1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Adenylyl Cyclase-Associated Protein
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
3BH6B 1HF2A 1K4ZA 2B0RA 4V02C 1KQ5A 2YUHA 2BX6A 1K8FA 3BH7B
chains in the Genus database with same CATH superfamily
4YFOA 5DNSA 4C2LA 2Z8GA 1L1IA 4HWVA 2EWEA 2X6WA 1VBLA 3ZPPA 4YZQA 1OFEA 2QYUA 2VFOA 2XTWA 3DU1X 2NTBA 4OJOA 2X6XA 4U4BA 2PYHA 3SQVA 3JURA 4XQFA 1LM1A 5JMCB 1DBOA 1TYXA 2J8KA 2XT4A 4XM3A 3GQAA 2B0RA 3B4NA 4OPWA 1OGOX 4OJPA 3GQ9A 1LLWA 1TSPA 5AMVA 1O8JA 1PXZA 4URRA 3RIQA 2INUA 1O8MA 3B8YA 3JX8A 3N90A 3ZSCA 5JLVC 3UW0A 1EA0A 4Z05A 1K4ZA 4AVZA 3SY2A 4XOPA 1OFLA 1OFDA 3N6ZA 2IOUG 2QX3A 4XLAA 2BM6A 2BM5A 3SUCA 4PMHA 3PSZA 2PYGA 2X85A 3P4GA 4JRAC 3WWGA 1O8EA 4YEJA 1IB4A 2VFNA 1DABA 1KCDA 1QCXA 1PLUA 3B90A 4MXNA 1O8KA 1IDJA 1LLZA 2F3LA 2X6YA 3BH6B 2O17A 2VFQA 1O8DA 1TYWA 2IQ7A 3KRGA 4OZZA 3LYCA 1IDKA 3NAWA 1O8FA 2J8IA 2O1DA 2VJIA 2VJJA 1K8FA 1OGMX 3GQ7A 3PETA 4OJ6A 4YCQA 4I84A 3VSTA 1QA3A 2VFMA 1O8HA 4V02C 4OJ5A 4W8SA 3H09A 2QY1A 1NHCA 4Z06A 4XKVA 3GQ8A 4XL9A 1QA1A 4YZ0A 1TYUA 2O6WA 2XTXA 4XLCA 4XLEA 4W8TA 2UVFA 5C1CA 1QRBA 1PE9A 1X0CA 2INVA 2NTQA 2NTPA 2VBEA 4OM9A 2QXZA 1QA2A 1KTWA 2BM7A 2VBMA 4MR0A 4YZXA 1BN8A 3VMVA 4XLFA 1AIRA 2VFPA 1KQ5A 1GQ8A 1BHEA 2W7ZA 2NT9A 4YC5A 1CLWA 1H80A 2XTYA 1JRGA 1OOCA 4W8RA 1XG2A 4XORA 1QRCA 2O0WA 3FY3A 1RU4A 2NZMA 2O0VA 3LJYA 2NT6A 3ML3A 2G0YA 1O8LA 4KH3A 1EE6A 4XN3A 4XN0A 2XC1A 1O88A 1EZGA 2BSPA 1CZFA 4NK6A 4OJLA 1HG8A 2BX6A 2VBKA 3BH7B 4XKWA 4XONA 4XOTA 2BM4A 1TYVA 4XMYA 1QJVA 3VSUA 3T9GA 4EW9A 2XT2A 2YUHA 4W8QA 4YZAA 1RWRA 3LMWA 4XLHA 3TH0A 2NSTA 4XR6A 3VMWA 3EQNA 2ODLA 1IA5A 4YELA 1O8GA 1WXRA 4XNFA 3SZEA 1K5CA 2NSPA 1HF2A 1DBGA 1RMGA 2X3HA 3EQOA 3VSVA 1KCCA 1JTAA 3SYJA 1O8IA 4Z03A 4YEIA 4OZYA 3NB2A 1OFMA 2PECA 5C1EA 2V5IA 4YDTA 3AK5A 3GRHA 2UVEA 4NK8A 3PSSA 1WMRA 2O04A 1QQ1A 2QZAA 4U49A
chains in the Genus database with same CATH topology
1TYUA 2BM4A 1TYVA 2BM6A 2BM5A 2YUHA 1QRBA 1QA2A 4OM9A 3TH0A 3P4GA 2BM7A 4JRAC 2VFOA 4OJOA 2VFNA 1DABA 2VFPA 1KQ5A 1WXRA 2F3LA 3SZEA 1TYXA 2W7ZA 1CLWA 3BH6B 1HF2A 2B0RA 2VFQA 4OPWA 1TYWA 4OJPA 3SYJA 1TSPA 1QRCA 3LYCA 3RIQA 5JMCB 2J8IA 3PETA 3JX8A 4OJ6A 1K8FA 3LJYA 3ML3A 3N90A 5JLVC 1QA3A 2G0YA 4KH3A 1K4ZA 2V5IA 2VFMA 3AK5A 2XC1A 4V02C 4OJLA 4OJ5A 3N6ZA 3H09A 2BX6A 2IOUG 1QQ1A 3BH7B 1QA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  1HF2 A;  1K4Z A;  2B0R A;  4V02 C;  1KQ5 A;  2YUH A;  2BX6 A;  1K8F A;  3BH7 B; 
#chains in the Genus database with same CATH topology
 4YFO A;  5DNS A;  4C2L A;  2Z8G A;  1L1I A;  4HWV A;  2EWE A;  2X6W A;  1VBL A;  3ZPP A;  4YZQ A;  1OFE A;  2QYU A;  2VFO A;  2XTW A;  3DU1 X;  2NTB A;  4OJO A;  2X6X A;  4U4B A;  2PYH A;  3SQV A;  3JUR A;  4XQF A;  1LM1 A;  5JMC B;  1DBO A;  1TYX A;  2J8K A;  2XT4 A;  4XM3 A;  3GQA A;  2B0R A;  3B4N A;  4OPW A;  1OGO X;  4OJP A;  3GQ9 A;  1LLW A;  1TSP A;  5AMV A;  1O8J A;  1PXZ A;  4URR A;  3RIQ A;  2INU A;  1O8M A;  3B8Y A;  3JX8 A;  3N90 A;  3ZSC A;  5JLV C;  3UW0 A;  1EA0 A;  4Z05 A;  1K4Z A;  4AVZ A;  3SY2 A;  4XOP A;  1OFL A;  1OFD A;  3N6Z A;  2IOU G;  2QX3 A;  4XLA A;  2BM6 A;  2BM5 A;  3SUC A;  4PMH A;  3PSZ A;  2PYG A;  2X85 A;  3P4G A;  4JRA C;  3WWG A;  1O8E A;  4YEJ A;  1IB4 A;  2VFN A;  1DAB A;  1KCD A;  1QCX A;  1PLU A;  3B90 A;  4MXN A;  1O8K A;  1IDJ A;  1LLZ A;  2F3L A;  2X6Y A;  3BH6 B;  2O17 A;  2VFQ A;  1O8D A;  1TYW A;  2IQ7 A;  3KRG A;  4OZZ A;  3LYC A;  1IDK A;  3NAW A;  1O8F A;  2J8I A;  2O1D A;  2VJI A;  2VJJ A;  1K8F A;  1OGM X;  3GQ7 A;  3PET A;  4OJ6 A;  4YCQ A;  4I84 A;  3VST A;  1QA3 A;  2VFM A;  1O8H A;  4V02 C;  4OJ5 A;  4W8S A;  3H09 A;  2QY1 A;  1NHC A;  4Z06 A;  4XKV A;  3GQ8 A;  4XL9 A;  1QA1 A;  4YZ0 A;  1TYU A;  2O6W A;  2XTX A;  4XLC A;  4XLE A;  4W8T A;  2UVF A;  5C1C A;  1QRB A;  1PE9 A;  1X0C A;  2INV A;  2NTQ A;  2NTP A;  2VBE A;  4OM9 A;  2QXZ A;  1QA2 A;  1KTW A;  2BM7 A;  2VBM A;  4MR0 A;  4YZX A;  1BN8 A;  3VMV A;  4XLF A;  1AIR A;  2VFP A;  1KQ5 A;  1GQ8 A;  1BHE A;  2W7Z A;  2NT9 A;  4YC5 A;  1CLW A;  1H80 A;  2XTY A;  1JRG A;  1OOC A;  4W8R A;  1XG2 A;  4XOR A;  1QRC A;  2O0W A;  3FY3 A;  1RU4 A;  2NZM A;  2O0V A;  3LJY A;  2NT6 A;  3ML3 A;  2G0Y A;  1O8L A;  4KH3 A;  1EE6 A;  4XN3 A;  4XN0 A;  2XC1 A;  1O88 A;  1EZG A;  2BSP A;  1CZF A;  4NK6 A;  4OJL A;  1HG8 A;  2BX6 A;  2VBK A;  3BH7 B;  4XKW A;  4XON A;  4XOT A;  2BM4 A;  1TYV A;  4XMY A;  1QJV A;  3VSU A;  3T9G A;  4EW9 A;  2XT2 A;  2YUH A;  4W8Q A;  4YZA A;  1RWR A;  3LMW A;  4XLH A;  3TH0 A;  2NST A;  4XR6 A;  3VMW A;  3EQN A;  2ODL A;  1IA5 A;  4YEL A;  1O8G A;  1WXR A;  4XNF A;  3SZE A;  1K5C A;  2NSP A;  1HF2 A;  1DBG A;  1RMG A;  2X3H A;  3EQO A;  3VSV A;  1KCC A;  1JTA A;  3SYJ A;  1O8I A;  4Z03 A;  4YEI A;  4OZY A;  3NB2 A;  1OFM A;  2PEC A;  5C1E A;  2V5I A;  4YDT A;  3AK5 A;  3GRH A;  2UVE A;  4NK8 A;  3PSS A;  1WMR A;  2O04 A;  1QQ1 A;  2QZA A;  4U49 A; 
#chains in the Genus database with same CATH homology
 1TYU A;  2BM4 A;  1TYV A;  2BM6 A;  2BM5 A;  2YUH A;  1QRB A;  1QA2 A;  4OM9 A;  3TH0 A;  3P4G A;  2BM7 A;  4JRA C;  2VFO A;  4OJO A;  2VFN A;  1DAB A;  2VFP A;  1KQ5 A;  1WXR A;  2F3L A;  3SZE A;  1TYX A;  2W7Z A;  1CLW A;  3BH6 B;  1HF2 A;  2B0R A;  2VFQ A;  4OPW A;  1TYW A;  4OJP A;  3SYJ A;  1TSP A;  1QRC A;  3LYC A;  3RIQ A;  5JMC B;  2J8I A;  3PET A;  3JX8 A;  4OJ6 A;  1K8F A;  3LJY A;  3ML3 A;  3N90 A;  5JLV C;  1QA3 A;  2G0Y A;  4KH3 A;  1K4Z A;  2V5I A;  2VFM A;  3AK5 A;  2XC1 A;  4V02 C;  4OJL A;  4OJ5 A;  3N6Z A;  3H09 A;  2BX6 A;  2IOU G;  1QQ1 A;  3BH7 B;  1QA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...