2F3LA

Crystal structure of a lumenal rfr-domain protein (contig83.1_1_243_746) from cyanothece sp. 51142 at 2.1 angstrom resolution.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords RFR-Domain
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2f3lA00
2W7ZA 3N90A 2BM7A 2J8IA 2BM6A 4JRAC 2BM4A 2G0YA 5JLVC 5JMCB 2BM5A 2F3LA
chains in the Genus database with same CATH superfamily
4XN3A 3JURA 2NSTA 3BH7B 1DBOA 1HG8A 1QCXA 2O0VA 3KRGA 1NHCA 1XG2A 1O8KA 4AVZA 2QX3A 1OGMX 2O6WA 2J8IA 1QA3A 4YC5A 3AK5A 3T9GA 1KCCA 1IA5A 2INVA 4W8RA 1KTWA 4XNFA 2VFNA 3GQAA 4OJ6A 4XOPA 2NSPA 3N6ZA 4PMHA 4C2LA 2VBEA 4OZYA 2NT9A 1BHEA 5C1EA 1DABA 1O8FA 1O8GA 4W8TA 2ODLA 2XT4A 4U49A 1X0CA 2VFOA 3GQ7A 2VFMA 4YEJA 2Z8GA 1OFLA 4XQFA 1PXZA 2UVFA 1LLWA 2UVEA 2X6WA 3GQ8A 2O0WA 3PETA 4I84A 5DNSA 2PYHA 2XT2A 1IB4A 3VMWA 2VBMA 3VSTA 2XTXA 2QYUA 1OFMA 1BN8A 1WMRA 4W8SA 1AIRA 1O8HA 2BM4A 4YELA 4Z05A 4YZAA 3FY3A 5JLVC 4KH3A 4YFOA 3SQVA 2QXZA 2VFPA 4XONA 2BM7A 1EA0A 2IOUG 2VJIA 3WWGA 3ZSCA 2XTWA 4YZ0A 4OJOA 2X6YA 1QJVA 3B4NA 3B90A 1PLUA 3PSZA 1LM1A 1O8LA 1CLWA 1EE6A 1TYXA 1IDKA 2BX6A 2EWEA 2NTQA 3NAWA 3PSSA 4NK6A 4XLAA 4YCQA 3VSVA 4OZZA 1QRCA 1L1IA 1O88A 2YUHA 1HF2A 1QA1A 1H80A 4XLEA 3SUCA 1EZGA 4XOTA 1KCDA 2NZMA 2X6XA 1OGOX 1GQ8A 2QY1A 4HWVA 4XM3A 2IQ7A 2NTBA 4JRAC 1O8DA 1QA2A 1K4ZA 1O8IA 1PE9A 1RU4A 2X3HA 3VMVA 5JMCB 3EQNA 2B0RA 3SYJA 4V02C 3LJYA 3ZPPA 3JX8A 1VBLA 4YEIA 1RWRA 4XLFA 1TYVA 2F3LA 2NTPA 2NT6A 2QZAA 3B8YA 2XTYA 3GRHA 2XC1A 1QQ1A 4MR0A 1O8MA 1IDJA 2PYGA 3H09A 2X85A 3LMWA 4OPWA 3UW0A 3DU1X 2O04A 1O8JA 4XLHA 3VSUA 2W7ZA 2O1DA 3EQOA 4XL9A 4XR6A 4URRA 5C1CA 4MXNA 2BM6A 1O8EA 4OJPA 2VBKA 1K5CA 2INUA 1TYWA 4OJLA 3GQ9A 3P4GA 4YDTA 1TYUA 4XLCA 2PECA 4XKVA 1WXRA 2VJJA 5AMVA 4XMYA 2O17A 1KQ5A 1QRBA 4OJ5A 4W8QA 1OOCA 1CZFA 4XORA 1JRGA 2VFQA 1RMGA 1OFDA 1TSPA 4YZQA 1OFEA 1K8FA 1JTAA 4Z03A 4U4BA 3TH0A 2G0YA 2BM5A 2BSPA 4XKWA 3SZEA 3BH6B 1DBGA 3N90A 4OM9A 4Z06A 4XN0A 4YZXA 2J8KA 1LLZA 3RIQA 4EW9A 3SY2A 3ML3A 3NB2A 2V5IA 3LYCA 4NK8A
chains in the Genus database with same CATH topology
2YUHA 3PETA 1HF2A 2W7ZA 3BH7B 2BM6A 4OJPA 4OJLA 1TYWA 3P4GA 1TYUA 1WXRA 2J8IA 4JRAC 1QA3A 1KQ5A 1QRBA 2BM4A 5JLVC 1QA2A 1K4ZA 3AK5A 4OJ5A 4KH3A 5JMCB 2VFQA 2B0RA 1TSPA 2VFNA 3SYJA 2VFPA 4OJ6A 1K8FA 4V02C 2BM7A 3LJYA 3N6ZA 3JX8A 2IOUG 3TH0A 2G0YA 2BM5A 4OJOA 1TYVA 2F3LA 1DABA 3SZEA 3BH6B 1TYXA 1CLWA 2VFOA 2XC1A 1QQ1A 2BX6A 3N90A 4OM9A 3H09A 2VFMA 3RIQA 4OPWA 3ML3A 1QA1A 2V5IA 3LYCA 1QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7Z A;  3N90 A;  2BM7 A;  2J8I A;  2BM6 A;  4JRA C;  2BM4 A;  2G0Y A;  5JLV C;  5JMC B;  2BM5 A;  2F3L A; 
#chains in the Genus database with same CATH topology
 4XN3 A;  3JUR A;  2NST A;  3BH7 B;  1DBO A;  1HG8 A;  1QCX A;  2O0V A;  3KRG A;  1NHC A;  1XG2 A;  1O8K A;  4AVZ A;  2QX3 A;  1OGM X;  2O6W A;  2J8I A;  1QA3 A;  4YC5 A;  3AK5 A;  3T9G A;  1KCC A;  1IA5 A;  2INV A;  4W8R A;  1KTW A;  4XNF A;  2VFN A;  3GQA A;  4OJ6 A;  4XOP A;  2NSP A;  3N6Z A;  4PMH A;  4C2L A;  2VBE A;  4OZY A;  2NT9 A;  1BHE A;  5C1E A;  1DAB A;  1O8F A;  1O8G A;  4W8T A;  2ODL A;  2XT4 A;  4U49 A;  1X0C A;  2VFO A;  3GQ7 A;  2VFM A;  4YEJ A;  2Z8G A;  1OFL A;  4XQF A;  1PXZ A;  2UVF A;  1LLW A;  2UVE A;  2X6W A;  3GQ8 A;  2O0W A;  3PET A;  4I84 A;  5DNS A;  2PYH A;  2XT2 A;  1IB4 A;  3VMW A;  2VBM A;  3VST A;  2XTX A;  2QYU A;  1OFM A;  1BN8 A;  1WMR A;  4W8S A;  1AIR A;  1O8H A;  2BM4 A;  4YEL A;  4Z05 A;  4YZA A;  3FY3 A;  5JLV C;  4KH3 A;  4YFO A;  3SQV A;  2QXZ A;  2VFP A;  4XON A;  2BM7 A;  1EA0 A;  2IOU G;  2VJI A;  3WWG A;  3ZSC A;  2XTW A;  4YZ0 A;  4OJO A;  2X6Y A;  1QJV A;  3B4N A;  3B90 A;  1PLU A;  3PSZ A;  1LM1 A;  1O8L A;  1CLW A;  1EE6 A;  1TYX A;  1IDK A;  2BX6 A;  2EWE A;  2NTQ A;  3NAW A;  3PSS A;  4NK6 A;  4XLA A;  4YCQ A;  3VSV A;  4OZZ A;  1QRC A;  1L1I A;  1O88 A;  2YUH A;  1HF2 A;  1QA1 A;  1H80 A;  4XLE A;  3SUC A;  1EZG A;  4XOT A;  1KCD A;  2NZM A;  2X6X A;  1OGO X;  1GQ8 A;  2QY1 A;  4HWV A;  4XM3 A;  2IQ7 A;  2NTB A;  4JRA C;  1O8D A;  1QA2 A;  1K4Z A;  1O8I A;  1PE9 A;  1RU4 A;  2X3H A;  3VMV A;  5JMC B;  3EQN A;  2B0R A;  3SYJ A;  4V02 C;  3LJY A;  3ZPP A;  3JX8 A;  1VBL A;  4YEI A;  1RWR A;  4XLF A;  1TYV A;  2F3L A;  2NTP A;  2NT6 A;  2QZA A;  3B8Y A;  2XTY A;  3GRH A;  2XC1 A;  1QQ1 A;  4MR0 A;  1O8M A;  1IDJ A;  2PYG A;  3H09 A;  2X85 A;  3LMW A;  4OPW A;  3UW0 A;  3DU1 X;  2O04 A;  1O8J A;  4XLH A;  3VSU A;  2W7Z A;  2O1D A;  3EQO A;  4XL9 A;  4XR6 A;  4URR A;  5C1C A;  4MXN A;  2BM6 A;  1O8E A;  4OJP A;  2VBK A;  1K5C A;  2INU A;  1TYW A;  4OJL A;  3GQ9 A;  3P4G A;  4YDT A;  1TYU A;  4XLC A;  2PEC A;  4XKV A;  1WXR A;  2VJJ A;  5AMV A;  4XMY A;  2O17 A;  1KQ5 A;  1QRB A;  4OJ5 A;  4W8Q A;  1OOC A;  1CZF A;  4XOR A;  1JRG A;  2VFQ A;  1RMG A;  1OFD A;  1TSP A;  4YZQ A;  1OFE A;  1K8F A;  1JTA A;  4Z03 A;  4U4B A;  3TH0 A;  2G0Y A;  2BM5 A;  2BSP A;  4XKW A;  3SZE A;  3BH6 B;  1DBG A;  3N90 A;  4OM9 A;  4Z06 A;  4XN0 A;  4YZX A;  2J8K A;  1LLZ A;  3RIQ A;  4EW9 A;  3SY2 A;  3ML3 A;  3NB2 A;  2V5I A;  3LYC A;  4NK8 A; 
#chains in the Genus database with same CATH homology
 2YUH A;  3PET A;  1HF2 A;  2W7Z A;  3BH7 B;  2BM6 A;  4OJP A;  4OJL A;  1TYW A;  3P4G A;  1TYU A;  1WXR A;  2J8I A;  4JRA C;  1QA3 A;  1KQ5 A;  1QRB A;  2BM4 A;  5JLV C;  1QA2 A;  1K4Z A;  3AK5 A;  4OJ5 A;  4KH3 A;  5JMC B;  2VFQ A;  2B0R A;  1TSP A;  2VFN A;  3SYJ A;  2VFP A;  4OJ6 A;  1K8F A;  4V02 C;  2BM7 A;  3LJY A;  3N6Z A;  3JX8 A;  2IOU G;  3TH0 A;  2G0Y A;  2BM5 A;  4OJO A;  1TYV A;  2F3L A;  1DAB A;  3SZE A;  3BH6 B;  1TYX A;  1CLW A;  2VFO A;  2XC1 A;  1QQ1 A;  2BX6 A;  3N90 A;  4OM9 A;  3H09 A;  2VFM A;  3RIQ A;  4OPW A;  3ML3 A;  1QA1 A;  2V5I A;  3LYC A;  1QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...