2F3LA

Crystal structure of a lumenal rfr-domain protein (contig83.1_1_243_746) from cyanothece sp. 51142 at 2.1 angstrom resolution.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RFR-Domain
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2f3lA00
2J8IA 5JMCB 4JRAC 5JLVC 2F3LA 2BM7A 2W7ZA 2BM5A 3N90A 2BM4A 2BM6A 2G0YA
chains in the Genus database with same CATH superfamily
2INVA 5C1EA 4Z03A 3VSUA 5JLVC 1LLZA 5AMVA 2J8KA 1PE9A 1O8EA 1QCXA 3FY3A 4OJPA 4XMYA 1K8FA 2QY1A 3B8YA 2X85A 2PYHA 2XC1A 1PXZA 1JRGA 4W8RA 1QRCA 1DABA 1WXRA 2QXZA 1TYVA 1OFEA 2BM7A 1X0CA 2NSPA 3LYCA 1OFDA 2VBEA 3JX8A 1LLWA 2PYGA 1O8JA 5DNSA 4OZYA 3ZPPA 2NTQA 2X6XA 4XM3A 3RIQA 1O8IA 2BM4A 4XLEA 1RWRA 2XTXA 3PETA 3SZEA 1K4ZA 4YZQA 3KRGA 1K5CA 2O0WA 2NTPA 4XNFA 1O8HA 4NK8A 1O8DA 3BH7B 4XN3A 3SY2A 1O8GA 4YELA 4W8SA 4XKVA 2QYUA 3LMWA 1BHEA 3T9GA 1TSPA 3SUCA 2BM5A 4V02C 2O0VA 2VFPA 5C1CA 4MR0A 4XOTA 2V5IA 4PMHA 2O6WA 4XONA 3B4NA 4YZ0A 3AK5A 1OGOX 4MXNA 1GQ8A 3LJYA 1OOCA 1DBGA 2NSTA 4I84A 1H80A 3BH6B 1IDKA 3DU1X 2UVEA 2VFQA 3EQOA 4XN0A 4YCQA 1O8LA 3ZSCA 1IB4A 3PSZA 1IDJA 1O88A 2NZMA 3JURA 4XORA 3GQAA 4W8QA 2VBMA 4YFOA 1VBLA 4XLAA 1O8FA 4C2LA 2XT2A 1QJVA 3N6ZA 2Z8GA 2XTYA 1QA2A 4NK6A 2PECA 4U4BA 4OJ6A 2G0YA 1KCCA 2B0RA 1PLUA 3B90A 5JMCB 4OJOA 3GQ7A 4YZAA 3H09A 1QA3A 1TYWA 1QRBA 3GQ8A 3N90A 4XLCA 3P4GA 1AIRA 3NB2A 3TH0A 3VSTA 2INUA 2NT6A 2VFOA 3NAWA 4OPWA 4JRAC 3VSVA 2BSPA 2O1DA 1OGMX 2W7ZA 3PSSA 4YZXA 2O04A 1NHCA 3VMWA 1RMGA 1HG8A 2BM6A 2VFMA 4U49A 4XKWA 4Z06A 4EW9A 4XQFA 2X6YA 2X6WA 1IA5A 1L1IA 2ODLA 3EQNA 4OZZA 2F3LA 1O8KA 3VMVA 2QX3A 2XT4A 3GRHA 1HF2A 4OM9A 1WMRA 2VJJA 3ML3A 4YEIA 2QZAA 2J8IA 1EA0A 3GQ9A 2VJIA 1CLWA 4OJ5A 1KTWA 4YDTA 4HWVA 2VFNA 2VBKA 2XTWA 4OJLA 4XLHA 4KH3A 2NTBA 4AVZA 3UW0A 1EE6A 1DBOA 2UVFA 4XLFA 1KQ5A 1LM1A 1TYUA 1XG2A 4YC5A 4YEJA 1QA1A 1CZFA 2O17A 3SYJA 1BN8A 1OFMA 1RU4A 4URRA 3WWGA 4Z05A 4XL9A 1QQ1A 2YUHA 1JTAA 2NT9A 1TYXA 4XOPA 2BX6A 2EWEA 2IQ7A 2X3HA 4W8TA 1KCDA 3SQVA 1O8MA 2IOUG 1OFLA 1EZGA 4XR6A
chains in the Genus database with same CATH topology
2J8IA 1CLWA 4OJ5A 5JLVC 3N6ZA 1QA2A 2VFNA 4OJLA 1TSPA 4OJPA 2BM5A 2G0YA 4KH3A 2B0RA 4OJ6A 4V02C 1K8FA 2VFPA 5JMCB 2V5IA 4OJOA 2XC1A 3H09A 1QA3A 1TYWA 1KQ5A 1QRBA 1TYUA 1QRCA 3N90A 1DABA 1QA1A 1WXRA 1TYVA 3P4GA 3AK5A 2BM7A 3LYCA 3SYJA 3TH0A 3LJYA 2VFOA 4OPWA 3JX8A 4JRAC 3BH6B 1QQ1A 2W7ZA 2VFQA 2YUHA 3RIQA 2BM4A 1TYXA 2BM6A 2BX6A 2VFMA 3PETA 3SZEA 1K4ZA 2F3LA 2IOUG 4OM9A 1HF2A 3BH7B 3ML3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  5JMC B;  4JRA C;  5JLV C;  2F3L A;  2BM7 A;  2W7Z A;  2BM5 A;  3N90 A;  2BM4 A;  2BM6 A;  2G0Y A; 
#chains in the Genus database with same CATH topology
 2INV A;  5C1E A;  4Z03 A;  3VSU A;  5JLV C;  1LLZ A;  5AMV A;  2J8K A;  1PE9 A;  1O8E A;  1QCX A;  3FY3 A;  4OJP A;  4XMY A;  1K8F A;  2QY1 A;  3B8Y A;  2X85 A;  2PYH A;  2XC1 A;  1PXZ A;  1JRG A;  4W8R A;  1QRC A;  1DAB A;  1WXR A;  2QXZ A;  1TYV A;  1OFE A;  2BM7 A;  1X0C A;  2NSP A;  3LYC A;  1OFD A;  2VBE A;  3JX8 A;  1LLW A;  2PYG A;  1O8J A;  5DNS A;  4OZY A;  3ZPP A;  2NTQ A;  2X6X A;  4XM3 A;  3RIQ A;  1O8I A;  2BM4 A;  4XLE A;  1RWR A;  2XTX A;  3PET A;  3SZE A;  1K4Z A;  4YZQ A;  3KRG A;  1K5C A;  2O0W A;  2NTP A;  4XNF A;  1O8H A;  4NK8 A;  1O8D A;  3BH7 B;  4XN3 A;  3SY2 A;  1O8G A;  4YEL A;  4W8S A;  4XKV A;  2QYU A;  3LMW A;  1BHE A;  3T9G A;  1TSP A;  3SUC A;  2BM5 A;  4V02 C;  2O0V A;  2VFP A;  5C1C A;  4MR0 A;  4XOT A;  2V5I A;  4PMH A;  2O6W A;  4XON A;  3B4N A;  4YZ0 A;  3AK5 A;  1OGO X;  4MXN A;  1GQ8 A;  3LJY A;  1OOC A;  1DBG A;  2NST A;  4I84 A;  1H80 A;  3BH6 B;  1IDK A;  3DU1 X;  2UVE A;  2VFQ A;  3EQO A;  4XN0 A;  4YCQ A;  1O8L A;  3ZSC A;  1IB4 A;  3PSZ A;  1IDJ A;  1O88 A;  2NZM A;  3JUR A;  4XOR A;  3GQA A;  4W8Q A;  2VBM A;  4YFO A;  1VBL A;  4XLA A;  1O8F A;  4C2L A;  2XT2 A;  1QJV A;  3N6Z A;  2Z8G A;  2XTY A;  1QA2 A;  4NK6 A;  2PEC A;  4U4B A;  4OJ6 A;  2G0Y A;  1KCC A;  2B0R A;  1PLU A;  3B90 A;  5JMC B;  4OJO A;  3GQ7 A;  4YZA A;  3H09 A;  1QA3 A;  1TYW A;  1QRB A;  3GQ8 A;  3N90 A;  4XLC A;  3P4G A;  1AIR A;  3NB2 A;  3TH0 A;  3VST A;  2INU A;  2NT6 A;  2VFO A;  3NAW A;  4OPW A;  4JRA C;  3VSV A;  2BSP A;  2O1D A;  1OGM X;  2W7Z A;  3PSS A;  4YZX A;  2O04 A;  1NHC A;  3VMW A;  1RMG A;  1HG8 A;  2BM6 A;  2VFM A;  4U49 A;  4XKW A;  4Z06 A;  4EW9 A;  4XQF A;  2X6Y A;  2X6W A;  1IA5 A;  1L1I A;  2ODL A;  3EQN A;  4OZZ A;  2F3L A;  1O8K A;  3VMV A;  2QX3 A;  2XT4 A;  3GRH A;  1HF2 A;  4OM9 A;  1WMR A;  2VJJ A;  3ML3 A;  4YEI A;  2QZA A;  2J8I A;  1EA0 A;  3GQ9 A;  2VJI A;  1CLW A;  4OJ5 A;  1KTW A;  4YDT A;  4HWV A;  2VFN A;  2VBK A;  2XTW A;  4OJL A;  4XLH A;  4KH3 A;  2NTB A;  4AVZ A;  3UW0 A;  1EE6 A;  1DBO A;  2UVF A;  4XLF A;  1KQ5 A;  1LM1 A;  1TYU A;  1XG2 A;  4YC5 A;  4YEJ A;  1QA1 A;  1CZF A;  2O17 A;  3SYJ A;  1BN8 A;  1OFM A;  1RU4 A;  4URR A;  3WWG A;  4Z05 A;  4XL9 A;  1QQ1 A;  2YUH A;  1JTA A;  2NT9 A;  1TYX A;  4XOP A;  2BX6 A;  2EWE A;  2IQ7 A;  2X3H A;  4W8T A;  1KCD A;  3SQV A;  1O8M A;  2IOU G;  1OFL A;  1EZG A;  4XR6 A; 
#chains in the Genus database with same CATH homology
 2J8I A;  1CLW A;  4OJ5 A;  5JLV C;  3N6Z A;  1QA2 A;  2VFN A;  4OJL A;  1TSP A;  4OJP A;  2BM5 A;  2G0Y A;  4KH3 A;  2B0R A;  4OJ6 A;  4V02 C;  1K8F A;  2VFP A;  5JMC B;  2V5I A;  4OJO A;  2XC1 A;  3H09 A;  1QA3 A;  1TYW A;  1KQ5 A;  1QRB A;  1TYU A;  1QRC A;  3N90 A;  1DAB A;  1QA1 A;  1WXR A;  1TYV A;  3P4G A;  3AK5 A;  2BM7 A;  3LYC A;  3SYJ A;  3TH0 A;  3LJY A;  2VFO A;  4OPW A;  3JX8 A;  4JRA C;  3BH6 B;  1QQ1 A;  2W7Z A;  2VFQ A;  2YUH A;  3RIQ A;  2BM4 A;  1TYX A;  2BM6 A;  2BX6 A;  2VFM A;  3PET A;  3SZE A;  1K4Z A;  2F3L A;  2IOU G;  4OM9 A;  1HF2 A;  3BH7 B;  3ML3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...