3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
1OGSA 2ZX7A 2X6YA 1OGOX 2E0PA 2VNCA 3BUIA 1O7DC 3WY3A 1PLUA 3L4WA 3W37A 3VO0A 2EO7A 3HG4A 4AMWA 1IB4A 4UQEA 1OB0A 3T9GA 2WVUA 1DBOA 4ATWA 2FH6A 5CGTA 1D3CA 1JXJA 1CGXA 2UVFA 2EJ1A 3WWGA 3ZPPA 3A6OA 1O8LA 1CLVA 5CXPA 1KTWA 2O17A 1VFUA 2X2HA 1CXEA 1PJ9A 1KWKA 3BMWA 1A47A 1IV8A 2ZUVA 3DX1A 3QGVA 4JL1A 1DHKA 4FMVA 2DH2A 3H53A 4GINA 4NZJA 2OW7A 1JD9A 2ZXDA 3B90A 4XLCA 2ZXQA 3CLWA 3S2CA 4YELA 4FNRA 3L2LA 3VX0A 4OGZA 3OLIA 5E9AA 3EJTA 3B4NA 4OJPA 2ZWZA 2DIEA 2ZX6A 2YOCA 3A23A 3BC9A 3VM5A 1E3ZA 1MFUA 1VAHA 4HOZA 1PIFA 5KEZA 1O8EA 3LPPA 2ZWYA 2D0HA 2FYVA 1QPKA 3GQ7A 1Q4NX 3BVTA 4GQRA 2D2OA 3WY2A 3WNNA 2ALWA 2NT6A 3CGTA 4OZYA 4TVUA 2WCSA 2F61A 3GRHA 3GQ8A 3L2MA 1CDGA 3BMVA 2QXZA 5BRQA 4XONA 1OSEA 2F1AA 4W93A 2YA2A 1BHEA 1VB9A 1NM9A 3IK2A 3GXTA 4YZXA 1UD8A 5E1QA 3DX3A 2YA0A 2YFOA 2QY1A 3WEMA 3ZR6A 3RIKA 1G1YA 3KL0A 1PIGA 3AMLA 1S46A 3A47A 1KXHA 3HJEA 3AMKA 3VU2A 2YKKA 4XLFA 3VSUA 4B9YA 2FHBA 4XKWA 1MW0A 1E3XA 4GQQA 4CN4A 3ZQ9A 4J7RA 1XH2A 4XQFA 2OSXA 4FNPA 4MB1A 2VBMA 5A2BA 2EAEA 1QWNA 3D4ZA 3ECQA 7CGTA 4CN1A 3EQOA 1KGWA 1ODUA 3K1DA 3EJPA 3RILA 4YZQA 4B9ZA 1UKTA 3L4TA 2G3MA 2TAAA 4W8RA 3DX2A 2E8ZA 4HOXA 3VMPA 1R33A 1JI1A 3GQ9A 2PYGA 3K8LA 1BSIA 4U49A 3BH4A 1RP9A 2GUYA 1SMDA 3BUBA 2QV4A 5TD4A 8CGTA 3LRLA 1JL8A 2V3EA 1RU4A 3MI6A 2QMKA 1KCLA 1UD5A 4HOWA 1CXHA 4HP5A 1CGVA 2XWEA 1UKQA 3L4ZA 5F7UA 2BSPA 1V3MA 3GQAA 4GI9A 1CGYA 2XN2A 4Z05A 2GJRA 6TAAA 4PSRA 3LXCA 1Z32X 1UH2A 1BG9A 4X0NA 4DO6A 1UH3A 2EADA 4QAWA 1LWHA 3IJ7A 3D51A 3OLEA 2ZUTA 3UW0A 2XN0A 3WDIA 2ZUWA 3W38A 2Z8GA 4UNIA 1VFMA 2X85A 4NK8A 3AXHA 3OLGA 3BAYA 3EJRA 4GI8A 1JRGA 4CKQA 4WSJA 4AEEA 2F1BA 3A21A 5C1CA 4XR6A 3UG4A 1X0CA 4URRA 3WN6A 3WMSA 2D3LA 1R75A 3LMWA 2D73A 4XN0A 1JIBA 2J25A 3KLKA 2BY2A 2BY3A 3VGHA 4UCFA 2GVYA 4JFWA 3LXAA 2ZE0A 1PXZA 1J0KA 3KEHA 1UD2A 4OJLA 4FNTA 3LX9A 1JAEA 2V3DA 4FLRA 2PWFA 3KWXA 4XNFA 3EDJA 3WENA 2GJPA 5HXMA 3LXBA 2WANA 1HX0A 2INUA 2X3HA 3LRKA 2YIHA 4LPCA 3WY4A 1KTBA 1XG2A 2QPSA 3FY3A 4GIAA 2NTPA 1MXGA 3TV8A 3LPOA 3DHUA 1JXKA 1MVYA 1KGXA 3BLBA 3GXIA 4UQCA 3DX0A 4PCTA 4UZUA 1M7XA 1AQMA 5I5RA 3BCDA 1VBLA 2VRQA 1AVAA 3BUDA 4E2OA 5CLWA 2YFNA 3VGFA 5I24A 2F18A 3KLLA 2E9BA 2ZICA 4HWVA 2O0WA 1E40A 3VGBA 1OOCA 1WZAA 1QI4A 2V3FA 3VNYA 3CZLA 3VMNA 3A5VA 2AAAA 2FHFA 1IZJA 1UD6A 2ODLA 1K5CA 1PZ3A 1M53A 1O8JA 1UKSA 3VNZA 3VGEA 2DH3A 1E43A 5HPOA 3WEOA 1LWJA 2NT1A 2PWEA 3VMOA 2VBKA 3WFZA 3UERA 4OIFA 1AIRA 1DEDA 3VGDA 1G5AA 3EQNA 3WNKA 1JDAA 2EWEA 1NHCA 2PYHA 1KBBA 2BHUA 1BF2A 1KCCA 3D52A 3WNPA 1GCYA 3BAIA 3CZNA 5E6YA 2QLYA 3GTNA 3WDJA 3KRGA 4W8TA 1KGUA 3BCFA 4AVZA 2NZMA 4J28A 1ZS2A 2FH8A 3A22A 2VRKA 2WSKA 2ZX8A 2XVLA 4MAZA 4J3XA 2OYLA 4AYSA 1WMRA 1QHOA 1MW1A 4JL2A 1CXKA 3KE0A 4FLOA 4GKLA 3EDKA 2IGTA 1O8IA 4OZZA 1OFLA 5BRPA 4WF7A 4KMQA 1QI5A 1KCKA 1V3JA 1ZJAA 1CXIA 4H2CA 3VM7A 4JFVA 3ZR5A 2EQDA 2WVTA 3WELA 1XD0A 2EABA 4FNSA 2O1DA 2F7RA 1JDCA 4UOQA 3ZOAA 2PWDA 1G9HA 1CGTA 1O8MA 3BVUA 1KTCA 4FLSA 4H8VA 3FAXA 3VGGA 2Y24A 2FE0A 1R46A 1OGMX 3EDFA 4UQ9A 4NXSA 1C8QA 1QI3A 4I84A 1MWOA 3D4YA 1O8DA 3K8KA 1J0JA 1CZFA 1KXVA 1VFOA 7TAAA 3ZSTA 5CLTA 6CGTA 3L4XA 3BVXA 3H55A 4JFUA 3ZSCA 1EH9A 2WNWA 4WSKA 5A6LA 2X6XA 1JD7A 2VJIA 3BUQA 3IJ9A 2QX3A 4U2YA 4XB3A 1DBGA 1KBKA 1NOFA 3GBDA 3GXMA 4NZFA 4PEEA 1UA7A 5CGMA 1JF5A 1RP8A 5A2AA 1XV8A 2OSWA 1VJSA 2WPGA 2ZX5A 3DHPA 3DX4A 4GI6A 1MW2A 1WZKA 1B0IA 4UQDA 4CVWA 5I23A 4Z03A 2BHYA 4XOTA 5DO8A 4UQAA 3UG5A 1TQUA 3S5ZA 4JFTA 2E8YA 1H3GA 3BVVA 3ZT6A 3CTTA 1PZ2A 2ZXAA 4H8HA 2F2HA 4U33A 4DO5A 1BVZA 3L4YA 2VBEA 3GXFA 4M56A 3HZ3A 4AIEA 1MXDA 1BAGA 2EEXA 3BLPX 3FAWA 3UCQA 4J3SA 1HG8A 4BA0A 4XM3A 4FNQA 2YJQA 1WPCA 4H8UA 4FNUA 1SMAA 1W9XA 3BAJA 5DFAA 2PWGA 2NT0A 3A24A 1QCXA 1OFMA 1U33A 1HL9A 1JF6A 4EW9A 3CPUA 2BY0A 4NI3A 1G94A 2NTQA 3VSVA 4XMYA 1MW3A 3VSTA 3DDFA 3II1A 1TCMA 3UEQA 2BHZA 3A4AA 1EA9C 4J3TA 1JDDA 1UA3A 3EDDA 2O0VA 1WZLA 3WNOA 2NSTA 1BLIA 3WY1A 1U30A 3CZEA 4AYGA 2BY1A 4LXFA 2NSPA 1PAMA 1HWWA 4AEFA 2YA1A 4XL9A 4PMHA 1JG9A 1JI2A 2O04A 1PPIA 1D7FA 1IDKA 4OKDA 1HVXA 3TOPA 4NX0A 1CXLA 3GBEA 3BSHA 4GO9A 4LQ1A 2G3NA 1XCXA 2CPUA 1QX1A 4M8UA 4U3CA 3L4UA 2XIIA 2D0FA 1UOKA 3HG2A 3BAXA 1KCDA 3OLDA 4AIOA 4XOPA 1J0HA 1QW9A 1P6WA 4OJYA 2F7PA 3TTYA 2WC7A 4MXNA 1GQ8A 3GXPA 1DTUA 3K8MA 3WDHA 4YZAA 2VUYA 1TQWA 3L4VA 4NXKA 4X9YA 1GJWA 1WP6A 2C8NA 3ZT5A 4AMXA 1PE9A 2CXGA 2F7OA 1XH0A 1WZMA 3FW6A 3WNLA 3UG3A 2D0GA 4MR0A 3GXDA 4YEJA 4HA1A 1EHAA 5E0FA 1KXTA 4J3WA 4W8SA 1J0IA 4U4BA 2WSPA 4OJ6A 1Y7VA 1WO2A 1ZJBA 4GO8A 1XCWA 1CYGA 4XLAA 1H80A 1GJUA 1IDJA 3VMWA 2ZIDA 3LRMA 5HDRA 4XORA 1WE5A 3KL3A 1XH1A 2X6WA 2FGZA 3VX1A 2WCGA 2NTBA 1R34A 3BSGA 2OYKA 1XSKA 5A2CA 2CHNA 4OJOA 1XSJA 2E4TA 3CZKA 3BUPA 1EE6A 1CXFA 1MFVA 3HG3A 3IJ8A 4KWUA 1TQSA 1HT6A 3BAWA 1KB3A 3KL5A 3VMVA 1PEZA 1XGZA 3H54A 9CGTA 3CV5A 2BXZA 2INVA 2X2JA 2OYMA 1RMGA 4U31A 4NK6A 2XVKA 1O8GA 4JFSA 1OT2A 4UOZA 1UASA 1O8HA 2EACA 1BVNP 2ZUSA 3AJ7A 4JCMA 4H7VA 2PECA 3EDEA 2ZX9A 1AQHA 1IA5A 3D50A 4J3VA 4J27A 3HG5A 3DC0A 1HXKA 2XVGA 4U2ZA 5C1EA 2WKGA 1VIWA 2VR5A 4J3UA 4BZYA 2WVVB 1HL8A 2FHCA 5E6ZA 2DIJA 1GVIA 1KXQA 3CC1A 1I75A 1B2YA 5A6MA 2WVVA 5EMYA 5E70A 1QW8A 1QJVA 2XIBA 3AXIA 3EJQA 4HPHA 1TQVA 3SUCA 3CZSA 2XN1A 4PCSA 3DDGA 1V3KA 2D3NA 3BAKA 2Y4SA 3BVWA 4OJ5A 2IQ7A 1U2YA 2ZXBA 2VJJA 1EO5A 3M07A 1JFHA 3S5YA 5AMVA 3GXNA 1BN8A 4C2LA 4UZSA 1RWRA 2BXYA 4JCLA 1AMYA 1HNYA 2NT9A 4CN6A 2OW6A 2C7FA 1CGWA 1T0OA 1O88A 1BPLB 1OT1A 4YZ0A 1UD4A 4AW7A 4FLQA 3ZO9A 1JGIA 2PWHA 1JTAA 4W8QA 1CPUA 1QWUA 1CIUA 4Z06A 1TMQA 3IGUA 2OSYA 1IZKA 3BLKA 2X2IA 2Y2WA 1L0PA 1UD3A 1SZNA 4DO4A 4WLCA 2VT0A 2NSXA 4XKVA 1QHPA 2F7QA 1V3LA 1UH4A 4CGTA 4XLHA 3EJUA 1EO7A 2ZUUA 2QMJA 1TQTA 1RPKA 1KWGA 1O8FA 1XD1A 2UVEA 1CGUA 4PSPA 2QPUA 2WKLA 3B8YA 1PS3A 3TTSA 3WNMA 3CZGA 1O8KA 3JURA 1HTYA 3ZT7A 3TONA 1XSIA 2WVSA 2XWDA 2Z1KA 2AMGA 2Y5EA 4UQBA 4XLEA 5I0DA 4XN3A 1R47A 3ZSSA 3EJSA
chains in the Genus database with same CATH superfamily
1DCLA 3OJVC 4NKDA 2MCPH 3H7BA 4IGBB 4ZZFA 1DBAH 3MNWB 2W07B 4XNQA 2DEWX 5IVXF 3UTSB 4Y9GA 2X4TA 1OTTC 2C4FT 4NM8L 4PJCA 5DF0A 1OF2B 4GUCA 2O6FA 5DJYA 5AW9B 4XWGL 3PYCA 2PP9A 4JUSA 2HUEA 2NYYC 3FQTA 2QQNH 5K1VA 2CO7A 3HNVL 4NUJA 1P1ZA 5CGTA 2VL5A 4WRLA 2PABA 1F5WA 2WN2A 1L9PA 3QJFA 3MJWA 3TA4D 1KJ2B 1VGKA 1QYGH 4MJIB 2WTRB 1HNGA 4M61B 5EBMA 4QNPF 4OT1H 4KH2A 2C4FU 1UA6L 3QI9C 2R9HC 5JQ6L 3G6JF 4WTQA 1HJBC 4MA1B 1NLBL 3PNWA 4OJDH 4GT0A 4K94L 4YBQC 3V4PH 2F9BT 3OLIA 2AKRA 2FBJL 4ETQB 4PB0H 4WI0B 4WW2C 2ZX6A 1WWWX 3MN8A 5D1QD 1HEJC 1KACB 3L3IA 4ELMB 4HOZA 1DZ0A 3LDBC 5KEZA 2OMUB 2GKIA 1HINL 5JHMA 1PL3A 3ZE2E 3ZZQA 2OLDA 4LCUA 2D2OA 3OSKA 3MLUH 4OF6A 5E1AB 7FABL 2WCSA 1PY9A 4YXKL 5F21B 1FPTL 4JO3L 5GZND 2R1XA 2X4OA 4POYA 5CKAA 4L3EA 1PZSA 4CU6A 1NCIA 1U8OB 4M8RA 1UD8A 5E9DB 5DC9B 1OCCB 2J6EA 5CJXC 2YFOA 1D5RA 3WEMA 4Y5VB 2A4CA 5EFIB 5CN3A 3RA7L 3VFMB 4YXHL 3OX8A 1GZQA 1NBVL 2HXAA 3K4AA 4I9WE 5F9OL 3QEQD 1R3IL 1X6NA 4ZUSA 2Q5BA 1CICA 1SJEB 4M6OH 5F1NB 3TBVA 1MQKH 4NO0A 2OI9B 1FFQA 1QUPA 5EBLA 5T1MB 4DTGH 5E2UL 7CGTA 1OGAE 4FQ1H 3D7PA 4ZMQA 1YEDB 3PIQA 4NHCH 1QA9A 5B3JF 4HK0A 4XMXA 4EDWH 3VDCA 4J23A 1D9KD 5E7BA 4QD2E 4XB8A 1T1WA 1SUHA 5ERWA 4MJ5A 4D7PA 1ZLDA 4OLZH 3MLYH 1QABA 4L9LA 5D9SA 3WNJA 4AEHL 3B9KA 3VXMD 2CBMA 1BBDL 1MREH 4HQQL 4HOWA 3VH8G 1RQ5A 4FFYA 4OZFG 4ZTOL 1U3HC 2G2NA 4W70A 1DN0A 1QVOA 1ICTA 3D05A 5FXCH 1B0WA 1KBVA 5HYJE 4BK5C 3LH8A 4KH9A 4U4IA 1UCBH 3UADA 2C9UA 1FGVL 3LN5A 4ZX3A 5DJ0B 3WSQL 1K3IA 3ULUL 1QUNA 2CO6B 1J05A 3MA9H 1FAKT 4UU9A 1AIZA 3BT2L 4P9ML 3VI4F 4IK6A 4N25A 2DQGH 2XWCA 3SKOA 2AJSL 2VZTA 4AQAA 3UG4A 3KR3L 3ZUCA 1A9EB 1A7PL 1ED3B 3FNKA 4FYTA 3ZE1B 1HIML 3BKYH 1CL7I 3CFJB 4HKXB 4FA6A 4NQDB 4ZNEA 7PCYA 3N6ZA 4K7PY 4WDIB 1UC6A 2ADGB 2WAHA 3GPSA 1KZYA 3ME0A 1S5IH 3CPLA 1BZEA 2G5UA 3C09C 3RY6C 4JO2H 1NM4A 3K81A 5IGXH 5F3BA 3X11A 3BPOB 3AT0A 4UQCA 5GS1C 4GUQA 4ZQKA 1L5GA 3F6JA 4B0MB 3D25A 1CD1B 1KIQA 3VD3A 3W11C 4PJEE 1KGIA 2GJ6B 2F18A 4G6FD 3FT2A 3P4LA 4RZCA 3MV8A 3UDWC 3RL2B 4GS7C 5J57B 5KN5A 3CBKB 1JZGA 4CU8A 1UM5H 2P7TB 5I1JL 3VXUA 4AGNA 2FHFA 3F8UB 3GM8A 3GHBH 1HJCA 3BAEH 3AB0B 4Y2DD 5TF1H 1INEH 3ZVVA 4NN5B 3KNBB 1DJIA 5EBGA 3KYNA 1EVTC 4DGWC 1KLGB 3E6HA 4HXAH 1XB6A 5DEZA 3T4AC 4D94A 1JK9B 4K2UL 2K45A 4HKJB 3WNKA 2YD2A 4YSSA 1OFDA 1J11A 4B27A 1GCYA 3ULUC 4TUKL 2GIYA 2XXMB 2XQYG 5I2IB 2XG4A 3ZKMD 1IBBA 4CL7A 3T4YB 1EEZA 4P5RA 3V9CA 2NZMA 5GSVA 5GJSH 4E36A 1LE5B 2OK0H 3TIDB 5T8IA 3FQXA 3WIHH 1CXKA 4PJ9C 2VDRB 4JQIH 4W4OA 3ZL4L 4KKBD 4J1UB 4JKMA 2PTTB 3BGAA 5FOBA 3QFGA 3SDXF 4QRUB 4ODVL 3MTXA 5AEAA 1LEIA 2EQDA 2MCAA 2R2EB 1FC2D 3TYFA 3WELA 1NKRA 3KVPA 2EABA 2C3WA 5DK0A 5EORH 2X40A 2VR3A 2AZUA 4ALAL 3NJGA 4YWGH 4MVBD 1I7UB 4QAMB 4WUUE 2OZ4A 3MQIA 3QW9A 4I0KA 4J12A 4NXSA 1MUJA 4J8RB 1IT9H 1S7TA 3D30A 3D4YA 4Y16D 4BQ9A 2XTJD 3NABL 2GHWB 3S37L 1KT2A 3IRCA 4ZFGH 1OAUH 3F00A 1YYLH 2XZAL 3VSQA 4AC4A 5E0QA 4KFMA 3IDUA 4Y19E 1NOFA 3QA3B 1JGDB 5EEUA 2YARA 1Q38A 3QB7C 1JF5A 1RP8A 3ALWA 1F1AA 1A6VL 3MXVL 2ZX5A 1IAIM 3CLEH 1B0IA 1FL5B 2OXGA 4JDEB 3ZT6A 5HSFA 1F11B 2Y1YA 3FO0L 4H8HA 2R1WA 5IF0B 3HUJA 3HZVB 5DA0B 1YEIH 3C5XA 2X3AA 3B2UC 4AJ0A 3V6ZB 4M56A 2Z91B 5EOTA 4AENA 4PJGF 4FFVD 2IEPA 2P5PA 4MBRA 3UCQA 4LVEA 5I1DA 4F7KA 4H0IA 2G2RB 3MRMB 4R6UA 5EUOA 5T33H 5I6XC 1J18A 3WFEL 4XZUB 4OV5B 3HI6H 4Q9BA 1XAUA 4ZBJA 4LCWD 2RCSL 1GKOA 3BDYL 1ZE3H 3NEEA 3IDNB 4O5LH 1SMAA 1A1MB 1W9XA 4U3SA 3UPCA 1BWMA 3JVGC 5DD1L 1BD2D 4KZEH 2FECL 1ZHLA 1UT2A 5L4FA 4P5TA 5IQ7H 4KXZH 1HL9A 1MDAA 3NVQA 3PE9A 4KI5C 3ZLQC 3IDGA 3HRPA 4ALAC 3AG2B 5IOKA 1JNNH 4QHNB 1ZWIA 2H47C 3VSVA 3LQZA 4L29B 2CGYA 4JN1H 4OD2B 1OALA 2O30A 4G6JH 2F54E 3UFIA 3MACH 3A4FA 1BEYH 1W15A 3TASA 1EGJL 5GS0D 2QGDA 4K23H 3LH2L 4JHAH 4Y2OA 5F0LB 1IM9A 3M45A 1LLZA 4G8EA 5F97E 4P04A 3UBXG 3APFA 4X6FA 2LLLA 1WG3A 4W9IC 2E9WA 5FDWB 3R0MA 3K2MC 3QWOB 2HT3D 4P23D 3B2DC 2YSSB 3LEVL 2CDEB 3B9VA 3O2DH 3WKNA 3QIUD 2ZXCA 2Y69B 5HTSA 2QSQA 3PWVA 1RK0A 1KCDA 3DETD 3GKZA 1DVTA 1JPFB 2VDQB 4HEME 4PWKA 1E4WL 4QHUB 1R3JB 3VXUE 4GQ9H 1FJ1B 4M8QA 5DK3A 1GJWA 2RQEA 1KPVB 1ZTXL 3DX7B 1YEEH 4H5SA 5FGCB 3W2DL 2ZSWA 3QAZB 3DI2B 3WNLA 4FULA 4UDTB 5J0BA 4N8VG 3TEWA 1NUDA 1XIWD 1E4KA 1U8JB 1W0WB 2VDPB 2GG1A 3MA7A 1WO2A 4I48A 3IAGC 4HH9A 3EFFA 1AZVA 5IMMB 2DRUA 5HGGS 5TJWK 4GNKB 4N4YB 3HPLA 2CJ3A 1RZJH 4Z9KB 1I1RA 3TWYA 2XC1A 2CE6A 1UJTA 4AQ1C 2AJXH 2P52A 3SGJC 3SIKA 4DN3L 5ISZE 1R34A 1AG6A 1WHPA 1RZ8A 5D5MB 3LTVA 4P2OA 2X9YA 4Y4HA 1XGUB 4N8PA 1CB4A 1JPGB 1XGZA 4YHKL 5C0RL 3K6IA 1VEPA 3FUMA 1O75A 4WWKD 2IXQB 1A6PA 3A4DA 1O8GA 3DSNB 3CXHJ 2DV6A 2VN3A 3RGHA 3W57A 4HIPA 3LHPH 4P59H 5DJAA 2NUTA 3TYGL 2XLLA 5CU9A 2DIAA 2Y7SA 4ISVB 3V6FB 3SHSA 3OR7B 4J3VA 2N1KA 4XMUA 3N6YA 2CZNA 3BH9A 2YUWA 4Y9EA 1JPST 5B39B 4U2ZA 3F01A 1GS7A 3CFQA 4NN7B 4J3UA 3RZWA 3LKOA 3IFPB 3LAFA 3LIUA 4OCRL 3RG1C 5B7FA 3VAEA 3ROOA 2DIBA 4UV4H 3TNMA 5A6MA 2D7TL 1A6TA 3D6GA 2VZVA 3APNA 5CF3A 3RFZA 2XIBA 3HW7A 4PRHE 2ZKXA 4Z7UF 4EOWH 1ZGLP 4LQFH 2CAKA 3RPBA 4Z77B 3SUCA 1PZCA 1U0QA 3IFOB 3SQOH 2R39A 3EJCA 1ZLVK 3ET9F 4X8CA 4BCXA 2CRYA 1FUNA 1E8XA 2Y4SA 5F3FA 2IAMB 1KELL 5F7DA 5FYJE 3WTXA 1WTGT 2MCG1 2IC2A 3NIDF 1DEEB 2NNAA 4OLUL 4OSUL 5GS3A 1CTOA 4Y5XB 2IADA 1FVDB 3STLB 4XP6L 4C2LA 1Z9OA 1DO6A 4BHUA 1AZBA 3QIBD 4JQVA 3QEUB 5D1QC 1N12A 2J5LC 3V8CA 5DMGD 4G9DA 3NJNA 3EHBD 4YZ0A 1ZAGA 4FLQA 1JGIA 2A7BA 4X5XB 1IBDA 4JHZA 5FKPA 1BX2A 2O61B 1FLRH 5EUOE 1YEGL 4NSKA 5GZNC 2OMWA 5E8EB 3VXOB 4XCNA 1TJIL 4HV8A 4PJ8A 5IB4B 4K7PH 3AWEA 4C56B 1EHKB 1KWGA 4HFWA 3L3KA 4HJTA 3LKRA 3QDJA 1E8WA 2IDFA 3T3PE 5E4IA 3DARA 4Z7NE 1S5HA 3E2HB 2AVGA 2Z1KA 2AMGA 5LGJA 5DRWB 4LPYA 3IMUA 1IM3B 2YRZA 4Q6IB 4WUKL 5GRYA 2E0PA 2VNCA 5CJ8A 3VDAA 3RU8L 1HHHA 4JFDD 5AKTA 3APMA 2J72A 1P0SE 2Z1PA 3E7JA 4M3HA 1D7CA 3RGBA 2X3BA 2W92A 3VE0A 5EZIL 1GW6A 3BVNA 3VFVA 1NFDF 5D70H 3ZHNA 1INDH 1M56B 5J1SC 4HALA 5SWZD 3QXDA 1D9KC 5JHLH 2YD4A 5ECJE 4IBSA 2NDGA 3H9YA 1G4MA 1P84K 1URLA 2M8XA 4LSRL 3L7FA 4LSTL 5EOQH 2AEPL 4UNUA 4E9TA 2CR6A 1QZNA 3S4SB 3EFDL 6FABL 4GAGH 1BCIA 3QGVA 3TV3L 4DGYL 4N85A 1EANA 5BZZA 1E8YA 1GOGA 2BVQB 1GGBH 1SXAA 2IANB 5GGRA 4WI6A 3POHA 1TZHA 3WE1A 4YHOL 4JM0A 3V55A 4DESA 3P02A 3EBAA 3LQAH 5MI0C 3PWNA 3RX9A 3CQPA 4RWYH 5I1KL 3AU1A 2DQFA 1PIFA 5IEKB 2J1KA 4U1HA 3LPPA 1G7JA 2ESVA 4LKCB 3S96B 1ECYA 1X5HA 2TSBA 2WP3O 2ZUQC 2Y0SA 4PJFF 1Q94B 4TVUA 3KLSA 4FYQA 3L2MA 5D1XD 2MQ3A 3P4OA 6PCYA 1OSEA 3X12B 4NC0B 4G6KH 2VXQH 3BO8B 3TS8A 3RGVA 1EUUA 3ATDA 2DWDB 2CUAA 2BSRB 2YA0A 4XP4H 2A73B 3T0EB 1GY1A 5C0GA 5D7KD 4XPGL 3QK0A 1G9EA 2NQDA 2AV7A 2IF7A 3W0WB 1FDLH 3HJEA 1YNLH 3EO0A 4JCWA 5DYOA 3U6RA 4AJWA 1X9UA 1YEWA 4KH3A 4HWBH 5DMIL 5CJOL 3FONA 4I0PA 3IJEB 2EAEA 3X2QB 4QRRA 3S8WA 5AVSB 4CVXB 1KB5A 1USZA 1CDBA 4JDTH 4M7LL 1RMFL 2CCWA 4HK3N 2KERA 3HG1B 2NR6C 4EUPB 3GJFB 2FL5B 3JV6B 3BH4A 4LRNH 2X6BA 3KBPA 2X4PB 4JQXC 2UZXB 4N22A 3Q3GA 5TD4A 3DX8A 8CGTA 3FQYA 2N7BA 1RURH 2K9FB 1VRSA 3SDDD 3HAEH 2ZZUT 4P05A 1IIIA 4HBCH 1BGXH 4Y2DC 1FG2A 1BOGA 1U93A 4WY7L 1RFDL 4GG8A 2P43B 5C08B 2K3HA 4XP9H 4G8GA 5CP3H 2IDQA 2IMMA 3AABA 2XG5B 1H3TA 4E41B 4X0NA 5L6YH 4OFKA 1UH3A 4O58L 3ZE0E 2VDNL 3OSVA 1D5IL 2G3XA 4PW9A 5E23A 4HFUH 3CVIL 5IOPA 1P4UA 2OMNA 4IBLT 3ZKMC 3J27A 4NWUL 3LVTA 5FYLE 1NGXA 3NCYS 1A3RH 4IMKA 4X8XA 3ARWA 1OCZB 1Y1UA 3MRDA 1TR7A 1P6AB 2YXWA 2DY2A 1AZZC 2CKBL 2HG5B 4JEGB 1PDKA 4L3FA 1UXSB 1X0CA 2UUDK 4KKBC 1OGAD 1FNEA 5HYSB 1CLOH 3KLKA 4Z3EA 9PCYA 3E9TA 5EU6E 4AVKA 2DYPB 3CN4A 3CSBA 4AGQA 3NQKA 3CCHB 2YUVA 4B9IA 5EIIA 3SJVD 5H37H 3VACA 4PD4J 5DEGA 2NY7H 3EZ8A 5D7JB 3IDYB 4EI5D 5J11C 2A74A 2GJPA 1S7SA 1V7NH 2M26A 1KCBA 1MRFL 4MVBC 1IGYA 1E4XL 1OW0C 1P7QB 2Y36H 1S78D 1JUFA 4P2AA 3VFWB 5B7MA 2NTPA 3FRUA 5FM8A 3H9SA 5ICYB 3OGCA 2OJEB 3QHFH 4Y16C 5CEZH 2XTJC 3DOHA 3WJLC 1M7XA 3GI8L 4NNPL 3ZHKA 1LQBC 5FYKE 1DCEA 4YJZL 1JWMA 4GAJL 5I24A 5IMLA 5MENB 5F6HJ 4WV1C 3QO1A 4FJYA 3AM8C 4G7RB 4JLRA 4A67A 3ZPDA 1QI4A 3CX5J 3N42F 4MQ7B 4ODBD 1BMZA 5LG1A 3NMEA 3WV0A 1UKSA 1UA6H 3NA9H 5GGSB 3LS4L 2K8QA 5I66A 3F2LA 3CH8A 2DBLL 3C2SA 1WBXA 2AXJA 5JHDD 2O6WA 3KD4A 2WGXA 3I6SA 4A6YL 4ZUTA 1RPUA 2FBJH 1NHCA 1XCTA 4G8IA 2WBJB 4PJ6A 3D39E 3ASOB 3WEAA 1IC1A 1MFAL 3EBHA 1IFHL 2V5TA 4FFVC 5JIDA 7FABH 4MAZA 4I18B 4WO0A 2OYLA 1WMRA 1LLAA 1MLCA 1Q0EA 1HI6B 3OB8A 4NQVA 2EEAA 5IB3A 3KJ4C 5IQ9B 2HJFB 4X4KA 3U7YH 5I8OH 4GB9A 4PRIE 2QQLH 2IGTA 2RIKA 5BRPA 4BRJA 3GHEL 2DQHL 3VI3F 4HUNB 3WL9A 1NFIA 4J3OD 3SCMA 4D8OA 3CFUA 2A6DB 3H3PL 4A37A 1MJJA 5DZLA 5I1GH 3FO1A 2NW3B 2JB6A 4R7NB 1AHMA 4L3CB 4NRXA 3IF1B 1FVCB 1R3IH 2WP3T 3QJRB 1IC7L 2BMKB 3WKML 4P2QB 1A4KB 1QI3A 1QNIA 1SLXA 3BESR 3FTGB 2F74A 4OVUA 5GS0C 1OGTB 1LO2L 2GI0A 3MROB 1KXVA 3EW3B 4O4YH 5FO7A 5PAZA 4JAMB 4E5XB 1FH5H 2AXGA 5F71A 2YAOA 2WNWA 4GUPB 1Z6JT 1A7RH 2B5IB 3CFDA 4G6MH 5I16B 2JKLA 4QRRE 4RSYA 5D6DC 1G6RH 3RNQA 2HT3C 4P23C 2IH1A 5HD8D 1RULL 1YEHL 1NDGB 1R9FA 4N2MA 5AVXB 3QIUC 2RD0A 3MUY1 4LVHB 5J06A 3DX4A 5I23A 2GC4C 5FO2A 4Z03A 2DYRB 2X6UA 3DETC 1VPOL 4ZTOH 1A8ZA 3CN2A 4UQAA 1KJMA 1QQDB 2X4NA 1MFDL 4K5PA 3VFNA 4Q8BA 1ZA6A 4MWFA 1U8QA 5JXEA 4NWTL 1FVEB 3L4YA 4IBZA 1OWRM 1GGIL 5C97A 4TOYH 3WFCH 3GXFA 4JFOA 1FAIH 3ULUH 5FIEA 3L9RB 2HKFH 2GSGA 2ZNXA 4P9MH 2XX1A 1XIWC 4ZPVB 4BA0A 1WUNT 4IDJH 1WPCA 2DI9A 1JHKL 1ET8A 2AJSH 2UY6A 4F33B 3KR3H 4RVBA 4AJYV 3D0VB 4FNUA 1A7PH 4YVNA 4KTYA 4AE0A 3VYPA 4D0CB 5I6KA 4EAEA 4OCLC 1A4CA 3T0BA 4QI3A 3IWVA 3VXTB 4M6ML 4XMYA 4ZTPH 3L3DA 4PCKA 1TCMA 3BJ91 3A4AA 4DKEL 5LDUA 2P48B 1E5CA 3GI9L 3MLTB 2QHRL 4QXGL 3WAJA 4WWKC 5L2KD 4HUXB 1BLIA 1TTFA 2AK4B 3KGTA 4G80B 5A2JH 1XFPA 4HJIA 5I5MA 3O11B 4UANA 1Z5LB 5HY9A 4OCWH 3C2AH 2W9DL 4PJBF 4X6CF 4MLSA 3GLZA 4JMXA 2AJUH 4LASH 2UWEF 1AY1H 5IB2B 1F86A 1JZ6A 1QX1A 2UZYB 3DX6B 3QJTB 4KBPA 4NP9A 4PPTA 5CFHA 5GGVY 3R4DA 2X6MA 3U4AA 4ZX5A 5JTWA 3LIZL 4YSTA 5GQBA 1YMMD 3KPQA 4RH4A 3D3VB 4G1MB 3WDHA 4NAJA 1BZ7A 3ZGIA 2E9GA 4BA8A 4HJJH 1TQWA 4X9YA 1A3QA 2C8NA 4UDUA 2YZ8A 3LOWA 4P99A 1XH0A 1E5YA 4X4XB 4Z7VB 1EMTL 4APQD 3MMEB 3QIBC 4YE4L 1UATA 4RA3A 4GXUM 5DMGC 5IEHA 3EHBC 5FO9B 1MCSA 4GRWB 1KIUB 12E8H 1RSYA 1FG9C 1CYGA 2GYSA 5I18L 2NZ1A 3ZL4H 1GJUA 4IGBD 2QELA 1RH8A 3F6IA 3TT3H 3UTSD 2YUHA 2ITDB 4I4WA 2OL3B 1XGYL 3DROB 3BIKB 4ODVH 3RURA 5K5YA 4B53A 4F7CA 3Q8EA 2H7WA 4DK5A 2H1PL 4ZUUB 4A04A 3PGDA 2LGNA 4YDMA 3MRIB 4YX2L 3DUSB 4ALAH 1HHJA 1E4HA 3EBIA 1DQVA 5JOEA 3R06A 4Z7WE 4G59C 3VJ6B 5IBTL 3Q2NA 1O8HA 2KT6A 4MJID 4XNYH 2DQTH 2P42B 2KZ1B 1MRDH 1QO3A 3SPVA 3QPXH 3FU9A 3OKNA 1C5BH 3QIWA 4F1SA 1FFNB 4M48L 3FYIB 3IAPA 5AD0B 5IVXA 4B95C 1XB8A 1N3NB 4NNXA 2BP8A 3GMQB 3UAJD 3EH4B 3RVUD 1HEZB 3B6SB 4FQPA 4J8QA 4ZXBA 1QASA 1A6VH 3MXVH 1ETZA 1GW0A 1U9KA 2HJLA 3VWKA 3FC8A 3NJJA 1QBMH 1I9RH 1RJZB 2JCCE 3IDJB 3V4VL 3QXAA 5TDNA 4QRFA 1MF2H 5K9JH 2VUKA 5BOJA 2ROYA 1H8LA 1IC4H 3EH3B 5D6CA 5E9DD 3S3SA 1KULA 3S5YA 4N3TA 3H09A 1GZPB 4HDIA 1SQ2N 1W0YT 3T5WA 4XPAL 2AJVL 4H13C 4AKPA 3MAWA 2RCSH 1IL1B 3IFNL 4CNIA 5B1CA 4Y4FB 4BFBD 5I8CB 1NUFA 2Y2WA 2OSLA 3QCUL 5D1XC 1AHWC 2VT0A 3C87A 4FA7B 3EAKA 4XRCA 2D3JA 1XF3B 1XHHA 2YAMA 5AVTB 3KH3A 3L9BA 1MELA 1TQTA 4AC2A 3I85A 3OR6A 5DDHA 3QDAA 3QZBA 4X5QA 3NEXA 5KUKA 1HTYA 4M5YH 2H32H 2E27L 4UQBA 1CG9B 4XN3A 1DJZA 4WFED 1EGJH 1G87A 2BX5A 5MEPB 3SYQA 4BZ2A 3F3HA 2OM5A 1H8SA 5AL8A 3FF7A 3J07A 5HHOA 1QFUH 3HKZA 4PJXB 1EO8H 3HA0A 1IQDB 5HDBB 3TEXA 3VGAB 1U8MA 4H0LC 4R3SA 2WVUA 3S3JA 2ADJA 3GSRB 3QUMB 2GI7A 4S1SH 1NGZA 2VM9A 3G5XA 1CGXA 4LHQB 2FO4A 4NBYB 3UZEC 1UENA 3HI5L 4H44C 3TM6A 1OCRB 5E6UB 5DFTA 3UC0L 4HZ1A 5HP5A 43C9B 3SDDC 4NM4H 3P2BA 5KAQG 3NB2A 1YVLA 3N1PC 1WZ1H 1ZLVH 1N6QL 2EVFA 4F20A 5E2WH 4X4MA 4OF8A 1OSZB 4KKQA 4C57C 1EAJA 1JF1B 1YY9D 2XZQL 3QRGL 3W2DH 1I1YB 4OZHF 4XOEA 3H3KA 4PI0A 2XPGA 3VM5A 1A21A 1RUKL 5C2BL 4NQDD 3EYVA 4PM1A 3BIAX 5SWSA 3ISWA 1EJOH 2R69H 4NC1C 5HDLA 4RAVB 3L95A 4U05A 5AAMC 4GKSB 2L04A 2ATKB 2DQDL 1LGVA 2HVBA 4WO4A 4WJG3 5IR1B 4CGUB 3KGSA 3UGUA 1J5HA 5J56B 4BUQA 5BRQA 3QQ3B 4OD1L 4KK8D 5CINH 1H3WM 4FQJL 2G3ZA 3SYPA 1W72H 3Q1EA 4PGJA 5I1LB 5TTRA 1A1NB 3NJMA 4H4NA 5E99H 3CZJA 4L8SB 2AZAA 3N91A 5IMOA 1TNNA 3KL0A 2FCBA 5TFSH 5D55A 2GJ6D 4YHKH 3RTLA 4H8QA 3T2NH 3V7AG 5C0RH 2B14A 4FFZH 4EI5C 5AVYB 1M42A 1KV7A 3H1ZA 3MVSA 2DQUH 1XTMA 2R2CA 3T6ZA 3JV4A 3D2UA 2GTZB 2WINA 4S1RH 2IOUG 1S78C 4KY1L 2V17L 3NPZB 4M1GH 5D2NE 3ECQA 5F88A 1G43A 1T21B 4JDZA 3ESNA 2MQ0A 4NZTH 2P4AB 1QSEA 4OQTA 1SHSA 3EFOA 1UKTA 2WQ8A 2IWGA 3RDTA 1ODAA 3K2UL 3MO1A 1M6OB 1FV1A 15C8L 1MCHA 5CZVL 2ZWSA 3N43B 2XWBB 5IVXE 3MBEA 3B56A 3CQFA 5EUKA 4JPWL 3CBRA 4XVUD 5FUZL 2Y5TB 2LE9A 3QWNA 4G3YH 2X7LB 4TNVK 1FORH 4OZ4A 5B1JC 3KDMA 4OH2A 1KELH 3D18A 4EPSA 5D7IF 2NY5L 4PS4L 1MIEH 2FB4L 4XP6H 2X2YA 4BRVA 3DA0A 4UAOB 2GUOA 2X38A 3LRGA 3HBPA 2ZJSL 1TYXA 3FUNA 4IRSB 2LAGB 3WO4C 4JKPL 4CKQA 3TBTA 2BM3A 4J6RH 1L9MA 4QNPE 1E8ZA 3QWRD 5KG9A 3BRDA 3TCXA 3G6JE 3VRLF 1I85C 5EO1A 1HCFX 2NX5E 2D03L 1QP1A 1RUAL 1YEGH 3OJDB 3PP3K 5E5MA 1T5XA 1U3YA 5I0YA 1F13A 2D73A 2ZT9C 4WFHD 4WJ5B 1ZV5A 2XACC 3KPSA 4NKDB 2CG9X 3H7BB 1AO7A 4J3OC 1O7SA 4XNQB 3B83A 5EPMA 2X4TB 3BD5A 4PJCB 3Q8FA 4YHIA 5DJYB 3ZQXA 4ILDA 5EEYA 5ICXA 2YUXA 4ZFOB 3EDJA 3WENA 3E3QC 3FQTB 3JTSA 3KLDA 3SDXA 1X4XA 3RU8H 4Y8DC 1PX4A 4NUJB 3LRKA 1XG2A 2QPSA 3GRWA 2R56H 5DVPA 3VH8A 4DPRA 4OZFA 3FB7A 2Q0ZX 3OAZH 3UZVB 3L9YA 5EZIH 4KVNH 4P8QA 1VGKB 2WQRA 4ZMYA 1ZV2A 2ZD0A 4MNGB 1ZT1A 4X6BA 4FYSA 5EBMB 3MRKA 1K6QH 4BH7A 4DN4H 2E9BA 5HD8C 4HWVA 3OGOE 4PJAE 5E56A 1UVQB 1EK3A 4AQZA 4JG1L 5LBSH 4F24A 5GGVH 3EFDH 2B7DT 4RFOH 1W91A 1JSYA 2AKRB 3FTVA 1TO5A 2A6JB 2Q8AH 1KGYE 2HVJB 4YLQT 3SPIA 2WWNA 2XN9A 3STZB 4PWGA 4A2EA 4CSTA 2NY5C 3L3IB 4MMZC 3CFTA 2QVTA 4XXCC 5E5UB 4XN1A 3WEOA 3WU1A 1CI5A 1LWJA 1Q0YH 3M8OH 4YHOH 2RGSA 2GSIA 4LCUB 1AZUA 1T6BX 1OAZH 1PFCA 4XN2A 3BUYB 4K71C 2R1XB 2X4OB 4L3EB 3LSOB 1XZWA 1ZS2A 2OCFD 4BK4A 3IN2A 4FQQA 4LGPB 1MW1A 4N28A 1GGCL 4PJDF 3L6FA 1TTUA 4KO9A 1XGRA 4NKIH 3V95A 4P57B 4Q89A 4ENZA 2QSCH 2BSTA 4PJGA 4BGDA 2UUDH 2A9BA 4O02B 1GZQB 2GW5A 1IGJB 2XWZA 1VCBC 2BIIA 4G8AC 3BQUA 3CE1A 4JKWA 3MOBL 3TBVB 2F7RA 4NO0B 3ZTJG 1G9HA 5E03A 3CHOA 2E47A 5EBLB 4HS6A 3VI4E 4YCQA 4NBXB 5FM5M 1FIEA 1ZGLB 3UC2A 2IGLA 3N44F 2LVCA 1T1WB 1H5BA 4R7XA 5C0CA 5ERWB 4OZIF 1CZFA 2D9CA 5C0IA 5EU7E 1SNRA 1RMFH 4KV5F 3B9KB 4DZ8A 5DZAA 5L2JA 2HB0A 4YFDB 5D2LA 3IJ9A 3E6FA 5T1LA 4U2YA 2QTVA 1QSEE 4CRPA 3BWUC 3GNMH 4DHLA 2JI3A 1NBCA 1TJGL 2XQYA 3BIBX 1QVOB 2DLFH 4BUHA 4F58H 3FSAA 4QXUL 4KTDL 3SDAB 4LE8A 3Q13A 1MW2A 2KYIA 4KOBA 4N2OA 3LN5B 5FECA 3SDYH 4JFTA 4BKSC 3CTTA 1S3KH 2QVFB 2WO3B 1SOKA 2Q10A 3NIGB 4MRBA 1J05B 3MC0A 5DEJA 3V6OE 2XV0A 2ZWNA 3K71A 1DVZA 5TQ0H 4UM8A 1EAQA 3SKOB 2H45A 4BFEA 4AQAB 4JZJC 2DTSA 1ZSHA 4APQC 2AJYL 4U7KA 4XM3A 5JMRA 4WW2F 3KYOA 5IWLC 5E24E 4IGBC 3MJ9H 1AXSA 3B5HA 4F1ZA 1IEHA 2FO8A 3IU3A 1U8NA 3CPLB 2DQIL 3DSFL 4WU5A 3CMOL 1A4JA 3WG7B 3H9HB 1ZCRA 2V33A 4NI3A 1UACL 2IG2H 5F3BB 3LD8B 4PB9L 5INCA 1J87A 3X11B 3DDFA 4JE4B 2XWXA 3GMPB 4ZQKB 1L5GB 1PAZA 3RPKA 1CE1L 1MRFH 2MNJB 4HS8L 3D25B 2O0VA 1WZLA 1HILA 4LEXH 2IQAA 1KIQB 5ESAA 1FZOB 4NGHH 3FT2B 3L5HA 1T1ZA 3MV8B 3ARBA 2BY1A 4RZCB 2R4RL 3F58L 1PAMA 5KN5B 1HWWA 5DVNA 5GS0H 3GI8H 3X3GH 1JWUA 4NNPH 2PW2A 2FD6H 3Q48A 4ABUA 3GSXA 4MA1C 2FGWL 1Z0MA 3QRLA 4WTWA 2H9GA 1BOYA 4HISA 3KYNB 3IDIA 3E6HB 3UAJC 2V9RA 4RDQG 3RVUC 4EVNA 2VDKL 4BFOA 1DABA 4TUJB 1FC1A 2D0FA 1IVLA 2AQ3A 3WUWB 5L7XH 5DLMH 4Q9QL 2J8OA 4JB9L 1U8KA 1T03L 1Y07A 4FL4B 4NO3A 1CDYA 2QSTA 5EC2A 5SV3A 2XG4B 1LO4H 1GQ8A 1PLCA 2WUCL 1EEZB 5GSVB 3PLYA 4A6YH 5HGDA 1DDHA 2XN9E 3FQXB 4CW1A 4C56D 2XYBA 1Y18A 4YEJA 1IX2A 1EHAA 2KZBA 3AK5A 4J3WA 5F44A 4Y5VC 1V54B 4YHNA 1XF5B 3CXFA 2P5EA 3TA3A 3VQLA 5BRZB 2GTWA 2B0RA 2NSQA 5GGUA 1LEIB 1U8IA 3TYFB 1IM3D 2ARJA 3BKML 5DK0B 2UY7A 2ZIDA 1IJNA 1UEYA 4TUUA 5E94A 3VX1A 5DJ2A 2DQHH 5AUMA 4NUPA 2OI9C 3L08A 4WK2B 4AY0A 1YECH 5LO7A 1MUJB 1EFQA 1XSJA 4Y1SA 1S7TB 1DVFA 3QJVB 2I5YL 4NQEE 4NT6B 3T2LA 1A65A 1J48A 3PWJB 4FTVA 1KT2B 1LP9A 2LU4A 3P30L 4FEIA 1PYWA 4X80H 5EOCJ 4BDVB 2V2TA 2BXZA 4TXVB 3PGCA 1P9MA 3WMQA 3N06B 4UILL 3NZUA 1EZVY 5KVMC 4JFSA 4YHPA 5SX5K 4NUGL 4PRPE 5GIRA 4F9PA 1M71A 5JUEH 5AAWA 3D50A 4R4BB 4TS6A 1CWVA 4HCRL 3KEDA 5DVOA 2Z34A 2R2BA 1D6EA 2IAND 5EZPA 1AG0A 1HXKA 2GY5A 4BSWA 2A83A 5HHNB 4GXFA 3PSZA 4UTAA 3VQ2C 4O9HL 3DTDA 3QE5A 1YEHH 4NPKA 5BJTA 2HPTA 2R1WB 3MLRL 2DM7A 3CUPB 4N8VA 3AXIA 3U0WL 3QDGA 3HBZA 1MOEA 3MCYA 1HNFA 1L0XA 4RNRB 2W60A 3CZSA 5EOTB 2P8LA 3QZNA 5I1DB 3W5MA 1DSFL 4NWTH 5D7LA 4JKNA 3TT1L 1GGIH 2O5XL 2VDRL 1YY9C 3FH8A 4WGWB 3BGFB 3UYRH 1EX0A 2XOTA 5B1KA 2VRAA 1RWRA 1CT8A 4HS3A 3T0ED 3LYCA 4XP5H 2F1EA 3R19A 1O88A 3W0WD 1ZHLB 2PTVA 5JMCB 4P5TB 4OIBA 3DJ9A 3ULUF 3IDGB 4HC1L 1T20A 4FQIL 5GISL 4MNQB 3Q0HA 1ZWIB 1BQRA 3LQZB 4ZOAA 1O6VA 5ENWA 4KK8C 4TQHA 4PY8J 3IU4L 4XBMA 5FWQA 3EJUA 3BPOC 1RPKA 4PJFA 4RDQF 2RH0A 1WFUA 5BVPL 1GYWA 1FQ9C 4S0HA 5LUMA 4IIQA 3KXFB 3HG1D 4OCNC 2WTOA 4K15A 1IM9B 2CCLA 2YPLA 4DKEH 4G8EB 2FTAA 3VXPB 4XO5A 4BFKA 3GI9H 3RJOA 4YN3A 2QHRH 4DGIH 4X6FB 1GYVA 2WIMA 3CDZA 5TE4H 1WCQA 2VLKA 4UM9A 3L5IA 1RU9H 3ECBA 3IXAA 4MRCA 4P9HL 1OM3L 2DQEH 3AB0C 5FUCC 2DL9A 4NN5C 4YFOA 3C8DA 5C08D 5IT2L 3PWVB 1RK0B 2Y07L 4FRWA 4E41D 4ETYA 4OCYH 1JZHA 1AGBA 2GB2A 2OJZH 2R15A 3MLSL 5DZNA 4LO9A 5FC9A 2A9NH 1QMUA 2CDGA 4K5LA 3O3BB 3I9AA 2GBVA 5FYLL 1B90A 1IV8A 1Z2KA 5DHYA 1KTRL 1DO5A 4H5SB 2ZSWB 3JWNG 4XVUC 5HHVH 3V9FA 1IKFH 2P24B 3ASWA 3P54A 5BQDA 3UH8A 4OFIA 1T80A 3MA7B 1BVLA 2J7LA 2Y6SD 3PDDA 4HH9B 3EFFB 1W80A 4MD4B 2B39A 1YN7A 4PWHA 4C55A 5AB9A 2YOCA 4KROB 5EIQA 3HPLB 1KPRA 3F6LA 4X4ZA 3GK8L 4JY5H 1NSNL 1HZHH 2UXTA 4Z7UE 2HMID 3NZ8A 4JPKH 5D7JD 1J9CT 1RZ8B 4LSVL 3L3GB 1CN4A 2AC0A 3CHRA 3FDWA 3G08A 4P2OB 4F7EA 2P5EE 3GMOB 4Y4HB 2JKSA 1P7QD 3NIDE 1X7TA 1BHEA 1AGFA 4IKJA 5DR5L 4TTGA 2DL2A 2GCYB 2CJUL 2K0RA 2QPFA 3NK4A 2E6JA 3BH6B 4YPGA 4Z7QB 2FQDA 2NUTB 4XMLL 5HHPA 1MWAL 1JV2A 2BRRH 5EZOL 1S46A 1FFRA 3FQ2A 1WT5A 5E08H 2P3YA 5MEND 3FBQA 2VISA 1JFQL 4NQCA 2FIKA 4FOMA 1NWOA 4P9HC 4KI5F 3UTZB 2J57A 4YC2B 3AS3A 1WFIA 2VO8A 2D4DA 3LKOB 1F1GA 4MXVF 4X83A 3KS0J 3ROOB 3TNMB 3EQOA 3GBMH 3H8NA 4FZEL 1A6TB 3RFZB 1G7LA 4Z1PA 2NPLX 2VDQL 1PBYA 3L4TA 2TAAA 2JQAA 3VMPA 1R33A 1AACA 2WBJD 1IKNC 4R26L 4PJHF 3MRRA 2EVGA 4M29A 4WKZA 5F7DB 4HZLB 3PSSA 3K6OA 5E2VH 1BECA 3O4OB 2R0ZL 1KCLA 1OP3H 2IADB 2EIZA 1KV3A 4DVBA 5F7UA 4JK0D 2VH5L 5EZLA 4G9DB 1NFDE 4Z05A 4R0LA 2VW4A 3HZKA 3NTCL 1UB6A 1AJ7H 3BZDA 1BX2B 2FVNA 3OAUH 3OLEA 1I9JH 4CMMA 2X70A 4NSKB 2OMWB 1KCVH 2RBLA 4XCNB 1JRGA 2VXUH 2DTML 3MNZA 3ARUA 3Q2WA 4F2MB 5JDSA 4HULB 3S88L 2Q76A 3AY4A 3P77A 3L3KB 3L7EA 4BQ8A 3PG2A 3K74B 3LKRB 3OHXB 1PKQE 3QDJB 3WUZA 1U6AH 5LXVA 4GW1A 3NP4A 1S5HB 2CLVA 4M43L 4P2QD 3GSNH 5LGJB 3HR6A 1FO0A 3VXQA 4HGKC 3VD1A 3VGHA 1PZDA 3S5LG 2ENYA 3QAQA 2VXTL 1QLEB 2ORBL 3IGAA 1HHHB 1S8DA 4PJ5A 4OJLA 3BW9B 1L7IH 2XT1B 4M62L 2ED7A 1EBAA 4PJFE 4Z8FH 5F6IB 4URKA 1P6FA 3VI3A 3VFVB 3BZFB 5JW5B 4HUVB 3D33A 4LPCA 2JK5A 3RHWK 4DFIA 1VADA 4PIBA 1V7MH 3LPOA 4L4VE 2HH0L 1JXKA 3L7FB 3AUWB 4OQ1A 1OB1A 2WXRA 2YFNA 2GITA 4G83A 3QAZC 1AOHA 1J1PL 1VFBA 2CNZA 4P49A 1TZHB 2EDWA 5LNGA 4HIEA 3VMNA 5KZCB 3A5VA 2AAAA 1XBDA 2PR9A 3PXHA 5A40E 3PWNB 3WIAA 3ZZ1A 1E43A 2UXFA 3KPNB 4RMTA 3AU1B 2DQFB 1F58H 1NGQL 5HPOA 1YNTF 4U1HB 3OKKB 4DGVL 3WFZA 2ESVB 2XZQH 2X89A 5A6IA 5HJ3B 1K9TA 2AW2A 1UM6L 2P28B 3EYSH 4N0RA 4NZRH 3LKPA 5EULV 4TN9A 2QLYA 2E7DA 4TRPH 3P4OB 3C08H 4EN3A 3KGUA 3PGFL 1BXVA 2VDML 4UT9L 2DMCA 5T5FA 4Z76A 4LP8A 4YGVA 3GIVB 3T8XA 3RGVB 3IPBA 1FWXA 1WCBA 2V9UA 4QRSA 1A7QH 1N0XL 1E9OB 4DWHA 3QQ4A 4KKNA 4WI9A 2OFQA 5HGAB 2AV7B 3VD4A 1MHHB 1QFWL 2I26N 3EO0B 3DLQR 3BH7B 2K78A 2ZP8A 1CFQA 4FJZA 4H20H 1KIRA 5DYOB 5KSUA 4JFVA 2R29L 4XVOA 1DQQA 3ZKND 3U6RB 2O1DA 1E2VA 1O8MA 4I0PB 3QORB 3JV0A 4J3OH 4DPAX 3BVUA 4FLSA 4YUEL 4NN7C 1C5CH 4DKFH 2CHXA 1QQ1A 2CDFB 3NJIA 4GKNB 4MMXA 1TZIB 2BX6A 3HN5A 2YD9A 5CJBA 1S6NA 1I1FA 5FUOH 3O3DA 2Z35B 4UMGA 3PHOA 2Z31A 4DW2H 1X44A 4L5FH 4JO5A 4YC5A 3Q3GB 1F41A 3D3VD 3DX8B 3JWOL 3T2OA 1KCSL 5C0BE 2X6XA 3K2UH 1FG2B 4HJUA 1BOGB 4YSRA 4ZAKA 4GG8B 3FTYA 4Y5XC 5CZVH 2E7MA 2EINB 1NWPA 1CLZH 1QBLL 5DD5H 3V0WH 1UOVA 1TT6A 3TBYB 5TH2A 1DJXA 2P5WE 1CCZA 4WCYH 4L4TE 2EXTA 1BBJB 5I71B 4KZDH 4X6CA 5IOPB 2X1XR 1NBZA 1DUYB 3OXRA 3IGFA 2UWEA 4XCCH 3NSXA 3LKNA 1RERA 1S9WA 2I27N 2NY5H 5GGTL 2VLMD 1NGXB 3DX9A 5GJTH 3SE4C 1CYWA 3ULSA 3NSJA 5F9WB 5B38G 3QYNA 3MRDB 1DBKL 5LGHH 3FUFA 4J2QA 2FLBT 4LP5A 4AIEA 1KN4L 1PDKB 3NRPA 2VLLA 3SO5A 3MNDA 1NANI 1BAGA 1T89A 1A3LH 1MVUA 1F2QA 3E2HC 1X7QA 3EH5B 5I5JA 3PJNA 2WXHA 4IU2B 3DTXB 4ZRGA 2CM5A 4Q6IC 3PWPA 5DEGB 4FCAA 3K2IA 4IDLA 3ZDYF 4JFHD 5DI8B 1U33A 2COQA 2A74B 3GMRA 3U2JA 5AYQA 1AR1B 4JR9H 1JZEA 4GMTL 2VSKB 1IGYB 1S7QB 4MA7L 1BDYA 4UIKH 1JUFB 1KCRL 2AANA 4PU2A 1JZ2A 1EEYA 1ZK9A 3FRUB 3H9SB 3M1BA 2HX7A 3OGCB 3PDGA 3LNGA 2AEOA 1ILSA 4XNUL 3AQDA 1S7RA 2IBZY 4BXVA 3IDXH 2WLIA 2QKIA 4E9QA 4P46A 4OGQC 1SGKA 2NSTA 1JWMB 1FLTX 3NT0A 3WY1A 5IMLB 3VI3E 3FCTA 4JLRB 1DVUA 3A0OA 4HT1L 5HBBA 2EXSA 3UMNA 2C34A 1VEMA 3CFNA 2HCZX 5I66B 2BINA 2MTAA 5HYQA 3GBEA 2LU5A 3ES6B 4JG1H 4B60A 3EO1A 2QQQA 1XCXA 2VLJE 3TURA 4ZUTB 3UGEA 3OLDA 1XCTB 4G8IB 3NJKA 3QHZH 3SE9L 1QW9A 3O3UN 2O5YL 4Y4FD 3STBA 1XF1A 2NNCA 2IBBA 4NHUA 3ZT5A 4JG0L 3G9AB 5IV2B 4MA8L 5TQ2L 1MLCB 3K6NA 4MDJA 1KJ3L 4QWWD 4NQVB 5IB3B 4RESB 4QR7A 4TSCL 4MR0A 1G9ML 1ACYH 5DK2A 4Y2NA 3T0EC 1J0IA 1ETB1 2BH0A 1NCUA 4U4BA 3SY6A 2YRLA 3O41A 2JKXA 3SY2A 1KDJA 1NFIB 3WYRA 3R7RA 2XXFA 4XLAA 4HX1A 4ZO6A 5DT1L 3U46A 3PETA 3FO1B 2JB6B 5DO2D 3NG5A 4NRXB 3Q8BA 3T3MF 1G7MA 2B4CC 4NZUL 1QACA 2W0LA 1ILUA 4F2EA 1OTSD 2F74B 3HG3A 4HHWA 3L5WA 2X4SA 5FHBL 5FO7B 3VA6A 5BCAA 3J8F7 1J1OL 2KQMA 1E5ZA 2AXGB 5DHXB 3GJFK 3DBSA 4U31A 4X8JB 3CFDB 5M94B 4FGMA 3KHOA 2BDNH 2YPVL 2IH1B 2PECA 4GEIA 2JJTC 1KJ2H 4I13B 3HG5A 4AVHA 1IBGL 1P7KA 5I9QB 5CLYA 1A7OH 3HPJA 2FK9A 1SLUA 2VQ1A 2B1AH 3ZTDC 5JR1L 4BZYA 3VB8A 2X9WA 4R90L 1B4RA 5MP6H 1MJ8L 4BHUI 2J8UF 2X4NB 4QXUH 3IGLA 1HHIA 1B2WL 3AREA 1ZA6B 4G6AD 1U8QB 1QJVA 2V7NA 5F9DC 5K9KA 1UXLA 1F3DJ 4LPVA 4G9FA 5F89A 2VDLL 4HU2A 4JFOB 4F5CA 2PPCA 5EBWA 3DMMA 3BVWA 4MCZA 1KF9B 2GSGB 2I32A 1K4CB 1REIA 4PJBE 4X6CE 1WLHA 5F7AA 1B9ZA 3LCYA 3O2WL 1G9MC 2UY6B 2Y6SC 3L8QA 3MREA 4XC3L 3O2DA 5LCVA 3DHJA 4BSVA 3ELQA 4XC1L 1C8PA 5EF0A 5IB5A 2AQPA 3K0WA 4MJHA 3Q9QA 4B96A 2HMIC 1ASPA 5DWPA 5D7JC 2JJVA 3IDYC 1UM4H 4OZHA 4F7PB 3V0VB 3U0PA 3DJZA 2X2IA 2V5IA 1F56A 1L0PA 2HTKD 3TJEH 4QY8A 2V2WA 3L3DB 4WLCA 4XKVA 2DQIH 3DSFH 2A9ML 4BV1A 1R5IA 2ZUUA 1G6VK 4AYFA 2WKLA 4GRLA 4XO4A 3T0DA 4Y1AA 1J5IA 4GLRI 1MFCL 5HYIA 1CE1H 1R47A 3FUKA 3AQYA 2F8XC 5DLLA 1FZKB 2V4LA 1A1OA 3U9WA 5F6HI 3MXWL 5KSBF 1T4KA 1IB4A 4M93B 2FGWH 2V9QA 3HJ0A 3FT4A 1GS8A 4ZFQA 4XPFH 4YSAA 2R23A 3KPQB 4KRMB 3A6OA 1BZ7B 2EDNA 4U1SB 1Q0XL 2O17A 1CURA 4HAGA 4A55A 4UDUB 1CXEA 1NAML 2KMWA 1CVRA 4R83A 4JB9H 3X1GA 4Q9QH 1ZPUA 2VZSA 3LQMA 2OAAA 4I18C 2DS4A 1N5AA 1X9RA 5AKSA 1JD9A 2F7IA 4BINA 4UMSA 2JVUA 1O0VA 2QZ5A 2GSMB 4N0UA 4UYQA 2BFGA 1MNUH 3RWJA 3BKJL 5IROD 1PFOA 4PJIA 4G71B 3L45A 4D8PA 1D7DA 3BC9A 3F65A 3GUFA 2BOBB 1MFUA 4F80A 1TQBB 2YXVA 3L4CA 5D7IA 2PO6A 2HSIA 3OMNB 1Q4NX 4Y9CA 4C8XA 2WXLA 2BSDA 3WY2A 2ETWA 2ALWA 4ONFL 4C58B 2JJSC 4IRZL 2F61A 2Y7LA 4HIHA 3VFRA 2E7LA 5DUML 4MCNA 2EDOA 2NY6B 3B9AA 4YZXA 4AXWA 4K3JL 3HHMA 3LZNA 4PR5B 2FEEI 3ZR6A 1LXMA 2BWQA 1LDPH 3EOTL 1TXKA 2B5IC 3MRFA 4HIIA 4RGNE 5GGQL 2PXYA 1QO3B 5HHME 1X4YA 3SPVB 3Q2CA 3VSUA 4B9YA 3VWJA 4PG2A 4XN8A 3KBHE 4UILH 1UWXK 3QIWB 1CFSA 4GQQA 3L3HB 4FNPA 2BCKA 4N0CD 4O2CB 1N5YH 4NNXB 2BP8B 1L9OA 4HCRH 3QSKB 4JM2B 4ZXBB 5FKAB 4LDEB 1ETZB 4NPYB 2HJLB 3VWKB 3GEWB 2OR9H 5I28A 2IH3B 4Y7MA 5I6PA 3QXAB 4MMYA 5TDNB 3ZYJA 1OAQL 5JXAL 1ZOXA 2VLRA 4K7PX 2VE6B 1R6VA 3CVHB 2QMKA 3ZJAA 5KYUA 1JNLL 1WGOA 2J4WH 1UKQA 4FG0A 4HDIB 5T3ZD 4NEHB 3BRFA 3IETA 3GQAA 1MHPH 4P5MA 1PCXA 1NCDL 2ZOUA 1UG9A 3HE6B 4KZCA 1F4WH 3V52H 2VDRH 4YHZL 2LW3A 5CUSL 1GKEA 2G0LA 2CMRH 4CNIB 4F5CE 2H0JA 2CO3A 1NZRA 3QG7L 1UYWL 2OSLB 3HC0B 2OL3L 3SO3B 2IO5A 2X85A 4NO0D 4M6NH 4XRCB 4A1RA 5ID1A 3BAYA 3F7VB 4W6WB 5BMFH 2BHFA 3WO3B 4I7ZC 4OB5L 4X42A 3K6SA 4X0KB 3C9NB 4FQIH 5GISH 2D7NA 5AVQB 3SN6N 4XR6A 5I8EB 3ARDD 4AEIH 4M7JL 3LMWA 4RISH 3IU4H 1KYOK 4PV9B 4OZHE 2XRAL 4X8GA 3UTQA 4PJDA 1R19A 3HB3B 1XL4A 3ZKNC 3B9KD 3MYZA 1IC5H 1UD2A 3KYKL 5KSVA 2KPNA 3SQRA 5HHOB 1FZMA 2DQ6A 1UURA 1D2PA 1DLFH 3W39A 4LMQE 2JV6A 2FEDD 4JJOA 4R3SB 2H0PA 5F96L 3GYRA 3B2XA 4BZ1H 3G5XB 1IEBB 4M02A 3SDAD 2JCWA 3D2TA 4P9HH 1OM3H 2FO4B 3K7UA 2VXQA 3WFDH 1TETL 1QHQA 2DWEA 2ZCLL 3RWDA 3WBDA 1OD7A 1SPDA 1M7IA 3CDCA 3LRSA 3I9GL 3KLLA 1X5KA 1THAA 2Z0UA 4OZIA 4QRPB 1E40A 2Q2EB 1HH6A 2OZNA 4JHVA 4HWBA 4N2IA 2XKUA 4DUVA 5E00A 2ZOOA 2XYCA 1M53A 2GAZA 4F92B 2XPGB 3RWFA 2R0WL 4LCYB 3OXSA 5DD0L 5IM7B 5SWSB 1QSFA 2PWEA 3VMOA 3L95B 4EMZA 4HOMA 3VGDA 1VEOA 4HCGA 3Q1SL 4DP8X 4WO4B 2ZPKL 3IFLL 1OP5K 3BAIA 3OWEA 4AVZA 3WTSA 2E86A 2L3BA 4LSUL 3GK8H 1FZJA 3QNZA 4D2NA 4WHTA 3CVCA 4EIUA 4LLMA 2XWJB 3DOIA 2H1XA 5I1HL 4D9QD 5IMOB 3QI9A 3B2PA 2BNQE 5DR5H 1MVFA 3MV8D 4JO1H 1NJ9A 3NACL 3US1A 5FLVA 3FCUB 4MZIA 4TSBL 3O2VL 5EZOH 3BT0A 3D2UB 3JV4B 2WINB 2I24N 2VTFA 2XTLA 5CBEA 2OTWA 2CO4A 1DL7H 4OZGE 4JDZB 3R8BB 1SN5A 3QUML 4ZD3H 1T04A 1K4DA 1RUPL 3S34L 3EFOB 4NCC1 4UQ9A 3QJHA 4YFLF 1F4XL 4BKLA 1MHCA 2JJUA 4ZW3A 5I8KH 3ILQD 1KTKE 3O0RH 4F9LC 4OCXL 2VDQH 3QC5X 3EG9B 5EUKB 5FGRA 5I1EH 3MUUA 4ZW8A 2MEJB 2Q7AA 2XPZA 5GGSY 1MAJA 1L9QA 2NYKA 1MAKA 3D18B 2R0ZH 5BRZD 1CTNA 4OUUA 1TFHA 4ZX4A 1BYNA 4I1RA 5D1ZA 3MZGB 4PW3A 2VH5H 3FOMA 1F3RB 2E8YA 2ZKMX 4AWJC 5LLIC 2VDPH 4U7SA 4K3DL 1JMZA 2EDDA 3NK3A 4QRTB 2XJLA 3FTSA 4Y4FC 3WTTA 3NTCH 3P11L 5F1IA 2OR8A 5BUPA 2HVKA 2O5ZH 4G42A 2VBEA 3K5SA 4JO4H 5EO1B 2JI1A 3VFUB 3KW7A 2XY2A 4R4FL 4TTDD 4PGBA 1GOFA 4QWWC 3DK2A 2YQBA 2C9PA 4X2UA 3MZTA 4L37A 3IBEA 1TPXB 2EYSA 1FYTB 2DTMH 2NY3D 1CLYH 3KPSB 5BV7L 1XH3A 4GW4B 4XVTH 3GQFA 1AO7B 1NCAL 2J2ZB 2WXKA 5EPMB 2XFGB 2OMXA 1U3HA 3INUH 4OD3H 4P5SA 4YHIB 2GJJA 1TOXA 1UT1A 5ICXB 4BFFA 5DO2C 4FQCH 3SDXB 1A8JH 3JTSB 2ORBH 4BK5A 2BJMH 3VGAC 3APDA 4PGEA 3ULAB 2JIXB 3D08A 3EJJX 1NL0H 3MLVH 3I9PA 4WW1B 1IGFL 5CGBA 3POCA 3X1EA 3VH8B 1OTSC 4WEBH 4OZFB 3FB7B 4JVPA 3UEQA 1UHVA 4X7TB 1KCWA 5BW7C 1JYVA 1UXMA 4YDKH 2NLJA 3U9PL 3WNOA 1ZT1B 4X6BB 2R4SH 3M88A 4UQ2A 3MRKB 3X3FL 2YRBA 3ZTNH 1IAKA 3H0TB 4NQXA 3G6DL 4K3HA 3SE8L 1TYWA 1VZGA 4GXVH 2WOBA 3ZKQD 3DPBA 1JG9A 1I3RA 1PPIA 2KHAA 1MCJA 4QLRA 4RBPK 1SJMA 2YBGA 1BYPA 2NUPB 1MFEH 4MDRA 2YQGA 2Q87A 3IN0A 4G6AC 3CFBB 3ABGA 1GR7A 2Y06L 4KZ0A 4P5TD 4OZIE 3LEXA 4I3SL 3FL7A 4JHWL 4OFQA 4KV5E 3GXPA 4JRXB 3EGXB 4MNQD 2W9EH 4H26A 1RV6X 4S11A 4D3CH 4FQQB 3QO0A 1Z3GH 5AG9A 1LQSR 5FEBA 5ALBH 3L6FB 4TNVF 3U25A 3EJZD 1XGRB 2BS8A 4LESA 4H25B 3PGFH 1WJ3A 2EDJA 2ZXGA 4L8SC 2BSTB 4PJGB 1R0AL 1FFPB 3FOLA 3KXFD 1A5FL 4LHUD 4U1NA 3SY0A 2WJ7A 2CIIA 5KYXB 1IM9D 4DEPB 3GSVA 3U9UA 5FM5O 1N0XH 4XMZA 3BQUB 3MRPA 4P3DA 3WIIH 2MRYA 4FS0A 1NCCH 5KYWA 3ZDXB 2ZAHA 4ZFOL 4UZGA 2HTKC 2ID5A 4HS6B 5ITBL 5DJ8A 2YO3A 4XNXH 1JTPA 2R29H 5DQDH 2VN6A 2Y3NA 4AG4L 1QPPA 2MWCA 2QEJA 1IBZA 3Q5TA 5EA0H 3UTPE 4LARH 3HBQA 1MFVA 1V5JA 4YBLB 4LLWA 4F3FB 5C0CB 4GIPD 3VVWA 2OTUA 5C0IB 1K5WA 1OVZA 3CV5A 1OAXH 1PX3A 5J6SA 4NK6A 5L2JB 5D2LB 2Z8WC 3FPYA 4PJ9A 5AOLA 5T1LB 4PVBA 1KIPA 1KUMA 3VXSE 4P48A 4H7VA 4RFNB 3ECUA 2XZZA 5F7KC 3L17A 1KCSH 1M9SA 1RKRA 5AWNL 4TL4A 1R5VA 4HIQA 1J8SA 1E6JH 2C3XA 4OM1H 1MFMA 4HJSA 4P0DA 5DURB 4HJGA 5GHWH 5FECB 2I69A 1HL8A 5C09A 4KROD 4YDLB 2DICA 1BAFH 4UAOC 1B88A 5AW0B 1MJ7L 2VN5A 4TM9A 4L2LA 4F8NA 3B3IB 3F62A 1RUQL 4EZKA 2IPTL 1TU2A 4HKBA 3K71B 2ED9A 3CX2A 4P2OD 1H3PH 3MRCB 4XPHL 4Y4HD 1IGIH 5T3ZL 1U2YA 2A5UA 3U7AA 4AUYA 4LLDB 5I75B 3CSYA 2ZYRA 5CEZE 5IROC 4ONGH 2HUHA 4Q56A 2RQ8A 4TLUA 2YUZA 3BXNB 1SY6H 3KYOB 4PCYA 4UTBL 4GJTB 1HNYA 1AXSB 3JQOB 1UZGA 1ZHKA 1BPLB 1OT1A 1U8NB 3NEOA 3RJQB 1YY8B 3SOBL 4WU5B 5I30H 3L54A 4KDTA 5C0EA 1A4JB 3JWDL 3MV7A 5AW2B 3AG3B 3F7YA 3U36A 3RUGB 5INCB 5EV7A 4NDMA 2AABL 3O0LA 5ESQA 4CGTA 5IHUL 1KYUA 1V05A 2FX9L 2KLSA 2B4CH 3BZ5A 4MA7H 1HILB 4OLEA 4WHYH 3EOBA 4WNSA 5ESAB 3ILEA 4HAFA 1RD6A 3CZGA 2GEEA 1WS8A 3VG0L 4MCYA 1OAKH 4Z3GA 1ASOA 1AQKL 1V10A 3FHAA 2B9AA 1JWUB 3B34A 3EJSA 5KBKA 4EUPH 3GJFH 2OMYB 2F8VA 3GSXB 5CMAA 2YLKA 3FMGL 3O6KH 4QGYA 3WY3A 1USQA 4F8PA 2H9GB 4N0CC 3S6CA 2E56A 3JVGA 1J1XL 1EHXA 4HF5L 4EVNB 4HT1H 4WFGE 3QR2A 1A7NL 2E3VA 4N0FB 2FUTA 4CBZA 1U8KB 4NO3B 1CO1A 5EC2B 3VFGL 1KLUA 3ZPPA 2OYPA 2YK1H 4F2FA 5HGDB 3DXAE 1DDHB 2NCEA 4HETA 4CW1B 3KLHD 2WZ0A 1A47A 4YDJA 3OBAA 4HMCA 4JL1A 1GZHC 1ZHBA 4FMVA 2DH2A 1Y18B 3QDJD 2HFEA 3BWUF 5DC0A 5I1CL 4WTZA 3QISA 5I76B 4MD0A 5KWYC 4DVRL 2YD5A 4JG0H 3EGSA 5E4OA 2GTWB 4FNRA 5TQ2H 4ANVA 4QUOA 5GGUB 4OJPA 1U8IB 3OKLA 1XMWA 1NCTA 3NAWA 1UJ3B 3A23A 3KWTA 4QJ5B 5L0QB 1G9MH 3LZFH 4I2XB 1VAHA 3ZXAC 5E94B 2YAFA 4TVSa 5DJ2B 4A7SA 4ZFFA 5HVGB 1YPZA 3BKCL 3K91A 1ZHNA 3JWDC 4G5AA 3X13A 3NN8B 3WKQA 5BUGA 1MLBA 1YCSA 3UBXB 5C0DB 4XHJD 2QXZA 3DIFA 4HWZB 5KOVC 4FTVB 2G75B 3ARDC 1LP9B 3VG9B 2XWRA 4NPJA 4NZUH 3FQRA 5L4MA 1PYWB 2V2TB 2UX7A 5I19L 2F53B 1EXHA 4CADA 3PGCB 4WFFE 3A67H 1NAKL 5E8OA 3SGDH 4XNZB 3OKMA 4YHPB 1QEWA 4IJTA 3B9KC 4ODUA 1M71B 2DEXX 1TSPA 2XTSA 1J1OH 3CDYA 4JFFE 4F93B 1N18A 3ULUE 2CO1A 3CFKB 2FEDC 1D6EB 2R2BB 2HKAA 2IV9A 2BW4A 3ZQ9A 1S7WA 4BSWB 5KW9L 2A83B 1URIA 5CNHA 5KZCD 5BNXD 3SDAC 1P5VA 2D8KA 2VAAA 4AQ1A 4Q9CA 3GMMA 4YZWA 3JTBA 4K8RL 1CQYA 3SZ6A 5A7EA 4H0HB 4IYKA 4N8VB 4CAGA 2ESVD 3QDGB 5JR1H 2VQTA 1INQA 3K3QA 5DZ9A 2W60B 5G55A 4V1DE 3RPIB 1MJ8H 2E9JA 2QV4A 3NCMA 1EGJA 5D7LB 4OJAA 4MXWH 1CUOA 4TYUA 2V3EA 2C7UB 2GFBA 5DFVD 3ARVA 2J1XA 3U82B 1ZPLA 1CGVA 2XWEA 3KPPA 3RGVD 3L4ZA 3ZHFA 3GIZL 1CT8B 3PQYB 4ZO7A 3QEHA 3GTVA 4C4KT 5BZWA 2E6PA 2AXHA 4ELMF 2WNXA 2BVOA 3O2WH 4XC3H 3RDJA 4NKQB 1FA4A 1MJUL 1HXMA 2XBDA 1T20B 3QFJA 4L1DA 4MA3B 4NKMB 3UW0A 3B9EA 1XZ0B 3WDIA 5C6PB 4I0PD 3QORD 1UUSA 4Z0BH 3LD8C 5EU5A 2YQ3A 4JFPB 3LN9A 2XU9A 1HOCB 3EZJB 2WUBL 4IIQB 4N2BA 3I6LE 3ZL1A 3AACA 1H0DB 4M03A 4ODTL 5HDQL 3P2DA 4XN0A 1MCWW 4FDWA 4IBQA 4Z95L 1WVZA 4XP1L 3WLWC 3MV7E 3KPMA 4IEFA 1H3UA 5K9OB 2XBTA 2VLKB 3CFMA 3LNFA 1MFCH 1XL6A 4RQQA 3JBG7 1Q9OB 4RMSA 4RWHA 1UWXH 1ZLSH 5LQBL 3I3DA 5CP7B 1KTBA 4W9CC 5TK2A 4CJ1A 1AGBB 1MXGA 5MHSE 3A6BL 3ILQC 4DZBA 4FL4C 2MCPL 2CDGB 4OF3A 3AGWA 3C6LA 4Z78A 1ZEAH 1RHFA 3QDMA 1QFWM 3TWCH 5FB8B 4OV6F 4F91B 2O0WA 2WZ5A 4GYBA 1QAWA 4JFEB 2BC4A 2QQNL 4KI5E 4ZMLA 4OKVB 4D9LL 2OX5A 1GRWA 4KAQH 2GTQA 3QEQA 3FFCB 1PZ3A 4MXVE 1YN7B 2E6QA 1G0DA 1B4JL 2H4EA 5DJ6B 1WBYA 1KPRB 3PWUA 2Z7ZA 1MCRA 4N87A 4Y9BA 1QYGL 1AIRA 3SKMA 1G5AA 3MRBA 3VQ1C 4OT1L 4PJHE 1KBBA 3BD4A 5ANMA 1AR1D 3G08B 3S5LA 4F7EB 1BJ1J 4W8TA 1D9KA 3L16A 2X9XA 4TTDC 3MCKB 4PP2B 3V4PL 2NY3C 2VR8A 4J3XA 2LTQB 4PB0L 3NYKA 4ONFH 3Q6FA 4IRZH 2Q8BH 1H6FA 2CUIA 3ZE1F 5HHPB 2MPAL 5LAXB 1JV2B 2BZ7A 3M86A 4FI6A 4HSQA 2FUQA 1O8IA 1J5CA 3ARRA 1KCKA 1AZCA 3MLUL 4FI8A 1V3JA 4K07A 4LEOA 4NQCB 1QD0A 2FIKB 3VM7A 3ZR5A 4J3BA 4E42A 5B22A 4ZMZA 3NJVA 3MJ8A 3AQXA 3RX8A 2PWDA 4F8OA 3NJFA 1K8IA 3FAXA 1MCOH 4EXKA 1VFAA 2B3IA 3EUUA 2Q6WA 5I17A 2QPEB 1BVNT 2ZTBA 3IDMA 3NRFA 4KK9D 2QGEA 3RQ3A 3LPWA 3PHSA 1DUZA 1YHPA 3L2NA 3G5VA 3G6AA 1BQHG 4WKZB 5I15L 5DRNA 4M6OL 5A6LA 1JD7A 1S7UA 1MQKL 5DU7A 4FXKA 2EIZB 2FX7H 4IHOA 2QV2A 1DBGA 1E0OB 1Z9SA 1LHZA 4FQ1L 5ICZA 3BGFC 5F2FA 4Z7IA 1UA7A 4R0LB 1MQ8A 4EDWL 1I7TB 5LAPA 2R7EA 4H0GA 4Q4EA 1AS8A 3HZKB 1S9XA 1UB6B 4WWNA 4P5TC 1P4BH 1R17A 1AE6L 4OLZL 3SZEA 4KGLA 4CMMB 4GRWH 1TZ8A 4PRNA 1PZ2A 3MLYL 4B9KC 2KLRA 4JDVA 3MNZB 2LT9A 4U33A 4DO5A 5JDSB 2Q76B 4LBEB 2NR6A 2PCFA 3L7EB 1RLWA 1OO2A 1S2EA 3VFSA 1UYWH 1OP5H 1NTDA 1Y6NR 2C9AA 3L13A 2OL3H 3EJZC 4GW1B 1QBBA 5D4HA 2EYTB 4JQXA 4Q2ZA 1FO0B 4PY8I 1UCBL 4OB5H 3VTAA 4XMPH 4MB5A 1GGYA 1KC5H 2YJQA 4IW4C 1UWFA 3ARFB 4JJ5A 3V9EA 3WE6B 3IGAB 3V79C 1QTYT 5JPMA 4PJ5B 5C07A 2QVIA 5T5NF 2VAJA 5DFAA 2PWGA 4Q14A 2XRAH 4L1TA 4M7KH 5CWSA 1T7YA 2DQGL 2J12B 1J9QA 1U8LA 3FPXA 1TVHA 4JZNB 4FG6D 4QTHB 2ICWA 2JK5B 3DGGA 2G2PA 1OPGH 1VADB 1EXUB 2K6YA 4QYAA 1TEYA 4RAHA 5DC4B 3SD2A 5AAPA 5DS1A 2IDCA 4LSQH 1Q1PA 3FT3A 3BKYL 3RBGA 4Y5YA 3JX8A 4DP7X 5D1QE 1T0MA 2OXHA 3MFGB 5JXED 2N0MA 3FCSA 3B7SA 4OVVA 4DEWA 1NCOA 4WWOA 3BP7A 2ZCLH 2YA1A 3BN3B 5KS9B 1EHLL 3PXLA 2VITB 2CBTA 3GS0A 4HIEB 4JO2L 5IGXL 4AM0A 3I9GH 2Z64C 5JW3L 1E4KC 2FQGA 3BSHA 4UQ3A 1B0RB 1I3GH 4MB3A 1TCRB 4KROC 4PVMA 1LMIA 3O6ML 4KQ3L 3ALXA 1PLAA 5FDYA 1OANA 3ZE0F 5IFAH 4AZ8A 1GS6X 1DFBH 3LKPB 5F1KC 3FK3A 4PH8A 2A38A 2L8AA 1UM5L 2XZCH 4EN3B 3GMLB 1PZ5A 4QOKB 4P2OC 1LEKA 1P84J 3QEQE 2J8UA 3B2MA 4H40A 3Q1SH 3GHBL 4Y4HC 3BAEL 4YGVB 4ZSOB 5TF1L 1INEL 3KG5A 1LD9A 1WCBB 3SB3A 4ZFZA 4NIYE 4QRSB 4FAAB 2HJKA 2BVTA 2L7QA 3QQ4B 4WV1A 4LDOB 4DNLA 1UUNA 2M83A 4JKKA 4ANWA 4OJ6A 4M7LT 1CFQB 5HHQA 5KSUB 4RX4D 4ES9A 5I1HH 2CWRA 3CVBA 1PD0A 4XBPA 5KJRL 1XEDA 5F9AC 5IVNA 5GJSL 4YC2C 2OK0L 3D9AL 3WIHL 2HYMA 2VERA 3F5WB 3TBBA 3VXME 1TVBA 5B3SB 1DQJB 1FCCA 3UL4A 1GTFA 4JQIL 3O2VH 5IUCA 1KG0B 2KBGA 4QIRA 4GBXB 3RFZC 3BUPA 2ITEA 1BQ5A 1I1FB 3O3DB 3PHOB 2VDOB 3CFEA 2Z31B 3HMXH 3QUMH 3MLPA 2BVPA 3H54A 2VXSL 3EYUH 3FZUD 3PFUA 2ZOLA 4D7BA 5JOPD 4LCWA 3ZDYE 3HHSA 3O4OC 2YMTA 1DQLH 4ZAKB 1UADC 2ZQKA 1W2KT 3RNKB 4B9FA 4YWGL 3PCYA 3F7QA 4OCXH 1BD2A 4LOUD 4JQVC 3HE7D 5TH2B 3RHWF 1LDSA 4RBPH 1IT9L 5C1EA 4ZUWA 4XH2B 2JQZA 3OXRB 4NB7A 5EIIG 2UWEB 3FB8B 2CLZA 4FLHA 1U8PA 3LKNB 1KXQA 1YSOA 1OAUL 3CC1A 4O51A 3UO1H 5C9KA 1YYLL 4NNYA 3DX9B 3BP5A 1ONQA 1SBSH 3TLRA 3TO2A 2BIOA 3KLHC 4NYLA 1XCQA 4ABQA 7PAZA 4JRYA 4K3DH 4UIMA 4MB4A 5DTFB 1FFTB 3DDGA 4JY4A 3T09A 3OHXC 1J8HA 3K72B 1MVUB 1DVXA 2NY6D 4WENB 1ZT4B 4DJMA 3UTPD 2EE9A 1C5DA 1U58A 3GXNA 4P23A 4AVJA 3PWPB 2BXYA 4HEPG 2NT9A 2XKSA 1A9BA 1U42A 3GMRB 2DM3A 4PBVC 4XMKH 1JTAA 3VRIA 4NRYA 5CCHE 5F6IC 1F90H 3QIWD 3IPEA 1IZKA 1G1CA 3NESA 3DWTA 3PREA 5CN1A 4A6YA 4XHJC 1UD3A 1SZNA 3M1BB 1T5KA 2ICWJ 1QA2A 5A2IH 3KPTA 2DDQL 3FO9A 3HI6L 1S7RB 4PTTA 1IAOA 3S3CB 2WLIB 2QKIB 3JUZA 2UVEA 4JM2D 4YOKA 4ZXBD 5HYEA 4O5LL 2W7ZA 2E76C 5JQIB 4L23A 1IGFH 1WFTA 3VWKD 1D2OA 2FJFA 4KZEL 1ACZA 2XWDA 2Z9TA 3HC3H 2XXCB 2ZUXA 4HLZH 5IQ7L 3BUIA 1JNNL 1JV5A 5A1AA 3TO4A 5HYQB 4FX5A 4FQ2H 4JN1L 4M4RA 3VO0A 4G6JL 4G1EA 3EO1B 3MACL 5J6GA 1R5WA 3ZDWA 1DBOA 3HE6D 3AU0A 4LP4A 4UYPA 5K39A 4K23L 2VIRB 4YDVA 1Q8MA 3SKJL 3V5HB 5ITFA 2VMJA 2EJ1A 4LKXB 4JFXB 2YWYA 5T1JA 1PG7H 4J6IA 1TYEB 3LZRA 4GQZA 4DKAA 2G5RA 2YBRB 4WWKA 5CILH 4JFEE 4HUKB 4MDJB 1FH2A 3CDGA 5DFVC 1DHKA 3RGVC 5J13B 1V27A