1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylyl Cyclase-Associated Protein
publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
2YUHA 3BH7B 4V02C 1KQ5A 2BX6A 1K8FA 3BH6B 2B0RA 1HF2A 1K4ZA
chains in the Genus database with same CATH superfamily
4OM9A 2G0YA 2XTYA 2IOUG 1IDJA 1O8JA 1BN8A 4MR0A 4YZQA 2J8KA 1H80A 2Z8GA 3NB2A 5AMVA 2NSPA 2VFMA 1OGMX 3WWGA 1GQ8A 1LM1A 4W8RA 2BM7A 2O0WA 4XKVA 1KQ5A 1RU4A 1VBLA 3ML3A 4U4BA 5C1CA 1KCDA 4C2LA 5DNSA 2V5IA 3SUCA 3DU1X 4XONA 5C1EA 3VMVA 1JRGA 1TYVA 1PLUA 1LLWA 2BX6A 3ZSCA 2VFOA 4Z05A 3GQ9A 4OZYA 4W8QA 4HWVA 1RMGA 4XM3A 2YUHA 2XT2A 1EA0A 1AIRA 2O1DA 4JRAC 3N90A 1EZGA 4URRA 4XN0A 2X3HA 2VBKA 1O8MA 3B90A 3EQOA 4Z03A 3T9GA 1DBOA 1QJVA 2VBEA 4YZ0A 1BHEA 4XOPA 5JMCB 1TYUA 2O0VA 3BH6B 1O88A 3H09A 3PSSA 1WXRA 3NAWA 2W7ZA 3GQ7A 4OJPA 2XTWA 1CLWA 1O8FA 5JLVC 1PXZA 4XN3A 2UVFA 1DBGA 2VFQA 1IDKA 1CZFA 1O8KA 2BM4A 2X6WA 2XTXA 4OJ6A 2QXZA 1OGOX 4XL9A 1QA3A 1OFEA 4OPWA 3SYJA 4W8TA 3KRGA 4YC5A 2B0RA 3GQ8A 2PECA 1OFDA 1O8LA 2NT9A 1IB4A 1K5CA 3AK5A 2NSTA 4PMHA 4AVZA 3P4GA 2NTQA 1QA1A 4YZXA 1DABA 1OFMA 4XLCA 3VMWA 4XLHA 4YELA 2NTPA 4YDTA 2QYUA 1JTAA 4OZZA 4OJOA 2X6YA 1L1IA 4XR6A 3UW0A 1QCXA 1QRCA 2PYGA 3JURA 2O6WA 1LLZA 2BM5A 2INUA 3JX8A 3PETA 1HF2A 1TSPA 2EWEA 1TYXA 2F3LA 4NK8A 1O8IA 4OJ5A 4XLAA 4YEJA 3B4NA 3VSUA 3ZPPA 3B8YA 1K8FA 3FY3A 3GRHA 2QZAA 2O17A 4XKWA 1KTWA 1RWRA 4XMYA 1EE6A 4YCQA 4YFOA 2QY1A 2X6XA 4V02C 1O8DA 1O8EA 2NTBA 1X0CA 2VJIA 1TYWA 3SY2A 3LMWA 3LJYA 1HG8A 4EW9A 3RIQA 4YEIA 1QRBA 4I84A 1WMRA 2PYHA 2VFPA 1XG2A 2VBMA 2XC1A 4XLEA 1QQ1A 2O04A 4XNFA 4KH3A 4W8SA 1QA2A 3VSVA 1NHCA 1IA5A 2VJJA 3LYCA 2INVA 4MXNA 4XQFA 1KCCA 4Z06A 2IQ7A 3GQAA 2BSPA 1K4ZA 2QX3A 3BH7B 4XOTA 1OFLA 1PE9A 4YZAA 3SZEA 1OOCA 3PSZA 3SQVA 4XORA 2J8IA 3EQNA 2VFNA 2NT6A 2X85A 2ODLA 3N6ZA 2XT4A 4NK6A 2UVEA 4OJLA 3TH0A 4XLFA 1O8GA 3VSTA 1O8HA 2BM6A 4U49A 2NZMA
chains in the Genus database with same CATH topology
4OM9A 3RIQA 1DABA 2G0YA 1QA1A 1QRBA 2IOUG 5JMCB 1TYUA 2VFPA 3BH6B 4OJOA 3H09A 2XC1A 1WXRA 1QQ1A 2VFMA 2W7ZA 4KH3A 1QRCA 1QA2A 2BM7A 4OJPA 1KQ5A 3LYCA 1CLWA 5JLVC 3ML3A 2BM5A 3JX8A 3PETA 1TSPA 1HF2A 2F3LA 1TYXA 1K4ZA 2V5IA 2VFQA 3BH7B 4OJ5A 3SZEA 4OJ6A 2BM4A 1TYVA 2BX6A 1K8FA 2VFOA 1QA3A 4OPWA 3SYJA 2J8IA 3N6ZA 2VFNA 2B0RA 4OJLA 2YUHA 3TH0A 3AK5A 4V02C 4JRAC 2BM6A 1TYWA 3N90A 3P4GA 3LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUH A;  3BH7 B;  4V02 C;  1KQ5 A;  2BX6 A;  1K8F A;  3BH6 B;  2B0R A;  1HF2 A;  1K4Z A; 
#chains in the Genus database with same CATH topology
 4OM9 A;  2G0Y A;  2XTY A;  2IOU G;  1IDJ A;  1O8J A;  1BN8 A;  4MR0 A;  4YZQ A;  2J8K A;  1H80 A;  2Z8G A;  3NB2 A;  5AMV A;  2NSP A;  2VFM A;  1OGM X;  3WWG A;  1GQ8 A;  1LM1 A;  4W8R A;  2BM7 A;  2O0W A;  4XKV A;  1KQ5 A;  1RU4 A;  1VBL A;  3ML3 A;  4U4B A;  5C1C A;  1KCD A;  4C2L A;  5DNS A;  2V5I A;  3SUC A;  3DU1 X;  4XON A;  5C1E A;  3VMV A;  1JRG A;  1TYV A;  1PLU A;  1LLW A;  2BX6 A;  3ZSC A;  2VFO A;  4Z05 A;  3GQ9 A;  4OZY A;  4W8Q A;  4HWV A;  1RMG A;  4XM3 A;  2YUH A;  2XT2 A;  1EA0 A;  1AIR A;  2O1D A;  4JRA C;  3N90 A;  1EZG A;  4URR A;  4XN0 A;  2X3H A;  2VBK A;  1O8M A;  3B90 A;  3EQO A;  4Z03 A;  3T9G A;  1DBO A;  1QJV A;  2VBE A;  4YZ0 A;  1BHE A;  4XOP A;  5JMC B;  1TYU A;  2O0V A;  3BH6 B;  1O88 A;  3H09 A;  3PSS A;  1WXR A;  3NAW A;  2W7Z A;  3GQ7 A;  4OJP A;  2XTW A;  1CLW A;  1O8F A;  5JLV C;  1PXZ A;  4XN3 A;  2UVF A;  1DBG A;  2VFQ A;  1IDK A;  1CZF A;  1O8K A;  2BM4 A;  2X6W A;  2XTX A;  4OJ6 A;  2QXZ A;  1OGO X;  4XL9 A;  1QA3 A;  1OFE A;  4OPW A;  3SYJ A;  4W8T A;  3KRG A;  4YC5 A;  2B0R A;  3GQ8 A;  2PEC A;  1OFD A;  1O8L A;  2NT9 A;  1IB4 A;  1K5C A;  3AK5 A;  2NST A;  4PMH A;  4AVZ A;  3P4G A;  2NTQ A;  1QA1 A;  4YZX A;  1DAB A;  1OFM A;  4XLC A;  3VMW A;  4XLH A;  4YEL A;  2NTP A;  4YDT A;  2QYU A;  1JTA A;  4OZZ A;  4OJO A;  2X6Y A;  1L1I A;  4XR6 A;  3UW0 A;  1QCX A;  1QRC A;  2PYG A;  3JUR A;  2O6W A;  1LLZ A;  2BM5 A;  2INU A;  3JX8 A;  3PET A;  1HF2 A;  1TSP A;  2EWE A;  1TYX A;  2F3L A;  4NK8 A;  1O8I A;  4OJ5 A;  4XLA A;  4YEJ A;  3B4N A;  3VSU A;  3ZPP A;  3B8Y A;  1K8F A;  3FY3 A;  3GRH A;  2QZA A;  2O17 A;  4XKW A;  1KTW A;  1RWR A;  4XMY A;  1EE6 A;  4YCQ A;  4YFO A;  2QY1 A;  2X6X A;  4V02 C;  1O8D A;  1O8E A;  2NTB A;  1X0C A;  2VJI A;  1TYW A;  3SY2 A;  3LMW A;  3LJY A;  1HG8 A;  4EW9 A;  3RIQ A;  4YEI A;  1QRB A;  4I84 A;  1WMR A;  2PYH A;  2VFP A;  1XG2 A;  2VBM A;  2XC1 A;  4XLE A;  1QQ1 A;  2O04 A;  4XNF A;  4KH3 A;  4W8S A;  1QA2 A;  3VSV A;  1NHC A;  1IA5 A;  2VJJ A;  3LYC A;  2INV A;  4MXN A;  4XQF A;  1KCC A;  4Z06 A;  2IQ7 A;  3GQA A;  2BSP A;  1K4Z A;  2QX3 A;  3BH7 B;  4XOT A;  1OFL A;  1PE9 A;  4YZA A;  3SZE A;  1OOC A;  3PSZ A;  3SQV A;  4XOR A;  2J8I A;  3EQN A;  2VFN A;  2NT6 A;  2X85 A;  2ODL A;  3N6Z A;  2XT4 A;  4NK6 A;  2UVE A;  4OJL A;  3TH0 A;  4XLF A;  1O8G A;  3VST A;  1O8H A;  2BM6 A;  4U49 A;  2NZM A; 
#chains in the Genus database with same CATH homology
 4OM9 A;  3RIQ A;  1DAB A;  2G0Y A;  1QA1 A;  1QRB A;  2IOU G;  5JMC B;  1TYU A;  2VFP A;  3BH6 B;  4OJO A;  3H09 A;  2XC1 A;  1WXR A;  1QQ1 A;  2VFM A;  2W7Z A;  4KH3 A;  1QRC A;  1QA2 A;  2BM7 A;  4OJP A;  1KQ5 A;  3LYC A;  1CLW A;  5JLV C;  3ML3 A;  2BM5 A;  3JX8 A;  3PET A;  1TSP A;  1HF2 A;  2F3L A;  1TYX A;  1K4Z A;  2V5I A;  2VFQ A;  3BH7 B;  4OJ5 A;  3SZE A;  4OJ6 A;  2BM4 A;  1TYV A;  2BX6 A;  1K8F A;  2VFO A;  1QA3 A;  4OPW A;  3SYJ A;  2J8I A;  3N6Z A;  2VFN A;  2B0R A;  4OJL A;  2YUH A;  3TH0 A;  3AK5 A;  4V02 C;  4JRA C;  2BM6 A;  1TYW A;  3N90 A;  3P4G A;  3LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...