1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
4Z05A 1KCCA 1O8GA 4XN3A 3KRGA 4YZQA 3VMWA 1HG8A 3GQ7A 1QCXA 3EQNA 1EE6A 1JTAA 4U49A 1PXZA 5AMVA 4I84A 1O8IA 1IDKA 3GQ8A 3JURA 4AVZA 3ZPPA 2O1DA 2ODLA 1CZFA 1KCDA 4W8QA 2NSTA 2NT9A 4OZYA 4XORA 2QX3A 4XMYA 4XNFA 1O8HA 2O04A 1RU4A 3WWGA 4YELA 1JRGA 4MR0A 2O0WA 2VBMA 1AIRA 2O0VA 4W8TA 4XLHA 3VMVA 3GRHA 3VSTA 2VBEA 4XOPA 4XN0A 2VJJA 3VSUA 4Z06A 4XLCA 4XLEA 2EWEA 1O8EA 2UVEA 2NTBA 2QXZA 4NK8A 4OJ6A 1IDJA 4Z03A 1PLUA 4C2LA 1O88A 2VJIA 1DBGA 3B90A 1O8LA 4NK6A 1VBLA 4U4BA 5C1CA 4W8SA 1OFLA 1BN8A 1XG2A 4MXNA 4OJOA 1QJVA 1IB4A 1OOCA 2X85A 2IQ7A 1PE9A 3LMWA 2X6XA 1WMRA 1O8DA 2NSPA 4XONA 1DBOA 2INVA 2NZMA 3UW0A 4OJLA 4XR6A 4PMHA 4XOTA 2QY1A 2X6WA 1H80A 2UVFA 2O17A 3FY3A 1RMGA 1O8MA 4YZAA 4XM3A 2X6YA 1NHCA 2NTPA 2VBKA 4W8RA 2PECA 4XQFA 3VSVA 2INUA 3ZSCA 2NT6A 1GQ8A 1O8JA 2PYHA 4URRA 3T9GA 1OGOX 2Z8GA 4HWVA 1O8FA 2PYGA 4XKWA 3GQAA 1OGMX 4XLAA 3B8YA 1RWRA 1O8KA 1OFMA 5C1EA 3B4NA 4YZ0A 1K5CA 4XL9A 4OZZA 4YZXA 1BHEA 3EQOA 4OJPA 1KTWA 2X3HA 2BSPA 3SUCA 3GQ9A 4XLFA 4EW9A 4OJ5A 4YEJA 2NTQA 1X0CA 4XKVA 1IA5A
chains in the Genus database with same CATH superfamily
2XC1A 4Z05A 1KCCA 1O8GA 4JRAC 2F3LA 4XN3A 3KRGA 4YZQA 3VMWA 1HG8A 1TYXA 2J8KA 3GQ7A 1QCXA 3EQNA 1EE6A 1JTAA 4U49A 1PXZA 5AMVA 1DABA 1L1IA 2QYUA 1OFEA 4I84A 1O8IA 1QRBA 2BM4A 2BM5A 3LJYA 1IDKA 3N90A 2XTWA 3P4GA 3SYJA 3GQ8A 3JURA 4AVZA 3ZPPA 2O1DA 2ODLA 1CZFA 1CLWA 1KCDA 4W8QA 1TYUA 2NSTA 2NT9A 4OZYA 4XORA 5JMCB 2QX3A 4XMYA 4XNFA 1LLZA 1O8HA 2O04A 1RU4A 2VFQA 3WWGA 1QA3A 2QZAA 4YELA 1JRGA 4MR0A 2O0WA 2VBMA 1AIRA 2O0VA 4W8TA 4XLHA 2O6WA 3VMVA 3GRHA 3VSTA 1TSPA 2VBEA 4XOPA 3LYCA 4XN0A 2VJJA 3VSUA 4Z06A 4YCQA 4XLCA 3PSSA 4XLEA 2IOUG 2EWEA 1O8EA 2UVEA 2NTBA 2QXZA 4NK8A 4OJ6A 1IDJA 4Z03A 1PLUA 3TH0A 4C2LA 2XT2A 1O88A 2VJIA 1DBGA 3B90A 1O8LA 4NK6A 1VBLA 4U4BA 5C1CA 5DNSA 4W8SA 5JLVC 1OFLA 1BN8A 3NAWA 1XG2A 4MXNA 4OJOA 1QJVA 1IB4A 1QQ1A 1OOCA 2X85A 2IQ7A 1PE9A 3LMWA 2X6XA 1WMRA 1O8DA 2NSPA 4V02C 2BM7A 4XONA 1DBOA 2INVA 2NZMA 3PSZA 3UW0A 2VFMA 1QA2A 4OJLA 4XR6A 3NB2A 2VFPA 2BM6A 4PMHA 4XOTA 4YFOA 4OPWA 2QY1A 2X6WA 1H80A 2UVFA 2O17A 3FY3A 1K8FA 1RMGA 1O8MA 2J8IA 2B0RA 2VFNA 4YZAA 2BX6A 2W7ZA 3N6ZA 2X6YA 1HF2A 2VFOA 4XM3A 2XTYA 2XT4A 3ML3A 1NHCA 2NTPA 1QRCA 2VBKA 4W8RA 2PECA 3PETA 3SZEA 3VSVA 1OFDA 4XQFA 2INUA 4YC5A 2NT6A 3ZSCA 3SY2A 1GQ8A 1O8JA 2PYHA 1WXRA 2XTXA 2YUHA 1K4ZA 3DU1X 4URRA 1OGOX 2Z8GA 3T9GA 4HWVA 1O8FA 2PYGA 4XKWA 4YEIA 3GQAA 4OM9A 1OGMX 4XLAA 1EA0A 3B8YA 1RWRA 1O8KA 1OFMA 5C1EA 3JX8A 1LM1A 3B4NA 4YZ0A 1QA1A 1K5CA 4XL9A 4OZZA 1KQ5A 4YZXA 3BH7B 1EZGA 1BHEA 3EQOA 1TYWA 4OJPA 3RIQA 1KTWA 2X3HA 1LLWA 3BH6B 1TYVA 4KH3A 2BSPA 3SUCA 3GQ9A 4YDTA 4XLFA 3H09A 4EW9A 3SQVA 4OJ5A 2G0YA 4YEJA 2V5IA 2NTQA 3AK5A 1X0CA 4XKVA 1IA5A
chains in the Genus database with same CATH topology
4Z05A 1KCCA 1O8GA 4XN3A 3KRGA 4YZQA 3VMWA 1HG8A 3GQ7A 1QCXA 3EQNA 1EE6A 1JTAA 4U49A 1PXZA 5AMVA 4I84A 1O8IA 1IDKA 3GQ8A 3JURA 4AVZA 3ZPPA 2O1DA 2ODLA 1CZFA 1KCDA 4W8QA 2NSTA 2NT9A 4OZYA 4XORA 2QX3A 4XMYA 4XNFA 1O8HA 2O04A 1RU4A 3WWGA 4YELA 1JRGA 4MR0A 2O0WA 2VBMA 1AIRA 2O0VA 4W8TA 4XLHA 3VMVA 3GRHA 3VSTA 2VBEA 4XOPA 4XN0A 2VJJA 3VSUA 4Z06A 4XLCA 4XLEA 2EWEA 1O8EA 2UVEA 2NTBA 2QXZA 4NK8A 4OJ6A 1IDJA 4Z03A 1PLUA 4C2LA 1O88A 2VJIA 1DBGA 3B90A 1O8LA 4NK6A 1VBLA 4U4BA 5C1CA 4W8SA 1OFLA 1BN8A 1XG2A 4MXNA 4OJOA 1QJVA 1IB4A 1OOCA 2X85A 2IQ7A 1PE9A 3LMWA 2X6XA 1WMRA 1O8DA 2NSPA 4XONA 1DBOA 2INVA 2NZMA 3UW0A 4OJLA 4XR6A 4PMHA 4XOTA 2QY1A 2X6WA 1H80A 2UVFA 2O17A 3FY3A 1RMGA 1O8MA 4YZAA 4XM3A 2X6YA 1NHCA 2NTPA 2VBKA 4W8RA 2PECA 4XQFA 3VSVA 2INUA 3ZSCA 2NT6A 1GQ8A 1O8JA 2PYHA 4URRA 3T9GA 1OGOX 2Z8GA 4HWVA 1O8FA 2PYGA 4XKWA 3GQAA 1OGMX 4XLAA 3B8YA 1RWRA 1O8KA 1OFMA 5C1EA 3B4NA 4YZ0A 1K5CA 4XL9A 4OZZA 4YZXA 1BHEA 3EQOA 4OJPA 1KTWA 2X3HA 2BSPA 3SUCA 3GQ9A 4XLFA 4EW9A 4OJ5A 4YEJA 2NTQA 1X0CA 4XKVA 1IA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z05 A;  1KCC A;  1O8G A;  4XN3 A;  3KRG A;  4YZQ A;  3VMW A;  1HG8 A;  3GQ7 A;  1QCX A;  3EQN A;  1EE6 A;  1JTA A;  4U49 A;  1PXZ A;  5AMV A;  4I84 A;  1O8I A;  1IDK A;  3GQ8 A;  3JUR A;  4AVZ A;  3ZPP A;  2O1D A;  2ODL A;  1CZF A;  1KCD A;  4W8Q A;  2NST A;  2NT9 A;  4OZY A;  4XOR A;  2QX3 A;  4XMY A;  4XNF A;  1O8H A;  2O04 A;  1RU4 A;  3WWG A;  4YEL A;  1JRG A;  4MR0 A;  2O0W A;  2VBM A;  1AIR A;  2O0V A;  4W8T A;  4XLH A;  3VMV A;  3GRH A;  3VST A;  2VBE A;  4XOP A;  4XN0 A;  2VJJ A;  3VSU A;  4Z06 A;  4XLC A;  4XLE A;  2EWE A;  1O8E A;  2UVE A;  2NTB A;  2QXZ A;  4NK8 A;  4OJ6 A;  1IDJ A;  4Z03 A;  1PLU A;  4C2L A;  1O88 A;  2VJI A;  1DBG A;  3B90 A;  1O8L A;  4NK6 A;  1VBL A;  4U4B A;  5C1C A;  4W8S A;  1OFL A;  1BN8 A;  1XG2 A;  4MXN A;  4OJO A;  1QJV A;  1IB4 A;  1OOC A;  2X85 A;  2IQ7 A;  1PE9 A;  3LMW A;  2X6X A;  1WMR A;  1O8D A;  2NSP A;  4XON A;  1DBO A;  2INV A;  2NZM A;  3UW0 A;  4OJL A;  4XR6 A;  4PMH A;  4XOT A;  2QY1 A;  2X6W A;  1H80 A;  2UVF A;  2O17 A;  3FY3 A;  1RMG A;  1O8M A;  4YZA A;  4XM3 A;  2X6Y A;  1NHC A;  2NTP A;  2VBK A;  4W8R A;  2PEC A;  4XQF A;  3VSV A;  2INU A;  3ZSC A;  2NT6 A;  1GQ8 A;  1O8J A;  2PYH A;  4URR A;  3T9G A;  1OGO X;  2Z8G A;  4HWV A;  1O8F A;  2PYG A;  4XKW A;  3GQA A;  1OGM X;  4XLA A;  3B8Y A;  1RWR A;  1O8K A;  1OFM A;  5C1E A;  3B4N A;  4YZ0 A;  1K5C A;  4XL9 A;  4OZZ A;  4YZX A;  1BHE A;  3EQO A;  4OJP A;  1KTW A;  2X3H A;  2BSP A;  3SUC A;  3GQ9 A;  4XLF A;  4EW9 A;  4OJ5 A;  4YEJ A;  2NTQ A;  1X0C A;  4XKV A;  1IA5 A; 
#chains in the Genus database with same CATH topology
 2XC1 A;  4Z05 A;  1KCC A;  1O8G A;  4JRA C;  2F3L A;  4XN3 A;  3KRG A;  4YZQ A;  3VMW A;  1HG8 A;  1TYX A;  2J8K A;  3GQ7 A;  1QCX A;  3EQN A;  1EE6 A;  1JTA A;  4U49 A;  1PXZ A;  5AMV A;  1DAB A;  1L1I A;  2QYU A;  1OFE A;  4I84 A;  1O8I A;  1QRB A;  2BM4 A;  2BM5 A;  3LJY A;  1IDK A;  3N90 A;  2XTW A;  3P4G A;  3SYJ A;  3GQ8 A;  3JUR A;  4AVZ A;  3ZPP A;  2O1D A;  2ODL A;  1CZF A;  1CLW A;  1KCD A;  4W8Q A;  1TYU A;  2NST A;  2NT9 A;  4OZY A;  4XOR A;  5JMC B;  2QX3 A;  4XMY A;  4XNF A;  1LLZ A;  1O8H A;  2O04 A;  1RU4 A;  2VFQ A;  3WWG A;  1QA3 A;  2QZA A;  4YEL A;  1JRG A;  4MR0 A;  2O0W A;  2VBM A;  1AIR A;  2O0V A;  4W8T A;  4XLH A;  2O6W A;  3VMV A;  3GRH A;  3VST A;  1TSP A;  2VBE A;  4XOP A;  3LYC A;  4XN0 A;  2VJJ A;  3VSU A;  4Z06 A;  4YCQ A;  4XLC A;  3PSS A;  4XLE A;  2IOU G;  2EWE A;  1O8E A;  2UVE A;  2NTB A;  2QXZ A;  4NK8 A;  4OJ6 A;  1IDJ A;  4Z03 A;  1PLU A;  3TH0 A;  4C2L A;  2XT2 A;  1O88 A;  2VJI A;  1DBG A;  3B90 A;  1O8L A;  4NK6 A;  1VBL A;  4U4B A;  5C1C A;  5DNS A;  4W8S A;  5JLV C;  1OFL A;  1BN8 A;  3NAW A;  1XG2 A;  4MXN A;  4OJO A;  1QJV A;  1IB4 A;  1QQ1 A;  1OOC A;  2X85 A;  2IQ7 A;  1PE9 A;  3LMW A;  2X6X A;  1WMR A;  1O8D A;  2NSP A;  4V02 C;  2BM7 A;  4XON A;  1DBO A;  2INV A;  2NZM A;  3PSZ A;  3UW0 A;  2VFM A;  1QA2 A;  4OJL A;  4XR6 A;  3NB2 A;  2VFP A;  2BM6 A;  4PMH A;  4XOT A;  4YFO A;  4OPW A;  2QY1 A;  2X6W A;  1H80 A;  2UVF A;  2O17 A;  3FY3 A;  1K8F A;  1RMG A;  1O8M A;  2J8I A;  2B0R A;  2VFN A;  4YZA A;  2BX6 A;  2W7Z A;  3N6Z A;  2X6Y A;  1HF2 A;  2VFO A;  4XM3 A;  2XTY A;  2XT4 A;  3ML3 A;  1NHC A;  2NTP A;  1QRC A;  2VBK A;  4W8R A;  2PEC A;  3PET A;  3SZE A;  3VSV A;  1OFD A;  4XQF A;  2INU A;  4YC5 A;  2NT6 A;  3ZSC A;  3SY2 A;  1GQ8 A;  1O8J A;  2PYH A;  1WXR A;  2XTX A;  2YUH A;  1K4Z A;  3DU1 X;  4URR A;  1OGO X;  2Z8G A;  3T9G A;  4HWV A;  1O8F A;  2PYG A;  4XKW A;  4YEI A;  3GQA A;  4OM9 A;  1OGM X;  4XLA A;  1EA0 A;  3B8Y A;  1RWR A;  1O8K A;  1OFM A;  5C1E A;  3JX8 A;  1LM1 A;  3B4N A;  4YZ0 A;  1QA1 A;  1K5C A;  4XL9 A;  4OZZ A;  1KQ5 A;  4YZX A;  3BH7 B;  1EZG A;  1BHE A;  3EQO A;  1TYW A;  4OJP A;  3RIQ A;  1KTW A;  2X3H A;  1LLW A;  3BH6 B;  1TYV A;  4KH3 A;  2BSP A;  3SUC A;  3GQ9 A;  4YDT A;  4XLF A;  3H09 A;  4EW9 A;  3SQV A;  4OJ5 A;  2G0Y A;  4YEJ A;  2V5I A;  2NTQ A;  3AK5 A;  1X0C A;  4XKV A;  1IA5 A; 
#chains in the Genus database with same CATH homology
 4Z05 A;  1KCC A;  1O8G A;  4XN3 A;  3KRG A;  4YZQ A;  3VMW A;  1HG8 A;  3GQ7 A;  1QCX A;  3EQN A;  1EE6 A;  1JTA A;  4U49 A;  1PXZ A;  5AMV A;  4I84 A;  1O8I A;  1IDK A;  3GQ8 A;  3JUR A;  4AVZ A;  3ZPP A;  2O1D A;  2ODL A;  1CZF A;  1KCD A;  4W8Q A;  2NST A;  2NT9 A;  4OZY A;  4XOR A;  2QX3 A;  4XMY A;  4XNF A;  1O8H A;  2O04 A;  1RU4 A;  3WWG A;  4YEL A;  1JRG A;  4MR0 A;  2O0W A;  2VBM A;  1AIR A;  2O0V A;  4W8T A;  4XLH A;  3VMV A;  3GRH A;  3VST A;  2VBE A;  4XOP A;  4XN0 A;  2VJJ A;  3VSU A;  4Z06 A;  4XLC A;  4XLE A;  2EWE A;  1O8E A;  2UVE A;  2NTB A;  2QXZ A;  4NK8 A;  4OJ6 A;  1IDJ A;  4Z03 A;  1PLU A;  4C2L A;  1O88 A;  2VJI A;  1DBG A;  3B90 A;  1O8L A;  4NK6 A;  1VBL A;  4U4B A;  5C1C A;  4W8S A;  1OFL A;  1BN8 A;  1XG2 A;  4MXN A;  4OJO A;  1QJV A;  1IB4 A;  1OOC A;  2X85 A;  2IQ7 A;  1PE9 A;  3LMW A;  2X6X A;  1WMR A;  1O8D A;  2NSP A;  4XON A;  1DBO A;  2INV A;  2NZM A;  3UW0 A;  4OJL A;  4XR6 A;  4PMH A;  4XOT A;  2QY1 A;  2X6W A;  1H80 A;  2UVF A;  2O17 A;  3FY3 A;  1RMG A;  1O8M A;  4YZA A;  4XM3 A;  2X6Y A;  1NHC A;  2NTP A;  2VBK A;  4W8R A;  2PEC A;  4XQF A;  3VSV A;  2INU A;  3ZSC A;  2NT6 A;  1GQ8 A;  1O8J A;  2PYH A;  4URR A;  3T9G A;  1OGO X;  2Z8G A;  4HWV A;  1O8F A;  2PYG A;  4XKW A;  3GQA A;  1OGM X;  4XLA A;  3B8Y A;  1RWR A;  1O8K A;  1OFM A;  5C1E A;  3B4N A;  4YZ0 A;  1K5C A;  4XL9 A;  4OZZ A;  4YZX A;  1BHE A;  3EQO A;  4OJP A;  1KTW A;  2X3H A;  2BSP A;  3SUC A;  3GQ9 A;  4XLF A;  4EW9 A;  4OJ5 A;  4YEJ A;  2NTQ A;  1X0C A;  4XKV A;  1IA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...