3RIQA

Siphovirus 9na tailspike receptor binding domain
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
541
structure length
541
Chain Sequence
FRSEADKKFKYSVKLSDYMTLQEAATAAVDSLLIDIDYNFIDGEAVDFGGKVLTIECKAKFIGDGVLNWNNLGSGSKVISPHMHTKTTPYTVYRFDDNGNWVTNPTTVLASVAQRLDKGYKPNVNDHDIWASLPDNVKNQVAGATLRVNSANNIIFTHPEATMGGYLFTLCNHILVESPRNFIAWESGITFENHHTTAWGTGNKVVGGEIKYGSGSAVLFIRNDGGDDHDGGVRDLISYRVGESGVKTYQNEIGGRSARNYRLVFDNITTIQCYYDGIDVNADTGSPTERVDDYTLAEYPWFQLPTQHIIRNIITRDCMGIGAWWDGQKNIIDNVVTYEAHKEGMFDRGTNNDITNITVVCANKDLTNLNQIVCEGGSRLRGIMVHAYTTQGYAVYAPSSEVSNVSCAGSGTKKILCTYVADIQGGNINVQHGENAMTLSMRPAMGGTINPSLVLTADCQVASPGNEASIVKLSAIQDGARVGELQLNRLGFKHMSIPVAESQLPESALEFNSSIGFFFGTDDELRILAKKPDGTFVTYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tail morphology controls DNA release in two Salmonella phages with one lipopolysaccharide receptor recognition system.
pubmed doi rcsb
source organism Siphovirus 9na
molecule tags Viral protein
molecule keywords Tailspike protein
total genus 206
structure length 541
sequence length 541
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09251 PhageP22-tail Salmonella phage P22 tail-spike
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3riqA00
1TSPA 2VFQA 3H09A 3ML3A 1QRCA 1WXRA 2V5IA 1DABA 2VFMA 2VFNA 1TYVA 2XC1A 3RIQA 3TH0A 1QA3A 1TYWA 3SZEA 1QA2A 2VFOA 1TYUA 2VFPA 1TYXA 1QRBA 4KH3A 1QA1A 1CLWA 2IOUG 3AK5A 4OM9A 3SYJA 1QQ1A
chains in the Genus database with same CATH superfamily
3GQAA 4XN0A 3B90A 3NAWA 4MR0A 1KQ5A 3LYCA 1IDJA 4OJOA 2INVA 2XT4A 4XORA 4YZXA 3EQNA 1K4ZA 2NT9A 3ML3A 1DBGA 1H80A 4JRAC 5C1CA 2VBEA 4C2LA 4XOPA 2VFNA 4XLAA 4YEIA 1LM1A 2VBMA 1KCDA 3N90A 3TH0A 1IA5A 4XONA 4YZ0A 2O0WA 4YCQA 4Z03A 2ODLA 4XLEA 4XNFA 1EZGA 3PETA 4U4BA 4YEJA 2VJJA 3VSTA 1PXZA 3T9GA 2BM7A 1O8FA 3UW0A 1OFEA 3VMVA 4AVZA 3SUCA 1KCCA 1QA1A 4OJPA 3NB2A 2PYHA 3GQ7A 4XLHA 1RMGA 3LMWA 4OM9A 1QQ1A 1RWRA 3P4GA 1TSPA 1O8DA 3ZPPA 3GRHA 4XL9A 2NTBA 3H09A 1LLWA 4OPWA 4XQFA 1JRGA 1L1IA 2O1DA 4U49A 2NT6A 3EQOA 4NK8A 1O8HA 2B0RA 1O88A 2BM5A 1DABA 1OOCA 4W8RA 1HG8A 4OJ6A 1EA0A 3BH6B 1O8GA 1GQ8A 1OFDA 1QA2A 2VFOA 1X0CA 2INUA 3GQ9A 2J8IA 1OGOX 4W8TA 2VJIA 1O8MA 1QRBA 4YZAA 1RU4A 4KH3A 3PSSA 3SY2A 4W8QA 1K5CA 4OZZA 1CLWA 2QY1A 2G0YA 3WWGA 2X3HA 2XTXA 4XKWA 2NSTA 2VFQA 3BH7B 5JLVC 1WMRA 2QXZA 3GQ8A 5JMCB 5C1EA 1WXRA 1AIRA 3KRGA 5DNSA 4YZQA 1BN8A 2O0VA 2V5IA 4I84A 4XOTA 4XLFA 3RIQA 1K8FA 1PLUA 1QCXA 4NK6A 3SQVA 2X85A 1O8JA 4XM3A 3SZEA 1EE6A 2BX6A 1O8IA 2IQ7A 4EW9A 4XMYA 4HWVA 1TYUA 3DU1X 2YUHA 4URRA 4XR6A 4OJLA 1TYXA 2VFPA 2QYUA 3SYJA 2NTQA 3N6ZA 1HF2A 1OGMX 2NSPA 2QZAA 3PSZA 4YFOA 1O8EA 3VSUA 2UVFA 3FY3A 2IOUG 1LLZA 2X6XA 2XC1A 1OFLA 4YELA 4Z06A 1IDKA 4Z05A 4XKVA 1VBLA 2W7ZA 4YDTA 2XTYA 3B8YA 1PE9A 1BHEA 1O8LA 2XTWA 3LJYA 2VBKA 1JTAA 3JURA 2BSPA 4OZYA 3VSVA 2Z8GA 5AMVA 3VMWA 4V02C 2BM4A 2O04A 4XN3A 1OFMA 2BM6A 2VFMA 2XT2A 1TYVA 2F3LA 1NHCA 2QX3A 3JX8A 1QA3A 4YC5A 2O17A 1TYWA 4PMHA 4XLCA 3B4NA 2PYGA 1IB4A 3ZSCA 1KTWA 2X6WA 1QJVA 1CZFA 1O8KA 2PECA 1DBOA 2NZMA 2J8KA 4W8SA 2NTPA 4OJ5A 4MXNA 2X6YA 1QRCA 3AK5A 1XG2A 2UVEA 2EWEA 2O6WA
chains in the Genus database with same CATH topology
3P4GA 1TSPA 1KQ5A 2W7ZA 3LYCA 4OJOA 2VFQA 3BH7B 3H09A 4OPWA 5JLVC 3LJYA 1K4ZA 3ML3A 5JMCB 1WXRA 4JRAC 2BM4A 4V02C 2B0RA 2BM5A 2V5IA 1DABA 2BM6A 2VFMA 2VFNA 1TYVA 2F3LA 1K8FA 3N90A 3RIQA 3TH0A 3JX8A 4OJ6A 1QA3A 1TYWA 3BH6B 2IOUG 3PETA 3SZEA 2BX6A 1QA2A 2VFOA 1TYUA 2YUHA 2J8IA 4OJLA 1TYXA 2BM7A 1QRBA 2VFPA 4KH3A 3N6ZA 1HF2A 1QA1A 4OM9A 1CLWA 4OJPA 4OJ5A 2G0YA 1QRCA 3AK5A 2XC1A 3SYJA 1QQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSP A;  2VFQ A;  3H09 A;  3ML3 A;  1QRC A;  1WXR A;  2V5I A;  1DAB A;  2VFM A;  2VFN A;  1TYV A;  2XC1 A;  3RIQ A;  3TH0 A;  1QA3 A;  1TYW A;  3SZE A;  1QA2 A;  2VFO A;  1TYU A;  2VFP A;  1TYX A;  1QRB A;  4KH3 A;  1QA1 A;  1CLW A;  2IOU G;  3AK5 A;  4OM9 A;  3SYJ A;  1QQ1 A; 
#chains in the Genus database with same CATH topology
 3GQA A;  4XN0 A;  3B90 A;  3NAW A;  4MR0 A;  1KQ5 A;  3LYC A;  1IDJ A;  4OJO A;  2INV A;  2XT4 A;  4XOR A;  4YZX A;  3EQN A;  1K4Z A;  2NT9 A;  3ML3 A;  1DBG A;  1H80 A;  4JRA C;  5C1C A;  2VBE A;  4C2L A;  4XOP A;  2VFN A;  4XLA A;  4YEI A;  1LM1 A;  2VBM A;  1KCD A;  3N90 A;  3TH0 A;  1IA5 A;  4XON A;  4YZ0 A;  2O0W A;  4YCQ A;  4Z03 A;  2ODL A;  4XLE A;  4XNF A;  1EZG A;  3PET A;  4U4B A;  4YEJ A;  2VJJ A;  3VST A;  1PXZ A;  3T9G A;  2BM7 A;  1O8F A;  3UW0 A;  1OFE A;  3VMV A;  4AVZ A;  3SUC A;  1KCC A;  1QA1 A;  4OJP A;  3NB2 A;  2PYH A;  3GQ7 A;  4XLH A;  1RMG A;  3LMW A;  4OM9 A;  1QQ1 A;  1RWR A;  3P4G A;  1TSP A;  1O8D A;  3ZPP A;  3GRH A;  4XL9 A;  2NTB A;  3H09 A;  1LLW A;  4OPW A;  4XQF A;  1JRG A;  1L1I A;  2O1D A;  4U49 A;  2NT6 A;  3EQO A;  4NK8 A;  1O8H A;  2B0R A;  1O88 A;  2BM5 A;  1DAB A;  1OOC A;  4W8R A;  1HG8 A;  4OJ6 A;  1EA0 A;  3BH6 B;  1O8G A;  1GQ8 A;  1OFD A;  1QA2 A;  2VFO A;  1X0C A;  2INU A;  3GQ9 A;  2J8I A;  1OGO X;  4W8T A;  2VJI A;  1O8M A;  1QRB A;  4YZA A;  1RU4 A;  4KH3 A;  3PSS A;  3SY2 A;  4W8Q A;  1K5C A;  4OZZ A;  1CLW A;  2QY1 A;  2G0Y A;  3WWG A;  2X3H A;  2XTX A;  4XKW A;  2NST A;  2VFQ A;  3BH7 B;  5JLV C;  1WMR A;  2QXZ A;  3GQ8 A;  5JMC B;  5C1E A;  1WXR A;  1AIR A;  3KRG A;  5DNS A;  4YZQ A;  1BN8 A;  2O0V A;  2V5I A;  4I84 A;  4XOT A;  4XLF A;  3RIQ A;  1K8F A;  1PLU A;  1QCX A;  4NK6 A;  3SQV A;  2X85 A;  1O8J A;  4XM3 A;  3SZE A;  1EE6 A;  2BX6 A;  1O8I A;  2IQ7 A;  4EW9 A;  4XMY A;  4HWV A;  1TYU A;  3DU1 X;  2YUH A;  4URR A;  4XR6 A;  4OJL A;  1TYX A;  2VFP A;  2QYU A;  3SYJ A;  2NTQ A;  3N6Z A;  1HF2 A;  1OGM X;  2NSP A;  2QZA A;  3PSZ A;  4YFO A;  1O8E A;  3VSU A;  2UVF A;  3FY3 A;  2IOU G;  1LLZ A;  2X6X A;  2XC1 A;  1OFL A;  4YEL A;  4Z06 A;  1IDK A;  4Z05 A;  4XKV A;  1VBL A;  2W7Z A;  4YDT A;  2XTY A;  3B8Y A;  1PE9 A;  1BHE A;  1O8L A;  2XTW A;  3LJY A;  2VBK A;  1JTA A;  3JUR A;  2BSP A;  4OZY A;  3VSV A;  2Z8G A;  5AMV A;  3VMW A;  4V02 C;  2BM4 A;  2O04 A;  4XN3 A;  1OFM A;  2BM6 A;  2VFM A;  2XT2 A;  1TYV A;  2F3L A;  1NHC A;  2QX3 A;  3JX8 A;  1QA3 A;  4YC5 A;  2O17 A;  1TYW A;  4PMH A;  4XLC A;  3B4N A;  2PYG A;  1IB4 A;  3ZSC A;  1KTW A;  2X6W A;  1QJV A;  1CZF A;  1O8K A;  2PEC A;  1DBO A;  2NZM A;  2J8K A;  4W8S A;  2NTP A;  4OJ5 A;  4MXN A;  2X6Y A;  1QRC A;  3AK5 A;  1XG2 A;  2UVE A;  2EWE A;  2O6W A; 
#chains in the Genus database with same CATH homology
 3P4G A;  1TSP A;  1KQ5 A;  2W7Z A;  3LYC A;  4OJO A;  2VFQ A;  3BH7 B;  3H09 A;  4OPW A;  5JLV C;  3LJY A;  1K4Z A;  3ML3 A;  5JMC B;  1WXR A;  4JRA C;  2BM4 A;  4V02 C;  2B0R A;  2BM5 A;  2V5I A;  1DAB A;  2BM6 A;  2VFM A;  2VFN A;  1TYV A;  2F3L A;  1K8F A;  3N90 A;  3RIQ A;  3TH0 A;  3JX8 A;  4OJ6 A;  1QA3 A;  1TYW A;  3BH6 B;  2IOU G;  3PET A;  3SZE A;  2BX6 A;  1QA2 A;  2VFO A;  1TYU A;  2YUH A;  2J8I A;  4OJL A;  1TYX A;  2BM7 A;  1QRB A;  2VFP A;  4KH3 A;  3N6Z A;  1HF2 A;  1QA1 A;  4OM9 A;  1CLW A;  4OJP A;  4OJ5 A;  2G0Y A;  1QRC A;  3AK5 A;  2XC1 A;  3SYJ A;  1QQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...