1KCDA

Endopolygalacturonase i from stereum purpureum complexed with two galacturonate at 1.15 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
b'CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kcdA00
4URRA 1EE6A 4XONA 3GQ7A 4OJ6A 4XL9A 2VBKA 1QJVA 2X3HA 1IDJA 3SUCA 1O8DA 1PXZA 2X6XA 4OZYA 4EW9A 1QCXA 3VSUA 1WMRA 3FY3A 1RMGA 3GRHA 4XKVA 4XOTA 3WWGA 2Z8GA 1OGMX 4AVZA 2NTPA 2PECA 3EQNA 4XLCA 4YZQA 1DBOA 4XORA 4Z05A 2X85A 4OJOA 2VJJA 2PYHA 4YZAA 4PMHA 2VBMA 1BN8A 3UW0A 2O1DA 4HWVA 1O8JA 1NHCA 3GQ9A 4C2LA 1RU4A 2PYGA 3GQAA 3KRGA 1JTAA 2NT9A 4U49A 4XN0A 1KCDA 3T9GA 4W8SA 1HG8A 4Z03A 1O8HA 3LMWA 1H80A 1BHEA 2O0VA 3GQ8A 3B90A 4XLHA 1OFLA 1O8EA 3JURA 2O0WA 2ODLA 2VBEA 2NTQA 1DBGA 2QX3A 2NTBA 4MR0A 1K5CA 1CZFA 1O88A 2O04A 4XR6A 4I84A 4U4BA 2QY1A 4XOPA 2NT6A 1PLUA 4XLFA 4YEJA 1KTWA 3VSTA 4NK6A 4NK8A 2IQ7A 2BSPA 1IDKA 1KCCA 1X0CA 4XQFA 1AIRA 1GQ8A 1XG2A 4OZZA 4W8RA 3ZSCA 4XLAA 3VSVA 1O8MA 5C1CA 4XLEA 3VMWA 1OGOX 4OJ5A 1O8LA 1IB4A 2EWEA 2NSPA 1O8FA 1VBLA 2VJIA 4XNFA 4YZ0A 2NSTA 3EQOA 4Z06A 1JRGA 4W8QA 4XKWA 2QXZA 2X6YA 2UVEA 4W8TA 1PE9A 4XM3A 3ZPPA 1IA5A 1RWRA 3VMVA 1O8IA 2UVFA 2NZMA 3B8YA 4MXNA 4XMYA 4XN3A 2O17A 1O8GA 1OFMA 1OOCA 2INUA 3B4NA 1O8KA 5AMVA 5C1EA 4YELA 4YZXA 2X6WA 2INVA 4OJPA 4OJLA
chains in the Genus database with same CATH superfamily
3BH6B 3SYJA 4URRA 1EE6A 4XONA 2J8IA 3GQ7A 4OJ6A 2YUHA 4XL9A 2VBKA 1QJVA 2X3HA 4YDTA 1QRCA 1IDJA 3SUCA 1O8DA 3N6ZA 4V02C 4YFOA 1PXZA 2X6XA 3TH0A 4OZYA 4EW9A 1QCXA 2XTXA 3VSUA 3ML3A 4YEIA 1WMRA 3FY3A 1RMGA 3GRHA 4XKVA 4XOTA 3WWGA 2Z8GA 3AK5A 1OGMX 4AVZA 2NTPA 2PECA 2BM5A 3EQNA 2VFNA 3LJYA 4XLCA 4YZQA 1DBOA 4XORA 1K4ZA 4Z05A 2X85A 2XT2A 4OJOA 2VJJA 2PYHA 2VFQA 4YZAA 4PMHA 2VFMA 2V5IA 3H09A 2XT4A 1TSPA 1BN8A 2VBMA 3UW0A 1LLWA 2O1DA 1HF2A 4HWVA 1O8JA 3PSZA 4OPWA 1QQ1A 1NHCA 3BH7B 3GQ9A 2QZAA 4C2LA 1RU4A 2PYGA 3GQAA 3KRGA 1QA2A 3LYCA 1JTAA 2NT9A 4U49A 4XN0A 1KCDA 2XTYA 3T9GA 4W8SA 2B0RA 1HG8A 1TYUA 4Z03A 1O8HA 3LMWA 1H80A 1BHEA 1TYVA 2O0VA 3GQ8A 3B90A 4JRAC 4XLHA 3SY2A 1OFEA 1OFLA 3SZEA 1O8EA 3SQVA 2BM7A 3JURA 2O0WA 2ODLA 2VBEA 2NTQA 1DBGA 2QX3A 2NTBA 4MR0A 3JX8A 1K5CA 1CZFA 1O88A 2O04A 2BX6A 2VFOA 4XR6A 4I84A 4KH3A 2QY1A 2BM4A 3DU1X 4U4BA 4XOPA 2XC1A 4YCQA 1TYXA 1CLWA 2NT6A 1PLUA 4XLFA 4YEJA 1WXRA 1KTWA 3VSTA 3NAWA 4NK6A 4NK8A 1EA0A 2IQ7A 2BSPA 1IDKA 1QRBA 1KCCA 1X0CA 3NB2A 4XQFA 1AIRA 1GQ8A 1XG2A 4OZZA 4W8RA 3ZSCA 4XLAA 3VSVA 1O8MA 5C1CA 2J8KA 4XLEA 3VMWA 1OGOX 4OJ5A 1EZGA 1O8LA 1K8FA 1IB4A 2EWEA 2IOUG 2NSPA 1O8FA 1VBLA 2G0YA 2VJIA 2W7ZA 2NSTA 4XNFA 3EQOA 4YZ0A 1LM1A 2BM6A 4Z06A 1OFDA 1JRGA 2F3LA 2O6WA 3P4GA 4W8QA 4XKWA 2QXZA 2X6YA 2UVEA 4W8TA 1PE9A 4XM3A 3ZPPA 1IA5A 1L1IA 1RWRA 3PSSA 5JLVC 3VMVA 1O8IA 1QA3A 2UVFA 3RIQA 2NZMA 3B8YA 4MXNA 1QA1A 4XMYA 2XTWA 4XN3A 1O8GA 2O17A 4OM9A 3PETA 5DNSA 1OFMA 1LLZA 1OOCA 2INUA 2QYUA 2VFPA 3B4NA 1O8KA 1TYWA 4YC5A 5AMVA 5JMCB 1KQ5A 5C1EA 1DABA 3N90A 4YELA 4YZXA 2X6WA 2INVA 4OJPA 4OJLA
chains in the Genus database with same CATH topology
4URRA 1EE6A 4XONA 3GQ7A 4OJ6A 4XL9A 2VBKA 1QJVA 2X3HA 1IDJA 3SUCA 1O8DA 1PXZA 2X6XA 4OZYA 4EW9A 1QCXA 3VSUA 1WMRA 3FY3A 1RMGA 3GRHA 4XKVA 4XOTA 3WWGA 2Z8GA 1OGMX 4AVZA 2NTPA 2PECA 3EQNA 4XLCA 4YZQA 1DBOA 4XORA 4Z05A 2X85A 4OJOA 2VJJA 2PYHA 4YZAA 4PMHA 2VBMA 1BN8A 3UW0A 2O1DA 4HWVA 1O8JA 1NHCA 3GQ9A 4C2LA 1RU4A 2PYGA 3GQAA 3KRGA 1JTAA 2NT9A 4U49A 4XN0A 1KCDA 3T9GA 4W8SA 1HG8A 4Z03A 1O8HA 3LMWA 1H80A 1BHEA 2O0VA 3GQ8A 3B90A 4XLHA 1OFLA 1O8EA 3JURA 2O0WA 2ODLA 2VBEA 2NTQA 1DBGA 2QX3A 2NTBA 4MR0A 1K5CA 1CZFA 1O88A 2O04A 4XR6A 4I84A 4U4BA 2QY1A 4XOPA 2NT6A 1PLUA 4XLFA 4YEJA 1KTWA 3VSTA 4NK6A 4NK8A 2IQ7A 2BSPA 1IDKA 1KCCA 1X0CA 4XQFA 1AIRA 1GQ8A 1XG2A 4OZZA 4W8RA 3ZSCA 4XLAA 3VSVA 1O8MA 5C1CA 4XLEA 3VMWA 1OGOX 4OJ5A 1O8LA 1IB4A 2EWEA 2NSPA 1O8FA 1VBLA 2VJIA 4XNFA 4YZ0A 2NSTA 3EQOA 4Z06A 1JRGA 4W8QA 4XKWA 2QXZA 2X6YA 2UVEA 4W8TA 1PE9A 4XM3A 3ZPPA 1IA5A 1RWRA 3VMVA 1O8IA 2UVFA 2NZMA 3B8YA 4MXNA 4XMYA 4XN3A 2O17A 1O8GA 1OFMA 1OOCA 2INUA 3B4NA 1O8KA 5AMVA 5C1EA 4YELA 4YZXA 2X6WA 2INVA 4OJPA 4OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URR A;  1EE6 A;  4XON A;  3GQ7 A;  4OJ6 A;  4XL9 A;  2VBK A;  1QJV A;  2X3H A;  1IDJ A;  3SUC A;  1O8D A;  1PXZ A;  2X6X A;  4OZY A;  4EW9 A;  1QCX A;  3VSU A;  1WMR A;  3FY3 A;  1RMG A;  3GRH A;  4XKV A;  4XOT A;  3WWG A;  2Z8G A;  1OGM X;  4AVZ A;  2NTP A;  2PEC A;  3EQN A;  4XLC A;  4YZQ A;  1DBO A;  4XOR A;  4Z05 A;  2X85 A;  4OJO A;  2VJJ A;  2PYH A;  4YZA A;  4PMH A;  2VBM A;  1BN8 A;  3UW0 A;  2O1D A;  4HWV A;  1O8J A;  1NHC A;  3GQ9 A;  4C2L A;  1RU4 A;  2PYG A;  3GQA A;  3KRG A;  1JTA A;  2NT9 A;  4U49 A;  4XN0 A;  1KCD A;  3T9G A;  4W8S A;  1HG8 A;  4Z03 A;  1O8H A;  3LMW A;  1H80 A;  1BHE A;  2O0V A;  3GQ8 A;  3B90 A;  4XLH A;  1OFL A;  1O8E A;  3JUR A;  2O0W A;  2ODL A;  2VBE A;  2NTQ A;  1DBG A;  2QX3 A;  2NTB A;  4MR0 A;  1K5C A;  1CZF A;  1O88 A;  2O04 A;  4XR6 A;  4I84 A;  4U4B A;  2QY1 A;  4XOP A;  2NT6 A;  1PLU A;  4XLF A;  4YEJ A;  1KTW A;  3VST A;  4NK6 A;  4NK8 A;  2IQ7 A;  2BSP A;  1IDK A;  1KCC A;  1X0C A;  4XQF A;  1AIR A;  1GQ8 A;  1XG2 A;  4OZZ A;  4W8R A;  3ZSC A;  4XLA A;  3VSV A;  1O8M A;  5C1C A;  4XLE A;  3VMW A;  1OGO X;  4OJ5 A;  1O8L A;  1IB4 A;  2EWE A;  2NSP A;  1O8F A;  1VBL A;  2VJI A;  4XNF A;  4YZ0 A;  2NST A;  3EQO A;  4Z06 A;  1JRG A;  4W8Q A;  4XKW A;  2QXZ A;  2X6Y A;  2UVE A;  4W8T A;  1PE9 A;  4XM3 A;  3ZPP A;  1IA5 A;  1RWR A;  3VMV A;  1O8I A;  2UVF A;  2NZM A;  3B8Y A;  4MXN A;  4XMY A;  4XN3 A;  2O17 A;  1O8G A;  1OFM A;  1OOC A;  2INU A;  3B4N A;  1O8K A;  5AMV A;  5C1E A;  4YEL A;  4YZX A;  2X6W A;  2INV A;  4OJP A;  4OJL A; 
#chains in the Genus database with same CATH topology
 3BH6 B;  3SYJ A;  4URR A;  1EE6 A;  4XON A;  2J8I A;  3GQ7 A;  4OJ6 A;  2YUH A;  4XL9 A;  2VBK A;  1QJV A;  2X3H A;  4YDT A;  1QRC A;  1IDJ A;  3SUC A;  1O8D A;  3N6Z A;  4V02 C;  4YFO A;  1PXZ A;  2X6X A;  3TH0 A;  4OZY A;  4EW9 A;  1QCX A;  2XTX A;  3VSU A;  3ML3 A;  4YEI A;  1WMR A;  3FY3 A;  1RMG A;  3GRH A;  4XKV A;  4XOT A;  3WWG A;  2Z8G A;  3AK5 A;  1OGM X;  4AVZ A;  2NTP A;  2PEC A;  2BM5 A;  3EQN A;  2VFN A;  3LJY A;  4XLC A;  4YZQ A;  1DBO A;  4XOR A;  1K4Z A;  4Z05 A;  2X85 A;  2XT2 A;  4OJO A;  2VJJ A;  2PYH A;  2VFQ A;  4YZA A;  4PMH A;  2VFM A;  2V5I A;  3H09 A;  2XT4 A;  1TSP A;  1BN8 A;  2VBM A;  3UW0 A;  1LLW A;  2O1D A;  1HF2 A;  4HWV A;  1O8J A;  3PSZ A;  4OPW A;  1QQ1 A;  1NHC A;  3BH7 B;  3GQ9 A;  2QZA A;  4C2L A;  1RU4 A;  2PYG A;  3GQA A;  3KRG A;  1QA2 A;  3LYC A;  1JTA A;  2NT9 A;  4U49 A;  4XN0 A;  1KCD A;  2XTY A;  3T9G A;  4W8S A;  2B0R A;  1HG8 A;  1TYU A;  4Z03 A;  1O8H A;  3LMW A;  1H80 A;  1BHE A;  1TYV A;  2O0V A;  3GQ8 A;  3B90 A;  4JRA C;  4XLH A;  3SY2 A;  1OFE A;  1OFL A;  3SZE A;  1O8E A;  3SQV A;  2BM7 A;  3JUR A;  2O0W A;  2ODL A;  2VBE A;  2NTQ A;  1DBG A;  2QX3 A;  2NTB A;  4MR0 A;  3JX8 A;  1K5C A;  1CZF A;  1O88 A;  2O04 A;  2BX6 A;  2VFO A;  4XR6 A;  4I84 A;  4KH3 A;  2QY1 A;  2BM4 A;  3DU1 X;  4U4B A;  4XOP A;  2XC1 A;  4YCQ A;  1TYX A;  1CLW A;  2NT6 A;  1PLU A;  4XLF A;  4YEJ A;  1WXR A;  1KTW A;  3VST A;  3NAW A;  4NK6 A;  4NK8 A;  1EA0 A;  2IQ7 A;  2BSP A;  1IDK A;  1QRB A;  1KCC A;  1X0C A;  3NB2 A;  4XQF A;  1AIR A;  1GQ8 A;  1XG2 A;  4OZZ A;  4W8R A;  3ZSC A;  4XLA A;  3VSV A;  1O8M A;  5C1C A;  2J8K A;  4XLE A;  3VMW A;  1OGO X;  4OJ5 A;  1EZG A;  1O8L A;  1K8F A;  1IB4 A;  2EWE A;  2IOU G;  2NSP A;  1O8F A;  1VBL A;  2G0Y A;  2VJI A;  2W7Z A;  2NST A;  4XNF A;  3EQO A;  4YZ0 A;  1LM1 A;  2BM6 A;  4Z06 A;  1OFD A;  1JRG A;  2F3L A;  2O6W A;  3P4G A;  4W8Q A;  4XKW A;  2QXZ A;  2X6Y A;  2UVE A;  4W8T A;  1PE9 A;  4XM3 A;  3ZPP A;  1IA5 A;  1L1I A;  1RWR A;  3PSS A;  5JLV C;  3VMV A;  1O8I A;  1QA3 A;  2UVF A;  3RIQ A;  2NZM A;  3B8Y A;  4MXN A;  1QA1 A;  4XMY A;  2XTW A;  4XN3 A;  1O8G A;  2O17 A;  4OM9 A;  3PET A;  5DNS A;  1OFM A;  1LLZ A;  1OOC A;  2INU A;  2QYU A;  2VFP A;  3B4N A;  1O8K A;  1TYW A;  4YC5 A;  5AMV A;  5JMC B;  1KQ5 A;  5C1E A;  1DAB A;  3N90 A;  4YEL A;  4YZX A;  2X6W A;  2INV A;  4OJP A;  4OJL A; 
#chains in the Genus database with same CATH homology
 4URR A;  1EE6 A;  4XON A;  3GQ7 A;  4OJ6 A;  4XL9 A;  2VBK A;  1QJV A;  2X3H A;  1IDJ A;  3SUC A;  1O8D A;  1PXZ A;  2X6X A;  4OZY A;  4EW9 A;  1QCX A;  3VSU A;  1WMR A;  3FY3 A;  1RMG A;  3GRH A;  4XKV A;  4XOT A;  3WWG A;  2Z8G A;  1OGM X;  4AVZ A;  2NTP A;  2PEC A;  3EQN A;  4XLC A;  4YZQ A;  1DBO A;  4XOR A;  4Z05 A;  2X85 A;  4OJO A;  2VJJ A;  2PYH A;  4YZA A;  4PMH A;  2VBM A;  1BN8 A;  3UW0 A;  2O1D A;  4HWV A;  1O8J A;  1NHC A;  3GQ9 A;  4C2L A;  1RU4 A;  2PYG A;  3GQA A;  3KRG A;  1JTA A;  2NT9 A;  4U49 A;  4XN0 A;  1KCD A;  3T9G A;  4W8S A;  1HG8 A;  4Z03 A;  1O8H A;  3LMW A;  1H80 A;  1BHE A;  2O0V A;  3GQ8 A;  3B90 A;  4XLH A;  1OFL A;  1O8E A;  3JUR A;  2O0W A;  2ODL A;  2VBE A;  2NTQ A;  1DBG A;  2QX3 A;  2NTB A;  4MR0 A;  1K5C A;  1CZF A;  1O88 A;  2O04 A;  4XR6 A;  4I84 A;  4U4B A;  2QY1 A;  4XOP A;  2NT6 A;  1PLU A;  4XLF A;  4YEJ A;  1KTW A;  3VST A;  4NK6 A;  4NK8 A;  2IQ7 A;  2BSP A;  1IDK A;  1KCC A;  1X0C A;  4XQF A;  1AIR A;  1GQ8 A;  1XG2 A;  4OZZ A;  4W8R A;  3ZSC A;  4XLA A;  3VSV A;  1O8M A;  5C1C A;  4XLE A;  3VMW A;  1OGO X;  4OJ5 A;  1O8L A;  1IB4 A;  2EWE A;  2NSP A;  1O8F A;  1VBL A;  2VJI A;  4XNF A;  4YZ0 A;  2NST A;  3EQO A;  4Z06 A;  1JRG A;  4W8Q A;  4XKW A;  2QXZ A;  2X6Y A;  2UVE A;  4W8T A;  1PE9 A;  4XM3 A;  3ZPP A;  1IA5 A;  1RWR A;  3VMV A;  1O8I A;  2UVF A;  2NZM A;  3B8Y A;  4MXN A;  4XMY A;  4XN3 A;  2O17 A;  1O8G A;  1OFM A;  1OOC A;  2INU A;  3B4N A;  1O8K A;  5AMV A;  5C1E A;  4YEL A;  4YZX A;  2X6W A;  2INV A;  4OJP A;  4OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...