3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
b'MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
3ZSTA 2WVTA 4J3WA 3WY4A 2F61A 2WVSA 3BUPA 1QWNA 2VNCA 3BAJA 4PSRA 1GCYA 2QMJA 3VMPA 3BVXA 2D73A 2EJ1A 4H8VA 2YA0A 5CLWA 3DHPA 2WNWA 5CXPA 3BCFA 5HPOA 3EJSA 2INUA 4MR0A 4H8UA 2UVFA 3ZR5A 2OYKA 3FAWA 1O8LA 3OLDA 1CXEA 4UOZA 3KL3A 3VMVA 2TAAA 1QX1A 5E70A 2E8ZA 2ZWZA 3ZOAA 2X6YA 1VFOA 3VNZA 2F7QA 1SZNA 2QPSA 1KGUA 1UD3A 2BY3A 2QMKA 2GJPA 3DX4A 3LPOA 4GQQA 4NXKA 2ZX8A 4CVWA 1CGWA 3DX1A 1QW8A 4MAZA 1TQWA 3A21A 4OIFA 2NT1A 4GO9A 4U31A 3UCQA 1O88A 2QXZA 4H2CA 1R46A 2QX3A 2X6XA 1KCDA 2DH3A 2D3LA 3BMVA 4PCSA 1XCXA 3VSUA 2C7FA 2WVVA 3A5VA 3GXFA 4JFUA 4U2ZA 1KTWA 4Z05A 3ZO9A 4EW9A 3K8MA 3ECQA 3EQOA 2ZWYA 2XWEA 1GJWA 3BVUA 5A2AA 3S5ZA 1NHCA 3AMKA 5HXMA 1UH2A 1CLVA 4XLEA 4GIAA 4YZAA 3ZSCA 3DDFA 1W9XA 1CXIA 1CGVA 4J27A 4PCTA 4U2YA 4UNIA 1A47A 3GXNA 3ZR6A 2FHCA 7TAAA 1O8DA 4OJPA 4XLAA 4JFWA 5E0FA 2EABA 4UCFA 1OT2A 4J3XA 3CV5A 3CC1A 3GQ9A 2ZXQA 2CXGA 4AIOA 1O8HA 3WELA 2WKLA 1BHEA 2O1DA 4LXFA 3EDKA 1BF2A 1I75A 2NT0A 1KB3A 5A6MA 1WMRA 4J3SA 2VBMA 1L0PA 3D52A 3LRLA 2CHNA 1HNYA 1KWGA 2BY0A 3VGFA 4AMWA 4FNQA 2WCSA 3AXHA 3W37A 3KWXA 3VGGA 1HTYA 4U3CA 3WMSA 2VJIA 4OJLA 3UW0A 1XGZA 2C8NA 4CKQA 4XB3A 2FHBA 4UQCA 3W38A 3L4YA 2ZUUA 2ZUTA 3M07A 3UG4A 2F7PA 3DC0A 1PZ3A 3D50A 2E0PA 3BLBA 3BVWA 4YZ0A 3B90A 1IZJA 3IJ8A 4KWUA 3GXDA 1TQUA 1PEZA 4CN1A 3ZT5A 1QWUA 3WNMA 3HG5A 3GQ7A 5AMVA 2PWGA 4JCMA 4BA0A 4CN6A 1EHAA 4H7VA 1EH9A 1X0CA 4NI3A 2WKGA 5E1QA 1SMDA 1XCWA 4OJ5A 2BY2A 1PJ9A 3EJQA 3D4YA 4HA1A 3EDDA 3B8YA 1CXKA 3AMLA 4BZYA 4XKVA 3RILA 4NX0A 2ZUVA 1KCCA 4JFTA 3CPUA 1WZKA 2WSKA 4UZSA 4M8UA 4LQ1A 4XL9A 2BHUA 1XD0A 4DO4A 2GUYA 3AXIA 3VNYA 1EE6A 2QY1A 4I84A 4FLQA 4B9ZA 1QPKA 4XLFA 2E9BA 1JDDA 1ODUA 1OGSA 1VFMA 4PSPA 1PE9A 4J7RA 2CPUA 2OSXA 1JFHA 1MW3A 4HOXA 1QHPA 2DIEA 3BAKA 1VIWA 1XV8A 4JCLA 2GJRA 2AMGA 3UEQA 1XSIA 4YEJA 1V3MA 1PXZA 1TQVA 3BLKA 1J0HA 4OJ6A 3BUBA 1OSEA 2NT6A 1IDJA 3BSHA 3GBDA 5KEZA 1JTAA 1UH4A 5DO8A 4XMYA 1HL8A 1IV8A 4H8HA 2NTBA 2X2IA 3LMWA 1XSJA 3LXBA 2OW6A 1JRGA 2EADA 3K8KA 4GINA 4C2LA 3WN6A 1MXGA 3VMWA 2ALWA 2BY1A 2WCGA 4Z06A 3S5YA 1PIGA 2D2OA 5C1CA 3WNLA 2ZIDA 3BAIA 3TTSA 1JD7A 2F18A 4FNRA 1G5AA 2PWDA 3KE0A 2VJJA 4YZQA 3T9GA 1KBKA 2FYVA 1VJSA 2YIHA 3KEHA 2IQ7A 1EO5A 1D3CA 3VGDA 4JL1A 1KXHA 5A2CA 1UA7A 4XN3A 4DO5A 1GQ8A 2XN2A 1WZAA 1O8KA 2PWEA 4XM3A 2EQDA 2VT0A 1O8IA 3MI6A 2VRKA 3VM5A 3K1DA 2X6WA 1OB0A 3WNNA 4XNFA 3ZPPA 4YZXA 3TONA 5CLTA 1O8MA 3VGBA 1MFUA 3WY1A 1R47A 3GXIA 2ZICA 1UASA 2VBKA 2XVKA 4FLOA 2FHFA 2D0HA 4TVUA 1QW9A 2O17A 2O0VA 2EO7A 4ATWA 4W8TA 1PAMA 1PZ2A 8CGTA 2YA2A 1E3ZA 1M53A 1MWOA 4GO8A 1HG8A 4W8RA 1QCXA 1JI1A 2OYLA 1V3LA 2XVGA 1ZJBA 3BC9A 2VUYA 3HG4A 2YFNA 5I24A 4WSKA 3DHUA 4JFVA 1HL9A 1UD2A 3GXPA 1MW1A 4FNUA 3AJ7A 1JXKA 1MW2A 1PLUA 3ZQ9A 3BVTA 4HOWA 2FH8A 1UH3A 2NTQA 2D3NA 4GKLA 2NSPA 1JI2A 3BMWA 3VMNA 2V3EA 3L2MA 5I0DA 3D4ZA 1O7DC 2D0GA 3TTYA 1DBGA 4QAWA 1PS3A 1OFMA 1LWHA 2Y2WA 1C8QA 4OGZA 1RU4A 4J3TA 5CGMA 1WE5A 2O04A 3KLKA 4FLRA 1UD8A 1OGMX 1VB9A 3L4VA 3EJPA 3H53A 3WENA 4XLCA 3BVVA 2BSPA 1U33A 4GI8A 1H80A 1BG9A 1RWRA 2EACA 4NZJA 1QJVA 1KCKA 1XD1A 3VM7A 3WFZA 1XG2A 4HP5A 1AQMA 3GQ8A 2WSPA 2F7RA 2WC7A 4AEFA 2ZXAA 1WZLA 4W93A 4NK8A 5CGTA 1XH1A 4OJOA 4W8SA 1G94A 4XOPA 1AIRA 2FGZA 2ZUWA 3A4AA 4AEEA 3CLWA 1CPUA 2Y4SA 1V3JA 4NZFA 3JURA 1DTUA 3WY2A 3L4XA 3GQAA 4XQFA 2PWHA 1IA5A 5TD4A 3DX0A 1R75A 1V3KA 1KGWA 9CGTA 1CXFA 3VX0A 1LWJA 4PEEA 4FMVA 2F2HA 1TQTA 4URRA 1TCMA 1HX0A 3BCDA 1R34A 1MW0A 3BAXA 4M56A 1QI5A 3KL0A 4XKWA 1XSKA 2D0FA 2IGTA 2ODLA 2INVA 1E43A 3VSVA 3H54A 4UQBA 3UERA 3KL5A 1B0IA 1M7XA 2DIJA 4UQ9A 4J28A 3UG5A 6CGTA 3KRGA 1O8FA 2PYHA 3A24A 3CZGA 3GBEA 5DFAA 1JF6A 1XH2A 1BPLB 1JF5A 2GVYA 1DHKA 1Q4NX 3UG3A 3GRHA 4UQDA 3L4WA 1DEDA 1IZKA 3BSGA 2ZUSA 1CYGA 1RPKA 1AMYA 1BSIA 1WP6A 4XORA 1Y7VA 3EDJA 1EO7A 3EJTA 2ZX7A 2BXZA 1Z32X 2E8YA 1CDGA 1BVZA 3EQNA 3CTTA 1BLIA 1UA3A 2QLYA 2XWDA 1VAHA 4FLSA 1KCLA 4AYGA 2OSYA 4PMHA 4UQEA 1JG9A 2BHYA 2OYMA 3L4TA 1GJUA 1WZMA 3L4UA 3TOPA 1B2YA 3WDJA 3WNOA 4CGTA 3EJRA 3K8LA 1T0OA 3FAXA 3DDGA 5C1EA 4AMXA 3LXCA 1UOKA 1HXKA 4GI9A 3FY3A 1KTCA 3QGVA 4B9YA 1J0IA 1J0JA 1IDKA 3BUQA 2VRQA 1K5CA 2EWEA 4U4BA 2FH6A 3GTNA 2AAAA 2YKKA 3KLLA 2NTPA 4Z03A 1PPIA 3LRMA 1CZFA 1UKSA 3H55A 3ZT7A 4AIEA 3VU2A 4OKDA 2FE0A 3A6OA 4NK6A 3WDIA 2Z1KA 4GQRA 4OJYA 1CGUA 1O8GA 3A47A 3GXTA 3HZ3A 4X0NA 3OLIA 5BRQA 1MXDA 2WPGA 1DBOA 1HWWA 2XN1A 3L4ZA 4WSJA 3L2LA 1UD4A 2XN0A 2X2HA 3LRKA 3WEMA 3WNPA 1KXVA 1NM9A 2V3FA 1CGYA 3BAYA 2J25A 3EDFA 4FNTA 4JFSA 1VBLA 3BH4A 3FW6A 5A6LA 4MB1A 4AVZA 3VMOA 1BN8A 3A23A 4LPCA 1HVXA 1CIUA 1WO2A 1CGXA 1E3XA 1R33A 4YELA 2UVEA 1TQSA 3BUDA 3CGTA 4XN0A 3HJEA 1JIBA 3CZSA 3WY3A 3SUCA 1JL8A 1S46A 3EJUA 5A2BA 1P6WA 2WVVB 5E9AA 4HWVA 3CZEA 1JDAA 1VFUA 1QHOA 2EEXA 5HDRA 2OSWA 3WEOA 5F7UA 4XLHA 1EA9C 3IK2A 4W8QA 4NXSA 4XOTA 1JDCA 3IJ9A 2ZX5A 3IJ7A 3ZSSA 5EMYA 4HPHA 2X85A 1XH0A 3WWGA 1KGXA 1RP9A 4DO6A 1O8JA 2NT9A 4CN4A 2ZE0A 3DX2A 3GXMA 4AYSA 5E6ZA 3CZKA 2X2JA 4J3VA 2ZX6A 3CZNA 4UQAA 4FNSA 3BLPX 2BXYA 1HT6A 2PECA 3HG3A 3B4NA 2NSXA 2ZX9A 2ZXDA 1AQHA 2G3NA 2Y5EA 2YA1A 1J0KA 1CXHA 1UD6A 3WDHA 2VBEA 3II1A 1UKTA 1OGOX 1U30A 4WLCA 3ZT6A 4E2OA 4X9YA 4U33A 2Y24A 1JAEA 1UKQA 1KXQA 3D51A 2ZXBA 1U2YA 2WVUA 4KMQA 1H3GA 1G9HA 1BAGA 3S2CA 1CGTA 1JD9A 1JXJA 4GI6A 1KXTA 2QPUA 4HOZA 2E4TA 2XIIA 3EDEA 2BHZA 1O8EA 3IGUA 2OW7A 1UD5A 1E40A 1OT1A 3A22A 4J3UA 6TAAA 4XR6A 1SMAA 1MFVA 2YOCA 3VSTA 1KWKA 2NZMA 2O0WA 4XONA 2XVLA 3BUIA 2X3HA 2EAEA 3WNKA 2WANA 2NSTA 1KTBA 3OLGA 2XIBA 3BAWA 5E6YA 1IB4A 1NOFA 1OFLA 3VO0A 1BVNP 1CXLA 1RMGA 1JGIA 3TV8A 1ZS2A 3VGEA 2F1BA 1OOCA 3VGHA 4UOQA 1RP8A 7CGTA 2PYGA 1MVYA 1WPCA 2V3DA 2YJQA 4JL2A 1AVAA 4OZZA 1D7FA 3CZLA 4UZUA 2DH2A 2G3MA 2F7OA 3LX9A 3HG2A 5I23A 2Z8GA 4WF7A 3LPPA 4FNPA 3VX1A 1TMQA 1KBBA 2F1AA 4OZYA 3LXAA 2QV4A 1QI4A 3RIKA 1GVIA 2YFOA 3OLEA 2PWFA 1PIFA 5I5RA 1G1YA 4AW7A 4MXNA 3DX3A 2VR5A 4U49A 1ZJAA 5BRPA 1QI3A
chains in the Genus database with same CATH superfamily
3BWAA 3D2UD 1NKOA 3VWJC 2F5AH 3VVVA 4GQ9L 4LCWB 1CYXA 1RSYA 2LLGA 3B1TA 3LKNB 3BCFA 5DJXA 5BMFH 2X4NA 1Z9NA 2Z65C 5J06A 1VZHA 1EHKB 4I0PD 1OHZA 2D4FA 3ZW3A 4JZNB 5LXGH 4HIHB 5DDHA 3ZOAA 4EVNA 2MNUA 1LE9B 1CI5A 4Z0BL 3MRLA 4E41A 1KGUA 2VDKH 4N2FA 5I2IB 5IKCA 1XGQA 4JREC 4PGBB 1EVTC 1JGDA 5E7FA 2XQ0A 4KITB 1VGEL 4IBQA 3DVGB 2Q5BA 5FO2A 2DEWX 1JE6A 3GPSA 2CRYA 4F9LA 5CSGA 1F6AA 1JP5A 3L9RB 3BMVA 4H8WC 1SY6H 2NY6D 4PRDB 1SVCP 1B0GA 3MLTB 4WO4B 5D7IA 2JI2A 4KK6C 5A16B 1T0MA 5E6ID 2FBRA 1A1OA 3K6OA 1ILSA 4YK4C 2ENPA 3D06A 4K94C 2XWXA 1MIEH 1A6ZB 4UNIA 3UX9B 2FHCA 2Z7UA 3FUHA 3GRBA 2CR6A 3RNQA 3EGSA 1WG3A 5AEAA 4TTDD 1HAUA 3D8MA 1MFDL 3AT8A 4XWOD 1P5UB 4LPVA 3EDKA 3VFUB 4R0LA 2EC8A 1BCIA 2BNQA 3W39A 2GBTA 4XVUC 1DL7L 1N4XL 3HAEG 4QOKB 2F3LA 3CFNA 2A9CA 2R2EB 3HS8A 5IMLB 4MNGE 5E00B 3T08A 1O6VA 3NIGE 1BQLL 4XHQA 5D5ME 5DLML 2E9JA 3MUY1 4ZTPL 4KRPC 3WNJA 3UW0A 4XC1H 3UACA 3FSOA 4MXWL 1A64A 2N01B 1WITA 2I9LA 4PREB 4UQCA 3UJJH 3FUJA 4JMXA 3ULVE 5JOPE 3ATEA 1T04B 3FNKA 1BQUA 1NGQH 1FWXA 2CNZA 3MYJA 1YEKL 3ISYA 3QNXB 4GKSA 4NQVA 4FNLL 2IOOA 2Z4TA 4M5YH 3IS0X 5FR3A 2CJSA 1R5IB 5D5MF 1NQBA 3WKQA 3MXWL 2QKIA 2Z31A 4KWUA 2FX8H 3LKRB 1GGBH 5H8DA 4KQ0A 3ULVF 2V7HB 2B3IA 4S11A 4Y8AA 4PW3A 5EBLB 3WS3B 4HOMA 5GIRA 2BW5A 2QVFB 2EDLA 3V9EA 5EIIG 3BP7A 1E7UA 5D6CB 2XN9E 1PJ9A 3D4YA 4NZDA 3EDDA 3B8YA 3DURB 3RDJA 1I8AA 4BK5C 1OGAB 5I0XA 1DE4B 2Y22A 4NX0A 1GYUA 2YRZA 1IGTB 3N0PB 3EYVA 4XAKE 1L9MA 4Y5VC 2R69H 5AVSB 5AQ0A 3UPRA 3Q8AA 3DOIA 1BWMA 4LQ1A 2JTDA 2BMKB 4OY9A 3T3PB 5E08H 2BIMA 2ZOOA 3Q6FA 4HBCH 3SDYL 5MEQB 2O5NA 1QPKA 1JN6B 1IBBA 5FV1L 1JVOA 2CPUA 4J7RA 1BM3H 3T0VA 3LQMA 5FKPB 5TE7H 1UZ8A 3C6LA 4PU2A 1NPJA 1AZVA 3IDXH 3ES6B 5FW8A 1QABA 1YEWA 3NEEA 4L3CB 5EFIA 1CR9H 4GAGH 3C09B 3F6IA 3FN3A 4H8WH 4UT9H 3PPSA 3U7AA 4UAOC 1PLBA 4XNUL 4ZOBA 5FGBA 3DYPA 5C7XH 4R8WL 5T1KD 3VWKB 4CNIA 3Q2VA 4MNGA 1EHNA 3SDXA 2ICCA 5D5MA 3HVDA 3FSVA 2HPTA 4DNLA 4N26A 3TEUA 1WV7T 4D9RD 2YMXL 1ZWIA 4PJXB 2H1LM 4CC4A 1CFVL 2D2OA 1TETL 2IADA 1CT8B 1KYOK 1SJMA 1UXMA 2F18A 4XT1C 5LBGA 1AGCA 5EU7E 2Y1VA 1E9OB 1EO5A 1G6RB 1FYTA 4XN3A 5EOCL 2YD2A 4JDTL 4JM2C 3NP3A 4XXDA 5LCVA 3IU4H 4WZ9A 3NFPB 1TTAA 4Q58C 4YXKL 1O8IA 3BWAB 5HHOD 4DEPB 3QRGH 4CILA 2Q86A 2XN9A 4HMDA 3CFMA 3WIHL 3DMMC 4ZPVA 4GRMB 4E36A 1B4TA 3MX0A 2HMIC 1CFBA 5EULV 4PJBF 1MI5D 3VYOA 2ZICA 1G7JA 3L3IB 5DJXB 4FX5A 1JZ8A 3ULSA 3D25A 5T3ZE 1D5MB 1ZHLA 4QDGA 1PY0A 2TSAA 4P3DA 3GLDA 3AUWB 4L23A 4BSWA 3RY6C 4M6NL 5B1KA 5I1DB 4EVNB 3QQDA 2UZPA 4LEEA 3BH8B 3FMGH 4E41B 1OOWA 5IKCB 2QFPA 5IB3A 1XGQB 1J87A 1QQ1A 4RA0C 5HJBA 3DV4B 3ZQXA 3WSQH 1UB6A 4LEBA 2NNRA 1F6AB 3NCCB 4JFXB 3UO1H 5DR5L 3ESPA 4JR9L 5J12C 1U2CA 1Y07A 3SD5A 1B0GB 4F7MA 1NDTA 2KERA 5I15L 1EXUA 2V2WB 4WU5A 4M8VA 5JXAH 2X10A 1A1OB 1SLXA 4OKVB 4GKLA 4XO5A 1AXTH 5F0JB 5DMYA 1G87A 2NYZA 4FQJH 1JZJA 3B3IA 1OAYH 1YECL 4LNRA 4P5RA 5ESVA 3GHEL 3B7UX 2BVOA 3RNQB 3CMOH 3EGSB 2AKRB 2B2XH 4GNKB 3NSXA 1U3NA 2AQTA 3I2CL 3AM8A 3GJFH 4NO0D 4C55A 5I5JA 3FJTA 3FF8A 4R0LB 3W39B 4EOWH 3GQ8A 2AEQL 1E7VA 4NBYB 5FA3A 1WZLA 1G9ML 1OAQH 4WGWB 4YDZA 3SBRA 4TUKL 4FOMA 1IEAA 3OKNA 3IDYB 1CPUA 3IDJA 5EPMA 4M6OL 1OCRB 3GM8A 4OJEH 4IDJH 1WH0A 3FQXA 4S1DD 4KQ4H 4IOIA 2BM5A 4KDWA 3UJJL 4NQVB 4GKSB 3QDJE 4LQFH 1CXFA 2RAMA 3G5YA 2G2NA 3DWTA 4PG9B 3TZVD 1BZQK 2XWCA 2QKIB 4AJ0A 2Z31B 4YHPA 4PBDA 2R0KL 1LNUA 2CA3A 2YD6A 1KYDA 3O4LD 3DYMA 4FERA 2L7EA 4FJYA 4P46C 5A7BA 3HS0A 5D71L 5E8DH 1SFHA 1C7TA 2UZXA 5K9JL 1R1CA 2DKUA 2PETA 3VG9B 4N0FB 1BPLB 1Z2KA 1JMXA 1G1KA 3BSZL 3C60B 4ZMYA 4G71B 3H4FA 3BSGA 1MCEA 3UO8B 3VSQA 2KH2B 2WIIB 4N0UE 1WP6A 4E5XA 3ILQC 3QR0A 5EF0A 1I1AC 1MHPL 2BXZA 2E8YA 1KFGA 5LQBL 3Q6FB 4HV8A 3H4HA 3AZUA 2WCPA 4N0RA 4PRPD 1WZ1L 5C71A 1JFQL 4PRID 2XYBA 3W9DB 5KTEH 2ZWSA 4XN9A 2XWBA 4PYHA 5E2VH 1ZA6A 3O6KH 3CU1A 1XL4A 4HLZH 1UZ8B 4IGBC 3SE9H 4N2KA 4XCEB 5C0CD 5IUCA 1W6WA 4XPGL 5HDQL 4MCYB 2DD8L 5EFIB 5KJ7E 1CU4L 5J13C 1SXNA 3CHQA 4M03A 4B9JA 2DJMA 4U4BA 3TH0A 4NWUH 3KLLA 2X89D 4ZFQA 1EHXA 3SDCA 3FC8A 3F05A 4PMEA 3ZT7A 4CNIB 5LAXA 1CFTA 4MNGB 3SDXB 3NIGB 3NFSL 1AXIB 4FFYA 5DRNA 1HCFX 1EERB 4G9DA 2H2PD 2HPOA 4ODSH 4OJYA 4C8XA 5AVRB 1ZPLA 5HYJE 4ZUTA 5JPNB 2CJUH 1JNLL 3IDMA 5DQDL 1ZWIB 5BRQA 3OX8B 3RDTA 1UWXK 2DMCA 2IADB 1GY2A 2K6ZA 3EFOB 3FO0H 2HX9A 1N0XH 2YAPA 3T0EC 3CBKB 1DEEA 3QDJA 3M7FB 3BAYA 3C75A 1V8HA 1FZJA 1M6UA 1JXDA 1FYTB 1SN0A 2PP8A 5KS9B 3RKDD 3HE6B 5ECJE 1CL7I 3MROA 3ZUNC 4XXDB 3NIFE 4LDOB 4UT7H 4XMKH 1I7ZA 2H2SD 1JIBA 3SO3C 2YGNA 2QR0A 2Q86B 1B90A 3ELQA 3VFOA 5DD0H 4ZPVB 1P6WA 3BGAA 5IHWA 3RI5K 1U36A 2EEXA 1I3GL 3MX0B 4LAJH 3E8UH 5A2IH 4NJ9L 5JIIA 3KPNA 4HIXL 5DHMC 1G7JB 3V7AE 1KIRA 2XKNA 2GSMB 4N0UA 4JFDD 3NIFF 4PLKD 5DMKB 4KZEH 1QKZH 4HS8L 5LG1A 1XH0A 1GGIL 1ZHLB 1UB5A 2FGWL 2IAMA 2HSIA 4U3XA 5A43C 3ZTEA 4P3DB 4ZOAA 3ROLA 2P5EB 2ZE0A 4EUPH 2GI0A 3QQDB 5JNYA 4KVPA 1Q9OA 5IB3B 1DBJH 3T0DA 5I17B 4KAQH 3S96A 1A6UL 2FLRT 5FW7A 4Y19E 3RGVB 1OCOB 3R18A 2NY1D 5IT2L 5JZ7D 4XOBA 1UB6B 2BIHA 1U30A 1JV5A 1WC7A 3L3GA 2CIIB 3NCBB 1GA2A 3B9KD 1CICD 2ZXBA 4OD2A 3QUHA 3B5GA 4PGEB 2XZCL 5L4IA 1EXUB 1XVSA 2NY4D 2AMUA 3K91A 3PL6C 4JPSA 5DWUL 1JXJA 1RL1A 4HPOL 1CMOA 1Q0XH 3ZKND 2XKSA 1OT1A 2JJVA 2YO3A 5ESVB 5HYJA 5AKSA 2BVOB 3ZTCC 2EAEA 2VO8A 2EE2A 3H9HA 1WLHA 1UVQA 2BH0A 3G5ZA 2JKNA 2DYPB 4QRAA 1OFLA 1IGYA 1I8UA 1KLGA 3FUIA 3RWJA 4KROC 5GGQH 3MRQA 2CKBH 5E2UH 3OMIB 2W60A 1N6VA 2CHDA 3MRIA 5ERWA 5LXVA 1CS6A 1UOLA 1IEAB 3OKNB 4KJPC 4YFDB 3QCVH 5DC0A 5EPMB 1UFGA 1WBXA 5C7ZA 5I6OA 1YEJL 4YWGL 1FL6A 5KBKA 3GHBH 4IOIB 2WYTA 1INEH 2BRRL 4J3OC 1M1XA 2G4EA 1NUGA 3CD4A 3QORA 3G5WA 5E9DD 3G5YB 4K3HA 3SGDH 4LP4A 1JPEA 3WNIA 5AG8A 1QWNA 3CFCH 3RWGA 1LNUB 4HUWA 1GCYA 2VL5A 5GGSY 4GB9A 4DVRL 2ROYA 2O5YH 2DQEL 4PJ6A 2GTWA 3HS0B 1XCQB 1OW0C 2UZXB 4A63A 4BSJA 2J55A 2VZ1A 4Y19A 2DWSA 3GLZA 1KDIA 1NCCL 5TDNA 3FAWA 2AW2A 2R9HD 1MSPA 3ZYJA 2UZIL 4FD0A 2A77L 2YGVA 1RK7A 2YXMA 2DWYA 1RZ7L 2GT9A 3US1A 1AACA 4GQQA 1MAJA 4BH8B 2HVKA 2FX9L 1S7XB 2PMZA 1OT4A 3UMNA 4U0QB 3AQDA 3S34H 4HV8B 4P2QE 2FWOA 1KCDA 1DN2A 1M56B 1Z9PA 4P4KD 4MHHG 1ZA6B 1A7RH 2MFNA 3GDBA 3LS5H 3PUUA 4FJZA 1RSFA 4U1NA 1OZUA 4OM9A 3RFZA 1PX4A 4PV1C 4YSOA 4A6YH 4WU7A 3SKOA 2A73A 1J5DA 1CGVA 1NGZA 5LAXB 1CFTB 4BGDA 5KSBA 3EZJB 1JZ4A 5DRNB 1HH9B 2NUTA 5GGSA 2IH9A 2Z64C 3P9LB 4G9DB 1A7OL 2X05A 4ZUTB 3IDMB 2WTRB 5I1IH 3NN8A 1ICTA 3CLFL 3MV01 3NMEA 3S35L 5ILTL 1BOGA 1TJMA 1DEEB 3QDJB 1E4XL 5EUKB 1DCEA 2ITEA 1M9WA 1DVFD 3ARPA 4QHKI 1WF5A 1YYLL 2XWJA 4QRRD 4YR6A 3NCJL 3MROB 5JOEA 3RIFF 5I6LA 5CHNA 2K7PA 5L9DL 2APXA 3C5SA 1I7ZB 4M7ZB 3MBEC 3V6ZA 4L4VE 3Q5YA 4D3CH 2NQCA 3WLBA 1BREA 2OTWB 4P2AA 3BD4A 2WWNA 4UILL 4HH9A 3X3FL 5JA8B 4RGNC 3KGUA 2J6WA 2IF7A 3CFQA 1G9EA 3KPNB 2MPAH 3QEHA 2XKNB 1NPNA 2OX5A 1JYWA 2XDHA 1AHWC 4TMPA 1UB5B 1E28A 5ID1A 4LAQL 2IAMB 3HNSL 1NAMH 3OKOB 4MS8D 3ROLB 2W1NA 3K80A 1QKZL 1ZK5A 2VDMH 4P2QA 4ZXBC 1U3HA 5JNYB 3W2DL 4XPFH 1D5RA 2UUDK 1Q9OB 1GKEA 3FOMB 1BZ8A 2DI9A 5GS0L 4K71C 4YQXL 5EHFA 1W2KT 4LIQE 3S96B 4JFTA 2O72A 5JDSB 3L5HA 4K23H 1IGCH 4YDIH 1IC4L 3UJTL 4KJYA 2IALA 2UYLB 1JV5B 2BHUA 2IH1B 3L3GB 4JVWA 4B7IA 1L9NA 4G7SB 4D0DA 5I1HL 3FUDA 4AGOA 2XPZA 4KMTL 4BELD 1P7QD 1DFBH 4MGXA 5C0FA 2DMBA 2DB8A 2YPLB 5IGXH 3BAKA 3GBMH 3MGAA 2EDFA 3I6KA 5TQ2L 3N91A 4XPTH 5I71B 1AC0A 5F9OL 4EI5D 2HYMA 4OJ6A 1KCRH 1YCSA 2CSPA 4KOCA 3MZGB 4I0CC 5IROD 2UY6A 5I74C 5JW5B 5TQ0H 4OGAC 4LLDB 4HJSA 1XWVA 5DYFA 5F6HI 5IQMA 1NKRA 4X7TA 1R0AH 1UVQB 1KJ2A 4MCMA 1DSFH 3G5ZB 5DO8A 2OXHA 2YD5A 5ISZA 3P40A 5DZNA 5DVPA 3RWJB 3JWOH 2X0VA 3MRQB 3NIDE 2NDGA 4S1RL 2W60B 4CJ1A 4C2LA 1H3VA 5ERWB 4OCYH 1OLZA 4Z06A 3BZEA 3NIFB 3Q9PA 5C1CA 2G75A 3L1GA 3N41F 2ZF9A 4NQEE 4YSQA 2R29H 2K8MA 5DD3L 2NUPA 4JLRA 1WBXB 4PTTB 1NJ9B 4RMBA 2YAHA 5MEOA 1FL6B 3VGDA 5L8JB 4WK2B 3NIDF 1B0RA 3ECBA 4GRWE 4R7DA 1UA7A 2E6JA 5F1OB 1M1XB 4WFEE 4XBGA 5KJRH 3EO0A 3KYMB 3C8KA 4X2UA 3IJEB 1HAWA 4AMKH 3GINA 5FM4A 1KT2B 3I9GL 4L1TA 1EFXD 3ZX1A 4DIXA 1DABA 1ROCA 5IQOA 5GZOD 1OB0A 2DWTA 3RWGB 4FFWC 1WYJA 4UM9D 1NLBH 2VL5B 4P23B 5HI4D 4OJCA 4GRWF 4NFBA 2GTWB 1NBYA 1S9YA 3FU8A 1Y18A 1IKFH 4Y19B 1SBSH 5CN2A 3KNBB 3PF2A 3NSJA 5TDNB 5E1HB 4QXWA 4XODA 4ODTL 5HHMD 2QHLA 1VSCA 5FYKU 3QUXC 1NCTA 1OAKL 2GT9B 2WNKA 5TF1L 4JKPL 2QSVA 2VMDA 2R8SL 3EJJX 2XC1A 2MOGA 1LGVA 1ZJBA 3AQXA 3OAZH 3VFWA 2AK4E 1TF4A 5F6IB 4WSKA 3DHUA 5DD5H 3TXAA 2FWOB 1DQKA 3OAUL 4MMZC 4HXBL 4NRZA 4PB0H 1AQDA 1VHPA 1CLOL 3MOBL 5GXBB 1U3YA 2ARJQ 1CQYA 3L5XL 2C3XA 1XGUA 4Q9CA 1MREH 4LARL 4OJFL 3SKOB 3SQBA 4HF5L 1LD9A 2DM7A 4CBPA 2BPBA 5E0QA 5KSBB 3Q2WA 4RMTA 1KC5H 1SPDA 4NQEA 1F3DJ 3TT3L 2NUTB 2CMRL 2ZONA 2H9GB 4L9LA 4X99B 1VLXA 3ZKXC 4ELME 3CVIH 3MOAL 4V2BA 5MEND 3TA3A 3NGBC 3PWNA 3C9NA 4WNQA 2ZXCA 2B4CH 3NN8B 3LNDA 4XB8A 3D30A 3FHQA 3R19A 1E4JA 1BOGB 3FN0L 1CI3M 3OWRA 1G94A 1LK3H 2GG1A 3MRHA 3VXUD 2DWXA 3A4AA 5D1QC 4AQEA 2ITCA 4GIPD 4OSUL 4JK0D 4ELMF 2XWJB 3UC0H 1AAJA 2R83A 4YO0B 1A9VA 4OD1H 5CHNB 5EZIL 1OF2A 5FWRA 1V10A 2ROXA 2W94A 3C5SB 5FGRA 4ZFGL 5BV7C 4F9PA 5IIEA 3AS0A 3FT0A 4NLHA 4JGMA 3UBGA 4LFHD 3MUGA 4P9MH 4HH9B 5IBTL 3LQZA 1QASA 2VTFA 4C57C 1X9RA 3AWFA 4QGYA 3QEHB 3LB6C 1DBBH 1AIFA 1NBVH 4A38A 3CFDA 3GRWH 3T6VA 2AK4A 2A6KA 1SEQH 3GF8A 1DJSA 5FHBL 5KVDL 3UG3A 3TEYA 2C9PA 3E6HA 1DEDA 3QJVB 1XGPA 5DT1L 4Y16A 3GJEA 1FJ1A 3GB7A 5FYJL 1OO2A 4KJYB 2IALB 5D4JA 3RVTD 4GXVL 3K4AA 4ZAKB 2B0SL 2VABA 4D0DB 4X8GA 2AHIA 1NL0H 2EYSA 4LCWD 3DX6A 5DJZB 3OPUA 3SYJA 4HUXA 4NWTL 4FGMA 3R8QA 2VLKE 4QMEA 5C0FB 3O6MH 5KYWA 1XF4A 3CXHK 3AABA 3I6KB 1HJBC 1YEDA 4GI9A 3BZ5A 4BEIA 4ELMA 1IDKA 3BUQA 5E1AA 4I0PC 4NIKB 2UY6B 3TGXA 5JIDA 3RWIB 1IC1A 1OK0A 1RPQA 2CALA 2BSTA 1GMIA 5L2KA 4DHLA 1KJ2B 2N59A 4NRXA 5CINL 3VU2A 3JV5A 5I66A 1G6RL 2OXHB 3X12A 5ISZB 2YZ8A 1JRHH 4JQIH 5FLUA 1BYNA 4JPKL 3WTWA 4QRFA 5KVEH 3HBPA 4X42A 3ZLQC 4D8OA 1M6OA 2ZCLL 3N6YA 2G75B 3L9YA 1HWWA 4XMXA 3GMMA 2OFQA 1L6XA 2NY6C 4WO4D 4WSJA 4F33A 1UD4A 2ED6A 1MWAA 4JLRB 4POZD 4PWEA 4O2FA 4KC3B 4ODHH 4ZUUA 5E6IC 2ATKA 2QGDA 1B0RB 3ECBB 4MB1A 5CMAA 5BO1L 2DN7A 4XBGB 1P1ZA 5L6YH 3C8KB 4X8JA 1QPXA 1CLZH 1HF2A 3PSZA 3QXUA 3SOBL 4NZUH 1WFTA 4WHYG 2SEBB 2ZCKL 1A3LH 5H2BA 4H1LA 3O8XC 1IGJA 2E6QA 3FYEB 2VRAA 1JDAA 4NYLA 4G5ZH 4TTDC 4XWOC 1NBYB 1S9YB 4G8FB 1QTYT 1Y18B 5BV7H 2AJZA 4BGLA 1OPGL 1ORQB 3V0WL 4U0RC 1C8PA 3MLWL 5D1XE 2OKMA 1TU2A 1QFWH 4DO6A 1M05A 2JKWA 4HZLA 4QRPE 1FUNA 3QUZC 1ZSHA 4J3VA 4QXUH 5C08A 4D7BA 5HYQA 2PECA 4XZUA 2VLKA 3O45A 3B4NA 3S8GB 1UWEL 3VFWB 3LEVL 1PG7L 1OGOX 1XHHA 2E9GA 2O5XL 4L3EE 4NRZB 1J5OH 1A66A 1BJ1J 2VDRL 1AQDB 5CZVL 3MLZH 4XP6L 4BE6A 2KUTA 5E4EC 1S7VB 1G9HA 3TS8A 3DO4A 2J1KA 1K8IB 4N2IA 5C0AA 4ONHA 1U41A 2XFXA 3Q8EA 3IGUA 3LQAC 4G6FB 1F4WL 3REVA 3SQBB 5LHDA 2FLBT 1IFRA 3K1KC 3GGWA 5ESAB 5G2NA 2F54E 1OGAD 2JF1A 3BI9X 2W9EH 4PI2A 5FUZH 4IIQA 4JY6A 2K6WA 4NQEB 4NNPH 3V2AR 5D8JL 3OKLB 5JR1H 1VFBA 1MCFA 1JNNH 3DHJA 1DQJA 2B7DT 4RRPA 3TA3B 3MBWB 4WNQB 4DK6A 4BFGA 1WBYA 1JNJA 1G7MA 1W6LA 3HRZA 1IAIL 3MOQA 3CVIL 3PP3K 4Y4HC 1BFVH 4UOQA 4JO1L 3MRHB 5T1DH 4QRBA 1MHEA 1NMAL 5EG6C 1EAQA 5KAQF 5I0WA 1I9IL 4KKNA 4RWYL 4WENB 1II4E 3HI5H 3FULA 4OIIL 2Q3XA 4X5WA 2WBXA 4OGQC 5IHZB 4FE9A 1XZ0A 5IIEB 3LXAA 12E8L 2ADIA 1I85A 3VWKD 4N9OB 3TA4D 2YS4A 3MUGB 4N8VA 2WLLA 3HR6A 5HYFA 5D1XA 3GWJA 4X98A 1RLBA 2H3NA 3QZOA 4J3WA 5AZ2H 3BAJA 3CX2A 4QRPA 4Z3HA 4MMXC 1OM9A 3OGOE 2D3JA 1M2OA 5F1NA 4X5PA 1AGFA 3GTTA 4MNHB 1RUQL 4FA7B 1AIFB 2WINA 5LGJA 5CXPA 5LDUA 3CFDB 3IU3A 4M1GL 1XBDA 3VU1A 5LKNA 1JSYA 1EWHA 3ARGB 2ZKWA 3W5NA 2A6KB 4OZ4A 1CXEA 4XE5B 1IBGH 4QHMB 3CFBA 4L3EA 3QPKA 5DUBA 1UUNA 4P5TB 1SF3A 1JGEA 4Y16B 3GJEB 2EINB 5HVHC 1CDCA 3T2OA 1FJ1B 1UM4L 2F7QA 4LLQA 4NXKA 3GB7B 5EF3A 4Q9RL 2GJPA 1IEHA 3APDA 3BPNB 4F2FA 3DX1A 1J1PH 1HHHA 4ZODA 1FL3A 2VABB 3MRKB 4WTZG 5DS1A 3QR1A 2EYSB 5DJ0A 3TBBA 1S7TA 3NCYS 5PAZA 3LNEA 2PO6A 2F54A 4TUOB 2DQIH 3I6GA 3VSUA 1EJ6A 3KLQA 5B3JE 2DPKA 1ZXQA 2DLHA 1ET5A 1YEDB 1YNTB 3OJVC 5E1AB 3K0WA 3R0NA 4HKJA 4XP4H 5HXMA 1S6NA 3LKPB 4XLEA 1N0LA 5KVGL 5L2KB 4E41D 3PXJA 4NRXB 1U8PA 1TFHA 5B3JF 4I9WD 3X12B 1YA5A 2EABA 1L0YA 4J3XA 2WQRA 5T1LB 1CTMA 4TM9A 1LO2L 1IC7H 4HUVA 1BF2A 5IJBC 2R0ZL 4CMMA 2F08A 4ERSL 2VBMA 1H5BA 3D52A 1P9MC 2EDNA 5JHLA 1IT9H 4BXSV 1MWAB 2Z0BA 4O2FB 4Z3JA 3I02A 3OSVA 5GGUB 2ATKB 3ZE2E 1WD8A 1W72A 2CKNA 3BT0A 5CMAB 3SHSA 1KBGL 3QAZC 2LE9A 4Y5XA 2DLEA 3P2TA 2AEIT 4X50A 4X8JB 1DQMH 3E8VA 4NN7C 5FECA 1HK6A 2BM3A 4NM4L 2F7PA 5B1JC 2VITA 3D50A 5H2BB 2CBPA 4MWFA 1IGJB 4NYLB 1IFGA 4BWUA 3DRTB 1NCUA 2E47A 2YD0A 2YR3A 1MAMH 4AL8L 2Y6SD 5DTFA 3T1FB 4L8BB 3UYRL 2N0KA 1U58B 2B9AA 5AOLA 1R3IL 1NC4B 4MCNA 3NPSB 2NY7H 1X0CA 3U9WA 3BRDA 4D9QE 4ZI8A 1KCSH 1AJ7L 1TU2B 5AVZB 2WZ0A 1RUKL 5F1KC 4XMZA 2JSFA 5T5FL 3SCMC 1QFUH 4HZLB 1BD2A 3L16A 3RU8L 4JO8A 4J8RA 5C08B 3BDYL 1SHXA 1NSNL 3MRGA 1PGRB 3AGWA 2QTVA 3OKKA 5D96B 2DJ4A 2C5DC 2AABH 3O45B 4KK5C 4JPVH 5D2NE 3S36L 4QWWD 3MA9L 2VIRA 5IHHA 1G4RA 1ZTMA 2DI7A 4WW2A 4MNQE 2PKDA 4DO4A 2YK1H 1MG2C 2Z31D 8FABB 4XO8A 4XI5C 5FO8A 4IRJC 3TZVC 4LRNH 4HAFA 1OGSA 4XXCA 7PCYA 3OD3A 1N12A 2WLMA 2OSXA 3PAVA 4PJ5B 5ICYB 5C0AB 1RZGA 1QHPA 3AQZA 4ONHB 4Y4FA 5TTRA 1KN2H 2VC2B 4JCLA 5AVUB 5B7MA 1KPVA 3QRFM 1TQVA 1KCVL 4ODWB 4HKXA 3LZFH 5FKAB 3REVB 3L7FB 4KVCH 2AXWA 1PSKH 3GGWB 3BUBA 3EH1A 3T0WA 2RA1A 4JKWA 5I1GH 3BSHA 1JK9A 2X40A 4IIQB 4JY6B 2DQUH 3NSFA 1UWYA 4PQXA 5PCYA 1NCGA 4XMYA 2J6EA 3AU0A 1VFBB 3BGFC 3SPJA 1AH1A 1DQJB 3P0YL 1WBYB 3ETBF 1G7MB 4I89A 4H0IA 4AJVA 5EU6E 4DKFL 2VQ1A 1BMZA 1VKXA 4MB3A 3C6LD 4N2GA 1MHEB 3KMDA 4K5PA 4OM1L 4XB7A 4XN8A 5GRVL 2VQTA 2Q8AL 1GC1L 1VJSA 4UWQB 4EI6B 2IVFC 4OGYL 5GQBA 1NMBH 4X5WB 3UTZA 3GUTA 1XZ0B 2NXZC 3AG4B 4QYOA 3BPOB 4U1JA 2ADIB 2I27N 4PJ9A 4N8VB 3E1ZA 2WLLB 4X98B 1AZUA 4JFPA 3F7QA 5DC2A 4ZMQA 3O2DH 2BWIA 5K1NA 4FXGB 5EOTA 2O6DA 3SBWA 3MLXL 3MNWB 4JRWA 5F1NB 3FT4B 1AGFB 3ULVD 4N2HA 1TQBB 2WINB 5JOPD 5LGJB 3CC5A 3L3OC 4CSTA 1B4LA 5D2NA 5J4MA 2NX5B 2VWEE 2XTJB 4IKJA 4F7EB 4XXWA 4IOSA 2O0VA 1RZFL 4HUMB 3SGKA 1PQZA 4MNQA 3CFBB 2X6AA 4L3EB 1FYTD 2CHWA 3CHPA 1YN7B 2IFGA 4GO8A 5DUBB 5EBWA 3SPHA 4F8NA 4DPCX 1SM3L 1BZOA 3TBVB 4LLQB 2BNUA 3JZ7A 1QR1A 1V3LA 3ZPDA 3RKDC 2QSQA 2XVGA 1S9VA 1T7ZA 2PR4H 5DRXA 1OP4A 3MLSH 2ITDA 1FL3B 5GGVY 5IWLC 4PJDF 3ZDZB 5DJ0B 3JVGC 1FC1A 2PO6B 4FQHB 1A14H 4HJJL 4NZRL 1KTLB 5TK4A 5HYIA 4GEIA 3I6GB 3T1WA 4OQTA 3EO9L 2HA1A 4XAKD 5E5LA 3M8OL 4W6XB 4PLKC 3F12A 1UTDA 2A9MH 2MSPA 5CIPA 3F00A 1DFXA 4MJIE 4RH4A 4HKJB 2D0GA 1ZTXH 3B2UC 2Q8BH 1X5ZA 4ZMPA 1L9TA 4ZMWA 5EU6A 4PJHA 4UYPA 3MV9A 1A6VL 1E4WL 1P6AB 4P2OA 3ARRA 1U8PB 5D70L 3FT3A 3H53A 4HJEA 2ADFH 2BSPA 2UZYA 2C1PA 3P54A 3U82B 4NZJA 5E8OB 1IAMA 1FPTL 3FPYA 2NY1C 3WFZA 5BS0B 4OCXL 5GJSH 3ZL4L 4HUVB 3UL4A 1INQA 4OUUB 1RUMH 3U0TA 5FO7B 1DZBA 4CMMB 4MBRA 3QJSB 4WWNA 3B9KC 1XCTA 2X6MA 4OIBA 5CGTA 2DIAA 4FYQA 5GGTL 5SX5K 3H42H 1AIRA 3I02B 5DZLA 1A7QL 3IJYA 1DVYA 1L6ZA 3WEAA 1W72B 1I1CA 2MNJB 3ZKNC 3DJRA 4Y5XB 3IN2A 3JURA 3IPBA 3WFBH 7FABH 3IF1A 4LCCC 1U8QB 5FECB 4UDUB 4ACTA 3DECA 5I75B 4I7ZC 4D9LL 1AS8A 2J73A 4MWFB 2DYPD 4FQLH 1DQML 4PEEA 1IJNA 4R7LA 2FATL 4UMGA 4H20H 2YBGA 4X7CC 3L81A 4W4OA 1UXWA 3IGFA 1FLRH 1CD9B 1PL3A 1EUTA 1CE6A 1EQWA 3U0PA 2JH2A 1DR9A 3AUVA 4L18A 2C26A 4ZMXA 2XQBL 1BX2A 1BD2B 1EJFA 4J8RB 4I1NB 5A3ID 4ZJ9A 5AW5B 5J57B 4F8OA 2FBJH 1KPRB 1X5MA 2C34A 3RVUC 2XWTA 3TT1H 1MF2H 3M7OA 1HJCA 2HX8A 4PD4J 1XDTT 2ZSVA 4PY8J 3EDJA 3WFHA 4IIZA 1VZIA 2VIRB 2H0PA 4WW2B 4MJIA 4NERA 3LHPL 4ATTA 3CN4A 4DKAA 4FA6A 4LLUB 5CBAA 3WJLA 1L7IH 3D33A 2DWDB 3HZMA 2DAVA 4YHYC 1GYWA 3ARDA 3MRPB 3L4TA 3WNOA 4Y4FB 2EVFA 4XAWH 1QSEA 2OAAA 4F1SA 1KPVB 3WIAA 5C9KA 1PCXA 3NBNA 2O93L 5LGKA 3O6FA 1LO4L 1D7DA 4YHKH 3O2WH 1X5AA 5CEYB 1HL5A 2R1YA 3SPCA 4UT6L 4AWJC 1RU9L 3OHXC 3F7LA 4DQAA 2OR9H 2OBGA 3LRMA 2OZ4H 4ELDA 4QRSB 4PP1D 5GRVK 1EIBA 1EVUA 3ZE2B 1AHMA 5DZVA 1N6QL 4IU3A 5KANI 3V4PB 2WXGA 3K5RA 1Z5YD 1A1NA 5T1MA 2VQ1B 2WPGA 1B9ZA 4BZ2H 3EFDH 5J5EA 1VKXB 3PETA 2W07A 2G5RA 3WEMA 2CBOA 4TUUA 3WGUB 5E5UB 2J25A 3RVWC 3G04A 4G7QB 2NY3B 3K72B 4JRXE 4LKCB 3WS6C 4B97A 3VDCA 5K59E 3GUTB 2XG4A 4XVSL 4QYOB 3QA3B 1Q9KA 1DVZA 5FF6A 1R33A 4M1DH 4PJ9B 4R9HA 1P4IH 3K6IA 4AUYA 5MERA 3CZSA 3IMTA 3IFNL 3U25A 1SY6A 6FABH 3S5LA 2DWEA 1NWOA 3QIUB 1FNGA 4N9GB 2RCSH 4WEMB 2X2UA 3RDTD 5B1CA 3CC5B 1GHFL 4L8SA 3LV3A 1L5GA 3HBGA 3ZSSA 1MQKL 1E6OH 1A25A 3QDJD 3ROOA 4OCWH 4DVBA 1PQZB 4FDWA 4AYSA 4HZAA 2Z93A 3MACL 1DVFC 1OTSC 1QSZA 4I48B 5E94A 2BNUB 4LHQB 1QR1B 1LE5A 1FNAA 1X7TA 5DRXB 3ALXA 1BDYA 4JZJC 2XPYA 4RX4A 4ZD3H 1UD6A 2A6JA 3N85L 2XU9A 4PFEA 2VXTL 3UXFA 4XN1A 3QUMB 4NUMA 2YRPA 1WT5C 1R5WA 1F2QA 3OB8A 4PYGA 3ECWA 1FQ9C 4OF8A 1NCDL 1KN4H 5F3BA 4AZ8B 2DLFL 2IV8A 2MRYA 4E9VA 3MUJA 5KBNC 2WTPA 3F12B 5AW1B 5CIPB 2IAMD 5DJCA 3QJOA 1A6WH 3UZVB 5BXFA 4NO2A 5FX3A 3LZNA 4GLRI 1O5DT 5C3LD 5DHXB 5EU6B 2HG5A 4PJHB 4N8CH 3MV9B 3CH8A 1E2ZA 1FO0L 2A1WL 4P2OB 3TBCA 4ZUSA 2WANA 3GMNA 1I7TA 1ZLWK 5GGRY 2UZYB 2C1PB 3LIZA 2NYYD 3P77B 3BQUB 1XF5B 3CFUA 4JRXA 1D5XA 3AREB 1INQB 1ZEAL 3RNKA 3BE1L 3ZTJH 1XCTB 1HEJC 3U30B 1OSZA 2BZCA 1FLTX 4WFHD 1OAZL 1Q0EA 5CJXC 1MVYA 1WPCA 2Q76A 3IJYB 4WV1C 5DZ9A 2DMGA 2DH2A 4NEHB 1B4JL 1SLUA 4WF7A 1A5FH 4EI5C 3IF1B 3R1GL 2C4FT 5IROC 4A39A 4YHIA 2CPCA 3LN5A 2YD7A 1BFOA 1AYOA 2VZOA 1SQMA 5CKGA 3ZSTA 3MRRA 4E0RA 2I07A 5CILL 4PSRA 2QMJA 3CXFA 3OZ9H 2G5BA 5KVFE 3VMPA 3ZQWA 2A6IA 2BVUA 1I9RH 2VXQA 3DHPA 2ESVB 1BX2B 3HZKA 4OZFH 1FCCA 3WXVH 4OLXH 2OYKA 5JIPA 3U4BH 1LXMA 4HWNA 1KNOA 2A2QT 2YEVB 1REIA 3IFLL 2Q3ZA 1MCRA 3VI4E 3WFHB 3LPOA 4CVWA 1FIGL 4NPYA 4GMTL 4MJIB 4HFUL 1I1FA 4OJDH 3I75B 3S3DB 1AE6L 3UCQA 4HKBA 2QXZA 3PV6A 2WNXA 5ICUA 3ZTNH 4JHUA 2OJZH 4P23D 1F0LA 3ARDB 4URTB 5FK9A 5GZOC 1Y6NR 2X44D 3VI4F 3RQ3A 5HI4C 1QSEB 4LLAA 2WVVA 3A5VA 4N3UA 5KOVC 4Y19D 5D7KD 2GFBA 1BXXA 1IAIM 3DPBA 5CEZE 4MMYA 4Y1TA 4BH7A 3MV8B 3O6FB 1KOAA 3HS9A 3N40P 3N1GC 2H26B 2UUDH 2WP3T 5DJAA 4KO5A 1AFVL 3KH3A 2WWMD 2FAUA 1OEZW 2R1YB 3G08A 4A67A 2DQHL 5E1GA 3NRFA 4GUPB 3GXNA 4RFNC 5IBUB 4I18A 3WTVA 2X4SA 4C58B 3JUYA 2WUBL 1HNFA 4C4UA 4POYA 4PGZA 4M9PA 4IU3B 4FYRA 1XH3B 2GABA 2Q7AA 3IFPA 1SHMA 2QFRA 1G9NL 3HBZA 3QZMA 4QXGL 5T1MB 1URLA 1DJHA 3N42B 1S4IA 1P4UA 2NT0A 4XCNA 2W07B 4WWID 1HS6A 2BP0B 4YHOH 4DESA 2E86A 3K7UA 3KPQA 4WTXA 1IQWH 4HGMA 4GQZA 3G04B 2H6PA 5E24E 4XE0A 1HTYA 5H37H 2C8NA 1Z0NA 4CKQA 4XB3A 4ZO9A 2GHWB 3OPZL 2GKIA 2XQYA 2MCG1 5FF6B 5DSCA 5BUAA 2X1XR 5MERB 5DS2A 5C2UB 1RIVH 4UBDC 4M7LT 3S5LB 4JM2F 1RMFL 2DWEB 3O2VL 1JZ3A 1B3IA 3HLKA 5MI0C 4BUHA 1KCUL 3F7RA 2D7TH 4XTRC 4JVPA 4N20A 4U1HA 1ZLSH 4CN1A 3GQ7A 3LV3B 4RMUA 5E95B 1O6SB 3MFGB 1N2RB 2ZUXA 5HDOA 1LQSR 1L5GB 1EHAA 3M17A 4FQIH 5I8EA 1KIQA 1J1XL 1KY6A 2HKHL 3BFWA 2P8LA 2Z93B 1RZKC 3DHMA 1RULH 5GS0C 5I1JL 1I8IA 1WWAX 1X5KA 4YNYA 5E94B 4M3JA 3DJSA 3PY9A 4Q56A 1XGRA 4IM8A 2A6JB 1I8LA 4MAUL 5GSVB 4N0CC 3DO7A 4N8VG 4JE0A 1QYGH 3GSNA 1IBZA 2VZ3A 4G6JL 5J56B 5F3BB 4LOUD 5C0BE 5EDSA 2V8MA 4UNTA 3N04A 3OKMA 1FC2D 5DJCB 3U36B 2DQJL 2QELA 2R27A 5BXFB 2QQLH 4K7PX 1DVQA 1ZANH 2H6UA 4P2QD 2YQBA 5JO5B 1ML0A 1BEXA 1ND0A 1L9OA 1JPFB 4IHOB 4YJZL 2HFTA 4ZUSB 4BBWA 4KPHL 3GMNB 4A7GF 1I7TB 2JQAA 1RV6X 4ZMLA 2XI9A 4H8PA 3U79A 4XCCH 1I8MB 4N4YB 4JM2A 2JE8A 1E6JL 1N3NA 4JRXB 4ZAKD 3EBIA 1D5XB 2NSMA 1GIGL 4EDWL 2B77A 4HC1L 4TQEL 3U4EA 1U8MB 1PIGA 1Q90A 4CADA 1OSZB 1G7QA 3KGRA 3TTSA 3NT0A 3KE0A 1D6VL 2YIHA 2G3ZA 3EAKA 3CLEH 1CGSH 3ZIYA 1CIDA 1MFCH 4EI0A 5C97A 5KJ4A 1WZAA 4PWKA 3CK0H 2XIDA 3IKCB 3IS1X 3MLYL 1E4KC 3LN5B 2EH7L 1WGOA 3QCTL 1BFOB 2VRKA 4HJGA 2DOCA 5ISZD 3KLHD 4AI7A 3KLAA 4HSQA 3MRRB 4E0RB 2I07B 1NGXA 2VH5L 4JFOB 4YMPA 2X0WA 3F8UB 2HLFD 2G5BB 1GS6X 4L2YA 2AF2A 1GPOH 2RFXA 3GXIA 5CJQL 3KPOA 3T8XA 1KMGA 4AH2B 4BM7A 2VBKA 4FRWA 4TVUA 2FYYA 3HZKB 1YEFL 4WO4C 3QDME 3S88H 4F92B 2VN5A 2AGJL 3ZZSA 4KXZI 2R7EA 2IDTA 1X5LA 1WS8A 3U4BL 5C0BA 2APBA 4NPYB 3A67H 4BQ6A 3BC9A 1I1FB 1AR2A 1RZKH 4HKBB 1T89C 1HL9A 3KEDA 3QCUH 1PLGL 4IDLA 1YPZE 4JKMA 5BRZA 3U9UA 1YMHB 2OMYA 1P5UC 3MLUH 4NBZB 3OZLA 5IUSA 5B38G 1UUSA 5T3XE 4QR7A 4MMYB 5D7LE 4BH7B 1SRDA 4ZX3A 3CG8A 2X1WL 2NZ1A 5DJAB 1HHJA 1DBGA 3BKMH 4HK3J 1FYHB 1PS3A 3G08B 4K5LA 5F21B 1LWHA 4KRPB 1YPZF 3H1ZA 3KM1A 2Y2WA 4ZMZA 1RU4A 1FBIH 5JW4R 1BBJA 1U93A 4I18B 2OMWA 1GR7A 1YSOA 2OSLB 4KKZA 5ANME 1B88A 4L4TE 5HTSA 2CRZA 4FJ6A 2VE6A 2AV7A 3PREA 3GSUA 1LWRA 3QC5X 1OCCB 1T1ZA 3T0EE 2V7NA 4L0YA 2DQGH 4OFIA 5CZRA 2WSPA 1BFTA 3FU3A 3ZN6A 2CCVA 3CZFB 5AB1A 3CN0A 1IM9A 3PXLA 4P46A 1AKJA 3BKYH 4AZUA 5I82A 3QFDA 4YC2B 3SE8H 4LL4A 1C12A 4NZFA 4G6FD 2H1PH 1AGBB 1ET7A 3V0JA 5CD5D 3WY2A 4Z78A 3HJ0A 1P1VA 3UTSE 2P42B 1ACCA 3HMXH 1XXFC 4NQED 5TD4A 1R75A 3TEWA 3VX0A 3QDMA 3FUKA 2F2HA 4LDEB 1URZA 1J48A 5HHPB 1I1AA 2J4WL 3TA3D 1SJHB 3QUYB 1LL1A 2VDOB 4U1HB 3P30H 5ADOH 4WFED 1EA0A 1YC8A 2W65A 1Y1UA 2LOEA 1IGMH 4IKLA 1Z3GL 4KO9A 2MQCA 1MY5A 5F7EH 5I8EB 5DMJB 3UERA 2DTSA 1CE1L 2CO3A 3EYUH 4K7PL 4MJ6B 1XH2A 4BKLB 1I8IB 1D5IH 1YPZA 4XVTH 1Q4NX 4B9GA 4UQDA 3C09C 1XGRB 1PAZA 5F8RC 4HU8A 2CKBA 1JZFA 2E7DA 4IU2B 5D7LA 3VWKC 3DV6B 3DO7B 3DI3B 1U8IA 3GSNB 2VXSH 1MHHA 3EYOA 3LH9A 2VR9A 1AXSB 2LLLA 5AKRA 4CSZA 4K5MA 4EXKA 3GRGA 3EOAB 4P3CL 5DHEA 5ANMA 1A8JH 4J8QA 3R4DA 4L4TA 3V0GA 2GITA 1M9SA 3ARGD 4H26A 4JFQB 1J0IA 1BQHG 3T0EA 1KJ3L 2TRHA 1ND0B 3V0AC 2I24N 2ERJB 1KXQE 1RZPA 4P5TD 5I1KH 4Y16D 3DVFA 1H9DA 4N5ED 5CLZA 5KWYC 4JRAC 1AR1C 4P8QA 5TFSL 3KGSA 4AGPA 3NJJA 1TJIL 3W56A 2GC4C 1FGNH 2NNXA 3MRMA 3ILPB 4DEPC 1K9TA 3HPJA 3GXTA 5ACMA 3UTPD 4NUJB 1PDKA 1FORL 3UTSA 4CADB 2WUCH 1QACA 2ZOTA 3FS9A 1T7YA 1G7QB 2WYIA 3HG0A 5E8PB 2HJFA 3S37X 2DRUA 3GFUA 4JUSA 1G7PA 1KGCE 1NLDL 3CBRA 3FRPA 4A2EA 4F5CE 1NICA 2VDLL 3HFML 2ATPB 4N25A 1LO3L 2ZPKH 1KPUA 1E27B 3R06B 2F19H 3U6RA 5L2KD 3CFJA 4YELA 2DKSA 3GSXB 4KXAA 4GUQA 4HJGB 4J3OF 3EGXA 4CW1A 1JL8A 3KLAB 1IEBA 1XO8A 4XC3L 3PP3H 2Z7ZA 3FONA 5ADPH 1LEKA 4NO3A 2D8KA 1F56A 1V7ML 3HE7B 4J3BA 2RFXB 3QJQB 3T8XB 3KPOB 4G70B 2R1WA 4OFDA 4KHTH 2EDXA 2X85A 3WWGA 2KC0A 1RZ8A 5IVXB 1F6LL 1HIMH 1BXVA 3PL6A 4KRNA 4PGDA 2J5LB 4PRBA 5E6ZA 4BFKA 4D0BB 4DOHE 1T7XA 4GMSH 2RH0A 5C0BB 2HTLC 4Z7QE 5IF0A 3QPQD 4PHXA 1CURA 3KJ6L 4LSRL 5L7XL 1CXHA 1NDGA 4YXHL 5AG9A 1PY4A 3A67L 1FNHA 3DX8B 1Q0YL 4EIZC 3U9UB 5BRZB 2Y24A 3WIIL 3QB7C 4GW4B 2OMYB 4KBPA 4OCRL 1KXQA 3NEXA 2V9TA 2HVBA 4JZOB 1KB5L 2WVUA 3TASA 1BVLA 4HSAC 4R0LC 2EC9U 5LO7A 1BAGA 2EILB 3DGDA 4M7LL 5B39G 2EDDA 1NEZA 4TN9A 2XBDA 2XTWA 4WUKL 4CDHA 2D03H 2VSMB 4GH7B 2WLKA 4JJHA 3IDYC 4LSSL 4M3KB 5C08D 3LEYL 1KG0A 1BBJB 1U93B 1OAJA 2VLKD 2OMWB 4GXUM 3MBXH 2IFFH 3S3JA 1OQOA 3G6JE 2VE6B 4F5CA 4EN2A 3MA7A 1OVZA 2ZSWA 2V7NB 3KCWA 4HEPG 4E9SA 2VKWA 5JIQA 3VXNA 4P59H 4NP9A 1NAMA 2QKIC 1FDLL 2Z31C 4AM0A 4PJ5D 2XTXA 1FRGH 5C0AD 2NY5H 2R2HB 1EEYA 1QZNA 3G6JF 4CKVX 1OW0A 3MDJA 4K4KA 2WP3O 1C12B 3CNKA 3G6AA 4UZUA 1OD7A 2G3MA 5DI8A 2WW8A 2O4EA 3FCGA 3VG9C 4Z78B 1F3RB 1FGVL 4L4JA 5JUEL 1AGEB 3PDGA 3TVMA 4RGNE 3GMRA 2H1PL 4F27A 3C60C 1QI4A 3DX3A 4F7PA 4U49A 3QDMB 1HL4A 5C0JA 1QI3A 5IBUG 3NP4A 3CUPA 2VLRB 1BVOA 1YJDH 4M43H 3OHMB 5KSAB 1A7PL 5KVMC 2NZ9D 3I50L 3MCKA 1UXLA 1UA6H 1NCOA 2K45A 2K1MA 3JZYA 3P30L 5ETUA 4KK8D 1HHGA 4FCHA 3GS7A 4NT6B 5E4IA 4FS0A 1ILUA 1MELA 3CPLA 3BEWA 3D4CA 4P2RE 5HGGS 1NGPH 2Z1PA 3V4UH 1EHLH 5CFAA 1VPOH 3MGOB 1KFAL 3BKCH 4ZUWA 4LSVH 1A3RL 2MQ0A 4MCZA 1G7IB 2BZ7A 3BHBA 3E6FA 3JTTA 1HESA 5ES4B 1MHHB 2P49B 2R29A 2EXYC 3CX5J 3EYOB 3HC2A 2VERA 1JERA 3H3PH 5I30L 1WFJA 4OPWA 1UM6L 4YVUA 3V4PL 4CC4C 2NX5D 2XTJD 3G6JA 3QW9A 4Z05A 1TDQA 4H26B 3K4ZA 3VJ6A 3MLRL 3D1MC 4NUQA 5LBSA 1JHKH 3T0EB 4L3ED 5HGBA 4W9JC 1EJ8A 3N43B 4YPGA 5LVEA 3HN8A 4KX9A 2EUVA 4U2YA 1OWWA 1UXSB 1LO5B 3HE6C 1LYQA 2ZKMX 4UTBL 2I32A 5C6WH 3OV6A 4M4RB 2AJ3A 3MBEA 2JKTM 3QO1A 4WY7H 1IFHH 2EXWD 4OF7A 2WKLA 3CXDL 2DEXX 2PO6D 2F54D 1PDKB 3UTSB 2UWEE 2RHEA 3M45A 2AI0L 1G7PB 2FT8A 3FRPB 3JTBA 4GG8A 3THMH 2WUCL 3T77A 1KGJA 2G30A 3AXHA 2DQTL 3WYRA 2P5WE 1F58L 2LU7A 1ACXA 5KW9L 3NZ8A 3HC3L 2OP4H 3OXSA 3L4YA 4WFGD 3M6DA 4HS6B 1C5CL 4ZXBA 2UWEF 4KKRA 3BAEH 5D93B 1OARH 2IDQA 3UBXA 4CW1B 3AS2A 1IEBB 5EDXA 2V17H 3P4NA 1M57B 2YUWA 3RGVC 5BS0D 4P2RA 1BLNA 1U8CA 3IDNB 4NO3B 2R59A 3E0GA 2R1WB 2ZOKA 1RK1A 2YPVA 4L5FL 4UIKL 4ZO8A 3QUML 4X80H 2EKJA 3DX7A 1RZ8B 4H7VA 4F24A 3IGAA 4IBSA 4NI3A 3ME0A 5CCKH 2CD0A 3MCLH 4PGDB 4YBHA 2AC0A 1E65A 4PRBB 5C70A 1D9KB 4H88L 5IF0B 2VFMA 2QQQA 4PGCA 1I3VA 5EU5B 4KQ3L 2ZUVA 1NDGB 4CU7A 4LASL 1MG3C 2RBLA 4OZIE 3JT0A 4MJJA 3DJZA 3AXIA 3D05A 4JGJA 4L3AA 5EU7C 1DQLH 1X44A 3EF4A 3TYGL 4XP1H 2KZBA 2X70B 2CBTA 3KLSA 1UZ6E 4G6MH 4HOXA 5IB5A 5AAMC 3QZNA 3QHFL 3GI8H 3LKSA 3PQYE 1Z6JT 4OZIF 4JO3L 1BD2D 3LH8A 4PJGE 1VGKA 4APXA 1BIIB 4UTAA 3RE0A 5SWSE 3ULVH 5A3IC 1VEPA 3GSRB 2UWEA 3WKML 4ZQKA 5GRYA 1UZ6F 2EIKB 1Y6MR 2H0JA 1EEUA 3MA7B 2ZSWB 5IEHA 4YHZH 1E8YA 1F41A 5GS1B 3MBXL 2KQMA 3JV6A 3K8KA 3L6FA 2X4OA 4P3WA 4PJGF 4PP2B 5FEBA 5D1QE 4WK4B 4Y4FD 3WNLA 5LCVH 2B08A 1EEYB 1GC1C 1HCYA 1LJMA 4Y1AE 2HKAA 4BINA 4K3DH 4EBQH 1HEZA 5D6DC 1FRGL 2QQNL 5DI8B 2GI7A 2RTTA 1T22A 2B9BA 3ILDA 1KXHA 2FJUB 3TVMB 4DO5A 3GMRB 5JQHC 1TFPA 1TZIA 4FQ2H 4KTDL 2DQCL 3QUXA 4F7PB 3U7WH 4IEFA 5C0JB 3VM5A 3CUPB 4MXQD 2OULB 4L37A 4PP1C 4Z3GA 5I1CL 5GJTH 5IJKC 4YZXA 3G6DL 4Z7QB 3MRCB 3L1OH 4HXAH 5SX5H 3MCKB 3HHMA 1L3NA 2EIJB 2VDQB 4MMZA 2RALA 5ETUB 3OJDA 5FYLE 1HHGB 3GKWH 3SZKC 3OXRA 4NS0A 3RAJL 4OZIA 3CVHA 1JHLH 2YA2A 1P7KA 2NY3D 1E3ZA 3BEWB 5AOMA 1HG8A 3VRJA 3QEQE 1WEJL 4Q89A 2WLNA 4YX2L 1TEFA 4MJ2A 4DAGH 3O3EA 4JN1L 3K6NA 4MQSB 4QTIH 4PJ9D 5BQ7A 4D9QD 4ZUWB 2Z8WC 4GIOA 3L9EA 3PQYA 3V4UL 4HJIA 5I24A 3BN3B 1SXBA 3BHBB 3LZPA 3JTTB 4PJ7E 1QEXA 4BDVA 3MJ9L 4PJGA 5K33A 1HEHC 1K5NB 3T4YA 1P4LA 2AQNA 1GL4B 5SWSA 2PUQT 1Y0LA 3ZZ1A 4QNPE 4UV4H 1LM1A 5B3NA 2CO6B 1JPTL 3S7GA 3G6JB 2J20A 4YLBA 1UH3A 3SZEA 3D0VB 1EX0A 4G7RB 4ANKA 1CL7L 4PJ7F 4TPRH 3ARBC 1X9LA 4YPGB 5D1QA 1SJEB 2WXFA 2R15A 1LTXA 1WE5A 1VCAA 5EBMB 4QNPF 4XPHH 4Y1AA 3S3CB 3DSNB 4L1DA 4LSUH 2AJ3B 4ODVH 4FFZL 2EACA 3QO1B 4KGLA 4TNGA 4F37K 1MCPL 3DGGA 1BXUA 2EXSA 5IHBA 4HWBA 5FYKL 5C2BL 1VERA 1F4YL 1JVLA 4ZFOA 5EWIL 5JW3L 3NCFB 2YXVA 2OL3B 2M8XA 4ZPTB 5ESQA 2HRHA 4LF3A 1UWGL 4Z7WE 4OJOA 4GG8B 2OQJA 4I8DA 3T77B 4M6AA 1N5YH 2ZUWA 2W91A 4F2EA 2WAQA 3RL2A 3NZ8B 5EU6D 1F2XK 3MV9D 3L4XA 1CDJA 5DJ2A 2P48B 4QRTA 4P2OD 3WJMA 1S78C 3VXQA 4OZHE 2VR8A 2OTUA 3GBNH 5AYUH 3KW8A 3FU6A 1V3KA 3UBXB 1KELH 2Y1YA 3BD3A 3QP3A 1NIDA 2IWEA 1JXFA 3P4NB 3T4AB 4JDZA 2Y06L 3SYCA 5ALBL 4URRA 3N50A 4WEBH 1B6UA 1BLNB 4YSDA 5EA0H 1OSPL 1SN5A 3A6CH 1MW0A 3QBTB 1IAKA 3QEQA 2ZOKB 1RK1B 5DVKA 2PN5A 3KL0A 3D2UA 1XSKA 2YKLL 3O3AA 2YOAA 2QL1A 1DYZA 4OZHF 3IGAB 4ECNA 2ODLA 3CHSA 4KNUA 4ZO7A 3ME0B 2Z8SA 3WEXA 3UZEC 4HGKC 4PJ7A 3GBEA 5DFAA 4NKIL 1HOCA 5IMOB 5I71C 5C6TL 3C2AH 3HUJB 2P24A 3L4WA 2CO1A 1T21B 5C0GB 2HTKD 3IGLA 4OCLC 1YY8A 4R4ND 4M7JL 2NLJB 5C8JA 4KMLB 1J9SA 3GIZL 2ED9A 2MCMA 4DGYH 4PJCB 1VAHA 5HD8D 2MWCA 2OSYA 4DPRA 1MCJA 2V2XA 1A65A 1FNSH 3NJNA 1VFAA 3ERXA 3AG2B 3U0WH 2IWGA 3PGFL 3WFCH 5JIMA 1JWSB 2ESVD 5HHXL 1J8KA 5T33L 1TITA 2YEZA 2VDPL 2I60L 2ENQA 2AJXL 4FFYH 4F3FA 1WFUA 5E2WH 4Y4KC 1VGKB 3UTTE 4APXB 5IFAL 2Z7WA 1R3HB 2AAVA 3HC4H 4G7YH 2DS4A 3POHA 4PAZA 4QLRA 2Z3FA 2FH6A 1YQVH 2UWEB 5E6IA 2DF3A 2NTPA 2AXFA 1KCBA 4Q74A 2LVEA 4ZQKB 1MRCL 4G6KL 3O6LL 4FQCH 4Z7WA 3RYMA 1QO3A 3EHBD 5IEHB 3CSYA 5GISH 1CWVA 4MJID 4G82A 1TYEB 1XF3A 1FVEB 2X9YA 3JV6B 1NZRA 3L6FB 2X4OB 1HXMA 1K3IA 3ARDD 3O8XA 1ONQB 2HT2C 1HZKA 4OZHA 5LWYH 1F18A 4P23C 3IDUA 3N1QC 3HZYB 1T4KA 1QSED 2APFA 4N24A 5I1LA 2W92A 1ASPA 3LY6A 1JUFB 4J6RL 3MV8D 2BDNL 3O6FD 4JRLA 4UAHA 2ALAA 5A6LA 4HGWA 4MVBD 5DCCA 1ZLWH 4M6MH 1CIUA 3QUZA 4HKZA 3QUXB 4LKXA 2RIKA 3WTSA 4IEFB 3HJEA 4WSGA 3IXTA 2BNRE 5E4AA 3KHQA 2HRPH 1ORSA 4W9CC 2EVGA 2GSIA 4CL7A 3L5JA 1PVHA 4HCRL 1K4DA 4XMPH 2J71A 4L1SA 4AYFB 4MMZB 3FQWA 2BJML 1Q94B 2X9XA 5GJTL 4XOTA 3IWUA 3STBA 5IESL 3OXRB 4G11A 4HPHA 4A2HA 3L1OL 1RJZA 1TLMA 3CVHB 1QA9A 3IRPX 3HW7A 1EZSA 2EECA 2QHRL 3ZDYB 4YUEH 5AB2A 1TENA 3VRJB 1R19A 5J11B 1USZA 3EJZD 4S1SH 5EZPA 4V1DA 5B7FA 1ZVHA 2YAFA 3O3EB 3UBXI 5LG6A 5LAPA 4Z23A 5K69A 2LR4A 4FYTA 4P5KA 1CVSC 2FECI 1A4CA 1OIOA 3J7HA 2J12B 4BDVB 1BVNT 1CB4A 1B2WL 3UTTA 3ZT6A 4XN4A 3P11H 3SDAA 3T4YB 3KCPA 5FUOL 1VEOA 1OTUD 5SWSB 2WXIA 3EXLA 1DBKL 5I18L 1V5JA 2MH4A 1X5JA 1DJWA 5F70A 2FX7H 4Y4HA 3RVXC 3VW3H 2FIKA 3LKQA 4DGIL 2BHZA 2AFNA 3QDHA 2LLNA 5D1QB 1QPPA 1CZ8H 2BWQA 2C3VA 5I19L 3HNVH 4FADA 1T03L 3JWNG 4JM4H 4RX4D 4Y1AB 5F6IC 1IBDA 3GIVA 3QG7L 2O6EA 2J21A 1KIUA 3WTTA 3FQ1A 1GXEA 3HPLA 4ZFOB 4XCFH 3GT6A 2XX1A 4DP2X 5EH1A 3SKJH 2FEEI 4MMXA 3X17A 4LOUC 3BP5B 2NR6C 2VZVA 1CFMA 2BNRA 2X5PA 1X5FA 1YNKH 1OK8A 4PLNC 1PTZA 4JFZH 4WRLA 3RWDA 5T3ZL 3SUCA 3AG3B 2ZAGA 3HG2A 5DJ2B 4QRTB 5HPMA 1Z9OA 3VXQB 2ZP0T 4GSDL 1NINA 1TMQA 1ETZB 2WJ7A 1BA9A 3RIKA 2H32A 3OLEA 5L4JA 2PWFA 1G1YA 2Y7SA 4GP8B 4OV5A 4MQTB 4JDZB 4JRXD 2VR3A 2WVSA 3BUPA 1Z5LB 1IAKB 1QBMH 2Y7NA 3QEQB 4ZAKC 3FU0A 4X6EA 1ZDSA 4Z7VB 3O3AB 1IILE 4NJAL 5F1IA 2BX6A 2GHZA 1MCKA 1GSMA 4H8UA 3U6XS 1X9QA 1XF2A 4JGUA 4KJQC 2UVFA 2C9SA 3OMNB 4PJFE 5CN3A 1HOCB 4BWWA 2EDRA 3BT2L 1XQ4A 1TJHH 4UOZA 2P24B 4ORGB 3OSKA 4O51A 2ZWZA 4WGVB 5FHAL 5HVGB 1D6EA 1YY8B 2QMKA 2V8LA 2BY3A 1ZTXE 3DX4A 4NC1C 1J0YA 3H09A 5C8JB 4YAQA 1JHTA 4PS8A 2H47C 4PJFF 4JO5A 4KK9C 5DUPL 1A4KB 4KKPA 1U8JA 2V2XB 4I3RL 1XIWB 4AQAA 3IVKB 2YEZB 2BOBB 4EW9A 3EH5B 4F3FB 1P9MA 1TQCB 3GQFA 4KK6D 4P9HL 1KGYE 2DBLL 5ABDE 1NHCA 1JRHI 2P80D 2YGOA 1QBAA 3LMJL 4Y88A 2AXFB 1UM5H 2DV6A 3MQIA 3O2DA 3OAYK 3CZJA 3F2LA 1TCRA 1MRFL 4Z7WB 3IMWA 2WMPA 2ZP9A 5JW4M 3CSYB 4B9KC 2D2CC 1KJVA 4FQ1H 4IBLT 1HXMB 4MRBA 5B1JA 2XY1A 3OBAA 1CLYL 5C0CE 4BRJA 2YD4A 1NFKA 1IC5H 1T4KB 4XX1E 1DANT 4XVUD 1GMEA 5JW4Q 1C5BH 1C5DA 3C5ZA 2WOYA 43C9A 1R3JA 3L95B 5EN3A 4YE4H 5TF0A 3MRDA 4K7FA 2OMVA 4HGWB 4WI0A 1MFAH 3SCMA 2Y6TE 2FHBA 4KRPD 4OB5H 2UY7A 3QUZB 2A6DA 4HJ0D 4LKXB 2E3VA 4ONFH 3RGHA 4O9HL 1T7VA 2FEDD 4BKTC 1L9SA 3IXTB 2A38A 4WCYH 5IVZB 1ORSB 2GSIB 4F80A 1T1WA 3BVWA 1K4DB 2EIZB 4G8EA 4IMKA 1IZJA 4JO4H 1JWUB 3B6SA 3OKEB 4LSQH 4NM8L 1HINL 1TQUA 3FQWB 2ZWKA 1F42A 3NA4A 2E56A 1TJXA 4IRJA 4JCMA 5IB2A 5K5YA 4P07A 5D4IA 2F6AA 1H19A 1QA9B 4CA4A 1XCWA 3V9CA 3HN3A 4NHCL 5J1SC 5IW6A 3C5JA 1OAXL 1R3LA 3UH8A 4Y7MA 4V1DB 2VISA 1FHGA 2FIRT 4G9FA 4PV9B 2ARJA 5CD5C 3C5XA 1KCCA 2VSCA 4TOYL 4OLWL 1WZKA 3V0HA 3D9AL 4J4PC 3SDAB 2JJUA 4JFDE 4DP4X 2CR3A 4NQUA 3QUYD 2HLAA 3EYSH 3TBTB 4TSBH 2RQ8A 1A6TA 5AOIA 3NJKA 2J8HA 3DTXA 4YEJA 2XQYK 1KJ2H 4Y4HB 4MA7H 2FIKB 3LKQB 1KEGL 1JF1A 4OGXH 3H56A 1MIMH 2C3VB 1MEXH 1DVXA 4GEJA 4B7LA 3FO9A 3VD2A 2HT3D 5E1IA 5C0CA 3US0A 3HZVA 1RK0A 1LK2A 1T0NA 1UH4A 3TO2A 1JGUH 2DM3A 4U7KA 3GIVB 4KY2A 2ZT9C 1S9XA 5IW3A 3UP6A 4AUJA 4F9PC 4ZW7A 5AVQB 5CEZD 3U6XA 5FFGA 4OZGE 3O0RH 3WIHA 2AK1L 4PVLA 2QKSA 1XF1A 1MOEA 5F3FA 1PLAA 3VFPA 4X7DC 5DMIH 4LLMA 2WCGA 5DVNA 1O7VA 2ZYSA 2AXJA 4H4NA 2ZWLT 2VDNH 3IKKA 4JKNA 3RBGA 5HDWA 3DLQR 4LVOC 1BZDA 2ZXWB 3MZTA 5BO0D 2VJJA 3V4VL 3RWDB 2FYVA 2FTAA 1CLCA 4OZGF 1F3JA 1EO8L 2C3HA 4TQIA 4UINH 3AITA 2E27H 3ARGC 4ZTOL 4RZCA 5HPMB 4APQC 3W9EA 1KUMA 3V0IA 5HP5A 4FF9A 3DYOA 4N2BA 1NAKL 1MJ7L 2H32B 4P5TC 2O6WA 4LIQH 4OV5B 2VT0A 4N5EC 3L1EA 3QH3A 2QVTA 3K0YA 4LU5H 3ATFA 4LSDA 2Q3AA 5CNHA 1AI1L 2F8VA 2PLTA 4X6EB 6PCYA 2HP4A 4NUGL 5F1IB 3JVGA 4X5XA 1AMXA 3ZZQA 1XF2B 4JS7A 3MUZ1 1H3WM 3TYFA 1KTDA 2DYSB 1JZIA 5EZLA 5LLIC 4JW3A 3A4EA 5E9DE 3KD4A 3T09A 1D6EB 4NQDE 5JPNC 3QFJB 1RY7B 4YAQB 1JHTB 5F88A 4ZMVA 1SJXA 2G60L 1UJ3B 5HHVH 2VR7A 5ALCH 1U8JB 2WSDA 3FB5A 1AOZA 2VW4A 1QLEL 3DVNB 2ISDA 1DJZA 4N0YH 4AQAB 1WS7A 2Y07H 3K6SB 2ZKHH 1U6AL 2DTML 3CSTA 3K5SA 2D3NA 4OZGA 4V33A 4XN5A 3HR5B 5JMRA 5F7MC 1IGIL 5C0BD 3NABH 2O04A 1TCRB 4Y5YB 2OK0H 3QAZB 2WMPB 2A9NH 2YWYA 3QPQC 4L05A 1KJVB 3TX4A 4LCCA 2LAAA 3SD2A 4NN7B 4MLSA 5MHSD 4MQ7B 4AJWA 3N0AA 4IJTA 3N40F 3TU6A 4OH2A 5BRZD 4B27A 1F1GA 1MKFA 4XWGL 5F3HB 5FA4B 3P73B 4AEFA 3GI9L 1O0VA 3JYCA 4NPJA 4NK8A 5EB9A 4UNUA 3HAEA 3BYYA 4XPAH 3C5ZB 2XXFA 4DQOH 2KLSA 3D85A 2EDBA 2OMTA 3MSPA 4EN3B 3NPSC 1RVFL 2OMVB 3KPRA 2Y4SA 4K7FB 4WI0B 2AANA 3ZKMC 3SCMB 2B3RA 1J18A 1LDSA 2ED8A 1DTUA 4NKMA 3BSZA 4AQ1C 3ULUD 2UY7B 2EUZA 2A6DB 2VM9A 4OCMC 1JGLH 1VENA 5CR8A 3T0AA 1A4JA 2WZ5A 4QKTA 4PJEE 5BVPL 3G5XB 3K2KA 3KHOA 2XJLA 4NQXA 1RFDH 1BQKA 5ECGA 1QFPA 4FMVA 3VFRB 5ITBH 3KLDA 1DBML 3B6SB 4JFYA 1UACH 3SGEI 4RISL 3H7LA 3O81A 2JTYA 4A68A 4M56A 4H44C 4NKQB 4NQDA 4IRJB 5IB2B 1IM9D 2W59A 4BFOA 3RX5A 1AKJD 4PJEF 2E7LC 4ALAL 2HKFH 3C5JB 4JO2H 4AE1A 2CGRH 5EBGA 3GMOA 2VISB 1JZ5A 2P8PA 4G9FB 2ARJB 4MA8H 1F1DA 4WHTB 4JB9H 4FTVB 1RPKA 5AKTA 1UCBL 1ZHBA 2LTQB 3OHXA 4J39A 1EO7A 2MHAA 4YHLL 3QDMD 4ZMNA 4OI9A 3ILQD 4FZ8L 3VFVB 2BSCA 2XWDA 1BBDH 5E9NA 1XR9A 4AGMA 3VDAA 5DK2A 4YHMH 2EYTA 3GXUB 4LDCA 1X5GA 2GQHA 2KZWA 2NZ9C 2AQ1A 4ANWA 4A04A 1I1RA 3RY5A 1HN1A 1JF1B 4KK8C 4HEME 4KZDH 1XBRA 3FO9B 3GLAA 3FTGB 4BQ9A 3PNWA 1EGJH 1FV1B 1RK0B 2AAAA 2YKKA 1T0NB 3WS6A 4EZKA 3TO2B 3HLAA 1I9JH 1XEDA 5T3XD 3UTQB 2NXZB 2F8OA 3BPOC 5D7LD 1I85C 1MWAH 3VH8B 3MLVL 1JGUL 4ZQTA 4NK6A 2PW2A 2MNWA 4HCFA 1U2HA 3VFPB 3A47A 5IQ7H 1O8GA 2K78A 4FXGC 4XN0A 4LLMB 1MXDA 1UEMA 3IAPA 1P5VA 5BZWA 2XN1A 3BVDB 1OOAA 1TQBC 4ZFFB 3CJJA 4J1UA 5F9AC 3BFOA 5B1AB 4E68A 2Z34A 3VG0L 2XTJC 1F3JB 3PWLA 2JELH 3T0ED 1EMTL 1ADQL 1N9PA 4XNYL 3W9EB 3QNZA 3U1SH 1QRCA 15C8L 3N5AA 3MGTA 1HVXA 3PWVB 2L04A 4JHZA 1N8OE 3NZHL 3BUDA 4O02L 3QH3B 1NCWH 1UYWH 1S46A 3EJUA 3L08A 4JZJA 3KM2A 3W81A 3LEXB 2C3GA 1RZJL 3WN5B 3IK2A 3UTSD 1RKRA 4Z8FL 1WT5A 2PO6C 3S97C 5AWNH 4A7VA 2W9LA 2HT4C 2Q20A 3TYFB 1NANI 4X7SH 4D8PA 5LN8A 1NWPA 3DX2A 4GG6B 1TTFA 2EVHA 4RIRA 4UQAA 1IL1A 2CDFA 1N6UA 4KGJA 2YD9A 4BZ1H 4G8GE 2NSXA 2ZX9A 4UM8A 5LNEA 2G3NA 5F96H 5IJCC 3FRUB 3NSDA 1FHNA 3JWDL 4OLZL 1M7UA 1ZT1B 2VC2H 3P3SA 4ZMTA 4HEMA 4KHXL 3P9MA 4X9YA 3FB5B 4GT0A 1UKQA 5GRWA 1XB3A 1TPXB 3L5IA 4OAWA 2APWA 2XX0A 1U2YA 2R0LL 3LSOA 3OL2A 4HUUA 3APMA 2WLHA 4GI6A 5HHME 5B4MD 1MH5A 3SEPA 4OZGB 3PL6D 5CUSH 2H3KA 3SPGA 4N0YL 3ZTDC 1O8EA 2OL3L 5JQ6L 2GYSA 3Q1SL 1QLFA 4MZ3A 5CJXA 4WV1A 1AOHA 2DMHA 4UQIM 4ODXA 4Y5XC 4LLVB 3SKUD 4BV1A 1S7UA 3VQ2C 4LCCB 1RLWA 4FABH 5IROA 3HI6L 1FZKB 4RBPK 3VB8A 3VO0A 3FQYA 5I75C 3T8VA 3V7MA 1J5IA 2YPKA 4LVHB 4IOFC 4JFHE 1J5CA 4L8CA 4W9LC 1S5IH 2VYRE 2X6VA 3K2UH 4G42A 4NAQA 3HAEB 4LCYA 1TO4A 2P26A 4LSPL 4JJ5A 1MFBL 1ZV9A 2OJEB 2OMTB 3KPRB 5L8KB 1RJCA 3DJTA 4N3TA 4PRNA 4FHBD 4NKMB 1ES0A 5B1BB 3U2IA 3AK5A 3D3VB 5C0RH 1KBBA 3O3DA 1A4JB 4NSKA 1RURH 4J3OD 2GPZA 2HLEB 3AVEA 1KGCD 4NQXB 1T6BX 3QEG