1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Adenylyl Cyclase-Associated Protein
publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
1K8FA 4V02C 1HF2A 3BH7B 2B0RA 2BX6A 3BH6B 1KQ5A 2YUHA 1K4ZA
chains in the Genus database with same CATH superfamily
4OZZA 2O0VA 3ZSCA 4OJ6A 4XLEA 1XG2A 4U4BA 2BX6A 2XTYA 1OFDA 2F3LA 1O88A 2VFNA 2VJJA 1OFLA 1EZGA 3WWGA 4URRA 1OGMX 1QCXA 2ODLA 3SUCA 1IB4A 2QX3A 2VFPA 4U49A 4Z06A 4AVZA 1KCCA 2NTQA 1BHEA 1OFEA 4NK6A 4YCQA 3T9GA 1GQ8A 4PMHA 4XN3A 1PLUA 1QRCA 2BM6A 3VSUA 4YZXA 2QYUA 1TYXA 2BM7A 2X85A 1LM1A 4OJOA 1NHCA 4OJLA 3JX8A 1TYUA 4YFOA 3SYJA 3AK5A 2X6WA 1HF2A 2VFOA 2Z8GA 2G0YA 4XR6A 3FY3A 2X6YA 1RMGA 3JURA 4XM3A 1QRBA 1AIRA 4YELA 4YZAA 3GRHA 4MR0A 3N6ZA 4OJPA 2XTWA 1X0CA 1TYVA 1QA2A 1OGOX 4OM9A 1OFMA 3LYCA 4W8SA 3NAWA 2J8IA 5DNSA 1K5CA 2J8KA 3GQ7A 1O8MA 3ZPPA 3VSVA 2VBMA 4OPWA 4OZYA 4YDTA 1DBOA 1O8JA 2O1DA 4YEJA 2VFMA 2QY1A 1TYWA 2INVA 1KTWA 3PETA 1WXRA 4V02C 1HG8A 1O8DA 1O8LA 1O8EA 3PSZA 3DU1X 1H80A 3GQAA 2INUA 1O8IA 4NK8A 1LLWA 3TH0A 2UVEA 3N90A 4I84A 4MXNA 2NSPA 5C1CA 2PYGA 3LJYA 2X3HA 3BH6B 2BSPA 3SY2A 2BM4A 1QQ1A 3PSSA 1RWRA 1EA0A 2O6WA 4XLHA 2NT9A 3RIQA 1DABA 3NB2A 1QJVA 4KH3A 4XONA 2YUHA 1TSPA 3BH7B 3B4NA 2NTPA 3H09A 2QXZA 1O8GA 1QA1A 4XORA 3P4GA 1QA3A 1PE9A 1KQ5A 1O8KA 1K4ZA 4XKVA 2VBEA 5C1EA 4XOPA 2XT2A 1WMRA 3GQ9A 2O04A 4XLCA 3EQNA 1EE6A 2IOUG 2NSTA 4XLFA 3ML3A 4XQFA 1KCDA 2VJIA 4XLAA 4YC5A 4EW9A 2EWEA 4YZQA 3UW0A 4W8TA 1OOCA 2NT6A 4HWVA 4XL9A 1BN8A 2V5IA 3LMWA 4W8QA 4XOTA 3VMWA 2W7ZA 4XMYA 2VFQA 4C2LA 3KRGA 4W8RA 1IDKA 2B0RA 2NZMA 1CLWA 5JLVC 3B90A 1VBLA 3VSTA 1JRGA 1K8FA 2XTXA 4Z03A 1L1IA 1IA5A 2VBKA 4XKWA 1DBGA 2PECA 1PXZA 2X6XA 4YZ0A 1JTAA 1IDJA 3EQOA 2XT4A 4JRAC 1CZFA 4YEIA 2PYHA 5AMVA 5JMCB 1LLZA 2O17A 1O8HA 4XN0A 1RU4A 2NTBA 1O8FA 2BM5A 4XNFA 4Z05A 2XC1A 2O0WA 3GQ8A 3VMVA 4OJ5A 3SQVA 2UVFA 3B8YA 3SZEA 2QZAA 2IQ7A
chains in the Genus database with same CATH topology
3N6ZA 4OJPA 1QA2A 1TYVA 2W7ZA 4OJ6A 2VFQA 4OM9A 3RIQA 1DABA 3LYCA 2B0RA 2BX6A 1CLWA 2F3LA 2J8IA 4KH3A 5JLVC 2VFNA 2YUHA 1TSPA 3BH7B 1K8FA 3H09A 4OPWA 2VFPA 1QA1A 3P4GA 1QA3A 2VFMA 1KQ5A 1K4ZA 2BM6A 1QRCA 1TYWA 3PETA 1WXRA 4V02C 4JRAC 1TYXA 2BM7A 2IOUG 5JMCB 3ML3A 4OJOA 4OJLA 2BM5A 1TYUA 3JX8A 3SYJA 3AK5A 1HF2A 2XC1A 2VFOA 2G0YA 3TH0A 3N90A 4OJ5A 3LJYA 3BH6B 1QRBA 3SZEA 2V5IA 2BM4A 1QQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8F A;  4V02 C;  1HF2 A;  3BH7 B;  2B0R A;  2BX6 A;  3BH6 B;  1KQ5 A;  2YUH A;  1K4Z A; 
#chains in the Genus database with same CATH topology
 4OZZ A;  2O0V A;  3ZSC A;  4OJ6 A;  4XLE A;  1XG2 A;  4U4B A;  2BX6 A;  2XTY A;  1OFD A;  2F3L A;  1O88 A;  2VFN A;  2VJJ A;  1OFL A;  1EZG A;  3WWG A;  4URR A;  1OGM X;  1QCX A;  2ODL A;  3SUC A;  1IB4 A;  2QX3 A;  2VFP A;  4U49 A;  4Z06 A;  4AVZ A;  1KCC A;  2NTQ A;  1BHE A;  1OFE A;  4NK6 A;  4YCQ A;  3T9G A;  1GQ8 A;  4PMH A;  4XN3 A;  1PLU A;  1QRC A;  2BM6 A;  3VSU A;  4YZX A;  2QYU A;  1TYX A;  2BM7 A;  2X85 A;  1LM1 A;  4OJO A;  1NHC A;  4OJL A;  3JX8 A;  1TYU A;  4YFO A;  3SYJ A;  3AK5 A;  2X6W A;  1HF2 A;  2VFO A;  2Z8G A;  2G0Y A;  4XR6 A;  3FY3 A;  2X6Y A;  1RMG A;  3JUR A;  4XM3 A;  1QRB A;  1AIR A;  4YEL A;  4YZA A;  3GRH A;  4MR0 A;  3N6Z A;  4OJP A;  2XTW A;  1X0C A;  1TYV A;  1QA2 A;  1OGO X;  4OM9 A;  1OFM A;  3LYC A;  4W8S A;  3NAW A;  2J8I A;  5DNS A;  1K5C A;  2J8K A;  3GQ7 A;  1O8M A;  3ZPP A;  3VSV A;  2VBM A;  4OPW A;  4OZY A;  4YDT A;  1DBO A;  1O8J A;  2O1D A;  4YEJ A;  2VFM A;  2QY1 A;  1TYW A;  2INV A;  1KTW A;  3PET A;  1WXR A;  4V02 C;  1HG8 A;  1O8D A;  1O8L A;  1O8E A;  3PSZ A;  3DU1 X;  1H80 A;  3GQA A;  2INU A;  1O8I A;  4NK8 A;  1LLW A;  3TH0 A;  2UVE A;  3N90 A;  4I84 A;  4MXN A;  2NSP A;  5C1C A;  2PYG A;  3LJY A;  2X3H A;  3BH6 B;  2BSP A;  3SY2 A;  2BM4 A;  1QQ1 A;  3PSS A;  1RWR A;  1EA0 A;  2O6W A;  4XLH A;  2NT9 A;  3RIQ A;  1DAB A;  3NB2 A;  1QJV A;  4KH3 A;  4XON A;  2YUH A;  1TSP A;  3BH7 B;  3B4N A;  2NTP A;  3H09 A;  2QXZ A;  1O8G A;  1QA1 A;  4XOR A;  3P4G A;  1QA3 A;  1PE9 A;  1KQ5 A;  1O8K A;  1K4Z A;  4XKV A;  2VBE A;  5C1E A;  4XOP A;  2XT2 A;  1WMR A;  3GQ9 A;  2O04 A;  4XLC A;  3EQN A;  1EE6 A;  2IOU G;  2NST A;  4XLF A;  3ML3 A;  4XQF A;  1KCD A;  2VJI A;  4XLA A;  4YC5 A;  4EW9 A;  2EWE A;  4YZQ A;  3UW0 A;  4W8T A;  1OOC A;  2NT6 A;  4HWV A;  4XL9 A;  1BN8 A;  2V5I A;  3LMW A;  4W8Q A;  4XOT A;  3VMW A;  2W7Z A;  4XMY A;  2VFQ A;  4C2L A;  3KRG A;  4W8R A;  1IDK A;  2B0R A;  2NZM A;  1CLW A;  5JLV C;  3B90 A;  1VBL A;  3VST A;  1JRG A;  1K8F A;  2XTX A;  4Z03 A;  1L1I A;  1IA5 A;  2VBK A;  4XKW A;  1DBG A;  2PEC A;  1PXZ A;  2X6X A;  4YZ0 A;  1JTA A;  1IDJ A;  3EQO A;  2XT4 A;  4JRA C;  1CZF A;  4YEI A;  2PYH A;  5AMV A;  5JMC B;  1LLZ A;  2O17 A;  1O8H A;  4XN0 A;  1RU4 A;  2NTB A;  1O8F A;  2BM5 A;  4XNF A;  4Z05 A;  2XC1 A;  2O0W A;  3GQ8 A;  3VMV A;  4OJ5 A;  3SQV A;  2UVF A;  3B8Y A;  3SZE A;  2QZA A;  2IQ7 A; 
#chains in the Genus database with same CATH homology
 3N6Z A;  4OJP A;  1QA2 A;  1TYV A;  2W7Z A;  4OJ6 A;  2VFQ A;  4OM9 A;  3RIQ A;  1DAB A;  3LYC A;  2B0R A;  2BX6 A;  1CLW A;  2F3L A;  2J8I A;  4KH3 A;  5JLV C;  2VFN A;  2YUH A;  1TSP A;  3BH7 B;  1K8F A;  3H09 A;  4OPW A;  2VFP A;  1QA1 A;  3P4G A;  1QA3 A;  2VFM A;  1KQ5 A;  1K4Z A;  2BM6 A;  1QRC A;  1TYW A;  3PET A;  1WXR A;  4V02 C;  4JRA C;  1TYX A;  2BM7 A;  2IOU G;  5JMC B;  3ML3 A;  4OJO A;  4OJL A;  2BM5 A;  1TYU A;  3JX8 A;  3SYJ A;  3AK5 A;  1HF2 A;  2XC1 A;  2VFO A;  2G0Y A;  3TH0 A;  3N90 A;  4OJ5 A;  3LJY A;  3BH6 B;  1QRB A;  3SZE A;  2V5I A;  2BM4 A;  1QQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...