4YEIA

Beta1mut synthetic solenoid protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
215
structure length
215
Chain Sequence
HMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDASLHGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural protein
molecule keywords beta1mut
total genus 97
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 4yeiA00
2QYUA 3NAWA 2XT4A 2J8KA 5DNSA 3PSSA 2XT2A 4YDTA 2XTWA 3SY2A 2QZAA 2O6WA 3DU1X 2XTXA 3SQVA 4YC5A 3PSZA 3NB2A 4YFOA 4YEIA 4YCQA 2XTYA
chains in the Genus database with same CATH superfamily
4YZAA 1RMGA 5DNSA 1BHEA 2F3LA 3VMVA 1WMRA 2X6WA 1K8FA 4KH3A 2NT6A 4XN3A 1CZFA 2B0RA 4XNFA 3UW0A 4U4BA 1LLWA 1QJVA 5C1CA 1K5CA 1GQ8A 1PXZA 2UVEA 4C2LA 4OJOA 1IA5A 2NSPA 2O6WA 3B90A 1HF2A 4XLHA 4XM3A 4YZQA 2XTXA 1O8JA 2XC1A 3JURA 4YC5A 1O88A 4XN0A 1TSPA 1TYVA 2X3HA 2NTPA 2W7ZA 1PLUA 4AVZA 1DABA 3GQ8A 2VJJA 2VFQA 4XLCA 2YUHA 1O8LA 2PYHA 4YEIA 5JMCB 1O8KA 4V02C 4XL9A 1RU4A 2NTBA 2QYUA 1OFDA 2O1DA 3N6ZA 4XQFA 4Z03A 1XG2A 2IOUG 1RWRA 1KCDA 2BM4A 2VBEA 1QA3A 1HG8A 3EQNA 4W8QA 4XORA 3RIQA 1K4ZA 1H80A 1PE9A 2G0YA 2QX3A 4Z05A 2BX6A 2PECA 2EWEA 4I84A 3SY2A 2PYGA 4OJPA 1KTWA 1JTAA 1LM1A 2X6YA 3TH0A 2Z8GA 2VFPA 1LLZA 2INVA 3DU1X 1DBGA 4OJ5A 3SQVA 4OJ6A 2V5IA 3SUCA 2ODLA 3BH6B 1O8IA 4XKWA 1O8HA 1QA2A 1IDKA 2BM5A 2O0VA 2O17A 4MR0A 3GQAA 1NHCA 1QCXA 1QRCA 4OM9A 4YCQA 3LMWA 4NK6A 5C1EA 3T9GA 2XTYA 3VSTA 2BSPA 3VSUA 2J8IA 3JX8A 1VBLA 2XT4A 4URRA 2X6XA 1KQ5A 3N90A 3PSSA 2INUA 4XMYA 1BN8A 4W8TA 1IB4A 4XONA 3B8YA 1QA1A 2VFOA 4EW9A 4XOTA 3BH7B 3VMWA 2XTWA 1O8FA 1OFMA 3WWGA 1EA0A 2UVFA 2NSTA 1EZGA 4Z06A 4OZYA 2QXZA 1DBOA 2NZMA 2X85A 4XOPA 4HWVA 3PSZA 1TYXA 4OZZA 3P4GA 4YELA 3SZEA 1QRBA 1IDJA 4U49A 4YZ0A 1L1IA 1O8EA 2BM6A 5JLVC 2VBMA 3LJYA 1TYWA 3VSVA 4W8RA 4JRAC 2VFMA 3GQ7A 4OJLA 4YZXA 3PETA 2VJIA 3NAWA 2J8KA 4XLFA 1O8DA 4XKVA 4NK8A 4W8SA 3FY3A 2BM7A 4PMHA 4XLEA 1JRGA 2VFNA 2XT2A 2NTQA 4YDTA 1OGOX 4MXNA 1EE6A 3KRGA 1OGMX 2O0WA 3H09A 1O8GA 1OOCA 1QQ1A 2QZAA 3GRHA 3LYCA 4XLAA 2VBKA 1OFEA 1CLWA 2NT9A 4XR6A 5AMVA 4OPWA 1TYUA 1OFLA 3GQ9A 1WXRA 3SYJA 2IQ7A 3NB2A 4YFOA 1X0CA 1KCCA 1O8MA 3ML3A 3ZSCA 3AK5A 2QY1A 3EQOA 3B4NA 2O04A 4YEJA 3ZPPA 1AIRA
chains in the Genus database with same CATH topology
2QYUA 3NAWA 2XT4A 2J8KA 5DNSA 3PSSA 2XT2A 4YDTA 2XTWA 3SY2A 2QZAA 2O6WA 3DU1X 2XTXA 3SQVA 4YC5A 3PSZA 3NB2A 4YFOA 4YEIA 4YCQA 2XTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYU A;  3NAW A;  2XT4 A;  2J8K A;  5DNS A;  3PSS A;  2XT2 A;  4YDT A;  2XTW A;  3SY2 A;  2QZA A;  2O6W A;  3DU1 X;  2XTX A;  3SQV A;  4YC5 A;  3PSZ A;  3NB2 A;  4YFO A;  4YEI A;  4YCQ A;  2XTY A; 
#chains in the Genus database with same CATH topology
 4YZA A;  1RMG A;  5DNS A;  1BHE A;  2F3L A;  3VMV A;  1WMR A;  2X6W A;  1K8F A;  4KH3 A;  2NT6 A;  4XN3 A;  1CZF A;  2B0R A;  4XNF A;  3UW0 A;  4U4B A;  1LLW A;  1QJV A;  5C1C A;  1K5C A;  1GQ8 A;  1PXZ A;  2UVE A;  4C2L A;  4OJO A;  1IA5 A;  2NSP A;  2O6W A;  3B90 A;  1HF2 A;  4XLH A;  4XM3 A;  4YZQ A;  2XTX A;  1O8J A;  2XC1 A;  3JUR A;  4YC5 A;  1O88 A;  4XN0 A;  1TSP A;  1TYV A;  2X3H A;  2NTP A;  2W7Z A;  1PLU A;  4AVZ A;  1DAB A;  3GQ8 A;  2VJJ A;  2VFQ A;  4XLC A;  2YUH A;  1O8L A;  2PYH A;  4YEI A;  5JMC B;  1O8K A;  4V02 C;  4XL9 A;  1RU4 A;  2NTB A;  2QYU A;  1OFD A;  2O1D A;  3N6Z A;  4XQF A;  4Z03 A;  1XG2 A;  2IOU G;  1RWR A;  1KCD A;  2BM4 A;  2VBE A;  1QA3 A;  1HG8 A;  3EQN A;  4W8Q A;  4XOR A;  3RIQ A;  1K4Z A;  1H80 A;  1PE9 A;  2G0Y A;  2QX3 A;  4Z05 A;  2BX6 A;  2PEC A;  2EWE A;  4I84 A;  3SY2 A;  2PYG A;  4OJP A;  1KTW A;  1JTA A;  1LM1 A;  2X6Y A;  3TH0 A;  2Z8G A;  2VFP A;  1LLZ A;  2INV A;  3DU1 X;  1DBG A;  4OJ5 A;  3SQV A;  4OJ6 A;  2V5I A;  3SUC A;  2ODL A;  3BH6 B;  1O8I A;  4XKW A;  1O8H A;  1QA2 A;  1IDK A;  2BM5 A;  2O0V A;  2O17 A;  4MR0 A;  3GQA A;  1NHC A;  1QCX A;  1QRC A;  4OM9 A;  4YCQ A;  3LMW A;  4NK6 A;  5C1E A;  3T9G A;  2XTY A;  3VST A;  2BSP A;  3VSU A;  2J8I A;  3JX8 A;  1VBL A;  2XT4 A;  4URR A;  2X6X A;  1KQ5 A;  3N90 A;  3PSS A;  2INU A;  4XMY A;  1BN8 A;  4W8T A;  1IB4 A;  4XON A;  3B8Y A;  1QA1 A;  2VFO A;  4EW9 A;  4XOT A;  3BH7 B;  3VMW A;  2XTW A;  1O8F A;  1OFM A;  3WWG A;  1EA0 A;  2UVF A;  2NST A;  1EZG A;  4Z06 A;  4OZY A;  2QXZ A;  1DBO A;  2NZM A;  2X85 A;  4XOP A;  4HWV A;  3PSZ A;  1TYX A;  4OZZ A;  3P4G A;  4YEL A;  3SZE A;  1QRB A;  1IDJ A;  4U49 A;  4YZ0 A;  1L1I A;  1O8E A;  2BM6 A;  5JLV C;  2VBM A;  3LJY A;  1TYW A;  3VSV A;  4W8R A;  4JRA C;  2VFM A;  3GQ7 A;  4OJL A;  4YZX A;  3PET A;  2VJI A;  3NAW A;  2J8K A;  4XLF A;  1O8D A;  4XKV A;  4NK8 A;  4W8S A;  3FY3 A;  2BM7 A;  4PMH A;  4XLE A;  1JRG A;  2VFN A;  2XT2 A;  2NTQ A;  4YDT A;  1OGO X;  4MXN A;  1EE6 A;  3KRG A;  1OGM X;  2O0W A;  3H09 A;  1O8G A;  1OOC A;  1QQ1 A;  2QZA A;  3GRH A;  3LYC A;  4XLA A;  2VBK A;  1OFE A;  1CLW A;  2NT9 A;  4XR6 A;  5AMV A;  4OPW A;  1TYU A;  1OFL A;  3GQ9 A;  1WXR A;  3SYJ A;  2IQ7 A;  3NB2 A;  4YFO A;  1X0C A;  1KCC A;  1O8M A;  3ML3 A;  3ZSC A;  3AK5 A;  2QY1 A;  3EQO A;  3B4N A;  2O04 A;  4YEJ A;  3ZPP A;  1AIR A; 
#chains in the Genus database with same CATH homology
 2QYU A;  3NAW A;  2XT4 A;  2J8K A;  5DNS A;  3PSS A;  2XT2 A;  4YDT A;  2XTW A;  3SY2 A;  2QZA A;  2O6W A;  3DU1 X;  2XTX A;  3SQV A;  4YC5 A;  3PSZ A;  3NB2 A;  4YFO A;  4YEI A;  4YCQ A;  2XTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...