1O8MA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with no ca2+ added
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 136
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8mA00
4Z03A 3FY3A 1IDJA 1X0CA 4OJLA 2VJJA 3UW0A 3JURA 2X85A 3B90A 1O8LA 4W8RA 4XM3A 4XR6A 1OGMX 4OZZA 4W8TA 2VBMA 1DBOA 1O8EA 1JRGA 4NK8A 2O1DA 1OOCA 4YZXA 1OGOX 2X6YA 2NZMA 1O8GA 2PYGA 2NT9A 2VBEA 1RU4A 3GQ8A 4XLAA 3VMWA 4C2LA 1JTAA 1O8IA 2NTBA 2O0WA 4NK6A 3EQOA 1HG8A 4XORA 1PE9A 1XG2A 4XLFA 2NTQA 1PXZA 2PECA 4U49A 2INUA 3GQAA 2X6WA 1QJVA 4Z05A 2ODLA 4YEJA 3GQ7A 4OJ5A 1RWRA 1O8HA 2UVFA 4URRA 4YZQA 1KTWA 4OJ6A 4YELA 2INVA 4MR0A 4YZAA 1IDKA 1OFLA 4PMHA 2NSPA 1VBLA 1GQ8A 3ZPPA 1DBGA 3T9GA 1O8KA 1RMGA 4OZYA 3ZSCA 4XOPA 2NT6A 2NTPA 4W8SA 4XONA 1EE6A 3EQNA 1O8JA 1K5CA 4YZ0A 4XLCA 4XL9A 2Z8GA 3GRHA 3SUCA 1IB4A 5C1CA 2VBKA 4EW9A 3VSVA 4HWVA 4Z06A 2EWEA 1IA5A 2O04A 1NHCA 1KCDA 1H80A 2O17A 2QXZA 3B4NA 3VSTA 1KCCA 4XKWA 1CZFA 4XOTA 2QY1A 3KRGA 4XNFA 4W8QA 1BN8A 4U4BA 1WMRA 1BHEA 1O88A 4XMYA 4XN0A 4XQFA 1PLUA 1AIRA 1OFMA 2NSTA 2O0VA 3LMWA 5C1EA 3B8YA 1O8FA 2UVEA 2BSPA 2QX3A 2VJIA 4AVZA 1QCXA 5AMVA 4I84A 4XN3A 2PYHA 1O8MA 3WWGA 4XLEA 4XLHA 4OJOA 2IQ7A 1O8DA 2X3HA 3VSUA 4OJPA 4XKVA 4MXNA 3GQ9A 2X6XA 3VMVA
chains in the Genus database with same CATH superfamily
4YFOA 4Z03A 3FY3A 1IDJA 1X0CA 4OJLA 2VJJA 3UW0A 3JURA 1KQ5A 2X85A 2YUHA 1O8LA 3B90A 4W8RA 4XM3A 4XR6A 1OGMX 2BM5A 1TYUA 2J8KA 3N90A 4OZZA 4YCQA 2BM6A 4W8TA 3H09A 2VBMA 3NAWA 1DBOA 3LYCA 3RIQA 1QA3A 1O8EA 1JRGA 4NK8A 2O1DA 1OOCA 4YZXA 3LJYA 1CLWA 1EA0A 1OGOX 2X6YA 2F3LA 2NZMA 1O8GA 2PYGA 2NT9A 1RU4A 2VBEA 3GQ8A 2J8IA 4XLAA 3VMWA 1JTAA 1O8IA 4C2LA 2NTBA 2O0WA 4NK6A 3EQOA 1HG8A 3ML3A 4XORA 1PE9A 1XG2A 4XLFA 5JLVC 1LM1A 1PXZA 2NTQA 2PECA 4U49A 2O6WA 3NB2A 2INUA 3GQAA 2X6WA 1QJVA 2BM4A 4Z05A 1TYWA 2ODLA 4YEJA 3GQ7A 4OJ5A 3JX8A 1RWRA 1TYXA 1OFEA 1LLWA 1O8HA 2UVFA 4URRA 5DNSA 4YZQA 1KTWA 4OJ6A 4YELA 4YC5A 2INVA 1TYVA 4MR0A 3P4GA 1IDKA 1OFLA 1OFDA 3BH7B 4PMHA 4YZAA 3SQVA 2VFQA 2NSPA 1HF2A 1VBLA 1GQ8A 4V02C 1EZGA 3ZPPA 1DBGA 3T9GA 4JRAC 1O8KA 3BH6B 3DU1X 1RMGA 2IOUG 1QRCA 4OZYA 4XOPA 3ZSCA 2NT6A 1L1IA 2NTPA 1LLZA 4W8SA 2G0YA 2VFPA 3PSSA 3SYJA 4XONA 1EE6A 2XTYA 3EQNA 1O8JA 1K5CA 4YZ0A 4XLCA 4XL9A 2Z8GA 2XC1A 3GRHA 3SUCA 1IB4A 5C1CA 2VBKA 1QA1A 4EW9A 3VSVA 4HWVA 1QA2A 4Z06A 2EWEA 2BM7A 2VFOA 3PSZA 1IA5A 2O04A 1NHCA 1KCDA 1H80A 2O17A 2QXZA 3B4NA 4OPWA 1QQ1A 3SY2A 2VFMA 3VSTA 1KCCA 4XKWA 2W7ZA 1CZFA 4XOTA 2QY1A 3KRGA 4XNFA 4W8QA 2QZAA 1BN8A 2VFNA 1WMRA 1BHEA 4U4BA 1O88A 2XT4A 5JMCB 4XMYA 4OM9A 4XN0A 4XQFA 1PLUA 1AIRA 1TSPA 1OFMA 2B0RA 2NSTA 2O0VA 3LMWA 2XTWA 5C1EA 2XTXA 3B8YA 1O8FA 2BX6A 2UVEA 1K4ZA 2BSPA 2QX3A 2VJIA 4AVZA 1QCXA 5AMVA 4I84A 4XN3A 2PYHA 1O8MA 3TH0A 3WWGA 4XLEA 3N6ZA 1WXRA 4XLHA 4OJOA 2IQ7A 3SZEA 4YEIA 1O8DA 2QYUA 2XT2A 1K8FA 2X3HA 4YDTA 3VSUA 2V5IA 4OJPA 1DABA 3AK5A 4XKVA 4KH3A 3PETA 4MXNA 3GQ9A 2X6XA 1QRBA 3VMVA
chains in the Genus database with same CATH topology
4Z03A 3FY3A 1IDJA 1X0CA 4OJLA 2VJJA 3UW0A 3JURA 2X85A 3B90A 1O8LA 4W8RA 4XM3A 4XR6A 1OGMX 4OZZA 4W8TA 2VBMA 1DBOA 1O8EA 1JRGA 4NK8A 2O1DA 1OOCA 4YZXA 1OGOX 2X6YA 2NZMA 1O8GA 2PYGA 2NT9A 2VBEA 1RU4A 3GQ8A 4XLAA 3VMWA 4C2LA 1JTAA 1O8IA 2NTBA 2O0WA 4NK6A 3EQOA 1HG8A 4XORA 1PE9A 1XG2A 4XLFA 2NTQA 1PXZA 2PECA 4U49A 2INUA 3GQAA 2X6WA 1QJVA 4Z05A 2ODLA 4YEJA 3GQ7A 4OJ5A 1RWRA 1O8HA 2UVFA 4URRA 4YZQA 1KTWA 4OJ6A 4YELA 2INVA 4MR0A 4YZAA 1IDKA 1OFLA 4PMHA 2NSPA 1VBLA 1GQ8A 3ZPPA 1DBGA 3T9GA 1O8KA 1RMGA 4OZYA 3ZSCA 4XOPA 2NT6A 2NTPA 4W8SA 4XONA 1EE6A 3EQNA 1O8JA 1K5CA 4YZ0A 4XLCA 4XL9A 2Z8GA 3GRHA 3SUCA 1IB4A 5C1CA 2VBKA 4EW9A 3VSVA 4HWVA 4Z06A 2EWEA 1IA5A 2O04A 1NHCA 1KCDA 1H80A 2O17A 2QXZA 3B4NA 3VSTA 1KCCA 4XKWA 1CZFA 4XOTA 2QY1A 3KRGA 4XNFA 4W8QA 1BN8A 4U4BA 1WMRA 1BHEA 1O88A 4XMYA 4XN0A 4XQFA 1PLUA 1AIRA 1OFMA 2NSTA 2O0VA 3LMWA 5C1EA 3B8YA 1O8FA 2UVEA 2BSPA 2QX3A 2VJIA 4AVZA 1QCXA 5AMVA 4I84A 4XN3A 2PYHA 1O8MA 3WWGA 4XLEA 4XLHA 4OJOA 2IQ7A 1O8DA 2X3HA 3VSUA 4OJPA 4XKVA 4MXNA 3GQ9A 2X6XA 3VMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z03 A;  3FY3 A;  1IDJ A;  1X0C A;  4OJL A;  2VJJ A;  3UW0 A;  3JUR A;  2X85 A;  3B90 A;  1O8L A;  4W8R A;  4XM3 A;  4XR6 A;  1OGM X;  4OZZ A;  4W8T A;  2VBM A;  1DBO A;  1O8E A;  1JRG A;  4NK8 A;  2O1D A;  1OOC A;  4YZX A;  1OGO X;  2X6Y A;  2NZM A;  1O8G A;  2PYG A;  2NT9 A;  2VBE A;  1RU4 A;  3GQ8 A;  4XLA A;  3VMW A;  4C2L A;  1JTA A;  1O8I A;  2NTB A;  2O0W A;  4NK6 A;  3EQO A;  1HG8 A;  4XOR A;  1PE9 A;  1XG2 A;  4XLF A;  2NTQ A;  1PXZ A;  2PEC A;  4U49 A;  2INU A;  3GQA A;  2X6W A;  1QJV A;  4Z05 A;  2ODL A;  4YEJ A;  3GQ7 A;  4OJ5 A;  1RWR A;  1O8H A;  2UVF A;  4URR A;  4YZQ A;  1KTW A;  4OJ6 A;  4YEL A;  2INV A;  4MR0 A;  4YZA A;  1IDK A;  1OFL A;  4PMH A;  2NSP A;  1VBL A;  1GQ8 A;  3ZPP A;  1DBG A;  3T9G A;  1O8K A;  1RMG A;  4OZY A;  3ZSC A;  4XOP A;  2NT6 A;  2NTP A;  4W8S A;  4XON A;  1EE6 A;  3EQN A;  1O8J A;  1K5C A;  4YZ0 A;  4XLC A;  4XL9 A;  2Z8G A;  3GRH A;  3SUC A;  1IB4 A;  5C1C A;  2VBK A;  4EW9 A;  3VSV A;  4HWV A;  4Z06 A;  2EWE A;  1IA5 A;  2O04 A;  1NHC A;  1KCD A;  1H80 A;  2O17 A;  2QXZ A;  3B4N A;  3VST A;  1KCC A;  4XKW A;  1CZF A;  4XOT A;  2QY1 A;  3KRG A;  4XNF A;  4W8Q A;  1BN8 A;  4U4B A;  1WMR A;  1BHE A;  1O88 A;  4XMY A;  4XN0 A;  4XQF A;  1PLU A;  1AIR A;  1OFM A;  2NST A;  2O0V A;  3LMW A;  5C1E A;  3B8Y A;  1O8F A;  2UVE A;  2BSP A;  2QX3 A;  2VJI A;  4AVZ A;  1QCX A;  5AMV A;  4I84 A;  4XN3 A;  2PYH A;  1O8M A;  3WWG A;  4XLE A;  4XLH A;  4OJO A;  2IQ7 A;  1O8D A;  2X3H A;  3VSU A;  4OJP A;  4XKV A;  4MXN A;  3GQ9 A;  2X6X A;  3VMV A; 
#chains in the Genus database with same CATH topology
 4YFO A;  4Z03 A;  3FY3 A;  1IDJ A;  1X0C A;  4OJL A;  2VJJ A;  3UW0 A;  3JUR A;  1KQ5 A;  2X85 A;  2YUH A;  1O8L A;  3B90 A;  4W8R A;  4XM3 A;  4XR6 A;  1OGM X;  2BM5 A;  1TYU A;  2J8K A;  3N90 A;  4OZZ A;  4YCQ A;  2BM6 A;  4W8T A;  3H09 A;  2VBM A;  3NAW A;  1DBO A;  3LYC A;  3RIQ A;  1QA3 A;  1O8E A;  1JRG A;  4NK8 A;  2O1D A;  1OOC A;  4YZX A;  3LJY A;  1CLW A;  1EA0 A;  1OGO X;  2X6Y A;  2F3L A;  2NZM A;  1O8G A;  2PYG A;  2NT9 A;  1RU4 A;  2VBE A;  3GQ8 A;  2J8I A;  4XLA A;  3VMW A;  1JTA A;  1O8I A;  4C2L A;  2NTB A;  2O0W A;  4NK6 A;  3EQO A;  1HG8 A;  3ML3 A;  4XOR A;  1PE9 A;  1XG2 A;  4XLF A;  5JLV C;  1LM1 A;  1PXZ A;  2NTQ A;  2PEC A;  4U49 A;  2O6W A;  3NB2 A;  2INU A;  3GQA A;  2X6W A;  1QJV A;  2BM4 A;  4Z05 A;  1TYW A;  2ODL A;  4YEJ A;  3GQ7 A;  4OJ5 A;  3JX8 A;  1RWR A;  1TYX A;  1OFE A;  1LLW A;  1O8H A;  2UVF A;  4URR A;  5DNS A;  4YZQ A;  1KTW A;  4OJ6 A;  4YEL A;  4YC5 A;  2INV A;  1TYV A;  4MR0 A;  3P4G A;  1IDK A;  1OFL A;  1OFD A;  3BH7 B;  4PMH A;  4YZA A;  3SQV A;  2VFQ A;  2NSP A;  1HF2 A;  1VBL A;  1GQ8 A;  4V02 C;  1EZG A;  3ZPP A;  1DBG A;  3T9G A;  4JRA C;  1O8K A;  3BH6 B;  3DU1 X;  1RMG A;  2IOU G;  1QRC A;  4OZY A;  4XOP A;  3ZSC A;  2NT6 A;  1L1I A;  2NTP A;  1LLZ A;  4W8S A;  2G0Y A;  2VFP A;  3PSS A;  3SYJ A;  4XON A;  1EE6 A;  2XTY A;  3EQN A;  1O8J A;  1K5C A;  4YZ0 A;  4XLC A;  4XL9 A;  2Z8G A;  2XC1 A;  3GRH A;  3SUC A;  1IB4 A;  5C1C A;  2VBK A;  1QA1 A;  4EW9 A;  3VSV A;  4HWV A;  1QA2 A;  4Z06 A;  2EWE A;  2BM7 A;  2VFO A;  3PSZ A;  1IA5 A;  2O04 A;  1NHC A;  1KCD A;  1H80 A;  2O17 A;  2QXZ A;  3B4N A;  4OPW A;  1QQ1 A;  3SY2 A;  2VFM A;  3VST A;  1KCC A;  4XKW A;  2W7Z A;  1CZF A;  4XOT A;  2QY1 A;  3KRG A;  4XNF A;  4W8Q A;  2QZA A;  1BN8 A;  2VFN A;  1WMR A;  1BHE A;  4U4B A;  1O88 A;  2XT4 A;  5JMC B;  4XMY A;  4OM9 A;  4XN0 A;  4XQF A;  1PLU A;  1AIR A;  1TSP A;  1OFM A;  2B0R A;  2NST A;  2O0V A;  3LMW A;  2XTW A;  5C1E A;  2XTX A;  3B8Y A;  1O8F A;  2BX6 A;  2UVE A;  1K4Z A;  2BSP A;  2QX3 A;  2VJI A;  4AVZ A;  1QCX A;  5AMV A;  4I84 A;  4XN3 A;  2PYH A;  1O8M A;  3TH0 A;  3WWG A;  4XLE A;  3N6Z A;  1WXR A;  4XLH A;  4OJO A;  2IQ7 A;  3SZE A;  4YEI A;  1O8D A;  2QYU A;  2XT2 A;  1K8F A;  2X3H A;  4YDT A;  3VSU A;  2V5I A;  4OJP A;  1DAB A;  3AK5 A;  4XKV A;  4KH3 A;  3PET A;  4MXN A;  3GQ9 A;  2X6X A;  1QRB A;  3VMV A; 
#chains in the Genus database with same CATH homology
 4Z03 A;  3FY3 A;  1IDJ A;  1X0C A;  4OJL A;  2VJJ A;  3UW0 A;  3JUR A;  2X85 A;  3B90 A;  1O8L A;  4W8R A;  4XM3 A;  4XR6 A;  1OGM X;  4OZZ A;  4W8T A;  2VBM A;  1DBO A;  1O8E A;  1JRG A;  4NK8 A;  2O1D A;  1OOC A;  4YZX A;  1OGO X;  2X6Y A;  2NZM A;  1O8G A;  2PYG A;  2NT9 A;  2VBE A;  1RU4 A;  3GQ8 A;  4XLA A;  3VMW A;  4C2L A;  1JTA A;  1O8I A;  2NTB A;  2O0W A;  4NK6 A;  3EQO A;  1HG8 A;  4XOR A;  1PE9 A;  1XG2 A;  4XLF A;  2NTQ A;  1PXZ A;  2PEC A;  4U49 A;  2INU A;  3GQA A;  2X6W A;  1QJV A;  4Z05 A;  2ODL A;  4YEJ A;  3GQ7 A;  4OJ5 A;  1RWR A;  1O8H A;  2UVF A;  4URR A;  4YZQ A;  1KTW A;  4OJ6 A;  4YEL A;  2INV A;  4MR0 A;  4YZA A;  1IDK A;  1OFL A;  4PMH A;  2NSP A;  1VBL A;  1GQ8 A;  3ZPP A;  1DBG A;  3T9G A;  1O8K A;  1RMG A;  4OZY A;  3ZSC A;  4XOP A;  2NT6 A;  2NTP A;  4W8S A;  4XON A;  1EE6 A;  3EQN A;  1O8J A;  1K5C A;  4YZ0 A;  4XLC A;  4XL9 A;  2Z8G A;  3GRH A;  3SUC A;  1IB4 A;  5C1C A;  2VBK A;  4EW9 A;  3VSV A;  4HWV A;  4Z06 A;  2EWE A;  1IA5 A;  2O04 A;  1NHC A;  1KCD A;  1H80 A;  2O17 A;  2QXZ A;  3B4N A;  3VST A;  1KCC A;  4XKW A;  1CZF A;  4XOT A;  2QY1 A;  3KRG A;  4XNF A;  4W8Q A;  1BN8 A;  4U4B A;  1WMR A;  1BHE A;  1O88 A;  4XMY A;  4XN0 A;  4XQF A;  1PLU A;  1AIR A;  1OFM A;  2NST A;  2O0V A;  3LMW A;  5C1E A;  3B8Y A;  1O8F A;  2UVE A;  2BSP A;  2QX3 A;  2VJI A;  4AVZ A;  1QCX A;  5AMV A;  4I84 A;  4XN3 A;  2PYH A;  1O8M A;  3WWG A;  4XLE A;  4XLH A;  4OJO A;  2IQ7 A;  1O8D A;  2X3H A;  3VSU A;  4OJP A;  4XKV A;  4MXN A;  3GQ9 A;  2X6X A;  3VMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...