1K4ZA

C-terminal domain of cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
b'MPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylyl Cyclase-Associated Protein
publication title Crystal structure of the actin binding domain of the cyclase-associated protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 47
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k4zA00
4V02C 1K8FA 1K4ZA 1HF2A 2B0RA 1KQ5A 2YUHA 2BX6A 3BH6B 3BH7B
chains in the Genus database with same CATH superfamily
1PLUA 1LLZA 3PSSA 1HF2A 2VFNA 4W8SA 1TYWA 3GQ9A 1VBLA 2XTWA 2X6WA 3GRHA 1H80A 2BM5A 1QJVA 3KRGA 1IA5A 4OJ5A 4MR0A 2NZMA 2O1DA 3WWGA 2B0RA 4OZYA 4XONA 4YELA 4YZ0A 2BM6A 1DBOA 1RU4A 2INUA 2ODLA 3SYJA 1QA3A 1CZFA 1KCCA 2NTQA 4XOPA 2X85A 2O04A 4OPWA 4OZZA 1O8FA 3VSVA 2O17A 4YEIA 1OGOX 2J8KA 1QCXA 3H09A 4XR6A 3JURA 1OOCA 4PMHA 4YZAA 1KQ5A 2PECA 2XT2A 4YZXA 4I84A 4HWVA 1LM1A 3LMWA 2QX3A 4YC5A 4W8RA 4YCQA 3SY2A 2VFQA 4XLCA 2J8IA 4Z05A 4Z03A 4XL9A 4XLEA 4Z06A 5C1CA 5JMCB 1OFEA 4OJPA 4XOTA 2PYGA 2VBMA 4XM3A 4YEJA 4YFOA 2O0WA 1RWRA 2QXZA 3DU1X 1TYXA 3SQVA 3LJYA 1JTAA 1TSPA 1OFDA 2QYUA 3N6ZA 4XLAA 4XMYA 3VMVA 4EW9A 1L1IA 2XT4A 2NTPA 1EE6A 4OJOA 1PE9A 1X0CA 1O8IA 2VBEA 3BH6B 4W8TA 5C1EA 3PETA 2F3LA 4U49A 3N90A 4OJLA 4XLFA 2XTYA 4URRA 3VMWA 4XQFA 1QRCA 1BHEA 1NHCA 2BM7A 1IDKA 1OFLA 1IB4A 1O8MA 3ZPPA 3T9GA 4XKWA 4NK6A 2IQ7A 3JX8A 2YUHA 1JRGA 2IOUG 2QY1A 4OJ6A 2UVFA 3GQAA 1AIRA 1DBGA 3NB2A 4V02C 1O8GA 2V5IA 4NK8A 4XN0A 2NSPA 1EZGA 2BX6A 2NTBA 3P4GA 2VBKA 1IDJA 1O88A 2NT9A 1RMGA 2X3HA 3LYCA 4YDTA 2W7ZA 3SUCA 1K4ZA 4XKVA 3PSZA 1O8EA 4JRAC 1EA0A 2VFPA 1BN8A 4OM9A 3NAWA 2VJIA 2XC1A 3B4NA 2NT6A 3BH7B 4W8QA 3TH0A 3ZSCA 1QQ1A 4KH3A 1HG8A 1KCDA 3EQNA 2VJJA 2INVA 1WXRA 2O6WA 2UVEA 5JLVC 1PXZA 1QRBA 1KTWA 3SZEA 1LLWA 2EWEA 3B90A 1QA1A 4C2LA 2VFOA 1O8KA 2BM4A 4AVZA 2PYHA 5DNSA 4YZQA 1O8HA 3GQ7A 1OFMA 4XORA 3B8YA 4XN3A 3FY3A 5AMVA 2G0YA 1DABA 2NSTA 3VSUA 4MXNA 1K8FA 1K5CA 3AK5A 4XNFA 3RIQA 4XLHA 1O8LA 1OGMX 1GQ8A 2QZAA 2X6YA 3ML3A 1O8JA 1TYUA 3GQ8A 1XG2A 3EQOA 1QA2A 3UW0A 1CLWA 2X6XA 1WMRA 2Z8GA 1O8DA 1TYVA 2BSPA 2XTXA 3VSTA 4U4BA 2O0VA 2VFMA
chains in the Genus database with same CATH topology
3SZEA 1QA1A 1HF2A 2VFNA 1TYWA 2VFOA 2VFQA 2BM4A 3JX8A 2YUHA 2J8IA 2IOUG 2BM5A 5JMCB 4OJ5A 4OJPA 4OJ6A 4V02C 2B0RA 2V5IA 2BM6A 3SYJA 1QA3A 2G0YA 2BX6A 1TYXA 3P4GA 1DABA 3LYCA 3LJYA 3N6ZA 1TSPA 4OPWA 3AK5A 2W7ZA 1K8FA 1K4ZA 4JRAC 4OJOA 3RIQA 3ML3A 2VFPA 3BH6B 4OM9A 2XC1A 1TYUA 3BH7B 3H09A 3TH0A 1QA2A 1QQ1A 1CLWA 2F3LA 3N90A 3PETA 4KH3A 4OJLA 1QRCA 1KQ5A 1TYVA 2BM7A 1WXRA 5JLVC 1QRBA 2VFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V02 C;  1K8F A;  1K4Z A;  1HF2 A;  2B0R A;  1KQ5 A;  2YUH A;  2BX6 A;  3BH6 B;  3BH7 B; 
#chains in the Genus database with same CATH topology
 1PLU A;  1LLZ A;  3PSS A;  1HF2 A;  2VFN A;  4W8S A;  1TYW A;  3GQ9 A;  1VBL A;  2XTW A;  2X6W A;  3GRH A;  1H80 A;  2BM5 A;  1QJV A;  3KRG A;  1IA5 A;  4OJ5 A;  4MR0 A;  2NZM A;  2O1D A;  3WWG A;  2B0R A;  4OZY A;  4XON A;  4YEL A;  4YZ0 A;  2BM6 A;  1DBO A;  1RU4 A;  2INU A;  2ODL A;  3SYJ A;  1QA3 A;  1CZF A;  1KCC A;  2NTQ A;  4XOP A;  2X85 A;  2O04 A;  4OPW A;  4OZZ A;  1O8F A;  3VSV A;  2O17 A;  4YEI A;  1OGO X;  2J8K A;  1QCX A;  3H09 A;  4XR6 A;  3JUR A;  1OOC A;  4PMH A;  4YZA A;  1KQ5 A;  2PEC A;  2XT2 A;  4YZX A;  4I84 A;  4HWV A;  1LM1 A;  3LMW A;  2QX3 A;  4YC5 A;  4W8R A;  4YCQ A;  3SY2 A;  2VFQ A;  4XLC A;  2J8I A;  4Z05 A;  4Z03 A;  4XL9 A;  4XLE A;  4Z06 A;  5C1C A;  5JMC B;  1OFE A;  4OJP A;  4XOT A;  2PYG A;  2VBM A;  4XM3 A;  4YEJ A;  4YFO A;  2O0W A;  1RWR A;  2QXZ A;  3DU1 X;  1TYX A;  3SQV A;  3LJY A;  1JTA A;  1TSP A;  1OFD A;  2QYU A;  3N6Z A;  4XLA A;  4XMY A;  3VMV A;  4EW9 A;  1L1I A;  2XT4 A;  2NTP A;  1EE6 A;  4OJO A;  1PE9 A;  1X0C A;  1O8I A;  2VBE A;  3BH6 B;  4W8T A;  5C1E A;  3PET A;  2F3L A;  4U49 A;  3N90 A;  4OJL A;  4XLF A;  2XTY A;  4URR A;  3VMW A;  4XQF A;  1QRC A;  1BHE A;  1NHC A;  2BM7 A;  1IDK A;  1OFL A;  1IB4 A;  1O8M A;  3ZPP A;  3T9G A;  4XKW A;  4NK6 A;  2IQ7 A;  3JX8 A;  2YUH A;  1JRG A;  2IOU G;  2QY1 A;  4OJ6 A;  2UVF A;  3GQA A;  1AIR A;  1DBG A;  3NB2 A;  4V02 C;  1O8G A;  2V5I A;  4NK8 A;  4XN0 A;  2NSP A;  1EZG A;  2BX6 A;  2NTB A;  3P4G A;  2VBK A;  1IDJ A;  1O88 A;  2NT9 A;  1RMG A;  2X3H A;  3LYC A;  4YDT A;  2W7Z A;  3SUC A;  1K4Z A;  4XKV A;  3PSZ A;  1O8E A;  4JRA C;  1EA0 A;  2VFP A;  1BN8 A;  4OM9 A;  3NAW A;  2VJI A;  2XC1 A;  3B4N A;  2NT6 A;  3BH7 B;  4W8Q A;  3TH0 A;  3ZSC A;  1QQ1 A;  4KH3 A;  1HG8 A;  1KCD A;  3EQN A;  2VJJ A;  2INV A;  1WXR A;  2O6W A;  2UVE A;  5JLV C;  1PXZ A;  1QRB A;  1KTW A;  3SZE A;  1LLW A;  2EWE A;  3B90 A;  1QA1 A;  4C2L A;  2VFO A;  1O8K A;  2BM4 A;  4AVZ A;  2PYH A;  5DNS A;  4YZQ A;  1O8H A;  3GQ7 A;  1OFM A;  4XOR A;  3B8Y A;  4XN3 A;  3FY3 A;  5AMV A;  2G0Y A;  1DAB A;  2NST A;  3VSU A;  4MXN A;  1K8F A;  1K5C A;  3AK5 A;  4XNF A;  3RIQ A;  4XLH A;  1O8L A;  1OGM X;  1GQ8 A;  2QZA A;  2X6Y A;  3ML3 A;  1O8J A;  1TYU A;  3GQ8 A;  1XG2 A;  3EQO A;  1QA2 A;  3UW0 A;  1CLW A;  2X6X A;  1WMR A;  2Z8G A;  1O8D A;  1TYV A;  2BSP A;  2XTX A;  3VST A;  4U4B A;  2O0V A;  2VFM A; 
#chains in the Genus database with same CATH homology
 3SZE A;  1QA1 A;  1HF2 A;  2VFN A;  1TYW A;  2VFO A;  2VFQ A;  2BM4 A;  3JX8 A;  2YUH A;  2J8I A;  2IOU G;  2BM5 A;  5JMC B;  4OJ5 A;  4OJP A;  4OJ6 A;  4V02 C;  2B0R A;  2V5I A;  2BM6 A;  3SYJ A;  1QA3 A;  2G0Y A;  2BX6 A;  1TYX A;  3P4G A;  1DAB A;  3LYC A;  3LJY A;  3N6Z A;  1TSP A;  4OPW A;  3AK5 A;  2W7Z A;  1K8F A;  1K4Z A;  4JRA C;  4OJO A;  3RIQ A;  3ML3 A;  2VFP A;  3BH6 B;  4OM9 A;  2XC1 A;  1TYU A;  3BH7 B;  3H09 A;  3TH0 A;  1QA2 A;  1QQ1 A;  1CLW A;  2F3L A;  3N90 A;  3PET A;  4KH3 A;  4OJL A;  1QRC A;  1KQ5 A;  1TYV A;  2BM7 A;  1WXR A;  5JLV C;  1QRB A;  2VFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...