3RIQA

Siphovirus 9na tailspike receptor binding domain
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
541
structure length
541
Chain Sequence
FRSEADKKFKYSVKLSDYMTLQEAATAAVDSLLIDIDYNFIDGEAVDFGGKVLTIECKAKFIGDGVLNWNNLGSGSKVISPHMHTKTTPYTVYRFDDNGNWVTNPTTVLASVAQRLDKGYKPNVNDHDIWASLPDNVKNQVAGATLRVNSANNIIFTHPEATMGGYLFTLCNHILVESPRNFIAWESGITFENHHTTAWGTGNKVVGGEIKYGSGSAVLFIRNDGGDDHDGGVRDLISYRVGESGVKTYQNEIGGRSARNYRLVFDNITTIQCYYDGIDVNADTGSPTERVDDYTLAEYPWFQLPTQHIIRNIITRDCMGIGAWWDGQKNIIDNVVTYEAHKEGMFDRGTNNDITNITVVCANKDLTNLNQIVCEGGSRLRGIMVHAYTTQGYAVYAPSSEVSNVSCAGSGTKKILCTYVADIQGGNINVQHGENAMTLSMRPAMGGTINPSLVLTADCQVASPGNEASIVKLSAIQDGARVGELQLNRLGFKHMSIPVAESQLPESALEFNSSIGFFFGTDDELRILAKKPDGTFVTYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tailspike protein
publication title Tail morphology controls DNA release in two Salmonella phages with one lipopolysaccharide receptor recognition system.
pubmed doi rcsb
source organism Siphovirus 9na
total genus 206
structure length 541
sequence length 541
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09251 PhageP22-tail Salmonella phage P22 tail-spike
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3riqA00
2VFNA 3RIQA 3SZEA 1TYXA 2VFQA 1CLWA 1DABA 1QQ1A 4OM9A 2IOUG 1QRBA 3SYJA 1TSPA 2VFMA 4KH3A 3ML3A 1TYVA 2XC1A 2V5IA 1QRCA 1TYUA 2VFPA 3TH0A 1WXRA 1QA3A 3AK5A 2VFOA 3H09A 1QA1A 1TYWA 1QA2A
chains in the Genus database with same CATH superfamily
3SZEA 1TYXA 4XM3A 2XT2A 1DABA 3KRGA 2BX6A 5JMCB 1QRBA 2NTBA 3WWGA 3VSTA 1O8EA 3VMWA 1O8IA 1O8LA 3SUCA 2VBKA 3VMVA 2QYUA 4YEIA 1QJVA 4U49A 1OGOX 1O8MA 1LM1A 2NZMA 3PSZA 4W8QA 2VFOA 3GQ8A 4XN3A 1O8HA 2BM5A 1PLUA 1BN8A 2QZAA 3VSVA 3ZSCA 1IDKA 1OGMX 4YZXA 1KQ5A 4Z06A 4XOPA 1EE6A 5C1CA 4MXNA 1O8DA 1TYWA 2NTQA 1OFLA 2ODLA 3B8YA 2X6YA 1QA3A 4YCQA 2XTWA 2VBMA 2VFNA 3B4NA 2B0RA 2EWEA 1QCXA 2BM6A 2X3HA 3EQOA 1CLWA 3NAWA 3LJYA 3ZPPA 2VJIA 3EQNA 4OM9A 4XLCA 1EA0A 4YC5A 4URRA 4Z05A 3GRHA 4XN0A 2PECA 4XMYA 3SYJA 1GQ8A 2VFMA 3NB2A 1L1IA 1O8JA 2QX3A 2VJJA 3LYCA 1DBOA 1HG8A 5JLVC 1IDJA 2X6WA 2V5IA 2XTXA 4OPWA 3P4GA 4XKVA 1OOCA 3TH0A 2BM7A 3GQ9A 1O8FA 1BHEA 4EW9A 3SQVA 1K8FA 4JRAC 4Z03A 4HWVA 2VBEA 4XL9A 2O1DA 2Z8GA 1K5CA 1RU4A 3BH7B 1DBGA 1QA1A 4YZQA 4XORA 4XKWA 2J8KA 4XLEA 4XNFA 3GQAA 1X0CA 3DU1X 2NT6A 1XG2A 2NT9A 1OFEA 4YELA 1O8KA 3T9GA 3RIQA 2VFQA 3JX8A 2O6WA 4OJ6A 5C1EA 1RWRA 1KTWA 2UVEA 4XOTA 3SY2A 4YZAA 4XLFA 4YZ0A 1LLZA 3GQ7A 4XR6A 3PSSA 4OJPA 1NHCA 2PYGA 1VBLA 2BM4A 1JRGA 3PETA 4I84A 4OJOA 1TYUA 2J8IA 2QY1A 1WXRA 2IQ7A 2NSPA 1H80A 3FY3A 1OFDA 4PMHA 3AK5A 1IA5A 3B90A 4C2LA 3H09A 4XONA 4XLHA 2INUA 1CZFA 4XQFA 2O0WA 2W7ZA 2X85A 2INVA 1KCDA 1HF2A 2O17A 2X6XA 1WMRA 4MR0A 4AVZA 2XTYA 1KCCA 3JURA 3N90A 1IB4A 2O04A 4OJ5A 3N6ZA 4YFOA 5AMVA 3VSUA 4NK8A 1QQ1A 3BH6B 1K4ZA 1O8GA 2NTPA 2IOUG 2BSPA 1JTAA 2YUHA 2XT4A 1TSPA 1LLWA 4KH3A 2QXZA 1PE9A 2O0VA 3ML3A 4W8RA 1TYVA 1O88A 4V02C 1AIRA 1EZGA 1QRCA 2XC1A 2VFPA 4OZZA 4NK6A 3UW0A 3LMWA 2UVFA 1RMGA 4W8SA 2PYHA 2NSTA 4U4BA 2G0YA 2F3LA 1OFMA 4YEJA 1PXZA 5DNSA 4W8TA 4OJLA 4OZYA 4YDTA 1QA2A 4XLAA
chains in the Genus database with same CATH topology
4OJ5A 2VFNA 3N6ZA 2B0RA 1TYXA 2VFQA 3JX8A 3RIQA 3SZEA 4OJ6A 2BM6A 1CLWA 1DABA 3LJYA 1QQ1A 3BH6B 2BX6A 1K4ZA 4OM9A 2IOUG 5JMCB 1QRBA 2YUHA 3SYJA 1TSPA 2VFMA 4KH3A 4OJPA 3ML3A 1TYVA 4V02C 3LYCA 2BM4A 5JLVC 3PETA 1QRCA 2V5IA 1TYUA 2J8IA 2VFPA 2XC1A 3P4GA 4OPWA 2BM7A 4OJOA 3TH0A 1QA3A 1K8FA 4JRAC 3AK5A 2VFOA 2BM5A 3H09A 2G0YA 1KQ5A 2F3LA 2W7ZA 3BH7B 1QA1A 4OJLA 1HF2A 1TYWA 1QA2A 3N90A 1WXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFN A;  3RIQ A;  3SZE A;  1TYX A;  2VFQ A;  1CLW A;  1DAB A;  1QQ1 A;  4OM9 A;  2IOU G;  1QRB A;  3SYJ A;  1TSP A;  2VFM A;  4KH3 A;  3ML3 A;  1TYV A;  2XC1 A;  2V5I A;  1QRC A;  1TYU A;  2VFP A;  3TH0 A;  1WXR A;  1QA3 A;  3AK5 A;  2VFO A;  3H09 A;  1QA1 A;  1TYW A;  1QA2 A; 
#chains in the Genus database with same CATH topology
 3SZE A;  1TYX A;  4XM3 A;  2XT2 A;  1DAB A;  3KRG A;  2BX6 A;  5JMC B;  1QRB A;  2NTB A;  3WWG A;  3VST A;  1O8E A;  3VMW A;  1O8I A;  1O8L A;  3SUC A;  2VBK A;  3VMV A;  2QYU A;  4YEI A;  1QJV A;  4U49 A;  1OGO X;  1O8M A;  1LM1 A;  2NZM A;  3PSZ A;  4W8Q A;  2VFO A;  3GQ8 A;  4XN3 A;  1O8H A;  2BM5 A;  1PLU A;  1BN8 A;  2QZA A;  3VSV A;  3ZSC A;  1IDK A;  1OGM X;  4YZX A;  1KQ5 A;  4Z06 A;  4XOP A;  1EE6 A;  5C1C A;  4MXN A;  1O8D A;  1TYW A;  2NTQ A;  1OFL A;  2ODL A;  3B8Y A;  2X6Y A;  1QA3 A;  4YCQ A;  2XTW A;  2VBM A;  2VFN A;  3B4N A;  2B0R A;  2EWE A;  1QCX A;  2BM6 A;  2X3H A;  3EQO A;  1CLW A;  3NAW A;  3LJY A;  3ZPP A;  2VJI A;  3EQN A;  4OM9 A;  4XLC A;  1EA0 A;  4YC5 A;  4URR A;  4Z05 A;  3GRH A;  4XN0 A;  2PEC A;  4XMY A;  3SYJ A;  1GQ8 A;  2VFM A;  3NB2 A;  1L1I A;  1O8J A;  2QX3 A;  2VJJ A;  3LYC A;  1DBO A;  1HG8 A;  5JLV C;  1IDJ A;  2X6W A;  2V5I A;  2XTX A;  4OPW A;  3P4G A;  4XKV A;  1OOC A;  3TH0 A;  2BM7 A;  3GQ9 A;  1O8F A;  1BHE A;  4EW9 A;  3SQV A;  1K8F A;  4JRA C;  4Z03 A;  4HWV A;  2VBE A;  4XL9 A;  2O1D A;  2Z8G A;  1K5C A;  1RU4 A;  3BH7 B;  1DBG A;  1QA1 A;  4YZQ A;  4XOR A;  4XKW A;  2J8K A;  4XLE A;  4XNF A;  3GQA A;  1X0C A;  3DU1 X;  2NT6 A;  1XG2 A;  2NT9 A;  1OFE A;  4YEL A;  1O8K A;  3T9G A;  3RIQ A;  2VFQ A;  3JX8 A;  2O6W A;  4OJ6 A;  5C1E A;  1RWR A;  1KTW A;  2UVE A;  4XOT A;  3SY2 A;  4YZA A;  4XLF A;  4YZ0 A;  1LLZ A;  3GQ7 A;  4XR6 A;  3PSS A;  4OJP A;  1NHC A;  2PYG A;  1VBL A;  2BM4 A;  1JRG A;  3PET A;  4I84 A;  4OJO A;  1TYU A;  2J8I A;  2QY1 A;  1WXR A;  2IQ7 A;  2NSP A;  1H80 A;  3FY3 A;  1OFD A;  4PMH A;  3AK5 A;  1IA5 A;  3B90 A;  4C2L A;  3H09 A;  4XON A;  4XLH A;  2INU A;  1CZF A;  4XQF A;  2O0W A;  2W7Z A;  2X85 A;  2INV A;  1KCD A;  1HF2 A;  2O17 A;  2X6X A;  1WMR A;  4MR0 A;  4AVZ A;  2XTY A;  1KCC A;  3JUR A;  3N90 A;  1IB4 A;  2O04 A;  4OJ5 A;  3N6Z A;  4YFO A;  5AMV A;  3VSU A;  4NK8 A;  1QQ1 A;  3BH6 B;  1K4Z A;  1O8G A;  2NTP A;  2IOU G;  2BSP A;  1JTA A;  2YUH A;  2XT4 A;  1TSP A;  1LLW A;  4KH3 A;  2QXZ A;  1PE9 A;  2O0V A;  3ML3 A;  4W8R A;  1TYV A;  1O88 A;  4V02 C;  1AIR A;  1EZG A;  1QRC A;  2XC1 A;  2VFP A;  4OZZ A;  4NK6 A;  3UW0 A;  3LMW A;  2UVF A;  1RMG A;  4W8S A;  2PYH A;  2NST A;  4U4B A;  2G0Y A;  2F3L A;  1OFM A;  4YEJ A;  1PXZ A;  5DNS A;  4W8T A;  4OJL A;  4OZY A;  4YDT A;  1QA2 A;  4XLA A; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  2VFN A;  3N6Z A;  2B0R A;  1TYX A;  2VFQ A;  3JX8 A;  3RIQ A;  3SZE A;  4OJ6 A;  2BM6 A;  1CLW A;  1DAB A;  3LJY A;  1QQ1 A;  3BH6 B;  2BX6 A;  1K4Z A;  4OM9 A;  2IOU G;  5JMC B;  1QRB A;  2YUH A;  3SYJ A;  1TSP A;  2VFM A;  4KH3 A;  4OJP A;  3ML3 A;  1TYV A;  4V02 C;  3LYC A;  2BM4 A;  5JLV C;  3PET A;  1QRC A;  2V5I A;  1TYU A;  2J8I A;  2VFP A;  2XC1 A;  3P4G A;  4OPW A;  2BM7 A;  4OJO A;  3TH0 A;  1QA3 A;  1K8F A;  4JRA C;  3AK5 A;  2VFO A;  2BM5 A;  3H09 A;  2G0Y A;  1KQ5 A;  2F3L A;  2W7Z A;  3BH7 B;  1QA1 A;  4OJL A;  1HF2 A;  1TYW A;  1QA2 A;  3N90 A;  1WXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...