2F3LA

Crystal structure of a lumenal rfr-domain protein (contig83.1_1_243_746) from cyanothece sp. 51142 at 2.1 angstrom resolution.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
molecule keywords RFR-Domain
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2f3lA00
2J8IA 5JLVC 2G0YA 2W7ZA 4JRAC 2BM5A 2BM7A 2BM6A 5JMCB 2F3LA 2BM4A 3N90A
chains in the Genus database with same CATH superfamily
2X6WA 2X6YA 4XONA 5C1CA 4MXNA 4AVZA 4XR6A 1IB4A 4XLEA 1BHEA 2XC1A 2XTYA 1O8EA 2J8KA 3EQOA 1NHCA 5JLVC 3ZPPA 1OFLA 1H80A 2NZMA 4XM3A 1O8LA 2BM7A 2BM6A 1QJVA 1TSPA 1CZFA 1EZGA 2V5IA 1O8MA 1GQ8A 1O8FA 1QCXA 2QYUA 2VFPA 3LYCA 4XLFA 3SYJA 1KTWA 2G0YA 2QXZA 4YELA 3H09A 3NB2A 4OZZA 4XORA 3NAWA 1KCDA 4XKVA 2PYGA 2INUA 3DU1X 3PSSA 1CLWA 1OFEA 2W7ZA 1IA5A 4YEJA 3UW0A 3GQ7A 2X85A 1EE6A 4U49A 1QA2A 3SY2A 4XNFA 3WWGA 3RIQA 2BM5A 1OFMA 1LLZA 3SQVA 3ZSCA 2VFNA 4PMHA 1IDKA 4YZXA 1OFDA 1WMRA 4XOTA 3VSUA 3ML3A 1HG8A 4NK8A 4XLCA 3B90A 1O8HA 3B4NA 1QQ1A 1K4ZA 2QZAA 2XT2A 4KH3A 2PYHA 4YCQA 3LJYA 1JRGA 2NTPA 3JX8A 1K8FA 1OOCA 4YFOA 2X3HA 3BH7B 1LM1A 3JURA 4YC5A 2NSTA 1PE9A 2UVFA 3SZEA 1O8GA 1TYUA 3VMVA 2VBMA 2VFMA 2XTXA 2NT6A 4XMYA 4W8SA 2BX6A 4OJPA 2VFOA 2O0VA 4V02C 4YZQA 1DBOA 1O8IA 1K5CA 3SUCA 4OJOA 2XTWA 2VFQA 1XG2A 2EWEA 3GQ8A 2B0RA 4XL9A 5C1EA 3VSVA 2VBEA 4I84A 1JTAA 3KRGA 4YDTA 2O1DA 1O88A 1O8JA 3EQNA 2PECA 1LLWA 3P4GA 4NK6A 2VJJA 2XT4A 1KCCA 1KQ5A 2IOUG 1PLUA 3LMWA 4XKWA 1QA3A 1PXZA 4Z06A 1TYWA 2UVEA 1BN8A 1QRCA 3GQAA 4OPWA 2IQ7A 2O6WA 3PETA 4OM9A 4EW9A 5JMCB 2ODLA 1VBLA 4XN3A 4YZ0A 5DNSA 1O8DA 3B8YA 2O04A 4Z05A 4OJ5A 3N90A 4YEIA 1EA0A 4XLAA 4XOPA 2NT9A 4Z03A 1TYXA 4OJ6A 2NTBA 2INVA 3VSTA 3N6ZA 2BM4A 4C2LA 2YUHA 4W8QA 4OZYA 1QRBA 3T9GA 1L1IA 2NTQA 4URRA 4XLHA 1DABA 4HWVA 3AK5A 4XN0A 1DBGA 1O8KA 5AMVA 2J8IA 1IDJA 1RWRA 1RU4A 2Z8GA 4XQFA 4W8TA 1AIRA 2F3LA 4OJLA 2X6XA 1HF2A 2BSPA 3GRHA 1X0CA 3PSZA 4YZAA 1QA1A 1WXRA 1RMGA 2O0WA 3GQ9A 2QY1A 4JRAC 4W8RA 2VBKA 3VMWA 4U4BA 1OGMX 3FY3A 4MR0A 1OGOX 2QX3A 3TH0A 1TYVA 2NSPA 2O17A 2VJIA 3BH6B
chains in the Genus database with same CATH topology
2VFQA 2B0RA 3RIQA 2BM5A 1QRBA 2VFNA 1DABA 5JMCB 2XC1A 3P4GA 3AK5A 2J8IA 5JLVC 3ML3A 1QA2A 1KQ5A 2IOUG 2BM7A 1QA3A 1TSPA 2BM6A 2V5IA 1TYWA 4OPWA 1QRCA 2VFPA 3LYCA 1QQ1A 1K4ZA 2F3LA 3PETA 4KH3A 4OJLA 4OM9A 3LJYA 3SYJA 3JX8A 1HF2A 1K8FA 2G0YA 3H09A 1WXRA 3BH7B 1QA1A 4JRAC 3SZEA 3BH6B 1TYUA 4OJ5A 1CLWA 3N90A 2VFMA 2W7ZA 2BX6A 4OJPA 2VFOA 3TH0A 4V02C 1TYVA 1TYXA 4OJ6A 3N6ZA 2BM4A 4OJOA 2YUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8I A;  5JLV C;  2G0Y A;  2W7Z A;  4JRA C;  2BM5 A;  2BM7 A;  2BM6 A;  5JMC B;  2F3L A;  2BM4 A;  3N90 A; 
#chains in the Genus database with same CATH topology
 2X6W A;  2X6Y A;  4XON A;  5C1C A;  4MXN A;  4AVZ A;  4XR6 A;  1IB4 A;  4XLE A;  1BHE A;  2XC1 A;  2XTY A;  1O8E A;  2J8K A;  3EQO A;  1NHC A;  5JLV C;  3ZPP A;  1OFL A;  1H80 A;  2NZM A;  4XM3 A;  1O8L A;  2BM7 A;  2BM6 A;  1QJV A;  1TSP A;  1CZF A;  1EZG A;  2V5I A;  1O8M A;  1GQ8 A;  1O8F A;  1QCX A;  2QYU A;  2VFP A;  3LYC A;  4XLF A;  3SYJ A;  1KTW A;  2G0Y A;  2QXZ A;  4YEL A;  3H09 A;  3NB2 A;  4OZZ A;  4XOR A;  3NAW A;  1KCD A;  4XKV A;  2PYG A;  2INU A;  3DU1 X;  3PSS A;  1CLW A;  1OFE A;  2W7Z A;  1IA5 A;  4YEJ A;  3UW0 A;  3GQ7 A;  2X85 A;  1EE6 A;  4U49 A;  1QA2 A;  3SY2 A;  4XNF A;  3WWG A;  3RIQ A;  2BM5 A;  1OFM A;  1LLZ A;  3SQV A;  3ZSC A;  2VFN A;  4PMH A;  1IDK A;  4YZX A;  1OFD A;  1WMR A;  4XOT A;  3VSU A;  3ML3 A;  1HG8 A;  4NK8 A;  4XLC A;  3B90 A;  1O8H A;  3B4N A;  1QQ1 A;  1K4Z A;  2QZA A;  2XT2 A;  4KH3 A;  2PYH A;  4YCQ A;  3LJY A;  1JRG A;  2NTP A;  3JX8 A;  1K8F A;  1OOC A;  4YFO A;  2X3H A;  3BH7 B;  1LM1 A;  3JUR A;  4YC5 A;  2NST A;  1PE9 A;  2UVF A;  3SZE A;  1O8G A;  1TYU A;  3VMV A;  2VBM A;  2VFM A;  2XTX A;  2NT6 A;  4XMY A;  4W8S A;  2BX6 A;  4OJP A;  2VFO A;  2O0V A;  4V02 C;  4YZQ A;  1DBO A;  1O8I A;  1K5C A;  3SUC A;  4OJO A;  2XTW A;  2VFQ A;  1XG2 A;  2EWE A;  3GQ8 A;  2B0R A;  4XL9 A;  5C1E A;  3VSV A;  2VBE A;  4I84 A;  1JTA A;  3KRG A;  4YDT A;  2O1D A;  1O88 A;  1O8J A;  3EQN A;  2PEC A;  1LLW A;  3P4G A;  4NK6 A;  2VJJ A;  2XT4 A;  1KCC A;  1KQ5 A;  2IOU G;  1PLU A;  3LMW A;  4XKW A;  1QA3 A;  1PXZ A;  4Z06 A;  1TYW A;  2UVE A;  1BN8 A;  1QRC A;  3GQA A;  4OPW A;  2IQ7 A;  2O6W A;  3PET A;  4OM9 A;  4EW9 A;  5JMC B;  2ODL A;  1VBL A;  4XN3 A;  4YZ0 A;  5DNS A;  1O8D A;  3B8Y A;  2O04 A;  4Z05 A;  4OJ5 A;  3N90 A;  4YEI A;  1EA0 A;  4XLA A;  4XOP A;  2NT9 A;  4Z03 A;  1TYX A;  4OJ6 A;  2NTB A;  2INV A;  3VST A;  3N6Z A;  2BM4 A;  4C2L A;  2YUH A;  4W8Q A;  4OZY A;  1QRB A;  3T9G A;  1L1I A;  2NTQ A;  4URR A;  4XLH A;  1DAB A;  4HWV A;  3AK5 A;  4XN0 A;  1DBG A;  1O8K A;  5AMV A;  2J8I A;  1IDJ A;  1RWR A;  1RU4 A;  2Z8G A;  4XQF A;  4W8T A;  1AIR A;  2F3L A;  4OJL A;  2X6X A;  1HF2 A;  2BSP A;  3GRH A;  1X0C A;  3PSZ A;  4YZA A;  1QA1 A;  1WXR A;  1RMG A;  2O0W A;  3GQ9 A;  2QY1 A;  4JRA C;  4W8R A;  2VBK A;  3VMW A;  4U4B A;  1OGM X;  3FY3 A;  4MR0 A;  1OGO X;  2QX3 A;  3TH0 A;  1TYV A;  2NSP A;  2O17 A;  2VJI A;  3BH6 B; 
#chains in the Genus database with same CATH homology
 2VFQ A;  2B0R A;  3RIQ A;  2BM5 A;  1QRB A;  2VFN A;  1DAB A;  5JMC B;  2XC1 A;  3P4G A;  3AK5 A;  2J8I A;  5JLV C;  3ML3 A;  1QA2 A;  1KQ5 A;  2IOU G;  2BM7 A;  1QA3 A;  1TSP A;  2BM6 A;  2V5I A;  1TYW A;  4OPW A;  1QRC A;  2VFP A;  3LYC A;  1QQ1 A;  1K4Z A;  2F3L A;  3PET A;  4KH3 A;  4OJL A;  4OM9 A;  3LJY A;  3SYJ A;  3JX8 A;  1HF2 A;  1K8F A;  2G0Y A;  3H09 A;  1WXR A;  3BH7 B;  1QA1 A;  4JRA C;  3SZE A;  3BH6 B;  1TYU A;  4OJ5 A;  1CLW A;  3N90 A;  2VFM A;  2W7Z A;  2BX6 A;  4OJP A;  2VFO A;  3TH0 A;  4V02 C;  1TYV A;  1TYX A;  4OJ6 A;  3N6Z A;  2BM4 A;  4OJO A;  2YUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...