1K5CA

Endopolygalacturonase i from stereum purpureum at 0.96 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1k5cA00
2VJIA 4XOTA 4Z03A 1O8FA 2NT9A 1OGOX 1NHCA 2O0VA 2PECA 2X6XA 1RWRA 4AVZA 3GQ8A 2QXZA 4YZQA 1KCDA 2QX3A 2NT6A 2NTPA 4C2LA 4XN3A 3T9GA 3VSUA 1X0CA 2X3HA 4Z05A 2EWEA 4XN0A 4U49A 2O1DA 2UVEA 4XNFA 4XORA 4W8TA 4URRA 1GQ8A 4W8QA 1O8DA 1O8GA 4OJ5A 1O8MA 4YZXA 3EQOA 3VSVA 2O04A 3ZSCA 3GQAA 2NZMA 1K5CA 4YZ0A 4XLFA 3GRHA 4XKWA 1BN8A 4XM3A 4XOPA 1EE6A 2BSPA 3B4NA 1KCCA 1KTWA 1O8KA 4W8SA 3B90A 1DBOA 2NSTA 1H80A 4HWVA 2INVA 1OFLA 2NSPA 2VBKA 1VBLA 2X6WA 3GQ7A 4OJOA 1OFMA 4XLCA 1AIRA 1O8JA 1RU4A 3FY3A 4XQFA 1PLUA 1RMGA 2Z8GA 3JURA 1OGMX 1JTAA 2VJJA 4YEJA 2UVFA 4XLHA 3SUCA 1O88A 4OZYA 1IA5A 2NTBA 4XONA 1XG2A 4Z06A 3GQ9A 1IDJA 2IQ7A 1O8EA 2X85A 3KRGA 4MR0A 4XLEA 4XKVA 1BHEA 1JRGA 2INUA 4OZZA 1O8LA 4XL9A 1IB4A 1HG8A 4XR6A 4U4BA 3VMWA 3EQNA 2PYHA 2VBEA 4PMHA 4XMYA 1DBGA 5AMVA 4NK6A 1PXZA 3LMWA 4XLAA 2O0WA 3UW0A 1O8HA 5C1CA 4W8RA 1QCXA 2QY1A 4OJLA 4OJ6A 2NTQA 1O8IA 3B8YA 4YELA 3WWGA 4I84A 5C1EA 4OJPA 1IDKA 1QJVA 4NK8A 3VSTA 2ODLA 4YZAA 3ZPPA 2PYGA 1PE9A 2O17A 3VMVA 1OOCA 1WMRA 4MXNA 2X6YA 1CZFA 4EW9A 2VBMA
chains in the Genus database with same CATH superfamily
3SQVA 2VJIA 1QA3A 4XOTA 4Z03A 1O8FA 1QRBA 1OGOX 2NT9A 3ML3A 1DABA 1NHCA 1EZGA 2XC1A 3N90A 3SY2A 1CLWA 2O0VA 2PECA 2X6XA 1RWRA 4AVZA 2IOUG 3GQ8A 1HF2A 2XT2A 2QXZA 4YZQA 3H09A 3LYCA 1KCDA 2QX3A 3N6ZA 2NT6A 2NTPA 4C2LA 4XN3A 2VFOA 3T9GA 2QYUA 3VSUA 1X0CA 5JMCB 2X3HA 4Z05A 2EWEA 4XN0A 4JRAC 4U49A 2O1DA 2UVEA 4XNFA 1TYVA 1LM1A 4XORA 5DNSA 1OFEA 4W8TA 1LLWA 2VFMA 1GQ8A 4URRA 1O8DA 1O8GA 4OJ5A 4W8QA 3LJYA 1O8MA 4YZXA 3SZEA 3EQOA 3VSVA 2O04A 3ZSCA 3GQAA 2NZMA 1K5CA 4YZ0A 4XLFA 1EA0A 3GRHA 4XKWA 1BN8A 2YUHA 4XM3A 4XOPA 1EE6A 2BSPA 2J8KA 3B4NA 3PSZA 1QQ1A 1KCCA 1KTWA 1O8KA 4W8SA 3B90A 1QA2A 2VFPA 1DBOA 2NSTA 1H80A 2XTXA 4HWVA 2J8IA 2F3LA 3P4GA 2INVA 1OFLA 2NSPA 2VBKA 1VBLA 2X6WA 1TYUA 3GQ7A 4YCQA 4OJOA 1K8FA 1OFMA 4XLCA 2BM5A 1AIRA 1O8JA 3DU1X 1RU4A 3FY3A 3BH7B 1KQ5A 1PLUA 1RMGA 3PSSA 4XQFA 2Z8GA 4V02C 3JURA 1OGMX 1JTAA 2VJJA 4OPWA 4YEJA 2UVFA 4XLHA 2BX6A 2W7ZA 3SUCA 1O88A 3AK5A 4OZYA 1IA5A 1L1IA 1K4ZA 2NTBA 4YDTA 2QZAA 1QRCA 5JLVC 4XONA 2O6WA 4KH3A 1XG2A 4Z06A 3GQ9A 1IDJA 2IQ7A 2XTWA 1O8EA 2X85A 3KRGA 2VFQA 4MR0A 4XLEA 2G0YA 4XKVA 1BHEA 1JRGA 2INUA 4OM9A 1QA1A 4OZZA 2BM6A 1O8LA 1LLZA 4XL9A 1IB4A 2VFNA 3NB2A 1HG8A 4YFOA 2XT4A 2BM4A 4XR6A 4U4BA 3VMWA 3EQNA 2PYHA 2VBEA 4PMHA 4XMYA 2B0RA 1DBGA 5AMVA 4NK6A 1PXZA 2BM7A 1OFDA 3LMWA 3BH6B 4XLAA 2O0WA 3UW0A 3PETA 1O8HA 1TYXA 2V5IA 4W8RA 1QCXA 2QY1A 4OJLA 4OJ6A 3TH0A 5C1CA 1TSPA 4YEIA 2NTQA 4YC5A 3SYJA 1O8IA 3B8YA 4YELA 3WWGA 4I84A 5C1EA 4OJPA 1IDKA 1TYWA 1QJVA 4NK8A 3NAWA 3VSTA 2ODLA 4YZAA 3ZPPA 2PYGA 2XTYA 1PE9A 3JX8A 2O17A 3VMVA 3RIQA 1OOCA 1WMRA 4MXNA 1WXRA 2X6YA 1CZFA 4EW9A 2VBMA
chains in the Genus database with same CATH topology
2VJIA 4XOTA 4Z03A 1O8FA 2NT9A 1OGOX 1NHCA 2O0VA 2PECA 2X6XA 1RWRA 4AVZA 3GQ8A 2QXZA 4YZQA 1KCDA 2QX3A 2NT6A 2NTPA 4C2LA 4XN3A 3T9GA 3VSUA 1X0CA 2X3HA 4Z05A 2EWEA 4XN0A 4U49A 2O1DA 2UVEA 4XNFA 4XORA 4W8TA 4URRA 1GQ8A 4W8QA 1O8DA 1O8GA 4OJ5A 1O8MA 4YZXA 3EQOA 3VSVA 2O04A 3ZSCA 3GQAA 2NZMA 1K5CA 4YZ0A 4XLFA 3GRHA 4XKWA 1BN8A 4XM3A 4XOPA 1EE6A 2BSPA 3B4NA 1KCCA 1KTWA 1O8KA 4W8SA 3B90A 1DBOA 2NSTA 1H80A 4HWVA 2INVA 1OFLA 2NSPA 2VBKA 1VBLA 2X6WA 3GQ7A 4OJOA 1OFMA 4XLCA 1AIRA 1O8JA 1RU4A 3FY3A 4XQFA 1PLUA 1RMGA 2Z8GA 3JURA 1OGMX 1JTAA 2VJJA 4YEJA 2UVFA 4XLHA 3SUCA 1O88A 4OZYA 1IA5A 2NTBA 4XONA 1XG2A 4Z06A 3GQ9A 1IDJA 2IQ7A 1O8EA 2X85A 3KRGA 4MR0A 4XLEA 4XKVA 1BHEA 1JRGA 2INUA 4OZZA 1O8LA 4XL9A 1IB4A 1HG8A 4XR6A 4U4BA 3VMWA 3EQNA 2PYHA 2VBEA 4PMHA 4XMYA 1DBGA 5AMVA 4NK6A 1PXZA 3LMWA 4XLAA 2O0WA 3UW0A 1O8HA 5C1CA 4W8RA 1QCXA 2QY1A 4OJLA 4OJ6A 2NTQA 1O8IA 3B8YA 4YELA 3WWGA 4I84A 5C1EA 4OJPA 1IDKA 1QJVA 4NK8A 3VSTA 2ODLA 4YZAA 3ZPPA 2PYGA 1PE9A 2O17A 3VMVA 1OOCA 1WMRA 4MXNA 2X6YA 1CZFA 4EW9A 2VBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJI A;  4XOT A;  4Z03 A;  1O8F A;  2NT9 A;  1OGO X;  1NHC A;  2O0V A;  2PEC A;  2X6X A;  1RWR A;  4AVZ A;  3GQ8 A;  2QXZ A;  4YZQ A;  1KCD A;  2QX3 A;  2NT6 A;  2NTP A;  4C2L A;  4XN3 A;  3T9G A;  3VSU A;  1X0C A;  2X3H A;  4Z05 A;  2EWE A;  4XN0 A;  4U49 A;  2O1D A;  2UVE A;  4XNF A;  4XOR A;  4W8T A;  4URR A;  1GQ8 A;  4W8Q A;  1O8D A;  1O8G A;  4OJ5 A;  1O8M A;  4YZX A;  3EQO A;  3VSV A;  2O04 A;  3ZSC A;  3GQA A;  2NZM A;  1K5C A;  4YZ0 A;  4XLF A;  3GRH A;  4XKW A;  1BN8 A;  4XM3 A;  4XOP A;  1EE6 A;  2BSP A;  3B4N A;  1KCC A;  1KTW A;  1O8K A;  4W8S A;  3B90 A;  1DBO A;  2NST A;  1H80 A;  4HWV A;  2INV A;  1OFL A;  2NSP A;  2VBK A;  1VBL A;  2X6W A;  3GQ7 A;  4OJO A;  1OFM A;  4XLC A;  1AIR A;  1O8J A;  1RU4 A;  3FY3 A;  4XQF A;  1PLU A;  1RMG A;  2Z8G A;  3JUR A;  1OGM X;  1JTA A;  2VJJ A;  4YEJ A;  2UVF A;  4XLH A;  3SUC A;  1O88 A;  4OZY A;  1IA5 A;  2NTB A;  4XON A;  1XG2 A;  4Z06 A;  3GQ9 A;  1IDJ A;  2IQ7 A;  1O8E A;  2X85 A;  3KRG A;  4MR0 A;  4XLE A;  4XKV A;  1BHE A;  1JRG A;  2INU A;  4OZZ A;  1O8L A;  4XL9 A;  1IB4 A;  1HG8 A;  4XR6 A;  4U4B A;  3VMW A;  3EQN A;  2PYH A;  2VBE A;  4PMH A;  4XMY A;  1DBG A;  5AMV A;  4NK6 A;  1PXZ A;  3LMW A;  4XLA A;  2O0W A;  3UW0 A;  1O8H A;  5C1C A;  4W8R A;  1QCX A;  2QY1 A;  4OJL A;  4OJ6 A;  2NTQ A;  1O8I A;  3B8Y A;  4YEL A;  3WWG A;  4I84 A;  5C1E A;  4OJP A;  1IDK A;  1QJV A;  4NK8 A;  3VST A;  2ODL A;  4YZA A;  3ZPP A;  2PYG A;  1PE9 A;  2O17 A;  3VMV A;  1OOC A;  1WMR A;  4MXN A;  2X6Y A;  1CZF A;  4EW9 A;  2VBM A; 
#chains in the Genus database with same CATH topology
 3SQV A;  2VJI A;  1QA3 A;  4XOT A;  4Z03 A;  1O8F A;  1QRB A;  1OGO X;  2NT9 A;  3ML3 A;  1DAB A;  1NHC A;  1EZG A;  2XC1 A;  3N90 A;  3SY2 A;  1CLW A;  2O0V A;  2PEC A;  2X6X A;  1RWR A;  4AVZ A;  2IOU G;  3GQ8 A;  1HF2 A;  2XT2 A;  2QXZ A;  4YZQ A;  3H09 A;  3LYC A;  1KCD A;  2QX3 A;  3N6Z A;  2NT6 A;  2NTP A;  4C2L A;  4XN3 A;  2VFO A;  3T9G A;  2QYU A;  3VSU A;  1X0C A;  5JMC B;  2X3H A;  4Z05 A;  2EWE A;  4XN0 A;  4JRA C;  4U49 A;  2O1D A;  2UVE A;  4XNF A;  1TYV A;  1LM1 A;  4XOR A;  5DNS A;  1OFE A;  4W8T A;  1LLW A;  2VFM A;  1GQ8 A;  4URR A;  1O8D A;  1O8G A;  4OJ5 A;  4W8Q A;  3LJY A;  1O8M A;  4YZX A;  3SZE A;  3EQO A;  3VSV A;  2O04 A;  3ZSC A;  3GQA A;  2NZM A;  1K5C A;  4YZ0 A;  4XLF A;  1EA0 A;  3GRH A;  4XKW A;  1BN8 A;  2YUH A;  4XM3 A;  4XOP A;  1EE6 A;  2BSP A;  2J8K A;  3B4N A;  3PSZ A;  1QQ1 A;  1KCC A;  1KTW A;  1O8K A;  4W8S A;  3B90 A;  1QA2 A;  2VFP A;  1DBO A;  2NST A;  1H80 A;  2XTX A;  4HWV A;  2J8I A;  2F3L A;  3P4G A;  2INV A;  1OFL A;  2NSP A;  2VBK A;  1VBL A;  2X6W A;  1TYU A;  3GQ7 A;  4YCQ A;  4OJO A;  1K8F A;  1OFM A;  4XLC A;  2BM5 A;  1AIR A;  1O8J A;  3DU1 X;  1RU4 A;  3FY3 A;  3BH7 B;  1KQ5 A;  1PLU A;  1RMG A;  3PSS A;  4XQF A;  2Z8G A;  4V02 C;  3JUR A;  1OGM X;  1JTA A;  2VJJ A;  4OPW A;  4YEJ A;  2UVF A;  4XLH A;  2BX6 A;  2W7Z A;  3SUC A;  1O88 A;  3AK5 A;  4OZY A;  1IA5 A;  1L1I A;  1K4Z A;  2NTB A;  4YDT A;  2QZA A;  1QRC A;  5JLV C;  4XON A;  2O6W A;  4KH3 A;  1XG2 A;  4Z06 A;  3GQ9 A;  1IDJ A;  2IQ7 A;  2XTW A;  1O8E A;  2X85 A;  3KRG A;  2VFQ A;  4MR0 A;  4XLE A;  2G0Y A;  4XKV A;  1BHE A;  1JRG A;  2INU A;  4OM9 A;  1QA1 A;  4OZZ A;  2BM6 A;  1O8L A;  1LLZ A;  4XL9 A;  1IB4 A;  2VFN A;  3NB2 A;  1HG8 A;  4YFO A;  2XT4 A;  2BM4 A;  4XR6 A;  4U4B A;  3VMW A;  3EQN A;  2PYH A;  2VBE A;  4PMH A;  4XMY A;  2B0R A;  1DBG A;  5AMV A;  4NK6 A;  1PXZ A;  2BM7 A;  1OFD A;  3LMW A;  3BH6 B;  4XLA A;  2O0W A;  3UW0 A;  3PET A;  1O8H A;  1TYX A;  2V5I A;  4W8R A;  1QCX A;  2QY1 A;  4OJL A;  4OJ6 A;  3TH0 A;  5C1C A;  1TSP A;  4YEI A;  2NTQ A;  4YC5 A;  3SYJ A;  1O8I A;  3B8Y A;  4YEL A;  3WWG A;  4I84 A;  5C1E A;  4OJP A;  1IDK A;  1TYW A;  1QJV A;  4NK8 A;  3NAW A;  3VST A;  2ODL A;  4YZA A;  3ZPP A;  2PYG A;  2XTY A;  1PE9 A;  3JX8 A;  2O17 A;  3VMV A;  3RIQ A;  1OOC A;  1WMR A;  4MXN A;  1WXR A;  2X6Y A;  1CZF A;  4EW9 A;  2VBM A; 
#chains in the Genus database with same CATH homology
 2VJI A;  4XOT A;  4Z03 A;  1O8F A;  2NT9 A;  1OGO X;  1NHC A;  2O0V A;  2PEC A;  2X6X A;  1RWR A;  4AVZ A;  3GQ8 A;  2QXZ A;  4YZQ A;  1KCD A;  2QX3 A;  2NT6 A;  2NTP A;  4C2L A;  4XN3 A;  3T9G A;  3VSU A;  1X0C A;  2X3H A;  4Z05 A;  2EWE A;  4XN0 A;  4U49 A;  2O1D A;  2UVE A;  4XNF A;  4XOR A;  4W8T A;  4URR A;  1GQ8 A;  4W8Q A;  1O8D A;  1O8G A;  4OJ5 A;  1O8M A;  4YZX A;  3EQO A;  3VSV A;  2O04 A;  3ZSC A;  3GQA A;  2NZM A;  1K5C A;  4YZ0 A;  4XLF A;  3GRH A;  4XKW A;  1BN8 A;  4XM3 A;  4XOP A;  1EE6 A;  2BSP A;  3B4N A;  1KCC A;  1KTW A;  1O8K A;  4W8S A;  3B90 A;  1DBO A;  2NST A;  1H80 A;  4HWV A;  2INV A;  1OFL A;  2NSP A;  2VBK A;  1VBL A;  2X6W A;  3GQ7 A;  4OJO A;  1OFM A;  4XLC A;  1AIR A;  1O8J A;  1RU4 A;  3FY3 A;  4XQF A;  1PLU A;  1RMG A;  2Z8G A;  3JUR A;  1OGM X;  1JTA A;  2VJJ A;  4YEJ A;  2UVF A;  4XLH A;  3SUC A;  1O88 A;  4OZY A;  1IA5 A;  2NTB A;  4XON A;  1XG2 A;  4Z06 A;  3GQ9 A;  1IDJ A;  2IQ7 A;  1O8E A;  2X85 A;  3KRG A;  4MR0 A;  4XLE A;  4XKV A;  1BHE A;  1JRG A;  2INU A;  4OZZ A;  1O8L A;  4XL9 A;  1IB4 A;  1HG8 A;  4XR6 A;  4U4B A;  3VMW A;  3EQN A;  2PYH A;  2VBE A;  4PMH A;  4XMY A;  1DBG A;  5AMV A;  4NK6 A;  1PXZ A;  3LMW A;  4XLA A;  2O0W A;  3UW0 A;  1O8H A;  5C1C A;  4W8R A;  1QCX A;  2QY1 A;  4OJL A;  4OJ6 A;  2NTQ A;  1O8I A;  3B8Y A;  4YEL A;  3WWG A;  4I84 A;  5C1E A;  4OJP A;  1IDK A;  1QJV A;  4NK8 A;  3VST A;  2ODL A;  4YZA A;  3ZPP A;  2PYG A;  1PE9 A;  2O17 A;  3VMV A;  1OOC A;  1WMR A;  4MXN A;  2X6Y A;  1CZF A;  4EW9 A;  2VBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...