4YEIA

Beta1mut synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDASLHGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta1mut
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
total genus 97
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yeiA00
4YCQA 2QYUA 3SY2A 3PSZA 2QZAA 2XTXA 2XTWA 3DU1X 3NB2A 2XTYA 5DNSA 2XT2A 4YFOA 3NAWA 2XT4A 4YDTA 3SQVA 2J8KA 3PSSA 2O6WA 4YEIA 4YC5A
chains in the Genus database with same CATH superfamily
4Z05A 1NHCA 3VSUA 3ML3A 4EW9A 1WMRA 1TYVA 2V5IA 2XTXA 3GQ8A 2VFNA 2XTWA 4W8RA 1K5CA 3DU1X 4XLAA 3NB2A 1O8DA 4NK6A 1L1IA 1OGOX 1QRCA 4OJPA 4V02C 4XM3A 2BSPA 2F3LA 2QY1A 4YFOA 3RIQA 1HF2A 3SYJA 2X85A 1LLWA 1QCXA 3JX8A 4MR0A 1KCDA 1LM1A 2VBKA 2INVA 2W7ZA 1O8FA 1O8GA 1PXZA 3WWGA 2NTBA 4YZ0A 1O8MA 2B0RA 4Z03A 4YC5A 2NZMA 2VFOA 1AIRA 2YUHA 4YCQA 2ODLA 1O8HA 3GQAA 2QYUA 4PMHA 2O1DA 4U49A 1OGMX 4NK8A 2BM7A 1OFLA 2BX6A 1TYWA 3PSZA 1KQ5A 4YZXA 3VSVA 1K4ZA 1VBLA 3BH6B 3BH7B 2QX3A 1XG2A 5AMVA 2PYHA 3B8YA 4U4BA 1DBGA 1HG8A 4MXNA 2X3HA 3LMWA 1KCCA 2INUA 4XR6A 1KTWA 4OJOA 1PE9A 2X6WA 3T9GA 3ZSCA 1X0CA 2VBMA 2EWEA 2BM5A 2IQ7A 2XT4A 4OM9A 2J8IA 1BN8A 1QQ1A 4OJ5A 1QA2A 2NTQA 1OFDA 4OJ6A 2UVEA 1GQ8A 4XOPA 1K8FA 1CLWA 4W8TA 4YEJA 4YELA 4XLEA 3JURA 1QA1A 1RWRA 2O0VA 3PETA 3KRGA 4W8QA 3SY2A 4XQFA 4YZAA 2NT6A 1JTAA 3UW0A 1RU4A 4I84A 3LJYA 4XKWA 4URRA 1WXRA 1OFMA 2NSTA 2O04A 1EZGA 3P4GA 3GRHA 1IDKA 3GQ7A 2Z8GA 1O88A 4XL9A 5DNSA 3AK5A 1BHEA 1H80A 2O17A 1RMGA 4Z06A 3ZPPA 4XNFA 2NT9A 3N90A 1O8IA 3GQ9A 5JLVC 2VFMA 3EQNA 3NAWA 2G0YA 2IOUG 4XLHA 3SUCA 1O8EA 2VFPA 5JMCB 4XOTA 1PLUA 2UVFA 2VJIA 2J8KA 2X6XA 4OZYA 4YDTA 1DBOA 1LLZA 1OFEA 4YEIA 4W8SA 1QA3A 5C1CA 1OOCA 4XKVA 4XORA 3FY3A 4OJLA 4XMYA 2PYGA 3VMVA 3VSTA 1IA5A 1EA0A 1O8KA 5C1EA 2QZAA 2VJJA 4XLCA 4XN3A 1O8LA 1QJVA 2NTPA 3B4NA 2VFQA 4OPWA 3TH0A 1CZFA 3LYCA 3SZEA 4KH3A 1QRBA 2NSPA 4C2LA 2XTYA 1TSPA 3N6ZA 2XT2A 3H09A 4AVZA 1IDJA 3EQOA 3VMWA 2X6YA 4HWVA 2PECA 1TYXA 2BM4A 4OZZA 4XLFA 4XN0A 2VBEA 4JRAC 1JRGA 2QXZA 4XONA 1EE6A 1O8JA 2O0WA 3SQVA 3PSSA 3B90A 2O6WA 2XC1A 1DABA 1IB4A 2BM6A 1TYUA 4YZQA
chains in the Genus database with same CATH topology
4YCQA 2QYUA 3SY2A 3PSZA 2QZAA 2XTXA 2XTWA 3DU1X 3NB2A 2XTYA 5DNSA 2XT2A 4YFOA 3NAWA 2XT4A 4YDTA 3SQVA 2J8KA 3PSSA 2O6WA 4YEIA 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCQ A;  2QYU A;  3SY2 A;  3PSZ A;  2QZA A;  2XTX A;  2XTW A;  3DU1 X;  3NB2 A;  2XTY A;  5DNS A;  2XT2 A;  4YFO A;  3NAW A;  2XT4 A;  4YDT A;  3SQV A;  2J8K A;  3PSS A;  2O6W A;  4YEI A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 4Z05 A;  1NHC A;  3VSU A;  3ML3 A;  4EW9 A;  1WMR A;  1TYV A;  2V5I A;  2XTX A;  3GQ8 A;  2VFN A;  2XTW A;  4W8R A;  1K5C A;  3DU1 X;  4XLA A;  3NB2 A;  1O8D A;  4NK6 A;  1L1I A;  1OGO X;  1QRC A;  4OJP A;  4V02 C;  4XM3 A;  2BSP A;  2F3L A;  2QY1 A;  4YFO A;  3RIQ A;  1HF2 A;  3SYJ A;  2X85 A;  1LLW A;  1QCX A;  3JX8 A;  4MR0 A;  1KCD A;  1LM1 A;  2VBK A;  2INV A;  2W7Z A;  1O8F A;  1O8G A;  1PXZ A;  3WWG A;  2NTB A;  4YZ0 A;  1O8M A;  2B0R A;  4Z03 A;  4YC5 A;  2NZM A;  2VFO A;  1AIR A;  2YUH A;  4YCQ A;  2ODL A;  1O8H A;  3GQA A;  2QYU A;  4PMH A;  2O1D A;  4U49 A;  1OGM X;  4NK8 A;  2BM7 A;  1OFL A;  2BX6 A;  1TYW A;  3PSZ A;  1KQ5 A;  4YZX A;  3VSV A;  1K4Z A;  1VBL A;  3BH6 B;  3BH7 B;  2QX3 A;  1XG2 A;  5AMV A;  2PYH A;  3B8Y A;  4U4B A;  1DBG A;  1HG8 A;  4MXN A;  2X3H A;  3LMW A;  1KCC A;  2INU A;  4XR6 A;  1KTW A;  4OJO A;  1PE9 A;  2X6W A;  3T9G A;  3ZSC A;  1X0C A;  2VBM A;  2EWE A;  2BM5 A;  2IQ7 A;  2XT4 A;  4OM9 A;  2J8I A;  1BN8 A;  1QQ1 A;  4OJ5 A;  1QA2 A;  2NTQ A;  1OFD A;  4OJ6 A;  2UVE A;  1GQ8 A;  4XOP A;  1K8F A;  1CLW A;  4W8T A;  4YEJ A;  4YEL A;  4XLE A;  3JUR A;  1QA1 A;  1RWR A;  2O0V A;  3PET A;  3KRG A;  4W8Q A;  3SY2 A;  4XQF A;  4YZA A;  2NT6 A;  1JTA A;  3UW0 A;  1RU4 A;  4I84 A;  3LJY A;  4XKW A;  4URR A;  1WXR A;  1OFM A;  2NST A;  2O04 A;  1EZG A;  3P4G A;  3GRH A;  1IDK A;  3GQ7 A;  2Z8G A;  1O88 A;  4XL9 A;  5DNS A;  3AK5 A;  1BHE A;  1H80 A;  2O17 A;  1RMG A;  4Z06 A;  3ZPP A;  4XNF A;  2NT9 A;  3N90 A;  1O8I A;  3GQ9 A;  5JLV C;  2VFM A;  3EQN A;  3NAW A;  2G0Y A;  2IOU G;  4XLH A;  3SUC A;  1O8E A;  2VFP A;  5JMC B;  4XOT A;  1PLU A;  2UVF A;  2VJI A;  2J8K A;  2X6X A;  4OZY A;  4YDT A;  1DBO A;  1LLZ A;  1OFE A;  4YEI A;  4W8S A;  1QA3 A;  5C1C A;  1OOC A;  4XKV A;  4XOR A;  3FY3 A;  4OJL A;  4XMY A;  2PYG A;  3VMV A;  3VST A;  1IA5 A;  1EA0 A;  1O8K A;  5C1E A;  2QZA A;  2VJJ A;  4XLC A;  4XN3 A;  1O8L A;  1QJV A;  2NTP A;  3B4N A;  2VFQ A;  4OPW A;  3TH0 A;  1CZF A;  3LYC A;  3SZE A;  4KH3 A;  1QRB A;  2NSP A;  4C2L A;  2XTY A;  1TSP A;  3N6Z A;  2XT2 A;  3H09 A;  4AVZ A;  1IDJ A;  3EQO A;  3VMW A;  2X6Y A;  4HWV A;  2PEC A;  1TYX A;  2BM4 A;  4OZZ A;  4XLF A;  4XN0 A;  2VBE A;  4JRA C;  1JRG A;  2QXZ A;  4XON A;  1EE6 A;  1O8J A;  2O0W A;  3SQV A;  3PSS A;  3B90 A;  2O6W A;  2XC1 A;  1DAB A;  1IB4 A;  2BM6 A;  1TYU A;  4YZQ A; 
#chains in the Genus database with same CATH homology
 4YCQ A;  2QYU A;  3SY2 A;  3PSZ A;  2QZA A;  2XTX A;  2XTW A;  3DU1 X;  3NB2 A;  2XTY A;  5DNS A;  2XT2 A;  4YFO A;  3NAW A;  2XT4 A;  4YDT A;  3SQV A;  2J8K A;  3PSS A;  2O6W A;  4YEI A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...