3VSVA

The complex structure of xylc with xylose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 239
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vsvA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vsvA01
3VMOA 3WMSA 4E2OA 3LXBA 2ZXDA 8CGTA 5HDRA 4W8SA 3BVTA 3L4XA 1R75A 1VFMA 3LMWA 4XL9A 2FHFA 4NZFA 3WNNA 1VJSA 4OKDA 2X2HA 4FNRA 3GXDA 1G1YA 1UA3A 1CGWA 2DIEA 3RILA 1CYGA 5AMVA 1UH4A 1GJWA 1XCWA 4J3TA 2C7FA 1KGUA 1ZS2A 1XD1A 1IV8A 2BXZA 2DH2A 4KMQA 4UZUA 2VBMA 2DIJA 3EJPA 3OLEA 2PWDA 3HG4A 3OLGA 4X0NA 4HOWA 2UVEA 1JI1A 4YZAA 4JCMA 1BLIA 4UOZA 2BY2A 1PAMA 4JCLA 4XLEA 2NTBA 3GXFA 3TTSA 1Z32X 2D3NA 2YKKA 1CXIA 2D73A 2XN0A 2ZWYA 3GQ8A 3UEQA 3GXIA 4FLRA 1XSIA 1HL8A 9CGTA 1B2YA 2XN2A 4YELA 3S5YA 3WNOA 4FMVA 1JXJA 2CXGA 3D51A 2ZXAA 3UG4A 3ZOAA 2TAAA 4EW9A 4W8QA 2XVKA 3BAIA 2WCSA 4W8TA 4U3CA 4CN1A 1QHOA 3IJ9A 2PWHA 1QI5A 4OIFA 3CZGA 2FE0A 1KTCA 4BZYA 4YZ0A 2VR5A 1QJVA 2X85A 3DDGA 4XLFA 3D50A 4XQFA 3UG5A 1W9XA 1KGWA 1QCXA 1DTUA 4AIEA 4XR6A 3WWGA 3A6OA 1DHKA 4PMHA 1MW0A 1HT6A 4CN4A 3S5ZA 3D4YA 3WEMA 2NT9A 3K8MA 1KCKA 7TAAA 4MR0A 4URRA 1NHCA 4XB3A 5I5RA 2PWFA 2VUYA 2NT1A 1EA9C 2FHCA 3DX2A 1CGUA 2BHYA 3D4ZA 1CIUA 1QWUA 3AXIA 5CLWA 4NK8A 3GBDA 4CVWA 3A4AA 4FNQA 3CGTA 2NSTA 3WEOA 1UOKA 3ZR6A 2QV4A 4OJ6A 2QX3A 4AMWA 2PECA 2X6YA 1C8QA 4FNTA 3EDJA 2YOCA 4FNPA 2EACA 3IJ7A 2FGZA 3WELA 3VX0A 3DX3A 5E9AA 3ZSTA 4AEFA 4XKWA 4J3WA 2NT0A 2BY1A 3KRGA 2YA1A 3BAYA 4OGZA 1MW3A 4PEEA 3AJ7A 1VFOA 2J25A 1UD3A 1JD9A 4XN3A 4UQAA 1PZ2A 1WPCA 1O8EA 3FY3A 2E9BA 3TTYA 1O8KA 4XKVA 3EDFA 4GQRA 1H3GA 2QMJA 3GRHA 2GUYA 1D7FA 3WDHA 5BRPA 1CPUA 3TONA 1BF2A 2XN1A 3LRLA 2XIIA 4CN6A 4UOQA 4YZXA 2CPUA 5F7UA 1O88A 3WY2A 3CTTA 1V3MA 4DO5A 2F2HA 3SUCA 3ZR5A 4YZQA 1P6WA 4W8RA 2WVVA 3VGEA 3GQAA 3VSVA 4PSPA 1JD7A 1WMRA 1MW1A 4YEJA 4MAZA 1X0CA 2Z1KA 3WN6A 1OT1A 4XLHA 1M7XA 2ZUUA 3KL3A 6CGTA 3BUDA 1PLUA 3HG5A 3ZQ9A 3DX1A 1QWNA 1UD4A 1SZNA 4XOPA 4XNFA 1VFUA 1O8HA 2CHNA 2V3FA 4XM3A 3K8KA 3ZT5A 3L2LA 1RU4A 3BUBA 1TQSA 4MXNA 3LXCA 3VSTA 3HG3A 2Y24A 3S2CA 3BVWA 1MW2A 1UKSA 1RMGA 2YFOA 5E70A 4OJ5A 2G3MA 1EO7A 2F7RA 4GIAA 1XG2A 2F18A 3DDFA 1PIGA 4Z06A 4UQCA 1G94A 4WLCA 3L4VA 1NM9A 1VBLA 1OSEA 5CGMA 1UKQA 3GXMA 1XSJA 2YIHA 1H80A 4Z05A 3BVVA 1O8GA 1KCLA 4NXSA 1TQUA 3AMLA 1QHPA 2EABA 3LRMA 4J27A 2D3LA 4J3UA 3D52A 1JG9A 1TMQA 2Y4SA 4U2ZA 1CDGA 3A24A 3IGUA 2E4TA 5E6YA 4XN0A 3ZT6A 2BY3A 2NTQA 1U30A 2O0WA 4JFTA 1AQHA 3II1A 1Q4NX 1T0OA 3L4YA 1KBKA 1G5AA 2VNCA 3LX9A 4HA1A 4DO4A 1I75A 1WZKA 1CGTA 3CZSA 3L2MA 3VM7A 4UQ9A 1AIRA 1ODUA 3BH4A 3IJ8A 1XD0A 2OW6A 4FLOA 3UERA 3GXPA 4GO8A 4NZJA 4WSKA 4AYGA 1R33A 2DH3A 2YA2A 1E43A 1KXHA 1KTWA 1O8IA 3CZLA 1CGYA 3CZNA 3EJSA 2XWEA 3BAJA 5HPOA 2ZX6A 2ZX8A 1SMDA 1O8JA 2NSXA 1OOCA 2XVLA 1UD5A 2V3DA 2ZUTA 3VNZA 1PZ3A 4UQBA 3WNLA 1CZFA 2EJ1A 3T9GA 1UD2A 3CPUA 3CC1A 5BRQA 1KWKA 2VJJA 1GJUA 1MWOA 1KXTA 3L4UA 2O0VA 3WFZA 1HWWA 2ZUSA 1UD8A 4HWVA 4GI8A 2XVGA 4JL1A 3ECQA 2WCGA 2X2IA 1RP8A 1XH2A 3BSHA 4UCFA 3B90A 4U49A 1JIBA 3TOPA 2E0PA 2ZUVA 4OJPA 4FLQA 1DBGA 1QX1A 2GJPA 4GI9A 1JDCA 4H7VA 1MXDA 3WDJA 3KWXA 4GKLA 3M07A 2NTPA 2ZWZA 3EDEA 4UNIA 1OB0A 1BAGA 3ZSSA 1WP6A 3JURA 1CXEA 4JL2A 2WSKA 4UQDA 4M56A 3UCQA 4ATWA 4HOZA 1U33A 1KB3A 1AVAA 1TQTA 3FAXA 3L4TA 3KL5A 1HTYA 3GQ7A 2WVUA 3BAWA 3VNYA 1PPIA 3BVUA 2ZE0A 2OYMA 2WPGA 1MFVA 1O8MA 2D0FA 3LXAA 3VGFA 4J7RA 4GINA 2EEXA 1KTBA 1LWHA 1V3KA 3GXTA 2PYGA 1IZKA 3EQOA 4AVZA 2YA0A 1QI3A 1JXKA 2WSPA 2XIBA 3BCFA 1CGVA 3BLPX 1J0KA 5DFAA 3BMVA 6TAAA 1RP9A 1CLVA 5CXPA 1BN8A 1Y7VA 3VU2A 3WDIA 3DHPA 1HXKA 2BHUA 1HX0A 3EJTA 3HG2A 2EO7A 3KLLA 4MB1A 5KEZA 4JFWA 2BSPA 1MXGA 4LXFA 1KWGA 3B4NA 1E3ZA 1JF5A 3BUIA 1QPKA 1UH3A 3RIKA 2QPSA 3WY3A 2FH6A 5DO8A 1O8LA 4UZSA 1OGOX 2IQ7A 3VGBA 4CGTA 1ZJBA 2V3EA 1VIWA 3IK2A 3VX1A 1HVXA 1TQVA 4FNUA 3W37A 1DEDA 2OSXA 2F7OA 3CZKA 4KWUA 1JI2A 3WNMA 4OJYA 4AYSA 2NSPA 1AMYA 2ZUWA 2QPUA 3WY4A 2PWGA 1EHAA 2O17A 2X2JA 2X6WA 1PJ9A 1B0IA 1OFMA 4JFSA 1JRGA 5E6ZA 1CGXA 2VRQA 1JGIA 3LRKA 3WNPA 1IZJA 1O7DC 3BLKA 3VMWA 2X6XA 2F61A 1R46A 1OGSA 1HNYA 3L4ZA 1VAHA 1HL9A 1SMAA 3KE0A 4H8UA 4AW7A 1PIFA 3VGDA 1WZLA 1KGXA 2E8ZA 3MI6A 4M8UA 4AIOA 4PCSA 2YFNA 3UG3A 5TD4A 4OZYA 5A2CA 3A22A 3VO0A 3B8YA 4XLCA 1K5CA 4J28A 4LQ1A 1V3JA 1L0PA 1E40A 3LPPA 5CGTA 4J3VA 3BAKA 2Y2WA 1KXQA 5E1QA 3VM5A 4XLAA 3BSGA 3A21A 3EDKA 5I23A 4TVUA 2QXZA 1UKTA 4PSRA 2GVYA 2ZIDA 3H55A 1TCMA 2OW7A 4PCTA 4W93A 2PYHA 2VBKA 2INUA 4AEEA 3VMPA 5EMYA 2PWEA 2WVTA 2ZX5A 4OZZA 2ALWA 2O1DA 4DO6A 4JFVA 2X3HA 1G9HA 1IDKA 3W38A 1PS3A 3CLWA 1PEZA 2GJRA 4HPHA 2D0HA 1JFHA 1EO5A 1XCXA 2F7PA 1JTAA 1BVZA 2EWEA 2FH8A 4NXKA 1LWJA 4UQEA 4U33A 3WNKA 4GO9A 5A6LA 1KCDA 1BHEA 3BAXA 5A2BA 1XV8A 1JL8A 3ZO9A 5I0DA 3UW0A 1OFLA 3H53A 4FNSA 1GQ8A 3VMNA 2EAEA 2VT0A 3VGGA 1OGMX 3EJQA 1HG8A 1M53A 1KBBA 3H54A 1J0IA 2Y5EA 1CXHA 2Z8GA 4I84A 3BMWA 1XGZA 4H8VA 2AAAA 4WSJA 1BPLB 3VGHA 3GBEA 4X9YA 3VMVA 3OLDA 1J0HA 3BUQA 3L4WA 3EJUA 1RWRA 4B9ZA 2G3NA 3DX0A 1JDAA 1O8DA 4XMYA 3BUPA 1UASA 3KL0A 5HXMA 1GVIA 3K8LA 3ZPPA 3CZEA 1R34A 3ZT7A 4XORA 2D0GA 2EADA 3GTNA 2QLYA 3DX4A 1OT2A 1KXVA 4HP5A 2D2OA 1UH2A 1WZMA 1CXKA 2BHZA 2ZICA 3KLKA 4B9YA 1ZJAA 2ZXBA 2WKGA 1D3CA 1O8FA 1WE5A 2F7QA 3FW6A 1QW9A 3GQ9A 2VRKA 4U31A 1EE6A 2FHBA 3TV8A 1QI4A 3EJRA 1JDDA 1BVNP 4AMXA 5I24A 1GCYA 4NI3A 1A47A 1NOFA 2C8NA 2ZX7A 3A47A 5CLTA 1PE9A 4XOTA 3A5VA 2VBEA 3HJEA 1IA5A 3A23A 2OSYA 1JF6A 2NT6A 4GI6A 4H8HA 3WY1A 5C1CA 3LPOA 2INVA 2BXYA 3BVXA 1CXLA 1U2YA 4J3SA 2WNWA 1CXFA 1WZAA 3AMKA 4U2YA 2QMKA 5A6MA 2VJIA 2YJQA 2BY0A 1JAEA 4CKQA 3QGVA 3FAWA 3HZ3A 4QAWA 3EDDA 1WO2A 5C1EA 3EQNA 2WC7A 3ZSCA 2F1BA 2O04A 1R47A 1XH0A 1XH1A 4C2LA 2WVSA 3OLIA 3K1DA 2FYVA 4BA0A 2ZXQA 2OSWA 1BSIA 3BC9A 3BCDA 1S46A 1KCCA 1BG9A 4FLSA 3DHUA 2QY1A 1IDJA 4U4BA 2WKLA 5E0FA 3BLBA 4GQQA 1AQMA 1UD6A 3GXNA 1MVYA 3AXHA 3WENA 2OYLA 2WANA 2NZMA 4NX0A 1XSKA 1VB9A 4NK6A 2AMGA 2E8YA 1EH9A 1J0JA 4WF7A 1MFUA 4J3XA 3CV5A 1DBOA 2OYKA 4JFUA 1TQWA 5A2AA 4HOXA 1PXZA 1IB4A 4LPCA 2XWDA 4H2CA 1E3XA 1QW8A 2ZX9A 1UA7A 2WVVB 1RPKA 2EQDA 4XONA 3DC0A 4OJLA 4OJOA 2IGTA 2F1AA 3KEHA 7CGTA 2ODLA 4Z03A 3VSUA 1V3LA 2UVFA
chains in the Genus database with same CATH superfamily
4I1PA 1KENL 4L9LA 2CDGB 5EU7C 1X5AA 1I9JH 2ZWNA 4AZ8B 1JZEA 4X6DB 4GQ9H 1DP0A 4HETA 3T9WA 4M4RB 1H9VA 3AGWA 5DFWH 5F2FA 1GGIL 1QQDA 1W0VB 1KB9J 1D5MB 4XMTA 2R0WH 4NKDB 3BEWA 5J89A 1ICTA 1BQKA 3MNWB 4NP4L 1KLFB 5DRZA 5EU6E 4BH7B 1HE7A 4X7CC 3WIHH 5IESL 3V79C 2PWDA 2UVEA 3OLGA 3BW9B 4X0NA 3O3AA 4Y9BA 4HOWA 5KSUB 4YZAA 4PRHB 4UOZA 4FYRA 1IQWL 1PAMA 4XLEA 4J3OH 1Z32X 4MQTB 4LKCB 5JQ6L 3NQIA 4BZ2A 1MRFL 3GXIA 3TV3H 2YEVB 2IOMA 3V6BR 3RVWC 5LQBL 1FG9C 1EEZB 2BVOB 2ICEA 1IEAA 1JV2A 2B59B 4I8DA 5D4QA 1ZOXA 1GC1L 1MEXH 2JELH 2F8OA 4TVPD 5D72L 2ITDB 4X5WB 1A6WL 2OL3B 2YD8A 5ANMB 1BD2A 4D3CH 4J8RB 2OMUA 1RJLA 4WI7A 4ZW5A 5E9NA 2F3LA 3QORB 3CZGA 3WUWB 3BQUA 4AKPA 5C0NC 5K9JH 3GF8A 2LABA 3CBKB 1NFDE 4HAGA 4TOYL 4W6WB 4XPGH 5F3FA 2ATPA 3DV4A 3DDGA 3D50A 1KT2B 2FJHB 1GGUA 3K80A 3UG5A 2P4AB 5JW4M 3WWGA 2DQEL 4QJ3B 4ICWA 1F5WA 1E9OB 5C97A 3Q2NA 2OQJA 5E08H 3LDBC 3K8MA 4WKZB 5DT1H 1WCBA 4L8BA 4R3SB 1WUZA 5HI4C 5B21A 2QSCH 5C0CE 3GMNB 1WXRA 1EA9C 3D2UB 4D0CB 4HJ1A 4NRZB 3NRFA 1LEIA 4P5RA 1Z9PA 2WTPA 4HXAH 3VFSB 4R9HA 3D3VE 1ZHKB 2BS8A 1X5XA 3PWPB 4FXGC 5B4MD 1MAMH 1YNLH 2G4GA 5DEFB 4M5ZH 1M71A 1NEPA 1W8OA 2IADB 4HS3A 4XXWC 4XCFH 3LDBB 4ZFZA 3SKNB 4F27A 4JDTH 2AXJA 3U46B 5HHPB 1NEZA 4DW2H 1JNHA 2FYYA 2DBLL 4UBDC 5LCVH 3MACH 1TCRA 5JHBA 2BY1A 5ILTH 2OP4H 3BAYA 4XPAH 4OGZA 3BQUD 2HYMA 1JD9A 4XN3A 1S8DB 1QBBA 4FXLA 5FFLA 1KV7A 1OTUD 4FQXC 3F7RA 1R3IH 4PP2A 5HDBB 2J5WA 4X6CB 2NY6B 4LU5H 2WQVA 3NACL 3L5XH 2QMJA 4S0HA 3P77A 2WIIB 2IQ9H 3NZHH 5ESAA 4BWTA 2CBMA 3IVKA 2B4CL 1KCVL 2FEJA 5EOQH 4KK6C 2XTJE 4DO5A 4P4RA 4AKQA 3DV6B 1I7TA 1OXYA 2XZAL 5E99L 4DVBB 2HP4A 2AQ2A 2ADFL 1NCTA 3OGOE 2VKWA 5IVXB 2V37A 2XZCH 3GC3A 1NFAA 5BOPA 4ANKA 5DRZB 4BH7A 1T89A 2ICWB 2PPCA 4N2CA 4B3VA 2N3JA 1BOGB 5HBBA 2Q2LA 2RJMA 3RX9A 1D5MA 4JFFD 2D4FA 4PJFF 4AG4H 1F0LA 5HY9B 3C60A 4NNXA 2BIHA 3ZQ9A 2VR7A 3FU9A 3WTWA 1SZNA 2YGQA 1KB5H 3RZWA 3ARDD 1TXKA 3U2IA 3KDMA 3K8KA 4Y9EA 2AEPH 1N59A 1O6TA 3BUBA 2AJZB 2F53B 3TXAA 4CW1B 1MHPH 3HG3A 3KYKL 3V0WH 4XWOD 5HGHA 2FZ3A 3T2NH 4MCZB 1RZGB 2G9KA 2Y36L 2Y2YA 4QHNA 1RIVH 4TSCH 3K72A 3KZ8A 3IF1A 4WLCA 4TMPA 3MRNB 1ZVNA 2DQMA 3MV9B 5D2LF 4AVIA 3MVSA 1CBJA 3HBZA 1J86A 3MA9L 1MZZA 3DX7B 3ISYA 4K3JL 3AMLA 3LKPB 1JYVA 1JPFA 1T6VN 5I19H 3E8VA 3QSKB 1MI5A 1WZ1L 1JG9A 2VIRB 3INUL 4KQ4H 1GPOH 1G1CA 2I5YL 3IGUA 4NQCE 1I9JL 1SRDA 1UYWH 3TJPA 2VJXA 3L3JA 2VB5A 2XQYK 3MUUA 4NENB 4HXAL 1N3NA 1SVZA 2HVBA 3PL6A 9PCYA 3B9KC 5AKTA 2L3BA 3IN2A 4MWFB 3QC6X 4WO0A 4LQFL 3ZKMD 2O6DA 3QI9A 1QFOA 3UERA 1JUFB 1G0DA 2ICWA 4JFPA 5G4NA 2PO6B 4P2QD 2FWLB 3BH9B 1QRBA 2COQA 1OD7A 1I7TB 5M7QA 1RMFH 5AW9B 4Y2DA 2GSGA 5C07E 3VNZA 5BOZG 2BWDA 3HNVH 4U6HA 5DLMH 4HEPA 1DBML 3QR2A 1MKFA 3HI5L 5EO1A 1I1AB 1FNSH 2QPEB 3Q1EA 4N28A 3BWSA 5LDUA 4KDTA 1NAKL 2DWYA 2OMXB 4TNFA 3SGEI 2Z7YA 2ZQKA 3B90A 3KVPA 3TN0D 4AITA 4GKNA 4B9KC 4DEUA 4QXUH 4R97B 5LG6A 4MJIE 2N0MA 2R1YB 1SJHA 3EO0B 4N68A 2XWJB 4OFYD 4BA8A 4HUWB 3OAWA 3ZMRA 3WDJA 1NCOA 4MAYC 1CL7L 5ECGA 2Z1PA 3HLAB 3OBAA 3QIWA 1VFAA 4ZPTA 2DLFL 3TEXA 5H35A 1XCTB 1QFWH 1IL1B 4G1MA 2ISDA 3GQ7A 4NC1C 3S6CA 3SYCA 2APFA 1XGPB 4HWZA 3T2OA 2UXVA 4LASL 1RV6X 3G6DL 2X6BA 1BVOA 3QDGB 2A9MH 5J12B 1MRCH 3DUSA 4L37B 1KTBA 3O9WD 4YDNA 2R4RH 4KTEL 1RUAH 1ZT1B 1FVDA 2D31B 3CVIH 5JXAL 3VRLF 4TUOB 5DFAA 3LQAH 1AGDB 4KKCC 3B8SA 5E4OA 4HGWB 2X87A 3OWRA 3TT1H 2W07B 4JDZA 4RMWA 1RIHH 4ABVA 1KLFA 4PRIB 1N0LA 5AKSA 1F41A 4HMEA 2YRPA 2YD7A 5DD5L 3IS0X 4L9LC 4M7ZC 4GUQA 3LB6D 3TF7C 2GHZA 1A02N 2IALA 2VDKB 4NQXA 4OFKA 4A04A 3HMWL 2PW1B 3LKRB 3NIGB 2W7ZA 2PYEA 1OB1A 1P7KA 2X1WL 2HN7A 4Y89A 4KMTL 3FTZA 3FCSB 3RTLA 4L9LB 4M7ZB 5C0BD 1E8XA 1L1IA 2O72A 4IEFB 4YL9A 4UIKH 1XXDC 3QHZL 1CGXA 3UIZA 3JWDH 4GKSB 1A6TB 4GG6A 1F8TH 1O7DC 3V4PA 1TQBC 1IKNC 3NSYA 1HL9A 4DP7X 1HHJA 2FJSA 1NGQL 2C1PB 3KGRA 3TFKD 2DZEA 5TD4A 2EIDA 4WGKA 1KJMA 2EZ0D 4QOKE 5D71L 2APVA 5D96B 2WLYA 2EDLA 5DMJB 3UPAA 4LQ1A 3TCTA 3NSCA 1QFUH 5BRZE 5MP6L 1BJ1J 1BWWA 3BAKA 4BM7A 3COOA 4GG6E 4KI5C 5E0QA 3P2TA 2WXOA 2Z64C 3IGKA 4XBPB 2QKSA 2ZIDA 1PYWA 3JTTA 4G8AC 2N1KA 2IWEA 4JFDD 1Q9WB 1Z0NA 1F58L 4OBRA 4QHMB 1GZPA 4BE5A 4JK0D 5C0BA 2X3HA 2NCMA 2RHEA 4Z7OF 2BSDA 5D7JB 1PS3A 1ZDSA 3CLWA 1EO5A 5IBUG 5C0CB 1KDJA 3MLXL 3LTVA 4JFYA 2B39A 4X8CA 5LBGA 5I19L 3ARVA 3FT4A 5SV3A 1F4WH 3GMPA 4PW4A 2VFOA 4KQ4L 4IRZH 2BP0A 3MRDB 2ZOWA 1X9QA 1NCGA 4KTGA 1GQ8A 4R7XA 5CSZB 2XKSA 3VGGA 2EXSA 4XXDA 1YEEH 1VKXA 1NFIB 5L8JB 4MCYB 4K4KA 4FABH 2QFRA 1TNNA 1OE1A 4DHLA 1YMHB 2FL5A 4W9EC 3MAWA 4X4XB 4GXUN 2DYPA 3BUQA 1FNGA 5EEUA 4W4OA 1OTSC 1E5CA 3DX0A 4RAUB 1JE6A 4AMKL 3ZZQA 2K3HA 1E0OB 1G7HB 4XPHL 4PJIE 3UTTE 2UXFA 5D2NB 4PG2A 3V9FA 1KXVA 4M62L 2HT2C 1WAEA 1GOHA 2Z9TA 1JZ3A 1JXGA 1D5XA 1KJMB 2ZICA 2FAUA 2WKGA 5LWYH 1D3CA 1AO7B 2F7QA 2B9AA 1CD9B 2D9CA 1ZTXH 1J18A 3PL6C 4U31A 5KYWA 3SZEA 1FHGA 1HL4A 1B0RB 3WNJA 5J6HB 1A1OA 5EEWA 3NPSC 1VEPA 2L7EA 2EH7L 4LCWA 1YN7B 1KLGB 1BZOA 1NANI 4EOWL 2NT6A 1HKFA 5ICZA 1NMBL 4IEFA 3IFPB 1N8OE 4F20A 3RNQA 1E27A 3WHE1 1BAFH 5GGTL 3F05A 4HWEH 2NX5E 3ZKXB 3N43F 1BZ8A 3FAWA 5EO9B 3ZYOA 4G70B 5DMGD 1ETZA 3EJYD 3FTSA 1PQZA 3BDXA 3B34A 4Z7WE 2FBRA 4JO2H 4LBAA 2MCAA 3ZDYB 4DTGL 2XT1B 4BV1A 3AABA 4HQQH 5LAXA 4F3FB 2H6OA 3ZUCA 5C71A 3TWYA 5I1HH 1V8HA 3RI5K 3L1GA 3RAJL 1OKEA 4R7VA 2OP4L 1E7VA 2OM5A 3EW3B 4YZWA 1OTUC 2DY2A 4OZHB 2PLTA 2PP7A 4ZPVA 3DOHA 5T33L 4Q58C 4X5PA 2OV0A 3C2AH 2WB1A 3K46A 2GAZA 4GQQA 1W91A 4DAGH 1UD6A 1N18A 4BWUA 4F24A 1IBHA 4ZUVB 1M6OB 4HGKC 2EYTA 2OYLA 4HWUA 2WANA 4LP5A 2IDCA 3QAZC 2R1WA 4MJ5B 4AC2A 1VB9A 2VH5H 3MOBL 2JKJA 2K78A 4HCGA 4QTHA 3F5WB 3L5XL 3FFCB 3NJXA 4KNSA 4PS4L 3FQRB 2R69H 4MA1C 4OD3L 4TM9A 5F44A 1S7UB 2ZNWA 3W0WA 3PJSB 3C87A 5D1QD 2XTYA 4PGDA 4YXLH 1M9SA 4O2FB 2IPTL 3JWOC 3M6DA 5EOTB 3DK0A 3MRDA 3LJ3A 4OQTL 3CHPA 4DK5A 1KYUA 4G5ZH 2OFQA 1TQCB 4EDXA 3STZB 2WTOA 1WRFA 1D7BA 3UAFA 5I1DA 5I17B 1SEBA 2FQFA 2X4OA 4XAKD 1AGDA 3LPGA 1A1OB 2WV3A 3QIWC 4ZQKB 4F9PA 4QRBA 1ZIBA 4NQSB 1JPST 2GQHA 3EF7A 3D1MC 3TIDA 1I9EA 4YE0A 4LEXL 1BVLB 2CIIB 3SBPA 5CILL 1Q9WA 3ZHKA 4LNRA 2VZOA 3QQXA 5MEPA 3T0DA 2EDOA 1TFPA 3SODB 5AW5B 1T0NB 1IL1A 1NCCH 4G1MB 5FA3B 3N0AA 3ZTJH 5BQ7A 5HJDA 2AZAA 2D3VA 3GB7A 4FULA 3O6FA 3N3EA 5IB1A 1RVFL 2D3NA 2DMGA 1U9KA 2EDMA 1M7IA 1I7RA 2ED9A 3EYOA 3QQ9C 4QRRB 3UEQA 1BM3H 1VGKA 3ZPDA 3M46A 1JZ4A 3CSTA 1KYOK 5CJXA 3RFZB 2VFPA 1AD0A 5CEYB 4PJEB 5D1QB 4YXHH 4YELA 2ZT9C 4FXTA 4KJWC 3RDTB 4DPAX 4XRCA 3ZOAA 1P7HL 2ZCZA 1MCEA 1NFIA 3SDYH 3VFNB 5SX4I 3T4AB 5FO8A 1BV8A 4CN1A 2PCFA 3I6KA 2L4OA 5KJRH 2BRQA 3KXFD 3P11H 4Z7VF 5JPNA 3VDBA 1AGEA 3RVTD 1G7QB 1RCYA 4YZ0A 2LGNA 1N7MH 4L23A 2MQ3A 4GW5A 3VB9A 5DZAA 2GSGB 3AUWB 5GHWH 4ZMQA 5LHDA 4I7ZC 4UT9H 2WP3O 1WBZA 3QQ3A 4Y2OB 3DVNA 1SFHA 4TLTA 1KEML 5F7MC 3U7YH 5K9KA 4OZIE 3ZRSA 2C9VA 2PWFA 4YO0B 4MAYB 4MNQE 1S7QA 2VYRE 4XN5A 5JIMA 1IC0A 1VZHA 2HJKB 2NX5D 4XAWH 3FYIB 4K0OA 2FJFA 3VFOB 1GY1A 2F9BT 5DF0A 3VXMA 5IJKC 2G60L 1OGTA 2NDFA 4N4YB 3HZKA 3R1GL 4QRRD 1XR9A 3U4KA 3QNXA 4BZ1A 4F7CB 3A4FA 4PHZA 4Q89A 1JRHH 1E4JA 2EACA 1KTLA 4ZJ9A 4GRWF 2NTFB 3FTWA 4HCRH 4RCAA 4ODBD 4JO1H 3P2DA 4N6QA 4UQ3A 4MJ2A 5CCKH 1CF8H 2OKMA 5LGYA 4ZMPA 1DQIA 1DQDH 4POZD 2FSEA 3VTTA 3ORJA 1K9TA 3LKRA 1Z5HA 3IDYB 1ILUA 1ZVYA 2RGSA 2CGRH 3SGKA 3BKYH 1NLDH 5E03A 2NY2D 3HMXH 3KYKH 3GSNL 3Q5TA 2AJXL 4OCWL 3V0WL 2CALA 3VH8A 1QUNA 1EJOL 2CA4A 3ARZA 4BSVB 3ARRA 5T3XH 4G9DB 3D4GA 2Z8SA 5F7UA 5I1AA 1J05A 1RSFA 4PGEA 3BT2H 4BCYA 1AH1A 3KWTA 4XN9A 4AUUA 2QYUA 4O51B 4JPIA 3KLHC 2X6MA 5CD3B 3T6QC 1A4CA 4HW6A 1JK9A 4KVCH 1ONQB 2EINB 3EZ8A 4NFCA 1IJ9A 3MV7B 4N2EA 5ALBL 5GISH 2AC0A 2QHRL 3C5JB 3ZL2A 4XP6H 5IVXA 5KYYA 1YYLL 2A6DA 3WKMH 2AV7A 3CN0A 5EOQL 4UM8A 5HHOE 5GGRY 3UZEA 4OZ4A 3H2WA 2VXQH 1CR9L 4HWEL 1DQKA 1RLWA 5D7HA 4R96A 1C5BL 3UTOA 3X3FL 3S2CA 1JMXA 1E27B 1X4ZA 3PWUA 3QE5A 1BX2B 1FDLH 4PS4H 3QCUH 1JGDA 2F7RA 2XWTA 4PREB 3QG6A 4QRSA 4Z06A 2VE6A 1SY6A 4OD2B 3TZVB 1OSEA 1WAAF 4HUNB 3EJJX 2BH0A 1FFRA 4NXSA 3C2AL 1GA2A 4HPYH 3GI8H 3PABA 3KVDD 3CSGA 3EOAA 3T09A 3P3SA 2IDSA 5MEQA 1QYGL 3BN9C 3IS1X 4PRHE 3II1A 1UUNA 3V52H 4ODTH 1VCBC 3K6SA 2GJJA 2W9EL 5B7EA 1C5CH 4JREB 4GFTB 3RGVC 3MV7D 1XXFC 4N8PA 1QBML 2EIMB 2NRDA 3P73B 4IHOA 4YAQB 2VN6A 3N1FC 4GKOA 4ESKA 2DTMH 3IU3A 3HE6C 4QKTA 1EMTH 3KLSA 1KBPA 3MLYL 2Y5TA 4MWFA 2X6VA 5DMYA 1ES0B 1C5DB 1I1YA 5T1DL 1FIGL 1G6RL 1KJ2A 4LSVL 4Y1AB 3MUGA 2AQNA 4JREC 5ICXA 2ZUTA 4FADA 1YEIH 1XIWB 4KY1H 2J1XA 1ANUA 3O3AB 1ACCA 3BH9A 4QRUA 5FUZH 5BRQA 1WTGT 2VJJA 4P9HL 4HC1H 1A5FH 5HGBA 3V6OC 1MCKA 3FPXA 3VCLB 3K0YA 1KPRB 4P2QB 4LFHD 1IM9D 3LIZA 5CZVL 4GI8A 3OV6A 1I82A 4JL1A 2FIKA 3PUCA 3GI8L 3BP6A 1FAKT 5ID0B 4D8PA 4HCFA 4DJMA 2K6ZA 2Q3ZA 2XT2A 3UFIA 4JQIH 1F58H 4YDIH 2X70B 5F0JB 3ZVVA 3M17A 4XNMB 3SKJL 4FA8A 2Z4QA 4PJFE 4WQOA 3D3VD 3EIFA 4RIRB 1U93A 1EXUB 1E5AA 1F3RB 3DO3A 1IAOB 2JLLA 4EN2A 5C9JB 1BAGA 1QRNA 3WNIA 2XYCA 4CU6A 3V4LA 1SOKA 1AVAA 4U3HA 1C9SA 3KJ4B 5KZCD 4DKTA 4KQ3L 1IBFA 4HT1H 2ZE0A 1FFNA 3VI4A 1YEKH 3TYGL 3DO4A 4AOFA 1QA2A 2E75C 2EEXA 1LWHA 4YSPA 1HHJB 2EC9T 3EQOA 4AG4L 1TTRA 1JNHB 3W1ZA 4DVBA 4M6OH 4MDJA 1CB4A 2YAHA 2K70A 1MF2H 1PSKL 3L3IB 5AOMA 4X6CE 3HG2A 4L4VD 3SE4C 2JKRM 5I73B 3U1SH 2JKSA 1E3ZA 1JF5A 1JWSA 4JPSA 1TFHA 3T8XB 2X4TA 4OCMC 1OWRM 3W2DH 3QAZB 4U05A 2R1XA 1QRND 2VJ8A 3LXUX 3CCHA 3WHXB 3ZTNH 1JP5A 1KELL 1TQVA 4Y2DC 1DFBL 4ZOBA 3NA4A 1YCSA 3E1ZA 3RLSA 5D1QA 3UAJC 2I24N 3KHOA 1MSPA 3SQBA 3H2PA 3ZBMA 3JVGC 1AC6A 4YIQA 3O2WL 4L4VA 2X6WA 4QNPF 5AL0A 3WUWG 2WQWA 1A4KB 2CZNA 4NP9A 3BJLA 3I6GB 4Y1AA 5C0DA 1IZJA 4EUPA 4NUPA 3KBFA 3G6JB 4HBQA 3DLQR 2NXZC 1I8LA 3U4EB 2QEJA 3GBNL 3MLRL 4NIKB 1YN6B 5H4YA 3MJ8B 2NX5A 2GBTA 5IVOA 4FZ8L 3ATBA 4LOUD 3P4OB 1YY9C 1OD9A 1H8NA 2D9QB 2OMNA 2FBJL 5CGTA 5CR1A 4FNLL 3VM5A 2CO1A 1JCKA 4Y4FD 1U4EA 4CGUB 3UMNA 2QXZA 1UKTA 4PSRA 1BYPA 1D6VH 1CZ8H 5SX5K 4NQCB 4LLWA 4ICXA 3VYPA 1DVXA 3V7AG 2AEWA 3S96A 3JT0A 4DO6A 3GRGA 2PR4L 4WI4A 1CJYA 1UGKA 1TTUA 1IBZA 3NJHA 2FJGA 2O6CA 3OSVA 2EDXA 2WYZA 1BBJB 2XV6B 1M3IA 3FO2A 1HEHC 1NCJA 4Z7OB 2DS4A 1IGIL 1G7PB 1LLAA 3RDTC 4U33A 3O0RL 1K4DB 3NEOA 3L9YA 5A2BA 1T04A 1CYXA 1TYWA 4U6HB 3ARDC 4QY8A 4X7SL 5C07B 3WHXA 3F58H 3VJ6B 4E42B 1KYOJ 4L3EE 1W72B 3HNTH 2Z0BA 2BPBA 4G9FD 4JFEE 2OULB 1AHMA 4P2AA 3KNBB 3T3ME 2WM0A 4J23A 5TH2B 2IDTA 3NP4A 5K69A 4GRLD 3QEHA 2D7NA 5A16B 3G9VA 4M4RA 1O8DA 3PHSA 4BHUI 2H3KA 1YG9A 3PL6B 3VSQA 1J5HA 2X10A 1J5IA 3KWWB 3W9DB 3WHE0 3F62A 2D0GA 3P1VA 4YFOA 3GTNA 4F37F 2KHAA 3EGDB 2BVUA 2HT2D 2E46A 2X4UA 4MXVE 1BOYA 4ODVL 3ZL4L 1DO5A 4B9YA 3QCVH 4PYHA 1RZJC 4U3XA 2BSBA 1N6UA 2VRKA 3S98A 4X83A 3ZDWA 4MLIA 5HP5A 3BPCA 3MNVA 3JYCA 3O2WH 4K3HA 5BOJA 3TBYB 1PE9A 3H3PH 3LEXA 1XB3A 1EFQA 3ZE2F 3S34L 3Q43A 1CDCA 4GUCA 5DMIH 4G6FD 4GI6A 3HE7A 3N5AA 3NCFB 1U3ZA 3FONB 1W8NA 2BOBA 4HZ1A 3TA3A 3PDDA 4NN5B 3WLWD 2JXMA 4J1UA 2DD8H 3QJVB 2QL1A 4KROD 5ESVB 4QAWA 3VI3E 4G8EB 2ID5A 4HZAA 4OTXH 4RISH 1M7DA 1TTGA 4IOSA 4RSYA 2XY1A 4KFMA 2F19H 2GKIA 2DWEA 5EIQA 2HMID 3K1DA 4I2XA 4UDUA 1FL3B 2AK4D 4K7FB 3VI4E 1A0QL 3N90A 3BC9A 5KTEH 1QATA 4Z7WF 1FIEA 3PAYA 1M05A 4M6OL 4ZUTA 5E5MB 5HDQL 3QPKA 3WIFA 2DQCL 3VI3A 3AXHA 1GTFA 1XBDA 5DQDL 4RDQF 4IU2B 4NX0A 3MC0A 3C6SB 4XI5D 3DOSB 3GSRB 1YQ2A 2EDWA 3GHBL 3QUXA 3KPLB 3CBRA 3P0YL 1QSEB 3PWJA 4GSDL 4YNYB 1F3JB 4KJYB 3DXAD 1EZGA 4AVHA 3DPDA 1UA7A 4PJBE 2CJTA 2Q87A 5EO0A 1UWGH 4I77H 4XONA 5JHLH 1QD0A 1QLFA 1T2QL 1Z3RA 1XGTB 3K81A 2Q7NA 4PJGF 3QDAA 4MNQD 3HG4A 1MFEL 5DJ6B 4LFHG 3K74B 4OGYH 2O6PA 4M48L 5DD1H 5KUKA 3T65B 3ULUD 3O6FB 5IB1B 4LGSB 5FW8A 3PUUA 1NICA 4A2DA 2CPCA 3SDAC 2YQ3A 3BFQG 5ALCH 1CGWA 4G3YH 4UNTA 2OZ4A 5J0BA 2NY5L 4F91B 4XC3H 4PREA 1IB5A 5DLML 3ZX1A 2BNUA 5FOBB 3KGUA 4JY4A 4UZUA 2CSPA 2X5PA 1IGML 2HLAB 2VMCA 2E9JA 4EI0A 4F7KA 4APXA 2HPTA 5JHDA 5EPMB 2C34A 1X5FA 4H8WH 3O8XD 4LCWE 1HILA 3AWGA 2XICA 1ODAA 4F8TA 4UT9A 5EEXA 1DDHA 4E5XG 2Q8AL 1KGIA 3P0VL 5HVWA 2BOBB 3CK0H 3MV11 3QQDB 3VWJD 3QDMA 5KS9F 3ULSA 9CGTA 2Z34A 1JXJA 2CXGA 1P7KB 3BGFC 2ZXAA 4Q52A 2Y7QA 1IIKA 3IE9A 2FATL 2E7MA 2XV0A 4LSTL 4TQIA 1XB6A 1U8JB 1RZFL 2NNCA 4PV1C 5CP3H 3TNMB 5GS1B 5KVDH 5K93A 2BP3A 1QI5A 1X5MA 3IRCA 4M48H 3AU1B 2WYTA 3B83A 1BIIB 4WFFE 5DD1L 1Q0EA 4ZZKA 1MCPL 1HK6A 5I1LB 4AWJC 1QJVA 2Q20A 1SLWA 3U30B 2WXQA 2CKBL 2P8LB 2AQQA 4JJHA 1F42A 4QPEA 4PWGA 1OPGH 3VH8B 3CJJA 1S5IH 1O6VA 2GAZB 5C7XL 4Q9RL 1YUHB 4CVZB 5D2LE 3WXVL 3BWUF 3N2JA 1BZ7B 5KVEL 4RWYH 3AXLB 4Y4KC 1AO7A 4ZK8A 4N2FA 3C6LC 1Q90A 2NNAA 3DNKA 1CGUA 1E2VA 3BZDA 1CIUA 1A7QL 5FOBA 1Q72H 5F96H 3KYNA 2AQSA 3Q01A 4UINH 2CDEB 1E2WA 2GK0B 5H94A 1E6OH 2NSTA 2H32A 3RY4A 4IGBC 3WEOA 4OJ6A 2VLME 2CM5A 5JR1L 5DQDH 2EXTA 1JPSH 1P6AB 1P6FA 3II2A 4YDMA 1L9RA 3I6LE 3ARGB 3TPUA 1XF2A 1YPZA 4GXVL 4UILL 4FNPA 4JM0A 3AT8A 3IJ7A 3PXHA 4F9PC 3ZSTA 4O02L 5E9AA 2X4PB 4D8OA 1KENH 5EWIH 3LNIA 2DYPB 5GSRB 3F7VA 3CVBA 3OKNA 4JPWL 5I8CA 2O93L 2NX5B 5E9DA 1T2QH 2RALA 5GJTH 1PZ2A 4IHBA 2R2EA 4LSVH 1O8EA 4GRWE 4R90H 1JHKH 4UOW1 1EDHA 1SOXA 2XPGA 2G2RA 1MFCH 4XNYH 5DJDB 3U9PL 1P84J 1OHQA 3QFGA 1CDYA 1P84K 4NM8H 3SZ6A 1O0VA 3PWNA 3RJDA 1M4KA 1E28A 4KJPC 3QJOA 4EOWH 1BXXA 1JN6B 1MG3C 3V5DA 3A4EA 4YZQA 3M8OL 4G3YL 4ONHB 5I6NA 3VSVA 1JD7A 2VW6A 2Z1KA 3DBSA 1WIPA 1JWMB 2XKNB 4QXWA 1AIZA 1JWSB 3PPSA 3LEVH 2X3CA 3BUDA 4EO5A 1EERB 1TQBB 1QWNA 1JZGA 2VLKE 2W5PA 2V3FA 5BS0E 4YUEH 1IC7L 1DJYA 4GP4B 3P30L 4KRPD 4Y8DC 3FOMB 3M7FB 1YMMA 5KVGH 5D70L 1KLUA 3HC0B 1RMGA 2YFOA 1RXLA 3CHSA 4NBXB 2VUOA 4OLUH 3FULA 1AQDB 3L3KA 1EO7A 3SE9H 1VSCA 3UO8B 3QDJE 4ELMB 4B9PA 1CD1B 2VFQA 4KKLD 3IAPA 1NM9A 1YEDA 5CGMA 5D7LA 4JZJB 1UKQA 2W88A 3OKOA 1X5ZA 4NFBA 1LO0H 3WTXA 2ZKHL 5I17A 2BM4A 4O5LL 1ZVHA 2XWZA 1ESOA 3ARSA 3D52A 1TMQA 3U4BH 1FZKA 5KYXA 5HGHB 4GH7B 5IUSA 3MRRA 3ZT6A 4JFTA 3KYMA 3QUML 2HN7B 3LEXB 1YC8A 1W6WA 1XZ0B 1KBKA 1OGAE 1SBBA 3IMUA 3MTRA 4D9QE 3EXJA 2FO4B 1NCAH 2RR3A 1X3DA 2FDBP 3SGJC 3QEHB 1HU8A 1UOWA 5IMOB 3IJ8A 43C9A 4YBQD 5INCA 4BQCA 1KBVA 1YDPB 4X80L 5AVWB 2WD0A 2XETA 3EYSL 4N8CH 5EUOB 3STBA 1T83C 1A4AA 1BZDA 1BECA 5HHNB 1T03L 3NDZE 4I48A 4ZOEA 5GJTL 1J8RA 2ZG2A 2P7TA 3CN2A 2F15A 4ADJA 4K5NA 4XWGL 1KWKA 1FA4A 3QR0A 4WW2C 3X11B 5T5NF 3ARBD 3QORD 3QORC 1OTTD 1A2YA 5KBDA 2QSVA 4MJ6A 4Y19D 4JFZL 1W72A 1OM3L 4N22A 4PW9A 5AZ2H 2H6PB 5DR5H 4UCFA 2A6JA 4PGCB 3KW8A 4U1NB 3KJ4C 2I07B 1LJMA 5E2TL 4OJPA 4M3JA 3L6FA 3J7HA 1GSMA 3L17A 3LIZH 2JI2A 4GAAA 2J8UE 1TNMA 4ETQB 3FO1A 4MB4A 1A1NA 5K39A 4PV8B 4A2MA 1CDHA 2B5IB 4JL2A 4UQDA 2BFVL 1Q0YH 2H3NA 5EZOL 3UCQA 5F72S 2DQTL 3CVCA 1LWRA 5DVOA 2WVUA 1ZT1A 3RIFK 3OAYK 1HINL 1A6PA 2QVIA 3GJFA 2WKOF 4NLAA 5FGSA 4C83B 1BJ1H 2WPGA 1JRHI 4BSWB 5DTFB 4Y4FC 3ZKXC 5FF6A 3BRDA 1LE5A 1BX2A 3PP4H 1S7SA 1QSEE 4J7RA 1UGNA 1IGFH 2HA1A 1NIAA 3HN3A 4Z7VE 3ZYZA 4CC1A 2VDQH 4BZ1L 3LKQB 5TDPA 1QA1A 3VQ1C 4H44C 2XIBA 4NQDE 4P5MA 1A7PH 2CIKA 2WMPB 1IKFH 3NJGA 1A9EA 3N1QC 1SGKA 3NFSH 5B3JF 1JRHL 2V7HA 5KG9B 4PFEA 3DX9A 3L7EB 5A2KH 2MNUA 3MLPA 3P69A 4FG4A 4WSGA 4GKNB 2NUTA 4DCQA 4RRPA 4UDTA 5EBLB 4E68A 1ZJBA 1ITCA 3L2NA 2EVFA 4MCNA 3VUAA 2KLRA 2DPKA 3GS4A 4P2OD 5IW1B 3IU4L 3SDCA 1DEDA 3O2DH 3VH8G 5IQOA 3BHBB 3C08H 4NQEE 4L4VB 1FYHB 5F9JA 3HC4H 2P8MB 1EEUA 2CU9A 3DKHA 1VFBB 3ZE0E 3GTVA 5AVYB 1HF2A 3RL2A 4HAKA 1HNYA 4HXBH 5DCCA 3IE4A 5E00B 3VGDA 3BKCL 2H41A 3G6JF 3S7GA 4B41A 4MJID 2EECA 4FXKA 5BUGA 3U0PA 2WXKA 3FU6A 5FK9A 4AKOA 3A67H 4XLCA 2WWOA 3C6LA 1Q0XH 2MHAB 1SXBA 3QWOB 4JPQA 1T5WB 4RMSA 3WS3A 4H8PA 4OLYL 1CICD 2X4QA 3O3EB 2QSCL 2CO6B 4OD3H 2HJFB 3L3GB 4YK4B 1OAUL 4F58L 3C60D 1FO0H 5JLZA 2XRAH 4KXCA 4AJ0A 4M43H 4DSYA 2FD6H 3FU3A 4FP8L 1Z6JT 4NKMB 2OTWB 1S7XA 1MCOL 2C9XA 2WO2B 1KCUL 4AQEB 4Q6IC 3RWHA 4V1DE 3U7WL 2E9GA 1TMCB 1TU2B 4JRXE 4QHLB 5KS9E 1UATA 2Q86B 2A9CA 4X7TA 3MRJA 4X4ZA 4FCAA 3IFLH 4G7YL 2ENSA 1EHXA 4URTB 4L4TD 3S3DB 4UB0L 5FX3A 4HUVA 4OF7A 2IAMD 4G8GD 2V2TA 4ZX3A 1KBBA 1P1ZB 5ACLA 1QEXA 4ISVB 3NSDA 3TJHD 1ZVSB 2HT3C 2Z91B 3T6ZA 1O9WA 4H8VA 3IJYB 4H88L 2P8PA 1ZHBA 1SHMA 5TE7L 3LNEA 3MYJA 2VDPH 2XV3A 3MRPA 2R0KL 4EZKA 3RL2B 1NC2A 4UMSA 5CNHA 7FABL 5L2KA 5IHZB 1UZ8B 3PV7A 3GMQB 3ULVC 5I6XC 3H7BB 3PLYA 5C9JA 3L3HB 4XP6L 2HJLB 1RZFH 1MOEA 2FK9A 3KS0J 4DGVL 3L95A 4DEPB 3JT2A 5D72H 5J5EA 3JWDL 1A9VA 4LMQI 3UL4A 4ZMLA 1EE6A 4H1LB 4WFEE 1QI4A 3GMRB 2ZYHA 1BGXH 3PP3K 4WI2A 4DCQB 1NOFA 2EIZB 3QO0B 1T5XA 1WQVT 1OP5H 4XHQA 1R3KB 2INVA 1MCFA 2DKUA 4N25A 4S1QH 1DN0A 1CBVL 2N01B 4JFDE 4B9IA 3KPOA 4UMGA 1FJ1A 1HZHH 1L4IA 3QA3B 3W57A 3IDIA 1AIFB 4LCCA 3TN0A 5ERWA 4EQ2A 4WHYH 4ZD3L 4AL8H 2A77H 2FBOJ 1EEYB 3QG7H 5F7BA 3W0WE 2NZIA 2VXQL 3N41B 4PJHE 5CU9A 3X3GH 4ZW3A 1YNKL 3L1EA 4PWFA 3O4OC 3QHFH 3QJTB 3EHBB 4PRID 1WSST 2GTZA 4HCRL 2B77A 4XZ4A 1J9CT 2NY3D 4Q74A 5D4HA 1FWXA 5LNDA 2V7NA 2I9LB 4ZW8A 5T1KB 1J05B 3DI2B 4TQHA 3HZYB 4F5CE 1QASA 1JPGB 3HLKA 5AB2A 3L48A 4LGPB 5DHDA 2D7QA 2EP6A 4DNLA 1JK8B 2OZ4H 3FHAA 5JW4R 3CVHA 4OCWH 4OCSH 4KZDH 1GW6A 3ZXAC 1S3KL 5IFJA 4E41D 1PKQE 4JGJA 3B5TA 5CP7B 1J8HE 2EQDA 2QVTA 5C09A 4Q6IA 2XWBB 1NH6A 3DC0A 1EPFA 3KYMB 5I1CL 1KCSL 3IAQA 3QI9C 5D93C 3U48A 4BFIA 2V4LA 1N7ML 3BGMA 3CX5K 3FTGB 1MCJA 1SJEA 5DURB 3S3CB 1TZAA 4B50A 5HYSA 3TZVC 4I9XA 4JZJC 4MXWL 3X12A 2UZIL 1UZ8A 1A7NL 3T4YB 5EHFA 4ZX6A 1HH9B 3LHAA 3NJVA 1PKQA 4XWOC 2YBGA 3VFTB 2AQ1A 2B1OA 3CHXA 3L9BA 3G5VB 5T3ZD 5HYFA 4JDEA 4L3CB 4FTVB 2OMZA 4GS7B 2X0VA 1WBYA 5AYQA 3EJYC 1B9ZA 1AE6H 2ERJB 4P5KA 4ZQTA 5KVMC 3RZCD 4CSTA 3SYAA 3U0TA 1TENA 3WE6B 4JCMA 1BLIA 4D94A 1UXLA 5DVNA 1ZGLP 5D1XD 4IRZA 5EO9A 4NZRL 4ELKB 4P04A 2NY1D 1NDGA 2XHNA 2OMVA 1FNLA 3MO1A 4C58B 1B2YA 1JZ7A 5KSAB 5DDHB 1ETB1 5GZOC 1U8CB 3TEUA 4UT6L 1I3GH 1BZ9B 4WCYL 2MTAA 4K5LA 4FG6D 1TF4A 4LAQH 4QDGA 5I16B 1R19A 4TNVF 4GXVH 4UILH 5IWLA 3SDCD 3VXME 5L9DH 4YSTA 5LBSA 4WW2B 4RGNE 4Y19A 5D9SA 5F89A 2PYED 1WZ1H 3INUH 3R1GH 2A7BA 4ZUUA 3C9NA 3T3MB 4DQOH 4NKOB 5HVHB 5F7EL 4NCC2 4LARL 3LB6C 4A66A 3KLHD 4NQDB 1EZSA 4JFYB 2P5WA 3RGVA 4CSPA 4AY0A 1BM3L 2X4QB 4S2SA 4ZFOL 3LEYL 2XXFA 2HCZX 5IBTH 5JHLA 1IAIM 4NZTL 1AY1H 3D8MA 1UWEH 4UTAA 1QTYT 4BD4A 3FCTA 5CLWA 1T6WA 1IUZA 1Y6NR 3A4AA 3CMOL 2X41A 3FHQA 4LSSL 4CMHC 1L9MA 2V7HB 1GYWA 3C5ZA 2OPCA 1YPZB 1PFOA 3DIDA 3KPSA 1CVRA 1U8LB 4X98B 3V6ZA 5CZVH 3EDJA 4W4OC 3HZVA 2H32B 2EIEA 5FKAB 1CFTB 2NT0A 4PJ7E 3DO7A 3NPSB 2B4CC 3SKMA 4WEEA 5D1XC 3SDCB 3I6KB 4ZT1A 1RIVL 2AQRA 2E86A 1PLGL 4UDTB 2YPVH 3B6SB 4G71B 3MCLH 4L0ZA 4XKVA 1Q9OB 5I73C 1QFHA 3T08A 3RDTA 3N85H 2WLKA 2AK4E 4YGVB 4KZEL 5B1JA 1D7FA 1DVFA 5HYJE 4I18B 4UV4L 3F85A 4Q97A 3CMGA 1O88A 5D2LA 3CUPB 4LSRL 5MI0B 3LN5A 4CU7A 2APXA 2WVVA 4I3RL 1SM3H 2V17H 4L9DA 4TVPE 5ISZE 2RD0A 1EHLL 2MQGA 1IU1A 1PG7X 3U82B 1CFVH 1FHNA 1OT1A 4XMVA 2QGDA 1RUPL 4RMBA 1TLMA 3QWQB 5JORA 1KF9B 1AZZC 5DJXA 4KI1A 4U6YA 3SDDC 3H4FA 4KK5D 4PJBB 5F1OB 1U8PB 5IMKA 4YSDA 3C6LD 3Q1SL 1KPUB 3MDJA 3S3PA 2XWCA 4E36A 3I3EA 4MXNA 3HNVL 5EUOA 4OZHA 1UACL 5JIIA 3ULVF 2PKDA 1QKZH 2QJDA 4Z7VA 3NJLA 4M6NH 4Z7UA 3QEUA 4NDMA 4LEEA 2CA3A 4PRDB 3LV3A 1KJ3L 3DDFA 2DLEA 4O2FA 2VC2B 1MHPL 4EZLA 1IC5L 5CSBA 1V54B 3SO5A 3WGVB 4K7PH 2IOUG 1CK0L 2IALB 1MIEL 2Y7LA 4NQXB 4D9LL 1A2YB 3HFFA 5DZPA 2WOBA 1P5UA 3QHTC 4OSUH 4KRMB 2WZ0A 2XX0A 2BZDA 3MRRB 3HG1D 3X11A 1D5XB 4TQEL 1ND0B 2A9AA 1DVFB 4HK3N 5CJBA 2KC0A 1EHLH 2RA1A 3WO4C 3AM8A 3ARTA 1GAFL 5D6DC 3T2QA 5MENA 3AY4C 3VQMA 5I0XA 3NRPA 2YPLE 1Q4NX 5GS1A 3JSSA 2Q0ZX 4HUCA 3TC9A 3DRQB 3VXUB 1K5WA 5EC1A 4DWHA 1S7RB 3S37H 1KYFA 3RQ3A 1OCWL 1RZ7L 3FCBA 1CUOA 4XP4L 4YS4A 1SQMA 1F02I 1MCLA 15C8H 4PJAA 1OAUH 1UFUA 5F6HJ 5GGTH 3QXUA 4WSKA 4F3FA 3N43B 2XRAL 1XMEB 1EEYA 2VO5A 5JHDD 1KN2L 4G1EA 4EI5D 1AR2A 1FC2D 5SX4H 1IGMH 4ATTA 1ET5A 4PI0A 3ZQXA 3VXRB 4ODTL 3BP4B 3T3PB 3PHOB 4U3SB 3HHSA 1UEYA 4FFYL 4KH9A 2WSDA 4WCYH 2XVGA 2O26U 1Q9OA 2CJUL 1WHOA 3WKQA 4U1JB 32C2B 5CLZA 3QH3B 4LHUG 3MLXH 4QTFA 5GS2H 1UCBL 4KXZH 4LLQA 3SJVA 4Z7NF 1K4ZA 2KMWA 2JXMB 1SN5A 2NW2B 4B9CA 2MRYA 2YK1H 4RSVA 3PHAA 1FP5A 3TH2T 4MAYD 4GO6B 2ZWZA 4HEMA 4ENZA 3QPXL 3QEQE 1N67A 4DVRL 1QBAA 1JBJA 1F1DA 2G3XA 3BYTA 1M42A 4YZFE 4KU1A 5KBMA 3FAXA 3P3YA 1LEGA 2J20A 4M61B 4OZGB 1L5GB 4XO5A 3RVXC 3ECWA 5HYJD 3HHMA 3T8MA 3MRMB 4X8XA 1OE2A 2Q8BH 4WWID 3RYMA 5HDBF 5M94B 4EI5B 5HYQA 3WL9B 2GJ6A 3GXTA 5D71H 4KX9A 4B53A 4LVHC 4QRAA 4N0CD 1JYXA 2NZ9D 2O5ZL 1CGVA 2ARWA 1RP9A 4XPAL 4KDWA 4YWGH 3B2DC 4OCYL 4XVSL 3CFDA 4JMNA 2R4RL 4NQUA 1CLZL 2AJUH 1Q1JL 2Q3XA 2H0JA 3EOBB 5IQNA 2JB5H 1MWAB 3FB5B 4X5XA 1BOGA 1FPTH 4WWNA 3S3JA 3GMLA 2Y9RT 4D0DA 2L7UA 3S4SG 2HMIC 4A7GA 5JNYB 4JG1H 4ODUA 2FBJH 3RU8H 1X9RA 2BCKB 1AMYA 1ADQL 2FZ3B 3FTGA 4X50A 2K7QA 4QTIL 2X4SB 4L8SB 3H6JA 4BKTC 5L88H 1IGCL 3EYUL 2CO6A 4ZFFB 2ODHA 1AZUA 5JXEA 1AXSB 5L7XL 4IOIA 3MRFB 1FZJA 4ZYKB 3RWIA 4IS6A 3X12B 4JFQB 1HCFX 1WFOA 3I3BA 4WHTB 4HUUB 4AENB 1VENA 2YFNA 1KB9K 1WBYB 1YNTF 3HC2A 3LQMA 4GQZA 3D08A 5I1IL 3SOBH 1T2XA 4KAQH 5B38G 5I6OA 4W68A 1FYTD 3ESNA 3TCLA 4OZFG 1E6JH 2CDFB 3IGLA 4JRYE 3FQTB 3MZGB 2GHWB 1L9PA 3MQIA 2OTUA 3PF2A 4U1IA 1MJUH 1OF2B 3UZQA 4WWPA 4JFEA 1U8JA 2Y25A 3ABZA 5J1SC 3V2AR 4JFOB 1HXYB 1R24B 1GPOL 1OSYA 1A7NH 4JO1L 2NY6D 3HLAA 4MNGB 1UYWL 2JKWA 3RWCB 3O11A 1A8JH 2OCFD 2ZKHH 1CFSB 3B2MA 3JV4A 5CEXA 2ATPB 1TCRB 1GGTA 4P59H 3BAXA 3OB0H 1X7QA 2EDDA 2BVEA 4JFFE 5GS0D 4X6EA 1E6OL 5T1JA 2QZAA 3MRGA 3ULAB 2GSMB 2P5WE 2GT9B 4JFED 4YHNA 3TJEL 1M71B 4XP1L 1HG8A 5J4MA 1M53A 1INDL 1L3NA 1NUDA 1FVDB 3ARPA 4JO5A 1IAKA 3UTSD 3HCVA 3IDMA 1CXHA 2Z8GA 1XGZA 3B43A 1I1AA 4BRVA 3JV6B 1AGFB 1XT5A 2N0KA 5KBNC 3DGCR 2ILLA 4ADGA 1PZSA 4LPWA 3VTAA 3J27A 4J6IA 3DX8A 4YQXL 5IP4A 4LF3A 5GRJH 1UZ6E 2JB5L 2EXWC 5CO1A 2YS4A 1L7IL 2X6CA 2WQUA 1BDYA 1R34A 3BH8B 3IPBA 4ZPTB 3KPSE 3Q2VA 4DAGL 4DGWC 5IMMA 3FFOA 1DBJL 3MYJB 3N6YA 1U8KB 1NAKH 3MCG1 5HDLA 1HJCA 4LSTH 4M5YL 3T2LA 3KS0H 1U2HA 3I9PA 2PPAA 2EC8A 4HIEB 2FHBA 4XNZC 4Y5XA 4JFQA 4FXGA 2WJ5A 4HVBA 2ATKA 3OC5A 1H5BA 2O5YL 4Q8BA 3AY2A 3OKMA 2AJ3B 5GRUL 1DUZA 5EZLA 1IA5A 1IAOA 5IG7A 3NIFF 2Q5BA 3DUUA 3ESMA 1E50A 2IMMA 5CBEA 1AP2B 2BY0A 4A2HA 5CEZH 3WLWC 1LK3L 5JHMA 2AABH 2DI8A 1T89C 3BVNB 2CDFA 3TH4T 1NDMA 4NC2B 4BZ2H 5INDA 2VDLL 35C8L 1HFUA 1EAQA 3B7UX 3CXDH 2AV1A 4N9GB 1XH0A 1PZCA 4RBPH 3G5WA 2JWYA 4E9WA 5FR3A 3LD8B 2K45A 2VLJB 3FUMA 5FWQA 4FLSA 2YD6A 5CHNA 1DBJH 3MUZ1 3MV9E 2EEBA 5BS0D 3FRPB 1XIWA 1XF5A 4RAHA 1N59B 4FF9A 5DK2B 2HFEB 5I0ZA 3MV01 1KJ2B 2DQFA 5AEAA 1QRNB 4G6JH 1GJIA 1ULVA 1EANA 1C08A 2VC2L 4ELDA 4QXTB 1WISA 3QCTH 5CINL 2ZOLA 3SO3C 4OM1L 2R0LL 4CUCA 4HOXA 2YPLB 3OKOB 3P73A 3CQPA 2ENJA 2WWKT 2NY3B 3MV9A 4OZIF 4HIEA 4PLJD 1INQA 3WN5A 2OJ1A 2ICCA 2DW5A 4BXSV 2A6IB 3ARWA 4WRLA 3UYPA 3G5XA 4YHPB 2XQBL 2A0LC 4C56A 3EGDA 3O6LH 4XNMA 4GW4A 5HSFA 4W9LC 4XNAA 1LTXA 2YRLA 5GS0L 4PBXA 5DHYA 5FYKE 2ATKB 3O8XA 1JZDC 1SXCA 1HKLL 2NOYA 2MHAA 1SEQL 1XCWA 2ZCHL 4E9SA 2P24B 2DH2A 2RAMA 3RFZC 4YHZL 4C56E 3DVGA 4K94H 3N41F 1F90H 4ZFOB 5IMMB 4IKNA 4K9EH 4B5ZA 3LAFA 4OAWA 5GS2D 4NPYB 3TVMA 3MODH 1G7MA 4I5BA 4FAAB 4NP4H 3SGJA 1BQHA 1TZGH 1G9NL 5HHMB 1JPTH 2IV8A 1RK0B 2C1OB 3KJ6H 1YN6A 5BZXA 2DQGH 3FO2B 3MACL 1ZANL 4PVMA 5ILTL 1F4WL 3VFWB 32C2A 2TAAA 3HRPA 4WEBH 1IEHA 2H0FA 1JNJA 3GIVB 1PNDA 1MRCL 1LXMA 1QHOA 1WGOA 5I1AB 1A0QH 5ADPL 5LQBH 2WQRA 3MPCA 2XXMB 1Z5YD 3OXRA 2VR5A 3HB3B 3REVA 3NP3A 1CVSC 1RUQL 3D05A 4HKJA 1DTUA 2DV6A 4AIEA 4Y2LA 5GGSB 3IU4H 3ZKSD 5E8EB 1F1AA 2EIZA 1R0AH 4X80H 3MGOB 3F8UB 1GGCH 5KVDE 1KCKA 1KIUA 4N8CL 2LU4A 3MLUL 3UC0H 4MJ6B 4WTZG 1J0ZA 3BRFA 1NHCA 2K6YA 3IDXH 3GDBA 1Q94B 2WAHA 4KUCF 4QRTB 4Z7AA 4QGYA 4OT1L 2ITCB 3CFJB 1UOKA 4NQDD 3ZDZE 5C7ZA 2YN5A 3KCPB 1DSYA 3CFNA 1RZIA 4R83A 4RMVA 2Y7OA 4YE4L 4PJDE 1MHHA 2HKAA 5E94B 4PV8A 4MDJB 3SDYL 4DPBX 4WFHD 3ZZ1A 4F2FA 5CEXB 4MJHA 4AC4A 3T1FA 5HPMA 1IRAY 1QUPA 2DQDL 3DMMD 5FYKU 2J25A 2ADJB 5L4MA 1DO6A 2CKBB 3W5NA 3CMOH 3QQ4A 1O5PA 4BFEA 3HUJE 3FT3A 2DICA 4PJDA 1U8MB 4OH2A 1RLBA 1ED3B 2NY2C 3RJOA 4JKKA 3UZQB 3QIUA 2GCYA 4TNWK 2IPKA 5TQ0L 4EVNA 2ENPA 3P30H 1LLZA 4Q14A 1L6XA 1FORL 1G7QA 2X70A 5E1AB 2LLGA 5F7NC 3RDJA 1KPUA 1UCBH 5HJBA 4DGIL 2VITA 2NY7L 4AQ1C 1OLLA 3ZYJA 2NY0C 3CLFL 3U79A 1XBRA 5FC9A 4UNVA 3TA3C 2QGCA 3ULVE 1CTNA 5L2JA 1U3HB 3P9LB 4PJCA 3WN6A 4ZO7A 2IOIA 4PJEA 2BZ7A 4NUGH 4WW1B 1SJXA 3VFVB 3UIYA 2CCLA 2X0WA 4NC1E 1MJ7L 2C3HA 5ABDE 3RA7H 4URKA 2JCCE 5KAQG 1UM5L 3HFML 4YXHL 1A6ZA 2CHNA 4XCEA 1H5BC 1YZZA 3FQWA 4NJAH 5DQJA 3SGEH 5T3XE 1URLA 5B8CA 4EXKA 1RU4A 1GGYA 2AVGA 4LLYB 4NUQA 3MR9B 3O3DB 2XY2A 2GJ6E 2WWMC 2XTJD 5DFVD 3ETTA 2XXGA 1DVUA 2ROXA 4XVTH 3QDME 5HTSA 1XG2A 2CUAA 5I1KL 4I1NB 3CQQA 1E5YA 4XRCB 5C09D 4WFGD 4U1MB 1OP4A 1HIMH 3H2QA 3QYMA 2Z31C 2J6EA 4L1LA 4MTMA 3BEVA 2UZYB 2NTQA 5JR1H 1XL4A 4KI5D 1AQHA 1NLBL 1TKWA 5KANG 3T0AA 3KPSB 3SDXB 3QH3A 4ZTEA 5ITFB 4ORGB 3CC5A 1U8CA 4NQTA 5F7YC 3DTUB 1WD8A 3FL7A 2OW6A 3GGWB 3R4DA 4K73A 2ARJQ 1QFWL 2IWFA 3HG1B 1UJ3B 2ZOTA 2WXPA 2DH3A 4A6YH 3ZTCC 4XPTH 4Y16B 2IFFH 3IJSA 3CZNA 1MFCL 3NEEA 2A9BA 4FQIL 2XA8H 1A22B 1JGEB 2C9QA 2NSXA 4Z3JA 1UD5A 4G8EA 2E6JA 4G42B 1MZYA 2WZ5A 3IMTA 4H0HB 1SJVA 2BRRL 2PYEE 4G72B 4RGNB 1PZ3A 2JIXA 5DI8B 1CZFA 3T6XA 1WFJA 4WHYG 4Z3FA 5AB9A 1A14H 2GPZA 4M1CD 2ZKXA 4PJ9A 4RAVA 5CZRA 3KGTA 3GI9H 3MNZA 3AG2B 3BPOB 4J3OC 5EF0A 3BZFB 5FO7A 3BP5B 4Q56A 2X2IA 3WYRA 3ATAA 5DJAB 5I1HL 1X9LA 2GBVA 4U49A 5EU3A 1C7SA 3CD4A 5A40E 5B7MA 2ZUVA 3P0VH 3DYOA 4P0DA 3RIFF 3QG7L 4DPCX 2AXWA 2NMSA 1N70A 4U6XA 1YYMH 1HZLA 5IB5A 4MJ4A 5IFAL 2SODB 3OHXA 4LL4A 4A55A 3QRLA 4TL4A 4KZEH 4F2ME 3CZJA 3NA9L 1JCVA 5AOZA 3VRJA 1DZ0A 5I2IB 5IMKB 3L1FA 4APQC 4IGBB 4YDZA 3WUZA 1HDMA 4OFPA 2XTXA 3ARGD 3DSNA 3KYNB 1XH3B 3LQZB 4QXVA 3VGFA 1Q0XL 2J73A 3FH8A 1CLWA 5A1AA 3SGDI 2H47C 4H25A 4PRPD 1VCAA 1JTOA 1MHCA 4HGWA 1EAOA 4N0CC 5AW7B 5JIKA 1AXSA 1BN8A 3QEGH 1Y7VA 5CR8A 4AYDC 2Y1YA 4C4KO 3B56A 1RUKH 1DN2A 1WA1X 4X99A 4HEPG 5HYJB 2AGJL 3PWLA 1UJTA 4JPVL 4AGOA 1UJ3A 3RX5A 4FP8H 1CDUA 3AU1A 3NJMA 3R4RA 2YR3A 3NYKA 3RZCC 1NCWL 4I2XE 1QQ1A 4XPBH 1F00I 3PWPE 1JSYA 5LNGA 2JQZA 4Q7DA 1T1ZB 4KNUA 1XCTA 2G5BB 5GRYA 4XNXH 2NQ3A 4FNUA 1A3LL 4PGBA 2OJZL 5B39A 3BZ5A 5B1AB 3DARA 4WI0A 4Z7UB 4R8WL 1ZSDA 1PLGH 2AI0L 5DJ2A 1A6VL 4U6VH 1XB8A 3ZIYA 4GYBA 5C0FB 3QDMD 4QYOB 3MLSL 4I4WB 5FYJU 2NY3C 3V7MA 5K9JL 4YGVA 4AE1A 4MASA 1MAJA 2CLVB 1QSFD 5EU3B 1HH6B 2XQ0A 5GISL 2H9GB 3BLKA 1DANT 4IYKA 1RPUA 3VQLA 3MRHA 1Z9SA 3U7WH 3D48R 4PJEE 2N1TE 5DK3A 3GGWA 3IFNH 3B8YA 4GUPB 4AEHH 2UWEA 4WEUD 3RUGA 2O5XH 2XG4B 3AT0A 2G2NA 4JM4L 4LLDA 4AM0B 3C08L 5I5IA 4J3VA 1ZLUK 4N1HB 3ILQC 4MMZC 4POYA 4YHKL 3EDKA 1NQBA 5I23A 3NIDB 3OF6D 3WKNA 4XP9L 3D39E 1KN4L 1T0NA 3GHBH 2ZAGA 4IKJA 2INUA 1DDTA 1E4KA 1G0XA 4Z76A 5FHAH 3P0YH 4NHUB 3OZKA 5C0IA 1T20B 2VSCA 5F7EH 5KUMA 1LE9B 2D03H 4HBCL 4WW2A 1AC0A 2GY7B 3ZHNA 3QNFA 2Y22A 3STLB 4PRPE 4HPHA 3DIFB 4QJ4B 5CJ5A 1F3JA 3RA7L 3V5KA 2YQBA 2BHFA 3NRQA 4J1UB 4FQQA 4YLBA 3S3BB 2YN3A 3O2VL 1THAA 2VLLB 4GT0A 5D7LD 3GMPB 2AJYH 3ZDZB 3ULUL 3G6DH 2G5BA 1PX4A 5BQ7B 5FO9B 3QT2A 3TJHC 2V5YA 4K9JA 1N0XH 2EE9A 4Q9QL 1S7XB 2OTWA 1RJYA 2OMTA 3HZMB 5D8JL 3VMVA 1OK0A 3EH2A 2XDHA 3MRIB 4XPTL 4G82A 3BKYL 3FU7A 2Y7SA 5JW3H 5FM8A 2Y23A 3BZEB 1GVIA 3P9MA 1HH6A 1DR9A 4HALA 4KV5F 4UM9A 5LKNA 4AQAB 4ZRGA 3HS8A 5ACMA 1ZLDA 5CN2A 4NQDA 1QSFE 3O4LA 1VEOA 3DX4A 1T5WA 4M5SA 4XOEA 4Z18A 5I82A 4KDVA 4K71B 5C0FA 3DJTA 3DUSB 2BHZA 4ZAKB 5BO0D 5L9DL 2W80C 3IJHA 4R7DA 3M1BA 1CU4H 3W82A 2ZSVA 3CN3A 4PWHA 4BIKA 5A7BA 5LXVA 1AS7A 1TOXA 3BD4A 1KIUB 1CI3M 4YBLC 3U9UB 2XPYA 4AGMA 3G04B 3V4PB 4AJWA 4MD5A 4IBQA 1L7IH 2QPDB 2X4RA 1JGUL 5DDHA 1ADWA 3MJ7B 4RZCB 5FYJD 3EXLA 4FQ2L 2JLPA 3GUTA 5FA4B 4HUWA 4U2YA 2AXGA 2FGWH 1SY6L 4XNBA 3QGVA 3LS4H 2C5DC 5BV7C 3WIHL 2A6KA 3DVFA 1ZGLA 4XZUB 4YBLB 4R7NB 1OB1B 3VD4A 3E2HB 4UZGA 3QRFM 5H2BA 2I7SA 4N8VA 2B3RA 5BZWA 2BDNL 2ADJA 4JN2B 4JMXA 3S96B 2FQDA 1BSIA 5IMLA 2XC8A 1U3YA 2IEPA 2OLDA 4AQ1B 4IHOB 4YAQA 3GRWL 1FRGH 1G9EA 4J3OD 1PKOA 3BN3B 1AHKA 1DVSA 5E0FA 2I26N 2NYYC 2XACC 3U46A 4ACTA 1GGBH 2CK0L 2BM7A 3NZ8B 1NOAA 3B1TA 2W60A 3P4NB 2WLMA 1NAMA 4FI8A 5EORH 3CX2A 3FN9A 5HI5D 1DBAL 5TDPB 3C8HA 4G11A 1JGLL 4KXAA 2GW5A 3REVB 5BZDB 1K4DA 4I18A 4ZS6C 1NUFA 4JKMA 2HKHL 2P24A 3PABB 2OMWB 2ENYA 2V5IA 2K8MA 3K5SA 1LVEA 4P2OA 4PRAB 5HYIA 3R8QA 3OKDB 1BG1A 4PRNA 2ZX9A 2H1PH 1Q1PA 1I1FA 4GLRH 3MOBH 2H3NB 4GSRA 2EYRB 2C1OA 4LRNH 3T0ED 3UZEC 4LCCB 3TN0B 3B2VL 2F1AA 3NH7L 4GW4B 4ETQA 3DV4B 5EIVA 3BT0A 2ZXDA 3TWCL 1WDAA 2HJLA 4HSQA 1HS6A 5BVJB 2X6AA 1X5LA 5JA8B 1VEMA 1UZ6F 2OR9L 3UYPB 1RZJH 4KKAC 4Z3EA 1GOGA 4BFBD 3NEXA 4FNRA 2WXJA 4FFYA 3VGAB 4XMWA 4H1LA 4EZJA 5DRWB 4GRWH 1CMOA 4Q4EA 1TVHB 3IETB 4K8RC 4N26A 5AW3B 5AMVA 2VDRH 3HPLA 4WFFD 3PXLA 4P2QE 1IV8A 4MQXD 3JWDC 2OJZH 5FW6A 2YGOA 4KKZA 4FJZA 4BK8A 4MD4B 3PP3H 4KXBA 4R8WH 4QIRA 4ZI8A 1PG7W 1GS8A 5DA4A 1BFSA 2R0ZH 5IJDC 2V0AA 2BINA 3WEXA 1KN4H 3NCCB 5GS1C 4M02A 5FA4A 5CCJA 3A67L 1HL8A 4LEOB 2VQ4A 5AYUH 3O45B 1E90A 3U30C 4JPWH 3WNOA 4PLNC 4NHCL 5JPMC 1CS6A 5BRZB 2VLMD 4M29A 4YXKL 3ZKMC 4W8TA 3UTQA 4F8LA 2X4TB 3EUUA 4O02B 4AW4A 1DQQA 2PWHA 3B2XA 2ADFH 5IHUL 2QHLA 1X5HA 4BCZA 3WFBL 2NY0D 1T2JA 2IC2A 1MCOH 3FONA 2Q10A 4W9IC 1LO4L 5T1DH 2ZKWA 1EZVX 4CC4A 5DQ9A 4A6YL 3EADA 4ZFQA 5FYKL 4AQAA 4B9FA 2KH2B 3D4YA 4HJGB 3FT3B 4XMXA 4FTDA 2NPLX 1F4AA 1GSKA 1B6UA 3VD5A 2HJKA 4F80A 1KPRA 1PW3A 3TBSA 1WGVA 2VZTA 4P9ML 5AG9A 4LLUA 4NSKB 1P69B 1I1CA 2Z35B 3GBDA 3QZWB 5IMOA 3B5HA 5JLZB 3O6ML 1X5GA 5GGVY 4DP2X 5EBMA 5DUMH 1BBDH 2ADGA 4ZS7L 5E94A 3QJZA 1B88A 4XCYA 4OFVA 5KYNA 2DF3A 3RFRA 3S37X 4FJYA 2CJUH 3VX0A 1BW8A 4XCNA 3BP7B 2KLTA 3CBJB 4JY6B 4KVNL 2VR9A 4EN3C 2R27A 1DVZA 1UXWA 2Z92B 5F1NB 1A65A 5EG6C 1UD3A 4I9WD 4UQAA 2AJ3A 1TEGA 4G5ZL 2H1PL 1X5JA 1YEKL 1E9PB 1O8KA 1FDLL 2O61A 4JPKH 4KGJA 4Z7WB 2NY0B 5E5UB 3KMDA 5EN2B 4PJIB 3UTTB 3CSFA 1A6UL 3V10A 4MXVF 4JQXC 5ACZB 1X7QB 2AZUA 2ZWSA 2AAVA 1WUNT 5B22A 3UDWC 3WDHA 1N0LB 1BF8A 1BF2A 3CSBA 2XIIA 2O1AA 5E4EC 4OD1L 1U8IA 5FHBL 1WH0A 3H3BC 5HHPA 1AJ7H 3AITA 3NCWA 1A6AB 1H5BB 2FEDD 2AF2A 4TULL 3RWEA 2EDNA 3S37L 4YCQA 3O41A 3BSZA 3D39B 3NZSA 2XG4A 1YECL 4P59L 5FS5A 1S9YA 1A6WH 3Q2WA 1LM8V 2H2PC 3HPLB 4RFNC 4F33B 1HOCA 1N5AA 2YUXA 4PRBB 1I3GL 5C6PB 2PCPA 3VI3F 3BD3A 3QRGH 1DLHA 1WFUA 4L5FL 1D5IH 1VFAB 4N0RA 4PM1A 1XF2B 1ID2A 3CHQA 3MSPA 3MA7B 1FVEB 4KBPA 1T7VA 4GAJL 3VSTA 2WGNB 2HT3D 2RQEA 3QIWD 4MS6A 3V0JA 2G3MA 3V4VH 1B4JH 3ZHDA 4NT6B 3RIAF 4DETA 2IFFL 4BWWA 2I07A 1TETH 2WINB 1YEHL 4J8RA 1EO8H 1P4IH 3WFCL 3HFMH 1B90A 4XX1E 3CZFB 2ZKYA 1FH5H 4OM0L 4X42A 4QRPD 1SFDA 1UEMA 4MFHA 2CDGA 4QTHB 3ULUF 4J3UA 3AG4B 4OLXL 3O3BB 2CRYA 2Y4SA 1LEKA 4IBTA 1JNNL 1G9ML 3KXFA 4DW2L 3G5XB 2ZYIA 3H7BA 2GSIA 3Q5YA 4IMLB 4KHXL 2O0WA 4N2OA 4ZUVA 2HTLD 4S1DD 1YA5A 1G5AA 3S5LG 4OF0A 2R69A 3OB0K 5J1AB 3CZSA 2G60H 5IB2A 4YBQC 3BH4A 3NDYE 1QO3A 2NY1B 3Q8EA 5F1NA 5KN5B 4KXZI 4FCHA 1ZVSA 2DL2A 1HNFA 2QTEA 2OJEA 3GZPA 1AQ8A 1WITA 2KDYA 5H2BB 2ZX6A 1MCSA 2DN7A 4LKCA 1GTNA 1O8JA 3HUJF 5C0GA 4L05A 4AT6A 1ZGLB 2NNFA 3IBEA 4LE8A 3M1OA 4LP8A 5BJTB 3WE1A 3MV8E 3FN0L 4XO4A 2K4AA 3DROA 1UD2A 4KO7A 1KXTA 1R5VB 2PNDA 1CTOA 2QDWA 1LHZA 3RRQA 2NUPA 3EYFA 4P46D 4M9OA 3QHZH 1FZOA 2UY6A 3ETBF 5DD6A 3I2CL 1G7IB 1OCCB 2B0SH 3T0VA 3VWKB 4K71C 5EUKB 1I7UB 4P2RA 4MNQB 1QX1A 4G8FA 1AP2A 2IDUA 3M88A 1ZIAA 2XA3A 5T3XL 3Q9QA 5T1LD 2WY3B 1WBXB 1CI5A 3F12B 5I76A 1KELH 4XNZB 1BD2D 3M17B 3JURA 3CDGA 4L8DB 4ATWA 2EDTA 1U33A 3MLWH 5DLLA 3F6JA 5EH1A 2WXRA 3FQUB 2XQYA 1RUQH 5CMAA 3MRQA 5IEKB 3SSGA 5TE4H 3BVUA 2JKTM 1KGYE 2HRPH 1MFVA 2MCMA 3L3KB 3ULUH 1S7QB 5HGBB 2VABA 3F2LA 2PYGA 3MLRH 1IZKA 4AVZA 4DF9A 4QRRA 1YPZF 3U36B 1NEZB 3BLPX 3NK3A 2QQLL 3UX9B 3F7PC 4J39A 1P9MC 1WS7A 3WDIA 3D18B 1BJ8A 2IGLA 1LDPH 3QWRD 4LLDB 4XPFL 2HWZL 5KYXB 3DUUB 3FCUB 1DQTA 3PWNB 4ZUWA 1FH5L 4PIRF 5E1GA 4IOSD 4YSAA 5TF1L 2B8OT 1KWGA 3VWKD 1U8HA 4G6MH 3GMNA 1D9KA 5EB9A 5LN8A 3RDTD 2D4DA 1GKOA 2O5NA 3EFFB 4PB0L 3GINA 4XNQA 2V3EA 4WGWB 2D3JA 1LE9A 2P43B 2YXFA 5DD0L 3SO3B 1AOZA 1MREH 3CZKA 4UUJA 1NMCC 1RULH 4Z76B 3QDJD 5C0EA 1NEUA 2AGJH 5CWSA 2LAAA 4W6XB 5D6CA 4X9HA 1U21A 4X6BA 3WNPA 1Y07A 5KVEE 2AJUL 2E27L 4W9CC 4PGDB 2PN5A 4Z78A 3RWFB 3SY0A 1M2VB 2O6FA 3X3GL 4UQ2A 2WXFA 1JV2B 4QOKA 2XT4A 4M8UA 4XN7A 4TUKH 4PCSA 1BXUA 5F9WC 3F5WA 4KY1L 4OZYA 1TZGL 2DYSB 1U3HA 4LOUC 4J28A 3UO1L 4R96B 4MRBA 1E40A 2KPNA 4LB8A 3CFUA 3QWNA 3GSUA 4F7EA 4GAYA 3VXOB 2ATAA 1ERNA 1GZQA 2B9BA 2DEYX 2GUOB 2A83A 4JFFA 4RX4A 1KT2A 2FJHA 2ALAA 5JORB 1IT9L 2OW7A 5GIRB 3PRZA 3VFRA 2VBKA 1S5IL 4MDIA 4OCSL 3VMPA 3C5XA 5EMYA 1BEXA 5IQ7L 2PWEA 2YUWA 3F83A 1WFTA 4JQIL 4MNGA 3GSVB 2NY5H 2PCXA 1U8MA 2Z31B 4JKLA 3V4PH 1KXQE 4Z9KB 1HQRA 3S4SA 3GMOB 4ZMWA 1XCXA 1VESA 3MROB 2R2EB 2AEIT 2ORBH 3MBWA 2EWEA 4XVJH 2P80A 4XNUL 1C7TA 1L6PA 3GSQA 3CFKA 4LPXA 3O8XC 3T4AC 3CFIC 4CDGC 4MZIA 1IILE 4BZ2L 3BDBA 4I0CC 3ECUA 3NFPA 4ZMXA 5HD8C 5EU5B 5JHDB 3ESUF 3H54A 2A77L 4YHYB 4DN4H 1YEHH 4L37A 3MNZB 1GIGL 3SD5A 1ASOA 3GIZL 3VQ2C 5J11C 4PJ5D 4BBWA 2YO3A 4M3KB 5GRUH 1SUJA 4DKFL 3AXLA 4PY8J 4KK6D 1JS4A 2VAJA 1BLNB 3K8LA 4AYID 3EKCA 3APNA 3K2MC 2AJSL 4QHPA 1H6UA 1OCWH 1TEYA 5IJKA 2R2BB 3PQYE 2EUVA 2MNJB 5D2LB 5IBLC 4HIPA 2PCPB 4NUMA 3VRLE 1WZMA 4JUSA 1HI6A 2ZCKL 5CAYB 3RBGA 3LS5L 4ANWA 3KLKA 2EDKA 1BIIA 4NQQA 3MFFA 3UBXA 2BWQA 1GZHC 1O8FA 2I32A 4JX0A 2JF1A 4XCFL 4PD4K 2ED7A 3VFUB 3ZJAA 3OKKB 3NBNA 3GZKA 2JI3A 4PW3A 1H6TA 4CKVX 5FLVA 4M00A 4PJ9B 3SKUD 2WWMD 4C4UA 2DQTH 2R4SH 4X6FA 4KI5F 2F08A 3FB7B 1U2YA 2HFTA 3AMKA 1CXFA 1F18A 1KCWA 2A9NH 4CKQA 3LEYH 2F58H 5D2NA 1S5HA 2PCFB 3FO0L 2HX8A 3JWNG 3EDDA 4QO1B 3QNYA 4OGXH 5E2VH 5E5RB 4YHIA 3WO3B 1IGTB 2J88H 3K6NA 1SYSA 4PJ5B 2W9EH 2KDGA 3V0AC 3PV6B 1E8ZA 4L1SA 4JFXA 3ZW3A 4DIXA 1NMAL 4OQ1A 4YFDB 5AUMB 1YAZA 4JHAL 4WGVB 3FT0A 4M1GL 4I2XB 1ECYA 2LFGA 1J8HA 5IZ7A 1HHHB 4LLYA 1ZCRA 4DN3H 3ATFA 1U3HC 1AQMA 2F19L 3FXIC 3OPZH 2XZCL 2QQNH 4G1EB 5E5MA 5HDOA 4N90E 4RFNB 4OLWL 1YEIL 4L48A 4NN6B 1BAWA 4NK6A 4HUMB 4C4BA 1M7UA 1LILA 1MLCA 5T5FH 4I3SL 1XEDA 3FUKA 3EOYG 4PJCB 4Y19B 5F89B 1IB4A 1JZIA 4LPCA 1KTRL 5TGBA 5JTWA 3IDNB 1INDH 2R1XB 1QW8A 3L16A 3QUKB 1L0QA 3GSXB 2P47B 2K8QA 3RKPA 5F70A 3B3IA 3K4DA 2LV4A 2BNRA 4G43B 4OJOA 4L0PB 3CFKB 5EORL 4DKEL 1CFMA 4HWBH 5GSRA 5I30H 3LXBA 4WI9A 1T7XA 2OMVB 2OZNA 3BKJH 5EUOE 1OE3A 4KVCL 1HYSD 3FRUB 3DRTA 4Z7QF 2E27H 1H0DA 4NZFA 3WIFB 4QAMB 2SEBB 1KDIA 1NIEA 4NGHH 4TPRL 1JHTB 3MV8B 5SWZB 4MB3A 2MJWA 1CYGA 1KJ2L 1T83A 5JYLA 3GPEA 5DVKA 5KN5A 3NH7H 2Y0SA 2N4IA 1SQ2N 2DLFH 4WNJA 1PD1A 1OLZA 1XQ4A 4JVUA 1WEJH 3R7RA 5B7FA 2OSLA 4FQHA 1G6RA 4ODXA 4C4KT 3LIZL 1NCDH 2CNZA 4RVBA 1MJ8H 3HE6B 1P4BL 1UJ3C 4WWKA 5ESAB 5GZND 5LVEA 3KR3L 1I4FA 4FLRA 1IKOP 2NLJB 3QZPA 1EXGA