A;  3I54 A;  1BW5 A;  1RQP A;  3BCB A;  4A93 J;  1P4M A;  4CCM A;  2GK7 A;  2QEX B;  3TP3 A;  5LLQ A;  1WJE A;  5LRS A;  3LQE A;  3P26 A;  3L2W A;  4TMX A;  2WA0 A;  4ZJZ A;  1TT0 A;  1SVO A;  2BY2 A;  4RD3 A;  2GAU A;  3KE2 A;  2E2H J;  3DKY A;  3MKW B;  4XRF A;  1I6X A;  2IGO A;  2R3S A;  4L0Z B;  2OBS A;  4ENN A;  3SXY A;  1AU7 A;  3DBH B;  4Z4V A;  2FUG 2;  1CNF A;  4PGO A;  1IN6 A;  2E1N A;  2LY2 A;  2XF6 A;  1MSF C;  1QH0 A;  3P27 A;  1ETY A;  2JA2 A;  2XAJ A;  1ETQ A;  1V5F A;  2NT6 A;  3KZZ A;  3TOA A;  3S32 A;  4Z6Y A;  2HMA A;  3RZO J;  2V7X A;  2RRE A;  4G7X A;  3ZMZ A;  2L9R A;  1QVG B;  4E6K G;  1HBX G;  3VNU A;  4Z4R A;  3MCZ A;  4K1X A;  1F60 A;  1FT9 A;  5KVR A;  1G7C A;  2VKV A;  4C3H J;  1Z6R A;  1LFB A;  3M8F A;  1D2E A;  2M87 A;  4OP7 A;  5HDG A;  3LSR A;  2XGD A;  1WSR A;  3GVJ A;  3CC7 B;  3HEF A;  2VT3 A;  5CVU A;  5AON A;  4LBZ A;  3GQA A;  1IUY A;  1WTH D;  3RSN A;  1IN8 A;  5EG0 A;  3AVY A;  4RDL A;  2F3L A;  3TED A;  3RYP A;  2R7T A;  3LVB A;  1WPK A;  2ELK A;  2E34 A;  3RKX A;  2HDC A;  1BC8 C;  2ZTG A;  3DKX A;  3DKW A;  3VMF A;  1AIR A;  1KU9 A;  3CDH A;  2OTL I;  4EJT A;  2M4K A;  1Z7U A;  5ERI A;  1IN7 A;  4P6Y A;  3JX8 A;  2V9K A;  4QUZ A;  1VQP B;  2VT2 A;  3M7G A;  1T6Z A;  2QA4 B;  2H27 A;  2OK8 A;  2WZN A;  1CZF A;  1YS6 A;  2VQG A;  2IS1 A;  4ZCM A;  4PC2 A;  4ZYD A;  4OPV A;  4BKX A;  2JSC A;  4II2 A;  5GV7 A;  3RTR A;  5IOZ A;  1E3X A;  3K4L A;  4TSF A;  1FC3 A;  1G8X A;  3I3L A;  2ZJQ F;  1YX5 A;  1FYK A;  3B90 A;  1ZRD A;  3CME B;  3AL0 B;  1OB5 A;  3I4M J;  1QGY A;  5KHD A;  2DFE A;  5DYM A;  2LSO A;  3S1R J;  4TKO B;  4V2F A;  3TL4 X;  2VNJ A;  3EUA A;  3ZCO A;  2W85 A;  3BQJ A;  4IPA A;  2FA5 A;  3H36 A;  2NS7 A;  1JTA A;  3B73 A;  2DYI A;  1HDP A;  5HDN A;  1R5O A;  2XSD C;  4KYW A;  4RD4 A;  1MBE A;  2ETH A;  2GOX B;  4N4O B;  1ZRF A;  2O0V A;  2LMD A;  1DU6 A;  1NG7 A;  2UVF A;  4MTE A;  4YAW A;  1N0U A;  1IB4 A;  1BHE A;  3N4M A;  1J59 A;  4HX7 A;  4KIF A;  4BEH B;  4L9N A;  2TCT A;  1DU0 A;  3B4N A;  1V54 H;  2D45 A;  2Q0O A;  2VBU A;  2XND A;  3ZPP A;  3G4S I;  4RAY A;  3MWM A;  3KL9 A;  4OOS A;  1BA5 A;  2V5I A;  2JRT A;  3WHC A;  3BTL A;  1R1V A;  1WJF A;  3GRH A;  3CMY A;  3ZPN A;  3TO6 A;  5L46 A;  1YX2 A;  1JGG A;  2M8G X;  1K28 D;  4CH7 A;  5TGT A;  2K9S A;  4OZY A;  1ZR2 A;  1H8E A;  2VBE A;  4RM2 A;  5A88 A;  5HS9 A;  2NSP A;  2XT4 A;  5DCM A;  3OV8 A;  4DYC A;  4YZA A;  3LA2 A;  4Q48 A;  4UUT A;  4IRH A;  3SFI A;  3ASS A;  3RKQ A;  3DU6 A;  4Z4Z A;  4Z2Y A;  3M07 A;  3P5J A;  4KMU X;  1UD2 A;  2FEZ A;  3CD6 I;  3MKZ A;  3FK6 A;  2VC1 A;  1BI3 A;  3HRT A;  1GXP A;  2OQR A;  3V7R A;  2XV4 S;  2Z1D A;  2ZL5 A;  3U1D A;  2DMQ A;  2WAE A;  3CC4 I;  1C0W A;  2D9R A;  3HOZ J;  1Y0N A;  4MFE A;  2X51 A;  2HS5 A;  5J47 A;  3G71 B;  2FSW A;  4F93 B;  3LST A;  4PJM A;  3E3V A;  1XD7 A;  2WJV A;  3DP7 A;  1OCC H;  2ZXI A;  2MYS A;  2DFF A;  5J6X A;  5LBQ A;  5FLM J;  2P8T A;  1BC7 C;  5TR9 A;  1KYW A;  1KK3 A;  2CW7 A;  1LM1 A;  1PLU A;  2Z8G A;  2VFN A;  3SEJ A;  2JMW A;  4OM9 A;  1KON A;  3J80 K;  5IYR A;  3ZZT A;  2L9V A;  1YRN A;  2DMP A;  2ZME B;  1FOY A;  2XIG A;  1T56 A;  3L9F A;  4UUS A;  1SAX A;  3OPO A;  1SVM A;  3I59 A;  4XRS G;  3B78 A;  4Y17 A;  3LSI A;  4AM3 A;  3TP0 A;  2LK2 A;  4F55 A;  3GIR A;  4I84 A;  1JKR C;  1B9M A;  2VZL A;  1D1N A;  4MEX F;  2D1H A;  1FTZ A;  2LBF A;  4ZYG A;  5FO5 A;  5HKK A;  4OIO F;  3PFY A;  3S3N A;  4XOP A;  2HQA A;  2PN6 A;  1VBL A;  1K4T A;  3VYS B;  4NC7 A;  3GTK J;  1WDT A;  2D3L A;  2A07 F;  2HOE A;  5F1R A;  5ICG A;  1IXC A;  4BY7 J;  4FWT A;  3F9K A;  4G5G A;  2E5Z A;  1Y1V J;  3Q0W A;  2IW5 A;  2LKP A;  2TRT A;  1E3P A;  1CNE A;  3DDY A;  3SDB A;  5B3S H;  3AG2 H;  4U87 A;  3I58 A;  4Z4T A;  3ZMU A;  2NVU B;  5AMV A;  1I39 A;  5DD8 A;  4O5V A;  3QP6 A;  4ABZ A;  5JFR A;  3I55 I;  3EQO A;  5E1W A;  3C1D A;  5EDN A;  2DPD A;  4HDV A;  5HDK A;  3DEU A;  2PQ8 A;  1BIB A;  1WKM A;  1QNT A;  4B1R A;  2FBK A;  1TC3 C;  3GTQ J;  3QFC A;  4ESJ A;  2H94 A;  3QYF A;  3VMV A;  3WTS C;  3I64 A;  1FIA A;  4BHP A;  2A5Y B;  1O7L A;  2NOG A;  4A5N A;  4BH9 A;  2KP6 A;  1B72 A;  5ICC A;  1L0O C;  3NAW A;  3ZMV A;  1JTX A;  3K4B A;  2W7N A;  2VAS A;  4CO8 A;  1IZ1 A;  2R5Y A;  1ETO A;  2E7W A;  1KA8 A;  2A61 A;  3TKY A;  4BUP A;  4M1K A;  3F22 A;  4OIN F;  2GRE A;  3CCL B;  1BL0 A;  1RU4 A;  2P5V A;  4XMY A;  4L9J A;  3ABM H;  2MLK A;  1D3Y A;  3ZQI A;  3A8I A;  3T0Y A;  5ILU A;  4RPD A;  2YUS A;  3O8G A;  3JRE A;  4UUV A;  4WXH A;  3X2Q H;  2K9N A;  3BJA A;  1JXS A;  1T8I A;  2BV3 A;  2PE3 A;  2DT5 A;  3U6K A;  3GVK A;  2VFP A;  4NB5 A;  1AOY A;  3LSG A;  2LTP A;  2BW3 B;  2O03 A;  4JX4 A;  2WJY A;  3ZIA A;  1VQ5 B;  2V7V A;  1RC9 A;  4LG3 A;  3P9C A;  1MJ9 A;  2X1C A;  1XS9 A;  2XKO A;  4W8T A;  4NBQ A;  3T5X A;  3OYK A;  4W97 A;  3BQZ A;  1ZGA A;  3FIS A;  3HRU A;  5M5W J;  2RGV A;  5LD2 C;  2BPO A;  3KP2 A;  3VSL A;  5LHI A;  3NEU A;  2GK6 A;  1T6S A;  2DT6 A;  2MD0 A;  1ZM2 A;  2VBT A;  1G3S A;  4A3J J;  4M53 A;  3F8F A;  4FX0 A;  2V7W A;  1W9X A;  2M3A A;  3MCA A;  1Y8R B;  4Z4W A;  2P6T A;  3BCA A;  1QFY A;  5IY5 H;  4A12 A;  1O4X A;  1PVE A;  4OJ6 A;  1YTY A;  3G1M A;  2IP2 A;  2XOK A;  3D1N I;  1ETX A;  1SD5 A;  3ABT A;  3WE3 A;  1CLW A;  2I10 A;  2V1N A;  1U9N A;  2NPF A;  3H5N A;  4YZX A;  2QCO A;  5K7H A;  2QY1 A;  3HOX J;  2RNG A;  1E2X A;  1O8D A;  4G8X A;  1YYV A;  5EYR A;  4CZZ A;  2JSP A;  2CFX A;  4YAL A;  4GGG A;  2XRN A;  1LB2 A;  1EFC A;  5F0C A;  3DXJ F;  1LEA A;  2DCU A;  2GA2 A;  4XLA A;  4UZE A;  3K2Z A;  3ZQF A;  4OIR F;  2YR2 A;  5HOO A;  2O61 A;  2Q1Z B;  1IRG A;  1SAN A;  4S0H B;  1DGR M;  1HW5 A;  3UKG A;  5FRO A;  4GYI A;  3BTC A;  1QGP A;  1XSV A;  3ABU A;  2N8G A;  4BGD A;  2WY8 Q;  5L3E A;  1HST A;  2L3D A;  1BR4 A;  3JR9 A;  3ASR A;  1U5T A;  3JCU C;  1K5C A;  4Y52 J;  1RKT A;  3EQL F;  3ZZ0 A;  3J7Y J;  1MDM B;  5DCM B;  2X3H A;  2DER A;  2A5W A;  2LF7 A;  3OWT A;  4DIQ A;  5HNH A;  5FGM A;  2KZV A;  2W82 A;  4U0Y A;  3T53 B;  3FXO A;  1YW7 A;  2LRE A;  1IDY A;  1YHQ I;  1FOK A;  2OZU A;  4O6J A;  3TDZ C;  2JA5 J;  2WAF A;  3K1P A;  3A3G A;  3B82 A;  2WWY A;  3HKZ N;  3CCM B;  4NK6 A;  5DS0 A;  4PUS A;  2Y9Z A;  1BJZ A;  2QN6 A;  3QPT A;  2H6C A;  3ZGK A;  3T1B A;  3TH0 A;  1KQ5 A;  4Y15 A;  4E4H A;  2XC7 A;  1F1Z A;  4BEH A;  5A8A A;  2DA5 A;  3I1F A;  3K70 C;  5F04 A;  4WX9 A;  1S72 I;  4M3B A;  3F21 A;  4MNU A;  2M7B A;  5JR3 A;  2E60 A;  3W2G A;  1TLL A;  3K9T A;  2BGC A;  4D1Q A;  4XL9 A;  3ISP A;  4X06 A;  4TMT A;  5LFA A;  2A6T A;  1FOW A;  3VNV A;  2V6C A;  1R49 A;  3LQQ A;  5C3E J;  4M74 A;  2DYR H;  3H35 A;  1I1S A;  3HTU A;  2BM1 A;  1W7P D;  2LBF B;  2DU9 A;  3H5A A;  1R4N B;  3ZRG A;  1KU3 A;  4LFU A;  3FM3 A;  1YI2 B;  2ZL7 A;  3V8J A;  1NRK A;  1J5Y A;  2CRG A;  1GQ8 A;  3OYF A;  3ASO H;  3OYJ A;  3GW2 A;  5C44 J;  1PDN C;  1RUN A;  4HBL A;  4DNT B;  4B3G A;  4X7D A;  2VNI A;  2HPM A;  2FVG A;  1Y39 A;  5KK1 A;  5CVJ A;  2C78 A;  4N9I A;  4OMZ A;  3RQ4 A;  1X1A A;  3FXL A;  3KEO A;  4XKB A;  1SFU A;  3KP4 A;  4DZP A;  1AIP A;  3CTA A;  4U49 A;  1VLY A;  3SZE A;  4A5M A;  5C4J J;  3ECH A;  2QYU A;  3ZMT A;  3WTU C;  5AIQ A;  1T33 A;  1X58 A;  4M3F A;  1S5L C;  2BHZ A;  2JVG A;  1YO5 C;  5L3D A;  1ZEL A;  2J5P A;  4YEL A;  3JU4 A;  2E7X A;  3OOU A;  5FFX A;  3U2Q A;  2BGI A;  2ZB9 A;  3A0B C;  5L3F A;  3SUC A;  3GVA A;  3ERE D;  4H0E A;  1OB2 A;  2QMU A;  2LNB A;  4U7B A;  1FNN A;  2BSA A;  2W1O A;  4MHG A;  3FXU A;  4OIQ F;  4KKT A;  2W00 A;  1Y8Q B;  2BBY A;  5E3N A;  2KLO A;  1HA8 A;  2ADU A;  3FBN B;  3VYU B;  1WQ2 A;  3DWL E;  5BNG A;  3ZR8 X;  1E17 A;  1OFE A;  1TWG J;  2MSY A;  2JDI A;  2R5Y B;  3V8K A;  5D6F A;  3GFI A;  1K8A D;  2CRV A;  3GF2 A;  4HWV A;  3QRF F;  3SEZ A;  1LKX A;  1ZK8 A;  4RDJ A;  3RYR A;  3WQZ A;  3OYE A;  4M0L A;  2D2W A;  3LJY A;  4LD5 A;  1CF7 A;  1HVX A;  1COW A;  4DZJ A;  4EEF G;  3SLN A;  3U21 A;  5D5V B;  2GA1 A;  2YU3 A;  1O8F A;  1OFL A;  4F3Q A;  3OSG A;  1TLH B;  2E1B A;  4XRM A;  4RAZ A;  2MC3 A;  1CQT A;  4B3F X;  1IN4 A;  4V2G A;  4LIT A;  1RKW A;  4PAA A;  4RDK A;  5DN6 A;  2P81 A;  4M6X A;  5FD5 A;  1B4A A;  4CZC A;  3G6E I;  2V31 A;  2VKH A;  4IRI A;  2X3U A;  2K3P A;  4ACB A;  4XLN F;  1ZH5 A;  1EP1 B;  1Y0R A;  4WXC A;  4ASN A;  2XC1 A;  3C3W A;  4ZZL A;  3HOU J;  4DYR A;  1VQ6 I;  1UCR A;  3CCM I;  1Z9C A;  4RD0 A;  3F8N A;  3WG7 H;  2BVL A;  2CO5 A;  1YIO A;  1DUX C;  3R0J A;  3CLO A;  4G12 A;  1POG A;  4A3B J;  1OJL A;  2ECC A;  4E7J A;  4HOB A;  3DFG A;  4XOT A;  2KL4 A;  3BPV A;  1XDU A;  3NWS A;  1HKS A;  1FPQ A;  3S3M A;  3K6G A;  1TSP A;  2EFW A;  4JP0 A;  3K10 A;  3LYC A;  4MR0 A;  1O3S A;  3W5V A;  1WXR A;  4JYK A;  2O8X A;  3OOC A;  1GO2 A;  2OBT A;  1K6Y A;  1W7P A;  4MLO A;  3OZW A;  4QIW N;  2D5V A;  5D5U B;  3BY1 A;  3U6B A;  2O1D A;  3W2V A;  2VBZ A;  2C2W A;  3QPH A;  4DYQ A;  3A2K A;  3E6B A;  3IRQ A;  2XZP A;  4M72 A;  3E5X A;  4GCV A;  3HL2 A;  2PIA A;  1TYW A;  4BAY A;  2EZH A;  4OMY A;  4XLF A;  4D9J A;  2Y31 A;  4X6A J;  3A8J A;  4PGH A;  1D8J A;  3IAM 2;  4EH1 A;  5LEJ A;  5DUK A;  2F2E A;  1B6A A;  1DDI A;  1E1Q A;  3V7S A;  1VF7 A;  5EJC A;  1VQN I;  4NDL A;  3RIR A;  1XB4 A;  4RGX A;  2M4G A;  2YS9 A;  4MO7 A;  2ZXJ A;  2ID3 A;  2COM A;  2VQH A;  2FQ3 A;  5J4Y A;  3GTL J;  3MAJ A;  4RLZ A;  5IP9 J;  1R9T J;  3GZ5 A;  4IJA A;  5DEQ A;  3ONU A;  4LBY A;  1YQA A;  3ZQC A;  3RQI A;  2M5S A;  2ZTN A;  3BR0 A;  3U9G A;  2WPD A;  1YIJ B;  2CQN A;  5TY0 A;  1WMR A;  5DSZ A;  5J4V A;  4BHC A;  3RI4 A;  2H1L A;  1YJW I;  4IEJ A;  1K7A A;  1IGN A;  2K27 A;  5IOY A;  3HOS A;  4KUM A;  1O8G A;  3IKT A;  1PUE E;  1E1R A;  2DDB A;  4P1W A;  2EIX A;  4QVA A;  2W48 A;  1WJ5 A;  3K70 D;  2VJ5 A;  3GTO J;  1BI0 A;  1MMG A;  2CQ7 A;  3ZZU A;  4L8J A;  2Q8K A;  2NVQ J;  4KIT B;  1G7T A;  1X3Z B;  2M1B A;  3CCR B;  1W0K A;  1O8M A;  1A5J A;  3FMR A;  2BEO A;  3HTS B;  1MBH A;  1W1W E;  2HVR A;  1KZL A;  2HU9 A;  1UG2 A;  2QLZ A;  4G6D A;  3HUG A;  2NAZ A;  3BJO A;  1PYV A;  5GV8 A;  2VNK A;  1IXS B;  5J1U A;  4LMY A;  2ELJ A;  1J7K A;  1LFP A;  2J7K A;  3BH7 B;  5DNS A;  3QQA A;  5K5O A;  1VQK I;  2R4G A;  2YWE A;  2A6E F;  4UB6 C;  5FKL A;  3SJM A;  4RD6 A;  4OJL A;  3W2H A;  5D5X B;  3E5Q A;  1K4S A;  4KDP A;  3FK7 A;  5GTI C;  2VFM A;  1QG0 A;  4P55 A;  2HOT A;  4KKS A;  2QKM B;  1GUU A;  3PA2 A;  1TQP A;  2CW0 F;  3G1L A;  5E1Z B;  5DUI A;  5CVR A;  3RJP A;  4DBR A;  3JAM Z;  3PVD A;  3MMY B;  1SAU A;  3B8Y A;  2VBS A;  4BQQ A;  4HF1 A;  2YX4 A;  2ME0 A;  2XKP A;  4HNT A;  3KZY A;  2CYY A;  2CGP A;  3KIO A;  2O8K A;  1IXR C;  5B6I A;  1BJK A;  3VO1 A;  1WOR A;  2DMN A;  2ZBV A;  2W84 A;  1D0X A;  3G1O A;  1OQY A;  4L9T A;  4RLF A;  4C3J J;  5L3B A;  2G0E A;  5J8C A;  4J01 A;  4FHT A;  4BU2 A;  1YW8 A;  4KIG A;  2CV1 A;  2QTZ A;  1LDJ A;  1ODD A;  1DQU A;  1EWY A;  4G7W A;  1QZY A;  2P4W A;  1O3R A;  2BVN A;  4GFB A;  2EV6 A;  3P7N A;  4QV2 A;  1VQO B;  3RIQ A;  5IT9 K;  1MIJ A;  4CSW A;  1RR7 A;  3OYM A;  3E7L A;  2CMP A;  3SEQ A;  3KLO A;  3Q3A A;  2ESN A;  2IVM A;  1RMG A;  4A3E J;  1V4R A;  3J81 K;  4IX7 A;  1WWX A;  2HDD A;  1KD1 D;  4EGY A;  4DJA A;  3S93 A;  2ZIT A;  2KRH A;  1ZQ3 P;  2XAH A;  5J1Y A;  5H2F C;  3PNV A;  3QYB A;  1IRZ A;  5CLS A;  2X8K A;  1VQK B;  1F9N A;  3CME I;  3V42 A;  2E1C A;  3L09 A;  2PI0 A;  4NBS A;  3O6B B;  1DP7 P;  1I6H J;  2VC0 A;  2WTE A;  2VJ4 A;  3M8E A;  1NB9 A;  3CDL A;  1MJA A;  1JGS A;  3Q0U A;  4D7M A;  1V0F A;  5FB2 A;  1X0C A;  2JJ2 A;  1D0Y A;  4NHJ A;  3LAP A;  1E0E A;  2YWG A;  1TWF J;  3T8T A;  3TW7 A;  3CMA B;  3GFJ A;  5FRN A;  5F64 A;  1QVF B;  4WXD A;  1J0R A;  3KLN A;  5KAF C;  2W4S A;  4RB3 C;  1O57 A;  3IV5 A;  2F5D A;  2B7C A;  1AA7 A;  2IS2 A;  4CHU A;  1TQI A;  3CO7 C;  2QZA A;  1EFR A;  3REO A;  4LB5 A;  3LSM A;  2Z6B D;  1QCX A;  4YDT A;  4YZ0 A;  1B8I B;  1TWA J;  4UV9 A;  3CJT B;  4PZJ A;  3LNQ A;  4C3I J;  4BQA A;  2FX3 A;  5JLX A;  2K7L A;  3F3X A;  3ZQG A;  1XCB A;  3FF5 A;  1VQ6 B;  1ZAO A;  4ZTJ A;  1VND A;  2ZSI B;  2XEX A;  3E97 A;  5DTD A;  2HPI A;  4FE7 A;  3W6J B;  2JA8 J;  5CDF A;  4LLL A;  3EYI A;  4OPO A;  1QGZ A;  3CCJ B;  1A6Q A;  3L2R A;  4IVN A;  2XB5 A;  1XMX A;  1UMQ A;  5D8L B;  1LNW A;  4TV7 A;  3JSO A;  3GTG J;  2XTW A;  5M3M J;  2E1M B;  3LO8 A;  2RQP A;  1S29 A;  1WH5 A;  1EF4 A;  4TMW A;  4YXW A;  3OW2 B;  4I0A A;  2EQR A;  2XRO A;  3Q39 A;  4CYC B;  4KNY A;  4N3G A;  1JUM A;  4FCY A;  3CP2 A;  2QXZ A;  2VPR A;  4D5F A;  2XAQ A;  3J7Z I;  5L3G A;  1AHD P;  2V7T A;  1XSD A;  2JUC A;  2ODL A;  2A6H F;  2JPB A;  2L4A A;  1J2X A;  2B7B A;  4UZU A;  2FBI A;  2NVX J;  1NB0 A;  2DOF A;  1SFK A;  4ZYH A;  1ZYR F;  5M5X J;  4Q5S F;  2LDU A;  2D3N A;  1XX5 A;  2AQE A;  2V79 A;  2K9M A;  4YFN F;  2Q6I A;  1BM9 A;  2DA4 A;  2VB6 A;  1JTY A;  1TTY A;  2IS6 A;  4KA4 A;  5DV5 A;  3KET A;  4FET A;  2R7S A;  3AFH A;  5FD6 A;  2EA2 A;  4U4B A;  3BY6 A;  1R23 A;  3FXK A;  2IBD A;  4OWR B;  4EW9 A;  1EKE A;  3VYT B;  3E5U A;  2ZME C;  3HM5 A;  4RLQ A;  1IF1 A;  3N6Z A;  2LR8 A;  1MGT A;  2ZXW H;  3MZY A;  1E79 A;  4EJO A;  1LE8 B;  3OKX A;  1EH7 A;  3H3U A;  3KZI C;  2GM4 A;  2K4J A;  3CUQ A;  4AUX A;  1MW7 A;  2FRH A;  2EWN A;  4WWV A;  3QOD A;  3DLL F;  3JRH A;  1KK2 A;  1KJZ A;  4OJO A;  2EIJ H;  4CCL A;  3Q9S A;  1TVC A;  2DTZ A;  1XGS A;  1GAW A;  4UNO A;  2Q6K A;  2L7Z A;  2NVY J;  1T08 B;  1W0U A;  1G7S A;  3LMM A;  3BJ6 A;  2XZL A;  1F4K A;  5FKM A;  3B8H A;  4OPW A;  1EFU A;  2MFZ A;  2W7Z A;  2GIZ A;  1W5C C;  1YS7 A;  2R7X A;  4P26 A;  3G05 A;  2Z33 A;  2EIM H;  3BG7 A;  2LKX A;  3BH6 B;  2NT9 A;  2A69 F;  3H09 A;  3ZN1 A;  4Y7C A;  3MFK A;  1Z91 A;  5D5W B;  1N0V C;  1G4D A;  3FMS A;  2ID6 A;  5JHF A;  2RC4 A;  3OS2 A;  1OHH A;  1TP4 A;  3QU3 A;  1OCO H;  1IJE A;  4FXU A;  3OYB A;  5KNL A;  3PNT A;  3HRM A;  3JRD A;  2JK3 A;  1W34 A;  2BY0 A;  5FKK A;  3J7A O;  3JQQ A;  2HQN A;  4RB2 C;  5EG0 B;  1JA1 A;  2E5N A;  4NC8 A;  1I1G A;  2YWH A;  1W4M A;  5KAI C;  3G3Z A;  1EP3 B;  5E1X A;  1U3E M;  5FLV A;  2VBV A;  2V1X A;  2CJJ A;  1ZKG A;  3JAM K;  2WZP P;  1MMA A;  2FX0 A;  1N05 A;  4GDF A;  3SLD A;  2RQQ A;  4BJ6 C;  1USS A;  2AO9 A;  2KKO A;  3H0D A;  3HPG A;  4HG2 A;  1GAQ A;  1R1U A;  2OC6 A;  3QPS A;  3OW7 A;  2F5E A;  1W5S A;  1S9H A;  3MVP A;  4Q47 A;  4LLG F;  2BV6 A;  2R9V A;  2DO7 A;  1VQP I;  1U5T C;  2KVO A;  3FBI B;  3M4O J;  5F1J A;  3AVU A;  5IT9 Z;  4QSH A;  4HF2 A;  4BJ5 C;  2YPR A;  1UJ8 A;  3CCQ B;  3H9G A;  2XHK A;  3GEZ A;  2DOG A;  3B6A A;  4L5J A;  3CCU I;  3NE5 B;  1FX7 A;  1D8K A;  4RA2 A;  2V26 A;  4F7Z A;  2P3M A;  3LSJ A;  1HF2 A;  1BBY A;  3S15 J;  2E1M C;  3RY8 A;  2DOA A;  4ON0 A;  3L2U A;  2ZFW A;  1JKO C;  1K83 J;  2CUE A;  4I6Z A;  1BX1 A;  2K4B A;  4LB6 B;  1E64 A;  2ZZG A;  4CXF A;  3PSZ A;  2OJE D;  2WYR A;  2HYG D;  1S4M A;  3AST A;  4PK4 A;  3JRG A;  1QVU A;  1F5T A;  3VST A;  4G7O F;  3KP3 A;  4RCZ A;  3BR6 A;  5FKO A;  2JT1 A;  3IP4 B;  4Q4Z F;  4E70 A;  4PMH A;  3HHG A;  5IT3 A;  1B1B A;  2L7M P;  2VOP A;  1QU3 A;  3BPX A;  1YX3 A;  5FKN A;  3I9V 2;  3I5U A;  2Y0S N;  3SY2 A;  4HPQ A;  4LC0 A;  1R5H A;  4P1V A;  2RVC A;  3S1Q J;  2QYO A;  1NK3 P;  1MBG A;  4BXX J;  4HE6 A;  3D5L A;  1YG2 A;  2HCJ B;  4X8I A;  2BN4 A;  2DPU A;  4KIS A;  4OZZ A;  3CMA I;  3HZJ A;  2HEO A;  5K5Q A;  1BR2 A;  2JTV A;  2QUF A;  3K0L A;  2R5Z A;  1PKV A;  3GME A;  1DAR A;  1WRJ A;  3WXM A;  1Z7L A;  4RPB A;  3QYE A;  1H8A C;  1IDZ A;  2INU A;  2ZNY A;  4PC3 A;  4HZF A;  3CC4 B;  3WBK A;  1LLW A;  2G9W A;  4UVB A;  1MNE A;  1AKH B;  3KRG A;  1HKT A;  1IRF A;  1I3Q J;  3RCO A;  5HS8 A;  5TIS C;  2FOW A;  4A3G J;  5IYP A;  1U2W A;  3CJQ B;  4BS9 A;  3OY9 A;  3VB2 A;  2QM3 A;  3K7A J;  3R6S A;  2H1K A;  2BY1 A;  2EH3 A;  2EIN H;  4U7D A;  4PFP A;  4OU0 A;  4UVC A;  4XK4 A;  5E20 A;  2QSG X;  1JT0 A;  4ZDO A;  3Q6R A;  3OP1 A;  4G6Q A;  1T95 A;  3WGI A;  3JW4 A;  3E0J B;  2VQL A;  5BPI A;  2PMZ N;  1F43 A;  2M7A A;  3ROU A;  3CB4 A;  1S7A A;  1T98 A;  3K1N A;  4A3L J;  1I7P A;  5F0F A;  2WAQ N;  1VQ7 I;  3LFU A;  4Y13 A;  4IHV A;  1TYX A;  2GQF A;  3BR1 A;  4WZL A;  2DW4 A;  4CCO A;  4ZGQ B;  2C4T A;  4WZK A;  3FZV A;  3C2B A;  2DY1 A;  1LLZ A;  3CZ6 A;  3CCE I;  4EGZ A;  1WOO A;  2XGX A;  3GXO A;  4RM3 A;  3S17 J;  2X0K A;  1SD4 A;  3OL3 A;  4XNF A;  4BL0 B;  2WBM A;  4ESB A;  1B8I A;  4F52 A;  2L9S A;  1YJW B;  3E20 A;  1RWR A;  3A4C A;  2V6E A;  3A02 A;  2EB7 A;  1VQM B;  4BDZ A;  2XNJ A;  5HLH A;  2CG4 A;  1P4A A;  2PFB A;  2MC4 A;  1FRN A;  1FYL A;  1QJV A;  2EFN A;  1H89 C;  5F08 A;  4XSZ F;  3T9G A;  3SZG A;  1RIO H;  1FIP A;  4G6T B;  3PIP F;  3JRF A;  3GQB A;  1P7J A;  3QFT A;  4P6V F;  4EV0 A;  4KFC A;  3A1Y A;  3KYC B;  2O17 A;  4DQL A;  3WGH A;  2L4M A;  3KP6 A;  2V4J C;  4BJT A;  1B2R A;  3OFN A;  2H6B A;  1J9Z A;  1X4O A;  3VR6 A;  4Z06 A;  3P4G A;  3NRV A;  4F92 B;  2BF4 A;  2PX9 A;  3R4K A;  3JSP A;  1BN5 A;  4YFX F;  3OYI A;  4LIU A;  4XLC A;  1H85 A;  3EUK L;  4FTH A;  2F1L A;  1RQR A;  3HOY J;  2O5R A;  3CCR I;  3BG9 A;  2Y30 A;  2JPC A;  4M9Z A;  2P7C B;  5B66 C;  4FX4 A;  2GLO A;  1WH7 A;  5FLX K;  1QA2 A;  3MQ0 A;  3HDD A;  1Q86 D;  1XMK A;  3Q38 A;  2HVS A;  1ENH A;  3S1M J;  5FL7 A;  1JKQ C;  2CQQ A;  4B09 A;  3L2C A;  3N97 A;  3IWZ A;  1W2B B;  2LY1 A;  2VI6 A;  3K4M A;  3G6E B;  2Z9O A;  2M45 A;  5K7F A;  3ECO A;  3FX3 A;  1K78 B;  1W35 A;  4S05 A;  2YUH A;  2R7F A;  3F72 A;  2IOU G;  2LFB A;  2IT0 A;  1XFO A;  3PL8 A;  4KH3 A;  4AYB N;  2HDW A;  2QVO A;  3WTY C;  5GP9 A;  3L1P A;  5EGO A;  4N4N B;  3DCF A;  2W24 A;  4Y3O A;  1TW2 A;  2VL8 A;  3A01 B;  4QHY A;  4JMQ A;  3HOV J;  1VTN C;  1D1A A;  4ZC3 A;  4RMN A;  1X1D A;  5FO1 A;  3B6C A;  3WYA A;  3TO7 A;  1EFT A;  2QQB A;  4J0Q A;  1Z3Y A;  4WWC A;  3W5U A;  5IPA A;  1D0Z A;  5CYV A;  1PUF B;  4ZCI A;  5IYC J;  1LDK B;  1IO2 A;  1X2M A;  1N06 A;  3SJP A;  1MMD A;  4DW6 A;  1VQ5 I;  1UD4 A;  3COA C;  4P9S A;  2PMU A;  1HZE A;  4MQV A;  1JUP A;  3R6J A;  4IKF A;  4C0S A;  1LVA A;  2HGC A;  1H80 A;  1JHF A;  4HNV A;  3H3Z A;  1SFX A;  3P9K A;  2H8W A;  5HVQ C;  5D6E A;  2MG4 A;  1V0E A;  1Q9S A;  1R4M B;  3UW0 A;  3GFL A;  2ZZQ A;  4HA8 A;  4BDY A;  2PJR B;  3WTV C;  3M1C A;  1RI7 A;  5EEH A;  4A2U A;  2O3F A;  4EJV A;  5LGU A;  2NVT J;  3AL0 C;  2R5Z B;  2YU9 J;  1O3Q A;  3MKY B;  3CJR B;  4PC1 A;  1KK1 A;  4BAC A;  4RB0 A;  1KQ9 A;  2PEC A;  1A36 A;  1VQ4 I;  3S3O A;  2L01 A;  4PJ0 C;  1FX0 A;  3QE2 A;  3W6K B;  3WWG A;  4Z05 A;  2QE7 A;  1X4P A;  1L3L A;  2GQQ A;  2XAF A;  3T8R A;  4UXN A;  1S0U A;  3RPQ A;  3ES9 A;  3H94 A;  1QFJ A;  1DGW Y;  1HXD A;  4UV8 A;  5J1R A;  3GX4 X;  2EFO A;  4IQ4 A;  1SC7 A;  2A68 F;  4TT3 A;  2NV4 A;  1FBU A;  1QHH D;  2CQK A;  2XRL A;  3SKB A;  1N8R D;  1OGM X;  3VWB A;  2OCC H;  3FDY A;  2VE9 A;  5H6R A;  4GXO A;  4F7D A;  2K40 A;  3ABK H;  1FBS A;  5IYQ A;  1HCR A;  3GTP J;  2M8E A;  2X48 A;  4EM2 A;  2CF4 A;  4GRI A;  4PAB A;  3ESW B;  1QQ1 A;  3F6V A;  3ZPL A;  3JTG A;  2ZXH A;  4J19 A;  4Y9U A;  2IQ7 A;  3FXM A;  1UB9 A;  1W7P B;  3BTJ A;  1YIJ I;  4KIB A;  2QF7 A;  3AG1 H;  1WJB A;  2P0W A;  4B43 A;  1W0T A;  2L7F P;  1N08 A;  1GLN A;  4YCQ A;  4HLY A;  2OAZ A;  1JB9 A;  2DET A;  1U8B A;  1U8R A;  1MBF A;  2VBK A;  4MQ9 F;  3ML3 A;  3HOW J;  5HXB A;  2NXN B;  2X6Y A;  3VEP A;  3OEH A;  3OEE A;  4ASU A;  4A3M J;  2DA3 A;  1BI1 A;  2LD5 A;  1WSU A;  5IYB J;  2B5O A;  4XBF A;  5DM6 F;  5BSY A;  1YIT B;  1W5T A;  1NJI D;  4V02 C;  4GO1 A;  4BQO A;  4P3I A;  2EFP A;  4D5C A;  2FD5 A;  2L2O A;  1NH3 A;  2EZL A;  4ZYE A;  1WOS A;  3CRZ A;  3DPU A;  1TW3 A;  4UAJ A;  3H9N A;  2C4U A;  3OZU A;  1ZTR A;  2Y2Z A;  2GXA A;  2UZK A;  1IDK A;  2W57 A;  1V55 H;  2XAG A;  3OYH A;  1ZLK A;  1BX0 A;  5HZA A;  5J8F A;  1WJD A;  1Y0Y A;  5GAG J;  4BNC A;  2PJP A;  5EF6 A;  2R0Q C;  2NS0 A;  3CC2 I;  1FMW A;  2IAI A;  1UZC A;  3FHZ A;  1R58 A;  1FWZ A;  2IXS A;  2WB1 A;  2XT2 A;  4LJZ F;  4MYU A;  4B4D A;  1EH6 A;  4IRG A;  1TWC J;  3QWL A;  1KC8 D;  2MAB A;  3ELK A;  5F6F A;  1OCR H;  1R7J A;  2BM4 A;  1IRX A;  2VPL A;  3R0A A;  2A05 A;  2GPJ A;  2KDZ A;  2KIM A;  5IP7 J;  4P3Y A;  1CGP A;  3R61 A;  1P6R A;  2LP0 A;  2R7Z J;  2HTS A;  1IA5 A;  1SMY F;  1KGS A;  2VBX A;  3HUG B;  1HF0 A;  2Z3Y A;  2M9H A;  3CW2 A;  1JKP C;  2PLF A;  3OYN A;  3F23 A;  2GJR A;  1MKM A;  3P9I A;  2C5H A;  1R00 A;  2HVQ A;  3RPU D;  3BY2 A;  4EAT A;  3C7J A;  5DM7 F;  3MZH A;  3OYC A;  2L0K A;  1HKQ A;  4I98 B;  3EQN A;  4K2E A;  1X1P A;  4EQQ A;  2EPF A;  2R7V A;  4HST A;  1KTV A;  1TWH J;  5IP6 A;  5LHH A;  9ANT A;  4OAZ A;  3E6M A;  2FMY A;  3O2P E;  4AVZ A;  1DBG A;  3V4G A;  2Z5U A;  1EV7 A;  3W5H A;  3M8J A;  2D1V A;  5F27 A;  2NTQ A;  3PUN A;  3CXC B;  2BXY A;  3U2R A;  4M3E A;  4LBV A;  1TYV A;  1D8T A;  4BQN A;  1WHU A;  3WNB A;  2ISZ A;  5ILS A;  1EA3 A;  3A1P A;  3IKV A;  2PJR A;  2CUJ A;  1QFZ A;  1ZM4 A;  1T0F A;  4C2M J;  1K79 A;  6PAX A;  1ITY A;  1FNB A;  1JNY A;  4Q7J B;  1R5I D;  1OMI A;  3CF5 F;  3FMQ A;  2VON A;  4ENM A;  4C30 A;  1YW9 A;  3I0T A;  3W2A A;  4JQF A;  1G59 A;  4B47 A;  1PUF A;  2DOE A;  2O6G E;  2FBH A;  3SZP A;  1Q1H A;  4NQW B;  1RUO A;  2HKX A;  3AK5 A;  1QPI A;  4R71 A;  4PJL A;  1LVK A;  5EZH A;  2BY3 A;  3CLQ A;  4KN4 X;  1M90 D;  1ZG1 A;  3M1E A;  3S16 J;  1OGJ A;  3SFZ A;  2QDX A;  1PJ6 A;  3BH4 A;  3HBL A;  4LG0 B;  1FBQ A;  3IHU A;  3HSE A;  3GLL A;  4AU7 A;  1JE8 A;  3VO2 A;  1R36 A;  2NS8 A;  2VJJ A;  3WU2 C;  2R7D A;  4FIS A;  1IW7 F;  1TBX A;  4X7C A;  1K78 A;  3IH3 A;  2Q2E B;  2DJN A;  4L0Y B;  2MH9 A;  4HIZ A;  3CPW B;  1DAB A;  3SQV A;  1E3Z A;  3D26 A;  3WTX C;  2LOO A;  2JN6 A;  3DTI A;  2ME6 A;  1VQ9 I;  1ZGW A;  2HXO A;  5EZG A;  5GAH J;  5EGO B;  2P7V B;  1XE1 A;  4C43 A;  4AD9 A;  2X6X A;  2DQL A;  4P9U A;  2DOD A;  1ZRC A;  1GHC A;  4A3I J;  1FOX A;  1SKQ A;  4I01 A;  3HRS A;  2KQR A;  2NZM A;  1MND A;  1FP1 D;  2OF7 A;  4PGG A;  1SFO J;  1G2H A;  4XKV A;  5JLW A;  2P5K A;  3WU0 A;  4BE0 A;  2E36 A;  3ZXS A;  4A0Y A;  1J09 A;  1LPQ A;  2BZT A;  3CES A;  2HZD A;  2IA1 A;  4L5I A;  3I4P A;  3OMY A;  4BBR J;  1T2K A;  1OLT A;  4KT5 C;  3S1N J;  4KKU A;  4HDU A;  4KN7 X;  1BN8 A;  2OU2 A;  5AN9 A;  5AIP A;  2IJL A;  3S2H J;  2C77 A;  3A03 A;  4Z4U A;  1X19 A;  3LFK A;  1H8H A;  3T51 B;  3AVT A;  2STT A;  3GQ7 A;  4I7H A;  3K4J A;  2ZJ2 A;  2OYN A;  5HS7 A;  4B8X A;  4WZT A;  3MN2 A;  1XGO A;  2M30 A;  4XID A;  5F4M A;  1MBK A;  1H0M A;  1N77 A;  2RC6 A;  1VHO A;  1QQI A;  3PSS A;  1WGX A;  1ZUN B;  1R22 A;  3F6O A;  2EZK A;  4MYT A;  2CW8 A;  3PSI A;  5CJ9 A;  1KQS B;  1FY7 A;  2E19 A;  2HI3 A;  3PSF A;  2VLA A;  3WY9 A;  3S14 J;  2LC2 A;  3HYI A;  3NAR A;  4A3K J;  3LSP A;  2QX3 A;  3V8L A;  1J9I A;  1KTW A;  1O8I A;  4BXF A;  1IV6 A;  3EPZ A;  2V7Q A;  3CUQ C;  5GAE J;  4OPS A;  2IPQ X;  3FJO A;  2H09 A;  1FSE A;  3OYG A;  1GVD A;  2UXN A;  3Q5F A;  1JT6 A;  1YRN B;  1UHW A;  2PMZ A;  3W2W A;  2BMW A;  4RS8 A;  4NNJ A;  3VSV A;  4P25 A;  3A0H C;  4ESF A;  5JVG F;  2F43 A;  3CD6 B;  4M3D A;  2KFD A;  2CH0 A;  5HZB A;  1K8F A;  1NHA A;  1E62 A;  4IOA F;  1HW2 A;  3ZMS A;  5LEK A;  1ZR4 A;  1IB0 A;  2WAD A;  2CBX A;  4PSX A;  1Z77 A;  1T6Y A;  1T0F C;  4LBW A;  2EFG A;  2EJR A;  2VBY A;  1I8D A;  4G1B A;  1A6I A;  3IH4 A;  2G0Y A;  3AKZ A;  1VZ0 A;  2V1D A;  3CC7 I;  5IYD J;  1VLO A;  3PEN A;  1B23 P;  3HOT A;  3K69 A;  1S7E A;  2HOA A;  3NQO A;  4Y33 A;  4Y7N J;  4P5O A;  5HLT A;  5F4J A;  5H59 A;  5E3L A;  3BP8 A;  4IHX A;  1WI3 A;  3R6K A;  1H9T A;  1UD5 A;  3HGY A;  3WE2 A;  4P22 A;  3JQP A;  1BOA A;  3BTI A;  1Z0X A;  5HNF A;  4KJZ A;  1R5B A;  3FKJ A;  1HDD C;  2QQ8 A;  2F5F A;  1STZ A;  5BMZ A;  2GXB A;  1XN7 A;  2VOD A;  4ZTF A;  2BM0 A;  5FNZ A;  1MMS A;  2RC5 A;  1OFD A;  3RDI A;  1ZG5 A;  3PET A;  1AMO A;  1P4X A;  3SJZ A;  2CWE A;  2JQ7 A;  4AVP A;  4QWQ A;  3HAG A;  2PYG A;  1ERD A;  4W8R A;  3JUR A;  5HLG A;  2XUB A;  3HB9 A;  3BC9 A;  2X1D A;  3BRO A;  4II3 A;  3OIP A;  2Y0S A;  4U9U A;  1HG8 A;  2VXZ A;  5H20 A;  2HXI A;  1LEB A;  1K4Z A;  1TYU A;  2RKH A;  4R8H A;  1ACI A;  4YC5 A;  4LIV A;  2WY7 Q;  1DPU A;  4OOX A;  3KYD B;  5M5Y J;  2ECB A;  4E7Z A;  3KYL A;  1MDM A;  1JJ2 B;  1Y56 A;  2ZKZ A;  4XLH A;  3WNC A;  4XLP F;  4C2T A;  3HHH A;  2XGE A;  1SMT A;  2QTL A;  4ITV A;  3DTK A; 
#chains in the Genus database with same CATH homology
 3IP4 B;  4PMH A;  5C1C A;  1N78 A;  2WAF A;  3A35 A;  1MMN A;  3K4N A;  1QU3 A;  3A3G A;  1YX3 A;  3OR2 C;  1D1C A;  3J7A Y;  3DU5 A;  3I9V 2;  2R7R A;  1OOC A;  4PUS A;  1PXZ A;  4NK6 A;  4HPQ A;  2CV0 A;  2OV7 A;  2DIE A;  3DQV C;  2F5V A;  3D5L A;  3ZGK A;  3OYL A;  1WPC A;  2NTB A;  4E4H A;  2XC7 A;  4KIS A;  4BEH A;  4OZZ A;  2LZJ A;  3K70 C;  4OJP A;  4JOM A;  1SKY B;  2M7B A;  3CMM A;  2E60 A;  4MXN A;  1BR2 A;  4R79 A;  3GVL A;  1PKV A;  2PYH A;  2F6C A;  4D1Q A;  2JUG A;  4XL9 A;  1Z7L A;  3QYE A;  2INU A;  5LFA A;  1WP6 A;  3FPP A;  2A6T A;  2F1M A;  4C9Y A;  2BOL A;  2X6W A;  3H35 A;  1MNE A;  4PFO A;  3H5R A;  3KRG A;  1NG6 A;  3RCO A;  1I18 A;  2LBF B;  3H5A A;  3CJQ B;  4Y4R A;  4BS9 A;  3OY9 A;  3ZRG A;  2VBM A;  1NRK A;  1GQ8 A;  4KT6 A;  4OAY A;  3OYF A;  3OYJ A;  2VQC A;  1TZL A;  4PFP A;  4ZDO A;  1VJS A;  4DNT B;  4B3G A;  1UAA A;  1T95 A;  2HPM A;  3E0J B;  2VQL A;  4E7I A;  2IS4 A;  2M7A A;  4W8Q A;  3E1S A;  3RQ4 A;  1X1A A;  3OR1 C;  3GQ8 A;  3LFU A;  4C2U A;  4XKB A;  5CQE A;  2DT7 B;  1UEL B;  3DTE A;  4CCO A;  1VLY A;  4U49 A;  1BMF A;  2GJP A;  1BOB A;  2KDO A;  2ZSH B;  3CZ6 A;  4RM3 A;  2JVG A;  1JRG A;  3OL3 A;  1XG2 A;  1ZEL A;  4YEL A;  3JU4 A;  3OOU A;  3SUC A;  4YRV A;  2LRD A;  2XAU A;  4XNF A;  4BL0 B;  2WBM A;  4NK8 A;  3HKZ A;  1WJC A;  4XKC A;  4CCK A;  2M0M A;  1X1B A;  2CV2 A;  4F52 A;  2L9S A;  4U7B A;  1O8E A;  1RWR A;  1KCD A;  2W1O A;  3A4C A;  2V6E A;  2ZFU A;  4KKT A;  3BG6 A;  2W00 A;  3DPL C;  2KLO A;  4HEA 2;  4BDZ A;  1HA8 A;  3FBN B;  4XN0 A;  2CFO A;  2MC4 A;  3VYU B;  3DWL E;  3ZR8 X;  2KPM A;  3H9J A;  3T53 B;  1QJV A;  1X1C A;  4NUB A;  2V4D A;  3VSU A;  2JDI A;  4B44 A;  3T9G A;  3SZG A;  1MAB A;  4G6T B;  3GQB A;  3FY3 A;  4OZY A;  4HSR A;  2O17 A;  3A1Y A;  1V5E A;  3UNG C;  4HWV A;  4Z1M A;  3SEZ A;  4DK0 A;  1LKX A;  2BVM A;  2V4J C;  3LSH A;  4BJT A;  3OYE A;  3OFN A;  3WQZ A;  3D5R C;  3ZSC A;  1X4O A;  3VR6 A;  1HVX A;  1Y6I A;  4Z06 A;  4F92 B;  4E0F A;  3KX2 A;  1COW A;  2LG4 A;  1FMV A;  4H4K C;  4PSW A;  3U21 A;  4BE1 A;  1DP3 A;  1IDJ A;  1O8F A;  1OFL A;  3PJR A;  3OYI A;  4B3X A;  4LIU A;  4XLC A;  4F3Q A;  2E1B A;  3EUK L;  1O8L A;  1OFM A;  2O5R A;  4J00 A;  4BE2 A;  4B3F X;  3NWT A;  4LIT A;  5DN6 A;  2K5C A;  3VDX A;  3VYR B;  4HRI A;  2DJI A;  3FHN A;  4CZC A;  2V31 A;  3LMW A;  2IGM A;  2VKH A;  4DGW B;  2K3P A;  4DOZ A;  2NTP A;  2Z2S B;  2KMU A;  1O8J A;  2HVS A;  4DNR B;  3OS1 A;  2XF5 A;  5FL7 A;  3CP8 A;  2LY1 A;  3K4M A;  2GJK A;  3K4C A;  2KRC A;  3PL8 A;  3K4K A;  2HDW A;  2BVL A;  3KEW A;  4N4N B;  3H9Q A;  4Y3O A;  1U0J A;  2W6J A;  4W8S A;  2VL8 A;  1T5E A;  4E7J A;  4JMQ A;  4XOT A;  1EE6 A;  2HLD A;  2KL4 A;  1D1A A;  3NWS A;  4ZC3 A;  4RMN A;  3S3M A;  1X1D A;  3K6G A;  1NHC A;  4CA0 A;  3K10 A;  4MR0 A;  1Z3Y A;  3OL4 A;  3A3B A;  1D0Z A;  4XQF A;  3QOE A;  1LDK B;  1YE9 A;  3OOC A;  3LSK A;  1MMD A;  1V5G A;  2Z16 A;  1K6Y A;  4MLO A;  2KHM A;  5FRM A;  1HZE A;  1UD4 A;  4YZQ A;  4IKF A;  3W3C A;  1H80 A;  2WAQ A;  2O1D A;  3W2V A;  3OE7 A;  5HVQ C;  3A2K A;  4C2L A;  3DPT A;  3TMO A;  1V0E A;  2XZP A;  1WJA A;  3UW0 A;  3HL2 A;  2ZZQ A;  3BCD A;  2PJR B;  4BDY A;  1BPL A;  3AL0 C;  3M1C A;  3BCF A;  4PJJ A;  1UD6 A;  4W8T A;  1WFX A;  4XKW A;  3OYA A;  3L2V A;  4XLF A;  4D9J A;  3MKY B;  3CJR B;  3IAM 2;  4BAC A;  4ANJ A;  2PEC A;  1PJR A;  2K9L A;  3S3O A;  1FX0 A;  1E1Q A;  2DCE A;  3CF2 A;  3WWG A;  1VF7 A;  4G6I A;  4Z05 A;  3BCB A;  4PJN A;  1R6R A;  4CCM A;  2GK7 A;  2QE7 A;  1X4P A;  1WJE A;  2L9N A;  2V7F A;  2M4G A;  3L2W A;  2WA0 A;  4ZJZ A;  1OR7 C;  2VQH A;  3H94 A;  1DGW Y;  2L5Q A;  1TT0 A;  2UV1 A;  2VXD A;  4IQ4 A;  3DKY A;  3MKW B;  4TT3 A;  1OGM X;  1QHH D;  2IGO A;  2M5S A;  2ZTN A;  2WPD A;  3VWB A;  3FDY A;  1WMR A;  1D1B A;  4GRI A;  5KCM A;  2FUG 2;  2ZXH A;  3HOS A;  3C2H A;  3OAA A;  2IQ7 A;  1O8G A;  1E1R A;  2LY2 A;  5C1E A;  2XF6 A;  4P1W A;  1WJB A;  2P0W A;  4B43 A;  1WJ5 A;  2JA2 A;  3K70 D;  1NBM A;  2VJ5 A;  1MMG A;  1V5F A;  4XON A;  1GLN A;  3D5S C;  2EWE A;  2NT6 A;  2CS3 A;  4L8J A;  3S32 A;  4KIT B;  4G7X A;  2RRE A;  1O8M A;  1W0K A;  2VBK A;  4E6K G;  1OGO X;  4DBQ A;  2HVR A;  2X85 A;  1KZL A;  2X6Y A;  2HU9 A;  3OEH A;  3OEE A;  4ASU A;  2UVE A;  1PYV A;  4BQO A;  2ELJ A;  4XLE A;  1LFP A;  3GVJ A;  4E7K A;  3GQA A;  2L2O A;  2R4G A;  4OJL A;  1WTH D;  3RSN A;  2BW3 A;  3MD2 A;  3DPU A;  4XOR A;  2LH9 A;  2R7T A;  4KKS A;  1IDK A;  2ZTG A;  3OYH A;  2QKM B;  3DKX A;  2VIX A;  1AIR A;  1WJD A;  1UG0 A;  2CK3 A;  2M4K A;  3ZQQ A;  4DBR A;  2V9K A;  3GQ9 A;  3MMY B;  1KMH A;  1SAU A;  1FMW A;  2LYC A;  3B8Y A;  4E7L A;  2IXS A;  1CZF A;  2WB1 A;  4BQQ A;  2VQG A;  3LL7 A;  4HNT A;  2X1E A;  2IS1 A;  3TBI A;  1DBO A;  2MAB A;  1O8H A;  4II2 A;  1IRX A;  2VPL A;  1D0X A;  3RTR A;  1E3X A;  3K4L A;  4RLF A;  4TSF A;  3I3L A;  1G8X A;  4J01 A;  1YX5 A;  4BU2 A;  2R7W A;  3B90 A;  2CV1 A;  3AL0 B;  5KHD A;  1DQU A;  4G7W A;  1JI8 A;  4TKO B;  1IA5 A;  3HUG B;  5CKT A;  3TL4 X;  3HG9 A;  3EUA A;  3ZCO A;  3PNY A;  3OYN A;  2GJR A;  1JTA A;  2ZZE A;  2HVQ A;  3RPU D;  4CSW A;  4EAT A;  3OYM A;  3SEQ A;  2CMP A;  1RMG A;  3OYC A;  4N4O B;  2GOX B;  4IX7 A;  1O8K A;  2O0V A;  3EQN A;  4DJA A;  1NG7 A;  3S93 A;  2R7V A;  4HST A;  2UVF A;  1IB4 A;  4OAZ A;  1BHE A;  2KRH A;  4AVZ A;  4GQN A;  1DBG A;  4BEH B;  4DK1 A;  2XSJ C;  3PNV A;  3QYB A;  2INV A;  3B4N A;  4URR A;  3M8J A;  2X8K A;  3V42 A;  2XF7 A;  4F91 B;  2XND A;  2NTQ A;  3ZPP A;  3GBG A;  2VJ4 A;  2BSP A;  3LNN A;  4ZDL A;  1V0F A;  1WJF A;  4BQN A;  3GRH A;  1X0C A;  2JJ2 A;  3ZPN A;  1D0Y A;  1EA3 A;  3IUO A;  1E0E A;  4AYB A;  1K28 D;  4CH7 A;  2PJR A;  1UD3 A;  2CUJ A;  2JVH A;  5TGT A;  2O0W A;  2JJ1 A;  5FRN A;  1H8E A;  2VBE A;  4RM2 A;  2W4S A;  2NSP A;  1AA7 A;  2CUZ A;  4YZA A;  2IS2 A;  2O04 A;  4IQJ A;  1KCC A;  2JIZ A;  3DU6 A;  4C30 A;  2F4I A;  3OYD A;  1EFR A;  3W2A A;  1BR1 A;  4JQF A;  1G59 A;  3HC7 A;  3LSM A;  4B47 A;  1QHG A;  4E7S A;  2DXI A;  3MKZ A;  1UD2 A;  2Z6B D;  1QCX A;  4NQW B;  4YZ0 A;  1OB0 A;  2Z1D A;  4PJL A;  1LVK A;  2WAE A;  4ZTJ A;  2X51 A;  4ZYA A;  2ZSI B;  4F93 B;  2HPI A;  5CDF A;  4PJM A;  5CQG A;  2QKL B;  3BH4 A;  1W0J A;  2WJV A;  2X53 S;  2ZXI A;  2MYS A;  3L2R A;  5IK2 A;  3UR3 C;  2CW7 A;  2Z8G A;  1PLU A;  2OUM A;  4AU7 A;  1KON A;  4QPQ A;  2VJJ A;  4Z03 A;  3FKS A;  2E1M B;  4YXW A;  3OPO A;  3N05 A;  4E7H A;  2IGK A;  2Q2E B;  2IGN A;  2ZZF A;  4HIZ A;  3DEE A;  4OJ5 A;  3LSI A;  3CP2 A;  1E3Z A;  2QXZ A;  4F55 A;  2LOO A;  2XZO A;  2NOJ B;  3DTI A;  4I84 A;  2ODL A;  1W36 D;  5HKK A;  2LBF A;  2X6X A;  4UZU A;  3PFY A;  3S3N A;  4XOP A;  1SFK A;  2HQA A;  1VBL A;  3VYS B;  4NC7 A;  4XD7 A;  4FAS D;  2D3L A;  2D3N A;  2KQR A;  2W6I A;  2NZM A;  1MND A;  2AQE A;  2K9M A;  3VSK A;  2VB6 A;  3VMW A;  3F9K A;  2IS6 A;  4XKV A;  4BE0 A;  3OS0 A;  4XR6 A;  2E5Z A;  4FET A;  3ZXS A;  1J09 A;  3AFH A;  2R7S A;  4U4B A;  2HZD A;  2R7O A;  2XDV A;  3BC8 A;  3CES A;  3OMY A;  4OWR B;  4KKU A;  3DDY A;  1OLT A;  2XGJ A;  3HXL A;  1N75 A;  3VYT B;  4RLQ A;  1BN8 A;  3SDB A;  1E79 A;  4IZZ A;  2HNH A;  4U87 A;  1E43 A;  5AMV A;  4B48 A;  1X19 A;  1H8H A;  3T51 B;  1MW7 A;  3EQO A;  3GQ7 A;  3ONQ A;  3K4J A;  3QOD A;  1PE9 A;  4OJO A;  3C2G A;  4CCL A;  2AQF A;  1W36 C;  3QYF A;  3VMV A;  2R7Q A;  4X0G A;  4CCJ A;  1N77 A;  1O88 A;  2WSS A;  3G2B A;  3LMM A;  2CW8 A;  3PSI A;  2KP6 A;  2VLA A;  3PSF A;  2XZL A;  2LC2 A;  2MFZ A;  3K4B A;  2W7N A;  2VAS A;  2QX3 A;  1O8I A;  1KTW A;  2R7X A;  4BXF A;  3DLA A;  4BUP A;  1RU4 A;  3EPZ A;  3L2Q A;  3G05 A;  2V7Q A;  3BG7 A;  4XMY A;  2NT9 A;  2R7U A;  3OYG A;  2I8D A;  3OIQ A;  2NST A;  5JHF A;  3OS2 A;  1OHH A;  2PMZ A;  2GOM A;  3W2W A;  4FXU A;  1Z21 A;  3OYB A;  5KNL A;  4NNJ A;  3VSV A;  3PNT A;  1Z3X A;  3GVK A;  2F43 A;  2CH0 A;  3LSG A;  2BW3 B;  2E5N A;  4NC8 A;  2WAD A;  2WJY A;  3S8P A;  4PSX A;  3ZIA A;  1T0F C;  4LG3 A;  2X1C A;  3OYK A;  1I8D A;  3AKZ A;  1VZ0 A;  5LD2 C;  3HOT A;  3VSL A;  2GK6 A;  3HPH A;  2DT6 A;  2MD0 A;  1MMA A;  4Y33 A;  2WZP P;  3T56 B;  1BLI A;  4P5O A;  5HLT A;  2RQQ A;  4BJ6 C;  3H0D A;  1W9X A;  2M3A A;  3HPG A;  4HG2 A;  2OC6 A;  3KEY A;  4EW9 A;  3BCA A;  4OJ6 A;  1UD5 A;  3OW7 A;  4P22 A;  4CUG A;  2XOK A;  1S9H A;  4QPO A;  2V1N A;  4YZX A;  3H5N A;  5HNF A;  3PUB A;  4KJZ A;  5CPR B;  1UD8 A;  2R9V A;  3FKJ A;  4HNU A;  2KVO A;  2QY1 A;  3FBI B;  4ZTF A;  2RNG A;  3EUH C;  1O8D A;  4BJ5 C;  2JSP A;  3IAS 2;  3H9G A;  4XLA A;  4YEJ A;  5HOO A;  3HAG A;  2PYG A;  1ERD A;  2Q1Z B;  3NE5 B;  3JUR A;  4W8R A;  2V26 A;  3BC9 A;  2X1D A;  2L7K A;  4II3 A;  1DGR M;  3OIP A;  2Y0S A;  5FRO A;  4ZDP A;  1HG8 A;  2VXZ A;  4CCN A;  2E1M C;  4BGD A;  2DOA A;  2UUZ A;  2WY8 Q;  3L2U A;  4LIV A;  1BR4 A;  2VKD A;  2VJI A;  2WY7 Q;  3KYL A;  4E7Z A;  1K5C A;  1Y56 A;  4XLH A;  3SYT A;  3BLY A;  2ZZG A;  2X3H A;  1P9Q C;  4XN3 A;  4XM3 A;  4C2T A;  2A5W A;  3OWT A;  4PK4 A;  4DIQ A;  5HNH A;  2KZV A;  2W82 A;  3VST A;  4ITV A;  3DTK A;  2UWM A;  2LRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...