3VMWA

Crystal structure of pectate lyase bsp165pela from bacillus sp. n165 in complex with trigalacturonate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
324
structure length
324
Chain Sequence
GPQGYASMNGGTTGGAGGRVEYASTGAQIQQLIDNRSRSNNPDEPLTIYVNGTITQGNSPQSLIDVKNHRGKAHEIKNISIIGVGTNGEFDGIGIRLSNAHNIIIQNVSIHHVREGEGTAIEVTDDSKNVWIDHNEFYSEFPGNGDSDYYDGLVDMKRNAEYITVSWNKFENHWKTMLVGHTDNASLAPDKITYHHNYFNNLNSRVPLIRYADVHMFNNYFKDINDTAINSRVGARVFVENNYFDNVGSGQADPTTGFIKGPVGWFYGSPSTGYWNLRGNVFVNTPNSHLNSTTNFTPPYSYQVQSATQAKSSVEQHSGVGVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title Crystal structure and substrate-binding mode of a novel pectate lyase from alkaliphilic Bacillus sp. N16-5.
pubmed doi rcsb
source organism Bacillus
total genus 133
structure length 324
sequence length 324
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vmwA00
2QY1A 2VJIA 4HWVA 1O8FA 1GQ8A 1OGOX 4YELA 1RMGA 2VBKA 4MR0A 2QX3A 3GQ9A 2NSTA 4XLFA 1AIRA 4OJOA 1HG8A 1EE6A 4XLHA 1IDKA 4XORA 4C2LA 1O8HA 2VBMA 1OFLA 4XONA 4XNFA 1O8GA 1KTWA 2O1DA 1IDJA 2VJJA 2INUA 3FY3A 3EQNA 1O8EA 3VSVA 1VBLA 4MXNA 2NTPA 1CZFA 2X85A 2PYGA 4XOPA 4OJ6A 2IQ7A 3GRHA 1DBGA 2INVA 4EW9A 2Z8GA 2NTQA 4OJLA 1PLUA 4YEJA 4OJPA 1PXZA 1RU4A 1OGMX 3B4NA 2ODLA 1OFMA 3ZPPA 4XN3A 4XOTA 4XQFA 3KRGA 2NZMA 2O17A 4OZZA 2UVEA 3B90A 1PE9A 5AMVA 3VSUA 2X6YA 4PMHA 4XN0A 2O0VA 1H80A 1BN8A 1NHCA 4XM3A 2X6WA 2NTBA 1KCCA 3LMWA 2NSPA 3JURA 4W8QA 1WMRA 4W8RA 4U4BA 1O8KA 1KCDA 4I84A 4XMYA 3VMVA 3SUCA 3VMWA 1XG2A 4XKWA 4YZXA 2X3HA 1O88A 2NT6A 4URRA 1X0CA 4U49A 4YZQA 4YZAA 4YZ0A 1BHEA 3T9GA 2UVFA 3EQOA 3UW0A 2PYHA 2PECA 2QXZA 1O8LA 1O8JA 1O8DA 3GQAA 3B8YA 1JRGA 4OZYA 4W8SA 4NK6A 1QCXA 1OOCA 2NT9A 4XR6A 4OJ5A 3ZSCA 4Z05A 1JTAA 1O8IA 2X6XA 4XLCA 4W8TA 4XKVA 3GQ7A 4XLAA 5C1CA 1IB4A 4NK8A 3WWGA 5C1EA 2VBEA 4Z03A 4XL9A 4XLEA 1DBOA 2EWEA 4AVZA 2BSPA 3VSTA 2O0WA 1K5CA 1IA5A 1RWRA 3GQ8A 1QJVA 4Z06A 1O8MA 2O04A
chains in the Genus database with same CATH superfamily
2QY1A 3BH7B 2VJIA 2YUHA 3JX8A 4HWVA 1O8FA 1GQ8A 1OGOX 1OFDA 4YELA 1RMGA 2VBKA 4MR0A 2QX3A 3GQ9A 5JLVC 2NSTA 3NAWA 4XLFA 1AIRA 4OJOA 1HG8A 1EE6A 2BM7A 4XLHA 2XT2A 1IDKA 4XORA 4C2LA 1O8HA 2IOUG 2VBMA 2VFMA 1QA2A 2B0RA 1OFLA 4OPWA 4XONA 4XNFA 1WXRA 1O8GA 1HF2A 1KTWA 2O1DA 1IDJA 2VFQA 2VJJA 2INUA 3FY3A 3EQNA 4V02C 1O8EA 3VSVA 1VBLA 4MXNA 2BM5A 2NTPA 1DABA 1QA3A 4YEIA 1CZFA 2X85A 1QRBA 2PYGA 1LLZA 4XOPA 4OJ6A 1CLWA 2IQ7A 3PSZA 3SYJA 3GRHA 2BM4A 1DBGA 2INVA 3N6ZA 1QQ1A 4EW9A 2Z8GA 2NTQA 1LLWA 4OJLA 4YC5A 1PLUA 4YEJA 4OJPA 1PXZA 1RU4A 1OGMX 3B4NA 2J8KA 2ODLA 1OFMA 3ZPPA 4XN3A 4XOTA 2BX6A 4XQFA 1EZGA 1OFEA 3PETA 3KRGA 2NZMA 2O17A 4OZZA 2UVEA 3B90A 1PE9A 3P4GA 5AMVA 2QZAA 3VSUA 2X6YA 3LJYA 4PMHA 4XN0A 4YFOA 2O0VA 1H80A 1BN8A 1NHCA 1TYWA 4XM3A 2X6WA 2NTBA 2XT4A 3LMWA 2NSPA 3H09A 1KCCA 2QYUA 3JURA 4W8QA 3NB2A 1WMRA 4W8RA 2J8IA 4U4BA 1O8KA 4OM9A 5JMCB 1KCDA 1K8FA 4I84A 4XMYA 3VMVA 3SUCA 3VMWA 1QRCA 3SQVA 3ML3A 3SZEA 3LYCA 1XG2A 3RIQA 1TYUA 2XTYA 4XKWA 4YZXA 1TYXA 2VFNA 2X3HA 1O88A 2NT6A 4URRA 1X0CA 4U49A 4YZQA 4YZAA 1TYVA 4JRAC 4YZ0A 1BHEA 2VFPA 2VFOA 4YDTA 3DU1X 3T9GA 2UVFA 3EQOA 3UW0A 2PYHA 1QA1A 2PECA 2QXZA 1O8LA 1EA0A 1O8JA 1O8DA 3GQAA 2O6WA 3B8YA 1JRGA 3N90A 1TSPA 4OZYA 2XC1A 4W8SA 1LM1A 4NK6A 1QCXA 1OOCA 2NT9A 3PSSA 5DNSA 4XR6A 3TH0A 4OJ5A 3ZSCA 4Z05A 1JTAA 3AK5A 1O8IA 4YCQA 3BH6B 2X6XA 4XLCA 4W8TA 4XKVA 3GQ7A 1K4ZA 1KQ5A 4XLAA 1L1IA 5C1CA 2V5IA 1IB4A 4NK8A 2XTWA 5C1EA 3WWGA 2VBEA 4Z03A 4XL9A 4KH3A 4XLEA 1DBOA 2BM6A 2EWEA 2G0YA 2BSPA 2W7ZA 2XTXA 2O0WA 3VSTA 4AVZA 1IA5A 1K5CA 2F3LA 1RWRA 3GQ8A 1QJVA 4Z06A 3SY2A 1O8MA 2O04A
chains in the Genus database with same CATH topology
2QY1A 2VJIA 4HWVA 1O8FA 1GQ8A 1OGOX 4YELA 1RMGA 2VBKA 4MR0A 2QX3A 3GQ9A 2NSTA 4XLFA 1AIRA 4OJOA 1HG8A 1EE6A 4XLHA 1IDKA 4XORA 4C2LA 1O8HA 2VBMA 1OFLA 4XONA 4XNFA 1O8GA 1KTWA 2O1DA 1IDJA 2VJJA 2INUA 3FY3A 3EQNA 1O8EA 3VSVA 1VBLA 4MXNA 2NTPA 1CZFA 2X85A 2PYGA 4XOPA 4OJ6A 2IQ7A 3GRHA 1DBGA 2INVA 4EW9A 2Z8GA 2NTQA 4OJLA 1PLUA 4YEJA 4OJPA 1PXZA 1RU4A 1OGMX 3B4NA 2ODLA 1OFMA 3ZPPA 4XN3A 4XOTA 4XQFA 3KRGA 2NZMA 2O17A 4OZZA 2UVEA 3B90A 1PE9A 5AMVA 3VSUA 2X6YA 4PMHA 4XN0A 2O0VA 1H80A 1BN8A 1NHCA 4XM3A 2X6WA 2NTBA 1KCCA 3LMWA 2NSPA 3JURA 4W8QA 1WMRA 4W8RA 4U4BA 1O8KA 1KCDA 4I84A 4XMYA 3VMVA 3SUCA 3VMWA 1XG2A 4XKWA 4YZXA 2X3HA 1O88A 2NT6A 4URRA 1X0CA 4U49A 4YZQA 4YZAA 4YZ0A 1BHEA 3T9GA 2UVFA 3EQOA 3UW0A 2PYHA 2PECA 2QXZA 1O8LA 1O8JA 1O8DA 3GQAA 3B8YA 1JRGA 4OZYA 4W8SA 4NK6A 1QCXA 1OOCA 2NT9A 4XR6A 4OJ5A 3ZSCA 4Z05A 1JTAA 1O8IA 2X6XA 4XLCA 4W8TA 4XKVA 3GQ7A 4XLAA 5C1CA 1IB4A 4NK8A 3WWGA 5C1EA 2VBEA 4Z03A 4XL9A 4XLEA 1DBOA 2EWEA 4AVZA 2BSPA 3VSTA 2O0WA 1K5CA 1IA5A 1RWRA 3GQ8A 1QJVA 4Z06A 1O8MA 2O04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QY1 A;  2VJI A;  4HWV A;  1O8F A;  1GQ8 A;  1OGO X;  4YEL A;  1RMG A;  2VBK A;  4MR0 A;  2QX3 A;  3GQ9 A;  2NST A;  4XLF A;  1AIR A;  4OJO A;  1HG8 A;  1EE6 A;  4XLH A;  1IDK A;  4XOR A;  4C2L A;  1O8H A;  2VBM A;  1OFL A;  4XON A;  4XNF A;  1O8G A;  1KTW A;  2O1D A;  1IDJ A;  2VJJ A;  2INU A;  3FY3 A;  3EQN A;  1O8E A;  3VSV A;  1VBL A;  4MXN A;  2NTP A;  1CZF A;  2X85 A;  2PYG A;  4XOP A;  4OJ6 A;  2IQ7 A;  3GRH A;  1DBG A;  2INV A;  4EW9 A;  2Z8G A;  2NTQ A;  4OJL A;  1PLU A;  4YEJ A;  4OJP A;  1PXZ A;  1RU4 A;  1OGM X;  3B4N A;  2ODL A;  1OFM A;  3ZPP A;  4XN3 A;  4XOT A;  4XQF A;  3KRG A;  2NZM A;  2O17 A;  4OZZ A;  2UVE A;  3B90 A;  1PE9 A;  5AMV A;  3VSU A;  2X6Y A;  4PMH A;  4XN0 A;  2O0V A;  1H80 A;  1BN8 A;  1NHC A;  4XM3 A;  2X6W A;  2NTB A;  1KCC A;  3LMW A;  2NSP A;  3JUR A;  4W8Q A;  1WMR A;  4W8R A;  4U4B A;  1O8K A;  1KCD A;  4I84 A;  4XMY A;  3VMV A;  3SUC A;  3VMW A;  1XG2 A;  4XKW A;  4YZX A;  2X3H A;  1O88 A;  2NT6 A;  4URR A;  1X0C A;  4U49 A;  4YZQ A;  4YZA A;  4YZ0 A;  1BHE A;  3T9G A;  2UVF A;  3EQO A;  3UW0 A;  2PYH A;  2PEC A;  2QXZ A;  1O8L A;  1O8J A;  1O8D A;  3GQA A;  3B8Y A;  1JRG A;  4OZY A;  4W8S A;  4NK6 A;  1QCX A;  1OOC A;  2NT9 A;  4XR6 A;  4OJ5 A;  3ZSC A;  4Z05 A;  1JTA A;  1O8I A;  2X6X A;  4XLC A;  4W8T A;  4XKV A;  3GQ7 A;  4XLA A;  5C1C A;  1IB4 A;  4NK8 A;  3WWG A;  5C1E A;  2VBE A;  4Z03 A;  4XL9 A;  4XLE A;  1DBO A;  2EWE A;  4AVZ A;  2BSP A;  3VST A;  2O0W A;  1K5C A;  1IA5 A;  1RWR A;  3GQ8 A;  1QJV A;  4Z06 A;  1O8M A;  2O04 A; 
#chains in the Genus database with same CATH topology
 2QY1 A;  3BH7 B;  2VJI A;  2YUH A;  3JX8 A;  4HWV A;  1O8F A;  1GQ8 A;  1OGO X;  1OFD A;  4YEL A;  1RMG A;  2VBK A;  4MR0 A;  2QX3 A;  3GQ9 A;  5JLV C;  2NST A;  3NAW A;  4XLF A;  1AIR A;  4OJO A;  1HG8 A;  1EE6 A;  2BM7 A;  4XLH A;  2XT2 A;  1IDK A;  4XOR A;  4C2L A;  1O8H A;  2IOU G;  2VBM A;  2VFM A;  1QA2 A;  2B0R A;  1OFL A;  4OPW A;  4XON A;  4XNF A;  1WXR A;  1O8G A;  1HF2 A;  1KTW A;  2O1D A;  1IDJ A;  2VFQ A;  2VJJ A;  2INU A;  3FY3 A;  3EQN A;  4V02 C;  1O8E A;  3VSV A;  1VBL A;  4MXN A;  2BM5 A;  2NTP A;  1DAB A;  1QA3 A;  4YEI A;  1CZF A;  2X85 A;  1QRB A;  2PYG A;  1LLZ A;  4XOP A;  4OJ6 A;  1CLW A;  2IQ7 A;  3PSZ A;  3SYJ A;  3GRH A;  2BM4 A;  1DBG A;  2INV A;  3N6Z A;  1QQ1 A;  4EW9 A;  2Z8G A;  2NTQ A;  1LLW A;  4OJL A;  4YC5 A;  1PLU A;  4YEJ A;  4OJP A;  1PXZ A;  1RU4 A;  1OGM X;  3B4N A;  2J8K A;  2ODL A;  1OFM A;  3ZPP A;  4XN3 A;  4XOT A;  2BX6 A;  4XQF A;  1EZG A;  1OFE A;  3PET A;  3KRG A;  2NZM A;  2O17 A;  4OZZ A;  2UVE A;  3B90 A;  1PE9 A;  3P4G A;  5AMV A;  2QZA A;  3VSU A;  2X6Y A;  3LJY A;  4PMH A;  4XN0 A;  4YFO A;  2O0V A;  1H80 A;  1BN8 A;  1NHC A;  1TYW A;  4XM3 A;  2X6W A;  2NTB A;  2XT4 A;  3LMW A;  2NSP A;  3H09 A;  1KCC A;  2QYU A;  3JUR A;  4W8Q A;  3NB2 A;  1WMR A;  4W8R A;  2J8I A;  4U4B A;  1O8K A;  4OM9 A;  5JMC B;  1KCD A;  1K8F A;  4I84 A;  4XMY A;  3VMV A;  3SUC A;  3VMW A;  1QRC A;  3SQV A;  3ML3 A;  3SZE A;  3LYC A;  1XG2 A;  3RIQ A;  1TYU A;  2XTY A;  4XKW A;  4YZX A;  1TYX A;  2VFN A;  2X3H A;  1O88 A;  2NT6 A;  4URR A;  1X0C A;  4U49 A;  4YZQ A;  4YZA A;  1TYV A;  4JRA C;  4YZ0 A;  1BHE A;  2VFP A;  2VFO A;  4YDT A;  3DU1 X;  3T9G A;  2UVF A;  3EQO A;  3UW0 A;  2PYH A;  1QA1 A;  2PEC A;  2QXZ A;  1O8L A;  1EA0 A;  1O8J A;  1O8D A;  3GQA A;  2O6W A;  3B8Y A;  1JRG A;  3N90 A;  1TSP A;  4OZY A;  2XC1 A;  4W8S A;  1LM1 A;  4NK6 A;  1QCX A;  1OOC A;  2NT9 A;  3PSS A;  5DNS A;  4XR6 A;  3TH0 A;  4OJ5 A;  3ZSC A;  4Z05 A;  1JTA A;  3AK5 A;  1O8I A;  4YCQ A;  3BH6 B;  2X6X A;  4XLC A;  4W8T A;  4XKV A;  3GQ7 A;  1K4Z A;  1KQ5 A;  4XLA A;  1L1I A;  5C1C A;  2V5I A;  1IB4 A;  4NK8 A;  2XTW A;  5C1E A;  3WWG A;  2VBE A;  4Z03 A;  4XL9 A;  4KH3 A;  4XLE A;  1DBO A;  2BM6 A;  2EWE A;  2G0Y A;  2BSP A;  2W7Z A;  2XTX A;  2O0W A;  3VST A;  4AVZ A;  1IA5 A;  1K5C A;  2F3L A;  1RWR A;  3GQ8 A;  1QJV A;  4Z06 A;  3SY2 A;  1O8M A;  2O04 A; 
#chains in the Genus database with same CATH homology
 2QY1 A;  2VJI A;  4HWV A;  1O8F A;  1GQ8 A;  1OGO X;  4YEL A;  1RMG A;  2VBK A;  4MR0 A;  2QX3 A;  3GQ9 A;  2NST A;  4XLF A;  1AIR A;  4OJO A;  1HG8 A;  1EE6 A;  4XLH A;  1IDK A;  4XOR A;  4C2L A;  1O8H A;  2VBM A;  1OFL A;  4XON A;  4XNF A;  1O8G A;  1KTW A;  2O1D A;  1IDJ A;  2VJJ A;  2INU A;  3FY3 A;  3EQN A;  1O8E A;  3VSV A;  1VBL A;  4MXN A;  2NTP A;  1CZF A;  2X85 A;  2PYG A;  4XOP A;  4OJ6 A;  2IQ7 A;  3GRH A;  1DBG A;  2INV A;  4EW9 A;  2Z8G A;  2NTQ A;  4OJL A;  1PLU A;  4YEJ A;  4OJP A;  1PXZ A;  1RU4 A;  1OGM X;  3B4N A;  2ODL A;  1OFM A;  3ZPP A;  4XN3 A;  4XOT A;  4XQF A;  3KRG A;  2NZM A;  2O17 A;  4OZZ A;  2UVE A;  3B90 A;  1PE9 A;  5AMV A;  3VSU A;  2X6Y A;  4PMH A;  4XN0 A;  2O0V A;  1H80 A;  1BN8 A;  1NHC A;  4XM3 A;  2X6W A;  2NTB A;  1KCC A;  3LMW A;  2NSP A;  3JUR A;  4W8Q A;  1WMR A;  4W8R A;  4U4B A;  1O8K A;  1KCD A;  4I84 A;  4XMY A;  3VMV A;  3SUC A;  3VMW A;  1XG2 A;  4XKW A;  4YZX A;  2X3H A;  1O88 A;  2NT6 A;  4URR A;  1X0C A;  4U49 A;  4YZQ A;  4YZA A;  4YZ0 A;  1BHE A;  3T9G A;  2UVF A;  3EQO A;  3UW0 A;  2PYH A;  2PEC A;  2QXZ A;  1O8L A;  1O8J A;  1O8D A;  3GQA A;  3B8Y A;  1JRG A;  4OZY A;  4W8S A;  4NK6 A;  1QCX A;  1OOC A;  2NT9 A;  4XR6 A;  4OJ5 A;  3ZSC A;  4Z05 A;  1JTA A;  1O8I A;  2X6X A;  4XLC A;  4W8T A;  4XKV A;  3GQ7 A;  4XLA A;  5C1C A;  1IB4 A;  4NK8 A;  3WWG A;  5C1E A;  2VBE A;  4Z03 A;  4XL9 A;  4XLE A;  1DBO A;  2EWE A;  4AVZ A;  2BSP A;  3VST A;  2O0W A;  1K5C A;  1IA5 A;  1RWR A;  3GQ8 A;  1QJV A;  4Z06 A;  1O8M A;  2O04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...