1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Adenylyl Cyclase-Associated Protein
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
2YUHA 4V02C 1KQ5A 1HF2A 3BH6B 3BH7B 1K8FA 1K4ZA 2B0RA 2BX6A
chains in the Genus database with same CATH superfamily
4XN0A 4XLHA 2X6YA 1IDJA 2UVFA 4AVZA 1LLZA 1TYXA 1RMGA 4YELA 4XNFA 5JMCB 1TYVA 2J8KA 2NTQA 2XT4A 1RWRA 4W8RA 1OFDA 4XORA 3ZPPA 4PMHA 1EE6A 5C1CA 1O8DA 1QRBA 3N6ZA 1O88A 3JURA 4URRA 3AK5A 1IDKA 1O8EA 1TYWA 1O8MA 4KH3A 1H80A 3LMWA 1CZFA 4W8QA 1GQ8A 1PLUA 4HWVA 4OJ6A 1JRGA 4XL9A 2EWEA 5AMVA 1EA0A 1XG2A 2VBMA 4YCQA 2QZAA 4NK8A 3SZEA 2XTYA 1O8LA 2O17A 3H09A 3JX8A 2X3HA 2W7ZA 4XONA 4U4BA 4XMYA 4YZAA 1QCXA 1WXRA 4C2LA 2B0RA 4XQFA 4OPWA 4YC5A 2V5IA 2VBKA 2ODLA 1O8HA 3B4NA 2NT9A 4W8SA 4XOTA 3PSSA 2O0WA 4OJ5A 1BHEA 2XTXA 2INVA 3EQOA 3P4GA 1WMRA 4OZZA 2O0VA 3DU1X 2NT6A 4XN3A 1VBLA 1OFEA 1DBGA 2VFOA 2VJJA 1QRCA 1QQ1A 1HG8A 4OJLA 3VMWA 4YDTA 4XR6A 4YEIA 3VSTA 1KTWA 3GRHA 3B90A 1EZGA 4XLFA 1LM1A 3SYJA 1OFMA 1O8KA 1IA5A 3PETA 4XOPA 1X0CA 3B8YA 4XLCA 2O04A 4W8TA 1OGMX 1QJVA 2NTPA 2IOUG 2QY1A 2X6WA 3EQNA 3LJYA 3RIQA 3GQAA 4YFOA 2XC1A 3ZSCA 1KQ5A 2G0YA 2BM4A 3NB2A 2BM5A 4I84A 3LYCA 4XLEA 1KCCA 1QA3A 3TH0A 1PXZA 2QXZA 2VFMA 4NK6A 1HF2A 1TSPA 4YZQA 3N90A 4Z03A 2BM6A 3PSZA 1O8IA 4XKWA 2PYHA 3SUCA 3T9GA 3VSVA 5JLVC 2Z8GA 1DBOA 3VSUA 3VMVA 2J8IA 3GQ7A 2NZMA 1O8JA 3BH7B 1K4ZA 2XT2A 4Z06A 1NHCA 2NSPA 2F3LA 2BM7A 2BSPA 1L1IA 1O8GA 2IQ7A 2O1DA 4OM9A 4OJPA 4YZXA 1K8FA 4MXNA 1AIRA 1JTAA 4JRAC 2VJIA 2NTBA 1PE9A 2O6WA 1CLWA 4XKVA 2QYUA 2VBEA 3SY2A 1KCDA 2NSTA 4EW9A 2X6XA 5DNSA 1QA1A 4OZYA 4YEJA 2QX3A 4Z05A 4YZ0A 1RU4A 2PECA 2VFPA 4U49A 4V02C 4OJOA 1BN8A 3BH6B 3GQ8A 4MR0A 1OFLA 3ML3A 1QA2A 1OGOX 1O8FA 3UW0A 1OOCA 4XLAA 3SQVA 2PYGA 4XM3A 2X85A 1K5CA 2INUA 2BX6A 2VFNA 1TYUA 1DABA 2YUHA 3NAWA 2XTWA 3GQ9A 3KRGA 3WWGA 1IB4A 5C1EA 1LLWA 2VFQA 2UVEA 3FY3A
chains in the Genus database with same CATH topology
4JRAC 2XC1A 1CLWA 1KQ5A 2G0YA 2BM4A 4OJ5A 1TYXA 2BM5A 3LYCA 1QA3A 5JMCB 3TH0A 1QA1A 1TYVA 3P4GA 2VFMA 2VFPA 4V02C 1HF2A 1TSPA 2VFOA 1QRCA 1QQ1A 3BH6B 3N90A 3N6ZA 1QRBA 2BM6A 4OJLA 3ML3A 4OJOA 1QA2A 1TYWA 5JLVC 4KH3A 2J8IA 4OJ6A 3SYJA 3BH7B 1K4ZA 3PETA 2F3LA 2BX6A 2BM7A 2VFNA 1TYUA 3H09A 2YUHA 3SZEA 4OM9A 3JX8A 1DABA 2W7ZA 4OJPA 3LJYA 2IOUG 3RIQA 1WXRA 1K8FA 2VFQA 2B0RA 4OPWA 3AK5A 2V5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUH A;  4V02 C;  1KQ5 A;  1HF2 A;  3BH6 B;  3BH7 B;  1K8F A;  1K4Z A;  2B0R A;  2BX6 A; 
#chains in the Genus database with same CATH topology
 4XN0 A;  4XLH A;  2X6Y A;  1IDJ A;  2UVF A;  4AVZ A;  1LLZ A;  1TYX A;  1RMG A;  4YEL A;  4XNF A;  5JMC B;  1TYV A;  2J8K A;  2NTQ A;  2XT4 A;  1RWR A;  4W8R A;  1OFD A;  4XOR A;  3ZPP A;  4PMH A;  1EE6 A;  5C1C A;  1O8D A;  1QRB A;  3N6Z A;  1O88 A;  3JUR A;  4URR A;  3AK5 A;  1IDK A;  1O8E A;  1TYW A;  1O8M A;  4KH3 A;  1H80 A;  3LMW A;  1CZF A;  4W8Q A;  1GQ8 A;  1PLU A;  4HWV A;  4OJ6 A;  1JRG A;  4XL9 A;  2EWE A;  5AMV A;  1EA0 A;  1XG2 A;  2VBM A;  4YCQ A;  2QZA A;  4NK8 A;  3SZE A;  2XTY A;  1O8L A;  2O17 A;  3H09 A;  3JX8 A;  2X3H A;  2W7Z A;  4XON A;  4U4B A;  4XMY A;  4YZA A;  1QCX A;  1WXR A;  4C2L A;  2B0R A;  4XQF A;  4OPW A;  4YC5 A;  2V5I A;  2VBK A;  2ODL A;  1O8H A;  3B4N A;  2NT9 A;  4W8S A;  4XOT A;  3PSS A;  2O0W A;  4OJ5 A;  1BHE A;  2XTX A;  2INV A;  3EQO A;  3P4G A;  1WMR A;  4OZZ A;  2O0V A;  3DU1 X;  2NT6 A;  4XN3 A;  1VBL A;  1OFE A;  1DBG A;  2VFO A;  2VJJ A;  1QRC A;  1QQ1 A;  1HG8 A;  4OJL A;  3VMW A;  4YDT A;  4XR6 A;  4YEI A;  3VST A;  1KTW A;  3GRH A;  3B90 A;  1EZG A;  4XLF A;  1LM1 A;  3SYJ A;  1OFM A;  1O8K A;  1IA5 A;  3PET A;  4XOP A;  1X0C A;  3B8Y A;  4XLC A;  2O04 A;  4W8T A;  1OGM X;  1QJV A;  2NTP A;  2IOU G;  2QY1 A;  2X6W A;  3EQN A;  3LJY A;  3RIQ A;  3GQA A;  4YFO A;  2XC1 A;  3ZSC A;  1KQ5 A;  2G0Y A;  2BM4 A;  3NB2 A;  2BM5 A;  4I84 A;  3LYC A;  4XLE A;  1KCC A;  1QA3 A;  3TH0 A;  1PXZ A;  2QXZ A;  2VFM A;  4NK6 A;  1HF2 A;  1TSP A;  4YZQ A;  3N90 A;  4Z03 A;  2BM6 A;  3PSZ A;  1O8I A;  4XKW A;  2PYH A;  3SUC A;  3T9G A;  3VSV A;  5JLV C;  2Z8G A;  1DBO A;  3VSU A;  3VMV A;  2J8I A;  3GQ7 A;  2NZM A;  1O8J A;  3BH7 B;  1K4Z A;  2XT2 A;  4Z06 A;  1NHC A;  2NSP A;  2F3L A;  2BM7 A;  2BSP A;  1L1I A;  1O8G A;  2IQ7 A;  2O1D A;  4OM9 A;  4OJP A;  4YZX A;  1K8F A;  4MXN A;  1AIR A;  1JTA A;  4JRA C;  2VJI A;  2NTB A;  1PE9 A;  2O6W A;  1CLW A;  4XKV A;  2QYU A;  2VBE A;  3SY2 A;  1KCD A;  2NST A;  4EW9 A;  2X6X A;  5DNS A;  1QA1 A;  4OZY A;  4YEJ A;  2QX3 A;  4Z05 A;  4YZ0 A;  1RU4 A;  2PEC A;  2VFP A;  4U49 A;  4V02 C;  4OJO A;  1BN8 A;  3BH6 B;  3GQ8 A;  4MR0 A;  1OFL A;  3ML3 A;  1QA2 A;  1OGO X;  1O8F A;  3UW0 A;  1OOC A;  4XLA A;  3SQV A;  2PYG A;  4XM3 A;  2X85 A;  1K5C A;  2INU A;  2BX6 A;  2VFN A;  1TYU A;  1DAB A;  2YUH A;  3NAW A;  2XTW A;  3GQ9 A;  3KRG A;  3WWG A;  1IB4 A;  5C1E A;  1LLW A;  2VFQ A;  2UVE A;  3FY3 A; 
#chains in the Genus database with same CATH homology
 4JRA C;  2XC1 A;  1CLW A;  1KQ5 A;  2G0Y A;  2BM4 A;  4OJ5 A;  1TYX A;  2BM5 A;  3LYC A;  1QA3 A;  5JMC B;  3TH0 A;  1QA1 A;  1TYV A;  3P4G A;  2VFM A;  2VFP A;  4V02 C;  1HF2 A;  1TSP A;  2VFO A;  1QRC A;  1QQ1 A;  3BH6 B;  3N90 A;  3N6Z A;  1QRB A;  2BM6 A;  4OJL A;  3ML3 A;  4OJO A;  1QA2 A;  1TYW A;  5JLV C;  4KH3 A;  2J8I A;  4OJ6 A;  3SYJ A;  3BH7 B;  1K4Z A;  3PET A;  2F3L A;  2BX6 A;  2BM7 A;  2VFN A;  1TYU A;  3H09 A;  2YUH A;  3SZE A;  4OM9 A;  3JX8 A;  1DAB A;  2W7Z A;  4OJP A;  3LJY A;  2IOU G;  3RIQ A;  1WXR A;  1K8F A;  2VFQ A;  2B0R A;  4OPW A;  3AK5 A;  2V5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...