3VMWA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165 in complex with trigalacturonate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
total genus 133
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmwA00
1O8DA 1KCCA 4URRA 1PLUA 1O8KA 4OZZA 1WMRA 3EQNA 4W8RA 4XMYA 2NTQA 1IB4A 2VBEA 2NSTA 4MXNA 4XLHA 2IQ7A 4Z06A 3SUCA 2O0VA 3ZSCA 4I84A 2O04A 3JURA 3EQOA 4OJLA 2QXZA 3UW0A 3ZPPA 5C1EA 4XLEA 3VSUA 2BSPA 1X0CA 4XQFA 3FY3A 4OJOA 2O17A 2QY1A 4XNFA 1IDKA 3B90A 2ODLA 4XLAA 4XN3A 4XORA 1RWRA 4EW9A 1RU4A 1NHCA 3GQAA 1DBOA 4XN0A 1IA5A 4U4BA 1BHEA 2VBKA 1O88A 1AIRA 2NT6A 4XM3A 2NT9A 1GQ8A 2NSPA 4Z05A 4XKVA 2NTPA 4YZQA 2INVA 2QX3A 2Z8GA 2O1DA 3VSTA 2EWEA 1CZFA 4YZAA 1OFLA 4YZ0A 3GRHA 4XR6A 1KTWA 4NK6A 4HWVA 4OJPA 3GQ7A 2O0WA 4YELA 1OGMX 2X3HA 2X85A 1O8LA 1QCXA 1O8MA 3GQ9A 1IDJA 1PE9A 2INUA 2X6YA 4PMHA 3GQ8A 1O8FA 3WWGA 1O8GA 1VBLA 4Z03A 1O8IA 1DBGA 4XONA 1RMGA 3VMWA 4XLCA 1O8HA 3T9GA 3B4NA 5AMVA 2UVFA 2PYHA 1QJVA 3KRGA 2VJJA 4NK8A 4U49A 1O8EA 4W8TA 4XOTA 3B8YA 1OGOX 3VSVA 2UVEA 4XL9A 2VJIA 4W8QA 4W8SA 2NZMA 5C1CA 2VBMA 3LMWA 2PECA 4XLFA 4MR0A 4XOPA 1OOCA 1PXZA 4YEJA 1KCDA 2PYGA 3VMVA 4OJ5A 2NTBA 4XKWA 1O8JA 1OFMA 1K5CA 1EE6A 2X6XA 1JRGA 4OJ6A 4YZXA 4OZYA 4AVZA 1HG8A 1H80A 4C2LA 1BN8A 1JTAA 1XG2A 2X6WA
chains in the Genus database with same CATH superfamily
1O8DA 1KCCA 1LM1A 2B0RA 4URRA 2J8KA 1PLUA 1O8KA 2BX6A 1WMRA 2XTXA 3EQNA 4OZZA 4W8RA 2NTQA 4XMYA 1LLZA 2VBEA 5JLVC 1IB4A 3AK5A 2NSTA 4MXNA 3SZEA 3N6ZA 4XLHA 4YEIA 2G0YA 1EA0A 2IQ7A 4Z06A 3SUCA 2O0VA 3ZSCA 4I84A 2O04A 3JURA 3ML3A 3EQOA 1QRCA 4OPWA 4OJLA 2QXZA 2V5IA 3UW0A 3ZPPA 5C1EA 4XLEA 3VSUA 1OFDA 2W7ZA 2BSPA 1X0CA 4XQFA 3FY3A 1OFEA 4OJOA 4YFOA 2O17A 4V02C 2QY1A 4XNFA 4YC5A 3BH7B 1TYXA 1IDKA 3B90A 2ODLA 4XLAA 2VFMA 4XN3A 1RWRA 4XORA 4EW9A 3TH0A 1RU4A 1NHCA 2J8IA 3GQAA 2BM6A 1K4ZA 1DBOA 4XN0A 1HF2A 1IA5A 4U4BA 1BHEA 2VBKA 1O88A 2IOUG 1KQ5A 1AIRA 1TYWA 2NT6A 4XM3A 2NT9A 1GQ8A 2BM7A 2NSPA 4Z05A 4XOTA 5JMCB 4XKVA 2NTPA 4YZQA 2INVA 3N90A 2QX3A 2Z8GA 4JRAC 2YUHA 2O1DA 3P4GA 1TSPA 3VSTA 1WXRA 2EWEA 1CZFA 4OM9A 4YZAA 1QA3A 3DU1X 3RIQA 3SYJA 1OFLA 1TYVA 1TYUA 4YZ0A 2VFQA 3GRHA 3PSSA 4XR6A 1KTWA 4NK6A 4HWVA 3NAWA 4OJPA 3GQ7A 2O0WA 4YELA 1OGMX 2X3HA 2X85A 4YCQA 2BM4A 1O8LA 1QCXA 3PSZA 1O8MA 2XTYA 1QRBA 3GQ9A 1IDJA 3JX8A 1PE9A 2INUA 2X6YA 4PMHA 3SQVA 2F3LA 1O8FA 3GQ8A 1O8GA 1VBLA 3WWGA 4Z03A 1O8IA 1DBGA 4XONA 1QA2A 1RMGA 3VMWA 2XTWA 4XLCA 1O8HA 3T9GA 1EZGA 1QA1A 3B4NA 5AMVA 2UVFA 1DABA 1QJVA 2PYHA 3KRGA 2VJJA 3NB2A 4NK8A 1O8EA 4U49A 4W8TA 2VFPA 3B8YA 2BM5A 2XT4A 1OGOX 1LLWA 2QYUA 3VSVA 2UVEA 3H09A 4XL9A 2XT2A 1CLWA 2VJIA 2VFNA 4W8QA 4W8SA 2NZMA 1K8FA 5DNSA 4KH3A 5C1CA 3SY2A 2VBMA 3BH6B 2PECA 3LMWA 4XLFA 4MR0A 1QQ1A 1OOCA 2QZAA 4XOPA 1PXZA 4YEJA 1KCDA 2O6WA 2PYGA 3VMVA 3LJYA 4YDTA 3PETA 4OJ5A 2NTBA 1L1IA 4XKWA 1O8JA 1OFMA 2VFOA 1EE6A 2X6XA 3LYCA 1K5CA 1JRGA 4OJ6A 4YZXA 4OZYA 2XC1A 4AVZA 1HG8A 1H80A 4C2LA 1BN8A 1JTAA 1XG2A 2X6WA
chains in the Genus database with same CATH topology
1O8DA 1KCCA 4URRA 1PLUA 1O8KA 4OZZA 1WMRA 3EQNA 4W8RA 4XMYA 2NTQA 1IB4A 2VBEA 2NSTA 4MXNA 4XLHA 2IQ7A 4Z06A 3SUCA 2O0VA 3ZSCA 4I84A 2O04A 3JURA 3EQOA 4OJLA 2QXZA 3UW0A 3ZPPA 5C1EA 4XLEA 3VSUA 2BSPA 1X0CA 4XQFA 3FY3A 4OJOA 2O17A 2QY1A 4XNFA 1IDKA 3B90A 2ODLA 4XLAA 4XN3A 4XORA 1RWRA 4EW9A 1RU4A 1NHCA 3GQAA 1DBOA 4XN0A 1IA5A 4U4BA 1BHEA 2VBKA 1O88A 1AIRA 2NT6A 4XM3A 2NT9A 1GQ8A 2NSPA 4Z05A 4XKVA 2NTPA 4YZQA 2INVA 2QX3A 2Z8GA 2O1DA 3VSTA 2EWEA 1CZFA 4YZAA 1OFLA 4YZ0A 3GRHA 4XR6A 1KTWA 4NK6A 4HWVA 4OJPA 3GQ7A 2O0WA 4YELA 1OGMX 2X3HA 2X85A 1O8LA 1QCXA 1O8MA 3GQ9A 1IDJA 1PE9A 2INUA 2X6YA 4PMHA 3GQ8A 1O8FA 3WWGA 1O8GA 1VBLA 4Z03A 1O8IA 1DBGA 4XONA 1RMGA 3VMWA 4XLCA 1O8HA 3T9GA 3B4NA 5AMVA 2UVFA 2PYHA 1QJVA 3KRGA 2VJJA 4NK8A 4U49A 1O8EA 4W8TA 4XOTA 3B8YA 1OGOX 3VSVA 2UVEA 4XL9A 2VJIA 4W8QA 4W8SA 2NZMA 5C1CA 2VBMA 3LMWA 2PECA 4XLFA 4MR0A 4XOPA 1OOCA 1PXZA 4YEJA 1KCDA 2PYGA 3VMVA 4OJ5A 2NTBA 4XKWA 1O8JA 1OFMA 1K5CA 1EE6A 2X6XA 1JRGA 4OJ6A 4YZXA 4OZYA 4AVZA 1HG8A 1H80A 4C2LA 1BN8A 1JTAA 1XG2A 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8D A;  1KCC A;  4URR A;  1PLU A;  1O8K A;  4OZZ A;  1WMR A;  3EQN A;  4W8R A;  4XMY A;  2NTQ A;  1IB4 A;  2VBE A;  2NST A;  4MXN A;  4XLH A;  2IQ7 A;  4Z06 A;  3SUC A;  2O0V A;  3ZSC A;  4I84 A;  2O04 A;  3JUR A;  3EQO A;  4OJL A;  2QXZ A;  3UW0 A;  3ZPP A;  5C1E A;  4XLE A;  3VSU A;  2BSP A;  1X0C A;  4XQF A;  3FY3 A;  4OJO A;  2O17 A;  2QY1 A;  4XNF A;  1IDK A;  3B90 A;  2ODL A;  4XLA A;  4XN3 A;  4XOR A;  1RWR A;  4EW9 A;  1RU4 A;  1NHC A;  3GQA A;  1DBO A;  4XN0 A;  1IA5 A;  4U4B A;  1BHE A;  2VBK A;  1O88 A;  1AIR A;  2NT6 A;  4XM3 A;  2NT9 A;  1GQ8 A;  2NSP A;  4Z05 A;  4XKV A;  2NTP A;  4YZQ A;  2INV A;  2QX3 A;  2Z8G A;  2O1D A;  3VST A;  2EWE A;  1CZF A;  4YZA A;  1OFL A;  4YZ0 A;  3GRH A;  4XR6 A;  1KTW A;  4NK6 A;  4HWV A;  4OJP A;  3GQ7 A;  2O0W A;  4YEL A;  1OGM X;  2X3H A;  2X85 A;  1O8L A;  1QCX A;  1O8M A;  3GQ9 A;  1IDJ A;  1PE9 A;  2INU A;  2X6Y A;  4PMH A;  3GQ8 A;  1O8F A;  3WWG A;  1O8G A;  1VBL A;  4Z03 A;  1O8I A;  1DBG A;  4XON A;  1RMG A;  3VMW A;  4XLC A;  1O8H A;  3T9G A;  3B4N A;  5AMV A;  2UVF A;  2PYH A;  1QJV A;  3KRG A;  2VJJ A;  4NK8 A;  4U49 A;  1O8E A;  4W8T A;  4XOT A;  3B8Y A;  1OGO X;  3VSV A;  2UVE A;  4XL9 A;  2VJI A;  4W8Q A;  4W8S A;  2NZM A;  5C1C A;  2VBM A;  3LMW A;  2PEC A;  4XLF A;  4MR0 A;  4XOP A;  1OOC A;  1PXZ A;  4YEJ A;  1KCD A;  2PYG A;  3VMV A;  4OJ5 A;  2NTB A;  4XKW A;  1O8J A;  1OFM A;  1K5C A;  1EE6 A;  2X6X A;  1JRG A;  4OJ6 A;  4YZX A;  4OZY A;  4AVZ A;  1HG8 A;  1H80 A;  4C2L A;  1BN8 A;  1JTA A;  1XG2 A;  2X6W A; 
#chains in the Genus database with same CATH topology
 1O8D A;  1KCC A;  1LM1 A;  2B0R A;  4URR A;  2J8K A;  1PLU A;  1O8K A;  2BX6 A;  1WMR A;  2XTX A;  3EQN A;  4OZZ A;  4W8R A;  2NTQ A;  4XMY A;  1LLZ A;  2VBE A;  5JLV C;  1IB4 A;  3AK5 A;  2NST A;  4MXN A;  3SZE A;  3N6Z A;  4XLH A;  4YEI A;  2G0Y A;  1EA0 A;  2IQ7 A;  4Z06 A;  3SUC A;  2O0V A;  3ZSC A;  4I84 A;  2O04 A;  3JUR A;  3ML3 A;  3EQO A;  1QRC A;  4OPW A;  4OJL A;  2QXZ A;  2V5I A;  3UW0 A;  3ZPP A;  5C1E A;  4XLE A;  3VSU A;  1OFD A;  2W7Z A;  2BSP A;  1X0C A;  4XQF A;  3FY3 A;  1OFE A;  4OJO A;  4YFO A;  2O17 A;  4V02 C;  2QY1 A;  4XNF A;  4YC5 A;  3BH7 B;  1TYX A;  1IDK A;  3B90 A;  2ODL A;  4XLA A;  2VFM A;  4XN3 A;  1RWR A;  4XOR A;  4EW9 A;  3TH0 A;  1RU4 A;  1NHC A;  2J8I A;  3GQA A;  2BM6 A;  1K4Z A;  1DBO A;  4XN0 A;  1HF2 A;  1IA5 A;  4U4B A;  1BHE A;  2VBK A;  1O88 A;  2IOU G;  1KQ5 A;  1AIR A;  1TYW A;  2NT6 A;  4XM3 A;  2NT9 A;  1GQ8 A;  2BM7 A;  2NSP A;  4Z05 A;  4XOT A;  5JMC B;  4XKV A;  2NTP A;  4YZQ A;  2INV A;  3N90 A;  2QX3 A;  2Z8G A;  4JRA C;  2YUH A;  2O1D A;  3P4G A;  1TSP A;  3VST A;  1WXR A;  2EWE A;  1CZF A;  4OM9 A;  4YZA A;  1QA3 A;  3DU1 X;  3RIQ A;  3SYJ A;  1OFL A;  1TYV A;  1TYU A;  4YZ0 A;  2VFQ A;  3GRH A;  3PSS A;  4XR6 A;  1KTW A;  4NK6 A;  4HWV A;  3NAW A;  4OJP A;  3GQ7 A;  2O0W A;  4YEL A;  1OGM X;  2X3H A;  2X85 A;  4YCQ A;  2BM4 A;  1O8L A;  1QCX A;  3PSZ A;  1O8M A;  2XTY A;  1QRB A;  3GQ9 A;  1IDJ A;  3JX8 A;  1PE9 A;  2INU A;  2X6Y A;  4PMH A;  3SQV A;  2F3L A;  1O8F A;  3GQ8 A;  1O8G A;  1VBL A;  3WWG A;  4Z03 A;  1O8I A;  1DBG A;  4XON A;  1QA2 A;  1RMG A;  3VMW A;  2XTW A;  4XLC A;  1O8H A;  3T9G A;  1EZG A;  1QA1 A;  3B4N A;  5AMV A;  2UVF A;  1DAB A;  1QJV A;  2PYH A;  3KRG A;  2VJJ A;  3NB2 A;  4NK8 A;  1O8E A;  4U49 A;  4W8T A;  2VFP A;  3B8Y A;  2BM5 A;  2XT4 A;  1OGO X;  1LLW A;  2QYU A;  3VSV A;  2UVE A;  3H09 A;  4XL9 A;  2XT2 A;  1CLW A;  2VJI A;  2VFN A;  4W8Q A;  4W8S A;  2NZM A;  1K8F A;  5DNS A;  4KH3 A;  5C1C A;  3SY2 A;  2VBM A;  3BH6 B;  2PEC A;  3LMW A;  4XLF A;  4MR0 A;  1QQ1 A;  1OOC A;  2QZA A;  4XOP A;  1PXZ A;  4YEJ A;  1KCD A;  2O6W A;  2PYG A;  3VMV A;  3LJY A;  4YDT A;  3PET A;  4OJ5 A;  2NTB A;  1L1I A;  4XKW A;  1O8J A;  1OFM A;  2VFO A;  1EE6 A;  2X6X A;  3LYC A;  1K5C A;  1JRG A;  4OJ6 A;  4YZX A;  4OZY A;  2XC1 A;  4AVZ A;  1HG8 A;  1H80 A;  4C2L A;  1BN8 A;  1JTA A;  1XG2 A;  2X6W A; 
#chains in the Genus database with same CATH homology
 1O8D A;  1KCC A;  4URR A;  1PLU A;  1O8K A;  4OZZ A;  1WMR A;  3EQN A;  4W8R A;  4XMY A;  2NTQ A;  1IB4 A;  2VBE A;  2NST A;  4MXN A;  4XLH A;  2IQ7 A;  4Z06 A;  3SUC A;  2O0V A;  3ZSC A;  4I84 A;  2O04 A;  3JUR A;  3EQO A;  4OJL A;  2QXZ A;  3UW0 A;  3ZPP A;  5C1E A;  4XLE A;  3VSU A;  2BSP A;  1X0C A;  4XQF A;  3FY3 A;  4OJO A;  2O17 A;  2QY1 A;  4XNF A;  1IDK A;  3B90 A;  2ODL A;  4XLA A;  4XN3 A;  4XOR A;  1RWR A;  4EW9 A;  1RU4 A;  1NHC A;  3GQA A;  1DBO A;  4XN0 A;  1IA5 A;  4U4B A;  1BHE A;  2VBK A;  1O88 A;  1AIR A;  2NT6 A;  4XM3 A;  2NT9 A;  1GQ8 A;  2NSP A;  4Z05 A;  4XKV A;  2NTP A;  4YZQ A;  2INV A;  2QX3 A;  2Z8G A;  2O1D A;  3VST A;  2EWE A;  1CZF A;  4YZA A;  1OFL A;  4YZ0 A;  3GRH A;  4XR6 A;  1KTW A;  4NK6 A;  4HWV A;  4OJP A;  3GQ7 A;  2O0W A;  4YEL A;  1OGM X;  2X3H A;  2X85 A;  1O8L A;  1QCX A;  1O8M A;  3GQ9 A;  1IDJ A;  1PE9 A;  2INU A;  2X6Y A;  4PMH A;  3GQ8 A;  1O8F A;  3WWG A;  1O8G A;  1VBL A;  4Z03 A;  1O8I A;  1DBG A;  4XON A;  1RMG A;  3VMW A;  4XLC A;  1O8H A;  3T9G A;  3B4N A;  5AMV A;  2UVF A;  2PYH A;  1QJV A;  3KRG A;  2VJJ A;  4NK8 A;  4U49 A;  1O8E A;  4W8T A;  4XOT A;  3B8Y A;  1OGO X;  3VSV A;  2UVE A;  4XL9 A;  2VJI A;  4W8Q A;  4W8S A;  2NZM A;  5C1C A;  2VBM A;  3LMW A;  2PEC A;  4XLF A;  4MR0 A;  4XOP A;  1OOC A;  1PXZ A;  4YEJ A;  1KCD A;  2PYG A;  3VMV A;  4OJ5 A;  2NTB A;  4XKW A;  1O8J A;  1OFM A;  1K5C A;  1EE6 A;  2X6X A;  1JRG A;  4OJ6 A;  4YZX A;  4OZY A;  4AVZ A;  1HG8 A;  1H80 A;  4C2L A;  1BN8 A;  1JTA A;  1XG2 A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...