1RMGA

Rhamnogalacturonase a from aspergillus aculeatus
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
422
structure length
422
Chain Sequence
b'QLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGEVYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDGYWSSMTAVAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLATAFGLTASIPIPTIPTSFYPGLTPYSALAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHAMNOGALACTURONASE A
publication title The crystal structure of rhamnogalacturonase A from Aspergillus aculeatus: a right-handed parallel beta helix.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
total genus 164
structure length 422
sequence length 422
ec nomenclature ec 3.2.1.171: Rhamnogalacturonan hydrolase.
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rmgA00
4XNFA 1O8HA 3GQ7A 4OJLA 2X85A 1O8IA 1K5CA 2PYGA 1BHEA 4EW9A 3GQAA 1IDKA 4OJ5A 1OOCA 2UVFA 3ZPPA 2PYHA 5AMVA 2INUA 2NT9A 4OZYA 1O8MA 2PECA 1EE6A 4XLHA 1O8LA 1CZFA 4Z05A 4XMYA 2X6YA 1O8JA 1PXZA 3JURA 2UVEA 3T9GA 1KCCA 4MXNA 1DBOA 2BSPA 1OGMX 3VSTA 1AIRA 4XL9A 1X0CA 2QY1A 3B4NA 1BN8A 4U49A 1O8DA 3WWGA 4YEJA 3LMWA 2QXZA 4U4BA 5C1CA 3GQ8A 4XLFA 3SUCA 1OFLA 4XLAA 2NTPA 2VJJA 4XN3A 2O17A 4XOPA 3ZSCA 4I84A 3VMWA 4XONA 4Z03A 1KCDA 3GRHA 2O0WA 1H80A 4YZAA 2VBEA 1QCXA 4XLEA 4YZXA 1O8KA 1PE9A 1O8GA 3VSUA 1JTAA 1XG2A 2VBKA 1IB4A 2IQ7A 1PLUA 4YELA 1IA5A 4XOTA 4OJOA 4XKVA 1RMGA 4XKWA 3B90A 4W8RA 2Z8GA 4OJ6A 2NSTA 1OGOX 1O88A 2VBMA 2O1DA 4XN0A 3UW0A 1NHCA 1GQ8A 4C2LA 3EQNA 4W8TA 2ODLA 1HG8A 4YZ0A 1RU4A 1IDJA 1QJVA 2NZMA 4NK8A 2NT6A 2EWEA 2NSPA 3VMVA 4NK6A 4XR6A 2NTQA 4AVZA 4URRA 4HWVA 1WMRA 2INVA 4PMHA 3B8YA 1VBLA 1RWRA 4MR0A 3EQOA 2X6WA 1O8EA 3FY3A 4W8SA 4YZQA 5C1EA 3VSVA 1O8FA 1JRGA 2X3HA 4XQFA 4W8QA 4OZZA 2NTBA 4XORA 3KRGA 1OFMA 1KTWA 2O04A 2QX3A 4OJPA 4XLCA 2X6XA 1DBGA 4Z06A 2VJIA 2O0VA 4XM3A 3GQ9A
chains in the Genus database with same CATH superfamily
4XNFA 2VFNA 1K8FA 1O8HA 3GQ7A 4OM9A 4OJLA 2X85A 1O8IA 1K5CA 2PYGA 1BHEA 4EW9A 3GQAA 1IDKA 2J8KA 2QZAA 4OJ5A 1OOCA 2UVFA 2BX6A 3ML3A 1QRCA 4YFOA 3ZPPA 2XTXA 2VFMA 2PYHA 5AMVA 2XC1A 2INUA 2NT9A 4OZYA 1O8MA 2PECA 5DNSA 1EE6A 4XLHA 2VFQA 1O8LA 3N6ZA 4YCQA 1CZFA 3BH6B 4Z05A 4XMYA 1QA1A 2X6YA 2YUHA 1O8JA 3LYCA 2O6WA 1PXZA 3JURA 2UVEA 3T9GA 1KCCA 4MXNA 1OFDA 2BM5A 1DBOA 2BSPA 1EA0A 1OGMX 3NB2A 3VSTA 1AIRA 4XL9A 1X0CA 2QY1A 3B4NA 3PSSA 1BN8A 4U49A 2F3LA 1O8DA 3WWGA 2BM7A 1OFEA 4YEJA 3LMWA 2QXZA 4U4BA 3TH0A 5C1CA 1WXRA 3NAWA 3AK5A 2XTYA 3GQ8A 4XLFA 3SUCA 2XTWA 1QA2A 1OFLA 4XLAA 2NTPA 1TYXA 2VJJA 1LLWA 2O17A 3DU1X 4XN3A 4XOPA 3ZSCA 4I84A 3VMWA 1LLZA 4XONA 4Z03A 1KCDA 4KH3A 1HF2A 3GRHA 2O0WA 1H80A 3PETA 3JX8A 1TYWA 1QCXA 2VBEA 4XLEA 4YZAA 4YZXA 1CLWA 1O8KA 1PE9A 1O8GA 2IOUG 1JTAA 3VSUA 4YEIA 1XG2A 2VBKA 2G0YA 2VFOA 2XT2A 4V02C 2BM6A 3SY2A 3PSZA 2IQ7A 1IB4A 1PLUA 1L1IA 4YELA 1QQ1A 2B0RA 4XOTA 1IA5A 4OJOA 4XKVA 1RMGA 4XKWA 3B90A 3P4GA 4W8RA 2Z8GA 4OJ6A 2NSTA 1OGOX 1O88A 2BM4A 2O1DA 2VBMA 4XN0A 3UW0A 1GQ8A 1NHCA 1DABA 4C2LA 3EQNA 4W8TA 2ODLA 1HG8A 4YZ0A 1RU4A 1LM1A 5JLVC 1IDJA 3SYJA 1QJVA 4YDTA 3SQVA 2NZMA 2W7ZA 1TSPA 2QYUA 2NT6A 2XT4A 4NK8A 2EWEA 4YC5A 2NSPA 3VMVA 5JMCB 3N90A 4NK6A 4XR6A 2NTQA 2V5IA 4AVZA 1KQ5A 4URRA 4OPWA 4HWVA 1WMRA 2INVA 4PMHA 3B8YA 1VBLA 3LJYA 1TYUA 1RWRA 1EZGA 4MR0A 3EQOA 2X6WA 3SZEA 1O8EA 2VFPA 3BH7B 3FY3A 4W8SA 4YZQA 5C1EA 3VSVA 1O8FA 1JRGA 2X3HA 3RIQA 4XQFA 4W8QA 4OZZA 2NTBA 4XORA 1TYVA 1OFMA 3KRGA 1KTWA 2J8IA 2O04A 2QX3A 4OJPA 4XLCA 1K4ZA 2X6XA 1DBGA 4JRAC 3H09A 4Z06A 1QRBA 2VJIA 1QA3A 2O0VA 4XM3A 3GQ9A
chains in the Genus database with same CATH topology
4XNFA 1O8HA 3GQ7A 4OJLA 2X85A 1O8IA 1K5CA 2PYGA 1BHEA 4EW9A 3GQAA 1IDKA 4OJ5A 1OOCA 2UVFA 3ZPPA 2PYHA 5AMVA 2INUA 2NT9A 4OZYA 1O8MA 2PECA 1EE6A 4XLHA 1O8LA 1CZFA 4Z05A 4XMYA 2X6YA 1O8JA 1PXZA 3JURA 2UVEA 3T9GA 1KCCA 4MXNA 1DBOA 2BSPA 1OGMX 3VSTA 1AIRA 4XL9A 1X0CA 2QY1A 3B4NA 1BN8A 4U49A 1O8DA 3WWGA 4YEJA 3LMWA 2QXZA 4U4BA 5C1CA 3GQ8A 4XLFA 3SUCA 1OFLA 4XLAA 2NTPA 2VJJA 4XN3A 2O17A 4XOPA 3ZSCA 4I84A 3VMWA 4XONA 4Z03A 1KCDA 3GRHA 2O0WA 1H80A 4YZAA 2VBEA 1QCXA 4XLEA 4YZXA 1O8KA 1PE9A 1O8GA 3VSUA 1JTAA 1XG2A 2VBKA 1IB4A 2IQ7A 1PLUA 4YELA 1IA5A 4XOTA 4OJOA 4XKVA 1RMGA 4XKWA 3B90A 4W8RA 2Z8GA 4OJ6A 2NSTA 1OGOX 1O88A 2VBMA 2O1DA 4XN0A 3UW0A 1NHCA 1GQ8A 4C2LA 3EQNA 4W8TA 2ODLA 1HG8A 4YZ0A 1RU4A 1IDJA 1QJVA 2NZMA 4NK8A 2NT6A 2EWEA 2NSPA 3VMVA 4NK6A 4XR6A 2NTQA 4AVZA 4URRA 4HWVA 1WMRA 2INVA 4PMHA 3B8YA 1VBLA 1RWRA 4MR0A 3EQOA 2X6WA 1O8EA 3FY3A 4W8SA 4YZQA 5C1EA 3VSVA 1O8FA 1JRGA 2X3HA 4XQFA 4W8QA 4OZZA 2NTBA 4XORA 3KRGA 1OFMA 1KTWA 2O04A 2QX3A 4OJPA 4XLCA 2X6XA 1DBGA 4Z06A 2VJIA 2O0VA 4XM3A 3GQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  1O8H A;  3GQ7 A;  4OJL A;  2X85 A;  1O8I A;  1K5C A;  2PYG A;  1BHE A;  4EW9 A;  3GQA A;  1IDK A;  4OJ5 A;  1OOC A;  2UVF A;  3ZPP A;  2PYH A;  5AMV A;  2INU A;  2NT9 A;  4OZY A;  1O8M A;  2PEC A;  1EE6 A;  4XLH A;  1O8L A;  1CZF A;  4Z05 A;  4XMY A;  2X6Y A;  1O8J A;  1PXZ A;  3JUR A;  2UVE A;  3T9G A;  1KCC A;  4MXN A;  1DBO A;  2BSP A;  1OGM X;  3VST A;  1AIR A;  4XL9 A;  1X0C A;  2QY1 A;  3B4N A;  1BN8 A;  4U49 A;  1O8D A;  3WWG A;  4YEJ A;  3LMW A;  2QXZ A;  4U4B A;  5C1C A;  3GQ8 A;  4XLF A;  3SUC A;  1OFL A;  4XLA A;  2NTP A;  2VJJ A;  4XN3 A;  2O17 A;  4XOP A;  3ZSC A;  4I84 A;  3VMW A;  4XON A;  4Z03 A;  1KCD A;  3GRH A;  2O0W A;  1H80 A;  4YZA A;  2VBE A;  1QCX A;  4XLE A;  4YZX A;  1O8K A;  1PE9 A;  1O8G A;  3VSU A;  1JTA A;  1XG2 A;  2VBK A;  1IB4 A;  2IQ7 A;  1PLU A;  4YEL A;  1IA5 A;  4XOT A;  4OJO A;  4XKV A;  1RMG A;  4XKW A;  3B90 A;  4W8R A;  2Z8G A;  4OJ6 A;  2NST A;  1OGO X;  1O88 A;  2VBM A;  2O1D A;  4XN0 A;  3UW0 A;  1NHC A;  1GQ8 A;  4C2L A;  3EQN A;  4W8T A;  2ODL A;  1HG8 A;  4YZ0 A;  1RU4 A;  1IDJ A;  1QJV A;  2NZM A;  4NK8 A;  2NT6 A;  2EWE A;  2NSP A;  3VMV A;  4NK6 A;  4XR6 A;  2NTQ A;  4AVZ A;  4URR A;  4HWV A;  1WMR A;  2INV A;  4PMH A;  3B8Y A;  1VBL A;  1RWR A;  4MR0 A;  3EQO A;  2X6W A;  1O8E A;  3FY3 A;  4W8S A;  4YZQ A;  5C1E A;  3VSV A;  1O8F A;  1JRG A;  2X3H A;  4XQF A;  4W8Q A;  4OZZ A;  2NTB A;  4XOR A;  3KRG A;  1OFM A;  1KTW A;  2O04 A;  2QX3 A;  4OJP A;  4XLC A;  2X6X A;  1DBG A;  4Z06 A;  2VJI A;  2O0V A;  4XM3 A;  3GQ9 A; 
#chains in the Genus database with same CATH topology
 4XNF A;  2VFN A;  1K8F A;  1O8H A;  3GQ7 A;  4OM9 A;  4OJL A;  2X85 A;  1O8I A;  1K5C A;  2PYG A;  1BHE A;  4EW9 A;  3GQA A;  1IDK A;  2J8K A;  2QZA A;  4OJ5 A;  1OOC A;  2UVF A;  2BX6 A;  3ML3 A;  1QRC A;  4YFO A;  3ZPP A;  2XTX A;  2VFM A;  2PYH A;  5AMV A;  2XC1 A;  2INU A;  2NT9 A;  4OZY A;  1O8M A;  2PEC A;  5DNS A;  1EE6 A;  4XLH A;  2VFQ A;  1O8L A;  3N6Z A;  4YCQ A;  1CZF A;  3BH6 B;  4Z05 A;  4XMY A;  1QA1 A;  2X6Y A;  2YUH A;  1O8J A;  3LYC A;  2O6W A;  1PXZ A;  3JUR A;  2UVE A;  3T9G A;  1KCC A;  4MXN A;  1OFD A;  2BM5 A;  1DBO A;  2BSP A;  1EA0 A;  1OGM X;  3NB2 A;  3VST A;  1AIR A;  4XL9 A;  1X0C A;  2QY1 A;  3B4N A;  3PSS A;  1BN8 A;  4U49 A;  2F3L A;  1O8D A;  3WWG A;  2BM7 A;  1OFE A;  4YEJ A;  3LMW A;  2QXZ A;  4U4B A;  3TH0 A;  5C1C A;  1WXR A;  3NAW A;  3AK5 A;  2XTY A;  3GQ8 A;  4XLF A;  3SUC A;  2XTW A;  1QA2 A;  1OFL A;  4XLA A;  2NTP A;  1TYX A;  2VJJ A;  1LLW A;  2O17 A;  3DU1 X;  4XN3 A;  4XOP A;  3ZSC A;  4I84 A;  3VMW A;  1LLZ A;  4XON A;  4Z03 A;  1KCD A;  4KH3 A;  1HF2 A;  3GRH A;  2O0W A;  1H80 A;  3PET A;  3JX8 A;  1TYW A;  1QCX A;  2VBE A;  4XLE A;  4YZA A;  4YZX A;  1CLW A;  1O8K A;  1PE9 A;  1O8G A;  2IOU G;  1JTA A;  3VSU A;  4YEI A;  1XG2 A;  2VBK A;  2G0Y A;  2VFO A;  2XT2 A;  4V02 C;  2BM6 A;  3SY2 A;  3PSZ A;  2IQ7 A;  1IB4 A;  1PLU A;  1L1I A;  4YEL A;  1QQ1 A;  2B0R A;  4XOT A;  1IA5 A;  4OJO A;  4XKV A;  1RMG A;  4XKW A;  3B90 A;  3P4G A;  4W8R A;  2Z8G A;  4OJ6 A;  2NST A;  1OGO X;  1O88 A;  2BM4 A;  2O1D A;  2VBM A;  4XN0 A;  3UW0 A;  1GQ8 A;  1NHC A;  1DAB A;  4C2L A;  3EQN A;  4W8T A;  2ODL A;  1HG8 A;  4YZ0 A;  1RU4 A;  1LM1 A;  5JLV C;  1IDJ A;  3SYJ A;  1QJV A;  4YDT A;  3SQV A;  2NZM A;  2W7Z A;  1TSP A;  2QYU A;  2NT6 A;  2XT4 A;  4NK8 A;  2EWE A;  4YC5 A;  2NSP A;  3VMV A;  5JMC B;  3N90 A;  4NK6 A;  4XR6 A;  2NTQ A;  2V5I A;  4AVZ A;  1KQ5 A;  4URR A;  4OPW A;  4HWV A;  1WMR A;  2INV A;  4PMH A;  3B8Y A;  1VBL A;  3LJY A;  1TYU A;  1RWR A;  1EZG A;  4MR0 A;  3EQO A;  2X6W A;  3SZE A;  1O8E A;  2VFP A;  3BH7 B;  3FY3 A;  4W8S A;  4YZQ A;  5C1E A;  3VSV A;  1O8F A;  1JRG A;  2X3H A;  3RIQ A;  4XQF A;  4W8Q A;  4OZZ A;  2NTB A;  4XOR A;  1TYV A;  1OFM A;  3KRG A;  1KTW A;  2J8I A;  2O04 A;  2QX3 A;  4OJP A;  4XLC A;  1K4Z A;  2X6X A;  1DBG A;  4JRA C;  3H09 A;  4Z06 A;  1QRB A;  2VJI A;  1QA3 A;  2O0V A;  4XM3 A;  3GQ9 A; 
#chains in the Genus database with same CATH homology
 4XNF A;  1O8H A;  3GQ7 A;  4OJL A;  2X85 A;  1O8I A;  1K5C A;  2PYG A;  1BHE A;  4EW9 A;  3GQA A;  1IDK A;  4OJ5 A;  1OOC A;  2UVF A;  3ZPP A;  2PYH A;  5AMV A;  2INU A;  2NT9 A;  4OZY A;  1O8M A;  2PEC A;  1EE6 A;  4XLH A;  1O8L A;  1CZF A;  4Z05 A;  4XMY A;  2X6Y A;  1O8J A;  1PXZ A;  3JUR A;  2UVE A;  3T9G A;  1KCC A;  4MXN A;  1DBO A;  2BSP A;  1OGM X;  3VST A;  1AIR A;  4XL9 A;  1X0C A;  2QY1 A;  3B4N A;  1BN8 A;  4U49 A;  1O8D A;  3WWG A;  4YEJ A;  3LMW A;  2QXZ A;  4U4B A;  5C1C A;  3GQ8 A;  4XLF A;  3SUC A;  1OFL A;  4XLA A;  2NTP A;  2VJJ A;  4XN3 A;  2O17 A;  4XOP A;  3ZSC A;  4I84 A;  3VMW A;  4XON A;  4Z03 A;  1KCD A;  3GRH A;  2O0W A;  1H80 A;  4YZA A;  2VBE A;  1QCX A;  4XLE A;  4YZX A;  1O8K A;  1PE9 A;  1O8G A;  3VSU A;  1JTA A;  1XG2 A;  2VBK A;  1IB4 A;  2IQ7 A;  1PLU A;  4YEL A;  1IA5 A;  4XOT A;  4OJO A;  4XKV A;  1RMG A;  4XKW A;  3B90 A;  4W8R A;  2Z8G A;  4OJ6 A;  2NST A;  1OGO X;  1O88 A;  2VBM A;  2O1D A;  4XN0 A;  3UW0 A;  1NHC A;  1GQ8 A;  4C2L A;  3EQN A;  4W8T A;  2ODL A;  1HG8 A;  4YZ0 A;  1RU4 A;  1IDJ A;  1QJV A;  2NZM A;  4NK8 A;  2NT6 A;  2EWE A;  2NSP A;  3VMV A;  4NK6 A;  4XR6 A;  2NTQ A;  4AVZ A;  4URR A;  4HWV A;  1WMR A;  2INV A;  4PMH A;  3B8Y A;  1VBL A;  1RWR A;  4MR0 A;  3EQO A;  2X6W A;  1O8E A;  3FY3 A;  4W8S A;  4YZQ A;  5C1E A;  3VSV A;  1O8F A;  1JRG A;  2X3H A;  4XQF A;  4W8Q A;  4OZZ A;  2NTB A;  4XOR A;  3KRG A;  1OFM A;  1KTW A;  2O04 A;  2QX3 A;  4OJP A;  4XLC A;  2X6X A;  1DBG A;  4Z06 A;  2VJI A;  2O0V A;  4XM3 A;  3GQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...