1O8MA

Pectate lyase c from erwinia chrysanthemi at ph 4.5 with no ca2+ added
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization and Implications of Ca2+ Binding to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords PECTATE LYASE C
total genus 136
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1o8mA00
4XLHA 3VSVA 2PYGA 1NHCA 1KTWA 4XL9A 4W8RA 4NK6A 4W8SA 4OZYA 2X6WA 4W8QA 1IDJA 4XLEA 2PYHA 4XORA 4XLCA 1DBGA 2VBMA 3EQOA 3EQNA 1O8HA 1RWRA 1IA5A 1OGMX 3GQAA 4EW9A 4MXNA 1O8DA 1RU4A 2X6XA 4I84A 4XONA 2INVA 3FY3A 1HG8A 4W8TA 2NSTA 4XR6A 3VSTA 3WWGA 1QJVA 4NK8A 2NZMA 4YEJA 2NSPA 4YELA 1PE9A 2QXZA 5AMVA 2X85A 1BHEA 4YZQA 4XQFA 4U4BA 4U49A 4XN3A 1WMRA 2BSPA 4XOTA 3VMWA 2O17A 2O04A 1OOCA 3GQ9A 4XKVA 2NT9A 5C1CA 2X6YA 1O8KA 3VMVA 1O8IA 2O0WA 4URRA 3B4NA 2QX3A 4XLAA 2VBKA 3B8YA 2UVFA 1OGOX 2INUA 1H80A 2QY1A 1EE6A 4OJLA 4XOPA 1VBLA 1O8EA 2NT6A 4AVZA 1KCCA 4XM3A 3T9GA 2VBEA 1O88A 1O8GA 1GQ8A 4XKWA 1O8JA 4XNFA 1OFLA 2EWEA 2PECA 4PMHA 3SUCA 1DBOA 2NTQA 4YZ0A 2X3HA 1O8FA 2Z8GA 3VSUA 2NTPA 4Z06A 1K5CA 1RMGA 2IQ7A 2UVEA 3KRGA 1OFMA 3GRHA 1BN8A 2VJIA 3GQ8A 2O0VA 4OZZA 1AIRA 3GQ7A 1XG2A 3ZPPA 1O8LA 3B90A 4YZXA 2ODLA 2NTBA 3LMWA 1JRGA 1O8MA 4OJPA 1QCXA 1IB4A 1CZFA 3JURA 4C2LA 4YZAA 4Z03A 1KCDA 1PLUA 1X0CA 4XMYA 4OJOA 4Z05A 4XLFA 1PXZA 4OJ5A 2O1DA 2VJJA 4XN0A 4MR0A 1IDKA 4OJ6A 4HWVA 3ZSCA 1JTAA 5C1EA 3UW0A
chains in the Genus database with same CATH superfamily
2V5IA 4XLHA 1TYWA 3VSVA 2PYGA 2VFOA 2VFPA 1NHCA 1KTWA 1KQ5A 4XL9A 4W8RA 1QRCA 4NK6A 1K8FA 4OZYA 4W8SA 3SQVA 2X6WA 2BM5A 3H09A 4W8QA 1IDJA 4XLEA 2PYHA 1QRBA 4XORA 1TYUA 4XLCA 1DBGA 1LLWA 2VBMA 3EQOA 3EQNA 1O8HA 1RWRA 1LLZA 1IA5A 1EZGA 1OGMX 3GQAA 4EW9A 1HF2A 4YC5A 3DU1X 4MXNA 4YCQA 1O8DA 1RU4A 2X6XA 4I84A 1QA2A 4XONA 2INVA 3FY3A 1HG8A 4W8TA 2NSTA 2W7ZA 2B0RA 3RIQA 4XR6A 3VSTA 3WWGA 1QJVA 4NK8A 2BM7A 2NZMA 4YEJA 3BH6B 2NSPA 4YELA 1PE9A 2XTWA 3SZEA 2QXZA 5AMVA 2XTYA 2X85A 1BHEA 4YZQA 4KH3A 2VFQA 4XQFA 4U4BA 4U49A 4XN3A 3LJYA 1WMRA 2BSPA 4XOTA 1OFDA 2O17A 3VMWA 2O04A 1OOCA 2XT4A 2YUHA 3GQ9A 1OFEA 4XKVA 2NT9A 4YDTA 5C1CA 2X6YA 1O8KA 3VMVA 1O8IA 1TYXA 2O0WA 2BM4A 4URRA 3B4NA 2QX3A 3NAWA 3PSZA 4XLAA 2VBKA 3B8YA 2UVFA 1OGOX 2INUA 1H80A 2QY1A 1EE6A 1CLWA 4JRAC 4OJLA 3NB2A 2XTXA 4XOPA 3SY2A 2G0YA 5JLVC 1VBLA 1O8EA 4YEIA 2NT6A 1QQ1A 4AVZA 4XM3A 1KCCA 3T9GA 1K4ZA 3BH7B 1LM1A 2VBEA 4OM9A 2VFNA 1O88A 1O8GA 2VFMA 1GQ8A 4XKWA 2J8KA 1DABA 1QA1A 1O8JA 1TSPA 4XNFA 1OFLA 2EWEA 2PECA 2O6WA 3PSSA 1DBOA 2NTQA 4PMHA 2X3HA 3SUCA 3UW0A 4YZ0A 1O8FA 2Z8GA 3AK5A 3VSUA 2NTPA 4Z06A 1K5CA 1RMGA 2IQ7A 2UVEA 2F3LA 3KRGA 3P4GA 3TH0A 1OFMA 2BX6A 4YFOA 3GRHA 1BN8A 3PETA 2VJIA 3GQ8A 2O0VA 4OZZA 3N6ZA 1AIRA 2XT2A 3GQ7A 1XG2A 4V02C 3ZPPA 1O8LA 5JMCB 3B90A 4YZXA 2ODLA 2NTBA 3LMWA 3ML3A 3JX8A 1JRGA 1O8MA 4OJPA 2IOUG 1EA0A 1QCXA 1IB4A 1TYVA 1CZFA 3JURA 1QA3A 4C2LA 3SYJA 1WXRA 4YZAA 4Z03A 1KCDA 1PLUA 1X0CA 3LYCA 4OJOA 4XMYA 2QZAA 4XLFA 5DNSA 4Z05A 1PXZA 2BM6A 2O1DA 4OJ5A 2VJJA 4XN0A 2QYUA 2J8IA 3N90A 2XC1A 1L1IA 4MR0A 1IDKA 4OJ6A 4HWVA 3ZSCA 1JTAA 5C1EA 4OPWA
chains in the Genus database with same CATH topology
4XLHA 3VSVA 2PYGA 1NHCA 1KTWA 4XL9A 4W8RA 4NK6A 4W8SA 4OZYA 2X6WA 4W8QA 1IDJA 4XLEA 2PYHA 4XORA 4XLCA 1DBGA 2VBMA 3EQOA 3EQNA 1O8HA 1RWRA 1IA5A 1OGMX 3GQAA 4EW9A 4MXNA 1O8DA 1RU4A 2X6XA 4I84A 4XONA 2INVA 3FY3A 1HG8A 4W8TA 2NSTA 4XR6A 3VSTA 3WWGA 1QJVA 4NK8A 2NZMA 4YEJA 2NSPA 4YELA 1PE9A 2QXZA 5AMVA 2X85A 1BHEA 4YZQA 4XQFA 4U4BA 4U49A 4XN3A 1WMRA 2BSPA 4XOTA 3VMWA 2O17A 2O04A 1OOCA 3GQ9A 4XKVA 2NT9A 5C1CA 2X6YA 1O8KA 3VMVA 1O8IA 2O0WA 4URRA 3B4NA 2QX3A 4XLAA 2VBKA 3B8YA 2UVFA 1OGOX 2INUA 1H80A 2QY1A 1EE6A 4OJLA 4XOPA 1VBLA 1O8EA 2NT6A 4AVZA 1KCCA 4XM3A 3T9GA 2VBEA 1O88A 1O8GA 1GQ8A 4XKWA 1O8JA 4XNFA 1OFLA 2EWEA 2PECA 4PMHA 3SUCA 1DBOA 2NTQA 4YZ0A 2X3HA 1O8FA 2Z8GA 3VSUA 2NTPA 4Z06A 1K5CA 1RMGA 2IQ7A 2UVEA 3KRGA 1OFMA 3GRHA 1BN8A 2VJIA 3GQ8A 2O0VA 4OZZA 1AIRA 3GQ7A 1XG2A 3ZPPA 1O8LA 3B90A 4YZXA 2ODLA 2NTBA 3LMWA 1JRGA 1O8MA 4OJPA 1QCXA 1IB4A 1CZFA 3JURA 4C2LA 4YZAA 4Z03A 1KCDA 1PLUA 1X0CA 4XMYA 4OJOA 4Z05A 4XLFA 1PXZA 4OJ5A 2O1DA 2VJJA 4XN0A 4MR0A 1IDKA 4OJ6A 4HWVA 3ZSCA 1JTAA 5C1EA 3UW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLH A;  3VSV A;  2PYG A;  1NHC A;  1KTW A;  4XL9 A;  4W8R A;  4NK6 A;  4W8S A;  4OZY A;  2X6W A;  4W8Q A;  1IDJ A;  4XLE A;  2PYH A;  4XOR A;  4XLC A;  1DBG A;  2VBM A;  3EQO A;  3EQN A;  1O8H A;  1RWR A;  1IA5 A;  1OGM X;  3GQA A;  4EW9 A;  4MXN A;  1O8D A;  1RU4 A;  2X6X A;  4I84 A;  4XON A;  2INV A;  3FY3 A;  1HG8 A;  4W8T A;  2NST A;  4XR6 A;  3VST A;  3WWG A;  1QJV A;  4NK8 A;  2NZM A;  4YEJ A;  2NSP A;  4YEL A;  1PE9 A;  2QXZ A;  5AMV A;  2X85 A;  1BHE A;  4YZQ A;  4XQF A;  4U4B A;  4U49 A;  4XN3 A;  1WMR A;  2BSP A;  4XOT A;  3VMW A;  2O17 A;  2O04 A;  1OOC A;  3GQ9 A;  4XKV A;  2NT9 A;  5C1C A;  2X6Y A;  1O8K A;  3VMV A;  1O8I A;  2O0W A;  4URR A;  3B4N A;  2QX3 A;  4XLA A;  2VBK A;  3B8Y A;  2UVF A;  1OGO X;  2INU A;  1H80 A;  2QY1 A;  1EE6 A;  4OJL A;  4XOP A;  1VBL A;  1O8E A;  2NT6 A;  4AVZ A;  1KCC A;  4XM3 A;  3T9G A;  2VBE A;  1O88 A;  1O8G A;  1GQ8 A;  4XKW A;  1O8J A;  4XNF A;  1OFL A;  2EWE A;  2PEC A;  4PMH A;  3SUC A;  1DBO A;  2NTQ A;  4YZ0 A;  2X3H A;  1O8F A;  2Z8G A;  3VSU A;  2NTP A;  4Z06 A;  1K5C A;  1RMG A;  2IQ7 A;  2UVE A;  3KRG A;  1OFM A;  3GRH A;  1BN8 A;  2VJI A;  3GQ8 A;  2O0V A;  4OZZ A;  1AIR A;  3GQ7 A;  1XG2 A;  3ZPP A;  1O8L A;  3B90 A;  4YZX A;  2ODL A;  2NTB A;  3LMW A;  1JRG A;  1O8M A;  4OJP A;  1QCX A;  1IB4 A;  1CZF A;  3JUR A;  4C2L A;  4YZA A;  4Z03 A;  1KCD A;  1PLU A;  1X0C A;  4XMY A;  4OJO A;  4Z05 A;  4XLF A;  1PXZ A;  4OJ5 A;  2O1D A;  2VJJ A;  4XN0 A;  4MR0 A;  1IDK A;  4OJ6 A;  4HWV A;  3ZSC A;  1JTA A;  5C1E A;  3UW0 A; 
#chains in the Genus database with same CATH topology
 2V5I A;  4XLH A;  1TYW A;  3VSV A;  2PYG A;  2VFO A;  2VFP A;  1NHC A;  1KTW A;  1KQ5 A;  4XL9 A;  4W8R A;  1QRC A;  4NK6 A;  1K8F A;  4OZY A;  4W8S A;  3SQV A;  2X6W A;  2BM5 A;  3H09 A;  4W8Q A;  1IDJ A;  4XLE A;  2PYH A;  1QRB A;  4XOR A;  1TYU A;  4XLC A;  1DBG A;  1LLW A;  2VBM A;  3EQO A;  3EQN A;  1O8H A;  1RWR A;  1LLZ A;  1IA5 A;  1EZG A;  1OGM X;  3GQA A;  4EW9 A;  1HF2 A;  4YC5 A;  3DU1 X;  4MXN A;  4YCQ A;  1O8D A;  1RU4 A;  2X6X A;  4I84 A;  1QA2 A;  4XON A;  2INV A;  3FY3 A;  1HG8 A;  4W8T A;  2NST A;  2W7Z A;  2B0R A;  3RIQ A;  4XR6 A;  3VST A;  3WWG A;  1QJV A;  4NK8 A;  2BM7 A;  2NZM A;  4YEJ A;  3BH6 B;  2NSP A;  4YEL A;  1PE9 A;  2XTW A;  3SZE A;  2QXZ A;  5AMV A;  2XTY A;  2X85 A;  1BHE A;  4YZQ A;  4KH3 A;  2VFQ A;  4XQF A;  4U4B A;  4U49 A;  4XN3 A;  3LJY A;  1WMR A;  2BSP A;  4XOT A;  1OFD A;  2O17 A;  3VMW A;  2O04 A;  1OOC A;  2XT4 A;  2YUH A;  3GQ9 A;  1OFE A;  4XKV A;  2NT9 A;  4YDT A;  5C1C A;  2X6Y A;  1O8K A;  3VMV A;  1O8I A;  1TYX A;  2O0W A;  2BM4 A;  4URR A;  3B4N A;  2QX3 A;  3NAW A;  3PSZ A;  4XLA A;  2VBK A;  3B8Y A;  2UVF A;  1OGO X;  2INU A;  1H80 A;  2QY1 A;  1EE6 A;  1CLW A;  4JRA C;  4OJL A;  3NB2 A;  2XTX A;  4XOP A;  3SY2 A;  2G0Y A;  5JLV C;  1VBL A;  1O8E A;  4YEI A;  2NT6 A;  1QQ1 A;  4AVZ A;  4XM3 A;  1KCC A;  3T9G A;  1K4Z A;  3BH7 B;  1LM1 A;  2VBE A;  4OM9 A;  2VFN A;  1O88 A;  1O8G A;  2VFM A;  1GQ8 A;  4XKW A;  2J8K A;  1DAB A;  1QA1 A;  1O8J A;  1TSP A;  4XNF A;  1OFL A;  2EWE A;  2PEC A;  2O6W A;  3PSS A;  1DBO A;  2NTQ A;  4PMH A;  2X3H A;  3SUC A;  3UW0 A;  4YZ0 A;  1O8F A;  2Z8G A;  3AK5 A;  3VSU A;  2NTP A;  4Z06 A;  1K5C A;  1RMG A;  2IQ7 A;  2UVE A;  2F3L A;  3KRG A;  3P4G A;  3TH0 A;  1OFM A;  2BX6 A;  4YFO A;  3GRH A;  1BN8 A;  3PET A;  2VJI A;  3GQ8 A;  2O0V A;  4OZZ A;  3N6Z A;  1AIR A;  2XT2 A;  3GQ7 A;  1XG2 A;  4V02 C;  3ZPP A;  1O8L A;  5JMC B;  3B90 A;  4YZX A;  2ODL A;  2NTB A;  3LMW A;  3ML3 A;  3JX8 A;  1JRG A;  1O8M A;  4OJP A;  2IOU G;  1EA0 A;  1QCX A;  1IB4 A;  1TYV A;  1CZF A;  3JUR A;  1QA3 A;  4C2L A;  3SYJ A;  1WXR A;  4YZA A;  4Z03 A;  1KCD A;  1PLU A;  1X0C A;  3LYC A;  4OJO A;  4XMY A;  2QZA A;  4XLF A;  5DNS A;  4Z05 A;  1PXZ A;  2BM6 A;  2O1D A;  4OJ5 A;  2VJJ A;  4XN0 A;  2QYU A;  2J8I A;  3N90 A;  2XC1 A;  1L1I A;  4MR0 A;  1IDK A;  4OJ6 A;  4HWV A;  3ZSC A;  1JTA A;  5C1E A;  4OPW A; 
#chains in the Genus database with same CATH homology
 4XLH A;  3VSV A;  2PYG A;  1NHC A;  1KTW A;  4XL9 A;  4W8R A;  4NK6 A;  4W8S A;  4OZY A;  2X6W A;  4W8Q A;  1IDJ A;  4XLE A;  2PYH A;  4XOR A;  4XLC A;  1DBG A;  2VBM A;  3EQO A;  3EQN A;  1O8H A;  1RWR A;  1IA5 A;  1OGM X;  3GQA A;  4EW9 A;  4MXN A;  1O8D A;  1RU4 A;  2X6X A;  4I84 A;  4XON A;  2INV A;  3FY3 A;  1HG8 A;  4W8T A;  2NST A;  4XR6 A;  3VST A;  3WWG A;  1QJV A;  4NK8 A;  2NZM A;  4YEJ A;  2NSP A;  4YEL A;  1PE9 A;  2QXZ A;  5AMV A;  2X85 A;  1BHE A;  4YZQ A;  4XQF A;  4U4B A;  4U49 A;  4XN3 A;  1WMR A;  2BSP A;  4XOT A;  3VMW A;  2O17 A;  2O04 A;  1OOC A;  3GQ9 A;  4XKV A;  2NT9 A;  5C1C A;  2X6Y A;  1O8K A;  3VMV A;  1O8I A;  2O0W A;  4URR A;  3B4N A;  2QX3 A;  4XLA A;  2VBK A;  3B8Y A;  2UVF A;  1OGO X;  2INU A;  1H80 A;  2QY1 A;  1EE6 A;  4OJL A;  4XOP A;  1VBL A;  1O8E A;  2NT6 A;  4AVZ A;  1KCC A;  4XM3 A;  3T9G A;  2VBE A;  1O88 A;  1O8G A;  1GQ8 A;  4XKW A;  1O8J A;  4XNF A;  1OFL A;  2EWE A;  2PEC A;  4PMH A;  3SUC A;  1DBO A;  2NTQ A;  4YZ0 A;  2X3H A;  1O8F A;  2Z8G A;  3VSU A;  2NTP A;  4Z06 A;  1K5C A;  1RMG A;  2IQ7 A;  2UVE A;  3KRG A;  1OFM A;  3GRH A;  1BN8 A;  2VJI A;  3GQ8 A;  2O0V A;  4OZZ A;  1AIR A;  3GQ7 A;  1XG2 A;  3ZPP A;  1O8L A;  3B90 A;  4YZX A;  2ODL A;  2NTB A;  3LMW A;  1JRG A;  1O8M A;  4OJP A;  1QCX A;  1IB4 A;  1CZF A;  3JUR A;  4C2L A;  4YZA A;  4Z03 A;  1KCD A;  1PLU A;  1X0C A;  4XMY A;  4OJO A;  4Z05 A;  4XLF A;  1PXZ A;  4OJ5 A;  2O1D A;  2VJJ A;  4XN0 A;  4MR0 A;  1IDK A;  4OJ6 A;  4HWV A;  3ZSC A;  1JTA A;  5C1E A;  3UW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...