3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
1XD1A 2QMKA 1MW3A 1OT1A 3GBDA 3UG3A 2E8ZA 3ZT6A 1SZNA 1VFMA 1JXKA 1PIGA 2V3EA 5BRPA 2NT0A 2CPUA 4JFUA 2DH2A 4W93A 1T0OA 3VGEA 1UA7A 4FNUA 1R34A 3A23A 1JF6A 3H55A 2O1DA 2XN1A 3BUPA 3DDGA 1CPUA 4W8RA 3B90A 3BUBA 5E70A 1E40A 3CZEA 3WY4A 2NTBA 4B9YA 1KGWA 2E0PA 2FYVA 2XVGA 3ZSTA 4KWUA 4AIEA 2ZUWA 1CGYA 1HNYA 2J25A 4YZXA 3VMWA 2FE0A 4AVZA 3B4NA 4CN4A 2ZX8A 3DX1A 3OLIA 4UNIA 3WDHA 1G5AA 2E9BA 1CXIA 3WEOA 1ZS2A 4I84A 1IZJA 3EDEA 2EO7A 3K8MA 4NZJA 2FH8A 3VGGA 2YIHA 1IDKA 1OGMX 1BHEA 4YZ0A 1QHOA 1LWJA 2IQ7A 1WP6A 3WY2A 2BY3A 2WCGA 4GQRA 1MWOA 1RP8A 2D0FA 3BVVA 4MAZA 4JCMA 3VMOA 2EWEA 2VJJA 4QAWA 2GJPA 4HOXA 2DIEA 1PEZA 4PSRA 1ODUA 4XNFA 4DO5A 1J0JA 2O04A 1AVAA 1DBOA 1Q4NX 1O8GA 1VB9A 2F7PA 4X0NA 3FY3A 2QMJA 2ZWZA 1KGXA 3EQNA 2WC7A 3GTNA 1MVYA 1MW0A 2NT9A 2X6WA 2DIJA 1VJSA 3LXBA 4OIFA 3DHPA 3BCDA 1OSEA 3EJSA 3EJUA 3ECQA 1CGWA 2Z1KA 1NHCA 2WSKA 1PZ3A 3BAJA 1JD7A 1LWHA 4TVUA 2DH3A 1M7XA 1AQHA 2CHNA 2G3NA 4NI3A 1QW8A 1G1YA 1CGXA 3VX0A 4XLEA 3DX2A 1KCDA 4FLQA 2ZUVA 3EQOA 2IGTA 3UEQA 3CC1A 3L4VA 1KCCA 1K5CA 3BC9A 2PYGA 4E2OA 1JL8A 1A47A 2Y4SA 3WY1A 3D50A 3CZSA 4H2CA 1PE9A 7CGTA 2VBEA 3UG4A 1IZKA 2OYMA 4OJPA 5A2CA 1CZFA 4PCTA 1O8KA 3T9GA 4JCLA 1TQWA 1EHAA 3KEHA 1QCXA 3DC0A 2BXYA 2WNWA 3S5YA 1O8LA 4FNRA 3D52A 4BA0A 3GXNA 3KLLA 4FNPA 3LRMA 2NSPA 3HG4A 2PWFA 1HG8A 1V3LA 1CXHA 1GJUA 4UQAA 2VT0A 2YA2A 1GVIA 4W8SA 1C8QA 5E0FA 3WNOA 2INUA 2EACA 1CXKA 2E4TA 3RIKA 1PPIA 1KTWA 1KWKA 3L2LA 1X0CA 1VIWA 4XKVA 1NM9A 5CLTA 1UD2A 1MXDA 2ZX9A 1MFVA 3L4ZA 3VM5A 4HWVA 1UH2A 4UQ9A 4WSJA 3UCQA 3BVXA 3WELA 2F2HA 1KCLA 4CN1A 2O17A 1JRGA 1VBLA 3BVWA 2NTPA 3M07A 1JFHA 1DHKA 4GI9A 2VRQA 3LXAA 4MB1A 2PWGA 3CZLA 2ZXAA 1DTUA 4HOZA 1PIFA 2ODLA 2ZUUA 4JFWA 1QI5A 1BSIA 4UQDA 4XN0A 3JURA 3VGBA 4YEJA 3VM7A 4AYSA 5E6YA 3AJ7A 3EDFA 2QLYA 2AAAA 1R47A 1WZLA 3OLDA 5DO8A 1ZJBA 4NXSA 1JD9A 2C7FA 2FGZA 3HG2A 4WSKA 5HPOA 2PYHA 4UOQA 2QXZA 3BAXA 2YFOA 2ZUTA 4U31A 3A47A 4HA1A 1XSIA 4NXKA 4GI8A 4JFVA 4J3UA 3WNLA 5EMYA 1GJWA 1CDGA 1QPKA 2WVVB 3VU2A 3DX3A 4U3CA 4OGZA 4J3SA 1CXLA 3ZSCA 1O8IA 2FHFA 4UZSA 4YELA 2D3LA 2NT6A 3GXMA 3K1DA 4M56A 1D3CA 2XVKA 2F7QA 1V3JA 4OZYA 5KEZA 3GQ7A 2FHCA 1BVNP 2PWHA 4H7VA 2QX3A 1KXQA 1WO2A 1RPKA 4U49A 2EQDA 3BH4A 3KWXA 1CXEA 3IJ8A 2XWEA 3DX0A 3BVUA 4GO9A 1JF5A 2BXZA 4XLFA 4XM3A 1IDJA 2EAEA 4ATWA 1KWGA 1OGSA 2PWEA 1CGVA 1Y7VA 2WVVA 3L4UA 3A22A 1RP9A 1UH3A 3AMLA 3S2CA 1R46A 1WZMA 1JI1A 3VSTA 2VNCA 3W38A 2FH6A 4JFTA 1TCMA 3GXFA 2QY1A 1KXTA 2OSWA 3LMWA 4U33A 1HL8A 1AQMA 3BSHA 4U4BA 1AIRA 3GRHA 1XCWA 4NZFA 4J3WA 3BMVA 1HL9A 3ZSSA 2WVSA 1JDCA 1DBGA 3HZ3A 3GBEA 4J27A 3WFZA 4UOZA 1PLUA 2D0HA 2YA0A 3CZKA 4PSPA 1MFUA 4CKQA 5E9AA 3CPUA 3W37A 2VR5A 2GVYA 3L4TA 3LPOA 2YJQA 3D4YA 1WPCA 1R75A 2EABA 2D3NA 3GXIA 3OLGA 3KL5A 4AIOA 1RU4A 4FNQA 4HPHA 3A5VA 3KLKA 4FLOA 3IK2A 1JDAA 3CV5A 1SMDA 2XN2A 1XH0A 2ZX7A 3EDKA 4NK8A 4XMYA 1QHPA 3BAKA 4NX0A 1BAGA 2YFNA 3MI6A 2OW6A 1B0IA 4Z06A 4JFSA 5A6MA 3HG3A 2BHZA 2OSYA 1JG9A 1KTCA 2F61A 1UD4A 2INVA 2O0VA 5E1QA 1IB4A 4XKWA 3BAYA 3EJPA 1G94A 2WSPA 4HP5A 4GQQA 1QX1A 4GKLA 1PZ2A 3FW6A 5CLWA 4MR0A 3A21A 1P6WA 1XH2A 1U30A 2X2HA 3CLWA 1QI4A 1U33A 2UVEA 3WDJA 1V3KA 3ZQ9A 1BN8A 1DEDA 1J0KA 1VFUA 4XLCA 3ZT5A 4XOPA 1KGUA 3RILA 1JAEA 4PEEA 2XVLA 3BLKA 2BHUA 3WENA 2F18A 2WKLA 2ALWA 2XN0A 1QI3A 3ZR6A 1CXFA 2FHBA 3BCFA 4AMXA 4KMQA 2UVFA 1NOFA 3L4YA 2V3DA 4H8UA 1G9HA 1MW1A 1PS3A 3AMKA 1OFMA 3TV8A 4AEEA 1QW9A 1W9XA 4J3VA 2WANA 3GXTA 2G3MA 3QGVA 4OJYA 3VMNA 2BY1A 2ZX6A 3BUDA 4UQBA 1JIBA 3S5ZA 1XSKA 1O8EA 3TONA 2WVUA 5CXPA 1E3XA 1UD6A 1XSJA 2EJ1A 3LXCA 1OGOX 4GO8A 3A6OA 2F1AA 3AXHA 4UCFA 2NT1A 1BG9A 2F1BA 1HTYA 2ZIDA 3KL0A 4LQ1A 2WPGA 3BMWA 3GXDA 5DFAA 2D0GA 2ZUSA 1XH1A 4J28A 4GIAA 2BY2A 1UKSA 1EA9C 3EJTA 3WDIA 4AMWA 4PCSA 1H80A 1PAMA 2X85A 3CZGA 3VSUA 1EE6A 4X9YA 4FNSA 1MW2A 3BAIA 1EO7A 2YOCA 1KXVA 4OJ6A 2NSTA 2ZXQA 1VAHA 1EH9A 2X6YA 1J0HA 4Z03A 4XQFA 2V3FA 2VBKA 1I75A 3BAWA 1UASA 3CTTA 5TD4A 3HJEA 3WNMA 4FLSA 1PXZA 3DDFA 4OJOA 3OLEA 6TAAA 4DO6A 1TQVA 6CGTA 2X6XA 4Z05A 3WWGA 2VRKA 2BSPA 1AMYA 1UKQA 2XIIA 1JTAA 1XGZA 2PECA 2CXGA 3BLBA 2F7RA 1OB0A 3A4AA 3HG5A 4J7RA 3LRLA 4UQEA 4W8QA 3VNYA 4B9ZA 3GQAA 4XR6A 3ZPPA 3TTSA 3L4XA 4JL1A 4XLHA 3EDJA 1WMRA 2X3HA 2NZMA 3K8LA 2QPUA 2EADA 2ZXDA 3WY3A 4AYGA 1UOKA 4YZQA 3EJQA 1IA5A 1R33A 3ZOAA 1UKTA 3VNZA 9CGTA 1BF2A 1UA3A 3LPPA 1H3GA 4PMHA 1TQSA 1PJ9A 1B2YA 2OSXA 3EJRA 3IGUA 1ZJAA 2WVTA 4BZYA 2VUYA 1O8HA 1EO5A 3WNKA 4XL9A 3L2MA 1O8DA 1HWWA 4GI6A 3CGTA 1WZKA 1TQUA 2OW7A 4FMVA 1CYGA 3KE0A 3ZO9A 1OFLA 1RWRA 1XD0A 4OKDA 2TAAA 4H8VA 1XCXA 4J3TA 4XN3A 3ZR5A 4XB3A 2Z8GA 3EDDA 1HT6A 1BLIA 2X2IA 4CN6A 5A2BA 2Y5EA 4LPCA 2GJRA 3VX1A 1QJVA 1GQ8A 1KTBA 5C1EA 2BY0A 5E6ZA 1HX0A 1BPLB 4W8TA 1KB3A 2QPSA 4XOTA 3BLPX 5A6LA 3B8YA 1CGUA 1E43A 2XWDA 2ZWYA 3VSVA 4J3XA 2PWDA 1UD3A 3D51A 3H54A 2NSXA 2Y2WA 4CVWA 4HOWA 3AXIA 2X2JA 4GINA 3BVTA 1JXJA 3DHUA 3KL3A 3D4ZA 4UZUA 5BRQA 4OZZA 3VGHA 1UD5A 2ZICA 1OT2A 4EW9A 5CGMA 1CGTA 3UG5A 1SMAA 1O8FA 1WE5A 1JI2A 2ZE0A 4XORA 4WF7A 1CIUA 3K8KA 5HXMA 2VBMA 3GQ9A 4NK6A 4XLAA 3VMVA 2F7OA 1KXHA 4H8HA 2D73A 3LX9A 4DO4A 5CGTA 2WCSA 2C8NA 3GXPA 1O88A 1XV8A 2QV4A 1E3ZA 1VFOA 2GUYA 1L0PA 5A2AA 3VMPA 2EEXA 2E8YA 3LRKA 2VJIA 3II1A 3VO0A 3CZNA 1HVXA 3BSGA 1Z32X 5HDRA 1IV8A 1D7FA 4AEFA 4CGTA 1QWUA 4AW7A 2ZX5A 1JGIA 3BUQA 4M8UA 1UD8A 1UH4A 4U2YA 4YZAA 1MXGA 2XIBA 3UERA 3IJ7A 3WNPA 7TAAA 4FNTA 1KCKA 2OYLA 2WKGA 1O8MA 3VGFA 1O8JA 1J0IA 5I24A 3KRGA 1JDDA 3BUIA 2O0WA 1S46A 5I23A 3FAXA 5I0DA 4MXNA 1V3MA 1WZAA 4URRA 4JL2A 1TQTA 3WNNA 1O7DC 3WMSA 2YKKA 3GQ8A 1KBBA 3IJ9A 3VGDA 4U2ZA 3UW0A 2AMGA 2ZXBA 3WEMA 1M53A 4LXFA 1RMGA 2NTQA 4C2LA 2BHYA 3TOPA 3SUCA 3H53A 3TTYA 2Y24A 3ZT7A 2OYKA 1CLVA 3WN6A 4FLRA 4OJLA 5F7UA 1OOCA 4WLCA 3A24A 2YA1A 1TMQA 1HXKA 1GCYA 2D2OA 8CGTA 1XG2A 4OJ5A 3FAWA 1KBKA 4UQCA 5C1CA 5AMVA 1QWNA 3L4WA 3DX4A 4XONA 1BVZA 5I5RA 1U2YA
chains in the Genus database with same CATH superfamily
1R3KB 2FLBT 4FQJH 4PRNB 3L3GA 2R9HD 3ZKQD 1PKOA 3N55A 4TPRH 2V3EA 1G6RB 4I89A 2IG2L 3FU0A 4QHLB 2CPUA 5KYUA 2CR6A 1NCDH 4YIQB 2DZEA 4JPVH 4JPKL 3VGEA 2VXVH 3Q5TA 3S88L 3P4OB 4Z0XA 4TNVF 2E6QA 2NY4C 5F7NC 1Q0XH 5F9WB 1YCSA 2MTPA 4P59H 1KGWA 1ZHKB 4IU2A 1PKQA 4P5MB 1KJ2L 4OB5H 2E56A 4QRRB 5LXGH 5F3BB 5IQLA 4GG6E 3IF1A 2P5WB 4ZMOA 1I7TB 3AK5A 3RKDC 3PNWA 2XYCA 2ZT9C 3WEOA 4GIOA 4CC4A 5I0VA 3BW9A 2W9EL 2PW1B 3V0FA 4LVOC 2H9GA 4AG4L 4PJ9B 2VDLB 2HLFC 4OFVA 4TNVK 3OMAB 5TDPA 4YS4A 2BY3A 2O6FA 2VZTA 2WP3O 4BIKA 3F5WA 4CJ0A 4XN2A 3DXAE 5ID1B 1QBLH 1I4FA 2C3XA 2NY2D 2XN9A 5GIRB 4Z23A 5L2JB 3K81A 3AUVA 4PSRA 3HB3D 4Z7QB 4PJAF 4AVJA 4XNFA 4A2LA 3W0WB 3BQVA 3IPBA 1JPTL 1MVYA 4TNFA 1EBPA 3UMNA 4NO3B 3K4AA 1EXUB 4YO0A 1VJSA 5MENA 1MCDA 3RWHB 4A38A 4A68A 3BCDA 4L3EA 5JOEA 3ECQA 5E8PB 2P8LB 3CFJB 4TMPA 4F80A 3PHOB 5IEKB 3BPCA 3MRFA 3VXOA 4LPUA 4R4FH 2QQNL 4G70B 2A6JA 1YECL 2BS71 3QHZH 1QLEL 2BM7A 3NA9H 3STBA 3VFUB 3KCWA 3TBYA 3QIBD 2IGTA 2MIZA 4DN4L 4YDJB 2PYGA 3X11B 1J0YA 2DWDB 4KJYA 1O0VA 3N44B 4PB9H 3ARFA 3IEAA 4XNXH 4Y1AA 4F92B 1A8ZA 1P84J 4CBPA 1SGKA 2CDGA 5A2CA 5KVGL 1OCWH 1OGAE 1HINH 4IW4C 3QS2A 1S7QA 1PMYA 3OXSB 2AEWA 1CZ8H 1MCJA 4H40A 1A7RL 1FL6A 1T7WA 3FT3A 3HE6D 3VFWA 1QCXA 4OUUB 3RL1B 3ZMEA 2BK8A 5BS0E 2OMXB 2HVKB 1KC5L 2CE6A 3GRBA 2FD6H 2BS8A 5AB2A 1V3LA 5ALCL 4FQXA 4I9WE 3AU1B 3DUSA 2YLHA 2XCMC 1LM1A 2NQDA 1PPIA 3FB6A 1GSKA 1PY9A 5TFSH 3U6XA 1EIBA 5CS7A 1LYQA 1WWBX 1ZOXA 1OTTC 2NY0D 1MXDA 3VM5A 4PG2C 4ZPVB 3UCQA 5KANI 4JFXA 2EEBA 1IGYA 4JFDA 4S0HA 1A9BA 3QCVH 1YNLL 3L81A 3O2DA 3D08A 3LSOA 4W9EC 2RACA 4WKXA 5GISH 1EAPB 1RUQL 2J8UB 1GPOH 3B7RL 3N6YA 4N8VA 3T2NL 1GXEA 1YNTF 3O6KH 4ENEC 4WKZA 5E8DH 2YPVH 3FSVA 1CE6B 2GSGB 3VTTA 1F6FB 4BDVB 1DBMH 3J8F7 1DUZB 2ZSWA 5F3FA 2QLYA 3QR2A 4XNZC 5BVPH 2AK1L 1N0LB 3VH8A 2OMTB 2B5IC 3P30L 4OZHF 4FF9A 1KIQA 1OM9A 5EEXA 3GMPB 3PREA 1GS6X 2TRYA 1HYSD 2VDOB 4XMPL 1Q9LA 4C56A 3NFPB 5EDSA 1CG9A 4JFQB 4X4YA 4FDWA 2XTXA 1V55B 4WEBH 3NCYS 5LGHL 1OFEA 4XN1A 5KANG 3P3RA 2XTYA 3N04A 3HLAB 3CXFA 1A0QL 1D3CA 2J6WA 3N9GL 4NQEE 4RESB 1QUPA 2P5WD 3MC0A 2F7QA 1YEFL 1V3JA 1W8EA 3KHOA 4L3AA 2CUMA 5CCHE 2ZD0A 2O61A 1MY7A 5KG9B 4YE4L 3O6LL 5D7JA 1Q72H 1C12B 4U6XB 1FZKA 2WM0A 5C07D 1EMTL 2GTQA 2XWEA 3Q0HA 4LU5H 4M4PA 4ZUSB 3TESA 2AF2A 4HUXB 1M7DA 2BXZA 4QJ5B 3KPRA 4Z18A 3MOBL 1ASQA 4HIXH 5GZND 1OAKL 1KG0A 3WD5L 4Z76A 1FFRA 3VG9B 4B0MM 4PCKA 4M1GH 1HESA 1HKFA 5CIPA 2MEJB 2Q10A 3CQFA 1LE9A 3UTTB 2GUOB 4JDEB 4LVOB 5BRZD 4IBTA 4PJ9C 3SE9L 1PNCA 3DLQR 4NZFA 4HT1L 4CU8A 2W9DL 5IW1A 1DDTA 2WVSA 4G8EB 4JRYB 3HZ3A 3V7AE 1JNLH 2XV0A 3ZDXB 4RZKA 2AK4D 4XNQB 2IBGA 4MBRA 2OTWA 3DX6B 4PJGA 1MFCL 4RGNB 1NFDA 5IREA 3CFNA 3EF7A 5IGXL 1XIWB 1R75A 2XT2A 3OF6D 4P2OD 4PRHD 3DXAA 3BQUB 2N0MA 3GZQA 4FLOA 4X4ZA 4YAQB 4F27A 4ZUUB 3MLPA 1G84A 1J10A 2ZX7A 3V4VH 3MRLA 2BOBA 3BAKA 1P7QA 3CFTA 3MLRH 4YPGB 4TQIA 3C5JA 5JOFB 3WLBA 1U8JA 1F0LA 3FMGL 5AEAA 1YYLH 2IFFH 1PZ5A 4K23L 4CVXB 1RUAH 5A6MA 1AOHA 4O4YH 4OLYL 3IKKA 5ANME 3UJJH 3SDCA 5EUOF 1Y1UA 3ULUD 2V6HA 4JFHD 4NUGH 2DD8H 5I8OH 3N3EA 4ZPTB 4UQ3A 3X3GH 2GTWA 5HDLA 4P5MA 4PLNC 1WG3A 1AGEB 4DW2H 1AQ8A 4WO4D 3Q2VA 3O3AB 1VENA 2DMKA 3SE4A 4EE2A 1GZQA 3LNEA 4Y4FD 3WEXA 1DEDA 4N2AA 3LIUA 3ZL2A 4JE0A 2HPTA 3T0EE 5IFAL 1IAOB 3ARQA 3R1GH 2QVFB 4NO5B 2D03H 5TDOB 3FFCB 4L29B 3O0LA 1F3DJ 2DI8A 1TQCB 3FH8A 1KCVL 1AZCA 4N8PA 3BSZL 3C60C 2EE9A 4HJ0D 4POZC 3MOBH 4KK5D 1DJSA 1TJGL 2O5ZH 2WOYA 4KAQH 1RUPH 1HEZB 3LXCA 5EF1A 2DPKA 4B9GA 2ZYRA 4I3GA 4AYMC 4NO3A 4XX5A 4K73A 1OT4A 4KH3A 2UZYA 5IFJB 3ZTDC 3O6LH 1FIGL 2ATAA 1FIEA 2F54B 2IANB 4RMSA 2Z7ZA 2F58L 5FEBA 3WU1A 4IOIB 4K7PY 4OFIA 3LN9A 5FDWB 3N9GH 4G3YH 3VSUA 3WGVB 3NTCH 3H2WA 3U7YH 2WO2B 2NSTA 3FT4B 5IJDC 1T5KA 4IBYA 4GYBA 4M4RA 2P52A 2VJXA 3RQ3A 3AAZB 2V3FA 5C07B 3D0AA 1BFTA 1UASA 3R0MA 2D03L 4N0FA 1IMHC 6TAAA 4DO6A 3DIVA 3KPOA 1A1NB 2E27H 1F6LL 4DCQB 4KRNA 3EYQC 5C0ND 1EV2E 5KBMA 3PABA 2ZOUA 5FGCE 5I82A 4F7KA 5LQBH 1CICD 3DO7A 1CGSH 4M61A 2FTAA 4ABVA 1VCBC 5E8DL 1I9IL 4Z77B 1R5IB 4PGCB 1WMRA 5CLXA 2X3HA 1I1FA 4MCZB 4LP8A 3VTAA 4YZQA 1BF5A 1YNLH 4PRIE 2D9CA 3VNZA 3C6LD 3SE6A 1OAYH 1KLUB 4DFIA 4EN3A 4MMYA 2Y6TE 4J3OH 3UAAA 3MGTB 3RTQB 4PLOB 4L4VD 3K72A 1K8IB 3MACL 2CGZA 3DTUB 1CFVL 2WAHA 4D9LH 5JW3L 5C3TA 3LRSB 2BO0A 1NGZA 1MZYA 4LMQI 4FMVA 3TNNB 1SJHB 3VFPA 2V2TB 2KH2B 2K0RA 2ZONA 3IN2A 5E00A 4QJ4B 4BGLA 3IMUA 2HJFA 1DANT 3KM2A 4AM0A 4Y9EA 2Y5EA 5J6GB 5DEJA 2WXNA 1SN0A 3MRRB 4K9JA 2QPSA 4M6MH 1P4LB 4Y4KA 2YAHA 5GS1C 2O6CA 2XWDA 1VZHA 3AZUA 5AVQB 2WLZA 4OF0A 2X70B 4J3XA 4YQXL 3H54A 2W65A 3UL4A 1J8KA 2X2UA 3C6SA 4UI2A 3WTUA 3ULUL 5LKNA 1XIWC 1IBDA 1M6UA 1D6EA 3FNKA 5EIIG 1WA1X 1SF3A 1QLEH 4XORA 5JPNB 1CIUA 3EFOB 4KTEH 1NIEA 4OQ1A 3RA7H 2IQAB 2HRPL 3KXFB 3V4UH 4CNIA 1JYVA 5F89B 1F8TH 2P24B 3UOAB 1F4YL 4H0IA 3RPIA 1L9QA 4TULL 5DTFA 5IHLB 4DEPC 4C83A 2QKIC 1XEUA 3OHXC 4HIJB 3U2IA 3JV4A 4F1ZA 4PJXF 4D9QD 4RFEB 1SXAA 3QXDA 5D2LA 4CGTA 4AW7A 3ARUA 3CFEA 1A3RL 3J07A 5GZOD 5JNYA 4JQIL 4BCYA 3W9DB 4YZAA 5BRZE 2A74B 5I76B 1TVBA 4PJCB 1CTMA 1LM8V 2HX8A 5IHZA 3F12A 4AVKA 3MUUA 4JZNB 2NTFB 4EI6B 1JDDA 4M5TA 2O0WA 3NQIA 1PCSA 1FFNA 2ZP0T 1T1ZB 3H56A 2NZIA 4XXDB 5E2VL 2HG0A 2A9AA 1D7CA 2OJEA 4RNRB 5EBMB 3W11D 3HAEA 2HFTA 3HI6H 1S9XA 2DTSA 3MUGA 4RRPG 1GZHA 1KYUA 4N20A 2C3HA 3I9GL 2ZXBA 1UWEH 3DNKA 1MQ8A 4MMZA 4XNMB 3VW3H 3QUZA 3TOPA 1RZ8A 1QSVA 4TVPH 4Z7UF 2AFNA 1A66A 5D5ME 1GR7A 1GY1A 2JKIS 3ZT7A 3V8CA 3L6FA 3VFVA 5DURB 4OD1L 5FUZH 5AW3B 4DJMA 4PJDE 1I3GH 3H42L 5D1XD 2WZAA 3CHOA 5B7MA 1BMZA 1HQ4B 4X5LA 5IB5A 4X9FA 3L9YA 2H0PA 2Y7SA 1E50A 5D1QB 2FEDD 2ADIB 4EZKA 1GYAA 1HCYA 3FRPB 4F20A 1ORSB 4F9LC 1RJLA 2R15A 4GRMA 3O2VL 1PD0A 5E6ID 5FGBA 5JLVC 1IBGL 1GGBL 4YHPA 4A6YB 5E6IB 1TVDA 1KN2H 1TOXA 1XGTB 5E6RB 4CRPA 4KI5C 1EZVY 3IN0A 5KYXB 5B39G 1ZIAA 4HXAL 1E27B 4FJZA 5BZDA 2R51A 2NTBA 4P99A 4M02A 5BVJA 5TK2A 2FYVA 5B1BB 4K3EL 4H20L 4E5XG 3B9VA 3E8UH 4WFFD 1KPVB 2C5DC 4HGWB 3U9UA 5SV3A 2W95A 3V79C 4I84A 5DK2B 1R3IL 4MXVE 4I1RA 5MEQB 1P5UA 3Q6FB 3NA9L 3QNXB 5C7XH 4AJYV 3PGCA 3VGGA 5SX5H 4NO2B 3AWFA 3EIFA 1QHOA 1KPUB 2VLRD 2WWKT 2DYPD 4DP9X 4EOWL 3CSBA 1T5WA 1AG0A 4PWEA 3TT1L 1PNDA 1JPGA 2A73A 1EEZB 5EN2A 3ZYIA 1TIUA 2VDLL 3NSCA 3WUWB 3ASOB 5BS0D 3ESMA 3BN9D 2X4QB 4JFZL 5T3XH 5IB4B 5T3XD 2L7UA 4GW4B 3NCJH 2XLLA 1T5XB 3DOSA 3VCLA 4KQ3L 5HYQB 3C8KB 4M48H 4OIFA 4QNPF 4R5TA 4X7TA 4ZDHB 3C5XA 3MJ8B 4H25A 2XUWA 3E6HA 3QORA 1JWUA 4MJ4A 1MJ7H 5IB2B 1YMMD 3IJEB 2DTMH 3KPRD 4XVJH 3FO9A 3NEXA 4M9OA 3FCSA 3DMMA 5F7YC 4I2XE 5E2VH 5A43C 1ZGLA 1KCDA 5SWSE 1CLOH 3V0WH 1CFNA 2BDNH 4JY5L 1MCIA 3PABB 1YEEL 4PJDF 2XI9A 3IPEA 5C0CB 2FQDA 3AS0A 4JRXD 4LLDB 3HG1B 1UXWB 3WFEH 7CGTA 3UG4A 4Z77A 1EXHA 4QXUL 3ISYA 2FUTA 2YO3A 3ESOA 3O9WB 2AJUL 1PSKL 1BGXL 5CWSB 3QNZB 1Z5LA 1W16A 4AT6A 4M93C 4LLVA 5FCUH 2G75B 2OMZA 3OSKA 5F1SA 2IBZX 3S5YA 3PAZA 5A16A 2WWOA 4LSSH 4QRTB 2P5EE 3QEUA 5D7KD 3FKUS 2J8KA 1NCDL 4TULH 1T1XB 4OIAA 4X6FA 1CWVA 4KMLB 2WQUA 3OBAA 5IB1B 5K9JH 3GUTA 1RXLA 1MLBA 4G9FE 3DPBB 4HS8L 4EN3D 1RZPA 4EKJA 2ATKA 5T1KD 3VD7A 3LOWA 3EOBB 5ESAA 4MNQA 4HWUA 3HCVA 3BDYL 1NCCL 1WD9A 2J1ZA 3ZYJA 1O6TA 4WSJA 5I1GL 5HYJB 4FZEL 2EZ0C 2F2HA 4LQFL 4PV8B 4Z3JA 1RY7B 1JFHA 3QIWA 4QI3A 4NWTL 1UADC 1QVOB 1MI5A 3FU7A 5IW6B 2ZOKB 2YMXH 1AZNA 2VE6A 2R0ZH 1DTUA 5F88A 3KJ4B 1C1EL 4WI2A 5JW4N 3MRGA 5IESL 5CJQH 5DD6B 1MG2C 5AL0A 5HHMB 2P8MB 1R47A 1V54B 2B1OA 3VG0L 3IFNL 3QRBA 3HG2A 2Z31C 1BZ9A 3POHA 4X99B 2DWTA 4IYKA 3BAXA 3FQWB 4HJUA 4YL4A 3RL2B 3UZEC 1J9CT 5GGUA 4M8QA 3UTPE 1ZS8A 2RQ8A 5K69A 2EVFA 5EMYA 3DJZA 5D9SA 1CDGA 1CFVH 4XN8A 3OHXA 4ZJ9A 3W82A 4OUUA 4J3SA 4NP4L 3F65A 1FSKC 2EINB 1HSBA 3D3VB 4LASL 4TNGA 4QKXB 3IFOA 3L1OL 3IFPA 3PWNA 4WK0B 1URLA 5IROA 4G8GE 3N40F 5GHWL 1JZ5A 2R1WB 4RMTA 1WJ3A 4FFTA 2V9UA 2EQDA 3PRZA 2EDMA 2EDHA 2O5XH 1AY1L 1BM7A 1V8HA 4K5NA 1G1OA 2ZNXA 2YQ3A 4Z0BL 5HGAB 1QSFE 2CM6A 2EDDA 2HJLB 2X4RA 1RIHH 2YOAA 3DX8A 5L6YL 2WVVA 3S4SG 2ORBH 4LCUB 2PCXA 3QDJA 3L7FB 1FZMA 4ZFQA 1ROCA 4BRJA 3QUGA 2ZNWA 1QPPA 3VYNA 5HY9A 3FCTB 3RUGE 4L0YA 4ETQB 5C7XL 2DICA 4ZAKA 4D94A 1QBAA 2PO6D 3WIAA 5L9DH 3F5WB 1GOFA 1MAML 3BGFC 5KVEL 3RWGB 2RJMA 5DR5L 4DZBB 3DGCR 5ISZE 1Q0EA 4WFED 4OZIE 1XCWA 2V4LA 1BJMA 3BT2L 4P0DA 5D7IE 3LXUX 2BWDA 4R0LB 1H3PL 1AOZA 1F58L 3KWVA 5DK3A 3NEOA 2NY3B 2N01B 4O5LH 4X8CA 4ZZKA 5HDWA 5ILTH 4HK0A 4LPYA 1PD6A 3IDGA 3MRIB 4PJEB 4MQ7A 1IM3A 1TU2A 3CPUA 2AI0L 4EBQL 3CVHL 2VMJA 3PP4H 4PD4K 4U1MB 3AT9A 1J1XL 2AVFA 4YH6A 3M7FB 4Y4FB 4KAQL 4ZQKB 3HLAA 3RFZB 4UM9A 4OGQC 2V37A 4HWEH 12E8L 3KLKA 5HYSG 4XMYA 1QHPA 1CDJA 4NX0A 1DQDH 5AG9A 1CD1B 3NDZE 1RPUA 2N59A 3MI6A 4XO9A 5EUKB 1WFUA 2ITCA 2VRAA 1JXFA 5KYXA 2SEBB 2K6ZA 2BP3A 1JN6A 3E8VA 3TN0A 4PGJA 3V9FA 1X9QA 1FGNH 4N2FA 2F61A 5IF0A 5I0XA 3GO1L 4P3CL 1IBFA 5E4EB 4OZFA 3KPPA 3IE9A 1QX1A 5H2BA 1CFTA 1F1GA 1UWEL 2E7MA 5D5MF 1T03L 1U30A 4QHNA 3BJLA 4A7TA 4Y16D 3BESR 5I73C 1V3KA 3EGDA 1BECA 1VFUA 4WK2B 4OTXL 4KKRA 3U9PH 5GRUH 2AHIA 5DJZB 1B0GA 4JFYB 1OF2B 2HCZX 1YMMA 2G3XA 2XTJE 3MUZ1 4W6XB 3SGDI 2YR3A 2I26N 4YDLB 2IFFL 1S7VA 5LGJB 2YD7A 1B4LA 1KGIA 5LNDA 5B1JC 2G3MA 1Z9MA 3B34A 2B14A 3WFHA 1KEGH 5KBPA 3MLTB 4R97C 3B83A 3I9AA 4JFDB 4YDZA 3GHPA 4PJ7A 1A9BB 5J6SA 3ZZLA 5BV7H 2NPLX 2FEEL 6FABL 4LF3B 3GSRA 1M05B 5E94A 2VABB 1BYNA 5C0BD 4PP1C 3S37H 3WGUB 3KNBB 1G7MB 1M2VA 1QAWA 3RJOA 1GGCL 5DD0L 1KJ2A 3VXMA 4OAWA 4Q14A 5D1XA 1SJEA 1WWWX 2ICES 2KLSA 5J3HD 4OV5B 2X85A 3CZGA 3OKEB 1F4YH 2GK0A 3ME0A 3QDGA 3BAIA 5CZXD 2YOCA 4DSYA 1SHMA 2WXQA 3OJDB 4OLZL 4OJEH 4Z3GA 2EDFA 1VAHA 2P80A 1EH9A 3N44F 1RUML 2VQ1A 3GEFA 2L3BA 4DQOL 1H3UA 4TL4A 4JFFB 1XH3B 4HBCH 3HHSB 1O5DT 3DJRA 5F7FA 1A9VA 2NY7H 3ULUH 1TFHA 3GM0A 4FS0A 1R5WA 1S9VB 3FFOA 4IBUA 3QIUC 1BQ5A 4ZO9A 2R9HC 3V4VB 1ASOA 1ETA1 3V0IA 4G8IB 3W56A 2XPYA 5KS9A 4Z7UA 3WLWD 4YSQA 3MYZA 1G0XA 2IOIA 4JDTL 4XR6A 2EDEA 2YARA 2E86A 3Q8AA 2NZMA 2X6CA 3U4EA 4O02B 1Q72L 2WTOA 2BSRB 4GQZA 1PX8A 5KSBA 3H9SA 4FFYA 3MRJB 2WXOA 1TQSA 4XC3H 1I3VA 2CRIA 1EERB 4TQEH 3V0GA 2VTFA 5F8QC 3PNWB 4NKIH 4WHYH 4WNSA 3A4DA 1B2WL 5JYMA 1X9UA 4L05A 4LDCA 4ZW6A 2X4OA 1F5WA 4NHCL 5ID1A 5D1XC 2B9BA 4JO1H 4MQXC 4FFVC 5GPRA 1RQ5A 2BZDA 5DZVA 1DBML 3ZJAA 4PB0L 2BY0A 4R0LC 5F88B 1PG7L 5A1AA 4HSAC 2X6UA 1Z9SA 1DANU 2OCJA 2HTKC 5DVNA 1E43A 3RX5A 4F7CA 5I2IA 4AQOA 3P1VA 5GJTH 1GIGL 3CK0L 3R4DA 1PY4A 1EXUA 1XIWA 4WHTB 2FEJA 3T2NH 5JA9A 4JM4H 3D2TA 1GL4B 2ZOOA 1F45A 2DQUL 3CQPA 3GKZA 3S35H 4Z95H 4PJHE 1AHWA 3QJZA 2ARJQ 4NHCH 5GGUB 1IBHA 3BPCB 3MXVL 1LEKA 3TJPA 5IKCB 3T0DA 1GMEA 1LO0L 3BEVB 3MCG1 3QUML 3CZJA 4B9JA 4HS3A 1W72A 4MA7L 3DO3A 5FUOL 1JI2A 4PW9A 5HXMA 2VC2B 2AGJH 4KKBC 2QSCH 1BLNB 2AQPA 1P1ZB 5EFIA 1AXIB 4LLYA 2D73A 3NTCL 5DRZB 5DUJA 4TQEL 4W1TA 4X9IA 5TJWK 3UX9B 4EUPH 1G7JA 1QQDA 4ABWA 1FFPB 4BH7A 1E3ZA 4G5ZL 2C3GA 2DM7A 2VR8A 1BZQK 2VDNB 2K3TA 1BVKA 1MY5A 3L1EA 4Y19B 2FLMA 5DRNB 2LVCA 4NBXB 2WWMD 2JKWA 4P5TA 5IQNA 3D2UB 1OF0A 1TJMA 5KJ4A 4UINL 4GQ9L 4AOFA 1SJHA 1NOAA 3CQQA 2OV0A 4M8UA 1UD8A 5GS0D 1IAOA 5DURD 5I73B 1QWHA 2ZXGA 5TQ0H 3QULA 2XXMB 4JVWA 5CD3A 4NERA 5J6GA 4MVBC 4OFPA 5BV7B 1S9WA 2APBA 2IWFA 4KXBA 1PFCA 5GJSH 2NY7L 2XN9E 2B3IA 3KRGA 1WSST 1QPXA 4ODWB 4RAUA 4DQOH 2BWIA 5IFAH 4AYFB 3HR6A 3CSGA 3NJVA 4YOKA 3O4OB 4U7SA 3WN5C 3JYCA 3T3PE 4ABQA 4PBVC 3X13B 3WEMA 2DYRB 2NTQA 1E6JH 3LRGA 5HJGA 4UV4L 3SY0B 4N8VB 5CD5D 2BHYA 4S2SA 5K9QI 2DD8L 3A0OA 3BP5B 5I8OL 1GGCH 4MZ2A 5G2NA 5B38B 4AUJA 1LWRA 3B7YA 3HS0A 4YHKL 1SYVB 2BRRL 2RFXA 4F7PA 1Z0NA 4K3HA 3TIEA 3VGAC 1RK7A 1F4AA 2QVIA 3FMGH 3NPZB 1IGML 4F2ME 2D2OA 2FATL 35C8L 3PXJA 8CGTA 3PY9A 1GTFA 5L7XH 5E70A 4XE0A 2VN6A 3WI9A 1XD1A 2GKIA 2OZ4H 3GSVA 3Q7JA 1E0OB 4NHUB 4FQQA 4ONFH 3L3OC 3FQYA 5JDSA 3MMEB 2CK0H 2EO9A 1AGCB 5H2BB 2K9FB 5DJYB 2E7BA 3H55A 4MX7B 5IEHB 1JWMB 1MFCH 1QASA 1KJ2H 3DDGA 4OB5L 4Y88A 5J5EA 2VC2H 4N3UA 4PJ5B 4BWWA 4LPTA 4PS4L 3UGEA 5AFAA 2KKQA 1FBIL 2E0PA 3U6XS 1DQML 4KWUA 1CGYA 1OF2A 3EUUA 3RU8L 3LRHA 3WSQH 3H9SD 1I7UB 4ORZC 4PRNA 4Z3FA 3BVDB 3MA7B 3VXUD 4RGMB 3ZE0B 4JPVL 2MPAL 3TVMA 4BKTC 1DQLH 4BD4A 4HUVA 1IZJA 1JHKH 4X5XB 3VDCA 1VHPA 1CDUA 1Q90A 2IG2H 4Z8FL 1KJ3L 1MRFL 1IDKA 3LY6A 4EN3C 1A2YB 4CSPA 2O6WA 4HLZH 2IQ7A 4I85A 5JIQA 1FDLL 3WS3B 2B4CH 2WCGA 4OLVL 1U6AL 5IHBA 2EE3A 3ABKB 4JCMA 4WW2C 1KIPB 3S3PA 2VUOA 2CLRB 1Y18A 5EU3A 3ZTNL 4CDGC 3K2UL 1XGRA 3FF8A 1IBYA 3PP4L 4PJ8C 3GFUA 3VXMB 4PRPA 4X0NA 2ICWJ 1KGXA 3HI1A 2GK0B 5AVUB 5IOPA 2XWJB 5EUOA 3DHPA 2BFGA 3GZKA 1ZD6A 1FP5A 3E2HB 2Z1KA 1NHCA 3BAJA 3MBWB 4MGXA 3BT2H 4YGVB 2FCBA 4LIQE 3G5XB 3MRDA 3WAKA 2IQ9H 4Z7NE 1OAUL 4TUKL 1A6ZB 3BRFA 3MCKA 1A7NL 3BKYL 3B1UA 2ZCHH 3GBNH 3JVGC 2P24A 1S7RA 3LKRB 4D2NA 5BVPL 5I74C 1ES0A 1SEBB 2ICEC 4PJAB 3L5IA 4HLEA 1AMXA 3R4RA 2HSIA 5J8OA 5FO8A 4YHZL 4LPVA 4J8RB 4XMKH 3T4AB 1TQWA 4NC1E 4ZPTA 3MFFB 4IKNA 3AABA 2BXYA 5GISL 3LHPL 3QCVL 4BSWA 4RZCB 5GHWH 3T6XA 4E9XA 2OMVB 3QUKA 3L1OH 4AK1A 1XGYL 2WYZA 4KY1L 4YDKH 4PU2A 2OJZH 3F12B 4YSSA 1DJIA 3WFBL 5E0FA 2CHWA 3ISWA 5K9QG 2UZXB 1NM9A 1THCA 4JFEA 3K46A 1YN6A 3BVXA 3WELA 3QJVB 1TYUA 2PMZA 4ZYKB 3NYKA 3WN5B 2BNUB 1MHEA 1OK8A 3FO0L 3MLVH 1RSYA 3QG7L 4JVPA 4FFZL 3ZHLA 1WYJA 2FB4L 5IBUB 1U8CA 1RZJC 1D5MA 1YEDB 1BSIA 3NSJA 4Q9BA 3JURA 4KK6D 4NAQA 4TVPE 1I9RH 1QBMH 3V4PH 1E65A 2IH1B 4UMSA 4TSAH 4OD2A 3D9AL 4KX8A 2X1XR 2I9LA 1N7MH 5EOTA 4FZEH 2EDWA 4OM1H 1EEYB 1X7SA 2Q8AL 4U31A 2FECL 4GI8A 3QHZL 4J3UA 2HLEB 3SO3C 1JGDB 2DDQL 2VW4A 5A16B 3GLDA 1F86A 5F3HB 5E6IA 4YELA 4BH7B 4FYQA 2NT6A 4J39A 3BH8A 1K5NB 3CH1A 3VFOA 2VERN 4B3VA 3CZFA 5CEXA 3EFDH 4L1SA 5B1CA 1I9JH 3SDXF 3NOIA 2G3ZA 1PBYA 1WO2A 2ATKB 1PD1A 2YLKA 1SLWA 2PTUA 1RPKA 3D5OF 4Y1AE 4W9KC 2ZPKL 4JPWH 5E8EA 5EOCJ 1NAMH 1RCYA 1E4XL 2E6JA 4Q0XH 1E6OH 4KK6C 3CAFA 25C8H 3CFMA 4KDVA 5DEGB 5GGVL 6PCYA 2R69L 1A7QL 3BZ4B 3HAEH 3IAPA 4AXWA 5DK2A 1UZ6F 1HH6A 4B27A 2OYPA 2QTVA 3L4UA 1QSEA 5JQ6L 4Y4HB 1K5WA 5DHYA 3X12A 5EZLA 1NICA 2RH0A 4JCWA 1A6VH 3VD5A 4L9LB 1EAJA 4YC2C 1WDAA 2XVBA 4U33A 3QAZC 2AQ1A 3QRLA 4HU2A 2LFEA 2XA8L 5C0BB 2JIXB 3CE1A 3OSVA 2ROXA 4N2BA 3HMXA 3IXTB 5JXEC 1CU4H 3CCHA 3GKWL 4P59L 4JFDD 2IDQA 2MHAA 2YD0A 4M7LL 4UQIM 3IDMB 4JUSA 3PIQB 4OKVB 4XHJC 3MREB 5HHOA 1T66D 2ZOWA 1NSNL 2VDQB 3NJNA 4MD4B 3CFDB 4FLHA 4JPKH 5CSGA 1HQRB 3OJ2C 4JFZH 5CIPB 3LPOA 4QRUA 1Z5HA 4RH4A 3ULAB 3D4YA 4IBQA 5ES4B 2VM3A 5LCVH 3T2LA 1I7ZA 5F0PB 2VXQA 5DK0B 3IK2A 3TT1H 4Y5YB 1SMDA 2DLIA 4EOWH 3EDKA 3OTTA 4J3BA 4CVUA 4LSRH 4EZJA 2VGLM 3LIZH 5J4MA 5C2BL 1CMOA 1ADQA 3OR6B 1C7TA 2JVUA 4ONOA 4OCSH 3ZZ1A 3GS7A 1O75A 1N7ML 2DYSB 3F62A 1BYOA 2P28B 4TSAL 3P77A 4YSPA 1PF3A 2UWEF 3SY6A 4L8BA 2J6EL 4OJDH 3QDJB 1R17A 5AOLA 2X42A 4ZMNA 3K6OA 1EA0A 4GQQA 3ARDC 5HI3C 4Z5RB 1CUOA 3G04B 3QG7H 1ADQH 3WDJA 4QYOA 4RX4D 2OI9B 2W92A 4MDIB 3MRLB 4GSDH 2VMFA 1P7QB 3H2QA 4FGMA 3QYMA 1MWAA 4WHCA 1UCBH 2ZSVB 1IBGH 2DI9A 3QHTC 4Y4KD 5CP7A 5AOZA 2A9MH 3AXLA 2ZYHA 3RWJB 4MNQB 2C9AA 5D8JH 4UMGA 1FO0B 4Z7VF 1QFOA 1Z9OA 2C9RA 4KK5C 1D5IH 1G6RH 1OTUD 1T1ZA 4MNGA 4OT1H 2OJZL 5D7LB 4PRPB 4IGBA 4R6UA 5I8CA 5IR1A 2EVIA 1XSJA 5ERWB 4UB0L 5F9OL 2OL3L 2CDFB 2CO7A 3O3AA 4QTIL 1MI5B 1N18A 3FU7B 1MNUL 5GSRA 3BFQG 4QXGL 2ZIDA 3TBVB 2VQUA 2BVOA 1WCQA 5H35A 1NL0L 2PPCA 1XH1A 2A77H 5D7IA 4J28A 2EDKA 2JLLA 4L4TB 4MJIB 2VAJA 1IEBA 4WHDA 2VFNA 1H80A 3Q06A 4ODSL 4BH8A 1L7TH 1X9LA 4MAYA 5LWYL 2C26A 1MJJB 2VR6A 4XCFH 4YBLB 3GIZL 3L6FB 1IVLA 3IBEA 2YAMA 5FW7A 3VE0A 3AACA 3O3BA 4QT5A 5IF0B 4KO6A 1BZEA 2X6YA 1AS6A 3S8FB 1ZS8B 1S7RB 1NDGB 2IIJA 4JGUA 4WGWB 1IGJA 1I75A 3BWUF 3VXRE 3FK3A 4KK9D 4ENZA 2OKMA 3O8XB 2VLMD 5BS0A 1AHWC 3WE6A 2IQ9L 4HWBA 3VQ2C 5JIPA 4UZGA 1U95B 3ENEA 1RZIA 3IJYB 2R2EA 5J1TC 1OB0A 3S48A 5KS9E 2Y7LA 3LRLA 4UQEA 4Q6YA 3GQAA 1BIIA 3L95A 3FQNA 2R2HB 3JBG7 4GG6F 4AYGA 3F7RA 5JPMC 3TV3L 1SM3L 3OPUA 5D2NA 3LKOB 1MHPL 3F2LA 1M7IB 5D4HA 3V2AR 4I77L 1NCAL 2VSMB 4CMMB 3CVCA 1OEZW 1L9RA 3ATBA 3NCMA 1KCSH 4DVRH 1BXXA 2HRPH 3V4UL 2Z93A 3WHXB 1JNNH 4DKAA 1YYMH 4XL9A 1YN6B 5EB9A 4G9FA 1LDSA 3FCUB 1E28B 1TQUA 3KZ8A 2OJ1A 2J20A 4DNLA 4FXGB 2TAAA 2RR3A 2BNUA 5DUPH 4R0LA 2JI2A 5D93C 3T0EA 1ECZA 1RHHA 5GGSB 2X89A 4DQAA 2X2IA 3ISRA 1PLGH 3QIUA 4PWGA 4U1IB 1QSFD 1QFUH 2F19H 4KUCD 4P2QD 1LLWA 1QJVA 4V1DA 15C8L 2DKUA 1ZANH 4YQXH 2LGNA 1FBIH 4NENA 4XMZA 1NDTA 2F8OA 2Z7YA 4M6ML 1GS8A 4M5ZH 3DJSA 2A9CA 3DMMC 3ETBF 4E36A 2G5RA 1OAZL 4F37K 1NUNB 3UPRB 2APWA 1RZKH 3RDTB 2CJUH 1W2KT 3U1SL 1A6TB 2X2JA 3P54A 2DM4A 2R29L 4P57A 1ZK9A 1S7XB 3LNGA 3L3HB 3P0YL 4UT6L 3VXPA 3U2SA 4GBXC 5GRJL 3V5KB 1YN7B 2BSRA 3PQYB 3VMVA 1WBXA 4JY6A 3MLWH 4YSAA 3LJYA 2R2BB 4BQ8A 3AQZA 1O88A 2BRRH 2DEXX 3LZRA 4MDRA 5FDYA 3T9WA 3QI9C 4Y5XB 4GOSA 5F44A 5BNXD 1KMGA 1XR8B 1GW0A 3UCRA 3CSTA 3VD4A 5HDRA 4JDZA 2NLJA 3IU4H 3B43A 3PWLA 1M2OA 2I5YH 43CAA 3N91A 2YD1A 4F8NA 3LH2H 2CDEB 2OI9C 2UWEB 3DRTA 3UYRL 2VDPH 4ADGA 3Q6GL 5C92A 1ML0A 5KYYB 2YEVB 1HE8A 5BO0D 3BUIA 4K71C 4OCRL 1DJYA 3MTXA 2WMPB 5GJSL 2JIXA 4L1LA 1GZHC 2OR7A 4PWHA 5ESAB 4JL2A 4BZ2A 2IOUG 4FQCH 5K9KA 2YKKA 2EIMB 4J1UB 5HJ3A 2CO1A 4LL1A 1KBVA 4I3RH 5G4MA 3PIQA 1IO4C 1HNGA 4XVOA 4Q9QH 3ZZSA 3KNBA 2P47B 3QXUA 3CFEB 5DYFA 1N0XL 2RAMA 1M53A 4TLKA 2LAAA 4DPRA 4ETYA 5GZNA 1QVOA 2E9GA 4UNTA 1HQRA 2F58H 5I76A 2DKSA 1U9KA 4FQ1H 5IP4A 3TTYA 5EORH 2OYKA 2DLEA 4H8WH 5CMAB 2WLIB 4IRJD 2GJZA 1OOCA 1P7BA 2NTFA 4OJFH 1CE1L 2BOLA 4PREA 1C5CH 2CRYA 1H3XA 3BIKA 5JW4Q 4LSVH 4GBXD 5HI5D 4HIIB 1BG1A 3U79A 2YQGA 4OZFH 3ZHKA 3VFTB 1PZCA 3IF1B 2P5WA 3X3FH 1S8DB 3V0AC 1DBAH 2YXWA 2Z31D 4M8QB 4OM0H 4MA7H 2DQCL 3GI9H 2WLNA 1NQBA 2PW1A 4EI5B 2HPOA 2O26U 3D7PA 4F8QA 1KLFA 4M5YH 4IK7A 4QRRE 1OARH 4Z7UB 5E0QA 2DQUH 4BEIA 3SDAD 1UA7A 3BRDA 3HHRB 4GG6B 1JF6A 5TDPB 5KSAD 3L5HA 5DJCB 2X38A 5FWQA 1M3JA 3L1FA 4P2RE 2Z64C 5T3ZH 1RZ7L 1VRSA 1PYWA 2J1XA 3DVNA 1GGYA 1NUGA 4B9YA 2IPKB 4YDTA 5GS0C 1J1PL 1W72L 1HNYA 3SHSA 3QUMA 1BVLA 1QRNB 1VFBA 2WW8A 2YD8A 2G5BA 1DCLA 4L4JA 4IBWA 5BXFA 1HI6A 2DS4A 2E9BA 4Q6IA 5CZKA 3HI5L 5DZ9A 2KZWA 3F6LA 3MUHL 1FLRH 4OLXL 4XHQA 4QRQA 1ACXA 1R19A 4HD9A 5AAMA 1RP8A 3VMOA 1Q9WA 4K3JH 1BYPA 4WRLA 2Y7QB 4XP4L 2R56L 1IEBB 2OULB 4HH9B 4PWFA 2PLTA 1NAKL 2HT2D 4WGKA 5EV7A 3QQ4B 4MWFA 3C75A 1PTZA 3SGJC 4L2YA 1XDTT 3QNXA 4Y7MA 2QQLH 1AZVA 2W9DH 2WSKA 1BAFH 1I1YA 1RVFH 1WICA 2N1KA 3GQFA 3MNWB 2VFPA 4JQXA 1VSCA 4TVUA 3FPYA 3LB6D 3D2UD 4NNXA 1M7XA 4JKKA 5EC1A 2BSBA 3QSKB 3DKHA 1KFAH 4ZO6A 5FHBH 1NBYB 2B0RA 5AB1A 4JR9H 5AW2B 3WIIH 4BZ1L 1BFOA 3FN3A 1ET8A 2R0KH 4HBCL 4U3SA 2CUHA 3IJYA 1IAII 1UWYA 4LCCB 5EEYA 5TTRA 2YPLE 2O1AA 1WITA 3EOAA 3FB6B 3TC9A 1FNGA 32C2A 1LD9B 1HXYB 5EEVA 1NLBH 43C9A 5EBWA 3MJ8A 4H25B 2ZAGA 1CI3M 4JFXB 4UIKL 2EP6A 1FAKT 1MCRA 3H0TB 3KEHA 3KPLA 1VKXA 3HZYA 3EOTL 3P3SA 1RERA 1BQRA 2NYYD 5EZOL 2NYYC 4LSUL 2DBJA 5IMMB 3LZOA 3SQBB 4AGNA 2NSPA 3QPXH 4I2XA 3CXHJ 4LNVA 1CS6A 3HNVH 5TE4H 5DD3L 2VLRE 3ML8A 5SWZE 2HLFD 3WKYA 1UJ3C 5C9JB 3QO0B 4GFXA 2ITFA 2QHRL 1CXKA 2FQGA 4U1KA 4WEBL 5C0AA 1UXWA 1NWOA 3MBEC 3M1CA 3RZWA 5EIIB 1KWKA 1XMEB 4ODUB 1OGTA 2VQTA 1IJNA 4M7LT 1CBJA 4IBLT 4QOKE 1KCWA 2OP4H 5EZJB 5KS9F 4OTXH 2VRQA 4Y9GA 3ZDXF 8PAZA 1BDYA 4TM9A 3TCXA 2JB5H 3QH3B 2X9ZA 1JZDC 2OQJA 1INQA 5EU6E 5F0JB 1OTUC 1XGPB 3TO4B 2VN3A 4ZNCD 3OKMA 1GPOL 2WD0A 2WIMA 2DL9A 1W80A 5B3NA 4LGPB 4PJAA 4Q7DA 3W11C 4EKXA 1E5ZA 2Y07H 4RRPA 4XBEL 5B21A 3SQOL 3GYRA 4QEGA 1QP1A 4PHZA 4Q56A 3KH4A 5TFSL 3ZYZA 1IGFH 5AOIA 4CA4A 2AQSA 3O41A 3MMEA 3GC3A 2VW6A 4YXHL 1K72A 1DP0A 1UWGH 1PDKA 1UATA 4LSVL 3SD2A 3V4VA 4FFYH 2DLGA 4B53A 2DL2A 2Q7NA 3UTSE 4H8WL 1BVNP 5FA3A 4NQTA 5DHDA 3U46A 4D0DA 5E08L 2P8MA 5ILTL 5F1IB 2D4FA 5DZOA 1AO7E 3KWXA 2AJYH 3IJ8A 3D85B 4YHNA 1BZ9B 3BVUA 4JRYA 3GJFA 1A1OB 4XM3A 4X2UA 2GT9B 5KSBB 1KWGA 4ZS7L 3ZIYA 3HC2A 2MOQA 4A7GA 2KERA 3HVDA 1WZMA 5BZWA 3SDDA 5ID0B 1IGCH 1SY6L 3MNZA 5DMIH 2RA1A 2QY1A 4ZTPL 1FNFA 5FYJD 2F54D 4LPWA 5AOKA 4FP8L 4QHUA 5D5MA 3JT0A 3Q3GB 4K94H 3HPLB 1HXMB 5DU7A 4RGNE 1DSFL 2QQNH 1FGVH 2ZAIA 5CSZB 1D2OA 1JVKA 3BIAX 4JKWA 4MD0A 2Q6WB 3HE7A 3KBPA 4PJXE 2A6DA 3IU4L 4J27A 4OF5A 3T0WA 5EIQA 3WFZA 2HT4D 1JPTH 1T20A 5C0DB 1J05B 2NCEA 4DIXA 1OSPL 2WBJA 5DWPA 3ILQC 3O9WD 2GVYA 3L4TA 4HJJH 4J6RH 4OZ4B 4YEIA 4GAYA 3PETA 3KL5A 1JWSB 3W9EA 4NN6C 4I3SL 2FQEA 4QCIA 1AJ7H 2H41A 4K7PX 2GIMA 2VISA 3EHBB 4WO4B 3ROOA 4HU8A 5AOJA 1O9WA 1ZLEA 3J2PA 4R7VA 4XCNB 5E2TH 5MEOA 3OAZH 3WXVH 2DLTA 1ZT1B 2WLYA 2P80D 1INEH 1BLNA 4PJEF 2OSYA 1HH6B 3ALWA 1D6VL 3NSFA 4ODVL 5L0QB 3JVGA 3RLSA 4PIBA 5LXGL 3GSQA 1G94A 3OKLA 2NX5E 1W0WB 3KPMA 2G2NA 5H94A 2YWYA 3NN8B 4LCYB 2NXZB 3FTXA 2W07A 4FG4A 4YZWA 4S1RH 1NEZG 1UHVA 3ZQ9A 2PYFB 1ZLSH 5H37H 2NZ9D 2J4WL 4K2UL 2OCFD 3IDNA 1QFWI 1Y0LB 2ITCB 3QNYA 3ZHNA 4E68A 2YUZA 3PV6B 1UZ8A 2FK9A 3EYOA 4NNYB 4FQJL 4UQBA 5I1HH 5I0YA 2Y5TA 3V5HA 1XSKA 4A63A 5MHSE 1NC4B 3W0WA 1TYEB 3LPWA 4X6CA 4O58H 4ZZFA 3A6OA 4TLSA 4JS7A 2F1BA 5K39B 3CVIH 1YC7A 2CA4A 3NJKA 3Q5YA 1YEDA 2CWRA 5C6TL 3ROLB 4KH9A 3NJIA 2E59A 2BNQB 4JK0D 1Q9OB 2B1HL 4PBDA 1PSKH 5AW9B 4S0SD 3MXWH 4GB9A 1H8SA 1UWGL 3IETA 3KPSA 3HR5A 1MCEA 3D0VB 4OJ6A 4UILL 4YLBA 4KU1A 2QQKH 4G83A 1YEEH 1J8SA 2EC8A 4U6VL 4I5BA 1BW8A 5EOQH 3D8MA 4KXCA 2P42B 5TD4A 1PXZA 2WKOF 2Y07L 3PAYA 5J6HA 3WWGA 1QEWB 5AVZB 1RLWA 5ESVB 1YJDH 4ZX6A 3SDDD 2DLFL 1N59B 3OXSA 5IVXB 3TLRA 4JHVA 1QTYT 3WLWC 2VFMA 4BYHA 5GS1A 1AGFB 1V7NH 3FYIB 2XX1A 3JX8A 3HRZC 4OD3L 3HHSA 4N0CC 3PWPE 3UIZA 5ERWA 4Y1SA 2PCFB 2X5PA 3VU1A 1V5JA 2OSXA 2YSTA 1D9KB 1U8HA 4ODUA 4YNYA 1HKLL 4IGBD 1AG6A 2KMWA 5H35B 4MA3A 2VM9A 5BV7C 3TFBA 2IADB 4JHBA 4MYWB 3ETBJ 4GRWE 3KHQA 1OFLA 3SZKC 1G9ML 5DJ6A 3ZE1B 4DGUA 1YPZA 2F3LA 4XB3A 4JNXA 2BRQA 3QH3A 5A2BA 3QC5X 1K3IA 2Q9OA 4XCYB 2MRYA 2VWEC 1WT5A 2J73A 3VXRD 4JHAH 3QORC 2XYBA 1G7IB 4WTZG 5E4IA 5A2JH 4YL9A 3O2WH 3CHPA 3ZUNC 5HJBA 3EO9H 4P4KC 3X2QB 4XPGH 1I7ZB 4FTDA 4M00A 4HXBH 5DK0A 5BRQA 1QNZL 4TV3A 5T5FA 1TZHB 5D2LB 3GSOA 4GNKB 3DYPA 3IMSA 3WFDL 2GTZA 4NKMA 1WTLA 1ADWA 1OQOA 3ZHFA 2IH3A 4WO4C 1KCUH 4WQOA 3E80A 3WIHH 4B7LA 5KN5A 4C54A 4XAWL 5A3ID 4JO4H 1SDYA 5CGTA 1LMKA 3OR7A 4HUCA 2JI1A 1L6XA 1J8HB 2WQAA 4GG8B 1A1MB 3U36A 3TO2B 5KVEE 1AD9A 3QIBB 4H2AA 4QWWD 1F4HA 3D07A 3QNFA 4QOKA 4X5QA 3S96B 4E0RB 1RIVL 1N8ZB 2MCG1 4DVBB 3KPRB 5CBAB 5ISZA 3MPCA 3K74B 2GI7A 2Q76B 2NXZC 4Z9KB 1JPFA 1UH4A 5IQ9A 5C0AE 2ZSVA 1M1XB 1UGKA 3DURB 5DFWH 2X2YA 3UERA 2GIYA 3GHEH 2G9HA 3IWVA 2XA8H 5C08E 5J06A 4RGMC 1BOYA 3B9KD 1KCKA 1U4FA 5I24A 4XMWA 3VI4F 3APCA 2JTDA 1JHLL 4TTGA 5JDJA 5I6NA 4URRA 2M1KA 2JCCF 3DXAD 2FZ3A 3QFGA 4WU5A 2R69H 2DYPB 4L1TA 4GW5B 4YXKH 4E41A 5LDUA 1BA9A 1WD8A 3T6WA 5JHDE 3C09B 1PY0A 1WBYB 2RGSA 1K8DB 4WI8A 3PJSA 3L9EA 3QULB 4WI5A 2B0SL 1QYGL 1NCBH 1YN7A 3PQYA 1WFOA 4JE4B 2GBAA 2CR0A 3PDOA 2L04A 2R1YA 2XC1A 4PGDB 3KVDD 3GI9L 4RMVA 3QJFB 3E2HC 2NR6A 3QDMA 4JRXA 4YPGA 1QWNA 2C9XA 1CICC 5I5RA 1USQA 4JMNA 3UG3A 5HYEA 2E8ZA 4MLSA 1L6PA 5F9WC 1WWAX 5LBSL 1EJFA 1BQHG 4JPSA 5CINL 4BELD 2R2EB 3GSQB 3QI9D 3H9YA 4PW4A 1BJ1H 1I9RL 1KPUA 4F24A 4IRZH 1QOKA 1AR1D 3QWOA 4KDTA 5HHXH 3BUBA 3WY4A 3T08A 1JYNA 4HC1L 3MHZA 5CJ8A 4ODTH 4I13B 5D7JD 5I28A 1FV1A 5EU5A 3F64A 2Q1EA 4F2EA 5AAWA 4XGZA 3RUGF 4UNIA 1DBKH 5C09B 3WJLA 1XZ0B 4DAGH 3BZ4A 2DQEH 1SQMA 2HKHH 2Z93B 3OX8B 2VFOA 1JRHI 1N5AA 1HHKB 3KLAA 1I8LC 1TT6A 4ONGL 5FS5A 3HMWH 4NBYB 3ECVA 4ZDHA 5DQ9A 1XB6A 2YIHA 1CCZA 1E9PB 3UBGA 2MSPA 4HFUH 5I18H 5MP6H 2OMXA 5L88H 4GQRA 1RHHB 5I15L 1MWOA 2C9PA 5SX4H 1AR2A 2APSA 1ODUA 2V7NA 3A4EA 3ROLA 5AW0B 3VXSD 5I30H 3WEAA 1O8GA 2F7PA 1EAOA 4XZUB 4AGMA 2QMJA 3UFIA 4MD5B 4TS6A 3PGDB 2CSPA 1KCBA 4TN9A 1Q9KB 1WFNA 3DVIA 4OKVA 3EYFB 3TBSB 2FR4A 2GSIB 1QRCA 2O6DA 2VR3A 4WJ5A 3VWKC 3NIFB 1T4KB 4YHZH 5J12C 4EI5A 2MH4A 1PZ3A 3GMNB 1A2YA 2A0LC 1LWHA 2NNFA 1P4BL 1AD0A 2OMZB 4HAFA 4NRYB 4W9LC 4M6OH 1AQHA 4XNDA 1L1IA 1Y1DA 4NI3A 5J6HB 2CLRA 1CGXA 4XLEA 3QUYA 3AFLA 4X6FB 3F7VA 2WZ0A 3VAEA 3S36L 2NNCA 4LHUA 2XJLA 3ABZA 1ZVYA 3EBGA 1N59A 4KDTC 1I53A 5TF1H 2HUHA 5CZXC 5IVXA 3FTVA 4KKNA 5AW5B 3OGOE 1K5CA 1TTCA 5AVVB 3UPAA 1AE6L 2CNYA 4ZI8A 1MCWW 1PE9A 1U8QA 2OYMA 2ZF9A 3DTXA 3QUHA 4J4PC 4IGBC 1HDMB 3NFNA 1O8KA 2AZAA 5CN2A 3ZXAC 1RJYA 5HBBA 2NLJB 3QIUD 4KHXL 4R7DA 1J12A 4LCWE 2WXMA 1R1CA 2OMWB 4OI7A 4IEFA 4MQXD 5ADPH 2PWFA 3HHMA 2O5ZL 4MMXB 1KDIA 5F93C 1U93B 1HIML 5B4MC 4G1EB 3MYJA 2EACA 3LKPB 4U6XA 1KTWA 5E5RB 4IOFC 4GW1B 1L9MA 1ZHLA 5SWQA 1J5CA 1LDPL 3H9HB 3OAZK 1X0CA 4DH2A 2Z9TA 3DV4B 3WIHA 4Z8FH 5F6HJ 1OP4A 1JHTA 2JKJA 4J8RA 4NZUH 3RL2A 4WJG3 5E1IA 3T0AA 5JW4R 4LBEA 1PZUB 3AROA 3MNWA 4OZIA 3BP6A 3DJ9A 3QEQD 2XOTA 3LXAA 1T6VN 4L3ED 4NDMA 4XNZB 3ZK0A 2JCCA 2W94A 2VMCA 3CZLA 1IIKA 3P69A 2ODLA 1Z6JT 1LE9B 2ZUUA 4GH7B 1BFOB 3BSZA 4IJ3B 5AG8A 3RY6A 4BQBA 2EIZB 4PJHA 3BZEB 4ACTA 4A6YL 4XH2B 3CMOL 4UOW1 2NXYB 4S1DC 3VVWA 3SCMC 1DQIA 4O4YL 4OLYH 3VI4B 4JMXA 2NOYA 2FL5A 2X89D 1NBVL 4K23H 5HYIA 4MCYB 3DOHA 2IDTA 4NGHL 3MBED 1QA9A 2ZOTA 4CILA 4L8SA 1XBRA 2D7TL 5I1AA 3NFSL 4KXDA 4EUPG 3QRGH 3TJEH 2GB2A 2KLTA 2VLLA 4JZJB 4R4BA 35C8H 4U6HB 1KSRA 1U8CB 4ANKA 1D5MB 4KFZC 3WFCH 5DJCA 1HC1A 1L9TA 5KEZA 1C08B 4UT9L 3GQ7A 5GS2H 1NFDE 2IVFC 2DN7A 3HW7A 4N2LA 3N1QC 3N85L 5I66B 4I87A 6PAZA 4RA0C 2RD0A 4PS7A 1E6JL 1OGTB 1F1AA 5I9QB 1NUDA 1JF5A 4QXWA 3M1BA 5BXFB 2ZCLL 3UO1L 4YZFF 2WQRA 5LG1A 1XSOA 4FXKA 1RP9A 3ARSA 3S2CA 3MRIA 4HFUL 2IGFH 3SE9H 4CMMA 1OB1A 1O6SA 1U8NB 4F7EB 2YHGA 4N9OB 4KVNL 3DVGB 3QQ9D 4KMTL 3TJHD 4RGNC 1E28A 4OCMC 3TZVD 1KT2A 2YPLA 3FBQA 4G71B 4FNLL 2IXQA 1HL9A 4U7MA 2VZ1A 2X4TA 5TDOA 2H2SC 4JLRB 1PU0A 4MQTB 5KZCD 2E7LC 5EWIH 1NPNA 1SRDA 1KBGH 4F8PA 2VDMH 1V7MH 1GYVA 2F74A 2UY7B 3CZKA 2J6EH 5HVFB 3SJVB 3EF4A 3HA0A 3UZEA 4HS3B 1MVUB 3TF4A 2VDRH 1FL3A 3US0A 1QR1B 3D39B 1WPCA 2G2RB 3ET9F 2ESVB 3LIZL 3FRPA 1MRDL 4N86A 3K3QA 4IBZA 4DERA 1MFBH 2XN2A 2OZNA 3U46B 5C0JA 1E2ZA 1XF5A 2E9JA 4GSXA 4W4NA 5I1JL 3WAJA 5CIPH 1BQUA 2OW6A 3L3HA 3E3QC 1KLGB 4XMPH 1EZGA 1MUJB 5DLML 1U8LB 3NIFF 5AAPA 2FUQA 3NJMA 3G5VB 3HN5A 5FYLD 3RWDA 5DMGC 3F7YA 3HUJE 4LHJB 2ZWKA 4D9RE 2BSSA 3LZFL 1IARB 2XTJB 3QVAA 4PJBF 2R39A 4Y5XA 4M7LH 1QI4A 4XGZB 2WBKA 1XZ0A 5IJKC 3GDBA 3MRQA 3EYSH 2XVLA 2WKLA 5DQ9B 4JFDE 1ORQB 3TX4A 1WAPA 3CX5K 4OV5A 3AMKA 3FRPG 1B2WH 4P4KD 3KLHD 3U0TB 5LGYA 1X5KA 3BW9B 3PG2A 3DX6A 4JUTA 4PJGB 2BY1A 4PRAB 4WTQA 3GD1C 1NIFA 1YPZF 3LPFA 2WBJB 3WTTA 1D5ZB 2WVUA 2IBZY 2X4QA 3JV6A 4F5CE 5GGVH 4OZGB 3PP3K 4QY8B 1JVLA 3WJMA 1Q9KA 3VCLB 2YN3A 3OD3A 1KTLB 1R24A 1S9VA 4Y5VC 4G7QB 4EPSA 3GI8L 2CM5A 3EKCA 1A7RH 2XBDA 4O2FA 3E6HB 1KTJA 4PUBH 2LVEA 5HTSA 1QA1A 1OXYA 3LMJL 4NN7B 1K4CA 3CFIC 4FNSA 2H47C 4GKNB 1TLKA 4DN3L 1HS6A 2P45B 4ELMB 3DMMB 4JHZA 3BRGC 2RCSH 3SIKA 4HK3J 4EI5D 2BNRA 2NXYC 4DN4H 3N1MC 3E3QE 1G4RA 3ESPA 4KKCD 3PNRB 4K3GA 2Y25A 3T77A 1P2CB 1OE2A 4Z7OF 3ZE2F 4LSTH 3RYMA 3DDFA 1FVDB 3HG1A 4FC3E 2I25N 1QG3A 3VI3F 1CN4A 3EO9L 4XWGH 3RNKA 1DZ0A 2WBJD 2UY6A 2YUHA 5G4NA 3CFKA 1ETJA 1D6EB 3NJGA 4IRJB 5B4MD 5F9AC 1MDTA 2E4FA 3ARFB 3GGWA 3ZL1A 1IBZA 3C08H 1UZ8B 3TTSA 5KSVB 1UM4L 3PWVB 4XLHA 3DUUB 3EDJA 5DFVC 4OCYL 2NMSA 4NNYA 4XPAL 3BGMA 4G82A 4EUPA 4S1SH 3DARA 3Q2WA 3ZOAA 4WWOA 3D30A 2C4FU 3DPBA 2X4NB 4PJDA 5I9QC 2AKRA 4KH2A 1FNSH 4GW1A 3C12A 3IGUA 2X12A 1RJZB 4ZTEA 4DKFH 2UZYB 5IFJA 1CQYA 2IANE 3VWJD 3EGXA 3DUSB 1HWWA 4PGBB 2V2WB 1FHNA 1KV3A 4G8GA 1E90A 4XPBL 2XBTA 4KY1H 4PTUA 5L4FA 3KE0A 5FK9B 1RWRA 1L0XA 1HU8A 1A14H 1BIIB 3LJ3A 4P04A 4J3TA 2Q6WA 4HZLA 2QQQA 4JPQA 4NN5C 3LHPH 2DJ4A 1HEHC 5FM5O 4GPVA 3NCBB 3U9PL 2YD6A 3ZZQA 1FE8H 1OSZA 4JJHA 4XVSL 4DF9A 2AMUA 4FZ8H 5ALBL 5JIKA 4HZ1A 3P2BA 2EIZA 4PJHB 5D7IF 4XOTA 5DRZA 3B8YA 3I6LD 2ESVD 1A7PH 5HGDB 4PVMA 2CHZA 3QQ4A 4MWFB 3WIFB 3ZL4H 5J1AB 4ICWA 3UC0H 4NJAL 3NZSA 1JWSA 1CFQB 2D8KA 2PO6A 4NC0B 4H88H 5FYLL 4QCIB 1I1YB 4DGVH 4MQSB 1OT2A 2AERT 5IMLA 5DJ8B 1SMAA 1OAUH 4TUKH 2ZE0A 4LL9A 4YE0A 3RWCB 4U1IA 5JYLA 2K45A 1UWXH 1F3JB 4NK6A 4Y19E 4ZNEE 5JHLA 4E9SA 3H7BA 4HOMA 2Y3NA 2YSSB 3DSNB 3L5XL 4Q2ZB 3RDTD 4AQ1B 1X5AA 4RAUB 1XV8A 5DF0A 3B6SA 2K6WA 3F01A 4PY8J 2ZWNA 2A74C 5D1QA 3TA3D 1DVFB 1YO4A 5EO9B 2YZ8A 3ECUA 5IBLD 1OM3L 2VJIA 3DV6B 4XVUD 4IMKC 1Z32X 1IV8A 4PY7A 1H0DA 1F58H 4N5UA 2XT1B 4ZXBD 1ND0B 1GCFA 3BWSA 3HKFA 3V52L 3E6FA 3MLSL 5KVEH 5MI0B 4AEIH 4Z3HA 1HJBC 4GS7B 4YFLF 1INDL 3QDMD 4L4VB 4DGVL 5HYFA 3EG9B 3EJYD 3FAXA 1UURA 1XF2B 1BHGA 4FQLH 3KBHE 4OFYA 1CT8A 1O7DC 4APQA 1FC1A 4NJAH 1KBBA 3MBXH 2BZ7A 5EO1A 1SYSA 2A6IB 3UTTA 3ZL4L 4B5ZA 2CAKA 2WNXA 4QTHA 5E23A 4EDWL 1XZWA 3NEEA 1DQMH 3CBJB 1RD6A 1WS7A 3N43F 2WLHA 5DHVA 4AEHL 2FJFB 4C2LA 4POYA 2QADD 4WWKC 5KOVC 3ASWA 3QIWD 1BQLH 1JCVA 3P3UA 1FL3B 2WLMA 2J1WA 5HYSA 1JP5A 1YEKH 2IPTL 2OTWB 3FUHA 4PJ5A 3OKMB 3DVFA 2J8IA 1T66C 4XHJD 1XG2A 3RJDA 1HOCA 3TT3L 4UQCA 2ICWI 1U91A 4LLMA 5F7BA 3SBRA 3BXNA 2YPKA 3B9KA 1U3HC 3TO4D 1AJ7L 3JV4B 3LN5A 2EDOA 3O4LD 4F3FB 3FUEA 3QEQB 3C9NA 3RVUC 4WUUE 1UM5L 3RWDB 5GXBB 3NESA 1KV7A 2VXSH 1FZOB 5CU9A 3QCTH 3TA3C 3VG0H 2DH2A 4YHKH 4KTYA 5IB2A 1YVLA 3UDWA 4HETA 2BSEA 3WHE0 3C6LC 3UJIH 4FKEA 1CLWA 1YEJH 1VGEL 3VI3A 1D5XA 3LS4L 4LHUG 2BVPB 4UBDC 3EYUH 4WUKH 1ZGLB 1KIPA 2EH7L 3AS2A 4N8VG 3K71A 2XWZA 4L4TD 2YMXL 3GEWB 3N6ZA 1XGRB 4KQ4H 1NMAL 5F9JA 3GF8A 4WU7B 1NFAA 4XWGL 1WGOA 1FFTB 2BVEA 1S8DA 3PFUA 3RIAF 2GT9A 1BZDA 1I8IB 4YSCA 3F83A 3EDEA 5AENA 5HHNA 3FUDA 5CLZA 5JOPD 2QZQA 4B9PA 4W9IC 1T22A 4PJ7B 1MQKL 4LLVB 4HEPA 5FGRA 4WW2F 4YZ0A 1FAIH 1LWJA 5DRXB 2HTKD 3DX9A 4QF1A 1H3TA 2D0FA 4KXZI 1P9MC 1YUHB 4LCWD 4N90D 2GJPA 1L0QA 2ARJA 4MJ5A 5H8DA 4DO5A 5KW9H 2AJSL 3DHMA 2BIHA 4N2MA 4Q4IA 3ZKND 3RB5A 4AK2A 4X50A 3P2DA 4I0PB 1XF3A 1Z9PA 1MPAL 4GKNA 4PJ8A 2NT9A 2I32A 4Z7NB 3OB8A 4HW6A 4XP9L 5B3JF 5K59E 1Q94A 3TEYA 4QXUH 4IOIA 1EDQA 5DT1L 2VZ3A 4JFFA 2M83A 4OR1A 4HC1A 4OF7A 1XAKA 5BZXA 1L5GB 4NJ9L 4MJHA 3BQUD 2VISB 4QHKI 5HVHB 3T0XA 1UWFA 3S35L 1TCRB 3IWUA 5T1JA 1KCCA 3BOVA 1NFKA 3RIQA 1RFDL 1BOGA 4HCRL 4H2CA 4Z3IA 4K5LA 4UTBL 2NNRA 4D3CL 3WTWA 5D72L 4XAKE 3V95A 5DJ0A 2LLNA 1MDAA 1FYHB 5D9SB 1X4YA 2ETWA 1QSEE 4N68A 2EXWD 1M1XA 2W07B 3DURA 1HEJC 3VRJA 2D7QA 5E2UH 1IVTA 4KZEH 3ULUC 1AXTH 1FORH 3IFOB 3PWNB 4Y0GA 3BFOA 3WUWA 3HBPA 4K7PL 3V55A 4UQAA 3OB0H 5I1JH 4TQHA 2VL5B 1T21A 1MELA 2E4TA 3GBMH 4U1GC 3TBWB 5T5NG 1Z3GH 3TF7C 4B7IA 3NABL 1U58A 3IDXH 4OQTL 4F7MB 2BP0B 2GSMB 2XSKA 1ZTMA 1UACL 2HVJA 3BVWA 5JZ7C 3VFMA 4YBHA 3EOTH 3UAFA 4POUB 1G7QB 2BIIA 3FU6A 1JPST 4I2XB 3QYCA 4WHTA 3ARGC 2Z31B 1CTOA 4RBPH 4J4PA 1G4MA 4DGYL 1NLBL 2FWUA 3MV8A 4MA8L 5FKPB 3INUL 5C0CA 1C5BH 2GHZA 4XXWC 5E6YA 2JF1A 1BQHA 3NQKA 3V0VA 5DJ8A 3AG3B 1ZJBA 4KMTH 3LHAA 4E9WA 2MNUA 3OM3B 2RALA 4PQXA 4NXKA 5D1XE 3GT6A 4RMWA 4LLYB 4LNRB 4FX5A 4Z3EA 4WZ9A 1CXLA 3P0VH 5MEPA 2ZCLH 4HIQA 3UO1H 3GPEA 2OQJB 4G80B 4ZW8A 4KVPA 2EIKB 1U8PB 1L6ZA 2LABA 3KWWB 5AL8A 1E4KC 2QGBA 3EUDA 5C0BA 4U49A 2X53A 1BMWA 4F7TB 3NUKA 3ZVVA 4G6JL 5C0EA 3ULVL 5EU5B 5PAZA 2NX5D 4BUQA 5FECA 4K3JL 3NSDA 2DMGA 1TR7A 2OTUB 4LGSB 4U1JB 4S11A 2PKDA 4P2OC 1NDMA 1NIDA 3W9DA 1DO5A 3BKJL 2FH6A 2PR9A 3M8OL 4ONHB 3KS0H 3W1ZA 4O9HH 2C1PB 3ARXA 1MWAH 4K8RC 2XPZA 4KKAC 1FC2D 3STZA 1N70A 1HL8A 4N0YH 5EPMA 5AYQA 3TNMA 3ILPB 1MHHB 5HHME 3SOBH 3K6SA 4M6AA 2WUCL 1DBGA 2P49B 4E5XA 2NW3A 2WQWA 3S5LG 3FQWA 5E5LA 2GSIA 1JS4A 4YHML 1TZGH 3IU3A 2UXTA 3SGDH 3WE1A 2CG9X 1FGNL 3W2DL 3MR9A 2LU5A 4JDVB 4TQ8A 3CDZA 4OM0L 4LIQH 1DSYA 2PN5A 4N8CL 4AMKH 5E4EC 5F7AA 3HUJF 1UG9A 3RGVA 2AV1A 2J2ZB 5JHMA 4DFHA 1E5AA 2A6DB 2NY6C 1R5VA 3T8XB 1QSFB 1U8QB 2AI0H 3TCTA 4CBZA 1UD4A 4ZFGH 2E76C 1NMBL 3QDME 4JGMA 2H4EA 2P8PB 3LEYL 3WKQA 1IAIH 2QDWA 1TNMA 3RUGB 3UJTL 1TQBB 2KQNA 5CILH 3S4SB 5IG7A 1XH2A 3FH7A 1E27A 4IEFB 1H5BB 5AVTB 3L7EA 5KUKA 4DZ8A 5ISZB 1BN8A 2CBTA 1SOXA 5BMFL 1AO7A 4PEEA 5D7IB 3BLKA 3P73A 1YPZE 8FABB 4AMXA 2UVFA 4PRPE 2YAQA 5LN8A 3QQ9C 4FQHB 3TV8A 3GMQB 4RQQA 4WW2A 3S3DB 4M6OL 3U7WH 5D6DC 1MG3C 4QT5B 2XQ0A 3OG4B 3CSPA 4MQ7B 5L6YH 2QPDB 1T0NA 2X4PB 2H26A 1HHGB 2JKNA 3CH8A 4K7PH 1EJ6A 4U3HA 1VLXA 4GO8A 2JCCB 2X1QA 5DVKA 5CCJA 4UCFA 2A73B 4FJYA 5ICYA 4FQ2H 4GW5A 5DFAA 5I8KL 5A2IH 1FL5B 4UDTA 1Q94B 2I60L 2VH5L 1UKSA 4K9EC 2CKBB 5EU6D 5IB4A 4OZIF 5FYLE 4L29A 1B0WA 1PAMA 2IOOA 2L8AA 1AACA 3MLWL 5J1SC 4RAHA 4O00A 5TF0A 5MP6L 3F7YB 3FT2B 4D7PA 3P0YH 3QZWG 3LKRA 2VBKA 2VZSA 4ONGH 3RVTD 4X6DE 4MDJA 2YRPA 4LMQE 4YSTA 3S34H 4U1LA 2VRKA 4GLRH 4QGTA 3KS0J 2R4SH 1T1YA 2CMRH 3RKDD 2EE0A 4MAUL 1XGZA 4S1DD 4DKTA 4L8SC 3BLBA 1R3HA 4GAFB 1YMHA 1ZA6B 1P1VA 3BKML 3RGHA 1MJUL 4BA8A 1ZVHA 2W0PA 3L4XA 4PI2A 2EIJB 4DESA 2EADA 3WY3A 2NY4D 4HCRA 5AZUA 1KELH 3QIBC 1FVCB 4XO8A 3NRPA 4M1DL 2C3VB 2XG4A 3AC0A 2H6OA 4M62H 4TNEA 1QLFA 3IMWA 1TJGH 1I31A 3X1GA 5GRWA 3QHFL 1T1XA 3EJRA 1JGEA 2LU4A 1ZT7B 4DP5X 1BVKB 4Y19A 3ARVA 2JJSC 1AAJA 1KCVH 1BFSA 1E9QB 3FN9A 4UAOB 3MDJA 4XCEB 4JREB 3EOBA 5JW4M 4H8VA 1NBZA 1S2EA 4P48A 4AGQA 4LEBA 3QDGB 4W4OC 2HMIC 1XR9A 4NQDA 4MZ3A 4OI9A 3QR0A 1SBSL 4G43B 1FG9C 2BNRB 3GNML 4R3SB 3VX1A 2WQXA 4IMLA 5BW7A 2DQHL 2WP3T 1MZZA 3VFGL 4I18C 3EYUL 1EGJA 2WUCH 4WUKL 2ZWYA 1MH5A 3AWGA 3HKZA 3VD3A 4H1LA 4PYGA 3BZFB 1A6PA 2Y2WA 2WQSA 1PQZB 3RX9A 3AXIA 2X9YA 3IAGC 5T1LA 5I8EB 4H1LG 1GKOA 2DQMA 3FDWA 2Z8RA 1UZ6E 3QPKA 3VWJC 3GZOA 4AYDC 1BEXA 4YDMA 3HS9A 3TU6A 1BF8A 4ZMLA 4XCYA 1FH5L 4XVJL 3V4VL 2UWEA 3DRTB 2VBMA 4XLAA 2H2PC 4I48B 2GY5A 4ZBJA 1TTFA 2NDFA 4FXTA 5CUSH 1XVSA 3FSAA 1EZSA 3DPDA 2DWEA 1UVQA 1T7XA 1TJIH 1XGUA 3M17A 5T5FL 4I4WB 2F53E 4KI5D 1YEKL 4HHAB 5C0IB 4TUOA 3T1WA 3NCJL 1EJ8A 2BFVH 3HFML 3FONA 3FH5A 1U8OB 1BD2A 5D6CB 4AE0A 1CK0L 1FNEB 1HCFX 4AEFA 3G5WA 4AEHH 5FK9A 2VDLH 3PF2A 4UT7H 3OWEA 4H5SB 4YPJA 3TASA 3IGLA 4PBXA 3REVB 3GTTA 1MXGA 2XQBL 1IL1A 1J9SA 1F3RB 1IC7L 1HAUA 3O4OC 5ICXA 3G5ZA 3BKCH 3IJ7A 1M7UA 1OSZB 3BPOB 3G6DL 3U0TA 5D8JL 4R2GD 1FHGA 4I0KA 4DP4X 1Z5YD 2XZZA 1I8KB 2DQFB 4E9VA 3U4KA 4MXNA 1ZLVK 3OGCB 3H9HA 4FG6C 3E8UL 4JKPH 1UYWH 4LE8A 3S96A 3MA9L 4PV9B 3UAJD 4FABH 3ZO0A 5C6WH 1MCCA 3RZCB 2IMMA 4JHAL 3SUCA 2VB5A 2J56A 5B39B 4X6DA 3VWJA 1KN2L 2J1KA 4FLRA 4ELMA 1GGBH 3D18A 3O45A 4FTVB 2W9LA 4JO8A 3DGDA 4R5VA 5IWLA 3JZ7A 3VI4A 4A1RA 4Z7UE 2CR3A 1DVUA 4PHXA 5I1HL 1WEJH 2G5BB 1AFVH 3I6GA 2FZ3B 4PJCF 1A6AB 4PI0A 5F6IB 5F21B 1AQDA 4L8DA 4BCXA 4FEMA 3H42H 5I6XC 2WTPA 1RI8A 1KB5L 2QGEA 3FTUA 1RK1A 4H0HB 4NO0B 5FFLA 1QFWL 1J18A 1R34A 3MRDB 4NNPL 1U8MA 2BX6A 1H5BA 1E40A 2XN9B 2BIQA 4UAHA 5GIRA 5FGBC 1AKJB 3EJZD 3M88A 1Z2KA 4EUPB 2CLZA 3Q13A 3GTVA 3C2AL 1ED3B 1KXVC 3WTSA 1FE8L 2Q86A 1RFDH 3I3EA 2NYKA 3CLEH 4MS8D 2KZBA 2Y7MA 1MCPH 1OCZB 1AXSA 1FO0A 4WI7A 1T0MA 3FQRA 3J27A 3CSFA 1B0GB 1IB5A 4DP7X 4NZJA 2BINA 1OB1B 2DAVA 5DLLA 3VXOB 4GAAA 4FCAA 2Q7YB 4UUJA 4GEJA 4BQ6A 1N19A 2VLJD