2X6WA

Tailspike protein mutant e372q of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 234
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6wA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6wA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6wA02
1OGMX 3JURA 2PYHA 1GQ8A 2O0VA 1BHEA 2NTBA 1KCDA 1O8JA 4U4BA 1OFLA 2BSPA 2X6WA 4Z06A 2IQ7A 4HWVA 3ZSCA 3B90A 3KRGA 3GQ9A 4XLFA 4W8SA 4OJ5A 4OJOA 2INVA 3LMWA 2VJJA 1O8FA 3VSTA 1O8KA 1QJVA 4XKWA 4OZYA 2O17A 1WMRA 2NT6A 3ZPPA 4NK6A 4YZXA 4PMHA 3T9GA 2INUA 4XL9A 4Z05A 1JTAA 2VBMA 1CZFA 3VMWA 4EW9A 1RMGA 4W8QA 1PLUA 4YZQA 1OOCA 2VBEA 2X85A 1O88A 2ODLA 4XLCA 1H80A 2VBKA 3EQOA 3UW0A 4XLAA 1X0CA 1OFMA 2NSTA 2NTPA 3GRHA 3VSVA 4OJLA 4NK8A 2UVFA 2Z8GA 4OZZA 4YEJA 3SUCA 1JRGA 2EWEA 1O8GA 2NSPA 1O8HA 4YZAA 4OJ6A 1HG8A 1EE6A 4XLEA 1PE9A 1RU4A 4YELA 1O8MA 4OJPA 1IB4A 1QCXA 1K5CA 1DBOA 2O04A 3GQ8A 4XOPA 3FY3A 4XNFA 1KTWA 1BN8A 2O1DA 2PYGA 2QX3A 5C1EA 1AIRA 4XLHA 1O8LA 4XQFA 4XM3A 2O0WA 4W8TA 1IA5A 4XN3A 1O8EA 3EQNA 4MXNA 1KCCA 3GQ7A 1DBGA 4YZ0A 2QY1A 2VJIA 3B4NA 3VSUA 2NT9A 4I84A 4AVZA 2X3HA 2QXZA 5C1CA 4C2LA 1IDKA 2PECA 1XG2A 5AMVA 4MR0A 2NZMA 4XN0A 2UVEA 1OGOX 1O8DA 4W8RA 3VMVA 1IDJA 4XKVA 1PXZA 3WWGA 3B8YA 2X6YA 3GQAA 4XONA 1O8IA 4XMYA 1VBLA 2NTQA 2X6XA 4XOTA 4U49A 4Z03A 4XORA 4URRA 1RWRA 4XR6A 1NHCA
chains in the Genus database with same CATH superfamily
3OY9A 1ACIA 4G1VA 2XEXA 2ZZGA 1BC7C 2GAUA 3CUQB 2O0VA 4M2LA 4X0CA 1JUPA 3Q9SA 2Z3YA 1G2HA 4EJVA 3IV5A 5FO0A 3AAFA 3A8JA 3LAPA 3VNUA 4GYGA 2DT5A 4LG0A 2IS6A 3B90A 2VBTA 3L9FA 2DFEA 4A3KJ 2PEXA 3MZYA 1P6RA 1EH8A 1V3FA 1S8NA 1BQEA 2F5DA 1JT6A 1SD4A 3QFSA 4ZGNB 2R5YB 2YPRA 2H8RA 3I3LA 4HZFA 5EYRA 3WTTC 1YFHA 1BM9A 2UUZA 3TOAA 1VQ4B 3QYEA 1QA6A 4M9XA 4P9FA 3JAMK 3ZQIA 4XKWA 3QU6A 2HPIA 3OYAA 2GJRA 1AOYA 4YFNF 1I50J 3G1LA 3DQVC 3C2GA 3DEUA 4IJAA 5J4VA 2IXSA 1U9NA 1QGYA 4OIQF 2EFPA 3H09A 2VFOA 3ZQHA 1F60A 3I59B 1QFYA 1Y0RA 3CPXA 5LMZA 2I10A 1TT5B 2Q2EA 2XAUA 4XLNF 1ZELA 2JT1A 4PGGA 2BM0A 3E97A 3RQIA 1W0TA 1BPLA 2X6OA 3JTGA 2NVTJ 2KQRA 1U0JA 1XFOA 4XICA 3CDHA 5D6EA 4YIFA 2B7EA 1KQ5A 4P2NA 3K4KA 1GT0C 2VBYA 2W25A 1W0UA 2BZTA 2ZSIB 2M4GA 3E3VA 4Z4ZA 3GTJJ 5D6FA 4LIVA 3IRQA 3LSPA 1JJ2B 2MLGA 1VJSA 4BBRJ 1ZK8A 1IW7F 2X48A 1KZHA 1EE6A 3CCUI 4Q5SF 3U6KA 1EFUA 4OJPA 3PIPF 1X4OA 4DW6A 5E8IA 2YU3A 1MDMA 4RM0A 2MLKA 2HGCA 2QKMB 2BXZA 3P27A 1DGWY 4BJ5C 3F8CA 1F36A 3ZQCA 1B9NA 3HKZN 2VOPA 2PMZN 2XPVA 1QX4A 5KNLA 4YDTA 3Q6RA 2B9SA 3NWTA 3OZVA 2IPQX 1UHSA 2NPFA 1D5YA 1J0RA 3CDLA 1FZPB 3TOBA 5CQEA 3GCMA 2FD5A 1R5BA 3CMMA 5BPIA 1YW7A 5E3MA 5LHHA 3AL0C 3K2AA 3BZ6A 2AHQA 1Q1VA 4L5IA 1SAXA 3J80K 2VKHA 3A3GA 1AHDP 3G3ZA 3QP6A 4D7MA 1JKPC 4F52A 3I4MJ 1BJAA 1I6HJ 2V1UA 1K73D 1NG7A 4M9ZA 1KU2A 3KZIC 4MNUA 4RM2A 4BKXA 1SVMA 1N0VC 3CLOA 3OS2A 4X05A 2KIMA 4MQVA 4A5NA 3WWGA 1O7FA 2XDVA 1GAQA 1MH4A 1M1KD 2IJLA 3CJTB 4R8HA 3IAS2 4U7BA 2WJYA 2BX6A 2WV1A 3S1QJ 1P4MA 2NTQA 1FY7A 2E7WA 4XOTA 1TQIA 1CNFA 1TWAJ 2Y69H 4IRGA 2XNDA 3L00A 2DTZA 3K10A 3IKTA 2QTZA 3C2BA 3TW6A 4XKBA 1IDYA 2BSPA 2B5OA 5GADJ 2FNAA 4XSZF 2G9WA 2H6CA 4C43A 2EA2A 3BTIA 2V6EA 1DPUA 3CCMI 1YJNI 3V8LA 4BE0A 1BW6A 2NVQJ 3BTJA 2XAGA 4A3DJ 4EJTA 2ZL5A 3BPVA 2B7BA 1QBJA 3H5RA 2AXTC 1ZRFA 4PGOA 4L0ZB 3ZQFA 4OZYA 5DUIA 4HE5A 3PNYA 2D1VA 3WODF 4CO8A 2VFNA 5DD4A 3SYTA 2JMWA 3OPOA 3QSYA 3CMEI 1A8PA 5EG0A 3RTRA 1U5TC 2R0QC 3ZQQA 2KP6A 1FNNA 3KLOA 1OOCA 2CUZA 4XRSA 1VF7A 3OEEA 4U88A 1EA0A 1MBHA 1R5HA 4XLCA 1UD8A 4LBYA 2LG4A 4X06A 3S2WA 5HODA 4PC7A 3ZP5A 1CGPA 3SY2A 3CCLB 2QTLA 3BY2A 4FX0A 4HNUA 1FDRA 2M0CA 3ZN1A 1E63A 4I76A 4FK8A 2LF8A 4G12A 5B5EC 3VSVA 4P26A 3FMSA 1FPQA 4YG2F 4IZZA 4KNYA 2P5KA 1R5OA 3WYAA 1HXDA 5HDKA 4I99C 3LO8A 4HX4A 2GWRA 2ESNA 5IT9Z 2CRGA 2HQRA 3H9JA 3TEDA 2CUJA 2KIQA 3BCDA 1YX5A 2VB6A 2ZC2A 3KP5A 3DV8A 3WGGA 3OP1A 5BSYA 3A3BA 4V02C 4RM3A 1MGTA 2OD5A 2F48A 2XTXA 3GVAA 3KZYA 2MA3A 2W85A 2OC6A 2ELHA 4BJ6C 1BN5A 4C0SA 1JA1A 5FFZA 2IAIA 1TLLA 4WZKA 1D1NA 3DKWA 2YSRA 2GA1A 5JI6A 1EP2B 5DSZA 2E1NA 3VSLA 1FOKA 4B3XA 4RD0A 2UV1A 4ANJA 3N4MA 1SD6A 2O1DA 4DYCA 4B4CA 1AIRA 5DS9A 1MMNA 4C3IJ 5FL7A 3LAJA 1MABA 4XQFA 4Y9UA 3TO7A 2A69F 3DU5A 1ZRDA 1ZH5A 2GXGA 2W4SA 1XSXA 1ZAOA 1AWCA 2LREA 4MXNA 4RAZA 1BJZA 4DIQA 2FUG2 1E64A 3LQ6A 5GV8A 1IJEA 1I7PA 1IRGA 4ROXA 3QRFF 4L9TA 3H9GA 4RPDA 4Q7JB 4MTDA 2FOKA 1FEXA 1OGIA 3JU4A 3IP4B 2DOFA 1Q81D 2PJPA 5H20A 4WZLA 3NRVA 2ZKZA 4PAAA 1KU9A 1WI3A 2LD5A 2HVSA 4HQMA 4NDLA 3VYUB 2RDPA 3BH7B 4F93B 4OPVA 3TO6A 1ZGJA 4CICA 2WR8A 1LEBA 3AGPA 2BM5A 4N0BA 5EZHA 1IG7A 2CQKA 2ZXWH 3CCRI 2XNCA 4G6DA 4PJLA 4GXOA 1IHMA 4XD7A 4HIZA 3RSNA 1ZTRA 3IL2A 1FYMA 2VZLA 4YHBA 2M4KA 2P7VB 3OYDA 2O61A 1NRKA 1QA1A 3B78A 1KGSA 4OOIA 1I3AA 4OIOF 2LBFA 3A35A 4G7XA 2BVNA 2CRVA 1HW5A 2GPJA 4YIRX 1I39A 2GREA 1N07A 3DBRB 4LG0B 5H59A 2HPMA 1RUNA 4MFEA 2COBA 4LC0A 2QQ8A 3G73A 1L3LA 1VHEA 1KQ9A 3NWSA 5J47A 4NC8A 4DK1A 2DODA 5TR9A 3ZQLA 5E3LA 1APLC 3HJEA 2E1OA 2Y48A 3SQVA 3LSKA 1QJVA 1TW3A 2E5ZA 5J8FA 5HLGA 2NT6A 3CRZA 2O9LA 4YZXA 2MGQA 3ROUA 2E35A 1JNYA 1Z7LA 3EDPA 3G6EI 3V7SA 2VE9A 1KRHA 2VYQA 1JTAA 1KC8D 2D3LA 1EP1B 2OAZA 1DABA 1FYKA 3RKQA 4IHXA 2Q2EB 2QSHX 4EEFG 4P12A 3I54A 2OU2A 1V54H 1Z3XA 3WG9A 4CCLA 1I3QJ 1S7EA 1ZLJA 4HAMA 1R49A 4QVAA 3B6CA 5DS0A 3ZPLA 3ASOH 5CVIA 2H94A 5E1WA 1V0EA 5CQGA 4E7JA 1ZR2A 5BQTA 2GK7A 4AF7A 5FKMA 1SEUA 3F21A 5L3DA 2EWEA 1Z21A 2NRAC 5KW9A 2MBFA 4KT5C 3HSRA 4A6DA 2LFBA 4XBFA 4RGSA 3KEQA 4FX4A 1EA3A 1VQ9B 3ZMZA 2EFOA 4MTEA 4AU7A 5FJ8J 4HQEA 4NHJA 2C78A 5THXA 4Z4YA 3I55B 2CQQA 2ZMEC 3JRAA 2M3AA 5IYWA 1ZREA 2G0YA 1E1QA 3RDIA 4G7HF 4D5FA 1MDMB 3M7GA 2X53S 1TWCJ 1W5SA 1T56A 5JHUA 4XNFA 3DBHB 3E6MA 4WWCA 3R6SA 5FRNA 3CB4A 2XC7A 5JVTA 4O5VA 3SFZA 4XLHA 1M1EB 3J7YJ 4LG3A 1B2RA 4RAYA 3I56I 3HL2A 4X7DA 4A3GJ 1PJ7A 2R93J 3DPLC 5IP6A 2Z99A 3EQNA 2ZTGA 3M1EA 1LKXA 1S29A 3QYFA 4Q48A 3ZMTA 5L3GA 4QPQA 1MZBA 3OYJA 2GM4A 3BR0A 1OLTA 2M34A 2ZZFA 3LSTA 3S93A 3W5UA 3OYCA 2XGEA 2E19A 3CP8A 2NZMA 2VKEA 4IOCF 2OBRA 2IBDA 2NS8A 1WJEA 5IY5H 3GZ6A 3V76A 3R60A 3TDUC 2HDWA 4P96A 5KHDA 3GSIA 1KONA 1A04A 2DBBA 4X6AJ 2CW8A 1VQPI 2P5VA 4N4NB 2V4DA 1T6SA 3UKGA 3JQRA 1I27A 1JA0A 3W6VA 2Y0MA 2DOGA 1TSPA 1YG2A 2HWVA 3BTCA 3H9QA 3J7AY 1E3PA 1OGMX 3DU1X 1SFKA 2JN6A 2RGVA 3K1MA 2E7XA 4YFXF 3WTSC 1BHEA 2BSAA 4U4BA 3VYSB 2STWA 1LE8A 3JCUC 1NTCA 2RREA 1G3TA 5IT9K 4M3FA 3ZSCA 4EM1A 3A0HC 4AWXB 2C6YA 3KRGA 1RQPA 2EPFA 4Y52J 1QQ1A 4W8SA 2R7XA 4R71A 2LH9A 4LB6B 3ULQB 3CCVB 2CUEA 1ERDA 3AGQA 2EBIA 1L1IA 1UG2A 4EMSA 5LGNA 1TLHB 2PBIA 3WTXC 2HQNA 4P9UA 2FNPA 3BROA 4BHBA 1O4XA 5JLVC 2DO7A 1KA8A 1UHWA 2ME0A 3IAM2 5EG0B 2ID6A 2QMUA 1R1UA 3P5JA 4CZZA 1REPC 1J9ZA 1YX3A 3L2VA 1S5LC 4LD5A 2XIGA 3AVYA 5HZAA 3DBLB 2JJ1A 2IS4A 4L0YB 5LRSA 3UW0A 3ZQ7A 2VLAA 3HRMA 2F4OB 2NS7A 3GTMJ 4Y17A 5JLXA 3FKIJ 3PO3J 1W7PA 1B23P 5JHFA 4PC2A 3Q3AA 3CCJB 4TV7A 3QOEA 1MJBA 4HSTA 1LFBA 2CG4A 2CV1A 2DA7A 5C4JJ 5J3OA 3T53B 3HRUA 4FCYA 3OYNA 2GIZA 4WQMA 1JGSA 2O8XA 3Q0VA 3LL7A 2X8KA 2V9KA 4FASD 4B43A 2CW5A 3ERED 1RPWA 4I2OA 2C4UA 4OIRF 3W2FA 4RGUA 1ZR4A 1E3OC 1H8HA 3QE2A 5LGTA 1FBQA 1HF2A 1W34A 2HKXA 4B09A 4X7CA 5HDGA 2HDNB 3ISPA 3SLNA 2E2IJ 3H5AA 5BNGA 3RI4A 1R5ID 3SZPA 4YXWA 5LGUA 4ITVA 1FLIA 4QVJA 1K6YA 2LLKA 1ETXA 5LEKA 2DTRA 4I02A 1WJCA 4AIKA 5F6FA 1I1GA 2XRNA 4FTHA 4Y33A 2KL4A 5CVVA 2V1NA 3T8RA 4AYBA 1H9TA 2VN2A 1ZM4A 3TQNA 3BG7A 2IA1A 4CUGA 5CVRA 4CGZA 3GQ7A 2K3FA 1T08B 1XD7A 2VJIA 1BC8C 2IS2A 3GVJA 3VSUA 4ZC3A 3VWBA 2CBXA 3HAGA 1B4AA 2VKVA 3KEYA 2ZJRF 4OPSA 2QXZA 4IHSA 2OTJB 5AIPA 2FX3A 1IDKA 5D4SA 2IP2A 2WAFA 2BVLA 3C2HA 1AKHA 4P5OA 4XRSG 2OK7A 1D8TA 3LQEA 3OMYA 4QFMA 2A6TA 2QM3A 3LVBA 3B02A 1MW7A 1XCVA 1ETOA 2K27A 4JK1X 3DXJF 2DU9A 3W6JB 1GDTA 1WH7A 1Z1DA 2BV6A 1QZEA 4LLLA 2YWGA 1FTTA 4ZDOA 4IO9F 4M4SA 1TT0A 3S32A 1KU3A 1PKVA 3PA1A 1POGA 3HYIA 2PIAA 3R4KA 2YUSA 4IRIA 3HSEA 5H5JA 3I5UA 1D1AA 2CS3A 5E79C 1XSDA 1W5CC 1OFLA 2VFQA 2CUFA 5K5RA 2LBFB 1PDNC 3CTAA 1X3ZB 3SYJA 2RQQA 1KD1D 3HEFA 3KP4A 1BI1A 3TKYA 1JTXA 2PN6A 2HOSA 2DA1A 5IYDJ 1QZYA 4RD1A 4WK8F 1QA2A 2ME6A 2R7DA 4EM0B 3MKWB 2GOXB 3NQOA 2VQLA 3A4CA 2CU7A 2MH2A 4BL0B 4P25A 5DNSA 2B0RA 2QQAA 3ESWB 1GV5A 2IGKA 5F0FA 1MJAA 2RN7A 4IXAA 2JZYA 2PX9A 3EYYA 3IUOA 3K1PA 2XF6A 3QP5A 1KZLA 4M53A 4P1WA 4K1XA 3W2EA 2K4JA 2VUMJ 3BJ6A 2Y0SA 2RNGA 3QYBA 4BXFA 3KX2A 2XB5A 1OYWA 4HX8A 3J81k 2AQFA 3DTKA 3EYIA 1B59A 4PJMA 4JX6A 2XAQA 2DYIA 2OQRA 3LA2A 3MCZA 3O6BB 1UELB 3TMOA 3X2QH 3ZRGA 4EJOA 2NTPA 5AONA 2W1OA 2UVFA 1K61A 4YFOA 1R4MB 3U9GA 3OFNA 1OFEA 5IOYA 1JUMA 4G9YA 3GFLA 2X9DA 3J7AO 1O8HA 3LFUA 1UJ8A 2W6JA 2BGCA 3RYRA 3CC2I 1EFCA 1VQ6I 4LGWA 3U21A 1W0JA 3LMMA 1B1BA 3H35A 5J3LA 2EZHA 3J81Z 3D1NI 2O7OA 2LNBA 4ZYHA 3SEJA 2K9NA 2FQ4A 2PE3A 2ELKA 2X0LA 5B1BH 3WG7H 1JGGA 1X1DA 4M3BA 1UAAA 3RZDJ 1P9QC 4CYCA 2PJRA 2OCEA 2HZTA 5B3SH 1B9MA 4S05A 1VQOI 4HV6A 3FBNB 1JKOC 2HU9A 1BL0A 1X3UA 1XB2A 1XDUA 3LQQA 4DZPA 3GTLJ 2DAOA 2PMHA 2JVHA 3FXOA 2XPUA 4ZTJA 4RDLA 2AO9A 4NC7A 2LP0A 2K9LA 1T38A 1QUFA 2CQNA 3AL0B 1DARA 3D0SA 3ZMSA 4XM3A 1VQMB 1ZLKA 5IYNA 2LC2A 1BR1A 3UR3C 4XN3A 5TV2A 1IRXA 3GTGJ 3E6CC 2XGXA 4RA2A 1Y8QB 2Y75A 2NT9A 5ILSA 1I1SA 2EIMH 4M3GA 4WXDA 3VDXA 3SDGA 4IW3B 1MMDA 1TW2A 3S16J 1T0FC 1K83J 5FA6A 2XT2A 3CC4B 3K9TA 2WZNA 1JUSA 2DA6A 3P4GA 2R7WA 2LY9A 4JQFA 3ABTA 5FLVA 5LHIA 4LJZF 4LB5A 3FWEA 3DDYA 5J4YA 3OSGA 3CCYA 3RPUA 4NQWA 4HE6A 2IOUG 4RCYA 4C30A 1BI0A 4OMZA 3CCLI 2CC2A 3S3OA 2DA2A 4AC0A 2K86A 4BHCA 4XORA 2Z6BD 1JJ6C 1KTWA 2R7VA 2DFHA 1CQXA 1TYWA 1Q82D 3OOUA 4ENMA 3ABKH 2VNHA 1I5ZA 3BZKA 3GUDA 5D4RA 5DCMA 1ORKA 2VT2A 3OR1C 4BY1J 2EFQA 3HC7A 1MJ9A 4IF4A 1VLYA 2W00A 4QPOA 3OEHA 4RJLA 1TYXA 1E2XA 4Q47A 2EFWA 1LE8B 3BY6A 3TP0A 3CCEB 1GXQA 2VBUA 1XSVA 2E34A 2X1CA 3KETA 1G6NA 1T33A 2I8DA 5CVUA 2XKOA 2L4AA 2F4NA 1G3SA 3WY9A 2ZCWA 4KDPA 2K3PA 5LEJA 2QEXB 5B66C 5IYQA 4GO1A 2FQ3A 2ZL6A 4WF2A 1SKQA 5EMNA 1X58A 3AVUA 2J5PA 2HR3A 3OR2C 3ML3A 1R1VA 4MO7A 2ZZEA 4DBQA 1T8IA 4W8QA 2R7TA 1PLUA 4Z4WA 3ERMA 2KZGA 3ZBTA 4PDKA 1SFUA 3BQJA 3DP7A 1MMAA 1XMKA 3HUGA 2XAHA 2Y9YA 3FK6A 3Q38A 2H1LA 2L9VA 3FHNA 2F5FA 3W2WA 3GTKJ 3A1YA 4L5EA 1QFZA 2IA0A 4NC6A 5FD6A 4U0VA 3G4SI 4NK8A 1ZG3A 2GJPA 2E1MC 1A6IA 1SMYF 1W7PB 4Q4ZF 3P26A 4X7FA 1O8GA 2F2EA 5HS8A 3KYLA 2R92J 2XB0X 2WTEA 2K9MA 1OCZH 2QWWA 1S3JA 3MCAA 4YZAA 2BYVE 5DTDA 4EJWA 5A89A 2LSOA 1N78A 4RD2A 3LA7A 4IQJA 1R00A 3S1RJ 1BBYA 3RKWA 5M5XJ 3MQ0A 4KN4X 3R6JA 4F7ZA 4WZEA 1HZEA 2UXXA 1Y8RB 2E36A 3PA2A 3PSFA 4F7DA 1U2WA 4IOAF 1ULYA 1E1RA 3FDYA 4PCQA 1WJDA 1ZGWA 1WOPA 3ASPA 3W3CA 4UUVA 4PC6A 4Z4UA 3CC7B 1N8RD 3S14J 4TN1A 1HKTA 1WDTA 2NVYJ 4E7KA 1D0YA 4PGHA 2LOOA 1VQNB 2FVGA 1MMGA 2DI3A 1VQLI 4GCVA 4F92B 2K40A 2A6HF 4MYTA 4OPOA 1W4MA 2VNKA 2V7UA 2XC1A 2QKLB 3BG3A 2Z33A 1GVJA 4KT6A 3V4GA 3R0AA 1O8EA 4CQJA 2OV7A 3HOVJ 1Q7YD 1SC7A 2V9VA 4PC3A 3OV8A 5HKKA 1P4AA 1S6LA 3I71A 5E1XA 2PYHA 1EH6A 3D26A 3K4NA 3AK5A 4ZYGA 4C2LA 2LTPA 3ZZTA 5FD5A 3GXOA 5BPDA 4DYRA 2RV8A 1K9MD 1J2XA 4A0YA 3BR5A 2FX0A 1YJ9I 3BR2A 1AKHB 1AIPA 2YX4A 5JFRA 4H0EA 4S0HB 3OYLA 4ENKA 4TMXA 4QHYA 2Q6LA 1K78A 2EWNA 5H6QA 1PXZA 3CO7C 1OPCA 1BR4A 3B8YA 1QZZA 3DWLE 1DGRM 3A01B 2STTA 3B8HA 2L9NA 3F8BA 2X4HA 3V8KA 2ZXJA 2VKDA 2G0EA 3ABUA 4GYIA 1VQ5I 1Z6TA 3ZUGA 1X1CA 1BIBA 5F1JA 1DUXC 4AF6A 4N4OB 3CCQB 1SKYB 2L9SA 1YI2B 4XKCA 2ESHA 1HKQA 1OCCH 3F9KA 4UHTA 1O8JA 1VF9A 5F64A 1KJZA 4Z4VA 2FXAA 4Z06A 2L01A 2JQ7A 2IQ7A 3BQYA 1B72A 1EJ9A 4IX7A 2QA4B 2E71A 2VQHA 3W2IA 4U0WA 1JTYA 3P9IA 3OSFA 1QNTA 3DF8A 2UZKA 1AMOA 1IN7A 3J81K 2R7UA 4Z2YA 3OWTA 1R1TA 3VO2A 1V0FA 2XTWA 3OYMA 1W1WE 2R9VA 2YWHA 4II2A 3CMAB 3WGHA 4A0ZA 2DCUA 4Y7CA 5FRMA 1LEAA 2I1LA 2CQ7A 2QZ8A 3KP6A 5ICCA 1TTYA 2GQQA 2ACJA 3DPTA 4K2EA 2P3MA 3PUNA 5TISC 3ZGKA 2DOAA 2JSPA 2LDUA 2ISYA 3OYBA 1YHQI 4G94A 3PVDA 1CF7A 2CJJA 2DMPA 1FT9A 5J1UA 2DMUA 1TBXA 1WSVA 1H80A 3ASTA 1YJWI 1N0UA 2KISA 3HB9A 2PMUA 3K4MA 2DLLA 2VIXA 4G6QA 4LOCA 4RB1A 3Q5FA 1IJFA 1T6YA 1XGMA 2PMDA 4HA8A 4E4HA 1B8IA 3HOXJ 1PP8F 2LY2A 3MAJA 3OYFA 2F4MB 4IEJA 5EEGA 4TMWA 4KMUX 4PSXA 1QH0A 2JPCA 3HM5A 3WGIA 1LFUP 2TRTA 1M90D 2BHZA 4B3GA 4HF0A 2J7KA 3EUKL 1HA8A 3OYKA 3H94A 4LLNA 2BM1A 3L1PA 3M8EA 3CF5F 2XNJA 4RGRA 3MFKA 3DKXA 3WU2C 1ZG1A 1VQKB 2M5WA 2VL8A 3OIQA 1BLIA 5FLXZ 2XGJA 1OFDA 4RS8A 2HMAA 4YEIA 3WBKA 4F55A 3PUFA 1J59A 5HS9A 2FOWA 4CYCB 2KKOA 2PJRB 3FK7A 2J8KA 2IA2A 4JP0A 3W2GA 2W24A 3HKZA 1F1ZA 1SVOA 2IGOA 1OB2A 2B63J 2PMZA 2R3SA 2HNHA 3N90A 5C1EA 2E1RA 1YO5C 4ZYEA 5BS6A 4TKOB 5FB2A 3LQRA 1T0FA 3CCSI 2HZDA 3CCVI 3KL9A 4YZ0A 2QY1A 2M30A 3BQZA 1VQ7I 1J9IA 1MIJA 2VBVA 3B4NA 4DQLA 1RESA 3BCFA 1QQIA 2KRFA 2K02A 1YS6A 2V31A 4WZTA 4R79A 3GEZA 1D3YA 2JJ7A 1WU8A 4QIWN 3ASSA 3H5NA 4E7ZA 1JXSA 3VMFA 3LJYA 1OCRH 1T39A 4G7WA 3DEEA 1FBUA 1AA7A 2HXIA 4EGYA 2PQ8A 4QV2A 1T6XA 1OCTC 3M07A 2KFDA 1YE9A 1MNDA 1SMTA 2OTLB 3H3VK 3L2CA 1D2EA 3SJZA 2X51A 4NQWB 4IPAA 2YS9A 1FP1D 1X2MA 3B82A 5L3EA 1O3RA 2X6XA 3PUMA 1TWHJ 3OYHA 4ZDPA 2GZWA 3M8FA 5EF6A 2V9PA 5JMCB 3FXUA 2FU4A 2FJ1A 3IH2A 2OJED 3LOCA 3ZMVA 2XV4S 2VBXA 1FIPA 1HSTA 5DCMB 3SLDA 1WJAA 2MABA 1K8AD 2G7UA 3TL4X 3O3KA 1ETYA 3U1KA 1HDDC 1Y56A 2V79A 1QG0A 2V7VA 4D5CA 2CGPA 2WC2A 2BEOA 4KIFA 5GPAA 4OAZA 1TNSA 2WAQA 1FJLA 2HI3A 3ONQA 3KP2A 5J1YA 1FOYA 1G7CA 5J35A 1HW1A 5F0CA 2W48A 1Z05A 3E5QA 4BGDA 4HSRA 4CSWA 2A5YB 5EGOA 3HSFA 3ZIAA 1XDSA 4HLXA 2E2HJ 1IUYA 2DERA 1CZFA 4N3NA 1OGJA 3FM5A 1RMGA 4YRVA 3HIFA 3KZZA 3S1NJ 3BTLA 4MLOA 2OUMA 2X85A 4J0QA 1P7JA 1GJRA 2DXIA 4M71A 4RPBA 1NK3P 3NE5B 3LSHA 1NHAA 3HUGB 3FISA 3MN2A 5LHGA 4UVCA 1WWXA 4F91B 3OL3A 4LBWA 1J75A 3GRHA 2AXLA 2DMTA 4X8IA 1ZG5A 4EV0A 1S4MA 3AVVA 1FYLA 3MMYB 4HYEA 3D5RC 4KISA 3Q9VA 3GLXA 2XSDC 3RZOJ 4YIIA 3VFZA 2XT4A 4A6EA 5IOZA 1WJFA 3M9AA 2ICWG 3LFKA 1IUFA 1IB4A 1Z7UA 4D7NA 4EQQA 2ISZA 4ZZDA 3EUAA 3AVWA 3FY3A 1W35A 1WCMJ 4TT3A 1YW8A 1FWZA 4AM3A 2UWMA 3WQZA 3W5VA 3DCFA 5GTIC 3E5UA 4ZJZA 1GXPA 1DG1G 4ACBA 3CCUB 2PYGA 4BQQA 3W2HA 4GGGA 4EH1A 2HVRA 2O8KA 2YUHA 3K1NA 5DM7F 5JVGF 2ZNZA 3OJXA 2XF7A 4FT8A 3SZGA 1Z6RA 1F43A 1TUIA 2C4TA 4Y9RA 1YIJB 3K69A 3KEOA 4ZYAA 4RDUA 1ZUNB 2RC4A 2D2WA 5EEAA 3F8FA 4M0LA 3S8PA 4BQAA 3GTPJ 2P6SA 1EF4A 4OP7A 5DV5A 2NS0A 3VO1A 2V7FA 4JOMA 1QRCA 5C1CA 5FGMA 2ELJA 5EEHA 3T8TA 3AG4H 4BYYA 3WTUC 1MKMA 3PSIA 3Q3SA 4KITB 2DJNA 3H9NA 2COMA 2EK5A 3ZR8X 4BAYA 3QFRA 3JX8A 5AMVA 4Y4RA 4UV8A 4HDUA 1WH5A 5TGTA 4DGWB 4IL6C 3AVTA 4C2TA 4XN0A 1TWGJ 2WY8Q 5CPRB 3DKYA 4EJUA 2VQCA 3D5SC 3E1YE 3HTUA 5DD8A 4PUSA 1K78B 2QGGA 2MC4A 3RIRA 5DEQA 3R61A 4C3JJ 2GOMA 3CJNA 5D8KB 5K7ZA 1T5EA 1Z91A 3I64A 2X3UA 4FWTA 3JSOA 5HDNA 1R6RA 1ITYA 2ZJPF 1HVXA 4W8TA 4XR6A 5E3OA 1HF0A 2OBTA 2P4WA 3JURA 3FM3A 4A69C 2QUFA 1X2NA 2M1BA 3OYGA 3E6DA 3L2UA 2E2JJ 1SD7A 5A8AA 1U8BA 2X6WA 9ANTA 1LM1A 3ECOA 2EV0A 1U6GA 5M3FJ 4P6YA 2JWTA 3HHHA 1B72B 3BCBA 4ASNA 4OJ5A 1PVEA 2CFXA 2JA6J 3BWGA 4RLQA 2KVOA 3W2VA 5FLXK 1BOBA 3JQQA 2Y31A 4JYKA 2LKPA 3OZWA 4A3IJ 3ZPPA 1MBFA 1NB9A 2ZZQA 3PSZA 2JA7J 4E7SA 2Q6IA 2INUA 5HOOA 4RD6A 5H6RA 3CCMB 4B8XA 1YJNB 3VMWA 3GLLA 2FSWA 3OOCA 1XX5A 1UFMA 4HLYA 1LVKA 1SANA 4I98B 3GQBA 4V2FA 2CQXA 2O03A 4BE1A 2HDDA 1ONVA 1UB9A 2VXDA 3ZZUA 2CWEA 2CK3A 1CF7B 5F4OA 2ZO4A 4BDZA 1MNEA 2VE8A 4U9UA 1V55H 1X0CA 3CMEB 2JRTA 2DQRA 2V26A 1K4TA 1OCPA 2JUCA 3F3XA 4KKUA 2ZXIA 1GVDA 4ENNA 4CCKA 1B8IB 2JPBA 4GFBA 3AG1H 2NSPA 1N05A 1RRJA 1U5TA 4BNCA 2M8EA 4OM9A 3IWZA 3PETA 1VQ8I 2CYYA 1RU4A 1E62A 5HNFA 2AS5F 3FJOA 1O8MA 1S72I 4C2UA 3V42A 5D5VB 3KIOA 4UB8C 2ZBUA 3G71I 5IYCJ 2NNYA 2NXNB 4XIDA 1TP4A 3MWMA 4I7HA 2V1DA 3L2QA 5FFXA 5C4XJ 2ADUA 1PJ6A 1Z9CA 3UNGC 5BMZA 2MD5A 1LNWA 1QO0D 1U2RA 2JA2A 1WRJA 1ZM9A 2V7XA 3OZUA 4UZFA 1X19A 2HS5A 2H27A 4S04A 6PAXA 4OU0A 2DEUA 2RAEA 1DP7P 2GXBA 4U0YA 2K9SA 3NAWA 4HF2A 1OB0A 5EDNA 1XTAA 1J5YA 1Z67A 2MG4A 2QSFX 4KN7X 1K79A 1WOOA 2WPDA 3GVKA 4TMTA 2O0WA 1DU0A 3FXLA 4JX4A 2XAJA 4U7DA 2WWYA 2W6IA 3FKJA 1R36A 3DFGA 1LDDA 3KLNA 2EH3A 2RC5A 5K5OA 1Y6IA 2X1EA 3FMQA 1OFCX 4L18B 3CD6B 3E1SA 1E0EA 5BOXA 3PM1A 4MR0A 4F3QA 2JDIA 1Y0YA 1NH3A 1IJWC 1JI8A 3VMVA 3RYPA 1IDJA 2DIEA 4KICA 2RVCA 5CJ9A 2WJVA 3U6BA 1G59A 4CCNA 2X6YA 4G6TB 4Y3OA 4ZZLA 5KAFC 3PUBA 1D1BA 4RAGA 1QPIA 1LFPA 1EZGA 2RQPA 4HG2A 4HNTA 4YAOA 4B1RA 2HVQA 2R6HA 1ETQA 1XCBA 1VQ4I 4XRFA 5DM6F 3COAC 2LRDA 4RLZA 1K4SA 3VR6A 4NBSA 4M73A 2XRLA 3H3UA 3WBJA 3CCRB 3H0DA 2MSYA 3ZC3A 3PQKA 4NUBA 5GTHC 1TL8A 1K7AA 1RKWA 4BU2A 1T2KA 5FIUA 1ENHA 1R71A 2BY0A 2ZL7A 1YI2I 3V7RA 3LWFA 3A01A 2ZJ2A 2O3FA 5F27A 3QPSA 2HDCA 3MHPA 5E17F 2W7NA 1X4PA 4D9JA 4PMHA 1XGSA 1H88C 3LYCA 3LSRA 2FF4A 4XL9A 1COWA 4Z05A 1K4ZA 5EGOB 2OZ6A 3ZOBA 4UVBA 1OHHA 4EW9A 1J7KA 5DCFA 2VBWA 5E8GA 5M5WJ 1WZ2A 2Z5UA 1OISA 1XQBA 2F6CA 2VBEA 3BG9A 2MH9A 3F0CA 2VI6A 2ODLA 1PUFA 4MFDA 5ILVA 2KRHA 2E1MB 1T95A 1QHHD 5GAGJ 3ABMH 2VPRA 2B0LA 2DOEA 5KCMA 2F5EA 5L3FA 2BN4A 3EQOA 3G6EB 3K2ZA 1ZYRF 4FHTA 4L9VA 3JW4A 1WGXA 4YEJA 3GFJA 2EIKH 4FETA 1I18A 1A5JA 2WB1N 2ZFUA 1OKRA 3TBIA 3WTYC 1TYUA 1GLNA 2ID3A 2ZB9A 5CVJA 2L7MP 2LF7A 4XLEA 3TW7A 2NOGA 3RKXA 4AUXA 1N06A 4FN5A 4ZDLA 2IW5A 3TP3A 4J19A 1WQ2A 2M45A 2Y30A 3IH3A 4EM2A 2A3SA 3REOA 3LSMA 2OBPA 4IVNA 4FE4A 1DBOA 5M3MJ 2M5SA 2BVMA 2CO5A 3L7WA 3JRHA 2A05A 3I4NJ 3SJPA 5IYRA 1FSHA 3W6KB 2QE7A 4DNCA 4AVPA 4KH3A 1DDNA 3N97A 3FHZA 4N9IA 3PFYA 4Z6YA 4JX5A 2KIFA 4ZV4A 2BW3A 1FNMA 3FXMA 2QA4I 2ZMEA 3CO6C 4P3IA 5JBQA 1YITB 2R7FA 2GBYA 2WSSA 2GQFA 3JR9A 3NEUA 1USTA 2F4IA 3OW2B 4YAWA 1MMSA 4WWVA 4LK1F 2K9QA 5JLWA 4KIBA 3RPQA 2BF4A 1S0UA 5F04A 4PABA 2PECA 1G7SA 2FA5A 3I56B 2XPWA 2E60A 2HYGD 4UV9A 3E6BA 2LKXA 2CNDA 3BJOA 3MEXA 4OAYA 4BBSJ 2MC3A 1W5TA 1N25A 5K1YA 2MW8A 3BG5A 1OYIA 1W0KA 1ZKGA 2A61A 2IGMA 1FOXA 1BA5A 2K7LA 3PL8A 4H4KC 4II3A 1PP7U 1DDIA 3T56B 4NBQA 5EJCA 3OIOA 1FIAA 4U49A 1ELOA 5HLHA 4E7HA 4I01A 3H36A 3CP2A 2L0KA 1NK2P 1NJID 3ASRA 4O6JA 2PI0A 1FP2A 2FBHA 4Z1MA 1KCDA 3A1PA 3SEZA 1HW2A 2E1BA 3RCOA 1XGOA 3K4CA 3VODA 1VQPB 3NARA 2QVOA 4HWVA 4G8XA 3GFIA 3GQ9A 5IYPA 1PYVA 4X7EA 4ETSA 2JUGA 1V4RA 2HTJA 3HG9A 4E0FA 2JTVA 4ZYDA 1VQKI 4CH7A 2R7QA 1WJBA 2VJJA 3M4OJ 4EATA 1WORA 5K5QA 1WTHD 4ZCIA 3KYCB 3O8GA 3WTVC 4X0GA 2HQ5A 2CH0A 3ML6A 1EWYA 1SVLA 2B7CA 4L8JA 4IHYA 1RC9A 2WYRA 3DTEA 1CNEA 4XSXF 4RMNA 1RUOA 2KHMA 3PQJA 3VOEA 4DYQA 1G4DA 1USSA 5IP9J 4HEA2 3SXYA 3BOQA 2LY1A 3DEWA 3FXKA 3GX4X 2Z2SB 3HZJA 3Q6QA 2BE5F 4XLAA 3A03A 3WE3A 2D1HA 3OYIA 1WOSA 3IKVA 2BXYA 2DA5A 4HPQA 5GPCA 3HXLA 2DT6A 3K4BA 3VSKA 2RC6A 2L02A 3L09A 3SKBA 1OYYA 1FNBA 4E7IA 3EUHC 1UD2A 1UD5A 2DCEA 1G8XA 1U5TB 4UUTA 3FKSA 2KIUA 4HDVA 3FXQA 5L3CA 1FMVA 4YELA 4D1QA 1F4KA 4I0AA 3F6OA 3SJMA 1OB5A 3K6GA 5HS7A 3JRGA 2BHYA 2OTLI 3WHCA 4ZGQB 1IN6A 4PFPA 1RR8C 4IHWA 1K5CA 2H6BA 4G1BA 2O04A 1PUEE 1YRNA 1HA3A 4P1VA 2O5RA 3KP3A 4B47A 1GUUA 4D0PA 3BNWA 2WZPP 3FXJA 2DA4A 4PJJA 3HOUJ 5D5XB 2WAEA 1R58A 4CCOA 4PJ0C 1MRZA 1UMQA 5TJJA 2YU9J 1KU7A 1IB0A 5IK2A 3FPPA 2Z9OA 5D8LB 2L54A 2BBYA 5E3NA 3OE7A 3DLAA 3CPWB 2DETA 3WNDA 2FE3A 1KCCA 3QODA 4DQKA 2K85A 5DDGA 4CCJA 3BDDA 3I1FA 2F43A 4DQ2A 4RB2C 3PNTA 4AVZA 5F4JA 4RGXA 2H1KA 2EQRA 2L7KA 2DN0A 1YX2A 1IXSB 2L2OA 4WXCA 3S2DJ 1XG2A 1ZARA 2QF7A 2F1LA 5E6TA 2Z16A 4IHTA 1R9TJ 5LFAA 1EFTA 5DN6A 1F5TA 4CZCA 4UXNA 3K4JA 2EV6A 4UVAA 1KMHA 1TTTA 2QENA 2XZOA 5HXBA 1PJRA 4BUPA 4Z03A 5HVQC 3C7JA 4KA4A 4URRA 5IP7J 4OMYA 1R5GA 2YWEA 5JR3A 4FE7A 1C0WA 2WV0A 2ZITA 4WXHA 3RKYA 3G1MA 1K8FA 2ZBVA 4HNVA 3OKXA 4PFOA 1WP6A 1GV2A 2R7ZJ 4P3YA 2QN6A 4ZH4F 1S7OA 4GDFA 2GLOA 3SZEA 1S7AA 3K0LA 1E79A 2TDXA 4DOZA 2XHKA 2R7RA 1UD4A 2RNJA 4ENJA 3ZZ0A 1K28D 3KFWX 1SD5A 3DTIA 3GWZA 4M72A 1NG6A 1V5FA 2CMPA 3BZCA 4NK6A 4Z4SA 1DP3A 3OJWA 3CJQB 3AG3H 2LR8A 4YAFA 4H9GA 2XF5A 2O0YA 4PK4A 4I6ZA 3BT9A 4A12A 1IZ1A 2QBYA 2EB7A 1B6AA 1Z77A 5GP9A 1Q1HA 5FO1A 4TMZA 2V1XA 3V8JA 2DK5A 1YIJI 4NNJA 1VQ9I 1SM4A 4LLGF 1PUFB 2D5VA 3EETA 4W1UA 2IGNA 1EXMA 1W87A 3N6ZA 3CLQA 2P7CB 5HLTA 4WCGA 3CDIA 3I55I 1BI3A 4LITA 3F22A 4KFCA 4UZUA 2Z8GA 5CKTA 3HBLA 3S3MA 1P7IA 1JRGA 3ONYA 2HYJA 5ILUA 5B1AH 2E5NA 2DT7B 4L5JA 2MD0A 5E20A 2YWFA 1PE9A 3AFHA 1XB4A 3IWFA 4XRMA 4QTRA 2M87A 1XS9A 2OF7A 1IRZA 4UZEA 5C3EJ 3G05A 2W84A 4ASUA 1IAWA 3GQ8A 3H92A 2FBKA 2HYFA 3CC2B 3HGGA 1YQAA 4E70A 1VQ6B 1IO2A 1ETKA 1KYWA 4BXUA 3MMPA 3QPHA 1RR7A 3KCCA 5CLSA 2DJIA 5D5UB 4M6YA 3K70D 1FRQA 1UD6A 1UMKA 4RDJA 1I8DA 1VTNC 4LIUA 3DPUA 1XE1A 3JSPA 4OINF 3ZMUA 1P4WA 2NAZA 2BW3B 3CXCB 2BM4A 2R7OA 1IA5A 1O57A 2ZSHB 1F20A 4M3DA 4BH9A 2ZMEB 4A93J 1VQOB 3LNQA 4A3LJ 3K7AJ 1QRBA 3CZ6A 2VC1A 1IF1A 5BSXA 4G7OF 1BW5A 1KTVA 4E7LA 2QZAA 3AVXA 1FMWA 5CDFA 2X3HA 4HW0A 3QFTA 4PJNA 1TQMA 2ECCA 3ZBUA 4U87A 1ODDA 3VPRA 1Y0UA 2Q1ZB 2VT3A 4KMFA 3WXMA 2RKHA 1CQTA 3PENA 2WAQN 3LSIA 4ZCMA 4BACA 5TRDA 3PSSA 1FC3A 4YALA 1R4NB 4R1HA 3FBIB 3CW2A 4A2UA 3ASNH 3HRSA 3SZTA 1BR2A 1UG0A 2P8TA 1IV8A 1IRFA 3FMRA 3IH4A 4MEXF 4XMYA 3ZN0A 2HCJB 3U2QA 2R5ZB 1GAWA 1LDKB 5J1RA 1LLWA 4B4DA 2M7BA 1HQCA 1QRYA 2QQ9A 2PLYA 2AHOA 4LBZA 2VFPA 3PO2J 2C77A 1WSRA 1Y39A 1MD0A 2GJKA 1TZLA 3OS1A 3PNVA 2P81A 1ZM2A 3ASQA 4Z4TA 2WA0A 4MIMA 2HQAA 2WY7Q 3VYRB 2OK8A 2LMDA 3CUQC 2IVMA 3QPTA 3FXRA 4ON0A 5AN9A 1ON2A 5E1ZB 4N3GA 4OPWA 2F3LA 3A2KA 2ZTNA 4OJOA 2MFZA 3BH6B 1NBMA 1KK3A 1O8FA 3AG2H 4AD9A 1H42A 2V7WA 1H8EA 4BS9A 4LFUA 2BM7A 3RIQA 2OA4A 2XGDA 5FO5A 2G7HA 3JRIA 2EFGA 2VBSA 3C1DA 4V19K 3E7LA 5EZGA 4NCNA 5A88A 4G5GA 4ABZA 1CLWA 1P2FA 4BEHA 3CCJI 5B6IA 3VNVA 4YZQA 3KEWA 1YS7A 3GYHX 4A3EJ 1H89C 1NDHA 1PJ5A 3V7AA 1O7LA 3GZNB 4A0XA 1FTZA 3EUHA 3T5XA 2VBKA 2R7SA 2Y2ZA 3WU1B 2D74A 1OFMA 4ACAA 2H09A 1QVGB 1G7RA 1YLFA 3PFIA 3JRFA 3A8IA 3CD6I 3SUCA 1JHHA 3I58A 4L9NA 2HTSA 4RLFA 3FZVA 4RBOA 2DW4A 1X3WB 2BOLA 3T1BA 3WTZA 2BGJA 2L4MA 3L2RA 3DLLF 1IDZA 1HG8A 4OJ6A 1D0ZA 3AKZA 1Q86D 4KKSA 2GIVA 2KJCA 4MGRA 2CF4A 3H3ZA 3G4SB 1JHFA 4RB3C 5IYBJ 2VPLA 4RD3A 3KPHA 1QCXA 3E5XA 1KK0A 1R23A 1Z3YA 3ZQGA 2EZLA 2Q0OA 3GBGA 2HEOA 2DY1A 2JN9A 1MBEA 1U78A 5GAEJ 2IS1A 4UAJA 1HBXG 4Y15A 1YRNB 4Z4RA 3QU3A 1R7JA 2HKOA 5ICEA 1KK1A 3M1CA 5DYMA 1SFXA 2QX3A 2XTYA 2EIXA 4P6VF 2F1MA 3MKZA 2OTJI 2X1DA 2DPUA 2J5OA 2GK6A 3ZXSA 1X1PA 4XK4A 2GXAA 1IN4A 3BC9A 3O2PE 5FKNA 2EZKA 1IXCA 1W36D 2KDOA 3GZ5A 1LJ9A 4G7ZF 3IC7A 4CYDA 4I84A 1QVTA 1A6QA 1VQLB 4FXUA 2XUBA 2W57A 2F5CA 4BY7J 3ZMDA 2DFFA 4AC9A 2QDXA 2A5WA 1HDPA 4UB6C 1OQYA 1E3HA 2M9HA 4W8RA 2LK2A 4UUSA 2CV0A 3OAAA 2D3NA 3LA3A 2EV5A 4OOSA 5HZBA 3GQAA 4OOXA 4HX7A 1QUEA 5F0HA 4ZTFA 1YJ9B 1KQ0A 2UVEA 3EQLF 3J7ZI 3BR3A 4IRHA 1KK2A 4P22A 1UCRA 2KLOA 4CDGA 2BM6A 2PLFA 1UHMA 2DYRH 3CMYA 1JE8A 3D5LA 2WBMA 4DJAA 3KYDB 3HOYJ 2ZXHA 3SDBA 3VYTB 1HCRA 1E3XA 3HOTA 1VQ5B 4X1EA 3I4PA 1A31A 1TVCA 1V5GA 3MKYB 2QCOA 2INVA 3E20A 3IRRA 3LMWA 1WJ5A 3A8KA 1L0OC 4M6VA 2JJ2A 2H8WA 4BQOA 2W82A 4B44A 2O17A 5K7HA 1WMRA 3Q0UA 4HOBA 1A36A 5HLIA 2XAFA 2N8GA 3QWLA 1ETVA 1QGAA 3L2WA 3GF2A 4LMYA 1SFOJ 1D5VA 2VXZA 2KJBA 1FSEA 4Y13A 4HRIA 1WFXA 3ZCOA 2D9RA 3BY1A 1N77A 5FKOA 2QBYB 2Q8KA 1YITI 4C3HJ 1GR1A 3RJPA 5C44J 1HC8A 1OMIA 5AIQA 4P9SA 3JQPA 5L3BA 1YOVB 2YR2A 1FNCA 1UD3A 1SAUA 1W9XA 3W2AA 1R22A 2FMLA 2Q6OA 2M7AA 3W5HA 1XG1A 5ICGA 2QQBA 3SFIA 3PIOF 3P7NA 2NSTA 1WI9A 4IQ4A 1MH3A 4EVIA 2EINH 3QOPA 3F8MA 4X07A 1YHQB 3WNCA 3OIPA 2JVGA 3BH4A 3WTWC 1T6ZA 3S15J 1VHOA 1YJWB 5E18F 3WE2A 5D5WB 1HLVA 3S1MJ 5TY0A 3QPLA 4A3BJ 1TWFJ 1UZCA 1JJ8C 4LBVA 1YIOA 3CF2A 1VQMI 2JA8J 4V2GA 3OW7A 3BR6A 4BXXJ 5GAHJ 1A35A 2DDAA 1KQSB 1WSUA 1OR7C 3BJAA 1W2BB 2OYNA 1BN8A 2PG4A 3T51B 1SFEA 2LVSA 5GV7A 3V7CA 4FQGA 1KYZA 3EPZA 4AYBN 4CCMA 4B3FX 3E0JB 3M3YJ 4YCQA 1ZM3A 3K4LA 2WADA 4QUZA 1IXRC 3CC4I 2KDZA 1E17A 3OYEA 2R4GA 2O6WA 3T0YA 3GMEA 4DK0A 3I9V2 2P6TA 1BJKA 1DBGA 2FMYA 1V5VA 3LSJA 4BDYA 3NB2A 1E43A 1QVFB 4RCZA 5F4MA 3QFCA 1D8KA 2HFHA 2P0WA 3DU6A 2I5UA 1XPXA 2O6GE 2C2WA 4TMVA 2E1CA 3Q0WA 2HLDA 2X0KA 3CCSB 2W7ZA 2BY1A 2L3DA 2M8GX 1VQ7B 1LPQA 1QPMA 1LB2A 1QHGA 3LSGA 3RY8A 1YLOA 3HPHA 2QGUA 4P55A 3GO5A 2Y9ZA 2KPMA 2OCCH 4OWRB 5DUKA 2C5BA 2ZFWA 1O8IA 4RAFA 2V6CA 3CCEI 5LD2C 4UY8I 2DK8A 4BE2A 3HTSB 1V5EA 3JRDA 1KQ8A 1VBLA 1RIOH 1D1CA 2L7ZA 3QQAA 1NHCA 3CUQA 1WPCA 5L46A 2DQLA 5FLMJ 1VFCA 3C3WA 4OOVA 1GQ8A 4UNOA 1XMAA 1U9OA 3G2BA 1JB9A 2QEXI 4A3CJ 1DDGA 3ISXA 2FRHA 4C9YA 2ECBA 3KP7A 2R5YA 1ON1A 1IV6A 5IT3A 2IT0A 1WXRA 3JTHA 1U3EM 2BGIA 3HGYA 3VEPA 1E3ZA 2MYSA 2ZBKA 1NB0A 2L5QA 4KYWA 3O8HA 3VSTA 3OS0A 5J40A 1YTYA 3GTQJ 5LBQA 2VBZA 3G1OA 5KAIC 3MVPA 5A2QZ 1H85A 2V5IA 1Y1VJ 1OJLA 3ONUA 2C5HA 4ESFA 3T9GA 1DU6A 3I59A 3KE2A 5ED4A 2VBMA 2Q6KA 2V4JC 2D45A 2VNIA 5K7FA 2VNJA 1Z0XA 2XASA 4BPRA 2Y0SN 2NOJB 1O3SA 2XROA 4IKFA 2ZNYA 1W7PD 3CJRB 4BEHB 2EILH 2HXOA 1LUJB 3ZPNA 4RD4A 2DYSH 4QSHA 3BG6A 4DNTB 3BP8A 2EA4A 3S3NA 1EFRA 2A68F 4M6XA 1N75A 1ZHFA 1IGNA 1J09A 4QLCU 4KIGA 4OJLA 2IRFG 1XGNA 4IHVA 1MSFC 2KRCA 4NB5A 4W97A 3CUOA 1BOAA 3GW2A 3CC7I 5KSWB 4CXFA 1BX1A 3MZHA 1X1AA 3MD2A 5ERIA 1TC3C 3RQ4A 2XSJC 1VQNI 2EFNA 1Q9SA 4BJTA 2PFBA 1D0XA 3HDDA 3JAMZ 1LLZA 4N9HA 1TQPA 4WX9A 3HOSA 4AIDA 3FF5A 1RKTA 3HPGA 4A3MJ 1QA3A 1GHCA 5KK1A 4ESJA 1QGZA 2DA3A 4MEYF 2KMUA 2M2EA 2K5CA 4YAUA 2V7QA 1RETA 1O8LA 3U1DA 4BQNA 3HOZJ 4C2MJ 2NVXJ 2JSCA 4ESBA 2QSGX 2VJ4A 3GIRA 4M3EA 5F1RA 3QAHA 4M9SA 1H8AC 3TGNA 2CW0F 4EGZA 3SEQA 3WU0A 2A07F 3MKLA 1Y1WJ 1EP3B 2ZJQF 2XVCA 1F9NA 3CQZJ 3BR1A 2LZJA 4MYUA 2CSOA 3BCAA 2JIZA 4HBLA 1YYVA 1XC5A 3K70C 4DZJA 1JKRC 4TSFA 1WVRA 1MBJA 2EZIA 4PZJA 2Z1DA 2HOTA 1XMXA 1LVAA 3P9CA 3CCQI 2P5LC 2HOAA 4MQ9F 2XZLA 1WHUA 3M8JA 3JRCA 3Q39A 3TO9A 4UUSB 2BPOA 2DMNA 2DMQA 3A02A 1STZA 1RQRA 2GA2A 3HRTA 3ELKA 1DPRA 3HOWJ 3F8NA 1G3YA 2DDBA 1LQ1A 4QWQA 1MBGA 2NVUB 1QGPA 2FEZA 1RWRA 3S2HJ 3S17J 1BMFA 1FOWA 1JKQC 1QFJA 2LKSA 1X1BA 3TH0A 4KJZA 3TDZC 4G6IA 2NTBA 5CYVA 3ECHA 2V7TA 1TYVA 1G7TA 2JK3A 1H0MA 2IEKA 3CMAI 4HF1A 4J00A 4PC1A 4XLFA 1BX0A 3LNNA 2M0MA 3F72A 4M1KA 1TNTA 5H2FC 2XOKA 5HNHA 1EKEA 1HKSA 2K4BA 4DBRA 2CW7A 3ABLH 5FNZA 1MBKA 5ICFA 2FBIA 2J8IA 4KKTA 3J80Z 3B6AA 1QU3A 1ZQ3P 1O8KA 3FIWA 3BC8A 2KZVA 3I53A 4B3AA 2TCTA 4O3MA 3SHFA 1WPKA 2NV4A 2R5ZA 2VQGA 2VASA 2VODA 2DFIA 4HV5A 3WHBA 2DPDA 2EJRA 2XKPA 2JA5J 3BPXA 1OCOH 3CESA 4AIHA 1EH7A 1MSEC 3BLYA 5FKLA 4BHPA 4M74A 5LLQA 2F5VA 1BIAA 4CHUA 4J01A 3JRBA 2OBSA 1O88A 2HOEA 3HHGA 4A5MA 4DNRB 2VJ5A 1HOMA 2YX7A 1YW9A 2CFOA 5J6XA 1G3WA 4ZCLA 5FKKA 1FRNA 4CA0A 1VI0A 1IN5A 4Y7NJ 1RI7A 1K6OA 2BMWA 2ETHA 2NNNA 2OQGA 4PSWA 4OZZA 1FNDA 1O3QA 2L9RA 2BY2A 3I0TA 4AIJA 2WB1A 4KUMA 3NAUA 3F23A 1OR7A 3JREA 2QYUA 4A3JJ 4B48A 1FX7A 4JMQA 3F6VA 2KT0A 3ES9A 1ZGAA 3OL4A 1XN7A 3OOPA 4FISA 2CV2A 1I6XA 3VB2A 3MZ8A 1ETWA 1Y0NA 1U8RA 4XOPA 1VNDA 3GVLA 3B73A 4MHGA 1WKMA 1VQ8B 1LDJA 3IHUA 4YFKF 3GFMA 2A6EF 2LYCA 1P92A 3FX3A 5IPAA 5J8CA 1VLOA 1IN8A 2VFMA 1H9GA 2QLZA 3GTOJ 2XZPA 1S72B 5FROA 3A0BC 3H0GJ 1GVHA 4GRIA 4GQNA 1EV7A 2UXNA 3G71B 4LK0F 1RNLA 1D8JA 1RZ4A 1N08A 4I0BA 3R0JA 4JRAC 3R6KA 4L9JA 4E6KG 5KVRA 3C18A 1R5NA 2VOOA 1BI2A 2OZUA 2VC0A 2XGCA 5A2QK 2BV3A 4RB0A 1FX0A 2AQEA 3N05A 4RDKA 3H1CA 4YC5A 3RPUD 1HSJA 1FBSA 3PJRA 1ZN2A 1DQUA 2OPTA 5M5YJ 4A3FJ 1IC8A 4OIPF 3FPKA 3WNBA 1O8DA 1OGOX 1T98A 5LRRA 4JBAA 2NYXA 4XKVA 1P4XA 2VONA 1JT0A 1W36C 4XLPF 2EIJH 1O3TA 1AU7A 2BY3A 1MNMC 1ZRCA 3SQNA 4XONA 1S9HA 3U2RA 2JRMA 1VZ0A 1GO2A 3P9KA 5F08A 1QVUA 2QYOA 4I09A 2L7FP
chains in the Genus database with same CATH topology
3OY9A 2ZZGA 3JURA 1D1AA 2CS3A 2GJKA 2O0VA 1TZLA 3OS1A 3OYGA 3L2UA 3PNVA 1OFLA 2X6WA 2LBFB 2WA0A 2IS6A 3B90A 2RQQA 2HQAA 2WY7Q 3VYRB 3BCBA 4OJ5A 3A2KA 2ZTNA 3I3LA 2MFZA 4OJOA 4RLQA 2KVOA 2UUZA 1NBMA 3W2VA 3QYEA 1O8FA 1BOBA 3MKWB 2GOXB 4XKWA 3OYAA 2HPIA 2VQLA 3A4CA 4BS9A 4BL0B 1H8EA 2GJRA 3DQVC 3ZPPA 3C2GA 2IXSA 2ZZQA 2INUA 4E7SA 5HOOA 2IGKA 3VMWA 3OOCA 4YZQA 3IUOA 4BEHA 2XF6A 1LVKA 1KZLA 2XAUA 4P1WA 3GQBA 3KEWA 4BE1A 1ZELA 2VXDA 2Y0SA 2RNGA 3QYBA 4BXFA 3KX2A 2CK3A 1BPLA 2AQFA 3DTKA 2VBKA 4PJMA 2KQRA 1MNEA 1U0JA 4BDZA 2R7SA 1X0CA 1OFMA 3TMOA 3K4KA 1UELB 2V26A 3ZRGA 4KKUA 2NTPA 2W1OA 2UVFA 2ZSIB 2ZXIA 2M4GA 4CCKA 3OFNA 3SUCA 2NSPA 4LIVA 4RLFA 1O8HA 3LFUA 2W6JA 2BOLA 1VJSA 3U21A 3L2RA 1W0JA 3LMMA 3H35A 1EE6A 1D0ZA 3AKZA 1HG8A 1RU4A 4OJ6A 4KKSA 5HNFA 1O8MA 1X1DA 4C2UA 4OJPA 1X4OA 3V42A 2VPLA 1QCXA 1UAAA 1P9QC 2QKMB 1Z3YA 2PJRA 3L2QA 1DGWY 4BJ5C 3GBGA 3FBNB 3UNGC 2HU9A 2IS1A 2JA2A 5KNLA 3M1CA 1X19A 2QX3A 2JVHA 3NWTA 4ZTJA 2F1MA 3MKZA 4NC7A 2X1DA 2K9LA 1OB0A 2GK6A 3ZXSA 3AL0B 4XM3A 3BC9A 3GVKA 2O0WA 2LC2A 1BR1A 3UR3C 4XN3A 2WPDA 1W36D 1IRXA 2KDOA 5CQEA 2W6IA 2NT9A 3CMMA 3FKJA 4I84A 3AL0C 3VDXA 2VKHA 3A3GA 4FXUA 1Y6IA 1MMDA 2X1EA 1T0FC 4F52A 3E1SA 2A5WA 1E0EA 4MR0A 2R7WA 1NG7A 4F3QA 2JDIA 4RM2A 4JQFA 4W8RA 1JI8A 3VMVA 2CV0A 3OS2A 3OAAA 2D3NA 2DIEA 1IDJA 3DDYA 2WJVA 3WWGA 1G59A 2XDVA 4CCNA 2X6YA 4G6TB 4Y3OA 3GQAA 3PUBA 1D1BA 3IAS2 4C30A 4U7BA 2WJYA 1LFPA 4ZTFA 3S3OA 4HG2A 4HNTA 2NTQA 4XOTA 4XORA 2Z6BD 1KTWA 2UVEA 2R7VA 2HVQA 3OOUA 4P22A 2KLOA 2XNDA 3K10A 3OR1C 3HC7A 2LRDA 3D5LA 4XKBA 2W00A 2WBMA 4QPOA 1VLYA 4DJAA 3OEHA 2BSPA 3VR6A 2ZXHA 3SDBA 3VYTB 1E3XA 3HOTA 3H0DA 2X1CA 4NUBA 2V6EA 4BU2A 4BE0A 2I8DA 1V5GA 3MKYB 2INVA 3LMWA 1WJ5A 2JJ2A 3H5RA 4BQOA 2W82A 4B44A 2O17A 2K3PA 4OZYA 1WMRA 3PNYA 2W7NA 1X4PA 4D9JA 4PMHA 3SYTA 3OR2C 3L2WA 4XL9A 1COWA 3OPOA 4Z05A 2VXZA 4DBQA 2ZZEA 1OHHA 3RTRA 4HRIA 4EW9A 4W8QA 1WFXA 3ZCOA 3ZQQA 2R7TA 2KP6A 1N77A 1OOCA 2F6CA 1PLUA 2CUZA 2VBEA 1VF7A 3OEEA 2ODLA 4XLCA 1UD8A 2LG4A 1MMAA 2KRHA 2E1MB 1T95A 1QHHD 1UD3A 1SAUA 3EQOA 5KCMA 1W9XA 3W2AA 3FHNA 4HNUA 3W2WA 3A1YA 2M7AA 2NSTA 3VSVA 4IZZA 4NK8A 4IQ4A 2GJPA 2E1MC 4YEJA 1O8GA 4FETA 1I18A 3KYLA 2ZFUA 3OIPA 2JVGA 3TBIA 3H9JA 3BH4A 2CUJA 1GLNA 2K9MA 3BCDA 4YZAA 1YX5A 2VB6A 4XLEA 3A3BA 1N78A 4RM3A 4IQJA 4ZDLA 1HZEA 2OC6A 3PSFA 4BJ6C 3LSMA 3CF2A 1E1RA 3FDYA 1WJDA 3OW7A 1DBOA 3W3CA 2M5SA 2BVMA 1OR7C 3VSLA 4B3XA 2QE7A 2UV1A 4ANJA 1D0YA 4E7KA 1BN8A 2LOOA 2O1DA 3T51B 1AIRA 1MMGA 3PFYA 4B3FX 4CCMA 3EPZA 1MMNA 4F92B 3E0JB 5FL7A 2BW3A 1MABA 4XQFA 2QKLB 3DU5A 2WADA 3K4LA 4KT6A 3OYEA 2WSSA 2R4GA 1O8EA 2W4SA 2OV7A 4DK0A 4MXNA 2LREA 3I9V2 1DBGA 4DIQA 2FUG2 2F4IA 5HKKA 4BDYA 1E43A 3K4NA 4C2LA 3H9GA 2PECA 2P0WA 3DU6A 2E60A 3JU4A 3IP4B 2HLDA 4OAYA 3OYLA 1QHGA 3LSGA 2HVSA 3VYUB 1W0KA 1PXZA 2IGMA 4F93B 3HPHA 1BR4A 3PL8A 3B8YA 2KPMA 3DWLE 4H4KC 4II3A 1DGRM 4OWRB 1O8IA 3T56B 2L9NA 5LD2C 2VKDA 4BE2A 1VBLA 4U49A 1V5EA 4PJLA 4E7HA 4XD7A 1D1CA 4HIZA 3CP2A 3RSNA 1NHCA 1X1CA 1WPCA 2M4KA 3OYDA 4N4OB 2PYHA 1SKYB 2L9SA 1NRKA 4XKCA 4Z1MA 1GQ8A 3F9KA 1KCDA 3A35A 3G2BA 2LBFA 3SEZA 4G7XA 1O8JA 2E1BA 3RCOA 4Z06A 3K4CA 2IQ7A 4HWVA 4C9YA 3GQ9A 4IX7A 1PYVA 2VQHA 2HPMA 2JUGA 2R7UA 3HG9A 3OWTA 4E0FA 3NWSA 1V0FA 4NC8A 4CH7A 1E3ZA 2MYSA 4DK1A 2R7QA 2L5QA 3OYMA 1WJBA 2VJJA 4EATA 2R9VA 3VSTA 4II2A 3OS0A 1WTHD 3LSKA 1QJVA 4X0GA 2CH0A 2E5ZA 2NT6A 5FRMA 4L8JA 4YZXA 3T9GA 3DTEA 3DPTA 1Z7LA 4RMNA 2KHMA 1JTAA 2VBMA 2V4JC 3ZGKA 2D3LA 2DOAA 2JSPA 4HEA2 2LY1A 3OYBA 2NOJB 4IKFA 4BEHB 3CJRB 2Q2EB 2Z2SB 3ZPNA 1H80A 4CCLA 1Z3XA 4XLAA 3BG6A 4DNTB 3K4MA 2VIXA 3S3NA 3OYIA 1EFRA 1N75A 4HPQA 1V0EA 1J09A 4E4HA 3HXLA 2DT6A 5CQGA 4E7JA 4OJLA 3K4BA 2GK7A 2LY2A 3OYFA 3VSKA 2EWEA 1Z21A 2KRCA 4PSXA 4E7IA 3EUHC 1UD2A 1UD5A 2DCEA 1EA3A 1G8XA 4B3GA 3EUKL 3FKSA 1HA8A 1X1AA 3MD2A 3OYKA 4AU7A 3H94A 1FMVA 3RQ4A 2XSJC 4YELA 4D1QA 3DKXA 2VL8A 3OIQA 4BJTA 1BLIA 2XGJA 1D0XA 3K6GA 2M3AA 4PFPA 3HOSA 4F55A 1K5CA 1E1QA 2O04A 2X53S 3HPGA 4XNFA 2O5RA 2PJRB 4B47A 5FRNA 2WZPP 4PJJA 3HKZA 2XC7A 2IGOA 5C1EA 2KMUA 2PMZA 2K5CA 2HNHA 2WAEA 4CCOA 4XLHA 2V7QA 1O8LA 4LG3A 4BQNA 3HL2A 5IK2A 3FPPA 4TKOB 3DPLC 2VJ4A 3EQNA 2HZDA 3DLAA 2ZTGA 3OE7A 4YZ0A 2QY1A 1KCCA 3QODA 1LKXA 3B4NA 3QYFA 3BCFA 4CCJA 4QPQA 3OYJA 2F43A 3SEQA 1OLTA 3PNTA 4AVZA 2LZJA 2V31A 2L7KA 2ZZFA 3BCAA 4R79A 2L2OA 3S93A 2JIZA 3OYCA 1XG2A 3K70C 4TSFA 3H5NA 3CP8A 2NZMA 4E7ZA 2Z1DA 2Z16A 5LFAA 1WJEA 4G7WA 3DEEA 5DN6A 1AA7A 5KHDA 2HDWA 2XZLA 3M8JA 1KONA 4CZCA 3K4JA 1KMHA 2CW8A 1YE9A 1MNDA 4N4NB 2V4DA 2X51A 4NQWB 2XZOA 1PJRA 2X6XA 4BUPA 4Z03A 5HVQC 4URRA 3OYHA 1RWRA 4ZDPA 3H9QA 3J7AY 1BMFA 1OGMX 1SFKA 1X1BA 4KJZA 4G6IA 1BHEA 2NTBA 4U4BA 3VYSB 1WJAA 2MABA 2RREA 3ZSCA 4J00A 4PFOA 1WP6A 3KRGA 4XLFA 3TL4X 3LNNA 2M0MA 4W8SA 2R7XA 2LH9A 1Y56A 2XOKA 5HNHA 1ERDA 4DBRA 2CW7A 1E79A 4OAZA 4DOZA 2WAQA 4KKTA 2R7RA 1QU3A 1UD4A 1O8KA 3ONQA 3BC8A 1K28D 2KZVA 3DTIA 1NG6A 1V5FA 2CMPA 2VQGA 2VASA 4HSRA 4CSWA 4BGDA 4NK6A 1DP3A 3CJQB 3ZIAA 2XF5A 4PK4A 3CESA 1CZFA 3IAM2 3BLYA 1RMGA 4YRVA 1YX3A 2F5VA 4MLOA 2OUMA 2X85A 4J01A 3L2VA 1O88A 2DXIA 4NNJA 4DNRB 2VJ5A 2JJ1A 2CFOA 2IS4A 2IGNA 3UW0A 2VLAA 3NE5B 3LSHA 3HUGB 4CA0A 5HLTA 4F91B 3OL3A 4LITA 3GRHA 4UZUA 5JHFA 2Z8GA 5CKTA 3S3MA 3QOEA 4PSWA 4OZZA 4HSTA 1JRGA 2CV1A 3MMYB 3T53B 3D5RC 2E5NA 4KISA 3OYNA 2WB1A 2DT7B 2MD0A 3LL7A 2V9KA 2X8KA 1PE9A 3AFHA 4B43A 4FASD 4B48A 4JMQA 1WJFA 1IB4A 1H8HA 3OL4A 2CV2A 3EUAA 3G05A 4ASUA 3H5AA 3GQ8A 4XOPA 3FY3A 4TT3A 4YXWA 3WQZA 2UWMA 4ITVA 3GVLA 1K6YA 4ZJZA 2PYGA 2DJIA 4BQQA 2LYCA 1WJCA 3K70D 1UD6A 2HVRA 1I8DA 4LIUA 3DPUA 2XZPA 4Y33A 2KL4A 2XF7A 2V1NA 5FROA 4AYBA 4GQNA 4GRIA 3SZGA 2BW3B 2R7OA 1IA5A 3BG7A 2ZSHB 4CUGA 4ZYAA 3GQ7A 2VJIA 2IS2A 3GVJA 3VSUA 4ZC3A 3CZ6A 3VWBA 4E6KG 3HAGA 3S8PA 3KEYA 4E7LA 1FMWA 2V7FA 4JOMA 5CDFA 2QXZA 4PJNA 2X3HA 5C1CA 2ELJA 1IDKA 3PSIA 3C2HA 2WAFA 2BVLA 4U87A 4KITB 1FX0A 2AQEA 3N05A 4P5OA 3ZR8X 2Q1ZB 3RPUD 5AMVA 3OMYA 2A6TA 4Y4RA 3PJRA 5TGTA 1MW7A 4DGWB 1DQUA 4C2TA 4XN0A 2WY8Q 5CPRB 1OGOX 3DKYA 3LSIA 4BACA 1O8DA 2VQCA 4XKVA 3D5SC 4ZDOA 3FBIB 1W36C 4PUSA 1BR2A 1TT0A 1UG0A 2MC4A 2GOMA 4XONA 3S32A 1T5EA 1S9HA 4XMYA 1PKVA 1VZ0A 1LDKB 1R6RA 2M7BA 1HVXA 4W8TA 4XR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGM X;  3JUR A;  2PYH A;  1GQ8 A;  2O0V A;  1BHE A;  2NTB A;  1KCD A;  1O8J A;  4U4B A;  1OFL A;  2BSP A;  2X6W A;  4Z06 A;  2IQ7 A;  4HWV A;  3ZSC A;  3B90 A;  3KRG A;  3GQ9 A;  4XLF A;  4W8S A;  4OJ5 A;  4OJO A;  2INV A;  3LMW A;  2VJJ A;  1O8F A;  3VST A;  1O8K A;  1QJV A;  4XKW A;  4OZY A;  2O17 A;  1WMR A;  2NT6 A;  3ZPP A;  4NK6 A;  4YZX A;  4PMH A;  3T9G A;  2INU A;  4XL9 A;  4Z05 A;  1JTA A;  2VBM A;  1CZF A;  3VMW A;  4EW9 A;  1RMG A;  4W8Q A;  1PLU A;  4YZQ A;  1OOC A;  2VBE A;  2X85 A;  1O88 A;  2ODL A;  4XLC A;  1H80 A;  2VBK A;  3EQO A;  3UW0 A;  4XLA A;  1X0C A;  1OFM A;  2NST A;  2NTP A;  3GRH A;  3VSV A;  4OJL A;  4NK8 A;  2UVF A;  2Z8G A;  4OZZ A;  4YEJ A;  3SUC A;  1JRG A;  2EWE A;  1O8G A;  2NSP A;  1O8H A;  4YZA A;  4OJ6 A;  1HG8 A;  1EE6 A;  4XLE A;  1PE9 A;  1RU4 A;  4YEL A;  1O8M A;  4OJP A;  1IB4 A;  1QCX A;  1K5C A;  1DBO A;  2O04 A;  3GQ8 A;  4XOP A;  3FY3 A;  4XNF A;  1KTW A;  1BN8 A;  2O1D A;  2PYG A;  2QX3 A;  5C1E A;  1AIR A;  4XLH A;  1O8L A;  4XQF A;  4XM3 A;  2O0W A;  4W8T A;  1IA5 A;  4XN3 A;  1O8E A;  3EQN A;  4MXN A;  1KCC A;  3GQ7 A;  1DBG A;  4YZ0 A;  2QY1 A;  2VJI A;  3B4N A;  3VSU A;  2NT9 A;  4I84 A;  4AVZ A;  2X3H A;  2QXZ A;  5C1C A;  4C2L A;  1IDK A;  2PEC A;  1XG2 A;  5AMV A;  4MR0 A;  2NZM A;  4XN0 A;  2UVE A;  1OGO X;  1O8D A;  4W8R A;  3VMV A;  1IDJ A;  4XKV A;  1PXZ A;  3WWG A;  3B8Y A;  2X6Y A;  3GQA A;  4XON A;  1O8I A;  4XMY A;  1VBL A;  2NTQ A;  2X6X A;  4XOT A;  4U49 A;  4Z03 A;  4XOR A;  4URR A;  1RWR A;  4XR6 A;  1NHC A; 
#chains in the Genus database with same CATH topology
 3OY9 A;  1ACI A;  4G1V A;  2XEX A;  2ZZG A;  1BC7 C;  2GAU A;  3CUQ B;  2O0V A;  4M2L A;  4X0C A;  1JUP A;  3Q9S A;  2Z3Y A;  1G2H A;  4EJV A;  3IV5 A;  5FO0 A;  3AAF A;  3A8J A;  3LAP A;  3VNU A;  4GYG A;  2DT5 A;  4LG0 A;  2IS6 A;  3B90 A;  2VBT A;  3L9F A;  2DFE A;  4A3K J;  2PEX A;  3MZY A;  1P6R A;  1EH8 A;  1V3F A;  1S8N A;  1BQE A;  2F5D A;  1JT6 A;  1SD4 A;  3QFS A;  4ZGN B;  2R5Y B;  2YPR A;  2H8R A;  3I3L A;  4HZF A;  5EYR A;  3WTT C;  1YFH A;  1BM9 A;  2UUZ A;  3TOA A;  1VQ4 B;  3QYE A;  1QA6 A;  4M9X A;  4P9F A;  3JAM K;  3ZQI A;  4XKW A;  3QU6 A;  2HPI A;  3OYA A;  2GJR A;  1AOY A;  4YFN F;  1I50 J;  3G1L A;  3DQV C;  3C2G A;  3DEU A;  4IJA A;  5J4V A;  2IXS A;  1U9N A;  1QGY A;  4OIQ F;  2EFP A;  3H09 A;  2VFO A;  3ZQH A;  1F60 A;  3I59 B;  1QFY A;  1Y0R A;  3CPX A;  5LMZ A;  2I10 A;  1TT5 B;  2Q2E A;  2XAU A;  4XLN F;  1ZEL A;  2JT1 A;  4PGG A;  2BM0 A;  3E97 A;  3RQI A;  1W0T A;  1BPL A;  2X6O A;  3JTG A;  2NVT J;  2KQR A;  1U0J A;  1XFO A;  4XIC A;  3CDH A;  5D6E A;  4YIF A;  2B7E A;  1KQ5 A;  4P2N A;  3K4K A;  1GT0 C;  2VBY A;  2W25 A;  1W0U A;  2BZT A;  2ZSI B;  2M4G A;  3E3V A;  4Z4Z A;  3GTJ J;  5D6F A;  4LIV A;  3IRQ A;  3LSP A;  1JJ2 B;  2MLG A;  1VJS A;  4BBR J;  1ZK8 A;  1IW7 F;  2X48 A;  1KZH A;  1EE6 A;  3CCU I;  4Q5S F;  3U6K A;  1EFU A;  4OJP A;  3PIP F;  1X4O A;  4DW6 A;  5E8I A;  2YU3 A;  1MDM A;  4RM0 A;  2MLK A;  2HGC A;  2QKM B;  2BXZ A;  3P27 A;  1DGW Y;  4BJ5 C;  3F8C A;  1F36 A;  3ZQC A;  1B9N A;  3HKZ N;  2VOP A;  2PMZ N;  2XPV A;  1QX4 A;  5KNL A;  4YDT A;  3Q6R A;  2B9S A;  3NWT A;  3OZV A;  2IPQ X;  1UHS A;  2NPF A;  1D5Y A;  1J0R A;  3CDL A;  1FZP B;  3TOB A;  5CQE A;  3GCM A;  2FD5 A;  1R5B A;  3CMM A;  5BPI A;  1YW7 A;  5E3M A;  5LHH A;  3AL0 C;  3K2A A;  3BZ6 A;  2AHQ A;  1Q1V A;  4L5I A;  1SAX A;  3J80 K;  2VKH A;  3A3G A;  1AHD P;  3G3Z A;  3QP6 A;  4D7M A;  1JKP C;  4F52 A;  3I4M J;  1BJA A;  1I6H J;  2V1U A;  1K73 D;  1NG7 A;  4M9Z A;  1KU2 A;  3KZI C;  4MNU A;  4RM2 A;  4BKX A;  1SVM A;  1N0V C;  3CLO A;  3OS2 A;  4X05 A;  2KIM A;  4MQV A;  4A5N A;  3WWG A;  1O7F A;  2XDV A;  1GAQ A;  1MH4 A;  1M1K D;  2IJL A;  3CJT B;  4R8H A;  3IAS 2;  4U7B A;  2WJY A;  2BX6 A;  2WV1 A;  3S1Q J;  1P4M A;  2NTQ A;  1FY7 A;  2E7W A;  4XOT A;  1TQI A;  1CNF A;  1TWA J;  2Y69 H;  4IRG A;  2XND A;  3L00 A;  2DTZ A;  3K10 A;  3IKT A;  2QTZ A;  3C2B A;  3TW6 A;  4XKB A;  1IDY A;  2BSP A;  2B5O A;  5GAD J;  2FNA A;  4XSZ F;  2G9W A;  2H6C A;  4C43 A;  2EA2 A;  3BTI A;  2V6E A;  1DPU A;  3CCM I;  1YJN I;  3V8L A;  4BE0 A;  1BW6 A;  2NVQ J;  3BTJ A;  2XAG A;  4A3D J;  4EJT A;  2ZL5 A;  3BPV A;  2B7B A;  1QBJ A;  3H5R A;  2AXT C;  1ZRF A;  4PGO A;  4L0Z B;  3ZQF A;  4OZY A;  5DUI A;  4HE5 A;  3PNY A;  2D1V A;  3WOD F;  4CO8 A;  2VFN A;  5DD4 A;  3SYT A;  2JMW A;  3OPO A;  3QSY A;  3CME I;  1A8P A;  5EG0 A;  3RTR A;  1U5T C;  2R0Q C;  3ZQQ A;  2KP6 A;  1FNN A;  3KLO A;  1OOC A;  2CUZ A;  4XRS A;  1VF7 A;  3OEE A;  4U88 A;  1EA0 A;  1MBH A;  1R5H A;  4XLC A;  1UD8 A;  4LBY A;  2LG4 A;  4X06 A;  3S2W A;  5HOD A;  4PC7 A;  3ZP5 A;  1CGP A;  3SY2 A;  3CCL B;  2QTL A;  3BY2 A;  4FX0 A;  4HNU A;  1FDR A;  2M0C A;  3ZN1 A;  1E63 A;  4I76 A;  4FK8 A;  2LF8 A;  4G12 A;  5B5E C;  3VSV A;  4P26 A;  3FMS A;  1FPQ A;  4YG2 F;  4IZZ A;  4KNY A;  2P5K A;  1R5O A;  3WYA A;  1HXD A;  5HDK A;  4I99 C;  3LO8 A;  4HX4 A;  2GWR A;  2ESN A;  5IT9 Z;  2CRG A;  2HQR A;  3H9J A;  3TED A;  2CUJ A;  2KIQ A;  3BCD A;  1YX5 A;  2VB6 A;  2ZC2 A;  3KP5 A;  3DV8 A;  3WGG A;  3OP1 A;  5BSY A;  3A3B A;  4V02 C;  4RM3 A;  1MGT A;  2OD5 A;  2F48 A;  2XTX A;  3GVA A;  3KZY A;  2MA3 A;  2W85 A;  2OC6 A;  2ELH A;  4BJ6 C;  1BN5 A;  4C0S A;  1JA1 A;  5FFZ A;  2IAI A;  1TLL A;  4WZK A;  1D1N A;  3DKW A;  2YSR A;  2GA1 A;  5JI6 A;  1EP2 B;  5DSZ A;  2E1N A;  3VSL A;  1FOK A;  4B3X A;  4RD0 A;  2UV1 A;  4ANJ A;  3N4M A;  1SD6 A;  2O1D A;  4DYC A;  4B4C A;  1AIR A;  5DS9 A;  1MMN A;  4C3I J;  5FL7 A;  3LAJ A;  1MAB A;  4XQF A;  4Y9U A;  3TO7 A;  2A69 F;  3DU5 A;  1ZRD A;  1ZH5 A;  2GXG A;  2W4S A;  1XSX A;  1ZAO A;  1AWC A;  2LRE A;  4MXN A;  4RAZ A;  1BJZ A;  4DIQ A;  2FUG 2;  1E64 A;  3LQ6 A;  5GV8 A;  1IJE A;  1I7P A;  1IRG A;  4ROX A;  3QRF F;  4L9T A;  3H9G A;  4RPD A;  4Q7J B;  4MTD A;  2FOK A;  1FEX A;  1OGI A;  3JU4 A;  3IP4 B;  2DOF A;  1Q81 D;  2PJP A;  5H20 A;  4WZL A;  3NRV A;  2ZKZ A;  4PAA A;  1KU9 A;  1WI3 A;  2LD5 A;  2HVS A;  4HQM A;  4NDL A;  3VYU B;  2RDP A;  3BH7 B;  4F93 B;  4OPV A;  3TO6 A;  1ZGJ A;  4CIC A;  2WR8 A;  1LEB A;  3AGP A;  2BM5 A;  4N0B A;  5EZH A;  1IG7 A;  2CQK A;  2ZXW H;  3CCR I;  2XNC A;  4G6D A;  4PJL A;  4GXO A;  1IHM A;  4XD7 A;  4HIZ A;  3RSN A;  1ZTR A;  3IL2 A;  1FYM A;  2VZL A;  4YHB A;  2M4K A;  2P7V B;  3OYD A;  2O61 A;  1NRK A;  1QA1 A;  3B78 A;  1KGS A;  4OOI A;  1I3A A;  4OIO F;  2LBF A;  3A35 A;  4G7X A;  2BVN A;  2CRV A;  1HW5 A;  2GPJ A;  4YIR X;  1I39 A;  2GRE A;  1N07 A;  3DBR B;  4LG0 B;  5H59 A;  2HPM A;  1RUN A;  4MFE A;  2COB A;  4LC0 A;  2QQ8 A;  3G73 A;  1L3L A;  1VHE A;  1KQ9 A;  3NWS A;  5J47 A;  4NC8 A;  4DK1 A;  2DOD A;  5TR9 A;  3ZQL A;  5E3L A;  1APL C;  3HJE A;  2E1O A;  2Y48 A;  3SQV A;  3LSK A;  1QJV A;  1TW3 A;  2E5Z A;  5J8F A;  5HLG A;  2NT6 A;  3CRZ A;  2O9L A;  4YZX A;  2MGQ A;  3ROU A;  2E35 A;  1JNY A;  1Z7L A;  3EDP A;  3G6E I;  3V7S A;  2VE9 A;  1KRH A;  2VYQ A;  1JTA A;  1KC8 D;  2D3L A;  1EP1 B;  2OAZ A;  1DAB A;  1FYK A;  3RKQ A;  4IHX A;  2Q2E B;  2QSH X;  4EEF G;  4P12 A;  3I54 A;  2OU2 A;  1V54 H;  1Z3X A;  3WG9 A;  4CCL A;  1I3Q J;  1S7E A;  1ZLJ A;  4HAM A;  1R49 A;  4QVA A;  3B6C A;  5DS0 A;  3ZPL A;  3ASO H;  5CVI A;  2H94 A;  5E1W A;  1V0E A;  5CQG A;  4E7J A;  1ZR2 A;  5BQT A;  2GK7 A;  4AF7 A;  5FKM A;  1SEU A;  3F21 A;  5L3D A;  2EWE A;  1Z21 A;  2NRA C;  5KW9 A;  2MBF A;  4KT5 C;  3HSR A;  4A6D A;  2LFB A;  4XBF A;  4RGS A;  3KEQ A;  4FX4 A;  1EA3 A;  1VQ9 B;  3ZMZ A;  2EFO A;  4MTE A;  4AU7 A;  5FJ8 J;  4HQE A;  4NHJ A;  2C78 A;  5THX A;  4Z4Y A;  3I55 B;  2CQQ A;  2ZME C;  3JRA A;  2M3A A;  5IYW A;  1ZRE A;  2G0Y A;  1E1Q A;  3RDI A;  4G7H F;  4D5F A;  1MDM B;  3M7G A;  2X53 S;  1TWC J;  1W5S A;  1T56 A;  5JHU A;  4XNF A;  3DBH B;  3E6M A;  4WWC A;  3R6S A;  5FRN A;  3CB4 A;  2XC7 A;  5JVT A;  4O5V A;  3SFZ A;  4XLH A;  1M1E B;  3J7Y J;  4LG3 A;  1B2R A;  4RAY A;  3I56 I;  3HL2 A;  4X7D A;  4A3G J;  1PJ7 A;  2R93 J;  3DPL C;  5IP6 A;  2Z99 A;  3EQN A;  2ZTG A;  3M1E A;  1LKX A;  1S29 A;  3QYF A;  4Q48 A;  3ZMT A;  5L3G A;  4QPQ A;  1MZB A;  3OYJ A;  2GM4 A;  3BR0 A;  1OLT A;  2M34 A;  2ZZF A;  3LST A;  3S93 A;  3W5U A;  3OYC A;  2XGE A;  2E19 A;  3CP8 A;  2NZM A;  2VKE A;  4IOC F;  2OBR A;  2IBD A;  2NS8 A;  1WJE A;  5IY5 H;  3GZ6 A;  3V76 A;  3R60 A;  3TDU C;  2HDW A;  4P96 A;  5KHD A;  3GSI A;  1KON A;  1A04 A;  2DBB A;  4X6A J;  2CW8 A;  1VQP I;  2P5V A;  4N4N B;  2V4D A;  1T6S A;  3UKG A;  3JQR A;  1I27 A;  1JA0 A;  3W6V A;  2Y0M A;  2DOG A;  1TSP A;  1YG2 A;  2HWV A;  3BTC A;  3H9Q A;  3J7A Y;  1E3P A;  1OGM X;  3DU1 X;  1SFK A;  2JN6 A;  2RGV A;  3K1M A;  2E7X A;  4YFX F;  3WTS C;  1BHE A;  2BSA A;  4U4B A;  3VYS B;  2STW A;  1LE8 A;  3JCU C;  1NTC A;  2RRE A;  1G3T A;  5IT9 K;  4M3F A;  3ZSC A;  4EM1 A;  3A0H C;  4AWX B;  2C6Y A;  3KRG A;  1RQP A;  2EPF A;  4Y52 J;  1QQ1 A;  4W8S A;  2R7X A;  4R71 A;  2LH9 A;  4LB6 B;  3ULQ B;  3CCV B;  2CUE A;  1ERD A;  3AGQ A;  2EBI A;  1L1I A;  1UG2 A;  4EMS A;  5LGN A;  1TLH B;  2PBI A;  3WTX C;  2HQN A;  4P9U A;  2FNP A;  3BRO A;  4BHB A;  1O4X A;  5JLV C;  2DO7 A;  1KA8 A;  1UHW A;  2ME0 A;  3IAM 2;  5EG0 B;  2ID6 A;  2QMU A;  1R1U A;  3P5J A;  4CZZ A;  1REP C;  1J9Z A;  1YX3 A;  3L2V A;  1S5L C;  4LD5 A;  2XIG A;  3AVY A;  5HZA A;  3DBL B;  2JJ1 A;  2IS4 A;  4L0Y B;  5LRS A;  3UW0 A;  3ZQ7 A;  2VLA A;  3HRM A;  2F4O B;  2NS7 A;  3GTM J;  4Y17 A;  5JLX A;  3FKI J;  3PO3 J;  1W7P A;  1B23 P;  5JHF A;  4PC2 A;  3Q3A A;  3CCJ B;  4TV7 A;  3QOE A;  1MJB A;  4HST A;  1LFB A;  2CG4 A;  2CV1 A;  2DA7 A;  5C4J J;  5J3O A;  3T53 B;  3HRU A;  4FCY A;  3OYN A;  2GIZ A;  4WQM A;  1JGS A;  2O8X A;  3Q0V A;  3LL7 A;  2X8K A;  2V9K A;  4FAS D;  4B43 A;  2CW5 A;  3ERE D;  1RPW A;  4I2O A;  2C4U A;  4OIR F;  3W2F A;  4RGU A;  1ZR4 A;  1E3O C;  1H8H A;  3QE2 A;  5LGT A;  1FBQ A;  1HF2 A;  1W34 A;  2HKX A;  4B09 A;  4X7C A;  5HDG A;  2HDN B;  3ISP A;  3SLN A;  2E2I J;  3H5A A;  5BNG A;  3RI4 A;  1R5I D;  3SZP A;  4YXW A;  5LGU A;  4ITV A;  1FLI A;  4QVJ A;  1K6Y A;  2LLK A;  1ETX A;  5LEK A;  2DTR A;  4I02 A;  1WJC A;  4AIK A;  5F6F A;  1I1G A;  2XRN A;  4FTH A;  4Y33 A;  2KL4 A;  5CVV A;  2V1N A;  3T8R A;  4AYB A;  1H9T A;  2VN2 A;  1ZM4 A;  3TQN A;  3BG7 A;  2IA1 A;  4CUG A;  5CVR A;  4CGZ A;  3GQ7 A;  2K3F A;  1T08 B;  1XD7 A;  2VJI A;  1BC8 C;  2IS2 A;  3GVJ A;  3VSU A;  4ZC3 A;  3VWB A;  2CBX A;  3HAG A;  1B4A A;  2VKV A;  3KEY A;  2ZJR F;  4OPS A;  2QXZ A;  4IHS A;  2OTJ B;  5AIP A;  2FX3 A;  1IDK A;  5D4S A;  2IP2 A;  2WAF A;  2BVL A;  3C2H A;  1AKH A;  4P5O A;  4XRS G;  2OK7 A;  1D8T A;  3LQE A;  3OMY A;  4QFM A;  2A6T A;  2QM3 A;  3LVB A;  3B02 A;  1MW7 A;  1XCV A;  1ETO A;  2K27 A;  4JK1 X;  3DXJ F;  2DU9 A;  3W6J B;  1GDT A;  1WH7 A;  1Z1D A;  2BV6 A;  1QZE A;  4LLL A;  2YWG A;  1FTT A;  4ZDO A;  4IO9 F;  4M4S A;  1TT0 A;  3S32 A;  1KU3 A;  1PKV A;  3PA1 A;  1POG A;  3HYI A;  2PIA A;  3R4K A;  2YUS A;  4IRI A;  3HSE A;  5H5J A;  3I5U A;  1D1A A;  2CS3 A;  5E79 C;  1XSD A;  1W5C C;  1OFL A;  2VFQ A;  2CUF A;  5K5R A;  2LBF B;  1PDN C;  3CTA A;  1X3Z B;  3SYJ A;  2RQQ A;  1KD1 D;  3HEF A;  3KP4 A;  1BI1 A;  3TKY A;  1JTX A;  2PN6 A;  2HOS A;  2DA1 A;  5IYD J;  1QZY A;  4RD1 A;  4WK8 F;  1QA2 A;  2ME6 A;  2R7D A;  4EM0 B;  3MKW B;  2GOX B;  3NQO A;  2VQL A;  3A4C A;  2CU7 A;  2MH2 A;  4BL0 B;  4P25 A;  5DNS A;  2B0R A;  2QQA A;  3ESW B;  1GV5 A;  2IGK A;  5F0F A;  1MJA A;  2RN7 A;  4IXA A;  2JZY A;  2PX9 A;  3EYY A;  3IUO A;  3K1P A;  2XF6 A;  3QP5 A;  1KZL A;  4M53 A;  4P1W A;  4K1X A;  3W2E A;  2K4J A;  2VUM J;  3BJ6 A;  2Y0S A;  2RNG A;  3QYB A;  4BXF A;  3KX2 A;  2XB5 A;  1OYW A;  4HX8 A;  3J81 k;  2AQF A;  3DTK A;  3EYI A;  1B59 A;  4PJM A;  4JX6 A;  2XAQ A;  2DYI A;  2OQR A;  3LA2 A;  3MCZ A;  3O6B B;  1UEL B;  3TMO A;  3X2Q H;  3ZRG A;  4EJO A;  2NTP A;  5AON A;  2W1O A;  2UVF A;  1K61 A;  4YFO A;  1R4M B;  3U9G A;  3OFN A;  1OFE A;  5IOY A;  1JUM A;  4G9Y A;  3GFL A;  2X9D A;  3J7A O;  1O8H A;  3LFU A;  1UJ8 A;  2W6J A;  2BGC A;  3RYR A;  3CC2 I;  1EFC A;  1VQ6 I;  4LGW A;  3U21 A;  1W0J A;  3LMM A;  1B1B A;  3H35 A;  5J3L A;  2EZH A;  3J81 Z;  3D1N I;  2O7O A;  2LNB A;  4ZYH A;  3SEJ A;  2K9N A;  2FQ4 A;  2PE3 A;  2ELK A;  2X0L A;  5B1B H;  3WG7 H;  1JGG A;  1X1D A;  4M3B A;  1UAA A;  3RZD J;  1P9Q C;  4CYC A;  2PJR A;  2OCE A;  2HZT A;  5B3S H;  1B9M A;  4S05 A;  1VQO I;  4HV6 A;  3FBN B;  1JKO C;  2HU9 A;  1BL0 A;  1X3U A;  1XB2 A;  1XDU A;  3LQQ A;  4DZP A;  3GTL J;  2DAO A;  2PMH A;  2JVH A;  3FXO A;  2XPU A;  4ZTJ A;  4RDL A;  2AO9 A;  4NC7 A;  2LP0 A;  2K9L A;  1T38 A;  1QUF A;  2CQN A;  3AL0 B;  1DAR A;  3D0S A;  3ZMS A;  4XM3 A;  1VQM B;  1ZLK A;  5IYN A;  2LC2 A;  1BR1 A;  3UR3 C;  4XN3 A;  5TV2 A;  1IRX A;  3GTG J;  3E6C C;  2XGX A;  4RA2 A;  1Y8Q B;  2Y75 A;  2NT9 A;  5ILS A;  1I1S A;  2EIM H;  4M3G A;  4WXD A;  3VDX A;  3SDG A;  4IW3 B;  1MMD A;  1TW2 A;  3S16 J;  1T0F C;  1K83 J;  5FA6 A;  2XT2 A;  3CC4 B;  3K9T A;  2WZN A;  1JUS A;  2DA6 A;  3P4G A;  2R7W A;  2LY9 A;  4JQF A;  3ABT A;  5FLV A;  5LHI A;  4LJZ F;  4LB5 A;  3FWE A;  3DDY A;  5J4Y A;  3OSG A;  3CCY A;  3RPU A;  4NQW A;  4HE6 A;  2IOU G;  4RCY A;  4C30 A;  1BI0 A;  4OMZ A;  3CCL I;  2CC2 A;  3S3O A;  2DA2 A;  4AC0 A;  2K86 A;  4BHC A;  4XOR A;  2Z6B D;  1JJ6 C;  1KTW A;  2R7V A;  2DFH A;  1CQX A;  1TYW A;  1Q82 D;  3OOU A;  4ENM A;  3ABK H;  2VNH A;  1I5Z A;  3BZK A;  3GUD A;  5D4R A;  5DCM A;  1ORK A;  2VT2 A;  3OR1 C;  4BY1 J;  2EFQ A;  3HC7 A;  1MJ9 A;  4IF4 A;  1VLY A;  2W00 A;  4QPO A;  3OEH A;  4RJL A;  1TYX A;  1E2X A;  4Q47 A;  2EFW A;  1LE8 B;  3BY6 A;  3TP0 A;  3CCE B;  1GXQ A;  2VBU A;  1XSV A;  2E34 A;  2X1C A;  3KET A;  1G6N A;  1T33 A;  2I8D A;  5CVU A;  2XKO A;  2L4A A;  2F4N A;  1G3S A;  3WY9 A;  2ZCW A;  4KDP A;  2K3P A;  5LEJ A;  2QEX B;  5B66 C;  5IYQ A;  4GO1 A;  2FQ3 A;  2ZL6 A;  4WF2 A;  1SKQ A;  5EMN A;  1X58 A;  3AVU A;  2J5P A;  2HR3 A;  3OR2 C;  3ML3 A;  1R1V A;  4MO7 A;  2ZZE A;  4DBQ A;  1T8I A;  4W8Q A;  2R7T A;  1PLU A;  4Z4W A;  3ERM A;  2KZG A;  3ZBT A;  4PDK A;  1SFU A;  3BQJ A;  3DP7 A;  1MMA A;  1XMK A;  3HUG A;  2XAH A;  2Y9Y A;  3FK6 A;  3Q38 A;  2H1L A;  2L9V A;  3FHN A;  2F5F A;  3W2W A;  3GTK J;  3A1Y A;  4L5E A;  1QFZ A;  2IA0 A;  4NC6 A;  5FD6 A;  4U0V A;  3G4S I;  4NK8 A;  1ZG3 A;  2GJP A;  2E1M C;  1A6I A;  1SMY F;  1W7P B;  4Q4Z F;  3P26 A;  4X7F A;  1O8G A;  2F2E A;  5HS8 A;  3KYL A;  2R92 J;  2XB0 X;  2WTE A;  2K9M A;  1OCZ H;  2QWW A;  1S3J A;  3MCA A;  4YZA A;  2BYV E;  5DTD A;  4EJW A;  5A89 A;  2LSO A;  1N78 A;  4RD2 A;  3LA7 A;  4IQJ A;  1R00 A;  3S1R J;  1BBY A;  3RKW A;  5M5X J;  3MQ0 A;  4KN4 X;  3R6J A;  4F7Z A;  4WZE A;  1HZE A;  2UXX A;  1Y8R B;  2E36 A;  3PA2 A;  3PSF A;  4F7D A;  1U2W A;  4IOA F;  1ULY A;  1E1R A;  3FDY A;  4PCQ A;  1WJD A;  1ZGW A;  1WOP A;  3ASP A;  3W3C A;  4UUV A;  4PC6 A;  4Z4U A;  3CC7 B;  1N8R D;  3S14 J;  4TN1 A;  1HKT A;  1WDT A;  2NVY J;  4E7K A;  1D0Y A;  4PGH A;  2LOO A;  1VQN B;  2FVG A;  1MMG A;  2DI3 A;  1VQL I;  4GCV A;  4F92 B;  2K40 A;  2A6H F;  4MYT A;  4OPO A;  1W4M A;  2VNK A;  2V7U A;  2XC1 A;  2QKL B;  3BG3 A;  2Z33 A;  1GVJ A;  4KT6 A;  3V4G A;  3R0A A;  1O8E A;  4CQJ A;  2OV7 A;  3HOV J;  1Q7Y D;  1SC7 A;  2V9V A;  4PC3 A;  3OV8 A;  5HKK A;  1P4A A;  1S6L A;  3I71 A;  5E1X A;  2PYH A;  1EH6 A;  3D26 A;  3K4N A;  3AK5 A;  4ZYG A;  4C2L A;  2LTP A;  3ZZT A;  5FD5 A;  3GXO A;  5BPD A;  4DYR A;  2RV8 A;  1K9M D;  1J2X A;  4A0Y A;  3BR5 A;  2FX0 A;  1YJ9 I;  3BR2 A;  1AKH B;  1AIP A;  2YX4 A;  5JFR A;  4H0E A;  4S0H B;  3OYL A;  4ENK A;  4TMX A;  4QHY A;  2Q6L A;  1K78 A;  2EWN A;  5H6Q A;  1PXZ A;  3CO7 C;  1OPC A;  1BR4 A;  3B8Y A;  1QZZ A;  3DWL E;  1DGR M;  3A01 B;  2STT A;  3B8H A;  2L9N A;  3F8B A;  2X4H A;  3V8K A;  2ZXJ A;  2VKD A;  2G0E A;  3ABU A;  4GYI A;  1VQ5 I;  1Z6T A;  3ZUG A;  1X1C A;  1BIB A;  5F1J A;  1DUX C;  4AF6 A;  4N4O B;  3CCQ B;  1SKY B;  2L9S A;  1YI2 B;  4XKC A;  2ESH A;  1HKQ A;  1OCC H;  3F9K A;  4UHT A;  1O8J A;  1VF9 A;  5F64 A;  1KJZ A;  4Z4V A;  2FXA A;  4Z06 A;  2L01 A;  2JQ7 A;  2IQ7 A;  3BQY A;  1B72 A;  1EJ9 A;  4IX7 A;  2QA4 B;  2E71 A;  2VQH A;  3W2I A;  4U0W A;  1JTY A;  3P9I A;  3OSF A;  1QNT A;  3DF8 A;  2UZK A;  1AMO A;  1IN7 A;  3J81 K;  2R7U A;  4Z2Y A;  3OWT A;  1R1T A;  3VO2 A;  1V0F A;  2XTW A;  3OYM A;  1W1W E;  2R9V A;  2YWH A;  4II2 A;  3CMA B;  3WGH A;  4A0Z A;  2DCU A;  4Y7C A;  5FRM A;  1LEA A;  2I1L A;  2CQ7 A;  2QZ8 A;  3KP6 A;  5ICC A;  1TTY A;  2GQQ A;  2ACJ A;  3DPT A;  4K2E A;  2P3M A;  3PUN A;  5TIS C;  3ZGK A;  2DOA A;  2JSP A;  2LDU A;  2ISY A;  3OYB A;  1YHQ I;  4G94 A;  3PVD A;  1CF7 A;  2CJJ A;  2DMP A;  1FT9 A;  5J1U A;  2DMU A;  1TBX A;  1WSV A;  1H80 A;  3AST A;  1YJW I;  1N0U A;  2KIS A;  3HB9 A;  2PMU A;  3K4M A;  2DLL A;  2VIX A;  4G6Q A;  4LOC A;  4RB1 A;  3Q5F A;  1IJF A;  1T6Y A;  1XGM A;  2PMD A;  4HA8 A;  4E4H A;  1B8I A;  3HOX J;  1PP8 F;  2LY2 A;  3MAJ A;  3OYF A;  2F4M B;  4IEJ A;  5EEG A;  4TMW A;  4KMU X;  4PSX A;  1QH0 A;  2JPC A;  3HM5 A;  3WGI A;  1LFU P;  2TRT A;  1M90 D;  2BHZ A;  4B3G A;  4HF0 A;  2J7K A;  3EUK L;  1HA8 A;  3OYK A;  3H94 A;  4LLN A;  2BM1 A;  3L1P A;  3M8E A;  3CF5 F;  2XNJ A;  4RGR A;  3MFK A;  3DKX A;  3WU2 C;  1ZG1 A;  1VQK B;  2M5W A;  2VL8 A;  3OIQ A;  1BLI A;  5FLX Z;  2XGJ A;  1OFD A;  4RS8 A;  2HMA A;  4YEI A;  3WBK A;  4F55 A;  3PUF A;  1J59 A;  5HS9 A;  2FOW A;  4CYC B;  2KKO A;  2PJR B;  3FK7 A;  2J8K A;  2IA2 A;  4JP0 A;  3W2G A;  2W24 A;  3HKZ A;  1F1Z A;  1SVO A;  2IGO A;  1OB2 A;  2B63 J;  2PMZ A;  2R3S A;  2HNH A;  3N90 A;  5C1E A;  2E1R A;  1YO5 C;  4ZYE A;  5BS6 A;  4TKO B;  5FB2 A;  3LQR A;  1T0F A;  3CCS I;  2HZD A;  3CCV I;  3KL9 A;  4YZ0 A;  2QY1 A;  2M30 A;  3BQZ A;  1VQ7 I;  1J9I A;  1MIJ A;  2VBV A;  3B4N A;  4DQL A;  1RES A;  3BCF A;  1QQI A;  2KRF A;  2K02 A;  1YS6 A;  2V31 A;  4WZT A;  4R79 A;  3GEZ A;  1D3Y A;  2JJ7 A;  1WU8 A;  4QIW N;  3ASS A;  3H5N A;  4E7Z A;  1JXS A;  3VMF A;  3LJY A;  1OCR H;  1T39 A;  4G7W A;  3DEE A;  1FBU A;  1AA7 A;  2HXI A;  4EGY A;  2PQ8 A;  4QV2 A;  1T6X A;  1OCT C;  3M07 A;  2KFD A;  1YE9 A;  1MND A;  1SMT A;  2OTL B;  3H3V K;  3L2C A;  1D2E A;  3SJZ A;  2X51 A;  4NQW B;  4IPA A;  2YS9 A;  1FP1 D;  1X2M A;  3B82 A;  5L3E A;  1O3R A;  2X6X A;  3PUM A;  1TWH J;  3OYH A;  4ZDP A;  2GZW A;  3M8F A;  5EF6 A;  2V9P A;  5JMC B;  3FXU A;  2FU4 A;  2FJ1 A;  3IH2 A;  2OJE D;  3LOC A;  3ZMV A;  2XV4 S;  2VBX A;  1FIP A;  1HST A;  5DCM B;  3SLD A;  1WJA A;  2MAB A;  1K8A D;  2G7U A;  3TL4 X;  3O3K A;  1ETY A;  3U1K A;  1HDD C;  1Y56 A;  2V79 A;  1QG0 A;  2V7V A;  4D5C A;  2CGP A;  2WC2 A;  2BEO A;  4KIF A;  5GPA A;  4OAZ A;  1TNS A;  2WAQ A;  1FJL A;  2HI3 A;  3ONQ A;  3KP2 A;  5J1Y A;  1FOY A;  1G7C A;  5J35 A;  1HW1 A;  5F0C A;  2W48 A;  1Z05 A;  3E5Q A;  4BGD A;  4HSR A;  4CSW A;  2A5Y B;  5EGO A;  3HSF A;  3ZIA A;  1XDS A;  4HLX A;  2E2H J;  1IUY A;  2DER A;  1CZF A;  4N3N A;  1OGJ A;  3FM5 A;  1RMG A;  4YRV A;  3HIF A;  3KZZ A;  3S1N J;  3BTL A;  4MLO A;  2OUM A;  2X85 A;  4J0Q A;  1P7J A;  1GJR A;  2DXI A;  4M71 A;  4RPB A;  1NK3 P;  3NE5 B;  3LSH A;  1NHA A;  3HUG B;  3FIS A;  3MN2 A;  5LHG A;  4UVC A;  1WWX A;  4F91 B;  3OL3 A;  4LBW A;  1J75 A;  3GRH A;  2AXL A;  2DMT A;  4X8I A;  1ZG5 A;  4EV0 A;  1S4M A;  3AVV A;  1FYL A;  3MMY B;  4HYE A;  3D5R C;  4KIS A;  3Q9V A;  3GLX A;  2XSD C;  3RZO J;  4YII A;  3VFZ A;  2XT4 A;  4A6E A;  5IOZ A;  1WJF A;  3M9A A;  2ICW G;  3LFK A;  1IUF A;  1IB4 A;  1Z7U A;  4D7N A;  4EQQ A;  2ISZ A;  4ZZD A;  3EUA A;  3AVW A;  3FY3 A;  1W35 A;  1WCM J;  4TT3 A;  1YW8 A;  1FWZ A;  4AM3 A;  2UWM A;  3WQZ A;  3W5V A;  3DCF A;  5GTI C;  3E5U A;  4ZJZ A;  1GXP A;  1DG1 G;  4ACB A;  3CCU B;  2PYG A;  4BQQ A;  3W2H A;  4GGG A;  4EH1 A;  2HVR A;  2O8K A;  2YUH A;  3K1N A;  5DM7 F;  5JVG F;  2ZNZ A;  3OJX A;  2XF7 A;  4FT8 A;  3SZG A;  1Z6R A;  1F43 A;  1TUI A;  2C4T A;  4Y9R A;  1YIJ B;  3K69 A;  3KEO A;  4ZYA A;  4RDU A;  1ZUN B;  2RC4 A;  2D2W A;  5EEA A;  3F8F A;  4M0L A;  3S8P A;  4BQA A;  3GTP J;  2P6S A;  1EF4 A;  4OP7 A;  5DV5 A;  2NS0 A;  3VO1 A;  2V7F A;  4JOM A;  1QRC A;  5C1C A;  5FGM A;  2ELJ A;  5EEH A;  3T8T A;  3AG4 H;  4BYY A;  3WTU C;  1MKM A;  3PSI A;  3Q3S A;  4KIT B;  2DJN A;  3H9N A;  2COM A;  2EK5 A;  3ZR8 X;  4BAY A;  3QFR A;  3JX8 A;  5AMV A;  4Y4R A;  4UV8 A;  4HDU A;  1WH5 A;  5TGT A;  4DGW B;  4IL6 C;  3AVT A;  4C2T A;  4XN0 A;  1TWG J;  2WY8 Q;  5CPR B;  3DKY A;  4EJU A;  2VQC A;  3D5S C;  3E1Y E;  3HTU A;  5DD8 A;  4PUS A;  1K78 B;  2QGG A;  2MC4 A;  3RIR A;  5DEQ A;  3R61 A;  4C3J J;  2GOM A;  3CJN A;  5D8K B;  5K7Z A;  1T5E A;  1Z91 A;  3I64 A;  2X3U A;  4FWT A;  3JSO A;  5HDN A;  1R6R A;  1ITY A;  2ZJP F;  1HVX A;  4W8T A;  4XR6 A;  5E3O A;  1HF0 A;  2OBT A;  2P4W A;  3JUR A;  3FM3 A;  4A69 C;  2QUF A;  1X2N A;  2M1B A;  3OYG A;  3E6D A;  3L2U A;  2E2J J;  1SD7 A;  5A8A A;  1U8B A;  2X6W A;  9ANT A;  1LM1 A;  3ECO A;  2EV0 A;  1U6G A;  5M3F J;  4P6Y A;  2JWT A;  3HHH A;  1B72 B;  3BCB A;  4ASN A;  4OJ5 A;  1PVE A;  2CFX A;  2JA6 J;  3BWG A;  4RLQ A;  2KVO A;  3W2V A;  5FLX K;  1BOB A;  3JQQ A;  2Y31 A;  4JYK A;  2LKP A;  3OZW A;  4A3I J;  3ZPP A;  1MBF A;  1NB9 A;  2ZZQ A;  3PSZ A;  2JA7 J;  4E7S A;  2Q6I A;  2INU A;  5HOO A;  4RD6 A;  5H6R A;  3CCM B;  4B8X A;  1YJN B;  3VMW A;  3GLL A;  2FSW A;  3OOC A;  1XX5 A;  1UFM A;  4HLY A;  1LVK A;  1SAN A;  4I98 B;  3GQB A;  4V2F A;  2CQX A;  2O03 A;  4BE1 A;  2HDD A;  1ONV A;  1UB9 A;  2VXD A;  3ZZU A;  2CWE A;  2CK3 A;  1CF7 B;  5F4O A;  2ZO4 A;  4BDZ A;  1MNE A;  2VE8 A;  4U9U A;  1V55 H;  1X0C A;  3CME B;  2JRT A;  2DQR A;  2V26 A;  1K4T A;  1OCP A;  2JUC A;  3F3X A;  4KKU A;  2ZXI A;  1GVD A;  4ENN A;  4CCK A;  1B8I B;  2JPB A;  4GFB A;  3AG1 H;  2NSP A;  1N05 A;  1RRJ A;  1U5T A;  4BNC A;  2M8E A;  4OM9 A;  3IWZ A;  3PET A;  1VQ8 I;  2CYY A;  1RU4 A;  1E62 A;  5HNF A;  2AS5 F;  3FJO A;  1O8M A;  1S72 I;  4C2U A;  3V42 A;  5D5V B;  3KIO A;  4UB8 C;  2ZBU A;  3G71 I;  5IYC J;  2NNY A;  2NXN B;  4XID A;  1TP4 A;  3MWM A;  4I7H A;  2V1D A;  3L2Q A;  5FFX A;  5C4X J;  2ADU A;  1PJ6 A;  1Z9C A;  3UNG C;  5BMZ A;  2MD5 A;  1LNW A;  1QO0 D;  1U2R A;  2JA2 A;  1WRJ A;  1ZM9 A;  2V7X A;  3OZU A;  4UZF A;  1X19 A;  2HS5 A;  2H27 A;  4S04 A;  6PAX A;  4OU0 A;  2DEU A;  2RAE A;  1DP7 P;  2GXB A;  4U0Y A;  2K9S A;  3NAW A;  4HF2 A;  1OB0 A;  5EDN A;  1XTA A;  1J5Y A;  1Z67 A;  2MG4 A;  2QSF X;  4KN7 X;  1K79 A;  1WOO A;  2WPD A;  3GVK A;  4TMT A;  2O0W A;  1DU0 A;  3FXL A;  4JX4 A;  2XAJ A;  4U7D A;  2WWY A;  2W6I A;  3FKJ A;  1R36 A;  3DFG A;  1LDD A;  3KLN A;  2EH3 A;  2RC5 A;  5K5O A;  1Y6I A;  2X1E A;  3FMQ A;  1OFC X;  4L18 B;  3CD6 B;  3E1S A;  1E0E A;  5BOX A;  3PM1 A;  4MR0 A;  4F3Q A;  2JDI A;  1Y0Y A;  1NH3 A;  1IJW C;  1JI8 A;  3VMV A;  3RYP A;  1IDJ A;  2DIE A;  4KIC A;  2RVC A;  5CJ9 A;  2WJV A;  3U6B A;  1G59 A;  4CCN A;  2X6Y A;  4G6T B;  4Y3O A;  4ZZL A;  5KAF C;  3PUB A;  1D1B A;  4RAG A;  1QPI A;  1LFP A;  1EZG A;  2RQP A;  4HG2 A;  4HNT A;  4YAO A;  4B1R A;  2HVQ A;  2R6H A;  1ETQ A;  1XCB A;  1VQ4 I;  4XRF A;  5DM6 F;  3COA C;  2LRD A;  4RLZ A;  1K4S A;  3VR6 A;  4NBS A;  4M73 A;  2XRL A;  3H3U A;  3WBJ A;  3CCR B;  3H0D A;  2MSY A;  3ZC3 A;  3PQK A;  4NUB A;  5GTH C;  1TL8 A;  1K7A A;  1RKW A;  4BU2 A;  1T2K A;  5FIU A;  1ENH A;  1R71 A;  2BY0 A;  2ZL7 A;  1YI2 I;  3V7R A;  3LWF A;  3A01 A;  2ZJ2 A;  2O3F A;  5F27 A;  3QPS A;  2HDC A;  3MHP A;  5E17 F;  2W7N A;  1X4P A;  4D9J A;  4PMH A;  1XGS A;  1H88 C;  3LYC A;  3LSR A;  2FF4 A;  4XL9 A;  1COW A;  4Z05 A;  1K4Z A;  5EGO B;  2OZ6 A;  3ZOB A;  4UVB A;  1OHH A;  4EW9 A;  1J7K A;  5DCF A;  2VBW A;  5E8G A;  5M5W J;  1WZ2 A;  2Z5U A;  1OIS A;  1XQB A;  2F6C A;  2VBE A;  3BG9 A;  2MH9 A;  3F0C A;  2VI6 A;  2ODL A;  1PUF A;  4MFD A;  5ILV A;  2KRH A;  2E1M B;  1T95 A;  1QHH D;  5GAG J;  3ABM H;  2VPR A;  2B0L A;  2DOE A;  5KCM A;  2F5E A;  5L3F A;  2BN4 A;  3EQO A;  3G6E B;  3K2Z A;  1ZYR F;  4FHT A;  4L9V A;  3JW4 A;  1WGX A;  4YEJ A;  3GFJ A;  2EIK H;  4FET A;  1I18 A;  1A5J A;  2WB1 N;  2ZFU A;  1OKR A;  3TBI A;  3WTY C;  1TYU A;  1GLN A;  2ID3 A;  2ZB9 A;  5CVJ A;  2L7M P;  2LF7 A;  4XLE A;  3TW7 A;  2NOG A;  3RKX A;  4AUX A;  1N06 A;  4FN5 A;  4ZDL A;  2IW5 A;  3TP3 A;  4J19 A;  1WQ2 A;  2M45 A;  2Y30 A;  3IH3 A;  4EM2 A;  2A3S A;  3REO A;  3LSM A;  2OBP A;  4IVN A;  4FE4 A;  1DBO A;  5M3M J;  2M5S A;  2BVM A;  2CO5 A;  3L7W A;  3JRH A;  2A05 A;  3I4N J;  3SJP A;  5IYR A;  1FSH A;  3W6K B;  2QE7 A;  4DNC A;  4AVP A;  4KH3 A;  1DDN A;  3N97 A;  3FHZ A;  4N9I A;  3PFY A;  4Z6Y A;  4JX5 A;  2KIF A;  4ZV4 A;  2BW3 A;  1FNM A;  3FXM A;  2QA4 I;  2ZME A;  3CO6 C;  4P3I A;  5JBQ A;  1YIT B;  2R7F A;  2GBY A;  2WSS A;  2GQF A;  3JR9 A;  3NEU A;  1UST A;  2F4I A;  3OW2 B;  4YAW A;  1MMS A;  4WWV A;  4LK1 F;  2K9Q A;  5JLW A;  4KIB A;  3RPQ A;  2BF4 A;  1S0U A;  5F04 A;  4PAB A;  2PEC A;  1G7S A;  2FA5 A;  3I56 B;  2XPW A;  2E60 A;  2HYG D;  4UV9 A;  3E6B A;  2LKX A;  2CND A;  3BJO A;  3MEX A;  4OAY A;  4BBS J;  2MC3 A;  1W5T A;  1N25 A;  5K1Y A;  2MW8 A;  3BG5 A;  1OYI A;  1W0K A;  1ZKG A;  2A61 A;  2IGM A;  1FOX A;  1BA5 A;  2K7L A;  3PL8 A;  4H4K C;  4II3 A;  1PP7 U;  1DDI A;  3T56 B;  4NBQ A;  5EJC A;  3OIO A;  1FIA A;  4U49 A;  1ELO A;  5HLH A;  4E7H A;  4I01 A;  3H36 A;  3CP2 A;  2L0K A;  1NK2 P;  1NJI D;  3ASR A;  4O6J A;  2PI0 A;  1FP2 A;  2FBH A;  4Z1M A;  1KCD A;  3A1P A;  3SEZ A;  1HW2 A;  2E1B A;  3RCO A;  1XGO A;  3K4C A;  3VOD A;  1VQP B;  3NAR A;  2QVO A;  4HWV A;  4G8X A;  3GFI A;  3GQ9 A;  5IYP A;  1PYV A;  4X7E A;  4ETS A;  2JUG A;  1V4R A;  2HTJ A;  3HG9 A;  4E0F A;  2JTV A;  4ZYD A;  1VQK I;  4CH7 A;  2R7Q A;  1WJB A;  2VJJ A;  3M4O J;  4EAT A;  1WOR A;  5K5Q A;  1WTH D;  4ZCI A;  3KYC B;  3O8G A;  3WTV C;  4X0G A;  2HQ5 A;  2CH0 A;  3ML6 A;  1EWY A;  1SVL A;  2B7C A;  4L8J A;  4IHY A;  1RC9 A;  2WYR A;  3DTE A;  1CNE A;  4XSX F;  4RMN A;  1RUO A;  2KHM A;  3PQJ A;  3VOE A;  4DYQ A;  1G4D A;  1USS A;  5IP9 J;  4HEA 2;  3SXY A;  3BOQ A;  2LY1 A;  3DEW A;  3FXK A;  3GX4 X;  2Z2S B;  3HZJ A;  3Q6Q A;  2BE5 F;  4XLA A;  3A03 A;  3WE3 A;  2D1H A;  3OYI A;  1WOS A;  3IKV A;  2BXY A;  2DA5 A;  4HPQ A;  5GPC A;  3HXL A;  2DT6 A;  3K4B A;  3VSK A;  2RC6 A;  2L02 A;  3L09 A;  3SKB A;  1OYY A;  1FNB A;  4E7I A;  3EUH C;  1UD2 A;  1UD5 A;  2DCE A;  1G8X A;  1U5T B;  4UUT A;  3FKS A;  2KIU A;  4HDV A;  3FXQ A;  5L3C A;  1FMV A;  4YEL A;  4D1Q A;  1F4K A;  4I0A A;  3F6O A;  3SJM A;  1OB5 A;  3K6G A;  5HS7 A;  3JRG A;  2BHY A;  2OTL I;  3WHC A;  4ZGQ B;  1IN6 A;  4PFP A;  1RR8 C;  4IHW A;  1K5C A;  2H6B A;  4G1B A;  2O04 A;  1PUE E;  1YRN A;  1HA3 A;  4P1V A;  2O5R A;  3KP3 A;  4B47 A;  1GUU A;  4D0P A;  3BNW A;  2WZP P;  3FXJ A;  2DA4 A;  4PJJ A;  3HOU J;  5D5X B;  2WAE A;  1R58 A;  4CCO A;  4PJ0 C;  1MRZ A;  1UMQ A;  5TJJ A;  2YU9 J;  1KU7 A;  1IB0 A;  5IK2 A;  3FPP A;  2Z9O A;  5D8L B;  2L54 A;  2BBY A;  5E3N A;  3OE7 A;  3DLA A;  3CPW B;  2DET A;  3WND A;  2FE3 A;  1KCC A;  3QOD A;  4DQK A;  2K85 A;  5DDG A;  4CCJ A;  3BDD A;  3I1F A;  2F43 A;  4DQ2 A;  4RB2 C;  3PNT A;  4AVZ A;  5F4J A;  4RGX A;  2H1K A;  2EQR A;  2L7K A;  2DN0 A;  1YX2 A;  1IXS B;  2L2O A;  4WXC A;  3S2D J;  1XG2 A;  1ZAR A;  2QF7 A;  2F1L A;  5E6T A;  2Z16 A;  4IHT A;  1R9T J;  5LFA A;  1EFT A;  5DN6 A;  1F5T A;  4CZC A;  4UXN A;  3K4J A;  2EV6 A;  4UVA A;  1KMH A;  1TTT A;  2QEN A;  2XZO A;  5HXB A;  1PJR A;  4BUP A;  4Z03 A;  5HVQ C;  3C7J A;  4KA4 A;  4URR A;  5IP7 J;  4OMY A;  1R5G A;  2YWE A;  5JR3 A;  4FE7 A;  1C0W A;  2WV0 A;  2ZIT A;  4WXH A;  3RKY A;  3G1M A;  1K8F A;  2ZBV A;  4HNV A;  3OKX A;  4PFO A;  1WP6 A;  1GV2 A;  2R7Z J;  4P3Y A;  2QN6 A;  4ZH4 F;  1S7O A;  4GDF A;  2GLO A;  3SZE A;  1S7A A;  3K0L A;  1E79 A;  2TDX A;  4DOZ A;  2XHK A;  2R7R A;  1UD4 A;  2RNJ A;  4ENJ A;  3ZZ0 A;  1K28 D;  3KFW X;  1SD5 A;  3DTI A;  3GWZ A;  4M72 A;  1NG6 A;  1V5F A;  2CMP A;  3BZC A;  4NK6 A;  4Z4S A;  1DP3 A;  3OJW A;  3CJQ B;  3AG3 H;  2LR8 A;  4YAF A;  4H9G A;  2XF5 A;  2O0Y A;  4PK4 A;  4I6Z A;  3BT9 A;  4A12 A;  1IZ1 A;  2QBY A;  2EB7 A;  1B6A A;  1Z77 A;  5GP9 A;  1Q1H A;  5FO1 A;  4TMZ A;  2V1X A;  3V8J A;  2DK5 A;  1YIJ I;  4NNJ A;  1VQ9 I;  1SM4 A;  4LLG F;  1PUF B;  2D5V A;  3EET A;  4W1U A;  2IGN A;  1EXM A;  1W87 A;  3N6Z A;  3CLQ A;  2P7C B;  5HLT A;  4WCG A;  3CDI A;  3I55 I;  1BI3 A;  4LIT A;  3F22 A;  4KFC A;  4UZU A;  2Z8G A;  5CKT A;  3HBL A;  3S3M A;  1P7I A;  1JRG A;  3ONY A;  2HYJ A;  5ILU A;  5B1A H;  2E5N A;  2DT7 B;  4L5J A;  2MD0 A;  5E20 A;  2YWF A;  1PE9 A;  3AFH A;  1XB4 A;  3IWF A;  4XRM A;  4QTR A;  2M87 A;  1XS9 A;  2OF7 A;  1IRZ A;  4UZE A;  5C3E J;  3G05 A;  2W84 A;  4ASU A;  1IAW A;  3GQ8 A;  3H92 A;  2FBK A;  2HYF A;  3CC2 B;  3HGG A;  1YQA A;  4E70 A;  1VQ6 B;  1IO2 A;  1ETK A;  1KYW A;  4BXU A;  3MMP A;  3QPH A;  1RR7 A;  3KCC A;  5CLS A;  2DJI A;  5D5U B;  4M6Y A;  3K70 D;  1FRQ A;  1UD6 A;  1UMK A;  4RDJ A;  1I8D A;  1VTN C;  4LIU A;  3DPU A;  1XE1 A;  3JSP A;  4OIN F;  3ZMU A;  1P4W A;  2NAZ A;  2BW3 B;  3CXC B;  2BM4 A;  2R7O A;  1IA5 A;  1O57 A;  2ZSH B;  1F20 A;  4M3D A;  4BH9 A;  2ZME B;  4A93 J;  1VQO B;  3LNQ A;  4A3L J;  3K7A J;  1QRB A;  3CZ6 A;  2VC1 A;  1IF1 A;  5BSX A;  4G7O F;  1BW5 A;  1KTV A;  4E7L A;  2QZA A;  3AVX A;  1FMW A;  5CDF A;  2X3H A;  4HW0 A;  3QFT A;  4PJN A;  1TQM A;  2ECC A;  3ZBU A;  4U87 A;  1ODD A;  3VPR A;  1Y0U A;  2Q1Z B;  2VT3 A;  4KMF A;  3WXM A;  2RKH A;  1CQT A;  3PEN A;  2WAQ N;  3LSI A;  4ZCM A;  4BAC A;  5TRD A;  3PSS A;  1FC3 A;  4YAL A;  1R4N B;  4R1H A;  3FBI B;  3CW2 A;  4A2U A;  3ASN H;  3HRS A;  3SZT A;  1BR2 A;  1UG0 A;  2P8T A;  1IV8 A;  1IRF A;  3FMR A;  3IH4 A;  4MEX F;  4XMY A;  3ZN0 A;  2HCJ B;  3U2Q A;  2R5Z B;  1GAW A;  1LDK B;  5J1R A;  1LLW A;  4B4D A;  2M7B A;  1HQC A;  1QRY A;  2QQ9 A;  2PLY A;  2AHO A;  4LBZ A;  2VFP A;  3PO2 J;  2C77 A;  1WSR A;  1Y39 A;  1MD0 A;  2GJK A;  1TZL A;  3OS1 A;  3PNV A;  2P81 A;  1ZM2 A;  3ASQ A;  4Z4T A;  2WA0 A;  4MIM A;  2HQA A;  2WY7 Q;  3VYR B;  2OK8 A;  2LMD A;  3CUQ C;  2IVM A;  3QPT A;  3FXR A;  4ON0 A;  5AN9 A;  1ON2 A;  5E1Z B;  4N3G A;  4OPW A;  2F3L A;  3A2K A;  2ZTN A;  4OJO A;  2MFZ A;  3BH6 B;  1NBM A;  1KK3 A;  1O8F A;  3AG2 H;  4AD9 A;  1H42 A;  2V7W A;  1H8E A;  4BS9 A;  4LFU A;  2BM7 A;  3RIQ A;  2OA4 A;  2XGD A;  5FO5 A;  2G7H A;  3JRI A;  2EFG A;  2VBS A;  3C1D A;  4V19 K;  3E7L A;  5EZG A;  4NCN A;  5A88 A;  4G5G A;  4ABZ A;  1CLW A;  1P2F A;  4BEH A;  3CCJ I;  5B6I A;  3VNV A;  4YZQ A;  3KEW A;  1YS7 A;  3GYH X;  4A3E J;  1H89 C;  1NDH A;  1PJ5 A;  3V7A A;  1O7L A;  3GZN B;  4A0X A;  1FTZ A;  3EUH A;  3T5X A;  2VBK A;  2R7S A;  2Y2Z A;  3WU1 B;  2D74 A;  1OFM A;  4ACA A;  2H09 A;  1QVG B;  1G7R A;  1YLF A;  3PFI A;  3JRF A;  3A8I A;  3CD6 I;  3SUC A;  1JHH A;  3I58 A;  4L9N A;  2HTS A;  4RLF A;  3FZV A;  4RBO A;  2DW4 A;  1X3W B;  2BOL A;  3T1B A;  3WTZ A;  2BGJ A;  2L4M A;  3L2R A;  3DLL F;  1IDZ A;  1HG8 A;  4OJ6 A;  1D0Z A;  3AKZ A;  1Q86 D;  4KKS A;  2GIV A;  2KJC A;  4MGR A;  2CF4 A;  3H3Z A;  3G4S B;  1JHF A;  4RB3 C;  5IYB J;  2VPL A;  4RD3 A;  3KPH A;  1QCX A;  3E5X A;  1KK0 A;  1R23 A;  1Z3Y A;  3ZQG A;  2EZL A;  2Q0O A;  3GBG A;  2HEO A;  2DY1 A;  2JN9 A;  1MBE A;  1U78 A;  5GAE J;  2IS1 A;  4UAJ A;  1HBX G;  4Y15 A;  1YRN B;  4Z4R A;  3QU3 A;  1R7J A;  2HKO A;  5ICE A;  1KK1 A;  3M1C A;  5DYM A;  1SFX A;  2QX3 A;  2XTY A;  2EIX A;  4P6V F;  2F1M A;  3MKZ A;  2OTJ I;  2X1D A;  2DPU A;  2J5O A;  2GK6 A;  3ZXS A;  1X1P A;  4XK4 A;  2GXA A;  1IN4 A;  3BC9 A;  3O2P E;  5FKN A;  2EZK A;  1IXC A;  1W36 D;  2KDO A;  3GZ5 A;  1LJ9 A;  4G7Z F;  3IC7 A;  4CYD A;  4I84 A;  1QVT A;  1A6Q A;  1VQL B;  4FXU A;  2XUB A;  2W57 A;  2F5C A;  4BY7 J;  3ZMD A;  2DFF A;  4AC9 A;  2QDX A;  2A5W A;  1HDP A;  4UB6 C;  1OQY A;  1E3H A;  2M9H A;  4W8R A;  2LK2 A;  4UUS A;  2CV0 A;  3OAA A;  2D3N A;  3LA3 A;  2EV5 A;  4OOS A;  5HZB A;  3GQA A;  4OOX A;  4HX7 A;  1QUE A;  5F0H A;  4ZTF A;  1YJ9 B;  1KQ0 A;  2UVE A;  3EQL F;  3J7Z I;  3BR3 A;  4IRH A;  1KK2 A;  4P22 A;  1UCR A;  2KLO A;  4CDG A;  2BM6 A;  2PLF A;  1UHM A;  2DYR H;  3CMY A;  1JE8 A;  3D5L A;  2WBM A;  4DJA A;  3KYD B;  3HOY J;  2ZXH A;  3SDB A;  3VYT B;  1HCR A;  1E3X A;  3HOT A;  1VQ5 B;  4X1E A;  3I4P A;  1A31 A;  1TVC A;  1V5G A;  3MKY B;  2QCO A;  2INV A;  3E20 A;  3IRR A;  3LMW A;  1WJ5 A;  3A8K A;  1L0O C;  4M6V A;  2JJ2 A;  2H8W A;  4BQO A;  2W82 A;  4B44 A;  2O17 A;  5K7H A;  1WMR A;  3Q0U A;  4HOB A;  1A36 A;  5HLI A;  2XAF A;  2N8G A;  3QWL A;  1ETV A;  1QGA A;  3L2W A;  3GF2 A;  4LMY A;  1SFO J;  1D5V A;  2VXZ A;  2KJB A;  1FSE A;  4Y13 A;  4HRI A;  1WFX A;  3ZCO A;  2D9R A;  3BY1 A;  1N77 A;  5FKO A;  2QBY B;  2Q8K A;  1YIT I;  4C3H J;  1GR1 A;  3RJP A;  5C44 J;  1HC8 A;  1OMI A;  5AIQ A;  4P9S A;  3JQP A;  5L3B A;  1YOV B;  2YR2 A;  1FNC A;  1UD3 A;  1SAU A;  1W9X A;  3W2A A;  1R22 A;  2FML A;  2Q6O A;  2M7A A;  3W5H A;  1XG1 A;  5ICG A;  2QQB A;  3SFI A;  3PIO F;  3P7N A;  2NST A;  1WI9 A;  4IQ4 A;  1MH3 A;  4EVI A;  2EIN H;  3QOP A;  3F8M A;  4X07 A;  1YHQ B;  3WNC A;  3OIP A;  2JVG A;  3BH4 A;  3WTW C;  1T6Z A;  3S15 J;  1VHO A;  1YJW B;  5E18 F;  3WE2 A;  5D5W B;  1HLV A;  3S1M J;  5TY0 A;  3QPL A;  4A3B J;  1TWF J;  1UZC A;  1JJ8 C;  4LBV A;  1YIO A;  3CF2 A;  1VQM I;  2JA8 J;  4V2G A;  3OW7 A;  3BR6 A;  4BXX J;  5GAH J;  1A35 A;  2DDA A;  1KQS B;  1WSU A;  1OR7 C;  3BJA A;  1W2B B;  2OYN A;  1BN8 A;  2PG4 A;  3T51 B;  1SFE A;  2LVS A;  5GV7 A;  3V7C A;  4FQG A;  1KYZ A;  3EPZ A;  4AYB N;  4CCM A;  4B3F X;  3E0J B;  3M3Y J;  4YCQ A;  1ZM3 A;  3K4L A;  2WAD A;  4QUZ A;  1IXR C;  3CC4 I;  2KDZ A;  1E17 A;  3OYE A;  2R4G A;  2O6W A;  3T0Y A;  3GME A;  4DK0 A;  3I9V 2;  2P6T A;  1BJK A;  1DBG A;  2FMY A;  1V5V A;  3LSJ A;  4BDY A;  3NB2 A;  1E43 A;  1QVF B;  4RCZ A;  5F4M A;  3QFC A;  1D8K A;  2HFH A;  2P0W A;  3DU6 A;  2I5U A;  1XPX A;  2O6G E;  2C2W A;  4TMV A;  2E1C A;  3Q0W A;  2HLD A;  2X0K A;  3CCS B;  2W7Z A;  2BY1 A;  2L3D A;  2M8G X;  1VQ7 B;  1LPQ A;  1QPM A;  1LB2 A;  1QHG A;  3LSG A;  3RY8 A;  1YLO A;  3HPH A;  2QGU A;  4P55 A;  3GO5 A;  2Y9Z A;  2KPM A;  2OCC H;  4OWR B;  5DUK A;  2C5B A;  2ZFW A;  1O8I A;  4RAF A;  2V6C A;  3CCE I;  5LD2 C;  4UY8 I;  2DK8 A;  4BE2 A;  3HTS B;  1V5E A;  3JRD A;  1KQ8 A;  1VBL A;  1RIO H;  1D1C A;  2L7Z A;  3QQA A;  1NHC A;  3CUQ A;  1WPC A;  5L46 A;  2DQL A;  5FLM J;  1VFC A;  3C3W A;  4OOV A;  1GQ8 A;  4UNO A;  1XMA A;  1U9O A;  3G2B A;  1JB9 A;  2QEX I;  4A3C J;  1DDG A;  3ISX A;  2FRH A;  4C9Y A;  2ECB A;  3KP7 A;  2R5Y A;  1ON1 A;  1IV6 A;  5IT3 A;  2IT0 A;  1WXR A;  3JTH A;  1U3E M;  2BGI A;  3HGY A;  3VEP A;  1E3Z A;  2MYS A;  2ZBK A;  1NB0 A;  2L5Q A;  4KYW A;  3O8H A;  3VST A;  3OS0 A;  5J40 A;  1YTY A;  3GTQ J;  5LBQ A;  2VBZ A;  3G1O A;  5KAI C;  3MVP A;  5A2Q Z;  1H85 A;  2V5I A;  1Y1V J;  1OJL A;  3ONU A;  2C5H A;  4ESF A;  3T9G A;  1DU6 A;  3I59 A;  3KE2 A;  5ED4 A;  2VBM A;  2Q6K A;  2V4J C;  2D45 A;  2VNI A;  5K7F A;  2VNJ A;  1Z0X A;  2XAS A;  4BPR A;  2Y0S N;  2NOJ B;  1O3S A;  2XRO A;  4IKF A;  2ZNY A;  1W7P D;  3CJR B;  4BEH B;  2EIL H;  2HXO A;  1LUJ B;  3ZPN A;  4RD4 A;  2DYS H;  4QSH A;  3BG6 A;  4DNT B;  3BP8 A;  2EA4 A;  3S3N A;  1EFR A;  2A68 F;  4M6X A;  1N75 A;  1ZHF A;  1IGN A;  1J09 A;  4QLC U;  4KIG A;  4OJL A;  2IRF G;  1XGN A;  4IHV A;  1MSF C;  2KRC A;  4NB5 A;  4W97 A;  3CUO A;  1BOA A;  3GW2 A;  3CC7 I;  5KSW B;  4CXF A;  1BX1 A;  3MZH A;  1X1A A;  3MD2 A;  5ERI A;  1TC3 C;  3RQ4 A;  2XSJ C;  1VQN I;  2EFN A;  1Q9S A;  4BJT A;  2PFB A;  1D0X A;  3HDD A;  3JAM Z;  1LLZ A;  4N9H A;  1TQP A;  4WX9 A;  3HOS A;  4AID A;  3FF5 A;  1RKT A;  3HPG A;  4A3M J;  1QA3 A;  1GHC A;  5KK1 A;  4ESJ A;  1QGZ A;  2DA3 A;  4MEY F;  2KMU A;  2M2E A;  2K5C A;  4YAU A;  2V7Q A;  1RET A;  1O8L A;  3U1D A;  4BQN A;  3HOZ J;  4C2M J;  2NVX J;  2JSC A;  4ESB A;  2QSG X;  2VJ4 A;  3GIR A;  4M3E A;  5F1R A;  3QAH A;  4M9S A;  1H8A C;  3TGN A;  2CW0 F;  4EGZ A;  3SEQ A;  3WU0 A;  2A07 F;  3MKL A;  1Y1W J;  1EP3 B;  2ZJQ F;  2XVC A;  1F9N A;  3CQZ J;  3BR1 A;  2LZJ A;  4MYU A;  2CSO A;  3BCA A;  2JIZ A;  4HBL A;  1YYV A;  1XC5 A;  3K70 C;  4DZJ A;  1JKR C;  4TSF A;  1WVR A;  1MBJ A;  2EZI A;  4PZJ A;  2Z1D A;  2HOT A;  1XMX A;  1LVA A;  3P9C A;  3CCQ I;  2P5L C;  2HOA A;  4MQ9 F;  2XZL A;  1WHU A;  3M8J A;  3JRC A;  3Q39 A;  3TO9 A;  4UUS B;  2BPO A;  2DMN A;  2DMQ A;  3A02 A;  1STZ A;  1RQR A;  2GA2 A;  3HRT A;  3ELK A;  1DPR A;  3HOW J;  3F8N A;  1G3Y A;  2DDB A;  1LQ1 A;  4QWQ A;  1MBG A;  2NVU B;  1QGP A;  2FEZ A;  1RWR A;  3S2H J;  3S17 J;  1BMF A;  1FOW A;  1JKQ C;  1QFJ A;  2LKS A;  1X1B A;  3TH0 A;  4KJZ A;  3TDZ C;  4G6I A;  2NTB A;  5CYV A;  3ECH A;  2V7T A;  1TYV A;  1G7T A;  2JK3 A;  1H0M A;  2IEK A;  3CMA I;  4HF1 A;  4J00 A;  4PC1 A;  4XLF A;  1BX0 A;  3LNN A;  2M0M A;  3F72 A;  4M1K A;  1TNT A;  5H2F C;  2XOK A;  5HNH A;  1EKE A;  1HKS A;  2K4B A;  4DBR A;  2CW7 A;  3ABL H;  5FNZ A;  1MBK A;  5ICF A;  2FBI A;  2J8I A;  4KKT A;  3J80 Z;  3B6A A;  1QU3 A;  1ZQ3 P;  1O8K A;  3FIW A;  3BC8 A;  2KZV A;  3I53 A;  4B3A A;  2TCT A;  4O3M A;  3SHF A;  1WPK A;  2NV4 A;  2R5Z A;  2VQG A;  2VAS A;  2VOD A;  2DFI A;  4HV5 A;  3WHB A;  2DPD A;  2EJR A;  2XKP A;  2JA5 J;  3BPX A;  1OCO H;  3CES A;  4AIH A;  1EH7 A;  1MSE C;  3BLY A;  5FKL A;  4BHP A;  4M74 A;  5LLQ A;  2F5V A;  1BIA A;  4CHU A;  4J01 A;  3JRB A;  2OBS A;  1O88 A;  2HOE A;  3HHG A;  4A5M A;  4DNR B;  2VJ5 A;  1HOM A;  2YX7 A;  1YW9 A;  2CFO A;  5J6X A;  1G3W A;  4ZCL A;  5FKK A;  1FRN A;  4CA0 A;  1VI0 A;  1IN5 A;  4Y7N J;  1RI7 A;  1K6O A;  2BMW A;  2ETH A;  2NNN A;  2OQG A;  4PSW A;  4OZZ A;  1FND A;  1O3Q A;  2L9R A;  2BY2 A;  3I0T A;  4AIJ A;  2WB1 A;  4KUM A;  3NAU A;  3F23 A;  1OR7 A;  3JRE A;  2QYU A;  4A3J J;  4B48 A;  1FX7 A;  4JMQ A;  3F6V A;  2KT0 A;  3ES9 A;  1ZGA A;  3OL4 A;  1XN7 A;  3OOP A;  4FIS A;  2CV2 A;  1I6X A;  3VB2 A;  3MZ8 A;  1ETW A;  1Y0N A;  1U8R A;  4XOP A;  1VND A;  3GVL A;  3B73 A;  4MHG A;  1WKM A;  1VQ8 B;  1LDJ A;  3IHU A;  4YFK F;  3GFM A;  2A6E F;  2LYC A;  1P92 A;  3FX3 A;  5IPA A;  5J8C A;  1VLO A;  1IN8 A;  2VFM A;  1H9G A;  2QLZ A;  3GTO J;  2XZP A;  1S72 B;  5FRO A;  3A0B C;  3H0G J;  1GVH A;  4GRI A;  4GQN A;  1EV7 A;  2UXN A;  3G71 B;  4LK0 F;  1RNL A;  1D8J A;  1RZ4 A;  1N08 A;  4I0B A;  3R0J A;  4JRA C;  3R6K A;  4L9J A;  4E6K G;  5KVR A;  3C18 A;  1R5N A;  2VOO A;  1BI2 A;  2OZU A;  2VC0 A;  2XGC A;  5A2Q K;  2BV3 A;  4RB0 A;  1FX0 A;  2AQE A;  3N05 A;  4RDK A;  3H1C A;  4YC5 A;  3RPU D;  1HSJ A;  1FBS A;  3PJR A;  1ZN2 A;  1DQU A;  2OPT A;  5M5Y J;  4A3F J;  1IC8 A;  4OIP F;  3FPK A;  3WNB A;  1O8D A;  1OGO X;  1T98 A;  5LRR A;  4JBA A;  2NYX A;  4XKV A;  1P4X A;  2VON A;  1JT0 A;  1W36 C;  4XLP F;  2EIJ H;  1O3T A;  1AU7 A;  2BY3 A;  1MNM C;  1ZRC A;  3SQN A;  4XON A;  1S9H A;  3U2R A;  2JRM A;  1VZ0 A;  1GO2 A;  3P9K A;  5F08 A;  1QVU A;  2QYO A;  4I09 A;  2L7F P; 
#chains in the Genus database with same CATH homology
 3OY9 A;  2ZZG A;  3JUR A;  1D1A A;  2CS3 A;  2GJK A;  2O0V A;  1TZL A;  3OS1 A;  3OYG A;  3L2U A;  3PNV A;  1OFL A;  2X6W A;  2LBF B;  2WA0 A;  2IS6 A;  3B90 A;  2RQQ A;  2HQA A;  2WY7 Q;  3VYR B;  3BCB A;  4OJ5 A;  3A2K A;  2ZTN A;  3I3L A;  2MFZ A;  4OJO A;  4RLQ A;  2KVO A;  2UUZ A;  1NBM A;  3W2V A;  3QYE A;  1O8F A;  1BOB A;  3MKW B;  2GOX B;  4XKW A;  3OYA A;  2HPI A;  2VQL A;  3A4C A;  4BS9 A;  4BL0 B;  1H8E A;  2GJR A;  3DQV C;  3ZPP A;  3C2G A;  2IXS A;  2ZZQ A;  2INU A;  4E7S A;  5HOO A;  2IGK A;  3VMW A;  3OOC A;  4YZQ A;  3IUO A;  4BEH A;  2XF6 A;  1LVK A;  1KZL A;  2XAU A;  4P1W A;  3GQB A;  3KEW A;  4BE1 A;  1ZEL A;  2VXD A;  2Y0S A;  2RNG A;  3QYB A;  4BXF A;  3KX2 A;  2CK3 A;  1BPL A;  2AQF A;  3DTK A;  2VBK A;  4PJM A;  2KQR A;  1MNE A;  1U0J A;  4BDZ A;  2R7S A;  1X0C A;  1OFM A;  3TMO A;  3K4K A;  1UEL B;  2V26 A;  3ZRG A;  4KKU A;  2NTP A;  2W1O A;  2UVF A;  2ZSI B;  2ZXI A;  2M4G A;  4CCK A;  3OFN A;  3SUC A;  2NSP A;  4LIV A;  4RLF A;  1O8H A;  3LFU A;  2W6J A;  2BOL A;  1VJS A;  3U21 A;  3L2R A;  1W0J A;  3LMM A;  3H35 A;  1EE6 A;  1D0Z A;  3AKZ A;  1HG8 A;  1RU4 A;  4OJ6 A;  4KKS A;  5HNF A;  1O8M A;  1X1D A;  4C2U A;  4OJP A;  1X4O A;  3V42 A;  2VPL A;  1QCX A;  1UAA A;  1P9Q C;  2QKM B;  1Z3Y A;  2PJR A;  3L2Q A;  1DGW Y;  4BJ5 C;  3GBG A;  3FBN B;  3UNG C;  2HU9 A;  2IS1 A;  2JA2 A;  5KNL A;  3M1C A;  1X19 A;  2QX3 A;  2JVH A;  3NWT A;  4ZTJ A;  2F1M A;  3MKZ A;  4NC7 A;  2X1D A;  2K9L A;  1OB0 A;  2GK6 A;  3ZXS A;  3AL0 B;  4XM3 A;  3BC9 A;  3GVK A;  2O0W A;  2LC2 A;  1BR1 A;  3UR3 C;  4XN3 A;  2WPD A;  1W36 D;  1IRX A;  2KDO A;  5CQE A;  2W6I A;  2NT9 A;  3CMM A;  3FKJ A;  4I84 A;  3AL0 C;  3VDX A;  2VKH A;  3A3G A;  4FXU A;  1Y6I A;  1MMD A;  2X1E A;  1T0F C;  4F52 A;  3E1S A;  2A5W A;  1E0E A;  4MR0 A;  2R7W A;  1NG7 A;  4F3Q A;  2JDI A;  4RM2 A;  4JQF A;  4W8R A;  1JI8 A;  3VMV A;  2CV0 A;  3OS2 A;  3OAA A;  2D3N A;  2DIE A;  1IDJ A;  3DDY A;  2WJV A;  3WWG A;  1G59 A;  2XDV A;  4CCN A;  2X6Y A;  4G6T B;  4Y3O A;  3GQA A;  3PUB A;  1D1B A;  3IAS 2;  4C30 A;  4U7B A;  2WJY A;  1LFP A;  4ZTF A;  3S3O A;  4HG2 A;  4HNT A;  2NTQ A;  4XOT A;  4XOR A;  2Z6B D;  1KTW A;  2UVE A;  2R7V A;  2HVQ A;  3OOU A;  4P22 A;  2KLO A;  2XND A;  3K10 A;  3OR1 C;  3HC7 A;  2LRD A;  3D5L A;  4XKB A;  2W00 A;  2WBM A;  4QPO A;  1VLY A;  4DJA A;  3OEH A;  2BSP A;  3VR6 A;  2ZXH A;  3SDB A;  3VYT B;  1E3X A;  3HOT A;  3H0D A;  2X1C A;  4NUB A;  2V6E A;  4BU2 A;  4BE0 A;  2I8D A;  1V5G A;  3MKY B;  2INV A;  3LMW A;  1WJ5 A;  2JJ2 A;  3H5R A;  4BQO A;  2W82 A;  4B44 A;  2O17 A;  2K3P A;  4OZY A;  1WMR A;  3PNY A;  2W7N A;  1X4P A;  4D9J A;  4PMH A;  3SYT A;  3OR2 C;  3L2W A;  4XL9 A;  1COW A;  3OPO A;  4Z05 A;  2VXZ A;  4DBQ A;  2ZZE A;  1OHH A;  3RTR A;  4HRI A;  4EW9 A;  4W8Q A;  1WFX A;  3ZCO A;  3ZQQ A;  2R7T A;  2KP6 A;  1N77 A;  1OOC A;  2F6C A;  1PLU A;  2CUZ A;  2VBE A;  1VF7 A;  3OEE A;  2ODL A;  4XLC A;  1UD8 A;  2LG4 A;  1MMA A;  2KRH A;  2E1M B;  1T95 A;  1QHH D;  1UD3 A;  1SAU A;  3EQO A;  5KCM A;  1W9X A;  3W2A A;  3FHN A;  4HNU A;  3W2W A;  3A1Y A;  2M7A A;  2NST A;  3VSV A;  4IZZ A;  4NK8 A;  4IQ4 A;  2GJP A;  2E1M C;  4YEJ A;  1O8G A;  4FET A;  1I18 A;  3KYL A;  2ZFU A;  3OIP A;  2JVG A;  3TBI A;  3H9J A;  3BH4 A;  2CUJ A;  1GLN A;  2K9M A;  3BCD A;  4YZA A;  1YX5 A;  2VB6 A;  4XLE A;  3A3B A;  1N78 A;  4RM3 A;  4IQJ A;  4ZDL A;  1HZE A;  2OC6 A;  3PSF A;  4BJ6 C;  3LSM A;  3CF2 A;  1E1R A;  3FDY A;  1WJD A;  3OW7 A;  1DBO A;  3W3C A;  2M5S A;  2BVM A;  1OR7 C;  3VSL A;  4B3X A;  2QE7 A;  2UV1 A;  4ANJ A;  1D0Y A;  4E7K A;  1BN8 A;  2LOO A;  2O1D A;  3T51 B;  1AIR A;  1MMG A;  3PFY A;  4B3F X;  4CCM A;  3EPZ A;  1MMN A;  4F92 B;  3E0J B;  5FL7 A;  2BW3 A;  1MAB A;  4XQF A;  2QKL B;  3DU5 A;  2WAD A;  3K4L A;  4KT6 A;  3OYE A;  2WSS A;  2R4G A;  1O8E A;  2W4S A;  2OV7 A;  4DK0 A;  4MXN A;  2LRE A;  3I9V 2;  1DBG A;  4DIQ A;  2FUG 2;  2F4I A;  5HKK A;  4BDY A;  1E43 A;  3K4N A;  4C2L A;  3H9G A;  2PEC A;  2P0W A;  3DU6 A;  2E60 A;  3JU4 A;  3IP4 B;  2HLD A;  4OAY A;  3OYL A;  1QHG A;  3LSG A;  2HVS A;  3VYU B;  1W0K A;  1PXZ A;  2IGM A;  4F93 B;  3HPH A;  1BR4 A;  3PL8 A;  3B8Y A;  2KPM A;  3DWL E;  4H4K C;  4II3 A;  1DGR M;  4OWR B;  1O8I A;  3T56 B;  2L9N A;  5LD2 C;  2VKD A;  4BE2 A;  1VBL A;  4U49 A;  1V5E A;  4PJL A;  4E7H A;  4XD7 A;  1D1C A;  4HIZ A;  3CP2 A;  3RSN A;  1NHC A;  1X1C A;  1WPC A;  2M4K A;  3OYD A;  4N4O B;  2PYH A;  1SKY B;  2L9S A;  1NRK A;  4XKC A;  4Z1M A;  1GQ8 A;  3F9K A;  1KCD A;  3A35 A;  3G2B A;  2LBF A;  3SEZ A;  4G7X A;  1O8J A;  2E1B A;  3RCO A;  4Z06 A;  3K4C A;  2IQ7 A;  4HWV A;  4C9Y A;  3GQ9 A;  4IX7 A;  1PYV A;  2VQH A;  2HPM A;  2JUG A;  2R7U A;  3HG9 A;  3OWT A;  4E0F A;  3NWS A;  1V0F A;  4NC8 A;  4CH7 A;  1E3Z A;  2MYS A;  4DK1 A;  2R7Q A;  2L5Q A;  3OYM A;  1WJB A;  2VJJ A;  4EAT A;  2R9V A;  3VST A;  4II2 A;  3OS0 A;  1WTH D;  3LSK A;  1QJV A;  4X0G A;  2CH0 A;  2E5Z A;  2NT6 A;  5FRM A;  4L8J A;  4YZX A;  3T9G A;  3DTE A;  3DPT A;  1Z7L A;  4RMN A;  2KHM A;  1JTA A;  2VBM A;  2V4J C;  3ZGK A;  2D3L A;  2DOA A;  2JSP A;  4HEA 2;  2LY1 A;  3OYB A;  2NOJ B;  4IKF A;  4BEH B;  3CJR B;  2Q2E B;  2Z2S B;  3ZPN A;  1H80 A;  4CCL A;  1Z3X A;  4XLA A;  3BG6 A;  4DNT B;  3K4M A;  2VIX A;  3S3N A;  3OYI A;  1EFR A;  1N75 A;  4HPQ A;  1V0E A;  1J09 A;  4E4H A;  3HXL A;  2DT6 A;  5CQG A;  4E7J A;  4OJL A;  3K4B A;  2GK7 A;  2LY2 A;  3OYF A;  3VSK A;  2EWE A;  1Z21 A;  2KRC A;  4PSX A;  4E7I A;  3EUH C;  1UD2 A;  1UD5 A;  2DCE A;  1EA3 A;  1G8X A;  4B3G A;  3EUK L;  3FKS A;  1HA8 A;  1X1A A;  3MD2 A;  3OYK A;  4AU7 A;  3H94 A;  1FMV A;  3RQ4 A;  2XSJ C;  4YEL A;  4D1Q A;  3DKX A;  2VL8 A;  3OIQ A;  4BJT A;  1BLI A;  2XGJ A;  1D0X A;  3K6G A;  2M3A A;  4PFP A;  3HOS A;  4F55 A;  1K5C A;  1E1Q A;  2O04 A;  2X53 S;  3HPG A;  4XNF A;  2O5R A;  2PJR B;  4B47 A;  5FRN A;  2WZP P;  4PJJ A;  3HKZ A;  2XC7 A;  2IGO A;  5C1E A;  2KMU A;  2PMZ A;  2K5C A;  2HNH A;  2WAE A;  4CCO A;  4XLH A;  2V7Q A;  1O8L A;  4LG3 A;  4BQN A;  3HL2 A;  5IK2 A;  3FPP A;  4TKO B;  3DPL C;  2VJ4 A;  3EQN A;  2HZD A;  3DLA A;  2ZTG A;  3OE7 A;  4YZ0 A;  2QY1 A;  1KCC A;  3QOD A;  1LKX A;  3B4N A;  3QYF A;  3BCF A;  4CCJ A;  4QPQ A;  3OYJ A;  2F43 A;  3SEQ A;  1OLT A;  3PNT A;  4AVZ A;  2LZJ A;  2V31 A;  2L7K A;  2ZZF A;  3BCA A;  4R79 A;  2L2O A;  3S93 A;  2JIZ A;  3OYC A;  1XG2 A;  3K70 C;  4TSF A;  3H5N A;  3CP8 A;  2NZM A;  4E7Z A;  2Z1D A;  2Z16 A;  5LFA A;  1WJE A;  4G7W A;  3DEE A;  5DN6 A;  1AA7 A;  5KHD A;  2HDW A;  2XZL A;  3M8J A;  1KON A;  4CZC A;  3K4J A;  1KMH A;  2CW8 A;  1YE9 A;  1MND A;  4N4N B;  2V4D A;  2X51 A;  4NQW B;  2XZO A;  1PJR A;  2X6X A;  4BUP A;  4Z03 A;  5HVQ C;  4URR A;  3OYH A;  1RWR A;  4ZDP A;  3H9Q A;  3J7A Y;  1BMF A;  1OGM X;  1SFK A;  1X1B A;  4KJZ A;  4G6I A;  1BHE A;  2NTB A;  4U4B A;  3VYS B;  1WJA A;  2MAB A;  2RRE A;  3ZSC A;  4J00 A;  4PFO A;  1WP6 A;  3KRG A;  4XLF A;  3TL4 X;  3LNN A;  2M0M A;  4W8S A;  2R7X A;  2LH9 A;  1Y56 A;  2XOK A;  5HNH A;  1ERD A;  4DBR A;  2CW7 A;  1E79 A;  4OAZ A;  4DOZ A;  2WAQ A;  4KKT A;  2R7R A;  1QU3 A;  1UD4 A;  1O8K A;  3ONQ A;  3BC8 A;  1K28 D;  2KZV A;  3DTI A;  1NG6 A;  1V5F A;  2CMP A;  2VQG A;  2VAS A;  4HSR A;  4CSW A;  4BGD A;  4NK6 A;  1DP3 A;  3CJQ B;  3ZIA A;  2XF5 A;  4PK4 A;  3CES A;  1CZF A;  3IAM 2;  3BLY A;  1RMG A;  4YRV A;  1YX3 A;  2F5V A;  4MLO A;  2OUM A;  2X85 A;  4J01 A;  3L2V A;  1O88 A;  2DXI A;  4NNJ A;  4DNR B;  2VJ5 A;  2JJ1 A;  2CFO A;  2IS4 A;  2IGN A;  3UW0 A;  2VLA A;  3NE5 B;  3LSH A;  3HUG B;  4CA0 A;  5HLT A;  4F91 B;  3OL3 A;  4LIT A;  3GRH A;  4UZU A;  5JHF A;  2Z8G A;  5CKT A;  3S3M A;  3QOE A;  4PSW A;  4OZZ A;  4HST A;  1JRG A;  2CV1 A;  3MMY B;  3T53 B;  3D5R C;  2E5N A;  4KIS A;  3OYN A;  2WB1 A;  2DT7 B;  2MD0 A;  3LL7 A;  2V9K A;  2X8K A;  1PE9 A;  3AFH A;  4B43 A;  4FAS D;  4B48 A;  4JMQ A;  1WJF A;  1IB4 A;  1H8H A;  3OL4 A;  2CV2 A;  3EUA A;  3G05 A;  4ASU A;  3H5A A;  3GQ8 A;  4XOP A;  3FY3 A;  4TT3 A;  4YXW A;  3WQZ A;  2UWM A;  4ITV A;  3GVL A;  1K6Y A;  4ZJZ A;  2PYG A;  2DJI A;  4BQQ A;  2LYC A;  1WJC A;  3K70 D;  1UD6 A;  2HVR A;  1I8D A;  4LIU A;  3DPU A;  2XZP A;  4Y33 A;  2KL4 A;  2XF7 A;  2V1N A;  5FRO A;  4AYB A;  4GQN A;  4GRI A;  3SZG A;  2BW3 B;  2R7O A;  1IA5 A;  3BG7 A;  2ZSH B;  4CUG A;  4ZYA A;  3GQ7 A;  2VJI A;  2IS2 A;  3GVJ A;  3VSU A;  4ZC3 A;  3CZ6 A;  3VWB A;  4E6K G;  3HAG A;  3S8P A;  3KEY A;  4E7L A;  1FMW A;  2V7F A;  4JOM A;  5CDF A;  2QXZ A;  4PJN A;  2X3H A;  5C1C A;  2ELJ A;  1IDK A;  3PSI A;  3C2H A;  2WAF A;  2BVL A;  4U87 A;  4KIT B;  1FX0 A;  2AQE A;  3N05 A;  4P5O A;  3ZR8 X;  2Q1Z B;  3RPU D;  5AMV A;  3OMY A;  2A6T A;  4Y4R A;  3PJR A;  5TGT A;  1MW7 A;  4DGW B;  1DQU A;  4C2T A;  4XN0 A;  2WY8 Q;  5CPR B;  1OGO X;  3DKY A;  3LSI A;  4BAC A;  1O8D A;  2VQC A;  4XKV A;  3D5S C;  4ZDO A;  3FBI B;  1W36 C;  4PUS A;  1BR2 A;  1TT0 A;  1UG0 A;  2MC4 A;  2GOM A;  4XON A;  3S32 A;  1T5E A;  1S9H A;  4XMY A;  1PKV A;  1VZ0 A;  1LDK B;  1R6R A;  2M7B A;  1HVX A;  4W8T A;  4XR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...