1O8MA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with no ca2+ added
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 136
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8mA00
4W8QA 1O8IA 4XNFA 5C1EA 1NHCA 2PYHA 2X85A 4XL9A 2NTQA 1O8JA 2UVFA 4XN0A 3T9GA 2VBMA 3LMWA 1WMRA 4XKWA 4NK8A 1KCDA 2X6WA 1O8HA 2IQ7A 2X3HA 3JURA 2INUA 4OZYA 4I84A 1JRGA 4OJPA 1JTAA 5C1CA 2O1DA 1KCCA 1O8EA 1PE9A 2NTPA 3KRGA 2BSPA 2Z8GA 4XN3A 2NTBA 3VSTA 2NT9A 1OOCA 1BN8A 1RWRA 2QY1A 1H80A 1VBLA 3EQNA 2VBEA 3GQ8A 1QCXA 1IDKA 4XLFA 1CZFA 1AIRA 3FY3A 4PMHA 4URRA 4XOPA 1IB4A 3VSUA 1O88A 4Z03A 2NT6A 2VBKA 1DBOA 4MXNA 2INVA 2NZMA 1QJVA 4XLAA 1IA5A 4C2LA 4YZ0A 2UVEA 2X6YA 3GQ9A 1O8FA 4YZAA 1OFLA 4XLEA 2QXZA 1X0CA 1O8GA 4YEJA 1EE6A 1PLUA 3SUCA 2O0VA 3B8YA 4AVZA 3ZPPA 1XG2A 2VJJA 4NK6A 2VJIA 2NSTA 2NSPA 3UW0A 3VMVA 4OJ5A 1PXZA 4U49A 3GRHA 4U4BA 4OZZA 4OJOA 5AMVA 3GQ7A 4XORA 3VSVA 1OFMA 2PECA 4YZQA 3EQOA 4XM3A 4YZXA 4W8TA 1KTWA 4W8RA 4XQFA 2O17A 3B90A 4XMYA 1IDJA 4XOTA 1BHEA 3GQAA 1RU4A 4OJLA 4XR6A 2QX3A 1O8MA 1OGOX 4XKVA 4OJ6A 4Z06A 4Z05A 1RMGA 4XLCA 2ODLA 4W8SA 1GQ8A 2EWEA 2O0WA 4XONA 3WWGA 1DBGA 4XLHA 2O04A 4HWVA 3ZSCA 1HG8A 2X6XA 3VMWA 1O8KA 4MR0A 1O8DA 1K5CA 1OGMX 4YELA 3B4NA 1O8LA 2PYGA 4EW9A
chains in the Genus database with same CATH superfamily
4KH3A 1O8IA 4W8QA 4XNFA 4YFOA 5C1EA 1NHCA 2PYHA 2BM6A 2X85A 3BH6B 4XL9A 2NTQA 3SZEA 1O8JA 2UVFA 1EA0A 4XN0A 3T9GA 2VBMA 3LMWA 1WMRA 4XKWA 4NK8A 1KCDA 1QRBA 2X6WA 1O8HA 2IQ7A 2X3HA 3JURA 2INUA 3DU1X 4OZYA 4V02C 2O6WA 2QYUA 3NB2A 4I84A 1L1IA 1JRGA 4OJPA 1JTAA 2XT2A 5C1CA 2O1DA 2IOUG 1KCCA 1O8EA 3P4GA 1PE9A 2NTPA 3KRGA 1OFDA 2BSPA 2F3LA 2J8IA 2Z8GA 4XN3A 1K8FA 2NTBA 3VSTA 1TYUA 2NT9A 4YEIA 1OOCA 1QA3A 3N90A 1BN8A 1RWRA 2QY1A 2BM4A 1KQ5A 3H09A 1H80A 1TYWA 1VBLA 2J8KA 2XT4A 3EQNA 3SYJA 2XTXA 2VBEA 3GQ8A 1LLWA 1QQ1A 1QCXA 4OM9A 1IDKA 4XLFA 2QZAA 1CZFA 1AIRA 3FY3A 3LJYA 4PMHA 4URRA 4XOPA 4YDTA 3RIQA 1QA2A 2BM7A 1IB4A 3PSZA 3VSUA 1WXRA 2W7ZA 1O88A 4Z03A 2NT6A 2VBKA 1DBOA 4MXNA 2INVA 2NZMA 3TH0A 1QJVA 4XLAA 1IA5A 4C2LA 2VFNA 4YZ0A 2UVEA 2V5IA 2X6YA 1O8FA 3GQ9A 4YC5A 2VFQA 1OFLA 3JX8A 1LLZA 4XLEA 2YUHA 2QXZA 4YZAA 5JMCB 1QRCA 1X0CA 1O8GA 4YEJA 1EE6A 1PLUA 2B0RA 2VFPA 2BM5A 2O0VA 3NAWA 3SUCA 3ML3A 4JRAC 1TYVA 3B8YA 4AVZA 3ZPPA 1XG2A 2G0YA 2VJJA 4NK6A 2VJIA 2NSTA 2NSPA 3UW0A 3VMVA 4OJ5A 1PXZA 4U49A 3GRHA 4U4BA 1CLWA 4OZZA 3N6ZA 2XTYA 4OJOA 5AMVA 5JLVC 3GQ7A 4XORA 3VSVA 1QA1A 3AK5A 3PSSA 1OFMA 2PECA 4YZQA 1TYXA 3EQOA 4XM3A 4YZXA 4W8TA 1KTWA 4W8RA 4YCQA 4XQFA 2O17A 3B90A 4XMYA 1EZGA 1IDJA 4XOTA 5DNSA 3SQVA 1BHEA 1DABA 3GQAA 1RU4A 1LM1A 4OJLA 4XR6A 2QX3A 1O8MA 2XTWA 1OGOX 4XKVA 3PETA 4OJ6A 4Z06A 4Z05A 3BH7B 1RMGA 4XLCA 1TSPA 2ODLA 2XC1A 1GQ8A 1K4ZA 4W8SA 2EWEA 2O0WA 4XONA 4OPWA 3WWGA 3SY2A 1DBGA 4XLHA 2O04A 4HWVA 3ZSCA 1HG8A 3LYCA 2VFOA 2X6XA 3VMWA 1O8KA 2VFMA 4MR0A 2BX6A 1OFEA 1O8DA 1K5CA 1OGMX 4YELA 3B4NA 1O8LA 2PYGA 1HF2A 4EW9A
chains in the Genus database with same CATH topology
4W8QA 1O8IA 4XNFA 5C1EA 1NHCA 2PYHA 2X85A 4XL9A 2NTQA 1O8JA 2UVFA 4XN0A 3T9GA 2VBMA 3LMWA 1WMRA 4XKWA 4NK8A 1KCDA 2X6WA 1O8HA 2IQ7A 2X3HA 3JURA 2INUA 4OZYA 4I84A 1JRGA 4OJPA 1JTAA 5C1CA 2O1DA 1KCCA 1O8EA 1PE9A 2NTPA 3KRGA 2BSPA 2Z8GA 4XN3A 2NTBA 3VSTA 2NT9A 1OOCA 1BN8A 1RWRA 2QY1A 1H80A 1VBLA 3EQNA 2VBEA 3GQ8A 1QCXA 1IDKA 4XLFA 1CZFA 1AIRA 3FY3A 4PMHA 4URRA 4XOPA 1IB4A 3VSUA 1O88A 4Z03A 2NT6A 2VBKA 1DBOA 4MXNA 2INVA 2NZMA 1QJVA 4XLAA 1IA5A 4C2LA 4YZ0A 2UVEA 2X6YA 3GQ9A 1O8FA 4YZAA 1OFLA 4XLEA 2QXZA 1X0CA 1O8GA 4YEJA 1EE6A 1PLUA 3SUCA 2O0VA 3B8YA 4AVZA 3ZPPA 1XG2A 2VJJA 4NK6A 2VJIA 2NSTA 2NSPA 3UW0A 3VMVA 4OJ5A 1PXZA 4U49A 3GRHA 4U4BA 4OZZA 4OJOA 5AMVA 3GQ7A 4XORA 3VSVA 1OFMA 2PECA 4YZQA 3EQOA 4XM3A 4YZXA 4W8TA 1KTWA 4W8RA 4XQFA 2O17A 3B90A 4XMYA 1IDJA 4XOTA 1BHEA 3GQAA 1RU4A 4OJLA 4XR6A 2QX3A 1O8MA 1OGOX 4XKVA 4OJ6A 4Z06A 4Z05A 1RMGA 4XLCA 2ODLA 4W8SA 1GQ8A 2EWEA 2O0WA 4XONA 3WWGA 1DBGA 4XLHA 2O04A 4HWVA 3ZSCA 1HG8A 2X6XA 3VMWA 1O8KA 4MR0A 1O8DA 1K5CA 1OGMX 4YELA 3B4NA 1O8LA 2PYGA 4EW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8Q A;  1O8I A;  4XNF A;  5C1E A;  1NHC A;  2PYH A;  2X85 A;  4XL9 A;  2NTQ A;  1O8J A;  2UVF A;  4XN0 A;  3T9G A;  2VBM A;  3LMW A;  1WMR A;  4XKW A;  4NK8 A;  1KCD A;  2X6W A;  1O8H A;  2IQ7 A;  2X3H A;  3JUR A;  2INU A;  4OZY A;  4I84 A;  1JRG A;  4OJP A;  1JTA A;  5C1C A;  2O1D A;  1KCC A;  1O8E A;  1PE9 A;  2NTP A;  3KRG A;  2BSP A;  2Z8G A;  4XN3 A;  2NTB A;  3VST A;  2NT9 A;  1OOC A;  1BN8 A;  1RWR A;  2QY1 A;  1H80 A;  1VBL A;  3EQN A;  2VBE A;  3GQ8 A;  1QCX A;  1IDK A;  4XLF A;  1CZF A;  1AIR A;  3FY3 A;  4PMH A;  4URR A;  4XOP A;  1IB4 A;  3VSU A;  1O88 A;  4Z03 A;  2NT6 A;  2VBK A;  1DBO A;  4MXN A;  2INV A;  2NZM A;  1QJV A;  4XLA A;  1IA5 A;  4C2L A;  4YZ0 A;  2UVE A;  2X6Y A;  3GQ9 A;  1O8F A;  4YZA A;  1OFL A;  4XLE A;  2QXZ A;  1X0C A;  1O8G A;  4YEJ A;  1EE6 A;  1PLU A;  3SUC A;  2O0V A;  3B8Y A;  4AVZ A;  3ZPP A;  1XG2 A;  2VJJ A;  4NK6 A;  2VJI A;  2NST A;  2NSP A;  3UW0 A;  3VMV A;  4OJ5 A;  1PXZ A;  4U49 A;  3GRH A;  4U4B A;  4OZZ A;  4OJO A;  5AMV A;  3GQ7 A;  4XOR A;  3VSV A;  1OFM A;  2PEC A;  4YZQ A;  3EQO A;  4XM3 A;  4YZX A;  4W8T A;  1KTW A;  4W8R A;  4XQF A;  2O17 A;  3B90 A;  4XMY A;  1IDJ A;  4XOT A;  1BHE A;  3GQA A;  1RU4 A;  4OJL A;  4XR6 A;  2QX3 A;  1O8M A;  1OGO X;  4XKV A;  4OJ6 A;  4Z06 A;  4Z05 A;  1RMG A;  4XLC A;  2ODL A;  4W8S A;  1GQ8 A;  2EWE A;  2O0W A;  4XON A;  3WWG A;  1DBG A;  4XLH A;  2O04 A;  4HWV A;  3ZSC A;  1HG8 A;  2X6X A;  3VMW A;  1O8K A;  4MR0 A;  1O8D A;  1K5C A;  1OGM X;  4YEL A;  3B4N A;  1O8L A;  2PYG A;  4EW9 A; 
#chains in the Genus database with same CATH topology
 4KH3 A;  1O8I A;  4W8Q A;  4XNF A;  4YFO A;  5C1E A;  1NHC A;  2PYH A;  2BM6 A;  2X85 A;  3BH6 B;  4XL9 A;  2NTQ A;  3SZE A;  1O8J A;  2UVF A;  1EA0 A;  4XN0 A;  3T9G A;  2VBM A;  3LMW A;  1WMR A;  4XKW A;  4NK8 A;  1KCD A;  1QRB A;  2X6W A;  1O8H A;  2IQ7 A;  2X3H A;  3JUR A;  2INU A;  3DU1 X;  4OZY A;  4V02 C;  2O6W A;  2QYU A;  3NB2 A;  4I84 A;  1L1I A;  1JRG A;  4OJP A;  1JTA A;  2XT2 A;  5C1C A;  2O1D A;  2IOU G;  1KCC A;  1O8E A;  3P4G A;  1PE9 A;  2NTP A;  3KRG A;  1OFD A;  2BSP A;  2F3L A;  2J8I A;  2Z8G A;  4XN3 A;  1K8F A;  2NTB A;  3VST A;  1TYU A;  2NT9 A;  4YEI A;  1OOC A;  1QA3 A;  3N90 A;  1BN8 A;  1RWR A;  2QY1 A;  2BM4 A;  1KQ5 A;  3H09 A;  1H80 A;  1TYW A;  1VBL A;  2J8K A;  2XT4 A;  3EQN A;  3SYJ A;  2XTX A;  2VBE A;  3GQ8 A;  1LLW A;  1QQ1 A;  1QCX A;  4OM9 A;  1IDK A;  4XLF A;  2QZA A;  1CZF A;  1AIR A;  3FY3 A;  3LJY A;  4PMH A;  4URR A;  4XOP A;  4YDT A;  3RIQ A;  1QA2 A;  2BM7 A;  1IB4 A;  3PSZ A;  3VSU A;  1WXR A;  2W7Z A;  1O88 A;  4Z03 A;  2NT6 A;  2VBK A;  1DBO A;  4MXN A;  2INV A;  2NZM A;  3TH0 A;  1QJV A;  4XLA A;  1IA5 A;  4C2L A;  2VFN A;  4YZ0 A;  2UVE A;  2V5I A;  2X6Y A;  1O8F A;  3GQ9 A;  4YC5 A;  2VFQ A;  1OFL A;  3JX8 A;  1LLZ A;  4XLE A;  2YUH A;  2QXZ A;  4YZA A;  5JMC B;  1QRC A;  1X0C A;  1O8G A;  4YEJ A;  1EE6 A;  1PLU A;  2B0R A;  2VFP A;  2BM5 A;  2O0V A;  3NAW A;  3SUC A;  3ML3 A;  4JRA C;  1TYV A;  3B8Y A;  4AVZ A;  3ZPP A;  1XG2 A;  2G0Y A;  2VJJ A;  4NK6 A;  2VJI A;  2NST A;  2NSP A;  3UW0 A;  3VMV A;  4OJ5 A;  1PXZ A;  4U49 A;  3GRH A;  4U4B A;  1CLW A;  4OZZ A;  3N6Z A;  2XTY A;  4OJO A;  5AMV A;  5JLV C;  3GQ7 A;  4XOR A;  3VSV A;  1QA1 A;  3AK5 A;  3PSS A;  1OFM A;  2PEC A;  4YZQ A;  1TYX A;  3EQO A;  4XM3 A;  4YZX A;  4W8T A;  1KTW A;  4W8R A;  4YCQ A;  4XQF A;  2O17 A;  3B90 A;  4XMY A;  1EZG A;  1IDJ A;  4XOT A;  5DNS A;  3SQV A;  1BHE A;  1DAB A;  3GQA A;  1RU4 A;  1LM1 A;  4OJL A;  4XR6 A;  2QX3 A;  1O8M A;  2XTW A;  1OGO X;  4XKV A;  3PET A;  4OJ6 A;  4Z06 A;  4Z05 A;  3BH7 B;  1RMG A;  4XLC A;  1TSP A;  2ODL A;  2XC1 A;  1GQ8 A;  1K4Z A;  4W8S A;  2EWE A;  2O0W A;  4XON A;  4OPW A;  3WWG A;  3SY2 A;  1DBG A;  4XLH A;  2O04 A;  4HWV A;  3ZSC A;  1HG8 A;  3LYC A;  2VFO A;  2X6X A;  3VMW A;  1O8K A;  2VFM A;  4MR0 A;  2BX6 A;  1OFE A;  1O8D A;  1K5C A;  1OGM X;  4YEL A;  3B4N A;  1O8L A;  2PYG A;  1HF2 A;  4EW9 A; 
#chains in the Genus database with same CATH homology
 4W8Q A;  1O8I A;  4XNF A;  5C1E A;  1NHC A;  2PYH A;  2X85 A;  4XL9 A;  2NTQ A;  1O8J A;  2UVF A;  4XN0 A;  3T9G A;  2VBM A;  3LMW A;  1WMR A;  4XKW A;  4NK8 A;  1KCD A;  2X6W A;  1O8H A;  2IQ7 A;  2X3H A;  3JUR A;  2INU A;  4OZY A;  4I84 A;  1JRG A;  4OJP A;  1JTA A;  5C1C A;  2O1D A;  1KCC A;  1O8E A;  1PE9 A;  2NTP A;  3KRG A;  2BSP A;  2Z8G A;  4XN3 A;  2NTB A;  3VST A;  2NT9 A;  1OOC A;  1BN8 A;  1RWR A;  2QY1 A;  1H80 A;  1VBL A;  3EQN A;  2VBE A;  3GQ8 A;  1QCX A;  1IDK A;  4XLF A;  1CZF A;  1AIR A;  3FY3 A;  4PMH A;  4URR A;  4XOP A;  1IB4 A;  3VSU A;  1O88 A;  4Z03 A;  2NT6 A;  2VBK A;  1DBO A;  4MXN A;  2INV A;  2NZM A;  1QJV A;  4XLA A;  1IA5 A;  4C2L A;  4YZ0 A;  2UVE A;  2X6Y A;  3GQ9 A;  1O8F A;  4YZA A;  1OFL A;  4XLE A;  2QXZ A;  1X0C A;  1O8G A;  4YEJ A;  1EE6 A;  1PLU A;  3SUC A;  2O0V A;  3B8Y A;  4AVZ A;  3ZPP A;  1XG2 A;  2VJJ A;  4NK6 A;  2VJI A;  2NST A;  2NSP A;  3UW0 A;  3VMV A;  4OJ5 A;  1PXZ A;  4U49 A;  3GRH A;  4U4B A;  4OZZ A;  4OJO A;  5AMV A;  3GQ7 A;  4XOR A;  3VSV A;  1OFM A;  2PEC A;  4YZQ A;  3EQO A;  4XM3 A;  4YZX A;  4W8T A;  1KTW A;  4W8R A;  4XQF A;  2O17 A;  3B90 A;  4XMY A;  1IDJ A;  4XOT A;  1BHE A;  3GQA A;  1RU4 A;  4OJL A;  4XR6 A;  2QX3 A;  1O8M A;  1OGO X;  4XKV A;  4OJ6 A;  4Z06 A;  4Z05 A;  1RMG A;  4XLC A;  2ODL A;  4W8S A;  1GQ8 A;  2EWE A;  2O0W A;  4XON A;  3WWG A;  1DBG A;  4XLH A;  2O04 A;  4HWV A;  3ZSC A;  1HG8 A;  2X6X A;  3VMW A;  1O8K A;  4MR0 A;  1O8D A;  1K5C A;  1OGM X;  4YEL A;  3B4N A;  1O8L A;  2PYG A;  4EW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...