The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
132
|
structure length |
132
|
Chain Sequence |
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb |
| molecule keywords |
RFR-Domain
|
| molecule tags |
Unknown function
|
| source organism |
Cyanothece sp. atcc 51142
|
| total genus |
53
|
| structure length |
132
|
| sequence length |
132
|
| ec nomenclature | |
| pdb deposition date | 2005-11-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00805 | Pentapeptide | Pentapeptide repeats (8 copies) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | 3 Solenoid | Pectate Lyase C-like | Pectate Lyase C-like |
#chains in the Genus database with same CATH superfamily 2F3L A; 2BM4 A; 2J8I A; 5JMC B; 3N90 A; 5JLV C; 2G0Y A; 2BM7 A; 4JRA C; 2W7Z A; 2BM5 A; 2BM6 A; #chains in the Genus database with same CATH topology 2NZM A; 1EZG A; 1K4Z A; 1XG2 A; 3PSS A; 2Z8G A; 2UVF A; 4OJL A; 3NAW A; 4XNF A; 1TYV A; 2XTX A; 2EWE A; 1LLZ A; 1AIR A; 3FY3 A; 1GQ8 A; 4KH3 A; 3ML3 A; 4OZZ A; 2G0Y A; 1QA1 A; 1IDK A; 1TSP A; 3B4N A; 4JRA C; 4URR A; 4HWV A; 2J8I A; 2NT9 A; 4YEI A; 1JRG A; 1PLU A; 2ODL A; 4XR6 A; 1EA0 A; 1CLW A; 1O8K A; 4NK8 A; 4YZA A; 1IDJ A; 4YEL A; 2BM4 A; 3EQO A; 1K5C A; 2X6X A; 1BHE A; 2XTY A; 1DAB A; 2VFP A; 1BN8 A; 3GQ9 A; 2NTB A; 1RMG A; 3AK5 A; 1OGM X; 2IOU G; 1OFM A; 4XLF A; 4OJO A; 4XOR A; 1RU4 A; 1H80 A; 1WMR A; 2XT2 A; 3VST A; 2O0W A; 1TYW A; 4W8S A; 1KCC A; 3DU1 X; 2QXZ A; 2INV A; 1O8G A; 4MR0 A; 3RIQ A; 3WWG A; 4XON A; 3EQN A; 2XT4 A; 4Z05 A; 3SQV A; 3LYC A; 4MXN A; 1TYU A; 2BM5 A; 2QYU A; 4OZY A; 4YDT A; 3SZE A; 2O6W A; 1VBL A; 2X6Y A; 1O8D A; 4XKW A; 3SYJ A; 2NSP A; 1OGO X; 1K8F A; 2IQ7 A; 4NK6 A; 1KCD A; 1CZF A; 2V5I A; 2X85 A; 1QQ1 A; 2O04 A; 2O1D A; 5JLV C; 1QA2 A; 4XQF A; 2NTP A; 1O8F A; 1KQ5 A; 1QRB A; 2X6W A; 1O8M A; 2VBK A; 2J8K A; 4OJ6 A; 3B90 A; 3B8Y A; 2X3H A; 2YUH A; 5AMV A; 1QJV A; 2W7Z A; 4PMH A; 1WXR A; 2BM6 A; 2VFM A; 4W8T A; 4Z06 A; 2QZA A; 3PSZ A; 4W8R A; 4XMY A; 3ZSC A; 1DBG A; 1HF2 A; 1QCX A; 1X0C A; 1OFE A; 4YEJ A; 4C2L A; 4XL9 A; 4EW9 A; 5JMC B; 4U4B A; 4OM9 A; 1O8J A; 4XLA A; 3LMW A; 1EE6 A; 1OOC A; 1OFD A; 4YC5 A; 1RWR A; 3N6Z A; 3ZPP A; 3N90 A; 4I84 A; 3SY2 A; 1PXZ A; 1HG8 A; 4OJP A; 2VJI A; 3VSU A; 3GQA A; 2B0R A; 3PET A; 2QX3 A; 2QY1 A; 4YZX A; 3VMW A; 1L1I A; 3JX8 A; 4XN3 A; 5C1C A; 4AVZ A; 1QA3 A; 1JTA A; 3H09 A; 1LLW A; 3GQ7 A; 3LJY A; 1O8L A; 4XOP A; 3TH0 A; 3VMV A; 1O8I A; 3UW0 A; 3BH6 B; 1O8E A; 3P4G A; 1KTW A; 1QRC A; 3JUR A; 4XLC A; 1DBO A; 1PE9 A; 1O8H A; 2NST A; 4OJ5 A; 2NT6 A; 4XLE A; 3NB2 A; 1LM1 A; 2INU A; 4V02 C; 2O17 A; 4YZQ A; 4YZ0 A; 4XKV A; 1IA5 A; 2VBE A; 2BM7 A; 2XC1 A; 2UVE A; 1IB4 A; 1TYX A; 4XOT A; 4YFO A; 4XLH A; 1O88 A; 2VBM A; 2VFO A; 4XN0 A; 3BH7 B; 3SUC A; 3T9G A; 2PYG A; 5C1E A; 2PYH A; 3GQ8 A; 5DNS A; 2NTQ A; 4U49 A; 3GRH A; 4OPW A; 2F3L A; 4W8Q A; 4YCQ A; 2O0V A; 2PEC A; 2VFN A; 2XTW A; 1OFL A; 4XM3 A; 3VSV A; 2VJJ A; 2BX6 A; 2VFQ A; 1NHC A; 2BSP A; 4Z03 A; 3KRG A; #chains in the Genus database with same CATH homology 4OJ6 A; 2IOU G; 1K4Z A; 3BH6 B; 4OJO A; 3P4G A; 1QRC A; 2YUH A; 1TYW A; 4OJL A; 2W7Z A; 1TYV A; 4OJ5 A; 2BM6 A; 1WXR A; 2VFM A; 3RIQ A; 1HF2 A; 4V02 C; 5JMC B; 4KH3 A; 3ML3 A; 1QA1 A; 2G0Y A; 2BM7 A; 2XC1 A; 3LYC A; 1TYU A; 4OM9 A; 2BM5 A; 1TYX A; 3SZE A; 1TSP A; 4JRA C; 3N6Z A; 2J8I A; 3SYJ A; 2VFO A; 3N90 A; 3BH7 B; 1K8F A; 3TH0 A; 1CLW A; 4OJP A; 2B0R A; 3PET A; 4OPW A; 2F3L A; 2V5I A; 2BM4 A; 1QQ1 A; 2VFN A; 3JX8 A; 1DAB A; 1QA3 A; 5JLV C; 1QA2 A; 3H09 A; 2VFP A; 2BX6 A; 2VFQ A; 3LJY A; 1KQ5 A; 1QRB A; 3AK5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
