2INUA

Crystal structure of insulin fructotransferase in the absence of substrate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Insulin fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
total genus 146
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2inuA00
4XORA 3KRGA 3ZPPA 1KTWA 2X85A 3ZSCA 3SUCA 1KCCA 1O8KA 4OJ6A 2NT6A 2VJIA 4OJPA 4W8QA 2X3HA 2O04A 1AIRA 2PECA 1BHEA 1KCDA 1X0CA 4XMYA 1DBOA 3UW0A 1O8LA 4PMHA 4XLFA 3WWGA 4XLAA 2ODLA 4YZXA 2O0VA 4MXNA 4YZQA 3EQNA 1IB4A 2NTBA 2UVEA 1VBLA 4I84A 1PE9A 4U49A 3LMWA 2X6YA 2X6WA 1O8IA 2Z8GA 2EWEA 1JTAA 3GQ9A 2NSPA 4XN0A 1H80A 1GQ8A 3JURA 3B8YA 3VMWA 1JRGA 1CZFA 1PLUA 4URRA 2NTQA 4XOTA 4XR6A 1O8GA 4XL9A 4XKWA 2NZMA 2VBMA 4XLHA 4YZAA 1IA5A 3VSUA 3GRHA 1OOCA 3B4NA 2INUA 2O0WA 1O8HA 3B90A 1O8DA 4XM3A 1O8MA 1QJVA 4OJ5A 1IDJA 2VBEA 1NHCA 4YELA 3EQOA 1IDKA 4OZZA 3GQ8A 3GQ7A 3T9GA 5C1CA 2QY1A 4NK8A 2VBKA 1O88A 4Z03A 4XONA 2INVA 2O1DA 1K5CA 4AVZA 5C1EA 1OFMA 1OGOX 4OJOA 4W8TA 4YEJA 1O8FA 1DBGA 1RMGA 2IQ7A 4XN3A 5AMVA 2PYGA 4OZYA 2NSTA 4XKVA 1RU4A 4C2LA 4W8SA 1EE6A 4XOPA 3VMVA 3VSTA 2O17A 4EW9A 4XQFA 4HWVA 4OJLA 1WMRA 2BSPA 4NK6A 3VSVA 2QXZA 3FY3A 4XLEA 1HG8A 2NTPA 4MR0A 4U4BA 4XLCA 4Z06A 1QCXA 2UVFA 1O8JA 2QX3A 1OGMX 4XNFA 1RWRA 4YZ0A 2X6XA 3GQAA 2VJJA 1BN8A 1O8EA 2NT9A 2PYHA 1XG2A 1OFLA 1PXZA 4Z05A 4W8RA
chains in the Genus database with same CATH superfamily
4XORA 3N6ZA 3KRGA 3ZPPA 1KTWA 2X85A 3ZSCA 3SUCA 1KCCA 2XT4A 1O8KA 4YFOA 4OJ6A 5JMCB 2NT6A 2VJIA 4OJPA 2BX6A 4OM9A 4W8QA 2BM4A 2X3HA 2O04A 1AIRA 2PECA 1BHEA 1KCDA 1X0CA 4XMYA 1DBOA 1K4ZA 3UW0A 1O8LA 4PMHA 3H09A 4XLFA 1TYXA 3WWGA 3DU1X 4XLAA 3JX8A 2ODLA 3P4GA 4YZXA 2VFMA 3SQVA 1EA0A 2VFOA 2O0VA 4MXNA 1TYWA 3AK5A 4YZQA 3EQNA 2VFQA 5JLVC 2VFNA 1IB4A 2NTBA 2UVEA 1VBLA 4I84A 1PE9A 4U49A 3LMWA 2X6YA 2X6WA 1O8IA 2Z8GA 2EWEA 1KQ5A 1JTAA 1QRBA 3GQ9A 2NSPA 4XN0A 2XTWA 3SY2A 1H80A 1GQ8A 3JURA 3B8YA 1CLWA 2VFPA 2XT2A 3VMWA 1QA1A 3PSZA 1JRGA 1OFDA 1CZFA 1PLUA 4URRA 2NTQA 4XOTA 4XR6A 1O8GA 1LLWA 3RIQA 4XL9A 3LJYA 4XKWA 2NZMA 2VBMA 4XLHA 2BM7A 3N90A 4YZAA 2QZAA 2W7ZA 1LLZA 1IA5A 2QYUA 3SYJA 3VSUA 3GRHA 1OOCA 2XC1A 3B4NA 2INUA 2O0WA 1O8HA 3B90A 1O8DA 3NB2A 4XM3A 4KH3A 1QA3A 1O8MA 1QJVA 2YUHA 1IDJA 2VBEA 4OJ5A 4V02C 1NHCA 1TYUA 3EQOA 1IDKA 4YELA 2O6WA 2G0YA 4OZZA 2J8IA 3GQ8A 3GQ7A 3T9GA 5C1CA 2QY1A 2BM5A 4NK8A 2VBKA 1O88A 4Z03A 4XONA 2INVA 2XTYA 3NAWA 2O1DA 1K5CA 4AVZA 1QQ1A 1OFMA 1OGOX 5C1EA 4OJOA 4W8TA 4YEJA 3PSSA 4YEIA 1O8FA 1DBGA 1RMGA 2F3LA 2IQ7A 4XN3A 5AMVA 2PYGA 4JRAC 1QA2A 2B0RA 4OZYA 1LM1A 4OPWA 2NSTA 4XKVA 1RU4A 4C2LA 4W8SA 1EE6A 3BH7B 4XOPA 3VMVA 2O17A 3VSTA 4EW9A 4HWVA 4XQFA 4OJLA 1WMRA 2BSPA 4NK6A 3VSVA 2QXZA 1TSPA 3FY3A 1L1IA 3SZEA 4XLEA 1HG8A 2BM6A 2NTPA 3ML3A 4MR0A 1K8FA 2J8KA 4U4BA 4XLCA 2V5IA 1OFEA 4YDTA 4Z06A 5DNSA 1QCXA 2IOUG 1O8JA 2UVFA 1EZGA 1HF2A 2QX3A 3BH6B 1OGMX 4YC5A 4XNFA 3TH0A 1RWRA 4YZ0A 1DABA 2X6XA 3GQAA 2VJJA 2XTXA 4YCQA 1BN8A 1O8EA 2NT9A 2PYHA 3LYCA 1XG2A 1QRCA 1WXRA 1OFLA 1PXZA 3PETA 1TYVA 4Z05A 4W8RA
chains in the Genus database with same CATH topology
4XORA 3KRGA 3ZPPA 1KTWA 2X85A 3ZSCA 3SUCA 1KCCA 1O8KA 4OJ6A 2NT6A 2VJIA 4OJPA 4W8QA 2X3HA 2O04A 1AIRA 2PECA 1BHEA 1KCDA 1X0CA 4XMYA 1DBOA 3UW0A 1O8LA 4PMHA 4XLFA 3WWGA 4XLAA 2ODLA 4YZXA 2O0VA 4MXNA 4YZQA 3EQNA 1IB4A 2NTBA 2UVEA 1VBLA 4I84A 1PE9A 4U49A 3LMWA 2X6YA 2X6WA 1O8IA 2Z8GA 2EWEA 1JTAA 3GQ9A 2NSPA 4XN0A 1H80A 1GQ8A 3JURA 3B8YA 3VMWA 1JRGA 1CZFA 1PLUA 4URRA 2NTQA 4XOTA 4XR6A 1O8GA 4XL9A 4XKWA 2NZMA 2VBMA 4XLHA 4YZAA 1IA5A 3VSUA 3GRHA 1OOCA 3B4NA 2INUA 2O0WA 1O8HA 3B90A 1O8DA 4XM3A 1O8MA 1QJVA 4OJ5A 1IDJA 2VBEA 1NHCA 4YELA 3EQOA 1IDKA 4OZZA 3GQ8A 3GQ7A 3T9GA 5C1CA 2QY1A 4NK8A 2VBKA 1O88A 4Z03A 4XONA 2INVA 2O1DA 1K5CA 4AVZA 5C1EA 1OFMA 1OGOX 4OJOA 4W8TA 4YEJA 1O8FA 1DBGA 1RMGA 2IQ7A 4XN3A 5AMVA 2PYGA 4OZYA 2NSTA 4XKVA 1RU4A 4C2LA 4W8SA 1EE6A 4XOPA 3VMVA 3VSTA 2O17A 4EW9A 4XQFA 4HWVA 4OJLA 1WMRA 2BSPA 4NK6A 3VSVA 2QXZA 3FY3A 4XLEA 1HG8A 2NTPA 4MR0A 4U4BA 4XLCA 4Z06A 1QCXA 2UVFA 1O8JA 2QX3A 1OGMX 4XNFA 1RWRA 4YZ0A 2X6XA 3GQAA 2VJJA 1BN8A 1O8EA 2NT9A 2PYHA 1XG2A 1OFLA 1PXZA 4Z05A 4W8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOR A;  3KRG A;  3ZPP A;  1KTW A;  2X85 A;  3ZSC A;  3SUC A;  1KCC A;  1O8K A;  4OJ6 A;  2NT6 A;  2VJI A;  4OJP A;  4W8Q A;  2X3H A;  2O04 A;  1AIR A;  2PEC A;  1BHE A;  1KCD A;  1X0C A;  4XMY A;  1DBO A;  3UW0 A;  1O8L A;  4PMH A;  4XLF A;  3WWG A;  4XLA A;  2ODL A;  4YZX A;  2O0V A;  4MXN A;  4YZQ A;  3EQN A;  1IB4 A;  2NTB A;  2UVE A;  1VBL A;  4I84 A;  1PE9 A;  4U49 A;  3LMW A;  2X6Y A;  2X6W A;  1O8I A;  2Z8G A;  2EWE A;  1JTA A;  3GQ9 A;  2NSP A;  4XN0 A;  1H80 A;  1GQ8 A;  3JUR A;  3B8Y A;  3VMW A;  1JRG A;  1CZF A;  1PLU A;  4URR A;  2NTQ A;  4XOT A;  4XR6 A;  1O8G A;  4XL9 A;  4XKW A;  2NZM A;  2VBM A;  4XLH A;  4YZA A;  1IA5 A;  3VSU A;  3GRH A;  1OOC A;  3B4N A;  2INU A;  2O0W A;  1O8H A;  3B90 A;  1O8D A;  4XM3 A;  1O8M A;  1QJV A;  4OJ5 A;  1IDJ A;  2VBE A;  1NHC A;  4YEL A;  3EQO A;  1IDK A;  4OZZ A;  3GQ8 A;  3GQ7 A;  3T9G A;  5C1C A;  2QY1 A;  4NK8 A;  2VBK A;  1O88 A;  4Z03 A;  4XON A;  2INV A;  2O1D A;  1K5C A;  4AVZ A;  5C1E A;  1OFM A;  1OGO X;  4OJO A;  4W8T A;  4YEJ A;  1O8F A;  1DBG A;  1RMG A;  2IQ7 A;  4XN3 A;  5AMV A;  2PYG A;  4OZY A;  2NST A;  4XKV A;  1RU4 A;  4C2L A;  4W8S A;  1EE6 A;  4XOP A;  3VMV A;  3VST A;  2O17 A;  4EW9 A;  4XQF A;  4HWV A;  4OJL A;  1WMR A;  2BSP A;  4NK6 A;  3VSV A;  2QXZ A;  3FY3 A;  4XLE A;  1HG8 A;  2NTP A;  4MR0 A;  4U4B A;  4XLC A;  4Z06 A;  1QCX A;  2UVF A;  1O8J A;  2QX3 A;  1OGM X;  4XNF A;  1RWR A;  4YZ0 A;  2X6X A;  3GQA A;  2VJJ A;  1BN8 A;  1O8E A;  2NT9 A;  2PYH A;  1XG2 A;  1OFL A;  1PXZ A;  4Z05 A;  4W8R A; 
#chains in the Genus database with same CATH topology
 4XOR A;  3N6Z A;  3KRG A;  3ZPP A;  1KTW A;  2X85 A;  3ZSC A;  3SUC A;  1KCC A;  2XT4 A;  1O8K A;  4YFO A;  4OJ6 A;  5JMC B;  2NT6 A;  2VJI A;  4OJP A;  2BX6 A;  4OM9 A;  4W8Q A;  2BM4 A;  2X3H A;  2O04 A;  1AIR A;  2PEC A;  1BHE A;  1KCD A;  1X0C A;  4XMY A;  1DBO A;  1K4Z A;  3UW0 A;  1O8L A;  4PMH A;  3H09 A;  4XLF A;  1TYX A;  3WWG A;  3DU1 X;  4XLA A;  3JX8 A;  2ODL A;  3P4G A;  4YZX A;  2VFM A;  3SQV A;  1EA0 A;  2VFO A;  2O0V A;  4MXN A;  1TYW A;  3AK5 A;  4YZQ A;  3EQN A;  2VFQ A;  5JLV C;  2VFN A;  1IB4 A;  2NTB A;  2UVE A;  1VBL A;  4I84 A;  1PE9 A;  4U49 A;  3LMW A;  2X6Y A;  2X6W A;  1O8I A;  2Z8G A;  2EWE A;  1KQ5 A;  1JTA A;  1QRB A;  3GQ9 A;  2NSP A;  4XN0 A;  2XTW A;  3SY2 A;  1H80 A;  1GQ8 A;  3JUR A;  3B8Y A;  1CLW A;  2VFP A;  2XT2 A;  3VMW A;  1QA1 A;  3PSZ A;  1JRG A;  1OFD A;  1CZF A;  1PLU A;  4URR A;  2NTQ A;  4XOT A;  4XR6 A;  1O8G A;  1LLW A;  3RIQ A;  4XL9 A;  3LJY A;  4XKW A;  2NZM A;  2VBM A;  4XLH A;  2BM7 A;  3N90 A;  4YZA A;  2QZA A;  2W7Z A;  1LLZ A;  1IA5 A;  2QYU A;  3SYJ A;  3VSU A;  3GRH A;  1OOC A;  2XC1 A;  3B4N A;  2INU A;  2O0W A;  1O8H A;  3B90 A;  1O8D A;  3NB2 A;  4XM3 A;  4KH3 A;  1QA3 A;  1O8M A;  1QJV A;  2YUH A;  1IDJ A;  2VBE A;  4OJ5 A;  4V02 C;  1NHC A;  1TYU A;  3EQO A;  1IDK A;  4YEL A;  2O6W A;  2G0Y A;  4OZZ A;  2J8I A;  3GQ8 A;  3GQ7 A;  3T9G A;  5C1C A;  2QY1 A;  2BM5 A;  4NK8 A;  2VBK A;  1O88 A;  4Z03 A;  4XON A;  2INV A;  2XTY A;  3NAW A;  2O1D A;  1K5C A;  4AVZ A;  1QQ1 A;  1OFM A;  1OGO X;  5C1E A;  4OJO A;  4W8T A;  4YEJ A;  3PSS A;  4YEI A;  1O8F A;  1DBG A;  1RMG A;  2F3L A;  2IQ7 A;  4XN3 A;  5AMV A;  2PYG A;  4JRA C;  1QA2 A;  2B0R A;  4OZY A;  1LM1 A;  4OPW A;  2NST A;  4XKV A;  1RU4 A;  4C2L A;  4W8S A;  1EE6 A;  3BH7 B;  4XOP A;  3VMV A;  2O17 A;  3VST A;  4EW9 A;  4HWV A;  4XQF A;  4OJL A;  1WMR A;  2BSP A;  4NK6 A;  3VSV A;  2QXZ A;  1TSP A;  3FY3 A;  1L1I A;  3SZE A;  4XLE A;  1HG8 A;  2BM6 A;  2NTP A;  3ML3 A;  4MR0 A;  1K8F A;  2J8K A;  4U4B A;  4XLC A;  2V5I A;  1OFE A;  4YDT A;  4Z06 A;  5DNS A;  1QCX A;  2IOU G;  1O8J A;  2UVF A;  1EZG A;  1HF2 A;  2QX3 A;  3BH6 B;  1OGM X;  4YC5 A;  4XNF A;  3TH0 A;  1RWR A;  4YZ0 A;  1DAB A;  2X6X A;  3GQA A;  2VJJ A;  2XTX A;  4YCQ A;  1BN8 A;  1O8E A;  2NT9 A;  2PYH A;  3LYC A;  1XG2 A;  1QRC A;  1WXR A;  1OFL A;  1PXZ A;  3PET A;  1TYV A;  4Z05 A;  4W8R A; 
#chains in the Genus database with same CATH homology
 4XOR A;  3KRG A;  3ZPP A;  1KTW A;  2X85 A;  3ZSC A;  3SUC A;  1KCC A;  1O8K A;  4OJ6 A;  2NT6 A;  2VJI A;  4OJP A;  4W8Q A;  2X3H A;  2O04 A;  1AIR A;  2PEC A;  1BHE A;  1KCD A;  1X0C A;  4XMY A;  1DBO A;  3UW0 A;  1O8L A;  4PMH A;  4XLF A;  3WWG A;  4XLA A;  2ODL A;  4YZX A;  2O0V A;  4MXN A;  4YZQ A;  3EQN A;  1IB4 A;  2NTB A;  2UVE A;  1VBL A;  4I84 A;  1PE9 A;  4U49 A;  3LMW A;  2X6Y A;  2X6W A;  1O8I A;  2Z8G A;  2EWE A;  1JTA A;  3GQ9 A;  2NSP A;  4XN0 A;  1H80 A;  1GQ8 A;  3JUR A;  3B8Y A;  3VMW A;  1JRG A;  1CZF A;  1PLU A;  4URR A;  2NTQ A;  4XOT A;  4XR6 A;  1O8G A;  4XL9 A;  4XKW A;  2NZM A;  2VBM A;  4XLH A;  4YZA A;  1IA5 A;  3VSU A;  3GRH A;  1OOC A;  3B4N A;  2INU A;  2O0W A;  1O8H A;  3B90 A;  1O8D A;  4XM3 A;  1O8M A;  1QJV A;  4OJ5 A;  1IDJ A;  2VBE A;  1NHC A;  4YEL A;  3EQO A;  1IDK A;  4OZZ A;  3GQ8 A;  3GQ7 A;  3T9G A;  5C1C A;  2QY1 A;  4NK8 A;  2VBK A;  1O88 A;  4Z03 A;  4XON A;  2INV A;  2O1D A;  1K5C A;  4AVZ A;  5C1E A;  1OFM A;  1OGO X;  4OJO A;  4W8T A;  4YEJ A;  1O8F A;  1DBG A;  1RMG A;  2IQ7 A;  4XN3 A;  5AMV A;  2PYG A;  4OZY A;  2NST A;  4XKV A;  1RU4 A;  4C2L A;  4W8S A;  1EE6 A;  4XOP A;  3VMV A;  3VST A;  2O17 A;  4EW9 A;  4XQF A;  4HWV A;  4OJL A;  1WMR A;  2BSP A;  4NK6 A;  3VSV A;  2QXZ A;  3FY3 A;  4XLE A;  1HG8 A;  2NTP A;  4MR0 A;  4U4B A;  4XLC A;  4Z06 A;  1QCX A;  2UVF A;  1O8J A;  2QX3 A;  1OGM X;  4XNF A;  1RWR A;  4YZ0 A;  2X6X A;  3GQA A;  2VJJ A;  1BN8 A;  1O8E A;  2NT9 A;  2PYH A;  1XG2 A;  1OFL A;  1PXZ A;  4Z05 A;  4W8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...