1KCDA

Endopolygalacturonase i from stereum purpureum complexed with two galacturonate at 1.15 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kcdA00
1IDKA 5C1EA 1BHEA 2BSPA 2INUA 4OZYA 4MR0A 1X0CA 1PXZA 4Z05A 4W8SA 3UW0A 4W8RA 4W8TA 3LMWA 2INVA 3GRHA 3GQ7A 4OJ5A 2NT6A 3VMVA 1KTWA 2VBKA 1O8DA 2IQ7A 1CZFA 4XNFA 5C1CA 2X6XA 1DBOA 3VSVA 1EE6A 4OJPA 1PLUA 4Z06A 4Z03A 1IA5A 3VSUA 1GQ8A 1O8JA 4XLAA 4MXNA 1O8LA 4W8QA 3EQOA 1HG8A 1K5CA 4XLEA 3KRGA 1OFMA 4XONA 1NHCA 2PYGA 3VMWA 2PYHA 2QX3A 3B8YA 2VBEA 5AMVA 1OGMX 1IDJA 1O88A 1O8MA 3JURA 4OJ6A 3SUCA 4U4BA 2NTBA 2VBMA 4URRA 4NK6A 4XKWA 4XORA 4EW9A 1RMGA 4NK8A 2NSPA 1DBGA 2NT9A 2EWEA 1O8FA 1OOCA 4U49A 4XLFA 4XOPA 1AIRA 3B90A 3GQ9A 2X3HA 3ZPPA 2VJIA 2QXZA 2O04A 4XR6A 4PMHA 1XG2A 4YELA 2O1DA 3GQ8A 1RU4A 2X85A 2O17A 1O8KA 3GQAA 4XMYA 4YZQA 1H80A 1VBLA 2NTPA 1OGOX 1O8IA 3B4NA 4XLCA 4XLHA 1O8HA 4OJOA 4OJLA 4YZAA 4C2LA 1IB4A 1WMRA 1O8GA 2O0WA 3VSTA 4XOTA 1PE9A 4YZ0A 2NZMA 3WWGA 1BN8A 4YZXA 4AVZA 4XN3A 4XL9A 1QJVA 2X6WA 1KCCA 3FY3A 2O0VA 2NSTA 2X6YA 3T9GA 4XN0A 1JRGA 2QY1A 4XM3A 4OZZA 2VJJA 3EQNA 4XKVA 2NTQA 4XQFA 4I84A 1KCDA 3ZSCA 1JTAA 1O8EA 2UVEA 2ODLA 1OFLA 1RWRA 4HWVA 4YEJA 2PECA 2Z8GA 2UVFA 1QCXA
chains in the Genus database with same CATH superfamily
1IDKA 5C1EA 1BHEA 3AK5A 2BSPA 2INUA 4OZYA 4JRAC 4MR0A 2XT2A 1X0CA 1PXZA 1QRBA 3H09A 3NB2A 2BX6A 4Z05A 4W8SA 3SQVA 3UW0A 4W8RA 4W8TA 5JMCB 4YCQA 3LMWA 1TYXA 2INVA 2J8IA 3GRHA 3GQ7A 2J8KA 3LYCA 4OJ5A 2NT6A 3VMVA 1LLWA 1KTWA 2B0RA 2VBKA 1QA2A 1O8DA 2G0YA 4YFOA 2IQ7A 1CZFA 4XNFA 5C1CA 2BM5A 2X6XA 1DBOA 3VSVA 1EE6A 1TSPA 4OJPA 1PLUA 4Z06A 4Z03A 1IA5A 3VSUA 1GQ8A 2BM4A 1O8JA 4XLAA 4MXNA 1O8LA 4W8QA 3EQOA 1HG8A 1K5CA 3SZEA 3LJYA 4YEIA 4XLEA 2XT4A 3KRGA 5DNSA 1OFMA 4XONA 1NHCA 2PYGA 3VMWA 2PYHA 2QX3A 3B8YA 2VBEA 5AMVA 1OGMX 1IDJA 3BH6B 1O88A 1O8MA 2VFOA 3JURA 4OJ6A 3SUCA 2IOUG 4U4BA 2NTBA 1HF2A 2VBMA 4NK6A 4URRA 4OPWA 4XKWA 4XORA 4EW9A 1RMGA 4NK8A 1QA3A 2NSPA 2QYUA 2XTXA 4V02C 1DBGA 2NT9A 2EWEA 1O8FA 1OOCA 4U49A 4XLFA 4XOPA 1EA0A 1AIRA 3B90A 2YUHA 3GQ9A 2X3HA 4YC5A 3ZPPA 2VJIA 5JLVC 2QXZA 2O04A 3SY2A 4XR6A 2VFQA 4PMHA 2BM7A 1XG2A 1EZGA 3RIQA 4YELA 2O1DA 3GQ8A 1CLWA 1LM1A 3PSSA 1RU4A 3ML3A 1OFEA 2X85A 1WXRA 2O17A 1O8KA 3GQAA 2XC1A 4XMYA 4YZQA 3N90A 1H80A 1VBLA 2W7ZA 2NTPA 3PSZA 3BH7B 1OGOX 1O8IA 3B4NA 3DU1X 4XLHA 4XLCA 1O8HA 4OJOA 4OJLA 1QA1A 4YZAA 4C2LA 1IB4A 3JX8A 1WMRA 1O8GA 2O0WA 3PETA 4XOTA 3VSTA 1PE9A 4YZ0A 1DABA 2NZMA 3WWGA 1BN8A 2O6WA 4YZXA 4AVZA 4XN3A 4XL9A 1QJVA 2X6WA 2V5IA 1KCCA 3FY3A 2O0VA 2XTWA 2NSTA 3SYJA 2X6YA 1K4ZA 3T9GA 2VFNA 4XN0A 1JRGA 2QY1A 1TYVA 4XM3A 2VFMA 4OZZA 2VJJA 1TYUA 3EQNA 2XTYA 3TH0A 4XKVA 3NAWA 2NTQA 1K8FA 4XQFA 2QZAA 4I84A 1KCDA 4KH3A 1OFDA 4OM9A 1L1IA 3ZSCA 1JTAA 1O8EA 1QRCA 1QQ1A 2UVEA 2ODLA 1OFLA 1RWRA 1LLZA 1TYWA 2BM6A 4YDTA 4HWVA 3N6ZA 2VFPA 1KQ5A 3P4GA 4YEJA 2PECA 2F3LA 2Z8GA 2UVFA 1QCXA
chains in the Genus database with same CATH topology
1IDKA 5C1EA 1BHEA 2BSPA 2INUA 4OZYA 4MR0A 1X0CA 1PXZA 4Z05A 4W8SA 3UW0A 4W8RA 4W8TA 3LMWA 2INVA 3GRHA 3GQ7A 4OJ5A 2NT6A 3VMVA 1KTWA 2VBKA 1O8DA 2IQ7A 1CZFA 4XNFA 5C1CA 2X6XA 1DBOA 3VSVA 1EE6A 4OJPA 1PLUA 4Z06A 4Z03A 1IA5A 3VSUA 1GQ8A 1O8JA 4XLAA 4MXNA 1O8LA 4W8QA 3EQOA 1HG8A 1K5CA 4XLEA 3KRGA 1OFMA 4XONA 1NHCA 2PYGA 3VMWA 2PYHA 2QX3A 3B8YA 2VBEA 5AMVA 1OGMX 1IDJA 1O88A 1O8MA 3JURA 4OJ6A 3SUCA 4U4BA 2NTBA 2VBMA 4URRA 4NK6A 4XKWA 4XORA 4EW9A 1RMGA 4NK8A 2NSPA 1DBGA 2NT9A 2EWEA 1O8FA 1OOCA 4U49A 4XLFA 4XOPA 1AIRA 3B90A 3GQ9A 2X3HA 3ZPPA 2VJIA 2QXZA 2O04A 4XR6A 4PMHA 1XG2A 4YELA 2O1DA 3GQ8A 1RU4A 2X85A 2O17A 1O8KA 3GQAA 4XMYA 4YZQA 1H80A 1VBLA 2NTPA 1OGOX 1O8IA 3B4NA 4XLCA 4XLHA 1O8HA 4OJOA 4OJLA 4YZAA 4C2LA 1IB4A 1WMRA 1O8GA 2O0WA 3VSTA 4XOTA 1PE9A 4YZ0A 2NZMA 3WWGA 1BN8A 4YZXA 4AVZA 4XN3A 4XL9A 1QJVA 2X6WA 1KCCA 3FY3A 2O0VA 2NSTA 2X6YA 3T9GA 4XN0A 1JRGA 2QY1A 4XM3A 4OZZA 2VJJA 3EQNA 4XKVA 2NTQA 4XQFA 4I84A 1KCDA 3ZSCA 1JTAA 1O8EA 2UVEA 2ODLA 1OFLA 1RWRA 4HWVA 4YEJA 2PECA 2Z8GA 2UVFA 1QCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDK A;  5C1E A;  1BHE A;  2BSP A;  2INU A;  4OZY A;  4MR0 A;  1X0C A;  1PXZ A;  4Z05 A;  4W8S A;  3UW0 A;  4W8R A;  4W8T A;  3LMW A;  2INV A;  3GRH A;  3GQ7 A;  4OJ5 A;  2NT6 A;  3VMV A;  1KTW A;  2VBK A;  1O8D A;  2IQ7 A;  1CZF A;  4XNF A;  5C1C A;  2X6X A;  1DBO A;  3VSV A;  1EE6 A;  4OJP A;  1PLU A;  4Z06 A;  4Z03 A;  1IA5 A;  3VSU A;  1GQ8 A;  1O8J A;  4XLA A;  4MXN A;  1O8L A;  4W8Q A;  3EQO A;  1HG8 A;  1K5C A;  4XLE A;  3KRG A;  1OFM A;  4XON A;  1NHC A;  2PYG A;  3VMW A;  2PYH A;  2QX3 A;  3B8Y A;  2VBE A;  5AMV A;  1OGM X;  1IDJ A;  1O88 A;  1O8M A;  3JUR A;  4OJ6 A;  3SUC A;  4U4B A;  2NTB A;  2VBM A;  4URR A;  4NK6 A;  4XKW A;  4XOR A;  4EW9 A;  1RMG A;  4NK8 A;  2NSP A;  1DBG A;  2NT9 A;  2EWE A;  1O8F A;  1OOC A;  4U49 A;  4XLF A;  4XOP A;  1AIR A;  3B90 A;  3GQ9 A;  2X3H A;  3ZPP A;  2VJI A;  2QXZ A;  2O04 A;  4XR6 A;  4PMH A;  1XG2 A;  4YEL A;  2O1D A;  3GQ8 A;  1RU4 A;  2X85 A;  2O17 A;  1O8K A;  3GQA A;  4XMY A;  4YZQ A;  1H80 A;  1VBL A;  2NTP A;  1OGO X;  1O8I A;  3B4N A;  4XLC A;  4XLH A;  1O8H A;  4OJO A;  4OJL A;  4YZA A;  4C2L A;  1IB4 A;  1WMR A;  1O8G A;  2O0W A;  3VST A;  4XOT A;  1PE9 A;  4YZ0 A;  2NZM A;  3WWG A;  1BN8 A;  4YZX A;  4AVZ A;  4XN3 A;  4XL9 A;  1QJV A;  2X6W A;  1KCC A;  3FY3 A;  2O0V A;  2NST A;  2X6Y A;  3T9G A;  4XN0 A;  1JRG A;  2QY1 A;  4XM3 A;  4OZZ A;  2VJJ A;  3EQN A;  4XKV A;  2NTQ A;  4XQF A;  4I84 A;  1KCD A;  3ZSC A;  1JTA A;  1O8E A;  2UVE A;  2ODL A;  1OFL A;  1RWR A;  4HWV A;  4YEJ A;  2PEC A;  2Z8G A;  2UVF A;  1QCX A; 
#chains in the Genus database with same CATH topology
 1IDK A;  5C1E A;  1BHE A;  3AK5 A;  2BSP A;  2INU A;  4OZY A;  4JRA C;  4MR0 A;  2XT2 A;  1X0C A;  1PXZ A;  1QRB A;  3H09 A;  3NB2 A;  2BX6 A;  4Z05 A;  4W8S A;  3SQV A;  3UW0 A;  4W8R A;  4W8T A;  5JMC B;  4YCQ A;  3LMW A;  1TYX A;  2INV A;  2J8I A;  3GRH A;  3GQ7 A;  2J8K A;  3LYC A;  4OJ5 A;  2NT6 A;  3VMV A;  1LLW A;  1KTW A;  2B0R A;  2VBK A;  1QA2 A;  1O8D A;  2G0Y A;  4YFO A;  2IQ7 A;  1CZF A;  4XNF A;  5C1C A;  2BM5 A;  2X6X A;  1DBO A;  3VSV A;  1EE6 A;  1TSP A;  4OJP A;  1PLU A;  4Z06 A;  4Z03 A;  1IA5 A;  3VSU A;  1GQ8 A;  2BM4 A;  1O8J A;  4XLA A;  4MXN A;  1O8L A;  4W8Q A;  3EQO A;  1HG8 A;  1K5C A;  3SZE A;  3LJY A;  4YEI A;  4XLE A;  2XT4 A;  3KRG A;  5DNS A;  1OFM A;  4XON A;  1NHC A;  2PYG A;  3VMW A;  2PYH A;  2QX3 A;  3B8Y A;  2VBE A;  5AMV A;  1OGM X;  1IDJ A;  3BH6 B;  1O88 A;  1O8M A;  2VFO A;  3JUR A;  4OJ6 A;  3SUC A;  2IOU G;  4U4B A;  2NTB A;  1HF2 A;  2VBM A;  4NK6 A;  4URR A;  4OPW A;  4XKW A;  4XOR A;  4EW9 A;  1RMG A;  4NK8 A;  1QA3 A;  2NSP A;  2QYU A;  2XTX A;  4V02 C;  1DBG A;  2NT9 A;  2EWE A;  1O8F A;  1OOC A;  4U49 A;  4XLF A;  4XOP A;  1EA0 A;  1AIR A;  3B90 A;  2YUH A;  3GQ9 A;  2X3H A;  4YC5 A;  3ZPP A;  2VJI A;  5JLV C;  2QXZ A;  2O04 A;  3SY2 A;  4XR6 A;  2VFQ A;  4PMH A;  2BM7 A;  1XG2 A;  1EZG A;  3RIQ A;  4YEL A;  2O1D A;  3GQ8 A;  1CLW A;  1LM1 A;  3PSS A;  1RU4 A;  3ML3 A;  1OFE A;  2X85 A;  1WXR A;  2O17 A;  1O8K A;  3GQA A;  2XC1 A;  4XMY A;  4YZQ A;  3N90 A;  1H80 A;  1VBL A;  2W7Z A;  2NTP A;  3PSZ A;  3BH7 B;  1OGO X;  1O8I A;  3B4N A;  3DU1 X;  4XLH A;  4XLC A;  1O8H A;  4OJO A;  4OJL A;  1QA1 A;  4YZA A;  4C2L A;  1IB4 A;  3JX8 A;  1WMR A;  1O8G A;  2O0W A;  3PET A;  4XOT A;  3VST A;  1PE9 A;  4YZ0 A;  1DAB A;  2NZM A;  3WWG A;  1BN8 A;  2O6W A;  4YZX A;  4AVZ A;  4XN3 A;  4XL9 A;  1QJV A;  2X6W A;  2V5I A;  1KCC A;  3FY3 A;  2O0V A;  2XTW A;  2NST A;  3SYJ A;  2X6Y A;  1K4Z A;  3T9G A;  2VFN A;  4XN0 A;  1JRG A;  2QY1 A;  1TYV A;  4XM3 A;  2VFM A;  4OZZ A;  2VJJ A;  1TYU A;  3EQN A;  2XTY A;  3TH0 A;  4XKV A;  3NAW A;  2NTQ A;  1K8F A;  4XQF A;  2QZA A;  4I84 A;  1KCD A;  4KH3 A;  1OFD A;  4OM9 A;  1L1I A;  3ZSC A;  1JTA A;  1O8E A;  1QRC A;  1QQ1 A;  2UVE A;  2ODL A;  1OFL A;  1RWR A;  1LLZ A;  1TYW A;  2BM6 A;  4YDT A;  4HWV A;  3N6Z A;  2VFP A;  1KQ5 A;  3P4G A;  4YEJ A;  2PEC A;  2F3L A;  2Z8G A;  2UVF A;  1QCX A; 
#chains in the Genus database with same CATH homology
 1IDK A;  5C1E A;  1BHE A;  2BSP A;  2INU A;  4OZY A;  4MR0 A;  1X0C A;  1PXZ A;  4Z05 A;  4W8S A;  3UW0 A;  4W8R A;  4W8T A;  3LMW A;  2INV A;  3GRH A;  3GQ7 A;  4OJ5 A;  2NT6 A;  3VMV A;  1KTW A;  2VBK A;  1O8D A;  2IQ7 A;  1CZF A;  4XNF A;  5C1C A;  2X6X A;  1DBO A;  3VSV A;  1EE6 A;  4OJP A;  1PLU A;  4Z06 A;  4Z03 A;  1IA5 A;  3VSU A;  1GQ8 A;  1O8J A;  4XLA A;  4MXN A;  1O8L A;  4W8Q A;  3EQO A;  1HG8 A;  1K5C A;  4XLE A;  3KRG A;  1OFM A;  4XON A;  1NHC A;  2PYG A;  3VMW A;  2PYH A;  2QX3 A;  3B8Y A;  2VBE A;  5AMV A;  1OGM X;  1IDJ A;  1O88 A;  1O8M A;  3JUR A;  4OJ6 A;  3SUC A;  4U4B A;  2NTB A;  2VBM A;  4URR A;  4NK6 A;  4XKW A;  4XOR A;  4EW9 A;  1RMG A;  4NK8 A;  2NSP A;  1DBG A;  2NT9 A;  2EWE A;  1O8F A;  1OOC A;  4U49 A;  4XLF A;  4XOP A;  1AIR A;  3B90 A;  3GQ9 A;  2X3H A;  3ZPP A;  2VJI A;  2QXZ A;  2O04 A;  4XR6 A;  4PMH A;  1XG2 A;  4YEL A;  2O1D A;  3GQ8 A;  1RU4 A;  2X85 A;  2O17 A;  1O8K A;  3GQA A;  4XMY A;  4YZQ A;  1H80 A;  1VBL A;  2NTP A;  1OGO X;  1O8I A;  3B4N A;  4XLC A;  4XLH A;  1O8H A;  4OJO A;  4OJL A;  4YZA A;  4C2L A;  1IB4 A;  1WMR A;  1O8G A;  2O0W A;  3VST A;  4XOT A;  1PE9 A;  4YZ0 A;  2NZM A;  3WWG A;  1BN8 A;  4YZX A;  4AVZ A;  4XN3 A;  4XL9 A;  1QJV A;  2X6W A;  1KCC A;  3FY3 A;  2O0V A;  2NST A;  2X6Y A;  3T9G A;  4XN0 A;  1JRG A;  2QY1 A;  4XM3 A;  4OZZ A;  2VJJ A;  3EQN A;  4XKV A;  2NTQ A;  4XQF A;  4I84 A;  1KCD A;  3ZSC A;  1JTA A;  1O8E A;  2UVE A;  2ODL A;  1OFL A;  1RWR A;  4HWV A;  4YEJ A;  2PEC A;  2Z8G A;  2UVF A;  1QCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...