1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
1KCDA 1HG8A 2NT6A 4XLFA 3JURA 2X85A 1OFMA 4XNFA 1RWRA 4MXNA 2Z8GA 4Z06A 4AVZA 1DBOA 1O8HA 2EWEA 4OJLA 1O8IA 1JTAA 3VMWA 3VSTA 2NZMA 1EE6A 2NTBA 1KTWA 4XN0A 1IB4A 5AMVA 1X0CA 4XONA 2NSTA 2NTQA 4YZ0A 4Z05A 1JRGA 2VBMA 4OJ6A 4YZAA 4OJ5A 4U49A 4XOPA 1RU4A 2X6WA 2O04A 4YEJA 2O17A 4XORA 2NTPA 4URRA 1PE9A 4I84A 3B8YA 3B4NA 4OZYA 1IDJA 4NK6A 1O8LA 1OGOX 1VBLA 1O8GA 3T9GA 4XLEA 4OZZA 3VSUA 1OFLA 1QCXA 1O8FA 2NSPA 1OOCA 2O0VA 4YZQA 4XLCA 5C1CA 1H80A 4W8TA 4C2LA 2VJIA 3EQNA 3UW0A 2VBEA 4XN3A 1PLUA 1RMGA 4U4BA 1BHEA 3ZSCA 1NHCA 2INUA 2X6XA 3SUCA 3FY3A 1O8DA 3B90A 3GQAA 1GQ8A 2IQ7A 1BN8A 4HWVA 2NT9A 2PYHA 2O0WA 3GRHA 4XMYA 1QJVA 3ZPPA 2QY1A 4XM3A 2BSPA 2UVEA 3GQ7A 2PECA 1PXZA 3VMVA 3GQ9A 4XL9A 3EQOA 1WMRA 3GQ8A 1O88A 4XLAA 4Z03A 4XKWA 4OJOA 4YELA 4MR0A 4W8RA 1O8EA 2PYGA 4XR6A 4XQFA 1O8JA 4W8SA 1IDKA 4OJPA 4W8QA 1O8KA 1OGMX 3VSVA 1CZFA 1XG2A 1IA5A 1KCCA 3KRGA 1K5CA 2QXZA 1AIRA 2O1DA 4XOTA 2VJJA 2ODLA 2X6YA 2UVFA 5C1EA 2QX3A 2X3HA 2INVA 1DBGA 1O8MA 3LMWA 4PMHA 3WWGA 4XKVA 2VBKA 4XLHA 4EW9A 4NK8A 4YZXA
chains in the Genus database with same CATH superfamily
3BH7B 1TSPA 1KCDA 1HG8A 2NT6A 2VFOA 3JURA 2X85A 1OFMA 4XLFA 4XNFA 1RWRA 1TYUA 4MXNA 1QA1A 2Z8GA 4Z06A 1K8FA 1DBOA 2YUHA 4AVZA 1O8HA 2EWEA 4OJLA 1O8IA 2VFPA 1JTAA 3VMWA 3VSTA 2BM4A 2NZMA 3SQVA 1EE6A 4YEIA 2NTBA 1KTWA 4XN0A 4YDTA 2XTYA 1IB4A 5AMVA 1KQ5A 2J8KA 1X0CA 2J8IA 3SZEA 4XONA 1TYVA 4KH3A 2NSTA 2NTQA 4YZ0A 4EW9A 4Z05A 1JRGA 2B0RA 2VBMA 4OJ6A 4V02C 4OJ5A 4YZAA 4U49A 1QRBA 4XOPA 1RU4A 2X6WA 3NB2A 3LJYA 2O04A 4YCQA 2XC1A 4YEJA 3DU1X 2O17A 4XORA 2NTPA 4URRA 2XTXA 1PE9A 4I84A 3B8YA 2W7ZA 3B4NA 4NK8A 1TYWA 4OZYA 1IDJA 4NK6A 1O8LA 1OGOX 1VBLA 1O8GA 3T9GA 4XLEA 4OZZA 3VSUA 1OFLA 1QCXA 1O8FA 2NSPA 1OOCA 2O0VA 4YZQA 1QA3A 4JRAC 4XLCA 5C1CA 1H80A 1QRCA 4W8TA 4C2LA 2VJIA 3EQNA 3UW0A 2VBEA 4XN3A 1PLUA 1L1IA 1RMGA 4U4BA 1BHEA 3ZSCA 3JX8A 1NHCA 2INUA 2X6XA 3SUCA 3FY3A 1O8DA 3B90A 3GQAA 2QYUA 1GQ8A 2IQ7A 3N6ZA 1OFEA 1BN8A 1LLWA 2BX6A 1OFDA 3PSSA 4HWVA 4YC5A 2NT9A 2PYHA 2O0WA 3GRHA 4XMYA 3N90A 1QJVA 3H09A 3SYJA 2QY1A 3ZPPA 1WXRA 4XM3A 2BSPA 1DABA 2UVEA 3AK5A 2G0YA 1QQ1A 3GQ7A 2PECA 1LM1A 3NAWA 2BM7A 1QA2A 1PXZA 3VMVA 3TH0A 3P4GA 3GQ9A 3SY2A 3PETA 4XL9A 2XT2A 3EQOA 1K4ZA 1WMRA 3GQ8A 2XT4A 1O88A 4XLAA 4Z03A 3LYCA 4XKWA 4OJOA 4YELA 4MR0A 4W8RA 1O8EA 2PYGA 2QZAA 4XR6A 4YFOA 4XQFA 1O8JA 4W8SA 2O6WA 2VFNA 2XTWA 3ML3A 4OPWA 4OM9A 2VFQA 1IDKA 4OJPA 4W8QA 2BM6A 3RIQA 1CLWA 5JMCB 1O8KA 1OGMX 2F3LA 1CZFA 1XG2A 3BH6B 2VFMA 3VSVA 1IA5A 1KCCA 3KRGA 1K5CA 1EA0A 1EZGA 2QXZA 2IOUG 1AIRA 5JLVC 2O1DA 4XOTA 2VJJA 2ODLA 1HF2A 2UVFA 2X6YA 5C1EA 2QX3A 2X3HA 2INVA 1DBGA 1O8MA 3LMWA 4PMHA 3WWGA 4XKVA 5DNSA 2V5IA 1LLZA 2VBKA 4XLHA 2BM5A 1TYXA 3PSZA 4YZXA
chains in the Genus database with same CATH topology
1KCDA 1HG8A 2NT6A 4XLFA 3JURA 2X85A 1OFMA 4XNFA 1RWRA 4MXNA 2Z8GA 4Z06A 4AVZA 1DBOA 1O8HA 2EWEA 4OJLA 1O8IA 1JTAA 3VMWA 3VSTA 2NZMA 1EE6A 2NTBA 1KTWA 4XN0A 1IB4A 5AMVA 1X0CA 4XONA 2NSTA 2NTQA 4YZ0A 4Z05A 1JRGA 2VBMA 4OJ6A 4YZAA 4OJ5A 4U49A 4XOPA 1RU4A 2X6WA 2O04A 4YEJA 2O17A 4XORA 2NTPA 4URRA 1PE9A 4I84A 3B8YA 3B4NA 4OZYA 1IDJA 4NK6A 1O8LA 1OGOX 1VBLA 1O8GA 3T9GA 4XLEA 4OZZA 3VSUA 1OFLA 1QCXA 1O8FA 2NSPA 1OOCA 2O0VA 4YZQA 4XLCA 5C1CA 1H80A 4W8TA 4C2LA 2VJIA 3EQNA 3UW0A 2VBEA 4XN3A 1PLUA 1RMGA 4U4BA 1BHEA 3ZSCA 1NHCA 2INUA 2X6XA 3SUCA 3FY3A 1O8DA 3B90A 3GQAA 1GQ8A 2IQ7A 1BN8A 4HWVA 2NT9A 2PYHA 2O0WA 3GRHA 4XMYA 1QJVA 3ZPPA 2QY1A 4XM3A 2BSPA 2UVEA 3GQ7A 2PECA 1PXZA 3VMVA 3GQ9A 4XL9A 3EQOA 1WMRA 3GQ8A 1O88A 4XLAA 4Z03A 4XKWA 4OJOA 4YELA 4MR0A 4W8RA 1O8EA 2PYGA 4XR6A 4XQFA 1O8JA 4W8SA 1IDKA 4OJPA 4W8QA 1O8KA 1OGMX 3VSVA 1CZFA 1XG2A 1IA5A 1KCCA 3KRGA 1K5CA 2QXZA 1AIRA 2O1DA 4XOTA 2VJJA 2ODLA 2X6YA 2UVFA 5C1EA 2QX3A 2X3HA 2INVA 1DBGA 1O8MA 3LMWA 4PMHA 3WWGA 4XKVA 2VBKA 4XLHA 4EW9A 4NK8A 4YZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCD A;  1HG8 A;  2NT6 A;  4XLF A;  3JUR A;  2X85 A;  1OFM A;  4XNF A;  1RWR A;  4MXN A;  2Z8G A;  4Z06 A;  4AVZ A;  1DBO A;  1O8H A;  2EWE A;  4OJL A;  1O8I A;  1JTA A;  3VMW A;  3VST A;  2NZM A;  1EE6 A;  2NTB A;  1KTW A;  4XN0 A;  1IB4 A;  5AMV A;  1X0C A;  4XON A;  2NST A;  2NTQ A;  4YZ0 A;  4Z05 A;  1JRG A;  2VBM A;  4OJ6 A;  4YZA A;  4OJ5 A;  4U49 A;  4XOP A;  1RU4 A;  2X6W A;  2O04 A;  4YEJ A;  2O17 A;  4XOR A;  2NTP A;  4URR A;  1PE9 A;  4I84 A;  3B8Y A;  3B4N A;  4OZY A;  1IDJ A;  4NK6 A;  1O8L A;  1OGO X;  1VBL A;  1O8G A;  3T9G A;  4XLE A;  4OZZ A;  3VSU A;  1OFL A;  1QCX A;  1O8F A;  2NSP A;  1OOC A;  2O0V A;  4YZQ A;  4XLC A;  5C1C A;  1H80 A;  4W8T A;  4C2L A;  2VJI A;  3EQN A;  3UW0 A;  2VBE A;  4XN3 A;  1PLU A;  1RMG A;  4U4B A;  1BHE A;  3ZSC A;  1NHC A;  2INU A;  2X6X A;  3SUC A;  3FY3 A;  1O8D A;  3B90 A;  3GQA A;  1GQ8 A;  2IQ7 A;  1BN8 A;  4HWV A;  2NT9 A;  2PYH A;  2O0W A;  3GRH A;  4XMY A;  1QJV A;  3ZPP A;  2QY1 A;  4XM3 A;  2BSP A;  2UVE A;  3GQ7 A;  2PEC A;  1PXZ A;  3VMV A;  3GQ9 A;  4XL9 A;  3EQO A;  1WMR A;  3GQ8 A;  1O88 A;  4XLA A;  4Z03 A;  4XKW A;  4OJO A;  4YEL A;  4MR0 A;  4W8R A;  1O8E A;  2PYG A;  4XR6 A;  4XQF A;  1O8J A;  4W8S A;  1IDK A;  4OJP A;  4W8Q A;  1O8K A;  1OGM X;  3VSV A;  1CZF A;  1XG2 A;  1IA5 A;  1KCC A;  3KRG A;  1K5C A;  2QXZ A;  1AIR A;  2O1D A;  4XOT A;  2VJJ A;  2ODL A;  2X6Y A;  2UVF A;  5C1E A;  2QX3 A;  2X3H A;  2INV A;  1DBG A;  1O8M A;  3LMW A;  4PMH A;  3WWG A;  4XKV A;  2VBK A;  4XLH A;  4EW9 A;  4NK8 A;  4YZX A; 
#chains in the Genus database with same CATH topology
 3BH7 B;  1TSP A;  1KCD A;  1HG8 A;  2NT6 A;  2VFO A;  3JUR A;  2X85 A;  1OFM A;  4XLF A;  4XNF A;  1RWR A;  1TYU A;  4MXN A;  1QA1 A;  2Z8G A;  4Z06 A;  1K8F A;  1DBO A;  2YUH A;  4AVZ A;  1O8H A;  2EWE A;  4OJL A;  1O8I A;  2VFP A;  1JTA A;  3VMW A;  3VST A;  2BM4 A;  2NZM A;  3SQV A;  1EE6 A;  4YEI A;  2NTB A;  1KTW A;  4XN0 A;  4YDT A;  2XTY A;  1IB4 A;  5AMV A;  1KQ5 A;  2J8K A;  1X0C A;  2J8I A;  3SZE A;  4XON A;  1TYV A;  4KH3 A;  2NST A;  2NTQ A;  4YZ0 A;  4EW9 A;  4Z05 A;  1JRG A;  2B0R A;  2VBM A;  4OJ6 A;  4V02 C;  4OJ5 A;  4YZA A;  4U49 A;  1QRB A;  4XOP A;  1RU4 A;  2X6W A;  3NB2 A;  3LJY A;  2O04 A;  4YCQ A;  2XC1 A;  4YEJ A;  3DU1 X;  2O17 A;  4XOR A;  2NTP A;  4URR A;  2XTX A;  1PE9 A;  4I84 A;  3B8Y A;  2W7Z A;  3B4N A;  4NK8 A;  1TYW A;  4OZY A;  1IDJ A;  4NK6 A;  1O8L A;  1OGO X;  1VBL A;  1O8G A;  3T9G A;  4XLE A;  4OZZ A;  3VSU A;  1OFL A;  1QCX A;  1O8F A;  2NSP A;  1OOC A;  2O0V A;  4YZQ A;  1QA3 A;  4JRA C;  4XLC A;  5C1C A;  1H80 A;  1QRC A;  4W8T A;  4C2L A;  2VJI A;  3EQN A;  3UW0 A;  2VBE A;  4XN3 A;  1PLU A;  1L1I A;  1RMG A;  4U4B A;  1BHE A;  3ZSC A;  3JX8 A;  1NHC A;  2INU A;  2X6X A;  3SUC A;  3FY3 A;  1O8D A;  3B90 A;  3GQA A;  2QYU A;  1GQ8 A;  2IQ7 A;  3N6Z A;  1OFE A;  1BN8 A;  1LLW A;  2BX6 A;  1OFD A;  3PSS A;  4HWV A;  4YC5 A;  2NT9 A;  2PYH A;  2O0W A;  3GRH A;  4XMY A;  3N90 A;  1QJV A;  3H09 A;  3SYJ A;  2QY1 A;  3ZPP A;  1WXR A;  4XM3 A;  2BSP A;  1DAB A;  2UVE A;  3AK5 A;  2G0Y A;  1QQ1 A;  3GQ7 A;  2PEC A;  1LM1 A;  3NAW A;  2BM7 A;  1QA2 A;  1PXZ A;  3VMV A;  3TH0 A;  3P4G A;  3GQ9 A;  3SY2 A;  3PET A;  4XL9 A;  2XT2 A;  3EQO A;  1K4Z A;  1WMR A;  3GQ8 A;  2XT4 A;  1O88 A;  4XLA A;  4Z03 A;  3LYC A;  4XKW A;  4OJO A;  4YEL A;  4MR0 A;  4W8R A;  1O8E A;  2PYG A;  2QZA A;  4XR6 A;  4YFO A;  4XQF A;  1O8J A;  4W8S A;  2O6W A;  2VFN A;  2XTW A;  3ML3 A;  4OPW A;  4OM9 A;  2VFQ A;  1IDK A;  4OJP A;  4W8Q A;  2BM6 A;  3RIQ A;  1CLW A;  5JMC B;  1O8K A;  1OGM X;  2F3L A;  1CZF A;  1XG2 A;  3BH6 B;  2VFM A;  3VSV A;  1IA5 A;  1KCC A;  3KRG A;  1K5C A;  1EA0 A;  1EZG A;  2QXZ A;  2IOU G;  1AIR A;  5JLV C;  2O1D A;  4XOT A;  2VJJ A;  2ODL A;  1HF2 A;  2UVF A;  2X6Y A;  5C1E A;  2QX3 A;  2X3H A;  2INV A;  1DBG A;  1O8M A;  3LMW A;  4PMH A;  3WWG A;  4XKV A;  5DNS A;  2V5I A;  1LLZ A;  2VBK A;  4XLH A;  2BM5 A;  1TYX A;  3PSZ A;  4YZX A; 
#chains in the Genus database with same CATH homology
 1KCD A;  1HG8 A;  2NT6 A;  4XLF A;  3JUR A;  2X85 A;  1OFM A;  4XNF A;  1RWR A;  4MXN A;  2Z8G A;  4Z06 A;  4AVZ A;  1DBO A;  1O8H A;  2EWE A;  4OJL A;  1O8I A;  1JTA A;  3VMW A;  3VST A;  2NZM A;  1EE6 A;  2NTB A;  1KTW A;  4XN0 A;  1IB4 A;  5AMV A;  1X0C A;  4XON A;  2NST A;  2NTQ A;  4YZ0 A;  4Z05 A;  1JRG A;  2VBM A;  4OJ6 A;  4YZA A;  4OJ5 A;  4U49 A;  4XOP A;  1RU4 A;  2X6W A;  2O04 A;  4YEJ A;  2O17 A;  4XOR A;  2NTP A;  4URR A;  1PE9 A;  4I84 A;  3B8Y A;  3B4N A;  4OZY A;  1IDJ A;  4NK6 A;  1O8L A;  1OGO X;  1VBL A;  1O8G A;  3T9G A;  4XLE A;  4OZZ A;  3VSU A;  1OFL A;  1QCX A;  1O8F A;  2NSP A;  1OOC A;  2O0V A;  4YZQ A;  4XLC A;  5C1C A;  1H80 A;  4W8T A;  4C2L A;  2VJI A;  3EQN A;  3UW0 A;  2VBE A;  4XN3 A;  1PLU A;  1RMG A;  4U4B A;  1BHE A;  3ZSC A;  1NHC A;  2INU A;  2X6X A;  3SUC A;  3FY3 A;  1O8D A;  3B90 A;  3GQA A;  1GQ8 A;  2IQ7 A;  1BN8 A;  4HWV A;  2NT9 A;  2PYH A;  2O0W A;  3GRH A;  4XMY A;  1QJV A;  3ZPP A;  2QY1 A;  4XM3 A;  2BSP A;  2UVE A;  3GQ7 A;  2PEC A;  1PXZ A;  3VMV A;  3GQ9 A;  4XL9 A;  3EQO A;  1WMR A;  3GQ8 A;  1O88 A;  4XLA A;  4Z03 A;  4XKW A;  4OJO A;  4YEL A;  4MR0 A;  4W8R A;  1O8E A;  2PYG A;  4XR6 A;  4XQF A;  1O8J A;  4W8S A;  1IDK A;  4OJP A;  4W8Q A;  1O8K A;  1OGM X;  3VSV A;  1CZF A;  1XG2 A;  1IA5 A;  1KCC A;  3KRG A;  1K5C A;  2QXZ A;  1AIR A;  2O1D A;  4XOT A;  2VJJ A;  2ODL A;  2X6Y A;  2UVF A;  5C1E A;  2QX3 A;  2X3H A;  2INV A;  1DBG A;  1O8M A;  3LMW A;  4PMH A;  3WWG A;  4XKV A;  2VBK A;  4XLH A;  4EW9 A;  4NK8 A;  4YZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...