2X6WA

Tailspike protein mutant e372q of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 234
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6wA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6wA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6wA02
1JTAA 2PYHA 3GQ7A 2QXZA 2VBEA 3LMWA 3VMWA 4XLEA 1H80A 2Z8GA 4Z05A 1OFMA 3JURA 1EE6A 4XLAA 4OZYA 2NTPA 4Z03A 2X6YA 4OJ6A 2O1DA 2O17A 3B90A 2VJIA 1HG8A 4W8TA 4HWVA 4XQFA 4W8QA 4MR0A 1O8GA 3UW0A 4OZZA 1O8LA 2NT9A 4YZAA 1NHCA 1IDKA 4C2LA 2NZMA 1O8JA 2VBMA 4XOPA 3ZSCA 3EQNA 2PYGA 4EW9A 1O8EA 2NSPA 4XL9A 4YZQA 2NT6A 4XR6A 2X3HA 2O0VA 1K5CA 4U4BA 1PE9A 1QJVA 4NK6A 1QCXA 5C1EA 2NSTA 1O8FA 1PXZA 4XKVA 2PECA 2O04A 1RU4A 2INUA 4NK8A 1O8MA 1XG2A 3VSTA 4OJPA 2X6WA 2QX3A 4OJOA 3VSVA 1WMRA 3ZPPA 3VMVA 4YEJA 4XOTA 3T9GA 1CZFA 1KCDA 1BHEA 1O8HA 1DBOA 2NTQA 2ODLA 2QY1A 2UVEA 4PMHA 4XONA 4Z06A 1RWRA 2O0WA 1VBLA 5AMVA 3FY3A 1IDJA 2VJJA 1O88A 4XLHA 4W8RA 1IB4A 1O8KA 1O8DA 4OJLA 4MXNA 4XN3A 1JRGA 1AIRA 4AVZA 3GRHA 2IQ7A 1O8IA 1OOCA 2UVFA 1KCCA 2VBKA 3GQ8A 4XLFA 1X0CA 3B8YA 3GQAA 3B4NA 4XORA 1PLUA 1OGMX 1DBGA 4XLCA 4YZXA 4W8SA 2X6XA 2INVA 3VSUA 4XMYA 3EQOA 4I84A 5C1CA 4XM3A 4XN0A 4URRA 3SUCA 1OFLA 2EWEA 3GQ9A 1GQ8A 3KRGA 4XNFA 4YZ0A 4U49A 2BSPA 2X85A 1IA5A 1BN8A 3WWGA 2NTBA 1KTWA 1RMGA 4OJ5A 4XKWA 1OGOX 4YELA
chains in the Genus database with same CATH superfamily
1DARA 1QNTA 3O6BB 3G71I 1JTAA 3OOPA 3ES9A 4CZCA 1JUMA 4CGZA 3EPZA 4XRFA 1IRFA 1P4WA 3CMEB 2EIKH 1JGGA 3LFUA 4C9YA 4B8XA 2YWGA 4WK8F 3L1PA 3BNWA 5CDFA 1VQMB 3FJOA 3K6GA 1YOVB 4AIKA 2X6YA 2K4BA 1QBJA 3Q39A 4MEYF 5J8FA 4RD3A 1V5FA 4M3DA 1BQEA 2OZ6A 4EJUA 2EFQA 1YIJI 3L7WA 3JRAA 1HBXG 3FK6A 4JBAA 1ZM9A 3CJNA 2ZXHA 3K1NA 4BHBA 5A2QZ 2CH0A 1LJ9A 4WZTA 2DMUA 1VQ6I 4KKUA 3A0HC 1UCRA 2A05A 1BI3A 1ZKGA 3EDPA 4BE2A 5IP9J 4ZDLA 2IGMA 2KDOA 4FN5A 2LP0A 1FNMA 3EQNA 1RI7A 2L3DA 3R0AA 2X4HA 5IYCJ 2F5EA 2KVOA 3K7AJ 2DT6A 2FOWA 2VT2A 2K7LA 1I5ZA 4YIRX 3ECHA 5JFRA 4PSWA 4DQ2A 3ZP5A 3QPTA 2CW8A 2GLOA 3MD2A 3WTZA 1MRZA 3FBNB 2NXNB 2QQ9A 3CPWB 2BYVE 1JKOC 4YIFA 4X06A 3HOXJ 4ZYGA 4ENKA 3U1KA 1FJLA 4RPDA 3CCQI 2Y31A 2J8IA 2IP2A 4Q47A 2EINH 1HDPA 2IGNA 4ANJA 2CRVA 2F43A 4KKSA 4DQLA 4IEJA 1OMIA 1XC5A 2HZTA 4K2EA 4AU7A 3OYKA 3A3BA 4HF1A 3JX8A 3C18A 3KEYA 1X3ZB 4PK4A 1IHMA 1R5OA 4BJ5C 2IT0A 4HV6A 2XAHA 1RETA 3KIOA 5M5YJ 5AIQA 2XKPA 1HW2A 1DBOA 1QPIA 4M53A 1U8BA 2R7FA 2BW3B 1G3WA 4HV5A 4QPOA 1IUFA 2E7XA 2DDAA 1UMQA 2LSOA 4EVIA 1IB0A 4RM0A 2BY1A 1HF2A 4XK4A 4RAZA 2EZHA 2HOAA 4OAZA 1QG0A 3CC4B 1WOSA 2VFQA 4D7MA 3S1QJ 5F1JA 2B7BA 4OU0A 4OJLA 2I5UA 4JOMA 3ECOA 4RDJA 1AIRA 4A3EJ 5K7ZA 4L0ZB 1V0EA 2COMA 2DA3A 1BR2A 2IXSA 2LLKA 1WSUA 3HOVJ 5LGTA 1DDIA 4L9VA 3ZGKA 1AMOA 1UD4A 3LYCA 3GVAA 4ENMA 1YW9A 3NQOA 4NCNA 1IJEA 4UVAA 1HF0A 2DMTA 2HVRA 2QSFX 1JA0A 4YXWA 4M3BA 3GVJA 2VXZA 3R4KA 3ZQLA 3AVVA 3K10A 1V0FA 3E97A 4YZXA 2WV1A 3A8IA 1EA3A 2VOPA 4OOXA 3V7AA 2FU4A 1ONVA 5IYWA 2OAZA 4LC0A 2VONA 3SUCA 3BG6A 1N75A 3O8GA 2HDCA 4X6AJ 2RV8A 4RDLA 4PJLA 3WHBA 2EA2A 5FNZA 2X85A 1X2MA 3DTEA 1JE8A 4Y15A 2NTBA 2HFHA 3E1SA 2L7FP 3HAGA 3ASSA 4LD5A 1MNMC 2PYHA 4KH3A 3PSSA 5FROA 4Z4YA 1TWGJ 2VZLA 4BXXJ 1XDUA 1ZK8A 1ULYA 3SEJA 2GA2A 1U2WA 4OOIA 4ZYEA 3HEFA 5GAHJ 2QYOA 3GLXA 4ACAA 4B3AA 4UNOA 3LSRA 1TVCA 3CCRI 4G6IA 2UV1A 2Q6LA 1JGSA 1ZTRA 5H2FC 3JREA 5F4JA 2VBVA 3AVWA 2VB6A 2W4SA 2VUMJ 3BCFA 3F0CA 2YU9J 3PNYA 3CPXA 3LJYA 1ZQ3P 2CQQA 3K4MA 1DU0A 3SQVA 3KEQA 4B3XA 5GTIC 5EF6A 2R92J 3ESWB 4MR0A 1KQ0A 5IT3A 1VLOA 3Q9SA 4O6JA 1KQ9A 2QA4B 4TN1A 2ID6A 1G3TA 1ZYRF 2TRTA 2W24A 4CQJA 1MJBA 2NS8A 3U1DA 4HRIA 3J80Z 2J5PA 4BE0A 1IXCA 2CO5A 2Q8KA 3CCVI 1NK3P 1N07A 1K9MD 1M90D 3NAUA 5IT9K 1WJCA 4FASD 4XR6A 2O03A 1D8JA 2MYSA 4RPBA 4TMXA 2R9VA 4Y52J 4CCKA 1KZHA 2L01A 2V31A 5DM6F 1MSEC 5TGTA 3CCUB 3NB2A 4X0GA 1IDZA 2HNHA 1NTCA 5K1YA 4DQKA 4YAWA 1WCMJ 2KT0A 1W35A 2V1XA 3PQKA 2Y0MA 2F48A 3AFHA 1XSXA 3V7RA 2BY0A 4BE1A 3I59A 2DXIA 2H09A 5CKTA 1X19A 1DDNA 2QE7A 3CW2A 4OPOA 2GK6A 4I0AA 3VMVA 3PM1A 4BPRA 4Z1MA 1QQ1A 3ISXA 4DGWB 1CZFA 3CCEI 4C43A 3WGIA 3IUOA 2JJ1A 5EGOB 4Z4UA 1JUPA 2JA2A 1IRXA 2XNJA 4M6XA 3T0YA 4NC7A 4ZV4A 2RAEA 1YLFA 2XASA 2XUBA 4Z4RA 4U0VA 3KLOA 3BY6A 3OW2B 1IDJA 1O88A 3NARA 1FOXA 3I4NJ 2JWTA 1RKWA 3LL7A 4A3JJ 1ERDA 1ZM4A 5DN6A 2MW8A 2R5YA 1K4SA 2UVFA 1APLC 3P5JA 2VOOA 3QYBA 2CUFA 1W7PB 2RQPA 3A0BC 4HEA2 3ZUGA 1U9OA 3S8PA 4BQOA 3B4NA 1G7TA 1BC8C 2DK8A 3CMAB 4BGDA 1V4RA 3W2WA 1OCZH 4ZZLA 1WOOA 1OGMX 4ON0A 3A03A 3G73A 4B09A 4FX0A 2X6XA 1CF7A 1FTZA 3MKYB 1QFJA 3VYRB 2DIEA 1FRQA 2VI6A 2JPBA 3AL0C 2DFHA 1J75A 3DEUA 3N05A 1IZ1A 4HSRA 4KIFA 2XZPA 5IK2A 4K1XA 1LUJB 3RQ4A 4M9XA 1WGXA 3R6KA 1EP3B 3OL3A 2E19A 3G4SB 3TP0A 1WH5A 3GZ5A 2DA5A 1BR4A 2WC2A 3K4CA 3PENA 2OQRA 1IV8A 1T33A 2HZDA 4MFEA 1VQ7I 1W5TA 2QXZA 2Q6OA 1FYLA 4HDVA 3GFIA 2HDWA 2ZTNA 4Z05A 2WJYA 2KIFA 3WE2A 1IGNA 3GZNB 1WSVA 1I7PA 3QODA 1MBFA 1FLIA 3LQEA 1EKEA 2BXYA 3IWFA 3LVBA 1HC8A 2HTJA 2HQNA 4XRSA 4PJMA 1XMKA 2C6YA 3GTLJ 2G7UA 4LG0B 1CQXA 2ZZEA 4KKTA 3H0GJ 4LBYA 2HYFA 2LVSA 1O7LA 3F8NA 1X2NA 2DYRH 1E2XA 1MNEA 2O8KA 2R4GA 4HNVA 1OB2A 4R8HA 3BJAA 4Z4TA 1E63A 1D0YA 1X3WB 2NAZA 1I1SA 2R7OA 4EH1A 3L2RA 1IDKA 4CCMA 4C2LA 3U9GA 2GQFA 1BIAA 1OISA 1T56A 1FEXA 1KQ5A 3GTGJ 2FUG2 1K4ZA 1XGOA 2G9WA 2WTEA 2P5KA 3CF2A 3HPHA 1R9TJ 1SFXA 2CUEA 2PYGA 5H6QA 4A3CJ 4IHXA 4A3BJ 2WJVA 2ZJRF 4FE4A 4BS9A 4IO9F 1Y1VJ 3IKVA 1MIJA 3VSLA 4M72A 5C4XJ 1V5GA 2EK5A 4YFXF 1W34A 4YAOA 4KJZA 1QJVA 2CF4A 3CC7B 5LGNA 1CGPA 1D1BA 1EH6A 2LY1A 3HSEA 3GFMA 4HX7A 3CUQA 2INUA 2HGCA 2NYXA 3V4GA 3OAAA 1QA3A 1R7JA 2DA2A 3HOWJ 3D26A 1R1UA 2X6WA 2HQ5A 4RB1A 2PMZA 1MABA 1N0VC 1PP7U 2R93J 2WSSA 1L1IA 3BT9A 2GREA 1BI1A 2FQ3A 2C77A 2VBSA 1XMAA 2D5VA 4ZTJA 1KCDA 3KCCA 3ASRA 3ZQQA 2IVMA 1OYIA 2EJRA 3BZCA 4RB0A 1AKHB 5B5EC 4C2TA 4N0BA 2MBFA 4M9ZA 1K8AD 2XZLA 2XHKA 1UD3A 3IWZA 4DZPA 5HODA 3JRGA 3ABTA 3CF5F 3A3GA 2X8KA 3LSTA 1IB4A 4U87A 3JW4A 1VQ9I 4UY8I 1YJNI 1BI2A 3FX3A 1EP2B 4ZCMA 1YHQI 1OFDA 4X7FA 2MABA 5FLVA 4V2GA 5FJ8J 3DKYA 4MEXF 4CHUA 1X1PA 1OLTA 5F27A 1JB9A 1QRCA 1R5ID 2F6CA 3CD6I 3REOA 2H94A 1KTVA 1X3UA 3S14J 2XB5A 1DQUA 2TDXA 4XORA 3VOEA 1SVOA 1Y1WJ 3GXOA 3FHZA 4UVBA 4G7HF 1HQCA 2HDNB 1ZG5A 3OYDA 3S2WA 3GWZA 2E1OA 2OQGA 2FNAA 3DTKA 2OZUA 4AF6A 4ZCLA 4MFDA 1W1WE 1MW7A 2CW0F 3T8TA 3AGPA 3M4OJ 2ZZQA 4XNFA 5JVTA 3H0DA 1OR7C 5GADJ 3KEWA 3OP1A 2MD0A 4PAAA 3G71B 2DQLA 2O3FA 3HTUA 2WADA 4OPWA 4ESBA 3Q38A 1AU7A 3UKGA 2HLDA 4BXUA 4P26A 2A69F 2IA0A 4G8XA 5JR3A 3GQ7A 3OYMA 4NBSA 4KIBA 5D8LB 1OKRA 2CGPA 2FX3A 4OPVA 4IHWA 3OZVA 5BSXA 2HU9A 2YX7A 5DDGA 3CMMA 5GPCA 1Z9CA 4I6ZA 1KU7A 1G6NA 1U9NA 1ZM3A 2ZITA 1OFMA 4Y13A 1EV7A 4A3DJ 4UAJA 1ETVA 1IXSB 2CW5A 4OPSA 5IPAA 4G5GA 1ZHFA 1WJBA 1IW7F 1X4OA 2DMNA 2F5VA 3CZ6A 1U5TA 3M9AA 3Q6QA 1VQ6B 2ADUA 3QOEA 3KP2A 2M45A 2Y9ZA 3GW2A 2CQ7A 3I3LA 4XQFA 5F0FA 4D5CA 1ZG3A 4M9SA 1QZEA 3S16J 1OHHA 1DDGA 2CW7A 2X9DA 3ABKH 2HI3A 4Y17A 3V8KA 4Q5SF 3HIFA 4KITB 4L9NA 1WJEA 4WF2A 5AONA 3DBLB 2Q2EB 5LBQA 3K70C 3DKXA 2LK2A 3F8MA 1V54H 3DDYA 1F5TA 2R7ZJ 4QSHA 5J3OA 3FXOA 1TT0A 3FXJA 3GZ6A 4UZEA 2O61A 4LJZF 2NT6A 1POGA 1XD7A 1SAXA 1B23P 3N6ZA 3BCDA 3J7ZI 3AG1H 4NQWA 4PJJA 4J01A 2X3HA 2F1LA 2QDXA 5HZAA 2WB1A 4P55A 3CCQB 1QPMA 2J8KA 3CCMI 5F0HA 4LFUA 3MAJA 1N06A 4QV2A 4OM9A 2PECA 4Z2YA 1E1RA 3RYRA 2B7CA 5F4MA 5FL7A 3LQQA 3ASNH 4PC2A 2CQNA 2HTSA 5M5WJ 1K4TA 5E17F 1EF4A 3IH3A 5HVQC 1E64A 3ZMUA 3VODA 4LBVA 1X1CA 1Z6TA 4KA4A 3ULQB 2VQGA 3QYFA 3F22A 2X6OA 5TY0A 2XC1A 3T1BA 5KW9A 2HKXA 1SMYF 2DMQA 1U78A 1VQ4I 3CC2I 1WSRA 1KYWA 1WVRA 1LKXA 3K69A 3ZQGA 4CZZA 1LVAA 2VFOA 4GCVA 3OZUA 1FPQA 3K2AA 1IC8A 3QAHA 1H9GA 3PJRA 3GRHA 3BPVA 1VZ0A 4I98B 1GAQA 2IS6A 2RGVA 1BA5A 2PX9A 4PFOA 1PJ5A 1Q82D 1B72B 2K3PA 3HJEA 4PDKA 4Y3OA 1Z05A 4X8IA 5B1BH 2XAJA 2F5FA 3GTOJ 1TQPA 3NWTA 3Q0WA 1W0UA 3Q9VA 2CK3A 4F3QA 4C2UA 3EUAA 4G7WA 4DK0A 1G7SA 2M4KA 3KLNA 3H3VK 2QMUA 1DABA 5IY5H 2ELKA 3K0LA 2P6TA 2JK3A 4EJVA 2OBTA 2F2EA 4U7BA 1GVHA 1FSHA 1EFRA 2BM1A 2BM7A 2V9KA 3CCJI 2UUZA 4YZ0A 3SZTA 4E6KG 3HKZA 2ZL7A 4QWQA 1KC8D 1R1VA 4L9JA 3A01B 3LNNA 5LRRA 4CDGA 2P7CB 1H8HA 3S32A 1XB4A 3EUHA 4IRHA 3CCRB 1FIAA 2P0WA 3OY9A 2VPRA 2RNJA 3HRUA 3V76A 1NDHA 2CSOA 3OZWA 3H3UA 4U9UA 5LRSA 1OCPA 2P5LC 5FD6A 3GFLA 4U88A 5HS8A 2J5OA 2VL8A 2O1DA 4KN4X 3QWLA 3NEUA 4E7JA 3ZC3A 3MZ8A 2DETA 5EMNA 1MGTA 3CJRB 1GR1A 1GXQA 3LSMA 2F4MB 3SJPA 2L9NA 3I59B 1TNSA 3D5RC 3SJMA 2H1LA 2KRFA 3UW0A 4OZZA 2CU7A 1FOYA 4C3IJ 3SHFA 3AKZA 3LNQA 3MHPA 4A0YA 2IPQX 1STZA 3VWBA 1MMDA 2E1MB 3Q3SA 4CYDA 5DM7F 5KSWB 3MMPA 1JHFA 2O6GE 2YSRA 4ZGNB 2VN2A 3E5XA 4P1VA 1ZUNB 1T98A 1QGAA 1USTA 4MLOA 2NOGA 1VQKB 2KJCA 1COWA 2ZKZA 1K8FA 4UUSA 2XKOA 4W97A 3KP3A 1XN7A 3BP8A 5HDGA 5ILSA 4MHGA 5GAEJ 2EZIA 3QSYA 2QUFA 4IRGA 4RD4A 5E6TA 5AIPA 4BQNA 1AOYA 1QCXA 1LEAA 1O8FA 5FRNA 1XG1A 3DCFA 2MA3A 3OIOA 3ZMZA 3E6DA 5IYRA 5DCMA 2DA4A 1SC7A 1O8MA 2HXOA 2P81A 3HOZJ 1YRNA 3WGHA 3RYPA 2UZKA 4A6EA 2OTJI 1IDYA 1WZ2A 1WMRA 3CCEB 2QX3A 4E7IA 3D5SC 3OYIA 4CICA 3FHNA 1JNYA 3OEHA 2PQ8A 1XTAA 4RLFA 5ICEA 3FPPA 4X05A 4RB3C 1ZN2A 4PMHA 1QH0A 4JP0A 1TQMA 4AYBA 1J5YA 2DT5A 3RIQA 5HNFA 4PUSA 1RC9A 1X1BA 2VE8A 3MKLA 4DNCA 1TTTA 4ZYDA 2X1DA 1FP1D 4JX6A 1JTXA 2HYGD 2WAFA 2KP6A 2VT3A 3FF5A 4XICA 2A5WA 3GMEA 4P3YA 1TWHJ 4AVZA 2QZ8A 2X0KA 3W2VA 3TP3A 3I4MJ 2E1NA 1ELOA 1PJ6A 2H1KA 4UHTA 4ESFA 2EQRA 3GTKJ 3DP7A 4GXOA 1ZG1A 3EYIA 1ODDA 3I56I 1SKQA 2VYQA 2FF4A 1FMWA 3HYIA 2ZSIB 4P1WA 3CCLI 4LB5A 1JA1A 4F93B 3IHUA 5TJJA 2INVA 1R4MB 3I53A 1WI9A 4MQVA 2WPDA 5FLXK 2Y0SN 2PEXA 4UV8A 2UWMA 1KMHA 3G6EI 1I6HJ 4M1KA 1YE9A 3BH6B 1BJZA 4TSFA 2XB0X 1HOMA 4LLNA 1MZBA 2EH3A 3FK7A 4I2OA 2AXTC 3EETA 4G6TB 1RZ4A 4EJTA 2HVSA 3BDDA 1JXSA 2ACJA 4QUZA 5ILVA 2VQLA 3HHHA 3TDUC 2E5NA 4BQQA 2VBEA 4YEIA 2VJ4A 3AVTA 3VMWA 1YW8A 4P12A 2VBYA 1GO2A 2COBA 2PLYA 1B8IA 2JTVA 1N25A 5CVJA 3HM5A 1W9XA 1NJID 2WZPP 3OSGA 2AQFA 4BBRJ 1XE1A 5E3OA 1K83J 3HHGA 4QVJA 2EIMH 2XIGA 5EG0A 2HCJB 1Q86D 1VQ5I 5E8GA 1FBSA 2CQKA 1JHHA 3BROA 2M5WA 4M0LA 1BW5A 4RD0A 3FZVA 3C1DA 2BEOA 3B82A 2P4WA 4RAFA 4M4SA 4HZFA 3FXMA 3PNVA 2B0RA 4D1QA 5JI6A 3L09A 1VTNC 1IG7A 2DDBA 1T2KA 1B9MA 2BSAA 2RDPA 3QFSA 4GO1A 3ZQ7A 4KUMA 5GV8A 3MEXA 5DV5A 4KN7X 4CYCB 3OYNA 1H8EA 1JKQC 5KCMA 2BPOA 2EZLA 3UNGC 2E36A 2E2JJ 2O0YA 1XGNA 1VNDA 2ZJ2A 2MGQA 3BTIA 2KZGA 5J4YA 2IRFG 2V7QA 3ZOBA 1WJFA 3SDBA 1HDDC 1BM9A 1KONA 4R79A 2WAEA 3LA2A 3OYLA 4NK6A 2ZFWA 4XRMA 4KMFA 1NRKA 2ZMEA 2NOJB 3A35A 1UD8A 2O6WA 1FOWA 2ZZGA 4M74A 2DCUA 3F72A 3PFIA 4NK8A 3DTIA 4M73A 1TLLA 1TUIA 4QIWN 1SEUA 3GO5A 2V1DA 3CB4A 2HOTA 3Q3AA 1Q1HA 3OV8A 3BR6A 2X51A 5FKKA 5FO5A 1UD2A 1MKMA 4XOTA 2DN0A 2LG4A 3BZ6A 5DD8A 2H27A 1FRNA 1FY7A 3L2QA 1HVXA 2WAQA 3KP7A 3A8JA 4OMZA 3P26A 1CNEA 3FMSA 3BWGA 1VQ9B 4B1RA 4M6YA 1YJNB 2Y2ZA 4LG3A 1D0ZA 4EMSA 5LEKA 1YHQB 3QFRA 4B43A 1YTYA 4DIQA 1X1DA 4XLHA 1PKVA 2BM4A 2UXNA 1O8DA 3LSKA 2GXAA 3B8HA 3CD6B 1SANA 3HUGA 4GYGA 1JRGA 3V42A 1S3JA 1I39A 3O2PE 2MLGA 4BUPA 5K5QA 3HOTA 1YITI 2ZC2A 1H89C 2PG4A 3B8YA 3R0JA 2XGCA 1DU6A 4A69C 4FCYA 4LGWA 4CSWA 1Q1VA 4S04A 1VF7A 2PJPA 2F4OB 2NPFA 2PMHA 1EH8A 3DPLC 1NG6A 1Z7UA 1D1CA 3PSFA 1U5TB 3D0SA 4RGUA 3JSPA 3R6JA 1DBGA 3DLLF 4ETSA 3EQOA 4RM3A 1AA7A 3FM5A 1QHHD 3H9QA 3MVPA 4XN0A 1VQPI 2VBXA 3OJXA 1OQYA 1BMFA 5E8IA 1KK3A 4X07A 1H9TA 4P25A 1TWFJ 4D7NA 3PUFA 2DFEA 4RGRA 3QPLA 4XKWA 2YUSA 1W36D 3MFKA 1H0MA 4CCNA 4HLXA 1OR7A 3JSOA 2DEUA 1F36A 4QTRA 2JA5J 3E5UA 3KFWX 1WOPA 5TR9A 2NVQJ 2JN6A 1KA8A 1ON2A 2ISYA 3GCMA 3VFZA 1FX0A 3NAWA 1UJ8A 2DQRA 1UMKA 2L4MA 5F0CA 4F91B 1ZLKA 1U8RA 1IJWC 4XLPF 1KK0A 4BEHB 3A1YA 3OOUA 2DFFA 4RA2A 3FISA 4A0ZA 1KU9A 2FMYA 3DF8A 1JI8A 2VJIA 2CJJA 1I27A 4RCYA 4BY1J 1TNTA 1K78A 1ETXA 4KT6A 5B3SH 1R5BA 5CPRB 4W8TA 1Z67A 1NK2P 3LQ6A 1MJ9A 1N05A 1D0XA 3RTRA 3KYLA 1PUFA 3PO2J 1YG2A 1IN8A 3V7SA 2OK7A 2C4TA 1ZRFA 2DOEA 1SD6A 4HQMA 2V5IA 4RAGA 4TKOB 2RN7A 3GYHX 3CRZA 1SVMA 2DO7A 3TL4X 2XRNA 2QGGA 1OCOH 4L9TA 2G0EA 3H5AA 2MFZA 4A0XA 1E43A 2LNBA 3TDZC 1O8EA 3F8FA 3B6AA 3DU5A 4WXHA 3FBIB 2N8GA 4Z6YA 4IRIA 2AO9A 2EIJH 3CCMB 2A07F 1K5CA 4ABZA 2XNCA 2OC6A 1ZR4A 1F20A 4UVCA 5JVGF 4ASNA 4BYYA 3GBGA 3PA1A 2DODA 2ECBA 3SEQA 2NSTA 2XZOA 4P2NA 3VR6A 5DNSA 2FBIA 4FX4A 1OB5A 4IXAA 4OOSA 1QGZA 3MN2A 4GQNA 2BBYA 5F64A 4LITA 2CQXA 3EUKL 1IN4A 1HSTA 5J3LA 1IN7A 2R7SA 5H59A 4PGHA 1HKQA 2KKOA 2FBHA 1VQ4B 3F3XA 1SD4A 5GPAA 2KFDA 4C3JJ 1PVEA 3TKYA 2QY1A 2M87A 2XPVA 3SY2A 4C0SA 1RKTA 5JHUA 2FNPA 4M3GA 2R5ZB 1RQRA 1Q7YD 2D1HA 5F04A 3LFKA 4LB6B 1A5JA 1MBKA 2BV3A 4Z06A 3IRRA 1XGMA 3H9JA 4UUTA 4IKFA 3VO2A 4CA0A 2OA4A 2W25A 3PSZA 5IOYA 2PI0A 2FBKA 1OFEA 2BM5A 1QGYA 4J0QA 4WZKA 2RREA 1ETOA 3GVKA 3AG2H 1O3QA 3R60A 4ZJZA 1EWYA 5F1RA 4DOZA 2VBUA 3E20A 3IAS2 1ETWA 3KEOA 4EJOA 3QE2A 2PJRB 2DTZA 4KIGA 3WBKA 5CYVA 4XLCA 3M7GA 1ORKA 3DU6A 1J9IA 1MDMB 1KK1A 3CCJB 2KJBA 4PC1A 1LEBA 2Z6BD 1IV6A 3IC7A 2EWEA 2CNDA 1GQ8A 3JRFA 4DJAA 1MBHA 2RQQA 3G3ZA 1QO0D 1GDTA 3QP5A 1ITYA 2AHQA 4D9JA 4KYWA 2IBDA 1F1ZA 2UXXA 2RC5A 2F5CA 2A6HF 2NVXJ 1FC3A 3KZYA 3QFTA 1QQIA 1Z91A 1WTHD 3X2QH 3PETA 3P9KA 1VQOI 2EV5A 3WGGA 2V79A 1EH7A 2ZZFA 5DCFA 3FXRA 3K4LA 1XB2A 3OWTA 3JCUC 4ZH4F 2ZCWA 1YJ9I 3C7JA 4UUVA 1JKPC 2QLZA 1YX2A 4JRAC 5EZGA 4HE6A 3DPUA 4OWRB 3QFCA 5ICGA 4WWVA 3K4NA 2O9LA 4F55A 4HWVA 2YPRA 1FNCA 2OF7A 1K7AA 2EB7A 3AG3H 4UXNA 3V7CA 5H20A 3W6JB 1Z6RA 1HA3A 2K9MA 2ZXWH 3RPQA 5BPDA 5CQEA 1P4AA 1Z3XA 2W6IA 3H5NA 2CWEA 3U21A 3BG5A 4A3KJ 3RZDJ 4HIZA 2PE3A 1HW1A 2L7MP 2M4GA 2HOSA 3CCYA 4L0YB 1S0UA 4PGOA 2V7WA 1YJWB 1BI0A 1N08A 3VO1A 2ZL5A 1J2XA 3A02A 3HSFA 4DYCA 4E7KA 1HZEA 3MZHA 3HB9A 3SFZA 3VB2A 4G7ZF 2OTJB 3W5UA 2LBFA 3QU6A 3IKTA 1BL0A 3QU3A 4LK0F 3PQJA 3PIOF 2P3MA 2M2EA 1TW3A 2DA6A 1QA2A 5JHFA 4GYIA 3OYBA 1Y0UA 2KPMA 4DW6A 2K4JA 2M8EA 2C5HA 4ZYHA 1KGSA 1SM4A 4FK8A 1UHSA 2LY9A 1EFCA 1OPCA 5FA6A 1QFYA 4TMTA 3HPGA 2GJKA 2PMZN 5M3FJ 2LF8A 1R36A 1UG0A 3IL2A 1R4NB 3CLOA 5DUIA 3MKZA 4ZYAA 1J59A 2VJJA 3TO9A 5B66C 5HLIA 4G9YA 2XC7A 1RUOA 2VBZA 3IV5A 1EXMA 5GTHC 3RPUD 3N4MA 1XCBA 4XN3A 3W5HA 5CVRA 5HLHA 2XAFA 1S72I 2G7HA 4M6VA 3DFGA 3MZYA 1B8IB 3I56B 2I8DA 2NVTJ 1P4MA 4H9GA 4XD7A 3CCLB 2DA7A 2D2WA 3OIPA 1LPQA 2P7VB 1XQBA 3SZGA 3SKBA 3HGGA 5BPIA 3G6EB 3HTSB 3M1CA 4O5VA 2VIXA 1XGSA 1JT6A 2JVGA 3RDIA 1P7IA 4I84A 4XM3A 2B7EA 4EM0B 4GGGA 5C3EJ 3CCSI 2V6EA 1TC3C 5KAIC 1ACIA 4FT8A 2OU2A 2F1MA 5LMZA 2JT1A 3IH2A 2IS2A 4OP7A 4A3GJ 4R71A 1D8TA 3FXQA 5LGUA 5DS9A 3RIRA 1T39A 3OFNA 3C3WA 5JLVC 2EFPA 4ZGQB 2M9HA 2BY2A 5E1WA 1LE8A 1WJ5A 2FE3A 4NBQA 4BDYA 2A61A 1KJZA 1OGJA 3LMWA 4YCQA 3KP6A 3W2FA 2Z8GA 4BQAA 2I10A 5JLXA 1VQNI 5J1RA 4X0CA 1EE6A 2JJ2A 3WG9A 1VQ5B 1N0UA 1UG2A 2ZMEB 2F3LA 3WG7H 4DYRA 2NTPA 1TWAJ 3ZPLA 2XAGA 1QVUA 3OPOA 1MMSA 5K7FA 4MYTA 2VNHA 5BQTA 4A3LJ 5DSZA 3O3KA 4NNJA 5HLTA 3HRSA 5DD4A 2C5BA 1PJRA 4PJ0C 1MJAA 3WE3A 4V19K 2JIZA 2OUMA 1S5LC 3E6BA 4LBZA 4WQMA 3WNCA 4N4OB 1EJ9A 2DA1A 4PGGA 1T6ZA 4NB5A 3D1NI 4NHJA 3H3ZA 1P92A 1OGIA 2HR3A 2QYUA 2NSPA 1W5SA 4AUXA 5CVVA 2FOKA 4OMYA 1YIJB 3DEEA 5KAFC 1UHWA 2JUCA 2ESHA 3CLQA 1OCCH 4IZZA 1WKMA 3TEDA 3NWSA 2W00A 3BG9A 1ZGAA 4MTDA 3I58A 3WBJA 1T6YA 2C4UA 1XDSA 2LD5A 2OBRA 2KL4A 5FRMA 1V5VA 4BU2A 1S6LA 5K5OA 2KIUA 5EJCA 3PA2A 5KVRA 1J09A 4QFMA 1KZLA 3CC4I 2AS5F 4F7DA 4BY7J 3MCAA 1P6RA 4OJOA 2E5ZA 2WB1N 3KP5A 5KK1A 2VQHA 3VEPA 2GXGA 3OYHA 2X53S 2QBYA 1ZM2A 1SVLA 1IJFA 2VQCA 3RKQA 3CXCB 2W85A 1FMVA 1VHOA 3GVLA 3JQPA 2IA2A 3BCBA 5IYBJ 4Z4WA 1BX1A 1F9NA 5IYDJ 2LF7A 4JMQA 1TYXA 1W4MA 3WTUC 1REPC 3ASOH 4I0BA 1ZAOA 2BY3A 2KQRA 2Z3YA 5EEHA 1MD0A 5E3NA 3ERED 3BY1A 3WNDA 3B02A 2BW3A 1ZH5A 3H1CA 3SLNA 2EPFA 1YITB 1W0TA 4BKXA 1BX0A 4MXNA 3F6OA 1E3XA 4KDPA 5D4SA 2DMPA 2Q1ZB 5LEJA 4NUBA 4XLFA 1A31A 4OIQF 2FJ1A 4E7SA 2QQ8A 2IS1A 4W1UA 3HRMA 3CMYA 1FBQA 2R7VA 1VQPB 2W7ZA 2DERA 2XF7A 3H9GA 3ZQHA 1Y8RB 3BC8A 3ZZ0A 3I55I 2A5YB 2BVMA 3MQ0A 3BR5A 1XPXA 2R6HA 3U2QA 3ZMSA 3V8JA 1VI0A 2QTZA 3ASTA 2CYYA 1A04A 5CQGA 1Y0YA 4BNCA 4RGSA 2JN9A 4ZDPA 4U49A 2BHZA 5BNGA 3OJWA 2W1OA 3M8JA 1A6QA 1QFZA 2V4DA 4OJ5A 1QX4A 4YELA 1YYVA 3HL2A 4DNTB 5K7HA 1V5EA 5AN9A 2OTLI 2YR2A 2WR8A 3WODF 1D5YA 5L3BA 4P3IA 2ELJA 3ZR8X 2CRGA 2GIVA 3TGNA 1G8XA 3CO7C 1VLYA 2ZNYA 3S2HJ 1YW7A 1XSDA 4OIPF 1OB0A 1N77A 2A6TA 5FO0A 4OJ6A 1XSVA 3FMRA 2QM3A 1GXPA 5J6XA 4Y7NJ 1KQSB 1G3YA 1QGPA 2V7VA 3DBRB 3SLDA 1E17A 2IJLA 2K3FA 4EGZA 5L3EA 4M3FA 3HDDA 3ONQA 1K6YA 1HXDA 2ZXIA 3Q0UA 2HPIA 2W82A 5J40A 1ETQA 5D8KB 5L3FA 3QP6A 5D6FA 1ZR2A 2E1MC 1NHCA 1P9QC 1DP3A 1LFUP 2NZMA 2VKDA 2VBTA 1QRBA 5CJ9A 3FDYA 4N9HA 3GTPJ 1FYMA 5LHIA 2E2HJ 2VNKA 3AGQA 3RPUA 3Q0VA 3U6KA 1PYVA 4EW9A 3VNVA 2JZYA 2OCEA 5IT9Z 1G7RA 2K5CA 2VJ5A 2QGUA 4HX8A 2GM4A 4WXCA 5GV7A 5M5XJ 2D3LA 1M1EB 2QTLA 4G12A 3JQQA 1L3LA 5LLQA 1F43A 1WXRA 3S1RJ 1IUYA 4GDFA 5KNLA 1WORA 2IGOA 1D1NA 4ZCIA 5HS7A 3CO6C 4RDUA 4ZTFA 1XG2A 2ZNZA 3PFYA 3H36A 1V3FA 2DPUA 1GUUA 1R23A 4ZC3A 4HNTA 1BN5A 4U0YA 1AIPA 3P4GA 2WZNA 2AXLA 1SD7A 1KU3A 1BW6A 3CP2A 3IP4B 4I02A 5ERIA 2JSPA 3OSFA 4ZZDA 1FNBA 3ZIAA 3CCVB 4UB8C 1TYWA 4A3FJ 4A3MJ 1RNLA 5TV2A 4AIJA 2ETHA 3ML3A 1OJLA 5E1ZB 4YG2F 3HRTA 1BHEA 1HSJA 1BBYA 2IA1A 3SFIA 1T8IA 1GLNA 3OYGA 2CV1A 5IP7J 4F7ZA 3WHCA 2XT2A 1U3EM 2O0WA 1EP1B 1QZYA 1VBLA 3M3YJ 5EGOA 3D5LA 1NH3A 2K27A 3WU1B 2F4IA 2R5YB 5E18F 4W8RA 3WU0A 1O8KA 5E1XA 2FEZA 4AYBN 2BF4A 2HMAA 3F6VA 2BGIA 2BOLA 5IP6A 2KISA 1G59A 4N3GA 4I99C 5J8CA 1IO2A 3VMFA 4HW0A 1YX3A 1UZCA 2J7KA 2LC2A 3FM3A 3T8RA 2XOKA 3IRQA 1CF7B 1SD5A 3S17J 2ZXJA 2QCOA 2JVHA 4PSXA 4IHVA 3OE7A 5J1UA 2XTYA 4W8SA 2BGCA 2BV6A 3HOSA 4MNUA 3T53B 4RD2A 4E7LA 1UD6A 2RC4A 4EM1A 3KRGA 1GV2A 1LFBA 3LSJA 4PZJA 1B4AA 2XF6A 1SFOJ 3P7NA 2D74A 3K70D 4C3HJ 1E79A 4E0FA 2QN6A 2BE5F 4WZLA 2LDUA 1VQOB 4Y9UA 2VC1A 3W6VA 2MD5A 3CUOA 2JA7J 2WA0A 1YJ9B 2PMDA 1YS7A 1SFEA 4LMYA 2V7UA 5M3MJ 4CXFA 2MH9A 3DEWA 3FKSA 3E7LA 4DBQA 2DOGA 3JURA 3IH4A 4OZYA 1WU8A 4Z03A 2WBMA 1IN6A 3M8FA 5FFXA 2KIMA 1BJAA 2L5QA 5D5WB 4RAYA 4OIOF 2ELHA 3S15J 2V9VA 1H42A 4IW3B 2MG4A 4LG0A 4A93J 1A36A 2V4JC 1T6SA 1VQ7B 4G7OF 2WY8Q 4IVNA 3F21A 3QQAA 4F52A 2EILH 1HA8A 3HGYA 2Z1DA 1K28D 2W57A 5FGMA 5FIUA 4HNUA 3GTJJ 2QVOA 3C2BA 2QSGX 3NRVA 2DY1A 4PC7A 1Z21A 2DW4A 1FT9A 1I6XA 1D3YA 4HX4A 3J81K 4HSTA 2K85A 1TZLA 3ABUA 5EEGA 3SZPA 2O0VA 2CFOA 4ITVA 3CUQB 5FKLA 3BQYA 4IQ4A 4Q4ZF 1KRHA 3GQBA 1A8PA 2K02A 2V1UA 3KP4A 2ME0A 3B6CA 2L4AA 5FB2A 3S1MJ 2RC6A 1QVFB 2B9SA 1G3SA 5DYMA 4HA8A 1B2RA 4X7CA 1RU4A 5K5RA 3VDXA 1LDKB 4UZFA 3ZPNA 4FETA 3W6KB 4P5OA 4B44A 2XSDC 3LMMA 3H92A 1ZRDA 2HS5A 3KYCB 2OCCH 4OIRF 4IQJA 3FXKA 3I5UA 2ZJPF 5J1YA 2PIAA 2YWHA 4PC6A 3CTAA 1K79A 2YWEA 3GLLA 3BTCA 3S3NA 4HG2A 2R7TA 1S7OA 2DCEA 2E1CA 4RD6A 1IAWA 2F4NA 4I76A 1TQIA 3P9CA 2KRHA 4JK1X 3W2GA 3J81k 1ZELA 3M07A 6PAXA 3BTLA 4G6QA 4OINF 3PIPF 4ENJA 2KDZA 2XT4A 3I1FA 1PUEE 1JKRC 2L9SA 1LM1A 2KRCA 2WAQN 1Z0XA 1NBMA 3OYAA 4YAFA 2L02A 2NVUB 3GUDA 4EM2A 5CVIA 1ZREA 2HVQA 4IOAF 1VJSA 3I4PA 3I71A 3KPHA 3FXUA 2WV0A 3ML6A 5D4RA 4TT3A 4ENNA 3GQAA 2M34A 4EEFG 5EDNA 1GHCA 3G1OA 2H8RA 3FWEA 4DZJA 3WTXC 4IOCF 3LO8A 3L2UA 1U5TC 2P8TA 3WY9A 2OV7A 3CCSB 4M71A 3G1LA 4HOBA 2V9PA 4I09A 3PUBA 4XKCA 2WY7Q 3MCZA 2L2OA 3VNUA 2O7OA 3CESA 3LOCA 2L0KA 1N8RD 3GFJA 1WFXA 1FZPB 3A4CA 4QPQA 3TO7A 3WWGA 2KLOA 4MO7A 5ICCA 3LSGA 3F8CA 1K61A 3BQZA 5HLGA 1L0OC 2BGJA 1VQNB 1S7EA 2IS4A 3L2VA 1ON1A 5D5UB 2PMUA 1HW5A 2DYSH 5EEAA 4Q48A 1E62A 1VQ8I 3E3VA 2XF5A 5C4JJ 2VFPA 3G1MA 5DUKA 4XLAA 1OFCX 1PJ7A 3ZXSA 5DEQA 2IEKA 3LAPA 4TV7A 3DBHB 2OBSA 1MNDA 4UB6C 2YUHA 2HQRA 3CP8A 3U2RA 2R7QA 1EZGA 1S9HA 4P9SA 1I50J 5FD5A 2XGEA 5JMCB 2VE9A 3SZEA 2GOXB 4FXUA 2QBYB 4AIHA 2Y75A 2OJED 2L9RA 1R71A 5E3MA 3BC9A 3DXJF 1NG7A 3I54A 3PL8A 2R3SA 1BJKA 3ZCOA 3GSIA 1O8JA 2VBMA 4J19A 3WQZA 4PCQA 3ZSCA 3EQLF 4EATA 1MBEA 4NQWB 3WTTC 3H5RA 1R22A 2LREA 2Q2EA 2JSCA 2LFBA 4YZQA 3K4KA 3R61A 3TO6A 5IYPA 3BOQA 2O8XA 1TYUA 3AK5A 2STWA 4WX9A 2X0LA 5ED4A 1O57A 4FHTA 3PUMA 4R1HA 1K73D 1DGWY 2V1NA 3FMQA 3ZRGA 3ASPA 1T0FC 2CS3A 1ZGWA 2JPCA 4WCGA 5LFAA 5E79C 4XKVA 2XROA 4A5MA 2RKHA 1B6AA 1ZRCA 1LLZA 3CJQB 1QVTA 1WJAA 2NVYJ 2M0MA 3QOPA 4BL0B 1JJ6C 4LBWA 5J35A 2JA6J 4FWTA 4E7HA 3CQZJ 3WU2C 1R6RA 3CDLA 3K4BA 4MYUA 3BLYA 2YX4A 2K40A 5FLMJ 3OYFA 3JU4A 1QRYA 5F6FA 2D3NA 3QRFF 3GTMJ 2Q0OA 4MTEA 1TL8A 3PNTA 2M5SA 5BSYA 3BG7A 2LMDA 2LTPA 5KHDA 1BOAA 1WWXA 4B4CA 4XRSG 3AVXA 1TSPA 4V02C 1J0RA 2GA1A 1TYVA 2E1BA 2DAOA 4Y33A 3HG9A 3EUHC 4A6DA 1WP6A 3WNBA 2PBIA 5IYNA 2E71A 2RVCA 3DPTA 3HC7A 4QHYA 3RY8A 3KZIC 1A6IA 3GQ8A 1X0CA 4L5IA 4AD9A 1TWCJ 3AG4H 3ZQIA 4QLCU 1C0WA 1EFUA 4KMUX 1LB2A 3W2IA 2DJIA 2IW5A 3JRBA 4Z4ZA 1B72A 3I55B 2DPDA 2FX0A 3ROUA 4RLZA 4TMZA 3CC2B 2HWVA 2MLKA 3OL4A 3TQNA 2KMUA 3J7AO 3H9NA 4P6YA 5F4OA 3AVUA 2GAUA 1SMTA 2VC0A 1TTYA 2V6CA 2QEXI 1B9NA 3RI4A 3F23A 2HYJA 2BVLA 4IX7A 2E7WA 2IGKA 3KZZA 4URRA 2K9SA 3C2HA 5D5XB 1WPKA 3P27A 2HXIA 4ACBA 1B59A 1BN8A 1KU2A 2OTLB 4EQQA 2F5DA 3OR1C 4P96A 1BPLA 2X1CA 2R7XA 1I8DA 5HDKA 3A01A 2D1VA 4H4KC 3GTQJ 3T51B 1WHUA 4XLEA 4RM2A 1HLVA 1H80A 2VXDA 2B0LA 2QWWA 3FPKA 3QYEA 1JJ8C 4BDZA 3DU1X 3E6CC 2Y9YA 1QU3A 4WZEA 4XLNF 4AF7A 1VQKI 1E0EA 2BVNA 1VQLI 1ZARA 3B90A 2Z16A 2EFWA 2XGJA 3NE5B 4ASUA 1VF9A 2XSJC 1RUNA 1G7CA 1QHGA 4G6DA 1TLHB 1IF1A 2MH2A 3BH4A 1XX5A 1FX7A 4ZDOA 2C2WA 2PFBA 1I18A 3M8EA 4M3EA 4DYQA 2Y30A 4L5EA 3CDHA 1TT5B 4XOPA 4UUSB 3ZMTA 1QUFA 3TW7A 4I7HA 3GEZA 2V7TA 1H88C 3BJ6A 4G1VA 5GAGJ 3BR0A 2R7UA 2CC2A 4CO8A 3FIWA 1YLOA 3G05A 3JAMK 1I3QJ 1CNFA 2YS9A 3VPRA 4JQFA 2ZL6A 2A3SA 5DCMB 1XFOA 2G0YA 1YS6A 1YRNB 2W7NA 3K2ZA 2ZBKA 3K4JA 1PP8F 2DOFA 2EV6A 4N4NB 4IJAA 4PFPA 1TW2A 2FA5A 2IOUG 4A3IJ 4RDKA 3VSVA 1BOBA 1YI2I 4LIVA 1IRGA 2QQAA 4LK1F 1HKSA 3LA3A 1U2RA 1MMAA 2VFNA 4YEJA 1MMNA 3JTHA 4BHCA 2CV2A 1O8HA 3ERMA 1DG1G 4G1BA 1H85A 4XIDA 3WYAA 2QKLB 3ISPA 2DFIA 5F08A 1FNNA 3TMOA 3KX2A 4DK1A 1SFUA 3BG3A 4RGXA 1FDRA 2I1LA 3KL9A 1P2FA 3L2WA 2DYIA 3I64A 2CUJA 3HOUJ 2NRAC 2Z9OA 1DPRA 2VKHA 1OOCA 1USSA 1KCCA 3SEZA 2DBBA 2JRMA 3BJOA 3U6BA 3A2KA 4F92B 5DS0A 4Q7JB 2QKMB 1OYWA 4L5JA 3OYCA 1U6GA 2XGDA 1T08B 4HPQA 2CBXA 2M30A 2DTRA 2M1BA 1FOKA 4XBFA 4BHPA 1PLUA 2L9VA 2BX6A 3LSHA 3E0JB 4B48A 4KICA 4N3NA 1P7JA 1LFPA 4XMYA 1KD1D 1DPUA 4OAYA 5FLXZ 1E3ZA 3B78A 3SYJA 1R49A 2XPWA 1YFHA 3HOYJ 1MSFC 2CFXA 4P6VF 2Z2SB 1S7AA 3DWLE 1QUEA 3AL0B 2GXBA 4AC9A 4FE7A 4HYEA 3ABMH 4OOVA 1Z1DA 3WTVC 4RCZA 1RMGA 1OGOX 2M7AA 3A1PA 4CCLA 5JLWA 5A8AA 4KT5C 4JX4A 2P5VA 1S4MA 1O7FA 2M7BA 2KHMA 3V8LA 5D5VB 3GX4X 2KZVA 1FSEA 3W2HA 3B73A 5EG0B 2ZMEC 3J81Z 1MMGA 1UB9A 1B1BA 4YFNF 2ZFUA 3CMEI 2Z99A 4IHYA 4U7DA 2FVGA 4B4DA 3ZN0A 2DI3A 2RNGA 4ESJA 2ZO4A 1VQMI 3R6SA 3MKWB 4X7EA 4NDLA 1ENHA 1O4XA 4P9UA 3E5QA 5EYRA 4BAYA 2HPMA 4W8QA 5J4VA 4RBOA 5HS9A 2E2IJ 5CLSA 3RQIA 4IHTA 2GK7A 1XCVA 1NB0A 1GVDA 3HXLA 3OS1A 1O8LA 5GP9A 2BXZA 1T6XA 2EV0A 1RR8C 3AVYA 2JJ7A 2K86A 1UD5A 2C78A 1AWCA 2OPTA 2PN6A 5JBQA 1SFKA 1YO5C 1ETKA 4C30A 2JQ7A 4P22A 4CUGA 1RRJA 3SYTA 1UHMA 3LAJA 3CDIA 3RJPA 3OEEA 1WRJA 2MC4A 4ROXA 3ZBUA 2W48A 1A35A 4CYCA 1VHEA 3QPSA 3VYSB 4J00A 3K1MA 4D0PA 4XSZF 2LKSA 2TCTA 1N78A 1ETYA 4DNRB 3OW7A 2EFNA 2DK5A 2AHOA 1Z77A 1YX5A 1QA6A 5A2QK 2V7FA 1X1AA 2GZWA 1W7PD 1YIOA 2LRDA 1WPCA 1CQTA 1PDNC 2VKEA 4UV9A 4BBSJ 3I9V2 3DLAA 2EFGA 5A88A 1X4PA 4II3A 1O3RA 2XTXA 2LZJA 1IN5A 1OCTC 2DLLA 2HQAA 4S05A 3OYEA 2BM0A 2FD5A 4Z4SA 3WTSC 3HBLA 3I0TA 5D6EA 3S3MA 2YWFA 2ODLA 3BZKA 3K9TA 1GV5A 5ICFA 1K6OA 2UVEA 3EYYA 2GIZA 5A89A 3SDGA 5THXA 2OD5A 1WH7A 2P6SA 2L7KA 1W0JA 3JTGA 4Y9RA 1MBGA 1R5HA 3HUGB 4GRIA 4G7XA 3JRIA 2FSWA 4MQ9F 3GIRA 2ZSHB 3RCOA 4II2A 4MGRA 1LLWA 3MMYB 4HF0A 2IQ7A 3H94A 2LKPA 9ANTA 4AM3A 3KYDB 2JDIA 4YFOA 4PJNA 2VBWA 2M8GX 5HKKA 4DBRA 3HSRA 3TW6A 4A5NA 4L18B 1FP2A 4A2UA 1UELB 3FKJA 5ILUA 1WQ2A 5IOZA 3ZZUA 3VSUA 2VFMA 2JUGA 2BZTA 3LSIA 4CH7A 1ZGJA 4B47A 3BCAA 5DTDA 1Y8QB 2Q6IA 4YFKF 3OKXA 3TOAA 1Y39A 1TP4A 4EGYA 5BMZA 3O8HA 1MH3A 1RQPA 4EJWA 3HZJA 1EA0A 1F60A 4NC8A 1F4KA 4I01A 4U0WA 2BMWA 3JQRA 2A68F 3ZQCA 3BR2A 3WTWC 1DUXC 1W87A 2YU3A 4KFCA 4B3GA 3UR3C 4GFBA 3RKYA 1VQ8B 1Y6IA 2EWNA 3M1EA 1E3HA 5LHGA 2XPUA 2PLFA 3SJZA 3S2DJ 5CVUA 3ELKA 4HAMA 4X1EA 3S3OA 2CG4A 5BOXA 1WDTA 2LOOA 1H8AC 1U0JA 3OIQA 1W5CC 2L54A 5E3LA 1S8NA 2DJNA 3LSPA 1K78B 2GOMA 4KNYA 1FTTA 4P9FA 4CCOA 2DT7B 4HLYA 5FO1A 2O17A 1PUFB 1Y0NA 2E34A 4BEHA 4HBLA 4D5FA 1R1TA 3OS0A 2E60A 1Y0RA 2XAUA 4RLQA 3S93A 5HZBA 2LKXA 1O8GA 2NV4A 2M0CA 2W6JA 2XNDA 2XEXA 4JYKA 2OK8A 2W84A 2XDVA 2NT9A 1OYYA 4YZAA 4IF4A 1NHAA 3ZN1A 2FMLA 2Q6KA 2WYRA 2GWRA 1UAAA 3E6MA 1Z7LA 4RD1A 1FBUA 1E1QA 1T5EA 2QA4I 3C2GA 3RSNA 1IXRC 1RR7A 3HKZN 3JRDA 4L8JA 5L46A 1J7KA 2QQBA 3T5XA 4XL9A 2LYCA 1GAWA 2H8WA 3T56B 4RS8A 2XVCA 3OOCA 3PSIA 3Q6RA 3KE2A 5C1EA 5EZHA 2NS0A 4AIDA 4C2MJ 4WWCA 5TRDA 4RJLA 2JRTA 5IYQA 4YRVA 4YIIA 3FKIJ 1T38A 2GPJA 2ZB9A 1JJ2B 1O3SA 1T0FA 2D9RA 1X58A 4OJPA 3VSTA 2Z33A 3CCUI 2R7WA 2R7RA 2VPLA 3A8KA 3ZPPA 4M2LA 3J80K 3QPHA 2NS7A 1JUSA 2VNJA 3ZQFA 3T9GA 3L2CA 1DGRM 2ICWG 2EIXA 2NTQA 2ISZA 2O5RA 2LH9A 2VLAA 2JMWA 1RWRA 4LLGF 5AMVA 4RB2C 1R5NA 4XKBA 4MIMA 2QZAA 5FFZA 2R5ZA 5L3CA 4A12A 1GT0C 2GJRA 1FYKA 3PO3J 1NB9A 4WXDA 1T95A 1E3PA 2ID3A 2LY2A 1YQAA 2B63J 2FQ4A 5LHHA 3DKWA 1D1AA 5BS6A 3W2EA 3LWFA 4LLLA 2R7DA 3DQVC 2V7XA 5H5JA 2VBKA 3OR2C 3JRCA 4YAUA 4IHSA 4BACA 4TMWA 1RESA 4JX5A 5B6IA 1R5GA 3TBIA 3SXYA 1BR1A 3COAC 1R00A 2QEXB 1V55H 3Q5FA 3DV8A 1JT0A 4YDTA 2K9LA 1G4DA 3BQJA 3E1YE 4HDUA 1I1GA 5L3DA 2H6BA 1O3TA 5C44J 1QA1A 2K9QA 3OMYA 1FWZA 2CUZA 4UZUA 1WJDA 2DU9A 1KK2A 3J7YJ 3CMAI 4BJ6C 5C1CA 2PJRA 2H6CA 4FQGA 3VSKA 2ESNA 4QVAA 1OFLA 3IAM2 2A6EF 2MSYA 3SQNA 1MDMA 4AC0A 3ABLH 2BSPA 3ZMDA 2QF7A 3K1PA 3LA7A 3G2BA 3LQRA 4YHBA 3FXLA 4IL6C 4HE5A 3W5VA 3VYTB 4YC5A 1XMXA 1CLWA 2BM6A 1D2EA 1LQ1A 1LDJA 3RZOJ 2HOEA 3N97A 3G4SI 2VASA 3W3CA 2K9NA 1VQLB 1XS9A 2CMPA 1AHDP 1W7PA 1KQ8A 4BH9A 2XV4S 3OYJA 4EV0A 4Z4VA 1HCRA 3S1NJ 1GVJA 4O3MA 2D45A 3JAMZ 2HKOA 2M3AA 4E7ZA 1RIOH 4KISA 2X3UA 3ASQA 3ZZTA 1YJWI 3H09A 2WWYA 4G94A 2EBIA 1VFCA 1P4XA 2AQEA 3BPXA 1HG8A 4N9IA 2X48A 4H0EA 4Y4RA 2ZBVA 4X7DA 1UFMA 3WXMA 2GBYA 5HNHA 2V26A 1ZLJA 3BR1A 2Z5UA 2ME6A 1MBJA 3BTJA 1OCRH 5FKMA 4BXFA 1SKYB 1JTYA 1WI3A 1Y56A 3PUNA 3MWMA 1W36C 2L7ZA 2DOAA 3CJTB 1BIBA 1I3AA 3F9KA 3KETA 1LNWA 5L3GA 1DP7P 2LR8A 1W0KA 2EFOA 3ZMVA 2E35A 4IPAA 1D5VA 2XAQA 3ONYA 3CUQC 1EFTA 3AAFA 2LBFB 1KYZA 1PE9A 1LDDA 3N90A 3ZBTA 1M1KD 4U4BA 5HDNA 2CV0A 1BLIA 1PXZA 1D8KA 4E70A 3L9FA 2B5OA 2O04A 5B1AH 4Y7CA 1LVKA 3CC7I 2ZTGA 1YI2B 3H35A 2QENA 5FKOA 1W2BB 4RMNA 4HF2A 1E3OC 1Q81D 5H6RA 1BC7C 2IAIA 3GF2A 2OBPA 2KIQA 3JR9A 2HEOA 1QVGB 2XTWA 2ZBUA 4AVPA 2BN4A 1MH4A 1QZZA 2VNIA 3JRHA 2HDDA 1Z3YA 2FXAA 2NNYA 2GQQA 4XONA 3VYUB 2Y48A 3WTYC 4FTHA 1IRZA 2EZKA 2XGXA 3RKXA 2JA8J 1Q9SA 2QSHX 3FY3A 2GJPA 4S0HB 3BR3A 1FNDA 4XSXF 4PC3A 2VODA 4B3FX 5LD2C 4AWXB 2BHYA 4V2FA 2OYNA 1O8IA 3PVDA 2VKVA 3TH0A 2ECCA 1FIPA 3OS2A 2E1RA 2Y69H 2Y0SA 5E20A 3W2AA 5FKNA 4E4HA 5J47A 2FRHA 1HKTA 3BY2A 2MC3A 4LOCA 4TMVA 2EA4A 5TISC 3P9IA 5HOOA 3J7AY 5HXBA 4LIUA 2XRLA 1RPWA 4PABA 3RKWA 1SAUA 3BH7B 1TBXA 1AKHA 3GQ9A 4CCJA 4BJTA 3L00A 1J9ZA 1GJRA 1S72B 1S29A 4YALA 3F8BA 2ZJQF 2X1EA 2STTA 3ONUA 1IA5A 1LE8B 2R0QC 4NC6A 3TOBA 2NNNA 1KTWA 4HQEA 1R58A 4FISA 1G2HA
chains in the Genus database with same CATH topology
1BPLA 2X1CA 1JTAA 2R7XA 1H8HA 4CZCA 1WJ5A 3S32A 4BDYA 1I8DA 3EPZA 3LMWA 4H4KC 3T51B 3LFUA 4XLEA 4RM2A 4C9YA 2P0WA 1H80A 2VXDA 3OY9A 2Z8GA 3QYEA 1EE6A 5CDFA 4BDZA 2JJ2A 3K6GA 1QU3A 2NTPA 2X6YA 2VL8A 3OPOA 1E0EA 2O1DA 1V5FA 3B90A 4E7JA 2Z16A 3CJRB 2XGJA 3NE5B 3LSMA 4ASUA 2L9NA 2XSJC 3D5RC 1QHGA 2ZXHA 4NNJA 5HLTA 2CH0A 3UW0A 4OZZA 1PJRA 3BH4A 3AKZA 4KKUA 4ZDOA 2JIZA 4BE2A 2OUMA 1I18A 3VWBA 1MMDA 2E1MB 4N4OB 4ZDLA 2IGMA 2KDOA 4XOPA 3EQNA 4MLOA 2NSPA 2KVOA 1COWA 2DT6A 2R7UA 3DEEA 3G05A 4IZZA 3NWSA 4PSWA 2W00A 4JQFA 1QCXA 4BQNA 2CW8A 3MD2A 1O8FA 3FBNB 5FRNA 2W7NA 3K4JA 2KL4A 5FRMA 4BU2A 4N4NB 1O8MA 4PFPA 4ANJA 1J09A 2IGNA 2F43A 1KZLA 4KKSA 2QX3A 4OJOA 2E5ZA 4AU7A 2X53S 1WMRA 2VQHA 3OYKA 1BOBA 3D5SC 3OYHA 4LIVA 3FHNA 3KEYA 4PK4A 3OYIA 4E7IA 2VQCA 4BJ5C 3OEHA 1MMAA 4RLFA 4YEJA 3FPPA 1FMVA 1MMNA 2CV2A 3GVLA 1O8HA 1DBOA 3BCBA 4PMHA 2BW3B 4AYBA 4JMQA 5HNFA 4PUSA 1X1BA 4QPOA 2QKLB 2KQRA 3TMOA 3KX2A 4DK1A 2BW3A 2X1DA 2WAFA 2KP6A 4OAZA 3L2WA 2CUJA 2A5WA 4MXNA 4OJLA 4JOMA 1E3XA 1AIRA 2VKHA 4AVZA 1V0EA 1OOCA 1KCCA 1BR2A 2IXSA 3SEZA 3A2KA 4F92B 2Q1ZB 3W2VA 3ZGKA 2QKMB 3OYCA 4NUBA 4XLFA 1UD4A 4HPQA 4E7SA 2IS1A 2HVRA 2R7VA 4YXWA 3GVJA 2VXZA 1PLUA 1FMWA 2ZSIB 2XF7A 4P1WA 3K10A 3H9GA 4F93B 3LSHA 3E0JB 4B48A 1V0FA 2INVA 2WPDA 3BC8A 1LFPA 4XMYA 1EA3A 4OAYA 1E3ZA 2BVMA 2UWMA 3SUCA 1KMHA 1YE9A 3BG6A 1N75A 2Z2SB 5CQGA 4TSFA 3DWLE 3AL0B 4PJLA 4ZDPA 4G6TB 4U49A 2X85A 3DTEA 2W1OA 2HVSA 2NTBA 3M8JA 3E1SA 1RMGA 2V4DA 4OJ5A 1OGOX 4YELA 3HAGA 2M7AA 2VQLA 3HL2A 4CCLA 4DNTB 2PYHA 1V5EA 2E5NA 5FROA 4BQQA 2VBEA 2VJ4A 3VMWA 2M7BA 2ELJA 3ZR8X 2KHMA 2KZVA 1G8XA 1W9XA 1VLYA 2WZPP 1MMGA 2ZFUA 2AQFA 1OB0A 4G6IA 2UV1A 2A6TA 1N77A 4OJ6A 2RNGA 2VB6A 2W4SA 3MKWB 3BCFA 3PNYA 3K4MA 2HPMA 4W8RA 4B3XA 4W8QA 4MR0A 3ONQA 1K6YA 2ZXIA 2GK7A 3HXLA 2HPIA 2W82A 3PNVA 3OS1A 4D1QA 1O8LA 1NHCA 2E1MC 1P9QC 1DP3A 4HRIA 2VKDA 2NZMA 1UD5A 1SFKA 4BE0A 3FDYA 4C30A 4P22A 1H8EA 4CUGA 3OYNA 1SKYB 5KCMA 4EW9A 3SYTA 1PYVA 3UNGC 1WJCA 3OEEA 2MC4A 2K5CA 2VJ5A 4XR6A 4FASD 2MYSA 2V7QA 2R9VA 4CCKA 1WJFA 2D3LA 3SDBA 3VYSB 4J00A 1KONA 2V31A 4R79A 2WAEA 3OYLA 1N78A 4DNRB 4NK6A 3A35A 1NRKA 2NOJB 3OW7A 5TGTA 1UD8A 5KNLA 4X0GA 2ZZGA 1YX5A 2HNHA 2IGOA 2V7FA 1X1AA 2LRDA 4NK8A 3DTIA 4ZTFA 1WPCA 1XG2A 3PFYA 4ZC3A 3AFHA 4HNTA 2DXIA 4BE1A 3I9V2 3DLAA 1X4PA 3CP2A 4II3A 3IP4B 5CKTA 1X19A 2LZJA 2QE7A 2JSPA 2HQAA 3ZIAA 3OYEA 2X51A 1UD2A 2GK6A 3VMVA 4Z1MA 4XOTA 2LG4A 4DGWB 3S3MA 1CZFA 1BHEA 2ODLA 1HVXA 3L2QA 2UVEA 2WAQA 3IUOA 2JJ1A 3A3BA 1GLNA 3OYGA 2JA2A 2CV1A 1IRXA 2L7KA 1W0JA 4NC7A 2O0WA 4LG3A 1D0ZA 1VBLA 3HUGB 3D5LA 4GRIA 4B43A 4G7XA 4DIQA 1IDJA 1X1DA 2F4IA 2ZSHB 4XLHA 4II2A 3RCOA 1PKVA 1O88A 1O8DA 3LSKA 1O8KA 3LL7A 1ERDA 3MMYB 1JRGA 5DN6A 3V42A 2IQ7A 2BOLA 3H94A 2UVFA 4BUPA 1G59A 3HOTA 3QYBA 4HEA2 2JDIA 3B8YA 1YX3A 4PJNA 3S8PA 2LC2A 4BQOA 3B4NA 4CSWA 1VF7A 2XOKA 5HKKA 4BGDA 4DBRA 3W2WA 3DPLC 1NG6A 1DBGA 1D1CA 3PSFA 4PSXA 2JVHA 3OE7A 1OGMX 4W8SA 1UELB 2X6XA 3FKJA 3VSUA 3HOSA 4RM3A 2JUGA 4CH7A 3LSIA 3T53B 3EQOA 3MKYB 4B47A 1AA7A 3BCAA 1QHHD 3H9QA 4XN0A 3VYRB 4E7LA 1UD6A 2DIEA 1BMFA 3AL0C 3KRGA 3N05A 2XZPA 4HSRA 4NC8A 2XF6A 5IK2A 3RQ4A 3K70D 1E79A 4E0FA 3OL3A 1W36D 4XKWA 4B3GA 3UR3C 4CCNA 1BR4A 3K4CA 2WA0A 1Y6IA 2QXZA 2HZDA 1FX0A 2W6IA 3S3OA 2HDWA 2ZTNA 4Z05A 2LOOA 2WJYA 3FKSA 4DBQA 4F91B 3JURA 3QODA 1U0JA 3OIQA 4OZYA 4Z03A 4BEHB 2WBMA 3A1YA 2GOMA 3OOUA 2O17A 4CCOA 2DT7B 4PJMA 2ZZEA 1JI8A 2VJIA 2L5QA 4KKTA 4BEHA 4KT6A 4W8TA 3OS0A 5CPRB 2E60A 1MNEA 2XAUA 4RLQA 1D0XA 2R4GA 3RTRA 3S93A 3KYLA 1O8GA 2W6JA 2V4JC 2XNDA 1D0YA 2R7OA 2XDVA 2NT9A 4YZAA 3L2RA 1IDKA 4CCMA 4C2LA 2WY8Q 4TKOB 1UAAA 1HA8A 1Z7LA 4F52A 2FUG2 3TL4X 3CF2A 2Z1DA 3HPHA 1E1QA 1K28D 3H5AA 3C2GA 2MFZA 3RSNA 1E43A 1T5EA 4HNUA 2WJVA 4L8JA 2PYGA 1O8EA 4XL9A 3DU5A 1Z21A 2LYCA 3FBIB 4HSTA 4BS9A 1TZLA 3VSLA 3T56B 2O0VA 2X3HA 1V5GA 2CFOA 4ITVA 1K5CA 3OOCA 2OC6A 4IQ4A 3PSIA 4KJZA 1QJVA 3GQBA 3GBGA 1D1BA 2LY1A 5C1EA 2NSTA 3SEQA 2XZOA 3VR6A 3VSVA 4YRVA 1RU4A 2INUA 3VDXA 1LDKB 3OAAA 4GQNA 3ZPNA 4FETA 4P5OA 3VSTA 4OJPA 4B44A 2X6WA 3LMMA 4LITA 2PMZA 3EUKL 2R7WA 2R7SA 1MABA 2R7RA 2VPLA 2WSSA 3ZPPA 4IQJA 3T9GA 4ZTJA 1KCDA 1DGRM 2NTQA 3ZQQA 3S3NA 2QY1A 4HG2A 2R7TA 2DCEA 2O5RA 4C2TA 2LH9A 2KRHA 2VLAA 2XZLA 1RWRA 1ZELA 4Z06A 3A3GA 3H9JA 5AMVA 4XKBA 2X8KA 4IKFA 1IB4A 2GJRA 4U87A 4CA0A 2L9SA 2KRCA 1T95A 1NBMA 3OYAA 2LY2A 2MABA 1D1AA 2HVQA 2VBKA 3DKYA 3DQVC 1VJSA 2RREA 3GVKA 1OLTA 3OR2C 2F6CA 4BACA 4ZJZA 4TT3A 3GQAA 3TBIA 1DQUA 4XORA 1BR1A 4DOZA 3IAS2 2K9LA 2PJRB 3L2UA 3OMYA 2CUZA 2OV7A 4XLCA 1WJDA 4UZUA 3DU6A 3OYDA 3DTKA 3PUBA 4XKCA 4BJ6C 2PJRA 2WY7Q 2Z6BD 5C1CA 2L2OA 1OFLA 1MW7A 3VSKA 2EWEA 3CESA 3IAM2 1GQ8A 4DJAA 2ZZQA 4XNFA 3KEWA 3H0DA 1OR7C 2RQQA 2MD0A 2BSPA 1WFXA 3G2BA 3A4CA 4QPQA 3WWGA 2WADA 2KLOA 4D9JA 3LSGA 3VYTB 2HLDA 3GQ7A 2IS4A 1WTHD 3OYMA 3L2VA 2VASA 2ZZFA 3W3CA 2HU9A 3K4LA 3CMMA 2XF5A 2CMPA 3OWTA 1OFMA 3OYJA 4XLAA 3ZXSA 2M3AA 1MNDA 3DPUA 4E7ZA 4KISA 4OWRB 3CP8A 1WJBA 1X4OA 2F5VA 2R7QA 3CZ6A 1S9HA 3QOEA 3K4NA 2AQEA 1HG8A 4F55A 3I3LA 2GOXB 4XQFA 4FXUA 4HWVA 4Y4RA 5HNHA 2V26A 2K9MA 1OHHA 3BC9A 2CW7A 5CQEA 1Z3XA 1NG7A 4BXFA 4KITB 3PL8A 1WJEA 1Y56A 3H5NA 3K70C 2Q2EB 3ZCOA 3U21A 3DKXA 1W36C 1O8JA 3WQZA 2VBMA 2DOAA 3ZSCA 4HIZA 3DDYA 4EATA 3F9KA 4NQWB 2M4GA 3H5RA 1TT0A 2LREA 1W0KA 4YZQA 3K4KA 2NT6A 3BCDA 4PJJA 4J01A 4E7KA 2LBFB 1PE9A 4U4BA 1HZEA 1DGWY 2V1NA 2WB1A 3ZRGA 1T0FC 2CS3A 2CV0A 1BLIA 5LFAA 1PXZA 4XKVA 2PECA 1E1RA 2LBFA 5FL7A 2O04A 1LVKA 2ZTGA 3H35A 4RMNA 3CJQB 5JHFA 5HVQC 1WJAA 3OYBA 2KPMA 2M0MA 4BL0B 4E7HA 1X1CA 1R6RA 2VQGA 3K4BA 3BLYA 3QYFA 3OYFA 3LNNA 3JU4A 3HPGA 2D3NA 2GJKA 1Z3YA 4XONA 3VYUB 1UG0A 3PNTA 2M5SA 3BG7A 1LKXA 5KHDA 3MKZA 3FY3A 2GJPA 4ZYAA 2VJJA 2XC7A 1UD3A 2E1BA 4Y33A 4B3FX 3RPUD 3PJRA 4XN3A 3HG9A 3EUHC 5LD2C 1WP6A 3GRHA 1O8IA 1VZ0A 3HC7A 2IS6A 3DPTA 4PFOA 3GQ8A 2K3PA 4Y3OA 3OS2A 1X0CA 2I8DA 2Y0SA 4XD7A 3W2AA 4E4HA 4YZXA 3NWTA 3OIPA 2DJIA 2CK3A 3SZGA 4F3QA 4C2UA 3OL4A 2KMUA 3EUAA 3M1CA 4G7WA 4DK0A 2M4KA 2VIXA 5HOOA 3J7AY 2JVGA 4LIUA 4IX7A 2BVLA 4I84A 4U7BA 2IGKA 4XM3A 4URRA 3C2HA 1SAUA 3GQ9A 2V6EA 4CCJA 1EFRA 4BJTA 2V9KA 2UUZA 4YZ0A 2F1MA 4E6KG 3HKZA 2X1EA 1IA5A 1BN8A 2IS2A 1KTWA 3OR1C 3OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTA A;  2PYH A;  3GQ7 A;  2QXZ A;  2VBE A;  3LMW A;  3VMW A;  4XLE A;  1H80 A;  2Z8G A;  4Z05 A;  1OFM A;  3JUR A;  1EE6 A;  4XLA A;  4OZY A;  2NTP A;  4Z03 A;  2X6Y A;  4OJ6 A;  2O1D A;  2O17 A;  3B90 A;  2VJI A;  1HG8 A;  4W8T A;  4HWV A;  4XQF A;  4W8Q A;  4MR0 A;  1O8G A;  3UW0 A;  4OZZ A;  1O8L A;  2NT9 A;  4YZA A;  1NHC A;  1IDK A;  4C2L A;  2NZM A;  1O8J A;  2VBM A;  4XOP A;  3ZSC A;  3EQN A;  2PYG A;  4EW9 A;  1O8E A;  2NSP A;  4XL9 A;  4YZQ A;  2NT6 A;  4XR6 A;  2X3H A;  2O0V A;  1K5C A;  4U4B A;  1PE9 A;  1QJV A;  4NK6 A;  1QCX A;  5C1E A;  2NST A;  1O8F A;  1PXZ A;  4XKV A;  2PEC A;  2O04 A;  1RU4 A;  2INU A;  4NK8 A;  1O8M A;  1XG2 A;  3VST A;  4OJP A;  2X6W A;  2QX3 A;  4OJO A;  3VSV A;  1WMR A;  3ZPP A;  3VMV A;  4YEJ A;  4XOT A;  3T9G A;  1CZF A;  1KCD A;  1BHE A;  1O8H A;  1DBO A;  2NTQ A;  2ODL A;  2QY1 A;  2UVE A;  4PMH A;  4XON A;  4Z06 A;  1RWR A;  2O0W A;  1VBL A;  5AMV A;  3FY3 A;  1IDJ A;  2VJJ A;  1O88 A;  4XLH A;  4W8R A;  1IB4 A;  1O8K A;  1O8D A;  4OJL A;  4MXN A;  4XN3 A;  1JRG A;  1AIR A;  4AVZ A;  3GRH A;  2IQ7 A;  1O8I A;  1OOC A;  2UVF A;  1KCC A;  2VBK A;  3GQ8 A;  4XLF A;  1X0C A;  3B8Y A;  3GQA A;  3B4N A;  4XOR A;  1PLU A;  1OGM X;  1DBG A;  4XLC A;  4YZX A;  4W8S A;  2X6X A;  2INV A;  3VSU A;  4XMY A;  3EQO A;  4I84 A;  5C1C A;  4XM3 A;  4XN0 A;  4URR A;  3SUC A;  1OFL A;  2EWE A;  3GQ9 A;  1GQ8 A;  3KRG A;  4XNF A;  4YZ0 A;  4U49 A;  2BSP A;  2X85 A;  1IA5 A;  1BN8 A;  3WWG A;  2NTB A;  1KTW A;  1RMG A;  4OJ5 A;  4XKW A;  1OGO X;  4YEL A; 
#chains in the Genus database with same CATH topology
 1DAR A;  1QNT A;  3O6B B;  3G71 I;  1JTA A;  3OOP A;  3ES9 A;  4CZC A;  1JUM A;  4CGZ A;  3EPZ A;  4XRF A;  1IRF A;  1P4W A;  3CME B;  2EIK H;  1JGG A;  3LFU A;  4C9Y A;  4B8X A;  2YWG A;  4WK8 F;  3L1P A;  3BNW A;  5CDF A;  1VQM B;  3FJO A;  3K6G A;  1YOV B;  4AIK A;  2X6Y A;  2K4B A;  1QBJ A;  3Q39 A;  4MEY F;  5J8F A;  4RD3 A;  1V5F A;  4M3D A;  1BQE A;  2OZ6 A;  4EJU A;  2EFQ A;  1YIJ I;  3L7W A;  3JRA A;  1HBX G;  3FK6 A;  4JBA A;  1ZM9 A;  3CJN A;  2ZXH A;  3K1N A;  4BHB A;  5A2Q Z;  2CH0 A;  1LJ9 A;  4WZT A;  2DMU A;  1VQ6 I;  4KKU A;  3A0H C;  1UCR A;  2A05 A;  1BI3 A;  1ZKG A;  3EDP A;  4BE2 A;  5IP9 J;  4ZDL A;  2IGM A;  2KDO A;  4FN5 A;  2LP0 A;  1FNM A;  3EQN A;  1RI7 A;  2L3D A;  3R0A A;  2X4H A;  5IYC J;  2F5E A;  2KVO A;  3K7A J;  2DT6 A;  2FOW A;  2VT2 A;  2K7L A;  1I5Z A;  4YIR X;  3ECH A;  5JFR A;  4PSW A;  4DQ2 A;  3ZP5 A;  3QPT A;  2CW8 A;  2GLO A;  3MD2 A;  3WTZ A;  1MRZ A;  3FBN B;  2NXN B;  2QQ9 A;  3CPW B;  2BYV E;  1JKO C;  4YIF A;  4X06 A;  3HOX J;  4ZYG A;  4ENK A;  3U1K A;  1FJL A;  4RPD A;  3CCQ I;  2Y31 A;  2J8I A;  2IP2 A;  4Q47 A;  2EIN H;  1HDP A;  2IGN A;  4ANJ A;  2CRV A;  2F43 A;  4KKS A;  4DQL A;  4IEJ A;  1OMI A;  1XC5 A;  2HZT A;  4K2E A;  4AU7 A;  3OYK A;  3A3B A;  4HF1 A;  3JX8 A;  3C18 A;  3KEY A;  1X3Z B;  4PK4 A;  1IHM A;  1R5O A;  4BJ5 C;  2IT0 A;  4HV6 A;  2XAH A;  1RET A;  3KIO A;  5M5Y J;  5AIQ A;  2XKP A;  1HW2 A;  1DBO A;  1QPI A;  4M53 A;  1U8B A;  2R7F A;  2BW3 B;  1G3W A;  4HV5 A;  4QPO A;  1IUF A;  2E7X A;  2DDA A;  1UMQ A;  2LSO A;  4EVI A;  1IB0 A;  4RM0 A;  2BY1 A;  1HF2 A;  4XK4 A;  4RAZ A;  2EZH A;  2HOA A;  4OAZ A;  1QG0 A;  3CC4 B;  1WOS A;  2VFQ A;  4D7M A;  3S1Q J;  5F1J A;  2B7B A;  4OU0 A;  4OJL A;  2I5U A;  4JOM A;  3ECO A;  4RDJ A;  1AIR A;  4A3E J;  5K7Z A;  4L0Z B;  1V0E A;  2COM A;  2DA3 A;  1BR2 A;  2IXS A;  2LLK A;  1WSU A;  3HOV J;  5LGT A;  1DDI A;  4L9V A;  3ZGK A;  1AMO A;  1UD4 A;  3LYC A;  3GVA A;  4ENM A;  1YW9 A;  3NQO A;  4NCN A;  1IJE A;  4UVA A;  1HF0 A;  2DMT A;  2HVR A;  2QSF X;  1JA0 A;  4YXW A;  4M3B A;  3GVJ A;  2VXZ A;  3R4K A;  3ZQL A;  3AVV A;  3K10 A;  1V0F A;  3E97 A;  4YZX A;  2WV1 A;  3A8I A;  1EA3 A;  2VOP A;  4OOX A;  3V7A A;  2FU4 A;  1ONV A;  5IYW A;  2OAZ A;  4LC0 A;  2VON A;  3SUC A;  3BG6 A;  1N75 A;  3O8G A;  2HDC A;  4X6A J;  2RV8 A;  4RDL A;  4PJL A;  3WHB A;  2EA2 A;  5FNZ A;  2X85 A;  1X2M A;  3DTE A;  1JE8 A;  4Y15 A;  2NTB A;  2HFH A;  3E1S A;  2L7F P;  3HAG A;  3ASS A;  4LD5 A;  1MNM C;  2PYH A;  4KH3 A;  3PSS A;  5FRO A;  4Z4Y A;  1TWG J;  2VZL A;  4BXX J;  1XDU A;  1ZK8 A;  1ULY A;  3SEJ A;  2GA2 A;  1U2W A;  4OOI A;  4ZYE A;  3HEF A;  5GAH J;  2QYO A;  3GLX A;  4ACA A;  4B3A A;  4UNO A;  3LSR A;  1TVC A;  3CCR I;  4G6I A;  2UV1 A;  2Q6L A;  1JGS A;  1ZTR A;  5H2F C;  3JRE A;  5F4J A;  2VBV A;  3AVW A;  2VB6 A;  2W4S A;  2VUM J;  3BCF A;  3F0C A;  2YU9 J;  3PNY A;  3CPX A;  3LJY A;  1ZQ3 P;  2CQQ A;  3K4M A;  1DU0 A;  3SQV A;  3KEQ A;  4B3X A;  5GTI C;  5EF6 A;  2R92 J;  3ESW B;  4MR0 A;  1KQ0 A;  5IT3 A;  1VLO A;  3Q9S A;  4O6J A;  1KQ9 A;  2QA4 B;  4TN1 A;  2ID6 A;  1G3T A;  1ZYR F;  2TRT A;  2W24 A;  4CQJ A;  1MJB A;  2NS8 A;  3U1D A;  4HRI A;  3J80 Z;  2J5P A;  4BE0 A;  1IXC A;  2CO5 A;  2Q8K A;  3CCV I;  1NK3 P;  1N07 A;  1K9M D;  1M90 D;  3NAU A;  5IT9 K;  1WJC A;  4FAS D;  4XR6 A;  2O03 A;  1D8J A;  2MYS A;  4RPB A;  4TMX A;  2R9V A;  4Y52 J;  4CCK A;  1KZH A;  2L01 A;  2V31 A;  5DM6 F;  1MSE C;  5TGT A;  3CCU B;  3NB2 A;  4X0G A;  1IDZ A;  2HNH A;  1NTC A;  5K1Y A;  4DQK A;  4YAW A;  1WCM J;  2KT0 A;  1W35 A;  2V1X A;  3PQK A;  2Y0M A;  2F48 A;  3AFH A;  1XSX A;  3V7R A;  2BY0 A;  4BE1 A;  3I59 A;  2DXI A;  2H09 A;  5CKT A;  1X19 A;  1DDN A;  2QE7 A;  3CW2 A;  4OPO A;  2GK6 A;  4I0A A;  3VMV A;  3PM1 A;  4BPR A;  4Z1M A;  1QQ1 A;  3ISX A;  4DGW B;  1CZF A;  3CCE I;  4C43 A;  3WGI A;  3IUO A;  2JJ1 A;  5EGO B;  4Z4U A;  1JUP A;  2JA2 A;  1IRX A;  2XNJ A;  4M6X A;  3T0Y A;  4NC7 A;  4ZV4 A;  2RAE A;  1YLF A;  2XAS A;  2XUB A;  4Z4R A;  4U0V A;  3KLO A;  3BY6 A;  3OW2 B;  1IDJ A;  1O88 A;  3NAR A;  1FOX A;  3I4N J;  2JWT A;  1RKW A;  3LL7 A;  4A3J J;  1ERD A;  1ZM4 A;  5DN6 A;  2MW8 A;  2R5Y A;  1K4S A;  2UVF A;  1APL C;  3P5J A;  2VOO A;  3QYB A;  2CUF A;  1W7P B;  2RQP A;  3A0B C;  4HEA 2;  3ZUG A;  1U9O A;  3S8P A;  4BQO A;  3B4N A;  1G7T A;  1BC8 C;  2DK8 A;  3CMA B;  4BGD A;  1V4R A;  3W2W A;  1OCZ H;  4ZZL A;  1WOO A;  1OGM X;  4ON0 A;  3A03 A;  3G73 A;  4B09 A;  4FX0 A;  2X6X A;  1CF7 A;  1FTZ A;  3MKY B;  1QFJ A;  3VYR B;  2DIE A;  1FRQ A;  2VI6 A;  2JPB A;  3AL0 C;  2DFH A;  1J75 A;  3DEU A;  3N05 A;  1IZ1 A;  4HSR A;  4KIF A;  2XZP A;  5IK2 A;  4K1X A;  1LUJ B;  3RQ4 A;  4M9X A;  1WGX A;  3R6K A;  1EP3 B;  3OL3 A;  2E19 A;  3G4S B;  3TP0 A;  1WH5 A;  3GZ5 A;  2DA5 A;  1BR4 A;  2WC2 A;  3K4C A;  3PEN A;  2OQR A;  1IV8 A;  1T33 A;  2HZD A;  4MFE A;  1VQ7 I;  1W5T A;  2QXZ A;  2Q6O A;  1FYL A;  4HDV A;  3GFI A;  2HDW A;  2ZTN A;  4Z05 A;  2WJY A;  2KIF A;  3WE2 A;  1IGN A;  3GZN B;  1WSV A;  1I7P A;  3QOD A;  1MBF A;  1FLI A;  3LQE A;  1EKE A;  2BXY A;  3IWF A;  3LVB A;  1HC8 A;  2HTJ A;  2HQN A;  4XRS A;  4PJM A;  1XMK A;  2C6Y A;  3GTL J;  2G7U A;  4LG0 B;  1CQX A;  2ZZE A;  4KKT A;  3H0G J;  4LBY A;  2HYF A;  2LVS A;  1O7L A;  3F8N A;  1X2N A;  2DYR H;  1E2X A;  1MNE A;  2O8K A;  2R4G A;  4HNV A;  1OB2 A;  4R8H A;  3BJA A;  4Z4T A;  1E63 A;  1D0Y A;  1X3W B;  2NAZ A;  1I1S A;  2R7O A;  4EH1 A;  3L2R A;  1IDK A;  4CCM A;  4C2L A;  3U9G A;  2GQF A;  1BIA A;  1OIS A;  1T56 A;  1FEX A;  1KQ5 A;  3GTG J;  2FUG 2;  1K4Z A;  1XGO A;  2G9W A;  2WTE A;  2P5K A;  3CF2 A;  3HPH A;  1R9T J;  1SFX A;  2CUE A;  2PYG A;  5H6Q A;  4A3C J;  4IHX A;  4A3B J;  2WJV A;  2ZJR F;  4FE4 A;  4BS9 A;  4IO9 F;  1Y1V J;  3IKV A;  1MIJ A;  3VSL A;  4M72 A;  5C4X J;  1V5G A;  2EK5 A;  4YFX F;  1W34 A;  4YAO A;  4KJZ A;  1QJV A;  2CF4 A;  3CC7 B;  5LGN A;  1CGP A;  1D1B A;  1EH6 A;  2LY1 A;  3HSE A;  3GFM A;  4HX7 A;  3CUQ A;  2INU A;  2HGC A;  2NYX A;  3V4G A;  3OAA A;  1QA3 A;  1R7J A;  2DA2 A;  3HOW J;  3D26 A;  1R1U A;  2X6W A;  2HQ5 A;  4RB1 A;  2PMZ A;  1MAB A;  1N0V C;  1PP7 U;  2R93 J;  2WSS A;  1L1I A;  3BT9 A;  2GRE A;  1BI1 A;  2FQ3 A;  2C77 A;  2VBS A;  1XMA A;  2D5V A;  4ZTJ A;  1KCD A;  3KCC A;  3ASR A;  3ZQQ A;  2IVM A;  1OYI A;  2EJR A;  3BZC A;  4RB0 A;  1AKH B;  5B5E C;  4C2T A;  4N0B A;  2MBF A;  4M9Z A;  1K8A D;  2XZL A;  2XHK A;  1UD3 A;  3IWZ A;  4DZP A;  5HOD A;  3JRG A;  3ABT A;  3CF5 F;  3A3G A;  2X8K A;  3LST A;  1IB4 A;  4U87 A;  3JW4 A;  1VQ9 I;  4UY8 I;  1YJN I;  1BI2 A;  3FX3 A;  1EP2 B;  4ZCM A;  1YHQ I;  1OFD A;  4X7F A;  2MAB A;  5FLV A;  4V2G A;  5FJ8 J;  3DKY A;  4MEX F;  4CHU A;  1X1P A;  1OLT A;  5F27 A;  1JB9 A;  1QRC A;  1R5I D;  2F6C A;  3CD6 I;  3REO A;  2H94 A;  1KTV A;  1X3U A;  3S14 J;  2XB5 A;  1DQU A;  2TDX A;  4XOR A;  3VOE A;  1SVO A;  1Y1W J;  3GXO A;  3FHZ A;  4UVB A;  4G7H F;  1HQC A;  2HDN B;  1ZG5 A;  3OYD A;  3S2W A;  3GWZ A;  2E1O A;  2OQG A;  2FNA A;  3DTK A;  2OZU A;  4AF6 A;  4ZCL A;  4MFD A;  1W1W E;  1MW7 A;  2CW0 F;  3T8T A;  3AGP A;  3M4O J;  2ZZQ A;  4XNF A;  5JVT A;  3H0D A;  1OR7 C;  5GAD J;  3KEW A;  3OP1 A;  2MD0 A;  4PAA A;  3G71 B;  2DQL A;  2O3F A;  3HTU A;  2WAD A;  4OPW A;  4ESB A;  3Q38 A;  1AU7 A;  3UKG A;  2HLD A;  4BXU A;  4P26 A;  2A69 F;  2IA0 A;  4G8X A;  5JR3 A;  3GQ7 A;  3OYM A;  4NBS A;  4KIB A;  5D8L B;  1OKR A;  2CGP A;  2FX3 A;  4OPV A;  4IHW A;  3OZV A;  5BSX A;  2HU9 A;  2YX7 A;  5DDG A;  3CMM A;  5GPC A;  1Z9C A;  4I6Z A;  1KU7 A;  1G6N A;  1U9N A;  1ZM3 A;  2ZIT A;  1OFM A;  4Y13 A;  1EV7 A;  4A3D J;  4UAJ A;  1ETV A;  1IXS B;  2CW5 A;  4OPS A;  5IPA A;  4G5G A;  1ZHF A;  1WJB A;  1IW7 F;  1X4O A;  2DMN A;  2F5V A;  3CZ6 A;  1U5T A;  3M9A A;  3Q6Q A;  1VQ6 B;  2ADU A;  3QOE A;  3KP2 A;  2M45 A;  2Y9Z A;  3GW2 A;  2CQ7 A;  3I3L A;  4XQF A;  5F0F A;  4D5C A;  1ZG3 A;  4M9S A;  1QZE A;  3S16 J;  1OHH A;  1DDG A;  2CW7 A;  2X9D A;  3ABK H;  2HI3 A;  4Y17 A;  3V8K A;  4Q5S F;  3HIF A;  4KIT B;  4L9N A;  1WJE A;  4WF2 A;  5AON A;  3DBL B;  2Q2E B;  5LBQ A;  3K70 C;  3DKX A;  2LK2 A;  3F8M A;  1V54 H;  3DDY A;  1F5T A;  2R7Z J;  4QSH A;  5J3O A;  3FXO A;  1TT0 A;  3FXJ A;  3GZ6 A;  4UZE A;  2O61 A;  4LJZ F;  2NT6 A;  1POG A;  1XD7 A;  1SAX A;  1B23 P;  3N6Z A;  3BCD A;  3J7Z I;  3AG1 H;  4NQW A;  4PJJ A;  4J01 A;  2X3H A;  2F1L A;  2QDX A;  5HZA A;  2WB1 A;  4P55 A;  3CCQ B;  1QPM A;  2J8K A;  3CCM I;  5F0H A;  4LFU A;  3MAJ A;  1N06 A;  4QV2 A;  4OM9 A;  2PEC A;  4Z2Y A;  1E1R A;  3RYR A;  2B7C A;  5F4M A;  5FL7 A;  3LQQ A;  3ASN H;  4PC2 A;  2CQN A;  2HTS A;  5M5W J;  1K4T A;  5E17 F;  1EF4 A;  3IH3 A;  5HVQ C;  1E64 A;  3ZMU A;  3VOD A;  4LBV A;  1X1C A;  1Z6T A;  4KA4 A;  3ULQ B;  2VQG A;  3QYF A;  3F22 A;  2X6O A;  5TY0 A;  2XC1 A;  3T1B A;  5KW9 A;  2HKX A;  1SMY F;  2DMQ A;  1U78 A;  1VQ4 I;  3CC2 I;  1WSR A;  1KYW A;  1WVR A;  1LKX A;  3K69 A;  3ZQG A;  4CZZ A;  1LVA A;  2VFO A;  4GCV A;  3OZU A;  1FPQ A;  3K2A A;  1IC8 A;  3QAH A;  1H9G A;  3PJR A;  3GRH A;  3BPV A;  1VZ0 A;  4I98 B;  1GAQ A;  2IS6 A;  2RGV A;  1BA5 A;  2PX9 A;  4PFO A;  1PJ5 A;  1Q82 D;  1B72 B;  2K3P A;  3HJE A;  4PDK A;  4Y3O A;  1Z05 A;  4X8I A;  5B1B H;  2XAJ A;  2F5F A;  3GTO J;  1TQP A;  3NWT A;  3Q0W A;  1W0U A;  3Q9V A;  2CK3 A;  4F3Q A;  4C2U A;  3EUA A;  4G7W A;  4DK0 A;  1G7S A;  2M4K A;  3KLN A;  3H3V K;  2QMU A;  1DAB A;  5IY5 H;  2ELK A;  3K0L A;  2P6T A;  2JK3 A;  4EJV A;  2OBT A;  2F2E A;  4U7B A;  1GVH A;  1FSH A;  1EFR A;  2BM1 A;  2BM7 A;  2V9K A;  3CCJ I;  2UUZ A;  4YZ0 A;  3SZT A;  4E6K G;  3HKZ A;  2ZL7 A;  4QWQ A;  1KC8 D;  1R1V A;  4L9J A;  3A01 B;  3LNN A;  5LRR A;  4CDG A;  2P7C B;  1H8H A;  3S32 A;  1XB4 A;  3EUH A;  4IRH A;  3CCR B;  1FIA A;  2P0W A;  3OY9 A;  2VPR A;  2RNJ A;  3HRU A;  3V76 A;  1NDH A;  2CSO A;  3OZW A;  3H3U A;  4U9U A;  5LRS A;  1OCP A;  2P5L C;  5FD6 A;  3GFL A;  4U88 A;  5HS8 A;  2J5O A;  2VL8 A;  2O1D A;  4KN4 X;  3QWL A;  3NEU A;  4E7J A;  3ZC3 A;  3MZ8 A;  2DET A;  5EMN A;  1MGT A;  3CJR B;  1GR1 A;  1GXQ A;  3LSM A;  2F4M B;  3SJP A;  2L9N A;  3I59 B;  1TNS A;  3D5R C;  3SJM A;  2H1L A;  2KRF A;  3UW0 A;  4OZZ A;  2CU7 A;  1FOY A;  4C3I J;  3SHF A;  3AKZ A;  3LNQ A;  3MHP A;  4A0Y A;  2IPQ X;  1STZ A;  3VWB A;  1MMD A;  2E1M B;  3Q3S A;  4CYD A;  5DM7 F;  5KSW B;  3MMP A;  1JHF A;  2O6G E;  2YSR A;  4ZGN B;  2VN2 A;  3E5X A;  4P1V A;  1ZUN B;  1T98 A;  1QGA A;  1UST A;  4MLO A;  2NOG A;  1VQK B;  2KJC A;  1COW A;  2ZKZ A;  1K8F A;  4UUS A;  2XKO A;  4W97 A;  3KP3 A;  1XN7 A;  3BP8 A;  5HDG A;  5ILS A;  4MHG A;  5GAE J;  2EZI A;  3QSY A;  2QUF A;  4IRG A;  4RD4 A;  5E6T A;  5AIP A;  4BQN A;  1AOY A;  1QCX A;  1LEA A;  1O8F A;  5FRN A;  1XG1 A;  3DCF A;  2MA3 A;  3OIO A;  3ZMZ A;  3E6D A;  5IYR A;  5DCM A;  2DA4 A;  1SC7 A;  1O8M A;  2HXO A;  2P81 A;  3HOZ J;  1YRN A;  3WGH A;  3RYP A;  2UZK A;  4A6E A;  2OTJ I;  1IDY A;  1WZ2 A;  1WMR A;  3CCE B;  2QX3 A;  4E7I A;  3D5S C;  3OYI A;  4CIC A;  3FHN A;  1JNY A;  3OEH A;  2PQ8 A;  1XTA A;  4RLF A;  5ICE A;  3FPP A;  4X05 A;  4RB3 C;  1ZN2 A;  4PMH A;  1QH0 A;  4JP0 A;  1TQM A;  4AYB A;  1J5Y A;  2DT5 A;  3RIQ A;  5HNF A;  4PUS A;  1RC9 A;  1X1B A;  2VE8 A;  3MKL A;  4DNC A;  1TTT A;  4ZYD A;  2X1D A;  1FP1 D;  4JX6 A;  1JTX A;  2HYG D;  2WAF A;  2KP6 A;  2VT3 A;  3FF5 A;  4XIC A;  2A5W A;  3GME A;  4P3Y A;  1TWH J;  4AVZ A;  2QZ8 A;  2X0K A;  3W2V A;  3TP3 A;  3I4M J;  2E1N A;  1ELO A;  1PJ6 A;  2H1K A;  4UHT A;  4ESF A;  2EQR A;  3GTK J;  3DP7 A;  4GXO A;  1ZG1 A;  3EYI A;  1ODD A;  3I56 I;  1SKQ A;  2VYQ A;  2FF4 A;  1FMW A;  3HYI A;  2ZSI B;  4P1W A;  3CCL I;  4LB5 A;  1JA1 A;  4F93 B;  3IHU A;  5TJJ A;  2INV A;  1R4M B;  3I53 A;  1WI9 A;  4MQV A;  2WPD A;  5FLX K;  2Y0S N;  2PEX A;  4UV8 A;  2UWM A;  1KMH A;  3G6E I;  1I6H J;  4M1K A;  1YE9 A;  3BH6 B;  1BJZ A;  4TSF A;  2XB0 X;  1HOM A;  4LLN A;  1MZB A;  2EH3 A;  3FK7 A;  4I2O A;  2AXT C;  3EET A;  4G6T B;  1RZ4 A;  4EJT A;  2HVS A;  3BDD A;  1JXS A;  2ACJ A;  4QUZ A;  5ILV A;  2VQL A;  3HHH A;  3TDU C;  2E5N A;  4BQQ A;  2VBE A;  4YEI A;  2VJ4 A;  3AVT A;  3VMW A;  1YW8 A;  4P12 A;  2VBY A;  1GO2 A;  2COB A;  2PLY A;  1B8I A;  2JTV A;  1N25 A;  5CVJ A;  3HM5 A;  1W9X A;  1NJI D;  2WZP P;  3OSG A;  2AQF A;  4BBR J;  1XE1 A;  5E3O A;  1K83 J;  3HHG A;  4QVJ A;  2EIM H;  2XIG A;  5EG0 A;  2HCJ B;  1Q86 D;  1VQ5 I;  5E8G A;  1FBS A;  2CQK A;  1JHH A;  3BRO A;  2M5W A;  4M0L A;  1BW5 A;  4RD0 A;  3FZV A;  3C1D A;  2BEO A;  3B82 A;  2P4W A;  4RAF A;  4M4S A;  4HZF A;  3FXM A;  3PNV A;  2B0R A;  4D1Q A;  5JI6 A;  3L09 A;  1VTN C;  1IG7 A;  2DDB A;  1T2K A;  1B9M A;  2BSA A;  2RDP A;  3QFS A;  4GO1 A;  3ZQ7 A;  4KUM A;  5GV8 A;  3MEX A;  5DV5 A;  4KN7 X;  4CYC B;  3OYN A;  1H8E A;  1JKQ C;  5KCM A;  2BPO A;  2EZL A;  3UNG C;  2E36 A;  2E2J J;  2O0Y A;  1XGN A;  1VND A;  2ZJ2 A;  2MGQ A;  3BTI A;  2KZG A;  5J4Y A;  2IRF G;  2V7Q A;  3ZOB A;  1WJF A;  3SDB A;  1HDD C;  1BM9 A;  1KON A;  4R79 A;  2WAE A;  3LA2 A;  3OYL A;  4NK6 A;  2ZFW A;  4XRM A;  4KMF A;  1NRK A;  2ZME A;  2NOJ B;  3A35 A;  1UD8 A;  2O6W A;  1FOW A;  2ZZG A;  4M74 A;  2DCU A;  3F72 A;  3PFI A;  4NK8 A;  3DTI A;  4M73 A;  1TLL A;  1TUI A;  4QIW N;  1SEU A;  3GO5 A;  2V1D A;  3CB4 A;  2HOT A;  3Q3A A;  1Q1H A;  3OV8 A;  3BR6 A;  2X51 A;  5FKK A;  5FO5 A;  1UD2 A;  1MKM A;  4XOT A;  2DN0 A;  2LG4 A;  3BZ6 A;  5DD8 A;  2H27 A;  1FRN A;  1FY7 A;  3L2Q A;  1HVX A;  2WAQ A;  3KP7 A;  3A8J A;  4OMZ A;  3P26 A;  1CNE A;  3FMS A;  3BWG A;  1VQ9 B;  4B1R A;  4M6Y A;  1YJN B;  2Y2Z A;  4LG3 A;  1D0Z A;  4EMS A;  5LEK A;  1YHQ B;  3QFR A;  4B43 A;  1YTY A;  4DIQ A;  1X1D A;  4XLH A;  1PKV A;  2BM4 A;  2UXN A;  1O8D A;  3LSK A;  2GXA A;  3B8H A;  3CD6 B;  1SAN A;  3HUG A;  4GYG A;  1JRG A;  3V42 A;  1S3J A;  1I39 A;  3O2P E;  2MLG A;  4BUP A;  5K5Q A;  3HOT A;  1YIT I;  2ZC2 A;  1H89 C;  2PG4 A;  3B8Y A;  3R0J A;  2XGC A;  1DU6 A;  4A69 C;  4FCY A;  4LGW A;  4CSW A;  1Q1V A;  4S04 A;  1VF7 A;  2PJP A;  2F4O B;  2NPF A;  2PMH A;  1EH8 A;  3DPL C;  1NG6 A;  1Z7U A;  1D1C A;  3PSF A;  1U5T B;  3D0S A;  4RGU A;  3JSP A;  3R6J A;  1DBG A;  3DLL F;  4ETS A;  3EQO A;  4RM3 A;  1AA7 A;  3FM5 A;  1QHH D;  3H9Q A;  3MVP A;  4XN0 A;  1VQP I;  2VBX A;  3OJX A;  1OQY A;  1BMF A;  5E8I A;  1KK3 A;  4X07 A;  1H9T A;  4P25 A;  1TWF J;  4D7N A;  3PUF A;  2DFE A;  4RGR A;  3QPL A;  4XKW A;  2YUS A;  1W36 D;  3MFK A;  1H0M A;  4CCN A;  4HLX A;  1OR7 A;  3JSO A;  2DEU A;  1F36 A;  4QTR A;  2JA5 J;  3E5U A;  3KFW X;  1WOP A;  5TR9 A;  2NVQ J;  2JN6 A;  1KA8 A;  1ON2 A;  2ISY A;  3GCM A;  3VFZ A;  1FX0 A;  3NAW A;  1UJ8 A;  2DQR A;  1UMK A;  2L4M A;  5F0C A;  4F91 B;  1ZLK A;  1U8R A;  1IJW C;  4XLP F;  1KK0 A;  4BEH B;  3A1Y A;  3OOU A;  2DFF A;  4RA2 A;  3FIS A;  4A0Z A;  1KU9 A;  2FMY A;  3DF8 A;  1JI8 A;  2VJI A;  2CJJ A;  1I27 A;  4RCY A;  4BY1 J;  1TNT A;  1K78 A;  1ETX A;  4KT6 A;  5B3S H;  1R5B A;  5CPR B;  4W8T A;  1Z67 A;  1NK2 P;  3LQ6 A;  1MJ9 A;  1N05 A;  1D0X A;  3RTR A;  3KYL A;  1PUF A;  3PO2 J;  1YG2 A;  1IN8 A;  3V7S A;  2OK7 A;  2C4T A;  1ZRF A;  2DOE A;  1SD6 A;  4HQM A;  2V5I A;  4RAG A;  4TKO B;  2RN7 A;  3GYH X;  3CRZ A;  1SVM A;  2DO7 A;  3TL4 X;  2XRN A;  2QGG A;  1OCO H;  4L9T A;  2G0E A;  3H5A A;  2MFZ A;  4A0X A;  1E43 A;  2LNB A;  3TDZ C;  1O8E A;  3F8F A;  3B6A A;  3DU5 A;  4WXH A;  3FBI B;  2N8G A;  4Z6Y A;  4IRI A;  2AO9 A;  2EIJ H;  3CCM B;  2A07 F;  1K5C A;  4ABZ A;  2XNC A;  2OC6 A;  1ZR4 A;  1F20 A;  4UVC A;  5JVG F;  4ASN A;  4BYY A;  3GBG A;  3PA1 A;  2DOD A;  2ECB A;  3SEQ A;  2NST A;  2XZO A;  4P2N A;  3VR6 A;  5DNS A;  2FBI A;  4FX4 A;  1OB5 A;  4IXA A;  4OOS A;  1QGZ A;  3MN2 A;  4GQN A;  2BBY A;  5F64 A;  4LIT A;  2CQX A;  3EUK L;  1IN4 A;  1HST A;  5J3L A;  1IN7 A;  2R7S A;  5H59 A;  4PGH A;  1HKQ A;  2KKO A;  2FBH A;  1VQ4 B;  3F3X A;  1SD4 A;  5GPA A;  2KFD A;  4C3J J;  1PVE A;  3TKY A;  2QY1 A;  2M87 A;  2XPV A;  3SY2 A;  4C0S A;  1RKT A;  5JHU A;  2FNP A;  4M3G A;  2R5Z B;  1RQR A;  1Q7Y D;  2D1H A;  5F04 A;  3LFK A;  4LB6 B;  1A5J A;  1MBK A;  2BV3 A;  4Z06 A;  3IRR A;  1XGM A;  3H9J A;  4UUT A;  4IKF A;  3VO2 A;  4CA0 A;  2OA4 A;  2W25 A;  3PSZ A;  5IOY A;  2PI0 A;  2FBK A;  1OFE A;  2BM5 A;  1QGY A;  4J0Q A;  4WZK A;  2RRE A;  1ETO A;  3GVK A;  3AG2 H;  1O3Q A;  3R60 A;  4ZJZ A;  1EWY A;  5F1R A;  4DOZ A;  2VBU A;  3E20 A;  3IAS 2;  1ETW A;  3KEO A;  4EJO A;  3QE2 A;  2PJR B;  2DTZ A;  4KIG A;  3WBK A;  5CYV A;  4XLC A;  3M7G A;  1ORK A;  3DU6 A;  1J9I A;  1MDM B;  1KK1 A;  3CCJ B;  2KJB A;  4PC1 A;  1LEB A;  2Z6B D;  1IV6 A;  3IC7 A;  2EWE A;  2CND A;  1GQ8 A;  3JRF A;  4DJA A;  1MBH A;  2RQQ A;  3G3Z A;  1QO0 D;  1GDT A;  3QP5 A;  1ITY A;  2AHQ A;  4D9J A;  4KYW A;  2IBD A;  1F1Z A;  2UXX A;  2RC5 A;  2F5C A;  2A6H F;  2NVX J;  1FC3 A;  3KZY A;  3QFT A;  1QQI A;  1Z91 A;  1WTH D;  3X2Q H;  3PET A;  3P9K A;  1VQO I;  2EV5 A;  3WGG A;  2V79 A;  1EH7 A;  2ZZF A;  5DCF A;  3FXR A;  3K4L A;  1XB2 A;  3OWT A;  3JCU C;  4ZH4 F;  2ZCW A;  1YJ9 I;  3C7J A;  4UUV A;  1JKP C;  2QLZ A;  1YX2 A;  4JRA C;  5EZG A;  4HE6 A;  3DPU A;  4OWR B;  3QFC A;  5ICG A;  4WWV A;  3K4N A;  2O9L A;  4F55 A;  4HWV A;  2YPR A;  1FNC A;  2OF7 A;  1K7A A;  2EB7 A;  3AG3 H;  4UXN A;  3V7C A;  5H20 A;  3W6J B;  1Z6R A;  1HA3 A;  2K9M A;  2ZXW H;  3RPQ A;  5BPD A;  5CQE A;  1P4A A;  1Z3X A;  2W6I A;  3H5N A;  2CWE A;  3U21 A;  3BG5 A;  4A3K J;  3RZD J;  4HIZ A;  2PE3 A;  1HW1 A;  2L7M P;  2M4G A;  2HOS A;  3CCY A;  4L0Y B;  1S0U A;  4PGO A;  2V7W A;  1YJW B;  1BI0 A;  1N08 A;  3VO1 A;  2ZL5 A;  1J2X A;  3A02 A;  3HSF A;  4DYC A;  4E7K A;  1HZE A;  3MZH A;  3HB9 A;  3SFZ A;  3VB2 A;  4G7Z F;  2OTJ B;  3W5U A;  2LBF A;  3QU6 A;  3IKT A;  1BL0 A;  3QU3 A;  4LK0 F;  3PQJ A;  3PIO F;  2P3M A;  2M2E A;  1TW3 A;  2DA6 A;  1QA2 A;  5JHF A;  4GYI A;  3OYB A;  1Y0U A;  2KPM A;  4DW6 A;  2K4J A;  2M8E A;  2C5H A;  4ZYH A;  1KGS A;  1SM4 A;  4FK8 A;  1UHS A;  2LY9 A;  1EFC A;  1OPC A;  5FA6 A;  1QFY A;  4TMT A;  3HPG A;  2GJK A;  2PMZ N;  5M3F J;  2LF8 A;  1R36 A;  1UG0 A;  3IL2 A;  1R4N B;  3CLO A;  5DUI A;  3MKZ A;  4ZYA A;  1J59 A;  2VJJ A;  3TO9 A;  5B66 C;  5HLI A;  4G9Y A;  2XC7 A;  1RUO A;  2VBZ A;  3IV5 A;  1EXM A;  5GTH C;  3RPU D;  3N4M A;  1XCB A;  4XN3 A;  3W5H A;  5CVR A;  5HLH A;  2XAF A;  1S72 I;  2G7H A;  4M6V A;  3DFG A;  3MZY A;  1B8I B;  3I56 B;  2I8D A;  2NVT J;  1P4M A;  4H9G A;  4XD7 A;  3CCL B;  2DA7 A;  2D2W A;  3OIP A;  1LPQ A;  2P7V B;  1XQB A;  3SZG A;  3SKB A;  3HGG A;  5BPI A;  3G6E B;  3HTS B;  3M1C A;  4O5V A;  2VIX A;  1XGS A;  1JT6 A;  2JVG A;  3RDI A;  1P7I A;  4I84 A;  4XM3 A;  2B7E A;  4EM0 B;  4GGG A;  5C3E J;  3CCS I;  2V6E A;  1TC3 C;  5KAI C;  1ACI A;  4FT8 A;  2OU2 A;  2F1M A;  5LMZ A;  2JT1 A;  3IH2 A;  2IS2 A;  4OP7 A;  4A3G J;  4R71 A;  1D8T A;  3FXQ A;  5LGU A;  5DS9 A;  3RIR A;  1T39 A;  3OFN A;  3C3W A;  5JLV C;  2EFP A;  4ZGQ B;  2M9H A;  2BY2 A;  5E1W A;  1LE8 A;  1WJ5 A;  2FE3 A;  4NBQ A;  4BDY A;  2A61 A;  1KJZ A;  1OGJ A;  3LMW A;  4YCQ A;  3KP6 A;  3W2F A;  2Z8G A;  4BQA A;  2I10 A;  5JLX A;  1VQN I;  5J1R A;  4X0C A;  1EE6 A;  2JJ2 A;  3WG9 A;  1VQ5 B;  1N0U A;  1UG2 A;  2ZME B;  2F3L A;  3WG7 H;  4DYR A;  2NTP A;  1TWA J;  3ZPL A;  2XAG A;  1QVU A;  3OPO A;  1MMS A;  5K7F A;  4MYT A;  2VNH A;  5BQT A;  4A3L J;  5DSZ A;  3O3K A;  4NNJ A;  5HLT A;  3HRS A;  5DD4 A;  2C5B A;  1PJR A;  4PJ0 C;  1MJA A;  3WE3 A;  4V19 K;  2JIZ A;  2OUM A;  1S5L C;  3E6B A;  4LBZ A;  4WQM A;  3WNC A;  4N4O B;  1EJ9 A;  2DA1 A;  4PGG A;  1T6Z A;  4NB5 A;  3D1N I;  4NHJ A;  3H3Z A;  1P92 A;  1OGI A;  2HR3 A;  2QYU A;  2NSP A;  1W5S A;  4AUX A;  5CVV A;  2FOK A;  4OMY A;  1YIJ B;  3DEE A;  5KAF C;  1UHW A;  2JUC A;  2ESH A;  3CLQ A;  1OCC H;  4IZZ A;  1WKM A;  3TED A;  3NWS A;  2W00 A;  3BG9 A;  1ZGA A;  4MTD A;  3I58 A;  3WBJ A;  1T6Y A;  2C4U A;  1XDS A;  2LD5 A;  2OBR A;  2KL4 A;  5FRM A;  1V5V A;  4BU2 A;  1S6L A;  5K5O A;  2KIU A;  5EJC A;  3PA2 A;  5KVR A;  1J09 A;  4QFM A;  1KZL A;  3CC4 I;  2AS5 F;  4F7D A;  4BY7 J;  3MCA A;  1P6R A;  4OJO A;  2E5Z A;  2WB1 N;  3KP5 A;  5KK1 A;  2VQH A;  3VEP A;  2GXG A;  3OYH A;  2X53 S;  2QBY A;  1ZM2 A;  1SVL A;  1IJF A;  2VQC A;  3RKQ A;  3CXC B;  2W85 A;  1FMV A;  1VHO A;  3GVL A;  3JQP A;  2IA2 A;  3BCB A;  5IYB J;  4Z4W A;  1BX1 A;  1F9N A;  5IYD J;  2LF7 A;  4JMQ A;  1TYX A;  1W4M A;  3WTU C;  1REP C;  3ASO H;  4I0B A;  1ZAO A;  2BY3 A;  2KQR A;  2Z3Y A;  5EEH A;  1MD0 A;  5E3N A;  3ERE D;  3BY1 A;  3WND A;  3B02 A;  2BW3 A;  1ZH5 A;  3H1C A;  3SLN A;  2EPF A;  1YIT B;  1W0T A;  4BKX A;  1BX0 A;  4MXN A;  3F6O A;  1E3X A;  4KDP A;  5D4S A;  2DMP A;  2Q1Z B;  5LEJ A;  4NUB A;  4XLF A;  1A31 A;  4OIQ F;  2FJ1 A;  4E7S A;  2QQ8 A;  2IS1 A;  4W1U A;  3HRM A;  3CMY A;  1FBQ A;  2R7V A;  1VQP B;  2W7Z A;  2DER A;  2XF7 A;  3H9G A;  3ZQH A;  1Y8R B;  3BC8 A;  3ZZ0 A;  3I55 I;  2A5Y B;  2BVM A;  3MQ0 A;  3BR5 A;  1XPX A;  2R6H A;  3U2Q A;  3ZMS A;  3V8J A;  1VI0 A;  2QTZ A;  3AST A;  2CYY A;  1A04 A;  5CQG A;  1Y0Y A;  4BNC A;  4RGS A;  2JN9 A;  4ZDP A;  4U49 A;  2BHZ A;  5BNG A;  3OJW A;  2W1O A;  3M8J A;  1A6Q A;  1QFZ A;  2V4D A;  4OJ5 A;  1QX4 A;  4YEL A;  1YYV A;  3HL2 A;  4DNT B;  5K7H A;  1V5E A;  5AN9 A;  2OTL I;  2YR2 A;  2WR8 A;  3WOD F;  1D5Y A;  5L3B A;  4P3I A;  2ELJ A;  3ZR8 X;  2CRG A;  2GIV A;  3TGN A;  1G8X A;  3CO7 C;  1VLY A;  2ZNY A;  3S2H J;  1YW7 A;  1XSD A;  4OIP F;  1OB0 A;  1N77 A;  2A6T A;  5FO0 A;  4OJ6 A;  1XSV A;  3FMR A;  2QM3 A;  1GXP A;  5J6X A;  4Y7N J;  1KQS B;  1G3Y A;  1QGP A;  2V7V A;  3DBR B;  3SLD A;  1E17 A;  2IJL A;  2K3F A;  4EGZ A;  5L3E A;  4M3F A;  3HDD A;  3ONQ A;  1K6Y A;  1HXD A;  2ZXI A;  3Q0U A;  2HPI A;  2W82 A;  5J40 A;  1ETQ A;  5D8K B;  5L3F A;  3QP6 A;  5D6F A;  1ZR2 A;  2E1M C;  1NHC A;  1P9Q C;  1DP3 A;  1LFU P;  2NZM A;  2VKD A;  2VBT A;  1QRB A;  5CJ9 A;  3FDY A;  4N9H A;  3GTP J;  1FYM A;  5LHI A;  2E2H J;  2VNK A;  3AGQ A;  3RPU A;  3Q0V A;  3U6K A;  1PYV A;  4EW9 A;  3VNV A;  2JZY A;  2OCE A;  5IT9 Z;  1G7R A;  2K5C A;  2VJ5 A;  2QGU A;  4HX8 A;  2GM4 A;  4WXC A;  5GV7 A;  5M5X J;  2D3L A;  1M1E B;  2QTL A;  4G12 A;  3JQQ A;  1L3L A;  5LLQ A;  1F43 A;  1WXR A;  3S1R J;  1IUY A;  4GDF A;  5KNL A;  1WOR A;  2IGO A;  1D1N A;  4ZCI A;  5HS7 A;  3CO6 C;  4RDU A;  4ZTF A;  1XG2 A;  2ZNZ A;  3PFY A;  3H36 A;  1V3F A;  2DPU A;  1GUU A;  1R23 A;  4ZC3 A;  4HNT A;  1BN5 A;  4U0Y A;  1AIP A;  3P4G A;  2WZN A;  2AXL A;  1SD7 A;  1KU3 A;  1BW6 A;  3CP2 A;  3IP4 B;  4I02 A;  5ERI A;  2JSP A;  3OSF A;  4ZZD A;  1FNB A;  3ZIA A;  3CCV B;  4UB8 C;  1TYW A;  4A3F J;  4A3M J;  1RNL A;  5TV2 A;  4AIJ A;  2ETH A;  3ML3 A;  1OJL A;  5E1Z B;  4YG2 F;  3HRT A;  1BHE A;  1HSJ A;  1BBY A;  2IA1 A;  3SFI A;  1T8I A;  1GLN A;  3OYG A;  2CV1 A;  5IP7 J;  4F7Z A;  3WHC A;  2XT2 A;  1U3E M;  2O0W A;  1EP1 B;  1QZY A;  1VBL A;  3M3Y J;  5EGO A;  3D5L A;  1NH3 A;  2K27 A;  3WU1 B;  2F4I A;  2R5Y B;  5E18 F;  4W8R A;  3WU0 A;  1O8K A;  5E1X A;  2FEZ A;  4AYB N;  2BF4 A;  2HMA A;  3F6V A;  2BGI A;  2BOL A;  5IP6 A;  2KIS A;  1G59 A;  4N3G A;  4I99 C;  5J8C A;  1IO2 A;  3VMF A;  4HW0 A;  1YX3 A;  1UZC A;  2J7K A;  2LC2 A;  3FM3 A;  3T8R A;  2XOK A;  3IRQ A;  1CF7 B;  1SD5 A;  3S17 J;  2ZXJ A;  2QCO A;  2JVH A;  4PSX A;  4IHV A;  3OE7 A;  5J1U A;  2XTY A;  4W8S A;  2BGC A;  2BV6 A;  3HOS A;  4MNU A;  3T53 B;  4RD2 A;  4E7L A;  1UD6 A;  2RC4 A;  4EM1 A;  3KRG A;  1GV2 A;  1LFB A;  3LSJ A;  4PZJ A;  1B4A A;  2XF6 A;  1SFO J;  3P7N A;  2D74 A;  3K70 D;  4C3H J;  1E79 A;  4E0F A;  2QN6 A;  2BE5 F;  4WZL A;  2LDU A;  1VQO B;  4Y9U A;  2VC1 A;  3W6V A;  2MD5 A;  3CUO A;  2JA7 J;  2WA0 A;  1YJ9 B;  2PMD A;  1YS7 A;  1SFE A;  4LMY A;  2V7U A;  5M3M J;  4CXF A;  2MH9 A;  3DEW A;  3FKS A;  3E7L A;  4DBQ A;  2DOG A;  3JUR A;  3IH4 A;  4OZY A;  1WU8 A;  4Z03 A;  2WBM A;  1IN6 A;  3M8F A;  5FFX A;  2KIM A;  1BJA A;  2L5Q A;  5D5W B;  4RAY A;  4OIO F;  2ELH A;  3S15 J;  2V9V A;  1H42 A;  4IW3 B;  2MG4 A;  4LG0 A;  4A93 J;  1A36 A;  2V4J C;  1T6S A;  1VQ7 B;  4G7O F;  2WY8 Q;  4IVN A;  3F21 A;  3QQA A;  4F52 A;  2EIL H;  1HA8 A;  3HGY A;  2Z1D A;  1K28 D;  2W57 A;  5FGM A;  5FIU A;  4HNU A;  3GTJ J;  2QVO A;  3C2B A;  2QSG X;  3NRV A;  2DY1 A;  4PC7 A;  1Z21 A;  2DW4 A;  1FT9 A;  1I6X A;  1D3Y A;  4HX4 A;  3J81 K;  4HST A;  2K85 A;  1TZL A;  3ABU A;  5EEG A;  3SZP A;  2O0V A;  2CFO A;  4ITV A;  3CUQ B;  5FKL A;  3BQY A;  4IQ4 A;  4Q4Z F;  1KRH A;  3GQB A;  1A8P A;  2K02 A;  2V1U A;  3KP4 A;  2ME0 A;  3B6C A;  2L4A A;  5FB2 A;  3S1M J;  2RC6 A;  1QVF B;  2B9S A;  1G3S A;  5DYM A;  4HA8 A;  1B2R A;  4X7C A;  1RU4 A;  5K5R A;  3VDX A;  1LDK B;  4UZF A;  3ZPN A;  4FET A;  3W6K B;  4P5O A;  4B44 A;  2XSD C;  3LMM A;  3H92 A;  1ZRD A;  2HS5 A;  3KYC B;  2OCC H;  4OIR F;  4IQJ A;  3FXK A;  3I5U A;  2ZJP F;  5J1Y A;  2PIA A;  2YWH A;  4PC6 A;  3CTA A;  1K79 A;  2YWE A;  3GLL A;  3BTC A;  3S3N A;  4HG2 A;  2R7T A;  1S7O A;  2DCE A;  2E1C A;  4RD6 A;  1IAW A;  2F4N A;  4I76 A;  1TQI A;  3P9C A;  2KRH A;  4JK1 X;  3W2G A;  3J81 k;  1ZEL A;  3M07 A;  6PAX A;  3BTL A;  4G6Q A;  4OIN F;  3PIP F;  4ENJ A;  2KDZ A;  2XT4 A;  3I1F A;  1PUE E;  1JKR C;  2L9S A;  1LM1 A;  2KRC A;  2WAQ N;  1Z0X A;  1NBM A;  3OYA A;  4YAF A;  2L02 A;  2NVU B;  3GUD A;  4EM2 A;  5CVI A;  1ZRE A;  2HVQ A;  4IOA F;  1VJS A;  3I4P A;  3I71 A;  3KPH A;  3FXU A;  2WV0 A;  3ML6 A;  5D4R A;  4TT3 A;  4ENN A;  3GQA A;  2M34 A;  4EEF G;  5EDN A;  1GHC A;  3G1O A;  2H8R A;  3FWE A;  4DZJ A;  3WTX C;  4IOC F;  3LO8 A;  3L2U A;  1U5T C;  2P8T A;  3WY9 A;  2OV7 A;  3CCS B;  4M71 A;  3G1L A;  4HOB A;  2V9P A;  4I09 A;  3PUB A;  4XKC A;  2WY7 Q;  3MCZ A;  2L2O A;  3VNU A;  2O7O A;  3CES A;  3LOC A;  2L0K A;  1N8R D;  3GFJ A;  1WFX A;  1FZP B;  3A4C A;  4QPQ A;  3TO7 A;  3WWG A;  2KLO A;  4MO7 A;  5ICC A;  3LSG A;  3F8C A;  1K61 A;  3BQZ A;  5HLG A;  1L0O C;  2BGJ A;  1VQN B;  1S7E A;  2IS4 A;  3L2V A;  1ON1 A;  5D5U B;  2PMU A;  1HW5 A;  2DYS H;  5EEA A;  4Q48 A;  1E62 A;  1VQ8 I;  3E3V A;  2XF5 A;  5C4J J;  2VFP A;  3G1M A;  5DUK A;  4XLA A;  1OFC X;  1PJ7 A;  3ZXS A;  5DEQ A;  2IEK A;  3LAP A;  4TV7 A;  3DBH B;  2OBS A;  1MND A;  4UB6 C;  2YUH A;  2HQR A;  3CP8 A;  3U2R A;  2R7Q A;  1EZG A;  1S9H A;  4P9S A;  1I50 J;  5FD5 A;  2XGE A;  5JMC B;  2VE9 A;  3SZE A;  2GOX B;  4FXU A;  2QBY B;  4AIH A;  2Y75 A;  2OJE D;  2L9R A;  1R71 A;  5E3M A;  3BC9 A;  3DXJ F;  1NG7 A;  3I54 A;  3PL8 A;  2R3S A;  1BJK A;  3ZCO A;  3GSI A;  1O8J A;  2VBM A;  4J19 A;  3WQZ A;  4PCQ A;  3ZSC A;  3EQL F;  4EAT A;  1MBE A;  4NQW B;  3WTT C;  3H5R A;  1R22 A;  2LRE A;  2Q2E A;  2JSC A;  2LFB A;  4YZQ A;  3K4K A;  3R61 A;  3TO6 A;  5IYP A;  3BOQ A;  2O8X A;  1TYU A;  3AK5 A;  2STW A;  4WX9 A;  2X0L A;  5ED4 A;  1O57 A;  4FHT A;  3PUM A;  4R1H A;  1K73 D;  1DGW Y;  2V1N A;  3FMQ A;  3ZRG A;  3ASP A;  1T0F C;  2CS3 A;  1ZGW A;  2JPC A;  4WCG A;  5LFA A;  5E79 C;  4XKV A;  2XRO A;  4A5M A;  2RKH A;  1B6A A;  1ZRC A;  1LLZ A;  3CJQ B;  1QVT A;  1WJA A;  2NVY J;  2M0M A;  3QOP A;  4BL0 B;  1JJ6 C;  4LBW A;  5J35 A;  2JA6 J;  4FWT A;  4E7H A;  3CQZ J;  3WU2 C;  1R6R A;  3CDL A;  3K4B A;  4MYU A;  3BLY A;  2YX4 A;  2K40 A;  5FLM J;  3OYF A;  3JU4 A;  1QRY A;  5F6F A;  2D3N A;  3QRF F;  3GTM J;  2Q0O A;  4MTE A;  1TL8 A;  3PNT A;  2M5S A;  5BSY A;  3BG7 A;  2LMD A;  2LTP A;  5KHD A;  1BOA A;  1WWX A;  4B4C A;  4XRS G;  3AVX A;  1TSP A;  4V02 C;  1J0R A;  2GA1 A;  1TYV A;  2E1B A;  2DAO A;  4Y33 A;  3HG9 A;  3EUH C;  4A6D A;  1WP6 A;  3WNB A;  2PBI A;  5IYN A;  2E71 A;  2RVC A;  3DPT A;  3HC7 A;  4QHY A;  3RY8 A;  3KZI C;  1A6I A;  3GQ8 A;  1X0C A;  4L5I A;  4AD9 A;  1TWC J;  3AG4 H;  3ZQI A;  4QLC U;  1C0W A;  1EFU A;  4KMU X;  1LB2 A;  3W2I A;  2DJI A;  2IW5 A;  3JRB A;  4Z4Z A;  1B72 A;  3I55 B;  2DPD A;  2FX0 A;  3ROU A;  4RLZ A;  4TMZ A;  3CC2 B;  2HWV A;  2MLK A;  3OL4 A;  3TQN A;  2KMU A;  3J7A O;  3H9N A;  4P6Y A;  5F4O A;  3AVU A;  2GAU A;  1SMT A;  2VC0 A;  1TTY A;  2V6C A;  2QEX I;  1B9N A;  3RI4 A;  3F23 A;  2HYJ A;  2BVL A;  4IX7 A;  2E7W A;  2IGK A;  3KZZ A;  4URR A;  2K9S A;  3C2H A;  5D5X B;  1WPK A;  3P27 A;  2HXI A;  4ACB A;  1B59 A;  1BN8 A;  1KU2 A;  2OTL B;  4EQQ A;  2F5D A;  3OR1 C;  4P96 A;  1BPL A;  2X1C A;  2R7X A;  1I8D A;  5HDK A;  3A01 A;  2D1V A;  4H4K C;  3GTQ J;  3T51 B;  1WHU A;  4XLE A;  4RM2 A;  1HLV A;  1H80 A;  2VXD A;  2B0L A;  2QWW A;  3FPK A;  3QYE A;  1JJ8 C;  4BDZ A;  3DU1 X;  3E6C C;  2Y9Y A;  1QU3 A;  4WZE A;  4XLN F;  4AF7 A;  1VQK I;  1E0E A;  2BVN A;  1VQL I;  1ZAR A;  3B90 A;  2Z16 A;  2EFW A;  2XGJ A;  3NE5 B;  4ASU A;  1VF9 A;  2XSJ C;  1RUN A;  1G7C A;  1QHG A;  4G6D A;  1TLH B;  1IF1 A;  2MH2 A;  3BH4 A;  1XX5 A;  1FX7 A;  4ZDO A;  2C2W A;  2PFB A;  1I18 A;  3M8E A;  4M3E A;  4DYQ A;  2Y30 A;  4L5E A;  3CDH A;  1TT5 B;  4XOP A;  4UUS B;  3ZMT A;  1QUF A;  3TW7 A;  4I7H A;  3GEZ A;  2V7T A;  1H88 C;  3BJ6 A;  4G1V A;  5GAG J;  3BR0 A;  2R7U A;  2CC2 A;  4CO8 A;  3FIW A;  1YLO A;  3G05 A;  3JAM K;  1I3Q J;  1CNF A;  2YS9 A;  3VPR A;  4JQF A;  2ZL6 A;  2A3S A;  5DCM B;  1XFO A;  2G0Y A;  1YS6 A;  1YRN B;  2W7N A;  3K2Z A;  2ZBK A;  3K4J A;  1PP8 F;  2DOF A;  2EV6 A;  4N4N B;  4IJA A;  4PFP A;  1TW2 A;  2FA5 A;  2IOU G;  4A3I J;  4RDK A;  3VSV A;  1BOB A;  1YI2 I;  4LIV A;  1IRG A;  2QQA A;  4LK1 F;  1HKS A;  3LA3 A;  1U2R A;  1MMA A;  2VFN A;  4YEJ A;  1MMN A;  3JTH A;  4BHC A;  2CV2 A;  1O8H A;  3ERM A;  1DG1 G;  4G1B A;  1H85 A;  4XID A;  3WYA A;  2QKL B;  3ISP A;  2DFI A;  5F08 A;  1FNN A;  3TMO A;  3KX2 A;  4DK1 A;  1SFU A;  3BG3 A;  4RGX A;  1FDR A;  2I1L A;  3KL9 A;  1P2F A;  3L2W A;  2DYI A;  3I64 A;  2CUJ A;  3HOU J;  2NRA C;  2Z9O A;  1DPR A;  2VKH A;  1OOC A;  1USS A;  1KCC A;  3SEZ A;  2DBB A;  2JRM A;  3BJO A;  3U6B A;  3A2K A;  4F92 B;  5DS0 A;  4Q7J B;  2QKM B;  1OYW A;  4L5J A;  3OYC A;  1U6G A;  2XGD A;  1T08 B;  4HPQ A;  2CBX A;  2M30 A;  2DTR A;  2M1B A;  1FOK A;  4XBF A;  4BHP A;  1PLU A;  2L9V A;  2BX6 A;  3LSH A;  3E0J B;  4B48 A;  4KIC A;  4N3N A;  1P7J A;  1LFP A;  4XMY A;  1KD1 D;  1DPU A;  4OAY A;  5FLX Z;  1E3Z A;  3B78 A;  3SYJ A;  1R49 A;  2XPW A;  1YFH A;  3HOY J;  1MSF C;  2CFX A;  4P6V F;  2Z2S B;  1S7A A;  3DWL E;  1QUE A;  3AL0 B;  2GXB A;  4AC9 A;  4FE7 A;  4HYE A;  3ABM H;  4OOV A;  1Z1D A;  3WTV C;  4RCZ A;  1RMG A;  1OGO X;  2M7A A;  3A1P A;  4CCL A;  5JLW A;  5A8A A;  4KT5 C;  4JX4 A;  2P5V A;  1S4M A;  1O7F A;  2M7B A;  2KHM A;  3V8L A;  5D5V B;  3GX4 X;  2KZV A;  1FSE A;  3W2H A;  3B73 A;  5EG0 B;  2ZME C;  3J81 Z;  1MMG A;  1UB9 A;  1B1B A;  4YFN F;  2ZFU A;  3CME I;  2Z99 A;  4IHY A;  4U7D A;  2FVG A;  4B4D A;  3ZN0 A;  2DI3 A;  2RNG A;  4ESJ A;  2ZO4 A;  1VQM I;  3R6S A;  3MKW B;  4X7E A;  4NDL A;  1ENH A;  1O4X A;  4P9U A;  3E5Q A;  5EYR A;  4BAY A;  2HPM A;  4W8Q A;  5J4V A;  4RBO A;  5HS9 A;  2E2I J;  5CLS A;  3RQI A;  4IHT A;  2GK7 A;  1XCV A;  1NB0 A;  1GVD A;  3HXL A;  3OS1 A;  1O8L A;  5GP9 A;  2BXZ A;  1T6X A;  2EV0 A;  1RR8 C;  3AVY A;  2JJ7 A;  2K86 A;  1UD5 A;  2C78 A;  1AWC A;  2OPT A;  2PN6 A;  5JBQ A;  1SFK A;  1YO5 C;  1ETK A;  4C30 A;  2JQ7 A;  4P22 A;  4CUG A;  1RRJ A;  3SYT A;  1UHM A;  3LAJ A;  3CDI A;  3RJP A;  3OEE A;  1WRJ A;  2MC4 A;  4ROX A;  3ZBU A;  2W48 A;  1A35 A;  4CYC A;  1VHE A;  3QPS A;  3VYS B;  4J00 A;  3K1M A;  4D0P A;  4XSZ F;  2LKS A;  2TCT A;  1N78 A;  1ETY A;  4DNR B;  3OW7 A;  2EFN A;  2DK5 A;  2AHO A;  1Z77 A;  1YX5 A;  1QA6 A;  5A2Q K;  2V7F A;  1X1A A;  2GZW A;  1W7P D;  1YIO A;  2LRD A;  1WPC A;  1CQT A;  1PDN C;  2VKE A;  4UV9 A;  4BBS J;  3I9V 2;  3DLA A;  2EFG A;  5A88 A;  1X4P A;  4II3 A;  1O3R A;  2XTX A;  2LZJ A;  1IN5 A;  1OCT C;  2DLL A;  2HQA A;  4S05 A;  3OYE A;  2BM0 A;  2FD5 A;  4Z4S A;  3WTS C;  3HBL A;  3I0T A;  5D6E A;  3S3M A;  2YWF A;  2ODL A;  3BZK A;  3K9T A;  1GV5 A;  5ICF A;  1K6O A;  2UVE A;  3EYY A;  2GIZ A;  5A89 A;  3SDG A;  5THX A;  2OD5 A;  1WH7 A;  2P6S A;  2L7K A;  1W0J A;  3JTG A;  4Y9R A;  1MBG A;  1R5H A;  3HUG B;  4GRI A;  4G7X A;  3JRI A;  2FSW A;  4MQ9 F;  3GIR A;  2ZSH B;  3RCO A;  4II2 A;  4MGR A;  1LLW A;  3MMY B;  4HF0 A;  2IQ7 A;  3H94 A;  2LKP A;  9ANT A;  4AM3 A;  3KYD B;  2JDI A;  4YFO A;  4PJN A;  2VBW A;  2M8G X;  5HKK A;  4DBR A;  3HSR A;  3TW6 A;  4A5N A;  4L18 B;  1FP2 A;  4A2U A;  1UEL B;  3FKJ A;  5ILU A;  1WQ2 A;  5IOZ A;  3ZZU A;  3VSU A;  2VFM A;  2JUG A;  2BZT A;  3LSI A;  4CH7 A;  1ZGJ A;  4B47 A;  3BCA A;  5DTD A;  1Y8Q B;  2Q6I A;  4YFK F;  3OKX A;  3TOA A;  1Y39 A;  1TP4 A;  4EGY A;  5BMZ A;  3O8H A;  1MH3 A;  1RQP A;  4EJW A;  3HZJ A;  1EA0 A;  1F60 A;  4NC8 A;  1F4K A;  4I01 A;  4U0W A;  2BMW A;  3JQR A;  2A68 F;  3ZQC A;  3BR2 A;  3WTW C;  1DUX C;  1W87 A;  2YU3 A;  4KFC A;  4B3G A;  3UR3 C;  4GFB A;  3RKY A;  1VQ8 B;  1Y6I A;  2EWN A;  3M1E A;  1E3H A;  5LHG A;  2XPU A;  2PLF A;  3SJZ A;  3S2D J;  5CVU A;  3ELK A;  4HAM A;  4X1E A;  3S3O A;  2CG4 A;  5BOX A;  1WDT A;  2LOO A;  1H8A C;  1U0J A;  3OIQ A;  1W5C C;  2L54 A;  5E3L A;  1S8N A;  2DJN A;  3LSP A;  1K78 B;  2GOM A;  4KNY A;  1FTT A;  4P9F A;  4CCO A;  2DT7 B;  4HLY A;  5FO1 A;  2O17 A;  1PUF B;  1Y0N A;  2E34 A;  4BEH A;  4HBL A;  4D5F A;  1R1T A;  3OS0 A;  2E60 A;  1Y0R A;  2XAU A;  4RLQ A;  3S93 A;  5HZB A;  2LKX A;  1O8G A;  2NV4 A;  2M0C A;  2W6J A;  2XND A;  2XEX A;  4JYK A;  2OK8 A;  2W84 A;  2XDV A;  2NT9 A;  1OYY A;  4YZA A;  4IF4 A;  1NHA A;  3ZN1 A;  2FML A;  2Q6K A;  2WYR A;  2GWR A;  1UAA A;  3E6M A;  1Z7L A;  4RD1 A;  1FBU A;  1E1Q A;  1T5E A;  2QA4 I;  3C2G A;  3RSN A;  1IXR C;  1RR7 A;  3HKZ N;  3JRD A;  4L8J A;  5L46 A;  1J7K A;  2QQB A;  3T5X A;  4XL9 A;  2LYC A;  1GAW A;  2H8W A;  3T56 B;  4RS8 A;  2XVC A;  3OOC A;  3PSI A;  3Q6R A;  3KE2 A;  5C1E A;  5EZH A;  2NS0 A;  4AID A;  4C2M J;  4WWC A;  5TRD A;  4RJL A;  2JRT A;  5IYQ A;  4YRV A;  4YII A;  3FKI J;  1T38 A;  2GPJ A;  2ZB9 A;  1JJ2 B;  1O3S A;  1T0F A;  2D9R A;  1X58 A;  4OJP A;  3VST A;  2Z33 A;  3CCU I;  2R7W A;  2R7R A;  2VPL A;  3A8K A;  3ZPP A;  4M2L A;  3J80 K;  3QPH A;  2NS7 A;  1JUS A;  2VNJ A;  3ZQF A;  3T9G A;  3L2C A;  1DGR M;  2ICW G;  2EIX A;  2NTQ A;  2ISZ A;  2O5R A;  2LH9 A;  2VLA A;  2JMW A;  1RWR A;  4LLG F;  5AMV A;  4RB2 C;  1R5N A;  4XKB A;  4MIM A;  2QZA A;  5FFZ A;  2R5Z A;  5L3C A;  4A12 A;  1GT0 C;  2GJR A;  1FYK A;  3PO3 J;  1NB9 A;  4WXD A;  1T95 A;  1E3P A;  2ID3 A;  2LY2 A;  1YQA A;  2B63 J;  2FQ4 A;  5LHH A;  3DKW A;  1D1A A;  5BS6 A;  3W2E A;  3LWF A;  4LLL A;  2R7D A;  3DQV C;  2V7X A;  5H5J A;  2VBK A;  3OR2 C;  3JRC A;  4YAU A;  4IHS A;  4BAC A;  4TMW A;  1RES A;  4JX5 A;  5B6I A;  1R5G A;  3TBI A;  3SXY A;  1BR1 A;  3COA C;  1R00 A;  2QEX B;  1V55 H;  3Q5F A;  3DV8 A;  1JT0 A;  4YDT A;  2K9L A;  1G4D A;  3BQJ A;  3E1Y E;  4HDU A;  1I1G A;  5L3D A;  2H6B A;  1O3T A;  5C44 J;  1QA1 A;  2K9Q A;  3OMY A;  1FWZ A;  2CUZ A;  4UZU A;  1WJD A;  2DU9 A;  1KK2 A;  3J7Y J;  3CMA I;  4BJ6 C;  5C1C A;  2PJR A;  2H6C A;  4FQG A;  3VSK A;  2ESN A;  4QVA A;  1OFL A;  3IAM 2;  2A6E F;  2MSY A;  3SQN A;  1MDM A;  4AC0 A;  3ABL H;  2BSP A;  3ZMD A;  2QF7 A;  3K1P A;  3LA7 A;  3G2B A;  3LQR A;  4YHB A;  3FXL A;  4IL6 C;  4HE5 A;  3W5V A;  3VYT B;  4YC5 A;  1XMX A;  1CLW A;  2BM6 A;  1D2E A;  1LQ1 A;  1LDJ A;  3RZO J;  2HOE A;  3N97 A;  3G4S I;  2VAS A;  3W3C A;  2K9N A;  1VQL B;  1XS9 A;  2CMP A;  1AHD P;  1W7P A;  1KQ8 A;  4BH9 A;  2XV4 S;  3OYJ A;  4EV0 A;  4Z4V A;  1HCR A;  3S1N J;  1GVJ A;  4O3M A;  2D45 A;  3JAM Z;  2HKO A;  2M3A A;  4E7Z A;  1RIO H;  4KIS A;  2X3U A;  3ASQ A;  3ZZT A;  1YJW I;  3H09 A;  2WWY A;  4G94 A;  2EBI A;  1VFC A;  1P4X A;  2AQE A;  3BPX A;  1HG8 A;  4N9I A;  2X48 A;  4H0E A;  4Y4R A;  2ZBV A;  4X7D A;  1UFM A;  3WXM A;  2GBY A;  5HNH A;  2V26 A;  1ZLJ A;  3BR1 A;  2Z5U A;  2ME6 A;  1MBJ A;  3BTJ A;  1OCR H;  5FKM A;  4BXF A;  1SKY B;  1JTY A;  1WI3 A;  1Y56 A;  3PUN A;  3MWM A;  1W36 C;  2L7Z A;  2DOA A;  3CJT B;  1BIB A;  1I3A A;  3F9K A;  3KET A;  1LNW A;  5L3G A;  1DP7 P;  2LR8 A;  1W0K A;  2EFO A;  3ZMV A;  2E35 A;  4IPA A;  1D5V A;  2XAQ A;  3ONY A;  3CUQ C;  1EFT A;  3AAF A;  2LBF B;  1KYZ A;  1PE9 A;  1LDD A;  3N90 A;  3ZBT A;  1M1K D;  4U4B A;  5HDN A;  2CV0 A;  1BLI A;  1PXZ A;  1D8K A;  4E70 A;  3L9F A;  2B5O A;  2O04 A;  5B1A H;  4Y7C A;  1LVK A;  3CC7 I;  2ZTG A;  1YI2 B;  3H35 A;  2QEN A;  5FKO A;  1W2B B;  4RMN A;  4HF2 A;  1E3O C;  1Q81 D;  5H6R A;  1BC7 C;  2IAI A;  3GF2 A;  2OBP A;  2KIQ A;  3JR9 A;  2HEO A;  1QVG B;  2XTW A;  2ZBU A;  4AVP A;  2BN4 A;  1MH4 A;  1QZZ A;  2VNI A;  3JRH A;  2HDD A;  1Z3Y A;  2FXA A;  2NNY A;  2GQQ A;  4XON A;  3VYU B;  2Y48 A;  3WTY C;  4FTH A;  1IRZ A;  2EZK A;  2XGX A;  3RKX A;  2JA8 J;  1Q9S A;  2QSH X;  3FY3 A;  2GJP A;  4S0H B;  3BR3 A;  1FND A;  4XSX F;  4PC3 A;  2VOD A;  4B3F X;  5LD2 C;  4AWX B;  2BHY A;  4V2F A;  2OYN A;  1O8I A;  3PVD A;  2VKV A;  3TH0 A;  2ECC A;  1FIP A;  3OS2 A;  2E1R A;  2Y69 H;  2Y0S A;  5E20 A;  3W2A A;  5FKN A;  4E4H A;  5J47 A;  2FRH A;  1HKT A;  3BY2 A;  2MC3 A;  4LOC A;  4TMV A;  2EA4 A;  5TIS C;  3P9I A;  5HOO A;  3J7A Y;  5HXB A;  4LIU A;  2XRL A;  1RPW A;  4PAB A;  3RKW A;  1SAU A;  3BH7 B;  1TBX A;  1AKH A;  3GQ9 A;  4CCJ A;  4BJT A;  3L00 A;  1J9Z A;  1GJR A;  1S72 B;  1S29 A;  4YAL A;  3F8B A;  2ZJQ F;  2X1E A;  2STT A;  3ONU A;  1IA5 A;  1LE8 B;  2R0Q C;  4NC6 A;  3TOB A;  2NNN A;  1KTW A;  4HQE A;  1R58 A;  4FIS A;  1G2H A; 
#chains in the Genus database with same CATH homology
 1BPL A;  2X1C A;  1JTA A;  2R7X A;  1H8H A;  4CZC A;  1WJ5 A;  3S32 A;  4BDY A;  1I8D A;  3EPZ A;  3LMW A;  4H4K C;  3T51 B;  3LFU A;  4XLE A;  4RM2 A;  4C9Y A;  2P0W A;  1H80 A;  2VXD A;  3OY9 A;  2Z8G A;  3QYE A;  1EE6 A;  5CDF A;  4BDZ A;  2JJ2 A;  3K6G A;  1QU3 A;  2NTP A;  2X6Y A;  2VL8 A;  3OPO A;  1E0E A;  2O1D A;  1V5F A;  3B90 A;  4E7J A;  2Z16 A;  3CJR B;  2XGJ A;  3NE5 B;  3LSM A;  4ASU A;  2L9N A;  2XSJ C;  3D5R C;  1QHG A;  2ZXH A;  4NNJ A;  5HLT A;  2CH0 A;  3UW0 A;  4OZZ A;  1PJR A;  3BH4 A;  3AKZ A;  4KKU A;  4ZDO A;  2JIZ A;  4BE2 A;  2OUM A;  1I18 A;  3VWB A;  1MMD A;  2E1M B;  4N4O B;  4ZDL A;  2IGM A;  2KDO A;  4XOP A;  3EQN A;  4MLO A;  2NSP A;  2KVO A;  1COW A;  2DT6 A;  2R7U A;  3DEE A;  3G05 A;  4IZZ A;  3NWS A;  4PSW A;  2W00 A;  4JQF A;  1QCX A;  4BQN A;  2CW8 A;  3MD2 A;  1O8F A;  3FBN B;  5FRN A;  2W7N A;  3K4J A;  2KL4 A;  5FRM A;  4BU2 A;  4N4N B;  1O8M A;  4PFP A;  4ANJ A;  1J09 A;  2IGN A;  2F43 A;  1KZL A;  4KKS A;  2QX3 A;  4OJO A;  2E5Z A;  4AU7 A;  2X53 S;  1WMR A;  2VQH A;  3OYK A;  1BOB A;  3D5S C;  3OYH A;  4LIV A;  3FHN A;  3KEY A;  4PK4 A;  3OYI A;  4E7I A;  2VQC A;  4BJ5 C;  3OEH A;  1MMA A;  4RLF A;  4YEJ A;  3FPP A;  1FMV A;  1MMN A;  2CV2 A;  3GVL A;  1O8H A;  1DBO A;  3BCB A;  4PMH A;  2BW3 B;  4AYB A;  4JMQ A;  5HNF A;  4PUS A;  1X1B A;  4QPO A;  2QKL B;  2KQR A;  3TMO A;  3KX2 A;  4DK1 A;  2BW3 A;  2X1D A;  2WAF A;  2KP6 A;  4OAZ A;  3L2W A;  2CUJ A;  2A5W A;  4MXN A;  4OJL A;  4JOM A;  1E3X A;  1AIR A;  2VKH A;  4AVZ A;  1V0E A;  1OOC A;  1KCC A;  1BR2 A;  2IXS A;  3SEZ A;  3A2K A;  4F92 B;  2Q1Z B;  3W2V A;  3ZGK A;  2QKM B;  3OYC A;  4NUB A;  4XLF A;  1UD4 A;  4HPQ A;  4E7S A;  2IS1 A;  2HVR A;  2R7V A;  4YXW A;  3GVJ A;  2VXZ A;  1PLU A;  1FMW A;  2ZSI B;  2XF7 A;  4P1W A;  3K10 A;  3H9G A;  4F93 B;  3LSH A;  3E0J B;  4B48 A;  1V0F A;  2INV A;  2WPD A;  3BC8 A;  1LFP A;  4XMY A;  1EA3 A;  4OAY A;  1E3Z A;  2BVM A;  2UWM A;  3SUC A;  1KMH A;  1YE9 A;  3BG6 A;  1N75 A;  2Z2S B;  5CQG A;  4TSF A;  3DWL E;  3AL0 B;  4PJL A;  4ZDP A;  4G6T B;  4U49 A;  2X85 A;  3DTE A;  2W1O A;  2HVS A;  2NTB A;  3M8J A;  3E1S A;  1RMG A;  2V4D A;  4OJ5 A;  1OGO X;  4YEL A;  3HAG A;  2M7A A;  2VQL A;  3HL2 A;  4CCL A;  4DNT B;  2PYH A;  1V5E A;  2E5N A;  5FRO A;  4BQQ A;  2VBE A;  2VJ4 A;  3VMW A;  2M7B A;  2ELJ A;  3ZR8 X;  2KHM A;  2KZV A;  1G8X A;  1W9X A;  1VLY A;  2WZP P;  1MMG A;  2ZFU A;  2AQF A;  1OB0 A;  4G6I A;  2UV1 A;  2A6T A;  1N77 A;  4OJ6 A;  2RNG A;  2VB6 A;  2W4S A;  3MKW B;  3BCF A;  3PNY A;  3K4M A;  2HPM A;  4W8R A;  4B3X A;  4W8Q A;  4MR0 A;  3ONQ A;  1K6Y A;  2ZXI A;  2GK7 A;  3HXL A;  2HPI A;  2W82 A;  3PNV A;  3OS1 A;  4D1Q A;  1O8L A;  1NHC A;  2E1M C;  1P9Q C;  1DP3 A;  4HRI A;  2VKD A;  2NZM A;  1UD5 A;  1SFK A;  4BE0 A;  3FDY A;  4C30 A;  4P22 A;  1H8E A;  4CUG A;  3OYN A;  1SKY B;  5KCM A;  4EW9 A;  3SYT A;  1PYV A;  3UNG C;  1WJC A;  3OEE A;  2MC4 A;  2K5C A;  2VJ5 A;  4XR6 A;  4FAS D;  2MYS A;  2V7Q A;  2R9V A;  4CCK A;  1WJF A;  2D3L A;  3SDB A;  3VYS B;  4J00 A;  1KON A;  2V31 A;  4R79 A;  2WAE A;  3OYL A;  1N78 A;  4DNR B;  4NK6 A;  3A35 A;  1NRK A;  2NOJ B;  3OW7 A;  5TGT A;  1UD8 A;  5KNL A;  4X0G A;  2ZZG A;  1YX5 A;  2HNH A;  2IGO A;  2V7F A;  1X1A A;  2LRD A;  4NK8 A;  3DTI A;  4ZTF A;  1WPC A;  1XG2 A;  3PFY A;  4ZC3 A;  3AFH A;  4HNT A;  2DXI A;  4BE1 A;  3I9V 2;  3DLA A;  1X4P A;  3CP2 A;  4II3 A;  3IP4 B;  5CKT A;  1X19 A;  2LZJ A;  2QE7 A;  2JSP A;  2HQA A;  3ZIA A;  3OYE A;  2X51 A;  1UD2 A;  2GK6 A;  3VMV A;  4Z1M A;  4XOT A;  2LG4 A;  4DGW B;  3S3M A;  1CZF A;  1BHE A;  2ODL A;  1HVX A;  3L2Q A;  2UVE A;  2WAQ A;  3IUO A;  2JJ1 A;  3A3B A;  1GLN A;  3OYG A;  2JA2 A;  2CV1 A;  1IRX A;  2L7K A;  1W0J A;  4NC7 A;  2O0W A;  4LG3 A;  1D0Z A;  1VBL A;  3HUG B;  3D5L A;  4GRI A;  4B43 A;  4G7X A;  4DIQ A;  1IDJ A;  1X1D A;  2F4I A;  2ZSH B;  4XLH A;  4II2 A;  3RCO A;  1PKV A;  1O88 A;  1O8D A;  3LSK A;  1O8K A;  3LL7 A;  1ERD A;  3MMY B;  1JRG A;  5DN6 A;  3V42 A;  2IQ7 A;  2BOL A;  3H94 A;  2UVF A;  4BUP A;  1G59 A;  3HOT A;  3QYB A;  4HEA 2;  2JDI A;  3B8Y A;  1YX3 A;  4PJN A;  3S8P A;  2LC2 A;  4BQO A;  3B4N A;  4CSW A;  1VF7 A;  2XOK A;  5HKK A;  4BGD A;  4DBR A;  3W2W A;  3DPL C;  1NG6 A;  1DBG A;  1D1C A;  3PSF A;  4PSX A;  2JVH A;  3OE7 A;  1OGM X;  4W8S A;  1UEL B;  2X6X A;  3FKJ A;  3VSU A;  3HOS A;  4RM3 A;  2JUG A;  4CH7 A;  3LSI A;  3T53 B;  3EQO A;  3MKY B;  4B47 A;  1AA7 A;  3BCA A;  1QHH D;  3H9Q A;  4XN0 A;  3VYR B;  4E7L A;  1UD6 A;  2DIE A;  1BMF A;  3AL0 C;  3KRG A;  3N05 A;  2XZP A;  4HSR A;  4NC8 A;  2XF6 A;  5IK2 A;  3RQ4 A;  3K70 D;  1E79 A;  4E0F A;  3OL3 A;  1W36 D;  4XKW A;  4B3G A;  3UR3 C;  4CCN A;  1BR4 A;  3K4C A;  2WA0 A;  1Y6I A;  2QXZ A;  2HZD A;  1FX0 A;  2W6I A;  3S3O A;  2HDW A;  2ZTN A;  4Z05 A;  2LOO A;  2WJY A;  3FKS A;  4DBQ A;  4F91 B;  3JUR A;  3QOD A;  1U0J A;  3OIQ A;  4OZY A;  4Z03 A;  4BEH B;  2WBM A;  3A1Y A;  2GOM A;  3OOU A;  2O17 A;  4CCO A;  2DT7 B;  4PJM A;  2ZZE A;  1JI8 A;  2VJI A;  2L5Q A;  4KKT A;  4BEH A;  4KT6 A;  4W8T A;  3OS0 A;  5CPR B;  2E60 A;  1MNE A;  2XAU A;  4RLQ A;  1D0X A;  2R4G A;  3RTR A;  3S93 A;  3KYL A;  1O8G A;  2W6J A;  2V4J C;  2XND A;  1D0Y A;  2R7O A;  2XDV A;  2NT9 A;  4YZA A;  3L2R A;  1IDK A;  4CCM A;  4C2L A;  2WY8 Q;  4TKO B;  1UAA A;  1HA8 A;  1Z7L A;  4F52 A;  2FUG 2;  3TL4 X;  3CF2 A;  2Z1D A;  3HPH A;  1E1Q A;  1K28 D;  3H5A A;  3C2G A;  2MFZ A;  3RSN A;  1E43 A;  1T5E A;  4HNU A;  2WJV A;  4L8J A;  2PYG A;  1O8E A;  4XL9 A;  3DU5 A;  1Z21 A;  2LYC A;  3FBI B;  4HST A;  4BS9 A;  1TZL A;  3VSL A;  3T56 B;  2O0V A;  2X3H A;  1V5G A;  2CFO A;  4ITV A;  1K5C A;  3OOC A;  2OC6 A;  4IQ4 A;  3PSI A;  4KJZ A;  1QJV A;  3GQB A;  3GBG A;  1D1B A;  2LY1 A;  5C1E A;  2NST A;  3SEQ A;  2XZO A;  3VR6 A;  3VSV A;  4YRV A;  1RU4 A;  2INU A;  3VDX A;  1LDK B;  3OAA A;  4GQN A;  3ZPN A;  4FET A;  4P5O A;  3VST A;  4OJP A;  4B44 A;  2X6W A;  3LMM A;  4LIT A;  2PMZ A;  3EUK L;  2R7W A;  2R7S A;  1MAB A;  2R7R A;  2VPL A;  2WSS A;  3ZPP A;  4IQJ A;  3T9G A;  4ZTJ A;  1KCD A;  1DGR M;  2NTQ A;  3ZQQ A;  3S3N A;  2QY1 A;  4HG2 A;  2R7T A;  2DCE A;  2O5R A;  4C2T A;  2LH9 A;  2KRH A;  2VLA A;  2XZL A;  1RWR A;  1ZEL A;  4Z06 A;  3A3G A;  3H9J A;  5AMV A;  4XKB A;  2X8K A;  4IKF A;  1IB4 A;  2GJR A;  4U87 A;  4CA0 A;  2L9S A;  2KRC A;  1T95 A;  1NBM A;  3OYA A;  2LY2 A;  2MAB A;  1D1A A;  2HVQ A;  2VBK A;  3DKY A;  3DQV C;  1VJS A;  2RRE A;  3GVK A;  1OLT A;  3OR2 C;  2F6C A;  4BAC A;  4ZJZ A;  4TT3 A;  3GQA A;  3TBI A;  1DQU A;  4XOR A;  1BR1 A;  4DOZ A;  3IAS 2;  2K9L A;  2PJR B;  3L2U A;  3OMY A;  2CUZ A;  2OV7 A;  4XLC A;  1WJD A;  4UZU A;  3DU6 A;  3OYD A;  3DTK A;  3PUB A;  4XKC A;  4BJ6 C;  2PJR A;  2WY7 Q;  2Z6B D;  5C1C A;  2L2O A;  1OFL A;  1MW7 A;  3VSK A;  2EWE A;  3CES A;  3IAM 2;  1GQ8 A;  4DJA A;  2ZZQ A;  4XNF A;  3KEW A;  3H0D A;  1OR7 C;  2RQQ A;  2MD0 A;  2BSP A;  1WFX A;  3G2B A;  3A4C A;  4QPQ A;  3WWG A;  2WAD A;  2KLO A;  4D9J A;  3LSG A;  3VYT B;  2HLD A;  3GQ7 A;  2IS4 A;  1WTH D;  3OYM A;  3L2V A;  2VAS A;  2ZZF A;  3W3C A;  2HU9 A;  3K4L A;  3CMM A;  2XF5 A;  2CMP A;  3OWT A;  1OFM A;  3OYJ A;  4XLA A;  3ZXS A;  2M3A A;  1MND A;  3DPU A;  4E7Z A;  4KIS A;  4OWR B;  3CP8 A;  1WJB A;  1X4O A;  2F5V A;  2R7Q A;  3CZ6 A;  1S9H A;  3QOE A;  3K4N A;  2AQE A;  1HG8 A;  4F55 A;  3I3L A;  2GOX B;  4XQF A;  4FXU A;  4HWV A;  4Y4R A;  5HNH A;  2V26 A;  2K9M A;  1OHH A;  3BC9 A;  2CW7 A;  5CQE A;  1Z3X A;  1NG7 A;  4BXF A;  4KIT B;  3PL8 A;  1WJE A;  1Y56 A;  3H5N A;  3K70 C;  2Q2E B;  3ZCO A;  3U21 A;  3DKX A;  1W36 C;  1O8J A;  3WQZ A;  2VBM A;  2DOA A;  3ZSC A;  4HIZ A;  3DDY A;  4EAT A;  3F9K A;  4NQW B;  2M4G A;  3H5R A;  1TT0 A;  2LRE A;  1W0K A;  4YZQ A;  3K4K A;  2NT6 A;  3BCD A;  4PJJ A;  4J01 A;  4E7K A;  2LBF B;  1PE9 A;  4U4B A;  1HZE A;  1DGW Y;  2V1N A;  2WB1 A;  3ZRG A;  1T0F C;  2CS3 A;  2CV0 A;  1BLI A;  5LFA A;  1PXZ A;  4XKV A;  2PEC A;  1E1R A;  2LBF A;  5FL7 A;  2O04 A;  1LVK A;  2ZTG A;  3H35 A;  4RMN A;  3CJQ B;  5JHF A;  5HVQ C;  1WJA A;  3OYB A;  2KPM A;  2M0M A;  4BL0 B;  4E7H A;  1X1C A;  1R6R A;  2VQG A;  3K4B A;  3BLY A;  3QYF A;  3OYF A;  3LNN A;  3JU4 A;  3HPG A;  2D3N A;  2GJK A;  1Z3Y A;  4XON A;  3VYU B;  1UG0 A;  3PNT A;  2M5S A;  3BG7 A;  1LKX A;  5KHD A;  3MKZ A;  3FY3 A;  2GJP A;  4ZYA A;  2VJJ A;  2XC7 A;  1UD3 A;  2E1B A;  4Y33 A;  4B3F X;  3RPU D;  3PJR A;  4XN3 A;  3HG9 A;  3EUH C;  5LD2 C;  1WP6 A;  3GRH A;  1O8I A;  1VZ0 A;  3HC7 A;  2IS6 A;  3DPT A;  4PFO A;  3GQ8 A;  2K3P A;  4Y3O A;  3OS2 A;  1X0C A;  2I8D A;  2Y0S A;  4XD7 A;  3W2A A;  4E4H A;  4YZX A;  3NWT A;  3OIP A;  2DJI A;  2CK3 A;  3SZG A;  4F3Q A;  4C2U A;  3OL4 A;  2KMU A;  3EUA A;  3M1C A;  4G7W A;  4DK0 A;  2M4K A;  2VIX A;  5HOO A;  3J7A Y;  2JVG A;  4LIU A;  4IX7 A;  2BVL A;  4I84 A;  4U7B A;  2IGK A;  4XM3 A;  4URR A;  3C2H A;  1SAU A;  3GQ9 A;  2V6E A;  4CCJ A;  1EFR A;  4BJT A;  2V9K A;  2UUZ A;  4YZ0 A;  2F1M A;  4E6K G;  3HKZ A;  2X1E A;  1IA5 A;  1BN8 A;  2IS2 A;  1KTW A;  3OR1 C;  3OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...