1RMGA

Rhamnogalacturonase a from aspergillus aculeatus
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
422
structure length
422
Chain Sequence
QLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGEVYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDGYWSSMTAVAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLATAFGLTASIPIPTIPTSFYPGLTPYSALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHAMNOGALACTURONASE A
publication title The crystal structure of rhamnogalacturonase A from Aspergillus aculeatus: a right-handed parallel beta helix.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
total genus 164
structure length 422
sequence length 422
ec nomenclature ec 3.2.1.171: Rhamnogalacturonan hydrolase.
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rmgA00
2VBKA 4XLEA 4XKVA 1X0CA 3JURA 4OJOA 4XN3A 4XL9A 4XMYA 1RMGA 3GRHA 2O17A 1BHEA 2NTBA 4W8SA 4XR6A 1GQ8A 3KRGA 1EE6A 1O8MA 1H80A 2X6WA 4Z05A 4U4BA 2NT6A 4XM3A 3FY3A 4PMHA 2PYGA 3ZSCA 4W8TA 2QX3A 4XOPA 2PYHA 2Z8GA 1RU4A 5AMVA 1PE9A 2PECA 4XLAA 1O8JA 3B4NA 3B8YA 4XKWA 3VMWA 4MR0A 4OJ6A 3EQNA 2NZMA 4HWVA 3T9GA 4XONA 4Z03A 4W8RA 4OZZA 4W8QA 1O8IA 1O8EA 1QJVA 4OJPA 4YZ0A 4XORA 1WMRA 3LMWA 4XN0A 4XLCA 1RWRA 2O1DA 3UW0A 3GQAA 1OOCA 1O8GA 2VJJA 5C1CA 4XLHA 3VMVA 2QY1A 4YZAA 1JTAA 2INVA 4NK8A 5C1EA 4XOTA 4XLFA 2NSPA 2VJIA 4Z06A 2INUA 4C2LA 1HG8A 1O8DA 3VSVA 2NSTA 3GQ9A 4XNFA 1O8HA 1OGMX 2O0WA 2QXZA 1JRGA 4EW9A 2O04A 2X85A 1KCDA 3SUCA 3GQ7A 3EQOA 4OJLA 4URRA 4YELA 4MXNA 3VSTA 3VSUA 1IDJA 1XG2A 1PXZA 2UVFA 2BSPA 1AIRA 2IQ7A 4OJ5A 1BN8A 2EWEA 4U49A 2UVEA 1O88A 1NHCA 2NTQA 2VBEA 2O0VA 1OGOX 1IA5A 2VBMA 4OZYA 3B90A 1O8LA 3ZPPA 1K5CA 4AVZA 1QCXA 1O8KA 4YEJA 1KTWA 2NTPA 2X6YA 4XQFA 2X6XA 1IDKA 1OFMA 1OFLA 4NK6A 4YZQA 3GQ8A 4YZXA 1PLUA 2NT9A 1IB4A 3WWGA 1VBLA 1DBOA 1KCCA 2ODLA 1DBGA 4I84A 2X3HA 1CZFA 1O8FA
chains in the Genus database with same CATH superfamily
2W7ZA 2VBKA 1K8FA 1HF2A 4XLEA 1QRBA 4YDTA 2VFMA 4XKVA 1X0CA 3JURA 4OJOA 4XN3A 2BX6A 4XL9A 4OM9A 4XMYA 1RMGA 3GRHA 2O17A 1BHEA 2NTBA 4W8SA 4XR6A 4XQFA 1GQ8A 4KH3A 1QA2A 3N6ZA 3KRGA 1EE6A 2VFPA 1O8MA 2YUHA 1H80A 2X6WA 4Z05A 4U4BA 2NT6A 5JLVC 1L1IA 4XM3A 3FY3A 4PMHA 2XT4A 2PYGA 2B0RA 2QZAA 3RIQA 3ZSCA 1CLWA 4W8TA 2XT2A 3NAWA 1LLWA 2QX3A 5DNSA 4XOPA 2PYHA 2QYUA 1RU4A 2Z8GA 2XTWA 5AMVA 4YC5A 1PE9A 2PECA 1QA3A 4XLAA 1K4ZA 1O8JA 3B4NA 3B8YA 4XKWA 3VMWA 4MR0A 4OJ6A 3EQNA 2NZMA 3N90A 4HWVA 3T9GA 1EA0A 2XTXA 3PETA 4XONA 4Z03A 4W8RA 4OZZA 3ML3A 3PSZA 4W8QA 1O8IA 2XTYA 4YEIA 1O8EA 1QJVA 2BM5A 4OJPA 4YZ0A 3TH0A 4XORA 1WMRA 3LMWA 4XN0A 4XLCA 4YFOA 1QQ1A 1RWRA 2O1DA 3LJYA 3GQAA 1OOCA 1O8GA 2VJJA 3UW0A 5C1CA 1OFEA 4XLHA 3VMVA 2QY1A 4YZAA 1JTAA 2INVA 4NK8A 5C1EA 4XOTA 4XLFA 2NSPA 3DU1X 2VJIA 4Z06A 2INUA 4C2LA 3JX8A 3AK5A 1HG8A 2VFQA 1O8DA 4JRAC 2F3LA 3H09A 1TYVA 3VSVA 2NSTA 2J8IA 4V02C 3GQ9A 4XNFA 1O8HA 1OGMX 2O0WA 2QXZA 1JRGA 4EW9A 2O04A 1LM1A 2X85A 1KCDA 3SUCA 3GQ7A 2BM6A 2J8KA 3PSSA 3EQOA 4OJLA 4URRA 4YELA 3SZEA 4MXNA 1QRCA 1OFDA 2VFNA 3VSTA 1TYXA 1TYUA 2BM7A 2VFOA 3VSUA 1IDJA 1XG2A 1PXZA 2UVFA 2BSPA 1KQ5A 1AIRA 2IQ7A 3P4GA 1TYWA 2BM4A 4OJ5A 1BN8A 2EWEA 1TSPA 4U49A 3SY2A 2UVEA 1O88A 1NHCA 2NTQA 2IOUG 2VBEA 2O0VA 1OGOX 1IA5A 2VBMA 4OZYA 5JMCB 3B90A 1WXRA 1O8LA 3ZPPA 1K5CA 4AVZA 3LYCA 1QCXA 1O8KA 4YEJA 1KTWA 2NTPA 2X6YA 4OPWA 2O6WA 1IDKA 1OFMA 1LLZA 2X6XA 1OFLA 2XC1A 3BH7B 4NK6A 3SQVA 1DABA 4YZQA 3GQ8A 4YZXA 1PLUA 4YCQA 2NT9A 1IB4A 1EZGA 3SYJA 3WWGA 1VBLA 1DBOA 3BH6B 2V5IA 1KCCA 2ODLA 1DBGA 2G0YA 3NB2A 4I84A 2X3HA 1QA1A 1CZFA 1O8FA
chains in the Genus database with same CATH topology
2VBKA 4XLEA 4XKVA 1X0CA 3JURA 4OJOA 4XN3A 4XL9A 4XMYA 1RMGA 3GRHA 2O17A 1BHEA 2NTBA 4W8SA 4XR6A 1GQ8A 3KRGA 1EE6A 1O8MA 1H80A 2X6WA 4Z05A 4U4BA 2NT6A 4XM3A 3FY3A 4PMHA 2PYGA 3ZSCA 4W8TA 2QX3A 4XOPA 2PYHA 2Z8GA 1RU4A 5AMVA 1PE9A 2PECA 4XLAA 1O8JA 3B4NA 3B8YA 4XKWA 3VMWA 4MR0A 4OJ6A 3EQNA 2NZMA 4HWVA 3T9GA 4XONA 4Z03A 4W8RA 4OZZA 4W8QA 1O8IA 1O8EA 1QJVA 4OJPA 4YZ0A 4XORA 1WMRA 3LMWA 4XN0A 4XLCA 1RWRA 2O1DA 3UW0A 3GQAA 1OOCA 1O8GA 2VJJA 5C1CA 4XLHA 3VMVA 2QY1A 4YZAA 1JTAA 2INVA 4NK8A 5C1EA 4XOTA 4XLFA 2NSPA 2VJIA 4Z06A 2INUA 4C2LA 1HG8A 1O8DA 3VSVA 2NSTA 3GQ9A 4XNFA 1O8HA 1OGMX 2O0WA 2QXZA 1JRGA 4EW9A 2O04A 2X85A 1KCDA 3SUCA 3GQ7A 3EQOA 4OJLA 4URRA 4YELA 4MXNA 3VSTA 3VSUA 1IDJA 1XG2A 1PXZA 2UVFA 2BSPA 1AIRA 2IQ7A 4OJ5A 1BN8A 2EWEA 4U49A 2UVEA 1O88A 1NHCA 2NTQA 2VBEA 2O0VA 1OGOX 1IA5A 2VBMA 4OZYA 3B90A 1O8LA 3ZPPA 1K5CA 4AVZA 1QCXA 1O8KA 4YEJA 1KTWA 2NTPA 2X6YA 4XQFA 2X6XA 1IDKA 1OFMA 1OFLA 4NK6A 4YZQA 3GQ8A 4YZXA 1PLUA 2NT9A 1IB4A 3WWGA 1VBLA 1DBOA 1KCCA 2ODLA 1DBGA 4I84A 2X3HA 1CZFA 1O8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBK A;  4XLE A;  4XKV A;  1X0C A;  3JUR A;  4OJO A;  4XN3 A;  4XL9 A;  4XMY A;  1RMG A;  3GRH A;  2O17 A;  1BHE A;  2NTB A;  4W8S A;  4XR6 A;  1GQ8 A;  3KRG A;  1EE6 A;  1O8M A;  1H80 A;  2X6W A;  4Z05 A;  4U4B A;  2NT6 A;  4XM3 A;  3FY3 A;  4PMH A;  2PYG A;  3ZSC A;  4W8T A;  2QX3 A;  4XOP A;  2PYH A;  2Z8G A;  1RU4 A;  5AMV A;  1PE9 A;  2PEC A;  4XLA A;  1O8J A;  3B4N A;  3B8Y A;  4XKW A;  3VMW A;  4MR0 A;  4OJ6 A;  3EQN A;  2NZM A;  4HWV A;  3T9G A;  4XON A;  4Z03 A;  4W8R A;  4OZZ A;  4W8Q A;  1O8I A;  1O8E A;  1QJV A;  4OJP A;  4YZ0 A;  4XOR A;  1WMR A;  3LMW A;  4XN0 A;  4XLC A;  1RWR A;  2O1D A;  3UW0 A;  3GQA A;  1OOC A;  1O8G A;  2VJJ A;  5C1C A;  4XLH A;  3VMV A;  2QY1 A;  4YZA A;  1JTA A;  2INV A;  4NK8 A;  5C1E A;  4XOT A;  4XLF A;  2NSP A;  2VJI A;  4Z06 A;  2INU A;  4C2L A;  1HG8 A;  1O8D A;  3VSV A;  2NST A;  3GQ9 A;  4XNF A;  1O8H A;  1OGM X;  2O0W A;  2QXZ A;  1JRG A;  4EW9 A;  2O04 A;  2X85 A;  1KCD A;  3SUC A;  3GQ7 A;  3EQO A;  4OJL A;  4URR A;  4YEL A;  4MXN A;  3VST A;  3VSU A;  1IDJ A;  1XG2 A;  1PXZ A;  2UVF A;  2BSP A;  1AIR A;  2IQ7 A;  4OJ5 A;  1BN8 A;  2EWE A;  4U49 A;  2UVE A;  1O88 A;  1NHC A;  2NTQ A;  2VBE A;  2O0V A;  1OGO X;  1IA5 A;  2VBM A;  4OZY A;  3B90 A;  1O8L A;  3ZPP A;  1K5C A;  4AVZ A;  1QCX A;  1O8K A;  4YEJ A;  1KTW A;  2NTP A;  2X6Y A;  4XQF A;  2X6X A;  1IDK A;  1OFM A;  1OFL A;  4NK6 A;  4YZQ A;  3GQ8 A;  4YZX A;  1PLU A;  2NT9 A;  1IB4 A;  3WWG A;  1VBL A;  1DBO A;  1KCC A;  2ODL A;  1DBG A;  4I84 A;  2X3H A;  1CZF A;  1O8F A; 
#chains in the Genus database with same CATH topology
 2W7Z A;  2VBK A;  1K8F A;  1HF2 A;  4XLE A;  1QRB A;  4YDT A;  2VFM A;  4XKV A;  1X0C A;  3JUR A;  4OJO A;  4XN3 A;  2BX6 A;  4XL9 A;  4OM9 A;  4XMY A;  1RMG A;  3GRH A;  2O17 A;  1BHE A;  2NTB A;  4W8S A;  4XR6 A;  4XQF A;  1GQ8 A;  4KH3 A;  1QA2 A;  3N6Z A;  3KRG A;  1EE6 A;  2VFP A;  1O8M A;  2YUH A;  1H80 A;  2X6W A;  4Z05 A;  4U4B A;  2NT6 A;  5JLV C;  1L1I A;  4XM3 A;  3FY3 A;  4PMH A;  2XT4 A;  2PYG A;  2B0R A;  2QZA A;  3RIQ A;  3ZSC A;  1CLW A;  4W8T A;  2XT2 A;  3NAW A;  1LLW A;  2QX3 A;  5DNS A;  4XOP A;  2PYH A;  2QYU A;  1RU4 A;  2Z8G A;  2XTW A;  5AMV A;  4YC5 A;  1PE9 A;  2PEC A;  1QA3 A;  4XLA A;  1K4Z A;  1O8J A;  3B4N A;  3B8Y A;  4XKW A;  3VMW A;  4MR0 A;  4OJ6 A;  3EQN A;  2NZM A;  3N90 A;  4HWV A;  3T9G A;  1EA0 A;  2XTX A;  3PET A;  4XON A;  4Z03 A;  4W8R A;  4OZZ A;  3ML3 A;  3PSZ A;  4W8Q A;  1O8I A;  2XTY A;  4YEI A;  1O8E A;  1QJV A;  2BM5 A;  4OJP A;  4YZ0 A;  3TH0 A;  4XOR A;  1WMR A;  3LMW A;  4XN0 A;  4XLC A;  4YFO A;  1QQ1 A;  1RWR A;  2O1D A;  3LJY A;  3GQA A;  1OOC A;  1O8G A;  2VJJ A;  3UW0 A;  5C1C A;  1OFE A;  4XLH A;  3VMV A;  2QY1 A;  4YZA A;  1JTA A;  2INV A;  4NK8 A;  5C1E A;  4XOT A;  4XLF A;  2NSP A;  3DU1 X;  2VJI A;  4Z06 A;  2INU A;  4C2L A;  3JX8 A;  3AK5 A;  1HG8 A;  2VFQ A;  1O8D A;  4JRA C;  2F3L A;  3H09 A;  1TYV A;  3VSV A;  2NST A;  2J8I A;  4V02 C;  3GQ9 A;  4XNF A;  1O8H A;  1OGM X;  2O0W A;  2QXZ A;  1JRG A;  4EW9 A;  2O04 A;  1LM1 A;  2X85 A;  1KCD A;  3SUC A;  3GQ7 A;  2BM6 A;  2J8K A;  3PSS A;  3EQO A;  4OJL A;  4URR A;  4YEL A;  3SZE A;  4MXN A;  1QRC A;  1OFD A;  2VFN A;  3VST A;  1TYX A;  1TYU A;  2BM7 A;  2VFO A;  3VSU A;  1IDJ A;  1XG2 A;  1PXZ A;  2UVF A;  2BSP A;  1KQ5 A;  1AIR A;  2IQ7 A;  3P4G A;  1TYW A;  2BM4 A;  4OJ5 A;  1BN8 A;  2EWE A;  1TSP A;  4U49 A;  3SY2 A;  2UVE A;  1O88 A;  1NHC A;  2NTQ A;  2IOU G;  2VBE A;  2O0V A;  1OGO X;  1IA5 A;  2VBM A;  4OZY A;  5JMC B;  3B90 A;  1WXR A;  1O8L A;  3ZPP A;  1K5C A;  4AVZ A;  3LYC A;  1QCX A;  1O8K A;  4YEJ A;  1KTW A;  2NTP A;  2X6Y A;  4OPW A;  2O6W A;  1IDK A;  1OFM A;  1LLZ A;  2X6X A;  1OFL A;  2XC1 A;  3BH7 B;  4NK6 A;  3SQV A;  1DAB A;  4YZQ A;  3GQ8 A;  4YZX A;  1PLU A;  4YCQ A;  2NT9 A;  1IB4 A;  1EZG A;  3SYJ A;  3WWG A;  1VBL A;  1DBO A;  3BH6 B;  2V5I A;  1KCC A;  2ODL A;  1DBG A;  2G0Y A;  3NB2 A;  4I84 A;  2X3H A;  1QA1 A;  1CZF A;  1O8F A; 
#chains in the Genus database with same CATH homology
 2VBK A;  4XLE A;  4XKV A;  1X0C A;  3JUR A;  4OJO A;  4XN3 A;  4XL9 A;  4XMY A;  1RMG A;  3GRH A;  2O17 A;  1BHE A;  2NTB A;  4W8S A;  4XR6 A;  1GQ8 A;  3KRG A;  1EE6 A;  1O8M A;  1H80 A;  2X6W A;  4Z05 A;  4U4B A;  2NT6 A;  4XM3 A;  3FY3 A;  4PMH A;  2PYG A;  3ZSC A;  4W8T A;  2QX3 A;  4XOP A;  2PYH A;  2Z8G A;  1RU4 A;  5AMV A;  1PE9 A;  2PEC A;  4XLA A;  1O8J A;  3B4N A;  3B8Y A;  4XKW A;  3VMW A;  4MR0 A;  4OJ6 A;  3EQN A;  2NZM A;  4HWV A;  3T9G A;  4XON A;  4Z03 A;  4W8R A;  4OZZ A;  4W8Q A;  1O8I A;  1O8E A;  1QJV A;  4OJP A;  4YZ0 A;  4XOR A;  1WMR A;  3LMW A;  4XN0 A;  4XLC A;  1RWR A;  2O1D A;  3UW0 A;  3GQA A;  1OOC A;  1O8G A;  2VJJ A;  5C1C A;  4XLH A;  3VMV A;  2QY1 A;  4YZA A;  1JTA A;  2INV A;  4NK8 A;  5C1E A;  4XOT A;  4XLF A;  2NSP A;  2VJI A;  4Z06 A;  2INU A;  4C2L A;  1HG8 A;  1O8D A;  3VSV A;  2NST A;  3GQ9 A;  4XNF A;  1O8H A;  1OGM X;  2O0W A;  2QXZ A;  1JRG A;  4EW9 A;  2O04 A;  2X85 A;  1KCD A;  3SUC A;  3GQ7 A;  3EQO A;  4OJL A;  4URR A;  4YEL A;  4MXN A;  3VST A;  3VSU A;  1IDJ A;  1XG2 A;  1PXZ A;  2UVF A;  2BSP A;  1AIR A;  2IQ7 A;  4OJ5 A;  1BN8 A;  2EWE A;  4U49 A;  2UVE A;  1O88 A;  1NHC A;  2NTQ A;  2VBE A;  2O0V A;  1OGO X;  1IA5 A;  2VBM A;  4OZY A;  3B90 A;  1O8L A;  3ZPP A;  1K5C A;  4AVZ A;  1QCX A;  1O8K A;  4YEJ A;  1KTW A;  2NTP A;  2X6Y A;  4XQF A;  2X6X A;  1IDK A;  1OFM A;  1OFL A;  4NK6 A;  4YZQ A;  3GQ8 A;  4YZX A;  1PLU A;  2NT9 A;  1IB4 A;  3WWG A;  1VBL A;  1DBO A;  1KCC A;  2ODL A;  1DBG A;  4I84 A;  2X3H A;  1CZF A;  1O8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...