2F3LA

Crystal structure of a lumenal rfr-domain protein (contig83.1_1_243_746) from cyanothece sp. 51142 at 2.1 angstrom resolution.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
132
structure length
132
Chain Sequence
ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of two potentially universal turn motifs that shape the repeated five-residues fold-Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142.
pubmed doi rcsb
source organism Cyanothece sp. atcc 51142
molecule tags Unknown function
molecule keywords RFR-Domain
total genus 53
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2f3lA00
2F3LA 2W7ZA 2BM5A 5JMCB 5JLVC 3N90A 2BM4A 2G0YA 2J8IA 2BM7A 4JRAC 2BM6A
chains in the Genus database with same CATH superfamily
1K5CA 2NT9A 2QXZA 2VFOA 1HF2A 4OPWA 2XT2A 3EQOA 4XONA 2B0RA 2YUHA 1KTWA 2BM6A 2XT4A 3P4GA 1RMGA 1QRCA 1EZGA 2BM5A 2IOUG 3PSSA 4U4BA 4V02C 3VSTA 1L1IA 3LMWA 4I84A 1QQ1A 2VBEA 4YEJA 2QYUA 1TYWA 3VSUA 1IA5A 1O8KA 1QRBA 2QZAA 3ML3A 3ZSCA 4XLCA 4OJ5A 4XQFA 4XLHA 2VBKA 2UVEA 1O8LA 2VFMA 1OFLA 2NTPA 1OGMX 3N6ZA 1IB4A 1PXZA 1JRGA 2W7ZA 3VMVA 3N90A 3BH6B 1O8FA 1TYXA 1OOCA 2INVA 2NTBA 3ZPPA 3PETA 4Z06A 1HG8A 1RWRA 2X6XA 4XKVA 4EW9A 2X3HA 5JLVC 4OJOA 1OFMA 1X0CA 1DBGA 2J8IA 4YZQA 1TYVA 4OJLA 2NSPA 3SYJA 3AK5A 2VJJA 4XLEA 2X6YA 4XR6A 4OM9A 3KRGA 2PYHA 3SZEA 4OZZA 2BM4A 2VBMA 2XTYA 4AVZA 2BSPA 4W8QA 1OGOX 4HWVA 4YZ0A 2X85A 1DBOA 2XC1A 4KH3A 4MR0A 4XN0A 3RIQA 1TSPA 4U49A 4C2LA 1BHEA 2O0VA 4XOTA 3T9GA 4XNFA 1KCDA 2J8KA 2VJIA 3LJYA 4XOPA 2O17A 3TH0A 4YFOA 4YC5A 1QA1A 1IDJA 4YDTA 2NSTA 2EWEA 3B8YA 2VFPA 4XKWA 4URRA 1O8GA 2O04A 2IQ7A 1LM1A 1CLWA 2XTWA 2PYGA 1AIRA 3GQ8A 1LLWA 1NHCA 1GQ8A 2NT6A 3GQAA 1QJVA 1QA3A 3UW0A 2BX6A 1OFEA 4OZYA 3FY3A 3B90A 1K4ZA 2VFQA 1O8JA 2F3LA 3EQNA 2VFNA 2O0WA 3VMWA 3VSVA 2QY1A 4PMHA 4XMYA 1EE6A 3JURA 2Z8GA 5C1EA 4YELA 2XTXA 3WWGA 2ODLA 3GQ9A 4OJ6A 2PECA 1BN8A 4XN3A 2O6WA 1O8EA 1DABA 4XLAA 1QCXA 1KCCA 1H80A 4OJPA 3NB2A 2INUA 4NK8A 1O8MA 4XM3A 3DU1X 3NAWA 2G0YA 3GRHA 3SUCA 5C1CA 1PE9A 4W8TA 2NTQA 3SQVA 1QA2A 4YEIA 3GQ7A 3PSZA 5JMCB 4NK6A 2V5IA 4XORA 1WXRA 1IDKA 3BH7B 1EA0A 4W8SA 1OFDA 2O1DA 3JX8A 4XL9A 4XLFA 1JTAA 1K8FA 1WMRA 4Z05A 1O8HA 4YZXA 3SY2A 1PLUA 1XG2A 4Z03A 2NZMA 5AMVA 1O88A 4MXNA 1CZFA 3H09A 1O8IA 2X6WA 5DNSA 2BM7A 4W8RA 4JRAC 2QX3A 1RU4A 3B4NA 2UVFA 1KQ5A 4YCQA 1O8DA 4YZAA 3LYCA 1LLZA 1VBLA 1TYUA
chains in the Genus database with same CATH topology
5JMCB 2VFOA 2V5IA 4OJOA 1WXRA 2J8IA 1HF2A 1TYVA 4OPWA 1QA3A 4OJLA 2B0RA 2BX6A 2YUHA 3SYJA 2BM6A 1K4ZA 2VFQA 2F3LA 1QRCA 2IOUG 2BM5A 3BH7B 3P4GA 4OM9A 2VFNA 4V02C 2BM4A 3SZEA 3JX8A 1QQ1A 2XC1A 1K8FA 4KH3A 4OJ6A 1TYWA 3RIQA 1TSPA 1QRBA 1DABA 3ML3A 3AK5A 4OJ5A 3H09A 2VFMA 2BM7A 4OJPA 3LJYA 3N6ZA 4JRAC 3TH0A 1QA1A 2W7ZA 3N90A 2G0YA 3BH6B 2VFPA 1TYXA 1KQ5A 3PETA 1QA2A 1CLWA 3LYCA 5JLVC 1TYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3L A;  2W7Z A;  2BM5 A;  5JMC B;  5JLV C;  3N90 A;  2BM4 A;  2G0Y A;  2J8I A;  2BM7 A;  4JRA C;  2BM6 A; 
#chains in the Genus database with same CATH topology
 1K5C A;  2NT9 A;  2QXZ A;  2VFO A;  1HF2 A;  4OPW A;  2XT2 A;  3EQO A;  4XON A;  2B0R A;  2YUH A;  1KTW A;  2BM6 A;  2XT4 A;  3P4G A;  1RMG A;  1QRC A;  1EZG A;  2BM5 A;  2IOU G;  3PSS A;  4U4B A;  4V02 C;  3VST A;  1L1I A;  3LMW A;  4I84 A;  1QQ1 A;  2VBE A;  4YEJ A;  2QYU A;  1TYW A;  3VSU A;  1IA5 A;  1O8K A;  1QRB A;  2QZA A;  3ML3 A;  3ZSC A;  4XLC A;  4OJ5 A;  4XQF A;  4XLH A;  2VBK A;  2UVE A;  1O8L A;  2VFM A;  1OFL A;  2NTP A;  1OGM X;  3N6Z A;  1IB4 A;  1PXZ A;  1JRG A;  2W7Z A;  3VMV A;  3N90 A;  3BH6 B;  1O8F A;  1TYX A;  1OOC A;  2INV A;  2NTB A;  3ZPP A;  3PET A;  4Z06 A;  1HG8 A;  1RWR A;  2X6X A;  4XKV A;  4EW9 A;  2X3H A;  5JLV C;  4OJO A;  1OFM A;  1X0C A;  1DBG A;  2J8I A;  4YZQ A;  1TYV A;  4OJL A;  2NSP A;  3SYJ A;  3AK5 A;  2VJJ A;  4XLE A;  2X6Y A;  4XR6 A;  4OM9 A;  3KRG A;  2PYH A;  3SZE A;  4OZZ A;  2BM4 A;  2VBM A;  2XTY A;  4AVZ A;  2BSP A;  4W8Q A;  1OGO X;  4HWV A;  4YZ0 A;  2X85 A;  1DBO A;  2XC1 A;  4KH3 A;  4MR0 A;  4XN0 A;  3RIQ A;  1TSP A;  4U49 A;  4C2L A;  1BHE A;  2O0V A;  4XOT A;  3T9G A;  4XNF A;  1KCD A;  2J8K A;  2VJI A;  3LJY A;  4XOP A;  2O17 A;  3TH0 A;  4YFO A;  4YC5 A;  1QA1 A;  1IDJ A;  4YDT A;  2NST A;  2EWE A;  3B8Y A;  2VFP A;  4XKW A;  4URR A;  1O8G A;  2O04 A;  2IQ7 A;  1LM1 A;  1CLW A;  2XTW A;  2PYG A;  1AIR A;  3GQ8 A;  1LLW A;  1NHC A;  1GQ8 A;  2NT6 A;  3GQA A;  1QJV A;  1QA3 A;  3UW0 A;  2BX6 A;  1OFE A;  4OZY A;  3FY3 A;  3B90 A;  1K4Z A;  2VFQ A;  1O8J A;  2F3L A;  3EQN A;  2VFN A;  2O0W A;  3VMW A;  3VSV A;  2QY1 A;  4PMH A;  4XMY A;  1EE6 A;  3JUR A;  2Z8G A;  5C1E A;  4YEL A;  2XTX A;  3WWG A;  2ODL A;  3GQ9 A;  4OJ6 A;  2PEC A;  1BN8 A;  4XN3 A;  2O6W A;  1O8E A;  1DAB A;  4XLA A;  1QCX A;  1KCC A;  1H80 A;  4OJP A;  3NB2 A;  2INU A;  4NK8 A;  1O8M A;  4XM3 A;  3DU1 X;  3NAW A;  2G0Y A;  3GRH A;  3SUC A;  5C1C A;  1PE9 A;  4W8T A;  2NTQ A;  3SQV A;  1QA2 A;  4YEI A;  3GQ7 A;  3PSZ A;  5JMC B;  4NK6 A;  2V5I A;  4XOR A;  1WXR A;  1IDK A;  3BH7 B;  1EA0 A;  4W8S A;  1OFD A;  2O1D A;  3JX8 A;  4XL9 A;  4XLF A;  1JTA A;  1K8F A;  1WMR A;  4Z05 A;  1O8H A;  4YZX A;  3SY2 A;  1PLU A;  1XG2 A;  4Z03 A;  2NZM A;  5AMV A;  1O88 A;  4MXN A;  1CZF A;  3H09 A;  1O8I A;  2X6W A;  5DNS A;  2BM7 A;  4W8R A;  4JRA C;  2QX3 A;  1RU4 A;  3B4N A;  2UVF A;  1KQ5 A;  4YCQ A;  1O8D A;  4YZA A;  3LYC A;  1LLZ A;  1VBL A;  1TYU A; 
#chains in the Genus database with same CATH homology
 5JMC B;  2VFO A;  2V5I A;  4OJO A;  1WXR A;  2J8I A;  1HF2 A;  1TYV A;  4OPW A;  1QA3 A;  4OJL A;  2B0R A;  2BX6 A;  2YUH A;  3SYJ A;  2BM6 A;  1K4Z A;  2VFQ A;  2F3L A;  1QRC A;  2IOU G;  2BM5 A;  3BH7 B;  3P4G A;  4OM9 A;  2VFN A;  4V02 C;  2BM4 A;  3SZE A;  3JX8 A;  1QQ1 A;  2XC1 A;  1K8F A;  4KH3 A;  4OJ6 A;  1TYW A;  3RIQ A;  1TSP A;  1QRB A;  1DAB A;  3ML3 A;  3AK5 A;  4OJ5 A;  3H09 A;  2VFM A;  2BM7 A;  4OJP A;  3LJY A;  3N6Z A;  4JRA C;  3TH0 A;  1QA1 A;  2W7Z A;  3N90 A;  2G0Y A;  3BH6 B;  2VFP A;  1TYX A;  1KQ5 A;  3PET A;  1QA2 A;  1CLW A;  3LYC A;  5JLV C;  1TYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...