3RIQA

Siphovirus 9na tailspike receptor binding domain
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
541
structure length
541
Chain Sequence
FRSEADKKFKYSVKLSDYMTLQEAATAAVDSLLIDIDYNFIDGEAVDFGGKVLTIECKAKFIGDGVLNWNNLGSGSKVISPHMHTKTTPYTVYRFDDNGNWVTNPTTVLASVAQRLDKGYKPNVNDHDIWASLPDNVKNQVAGATLRVNSANNIIFTHPEATMGGYLFTLCNHILVESPRNFIAWESGITFENHHTTAWGTGNKVVGGEIKYGSGSAVLFIRNDGGDDHDGGVRDLISYRVGESGVKTYQNEIGGRSARNYRLVFDNITTIQCYYDGIDVNADTGSPTERVDDYTLAEYPWFQLPTQHIIRNIITRDCMGIGAWWDGQKNIIDNVVTYEAHKEGMFDRGTNNDITNITVVCANKDLTNLNQIVCEGGSRLRGIMVHAYTTQGYAVYAPSSEVSNVSCAGSGTKKILCTYVADIQGGNINVQHGENAMTLSMRPAMGGTINPSLVLTADCQVASPGNEASIVKLSAIQDGARVGELQLNRLGFKHMSIPVAESQLPESALEFNSSIGFFFGTDDELRILAKKPDGTFVTYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tailspike protein
publication title Tail morphology controls DNA release in two Salmonella phages with one lipopolysaccharide receptor recognition system.
pubmed doi rcsb
source organism Siphovirus 9na
molecule tags Viral protein
total genus 206
structure length 541
sequence length 541
ec nomenclature
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09251 PhageP22-tail Salmonella phage P22 tail-spike
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.20 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3riqA00
1TYXA 2VFNA 1QRCA 2IOUG 4OM9A 1QQ1A 1WXRA 1TYUA 3RIQA 3ML3A 3H09A 2VFQA 3TH0A 3AK5A 1TYVA 1CLWA 1QA3A 2XC1A 1DABA 1TYWA 3SYJA 1QRBA 2V5IA 1TSPA 1QA1A 1QA2A 3SZEA 4KH3A 2VFPA 2VFOA 2VFMA
chains in the Genus database with same CATH superfamily
4W8RA 2NT6A 2VBKA 4U4BA 2INVA 2W7ZA 1L1IA 1OFEA 1XG2A 3ZSCA 3WWGA 3VSUA 3B4NA 2O04A 2NTQA 2NTPA 1RMGA 2X3HA 3LJYA 4XMYA 1O8JA 2VFNA 4XN0A 2PECA 4XLCA 4YELA 2IQ7A 2X6YA 2VJJA 2F3LA 3LMWA 4OJOA 4XORA 2J8IA 3EQOA 3NB2A 1TYUA 4XLEA 4XKWA 2VFQA 4URRA 1JTAA 2QY1A 4XL9A 2YUHA 2XTWA 4XOTA 1DABA 3SYJA 2NSTA 1OGMX 1IDKA 1CZFA 1TSPA 4MR0A 1O8FA 2NTBA 1KCDA 2X85A 4KH3A 4XLAA 5C1CA 1RWRA 4XM3A 3SY2A 1HG8A 4XNFA 1IA5A 2BM6A 3B8YA 4XQFA 4MXNA 3DU1X 4OJPA 1KTWA 3JURA 3JX8A 1X0CA 4XR6A 2J8KA 2O6WA 1IDJA 2X6WA 1OOCA 1TYXA 4NK6A 3GQ9A 4OZZA 2Z8GA 3VMWA 1OFDA 5C1EA 2QZAA 2NSPA 1OFLA 1IB4A 1O8LA 2IOUG 4V02C 2BX6A 1EE6A 1O8HA 1PLUA 1JRGA 4XONA 1WXRA 2BSPA 3H09A 1O8GA 1VBLA 1DBGA 4YCQA 2INUA 3AK5A 4YZAA 1K5CA 4PMHA 1PXZA 3PSSA 2O0VA 1PE9A 1K4ZA 1QA2A 1TYWA 4W8QA 1QRBA 3GQ8A 5JLVC 2EWEA 4XN3A 3VSTA 4EW9A 4NK8A 4XLFA 1LLZA 1O8KA 1OGOX 2VFOA 3RIQA 4YFOA 3VSVA 4AVZA 1O8MA 2PYHA 2UVEA 2VFMA 3BH6B 1BN8A 1KCCA 4OJ6A 1AIRA 4Z06A 1BHEA 2XT4A 1LLWA 2VBEA 4OM9A 4YEJA 3B90A 1HF2A 2BM4A 1QQ1A 3SUCA 2ODLA 3EQNA 2PYGA 3GQ7A 2UVFA 3ML3A 3UW0A 4C2LA 5DNSA 1TYVA 2O17A 1EZGA 2QYUA 4YZ0A 1QA3A 2XTXA 1O8IA 1RU4A 4XLHA 2V5IA 5JMCB 1O88A 1GQ8A 3KRGA 3P4GA 1OFMA 3PSZA 2VFPA 2NT9A 4OZYA 2G0YA 4XOPA 4I84A 3N6ZA 4OJLA 1H80A 1KQ5A 4JRAC 2QX3A 1QJVA 3GQAA 3ZPPA 4YZQA 2VBMA 5AMVA 1QRCA 2VJIA 3FY3A 4YEIA 2B0RA 1O8DA 1O8EA 2O0WA 4OPWA 4U49A 4XKVA 3TH0A 1WMRA 3NAWA 2XT2A 4Z05A 4W8SA 1CLWA 1DBOA 4YC5A 2BM7A 2XC1A 3BH7B 1LM1A 4OJ5A 1QA1A 2X6XA 3T9GA 3SZEA 1NHCA 4HWVA 4YDTA 1K8FA 2QXZA 3GRHA 1QCXA 2NZMA 2O1DA 3VMVA 2BM5A 3LYCA 3SQVA 1EA0A 4W8TA 2XTYA 3PETA 3N90A 4YZXA 4Z03A
chains in the Genus database with same CATH topology
3BH6B 2W7ZA 4JRAC 1TYXA 4OJ6A 3LJYA 2VFNA 1QA2A 1QRCA 2IOUG 4OM9A 4V02C 2BX6A 1HF2A 2BM4A 1QQ1A 2B0RA 2F3LA 4OJOA 2J8IA 4OPWA 1WXRA 1TYUA 3RIQA 3ML3A 3H09A 2VFQA 3TH0A 3AK5A 1TYVA 2YUHA 1CLWA 1QA3A 2BM7A 1K4ZA 2XC1A 1DABA 1TYWA 3SYJA 1QRBA 2V5IA 1TSPA 3BH7B 4OJ5A 5JLVC 5JMCB 1QA1A 3SZEA 3P4GA 4KH3A 1K8FA 4OJPA 2BM5A 3LYCA 2VFPA 2BM6A 3PETA 2VFMA 3N90A 2G0YA 2VFOA 3N6ZA 4OJLA 3JX8A 1KQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYX A;  2VFN A;  1QRC A;  2IOU G;  4OM9 A;  1QQ1 A;  1WXR A;  1TYU A;  3RIQ A;  3ML3 A;  3H09 A;  2VFQ A;  3TH0 A;  3AK5 A;  1TYV A;  1CLW A;  1QA3 A;  2XC1 A;  1DAB A;  1TYW A;  3SYJ A;  1QRB A;  2V5I A;  1TSP A;  1QA1 A;  1QA2 A;  3SZE A;  4KH3 A;  2VFP A;  2VFO A;  2VFM A; 
#chains in the Genus database with same CATH topology
 4W8R A;  2NT6 A;  2VBK A;  4U4B A;  2INV A;  2W7Z A;  1L1I A;  1OFE A;  1XG2 A;  3ZSC A;  3WWG A;  3VSU A;  3B4N A;  2O04 A;  2NTQ A;  2NTP A;  1RMG A;  2X3H A;  3LJY A;  4XMY A;  1O8J A;  2VFN A;  4XN0 A;  2PEC A;  4XLC A;  4YEL A;  2IQ7 A;  2X6Y A;  2VJJ A;  2F3L A;  3LMW A;  4OJO A;  4XOR A;  2J8I A;  3EQO A;  3NB2 A;  1TYU A;  4XLE A;  4XKW A;  2VFQ A;  4URR A;  1JTA A;  2QY1 A;  4XL9 A;  2YUH A;  2XTW A;  4XOT A;  1DAB A;  3SYJ A;  2NST A;  1OGM X;  1IDK A;  1CZF A;  1TSP A;  4MR0 A;  1O8F A;  2NTB A;  1KCD A;  2X85 A;  4KH3 A;  4XLA A;  5C1C A;  1RWR A;  4XM3 A;  3SY2 A;  1HG8 A;  4XNF A;  1IA5 A;  2BM6 A;  3B8Y A;  4XQF A;  4MXN A;  3DU1 X;  4OJP A;  1KTW A;  3JUR A;  3JX8 A;  1X0C A;  4XR6 A;  2J8K A;  2O6W A;  1IDJ A;  2X6W A;  1OOC A;  1TYX A;  4NK6 A;  3GQ9 A;  4OZZ A;  2Z8G A;  3VMW A;  1OFD A;  5C1E A;  2QZA A;  2NSP A;  1OFL A;  1IB4 A;  1O8L A;  2IOU G;  4V02 C;  2BX6 A;  1EE6 A;  1O8H A;  1PLU A;  1JRG A;  4XON A;  1WXR A;  2BSP A;  3H09 A;  1O8G A;  1VBL A;  1DBG A;  4YCQ A;  2INU A;  3AK5 A;  4YZA A;  1K5C A;  4PMH A;  1PXZ A;  3PSS A;  2O0V A;  1PE9 A;  1K4Z A;  1QA2 A;  1TYW A;  4W8Q A;  1QRB A;  3GQ8 A;  5JLV C;  2EWE A;  4XN3 A;  3VST A;  4EW9 A;  4NK8 A;  4XLF A;  1LLZ A;  1O8K A;  1OGO X;  2VFO A;  3RIQ A;  4YFO A;  3VSV A;  4AVZ A;  1O8M A;  2PYH A;  2UVE A;  2VFM A;  3BH6 B;  1BN8 A;  1KCC A;  4OJ6 A;  1AIR A;  4Z06 A;  1BHE A;  2XT4 A;  1LLW A;  2VBE A;  4OM9 A;  4YEJ A;  3B90 A;  1HF2 A;  2BM4 A;  1QQ1 A;  3SUC A;  2ODL A;  3EQN A;  2PYG A;  3GQ7 A;  2UVF A;  3ML3 A;  3UW0 A;  4C2L A;  5DNS A;  1TYV A;  2O17 A;  1EZG A;  2QYU A;  4YZ0 A;  1QA3 A;  2XTX A;  1O8I A;  1RU4 A;  4XLH A;  2V5I A;  5JMC B;  1O88 A;  1GQ8 A;  3KRG A;  3P4G A;  1OFM A;  3PSZ A;  2VFP A;  2NT9 A;  4OZY A;  2G0Y A;  4XOP A;  4I84 A;  3N6Z A;  4OJL A;  1H80 A;  1KQ5 A;  4JRA C;  2QX3 A;  1QJV A;  3GQA A;  3ZPP A;  4YZQ A;  2VBM A;  5AMV A;  1QRC A;  2VJI A;  3FY3 A;  4YEI A;  2B0R A;  1O8D A;  1O8E A;  2O0W A;  4OPW A;  4U49 A;  4XKV A;  3TH0 A;  1WMR A;  3NAW A;  2XT2 A;  4Z05 A;  4W8S A;  1CLW A;  1DBO A;  4YC5 A;  2BM7 A;  2XC1 A;  3BH7 B;  1LM1 A;  4OJ5 A;  1QA1 A;  2X6X A;  3T9G A;  3SZE A;  1NHC A;  4HWV A;  4YDT A;  1K8F A;  2QXZ A;  3GRH A;  1QCX A;  2NZM A;  2O1D A;  3VMV A;  2BM5 A;  3LYC A;  3SQV A;  1EA0 A;  4W8T A;  2XTY A;  3PET A;  3N90 A;  4YZX A;  4Z03 A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  2W7Z A;  4JRA C;  1TYX A;  4OJ6 A;  3LJY A;  2VFN A;  1QA2 A;  1QRC A;  2IOU G;  4OM9 A;  4V02 C;  2BX6 A;  1HF2 A;  2BM4 A;  1QQ1 A;  2B0R A;  2F3L A;  4OJO A;  2J8I A;  4OPW A;  1WXR A;  1TYU A;  3RIQ A;  3ML3 A;  3H09 A;  2VFQ A;  3TH0 A;  3AK5 A;  1TYV A;  2YUH A;  1CLW A;  1QA3 A;  2BM7 A;  1K4Z A;  2XC1 A;  1DAB A;  1TYW A;  3SYJ A;  1QRB A;  2V5I A;  1TSP A;  3BH7 B;  4OJ5 A;  5JLV C;  5JMC B;  1QA1 A;  3SZE A;  3P4G A;  4KH3 A;  1K8F A;  4OJP A;  2BM5 A;  3LYC A;  2VFP A;  2BM6 A;  3PET A;  2VFM A;  3N90 A;  2G0Y A;  2VFO A;  3N6Z A;  4OJL A;  3JX8 A;  1KQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...