3VMWA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165 in complex with trigalacturonate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
molecule tags Lyase
total genus 133
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmwA00
1RU4A 1O8MA 2NT9A 2PECA 1VBLA 4W8QA 2EWEA 2X85A 2UVEA 1K5CA 1PXZA 4OJLA 3VMWA 4XKWA 3JURA 3UW0A 2O04A 3ZPPA 4YZXA 1PLUA 4AVZA 4URRA 2QXZA 4XNFA 3VMVA 2QX3A 2X6WA 2NTPA 1JRGA 3GQ9A 3B90A 2INVA 2PYHA 2NSPA 3GQ7A 3VSUA 1XG2A 1OFMA 4EW9A 1JTAA 3GQAA 4OJ6A 5AMVA 2VBKA 4XLCA 2BSPA 3VSVA 3GQ8A 4XN0A 3T9GA 1O8LA 2PYGA 2Z8GA 4XLHA 4OZZA 4XLEA 4XORA 1O88A 1O8GA 1RMGA 3EQOA 4U49A 1KTWA 2O1DA 4PMHA 4OJPA 1O8JA 4XL9A 2VBEA 1OFLA 1BN8A 4I84A 2NZMA 1HG8A 4XOTA 4Z06A 2VJJA 4OJOA 4Z03A 2O17A 1O8IA 2X6XA 2INUA 1IA5A 4C2LA 4YEJA 1X0CA 1BHEA 3EQNA 4U4BA 1OOCA 3B8YA 1IDKA 3B4NA 4XR6A 5C1EA 2NTBA 2VJIA 1O8KA 1O8HA 3GRHA 2VBMA 5C1CA 4XLFA 3ZSCA 4MXNA 4NK6A 3LMWA 1OGMX 1QJVA 2X6YA 3FY3A 1KCDA 4HWVA 4YELA 4Z05A 4XMYA 4YZAA 2O0WA 4NK8A 4OZYA 1H80A 4W8TA 1RWRA 4MR0A 4W8RA 1DBGA 4W8SA 1GQ8A 4XOPA 4YZQA 4XQFA 1O8FA 1QCXA 4XN3A 1IB4A 2NSTA 1AIRA 1EE6A 2O0VA 2QY1A 1CZFA 1WMRA 1KCCA 4XKVA 4OJ5A 4XM3A 3KRGA 1PE9A 2UVFA 3WWGA 1DBOA 4YZ0A 1OGOX 3VSTA 2NT6A 1O8EA 2IQ7A 3SUCA 1O8DA 2NTQA 2X3HA 1IDJA 4XONA 1NHCA 4XLAA 2ODLA
chains in the Genus database with same CATH superfamily
1RU4A 1O8MA 2NT9A 3NB2A 5JLVC 2PECA 1VBLA 1QQ1A 4W8QA 2EWEA 2BM4A 2X85A 2XTXA 2UVEA 1K5CA 1PXZA 4OJLA 3VMWA 4XKWA 3JURA 3UW0A 2G0YA 3ML3A 2O04A 3ZPPA 2O6WA 4YZXA 3RIQA 1PLUA 4AVZA 2F3LA 4URRA 2QXZA 4XNFA 1QA2A 3VMVA 2QX3A 2X6WA 3N90A 2NTPA 3H09A 1JRGA 3GQ9A 3B90A 1L1IA 4YEIA 3DU1X 1QRBA 2INVA 2PYHA 4V02C 2NSPA 3GQ7A 3VSUA 2VFMA 2VFOA 1XG2A 1OFMA 4EW9A 1JTAA 1QA1A 3GQAA 4OJ6A 1LM1A 2VFNA 5AMVA 2BM6A 2VBKA 4XLCA 2BSPA 3VSVA 3GQ8A 4XN0A 1EA0A 3T9GA 3AK5A 1O8LA 2PYGA 4OPWA 1QRCA 2Z8GA 4XLHA 3BH7B 4OZZA 4XLEA 4XORA 2BX6A 3TH0A 1LLWA 1O88A 1O8GA 1RMGA 3EQOA 3JX8A 3P4GA 4U49A 1KTWA 1TSPA 2O1DA 3SYJA 4PMHA 4OJPA 1O8JA 1K8FA 4XL9A 2VBEA 1OFLA 1WXRA 4YDTA 1TYWA 1BN8A 4I84A 2B0RA 1HG8A 2NZMA 4XOTA 4Z06A 2VJJA 3LYCA 4OJOA 4KH3A 4Z03A 2IOUG 1TYUA 2O17A 2V5IA 1O8IA 2X6XA 2INUA 3LJYA 1IA5A 4C2LA 3PSZA 4YEJA 1X0CA 1BHEA 3EQNA 1QA3A 1KQ5A 1TYXA 4U4BA 1OOCA 3B8YA 4OM9A 3N6ZA 1CLWA 2XTYA 1IDKA 3B4NA 4XR6A 2XT4A 2NTBA 5C1EA 2VJIA 1HF2A 1O8KA 4YFOA 1O8HA 1LLZA 5JMCB 3PSSA 1OFDA 3GRHA 2VFPA 1K4ZA 3PETA 4JRAC 2VBMA 5C1CA 1EZGA 4XLFA 3ZSCA 4MXNA 4YCQA 2YUHA 2VFQA 3LMWA 4NK6A 1OGMX 2W7ZA 1QJVA 2X6YA 3FY3A 1TYVA 4HWVA 2XC1A 4YELA 1KCDA 4Z05A 4XMYA 4YZAA 2O0WA 1OFEA 4NK8A 4OZYA 1H80A 2BM7A 2BM5A 3BH6B 1RWRA 4MR0A 4W8TA 1DBGA 4W8SA 1GQ8A 4W8RA 4XOPA 4YZQA 4XQFA 1O8FA 1QCXA 3SZEA 4XN3A 2J8KA 1IB4A 2NSTA 1AIRA 5DNSA 1EE6A 2O0VA 2QY1A 1CZFA 2QZAA 1WMRA 3SY2A 1KCCA 4XKVA 3NAWA 4OJ5A 4XM3A 3KRGA 1PE9A 2UVFA 3WWGA 1DABA 4YC5A 1DBOA 4YZ0A 1OGOX 3VSTA 2NT6A 1O8EA 2IQ7A 3SQVA 2XT2A 2QYUA 3SUCA 2J8IA 1O8DA 2NTQA 2X3HA 1IDJA 4XONA 1NHCA 4XLAA 2XTWA 2ODLA
chains in the Genus database with same CATH topology
1RU4A 1O8MA 2NT9A 2PECA 1VBLA 4W8QA 2EWEA 2X85A 2UVEA 1K5CA 1PXZA 4OJLA 3VMWA 4XKWA 3JURA 3UW0A 2O04A 3ZPPA 4YZXA 1PLUA 4AVZA 4URRA 2QXZA 4XNFA 3VMVA 2QX3A 2X6WA 2NTPA 1JRGA 3GQ9A 3B90A 2INVA 2PYHA 2NSPA 3GQ7A 3VSUA 1XG2A 1OFMA 4EW9A 1JTAA 3GQAA 4OJ6A 5AMVA 2VBKA 4XLCA 2BSPA 3VSVA 3GQ8A 4XN0A 3T9GA 1O8LA 2PYGA 2Z8GA 4XLHA 4OZZA 4XLEA 4XORA 1O88A 1O8GA 1RMGA 3EQOA 4U49A 1KTWA 2O1DA 4PMHA 4OJPA 1O8JA 4XL9A 2VBEA 1OFLA 1BN8A 4I84A 2NZMA 1HG8A 4XOTA 4Z06A 2VJJA 4OJOA 4Z03A 2O17A 1O8IA 2X6XA 2INUA 1IA5A 4C2LA 4YEJA 1X0CA 1BHEA 3EQNA 4U4BA 1OOCA 3B8YA 1IDKA 3B4NA 4XR6A 5C1EA 2NTBA 2VJIA 1O8KA 1O8HA 3GRHA 2VBMA 5C1CA 4XLFA 3ZSCA 4MXNA 4NK6A 3LMWA 1OGMX 1QJVA 2X6YA 3FY3A 1KCDA 4HWVA 4YELA 4Z05A 4XMYA 4YZAA 2O0WA 4NK8A 4OZYA 1H80A 4W8TA 1RWRA 4MR0A 4W8RA 1DBGA 4W8SA 1GQ8A 4XOPA 4YZQA 4XQFA 1O8FA 1QCXA 4XN3A 1IB4A 2NSTA 1AIRA 1EE6A 2O0VA 2QY1A 1CZFA 1WMRA 1KCCA 4XKVA 4OJ5A 4XM3A 3KRGA 1PE9A 2UVFA 3WWGA 1DBOA 4YZ0A 1OGOX 3VSTA 2NT6A 1O8EA 2IQ7A 3SUCA 1O8DA 2NTQA 2X3HA 1IDJA 4XONA 1NHCA 4XLAA 2ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  1O8M A;  2NT9 A;  2PEC A;  1VBL A;  4W8Q A;  2EWE A;  2X85 A;  2UVE A;  1K5C A;  1PXZ A;  4OJL A;  3VMW A;  4XKW A;  3JUR A;  3UW0 A;  2O04 A;  3ZPP A;  4YZX A;  1PLU A;  4AVZ A;  4URR A;  2QXZ A;  4XNF A;  3VMV A;  2QX3 A;  2X6W A;  2NTP A;  1JRG A;  3GQ9 A;  3B90 A;  2INV A;  2PYH A;  2NSP A;  3GQ7 A;  3VSU A;  1XG2 A;  1OFM A;  4EW9 A;  1JTA A;  3GQA A;  4OJ6 A;  5AMV A;  2VBK A;  4XLC A;  2BSP A;  3VSV A;  3GQ8 A;  4XN0 A;  3T9G A;  1O8L A;  2PYG A;  2Z8G A;  4XLH A;  4OZZ A;  4XLE A;  4XOR A;  1O88 A;  1O8G A;  1RMG A;  3EQO A;  4U49 A;  1KTW A;  2O1D A;  4PMH A;  4OJP A;  1O8J A;  4XL9 A;  2VBE A;  1OFL A;  1BN8 A;  4I84 A;  2NZM A;  1HG8 A;  4XOT A;  4Z06 A;  2VJJ A;  4OJO A;  4Z03 A;  2O17 A;  1O8I A;  2X6X A;  2INU A;  1IA5 A;  4C2L A;  4YEJ A;  1X0C A;  1BHE A;  3EQN A;  4U4B A;  1OOC A;  3B8Y A;  1IDK A;  3B4N A;  4XR6 A;  5C1E A;  2NTB A;  2VJI A;  1O8K A;  1O8H A;  3GRH A;  2VBM A;  5C1C A;  4XLF A;  3ZSC A;  4MXN A;  4NK6 A;  3LMW A;  1OGM X;  1QJV A;  2X6Y A;  3FY3 A;  1KCD A;  4HWV A;  4YEL A;  4Z05 A;  4XMY A;  4YZA A;  2O0W A;  4NK8 A;  4OZY A;  1H80 A;  4W8T A;  1RWR A;  4MR0 A;  4W8R A;  1DBG A;  4W8S A;  1GQ8 A;  4XOP A;  4YZQ A;  4XQF A;  1O8F A;  1QCX A;  4XN3 A;  1IB4 A;  2NST A;  1AIR A;  1EE6 A;  2O0V A;  2QY1 A;  1CZF A;  1WMR A;  1KCC A;  4XKV A;  4OJ5 A;  4XM3 A;  3KRG A;  1PE9 A;  2UVF A;  3WWG A;  1DBO A;  4YZ0 A;  1OGO X;  3VST A;  2NT6 A;  1O8E A;  2IQ7 A;  3SUC A;  1O8D A;  2NTQ A;  2X3H A;  1IDJ A;  4XON A;  1NHC A;  4XLA A;  2ODL A; 
#chains in the Genus database with same CATH topology
 1RU4 A;  1O8M A;  2NT9 A;  3NB2 A;  5JLV C;  2PEC A;  1VBL A;  1QQ1 A;  4W8Q A;  2EWE A;  2BM4 A;  2X85 A;  2XTX A;  2UVE A;  1K5C A;  1PXZ A;  4OJL A;  3VMW A;  4XKW A;  3JUR A;  3UW0 A;  2G0Y A;  3ML3 A;  2O04 A;  3ZPP A;  2O6W A;  4YZX A;  3RIQ A;  1PLU A;  4AVZ A;  2F3L A;  4URR A;  2QXZ A;  4XNF A;  1QA2 A;  3VMV A;  2QX3 A;  2X6W A;  3N90 A;  2NTP A;  3H09 A;  1JRG A;  3GQ9 A;  3B90 A;  1L1I A;  4YEI A;  3DU1 X;  1QRB A;  2INV A;  2PYH A;  4V02 C;  2NSP A;  3GQ7 A;  3VSU A;  2VFM A;  2VFO A;  1XG2 A;  1OFM A;  4EW9 A;  1JTA A;  1QA1 A;  3GQA A;  4OJ6 A;  1LM1 A;  2VFN A;  5AMV A;  2BM6 A;  2VBK A;  4XLC A;  2BSP A;  3VSV A;  3GQ8 A;  4XN0 A;  1EA0 A;  3T9G A;  3AK5 A;  1O8L A;  2PYG A;  4OPW A;  1QRC A;  2Z8G A;  4XLH A;  3BH7 B;  4OZZ A;  4XLE A;  4XOR A;  2BX6 A;  3TH0 A;  1LLW A;  1O88 A;  1O8G A;  1RMG A;  3EQO A;  3JX8 A;  3P4G A;  4U49 A;  1KTW A;  1TSP A;  2O1D A;  3SYJ A;  4PMH A;  4OJP A;  1O8J A;  1K8F A;  4XL9 A;  2VBE A;  1OFL A;  1WXR A;  4YDT A;  1TYW A;  1BN8 A;  4I84 A;  2B0R A;  1HG8 A;  2NZM A;  4XOT A;  4Z06 A;  2VJJ A;  3LYC A;  4OJO A;  4KH3 A;  4Z03 A;  2IOU G;  1TYU A;  2O17 A;  2V5I A;  1O8I A;  2X6X A;  2INU A;  3LJY A;  1IA5 A;  4C2L A;  3PSZ A;  4YEJ A;  1X0C A;  1BHE A;  3EQN A;  1QA3 A;  1KQ5 A;  1TYX A;  4U4B A;  1OOC A;  3B8Y A;  4OM9 A;  3N6Z A;  1CLW A;  2XTY A;  1IDK A;  3B4N A;  4XR6 A;  2XT4 A;  2NTB A;  5C1E A;  2VJI A;  1HF2 A;  1O8K A;  4YFO A;  1O8H A;  1LLZ A;  5JMC B;  3PSS A;  1OFD A;  3GRH A;  2VFP A;  1K4Z A;  3PET A;  4JRA C;  2VBM A;  5C1C A;  1EZG A;  4XLF A;  3ZSC A;  4MXN A;  4YCQ A;  2YUH A;  2VFQ A;  3LMW A;  4NK6 A;  1OGM X;  2W7Z A;  1QJV A;  2X6Y A;  3FY3 A;  1TYV A;  4HWV A;  2XC1 A;  4YEL A;  1KCD A;  4Z05 A;  4XMY A;  4YZA A;  2O0W A;  1OFE A;  4NK8 A;  4OZY A;  1H80 A;  2BM7 A;  2BM5 A;  3BH6 B;  1RWR A;  4MR0 A;  4W8T A;  1DBG A;  4W8S A;  1GQ8 A;  4W8R A;  4XOP A;  4YZQ A;  4XQF A;  1O8F A;  1QCX A;  3SZE A;  4XN3 A;  2J8K A;  1IB4 A;  2NST A;  1AIR A;  5DNS A;  1EE6 A;  2O0V A;  2QY1 A;  1CZF A;  2QZA A;  1WMR A;  3SY2 A;  1KCC A;  4XKV A;  3NAW A;  4OJ5 A;  4XM3 A;  3KRG A;  1PE9 A;  2UVF A;  3WWG A;  1DAB A;  4YC5 A;  1DBO A;  4YZ0 A;  1OGO X;  3VST A;  2NT6 A;  1O8E A;  2IQ7 A;  3SQV A;  2XT2 A;  2QYU A;  3SUC A;  2J8I A;  1O8D A;  2NTQ A;  2X3H A;  1IDJ A;  4XON A;  1NHC A;  4XLA A;  2XTW A;  2ODL A; 
#chains in the Genus database with same CATH homology
 1RU4 A;  1O8M A;  2NT9 A;  2PEC A;  1VBL A;  4W8Q A;  2EWE A;  2X85 A;  2UVE A;  1K5C A;  1PXZ A;  4OJL A;  3VMW A;  4XKW A;  3JUR A;  3UW0 A;  2O04 A;  3ZPP A;  4YZX A;  1PLU A;  4AVZ A;  4URR A;  2QXZ A;  4XNF A;  3VMV A;  2QX3 A;  2X6W A;  2NTP A;  1JRG A;  3GQ9 A;  3B90 A;  2INV A;  2PYH A;  2NSP A;  3GQ7 A;  3VSU A;  1XG2 A;  1OFM A;  4EW9 A;  1JTA A;  3GQA A;  4OJ6 A;  5AMV A;  2VBK A;  4XLC A;  2BSP A;  3VSV A;  3GQ8 A;  4XN0 A;  3T9G A;  1O8L A;  2PYG A;  2Z8G A;  4XLH A;  4OZZ A;  4XLE A;  4XOR A;  1O88 A;  1O8G A;  1RMG A;  3EQO A;  4U49 A;  1KTW A;  2O1D A;  4PMH A;  4OJP A;  1O8J A;  4XL9 A;  2VBE A;  1OFL A;  1BN8 A;  4I84 A;  2NZM A;  1HG8 A;  4XOT A;  4Z06 A;  2VJJ A;  4OJO A;  4Z03 A;  2O17 A;  1O8I A;  2X6X A;  2INU A;  1IA5 A;  4C2L A;  4YEJ A;  1X0C A;  1BHE A;  3EQN A;  4U4B A;  1OOC A;  3B8Y A;  1IDK A;  3B4N A;  4XR6 A;  5C1E A;  2NTB A;  2VJI A;  1O8K A;  1O8H A;  3GRH A;  2VBM A;  5C1C A;  4XLF A;  3ZSC A;  4MXN A;  4NK6 A;  3LMW A;  1OGM X;  1QJV A;  2X6Y A;  3FY3 A;  1KCD A;  4HWV A;  4YEL A;  4Z05 A;  4XMY A;  4YZA A;  2O0W A;  4NK8 A;  4OZY A;  1H80 A;  4W8T A;  1RWR A;  4MR0 A;  4W8R A;  1DBG A;  4W8S A;  1GQ8 A;  4XOP A;  4YZQ A;  4XQF A;  1O8F A;  1QCX A;  4XN3 A;  1IB4 A;  2NST A;  1AIR A;  1EE6 A;  2O0V A;  2QY1 A;  1CZF A;  1WMR A;  1KCC A;  4XKV A;  4OJ5 A;  4XM3 A;  3KRG A;  1PE9 A;  2UVF A;  3WWG A;  1DBO A;  4YZ0 A;  1OGO X;  3VST A;  2NT6 A;  1O8E A;  2IQ7 A;  3SUC A;  1O8D A;  2NTQ A;  2X3H A;  1IDJ A;  4XON A;  1NHC A;  4XLA A;  2ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...