1O8MA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with no ca2+ added
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 136
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8mA00
2EWEA 1RU4A 2X85A 4XONA 2X3HA 4XLCA 3VMVA 1O8EA 4YZXA 2X6WA 3B4NA 3GQ8A 4OJ5A 2NZMA 1BN8A 1O8IA 2INUA 1O8LA 4HWVA 3UW0A 1JRGA 3B8YA 4YZAA 1IDKA 3WWGA 4OZZA 4EW9A 1K5CA 1O8FA 2NSTA 4AVZA 4XLAA 4XKVA 1GQ8A 4U49A 1DBOA 2UVFA 2NTPA 3LMWA 1EE6A 2VBMA 2NT9A 3SUCA 2X6XA 3EQOA 4XKWA 2ODLA 1OGOX 4XN3A 3ZSCA 2VBEA 5AMVA 2NSPA 4XM3A 1DBGA 1AIRA 3B90A 4U4BA 4XL9A 4I84A 4XLHA 1H80A 1O8MA 3VSUA 2INVA 1OFMA 4YELA 4XN0A 4Z05A 2O17A 4XOTA 2IQ7A 1OGMX 2VBKA 2O04A 2PYGA 4YEJA 1KTWA 1RMGA 1PLUA 2Z8GA 1CZFA 1O8JA 3GQ7A 1O8GA 1OOCA 4OJLA 2X6YA 1X0CA 5C1EA 4XORA 3GQ9A 4XLFA 1IB4A 1BHEA 4Z03A 2NT6A 4W8TA 3FY3A 3VMWA 1KCDA 1O8KA 2QXZA 2PECA 4OJOA 3VSTA 1IDJA 2VJJA 3EQNA 1O8DA 3ZPPA 2QY1A 1QCXA 4URRA 3VSVA 4OJPA 2O0WA 5C1CA 4W8RA 1WMRA 4YZ0A 1IA5A 4XNFA 2PYHA 4OJ6A 2NTQA 1RWRA 3T9GA 3GRHA 4XR6A 4C2LA 1KCCA 4XQFA 4W8QA 2NTBA 2O0VA 1O8HA 2UVEA 4MR0A 4XMYA 1HG8A 1PXZA 3GQAA 2BSPA 1OFLA 1XG2A 1VBLA 3KRGA 4W8SA 4XOPA 4Z06A 4XLEA 2QX3A 1O88A 4NK6A 4YZQA 3JURA 4MXNA 1NHCA 1PE9A 4OZYA 4PMHA 1JTAA 1QJVA 2VJIA 4NK8A 2O1DA
chains in the Genus database with same CATH superfamily
2EWEA 1RU4A 2X85A 4XONA 1OFDA 2X3HA 4XLCA 2BM6A 3VMVA 2VFMA 1O8EA 4YZXA 2BX6A 2X6WA 3B4NA 3GQ8A 4OJ5A 2NZMA 1BN8A 1QA2A 2O6WA 3AK5A 4OM9A 1O8IA 2INUA 1O8LA 1TSPA 4HWVA 3UW0A 5JMCB 1JRGA 3B8YA 4YZAA 1IDKA 3WWGA 1QRCA 4OZZA 4EW9A 1K4ZA 1K5CA 1O8FA 1K8FA 1TYWA 2NSTA 3BH7B 4AVZA 4XLAA 4XKVA 1GQ8A 4U49A 3SQVA 2VFNA 2VFPA 3NAWA 2XT2A 2UVFA 2NTPA 3RIQA 3LMWA 1EE6A 4YFOA 2VBMA 2NT9A 3ML3A 3SUCA 2X6XA 3EQOA 4XKWA 2ODLA 3PETA 1OGOX 2G0YA 1KQ5A 2J8IA 1DABA 4XN3A 3ZSCA 2VBEA 5AMVA 1TYUA 2NSPA 4XM3A 1AIRA 1DBGA 3B90A 4U4BA 4XL9A 3LJYA 4I84A 3SYJA 3DU1X 4XLHA 1H80A 1O8MA 3BH6B 3VSUA 2INVA 3NB2A 1TYXA 1OFMA 2BM7A 4YELA 1HF2A 1LM1A 4XN0A 4Z05A 2O17A 1EZGA 3PSSA 4XOTA 2IQ7A 1OGMX 2VBKA 4KH3A 2XTYA 2O04A 2PYGA 4YEJA 1KTWA 1RMGA 1PLUA 2Z8GA 2QZAA 3H09A 1LLWA 3TH0A 2BM5A 1CZFA 1O8JA 3GQ7A 1O8GA 3SZEA 2BM4A 1OOCA 4OJLA 2X6YA 1X0CA 5C1EA 3LYCA 2VFQA 4XORA 4YDTA 3GQ9A 4XLFA 1IB4A 1BHEA 4Z03A 4YC5A 2NT6A 4W8TA 3FY3A 3VMWA 1KCDA 1O8KA 2QXZA 2PECA 4OJOA 3VSTA 1QA1A 1IDJA 2VJJA 2IOUG 3EQNA 1O8DA 1OFEA 2W7ZA 3ZPPA 4YCQA 2QY1A 1QCXA 4URRA 2V5IA 3VSVA 1L1IA 4OJPA 3N6ZA 4V02C 2XC1A 2O0WA 5C1CA 4W8RA 1WMRA 2YUHA 4YZ0A 1IA5A 2XTWA 4XNFA 2PYHA 2VJIA 4OJ6A 2NTQA 2QYUA 1RWRA 5DNSA 3GRHA 4XR6A 3T9GA 4OPWA 4C2LA 1KCCA 5JLVC 4XQFA 4W8QA 2NTBA 2O0VA 1O8HA 2UVEA 4JRAC 4MR0A 1LLZA 4XMYA 1WXRA 1HG8A 3N90A 4YEIA 1PXZA 1QA3A 1EA0A 2XT4A 1CLWA 1QRBA 1TYVA 2BSPA 1OFLA 1XG2A 3GQAA 1VBLA 3KRGA 4W8SA 4XOPA 4Z06A 2B0RA 2QX3A 1O88A 2XTXA 4NK6A 4XLEA 4YZQA 3JURA 3PSZA 4MXNA 1NHCA 3P4GA 1PE9A 3JX8A 2F3LA 2J8KA 4OZYA 2VFOA 1QQ1A 4PMHA 1JTAA 1QJVA 3SY2A 1DBOA 4NK8A 2O1DA
chains in the Genus database with same CATH topology
2EWEA 1RU4A 2X85A 4XONA 2X3HA 4XLCA 3VMVA 1O8EA 4YZXA 2X6WA 3B4NA 3GQ8A 4OJ5A 2NZMA 1BN8A 1O8IA 2INUA 1O8LA 4HWVA 3UW0A 1JRGA 3B8YA 4YZAA 1IDKA 3WWGA 4OZZA 4EW9A 1K5CA 1O8FA 2NSTA 4AVZA 4XLAA 4XKVA 1GQ8A 4U49A 1DBOA 2UVFA 2NTPA 3LMWA 1EE6A 2VBMA 2NT9A 3SUCA 2X6XA 3EQOA 4XKWA 2ODLA 1OGOX 4XN3A 3ZSCA 2VBEA 5AMVA 2NSPA 4XM3A 1DBGA 1AIRA 3B90A 4U4BA 4XL9A 4I84A 4XLHA 1H80A 1O8MA 3VSUA 2INVA 1OFMA 4YELA 4XN0A 4Z05A 2O17A 4XOTA 2IQ7A 1OGMX 2VBKA 2O04A 2PYGA 4YEJA 1KTWA 1RMGA 1PLUA 2Z8GA 1CZFA 1O8JA 3GQ7A 1O8GA 1OOCA 4OJLA 2X6YA 1X0CA 5C1EA 4XORA 3GQ9A 4XLFA 1IB4A 1BHEA 4Z03A 2NT6A 4W8TA 3FY3A 3VMWA 1KCDA 1O8KA 2QXZA 2PECA 4OJOA 3VSTA 1IDJA 2VJJA 3EQNA 1O8DA 3ZPPA 2QY1A 1QCXA 4URRA 3VSVA 4OJPA 2O0WA 5C1CA 4W8RA 1WMRA 4YZ0A 1IA5A 4XNFA 2PYHA 4OJ6A 2NTQA 1RWRA 3T9GA 3GRHA 4XR6A 4C2LA 1KCCA 4XQFA 4W8QA 2NTBA 2O0VA 1O8HA 2UVEA 4MR0A 4XMYA 1HG8A 1PXZA 3GQAA 2BSPA 1OFLA 1XG2A 1VBLA 3KRGA 4W8SA 4XOPA 4Z06A 4XLEA 2QX3A 1O88A 4NK6A 4YZQA 3JURA 4MXNA 1NHCA 1PE9A 4OZYA 4PMHA 1JTAA 1QJVA 2VJIA 4NK8A 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWE A;  1RU4 A;  2X85 A;  4XON A;  2X3H A;  4XLC A;  3VMV A;  1O8E A;  4YZX A;  2X6W A;  3B4N A;  3GQ8 A;  4OJ5 A;  2NZM A;  1BN8 A;  1O8I A;  2INU A;  1O8L A;  4HWV A;  3UW0 A;  1JRG A;  3B8Y A;  4YZA A;  1IDK A;  3WWG A;  4OZZ A;  4EW9 A;  1K5C A;  1O8F A;  2NST A;  4AVZ A;  4XLA A;  4XKV A;  1GQ8 A;  4U49 A;  1DBO A;  2UVF A;  2NTP A;  3LMW A;  1EE6 A;  2VBM A;  2NT9 A;  3SUC A;  2X6X A;  3EQO A;  4XKW A;  2ODL A;  1OGO X;  4XN3 A;  3ZSC A;  2VBE A;  5AMV A;  2NSP A;  4XM3 A;  1DBG A;  1AIR A;  3B90 A;  4U4B A;  4XL9 A;  4I84 A;  4XLH A;  1H80 A;  1O8M A;  3VSU A;  2INV A;  1OFM A;  4YEL A;  4XN0 A;  4Z05 A;  2O17 A;  4XOT A;  2IQ7 A;  1OGM X;  2VBK A;  2O04 A;  2PYG A;  4YEJ A;  1KTW A;  1RMG A;  1PLU A;  2Z8G A;  1CZF A;  1O8J A;  3GQ7 A;  1O8G A;  1OOC A;  4OJL A;  2X6Y A;  1X0C A;  5C1E A;  4XOR A;  3GQ9 A;  4XLF A;  1IB4 A;  1BHE A;  4Z03 A;  2NT6 A;  4W8T A;  3FY3 A;  3VMW A;  1KCD A;  1O8K A;  2QXZ A;  2PEC A;  4OJO A;  3VST A;  1IDJ A;  2VJJ A;  3EQN A;  1O8D A;  3ZPP A;  2QY1 A;  1QCX A;  4URR A;  3VSV A;  4OJP A;  2O0W A;  5C1C A;  4W8R A;  1WMR A;  4YZ0 A;  1IA5 A;  4XNF A;  2PYH A;  4OJ6 A;  2NTQ A;  1RWR A;  3T9G A;  3GRH A;  4XR6 A;  4C2L A;  1KCC A;  4XQF A;  4W8Q A;  2NTB A;  2O0V A;  1O8H A;  2UVE A;  4MR0 A;  4XMY A;  1HG8 A;  1PXZ A;  3GQA A;  2BSP A;  1OFL A;  1XG2 A;  1VBL A;  3KRG A;  4W8S A;  4XOP A;  4Z06 A;  4XLE A;  2QX3 A;  1O88 A;  4NK6 A;  4YZQ A;  3JUR A;  4MXN A;  1NHC A;  1PE9 A;  4OZY A;  4PMH A;  1JTA A;  1QJV A;  2VJI A;  4NK8 A;  2O1D A; 
#chains in the Genus database with same CATH topology
 2EWE A;  1RU4 A;  2X85 A;  4XON A;  1OFD A;  2X3H A;  4XLC A;  2BM6 A;  3VMV A;  2VFM A;  1O8E A;  4YZX A;  2BX6 A;  2X6W A;  3B4N A;  3GQ8 A;  4OJ5 A;  2NZM A;  1BN8 A;  1QA2 A;  2O6W A;  3AK5 A;  4OM9 A;  1O8I A;  2INU A;  1O8L A;  1TSP A;  4HWV A;  3UW0 A;  5JMC B;  1JRG A;  3B8Y A;  4YZA A;  1IDK A;  3WWG A;  1QRC A;  4OZZ A;  4EW9 A;  1K4Z A;  1K5C A;  1O8F A;  1K8F A;  1TYW A;  2NST A;  3BH7 B;  4AVZ A;  4XLA A;  4XKV A;  1GQ8 A;  4U49 A;  3SQV A;  2VFN A;  2VFP A;  3NAW A;  2XT2 A;  2UVF A;  2NTP A;  3RIQ A;  3LMW A;  1EE6 A;  4YFO A;  2VBM A;  2NT9 A;  3ML3 A;  3SUC A;  2X6X A;  3EQO A;  4XKW A;  2ODL A;  3PET A;  1OGO X;  2G0Y A;  1KQ5 A;  2J8I A;  1DAB A;  4XN3 A;  3ZSC A;  2VBE A;  5AMV A;  1TYU A;  2NSP A;  4XM3 A;  1AIR A;  1DBG A;  3B90 A;  4U4B A;  4XL9 A;  3LJY A;  4I84 A;  3SYJ A;  3DU1 X;  4XLH A;  1H80 A;  1O8M A;  3BH6 B;  3VSU A;  2INV A;  3NB2 A;  1TYX A;  1OFM A;  2BM7 A;  4YEL A;  1HF2 A;  1LM1 A;  4XN0 A;  4Z05 A;  2O17 A;  1EZG A;  3PSS A;  4XOT A;  2IQ7 A;  1OGM X;  2VBK A;  4KH3 A;  2XTY A;  2O04 A;  2PYG A;  4YEJ A;  1KTW A;  1RMG A;  1PLU A;  2Z8G A;  2QZA A;  3H09 A;  1LLW A;  3TH0 A;  2BM5 A;  1CZF A;  1O8J A;  3GQ7 A;  1O8G A;  3SZE A;  2BM4 A;  1OOC A;  4OJL A;  2X6Y A;  1X0C A;  5C1E A;  3LYC A;  2VFQ A;  4XOR A;  4YDT A;  3GQ9 A;  4XLF A;  1IB4 A;  1BHE A;  4Z03 A;  4YC5 A;  2NT6 A;  4W8T A;  3FY3 A;  3VMW A;  1KCD A;  1O8K A;  2QXZ A;  2PEC A;  4OJO A;  3VST A;  1QA1 A;  1IDJ A;  2VJJ A;  2IOU G;  3EQN A;  1O8D A;  1OFE A;  2W7Z A;  3ZPP A;  4YCQ A;  2QY1 A;  1QCX A;  4URR A;  2V5I A;  3VSV A;  1L1I A;  4OJP A;  3N6Z A;  4V02 C;  2XC1 A;  2O0W A;  5C1C A;  4W8R A;  1WMR A;  2YUH A;  4YZ0 A;  1IA5 A;  2XTW A;  4XNF A;  2PYH A;  2VJI A;  4OJ6 A;  2NTQ A;  2QYU A;  1RWR A;  5DNS A;  3GRH A;  4XR6 A;  3T9G A;  4OPW A;  4C2L A;  1KCC A;  5JLV C;  4XQF A;  4W8Q A;  2NTB A;  2O0V A;  1O8H A;  2UVE A;  4JRA C;  4MR0 A;  1LLZ A;  4XMY A;  1WXR A;  1HG8 A;  3N90 A;  4YEI A;  1PXZ A;  1QA3 A;  1EA0 A;  2XT4 A;  1CLW A;  1QRB A;  1TYV A;  2BSP A;  1OFL A;  1XG2 A;  3GQA A;  1VBL A;  3KRG A;  4W8S A;  4XOP A;  4Z06 A;  2B0R A;  2QX3 A;  1O88 A;  2XTX A;  4NK6 A;  4XLE A;  4YZQ A;  3JUR A;  3PSZ A;  4MXN A;  1NHC A;  3P4G A;  1PE9 A;  3JX8 A;  2F3L A;  2J8K A;  4OZY A;  2VFO A;  1QQ1 A;  4PMH A;  1JTA A;  1QJV A;  3SY2 A;  1DBO A;  4NK8 A;  2O1D A; 
#chains in the Genus database with same CATH homology
 2EWE A;  1RU4 A;  2X85 A;  4XON A;  2X3H A;  4XLC A;  3VMV A;  1O8E A;  4YZX A;  2X6W A;  3B4N A;  3GQ8 A;  4OJ5 A;  2NZM A;  1BN8 A;  1O8I A;  2INU A;  1O8L A;  4HWV A;  3UW0 A;  1JRG A;  3B8Y A;  4YZA A;  1IDK A;  3WWG A;  4OZZ A;  4EW9 A;  1K5C A;  1O8F A;  2NST A;  4AVZ A;  4XLA A;  4XKV A;  1GQ8 A;  4U49 A;  1DBO A;  2UVF A;  2NTP A;  3LMW A;  1EE6 A;  2VBM A;  2NT9 A;  3SUC A;  2X6X A;  3EQO A;  4XKW A;  2ODL A;  1OGO X;  4XN3 A;  3ZSC A;  2VBE A;  5AMV A;  2NSP A;  4XM3 A;  1DBG A;  1AIR A;  3B90 A;  4U4B A;  4XL9 A;  4I84 A;  4XLH A;  1H80 A;  1O8M A;  3VSU A;  2INV A;  1OFM A;  4YEL A;  4XN0 A;  4Z05 A;  2O17 A;  4XOT A;  2IQ7 A;  1OGM X;  2VBK A;  2O04 A;  2PYG A;  4YEJ A;  1KTW A;  1RMG A;  1PLU A;  2Z8G A;  1CZF A;  1O8J A;  3GQ7 A;  1O8G A;  1OOC A;  4OJL A;  2X6Y A;  1X0C A;  5C1E A;  4XOR A;  3GQ9 A;  4XLF A;  1IB4 A;  1BHE A;  4Z03 A;  2NT6 A;  4W8T A;  3FY3 A;  3VMW A;  1KCD A;  1O8K A;  2QXZ A;  2PEC A;  4OJO A;  3VST A;  1IDJ A;  2VJJ A;  3EQN A;  1O8D A;  3ZPP A;  2QY1 A;  1QCX A;  4URR A;  3VSV A;  4OJP A;  2O0W A;  5C1C A;  4W8R A;  1WMR A;  4YZ0 A;  1IA5 A;  4XNF A;  2PYH A;  4OJ6 A;  2NTQ A;  1RWR A;  3T9G A;  3GRH A;  4XR6 A;  4C2L A;  1KCC A;  4XQF A;  4W8Q A;  2NTB A;  2O0V A;  1O8H A;  2UVE A;  4MR0 A;  4XMY A;  1HG8 A;  1PXZ A;  3GQA A;  2BSP A;  1OFL A;  1XG2 A;  1VBL A;  3KRG A;  4W8S A;  4XOP A;  4Z06 A;  4XLE A;  2QX3 A;  1O88 A;  4NK6 A;  4YZQ A;  3JUR A;  4MXN A;  1NHC A;  1PE9 A;  4OZY A;  4PMH A;  1JTA A;  1QJV A;  2VJI A;  4NK8 A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...