1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
1K5CA 2PECA 2NTBA 1X0CA 3VSTA 2NTQA 4YZ0A 2NT6A 1OFMA 5AMVA 4MXNA 2PYGA 1IDKA 1RU4A 4W8TA 1IA5A 1KTWA 4XORA 4W8QA 1O8KA 2PYHA 2NZMA 2ODLA 4NK8A 1O8HA 4XONA 2O17A 2VJJA 3VSVA 4I84A 2NSTA 2Z8GA 4YEJA 4XLFA 2VBMA 3T9GA 4XM3A 1O8MA 2NTPA 4XMYA 4XN0A 5C1EA 1O8GA 1EE6A 2UVFA 3B8YA 2IQ7A 3ZPPA 1HG8A 1PXZA 2BSPA 2O04A 4NK6A 1OGOX 1O8IA 4YZXA 4PMHA 1O8FA 4Z06A 2INVA 1BHEA 2X6XA 1KCDA 1QJVA 3GQ9A 1NHCA 4OJ5A 3VSUA 1GQ8A 1XG2A 3SUCA 1OOCA 1DBOA 4AVZA 2VBKA 1PLUA 2X85A 4OJPA 2VBEA 2EWEA 4XOPA 1H80A 3UW0A 4HWVA 4MR0A 4XLEA 1JRGA 1RWRA 2X3HA 3EQOA 3EQNA 4U4BA 2QY1A 4URRA 4YZAA 2O0WA 1O8DA 2O0VA 3KRGA 4XKWA 1RMGA 1DBGA 3B90A 1BN8A 2QXZA 1CZFA 2X6WA 4W8RA 4XKVA 4XN3A 1O88A 3GQAA 3GQ7A 4U49A 1QCXA 1PE9A 4XLAA 2VJIA 4Z03A 1OGMX 3FY3A 4XLCA 1AIRA 5C1CA 3B4NA 4OJLA 4XL9A 4XR6A 3VMVA 1KCCA 3GQ8A 2O1DA 1OFLA 4OJ6A 1IB4A 4XOTA 4EW9A 1WMRA 4YZQA 2NT9A 3GRHA 4XQFA 3WWGA 3ZSCA 1O8EA 4Z05A 2QX3A 2NSPA 2UVEA 4YELA 2X6YA 2INUA 1IDJA 3VMWA 1O8JA 1O8LA 4XNFA 4OZZA 1JTAA 4XLHA 4OZYA 1VBLA 4OJOA 4W8SA 3JURA 4C2LA 3LMWA
chains in the Genus database with same CATH superfamily
1K5CA 1QRCA 2PECA 2NTBA 3TH0A 1X0CA 3VSTA 2NTQA 2J8IA 2J8KA 2XT2A 2NT6A 2B0RA 4YZ0A 1QA2A 1OFMA 1TYWA 2VFQA 4MXNA 5AMVA 2PYGA 1IDKA 2QZAA 1RU4A 4W8TA 1IA5A 1KTWA 4XORA 4W8QA 1O8KA 3SY2A 2PYHA 2NZMA 3NAWA 4OPWA 2BM4A 2ODLA 2IOUG 1O8HA 4NK8A 4XONA 2O17A 1K4ZA 2VJJA 3VSVA 4I84A 2NSTA 2Z8GA 3BH7B 2QYUA 4YEJA 4XLFA 2VBMA 3T9GA 2XT4A 4XM3A 1L1IA 2VFNA 3ML3A 1O8MA 4YCQA 1TSPA 1LM1A 2NTPA 2VFMA 4XMYA 4XN0A 2VFPA 5C1EA 1O8GA 1EE6A 2UVFA 3B8YA 2IQ7A 3ZPPA 1HG8A 1PXZA 3LJYA 2BSPA 2O04A 1CLWA 1LLZA 2YUHA 4NK6A 1OGOX 3JX8A 1O8IA 4YZXA 4PMHA 1O8FA 4Z06A 2INVA 1BHEA 3DU1X 2X6XA 1LLWA 1QJVA 1KCDA 3GQ9A 1NHCA 4OJ5A 4YC5A 3VSUA 1GQ8A 3H09A 2G0YA 1XG2A 2BM7A 3SUCA 2XTYA 1OOCA 1DBOA 4AVZA 2VBKA 1PLUA 2X85A 3NB2A 3SZEA 2W7ZA 4OJPA 2VBEA 2EWEA 4XOPA 1H80A 3UW0A 2BM6A 1OFEA 4HWVA 1QA1A 4MR0A 4XLEA 1JRGA 3PSZA 1K8FA 1RWRA 2X3HA 3EQOA 3EQNA 2VFOA 4U4BA 2BM5A 2QY1A 3N90A 2V5IA 5JLVC 4URRA 4YZAA 1WXRA 2O0WA 3N6ZA 1O8DA 3PSSA 4JRAC 2O0VA 3KRGA 4XKWA 1RMGA 1DBGA 3B90A 1BN8A 2QXZA 1CZFA 2X6WA 1TYVA 2F3LA 4W8RA 4XKVA 1TYUA 1O88A 3GQAA 4XN3A 3GQ7A 3LYCA 4U49A 1QCXA 1PE9A 5JMCB 4XLAA 1EZGA 2XTWA 4YEIA 2XTXA 1TYXA 2VJIA 3BH6B 4Z03A 2O6WA 1OGMX 3FY3A 3P4GA 4XLCA 1AIRA 5C1CA 3B4NA 4OJLA 4XL9A 4XR6A 3VMVA 1KCCA 3GQ8A 2O1DA 4YDTA 1OFLA 4OJ6A 1QQ1A 1QA3A 1IB4A 1QRBA 4XOTA 4EW9A 1WMRA 4YZQA 3AK5A 4V02C 2NT9A 3GRHA 4XQFA 2BX6A 1DABA 5DNSA 2XC1A 3SQVA 3WWGA 3PETA 3ZSCA 1O8EA 4Z05A 2QX3A 1EA0A 2NSPA 1KQ5A 2UVEA 2X6YA 4YELA 2INUA 1IDJA 1OFDA 1O8JA 3VMWA 1O8LA 3RIQA 4XNFA 4OZZA 1JTAA 1HF2A 4OZYA 1VBLA 4OJOA 4KH3A 4OM9A 4W8SA 4XLHA 4YFOA 3SYJA 3JURA 4C2LA 3LMWA
chains in the Genus database with same CATH topology
1K5CA 2PECA 2NTBA 1X0CA 3VSTA 2NTQA 4YZ0A 2NT6A 1OFMA 5AMVA 4MXNA 2PYGA 1IDKA 1RU4A 4W8TA 1IA5A 1KTWA 4XORA 4W8QA 1O8KA 2PYHA 2NZMA 2ODLA 4NK8A 1O8HA 4XONA 2O17A 2VJJA 3VSVA 4I84A 2NSTA 2Z8GA 4YEJA 4XLFA 2VBMA 3T9GA 4XM3A 1O8MA 2NTPA 4XMYA 4XN0A 5C1EA 1O8GA 1EE6A 2UVFA 3B8YA 2IQ7A 3ZPPA 1HG8A 1PXZA 2BSPA 2O04A 4NK6A 1OGOX 1O8IA 4YZXA 4PMHA 1O8FA 4Z06A 2INVA 1BHEA 2X6XA 1KCDA 1QJVA 3GQ9A 1NHCA 4OJ5A 3VSUA 1GQ8A 1XG2A 3SUCA 1OOCA 1DBOA 4AVZA 2VBKA 1PLUA 2X85A 4OJPA 2VBEA 2EWEA 4XOPA 1H80A 3UW0A 4HWVA 4MR0A 4XLEA 1JRGA 1RWRA 2X3HA 3EQOA 3EQNA 4U4BA 2QY1A 4URRA 4YZAA 2O0WA 1O8DA 2O0VA 3KRGA 4XKWA 1RMGA 1DBGA 3B90A 1BN8A 2QXZA 1CZFA 2X6WA 4W8RA 4XKVA 4XN3A 1O88A 3GQAA 3GQ7A 4U49A 1QCXA 1PE9A 4XLAA 2VJIA 4Z03A 1OGMX 3FY3A 4XLCA 1AIRA 5C1CA 3B4NA 4OJLA 4XL9A 4XR6A 3VMVA 1KCCA 3GQ8A 2O1DA 1OFLA 4OJ6A 1IB4A 4XOTA 4EW9A 1WMRA 4YZQA 2NT9A 3GRHA 4XQFA 3WWGA 3ZSCA 1O8EA 4Z05A 2QX3A 2NSPA 2UVEA 4YELA 2X6YA 2INUA 1IDJA 3VMWA 1O8JA 1O8LA 4XNFA 4OZZA 1JTAA 4XLHA 4OZYA 1VBLA 4OJOA 4W8SA 3JURA 4C2LA 3LMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5C A;  2PEC A;  2NTB A;  1X0C A;  3VST A;  2NTQ A;  4YZ0 A;  2NT6 A;  1OFM A;  5AMV A;  4MXN A;  2PYG A;  1IDK A;  1RU4 A;  4W8T A;  1IA5 A;  1KTW A;  4XOR A;  4W8Q A;  1O8K A;  2PYH A;  2NZM A;  2ODL A;  4NK8 A;  1O8H A;  4XON A;  2O17 A;  2VJJ A;  3VSV A;  4I84 A;  2NST A;  2Z8G A;  4YEJ A;  4XLF A;  2VBM A;  3T9G A;  4XM3 A;  1O8M A;  2NTP A;  4XMY A;  4XN0 A;  5C1E A;  1O8G A;  1EE6 A;  2UVF A;  3B8Y A;  2IQ7 A;  3ZPP A;  1HG8 A;  1PXZ A;  2BSP A;  2O04 A;  4NK6 A;  1OGO X;  1O8I A;  4YZX A;  4PMH A;  1O8F A;  4Z06 A;  2INV A;  1BHE A;  2X6X A;  1KCD A;  1QJV A;  3GQ9 A;  1NHC A;  4OJ5 A;  3VSU A;  1GQ8 A;  1XG2 A;  3SUC A;  1OOC A;  1DBO A;  4AVZ A;  2VBK A;  1PLU A;  2X85 A;  4OJP A;  2VBE A;  2EWE A;  4XOP A;  1H80 A;  3UW0 A;  4HWV A;  4MR0 A;  4XLE A;  1JRG A;  1RWR A;  2X3H A;  3EQO A;  3EQN A;  4U4B A;  2QY1 A;  4URR A;  4YZA A;  2O0W A;  1O8D A;  2O0V A;  3KRG A;  4XKW A;  1RMG A;  1DBG A;  3B90 A;  1BN8 A;  2QXZ A;  1CZF A;  2X6W A;  4W8R A;  4XKV A;  4XN3 A;  1O88 A;  3GQA A;  3GQ7 A;  4U49 A;  1QCX A;  1PE9 A;  4XLA A;  2VJI A;  4Z03 A;  1OGM X;  3FY3 A;  4XLC A;  1AIR A;  5C1C A;  3B4N A;  4OJL A;  4XL9 A;  4XR6 A;  3VMV A;  1KCC A;  3GQ8 A;  2O1D A;  1OFL A;  4OJ6 A;  1IB4 A;  4XOT A;  4EW9 A;  1WMR A;  4YZQ A;  2NT9 A;  3GRH A;  4XQF A;  3WWG A;  3ZSC A;  1O8E A;  4Z05 A;  2QX3 A;  2NSP A;  2UVE A;  4YEL A;  2X6Y A;  2INU A;  1IDJ A;  3VMW A;  1O8J A;  1O8L A;  4XNF A;  4OZZ A;  1JTA A;  4XLH A;  4OZY A;  1VBL A;  4OJO A;  4W8S A;  3JUR A;  4C2L A;  3LMW A; 
#chains in the Genus database with same CATH topology
 1K5C A;  1QRC A;  2PEC A;  2NTB A;  3TH0 A;  1X0C A;  3VST A;  2NTQ A;  2J8I A;  2J8K A;  2XT2 A;  2NT6 A;  2B0R A;  4YZ0 A;  1QA2 A;  1OFM A;  1TYW A;  2VFQ A;  4MXN A;  5AMV A;  2PYG A;  1IDK A;  2QZA A;  1RU4 A;  4W8T A;  1IA5 A;  1KTW A;  4XOR A;  4W8Q A;  1O8K A;  3SY2 A;  2PYH A;  2NZM A;  3NAW A;  4OPW A;  2BM4 A;  2ODL A;  2IOU G;  1O8H A;  4NK8 A;  4XON A;  2O17 A;  1K4Z A;  2VJJ A;  3VSV A;  4I84 A;  2NST A;  2Z8G A;  3BH7 B;  2QYU A;  4YEJ A;  4XLF A;  2VBM A;  3T9G A;  2XT4 A;  4XM3 A;  1L1I A;  2VFN A;  3ML3 A;  1O8M A;  4YCQ A;  1TSP A;  1LM1 A;  2NTP A;  2VFM A;  4XMY A;  4XN0 A;  2VFP A;  5C1E A;  1O8G A;  1EE6 A;  2UVF A;  3B8Y A;  2IQ7 A;  3ZPP A;  1HG8 A;  1PXZ A;  3LJY A;  2BSP A;  2O04 A;  1CLW A;  1LLZ A;  2YUH A;  4NK6 A;  1OGO X;  3JX8 A;  1O8I A;  4YZX A;  4PMH A;  1O8F A;  4Z06 A;  2INV A;  1BHE A;  3DU1 X;  2X6X A;  1LLW A;  1QJV A;  1KCD A;  3GQ9 A;  1NHC A;  4OJ5 A;  4YC5 A;  3VSU A;  1GQ8 A;  3H09 A;  2G0Y A;  1XG2 A;  2BM7 A;  3SUC A;  2XTY A;  1OOC A;  1DBO A;  4AVZ A;  2VBK A;  1PLU A;  2X85 A;  3NB2 A;  3SZE A;  2W7Z A;  4OJP A;  2VBE A;  2EWE A;  4XOP A;  1H80 A;  3UW0 A;  2BM6 A;  1OFE A;  4HWV A;  1QA1 A;  4MR0 A;  4XLE A;  1JRG A;  3PSZ A;  1K8F A;  1RWR A;  2X3H A;  3EQO A;  3EQN A;  2VFO A;  4U4B A;  2BM5 A;  2QY1 A;  3N90 A;  2V5I A;  5JLV C;  4URR A;  4YZA A;  1WXR A;  2O0W A;  3N6Z A;  1O8D A;  3PSS A;  4JRA C;  2O0V A;  3KRG A;  4XKW A;  1RMG A;  1DBG A;  3B90 A;  1BN8 A;  2QXZ A;  1CZF A;  2X6W A;  1TYV A;  2F3L A;  4W8R A;  4XKV A;  1TYU A;  1O88 A;  3GQA A;  4XN3 A;  3GQ7 A;  3LYC A;  4U49 A;  1QCX A;  1PE9 A;  5JMC B;  4XLA A;  1EZG A;  2XTW A;  4YEI A;  2XTX A;  1TYX A;  2VJI A;  3BH6 B;  4Z03 A;  2O6W A;  1OGM X;  3FY3 A;  3P4G A;  4XLC A;  1AIR A;  5C1C A;  3B4N A;  4OJL A;  4XL9 A;  4XR6 A;  3VMV A;  1KCC A;  3GQ8 A;  2O1D A;  4YDT A;  1OFL A;  4OJ6 A;  1QQ1 A;  1QA3 A;  1IB4 A;  1QRB A;  4XOT A;  4EW9 A;  1WMR A;  4YZQ A;  3AK5 A;  4V02 C;  2NT9 A;  3GRH A;  4XQF A;  2BX6 A;  1DAB A;  5DNS A;  2XC1 A;  3SQV A;  3WWG A;  3PET A;  3ZSC A;  1O8E A;  4Z05 A;  2QX3 A;  1EA0 A;  2NSP A;  1KQ5 A;  2UVE A;  2X6Y A;  4YEL A;  2INU A;  1IDJ A;  1OFD A;  1O8J A;  3VMW A;  1O8L A;  3RIQ A;  4XNF A;  4OZZ A;  1JTA A;  1HF2 A;  4OZY A;  1VBL A;  4OJO A;  4KH3 A;  4OM9 A;  4W8S A;  4XLH A;  4YFO A;  3SYJ A;  3JUR A;  4C2L A;  3LMW A; 
#chains in the Genus database with same CATH homology
 1K5C A;  2PEC A;  2NTB A;  1X0C A;  3VST A;  2NTQ A;  4YZ0 A;  2NT6 A;  1OFM A;  5AMV A;  4MXN A;  2PYG A;  1IDK A;  1RU4 A;  4W8T A;  1IA5 A;  1KTW A;  4XOR A;  4W8Q A;  1O8K A;  2PYH A;  2NZM A;  2ODL A;  4NK8 A;  1O8H A;  4XON A;  2O17 A;  2VJJ A;  3VSV A;  4I84 A;  2NST A;  2Z8G A;  4YEJ A;  4XLF A;  2VBM A;  3T9G A;  4XM3 A;  1O8M A;  2NTP A;  4XMY A;  4XN0 A;  5C1E A;  1O8G A;  1EE6 A;  2UVF A;  3B8Y A;  2IQ7 A;  3ZPP A;  1HG8 A;  1PXZ A;  2BSP A;  2O04 A;  4NK6 A;  1OGO X;  1O8I A;  4YZX A;  4PMH A;  1O8F A;  4Z06 A;  2INV A;  1BHE A;  2X6X A;  1KCD A;  1QJV A;  3GQ9 A;  1NHC A;  4OJ5 A;  3VSU A;  1GQ8 A;  1XG2 A;  3SUC A;  1OOC A;  1DBO A;  4AVZ A;  2VBK A;  1PLU A;  2X85 A;  4OJP A;  2VBE A;  2EWE A;  4XOP A;  1H80 A;  3UW0 A;  4HWV A;  4MR0 A;  4XLE A;  1JRG A;  1RWR A;  2X3H A;  3EQO A;  3EQN A;  4U4B A;  2QY1 A;  4URR A;  4YZA A;  2O0W A;  1O8D A;  2O0V A;  3KRG A;  4XKW A;  1RMG A;  1DBG A;  3B90 A;  1BN8 A;  2QXZ A;  1CZF A;  2X6W A;  4W8R A;  4XKV A;  4XN3 A;  1O88 A;  3GQA A;  3GQ7 A;  4U49 A;  1QCX A;  1PE9 A;  4XLA A;  2VJI A;  4Z03 A;  1OGM X;  3FY3 A;  4XLC A;  1AIR A;  5C1C A;  3B4N A;  4OJL A;  4XL9 A;  4XR6 A;  3VMV A;  1KCC A;  3GQ8 A;  2O1D A;  1OFL A;  4OJ6 A;  1IB4 A;  4XOT A;  4EW9 A;  1WMR A;  4YZQ A;  2NT9 A;  3GRH A;  4XQF A;  3WWG A;  3ZSC A;  1O8E A;  4Z05 A;  2QX3 A;  2NSP A;  2UVE A;  4YEL A;  2X6Y A;  2INU A;  1IDJ A;  3VMW A;  1O8J A;  1O8L A;  4XNF A;  4OZZ A;  1JTA A;  4XLH A;  4OZY A;  1VBL A;  4OJO A;  4W8S A;  3JUR A;  4C2L A;  3LMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...