1RMGA

Rhamnogalacturonase a from aspergillus aculeatus
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
422
structure length
422
Chain Sequence
QLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGEVYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDGYWSSMTAVAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLATAFGLTASIPIPTIPTSFYPGLTPYSALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of rhamnogalacturonase A from Aspergillus aculeatus: a right-handed parallel beta helix.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
molecule keywords RHAMNOGALACTURONASE A
total genus 164
structure length 422
sequence length 422
ec nomenclature ec 3.2.1.171: Rhamnogalacturonan hydrolase.
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rmgA00
5C1EA 4OJLA 4OJ5A 2X3HA 3VSUA 2O17A 1XG2A 3ZSCA 1PE9A 2Z8GA 4U4BA 2NT9A 4YZXA 4MXNA 1QJVA 4XL9A 2NTPA 4MR0A 2IQ7A 2X6XA 1IA5A 1PXZA 2NSPA 2O0VA 1JTAA 1O8GA 4XQFA 1O8MA 4XLAA 4Z06A 1OOCA 1O88A 1O8HA 2VJIA 2INVA 4AVZA 1K5CA 1HG8A 2PYGA 2UVFA 3GRHA 4XN3A 4XR6A 5C1CA 2UVEA 3VMVA 3LMWA 4YZ0A 1GQ8A 4XORA 4W8TA 1RWRA 3SUCA 2VBMA 4HWVA 1OGMX 2O04A 3GQ7A 2NZMA 2INUA 2X6WA 1CZFA 1EE6A 2QY1A 4OZZA 3ZPPA 4XN0A 2PYHA 4XNFA 3UW0A 1RMGA 2O0WA 4W8QA 4XLFA 1WMRA 1BN8A 4XLHA 1AIRA 1O8LA 3T9GA 1H80A 1QCXA 4U49A 1KTWA 4YZAA 4XLEA 1KCCA 1VBLA 3KRGA 2X85A 4URRA 4Z05A 1DBGA 1KCDA 2VBKA 3B8YA 1X0CA 2VJJA 4XOPA 3VSVA 4YELA 1DBOA 3B90A 1O8KA 1BHEA 1PLUA 2NTQA 4OJPA 3B4NA 2VBEA 4XMYA 4OJOA 1OFLA 3EQOA 2PECA 4XKVA 1JRGA 1NHCA 3GQAA 1O8EA 4EW9A 2O1DA 3VMWA 5AMVA 4OJ6A 4C2LA 4PMHA 4Z03A 2QXZA 4YEJA 2EWEA 2NTBA 1OFMA 1O8DA 4XM3A 1O8JA 3VSTA 3GQ9A 3EQNA 4XONA 3JURA 2ODLA 4NK6A 4XLCA 2NT6A 3GQ8A 3WWGA 1OGOX 2QX3A 2NSTA 1IB4A 1IDKA 4XOTA 2X6YA 4W8RA 4YZQA 4I84A 4W8SA 1IDJA 1O8IA 4OZYA 4XKWA 3FY3A 1O8FA 1RU4A 2BSPA 4NK8A
chains in the Genus database with same CATH superfamily
5C1EA 3PSZA 4OJ5A 4OJLA 2X3HA 3N6ZA 3VSUA 2O17A 1XG2A 3ZSCA 1PE9A 2Z8GA 4U4BA 2NT9A 4YZXA 1CLWA 4MXNA 1QJVA 2VFPA 2XTWA 5DNSA 1LLZA 4XL9A 2NTPA 2QZAA 3LYCA 3H09A 4MR0A 2IQ7A 1LLWA 2X6XA 1PXZA 1IA5A 2NSPA 2O0VA 1JTAA 1TYVA 1O8GA 2BM7A 4XQFA 1O8MA 4XLAA 4Z06A 3BH7B 4OPWA 2BM5A 1OOCA 1O88A 1O8HA 2VJIA 3PETA 1KQ5A 2INVA 4AVZA 1K5CA 2O6WA 1HG8A 2PYGA 2UVFA 3GRHA 4XN3A 4XR6A 5C1CA 1DABA 3NB2A 1L1IA 1EZGA 2BM4A 2UVEA 3VMVA 4YC5A 3LMWA 4YZ0A 1GQ8A 3PSSA 4XORA 4W8TA 4YCQA 1RWRA 3SUCA 2VBMA 4HWVA 1OGMX 1HF2A 2O04A 2W7ZA 3GQ7A 2QYUA 1QA2A 2NZMA 2INUA 2X6WA 1CZFA 3NAWA 1EE6A 4OM9A 2QY1A 4OZZA 3ZPPA 3DU1X 4XN0A 2PYHA 3ML3A 3SQVA 4XNFA 3UW0A 2V5IA 1EA0A 4YDTA 1RMGA 2O0WA 4W8QA 4XLFA 1WMRA 4JRAC 1BN8A 4XLHA 1AIRA 1O8LA 1K8FA 4KH3A 3T9GA 1H80A 1QCXA 4U49A 2XC1A 1KTWA 3JX8A 4YZAA 4XLEA 4YFOA 1QQ1A 1KCCA 1VBLA 3KRGA 2X85A 4URRA 4Z05A 1QRBA 2YUHA 3TH0A 3SZEA 1DBGA 3LJYA 1KCDA 2VBKA 3B8YA 1X0CA 1OFDA 2VJJA 4XOPA 3VSVA 1TSPA 1K4ZA 4YELA 1DBOA 2VFMA 3B90A 1O8KA 1BHEA 1PLUA 2NTQA 4OJPA 2XT2A 3SYJA 3B4NA 1TYWA 2VBEA 1QRCA 4XMYA 2J8KA 1OFLA 2F3LA 2PECA 3EQOA 4OJOA 4XKVA 3SY2A 5JLVC 1JRGA 1NHCA 2VFNA 3GQAA 1OFEA 3P4GA 1O8EA 1LM1A 4EW9A 2O1DA 3VMWA 5AMVA 4OJ6A 4C2LA 3AK5A 2J8IA 4PMHA 4Z03A 2XTYA 2QXZA 4YEJA 2EWEA 2BM6A 2NTBA 1WXRA 1OFMA 1O8DA 4XM3A 2XT4A 1O8JA 2XTXA 3VSTA 3GQ9A 3EQNA 4XONA 3JURA 2ODLA 4NK6A 4XLCA 2NT6A 3GQ8A 3WWGA 1OGOX 2QX3A 2NSTA 1IB4A 1IDKA 1TYUA 4XOTA 2X6YA 2VFQA 4V02C 4W8RA 4YZQA 4YEIA 2IOUG 4I84A 4W8SA 1QA3A 3N90A 1IDJA 2B0RA 2G0YA 1O8IA 4OZYA 1QA1A 2VFOA 4XKWA 3BH6B 3RIQA 5JMCB 3FY3A 1O8FA 1RU4A 2BSPA 2BX6A 1TYXA 4NK8A
chains in the Genus database with same CATH topology
5C1EA 4OJLA 4OJ5A 2X3HA 3VSUA 2O17A 1XG2A 3ZSCA 1PE9A 2Z8GA 4U4BA 2NT9A 4YZXA 4MXNA 1QJVA 4XL9A 2NTPA 4MR0A 2IQ7A 2X6XA 1IA5A 1PXZA 2NSPA 2O0VA 1JTAA 1O8GA 4XQFA 1O8MA 4XLAA 4Z06A 1OOCA 1O88A 1O8HA 2VJIA 2INVA 4AVZA 1K5CA 1HG8A 2PYGA 2UVFA 3GRHA 4XN3A 4XR6A 5C1CA 2UVEA 3VMVA 3LMWA 4YZ0A 1GQ8A 4XORA 4W8TA 1RWRA 3SUCA 2VBMA 4HWVA 1OGMX 2O04A 3GQ7A 2NZMA 2INUA 2X6WA 1CZFA 1EE6A 2QY1A 4OZZA 3ZPPA 4XN0A 2PYHA 4XNFA 3UW0A 1RMGA 2O0WA 4W8QA 4XLFA 1WMRA 1BN8A 4XLHA 1AIRA 1O8LA 3T9GA 1H80A 1QCXA 4U49A 1KTWA 4YZAA 4XLEA 1KCCA 1VBLA 3KRGA 2X85A 4URRA 4Z05A 1DBGA 1KCDA 2VBKA 3B8YA 1X0CA 2VJJA 4XOPA 3VSVA 4YELA 1DBOA 3B90A 1O8KA 1BHEA 1PLUA 2NTQA 4OJPA 3B4NA 2VBEA 4XMYA 4OJOA 1OFLA 3EQOA 2PECA 4XKVA 1JRGA 1NHCA 3GQAA 1O8EA 4EW9A 2O1DA 3VMWA 5AMVA 4OJ6A 4C2LA 4PMHA 4Z03A 2QXZA 4YEJA 2EWEA 2NTBA 1OFMA 1O8DA 4XM3A 1O8JA 3VSTA 3GQ9A 3EQNA 4XONA 3JURA 2ODLA 4NK6A 4XLCA 2NT6A 3GQ8A 3WWGA 1OGOX 2QX3A 2NSTA 1IB4A 1IDKA 4XOTA 2X6YA 4W8RA 4YZQA 4I84A 4W8SA 1IDJA 1O8IA 4OZYA 4XKWA 3FY3A 1O8FA 1RU4A 2BSPA 4NK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1E A;  4OJL A;  4OJ5 A;  2X3H A;  3VSU A;  2O17 A;  1XG2 A;  3ZSC A;  1PE9 A;  2Z8G A;  4U4B A;  2NT9 A;  4YZX A;  4MXN A;  1QJV A;  4XL9 A;  2NTP A;  4MR0 A;  2IQ7 A;  2X6X A;  1IA5 A;  1PXZ A;  2NSP A;  2O0V A;  1JTA A;  1O8G A;  4XQF A;  1O8M A;  4XLA A;  4Z06 A;  1OOC A;  1O88 A;  1O8H A;  2VJI A;  2INV A;  4AVZ A;  1K5C A;  1HG8 A;  2PYG A;  2UVF A;  3GRH A;  4XN3 A;  4XR6 A;  5C1C A;  2UVE A;  3VMV A;  3LMW A;  4YZ0 A;  1GQ8 A;  4XOR A;  4W8T A;  1RWR A;  3SUC A;  2VBM A;  4HWV A;  1OGM X;  2O04 A;  3GQ7 A;  2NZM A;  2INU A;  2X6W A;  1CZF A;  1EE6 A;  2QY1 A;  4OZZ A;  3ZPP A;  4XN0 A;  2PYH A;  4XNF A;  3UW0 A;  1RMG A;  2O0W A;  4W8Q A;  4XLF A;  1WMR A;  1BN8 A;  4XLH A;  1AIR A;  1O8L A;  3T9G A;  1H80 A;  1QCX A;  4U49 A;  1KTW A;  4YZA A;  4XLE A;  1KCC A;  1VBL A;  3KRG A;  2X85 A;  4URR A;  4Z05 A;  1DBG A;  1KCD A;  2VBK A;  3B8Y A;  1X0C A;  2VJJ A;  4XOP A;  3VSV A;  4YEL A;  1DBO A;  3B90 A;  1O8K A;  1BHE A;  1PLU A;  2NTQ A;  4OJP A;  3B4N A;  2VBE A;  4XMY A;  4OJO A;  1OFL A;  3EQO A;  2PEC A;  4XKV A;  1JRG A;  1NHC A;  3GQA A;  1O8E A;  4EW9 A;  2O1D A;  3VMW A;  5AMV A;  4OJ6 A;  4C2L A;  4PMH A;  4Z03 A;  2QXZ A;  4YEJ A;  2EWE A;  2NTB A;  1OFM A;  1O8D A;  4XM3 A;  1O8J A;  3VST A;  3GQ9 A;  3EQN A;  4XON A;  3JUR A;  2ODL A;  4NK6 A;  4XLC A;  2NT6 A;  3GQ8 A;  3WWG A;  1OGO X;  2QX3 A;  2NST A;  1IB4 A;  1IDK A;  4XOT A;  2X6Y A;  4W8R A;  4YZQ A;  4I84 A;  4W8S A;  1IDJ A;  1O8I A;  4OZY A;  4XKW A;  3FY3 A;  1O8F A;  1RU4 A;  2BSP A;  4NK8 A; 
#chains in the Genus database with same CATH topology
 5C1E A;  3PSZ A;  4OJ5 A;  4OJL A;  2X3H A;  3N6Z A;  3VSU A;  2O17 A;  1XG2 A;  3ZSC A;  1PE9 A;  2Z8G A;  4U4B A;  2NT9 A;  4YZX A;  1CLW A;  4MXN A;  1QJV A;  2VFP A;  2XTW A;  5DNS A;  1LLZ A;  4XL9 A;  2NTP A;  2QZA A;  3LYC A;  3H09 A;  4MR0 A;  2IQ7 A;  1LLW A;  2X6X A;  1PXZ A;  1IA5 A;  2NSP A;  2O0V A;  1JTA A;  1TYV A;  1O8G A;  2BM7 A;  4XQF A;  1O8M A;  4XLA A;  4Z06 A;  3BH7 B;  4OPW A;  2BM5 A;  1OOC A;  1O88 A;  1O8H A;  2VJI A;  3PET A;  1KQ5 A;  2INV A;  4AVZ A;  1K5C A;  2O6W A;  1HG8 A;  2PYG A;  2UVF A;  3GRH A;  4XN3 A;  4XR6 A;  5C1C A;  1DAB A;  3NB2 A;  1L1I A;  1EZG A;  2BM4 A;  2UVE A;  3VMV A;  4YC5 A;  3LMW A;  4YZ0 A;  1GQ8 A;  3PSS A;  4XOR A;  4W8T A;  4YCQ A;  1RWR A;  3SUC A;  2VBM A;  4HWV A;  1OGM X;  1HF2 A;  2O04 A;  2W7Z A;  3GQ7 A;  2QYU A;  1QA2 A;  2NZM A;  2INU A;  2X6W A;  1CZF A;  3NAW A;  1EE6 A;  4OM9 A;  2QY1 A;  4OZZ A;  3ZPP A;  3DU1 X;  4XN0 A;  2PYH A;  3ML3 A;  3SQV A;  4XNF A;  3UW0 A;  2V5I A;  1EA0 A;  4YDT A;  1RMG A;  2O0W A;  4W8Q A;  4XLF A;  1WMR A;  4JRA C;  1BN8 A;  4XLH A;  1AIR A;  1O8L A;  1K8F A;  4KH3 A;  3T9G A;  1H80 A;  1QCX A;  4U49 A;  2XC1 A;  1KTW A;  3JX8 A;  4YZA A;  4XLE A;  4YFO A;  1QQ1 A;  1KCC A;  1VBL A;  3KRG A;  2X85 A;  4URR A;  4Z05 A;  1QRB A;  2YUH A;  3TH0 A;  3SZE A;  1DBG A;  3LJY A;  1KCD A;  2VBK A;  3B8Y A;  1X0C A;  1OFD A;  2VJJ A;  4XOP A;  3VSV A;  1TSP A;  1K4Z A;  4YEL A;  1DBO A;  2VFM A;  3B90 A;  1O8K A;  1BHE A;  1PLU A;  2NTQ A;  4OJP A;  2XT2 A;  3SYJ A;  3B4N A;  1TYW A;  2VBE A;  1QRC A;  4XMY A;  2J8K A;  1OFL A;  2F3L A;  2PEC A;  3EQO A;  4OJO A;  4XKV A;  3SY2 A;  5JLV C;  1JRG A;  1NHC A;  2VFN A;  3GQA A;  1OFE A;  3P4G A;  1O8E A;  1LM1 A;  4EW9 A;  2O1D A;  3VMW A;  5AMV A;  4OJ6 A;  4C2L A;  3AK5 A;  2J8I A;  4PMH A;  4Z03 A;  2XTY A;  2QXZ A;  4YEJ A;  2EWE A;  2BM6 A;  2NTB A;  1WXR A;  1OFM A;  1O8D A;  4XM3 A;  2XT4 A;  1O8J A;  2XTX A;  3VST A;  3GQ9 A;  3EQN A;  4XON A;  3JUR A;  2ODL A;  4NK6 A;  4XLC A;  2NT6 A;  3GQ8 A;  3WWG A;  1OGO X;  2QX3 A;  2NST A;  1IB4 A;  1IDK A;  1TYU A;  4XOT A;  2X6Y A;  2VFQ A;  4V02 C;  4W8R A;  4YZQ A;  4YEI A;  2IOU G;  4I84 A;  4W8S A;  1QA3 A;  3N90 A;  1IDJ A;  2B0R A;  2G0Y A;  1O8I A;  4OZY A;  1QA1 A;  2VFO A;  4XKW A;  3BH6 B;  3RIQ A;  5JMC B;  3FY3 A;  1O8F A;  1RU4 A;  2BSP A;  2BX6 A;  1TYX A;  4NK8 A; 
#chains in the Genus database with same CATH homology
 5C1E A;  4OJL A;  4OJ5 A;  2X3H A;  3VSU A;  2O17 A;  1XG2 A;  3ZSC A;  1PE9 A;  2Z8G A;  4U4B A;  2NT9 A;  4YZX A;  4MXN A;  1QJV A;  4XL9 A;  2NTP A;  4MR0 A;  2IQ7 A;  2X6X A;  1IA5 A;  1PXZ A;  2NSP A;  2O0V A;  1JTA A;  1O8G A;  4XQF A;  1O8M A;  4XLA A;  4Z06 A;  1OOC A;  1O88 A;  1O8H A;  2VJI A;  2INV A;  4AVZ A;  1K5C A;  1HG8 A;  2PYG A;  2UVF A;  3GRH A;  4XN3 A;  4XR6 A;  5C1C A;  2UVE A;  3VMV A;  3LMW A;  4YZ0 A;  1GQ8 A;  4XOR A;  4W8T A;  1RWR A;  3SUC A;  2VBM A;  4HWV A;  1OGM X;  2O04 A;  3GQ7 A;  2NZM A;  2INU A;  2X6W A;  1CZF A;  1EE6 A;  2QY1 A;  4OZZ A;  3ZPP A;  4XN0 A;  2PYH A;  4XNF A;  3UW0 A;  1RMG A;  2O0W A;  4W8Q A;  4XLF A;  1WMR A;  1BN8 A;  4XLH A;  1AIR A;  1O8L A;  3T9G A;  1H80 A;  1QCX A;  4U49 A;  1KTW A;  4YZA A;  4XLE A;  1KCC A;  1VBL A;  3KRG A;  2X85 A;  4URR A;  4Z05 A;  1DBG A;  1KCD A;  2VBK A;  3B8Y A;  1X0C A;  2VJJ A;  4XOP A;  3VSV A;  4YEL A;  1DBO A;  3B90 A;  1O8K A;  1BHE A;  1PLU A;  2NTQ A;  4OJP A;  3B4N A;  2VBE A;  4XMY A;  4OJO A;  1OFL A;  3EQO A;  2PEC A;  4XKV A;  1JRG A;  1NHC A;  3GQA A;  1O8E A;  4EW9 A;  2O1D A;  3VMW A;  5AMV A;  4OJ6 A;  4C2L A;  4PMH A;  4Z03 A;  2QXZ A;  4YEJ A;  2EWE A;  2NTB A;  1OFM A;  1O8D A;  4XM3 A;  1O8J A;  3VST A;  3GQ9 A;  3EQN A;  4XON A;  3JUR A;  2ODL A;  4NK6 A;  4XLC A;  2NT6 A;  3GQ8 A;  3WWG A;  1OGO X;  2QX3 A;  2NST A;  1IB4 A;  1IDK A;  4XOT A;  2X6Y A;  4W8R A;  4YZQ A;  4I84 A;  4W8S A;  1IDJ A;  1O8I A;  4OZY A;  4XKW A;  3FY3 A;  1O8F A;  1RU4 A;  2BSP A;  4NK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...