2F3LA

Crystal structure of a lumenal rfr-domain protein (contig83.1_1_243_746) from cyanothece sp. 51142 at 2.1 angstrom resolution.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RFR-Domain
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2f3lA00
5JLVC 2J8IA 2BM5A 2G0YA 3N90A 2BM7A 4JRAC 2BM4A 5JMCB 2F3LA 2BM6A 2W7ZA
chains in the Genus database with same CATH superfamily
3VSUA 1EA0A 1TYUA 3ZPPA 4YZ0A 4YDTA 3LJYA 4MR0A 4OJPA 4XQFA 4XM3A 4OPWA 1OFLA 3JURA 3TH0A 2IQ7A 2PYHA 2NSTA 2X85A 4OJOA 3BH7B 4XN3A 2UVEA 2VBKA 2XTXA 5JMCB 1O8FA 2QX3A 4YC5A 4XLHA 4YELA 4XORA 1QA3A 1O8KA 4I84A 1IDJA 2XTWA 2BM4A 1KQ5A 1O8DA 3PSSA 4XR6A 3AK5A 4EW9A 1K8FA 4OM9A 2G0YA 3LMWA 1L1IA 4OJ6A 4MXNA 2VFPA 3T9GA 1OGMX 1O8MA 4XONA 3VSVA 1IB4A 2NSPA 2VFNA 2XC1A 1OFMA 1VBLA 4XLFA 2NZMA 1IA5A 1WMRA 5C1CA 1RU4A 2X6YA 2QXZA 2NTQA 1LLZA 4W8TA 1QRBA 1TYWA 1CZFA 3ML3A 1KCDA 2O17A 2NTPA 3GQ7A 4PMHA 3NB2A 3VSTA 1TYXA 2BX6A 4HWVA 4V02C 4Z06A 1DBOA 3PSZA 4AVZA 1QA2A 1QQ1A 2BM5A 1DBGA 4XLEA 4YZAA 5AMVA 1QJVA 3VMWA 4XL9A 2VJJA 3H09A 1RWRA 2INUA 3JX8A 3PETA 1OFDA 1O8EA 2O04A 2B0RA 2O0VA 2IOUG 1KTWA 1O8IA 2X6WA 1HG8A 1KCCA 4XKWA 4YEIA 5DNSA 1WXRA 4W8SA 1TSPA 2UVFA 1QRCA 3BH6B 3RIQA 2NTBA 1LM1A 1PLUA 4OJ5A 1RMGA 2NT9A 1LLWA 2INVA 2EWEA 2PECA 3SZEA 4XMYA 4OZYA 4Z05A 2X6XA 2QYUA 2VBEA 1BHEA 3B8YA 4XLCA 1O88A 4OZZA 4U4BA 4XN0A 3NAWA 1BN8A 1O8LA 2ODLA 4YCQA 4NK6A 2VJIA 2J8IA 2YUHA 2Z8GA 4XNFA 5C1EA 3UW0A 3B4NA 3SY2A 1O8JA 2QY1A 2QZAA 1NHCA 4YFOA 1EE6A 2O6WA 2VFOA 1XG2A 1IDKA 2NT6A 4OJLA 1PXZA 2XTYA 3DU1X 1OOCA 4C2LA 1DABA 3VMVA 1X0CA 1QCXA 2J8KA 2X3HA 4W8QA 1O8GA 4YZXA 1CLWA 2VFQA 4XOTA 5JLVC 1K5CA 1K4ZA 1JTAA 1JRGA 3GQAA 2XT2A 3ZSCA 4NK8A 2BM7A 3GQ8A 1TYVA 1OFEA 3N6ZA 4Z03A 2VFMA 1GQ8A 2V5IA 3SQVA 3GQ9A 2VBMA 4XKVA 4JRAC 1EZGA 3P4GA 2O0WA 3B90A 3FY3A 4XLAA 2BSPA 3WWGA 1HF2A 3EQNA 2O1DA 3KRGA 3N90A 3GRHA 4URRA 4YZQA 2F3LA 1O8HA 2BM6A 4YEJA 3SYJA 1AIRA 3LYCA 4XOPA 2W7ZA 1QA1A 4W8RA 1OGOX 2PYGA 3EQOA 2XT4A 1PE9A 4U49A 1H80A 4KH3A 3SUCA
chains in the Genus database with same CATH topology
2VFNA 2XC1A 5JLVC 1K4ZA 1TYUA 1TSPA 3BH6B 1QRCA 3RIQA 2BM7A 3LJYA 4OJ5A 4OJPA 1TYVA 3SZEA 1QRBA 3N6ZA 1TYWA 2VFMA 3ML3A 4OPWA 2V5IA 3TH0A 4OJOA 3BH7B 4JRAC 5JMCB 1TYXA 2BX6A 4V02C 1WXRA 3P4GA 1QA2A 1HF2A 1QQ1A 2J8IA 2BM5A 2YUHA 3N90A 2BM4A 2F3LA 1KQ5A 3AK5A 2BM6A 3H09A 3PETA 2VFQA 3JX8A 3SYJA 3LYCA 2W7ZA 1QA1A 2VFOA 1K8FA 2B0RA 4OM9A 2IOUG 2G0YA 4OJLA 4OJ6A 2VFPA 1DABA 1QA3A 4KH3A 1CLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLV C;  2J8I A;  2BM5 A;  2G0Y A;  3N90 A;  2BM7 A;  4JRA C;  2BM4 A;  5JMC B;  2F3L A;  2BM6 A;  2W7Z A; 
#chains in the Genus database with same CATH topology
 3VSU A;  1EA0 A;  1TYU A;  3ZPP A;  4YZ0 A;  4YDT A;  3LJY A;  4MR0 A;  4OJP A;  4XQF A;  4XM3 A;  4OPW A;  1OFL A;  3JUR A;  3TH0 A;  2IQ7 A;  2PYH A;  2NST A;  2X85 A;  4OJO A;  3BH7 B;  4XN3 A;  2UVE A;  2VBK A;  2XTX A;  5JMC B;  1O8F A;  2QX3 A;  4YC5 A;  4XLH A;  4YEL A;  4XOR A;  1QA3 A;  1O8K A;  4I84 A;  1IDJ A;  2XTW A;  2BM4 A;  1KQ5 A;  1O8D A;  3PSS A;  4XR6 A;  3AK5 A;  4EW9 A;  1K8F A;  4OM9 A;  2G0Y A;  3LMW A;  1L1I A;  4OJ6 A;  4MXN A;  2VFP A;  3T9G A;  1OGM X;  1O8M A;  4XON A;  3VSV A;  1IB4 A;  2NSP A;  2VFN A;  2XC1 A;  1OFM A;  1VBL A;  4XLF A;  2NZM A;  1IA5 A;  1WMR A;  5C1C A;  1RU4 A;  2X6Y A;  2QXZ A;  2NTQ A;  1LLZ A;  4W8T A;  1QRB A;  1TYW A;  1CZF A;  3ML3 A;  1KCD A;  2O17 A;  2NTP A;  3GQ7 A;  4PMH A;  3NB2 A;  3VST A;  1TYX A;  2BX6 A;  4HWV A;  4V02 C;  4Z06 A;  1DBO A;  3PSZ A;  4AVZ A;  1QA2 A;  1QQ1 A;  2BM5 A;  1DBG A;  4XLE A;  4YZA A;  5AMV A;  1QJV A;  3VMW A;  4XL9 A;  2VJJ A;  3H09 A;  1RWR A;  2INU A;  3JX8 A;  3PET A;  1OFD A;  1O8E A;  2O04 A;  2B0R A;  2O0V A;  2IOU G;  1KTW A;  1O8I A;  2X6W A;  1HG8 A;  1KCC A;  4XKW A;  4YEI A;  5DNS A;  1WXR A;  4W8S A;  1TSP A;  2UVF A;  1QRC A;  3BH6 B;  3RIQ A;  2NTB A;  1LM1 A;  1PLU A;  4OJ5 A;  1RMG A;  2NT9 A;  1LLW A;  2INV A;  2EWE A;  2PEC A;  3SZE A;  4XMY A;  4OZY A;  4Z05 A;  2X6X A;  2QYU A;  2VBE A;  1BHE A;  3B8Y A;  4XLC A;  1O88 A;  4OZZ A;  4U4B A;  4XN0 A;  3NAW A;  1BN8 A;  1O8L A;  2ODL A;  4YCQ A;  4NK6 A;  2VJI A;  2J8I A;  2YUH A;  2Z8G A;  4XNF A;  5C1E A;  3UW0 A;  3B4N A;  3SY2 A;  1O8J A;  2QY1 A;  2QZA A;  1NHC A;  4YFO A;  1EE6 A;  2O6W A;  2VFO A;  1XG2 A;  1IDK A;  2NT6 A;  4OJL A;  1PXZ A;  2XTY A;  3DU1 X;  1OOC A;  4C2L A;  1DAB A;  3VMV A;  1X0C A;  1QCX A;  2J8K A;  2X3H A;  4W8Q A;  1O8G A;  4YZX A;  1CLW A;  2VFQ A;  4XOT A;  5JLV C;  1K5C A;  1K4Z A;  1JTA A;  1JRG A;  3GQA A;  2XT2 A;  3ZSC A;  4NK8 A;  2BM7 A;  3GQ8 A;  1TYV A;  1OFE A;  3N6Z A;  4Z03 A;  2VFM A;  1GQ8 A;  2V5I A;  3SQV A;  3GQ9 A;  2VBM A;  4XKV A;  4JRA C;  1EZG A;  3P4G A;  2O0W A;  3B90 A;  3FY3 A;  4XLA A;  2BSP A;  3WWG A;  1HF2 A;  3EQN A;  2O1D A;  3KRG A;  3N90 A;  3GRH A;  4URR A;  4YZQ A;  2F3L A;  1O8H A;  2BM6 A;  4YEJ A;  3SYJ A;  1AIR A;  3LYC A;  4XOP A;  2W7Z A;  1QA1 A;  4W8R A;  1OGO X;  2PYG A;  3EQO A;  2XT4 A;  1PE9 A;  4U49 A;  1H80 A;  4KH3 A;  3SUC A; 
#chains in the Genus database with same CATH homology
 2VFN A;  2XC1 A;  5JLV C;  1K4Z A;  1TYU A;  1TSP A;  3BH6 B;  1QRC A;  3RIQ A;  2BM7 A;  3LJY A;  4OJ5 A;  4OJP A;  1TYV A;  3SZE A;  1QRB A;  3N6Z A;  1TYW A;  2VFM A;  3ML3 A;  4OPW A;  2V5I A;  3TH0 A;  4OJO A;  3BH7 B;  4JRA C;  5JMC B;  1TYX A;  2BX6 A;  4V02 C;  1WXR A;  3P4G A;  1QA2 A;  1HF2 A;  1QQ1 A;  2J8I A;  2BM5 A;  2YUH A;  3N90 A;  2BM4 A;  2F3L A;  1KQ5 A;  3AK5 A;  2BM6 A;  3H09 A;  3PET A;  2VFQ A;  3JX8 A;  3SYJ A;  3LYC A;  2W7Z A;  1QA1 A;  2VFO A;  1K8F A;  2B0R A;  4OM9 A;  2IOU G;  2G0Y A;  4OJL A;  4OJ6 A;  2VFP A;  1DAB A;  1QA3 A;  4KH3 A;  1CLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...