1RMGA

Rhamnogalacturonase a from aspergillus aculeatus
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
422
structure length
422
Chain Sequence
QLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGEVYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDGYWSSMTAVAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLATAFGLTASIPIPTIPTSFYPGLTPYSALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RHAMNOGALACTURONASE A
publication title The crystal structure of rhamnogalacturonase A from Aspergillus aculeatus: a right-handed parallel beta helix.
pubmed doi rcsb
source organism Aspergillus aculeatus
total genus 164
structure length 422
sequence length 422
ec nomenclature ec 3.2.1.171: Rhamnogalacturonan hydrolase.
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rmgA00
3UW0A 1OGOX 1PXZA 3GQAA 3ZPPA 5C1EA 2PECA 2PYGA 4YZ0A 2O1DA 4OJLA 3EQNA 4XLFA 2VJJA 1O8IA 1OOCA 1DBOA 4YZXA 4PMHA 1PLUA 2X6XA 4OJ6A 2NT6A 4W8SA 1O8EA 1RU4A 4YZAA 2QX3A 1O8FA 3GQ9A 2QY1A 1JRGA 1WMRA 1HG8A 1OFLA 4XMYA 3ZSCA 3WWGA 1KCCA 2UVFA 2VJIA 4AVZA 3VSUA 1OFMA 1RMGA 2NTQA 2EWEA 2X6WA 4I84A 4W8QA 4U4BA 4XLAA 1VBLA 2VBKA 4OJPA 4XLEA 2O04A 2X6YA 1AIRA 2ODLA 4XLCA 1KCDA 3JURA 3GQ8A 3VSVA 2BSPA 4W8RA 1O8HA 4XKWA 4XOTA 4XLHA 2UVEA 4OZZA 1O8GA 2O17A 1O8JA 4OJOA 1JTAA 4XOPA 4XKVA 1O88A 4MXNA 2NTPA 3SUCA 4NK6A 1IB4A 4XR6A 1O8DA 4XORA 4YEJA 1K5CA 3EQOA 3VSTA 2O0VA 4W8TA 4Z06A 2NT9A 4XL9A 2NSTA 2NSPA 4HWVA 1O8KA 3FY3A 1RWRA 1IDKA 2IQ7A 4XQFA 3T9GA 2NZMA 1KTWA 4URRA 5AMVA 4C2LA 4YELA 2X3HA 4U49A 2PYHA 2VBEA 3B4NA 3B90A 1O8MA 1BN8A 2O0WA 1PE9A 1OGMX 2INUA 1H80A 5C1CA 1EE6A 1IA5A 3VMWA 1NHCA 3LMWA 2Z8GA 4XNFA 3GRHA 1O8LA 4Z03A 4OJ5A 4MR0A 2VBMA 1QCXA 3KRGA 1BHEA 3VMVA 2NTBA 4XM3A 4EW9A 4OZYA 2X85A 4NK8A 3GQ7A 1QJVA 4XN0A 4XONA 1IDJA 2QXZA 1X0CA 1DBGA 2INVA 4XN3A 1XG2A 3B8YA 1CZFA 1GQ8A 4YZQA 4Z05A
chains in the Genus database with same CATH superfamily
2VFNA 2XTXA 4YC5A 3UW0A 3LJYA 1OGOX 1PXZA 3GQAA 1HF2A 1QA2A 3ZPPA 5C1EA 2PECA 4OM9A 2PYGA 4V02C 3DU1X 3ML3A 2O1DA 4YZ0A 4OJLA 3EQNA 4XLFA 2VJJA 1O8IA 1OOCA 1DBOA 4YZXA 4PMHA 1PLUA 2X6XA 4OJ6A 2BX6A 2NT6A 4W8SA 4YEIA 2XT2A 1WXRA 1O8EA 1RU4A 1EA0A 1TSPA 2QX3A 4YZAA 1O8FA 3GQ9A 2QY1A 3LYCA 1JRGA 1TYWA 1WMRA 2O6WA 1HG8A 1OFLA 1OFEA 2W7ZA 4XMYA 3ZSCA 3WWGA 1KCCA 2UVFA 2VJIA 4AVZA 3VSUA 1KQ5A 1OFMA 3RIQA 1RMGA 2IOUG 2NTQA 3JX8A 2EWEA 2X6WA 4I84A 4W8QA 4U4BA 4XLAA 1VBLA 2VBKA 4OJPA 2BM5A 4XLEA 2O04A 3SYJA 3AK5A 2X6YA 1AIRA 2ODLA 4XLCA 3TH0A 1KCDA 3JURA 3GQ8A 3VSVA 2BSPA 2YUHA 4W8RA 1O8HA 4XKWA 4XOTA 4XLHA 2UVEA 4OZZA 1O8GA 2O17A 1O8JA 4OJOA 3SZEA 1JTAA 4XOPA 4XKVA 2XC1A 2XTWA 2J8KA 1O88A 2XT4A 1OFDA 1L1IA 1CLWA 2NTPA 4MXNA 4NK6A 3SUCA 1IB4A 4YFOA 4XR6A 1O8DA 4XORA 4YEJA 1K5CA 3EQOA 4YDTA 2O0VA 3VSTA 1EZGA 4W8TA 3SY2A 4Z06A 2NT9A 4XL9A 2NSTA 2NSPA 4HWVA 4YCQA 1O8KA 3FY3A 1RWRA 1IDKA 2F3LA 1QRBA 2IQ7A 3SQVA 3P4GA 3T9GA 4XQFA 2NZMA 1KTWA 1TYUA 2V5IA 4URRA 5AMVA 4C2LA 4YELA 5JMCB 2X3HA 2VFPA 5DNSA 4U49A 2PYHA 2VBEA 4KH3A 3B4NA 3B90A 1O8MA 1LLZA 3PSZA 3N90A 1TYVA 1BN8A 2O0WA 1PE9A 2B0RA 1TYXA 1OGMX 1QQ1A 2QZAA 2INUA 3BH7B 1H80A 5C1CA 1EE6A 2BM6A 3VMWA 1IA5A 3PSSA 4JRAC 1NHCA 3LMWA 2Z8GA 1LM1A 2BM7A 4XNFA 3GRHA 1QA3A 1O8LA 4Z03A 2VFQA 3H09A 4OJ5A 4MR0A 2VBMA 3N6ZA 1QCXA 1LLWA 2QYUA 1BHEA 3KRGA 1QA1A 3VMVA 2VFMA 2NTBA 2XTYA 4XM3A 5JLVC 4EW9A 3NB2A 3PETA 4OPWA 4OZYA 2X85A 4NK8A 3GQ7A 1QJVA 4XN0A 1QRCA 4XONA 1IDJA 2QXZA 2VFOA 3BH6B 1X0CA 1K4ZA 1DBGA 2J8IA 2BM4A 2INVA 2G0YA 3NAWA 1XG2A 3B8YA 4XN3A 1DABA 1K8FA 1CZFA 1GQ8A 4YZQA 4Z05A
chains in the Genus database with same CATH topology
3UW0A 1OGOX 1PXZA 3GQAA 3ZPPA 5C1EA 2PECA 2PYGA 4YZ0A 2O1DA 4OJLA 3EQNA 4XLFA 2VJJA 1O8IA 1OOCA 1DBOA 4YZXA 4PMHA 1PLUA 2X6XA 4OJ6A 2NT6A 4W8SA 1O8EA 1RU4A 4YZAA 2QX3A 1O8FA 3GQ9A 2QY1A 1JRGA 1WMRA 1HG8A 1OFLA 4XMYA 3ZSCA 3WWGA 1KCCA 2UVFA 2VJIA 4AVZA 3VSUA 1OFMA 1RMGA 2NTQA 2EWEA 2X6WA 4I84A 4W8QA 4U4BA 4XLAA 1VBLA 2VBKA 4OJPA 4XLEA 2O04A 2X6YA 1AIRA 2ODLA 4XLCA 1KCDA 3JURA 3GQ8A 3VSVA 2BSPA 4W8RA 1O8HA 4XKWA 4XOTA 4XLHA 2UVEA 4OZZA 1O8GA 2O17A 1O8JA 4OJOA 1JTAA 4XOPA 4XKVA 1O88A 4MXNA 2NTPA 3SUCA 4NK6A 1IB4A 4XR6A 1O8DA 4XORA 4YEJA 1K5CA 3EQOA 3VSTA 2O0VA 4W8TA 4Z06A 2NT9A 4XL9A 2NSTA 2NSPA 4HWVA 1O8KA 3FY3A 1RWRA 1IDKA 2IQ7A 4XQFA 3T9GA 2NZMA 1KTWA 4URRA 5AMVA 4C2LA 4YELA 2X3HA 4U49A 2PYHA 2VBEA 3B4NA 3B90A 1O8MA 1BN8A 2O0WA 1PE9A 1OGMX 2INUA 1H80A 5C1CA 1EE6A 1IA5A 3VMWA 1NHCA 3LMWA 2Z8GA 4XNFA 3GRHA 1O8LA 4Z03A 4OJ5A 4MR0A 2VBMA 1QCXA 3KRGA 1BHEA 3VMVA 2NTBA 4XM3A 4EW9A 4OZYA 2X85A 4NK8A 3GQ7A 1QJVA 4XN0A 4XONA 1IDJA 2QXZA 1X0CA 1DBGA 2INVA 4XN3A 1XG2A 3B8YA 1CZFA 1GQ8A 4YZQA 4Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW0 A;  1OGO X;  1PXZ A;  3GQA A;  3ZPP A;  5C1E A;  2PEC A;  2PYG A;  4YZ0 A;  2O1D A;  4OJL A;  3EQN A;  4XLF A;  2VJJ A;  1O8I A;  1OOC A;  1DBO A;  4YZX A;  4PMH A;  1PLU A;  2X6X A;  4OJ6 A;  2NT6 A;  4W8S A;  1O8E A;  1RU4 A;  4YZA A;  2QX3 A;  1O8F A;  3GQ9 A;  2QY1 A;  1JRG A;  1WMR A;  1HG8 A;  1OFL A;  4XMY A;  3ZSC A;  3WWG A;  1KCC A;  2UVF A;  2VJI A;  4AVZ A;  3VSU A;  1OFM A;  1RMG A;  2NTQ A;  2EWE A;  2X6W A;  4I84 A;  4W8Q A;  4U4B A;  4XLA A;  1VBL A;  2VBK A;  4OJP A;  4XLE A;  2O04 A;  2X6Y A;  1AIR A;  2ODL A;  4XLC A;  1KCD A;  3JUR A;  3GQ8 A;  3VSV A;  2BSP A;  4W8R A;  1O8H A;  4XKW A;  4XOT A;  4XLH A;  2UVE A;  4OZZ A;  1O8G A;  2O17 A;  1O8J A;  4OJO A;  1JTA A;  4XOP A;  4XKV A;  1O88 A;  4MXN A;  2NTP A;  3SUC A;  4NK6 A;  1IB4 A;  4XR6 A;  1O8D A;  4XOR A;  4YEJ A;  1K5C A;  3EQO A;  3VST A;  2O0V A;  4W8T A;  4Z06 A;  2NT9 A;  4XL9 A;  2NST A;  2NSP A;  4HWV A;  1O8K A;  3FY3 A;  1RWR A;  1IDK A;  2IQ7 A;  4XQF A;  3T9G A;  2NZM A;  1KTW A;  4URR A;  5AMV A;  4C2L A;  4YEL A;  2X3H A;  4U49 A;  2PYH A;  2VBE A;  3B4N A;  3B90 A;  1O8M A;  1BN8 A;  2O0W A;  1PE9 A;  1OGM X;  2INU A;  1H80 A;  5C1C A;  1EE6 A;  1IA5 A;  3VMW A;  1NHC A;  3LMW A;  2Z8G A;  4XNF A;  3GRH A;  1O8L A;  4Z03 A;  4OJ5 A;  4MR0 A;  2VBM A;  1QCX A;  3KRG A;  1BHE A;  3VMV A;  2NTB A;  4XM3 A;  4EW9 A;  4OZY A;  2X85 A;  4NK8 A;  3GQ7 A;  1QJV A;  4XN0 A;  4XON A;  1IDJ A;  2QXZ A;  1X0C A;  1DBG A;  2INV A;  4XN3 A;  1XG2 A;  3B8Y A;  1CZF A;  1GQ8 A;  4YZQ A;  4Z05 A; 
#chains in the Genus database with same CATH topology
 2VFN A;  2XTX A;  4YC5 A;  3UW0 A;  3LJY A;  1OGO X;  1PXZ A;  3GQA A;  1HF2 A;  1QA2 A;  3ZPP A;  5C1E A;  2PEC A;  4OM9 A;  2PYG A;  4V02 C;  3DU1 X;  3ML3 A;  2O1D A;  4YZ0 A;  4OJL A;  3EQN A;  4XLF A;  2VJJ A;  1O8I A;  1OOC A;  1DBO A;  4YZX A;  4PMH A;  1PLU A;  2X6X A;  4OJ6 A;  2BX6 A;  2NT6 A;  4W8S A;  4YEI A;  2XT2 A;  1WXR A;  1O8E A;  1RU4 A;  1EA0 A;  1TSP A;  2QX3 A;  4YZA A;  1O8F A;  3GQ9 A;  2QY1 A;  3LYC A;  1JRG A;  1TYW A;  1WMR A;  2O6W A;  1HG8 A;  1OFL A;  1OFE A;  2W7Z A;  4XMY A;  3ZSC A;  3WWG A;  1KCC A;  2UVF A;  2VJI A;  4AVZ A;  3VSU A;  1KQ5 A;  1OFM A;  3RIQ A;  1RMG A;  2IOU G;  2NTQ A;  3JX8 A;  2EWE A;  2X6W A;  4I84 A;  4W8Q A;  4U4B A;  4XLA A;  1VBL A;  2VBK A;  4OJP A;  2BM5 A;  4XLE A;  2O04 A;  3SYJ A;  3AK5 A;  2X6Y A;  1AIR A;  2ODL A;  4XLC A;  3TH0 A;  1KCD A;  3JUR A;  3GQ8 A;  3VSV A;  2BSP A;  2YUH A;  4W8R A;  1O8H A;  4XKW A;  4XOT A;  4XLH A;  2UVE A;  4OZZ A;  1O8G A;  2O17 A;  1O8J A;  4OJO A;  3SZE A;  1JTA A;  4XOP A;  4XKV A;  2XC1 A;  2XTW A;  2J8K A;  1O88 A;  2XT4 A;  1OFD A;  1L1I A;  1CLW A;  2NTP A;  4MXN A;  4NK6 A;  3SUC A;  1IB4 A;  4YFO A;  4XR6 A;  1O8D A;  4XOR A;  4YEJ A;  1K5C A;  3EQO A;  4YDT A;  2O0V A;  3VST A;  1EZG A;  4W8T A;  3SY2 A;  4Z06 A;  2NT9 A;  4XL9 A;  2NST A;  2NSP A;  4HWV A;  4YCQ A;  1O8K A;  3FY3 A;  1RWR A;  1IDK A;  2F3L A;  1QRB A;  2IQ7 A;  3SQV A;  3P4G A;  3T9G A;  4XQF A;  2NZM A;  1KTW A;  1TYU A;  2V5I A;  4URR A;  5AMV A;  4C2L A;  4YEL A;  5JMC B;  2X3H A;  2VFP A;  5DNS A;  4U49 A;  2PYH A;  2VBE A;  4KH3 A;  3B4N A;  3B90 A;  1O8M A;  1LLZ A;  3PSZ A;  3N90 A;  1TYV A;  1BN8 A;  2O0W A;  1PE9 A;  2B0R A;  1TYX A;  1OGM X;  1QQ1 A;  2QZA A;  2INU A;  3BH7 B;  1H80 A;  5C1C A;  1EE6 A;  2BM6 A;  3VMW A;  1IA5 A;  3PSS A;  4JRA C;  1NHC A;  3LMW A;  2Z8G A;  1LM1 A;  2BM7 A;  4XNF A;  3GRH A;  1QA3 A;  1O8L A;  4Z03 A;  2VFQ A;  3H09 A;  4OJ5 A;  4MR0 A;  2VBM A;  3N6Z A;  1QCX A;  1LLW A;  2QYU A;  1BHE A;  3KRG A;  1QA1 A;  3VMV A;  2VFM A;  2NTB A;  2XTY A;  4XM3 A;  5JLV C;  4EW9 A;  3NB2 A;  3PET A;  4OPW A;  4OZY A;  2X85 A;  4NK8 A;  3GQ7 A;  1QJV A;  4XN0 A;  1QRC A;  4XON A;  1IDJ A;  2QXZ A;  2VFO A;  3BH6 B;  1X0C A;  1K4Z A;  1DBG A;  2J8I A;  2BM4 A;  2INV A;  2G0Y A;  3NAW A;  1XG2 A;  3B8Y A;  4XN3 A;  1DAB A;  1K8F A;  1CZF A;  1GQ8 A;  4YZQ A;  4Z05 A; 
#chains in the Genus database with same CATH homology
 3UW0 A;  1OGO X;  1PXZ A;  3GQA A;  3ZPP A;  5C1E A;  2PEC A;  2PYG A;  4YZ0 A;  2O1D A;  4OJL A;  3EQN A;  4XLF A;  2VJJ A;  1O8I A;  1OOC A;  1DBO A;  4YZX A;  4PMH A;  1PLU A;  2X6X A;  4OJ6 A;  2NT6 A;  4W8S A;  1O8E A;  1RU4 A;  4YZA A;  2QX3 A;  1O8F A;  3GQ9 A;  2QY1 A;  1JRG A;  1WMR A;  1HG8 A;  1OFL A;  4XMY A;  3ZSC A;  3WWG A;  1KCC A;  2UVF A;  2VJI A;  4AVZ A;  3VSU A;  1OFM A;  1RMG A;  2NTQ A;  2EWE A;  2X6W A;  4I84 A;  4W8Q A;  4U4B A;  4XLA A;  1VBL A;  2VBK A;  4OJP A;  4XLE A;  2O04 A;  2X6Y A;  1AIR A;  2ODL A;  4XLC A;  1KCD A;  3JUR A;  3GQ8 A;  3VSV A;  2BSP A;  4W8R A;  1O8H A;  4XKW A;  4XOT A;  4XLH A;  2UVE A;  4OZZ A;  1O8G A;  2O17 A;  1O8J A;  4OJO A;  1JTA A;  4XOP A;  4XKV A;  1O88 A;  4MXN A;  2NTP A;  3SUC A;  4NK6 A;  1IB4 A;  4XR6 A;  1O8D A;  4XOR A;  4YEJ A;  1K5C A;  3EQO A;  3VST A;  2O0V A;  4W8T A;  4Z06 A;  2NT9 A;  4XL9 A;  2NST A;  2NSP A;  4HWV A;  1O8K A;  3FY3 A;  1RWR A;  1IDK A;  2IQ7 A;  4XQF A;  3T9G A;  2NZM A;  1KTW A;  4URR A;  5AMV A;  4C2L A;  4YEL A;  2X3H A;  4U49 A;  2PYH A;  2VBE A;  3B4N A;  3B90 A;  1O8M A;  1BN8 A;  2O0W A;  1PE9 A;  1OGM X;  2INU A;  1H80 A;  5C1C A;  1EE6 A;  1IA5 A;  3VMW A;  1NHC A;  3LMW A;  2Z8G A;  4XNF A;  3GRH A;  1O8L A;  4Z03 A;  4OJ5 A;  4MR0 A;  2VBM A;  1QCX A;  3KRG A;  1BHE A;  3VMV A;  2NTB A;  4XM3 A;  4EW9 A;  4OZY A;  2X85 A;  4NK8 A;  3GQ7 A;  1QJV A;  4XN0 A;  4XON A;  1IDJ A;  2QXZ A;  1X0C A;  1DBG A;  2INV A;  4XN3 A;  1XG2 A;  3B8Y A;  1CZF A;  1GQ8 A;  4YZQ A;  4Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...