1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
b'MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylyl Cyclase-Associated Protein
molecule tags Membrane protein
source organism Saccharomyces cerevisiae
publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
3BH6B 2BX6A 2YUHA 1K8FA 1KQ5A 1K4ZA 4V02C 1HF2A 2B0RA 3BH7B
chains in the Genus database with same CATH superfamily
2QYUA 4YDTA 3VSTA 4XMYA 2VFOA 4Z06A 4XKWA 1DBGA 4YEJA 4OPWA 1WXRA 1OGMX 4YZXA 4XM3A 3JURA 2X85A 1QRBA 1LM1A 1O8KA 2PYGA 1IDJA 2VJIA 2X6YA 4OZYA 3SY2A 5C1CA 3VMVA 4OJ6A 4MXNA 2PECA 4XLHA 2G0YA 1AIRA 2VFPA 3VMWA 3PSSA 4XNFA 3SYJA 4C2LA 5DNSA 2QY1A 5AMVA 5JLVC 2V5IA 2BSPA 3VSVA 4U49A 4Z05A 4W8TA 4NK8A 2NSPA 2O1DA 1PXZA 2QXZA 2X6XA 4XONA 4YEIA 3ZSCA 4AVZA 1HF2A 1O8JA 1QJVA 4NK6A 2XT2A 3H09A 3N6ZA 1QQ1A 1O8FA 2NZMA 1EA0A 2XTXA 1WMRA 4U4BA 2BM6A 4XL9A 3RIQA 1NHCA 1O8EA 1K8FA 2BM4A 3JX8A 1TYXA 4YELA 1OFDA 3GQ8A 1CZFA 1O8HA 4JRAC 3ZPPA 1QA1A 1VBLA 3GRHA 1IA5A 2VJJA 4YZAA 4XLAA 3LMWA 1PLUA 4XOTA 2IQ7A 1LLZA 2VFMA 2NTQA 1RWRA 3SUCA 2UVFA 4XLEA 2F3LA 4OJPA 1JRGA 2QX3A 2YUHA 2O6WA 3ML3A 3FY3A 4YC5A 2B0RA 2NT6A 2BM5A 2VBEA 3KRGA 1O8IA 1TYWA 2VBMA 3WWGA 1KCDA 1O8GA 2XTWA 4YZQA 2VBKA 2X6WA 2ODLA 3PSZA 4OJ5A 2Z8GA 1O8LA 4OJOA 1OGOX 2BX6A 2O17A 2W7ZA 2XTYA 4XN0A 1IB4A 1BN8A 1KQ5A 2INVA 3B8YA 1RMGA 3LYCA 4I84A 4PMHA 1OFMA 1XG2A 2BM7A 3LJYA 4OZZA 4XN3A 1HG8A 3SZEA 1X0CA 2NTBA 2XC1A 2X3HA 1PE9A 4W8SA 1OOCA 3B4NA 2O0VA 3BH7B 2EWEA 4YCQA 4W8QA 2NTPA 1LLWA 4EW9A 1RU4A 1DABA 2IOUG 4URRA 3P4GA 4OM9A 3DU1X 2QZAA 4XR6A 1BHEA 3AK5A 1TSPA 2O04A 2VFNA 2UVEA 3GQ7A 2XT4A 1CLWA 3EQNA 1O88A 3VSUA 1KCCA 1KTWA 2NSTA 4XLCA 3PETA 1GQ8A 2J8KA 3B90A 3NAWA 1DBOA 5JMCB 3GQAA 4V02C 1IDKA 2VFQA 4KH3A 4OJLA 1JTAA 1L1IA 2NT9A 1K5CA 1QA2A 1QA3A 4XOPA 1EZGA 1H80A 4YFOA 3TH0A 1QCXA 1OFEA 1TYUA 4MR0A 1EE6A 4Z03A 3SQVA 2INUA 3GQ9A 4XKVA 1O8DA 1OFLA 4HWVA 4XQFA 3EQOA 1QRCA 3NB2A 3BH6B 1TYVA 2J8IA 4XLFA 4W8RA 2O0WA 3N90A 3UW0A 5C1EA 1K4ZA 3T9GA 2PYHA 4XORA 1O8MA 4YZ0A
chains in the Genus database with same CATH topology
1QQ1A 3PETA 4OJOA 3RIQA 2BM6A 2BX6A 2VFOA 2W7ZA 2BM4A 1K8FA 3JX8A 5JMCB 1TYXA 1KQ5A 4V02C 4OPWA 2VFQA 1WXRA 4KH3A 4OJLA 4JRAC 3LYCA 1QA1A 1QRBA 1QA2A 1QA3A 2BM7A 3LJYA 3SZEA 4OJ6A 2XC1A 2VFMA 3TH0A 2G0YA 1TYUA 2VFPA 3BH7B 3SYJA 5JLVC 2F3LA 4OJPA 2V5IA 2YUHA 3ML3A 1DABA 2IOUG 2B0RA 2BM5A 1QRCA 3P4GA 3BH6B 1TYWA 4OM9A 1TYVA 2J8IA 3AK5A 1TSPA 2VFNA 3N90A 1K4ZA 1CLWA 1HF2A 3H09A 4OJ5A 3N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  2BX6 A;  2YUH A;  1K8F A;  1KQ5 A;  1K4Z A;  4V02 C;  1HF2 A;  2B0R A;  3BH7 B; 
#chains in the Genus database with same CATH topology
 2QYU A;  4YDT A;  3VST A;  4XMY A;  2VFO A;  4Z06 A;  4XKW A;  1DBG A;  4YEJ A;  4OPW A;  1WXR A;  1OGM X;  4YZX A;  4XM3 A;  3JUR A;  2X85 A;  1QRB A;  1LM1 A;  1O8K A;  2PYG A;  1IDJ A;  2VJI A;  2X6Y A;  4OZY A;  3SY2 A;  5C1C A;  3VMV A;  4OJ6 A;  4MXN A;  2PEC A;  4XLH A;  2G0Y A;  1AIR A;  2VFP A;  3VMW A;  3PSS A;  4XNF A;  3SYJ A;  4C2L A;  5DNS A;  2QY1 A;  5AMV A;  5JLV C;  2V5I A;  2BSP A;  3VSV A;  4U49 A;  4Z05 A;  4W8T A;  4NK8 A;  2NSP A;  2O1D A;  1PXZ A;  2QXZ A;  2X6X A;  4XON A;  4YEI A;  3ZSC A;  4AVZ A;  1HF2 A;  1O8J A;  1QJV A;  4NK6 A;  2XT2 A;  3H09 A;  3N6Z A;  1QQ1 A;  1O8F A;  2NZM A;  1EA0 A;  2XTX A;  1WMR A;  4U4B A;  2BM6 A;  4XL9 A;  3RIQ A;  1NHC A;  1O8E A;  1K8F A;  2BM4 A;  3JX8 A;  1TYX A;  4YEL A;  1OFD A;  3GQ8 A;  1CZF A;  1O8H A;  4JRA C;  3ZPP A;  1QA1 A;  1VBL A;  3GRH A;  1IA5 A;  2VJJ A;  4YZA A;  4XLA A;  3LMW A;  1PLU A;  4XOT A;  2IQ7 A;  1LLZ A;  2VFM A;  2NTQ A;  1RWR A;  3SUC A;  2UVF A;  4XLE A;  2F3L A;  4OJP A;  1JRG A;  2QX3 A;  2YUH A;  2O6W A;  3ML3 A;  3FY3 A;  4YC5 A;  2B0R A;  2NT6 A;  2BM5 A;  2VBE A;  3KRG A;  1O8I A;  1TYW A;  2VBM A;  3WWG A;  1KCD A;  1O8G A;  2XTW A;  4YZQ A;  2VBK A;  2X6W A;  2ODL A;  3PSZ A;  4OJ5 A;  2Z8G A;  1O8L A;  4OJO A;  1OGO X;  2BX6 A;  2O17 A;  2W7Z A;  2XTY A;  4XN0 A;  1IB4 A;  1BN8 A;  1KQ5 A;  2INV A;  3B8Y A;  1RMG A;  3LYC A;  4I84 A;  4PMH A;  1OFM A;  1XG2 A;  2BM7 A;  3LJY A;  4OZZ A;  4XN3 A;  1HG8 A;  3SZE A;  1X0C A;  2NTB A;  2XC1 A;  2X3H A;  1PE9 A;  4W8S A;  1OOC A;  3B4N A;  2O0V A;  3BH7 B;  2EWE A;  4YCQ A;  4W8Q A;  2NTP A;  1LLW A;  4EW9 A;  1RU4 A;  1DAB A;  2IOU G;  4URR A;  3P4G A;  4OM9 A;  3DU1 X;  2QZA A;  4XR6 A;  1BHE A;  3AK5 A;  1TSP A;  2O04 A;  2VFN A;  2UVE A;  3GQ7 A;  2XT4 A;  1CLW A;  3EQN A;  1O88 A;  3VSU A;  1KCC A;  1KTW A;  2NST A;  4XLC A;  3PET A;  1GQ8 A;  2J8K A;  3B90 A;  3NAW A;  1DBO A;  5JMC B;  3GQA A;  4V02 C;  1IDK A;  2VFQ A;  4KH3 A;  4OJL A;  1JTA A;  1L1I A;  2NT9 A;  1K5C A;  1QA2 A;  1QA3 A;  4XOP A;  1EZG A;  1H80 A;  4YFO A;  3TH0 A;  1QCX A;  1OFE A;  1TYU A;  4MR0 A;  1EE6 A;  4Z03 A;  3SQV A;  2INU A;  3GQ9 A;  4XKV A;  1O8D A;  1OFL A;  4HWV A;  4XQF A;  3EQO A;  1QRC A;  3NB2 A;  3BH6 B;  1TYV A;  2J8I A;  4XLF A;  4W8R A;  2O0W A;  3N90 A;  3UW0 A;  5C1E A;  1K4Z A;  3T9G A;  2PYH A;  4XOR A;  1O8M A;  4YZ0 A; 
#chains in the Genus database with same CATH homology
 1QQ1 A;  3PET A;  4OJO A;  3RIQ A;  2BM6 A;  2BX6 A;  2VFO A;  2W7Z A;  2BM4 A;  1K8F A;  3JX8 A;  5JMC B;  1TYX A;  1KQ5 A;  4V02 C;  4OPW A;  2VFQ A;  1WXR A;  4KH3 A;  4OJL A;  4JRA C;  3LYC A;  1QA1 A;  1QRB A;  1QA2 A;  1QA3 A;  2BM7 A;  3LJY A;  3SZE A;  4OJ6 A;  2XC1 A;  2VFM A;  3TH0 A;  2G0Y A;  1TYU A;  2VFP A;  3BH7 B;  3SYJ A;  5JLV C;  2F3L A;  4OJP A;  2V5I A;  2YUH A;  3ML3 A;  1DAB A;  2IOU G;  2B0R A;  2BM5 A;  1QRC A;  3P4G A;  3BH6 B;  1TYW A;  4OM9 A;  1TYV A;  2J8I A;  3AK5 A;  1TSP A;  2VFN A;  3N90 A;  1K4Z A;  1CLW A;  1HF2 A;  3H09 A;  4OJ5 A;  3N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...