1KCDA

Endopolygalacturonase i from stereum purpureum complexed with two galacturonate at 1.15 a resolution.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
333
structure length
333
Chain Sequence
CTVKSVDDAKDIAGCSAVTLNGFTVPAGNTLVLNPDKGATVTMAGDITFAKTTLDGPLFTIDGTGINFVGADHIFDGNGALYWDGKGTNNGTHKPHPFLKIKGSGTYKKFEVLNSPAQAISVGPTDAHLTLDGITVDDFAGDTKNLGHNTDGFDVSANNVTIQNCIVKNQDDCIAINDGNNIRFENNQCSGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGIAKYGVLISQSYPDDVGNPGTGAPFSDVNFTGGATTIKVNNAATRVTVECGNCSGNWNWSQLTVTGGKAGTIKSDKAKITGGQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Active-site architecture of endopolygalacturonase I from Stereum purpureum revealed by crystal structures in native and ligand-bound forms at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 135
structure length 333
sequence length 333
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2001-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1kcdA00
1OOCA 1OFMA 2VBKA 2NSPA 1BHEA 1RMGA 4Z03A 2VBMA 1O8DA 2O1DA 3ZSCA 4MXNA 4EW9A 2UVEA 4C2LA 4OJLA 4XLEA 4W8TA 3VMWA 2UVFA 3GQ8A 1O8IA 1RU4A 4U4BA 2QXZA 4U49A 2BSPA 2X85A 4NK6A 2O0VA 1O8HA 5C1EA 1OGOX 2NTBA 1OFLA 2VJIA 1KTWA 3GRHA 2VBEA 1NHCA 4XLFA 4Z05A 3GQAA 3VSUA 1O8JA 3EQOA 4YZQA 1RWRA 1X0CA 4OJPA 1EE6A 4XOPA 2VJJA 2QY1A 3UW0A 4NK8A 2NT9A 4OZYA 1XG2A 4URRA 2O04A 4XN0A 2X3HA 2ODLA 2Z8GA 2X6YA 1BN8A 1JTAA 3B4NA 4W8QA 4OZZA 4PMHA 2INVA 1DBGA 4XLHA 1HG8A 4YELA 1O8FA 2O0WA 2X6XA 4MR0A 2X6WA 4W8RA 1GQ8A 4XN3A 3EQNA 4XL9A 3ZPPA 1CZFA 1OGMX 4YZXA 1O8KA 3GQ7A 4W8SA 3VSVA 3SUCA 4XM3A 4OJ6A 1JRGA 1VBLA 4I84A 4OJ5A 4XLAA 2PYHA 2NTQA 3WWGA 2O17A 4XOTA 1K5CA 3LMWA 4YZ0A 4XKVA 1DBOA 1O8EA 4XLCA 4XONA 5C1CA 2QX3A 1O88A 2PECA 1IDKA 3KRGA 4XR6A 2NT6A 2NSTA 1KCCA 1IA5A 1O8GA 1QJVA 4Z06A 4XORA 4XNFA 4AVZA 1QCXA 4YZAA 4XKWA 2IQ7A 3B8YA 1PE9A 4OJOA 1PLUA 5AMVA 2INUA 4XMYA 1AIRA 2NTPA 3FY3A 3VMVA 1PXZA 3JURA 1H80A 2NZMA 3B90A 4XQFA 1IDJA 1KCDA 2EWEA 1WMRA 4HWVA 4YEJA 1O8LA 1IB4A 2PYGA 3T9GA 3GQ9A 1O8MA 3VSTA
chains in the Genus database with same CATH superfamily
1OOCA 3SQVA 1OFMA 2VBKA 2NSPA 1BHEA 1RMGA 4YCQA 4Z03A 2VBMA 3PETA 1O8DA 2O1DA 1OFDA 4MXNA 3ZSCA 4YEIA 4EW9A 2UVEA 4C2LA 4OJLA 4XLEA 4YFOA 4W8TA 3VMWA 2UVFA 3GQ8A 1O8IA 1RU4A 1QA2A 4U4BA 3PSZA 2QXZA 4U49A 2BSPA 2X85A 3SZEA 1QRCA 4NK6A 2O0VA 1O8HA 5C1EA 3LYCA 1OGOX 2NTBA 1OFLA 2VJIA 1KTWA 3GRHA 2VBEA 1LLZA 1NHCA 5JLVC 4XLFA 4Z05A 3GQAA 3VSUA 1TYUA 1QA1A 1O8JA 3EQOA 4YZQA 2F3LA 2XTXA 1RWRA 1X0CA 4OJPA 3RIQA 1CLWA 1EE6A 2O6WA 4XOPA 1OFEA 1TYVA 2BM5A 2VJJA 2QY1A 3UW0A 4NK8A 2NT9A 1LLWA 4OZYA 2YUHA 1L1IA 1XG2A 3DU1X 2XTYA 4OPWA 4URRA 2O04A 4YDTA 4XN0A 2W7ZA 5DNSA 2X3HA 2ODLA 2Z8GA 2X6YA 1QQ1A 1BN8A 2V5IA 1JTAA 2XT2A 3SY2A 3B4NA 4W8QA 4OM9A 3TH0A 4OZZA 5JMCB 4PMHA 2J8KA 2INVA 1DBGA 3ML3A 2IOUG 2G0YA 4XLHA 1HG8A 2BX6A 3N6ZA 2VFQA 2XT4A 4YELA 1O8FA 2O0WA 2X6XA 4MR0A 2X6WA 3PSSA 4W8RA 1WXRA 1GQ8A 1TYWA 1TSPA 4XN3A 2XC1A 3EQNA 3NB2A 4XL9A 4V02C 1LM1A 1CZFA 1OGMX 4YZXA 3ZPPA 2VFMA 1O8KA 2QZAA 3GQ7A 4W8SA 3SUCA 3VSVA 4XM3A 4OJ6A 1KQ5A 1JRGA 1VBLA 4I84A 4OJ5A 4XLAA 2PYHA 1TYXA 2NTQA 3WWGA 2O17A 4XOTA 1K5CA 3LMWA 2BM6A 4YZ0A 4XKVA 3NAWA 1DBOA 1O8EA 4XLCA 4XONA 2BM4A 4YC5A 5C1CA 2QX3A 1O88A 2PECA 3H09A 1IDKA 3KRGA 4XR6A 2NT6A 2NSTA 1K8FA 1KCCA 3LJYA 1IA5A 1O8GA 1QJVA 4Z06A 4XORA 4XNFA 4AVZA 2QYUA 1QCXA 4YZAA 4XKWA 2IQ7A 1EA0A 3B8YA 1EZGA 1PE9A 4JRAC 2VFPA 4KH3A 4OJOA 1PLUA 1DABA 3JX8A 5AMVA 2INUA 4XMYA 1AIRA 2NTPA 3FY3A 1HF2A 1QRBA 3N90A 3VMVA 1PXZA 2B0RA 3P4GA 3JURA 1H80A 2NZMA 3B90A 3BH7B 1IDJA 4XQFA 1KCDA 2EWEA 1WMRA 2VFOA 4HWVA 4YEJA 1O8LA 2J8IA 3AK5A 1IB4A 2PYGA 3T9GA 2BM7A 1K4ZA 3BH6B 1O8MA 2XTWA 3GQ9A 2VFNA 3SYJA 1QA3A 3VSTA
chains in the Genus database with same CATH topology
1OOCA 1OFMA 2VBKA 2NSPA 1BHEA 1RMGA 4Z03A 2VBMA 1O8DA 2O1DA 3ZSCA 4MXNA 4EW9A 2UVEA 4C2LA 4OJLA 4XLEA 4W8TA 3VMWA 2UVFA 3GQ8A 1O8IA 1RU4A 4U4BA 2QXZA 4U49A 2BSPA 2X85A 4NK6A 2O0VA 1O8HA 5C1EA 1OGOX 2NTBA 1OFLA 2VJIA 1KTWA 3GRHA 2VBEA 1NHCA 4XLFA 4Z05A 3GQAA 3VSUA 1O8JA 3EQOA 4YZQA 1RWRA 1X0CA 4OJPA 1EE6A 4XOPA 2VJJA 2QY1A 3UW0A 4NK8A 2NT9A 4OZYA 1XG2A 4URRA 2O04A 4XN0A 2X3HA 2ODLA 2Z8GA 2X6YA 1BN8A 1JTAA 3B4NA 4W8QA 4OZZA 4PMHA 2INVA 1DBGA 4XLHA 1HG8A 4YELA 1O8FA 2O0WA 2X6XA 4MR0A 2X6WA 4W8RA 1GQ8A 4XN3A 3EQNA 4XL9A 3ZPPA 1CZFA 1OGMX 4YZXA 1O8KA 3GQ7A 4W8SA 3VSVA 3SUCA 4XM3A 4OJ6A 1JRGA 1VBLA 4I84A 4OJ5A 4XLAA 2PYHA 2NTQA 3WWGA 2O17A 4XOTA 1K5CA 3LMWA 4YZ0A 4XKVA 1DBOA 1O8EA 4XLCA 4XONA 5C1CA 2QX3A 1O88A 2PECA 1IDKA 3KRGA 4XR6A 2NT6A 2NSTA 1KCCA 1IA5A 1O8GA 1QJVA 4Z06A 4XORA 4XNFA 4AVZA 1QCXA 4YZAA 4XKWA 2IQ7A 3B8YA 1PE9A 4OJOA 1PLUA 5AMVA 2INUA 4XMYA 1AIRA 2NTPA 3FY3A 3VMVA 1PXZA 3JURA 1H80A 2NZMA 3B90A 4XQFA 1IDJA 1KCDA 2EWEA 1WMRA 4HWVA 4YEJA 1O8LA 1IB4A 2PYGA 3T9GA 3GQ9A 1O8MA 3VSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOC A;  1OFM A;  2VBK A;  2NSP A;  1BHE A;  1RMG A;  4Z03 A;  2VBM A;  1O8D A;  2O1D A;  3ZSC A;  4MXN A;  4EW9 A;  2UVE A;  4C2L A;  4OJL A;  4XLE A;  4W8T A;  3VMW A;  2UVF A;  3GQ8 A;  1O8I A;  1RU4 A;  4U4B A;  2QXZ A;  4U49 A;  2BSP A;  2X85 A;  4NK6 A;  2O0V A;  1O8H A;  5C1E A;  1OGO X;  2NTB A;  1OFL A;  2VJI A;  1KTW A;  3GRH A;  2VBE A;  1NHC A;  4XLF A;  4Z05 A;  3GQA A;  3VSU A;  1O8J A;  3EQO A;  4YZQ A;  1RWR A;  1X0C A;  4OJP A;  1EE6 A;  4XOP A;  2VJJ A;  2QY1 A;  3UW0 A;  4NK8 A;  2NT9 A;  4OZY A;  1XG2 A;  4URR A;  2O04 A;  4XN0 A;  2X3H A;  2ODL A;  2Z8G A;  2X6Y A;  1BN8 A;  1JTA A;  3B4N A;  4W8Q A;  4OZZ A;  4PMH A;  2INV A;  1DBG A;  4XLH A;  1HG8 A;  4YEL A;  1O8F A;  2O0W A;  2X6X A;  4MR0 A;  2X6W A;  4W8R A;  1GQ8 A;  4XN3 A;  3EQN A;  4XL9 A;  3ZPP A;  1CZF A;  1OGM X;  4YZX A;  1O8K A;  3GQ7 A;  4W8S A;  3VSV A;  3SUC A;  4XM3 A;  4OJ6 A;  1JRG A;  1VBL A;  4I84 A;  4OJ5 A;  4XLA A;  2PYH A;  2NTQ A;  3WWG A;  2O17 A;  4XOT A;  1K5C A;  3LMW A;  4YZ0 A;  4XKV A;  1DBO A;  1O8E A;  4XLC A;  4XON A;  5C1C A;  2QX3 A;  1O88 A;  2PEC A;  1IDK A;  3KRG A;  4XR6 A;  2NT6 A;  2NST A;  1KCC A;  1IA5 A;  1O8G A;  1QJV A;  4Z06 A;  4XOR A;  4XNF A;  4AVZ A;  1QCX A;  4YZA A;  4XKW A;  2IQ7 A;  3B8Y A;  1PE9 A;  4OJO A;  1PLU A;  5AMV A;  2INU A;  4XMY A;  1AIR A;  2NTP A;  3FY3 A;  3VMV A;  1PXZ A;  3JUR A;  1H80 A;  2NZM A;  3B90 A;  4XQF A;  1IDJ A;  1KCD A;  2EWE A;  1WMR A;  4HWV A;  4YEJ A;  1O8L A;  1IB4 A;  2PYG A;  3T9G A;  3GQ9 A;  1O8M A;  3VST A; 
#chains in the Genus database with same CATH topology
 1OOC A;  3SQV A;  1OFM A;  2VBK A;  2NSP A;  1BHE A;  1RMG A;  4YCQ A;  4Z03 A;  2VBM A;  3PET A;  1O8D A;  2O1D A;  1OFD A;  4MXN A;  3ZSC A;  4YEI A;  4EW9 A;  2UVE A;  4C2L A;  4OJL A;  4XLE A;  4YFO A;  4W8T A;  3VMW A;  2UVF A;  3GQ8 A;  1O8I A;  1RU4 A;  1QA2 A;  4U4B A;  3PSZ A;  2QXZ A;  4U49 A;  2BSP A;  2X85 A;  3SZE A;  1QRC A;  4NK6 A;  2O0V A;  1O8H A;  5C1E A;  3LYC A;  1OGO X;  2NTB A;  1OFL A;  2VJI A;  1KTW A;  3GRH A;  2VBE A;  1LLZ A;  1NHC A;  5JLV C;  4XLF A;  4Z05 A;  3GQA A;  3VSU A;  1TYU A;  1QA1 A;  1O8J A;  3EQO A;  4YZQ A;  2F3L A;  2XTX A;  1RWR A;  1X0C A;  4OJP A;  3RIQ A;  1CLW A;  1EE6 A;  2O6W A;  4XOP A;  1OFE A;  1TYV A;  2BM5 A;  2VJJ A;  2QY1 A;  3UW0 A;  4NK8 A;  2NT9 A;  1LLW A;  4OZY A;  2YUH A;  1L1I A;  1XG2 A;  3DU1 X;  2XTY A;  4OPW A;  4URR A;  2O04 A;  4YDT A;  4XN0 A;  2W7Z A;  5DNS A;  2X3H A;  2ODL A;  2Z8G A;  2X6Y A;  1QQ1 A;  1BN8 A;  2V5I A;  1JTA A;  2XT2 A;  3SY2 A;  3B4N A;  4W8Q A;  4OM9 A;  3TH0 A;  4OZZ A;  5JMC B;  4PMH A;  2J8K A;  2INV A;  1DBG A;  3ML3 A;  2IOU G;  2G0Y A;  4XLH A;  1HG8 A;  2BX6 A;  3N6Z A;  2VFQ A;  2XT4 A;  4YEL A;  1O8F A;  2O0W A;  2X6X A;  4MR0 A;  2X6W A;  3PSS A;  4W8R A;  1WXR A;  1GQ8 A;  1TYW A;  1TSP A;  4XN3 A;  2XC1 A;  3EQN A;  3NB2 A;  4XL9 A;  4V02 C;  1LM1 A;  1CZF A;  1OGM X;  4YZX A;  3ZPP A;  2VFM A;  1O8K A;  2QZA A;  3GQ7 A;  4W8S A;  3SUC A;  3VSV A;  4XM3 A;  4OJ6 A;  1KQ5 A;  1JRG A;  1VBL A;  4I84 A;  4OJ5 A;  4XLA A;  2PYH A;  1TYX A;  2NTQ A;  3WWG A;  2O17 A;  4XOT A;  1K5C A;  3LMW A;  2BM6 A;  4YZ0 A;  4XKV A;  3NAW A;  1DBO A;  1O8E A;  4XLC A;  4XON A;  2BM4 A;  4YC5 A;  5C1C A;  2QX3 A;  1O88 A;  2PEC A;  3H09 A;  1IDK A;  3KRG A;  4XR6 A;  2NT6 A;  2NST A;  1K8F A;  1KCC A;  3LJY A;  1IA5 A;  1O8G A;  1QJV A;  4Z06 A;  4XOR A;  4XNF A;  4AVZ A;  2QYU A;  1QCX A;  4YZA A;  4XKW A;  2IQ7 A;  1EA0 A;  3B8Y A;  1EZG A;  1PE9 A;  4JRA C;  2VFP A;  4KH3 A;  4OJO A;  1PLU A;  1DAB A;  3JX8 A;  5AMV A;  2INU A;  4XMY A;  1AIR A;  2NTP A;  3FY3 A;  1HF2 A;  1QRB A;  3N90 A;  3VMV A;  1PXZ A;  2B0R A;  3P4G A;  3JUR A;  1H80 A;  2NZM A;  3B90 A;  3BH7 B;  1IDJ A;  4XQF A;  1KCD A;  2EWE A;  1WMR A;  2VFO A;  4HWV A;  4YEJ A;  1O8L A;  2J8I A;  3AK5 A;  1IB4 A;  2PYG A;  3T9G A;  2BM7 A;  1K4Z A;  3BH6 B;  1O8M A;  2XTW A;  3GQ9 A;  2VFN A;  3SYJ A;  1QA3 A;  3VST A; 
#chains in the Genus database with same CATH homology
 1OOC A;  1OFM A;  2VBK A;  2NSP A;  1BHE A;  1RMG A;  4Z03 A;  2VBM A;  1O8D A;  2O1D A;  3ZSC A;  4MXN A;  4EW9 A;  2UVE A;  4C2L A;  4OJL A;  4XLE A;  4W8T A;  3VMW A;  2UVF A;  3GQ8 A;  1O8I A;  1RU4 A;  4U4B A;  2QXZ A;  4U49 A;  2BSP A;  2X85 A;  4NK6 A;  2O0V A;  1O8H A;  5C1E A;  1OGO X;  2NTB A;  1OFL A;  2VJI A;  1KTW A;  3GRH A;  2VBE A;  1NHC A;  4XLF A;  4Z05 A;  3GQA A;  3VSU A;  1O8J A;  3EQO A;  4YZQ A;  1RWR A;  1X0C A;  4OJP A;  1EE6 A;  4XOP A;  2VJJ A;  2QY1 A;  3UW0 A;  4NK8 A;  2NT9 A;  4OZY A;  1XG2 A;  4URR A;  2O04 A;  4XN0 A;  2X3H A;  2ODL A;  2Z8G A;  2X6Y A;  1BN8 A;  1JTA A;  3B4N A;  4W8Q A;  4OZZ A;  4PMH A;  2INV A;  1DBG A;  4XLH A;  1HG8 A;  4YEL A;  1O8F A;  2O0W A;  2X6X A;  4MR0 A;  2X6W A;  4W8R A;  1GQ8 A;  4XN3 A;  3EQN A;  4XL9 A;  3ZPP A;  1CZF A;  1OGM X;  4YZX A;  1O8K A;  3GQ7 A;  4W8S A;  3VSV A;  3SUC A;  4XM3 A;  4OJ6 A;  1JRG A;  1VBL A;  4I84 A;  4OJ5 A;  4XLA A;  2PYH A;  2NTQ A;  3WWG A;  2O17 A;  4XOT A;  1K5C A;  3LMW A;  4YZ0 A;  4XKV A;  1DBO A;  1O8E A;  4XLC A;  4XON A;  5C1C A;  2QX3 A;  1O88 A;  2PEC A;  1IDK A;  3KRG A;  4XR6 A;  2NT6 A;  2NST A;  1KCC A;  1IA5 A;  1O8G A;  1QJV A;  4Z06 A;  4XOR A;  4XNF A;  4AVZ A;  1QCX A;  4YZA A;  4XKW A;  2IQ7 A;  3B8Y A;  1PE9 A;  4OJO A;  1PLU A;  5AMV A;  2INU A;  4XMY A;  1AIR A;  2NTP A;  3FY3 A;  3VMV A;  1PXZ A;  3JUR A;  1H80 A;  2NZM A;  3B90 A;  4XQF A;  1IDJ A;  1KCD A;  2EWE A;  1WMR A;  4HWV A;  4YEJ A;  1O8L A;  1IB4 A;  2PYG A;  3T9G A;  3GQ9 A;  1O8M A;  3VST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...