2INUA

Crystal structure of insulin fructotransferase in the absence of substrate
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
399
Chain Sequence
PNTYDVTTWRIKAHPEVTAQSDIGAVINDIIADIKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVSYLTIAGFGHGFFSRSILDNSNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECGNCVELTGAGQATIVSGNHMGAGPDGVTLLAENHEGLLVTGNNLFPRGRSLIEFTGCNRCSVTSNRLQGFYPGMLRLLNGCKENLITANHIRRTNEGYPPFIGRGNGLDDLYGVVHIAGDNNLISDNLFAYNVPPANIAPAGAQPTQILIAGGDANVVALNHVVSDVASQHVVLDASTTHSKVLDSGTASQITSYSSDTAIRPTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insulin fructotransferase
publication title Structural and functional insights into intramolecular fructosyl transfer by insulin fructotransferase
pubmed doi rcsb
source organism Bacillus sp. snu-7
molecule tags Lyase
total genus 146
structure length 399
sequence length 399
chains with identical sequence B, C
ec nomenclature ec 4.2.2.18: Inulin fructotransferase (DFA-III-forming).
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18835 Beta_helix_2 Beta helix repeat of Inulin fructotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2inuA00
3VMWA 1EE6A 2O0VA 2QX3A 4YZXA 4XM3A 1O8JA 2VJJA 4OJLA 2O04A 4XLFA 1IDKA 1RU4A 3GQAA 4OJ5A 2O1DA 5AMVA 2PYHA 4OZZA 4YZAA 1O8GA 4XLAA 2EWEA 3JURA 2INVA 2NZMA 1O8HA 2UVEA 2X6XA 3LMWA 1OOCA 4I84A 1O8FA 4XLCA 2NTBA 4XOPA 4Z05A 3KRGA 2X6YA 4NK8A 1O88A 1RWRA 2PECA 1QJVA 1CZFA 3B90A 4Z03A 2NTQA 5C1EA 1QCXA 4OJOA 3GQ9A 2NTPA 4XLHA 1PE9A 1O8IA 1NHCA 3FY3A 2VBEA 4XR6A 1JRGA 1BN8A 4XQFA 1IA5A 1KCCA 4OZYA 4YZQA 1H80A 2NSPA 1DBGA 4YEJA 1OGOX 1IDJA 1PXZA 3B8YA 4XMYA 4YZ0A 4W8SA 2ODLA 2NT6A 3VMVA 3VSUA 3WWGA 2BSPA 1XG2A 4MR0A 4EW9A 1PLUA 4MXNA 1HG8A 3UW0A 1WMRA 3ZSCA 3EQOA 1O8LA 2QXZA 2UVFA 1JTAA 2X3HA 3GRHA 1K5CA 4U4BA 1O8MA 2NT9A 3GQ7A 4OJPA 1VBLA 4C2LA 1OFMA 4XKWA 1DBOA 2O17A 4W8RA 3ZPPA 1KTWA 2Z8GA 4YELA 4XLEA 2IQ7A 4OJ6A 4XN3A 4AVZA 1OGMX 2X85A 1KCDA 4XNFA 4URRA 4W8TA 2VBMA 1O8KA 4Z06A 1RMGA 3EQNA 2NSTA 4HWVA 2PYGA 3VSVA 4XORA 4W8QA 3GQ8A 1IB4A 2O0WA 4XN0A 3SUCA 4XKVA 2INUA 3T9GA 1BHEA 3B4NA 1AIRA 1X0CA 2VBKA 5C1CA 1O8DA 1OFLA 4XONA 3VSTA 4XOTA 1GQ8A 2QY1A 2X6WA 4XL9A 4U49A 4PMHA 2VJIA 1O8EA 4NK6A
chains in the Genus database with same CATH superfamily
2J8IA 3VMWA 3BH6B 1EE6A 2BX6A 4OPWA 3SZEA 2O0VA 2QX3A 3BH7B 3PSSA 4XM3A 4YZXA 1O8JA 2BM4A 2VJJA 3NAWA 4OJLA 2G0YA 2O04A 1LLZA 4XLFA 1IDKA 1QQ1A 1RU4A 3GQAA 4OJ5A 2O1DA 1QRBA 5AMVA 2PYHA 4OZZA 1TSPA 1O8GA 2BM7A 4XLAA 4YZAA 2EWEA 1QRCA 1OFDA 2XT2A 3JURA 3DU1X 2INVA 4YDTA 2VFPA 3H09A 2NZMA 1O8HA 2UVEA 2BM6A 1LM1A 2X6XA 3LMWA 1KQ5A 1K8FA 1OOCA 3P4GA 4I84A 1O8FA 2VFNA 4XLCA 1LLWA 2NTBA 4XOPA 4OM9A 4Z05A 2QYUA 3KRGA 1QA1A 2X6YA 4NK8A 1O88A 1RWRA 2PECA 1QJVA 1CZFA 3B90A 4Z03A 2NTQA 2XT4A 5C1EA 1QCXA 1TYUA 4OJOA 4YCQA 3GQ9A 2NTPA 4XLHA 3SY2A 1PE9A 1O8IA 1NHCA 3FY3A 4V02C 1DABA 1QA2A 2VBEA 4XR6A 1QA3A 1JRGA 1BN8A 4XQFA 1IA5A 1KCCA 4OZYA 1TYWA 4YZQA 1H80A 2NSPA 3JX8A 1DBGA 4YEJA 1OGOX 1IDJA 3PETA 1PXZA 3ML3A 3N90A 2XC1A 3LJYA 3B8YA 4XMYA 3SYJA 2V5IA 4YZ0A 4W8SA 2ODLA 2NT6A 1WXRA 2W7ZA 3VMVA 3VSUA 3WWGA 2BSPA 3TH0A 1XG2A 2BM5A 2VFOA 2XTWA 4MR0A 1PLUA 4MXNA 1HG8A 4YFOA 3RIQA 3UW0A 4EW9A 1WMRA 3ZSCA 3EQOA 1O8LA 2QXZA 2UVFA 1JTAA 2X3HA 3GRHA 2XTXA 4KH3A 4U4BA 3SQVA 1K5CA 1O8MA 1TYVA 2NT9A 3GQ7A 4OJPA 1VBLA 3PSZA 4C2LA 1OFMA 1EA0A 4XKWA 3N6ZA 1DBOA 2O17A 4W8RA 3NB2A 1L1IA 3ZPPA 1KTWA 2Z8GA 4YELA 4XLEA 2IQ7A 4OJ6A 4XN3A 4AVZA 1HF2A 1OFEA 2J8KA 1OGMX 1EZGA 2X85A 1KCDA 5DNSA 4XNFA 4URRA 2B0RA 2VBMA 4W8TA 1O8KA 4Z06A 1RMGA 3EQNA 2NSTA 2IOUG 2O6WA 2PYGA 4HWVA 3VSVA 5JLVC 4XORA 5JMCB 1TYXA 2YUHA 4W8QA 3GQ8A 1IB4A 2O0WA 4XN0A 3SUCA 4XKVA 2INUA 3T9GA 4YC5A 1BHEA 1CLWA 3B4NA 3LYCA 1AIRA 1K4ZA 1X0CA 2VBKA 2XTYA 5C1CA 4YEIA 2F3LA 1O8DA 1OFLA 2VFMA 2QZAA 3AK5A 2VFQA 4XONA 3VSTA 4XOTA 1GQ8A 2QY1A 2X6WA 4XL9A 4U49A 4PMHA 2VJIA 4JRAC 1O8EA 4NK6A
chains in the Genus database with same CATH topology
3VMWA 1EE6A 2O0VA 2QX3A 4YZXA 4XM3A 1O8JA 2VJJA 4OJLA 2O04A 4XLFA 1IDKA 1RU4A 3GQAA 4OJ5A 2O1DA 5AMVA 2PYHA 4OZZA 4YZAA 1O8GA 4XLAA 2EWEA 3JURA 2INVA 2NZMA 1O8HA 2UVEA 2X6XA 3LMWA 1OOCA 4I84A 1O8FA 4XLCA 2NTBA 4XOPA 4Z05A 3KRGA 2X6YA 4NK8A 1O88A 1RWRA 2PECA 1QJVA 1CZFA 3B90A 4Z03A 2NTQA 5C1EA 1QCXA 4OJOA 3GQ9A 2NTPA 4XLHA 1PE9A 1O8IA 1NHCA 3FY3A 2VBEA 4XR6A 1JRGA 1BN8A 4XQFA 1IA5A 1KCCA 4OZYA 4YZQA 1H80A 2NSPA 1DBGA 4YEJA 1OGOX 1IDJA 1PXZA 3B8YA 4XMYA 4YZ0A 4W8SA 2ODLA 2NT6A 3VMVA 3VSUA 3WWGA 2BSPA 1XG2A 4MR0A 4EW9A 1PLUA 4MXNA 1HG8A 3UW0A 1WMRA 3ZSCA 3EQOA 1O8LA 2QXZA 2UVFA 1JTAA 2X3HA 3GRHA 1K5CA 4U4BA 1O8MA 2NT9A 3GQ7A 4OJPA 1VBLA 4C2LA 1OFMA 4XKWA 1DBOA 2O17A 4W8RA 3ZPPA 1KTWA 2Z8GA 4YELA 4XLEA 2IQ7A 4OJ6A 4XN3A 4AVZA 1OGMX 2X85A 1KCDA 4XNFA 4URRA 4W8TA 2VBMA 1O8KA 4Z06A 1RMGA 3EQNA 2NSTA 4HWVA 2PYGA 3VSVA 4XORA 4W8QA 3GQ8A 1IB4A 2O0WA 4XN0A 3SUCA 4XKVA 2INUA 3T9GA 1BHEA 3B4NA 1AIRA 1X0CA 2VBKA 5C1CA 1O8DA 1OFLA 4XONA 3VSTA 4XOTA 1GQ8A 2QY1A 2X6WA 4XL9A 4U49A 4PMHA 2VJIA 1O8EA 4NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMW A;  1EE6 A;  2O0V A;  2QX3 A;  4YZX A;  4XM3 A;  1O8J A;  2VJJ A;  4OJL A;  2O04 A;  4XLF A;  1IDK A;  1RU4 A;  3GQA A;  4OJ5 A;  2O1D A;  5AMV A;  2PYH A;  4OZZ A;  4YZA A;  1O8G A;  4XLA A;  2EWE A;  3JUR A;  2INV A;  2NZM A;  1O8H A;  2UVE A;  2X6X A;  3LMW A;  1OOC A;  4I84 A;  1O8F A;  4XLC A;  2NTB A;  4XOP A;  4Z05 A;  3KRG A;  2X6Y A;  4NK8 A;  1O88 A;  1RWR A;  2PEC A;  1QJV A;  1CZF A;  3B90 A;  4Z03 A;  2NTQ A;  5C1E A;  1QCX A;  4OJO A;  3GQ9 A;  2NTP A;  4XLH A;  1PE9 A;  1O8I A;  1NHC A;  3FY3 A;  2VBE A;  4XR6 A;  1JRG A;  1BN8 A;  4XQF A;  1IA5 A;  1KCC A;  4OZY A;  4YZQ A;  1H80 A;  2NSP A;  1DBG A;  4YEJ A;  1OGO X;  1IDJ A;  1PXZ A;  3B8Y A;  4XMY A;  4YZ0 A;  4W8S A;  2ODL A;  2NT6 A;  3VMV A;  3VSU A;  3WWG A;  2BSP A;  1XG2 A;  4MR0 A;  4EW9 A;  1PLU A;  4MXN A;  1HG8 A;  3UW0 A;  1WMR A;  3ZSC A;  3EQO A;  1O8L A;  2QXZ A;  2UVF A;  1JTA A;  2X3H A;  3GRH A;  1K5C A;  4U4B A;  1O8M A;  2NT9 A;  3GQ7 A;  4OJP A;  1VBL A;  4C2L A;  1OFM A;  4XKW A;  1DBO A;  2O17 A;  4W8R A;  3ZPP A;  1KTW A;  2Z8G A;  4YEL A;  4XLE A;  2IQ7 A;  4OJ6 A;  4XN3 A;  4AVZ A;  1OGM X;  2X85 A;  1KCD A;  4XNF A;  4URR A;  4W8T A;  2VBM A;  1O8K A;  4Z06 A;  1RMG A;  3EQN A;  2NST A;  4HWV A;  2PYG A;  3VSV A;  4XOR A;  4W8Q A;  3GQ8 A;  1IB4 A;  2O0W A;  4XN0 A;  3SUC A;  4XKV A;  2INU A;  3T9G A;  1BHE A;  3B4N A;  1AIR A;  1X0C A;  2VBK A;  5C1C A;  1O8D A;  1OFL A;  4XON A;  3VST A;  4XOT A;  1GQ8 A;  2QY1 A;  2X6W A;  4XL9 A;  4U49 A;  4PMH A;  2VJI A;  1O8E A;  4NK6 A; 
#chains in the Genus database with same CATH topology
 2J8I A;  3VMW A;  3BH6 B;  1EE6 A;  2BX6 A;  4OPW A;  3SZE A;  2O0V A;  2QX3 A;  3BH7 B;  3PSS A;  4XM3 A;  4YZX A;  1O8J A;  2BM4 A;  2VJJ A;  3NAW A;  4OJL A;  2G0Y A;  2O04 A;  1LLZ A;  4XLF A;  1IDK A;  1QQ1 A;  1RU4 A;  3GQA A;  4OJ5 A;  2O1D A;  1QRB A;  5AMV A;  2PYH A;  4OZZ A;  1TSP A;  1O8G A;  2BM7 A;  4XLA A;  4YZA A;  2EWE A;  1QRC A;  1OFD A;  2XT2 A;  3JUR A;  3DU1 X;  2INV A;  4YDT A;  2VFP A;  3H09 A;  2NZM A;  1O8H A;  2UVE A;  2BM6 A;  1LM1 A;  2X6X A;  3LMW A;  1KQ5 A;  1K8F A;  1OOC A;  3P4G A;  4I84 A;  1O8F A;  2VFN A;  4XLC A;  1LLW A;  2NTB A;  4XOP A;  4OM9 A;  4Z05 A;  2QYU A;  3KRG A;  1QA1 A;  2X6Y A;  4NK8 A;  1O88 A;  1RWR A;  2PEC A;  1QJV A;  1CZF A;  3B90 A;  4Z03 A;  2NTQ A;  2XT4 A;  5C1E A;  1QCX A;  1TYU A;  4OJO A;  4YCQ A;  3GQ9 A;  2NTP A;  4XLH A;  3SY2 A;  1PE9 A;  1O8I A;  1NHC A;  3FY3 A;  4V02 C;  1DAB A;  1QA2 A;  2VBE A;  4XR6 A;  1QA3 A;  1JRG A;  1BN8 A;  4XQF A;  1IA5 A;  1KCC A;  4OZY A;  1TYW A;  4YZQ A;  1H80 A;  2NSP A;  3JX8 A;  1DBG A;  4YEJ A;  1OGO X;  1IDJ A;  3PET A;  1PXZ A;  3ML3 A;  3N90 A;  2XC1 A;  3LJY A;  3B8Y A;  4XMY A;  3SYJ A;  2V5I A;  4YZ0 A;  4W8S A;  2ODL A;  2NT6 A;  1WXR A;  2W7Z A;  3VMV A;  3VSU A;  3WWG A;  2BSP A;  3TH0 A;  1XG2 A;  2BM5 A;  2VFO A;  2XTW A;  4MR0 A;  1PLU A;  4MXN A;  1HG8 A;  4YFO A;  3RIQ A;  3UW0 A;  4EW9 A;  1WMR A;  3ZSC A;  3EQO A;  1O8L A;  2QXZ A;  2UVF A;  1JTA A;  2X3H A;  3GRH A;  2XTX A;  4KH3 A;  4U4B A;  3SQV A;  1K5C A;  1O8M A;  1TYV A;  2NT9 A;  3GQ7 A;  4OJP A;  1VBL A;  3PSZ A;  4C2L A;  1OFM A;  1EA0 A;  4XKW A;  3N6Z A;  1DBO A;  2O17 A;  4W8R A;  3NB2 A;  1L1I A;  3ZPP A;  1KTW A;  2Z8G A;  4YEL A;  4XLE A;  2IQ7 A;  4OJ6 A;  4XN3 A;  4AVZ A;  1HF2 A;  1OFE A;  2J8K A;  1OGM X;  1EZG A;  2X85 A;  1KCD A;  5DNS A;  4XNF A;  4URR A;  2B0R A;  2VBM A;  4W8T A;  1O8K A;  4Z06 A;  1RMG A;  3EQN A;  2NST A;  2IOU G;  2O6W A;  2PYG A;  4HWV A;  3VSV A;  5JLV C;  4XOR A;  5JMC B;  1TYX A;  2YUH A;  4W8Q A;  3GQ8 A;  1IB4 A;  2O0W A;  4XN0 A;  3SUC A;  4XKV A;  2INU A;  3T9G A;  4YC5 A;  1BHE A;  1CLW A;  3B4N A;  3LYC A;  1AIR A;  1K4Z A;  1X0C A;  2VBK A;  2XTY A;  5C1C A;  4YEI A;  2F3L A;  1O8D A;  1OFL A;  2VFM A;  2QZA A;  3AK5 A;  2VFQ A;  4XON A;  3VST A;  4XOT A;  1GQ8 A;  2QY1 A;  2X6W A;  4XL9 A;  4U49 A;  4PMH A;  2VJI A;  4JRA C;  1O8E A;  4NK6 A; 
#chains in the Genus database with same CATH homology
 3VMW A;  1EE6 A;  2O0V A;  2QX3 A;  4YZX A;  4XM3 A;  1O8J A;  2VJJ A;  4OJL A;  2O04 A;  4XLF A;  1IDK A;  1RU4 A;  3GQA A;  4OJ5 A;  2O1D A;  5AMV A;  2PYH A;  4OZZ A;  4YZA A;  1O8G A;  4XLA A;  2EWE A;  3JUR A;  2INV A;  2NZM A;  1O8H A;  2UVE A;  2X6X A;  3LMW A;  1OOC A;  4I84 A;  1O8F A;  4XLC A;  2NTB A;  4XOP A;  4Z05 A;  3KRG A;  2X6Y A;  4NK8 A;  1O88 A;  1RWR A;  2PEC A;  1QJV A;  1CZF A;  3B90 A;  4Z03 A;  2NTQ A;  5C1E A;  1QCX A;  4OJO A;  3GQ9 A;  2NTP A;  4XLH A;  1PE9 A;  1O8I A;  1NHC A;  3FY3 A;  2VBE A;  4XR6 A;  1JRG A;  1BN8 A;  4XQF A;  1IA5 A;  1KCC A;  4OZY A;  4YZQ A;  1H80 A;  2NSP A;  1DBG A;  4YEJ A;  1OGO X;  1IDJ A;  1PXZ A;  3B8Y A;  4XMY A;  4YZ0 A;  4W8S A;  2ODL A;  2NT6 A;  3VMV A;  3VSU A;  3WWG A;  2BSP A;  1XG2 A;  4MR0 A;  4EW9 A;  1PLU A;  4MXN A;  1HG8 A;  3UW0 A;  1WMR A;  3ZSC A;  3EQO A;  1O8L A;  2QXZ A;  2UVF A;  1JTA A;  2X3H A;  3GRH A;  1K5C A;  4U4B A;  1O8M A;  2NT9 A;  3GQ7 A;  4OJP A;  1VBL A;  4C2L A;  1OFM A;  4XKW A;  1DBO A;  2O17 A;  4W8R A;  3ZPP A;  1KTW A;  2Z8G A;  4YEL A;  4XLE A;  2IQ7 A;  4OJ6 A;  4XN3 A;  4AVZ A;  1OGM X;  2X85 A;  1KCD A;  4XNF A;  4URR A;  4W8T A;  2VBM A;  1O8K A;  4Z06 A;  1RMG A;  3EQN A;  2NST A;  4HWV A;  2PYG A;  3VSV A;  4XOR A;  4W8Q A;  3GQ8 A;  1IB4 A;  2O0W A;  4XN0 A;  3SUC A;  4XKV A;  2INU A;  3T9G A;  1BHE A;  3B4N A;  1AIR A;  1X0C A;  2VBK A;  5C1C A;  1O8D A;  1OFL A;  4XON A;  3VST A;  4XOT A;  1GQ8 A;  2QY1 A;  2X6W A;  4XL9 A;  4U49 A;  4PMH A;  2VJI A;  1O8E A;  4NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...