4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
b'DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
2X6YA 4XLEA 1NHCA 4XOTA 2NSTA 4URRA 3GQ8A 4OJLA 4OJOA 1IDJA 1K5CA 2VBMA 4XORA 3JURA 2QX3A 4U4BA 4XKVA 3B90A 3GQ7A 2QY1A 2X85A 1PLUA 1RWRA 4MXNA 4XONA 4XLAA 2O1DA 1JTAA 3LMWA 2O04A 2IQ7A 4W8TA 4I84A 4YZXA 3T9GA 2PYHA 2INVA 4Z06A 4XLCA 4W8QA 2INUA 2PYGA 2NT9A 4OJ6A 1OFMA 3SUCA 2VBEA 1O8DA 4HWVA 1IDKA 4XL9A 3FY3A 4U49A 4MR0A 3GQ9A 2NZMA 3VSUA 2X6WA 1KTWA 4XN3A 4XMYA 3ZSCA 1O8EA 1IA5A 1O8KA 4NK8A 2BSPA 4Z03A 1X0CA 4AVZA 1EE6A 2NTQA 1PE9A 1XG2A 1CZFA 2NSPA 1RU4A 1GQ8A 1OGOX 1RMGA 3ZPPA 3EQOA 2X3HA 4XLFA 4YEJA 4OZYA 1BN8A 4OZZA 4PMHA 4Z05A 2NTBA 3B8YA 3VMWA 1WMRA 1DBOA 3VSTA 4YELA 1JRGA 1OOCA 4W8SA 4XNFA 1O8GA 4NK6A 3KRGA 3UW0A 2O0VA 2NT6A 2O17A 2UVEA 4OJPA 1OFLA 1OGMX 1AIRA 5C1CA 4XN0A 2X6XA 4XM3A 3EQNA 3GRHA 4XQFA 4YZAA 2NTPA 1HG8A 2VJJA 3VMVA 3GQAA 4W8RA 2QXZA 4YZQA 1O8LA 2ODLA 4OJ5A 2VJIA 2O0WA 2VBKA 4EW9A 4XOPA 4YZ0A 1O8HA 4XLHA 1O8JA 2EWEA 1BHEA 1KCCA 4XR6A 1IB4A 2UVFA 1O8IA 1PXZA 4XKWA 1VBLA 2PECA 3B4NA 5AMVA 1QCXA 5C1EA 3VSVA 4C2LA 1DBGA 2Z8GA 1KCDA 1O8FA 3WWGA 1QJVA 1O8MA 1O88A 1H80A
chains in the Genus database with same CATH superfamily
4BU2A 1FNDA 3QWLA 4Z4RA 2HVQA 2FF4A 3OWTA 3J81k 1FYMA 2HKXA 4MFEA 3GW2A 5L3FA 3GWZA 2EWNA 3SLNA 4M6XA 1B8IA 4IXAA 2ZSIB 1USTA 2E36A 1VQNB 1ZK8A 2KPMA 5CJ9A 2H8RA 2FMYA 4U4BA 2MFZA 2BY3A 5JLVC 4OMYA 4CCNA 1EA3A 4YRVA 2KJBA 4BQNA 2HYFA 3LFKA 3KIOA 2BSAA 2O04A 5D4SA 5HODA 1JE8A 1F36A 3OYCA 4TSFA 2IXSA 1ZAOA 4DGWB 2INUA 3WU2C 1Q9SA 2RGVA 3MAJA 3SJPA 1G4DA 4PJJA 1IXSB 1WTHD 5F0FA 2IOUG 1PJ7A 1SMTA 2DAOA 3VB2A 3WBJA 5FFXA 3ZPNA 2O03A 3LAPA 3OZVA 2W48A 1YI2B 5DD8A 2W85A 4G12A 1DQUA 2LK2A 1MMAA 1V54H 3M9AA 4XN3A 1Y1VJ 1VQMB 2FOWA 3PETA 1K28D 4WXCA 2QQ8A 2FBHA 3CLOA 3WTYC 3FXJA 2C5HA 3BPVA 1J0RA 5AIQA 4H9GA 3G1LA 2IGMA 1HCRA 1MH3A 1RQPA 2DBBA 1IRXA 3PM1A 5HLHA 4IJAA 4F55A 3DBHB 3RCOA 1Z7LA 2KP6A 4Z05A 3CZ6A 4HNTA 4Q4ZF 3L1PA 4A3FJ 4UV9A 1PVEA 5IPAA 1MNEA 1JT6A 1EH8A 4A6DA 2FX3A 3V7SA 2XT4A 2XZOA 1X2MA 2W4SA 4JQFA 1MNMC 1OOCA 2L7KA 1BQEA 2WC2A 3TP3A 2EFGA 2EB7A 3RDIA 3OJWA 5IYQA 2R5YA 1P7IA 1RC9A 2DCEA 2VQCA 1FYLA 2E2IJ 3ASRA 3ASOH 1KQ9A 2MA3A 2Q8KA 2F5FA 3KEOA 1JGSA 4X07A 4M71A 5LGTA 1OFLA 2LTPA 2RAEA 1PJ6A 3L7WA 2HXIA 1OYWA 2ZTNA 3D5LA 1S29A 4I0BA 4K2EA 1OB5A 2QMUA 2COMA 3KZZA 3ONYA 1GVJA 4UVCA 4MFDA 2M5WA 2R4GA 3HOTA 1YIJI 3ZBUA 3VNVA 1XSXA 2DTRA 1VQ5B 2I10A 4O3MA 1EFCA 3G4SB 4JX5A 3N97A 5IYWA 4PC1A 2GIVA 3MEXA 2EINH 1MW7A 1CQTA 3A8KA 3FXKA 2ZFWA 5L3CA 4HF2A 3C1DA 3FXUA 4WZKA 2CSOA 1ETXA 3KYCB 4N4OB 1J9ZA 4YAUA 2PX9A 5M5XJ 3JRFA 3PSZA 4C2LA 1MGTA 1EH6A 5L46A 4ZC3A 2OU2A 3G73A 2EILH 3KL9A 2HZTA 2X1CA 5C4XJ 3FMSA 3VPRA 2GJKA 1RUNA 3HUGB 4XIDA 2Y0SA 4KIFA 3H0DA 1BIAA 2DDAA 1IN7A 1IGNA 1R1UA 1MABA 4URRA 1ENHA 2GXBA 1FNBA 3HTSB 3H3ZA 4XSZF 3BTCA 2CW0F 4LC0A 2VBYA 4OJOA 3E1SA 4JOMA 3BP8A 4CO8A 4QVJA 4XORA 2RN7A 5F04A 1FMWA 4LG0A 4AYBA 5A8AA 1KC8D 3OEEA 4P12A 5E8GA 4ENNA 2X85A 1FBSA 2NVYJ 2OC6A 3HOXJ 1R36A 2HDDA 4A3BJ 1I39A 4I09A 5JLWA 1IF1A 3MZ8A 2TCTA 5H2FC 2HOTA 4XRSG 1W1WE 3WE2A 2HR3A 5BNGA 3S1MJ 1Z6TA 3LVBA 2STTA 4WK8F 2NNYA 1IV6A 1A6QA 3LO8A 2VBEA 2DA4A 3Q39A 4OOSA 1E1QA 4Y33A 2JPCA 1S72I 2OJED 2VE9A 4HV6A 3FY3A 3OYFA 4WQMA 1OCOH 3G2BA 3ES9A 2H94A 1XDUA 3F6OA 1YIOA 5DUIA 4ENJA 2X6WA 3L09A 2XEXA 4FHTA 5LGNA 1D5YA 1EH7A 2J7KA 3JCUC 2C78A 2LVSA 2Q2EA 3NRVA 3CCLI 3QRFF 3PJRA 2DA6A 3AG4H 3IWFA 1UD4A 4NK8A 1I7PA 2LYCA 1JJ2B 2XB0X 2EBIA 5GPAA 2LP0A 5HDKA 5AIPA 3RYRA 3DDYA 4P1WA 3DEWA 2P3MA 5ICCA 3VYUB 1D0ZA 4KJZA 4EJTA 3ZPPA 3PA2A 2E1MB 4YC5A 3HM5A 4PC2A 3EQOA 1GV2A 1VZ0A 1LM1A 1LUJB 2WAEA 2PE3A 4X7EA 5D5UB 2B7CA 4YEIA 4RCZA 3COAC 1DP7P 2V6CA 2YSRA 4YIRX 3DKYA 3K4KA 1OB0A 2CUEA 2GBYA 1I3AA 2ZXHA 4BJ5C 1SEUA 4X6AJ 2WPDA 2CG4A 2BHYA 3BG6A 4XRFA 1KU3A 3WTVC 4RDLA 3KRGA 3HDDA 2A6EF 3ZQLA 4D5FA 2B7BA 1G7SA 1X2NA 3MCZA 4K1XA 3WQZA 2MH9A 4OJPA 2Y69H 3DBLB 1TWFJ 3IC7A 3BCBA 1PP8F 2QTZA 1IN5A 3NQOA 3DPUA 1X19A 5DDGA 1J59A 1QFZA 5ED4A 4R8HA 3OYEA 1IJEA 2DY1A 2PQ8A 1Q1HA 3RI4A 3B8HA 3WGGA 2HXOA 4L5EA 2ETHA 5C3EJ 2IA1A 1KU9A 1SFKA 5TV2A 3W2VA 2O0WA 4FX0A 1S7OA 3PQKA 2DLLA 4XOPA 2VN2A 3G3ZA 5FFZA 2DTZA 3K1NA 2BW3B 4EQQA 4J19A 1BJKA 3A8JA 1DG1G 3I1FA 2ID3A 3TW7A 1KK2A 3PNTA 1SKYB 2BM0A 4YAOA 2VZLA 1YJ9B 1QGPA 1X3ZB 2BXYA 3MZHA 3ASSA 4IRHA 3IP4B 4UY8I 2GQFA 2KFDA 4P25A 2OZUA 2PMUA 1P4WA 2PN6A 2HZDA 1VHOA 3ZBTA 2J5OA 3GF2A 1BOBA 3CF2A 4XBFA 1D8JA 1QGAA 1LJ9A 2XB5A 2MYSA 3BTIA 5IYDJ 3L2VA 3GQ8A 4E6KG 4IO9F 2KIFA 4HIZA 1BOAA 1WGXA 2DA2A 2XPWA 5FKNA 3PA1A 3ZCOA 1E0EA 4M3DA 1WOPA 3ML6A 2HKOA 2A6TA 4XKVA 2E1OA 5HDNA 5ILSA 1YJNI 2K3FA 2A68F 1HA3A 2IBDA 1QVGB 4BDYA 4XLAA 5K5OA 2JQ7A 1MH4A 3ZOBA 2CQKA 4BXFA 2NVUB 4BXXJ 2CS3A 2ZJRF 3ULQB 2E34A 2NT9A 2DT5A 2L2OA 3W5UA 3SZEA 3FZVA 1LKXA 4LFUA 5DNSA 1XGNA 1HXDA 3ROUA 4ZTFA 4GFBA 3QU3A 3J81K 2FBKA 3HGYA 4X7FA 1K6OA 2XNJA 1ETOA 3TDUC 1NG7A 3J81Z 4AC9A 4QWQA 3GUDA 2V1NA 1IHMA 5IT9Z 2J8KA 4Q47A 2XTWA 2A5WA 1YJWI 1MKMA 1X1DA 3Q0UA 1RZ4A 5ICGA 4E7JA 2LREA 4HX8A 1GJRA 5DM7F 3R6JA 2NYXA 2DFFA 3HRUA 2NS7A 4D9JA 1WH5A 4XRSA 5FO5A 1X0CA 1EE6A 4JRAC 2NRAC 2V6EA 3IKVA 5L3GA 2MG4A 1FIPA 3TGNA 1IRGA 2HOSA 2OCEA 2ESHA 1ZYRF 3NEUA 1OMIA 1FBQA 1FX0A 2XSDC 3QOEA 1QNTA 2CQXA 5LRSA 4BUPA 2OBRA 2QF7A 1BMFA 4HRIA 3ZC3A 1IJFA 4LK0F 2C6YA 4IRIA 3HOWJ 3VSTA 1OISA 3ABUA 3RKWA 1D8TA 2VC1A 2HYGD 1IJWC 1O8GA 4IHXA 4X7DA 4XLPF 3OW2B 2L5QA 2DEUA 3HJEA 4J01A 1LNWA 3HSEA 1T6XA 1XFOA 1M90D 5KCMA 1YFHA 1PP7U 2LY1A 2BM1A 3OMYA 1T56A 3IV5A 1FOYA 1X58A 2ZL5A 3ERMA 1BX0A 3WNCA 4XM3A 2V7TA 3EQNA 4XQFA 2WBMA 3WHCA 3EDPA 3CCEI 1KU7A 1VF9A 2XSJC 2VXDA 3OYDA 1O3SA 3ASQA 4CHUA 2MABA 3CCMI 3C2BA 4RCYA 3BC9A 1WJAA 2R7XA 1TQIA 2VBWA 4IZZA 5CPRB 5IOZA 2X4HA 2ACJA 5GAGJ 2UVFA 2BV6A 3E20A 3FXMA 5EG0A 1X1PA 2XC1A 2RKHA 5GTHC 4G8XA 3M8EA 1LLWA 4GQNA 4X7CA 4HV5A 1Z05A 3SZPA 1R7JA 1FLIA 1E64A 3HPHA 3R6SA 1VQKI 2Y2ZA 3KEQA 2HQ5A 3LA2A 2OTJI 2AHOA 1ZLJA 4XRMA 5J1RA 1UMKA 2WB1N 4ASUA 2JRTA 2KMUA 4MHGA 1MMNA 5D5WB 2Y9ZA 1CNEA 3FM3A 1NTCA 5F0CA 3Q0VA 3E6MA 4KICA 1WJ5A 3DEEA 4AIKA 3HOVJ 1BJAA 1R5NA 2K4BA 2AXLA 3D1NI 4Y7NJ 1W7PB 2FSWA 2LDUA 2Q1ZB 3E6CC 3FHNA 2E35A 1TWAJ 3K4JA 2M45A 4YHBA 2EIKH 3KZYA 3B73A 4X05A 2Z6BD 3PSSA 3SYJA 2XZPA 1BR2A 3K4MA 3PSIA 4PFOA 3KP5A 3PL8A 1I18A 4B44A 4MXNA 1U0JA 3FXQA 2VXZA 3H35A 5E8IA 2WJYA 4J0QA 3I5UA 1WZ2A 1D8KA 1NK3P 1FRNA 2VI6A 3CCSB 5D6FA 4XL9A 1WU8A 2QWWA 3ASTA 5E3MA 1ZLKA 3F0CA 1XMKA 5BOXA 4ZDOA 4U87A 2PMZN 2IT0A 4IHWA 4Y3OA 1A35A 1HW1A 2MC3A 5F1RA 4ACBA 1WQ2A 2WAFA 2ZITA 2Y75A 3DEUA 1Z9CA 2D1HA 3ECHA 3C2GA 2M8GX 3NE5B 2XVCA 1IRFA 2IW5A 1CQXA 2IGOA 3I3LA 5KVRA 4R1HA 3GTQJ 5DSZA 4BGDA 4D1QA 3EUAA 1FPQA 4N9HA 5C4JJ 4ENKA 3BROA 3FKJA 1R71A 2D3NA 1TYXA 2OCCH 3ECOA 2BN4A 1YO5C 5IY5H 1G7TA 1U3EM 2M2EA 1N25A 4UB8C 1UCRA 3S1QJ 3EPZA 3O3KA 3WHBA 3F8MA 1MBHA 3A01A 1GXQA 2VONA 1K6YA 2Q6IA 4I76A 3P9IA 3QFRA 3GTKJ 2YX7A 2OBSA 2BGIA 3QU6A 2EFQA 4ZZDA 1SFOJ 2STWA 3GMEA 4V2GA 4FE4A 2UWMA 2OK7A 3U2RA 1U6GA 4FT8A 3IH4A 2RVCA 4GYIA 5F4MA 1NJID 4Y52J 2RREA 2V1DA 3IKTA 2XKOA 2HPMA 2K5CA 3E97A 4M3GA 5E3LA 1J2XA 2JRMA 4QFMA 5KSWB 1TL8A 1LDDA 2F4OB 3TH0A 2Y0SN 4F92B 1JKQC 1UD8A 1V4RA 3CDHA 3DV8A 1U8BA 3T56B 1IUYA 1V0EA 3AVUA 1JGGA 4LMYA 4A3KJ 1KQ8A 5HVQC 3BR6A 5IYRA 4CCKA 4WZTA 2HI3A 4YZ0A 4G7ZF 3JTGA 2DT7B 3A0HC 2C2WA 2E5ZA 1XB4A 1WPKA 1IB4A 3H9GA 4PSXA 3BC8A 4PC7A 1YJWB 4NQWB 3S2WA 2CQ7A 1UD6A 2P81A 5ILVA 3H36A 2E1CA 1HKSA 3DTIA 3FK7A 3TBIA 3KEWA 3Q6RA 3V7AA 2DMTA 1VBLA 2VYQA 4MIMA 3VSVA 5ICFA 3PIOF 1DBGA 3KYDB 3OL3A 2R92J 3S2HJ 3A8IA 2V1XA 1K78B 3MZYA 4MEXF 2A69F 1YX3A 4XOTA 3OR1C 4BBSJ 5CYVA 4XKCA 4L9JA 1HDPA 1YLFA 2DPDA 6PAXA 4IHYA 2BXZA 4Y17A 4P22A 5F4JA 2DOEA 5IYNA 1SC7A 2GXAA 4HOBA 1WCMJ 1WPCA 4RD4A 4L5JA 1E43A 2VOOA 3CRZA 2KDOA 3F72A 3S3NA 2F3LA 1R22A 2A6HF 1S9HA 4RGUA 1GDTA 1O7FA 4JX4A 3TO6A 5TJJA 3OSFA 2KVOA 1YI2I 2L9RA 2B5OA 4A3JJ 4HAMA 5E1WA 1I5ZA 3VYSB 3CW2A 3I59A 2QKMB 3F9KA 3ZQFA 3LYCA 2KLOA 2FQ4A 1VQMI 3QP5A 2WY8Q 2IQ7A 3I53A 3GFMA 4CZZA 4P9SA 2MLKA 1ZM4A 5M5WJ 2BM6A 1LE8B 3OSGA 1JJ8C 1G3TA 4OJ6A 4RD3A 2VC0A 1U2WA 2VBZA 2V4JC 3JRHA 4LB5A 1RI7A 2FU4A 1RNLA 4CA0A 1MMSA 2VPLA 1YYVA 3GFJA 3MCAA 3QE2A 2LY2A 3P9CA 3FBIB 1XSDA 3ABMH 1W7PD 3TMOA 3R4KA 3DBRB 4C2UA 2IJLA 1EKEA 2VODA 2BGCA 1FT9A 2BZTA 2R6HA 2CV0A 1RPWA 3HEFA 4II2A 5BSXA 2K7LA 3KP6A 1UZCA 3K9TA 1OLTA 4DNTB 3CXCB 4BY7J 3JX8A 1BM9A 3SJMA 3OL4A 3GTLJ 4QTRA 2Q0OA 4AVZA 1VQKB 3H1CA 4HW0A 3ZMUA 4FN5A 3GLLA 1DARA 3BR1A 2YWGA 4N4NB 2XNCA 3ZZTA 3BOQA 1OGOX 1SAUA 1F43A 2FNPA 1QZYA 5EYRA 4MQ9F 2X1DA 1RIOH 5FKKA 5KK1A 1NB0A 4B47A 3OOPA 2L01A 3T51B 2C77A 1D0XA 1ZTRA 4E4HA 1GXPA 3S1NJ 4ZV4A 1DBOA 5HZAA 1OCTC 3F8NA 4GRIA 4EJUA 2E7WA 5JI6A 1LEAA 5JVGF 5HLIA 1VQ5I 3G4SI 4M6VA 1LFBA 1QHHD 2CU7A 3GFLA 4C30A 1WJDA 2NVTJ 3QP6A 4RGRA 2GQQA 1HF2A 2VBXA 4IPAA 3DP7A 1G3YA 1HSTA 5EJCA 1GVDA 4AU7A 3WTUC 3HYIA 4E7KA 1AIRA 4EM1A 3OAAA 1VQ6I 3K10A 2DQRA 2X6XA 2PJPA 2HYJA 2P7CB 1R5GA 2OD5A 2RQQA 3DKXA 4UUTA 5D4RA 1WSRA 3M4OJ 3LSKA 3V8JA 2DIEA 5HLGA 3S3MA 5JMCB 3BG7A 3FKIJ 4DNRB 1IN6A 2Z3YA 2CH0A 2K9LA 2JJ1A 2NOGA 2RNJA 3U6KA 1UD2A 4AM3A 4LLNA 2OPTA 3H3UA 2HMAA 1O8HA 5HNHA 1X1CA 2V9PA 3R0AA 2K40A 1PYVA 3M3YJ 2IA0A 3IWZA 4O6JA 3A01B 5JR3A 3I64A 4GDFA 3T5XA 2XRNA 2ZXIA 2BMWA 1TZLA 3BR2A 1QHGA 3ZMDA 3CO7C 3CMEI 4HSTA 3MFKA 1H8EA 5D8KB 1UJ8A 2WY7Q 2K9NA 3QPLA 3ZQQA 4NB5A 4CUGA 1XCBA 1T6ZA 2BVNA 2W57A 4W1UA 1OJLA 2YU3A 4XLEA 2TRTA 1QBJA 5FD5A 2CYYA 1DU6A 3LQEA 2CWEA 1AIPA 2P5VA 4V2FA 1P9QC 3NARA 2R7DA 2ZC2A 3ZN1A 2DU9A 3OY9A 2OQRA 1N07A 1VQ8I 3E7LA 2HS5A 4RAFA 2QZAA 1TUIA 2PLFA 2Q6KA 1EF4A 5FLMJ 3HG9A 2VBMA 1TWCJ 1DPRA 3GVAA 3GYHX 2EZIA 3GO5A 5TY0A 2YX4A 3MKLA 2OF7A 3W2GA 3JAMK 1H8HA 2R7SA 2HGCA 1W5CC 1WKMA 2Y0MA 3LNNA 3JAMZ 3OS0A 3A03A 4BY1J 4W8TA 1JTAA 1PUFB 5TGTA 3DU1X 4G6QA 3MN2A 4KA4A 3ZQCA 3N4MA 1BL0A 2EIMH 4A0XA 1B1BA 4ZDLA 3SUCA 2HFHA 4HDVA 2VIXA 1CF7B 1JHHA 2KKOA 2VFPA 4PC3A 1AKHA 3WGHA 4HWVA 3RKYA 3S32A 4CZCA 2PIAA 1WVRA 4UV8A 4P55A 5J47A 3I71A 2MH2A 1QUFA 3REOA 1MJ9A 5FGMA 5DV5A 4M73A 3SZGA 1NB9A 3ZSCA 1W5TA 1QH0A 1BLIA 3FM5A 2ELJA 5FKLA 1JA0A 3V8KA 1K9MD 3CC2I 1N75A 2ZZFA 2EV5A 3I59B 1D1CA 1AHDP 1H42A 1BBYA 1MJAA 2MW8A 3MVPA 1XPXA 4JMQA 4TMZA 1GQ8A 1BR4A 2BYVE 3MHPA 1HW5A 1XTAA 2CFXA 4RPBA 3A4CA 2VKDA 4HEA2 3OYIA 1RR8C 4ASNA 4Y7CA 2XPVA 3GIRA 3LJYA 1JTXA 1MIJA 4YDTA 1BI0A 2DW4A 3FIWA 1L1IA 3GZNB 1T6YA 1S5LC 2JJ2A 4M3EA 1MDMA 1QGZA 1TBXA 4LK1F 2RC6A 4A0ZA 3HIFA 2O8KA 2LLKA 1IAWA 2VUMJ 2HQAA 2MSYA 2DO7A 2IS4A 2XGJA 4QPOA 2QQBA 4OM9A 2JA7J 1TYUA 1W0TA 2X3UA 5F08A 4BBRJ 5LEJA 2D45A 4PAAA 1YJ9I 2E71A 3MKZA 3V76A 1N8RD 3JQPA 4YFKF 2GXGA 4AF6A 2I1LA 2R7QA 2L9NA 3FHZA 4QHYA 2D9RA 3KETA 3BG5A 5TRDA 1IN8A 5J1YA 2D3LA 2E1RA 3OFNA 3L2UA 2FQ3A 1TNTA 1FX7A 2O5RA 4U0YA 2PMHA 2Z9OA 4A3DJ 1QU3A 2ODLA 2XOKA 2QYUA 4W97A 5J4VA 1W35A 4AD9A 3CJQB 2V5IA 3BTLA 2V7FA 3JSPA 3W6VA 4LBYA 2BV3A 3OZWA 1FMVA 3LWFA 2WZPP 1KD1D 1EA0A 3E5QA 3A35A 2FXAA 3CCJB 1ZQ3P 1T08B 2F5CA 2CJJA 3CF5F 1N0VC 4ITVA 3F6VA 5M5YJ 4P1VA 3WWGA 2CRVA 5A2QK 2ZB9A 3D5SC 1Q82D 4UZFA 4ON0A 1LLZA 2RDPA 4OOIA 1S0UA 2L4MA 2DYSH 4CYCA 4FTHA 4OJLA 2CQNA 4ETSA 1Z1DA 3VYTB 4RS8A 1G59A 3JURA 4KN4X 2CUJA 5IYCJ 3B90A 4RMNA 1I1GA 2DCUA 1BIBA 3OIQA 5E17F 5B5EC 3PO3J 2M4KA 1O3QA 3KP4A 4Q48A 1VQ6B 1B2RA 3JRIA 1G7CA 5ILUA 4YAWA 3UR3C 3OE7A 4XICA 1SD7A 1UMQA 2R7WA 4KITB 3CUQB 1L3LA 3I9V2 4PGGA 3HPGA 4PGHA 1MBKA 4RB1A 2FMLA 1K61A 3AG1H 1FY7A 4II3A 4LBWA 1TYWA 2ZCWA 2VLAA 3CUOA 3M07A 1V5GA 3QPTA 2VNKA 1SD6A 4WWCA 3VWBA 5E3OA 3VSUA 2LFBA 3H94A 4E7LA 4P26A 5IK2A 3VFZA 1W0JA 1YX2A 2BBYA 2PLYA 1D5VA 3CMEB 1DU0A 4RAZA 3CCVI 1S7EA 2VNHA 2H6BA 2XV4S 1ZG5A 2L02A 3JTHA 5LHIA 3I55B 4NC8A 5F64A 3FPKA 3CC7B 3VEPA 1CZFA 3I0TA 2BY0A 1EP2B 5GPCA 1LFUP 4PGOA 1T33A 3CCQB 4Z4YA 3NAWA 2JPBA 1FSEA 1PJ5A 4G6IA 1IO2A 3DQVC 4CGZA 1VQ8B 2XTXA 3BWGA 4UZEA 4BHBA 3IH3A 4LJZF 3PENA 2QM3A 2ZJ2A 4NC6A 5FL7A 5FROA 2HOEA 3WTSC 3OYHA 1ITYA 4OPWA 4G7WA 1I50J 2CNDA 2HQRA 4RDJA 2K27A 2VFQA 3HOUJ 1N78A 1BI1A 1RUOA 2F4NA 3UW0A 1B8IB 3SFZA 4I98B 2COBA 1TTYA 3TEDA 3NB2A 4G7XA 3F22A 5EGOA 1A04A 4G6DA 4A3MJ 1B9MA 1R58A 4XN0A 2MD0A 2OTLB 3J7AY 2YWFA 1ZRDA 3EQLF 2GWRA 1BX1A 1FBUA 2LD5A 3EUHC 2O6GE 1TT5B 3VSLA 1R4NB 2VJIA 2YWEA 1QRYA 5EMNA 3CC4B 4JBAA 3E6BA 3EUHA 5FNZA 3J80K 3GX4X 1YOVB 1YS7A 2JUGA 2R3SA 3VNUA 3WGIA 3PIPF 2VBSA 1QO0D 2WR8A 4HX7A 4XKWA 4DYRA 1E3HA 4RLFA 1MDMB 3CC2B 2A5YB 2HEOA 3B4NA 3QODA 4OOVA 4F93B 5AMVA 4FX4A 4RB2C 2EV0A 1D1NA 4F3QA 3W5VA 4MTDA 3EUKL 2CV1A 5EEGA 4PABA 5IYPA 1A36A 4YG2F 2FBIA 2VQGA 1H0MA 4B4CA 4NNJA 4DW6A 3FMRA 5LLQA 5F0HA 2WZNA 2ZXWH 2AQEA 2PJRA 2GM4A 5GV8A 2DA3A 3CCSI 2GIZA 1H9TA 1UD3A 2IGNA 3FXRA 2F48A 3LA3A 3M1CA 1QFYA 5A89A 1Y0YA 3M8JA 3P27A 1IZ1A 1HQCA 2W84A 4Y4RA 4BQQA 4BE1A 1IDYA 3N6ZA 2HVRA 4PJNA 4OAZA 2XF6A 3ZQHA 2R5YB 5M3FJ 1EFUA 3CMAB 3F8BA 3B02A 3RY8A 3DTEA 5FLVA 4W8QA 4HPQA 1X1BA 4Q5SF 2I8DA 4Z4VA 4HE5A 5EDNA 1X1AA 2W24A 3OW7A 1TT0A 2JTVA 4CQJA 3OP1A 3E0JB 5HLTA 4EM0B 4A3GJ 4QVAA 1W36D 1VTNC 4DIQA 4NHJA 4A3IJ 1W2BB 3HHGA 3UKGA 2G7UA 2EA2A 2FOKA 2JVHA 5DCMA 5TR9A 1IB0A 5GV7A 3IH2A 1N06A 1O8KA 2VASA 3HC7A 2VE8A 3S93A 2L7ZA 1J75A 3W2FA 2JT1A 1MD0A 2X48A 4E7HA 2W82A 3JR9A 5L3EA 1U5TC 1XB2A 3V7RA 3H9JA 1Z0XA 1HOMA 1SD4A 4G7OF 1P4MA 3U2QA 3ONUA 1U5TA 4MNUA 2KZGA 3A1PA 1O7LA 1DGRM 2EK5A 2LMDA 1WMRA 1YRNA 5F1JA 4UAJA 1QRBA 1T39A 2M9HA 2K3PA 5EZGA 1E3PA 3WG7H 4F7ZA 4KISA 1YG2A 2BX6A 2DOAA 4KT6A 4ZZLA 1YLOA 3RKXA 1T98A 3WY9A 2DA1A 2UVEA 2BOLA 2RV8A 3CTAA 4LG0B 1ERDA 2ZL6A 1XQBA 1ZELA 4CCOA 1VQLB 1TLHB 2F5DA 3K6GA 4DK1A 3F21A 1I6XA 2FRHA 4DJAA 3AFHA 2CW7A 1HF0A 3A02A 1GAWA 2M0CA 2X6OA 1IV8A 4LLLA 3VMVA 5CKTA 1T95A 3A2KA 1O8LA 4QSHA 4NUBA 3M1EA 1ZGJA 3J7ZI 2YUSA 4AIHA 4CSWA 2MBFA 5AONA 2EZKA 2CGPA 2WJVA 1OCPA 4HNVA 3GTPJ 3SZTA 2F43A 1BHEA 1KCCA 1Y6IA 1R5OA 2J8IA 1Q7YD 1MRZA 4QIWN 1ELOA 3CCUB 3CCVB 5CVJA 4AF7A 1WSVA 2Y31A 1FRQA 4Z1MA 3H5RA 2O7OA 1YX5A 5D5XB 2Q2EB 5EF6A 2EFPA 1V5EA 3V8LA 5GAHJ 2R93J 1SKQA 2FX0A 2ZMEA 5EGOB 2E19A 3QYEA 3BTJA 2YWHA 4LGWA 1KYWA 5FKMA 1R4MB 2K9QA 2VNIA 3AVTA 2QSFX 3FISA 1IXRC 3H5AA 1I1SA 4DBRA 2NVQJ 3A3BA 1UB9A 2HWVA 4KH3A 2FE3A 4F7DA 1DP3A 3FXOA 2BY1A 4RM0A 3QSYA 1MZBA 3GQ7A 2N8GA 2ZBUA 2AS5F 1XGOA 4F91B 4G6TB 4LD5A 4P5OA 4A69C 4RGXA 4I84A 1OCZH 2VPRA 1YE9A 3DU5A 2ZFUA 5CVUA 1VFCA 5A88A 1TWHJ 2Z16A 3PVDA 1EWYA 1WXRA 1HDDC 2LRDA 3VSKA 2BY2A 1EP1B 5H59A 2VBVA 2ELKA 1SM4A 1VQ7I 3EETA 1NHAA 3BG3A 4G7HF 2CO5A 3KLNA 4I99C 1ZH5A 5LD2C 4IQJA 1FYKA 1YW9A 4A6EA 5BPIA 1ZUNB 1Y0UA 3BR3A 3J7YJ 3VR6A 1ONVA 3AVVA 1RR7A 1TYVA 1O8EA 2OK8A 1TC3C 2YU9J 1YHQB 2W00A 2KJCA 1N0UA 2ZZEA 2BSPA 1JT0A 3BJ6A 3AG3H 2NTQA 3W2AA 2DMQA 1DGWY 1XG2A 3JU4A 4EVIA 2F2EA 2XAQA 2GREA 2ME0A 2MLGA 5KHDA 3G1OA 4PMHA 1P4XA 4V19K 3ZIAA 2UXXA 3M7GA 4XSXF 5E1XA 4MYUA 4BDZA 3EYYA 2BGJA 1TNSA 2HU9A 1XDSA 2QKLB 4BKXA 4BYYA 3L2RA 4QLCU 3FBNB 1OGIA 3AVWA 4DK0A 1V55H 4ZTJA 4M53A 3F23A 1XMXA 4GO1A 4IF4A 5DCMB 1EFTA 3K1PA 3BJAA 1J09A 1OGMX 2XC7A 1LEBA 3CPWB 4KYWA 2H1LA 4OAYA 1JNYA 4PDKA 1V3FA 3BQZA 2R5ZA 3P4GA 2DN0A 2VJJA 3LSHA 5B6IA 9ANTA 1I3QJ 4BEHA 2XF7A 4EJWA 2CRGA 1SAXA 3QFSA 3JRGA 2O3FA 4OJ5A 1SVOA 2EFOA 4UVBA 2HDCA 2DQLA 4EW9A 3IRQA 2KL4A 2OYNA 4PUSA 4XLHA 1O8JA 3ZMZA 2L4AA 4BE0A 2DFEA 3TDZC 2G9WA 1PXZA 1DABA 4E70A 3A3GA 3QFTA 1FJLA 2XKPA 1U9OA 3BQYA 1HVXA 1ZGWA 2F1MA 3LQQA 2XTYA 3KFWX 4M6YA 5EZHA 1Q81D 4KMFA 1O8MA 2LKXA 5JHUA 3QPHA 1H80A 5B1BH 4U88A 2ZTGA 3MKWB 2XIGA 3CO6C 1XE1A 2EJRA 4CYDA 1T0FC 4OPVA 2ICWG 1Z7UA 1KQ5A 4ZDPA 3ISXA 4Z6YA 3PUNA 4UUVA 1V5FA 4RLZA 1L0OC 5J40A 1T0FA 2H1KA 3RYPA 2KRCA 3AKZA 1KK1A 2UZKA 1N08A 1Q1VA 3SY2A 2X0KA 2LBFA 4EM2A 4BE2A 2XUBA 2R9VA 3WXMA 2F4MB 5LGUA 2XRLA 2DK8A 4AYBN 4HF0A 3FPPA 2HDWA 2VQHA 3IAS2 4RAYA 4HSRA 4U7BA 4ABZA 1RWRA 1P2FA 1WDTA 4HX4A 3KP3A 5DCFA 4JYKA 3S16J 2O1DA 4UUSA 1SVLA 4Z06A 4OU0A 3HXLA 1U9NA 3FF5A 1EFRA 4ZYEA 3BT9A 4X8IA 1VI0A 4P96A 4YIIA 1H89C 1OPCA 1E1RA 5LBQA 3R60A 1LB2A 1K4ZA 1VQPB 1VLOA 1JTYA 3B6CA 4OIQF 2KIUA 2DFHA 4B48A 2CFOA 1WOSA 5IYBJ 2IAIA 2R0QC 1E3OC 3B6AA 4P6VF 1O57A 4DZJA 2R7FA 1Y56A 3HKZA 2QSGX 2CUFA 1QA2A 4WF2A 3DPTA 4B43A 2H6CA 4Z03A 5H6QA 3WNBA 5EG0B 1TVCA 1UHWA 3S8PA 4U7DA 2F5VA 3W6JB 1KZLA 3R0JA 1W5SA 3ERED 1Z67A 1BI2A 2R7UA 4YFOA 4TT3A 4KN7X 2WA0A 1IUFA 3KP2A 2NTBA 1FP1D 3PFYA 3B8YA 2DMUA 1BPLA 4HLYA 2O9LA 2QE7A 4BL0B 4L0ZB 5FA6A 1JRGA 2ZL7A 4RB3C 3HOSA 2BVLA 1UG0A 1F9NA 3QAHA 4IRGA 2Z2SB 4NBQA 3VYRB 1B72A 1GR1A 2XNDA 1V0FA 3CDIA 4I7HA 3LSMA 5CLSA 1Z91A 4BNCA 3K69A 2BM7A 2CW8A 1O3TA 5E6TA 3ZMTA 3WODF 4RA2A 4P3YA 4WZEA 4RD2A 1RETA 2EZLA 2HPIA 3LSGA 1LQ1A 5C1CA 3CCJI 4HF1A 1T38A 4UNOA 1QQ1A 1ZM9A 1VQ7B 3GRHA 2DPUA 3U1DA 3FMQA 4FETA 3D0SA 5C44J 2X51A 3L2WA 1WJBA 3ZXSA 4OPOA 3KPHA 4X0GA 1UFMA 2P7VB 1ZGAA 1EJ9A 2M4GA 1VF7A 1ETYA 3W3CA 3DLAA 3BH7B 1WP6A 2XGDA 4CXFA 2B7EA 2QN6A 2X53S 3Q9VA 2KT0A 3LSPA 1VQ9I 1JKOC 4L0YB 3LQRA 1PUEE 1K83J 2DXIA 2ZBVA 2ZKZA 1QCXA 2P5LC 3GLXA 1WSUA 3OIOA 1MSEC 4RD6A 1WI9A 2V9VA 3MD2A 5DTDA 3JRBA 1FOWA 3GEZA 3KCCA 2LKPA 3ABTA 2IEKA 1QJVA 1ZKGA 3A0BC 4Y15A 4M74A 1TW3A 5GP9A 1YW7A 3HSRA 2M3AA 2R7OA 4I02A 2W1OA 4RGSA 4FE7A 2NS8A 2R5ZB 4KKUA 2ZZGA 5IP6A 4E0FA 3CPXA 2LF8A 5GAEJ 1ACIA 1YS6A 4CICA 3VOEA 2XGXA 1DPUA 3S17J 3L2CA 2RC4A 2VB6A 2ZXJA 4DOZA 1OHHA 3C2HA 5HS8A 3G05A 2EA4A 4GGGA 3FX3A 4XONA 5CVRA 3ZZUA 3H09A 1ON1A 1G7RA 1A31A 2CC2A 2KRHA 2GJPA 5FIUA 5J3OA 2JA2A 1CLWA 2OBPA 4PJMA 2V31A 1FOXA 5HOOA 4A2UA 4X06A 4L9TA 4IVNA 1KK0A 4I6ZA 3I55I 4HLXA 3CC7I 1VLYA 3G71B 5E20A 2O61A 5DD4A 4M2LA 2PBIA 3IUOA 3CCQI 3RIQA 3LSIA 3RSNA 1E79A 1OQYA 4G9YA 4ZGNB 4D5CA 3DU6A 1FC3A 3O8GA 3WTTC 1D0YA 5HDGA 3SLDA 1XD7A 2VFOA 1KTWA 3LFUA 3AG2H 2CW5A 3I56B 3VO1A 2YS9A 4OIPF 1E3XA 1HZEA 3HTUA 2L54A 1K8AD 1WOOA 3SXYA 3OYNA 3KZIC 3HUGA 4C9YA 1MMDA 2M5SA 4BH9A 3GFIA 1GHCA 1HA8A 3KX2A 4ZYHA 4H4KC 3BZCA 4PJLA 3RPUD 2OTLI 5JFRA 3BR0A 4RPDA 3WTZA 3VO2A 1IRZA 2IS6A 3W2EA 3KLOA 5HS9A 3B78A 2QA4B 3EYIA 4KFCA 4L18B 1R9TJ 2C5BA 3CC4I 4EGYA 5ERIA 1I27A 4U0VA 3MWMA 1LVKA 1G2HA 5HZBA 2M87A 3SKBA 2DMPA 1XMAA 4RDKA 1K4TA 3Q5FA 5BMZA 1Z21A 2PMDA 5CVVA 3GXOA 1MBGA 1CGPA 4IL6C 1R00A 3AAFA 2DMNA 2QUFA 2WAQA 1ZN2A 3ZGKA 1F4KA 3U21A 3WNDA 1KQ0A 2NNNA 3TL4X 4IHSA 3W2WA 3LQ6A 1S4MA 4LLGF 1P6RA 5FB2A 3NWTA 3DTKA 3Q3SA 4WZLA 1ZR2A 4E7IA 2CF4A 2V1UA 4GXOA 1UHMA 4Z2YA 2VBKA 3ZP5A 2K9SA 4BACA 2F6CA 4HBLA 5FKOA 3UNGC 2EWEA 3N90A 2ELHA 2VNJA 4OINF 5KNLA 1O8IA 3Q3AA 3S3OA 1T2KA 2GK6A 2E1MC 4MQVA 3TOBA 4PK4A 2BM5A 4NC7A 1FNMA 1OB2A 2ZO4A 1B72B 2F1LA 1GT0C 3GZ6A 1U8RA 2OQGA 3WU1B 3H9QA 5K7HA 3R61A 4E7ZA 3BH6B 3HL2A 2EV6A 3QPSA 1M1KD 1GAQA 4RJLA 2WB1A 1NHCA 4AWXB 3CMAI 4B3FX 1P92A 2GA1A 3K0LA 4KKSA 4D7NA 4ZCIA 2XROA 2LZJA 3RTRA 1DDGA 3SQNA 2CQQA 2P5KA 4Y9RA 4CDGA 2EH3A 3JRDA 1PDNC 2ECCA 3W6KB 3S15J 2D74A 3K1MA 2RQPA 2IVMA 1ULYA 3S14J 3OEHA 2QYOA 2VT2A 2JK3A 3G1MA 3H5NA 1ZREA 2G0YA 2QY1A 1PLUA 4KIGA 1Z3YA 3ONQA 1QA6A 2ADUA 1G3WA 2L7FP 3T1BA 4IEJA 1BW5A 2OZ6A 4E7SA 4IW3B 3LMWA 4YZXA 3MKYB 1Y39A 2B63J 3KE2A 2E1BA 2VJ4A 4RAGA 5HKKA 2PYGA 1QUEA 4WXHA 5AN9A 2NXNB 1K8FA 1IDZA 5A2QZ 1JUMA 4U0WA 4C43A 3MQ0A 2M1BA 1ZG3A 3LAJA 2BW3A 2V26A 4FASD 2V7QA 1IDKA 3DFGA 4PZJA 2VKEA 2M0MA 2E5NA 3OR2C 1BC8C 2PMZA 3BZKA 3I4MJ 2PI0A 4ZH4F 4ZCMA 2DA7A 2HTSA 4F52A 3DCFA 1VQ9B 2NZMA 3GVKA 3QOPA 5DS9A 3AGPA 4XMYA 4CCJA 4A3LJ 2PFBA 2K86A 3BH4A 2BEOA 2GA2A 3HBLA 5F6FA 3VDXA 2DERA 1ZR4A 3K4NA 4WX9A 1VQLI 1GLNA 5BS6A 1RU4A 2ZSHB 3OOCA 2OAZA 2XAUA 1SVMA 1QRCA 4BQOA 2EQRA 1G8XA 4NDLA 3K4BA 2X1EA 3RPQA 1E63A 1IXCA 3AVYA 1MBEA 2GPJA 1COWA 3DF8A 1LPQA 1RRJA 2QVOA 4RLQA 5J6XA 3H3VK 4W8SA 4IX7A 1N77A 3BJOA 4DZPA 4BJ6C 2HDNB 2V7UA 2NPFA 2XGCA 3AL0C 4S0HB 4C3JJ 2IGKA 2NT6A 3LSTA 3WBKA 3C7JA 2JUCA 3FDYA 2EZHA 3O6BB 3OS1A 2KDZA 3BY2A 1YITB 3CCUI 1JJ6C 1MNDA 2VT3A 5BSYA 4UB6C 1F20A 4IQ4A 4DNCA 4B09A 3SDBA 1QFJA 3WU0A 4LIVA 5LEKA 2NTPA 2BVMA 1HG8A 1P7JA 2DDBA 3CQZJ 4ACAA 2QQ9A 1VQ4B 4W8RA 3HRMA 3SHFA 4IOAF 4B3AA 1B4AA 5BQTA 5L3BA 3GSIA 4TMVA 3ZZ0A 4QPQA 1U78A 4KKTA 3SYTA 4FK8A 3E5XA 3HOYJ 1JHFA 2ME6A 1AKHB 1FNCA 3ZMVA 3P5JA 2NAZA 3ABKH 4OPSA 3K4LA 3DKWA 3BPXA 4I0AA 1REPC 5C1EA 2P8TA 1FIAA 3U1KA 2HNHA 4KDPA 2XAJA 2VFMA 4BXUA 2XHKA 3T53B 3PFIA 4Z4UA 2LY9A 5B3SH 2VKVA 2ZZQA 2FD5A 3TW6A 3T0YA 3DLLF 5DS0A 2P6SA 2WADA 4NBSA 1WJCA 2K4JA 4G94A 2KQRA 2E2JJ 4C3HJ 3WYAA 4M9ZA 2M34A 3PQJA 1J5YA 4ZCLA 3A1YA 1KZHA 2ZJQF 1Y8RB 3R6KA 4TMXA 2P4WA 1VNDA 4EMSA 1EZGA 2CMPA 2B9SA 4OWRB 3BY6A 3CLQA 4BJTA 2QX3A 3SQVA 1VQOB 1JI8A 1ORKA 3P9KA 3U6BA 3SEJA 5CQEA 1IG7A 3B82A 2L7MP 3TOAA 4DYQA 3J80Z 1F5TA 1F1ZA 3HKZN 3OOUA 2XF5A 1HLVA 2L9SA 1RQRA 3OKXA 1SFXA 4UZUA 2B0RA 2KIQA 1X3UA 2EPFA 3GCMA 2VL8A 1WI3A 4GCVA 4MGRA 4Z4WA 1YHQI 4OOXA 1FWZA 4X0CA 5GTIC 2INVA 3V7CA 4XLCA 4LIUA 2DOGA 3DXJF 4P6YA 1R5ID 3ZPLA 2WYRA 2L0KA 1UAAA 2ISZA 1R1TA 5FRNA 3HHHA 5FLXK 5JBQA 4AC0A 1TQPA 4ZYDA 2Z99A 3VMFA 3C18A 5FLXZ 1QPMA 3TQNA 3WE3A 3GTGJ 2EFWA 5K7ZA 4BS9A 2OUMA 2QEXI 2CV2A 2PEXA 4L9NA 1B59A 2M7BA 5KAIC 1O3RA 1NRKA 1QG0A 1ZARA 3K70D 2H27A 3OJXA 2WV0A 4LG3A 1IA5A 2X9DA 1K73D 5KW9A 2JN6A 3V4GA 2ZJPF 2BE5F 2I5UA 2VJ5A 2R7VA 4M9XA 1TSPA 4C0SA 1PE9A 5DEQA 3HRSA 1VJSA 3OIPA 4OIRF 1KRHA 3PNYA 1ZRFA 1H9GA 4P3IA 1E2XA 4M1KA 2IA2A 4DBQA 2VBTA 1W7PA 4Z4TA 4OZZA 2FNAA 1ETVA 2IRFG 2GZWA 4ENMA 2A61A 2Y9YA 5F4OA 4HG2A 4L9VA 4ESJA 4YELA 4LBVA 4PSWA 1LDKB 3JRAA 3PUFA 4KNYA 4ZGQB 4CYCB 1B9NA 1HKQA 1G3SA 4UVAA 1QVUA 4NK6A 4G1VA 2O0VA 2KIMA 2O17A 3CESA 2XT2A 1TLLA 2NS0A 3RJPA 2ISYA 3WTWC 2NOJB 2RNGA 1H88C 3BCDA 2JJ7A 1BI3A 2V9KA 3LL7A 1OYIA 3Q6QA 1RKWA 2VKHA 2DYIA 1W9XA 2LSOA 1ODDA 1Y0NA 1D1AA 4B1RA 2HOAA 2V7WA 4QV2A 3IAM2 1KMHA 1KTVA 4L8JA 3W5HA 3CD6I 4CCLA 3OV8A 1WORA 2Z33A 3LMMA 2E2HJ 4LBZA 5FD6A 4N0BA 3WG9A 2D5VA 4XR6A 1KU2A 2GLOA 3W2HA 2KRFA 4A5NA 1QQIA 2MGQA 1EXMA 3GTJJ 4M3BA 3QFCA 5LFAA 3ISPA 1WFXA 2JA6J 2WTEA 3NAUA 1K4SA 2L3DA 1O8FA 5EEHA 4DYCA 4HQMA 2GOMA 2HTJA 3JQRA 2GJRA 5D5VB 2O8XA 4X1EA 3TO7A 3S1RJ 3AL0B 4QUZA 2X8KA 2NSTA 3P7NA 1GO2A 2K02A 3OYAA 3OYJA 3CJNA 3GVLA 1Y1WJ 1YIJB 4KT5C 3RIRA 2JMWA 1MBFA 2GOXB 4L5IA 1TTTA 2QZ8A 4DQKA 5J35A 1AMOA 3IL2A 3BCAA 2QSHX 4B3GA 1QZZA 4P2NA 4S05A 5IT9K 1IDJA 1VQPI 4U9UA 3CCRI 2YR2A 3Q0WA 1BR1A 2UUZA 4HZFA 1FTTA 2IS1A 3OYKA 4H0EA 2QCOA 4OP7A 3I4PA 3V42A 2ZMEC 5GADJ 1A8PA 2G7HA 2PYHA 2BPOA 3K2AA 2IP2A 1ETQA 1QPIA 3JSOA 2JZYA 3CMYA 2QDXA 4TN1A 2ZBKA 4P9FA 2CBXA 4HQEA 1WRJA 2K85A 4RD0A 5J3LA 5DM6F 4AVPA 5FRMA 2RC5A 3I4NJ 1O8DA 2LKSA 2V79A 1TW2A 1Z77A 4MTEA 1S7AA 2DK5A 4NQWA 2XDVA 3KP7A 4ESFA 3OYMA 3E1YE 3SEZA 5D8LB 3K7AJ 1BN5A 4MR0A 1JXSA 1DDNA 4WCGA 3JW4A 2XASA 3FKSA 2E60A 3ABLH 4OMZA 4B8XA 4C3IJ 1KGSA 2Q6OA 2V7XA 1K78A 3CP8A 1W34A 4B4DA 4CCMA 3RPUA 1WJFA 3E5UA 3RQ4A 2ZNZA 3PUMA 4YXWA 4EJVA 1Q86D 2GAUA 4ROXA 2AQFA 2WAQN 3CP2A 2OBTA 3CJTB 3IRRA 1S72B 1GVHA 4YEJA 4OZYA 4Y13A 3GTOJ 2HLDA 2AO9A 4ZJZA 3BG9A 2A05A 2Y30A 4C2MJ 2OA4A 4LOCA 1AWCA 4I2OA 4EATA 1XX5A 1EP3B 1M1EB 5F27A 5BPDA 1WH7A 1NH3A 2G0EA 1GV5A 2PJRB 4IHTA 1W4MA 2LC2A 2CK3A 3CCLB 4EGZA 3MMYB 2UXNA 1T8IA 1JUSA 3BR5A 1W0KA 1LE8A 5E18F 1U2RA 1OFCX 2BHZA 3P26A 2XPUA 3FWEA 4FCYA 2EFNA 3W2IA 3QYBA 5IP7J 2CUZA 1OFDA 2YUHA 4Z4ZA 3HB9A 5EEAA 2ESNA 3AK5A 2DODA 2IS2A 3G6EI 3KYLA 4D0PA 2QBYA 4O5VA 1QZEA 1SFUA 1XGSA 1X4OA 2E1NA 2K9MA 2VQLA 3BNWA 1K7AA 5HNFA 4YALA 1ZG1A 1IN4A 1MMGA 2FJ1A 4DQ2A 2VOPA 2QEXB 1HKTA 3C3WA 1G6NA 3L00A 1XN7A 3JRCA 1KK3A 3BCFA 4N3NA 4TMTA 1XGMA 1JKRC 2XAFA 1Y0RA 4ESBA 1HW2A 1A5JA 1X4PA 1S8NA 1E62A 3RZOJ 1NK2P 1V5VA 3I54A 5DYMA 2P0WA 1SANA 4KIBA 4A3CJ 4IHVA 1AA7A 5DUKA 3D5RC 2QGUA 5THXA 3QQAA 1R6RA 3TO9A 3OS2A 1H85A 2OV7A 1R23A 1H8AC 2GK7A 2VFNA 3U9GA 1MJBA 1X3WB 5K5QA 3LSRA 4IOCF 1HC8A 2QGGA 4P9UA 1ON2A 5JLXA 2P6TA 3G71I 2W7ZA 4XK4A 3ZQ7A 4HE6A 4M4SA 2M7AA 4LB6B 5DN6A 2C4UA 5JVTA 1U5TB 4I01A 2NVXJ 3PUBA 3TKYA 1D1BA 1OKRA 5J8FA 3HOZJ 1YRNB 4MYTA 1TQMA 2WWYA 1SFEA 1BJZA 3ASNH 5B1AH 3I56I 2WV1A 2DA5A 3BZ6A 5IOYA 5IP9J 1O4XA 5K7FA 4PJ0C 1QVFB 3GZ5A 4EH1A 4B3XA 1SD5A 2LR8A 2O0YA 1N05A 4FXUA 3BLYA 1OFMA 2HQNA 1POGA 4Q7JB 5IT3A 2H09A 3JQQA 3CD6B 4NCNA 1F60A 2FUG2 5FJ8J 5K5RA 4A3EJ 2M30A 1ETWA 4U49A 2MD5A 4G5GA 2JVGA 3Q38A 1ZM3A 5HXBA 3LNQA 1YJNB 2QA4I 4TKOB 1IC8A 3HGGA 3Q9SA 4V02C 2UV1A 1IW7F 4A0YA 3DWLE 5CQGA 2PG4A 2JN9A 4PCQA 2ECBA 3SFIA 3E3VA 3ZMSA 3T8RA 5CVIA 1ZHFA 2BM4A 5FO1A 5M3MJ 1JKPC 1YQAA 2NSPA 1KYZA 1TP4A 2W25A 3F8FA 4R71A 1P4AA 1R49A 2R7ZJ 2V7VA 2W6JA 2X3HA 4A93J 1QA1A 4XLFA 3CMMA 3D26A 4CH7A 1XG1A 4GYGA 4MO7A 3GTMJ 3J7AO 3ZQGA 2V4DA 1Y8QB 2ZMEB 1TWGJ 2LH9A 2AXTC 4G1BA 3VMWA 4EEFG 4YIFA 1ZRCA 3CCRB 4C2TA 3ZR8X 1MBJA 1BC7C 4KUMA 1W87A 4XNFA 3GVJA 2D2WA 2TDXA 1VQNI 1PUFA 1Z6RA 3VODA 4YCQA 4YAFA 1Z3XA 3F8CA 1FEXA 2ZNYA 1STZA 1A6IA 3K4CA 1PKVA 1OCRH 4FQGA 1WHUA 1T6SA 1CF7A 1S3JA 5B66C 1OFEA 2A3SA 1NBMA 1RKTA 4YZAA 3GBGA 3GQAA 1XCVA 3RKQA 2QXZA 5E3NA 1J7KA 2IPQX 1C0WA 3RQIA 4TMWA 2Y48A 2JSCA 2B0LA 2DT6A 1XSVA 3O8HA 2BF4A 1XC5A 2JIZA 2KZVA 2DETA 2Z5UA 4YFNF 1R5BA 3SEQA 3N05A 3I58A 3L2QA 2DOFA 5J1UA 1FTZA 3CB4A 2KISA 4AIJA 3BY1A 3ESWB 2Z8GA 3DPLC 1KCDA 5D6EA 1O88A 3GQBA 4BHCA 2JA8J 3PO2J 1JA1A 2X6YA 3CCEB 3H92A 4TV7A 2L9VA 2JWTA 3CCMB 3ZN0A 5J8CA 1R1VA 4YZQA 2HCJB 2QENA 2HVSA 1JB9A 1OYYA 2DJIA 3T8TA 5H5JA 2LF7A 2DFIA 2QBYB 3O2PE 1GUUA 4BAYA 1E17A 1K5CA 1FNNA 4OIOF 2WSSA 4HNUA 2DYRH 4WWVA 2H8WA 2LNBA 2JDIA 2F4IA 2YPRA 3FXLA 4EJOA 5LHGA 2ID6A 1T5EA 4BPRA 1YTYA 4S04A 4DQLA 3RZDJ 2JA5J 5H6RA 1W0UA 1FOKA 4FISA 3PSFA 3T9GA 2LG4A 3WTXC 1I8DA 2OTJB 4ZYAA 1R5HA 3PNVA 3G6EB 1OR7C 3LSJA 3FK6A 1UELB 1B6AA 3CJRB 2XAHA 4RDUA 1KJZA 3FJOA 4JK1X 1OR7A 3K70C 1J9IA 1QGYA 3ASPA 1D2EA 1VHEA 4N9IA 2M8EA 3CCYA 2A07F 2FEZA 3BQJA 1FSHA 3SJZA 3OZUA 1BW6A 4BEHB 1RESA 1BA5A 3BDDA 5HS7A 4D7MA 1UHSA 1NDHA 4XKBA 3H9NA 2AHQA 4A5MA 3HZJA 1JUPA 1SMYF 4MLOA 3GQ9A 5L3DA 4PC6A 1AU7A 2JSPA 2FA5A 1WWXA 3JREA 5FO0A 2QTLA 3CDLA 3ZRGA 1AOYA 3MMPA 5TISC 2QLZA 2X0LA 1FDRA 2XGEA 1W36C 1YITI 3ZUGA 4ZYGA 1B23P 5JHFA 3X2QH 2R7RA 1RMGA 1I6HJ 4XD7A 3IHUA 5ICEA 3K2ZA 1HBXG 4R79A 1BN8A 4RB0A 4M9SA 4HA8A 3E6DA 1MSFC 1YW8A 3F3XA 1VQ4I 1WJEA 1FZPB 1KA8A 2FVGA 1QVTA 4AUXA 2W6IA 1KQSB 4M72A 5CDFA 2EIJH 1CNFA 4RD1A 2NV4A 2MC4A 4N3GA 1HSJA 1LDJA 4JX6A 4LITA 4XLNF 3ELKA 4A12A 1UG2A 4KMUX 2F5EA 3QYFA 4YFXF 1S6LA 2XAGA 5LHHA 3CUQC 2QQAA 4UHTA 2LBFB 1EV7A 3NWSA 4MEYF 3OYLA 1DUXC 4IKFA 3HRTA 3CUQA 3AVXA 4BQAA 1LFPA 3M8FA 5E79C 1OGJA 2D1VA 2R7TA 4UXNA 4J00A 5LRRA 2EIXA 3OYGA 5H20A 4M3FA 4UUSB 4HDUA 1PJRA 4FWTA 1ETKA 4EV0A 5E1ZB 3LOCA 3SDGA 4ANJA 1DDIA 2W7NA 2O6WA 1FP2A 2Q6LA 1K79A 4Z4SA 1APLC 4RM3A 4RM2A 3L9FA 1USSA 4HYEA 1D3YA 2LOOA 4BHPA 2DI3A 5KAFC 3KEYA 1E3ZA 3OYBA 5J4YA 1UD5A 5K1YA 1XS9A 3LA7A 4Y9UA 1KONA 3ML3A 3HSFA 5LMZA 1QA3A 3TP0A 2XZLA 2J5PA 1OCCH 1VQOI 3OPOA 2PECA 4JP0A 1NG6A 1QX4A 3ZQIA 4AIDA 4WXDA 3S2DJ 1ZM2A 2KHMA 4M0LA 2E7XA 2Z1DA 3HAGA 2VBUA 4PFPA 3AGQA 1LVAA 3H0GJ 4RBOA 2C4TA 2DJNA
chains in the Genus database with same CATH topology
4BU2A 2ZZQA 1V5EA 1YX3A 4XOTA 3OR1C 2WADA 3QYEA 1WJCA 4XKCA 2HVQA 2KQRA 3OWTA 4P22A 3H5AA 3A1YA 1WPCA 4DBRA 1E43A 3A3BA 2KDOA 2CMPA 2ZSIB 3S3NA 4OWRB 4BJTA 1S9HA 2KPMA 1DP3A 2KVOA 2QX3A 4U4BA 1JI8A 2MFZA 3VYSB 5CQEA 3GQ7A 2QKMB 3OOUA 3F9KA 1EA3A 2XF5A 2L9SA 4BQNA 4CCNA 4YRVA 4UZUA 2KLOA 2VL8A 4F91B 4G6TB 4P5OA 2WY8Q 2IQ7A 2O04A 4I84A 1YE9A 3DU5A 2ZFUA 2INVA 4XLCA 2Z16A 3OYCA 4TSFA 2IXSA 4LIUA 4DGWB 2LRDA 3VSKA 2INUA 4OJ6A 2V4JC 4PJJA 1UAAA 5FRNA 1WTHD 4CA0A 2VPLA 2LY2A 3ZPNA 3FBIB 5LD2C 4IQJA 3TMOA 4BS9A 2OUMA 2CV2A 4C2UA 1DQUA 1NRKA 2M7BA 2CV0A 1MMAA 3VR6A 3K70D 4XN3A 4II2A 4DNTB 1O8EA 1OLTA 4LG3A 1K28D 1IA5A 2W00A 3OL4A 2ZZEA 2BSPA 4AVZA 2VJ5A 2R7VA 2NTQA 3W2AA 1PE9A 1DGWY 1XG2A 4N4NB 3OIPA 2IGMA 1VJSA 3JU4A 1IRXA 1SAUA 3PNYA 1OGOX 4F55A 3RCOA 2X1DA 5KHDA 1Z7LA 2KP6A 4DBQA 4PMHA 4Z05A 4OZZA 4B47A 3CZ6A 4HNTA 3ZIAA 3T51B 1D0XA 1MNEA 4BDZA 4E4HA 4HG2A 2HU9A 2XZOA 1DBOA 2W4SA 4YELA 2QKLB 4GRIA 1LDKB 4JQFA 4PSWA 1OOCA 2L7KA 3L2RA 4MXNA 4NK6A 1QHHD 3FBNB 2DCEA 4C30A 2VQCA 4DK0A 1WJDA 2O0VA 2O17A 3CESA 4ZTJA 2NOJB 2RNGA 1OFLA 4AU7A 1J09A 1OGMX 2XC7A 4E7KA 1AIRA 3OAAA 3BCDA 2V9KA 3K10A 4OAYA 2X6XA 3D5LA 3LL7A 2ZTNA 2VKHA 2RQQA 2VJJA 3DKXA 3LSHA 1W9XA 3LSKA 4BEHA 2XF7A 1D1AA 2DIEA 3IAM2 3S3MA 3BG7A 1KMHA 2R4GA 4L8JA 4DNRB 2JJ1A 2CH0A 2K9LA 4CCLA 3HOTA 4OJ5A 3LMMA 1UD2A 4EW9A 2KL4A 4PUSA 4XLHA 1O8JA 1O8HA 5HNHA 1X1CA 4XR6A 1MW7A 1PYVA 4BE0A 1PXZA 3A3GA 5LFAA 4N4OB 1HVXA 1WFXA 2ZXIA 4C2LA 1TZLA 2F1MA 1QHGA 4HSTA 1H8EA 1O8FA 2WY7Q 2GOMA 4ZC3A 3ZQQA 1O8MA 4CUGA 2GJRA 1H80A 2X1CA 3AL0B 4XLEA 2GJKA 3HUGB 3H0DA 2Y0SA 3MKWB 2X8KA 2ZTGA 2NSTA 3OYAA 3OYJA 3GVLA 1T0FC 1MABA 1P9QC 4URRA 3OY9A 4ZDPA 2GOXB 1V5FA 4OJOA 3BCAA 4B3GA 2KRCA 3AKZA 3E1SA 4JOMA 1IDJA 3HG9A 2VBMA 4XORA 2LBFA 1FMWA 4BE2A 4AYBA 2R9VA 3OEEA 1BR1A 2UUZA 3FPPA 2HDWA 2R7SA 1H8HA 2VQHA 2X85A 2OC6A 3IAS2 2IS1A 4HSRA 3OYKA 4U7BA 1RWRA 3LNNA 3OS0A 2O1DA 1JTAA 4W8TA 5TGTA 3V42A 2PYHA 4Z06A 3HXLA 3SUCA 4ZDLA 2VBEA 1EFRA 2VIXA 5FRMA 1E1QA 4Y33A 1O8DA 1E1RA 4HWVA 3S32A 4CZCA 2XDVA 3FY3A 3OYFA 3OYMA 3G2BA 3SEZA 4MR0A 4B48A 2CFOA 2X6WA 3FKSA 2E60A 3SZGA 3ZSCA 1Y56A 3HKZA 1BLIA 3PJRA 3CP8A 2ELJA 3DPTA 1UD4A 4B43A 4NK8A 1N75A 4CCMA 2ZZFA 2LYCA 4Z03A 1WJFA 1D1CA 3RQ4A 4YXWA 3DDYA 3S8PA 2AQFA 4P1WA 2F5VA 4JMQA 3CP2A 1KZLA 3VYUB 1GQ8A 1BR4A 1D0ZA 4KJZA 3ZPPA 2R7UA 2E1MB 3EQOA 1VZ0A 4YEJA 3A4CA 2WA0A 2VKDA 4HEA2 2WAEA 3OYIA 4TT3A 4OZYA 2HLDA 4ZJZA 2NTBA 3B8YA 3PFYA 1BPLA 2QE7A 4BL0B 3DKYA 2JJ2A 3K4KA 4EATA 1OB0A 2ZXHA 2WPDA 1JRGA 4BJ5C 3HOSA 2PJRB 2BVLA 1UG0A 2CK3A 2LC2A 3BG6A 2Z2SB 3VYRB 2XNDA 3KRGA 3MMYB 1V0FA 3LSMA 2IS4A 2HQAA 1W0KA 3WQZA 2CW8A 4QPOA 2XGJA 4OJPA 3BCBA 2HPIA 3DPUA 1X19A 3LSGA 3QYBA 2CUZA 5C1CA 3MKZA 3OYEA 2IS2A 3GRHA 3KYLA 4FETA 2R7QA 2L9NA 1X4OA 2K9MA 2VQLA 2X51A 3L2WA 1WJBA 3ZXSA 5HNFA 2D3LA 1SFKA 3OFNA 1MMGA 3L2UA 2O5RA 4X0GA 3W2VA 2ODLA 2O0WA 1QU3A 4XOPA 2M4GA 1VF7A 2XOKA 3BCFA 3W3CA 3CJQB 3DLAA 2BW3B 2V7FA 1X4PA 1WP6A 2X53S 1FMVA 2WZPP 3PNTA 2DXIA 2P0WA 1SKYB 1QCXA 3A35A 1AA7A 3MD2A 3D5RC 4ITVA 1R6RA 3IP4B 3OS2A 1QJVA 2OV7A 2GK7A 3WWGA 3D5SC 2HZDA 1BOBA 3CF2A 2MYSA 2M3AA 2R7OA 2W1OA 3L2VA 3GQ8A 4KKUA 2ZZGA 4E6KG 4OJLA 4E0FA 2M7AA 3VYTB 4HIZA 5DN6A 1G59A 3JURA 3ZCOA 1E0EA 2CUJA 2A6TA 3PUBA 4XKVA 3B90A 1D1BA 2VB6A 4RMNA 1OHHA 4DOZA 3OIQA 3C2HA 3G05A 2M4KA 4XONA 4XLAA 4BDYA 2KRHA 2GJPA 4BXFA 2JA2A 4PJMA 2V31A 2CS3A 5HOOA 4B3XA 3UR3C 3OE7A 2NT9A 4FXUA 1OFMA 3BLYA 2L2OA 1VLYA 2R7WA 4KITB 1LKXA 3I9V2 3HPGA 3IUOA 4ZTFA 2FUG2 4II3A 3LSIA 3RSNA 1E79A 4U49A 2VLAA 3DU6A 1V5GA 2JVGA 1D0YA 3VWBA 1NG7A 3VSUA 4TKOB 3H94A 4E7LA 3LFUA 2V1NA 5IK2A 1KTWA 4YZXA 2UV1A 1W0JA 2A5WA 1E3XA 1X1DA 3DWLE 5CQGA 4E7JA 1HZEA 2LREA 3OYNA 4C9YA 1MMDA 4D9JA 2M5SA 1X0CA 1EE6A 2V6EA 4NC8A 3KX2A 1HA8A 4H4KC 1CZFA 2NSPA 4PJLA 3RPUD 2W6JA 2X3HA 4XLFA 1FX0A 3CMMA 3QOEA 4G6IA 3DQVC 4CH7A 2V4DA 4BUPA 2IS6A 1BMFA 2LH9A 4HRIA 5FL7A 3VMWA 5FROA 3VSTA 3OYHA 4C2TA 3ZR8X 4G7WA 4XNFA 3GVJA 1O8GA 1LVKA 1N78A 3UW0A 2L5QA 4J01A 1Z3XA 1Z21A 3K4CA 1PKVA 5KCMA 2LY1A 4G7XA 3OMYA 2WAQA 4XN0A 2MD0A 3ZGKA 3J7AY 3U21A 4XM3A 3EQNA 1NBMA 3TL4X 2WBMA 4XQFA 3W2WA 3GBGA 4YZAA 3GQAA 3NWTA 3DTKA 2QXZA 2XSJC 2VXDA 3OYDA 3EUHC 2MABA 3VSLA 4E7IA 3BC9A 2VJIA 1WJAA 2VBKA 2R7XA 2DT6A 4BACA 2F6CA 3UNGC 2JIZA 2KZVA 2EWEA 4IZZA 5CPRB 2JUGA 3SEQA 5KNLA 3N05A 1O8IA 2UVFA 3S3OA 2GK6A 3L2QA 4XKWA 2E1MC 4RLFA 4PK4A 3B4NA 3QODA 4NC7A 4F93B 5AMVA 4GQNA 2Z8GA 3DPLC 4F3QA 3H9QA 1KCDA 4E7ZA 1O88A 3GQBA 3HL2A 3HPHA 3EUKL 2CV1A 2X6YA 1NHCA 2WB1A 4B3FX 4KKSA 2VQGA 4ASUA 4NNJA 2KMUA 1MMNA 2LZJA 3RTRA 2HVSA 2DJIA 2XZPA 2AQEA 2PJRA 1WJ5A 3DEEA 1K5CA 1UD3A 2IGNA 2WSSA 2Q1ZB 4HNUA 3FHNA 2JDIA 2F4IA 3K4JA 3M1CA 3OEHA 3H5NA 3M8JA 2Z6BD 2QY1A 1T5EA 1PLUA 4Y4RA 1Z3YA 3ONQA 1BR2A 3K4MA 3PSIA 4PFOA 4BQQA 3PL8A 4BE1A 4B44A 4E7SA 1U0JA 3PSFA 4OAZA 2XF6A 4PJNA 2LG4A 3MKYB 2HVRA 1I8DA 3LMWA 4ZYAA 3T9GA 2VXZA 3PNVA 3H35A 3DTEA 1OR7C 2VJ4A 2E1BA 4W8QA 4HPQA 2WJYA 5HKKA 1UELB 1X1BA 3CJRB 2I8DA 2PYGA 1X1AA 3OW7A 3K70C 1TT0A 2BW3A 2V26A 3E0JB 4FASD 5HLTA 4XL9A 2V7QA 1IDKA 1W36D 2M0MA 2E5NA 3OR2C 4DIQA 2PMZA 4BEHB 4ZDOA 4U87A 4F52A 4XKBA 3GQ9A 2NZMA 4MLOA 3GVKA 2JVHA 4Y3OA 2WAFA 4XMYA 4CCJA 2JSPA 3C2GA 3NE5B 3BH4A 1O8KA 2VASA 3HC7A 3ZRGA 3VDXA 2IGOA 3I3LA 3S93A 1W36C 3K4NA 4BGDA 1GLNA 3EUAA 5JHFA 2W82A 2ZSHB 4D1QA 2R7RA 4E7HA 4XD7A 3OOCA 1RMGA 3FKJA 3H9JA 2XAUA 2D3NA 4R79A 4BQOA 1BN8A 1G8XA 3K4BA 2X1EA 1I18A 1WJEA 1DGRM 3EPZA 2W6IA 1COWA 1WMRA 5CDFA 1K6YA 4RLQA 2MC4A 2K3PA 4W8SA 4IX7A 1N77A 4LITA 4KISA 4BJ6C 2DOAA 4KT6A 3AL0C 3QYFA 2UWMA 2IGKA 2NT6A 2LBFB 3FDYA 3OS1A 2BOLA 2UVEA 1ERDA 1MNDA 1ZELA 3NWSA 4CCOA 3OYLA 4IKFA 2RREA 3K6GA 4DK1A 4IQ4A 2HPMA 1LFPA 2K5CA 4DJAA 3SDBA 2R7TA 3AFHA 2CW7A 4LIVA 4J00A 3OYGA 4F92B 2NTPA 2BVMA 1UD8A 1HG8A 3VMVA 3T56B 1PJRA 4W8RA 1V0EA 5CKTA 4ANJA 1T95A 3A2KA 4YZQA 2W7NA 1O8LA 4RM3A 4NUBA 5HVQC 4RM2A 4CCKA 2LOOA 4QPQA 4CSWA 1E3ZA 4KKTA 3KEYA 3SYTA 4YZ0A 2DT7B 2WJVA 2E5ZA 3OYBA 1UD5A 2F43A 1BHEA 1IB4A 1KCCA 3H9GA 1Y6IA 3BC8A 4PSXA 1KONA 4NQWB 1UD6A 3DTIA 3TBIA 3KEWA 2XZLA 1VBLA 3OPOA 2PECA 1RU4A 3K4LA 1NG6A 5C1EA 3VSVA 1DBGA 2HNHA 2KHMA 4Z1MA 3HAGA 2Z1DA 3H5RA 4PFPA 3OL3A 1YX5A 3T53B 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6Y A;  4XLE A;  1NHC A;  4XOT A;  2NST A;  4URR A;  3GQ8 A;  4OJL A;  4OJO A;  1IDJ A;  1K5C A;  2VBM A;  4XOR A;  3JUR A;  2QX3 A;  4U4B A;  4XKV A;  3B90 A;  3GQ7 A;  2QY1 A;  2X85 A;  1PLU A;  1RWR A;  4MXN A;  4XON A;  4XLA A;  2O1D A;  1JTA A;  3LMW A;  2O04 A;  2IQ7 A;  4W8T A;  4I84 A;  4YZX A;  3T9G A;  2PYH A;  2INV A;  4Z06 A;  4XLC A;  4W8Q A;  2INU A;  2PYG A;  2NT9 A;  4OJ6 A;  1OFM A;  3SUC A;  2VBE A;  1O8D A;  4HWV A;  1IDK A;  4XL9 A;  3FY3 A;  4U49 A;  4MR0 A;  3GQ9 A;  2NZM A;  3VSU A;  2X6W A;  1KTW A;  4XN3 A;  4XMY A;  3ZSC A;  1O8E A;  1IA5 A;  1O8K A;  4NK8 A;  2BSP A;  4Z03 A;  1X0C A;  4AVZ A;  1EE6 A;  2NTQ A;  1PE9 A;  1XG2 A;  1CZF A;  2NSP A;  1RU4 A;  1GQ8 A;  1OGO X;  1RMG A;  3ZPP A;  3EQO A;  2X3H A;  4XLF A;  4YEJ A;  4OZY A;  1BN8 A;  4OZZ A;  4PMH A;  4Z05 A;  2NTB A;  3B8Y A;  3VMW A;  1WMR A;  1DBO A;  3VST A;  4YEL A;  1JRG A;  1OOC A;  4W8S A;  4XNF A;  1O8G A;  4NK6 A;  3KRG A;  3UW0 A;  2O0V A;  2NT6 A;  2O17 A;  2UVE A;  4OJP A;  1OFL A;  1OGM X;  1AIR A;  5C1C A;  4XN0 A;  2X6X A;  4XM3 A;  3EQN A;  3GRH A;  4XQF A;  4YZA A;  2NTP A;  1HG8 A;  2VJJ A;  3VMV A;  3GQA A;  4W8R A;  2QXZ A;  4YZQ A;  1O8L A;  2ODL A;  4OJ5 A;  2VJI A;  2O0W A;  2VBK A;  4EW9 A;  4XOP A;  4YZ0 A;  1O8H A;  4XLH A;  1O8J A;  2EWE A;  1BHE A;  1KCC A;  4XR6 A;  1IB4 A;  2UVF A;  1O8I A;  1PXZ A;  4XKW A;  1VBL A;  2PEC A;  3B4N A;  5AMV A;  1QCX A;  5C1E A;  3VSV A;  4C2L A;  1DBG A;  2Z8G A;  1KCD A;  1O8F A;  3WWG A;  1QJV A;  1O8M A;  1O88 A;  1H80 A; 
#chains in the Genus database with same CATH topology
 4BU2 A;  1FND A;  3QWL A;  4Z4R A;  2HVQ A;  2FF4 A;  3OWT A;  3J81 k;  1FYM A;  2HKX A;  4MFE A;  3GW2 A;  5L3F A;  3GWZ A;  2EWN A;  3SLN A;  4M6X A;  1B8I A;  4IXA A;  2ZSI B;  1UST A;  2E36 A;  1VQN B;  1ZK8 A;  2KPM A;  5CJ9 A;  2H8R A;  2FMY A;  4U4B A;  2MFZ A;  2BY3 A;  5JLV C;  4OMY A;  4CCN A;  1EA3 A;  4YRV A;  2KJB A;  4BQN A;  2HYF A;  3LFK A;  3KIO A;  2BSA A;  2O04 A;  5D4S A;  5HOD A;  1JE8 A;  1F36 A;  3OYC A;  4TSF A;  2IXS A;  1ZAO A;  4DGW B;  2INU A;  3WU2 C;  1Q9S A;  2RGV A;  3MAJ A;  3SJP A;  1G4D A;  4PJJ A;  1IXS B;  1WTH D;  5F0F A;  2IOU G;  1PJ7 A;  1SMT A;  2DAO A;  3VB2 A;  3WBJ A;  5FFX A;  3ZPN A;  2O03 A;  3LAP A;  3OZV A;  2W48 A;  1YI2 B;  5DD8 A;  2W85 A;  4G12 A;  1DQU A;  2LK2 A;  1MMA A;  1V54 H;  3M9A A;  4XN3 A;  1Y1V J;  1VQM B;  2FOW A;  3PET A;  1K28 D;  4WXC A;  2QQ8 A;  2FBH A;  3CLO A;  3WTY C;  3FXJ A;  2C5H A;  3BPV A;  1J0R A;  5AIQ A;  4H9G A;  3G1L A;  2IGM A;  1HCR A;  1MH3 A;  1RQP A;  2DBB A;  1IRX A;  3PM1 A;  5HLH A;  4IJA A;  4F55 A;  3DBH B;  3RCO A;  1Z7L A;  2KP6 A;  4Z05 A;  3CZ6 A;  4HNT A;  4Q4Z F;  3L1P A;  4A3F J;  4UV9 A;  1PVE A;  5IPA A;  1MNE A;  1JT6 A;  1EH8 A;  4A6D A;  2FX3 A;  3V7S A;  2XT4 A;  2XZO A;  1X2M A;  2W4S A;  4JQF A;  1MNM C;  1OOC A;  2L7K A;  1BQE A;  2WC2 A;  3TP3 A;  2EFG A;  2EB7 A;  3RDI A;  3OJW A;  5IYQ A;  2R5Y A;  1P7I A;  1RC9 A;  2DCE A;  2VQC A;  1FYL A;  2E2I J;  3ASR A;  3ASO H;  1KQ9 A;  2MA3 A;  2Q8K A;  2F5F A;  3KEO A;  1JGS A;  4X07 A;  4M71 A;  5LGT A;  1OFL A;  2LTP A;  2RAE A;  1PJ6 A;  3L7W A;  2HXI A;  1OYW A;  2ZTN A;  3D5L A;  1S29 A;  4I0B A;  4K2E A;  1OB5 A;  2QMU A;  2COM A;  3KZZ A;  3ONY A;  1GVJ A;  4UVC A;  4MFD A;  2M5W A;  2R4G A;  3HOT A;  1YIJ I;  3ZBU A;  3VNV A;  1XSX A;  2DTR A;  1VQ5 B;  2I10 A;  4O3M A;  1EFC A;  3G4S B;  4JX5 A;  3N97 A;  5IYW A;  4PC1 A;  2GIV A;  3MEX A;  2EIN H;  1MW7 A;  1CQT A;  3A8K A;  3FXK A;  2ZFW A;  5L3C A;  4HF2 A;  3C1D A;  3FXU A;  4WZK A;  2CSO A;  1ETX A;  3KYC B;  4N4O B;  1J9Z A;  4YAU A;  2PX9 A;  5M5X J;  3JRF A;  3PSZ A;  4C2L A;  1MGT A;  1EH6 A;  5L46 A;  4ZC3 A;  2OU2 A;  3G73 A;  2EIL H;  3KL9 A;  2HZT A;  2X1C A;  5C4X J;  3FMS A;  3VPR A;  2GJK A;  1RUN A;  3HUG B;  4XID A;  2Y0S A;  4KIF A;  3H0D A;  1BIA A;  2DDA A;  1IN7 A;  1IGN A;  1R1U A;  1MAB A;  4URR A;  1ENH A;  2GXB A;  1FNB A;  3HTS B;  3H3Z A;  4XSZ F;  3BTC A;  2CW0 F;  4LC0 A;  2VBY A;  4OJO A;  3E1S A;  4JOM A;  3BP8 A;  4CO8 A;  4QVJ A;  4XOR A;  2RN7 A;  5F04 A;  1FMW A;  4LG0 A;  4AYB A;  5A8A A;  1KC8 D;  3OEE A;  4P12 A;  5E8G A;  4ENN A;  2X85 A;  1FBS A;  2NVY J;  2OC6 A;  3HOX J;  1R36 A;  2HDD A;  4A3B J;  1I39 A;  4I09 A;  5JLW A;  1IF1 A;  3MZ8 A;  2TCT A;  5H2F C;  2HOT A;  4XRS G;  1W1W E;  3WE2 A;  2HR3 A;  5BNG A;  3S1M J;  1Z6T A;  3LVB A;  2STT A;  4WK8 F;  2NNY A;  1IV6 A;  1A6Q A;  3LO8 A;  2VBE A;  2DA4 A;  3Q39 A;  4OOS A;  1E1Q A;  4Y33 A;  2JPC A;  1S72 I;  2OJE D;  2VE9 A;  4HV6 A;  3FY3 A;  3OYF A;  4WQM A;  1OCO H;  3G2B A;  3ES9 A;  2H94 A;  1XDU A;  3F6O A;  1YIO A;  5DUI A;  4ENJ A;  2X6W A;  3L09 A;  2XEX A;  4FHT A;  5LGN A;  1D5Y A;  1EH7 A;  2J7K A;  3JCU C;  2C78 A;  2LVS A;  2Q2E A;  3NRV A;  3CCL I;  3QRF F;  3PJR A;  2DA6 A;  3AG4 H;  3IWF A;  1UD4 A;  4NK8 A;  1I7P A;  2LYC A;  1JJ2 B;  2XB0 X;  2EBI A;  5GPA A;  2LP0 A;  5HDK A;  5AIP A;  3RYR A;  3DDY A;  4P1W A;  3DEW A;  2P3M A;  5ICC A;  3VYU B;  1D0Z A;  4KJZ A;  4EJT A;  3ZPP A;  3PA2 A;  2E1M B;  4YC5 A;  3HM5 A;  4PC2 A;  3EQO A;  1GV2 A;  1VZ0 A;  1LM1 A;  1LUJ B;  2WAE A;  2PE3 A;  4X7E A;  5D5U B;  2B7C A;  4YEI A;  4RCZ A;  3COA C;  1DP7 P;  2V6C A;  2YSR A;  4YIR X;  3DKY A;  3K4K A;  1OB0 A;  2CUE A;  2GBY A;  1I3A A;  2ZXH A;  4BJ5 C;  1SEU A;  4X6A J;  2WPD A;  2CG4 A;  2BHY A;  3BG6 A;  4XRF A;  1KU3 A;  3WTV C;  4RDL A;  3KRG A;  3HDD A;  2A6E F;  3ZQL A;  4D5F A;  2B7B A;  1G7S A;  1X2N A;  3MCZ A;  4K1X A;  3WQZ A;  2MH9 A;  4OJP A;  2Y69 H;  3DBL B;  1TWF J;  3IC7 A;  3BCB A;  1PP8 F;  2QTZ A;  1IN5 A;  3NQO A;  3DPU A;  1X19 A;  5DDG A;  1J59 A;  1QFZ A;  5ED4 A;  4R8H A;  3OYE A;  1IJE A;  2DY1 A;  2PQ8 A;  1Q1H A;  3RI4 A;  3B8H A;  3WGG A;  2HXO A;  4L5E A;  2ETH A;  5C3E J;  2IA1 A;  1KU9 A;  1SFK A;  5TV2 A;  3W2V A;  2O0W A;  4FX0 A;  1S7O A;  3PQK A;  2DLL A;  4XOP A;  2VN2 A;  3G3Z A;  5FFZ A;  2DTZ A;  3K1N A;  2BW3 B;  4EQQ A;  4J19 A;  1BJK A;  3A8J A;  1DG1 G;  3I1F A;  2ID3 A;  3TW7 A;  1KK2 A;  3PNT A;  1SKY B;  2BM0 A;  4YAO A;  2VZL A;  1YJ9 B;  1QGP A;  1X3Z B;  2BXY A;  3MZH A;  3ASS A;  4IRH A;  3IP4 B;  4UY8 I;  2GQF A;  2KFD A;  4P25 A;  2OZU A;  2PMU A;  1P4W A;  2PN6 A;  2HZD A;  1VHO A;  3ZBT A;  2J5O A;  3GF2 A;  1BOB A;  3CF2 A;  4XBF A;  1D8J A;  1QGA A;  1LJ9 A;  2XB5 A;  2MYS A;  3BTI A;  5IYD J;  3L2V A;  3GQ8 A;  4E6K G;  4IO9 F;  2KIF A;  4HIZ A;  1BOA A;  1WGX A;  2DA2 A;  2XPW A;  5FKN A;  3PA1 A;  3ZCO A;  1E0E A;  4M3D A;  1WOP A;  3ML6 A;  2HKO A;  2A6T A;  4XKV A;  2E1O A;  5HDN A;  5ILS A;  1YJN I;  2K3F A;  2A68 F;  1HA3 A;  2IBD A;  1QVG B;  4BDY A;  4XLA A;  5K5O A;  2JQ7 A;  1MH4 A;  3ZOB A;  2CQK A;  4BXF A;  2NVU B;  4BXX J;  2CS3 A;  2ZJR F;  3ULQ B;  2E34 A;  2NT9 A;  2DT5 A;  2L2O A;  3W5U A;  3SZE A;  3FZV A;  1LKX A;  4LFU A;  5DNS A;  1XGN A;  1HXD A;  3ROU A;  4ZTF A;  4GFB A;  3QU3 A;  3J81 K;  2FBK A;  3HGY A;  4X7F A;  1K6O A;  2XNJ A;  1ETO A;  3TDU C;  1NG7 A;  3J81 Z;  4AC9 A;  4QWQ A;  3GUD A;  2V1N A;  1IHM A;  5IT9 Z;  2J8K A;  4Q47 A;  2XTW A;  2A5W A;  1YJW I;  1MKM A;  1X1D A;  3Q0U A;  1RZ4 A;  5ICG A;  4E7J A;  2LRE A;  4HX8 A;  1GJR A;  5DM7 F;  3R6J A;  2NYX A;  2DFF A;  3HRU A;  2NS7 A;  4D9J A;  1WH5 A;  4XRS A;  5FO5 A;  1X0C A;  1EE6 A;  4JRA C;  2NRA C;  2V6E A;  3IKV A;  5L3G A;  2MG4 A;  1FIP A;  3TGN A;  1IRG A;  2HOS A;  2OCE A;  2ESH A;  1ZYR F;  3NEU A;  1OMI A;  1FBQ A;  1FX0 A;  2XSD C;  3QOE A;  1QNT A;  2CQX A;  5LRS A;  4BUP A;  2OBR A;  2QF7 A;  1BMF A;  4HRI A;  3ZC3 A;  1IJF A;  4LK0 F;  2C6Y A;  4IRI A;  3HOW J;  3VST A;  1OIS A;  3ABU A;  3RKW A;  1D8T A;  2VC1 A;  2HYG D;  1IJW C;  1O8G A;  4IHX A;  4X7D A;  4XLP F;  3OW2 B;  2L5Q A;  2DEU A;  3HJE A;  4J01 A;  1LNW A;  3HSE A;  1T6X A;  1XFO A;  1M90 D;  5KCM A;  1YFH A;  1PP7 U;  2LY1 A;  2BM1 A;  3OMY A;  1T56 A;  3IV5 A;  1FOY A;  1X58 A;  2ZL5 A;  3ERM A;  1BX0 A;  3WNC A;  4XM3 A;  2V7T A;  3EQN A;  4XQF A;  2WBM A;  3WHC A;  3EDP A;  3CCE I;  1KU7 A;  1VF9 A;  2XSJ C;  2VXD A;  3OYD A;  1O3S A;  3ASQ A;  4CHU A;  2MAB A;  3CCM I;  3C2B A;  4RCY A;  3BC9 A;  1WJA A;  2R7X A;  1TQI A;  2VBW A;  4IZZ A;  5CPR B;  5IOZ A;  2X4H A;  2ACJ A;  5GAG J;  2UVF A;  2BV6 A;  3E20 A;  3FXM A;  5EG0 A;  1X1P A;  2XC1 A;  2RKH A;  5GTH C;  4G8X A;  3M8E A;  1LLW A;  4GQN A;  4X7C A;  4HV5 A;  1Z05 A;  3SZP A;  1R7J A;  1FLI A;  1E64 A;  3HPH A;  3R6S A;  1VQK I;  2Y2Z A;  3KEQ A;  2HQ5 A;  3LA2 A;  2OTJ I;  2AHO A;  1ZLJ A;  4XRM A;  5J1R A;  1UMK A;  2WB1 N;  4ASU A;  2JRT A;  2KMU A;  4MHG A;  1MMN A;  5D5W B;  2Y9Z A;  1CNE A;  3FM3 A;  1NTC A;  5F0C A;  3Q0V A;  3E6M A;  4KIC A;  1WJ5 A;  3DEE A;  4AIK A;  3HOV J;  1BJA A;  1R5N A;  2K4B A;  2AXL A;  3D1N I;  4Y7N J;  1W7P B;  2FSW A;  2LDU A;  2Q1Z B;  3E6C C;  3FHN A;  2E35 A;  1TWA J;  3K4J A;  2M45 A;  4YHB A;  2EIK H;  3KZY A;  3B73 A;  4X05 A;  2Z6B D;  3PSS A;  3SYJ A;  2XZP A;  1BR2 A;  3K4M A;  3PSI A;  4PFO A;  3KP5 A;  3PL8 A;  1I18 A;  4B44 A;  4MXN A;  1U0J A;  3FXQ A;  2VXZ A;  3H35 A;  5E8I A;  2WJY A;  4J0Q A;  3I5U A;  1WZ2 A;  1D8K A;  1NK3 P;  1FRN A;  2VI6 A;  3CCS B;  5D6F A;  4XL9 A;  1WU8 A;  2QWW A;  3AST A;  5E3M A;  1ZLK A;  3F0C A;  1XMK A;  5BOX A;  4ZDO A;  4U87 A;  2PMZ N;  2IT0 A;  4IHW A;  4Y3O A;  1A35 A;  1HW1 A;  2MC3 A;  5F1R A;  4ACB A;  1WQ2 A;  2WAF A;  2ZIT A;  2Y75 A;  3DEU A;  1Z9C A;  2D1H A;  3ECH A;  3C2G A;  2M8G X;  3NE5 B;  2XVC A;  1IRF A;  2IW5 A;  1CQX A;  2IGO A;  3I3L A;  5KVR A;  4R1H A;  3GTQ J;  5DSZ A;  4BGD A;  4D1Q A;  3EUA A;  1FPQ A;  4N9H A;  5C4J J;  4ENK A;  3BRO A;  3FKJ A;  1R71 A;  2D3N A;  1TYX A;  2OCC H;  3ECO A;  2BN4 A;  1YO5 C;  5IY5 H;  1G7T A;  1U3E M;  2M2E A;  1N25 A;  4UB8 C;  1UCR A;  3S1Q J;  3EPZ A;  3O3K A;  3WHB A;  3F8M A;  1MBH A;  3A01 A;  1GXQ A;  2VON A;  1K6Y A;  2Q6I A;  4I76 A;  3P9I A;  3QFR A;  3GTK J;  2YX7 A;  2OBS A;  2BGI A;  3QU6 A;  2EFQ A;  4ZZD A;  1SFO J;  2STW A;  3GME A;  4V2G A;  4FE4 A;  2UWM A;  2OK7 A;  3U2R A;  1U6G A;  4FT8 A;  3IH4 A;  2RVC A;  4GYI A;  5F4M A;  1NJI D;  4Y52 J;  2RRE A;  2V1D A;  3IKT A;  2XKO A;  2HPM A;  2K5C A;  3E97 A;  4M3G A;  5E3L A;  1J2X A;  2JRM A;  4QFM A;  5KSW B;  1TL8 A;  1LDD A;  2F4O B;  3TH0 A;  2Y0S N;  4F92 B;  1JKQ C;  1UD8 A;  1V4R A;  3CDH A;  3DV8 A;  1U8B A;  3T56 B;  1IUY A;  1V0E A;  3AVU A;  1JGG A;  4LMY A;  4A3K J;  1KQ8 A;  5HVQ C;  3BR6 A;  5IYR A;  4CCK A;  4WZT A;  2HI3 A;  4YZ0 A;  4G7Z F;  3JTG A;  2DT7 B;  3A0H C;  2C2W A;  2E5Z A;  1XB4 A;  1WPK A;  1IB4 A;  3H9G A;  4PSX A;  3BC8 A;  4PC7 A;  1YJW B;  4NQW B;  3S2W A;  2CQ7 A;  1UD6 A;  2P81 A;  5ILV A;  3H36 A;  2E1C A;  1HKS A;  3DTI A;  3FK7 A;  3TBI A;  3KEW A;  3Q6R A;  3V7A A;  2DMT A;  1VBL A;  2VYQ A;  4MIM A;  3VSV A;  5ICF A;  3PIO F;  1DBG A;  3KYD B;  3OL3 A;  2R92 J;  3S2H J;  3A8I A;  2V1X A;  1K78 B;  3MZY A;  4MEX F;  2A69 F;  1YX3 A;  4XOT A;  3OR1 C;  4BBS J;  5CYV A;  4XKC A;  4L9J A;  1HDP A;  1YLF A;  2DPD A;  6PAX A;  4IHY A;  2BXZ A;  4Y17 A;  4P22 A;  5F4J A;  2DOE A;  5IYN A;  1SC7 A;  2GXA A;  4HOB A;  1WCM J;  1WPC A;  4RD4 A;  4L5J A;  1E43 A;  2VOO A;  3CRZ A;  2KDO A;  3F72 A;  3S3N A;  2F3L A;  1R22 A;  2A6H F;  1S9H A;  4RGU A;  1GDT A;  1O7F A;  4JX4 A;  3TO6 A;  5TJJ A;  3OSF A;  2KVO A;  1YI2 I;  2L9R A;  2B5O A;  4A3J J;  4HAM A;  5E1W A;  1I5Z A;  3VYS B;  3CW2 A;  3I59 A;  2QKM B;  3F9K A;  3ZQF A;  3LYC A;  2KLO A;  2FQ4 A;  1VQM I;  3QP5 A;  2WY8 Q;  2IQ7 A;  3I53 A;  3GFM A;  4CZZ A;  4P9S A;  2MLK A;  1ZM4 A;  5M5W J;  2BM6 A;  1LE8 B;  3OSG A;  1JJ8 C;  1G3T A;  4OJ6 A;  4RD3 A;  2VC0 A;  1U2W A;  2VBZ A;  2V4J C;  3JRH A;  4LB5 A;  1RI7 A;  2FU4 A;  1RNL A;  4CA0 A;  1MMS A;  2VPL A;  1YYV A;  3GFJ A;  3MCA A;  3QE2 A;  2LY2 A;  3P9C A;  3FBI B;  1XSD A;  3ABM H;  1W7P D;  3TMO A;  3R4K A;  3DBR B;  4C2U A;  2IJL A;  1EKE A;  2VOD A;  2BGC A;  1FT9 A;  2BZT A;  2R6H A;  2CV0 A;  1RPW A;  3HEF A;  4II2 A;  5BSX A;  2K7L A;  3KP6 A;  1UZC A;  3K9T A;  1OLT A;  4DNT B;  3CXC B;  4BY7 J;  3JX8 A;  1BM9 A;  3SJM A;  3OL4 A;  3GTL J;  4QTR A;  2Q0O A;  4AVZ A;  1VQK B;  3H1C A;  4HW0 A;  3ZMU A;  4FN5 A;  3GLL A;  1DAR A;  3BR1 A;  2YWG A;  4N4N B;  2XNC A;  3ZZT A;  3BOQ A;  1OGO X;  1SAU A;  1F43 A;  2FNP A;  1QZY A;  5EYR A;  4MQ9 F;  2X1D A;  1RIO H;  5FKK A;  5KK1 A;  1NB0 A;  4B47 A;  3OOP A;  2L01 A;  3T51 B;  2C77 A;  1D0X A;  1ZTR A;  4E4H A;  1GXP A;  3S1N J;  4ZV4 A;  1DBO A;  5HZA A;  1OCT C;  3F8N A;  4GRI A;  4EJU A;  2E7W A;  5JI6 A;  1LEA A;  5JVG F;  5HLI A;  1VQ5 I;  3G4S I;  4M6V A;  1LFB A;  1QHH D;  2CU7 A;  3GFL A;  4C30 A;  1WJD A;  2NVT J;  3QP6 A;  4RGR A;  2GQQ A;  1HF2 A;  2VBX A;  4IPA A;  3DP7 A;  1G3Y A;  1HST A;  5EJC A;  1GVD A;  4AU7 A;  3WTU C;  3HYI A;  4E7K A;  1AIR A;  4EM1 A;  3OAA A;  1VQ6 I;  3K10 A;  2DQR A;  2X6X A;  2PJP A;  2HYJ A;  2P7C B;  1R5G A;  2OD5 A;  2RQQ A;  3DKX A;  4UUT A;  5D4R A;  1WSR A;  3M4O J;  3LSK A;  3V8J A;  2DIE A;  5HLG A;  3S3M A;  5JMC B;  3BG7 A;  3FKI J;  4DNR B;  1IN6 A;  2Z3Y A;  2CH0 A;  2K9L A;  2JJ1 A;  2NOG A;  2RNJ A;  3U6K A;  1UD2 A;  4AM3 A;  4LLN A;  2OPT A;  3H3U A;  2HMA A;  1O8H A;  5HNH A;  1X1C A;  2V9P A;  3R0A A;  2K40 A;  1PYV A;  3M3Y J;  2IA0 A;  3IWZ A;  4O6J A;  3A01 B;  5JR3 A;  3I64 A;  4GDF A;  3T5X A;  2XRN A;  2ZXI A;  2BMW A;  1TZL A;  3BR2 A;  1QHG A;  3ZMD A;  3CO7 C;  3CME I;  4HST A;  3MFK A;  1H8E A;  5D8K B;  1UJ8 A;  2WY7 Q;  2K9N A;  3QPL A;  3ZQQ A;  4NB5 A;  4CUG A;  1XCB A;  1T6Z A;  2BVN A;  2W57 A;  4W1U A;  1OJL A;  2YU3 A;  4XLE A;  2TRT A;  1QBJ A;  5FD5 A;  2CYY A;  1DU6 A;  3LQE A;  2CWE A;  1AIP A;  2P5V A;  4V2F A;  1P9Q C;  3NAR A;  2R7D A;  2ZC2 A;  3ZN1 A;  2DU9 A;  3OY9 A;  2OQR A;  1N07 A;  1VQ8 I;  3E7L A;  2HS5 A;  4RAF A;  2QZA A;  1TUI A;  2PLF A;  2Q6K A;  1EF4 A;  5FLM J;  3HG9 A;  2VBM A;  1TWC J;  1DPR A;  3GVA A;  3GYH X;  2EZI A;  3GO5 A;  5TY0 A;  2YX4 A;  3MKL A;  2OF7 A;  3W2G A;  3JAM K;  1H8H A;  2R7S A;  2HGC A;  1W5C C;  1WKM A;  2Y0M A;  3LNN A;  3JAM Z;  3OS0 A;  3A03 A;  4BY1 J;  4W8T A;  1JTA A;  1PUF B;  5TGT A;  3DU1 X;  4G6Q A;  3MN2 A;  4KA4 A;  3ZQC A;  3N4M A;  1BL0 A;  2EIM H;  4A0X A;  1B1B A;  4ZDL A;  3SUC A;  2HFH A;  4HDV A;  2VIX A;  1CF7 B;  1JHH A;  2KKO A;  2VFP A;  4PC3 A;  1AKH A;  3WGH A;  4HWV A;  3RKY A;  3S32 A;  4CZC A;  2PIA A;  1WVR A;  4UV8 A;  4P55 A;  5J47 A;  3I71 A;  2MH2 A;  1QUF A;  3REO A;  1MJ9 A;  5FGM A;  5DV5 A;  4M73 A;  3SZG A;  1NB9 A;  3ZSC A;  1W5T A;  1QH0 A;  1BLI A;  3FM5 A;  2ELJ A;  5FKL A;  1JA0 A;  3V8K A;  1K9M D;  3CC2 I;  1N75 A;  2ZZF A;  2EV5 A;  3I59 B;  1D1C A;  1AHD P;  1H42 A;  1BBY A;  1MJA A;  2MW8 A;  3MVP A;  1XPX A;  4JMQ A;  4TMZ A;  1GQ8 A;  1BR4 A;  2BYV E;  3MHP A;  1HW5 A;  1XTA A;  2CFX A;  4RPB A;  3A4C A;  2VKD A;  4HEA 2;  3OYI A;  1RR8 C;  4ASN A;  4Y7C A;  2XPV A;  3GIR A;  3LJY A;  1JTX A;  1MIJ A;  4YDT A;  1BI0 A;  2DW4 A;  3FIW A;  1L1I A;  3GZN B;  1T6Y A;  1S5L C;  2JJ2 A;  4M3E A;  1MDM A;  1QGZ A;  1TBX A;  4LK1 F;  2RC6 A;  4A0Z A;  3HIF A;  2O8K A;  2LLK A;  1IAW A;  2VUM J;  2HQA A;  2MSY A;  2DO7 A;  2IS4 A;  2XGJ A;  4QPO A;  2QQB A;  4OM9 A;  2JA7 J;  1TYU A;  1W0T A;  2X3U A;  5F08 A;  4BBR J;  5LEJ A;  2D45 A;  4PAA A;  1YJ9 I;  2E71 A;  3MKZ A;  3V76 A;  1N8R D;  3JQP A;  4YFK F;  2GXG A;  4AF6 A;  2I1L A;  2R7Q A;  2L9N A;  3FHZ A;  4QHY A;  2D9R A;  3KET A;  3BG5 A;  5TRD A;  1IN8 A;  5J1Y A;  2D3L A;  2E1R A;  3OFN A;  3L2U A;  2FQ3 A;  1TNT A;  1FX7 A;  2O5R A;  4U0Y A;  2PMH A;  2Z9O A;  4A3D J;  1QU3 A;  2ODL A;  2XOK A;  2QYU A;  4W97 A;  5J4V A;  1W35 A;  4AD9 A;  3CJQ B;  2V5I A;  3BTL A;  2V7F A;  3JSP A;  3W6V A;  4LBY A;  2BV3 A;  3OZW A;  1FMV A;  3LWF A;  2WZP P;  1KD1 D;  1EA0 A;  3E5Q A;  3A35 A;  2FXA A;  3CCJ B;  1ZQ3 P;  1T08 B;  2F5C A;  2CJJ A;  3CF5 F;  1N0V C;  4ITV A;  3F6V A;  5M5Y J;  4P1V A;  3WWG A;  2CRV A;  5A2Q K;  2ZB9 A;  3D5S C;  1Q82 D;  4UZF A;  4ON0 A;  1LLZ A;  2RDP A;  4OOI A;  1S0U A;  2L4M A;  2DYS H;  4CYC A;  4FTH A;  4OJL A;  2CQN A;  4ETS A;  1Z1D A;  3VYT B;  4RS8 A;  1G59 A;  3JUR A;  4KN4 X;  2CUJ A;  5IYC J;  3B90 A;  4RMN A;  1I1G A;  2DCU A;  1BIB A;  3OIQ A;  5E17 F;  5B5E C;  3PO3 J;  2M4K A;  1O3Q A;  3KP4 A;  4Q48 A;  1VQ6 B;  1B2R A;  3JRI A;  1G7C A;  5ILU A;  4YAW A;  3UR3 C;  3OE7 A;  4XIC A;  1SD7 A;  1UMQ A;  2R7W A;  4KIT B;  3CUQ B;  1L3L A;  3I9V 2;  4PGG A;  3HPG A;  4PGH A;  1MBK A;  4RB1 A;  2FML A;  1K61 A;  3AG1 H;  1FY7 A;  4II3 A;  4LBW A;  1TYW A;  2ZCW A;  2VLA A;  3CUO A;  3M07 A;  1V5G A;  3QPT A;  2VNK A;  1SD6 A;  4WWC A;  3VWB A;  5E3O A;  3VSU A;  2LFB A;  3H94 A;  4E7L A;  4P26 A;  5IK2 A;  3VFZ A;  1W0J A;  1YX2 A;  2BBY A;  2PLY A;  1D5V A;  3CME B;  1DU0 A;  4RAZ A;  3CCV I;  1S7E A;  2VNH A;  2H6B A;  2XV4 S;  1ZG5 A;  2L02 A;  3JTH A;  5LHI A;  3I55 B;  4NC8 A;  5F64 A;  3FPK A;  3CC7 B;  3VEP A;  1CZF A;  3I0T A;  2BY0 A;  1EP2 B;  5GPC A;  1LFU P;  4PGO A;  1T33 A;  3CCQ B;  4Z4Y A;  3NAW A;  2JPB A;  1FSE A;  1PJ5 A;  4G6I A;  1IO2 A;  3DQV C;  4CGZ A;  1VQ8 B;  2XTX A;  3BWG A;  4UZE A;  4BHB A;  3IH3 A;  4LJZ F;  3PEN A;  2QM3 A;  2ZJ2 A;  4NC6 A;  5FL7 A;  5FRO A;  2HOE A;  3WTS C;  3OYH A;  1ITY A;  4OPW A;  4G7W A;  1I50 J;  2CND A;  2HQR A;  4RDJ A;  2K27 A;  2VFQ A;  3HOU J;  1N78 A;  1BI1 A;  1RUO A;  2F4N A;  3UW0 A;  1B8I B;  3SFZ A;  4I98 B;  2COB A;  1TTY A;  3TED A;  3NB2 A;  4G7X A;  3F22 A;  5EGO A;  1A04 A;  4G6D A;  4A3M J;  1B9M A;  1R58 A;  4XN0 A;  2MD0 A;  2OTL B;  3J7A Y;  2YWF A;  1ZRD A;  3EQL F;  2GWR A;  1BX1 A;  1FBU A;  2LD5 A;  3EUH C;  2O6G E;  1TT5 B;  3VSL A;  1R4N B;  2VJI A;  2YWE A;  1QRY A;  5EMN A;  3CC4 B;  4JBA A;  3E6B A;  3EUH A;  5FNZ A;  3J80 K;  3GX4 X;  1YOV B;  1YS7 A;  2JUG A;  2R3S A;  3VNU A;  3WGI A;  3PIP F;  2VBS A;  1QO0 D;  2WR8 A;  4HX7 A;  4XKW A;  4DYR A;  1E3H A;  4RLF A;  1MDM B;  3CC2 B;  2A5Y B;  2HEO A;  3B4N A;  3QOD A;  4OOV A;  4F93 B;  5AMV A;  4FX4 A;  4RB2 C;  2EV0 A;  1D1N A;  4F3Q A;  3W5V A;  4MTD A;  3EUK L;  2CV1 A;  5EEG A;  4PAB A;  5IYP A;  1A36 A;  4YG2 F;  2FBI A;  2VQG A;  1H0M A;  4B4C A;  4NNJ A;  4DW6 A;  3FMR A;  5LLQ A;  5F0H A;  2WZN A;  2ZXW H;  2AQE A;  2PJR A;  2GM4 A;  5GV8 A;  2DA3 A;  3CCS I;  2GIZ A;  1H9T A;  1UD3 A;  2IGN A;  3FXR A;  2F48 A;  3LA3 A;  3M1C A;  1QFY A;  5A89 A;  1Y0Y A;  3M8J A;  3P27 A;  1IZ1 A;  1HQC A;  2W84 A;  4Y4R A;  4BQQ A;  4BE1 A;  1IDY A;  3N6Z A;  2HVR A;  4PJN A;  4OAZ A;  2XF6 A;  3ZQH A;  2R5Y B;  5M3F J;  1EFU A;  3CMA B;  3F8B A;  3B02 A;  3RY8 A;  3DTE A;  5FLV A;  4W8Q A;  4HPQ A;  1X1B A;  4Q5S F;  2I8D A;  4Z4V A;  4HE5 A;  5EDN A;  1X1A A;  2W24 A;  3OW7 A;  1TT0 A;  2JTV A;  4CQJ A;  3OP1 A;  3E0J B;  5HLT A;  4EM0 B;  4A3G J;  4QVA A;  1W36 D;  1VTN C;  4DIQ A;  4NHJ A;  4A3I J;  1W2B B;  3HHG A;  3UKG A;  2G7U A;  2EA2 A;  2FOK A;  2JVH A;  5DCM A;  5TR9 A;  1IB0 A;  5GV7 A;  3IH2 A;  1N06 A;  1O8K A;  2VAS A;  3HC7 A;  2VE8 A;  3S93 A;  2L7Z A;  1J75 A;  3W2F A;  2JT1 A;  1MD0 A;  2X48 A;  4E7H A;  2W82 A;  3JR9 A;  5L3E A;  1U5T C;  1XB2 A;  3V7R A;  3H9J A;  1Z0X A;  1HOM A;  1SD4 A;  4G7O F;  1P4M A;  3U2Q A;  3ONU A;  1U5T A;  4MNU A;  2KZG A;  3A1P A;  1O7L A;  1DGR M;  2EK5 A;  2LMD A;  1WMR A;  1YRN A;  5F1J A;  4UAJ A;  1QRB A;  1T39 A;  2M9H A;  2K3P A;  5EZG A;  1E3P A;  3WG7 H;  4F7Z A;  4KIS A;  1YG2 A;  2BX6 A;  2DOA A;  4KT6 A;  4ZZL A;  1YLO A;  3RKX A;  1T98 A;  3WY9 A;  2DA1 A;  2UVE A;  2BOL A;  2RV8 A;  3CTA A;  4LG0 B;  1ERD A;  2ZL6 A;  1XQB A;  1ZEL A;  4CCO A;  1VQL B;  1TLH B;  2F5D A;  3K6G A;  4DK1 A;  3F21 A;  1I6X A;  2FRH A;  4DJA A;  3AFH A;  2CW7 A;  1HF0 A;  3A02 A;  1GAW A;  2M0C A;  2X6O A;  1IV8 A;  4LLL A;  3VMV A;  5CKT A;  1T95 A;  3A2K A;  1O8L A;  4QSH A;  4NUB A;  3M1E A;  1ZGJ A;  3J7Z I;  2YUS A;  4AIH A;  4CSW A;  2MBF A;  5AON A;  2EZK A;  2CGP A;  2WJV A;  1OCP A;  4HNV A;  3GTP J;  3SZT A;  2F43 A;  1BHE A;  1KCC A;  1Y6I A;  1R5O A;  2J8I A;  1Q7Y D;  1MRZ A;  4QIW N;  1ELO A;  3CCU B;  3CCV B;  5CVJ A;  4AF7 A;  1WSV A;  2Y31 A;  1FRQ A;  4Z1M A;  3H5R A;  2O7O A;  1YX5 A;  5D5X B;  2Q2E B;  5EF6 A;  2EFP A;  1V5E A;  3V8L A;  5GAH J;  2R93 J;  1SKQ A;  2FX0 A;  2ZME A;  5EGO B;  2E19 A;  3QYE A;  3BTJ A;  2YWH A;  4LGW A;  1KYW A;  5FKM A;  1R4M B;  2K9Q A;  2VNI A;  3AVT A;  2QSF X;  3FIS A;  1IXR C;  3H5A A;  1I1S A;  4DBR A;  2NVQ J;  3A3B A;  1UB9 A;  2HWV A;  4KH3 A;  2FE3 A;  4F7D A;  1DP3 A;  3FXO A;  2BY1 A;  4RM0 A;  3QSY A;  1MZB A;  3GQ7 A;  2N8G A;  2ZBU A;  2AS5 F;  1XGO A;  4F91 B;  4G6T B;  4LD5 A;  4P5O A;  4A69 C;  4RGX A;  4I84 A;  1OCZ H;  2VPR A;  1YE9 A;  3DU5 A;  2ZFU A;  5CVU A;  1VFC A;  5A88 A;  1TWH J;  2Z16 A;  3PVD A;  1EWY A;  1WXR A;  1HDD C;  2LRD A;  3VSK A;  2BY2 A;  1EP1 B;  5H59 A;  2VBV A;  2ELK A;  1SM4 A;  1VQ7 I;  3EET A;  1NHA A;  3BG3 A;  4G7H F;  2CO5 A;  3KLN A;  4I99 C;  1ZH5 A;  5LD2 C;  4IQJ A;  1FYK A;  1YW9 A;  4A6E A;  5BPI A;  1ZUN B;  1Y0U A;  3BR3 A;  3J7Y J;  3VR6 A;  1ONV A;  3AVV A;  1RR7 A;  1TYV A;  1O8E A;  2OK8 A;  1TC3 C;  2YU9 J;  1YHQ B;  2W00 A;  2KJC A;  1N0U A;  2ZZE A;  2BSP A;  1JT0 A;  3BJ6 A;  3AG3 H;  2NTQ A;  3W2A A;  2DMQ A;  1DGW Y;  1XG2 A;  3JU4 A;  4EVI A;  2F2E A;  2XAQ A;  2GRE A;  2ME0 A;  2MLG A;  5KHD A;  3G1O A;  4PMH A;  1P4X A;  4V19 K;  3ZIA A;  2UXX A;  3M7G A;  4XSX F;  5E1X A;  4MYU A;  4BDZ A;  3EYY A;  2BGJ A;  1TNS A;  2HU9 A;  1XDS A;  2QKL B;  4BKX A;  4BYY A;  3L2R A;  4QLC U;  3FBN B;  1OGI A;  3AVW A;  4DK0 A;  1V55 H;  4ZTJ A;  4M53 A;  3F23 A;  1XMX A;  4GO1 A;  4IF4 A;  5DCM B;  1EFT A;  3K1P A;  3BJA A;  1J09 A;  1OGM X;  2XC7 A;  1LEB A;  3CPW B;  4KYW A;  2H1L A;  4OAY A;  1JNY A;  4PDK A;  1V3F A;  3BQZ A;  2R5Z A;  3P4G A;  2DN0 A;  2VJJ A;  3LSH A;  5B6I A;  9ANT A;  1I3Q J;  4BEH A;  2XF7 A;  4EJW A;  2CRG A;  1SAX A;  3QFS A;  3JRG A;  2O3F A;  4OJ5 A;  1SVO A;  2EFO A;  4UVB A;  2HDC A;  2DQL A;  4EW9 A;  3IRQ A;  2KL4 A;  2OYN A;  4PUS A;  4XLH A;  1O8J A;  3ZMZ A;  2L4A A;  4BE0 A;  2DFE A;  3TDZ C;  2G9W A;  1PXZ A;  1DAB A;  4E70 A;  3A3G A;  3QFT A;  1FJL A;  2XKP A;  1U9O A;  3BQY A;  1HVX A;  1ZGW A;  2F1M A;  3LQQ A;  2XTY A;  3KFW X;  4M6Y A;  5EZH A;  1Q81 D;  4KMF A;  1O8M A;  2LKX A;  5JHU A;  3QPH A;  1H80 A;  5B1B H;  4U88 A;  2ZTG A;  3MKW B;  2XIG A;  3CO6 C;  1XE1 A;  2EJR A;  4CYD A;  1T0F C;  4OPV A;  2ICW G;  1Z7U A;  1KQ5 A;  4ZDP A;  3ISX A;  4Z6Y A;  3PUN A;  4UUV A;  1V5F A;  4RLZ A;  1L0O C;  5J40 A;  1T0F A;  2H1K A;  3RYP A;  2KRC A;  3AKZ A;  1KK1 A;  2UZK A;  1N08 A;  1Q1V A;  3SY2 A;  2X0K A;  2LBF A;  4EM2 A;  4BE2 A;  2XUB A;  2R9V A;  3WXM A;  2F4M B;  5LGU A;  2XRL A;  2DK8 A;  4AYB N;  4HF0 A;  3FPP A;  2HDW A;  2VQH A;  3IAS 2;  4RAY A;  4HSR A;  4U7B A;  4ABZ A;  1RWR A;  1P2F A;  1WDT A;  4HX4 A;  3KP3 A;  5DCF A;  4JYK A;  3S16 J;  2O1D A;  4UUS A;  1SVL A;  4Z06 A;  4OU0 A;  3HXL A;  1U9N A;  3FF5 A;  1EFR A;  4ZYE A;  3BT9 A;  4X8I A;  1VI0 A;  4P96 A;  4YII A;  1H89 C;  1OPC A;  1E1R A;  5LBQ A;  3R60 A;  1LB2 A;  1K4Z A;  1VQP B;  1VLO A;  1JTY A;  3B6C A;  4OIQ F;  2KIU A;  2DFH A;  4B48 A;  2CFO A;  1WOS A;  5IYB J;  2IAI A;  2R0Q C;  1E3O C;  3B6A A;  4P6V F;  1O57 A;  4DZJ A;  2R7F A;  1Y56 A;  3HKZ A;  2QSG X;  2CUF A;  1QA2 A;  4WF2 A;  3DPT A;  4B43 A;  2H6C A;  4Z03 A;  5H6Q A;  3WNB A;  5EG0 B;  1TVC A;  1UHW A;  3S8P A;  4U7D A;  2F5V A;  3W6J B;  1KZL A;  3R0J A;  1W5S A;  3ERE D;  1Z67 A;  1BI2 A;  2R7U A;  4YFO A;  4TT3 A;  4KN7 X;  2WA0 A;  1IUF A;  3KP2 A;  2NTB A;  1FP1 D;  3PFY A;  3B8Y A;  2DMU A;  1BPL A;  4HLY A;  2O9L A;  2QE7 A;  4BL0 B;  4L0Z B;  5FA6 A;  1JRG A;  2ZL7 A;  4RB3 C;  3HOS A;  2BVL A;  1UG0 A;  1F9N A;  3QAH A;  4IRG A;  2Z2S B;  4NBQ A;  3VYR B;  1B72 A;  1GR1 A;  2XND A;  1V0F A;  3CDI A;  4I7H A;  3LSM A;  5CLS A;  1Z91 A;  4BNC A;  3K69 A;  2BM7 A;  2CW8 A;  1O3T A;  5E6T A;  3ZMT A;  3WOD F;  4RA2 A;  4P3Y A;  4WZE A;  4RD2 A;  1RET A;  2EZL A;  2HPI A;  3LSG A;  1LQ1 A;  5C1C A;  3CCJ I;  4HF1 A;  1T38 A;  4UNO A;  1QQ1 A;  1ZM9 A;  1VQ7 B;  3GRH A;  2DPU A;  3U1D A;  3FMQ A;  4FET A;  3D0S A;  5C44 J;  2X51 A;  3L2W A;  1WJB A;  3ZXS A;  4OPO A;  3KPH A;  4X0G A;  1UFM A;  2P7V B;  1ZGA A;  1EJ9 A;  2M4G A;  1VF7 A;  1ETY A;  3W3C A;  3DLA A;  3BH7 B;  1WP6 A;  2XGD A;  4CXF A;  2B7E A;  2QN6 A;  2X53 S;  3Q9V A;  2KT0 A;  3LSP A;  1VQ9 I;  1JKO C;  4L0Y B;  3LQR A;  1PUE E;  1K83 J;  2DXI A;  2ZBV A;  2ZKZ A;  1QCX A;  2P5L C;  3GLX A;  1WSU A;  3OIO A;  1MSE C;  4RD6 A;  1WI9 A;  2V9V A;  3MD2 A;  5DTD A;  3JRB A;  1FOW A;  3GEZ A;  3KCC A;  2LKP A;  3ABT A;  2IEK A;  1QJV A;  1ZKG A;  3A0B C;  4Y15 A;  4M74 A;  1TW3 A;  5GP9 A;  1YW7 A;  3HSR A;  2M3A A;  2R7O A;  4I02 A;  2W1O A;  4RGS A;  4FE7 A;  2NS8 A;  2R5Z B;  4KKU A;  2ZZG A;  5IP6 A;  4E0F A;  3CPX A;  2LF8 A;  5GAE J;  1ACI A;  1YS6 A;  4CIC A;  3VOE A;  2XGX A;  1DPU A;  3S17 J;  3L2C A;  2RC4 A;  2VB6 A;  2ZXJ A;  4DOZ A;  1OHH A;  3C2H A;  5HS8 A;  3G05 A;  2EA4 A;  4GGG A;  3FX3 A;  4XON A;  5CVR A;  3ZZU A;  3H09 A;  1ON1 A;  1G7R A;  1A31 A;  2CC2 A;  2KRH A;  2GJP A;  5FIU A;  5J3O A;  2JA2 A;  1CLW A;  2OBP A;  4PJM A;  2V31 A;  1FOX A;  5HOO A;  4A2U A;  4X06 A;  4L9T A;  4IVN A;  1KK0 A;  4I6Z A;  3I55 I;  4HLX A;  3CC7 I;  1VLY A;  3G71 B;  5E20 A;  2O61 A;  5DD4 A;  4M2L A;  2PBI A;  3IUO A;  3CCQ I;  3RIQ A;  3LSI A;  3RSN A;  1E79 A;  1OQY A;  4G9Y A;  4ZGN B;  4D5C A;  3DU6 A;  1FC3 A;  3O8G A;  3WTT C;  1D0Y A;  5HDG A;  3SLD A;  1XD7 A;  2VFO A;  1KTW A;  3LFU A;  3AG2 H;  2CW5 A;  3I56 B;  3VO1 A;  2YS9 A;  4OIP F;  1E3X A;  1HZE A;  3HTU A;  2L54 A;  1K8A D;  1WOO A;  3SXY A;  3OYN A;  3KZI C;  3HUG A;  4C9Y A;  1MMD A;  2M5S A;  4BH9 A;  3GFI A;  1GHC A;  1HA8 A;  3KX2 A;  4ZYH A;  4H4K C;  3BZC A;  4PJL A;  3RPU D;  2OTL I;  5JFR A;  3BR0 A;  4RPD A;  3WTZ A;  3VO2 A;  1IRZ A;  2IS6 A;  3W2E A;  3KLO A;  5HS9 A;  3B78 A;  2QA4 B;  3EYI A;  4KFC A;  4L18 B;  1R9T J;  2C5B A;  3CC4 I;  4EGY A;  5ERI A;  1I27 A;  4U0V A;  3MWM A;  1LVK A;  1G2H A;  5HZB A;  2M87 A;  3SKB A;  2DMP A;  1XMA A;  4RDK A;  1K4T A;  3Q5F A;  5BMZ A;  1Z21 A;  2PMD A;  5CVV A;  3GXO A;  1MBG A;  1CGP A;  4IL6 C;  1R00 A;  3AAF A;  2DMN A;  2QUF A;  2WAQ A;  1ZN2 A;  3ZGK A;  1F4K A;  3U21 A;  3WND A;  1KQ0 A;  2NNN A;  3TL4 X;  4IHS A;  3W2W A;  3LQ6 A;  1S4M A;  4LLG F;  1P6R A;  5FB2 A;  3NWT A;  3DTK A;  3Q3S A;  4WZL A;  1ZR2 A;  4E7I A;  2CF4 A;  2V1U A;  4GXO A;  1UHM A;  4Z2Y A;  2VBK A;  3ZP5 A;  2K9S A;  4BAC A;  2F6C A;  4HBL A;  5FKO A;  3UNG C;  2EWE A;  3N90 A;  2ELH A;  2VNJ A;  4OIN F;  5KNL A;  1O8I A;  3Q3A A;  3S3O A;  1T2K A;  2GK6 A;  2E1M C;  4MQV A;  3TOB A;  4PK4 A;  2BM5 A;  4NC7 A;  1FNM A;  1OB2 A;  2ZO4 A;  1B72 B;  2F1L A;  1GT0 C;  3GZ6 A;  1U8R A;  2OQG A;  3WU1 B;  3H9Q A;  5K7H A;  3R61 A;  4E7Z A;  3BH6 B;  3HL2 A;  2EV6 A;  3QPS A;  1M1K D;  1GAQ A;  4RJL A;  2WB1 A;  1NHC A;  4AWX B;  3CMA I;  4B3F X;  1P92 A;  2GA1 A;  3K0L A;  4KKS A;  4D7N A;  4ZCI A;  2XRO A;  2LZJ A;  3RTR A;  1DDG A;  3SQN A;  2CQQ A;  2P5K A;  4Y9R A;  4CDG A;  2EH3 A;  3JRD A;  1PDN C;  2ECC A;  3W6K B;  3S15 J;  2D74 A;  3K1M A;  2RQP A;  2IVM A;  1ULY A;  3S14 J;  3OEH A;  2QYO A;  2VT2 A;  2JK3 A;  3G1M A;  3H5N A;  1ZRE A;  2G0Y A;  2QY1 A;  1PLU A;  4KIG A;  1Z3Y A;  3ONQ A;  1QA6 A;  2ADU A;  1G3W A;  2L7F P;  3T1B A;  4IEJ A;  1BW5 A;  2OZ6 A;  4E7S A;  4IW3 B;  3LMW A;  4YZX A;  3MKY B;  1Y39 A;  2B63 J;  3KE2 A;  2E1B A;  2VJ4 A;  4RAG A;  5HKK A;  2PYG A;  1QUE A;  4WXH A;  5AN9 A;  2NXN B;  1K8F A;  1IDZ A;  5A2Q Z;  1JUM A;  4U0W A;  4C43 A;  3MQ0 A;  2M1B A;  1ZG3 A;  3LAJ A;  2BW3 A;  2V26 A;  4FAS D;  2V7Q A;  1IDK A;  3DFG A;  4PZJ A;  2VKE A;  2M0M A;  2E5N A;  3OR2 C;  1BC8 C;  2PMZ A;  3BZK A;  3I4M J;  2PI0 A;  4ZH4 F;  4ZCM A;  2DA7 A;  2HTS A;  4F52 A;  3DCF A;  1VQ9 B;  2NZM A;  3GVK A;  3QOP A;  5DS9 A;  3AGP A;  4XMY A;  4CCJ A;  4A3L J;  2PFB A;  2K86 A;  3BH4 A;  2BEO A;  2GA2 A;  3HBL A;  5F6F A;  3VDX A;  2DER A;  1ZR4 A;  3K4N A;  4WX9 A;  1VQL I;  1GLN A;  5BS6 A;  1RU4 A;  2ZSH B;  3OOC A;  2OAZ A;  2XAU A;  1SVM A;  1QRC A;  4BQO A;  2EQR A;  1G8X A;  4NDL A;  3K4B A;  2X1E A;  3RPQ A;  1E63 A;  1IXC A;  3AVY A;  1MBE A;  2GPJ A;  1COW A;  3DF8 A;  1LPQ A;  1RRJ A;  2QVO A;  4RLQ A;  5J6X A;  3H3V K;  4W8S A;  4IX7 A;  1N77 A;  3BJO A;  4DZP A;  4BJ6 C;  2HDN B;  2V7U A;  2NPF A;  2XGC A;  3AL0 C;  4S0H B;  4C3J J;  2IGK A;  2NT6 A;  3LST A;  3WBK A;  3C7J A;  2JUC A;  3FDY A;  2EZH A;  3O6B B;  3OS1 A;  2KDZ A;  3BY2 A;  1YIT B;  3CCU I;  1JJ6 C;  1MND A;  2VT3 A;  5BSY A;  4UB6 C;  1F20 A;  4IQ4 A;  4DNC A;  4B09 A;  3SDB A;  1QFJ A;  3WU0 A;  4LIV A;  5LEK A;  2NTP A;  2BVM A;  1HG8 A;  1P7J A;  2DDB A;  3CQZ J;  4ACA A;  2QQ9 A;  1VQ4 B;  4W8R A;  3HRM A;  3SHF A;  4IOA F;  4B3A A;  1B4A A;  5BQT A;  5L3B A;  3GSI A;  4TMV A;  3ZZ0 A;  4QPQ A;  1U78 A;  4KKT A;  3SYT A;  4FK8 A;  3E5X A;  3HOY J;  1JHF A;  2ME6 A;  1AKH B;  1FNC A;  3ZMV A;  3P5J A;  2NAZ A;  3ABK H;  4OPS A;  3K4L A;  3DKW A;  3BPX A;  4I0A A;  1REP C;  5C1E A;  2P8T A;  1FIA A;  3U1K A;  2HNH A;  4KDP A;  2XAJ A;  2VFM A;  4BXU A;  2XHK A;  3T53 B;  3PFI A;  4Z4U A;  2LY9 A;  5B3S H;  2VKV A;  2ZZQ A;  2FD5 A;  3TW6 A;  3T0Y A;  3DLL F;  5DS0 A;  2P6S A;  2WAD A;  4NBS A;  1WJC A;  2K4J A;  4G94 A;  2KQR A;  2E2J J;  4C3H J;  3WYA A;  4M9Z A;  2M34 A;  3PQJ A;  1J5Y A;  4ZCL A;  3A1Y A;  1KZH A;  2ZJQ F;  1Y8R B;  3R6K A;  4TMX A;  2P4W A;  1VND A;  4EMS A;  1EZG A;  2CMP A;  2B9S A;  4OWR B;  3BY6 A;  3CLQ A;  4BJT A;  2QX3 A;  3SQV A;  1VQO B;  1JI8 A;  1ORK A;  3P9K A;  3U6B A;  3SEJ A;  5CQE A;  1IG7 A;  3B82 A;  2L7M P;  3TOA A;  4DYQ A;  3J80 Z;  1F5T A;  1F1Z A;  3HKZ N;  3OOU A;  2XF5 A;  1HLV A;  2L9S A;  1RQR A;  3OKX A;  1SFX A;  4UZU A;  2B0R A;  2KIQ A;  1X3U A;  2EPF A;  3GCM A;  2VL8 A;  1WI3 A;  4GCV A;  4MGR A;  4Z4W A;  1YHQ I;  4OOX A;  1FWZ A;  4X0C A;  5GTI C;  2INV A;  3V7C A;  4XLC A;  4LIU A;  2DOG A;  3DXJ F;  4P6Y A;  1R5I D;  3ZPL A;  2WYR A;  2L0K A;  1UAA A;  2ISZ A;  1R1T A;  5FRN A;  3HHH A;  5FLX K;  5JBQ A;  4AC0 A;  1TQP A;  4ZYD A;  2Z99 A;  3VMF A;  3C18 A;  5FLX Z;  1QPM A;  3TQN A;  3WE3 A;  3GTG J;  2EFW A;  5K7Z A;  4BS9 A;  2OUM A;  2QEX I;  2CV2 A;  2PEX A;  4L9N A;  1B59 A;  2M7B A;  5KAI C;  1O3R A;  1NRK A;  1QG0 A;  1ZAR A;  3K70 D;  2H27 A;  3OJX A;  2WV0 A;  4LG3 A;  1IA5 A;  2X9D A;  1K73 D;  5KW9 A;  2JN6 A;  3V4G A;  2ZJP F;  2BE5 F;  2I5U A;  2VJ5 A;  2R7V A;  4M9X A;  1TSP A;  4C0S A;  1PE9 A;  5DEQ A;  3HRS A;  1VJS A;  3OIP A;  4OIR F;  1KRH A;  3PNY A;  1ZRF A;  1H9G A;  4P3I A;  1E2X A;  4M1K A;  2IA2 A;  4DBQ A;  2VBT A;  1W7P A;  4Z4T A;  4OZZ A;  2FNA A;  1ETV A;  2IRF G;  2GZW A;  4ENM A;  2A61 A;  2Y9Y A;  5F4O A;  4HG2 A;  4L9V A;  4ESJ A;  4YEL A;  4LBV A;  4PSW A;  1LDK B;  3JRA A;  3PUF A;  4KNY A;  4ZGQ B;  4CYC B;  1B9N A;  1HKQ A;  1G3S A;  4UVA A;  1QVU A;  4NK6 A;  4G1V A;  2O0V A;  2KIM A;  2O17 A;  3CES A;  2XT2 A;  1TLL A;  2NS0 A;  3RJP A;  2ISY A;  3WTW C;  2NOJ B;  2RNG A;  1H88 C;  3BCD A;  2JJ7 A;  1BI3 A;  2V9K A;  3LL7 A;  1OYI A;  3Q6Q A;  1RKW A;  2VKH A;  2DYI A;  1W9X A;  2LSO A;  1ODD A;  1Y0N A;  1D1A A;  4B1R A;  2HOA A;  2V7W A;  4QV2 A;  3IAM 2;  1KMH A;  1KTV A;  4L8J A;  3W5H A;  3CD6 I;  4CCL A;  3OV8 A;  1WOR A;  2Z33 A;  3LMM A;  2E2H J;  4LBZ A;  5FD6 A;  4N0B A;  3WG9 A;  2D5V A;  4XR6 A;  1KU2 A;  2GLO A;  3W2H A;  2KRF A;  4A5N A;  1QQI A;  2MGQ A;  1EXM A;  3GTJ J;  4M3B A;  3QFC A;  5LFA A;  3ISP A;  1WFX A;  2JA6 J;  2WTE A;  3NAU A;  1K4S A;  2L3D A;  1O8F A;  5EEH A;  4DYC A;  4HQM A;  2GOM A;  2HTJ A;  3JQR A;  2GJR A;  5D5V B;  2O8X A;  4X1E A;  3TO7 A;  3S1R J;  3AL0 B;  4QUZ A;  2X8K A;  2NST A;  3P7N A;  1GO2 A;  2K02 A;  3OYA A;  3OYJ A;  3CJN A;  3GVL A;  1Y1W J;  1YIJ B;  4KT5 C;  3RIR A;  2JMW A;  1MBF A;  2GOX B;  4L5I A;  1TTT A;  2QZ8 A;  4DQK A;  5J35 A;  1AMO A;  3IL2 A;  3BCA A;  2QSH X;  4B3G A;  1QZZ A;  4P2N A;  4S05 A;  5IT9 K;  1IDJ A;  1VQP I;  4U9U A;  3CCR I;  2YR2 A;  3Q0W A;  1BR1 A;  2UUZ A;  4HZF A;  1FTT A;  2IS1 A;  3OYK A;  4H0E A;  2QCO A;  4OP7 A;  3I4P A;  3V42 A;  2ZME C;  5GAD J;  1A8P A;  2G7H A;  2PYH A;  2BPO A;  3K2A A;  2IP2 A;  1ETQ A;  1QPI A;  3JSO A;  2JZY A;  3CMY A;  2QDX A;  4TN1 A;  2ZBK A;  4P9F A;  2CBX A;  4HQE A;  1WRJ A;  2K85 A;  4RD0 A;  5J3L A;  5DM6 F;  4AVP A;  5FRM A;  2RC5 A;  3I4N J;  1O8D A;  2LKS A;  2V79 A;  1TW2 A;  1Z77 A;  4MTE A;  1S7A A;  2DK5 A;  4NQW A;  2XDV A;  3KP7 A;  4ESF A;  3OYM A;  3E1Y E;  3SEZ A;  5D8L B;  3K7A J;  1BN5 A;  4MR0 A;  1JXS A;  1DDN A;  4WCG A;  3JW4 A;  2XAS A;  3FKS A;  2E60 A;  3ABL H;  4OMZ A;  4B8X A;  4C3I J;  1KGS A;  2Q6O A;  2V7X A;  1K78 A;  3CP8 A;  1W34 A;  4B4D A;  4CCM A;  3RPU A;  1WJF A;  3E5U A;  3RQ4 A;  2ZNZ A;  3PUM A;  4YXW A;  4EJV A;  1Q86 D;  2GAU A;  4ROX A;  2AQF A;  2WAQ N;  3CP2 A;  2OBT A;  3CJT B;  3IRR A;  1S72 B;  1GVH A;  4YEJ A;  4OZY A;  4Y13 A;  3GTO J;  2HLD A;  2AO9 A;  4ZJZ A;  3BG9 A;  2A05 A;  2Y30 A;  4C2M J;  2OA4 A;  4LOC A;  1AWC A;  4I2O A;  4EAT A;  1XX5 A;  1EP3 B;  1M1E B;  5F27 A;  5BPD A;  1WH7 A;  1NH3 A;  2G0E A;  1GV5 A;  2PJR B;  4IHT A;  1W4M A;  2LC2 A;  2CK3 A;  3CCL B;  4EGZ A;  3MMY B;  2UXN A;  1T8I A;  1JUS A;  3BR5 A;  1W0K A;  1LE8 A;  5E18 F;  1U2R A;  1OFC X;  2BHZ A;  3P26 A;  2XPU A;  3FWE A;  4FCY A;  2EFN A;  3W2I A;  3QYB A;  5IP7 J;  2CUZ A;  1OFD A;  2YUH A;  4Z4Z A;  3HB9 A;  5EEA A;  2ESN A;  3AK5 A;  2DOD A;  2IS2 A;  3G6E I;  3KYL A;  4D0P A;  2QBY A;  4O5V A;  1QZE A;  1SFU A;  1XGS A;  1X4O A;  2E1N A;  2K9M A;  2VQL A;  3BNW A;  1K7A A;  5HNF A;  4YAL A;  1ZG1 A;  1IN4 A;  1MMG A;  2FJ1 A;  4DQ2 A;  2VOP A;  2QEX B;  1HKT A;  3C3W A;  1G6N A;  3L00 A;  1XN7 A;  3JRC A;  1KK3 A;  3BCF A;  4N3N A;  4TMT A;  1XGM A;  1JKR C;  2XAF A;  1Y0R A;  4ESB A;  1HW2 A;  1A5J A;  1X4P A;  1S8N A;  1E62 A;  3RZO J;  1NK2 P;  1V5V A;  3I54 A;  5DYM A;  2P0W A;  1SAN A;  4KIB A;  4A3C J;  4IHV A;  1AA7 A;  5DUK A;  3D5R C;  2QGU A;  5THX A;  3QQA A;  1R6R A;  3TO9 A;  3OS2 A;  1H85 A;  2OV7 A;  1R23 A;  1H8A C;  2GK7 A;  2VFN A;  3U9G A;  1MJB A;  1X3W B;  5K5Q A;  3LSR A;  4IOC F;  1HC8 A;  2QGG A;  4P9U A;  1ON2 A;  5JLX A;  2P6T A;  3G71 I;  2W7Z A;  4XK4 A;  3ZQ7 A;  4HE6 A;  4M4S A;  2M7A A;  4LB6 B;  5DN6 A;  2C4U A;  5JVT A;  1U5T B;  4I01 A;  2NVX J;  3PUB A;  3TKY A;  1D1B A;  1OKR A;  5J8F A;  3HOZ J;  1YRN B;  4MYT A;  1TQM A;  2WWY A;  1SFE A;  1BJZ A;  3ASN H;  5B1A H;  3I56 I;  2WV1 A;  2DA5 A;  3BZ6 A;  5IOY A;  5IP9 J;  1O4X A;  5K7F A;  4PJ0 C;  1QVF B;  3GZ5 A;  4EH1 A;  4B3X A;  1SD5 A;  2LR8 A;  2O0Y A;  1N05 A;  4FXU A;  3BLY A;  1OFM A;  2HQN A;  1POG A;  4Q7J B;  5IT3 A;  2H09 A;  3JQQ A;  3CD6 B;  4NCN A;  1F60 A;  2FUG 2;  5FJ8 J;  5K5R A;  4A3E J;  2M30 A;  1ETW A;  4U49 A;  2MD5 A;  4G5G A;  2JVG A;  3Q38 A;  1ZM3 A;  5HXB A;  3LNQ A;  1YJN B;  2QA4 I;  4TKO B;  1IC8 A;  3HGG A;  3Q9S A;  4V02 C;  2UV1 A;  1IW7 F;  4A0Y A;  3DWL E;  5CQG A;  2PG4 A;  2JN9 A;  4PCQ A;  2ECB A;  3SFI A;  3E3V A;  3ZMS A;  3T8R A;  5CVI A;  1ZHF A;  2BM4 A;  5FO1 A;  5M3M J;  1JKP C;  1YQA A;  2NSP A;  1KYZ A;  1TP4 A;  2W25 A;  3F8F A;  4R71 A;  1P4A A;  1R49 A;  2R7Z J;  2V7V A;  2W6J A;  2X3H A;  4A93 J;  1QA1 A;  4XLF A;  3CMM A;  3D26 A;  4CH7 A;  1XG1 A;  4GYG A;  4MO7 A;  3GTM J;  3J7A O;  3ZQG A;  2V4D A;  1Y8Q B;  2ZME B;  1TWG J;  2LH9 A;  2AXT C;  4G1B A;  3VMW A;  4EEF G;  4YIF A;  1ZRC A;  3CCR B;  4C2T A;  3ZR8 X;  1MBJ A;  1BC7 C;  4KUM A;  1W87 A;  4XNF A;  3GVJ A;  2D2W A;  2TDX A;  1VQN I;  1PUF A;  1Z6R A;  3VOD A;  4YCQ A;  4YAF A;  1Z3X A;  3F8C A;  1FEX A;  2ZNY A;  1STZ A;  1A6I A;  3K4C A;  1PKV A;  1OCR H;  4FQG A;  1WHU A;  1T6S A;  1CF7 A;  1S3J A;  5B66 C;  1OFE A;  2A3S A;  1NBM A;  1RKT A;  4YZA A;  3GBG A;  3GQA A;  1XCV A;  3RKQ A;  2QXZ A;  5E3N A;  1J7K A;  2IPQ X;  1C0W A;  3RQI A;  4TMW A;  2Y48 A;  2JSC A;  2B0L A;  2DT6 A;  1XSV A;  3O8H A;  2BF4 A;  1XC5 A;  2JIZ A;  2KZV A;  2DET A;  2Z5U A;  4YFN F;  1R5B A;  3SEQ A;  3N05 A;  3I58 A;  3L2Q A;  2DOF A;  5J1U A;  1FTZ A;  3CB4 A;  2KIS A;  4AIJ A;  3BY1 A;  3ESW B;  2Z8G A;  3DPL C;  1KCD A;  5D6E A;  1O88 A;  3GQB A;  4BHC A;  2JA8 J;  3PO2 J;  1JA1 A;  2X6Y A;  3CCE B;  3H92 A;  4TV7 A;  2L9V A;  2JWT A;  3CCM B;  3ZN0 A;  5J8C A;  1R1V A;  4YZQ A;  2HCJ B;  2QEN A;  2HVS A;  1JB9 A;  1OYY A;  2DJI A;  3T8T A;  5H5J A;  2LF7 A;  2DFI A;  2QBY B;  3O2P E;  1GUU A;  4BAY A;  1E17 A;  1K5C A;  1FNN A;  4OIO F;  2WSS A;  4HNU A;  2DYR H;  4WWV A;  2H8W A;  2LNB A;  2JDI A;  2F4I A;  2YPR A;  3FXL A;  4EJO A;  5LHG A;  2ID6 A;  1T5E A;  4BPR A;  1YTY A;  4S04 A;  4DQL A;  3RZD J;  2JA5 J;  5H6R A;  1W0U A;  1FOK A;  4FIS A;  3PSF A;  3T9G A;  2LG4 A;  3WTX C;  1I8D A;  2OTJ B;  4ZYA A;  1R5H A;  3PNV A;  3G6E B;  1OR7 C;  3LSJ A;  3FK6 A;  1UEL B;  1B6A A;  3CJR B;  2XAH A;  4RDU A;  1KJZ A;  3FJO A;  4JK1 X;  1OR7 A;  3K70 C;  1J9I A;  1QGY A;  3ASP A;  1D2E A;  1VHE A;  4N9I A;  2M8E A;  3CCY A;  2A07 F;  2FEZ A;  3BQJ A;  1FSH A;  3SJZ A;  3OZU A;  1BW6 A;  4BEH B;  1RES A;  1BA5 A;  3BDD A;  5HS7 A;  4D7M A;  1UHS A;  1NDH A;  4XKB A;  3H9N A;  2AHQ A;  4A5M A;  3HZJ A;  1JUP A;  1SMY F;  4MLO A;  3GQ9 A;  5L3D A;  4PC6 A;  1AU7 A;  2JSP A;  2FA5 A;  1WWX A;  3JRE A;  5FO0 A;  2QTL A;  3CDL A;  3ZRG A;  1AOY A;  3MMP A;  5TIS C;  2QLZ A;  2X0L A;  1FDR A;  2XGE A;  1W36 C;  1YIT I;  3ZUG A;  4ZYG A;  1B23 P;  5JHF A;  3X2Q H;  2R7R A;  1RMG A;  1I6H J;  4XD7 A;  3IHU A;  5ICE A;  3K2Z A;  1HBX G;  4R79 A;  1BN8 A;  4RB0 A;  4M9S A;  4HA8 A;  3E6D A;  1MSF C;  1YW8 A;  3F3X A;  1VQ4 I;  1WJE A;  1FZP B;  1KA8 A;  2FVG A;  1QVT A;  4AUX A;  2W6I A;  1KQS B;  4M72 A;  5CDF A;  2EIJ H;  1CNF A;  4RD1 A;  2NV4 A;  2MC4 A;  4N3G A;  1HSJ A;  1LDJ A;  4JX6 A;  4LIT A;  4XLN F;  3ELK A;  4A12 A;  1UG2 A;  4KMU X;  2F5E A;  3QYF A;  4YFX F;  1S6L A;  2XAG A;  5LHH A;  3CUQ C;  2QQA A;  4UHT A;  2LBF B;  1EV7 A;  3NWS A;  4MEY F;  3OYL A;  1DUX C;  4IKF A;  3HRT A;  3CUQ A;  3AVX A;  4BQA A;  1LFP A;  3M8F A;  5E79 C;  1OGJ A;  2D1V A;  2R7T A;  4UXN A;  4J00 A;  5LRR A;  2EIX A;  3OYG A;  5H20 A;  4M3F A;  4UUS B;  4HDU A;  1PJR A;  4FWT A;  1ETK A;  4EV0 A;  5E1Z B;  3LOC A;  3SDG A;  4ANJ A;  1DDI A;  2W7N A;  2O6W A;  1FP2 A;  2Q6L A;  1K79 A;  4Z4S A;  1APL C;  4RM3 A;  4RM2 A;  3L9F A;  1USS A;  4HYE A;  1D3Y A;  2LOO A;  4BHP A;  2DI3 A;  5KAF C;  3KEY A;  1E3Z A;  3OYB A;  5J4Y A;  1UD5 A;  5K1Y A;  1XS9 A;  3LA7 A;  4Y9U A;  1KON A;  3ML3 A;  3HSF A;  5LMZ A;  1QA3 A;  3TP0 A;  2XZL A;  2J5P A;  1OCC H;  1VQO I;  3OPO A;  2PEC A;  4JP0 A;  1NG6 A;  1QX4 A;  3ZQI A;  4AID A;  4WXD A;  3S2D J;  1ZM2 A;  2KHM A;  4M0L A;  2E7X A;  2Z1D A;  3HAG A;  2VBU A;  4PFP A;  3AGQ A;  1LVA A;  3H0G J;  4RBO A;  2C4T A;  2DJN A; 
#chains in the Genus database with same CATH homology
 4BU2 A;  2ZZQ A;  1V5E A;  1YX3 A;  4XOT A;  3OR1 C;  2WAD A;  3QYE A;  1WJC A;  4XKC A;  2HVQ A;  2KQR A;  3OWT A;  4P22 A;  3H5A A;  3A1Y A;  1WPC A;  4DBR A;  1E43 A;  3A3B A;  2KDO A;  2CMP A;  2ZSI B;  3S3N A;  4OWR B;  4BJT A;  1S9H A;  2KPM A;  1DP3 A;  2KVO A;  2QX3 A;  4U4B A;  1JI8 A;  2MFZ A;  3VYS B;  5CQE A;  3GQ7 A;  2QKM B;  3OOU A;  3F9K A;  1EA3 A;  2XF5 A;  2L9S A;  4BQN A;  4CCN A;  4YRV A;  4UZU A;  2KLO A;  2VL8 A;  4F91 B;  4G6T B;  4P5O A;  2WY8 Q;  2IQ7 A;  2O04 A;  4I84 A;  1YE9 A;  3DU5 A;  2ZFU A;  2INV A;  4XLC A;  2Z16 A;  3OYC A;  4TSF A;  2IXS A;  4LIU A;  4DGW B;  2LRD A;  3VSK A;  2INU A;  4OJ6 A;  2V4J C;  4PJJ A;  1UAA A;  5FRN A;  1WTH D;  4CA0 A;  2VPL A;  2LY2 A;  3ZPN A;  3FBI B;  5LD2 C;  4IQJ A;  3TMO A;  4BS9 A;  2OUM A;  2CV2 A;  4C2U A;  1DQU A;  1NRK A;  2M7B A;  2CV0 A;  1MMA A;  3VR6 A;  3K70 D;  4XN3 A;  4II2 A;  4DNT B;  1O8E A;  1OLT A;  4LG3 A;  1K28 D;  1IA5 A;  2W00 A;  3OL4 A;  2ZZE A;  2BSP A;  4AVZ A;  2VJ5 A;  2R7V A;  2NTQ A;  3W2A A;  1PE9 A;  1DGW Y;  1XG2 A;  4N4N B;  3OIP A;  2IGM A;  1VJS A;  3JU4 A;  1IRX A;  1SAU A;  3PNY A;  1OGO X;  4F55 A;  3RCO A;  2X1D A;  5KHD A;  1Z7L A;  2KP6 A;  4DBQ A;  4PMH A;  4Z05 A;  4OZZ A;  4B47 A;  3CZ6 A;  4HNT A;  3ZIA A;  3T51 B;  1D0X A;  1MNE A;  4BDZ A;  4E4H A;  4HG2 A;  2HU9 A;  2XZO A;  1DBO A;  2W4S A;  4YEL A;  2QKL B;  4GRI A;  1LDK B;  4JQF A;  4PSW A;  1OOC A;  2L7K A;  3L2R A;  4MXN A;  4NK6 A;  1QHH D;  3FBN B;  2DCE A;  4C30 A;  2VQC A;  4DK0 A;  1WJD A;  2O0V A;  2O17 A;  3CES A;  4ZTJ A;  2NOJ B;  2RNG A;  1OFL A;  4AU7 A;  1J09 A;  1OGM X;  2XC7 A;  4E7K A;  1AIR A;  3OAA A;  3BCD A;  2V9K A;  3K10 A;  4OAY A;  2X6X A;  3D5L A;  3LL7 A;  2ZTN A;  2VKH A;  2RQQ A;  2VJJ A;  3DKX A;  3LSH A;  1W9X A;  3LSK A;  4BEH A;  2XF7 A;  1D1A A;  2DIE A;  3IAM 2;  3S3M A;  3BG7 A;  1KMH A;  2R4G A;  4L8J A;  4DNR B;  2JJ1 A;  2CH0 A;  2K9L A;  4CCL A;  3HOT A;  4OJ5 A;  3LMM A;  1UD2 A;  4EW9 A;  2KL4 A;  4PUS A;  4XLH A;  1O8J A;  1O8H A;  5HNH A;  1X1C A;  4XR6 A;  1MW7 A;  1PYV A;  4BE0 A;  1PXZ A;  3A3G A;  5LFA A;  4N4O B;  1HVX A;  1WFX A;  2ZXI A;  4C2L A;  1TZL A;  2F1M A;  1QHG A;  4HST A;  1H8E A;  1O8F A;  2WY7 Q;  2GOM A;  4ZC3 A;  3ZQQ A;  1O8M A;  4CUG A;  2GJR A;  1H80 A;  2X1C A;  3AL0 B;  4XLE A;  2GJK A;  3HUG B;  3H0D A;  2Y0S A;  3MKW B;  2X8K A;  2ZTG A;  2NST A;  3OYA A;  3OYJ A;  3GVL A;  1T0F C;  1MAB A;  1P9Q C;  4URR A;  3OY9 A;  4ZDP A;  2GOX B;  1V5F A;  4OJO A;  3BCA A;  4B3G A;  2KRC A;  3AKZ A;  3E1S A;  4JOM A;  1IDJ A;  3HG9 A;  2VBM A;  4XOR A;  2LBF A;  1FMW A;  4BE2 A;  4AYB A;  2R9V A;  3OEE A;  1BR1 A;  2UUZ A;  3FPP A;  2HDW A;  2R7S A;  1H8H A;  2VQH A;  2X85 A;  2OC6 A;  3IAS 2;  2IS1 A;  4HSR A;  3OYK A;  4U7B A;  1RWR A;  3LNN A;  3OS0 A;  2O1D A;  1JTA A;  4W8T A;  5TGT A;  3V42 A;  2PYH A;  4Z06 A;  3HXL A;  3SUC A;  4ZDL A;  2VBE A;  1EFR A;  2VIX A;  5FRM A;  1E1Q A;  4Y33 A;  1O8D A;  1E1R A;  4HWV A;  3S32 A;  4CZC A;  2XDV A;  3FY3 A;  3OYF A;  3OYM A;  3G2B A;  3SEZ A;  4MR0 A;  4B48 A;  2CFO A;  2X6W A;  3FKS A;  2E60 A;  3SZG A;  3ZSC A;  1Y56 A;  3HKZ A;  1BLI A;  3PJR A;  3CP8 A;  2ELJ A;  3DPT A;  1UD4 A;  4B43 A;  4NK8 A;  1N75 A;  4CCM A;  2ZZF A;  2LYC A;  4Z03 A;  1WJF A;  1D1C A;  3RQ4 A;  4YXW A;  3DDY A;  3S8P A;  2AQF A;  4P1W A;  2F5V A;  4JMQ A;  3CP2 A;  1KZL A;  3VYU B;  1GQ8 A;  1BR4 A;  1D0Z A;  4KJZ A;  3ZPP A;  2R7U A;  2E1M B;  3EQO A;  1VZ0 A;  4YEJ A;  3A4C A;  2WA0 A;  2VKD A;  4HEA 2;  2WAE A;  3OYI A;  4TT3 A;  4OZY A;  2HLD A;  4ZJZ A;  2NTB A;  3B8Y A;  3PFY A;  1BPL A;  2QE7 A;  4BL0 B;  3DKY A;  2JJ2 A;  3K4K A;  4EAT A;  1OB0 A;  2ZXH A;  2WPD A;  1JRG A;  4BJ5 C;  3HOS A;  2PJR B;  2BVL A;  1UG0 A;  2CK3 A;  2LC2 A;  3BG6 A;  2Z2S B;  3VYR B;  2XND A;  3KRG A;  3MMY B;  1V0F A;  3LSM A;  2IS4 A;  2HQA A;  1W0K A;  3WQZ A;  2CW8 A;  4QPO A;  2XGJ A;  4OJP A;  3BCB A;  2HPI A;  3DPU A;  1X19 A;  3LSG A;  3QYB A;  2CUZ A;  5C1C A;  3MKZ A;  3OYE A;  2IS2 A;  3GRH A;  3KYL A;  4FET A;  2R7Q A;  2L9N A;  1X4O A;  2K9M A;  2VQL A;  2X51 A;  3L2W A;  1WJB A;  3ZXS A;  5HNF A;  2D3L A;  1SFK A;  3OFN A;  1MMG A;  3L2U A;  2O5R A;  4X0G A;  3W2V A;  2ODL A;  2O0W A;  1QU3 A;  4XOP A;  2M4G A;  1VF7 A;  2XOK A;  3BCF A;  3W3C A;  3CJQ B;  3DLA A;  2BW3 B;  2V7F A;  1X4P A;  1WP6 A;  2X53 S;  1FMV A;  2WZP P;  3PNT A;  2DXI A;  2P0W A;  1SKY B;  1QCX A;  3A35 A;  1AA7 A;  3MD2 A;  3D5R C;  4ITV A;  1R6R A;  3IP4 B;  3OS2 A;  1QJV A;  2OV7 A;  2GK7 A;  3WWG A;  3D5S C;  2HZD A;  1BOB A;  3CF2 A;  2MYS A;  2M3A A;  2R7O A;  2W1O A;  3L2V A;  3GQ8 A;  4KKU A;  2ZZG A;  4E6K G;  4OJL A;  4E0F A;  2M7A A;  3VYT B;  4HIZ A;  5DN6 A;  1G59 A;  3JUR A;  3ZCO A;  1E0E A;  2CUJ A;  2A6T A;  3PUB A;  4XKV A;  3B90 A;  1D1B A;  2VB6 A;  4RMN A;  1OHH A;  4DOZ A;  3OIQ A;  3C2H A;  3G05 A;  2M4K A;  4XON A;  4XLA A;  4BDY A;  2KRH A;  2GJP A;  4BXF A;  2JA2 A;  4PJM A;  2V31 A;  2CS3 A;  5HOO A;  4B3X A;  3UR3 C;  3OE7 A;  2NT9 A;  4FXU A;  1OFM A;  3BLY A;  2L2O A;  1VLY A;  2R7W A;  4KIT B;  1LKX A;  3I9V 2;  3HPG A;  3IUO A;  4ZTF A;  2FUG 2;  4II3 A;  3LSI A;  3RSN A;  1E79 A;  4U49 A;  2VLA A;  3DU6 A;  1V5G A;  2JVG A;  1D0Y A;  3VWB A;  1NG7 A;  3VSU A;  4TKO B;  3H94 A;  4E7L A;  3LFU A;  2V1N A;  5IK2 A;  1KTW A;  4YZX A;  2UV1 A;  1W0J A;  2A5W A;  1E3X A;  1X1D A;  3DWL E;  5CQG A;  4E7J A;  1HZE A;  2LRE A;  3OYN A;  4C9Y A;  1MMD A;  4D9J A;  2M5S A;  1X0C A;  1EE6 A;  2V6E A;  4NC8 A;  3KX2 A;  1HA8 A;  4H4K C;  1CZF A;  2NSP A;  4PJL A;  3RPU D;  2W6J A;  2X3H A;  4XLF A;  1FX0 A;  3CMM A;  3QOE A;  4G6I A;  3DQV C;  4CH7 A;  2V4D A;  4BUP A;  2IS6 A;  1BMF A;  2LH9 A;  4HRI A;  5FL7 A;  3VMW A;  5FRO A;  3VST A;  3OYH A;  4C2T A;  3ZR8 X;  4G7W A;  4XNF A;  3GVJ A;  1O8G A;  1LVK A;  1N78 A;  3UW0 A;  2L5Q A;  4J01 A;  1Z3X A;  1Z21 A;  3K4C A;  1PKV A;  5KCM A;  2LY1 A;  4G7X A;  3OMY A;  2WAQ A;  4XN0 A;  2MD0 A;  3ZGK A;  3J7A Y;  3U21 A;  4XM3 A;  3EQN A;  1NBM A;  3TL4 X;  2WBM A;  4XQF A;  3W2W A;  3GBG A;  4YZA A;  3GQA A;  3NWT A;  3DTK A;  2QXZ A;  2XSJ C;  2VXD A;  3OYD A;  3EUH C;  2MAB A;  3VSL A;  4E7I A;  3BC9 A;  2VJI A;  1WJA A;  2VBK A;  2R7X A;  2DT6 A;  4BAC A;  2F6C A;  3UNG C;  2JIZ A;  2KZV A;  2EWE A;  4IZZ A;  5CPR B;  2JUG A;  3SEQ A;  5KNL A;  3N05 A;  1O8I A;  2UVF A;  3S3O A;  2GK6 A;  3L2Q A;  4XKW A;  2E1M C;  4RLF A;  4PK4 A;  3B4N A;  3QOD A;  4NC7 A;  4F93 B;  5AMV A;  4GQN A;  2Z8G A;  3DPL C;  4F3Q A;  3H9Q A;  1KCD A;  4E7Z A;  1O88 A;  3GQB A;  3HL2 A;  3HPH A;  3EUK L;  2CV1 A;  2X6Y A;  1NHC A;  2WB1 A;  4B3F X;  4KKS A;  2VQG A;  4ASU A;  4NNJ A;  2KMU A;  1MMN A;  2LZJ A;  3RTR A;  2HVS A;  2DJI A;  2XZP A;  2AQE A;  2PJR A;  1WJ5 A;  3DEE A;  1K5C A;  1UD3 A;  2IGN A;  2WSS A;  2Q1Z B;  4HNU A;  3FHN A;  2JDI A;  2F4I A;  3K4J A;  3M1C A;  3OEH A;  3H5N A;  3M8J A;  2Z6B D;  2QY1 A;  1T5E A;  1PLU A;  4Y4R A;  1Z3Y A;  3ONQ A;  1BR2 A;  3K4M A;  3PSI A;  4PFO A;  4BQQ A;  3PL8 A;  4BE1 A;  4B44 A;  4E7S A;  1U0J A;  3PSF A;  4OAZ A;  2XF6 A;  4PJN A;  2LG4 A;  3MKY B;  2HVR A;  1I8D A;  3LMW A;  4ZYA A;  3T9G A;  2VXZ A;  3PNV A;  3H35 A;  3DTE A;  1OR7 C;  2VJ4 A;  2E1B A;  4W8Q A;  4HPQ A;  2WJY A;  5HKK A;  1UEL B;  1X1B A;  3CJR B;  2I8D A;  2PYG A;  1X1A A;  3OW7 A;  3K70 C;  1TT0 A;  2BW3 A;  2V26 A;  3E0J B;  4FAS D;  5HLT A;  4XL9 A;  2V7Q A;  1IDK A;  1W36 D;  2M0M A;  2E5N A;  3OR2 C;  4DIQ A;  2PMZ A;  4BEH B;  4ZDO A;  4U87 A;  4F52 A;  4XKB A;  3GQ9 A;  2NZM A;  4MLO A;  3GVK A;  2JVH A;  4Y3O A;  2WAF A;  4XMY A;  4CCJ A;  2JSP A;  3C2G A;  3NE5 B;  3BH4 A;  1O8K A;  2VAS A;  3HC7 A;  3ZRG A;  3VDX A;  2IGO A;  3I3L A;  3S93 A;  1W36 C;  3K4N A;  4BGD A;  1GLN A;  3EUA A;  5JHF A;  2W82 A;  2ZSH B;  4D1Q A;  2R7R A;  4E7H A;  4XD7 A;  3OOC A;  1RMG A;  3FKJ A;  3H9J A;  2XAU A;  2D3N A;  4R79 A;  4BQO A;  1BN8 A;  1G8X A;  3K4B A;  2X1E A;  1I18 A;  1WJE A;  1DGR M;  3EPZ A;  2W6I A;  1COW A;  1WMR A;  5CDF A;  1K6Y A;  4RLQ A;  2MC4 A;  2K3P A;  4W8S A;  4IX7 A;  1N77 A;  4LIT A;  4KIS A;  4BJ6 C;  2DOA A;  4KT6 A;  3AL0 C;  3QYF A;  2UWM A;  2IGK A;  2NT6 A;  2LBF B;  3FDY A;  3OS1 A;  2BOL A;  2UVE A;  1ERD A;  1MND A;  1ZEL A;  3NWS A;  4CCO A;  3OYL A;  4IKF A;  2RRE A;  3K6G A;  4DK1 A;  4IQ4 A;  2HPM A;  1LFP A;  2K5C A;  4DJA A;  3SDB A;  2R7T A;  3AFH A;  2CW7 A;  4LIV A;  4J00 A;  3OYG A;  4F92 B;  2NTP A;  2BVM A;  1UD8 A;  1HG8 A;  3VMV A;  3T56 B;  1PJR A;  4W8R A;  1V0E A;  5CKT A;  4ANJ A;  1T95 A;  3A2K A;  4YZQ A;  2W7N A;  1O8L A;  4RM3 A;  4NUB A;  5HVQ C;  4RM2 A;  4CCK A;  2LOO A;  4QPQ A;  4CSW A;  1E3Z A;  4KKT A;  3KEY A;  3SYT A;  4YZ0 A;  2DT7 B;  2WJV A;  2E5Z A;  3OYB A;  1UD5 A;  2F43 A;  1BHE A;  1IB4 A;  1KCC A;  3H9G A;  1Y6I A;  3BC8 A;  4PSX A;  1KON A;  4NQW B;  1UD6 A;  3DTI A;  3TBI A;  3KEW A;  2XZL A;  1VBL A;  3OPO A;  2PEC A;  1RU4 A;  3K4L A;  1NG6 A;  5C1E A;  3VSV A;  1DBG A;  2HNH A;  2KHM A;  4Z1M A;  3HAG A;  2Z1D A;  3H5R A;  4PFP A;  3OL3 A;  1YX5 A;  3T53 B;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...