2X6WA

Tailspike protein mutant e372q of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
total genus 234
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6wA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6wA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6wA02
2NSPA 4OZYA 2EWEA 1RU4A 1O8JA 4XN3A 3B4NA 3KRGA 5AMVA 1O8IA 4XMYA 3UW0A 3VMVA 4I84A 4XLFA 4W8SA 4Z05A 2NTPA 1OOCA 3VMWA 1IDJA 1PXZA 4XLEA 2ODLA 4YZAA 4YEJA 1IDKA 1O8HA 2NT6A 4XLHA 4XOPA 1IB4A 4XQFA 4YELA 1GQ8A 3ZSCA 4XKVA 2NZMA 1QJVA 1RMGA 1O8DA 2O0WA 5C1CA 4Z03A 3VSTA 4NK6A 2PYGA 2VBMA 1DBGA 4XONA 3EQOA 1OFLA 1CZFA 2VJIA 2QXZA 1KCDA 4XR6A 1O8LA 4XN0A 2X6YA 4YZQA 4W8TA 1KTWA 4EW9A 4W8QA 3GQ7A 2NTBA 3B8YA 4XM3A 1OGOX 4AVZA 1OGMX 4XOTA 4XORA 1BHEA 1BN8A 4OZZA 1EE6A 1H80A 1K5CA 2NTQA 2UVFA 3VSUA 3FY3A 3ZPPA 2O04A 4U4BA 2VBEA 4PMHA 3GQ8A 4OJ5A 2QY1A 1RWRA 1PLUA 2INVA 4W8RA 3EQNA 2NT9A 1JRGA 2IQ7A 4URRA 4HWVA 4XLCA 3JURA 3T9GA 3SUCA 4XKWA 1PE9A 2PECA 1O8KA 2Z8GA 2X6WA 1O8GA 1KCCA 2QX3A 2VJJA 2O0VA 2PYHA 2X6XA 1O8MA 3GRHA 3LMWA 4MXNA 4YZ0A 1O8EA 2VBKA 3GQ9A 3GQAA 1OFMA 1HG8A 1O88A 4XNFA 1JTAA 1X0CA 2UVEA 2INUA 5C1EA 3B90A 4MR0A 4OJPA 4OJ6A 4XL9A 4YZXA 1VBLA 1DBOA 1AIRA 1QCXA 3VSVA 1WMRA 2X85A 1IA5A 4OJLA 3WWGA 1NHCA 4OJOA 2BSPA 1XG2A 2NSTA 4C2LA 4XLAA 1O8FA 2O1DA 4NK8A 4Z06A 2O17A 2X3HA 4U49A
chains in the Genus database with same CATH superfamily
5EG0B 1TLHB 2Y0MA 3CMYA 1BX1A 4HW0A 3EUHC 2K5CA 2X48A 2ISYA 2LBFA 3KP4A 4PC6A 2E60A 3L7WA 2GIZA 2XNDA 3DBLB 1WJCA 1AKHA 1NDHA 4W8SA 4Z05A 2D9RA 3ZMDA 5THXA 1U5TC 1GAWA 2R5ZA 2VFQA 1TQPA 1TZLA 1ZK8A 2CQKA 2W85A 4P1WA 2QYUA 5TGTA 1IDKA 4LK0F 3W5UA 1WJEA 2ZSIB 1ETXA 2ZKZA 2WZNA 2V26A 3K4JA 1APLC 2PI0A 1HSTA 4YEIA 2VNIA 3ZSCA 3WGHA 3NQOA 2O5RA 3A8KA 2CK3A 1ZRFA 3CXCB 1Z3YA 2A6EF 1E3ZA 3Q39A 1VF9A 1T33A 2IGKA 2BSAA 5HS7A 3BG6A 3FHNA 3A01A 3OWTA 2M5WA 2IGMA 3F0CA 4DNCA 4EEFG 4YAOA 1J5YA 4I02A 3I4MJ 1E64A 1Q82D 2M3AA 4B3XA 3AG4H 1ZREA 3OEEA 1EZGA 1V4RA 1BM9A 1K6OA 3D5RC 5L3FA 2L9SA 3HOVJ 4WX9A 1N06A 2HNHA 3BPVA 4K1XA 2V1UA 2JMWA 1FLIA 4KH3A 2EA2A 1ETVA 2WPDA 1CQXA 3DPTA 1TTYA 1BN8A 3ECOA 2QTLA 1RUOA 3PA2A 2ZFWA 2B7EA 5A2QK 5K7ZA 5F1RA 4JYKA 2ZITA 4LFUA 1K78B 3WTVC 2IOUG 3CMAI 4Z4ZA 3A0BC 3S2HJ 2L3DA 3EQNA 4WZTA 3Q9SA 2VE9A 1BI0A 5FD5A 1LDDA 5FKLA 3FXUA 4FETA 4M73A 3CCUI 2D5VA 4BNCA 1E1QA 4TMWA 1QVUA 3VYSB 2GIVA 2QLZA 4I7HA 4L0ZB 2LY9A 1PJRA 5A88A 3PENA 2CUZA 2DTZA 4TMVA 3CCMB 1ZHFA 2ZJPF 2LNBA 3G73A 1Y39A 2P7CB 3OIPA 4JQFA 2UXNA 3LMMA 3OKXA 2XZLA 3F6OA 2NV4A 1SVLA 4NC6A 5J6XA 5FB2A 4WF2A 1EP1B 1VQ7B 3VR6A 1X1PA 4MQVA 2MLKA 2Q2EB 5HLIA 2LKSA 5FA6A 4ITVA 3LSRA 3LQRA 2EFOA 3OJWA 1AIRA 2XNJA 3TGNA 2IW5A 4HNUA 1OR7A 4DK1A 2XGJA 4BGDA 2EK5A 2JVGA 4BJ6C 1WWXA 1MBFA 2W84A 1LEBA 3T56B 4KJZA 4UVAA 1Z91A 2KHMA 2HPIA 4YAFA 1FMWA 3ASNH 4X7EA 1NHCA 4X7DA 4C2LA 3JQQA 4XLAA 2XPUA 4M9SA 3J7AO 1TWGJ 2V1XA 3G1LA 4ON0A 4GDFA 4A0ZA 5J8FA 2M5SA 1GVDA 2JJ1A 4P26A 2FBHA 2L9NA 3VSLA 1E1RA 1S72B 3WGIA 1BPLA 3BCAA 3GVAA 4B1RA 2V7WA 4M71A 2O9LA 2ID6A 3CMEI 4V02C 2DJIA 2OU2A 2MW8A 2EV6A 1G3SA 1HKTA 4MIMA 4AF6A 4F93B 3JSPA 3K10A 1YW7A 4X07A 4N3NA 5GV8A 5D4SA 4BE2A 1O7LA 1GXPA 2JUGA 5BSYA 1ULYA 4DK0A 3WG7H 4CCOA 4UUSB 4RPDA 2LOOA 2BZTA 1L1IA 5DCMA 2ZZQA 4A3GJ 1MJ9A 1G7TA 2LRDA 1NB9A 4DQLA 2JK3A 1WDTA 4IVNA 3CC2B 4HX4A 1CLWA 1R36A 3CMMA 2OBRA 3X2QH 4YC5A 1SAXA 1QJVA 2UXXA 3CESA 1X2MA 3VSTA 3V8JA 1P92A 1H8HA 1RETA 2DN0A 1O3RA 3UKGA 2DA2A 1DU0A 4HDVA 4IQJA 1OFLA 3CJQB 3IH2A 2QXZA 1HC8A 3J80K 2G0YA 1XS9A 2R7QA 3QP5A 5LFAA 1WXRA 2ELHA 2D2WA 4DZJA 1E63A 2JIZA 2BVLA 3S93A 1TL8A 1R1VA 2BM0A 1YJWI 3SEQA 1FIPA 4AYBN 1VQ9B 2ZO4A 4I76A 5L3GA 1ELOA 1OGMX 4XORA 5FFZA 1E3OC 2HZTA 3GFJA 4YIIA 2VUMJ 1MJBA 2V7UA 3KZZA 1H42A 2DJNA 2UVFA 5ICGA 2RC4A 2LSOA 4RAFA 3I1FA 3BR0A 4B4DA 2VBYA 3AL0C 2VNHA 3ABMH 1FTTA 3PA1A 4KIGA 1O4XA 4OM9A 3CCRI 2COMA 3A1YA 3O6BB 5EYRA 2JRTA 3MKWB 4TKOB 1PE9A 2PECA 2KRCA 4C3HJ 2EH3A 2XPVA 1Y0YA 4H9GA 3GVKA 1GO2A 1ZN2A 4M3DA 4GYGA 1V55H 1SVOA 2XGXA 3FXKA 3HOXJ 1D8TA 5FL7A 2PYHA 2EZIA 3SFIA 3D26A 1R22A 4P9FA 3BG7A 3FKJA 4HQMA 2GXBA 2P5KA 3BTJA 2Q6IA 3DWLE 4WXDA 2Z2SB 2EJRA 2DY1A 4RAGA 1ETQA 5IT3A 2DERA 2AQEA 3TL4X 4KUMA 2H8WA 4ZDPA 2ELKA 4HYEA 1FP1D 3P9KA 4CA0A 3SLDA 2OTJB 1JJ6C 3PO3J 4H0EA 4Y33A 4M0LA 4NCNA 3ZXSA 1EFCA 1USSA 4OAZA 1ZLKA 1ZM4A 3PL8A 1FDRA 4MLOA 1LVAA 3BTIA 4HG2A 2WAQN 3ABTA 4BEHA 2V5IA 4ESJA 5E8IA 2VPRA 1PUEE 2C4UA 1Z67A 2V31A 1LEAA 2O17A 1TYXA 2QVOA 2HU9A 3KP6A 4Z4WA 4LK1F 1E3PA 2X8KA 5IYBJ 1VQOB 2W7ZA 1OHHA 3HYIA 3ONQA 4IHXA 2B5OA 4NBQA 4RJLA 3CPWB 1LDKB 2M7AA 5LRRA 2CV0A 2IGOA 1R5ID 1N8RD 2OK8A 1R4MB 4PJLA 3W2IA 3K70C 4NHJA 1POGA 4I09A 2MH9A 1OISA 5IOZA 1P7JA 2OA4A 3L00A 3OR1C 4XLPF 3JRIA 3ZQHA 3OJXA 4BXUA 1QVTA 5J1YA 3Q6QA 2MC4A 4ANJA 2KRFA 2W57A 1UMQA 2STTA 1K28D 1T08B 1EWYA 3A8JA 1LKXA 4L9VA 1O3SA 2DOFA 4KN7X 3G4SI 3PSIA 5DTDA 2Z99A 4IHSA 5M3MJ 1IB4A 2FNPA 3RKXA 2F5CA 2IBDA 4DIQA 5JHFA 4KITB 4FX4A 1JJ2B 3RIRA 1XFOA 1UJ8A 2K85A 2RREA 3A02A 3KPHA 1KZLA 3BY1A 3PUMA 3BH7B 3J7AY 2LLKA 4NK6A 3Q0UA 1JKPC 3M9AA 3SYTA 2CFOA 4L9JA 4C3JJ 2VE8A 3JRAA 3WTXC 3IV5A 3PIOF 2D1VA 3F72A 3F8MA 3CCQI 1S8NA 5FFXA 1X1DA 4NC8A 4L0YB 2KIFA 3I55B 4YZQA 4A2UA 2IPQX 3R60A 1JNYA 1K61A 4EH1A 1VQMB 4OPVA 3GQ7A 1IN7A 2DOEA 1X3ZB 2JA8J 3A8IA 2GJPA 3S1QJ 3MKYB 4O5VA 4KT6A 1QO0D 1VZ0A 2K02A 3KYDB 3CCSI 1ACIA 2CBXA 1FMVA 4G9YA 2O8XA 4JBAA 3CF2A 2UUZA 1O7FA 5DS9A 2I1LA 3OFNA 5B5EC 1GV5A 2CQXA 3ASPA 3BCDA 4Y15A 4YCQA 1CGPA 5GPCA 2G7UA 1U0JA 3MZYA 1X3WB 4U4BA 3TP0A 4PC2A 4IRHA 1QG0A 3GQ8A 3ZMVA 4QVAA 1RWRA 1TYWA 3CC7B 1FPQA 1EJ9A 2D45A 4LIUA 4BE0A 1XMAA 2GK6A 2A6TA 1OQYA 5B66C 1YFHA 4A5NA 4G7XA 1WSVA 2G9WA 2QE7A 4E7SA 2L02A 2L7KA 1DPUA 2DIEA 3QFCA 4HNVA 2CO5A 2BOLA 2I8DA 3GEZA 2LFBA 5HDGA 1A35A 2HWVA 3R61A 4WZLA 3MEXA 1OCTC 1U3EM 4E6KG 2UVEA 2HYFA 3BR1A 5ICFA 4UUTA 3OYNA 3GTKJ 2D3LA 2RQQA 3F22A 3BG5A 3BY6A 1UG2A 1UHSA 3HSFA 4YFOA 5E20A 2LY2A 2OZ6A 2DOGA 2FQ4A 5C44J 4IJAA 2QBYA 1SD4A 4LBVA 1WMRA 4XIDA 3ZQ7A 2M7BA 1KGSA 2A5YB 4Q48A 4NC7A 3S14J 5IYPA 4TSFA 3S15J 3WU1B 3TEDA 2ZJQF 1ZGJA 2HQ5A 4RS8A 3VEPA 2VQLA 4W1UA 4LLGF 1IXRC 1GLNA 3GW2A 3MZHA 1ZGWA 4CQJA 1KQ5A 3HHGA 4B8XA 3FXLA 5BOXA 2F5FA 2C5BA 3KEOA 2EFQA 3HL2A 3CCJI 1H88C 2ID3A 4RGRA 2XTWA 2DBBA 5J40A 1JTYA 2DMQA 2M0MA 1XQBA 3CJRB 5H6QA 5EEAA 3CDLA 1IN8A 2BW3A 1XCBA 1OB0A 1V5EA 2OJED 1RU4A 1BMFA 3QYBA 2ZJ2A 1KQ9A 4HLYA 1R71A 4HF1A 4XN3A 3KYLA 3RZOJ 1XSDA 3ZOBA 1ZTRA 2KT0A 1F60A 4ENKA 1ZM3A 3LAPA 2E1MB 1FOKA 3UW0A 3ML6A 4HA8A 2PG4A 2O3FA 3FK7A 2IA2A 4GRIA 3V7CA 4IKFA 1E3XA 4ZYDA 1T6ZA 4RD4A 2VIXA 2FE3A 4OP7A 4EGZA 3F6VA 1DP3A 2XKPA 2BM6A 2FOWA 5GV7A 4V19K 3S2WA 3SZPA 3F3XA 2Q6LA 3B8HA 1U5TB 1J0RA 1DG1G 3PNTA 2F6CA 3FHZA 3H9JA 2ZZGA 4TV7A 1UD6A 3CCVI 2CRVA 3E97A 1QX4A 1IRZA 3J81k 2LMDA 1HKQA 3IP4B 4BAYA 1D8KA 3ZQLA 2XPWA 1XMXA 1KA8A 2QM3A 3LFUA 2DCEA 3LSTA 4QPQA 4YIRX 1QQ1A 1R7JA 1GDTA 1HQCA 1VHEA 2J5PA 4DGWB 4EQQA 2X1EA 3S3MA 2L7MP 1F4KA 4IQ4A 2HGCA 3SY2A 4OIPF 2EPFA 3B6AA 2VXZA 5H6RA 3TKYA 1PJ5A 2GWRA 5IP6A 3I9V2 3BC9A 5F4MA 1BA5A 1EH8A 4ACBA 4MQ9F 5F0HA 1QZZA 1HW5A 2DU9A 2E1NA 4XM3A 2XB5A 3T0YA 1OGOX 2M8GX 2KVOA 1YOVB 5LLQA 3LYCA 3ZZTA 4JK1X 2K3FA 4WZEA 1RQPA 3U21A 1LE8A 2HVSA 4KKSA 2D3NA 2DYIA 2YWGA 3VSUA 4GQNA 3JCUC 1H85A 1NK3P 5FLVA 1WORA 2CC2A 5FNZA 3SJZA 1RNLA 2E7XA 1UD4A 2HCJB 3FPPA 1RR8C 3IAM2 2KZGA 2KIQA 2R3SA 1S9HA 2ZNZA 1M1EB 2FBKA 2VKHA 2ADUA 2ZJRF 1FNMA 5DD4A 3D1NI 1MABA 1PJ7A 2XHKA 4YFNF 1ETKA 5E79C 1KQ0A 1OB2A 2AQFA 2H6BA 2LYCA 1R1UA 3ZN1A 3OZWA 1FC3A 2JJ7A 2O0VA 3I5UA 2FOKA 3VDXA 1ETOA 4P96A 3JQPA 1U6GA 1X0CA 4E7LA 3QSYA 5HDKA 4EJOA 1S3JA 4RAYA 1KK2A 4XRSA 4OJ6A 3UNGC 4BKXA 5H59A 3JAMZ 4Y3OA 1JI8A 3OS0A 1DBOA 2JWTA 3G2BA 1V54H 3WTTC 2BEOA 5M3FJ 2M45A 3I4NJ 5LEKA 4LB6B 3VFZA 3RPUA 1TWHJ 1DDGA 1H8AC 3TH0A 3H3UA 4I0AA 3W6JB 2GXGA 4OJOA 1IAWA 3JTHA 2FX0A 1RC9A 2BXZA 2V4DA 4RGSA 2DA7A 2DODA 4ENJA 1JKOC 2ZMEC 2M34A 5FRNA 5K1YA 2YUHA 1IW7F 3OYEA 2CV1A 2W4SA 2RV8A 1WZ2A 2V79A 1KTVA 3MCZA 3I64A 5EGOB 3GIRA 4KKTA 1BL0A 1O8JA 1MDMA 1JKQC 2F5DA 1LVKA 1MSFC 3MWMA 1HA8A 3H5NA 2MSYA 1W4MA 1QFJA 3HRMA 3KRGA 1SKQA 1Y0RA 1IO2A 2XB0X 3ISPA 4F7ZA 2E1BA 2FBIA 4RBOA 3O2PE 3IKVA 4GO1A 4IEJA 2W48A 5L46A 5AN9A 3A4CA 5ERIA 4XLEA 2M1BA 1ZR2A 4ENNA 3S16J 2HDDA 2EZKA 3BR6A 2KISA 3IWFA 1RUNA 5IYWA 4XLNF 3I56I 2DDBA 1MMNA 1K4TA 3BR2A 5F6FA 5E18F 4ZGNB 1VQNB 2BVMA 2D1HA 1O8DA 5C1CA 5JLWA 1QA3A 2WWYA 1CF7B 2GQFA 4ZYAA 2XZPA 5FJ8J 2PYGA 1PJ6A 4P22A 3MFKA 2HXOA 2V1NA 1BN5A 3FM3A 2IVMA 4CCMA 1U9OA 2EV0A 2WAFA 2M8EA 2R5YB 1E62A 2A6HF 4MTDA 1DDIA 4HV5A 5FLMJ 1ZLJA 3NAWA 2ECBA 2IXSA 1KJZA 1DARA 2HLDA 2AXTC 3EDPA 1W1WE 2L4MA 4BXXJ 1Y56A 3ERMA 1T0FA 3DP7A 2VQHA 2PN6A 4DZPA 2G0EA 2Z9OA 5E8GA 2J8IA 4KMFA 4OPSA 5KVRA 1MNDA 2CFXA 2P81A 4EJVA 3I59A 1K79A 2QSFX 2X6OA 3FM5A 2LZJA 4R71A 1K4SA 2K9NA 2FUG2 3IL2A 5LD2C 2NTQA 4JMQA 4LG0B 2NXNB 1ZRCA 3EUKL 2Q8KA 1K73D 4OJ5A 1G59A 3U1KA 1FJLA 5EEHA 2DAOA 5EG0A 4LC0A 3C3WA 2QA4B 2CG4A 1JXSA 3AL0B 4PC3A 1SVMA 1HW2A 4LBWA 4XLCA 3T9GA 3QQAA 2K9QA 1OPCA 1IXSB 3HAGA 5IYNA 2H94A 2NS7A 3K2AA 2ZZFA 2OTLB 2JA2A 1BBYA 3PNYA 5TRDA 4I2OA 1W9XA 2QTZA 1IDZA 3LMWA 1AOYA 1FX0A 5DN6A 4KT5C 2VBKA 3ELKA 1UD3A 1XCVA 3BWGA 1FT9A 3HZJA 5IK2A 1ZELA 4GCVA 2HDWA 3PUBA 4ZDLA 3JTGA 4E7JA 4X6AJ 5D5WB 4QLCU 4QSHA 2ZC2A 3R6SA 1VF7A 1QNTA 1EXMA 2WTEA 2CYYA 1HVXA 3N90A 4GYIA 3KE2A 1LUJB 1Z77A 3Q0VA 4D9JA 4I01A 5A2QZ 3JRFA 2Y9ZA 1FYKA 1AHDP 1HA3A 4U7DA 4A69C 2UWMA 3HSRA 1BI1A 4YFKF 2HYJA 4JRAC 2EIXA 4MHGA 4U0WA 1IUYA 1T6XA 3MKLA 4G7ZF 2WSSA 3NB2A 2V7VA 4L18B 3G3ZA 4CGZA 3K4BA 2JSCA 4C3IJ 3SXYA 5CPRB 2EIMH 2LC2A 3HC7A 4V2FA 1QA6A 1IGNA 4IXAA 1I7PA 1V0EA 3ML3A 3RKWA 4XKCA 3BH6B 3PO2J 3OL3A 4PGHA 4RPBA 2ZL6A 3R6KA 3P27A 3ABUA 3HBLA 4RCZA 1GT0C 3CCEB 2NTPA 2KIUA 2DMTA 2ACJA 1YLFA 2PMZA 3IHUA 2PX9A 2NVUB 1SFUA 2ODLA 4E7HA 4RDJA 2A5WA 1Z6TA 4LJZF 1K78A 4J00A 2OV7A 4AU7A 2FXAA 2R7DA 4XLHA 5CQEA 1QZYA 1W35A 3RPUD 1HKSA 4AD9A 2F1MA 2F5EA 3OYGA 4G5GA 3RKYA 4BQNA 1FBUA 3P7NA 1HF0A 5CKTA 4Z03A 3R0AA 4UAJA 3IAS2 2E1MC 1OCCH 3DF8A 1VQ4I 3CD6I 2P0WA 3WNCA 3PM1A 1KK1A 3VPRA 3Q6RA 1VQ8I 4P5OA 1FNNA 3QPHA 3HUGB 1RIOH 1YI2I 1V5GA 4MFDA 4UV9A 4HE5A 2FX3A 4F92B 2Q2EA 1UB9A 4JX5A 1Z0XA 1HF2A 3HDDA 5CVVA 2GM4A 2R92J 4RLQA 3OR2C 2F4MB 1FYMA 1GVJA 1ZG5A 2XOKA 2BY2A 3ONYA 3AVVA 1LJ9A 1OCOH 1TSPA 5FGMA 1A8PA 1E43A 1YS7A 3J7ZI 2L01A 3AFHA 3V7AA 5ICCA 2E71A 4YAUA 1NTCA 2EIKH 3LA3A 1HSJA 4HLXA 3T1BA 3PUNA 4OIRF 4W8RA 3SEJA 3E6DA 2EZLA 2IA1A 3ZMTA 3EYYA 3BJ6A 3OYHA 1YQAA 3LSKA 1V5FA 1EFUA 4HX7A 5H20A 1QH0A 5TR9A 5FO5A 3L09A 4Q7JB 1VQ6I 2XGCA 1H8EA 2VBVA 1XMKA 1E17A 3ZBUA 4J0QA 4OOVA 4UUSA 1IUFA 1IRFA 2E1OA 2KFDA 3BC8A 2G7HA 2FNAA 2GBYA 1K8AD 1SFOJ 2INUA 2EWNA 2OQRA 2C6YA 2FU4A 2Y69H 4L5IA 3J7YJ 3BROA 2RKHA 4D5CA 2YX7A 1B23P 2X1CA 1T56A 1YHQI 3W6VA 2JA7J 2OCEA 1K9MD 3TDUC 1VQPB 3QPLA 3DTEA 5F08A 5HLGA 2VBTA 1XGNA 2ECCA 4KICA 1T39A 2XSDC 1YJ9I 2BSPA 1QHHD 4F55A 2JUCA 4OOXA 2O1DA 1ZQ3P 2QUFA 3GUDA 4U0VA 3K4CA 3GVLA 1MMAA 1D0XA 1ZR4A 1B8IB 2DEUA 5J47A 2V7FA 3GZ6A 1NJID 3FISA 3G71I 2QCOA 4AIHA 2H27A 2YWEA 3K69A 4C9YA 1JA0A 2EA4A 2VKEA 2LH9A 3DCFA 1N78A 1UELB 3ZIAA 1VQKB 3TMOA 2H09A 2QENA 1ODDA 3S32A 4S05A 4I84A 1ON2A 4TT3A 2I10A 3GLLA 4A3DJ 3F8CA 3VMWA 1I1SA 1J75A 1KU9A 4CO8A 1IDJA 3VSKA 2VONA 1B2RA 4YZAA 2DETA 4EM1A 4MYTA 3NARA 2VASA 1XX5A 2NT6A 1AKHB 4P3YA 3G1MA 2BMWA 5FLXK 3SHFA 2V9PA 2ZTGA 4X7FA 4L9NA 2DA5A 2PBIA 2GAUA 4HV6A 4HWVA 3L2CA 1ZG1A 2HKXA 2LP0A 2MC3A 3QYFA 2XROA 3V8KA 2QEXI 1Z05A 2PEXA 2VQGA 3CUOA 4UB6C 4DOZA 2W7NA 1QBJA 2Y0SN 4OPWA 1WFXA 1W7PD 2RC5A 2WJVA 4RM3A 2QSGX 3KP3A 2VFOA 2CQ7A 2X6YA 3H92A 4XN0A 1RKWA 2PLFA 2DW4A 3WU0A 1REPC 2F1LA 3VODA 3VWBA 1EH6A 4G6TB 3QFRA 1KONA 3LSPA 1VQLI 1L0OC 4Z4VA 4HPQA 2P5LC 3CUQC 1COWA 2FRHA 1DGRM 1R6RA 2ESHA 3DPUA 3HKZA 3K7AJ 3ZQQA 2AS5F 3BOQA 3BZCA 4P9UA 1YJNI 1BHEA 3PSZA 2DTRA 3OP1A 3H3ZA 3M8EA 3OE7A 5ILVA 1QRBA 3SZTA 4B09A 2F4IA 2Z1DA 3ZQCA 1MBKA 3AG2H 4LG3A 5L3CA 1JHHA 3WE2A 1KC8D 1U9NA 3JREA 3JSOA 1IDYA 2BX6A 1GVHA 3ABLH 2INVA 4U0YA 1YITB 2ESNA 4DNTB 3B73A 2JN9A 3W5VA 3W2AA 3JQRA 3JURA 1KZHA 2ELJA 4OINF 4G7OF 1YIJB 2R93J 2Z8GA 1P9QC 2CH0A 4P6VF 3QWLA 4GFBA 2OPTA 2YSRA 2C78A 1FTZA 3I3LA 5JLXA 2JDIA 1LM1A 3F8NA 2O03A 1D0ZA 4WWCA 1N07A 4MXNA 2XAUA 3BZ6A 4RMNA 3OYMA 3KEWA 3SQNA 1I1GA 2BY0A 5JR3A 4BXFA 1KMHA 1Z7UA 2GA1A 2P5VA 4YIFA 1WOSA 3LSIA 1FP2A 4D5FA 1ON1A 4PK4A 2NPFA 3MQ0A 4CHUA 2DQLA 3M8FA 1B59A 1TBXA 2K4BA 5HXBA 2NS0A 4XRFA 1FEXA 3CCYA 3GFIA 5J1UA 1IXCA 4W97A 3OOCA 3ZC3A 2H1KA 3M7GA 3CP2A 1PP8F 2RNJA 2E35A 1SAUA 2WB1A 4WCGA 1VQNI 3GLXA 3DFGA 5FO1A 2K9SA 4Z6YA 4E70A 1DPRA 5BNGA 4XBFA 4QIWN 3WQZA 5HOOA 3JU4A 2DDAA 1QGZA 2CUEA 2ZMEB 4RAZA 1KU3A 4BHPA 4OMZA 4DYQA 2Z3YA 3HGGA 3IRRA 1AIPA 2H1LA 3CC4I 1A6IA 5LBQA 5F0CA 5DD8A 3W2VA 3GZNB 1CQTA 1TT0A 2KMUA 4G6IA 1QZEA 5J3LA 2Q1ZB 3M3YJ 2QKMB 4L5JA 5FRMA 2FF4A 2QDXA 2VBWA 1EF4A 1YRNB 1Q86D 3TDZC 2LF7A 3MMPA 4EJTA 5CVRA 2DFFA 2J5OA 3OYDA 3K6GA 4PABA 4UZUA 2IAIA 5DYMA 2VI6A 4OAYA 3E5QA 3KZYA 4XICA 3LJYA 2GPJA 3GTPJ 3HOYJ 2DXIA 3REOA 1R5NA 1RR7A 3COAC 5HKKA 3GCMA 3SZGA 1FSHA 1R5BA 2FVGA 2LD5A 1WJAA 3DTKA 1CZFA 4BUPA 2R7UA 1WKMA 4XR6A 1QFYA 3KFWX 1I39A 3MVPA 4J19A 3FWEA 1S6LA 5L3DA 2W6IA 1NG6A 5IP9J 3K1PA 2EILH 1ERDA 2IA0A 3ZZ0A 2JZYA 5LHHA 3E20A 4IRIA 2Y2ZA 4PJMA 1AA7A 3EUAA 3DU5A 3PQKA 4ZC3A 1MKMA 4U88A 5FKOA 1X4OA 4AVZA 1FIAA 5K5QA 1G7RA 2QWWA 2KZVA 1SFKA 5IYQA 4BHBA 4UV8A 2TDXA 2YU9J 3A3BA 3R4KA 2NOGA 1QPMA 5D6FA 3AVUA 3KLOA 5GP9A 5FROA 1O3TA 2WR8A 1VQ5B 4PJ0C 4NNJA 3IKTA 3CCLB 3GO5A 3F23A 4ZGQB 5KAIC 1KD1D 4IHVA 5BS6A 4M1KA 3CJTB 1W0TA 3B82A 1BX0A 5TY0A 1PDNC 4RD0A 3PFYA 3P4GA 1FNCA 3M07A 1S0UA 1MIJA 3ASRA 1IG7A 4ZJZA 3HHHA 3I54A 3E7LA 5DDGA 4E7KA 2DYRH 2JN6A 2VT3A 1SM4A 1XGOA 1MMDA 3EUHA 4FE4A 3MZ8A 1LFPA 2C5HA 3CP8A 2EV5A 1QA2A 4I6ZA 4ESBA 2IRFG 3C1DA 1WU8A 4HOBA 4JX4A 5FKMA 3TBIA 3CPXA 4FK8A 2GA2A 3UR3C 1V3FA 3FMSA 1QGYA 2ZFUA 4A0YA 2KDZA 1W0JA 2ZTNA 3OYCA 1U5TA 2HQRA 3BZKA 3F8FA 3M1CA 1D0YA 3ZMZA 2XT2A 2VOOA 4PZJA 1R5OA 5KAFC 1MJAA 3G6EB 1FOWA 2OF7A 3WBJA 3S1NJ 5AONA 1TNSA 4RGUA 2E5NA 1X58A 3C2GA 4HBLA 3VB2A 2V4JC 5D8LB 1ETYA 1NK2P 1S4MA 1XTAA 3HB9A 2HPMA 4MTEA 4Q5SF 1K6YA 4Y52J 3HTSB 3QU6A 4Z06A 4XRSG 3KP2A 1D1BA 1FYLA 1YTYA 3DEEA 5JI6A 5KCMA 1D3YA 4A93J 2BF4A 2OK7A 2Q6KA 2MBFA 2NSPA 3P5JA 3Q3SA 1B9NA 1ZARA 2Y9YA 4TN1A 4D7MA 1XC5A 4IHTA 1Q1VA 2O61A 3KP7A 1WGXA 3VMVA 1YS6A 1EH7A 3OIOA 1LDJA 1OOCA 1S7AA 2XRNA 3AKZA 1MBHA 3F9KA 4DYCA 3I0TA 4LOCA 3ZQFA 3CB4A 4HE6A 3CJNA 1DDNA 2JQ7A 3KP5A 1B1BA 2L2OA 4RA2A 2Z6BD 4ZYHA 5C4JJ 2B9SA 2ME6A 3D0SA 1TTTA 3VNUA 2DFIA 3GZ5A 1Z1DA 2B0LA 3OMYA 1ITYA 2DT7B 3AG3H 1W2BB 4B48A 2KRHA 3HPGA 5DV5A 2NNYA 3J81Z 3ASTA 3CF5F 5H5JA 1X1BA 3T51B 1HLVA 4RM0A 2HXIA 3K4LA 1B72B 1VLOA 1JTXA 5H2FC 2NVYJ 2QN6A 4A5MA 3KEQA 3MAJA 1E79A 4GGGA 2B63J 2LREA 3LSMA 2QMUA 2KJCA 4OPOA 4FTHA 4EJUA 3ROUA 4PC1A 1TWAJ 3B02A 4XOTA 4UNOA 3OSFA 4UVBA 5LGTA 3K4NA 3BQYA 1FRQA 1FOYA 5GAEJ 4XSXF 4KNYA 1RQRA 2NVQJ 2BVNA 2DI3A 1QGPA 2KJBA 4ZTJA 4ACAA 3OV8A 1WJ5A 2PJRB 4RDLA 4M74A 3U2QA 1BI3A 5CVJA 1P6RA 1SC7A 4CYCB 1BOAA 5IPAA 3NWSA 4KFCA 3GVJA 3CMAB 3FX3A 3KL9A 3CO7C 3H3VK 4Z4UA 3GQBA 3U6BA 5EGOA 3CCMI 2P3MA 5K7HA 3OYIA 1W36D 3CCUB 3AK5A 3O8GA 2E2JJ 1J9IA 4CICA 1XSXA 2XUBA 1AWCA 1G2HA 3WTSC 2E1RA 3RJPA 1XG1A 2F43A 4YZ0A 1VQ7I 3DKYA 3GQ9A 2KQRA 1UD5A 2MA3A 5L3BA 2R7XA 4QVJA 3PJRA 1PUFB 2VNJA 4PSXA 3T53B 2JRMA 3ZGKA 3FKIJ 2TRTA 3WXMA 1FX7A 2LDUA 2VQCA 4I0BA 1CNFA 1D1AA 1EFRA 4HF0A 3H35A 2DYSH 1FNBA 3L9FA 4G6DA 3VSVA 2ZL5A 4MFEA 5DM6F 3ZRGA 1OYIA 1OJLA 4NUBA 4BJ5C 5EDNA 2E2IJ 5C4XJ 3HSEA 3GSIA 2X1DA 3B78A 1U2WA 1XB2A 2KKOA 3LSHA 1UCRA 4A3CJ 1S72I 3OYBA 4AF7A 1OFEA 1STZA 3FBNB 3H9QA 5ILUA 5IOYA 1EP3B 2XC7A 1Y0UA 3WNBA 5FKNA 1SD7A 1K4ZA 3WE3A 3FXQA 2WAQA 5GPAA 2X9DA 3DBRB 3HJEA 4A3EJ 1SFEA 4LBZA 1KU2A 4B3AA 4X0CA 5DEQA 3CMEB 4M3FA 1GV2A 4C2MJ 2VJ4A 4PJJA 3B4NA 2DK5A 1FY7A 2FJ1A 2QGUA 5AMVA 1EKEA 4XMYA 2F4OB 5M5WJ 3S3NA 2L5QA 4RB3C 2QQ9A 2L7ZA 2YPRA 4LG0A 4RB0A 1L3LA 1XD7A 5D8KB 1OR7C 1X2NA 2DA6A 4R8HA 3SKBA 3K2ZA 5B1AH 1QPIA 3CC2I 1TW2A 3PUFA 1DUXC 4QHYA 3MCAA 1LB2A 2V7TA 2K3PA 4XOPA 2EIJH 1A36A 1QA1A 5FO0A 1T8IA 3FF5A 3FJOA 2CQNA 1HXDA 4WQMA 2HOAA 3OYKA 1TT5B 2MFZA 1RESA 3ABKH 1W0UA 3BT9A 3U6KA 1FRNA 4BDYA 4Y7NJ 3Q0WA 3M8JA 4PCQA 3ERED 2UZKA 1D5YA 4HDUA 1UD2A 2QGGA 3Q3AA 4TMZA 2PJPA 3GTJJ 1KK3A 2IP2A 3AG1H 1QFZA 2OQGA 2AHOA 4U7BA 3LO8A 4Y7CA 2E19A 3DLAA 1JKRC 4IW3B 2VODA 2PMDA 3OW7A 1J59A 1I18A 2XDVA 2W6JA 4IPAA 2XT4A 4N9IA 1OB5A 1MBJA 3T8TA 3AVTA 3S1RJ 4BY1J 1T38A 3OS1A 1VQ9I 4XRMA 1U78A 5GAHJ 4LMYA 5AIPA 1IV6A 4Y17A 1WJBA 4BY7J 2KDOA 2R4GA 5F4OA 1W34A 1XN7A 2WC2A 4P55A 1YJWB 3CUQB 5IYDJ 4LB5A 3A03A 1R23A 1HDDC 2IT0A 2IS2A 1NH3A 2XAGA 5LRSA 4ENMA 5LHGA 3VNVA 4II2A 4BHCA 1F43A 2VNKA 1N75A 3K1MA 2NT9A 2RVCA 5B3SH 4G1VA 4NB5A 4X7CA 3WTUC 4IHYA 3CCRB 1O8KA 2X6WA 4GXOA 1JGGA 2DT6A 4P1VA 2K27A 5J4VA 1BQEA 2Q0OA 2XF5A 2WA0A 1FWZA 2YU3A 1MH3A 3DKWA 2X6XA 3HXLA 1QU3A 1KRHA 4M53A 1WI3A 4Z4SA 3GRHA 1ENHA 2K9LA 5DUIA 2L9RA 3FBIB 3GTLJ 1WH7A 1SMTA 2OTJI 2L7FP 1PYVA 4F52A 1WJDA 3C2HA 2GLOA 3TW6A 2AO9A 1BIAA 4N4NB 4M2LA 4U9UA 4WWVA 1JGSA 1BC7C 4MYUA 1CNEA 5BPIA 2QSHX 4AIJA 3WGGA 2IEKA 4ETSA 1BJKA 2HVQA 4C2UA 3SDBA 2XAFA 2HKOA 3H09A 4MEYF 2RAEA 2M4KA 3ISXA 3DEWA 3H5AA 1VQOI 1EA0A 2IS6A 2LF8A 2GZWA 2GXAA 4A0XA 2CUFA 3HUGA 3OS2A 1P7IA 1I50J 2GJKA 4Z4RA 3OZVA 1TNTA 3CDIA 3WNDA 4DNRB 9ANTA 4OZYA 1EP2B 2CSOA 4N9HA 3SFZA 3TOBA 4AIDA 2HMAA 3PSSA 1FZPB 2CW0F 1K8FA 2VBSA 3A1PA 4LGWA 1ZGAA 3MMYB 4A3FJ 1T6YA 4YXWA 2VJ5A 4X05A 4IHWA 4A3BJ 5JHUA 5IT9K 2CV2A 2JPBA 2IJLA 2BM7A 3HKZN 1X1AA 5LGUA 2BGCA 4IOAF 1OCZH 3RYRA 1YE9A 4YEJA 1LFUP 4RD6A 1LLZA 1R5GA 4WZKA 3VYRB 2IGNA 3WTZA 1J9ZA 3QYEA 2B7CA 4MNUA 3G4SB 2QZAA 1GQ8A 1TC3C 3JAMK 4WK8F 2EINH 4P6YA 1IJEA 5CYVA 3F21A 2OCCH 1ZM9A 4RLZA 2VBMA 3QP6A 1EFTA 2OZUA 3E1SA 2EQRA 4JX6A 1IN5A 3K4MA 3KX2A 4E4HA 2MD5A 4HSRA 3I55I 1NRKA 5CVIA 3GTQJ 4L9TA 3E6CC 1KK0A 3OL4A 2Q6OA 4M6YA 5DSZA 5LMZA 1W36C 1J7KA 4BYYA 1ORKA 1VQMI 3CCQB 1WH5A 2EBIA 4EW9A 4S04A 1W5TA 2XIGA 2VC1A 3CLOA 5JVTA 3S1MJ 2B7BA 1ETWA 3HOUJ 5EMNA 2B0RA 2NTBA 1S5LC 3CDHA 4WXHA 3B8YA 1RPWA 5KK1A 2GOXB 1HZEA 2Y31A 1MD0A 1TP4A 4PSWA 4XK4A 4KKUA 3CCSB 1F36A 2XAQA 1F9NA 2E2HJ 5FLXZ 3LQEA 3FPKA 2MGQA 4Q47A 3AVXA 2O04A 4FWTA 1I8DA 5EF6A 4PMHA 3CC7I 2ZB9A 1B8IA 1Z3XA 4IZZA 2XKOA 4ASNA 4L8JA 3AAFA 2P6TA 2BV6A 2WB1N 1GR1A 4AM3A 1XE1A 1N0UA 4EJWA 3BH4A 4QV2A 5EZGA 4DYRA 3N4MA 1G3TA 2BN4A 3GTGJ 2CU7A 2DPDA 2IS4A 3AGQA 1G3YA 2JT1A 3TW7A 1O8MA 2EFGA 3Q38A 2X4HA 3U1DA 3RKQA 4UZFA 2CNDA 4HIZA 4BQAA 5KW9A 2E36A 2EZHA 2ZCWA 4UB8C 5CLSA 4FN5A 1MBGA 4UHTA 4N3GA 4CCLA 3HPHA 4CCKA 1Z21A 1WOOA 1R49A 4TMXA 1E0EA 4O3MA 5J35A 1ZH5A 1GAQA 2XGEA 3KEYA 4RDUA 1WHUA 2W1OA 5IYRA 2JA6J 4N0BA 4JOMA 2W25A 3RCOA 5LEJA 4M6XA 3LAJA 2ZXIA 1G7CA 3HTUA 4YG2F 3U9GA 3PETA 1XG2A 2YUSA 2V6EA 5HZBA 5EJCA 5HLTA 5D5VB 3JW4A 2JA5J 2RQPA 2HTSA 1BR1A 3J80Z 4NK8A 3FXMA 3EETA 2VBXA 3QU3A 3ULQB 4ASUA 2KPMA 4U49A 2NAZA 3EQLF 2R7WA 3CCJB 2XASA 3M1EA 3RZDJ 2EWEA 4II3A 3JR9A 5CDFA 3L2VA 3ONUA 3OEHA 3GTOJ 1VFCA 4NDLA 2CMPA 4PDKA 3DU6A 3K70D 2ICWG 1FOXA 1P4MA 2ZNYA 4MGRA 3BDDA 4RLFA 1W7PB 3KETA 4DQ2A 1SANA 4BACA 3TOAA 2NOJB 4O6JA 2XAJA 1PKVA 1WSRA 2V9KA 4G94A 4X0GA 3RI4A 1KYZA 4AC9A 1BI2A 3S8PA 4B44A 1T5EA 1UFMA 2ZXWH 3WHBA 1MZBA 3QOEA 4C30A 2A07F 3GMEA 1YG2A 1T6SA 4UVCA 2MD0A 3O8HA 1Q1HA 2F5VA 2V9VA 2RGVA 1YIOA 2UV1A 2YWFA 2COBA 1Y0NA 3KLNA 3FKSA 2X53S 2W24A 3ZBTA 4G7WA 3C18A 3CCVB 2PLYA 5EEGA 3A35A 4B43A 1UD8A 2XRLA 1TLLA 4EMSA 4ZYEA 3GTMJ 1OLTA 4NQWB 3LNNA 5DS0A 3I58A 1N08A 2PE3A 2O0YA 2CF4A 1QHGA 1P2FA 3BP8A 2ISZA 4F3QA 2EFNA 1JUMA 2YX4A 3DDYA 4RD1A 3HOWJ 3IWZA 1BW5A 3W2GA 4X1EA 3SJMA 3PSFA 4CH7A 2XAHA 2LBFB 3PVDA 3TQNA 4FXUA 4X06A 3ECHA 4XKBA 1BJZA 1XGMA 1FSEA 4BU2A 1C0WA 1G8XA 3NRVA 2QYOA 4U87A 3M4OJ 4F7DA 1SEUA 3V4GA 2LKPA 3FMQA 1JT6A 3O3KA 2R5ZB 3DEUA 2VBZA 1ZYRF 2O6GE 3ZPPA 2MYSA 3A2KA 4FT8A 4HEA2 1BR4A 1Y6IA 2VXDA 4LLLA 3CO6C 4B47A 1A5JA 1JA1A 2DMPA 3L2WA 1S29A 5E3OA 2VL8A 5F1JA 5HZAA 3Q5FA 2ZMEA 1MW7A 2QQ8A 4XKWA 5F64A 3T5XA 3H9NA 2QF7A 3CZ6A 4PFOA 2M0CA 4A3JJ 4KA4A 4EGYA 2EFPA 2VJJA 4Y4RA 3A01B 1WJFA 2VT2A 3SYJA 3VO2A 4CYDA 2JTVA 4CUGA 4EM2A 3BJAA 2IS1A 3K0LA 3HOZJ 1YW9A 4A3LJ 3FXRA 4FE7A 4M9XA 1UAAA 2D74A 1TYVA 1MNEA 1B9MA 1NG7A 2PMUA 3H9GA 4ZZDA 1JJ8C 3B90A 1YRNA 4OJPA 1RI7A 2DQRA 1GUUA 2R7ZJ 2XZOA 4FASD 3JRHA 3OYFA 1VBLA 2VKVA 4OIQF 2DO7A 2XV4S 2R7SA 1QRYA 3ZUGA 4P2NA 4QTRA 2GOMA 1WI9A 3K1NA 3I53A 2F2EA 3BCFA 4R1HA 2HQNA 2X85A 1OFDA 5IY5H 2XVCA 1HOMA 1N25A 1IC8A 4HZFA 1VJSA 4BBSJ 2R7VA 2CRGA 2XF6A 2OUMA 4AC0A 4AVPA 1U2RA 1V5VA 3OAAA 5TV2A 3LL7A 5HS9A 2BY1A 2K40A 4UXNA 3SQVA 4BS9A 1R9TJ 3CRZA 3VOEA 4BPRA 3TO6A 2STWA 1I3AA 2GQQA 4DBQA 1IJWC 2E7WA 2RNGA 2DMNA 3H1CA 5HVQC 3MKZA 1MSEC 2DMUA 4MO7A 4HF2A 1OGJA 4XLFA 3OIQA 1OMIA 3JRCA 3CW2A 3NWTA 1WOPA 3SJPA 3KCCA 2OYNA 1PXZA 1LNWA 4ROXA 2R7TA 2DA3A 1MH4A 1R00A 2KP6A 3ZN0A 1IN6A 4EV0A 5CQGA 2QKLB 1N0VC 1WTHD 5DUKA 2PQ8A 4ZDOA 5F04A 4IF4A 4XKVA 3DV8A 2L54A 4M6VA 3NAUA 4EATA 3LVBA 3I56B 4PJNA 2VB6A 1BIBA 1JHFA 4CZZA 4KN4X 4FHTA 4CXFA 2ZZEA 1TWCJ 2FSWA 2E34A 1FBSA 2PMHA 2WV1A 4XONA 3N6ZA 3EQOA 3DQVC 1F1ZA 1W5SA 2WAEA 3VYTB 1J09A 2VLAA 3ASQA 1BJAA 3BJOA 2XGDA 5J4YA 1KTWA 1HDPA 5EZHA 5L3EA 4Z4YA 3SDGA 1BC8C 1D1CA 5J8CA 1ZRDA 3CTAA 1KYWA 5GAGJ 4ABZA 1O3QA 4YRVA 2KL4A 2HFHA 4AUXA 5J3OA 2XEXA 1TQMA 3R6JA 1HCRA 3FXOA 4HNTA 2VKDA 4ZTFA 4W8TA 1KU7A 2QQAA 2CS3A 1R4NB 5GTHC 3BTCA 3HOSA 1JUPA 1KQ8A 3FY3A 5DCMB 3ZQGA 2QA4I 1TVCA 4CSWA 1MNMC 3TO9A 5HNHA 2A69F 3KYCB 1H0MA 2ZL7A 2HDCA 2IQ7A 2OTLI 4KYWA 3RSNA 3ASSA 3BR3A 2N8GA 3KIOA 5IYCJ 1E2XA 1N05A 3CQZJ 4L5EA 3W2FA 1ONVA 2K4JA 2QX3A 1IN4A 3W3CA 2ZBVA 4DQKA 2R7FA 3ESWB 3V7SA 4KIFA 4G8XA 2ZSHB 1QVFB 3GQAA 3H0GJ 3OSGA 1JUSA 4ZZLA 1HG8A 1O88A 1WCMJ 1T0FC 2BE5F 4LLNA 2CW7A 2FEZA 4A12A 3RY8A 1JTAA 1SD6A 3BPXA 1D5VA 1WRJA 2MABA 2BM1A 4MR0A 4C43A 3LA7A 2VZLA 5BMZA 3ZMSA 4ZH4F 1H89C 3HIFA 4ZCMA 1OCPA 1X4PA 2NRAC 3GWZA 4LD5A 3HG9A 5FKKA 4ESFA 2H8RA 4QWQA 3S3OA 1I27A 4UY8I 1D2EA 4BE1A 3G05A 1G6NA 3NE5B 3WWGA 2P4WA 3PNVA 2XSJC 3E6MA 2BM5A 2OBSA 1I6HJ 1X1CA 1IRXA 3HGYA 3HOTA 5AIQA 1WP6A 1RZ4A 4I98B 2FA5A 4KIBA 1B72A 2WADA 2M4GA 1F5TA 1MMSA 3D5SC 2RN7A 2VFNA 3BR5A 4JP0A 1Q7YD 1ZG3A 5J1RA 2YWHA 3SLNA 1MBEA 2JJ2A 3CCEI 3SZEA 2ME0A 2XF7A 3DTIA 1DABA 4OIOF 3E3VA 1W87A 3LFKA 5E17F 1IJFA 2PIAA 2XNCA 1IV8A 3MHPA 4ZV4A 1O8IA 3BCBA 3GFMA 1WPKA 1I5ZA 5KNLA 3WTWC 2XC1A 1W0KA 2NS8A 1J2XA 3EYIA 1VTNC 1O8HA 5TJJA 1S7OA 4IX7A 2PJRA 4CCNA 2JVHA 3IH3A 1B6AA 3BLYA 2HTJA 4M3EA 4PGOA 4CYCA 5FD6A 3H36A 5F0FA 2R7RA 2X0KA 3V8LA 1A31A 3ES9A 3LQ6A 2GK7A 2BHYA 5M5YJ 3S2DJ 1OFCX 4EM0B 2QQBA 1QUEA 4BEHB 2A68F 2HI3A 2DPUA 3CD6B 1G4DA 3HRUA 1VQ4B 5ICEA 4D1QA 4P25A 2M30A 2VJIA 3L2QA 1PUFA 4HQEA 2BGJA 2K86A 3VMFA 1O8LA 1YX3A 2HOSA 1VQ8B 1UG0A 1UZCA 3LA2A 5F27A 2O8KA 5JVGF 2DFEA 1YI2B 3FIWA 3RQ4A 4F91B 1TUIA 3P9IA 1YLOA 3WG9A 2Y0SA 3AVWA 4X8IA 4W8QA 4E0FA 1EA3A 2E1CA 1TYUA 1BLIA 4OWRB 2VFMA 4Y9UA 1M90D 1LQ1A 4OZZA 2HYGD 2XTXA 3FK6A 4I99C 2F48A 1IHMA 1ZM2A 4M9ZA 1USTA 1M1KD 3S17J 2Z16A 2JSPA 1DU6A 3H94A 2WJYA 2OD5A 1TQIA 1FNDA 4CCJA 5B1BH 1P4AA 3N05A 1XDSA 1JRGA 1HW1A 3V42A 4Y13A 4BH9A 2F4NA 2HR3A 3V76A 1SMYF 3SEZA 4FQGA 2NNNA 2LVSA 3ZQIA 1LPQA 2VYQA 1T98A 1U8RA 3QPSA 2LTPA 4IRGA 4P12A 2MG4A 1VHOA 1VQ6B 1E3HA 1TW3A 2CGPA 3LQQA 2WY8Q 1O57A 2CUJA 2FQ3A 3RDIA 4J01A 1P4XA 2DLLA 4ZYGA 3QE2A 2X0LA 4XL9A 4RM2A 3V7RA 1ZAOA 4AYBA 1Y1WJ 3N97A 1VQPI 3WTYC 1IRGA 2DK8A 2C4TA 1YHQB 5KSWB 4CDGA 1SD5A 3TP3A 3DBHB 4K2EA 1VLYA 5DCFA 5D4RA 4A3IJ 2YR2A 6PAXA 1KQSB 2V6CA 2Z5UA 3L1PA 1YJ9B 3A3GA 1ZKGA 1WVRA 4FCYA 2K7LA 4YHBA 4PAAA 2W82A 2L9VA 4IOCF 3LOCA 2LKXA 3QRFF 1GJRA 3P26A 4FISA 4ZCIA 2QZ8A 2VN2A 3E5XA 2Z33A 2Y48A 4KMUX 2ZBUA 4D0PA 1B4AA 1DP7P 1VQKI 2XTYA 3ZMUA 3G71B 1Q81D 1K5CA 2OBPA 2A61A 2KLOA 2HEOA 1OYYA 3R0JA 2PMZN 3W2WA 3MD2A 4G6QA 1I6XA 3ZR8X 1YO5C 2OBTA 4BJTA 5K5RA 4ZCLA 5E3NA 2NYXA 4CZCA 3CUQA 4IO9F 4TMTA 1CF7A 2DFHA 5DM7F 4AIKA 1U8BA 1SFXA 2L0KA 3LSGA 2J8KA 4DBRA 4Z1MA 4B4CA 1ZUNB 2DCUA 1QUFA 2WY7Q 2R5YA 1IZ1A 5A8AA 3JX8A 1UHWA 4V2GA 4XQFA 1S7EA 2QBYB 2FD5A 2NZMA 4OOIA 3BTLA 5JBQA 4EVIA 4G12A 2VPLA 5A89A 1Z7LA 3BG3A 5K7FA 1DQUA 2NVTJ 4LITA 1DBGA 1A04A 3ZCOA 1MGTA 1H9GA 3E0JB 1XPXA 4RB2C 3WHCA 3GF2A 4M3GA 2QEXB 2WBMA 4G1BA 2VFPA 3QODA 2HDNB 4RD3A 3L2UA 3OYJA 5E3LA 5D5UB 2VC0A 5E1WA 5IT9Z 4DW6A 2BW3B 4P9SA 1AMOA 2EFWA 2OC6A 4OOSA 2DA1A 2X51A 2CW8A 4M3BA 1Y1VJ 2VOPA 3MN2A 4M72A 3EPZA 1VQLB 4B3FX 3VYUB 3WBKA 3JRBA 1JB9A 2GJRA 1F20A 1WQ2A 1YJNB 2EB7A 3DXJF 5LGNA 4A3MJ 3OOUA 5JMCB 1QVGB 2DA4A 1YITI 3JRDA 4HRIA 1V0FA 2QY1A 5D5XB 3HRTA 1YIJI 1X19A 4URRA 4HSTA 3PIPF 2HZDA 4BQQA 1RKTA 3QOPA 5HLHA 3GFLA 2BGIA 2K9MA 3A0HC 1O8GA 3E1YE 1KCCA 1T2KA 1GHCA 1R58A 2DOAA 4PFPA 3B6CA 3D5LA 2BXYA 1LLWA 4DJAA 4PGGA 2BM4A 5HODA 3IUOA 4Z2YA 1XB4A 1IB0A 3QFSA 3FMRA 3K9TA 3OW2B 1OFMA 2A05A 2CW5A 1OYWA 3ASOH 1YYVA 5C1EA 3OPOA 3GX4X 3G1OA 3I4PA 3J81K 2HVRA 1OGIA 3T8RA 4M4SA 4YALA 3IC7A 1W5CC 4YZXA 1GXQA 5JLVC 3AGPA 1QCXA 4RCYA 5ILSA 3WYAA 2CQQA 2JPCA 3TO7A 4A6DA 2E5ZA 1YX5A 3QFTA 2BYVE 5GADJ 2V7QA 4BL0B 2AXLA 5E3MA 5K5OA 3WY9A 1LE8B 3OZUA 3QPTA 1BOBA 2WV0A 5CJ9A 1O8FA 3QAHA 2LG4A 1K7AA 2LY1A 2H6CA 3WODF 3FZVA 5C3EJ 2Y75A 4BBRJ 3AVYA 5CVUA 4IL6C 4E7IA 2I5UA 1PVEA 1YX2A 2VBUA 1AU7A 2HOTA 4RGXA 4NBSA 1QRCA 5DNSA 4AWXB 1N77A 5M5XJ 4E7ZA 1H9TA 1NBMA 3ZZUA 2CJJA 1EV7A 4BQOA 2P8TA 4P3IA 5TISC 4UUVA 3BY2A 4B3GA 4RB1A 2P7VB 5BSXA 1R1TA 4OU0A 2C2WA 3CLQA 1HBXG 3CC4B 1QGAA 3DU1X 4YAWA 2RC6A 2BBYA 2X3UA 3OYAA 3BQZA 1A6QA 2C77A 3E5UA 4Q4ZF 1OKRA 1YW8A 1DGWY 3I71A 2R9VA 3DKXA 3DPLC 3KZIC 2M9HA 2WYRA 1NB0A 4YELA 2NVXJ 4RDKA 4OMYA 2M87A 4KDPA 1SKYB 2OAZA 4PUSA 1RMGA 2O0WA 4H4KC 4YDTA 2W00A 3HRSA 1R5HA 1G7SA 2BV3A 2M2EA 4S0HB 1IF1A 2TCTA 3IH4A 5HNFA 4G7HF 3RTRA 1I3QJ 4YFXF 5E6TA 4Y9RA 1XGSA 3H0DA 5E1ZB 3U2RA 5FIUA 1Y8RB 5KHDA 2V1DA 2BHZA 4QFMA 5F4JA 4D7NA 5B6IA 1KCDA 4XSZF 2WZPP 4WXCA 3OY9A 5E1XA 4A3KJ 1Z6RA 1WPCA 4R79A 4BDZA 4KISA 1VI0A 4LBYA 1TWFJ 3Q9VA 5JFRA 4UZEA 1FBQA 1NHAA 3IRQA 4RD2A 3VO1A 2R7OA 1MDMB 2LR8A 2MLGA 1PP7U 2ZXHA 3F8BA 1Q9SA 4PC7A 3HEFA 4LIVA 1OCRH 2YS9A 3LNQA 2P6SA 2BPOA 2Y30A 1LFBA 3BQJA 1EE6A 1H80A 1VQ5I 2CWEA 3CCLI 1BW6A 1T95A 3K4KA 2VBEA 3L2RA 2ZBKA 3JRGA 4N4OB 3W2HA 3GXOA 2F3LA 2HQAA 2O6WA 1PLUA 3W5HA 4MEXF 1D8JA 3E6BA 3DLLF 5HDNA 3OOPA 1P4WA 2J7KA 1XDUA 3SUCA 1Y8QB 2HS5A 1JT0A 3PQJA 1XSVA 3H5RA 2RDPA 5GTIC 3P9CA 1Z9CA 2PFBA 1BR2A 5D6EA 1RRJA 1G3WA 2R0QC 1MRZA 1UHMA 3NEUA 2R6HA 3W2EA 1O8EA 2O7OA 1W7PA 3RPQA 1WSUA 3ZPLA 4XNFA 3RQIA 4Z4TA 5IP7J 3FXJA 4HAMA 3ZP5A 5BPDA 3FDYA 2AHQA 5HS8A 3G6EI 4XD7A 2FMYA 3C2BA 5BQTA 5ED4A 4C2TA 2MH2A 3ZPNA 3BNWA 3WU2C 3LWFA 1UMKA 3PFIA 2A3SA 2GREA 3C7JA 2HOEA 3BG9A 2BY3A 3HM5A 4QPOA 3I59B 4OJLA 1IA5A 2KIMA 1MMGA 1VNDA 2DT5A 3RYPA 2V7XA 4QUZA 2NSTA 2FMLA 3GBGA 4HX8A 1D1NA 1K83J 3W6KB 4A6EA 3GYHX 1QQIA 1JE8A 3RIQA 4C0SA 2ZXJA 4NQWA 3LSJA 2X3HA 3OYLA 2ETHA 4FX0A 5LHIA 1X3UA 2L4AA 2LK2A
chains in the Genus database with same CATH topology
2NSPA 2W4SA 4BS9A 4KKTA 1O8JA 3EUHC 2K5CA 2LBFA 4DBQA 1LVKA 2E60A 3MKZA 2RNGA 5HVQC 3H5NA 1WJCA 1HA8A 2XNDA 3KRGA 3VMVA 4XLFA 2E1BA 4W8SA 3OIQA 4Z05A 1OOCA 3NWTA 1PXZA 1TZLA 2R7TA 4P1WA 3A4CA 3AKZA 4XLEA 5TGTA 1IDKA 3F9KA 2KP6A 1WJEA 2ZSIB 2V26A 3K4JA 5CQGA 2QKLB 1WTHD 3ZSCA 4ZDOA 1MMNA 2L2OA 2O5RA 4XKVA 2CK3A 2Z6BD 2BVMA 1Z3YA 4EATA 1E3ZA 1O8DA 4PJNA 5C1CA 2VB6A 2XZPA 4ZYAA 2IGKA 2PYGA 2ZZEA 4P22A 3BG6A 3FHNA 3OMYA 2DT7B 3OWTA 2V1NA 4B48A 2IGMA 2KRHA 3HPGA 4CCMA 4XONA 2WAFA 3EQOA 2M3AA 3DQVC 1X1BA 4B3XA 3T51B 2WAEA 3K4LA 3OEEA 3VYTB 1J09A 2IXSA 3D5RC 2VLAA 2HLDA 2L9SA 1KTWA 1Y56A 1E79A 2VQHA 2HNHA 2LREA 3LSMA 1D1CA 1MNDA 4YRVA 2KL4A 4XOTA 2WPDA 3DPTA 1BN8A 4HNTA 3K4NA 2VKDA 4ZTFA 2LZJA 2CS3A 2FUG2 5LD2C 2NTQA 4JMQA 3HOSA 3FY3A 4CSWA 4ZTJA 3EUKL 5HNHA 4OJ5A 1WJ5A 1G59A 2PJRB 3EQNA 2IQ7A 3NWSA 3RSNA 3AL0B 1E1QA 3GVJA 4FETA 4XLCA 3T9GA 3GQBA 3VYSB 3HAGA 3OYIA 1PJRA 1W36D 2ZZFA 2CUZA 2JA2A 3PNYA 2QX3A 3W3CA 1W9XA 3OIPA 4JQFA 3LMMA 2F43A 3LMWA 4YZ0A 1FX0A 2ZSHB 3DKYA 5DN6A 2XZLA 2VBKA 3GQAA 3GQ9A 2KQRA 1UD3A 1UD5A 1HG8A 2R7XA 1O88A 1JTAA 1T0FC 3PJRA 2CW7A 5IK2A 1ZELA 3VR6A 2HDWA 3PUBA 4PSXA 4ZDLA 4E7JA 3T53B 2MABA 4MR0A 2Q2EB 3ZGKA 4ITVA 1VF7A 2VQCA 1X4PA 1HVXA 1AIRA 1D1AA 4D9JA 3HG9A 1EFRA 4HNUA 3H35A 4DK1A 2XGJA 3S3OA 3VSVA 4BGDA 2JVGA 4BJ6C 4BE1A 3G05A 3ZRGA 2UWMA 4NUBA 4BJ5C 3NE5B 3T56B 4KJZA 3WWGA 2KHMA 2HPIA 2X1DA 1FMWA 3PNVA 1NHCA 3LSHA 2XSJC 4C2LA 4XLAA 2WSSA 3OYBA 1X1CA 1IRXA 3FBNB 3H9QA 3HOTA 1WP6A 2JJ1A 2M5SA 2L9NA 3VSLA 2XC7A 3K4BA 1E1RA 2WADA 2M4GA 3BCAA 1BPLA 2WAQA 3D5SC 5CPRB 2DJIA 2LC2A 3HC7A 1V0EA 4XKCA 3OL3A 2JJ2A 4F93B 2VJ4A 2XF7A 3DTIA 3K10A 4PJJA 3B4NA 5AMVA 1O8IA 4XMYA 3S3NA 2L5QA 4BE2A 3BCBA 2JUGA 2NTPA 4DK0A 4CCOA 5KNLA 2PMZA 2LOOA 1W0KA 2ODLA 4E7HA 1OR7C 2ZZQA 2A5WA 1O8HA 4IX7A 2LRDA 4J00A 2OV7A 2PJRA 4AU7A 4CCNA 2JVHA 4XLHA 2K3PA 3BLYA 5CQEA 4XOPA 2F1MA 3RPUD 3OYGA 2R7RA 3CMMA 4BQNA 1QJVA 3CESA 3OYKA 2MFZA 5CKTA 2GK7A 4Z03A 3VSTA 3IAS2 4BDYA 2E1MC 1H8HA 3M8JA 2P0WA 4BEHB 1UD2A 4IQJA 4D1QA 4P5OA 4U7BA 1OFLA 2VJIA 3CJQB 3HUGB 3L2QA 3DLAA 2QXZA 1V5GA 1I18A 3OW7A 1O8LA 1YX3A 2XDVA 4F92B 1UG0A 2R7QA 2W6JA 5LFAA 3RQ4A 4F91B 2JIZA 2Y0SA 3OR2C 4RLQA 2BVLA 3S93A 4W8QA 3OS1A 2XOKA 4E0FA 1EA3A 1WJBA 3SEQA 1E43A 1BLIA 2KDOA 2R4GA 4OWRB 1OGMX 4XORA 4OZZA 3AFHA 2UVFA 2IS2A 3AL0C 2Z16A 2JSPA 4II2A 3H94A 2WJYA 1N75A 4CCJA 4W8RA 3N05A 1JRGA 2NT9A 3A1YA 3V42A 3OYHA 3MKWB 4TKOB 1PE9A 2PECA 2KRCA 3LSKA 1V5FA 1O8KA 2X6WA 3SEZA 2DT6A 3GVKA 2XF5A 1QU3A 2WA0A 3HXLA 2PYHA 1H8EA 2X6XA 5FL7A 3GRHA 2K9LA 3BG7A 3FKJA 3FBIB 3DWLE 2Z2SB 3BC8A 2WY8Q 2CUJA 2INUA 2AQEA 3TL4X 4J01A 4ZDPA 1PYVA 4F52A 1WJDA 3C2HA 4XL9A 4CA0A 4RM2A 4AYBA 2X1CA 4N4NB 4Y33A 3ZXSA 4OAZA 3DTEA 3PL8A 4MLOA 2HVQA 1VLYA 1QHHD 4C2UA 3SDBA 2BSPA 4HG2A 4BEHA 4F55A 2O1DA 2M4KA 3A3GA 3H5AA 2V31A 3K4CA 3GVLA 2O17A 2IS6A 1MMAA 1D0XA 2HU9A 2W82A 3OS2A 2X8KA 2V7FA 2GJKA 4DNRB 4OZYA 1OHHA 3ONQA 1LDKB 2M7AA 2CV0A 2IGOA 4C9YA 2LH9A 4PJLA 3K70C 1N78A 1UELB 3ZIAA 2KLOA 3TMOA 3W2WA 3OYEA 3MD2A 3MMYB 3ZR8X 4YXWA 3OR1C 2VJ5A 4BJTA 3S32A 4I84A 4TT3A 2CV2A 2MC4A 4ANJA 4CZCA 3VMWA 1K28D 1IDJA 3VSKA 1X1AA 1LKXA 4YZAA 1YE9A 3LSGA 4YEJA 4DBRA 4Z1MA 3PSIA 2VASA 2NT6A 3VYRB 2IGNA 2WY7Q 3QYEA 1IB4A 4DIQA 4XQFA 5JHFA 1GQ8A 4KITB 2ZTGA 2NZMA 2VPLA 1KZLA 2RREA 1Z7LA 3J7AY 1DQUA 4NK6A 2VBMA 4LITA 1DBGA 3ZCOA 3E1SA 3QYFA 3K4MA 3KX2A 3SYTA 2CFOA 3E0JB 4E4HA 2VQGA 4HSRA 1NRKA 2WBMA 4DOZA 2W7NA 3OL4A 1WFXA 2WJVA 4RM3A 1W36C 3QODA 1X1DA 4NC8A 4XN0A 2X6YA 3L2UA 3OYJA 4YZQA 3VWBA 4G6TB 4EW9A 1KONA 2BW3B 2OC6A 2X51A 2CW8A 3GQ7A 4HPQA 2NTBA 2GJPA 3EPZA 3MKYB 1COWA 4KT6A 1DGRM 1R6RA 1VZ0A 4B3FX 3B8YA 3DPUA 3HKZA 1FMVA 2GOXB 3VYUB 3ZQQA 3CF2A 2UUZA 1HZEA 3OFNA 1BHEA 4KKUA 4PSWA 2GJRA 3BCDA 3OE7A 2F4IA 1U0JA 2Z1DA 2O04A 4U4BA 3OOUA 1I8DA 4LG3A 3GQ8A 4PMHA 1Z3XA 4HRIA 4IZZA 1V0FA 2QY1A 1RWRA 4L8JA 2INVA 1X19A 4URRA 4HSTA 4LIUA 4BE0A 4DNTB 2HZDA 2A6TA 4BQQA 2GK6A 3W2AA 3JURA 4G7XA 2ELJA 3BH4A 2K9MA 2Z8GA 1P9QC 2CH0A 2QE7A 4E7SA 1O8GA 1KCCA 2L7KA 2DOAA 4PFPA 2DIEA 3D5LA 2IS4A 4DJAA 3I3LA 2BOLA 2JDIA 3IUOA 1O8MA 2I8DA 4MXNA 1D0ZA 2XAUA 4RMNA 3OYMA 3KEWA 1OFMA 4HIZA 4E6KG 2UVEA 4CCLA 3OYNA 3HPHA 4BXFA 1Z21A 2RQQA 4CCKA 2HVRA 1KMHA 2D3LA 3OPOA 1E0EA 4YZXA 3KEYA 3LSIA 2LY2A 2W1OA 4PK4A 1QCXA 3LL7A 1WMRA 4JOMA 2M7BA 3RCOA 2E5ZA 1YX5A 2ZXIA 4NC7A 4BL0B 2V7QA 4TSFA 1XG2A 3OOCA 2V6EA 2VQLA 1GLNA 5HLTA 1BOBA 3CP2A 1O8FA 2LG4A 1BR1A 1SAUA 2LY1A 2WB1A 4NK8A 3HL2A 4ASUA 2KPMA 3WQZA 4U49A 4E7IA 5HOOA 2R7WA 2M0MA 3JU4A 3CJRB 2EWEA 2BW3A 4II3A 1OB0A 1V5EA 5CDFA 1RU4A 3L2VA 1BMFA 1N77A 3QYBA 4E7ZA 1NBMA 3OEHA 4XN3A 3KYLA 4BQOA 4B3GA 3K70D 2CMPA 2CV1A 3DU6A 3UW0A 2E1MB 3W2VA 4GRIA 1TT0A 4IKFA 1E3XA 4RLFA 2KMUA 4BACA 4G6IA 2VIXA 2Q1ZB 2NOJB 3OYAA 2QKMB 5FRMA 1DP3A 1PKVA 2V9KA 4X0GA 1DGWY 2R9VA 3DKXA 3DPLC 3OYDA 3S8PA 3K6GA 4B44A 4UZUA 1T5EA 4YELA 3PNTA 2F6CA 4OAYA 3H9JA 3QOEA 4C30A 2ZZGA 1SKYB 4PUSA 1UD6A 1RMGA 2O0WA 4H4KC 2MD0A 2F5VA 2W00A 2UV1A 3FKSA 2X53S 3IP4B 5HNFA 2DXIA 4G7WA 3RTRA 5HKKA 3A35A 4B43A 3SZGA 3LFUA 2DCEA 4QPQA 1WJAA 1UD8A 3DTKA 3H0DA 1OLTA 4NQWB 3LNNA 5KHDA 1CZFA 4BUPA 4DGWB 2R7UA 1QHGA 2X1EA 4XR6A 1KCDA 4F3QA 2WZPP 1WPCA 3OY9A 3S3MA 4W8TA 4R79A 4BDZA 4KISA 1NG6A 2W6IA 3DDYA 4IQ4A 3PSFA 4CH7A 1ERDA 2VXZA 2R7OA 3BC9A 2LBFB 3I9V2 4FXUA 4PJMA 2ZXHA 4XKBA 1AA7A 3EUAA 3DU5A 4XM3A 4ZC3A 4LIVA 4BU2A 1X4OA 4AVZA 1OGOX 2KVOA 1G8XA 2KZVA 1SFKA 4U87A 3U21A 4KKSA 2HVSA 1EE6A 1H80A 2D3NA 1K5CA 3A3BA 3VSUA 4GQNA 3ZPPA 3K4KA 1T95A 2MYSA 3A2KA 3L2RA 2VBEA 4HEA2 1BR4A 1Y6IA 2VXDA 4N4OB 5FROA 4B47A 4NNJA 2HQAA 1UD4A 3L2WA 1PLUA 3FPPA 3IAM2 2VL8A 1S9HA 4HWVA 2VKHA 1MW7A 3PFYA 1MABA 3SUCA 4XKWA 2AQFA 2LYCA 3CZ6A 4PFOA 3H5RA 2VJJA 4ZJZA 4Y4RA 4E7KA 2O0VA 1WJFA 1BR2A 3VDXA 1MMDA 4CUGA 1LFPA 1O8EA 3CP8A 2IS1A 4XNFA 1X0CA 3TBIA 4E7LA 1UAAA 5C1EA 1MNEA 1NG7A 3H9GA 3UR3C 3B90A 4OJPA 2ZFUA 2ZTNA 3UNGC 1W0JA 4OJ6A 3FDYA 4Y3OA 4FASD 3OYCA 2XZOA 3OYFA 3M1CA 1JI8A 4XD7A 3OS0A 1D0YA 4C2TA 3G2BA 3ZPNA 1DBOA 1VBLA 2R7SA 2GOMA 3BCFA 2X85A 4QPOA 1IA5A 4OJLA 1MMGA 4OJOA 2E5NA 3C2GA 2NSTA 3GBGA 2V4JC 1VJSA 2R7VA 2XF6A 2OUMA 2HPMA 1K6YA 2V4DA 4Z06A 2X3HA 1D1BA 3OYLA 5FRNA 3OAAA 3DEEA 5KCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSP A;  4OZY A;  2EWE A;  1RU4 A;  1O8J A;  4XN3 A;  3B4N A;  3KRG A;  5AMV A;  1O8I A;  4XMY A;  3UW0 A;  3VMV A;  4I84 A;  4XLF A;  4W8S A;  4Z05 A;  2NTP A;  1OOC A;  3VMW A;  1IDJ A;  1PXZ A;  4XLE A;  2ODL A;  4YZA A;  4YEJ A;  1IDK A;  1O8H A;  2NT6 A;  4XLH A;  4XOP A;  1IB4 A;  4XQF A;  4YEL A;  1GQ8 A;  3ZSC A;  4XKV A;  2NZM A;  1QJV A;  1RMG A;  1O8D A;  2O0W A;  5C1C A;  4Z03 A;  3VST A;  4NK6 A;  2PYG A;  2VBM A;  1DBG A;  4XON A;  3EQO A;  1OFL A;  1CZF A;  2VJI A;  2QXZ A;  1KCD A;  4XR6 A;  1O8L A;  4XN0 A;  2X6Y A;  4YZQ A;  4W8T A;  1KTW A;  4EW9 A;  4W8Q A;  3GQ7 A;  2NTB A;  3B8Y A;  4XM3 A;  1OGO X;  4AVZ A;  1OGM X;  4XOT A;  4XOR A;  1BHE A;  1BN8 A;  4OZZ A;  1EE6 A;  1H80 A;  1K5C A;  2NTQ A;  2UVF A;  3VSU A;  3FY3 A;  3ZPP A;  2O04 A;  4U4B A;  2VBE A;  4PMH A;  3GQ8 A;  4OJ5 A;  2QY1 A;  1RWR A;  1PLU A;  2INV A;  4W8R A;  3EQN A;  2NT9 A;  1JRG A;  2IQ7 A;  4URR A;  4HWV A;  4XLC A;  3JUR A;  3T9G A;  3SUC A;  4XKW A;  1PE9 A;  2PEC A;  1O8K A;  2Z8G A;  2X6W A;  1O8G A;  1KCC A;  2QX3 A;  2VJJ A;  2O0V A;  2PYH A;  2X6X A;  1O8M A;  3GRH A;  3LMW A;  4MXN A;  4YZ0 A;  1O8E A;  2VBK A;  3GQ9 A;  3GQA A;  1OFM A;  1HG8 A;  1O88 A;  4XNF A;  1JTA A;  1X0C A;  2UVE A;  2INU A;  5C1E A;  3B90 A;  4MR0 A;  4OJP A;  4OJ6 A;  4XL9 A;  4YZX A;  1VBL A;  1DBO A;  1AIR A;  1QCX A;  3VSV A;  1WMR A;  2X85 A;  1IA5 A;  4OJL A;  3WWG A;  1NHC A;  4OJO A;  2BSP A;  1XG2 A;  2NST A;  4C2L A;  4XLA A;  1O8F A;  2O1D A;  4NK8 A;  4Z06 A;  2O17 A;  2X3H A;  4U49 A; 
#chains in the Genus database with same CATH topology
 5EG0 B;  1TLH B;  2Y0M A;  3CMY A;  1BX1 A;  4HW0 A;  3EUH C;  2K5C A;  2X48 A;  2ISY A;  2LBF A;  3KP4 A;  4PC6 A;  2E60 A;  3L7W A;  2GIZ A;  2XND A;  3DBL B;  1WJC A;  1AKH A;  1NDH A;  4W8S A;  4Z05 A;  2D9R A;  3ZMD A;  5THX A;  1U5T C;  1GAW A;  2R5Z A;  2VFQ A;  1TQP A;  1TZL A;  1ZK8 A;  2CQK A;  2W85 A;  4P1W A;  2QYU A;  5TGT A;  1IDK A;  4LK0 F;  3W5U A;  1WJE A;  2ZSI B;  1ETX A;  2ZKZ A;  2WZN A;  2V26 A;  3K4J A;  1APL C;  2PI0 A;  1HST A;  4YEI A;  2VNI A;  3ZSC A;  3WGH A;  3NQO A;  2O5R A;  3A8K A;  2CK3 A;  1ZRF A;  3CXC B;  1Z3Y A;  2A6E F;  1E3Z A;  3Q39 A;  1VF9 A;  1T33 A;  2IGK A;  2BSA A;  5HS7 A;  3BG6 A;  3FHN A;  3A01 A;  3OWT A;  2M5W A;  2IGM A;  3F0C A;  4DNC A;  4EEF G;  4YAO A;  1J5Y A;  4I02 A;  3I4M J;  1E64 A;  1Q82 D;  2M3A A;  4B3X A;  3AG4 H;  1ZRE A;  3OEE A;  1EZG A;  1V4R A;  1BM9 A;  1K6O A;  3D5R C;  5L3F A;  2L9S A;  3HOV J;  4WX9 A;  1N06 A;  2HNH A;  3BPV A;  4K1X A;  2V1U A;  2JMW A;  1FLI A;  4KH3 A;  2EA2 A;  1ETV A;  2WPD A;  1CQX A;  3DPT A;  1TTY A;  1BN8 A;  3ECO A;  2QTL A;  1RUO A;  3PA2 A;  2ZFW A;  2B7E A;  5A2Q K;  5K7Z A;  5F1R A;  4JYK A;  2ZIT A;  4LFU A;  1K78 B;  3WTV C;  2IOU G;  3CMA I;  4Z4Z A;  3A0B C;  3S2H J;  2L3D A;  3EQN A;  4WZT A;  3Q9S A;  2VE9 A;  1BI0 A;  5FD5 A;  1LDD A;  5FKL A;  3FXU A;  4FET A;  4M73 A;  3CCU I;  2D5V A;  4BNC A;  1E1Q A;  4TMW A;  1QVU A;  3VYS B;  2GIV A;  2QLZ A;  4I7H A;  4L0Z B;  2LY9 A;  1PJR A;  5A88 A;  3PEN A;  2CUZ A;  2DTZ A;  4TMV A;  3CCM B;  1ZHF A;  2ZJP F;  2LNB A;  3G73 A;  1Y39 A;  2P7C B;  3OIP A;  4JQF A;  2UXN A;  3LMM A;  3OKX A;  2XZL A;  3F6O A;  2NV4 A;  1SVL A;  4NC6 A;  5J6X A;  5FB2 A;  4WF2 A;  1EP1 B;  1VQ7 B;  3VR6 A;  1X1P A;  4MQV A;  2MLK A;  2Q2E B;  5HLI A;  2LKS A;  5FA6 A;  4ITV A;  3LSR A;  3LQR A;  2EFO A;  3OJW A;  1AIR A;  2XNJ A;  3TGN A;  2IW5 A;  4HNU A;  1OR7 A;  4DK1 A;  2XGJ A;  4BGD A;  2EK5 A;  2JVG A;  4BJ6 C;  1WWX A;  1MBF A;  2W84 A;  1LEB A;  3T56 B;  4KJZ A;  4UVA A;  1Z91 A;  2KHM A;  2HPI A;  4YAF A;  1FMW A;  3ASN H;  4X7E A;  1NHC A;  4X7D A;  4C2L A;  3JQQ A;  4XLA A;  2XPU A;  4M9S A;  3J7A O;  1TWG J;  2V1X A;  3G1L A;  4ON0 A;  4GDF A;  4A0Z A;  5J8F A;  2M5S A;  1GVD A;  2JJ1 A;  4P26 A;  2FBH A;  2L9N A;  3VSL A;  1E1R A;  1S72 B;  3WGI A;  1BPL A;  3BCA A;  3GVA A;  4B1R A;  2V7W A;  4M71 A;  2O9L A;  2ID6 A;  3CME I;  4V02 C;  2DJI A;  2OU2 A;  2MW8 A;  2EV6 A;  1G3S A;  1HKT A;  4MIM A;  4AF6 A;  4F93 B;  3JSP A;  3K10 A;  1YW7 A;  4X07 A;  4N3N A;  5GV8 A;  5D4S A;  4BE2 A;  1O7L A;  1GXP A;  2JUG A;  5BSY A;  1ULY A;  4DK0 A;  3WG7 H;  4CCO A;  4UUS B;  4RPD A;  2LOO A;  2BZT A;  1L1I A;  5DCM A;  2ZZQ A;  4A3G J;  1MJ9 A;  1G7T A;  2LRD A;  1NB9 A;  4DQL A;  2JK3 A;  1WDT A;  4IVN A;  3CC2 B;  4HX4 A;  1CLW A;  1R36 A;  3CMM A;  2OBR A;  3X2Q H;  4YC5 A;  1SAX A;  1QJV A;  2UXX A;  3CES A;  1X2M A;  3VST A;  3V8J A;  1P92 A;  1H8H A;  1RET A;  2DN0 A;  1O3R A;  3UKG A;  2DA2 A;  1DU0 A;  4HDV A;  4IQJ A;  1OFL A;  3CJQ B;  3IH2 A;  2QXZ A;  1HC8 A;  3J80 K;  2G0Y A;  1XS9 A;  2R7Q A;  3QP5 A;  5LFA A;  1WXR A;  2ELH A;  2D2W A;  4DZJ A;  1E63 A;  2JIZ A;  2BVL A;  3S93 A;  1TL8 A;  1R1V A;  2BM0 A;  1YJW I;  3SEQ A;  1FIP A;  4AYB N;  1VQ9 B;  2ZO4 A;  4I76 A;  5L3G A;  1ELO A;  1OGM X;  4XOR A;  5FFZ A;  1E3O C;  2HZT A;  3GFJ A;  4YII A;  2VUM J;  1MJB A;  2V7U A;  3KZZ A;  1H42 A;  2DJN A;  2UVF A;  5ICG A;  2RC4 A;  2LSO A;  4RAF A;  3I1F A;  3BR0 A;  4B4D A;  2VBY A;  3AL0 C;  2VNH A;  3ABM H;  1FTT A;  3PA1 A;  4KIG A;  1O4X A;  4OM9 A;  3CCR I;  2COM A;  3A1Y A;  3O6B B;  5EYR A;  2JRT A;  3MKW B;  4TKO B;  1PE9 A;  2PEC A;  2KRC A;  4C3H J;  2EH3 A;  2XPV A;  1Y0Y A;  4H9G A;  3GVK A;  1GO2 A;  1ZN2 A;  4M3D A;  4GYG A;  1V55 H;  1SVO A;  2XGX A;  3FXK A;  3HOX J;  1D8T A;  5FL7 A;  2PYH A;  2EZI A;  3SFI A;  3D26 A;  1R22 A;  4P9F A;  3BG7 A;  3FKJ A;  4HQM A;  2GXB A;  2P5K A;  3BTJ A;  2Q6I A;  3DWL E;  4WXD A;  2Z2S B;  2EJR A;  2DY1 A;  4RAG A;  1ETQ A;  5IT3 A;  2DER A;  2AQE A;  3TL4 X;  4KUM A;  2H8W A;  4ZDP A;  2ELK A;  4HYE A;  1FP1 D;  3P9K A;  4CA0 A;  3SLD A;  2OTJ B;  1JJ6 C;  3PO3 J;  4H0E A;  4Y33 A;  4M0L A;  4NCN A;  3ZXS A;  1EFC A;  1USS A;  4OAZ A;  1ZLK A;  1ZM4 A;  3PL8 A;  1FDR A;  4MLO A;  1LVA A;  3BTI A;  4HG2 A;  2WAQ N;  3ABT A;  4BEH A;  2V5I A;  4ESJ A;  5E8I A;  2VPR A;  1PUE E;  2C4U A;  1Z67 A;  2V31 A;  1LEA A;  2O17 A;  1TYX A;  2QVO A;  2HU9 A;  3KP6 A;  4Z4W A;  4LK1 F;  1E3P A;  2X8K A;  5IYB J;  1VQO B;  2W7Z A;  1OHH A;  3HYI A;  3ONQ A;  4IHX A;  2B5O A;  4NBQ A;  4RJL A;  3CPW B;  1LDK B;  2M7A A;  5LRR A;  2CV0 A;  2IGO A;  1R5I D;  1N8R D;  2OK8 A;  1R4M B;  4PJL A;  3W2I A;  3K70 C;  4NHJ A;  1POG A;  4I09 A;  2MH9 A;  1OIS A;  5IOZ A;  1P7J A;  2OA4 A;  3L00 A;  3OR1 C;  4XLP F;  3JRI A;  3ZQH A;  3OJX A;  4BXU A;  1QVT A;  5J1Y A;  3Q6Q A;  2MC4 A;  4ANJ A;  2KRF A;  2W57 A;  1UMQ A;  2STT A;  1K28 D;  1T08 B;  1EWY A;  3A8J A;  1LKX A;  4L9V A;  1O3S A;  2DOF A;  4KN7 X;  3G4S I;  3PSI A;  5DTD A;  2Z99 A;  4IHS A;  5M3M J;  1IB4 A;  2FNP A;  3RKX A;  2F5C A;  2IBD A;  4DIQ A;  5JHF A;  4KIT B;  4FX4 A;  1JJ2 B;  3RIR A;  1XFO A;  1UJ8 A;  2K85 A;  2RRE A;  3A02 A;  3KPH A;  1KZL A;  3BY1 A;  3PUM A;  3BH7 B;  3J7A Y;  2LLK A;  4NK6 A;  3Q0U A;  1JKP C;  3M9A A;  3SYT A;  2CFO A;  4L9J A;  4C3J J;  2VE8 A;  3JRA A;  3WTX C;  3IV5 A;  3PIO F;  2D1V A;  3F72 A;  3F8M A;  3CCQ I;  1S8N A;  5FFX A;  1X1D A;  4NC8 A;  4L0Y B;  2KIF A;  3I55 B;  4YZQ A;  4A2U A;  2IPQ X;  3R60 A;  1JNY A;  1K61 A;  4EH1 A;  1VQM B;  4OPV A;  3GQ7 A;  1IN7 A;  2DOE A;  1X3Z B;  2JA8 J;  3A8I A;  2GJP A;  3S1Q J;  3MKY B;  4O5V A;  4KT6 A;  1QO0 D;  1VZ0 A;  2K02 A;  3KYD B;  3CCS I;  1ACI A;  2CBX A;  1FMV A;  4G9Y A;  2O8X A;  4JBA A;  3CF2 A;  2UUZ A;  1O7F A;  5DS9 A;  2I1L A;  3OFN A;  5B5E C;  1GV5 A;  2CQX A;  3ASP A;  3BCD A;  4Y15 A;  4YCQ A;  1CGP A;  5GPC A;  2G7U A;  1U0J A;  3MZY A;  1X3W B;  4U4B A;  3TP0 A;  4PC2 A;  4IRH A;  1QG0 A;  3GQ8 A;  3ZMV A;  4QVA A;  1RWR A;  1TYW A;  3CC7 B;  1FPQ A;  1EJ9 A;  2D45 A;  4LIU A;  4BE0 A;  1XMA A;  2GK6 A;  2A6T A;  1OQY A;  5B66 C;  1YFH A;  4A5N A;  4G7X A;  1WSV A;  2G9W A;  2QE7 A;  4E7S A;  2L02 A;  2L7K A;  1DPU A;  2DIE A;  3QFC A;  4HNV A;  2CO5 A;  2BOL A;  2I8D A;  3GEZ A;  2LFB A;  5HDG A;  1A35 A;  2HWV A;  3R61 A;  4WZL A;  3MEX A;  1OCT C;  1U3E M;  4E6K G;  2UVE A;  2HYF A;  3BR1 A;  5ICF A;  4UUT A;  3OYN A;  3GTK J;  2D3L A;  2RQQ A;  3F22 A;  3BG5 A;  3BY6 A;  1UG2 A;  1UHS A;  3HSF A;  4YFO A;  5E20 A;  2LY2 A;  2OZ6 A;  2DOG A;  2FQ4 A;  5C44 J;  4IJA A;  2QBY A;  1SD4 A;  4LBV A;  1WMR A;  4XID A;  3ZQ7 A;  2M7B A;  1KGS A;  2A5Y B;  4Q48 A;  4NC7 A;  3S14 J;  5IYP A;  4TSF A;  3S15 J;  3WU1 B;  3TED A;  2ZJQ F;  1ZGJ A;  2HQ5 A;  4RS8 A;  3VEP A;  2VQL A;  4W1U A;  4LLG F;  1IXR C;  1GLN A;  3GW2 A;  3MZH A;  1ZGW A;  4CQJ A;  1KQ5 A;  3HHG A;  4B8X A;  3FXL A;  5BOX A;  2F5F A;  2C5B A;  3KEO A;  2EFQ A;  3HL2 A;  3CCJ I;  1H88 C;  2ID3 A;  4RGR A;  2XTW A;  2DBB A;  5J40 A;  1JTY A;  2DMQ A;  2M0M A;  1XQB A;  3CJR B;  5H6Q A;  5EEA A;  3CDL A;  1IN8 A;  2BW3 A;  1XCB A;  1OB0 A;  1V5E A;  2OJE D;  1RU4 A;  1BMF A;  3QYB A;  2ZJ2 A;  1KQ9 A;  4HLY A;  1R71 A;  4HF1 A;  4XN3 A;  3KYL A;  3RZO J;  1XSD A;  3ZOB A;  1ZTR A;  2KT0 A;  1F60 A;  4ENK A;  1ZM3 A;  3LAP A;  2E1M B;  1FOK A;  3UW0 A;  3ML6 A;  4HA8 A;  2PG4 A;  2O3F A;  3FK7 A;  2IA2 A;  4GRI A;  3V7C A;  4IKF A;  1E3X A;  4ZYD A;  1T6Z A;  4RD4 A;  2VIX A;  2FE3 A;  4OP7 A;  4EGZ A;  3F6V A;  1DP3 A;  2XKP A;  2BM6 A;  2FOW A;  5GV7 A;  4V19 K;  3S2W A;  3SZP A;  3F3X A;  2Q6L A;  3B8H A;  1U5T B;  1J0R A;  1DG1 G;  3PNT A;  2F6C A;  3FHZ A;  3H9J A;  2ZZG A;  4TV7 A;  1UD6 A;  3CCV I;  2CRV A;  3E97 A;  1QX4 A;  1IRZ A;  3J81 k;  2LMD A;  1HKQ A;  3IP4 B;  4BAY A;  1D8K A;  3ZQL A;  2XPW A;  1XMX A;  1KA8 A;  2QM3 A;  3LFU A;  2DCE A;  3LST A;  4QPQ A;  4YIR X;  1QQ1 A;  1R7J A;  1GDT A;  1HQC A;  1VHE A;  2J5P A;  4DGW B;  4EQQ A;  2X1E A;  3S3M A;  2L7M P;  1F4K A;  4IQ4 A;  2HGC A;  3SY2 A;  4OIP F;  2EPF A;  3B6A A;  2VXZ A;  5H6R A;  3TKY A;  1PJ5 A;  2GWR A;  5IP6 A;  3I9V 2;  3BC9 A;  5F4M A;  1BA5 A;  1EH8 A;  4ACB A;  4MQ9 F;  5F0H A;  1QZZ A;  1HW5 A;  2DU9 A;  2E1N A;  4XM3 A;  2XB5 A;  3T0Y A;  1OGO X;  2M8G X;  2KVO A;  1YOV B;  5LLQ A;  3LYC A;  3ZZT A;  4JK1 X;  2K3F A;  4WZE A;  1RQP A;  3U21 A;  1LE8 A;  2HVS A;  4KKS A;  2D3N A;  2DYI A;  2YWG A;  3VSU A;  4GQN A;  3JCU C;  1H85 A;  1NK3 P;  5FLV A;  1WOR A;  2CC2 A;  5FNZ A;  3SJZ A;  1RNL A;  2E7X A;  1UD4 A;  2HCJ B;  3FPP A;  1RR8 C;  3IAM 2;  2KZG A;  2KIQ A;  2R3S A;  1S9H A;  2ZNZ A;  1M1E B;  2FBK A;  2VKH A;  2ADU A;  2ZJR F;  1FNM A;  5DD4 A;  3D1N I;  1MAB A;  1PJ7 A;  2XHK A;  4YFN F;  1ETK A;  5E79 C;  1KQ0 A;  1OB2 A;  2AQF A;  2H6B A;  2LYC A;  1R1U A;  3ZN1 A;  3OZW A;  1FC3 A;  2JJ7 A;  2O0V A;  3I5U A;  2FOK A;  3VDX A;  1ETO A;  4P96 A;  3JQP A;  1U6G A;  1X0C A;  4E7L A;  3QSY A;  5HDK A;  4EJO A;  1S3J A;  4RAY A;  1KK2 A;  4XRS A;  4OJ6 A;  3UNG C;  4BKX A;  5H59 A;  3JAM Z;  4Y3O A;  1JI8 A;  3OS0 A;  1DBO A;  2JWT A;  3G2B A;  1V54 H;  3WTT C;  2BEO A;  5M3F J;  2M45 A;  3I4N J;  5LEK A;  4LB6 B;  3VFZ A;  3RPU A;  1TWH J;  1DDG A;  1H8A C;  3TH0 A;  3H3U A;  4I0A A;  3W6J B;  2GXG A;  4OJO A;  1IAW A;  3JTH A;  2FX0 A;  1RC9 A;  2BXZ A;  2V4D A;  4RGS A;  2DA7 A;  2DOD A;  4ENJ A;  1JKO C;  2ZME C;  2M34 A;  5FRN A;  5K1Y A;  2YUH A;  1IW7 F;  3OYE A;  2CV1 A;  2W4S A;  2RV8 A;  1WZ2 A;  2V79 A;  1KTV A;  3MCZ A;  3I64 A;  5EGO B;  3GIR A;  4KKT A;  1BL0 A;  1O8J A;  1MDM A;  1JKQ C;  2F5D A;  1LVK A;  1MSF C;  3MWM A;  1HA8 A;  3H5N A;  2MSY A;  1W4M A;  1QFJ A;  3HRM A;  3KRG A;  1SKQ A;  1Y0R A;  1IO2 A;  2XB0 X;  3ISP A;  4F7Z A;  2E1B A;  2FBI A;  4RBO A;  3O2P E;  3IKV A;  4GO1 A;  4IEJ A;  2W48 A;  5L46 A;  5AN9 A;  3A4C A;  5ERI A;  4XLE A;  2M1B A;  1ZR2 A;  4ENN A;  3S16 J;  2HDD A;  2EZK A;  3BR6 A;  2KIS A;  3IWF A;  1RUN A;  5IYW A;  4XLN F;  3I56 I;  2DDB A;  1MMN A;  1K4T A;  3BR2 A;  5F6F A;  5E18 F;  4ZGN B;  1VQN B;  2BVM A;  2D1H A;  1O8D A;  5C1C A;  5JLW A;  1QA3 A;  2WWY A;  1CF7 B;  2GQF A;  4ZYA A;  2XZP A;  5FJ8 J;  2PYG A;  1PJ6 A;  4P22 A;  3MFK A;  2HXO A;  2V1N A;  1BN5 A;  3FM3 A;  2IVM A;  4CCM A;  1U9O A;  2EV0 A;  2WAF A;  2M8E A;  2R5Y B;  1E62 A;  2A6H F;  4MTD A;  1DDI A;  4HV5 A;  5FLM J;  1ZLJ A;  3NAW A;  2ECB A;  2IXS A;  1KJZ A;  1DAR A;  2HLD A;  2AXT C;  3EDP A;  1W1W E;  2L4M A;  4BXX J;  1Y56 A;  3ERM A;  1T0F A;  3DP7 A;  2VQH A;  2PN6 A;  4DZP A;  2G0E A;  2Z9O A;  5E8G A;  2J8I A;  4KMF A;  4OPS A;  5KVR A;  1MND A;  2CFX A;  2P81 A;  4EJV A;  3I59 A;  1K79 A;  2QSF X;  2X6O A;  3FM5 A;  2LZJ A;  4R71 A;  1K4S A;  2K9N A;  2FUG 2;  3IL2 A;  5LD2 C;  2NTQ A;  4JMQ A;  4LG0 B;  2NXN B;  1ZRC A;  3EUK L;  2Q8K A;  1K73 D;  4OJ5 A;  1G59 A;  3U1K A;  1FJL A;  5EEH A;  2DAO A;  5EG0 A;  4LC0 A;  3C3W A;  2QA4 B;  2CG4 A;  1JXS A;  3AL0 B;  4PC3 A;  1SVM A;  1HW2 A;  4LBW A;  4XLC A;  3T9G A;  3QQA A;  2K9Q A;  1OPC A;  1IXS B;  3HAG A;  5IYN A;  2H94 A;  2NS7 A;  3K2A A;  2ZZF A;  2OTL B;  2JA2 A;  1BBY A;  3PNY A;  5TRD A;  4I2O A;  1W9X A;  2QTZ A;  1IDZ A;  3LMW A;  1AOY A;  1FX0 A;  5DN6 A;  4KT5 C;  2VBK A;  3ELK A;  1UD3 A;  1XCV A;  3BWG A;  1FT9 A;  3HZJ A;  5IK2 A;  1ZEL A;  4GCV A;  2HDW A;  3PUB A;  4ZDL A;  3JTG A;  4E7J A;  4X6A J;  5D5W B;  4QLC U;  4QSH A;  2ZC2 A;  3R6S A;  1VF7 A;  1QNT A;  1EXM A;  2WTE A;  2CYY A;  1HVX A;  3N90 A;  4GYI A;  3KE2 A;  1LUJ B;  1Z77 A;  3Q0V A;  4D9J A;  4I01 A;  5A2Q Z;  3JRF A;  2Y9Z A;  1FYK A;  1AHD P;  1HA3 A;  4U7D A;  4A69 C;  2UWM A;  3HSR A;  1BI1 A;  4YFK F;  2HYJ A;  4JRA C;  2EIX A;  4MHG A;  4U0W A;  1IUY A;  1T6X A;  3MKL A;  4G7Z F;  2WSS A;  3NB2 A;  2V7V A;  4L18 B;  3G3Z A;  4CGZ A;  3K4B A;  2JSC A;  4C3I J;  3SXY A;  5CPR B;  2EIM H;  2LC2 A;  3HC7 A;  4V2F A;  1QA6 A;  1IGN A;  4IXA A;  1I7P A;  1V0E A;  3ML3 A;  3RKW A;  4XKC A;  3BH6 B;  3PO2 J;  3OL3 A;  4PGH A;  4RPB A;  2ZL6 A;  3R6K A;  3P27 A;  3ABU A;  3HBL A;  4RCZ A;  1GT0 C;  3CCE B;  2NTP A;  2KIU A;  2DMT A;  2ACJ A;  1YLF A;  2PMZ A;  3IHU A;  2PX9 A;  2NVU B;  1SFU A;  2ODL A;  4E7H A;  4RDJ A;  2A5W A;  1Z6T A;  4LJZ F;  1K78 A;  4J00 A;  2OV7 A;  4AU7 A;  2FXA A;  2R7D A;  4XLH A;  5CQE A;  1QZY A;  1W35 A;  3RPU D;  1HKS A;  4AD9 A;  2F1M A;  2F5E A;  3OYG A;  4G5G A;  3RKY A;  4BQN A;  1FBU A;  3P7N A;  1HF0 A;  5CKT A;  4Z03 A;  3R0A A;  4UAJ A;  3IAS 2;  2E1M C;  1OCC H;  3DF8 A;  1VQ4 I;  3CD6 I;  2P0W A;  3WNC A;  3PM1 A;  1KK1 A;  3VPR A;  3Q6R A;  1VQ8 I;  4P5O A;  1FNN A;  3QPH A;  3HUG B;  1RIO H;  1YI2 I;  1V5G A;  4MFD A;  4UV9 A;  4HE5 A;  2FX3 A;  4F92 B;  2Q2E A;  1UB9 A;  4JX5 A;  1Z0X A;  1HF2 A;  3HDD A;  5CVV A;  2GM4 A;  2R92 J;  4RLQ A;  3OR2 C;  2F4M B;  1FYM A;  1GVJ A;  1ZG5 A;  2XOK A;  2BY2 A;  3ONY A;  3AVV A;  1LJ9 A;  1OCO H;  1TSP A;  5FGM A;  1A8P A;  1E43 A;  1YS7 A;  3J7Z I;  2L01 A;  3AFH A;  3V7A A;  5ICC A;  2E71 A;  4YAU A;  1NTC A;  2EIK H;  3LA3 A;  1HSJ A;  4HLX A;  3T1B A;  3PUN A;  4OIR F;  4W8R A;  3SEJ A;  3E6D A;  2EZL A;  2IA1 A;  3ZMT A;  3EYY A;  3BJ6 A;  3OYH A;  1YQA A;  3LSK A;  1V5F A;  1EFU A;  4HX7 A;  5H20 A;  1QH0 A;  5TR9 A;  5FO5 A;  3L09 A;  4Q7J B;  1VQ6 I;  2XGC A;  1H8E A;  2VBV A;  1XMK A;  1E17 A;  3ZBU A;  4J0Q A;  4OOV A;  4UUS A;  1IUF A;  1IRF A;  2E1O A;  2KFD A;  3BC8 A;  2G7H A;  2FNA A;  2GBY A;  1K8A D;  1SFO J;  2INU A;  2EWN A;  2OQR A;  2C6Y A;  2FU4 A;  2Y69 H;  4L5I A;  3J7Y J;  3BRO A;  2RKH A;  4D5C A;  2YX7 A;  1B23 P;  2X1C A;  1T56 A;  1YHQ I;  3W6V A;  2JA7 J;  2OCE A;  1K9M D;  3TDU C;  1VQP B;  3QPL A;  3DTE A;  5F08 A;  5HLG A;  2VBT A;  1XGN A;  2ECC A;  4KIC A;  1T39 A;  2XSD C;  1YJ9 I;  2BSP A;  1QHH D;  4F55 A;  2JUC A;  4OOX A;  2O1D A;  1ZQ3 P;  2QUF A;  3GUD A;  4U0V A;  3K4C A;  3GVL A;  1MMA A;  1D0X A;  1ZR4 A;  1B8I B;  2DEU A;  5J47 A;  2V7F A;  3GZ6 A;  1NJI D;  3FIS A;  3G71 I;  2QCO A;  4AIH A;  2H27 A;  2YWE A;  3K69 A;  4C9Y A;  1JA0 A;  2EA4 A;  2VKE A;  2LH9 A;  3DCF A;  1N78 A;  1UEL B;  3ZIA A;  1VQK B;  3TMO A;  2H09 A;  2QEN A;  1ODD A;  3S32 A;  4S05 A;  4I84 A;  1ON2 A;  4TT3 A;  2I10 A;  3GLL A;  4A3D J;  3F8C A;  3VMW A;  1I1S A;  1J75 A;  1KU9 A;  4CO8 A;  1IDJ A;  3VSK A;  2VON A;  1B2R A;  4YZA A;  2DET A;  4EM1 A;  4MYT A;  3NAR A;  2VAS A;  1XX5 A;  2NT6 A;  1AKH B;  4P3Y A;  3G1M A;  2BMW A;  5FLX K;  3SHF A;  2V9P A;  2ZTG A;  4X7F A;  4L9N A;  2DA5 A;  2PBI A;  2GAU A;  4HV6 A;  4HWV A;  3L2C A;  1ZG1 A;  2HKX A;  2LP0 A;  2MC3 A;  3QYF A;  2XRO A;  3V8K A;  2QEX I;  1Z05 A;  2PEX A;  2VQG A;  3CUO A;  4UB6 C;  4DOZ A;  2W7N A;  1QBJ A;  2Y0S N;  4OPW A;  1WFX A;  1W7P D;  2RC5 A;  2WJV A;  4RM3 A;  2QSG X;  3KP3 A;  2VFO A;  2CQ7 A;  2X6Y A;  3H92 A;  4XN0 A;  1RKW A;  2PLF A;  2DW4 A;  3WU0 A;  1REP C;  2F1L A;  3VOD A;  3VWB A;  1EH6 A;  4G6T B;  3QFR A;  1KON A;  3LSP A;  1VQL I;  1L0O C;  4Z4V A;  4HPQ A;  2P5L C;  3CUQ C;  1COW A;  2FRH A;  1DGR M;  1R6R A;  2ESH A;  3DPU A;  3HKZ A;  3K7A J;  3ZQQ A;  2AS5 F;  3BOQ A;  3BZC A;  4P9U A;  1YJN I;  1BHE A;  3PSZ A;  2DTR A;  3OP1 A;  3H3Z A;  3M8E A;  3OE7 A;  5ILV A;  1QRB A;  3SZT A;  4B09 A;  2F4I A;  2Z1D A;  3ZQC A;  1MBK A;  3AG2 H;  4LG3 A;  5L3C A;  1JHH A;  3WE2 A;  1KC8 D;  1U9N A;  3JRE A;  3JSO A;  1IDY A;  2BX6 A;  1GVH A;  3ABL H;  2INV A;  4U0Y A;  1YIT B;  2ESN A;  4DNT B;  3B73 A;  2JN9 A;  3W5V A;  3W2A A;  3JQR A;  3JUR A;  1KZH A;  2ELJ A;  4OIN F;  4G7O F;  1YIJ B;  2R93 J;  2Z8G A;  1P9Q C;  2CH0 A;  4P6V F;  3QWL A;  4GFB A;  2OPT A;  2YSR A;  2C78 A;  1FTZ A;  3I3L A;  5JLX A;  2JDI A;  1LM1 A;  3F8N A;  2O03 A;  1D0Z A;  4WWC A;  1N07 A;  4MXN A;  2XAU A;  3BZ6 A;  4RMN A;  3OYM A;  3KEW A;  3SQN A;  1I1G A;  2BY0 A;  5JR3 A;  4BXF A;  1KMH A;  1Z7U A;  2GA1 A;  2P5V A;  4YIF A;  1WOS A;  3LSI A;  1FP2 A;  4D5F A;  1ON1 A;  4PK4 A;  2NPF A;  3MQ0 A;  4CHU A;  2DQL A;  3M8F A;  1B59 A;  1TBX A;  2K4B A;  5HXB A;  2NS0 A;  4XRF A;  1FEX A;  3CCY A;  3GFI A;  5J1U A;  1IXC A;  4W97 A;  3OOC A;  3ZC3 A;  2H1K A;  3M7G A;  3CP2 A;  1PP8 F;  2RNJ A;  2E35 A;  1SAU A;  2WB1 A;  4WCG A;  1VQN I;  3GLX A;  3DFG A;  5FO1 A;  2K9S A;  4Z6Y A;  4E70 A;  1DPR A;  5BNG A;  4XBF A;  4QIW N;  3WQZ A;  5HOO A;  3JU4 A;  2DDA A;  1QGZ A;  2CUE A;  2ZME B;  4RAZ A;  1KU3 A;  4BHP A;  4OMZ A;  4DYQ A;  2Z3Y A;  3HGG A;  3IRR A;  1AIP A;  2H1L A;  3CC4 I;  1A6I A;  5LBQ A;  5F0C A;  5DD8 A;  3W2V A;  3GZN B;  1CQT A;  1TT0 A;  2KMU A;  4G6I A;  1QZE A;  5J3L A;  2Q1Z B;  3M3Y J;  2QKM B;  4L5J A;  5FRM A;  2FF4 A;  2QDX A;  2VBW A;  1EF4 A;  1YRN B;  1Q86 D;  3TDZ C;  2LF7 A;  3MMP A;  4EJT A;  5CVR A;  2DFF A;  2J5O A;  3OYD A;  3K6G A;  4PAB A;  4UZU A;  2IAI A;  5DYM A;  2VI6 A;  4OAY A;  3E5Q A;  3KZY A;  4XIC A;  3LJY A;  2GPJ A;  3GTP J;  3HOY J;  2DXI A;  3REO A;  1R5N A;  1RR7 A;  3COA C;  5HKK A;  3GCM A;  3SZG A;  1FSH A;  1R5B A;  2FVG A;  2LD5 A;  1WJA A;  3DTK A;  1CZF A;  4BUP A;  2R7U A;  1WKM A;  4XR6 A;  1QFY A;  3KFW X;  1I39 A;  3MVP A;  4J19 A;  3FWE A;  1S6L A;  5L3D A;  2W6I A;  1NG6 A;  5IP9 J;  3K1P A;  2EIL H;  1ERD A;  2IA0 A;  3ZZ0 A;  2JZY A;  5LHH A;  3E20 A;  4IRI A;  2Y2Z A;  4PJM A;  1AA7 A;  3EUA A;  3DU5 A;  3PQK A;  4ZC3 A;  1MKM A;  4U88 A;  5FKO A;  1X4O A;  4AVZ A;  1FIA A;  5K5Q A;  1G7R A;  2QWW A;  2KZV A;  1SFK A;  5IYQ A;  4BHB A;  4UV8 A;  2TDX A;  2YU9 J;  3A3B A;  3R4K A;  2NOG A;  1QPM A;  5D6F A;  3AVU A;  3KLO A;  5GP9 A;  5FRO A;  1O3T A;  2WR8 A;  1VQ5 B;  4PJ0 C;  4NNJ A;  3IKT A;  3CCL B;  3GO5 A;  3F23 A;  4ZGQ B;  5KAI C;  1KD1 D;  4IHV A;  5BS6 A;  4M1K A;  3CJT B;  1W0T A;  3B82 A;  1BX0 A;  5TY0 A;  1PDN C;  4RD0 A;  3PFY A;  3P4G A;  1FNC A;  3M07 A;  1S0U A;  1MIJ A;  3ASR A;  1IG7 A;  4ZJZ A;  3HHH A;  3I54 A;  3E7L A;  5DDG A;  4E7K A;  2DYR H;  2JN6 A;  2VT3 A;  1SM4 A;  1XGO A;  1MMD A;  3EUH A;  4FE4 A;  3MZ8 A;  1LFP A;  2C5H A;  3CP8 A;  2EV5 A;  1QA2 A;  4I6Z A;  4ESB A;  2IRF G;  3C1D A;  1WU8 A;  4HOB A;  4JX4 A;  5FKM A;  3TBI A;  3CPX A;  4FK8 A;  2GA2 A;  3UR3 C;  1V3F A;  3FMS A;  1QGY A;  2ZFU A;  4A0Y A;  2KDZ A;  1W0J A;  2ZTN A;  3OYC A;  1U5T A;  2HQR A;  3BZK A;  3F8F A;  3M1C A;  1D0Y A;  3ZMZ A;  2XT2 A;  2VOO A;  4PZJ A;  1R5O A;  5KAF C;  1MJA A;  3G6E B;  1FOW A;  2OF7 A;  3WBJ A;  3S1N J;  5AON A;  1TNS A;  4RGU A;  2E5N A;  1X58 A;  3C2G A;  4HBL A;  3VB2 A;  2V4J C;  5D8L B;  1ETY A;  1NK2 P;  1S4M A;  1XTA A;  3HB9 A;  2HPM A;  4MTE A;  4Q5S F;  1K6Y A;  4Y52 J;  3HTS B;  3QU6 A;  4Z06 A;  4XRS G;  3KP2 A;  1D1B A;  1FYL A;  1YTY A;  3DEE A;  5JI6 A;  5KCM A;  1D3Y A;  4A93 J;  2BF4 A;  2OK7 A;  2Q6K A;  2MBF A;  2NSP A;  3P5J A;  3Q3S A;  1B9N A;  1ZAR A;  2Y9Y A;  4TN1 A;  4D7M A;  1XC5 A;  4IHT A;  1Q1V A;  2O61 A;  3KP7 A;  1WGX A;  3VMV A;  1YS6 A;  1EH7 A;  3OIO A;  1LDJ A;  1OOC A;  1S7A A;  2XRN A;  3AKZ A;  1MBH A;  3F9K A;  4DYC A;  3I0T A;  4LOC A;  3ZQF A;  3CB4 A;  4HE6 A;  3CJN A;  1DDN A;  2JQ7 A;  3KP5 A;  1B1B A;  2L2O A;  4RA2 A;  2Z6B D;  4ZYH A;  5C4J J;  2B9S A;  2ME6 A;  3D0S A;  1TTT A;  3VNU A;  2DFI A;  3GZ5 A;  1Z1D A;  2B0L A;  3OMY A;  1ITY A;  2DT7 B;  3AG3 H;  1W2B B;  4B48 A;  2KRH A;  3HPG A;  5DV5 A;  2NNY A;  3J81 Z;  3AST A;  3CF5 F;  5H5J A;  1X1B A;  3T51 B;  1HLV A;  4RM0 A;  2HXI A;  3K4L A;  1B72 B;  1VLO A;  1JTX A;  5H2F C;  2NVY J;  2QN6 A;  4A5M A;  3KEQ A;  3MAJ A;  1E79 A;  4GGG A;  2B63 J;  2LRE A;  3LSM A;  2QMU A;  2KJC A;  4OPO A;  4FTH A;  4EJU A;  3ROU A;  4PC1 A;  1TWA J;  3B02 A;  4XOT A;  4UNO A;  3OSF A;  4UVB A;  5LGT A;  3K4N A;  3BQY A;  1FRQ A;  1FOY A;  5GAE J;  4XSX F;  4KNY A;  1RQR A;  2NVQ J;  2BVN A;  2DI3 A;  1QGP A;  2KJB A;  4ZTJ A;  4ACA A;  3OV8 A;  1WJ5 A;  2PJR B;  4RDL A;  4M74 A;  3U2Q A;  1BI3 A;  5CVJ A;  1P6R A;  1SC7 A;  4CYC B;  1BOA A;  5IPA A;  3NWS A;  4KFC A;  3GVJ A;  3CMA B;  3FX3 A;  3KL9 A;  3CO7 C;  3H3V K;  4Z4U A;  3GQB A;  3U6B A;  5EGO A;  3CCM I;  2P3M A;  5K7H A;  3OYI A;  1W36 D;  3CCU B;  3AK5 A;  3O8G A;  2E2J J;  1J9I A;  4CIC A;  1XSX A;  2XUB A;  1AWC A;  1G2H A;  3WTS C;  2E1R A;  3RJP A;  1XG1 A;  2F43 A;  4YZ0 A;  1VQ7 I;  3DKY A;  3GQ9 A;  2KQR A;  1UD5 A;  2MA3 A;  5L3B A;  2R7X A;  4QVJ A;  3PJR A;  1PUF B;  2VNJ A;  4PSX A;  3T53 B;  2JRM A;  3ZGK A;  3FKI J;  2TRT A;  3WXM A;  1FX7 A;  2LDU A;  2VQC A;  4I0B A;  1CNF A;  1D1A A;  1EFR A;  4HF0 A;  3H35 A;  2DYS H;  1FNB A;  3L9F A;  4G6D A;  3VSV A;  2ZL5 A;  4MFE A;  5DM6 F;  3ZRG A;  1OYI A;  1OJL A;  4NUB A;  4BJ5 C;  5EDN A;  2E2I J;  5C4X J;  3HSE A;  3GSI A;  2X1D A;  3B78 A;  1U2W A;  1XB2 A;  2KKO A;  3LSH A;  1UCR A;  4A3C J;  1S72 I;  3OYB A;  4AF7 A;  1OFE A;  1STZ A;  3FBN B;  3H9Q A;  5ILU A;  5IOY A;  1EP3 B;  2XC7 A;  1Y0U A;  3WNB A;  5FKN A;  1SD7 A;  1K4Z A;  3WE3 A;  3FXQ A;  2WAQ A;  5GPA A;  2X9D A;  3DBR B;  3HJE A;  4A3E J;  1SFE A;  4LBZ A;  1KU2 A;  4B3A A;  4X0C A;  5DEQ A;  3CME B;  4M3F A;  1GV2 A;  4C2M J;  2VJ4 A;  4PJJ A;  3B4N A;  2DK5 A;  1FY7 A;  2FJ1 A;  2QGU A;  5AMV A;  1EKE A;  4XMY A;  2F4O B;  5M5W J;  3S3N A;  2L5Q A;  4RB3 C;  2QQ9 A;  2L7Z A;  2YPR A;  4LG0 A;  4RB0 A;  1L3L A;  1XD7 A;  5D8K B;  1OR7 C;  1X2N A;  2DA6 A;  4R8H A;  3SKB A;  3K2Z A;  5B1A H;  1QPI A;  3CC2 I;  1TW2 A;  3PUF A;  1DUX C;  4QHY A;  3MCA A;  1LB2 A;  2V7T A;  2K3P A;  4XOP A;  2EIJ H;  1A36 A;  1QA1 A;  5FO0 A;  1T8I A;  3FF5 A;  3FJO A;  2CQN A;  1HXD A;  4WQM A;  2HOA A;  3OYK A;  1TT5 B;  2MFZ A;  1RES A;  3ABK H;  1W0U A;  3BT9 A;  3U6K A;  1FRN A;  4BDY A;  4Y7N J;  3Q0W A;  3M8J A;  4PCQ A;  3ERE D;  2UZK A;  1D5Y A;  4HDU A;  1UD2 A;  2QGG A;  3Q3A A;  4TMZ A;  2PJP A;  3GTJ J;  1KK3 A;  2IP2 A;  3AG1 H;  1QFZ A;  2OQG A;  2AHO A;  4U7B A;  3LO8 A;  4Y7C A;  2E19 A;  3DLA A;  1JKR C;  4IW3 B;  2VOD A;  2PMD A;  3OW7 A;  1J59 A;  1I18 A;  2XDV A;  2W6J A;  4IPA A;  2XT4 A;  4N9I A;  1OB5 A;  1MBJ A;  3T8T A;  3AVT A;  3S1R J;  4BY1 J;  1T38 A;  3OS1 A;  1VQ9 I;  4XRM A;  1U78 A;  5GAH J;  4LMY A;  5AIP A;  1IV6 A;  4Y17 A;  1WJB A;  4BY7 J;  2KDO A;  2R4G A;  5F4O A;  1W34 A;  1XN7 A;  2WC2 A;  4P55 A;  1YJW B;  3CUQ B;  5IYD J;  4LB5 A;  3A03 A;  1R23 A;  1HDD C;  2IT0 A;  2IS2 A;  1NH3 A;  2XAG A;  5LRS A;  4ENM A;  5LHG A;  3VNV A;  4II2 A;  4BHC A;  1F43 A;  2VNK A;  1N75 A;  3K1M A;  2NT9 A;  2RVC A;  5B3S H;  4G1V A;  4NB5 A;  4X7C A;  3WTU C;  4IHY A;  3CCR B;  1O8K A;  2X6W A;  4GXO A;  1JGG A;  2DT6 A;  4P1V A;  2K27 A;  5J4V A;  1BQE A;  2Q0O A;  2XF5 A;  2WA0 A;  1FWZ A;  2YU3 A;  1MH3 A;  3DKW A;  2X6X A;  3HXL A;  1QU3 A;  1KRH A;  4M53 A;  1WI3 A;  4Z4S A;  3GRH A;  1ENH A;  2K9L A;  5DUI A;  2L9R A;  3FBI B;  3GTL J;  1WH7 A;  1SMT A;  2OTJ I;  2L7F P;  1PYV A;  4F52 A;  1WJD A;  3C2H A;  2GLO A;  3TW6 A;  2AO9 A;  1BIA A;  4N4N B;  4M2L A;  4U9U A;  4WWV A;  1JGS A;  1BC7 C;  4MYU A;  1CNE A;  5BPI A;  2QSH X;  4AIJ A;  3WGG A;  2IEK A;  4ETS A;  1BJK A;  2HVQ A;  4C2U A;  3SDB A;  2XAF A;  2HKO A;  3H09 A;  4MEY F;  2RAE A;  2M4K A;  3ISX A;  3DEW A;  3H5A A;  1VQO I;  1EA0 A;  2IS6 A;  2LF8 A;  2GZW A;  2GXA A;  4A0X A;  2CUF A;  3HUG A;  3OS2 A;  1P7I A;  1I50 J;  2GJK A;  4Z4R A;  3OZV A;  1TNT A;  3CDI A;  3WND A;  4DNR B;  9ANT A;  4OZY A;  1EP2 B;  2CSO A;  4N9H A;  3SFZ A;  3TOB A;  4AID A;  2HMA A;  3PSS A;  1FZP B;  2CW0 F;  1K8F A;  2VBS A;  3A1P A;  4LGW A;  1ZGA A;  3MMY B;  4A3F J;  1T6Y A;  4YXW A;  2VJ5 A;  4X05 A;  4IHW A;  4A3B J;  5JHU A;  5IT9 K;  2CV2 A;  2JPB A;  2IJL A;  2BM7 A;  3HKZ N;  1X1A A;  5LGU A;  2BGC A;  4IOA F;  1OCZ H;  3RYR A;  1YE9 A;  4YEJ A;  1LFU P;  4RD6 A;  1LLZ A;  1R5G A;  4WZK A;  3VYR B;  2IGN A;  3WTZ A;  1J9Z A;  3QYE A;  2B7C A;  4MNU A;  3G4S B;  2QZA A;  1GQ8 A;  1TC3 C;  3JAM K;  4WK8 F;  2EIN H;  4P6Y A;  1IJE A;  5CYV A;  3F21 A;  2OCC H;  1ZM9 A;  4RLZ A;  2VBM A;  3QP6 A;  1EFT A;  2OZU A;  3E1S A;  2EQR A;  4JX6 A;  1IN5 A;  3K4M A;  3KX2 A;  4E4H A;  2MD5 A;  4HSR A;  3I55 I;  1NRK A;  5CVI A;  3GTQ J;  4L9T A;  3E6C C;  1KK0 A;  3OL4 A;  2Q6O A;  4M6Y A;  5DSZ A;  5LMZ A;  1W36 C;  1J7K A;  4BYY A;  1ORK A;  1VQM I;  3CCQ B;  1WH5 A;  2EBI A;  4EW9 A;  4S04 A;  1W5T A;  2XIG A;  2VC1 A;  3CLO A;  5JVT A;  3S1M J;  2B7B A;  1ETW A;  3HOU J;  5EMN A;  2B0R A;  2NTB A;  1S5L C;  3CDH A;  4WXH A;  3B8Y A;  1RPW A;  5KK1 A;  2GOX B;  1HZE A;  2Y31 A;  1MD0 A;  1TP4 A;  4PSW A;  4XK4 A;  4KKU A;  3CCS B;  1F36 A;  2XAQ A;  1F9N A;  2E2H J;  5FLX Z;  3LQE A;  3FPK A;  2MGQ A;  4Q47 A;  3AVX A;  2O04 A;  4FWT A;  1I8D A;  5EF6 A;  4PMH A;  3CC7 I;  2ZB9 A;  1B8I A;  1Z3X A;  4IZZ A;  2XKO A;  4ASN A;  4L8J A;  3AAF A;  2P6T A;  2BV6 A;  2WB1 N;  1GR1 A;  4AM3 A;  1XE1 A;  1N0U A;  4EJW A;  3BH4 A;  4QV2 A;  5EZG A;  4DYR A;  3N4M A;  1G3T A;  2BN4 A;  3GTG J;  2CU7 A;  2DPD A;  2IS4 A;  3AGQ A;  1G3Y A;  2JT1 A;  3TW7 A;  1O8M A;  2EFG A;  3Q38 A;  2X4H A;  3U1D A;  3RKQ A;  4UZF A;  2CND A;  4HIZ A;  4BQA A;  5KW9 A;  2E36 A;  2EZH A;  2ZCW A;  4UB8 C;  5CLS A;  4FN5 A;  1MBG A;  4UHT A;  4N3G A;  4CCL A;  3HPH A;  4CCK A;  1Z21 A;  1WOO A;  1R49 A;  4TMX A;  1E0E A;  4O3M A;  5J35 A;  1ZH5 A;  1GAQ A;  2XGE A;  3KEY A;  4RDU A;  1WHU A;  2W1O A;  5IYR A;  2JA6 J;  4N0B A;  4JOM A;  2W25 A;  3RCO A;  5LEJ A;  4M6X A;  3LAJ A;  2ZXI A;  1G7C A;  3HTU A;  4YG2 F;  3U9G A;  3PET A;  1XG2 A;  2YUS A;  2V6E A;  5HZB A;  5EJC A;  5HLT A;  5D5V B;  3JW4 A;  2JA5 J;  2RQP A;  2HTS A;  1BR1 A;  3J80 Z;  4NK8 A;  3FXM A;  3EET A;  2VBX A;  3QU3 A;  3ULQ B;  4ASU A;  2KPM A;  4U49 A;  2NAZ A;  3EQL F;  2R7W A;  3CCJ B;  2XAS A;  3M1E A;  3RZD J;  2EWE A;  4II3 A;  3JR9 A;  5CDF A;  3L2V A;  3ONU A;  3OEH A;  3GTO J;  1VFC A;  4NDL A;  2CMP A;  4PDK A;  3DU6 A;  3K70 D;  2ICW G;  1FOX A;  1P4M A;  2ZNY A;  4MGR A;  3BDD A;  4RLF A;  1W7P B;  3KET A;  4DQ2 A;  1SAN A;  4BAC A;  3TOA A;  2NOJ B;  4O6J A;  2XAJ A;  1PKV A;  1WSR A;  2V9K A;  4G94 A;  4X0G A;  3RI4 A;  1KYZ A;  4AC9 A;  1BI2 A;  3S8P A;  4B44 A;  1T5E A;  1UFM A;  2ZXW H;  3WHB A;  1MZB A;  3QOE A;  4C30 A;  2A07 F;  3GME A;  1YG2 A;  1T6S A;  4UVC A;  2MD0 A;  3O8H A;  1Q1H A;  2F5V A;  2V9V A;  2RGV A;  1YIO A;  2UV1 A;  2YWF A;  2COB A;  1Y0N A;  3KLN A;  3FKS A;  2X53 S;  2W24 A;  3ZBT A;  4G7W A;  3C18 A;  3CCV B;  2PLY A;  5EEG A;  3A35 A;  4B43 A;  1UD8 A;  2XRL A;  1TLL A;  4EMS A;  4ZYE A;  3GTM J;  1OLT A;  4NQW B;  3LNN A;  5DS0 A;  3I58 A;  1N08 A;  2PE3 A;  2O0Y A;  2CF4 A;  1QHG A;  1P2F A;  3BP8 A;  2ISZ A;  4F3Q A;  2EFN A;  1JUM A;  2YX4 A;  3DDY A;  4RD1 A;  3HOW J;  3IWZ A;  1BW5 A;  3W2G A;  4X1E A;  3SJM A;  3PSF A;  4CH7 A;  2XAH A;  2LBF B;  3PVD A;  3TQN A;  4FXU A;  4X06 A;  3ECH A;  4XKB A;  1BJZ A;  1XGM A;  1FSE A;  4BU2 A;  1C0W A;  1G8X A;  3NRV A;  2QYO A;  4U87 A;  3M4O J;  4F7D A;  1SEU A;  3V4G A;  2LKP A;  3FMQ A;  1JT6 A;  3O3K A;  2R5Z B;  3DEU A;  2VBZ A;  1ZYR F;  2O6G E;  3ZPP A;  2MYS A;  3A2K A;  4FT8 A;  4HEA 2;  1BR4 A;  1Y6I A;  2VXD A;  4LLL A;  3CO6 C;  4B47 A;  1A5J A;  1JA1 A;  2DMP A;  3L2W A;  1S29 A;  5E3O A;  2VL8 A;  5F1J A;  5HZA A;  3Q5F A;  2ZME A;  1MW7 A;  2QQ8 A;  4XKW A;  5F64 A;  3T5X A;  3H9N A;  2QF7 A;  3CZ6 A;  4PFO A;  2M0C A;  4A3J J;  4KA4 A;  4EGY A;  2EFP A;  2VJJ A;  4Y4R A;  3A01 B;  1WJF A;  2VT2 A;  3SYJ A;  3VO2 A;  4CYD A;  2JTV A;  4CUG A;  4EM2 A;  3BJA A;  2IS1 A;  3K0L A;  3HOZ J;  1YW9 A;  4A3L J;  3FXR A;  4FE7 A;  4M9X A;  1UAA A;  2D74 A;  1TYV A;  1MNE A;  1B9M A;  1NG7 A;  2PMU A;  3H9G A;  4ZZD A;  1JJ8 C;  3B90 A;  1YRN A;  4OJP A;  1RI7 A;  2DQR A;  1GUU A;  2R7Z J;  2XZO A;  4FAS D;  3JRH A;  3OYF A;  1VBL A;  2VKV A;  4OIQ F;  2DO7 A;  2XV4 S;  2R7S A;  1QRY A;  3ZUG A;  4P2N A;  4QTR A;  2GOM A;  1WI9 A;  3K1N A;  3I53 A;  2F2E A;  3BCF A;  4R1H A;  2HQN A;  2X85 A;  1OFD A;  5IY5 H;  2XVC A;  1HOM A;  1N25 A;  1IC8 A;  4HZF A;  1VJS A;  4BBS J;  2R7V A;  2CRG A;  2XF6 A;  2OUM A;  4AC0 A;  4AVP A;  1U2R A;  1V5V A;  3OAA A;  5TV2 A;  3LL7 A;  5HS9 A;  2BY1 A;  2K40 A;  4UXN A;  3SQV A;  4BS9 A;  1R9T J;  3CRZ A;  3VOE A;  4BPR A;  3TO6 A;  2STW A;  1I3A A;  2GQQ A;  4DBQ A;  1IJW C;  2E7W A;  2RNG A;  2DMN A;  3H1C A;  5HVQ C;  3MKZ A;  1MSE C;  2DMU A;  4MO7 A;  4HF2 A;  1OGJ A;  4XLF A;  3OIQ A;  1OMI A;  3JRC A;  3CW2 A;  3NWT A;  1WOP A;  3SJP A;  3KCC A;  2OYN A;  1PXZ A;  1LNW A;  4ROX A;  2R7T A;  2DA3 A;  1MH4 A;  1R00 A;  2KP6 A;  3ZN0 A;  1IN6 A;  4EV0 A;  5CQG A;  2QKL B;  1N0V C;  1WTH D;  5DUK A;  2PQ8 A;  4ZDO A;  5F04 A;  4IF4 A;  4XKV A;  3DV8 A;  2L54 A;  4M6V A;  3NAU A;  4EAT A;  3LVB A;  3I56 B;  4PJN A;  2VB6 A;  1BIB A;  1JHF A;  4CZZ A;  4KN4 X;  4FHT A;  4CXF A;  2ZZE A;  1TWC J;  2FSW A;  2E34 A;  1FBS A;  2PMH A;  2WV1 A;  4XON A;  3N6Z A;  3EQO A;  3DQV C;  1F1Z A;  1W5S A;  2WAE A;  3VYT B;  1J09 A;  2VLA A;  3ASQ A;  1BJA A;  3BJO A;  2XGD A;  5J4Y A;  1KTW A;  1HDP A;  5EZH A;  5L3E A;  4Z4Y A;  3SDG A;  1BC8 C;  1D1C A;  5J8C A;  1ZRD A;  3CTA A;  1KYW A;  5GAG J;  4ABZ A;  1O3Q A;  4YRV A;  2KL4 A;  2HFH A;  4AUX A;  5J3O A;  2XEX A;  1TQM A;  3R6J A;  1HCR A;  3FXO A;  4HNT A;  2VKD A;  4ZTF A;  4W8T A;  1KU7 A;  2QQA A;  2CS3 A;  1R4N B;  5GTH C;  3BTC A;  3HOS A;  1JUP A;  1KQ8 A;  3FY3 A;  5DCM B;  3ZQG A;  2QA4 I;  1TVC A;  4CSW A;  1MNM C;  3TO9 A;  5HNH A;  2A69 F;  3KYC B;  1H0M A;  2ZL7 A;  2HDC A;  2IQ7 A;  2OTL I;  4KYW A;  3RSN A;  3ASS A;  3BR3 A;  2N8G A;  3KIO A;  5IYC J;  1E2X A;  1N05 A;  3CQZ J;  4L5E A;  3W2F A;  1ONV A;  2K4J A;  2QX3 A;  1IN4 A;  3W3C A;  2ZBV A;  4DQK A;  2R7F A;  3ESW B;  3V7S A;  4KIF A;  4G8X A;  2ZSH B;  1QVF B;  3GQA A;  3H0G J;  3OSG A;  1JUS A;  4ZZL A;  1HG8 A;  1O88 A;  1WCM J;  1T0F C;  2BE5 F;  4LLN A;  2CW7 A;  2FEZ A;  4A12 A;  3RY8 A;  1JTA A;  1SD6 A;  3BPX A;  1D5V A;  1WRJ A;  2MAB A;  2BM1 A;  4MR0 A;  4C43 A;  3LA7 A;  2VZL A;  5BMZ A;  3ZMS A;  4ZH4 F;  1H89 C;  3HIF A;  4ZCM A;  1OCP A;  1X4P A;  2NRA C;  3GWZ A;  4LD5 A;  3HG9 A;  5FKK A;  4ESF A;  2H8R A;  4QWQ A;  3S3O A;  1I27 A;  4UY8 I;  1D2E A;  4BE1 A;  3G05 A;  1G6N A;  3NE5 B;  3WWG A;  2P4W A;  3PNV A;  2XSJ C;  3E6M A;  2BM5 A;  2OBS A;  1I6H J;  1X1C A;  1IRX A;  3HGY A;  3HOT A;  5AIQ A;  1WP6 A;  1RZ4 A;  4I98 B;  2FA5 A;  4KIB A;  1B72 A;  2WAD A;  2M4G A;  1F5T A;  1MMS A;  3D5S C;  2RN7 A;  2VFN A;  3BR5 A;  4JP0 A;  1Q7Y D;  1ZG3 A;  5J1R A;  2YWH A;  3SLN A;  1MBE A;  2JJ2 A;  3CCE I;  3SZE A;  2ME0 A;  2XF7 A;  3DTI A;  1DAB A;  4OIO F;  3E3V A;  1W87 A;  3LFK A;  5E17 F;  1IJF A;  2PIA A;  2XNC A;  1IV8 A;  3MHP A;  4ZV4 A;  1O8I A;  3BCB A;  3GFM A;  1WPK A;  1I5Z A;  5KNL A;  3WTW C;  2XC1 A;  1W0K A;  2NS8 A;  1J2X A;  3EYI A;  1VTN C;  1O8H A;  5TJJ A;  1S7O A;  4IX7 A;  2PJR A;  4CCN A;  2JVH A;  3IH3 A;  1B6A A;  3BLY A;  2HTJ A;  4M3E A;  4PGO A;  4CYC A;  5FD6 A;  3H36 A;  5F0F A;  2R7R A;  2X0K A;  3V8L A;  1A31 A;  3ES9 A;  3LQ6 A;  2GK7 A;  2BHY A;  5M5Y J;  3S2D J;  1OFC X;  4EM0 B;  2QQB A;  1QUE A;  4BEH B;  2A68 F;  2HI3 A;  2DPU A;  3CD6 B;  1G4D A;  3HRU A;  1VQ4 B;  5ICE A;  4D1Q A;  4P25 A;  2M30 A;  2VJI A;  3L2Q A;  1PUF A;  4HQE A;  2BGJ A;  2K86 A;  3VMF A;  1O8L A;  1YX3 A;  2HOS A;  1VQ8 B;  1UG0 A;  1UZC A;  3LA2 A;  5F27 A;  2O8K A;  5JVG F;  2DFE A;  1YI2 B;  3FIW A;  3RQ4 A;  4F91 B;  1TUI A;  3P9I A;  1YLO A;  3WG9 A;  2Y0S A;  3AVW A;  4X8I A;  4W8Q A;  4E0F A;  1EA3 A;  2E1C A;  1TYU A;  1BLI A;  4OWR B;  2VFM A;  4Y9U A;  1M90 D;  1LQ1 A;  4OZZ A;  2HYG D;  2XTX A;  3FK6 A;  4I99 C;  2F48 A;  1IHM A;  1ZM2 A;  4M9Z A;  1UST A;  1M1K D;  3S17 J;  2Z16 A;  2JSP A;  1DU6 A;  3H94 A;  2WJY A;  2OD5 A;  1TQI A;  1FND A;  4CCJ A;  5B1B H;  1P4A A;  3N05 A;  1XDS A;  1JRG A;  1HW1 A;  3V42 A;  4Y13 A;  4BH9 A;  2F4N A;  2HR3 A;  3V76 A;  1SMY F;  3SEZ A;  4FQG A;  2NNN A;  2LVS A;  3ZQI A;  1LPQ A;  2VYQ A;  1T98 A;  1U8R A;  3QPS A;  2LTP A;  4IRG A;  4P12 A;  2MG4 A;  1VHO A;  1VQ6 B;  1E3H A;  1TW3 A;  2CGP A;  3LQQ A;  2WY8 Q;  1O57 A;  2CUJ A;  2FQ3 A;  3RDI A;  4J01 A;  1P4X A;  2DLL A;  4ZYG A;  3QE2 A;  2X0L A;  4XL9 A;  4RM2 A;  3V7R A;  1ZAO A;  4AYB A;  1Y1W J;  3N97 A;  1VQP I;  3WTY C;  1IRG A;  2DK8 A;  2C4T A;  1YHQ B;  5KSW B;  4CDG A;  1SD5 A;  3TP3 A;  3DBH B;  4K2E A;  1VLY A;  5DCF A;  5D4R A;  4A3I J;  2YR2 A;  6PAX A;  1KQS B;  2V6C A;  2Z5U A;  3L1P A;  1YJ9 B;  3A3G A;  1ZKG A;  1WVR A;  4FCY A;  2K7L A;  4YHB A;  4PAA A;  2W82 A;  2L9V A;  4IOC F;  3LOC A;  2LKX A;  3QRF F;  1GJR A;  3P26 A;  4FIS A;  4ZCI A;  2QZ8 A;  2VN2 A;  3E5X A;  2Z33 A;  2Y48 A;  4KMU X;  2ZBU A;  4D0P A;  1B4A A;  1DP7 P;  1VQK I;  2XTY A;  3ZMU A;  3G71 B;  1Q81 D;  1K5C A;  2OBP A;  2A61 A;  2KLO A;  2HEO A;  1OYY A;  3R0J A;  2PMZ N;  3W2W A;  3MD2 A;  4G6Q A;  1I6X A;  3ZR8 X;  1YO5 C;  2OBT A;  4BJT A;  5K5R A;  4ZCL A;  5E3N A;  2NYX A;  4CZC A;  3CUQ A;  4IO9 F;  4TMT A;  1CF7 A;  2DFH A;  5DM7 F;  4AIK A;  1U8B A;  1SFX A;  2L0K A;  3LSG A;  2J8K A;  4DBR A;  4Z1M A;  4B4C A;  1ZUN B;  2DCU A;  1QUF A;  2WY7 Q;  2R5Y A;  1IZ1 A;  5A8A A;  3JX8 A;  1UHW A;  4V2G A;  4XQF A;  1S7E A;  2QBY B;  2FD5 A;  2NZM A;  4OOI A;  3BTL A;  5JBQ A;  4EVI A;  4G12 A;  2VPL A;  5A89 A;  1Z7L A;  3BG3 A;  5K7F A;  1DQU A;  2NVT J;  4LIT A;  1DBG A;  1A04 A;  3ZCO A;  1MGT A;  1H9G A;  3E0J B;  1XPX A;  4RB2 C;  3WHC A;  3GF2 A;  4M3G A;  2QEX B;  2WBM A;  4G1B A;  2VFP A;  3QOD A;  2HDN B;  4RD3 A;  3L2U A;  3OYJ A;  5E3L A;  5D5U B;  2VC0 A;  5E1W A;  5IT9 Z;  4DW6 A;  2BW3 B;  4P9S A;  1AMO A;  2EFW A;  2OC6 A;  4OOS A;  2DA1 A;  2X51 A;  2CW8 A;  4M3B A;  1Y1V J;  2VOP A;  3MN2 A;  4M72 A;  3EPZ A;  1VQL B;  4B3F X;  3VYU B;  3WBK A;  3JRB A;  1JB9 A;  2GJR A;  1F20 A;  1WQ2 A;  1YJN B;  2EB7 A;  3DXJ F;  5LGN A;  4A3M J;  3OOU A;  5JMC B;  1QVG B;  2DA4 A;  1YIT I;  3JRD A;  4HRI A;  1V0F A;  2QY1 A;  5D5X B;  3HRT A;  1YIJ I;  1X19 A;  4URR A;  4HST A;  3PIP F;  2HZD A;  4BQQ A;  1RKT A;  3QOP A;  5HLH A;  3GFL A;  2BGI A;  2K9M A;  3A0H C;  1O8G A;  3E1Y E;  1KCC A;  1T2K A;  1GHC A;  1R58 A;  2DOA A;  4PFP A;  3B6C A;  3D5L A;  2BXY A;  1LLW A;  4DJA A;  4PGG A;  2BM4 A;  5HOD A;  3IUO A;  4Z2Y A;  1XB4 A;  1IB0 A;  3QFS A;  3FMR A;  3K9T A;  3OW2 B;  1OFM A;  2A05 A;  2CW5 A;  1OYW A;  3ASO H;  1YYV A;  5C1E A;  3OPO A;  3GX4 X;  3G1O A;  3I4P A;  3J81 K;  2HVR A;  1OGI A;  3T8R A;  4M4S A;  4YAL A;  3IC7 A;  1W5C C;  4YZX A;  1GXQ A;  5JLV C;  3AGP A;  1QCX A;  4RCY A;  5ILS A;  3WYA A;  2CQQ A;  2JPC A;  3TO7 A;  4A6D A;  2E5Z A;  1YX5 A;  3QFT A;  2BYV E;  5GAD J;  2V7Q A;  4BL0 B;  2AXL A;  5E3M A;  5K5O A;  3WY9 A;  1LE8 B;  3OZU A;  3QPT A;  1BOB A;  2WV0 A;  5CJ9 A;  1O8F A;  3QAH A;  2LG4 A;  1K7A A;  2LY1 A;  2H6C A;  3WOD F;  3FZV A;  5C3E J;  2Y75 A;  4BBR J;  3AVY A;  5CVU A;  4IL6 C;  4E7I A;  2I5U A;  1PVE A;  1YX2 A;  2VBU A;  1AU7 A;  2HOT A;  4RGX A;  4NBS A;  1QRC A;  5DNS A;  4AWX B;  1N77 A;  5M5X J;  4E7Z A;  1H9T A;  1NBM A;  3ZZU A;  2CJJ A;  1EV7 A;  4BQO A;  2P8T A;  4P3I A;  5TIS C;  4UUV A;  3BY2 A;  4B3G A;  4RB1 A;  2P7V B;  5BSX A;  1R1T A;  4OU0 A;  2C2W A;  3CLQ A;  1HBX G;  3CC4 B;  1QGA A;  3DU1 X;  4YAW A;  2RC6 A;  2BBY A;  2X3U A;  3OYA A;  3BQZ A;  1A6Q A;  2C77 A;  3E5U A;  4Q4Z F;  1OKR A;  1YW8 A;  1DGW Y;  3I71 A;  2R9V A;  3DKX A;  3DPL C;  3KZI C;  2M9H A;  2WYR A;  1NB0 A;  4YEL A;  2NVX J;  4RDK A;  4OMY A;  2M87 A;  4KDP A;  1SKY B;  2OAZ A;  4PUS A;  1RMG A;  2O0W A;  4H4K C;  4YDT A;  2W00 A;  3HRS A;  1R5H A;  1G7S A;  2BV3 A;  2M2E A;  4S0H B;  1IF1 A;  2TCT A;  3IH4 A;  5HNF A;  4G7H F;  3RTR A;  1I3Q J;  4YFX F;  5E6T A;  4Y9R A;  1XGS A;  3H0D A;  5E1Z B;  3U2R A;  5FIU A;  1Y8R B;  5KHD A;  2V1D A;  2BHZ A;  4QFM A;  5F4J A;  4D7N A;  5B6I A;  1KCD A;  4XSZ F;  2WZP P;  4WXC A;  3OY9 A;  5E1X A;  4A3K J;  1Z6R A;  1WPC A;  4R79 A;  4BDZ A;  4KIS A;  1VI0 A;  4LBY A;  1TWF J;  3Q9V A;  5JFR A;  4UZE A;  1FBQ A;  1NHA A;  3IRQ A;  4RD2 A;  3VO1 A;  2R7O A;  1MDM B;  2LR8 A;  2MLG A;  1PP7 U;  2ZXH A;  3F8B A;  1Q9S A;  4PC7 A;  3HEF A;  4LIV A;  1OCR H;  2YS9 A;  3LNQ A;  2P6S A;  2BPO A;  2Y30 A;  1LFB A;  3BQJ A;  1EE6 A;  1H80 A;  1VQ5 I;  2CWE A;  3CCL I;  1BW6 A;  1T95 A;  3K4K A;  2VBE A;  3L2R A;  2ZBK A;  3JRG A;  4N4O B;  3W2H A;  3GXO A;  2F3L A;  2HQA A;  2O6W A;  1PLU A;  3W5H A;  4MEX F;  1D8J A;  3E6B A;  3DLL F;  5HDN A;  3OOP A;  1P4W A;  2J7K A;  1XDU A;  3SUC A;  1Y8Q B;  2HS5 A;  1JT0 A;  3PQJ A;  1XSV A;  3H5R A;  2RDP A;  5GTI C;  3P9C A;  1Z9C A;  2PFB A;  1BR2 A;  5D6E A;  1RRJ A;  1G3W A;  2R0Q C;  1MRZ A;  1UHM A;  3NEU A;  2R6H A;  3W2E A;  1O8E A;  2O7O A;  1W7P A;  3RPQ A;  1WSU A;  3ZPL A;  4XNF A;  3RQI A;  4Z4T A;  5IP7 J;  3FXJ A;  4HAM A;  3ZP5 A;  5BPD A;  3FDY A;  2AHQ A;  5HS8 A;  3G6E I;  4XD7 A;  2FMY A;  3C2B A;  5BQT A;  5ED4 A;  4C2T A;  2MH2 A;  3ZPN A;  3BNW A;  3WU2 C;  3LWF A;  1UMK A;  3PFI A;  2A3S A;  2GRE A;  3C7J A;  2HOE A;  3BG9 A;  2BY3 A;  3HM5 A;  4QPO A;  3I59 B;  4OJL A;  1IA5 A;  2KIM A;  1MMG A;  1VND A;  2DT5 A;  3RYP A;  2V7X A;  4QUZ A;  2NST A;  2FML A;  3GBG A;  4HX8 A;  1D1N A;  1K83 J;  3W6K B;  4A6E A;  3GYH X;  1QQI A;  1JE8 A;  3RIQ A;  4C0S A;  2ZXJ A;  4NQW A;  3LSJ A;  2X3H A;  3OYL A;  2ETH A;  4FX0 A;  5LHI A;  1X3U A;  2L4A A;  2LK2 A; 
#chains in the Genus database with same CATH homology
 2NSP A;  2W4S A;  4BS9 A;  4KKT A;  1O8J A;  3EUH C;  2K5C A;  2LBF A;  4DBQ A;  1LVK A;  2E60 A;  3MKZ A;  2RNG A;  5HVQ C;  3H5N A;  1WJC A;  1HA8 A;  2XND A;  3KRG A;  3VMV A;  4XLF A;  2E1B A;  4W8S A;  3OIQ A;  4Z05 A;  1OOC A;  3NWT A;  1PXZ A;  1TZL A;  2R7T A;  4P1W A;  3A4C A;  3AKZ A;  4XLE A;  5TGT A;  1IDK A;  3F9K A;  2KP6 A;  1WJE A;  2ZSI B;  2V26 A;  3K4J A;  5CQG A;  2QKL B;  1WTH D;  3ZSC A;  4ZDO A;  1MMN A;  2L2O A;  2O5R A;  4XKV A;  2CK3 A;  2Z6B D;  2BVM A;  1Z3Y A;  4EAT A;  1E3Z A;  1O8D A;  4PJN A;  5C1C A;  2VB6 A;  2XZP A;  4ZYA A;  2IGK A;  2PYG A;  2ZZE A;  4P22 A;  3BG6 A;  3FHN A;  3OMY A;  2DT7 B;  3OWT A;  2V1N A;  4B48 A;  2IGM A;  2KRH A;  3HPG A;  4CCM A;  4XON A;  2WAF A;  3EQO A;  2M3A A;  3DQV C;  1X1B A;  4B3X A;  3T51 B;  2WAE A;  3K4L A;  3OEE A;  3VYT B;  1J09 A;  2IXS A;  3D5R C;  2VLA A;  2HLD A;  2L9S A;  1KTW A;  1Y56 A;  1E79 A;  2VQH A;  2HNH A;  2LRE A;  3LSM A;  1D1C A;  1MND A;  4YRV A;  2KL4 A;  4XOT A;  2WPD A;  3DPT A;  1BN8 A;  4HNT A;  3K4N A;  2VKD A;  4ZTF A;  2LZJ A;  2CS3 A;  2FUG 2;  5LD2 C;  2NTQ A;  4JMQ A;  3HOS A;  3FY3 A;  4CSW A;  4ZTJ A;  3EUK L;  5HNH A;  4OJ5 A;  1WJ5 A;  1G59 A;  2PJR B;  3EQN A;  2IQ7 A;  3NWS A;  3RSN A;  3AL0 B;  1E1Q A;  3GVJ A;  4FET A;  4XLC A;  3T9G A;  3GQB A;  3VYS B;  3HAG A;  3OYI A;  1PJR A;  1W36 D;  2ZZF A;  2CUZ A;  2JA2 A;  3PNY A;  2QX3 A;  3W3C A;  1W9X A;  3OIP A;  4JQF A;  3LMM A;  2F43 A;  3LMW A;  4YZ0 A;  1FX0 A;  2ZSH B;  3DKY A;  5DN6 A;  2XZL A;  2VBK A;  3GQA A;  3GQ9 A;  2KQR A;  1UD3 A;  1UD5 A;  1HG8 A;  2R7X A;  1O88 A;  1JTA A;  1T0F C;  3PJR A;  2CW7 A;  5IK2 A;  1ZEL A;  3VR6 A;  2HDW A;  3PUB A;  4PSX A;  4ZDL A;  4E7J A;  3T53 B;  2MAB A;  4MR0 A;  2Q2E B;  3ZGK A;  4ITV A;  1VF7 A;  2VQC A;  1X4P A;  1HVX A;  1AIR A;  1D1A A;  4D9J A;  3HG9 A;  1EFR A;  4HNU A;  3H35 A;  4DK1 A;  2XGJ A;  3S3O A;  3VSV A;  4BGD A;  2JVG A;  4BJ6 C;  4BE1 A;  3G05 A;  3ZRG A;  2UWM A;  4NUB A;  4BJ5 C;  3NE5 B;  3T56 B;  4KJZ A;  3WWG A;  2KHM A;  2HPI A;  2X1D A;  1FMW A;  3PNV A;  1NHC A;  3LSH A;  2XSJ C;  4C2L A;  4XLA A;  2WSS A;  3OYB A;  1X1C A;  1IRX A;  3FBN B;  3H9Q A;  3HOT A;  1WP6 A;  2JJ1 A;  2M5S A;  2L9N A;  3VSL A;  2XC7 A;  3K4B A;  1E1R A;  2WAD A;  2M4G A;  3BCA A;  1BPL A;  2WAQ A;  3D5S C;  5CPR B;  2DJI A;  2LC2 A;  3HC7 A;  1V0E A;  4XKC A;  3OL3 A;  2JJ2 A;  4F93 B;  2VJ4 A;  2XF7 A;  3DTI A;  3K10 A;  4PJJ A;  3B4N A;  5AMV A;  1O8I A;  4XMY A;  3S3N A;  2L5Q A;  4BE2 A;  3BCB A;  2JUG A;  2NTP A;  4DK0 A;  4CCO A;  5KNL A;  2PMZ A;  2LOO A;  1W0K A;  2ODL A;  4E7H A;  1OR7 C;  2ZZQ A;  2A5W A;  1O8H A;  4IX7 A;  2LRD A;  4J00 A;  2OV7 A;  2PJR A;  4AU7 A;  4CCN A;  2JVH A;  4XLH A;  2K3P A;  3BLY A;  5CQE A;  4XOP A;  2F1M A;  3RPU D;  3OYG A;  2R7R A;  3CMM A;  4BQN A;  1QJV A;  3CES A;  3OYK A;  2MFZ A;  5CKT A;  2GK7 A;  4Z03 A;  3VST A;  3IAS 2;  4BDY A;  2E1M C;  1H8H A;  3M8J A;  2P0W A;  4BEH B;  1UD2 A;  4IQJ A;  4D1Q A;  4P5O A;  4U7B A;  1OFL A;  2VJI A;  3CJQ B;  3HUG B;  3L2Q A;  3DLA A;  2QXZ A;  1V5G A;  1I18 A;  3OW7 A;  1O8L A;  1YX3 A;  2XDV A;  4F92 B;  1UG0 A;  2R7Q A;  2W6J A;  5LFA A;  3RQ4 A;  4F91 B;  2JIZ A;  2Y0S A;  3OR2 C;  4RLQ A;  2BVL A;  3S93 A;  4W8Q A;  3OS1 A;  2XOK A;  4E0F A;  1EA3 A;  1WJB A;  3SEQ A;  1E43 A;  1BLI A;  2KDO A;  2R4G A;  4OWR B;  1OGM X;  4XOR A;  4OZZ A;  3AFH A;  2UVF A;  2IS2 A;  3AL0 C;  2Z16 A;  2JSP A;  4II2 A;  3H94 A;  2WJY A;  1N75 A;  4CCJ A;  4W8R A;  3N05 A;  1JRG A;  2NT9 A;  3A1Y A;  3V42 A;  3OYH A;  3MKW B;  4TKO B;  1PE9 A;  2PEC A;  2KRC A;  3LSK A;  1V5F A;  1O8K A;  2X6W A;  3SEZ A;  2DT6 A;  3GVK A;  2XF5 A;  1QU3 A;  2WA0 A;  3HXL A;  2PYH A;  1H8E A;  2X6X A;  5FL7 A;  3GRH A;  2K9L A;  3BG7 A;  3FKJ A;  3FBI B;  3DWL E;  2Z2S B;  3BC8 A;  2WY8 Q;  2CUJ A;  2INU A;  2AQE A;  3TL4 X;  4J01 A;  4ZDP A;  1PYV A;  4F52 A;  1WJD A;  3C2H A;  4XL9 A;  4CA0 A;  4RM2 A;  4AYB A;  2X1C A;  4N4N B;  4Y33 A;  3ZXS A;  4OAZ A;  3DTE A;  3PL8 A;  4MLO A;  2HVQ A;  1VLY A;  1QHH D;  4C2U A;  3SDB A;  2BSP A;  4HG2 A;  4BEH A;  4F55 A;  2O1D A;  2M4K A;  3A3G A;  3H5A A;  2V31 A;  3K4C A;  3GVL A;  2O17 A;  2IS6 A;  1MMA A;  1D0X A;  2HU9 A;  2W82 A;  3OS2 A;  2X8K A;  2V7F A;  2GJK A;  4DNR B;  4OZY A;  1OHH A;  3ONQ A;  1LDK B;  2M7A A;  2CV0 A;  2IGO A;  4C9Y A;  2LH9 A;  4PJL A;  3K70 C;  1N78 A;  1UEL B;  3ZIA A;  2KLO A;  3TMO A;  3W2W A;  3OYE A;  3MD2 A;  3MMY B;  3ZR8 X;  4YXW A;  3OR1 C;  2VJ5 A;  4BJT A;  3S32 A;  4I84 A;  4TT3 A;  2CV2 A;  2MC4 A;  4ANJ A;  4CZC A;  3VMW A;  1K28 D;  1IDJ A;  3VSK A;  1X1A A;  1LKX A;  4YZA A;  1YE9 A;  3LSG A;  4YEJ A;  4DBR A;  4Z1M A;  3PSI A;  2VAS A;  2NT6 A;  3VYR B;  2IGN A;  2WY7 Q;  3QYE A;  1IB4 A;  4DIQ A;  4XQF A;  5JHF A;  1GQ8 A;  4KIT B;  2ZTG A;  2NZM A;  2VPL A;  1KZL A;  2RRE A;  1Z7L A;  3J7A Y;  1DQU A;  4NK6 A;  2VBM A;  4LIT A;  1DBG A;  3ZCO A;  3E1S A;  3QYF A;  3K4M A;  3KX2 A;  3SYT A;  2CFO A;  3E0J B;  4E4H A;  2VQG A;  4HSR A;  1NRK A;  2WBM A;  4DOZ A;  2W7N A;  3OL4 A;  1WFX A;  2WJV A;  4RM3 A;  1W36 C;  3QOD A;  1X1D A;  4NC8 A;  4XN0 A;  2X6Y A;  3L2U A;  3OYJ A;  4YZQ A;  3VWB A;  4G6T B;  4EW9 A;  1KON A;  2BW3 B;  2OC6 A;  2X51 A;  2CW8 A;  3GQ7 A;  4HPQ A;  2NTB A;  2GJP A;  3EPZ A;  3MKY B;  1COW A;  4KT6 A;  1DGR M;  1R6R A;  1VZ0 A;  4B3F X;  3B8Y A;  3DPU A;  3HKZ A;  1FMV A;  2GOX B;  3VYU B;  3ZQQ A;  3CF2 A;  2UUZ A;  1HZE A;  3OFN A;  1BHE A;  4KKU A;  4PSW A;  2GJR A;  3BCD A;  3OE7 A;  2F4I A;  1U0J A;  2Z1D A;  2O04 A;  4U4B A;  3OOU A;  1I8D A;  4LG3 A;  3GQ8 A;  4PMH A;  1Z3X A;  4HRI A;  4IZZ A;  1V0F A;  2QY1 A;  1RWR A;  4L8J A;  2INV A;  1X19 A;  4URR A;  4HST A;  4LIU A;  4BE0 A;  4DNT B;  2HZD A;  2A6T A;  4BQQ A;  2GK6 A;  3W2A A;  3JUR A;  4G7X A;  2ELJ A;  3BH4 A;  2K9M A;  2Z8G A;  1P9Q C;  2CH0 A;  2QE7 A;  4E7S A;  1O8G A;  1KCC A;  2L7K A;  2DOA A;  4PFP A;  2DIE A;  3D5L A;  2IS4 A;  4DJA A;  3I3L A;  2BOL A;  2JDI A;  3IUO A;  1O8M A;  2I8D A;  4MXN A;  1D0Z A;  2XAU A;  4RMN A;  3OYM A;  3KEW A;  1OFM A;  4HIZ A;  4E6K G;  2UVE A;  4CCL A;  3OYN A;  3HPH A;  4BXF A;  1Z21 A;  2RQQ A;  4CCK A;  2HVR A;  1KMH A;  2D3L A;  3OPO A;  1E0E A;  4YZX A;  3KEY A;  3LSI A;  2LY2 A;  2W1O A;  4PK4 A;  1QCX A;  3LL7 A;  1WMR A;  4JOM A;  2M7B A;  3RCO A;  2E5Z A;  1YX5 A;  2ZXI A;  4NC7 A;  4BL0 B;  2V7Q A;  4TSF A;  1XG2 A;  3OOC A;  2V6E A;  2VQL A;  1GLN A;  5HLT A;  1BOB A;  3CP2 A;  1O8F A;  2LG4 A;  1BR1 A;  1SAU A;  2LY1 A;  2WB1 A;  4NK8 A;  3HL2 A;  4ASU A;  2KPM A;  3WQZ A;  4U49 A;  4E7I A;  5HOO A;  2R7W A;  2M0M A;  3JU4 A;  3CJR B;  2EWE A;  2BW3 A;  4II3 A;  1OB0 A;  1V5E A;  5CDF A;  1RU4 A;  3L2V A;  1BMF A;  1N77 A;  3QYB A;  4E7Z A;  1NBM A;  3OEH A;  4XN3 A;  3KYL A;  4BQO A;  4B3G A;  3K70 D;  2CMP A;  2CV1 A;  3DU6 A;  3UW0 A;  2E1M B;  3W2V A;  4GRI A;  1TT0 A;  4IKF A;  1E3X A;  4RLF A;  2KMU A;  4BAC A;  4G6I A;  2VIX A;  2Q1Z B;  2NOJ B;  3OYA A;  2QKM B;  5FRM A;  1DP3 A;  1PKV A;  2V9K A;  4X0G A;  1DGW Y;  2R9V A;  3DKX A;  3DPL C;  3OYD A;  3S8P A;  3K6G A;  4B44 A;  4UZU A;  1T5E A;  4YEL A;  3PNT A;  2F6C A;  4OAY A;  3H9J A;  3QOE A;  4C30 A;  2ZZG A;  1SKY B;  4PUS A;  1UD6 A;  1RMG A;  2O0W A;  4H4K C;  2MD0 A;  2F5V A;  2W00 A;  2UV1 A;  3FKS A;  2X53 S;  3IP4 B;  5HNF A;  2DXI A;  4G7W A;  3RTR A;  5HKK A;  3A35 A;  4B43 A;  3SZG A;  3LFU A;  2DCE A;  4QPQ A;  1WJA A;  1UD8 A;  3DTK A;  3H0D A;  1OLT A;  4NQW B;  3LNN A;  5KHD A;  1CZF A;  4BUP A;  4DGW B;  2R7U A;  1QHG A;  2X1E A;  4XR6 A;  1KCD A;  4F3Q A;  2WZP P;  1WPC A;  3OY9 A;  3S3M A;  4W8T A;  4R79 A;  4BDZ A;  4KIS A;  1NG6 A;  2W6I A;  3DDY A;  4IQ4 A;  3PSF A;  4CH7 A;  1ERD A;  2VXZ A;  2R7O A;  3BC9 A;  2LBF B;  3I9V 2;  4FXU A;  4PJM A;  2ZXH A;  4XKB A;  1AA7 A;  3EUA A;  3DU5 A;  4XM3 A;  4ZC3 A;  4LIV A;  4BU2 A;  1X4O A;  4AVZ A;  1OGO X;  2KVO A;  1G8X A;  2KZV A;  1SFK A;  4U87 A;  3U21 A;  4KKS A;  2HVS A;  1EE6 A;  1H80 A;  2D3N A;  1K5C A;  3A3B A;  3VSU A;  4GQN A;  3ZPP A;  3K4K A;  1T95 A;  2MYS A;  3A2K A;  3L2R A;  2VBE A;  4HEA 2;  1BR4 A;  1Y6I A;  2VXD A;  4N4O B;  5FRO A;  4B47 A;  4NNJ A;  2HQA A;  1UD4 A;  3L2W A;  1PLU A;  3FPP A;  3IAM 2;  2VL8 A;  1S9H A;  4HWV A;  2VKH A;  1MW7 A;  3PFY A;  1MAB A;  3SUC A;  4XKW A;  2AQF A;  2LYC A;  3CZ6 A;  4PFO A;  3H5R A;  2VJJ A;  4ZJZ A;  4Y4R A;  4E7K A;  2O0V A;  1WJF A;  1BR2 A;  3VDX A;  1MMD A;  4CUG A;  1LFP A;  1O8E A;  3CP8 A;  2IS1 A;  4XNF A;  1X0C A;  3TBI A;  4E7L A;  1UAA A;  5C1E A;  1MNE A;  1NG7 A;  3H9G A;  3UR3 C;  3B90 A;  4OJP A;  2ZFU A;  2ZTN A;  3UNG C;  1W0J A;  4OJ6 A;  3FDY A;  4Y3O A;  4FAS D;  3OYC A;  2XZO A;  3OYF A;  3M1C A;  1JI8 A;  4XD7 A;  3OS0 A;  1D0Y A;  4C2T A;  3G2B A;  3ZPN A;  1DBO A;  1VBL A;  2R7S A;  2GOM A;  3BCF A;  2X85 A;  4QPO A;  1IA5 A;  4OJL A;  1MMG A;  4OJO A;  2E5N A;  3C2G A;  2NST A;  3GBG A;  2V4J C;  1VJS A;  2R7V A;  2XF6 A;  2OUM A;  2HPM A;  1K6Y A;  2V4D A;  4Z06 A;  2X3H A;  1D1B A;  3OYL A;  5FRN A;  3OAA A;  3DEE A;  5KCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...