1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
b'CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
4OJLA 4MR0A 3FY3A 3B90A 4XOTA 1O8GA 1PE9A 2NSTA 4URRA 2PECA 2PYGA 4YELA 1O8MA 3VMVA 1KTWA 2X85A 2X6XA 1O8EA 4NK8A 1JRGA 4OJPA 2VBKA 4XLFA 1RMGA 2NT6A 1XG2A 1O8HA 1O8KA 4XORA 3EQNA 4W8TA 4HWVA 3B8YA 4OJ6A 4XKWA 4C2LA 1IB4A 1RU4A 3B4NA 3EQOA 3GQ7A 2Z8GA 4XNFA 1O8IA 5C1CA 3ZPPA 4XLCA 4XM3A 4MXNA 1IDJA 1DBOA 4OJ5A 4XR6A 1X0CA 2O1DA 2QXZA 3LMWA 3VSUA 1HG8A 1DBGA 4OZZA 1OGOX 4XN3A 1VBLA 5C1EA 1NHCA 2X6WA 4I84A 4XL9A 2VBMA 1O8LA 2QX3A 4XQFA 3T9GA 1BN8A 3VSTA 2NTBA 2NZMA 2VJIA 4NK6A 1QJVA 1O8FA 2EWEA 4YZ0A 1KCDA 1BHEA 4YZAA 1O8JA 2X6YA 1EE6A 1RWRA 3GQ9A 2O0VA 4YEJA 5AMVA 4YZXA 1O88A 3UW0A 4EW9A 3WWGA 1IA5A 1WMRA 1CZFA 4W8RA 4XLHA 1OFLA 1O8DA 2UVFA 3GQAA 4PMHA 4U49A 1OGMX 4XLEA 1OOCA 2NSPA 1QCXA 2X3HA 3JURA 4W8QA 4XKVA 1PLUA 4YZQA 3SUCA 1GQ8A 3ZSCA 2ODLA 2INUA 4W8SA 4Z05A 1JTAA 1PXZA 3GRHA 3VMWA 2UVEA 2BSPA 2NTQA 2O04A 4OZYA 1OFMA 4U4BA 3GQ8A 4OJOA 4XMYA 1H80A 2NTPA 2NT9A 3VSVA 2IQ7A 4AVZA 1KCCA 2VJJA 2O17A 2INVA 2VBEA 1K5CA 4Z03A 4Z06A 4XONA 4XOPA 1AIRA 2QY1A 2PYHA 3KRGA 4XLAA 1IDKA 4XN0A 2O0WA
chains in the Genus database with same CATH superfamily
2VFOA 4OJLA 4MR0A 3FY3A 3B90A 4XOTA 2B0RA 1O8GA 1K4ZA 4KH3A 4YCQA 1PE9A 2NSTA 4V02C 4URRA 3SQVA 1OFEA 2PECA 2PYGA 4YELA 1O8MA 3VMVA 1KTWA 4YFOA 2X85A 3LJYA 2X6XA 1O8EA 4NK8A 2YUHA 1JRGA 1HF2A 2O0WA 4OJPA 2VBKA 2IOUG 2O6WA 4XLFA 1RMGA 5DNSA 1DABA 2NT6A 4JRAC 2VFPA 1TYUA 1KQ5A 1LLZA 2V5IA 1XG2A 1O8HA 1O8KA 4XORA 3EQNA 4W8TA 3SZEA 1LM1A 4HWVA 3B8YA 4OJ6A 4OM9A 4XKWA 4C2LA 1RU4A 2XTYA 3B4NA 3EQOA 3GQ7A 2Z8GA 1IB4A 3ZSCA 4XNFA 3PETA 1O8IA 2BM5A 5C1CA 3H09A 4XLCA 4XM3A 4MXNA 1IDJA 1DBOA 4OJ5A 4XR6A 3ZPPA 1X0CA 1EA0A 2O1DA 2QXZA 3LMWA 4YC5A 3VSUA 1HG8A 2BM7A 1DBGA 4OZZA 1OGOX 1TSPA 1TYVA 4XN3A 1VBLA 5C1EA 1NHCA 2VFQA 1WXRA 2X6WA 4I84A 3N90A 4XL9A 1QA3A 2VBMA 1O8LA 2QX3A 4XQFA 3T9GA 1BN8A 3RIQA 3VSTA 2XC1A 3ML3A 2NTBA 2NZMA 2VJIA 3BH6B 1QJVA 3N6ZA 4NK6A 3PSZA 1O8FA 3AK5A 2EWEA 1QRCA 5JLVC 2XT4A 3BH7B 4YZ0A 1KCDA 1BHEA 2XTWA 4YZAA 4OPWA 1O8JA 2X6YA 1EE6A 1RWRA 3GQ9A 2O0VA 4YEJA 2BM6A 2XTXA 2F3LA 5AMVA 4YZXA 1O88A 3UW0A 4EW9A 1L1IA 3WWGA 1QRBA 1WMRA 1IA5A 1CZFA 5JMCB 4W8RA 1EZGA 2VFNA 4XLHA 3SYJA 1LLWA 1OFLA 2J8KA 1O8DA 2UVFA 3GQAA 3PSSA 1TYXA 1OGMX 4PMHA 4U49A 2W7ZA 4XLEA 4YEIA 1OOCA 2NSPA 2QZAA 1QCXA 2X3HA 3JURA 4W8QA 4XKVA 2BX6A 1PLUA 4YZQA 1GQ8A 3SUCA 2ODLA 2INUA 3NAWA 4W8SA 4Z05A 1JTAA 1PXZA 1QA2A 3GRHA 3LYCA 3VMWA 2UVEA 2BSPA 2NTQA 2O04A 3TH0A 1QQ1A 3NB2A 4OZYA 1OFMA 4U4BA 3JX8A 3DU1X 3GQ8A 4OJOA 4XMYA 4YDTA 1H80A 2BM4A 2NTPA 1QA1A 2NT9A 2XT2A 1CLWA 2IQ7A 3VSVA 2VJJA 4AVZA 1KCCA 1K8FA 2QYUA 2O17A 3SY2A 2INVA 2J8IA 2VBEA 1K5CA 2G0YA 4Z03A 4Z06A 4XONA 4XOPA 1AIRA 2QY1A 2PYHA 3KRGA 4XLAA 1OFDA 1IDKA 4XN0A 3P4GA 1TYWA 2VFMA
chains in the Genus database with same CATH topology
4OJLA 4MR0A 3FY3A 3B90A 4XOTA 1O8GA 1PE9A 2NSTA 4URRA 2PECA 2PYGA 4YELA 1O8MA 3VMVA 1KTWA 2X85A 2X6XA 1O8EA 4NK8A 1JRGA 4OJPA 2VBKA 4XLFA 1RMGA 2NT6A 1XG2A 1O8HA 1O8KA 4XORA 3EQNA 4W8TA 4HWVA 3B8YA 4OJ6A 4XKWA 4C2LA 1IB4A 1RU4A 3B4NA 3EQOA 3GQ7A 2Z8GA 4XNFA 1O8IA 5C1CA 3ZPPA 4XLCA 4XM3A 4MXNA 1IDJA 1DBOA 4OJ5A 4XR6A 1X0CA 2O1DA 2QXZA 3LMWA 3VSUA 1HG8A 1DBGA 4OZZA 1OGOX 4XN3A 1VBLA 5C1EA 1NHCA 2X6WA 4I84A 4XL9A 2VBMA 1O8LA 2QX3A 4XQFA 3T9GA 1BN8A 3VSTA 2NTBA 2NZMA 2VJIA 4NK6A 1QJVA 1O8FA 2EWEA 4YZ0A 1KCDA 1BHEA 4YZAA 1O8JA 2X6YA 1EE6A 1RWRA 3GQ9A 2O0VA 4YEJA 5AMVA 4YZXA 1O88A 3UW0A 4EW9A 3WWGA 1IA5A 1WMRA 1CZFA 4W8RA 4XLHA 1OFLA 1O8DA 2UVFA 3GQAA 4PMHA 4U49A 1OGMX 4XLEA 1OOCA 2NSPA 1QCXA 2X3HA 3JURA 4W8QA 4XKVA 1PLUA 4YZQA 3SUCA 1GQ8A 3ZSCA 2ODLA 2INUA 4W8SA 4Z05A 1JTAA 1PXZA 3GRHA 3VMWA 2UVEA 2BSPA 2NTQA 2O04A 4OZYA 1OFMA 4U4BA 3GQ8A 4OJOA 4XMYA 1H80A 2NTPA 2NT9A 3VSVA 2IQ7A 4AVZA 1KCCA 2VJJA 2O17A 2INVA 2VBEA 1K5CA 4Z03A 4Z06A 4XONA 4XOPA 1AIRA 2QY1A 2PYHA 3KRGA 4XLAA 1IDKA 4XN0A 2O0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJL A;  4MR0 A;  3FY3 A;  3B90 A;  4XOT A;  1O8G A;  1PE9 A;  2NST A;  4URR A;  2PEC A;  2PYG A;  4YEL A;  1O8M A;  3VMV A;  1KTW A;  2X85 A;  2X6X A;  1O8E A;  4NK8 A;  1JRG A;  4OJP A;  2VBK A;  4XLF A;  1RMG A;  2NT6 A;  1XG2 A;  1O8H A;  1O8K A;  4XOR A;  3EQN A;  4W8T A;  4HWV A;  3B8Y A;  4OJ6 A;  4XKW A;  4C2L A;  1IB4 A;  1RU4 A;  3B4N A;  3EQO A;  3GQ7 A;  2Z8G A;  4XNF A;  1O8I A;  5C1C A;  3ZPP A;  4XLC A;  4XM3 A;  4MXN A;  1IDJ A;  1DBO A;  4OJ5 A;  4XR6 A;  1X0C A;  2O1D A;  2QXZ A;  3LMW A;  3VSU A;  1HG8 A;  1DBG A;  4OZZ A;  1OGO X;  4XN3 A;  1VBL A;  5C1E A;  1NHC A;  2X6W A;  4I84 A;  4XL9 A;  2VBM A;  1O8L A;  2QX3 A;  4XQF A;  3T9G A;  1BN8 A;  3VST A;  2NTB A;  2NZM A;  2VJI A;  4NK6 A;  1QJV A;  1O8F A;  2EWE A;  4YZ0 A;  1KCD A;  1BHE A;  4YZA A;  1O8J A;  2X6Y A;  1EE6 A;  1RWR A;  3GQ9 A;  2O0V A;  4YEJ A;  5AMV A;  4YZX A;  1O88 A;  3UW0 A;  4EW9 A;  3WWG A;  1IA5 A;  1WMR A;  1CZF A;  4W8R A;  4XLH A;  1OFL A;  1O8D A;  2UVF A;  3GQA A;  4PMH A;  4U49 A;  1OGM X;  4XLE A;  1OOC A;  2NSP A;  1QCX A;  2X3H A;  3JUR A;  4W8Q A;  4XKV A;  1PLU A;  4YZQ A;  3SUC A;  1GQ8 A;  3ZSC A;  2ODL A;  2INU A;  4W8S A;  4Z05 A;  1JTA A;  1PXZ A;  3GRH A;  3VMW A;  2UVE A;  2BSP A;  2NTQ A;  2O04 A;  4OZY A;  1OFM A;  4U4B A;  3GQ8 A;  4OJO A;  4XMY A;  1H80 A;  2NTP A;  2NT9 A;  3VSV A;  2IQ7 A;  4AVZ A;  1KCC A;  2VJJ A;  2O17 A;  2INV A;  2VBE A;  1K5C A;  4Z03 A;  4Z06 A;  4XON A;  4XOP A;  1AIR A;  2QY1 A;  2PYH A;  3KRG A;  4XLA A;  1IDK A;  4XN0 A;  2O0W A; 
#chains in the Genus database with same CATH topology
 2VFO A;  4OJL A;  4MR0 A;  3FY3 A;  3B90 A;  4XOT A;  2B0R A;  1O8G A;  1K4Z A;  4KH3 A;  4YCQ A;  1PE9 A;  2NST A;  4V02 C;  4URR A;  3SQV A;  1OFE A;  2PEC A;  2PYG A;  4YEL A;  1O8M A;  3VMV A;  1KTW A;  4YFO A;  2X85 A;  3LJY A;  2X6X A;  1O8E A;  4NK8 A;  2YUH A;  1JRG A;  1HF2 A;  2O0W A;  4OJP A;  2VBK A;  2IOU G;  2O6W A;  4XLF A;  1RMG A;  5DNS A;  1DAB A;  2NT6 A;  4JRA C;  2VFP A;  1TYU A;  1KQ5 A;  1LLZ A;  2V5I A;  1XG2 A;  1O8H A;  1O8K A;  4XOR A;  3EQN A;  4W8T A;  3SZE A;  1LM1 A;  4HWV A;  3B8Y A;  4OJ6 A;  4OM9 A;  4XKW A;  4C2L A;  1RU4 A;  2XTY A;  3B4N A;  3EQO A;  3GQ7 A;  2Z8G A;  1IB4 A;  3ZSC A;  4XNF A;  3PET A;  1O8I A;  2BM5 A;  5C1C A;  3H09 A;  4XLC A;  4XM3 A;  4MXN A;  1IDJ A;  1DBO A;  4OJ5 A;  4XR6 A;  3ZPP A;  1X0C A;  1EA0 A;  2O1D A;  2QXZ A;  3LMW A;  4YC5 A;  3VSU A;  1HG8 A;  2BM7 A;  1DBG A;  4OZZ A;  1OGO X;  1TSP A;  1TYV A;  4XN3 A;  1VBL A;  5C1E A;  1NHC A;  2VFQ A;  1WXR A;  2X6W A;  4I84 A;  3N90 A;  4XL9 A;  1QA3 A;  2VBM A;  1O8L A;  2QX3 A;  4XQF A;  3T9G A;  1BN8 A;  3RIQ A;  3VST A;  2XC1 A;  3ML3 A;  2NTB A;  2NZM A;  2VJI A;  3BH6 B;  1QJV A;  3N6Z A;  4NK6 A;  3PSZ A;  1O8F A;  3AK5 A;  2EWE A;  1QRC A;  5JLV C;  2XT4 A;  3BH7 B;  4YZ0 A;  1KCD A;  1BHE A;  2XTW A;  4YZA A;  4OPW A;  1O8J A;  2X6Y A;  1EE6 A;  1RWR A;  3GQ9 A;  2O0V A;  4YEJ A;  2BM6 A;  2XTX A;  2F3L A;  5AMV A;  4YZX A;  1O88 A;  3UW0 A;  4EW9 A;  1L1I A;  3WWG A;  1QRB A;  1WMR A;  1IA5 A;  1CZF A;  5JMC B;  4W8R A;  1EZG A;  2VFN A;  4XLH A;  3SYJ A;  1LLW A;  1OFL A;  2J8K A;  1O8D A;  2UVF A;  3GQA A;  3PSS A;  1TYX A;  1OGM X;  4PMH A;  4U49 A;  2W7Z A;  4XLE A;  4YEI A;  1OOC A;  2NSP A;  2QZA A;  1QCX A;  2X3H A;  3JUR A;  4W8Q A;  4XKV A;  2BX6 A;  1PLU A;  4YZQ A;  1GQ8 A;  3SUC A;  2ODL A;  2INU A;  3NAW A;  4W8S A;  4Z05 A;  1JTA A;  1PXZ A;  1QA2 A;  3GRH A;  3LYC A;  3VMW A;  2UVE A;  2BSP A;  2NTQ A;  2O04 A;  3TH0 A;  1QQ1 A;  3NB2 A;  4OZY A;  1OFM A;  4U4B A;  3JX8 A;  3DU1 X;  3GQ8 A;  4OJO A;  4XMY A;  4YDT A;  1H80 A;  2BM4 A;  2NTP A;  1QA1 A;  2NT9 A;  2XT2 A;  1CLW A;  2IQ7 A;  3VSV A;  2VJJ A;  4AVZ A;  1KCC A;  1K8F A;  2QYU A;  2O17 A;  3SY2 A;  2INV A;  2J8I A;  2VBE A;  1K5C A;  2G0Y A;  4Z03 A;  4Z06 A;  4XON A;  4XOP A;  1AIR A;  2QY1 A;  2PYH A;  3KRG A;  4XLA A;  1OFD A;  1IDK A;  4XN0 A;  3P4G A;  1TYW A;  2VFM A; 
#chains in the Genus database with same CATH homology
 4OJL A;  4MR0 A;  3FY3 A;  3B90 A;  4XOT A;  1O8G A;  1PE9 A;  2NST A;  4URR A;  2PEC A;  2PYG A;  4YEL A;  1O8M A;  3VMV A;  1KTW A;  2X85 A;  2X6X A;  1O8E A;  4NK8 A;  1JRG A;  4OJP A;  2VBK A;  4XLF A;  1RMG A;  2NT6 A;  1XG2 A;  1O8H A;  1O8K A;  4XOR A;  3EQN A;  4W8T A;  4HWV A;  3B8Y A;  4OJ6 A;  4XKW A;  4C2L A;  1IB4 A;  1RU4 A;  3B4N A;  3EQO A;  3GQ7 A;  2Z8G A;  4XNF A;  1O8I A;  5C1C A;  3ZPP A;  4XLC A;  4XM3 A;  4MXN A;  1IDJ A;  1DBO A;  4OJ5 A;  4XR6 A;  1X0C A;  2O1D A;  2QXZ A;  3LMW A;  3VSU A;  1HG8 A;  1DBG A;  4OZZ A;  1OGO X;  4XN3 A;  1VBL A;  5C1E A;  1NHC A;  2X6W A;  4I84 A;  4XL9 A;  2VBM A;  1O8L A;  2QX3 A;  4XQF A;  3T9G A;  1BN8 A;  3VST A;  2NTB A;  2NZM A;  2VJI A;  4NK6 A;  1QJV A;  1O8F A;  2EWE A;  4YZ0 A;  1KCD A;  1BHE A;  4YZA A;  1O8J A;  2X6Y A;  1EE6 A;  1RWR A;  3GQ9 A;  2O0V A;  4YEJ A;  5AMV A;  4YZX A;  1O88 A;  3UW0 A;  4EW9 A;  3WWG A;  1IA5 A;  1WMR A;  1CZF A;  4W8R A;  4XLH A;  1OFL A;  1O8D A;  2UVF A;  3GQA A;  4PMH A;  4U49 A;  1OGM X;  4XLE A;  1OOC A;  2NSP A;  1QCX A;  2X3H A;  3JUR A;  4W8Q A;  4XKV A;  1PLU A;  4YZQ A;  3SUC A;  1GQ8 A;  3ZSC A;  2ODL A;  2INU A;  4W8S A;  4Z05 A;  1JTA A;  1PXZ A;  3GRH A;  3VMW A;  2UVE A;  2BSP A;  2NTQ A;  2O04 A;  4OZY A;  1OFM A;  4U4B A;  3GQ8 A;  4OJO A;  4XMY A;  1H80 A;  2NTP A;  2NT9 A;  3VSV A;  2IQ7 A;  4AVZ A;  1KCC A;  2VJJ A;  2O17 A;  2INV A;  2VBE A;  1K5C A;  4Z03 A;  4Z06 A;  4XON A;  4XOP A;  1AIR A;  2QY1 A;  2PYH A;  3KRG A;  4XLA A;  1IDK A;  4XN0 A;  2O0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...