4XLAA

Tailspike protein mutant d339a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 235
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
235
sequence length
600
structure length
600
Chain Sequence
DPDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 235
structure length 600
sequence length 600
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlaA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlaA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlaA02
4XN0A 1O8MA 3B4NA 2VJIA 1O8LA 3B8YA 4W8RA 3VSTA 2O1DA 1BHEA 4XLEA 1IA5A 1EE6A 1PE9A 2VBEA 3KRGA 1H80A 1HG8A 2VBKA 4XOPA 3GQAA 4XQFA 1PXZA 3GQ8A 3WWGA 1RU4A 2O0WA 4OJLA 1RWRA 4XLAA 2X3HA 4URRA 3VSVA 4HWVA 2O0VA 4OJOA 2PECA 2NSPA 4OJ5A 3VMWA 1K5CA 3FY3A 2QX3A 4XM3A 4C2LA 4OZYA 4XLCA 1BN8A 4XONA 2Z8GA 4XKVA 2UVEA 2ODLA 2INUA 3SUCA 4Z03A 1OGMX 4XLFA 1KCDA 4XKWA 4YZAA 2INVA 4W8TA 3ZPPA 1VBLA 3LMWA 1KCCA 4XMYA 1OGOX 4NK6A 4YZ0A 1KTWA 2X85A 1O8HA 1OOCA 4U49A 4YZQA 1RMGA 1O8IA 1IB4A 3VMVA 4YELA 2NTBA 1X0CA 2O04A 4MXNA 3EQNA 1O8FA 1XG2A 4YEJA 1O8JA 2PYGA 4NK8A 4AVZA 2NT9A 1O88A 3T9GA 3GQ9A 2QXZA 2PYHA 1O8EA 1PLUA 1AIRA 1IDKA 4MR0A 4XN3A 4PMHA 1O8DA 3GQ7A 2QY1A 2VBMA 2NTPA 1NHCA 4XR6A 2NTQA 3GRHA 4U4BA 4OJ6A 5AMVA 4OJPA 1JRGA 4I84A 3VSUA 4XORA 2VJJA 4XNFA 2O17A 1QCXA 2BSPA 2X6YA 4W8SA 4Z06A 2X6XA 2NT6A 4Z05A 3JURA 3ZSCA 4XL9A 1DBOA 4XOTA 4OZZA 4EW9A 4XLHA 1OFLA 3B90A 1O8GA 1DBGA 1OFMA 1CZFA 1WMRA 1JTAA 2UVFA 3UW0A 4YZXA 1IDJA 2EWEA 1O8KA 3EQOA 2X6WA 1GQ8A 1QJVA 2IQ7A 2NZMA 4W8QA 5C1CA 2NSTA 5C1EA
chains in the Genus database with same CATH superfamily
4XN0A 3G4SI 2DO7A 2CW5A 3MVPA 1U9NA 2DTZA 4YAUA 4P6VF 1I3QJ 1O8LA 2ACJA 5M5YJ 2HXIA 2F5VA 1E64A 2FOWA 2M0MA 3RQIA 2YWGA 5E3OA 3BH4A 2Q6OA 1R71A 2DK5A 4C0SA 3J80Z 2RV8A 4N0BA 4OMYA 4QSHA 3TBIA 2RVCA 4XD7A 1S72B 3TW6A 3REOA 3GQAA 4EVIA 1O3RA 2HMAA 5H6RA 2H8RA 2VASA 3H0GJ 1BMFA 3EUHC 2YU9J 5GV7A 2LBFB 4HX7A 1WJEA 2HDWA 3BTCA 3H92A 1WJDA 4PSWA 2GK7A 3ESWB 3W5VA 3I59B 3TOBA 1EP1B 3IL2A 1WP6A 2HKOA 1XS9A 3GTJJ 2IOUG 3OYJA 1S6LA 1TQMA 4OPOA 3BNWA 2QKMB 1BN8A 2JIZA 3S32A 2V9KA 4KISA 2E2IJ 2OTJI 2P5KA 2X1EA 4Y3OA 3K4NA 3J7ZI 3VO1A 1QO0D 4AWXB 3QOPA 3KLOA 5J4YA 3WGIA 2X0LA 3K4CA 1MGTA 5BOXA 3DLAA 2HOTA 3HEFA 3ERMA 4WX9A 2L4AA 2CH0A 3SQVA 1E3HA 4WXHA 5EF6A 3LAPA 3TGNA 4C2UA 3W2HA 3CCYA 2L54A 4XMYA 1DP7P 1QA6A 1JUMA 3IKVA 3UKGA 2BXYA 4DZJA 1ORKA 3LO8A 2R7VA 4PC2A 3RPUA 3GUDA 4DYQA 1SM4A 3PFYA 1W36C 3CLQA 2IGNA 1VLYA 4XICA 3OE7A 2LC2A 1RESA 2VBXA 2OZ6A 4WWVA 2F4OB 1BBYA 1IDZA 2V31A 1B2RA 2EFQA 2LK2A 2PX9A 4P25A 1T6ZA 2LD5A 1SANA 2Q6LA 4PC3A 3AVYA 2HZDA 1XSVA 1VQNI 1O3TA 1P9QC 1E3ZA 2E5NA 1P7JA 4N4NB 4P3YA 4RDKA 3EYYA 3HAGA 3ZBTA 5FA6A 3JRAA 2ESHA 1MBGA 2K9MA 4JYKA 4EJOA 5LBQA 2GREA 2F48A 2YSRA 5F0FA 1D0XA 3R4KA 1DGRM 3BQZA 4BUPA 3ML6A 3TW7A 4C43A 4V19K 4LG0A 2FMLA 5LLQA 1BI0A 3VEPA 2D3NA 4F92B 5IYNA 2JMWA 5CVJA 1A6IA 3OYLA 1ITYA 2HEOA 3OW7A 1R1TA 1R4MB 5HXBA 4J0QA 4G7ZF 2V7XA 2DPDA 1QGAA 4YFOA 1I1GA 4EJWA 2A68F 3GO5A 2X1DA 2XGDA 3IWZA 3F0CA 2VKHA 3ZMZA 1KQ9A 1W5SA 2F4MB 5HDNA 1WPCA 2XUBA 2V6CA 3SY2A 1JTAA 1VQPI 3LSKA 2WAQA 2NS0A 2HYFA 4QIWN 4OP7A 2FA5A 1UHMA 4MFDA 2X6WA 1VJSA 4HLYA 2PFBA 1QJVA 3FWEA 4GO1A 1S29A 4M9SA 3DQVC 2HPMA 3AG1H 3PSFA 3RSNA 4NQWB 3AVTA 1UG2A 3KP5A 3G3ZA 5JI6A 1K7AA 1TT5B 3B6CA 1VHOA 4KYWA 1QGZA 3OL4A 2E5ZA 2QYOA 3KP7A 4I0BA 4XLEA 3JQPA 1IA5A 3FBIB 1ZARA 4A3LJ 3ASOH 2BHZA 4ZDPA 2JQ7A 1HG8A 1PP7U 3BG9A 5M3FJ 2Q2EA 2ZJQF 3Q0UA 2HWVA 1UHSA 3B02A 1LKXA 5L3EA 5LMZA 3ZQIA 1XSDA 1GDTA 2VB6A 2IBDA 2EPFA 2LP0A 3C3WA 2BM7A 3HOXJ 1K78A 2ZMEA 1B6AA 1IF1A 3MD2A 4QVAA 3ABUA 2QQAA 1DDIA 3GYHX 2Q6IA 2QX3A 1BI2A 3LSHA 2MGQA 3MCZA 5DM7F 3FKIJ 4F7DA 1EWYA 2VONA 5CQEA 1IRFA 2VXDA 3VYSB 5KK1A 4GFBA 2B5OA 3WYAA 3F72A 4N9HA 1MSFC 3AK5A 4RB1A 4PAAA 3WNCA 4BDYA 1T6SA 4ZTFA 1Y8QB 2KJBA 5F1JA 1MDMA 4Q7JB 3ONQA 3PIPF 4XKWA 1MMDA 1UB9A 3FX3A 3HKZA 3GTLJ 1U5TC 2B7EA 1D8TA 2ZJPF 3ZBUA 4HLXA 2XB5A 1O8KA 2CF4A 3ZPPA 1MH4A 2OK7A 1SFEA 1ZTRA 3WTWC 4L0YB 3S14J 4M3FA 4PJLA 5DCFA 2XROA 1VBLA 2EFPA 2DT5A 3WTZA 1KQ8A 3OFNA 2XZLA 5F4JA 1KYWA 5A8AA 5EDNA 1EV7A 1ZGAA 4E7KA 3S1MJ 4AC9A 1BJZA 2C2WA 3I71A 1COWA 2KISA 4I7HA 2LKSA 2P7CB 1D8KA 3A2KA 3ZC3A 4Z4UA 3J81k 2X6OA 4C2MJ 2ZBVA 3ABTA 2WBMA 4M74A 3EQNA 2HQ5A 4L5JA 4YEJA 2XGCA 4Y17A 3JRCA 4P3IA 4QFMA 4WZTA 1O8JA 1IJEA 2LY1A 3AG4H 3R0AA 1WZ2A 4UZUA 3D5SC 1WH7A 1V54H 1Z7LA 1QFJA 2EFOA 2K3FA 2AS5F 1OR7C 2V7QA 5LGTA 1KK0A 3NEUA 3CC2B 1Q81D 2KP6A 3FXRA 3PVDA 1JJ6C 1YJ9B 1NK3P 2R92J 2M87A 3GLXA 1H89C 5H59A 3CCRB 4A3FJ 3I56B 2DIEA 5ICCA 4HRIA 1IN4A 1ZR2A 1R4NB 2KZVA 2MLGA 2ZNYA 1YJWI 3ABMH 5L3FA 2ZL7A 3MQ0A 5LD2C 4ESFA 1UD3A 2R6HA 2O17A 3F6OA 1LE8A 2DTRA 2BGIA 4Z06A 2W1OA 1PUEE 1SMTA 2XTYA 3H94A 4CCKA 4RPDA 5FRNA 1HKTA 5ERIA 4R8HA 3TP3A 2JA7J 1GJRA 5K5RA 1HVXA 3NAUA 2O8XA 4HF0A 1ZRFA 2ISZA 4Y13A 1UCRA 5GV8A 1PKVA 2BW3B 2PMZN 4KKUA 4RD4A 1D1AA 3KP4A 1MNMC 2I1LA 3UNGC 4NDLA 1R36A 4JK1X 4W8QA 1W5CC 3TO6A 5C1CA 4RD1A 5C1EA 1UD5A 3I64A 5BMZA 2IT0A 3PO2J 4XKBA 3OYNA 4KNYA 4YIRX 1WHUA 4QTRA 4IO9F 1A8PA 2QMUA 4W8RA 1XX5A 4XKCA 2QEXB 2FEZA 2K9LA 2KIMA 2OQRA 4NHJA 2Z9OA 1VI0A 4HW0A 1JB9A 5ILSA 4A6EA 5EGOB 2GAUA 4Y4RA 4S04A 4L9TA 4DYCA 4HNUA 2OUMA 5TISC 1LPQA 2VFQA 4GYIA 4P12A 3SEJA 1MMAA 2C5HA 5HZAA 1V5EA 2PI0A 3OZWA 1Z1DA 4F91B 1PXZA 2FMYA 1YITB 3PSIA 3VB2A 3LSGA 5CVUA 3A0HC 2K9QA 4XSZF 1FOXA 2GK6A 3CB4A 1XE1A 1RC9A 5EZHA 2PECA 4ENKA 3M9AA 3MZ8A 1GLNA 2QQ9A 1GO2A 4KH3A 3CCUI 4A3CJ 5DTDA 1LUJB 5M3MJ 1JKPC 3MCAA 1T0FC 1Q9SA 1VQ5I 4I02A 1N78A 2WAEA 3QP6A 4RM2A 3LSRA 2STTA 1SAUA 4BQOA 2EJRA 3CD6I 4W8TA 1YX5A 1ENHA 2BOLA 3WU1B 3W6KB 3OEHA 1O7FA 2I5UA 2PMHA 3GSIA 3I55I 5E6TA 3A3BA 1WJ5A 3HPGA 4G6QA 4G7HF 3LA2A 3BPVA 3D0SA 2AQEA 2VODA 1ZREA 3OJXA 2OTJB 4YELA 4FISA 3HOWJ 4J19A 4A93J 4OAYA 5D5XB 3GTMJ 2M0CA 1T95A 1V4RA 1FYKA 1BPLA 4E7ZA 3PSSA 4G5GA 4YFNF 1TW2A 2EV6A 4XLPF 1RR7A 3SEZA 1TVCA 5CQGA 2AQFA 3HTSB 4KIGA 3OYDA 3K70D 3CCJI 4BHPA 2VUMJ 4G1VA 1J2XA 1QPIA 4Z2YA 4ROXA 3CMEI 2JJ7A 4BU2A 1XGSA 5D8KB 2FF4A 2IS2A 2XNCA 3GQ7A 1HDDC 4GCVA 4G12A 1ZR4A 2O6GE 3KFWX 3U1KA 2KRFA 3GX4X 5IYCJ 1R5BA 3WE2A 1KQSB 4XSXF 2QZAA 2RAEA 3QU6A 3BTJA 2Z3YA 1T38A 2WY8Q 2NPFA 1CF7A 4X0GA 3GFMA 3LFKA 2W4SA 2DYRH 2ELKA 4RAGA 3G1OA 1FT9A 2HOEA 2VJJA 1CLWA 2HZTA 2IVMA 1JA0A 2LH9A 3ONUA 4W8SA 5ICEA 1VQNB 1FX0A 4ACBA 2OBSA 4ZH4F 1PDNC 4X7CA 3K69A 5DCMB 4MTEA 3TO7A 4IW3B 3ZSCA 1JGSA 1ZK8A 3BCAA 2JA5J 3BH7B 2DDAA 2CBXA 1DBOA 2RC6A 2E71A 3T53B 5LEJA 2Y0SN 4L8JA 5EEGA 3ZQQA 3OYGA 1IUFA 3PQKA 1GT0C 2IS4A 3SDGA 2CQXA 2QF7A 1BN5A 1TWAJ 4P1VA 2M34A 5GADJ 1IRGA 3EQOA 4WCGA 4D5CA 3ZPLA 4ABZA 4U9UA 4YHBA 5H6QA 1FSEA 3H9GA 3CDIA 1KU9A 2BE5F 1RQRA 2R7OA 1QVUA 5DNSA 1SD7A 4S0HB 4AVPA 1FIPA 1BHEA 4P96A 4HEA2 4MIMA 3FJOA 1YG2A 2OQGA 1B4AA 3MKYB 4LC0A 3FKJA 3HGYA 4G6DA 4E7JA 1W87A 4M1KA 1VQPB 2XRNA 1YJNI 2NYXA 4XOPA 3VMFA 1ZG1A 2J8IA 3GQ8A 1SKYB 2Z1DA 3CQZJ 1SKQA 2M8EA 1RWRA 1YW8A 1TBXA 2OK8A 4Y7CA 3ZCOA 3NQOA 3VSVA 2EB7A 4L9VA 4HWVA 2IAIA 2QSHX 4Z1MA 2OV7A 3ASNH 2DPUA 5F0CA 3OS2A 2MG4A 3QRFF 2JJ1A 4L5IA 1GVHA 4E7HA 1L3LA 3A01B 2LNBA 4D7MA 1BL0A 3HIFA 2QTZA 1K6OA 4I76A 5F27A 3EDPA 2HFHA 2WAQN 4FTHA 1GUUA 2KL4A 3H3VK 1LDKB 1SFXA 2W85A 5JHFA 1YOVB 5LFAA 1LVKA 1NDHA 2DXIA 1QUFA 2V7FA 3ERED 1WGXA 1X58A 2BY2A 2EZIA 3KZZA 5JLXA 3CCEI 4TMVA 3ABKH 1QVGB 4RB2C 5LRSA 2CRVA 1SD5A 2K85A 3OOPA 3PNYA 4BQNA 5HDKA 1F43A 1MKMA 1G7CA 2CQ7A 3MEXA 4ETSA 3A3GA 3QFCA 4PGOA 2Y30A 5LEKA 1H0MA 3ZUGA 1O8IA 4DGWB 2R7FA 1X0CA 4B47A 4Q48A 2WSSA 4UVBA 4X7FA 5E3LA 2E34A 1J9IA 3QPHA 3I58A 5BQTA 4ASNA 2DA3A 1FX7A 1VF9A 2MC4A 3CF2A 1OISA 4M6YA 1WJCA 1XB4A 3L1PA 3SLDA 3N90A 2ZJRF 4GYGA 2RC5A 4M9ZA 1K4TA 1USSA 2XAGA 4RS8A 3HB9A 4I98B 3S2WA 1OFEA 1HF0A 4A3JJ 4MR0A 3E5UA 2E7XA 1A36A 3CC4I 1POGA 2JA2A 3L2QA 2GXGA 2JPBA 3BR3A 4M0LA 2L7KA 3Q3SA 3VYRB 4BDZA 3DPTA 3F9KA 1VLOA 4LG3A 1R5ID 1W0JA 2B7CA 3BCFA 2F1LA 2QKLB 2VT3A 2W6JA 4RDJA 4OJ6A 1OB5A 1I5ZA 4YCQA 4C2TA 2OF7A 3IAM2 5IPAA 2C77A 1YW7A 2X6XA 1BW6A 2CS3A 3JURA 4N4OB 2Y2ZA 3FIWA 3R60A 1QFZA 3ZN1A 1WOSA 4CZCA 1ZKGA 3ELKA 3WTVC 3U6BA 2Y31A 1YIOA 2XB0X 2P5VA 1R5OA 4IQJA 3SHFA 2Z99A 2CJJA 3OEEA 2FXAA 4HIZA 3W3CA 3ASPA 1YJWB 2JK3A 3RCOA 3OS0A 1T8IA 1MBEA 1YS6A 3P5JA 5D6FA 4PDKA 2QYUA 2O03A 4HA8A 5FLMJ 1OYYA 3JRBA 2VQGA 2DA5A 4JP0A 2COMA 2WAFA 3BR0A 1O57A 3SYTA 3J80K 3BCBA 4B09A 1I27A 2YR2A 4L5EA 1T6YA 2CUFA 4M4SA 1WWXA 4RD3A 3A8KA 4OOSA 2VBEA 1LDJA 5J1UA 1QU3A 1YLFA 3T8TA 4LBZA 1W2BB 3S1NJ 4YRVA 2DEUA 2IA1A 1F60A 4OIQF 4U0YA 4M3GA 2MD0A 1H8HA 1KK1A 1REPC 3FMSA 3OJWA 5F4OA 3MMYB 4XQFA 1E43A 2E2JJ 1LFBA 1RU4A 1W34A 3TL4X 5KSWB 4KUMA 2P5LC 4KMFA 1GAQA 2X3HA 2L02A 5AIPA 4IKFA 4G9YA 1WI9A 2PMDA 3S8PA 2NSPA 3H9JA 2UUZA 1PVEA 2H09A 4XRFA 4OJ5A 3OSGA 3M8EA 1G8XA 3RKYA 3F8NA 2L0KA 1QZZA 4CYCB 4BY1J 1MMSA 2J5PA 1G3WA 4M6XA 3IH4A 1TYWA 3DPUA 3RIQA 3WY9A 4A3MJ 1UZCA 1KU2A 3KZIC 1EXMA 5AN9A 3BY2A 3ZQFA 5E3NA 4I0AA 1OGJA 2QENA 2PQ8A 4RAFA 4Z4YA 3SJPA 1KQ5A 1L1IA 2Z6BD 1QNTA 3OWTA 4XRSA 2KDZA 3F6VA 1QRYA 2ZFWA 4PGHA 1TLHB 1EFUA 1P4AA 3Q39A 3PENA 4ZCLA 4ZYGA 3CCUB 1R5NA 4ZV4A 3QFSA 1VFCA 1VQ5B 2FQ4A 3CUQA 4NK8A 5JHUA 4FX0A 2VI6A 1K79A 6PAXA 1PJ7A 2LREA 3CD6B 3BZKA 5GTIC 2QXZA 1X4PA 3I53A 1OB2A 3GBGA 3I9V2 2BVMA 1F36A 2LR8A 3K6GA 2BM5A 1FC3A 3BT9A 4MTDA 3QYEA 3V7RA 3JRGA 3S3NA 1JE8A 4HX8A 2YWFA 3LA3A 3I55B 1E0EA 4BBRJ 2VZLA 1GR1A 4F3QA 1WOOA 4DQKA 4ZJZA 4X7DA 1I6XA 3Q5FA 4YIIA 4MGRA 3QQAA 4UUSB 2B63J 4I01A 5TY0A 2K9SA 5E1ZB 2M2EA 4TT3A 2LKXA 1VZ0A 2DYIA 3EUHA 3GFIA 1JTXA 1YHQI 4HBLA 3SQNA 4I84A 2JT1A 3FMRA 1E17A 3H1CA 3CCJB 3WG9A 1DPRA 3PNVA 3WTYC 2E60A 2NS7A 1QBJA 4BBSJ 4Y52J 3CMEB 2VQLA 3KP6A 1G7RA 3KPHA 4XL9A 4OZZA 1KK3A 2W7NA 1BLIA 2FRHA 4M6VA 1NJID 4G7OF 3LSPA 3DPLC 2ZBKA 3FXKA 1VQ9I 2NVUB 2L4MA 1OCCH 1W7PB 5DUKA 4ESBA 5J6XA 3IH3A 3L00A 3ZQCA 3N4MA 4KFCA 4WZKA 1WDTA 2LTPA 4TMTA 1VHEA 4Z4WA 1YYVA 1BR2A 2IPQX 3V8JA 3FHNA 1ERDA 2VBSA 1S8NA 5HS9A 2K02A 1ZM2A 2JA8J 3GTPJ 3IAS2 2WR8A 1H42A 1A35A 2GM4A 1PE9A 5FO1A 4BGDA 2XZOA 1T6XA 1XD7A 3HUGA 2E1RA 2KIFA 1STZA 1RPWA 3GMEA 1R22A 2GXAA 5CVIA 4LJZF 3VYUB 2CK3A 4D7NA 3HRUA 5DD8A 2VC1A 1TUIA 2BM1A 5HNHA 1ETWA 4EM0B 1W1WE 4RCZA 3M4OJ 2O61A 2QBYA 4IRHA 4DBQA 3TO9A 1Q1HA 3AFHA 5GPCA 2HKXA 1DDNA 2O6WA 2ECCA 4TMWA 1VQ7I 2XASA 2DMNA 4MNUA 4A3GJ 1YJNB 1MRZA 5J1YA 2JPCA 4ZYHA 3KEQA 4IXAA 2M4KA 4XLFA 1OJLA 3TOAA 4ANJA 4A3EJ 4QPOA 1IJWC 3GZ5A 1KCDA 3AVXA 3ZZ0A 5HNFA 2XZPA 1S7OA 1UG0A 2EBIA 4G1BA 2NNNA 1U78A 5FKNA 1V5VA 5BSXA 1HSTA 1B23P 1W0KA 3ZRGA 2H1KA 1O8HA 2I8DA 5LHIA 4U49A 1FJLA 2QE7A 2LKPA 3BQYA 3OL3A 2HOAA 3VR6A 3LQ6A 5HZBA 2KJCA 3E6CC 4O3MA 4HAMA 1M90D 4F7ZA 4HNVA 3SJZA 4Z4VA 2IGMA 3MZYA 3QODA 4MXNA 2QWWA 1G3SA 3ZQHA 3HOYJ 2QM3A 2ECBA 3D5RC 5EJCA 3L2UA 1T56A 4H9GA 2M9HA 1GV5A 2ZJ2A 2JN6A 3PNTA 2G0EA 2NVTJ 1NG7A 4RGUA 1XB2A 3BP8A 3FXQA 2JZYA 2VNHA 1Y1VJ 1EF4A 3LSJA 3F3XA 3CCEB 1P4XA 4MHGA 4BXXJ 2E1MB 3DF8A 2BV6A 4XN3A 1W7PD 3K4JA 5IT9K 1FP1D 3OYKA 1DP3A 3NE5B 2DMUA 3OYBA 3LQEA 3B8HA 2OD5A 4M72A 2Y0SA 1IG7A 4YEIA 1G4DA 2EIXA 2Z5UA 3P27A 5BS6A 3OYIA 1VQ6I 4QVJA 4RBOA 1HLVA 2XTWA 3KETA 1JRGA 1K4ZA 4XORA 4A5MA 3U2RA 1LB2A 1MBJA 4AIHA 2VJ4A 4C9YA 3H0DA 2VPLA 2E1BA 2EFGA 4X8IA 2BSPA 1JHHA 3SFZA 3CXCB 3CCMI 2UZKA 4Z05A 2R7DA 3SXYA 4D5FA 3ZOBA 4DJAA 3OYAA 1IGNA 4P2NA 2F43A 2E2HJ 5ED4A 2HR3A 4XOTA 2A07F 4NBSA 5H5JA 3CC4B 1QX4A 4RD6A 2CQQA 1OQYA 4LG0B 2UVFA 3FHZA 2Q1ZB 3W6JB 2WPDA 1Q82D 1RKWA 4LB5A 4DQ2A 1WSVA 1UMKA 4YAFA 3QYBA 2EIMH 4G94A 1U5TA 2ZXHA 5L3GA 3W6VA 1RQPA 1S4MA 1H9GA 2R5ZA 5EEAA 3KE2A 4II3A 1FRQA 3KL9A 2IW5A 4LIVA 1DGWY 1W5TA 5FJ8J 2IGKA 1SC7A 3E1YE 2VFOA 2M7AA 2R3SA 3IP4B 2V6EA 4BACA 1ZGJA 2PEXA 2CUEA 2F5EA 5FB2A 4UZEA 1YFHA 1B72A 1BX1A 2BEOA 1PJ5A 3BR6A 2XGXA 3LWFA 3A03A 5D5VB 2VBKA 1BOAA 1T08B 2V7VA 1VQKI 2OYNA 4DK0A 3ASRA 4BHCA 1I8DA 4CA0A 1FZPB 2RC4A 2K40A 2VLAA 1E1QA 3HZJA 4YAOA 5FGMA 2LY2A 5HLTA 2DMQA 2WTEA 3PFIA 4PJJA 3LYCA 1ZG5A 1Y0RA 1P4MA 2V1XA 4XK4A 5HDGA 1VQMI 1NH3A 1FNMA 5IK2A 3CCVI 2DERA 1SAXA 2O5RA 3H5NA 5J40A 2Q2EB 4F52A 3ABLH 3KLNA 4P6YA 1DU0A 1TWFJ 2K4JA 3HTUA 4BEHA 4EM2A 3SZPA 1ZLJA 4HF2A 2DCEA 3W2EA 5LGUA 1Z6RA 3T51B 3PL8A 2WA0A 3MAJA 1RRJA 2ZMEB 5J4VA 3RPUD 5DM6F 5F6FA 4IX7A 1K78B 3AL0B 2ICWG 3RPQA 4JX6A 2QUFA 2QCOA 1KCCA 3DCFA 1BQEA 1BX0A 5A88A 3NAWA 2I10A 2MH9A 2XEXA 3ZIAA 3GTQJ 4I2OA 1X19A 3FXJA 4EH1A 2X53S 2ZO4A 1TP4A 5DV5A 5FFZA 2IA2A 1T39A 3A1YA 4X7EA 3RQ4A 2VNJA 4QUZA 5L3CA 1MDMB 5KHDA 1KQ0A 4GQNA 3OZUA 2Z33A 2IGOA 3K1NA 5CVVA 2VIXA 2STWA 1N06A 3M3YJ 4E4HA 3IUOA 3A35A 3AVWA 2FUG2 1GVJA 2HYJA 2VBYA 1OLTA 3FK6A 4C30A 1RUOA 2GXBA 5DUIA 1HA8A 5C4XJ 4JX5A 1HW1A 1WORA 1XG1A 5ICGA 1EFTA 2CW0F 1T5EA 1ETYA 1BC7C 1O7LA 4P1WA 4PMHA 2YU3A 1J5YA 2QY1A 3CDHA 5IYQA 4QHYA 1IN5A 2BY0A 3FXMA 5LHGA 4IHYA 2VBWA 1XSXA 4IHTA 4UUVA 3FXOA 4A2UA 2KHMA 4PZJA 2H6CA 2YWHA 2CMPA 4CXFA 1FNNA 2P0WA 3K9TA 2R7XA 2Y75A 4ZZDA 5TGTA 4CZZA 3FM5A 2JSPA 3ZQ7A 3RTRA 3TP0A 5ILVA 4ZDOA 4YALA 3ONYA 1ETXA 2E1CA 4BE0A 3T8RA 4XLNF 3WQZA 3M1EA 2X3UA 2GA2A 3GF2A 1HSJA 1DABA 3QU3A 4KICA 3B90A 1O8GA 2VFMA 1TQPA 3ES9A 3AG2H 3R6KA 5EMNA 1V55H 1TSPA 1UD8A 3OR2C 2M45A 4RM3A 2DT6A 2OU2A 1MJAA 2IQ7A 4NBQA 2NZMA 4BXUA 2NSTA 1LE8B 1Z67A 3VPRA 1YHQB 3H09A 3F8BA 1Z9CA 4CICA 2QDXA 4OINF 4BY7J 4CGZA 1XDUA 3HXLA 5IT9Z 3QE2A 3S3MA 4L18B 3SYJA 4ENMA 4HNTA 4WQMA 2M7BA 2BXZA 4BHBA 1TTYA 3MKWB 3W2FA 1U0JA 2MA3A 1FTTA 2DODA 3BQJA 4QWQA 4OPWA 4RLFA 2VFNA 3V7AA 4LFUA 1WPKA 1VQ9B 1ZM4A 2EK5A 2F3LA 4LK1F 1J7KA 2DOAA 4U0VA 5HLGA 2O3FA 3FISA 2V1NA 2HDDA 3GQBA 1ZGWA 5CJ9A 5HVQC 2DOGA 4OWRB 3C1DA 4OJOA 4A69C 2ADUA 1ZH5A 4W97A 2KFDA 1FSHA 4JOMA 4OZYA 1P2FA 1K83J 4B3XA 1QVFB 3H3UA 3CZ6A 3S16J 3U9GA 1ZHFA 1I39A 2XHKA 2X51A 2ZFUA 2GQFA 1X2MA 2UVEA 2INUA 2UXXA 3DFGA 4OPSA 3LQRA 4R79A 1ZN2A 1HW5A 1Y1WJ 3AVUA 2WB1N 2EV5A 3BZCA 1TNSA 4KKTA 4YZAA 2UV1A 4IEJA 2ID6A 3CPWB 1B1BA 2MD5A 4NC8A 1W9XA 2V4DA 3CMAI 1IDYA 1NG6A 3KP2A 3WHBA 5EG0A 2Y48A 1KTWA 2QQ8A 1LFPA 4WF2A 4EMSA 5IYBJ 1IV6A 5CVRA 3G4SB 4YZQA 3RKXA 4LLLA 4X07A 3GVAA 4OOIA 4AD9A 4IQ4A 1VQ7B 2ZB9A 2EILH 2NTBA 1HQCA 2X1CA 3OOCA 1OB0A 2VKDA 4RPBA 3QPTA 2PBIA 1VNDA 3I4NJ 2RQQA 2H94A 2AO9A 4IRGA 1G2HA 2AHOA 4G6TB 1BOBA 1D5VA 3B82A 3OW2B 2WJYA 4AF7A 1TTTA 2VL8A 2DETA 4UV8A 1QZYA 1Q7YD 1EP3B 2HLDA 2A6HF 4B3GA 1O8DA 2ELJA 2DYSH 3LSIA 2NAZA 4M9XA 1K6YA 3R0JA 3V7SA 1JT0A 2L9SA 2XC7A 2VBMA 2GJKA 3MKLA 1WJFA 1BR1A 1DDGA 5FD6A 2HGCA 3ZPNA 4S05A 2FBHA 1YIJI 3IKTA 2DQLA 5HODA 3CC7I 2WJVA 4I99C 3N05A 5DSZA 4XNFA 4HE5A 3W5UA 3VODA 1QCXA 2YPRA 1I3AA 1RR8C 5LGNA 4M2LA 1QRBA 4LBVA 1JT6A 1D1CA 5M5XJ 1AKHA 1S3JA 3K4LA 1NK2P 1YW9A 3UR3C 1WKMA 3LA7A 2HDNB 1EH8A 2XKPA 4EW9A 2BVLA 3K4KA 1S7EA 3M8FA 2KRCA 4XLHA 3FDYA 3MMPA 4IZZA 1ULYA 4OIPF 3W2GA 1CZFA 4TV7A 1CF7B 3G2BA 3HM5A 2V7UA 2P3MA 2LRDA 4XBFA 3D5LA 1VQ6B 2JA6J 1AA7A 2HOSA 2LG4A 2BMWA 4BYYA 4DK1A 3M1CA 3OIOA 5L3BA 5EZGA 3B4NA 1X1AA 1X1BA 3KZYA 3CCMB 2VE9A 3RKWA 4FN5A 2FQ3A 3HRTA 1B9MA 1T2KA 3BTIA 4P9SA 4A0ZA 2DOEA 4FXUA 1MNDA 4KIBA 1UD2A 1MIJA 1OPCA 2ME0A 3K70C 2BVNA 1AHDP 4LGWA 1FBSA 1WCMJ 2DDBA 2LF7A 1E63A 1X2NA 4URRA 3KYCB 2TDXA 1ELOA 2L5QA 3CPXA 1WTHD 3DXJF 2VOOA 1ZYRF 4BE1A 2W7ZA 1FEXA 1QA1A 2WYRA 4K2EA 2JUCA 2EV0A 5IT3A 3JTGA 1Y0NA 2LFBA 1KK2A 3LNNA 3ZMTA 1FYLA 4NUBA 4BNCA 1PUFB 1JI8A 5GP9A 3ZQLA 1SFUA 2BN4A 1VQOI 2BV3A 1XGMA 3MN2A 1VQKB 2W48A 1OMIA 3MHPA 1ONVA 1OGMX 4UY8I 3AGQA 4P9UA 4KN4X 1G6NA 3FM3A 2INVA 4O6JA 2G9WA 1KONA 1N75A 2W24A 1PUFA 4II2A 4FASD 4DBRA 1KMHA 4HE6A 1VQMB 1FMVA 4ENJA 1PJ6A 3CCVB 2WC2A 1R23A 2W84A 3I54A 4OAZA 3HGGA 2X85A 3CJNA 3A4CA 3SDBA 1DUXC 4PC1A 3WBKA 5FROA 3CP8A 2M4GA 2A69F 2KQRA 2VBZA 4PJ0C 3F22A 4HSTA 1IB4A 4HYEA 3FXUA 1SEUA 3SLNA 3ASTA 4M3DA 2CW8A 2G0YA 1IXSB 2HNHA 3S93A 4DNCA 1UD6A 2C5BA 3F21A 1OCZH 3T9GA 3CCSI 2J5OA 4UUTA 4Q47A 1PLUA 1F20A 2D5VA 4BXFA 2EFWA 4UAJA 1IO2A 4IVNA 1F9NA 2F5DA 2YX4A 5C44J 3IWFA 4IL6C 3E6MA 3NWTA 2EINH 4OMZA 2VT2A 2XAQA 1ZRDA 3L2VA 2XSJC 2V7WA 2W25A 2MC3A 1FNCA 3S1QJ 2NTPA 1NHCA 4XR6A 1BJKA 2F1MA 3TH0A 1JKOC 3DEWA 3H3ZA 3F8FA 4HQEA 1ETQA 3DKWA 4Y7NJ 5E1XA 1D3YA 4C3JJ 2V9PA 3HBLA 3QFTA 2BM4A 2IRFG 1T98A 2HTJA 2NT6A 3N97A 4LLGF 1WH5A 1IW7F 3JW4A 2GPJA 1KRHA 5FLVA 1Z91A 3CMYA 2BBYA 2NVYJ 4ESJA 1PJRA 2BPOA 5GPAA 1OFLA 4J00A 2ETHA 3H35A 3K1MA 1N77A 3VO2A 1TL8A 2TRTA 2A61A 1IDJA 4RDUA 3WTTC 2WWYA 2DMTA 2GIVA 1WI3A 3VSLA 4DZPA 1QGYA 3U2QA 2GJRA 2LYCA 2VKEA 2ZSHB 5AONA 4AU7A 2QGGA 1RETA 2B0LA 2L2OA 3ZQGA 1NBMA 3DU1X 1JTYA 2DLLA 2JWTA 1M1EB 5ICFA 3GIRA 2LVSA 3GFLA 4Y33A 4NCNA 4UB6C 4RB0A 3W2AA 2RNGA 2ZZEA 3X2QH 3B73A 3QYFA 2C78A 2HCJB 2O0WA 3WNBA 3G73A 2XAHA 1MSEC 1S0UA 4Z4TA 1QQ1A 2LF8A 3K2AA 1LNWA 2DFEA 1YS7A 3DKYA 4H4KC 4DW6A 3ASQA 4N3NA 3E6BA 1X3ZB 2K3PA 4A12A 4C2LA 4XLCA 5CPRB 2D3LA 4B8XA 1YRNA 1S5LC 1IJFA 3OYHA 2XT2A 4XKVA 5D5WB 3P4GA 4NC7A 3J7AO 4LMYA 3GTGJ 2NOJB 3FKSA 4M3EA 2D74A 4UHTA 5FIUA 3C7JA 1D1NA 2ISYA 1GV2A 3GXOA 4RA2A 5LHHA 3CF5F 5E17F 3H5AA 5E20A 5JR3A 2EIKH 1SMYF 4IHWA 4RGXA 3E20A 3G1LA 3LVBA 4P26A 1ZAOA 1R49A 2CGPA 1Z7UA 4FHTA 1X3UA 4HDVA 2AXTC 2ZZGA 4A3IJ 3OP1A 4MFEA 4BQQA 3CJTB 4ZYEA 4HSRA 1W0UA 2JJ2A 2ZKZA 1XG2A 2FBIA 4JX4A 5GAEJ 3OMYA 2DCUA 2R0QC 4O5VA 1YQAA 5FFXA 3ZGKA 4E7LA 3W2WA 1JUSA 1Z3XA 1SFOJ 1WXRA 5F04A 3BG7A 2RREA 5FO5A 3CMAB 5JBQA 2DA4A 2DBBA 4LITA 2R5YA 4A3DJ 1KU7A 2DU9A 2QTLA 1JUPA 2XGJA 2ME6A 3COAC 3HHHA 5IYRA 3O8HA 3OOUA 3CUQB 1GXQA 3OV8A 1X4OA 5J8FA 1IRZA 3GRHA 2A5YB 4FQGA 1XGNA 2CRGA 2R4GA 2XVCA 1R00A 3BOQA 3PUBA 3VYTB 1A31A 2B7BA 3E7LA 2C4TA 2LDUA 3FF5A 2DFIA 3PUNA 2IJLA 4FE4A 2YWEA 3BG6A 1B8IA 3JQQA 2R7ZJ 1TQIA 2GJPA 4B44A 2HVQA 4AYBA 5FL7A 4BPRA 1RNLA 5GAGJ 3O8GA 2Z16A 3PUFA 4U88A 4CUGA 4EEFG 2OCCH 1J75A 2K9NA 5CLSA 3A8IA 4PJNA 4V2FA 4X1EA 1IAWA 3HPHA 5K7ZA 1TLLA 1YIJB 1GQ8A 4W1UA 1A04A 5A2QK 2Y69H 1NTCA 4BJ6C 4EV0A 4OU0A 5L3DA 3G6EI 4X6AJ 3GFJA 5E1WA 3ZXSA 3R6JA 1TYUA 2MFZA 3HYIA 3B8YA 2OBTA 1WVRA 4ZGQB 3VSTA 1FYMA 4I6ZA 3G1MA 3EYIA 3Q9SA 3U6KA 4Y9UA 5F4MA 3NB2A 1F1ZA 2NRAC 1CQTA 1Y39A 1B59A 2UWMA 1O3SA 2HYGD 4CDGA 5IOYA 3WODF 1BIBA 4NC6A 3E3VA 1CNEA 3V8KA 4Z6YA 5HKKA 2A5WA 2QGUA 1TWHJ 1Z21A 2VKVA 3P9KA 1H8EA 3TDZC 4R1HA 1WU8A 2WB1A 1X3WB 3K4MA 1LVAA 1YX3A 1KTVA 4EGZA 2XV4S 1JJ8C 3A1PA 3AGPA 1ETOA 3HUGB 2HDCA 1UJ8A 4OPVA 3KYDB 3TEDA 3OY9A 4BKXA 4P5OA 3RZOJ 3BJOA 1R1UA 1GAWA 1W4MA 5IP9J 1YI2I 1ZM3A 1XMXA 2F2EA 4Z03A 2QBYB 3OR1C 4WXCA 3JAMZ 2R7UA 1I18A 4YDTA 5K5QA 2ZL6A 4L9JA 2D2WA 3LJYA 3DWLE 3D1NI 3KCCA 2KIUA 4NK6A 2NOGA 3BJ6A 3C18A 1E3OC 3PO3J 3BCDA 3WU2C 3KYLA 1KJZA 1VQ8I 2VPRA 1HW2A 5IYDJ 2BY1A 3L2RA 2LOOA 3AVVA 2H1LA 1NHAA 1KZLA 2PLFA 3FPKA 4HX4A 1VQOB 3O6BB 1O8FA 4AIDA 2K7LA 1XTAA 2KDOA 3QFRA 4LBWA 1O88A 2E7WA 1Q86D 1TYXA 3S17J 2PYHA 3MZHA 1VQ4I 2JTVA 4RDLA 1LLWA 1XMAA 2HS5A 1E1RA 1A5JA 4UVAA 1IZ1A 2DFFA 4DYRA 1J59A 3OYMA 1FOKA 5K7FA 2P8TA 4KN7X 1N05A 1EKEA 1QRCA 3DBRB 1N25A 4CQJA 3G71I 1LFUP 1LM1A 1I1SA 1PYVA 2HQAA 3CUQC 5L46A 3OZVA 1U6GA 3GLLA 3M7GA 3PM1A 2CYYA 3ZN0A 3TDUC 3RZDJ 1L0OC 3A0BC 3P9CA 5J3OA 4OJPA 3M07A 1S7AA 4KIFA 1MD0A 4DOZA 3CCSB 3P26A 5KVRA 4A5NA 1E62A 4BQAA 4A6DA 3SEQA 2VJ5A 1BW5A 5FLXZ 2OTLI 1HDPA 2DQRA 3LMMA 3E5QA 4CH7A 4AIKA 1EFRA 2WV0A 3RYRA 1SVLA 2CNDA 1V0FA 4ZC3A 4YZXA 1XQBA 2EWEA 2FNAA 1U8BA 3O3KA 5E79C 1VQLI 3DBLB 2OAZA 1W36D 1MJBA 3K10A 2NNYA 1P6RA 3WBJA 1SVOA 2W6IA 4TMZA 4V2GA 5TJJA 4ZYDA 1FRNA 4RM0A 2V4JC 5IY5H 4EGYA 2LBFA 4IPAA 5HLHA 2DA7A 2RNJA 2YUSA 2VE8A 2Y0MA 2MBFA 5C3EJ 2KLOA 2YS9A 3I59A 2NXNB 1WRJA 1R7JA 4RAYA 1BJAA 1U5TB 1TWCJ 2QQBA 2R5ZB 3CCQI 1KGSA 2MH2A 3WE3A 2BSAA 2FOKA 1IN8A 2EFNA 2FU4A 3WWGA 2PG4A 5A89A 5H2FC 2V79A 2VNIA 4ENNA 4OIOF 5LRRA 2O0VA 4RD0A 3SZTA 3VNVA 1B72B 2X9DA 2XC1A 3FZVA 3BJAA 3BG5A 3WTSC 3E0JB 2BM0A 3GZ6A 1N0UA 4A3BJ 2ZTGA 3ZP5A 2EWNA 1WJBA 3AG3H 3LL7A 2A3SA 3KP3A 5A2QZ 2K86A 2QVOA 3P9IA 4CYDA 4M53A 1AMOA 5JVTA 4A0YA 3J81K 3S3OA 3WXMA 3HJEA 2IS6A 4F93B 3OYFA 3LOCA 1JJ2B 4AIJA 2FD5A 3SKBA 3B78A 3C2GA 2OC6A 2IS1A 2CUZA 2M5WA 1OR7A 4DIQA 4GDFA 1R5GA 3V4GA 5TV2A 4BEHB 3EUAA 2QSFX 4U0WA 4FE7A 4H0EA 5HS8A 2J8KA 4PK4A 1D1BA 2OJED 2O04A 2EH3A 1SD6A 2PMUA 2PE3A 1JA1A 4Q5SF 4BE2A 2EZKA 2HTSA 5HOOA 4ZCMA 2EIJH 2HVSA 4GGGA 3WU0A 4QPQA 4L0ZB 2NT9A 1UELB 4L9NA 2DI3A 3FK7A 1JKQC 1QFYA 2OPTA 2W00A 1G7TA 3JTHA 4KT5C 5FNZA 3CJQB 3OSFA 2DT7B 2Y9YA 2IXSA 2BM6A 1KYZA 3W5HA 1FLIA 2P81A 3ISXA 1IN7A 2IP2A 3I3LA 3T0YA 4MEXF 1ZQ3P 3T5XA 3EPZA 2LMDA 4KDPA 3TKYA 3WNDA 1YTYA 1CGPA 3I4PA 2JUGA 4ASUA 3PA2A 5KW9A 4HF1A 2WADA 4HG2A 5KAIC 2H6BA 1ZLKA 5HLIA 4PABA 1SVMA 2MW8A 3IC7A 2GWRA 1OCRH 1R5HA 4J01A 1Y0UA 3RDIA 4Y9RA 1XMKA 3CLOA 3G05A 3K0LA 1QQIA 4NQWA 2XTXA 1E3XA 4HV6A 3I4MJ 5E3MA 1Q1VA 2ESNA 1X1PA 3OYEA 4EM1A 2GOXB 4BS9A 4IF4A 3HOSA 1N08A 2JN9A 3KEWA 4PUSA 5FO0A 3IHUA 4F55A 2E1MC 3L09A 3K7AJ 3BR5A 4WXDA 3PETA 4MLOA 3JRDA 1G3YA 4Z4RA 2AHQA 4BL0B 1Z77A 2H27A 2IA0A 2L01A 1KU3A 2M3AA 2RKHA 2VC0A 1ODDA 2VBTA 3M8JA 3E1SA 1KD1D 3JR9A 3HOVJ 1RZ4A 2O1DA 3PSZA 2VBUA 4PFPA 2O8KA 2V7TA 2D45A 5TRDA 3W2IA 2L7ZA 2R7QA 3S1RJ 4ITVA 1K8AD 3C2BA 4FETA 5IYPA 2Q0OA 2JSCA 3BY6A 4KT6A 4RGRA 1HOMA 3CRZA 5FKMA 1HCRA 4UXNA 1IV8A 2FJ1A 1EH6A 1X1CA 2LSOA 5B5EC 1D5YA 4IHSA 1J9ZA 1VF7A 4MQVA 2CC2A 1T0FA 4DNRB 3BTLA 1OKRA 1USTA 2AXLA 2M5SA 3G6EB 2BHYA 2EA2A 2FNPA 3PQJA 4ON0A 3CESA 4RB3C 2P6SA 1LQ1A 3CO6C 4EJTA 4D0PA 3Q38A 4M3BA 3CTAA 1BA5A 4RCYA 1HKQA 2N8GA 1MBHA 4LK0F 4EJUA 4AYBN 4HDUA 2D1HA 3VWBA 1V3FA 1V0EA 3K1PA 4YAWA 3T56B 3JREA 4KKSA 2GOMA 1OCPA 5IP7J 2DA1A 3SUCA 3MWMA 4C3HJ 3O2PE 2DMPA 3OS1A 2X0KA 3Q6RA 2CSOA 3B6AA 3R61A 1CNFA 5K1YA 3LMWA 3BZ6A 1OGOX 3ROUA 1TC3C 2L7MP 3DKXA 4IRIA 1BR4A 1OOCA 1QA3A 1IXCA 5D6EA 3U1DA 1TYVA 4BJTA 2F6CA 1E2XA 2DAOA 4LB6B 1DARA 5TR9A 1FBUA 4IJAA 4HV5A 2TCTA 1ETVA 1W35A 1YI2B 5JLWA 1MABA 3NWSA 2M30A 4AVZA 4G7XA 4YC5A 1UHWA 2G7HA 1CQXA 5EG0B 1BI3A 1BIAA 1MH3A 4U87A 1K4SA 4N9IA 3ZMSA 4RJLA 2WZPP 1W0TA 2ZZFA 2W82A 2ZMEC 3AL0C 5CKTA 2BY3A 3PJRA 1ACIA 1VQ8B 5F0HA 1EZGA 2W57A 1HKSA 5B1BH 1V5GA 2XKOA 3QOEA 2EZLA 3J81Z 2Y9ZA 4N3GA 3BC8A 3VFZA 1IXRC 3LAJA 5FKKA 2JVHA 3HOZJ 4P22A 3GZNB 2QA4I 5F08A 2BW3A 2UXNA 3J7YJ 1Y0YA 3C2HA 4FK8A 4MEYF 3OIQA 5CYVA 5DN6A 1VQ4B 4BH9A 2LY9A 4A0XA 1XCVA 5IYWA 4PJMA 4LD5A 2OCEA 5JLVC 4E70A 1EH7A 3V8LA 4B4CA 1MZBA 3BG3A 3Q6QA 3NARA 3EUKL 4FT8A 4CCMA 1HA3A 3G71B 2JRTA 2KMUA 3GEZA 3T1BA 4OM9A 1Y6IA 4CCNA 2P6TA 1FIAA 3LQQA 5EGOA 5ILUA 1HF2A 4Y15A 1GVDA 1AKHB 1RIOH 1D2EA 5D5UB 1I50J 2DA2A 5B1AH 3KX2A 1GXPA 1JGGA 4CHUA 1TW3A 3F8CA 3QWLA 3IRQA 1R1VA 5J3LA 1I7PA 1MMGA 1WFXA 2YX7A 3GW2A 3GWZA 5D4SA 4G8XA 3ZZTA 2OTLB 5IP6A 4PC7A 1H80A 3HL2A 2XDVA 2VNKA 1R9TJ 2R7RA 3PIOF 5FRMA 2ZZQA 2P7VB 2E1NA 3L9FA 1VQLB 2ELHA 2E36A 2KZGA 2JRMA 4AUXA 3GVKA 4CCLA 3AAFA 5J47A 2GZWA 3DLLF 1ON1A 2A6EF 2VN2A 4JQFA 3S2DJ 4QLCU 3ISPA 1K73D 3E5XA 1U8RA 2ZBUA 2V9VA 1K5CA 5BSYA 4EJVA 3RYPA 4PSXA 2CG4A 4EATA 3JSOA 3BDDA 2VQCA 4JMQA 1NRKA 1O3QA 5KAFC 3V76A 3OAAA 4X06A 1YO5C 2KVOA 4PFOA 2ZXIA 2XOKA 1G7SA 1J09A 4ZCIA 2Z8GA 1EA0A 3FMQA 2L9RA 4MO7A 5F64A 1APLC 3CCQB 4FWTA 3DEUA 2V5IA 2HPIA 4RMNA 4YFXF 1FOYA 5D4RA 2VFPA 3Q0WA 2PJPA 3ZMUA 4WZEA 3AKZA 2GQQA 1GHCA 1T33A 2XPWA 3BWGA 4M71A 5K7HA 3BC9A 1EJ9A 3PUMA 1LJ9A 2COBA 3ZMVA 4IOCF 3L7WA 2KPMA 2NVXJ 1AIPA 5DYMA 2GBYA 3OIPA 3RI4A 3JRFA 4A3KJ 1X1DA 1G59A 1NB0A 3SFIA 3K4BA 4Q4ZF 4TSFA 2DOFA 4UV9A 5JFRA 3CCLI 2WY7Q 2EQRA 1QHHD 3V42A 3DU5A 3ZMDA 2ZITA 2ZNZA 2PYGA 3N6ZA 4U4BA 1F5TA 2C4UA 2XIGA 9ANTA 3PA1A 1C0WA 3ZZUA 3GQ9A 2XSDC 1WJAA 2H8WA 1G3TA 4KA4A 2C6YA 1TT0A 2GA1A 2R93J 1XFOA 1O8EA 1IDKA 2ZCWA 1YX2A 2DJNA 4UVCA 2F4NA 3JRHA 2MLKA 4XIDA 2X4HA 2XAFA 4WK8F 1FNBA 5JMCB 5DCMA 1RKTA 4DQLA 1LEAA 2DW4A 2CU7A 4HZFA 4X0CA 4RGSA 1M1KD 4KJZA 2QSGX 2NTQA 3HOUJ 2O9LA 2CV1A 4Z4ZA 5FKLA 4TN1A 2WZNA 3EETA 5AMVA 3A02A 3VSUA 5M5WJ 1U2RA 2MSYA 2KIQA 3W2VA 2B9SA 4G7WA 2A6TA 3KIOA 4IHVA 4YG2F 1HBXG 1ETKA 1MW7A 1MBFA 2GLOA 2XNJA 1FTZA 5AIQA 2VYQA 2OBRA 3D26A 1AWCA 4V02C 5KNLA 2G7UA 3HC7A 2M8GX 3I5UA 4PGGA 4QV2A 3HRMA 2BX6A 1TWGJ 3DV8A 3DEEA 2NVQJ 5DD4A 3UW0A 2XPUA 2ZC2A 2QN6A 1S72I 1ZM9A 2YUHA 1WSRA 4U7DA 3S15J 3BPXA 4UZFA 3P7NA 4D1QA 1ZUNB 2OZUA 3DTIA 1AU7A 1QPMA 2V1DA 1FNDA 3BY1A 1O8MA 2VJIA 3KEOA 1QG0A 3GCMA 2Q8KA 2BGJA 2R9VA 5FD5A 3GVJA 1DPUA 4ZGNB 1OYIA 1SFKA 3JRIA 4OIRF 3SZGA 4DNTB 2VXZA 2HVRA 5GTHC 1P92A 4KITB 5E18F 1ZELA 2XF6A 4IOAF 3DTKA 2E1OA 1OCTC 4B43A 4LIUA 1V5FA 1WQ2A 1QGPA 2ID3A 2K27A 3VOEA 4XRMA 2B0RA 1IB0A 1Z05A 3A01A 3WTUC 2P4WA 1B9NA 2V1UA 4AM3A 4OJLA 4RLQA 2PJRB 2M1BA 3Q3AA 1XC5A 2L3DA 4XLAA 2HU9A 3FBNB 1K28D 1FOWA 1OYWA 1EA3A 1J0RA 3QP5A 5E8IA 3LFUA 2D9RA 2DY1A 3FY3A 3GTOJ 5CDFA 1R58A 2PN6A 5E8GA 1KZHA 2R7WA 1JXSA 1H8AC 2PJRA 2FSWA 1FP2A 1QZEA 4HOBA 3JAMK 1D0ZA 4K1XA 2MABA 4RLZA 1N07A 2K4BA 4AC0A 2MYSA 1BC8C 2ZSIB 4BJ5C 1E79A 1FDRA 4YIFA 4TMXA 1QHGA 2BGCA 4U7BA 1H9TA 3OPOA 2O0YA 4C3IJ 3H36A 3DU6A 3NRVA 2ZL5A 1P4WA 2FX3A 2FX0A 5IOZA 3BH6B 2NS8A 4NNJA 2EZHA 4AF6A 1ZG3A 2RN7A 3WTXC 4GXOA 5EEHA 3JU4A 4ZTJA 1YRNB 3RIRA 5F1RA 1XDSA 2VBVA 3EQLF 1N8RD 1LEBA 3CUOA 3HHGA 4WWCA 2O7OA 1YLOA 2FVGA 3VMVA 1P7IA 2BYVE 1H85A 3I0TA 3CDLA 4MYUA 4PC6A 1JHFA 3HKZN 3I1FA 4GRIA 1FY7A 2DJIA 5FKOA 1MBKA 1FPQA 3LSMA 1IUYA 1QA2A 3KEYA 2JVGA 4WZLA 3CJRB 3QPSA 1FWZA 1AIRA 2DN0A 3J7AY 2CFOA 1F4KA 4IHXA 5J1RA 3HSEA 1EFCA 1WOPA 2BF4A 2V26A 3DP7A 2X48A 3L2CA 4RAZA 4UNOA 5B6IA 5BNGA 4OOXA 2KKOA 2XT4A 1A6QA 2CV0A 5DEQA 3WGHA 3H9NA 4LLNA 1Y8RB 1DU6A 3CO7C 1HZEA 4CCJA 1Z3YA 1EP2B 1RI7A 2E19A 3H5RA 5FLXK 2R5YB 2CUJA 4YFKF 4X05A 1BM9A 2NV4A 2HI3A 5KCMA 2HQRA 2RQPA 4I09A 4B1RA 4MYTA 1RUNA 4R71A 1D8JA 2VQHA 3JSPA 2ZXWH 2XAUA 4Z4SA 1IRXA 2F5FA 2OA4A 1TZLA 5EYRA 1YE9A 4M73A 1DBGA 3IRRA 1OFMA 1HC8A 1NB9A 2XRLA 3LSTA 4E6KG 3K2ZA 2QA4B 4JBAA 3MKZA 1MMNA 1XCBA 3BLYA 3BR1A 1Y56A 2D1VA 3F8MA 1Z0XA 4HQMA 4XRSG 3WHCA 2GIZA 2Z2SB 5DS9A 3TMOA 4LBYA 1LDDA 2CFXA 1B8IB 2KT0A 3DTEA 2Q6KA 4B4DA 4D9JA 1MJ9A 3E6DA 3Q9VA 5K5OA 2IEKA 3V7CA 3E97A 1XN7A 5J35A 1QH0A 3MFKA 1EE6A 4EQQA 1N0VC 3L2WA 3WG7H 3KRGA 3DBHB 1UD4A 2XGEA 1QVTA 5BPIA 1JKRC 1DG1G 3Q0VA 2ZTNA 3SZEA 4CYCA 1FBQA 1LLZA 2CO5A 1TNTA 4HPQA 3U21A 4KMUX 4CCOA 3BR2A 4UB8C 3OKXA 3TQNA 1R6RA 4PCQA 3IV5A 2LZJA 4FCYA 2RGVA 1KA8A 4NB5A 2PIAA 5B3SH 2DK8A 2L9NA 2WV1A 2XAJA 3F23A 3RKQA 3A8JA 5HS7A 1K61A 2QZ8A 3CC7B 3VMWA 2EA4A 3RY8A 4XM3A 2VOPA 2FBKA 1KC8D 1UAAA 1K9MD 3RJPA 4XONA 2CQNA 2X8KA 1WSUA 2ODLA 1OHHA 3HG9A 2R7SA 3FXLA 3HRSA 3JCUC 5B66C 4CSWA 2F5CA 3S2HJ 2BZTA 2DFHA 3SJMA 1XGOA 1HXDA 3JX8A 4TKOB 1DQUA 5JVGF 5THXA 3HDDA 2DA6A 1UMQA 2HQNA 4ZYAA 1PP8F 4G6IA 4JRAC 4E7IA 4YZ0A 2XF5A 2F4IA 3LNQA 3ECOA 3CC2I 3HSRA 3FPPA 1RMGA 2CQKA 2RDPA 2PMZA 3GTKJ 1YJ9I 1OCOH 3ECHA 2PLYA 1U2WA 2CW7A 3CCRI 4FX4A 2QLZA 3I56I 1OGIA 5DS0A 1SD4A 5DDGA 5C4JJ 1U9OA 5GAHJ 4UUSA 3DDYA 1S9HA 3R6SA 5H20A 3VSKA 3HOTA 1I6HJ 2E35A 4B48A 1QUEA 3ASSA 1D0YA 3IH2A 3ML3A 2ZXJA 1IN6A 1IC8A 1Z6TA 3CMMA 1E3PA 4B3FX 4E7SA 1OFDA 1JNYA 1MNEA 4ZZLA 2HXOA 4BAYA 4MQ9F 2LLKA 3WGGA 3QAHA 2K5CA 1UFMA 4P55A 1K8FA 4RD2A 1ON2A 3CCLB 4CO8A 4LOCA 2XF7A 1XPXA 3OYCA 1VTNC 2CV2A 3GVLA 5BPDA 4ACAA 2J7KA 3ZR8X 3HSFA 3CP2A 3ULQB 4B3AA 1W7PA 2KRHA 4OOVA 2X6YA 1O4XA 1ZRCA 1AOYA 3CW2A 3H9QA 2R7TA 2XPVA 5D8LB 2QEXI 2L9VA 3VNUA 4YXWA 2A05A 1OFCX 4P9FA 1H88C 1WMRA 1IHMA 1BI1A 2XNDA 4E0FA 2CWEA 3QPLA 1U3EM 3BROA 2L7FP 2JDIA 3JQRA 4ZDLA 1FMWA 3VDXA 2FE3A 3QSYA 2OBPA 1YITI 5J8CA
chains in the Genus database with same CATH topology
2M3AA 4XN0A 3M8JA 3B4NA 1X1AA 1X1BA 3E1SA 1O8LA 2VQGA 2WAFA 3SYTA 2O1DA 2F5VA 3BCBA 4PFPA 2M0MA 3BH4A 2R7QA 4ITVA 2VBEA 1QU3A 4FETA 4YRVA 4KT6A 3TBIA 4FXUA 1MNDA 2MD0A 4XD7A 1H8HA 1UD2A 1VF7A 2HLDA 1X1CA 3GQAA 4DNRB 3MMYB 4XQFA 3K70C 1E43A 1RU4A 3TL4X 2M5SA 2VASA 1BMFA 3EUHC 2X3HA 4URRA 2LBFB 4IKFA 3CESA 1WJEA 2HDWA 2L5QA 1WTHD 4PSWA 1WJDA 4BE1A 3S8PA 2NSPA 2GK7A 3H9JA 2UUZA 4OJ5A 1WP6A 3OYJA 1G8XA 3LNNA 2QKMB 1BN8A 2JIZA 3S32A 4NUBA 2V9KA 3VWBA 1V0EA 4KISA 1JI8A 2X1EA 4Y3OA 3T56B 3K4NA 4KKSA 2GOMA 3DPUA 3SUCA 1OGMX 3K4CA 3OS1A 2INVA 3DLAA 1KONA 1N75A 2CH0A 4II2A 4DBRA 4FASD 4C2UA 1KMHA 3LMWA 2Z6BD 1FMVA 4XMYA 1OGOX 3OWTA 4OAZA 3SDBA 5KHDA 2X85A 3DKXA 3A4CA 1BR4A 1OOCA 2R7VA 5FROA 3CP8A 2M4GA 2F6CA 2KQRA 4BJTA 1IB4A 4HSTA 3PFYA 1W36C 2IGNA 1VLYA 3OE7A 2LC2A 4NK8A 2CW8A 1MABA 3NWSA 4AVZA 4G7XA 2HNHA 3S93A 2LREA 1UD6A 2V31A 3T9GA 2QXZA 1X4PA 3GBGA 3I9V2 2BVMA 4U87A 3K6GA 1PLUA 2HZDA 2WZPP 4BXFA 3QYEA 1P9QC 3S3NA 2W82A 2E5NA 3AL0C 1E3ZA 4N4NB 5CKTA 2ZZFA 3PJRA 1E0EA 3HAGA 3NWTA 2K9MA 4F3QA 1V5GA 3QOEA 4ZJZA 3BC8A 2XSJC 3L2VA 1D0XA 1DGRM 4P22A 2JVHA 4BUPA 2NTPA 1NHCA 4XR6A 2F1MA 4TT3A 1VZ0A 2BW3A 2D3NA 4F92B 3C2HA 4I84A 3OYLA 3EQNA 3OIQA 3OW7A 5DN6A 2NT6A 4PJMA 3PNVA 2E60A 2VQLA 4XL9A 2X1DA 4OZZA 1PJRA 2VKHA 3EUKL 4CCMA 2W7NA 1BLIA 1WPCA 1OFLA 4J00A 3H35A 1JTAA 1N77A 2KMUA 3LSKA 2WAQA 3DPLC 1Y6IA 4CCNA 1IDJA 1O8KA 2X6WA 1VJSA 1QJVA 3VSLA 2GJRA 2LYCA 4AU7A 2ZSHB 2HPMA 3DQVC 2L2OA 3PSFA 4NQWB 3RSNA 1NBMA 1BR2A 3FHNA 1ERDA 3KX2A 3OL4A 3IAS2 2E5ZA 4XLEA 1IA5A 3FBIB 1MMGA 1WFXA 4ZDPA 1PE9A 4Y33A 4BGDA 2XZOA 1H80A 3HL2A 1HG8A 2XDVA 2R7RA 5FRMA 3W2AA 2ZZQA 2RNGA 2ZZEA 3QYFA 3VYUB 2CK3A 1LKXA 2O0WA 3GVKA 5HNHA 4CCLA 2VB6A 4JQFA 4H4KC 4DBQA 3DKYA 3MD2A 3AFHA 1K5CA 2K3PA 2QX3A 3LSHA 4PSXA 4C2LA 4EATA 4XLCA 5CPRB 2D3LA 2VQCA 4JMQA 1NRKA 3OYHA 3OAAA 5CQEA 2VXDA 3VYSB 4PFOA 2ZXIA 4XKVA 2KVOA 1J09A 2XOKA 4NC7A 2Z8GA 2NOJB 3FKSA 4BDYA 4XLFA 2M4KA 2HPIA 4ANJA 4RMNA 4ZTFA 1KCDA 4QPOA 3ONQA 4XKWA 1MMDA 3HKZA 5HNFA 3ZPPA 2XZPA 1UG0A 3AKZA 1VBLA 3H5AA 4PJLA 3BC9A 1W0KA 3OFNA 3ZRGA 2XZLA 1O8HA 2I8DA 2KPMA 4U49A 2QE7A 4E7KA 3OL3A 2ZZGA 3VR6A 3OIPA 1G59A 1COWA 1X1DA 4BQQA 3A2KA 3K4BA 4TSFA 2IGMA 3QODA 4HSRA 4MXNA 2JJ2A 2WBMA 2WY7Q 1XG2A 1QHHD 3V42A 3D5RC 3DU5A 4YEJA 1O8JA 3OMYA 2PYGA 3L2UA 2LY1A 4UZUA 3D5SC 3PNTA 1NG7A 1Z7LA 4E7LA 3ZGKA 3GQ9A 3W2WA 1WJAA 1Z3XA 1O8EA 1TT0A 3BG7A 1OR7C 2RREA 1IDKA 4LITA 2E1MB 2V7QA 4XN3A 3K4JA 2XGJA 2KP6A 3OYKA 1DP3A 3NE5B 3OYBA 3OOUA 2DIEA 1X4OA 4KJZA 2Y0SA 4HRIA 2NTQA 3GRHA 2CV1A 3OYIA 5AMVA 2KZVA 2R4GA 3PUBA 1JRGA 3VSUA 3VYTB 4XORA 5LD2C 1UD3A 3W2VA 4C9YA 2VJ4A 2VPLA 2A6TA 3H0DA 2E1BA 4G7WA 2BSPA 2O17A 4Z06A 3BG6A 1MW7A 2W1OA 4Z05A 3H94A 4CCKA 4DJAA 3OYAA 5FRNA 2GJPA 4B44A 2HVQA 4AYBA 5KNLA 1HVXA 2F43A 5FL7A 3HC7A 4XOTA 2Z16A 2BW3B 4CUGA 3DEEA 1PKVA 1D1AA 4KKUA 2Q1ZB 2WPDA 2UVFA 3UW0A 3UNGC 4PJNA 3HPHA 3QYBA 1GQ8A 4W8QA 5C1CA 2ZXHA 4D1QA 5C1EA 4BJ6C 1UD5A 4XKBA 3DTIA 4II3A 3ZXSA 3OYNA 1O8MA 4LIVA 1DGWY 2MFZA 2IGKA 2VJIA 2M7AA 2R9VA 3B8YA 4W8RA 3GVJA 3VSTA 3IP4B 2V6EA 1SFKA 4BACA 3SZGA 4DNTB 2VXZA 2HVRA 4XKCA 4KITB 1ZELA 2K9LA 2XF6A 3DTKA 2UWMA 4B43A 4LIUA 4Y4RA 2VBKA 1V5FA 4HNUA 2OUMA 4DK0A 1MMAA 1V5EA 1I8DA 4CA0A 4F91B 1PXZA 5HKKA 2A5WA 4RLQA 2VLAA 2PJRB 1E1QA 4OJLA 1Z21A 3PSIA 4XLAA 2HU9A 2LY2A 3FBNB 3LSGA 5HLTA 1H8EA 4PJJA 2WB1A 1K28D 2GK6A 3K4MA 1EA3A 5IK2A 2PECA 1YX3A 3LFUA 2O5RA 3H5NA 3FY3A 5CDFA 3HUGB 1GLNA 2Q2EB 4F52A 2R7WA 2PJRA 3OY9A 1D0ZA 4P5OA 4BEHA 2MABA 2DCEA 1T0FC 2MYSA 2ZSIB 4BJ5C 1E79A 3T51B 4Z03A 1QHGA 3PL8A 2WA0A 2WAEA 4RM2A 4U7BA 1N78A 3AL0B 1SAUA 3OR1C 3RPUD 2R7UA 4IX7A 3OPOA 4BQOA 3DU6A 1I18A 4W8TA 1YX5A 2BOLA 1KCCA 3DWLE 4NNJA 3OEHA 4NK6A 3BCDA 3ZIAA 3JU4A 4ZTJA 3KYLA 1X19A 3A3BA 1WJ5A 3HPGA 2X53S 3L2RA 2AQEA 2LOOA 3A1YA 3RQ4A 3VMVA 4YELA 1KZLA 4OAYA 4GQNA 1T95A 1O8FA 1BPLA 2IGOA 4E7ZA 2VIXA 4GRIA 2KDOA 4E4HA 3IUOA 1O88A 2DJIA 3A35A 2FUG2 3SEZA 3LSMA 4C30A 1OLTA 3KEYA 2AQFA 5CQGA 2PYHA 2JVGA 3CJRB 3OYDA 3K70D 1HA8A 1AIRA 3J7AY 2CFOA 1E1RA 4BU2A 1T5EA 2IS2A 2V26A 4P1WA 3OYMA 3GQ7A 4PMHA 2QY1A 2CV0A 1PYVA 2HQAA 4U4BA 2WY8Q 1HZEA 4CCJA 1Z3YA 4X0GA 2KHMA 4OJPA 2W4SA 2CMPA 4DOZA 2R7XA 2P0WA 2VJJA 3H5RA 2CUJA 2LH9A 5TGTA 4W8SA 2JSPA 5KCMA 3RTRA 4ZDOA 1FX0A 4BE0A 3SEQA 2VQHA 2VJ5A 3WQZA 3BCAA 2XAUA 3ZSCA 3LMMA 1DBOA 1IRXA 3T53B 4L8JA 1TZLA 4CH7A 3B90A 1YE9A 3ZQQA 3OYGA 1DBGA 1EFRA 1O8GA 2IS4A 1OFMA 4E6KG 1V0FA 4ZC3A 1UD8A 4YZXA 3OR2C 3MKZA 2EWEA 4RM3A 2DT6A 1MMNA 3EQOA 3BLYA 2IQ7A 1Y56A 2NZMA 2Z2SB 2NSTA 3TMOA 1W36D 3H9GA 3K10A 3DTEA 2R7OA 4D9JA 2W6IA 3HXLA 3S3MA 2V4JC 4HNTA 1BHEA 2LBFA 2M7BA 4HEA2 1EE6A 3MKWB 1U0JA 2KLOA 3MKYB 3L2WA 3KRGA 3FKJA 1UD4A 4E7JA 4RLFA 4XOPA 2ZTNA 4EW9A 4HPQA 2DOAA 3U21A 3GQ8A 3WWGA 4CCOA 1SKYB 2Z1DA 2V1NA 1R6RA 4HIZA 1RWRA 2LZJA 3GQBA 3VSVA 3ZCOA 2L9NA 5HVQC 4HWVA 2O0VA 4OWRB 4OJOA 4Z1MA 2OV7A 3VMWA 4JOMA 3E0JB 4XM3A 3OS2A 2JJ1A 4OZYA 2ZTGA 4E7HA 4B3XA 1WJBA 3LL7A 3CZ6A 1UAAA 4XONA 2X51A 2ZFUA 2X8KA 2UVEA 2ODLA 1OHHA 2INUA 3HG9A 2R7SA 4R79A 3S3OA 2KL4A 4CSWA 2IS6A 1LDKB 4KKTA 5JHFA 4YZAA 2UV1A 4F93B 3OYFA 5LFAA 1LVKA 1W9XA 4NC8A 2DXIA 2V7FA 2V4DA 1NG6A 3C2GA 1DQUA 4TKOB 2OC6A 2IS1A 2CUZA 4ZYAA 4DIQA 4G6IA 1KTWA 4YZ0A 1LFPA 4E7IA 2XF5A 4YZQA 2F4IA 3PNYA 4BEHB 4BQNA 3FPPA 3A3GA 3EUAA 1RMGA 2PMZA 4IQ4A 1O8IA 4PK4A 2CW7A 1D1BA 4DGWB 2X1CA 4B47A 3OOCA 1OB0A 1X0CA 2NTBA 2O04A 2WSSA 2VKDA 4BE2A 5HOOA 2HVSA 3DDYA 1S9HA 4QPQA 2RQQA 2MC4A 2NT9A 3CF2A 1UELB 1WJCA 2W00A 4G6TB 1BOBA 3VSKA 3HOTA 4B48A 2WJYA 3CJQB 1D0YA 2VL8A 2DT7B 2IXSA 3CMMA 4MR0A 4B3FX 4E7SA 4B3GA 3I3LA 1MNEA 1O8DA 2JA2A 3L2QA 2ELJA 3EPZA 3LSIA 2L7KA 3VYRB 4BDZA 3DPTA 1K6YA 2K5CA 3F9KA 2L9SA 2XC7A 4LG3A 2VBMA 4ASUA 2JUGA 1W0JA 2GJKA 2XF7A 1WJFA 1BR1A 3OYCA 3BCFA 2CV2A 3GVLA 3ZPNA 2WADA 2QKLB 4HG2A 2W6JA 4OJ6A 3ZR8X 3CP2A 2WJVA 3N05A 4J01A 4C2TA 2KRHA 4XNFA 1QCXA 2X6YA 3IAM2 2X6XA 3G05A 1D1CA 2CS3A 3JURA 3K4LA 4N4OB 3H9QA 3UR3C 2R7TA 1E3XA 3OYEA 2BVLA 3K4KA 2GOXB 4BS9A 3HOSA 2KRCA 4CZCA 4XLHA 3FDYA 3KEWA 4IZZA 4YXWA 4PUSA 1WMRA 4F55A 1CZFA 2XNDA 4E0FA 2E1MC 3G2BA 2JDIA 4MLOA 4IQJA 2LRDA 3OEEA 3D5LA 4ZDLA 1FMWA 3VDXA 3W3CA 4BL0B 1AA7A 2LG4A 3RCOA 4DK1A 3OS0A 3M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN0 A;  1O8M A;  3B4N A;  2VJI A;  1O8L A;  3B8Y A;  4W8R A;  3VST A;  2O1D A;  1BHE A;  4XLE A;  1IA5 A;  1EE6 A;  1PE9 A;  2VBE A;  3KRG A;  1H80 A;  1HG8 A;  2VBK A;  4XOP A;  3GQA A;  4XQF A;  1PXZ A;  3GQ8 A;  3WWG A;  1RU4 A;  2O0W A;  4OJL A;  1RWR A;  4XLA A;  2X3H A;  4URR A;  3VSV A;  4HWV A;  2O0V A;  4OJO A;  2PEC A;  2NSP A;  4OJ5 A;  3VMW A;  1K5C A;  3FY3 A;  2QX3 A;  4XM3 A;  4C2L A;  4OZY A;  4XLC A;  1BN8 A;  4XON A;  2Z8G A;  4XKV A;  2UVE A;  2ODL A;  2INU A;  3SUC A;  4Z03 A;  1OGM X;  4XLF A;  1KCD A;  4XKW A;  4YZA A;  2INV A;  4W8T A;  3ZPP A;  1VBL A;  3LMW A;  1KCC A;  4XMY A;  1OGO X;  4NK6 A;  4YZ0 A;  1KTW A;  2X85 A;  1O8H A;  1OOC A;  4U49 A;  4YZQ A;  1RMG A;  1O8I A;  1IB4 A;  3VMV A;  4YEL A;  2NTB A;  1X0C A;  2O04 A;  4MXN A;  3EQN A;  1O8F A;  1XG2 A;  4YEJ A;  1O8J A;  2PYG A;  4NK8 A;  4AVZ A;  2NT9 A;  1O88 A;  3T9G A;  3GQ9 A;  2QXZ A;  2PYH A;  1O8E A;  1PLU A;  1AIR A;  1IDK A;  4MR0 A;  4XN3 A;  4PMH A;  1O8D A;  3GQ7 A;  2QY1 A;  2VBM A;  2NTP A;  1NHC A;  4XR6 A;  2NTQ A;  3GRH A;  4U4B A;  4OJ6 A;  5AMV A;  4OJP A;  1JRG A;  4I84 A;  3VSU A;  4XOR A;  2VJJ A;  4XNF A;  2O17 A;  1QCX A;  2BSP A;  2X6Y A;  4W8S A;  4Z06 A;  2X6X A;  2NT6 A;  4Z05 A;  3JUR A;  3ZSC A;  4XL9 A;  1DBO A;  4XOT A;  4OZZ A;  4EW9 A;  4XLH A;  1OFL A;  3B90 A;  1O8G A;  1DBG A;  1OFM A;  1CZF A;  1WMR A;  1JTA A;  2UVF A;  3UW0 A;  4YZX A;  1IDJ A;  2EWE A;  1O8K A;  3EQO A;  2X6W A;  1GQ8 A;  1QJV A;  2IQ7 A;  2NZM A;  4W8Q A;  5C1C A;  2NST A;  5C1E A; 
#chains in the Genus database with same CATH topology
 4XN0 A;  3G4S I;  2DO7 A;  2CW5 A;  3MVP A;  1U9N A;  2DTZ A;  4YAU A;  4P6V F;  1I3Q J;  1O8L A;  2ACJ A;  5M5Y J;  2HXI A;  2F5V A;  1E64 A;  2FOW A;  2M0M A;  3RQI A;  2YWG A;  5E3O A;  3BH4 A;  2Q6O A;  1R71 A;  2DK5 A;  4C0S A;  3J80 Z;  2RV8 A;  4N0B A;  4OMY A;  4QSH A;  3TBI A;  2RVC A;  4XD7 A;  1S72 B;  3TW6 A;  3REO A;  3GQA A;  4EVI A;  1O3R A;  2HMA A;  5H6R A;  2H8R A;  2VAS A;  3H0G J;  1BMF A;  3EUH C;  2YU9 J;  5GV7 A;  2LBF B;  4HX7 A;  1WJE A;  2HDW A;  3BTC A;  3H92 A;  1WJD A;  4PSW A;  2GK7 A;  3ESW B;  3W5V A;  3I59 B;  3TOB A;  1EP1 B;  3IL2 A;  1WP6 A;  2HKO A;  1XS9 A;  3GTJ J;  2IOU G;  3OYJ A;  1S6L A;  1TQM A;  4OPO A;  3BNW A;  2QKM B;  1BN8 A;  2JIZ A;  3S32 A;  2V9K A;  4KIS A;  2E2I J;  2OTJ I;  2P5K A;  2X1E A;  4Y3O A;  3K4N A;  3J7Z I;  3VO1 A;  1QO0 D;  4AWX B;  3QOP A;  3KLO A;  5J4Y A;  3WGI A;  2X0L A;  3K4C A;  1MGT A;  5BOX A;  3DLA A;  2HOT A;  3HEF A;  3ERM A;  4WX9 A;  2L4A A;  2CH0 A;  3SQV A;  1E3H A;  4WXH A;  5EF6 A;  3LAP A;  3TGN A;  4C2U A;  3W2H A;  3CCY A;  2L54 A;  4XMY A;  1DP7 P;  1QA6 A;  1JUM A;  3IKV A;  3UKG A;  2BXY A;  4DZJ A;  1ORK A;  3LO8 A;  2R7V A;  4PC2 A;  3RPU A;  3GUD A;  4DYQ A;  1SM4 A;  3PFY A;  1W36 C;  3CLQ A;  2IGN A;  1VLY A;  4XIC A;  3OE7 A;  2LC2 A;  1RES A;  2VBX A;  2OZ6 A;  4WWV A;  2F4O B;  1BBY A;  1IDZ A;  2V31 A;  1B2R A;  2EFQ A;  2LK2 A;  2PX9 A;  4P25 A;  1T6Z A;  2LD5 A;  1SAN A;  2Q6L A;  4PC3 A;  3AVY A;  2HZD A;  1XSV A;  1VQN I;  1O3T A;  1P9Q C;  1E3Z A;  2E5N A;  1P7J A;  4N4N B;  4P3Y A;  4RDK A;  3EYY A;  3HAG A;  3ZBT A;  5FA6 A;  3JRA A;  2ESH A;  1MBG A;  2K9M A;  4JYK A;  4EJO A;  5LBQ A;  2GRE A;  2F48 A;  2YSR A;  5F0F A;  1D0X A;  3R4K A;  1DGR M;  3BQZ A;  4BUP A;  3ML6 A;  3TW7 A;  4C43 A;  4V19 K;  4LG0 A;  2FML A;  5LLQ A;  1BI0 A;  3VEP A;  2D3N A;  4F92 B;  5IYN A;  2JMW A;  5CVJ A;  1A6I A;  3OYL A;  1ITY A;  2HEO A;  3OW7 A;  1R1T A;  1R4M B;  5HXB A;  4J0Q A;  4G7Z F;  2V7X A;  2DPD A;  1QGA A;  4YFO A;  1I1G A;  4EJW A;  2A68 F;  3GO5 A;  2X1D A;  2XGD A;  3IWZ A;  3F0C A;  2VKH A;  3ZMZ A;  1KQ9 A;  1W5S A;  2F4M B;  5HDN A;  1WPC A;  2XUB A;  2V6C A;  3SY2 A;  1JTA A;  1VQP I;  3LSK A;  2WAQ A;  2NS0 A;  2HYF A;  4QIW N;  4OP7 A;  2FA5 A;  1UHM A;  4MFD A;  2X6W A;  1VJS A;  4HLY A;  2PFB A;  1QJV A;  3FWE A;  4GO1 A;  1S29 A;  4M9S A;  3DQV C;  2HPM A;  3AG1 H;  3PSF A;  3RSN A;  4NQW B;  3AVT A;  1UG2 A;  3KP5 A;  3G3Z A;  5JI6 A;  1K7A A;  1TT5 B;  3B6C A;  1VHO A;  4KYW A;  1QGZ A;  3OL4 A;  2E5Z A;  2QYO A;  3KP7 A;  4I0B A;  4XLE A;  3JQP A;  1IA5 A;  3FBI B;  1ZAR A;  4A3L J;  3ASO H;  2BHZ A;  4ZDP A;  2JQ7 A;  1HG8 A;  1PP7 U;  3BG9 A;  5M3F J;  2Q2E A;  2ZJQ F;  3Q0U A;  2HWV A;  1UHS A;  3B02 A;  1LKX A;  5L3E A;  5LMZ A;  3ZQI A;  1XSD A;  1GDT A;  2VB6 A;  2IBD A;  2EPF A;  2LP0 A;  3C3W A;  2BM7 A;  3HOX J;  1K78 A;  2ZME A;  1B6A A;  1IF1 A;  3MD2 A;  4QVA A;  3ABU A;  2QQA A;  1DDI A;  3GYH X;  2Q6I A;  2QX3 A;  1BI2 A;  3LSH A;  2MGQ A;  3MCZ A;  5DM7 F;  3FKI J;  4F7D A;  1EWY A;  2VON A;  5CQE A;  1IRF A;  2VXD A;  3VYS B;  5KK1 A;  4GFB A;  2B5O A;  3WYA A;  3F72 A;  4N9H A;  1MSF C;  3AK5 A;  4RB1 A;  4PAA A;  3WNC A;  4BDY A;  1T6S A;  4ZTF A;  1Y8Q B;  2KJB A;  5F1J A;  1MDM A;  4Q7J B;  3ONQ A;  3PIP F;  4XKW A;  1MMD A;  1UB9 A;  3FX3 A;  3HKZ A;  3GTL J;  1U5T C;  2B7E A;  1D8T A;  2ZJP F;  3ZBU A;  4HLX A;  2XB5 A;  1O8K A;  2CF4 A;  3ZPP A;  1MH4 A;  2OK7 A;  1SFE A;  1ZTR A;  3WTW C;  4L0Y B;  3S14 J;  4M3F A;  4PJL A;  5DCF A;  2XRO A;  1VBL A;  2EFP A;  2DT5 A;  3WTZ A;  1KQ8 A;  3OFN A;  2XZL A;  5F4J A;  1KYW A;  5A8A A;  5EDN A;  1EV7 A;  1ZGA A;  4E7K A;  3S1M J;  4AC9 A;  1BJZ A;  2C2W A;  3I71 A;  1COW A;  2KIS A;  4I7H A;  2LKS A;  2P7C B;  1D8K A;  3A2K A;  3ZC3 A;  4Z4U A;  3J81 k;  2X6O A;  4C2M J;  2ZBV A;  3ABT A;  2WBM A;  4M74 A;  3EQN A;  2HQ5 A;  4L5J A;  4YEJ A;  2XGC A;  4Y17 A;  3JRC A;  4P3I A;  4QFM A;  4WZT A;  1O8J A;  1IJE A;  2LY1 A;  3AG4 H;  3R0A A;  1WZ2 A;  4UZU A;  3D5S C;  1WH7 A;  1V54 H;  1Z7L A;  1QFJ A;  2EFO A;  2K3F A;  2AS5 F;  1OR7 C;  2V7Q A;  5LGT A;  1KK0 A;  3NEU A;  3CC2 B;  1Q81 D;  2KP6 A;  3FXR A;  3PVD A;  1JJ6 C;  1YJ9 B;  1NK3 P;  2R92 J;  2M87 A;  3GLX A;  1H89 C;  5H59 A;  3CCR B;  4A3F J;  3I56 B;  2DIE A;  5ICC A;  4HRI A;  1IN4 A;  1ZR2 A;  1R4N B;  2KZV A;  2MLG A;  2ZNY A;  1YJW I;  3ABM H;  5L3F A;  2ZL7 A;  3MQ0 A;  5LD2 C;  4ESF A;  1UD3 A;  2R6H A;  2O17 A;  3F6O A;  1LE8 A;  2DTR A;  2BGI A;  4Z06 A;  2W1O A;  1PUE E;  1SMT A;  2XTY A;  3H94 A;  4CCK A;  4RPD A;  5FRN A;  1HKT A;  5ERI A;  4R8H A;  3TP3 A;  2JA7 J;  1GJR A;  5K5R A;  1HVX A;  3NAU A;  2O8X A;  4HF0 A;  1ZRF A;  2ISZ A;  4Y13 A;  1UCR A;  5GV8 A;  1PKV A;  2BW3 B;  2PMZ N;  4KKU A;  4RD4 A;  1D1A A;  3KP4 A;  1MNM C;  2I1L A;  3UNG C;  4NDL A;  1R36 A;  4JK1 X;  4W8Q A;  1W5C C;  3TO6 A;  5C1C A;  4RD1 A;  5C1E A;  1UD5 A;  3I64 A;  5BMZ A;  2IT0 A;  3PO2 J;  4XKB A;  3OYN A;  4KNY A;  4YIR X;  1WHU A;  4QTR A;  4IO9 F;  1A8P A;  2QMU A;  4W8R A;  1XX5 A;  4XKC A;  2QEX B;  2FEZ A;  2K9L A;  2KIM A;  2OQR A;  4NHJ A;  2Z9O A;  1VI0 A;  4HW0 A;  1JB9 A;  5ILS A;  4A6E A;  5EGO B;  2GAU A;  4Y4R A;  4S04 A;  4L9T A;  4DYC A;  4HNU A;  2OUM A;  5TIS C;  1LPQ A;  2VFQ A;  4GYI A;  4P12 A;  3SEJ A;  1MMA A;  2C5H A;  5HZA A;  1V5E A;  2PI0 A;  3OZW A;  1Z1D A;  4F91 B;  1PXZ A;  2FMY A;  1YIT B;  3PSI A;  3VB2 A;  3LSG A;  5CVU A;  3A0H C;  2K9Q A;  4XSZ F;  1FOX A;  2GK6 A;  3CB4 A;  1XE1 A;  1RC9 A;  5EZH A;  2PEC A;  4ENK A;  3M9A A;  3MZ8 A;  1GLN A;  2QQ9 A;  1GO2 A;  4KH3 A;  3CCU I;  4A3C J;  5DTD A;  1LUJ B;  5M3M J;  1JKP C;  3MCA A;  1T0F C;  1Q9S A;  1VQ5 I;  4I02 A;  1N78 A;  2WAE A;  3QP6 A;  4RM2 A;  3LSR A;  2STT A;  1SAU A;  4BQO A;  2EJR A;  3CD6 I;  4W8T A;  1YX5 A;  1ENH A;  2BOL A;  3WU1 B;  3W6K B;  3OEH A;  1O7F A;  2I5U A;  2PMH A;  3GSI A;  3I55 I;  5E6T A;  3A3B A;  1WJ5 A;  3HPG A;  4G6Q A;  4G7H F;  3LA2 A;  3BPV A;  3D0S A;  2AQE A;  2VOD A;  1ZRE A;  3OJX A;  2OTJ B;  4YEL A;  4FIS A;  3HOW J;  4J19 A;  4A93 J;  4OAY A;  5D5X B;  3GTM J;  2M0C A;  1T95 A;  1V4R A;  1FYK A;  1BPL A;  4E7Z A;  3PSS A;  4G5G A;  4YFN F;  1TW2 A;  2EV6 A;  4XLP F;  1RR7 A;  3SEZ A;  1TVC A;  5CQG A;  2AQF A;  3HTS B;  4KIG A;  3OYD A;  3K70 D;  3CCJ I;  4BHP A;  2VUM J;  4G1V A;  1J2X A;  1QPI A;  4Z2Y A;  4ROX A;  3CME I;  2JJ7 A;  4BU2 A;  1XGS A;  5D8K B;  2FF4 A;  2IS2 A;  2XNC A;  3GQ7 A;  1HDD C;  4GCV A;  4G12 A;  1ZR4 A;  2O6G E;  3KFW X;  3U1K A;  2KRF A;  3GX4 X;  5IYC J;  1R5B A;  3WE2 A;  1KQS B;  4XSX F;  2QZA A;  2RAE A;  3QU6 A;  3BTJ A;  2Z3Y A;  1T38 A;  2WY8 Q;  2NPF A;  1CF7 A;  4X0G A;  3GFM A;  3LFK A;  2W4S A;  2DYR H;  2ELK A;  4RAG A;  3G1O A;  1FT9 A;  2HOE A;  2VJJ A;  1CLW A;  2HZT A;  2IVM A;  1JA0 A;  2LH9 A;  3ONU A;  4W8S A;  5ICE A;  1VQN B;  1FX0 A;  4ACB A;  2OBS A;  4ZH4 F;  1PDN C;  4X7C A;  3K69 A;  5DCM B;  4MTE A;  3TO7 A;  4IW3 B;  3ZSC A;  1JGS A;  1ZK8 A;  3BCA A;  2JA5 J;  3BH7 B;  2DDA A;  2CBX A;  1DBO A;  2RC6 A;  2E71 A;  3T53 B;  5LEJ A;  2Y0S N;  4L8J A;  5EEG A;  3ZQQ A;  3OYG A;  1IUF A;  3PQK A;  1GT0 C;  2IS4 A;  3SDG A;  2CQX A;  2QF7 A;  1BN5 A;  1TWA J;  4P1V A;  2M34 A;  5GAD J;  1IRG A;  3EQO A;  4WCG A;  4D5C A;  3ZPL A;  4ABZ A;  4U9U A;  4YHB A;  5H6Q A;  1FSE A;  3H9G A;  3CDI A;  1KU9 A;  2BE5 F;  1RQR A;  2R7O A;  1QVU A;  5DNS A;  1SD7 A;  4S0H B;  4AVP A;  1FIP A;  1BHE A;  4P96 A;  4HEA 2;  4MIM A;  3FJO A;  1YG2 A;  2OQG A;  1B4A A;  3MKY B;  4LC0 A;  3FKJ A;  3HGY A;  4G6D A;  4E7J A;  1W87 A;  4M1K A;  1VQP B;  2XRN A;  1YJN I;  2NYX A;  4XOP A;  3VMF A;  1ZG1 A;  2J8I A;  3GQ8 A;  1SKY B;  2Z1D A;  3CQZ J;  1SKQ A;  2M8E A;  1RWR A;  1YW8 A;  1TBX A;  2OK8 A;  4Y7C A;  3ZCO A;  3NQO A;  3VSV A;  2EB7 A;  4L9V A;  4HWV A;  2IAI A;  2QSH X;  4Z1M A;  2OV7 A;  3ASN H;  2DPU A;  5F0C A;  3OS2 A;  2MG4 A;  3QRF F;  2JJ1 A;  4L5I A;  1GVH A;  4E7H A;  1L3L A;  3A01 B;  2LNB A;  4D7M A;  1BL0 A;  3HIF A;  2QTZ A;  1K6O A;  4I76 A;  5F27 A;  3EDP A;  2HFH A;  2WAQ N;  4FTH A;  1GUU A;  2KL4 A;  3H3V K;  1LDK B;  1SFX A;  2W85 A;  5JHF A;  1YOV B;  5LFA A;  1LVK A;  1NDH A;  2DXI A;  1QUF A;  2V7F A;  3ERE D;  1WGX A;  1X58 A;  2BY2 A;  2EZI A;  3KZZ A;  5JLX A;  3CCE I;  4TMV A;  3ABK H;  1QVG B;  4RB2 C;  5LRS A;  2CRV A;  1SD5 A;  2K85 A;  3OOP A;  3PNY A;  4BQN A;  5HDK A;  1F43 A;  1MKM A;  1G7C A;  2CQ7 A;  3MEX A;  4ETS A;  3A3G A;  3QFC A;  4PGO A;  2Y30 A;  5LEK A;  1H0M A;  3ZUG A;  1O8I A;  4DGW B;  2R7F A;  1X0C A;  4B47 A;  4Q48 A;  2WSS A;  4UVB A;  4X7F A;  5E3L A;  2E34 A;  1J9I A;  3QPH A;  3I58 A;  5BQT A;  4ASN A;  2DA3 A;  1FX7 A;  1VF9 A;  2MC4 A;  3CF2 A;  1OIS A;  4M6Y A;  1WJC A;  1XB4 A;  3L1P A;  3SLD A;  3N90 A;  2ZJR F;  4GYG A;  2RC5 A;  4M9Z A;  1K4T A;  1USS A;  2XAG A;  4RS8 A;  3HB9 A;  4I98 B;  3S2W A;  1OFE A;  1HF0 A;  4A3J J;  4MR0 A;  3E5U A;  2E7X A;  1A36 A;  3CC4 I;  1POG A;  2JA2 A;  3L2Q A;  2GXG A;  2JPB A;  3BR3 A;  4M0L A;  2L7K A;  3Q3S A;  3VYR B;  4BDZ A;  3DPT A;  3F9K A;  1VLO A;  4LG3 A;  1R5I D;  1W0J A;  2B7C A;  3BCF A;  2F1L A;  2QKL B;  2VT3 A;  2W6J A;  4RDJ A;  4OJ6 A;  1OB5 A;  1I5Z A;  4YCQ A;  4C2T A;  2OF7 A;  3IAM 2;  5IPA A;  2C77 A;  1YW7 A;  2X6X A;  1BW6 A;  2CS3 A;  3JUR A;  4N4O B;  2Y2Z A;  3FIW A;  3R60 A;  1QFZ A;  3ZN1 A;  1WOS A;  4CZC A;  1ZKG A;  3ELK A;  3WTV C;  3U6B A;  2Y31 A;  1YIO A;  2XB0 X;  2P5V A;  1R5O A;  4IQJ A;  3SHF A;  2Z99 A;  2CJJ A;  3OEE A;  2FXA A;  4HIZ A;  3W3C A;  3ASP A;  1YJW B;  2JK3 A;  3RCO A;  3OS0 A;  1T8I A;  1MBE A;  1YS6 A;  3P5J A;  5D6F A;  4PDK A;  2QYU A;  2O03 A;  4HA8 A;  5FLM J;  1OYY A;  3JRB A;  2VQG A;  2DA5 A;  4JP0 A;  2COM A;  2WAF A;  3BR0 A;  1O57 A;  3SYT A;  3J80 K;  3BCB A;  4B09 A;  1I27 A;  2YR2 A;  4L5E A;  1T6Y A;  2CUF A;  4M4S A;  1WWX A;  4RD3 A;  3A8K A;  4OOS A;  2VBE A;  1LDJ A;  5J1U A;  1QU3 A;  1YLF A;  3T8T A;  4LBZ A;  1W2B B;  3S1N J;  4YRV A;  2DEU A;  2IA1 A;  1F60 A;  4OIQ F;  4U0Y A;  4M3G A;  2MD0 A;  1H8H A;  1KK1 A;  1REP C;  3FMS A;  3OJW A;  5F4O A;  3MMY B;  4XQF A;  1E43 A;  2E2J J;  1LFB A;  1RU4 A;  1W34 A;  3TL4 X;  5KSW B;  4KUM A;  2P5L C;  4KMF A;  1GAQ A;  2X3H A;  2L02 A;  5AIP A;  4IKF A;  4G9Y A;  1WI9 A;  2PMD A;  3S8P A;  2NSP A;  3H9J A;  2UUZ A;  1PVE A;  2H09 A;  4XRF A;  4OJ5 A;  3OSG A;  3M8E A;  1G8X A;  3RKY A;  3F8N A;  2L0K A;  1QZZ A;  4CYC B;  4BY1 J;  1MMS A;  2J5P A;  1G3W A;  4M6X A;  3IH4 A;  1TYW A;  3DPU A;  3RIQ A;  3WY9 A;  4A3M J;  1UZC A;  1KU2 A;  3KZI C;  1EXM A;  5AN9 A;  3BY2 A;  3ZQF A;  5E3N A;  4I0A A;  1OGJ A;  2QEN A;  2PQ8 A;  4RAF A;  4Z4Y A;  3SJP A;  1KQ5 A;  1L1I A;  2Z6B D;  1QNT A;  3OWT A;  4XRS A;  2KDZ A;  3F6V A;  1QRY A;  2ZFW A;  4PGH A;  1TLH B;  1EFU A;  1P4A A;  3Q39 A;  3PEN A;  4ZCL A;  4ZYG A;  3CCU B;  1R5N A;  4ZV4 A;  3QFS A;  1VFC A;  1VQ5 B;  2FQ4 A;  3CUQ A;  4NK8 A;  5JHU A;  4FX0 A;  2VI6 A;  1K79 A;  6PAX A;  1PJ7 A;  2LRE A;  3CD6 B;  3BZK A;  5GTI C;  2QXZ A;  1X4P A;  3I53 A;  1OB2 A;  3GBG A;  3I9V 2;  2BVM A;  1F36 A;  2LR8 A;  3K6G A;  2BM5 A;  1FC3 A;  3BT9 A;  4MTD A;  3QYE A;  3V7R A;  3JRG A;  3S3N A;  1JE8 A;  4HX8 A;  2YWF A;  3LA3 A;  3I55 B;  1E0E A;  4BBR J;  2VZL A;  1GR1 A;  4F3Q A;  1WOO A;  4DQK A;  4ZJZ A;  4X7D A;  1I6X A;  3Q5F A;  4YII A;  4MGR A;  3QQA A;  4UUS B;  2B63 J;  4I01 A;  5TY0 A;  2K9S A;  5E1Z B;  2M2E A;  4TT3 A;  2LKX A;  1VZ0 A;  2DYI A;  3EUH A;  3GFI A;  1JTX A;  1YHQ I;  4HBL A;  3SQN A;  4I84 A;  2JT1 A;  3FMR A;  1E17 A;  3H1C A;  3CCJ B;  3WG9 A;  1DPR A;  3PNV A;  3WTY C;  2E60 A;  2NS7 A;  1QBJ A;  4BBS J;  4Y52 J;  3CME B;  2VQL A;  3KP6 A;  1G7R A;  3KPH A;  4XL9 A;  4OZZ A;  1KK3 A;  2W7N A;  1BLI A;  2FRH A;  4M6V A;  1NJI D;  4G7O F;  3LSP A;  3DPL C;  2ZBK A;  3FXK A;  1VQ9 I;  2NVU B;  2L4M A;  1OCC H;  1W7P B;  5DUK A;  4ESB A;  5J6X A;  3IH3 A;  3L00 A;  3ZQC A;  3N4M A;  4KFC A;  4WZK A;  1WDT A;  2LTP A;  4TMT A;  1VHE A;  4Z4W A;  1YYV A;  1BR2 A;  2IPQ X;  3V8J A;  3FHN A;  1ERD A;  2VBS A;  1S8N A;  5HS9 A;  2K02 A;  1ZM2 A;  2JA8 J;  3GTP J;  3IAS 2;  2WR8 A;  1H42 A;  1A35 A;  2GM4 A;  1PE9 A;  5FO1 A;  4BGD A;  2XZO A;  1T6X A;  1XD7 A;  3HUG A;  2E1R A;  2KIF A;  1STZ A;  1RPW A;  3GME A;  1R22 A;  2GXA A;  5CVI A;  4LJZ F;  3VYU B;  2CK3 A;  4D7N A;  3HRU A;  5DD8 A;  2VC1 A;  1TUI A;  2BM1 A;  5HNH A;  1ETW A;  4EM0 B;  1W1W E;  4RCZ A;  3M4O J;  2O61 A;  2QBY A;  4IRH A;  4DBQ A;  3TO9 A;  1Q1H A;  3AFH A;  5GPC A;  2HKX A;  1DDN A;  2O6W A;  2ECC A;  4TMW A;  1VQ7 I;  2XAS A;  2DMN A;  4MNU A;  4A3G J;  1YJN B;  1MRZ A;  5J1Y A;  2JPC A;  4ZYH A;  3KEQ A;  4IXA A;  2M4K A;  4XLF A;  1OJL A;  3TOA A;  4ANJ A;  4A3E J;  4QPO A;  1IJW C;  3GZ5 A;  1KCD A;  3AVX A;  3ZZ0 A;  5HNF A;  2XZP A;  1S7O A;  1UG0 A;  2EBI A;  4G1B A;  2NNN A;  1U78 A;  5FKN A;  1V5V A;  5BSX A;  1HST A;  1B23 P;  1W0K A;  3ZRG A;  2H1K A;  1O8H A;  2I8D A;  5LHI A;  4U49 A;  1FJL A;  2QE7 A;  2LKP A;  3BQY A;  3OL3 A;  2HOA A;  3VR6 A;  3LQ6 A;  5HZB A;  2KJC A;  3E6C C;  4O3M A;  4HAM A;  1M90 D;  4F7Z A;  4HNV A;  3SJZ A;  4Z4V A;  2IGM A;  3MZY A;  3QOD A;  4MXN A;  2QWW A;  1G3S A;  3ZQH A;  3HOY J;  2QM3 A;  2ECB A;  3D5R C;  5EJC A;  3L2U A;  1T56 A;  4H9G A;  2M9H A;  1GV5 A;  2ZJ2 A;  2JN6 A;  3PNT A;  2G0E A;  2NVT J;  1NG7 A;  4RGU A;  1XB2 A;  3BP8 A;  3FXQ A;  2JZY A;  2VNH A;  1Y1V J;  1EF4 A;  3LSJ A;  3F3X A;  3CCE B;  1P4X A;  4MHG A;  4BXX J;  2E1M B;  3DF8 A;  2BV6 A;  4XN3 A;  1W7P D;  3K4J A;  5IT9 K;  1FP1 D;  3OYK A;  1DP3 A;  3NE5 B;  2DMU A;  3OYB A;  3LQE A;  3B8H A;  2OD5 A;  4M72 A;  2Y0S A;  1IG7 A;  4YEI A;  1G4D A;  2EIX A;  2Z5U A;  3P27 A;  5BS6 A;  3OYI A;  1VQ6 I;  4QVJ A;  4RBO A;  1HLV A;  2XTW A;  3KET A;  1JRG A;  1K4Z A;  4XOR A;  4A5M A;  3U2R A;  1LB2 A;  1MBJ A;  4AIH A;  2VJ4 A;  4C9Y A;  3H0D A;  2VPL A;  2E1B A;  2EFG A;  4X8I A;  2BSP A;  1JHH A;  3SFZ A;  3CXC B;  3CCM I;  2UZK A;  4Z05 A;  2R7D A;  3SXY A;  4D5F A;  3ZOB A;  4DJA A;  3OYA A;  1IGN A;  4P2N A;  2F43 A;  2E2H J;  5ED4 A;  2HR3 A;  4XOT A;  2A07 F;  4NBS A;  5H5J A;  3CC4 B;  1QX4 A;  4RD6 A;  2CQQ A;  1OQY A;  4LG0 B;  2UVF A;  3FHZ A;  2Q1Z B;  3W6J B;  2WPD A;  1Q82 D;  1RKW A;  4LB5 A;  4DQ2 A;  1WSV A;  1UMK A;  4YAF A;  3QYB A;  2EIM H;  4G94 A;  1U5T A;  2ZXH A;  5L3G A;  3W6V A;  1RQP A;  1S4M A;  1H9G A;  2R5Z A;  5EEA A;  3KE2 A;  4II3 A;  1FRQ A;  3KL9 A;  2IW5 A;  4LIV A;  1DGW Y;  1W5T A;  5FJ8 J;  2IGK A;  1SC7 A;  3E1Y E;  2VFO A;  2M7A A;  2R3S A;  3IP4 B;  2V6E A;  4BAC A;  1ZGJ A;  2PEX A;  2CUE A;  2F5E A;  5FB2 A;  4UZE A;  1YFH A;  1B72 A;  1BX1 A;  2BEO A;  1PJ5 A;  3BR6 A;  2XGX A;  3LWF A;  3A03 A;  5D5V B;  2VBK A;  1BOA A;  1T08 B;  2V7V A;  1VQK I;  2OYN A;  4DK0 A;  3ASR A;  4BHC A;  1I8D A;  4CA0 A;  1FZP B;  2RC4 A;  2K40 A;  2VLA A;  1E1Q A;  3HZJ A;  4YAO A;  5FGM A;  2LY2 A;  5HLT A;  2DMQ A;  2WTE A;  3PFI A;  4PJJ A;  3LYC A;  1ZG5 A;  1Y0R A;  1P4M A;  2V1X A;  4XK4 A;  5HDG A;  1VQM I;  1NH3 A;  1FNM A;  5IK2 A;  3CCV I;  2DER A;  1SAX A;  2O5R A;  3H5N A;  5J40 A;  2Q2E B;  4F52 A;  3ABL H;  3KLN A;  4P6Y A;  1DU0 A;  1TWF J;  2K4J A;  3HTU A;  4BEH A;  4EM2 A;  3SZP A;  1ZLJ A;  4HF2 A;  2DCE A;  3W2E A;  5LGU A;  1Z6R A;  3T51 B;  3PL8 A;  2WA0 A;  3MAJ A;  1RRJ A;  2ZME B;  5J4V A;  3RPU D;  5DM6 F;  5F6F A;  4IX7 A;  1K78 B;  3AL0 B;  2ICW G;  3RPQ A;  4JX6 A;  2QUF A;  2QCO A;  1KCC A;  3DCF A;  1BQE A;  1BX0 A;  5A88 A;  3NAW A;  2I10 A;  2MH9 A;  2XEX A;  3ZIA A;  3GTQ J;  4I2O A;  1X19 A;  3FXJ A;  4EH1 A;  2X53 S;  2ZO4 A;  1TP4 A;  5DV5 A;  5FFZ A;  2IA2 A;  1T39 A;  3A1Y A;  4X7E A;  3RQ4 A;  2VNJ A;  4QUZ A;  5L3C A;  1MDM B;  5KHD A;  1KQ0 A;  4GQN A;  3OZU A;  2Z33 A;  2IGO A;  3K1N A;  5CVV A;  2VIX A;  2STW A;  1N06 A;  3M3Y J;  4E4H A;  3IUO A;  3A35 A;  3AVW A;  2FUG 2;  1GVJ A;  2HYJ A;  2VBY A;  1OLT A;  3FK6 A;  4C30 A;  1RUO A;  2GXB A;  5DUI A;  1HA8 A;  5C4X J;  4JX5 A;  1HW1 A;  1WOR A;  1XG1 A;  5ICG A;  1EFT A;  2CW0 F;  1T5E A;  1ETY A;  1BC7 C;  1O7L A;  4P1W A;  4PMH A;  2YU3 A;  1J5Y A;  2QY1 A;  3CDH A;  5IYQ A;  4QHY A;  1IN5 A;  2BY0 A;  3FXM A;  5LHG A;  4IHY A;  2VBW A;  1XSX A;  4IHT A;  4UUV A;  3FXO A;  4A2U A;  2KHM A;  4PZJ A;  2H6C A;  2YWH A;  2CMP A;  4CXF A;  1FNN A;  2P0W A;  3K9T A;  2R7X A;  2Y75 A;  4ZZD A;  5TGT A;  4CZZ A;  3FM5 A;  2JSP A;  3ZQ7 A;  3RTR A;  3TP0 A;  5ILV A;  4ZDO A;  4YAL A;  3ONY A;  1ETX A;  2E1C A;  4BE0 A;  3T8R A;  4XLN F;  3WQZ A;  3M1E A;  2X3U A;  2GA2 A;  3GF2 A;  1HSJ A;  1DAB A;  3QU3 A;  4KIC A;  3B90 A;  1O8G A;  2VFM A;  1TQP A;  3ES9 A;  3AG2 H;  3R6K A;  5EMN A;  1V55 H;  1TSP A;  1UD8 A;  3OR2 C;  2M45 A;  4RM3 A;  2DT6 A;  2OU2 A;  1MJA A;  2IQ7 A;  4NBQ A;  2NZM A;  4BXU A;  2NST A;  1LE8 B;  1Z67 A;  3VPR A;  1YHQ B;  3H09 A;  3F8B A;  1Z9C A;  4CIC A;  2QDX A;  4OIN F;  4BY7 J;  4CGZ A;  1XDU A;  3HXL A;  5IT9 Z;  3QE2 A;  3S3M A;  4L18 B;  3SYJ A;  4ENM A;  4HNT A;  4WQM A;  2M7B A;  2BXZ A;  4BHB A;  1TTY A;  3MKW B;  3W2F A;  1U0J A;  2MA3 A;  1FTT A;  2DOD A;  3BQJ A;  4QWQ A;  4OPW A;  4RLF A;  2VFN A;  3V7A A;  4LFU A;  1WPK A;  1VQ9 B;  1ZM4 A;  2EK5 A;  2F3L A;  4LK1 F;  1J7K A;  2DOA A;  4U0V A;  5HLG A;  2O3F A;  3FIS A;  2V1N A;  2HDD A;  3GQB A;  1ZGW A;  5CJ9 A;  5HVQ C;  2DOG A;  4OWR B;  3C1D A;  4OJO A;  4A69 C;  2ADU A;  1ZH5 A;  4W97 A;  2KFD A;  1FSH A;  4JOM A;  4OZY A;  1P2F A;  1K83 J;  4B3X A;  1QVF B;  3H3U A;  3CZ6 A;  3S16 J;  3U9G A;  1ZHF A;  1I39 A;  2XHK A;  2X51 A;  2ZFU A;  2GQF A;  1X2M A;  2UVE A;  2INU A;  2UXX A;  3DFG A;  4OPS A;  3LQR A;  4R79 A;  1ZN2 A;  1HW5 A;  1Y1W J;  3AVU A;  2WB1 N;  2EV5 A;  3BZC A;  1TNS A;  4KKT A;  4YZA A;  2UV1 A;  4IEJ A;  2ID6 A;  3CPW B;  1B1B A;  2MD5 A;  4NC8 A;  1W9X A;  2V4D A;  3CMA I;  1IDY A;  1NG6 A;  3KP2 A;  3WHB A;  5EG0 A;  2Y48 A;  1KTW A;  2QQ8 A;  1LFP A;  4WF2 A;  4EMS A;  5IYB J;  1IV6 A;  5CVR A;  3G4S B;  4YZQ A;  3RKX A;  4LLL A;  4X07 A;  3GVA A;  4OOI A;  4AD9 A;  4IQ4 A;  1VQ7 B;  2ZB9 A;  2EIL H;  2NTB A;  1HQC A;  2X1C A;  3OOC A;  1OB0 A;  2VKD A;  4RPB A;  3QPT A;  2PBI A;  1VND A;  3I4N J;  2RQQ A;  2H94 A;  2AO9 A;  4IRG A;  1G2H A;  2AHO A;  4G6T B;  1BOB A;  1D5V A;  3B82 A;  3OW2 B;  2WJY A;  4AF7 A;  1TTT A;  2VL8 A;  2DET A;  4UV8 A;  1QZY A;  1Q7Y D;  1EP3 B;  2HLD A;  2A6H F;  4B3G A;  1O8D A;  2ELJ A;  2DYS H;  3LSI A;  2NAZ A;  4M9X A;  1K6Y A;  3R0J A;  3V7S A;  1JT0 A;  2L9S A;  2XC7 A;  2VBM A;  2GJK A;  3MKL A;  1WJF A;  1BR1 A;  1DDG A;  5FD6 A;  2HGC A;  3ZPN A;  4S05 A;  2FBH A;  1YIJ I;  3IKT A;  2DQL A;  5HOD A;  3CC7 I;  2WJV A;  4I99 C;  3N05 A;  5DSZ A;  4XNF A;  4HE5 A;  3W5U A;  3VOD A;  1QCX A;  2YPR A;  1I3A A;  1RR8 C;  5LGN A;  4M2L A;  1QRB A;  4LBV A;  1JT6 A;  1D1C A;  5M5X J;  1AKH A;  1S3J A;  3K4L A;  1NK2 P;  1YW9 A;  3UR3 C;  1WKM A;  3LA7 A;  2HDN B;  1EH8 A;  2XKP A;  4EW9 A;  2BVL A;  3K4K A;  1S7E A;  3M8F A;  2KRC A;  4XLH A;  3FDY A;  3MMP A;  4IZZ A;  1ULY A;  4OIP F;  3W2G A;  1CZF A;  4TV7 A;  1CF7 B;  3G2B A;  3HM5 A;  2V7U A;  2P3M A;  2LRD A;  4XBF A;  3D5L A;  1VQ6 B;  2JA6 J;  1AA7 A;  2HOS A;  2LG4 A;  2BMW A;  4BYY A;  4DK1 A;  3M1C A;  3OIO A;  5L3B A;  5EZG A;  3B4N A;  1X1A A;  1X1B A;  3KZY A;  3CCM B;  2VE9 A;  3RKW A;  4FN5 A;  2FQ3 A;  3HRT A;  1B9M A;  1T2K A;  3BTI A;  4P9S A;  4A0Z A;  2DOE A;  4FXU A;  1MND A;  4KIB A;  1UD2 A;  1MIJ A;  1OPC A;  2ME0 A;  3K70 C;  2BVN A;  1AHD P;  4LGW A;  1FBS A;  1WCM J;  2DDB A;  2LF7 A;  1E63 A;  1X2N A;  4URR A;  3KYC B;  2TDX A;  1ELO A;  2L5Q A;  3CPX A;  1WTH D;  3DXJ F;  2VOO A;  1ZYR F;  4BE1 A;  2W7Z A;  1FEX A;  1QA1 A;  2WYR A;  4K2E A;  2JUC A;  2EV0 A;  5IT3 A;  3JTG A;  1Y0N A;  2LFB A;  1KK2 A;  3LNN A;  3ZMT A;  1FYL A;  4NUB A;  4BNC A;  1PUF B;  1JI8 A;  5GP9 A;  3ZQL A;  1SFU A;  2BN4 A;  1VQO I;  2BV3 A;  1XGM A;  3MN2 A;  1VQK B;  2W48 A;  1OMI A;  3MHP A;  1ONV A;  1OGM X;  4UY8 I;  3AGQ A;  4P9U A;  4KN4 X;  1G6N A;  3FM3 A;  2INV A;  4O6J A;  2G9W A;  1KON A;  1N75 A;  2W24 A;  1PUF A;  4II2 A;  4FAS D;  4DBR A;  1KMH A;  4HE6 A;  1VQM B;  1FMV A;  4ENJ A;  1PJ6 A;  3CCV B;  2WC2 A;  1R23 A;  2W84 A;  3I54 A;  4OAZ A;  3HGG A;  2X85 A;  3CJN A;  3A4C A;  3SDB A;  1DUX C;  4PC1 A;  3WBK A;  5FRO A;  3CP8 A;  2M4G A;  2A69 F;  2KQR A;  2VBZ A;  4PJ0 C;  3F22 A;  4HST A;  1IB4 A;  4HYE A;  3FXU A;  1SEU A;  3SLN A;  3AST A;  4M3D A;  2CW8 A;  2G0Y A;  1IXS B;  2HNH A;  3S93 A;  4DNC A;  1UD6 A;  2C5B A;  3F21 A;  1OCZ H;  3T9G A;  3CCS I;  2J5O A;  4UUT A;  4Q47 A;  1PLU A;  1F20 A;  2D5V A;  4BXF A;  2EFW A;  4UAJ A;  1IO2 A;  4IVN A;  1F9N A;  2F5D A;  2YX4 A;  5C44 J;  3IWF A;  4IL6 C;  3E6M A;  3NWT A;  2EIN H;  4OMZ A;  2VT2 A;  2XAQ A;  1ZRD A;  3L2V A;  2XSJ C;  2V7W A;  2W25 A;  2MC3 A;  1FNC A;  3S1Q J;  2NTP A;  1NHC A;  4XR6 A;  1BJK A;  2F1M A;  3TH0 A;  1JKO C;  3DEW A;  3H3Z A;  3F8F A;  4HQE A;  1ETQ A;  3DKW A;  4Y7N J;  5E1X A;  1D3Y A;  4C3J J;  2V9P A;  3HBL A;  3QFT A;  2BM4 A;  2IRF G;  1T98 A;  2HTJ A;  2NT6 A;  3N97 A;  4LLG F;  1WH5 A;  1IW7 F;  3JW4 A;  2GPJ A;  1KRH A;  5FLV A;  1Z91 A;  3CMY A;  2BBY A;  2NVY J;  4ESJ A;  1PJR A;  2BPO A;  5GPA A;  1OFL A;  4J00 A;  2ETH A;  3H35 A;  3K1M A;  1N77 A;  3VO2 A;  1TL8 A;  2TRT A;  2A61 A;  1IDJ A;  4RDU A;  3WTT C;  2WWY A;  2DMT A;  2GIV A;  1WI3 A;  3VSL A;  4DZP A;  1QGY A;  3U2Q A;  2GJR A;  2LYC A;  2VKE A;  2ZSH B;  5AON A;  4AU7 A;  2QGG A;  1RET A;  2B0L A;  2L2O A;  3ZQG A;  1NBM A;  3DU1 X;  1JTY A;  2DLL A;  2JWT A;  1M1E B;  5ICF A;  3GIR A;  2LVS A;  3GFL A;  4Y33 A;  4NCN A;  4UB6 C;  4RB0 A;  3W2A A;  2RNG A;  2ZZE A;  3X2Q H;  3B73 A;  3QYF A;  2C78 A;  2HCJ B;  2O0W A;  3WNB A;  3G73 A;  2XAH A;  1MSE C;  1S0U A;  4Z4T A;  1QQ1 A;  2LF8 A;  3K2A A;  1LNW A;  2DFE A;  1YS7 A;  3DKY A;  4H4K C;  4DW6 A;  3ASQ A;  4N3N A;  3E6B A;  1X3Z B;  2K3P A;  4A12 A;  4C2L A;  4XLC A;  5CPR B;  2D3L A;  4B8X A;  1YRN A;  1S5L C;  1IJF A;  3OYH A;  2XT2 A;  4XKV A;  5D5W B;  3P4G A;  4NC7 A;  3J7A O;  4LMY A;  3GTG J;  2NOJ B;  3FKS A;  4M3E A;  2D74 A;  4UHT A;  5FIU A;  3C7J A;  1D1N A;  2ISY A;  1GV2 A;  3GXO A;  4RA2 A;  5LHH A;  3CF5 F;  5E17 F;  3H5A A;  5E20 A;  5JR3 A;  2EIK H;  1SMY F;  4IHW A;  4RGX A;  3E20 A;  3G1L A;  3LVB A;  4P26 A;  1ZAO A;  1R49 A;  2CGP A;  1Z7U A;  4FHT A;  1X3U A;  4HDV A;  2AXT C;  2ZZG A;  4A3I J;  3OP1 A;  4MFE A;  4BQQ A;  3CJT B;  4ZYE A;  4HSR A;  1W0U A;  2JJ2 A;  2ZKZ A;  1XG2 A;  2FBI A;  4JX4 A;  5GAE J;  3OMY A;  2DCU A;  2R0Q C;  4O5V A;  1YQA A;  5FFX A;  3ZGK A;  4E7L A;  3W2W A;  1JUS A;  1Z3X A;  1SFO J;  1WXR A;  5F04 A;  3BG7 A;  2RRE A;  5FO5 A;  3CMA B;  5JBQ A;  2DA4 A;  2DBB A;  4LIT A;  2R5Y A;  4A3D J;  1KU7 A;  2DU9 A;  2QTL A;  1JUP A;  2XGJ A;  2ME6 A;  3COA C;  3HHH A;  5IYR A;  3O8H A;  3OOU A;  3CUQ B;  1GXQ A;  3OV8 A;  1X4O A;  5J8F A;  1IRZ A;  3GRH A;  2A5Y B;  4FQG A;  1XGN A;  2CRG A;  2R4G A;  2XVC A;  1R00 A;  3BOQ A;  3PUB A;  3VYT B;  1A31 A;  2B7B A;  3E7L A;  2C4T A;  2LDU A;  3FF5 A;  2DFI A;  3PUN A;  2IJL A;  4FE4 A;  2YWE A;  3BG6 A;  1B8I A;  3JQQ A;  2R7Z J;  1TQI A;  2GJP A;  4B44 A;  2HVQ A;  4AYB A;  5FL7 A;  4BPR A;  1RNL A;  5GAG J;  3O8G A;  2Z16 A;  3PUF A;  4U88 A;  4CUG A;  4EEF G;  2OCC H;  1J75 A;  2K9N A;  5CLS A;  3A8I A;  4PJN A;  4V2F A;  4X1E A;  1IAW A;  3HPH A;  5K7Z A;  1TLL A;  1YIJ B;  1GQ8 A;  4W1U A;  1A04 A;  5A2Q K;  2Y69 H;  1NTC A;  4BJ6 C;  4EV0 A;  4OU0 A;  5L3D A;  3G6E I;  4X6A J;  3GFJ A;  5E1W A;  3ZXS A;  3R6J A;  1TYU A;  2MFZ A;  3HYI A;  3B8Y A;  2OBT A;  1WVR A;  4ZGQ B;  3VST A;  1FYM A;  4I6Z A;  3G1M A;  3EYI A;  3Q9S A;  3U6K A;  4Y9U A;  5F4M A;  3NB2 A;  1F1Z A;  2NRA C;  1CQT A;  1Y39 A;  1B59 A;  2UWM A;  1O3S A;  2HYG D;  4CDG A;  5IOY A;  3WOD F;  1BIB A;  4NC6 A;  3E3V A;  1CNE A;  3V8K A;  4Z6Y A;  5HKK A;  2A5W A;  2QGU A;  1TWH J;  1Z21 A;  2VKV A;  3P9K A;  1H8E A;  3TDZ C;  4R1H A;  1WU8 A;  2WB1 A;  1X3W B;  3K4M A;  1LVA A;  1YX3 A;  1KTV A;  4EGZ A;  2XV4 S;  1JJ8 C;  3A1P A;  3AGP A;  1ETO A;  3HUG B;  2HDC A;  1UJ8 A;  4OPV A;  3KYD B;  3TED A;  3OY9 A;  4BKX A;  4P5O A;  3RZO J;  3BJO A;  1R1U A;  1GAW A;  1W4M A;  5IP9 J;  1YI2 I;  1ZM3 A;  1XMX A;  2F2E A;  4Z03 A;  2QBY B;  3OR1 C;  4WXC A;  3JAM Z;  2R7U A;  1I18 A;  4YDT A;  5K5Q A;  2ZL6 A;  4L9J A;  2D2W A;  3LJY A;  3DWL E;  3D1N I;  3KCC A;  2KIU A;  4NK6 A;  2NOG A;  3BJ6 A;  3C18 A;  1E3O C;  3PO3 J;  3BCD A;  3WU2 C;  3KYL A;  1KJZ A;  1VQ8 I;  2VPR A;  1HW2 A;  5IYD J;  2BY1 A;  3L2R A;  2LOO A;  3AVV A;  2H1L A;  1NHA A;  1KZL A;  2PLF A;  3FPK A;  4HX4 A;  1VQO B;  3O6B B;  1O8F A;  4AID A;  2K7L A;  1XTA A;  2KDO A;  3QFR A;  4LBW A;  1O88 A;  2E7W A;  1Q86 D;  1TYX A;  3S17 J;  2PYH A;  3MZH A;  1VQ4 I;  2JTV A;  4RDL A;  1LLW A;  1XMA A;  2HS5 A;  1E1R A;  1A5J A;  4UVA A;  1IZ1 A;  2DFF A;  4DYR A;  1J59 A;  3OYM A;  1FOK A;  5K7F A;  2P8T A;  4KN7 X;  1N05 A;  1EKE A;  1QRC A;  3DBR B;  1N25 A;  4CQJ A;  3G71 I;  1LFU P;  1LM1 A;  1I1S A;  1PYV A;  2HQA A;  3CUQ C;  5L46 A;  3OZV A;  1U6G A;  3GLL A;  3M7G A;  3PM1 A;  2CYY A;  3ZN0 A;  3TDU C;  3RZD J;  1L0O C;  3A0B C;  3P9C A;  5J3O A;  4OJP A;  3M07 A;  1S7A A;  4KIF A;  1MD0 A;  4DOZ A;  3CCS B;  3P26 A;  5KVR A;  4A5N A;  1E62 A;  4BQA A;  4A6D A;  3SEQ A;  2VJ5 A;  1BW5 A;  5FLX Z;  2OTL I;  1HDP A;  2DQR A;  3LMM A;  3E5Q A;  4CH7 A;  4AIK A;  1EFR A;  2WV0 A;  3RYR A;  1SVL A;  2CND A;  1V0F A;  4ZC3 A;  4YZX A;  1XQB A;  2EWE A;  2FNA A;  1U8B A;  3O3K A;  5E79 C;  1VQL I;  3DBL B;  2OAZ A;  1W36 D;  1MJB A;  3K10 A;  2NNY A;  1P6R A;  3WBJ A;  1SVO A;  2W6I A;  4TMZ A;  4V2G A;  5TJJ A;  4ZYD A;  1FRN A;  4RM0 A;  2V4J C;  5IY5 H;  4EGY A;  2LBF A;  4IPA A;  5HLH A;  2DA7 A;  2RNJ A;  2YUS A;  2VE8 A;  2Y0M A;  2MBF A;  5C3E J;  2KLO A;  2YS9 A;  3I59 A;  2NXN B;  1WRJ A;  1R7J A;  4RAY A;  1BJA A;  1U5T B;  1TWC J;  2QQB A;  2R5Z B;  3CCQ I;  1KGS A;  2MH2 A;  3WE3 A;  2BSA A;  2FOK A;  1IN8 A;  2EFN A;  2FU4 A;  3WWG A;  2PG4 A;  5A89 A;  5H2F C;  2V79 A;  2VNI A;  4ENN A;  4OIO F;  5LRR A;  2O0V A;  4RD0 A;  3SZT A;  3VNV A;  1B72 B;  2X9D A;  2XC1 A;  3FZV A;  3BJA A;  3BG5 A;  3WTS C;  3E0J B;  2BM0 A;  3GZ6 A;  1N0U A;  4A3B J;  2ZTG A;  3ZP5 A;  2EWN A;  1WJB A;  3AG3 H;  3LL7 A;  2A3S A;  3KP3 A;  5A2Q Z;  2K86 A;  2QVO A;  3P9I A;  4CYD A;  4M53 A;  1AMO A;  5JVT A;  4A0Y A;  3J81 K;  3S3O A;  3WXM A;  3HJE A;  2IS6 A;  4F93 B;  3OYF A;  3LOC A;  1JJ2 B;  4AIJ A;  2FD5 A;  3SKB A;  3B78 A;  3C2G A;  2OC6 A;  2IS1 A;  2CUZ A;  2M5W A;  1OR7 A;  4DIQ A;  4GDF A;  1R5G A;  3V4G A;  5TV2 A;  4BEH B;  3EUA A;  2QSF X;  4U0W A;  4FE7 A;  4H0E A;  5HS8 A;  2J8K A;  4PK4 A;  1D1B A;  2OJE D;  2O04 A;  2EH3 A;  1SD6 A;  2PMU A;  2PE3 A;  1JA1 A;  4Q5S F;  4BE2 A;  2EZK A;  2HTS A;  5HOO A;  4ZCM A;  2EIJ H;  2HVS A;  4GGG A;  3WU0 A;  4QPQ A;  4L0Z B;  2NT9 A;  1UEL B;  4L9N A;  2DI3 A;  3FK7 A;  1JKQ C;  1QFY A;  2OPT A;  2W00 A;  1G7T A;  3JTH A;  4KT5 C;  5FNZ A;  3CJQ B;  3OSF A;  2DT7 B;  2Y9Y A;  2IXS A;  2BM6 A;  1KYZ A;  3W5H A;  1FLI A;  2P81 A;  3ISX A;  1IN7 A;  2IP2 A;  3I3L A;  3T0Y A;  4MEX F;  1ZQ3 P;  3T5X A;  3EPZ A;  2LMD A;  4KDP A;  3TKY A;  3WND A;  1YTY A;  1CGP A;  3I4P A;  2JUG A;  4ASU A;  3PA2 A;  5KW9 A;  4HF1 A;  2WAD A;  4HG2 A;  5KAI C;  2H6B A;  1ZLK A;  5HLI A;  4PAB A;  1SVM A;  2MW8 A;  3IC7 A;  2GWR A;  1OCR H;  1R5H A;  4J01 A;  1Y0U A;  3RDI A;  4Y9R A;  1XMK A;  3CLO A;  3G05 A;  3K0L A;  1QQI A;  4NQW A;  2XTX A;  1E3X A;  4HV6 A;  3I4M J;  5E3M A;  1Q1V A;  2ESN A;  1X1P A;  3OYE A;  4EM1 A;  2GOX B;  4BS9 A;  4IF4 A;  3HOS A;  1N08 A;  2JN9 A;  3KEW A;  4PUS A;  5FO0 A;  3IHU A;  4F55 A;  2E1M C;  3L09 A;  3K7A J;  3BR5 A;  4WXD A;  3PET A;  4MLO A;  3JRD A;  1G3Y A;  4Z4R A;  2AHQ A;  4BL0 B;  1Z77 A;  2H27 A;  2IA0 A;  2L01 A;  1KU3 A;  2M3A A;  2RKH A;  2VC0 A;  1ODD A;  2VBT A;  3M8J A;  3E1S A;  1KD1 D;  3JR9 A;  3HOV J;  1RZ4 A;  2O1D A;  3PSZ A;  2VBU A;  4PFP A;  2O8K A;  2V7T A;  2D45 A;  5TRD A;  3W2I A;  2L7Z A;  2R7Q A;  3S1R J;  4ITV A;  1K8A D;  3C2B A;  4FET A;  5IYP A;  2Q0O A;  2JSC A;  3BY6 A;  4KT6 A;  4RGR A;  1HOM A;  3CRZ A;  5FKM A;  1HCR A;  4UXN A;  1IV8 A;  2FJ1 A;  1EH6 A;  1X1C A;  2LSO A;  5B5E C;  1D5Y A;  4IHS A;  1J9Z A;  1VF7 A;  4MQV A;  2CC2 A;  1T0F A;  4DNR B;  3BTL A;  1OKR A;  1UST A;  2AXL A;  2M5S A;  3G6E B;  2BHY A;  2EA2 A;  2FNP A;  3PQJ A;  4ON0 A;  3CES A;  4RB3 C;  2P6S A;  1LQ1 A;  3CO6 C;  4EJT A;  4D0P A;  3Q38 A;  4M3B A;  3CTA A;  1BA5 A;  4RCY A;  1HKQ A;  2N8G A;  1MBH A;  4LK0 F;  4EJU A;  4AYB N;  4HDU A;  2D1H A;  3VWB A;  1V3F A;  1V0E A;  3K1P A;  4YAW A;  3T56 B;  3JRE A;  4KKS A;  2GOM A;  1OCP A;  5IP7 J;  2DA1 A;  3SUC A;  3MWM A;  4C3H J;  3O2P E;  2DMP A;  3OS1 A;  2X0K A;  3Q6R A;  2CSO A;  3B6A A;  3R61 A;  1CNF A;  5K1Y A;  3LMW A;  3BZ6 A;  1OGO X;  3ROU A;  1TC3 C;  2L7M P;  3DKX A;  4IRI A;  1BR4 A;  1OOC A;  1QA3 A;  1IXC A;  5D6E A;  3U1D A;  1TYV A;  4BJT A;  2F6C A;  1E2X A;  2DAO A;  4LB6 B;  1DAR A;  5TR9 A;  1FBU A;  4IJA A;  4HV5 A;  2TCT A;  1ETV A;  1W35 A;  1YI2 B;  5JLW A;  1MAB A;  3NWS A;  2M30 A;  4AVZ A;  4G7X A;  4YC5 A;  1UHW A;  2G7H A;  1CQX A;  5EG0 B;  1BI3 A;  1BIA A;  1MH3 A;  4U87 A;  1K4S A;  4N9I A;  3ZMS A;  4RJL A;  2WZP P;  1W0T A;  2ZZF A;  2W82 A;  2ZME C;  3AL0 C;  5CKT A;  2BY3 A;  3PJR A;  1ACI A;  1VQ8 B;  5F0H A;  1EZG A;  2W57 A;  1HKS A;  5B1B H;  1V5G A;  2XKO A;  3QOE A;  2EZL A;  3J81 Z;  2Y9Z A;  4N3G A;  3BC8 A;  3VFZ A;  1IXR C;  3LAJ A;  5FKK A;  2JVH A;  3HOZ J;  4P22 A;  3GZN B;  2QA4 I;  5F08 A;  2BW3 A;  2UXN A;  3J7Y J;  1Y0Y A;  3C2H A;  4FK8 A;  4MEY F;  3OIQ A;  5CYV A;  5DN6 A;  1VQ4 B;  4BH9 A;  2LY9 A;  4A0X A;  1XCV A;  5IYW A;  4PJM A;  4LD5 A;  2OCE A;  5JLV C;  4E70 A;  1EH7 A;  3V8L A;  4B4C A;  1MZB A;  3BG3 A;  3Q6Q A;  3NAR A;  3EUK L;  4FT8 A;  4CCM A;  1HA3 A;  3G71 B;  2JRT A;  2KMU A;  3GEZ A;  3T1B A;  4OM9 A;  1Y6I A;  4CCN A;  2P6T A;  1FIA A;  3LQQ A;  5EGO A;  5ILU A;  1HF2 A;  4Y15 A;  1GVD A;  1AKH B;  1RIO H;  1D2E A;  5D5U B;  1I50 J;  2DA2 A;  5B1A H;  3KX2 A;  1GXP A;  1JGG A;  4CHU A;  1TW3 A;  3F8C A;  3QWL A;  3IRQ A;  1R1V A;  5J3L A;  1I7P A;  1MMG A;  1WFX A;  2YX7 A;  3GW2 A;  3GWZ A;  5D4S A;  4G8X A;  3ZZT A;  2OTL B;  5IP6 A;  4PC7 A;  1H80 A;  3HL2 A;  2XDV A;  2VNK A;  1R9T J;  2R7R A;  3PIO F;  5FRM A;  2ZZQ A;  2P7V B;  2E1N A;  3L9F A;  1VQL B;  2ELH A;  2E36 A;  2KZG A;  2JRM A;  4AUX A;  3GVK A;  4CCL A;  3AAF A;  5J47 A;  2GZW A;  3DLL F;  1ON1 A;  2A6E F;  2VN2 A;  4JQF A;  3S2D J;  4QLC U;  3ISP A;  1K73 D;  3E5X A;  1U8R A;  2ZBU A;  2V9V A;  1K5C A;  5BSY A;  4EJV A;  3RYP A;  4PSX A;  2CG4 A;  4EAT A;  3JSO A;  3BDD A;  2VQC A;  4JMQ A;  1NRK A;  1O3Q A;  5KAF C;  3V76 A;  3OAA A;  4X06 A;  1YO5 C;  2KVO A;  4PFO A;  2ZXI A;  2XOK A;  1G7S A;  1J09 A;  4ZCI A;  2Z8G A;  1EA0 A;  3FMQ A;  2L9R A;  4MO7 A;  5F64 A;  1APL C;  3CCQ B;  4FWT A;  3DEU A;  2V5I A;  2HPI A;  4RMN A;  4YFX F;  1FOY A;  5D4R A;  2VFP A;  3Q0W A;  2PJP A;  3ZMU A;  4WZE A;  3AKZ A;  2GQQ A;  1GHC A;  1T33 A;  2XPW A;  3BWG A;  4M71 A;  5K7H A;  3BC9 A;  1EJ9 A;  3PUM A;  1LJ9 A;  2COB A;  3ZMV A;  4IOC F;  3L7W A;  2KPM A;  2NVX J;  1AIP A;  5DYM A;  2GBY A;  3OIP A;  3RI4 A;  3JRF A;  4A3K J;  1X1D A;  1G59 A;  1NB0 A;  3SFI A;  3K4B A;  4Q4Z F;  4TSF A;  2DOF A;  4UV9 A;  5JFR A;  3CCL I;  2WY7 Q;  2EQR A;  1QHH D;  3V42 A;  3DU5 A;  3ZMD A;  2ZIT A;  2ZNZ A;  2PYG A;  3N6Z A;  4U4B A;  1F5T A;  2C4U A;  2XIG A;  9ANT A;  3PA1 A;  1C0W A;  3ZZU A;  3GQ9 A;  2XSD C;  1WJA A;  2H8W A;  1G3T A;  4KA4 A;  2C6Y A;  1TT0 A;  2GA1 A;  2R93 J;  1XFO A;  1O8E A;  1IDK A;  2ZCW A;  1YX2 A;  2DJN A;  4UVC A;  2F4N A;  3JRH A;  2MLK A;  4XID A;  2X4H A;  2XAF A;  4WK8 F;  1FNB A;  5JMC B;  5DCM A;  1RKT A;  4DQL A;  1LEA A;  2DW4 A;  2CU7 A;  4HZF A;  4X0C A;  4RGS A;  1M1K D;  4KJZ A;  2QSG X;  2NTQ A;  3HOU J;  2O9L A;  2CV1 A;  4Z4Z A;  5FKL A;  4TN1 A;  2WZN A;  3EET A;  5AMV A;  3A02 A;  3VSU A;  5M5W J;  1U2R A;  2MSY A;  2KIQ A;  3W2V A;  2B9S A;  4G7W A;  2A6T A;  3KIO A;  4IHV A;  4YG2 F;  1HBX G;  1ETK A;  1MW7 A;  1MBF A;  2GLO A;  2XNJ A;  1FTZ A;  5AIQ A;  2VYQ A;  2OBR A;  3D26 A;  1AWC A;  4V02 C;  5KNL A;  2G7U A;  3HC7 A;  2M8G X;  3I5U A;  4PGG A;  4QV2 A;  3HRM A;  2BX6 A;  1TWG J;  3DV8 A;  3DEE A;  2NVQ J;  5DD4 A;  3UW0 A;  2XPU A;  2ZC2 A;  2QN6 A;  1S72 I;  1ZM9 A;  2YUH A;  1WSR A;  4U7D A;  3S15 J;  3BPX A;  4UZF A;  3P7N A;  4D1Q A;  1ZUN B;  2OZU A;  3DTI A;  1AU7 A;  1QPM A;  2V1D A;  1FND A;  3BY1 A;  1O8M A;  2VJI A;  3KEO A;  1QG0 A;  3GCM A;  2Q8K A;  2BGJ A;  2R9V A;  5FD5 A;  3GVJ A;  1DPU A;  4ZGN B;  1OYI A;  1SFK A;  3JRI A;  4OIR F;  3SZG A;  4DNT B;  2VXZ A;  2HVR A;  5GTH C;  1P92 A;  4KIT B;  5E18 F;  1ZEL A;  2XF6 A;  4IOA F;  3DTK A;  2E1O A;  1OCT C;  4B43 A;  4LIU A;  1V5F A;  1WQ2 A;  1QGP A;  2ID3 A;  2K27 A;  3VOE A;  4XRM A;  2B0R A;  1IB0 A;  1Z05 A;  3A01 A;  3WTU C;  2P4W A;  1B9N A;  2V1U A;  4AM3 A;  4OJL A;  4RLQ A;  2PJR B;  2M1B A;  3Q3A A;  1XC5 A;  2L3D A;  4XLA A;  2HU9 A;  3FBN B;  1K28 D;  1FOW A;  1OYW A;  1EA3 A;  1J0R A;  3QP5 A;  5E8I A;  3LFU A;  2D9R A;  2DY1 A;  3FY3 A;  3GTO J;  5CDF A;  1R58 A;  2PN6 A;  5E8G A;  1KZH A;  2R7W A;  1JXS A;  1H8A C;  2PJR A;  2FSW A;  1FP2 A;  1QZE A;  4HOB A;  3JAM K;  1D0Z A;  4K1X A;  2MAB A;  4RLZ A;  1N07 A;  2K4B A;  4AC0 A;  2MYS A;  1BC8 C;  2ZSI B;  4BJ5 C;  1E79 A;  1FDR A;  4YIF A;  4TMX A;  1QHG A;  2BGC A;  4U7B A;  1H9T A;  3OPO A;  2O0Y A;  4C3I J;  3H36 A;  3DU6 A;  3NRV A;  2ZL5 A;  1P4W A;  2FX3 A;  2FX0 A;  5IOZ A;  3BH6 B;  2NS8 A;  4NNJ A;  2EZH A;  4AF6 A;  1ZG3 A;  2RN7 A;  3WTX C;  4GXO A;  5EEH A;  3JU4 A;  4ZTJ A;  1YRN B;  3RIR A;  5F1R A;  1XDS A;  2VBV A;  3EQL F;  1N8R D;  1LEB A;  3CUO A;  3HHG A;  4WWC A;  2O7O A;  1YLO A;  2FVG A;  3VMV A;  1P7I A;  2BYV E;  1H85 A;  3I0T A;  3CDL A;  4MYU A;  4PC6 A;  1JHF A;  3HKZ N;  3I1F A;  4GRI A;  1FY7 A;  2DJI A;  5FKO A;  1MBK A;  1FPQ A;  3LSM A;  1IUY A;  1QA2 A;  3KEY A;  2JVG A;  4WZL A;  3CJR B;  3QPS A;  1FWZ A;  1AIR A;  2DN0 A;  3J7A Y;  2CFO A;  1F4K A;  4IHX A;  5J1R A;  3HSE A;  1EFC A;  1WOP A;  2BF4 A;  2V26 A;  3DP7 A;  2X48 A;  3L2C A;  4RAZ A;  4UNO A;  5B6I A;  5BNG A;  4OOX A;  2KKO A;  2XT4 A;  1A6Q A;  2CV0 A;  5DEQ A;  3WGH A;  3H9N A;  4LLN A;  1Y8R B;  1DU6 A;  3CO7 C;  1HZE A;  4CCJ A;  1Z3Y A;  1EP2 B;  1RI7 A;  2E19 A;  3H5R A;  5FLX K;  2R5Y B;  2CUJ A;  4YFK F;  4X05 A;  1BM9 A;  2NV4 A;  2HI3 A;  5KCM A;  2HQR A;  2RQP A;  4I09 A;  4B1R A;  4MYT A;  1RUN A;  4R71 A;  1D8J A;  2VQH A;  3JSP A;  2ZXW H;  2XAU A;  4Z4S A;  1IRX A;  2F5F A;  2OA4 A;  1TZL A;  5EYR A;  1YE9 A;  4M73 A;  1DBG A;  3IRR A;  1OFM A;  1HC8 A;  1NB9 A;  2XRL A;  3LST A;  4E6K G;  3K2Z A;  2QA4 B;  4JBA A;  3MKZ A;  1MMN A;  1XCB A;  3BLY A;  3BR1 A;  1Y56 A;  2D1V A;  3F8M A;  1Z0X A;  4HQM A;  4XRS G;  3WHC A;  2GIZ A;  2Z2S B;  5DS9 A;  3TMO A;  4LBY A;  1LDD A;  2CFX A;  1B8I B;  2KT0 A;  3DTE A;  2Q6K A;  4B4D A;  4D9J A;  1MJ9 A;  3E6D A;  3Q9V A;  5K5O A;  2IEK A;  3V7C A;  3E97 A;  1XN7 A;  5J35 A;  1QH0 A;  3MFK A;  1EE6 A;  4EQQ A;  1N0V C;  3L2W A;  3WG7 H;  3KRG A;  3DBH B;  1UD4 A;  2XGE A;  1QVT A;  5BPI A;  1JKR C;  1DG1 G;  3Q0V A;  2ZTN A;  3SZE A;  4CYC A;  1FBQ A;  1LLZ A;  2CO5 A;  1TNT A;  4HPQ A;  3U21 A;  4KMU X;  4CCO A;  3BR2 A;  4UB8 C;  3OKX A;  3TQN A;  1R6R A;  4PCQ A;  3IV5 A;  2LZJ A;  4FCY A;  2RGV A;  1KA8 A;  4NB5 A;  2PIA A;  5B3S H;  2DK8 A;  2L9N A;  2WV1 A;  2XAJ A;  3F23 A;  3RKQ A;  3A8J A;  5HS7 A;  1K61 A;  2QZ8 A;  3CC7 B;  3VMW A;  2EA4 A;  3RY8 A;  4XM3 A;  2VOP A;  2FBK A;  1KC8 D;  1UAA A;  1K9M D;  3RJP A;  4XON A;  2CQN A;  2X8K A;  1WSU A;  2ODL A;  1OHH A;  3HG9 A;  2R7S A;  3FXL A;  3HRS A;  3JCU C;  5B66 C;  4CSW A;  2F5C A;  3S2H J;  2BZT A;  2DFH A;  3SJM A;  1XGO A;  1HXD A;  3JX8 A;  4TKO B;  1DQU A;  5JVG F;  5THX A;  3HDD A;  2DA6 A;  1UMQ A;  2HQN A;  4ZYA A;  1PP8 F;  4G6I A;  4JRA C;  4E7I A;  4YZ0 A;  2XF5 A;  2F4I A;  3LNQ A;  3ECO A;  3CC2 I;  3HSR A;  3FPP A;  1RMG A;  2CQK A;  2RDP A;  2PMZ A;  3GTK J;  1YJ9 I;  1OCO H;  3ECH A;  2PLY A;  1U2W A;  2CW7 A;  3CCR I;  4FX4 A;  2QLZ A;  3I56 I;  1OGI A;  5DS0 A;  1SD4 A;  5DDG A;  5C4J J;  1U9O A;  5GAH J;  4UUS A;  3DDY A;  1S9H A;  3R6S A;  5H20 A;  3VSK A;  3HOT A;  1I6H J;  2E35 A;  4B48 A;  1QUE A;  3ASS A;  1D0Y A;  3IH2 A;  3ML3 A;  2ZXJ A;  1IN6 A;  1IC8 A;  1Z6T A;  3CMM A;  1E3P A;  4B3F X;  4E7S A;  1OFD A;  1JNY A;  1MNE A;  4ZZL A;  2HXO A;  4BAY A;  4MQ9 F;  2LLK A;  3WGG A;  3QAH A;  2K5C A;  1UFM A;  4P55 A;  1K8F A;  4RD2 A;  1ON2 A;  3CCL B;  4CO8 A;  4LOC A;  2XF7 A;  1XPX A;  3OYC A;  1VTN C;  2CV2 A;  3GVL A;  5BPD A;  4ACA A;  2J7K A;  3ZR8 X;  3HSF A;  3CP2 A;  3ULQ B;  4B3A A;  1W7P A;  2KRH A;  4OOV A;  2X6Y A;  1O4X A;  1ZRC A;  1AOY A;  3CW2 A;  3H9Q A;  2R7T A;  2XPV A;  5D8L B;  2QEX I;  2L9V A;  3VNU A;  4YXW A;  2A05 A;  1OFC X;  4P9F A;  1H88 C;  1WMR A;  1IHM A;  1BI1 A;  2XND A;  4E0F A;  2CWE A;  3QPL A;  1U3E M;  3BRO A;  2L7F P;  2JDI A;  3JQR A;  4ZDL A;  1FMW A;  3VDX A;  2FE3 A;  3QSY A;  2OBP A;  1YIT I;  5J8C A; 
#chains in the Genus database with same CATH homology
 2M3A A;  4XN0 A;  3M8J A;  3B4N A;  1X1A A;  1X1B A;  3E1S A;  1O8L A;  2VQG A;  2WAF A;  3SYT A;  2O1D A;  2F5V A;  3BCB A;  4PFP A;  2M0M A;  3BH4 A;  2R7Q A;  4ITV A;  2VBE A;  1QU3 A;  4FET A;  4YRV A;  4KT6 A;  3TBI A;  4FXU A;  1MND A;  2MD0 A;  4XD7 A;  1H8H A;  1UD2 A;  1VF7 A;  2HLD A;  1X1C A;  3GQA A;  4DNR B;  3MMY B;  4XQF A;  3K70 C;  1E43 A;  1RU4 A;  3TL4 X;  2M5S A;  2VAS A;  1BMF A;  3EUH C;  2X3H A;  4URR A;  2LBF B;  4IKF A;  3CES A;  1WJE A;  2HDW A;  2L5Q A;  1WTH D;  4PSW A;  1WJD A;  4BE1 A;  3S8P A;  2NSP A;  2GK7 A;  3H9J A;  2UUZ A;  4OJ5 A;  1WP6 A;  3OYJ A;  1G8X A;  3LNN A;  2QKM B;  1BN8 A;  2JIZ A;  3S32 A;  4NUB A;  2V9K A;  3VWB A;  1V0E A;  4KIS A;  1JI8 A;  2X1E A;  4Y3O A;  3T56 B;  3K4N A;  4KKS A;  2GOM A;  3DPU A;  3SUC A;  1OGM X;  3K4C A;  3OS1 A;  2INV A;  3DLA A;  1KON A;  1N75 A;  2CH0 A;  4II2 A;  4DBR A;  4FAS D;  4C2U A;  1KMH A;  3LMW A;  2Z6B D;  1FMV A;  4XMY A;  1OGO X;  3OWT A;  4OAZ A;  3SDB A;  5KHD A;  2X85 A;  3DKX A;  3A4C A;  1BR4 A;  1OOC A;  2R7V A;  5FRO A;  3CP8 A;  2M4G A;  2F6C A;  2KQR A;  4BJT A;  1IB4 A;  4HST A;  3PFY A;  1W36 C;  2IGN A;  1VLY A;  3OE7 A;  2LC2 A;  4NK8 A;  2CW8 A;  1MAB A;  3NWS A;  4AVZ A;  4G7X A;  2HNH A;  3S93 A;  2LRE A;  1UD6 A;  2V31 A;  3T9G A;  2QXZ A;  1X4P A;  3GBG A;  3I9V 2;  2BVM A;  4U87 A;  3K6G A;  1PLU A;  2HZD A;  2WZP P;  4BXF A;  3QYE A;  1P9Q C;  3S3N A;  2W82 A;  2E5N A;  3AL0 C;  1E3Z A;  4N4N B;  5CKT A;  2ZZF A;  3PJR A;  1E0E A;  3HAG A;  3NWT A;  2K9M A;  4F3Q A;  1V5G A;  3QOE A;  4ZJZ A;  3BC8 A;  2XSJ C;  3L2V A;  1D0X A;  1DGR M;  4P22 A;  2JVH A;  4BUP A;  2NTP A;  1NHC A;  4XR6 A;  2F1M A;  4TT3 A;  1VZ0 A;  2BW3 A;  2D3N A;  4F92 B;  3C2H A;  4I84 A;  3OYL A;  3EQN A;  3OIQ A;  3OW7 A;  5DN6 A;  2NT6 A;  4PJM A;  3PNV A;  2E60 A;  2VQL A;  4XL9 A;  2X1D A;  4OZZ A;  1PJR A;  2VKH A;  3EUK L;  4CCM A;  2W7N A;  1BLI A;  1WPC A;  1OFL A;  4J00 A;  3H35 A;  1JTA A;  1N77 A;  2KMU A;  3LSK A;  2WAQ A;  3DPL C;  1Y6I A;  4CCN A;  1IDJ A;  1O8K A;  2X6W A;  1VJS A;  1QJV A;  3VSL A;  2GJR A;  2LYC A;  4AU7 A;  2ZSH B;  2HPM A;  3DQV C;  2L2O A;  3PSF A;  4NQW B;  3RSN A;  1NBM A;  1BR2 A;  3FHN A;  1ERD A;  3KX2 A;  3OL4 A;  3IAS 2;  2E5Z A;  4XLE A;  1IA5 A;  3FBI B;  1MMG A;  1WFX A;  4ZDP A;  1PE9 A;  4Y33 A;  4BGD A;  2XZO A;  1H80 A;  3HL2 A;  1HG8 A;  2XDV A;  2R7R A;  5FRM A;  3W2A A;  2ZZQ A;  2RNG A;  2ZZE A;  3QYF A;  3VYU B;  2CK3 A;  1LKX A;  2O0W A;  3GVK A;  5HNH A;  4CCL A;  2VB6 A;  4JQF A;  4H4K C;  4DBQ A;  3DKY A;  3MD2 A;  3AFH A;  1K5C A;  2K3P A;  2QX3 A;  3LSH A;  4PSX A;  4C2L A;  4EAT A;  4XLC A;  5CPR B;  2D3L A;  2VQC A;  4JMQ A;  1NRK A;  3OYH A;  3OAA A;  5CQE A;  2VXD A;  3VYS B;  4PFO A;  2ZXI A;  4XKV A;  2KVO A;  1J09 A;  2XOK A;  4NC7 A;  2Z8G A;  2NOJ B;  3FKS A;  4BDY A;  4XLF A;  2M4K A;  2HPI A;  4ANJ A;  4RMN A;  4ZTF A;  1KCD A;  4QPO A;  3ONQ A;  4XKW A;  1MMD A;  3HKZ A;  5HNF A;  3ZPP A;  2XZP A;  1UG0 A;  3AKZ A;  1VBL A;  3H5A A;  4PJL A;  3BC9 A;  1W0K A;  3OFN A;  3ZRG A;  2XZL A;  1O8H A;  2I8D A;  2KPM A;  4U49 A;  2QE7 A;  4E7K A;  3OL3 A;  2ZZG A;  3VR6 A;  3OIP A;  1G59 A;  1COW A;  1X1D A;  4BQQ A;  3A2K A;  3K4B A;  4TSF A;  2IGM A;  3QOD A;  4HSR A;  4MXN A;  2JJ2 A;  2WBM A;  2WY7 Q;  1XG2 A;  1QHH D;  3V42 A;  3D5R C;  3DU5 A;  4YEJ A;  1O8J A;  3OMY A;  2PYG A;  3L2U A;  2LY1 A;  4UZU A;  3D5S C;  3PNT A;  1NG7 A;  1Z7L A;  4E7L A;  3ZGK A;  3GQ9 A;  3W2W A;  1WJA A;  1Z3X A;  1O8E A;  1TT0 A;  3BG7 A;  1OR7 C;  2RRE A;  1IDK A;  4LIT A;  2E1M B;  2V7Q A;  4XN3 A;  3K4J A;  2XGJ A;  2KP6 A;  3OYK A;  1DP3 A;  3NE5 B;  3OYB A;  3OOU A;  2DIE A;  1X4O A;  4KJZ A;  2Y0S A;  4HRI A;  2NTQ A;  3GRH A;  2CV1 A;  3OYI A;  5AMV A;  2KZV A;  2R4G A;  3PUB A;  1JRG A;  3VSU A;  3VYT B;  4XOR A;  5LD2 C;  1UD3 A;  3W2V A;  4C9Y A;  2VJ4 A;  2VPL A;  2A6T A;  3H0D A;  2E1B A;  4G7W A;  2BSP A;  2O17 A;  4Z06 A;  3BG6 A;  1MW7 A;  2W1O A;  4Z05 A;  3H94 A;  4CCK A;  4DJA A;  3OYA A;  5FRN A;  2GJP A;  4B44 A;  2HVQ A;  4AYB A;  5KNL A;  1HVX A;  2F43 A;  5FL7 A;  3HC7 A;  4XOT A;  2Z16 A;  2BW3 B;  4CUG A;  3DEE A;  1PKV A;  1D1A A;  4KKU A;  2Q1Z B;  2WPD A;  2UVF A;  3UW0 A;  3UNG C;  4PJN A;  3HPH A;  3QYB A;  1GQ8 A;  4W8Q A;  5C1C A;  2ZXH A;  4D1Q A;  5C1E A;  4BJ6 C;  1UD5 A;  4XKB A;  3DTI A;  4II3 A;  3ZXS A;  3OYN A;  1O8M A;  4LIV A;  1DGW Y;  2MFZ A;  2IGK A;  2VJI A;  2M7A A;  2R9V A;  3B8Y A;  4W8R A;  3GVJ A;  3VST A;  3IP4 B;  2V6E A;  1SFK A;  4BAC A;  3SZG A;  4DNT B;  2VXZ A;  2HVR A;  4XKC A;  4KIT B;  1ZEL A;  2K9L A;  2XF6 A;  3DTK A;  2UWM A;  4B43 A;  4LIU A;  4Y4R A;  2VBK A;  1V5F A;  4HNU A;  2OUM A;  4DK0 A;  1MMA A;  1V5E A;  1I8D A;  4CA0 A;  4F91 B;  1PXZ A;  5HKK A;  2A5W A;  4RLQ A;  2VLA A;  2PJR B;  1E1Q A;  4OJL A;  1Z21 A;  3PSI A;  4XLA A;  2HU9 A;  2LY2 A;  3FBN B;  3LSG A;  5HLT A;  1H8E A;  4PJJ A;  2WB1 A;  1K28 D;  2GK6 A;  3K4M A;  1EA3 A;  5IK2 A;  2PEC A;  1YX3 A;  3LFU A;  2O5R A;  3H5N A;  3FY3 A;  5CDF A;  3HUG B;  1GLN A;  2Q2E B;  4F52 A;  2R7W A;  2PJR A;  3OY9 A;  1D0Z A;  4P5O A;  4BEH A;  2MAB A;  2DCE A;  1T0F C;  2MYS A;  2ZSI B;  4BJ5 C;  1E79 A;  3T51 B;  4Z03 A;  1QHG A;  3PL8 A;  2WA0 A;  2WAE A;  4RM2 A;  4U7B A;  1N78 A;  3AL0 B;  1SAU A;  3OR1 C;  3RPU D;  2R7U A;  4IX7 A;  3OPO A;  4BQO A;  3DU6 A;  1I18 A;  4W8T A;  1YX5 A;  2BOL A;  1KCC A;  3DWL E;  4NNJ A;  3OEH A;  4NK6 A;  3BCD A;  3ZIA A;  3JU4 A;  4ZTJ A;  3KYL A;  1X19 A;  3A3B A;  1WJ5 A;  3HPG A;  2X53 S;  3L2R A;  2AQE A;  2LOO A;  3A1Y A;  3RQ4 A;  3VMV A;  4YEL A;  1KZL A;  4OAY A;  4GQN A;  1T95 A;  1O8F A;  1BPL A;  2IGO A;  4E7Z A;  2VIX A;  4GRI A;  2KDO A;  4E4H A;  3IUO A;  1O88 A;  2DJI A;  3A35 A;  2FUG 2;  3SEZ A;  3LSM A;  4C30 A;  1OLT A;  3KEY A;  2AQF A;  5CQG A;  2PYH A;  2JVG A;  3CJR B;  3OYD A;  3K70 D;  1HA8 A;  1AIR A;  3J7A Y;  2CFO A;  1E1R A;  4BU2 A;  1T5E A;  2IS2 A;  2V26 A;  4P1W A;  3OYM A;  3GQ7 A;  4PMH A;  2QY1 A;  2CV0 A;  1PYV A;  2HQA A;  4U4B A;  2WY8 Q;  1HZE A;  4CCJ A;  1Z3Y A;  4X0G A;  2KHM A;  4OJP A;  2W4S A;  2CMP A;  4DOZ A;  2R7X A;  2P0W A;  2VJJ A;  3H5R A;  2CUJ A;  2LH9 A;  5TGT A;  4W8S A;  2JSP A;  5KCM A;  3RTR A;  4ZDO A;  1FX0 A;  4BE0 A;  3SEQ A;  2VQH A;  2VJ5 A;  3WQZ A;  3BCA A;  2XAU A;  3ZSC A;  3LMM A;  1DBO A;  1IRX A;  3T53 B;  4L8J A;  1TZL A;  4CH7 A;  3B90 A;  1YE9 A;  3ZQQ A;  3OYG A;  1DBG A;  1EFR A;  1O8G A;  2IS4 A;  1OFM A;  4E6K G;  1V0F A;  4ZC3 A;  1UD8 A;  4YZX A;  3OR2 C;  3MKZ A;  2EWE A;  4RM3 A;  2DT6 A;  1MMN A;  3EQO A;  3BLY A;  2IQ7 A;  1Y56 A;  2NZM A;  2Z2S B;  2NST A;  3TMO A;  1W36 D;  3H9G A;  3K10 A;  3DTE A;  2R7O A;  4D9J A;  2W6I A;  3HXL A;  3S3M A;  2V4J C;  4HNT A;  1BHE A;  2LBF A;  2M7B A;  4HEA 2;  1EE6 A;  3MKW B;  1U0J A;  2KLO A;  3MKY B;  3L2W A;  3KRG A;  3FKJ A;  1UD4 A;  4E7J A;  4RLF A;  4XOP A;  2ZTN A;  4EW9 A;  4HPQ A;  2DOA A;  3U21 A;  3GQ8 A;  3WWG A;  4CCO A;  1SKY B;  2Z1D A;  2V1N A;  1R6R A;  4HIZ A;  1RWR A;  2LZJ A;  3GQB A;  3VSV A;  3ZCO A;  2L9N A;  5HVQ C;  4HWV A;  2O0V A;  4OWR B;  4OJO A;  4Z1M A;  2OV7 A;  3VMW A;  4JOM A;  3E0J B;  4XM3 A;  3OS2 A;  2JJ1 A;  4OZY A;  2ZTG A;  4E7H A;  4B3X A;  1WJB A;  3LL7 A;  3CZ6 A;  1UAA A;  4XON A;  2X51 A;  2ZFU A;  2X8K A;  2UVE A;  2ODL A;  1OHH A;  2INU A;  3HG9 A;  2R7S A;  4R79 A;  3S3O A;  2KL4 A;  4CSW A;  2IS6 A;  1LDK B;  4KKT A;  5JHF A;  4YZA A;  2UV1 A;  4F93 B;  3OYF A;  5LFA A;  1LVK A;  1W9X A;  4NC8 A;  2DXI A;  2V7F A;  2V4D A;  1NG6 A;  3C2G A;  1DQU A;  4TKO B;  2OC6 A;  2IS1 A;  2CUZ A;  4ZYA A;  4DIQ A;  4G6I A;  1KTW A;  4YZ0 A;  1LFP A;  4E7I A;  2XF5 A;  4YZQ A;  2F4I A;  3PNY A;  4BEH B;  4BQN A;  3FPP A;  3A3G A;  3EUA A;  1RMG A;  2PMZ A;  4IQ4 A;  1O8I A;  4PK4 A;  2CW7 A;  1D1B A;  4DGW B;  2X1C A;  4B47 A;  3OOC A;  1OB0 A;  1X0C A;  2NTB A;  2O04 A;  2WSS A;  2VKD A;  4BE2 A;  5HOO A;  2HVS A;  3DDY A;  1S9H A;  4QPQ A;  2RQQ A;  2MC4 A;  2NT9 A;  3CF2 A;  1UEL B;  1WJC A;  2W00 A;  4G6T B;  1BOB A;  3VSK A;  3HOT A;  4B48 A;  2WJY A;  3CJQ B;  1D0Y A;  2VL8 A;  2DT7 B;  2IXS A;  3CMM A;  4MR0 A;  4B3F X;  4E7S A;  4B3G A;  3I3L A;  1MNE A;  1O8D A;  2JA2 A;  3L2Q A;  2ELJ A;  3EPZ A;  3LSI A;  2L7K A;  3VYR B;  4BDZ A;  3DPT A;  1K6Y A;  2K5C A;  3F9K A;  2L9S A;  2XC7 A;  4LG3 A;  2VBM A;  4ASU A;  2JUG A;  1W0J A;  2GJK A;  2XF7 A;  1WJF A;  1BR1 A;  3OYC A;  3BCF A;  2CV2 A;  3GVL A;  3ZPN A;  2WAD A;  2QKL B;  4HG2 A;  2W6J A;  4OJ6 A;  3ZR8 X;  3CP2 A;  2WJV A;  3N05 A;  4J01 A;  4C2T A;  2KRH A;  4XNF A;  1QCX A;  2X6Y A;  3IAM 2;  2X6X A;  3G05 A;  1D1C A;  2CS3 A;  3JUR A;  3K4L A;  4N4O B;  3H9Q A;  3UR3 C;  2R7T A;  1E3X A;  3OYE A;  2BVL A;  3K4K A;  2GOX B;  4BS9 A;  3HOS A;  2KRC A;  4CZC A;  4XLH A;  3FDY A;  3KEW A;  4IZZ A;  4YXW A;  4PUS A;  1WMR A;  4F55 A;  1CZF A;  2XND A;  4E0F A;  2E1M C;  3G2B A;  2JDI A;  4MLO A;  4IQJ A;  2LRD A;  3OEE A;  3D5L A;  4ZDL A;  1FMW A;  3VDX A;  3W3C A;  4BL0 B;  1AA7 A;  2LG4 A;  3RCO A;  4DK1 A;  3OS0 A;  3M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...