1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
4U4BA 2O0WA 1O88A 1QJVA 4W8RA 4OJ6A 1WMRA 4NK6A 4Z05A 1O8MA 5AMVA 1OGMX 1DBOA 1O8HA 1GQ8A 3VSVA 2VJIA 3GQ7A 3EQNA 1O8EA 4C2LA 2UVFA 2VBEA 4U49A 3SUCA 4YZ0A 4YZQA 1XG2A 1K5CA 1CZFA 1VBLA 4XN0A 4PMHA 1AIRA 2QX3A 3LMWA 1OOCA 2NSPA 4XOPA 4W8TA 2NTBA 5C1EA 2X85A 1IDJA 3UW0A 1O8FA 2VJJA 3T9GA 2INUA 1OGOX 2NSTA 2O04A 3ZPPA 4XMYA 1KCCA 1X0CA 3VMVA 3GQAA 2NTQA 1IDKA 2ODLA 3B90A 4OJ5A 1H80A 1RU4A 4OJPA 4XLHA 1O8DA 4Z06A 2EWEA 3VSTA 2PECA 4XNFA 2PYHA 4OZZA 4OJOA 3WWGA 1BN8A 1IB4A 2O17A 1QCXA 2Z8GA 4NK8A 1BHEA 1RWRA 4YZAA 3JURA 2NT6A 4XLAA 4YEJA 4OJLA 4XQFA 4HWVA 4YELA 3FY3A 1PXZA 4AVZA 4OZYA 4W8SA 4XL9A 4Z03A 1JTAA 1IA5A 2O0VA 3EQOA 1RMGA 2X6WA 1PLUA 3VSUA 4XORA 2INVA 2BSPA 2PYGA 1O8JA 3KRGA 4XKWA 2X6YA 1EE6A 1OFLA 3GQ8A 4XONA 1KCDA 4EW9A 2UVEA 2QY1A 2NT9A 4I84A 3B4NA 1O8LA 1JRGA 4XN3A 4XM3A 4URRA 2IQ7A 1KTWA 1OFMA 2X3HA 4W8QA 1NHCA 1DBGA 5C1CA 4XOTA 1PE9A 2VBKA 4MXNA 3VMWA 4XKVA 2NTPA 1HG8A 1O8GA 1O8KA 2VBMA 3GQ9A 4XLEA 1O8IA 2NZMA 4MR0A 2X6XA 3GRHA 3ZSCA 2QXZA 4XR6A 3B8YA 4XLCA 4YZXA 4XLFA 2O1DA
chains in the Genus database with same CATH superfamily
4U4BA 2O0WA 1WXRA 1O88A 1QJVA 4W8RA 4OJ6A 1WMRA 4NK6A 4Z05A 3LYCA 1O8MA 1QA3A 3P4GA 1TYWA 5AMVA 1OGMX 1DBOA 1O8HA 1GQ8A 3VSVA 5JMCB 2VJIA 3GQ7A 4YCQA 3BH6B 1QRCA 3EQNA 1O8EA 4C2LA 2UVFA 2VBEA 4U49A 3SUCA 4YZ0A 2XC1A 1LM1A 4YZQA 3H09A 1XG2A 1K5CA 3N90A 1OFDA 1CZFA 2BM4A 1VBLA 4XN0A 4PMHA 1DABA 1AIRA 2QX3A 3LMWA 5JLVC 1OOCA 2NSPA 4XOPA 4W8TA 2NTBA 5C1EA 2X85A 1IDJA 2BM5A 1O8FA 2XT4A 3UW0A 2VJJA 2W7ZA 3T9GA 2INUA 3AK5A 1TSPA 1OGOX 2NSTA 4JRAC 2O04A 3BH7B 3NAWA 4XMYA 3ZPPA 1KCCA 1QA2A 2BX6A 1X0CA 3VMVA 3GQAA 5DNSA 1KQ5A 1IDKA 2NTQA 2ODLA 3B90A 2BM6A 4OJ5A 4OM9A 1H80A 1RU4A 4V02C 4OJPA 4XLHA 1O8DA 4Z06A 2EWEA 3VSTA 1TYUA 1TYVA 2PECA 4XNFA 2PYHA 2O6WA 3JX8A 4OZZA 4OJOA 4YDTA 2BM7A 4YEIA 3WWGA 1BN8A 1QQ1A 1IB4A 2O17A 4YFOA 1L1IA 3RIQA 2YUHA 1QCXA 2Z8GA 1OFEA 4NK8A 1BHEA 1RWRA 4YZAA 3JURA 2NT6A 3NB2A 4XLAA 2VFMA 2B0RA 4OJLA 4YEJA 4XQFA 3SY2A 4HWVA 4YELA 3FY3A 1PXZA 4AVZA 4OZYA 4W8SA 4XL9A 3DU1X 4Z03A 2IOUG 1JTAA 1K4ZA 1IA5A 2O0VA 2QZAA 3EQOA 2F3LA 1RMGA 2VFQA 4YC5A 2VFOA 2X6WA 1PLUA 3PSSA 3ML3A 3VSUA 4XORA 2INVA 2XTWA 2BSPA 2PYGA 1O8JA 3KRGA 2J8KA 4XKWA 2X6YA 2XTYA 1EE6A 1OFLA 3GQ8A 4XONA 1QRBA 4EW9A 1KCDA 1EA0A 2QY1A 2UVEA 4KH3A 2NT9A 4I84A 1EZGA 1TYXA 2V5IA 3B4NA 1O8LA 2G0YA 1JRGA 1QA1A 4XN3A 4XM3A 4URRA 3SYJA 2IQ7A 1KTWA 1OFMA 2X3HA 4W8QA 1NHCA 1DBGA 3TH0A 2VFPA 4XOTA 3SQVA 5C1CA 1PE9A 2VBKA 3LJYA 4MXNA 3VMWA 2XTXA 3N6ZA 3PSZA 4XKVA 2NTPA 2VFNA 4OPWA 1HG8A 1K8FA 1O8GA 1O8KA 1LLZA 2VBMA 3GQ9A 4XLEA 1O8IA 1CLWA 1LLWA 2J8IA 2NZMA 3PETA 2XT2A 2X6XA 3GRHA 4MR0A 3ZSCA 2QXZA 4XR6A 3SZEA 2QYUA 3B8YA 4XLCA 1HF2A 4YZXA 4XLFA 2O1DA
chains in the Genus database with same CATH topology
4U4BA 2O0WA 1O88A 1QJVA 4W8RA 4OJ6A 1WMRA 4NK6A 4Z05A 1O8MA 5AMVA 1OGMX 1DBOA 1O8HA 1GQ8A 3VSVA 2VJIA 3GQ7A 3EQNA 1O8EA 4C2LA 2UVFA 2VBEA 4U49A 3SUCA 4YZ0A 4YZQA 1XG2A 1K5CA 1CZFA 1VBLA 4XN0A 4PMHA 1AIRA 2QX3A 3LMWA 1OOCA 2NSPA 4XOPA 4W8TA 2NTBA 5C1EA 2X85A 1IDJA 3UW0A 1O8FA 2VJJA 3T9GA 2INUA 1OGOX 2NSTA 2O04A 3ZPPA 4XMYA 1KCCA 1X0CA 3VMVA 3GQAA 2NTQA 1IDKA 2ODLA 3B90A 4OJ5A 1H80A 1RU4A 4OJPA 4XLHA 1O8DA 4Z06A 2EWEA 3VSTA 2PECA 4XNFA 2PYHA 4OZZA 4OJOA 3WWGA 1BN8A 1IB4A 2O17A 1QCXA 2Z8GA 4NK8A 1BHEA 1RWRA 4YZAA 3JURA 2NT6A 4XLAA 4YEJA 4OJLA 4XQFA 4HWVA 4YELA 3FY3A 1PXZA 4AVZA 4OZYA 4W8SA 4XL9A 4Z03A 1JTAA 1IA5A 2O0VA 3EQOA 1RMGA 2X6WA 1PLUA 3VSUA 4XORA 2INVA 2BSPA 2PYGA 1O8JA 3KRGA 4XKWA 2X6YA 1EE6A 1OFLA 3GQ8A 4XONA 1KCDA 4EW9A 2UVEA 2QY1A 2NT9A 4I84A 3B4NA 1O8LA 1JRGA 4XN3A 4XM3A 4URRA 2IQ7A 1KTWA 1OFMA 2X3HA 4W8QA 1NHCA 1DBGA 5C1CA 4XOTA 1PE9A 2VBKA 4MXNA 3VMWA 4XKVA 2NTPA 1HG8A 1O8GA 1O8KA 2VBMA 3GQ9A 4XLEA 1O8IA 2NZMA 4MR0A 2X6XA 3GRHA 3ZSCA 2QXZA 4XR6A 3B8YA 4XLCA 4YZXA 4XLFA 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  2O0W A;  1O88 A;  1QJV A;  4W8R A;  4OJ6 A;  1WMR A;  4NK6 A;  4Z05 A;  1O8M A;  5AMV A;  1OGM X;  1DBO A;  1O8H A;  1GQ8 A;  3VSV A;  2VJI A;  3GQ7 A;  3EQN A;  1O8E A;  4C2L A;  2UVF A;  2VBE A;  4U49 A;  3SUC A;  4YZ0 A;  4YZQ A;  1XG2 A;  1K5C A;  1CZF A;  1VBL A;  4XN0 A;  4PMH A;  1AIR A;  2QX3 A;  3LMW A;  1OOC A;  2NSP A;  4XOP A;  4W8T A;  2NTB A;  5C1E A;  2X85 A;  1IDJ A;  3UW0 A;  1O8F A;  2VJJ A;  3T9G A;  2INU A;  1OGO X;  2NST A;  2O04 A;  3ZPP A;  4XMY A;  1KCC A;  1X0C A;  3VMV A;  3GQA A;  2NTQ A;  1IDK A;  2ODL A;  3B90 A;  4OJ5 A;  1H80 A;  1RU4 A;  4OJP A;  4XLH A;  1O8D A;  4Z06 A;  2EWE A;  3VST A;  2PEC A;  4XNF A;  2PYH A;  4OZZ A;  4OJO A;  3WWG A;  1BN8 A;  1IB4 A;  2O17 A;  1QCX A;  2Z8G A;  4NK8 A;  1BHE A;  1RWR A;  4YZA A;  3JUR A;  2NT6 A;  4XLA A;  4YEJ A;  4OJL A;  4XQF A;  4HWV A;  4YEL A;  3FY3 A;  1PXZ A;  4AVZ A;  4OZY A;  4W8S A;  4XL9 A;  4Z03 A;  1JTA A;  1IA5 A;  2O0V A;  3EQO A;  1RMG A;  2X6W A;  1PLU A;  3VSU A;  4XOR A;  2INV A;  2BSP A;  2PYG A;  1O8J A;  3KRG A;  4XKW A;  2X6Y A;  1EE6 A;  1OFL A;  3GQ8 A;  4XON A;  1KCD A;  4EW9 A;  2UVE A;  2QY1 A;  2NT9 A;  4I84 A;  3B4N A;  1O8L A;  1JRG A;  4XN3 A;  4XM3 A;  4URR A;  2IQ7 A;  1KTW A;  1OFM A;  2X3H A;  4W8Q A;  1NHC A;  1DBG A;  5C1C A;  4XOT A;  1PE9 A;  2VBK A;  4MXN A;  3VMW A;  4XKV A;  2NTP A;  1HG8 A;  1O8G A;  1O8K A;  2VBM A;  3GQ9 A;  4XLE A;  1O8I A;  2NZM A;  4MR0 A;  2X6X A;  3GRH A;  3ZSC A;  2QXZ A;  4XR6 A;  3B8Y A;  4XLC A;  4YZX A;  4XLF A;  2O1D A; 
#chains in the Genus database with same CATH topology
 4U4B A;  2O0W A;  1WXR A;  1O88 A;  1QJV A;  4W8R A;  4OJ6 A;  1WMR A;  4NK6 A;  4Z05 A;  3LYC A;  1O8M A;  1QA3 A;  3P4G A;  1TYW A;  5AMV A;  1OGM X;  1DBO A;  1O8H A;  1GQ8 A;  3VSV A;  5JMC B;  2VJI A;  3GQ7 A;  4YCQ A;  3BH6 B;  1QRC A;  3EQN A;  1O8E A;  4C2L A;  2UVF A;  2VBE A;  4U49 A;  3SUC A;  4YZ0 A;  2XC1 A;  1LM1 A;  4YZQ A;  3H09 A;  1XG2 A;  1K5C A;  3N90 A;  1OFD A;  1CZF A;  2BM4 A;  1VBL A;  4XN0 A;  4PMH A;  1DAB A;  1AIR A;  2QX3 A;  3LMW A;  5JLV C;  1OOC A;  2NSP A;  4XOP A;  4W8T A;  2NTB A;  5C1E A;  2X85 A;  1IDJ A;  2BM5 A;  1O8F A;  2XT4 A;  3UW0 A;  2VJJ A;  2W7Z A;  3T9G A;  2INU A;  3AK5 A;  1TSP A;  1OGO X;  2NST A;  4JRA C;  2O04 A;  3BH7 B;  3NAW A;  4XMY A;  3ZPP A;  1KCC A;  1QA2 A;  2BX6 A;  1X0C A;  3VMV A;  3GQA A;  5DNS A;  1KQ5 A;  1IDK A;  2NTQ A;  2ODL A;  3B90 A;  2BM6 A;  4OJ5 A;  4OM9 A;  1H80 A;  1RU4 A;  4V02 C;  4OJP A;  4XLH A;  1O8D A;  4Z06 A;  2EWE A;  3VST A;  1TYU A;  1TYV A;  2PEC A;  4XNF A;  2PYH A;  2O6W A;  3JX8 A;  4OZZ A;  4OJO A;  4YDT A;  2BM7 A;  4YEI A;  3WWG A;  1BN8 A;  1QQ1 A;  1IB4 A;  2O17 A;  4YFO A;  1L1I A;  3RIQ A;  2YUH A;  1QCX A;  2Z8G A;  1OFE A;  4NK8 A;  1BHE A;  1RWR A;  4YZA A;  3JUR A;  2NT6 A;  3NB2 A;  4XLA A;  2VFM A;  2B0R A;  4OJL A;  4YEJ A;  4XQF A;  3SY2 A;  4HWV A;  4YEL A;  3FY3 A;  1PXZ A;  4AVZ A;  4OZY A;  4W8S A;  4XL9 A;  3DU1 X;  4Z03 A;  2IOU G;  1JTA A;  1K4Z A;  1IA5 A;  2O0V A;  2QZA A;  3EQO A;  2F3L A;  1RMG A;  2VFQ A;  4YC5 A;  2VFO A;  2X6W A;  1PLU A;  3PSS A;  3ML3 A;  3VSU A;  4XOR A;  2INV A;  2XTW A;  2BSP A;  2PYG A;  1O8J A;  3KRG A;  2J8K A;  4XKW A;  2X6Y A;  2XTY A;  1EE6 A;  1OFL A;  3GQ8 A;  4XON A;  1QRB A;  4EW9 A;  1KCD A;  1EA0 A;  2QY1 A;  2UVE A;  4KH3 A;  2NT9 A;  4I84 A;  1EZG A;  1TYX A;  2V5I A;  3B4N A;  1O8L A;  2G0Y A;  1JRG A;  1QA1 A;  4XN3 A;  4XM3 A;  4URR A;  3SYJ A;  2IQ7 A;  1KTW A;  1OFM A;  2X3H A;  4W8Q A;  1NHC A;  1DBG A;  3TH0 A;  2VFP A;  4XOT A;  3SQV A;  5C1C A;  1PE9 A;  2VBK A;  3LJY A;  4MXN A;  3VMW A;  2XTX A;  3N6Z A;  3PSZ A;  4XKV A;  2NTP A;  2VFN A;  4OPW A;  1HG8 A;  1K8F A;  1O8G A;  1O8K A;  1LLZ A;  2VBM A;  3GQ9 A;  4XLE A;  1O8I A;  1CLW A;  1LLW A;  2J8I A;  2NZM A;  3PET A;  2XT2 A;  2X6X A;  3GRH A;  4MR0 A;  3ZSC A;  2QXZ A;  4XR6 A;  3SZE A;  2QYU A;  3B8Y A;  4XLC A;  1HF2 A;  4YZX A;  4XLF A;  2O1D A; 
#chains in the Genus database with same CATH homology
 4U4B A;  2O0W A;  1O88 A;  1QJV A;  4W8R A;  4OJ6 A;  1WMR A;  4NK6 A;  4Z05 A;  1O8M A;  5AMV A;  1OGM X;  1DBO A;  1O8H A;  1GQ8 A;  3VSV A;  2VJI A;  3GQ7 A;  3EQN A;  1O8E A;  4C2L A;  2UVF A;  2VBE A;  4U49 A;  3SUC A;  4YZ0 A;  4YZQ A;  1XG2 A;  1K5C A;  1CZF A;  1VBL A;  4XN0 A;  4PMH A;  1AIR A;  2QX3 A;  3LMW A;  1OOC A;  2NSP A;  4XOP A;  4W8T A;  2NTB A;  5C1E A;  2X85 A;  1IDJ A;  3UW0 A;  1O8F A;  2VJJ A;  3T9G A;  2INU A;  1OGO X;  2NST A;  2O04 A;  3ZPP A;  4XMY A;  1KCC A;  1X0C A;  3VMV A;  3GQA A;  2NTQ A;  1IDK A;  2ODL A;  3B90 A;  4OJ5 A;  1H80 A;  1RU4 A;  4OJP A;  4XLH A;  1O8D A;  4Z06 A;  2EWE A;  3VST A;  2PEC A;  4XNF A;  2PYH A;  4OZZ A;  4OJO A;  3WWG A;  1BN8 A;  1IB4 A;  2O17 A;  1QCX A;  2Z8G A;  4NK8 A;  1BHE A;  1RWR A;  4YZA A;  3JUR A;  2NT6 A;  4XLA A;  4YEJ A;  4OJL A;  4XQF A;  4HWV A;  4YEL A;  3FY3 A;  1PXZ A;  4AVZ A;  4OZY A;  4W8S A;  4XL9 A;  4Z03 A;  1JTA A;  1IA5 A;  2O0V A;  3EQO A;  1RMG A;  2X6W A;  1PLU A;  3VSU A;  4XOR A;  2INV A;  2BSP A;  2PYG A;  1O8J A;  3KRG A;  4XKW A;  2X6Y A;  1EE6 A;  1OFL A;  3GQ8 A;  4XON A;  1KCD A;  4EW9 A;  2UVE A;  2QY1 A;  2NT9 A;  4I84 A;  3B4N A;  1O8L A;  1JRG A;  4XN3 A;  4XM3 A;  4URR A;  2IQ7 A;  1KTW A;  1OFM A;  2X3H A;  4W8Q A;  1NHC A;  1DBG A;  5C1C A;  4XOT A;  1PE9 A;  2VBK A;  4MXN A;  3VMW A;  4XKV A;  2NTP A;  1HG8 A;  1O8G A;  1O8K A;  2VBM A;  3GQ9 A;  4XLE A;  1O8I A;  2NZM A;  4MR0 A;  2X6X A;  3GRH A;  3ZSC A;  2QXZ A;  4XR6 A;  3B8Y A;  4XLC A;  4YZX A;  4XLF A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...