3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
3GBEA 2D0HA 1TQUA 4X9YA 3LRLA 2VJJA 1KGXA 4TVUA 1MWOA 1R33A 3DX4A 4Z03A 4AYGA 2O17A 3SUCA 9CGTA 1Z32X 1O8DA 2CXGA 2INVA 2ZUTA 1WZMA 4WSKA 1HVXA 2ZUWA 3CZSA 3ZO9A 4OZYA 1OGMX 3DHPA 1XGZA 2Z1KA 3GQ8A 3GQAA 1PEZA 4HOXA 3KL5A 1UKTA 4XLHA 5EMYA 1UKSA 4MXNA 4AW7A 3A22A 2ZE0A 4GQQA 1KWGA 2CHNA 1VIWA 2D3LA 2D0GA 3CZKA 3S5ZA 5HPOA 4XL9A 1WO2A 4XOPA 4HOWA 1BLIA 2Y5EA 1UOKA 2EAEA 3L4VA 4UQ9A 2NT0A 3IJ7A 5TD4A 3TTSA 1HNYA 2F7OA 5A2BA 3A24A 1UD2A 3CZGA 1MVYA 4XMYA 3GXMA 1XSJA 3GXDA 2WCSA 3BAXA 3IJ9A 3K8KA 2NT1A 3EJPA 3GXPA 1XH0A 2ZUSA 4WSJA 2BSPA 2VUYA 1JDCA 1E3XA 1OT1A 1KXTA 1HL9A 2Y24A 2WANA 2ZWYA 2F61A 3BVVA 2OSWA 1KXHA 3GQ9A 1JDDA 1HL8A 1XD1A 5I24A 3VSVA 3WEMA 3KL0A 5C1EA 1AQHA 3UERA 1KTCA 3B8YA 1G1YA 1MFUA 3A5VA 3EJUA 2D2OA 1OSEA 1PPIA 3QGVA 1CGWA 1H80A 3LRKA 3BSHA 1E43A 5I23A 3UCQA 3UG3A 4NK6A 4JFUA 4HA1A 2NTBA 4DO4A 1BG9A 4U33A 3VGEA 2OW7A 3BMWA 1VFUA 3A23A 4I84A 3CPUA 3BVXA 4XKWA 1JIBA 4XOTA 4XNFA 3BUIA 3WMSA 3BVUA 4XQFA 1D7FA 4FNSA 2VRKA 1CGVA 4CGTA 3L4WA 3BUQA 3L4UA 2YFOA 4XLCA 2X2HA 1XSKA 2X6YA 1CGXA 4E2OA 4NX0A 2PWDA 1O8JA 2EQDA 1U2YA 2BXYA 1MFVA 3RILA 1GCYA 5E6ZA 1OFMA 2ZICA 3VMNA 1GJWA 3HG2A 1OGSA 5A6LA 2ZXQA 4AIOA 4W8TA 1CXHA 4H8UA 2ZX5A 4J7RA 3RIKA 3WDHA 1QJVA 1TQSA 4GO8A 3WY3A 3OLEA 3KE0A 1W9XA 3A47A 2PWHA 5CLWA 3BUDA 3GXFA 1O7DC 2GJPA 1SZNA 2VRQA 2X85A 5HDRA 1HTYA 4FMVA 4PMHA 4H8VA 4QAWA 1KTWA 3VGFA 1O88A 4J3TA 1JF5A 5CGMA 1Y7VA 1JI1A 1QHPA 1JXJA 2EWEA 3EJTA 3EDDA 1OOCA 2NSPA 1LWJA 3WEOA 3A4AA 3VMWA 1VBLA 5A2CA 3UG5A 3DX1A 4J3WA 5CXPA 1O8FA 2DH3A 1NOFA 1Q4NX 1JGIA 4NXKA 4FLOA 4H7VA 4MB1A 1R47A 4YZAA 2G3NA 1K5CA 3UG4A 2IQ7A 1JG9A 2VR5A 1O8MA 3KL3A 1CZFA 3KRGA 4U49A 1UASA 3MI6A 1O8HA 1QCXA 1RWRA 3GRHA 1QWUA 2EEXA 4HWVA 3EDJA 3S2CA 1SMAA 4GI6A 2BY3A 3GXIA 4J3SA 1E40A 1A47A 3D50A 4GKLA 2FH6A 4PSRA 4U31A 1KXVA 3FY3A 3GBDA 1RP8A 3AXIA 2OSXA 4BA0A 3DX3A 1J0IA 2ALWA 5E6YA 4AVZA 1NHCA 1XH2A 4B9YA 2NTQA 4BZYA 3CC1A 1P6WA 2X6XA 1S46A 1WPCA 3CZNA 1XG2A 1KB3A 3VGDA 2X2JA 3VGGA 1UA3A 1DBOA 5CLTA 3LMWA 3B4NA 1MW1A 1XCWA 2Y2WA 3VM7A 3OLGA 4M56A 2C8NA 2EJ1A 3VSUA 2DIJA 3DDFA 4OJ5A 4OJLA 4AYSA 1HXKA 1LWHA 3KWXA 1HT6A 1WZKA 1MXDA 3AJ7A 4XORA 3ZQ9A 2F1BA 2YJQA 4OJYA 3VGBA 3UW0A 3WDJA 1MW0A 1ZJBA 3LXBA 2E8YA 4XONA 2PWFA 2GUYA 2WVVB 3WELA 5E0FA 3IK2A 1O8EA 2ZX8A 1BSIA 4GI8A 7TAAA 1WMRA 3HG3A 1G9HA 2EADA 3ZT6A 2VJIA 2E8ZA 3DX2A 1KGUA 3K8MA 2GJRA 2OW6A 4OGZA 3AMLA 2XN2A 3HJEA 2QY1A 1QX1A 1OGOX 1R34A 3ZSSA 3KLLA 2ZIDA 2EO7A 4HPHA 2WVTA 3KEHA 2ZXBA 1VJSA 1UD8A 3H54A 2YIHA 2YA2A 1IV8A 2ODLA 2BY2A 4W93A 1BN8A 1VFMA 4Z06A 1UH3A 4YELA 2E0PA 3A21A 4J27A 4OJPA 4LXFA 5I5RA 2XVKA 4JCMA 4NZJA 4XR6A 2NTPA 4UQDA 1R75A 1CXIA 1GVIA 1ZJAA 2GVYA 1V3JA 2WCGA 3LPOA 2VBKA 3IJ8A 3L2LA 3LX9A 4NK8A 1IB4A 6CGTA 5DO8A 1BHEA 4JFTA 4CN6A 1QPKA 3WFZA 1UH4A 1PJ9A 1GJUA 4ATWA 2ZX9A 4URRA 1UD6A 3FAWA 4HOZA 2ZXDA 4X0NA 1WZLA 4UCFA 1KCLA 4J3XA 2FHFA 3BAWA 2ZUVA 3VMVA 1C8QA 3TV8A 4NXSA 3W38A 5CGTA 2UVEA 2XWDA 3BSGA 2BHYA 3ZSTA 3T9GA 2ZWZA 4MAZA 1QHOA 1DHKA 1HWWA 4OJOA 3WWGA 2PECA 2WC7A 1EA9C 2BY0A 2ZX6A 4DO6A 3L4ZA 1PXZA 1G5AA 5A6MA 1KXQA 1XCXA 3TOPA 3H53A 1CXEA 2QX3A 3D52A 1KBBA 3BUBA 3EJRA 3L4TA 4FLSA 3WNNA 3DX0A 2PWEA 1CGUA 2F2HA 2NT6A 5E9AA 3GXTA 1CXLA 1UH2A 2UVFA 1KCDA 3B90A 4YZQA 2V3DA 3WN6A 2F1AA 5A2AA 2AAAA 4UZUA 3D51A 4GINA 1I75A 2BHZA 1DBGA 2BXZA 4CKQA 3L4XA 2VBEA 4XM3A 1J0HA 4NI3A 5BRQA 4PEEA 1HG8A 1EHAA 1GQ8A 4JFSA 3VX0A 4Z05A 1EH9A 2XVGA 1UD5A 3CZEA 4XLFA 4XLEA 3BMVA 1AMYA 3GXNA 2FHCA 5F7UA 2O0VA 1CXKA 1U30A 4CVWA 2OYLA 3BVWA 5HXMA 3ZR5A 3CTTA 2WSKA 1DEDA 1AIRA 1QI3A 2IGTA 1QWNA 1QW9A 2V3EA 3LXCA 1XH1A 2NT9A 1CPUA 4OZZA 1WP6A 4WLCA 2YA0A 4HP5A 4W8RA 3BAYA 1TQTA 1IDKA 4OJ6A 2EACA 4UQBA 4C2LA 2VNCA 2QPSA 1MW3A 1JD7A 1VAHA 4PCSA 3ZSCA 2E4TA 3FW6A 4FNRA 3A6OA 1TQWA 4WF7A 1UA7A 4GO9A 2J25A 2D73A 1UD4A 3OLIA 1OT2A 2XIIA 3VGHA 2X6WA 1V3KA 1UD3A 3VO0A 1CDGA 4UZSA 1G94A 3VMPA 1U33A 1KCCA 2YKKA 3DC0A 4FNUA 3EDFA 3TONA 4CN1A 2Z8GA 1RU4A 1XD0A 3TTYA 1KBKA 2INUA 1TMQA 1KWKA 1IZJA 1WE5A 3BCDA 3WDIA 1VFOA 3WY2A 2WVUA 4UQCA 1IA5A 3WY1A 1B2YA 2TAAA 3WNOA 1ODUA 4LPCA 3ZOAA 2FE0A 4AEFA 1BVZA 5AMVA 3AXHA 1ZS2A 4XKVA 1PE9A 4B9ZA 1BPLB 5E70A 2XN0A 1PZ2A 2XIBA 2V3FA 3WNLA 1XSIA 2FGZA 3LPPA 2E9BA 1X0CA 1JI2A 1DTUA 3EDKA 1SMDA 1AQMA 4UOQA 2WPGA 3GTNA 3UEQA 2WNWA 3IGUA 1RMGA 1AVAA 2ZXAA 2OYKA 2XN1A 3BVTA 2NSXA 4AMWA 1BVNP 3AMKA 1QW8A 1T0OA 1JF6A 3ZPPA 5C1CA 3EQNA 5I0DA 4FLRA 2AMGA 3BAJA 3S5YA 2FYVA 1CYGA 4GI9A 1EO5A 4UQEA 4W8SA 5BRPA 2X3HA 4YZXA 3VU2A 1NM9A 2YOCA 1CGTA 1JXKA 1XV8A 3GQ7A 1JL8A 1O8GA 3VNYA 4XLAA 3CZLA 2OSYA 3DDGA 3K1DA 3OLDA 4JFVA 1PAMA 2QMKA 4J3VA 2FHBA 3WNMA 4FLQA 3LRMA 3VNZA 1BF2A 3VX1A 7CGTA 2YFNA 2VBMA 4EW9A 3BAKA 4U3CA 1PZ3A 3CGTA 2QMJA 4GIAA 3BH4A 3JURA 3EDEA 2EABA 1B0IA 1PS3A 4J3UA 2FH8A 1V3LA 3KLKA 1CIUA 3WNPA 3EQOA 4FNQA 3WNKA 2QLYA 4H8HA 4H2CA 1OB0A 2WVSA 1JTAA 1E3ZA 1CGYA 1MXGA 3BC9A 3CLWA 1O8IA 1V3MA 1KTBA 4AEEA 2ZX7A 4YZ0A 1EO7A 4U2ZA 5E1QA 1JD9A 8CGTA 2XVLA 3HG5A 1RP9A 2BHUA 2F7QA 1L0PA 3EJSA 4OIFA 4FNPA 1JAEA 1KCKA 4KMQA 3M07A 1TCMA 2WKLA 2G3MA 2WKGA 2F7RA 1EE6A 3W37A 2QPUA 2VT0A 1O8KA 1O8LA 2WVVA 4JL2A 1KGWA 1R46A 4NZFA 2YA1A 2D0FA 2NZMA 4U2YA 4J28A 1BAGA 1VB9A 3VMOA 2C7FA 2DH2A 2O04A 2PYHA 1D3CA 1JRGA 2WSPA 2NSTA 3H55A 3HZ3A 1IDJA 2F7PA 2CPUA 2ZUUA 2Y4SA 4PSPA 4CN4A 2XWEA 4U4BA 1CLVA 1M7XA 3BLKA 4M8UA 4W8QA 3BCFA 3L4YA 4DO5A 4UQAA 4PCTA 1OFLA 3ECQA 1CXFA 5KEZA 3II1A 3VSTA 1QI4A 4JFWA 4OKDA 1J0JA 4JCLA 2O1DA 1JFHA 4XB3A 3K8LA 4KWUA 4FNTA 1PIFA 3L2MA 4JL1A 2QV4A 2PYGA 3HG4A 6TAAA 1M53A 2DIEA 2O0WA 3WENA 1H3GA 3BLBA 1UKQA 4GQRA 4UOZA 3ZR6A 1MW2A 4XN3A 3BLPX 1PLUA 4MR0A 4XN0A 2QXZA 1HX0A 3D4ZA 1WZAA 1IZKA 3BAIA 2X2IA 3BUPA 2PWGA 3CV5A 3FAXA 3ZT5A 4AIEA 3EJQA 3DHUA 1QI5A 1JDAA 1PIGA 1RPKA 1TQVA 3LXAA 4LQ1A 3ZT7A 4YEJA 2D3NA 2F18A 1J0KA 3WY4A 3D4YA 4UNIA 5DFAA 3VM5A 2BY1A 4AMXA 2OYMA
chains in the Genus database with same CATH superfamily
3GBEA 3LRLA 1UJ3A 4KTEH 4MMXA 4PG2C 3FU8A 4HV8A 2MHAB 4PJCB 1MUJA 1A0QH 1XGTA 5K39B 3FF8A 1AQDA 2ICES 1UWXK 1MCSA 2R1XA 1NPUA 2B59A 3T3ME 4YE4L 4FXTA 5D1ZI 4ECNA 5KW9L 4V33A 3BJ91 1UB6B 3CZSA 4PJ7A 3HNVH 4W6YB 3GQ8A 1VHPA 1RZIA 5CSGA 1MUJB 3UTPE 1P7HL 4ALAL 1SXBA 3HFMH 3MRIA 3UMNA 4P4KD 3SB3A 3TVMC 5E4EC 3U0WL 1BQRA 4R4FL 2EEDA 4G1MB 4JHVA 4ODWB 4ZAKA 1YYML 3GNML 1XGQB 4YDVB 4HZ1A 3AS2A 2Y0SA 4PV9A 5DURD 1MFMA 1P2CA 3WLBB 1P7QB 2GAZA 2MPVA 5LGHL 5JHLA 4UMSA 5C0NC 5IGXH 3KH3A 3VH8A 1WGVA 5CU9A 5E1IA 2FX9L 1QABA 4AX3A 5BVJB 3UX9B 2C9AA 3AG3B 2EINB 2X0WA 3ETBJ 5F1KC 3GQ9A 1TU2B 3O6ML 2F0CA 2PPFA 3ML3A 4JN1H 3SY2A 3L3OA 3VI4B 1WAAF 3BAEL 1AO7A 2BNQE 5DJ0A 1YLBB 5CSBA 3TEWA 1PSKH 5EN3A 4O9HL 1BLNA 7PCYA 2APTA 4YHZL 3BSHA 4E41B 3OKNA 4OZHF 2O6PA 1D5ZA 1N3NB 4HYTB 4QKXB 4XMTA 3NPSC 1JFQL 2B20A 3BPCB 3NJKA 5E8DL 5I82A 3VD5A 1E2VA 3MPCA 5E6IA 4I5BB 2XUWA 4WAFA 3IF1B 1FWXA 5ANHA 2ISDA 3VGEA 4OGQC 4ZODA 5DGQA 1W72H 3A23A 1C5CL 2LV4A 5GSRA 5BXFA 1PDKA 2FD6L 3EJJX 4FHBD 4Q97A 1MRCH 4G80B 2BVYA 4UYQA 3I02B 3ZX1A 4KJWD 1BD2D 4CW1A 5JIPA 1A7NH 2W60A 3IDJA 4TTDD 3RKPA 3W0WD 4P2OC 1QSEA 4BKLA 2P4AB 1FAIL 4G11A 5GZND 3MXVL 4XP9L 4DEPB 1NGXB 3IDUA 2FT6A 5BMFL 4JY5L 3HVDA 1IE5A 2OI9B 2VN7A 3NJHA 4HHGA 4NO5A 1BJ8A 3RIKA 1EEZA 1WBYB 1ZOXA 4DAGL 5AD0B 4MSWA 4H88L 1R5VA 3TYGL 4YLCA 3LPGA 5AYQA 1EUTA 4JHBA 4U05A 4EN3B 4YSUA 4E68A 3LIZA 1XF4A 1G6RA 1RU9L 4HHAA 5JLVC 1U8OA 1QSVA 3DJ9A 5DU7A 1I7ZA 4KJYA 1QHPA 3FT1A 1JXJA 4BFNA 4FI7A 4JO4H 2KKQA 3DGDA 1IM9A 5HHMB 4R4FH 3UG5A 5CXPA 5DURB 4X5WA 4PJ7E 3LJYA 4ATTA 1JK9B 3HS0A 5D1XA 2CLZA 1SDAB 3PGFH 1H19A 3DBXA 3SYOA 3X1GA 2RGSA 4L1SA 4RGNC 3O11B 2IDCA 1QFWI 5DD6B 1QCXA 2YMOA 1P4BL 15C8L 1YDPA 4S1RH 1JRHH 4M5TA 4UT6A 2OMUB 5CJOL 4RIRA 1LEKB 1LMIA 4JHZA 5E2TH 5FO9A 1QSFD 2FH6A 5I1CL 4U31A 5A3ID 2D7PA 1JUFB 5AOIA 3ZLQC 4YFLF 2R4RL 4GW5A 2C3XA 1VRSA 2EC9U 4ERSL 1IGIH 1XH2A 3PABB 3PUUA 4H8WH 1NHCA 1Z7JA 4GUPA 1CLZH 3G5XA 4OF5A 1Q0XL 4BK8A 5EEWA 3O8XD 1BM7A 1SBSL 2I7SA 1H8LA 1U8JA 3A4DA 4LP5A 4X6CF 1UQSB 4D8PB 1MCOL 2C1OB 4JEGB 4U6HA 2CKBL 1TZGL 4DKDC 1MEXH 2EZ0D 2Y7QB 3LXBA 1KIQA 3BT2L 1UYWL 4AENB 5K9QI 3SYPA 1OFDA 3ROLA 1A9VA 1M6UA 3K2UH 2PP7A 2Y6TE 3TA3B 2JKIS 2Y3AA 2NW3B 1YUHA 5IB4B 3FB5B 2FB4L 4RWHA 1JV2A 2CM5A 3W11C 5F8RC 1SLWA 2Q8AL 4WFFD 3B3BA 1Q9KA 2FR4B 4HGMA 2H8PB 3P4OA 2CK0H 4M6OL 4XCNA 3ZDYF 2DV6A 4P2RD 4AJVA 3DV6A 3HLKA 4GRMB 4KAQH 4WHDA 2Z4QB 5F21B 4MAYB 4LSVH 3QXWA 3GSNL 5D4QA 2P24A 4MSWB 4CJ1A 4FG4A 4QD2E 4QMEA 2ODLA 3UBXI 3FQTA 1MFAH 3HHSA 2IMMA 1UH3A 4IQHA 5D7SH 3SY0A 3A21A 1PGRB 3LQAH 5KWYC 3JV4B 2ICEC 1KYOJ 2BVTA 3QHZH 3MHZA 1HS6A 3LPOA 5D71H 4RFEB 3L2LA 5IB2A 4FGMA 1XGRB 4M8VA 4KK8C 2C4XA 4Z78B 4Q14A 2OMYB 2YD3A 4TNWK 1OGAE 3WE1A 2E7BA 1PDKB 3UZVB 4UNUA 4I8DA 3X13B 3BWZA 1FCGA 3AUVA 1FQ9C 2AQ1A 2R2BB 4HLZH 3UPAA 2WQUA 2K4WA 1QASA 1JXDA 1Q8MA 3JV0A 4G8FA 3GSWA 4ZFOL 4AGNA 3GSVB 1EA9C 4AQEA 3TBWA 1OT4A 1JNLH 3HUJB 2TSAA 1LM1A 3GMMA 5CLYA 4XOEA 5IBUG 2H0PA 3BW9A 3VFOA 1XIWD 5DFWH 1KBBA 5T1KB 1CGUA 1KJ2L 5GGVY 4P2QB 3L3OB 3VI4A 4DWHA 4EE2A 4EXKA 5EO0B 1FDLL 3APMA 5C71A 2A77H 5J5EA 1YY9D 4QT5A 1SQMA 3PWVB 4QXGL 5IB3A 4YZFE 1LO2L 1L9NA 2YLKA 5C97A 4NZRL 1JP5A 4K8RH 4R97B 4YAQA 3I6GB 3SPHA 4DEUA 2HLFC 1C12A 1KBVA 3TJHD 4H5SB 1IGTA 1OSPH 5IW6A 2VCOA 1OFEA 4H0GA 2AK4E 4HULB 4MAUH 3BMVA 2RMNA 3FUDA 4B50A 3DO3A 4XP4L 2VW4A 4NQSA 5GS0L 5TF1L 3ZDZE 5D5MF 2F68X 1IKNC 2R39A 5HVHB 2X10A 3P0GB 2Y7SA 4LLQB 3BGFB 5DEJA 2WBWB 3DV4B 1NCGA 2UZIL 4NPJA 3BRDA 3D39A 4OJ6A 2EACA 4KUZL 2F7IA 2GJZA 2WBKA 4OV5B 5L2KB 4JW3A 4FNRA 4KZEL 4GO9A 1TZGH 1PZ5A 2YS4A 3L3OC 3QO1A 2HRPH 3N90A 5T3ZD 3FB7B 4TQHA 4LCWA 1L7IH 2BIHA 2PYFA 5JW4R 4JFHD 5CSZA 2G0KA 2Z1PA 5LQBH 4YWGH 5D7LA 1KCUL 1JPSH 1SOXA 4FX5A 3J7HA 5LAXB 5B4MC 1IZJA 2N59A 3RWEB 1UGKA 3JBG7 4YXKL 3ZDYE 4TLKA 4YAQB 4UQCA 4LEOA 2Z31D 1TSPA 1CFNB 1ZHNB 5AB2A 1FNSL 1E4WH 4RDBA 3SBQA 1A9BA 1HEZB 1KCBA 1I8IB 1XTLA 1ZS2A 3N06B 3H8NA 3QIBB 3S96B 5IHWA 5IWLC 5HD8D 6PCYA 2L4OA 4JFPB 4NGHH 1EO8H 4NZTH 3R8BB 1S9XB 3L1OL 4PRBA 4QR7A 4F9PA 2WCPA 2Y22A 3TBTA 4KO9A 1FL5B 4MMZA 1W6WA 2BINA 5LGYA 5CNHA 5IZ7A 3B2PA 2WPGA 3O3BA 3FTUA 3ZTDC 3BKML 4NJAL 1AVAA 5EN2B 3ZPPA 3NIDF 3AWGA 3PGCA 4ZUTB 2X1PA 4XMLL 1DO6A 5KS9F 4Z77B 4GI9A 3LQZB 4G5AA 2H6UA 3P4NA 3FMGH 1N6UA 2VSKB 1JRHI 4F37F 3LNFA 5I75C 2N1KA 5GIRA 5IUCA 4O2FA 1QBML 4JDVA 2PCYA 4ZUTA 4YDKH 2WZ0A 1XL4A 5G5DA 1G7QA 4P5TC 2JNZA 4EW9A 4JRYE 4OGXH 2EXYC 1M3JA 3JT0A 4Y5YA 3I9IA 2Z65C 3BH4A 3UYPA 3EJZD 3HHSB 5AUMA 4I18B 2V9UA 5I15L 3RRQA 5DZNA 4FNQA 2VH5L 5AYUL 1HH9A 1MHHB 1GOGA 3B9EA 4GRMA 1F3JB 1U41A 1E3ZA 3BC9A 4GXVL 3T77A 3T8VA 1LO2H 2VO5A 5E1AA 5HY9A 4JFPA 5JMOC 3DU1X 3UIYA 2CDEA 4Y0GA 1JPFB 4IHOA 3P9MA 1YG9A 4Y5VB 1A9BB 3EH5B 5LN8A 3QEQE 4F9LC 1DDTA 1NGQH 3PP4L 4AEIL 4FNLL 2G0YA 1T0MA 1NIBA 3RUGB 5JIIA 4IHBA 4MMXC 5AVSB 4LRNH 1X4ZA 2VT0A 4U3XA 1ZHBA 3MVSA 4JFOA 3HTLX 4N9OB 5IY5B 3CVHA 2GB2A 4K5PA 3T0BA 5F9WB 4U2YA 2DD8L 3WJMA 5DD3L 2BX5A 3EH2A 2NY6D 1D3CA 2BSTB 2H26B 5SWZB 5HYIA 3F7LA 3ZDZB 4AH2B 2LGNA 5F89B 4H0LC 1MN4A 1QEWA 1FLRL 1WQVT 2BS8A 1YSOA 2XWEA 5IW3A 3SJVB 2QHLA 3OXRB 4NUJB 2YK1H 4UQAA 3IDXH 3D39B 1X3DA 3FQXB 2OL3A 2R7EA 4BFFA 1OD9A 5HHXL 1CJYA 4NN7C 1BXAA 3EYSH 4U6TA 1SHMA 4RIRB 3ZRSA 2VDQB 4N8VB 2NY2D 3HG4A 4KKCC 2DPKA 3MNZA 1L0QA 3O4OC 3O6FC 5EIIG 5HI5C 4GBXA 2NOYA 3RG1C 1PY4A 5J06A 2DLFH 4AIEA 2AQNA 3ET9F 1W2KT 5CJXC 2VLKB 3HFFA 1PKOA 2D7QA 2JE8A 5JHDD 1R33A 2OYMA 2Y1VA 4A66A 4XCEB 1PFOA 4WO4A 3OR6A 4JDZA 3E6FA 5FUCE 1Z9NA 4AC2A 1XGUB 3WS3A 1QBMH 3HPLB 5PAZA 5KW9H 4Y2NA 4PRPA 1UWEL 2FX7L 5DJAA 2EDHA 5E7FA 4FC3E 3HE7A 4WWKB 2P8MB 5GRXG 4A6YL 3CZFB 3VFSA 4IBLT 3FTGA 3GSXB 4NN7B 4ZX3A 3UPCA 3HZVB 4U1IA 3OQ3B 1RJYA 4IBWA 3EIFA 3DYMA 1KV3A 3Q44A 2CA4A 1Q9LB 3DIDA 1F58H 4Z7QB 2C5DC 1AGBA 4F57H 4FFZA 5FF6A 2NQCA 5D2LF 4PJ9D 3S5ZA 5HPOA 1NGXA 4MJJA 1RI8A 1I1YA 2LOEA 1BPVA 3GUFA 1WA1X 3HNSH 3N04A 3ULUH 5F8QC 2NT0A 2WYZA 1KQ5A 2QQNL 3CFBA 3IB4A 3W9DA 3NJMA 5IGXL 1LDSA 4MXWL 1ZT1A 5A2BA 3A24A 4CW1B 3VXQA 1MJ7L 3U1PA 3O45B 4O2EB 5E4IA 3K8KA 4H0HB 3HS9A 2DWEB 4JQXC 5GS2H 4N4YB 3CLFH 4K3HA 3L5WB 5DD3H 5J12B 1B4RA 2DAVA 4JUTA 3CFEA 4UF7C 4LIQE 2WJ5A 2GHWB 4KVNH 4PJXB 2CRYA 3DBSA 4XXCA 2ZSVA 4PJXF 3V4PA 3PE9A 4E41A 1KZQA 5TTRA 3QDGE 5EWIH 1PF3A 3QGVA 1K4CB 2VN6A 2B0SH 3FZUD 3SODB 2EXWC 1PU0A 1AO7B 1T6BX 4M7ZB 1SHWA 2X3BA 1G1OA 1JWMA 5KJRH 5CFAA 3CSPA 4X2UA 2DEYX 3H3PL 3FT3A 3S5LA 4S1SL 5DMIH 4WNJA 1A6AB 4XOTA 1LDPH 2AXGB 3CPUA 4U1LB 5F1NB 3KPLB 4FNSA 4A7GF 2PO6B 2Y7QA 1WAPA 2CO3A 3HI5L 1D5MB 1P6FA 2WHVA 4XLCA 4XX1G 2X6YA 2C1OA 2W80C 1NGZA 1UQSA 4H20L 4JN2A 2NNRA 3C6LC 5JPNA 3SD5A 3PS6A 3JSSA 1I53A 1SLXA 5A6LA 3GDBA 3E7JA 4KO5A 1ZHLA 3OJ2C 4BZ2H 3FN9A 1OPOA 1QAWA 3NN8A 3WFHB 1A6ZA 1NIDA 3MRHA 4GW5B 3KE0A 3UO1H 5I17B 2FJUB 3SQRA 1IIIA 4X5XB 1B4LA 2J5LB 4K71B 5HJDA 4S11A 4Q4IA 1AZBA 3U9PH 1KN4L 3P3RA 1SDDA 3JWDH 1X6NA 1JF5A 1U91B 4LSTH 5C0FA 1N18A 3MRDA 4W4NA 1UJ3B 1LP9F 3CFDB 3DKHA 5A2CA 1YRKA 1Q38A 2YAEA 4JRYD 5C0JA 2HFGL 3PJNA 3SZKC 2AK4D 4JVUA 1MCNA 5TDOB 4XC3H 2AJUL 4WUUB 5E8OA 3B5GA 5ENWA 1IM9B 2FEDC 2PPDA 3VFTA 2PXYC 2IQ7A 1XAKA 4JFOB 5CMAA 2PTTA 35C8L 3EUUA 1DJIA 4IU2A 4NERA 3X3FH 1CD8A 1JZDC 3MX0B 3MI6A 2BX6A 2BSSB 1O75A 3L5HA 4XOAA 1G6RB 2BO0A 3ZYOA 1J8HA 4H44C 1Q1JH 2CIIB 3DK0A 4TV3A 3RP1A 2BCKB 1EAOA 1JPFA 5I6NA 1TVDA 4L4TA 1E8WA 3RZCD 2CDFA 4RMQA 4YSQA 2G5BB 3JZYA 1YHPA 3POHA 2Z0UA 1UVQB 4NO5B 5FV2A 2P80D 1DP0A 2NTQA 2B08A 1S46A 1KEGL 3VGGA 2H32B 1G7MA 1NCNA 3R0NA 3VGDA 1UA3A 1BQSA 1FJ1B 5D71L 3PXHA 2X05A 3T0EE 1RUPL 4TSBL 1H3TA 3DRQB 3RTQC 4JKMA 4KMTH 4V11A 3KPQB 3WEAA 3K1KC 1F8TH 1IFHH 3NIFF 4AG4H 2VZVA 1OAYL 1FGNH 1XF2A 4X7SL 1S9WA 4UM8B 1KFAH 1CFVH 2P7TB 4MMYA 2V8MA 3DX2A 1MOEA 2NDGA 1QHQA 2BSCA 1I4FA 3ML9A 1MNUL 1WWBX 1GTFA 1GGBH 3BPCA 2XN2A 4ALAH 1CO1A 4JO2L 4NKDB 4P23D 1KBWA 4PRHA 1VZIA 2BVPB 2Q7AA 4MMZC 4ONHB 3IGFA 4TVPH 4YFLI 4NPYB 3B8SA 4RFOH 5FW6A 3NVQA 2QADD 4HXBL 1O5DT 3HC2A 2ZXBA 1K2DA 3LEXB 1Y0LB 2AI0L 4U3SB 4XNZC 3S48A 3AWEA 1VFMA 5HHOB 1E5AA 4I48A 1ZDQA 2B1AL 4P46B 2YPVA 3LEVH 4IYKA 4JO8A 1IX2A 4XCYA 3NSFA 3UTSD 4N2FA 3QUYD 4ZFGH 1TJHL 1S4IA 5FFOA 2B4CC 3ULVE 4ZTPL 5C3TA 2VLJD 1UM4L 4K3JH 1P0SE 1IAOB 4X8CA 3VYPA 3MROA 4XAWL 1YC7A 5GS1A 3EBIA 4JRXB 4D9LL 4WFGE 4BA8A 3N6ZA 1PJ9A 5GRUH 4JHWH 3UJIL 5I1LA 4ZXBC 5IROC 2DKMA 2C3WA 2ODIA 5DGRA 4HAKA 1GAFL 1NCWL 5CGTA 5EZOL 3MRMB 3O3EA 2FX8L 4AE1A 4POZC 1KJVB 3QO1B 4MJ5A 4R5XA 3WMQA 4B95C 1S3KH 4P07A 4F7TB 1AQDB 1DVXA 1JHKH 1YEFL 3O9WB 5FHBH 2HKFH 5CWSB 2AMUA 5AFAA 1IKNA 4GKZB 4NN5B 4BFBD 3SPJA 2QX3A 5C0CB 1GA2A 5HYSA 2I27N 4UDUA 4IU3B 2C4FT 4NN6B 3GXTA 4PRHE 3N43B 1M2OA 1OEZW 2EE0A 4FULA 1GS6X 2AAAA 4KNQA 1G7IA 2OZ4H 2Q87A 4NUMA 4NO0A 4GQ9H 5K9JH 4CKQA 2VBEA 1MVUB 1JV5A 4KXDA 4GRWB 4KI1A 1TTAA 1DSWA 2SEBB 2EDJA 5HI4D 1KGJA 4ZNEA 1HJBC 2P26A 4JFSA 2UXFA 3N43F 2NW2A 1C12B 1EFXD 4C4BA 4LCYB 5IMKA 1S9KC 3MV7D 2CR6A 3DYPA 5ESVA 1TZ8A 1RURH 5HGBB 4HBCH 3NCYP 3PNWA 3PWVA 1G43A 1G9NL 2AXFA 2BM4A 3N42F 5H37G 3AGWA 2XQYK 4LQFL 1DQLL 3S36H 3V7AG 5TH2B 2XG4B 1IGCH 5A6IA 1U3HB 1QUNB 1NBCA 5EZIH 1NBZB 2JCCB 5FM8A 5EC1A 5KG9B 3KNBA 2OMVB 2ED8A 4L4VD 1UD4A 1P7KA 5FKAB 5B38B 4ORGA 3TN0B 5T1MB 4OI7A 1KENL 1HJCA 2BFVH 1ANUA 3FSOA 1ORQA 1FV1B 1PCSA 3SE4A 4Q6IB 1WH0A 1DE4B 1I1AC 2VXQA 5DHXB 3ARFC 3BCDA 1DSFH 3ARDC 2A9BA 3QIWB 3RYMA 5K9KB 3B7YA 4FMKA 2J1WA 2Y1ZA 4HKBB 5EHFA 1W0WA 1FRGH 1XGRA 2ZYSA 3LEYL 2R4RH 3DGGA 4KK8D 3WKYA 2AQ3A 3IT8D 2OMZA 4LPCA 1MHEB 4PJ5B 3ZOAA 1RZKH 5ESQA 4ZMQA 2AI0H 4TM9A 4DVBA 3NDZE 3QWRA 1B6UA 2ICCA 3QORC 3BP4A 1ETJA 1ZEAH 5FEBA 4Q2ZB 1TYXA 1TQCC 2E7HA 1CLYH 2YAMA 1FNFA 4JE4B 1GY1A 3HOGA 4YEFA 1S7XA 3TZVC 1SMDA 3OHXC 3SPCA 5C0CD 3JTTA 3GTNA 5IVNA 2PLTA 1TXKA 3GEWB 4JFFB 5KSBE 4AMWA 4GKNA 2FR4A 1MCLA 4YDIL 3AMKA 2YUVA 3ZDYB 2VWEE 2R0WL 4O2CA 3VE0B 1WIPA 3FMGL 4EI0A 3BAJA 3ZQWA 2OJEA 2QR0B 3QRFM 1W0VA 3TA3A 1EO5A 1QEXA 3QIWC 4RGOH 1IT9L 4UQEA 5LXGH 2V9QA 3OKEA 1M7IB 4U1MB 3QZWG 2P8PB 1BYOA 1IQWH 4JK0D 1X5FA 1A7OL 5F3BA 3ARGC 4KH9A 5FHAH 5LNGA 3OZ9H 1CURA 2IMNA 4DEWA 3QT2A 2FHBA 3HAEA 1UZ8A 3WE6A 3IAQA 1WWAX 4F8PA 1JHKL 3BAKA 4XVSL 3P4MA 2IFGA 5F6IC 5F7BA 3QORB 3LS4H 4LLVA 2A6KB 3PWPD 3QJHB 3CQFA 2YEZB 2HJKA 3QDGD 1V3LA 4NQCD 4MD0B 2XETA 3ARSA 4H8HA 4ELKA 3PLYA 4Y4FB 4ZTOL 5A40E 1OB0A 1SRDA 2WVSA 4DP4X 3CN1A 3TZVB 4AQAB 2HT2D 4ZZKA 5H4YA 1KTBA 2V5MA 1X5AA 1EO7A 4M48L 3FK3A 2FJFA 3QCTH 2AK4B 1YMMD 4XB8A 4EUPH 3RTQD 3TEUA 2YAQA 2Y72A 2BHUA 2DMGA 3V52L 4FNPA 2CA3A 4AKOA 4O4YH 1KCKA 4PS3A 4L5FL 2BFVL 1N6VA 2V9TA 3MNVB 2ZUXA 4M5SA 1W72B 3FH7A 3RPIA 2DYPB 1X4XA 1ZK5A 2QSTA 4M93B 3OV6A 4ZMZA 1BAGA 3VMOA 2NR6A 5GHWL 4CKVX 2ITDB 2NZ1A 4HIIA 3IDMA 4FTDA 4NJ9H 1AI1H 1PZUB 2E6JA 2YXWA 4GLRI 4LLMA 3RJDA 3AXLA 5F6IB 2I07A 4LVOB 3EBGA 5FAAA 2PTVA 1IGJA 2B1OA 1CBJA 1XXFC 4UU9A 5I76A 4X6BB 5SWSD 2F8VA 4DQOH 1XGPB 2D7TL 3L16A 3PL6B 4HZAA 2WLZA 1I3VA 1MFCH 3NRPA 2BM5A 1VA9A 4JFWA 3O0RL 5IOKA 2AEPL 1TZHB 4E9RA 2GTWA 3MV01 1QACA 5E2UL 4YCQA 3OC5A 4NLHA 2QKIC 4XZ4A 4GQRA 2PNDA 3QWOB 4X4YB 1AJ7H 3TNNB 1N5YL 4MR0A 3ZTJH 1SQ2N 2XKSA 1EGJA 3GT6A 1FNGA 1IMHC 4IJ3C 5MERB 3QQDA 5D2NC 5AW7B 1NCCL 2X4RA 4YHML 2F18A 2AQ2A 1INQA 2IV9A 1BQHA 2ORBL 4X0KB 4G80A 5L2JA 5J4MA 2ADJB 3MR9A 5F7FA 1PZAA 3WUWB 1EDHA 2DJMA 2FQGA 1WT5C 3E8VA 5D7HA 1CFBA 3NOIA 4M43L 2ARJB 2VXSH 3ILPB 4YGVA 4B7IA 1WIOA 3TURA 1YNKH 2GIXA 4UDTA 3I9GH 4PJ8B 4TSCH 2BWDA 4PJBB 5IT2L 5DDHB 3UTSB 3D1MC 1HVXA 3WXWL 3VRJA 4BJLA 4BXVA 1QLFB 2BLFA 1F86A 2JV6A 2W81C 1G6VK 4PRIA 5I73C 1UM6L 2DQDH 4FYSA 1R3KA 3SPIA 2C7UA 5D9SB 1JGVH 3TPUB 2DQHL 3O2DL 1LD9A 1QRKA 4AL8H 3MRQB 4XL9A 1NKOA 5B8CB 1MY7A 1H15B 1RD6A 5CZRA 2WM0A 3ZHKA 3EGDA 2YXFA 2GYSA 2HFEA 4BQCA 2CJUH 2HFGH 4G6JH 3HMXA 3KYOA 2QBWA 3VXTA 1TTUA 3LS5L 2AQSA 3I6KA 4YHZH 5DNSA 5CR8A 5E2WH 1ADWA 3MOAH 1T5XB 2CJ3A 1G7HA 2VKWA 1USZA 4GT7A 4NKMA 5ESAA 1N26A 1ET5A 2VUYA 3NJFA 4DW2L 5IKCB 4OZFA 4G6MH 4G1MA 1KXHA 4FLHA 2F53A 3VSVA 2J4WH 4N5ED 4E5XB 2A99A 4PJAF 1VACB 4J12A 1X7TA 4QHLA 4P9MH 1PPIA 3G5ZA 4LASL 4ODHH 5D5MA 5DA0B 5IQ9B 1DVFC 1ODAA 1UB6A 4F1ZA 5I73B 2XJKA 4NO2A 4FHKA 4Y16C 1MFDH 4N0UB 4WEBH 3ZL2A 5C6TL 4U33A 2AEPH 3NUKA 2CO6B 4NCC2 4X6DA 4PV8B 2HT4D 5HI3C 3QNXA 2Z31A 5T1DL 3D3VE 2AEIT 1FORL 3K46A 2EH8L 2E4FA 3U6RB 4PGCA 2G5UA 3WIHL 1I7UA 4HUWA 2DLGA 1CGXA 1TCRA 35C8H 4ZPVB 3Q5YA 5L0QC 3VD0A 5EA0H 4S1DC 3RILA 3WEBA 3N9GL 2GQHA 4BFIA 3FF7A 1BQUA 5I8OL 4P2OD 4ZK8A 2ZXQA 3IGKA 1E67A 3M8OH 1FZKB 4FQQA 3U9UB 4XPAH 3ESVF 5D1ZB 3W81A 3LKQA 3MV8B 4LHJB 3PCYA 3QAQA 5AW1B 2GJPA 2IH3A 4Y16B 1LYQA 5DWUL 3FU7A 4AQ1C 1UENA 3ZKND 1B88A 2KPWA 3M6DA 4B6ZA 3VGFA 5KOVC 3KHQA 1NC4D 4HKZB 4J3TA 4NPKA 1BWMA 5K9QG 4BKTC 4F2ME 2VZ1A 4ZFGL 1ZHKB 1WC7B 3H7BA 3EDDA 1OOCA 1LWJA 1TYJA 1UT1A 4XB7A 5H4ZA 3EF4A 1I9IL 2X9ZA 3QZBA 5EBMB 3CBKB 1CI3M 3HE6C 2ICWA 4P59L 1T04B 2DH3A 2JIXD 2NPLX 2V37A 1O0VA 1S7RA 4W9GC 2EIEA 3QJXA 4Y1AE 3V0WH 4FZEH 4HUUA 1KG0B 2VR5A 4O58H 1ZXKA 1FZJB 3FRPB 4H88H 4W9JC 3F7QA 4NHUB 4FXGA 2G4EA 2JB6A 3RVWD 2R1YB 2W0FA 2ZT9C 3K80A 3MYJB 3QI9C 2EKJA 5DS2A 5IVXB 1PMYA 3O2VL 2YD7A 1QLEL 3Q0HA 5JO5A 2X4OB 1NC2A 4KV5E 3V0AC 4HWEH 1XT5A 2Z4TA 4Z7IA 1YEHH 3KW8A 2H3XC 5D2LE 4CILA 2CGRH 3MV9E 2J6EA 1XG2A 3NK4A 1PTZA 1KB3A 2DQJH 2VJ0A 1TZIB 5IVXA 3VSUA 4ZRGA 3ZE0B 4AIZA 2FUTA 1NDMB 1VGKA 4K7FA 4DW2H 2CKBB 5JUEH 4NYLA 5I2IB 2F1BA 2PUQT 2HJFB 3B6SB 1S7UA 1C16B 3GSNH 5I26A 4Z7WF 1N6QL 2NXZD 4XTRC 3VGAC 1O6SB 5DJXA 1G9HA 1YEIH 4IEFB 3WXVL 4CSZA 1KCRL 1JK8B 3EUDA 3X17A 3LQAL 1JGDA 1KNOB 1M9SA 4WEMB 1QX1A 2OZ4A 5KSBA 5ITBH 1RPUA 5AKTA 1YY8A 1CQYA 1BREA 3FCTA 2VITB 1YPZE 4M61B 1ZSDB 2ZWSA 3IJYB 2BSED 2IH3B 4Y16A 2ZOUA 4WHCA 4P06A 4LHUB 5C07A 3LKQB 3MV8A 2IWFA 2FO4A 4JVWA 3DROB 5EA0L 3BP6B 4XNUH 1AFVL 2XVKA 2EUVA 3SBWC 2QVKA 2NUTA 4HEPA 1GMIA 1OW0A 1WFNA 3Q13A 1DSFL 2WXQA 2VBKA 4FTVE 5TDNB 1IB4A 2LFEA 1Q0XH 3GJEB 4PJDE 3IGAB 1WCQA 4PGCB 1FNHA 4RISL 4L9DA 2CR3A 3P3UA 5IQLA 4CNIA 5GSVA 1TVHA 5E2VH 1E42A 1A4BA 4PUBL 4JFZH 1N12A 1OCCB 1EERB 3BYTA 4LSVL 5EZIL 1IC5H 3K2KA 4AVIA 1AHKA 2FZ3B 1HZHH 2BIMA 4UWQB 1CFMA 1S7SB 5C7XH 5IW1B 2WQWA 2WC7A 4HHWA 3FFOA 2YC1A 1RUAL 5D7KD 5IQ9A 4PRPD 3G5ZB 5MEND 3GIVA 1FC1A 4Y4HC 2ZOKA 1A64A 1KTLB 2A9MH 1VACA 3D52A 3RY6A 3U9WA 4NZ8A 4WO4C 2K8MA 2K6YA 2F53B 4M6OH 2P8LB 1UXWB 2JJWA 3BEWB 4X8JA 5FLUA 5A2AA 5DJYB 3D51A 5MEPB 1KIUB 1I75A 1UACH 5FFGA 1NSNL 3R19A 3UYRH 1NKRA 2VDKH 5EEZA 4W68A 5BPPA 3PU7A 3CMOH 5GGTL 5B1CA 1E5CA 5C3LD 4Z05A 5D2LA 2ZAHA 1KJ3H 4JMNA 2EUWA 1UD5A 2I25N 3O4LB 4GY4A 4KV5F 4WI2A 4P3CL 4XLFA 3IETA 1AMYA 2D3VA 4MDJA 4ZUSB 4DVRH 1AD0B 4NLAA 5KYNA 5MENE 2NX5D 5KSAB 3BVWA 3F7RA 3N0PB 3CSFA 1N64H 4UV7L 3QULA 1IAKB 5D1ZD 5SWSE 5D4JA 4AYBA 1QW9A 4N0FA 3HRZA 2NT9A 4BINA 4K3EH 5LGJA 1CTMA 2A0LC 3MRNB 4Y19B 5LCVH 3T4YB 2F8OA 4LGPB 5FYJH 2ZSWA 4XWGL 1E9OB 3DO7B 5F9AC 3OGCB 2IDUA 4WI3A 1PLAA 4Z3GA 4MD5B 4PJDB 4WDIA 1GRWA 2HVKB 2K7QA 2EIZB 2WMPA 3IDIA 4OLZL 1LO0H 4UZSA 2VXVH 1WTGT 4NNYA 4LLUA 4XP1L 4EIZC 2AKRA 3SDCB 2B15A 3TO4D 1UCTA 2YKKA 2B0RA 4MCMA 4XP6L 4ZFFB 3QUYC 4TUJA 3BQUD 1CTNA 2AJYL 2HJLB 1WE5A 1JGLH 2GC4C 2J2ZA 4L4VE 1MCKA 5FXCH 1FI8C 2X1QA 4L8BB 4LSQL 5J3HD 2DWXA 4G8EA 2CUMA 3WY1A 2V4LA 4RETB 5HGDB 3EYOA 5I8EB 4HK0B 4L1LA 2YQ2A 1D5BB 4KNUA 4AEFA 5EUKB 1JNNL 1JCVA 3S9DB 3E8UH 3UZEA 2B5IB 3QWOA 4X4YA 1PE9A 4B9ZA 3HCVA 4Q0XL 2C3HA 3O41B 4F27A 3DX6A 4DFIA 3EW3B 4PI2A 5C07D 5JQ6H 1ZLEA 2YN5A 2Q8BL 3GB7A 3APDA 3PQYB 2F3LA 3D12B 4N2MA 3MRJA 2WXMA 4KNSA 4XP4H 4XMKH 1OZTG 3NZHL 4EVNA 1AY1L 3T3MF 2XXFA 3TF4A 4OLVH 3GMLA 1XXDC 5F7MC 2J8UE 4CU6A 1RMGA 1FE8L 3FT2A 3SDCC 3BKCH 4R90L 4XAKD 3V95A 3INUL 4APQA 3WFCH 3O81A 4X9HA 1PEWA 4R3SA 5DHVA 3GJFH 4CJ0A 1KGCD 2WUBL 4OT1H 3QIUD 4XN7A 4A7QA 4GSDH 1FNSH 1G7JA 3M46A 1HHIA 3ABGA 3S4SA 1LHZA 5EZJA 2AXJA 4TYUA 4AXWB 4JFYA 1IE4A 4ZAKD 3VNYA 1GHFL 2WQVA 4QRQA 3QRBA 1GOFA 3DX9B 5HHVH 1Y07A 2XTWA 5IESL 1JN6A 5E08H 1T03H 2FECI 4N8PA 1E50A 1JPSL 2NY0D 1X9UA 4GRWE 4B0MB 2WYHA 2A7BA 3CH8A 4D0BB 3IXAB 3GSNA 1N7ML 3TT3H 5BMFH 4QXTB 2WOYA 1BFVL 4G6AC 3SGEH 2FAUA 4CC1A 5DUML 4C55A 1DQIA 1NSNH 2JI1A 4AEEA 5CD5D 1ZA3A 1X5YA 1YJDH 4IRZL 3RGVA 3BRGC 4UBDC 3NTCL 4PTTA 1T7YA 2Q2LA 1U3JA 4OIFA 5DTFB 2A6KA 3QJHA 1OGPA 4DKFH 4OCMC 1RZ7H 4MNHA 4E0RA 4I77L 1ZPUA 3KBEA 3L5XL 3W37A 3CPLB 2X4NA 2WVVA 2XT2A 2ZNWA 4WK0B 4N9GB 3TWCL 4FFWD 2NZMA 3S37X 2V7NA 5C0GB 2Z91A 4LDOB 1MIML 4EZKA 3RIFK 1H9DA 2JTYA 4OKVB 1HZLA 1TYUA 2FEEI 2H5UA 3GSUA 5AKVA 4OZGE 3ZRCC 4HZLB 1T2JA 1IDJA 4PTUA 2F7PA 4TNFA 5KZCB 1VFBB 2VAJA 1A1NB 4HLEA 1IKFH 3GGWB 2ITCA 4AYDC 3T09A 2O6WA 1T1XA 3N55A 4JZOA 4YXHH 1NBYB 1KLGB 3L9RB 1BFOB 3FO2A 3FSAA 1YN6B 3NRFA 1GW6A 4JCLA 2O1DA 5T5FL 3RVUD 1PIFA 4HWZA 1VGEL 4LAJH 4HCRH 2G9HB 2PYGA 1D5XB 5I0XA 2R4SH 2EH7L 2O30A 3WENA 3ZO0A 4X6EB 1IB5A 1OK8A 2APWA 4XN3A 4IBSA 2MCAA 1KPUA 2NY2C 4KKCD 3AG4B 3QIUB 3V0EA 4PGBB 3DK2A 5CINH 5DQ9B 2V17H 1GYCA 2HG5B 1R3IL 1RPKA 1TQVA 3WFBH 2J8HA 3RA7L 4YMPA 3AU0A 1B3IA 4LSUL 3DPBB 5I74B 3C08L 4G7SB 2N01B 4C4KT 3IDNA 3RAJH 3FO9A 2Y3NA 1XX9C 4LOVA 2A9AA 4JRYB 3MV9A 4X7DC 4BRJA 1IC7H 3LXUX 2O17A 3SUCA 4U6XB 4FHJA 2VLRB 9CGTA 3TN0A 2DQEH 4A2DA 2ETWA 3M1OA 1P7KB 2CXGA 3Q7JA 5FKAA 1MCWM 4XO8A 1MFDL 2X1WL 3MJ9L 4DK6A 3F6LA 4KI5D 1NWPA 2CBMA 1JVKA 2Z1KA 1G7LA 1NEZB 1RVFH 1IEBA 3BVNA 3LHAA 4NQCA 2L3BA 1DUYA 3LD8C 1U8HA 2XBZA 3S88L 1TEYA 5AYTA 3Q5TA 3MUUA 2ZE0A 2LAGB 5BVPH 2E7DA 2ADFL 1ZIBA 3QIUC 5J6GB 4X98B 4XNXH 2DYSB 5ESVB 5B3JF 3X11A 5D1XC 5IJBC 4KKAC 1HZKA 4M29A 2KYIA 3RL2A 5I74C 1ASOA 4YIQA 2NNXA 5IF0B 4KU1A 3O3DA 3EYVB 3GXDA 2J8IA 4A37A 2H2PD 3IJHA 4A04A 2ZUSA 1WSST 1ITBB 3X11B 4N1EA 2Z7UA 2I60L 3GPEA 1B3JA 3LRSA 3HPJA 2G3ZA 2XIDA 4PIRF 4ONOA 4EDWH 4UOJA 3C5ZD 4PCYA 2VLME 3DJZA 3JT2A 3KL0A 4PRID 5F7KC 4QTIH 4ZX5A 1YCSA 4HEME 4F2EA 5HYSB 1BD2E 5HHME 4GUCA 3STZA 3EJUA 3QB7C 4JREC 4YHYB 2R56H 1YEGH 4M5ZL 1DVTA 4KDWA 1II4E 2RJMA 4MNGA 4NK6A 1TENA 1AP2A 4Y5XC 4CU7A 3IDYC 3QCVL 1KGYE 4GRLA 3NZ8A 3PIQA 4H1LA 3MCLL 3L13A 2HRGA 3BMWA 4RESB 3ZW3A 4OQTL 1JIBA 1LO4L 5ES4B 1N5AA 1MKFA 1EJFA 4OIAA 3SCMD 3BUQA 2FL5B 4M1GL 5EC2A 5T5NG 4HIJA 4OD3L 4BK4A 4N0CD 1IAOA 3GMNA 3K81A 3OHXA 4N2HA 5EZLB 2BXYA 4GXFA 3QG6B 1GIGH 2ZWKA 3QDMB 1AMXA 3VXMA 4DUWA 2QVTA 2XV3A 1U8CB 5B1JA 4IS6B 2QDWA 4AI7A 3BGMA 3CFMA 3QW9A 2RH0A 3ESUF 4OZIE 1QJVA 2G9HA 2F19L 4PRPE 4YHYC 3MCYA 5JR1L 3HBQA 1KC5L 4FI8A 2PWHA 5CLWA 3VJ6A 1ET8A 4PLKC 5HDRA 4B9PA 3QWNA 2ITCB 4PBVC 4YDJA 1GL4B 1KOAA 2WXFA 3HI6L 5E99L 5I1IH 4RBPH 4UNTA 5HGHB 4FXKB 4Z7VA 1SUJA 3BH8A 3MTRA 4XPFH 5GRWA 5IHZA 3FYEB 4OD1L 3MKGA 4YGAB 3FTYA 4QRRD 4FKHA 2OFQA 2WQ8A 4M4PA 3EFFA 1UHVA 1MLCB 3GBLA 1QVOB 4YK4C 2WIMA 3KEDA 3UG4A 2X89D 1O5PA 4IKJA 3KL3A 4KTDL 3TBBA 3C2SA 4K94C 3U46A 1UASA 4E0RB 1QWUA 2EEXA 5EU4A 2X6UA 5D96B 3VA2C 5C0IA 2YARA 2HPOA 2GTQA 2I9TB 4HQQH 1HZHL 2X28A 3ALWA 4HPOL 4GKLA 4FQ2L 4TXVB 2DWDB 4ORZC 1UVQA 2DTSA 3KXFA 3ZKMC 4NUGL 5T5NF 2B9AA 3VRLF 4NB7A 5JW4M 3QDGA 3RPKA 3HC4H 2WO4A 1DANU 3B1UA 2QSQA 3IU3B 4R4BA 1YY9C 2IDFA 4RMWA 4JQVA 4FXKC 5CLXA 1NCAL 4YH6A 1XCWA 2Y6SD 3S34L 3WKPA 2GIYA 4GB9A 3OLGA 1W8OA 3REVA 3LV3B 3F01A 2EYSB 4KKAD 5IMLB 4BSWA 1IARB 3QPKA 5GQBA 2WXRA 2R59A 3VFTB 3VGBA 2MTAA 1KTKE 1D6EA 5CIPA 4TSCL 3UGUA 4QTFA 4AXWA 1N8ZA 1RHFA 1SJHA 2PWFA 2GUYA 4FEMA 2GTZB 3VXUA 1PZSA 1FYTD 3HZMA 2YRLA 1N70A 4A7UA 1GKOA 1YAZA 4P23B 1U91A 2R69H 1VENA 3PWUB 5DEZA 4BFGA 1KLUA 5HHQB 1PG7H 5DF0A 4QEGA 1UM4H 2H3NA 2A9NL 3E9UA 2WLMA 4X5XA 4HJ0D 1PYWA 1J11A 4K94H 3V6OE 1A8JH 1KMGA 3H54A 4FYQA 3EH1A 3VYOA 3TXAA 2BY2A 5ANME 4ODTH 4YELA 3WNIA 2EYRA 4GP4B 4C83B 4DP5X 5I1DB 5J6HA 1I82A 1OAYH 5JPMC 5HVFB 5E99H 4NZJA 3F7YA 3S8FB 1R75A 2X42A 5JPNB 4XMXA 5ICYA 5ALBL 5BOZG 3GSOB 1JHTA 1E4XH 2P5PA 5DUPH 2NNAB 5DO8A 2H32H 2LAAA 5E2VL 4AM0A 4U7KA 4JDTH 1H0DB 4QOKD 3UAJC 3HZYA 3WIIL 3SOTA 4QJ5B 5CEXB 1A6AA 4UT6H 1SXCA 5I1KH 1C8QA 2E9JA 4MJID 1FIGL 4HIXL 4I3GA 2BHYA 2EE9A 3PPSA 3MODL 2OXHA 4PJDA 3RVWC 3BZDA 1BZEA 3ZMRA 2R15A 1U58A 3EO0A 3MGAA 5KSAD 3TT1H 2NY4C 4QTHB 4LSRL 5FUZH 2BOBA 2FBJL 3MRPA 3GO1L 5I5IA 3ARRA 3H53A 3IMRA 3T4YA 3LZLA 3CG8A 2KLTA 2N7BA 2IANA 1IVLA 5KSVB 5D6DC 2ZCHH 4Z7OE 2WNKA 2NSQA 2VZSA 1IAKA 4GW1A 4JGNA 2ATKB 2VAAA 5KN5A 2YPLA 4K9JA 2VN3A 2X4UB 1P5VA 4DVRL 4Z7UF 3K7UA 3O4LA 4MQTB 4YSCA 3ISWA 5KOMC 3AB0B 1BXVA 2NY6B 5I15H 4MYWB 1FNLA 1I8KA 3C75A 2FHCA 3FQ2A 3CFBB 3V5DB 4CVWA 2EXYD 4QRRA 5F3HB 2W9EL 1F90L 4QJ3B 3E2HB 5AOMA 2VOTA 3X2QB 1QI3A 4QRBA 5DJYA 2HVJA 1YEKL 3OKMB 5FLVA 3VI3B 2IIJA 2V3EA 1CICA 3T1WA 3RKDD 4PGDA 4PBXA 1QFWM 4PJCE 3CXHK 4MCZA 3VXRE 1QRND 3OAWA 3WL9A 2RD0A 3PGDA 3E6HA 3IKCA 2OXHB 4DESA 1TQTA 4CBPA 4GG6B 3GRWA 4CADA 2YBGA 4XMPH 1DVZA 3FB6A 3G6JE 3FTGB 1ONQA 7FABH 3OLIA 3X1BA 4FJ6A 4ODTL 1VEMA 5SWSB 5ACLA 3QWQB 4M1DH 2OP4H 4Z5RA 4IIZA 3V6ZB 1O6TA 1K6QH 1L3WA 1L5GA 2WBJA 3ULUC 3FONB 4Q7DA 3B34A 1F4AA 4G6FD 3JQOB 1BEYH 3WY2A 2D7NA 3EYUL 2DY2A 5F3FA 3SGDH 1JMZA 1IA5A 5DUBA 4XO4A 3ZTCC 2UZYA 4HUCA 3UBXG 1H3PL 3UAAA 2HH0H 3FRUA 3D30A 3MA9L 2DLHA 4GBXB 3WO4C 2AJ3B 2VE6A 3ECWA 1Z6JT 4OLXL 2QKIA 4LIQL 1T7ZA 4XMLH 1GGUA 1ZVSB 2MFNA 5FW8A 3WNLA 5GGUA 4BH7A 4YJZL 3DARA 3UC0L 3PWUA 4OIIL 4EN3D 3G3LA 1CI5A 3BX7C 1OE2A 3BKCL 3HN8A 4DHLA 1DTUA 4OFYA 4P23A 5KUMA 3ELAT 3FQXA 4FG6C 4A1RA 1CF8H 4JY5H 2VC2L 4PLJC 4HJUA 2TRYA 1X9RA 5CN1A 2OMXB 2FYVA 1N19A 4DP7X 5F6HI 2QLVB 1X9QA 4S0TD 1DANT 3GFUA 3BUTA 3BZ5A 5E4EB 5BRPA 3L6FB 2YOCA 3ARBC 3WJMB 2AK1L 1T7VA 2BP5M 3UAJA 3ULVD 2EYSA 3NIDB 2BM7A 3JTSA 1EQWA 3PWPA 1RPQA 4MDIB 2HJFA 3B6SA 4JFVA 3ME0A 2B8OT 2XTJC 1OV8A 4KKLD 2CHXA 3NRQA 4K7FB 1TSRA 2BP3A 4GBXC 4JANB 1LEGB 3AGVA 3GO1H 2QMJA 4YX2H 2BIIA 4JLRB 3H09A 1SY6H 3E9TA 4JQVC 3WNPA 1TZIA 3ZIYA 3Q8AA 3PJSA 4RGND 4PREB 1P1ZA 2GEQA 4WTQA 1KULA 1RAMA 1H5BA 4YNYA 2VDPB 1OALA 2D31A 3THML 5IIEB 2ZX7A 2X4OA 3COOA 3KPOA 4HUNB 2Q7YA 2CO1A 2W91A 1DVUA 4KRPC 2APFA 2PCFB 1RP9A 3U7WH 3K72B 4P2RB 1NLDH 3EJSA 4G59C 2VZTA 3RWJA 4GAGL 2LTQB 3WLWD 2GJJA 3RX7A 2QPUA 3O8XC 1K8IB 5FM5O 4D9RE 1O8LA 1O8KA 5MP6H 2NY3B 1AG6A 1GGTA 2D0FA 3H42L 3NJXA 4MX7A 2Y2YA 1DFXA 2XTJB 4FXKA 3O0RH 1TTBA 4UTAL 1A7PH 4ZSOB 3FJTA 5EBMA 5HPMB 1J18A 2WGXA 1D5RA 2MPAL 2Y4SA 5C0EB 1YYLL 4TOYH 1E27A 1M7XA 3IFOA 3D48R 1UGNA 1CMOA 2HX7A 1YEJH 4DO5A 5IVOA 1RZPA 4NQXA 5IM7A 4W9ZA 5ID0B 2EXWD 5HYEA 4PM1A 4XGZB 5MI0C 1FHGA 5KSBF 1QD0A 2YUZA 3A6BH 4HXAH 5AVQB 3TBTB 1GW0A 4ETQA 2OMNA 3VXMB 1H8OA 4PJIB 5LBSA 1UKQA 4OLWH 5I1AA 1J88A 3RB5A 2A6IA 1NZRA 1HEZA 1ND0A 4XC1L 5AEAA 2C3GA 4FQIL 3T2LA 3LNHA 3ZT5A 1ZHNA 4X99A 3L7EA 1MHCB 2X4SA 2XSKA 5J9PA 3UJTL 4LEOB 5FV1L 3QFJB 3OMAB 1MH5B 4X6FB 5IROD 4YHOL 4B0MM 1OOWA 2BY1A 1V7NL 4AMXA 3CFCL 3MJ6A 1H6EA 5J11C 2W65B 5D7LB 4JGUA 3H9HA 3GSQA 5FA4B 3V4PH 5L7XH 1MWOA 5AQ0A 4PV8A 2UUDH 4PG9A 4PJ8D 4DPAX 4NEHB 4PYGA 1OL0A 1DJWA 5IMOA 3ASNB 4F8NA 3P30H 3STZB 2ZUTA 3DRTB 3K0YA 2FLMA 4WSKA 4XN1A 5ERWA 4JM2D 3K6IA 4JN1L 1HYSC 1GYVA 4OR1A 5D1QD 5KVFH 1NAMA 4HH9A 1DBAH 1SF5A 1DVQA 3VD4A 1JVOA 4AZ8B 4LLQA 1S5HB 4HIEB 3EYVA 3WG7B 2NCEA 4XPFL 1O7VA 5DD1L 5IKCA 5D2NA 4IOIA 2XU9A 3P0VL 1HNYA 2M26A 4GAYA 4FFYA 2ADGA 3ATAA 3SE8L 4AL8C 5GJTL 1NL0H 3VDBA 3FOLB 4Z3TA 2XVBA 3WHE1 3WGUB 5J11B 4I0PC 4E5XG 3AM8C 3K6SA 3F7VB 3KGUA 1AYRA 1XH0A 2ED6A 3D3VB 4AGOA 3L5IA 4CVZB 1BZ8A 4IDLA 1JDCA 1EXGA 1T20B 2IDTA 3QQ3A 1G7LB 1NEZA 2X40A 4QXGH 4X4KA 3T1FA 5I6LA 1XD1A 4TRPH 4A7TA 5T5FA 2NYZA 4JRLA 1AQHA 4JS7A 1LDPL 3ES6B 2VDLB 5K69A 5GS2D 2D2OA 1OSEA 4TVSa 1CIDA 2N3JA 4DP1X 4GSDL 1E43A 2IO5A 2Z7YA 4O5LL 4R6UA 4S2SA 1BVKB 3UTSA 4CAGA 1P4LB 3QWRD 1J9TA 1D2OA 2X88A 1P1VA 4K7PL 3RDTC 1FO0A 4MBRA 1HSBA 4AMKH 4NQVB 3WLWC 2R83A 2VDQH 4YGVB 1J9RA 3ILPA 4MAYC 2CWRA 4ZNEE 3BVXA 1KIPA 2LLLA 3BUIA 4OFYD 3M17B 1BQLL 1MWAH 2UZIH 1CGVA 1OPGH 4PN6A 5CP3A 3ZUNC 5H2BB 3BHBA 4OAWA 1AYOA 2XACC 3TF7C 4IGBA 2Q86B 4DUVA 3KLQA 3UPRA 4ZUVA 3VG0H 2HRPL 4HF5L 3AREB 3VXOB 3WNJA 1NBVH 3Q8BA 1LLAA 2QGBA 2NNFA 5ALCH 3ROOB 3U2JA 1GJWA 3U0TB 3JVGC 3JWDL 1FFQA 4G8AC 4AIOA 4LASH 5CZKA 3T65A 4GQPH 1CGSH 2IQ9H 1X5XA 2NY7L 2BVOA 1TZHA 3GI8H 1NBYA 3H4FA 4Y4HA 3BIBX 3U1QA 3L3DB 2WIIA 3GXUB 3QUZD 4QRSB 4M6MH 3ZYJA 2E74C 4MQXD 4NHCH 3IMBA 1QFPA 4KI5C 1O88A 3MLTB 3GSUB 2OSLA 1XF3A 4OD1H 2DM7A 2MOGA 3DI3B 1QYGL 2E3VA 1RZGA 3LKOA 1I8AA 5BS0D 2E9IA 1EFXA 1G87A 2I07B 3ULSB 3DX1A 3PWJA 3MRLB 3RL1A 2J43A 2FVNA 3BI9X 1KN2H 2WXKA 1KIQB 4ELMF 1ORSB 3MBWB 3ILQD 2HN7B 4HPYH 4NO0D 3LY6A 4KVCL 2EDRA 3Q9PA 4R97C 2NQ3A 3U1SL 3OKOB 2WLHA 5C6WH 5B1AB 4H8PA 3UAEA 1D9KB 3OMZA 1KEGH 1X5JA 4HKJB 2W07B 4KXZH 5FGSA 3ZL4H 5C7ZA 5D7JA 4KQ3L 4GI6A 2BY3A 1JZFA 3GXIA 3WUWG 1BBJB 2P3YA 4PSRA 4MZRA 1R5IA 3FY3A 3LSOB 1K4DB 4LSRH 5FUZL 1RZFH 4I9XA 2VDLH 5I8OH 4TUUA 4X4XB 4G42A 2WTPA 3MZTA 1HHKB 3UEZA 1QA9B 1WAEA 2DQTL 5C0AE 5FO9B 2ZWLT 1KPVB 1X5MA 1LEKA 3D06A 2MNUA 4FG0A 1T4KB 3C08H 3DX9A 1CR9H 2F5AH 3LMWA 4Z7UA 1MW1A 1M6OA 15C8H 4I4WA 1DBBL 3LZRA 5DD6A 5DD0L 4LCIL 4XVTL 3O11A 4QNPF 3GLAA 4JO2H 4Z3JA 4JDTL 5BZWB 3F62A 4KRMB 5KUKA 5DT1H 2R29H 4Y19E 3CSTA 4PJGA 3ZU8A 2ZX8A 2FATL 1D9KC 3DJSA 2OSLB 2E8ZA 1KGUA 2PO6D 3L7FB 2L04A 5FFLA 4LDLB 2QY1A 5KVGH 4KJYB 4HDIA 2WIIB 5D6CB 2VLJE 4Y2DC 3O6KL 2BDNH 4XMUA 4OZ4A 3EGXA 1MJJB 2DYRB 1XF4B 1QOKA 1J8HE 2WN3A 3QIBC 4F7EB 3QHFH 3U7AA 3KEHA 1A7QL 3DVNB 4UQIM 1Z9MA 2WY3B 5JYLA 3OZLA 1ES0B 1YQ2A 4W9FC 1ETZA 3GKWH 1RIUL 3UFIA 4KOBA 4DKAA 3AREA 3VXOA 1HCYA 1EHLH 2XA3A 3SO5A 2H1LM 2Q86A 5JIDA 3CVIH 4HK3J 2A74B 4J2QA 3DGGB 3F7PC 2ENYA 4ZFFA 3LVTA 3VYNA 3U4KA 1F4XL 1O7DE 4RFNC 2FJGB 5CUSH 3QZMA 4R7LA 4NQVA 5K5YA 1N4XL 2NXZB 3MREA 1F11A 2H0FA 2IWGA 2YMXH 3KPRA 1NCBL 5C9JA 3R8QA 4NXSA 4EUPA 4LEEA 5KBKA 4QF1B 3V9CA 3ES6A 1Z9SB 2DM2A 2VERA 5KG9A 1JHLH 4F7MB 4I18C 4OCWL 5FCSH 3U0PB 4QY8A 5HDBE 1OQXA 3QULB 4GP5B 3WNNA 1U93B 1E28A 3TNMA 1TZAA 2F2HA 3H56A 3QDJB 3KYMA 2OXGA 1A7OH 2BNQD 2F1AA 3OR7B 3BIKA 4GINA 5CAYB 2OBGA 4HBCL 3WKML 4WO4D 1JXFA 1J0HA 1PVHA 3EGSA 1Q0YH 3FO1A 4L1TA 4XBGA 5JA8B 2NX5A 4RZKA 2YLHA 4W1TA 1GQ8A 3LPFA 5PCYA 2IXQB 3VX0A 4G9FA 3SE9H 2HH0L 3N42B 2Z8RA 5L4IA 5JHMA 2BMKB 1NBQA 1UXWA 2P8LA 3BEWA 4X8JB 2VLKD 1F02I 4K8RL 4Z8FL 3WKNA 5JZ7C 1M56B 2ZOWA 1Z3GL 2R27A 3FQWA 3RWIA 1XGQA 3NJNA 3V4VA 1IUZA 2JJUA 5CEZL 1HWGB 4XN5A 2ZP9A 4NBXB 5I8KH 2HT3C 3VFUB 4M48H 4HJJL 2APSA 2E46A 1XIWA 4X5PA 2EEAA 5FA3A 5A3IC 1DJYA 2JQZA 5KVEE 3LB6C 1EANA 4TQIA 1A3ZA 5KVGL 3I84A 4OGYH 2D4DA 1T1ZA 1T7WA 1NLBH 4JG5A 5LWYH 4UILH 3U4BL 2MKLC 4P4RA 3KDPB 2MCG1 2O6CA 4EMZA 3QAZB 1TQWA 3NIDE 4PFEA 1TTRA 3L1OH 3GTTA 1U2HA 3R1GL 3LEYH 1FFOA 1KXTB 4PJCA 4N2EA 4A2LA 1RZKL 3ARFA 5LUMA 3TONA 2GSGA 2J71A 2NR6C 4GKOA 4G8GD 3KLSA 1J05B 1NFIA 4CMHB 1ACXA 3EZJB 3U4AA 4NZUL 4ZD3H 1N9PA 1IBGL 1KV7A 3BXNB 4Z76A 5I30L 4Q89A 3QUYA 2DLTA 4RAUB 1NIFA 2XTSA 3MNDA 1B2YA 4XWOD 3SY6A 3VQ2C 3VTMA 1I7TA 3F8UB 2F53E 2GJ6E 3K91A 4IIQA 5D93B 1R1CA 4WJKB 3IAPA 4F3FB 4YBLB 5J3HC 4LHUA 5C07B 1E30A 4XWGH 3RWHB 2VDKB 4ABQA 1BDYA 4AT6A 5E70A 4WWPA 2WUBH 4XN2A 4M61A 3PUCA 3S8GB 4XVJH 5CJQL 2YAHA 3QPXH 4NKOA 4OB5L 4Y4KD 4G8GE 1K2DB 3LEXA 4JZNA 1EO8L 4NZTL 1IBZA 1KJ2B 2FWSA 3EDKA 2LU4A 4IK6A 4ZW7A 3OZ9L 1B0RA 1EZSA 2ZXAA 2PXYA 3NCYS 1E4WL 2Z7ZA 4YHIA 2GITB 3QEUA 2J88L 4ISVA 3D07A 2VJ8A 1WAAE 2WK2A 1XBRA 3FYIB 3N1PC 5CEZE 5F7EH 1ZGLB 3VU2A 1RMFH 1XDTT 1ZANL 4TULH 3E8UL 1MCWW 3HG1D 4LPXA 1VDGA 3OMIB 3C5ZA 4KK6D 4M6AA 3OLDA 4Z7VF 4CVUA 4YBLC 1FHNA 1PLGH 3MRGB 2OPCA 2X87A 3QI9D 5D7IF 3NK3A 1ACYL 3DRQA 2EDDA 1T5KA 3QUZA 5DJCB 1F1GA 3TWYA 3UL4A 4DKFL 1UOWA 3TVMA 5F88B 4LF3A 1MAKA 2GKIA 3T6WA 4U1JB 2NY0C 2EDXA 4GAFB 4BE5A 5IJVB 4PREA 3HA0A 2K4AA 3ATBA 1YN7A 1MZZA 4XNQB 1WA2X 1J8HD 3OF6D 4OY9A 5IMMB 1Q0YL 4JLRA 4WI6A 4I3SL 1JPTH 4YZ0A 5TDPA 3FU9A 2ED7A 2VSCA 2I9LA 4JANA 4JKNA 4MQ7A 1JZ2A 4YDKL 4OVUA 4PJEF 4X9GA 4FZ8H 5C0AA 4BWUA 3O3AB 3ME0B 2WYTA 2X4PB 1C5CH 4F7PB 3MOAL 3C60B 2F8XC 3MCKA 2X89A 4P5TA 4MCYB 2HLFD 1FVDA 1CCZA 3ZE1B 2F6AA 1R46A 1RZKC 3G6JB 4J3OD 3F04A 5ENWB 2DF3A 3D0VB 3HMWH 5F97E 2GT9A 2PO6C 2JB5H 2WB1A 1HI6B 3FRPG 1WC7A 2YQBA 3H7BB 2DZEA 3Q1SL 5GISH 1JZ4A 3QUHA 1JRGA 1HHHB 1WCBB 5SX5K 1U8IB 4Y5XA 2DD8H 1P4IH 3ZK0A 3VFPB 3RGVD 4F15C 3C6LB 1PKQA 2VXTH 3ZPDA 3E3QC 1T21A 4M4RA 1WV7T 2QGCA 3PGFL 1OFLA 5AW8B 3WFBL 3QDMD 5IV2B 1TYVA 1PNDA 3ARXA 3S3JA 2J8UF 2QKSA 4MJIA 3UZEC 2HTKC 4FNTA 2BJMH 2ZJSL 4TNGA 3SQBB 3V2AR 1L9OA 2VWEC 4P49A 4D8OA 3ALPA 5FGBC 2O0WA 3DMMA 2PETA 3C60C 2UZYB 2FWOA 3B7SA 3JWNH 2HKHL 3MNWB 2PWGA 4TTDC 2QQKH 3EJQA 2R2EB 3EYQC 3CLEL 4KK5C 1PIGA 4LCCA 1MI5A 3CVHL 3PWLA 2Z31B 5DFAA 1SEBB 1EUUA 4KO6A 3K2IA 3IS1X 2CO6A 4X6DB 5BQDA 3TCLB 3TH2T 3X1EA 1KUMA 1S7QA 1RZ7L 4WEUD 3AZUA 2WUCH 2ZXGA 4X6CE 3P02A 1X5KA 2EXTA 3D87B 5I8CA 1DLHA 1FVEA 4RGMC 2R2HA 4PVMA 2QVIA 3L3HA 3BT2H 1M1XA 2MH4A 2M83A 4LARH 2B2XL 3T0WA 1X5HA 3DPDA 2CDGA 5AVXB 4JHWL 3UJIH 1RUKH 2HAZA 4ANVA 5KYUA 3STBA 3SYQA 3B9AA 4BHUA 2J3SA 3NCMA 4YC2C 2FB4H 4QHNB 4HOXA 1U8NB 3I75B 4M6NL 4PJDF 1UKSA 3T6XA 1R3IH 3QUXC 4GQQA 3RGHA 2XQYG 3HB3C 4H25A 2C3VA 2Q1EA 4XRCB 4ZO8A 1ECYA 2X4UA 1UWYA 5MEOA 1ZV9A 3ARZA 1B2WH 1BBDH 1ZSHA 2GIMA 5EIVA 3VXQB 1IC7L 4BQ6A 4L5FH 1M2VA 3IJ9A 4YHPA 1NCIA 2EDTA 2UY6A 4PWJA 4JRXD 3W9DB 5F71A 3FN0H 5T1LB 4L23A 4F37K 2Y24A 1I1YB 4MA1C 1RZJH 2B16A 1JDDA 3QJTB 3WEMA 3RA7H 3EO0B 2ZD0A 1G1YA 1CK0L 3U82B 1UURA 1EWHA 5FECB 3LRKA 1A1OA 2JQAA 4XR8C 1N2RA 1XR8B 4JFUA 3VFSB 3MRCA 5IVZB 2VZ3A 1TPXC 3SJVE 3FQRA 3QUXB 3G08A 3IAGC 2ICWJ 4PJAB 3KYKL 2OW7A 3MLUH 1P84J 3MLXH 2IGFL 3R06B 3KS0J 3QP3A 3HPLA 3VG9B 2X4RB 3QR0A 4M7LT 3MMEA 2VFMA 1GC1L 1IFGA 5D7LE 3AQDA 2DIBA 4R26L 3T5WA 4MA3A 5J8OA 1I1AD 4JRAC 4LDEB 2EQDA 4WZ9A 5FB8A 2WTRA 4LCUA 4C83A 5I1DA 5J6HB 1EXHA 3PHQB 4H40A 3DI2B 1KYAA 5DQDH 1SFHA 3LN4B 4J8QA 3SJVD 3C09B 3D2UA 1NCOA 5K9OB 1ZLUH 4PLKD 1CDUA 3QRGL 2AERT 3B37A 1OAXL 1L9TA 1TQSA 4RAHA 3S97C 2JLPA 4G1EA 3B9KC 3HI1B 3WEXA 4ZX6A 2QFPA 3QI9A 1RZ8B 5AVWB 5CZVL 4PMFA 2HTKD 1ML0A 1MQKH 4N86A 5DRNB 3BD4A 4LOUC 5JW4Q 1U8PA 1WUZA 3BE1L 1TPXB 1K72A 1IGJB 1YEDB 4JQIA 5F7DB 5GRJH 3G9VA 1SLVA 4LLMB 2VDRB 4DP2X 4HMEA 2N0MA 1CN4A 1BAFL 4Y2OA 3BO8A 4JO1L 4HIIB 4QHUB 1X9LA 3VG9C 1U42A 2XPGB 4K15A 3BYYA 1DZBA 2VZUA 2IC2A 32C2A 1O8FA 4KK6C 2PXYD 4ZS6C 3EOBB 1W72A 4FADA 1IQDA 5GGVH 2YZ8A 3PRZA 1MCBA 2JJTC 3UC2A 3MUHL 1OD7A 4X50A 2AEQL 3GK8L 3CVHB 3D5OF 1JG9A 2YEVB 1Q1PA 4B97A 1TR7A 2F1EA 4G7YL 1FNEB 2FJFB 1T0MB 4DQAA 2VQ4A 3RZCC 1FFPA 2VDLL 3RI5K 3OTTA 1K3ZA 1ZLWK 1IGYA 1A47A 1YMMA 2BNRB 5BJTA 1GIGL 1HK6A 3GMQA 2HJKB 1F3JA 3DX3A 2B3IA 2NDFA 5DJ6A 1QP1A 3E1ZA 1P6WA 2AGJL 3HR5B 5DSCA 2FUQA 2X2JA 4KI5E 4BZ1H 1L6XA 1ERNA 2GUOB 1KN4H 1HOCA 3BESR 2AQTA 2X7LA 2YRPA 2WP3T 3MGOB 4JHAH 4D9QE 4N24A 5JHAA 1M7IA 3C2AH 1MXDA 3EFDH 1FL6B 4OCRL 3MJ7B 4DGYH 3LEVL 1RZJL 3PG2A 5IHZB 3FUHA 3WDJA 3Q8CA 3HKZA 2UWEB 3BH8B 4NQUA 4Z7VB 1YPZA 1ZLDA 4R0LA 3VXNA 3VDCA 4G8GA 1I9EA 1P7BA 2CRMA 4MS8D 1NUFA 1Y18B 5D7IB 2BP8B 4UM9B 2XT4A 3IFNH 4K9EC 3RZCB 1RK0B 1WG3A 4OGZA 2VLRE 4BHUI 1RCYA 1R34A 2AJZA 1S9YB 2CO2A 5BV7L 3HKFA 1FG2A 4W9EC 1K85A 2VDRH 1XCQB 5DLML 4Z7NB 2XN9E 2VR9A 2GI7A 4UYPA 2V5IA 1XR9B 2P5EE 3MV11 2ESVD 1ACCA 1AO7D 4NKIL 3VFWA 2A73B 3TC9A 2WNXA 2V6HA 4Z06A 2FJSA 3VSQA 2XPYA 1H3WM 1TT6A 4H8WL 3L2NA 4J27A 2EDWA 1MNUH 4K0OA 4IJTA 3N40F 3GMNB 3OHXB 4NSKA 1KLFB 4BQ8A 3NJJA 4RRPG 4WY7L 1BOYA 2CSPA 4JR9H 4Q6IA 3FCBA 3WFZA 3RWEA 2R69L 2V5SA 4UAOC 5GZOA 3M1CA 5GS1C 5T1MA 1TG8A 3CX5K 4BSVB 4FFZL 4IBVA 1AP2B 2V7HB 1M7DB 1L6ZA 2JCCA 2UVEA 1UEYA 1JRHL 1SJEA 3C8DA 3K4DA 5H8DA 4MAZA 4QIRA 4MBOA 2XG4A 3P69A 5EV7A 5HHOD 4ZFOB 3INUH 1HF2A 2BY0A 4YHKH 4DO6A 1PAZA 1KXQA 4NIKB 5C09E 2F58H 3PNWB 2Q9OA 3VB8A 3LQMA 5KANG 1IKOP 1RU9H 5GGVL 4NDMA 4L4TD 1HSAB 4AEIH 3PDOB 1CFSA 5IEKB 5INDA 1YEKH 2HKFL 1A5FH 1B9ZA 4UI2A 1HE7A 3VI3E 1VKXB 3NCXA 5F7EL 1YEHL 5BRQA 5I5MA 1OAZL 4E9LA 1WISA 5L8LB 1ED3A 4OCRH 5EPMA 3Q01A 4OLUL 4WFHE 2OJZH 1IM9D 3LHPL 4XI5D 5IEKA 2W0PA 3PDOA 5DVKA 3RDJA 1U30A 1UB5A 4WFFE 4FA6A 4HUVB 2MQGA 4NHCL 3QZWB 3UTZB 4XN9A 4MFHA 3TASA 4NOFA 3VXSE 5IB5A 5CWSA 1RHHB 3MUGB 4CL7A 2AGJH 2F74A 2JLLA 1FIEA 3RFZC 1F3RB 3D2TA 1RJZA 4G6AD 5GXBB 1TIUA 4IKKA 1VPOL 2FIKB 2Q2EB 2Y5QA 3BW9B 4S0HA 4PYHA 1IDKA 2IV8A 2YXMA 2QPSA 3GSRB 4UTCA 3QIBD 2YJLA 3A6OA 5AZEH 4YEEA 4LSQH 2J25A 3VGHA 4OFQA 3V6OA 1I7RB 1V3KA 3KPSB 5DVLA 1S7TB 2R2BA 3RWCA 4P5MA 2OQJA 2VZOA 4L3CB 3DPBA 4ETYA 2XNAB 2YRZA 3LPWA 2QQLH 4ZD3L 3MOBL 3TTYA 2V5YA 1QRCA 1INDH 3QCUH 1YUKB 3MFFB 1A4KB 2DWYA 2VMJA 3P0YL 4OIIH 5FYLD 3UC0H 1NGQL 3PP4H 3DO4A 2OMYA 1KLFA 3EZ8A 1NFDE 1TJGL 3GJFB 1CFQB 2YUWA 2LU7A 4GOSA 1PZDA 1S5IH 1BVZA 3DOSB 1UEMA 2QQNH 2VLLB 3BZFA 3MV8D 3TCTA 1T7XA 2XN0A 3T2OA 1U6AH 4L9LC 3LYCA 3F6JA 5D72L 2B4CH 3AT9A 4HC1L 5IK3A 5LHDA 4XVOA 3BDYH 4F92B 2LT9A 4QI3A 3RBSA 1J5HA 4U1NA 4N0YL 1DABA 1I3RB 4FQ1L 5JIKA 3J8F7 4XCNB 1G84A 3P4OB 2EIJB 1OKEA 5FDWA 5C7XL 3B9KA 1OSPL 4ZMXA 4WU5A 1YPZB 4I0KA 2AMGA 3CN0A 4YQXH 3ULUL 5CCHE 3V6FA 4Z7UE 4N9GA 2BW5A 4PJHB 4F20A 5T8IA 1TETH 1A9EA 1FL6A 4M03A 3ROLB 5B8CC 2YPKB 4HETA 3SDXB 5T3XH 5FM4A 1KCUH 3NFPA 3GQ7A 2ID5A 2A1WH 2JKXA 1DQQA 2F53D 3DDGA 3GZQA 4U6HB 5IOPB 4S1SH 5DMIL 4HGWB 4ODUB 2YFNA 3GZOA 5GGRB 4L8SA 5GS0H 2YD2A 3D39D 5I0VA 3OAZH 1X7QB 3EDEA 4YE4H 2IG2H 2X2UA 1T1YA 4NJ9L 3GRGA 3S3PA 5KBLA 1JWUA 2VDPL 2FYYA 4DOHE 1KB5A 3DURA 4RWYH 4XHJC 5D70L 1S2EA 4J4PA 3HZKA 3O9WD 1Q94B 4L4VB 3I9AA 2BSSA 3SGJA 4O58L 3QH3B 3HG5A 1F4XH 3B3IA 1EMTL 5I16B 4GKSA 5D1XD 2XWRA 2P46B 4YR6B 1HXMB 5BZDB 3B2UD 2XZZA 4JFYB 1QFUH 4N6RB 3DVGB 4LKXA 3NZSA 4WUUA 1EE6A 5AW4B 1OWWA 1WBXA 2D9QB 2QQLL 3H7LA 3INOA 3MFGB 1VESA 4PD4K 1YNTF 4KITB 1FFTB 4XI5C 1JZ7A 1RUMH 2NLJB 5I1GL 4O51A 4HIQA 4XBMA 3EXLA 2MNWA 1HXMA 5BZDA 4M5ZH 4M9OA 3P40A 3BQUB 3RVXD 2YBRA 4WI5A 5KYWA 2JQMA 4C56D 4QXWA 2B1HH 3Q2NA 2FTAA 3KS0H 3VWJA 3U7YH 4U1SA 4AV5A 4KZDL 1ZVNA 2D9CA 1HXYA 3WFHA 3DA0A 3QPQC 5D1QB 3C5SA 1M4KA 4TPRH 1JWUB 1V10A 3IN2A 3O41A 4A7SA 1QI4A 3EHBC 2UZXB 4LP8A 2X70B 3MSPA 3A0OA 4B96A 4JO3H 1HDMB 4Z7OB 4GXVH 4LO9A 4I87A 1U8LA 4GW4B 3GUTB 1CQKA 3EYOB 5I8EA 2DYPD 2NUPB 3GF8A 5CBEA 2WTRB 4TNWF 1MW2A 4G8EB 3H0TA 1F41A 5KYYB 2WXGA 3D4ZA 1P5UC 3BAIA 1AHWA 1MCFA 4XPTH 2J2ZB 1AGEB 4ABVA 4JFDB 4B27A 3MMEB 1J12A 3GYRA 1TKWA 1RUQH 4HMCA 3QXDA 2QSCH 5ADPH 1FVCA 4LLUB 5D72H 5JR1H 3CU1A 3WTTA 4ZI8A 3BJLA 5E2UH 3QR2A 5IVZA 1OANA 5IHBA 2J8OA 3CNKA 4P5SA 3IF1A 3I50L 1I3RA 5D1QC 5I1IL 2AV1B 2C1PB 5IQMA 2QJDA 2BW4A 2VLKE 2ZUWA 5AYUH 3ZO9A 1CG9A 3DIFB 1HCFX 2FT8A 4NZUH 3WI9A 4YDTA 1A6TB 1VADA 4ZXBA 2E76C 3R4RA 4G3YL 3GS0A 3HS0C 1FC2D 4TSAL 4J4PC 4MDJB 2A4EA 2CHNA