4YEIA

Beta1mut synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDASLHGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1mut
total genus 97
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yeiA00
3NAWA 3PSSA 4YFOA 2XTWA 3SY2A 2QYUA 2XT2A 2O6WA 3DU1X 2XTXA 3NB2A 2XTYA 4YCQA 2J8KA 2QZAA 4YEIA 4YC5A 3PSZA 3SQVA 4YDTA 5DNSA 2XT4A
chains in the Genus database with same CATH superfamily
1OFEA 2VFPA 1IDJA 3B90A 1K4ZA 2NSPA 2VJIA 2J8IA 1EA0A 2O1DA 1XG2A 2VBMA 1EZGA 2QXZA 4JRAC 3SY2A 1VBLA 4NK6A 1AIRA 1RWRA 1IDKA 2O6WA 4MR0A 3H09A 2UVEA 4XORA 2VFOA 1DABA 2PECA 1O8MA 1L1IA 2X6WA 1QA1A 3BH6B 1O8HA 3SYJA 4YELA 4OPWA 3SUCA 4W8RA 2VBEA 3AK5A 1LLZA 4XLAA 1IB4A 2UVFA 4W8SA 4Z06A 4OJPA 1PLUA 4XNFA 3UW0A 3T9GA 4XL9A 1TYVA 1QRBA 4EW9A 1TYUA 4W8TA 3KRGA 2IQ7A 4I84A 1O88A 1LLWA 2XT4A 3LYCA 5DNSA 3NAWA 5AMVA 1O8GA 2BM7A 1O8IA 1RU4A 1H80A 3P4GA 1KCCA 1TYXA 3ZPPA 1KCDA 1TYWA 1OFMA 2V5IA 3JURA 2W7ZA 2XT2A 5JMCB 1OFLA 2IOUG 2BX6A 1PXZA 2QX3A 4MXNA 4XN0A 2X3HA 5JLVC 1HG8A 4XONA 3N6ZA 2BM6A 3TH0A 1JTAA 3PETA 4XLFA 3SZEA 2NZMA 1RMGA 1DBGA 4YZXA 2X6XA 4HWVA 2QY1A 2J8KA 3EQNA 3LJYA 3VSUA 3VSTA 4XLEA 2QZAA 1O8DA 1CZFA 4URRA 1OGOX 1O8FA 2INVA 3PSZA 3SQVA 1JRGA 1TSPA 2Z8GA 4XOPA 3VSVA 4YZ0A 3PSSA 4U4BA 1IA5A 2NT6A 1K5CA 4OJLA 1K8FA 4YFOA 2NTQA 2XTWA 3ML3A 4C2LA 3GRHA 1QA2A 1KTWA 1O8JA 2QYUA 3DU1X 3FY3A 4XKWA 2XTXA 2BM4A 2INUA 2X6YA 2BSPA 2X85A 3NB2A 4XLHA 4XM3A 1HF2A 2NTPA 4XMYA 4OJ6A 4V02C 2VBKA 1X0CA 2VJJA 3N90A 3EQOA 2XTYA 4YCQA 1QQ1A 3GQ9A 2BM5A 4XQFA 4OZYA 1WXRA 4YZQA 4XR6A 1NHCA 4XLCA 2ODLA 3BH7B 4W8QA 1O8EA 1OOCA 4OJOA 3VMWA 1BN8A 1GQ8A 5C1CA 3GQ8A 2NT9A 4YEJA 3VMVA 4OM9A 1BHEA 3ZSCA 2O04A 2B0RA 3WWGA 3B4NA 2NSTA 2EWEA 4XKVA 2YUHA 1WMRA 2O17A 1QRCA 3RIQA 3B8YA 4NK8A 2VFNA 1KQ5A 1LM1A 4U49A 1QJVA 1O8KA 1OFDA 2PYGA 4YZAA 1PE9A 5C1EA 2F3LA 4XOTA 1DBOA 2VFMA 3GQAA 2XC1A 3JX8A 1EE6A 2VFQA 1OGMX 1QCXA 2O0WA 3LMWA 1O8LA 4YEIA 1QA3A 2PYHA 4Z05A 4OZZA 4OJ5A 4XN3A 1CLWA 3GQ7A 2G0YA 4YC5A 2O0VA 4Z03A 4AVZA 4YDTA 4PMHA 2NTBA 4KH3A
chains in the Genus database with same CATH topology
3NAWA 3PSSA 4YFOA 2XTWA 3SY2A 2QYUA 2XT2A 2O6WA 3DU1X 2XTXA 3NB2A 2XTYA 4YCQA 2J8KA 2QZAA 4YEIA 4YC5A 3PSZA 3SQVA 4YDTA 5DNSA 2XT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NAW A;  3PSS A;  4YFO A;  2XTW A;  3SY2 A;  2QYU A;  2XT2 A;  2O6W A;  3DU1 X;  2XTX A;  3NB2 A;  2XTY A;  4YCQ A;  2J8K A;  2QZA A;  4YEI A;  4YC5 A;  3PSZ A;  3SQV A;  4YDT A;  5DNS A;  2XT4 A; 
#chains in the Genus database with same CATH topology
 1OFE A;  2VFP A;  1IDJ A;  3B90 A;  1K4Z A;  2NSP A;  2VJI A;  2J8I A;  1EA0 A;  2O1D A;  1XG2 A;  2VBM A;  1EZG A;  2QXZ A;  4JRA C;  3SY2 A;  1VBL A;  4NK6 A;  1AIR A;  1RWR A;  1IDK A;  2O6W A;  4MR0 A;  3H09 A;  2UVE A;  4XOR A;  2VFO A;  1DAB A;  2PEC A;  1O8M A;  1L1I A;  2X6W A;  1QA1 A;  3BH6 B;  1O8H A;  3SYJ A;  4YEL A;  4OPW A;  3SUC A;  4W8R A;  2VBE A;  3AK5 A;  1LLZ A;  4XLA A;  1IB4 A;  2UVF A;  4W8S A;  4Z06 A;  4OJP A;  1PLU A;  4XNF A;  3UW0 A;  3T9G A;  4XL9 A;  1TYV A;  1QRB A;  4EW9 A;  1TYU A;  4W8T A;  3KRG A;  2IQ7 A;  4I84 A;  1O88 A;  1LLW A;  2XT4 A;  3LYC A;  5DNS A;  3NAW A;  5AMV A;  1O8G A;  2BM7 A;  1O8I A;  1RU4 A;  1H80 A;  3P4G A;  1KCC A;  1TYX A;  3ZPP A;  1KCD A;  1TYW A;  1OFM A;  2V5I A;  3JUR A;  2W7Z A;  2XT2 A;  5JMC B;  1OFL A;  2IOU G;  2BX6 A;  1PXZ A;  2QX3 A;  4MXN A;  4XN0 A;  2X3H A;  5JLV C;  1HG8 A;  4XON A;  3N6Z A;  2BM6 A;  3TH0 A;  1JTA A;  3PET A;  4XLF A;  3SZE A;  2NZM A;  1RMG A;  1DBG A;  4YZX A;  2X6X A;  4HWV A;  2QY1 A;  2J8K A;  3EQN A;  3LJY A;  3VSU A;  3VST A;  4XLE A;  2QZA A;  1O8D A;  1CZF A;  4URR A;  1OGO X;  1O8F A;  2INV A;  3PSZ A;  3SQV A;  1JRG A;  1TSP A;  2Z8G A;  4XOP A;  3VSV A;  4YZ0 A;  3PSS A;  4U4B A;  1IA5 A;  2NT6 A;  1K5C A;  4OJL A;  1K8F A;  4YFO A;  2NTQ A;  2XTW A;  3ML3 A;  4C2L A;  3GRH A;  1QA2 A;  1KTW A;  1O8J A;  2QYU A;  3DU1 X;  3FY3 A;  4XKW A;  2XTX A;  2BM4 A;  2INU A;  2X6Y A;  2BSP A;  2X85 A;  3NB2 A;  4XLH A;  4XM3 A;  1HF2 A;  2NTP A;  4XMY A;  4OJ6 A;  4V02 C;  2VBK A;  1X0C A;  2VJJ A;  3N90 A;  3EQO A;  2XTY A;  4YCQ A;  1QQ1 A;  3GQ9 A;  2BM5 A;  4XQF A;  4OZY A;  1WXR A;  4YZQ A;  4XR6 A;  1NHC A;  4XLC A;  2ODL A;  3BH7 B;  4W8Q A;  1O8E A;  1OOC A;  4OJO A;  3VMW A;  1BN8 A;  1GQ8 A;  5C1C A;  3GQ8 A;  2NT9 A;  4YEJ A;  3VMV A;  4OM9 A;  1BHE A;  3ZSC A;  2O04 A;  2B0R A;  3WWG A;  3B4N A;  2NST A;  2EWE A;  4XKV A;  2YUH A;  1WMR A;  2O17 A;  1QRC A;  3RIQ A;  3B8Y A;  4NK8 A;  2VFN A;  1KQ5 A;  1LM1 A;  4U49 A;  1QJV A;  1O8K A;  1OFD A;  2PYG A;  4YZA A;  1PE9 A;  5C1E A;  2F3L A;  4XOT A;  1DBO A;  2VFM A;  3GQA A;  2XC1 A;  3JX8 A;  1EE6 A;  2VFQ A;  1OGM X;  1QCX A;  2O0W A;  3LMW A;  1O8L A;  4YEI A;  1QA3 A;  2PYH A;  4Z05 A;  4OZZ A;  4OJ5 A;  4XN3 A;  1CLW A;  3GQ7 A;  2G0Y A;  4YC5 A;  2O0V A;  4Z03 A;  4AVZ A;  4YDT A;  4PMH A;  2NTB A;  4KH3 A; 
#chains in the Genus database with same CATH homology
 3NAW A;  3PSS A;  4YFO A;  2XTW A;  3SY2 A;  2QYU A;  2XT2 A;  2O6W A;  3DU1 X;  2XTX A;  3NB2 A;  2XTY A;  4YCQ A;  2J8K A;  2QZA A;  4YEI A;  4YC5 A;  3PSZ A;  3SQV A;  4YDT A;  5DNS A;  2XT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...