1RMGA

Rhamnogalacturonase a from aspergillus aculeatus
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
422
structure length
422
Chain Sequence
QLSGSVGPLTSASTKGATKTCNILSYGAVADNSTDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTSKGAVQGFGYVYHAEGTYGARILRLTDVTHFSVHDIILVDAPAFHFTMDTCSDGEVYNMAIRGGNEGGLDGIDVWGSNIWVHDVEVTNKDECVTVKSPANNILVESIYCNWSGGCAMGSLGADTDVTDIVYRNVYTWSSNQMYMIKSNGGSGTVSNVLLENFIGHGNAYSLDIDGYWSSMTAVAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTDLTLEDIAIWTESGSSELYLCRSAYGSGYCLKDSSSHTSYTTTSTVTAAPSGYSATTMAADLATAFGLTASIPIPTIPTSFYPGLTPYSALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of rhamnogalacturonase A from Aspergillus aculeatus: a right-handed parallel beta helix.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
molecule keywords RHAMNOGALACTURONASE A
total genus 164
structure length 422
sequence length 422
ec nomenclature ec 3.2.1.171: Rhamnogalacturonan hydrolase.
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1rmgA00
5C1CA 3GRHA 2O0VA 4YEJA 4W8QA 1EE6A 3T9GA 4XM3A 3B90A 2O04A 3GQ9A 1IA5A 4OJLA 4Z06A 2IQ7A 4URRA 1RMGA 4AVZA 1PLUA 4XLEA 2UVEA 1X0CA 4XQFA 1OFMA 1DBGA 1O88A 4PMHA 4XR6A 2VBMA 3ZSCA 1KTWA 3FY3A 2NSPA 4XN0A 3WWGA 3EQNA 1NHCA 2PYGA 1QJVA 2NTBA 2QX3A 1O8LA 2VJIA 4XKWA 2INUA 4YELA 1RU4A 2NZMA 4OJOA 4OJ5A 4XOTA 3SUCA 4W8RA 4XKVA 3B4NA 1DBOA 2PYHA 2VBKA 1O8GA 1O8IA 4U49A 2VJJA 1OFLA 1O8DA 2UVFA 2X85A 1RWRA 4C2LA 4Z03A 1O8EA 4HWVA 1VBLA 1KCCA 4XLAA 4XNFA 4OZZA 3VSUA 1JTAA 4MXNA 3VSVA 1BN8A 2PECA 4XLFA 1O8JA 1PXZA 4NK6A 2NT9A 2O0WA 4OJPA 4YZXA 1KCDA 3LMWA 1K5CA 1XG2A 2X6XA 4U4BA 5AMVA 3UW0A 2INVA 3VSTA 1JRGA 2X3HA 1O8MA 1IB4A 3JURA 2NT6A 3GQAA 2BSPA 1IDJA 1HG8A 2X6YA 4YZAA 4YZQA 2QY1A 1AIRA 4XORA 4OJ6A 2X6WA 2ODLA 2VBEA 1QCXA 1WMRA 4W8TA 3B8YA 4XMYA 4XOPA 4I84A 1OOCA 4Z05A 1OGOX 2Z8GA 1GQ8A 4EW9A 1O8FA 4XLHA 3VMVA 3ZPPA 2O1DA 1H80A 4XLCA 1CZFA 2NSTA 5C1EA 2EWEA 4YZ0A 4OZYA 1O8HA 2O17A 4XONA 4NK8A 1PE9A 4MR0A 1OGMX 2NTQA 4W8SA 3KRGA 1IDKA 4XN3A 2QXZA 2NTPA 1O8KA 3GQ7A 3GQ8A 4XL9A 3VMWA 3EQOA 1BHEA
chains in the Genus database with same CATH superfamily
3BH6B 5C1CA 1QRCA 3GRHA 2O0VA 4JRAC 4YEJA 3DU1X 1TSPA 2IOUG 1EE6A 4W8QA 4XM3A 1KQ5A 4YCQA 3B90A 3T9GA 1CLWA 2O04A 3GQ9A 3PSSA 1IA5A 4OM9A 4OJLA 2XC1A 2IQ7A 2YUHA 4URRA 4Z06A 1RMGA 4AVZA 1OFDA 4YFOA 3N90A 1PLUA 4XLEA 2BM6A 1X0CA 2UVEA 1OFMA 2XTYA 3NB2A 4XQFA 1OFEA 1EA0A 1DBGA 1O88A 4PMHA 4XR6A 2VBMA 3ZSCA 1KTWA 3ML3A 3FY3A 3LJYA 2NSPA 4XN0A 3WWGA 3EQNA 1NHCA 2PYGA 1QJVA 1QA1A 2BM4A 2NTBA 2VFOA 2W7ZA 3TH0A 3SZEA 2QX3A 1O8LA 2VJIA 4XKWA 3BH7B 2INUA 4YELA 1QA3A 1RU4A 2NZMA 4OJOA 4OJ5A 4XOTA 3SUCA 4W8RA 4XKVA 3B4NA 1DBOA 3PETA 2PYHA 2VBKA 2XTWA 1O8GA 1O8IA 2BX6A 4U49A 2VJJA 1TYUA 1OFLA 1O8DA 1K8FA 2UVFA 2X85A 1RWRA 4C2LA 3SYJA 4Z03A 1O8EA 4HWVA 4YDTA 1VBLA 2G0YA 1KCCA 4XLAA 4XNFA 2XTXA 4OZZA 1QRBA 1JTAA 3VSUA 3LYCA 4MXNA 3RIQA 3VSVA 4YEIA 1BN8A 2PECA 3H09A 4XLFA 1O8JA 1PXZA 4NK6A 2NT9A 1QA2A 1EZGA 2V5IA 2O0WA 4OJPA 4YZXA 1KCDA 3LMWA 1DABA 1K5CA 1XG2A 2X6XA 4U4BA 5AMVA 3UW0A 2INVA 3VSTA 1WXRA 2VFMA 1JRGA 2X3HA 2F3LA 1O8MA 1IB4A 3JURA 2NT6A 3GQAA 2BSPA 1LLWA 1IDJA 1HG8A 2X6YA 2QYUA 3PSZA 1TYWA 4YC5A 3SY2A 4YZAA 1K4ZA 2O6WA 4YZQA 2XT2A 5JMCB 1L1IA 2QY1A 1AIRA 3JX8A 4XORA 1LM1A 4OJ6A 2X6WA 2BM7A 1HF2A 2VBEA 1QCXA 3P4GA 1WMRA 4OPWA 1TYVA 4W8TA 2B0RA 2XT4A 3B8YA 5JLVC 3AK5A 4XMYA 4XOPA 3EQOA 1LLZA 4I84A 1OOCA 4Z05A 1OGOX 1TYXA 1GQ8A 2Z8GA 2J8IA 3N6ZA 2VFPA 4EW9A 1O8FA 4XLHA 3VMVA 3ZPPA 2O1DA 1H80A 4XLCA 3NAWA 1QQ1A 1CZFA 2QZAA 2NSTA 5C1EA 2EWEA 4YZ0A 4OZYA 3SQVA 1O8HA 2O17A 4V02C 4XONA 4NK8A 2BM5A 2VFQA 1PE9A 4MR0A 1OGMX 4KH3A 2J8KA 2NTQA 3KRGA 4W8SA 1IDKA 4XN3A 2QXZA 2NTPA 1O8KA 5DNSA 3GQ7A 2VFNA 3GQ8A 4XL9A 3VMWA 2ODLA 1BHEA
chains in the Genus database with same CATH topology
5C1CA 3GRHA 2O0VA 4YEJA 4W8QA 1EE6A 3T9GA 4XM3A 3B90A 2O04A 3GQ9A 1IA5A 4OJLA 4Z06A 2IQ7A 4URRA 1RMGA 4AVZA 1PLUA 4XLEA 2UVEA 1X0CA 4XQFA 1OFMA 1DBGA 1O88A 4PMHA 4XR6A 2VBMA 3ZSCA 1KTWA 3FY3A 2NSPA 4XN0A 3WWGA 3EQNA 1NHCA 2PYGA 1QJVA 2NTBA 2QX3A 1O8LA 2VJIA 4XKWA 2INUA 4YELA 1RU4A 2NZMA 4OJOA 4OJ5A 4XOTA 3SUCA 4W8RA 4XKVA 3B4NA 1DBOA 2PYHA 2VBKA 1O8GA 1O8IA 4U49A 2VJJA 1OFLA 1O8DA 2UVFA 2X85A 1RWRA 4C2LA 4Z03A 1O8EA 4HWVA 1VBLA 1KCCA 4XLAA 4XNFA 4OZZA 3VSUA 1JTAA 4MXNA 3VSVA 1BN8A 2PECA 4XLFA 1O8JA 1PXZA 4NK6A 2NT9A 2O0WA 4OJPA 4YZXA 1KCDA 3LMWA 1K5CA 1XG2A 2X6XA 4U4BA 5AMVA 3UW0A 2INVA 3VSTA 1JRGA 2X3HA 1O8MA 1IB4A 3JURA 2NT6A 3GQAA 2BSPA 1IDJA 1HG8A 2X6YA 4YZAA 4YZQA 2QY1A 1AIRA 4XORA 4OJ6A 2X6WA 2ODLA 2VBEA 1QCXA 1WMRA 4W8TA 3B8YA 4XMYA 4XOPA 4I84A 1OOCA 4Z05A 1OGOX 2Z8GA 1GQ8A 4EW9A 1O8FA 4XLHA 3VMVA 3ZPPA 2O1DA 1H80A 4XLCA 1CZFA 2NSTA 5C1EA 2EWEA 4YZ0A 4OZYA 1O8HA 2O17A 4XONA 4NK8A 1PE9A 4MR0A 1OGMX 2NTQA 4W8SA 3KRGA 1IDKA 4XN3A 2QXZA 2NTPA 1O8KA 3GQ7A 3GQ8A 4XL9A 3VMWA 3EQOA 1BHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  3GRH A;  2O0V A;  4YEJ A;  4W8Q A;  1EE6 A;  3T9G A;  4XM3 A;  3B90 A;  2O04 A;  3GQ9 A;  1IA5 A;  4OJL A;  4Z06 A;  2IQ7 A;  4URR A;  1RMG A;  4AVZ A;  1PLU A;  4XLE A;  2UVE A;  1X0C A;  4XQF A;  1OFM A;  1DBG A;  1O88 A;  4PMH A;  4XR6 A;  2VBM A;  3ZSC A;  1KTW A;  3FY3 A;  2NSP A;  4XN0 A;  3WWG A;  3EQN A;  1NHC A;  2PYG A;  1QJV A;  2NTB A;  2QX3 A;  1O8L A;  2VJI A;  4XKW A;  2INU A;  4YEL A;  1RU4 A;  2NZM A;  4OJO A;  4OJ5 A;  4XOT A;  3SUC A;  4W8R A;  4XKV A;  3B4N A;  1DBO A;  2PYH A;  2VBK A;  1O8G A;  1O8I A;  4U49 A;  2VJJ A;  1OFL A;  1O8D A;  2UVF A;  2X85 A;  1RWR A;  4C2L A;  4Z03 A;  1O8E A;  4HWV A;  1VBL A;  1KCC A;  4XLA A;  4XNF A;  4OZZ A;  3VSU A;  1JTA A;  4MXN A;  3VSV A;  1BN8 A;  2PEC A;  4XLF A;  1O8J A;  1PXZ A;  4NK6 A;  2NT9 A;  2O0W A;  4OJP A;  4YZX A;  1KCD A;  3LMW A;  1K5C A;  1XG2 A;  2X6X A;  4U4B A;  5AMV A;  3UW0 A;  2INV A;  3VST A;  1JRG A;  2X3H A;  1O8M A;  1IB4 A;  3JUR A;  2NT6 A;  3GQA A;  2BSP A;  1IDJ A;  1HG8 A;  2X6Y A;  4YZA A;  4YZQ A;  2QY1 A;  1AIR A;  4XOR A;  4OJ6 A;  2X6W A;  2ODL A;  2VBE A;  1QCX A;  1WMR A;  4W8T A;  3B8Y A;  4XMY A;  4XOP A;  4I84 A;  1OOC A;  4Z05 A;  1OGO X;  2Z8G A;  1GQ8 A;  4EW9 A;  1O8F A;  4XLH A;  3VMV A;  3ZPP A;  2O1D A;  1H80 A;  4XLC A;  1CZF A;  2NST A;  5C1E A;  2EWE A;  4YZ0 A;  4OZY A;  1O8H A;  2O17 A;  4XON A;  4NK8 A;  1PE9 A;  4MR0 A;  1OGM X;  2NTQ A;  4W8S A;  3KRG A;  1IDK A;  4XN3 A;  2QXZ A;  2NTP A;  1O8K A;  3GQ7 A;  3GQ8 A;  4XL9 A;  3VMW A;  3EQO A;  1BHE A; 
#chains in the Genus database with same CATH topology
 3BH6 B;  5C1C A;  1QRC A;  3GRH A;  2O0V A;  4JRA C;  4YEJ A;  3DU1 X;  1TSP A;  2IOU G;  1EE6 A;  4W8Q A;  4XM3 A;  1KQ5 A;  4YCQ A;  3B90 A;  3T9G A;  1CLW A;  2O04 A;  3GQ9 A;  3PSS A;  1IA5 A;  4OM9 A;  4OJL A;  2XC1 A;  2IQ7 A;  2YUH A;  4URR A;  4Z06 A;  1RMG A;  4AVZ A;  1OFD A;  4YFO A;  3N90 A;  1PLU A;  4XLE A;  2BM6 A;  1X0C A;  2UVE A;  1OFM A;  2XTY A;  3NB2 A;  4XQF A;  1OFE A;  1EA0 A;  1DBG A;  1O88 A;  4PMH A;  4XR6 A;  2VBM A;  3ZSC A;  1KTW A;  3ML3 A;  3FY3 A;  3LJY A;  2NSP A;  4XN0 A;  3WWG A;  3EQN A;  1NHC A;  2PYG A;  1QJV A;  1QA1 A;  2BM4 A;  2NTB A;  2VFO A;  2W7Z A;  3TH0 A;  3SZE A;  2QX3 A;  1O8L A;  2VJI A;  4XKW A;  3BH7 B;  2INU A;  4YEL A;  1QA3 A;  1RU4 A;  2NZM A;  4OJO A;  4OJ5 A;  4XOT A;  3SUC A;  4W8R A;  4XKV A;  3B4N A;  1DBO A;  3PET A;  2PYH A;  2VBK A;  2XTW A;  1O8G A;  1O8I A;  2BX6 A;  4U49 A;  2VJJ A;  1TYU A;  1OFL A;  1O8D A;  1K8F A;  2UVF A;  2X85 A;  1RWR A;  4C2L A;  3SYJ A;  4Z03 A;  1O8E A;  4HWV A;  4YDT A;  1VBL A;  2G0Y A;  1KCC A;  4XLA A;  4XNF A;  2XTX A;  4OZZ A;  1QRB A;  1JTA A;  3VSU A;  3LYC A;  4MXN A;  3RIQ A;  3VSV A;  4YEI A;  1BN8 A;  2PEC A;  3H09 A;  4XLF A;  1O8J A;  1PXZ A;  4NK6 A;  2NT9 A;  1QA2 A;  1EZG A;  2V5I A;  2O0W A;  4OJP A;  4YZX A;  1KCD A;  3LMW A;  1DAB A;  1K5C A;  1XG2 A;  2X6X A;  4U4B A;  5AMV A;  3UW0 A;  2INV A;  3VST A;  1WXR A;  2VFM A;  1JRG A;  2X3H A;  2F3L A;  1O8M A;  1IB4 A;  3JUR A;  2NT6 A;  3GQA A;  2BSP A;  1LLW A;  1IDJ A;  1HG8 A;  2X6Y A;  2QYU A;  3PSZ A;  1TYW A;  4YC5 A;  3SY2 A;  4YZA A;  1K4Z A;  2O6W A;  4YZQ A;  2XT2 A;  5JMC B;  1L1I A;  2QY1 A;  1AIR A;  3JX8 A;  4XOR A;  1LM1 A;  4OJ6 A;  2X6W A;  2BM7 A;  1HF2 A;  2VBE A;  1QCX A;  3P4G A;  1WMR A;  4OPW A;  1TYV A;  4W8T A;  2B0R A;  2XT4 A;  3B8Y A;  5JLV C;  3AK5 A;  4XMY A;  4XOP A;  3EQO A;  1LLZ A;  4I84 A;  1OOC A;  4Z05 A;  1OGO X;  1TYX A;  1GQ8 A;  2Z8G A;  2J8I A;  3N6Z A;  2VFP A;  4EW9 A;  1O8F A;  4XLH A;  3VMV A;  3ZPP A;  2O1D A;  1H80 A;  4XLC A;  3NAW A;  1QQ1 A;  1CZF A;  2QZA A;  2NST A;  5C1E A;  2EWE A;  4YZ0 A;  4OZY A;  3SQV A;  1O8H A;  2O17 A;  4V02 C;  4XON A;  4NK8 A;  2BM5 A;  2VFQ A;  1PE9 A;  4MR0 A;  1OGM X;  4KH3 A;  2J8K A;  2NTQ A;  3KRG A;  4W8S A;  1IDK A;  4XN3 A;  2QXZ A;  2NTP A;  1O8K A;  5DNS A;  3GQ7 A;  2VFN A;  3GQ8 A;  4XL9 A;  3VMW A;  2ODL A;  1BHE A; 
#chains in the Genus database with same CATH homology
 5C1C A;  3GRH A;  2O0V A;  4YEJ A;  4W8Q A;  1EE6 A;  3T9G A;  4XM3 A;  3B90 A;  2O04 A;  3GQ9 A;  1IA5 A;  4OJL A;  4Z06 A;  2IQ7 A;  4URR A;  1RMG A;  4AVZ A;  1PLU A;  4XLE A;  2UVE A;  1X0C A;  4XQF A;  1OFM A;  1DBG A;  1O88 A;  4PMH A;  4XR6 A;  2VBM A;  3ZSC A;  1KTW A;  3FY3 A;  2NSP A;  4XN0 A;  3WWG A;  3EQN A;  1NHC A;  2PYG A;  1QJV A;  2NTB A;  2QX3 A;  1O8L A;  2VJI A;  4XKW A;  2INU A;  4YEL A;  1RU4 A;  2NZM A;  4OJO A;  4OJ5 A;  4XOT A;  3SUC A;  4W8R A;  4XKV A;  3B4N A;  1DBO A;  2PYH A;  2VBK A;  1O8G A;  1O8I A;  4U49 A;  2VJJ A;  1OFL A;  1O8D A;  2UVF A;  2X85 A;  1RWR A;  4C2L A;  4Z03 A;  1O8E A;  4HWV A;  1VBL A;  1KCC A;  4XLA A;  4XNF A;  4OZZ A;  3VSU A;  1JTA A;  4MXN A;  3VSV A;  1BN8 A;  2PEC A;  4XLF A;  1O8J A;  1PXZ A;  4NK6 A;  2NT9 A;  2O0W A;  4OJP A;  4YZX A;  1KCD A;  3LMW A;  1K5C A;  1XG2 A;  2X6X A;  4U4B A;  5AMV A;  3UW0 A;  2INV A;  3VST A;  1JRG A;  2X3H A;  1O8M A;  1IB4 A;  3JUR A;  2NT6 A;  3GQA A;  2BSP A;  1IDJ A;  1HG8 A;  2X6Y A;  4YZA A;  4YZQ A;  2QY1 A;  1AIR A;  4XOR A;  4OJ6 A;  2X6W A;  2ODL A;  2VBE A;  1QCX A;  1WMR A;  4W8T A;  3B8Y A;  4XMY A;  4XOP A;  4I84 A;  1OOC A;  4Z05 A;  1OGO X;  2Z8G A;  1GQ8 A;  4EW9 A;  1O8F A;  4XLH A;  3VMV A;  3ZPP A;  2O1D A;  1H80 A;  4XLC A;  1CZF A;  2NST A;  5C1E A;  2EWE A;  4YZ0 A;  4OZY A;  1O8H A;  2O17 A;  4XON A;  4NK8 A;  1PE9 A;  4MR0 A;  1OGM X;  2NTQ A;  4W8S A;  3KRG A;  1IDK A;  4XN3 A;  2QXZ A;  2NTP A;  1O8K A;  3GQ7 A;  3GQ8 A;  4XL9 A;  3VMW A;  3EQO A;  1BHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...