1KCDA

Endopolygalacturonase i from stereum purpureum complexed with two galacturonate at 1.15 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kcdA00
4YELA 2PYGA 1WMRA 1O8FA 2X6XA 2INVA 4XQFA 4NK8A 1EE6A 2BSPA 1CZFA 3SUCA 2VBMA 1KCDA 4XLCA 2NTPA 3VSUA 5C1EA 4Z05A 4YZXA 1OFLA 2PYHA 2O1DA 2VBKA 1O8EA 4I84A 3GQ9A 4Z03A 2NT6A 3EQNA 4OZZA 1GQ8A 3VSVA 1RU4A 2X6WA 1JRGA 2EWEA 2VBEA 3B4NA 4XNFA 4W8TA 2QX3A 4XM3A 2ODLA 1O8KA 3VSTA 1X0CA 1IB4A 2O0WA 2NTQA 3GQ8A 4MR0A 4W8QA 4XKVA 2VJJA 4PMHA 4XLEA 3ZSCA 1O8LA 2NSTA 1JTAA 4XLAA 3KRGA 1KTWA 3FY3A 2QXZA 5AMVA 3T9GA 1HG8A 4W8SA 1AIRA 1QJVA 2PECA 4AVZA 3UW0A 2NZMA 2INUA 1XG2A 4XMYA 3B8YA 4MXNA 4XR6A 4OZYA 1K5CA 2X85A 3GRHA 4OJPA 1OGOX 2Z8GA 2O04A 1H80A 1O8MA 4W8RA 4YZAA 4YZ0A 1DBOA 1RWRA 3VMWA 1IDKA 1BN8A 1O8IA 4YEJA 5C1CA 2X3HA 2UVFA 3B90A 3LMWA 4XOTA 1PE9A 4XORA 3WWGA 4XN3A 1PLUA 2X6YA 2O0VA 4Z06A 4OJLA 1BHEA 4XONA 3VMVA 4XN0A 4C2LA 1VBLA 2VJIA 4XOPA 3GQ7A 3EQOA 4XLFA 1OOCA 1PXZA 1OGMX 1IDJA 1QCXA 2NT9A 1O8HA 1O8JA 2QY1A 1IA5A 4NK6A 4EW9A 1O8GA 1KCCA 4XKWA 4OJ6A 4OJOA 4XL9A 1DBGA 1O8DA 1RMGA 4XLHA 3JURA 1O88A 3ZPPA 1OFMA 2UVEA 4U4BA 4URRA 4YZQA 2IQ7A 4OJ5A 4U49A 2NTBA 1NHCA 2O17A 3GQAA 2NSPA 4HWVA
chains in the Genus database with same CATH superfamily
4YELA 2B0RA 2PYGA 1WMRA 1O8FA 2X6XA 2INVA 4XQFA 4NK8A 1HF2A 4YC5A 1LLWA 2BM6A 1EE6A 2BSPA 2O6WA 4OM9A 1CZFA 3RIQA 3SUCA 3SYJA 2VBMA 1KCDA 4XLCA 2NTPA 1OFDA 4YFOA 2G0YA 3VSUA 5C1EA 4Z05A 4YZXA 3P4GA 1OFLA 2PYHA 2QYUA 2O1DA 1KQ5A 2VBKA 1O8EA 4I84A 3GQ9A 4Z03A 2NT6A 3EQNA 2V5IA 2BM5A 3N90A 4OZZA 3SQVA 2XTYA 3BH7B 1GQ8A 3VSVA 4YDTA 1RU4A 2X6WA 4KH3A 1JRGA 2EWEA 2VBEA 3B4NA 2BM4A 4OPWA 4W8TA 2QX3A 1TYWA 3JX8A 4XM3A 2ODLA 4XNFA 1O8KA 3BH6B 3VSTA 1QRBA 1X0CA 1QQ1A 1IB4A 2O0WA 1QA1A 2NTQA 3GQ8A 4MR0A 2VFMA 4W8QA 2QZAA 4XKVA 2VJJA 4PMHA 3N6ZA 2F3LA 4XLEA 2XTWA 3ZSCA 1O8LA 2NSTA 1JTAA 3PSZA 4XLAA 3KRGA 1KTWA 3FY3A 2QXZA 1TYUA 5AMVA 3T9GA 1HG8A 4W8SA 1AIRA 1QJVA 2PECA 4AVZA 3UW0A 1LM1A 1LLZA 2NZMA 2INUA 1XG2A 4XMYA 3B8YA 4MXNA 4XR6A 4OZYA 1K5CA 2X85A 3GRHA 4OJPA 1OGOX 2Z8GA 1EZGA 2O04A 1H80A 1O8MA 4W8RA 4YZAA 4YZ0A 2VFPA 1DBOA 1RWRA 3VMWA 1IDKA 1BN8A 1O8IA 4YEJA 5C1CA 2X3HA 2UVFA 3B90A 3LMWA 2XT4A 1PE9A 4XOTA 4XORA 3WWGA 5JMCB 5DNSA 4XN3A 1TYXA 1PLUA 2X6YA 2VFNA 2O0VA 2XTXA 4V02C 4Z06A 4OJLA 2VFOA 1BHEA 4XONA 3VMVA 2YUHA 4XN0A 1VBLA 3PSSA 4C2LA 2VJIA 3TH0A 3NB2A 2BM7A 3GQ7A 4XOPA 3SZEA 1QA2A 5JLVC 1TSPA 3DU1X 2VFQA 3EQOA 1CLWA 4XLFA 1EA0A 1OOCA 1PXZA 1OGMX 2BX6A 1IDJA 2XC1A 3LYCA 1QCXA 2NT9A 2XT2A 1O8HA 1O8JA 2J8IA 2QY1A 3AK5A 1IA5A 4NK6A 4EW9A 1O8GA 2IOUG 4XKWA 1K4ZA 1KCCA 1WXRA 4OJ6A 4OJOA 1K8FA 3NAWA 1DBGA 4XL9A 1O8DA 1RMGA 4XLHA 3JURA 1O88A 1TYVA 3SY2A 3ZPPA 1QA3A 1OFMA 2UVEA 3LJYA 4U4BA 1OFEA 3H09A 4URRA 2W7ZA 4YZQA 3PETA 1QRCA 2J8KA 4JRAC 2IQ7A 4OJ5A 4U49A 2NTBA 4YCQA 2O17A 1NHCA 3GQAA 3ML3A 1DABA 2NSPA 4HWVA 1L1IA 4YEIA
chains in the Genus database with same CATH topology
4YELA 2PYGA 1WMRA 1O8FA 2X6XA 2INVA 4XQFA 4NK8A 1EE6A 2BSPA 1CZFA 3SUCA 2VBMA 1KCDA 4XLCA 2NTPA 3VSUA 5C1EA 4Z05A 4YZXA 1OFLA 2PYHA 2O1DA 2VBKA 1O8EA 4I84A 3GQ9A 4Z03A 2NT6A 3EQNA 4OZZA 1GQ8A 3VSVA 1RU4A 2X6WA 1JRGA 2EWEA 2VBEA 3B4NA 4XNFA 4W8TA 2QX3A 4XM3A 2ODLA 1O8KA 3VSTA 1X0CA 1IB4A 2O0WA 2NTQA 3GQ8A 4MR0A 4W8QA 4XKVA 2VJJA 4PMHA 4XLEA 3ZSCA 1O8LA 2NSTA 1JTAA 4XLAA 3KRGA 1KTWA 3FY3A 2QXZA 5AMVA 3T9GA 1HG8A 4W8SA 1AIRA 1QJVA 2PECA 4AVZA 3UW0A 2NZMA 2INUA 1XG2A 4XMYA 3B8YA 4MXNA 4XR6A 4OZYA 1K5CA 2X85A 3GRHA 4OJPA 1OGOX 2Z8GA 2O04A 1H80A 1O8MA 4W8RA 4YZAA 4YZ0A 1DBOA 1RWRA 3VMWA 1IDKA 1BN8A 1O8IA 4YEJA 5C1CA 2X3HA 2UVFA 3B90A 3LMWA 4XOTA 1PE9A 4XORA 3WWGA 4XN3A 1PLUA 2X6YA 2O0VA 4Z06A 4OJLA 1BHEA 4XONA 3VMVA 4XN0A 4C2LA 1VBLA 2VJIA 4XOPA 3GQ7A 3EQOA 4XLFA 1OOCA 1PXZA 1OGMX 1IDJA 1QCXA 2NT9A 1O8HA 1O8JA 2QY1A 1IA5A 4NK6A 4EW9A 1O8GA 1KCCA 4XKWA 4OJ6A 4OJOA 4XL9A 1DBGA 1O8DA 1RMGA 4XLHA 3JURA 1O88A 3ZPPA 1OFMA 2UVEA 4U4BA 4URRA 4YZQA 2IQ7A 4OJ5A 4U49A 2NTBA 1NHCA 2O17A 3GQAA 2NSPA 4HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEL A;  2PYG A;  1WMR A;  1O8F A;  2X6X A;  2INV A;  4XQF A;  4NK8 A;  1EE6 A;  2BSP A;  1CZF A;  3SUC A;  2VBM A;  1KCD A;  4XLC A;  2NTP A;  3VSU A;  5C1E A;  4Z05 A;  4YZX A;  1OFL A;  2PYH A;  2O1D A;  2VBK A;  1O8E A;  4I84 A;  3GQ9 A;  4Z03 A;  2NT6 A;  3EQN A;  4OZZ A;  1GQ8 A;  3VSV A;  1RU4 A;  2X6W A;  1JRG A;  2EWE A;  2VBE A;  3B4N A;  4XNF A;  4W8T A;  2QX3 A;  4XM3 A;  2ODL A;  1O8K A;  3VST A;  1X0C A;  1IB4 A;  2O0W A;  2NTQ A;  3GQ8 A;  4MR0 A;  4W8Q A;  4XKV A;  2VJJ A;  4PMH A;  4XLE A;  3ZSC A;  1O8L A;  2NST A;  1JTA A;  4XLA A;  3KRG A;  1KTW A;  3FY3 A;  2QXZ A;  5AMV A;  3T9G A;  1HG8 A;  4W8S A;  1AIR A;  1QJV A;  2PEC A;  4AVZ A;  3UW0 A;  2NZM A;  2INU A;  1XG2 A;  4XMY A;  3B8Y A;  4MXN A;  4XR6 A;  4OZY A;  1K5C A;  2X85 A;  3GRH A;  4OJP A;  1OGO X;  2Z8G A;  2O04 A;  1H80 A;  1O8M A;  4W8R A;  4YZA A;  4YZ0 A;  1DBO A;  1RWR A;  3VMW A;  1IDK A;  1BN8 A;  1O8I A;  4YEJ A;  5C1C A;  2X3H A;  2UVF A;  3B90 A;  3LMW A;  4XOT A;  1PE9 A;  4XOR A;  3WWG A;  4XN3 A;  1PLU A;  2X6Y A;  2O0V A;  4Z06 A;  4OJL A;  1BHE A;  4XON A;  3VMV A;  4XN0 A;  4C2L A;  1VBL A;  2VJI A;  4XOP A;  3GQ7 A;  3EQO A;  4XLF A;  1OOC A;  1PXZ A;  1OGM X;  1IDJ A;  1QCX A;  2NT9 A;  1O8H A;  1O8J A;  2QY1 A;  1IA5 A;  4NK6 A;  4EW9 A;  1O8G A;  1KCC A;  4XKW A;  4OJ6 A;  4OJO A;  4XL9 A;  1DBG A;  1O8D A;  1RMG A;  4XLH A;  3JUR A;  1O88 A;  3ZPP A;  1OFM A;  2UVE A;  4U4B A;  4URR A;  4YZQ A;  2IQ7 A;  4OJ5 A;  4U49 A;  2NTB A;  1NHC A;  2O17 A;  3GQA A;  2NSP A;  4HWV A; 
#chains in the Genus database with same CATH topology
 4YEL A;  2B0R A;  2PYG A;  1WMR A;  1O8F A;  2X6X A;  2INV A;  4XQF A;  4NK8 A;  1HF2 A;  4YC5 A;  1LLW A;  2BM6 A;  1EE6 A;  2BSP A;  2O6W A;  4OM9 A;  1CZF A;  3RIQ A;  3SUC A;  3SYJ A;  2VBM A;  1KCD A;  4XLC A;  2NTP A;  1OFD A;  4YFO A;  2G0Y A;  3VSU A;  5C1E A;  4Z05 A;  4YZX A;  3P4G A;  1OFL A;  2PYH A;  2QYU A;  2O1D A;  1KQ5 A;  2VBK A;  1O8E A;  4I84 A;  3GQ9 A;  4Z03 A;  2NT6 A;  3EQN A;  2V5I A;  2BM5 A;  3N90 A;  4OZZ A;  3SQV A;  2XTY A;  3BH7 B;  1GQ8 A;  3VSV A;  4YDT A;  1RU4 A;  2X6W A;  4KH3 A;  1JRG A;  2EWE A;  2VBE A;  3B4N A;  2BM4 A;  4OPW A;  4W8T A;  2QX3 A;  1TYW A;  3JX8 A;  4XM3 A;  2ODL A;  4XNF A;  1O8K A;  3BH6 B;  3VST A;  1QRB A;  1X0C A;  1QQ1 A;  1IB4 A;  2O0W A;  1QA1 A;  2NTQ A;  3GQ8 A;  4MR0 A;  2VFM A;  4W8Q A;  2QZA A;  4XKV A;  2VJJ A;  4PMH A;  3N6Z A;  2F3L A;  4XLE A;  2XTW A;  3ZSC A;  1O8L A;  2NST A;  1JTA A;  3PSZ A;  4XLA A;  3KRG A;  1KTW A;  3FY3 A;  2QXZ A;  1TYU A;  5AMV A;  3T9G A;  1HG8 A;  4W8S A;  1AIR A;  1QJV A;  2PEC A;  4AVZ A;  3UW0 A;  1LM1 A;  1LLZ A;  2NZM A;  2INU A;  1XG2 A;  4XMY A;  3B8Y A;  4MXN A;  4XR6 A;  4OZY A;  1K5C A;  2X85 A;  3GRH A;  4OJP A;  1OGO X;  2Z8G A;  1EZG A;  2O04 A;  1H80 A;  1O8M A;  4W8R A;  4YZA A;  4YZ0 A;  2VFP A;  1DBO A;  1RWR A;  3VMW A;  1IDK A;  1BN8 A;  1O8I A;  4YEJ A;  5C1C A;  2X3H A;  2UVF A;  3B90 A;  3LMW A;  2XT4 A;  1PE9 A;  4XOT A;  4XOR A;  3WWG A;  5JMC B;  5DNS A;  4XN3 A;  1TYX A;  1PLU A;  2X6Y A;  2VFN A;  2O0V A;  2XTX A;  4V02 C;  4Z06 A;  4OJL A;  2VFO A;  1BHE A;  4XON A;  3VMV A;  2YUH A;  4XN0 A;  1VBL A;  3PSS A;  4C2L A;  2VJI A;  3TH0 A;  3NB2 A;  2BM7 A;  3GQ7 A;  4XOP A;  3SZE A;  1QA2 A;  5JLV C;  1TSP A;  3DU1 X;  2VFQ A;  3EQO A;  1CLW A;  4XLF A;  1EA0 A;  1OOC A;  1PXZ A;  1OGM X;  2BX6 A;  1IDJ A;  2XC1 A;  3LYC A;  1QCX A;  2NT9 A;  2XT2 A;  1O8H A;  1O8J A;  2J8I A;  2QY1 A;  3AK5 A;  1IA5 A;  4NK6 A;  4EW9 A;  1O8G A;  2IOU G;  4XKW A;  1K4Z A;  1KCC A;  1WXR A;  4OJ6 A;  4OJO A;  1K8F A;  3NAW A;  1DBG A;  4XL9 A;  1O8D A;  1RMG A;  4XLH A;  3JUR A;  1O88 A;  1TYV A;  3SY2 A;  3ZPP A;  1QA3 A;  1OFM A;  2UVE A;  3LJY A;  4U4B A;  1OFE A;  3H09 A;  4URR A;  2W7Z A;  4YZQ A;  3PET A;  1QRC A;  2J8K A;  4JRA C;  2IQ7 A;  4OJ5 A;  4U49 A;  2NTB A;  4YCQ A;  2O17 A;  1NHC A;  3GQA A;  3ML3 A;  1DAB A;  2NSP A;  4HWV A;  1L1I A;  4YEI A; 
#chains in the Genus database with same CATH homology
 4YEL A;  2PYG A;  1WMR A;  1O8F A;  2X6X A;  2INV A;  4XQF A;  4NK8 A;  1EE6 A;  2BSP A;  1CZF A;  3SUC A;  2VBM A;  1KCD A;  4XLC A;  2NTP A;  3VSU A;  5C1E A;  4Z05 A;  4YZX A;  1OFL A;  2PYH A;  2O1D A;  2VBK A;  1O8E A;  4I84 A;  3GQ9 A;  4Z03 A;  2NT6 A;  3EQN A;  4OZZ A;  1GQ8 A;  3VSV A;  1RU4 A;  2X6W A;  1JRG A;  2EWE A;  2VBE A;  3B4N A;  4XNF A;  4W8T A;  2QX3 A;  4XM3 A;  2ODL A;  1O8K A;  3VST A;  1X0C A;  1IB4 A;  2O0W A;  2NTQ A;  3GQ8 A;  4MR0 A;  4W8Q A;  4XKV A;  2VJJ A;  4PMH A;  4XLE A;  3ZSC A;  1O8L A;  2NST A;  1JTA A;  4XLA A;  3KRG A;  1KTW A;  3FY3 A;  2QXZ A;  5AMV A;  3T9G A;  1HG8 A;  4W8S A;  1AIR A;  1QJV A;  2PEC A;  4AVZ A;  3UW0 A;  2NZM A;  2INU A;  1XG2 A;  4XMY A;  3B8Y A;  4MXN A;  4XR6 A;  4OZY A;  1K5C A;  2X85 A;  3GRH A;  4OJP A;  1OGO X;  2Z8G A;  2O04 A;  1H80 A;  1O8M A;  4W8R A;  4YZA A;  4YZ0 A;  1DBO A;  1RWR A;  3VMW A;  1IDK A;  1BN8 A;  1O8I A;  4YEJ A;  5C1C A;  2X3H A;  2UVF A;  3B90 A;  3LMW A;  4XOT A;  1PE9 A;  4XOR A;  3WWG A;  4XN3 A;  1PLU A;  2X6Y A;  2O0V A;  4Z06 A;  4OJL A;  1BHE A;  4XON A;  3VMV A;  4XN0 A;  4C2L A;  1VBL A;  2VJI A;  4XOP A;  3GQ7 A;  3EQO A;  4XLF A;  1OOC A;  1PXZ A;  1OGM X;  1IDJ A;  1QCX A;  2NT9 A;  1O8H A;  1O8J A;  2QY1 A;  1IA5 A;  4NK6 A;  4EW9 A;  1O8G A;  1KCC A;  4XKW A;  4OJ6 A;  4OJO A;  4XL9 A;  1DBG A;  1O8D A;  1RMG A;  4XLH A;  3JUR A;  1O88 A;  3ZPP A;  1OFM A;  2UVE A;  4U4B A;  4URR A;  4YZQ A;  2IQ7 A;  4OJ5 A;  4U49 A;  2NTB A;  1NHC A;  2O17 A;  3GQA A;  2NSP A;  4HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...