2INUA

Crystal structure of insulin fructotransferase in the absence of substrate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
total genus 146
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2inuA00
1K5CA 1X0CA 2UVFA 3VSTA 3JURA 1O8HA 2NTPA 1O8IA 1OFLA 4XLFA 3GQ7A 1HG8A 4C2LA 3VMWA 4XONA 2X6YA 3SUCA 1OFMA 3T9GA 2O04A 1O8JA 3B90A 3EQNA 2VJIA 1EE6A 3FY3A 2INVA 2X85A 1RU4A 5C1CA 1DBGA 5C1EA 1O8KA 4XMYA 1PE9A 4U49A 4W8QA 2BSPA 4XLAA 4HWVA 4XOTA 2NTQA 2X6XA 4MXNA 3VMVA 2NT6A 4YZXA 1H80A 2QY1A 1JRGA 2IQ7A 3UW0A 1QJVA 4URRA 1RWRA 2NT9A 1RMGA 4W8TA 3B4NA 2VJJA 4YZ0A 1KCDA 4OJ6A 3VSUA 1OOCA 1GQ8A 4XLCA 4XL9A 4XNFA 3GQ9A 1XG2A 4I84A 1DBOA 2X6WA 1OGOX 2NZMA 4OJPA 4YZQA 4OZYA 1O8DA 4NK8A 4XLEA 1O8MA 4YEJA 1VBLA 4XORA 1O8EA 2X3HA 5AMVA 1IB4A 1IDJA 2PECA 1WMRA 2VBKA 2Z8GA 3B8YA 4XN3A 3ZPPA 1O8GA 4YELA 3KRGA 2O0VA 4PMHA 2PYHA 1IA5A 3WWGA 4EW9A 1O8FA 1IDKA 1O88A 4Z05A 2INUA 1QCXA 3VSVA 2NSTA 1KTWA 2O0WA 4XOPA 4XM3A 4OJOA 2PYGA 1CZFA 4XN0A 2O1DA 4Z03A 2EWEA 1AIRA 1BN8A 4XLHA 2QXZA 2ODLA 4XKWA 4OJLA 1OGMX 4OJ5A 2O17A 2QX3A 1PXZA 3GQ8A 2NSPA 1JTAA 4AVZA 4MR0A 4W8SA 4YZAA 3GQAA 3LMWA 1KCCA 1PLUA 3ZSCA 4XKVA 4W8RA 1BHEA 2VBMA 2NTBA 1O8LA 1NHCA 4Z06A 2VBEA 4XQFA 3EQOA 4U4BA 3GRHA 4OZZA 4XR6A 4NK6A 2UVEA
chains in the Genus database with same CATH superfamily
1QA3A 1K5CA 3BH7B 1X0CA 2UVFA 3VSTA 3P4GA 3JURA 1O8HA 1QRCA 2NTPA 1O8IA 1OFLA 3NB2A 2O6WA 2F3LA 4XLFA 3GQ7A 2XTXA 1HF2A 2BM6A 2BX6A 3N90A 1HG8A 4C2LA 3VMWA 1CLWA 4XONA 4OPWA 2YUHA 2XC1A 2X6YA 3SUCA 1OFMA 3T9GA 1OFDA 2O04A 1O8JA 5JLVC 3B90A 3EQNA 4YCQA 2VJIA 1EE6A 3FY3A 2INVA 2X85A 1RU4A 2XT2A 4YEIA 5C1CA 1DBGA 5C1EA 1O8KA 4XMYA 1PE9A 4U49A 4W8QA 1TYWA 5JMCB 2BSPA 2QYUA 4XLAA 4HWVA 4XOTA 2NTQA 2X6XA 2XTYA 4MXNA 3VMVA 2NT6A 3LYCA 2VFOA 3BH6B 4YZXA 1H80A 2QY1A 2BM5A 3SY2A 1JRGA 3TH0A 2IQ7A 3H09A 3UW0A 1QJVA 2G0YA 4URRA 1RWRA 2NT9A 1RMGA 4W8TA 3B4NA 2XTWA 4Z05A 2QZAA 2VJJA 3PSZA 4YZ0A 1KCDA 4OJ6A 3VSUA 1OOCA 1EA0A 1GQ8A 4XLCA 4XL9A 4XNFA 2J8KA 2VFPA 3GQ9A 1XG2A 4I84A 1DBOA 2X6WA 1OGOX 2NZMA 3LJYA 4OJPA 4V02C 4YZQA 4OZYA 1O8DA 2XT4A 4NK8A 4XLEA 1O8MA 3SQVA 1EZGA 4YEJA 1OFEA 1QA2A 2B0RA 1VBLA 4XORA 1O8EA 2X3HA 5AMVA 1IB4A 1LM1A 2IOUG 1IDJA 2PECA 1WMRA 2VBKA 1LLZA 2Z8GA 3B8YA 4XN3A 3RIQA 3ZPPA 1O8GA 4YELA 3KRGA 1LLWA 1DABA 1TYVA 2O0VA 1K8FA 1TYUA 4PMHA 2PYHA 2V5IA 1IA5A 3WWGA 4EW9A 1O8FA 1IDKA 1K4ZA 1O88A 2VFQA 2INUA 1QCXA 2W7ZA 2NSTA 1KQ5A 1KTWA 2J8IA 2BM4A 2O0WA 3VSVA 1TSPA 2VFMA 4XOPA 4XM3A 3SZEA 4OJOA 1QA1A 2PYGA 1QRBA 1CZFA 4XN0A 2O1DA 4Z03A 2EWEA 1AIRA 1BN8A 4XLHA 3DU1X 2QXZA 2ODLA 4XKWA 4OJLA 1OGMX 3PSSA 4OM9A 4OJ5A 2O17A 2QX3A 1PXZA 3PETA 3GQ8A 4JRAC 2NSPA 1JTAA 4AVZA 1TYXA 3NAWA 4MR0A 4W8SA 2VFNA 4YZAA 3AK5A 3GQAA 3LMWA 1KCCA 1PLUA 3SYJA 4YDTA 4XKVA 3ZSCA 1QQ1A 4W8RA 5DNSA 1BHEA 2VBMA 1WXRA 2NTBA 1O8LA 1NHCA 4Z06A 2VBEA 3ML3A 4XQFA 3N6ZA 4YFOA 3EQOA 1L1IA 4U4BA 3GRHA 2BM7A 4OZZA 4XR6A 3JX8A 4NK6A 2UVEA 4KH3A 4YC5A
chains in the Genus database with same CATH topology
1K5CA 1X0CA 2UVFA 3VSTA 3JURA 1O8HA 2NTPA 1O8IA 1OFLA 4XLFA 3GQ7A 1HG8A 4C2LA 3VMWA 4XONA 2X6YA 3SUCA 1OFMA 3T9GA 2O04A 1O8JA 3B90A 3EQNA 2VJIA 1EE6A 3FY3A 2INVA 2X85A 1RU4A 5C1CA 1DBGA 5C1EA 1O8KA 4XMYA 1PE9A 4U49A 4W8QA 2BSPA 4XLAA 4HWVA 4XOTA 2NTQA 2X6XA 4MXNA 3VMVA 2NT6A 4YZXA 1H80A 2QY1A 1JRGA 2IQ7A 3UW0A 1QJVA 4URRA 1RWRA 2NT9A 1RMGA 4W8TA 3B4NA 2VJJA 4YZ0A 1KCDA 4OJ6A 3VSUA 1OOCA 1GQ8A 4XLCA 4XL9A 4XNFA 3GQ9A 1XG2A 4I84A 1DBOA 2X6WA 1OGOX 2NZMA 4OJPA 4YZQA 4OZYA 1O8DA 4NK8A 4XLEA 1O8MA 4YEJA 1VBLA 4XORA 1O8EA 2X3HA 5AMVA 1IB4A 1IDJA 2PECA 1WMRA 2VBKA 2Z8GA 3B8YA 4XN3A 3ZPPA 1O8GA 4YELA 3KRGA 2O0VA 4PMHA 2PYHA 1IA5A 3WWGA 4EW9A 1O8FA 1IDKA 1O88A 4Z05A 2INUA 1QCXA 3VSVA 2NSTA 1KTWA 2O0WA 4XOPA 4XM3A 4OJOA 2PYGA 1CZFA 4XN0A 2O1DA 4Z03A 2EWEA 1AIRA 1BN8A 4XLHA 2QXZA 2ODLA 4XKWA 4OJLA 1OGMX 4OJ5A 2O17A 2QX3A 1PXZA 3GQ8A 2NSPA 1JTAA 4AVZA 4MR0A 4W8SA 4YZAA 3GQAA 3LMWA 1KCCA 1PLUA 3ZSCA 4XKVA 4W8RA 1BHEA 2VBMA 2NTBA 1O8LA 1NHCA 4Z06A 2VBEA 4XQFA 3EQOA 4U4BA 3GRHA 4OZZA 4XR6A 4NK6A 2UVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5C A;  1X0C A;  2UVF A;  3VST A;  3JUR A;  1O8H A;  2NTP A;  1O8I A;  1OFL A;  4XLF A;  3GQ7 A;  1HG8 A;  4C2L A;  3VMW A;  4XON A;  2X6Y A;  3SUC A;  1OFM A;  3T9G A;  2O04 A;  1O8J A;  3B90 A;  3EQN A;  2VJI A;  1EE6 A;  3FY3 A;  2INV A;  2X85 A;  1RU4 A;  5C1C A;  1DBG A;  5C1E A;  1O8K A;  4XMY A;  1PE9 A;  4U49 A;  4W8Q A;  2BSP A;  4XLA A;  4HWV A;  4XOT A;  2NTQ A;  2X6X A;  4MXN A;  3VMV A;  2NT6 A;  4YZX A;  1H80 A;  2QY1 A;  1JRG A;  2IQ7 A;  3UW0 A;  1QJV A;  4URR A;  1RWR A;  2NT9 A;  1RMG A;  4W8T A;  3B4N A;  2VJJ A;  4YZ0 A;  1KCD A;  4OJ6 A;  3VSU A;  1OOC A;  1GQ8 A;  4XLC A;  4XL9 A;  4XNF A;  3GQ9 A;  1XG2 A;  4I84 A;  1DBO A;  2X6W A;  1OGO X;  2NZM A;  4OJP A;  4YZQ A;  4OZY A;  1O8D A;  4NK8 A;  4XLE A;  1O8M A;  4YEJ A;  1VBL A;  4XOR A;  1O8E A;  2X3H A;  5AMV A;  1IB4 A;  1IDJ A;  2PEC A;  1WMR A;  2VBK A;  2Z8G A;  3B8Y A;  4XN3 A;  3ZPP A;  1O8G A;  4YEL A;  3KRG A;  2O0V A;  4PMH A;  2PYH A;  1IA5 A;  3WWG A;  4EW9 A;  1O8F A;  1IDK A;  1O88 A;  4Z05 A;  2INU A;  1QCX A;  3VSV A;  2NST A;  1KTW A;  2O0W A;  4XOP A;  4XM3 A;  4OJO A;  2PYG A;  1CZF A;  4XN0 A;  2O1D A;  4Z03 A;  2EWE A;  1AIR A;  1BN8 A;  4XLH A;  2QXZ A;  2ODL A;  4XKW A;  4OJL A;  1OGM X;  4OJ5 A;  2O17 A;  2QX3 A;  1PXZ A;  3GQ8 A;  2NSP A;  1JTA A;  4AVZ A;  4MR0 A;  4W8S A;  4YZA A;  3GQA A;  3LMW A;  1KCC A;  1PLU A;  3ZSC A;  4XKV A;  4W8R A;  1BHE A;  2VBM A;  2NTB A;  1O8L A;  1NHC A;  4Z06 A;  2VBE A;  4XQF A;  3EQO A;  4U4B A;  3GRH A;  4OZZ A;  4XR6 A;  4NK6 A;  2UVE A; 
#chains in the Genus database with same CATH topology
 1QA3 A;  1K5C A;  3BH7 B;  1X0C A;  2UVF A;  3VST A;  3P4G A;  3JUR A;  1O8H A;  1QRC A;  2NTP A;  1O8I A;  1OFL A;  3NB2 A;  2O6W A;  2F3L A;  4XLF A;  3GQ7 A;  2XTX A;  1HF2 A;  2BM6 A;  2BX6 A;  3N90 A;  1HG8 A;  4C2L A;  3VMW A;  1CLW A;  4XON A;  4OPW A;  2YUH A;  2XC1 A;  2X6Y A;  3SUC A;  1OFM A;  3T9G A;  1OFD A;  2O04 A;  1O8J A;  5JLV C;  3B90 A;  3EQN A;  4YCQ A;  2VJI A;  1EE6 A;  3FY3 A;  2INV A;  2X85 A;  1RU4 A;  2XT2 A;  4YEI A;  5C1C A;  1DBG A;  5C1E A;  1O8K A;  4XMY A;  1PE9 A;  4U49 A;  4W8Q A;  1TYW A;  5JMC B;  2BSP A;  2QYU A;  4XLA A;  4HWV A;  4XOT A;  2NTQ A;  2X6X A;  2XTY A;  4MXN A;  3VMV A;  2NT6 A;  3LYC A;  2VFO A;  3BH6 B;  4YZX A;  1H80 A;  2QY1 A;  2BM5 A;  3SY2 A;  1JRG A;  3TH0 A;  2IQ7 A;  3H09 A;  3UW0 A;  1QJV A;  2G0Y A;  4URR A;  1RWR A;  2NT9 A;  1RMG A;  4W8T A;  3B4N A;  2XTW A;  4Z05 A;  2QZA A;  2VJJ A;  3PSZ A;  4YZ0 A;  1KCD A;  4OJ6 A;  3VSU A;  1OOC A;  1EA0 A;  1GQ8 A;  4XLC A;  4XL9 A;  4XNF A;  2J8K A;  2VFP A;  3GQ9 A;  1XG2 A;  4I84 A;  1DBO A;  2X6W A;  1OGO X;  2NZM A;  3LJY A;  4OJP A;  4V02 C;  4YZQ A;  4OZY A;  1O8D A;  2XT4 A;  4NK8 A;  4XLE A;  1O8M A;  3SQV A;  1EZG A;  4YEJ A;  1OFE A;  1QA2 A;  2B0R A;  1VBL A;  4XOR A;  1O8E A;  2X3H A;  5AMV A;  1IB4 A;  1LM1 A;  2IOU G;  1IDJ A;  2PEC A;  1WMR A;  2VBK A;  1LLZ A;  2Z8G A;  3B8Y A;  4XN3 A;  3RIQ A;  3ZPP A;  1O8G A;  4YEL A;  3KRG A;  1LLW A;  1DAB A;  1TYV A;  2O0V A;  1K8F A;  1TYU A;  4PMH A;  2PYH A;  2V5I A;  1IA5 A;  3WWG A;  4EW9 A;  1O8F A;  1IDK A;  1K4Z A;  1O88 A;  2VFQ A;  2INU A;  1QCX A;  2W7Z A;  2NST A;  1KQ5 A;  1KTW A;  2J8I A;  2BM4 A;  2O0W A;  3VSV A;  1TSP A;  2VFM A;  4XOP A;  4XM3 A;  3SZE A;  4OJO A;  1QA1 A;  2PYG A;  1QRB A;  1CZF A;  4XN0 A;  2O1D A;  4Z03 A;  2EWE A;  1AIR A;  1BN8 A;  4XLH A;  3DU1 X;  2QXZ A;  2ODL A;  4XKW A;  4OJL A;  1OGM X;  3PSS A;  4OM9 A;  4OJ5 A;  2O17 A;  2QX3 A;  1PXZ A;  3PET A;  3GQ8 A;  4JRA C;  2NSP A;  1JTA A;  4AVZ A;  1TYX A;  3NAW A;  4MR0 A;  4W8S A;  2VFN A;  4YZA A;  3AK5 A;  3GQA A;  3LMW A;  1KCC A;  1PLU A;  3SYJ A;  4YDT A;  4XKV A;  3ZSC A;  1QQ1 A;  4W8R A;  5DNS A;  1BHE A;  2VBM A;  1WXR A;  2NTB A;  1O8L A;  1NHC A;  4Z06 A;  2VBE A;  3ML3 A;  4XQF A;  3N6Z A;  4YFO A;  3EQO A;  1L1I A;  4U4B A;  3GRH A;  2BM7 A;  4OZZ A;  4XR6 A;  3JX8 A;  4NK6 A;  2UVE A;  4KH3 A;  4YC5 A; 
#chains in the Genus database with same CATH homology
 1K5C A;  1X0C A;  2UVF A;  3VST A;  3JUR A;  1O8H A;  2NTP A;  1O8I A;  1OFL A;  4XLF A;  3GQ7 A;  1HG8 A;  4C2L A;  3VMW A;  4XON A;  2X6Y A;  3SUC A;  1OFM A;  3T9G A;  2O04 A;  1O8J A;  3B90 A;  3EQN A;  2VJI A;  1EE6 A;  3FY3 A;  2INV A;  2X85 A;  1RU4 A;  5C1C A;  1DBG A;  5C1E A;  1O8K A;  4XMY A;  1PE9 A;  4U49 A;  4W8Q A;  2BSP A;  4XLA A;  4HWV A;  4XOT A;  2NTQ A;  2X6X A;  4MXN A;  3VMV A;  2NT6 A;  4YZX A;  1H80 A;  2QY1 A;  1JRG A;  2IQ7 A;  3UW0 A;  1QJV A;  4URR A;  1RWR A;  2NT9 A;  1RMG A;  4W8T A;  3B4N A;  2VJJ A;  4YZ0 A;  1KCD A;  4OJ6 A;  3VSU A;  1OOC A;  1GQ8 A;  4XLC A;  4XL9 A;  4XNF A;  3GQ9 A;  1XG2 A;  4I84 A;  1DBO A;  2X6W A;  1OGO X;  2NZM A;  4OJP A;  4YZQ A;  4OZY A;  1O8D A;  4NK8 A;  4XLE A;  1O8M A;  4YEJ A;  1VBL A;  4XOR A;  1O8E A;  2X3H A;  5AMV A;  1IB4 A;  1IDJ A;  2PEC A;  1WMR A;  2VBK A;  2Z8G A;  3B8Y A;  4XN3 A;  3ZPP A;  1O8G A;  4YEL A;  3KRG A;  2O0V A;  4PMH A;  2PYH A;  1IA5 A;  3WWG A;  4EW9 A;  1O8F A;  1IDK A;  1O88 A;  4Z05 A;  2INU A;  1QCX A;  3VSV A;  2NST A;  1KTW A;  2O0W A;  4XOP A;  4XM3 A;  4OJO A;  2PYG A;  1CZF A;  4XN0 A;  2O1D A;  4Z03 A;  2EWE A;  1AIR A;  1BN8 A;  4XLH A;  2QXZ A;  2ODL A;  4XKW A;  4OJL A;  1OGM X;  4OJ5 A;  2O17 A;  2QX3 A;  1PXZ A;  3GQ8 A;  2NSP A;  1JTA A;  4AVZ A;  4MR0 A;  4W8S A;  4YZA A;  3GQA A;  3LMW A;  1KCC A;  1PLU A;  3ZSC A;  4XKV A;  4W8R A;  1BHE A;  2VBM A;  2NTB A;  1O8L A;  1NHC A;  4Z06 A;  2VBE A;  4XQF A;  3EQO A;  4U4B A;  3GRH A;  4OZZ A;  4XR6 A;  4NK6 A;  2UVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...