3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
4H2CA 4UCFA 4UQCA 3ZO9A 2TAAA 2YJQA 1KXHA 4BA0A 2VJJA 1KGWA 2ZUSA 1VBLA 4HP5A 4AMWA 4CN4A 3RILA 4U31A 2EWEA 2IGTA 3K8MA 1KCKA 4AEEA 3L4ZA 1UH2A 1IZKA 1SZNA 1ZJBA 2GJPA 2PWDA 2YKKA 5CXPA 3RIKA 2X2HA 3UCQA 2NT6A 2O1DA 1Q4NX 3DX4A 4JL2A 4XLCA 2F18A 2DH2A 1JDDA 4DO4A 4LPCA 1R75A 1QHOA 3EJQA 4JFSA 4Z06A 3LXAA 4OKDA 5HDRA 2X3HA 1RMGA 4OJOA 1V3JA 2IQ7A 1KWKA 1R47A 1UASA 3DC0A 3BAYA 3GXNA 2ZUUA 3UEQA 1VFOA 1V3LA 2EADA 1KCDA 1XD1A 3GXMA 3JURA 3EQNA 2QPUA 1IZJA 3BAWA 3AXHA 1O8JA 1QJVA 1QI4A 4UQAA 1CDGA 3ECQA 4NX0A 3CPUA 1UD2A 2F7RA 1XH0A 2ZWZA 3CV5A 4XLHA 4MR0A 3WEOA 4OJPA 1BF2A 3DX0A 2VJIA 4XORA 4YZAA 1U33A 3BUPA 3VGDA 4EW9A 4PSPA 1H80A 5I0DA 1PEZA 3M07A 3BCDA 3L2LA 1IDJA 3H54A 3B4NA 1NHCA 1KTBA 1WPCA 2ZXAA 4XOPA 1VIWA 2FE0A 2ALWA 4J3WA 2X2IA 3GXPA 5E9AA 5E6ZA 4DO6A 1B2YA 1CXFA 2ZE0A 3CGTA 5F7UA 3BAJA 4FNQA 1CXEA 1UD4A 1VAHA 3S5YA 4AIOA 3A24A 3WDJA 1BG9A 1E43A 1JFHA 3GQ7A 5A2BA 2Y5EA 4UQ9A 3T9GA 2XIIA 4X9YA 1MFUA 2BHZA 4U33A 4C2LA 7CGTA 3H53A 1WZLA 2F7OA 1XSJA 4BZYA 4AYGA 4OZZA 3L4TA 3BUDA 2YFOA 4FLOA 1R34A 1Z32X 3CLWA 1QCXA 1XSKA 4YEJA 3GQ9A 1JAEA 4X0NA 2NTPA 4GQRA 4FNTA 1PS3A 1E40A 1JI1A 3ZPPA 3BUQA 1G94A 1VB9A 3L4WA 3LMWA 1PAMA 4GO8A 4H7VA 4HPHA 1RWRA 3CC1A 2D0GA 1EO5A 1PIFA 2EO7A 1HG8A 1GCYA 1JXKA 3LRKA 1OGOX 5A6MA 5A2AA 4JFWA 3VM5A 1DBOA 4FLQA 4UOZA 2VBMA 2F61A 2Y4SA 3UG3A 4MB1A 3S5ZA 1O7DC 2FHBA 1P6WA 2ZX8A 4NZFA 1KXQA 3CTTA 1OSEA 4UOQA 1XGZA 3LRMA 3OLIA 4JFTA 1PJ9A 1TQSA 3AXIA 4JFUA 3VO0A 1HL9A 5BRQA 1GVIA 2D2OA 1TQTA 3AMLA 4U2ZA 3BMWA 1X0CA 3CZEA 4H8VA 4OJ6A 3GTNA 4QAWA 1BLIA 1BAGA 5DO8A 4W8QA 5A6LA 4JCLA 4AMXA 3D51A 3ZT6A 4CKQA 3VU2A 4MAZA 3VSVA 1G5AA 1CYGA 1CXHA 3WEMA 2QX3A 2O0WA 3EDJA 4JL1A 3TV8A 2ZX7A 1RPKA 3A4AA 2X6YA 2BHUA 3LXCA 3FAWA 2X85A 5AMVA 1IA5A 2WCSA 4M8UA 3EDKA 2WKGA 4AIEA 2FHFA 4NK6A 1EA9C 2WVUA 1WMRA 4UQDA 4J27A 3A47A 3L4XA 5DFAA 3HG2A 1I75A 3CZSA 1AIRA 3B8YA 1OFMA 1KB3A 2BXZA 2VNCA 2YIHA 2ODLA 3AJ7A 4WLCA 2UVEA 3H55A 2INVA 3VX1A 3W38A 2ZXQA 2ZIDA 1GQ8A 3KE0A 2V3FA 2GUYA 1ZJAA 4AEFA 2QV4A 3EDFA 1XCXA 3KL3A 1JF6A 3DDGA 3WDHA 2QY1A 2F7QA 3EJRA 1DEDA 2ZWYA 2OSWA 3BVTA 3BVXA 4HOZA 1M53A 5HXMA 3VMOA 1O8HA 2V3EA 3L4VA 2ZXBA 4NXKA 4FLRA 2PECA 4UZSA 2XVLA 4PCSA 3BCFA 2WVTA 1CXKA 1QI5A 3EJSA 3WDIA 2O17A 4H8HA 1UKSA 2CXGA 2YFNA 3ZT7A 2GVYA 2Z1KA 4PMHA 3CZNA 4W8SA 3WNLA 3IK2A 3TOPA 1PE9A 1OB0A 3BVUA 2G3MA 2CPUA 1U30A 2YA1A 1ODUA 1RP8A 2VRQA 3GXDA 5E6YA 3BSGA 1GJWA 1JL8A 3MI6A 3FY3A 5C1EA 3D4YA 3SUCA 1VFMA 3CZGA 1UKQA 2BHYA 3HG3A 1CGXA 1MXDA 1VJSA 3II1A 2QXZA 4XQFA 2XVGA 1JDCA 3WNMA 4WSKA 4AYSA 1BHEA 4HWVA 1QWNA 1CGWA 3OLDA 3KL5A 2XN1A 2BXYA 1HX0A 1MVYA 2C8NA 1R46A 3VNYA 2INUA 2UVFA 1KXVA 3VMVA 4UQBA 1TQWA 4FNRA 2OW6A 3VM7A 5HPOA 2D0FA 2ZX5A 4PCTA 3EDEA 4J3UA 4NXSA 3KWXA 2WCGA 3BVVA 1JGIA 1UKTA 5BRPA 3WFZA 2CHNA 4OIFA 1CZFA 1O88A 1PZ2A 4U49A 5E0FA 4Z05A 3IJ9A 1L0PA 3GXTA 3EJUA 1UA3A 1H3GA 1JF5A 3KL0A 1CPUA 2ZXDA 3WNNA 3CZKA 1DHKA 1HTYA 3A6OA 1QW9A 1UA7A 2OW7A 2J25A 2F2HA 4FNSA 1G1YA 3KRGA 3ZR6A 4DO5A 3VNZA 3ZSTA 3A21A 1E3XA 1DBGA 1KXTA 1WE5A 3BLPX 4OJ5A 5E70A 4OJLA 2OSXA 1UD6A 3EDDA 4CN6A 1QWUA 2NT0A 1MW2A 1G9HA 3HG5A 3BSHA 2BY3A 4JCMA 3UW0A 5KEZA 4J28A 1KGUA 4XKVA 4YZ0A 2XWEA 4KWUA 2OYMA 1OT1A 4KMQA 3L4YA 2VRKA 2WNWA 1XSIA 3QGVA 1HT6A 1UD5A 1KCLA 1U2YA 3TTYA 2WSPA 1O8IA 2NT9A 3GBDA 3LRLA 2NTQA 2QPSA 3WWGA 3D50A 3VX0A 1BVNP 2YA0A 2D3LA 4U3CA 1BN8A 1KBBA 2DIJA 4XONA 2VUYA 3VMPA 1LWHA 1WZAA 2DH3A 2WPGA 1OOCA 5TD4A 1O8EA 2FHCA 4XKWA 4AW7A 2PYHA 3K8KA 3DX2A 3BAIA 3VGGA 4Z03A 2C7FA 1KCCA 2FYVA 2WANA 2NSPA 2EEXA 1XD0A 1JD9A 2VBEA 2D73A 2PWGA 1CIUA 3BUBA 1UD3A 3ZT5A 3BVWA 1QHPA 1XH1A 4FNPA 3BAXA 5CLWA 1JRGA 2AAAA 4YZXA 2VR5A 4CN1A 3D52A 1KTWA 2QMJA 2YA2A 6TAAA 1D3CA 1M7XA 1T0OA 1BPLB 3WNOA 4GO9A 1J0IA 3GQ8A 4YZQA 8CGTA 7TAAA 4XM3A 1PPIA 3WMSA 1QW8A 3A23A 3ZR5A 2PWFA 1OGMX 3ZSCA 2PWHA 1TQUA 3DHPA 6CGTA 2X2JA 3GRHA 2EJ1A 5E1QA 4WF7A 4HA1A 3B90A 2E8YA 2OYLA 3UERA 1O8LA 2FH6A 1HXKA 5I23A 4XLEA 3WENA 2EAEA 3DX1A 1J0JA 1UD8A 1OT2A 4YELA 2WVVB 2E8ZA 1KBKA 4OJYA 2D0HA 3WNPA 4HOWA 1ZS2A 5A2CA 2YOCA 4W8TA 4XMYA 1CGVA 1MW3A 3DDFA 9CGTA 2E0PA 2F7PA 3GBEA 2OYKA 3GXFA 3ZOAA 2GJRA 4WSJA 4NI3A 1MFVA 1O8FA 4TVUA 4GIAA 4UNIA 1MW1A 3TONA 4ATWA 2OSYA 4CVWA 1A47A 1CLVA 2XN2A 1UH4A 4XB3A 5CLTA 1J0KA 4J3XA 1AQHA 4MXNA 1UOKA 3BH4A 1WZKA 4GI6A 4XLAA 2NT1A 3K1DA 1GJUA 3LPOA 4XL9A 2PWEA 3FAXA 2QMKA 4GQQA 2WSKA 4J3VA 2E4TA 3LPPA 1DTUA 3KLKA 1MW0A 1V3KA 4URRA 1KGXA 1Y7VA 1WZMA 2XN0A 3A5VA 1UH3A 3BAKA 4FNUA 1D7FA 2G3NA 2WC7A 1PLUA 2XIBA 5CGMA 5I24A 4XN3A 1JI2A 1IV8A 2X6WA 4GINA 3EJTA 1JDAA 1JG9A 1BSIA 2VBKA 3LX9A 4NK8A 1MXGA 1XH2A 3DHUA 1CGYA 3WNKA 1B0IA 4XOTA 3ZQ9A 2WKLA 2WVVA 3VSUA 4U2YA 2D3NA 4J3SA 3HZ3A 4FMVA 4LXFA 2EQDA 3VSTA 1IB4A 1RP9A 1PXZA 1CXIA 2VT0A 3IJ8A 3K8LA 3HG4A 3VGBA 1HNYA 1XCWA 1R33A 4FLSA 1QI3A 3IGUA 1WO2A 1AMYA 3WELA 2XVKA 4HOXA 1O8KA 1O8DA 4PEEA 3WY1A 1TQVA 2ZX6A 3VMWA 1SMAA 2AMGA 1O8MA 1S46A 2ZICA 1NOFA 4B9ZA 1EE6A 1VFUA 3HJEA 1KTCA 2NTBA 1RU4A 2Z8GA 1CGTA 3GQAA 4J7RA 4NZJA 1K5CA 3ZSSA 3BLBA 3VGFA 2QLYA 1QPKA 1PIGA 4E2OA 1QX1A 3WY3A 4XNFA 3W37A 2ZUTA 1JXJA 1AVAA 3EJPA 3BC9A 3L4UA 1W9XA 2O0VA 1CGUA 4I84A 3WY4A 3D4ZA 2EACA 1OGSA 2FH8A 4M56A 3OLEA 1WP6A 4W93A 4LQ1A 4PSRA 2X6XA 3LXBA 2FGZA 4UZUA 4GI8A 4CGTA 1JIBA 4AVZA 4XLFA 3VMNA 3VGHA 4JFVA 3BMVA 2NSTA 1HWWA 3BLKA 5C1CA 2BY2A 4H8UA 1MWOA 5CGTA 3CZLA 3S2CA 2WVSA 3IJ7A 1EHAA 1O8GA 2O04A 1PZ3A 4XN0A 4UQEA 1CXLA 3DX3A 4B9YA 1KWGA 3GXIA 3KLLA 2Y2WA 1SMDA 5I5RA 4U4BA 3A22A 4OGZA 2DIEA 1HL8A 2ZUWA 3L2MA 4J3TA 3VGEA 3WY2A 1JTAA 1E3ZA 2E9BA 4GI9A 1EO7A 1IDKA 1C8QA 1AQMA 2ZUVA 1HVXA 1XV8A 2PYGA 3BUIA 3KEHA 3FW6A 5EMYA 3EQOA 3UG4A 2BY0A 2BSPA 4OZYA 2F1BA 3OLGA 1EH9A 2Y24A 1JD7A 1OFLA 2BY1A 3UG5A 1V3MA 2NZMA 4GKLA 4XR6A 2EABA 2XWDA 3WN6A 1XG2A 2V3DA 2NSXA 1TMQA 1NM9A 1TCMA 4W8RA 2F1AA 3AMKA 1LWJA 3TTSA 2ZX9A 1BVZA 1J0HA
chains in the Genus database with same CATH superfamily
3WHXA 4LOFA 2YD7A 3FQRA 4G9FD 3V10A 3LN4A 4ZAKB 1U8OB 5I1HH 3UTOA 4I5BB 4ZFGL 1IGML 2F15A 2IGTA 3REVB 5IG7B 1HHKA 2AEOA 3I6GA 3ZKMD 2CDEA 1PLBA 2G9KA 3C8KA 4NCC1 5BZWA 2GJPA 4BM7A 4UTAH 3TFKD 5CZRA 3WGUB 4LFHG 1U58B 4M93C 1QATA 1PLCA 5DHYB 5DC2A 3FC8A 1X5KA 5J6GA 5FHAL 1N0XH 1WEJH 4UZGA 1KWKA 3GXUB 1INQB 2QGEA 3DC0A 3GXNA 2JSFA 4PGCA 2NTSP 2X4NB 5G55A 1MREH 2EEBA 4IDJH 4KDTA 1QABA 5H2BA 4DSYA 2GSIA 1VHPA 3BJLA 3VXSE 1MQ8A 2BFGA 3EF7A 3FO9B 4X5RA 3FNKA 4NQXA 3ZE1B 2VN4A 1I1RA 5D70H 3QORB 3KH3A 2W80C 3MUZ1 1JYVA 3LB6C 3UTTA 5IHZA 2EILB 1NPNA 1RJLB 1HCYA 3WBDA 4MR0A 1MFCH 2VJIA 5FYJL 2N7AA 1I8LA 4L1SA 4MQSB 4ZAKA 3HNVH 4G6ML 4WWNA 4ZOCA 2ZJSH 1MIMH 4I5BA 3ELQA 3CN1A 4L29A 3TA3C 5L88L 1QBMH 4XWOD 2QHLA 5IG7A 2CK2A 5E6ZA 5KBMA 2Z0UA 4OF7A 5JXAH 1TTUA 4HV8B 2YEZA 1U58A 3P9WB 5C6TL 4R5TA 1UGNA 5LGYA 1TZ8A 2M1KA 4U1MB 5DHYA 4OZIE 2EIJB 2VRAA 3CFEB 4FHBD 4HZAA 3MXWL 4X5QA 2Q7NA 2BIOA 1INQA 2ITEA 1GKEA 4P2CG 1QFUL 1J5DA 3WKYA 4HS3B 2BNQB 2X4NA 1QEWA 5AW8B 4HJEA 4BZYA 1EXHA 4IJTA 2ED7A 5E1GA 3CFTA 4ODVH 2IV8A 1D5XB 3O4LB 1PS3A 3D08A 2VR3A 3QORA 3FQXB 1NKRA 5KTEH 3V5DB 5IV2B 2L7QA 3BUQA 1NEZB 1N19A 1RJLA 3POHA 3ME0B 5ANHA 5I5JA 3OWEA 4LCIL 1EO5A 1EVUA 1CTOA 1PG7W 2ARJB 2EDRA 3ENEA 4YBQD 1DBKL 4M8RA 4G6AD 3NBNA 5LCVA 1M56B 2MSPA 3I74A 1ECZA 4UOZA 5LXGL 4WTXA 3ZTEA 5GISH 1KXQA 2CUAA 4WTWA 4OD3L 1EIBA 4GXVL 3DRQB 3MODL 1EAQA 4JM0A 4OIIL 4Y1AE 4XP1L 5BW7C 4OM0H 4HV8A 4RESB 2E5EA 2YPLB 1GVIA 4U1MA 3V4VL 5C9KA 4ZS7H 3CFEA 1PQZB 4ES8A 3FH8A 2WBWB 3CZEA 1RPUA 4HJ0D 2W0PA 3K6SA 3NCXA 4HS3A 5A43C 4AMXA 3ULUF 3VU2A 5HHXL 1A3RL 2BSSB 3HKZA 4MMZC 3NGBB 1CBVL 1NMCB 4ONOA 4WW2F 3SDYH 1KJ2A 2QYUA 2ENQA 1DVFA 5KYYB 3B2XA 3MLUL 2HUHA 4KAQL 2X6YA 1D5XA 3LXCA 3O4LA 5AOZA 4OUUB 4WQOA 3FQXA 3V5DA 2FHFA 5IV2A 4JN1H 1NEZA 3PAVA 5BVPL 3ME0A 2P49B 5IGXH 4LB8A 4CJ0A 3CDGB 3PJSB 5GHWH 3TWCL 2ARJA 1NIBA 1YQVL 4TSBH 3TN0A 2GT9A 3VX1A 4DP7X 2VABB 2ZIDA 3SYJA 5CP3H 4RGNC 4LP4A 1V7ML 4GSDH 2VMFA 3KL3A 3D09A 3QBTB 3DRQA 4FQCH 1OP4A 4KKCD 4RH4A 3T5WA 5I82A 3UTTE 1IM9A 4LEXH 5AB9A 2YPLA 3C6LD 5C0GB 3L4VA 4G2AA 1IEAB 1PQZA 4GSRA 1E8YA 1QR4A 5L9DH 2PECA 2ZWSA 4N20A 1EBAA 1DBAH 1KPVB 2HSIA 3WDIA 4HF5L 2A6IB 1MRFL 1P4UA 4W9HC 3V0EA 1MFAH 5DEZA 4JDZB 3ZVVA 2IBGA 2BSSA 4MXQC 2LE9A 3D6GA 1EFQA 4HK3N 3TOPA 1KDJA 3D69B 3V0HA 1VERA 5T1KD 4C55A 5KYYA 1RZFL 3GXDA 2IWFA 3SKJL 4OUUA 2OS7A 4F8QA 1E90A 1P0SE 4GNKB 3WO3B 3T77B 3HNSL 1Z5LB 2JQAA 3VUAA 2E7MA 2FBJH 3PJSA 4Y2DB 3BQUB 1KUMA 2G5BB 2A74B 3I3EA 1JZ4A 4X98B 1R46A 2Z64C 4KTEH 4XPFL 2J6EL 4UQBA 2EZ0D 2VABA 1YYCA 3MLZH 4FNRA 3WIIL 3LDBC 2Y7QB 1PX3A 3C6EA 3ZE1E 4AENB 4EUPG 3HI5L 2FD6H 3ZDYF 2OP4H 7FABL 3UZEC 5JYMA 4QRSB 4KXZI 1T0NB 1JNLL 3AT8A 2PPFA 3CUPB 1S7UB 4JUTA 3NRQA 1IEAA 2IGFL 5FM8A 5AYUL 4E42B 1MCCA 1BIIB 1PKQA 2PPDA 4QXUL 3TEWA 4R7LA 1UA3A 1B4JH 1KPVA 2A9AA 2A6IA 4CNIB 1WT5C 2Y7LA 4P2OC 2D8KA 1NGPH 4JDZA 1RZPA 1XEUA 1KXQE 4MXVE 2OL3L 3D69A 2IQ9H 1U3ZA 1T5XB 4GKZB 1O5DT 4L4TD 2Q7YB 1A3LL 1P5UC 1Z5LA 4GRMB 3NA9H 1WS8A 1MW2A 3QAZC 4L9DA 4TVPD 1U8NB 3FDWA 4Y2DA 4FI6A 5BUGA 2BY3A 2ZSWB 3BQUA 3UW0A 3SEPA 2G5BA 2A74A 5F1OB 1OT1A 4X98A 4FYSA 5C09A 3RPIA 1KB9J 3EYSH 4W4OA 3H2PA 3D3VB 3DMMB 2Y7QA 3O4LE 4BZ2L 1KV7A 3VXRD 4PJ5B 4AENA 3VU1A 3VD4A 1JYWA 5LBVA 4XONA 5AD0B 5ELIA 2ADFL 4H4NA 2R7EB 4BYHA 3PE9A 3CN0A 5FA4B 3VI4A 4QRSA 3HBQA 1CBJA 1T0NA 3CUPA 1S7UA 1A6UH 2MCPH 3VFPB 4E42A 3ZDXF 2MKWA 1BIIA 2VSDA 2NSPA 4CNIA 3BSZH 1ZTXH 5IP4A 1UD3A 4FNPA 4LLWB 4LSVL 2XWRA 2YZ8A 4HALA 1DQML 2N0KA 1MFDL 4B9GA 1YEHL 4KBPA 5K1VA 3FUHA 3OHMB 1K2DB 1T5XA 2W0LA 4GKZA 3RWFB 3NCEB 4D8PB 1DSYA 2Q7YA 1BZDA 2YPLE 2DW5A 3GSRB 1TENA 4GRMA 5EF2A 4F37K 3T0BA 2A83B 1U8NA 3P0YH 2ZSWA 2OR7A 1YNTF 3VVWA 4MCNA 4ZFQA 1NH6A 5EEZA 3BT2H 3CU1A 2BOLA 2WWKO 3G5XB 4AVHA 3D3VA 3DMMA 1TYXA 1YNLL 3LH8A 1H6EA 1OARL 2Q5BA 5T5FA 4B27A 4PJ5A 5MHSE 5AD0A 4MNQD 2R7EA 5A2CA 1FORL 3PREA 5FA4A 1KGCD 1EHLH 5KSAD 3VFPA 2YPVL 4ZS6D 3UTZA 1IKFL 4PWFA 4RA0C 4UU9B 4ATWA 4WZ9A 1U3HC 1A8JH 5T3XL 4LLWA 7PCYA 5HHPB 2B16A 4NGHL 5EOCJ 1K2DA 2EE2A 5CZVL 1XF4B 1XBRA 3RWFA 3RGVC 4OCMC 4ZSOB 3TV3H 4D8PA 2NUPB 3IDIB 1GL4B 3GSRA 4RGND 2YKLH 4J4PD 1PKQE 4UV4H 4BWTA 4OZHF 1KGXA 2A83A 3LN5A 4K71B 2XIBA 3QFJB 4LVOC 1CG9B 5I24A 2X6WA 5F6HJ 1F11A 4RCAA 3G5XA 2FX9H 2G9HB 3DO4A 2HP4A 4R26L 3MVSA 1WC7B 2JFCA 3U46B 1I1AC 5CJOL 1S9YB 3SBQA 2IIJA 2GY5A 4MXQD 1RP9A 3VH8B 3DVNA 3FT4B 3IJ8A 1I9JH 1RU9L 4ECNA 2BOBB 1AQDB 3RKDD 4M1GH 4UU9A 1DANU 5C09E 3S36H 1QNIA 3VXUB 1NCOA 5J6SA 1UEYA 3WELA 5KANG 1OWWA 4PW3A 1YUKB 3OC8A 2QGDA 5HHPA 3VFOB 3WMPA 1I8MB 5KG9B 3O6FC 2V5IA 1XF4A 4YS4A 4AGMA 3HJEA 4ZSOA 3VI4E 2NUPA 3IDIA 1WICA 3O3BB 3X3FH 3ZTJH 4M3KB 1LTXA 1XIWD 3QCVL 1D5IH 3K3QA 5CZKA 5F9DC 1CICC 3JZYA 4WWKB 2X4PB 3B1UA 3QFJA 1CG9A 5AAMA 3W37A 1P2CB 3CQFA 4XR8C 5IB5B 3WFBL 1AHMA 2ZCKL 3VG9C 4TNVF 2X0UA 4QXGL 2G9HA 3JWOC 1IM3D 4RMUA 4M48L 5HHOD 1NBYA 4HK3J 5FFLA 1WC7A 3P3TA 4LQ1A 3LXBA 4NQCB 3U46A 4UTBA 5CFHA 1S9YA 2V9QA 5HDBF 3V4VB 4TVSa 1B2WL 3VH8A 3EH5B 3FT4A 4FNLL 3GNMH 4XNYH 2BOBA 1AQDA 5I1CL 1MKFA 1UZ8B 3CDZB 3TBWB 3VXUA 3DGDA 2R4SL 4U6XB 5D93C 4CU6A 3D3VE 3IU4H 3EYFB 2VDKL 5E08L 3VFOA 4J2XA 2B2XH 4G5ZL 5KG9A 4PJ5E 4ZFZB 2ZKHH 1OQOA 4UI2A 3QUYB 3O3BA 1HL8A 2ZUWA 2DAVA 2OSLB 3T0XA 1A6TB 4GI9A 5IIEB 4DGWC 2ZUVA 3PAYA 1ZHBB 4ONFL 4WWKA 2X4PA 1KCVH 2I5YL 1P2CA 4DFHA 3SDAC 5IB5A 5EULV 4GSQA 3GHBH 2AZUA 1ADQL 5K59F 4BUHA 4GKLA 2HMID 1MI5B 5EBLB 4NQCA 1JK9B 1G7QA 2Q3ZA 2R51A 2V9TA 4O02B 3N44B 5EN2B 4N2FA 1BVKB 5HI5D 5C7XL 1UZ8A 1P5VA 3CDZA 2E6JA 3TBWA 4F57L 2DL2A 1YG9A 3QEUB 4N25A 4P9ML 4PRID 3LKRB 4U6XA 3L9YA 3PHAA 4UQCA 5KOMC 3Q2CA 3LVTA 3EYFA 2XA8L 4MZIA 1MAJA 5FM5O 4HCIA 4KRNA 2QQNL 4P59L 2H5UA 4ZFZA 4HP5A 4U6YB 5JUEH 1B3IA 5E8DH 4RFNB 1I4FB 3TBVB 1CCZA 3QUYA 4PJXA 4CC0A 2OSLA 3ULVC 2RFXB 1A6TA 2NX5B 5IIEA 1WWBX 1N8ZB 3GMQA 5I1HL 3MBEC 3IDNB 2X2HA 4M6NH 3SDDB 4YMPA 3DX4A 4JRYB 4LKXB 5KVEH 1ZHBA 4ODSL 3KJ4C 1KYAA 4JKLA 5HDRA 3EOTH 4GQ9H 4UANA 1CD1B 1QSFB 4TF4A 5JIMA 3HC4H 1MCBA 1SXZA 3BN9D 1CWVA 5D1ZB 3E1F1 5FYLH 2H9GB 4KI5F 4ZSOE 5TGBB 4GW5B 5GRJL 5EBLA 4FG2A 1KCDA 3QEGH 4O02A 5EN2A 1T3FB 3HFMH 1BVKA 1A6VH 2E76C 3ZTDC 1O8JA 4ZXBB 4HJIA 3QFJE 1CDGA 1MREL 3Q01A 4IDJL 3QEUA 2V9UA 4PJFF 5CZXD 1J5CA 5I18H 3LKRA 5D72L 2IEPA 3VGAC 4FQXC 4KC3B 2OL3B 4W1TA 2VFOA 2DQFB 5D70L 1ZA3B 2DEYX 3BCDA 4IOIB 4J3OH 1HNFA 4NIKB 2A9DA 3TBVA 1I4FA 4ATTA 4Y9FA 2ZF8A 2P47B 2RFXA 4DQOH 3AK5A 1J12A 1R5IB 1CFBA 2CAKA 2NX5A 4X7TB 4JGJA 1N8ZA 1CU4H 1EDHA 1M05A 5DWPA 3IDNA 1UGKA 3SDDA 1JE6A 4G6KH 4JRYA 2DPKA 4LKXA 5LBSL 1GJIA 3VXUE 1DBML 3N04A 4Q9QH 3OR6B 1QBML 3S5YA 5I0XA 2BWIA 3BE1L 3JT0A 3NYKA 5JXAL 1CD1A 1QSFA 4P5TB 4WWPA 5EN3A 5JPMB 4U1LB 1ORQB 5D1ZA 3MR9B 2H9GA 5TGBA 5HYIA 4GW5A 1SVCP 1KJ2H 2VJ0A 2XQ0A 3L4TA 5EOCH 4XN1A 4YDVB 4K3DH 1CL7L 4K8RL 4BKLB 1JAEA 1T3FA 5IW1B 5CEXB 5JHAA 1JYXA 3B6SB 4IBSA 4OLXH 1A7NL 4ZXBA 2R56H 4JANB 2BVPB 3FONB 1OAZH 3S35H 4DHLA 4P3CL 4ODVL 4P05A 3QUXB 1RFDH 3TJEL 4HPHA 2MPAH 1ZGLB 1GCFA 2OL3A 4KNQA 4IEFB 1UUSA 4D7BA 1OGOX 1ZA3A 2B8OT 3PWVB 3H4FA 4IOIA 3II3A 5KTEL 4NQCE 3M8OL 1M6OB 1WITA 4Z0XB 1GKOA 3VQMA 3TBSB 4TPRH 1IVLA 1AC0A 2WD0A 2YGOA 3F5WB 3LHPL 4PBVC 1L5GB 2FIKB 3LRMA 4X7TA 2XPGB 3GB7A 3EGSB 3OR6A 5FPIA 5GISL 3B9VA 3OKKB 4BGDA 1NAKH 4HKZB 2GITB 1T89C 4OM0L 4P5TA 5JPMA 2EXWC 1Z3RA 4U1LA 1ORQA 3U6XA 4PJXE 3V7AG 4WHCA 1ZSHA 4ZS7L 4JM4L 4YDVA 3WEMA 3PJNA 4F7EB 1F8TH 4BKLA 5IW1A 5TF1H 2K0RA 3HUJF 3GM0A 2W60B 3B6SA 1E50A 4JANA 1Z0NA 3K4ZA 3FONA 2WUCH 3SDYL 1EFXD 4M1DH 3CHSA 1A14H 3QUXA 3HG2A 1BJ1J 2JJTC 1ZGLA 1WFTA 1JTPA 2VNCA 1DQIA 2YQBA 4IEFA 3PWVA 1TEYA 2UVEA 4MD0A 3QG7L 3S4SG 4RBPK 1ZXQA 1M6OA 3K74B 4GPVA 4Z0XA 3BHBB 3FULA 3TBSA 5JIPA 3F5WA 1M42A 1A8ZA 1ETB1 1L5GA 1R17A 2FIKA 1XB6A 2XJKA 3DGGB 3O9WD 4TSBL 2X4RB 4LGRB 3BRDA 4MJ6B 2F7QA 2CCVA 3EGSA 4ZMQA 1KCUH 3DVFA 5IW6B 4IW4C 4KJWC 3TEXA 2BS8A 4GSDL 4OLYL 3OKKA 3LPWA 3UJTH 4FQCL 4QHKI 1LMKA 4HKZA 12E8L 2GITA 3EJYC 1IO4C 3C60C 4LEXL 1RUML 4WUKH 4ZMOA 1S8DB 2VQUA 2UXTA 5I5MA 2NX5E 3T6WA 4RMQA 4F7EA 3FB6B 3SQRA 3J7HA 2DQHH 2YPVA 1PE9A 1RP8A 2W60A 4JRYE 3VWJD 4A55A 5CD5C 4DUXA 4WEMB 3HG3A 1VJSA 2GIXA 4HIEB 3ULVD 1CVSC 2VDNL 1RUAH 3OPUA 1QSFE 4LCUB 3DX9B 1A21A 1YVLA 2DMKA 5DZNA 3VNYA 2N0MA 1A9VA 1TQWA 2E9JA 3BHBA 1R1CA 2UYLB 4S1SH 4V1DA 5IJVB 3DGGA 3JV5A 1VDGA 2ZX5A 4X0KB 4KHTH 2X4RA 1DQQB 4MJ6A 3I3BA 2YAEA 4KTEL 4H8WL 2Q8AH 4YHYB 2LW3A 5IW6A 2DWTA 1SMOA 3AS1A 2OMUB 4FD0A 4XXWA 1JV5B 3T2NL 4TQPA 4NC0B 1L9MA 2OP4L 4HCRL 3U0TB 1A66A 1DHKA 1S8DA 4LLAA 4LHQB 3TVMC 2CR3A 2PPAA 1TSHA 1U8CB 1OSYA 1B4JL 3EUUA 3FB6A 1GOHA 3Q8EA 1WYJA 1DBGA 4KXAA 3A6CH 4OJ5A 4FG4A 1A6AB 3GPEA 4OCLC 4HIEA 3ARDD 5AENA 4FX5A 5IB2B 4KV5F 4CVXB 4L3ED 1KGUA 3DX9A 4PJGA 5AW3B 3H9SB 4H8PA 5I73C 4E68A 1J88A 4PG9B 2CG9X 1NGYB 3NA9L 4IYKA 4MDJB 1PGRB 5T5FH 2OTPA 2ZXWB 2JKSA 2UYLA 3ABGA 5KVFE 5IJVA 4KKNA 2FCBA 4YHMH 4KK8C 4X0KA 1JRHI 1KBBA 1ZXKA 2WYTA 3C8DA 4KQ3H 4XAWL 1DQQA 2DIBA 1XGUB 1IAMA 4PJ9B 3S3PA 4NFCA 4DF9A 1OOCA 3BVDB 5A2JH 1EZVY 2OMUA 1JV5A 4Z03A 3ZJAA 4X80L 5EH1A 5I74C 1OXYA 3ZE2F 4EZJA 1OQXA 1XD0A 2GBTA 3U0TA 2YGVA 3BUBA 1Q9LB 4OLUH 2AAAA 2VR5A 3LJ3A 5ITBH 4KY1H 5ILTL 2Z31C 2HKAA 5CCKL 2XICA 2VN3A 1ZTXL 3FTYA 5F9WB 1FHNA 3GS0A 3WAKA 2OK0L 1A6AA 3HPLB 2NY2D 2A6KB 1TMCB 2HX7A 2XBTA 2FT8A 5IB2A 1D5MB 3LS5H 2DQ6A 2WQAA 4CVXA 3GRHA 2X40A 2E8YA 3H9SA 5B38G 5AVUB 3U30C 4PG9A 5EPMB 1NGYA 3ETSA 4MDJA 1N64H 1WWAX 4BQBA 1I85C 4PRBB 4R8WL 1MJUL 3NPZB 3O4OB 5DD6B 5F7MC 4P2RD 3MV8B 4HGWA 1XGUA 1YA5A 3BT2L 4UAOC 3G5VB 4JPKL 2VDOB 1N7MH 2YAHA 3VFTB 4ILDA 3ZOAA 2ZXGA 4LIQL 1MG3C 1DP0A 4ADGA 4RISL 2PCYA 2O1AA 3WN5C 2OSYA 4NO0D 4WDIB 1H8LA 1XTMA 1Q9LA 2FUTA 3D9AH 1EHLL 3MOAH 2WM0A 3ULSB 1IBGL 4V1DE 1FZJB 1EDQA 1QASA 3EYQD 2QFRA 1N70A 4I1RA 4F80A 4NUMA 2Y06H 4NB7A 3KM1A 2A6KA 4WJKB 2A5UA 3WFEH 4BA8A 2J71A 2X6BA 1QFPA 4E0RB 1D5MA 2XN0A 4GT0A 5C0BD 3G9VA 4IKLA 4TUJB 5CGMA 2VR9A 4XN3A 5C0RH 3P0VL 5EPMA 4UV4L 1EXGA 5CKAA 2DM4A 4JB9H 2YMOA 5DD6A 4NERA 4YGVB 4CSTA 3ATBA 5GZNA 4KKZA 4XT1C 4EDXB 1YDPA 3AY4C 4NNPH 2CWRA 3G5ZB 1U95B 3G5VA 2VT0A 3VFTA 4AG4H 1JTTA 1I8UA 4IKIA 4PJGE 4OM9A 2PCFA 3PWLB 1BJ1H 1I9RH 4WDIA 1HXYB 1C5BH 3E8UH 1O8KA 4JPIA 3ULSA 1F1AA 2D4FA 3IDYB 4AK2A 3VMWA 1FZJA 5HGAB 4BZ1H 2A9ML 1HI6A 2WYHA 4M1GL 5CBAB 1O8MA 1AD0B 4LEEA 3O41B 1T6BX 3ZHNA 5CSZB 2VN5A 2ROYA 4WTZG 3HJ0A 4I3RH 3TWYA 5AKTA 4E0RA 3Q6FB 4AX3A 4TUJA 1Y0LB 3S6CA 4Y5VC 5GGQH 3X3FL 1IC4L 4H25B 1XCTB 2FO1A 3ROLB 3NAWA 3QUGA 3FN0H 4LPXA 5KSVB 1V05A 3ALPA 3OLEA 3UTPD 4YGVA 5E4OA 5LBSA 1H15B 2EVHA 1QFWM 4K9JA 5E51A 4LHUD 4EDXA 3FBKA 1HHGB 2K78A 3G5ZA 4AVZA 1U95A 2Q8BL 5JLZB 4G8GB 4GIPD 5F9OH 3AREB 2NSTA 3H9SE 3ZTCC 4PJ8D 2GCYB 3GZOA 1JGEB 3ARTA 4JY4B 1HXYA 2IF7A 3S2CA 3HMXL 1ZPLA 1KWGA 5J06A 5HGAA 1CFVL 3QS2A 3RVXC 5CBAA 1BW8A 4HLEA 2DQCH 5IEHB 2ADJA 1AD0A 3O41A 4YE4L 4TUKL 4GSUA 5CSZA 4TKWA 2LLNA 4Y89A 1VSCA 1XBDA 3GFUA 5MEND 2C9XA 3BP5B 2W65B 1H6FA 4Q9BA 3H1ZA 4JCWA 3CCHB 3LS4L 3MJ7B 1P7HL 1Y0LA 1GAFH 4N90E 2DBJA 1TT6A 5DHDA 5I6NA 1ZHLB 5CN1A 3LQZB 2IBZY 4XC1H 2B3RA 1XCTA 1OZUA 2Y24A 43CAB 3ROLA 3SY0B 5KSVA 4RAUB 3U1SL 3AS0A 1OVZA 5B1AB 1H15A 4R4NC 3B2UD 1OV8A 3DX6B 4LL4A 1HHGA 1HZKA 1CZ8H 2EDOA 3HS8A 3HBGA 3GLEA 1JNJA 4G8GA 4AZ8B 3AVEA 3AREA 5EZLB 3ESMA 4LARH 2MTAA 5C08D 5ABZA 2GCYA 3MX0B 1JGEA 4JY4A 2X6CA 4JHWL 4LCYA 4Y7MA 1X4YA 4KDTC 1TFHA 5IESH 4EBQH 3SE3A 5BZDA 3E0GA 4F7KA 3OKOB 3P3RA 3I75B 5IEHA 3NFNA 3MOQA 4AGLA 1T22B 4I3SH 2VDNB 1I8LC 3BP5A 3NDYE 2W65A 4ZAKC 1F45A 3D7PA 3QHTC 5JUEL 5E8DL 5BRZD 3MBXH 1K72A 3CCHA 4K3GA 2BH0A 3MJ7A 2CNZA 4FABH 4IMLB 3DPBB 4KXBA 3KGTA 1ZHLA 5D1XB 3LQZA 43CAA 4TLUA 4M6NL 2CH8A 3SY0A 4RAUA 4WFGE 3TZVD 2EADA 1RZ7L 4DVRL 3DX6A 4WI0B 3CE1A 4GQ9L 3QXTA 2HRPH 4K2UH 4AZ8A 5FYLL 4GP4B 4H0GA 1XR9B 5EZLA 3TCXA 3MCYA 5EIQA 3MX0A 1UD2A 5SX5H 1EAOA 2EDQA 4JHBA 4RQQB 1H80A 1WIPA 4D8OA 4XCCL 5BV7H 1JCVA 4AJVA 3MNVB 3OKOA 3LIZH 3PF2A 3I75A 5FLVA 1RULH 1ETJA 1KTBA 3QORC 3T0VA 3FUIA 3I02B 3IGKA 1KJ3H 5F7DB 4HUKB 2DF3A 4NHUB 3OZLA 2X2IA 2KPWA 3MTXA 1K5NB 4CL7A 3H7BB 5D7JB 4EF3A 4TOYL 4Z3JA 3S9DB 2WMPB 3UC0H 3UGUA 4IMLA 3DPBA 4DQOL 3GQ7A 5A2BA 3BZ4B 4A2GA 1E5AA 2ZKXA 1BAFL 1CU4L 4KROD 2O30A 3RIAF 2XKSA 3EO0B 2AITA 3BUDA 3KYOB 4WI0A 5J11B 4XPHH 5EIIB 5FHBH 5LN4A 5M95B 3L3HB 4KKPA 2ZG2A 3IE9A 4JFFD 2WQSA 4AE1A 2C3HA 2MJWA 4HJUA 1XR9A 2VE6B 2Q76A 4P5SA 2KQNA 3NCYS 5EOCL 4YSUA 5TFSH 3FCBA 4DKFH 4N0YH 4EUPH 1MRDL 1NSNH 1MZYA 1DVFC 4RQQA 3AGWA 4AYFB 4XXDB 2R56L 3MNVA 2VERN 1G5GA 3WHE1 2G0KA 3I02A 5I6KA 5F7DA 4ZMWA 1RFDL 2QQKL 1O7DC 1W0YT 4XPBL 3WEBA 2MPAL 4JG9A 1JFQL 2YSSA 1EK3A 1K5NA 4N3UA 1QZ1A 5FGRA 1OSEA 4G8GE 4Z3EA 5D7JA 4N2KA 1AHWB 4RMTA 1UFGA 1PDKB 2DI9A 1LEKB 3AUWB 3GMOB 5GS3A 3RX5A 1WIOA 2WMPA 2AXHA 5GGSY 1DN0B 1QEXA 4N8VB 4TPRL 3WUWA 1X5ZA 1WCQA 3BZ4A 1PBYA 4JHVA 1CI5A 2AJUH 4HWZA 2H32H 4YUEH 1L0QA 3MRJB 3B43A 3EO0A 3MLRL 3D51A 3Q2VA 4M5SA 3J8F7 5FUCE 4KKRA 1CYGA 4LSPL 5ICYB 5EIIA 4MS6A 1S5IH 4NNXB 1ADWA 3L3HA 1E8WA 2BHUA 1RURL 1Z66A 3F6JA 5AOJA 4JRXD 3TJPA 3QEQD 2VE6A 3WL9B 3B7YA 3NGBC 1NMCC 2V2TB 1DJZA 4L8SB 1P1ZB 5TF1L 2X6AA 3FFCD 1REIA 5DHVH 4GAFB 4HH9B 4ZYKB 5IQ7L 4WLCA 5C2BH 3H55A 2WUCL 2PN5A 7PAZA 1T20B 1YMHB 3CFMA 5JHMA 1T7ZA 2KH2B 3KHQA 1AHWA 2G4EA 1PDKA 3IU3B 3QDJB 4HU8A 1LEKA 3GMOA 2ZWYA 5CJ8A 3BVXA 4N8VA 1UHVA 3H6AA 3OF6D 4R96B 4J8RB 4JRAC 1TJIL 3GUFA 2YXMA 1P4LB 3I2CH 3MRJA 3NZSA 4HIIA 3QFGA 4XP9H 5DMJB 3SBWA 4XP6L 4NWTH 4PVLA 4Z95H 3PYCA 3DUUB 5IFAL 2VDPB 3QFDB 3UJTL 5ICYA 3MRMB 3UZQB 2G3MA 4NNXA 2JLLA 5CLYA 3ALWA 4HAGA 5DLML 4R4BB 4CVUA 4WUKL 1VFMA 5J12B 3WL9A 5I75B 3F7QA 2EH7L 4YLQT 2V2TA 4ZQTA 3KXFD 2DQHL 4L8SA 3MO1B 1P6FA 3D85A 4L4VB 5JOPD 2WO4A 4HH9A 4M29A 1UACH 3CLFH 4ZYKA 4ZX3A 4ADJA 2DWDB 3FU5A 2BNRD 4L9LB 2A2QT 2NY0B 5B7EA 1NBCA 1RUAL 3QAQA 4KRPC 4FULA 1FIGL 1T20A 1YMHA 2Q6WB 4Y2DC 3TJHC 3BQUC 3FUMA 2A74C 2Y7OA 3IU3A 5IMOB 3QDJA 1HOCB 2KLTA 3ZHFA 4HS6B 4W4OC 4R96A 4J8RA 4PAZA 1KGIA 3MOBH 2EVJA 3PGDB 1JWSB 2YQ3A 3P2BA 1JF5A 3QEHB 4PLOB 5IMOA 2ZXDA 1JZ8A 4YHLH 3DUUA 1WTLA 3MRMA 2IOOA 3UZQA 1G1YA 3DOIA 1ANUA 4FQIH 1MCIA 4MKMA 1WE5A 3QORD 4R4BA 3UJIH 2Y6SC 1BECA 1D5BA 1XR8B 4X8JB 2OXHA 3MO1A 1DQKA 1BXVA 4L4VA 4X5WB 5H37G 4AMKL 4IBTA 4XMVA 1T04A 2WNWA 2WOBA 4L9LA 1U2YA 5E9DB 2TSBA 2WCPA 4XPAH 2Q6WA 3S34H 2GTZB 1GGYA 1GXEA 5EHFA 4B7LA 3VX0A 1BVNP 3GZKA 3RX8A 4N1EA 3U0PB 3V2AR 4F15B 4HPOL 5C3LD 2FYYB 1UJ3B 5GQBA 1HOCA 4FXLA 4DP0X 4HS6A 3DMMC 1WRFA 4YHML 4MLSA 3VGGA 1GC1L 4KQ3L 1JGLL 1YJDC 3NJMA 1JWSA 3PGDA 4WHYH 3FJTA 3QEHA 4TTGA 2AJZB 2BNQD 3ISRA 1YAZA 3BAXA 5DO2C 1NEPA 3K4AA 5CEYA 5D4JA 4M4RB 3O4LD 3FTVA 5B4MC 4ZNEA 5KVMC 3LH9A 3T2QA 3KPQB 2X41A 1QQDB 4KY1L 4X8JA 4X5WA 2AJSH 4NRZB 1IQWH 1X5IA 4HA1A 5KBKA 2PABA 4H2AA 2CRYA 1IC0A 4NN6B 1JZ5A 1O8LA 2NPLX 3QIWB 1P9MA 4N0UB 4JDVB 3FB7B 2IFFH 3LS5L 2BM7A 2GTZA 3WENA 3DECA 1PKOA 3GS7A 4M5YH 1N6QL 3U0PA 2EEAA 1KBKA 1TO4A 1FO0B 2FYYA 1S9VB 1NANH 2VUKA 5EO9A 5FOJA 2R1XB 3SYAA 1PG7H 4XVOA 5KJRH 1MEXL 4HT1H 1UM5H 4WI3A 3QPQC 1MW1A 3MTRA 3F3HA 2AJZA 4LP8A 4XB3A 2NYYD 2CM5A 1SJMA 3V0IA 5E95B 4M4RA 5E7BA 1IFHH 3QDJE 3D9AL 4J3VA 3M7FB 3MOAL 4LPTA 5DVKA 4MXWL 3NUKA 2YUZA 4XTRC 2FEEI 4EN2A 1F56A 1M7IB 3KPQA 4G43B 4MMXB 4A63A 1QQDA 4URRA 1N6UA 4NRZA 3ECWA 3IS0X 3QDGA 4MVBD 4WAFA 5IK3B 1E6JL 3LXUX 4ESKA 1ZT7B 2H4EA 4N0UA 4JDVA 2LU7A 1QA3A 2UWEF 1K4CB 3FB7A 3QWRA 2OTUA 3DHUA 4JFZL 2V9RA 4W6WB 3PXHA 3FB5A 4K71C 5KSBB 1FO0A 1S9VA 4J3SA 1ZVSB 5AAMC 3VB8A 3VSTA 4HMEA 5CAYB 1HEZB 2RHEA 2XQYA 4I8DA 3HRZB 4L4VE 3K6DA 2YGQA 3HB3D 3UO1L 1IC7H 5E5UB 5F93C 2A9BA 3J2PA 1KBGH 3IDGA 2IG2H 1TQVA 5FX3A 1CYXA 3KBEA 3CZUB 4NN7B 1J5HA 4Z7OF 1WAAA 3E8UL 1C5BL 4JO5A 3TF7C 1E9QA 2ZXCA 1TEGA 2XACC 3C09B 3GI9L 3QJHA 4MX7B 1IVTA 2ZP0T 1RLWA 2NY4B 4RRPA 1M7IA 2J43A 2OMTB 4G43A 3GSQB 4I77H 4HSQA 4MMXA 4BZ1L 2LGNA 3BQUD 4E2OA 1QX1A 2WW8A 2BHFA 4G7SB 5IK3A 3WY3A 3P2DA 2XXMB 2X4QB 5BJTB 2ZKMX 1MNUH 2AQPA 3L4UA 4NQEB 4TNGA 4I7ZC 4N2AA 3KJ6L 4WFFE 2XY1A 1K4CA 2MHAA 1A7BA 3OD3A 3N9GH 4ZNEE 5D1QD 5FUZH 5KSBA 1WP6A 4WWKC 1ZVSA 4GG8B 5GGQL 1VPOL 2AGJL 4JKMA 4JBSA 4ODUB 2BCKB 4HS8L 1HEZA 4UT6L 4UOW0 3FN0L 5DEFB 1SXNA 2EH8H 3HRZA 2C9RA 4XVSL 1N10A 2VLKB 4UV7L 1WISA 1D7DA 1K4DB 3BKYL 2ZP9A 3B5GA 5EUOB 4AKOA 1IGFH 4N5ED 2OM5A 1TTGA 4QGTA 3EFDH 3WKQA 2FQEA 3GMRB 3UBXG 4XN0A 3L9RB 4DKAA 1LXMA 3QCTL 2Y2WA 1SMDA 4I9WD 4M8QB 4IOSA 4PGEB 4DGIH 5I5RA 2EUWA 1GS7A 5H35B 1E4WL 4H0LC 2DIEA 3NCJH 4BELD 1YN7B 3VGEA 1JWUB 2L7JA 4MX7A 2C4FU 2WO3B 4UYPA 3UBFA 3GSQA 1LE5B 1MHHB 4Y2LA 2PYGA 4JG1H 2NY1B 4DETA 2X4QA 3KHOA 3Q2NA 3QUYC 5BJTA 4NQEA 2F1BA 4K9EL 1FGNH 5CKGA 3RIAK 3IGAB 1RJZB 3VXOB 1GAFL 2G4GA 2XWDA 2YHGA 4JKWA 3T4AA 5JOFB 4GG8A 4ODUA 2NY3B 2EDMA 2BCKA 4FQJL 4UQ3B 4M3HA 5KN5B 3QDGE 3AMKA 1QPPA 2VLKA 2B08A 1K4DA 5EUOA 4YHIB 5FW8A 5F1SA 3VFMB 3AABA 4N0UE 3GMRA 3ULUH 2YJQA 3LNIA 4A6YH 1NCDL 3L9RA 4JHAH 4PGEA 2KQMA 2ZG3A 5H35A 4OVUA 1YN7A 3G9AB 1LO4H 4DEPB 3BFQG 4EBQL 1S7VB 5DGRA 3VD1A 1UH2A 4TL4A 2BZCA 1LE5A 1QVOB 4MRBA 3G6AB 1KIUB 4RFNC 1EGJL 4W4NA 4G9DB 4LAQL 3LXAA 2EIEA 4X50A 4QUOA 1B4RA 1KC5H 1OAUH 2APTA 1RJZA 2J56A 3HVDA 1AGCB 1AGEB 3IGAA 2HPOA 4JE0A 5DJAB 3CXHK 3QPQD 1UM4L 4IIZA 4P5KB 1WAAE 3SDDC 5IMLB 3VXOA 4FABL 1R0AL 4F3FB 5JOFA 3BEVB 3TBTB 2SEBB 2CIKB 1U91B 4Y88A 3WXVH 3PXJA 3P1VA 4I87A 5KN5A 1U2HA 4JY6B 4XMTA 2VW7A 5D1ZC 3AACA 2H0EA 4HIQA 1XWVA 4X5PA 2XN9B 4YHIA 3TYFB 3VFMA 2CSPA 4OJPA 4XORA 3VGDA 3D0VA 2HRPL 2ZNXA 3HHRB 4K2UL 4A66A 3EH3B 4CC4A 2HH0L 1BMWA 2E7LA 4ZXBC 4BK8A 5KSBE 3IYLW 1WPCA 8FABB 2ZXAA 5DZOA 1S7TB 3BFWA 1H0DB 5L8JB 3L9BA 3FF7A 5FYJD 2JK5B 4OH2A 4R84A 3B83A 1S7VA 1HU8A 2ZE0A 2Z7WA 3BAJA 1KIUA 5BV7C 2HT3C 5CGYC 1ESOA 2R0WH 4G9DA 4YSRA 3SPHA 2VAJA 3WTTA 3ZE0B 2AP2A 3N85H 3C08H 1AGEA 1MHEB 5DJAA 3SGJA 4P5KA 4R2GB 5IMLA 4Z7VF 3UC0L 3MRBB 2VC2B 4X6BB 4F3FA 3BEVA 5I6XB 3CLWA 3Q1SL 3TBTA 4ZD3H 2SEBA 4WEBH 1FA4A 1R24B 1U91A 2WQUA 1ZS8B 4P5TC 5K33A 4JY6A 5T1MB 1HH6B 5JPMC 5DK0B 3X13B 2FJHB 1AJ7H 2K3TA 2XN9A 4NQEE 3B9AA 3TYFA 1CLCA 2GG1A 5FHBL 4XAKD 5DFWH 4OF3A 1DVZA 4HG4K 3BW9B 3MA7B 2QZQA 4JFWA 2ZCZA 4FLQA 2VIRB 3NJVA 8FABA 4FFZH 1H0DA 3QRBA 4OJEH 3IMSA 1NSNL 2W94A 3F01A 3QUXC 1QFWH 2JK5A 3COOA 1AACA 2GBUA 4UOQA 1G6VK 2VLKE 3LMJL 3QXWA 5B3JF 5IKCB 2J1ZA 4IHOB 1KB5H 5EUOE 4L48A 4ZT1A 4HLZH 3T8VA 3THML 3IJYB 3D12B 3EGXB 1CLWA 5CR8A 2VKXA 5KAQF 1ZOXA 2FQGA 1NMAH 1NM4A 2D7MA 4PIRF 1R3IH 3OGCB 3MRBA 2J8UB 4X6BA 5AW9B 3RE0A 3SOBL 3D39B 2WLYA 2AJUL 1E5BA 3DSNB 4PUBL 3GJEB 1R24A 3QNXB 3NTCL 3WKNA 3U82B 1ZS8A 3AITA 4GEIA 4G6JL 4XNBA 5K5YA 5T1MA 1HH6A 2H45A 4GOSA 5AMVA 5DK0A 3L3GB 2OAAA 3X13A 4YEIA 5J7CC 2FUQA 1OCRB 3BW9A 3MA7A 1S9XB 2BXZA 1HZLA 4ZUVB 1Q0YL 4R4FH 1UQSB 4P06A 5E03A 5AWNH 2VIRA 3QUYD 3PGCB 2GUYA 2NQDA 1V7NH 4KDWA 2VLJD 1PFCA 1JPSH 1PLAA 5IKCA 3EFFB 5C2BL 5C6PB 3EJRA 4UT7L 3BUYB 2P5EB 3IJYA 1I3GH 3HS9A 3ZL1A 3GWJA 5BS0D 2ZXBA 5D7SH 3EGXA 2JTDA 3DNKA 4UZSA 2R9HC 3QUHA 2C1PB 1TYWA 1J05B 2YD3A 1DVXA 1FGVH 1MI5D 4OM1H 3OGCA 3HUJE 1IAIM 4ZI8A 1K3IA 3IK2A 2KS0A 3DSNA 3I6LE 3ILEA 3QDHA 4IU2A 3GJEA 3QNXA 4QOKB 4XXWC 5DFTA 3MI6A 3X12A 1OAJA 3L3GA 2OMNA 1MXDA 4YQXL 4XP4L 4GMTH 1C7SA 2W9LA 4WJG3 4AV0A 3HE6D 3BP7B 5DC4B 3OLDA 4YDJB 4QRQB 4YLBA 4ZUVA 4MQ7B 4K73A 1UQSA 3NK4A 3ARQA 2X4OB 5DS8B 4YDKL 2FJSA 3PGCA 4X7CC 3VM7A 3L8QA 4PJIB 2A0LD 4PCTA 1S7SA 4AJ0A 4FQQB 3EFFA 4JRYD 2AZAA 2XN9E 4FS0A 2P5EA 2WXJA 1I7RB 4U49A 5DJXB 3V9CA 3GMNB 1KYDA 5JYLA 1J1OH 5SWSB 3D4CA 2C1PA 4FQ1L 1H3GA 1MY5A 1J05A 1CPUA 1RXLA 4B3VA 3WNNA 5KZCB 4O4YL 2FX7H 2MEJB 4WY7L 3P11H 4YHYC 4Z8FL 4QTHB 2IGLA 4NO3B 2J25A 5JOEA 4HH8A 4OFVA 2NXZC 4QOKA 4BQ8A 3E9UA 3H8NA 3IMRA 4XNDA 4NHCH 1JZ2A 3HTLX 4GBXD 2Y1AA 1P4IH 3VFNA 3ZE0E 4B3EA 2QPEB 3BP7A 3BSHA 3MACH 4QIRA 4YDJA 1H19A 4QRQA 3Q9QA 3SE8H 3UJIL 3WI9A 1QR1B 4YZ0A 4YX2L 1AS7A 2HG5B 2IMMA 3K2UL 5DS8A 2X4OA 4NPKA 1U8HB 1UD5A 5C0AB 5CILL 5CINL 1BM3H 4QRUB 2ZD0A 4LLQB 4ZW3A 4TSAL 2YA0A 2A99A 3FQ1A 4MJHA 3OZ9L 4RGOH 4WUUB 4FQQA 1ASPA 5CJQL 3BZFB 4D9QD 1L9TA 4CMHB 4S0SD 4OLVL 4XPAL 3UCRA 1WFMA 2NNXA 1I7RA 5DJXA 2RALA 3GMNA 5DZVA 4FZ8H 1WA0X 2XRAH 1FZMA 5SWSA 3DI2B 4P5TD 1OK8A 3JUYA 3I6KB 3SY6A 2X42A 1TCRB 3X14A 1XH1A 4QTHA 3NACL 5LGJA 1M57B 4K5MA 6TAAA 1D3CA 4UINH 3GQ8A 3L3OB 4CVZB 4XM3A 5HVGB 3AQXA 1OGMX 4MZ3A 3ARBA 4NSKB 4LGSB 3HAEG 3U6XS 3JV4B 4N86A 1F90L 1H3TA 4WF7A 1RIUH 4YEEA 1QR1A 1S7XB 2HG5A 4KMTL 5F9WC 3HS0B 3OKYA 1U8HA 1HIML 2K6ZA 5D7IF 3DBSA 5C0AA 1JGUH 4AQAB 4QRUA 2AJSL 1LDPH 4GY4A 4LLQA 4EIBA 4P2QB 3LQAL 3OB0K 4PWJA 4UAHA 3K80A 4WUUA 5EU6B 5FAAA 4W8TA 4XMYA 4YCQA 2K6WA 3BPOB 3DDFA 3NEEA 4PW9A 1KPRB 4ELKB 2X0WA 3NOIA 5K1NA 1KIRA 4AT6B 5F96L 5FYKE 1K4ZA 2HTLC 2WSDA 1TPXB 2VDRH 5GZNC 1PG7L 2XPZA 1BYOA 2YXWA 3REWB 1RZQA 2FVNA 3I6KA 3RBSA 5KJRL 1AQHA 5FV1L 3BD4A 1TCRA 4HT1L 1WH0A 1DFBH 5EC2A 1UM5L 3N6ZA 5F7WC 5EZPA 2BS9A 4PJ6A 3QT2A 1FPTH 3X3GH 2PP8A 3L3OA 2WSKA 4N24A 2P5EE 2Q2LA 5T3XD 2BOCB 2QGBA 1SLUA 4IRJB 1DTUA 3AG2B 4NSKA 3B37A 3VA6A 2PCXA 4P3WA 1S7XA 3HS0A 4GINA 4P4KA 3IXTB 1ASOA 1DQTA 4BE6A 2XTXA 3SDXB 4G7RB 4QOKE 2DBLH 4AQAA 2AABH 1QSEB 2QSVA 4XH2B 2R9HD 1MVUB 4P2QA 3UYRL 2G30A 1AH1A 5F6IB 2VZUA 1L3NA 3HZ3A 3GJFA 1H3VA 3S36X 1ETZB 4XO4A 4WHTA 1BQSA 2HYMA 3GHEH 2B4CL 4ELKA 2NZ1A 3OSVA 2ZAHA 1QI3A 3REWA 2ZWNA 3N0PB 4N2DA 3JYBA 4OTXL 3PIQB 1EZGA 2ED9A 1KENH 4XMZA 4S10A 1OD7A 5CJXA 2VB5A 2D03L 1YECL 3G6JA 2Y22A 2IG2L 3BWSA 2VZSA 2BOCA 4IRJA 1OB1B 5ENWB 5EO1B 1K5CA 5SWSE 5KBDA 4CJ1A 2JXMB 3S0PA 2IPUK 4WU5B 3N41B 5IUCA 4AGQA 1MCEA 3IE4A 5F3FA 1WAPA 4DP9X 2WXIA 4JHZA 3SDXA 4NIYE 3SDCB 1QSEA 4XH2A 3WY4A 1MVUA 4LSRH 4P07A 1EXUB 2KERA 2SODB 1MNUL 3PP3H 4BH7B 2D7OA 4UZUA 2JCCB 1ETZA 2WZ6A 4XVUC 2J55A 1HS6A 1JOIA 5BCAA 3BMVA 3HBZA 5ISZB 1IGIH 1HWWA 3L5HA 2QVMA 1ND0B 2UXGA 5I1GH 3Q3GB 5C0AE 4APXB 2VR8A 3FSAA 5E5MA 2EH8L 3D48R 2NDGA 4DK3A 1UOVA 2AQRA 1ZE3H 2XQBH 3AREC 4WUUE 3A4EA 1U0QA 3FT0A 1IGFL 1RK0B 4R90L 1NZRA 4EJ1C 4JG5A 1E3ZA 3VYNA 3OQ3B 1OB1A 4Z9KB 5ENWA 5EO1A 2EE6A 1A4AA 1UJTA 3NCMA 1M2VB 3SE3C 4DIXA 1XV8A 2JXMA 3QNFA 1JHKL 3NCJL 3PDOB 4WU5A 2QLVB 5LAPA 3ULVF 5FUCC 2YLHA 3IMWA 5LGHL 1JD7A 1W0WB 4NC1E 3QC5X 4JG1L 1JPGB 1EXUA 1XGQB 5TE7H 1OP3K 4P9HL 4PJ9D 3QC6X 4FI7A 1FGNL 4BH7A 4D3CL 2JCCA 5JDSB 1MPAL 3DTXB 3EYUL 5ISZA 1ZMYA 4AUUA 3NABH 4ZODA 2K6YA 4N2IA 2TRHA 4X83A 1ND0A 3QJOA 1T7VA 3Q3GA 4N90D 4APXA 2WKOF 4RNRB 4MQTB 4FTDA 3FN9A 3ZDWA 3E2HB 3LKOB 4P2QE 2VJJA 2WQXA 4V11A 3K72B 3MJGX 4NAJA 3QZLA 4AVKA 3S37L 1RK0A 3O6MH 4L0PB 4G8IB 2IPUG 5T1LA 3RZWA 3ULUL 3P30H 2EDWA 4PJDB 3L4ZA 4A6YL 1UWEH 5I1LB 1EV2E 3L3IB 4JHAL 2O1DA 5DD1H 3UCQA 1M2VA 4IK7A 1P1VA 3C75A 2P8MB 4GFXA 3PDOA 2Q1EA 5BQ7B 1MWAL 1QHOA 1TYJA 5IVXF 4PP1C 5D7LB 1G6RL 2M83A 2VZOA 2XZQL 3PL6B 4MQXC 1W0WA 4UDUB 1KLUA 3WNJA 3RL2B 4AYMC 3MV8D 1F4YH 1XGQA 3G6JE 2QBWA 5EBWB 5JDSA 4OGYH 1IZJA 1H8SA 3DTXA 3GQFA 4F91B 2NY5H 1ACYH 2A3TA 3T3MB 1NL0H 3L5XL 4OCXL 2ESVD 5FB8B 2UX7A 4YZAA 3OZKA 4RNRA 3SDXE 2MTPA 1U33A 1HWGB 3BUPA 1CLOH 1QSEE 4PSPA 3N1FC 1L1IA 3VI3F 1V54B 3LKOA 5FUOL 1SPDA 3R1GH 3K72A 4A2LA 1BXAA 2QR0B 4E36A 1WAEA 1OZTG 1L9RA 1PCXA 2FE0A 4XPGL 1TJHL 4G8IA 5EA0H 5E9AA 4A7SA 4PJDA 3US1A 3SBPA 4R5XA 2WJ7A 5I1LA 3DJTA 3L3IA 2IO5A 3AU0A 1LWRA 3QB7C 2P8MA 4ADIA 4L8CB 5BQ7A 2UUDH 2OV0A 3CN3A 2CGRH 2NR6A 4PBDA 3DX7B 3SQBB 2BHZA 2G2NA 3PL6A 4EIZC 3UAFA 4LEBA 4PBXA 5D7JC 1WXRA 3IM1A 1HL5A 1SQ2N 5CNHA 3ARVA 3IAPA 2NZ9C 5D5MB 4PH8A 3U1PA 5K39A 1R34A 2PCPB 4FN0A 4LDLB 5EBWA 3S35X 3CHXA 1OE1A 4GRWF 4UM8B 5HHNB 3L95B 2ZOWA 1E40A 2NZIA 2QJDA 2APVA 2YO3A 5DRZA 4HZ1A 3B2PA 4XBEL 1BFOB 3ZPPA 1CL7I 4NPYB 1OOWA 4WEBL 4FCHA 5FB8A 5J11C 2D0GA 4GAAA 4K8RD 3MRRB 2GYSA 4Z7UB 3F05A 4U0RB 2Y07H 3QJSB 4ZMYA 2QR0A 1AJ7L 1MLBB 5E8EB 5TE4H 2F61A 3O6KH 4MB1A 2JCCE 2AEPH 3ARRA 1KV3A 5ISZE 2QQLH 4HMCA 4JPSA 4PGBB 2BVQB 2ENPA 3FSWA 3LEXB 1WF5A 3AXIA 1N9PA 2X3BA 2E75C 2BDNL 4FFZL 4L8CA 2D2OA 3Q2LA 1TQTA 3MREA 1QFWL 3L16A 4PJCF 3DX7A 3SQBA 5TQ0H 1UB6B 3TIDB 1AHWC 2LFGA 1KB5L 2E59A 5IQMA 4GMSH 4C4UA 5D5MA 3GSNH 4AI7A 4G9FB 2R8SH 3D2UB 1ZD6A 4HC1L 2QHRH 5HHNA 4UM8A 3TGXA 1YRKA 2ZOLA 4NZRH 3O2WL 3PG2A 3L95A 1HHIB 3SBWC 1TOXA 4PVNA 1TTAA 4FP8L 1BFOA 2TRYA 4KOCA 3RIQA 4NK6A 4NPYA 2WVUA 4ZPTB 3MRRA 5C0JA 3PABB 3DOSB 4Z7UA 1SYVA 2GIYA 4HHGA 4RZCA 1MLBA 3L48A 4W68A 5E8EA 5TQ2L 2AQ1A 1IUZA 1ID2A 3CX5K 3CVHA 4L8SC 2R27A 2EDEA 5AEAA 5GGSB 4NYLB 4PGBA 1UZ6E 4M7LL 4R4FL 2BVQA 3LEXA 5DF0A 3VFGH 1IT9H 3OJMB 3AGVA 3SQOH 1GHFL 4OF8A 1AMXA 3EH2A 3U25A 2BWQA 5T1DH 1V7NL 1O8HA 3L5JA 2IH9A 4NZTH 2WJ5A 1BFTA 2FR4B 1UB6A 3GT6A 3TIDA 1DCLA 3O2DH 2YFNA 1XZWA 1FCCA 4C8XA 2GVYA 4Z7AA 4G9FA 1I3GL 3D2UA 4PJDE 4YDIL 3F58H 3N42F 1PSKL 4NUGH 3ZYZA 5CS7A 2YA1A 1U30A 3WE1A 1FH2A 2L3BA 1HHIA 1Z9SB 3PWJB 4LVHB 4OM1L 3CZGA 4YHKH 2LU5A 4OI8A 2FJFB 4XQFA 4ZPTA 2MCMA 3WNMA 3NJHA 4XNMB 1G84A 3PABA 1BVLB 3DOSA 4PGDB 2BM4A 4GG6F 2CGZA 3QQ4B 3CD4A 2KZ1B 5J12C 5I75C 1KTDB 3Q44A 4JG0H 3WS3B 2YD9A 2IDTA 3JWDL 3MJ6A 2B7DT 3AZUA 3IT8D 4PY8I 5GGSA 4NYLA 5TK2A 1X5FA 1Z9NA 3T3ME 3LEVH 3BVVA 4MLIA 1RVFL 1DQDH 3OKLB 4EOWL 4L9LC 2NY0C 5D1XD 1HKLL 5E94B 2B77A 3UC2A 3OB8A 2HTKD 2RD0A 2CRZA 2GI0A 3K7UA 4XI5D 2YRZA 4F20A 2FR4A 3KL0A 4B7IA 4KUCD 5DQDH 2ZYIA 1J1OL 3MLTB 5CEZL 5HGDB 4HJGB 1A22B 1AXIB 3VNZA 3T2PA 3PFUA 1Z9SA 1KEML 2OMYA 3KLDA 1IBBA 3P11L 3PU7A 2AJXH 3FT9A 2FL5B 2OSXA 2FJFA 4CN6A 4FXTA 4XNMA 4BSJA 4R0LA 4G5AA 4NHCL 1AYRA 4PGDA 4XZ4A 2YGPA 2DQUH 3MRGB 4LK4A 3QQ4A 3JX8A 1KTDA 3ZYJA 1BD2B 2FGWH 2MOVA 3GBDA 3JV6B 4N3TA 4TN9A 4AK1A 1IIKA 2R29L 3SE8L 4A2MA 4LDEB 2BIQA 2FO8A 4OGXL 3NP4A 1TJGL 4RSYA 3OKLA 1P9MC 5E94A 4QY8B 4Z7UE 2HZHA 3RZCB 5G4NA 3BIKB 4AQ1B 2AV1A 2X38A 4JO2L 2VBEA 1JD9A 3AM8A 3FZUD 3P73A 1CIUA 1F2QA 1L9OA 1NPUA 4U3SB 4X4ZA 3WTXA 1GGIH 2XRAL 3MLTA 5HGDA 4HJGA 4F24A 2A9CA 1BPLB 3C5SB 2X4TB 3CHRA 4WIQA 5JXED 3FQTB 3FTGB 4Z7QB 2PWFA 2FL5A 5GSVB 3ZSCA 3DHPA 2ALAA 2KI6A 4G70B 4OCYH 3L5IA 4QD2E 3SKMB 5JW4Q 3MQIA 5K9JL 2EJ1A 1RZ8A 4RLDA 1DZBA 4G1MB 3NCCB 2D7TL 5JZ7D 4ODTH 4G9FE 5D96B 5I66B 2BINA 2WTRB 2ENYA 3JV6A 1O0VA 3FT1A 3KYAA 3H9YA 1J0JA 4B0MM 1RIUL 4D9RE 3GJFH 3WNPA 1MELA 1ZS2A 2ED8A 2OPCA 1MWAB 4NN6C 4NKMB 5T1KB 3UGXA 3GO1H 4KXCA 1MJJB 1G6RB 1LDPL 4QY8A 3DO7B 2AEQH 5MI0B 4NI3A 2BMKB 3RZCA 3BIKA 5D7HA 4AQ1A 4HG4J 1BWWA 2J88H 1N3NB 2UXFA 4NWUH 3AT9A 4U3SA 3T71A 1A1MB 5IQOA 1ILSA 2E27H 5JR1H 4MAUH 3C5SA 2X4TA 3H3BC 3S5LG 2AQNA 1TNNA 4LCCA 3FQTA 3FTGA 3E9TA 3GSVB 2W9EH 3VYPA 4DZBB 2WXQA 5EOTB 5GSVA 3QJFB 3S4SB 2YPKB 1LEIB 4JFPB 1URIA 2E3VA 3SKMA 1G7LB 1E7UA 1RUPL 4FNUA 2G3NA 4PJAB 3LZPA 4G1MA 3NRPA 3OKDA 1GZQB 2IMNA 5I66A 1E3FA 1JDAA 1RZKH 5E6UB 1HZHH 2WB7A 4OZIF 2WTRA 4HXBH 5FM5M 1CGYA 4MMXC 2IPTH 1IAIH 3RWGB 2J1XA 4NOFA 1T66C 3QDJD 3ILQD 3KPOB 2F19H 2EQDA 5HBBA 1MWAA 4GXUM 4NKMA 5T1KA 2JJWA 1OAXH 2AABL 4OV6F 1XGRB 1MJJA 1G6RA 4IBWA 3DO7A 3FU8A 3K8LA 5DURB 3VGBA 2BMKA 4Z3HA 1IFRA 4K7PX 5EG6C 3D1MC 1N3NA 2VDLL 3FMGH 3BP4B 1SHXA 1A1MA 3V0AC 3HRZC 3BKJH 2IQAB 2AMGA 4ZW5A 1FBIH 3K0YA 2D7PA 1LLWA 2VGLM 1VFUA 2WN2A 4XOAA 3QR0A 3GSVA 2Z8GA 4DZBA 5KVGL 5EOTA 5B1JA 1VADA 3S4SA 2YPKA 1LEIA 2X28A 4X6EB 4I4WB 4NN7C 5FCUL 2CRMA 1BQ5A 1G7LA 5JHDD 4PJAA 2CBQA 4N2MA 2XY2A 4B96A 1KFAL 1GZQA 4LBEB 1T4KB 3AWFA 1YEFH 5JHLH 3PV7A 5AYTA 3RVTD 1ZWIB 3BC9A 1DN2A 3C09C 2DQMA 2YARA 4RDQG 2DQEL 4Y5YB 2H8PA 2EP6A 2NY4C 4GIOA 4BK4A 1G1CA 4JM2D 4N68A 1LO0L 3NSCA 4QHMB 5F7FA 2WQWA 3L3JB 4WI8A 4F7TB 2WHVA 3LRHA 1PZDA 2EICA 3EAKA 4FFVD 3FCSB 1AG0A 3RNQB 2M8XA 1KCSL 2EIKB 1XGRA 1BQRA 4LDCA 3GKWH 5DVNA 2B0SH 4OJDH 3KW7A 1JPFB 4H8UA 5CGTA 3T4AC 1Z5HA 3BP4A 3KDMA 1BZ7B 4BH8B 3TP4A 4Z7OE 1NIAA 3Q48A 1K6QH 4WFFD 1JZDC 2HLAB 4L5FH 1SUJA 5AAPA 4CDGC 1AFVH 3ZYOA 3BKMH 5KBNC 2ORBL 1QACA 2NNFA 1CTMA 1JZGA 5GJSH 1CDIA 1GOGA 2JKTM 2W91A 2XQBL 4I4WA 4KTYA 4MNQB 5HI4D 3DETC 3LD8B 1XB3A 4UIKL 4LBEA 4WO4B 1T4KA 3OBAA 1FL3B 1GOFA 1ZWIA 5CIPB 5E9DD 4XO8A 2K4WA 4Y5YA 4S1RH 2P9RA 2EDNA 4MS8C 4QHMA 1WHPA 3NESA 4R7VA 3L3JA 4F7TA 2VZ1A 4Z7QE 2DM7A 1XO8A 1EBPA 3FCSA 3RNQA 1NC4B 4TQEH 5FO7B 2F1AA 4EQ2A 1X5MA 4OF5A 5TE7L 1JPFA 1F6LL 1PF3A 2JKRM 1U3YA 2FAUA 5CLXA 1BOGB 2CCLA 2QFPA 4N8CH 1MCSA 2ATPB 2NY3C 4BH8A 1BZ7A 2E9WA 1LYQA 2ZONA 2TAAA 4H44C 1TNMA 1J1PH 4MMYB 2OA9A 1VBLA 1RV6X 2HLAA 2ZWKA 4JPWL 5C2UB 3L54A 2IWKA 3QZMA 3VRJB 1T1ZB 1LK2B 3QRGH 2WXFA 4YEFA 4O58L 5GS2D 3GRGA 2YKKA 4MNQA 4CC4C 2E7LC 2M26A 2MQCA 2GTWB 3ZE1F 5F71A 2WBKA 1FDLH 2DH2A 3VXMD 5KSAA 3O6ML 5AVVB 3P30L 1FL3A 3QIWD 4DEPC 1UWEL 3MU3A 5CIPA 2WINB 4K3EL 3ZBMA 3QWRD 1EX0A 4LBAA 5DD5L 4XN8A 4ZFOL 5DT1L 2BSBA 1A2YB 3FQYA 5T3ZH 4NQUA 1OTTD 4NM8H 1NMBL 5ID0B 1INEL 2WP3T 3BOVA 3TXAA 4YXLH 4MXVF 5FO7A 1DL7H 4DP8X 4PB0H 1QI4A 4PJAE 1G43A 1VGKB 3SGJC 1HJBC 4BFEA 1K3ZA 3RAJH 3CPUA 4J4PA 4NT6B 5IROD 1P4BH 1BOGA 4NO2A 1BF2A 2ATPA 2PW1B 4TSCH 1XIWB 3SCMB 4OGYL 1YYLH 3U9WA 4MMYA 4RGMB 2NCMA 3DK0A 1ACYL 3O11B 5FYLD 3H54A 3MUHL 1NL0L 1SXBA 1VIWA 2NY5C 2VN6A 3VRJA 4QXTA 3L1OH 4NUPA 5HHOB 2CLVB 1A1NA 1YCSA 4Y0GA 5CU9A 1K8FA 3R1GL 3WUZA 4ANVA 4BFBD 1T66D 2GTWA 5LDSA 3IXAB 3AFLA 3ML8A 4GUQA 4TVPE 4GAYB 2WBXA 2N1TE 5EU3B 3OJ2C 2RACA 1BG9A 4N1CA 4Q9CA 2D3JA 2WINA 3HBPA 2XZZA 4JQIA 3ESNA 2BLFA 1X4XA 5HJDA 3I9PA 4U33A 1A2YA 2DD8L 2R0KH 1NKGA 1S5HB 1CFMA 4X6DB 5FDYA 5C71A 2CGRL 5ID0A 4KVNH 2PO6D 2XNAB 4NRYB 4LP5A 4LSSL 4HWBA 1PZ5B 4GXUN 1VGKA 4D0DB 4R2GC 3U6RB 4APQD 3NSFA 1HNGA 2WLKA 4NT6A 3W2DH 5I6XC 4UBDC 4N22A 5IT2H 2PW1A 4J3BA 1XIWA 1NEUA 4AM0B 2G5UA 1GC1C 2W9DL 3Q2WA 4ANKA 4IRZH 3O11A 4M7JH 3N40P 1XFPA 4KX8A 4A7TA 5I1IH 1RH8A 5E1HB 5J13B 2ODIA 3CVHH 4ZMZA 4ZNCD 3WTUA 2FHBA 1IM3A 4HU2A 4HXAH 4ZMAT 5HHOA 4S2SB 4G3YL 5F7HA 5DUPH 2EINB 2Y07L 5ALBH 5TE4L 2HRGA 3O6KL 2ZYSA 2X10A 2AEPL 4GAYA 2AK1L 4FLHA 5EU3A 4DKTA 4LT7A 1CE1H 1M9SA 5EWIH 4HQQH 1NUFA 1E4KC 2AQ3A 3QULB 2CMRH 2JKNA 2R29A 4JRLA 2YAPA 3HA0A 4FHKA 5AKSA 4PRIB 1I82A 1MOEA 4JCLA 2R15A 1S5HA 2VXUH 4X6DA 1HKFA 4HAKA 3L3KB 2JJVA 2BO0A 5TQ0L 1HQRB 4JL1A 4NRYA 4UM9D 2C3WA 4MNQE 4XNXH 1U8KA 4L4JA 4H5SB 1PZ5A 2VLKD 2Z8SA 1KGCE 1E4HA 2BCMA 4PBWD 4H20L 4D0DA 3IETB 3U6RA 1I8IB 1BF8A 4YN3A 4BXVA 4TUOB 5LAXB 3LZRA 4NZRL 4YBLB 4AM0A 1Q9WB 2YIHA 3QZBA 4HWEH 4M7LT 5MEQB 1SJXA 3CPLB 5IHUL 5ESVA 3BPNB 2INVA 4K3JH 4M43L 3W38A 4CA4A 2XC8A 3KE0A 1BZEA 2HFGL 1HHJA 3CVBA 1XL6A 1UOLA 1S4IA 1ZLUK 4S2SA 3EDFA 3K5SA 3MYJB 2ERJB 3L5WB 1YEKL 4IOFC 2NY1D 2OSWA 4W9KC 2VZVA 4A7GA 3MUY1 3RDTB 3VMOA 5ADOH 4E9LA 2V8LA 4GRLD 2J8IA 4PY7B 3QULA 4XCYA 2AS5M 4CAGA 4LSQL 1IT9L 3SQOL 3M6DA 1MCLA 4H8HA 4PRIA 4WNSA 4YSAA 3C5JA 3NJLA 2NY3D 3L3KA 3V6ZA 4DW2H 1HQRA 3KPLB 1M7DB 1GJWA 3O2DL 3QG6A 3IETA 1ZLWK 2VDLB 1I8IA 4KK5D 2E6QA 3F58L 3DKHA 3VI4F 3ES6B 4JFQA 4TUOA 5LAXA 4N2LA 3PGFL 4OSUL 4GUOA 1Q9WA 3MRHB 2BXYA 4EDWH 5MEQA 3CPLA 1JPTH 1RUKH 5EOQH 1Y07A 2L7EA 5BO1L 3RB7A 3O8XD 4GXFA 1RERA 2N56A 4RX4D 3FU9A 3MYJA 4FEIA 4JREB 3UAJD 3Q8CA 4JG0L 4U0QB 4N2CA 3QQXA 2X4UA 3RDTA 1DLHA 1EUUA 2HT4C 3QUKA 3DSFH 5FDWB 3VE0B 2GI7A 3I50H 4U6TA 3EJUA 4PY7A 5T1JA 1UCTA 3LEVL 4J6RH 1DQDL 4AEHL 5HYEA 1UT1A 2CA3A 5TDNA 1MRCH 3CLEL 2YSTA 3A6OA 2F1EA 4S1QL 5HHOE 3MCKB 4MCYA 4YDTA 4TMPA 5A3ID 4DO5A 3W81A 1RK7A 1E3XA 2EDXA 3A21A 3BH9B 5TTRA 1EUTA 1WLHA 3CK0H 5DQDL 4JO1L 2JB6B 5F7AA 3WS6A 3ES6A 2WZ5A 3B9EA 1FNLA 1B3JA 1W72B 4Y2OB 5IBTH 5DHXB 4H26B 1XGYL 4UT9A 4X6DE 2LAAA 3BAEH 4BRVA 1KCLA 3G04A 4FAAB 1FC1A 5TJWK 2Y7MA 3ARBC 5MP6L 2QPSA 5LVEA 1T2JA 4U7MA 4R7XA 4HD9A 4YBHA 3RPKA 3NJJA 4JRFA 4KZDH 1BFVH 4XOCA 2WLJA 2DH3A 4GLRI 4BKTC 3ARGB 5FDWA 3VE0A 1RIHH 3OJVC 4Z77B 4FFYL 3RQ3A 2XWJB 5DVOA 1AY1L 4N2EA 1EFXB 5HY9A 4JKNA 3BZEB 1MF2H 4XVTL 4CMHC 4UBDD 2VXTH 3B2VH 3O2VL 1UM6L 2WV3A 4Y16B 3MCKA 3TPKA 5HI3D 4JZJA 4ANWA 3RFZB 5C6WH 1MCDA 4LNRA 2BM5A 3BH9A 1VFAB 4YHZL 1AQ8A 3ZR5A 3D0LB 4P4RB 3O9WB 3QW9A 4OCRH 3UL4A 1HAWA 1A9EB 1TU2B 3GRWA 1U93B 1W72A 5C0FB 1WFOA 1KN4H 4H26A 4NC1C 4PRIE 5F0LB 4G7YH 2WLHA 3NSYA 3FUFA 4ZMXA 3L3OC 3FFDB 3FO0H 1HXKA 1PG7X 2FEDC 2MQGA 5I23A 4OCYL 4ETQB 1P53A 2FX8L 1TSPA 1AO7D 2OJEB 4OJYA 3CU7A 1EJ8A 3L81A 1TVDA 2DQJH 3HS0C 4P4KC 1HXMB 2B0RA 2YR3A 4X4XB 4P3DA 3VWJB 3CMOH 3GXFA 3IFLH 4HUWB 4QLWA 1XGTA 1NDMB 1USQA 4Z77A 5CM1A 1EFXA 5K9OB 3BZEA 5CLTA 4TRPH 1X3DA 5LWYH 1UOKA 1B88A 1YEEH 4BXSV 3D39D 4YE0A 3BPOC 3CSFA 4Y16A 2WAHA 3RFZA 3LPOA 5LNEA 5FOBA 2DJMA 1TPXC 2J88L 3CHOA 1VFAA 3CFKB 5HHVL 4ETYA 3D0LA 4P4RA 3O9WA 2CUHA 1FHGA 3HG0A 1KIQB 1A9EA 1TU2A 5AKRA 1U93A 2HKHL 1UH3A 2YJLA 1S9WB 5C0FA 5CJXC 2CBTA 4KXZH 3KPPB 4YWGH 2W9EL 3FFDA 4KTDH 1KB9K 2UZXB 4IRJC 4KJQC 4QRRB 4ETQA 2Y69B 3ZTJG 1H8NA 2CHWA 5BUPA 2OJEA 4DTGL 4PWHA 5E99H 1KZYA 1YEIH 5D4IA 1J7VR 1RZKL 1HZHL 4EKJA 1HSAB 4AVIA 1HXMA 3ZKND 4OB5L 6FABH 4X4XA 3VWJA 2UZIL 5MERB 4V02C 1INDL 4JK0D 3I84A 4HUWA 3PSSA 3HG4A 1NDMA 5F6IC 3DV4A 2K8QA 5AVRB 3ECUA 2F19L 3ARDB 3S98A 5K9OA 1RK1B 1JZEA 4NLHA 4L3EB 5E8PB 3QWQB 2PPCA 1RIVL 4Y4KD 1RZJL 2C26A 2MNWA 2QVTA 3WXWH 4Y8DC 4YXKL 2BZ7A 1HYSC 3CFKA 1FG2B 3EZ8A 3H3PL 5C0CB 4NC2B 1G0YR 5HDQH 4ZX4A 2Z34A 1SY6L 3EG9A 3GBNL 1YEGH 5FM4A 1KIQA 4DOHB 3GZQA 4JFHE 1C1EH 1PIGA 1S9WA 4X6FB 3KPPA 4XMLH 4LASH 1XF2B 2VDQL 2FRGP 2V4LA 2WXPA 1AVAA 4DKDC 1EQWA 4LFHD 2J1KA 2UZXA 2WZ0A 1J8KA 5GRVK 4FQLL 3MRPB 1DANT 2OX5B 4I84A 5AL8A 4PSRA 5E7FA 1Z3GL 5JHLL 2QDVA 1G7PB 3KGRA 4PJXF 1NAMH 2C5DC 1HSAA 1KEGH 3FT2A 2VMJA 5F9AC 1S7WB 2VQTA 3B9DA 3FCUB 4QCIB 1AIFB 2PXYD 2NY2B 4A37A 1BIHA 4MWFB 3ARDA 1T2QH 3T8XB 1RK1A 4LEOB 2QZAA 1FFPB 4EXPX 4L3EA 5E8PA 3GKWL 2P8LB 5AZUA 1GH7A 2B0SL 3QHFH 4WGKA 3SE9L 1BJ8A 3B9KD 2VN7A 1T7WA 2X53A 3FTUA 2L8AA 1OP3H 4HBQA 1FG2A 4J3TA 2ENJA 5C0CA 3MLXH 2O5YH 4JY5H 2E9BA 3N44F 1OM9A 3TH2T 2WZPD 4L5FL 4X6FA 2GSMB 5IBLC 1XQ4A 5C86A 3LKQA 1XF2A 3BKML 3NSDA 5DS2A 3MRPA 4NO0B 2OX5A 4F93B 3BIAX 1NGQL 4PV9B 2XV3A 5IOPB 2MCG1 3RFRA 5H4ZA 1S78D 1G7PA 5E8OB 2J44A 2X12A 4HULB 5GS0L 3ECBB 1TMQA 1NM9A 4LKCA 1S7WA 3LH2H 1TYVA 3MBWB 4QCIA 1AIFA 1ZIAA 2IOMA 1RHHB 1KULA 1KY6A 4MWFA 2XJLA 1H3PL 3L1EA 4LEOA 4TQEL 1FFPA 3E6FB 5C0BB 2FO4B 3ZZSA 4WU7B 3QISA 1SOKA 2G0LA 2P8LA 4NP4L 1HDMB 2V5YA 3ZQWA 4PW4A 1DABA 2WLLA 5GGTL 3ZX1A 2QGCA 5AAWA 2E7BA 1BBDH 1CJYA 5H37A 1AE6H 1OTUD 1M4KA 2I69A 3BGFB 4C4KT 2VFPA 1J1PL 5ALCL 3LYCA 1BCIA 2M2DA 3CQPA 3E2HC 3RIKA 4J3OG 4M3JA 1BGXL 3QRGL 1R75A 3B2MA 4JFSA 4GAGL 5ESAB 4NLAA 4OJOA 1A64A 1RCYA 4F9LA 2IQ7A 3SPGA 2BM6A 3IFOB 1XF1A 1R47A 1ZANL 4NO0A 2YD1A 2V5RA 4PV9A 1LP9B 5EU6D 2IOUG 3MFGB 5IOPA 4D2NA 5E8OA 3ETBF 15C8H 3MDJA 4HWBH 3ECBA 2NR6C 2GEEA 3MXVH 4C58B 3PL6C 3MBWA 1FH5H 1RHHA 4Z76A 3GDBA 4NX0A