2NT9A

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide iv
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
342
structure length
342
Chain Sequence
ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 127
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nt9A00
2O17A 1HG8A 1O8DA 1JRGA 2X3HA 4OZZA 4XM3A 4XORA 2X6YA 3LMWA 2PECA 3VSUA 4OJOA 3VSTA 4OJ6A 4U49A 4OJLA 4W8SA 2ODLA 2INUA 3SUCA 2INVA 4YELA 2NSTA 1O8FA 2VJIA 4MXNA 4XNFA 3FY3A 1IB4A 4YZAA 3VMVA 1OGOX 4YZ0A 1O8GA 1PXZA 1H80A 3B8YA 1O8KA 4XLEA 3GQ9A 1RU4A 1AIRA 1KCDA 4W8TA 1RMGA 1XG2A 4XOPA 4XL9A 1OFLA 3GQ7A 3EQOA 4AVZA 3GQ8A 1JTAA 4OZYA 2O1DA 4I84A 2IQ7A 1KTWA 2O0VA 4XLCA 1BN8A 4U4BA 4Z03A 4XMYA 5AMVA 1O88A 4NK8A 1KCCA 2BSPA 1QJVA 2UVEA 1DBOA 1CZFA 1PLUA 1O8IA 4Z05A 4YEJA 1BHEA 4HWVA 4XQFA 1EE6A 3GRHA 1PE9A 2QXZA 3ZSCA 2QY1A 1O8MA 3B4NA 3UW0A 4XLFA 2UVFA 4MR0A 1OGMX 2VBMA 2Z8GA 3T9GA 1RWRA 2VBKA 1GQ8A 4XN3A 3VMWA 2NSPA 3WWGA 2X85A 3ZPPA 2O0WA 1OFMA 2X6XA 1WMRA 1K5CA 2X6WA 5C1EA 1O8HA 2VJJA 4XKWA 5C1CA 1QCXA 2O04A 2NTBA 1DBGA 1NHCA 3EQNA 4XN0A 4XR6A 2NT6A 3VSVA 4C2LA 4XLAA 2NTQA 3KRGA 4XOTA 1IA5A 1O8JA 4YZQA 4XONA 4PMHA 2NT9A 1OOCA 4XKVA 4XLHA 4EW9A 4OJ5A 1IDJA 3B90A 2EWEA 2NTPA 2PYGA 4YZXA 1X0CA 4W8RA 1IDKA 2NZMA 1O8EA 4W8QA 3GQAA 1O8LA 1VBLA 2PYHA 4Z06A 4OJPA 4URRA 2VBEA 4NK6A 3JURA 2QX3A
chains in the Genus database with same CATH superfamily
2O17A 1HG8A 1O8DA 1TSPA 1JRGA 2YUHA 2X3HA 4OZZA 4XM3A 4XORA 2X6YA 3LMWA 2PECA 3VSUA 1L1IA 1QA1A 4OJOA 3VSTA 4KH3A 4OJ6A 3LJYA 4U49A 4OJLA 4W8SA 2BM6A 2QZAA 2ODLA 2INUA 3SUCA 3TH0A 1OFEA 2J8KA 4OM9A 3PSSA 1LM1A 2VFOA 2INVA 4YELA 3BH7B 2NSTA 1O8FA 2J8IA 2V5IA 1OFDA 2VJIA 4MXNA 4XNFA 2VFNA 3FY3A 1IB4A 4YZAA 2B0RA 3VMVA 1OGOX 2QYUA 4YZ0A 1LLZA 3H09A 1O8GA 1PXZA 1QRBA 3PETA 1H80A 4JRAC 3B8YA 1O8KA 4XLEA 1EZGA 3GQ9A 1RU4A 1AIRA 1TYWA 1TYUA 3BH6B 1KCDA 4W8TA 4YCQA 1RMGA 1XG2A 4XOPA 4XL9A 1OFLA 3GQ7A 4YC5A 1QRCA 3EQOA 4YFOA 5DNSA 1KQ5A 3GQ8A 1JTAA 4OZYA 3SYJA 2O1DA 4I84A 3SQVA 4AVZA 1WXRA 2IQ7A 1KTWA 2O0VA 4XLCA 2VFMA 1BN8A 2XTXA 4U4BA 4Z03A 4XMYA 5AMVA 1TYVA 3ML3A 3SZEA 5JLVC 4YEIA 1O88A 1DABA 4NK8A 1KCCA 2BSPA 1QJVA 2UVEA 2XTWA 1DBOA 1CZFA 1PLUA 1O8IA 4Z05A 1LLWA 2XC1A 4YEJA 1BHEA 2W7ZA 4HWVA 5JMCB 4XQFA 1EE6A 2VFQA 1PE9A 2QXZA 3GRHA 3ZSCA 4OPWA 2QY1A 1O8MA 3B4NA 3NB2A 3NAWA 3UW0A 4XLFA 2UVFA 4MR0A 3DU1X 1OGMX 1HF2A 2VBMA 2Z8GA 3T9GA 1RWRA 2VBKA 1K4ZA 1GQ8A 4XN3A 3VMWA 2BM4A 2VFPA 2NSPA 3WWGA 2X85A 3ZPPA 3AK5A 2O0WA 1OFMA 1QQ1A 2X6XA 1K8FA 1WMRA 1K5CA 2X6WA 2XT4A 1O8HA 5C1EA 2VJJA 4XKWA 5C1CA 1QCXA 2O04A 2NTBA 1DBGA 2XTYA 3P4GA 3PSZA 1NHCA 3EQNA 4XN0A 4XR6A 2NT6A 3VSVA 4V02C 4C2LA 4XLAA 1QA2A 2NTQA 3KRGA 4XOTA 1IA5A 3N6ZA 2G0YA 1O8JA 2BX6A 4XONA 4YZQA 4PMHA 3RIQA 2F3LA 2NT9A 1OOCA 2BM5A 4XKVA 4XLHA 4EW9A 4OJ5A 1IDJA 3B90A 2EWEA 3LYCA 2NTPA 2PYGA 3JX8A 4YZXA 1X0CA 4W8RA 1IDKA 2BM7A 1TYXA 2NZMA 1O8EA 4W8QA 4YDTA 3GQAA 1QA3A 1O8LA 1VBLA 2PYHA 4Z06A 1EA0A 2O6WA 4OJPA 2XT2A 3N90A 4URRA 2VBEA 3SY2A 2IOUG 4NK6A 3JURA 2QX3A 1CLWA
chains in the Genus database with same CATH topology
2O17A 1HG8A 1O8DA 1JRGA 2X3HA 4OZZA 4XM3A 4XORA 2X6YA 3LMWA 2PECA 3VSUA 4OJOA 3VSTA 4OJ6A 4U49A 4OJLA 4W8SA 2ODLA 2INUA 3SUCA 2INVA 4YELA 2NSTA 1O8FA 2VJIA 4MXNA 4XNFA 3FY3A 1IB4A 4YZAA 3VMVA 1OGOX 4YZ0A 1O8GA 1PXZA 1H80A 3B8YA 1O8KA 4XLEA 3GQ9A 1RU4A 1AIRA 1KCDA 4W8TA 1RMGA 1XG2A 4XOPA 4XL9A 1OFLA 3GQ7A 3EQOA 4AVZA 3GQ8A 1JTAA 4OZYA 2O1DA 4I84A 2IQ7A 1KTWA 2O0VA 4XLCA 1BN8A 4U4BA 4Z03A 4XMYA 5AMVA 1O88A 4NK8A 1KCCA 2BSPA 1QJVA 2UVEA 1DBOA 1CZFA 1PLUA 1O8IA 4Z05A 4YEJA 1BHEA 4HWVA 4XQFA 1EE6A 3GRHA 1PE9A 2QXZA 3ZSCA 2QY1A 1O8MA 3B4NA 3UW0A 4XLFA 2UVFA 4MR0A 1OGMX 2VBMA 2Z8GA 3T9GA 1RWRA 2VBKA 1GQ8A 4XN3A 3VMWA 2NSPA 3WWGA 2X85A 3ZPPA 2O0WA 1OFMA 2X6XA 1WMRA 1K5CA 2X6WA 5C1EA 1O8HA 2VJJA 4XKWA 5C1CA 1QCXA 2O04A 2NTBA 1DBGA 1NHCA 3EQNA 4XN0A 4XR6A 2NT6A 3VSVA 4C2LA 4XLAA 2NTQA 3KRGA 4XOTA 1IA5A 1O8JA 4YZQA 4XONA 4PMHA 2NT9A 1OOCA 4XKVA 4XLHA 4EW9A 4OJ5A 1IDJA 3B90A 2EWEA 2NTPA 2PYGA 4YZXA 1X0CA 4W8RA 1IDKA 2NZMA 1O8EA 4W8QA 3GQAA 1O8LA 1VBLA 2PYHA 4Z06A 4OJPA 4URRA 2VBEA 4NK6A 3JURA 2QX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O17 A;  1HG8 A;  1O8D A;  1JRG A;  2X3H A;  4OZZ A;  4XM3 A;  4XOR A;  2X6Y A;  3LMW A;  2PEC A;  3VSU A;  4OJO A;  3VST A;  4OJ6 A;  4U49 A;  4OJL A;  4W8S A;  2ODL A;  2INU A;  3SUC A;  2INV A;  4YEL A;  2NST A;  1O8F A;  2VJI A;  4MXN A;  4XNF A;  3FY3 A;  1IB4 A;  4YZA A;  3VMV A;  1OGO X;  4YZ0 A;  1O8G A;  1PXZ A;  1H80 A;  3B8Y A;  1O8K A;  4XLE A;  3GQ9 A;  1RU4 A;  1AIR A;  1KCD A;  4W8T A;  1RMG A;  1XG2 A;  4XOP A;  4XL9 A;  1OFL A;  3GQ7 A;  3EQO A;  4AVZ A;  3GQ8 A;  1JTA A;  4OZY A;  2O1D A;  4I84 A;  2IQ7 A;  1KTW A;  2O0V A;  4XLC A;  1BN8 A;  4U4B A;  4Z03 A;  4XMY A;  5AMV A;  1O88 A;  4NK8 A;  1KCC A;  2BSP A;  1QJV A;  2UVE A;  1DBO A;  1CZF A;  1PLU A;  1O8I A;  4Z05 A;  4YEJ A;  1BHE A;  4HWV A;  4XQF A;  1EE6 A;  3GRH A;  1PE9 A;  2QXZ A;  3ZSC A;  2QY1 A;  1O8M A;  3B4N A;  3UW0 A;  4XLF A;  2UVF A;  4MR0 A;  1OGM X;  2VBM A;  2Z8G A;  3T9G A;  1RWR A;  2VBK A;  1GQ8 A;  4XN3 A;  3VMW A;  2NSP A;  3WWG A;  2X85 A;  3ZPP A;  2O0W A;  1OFM A;  2X6X A;  1WMR A;  1K5C A;  2X6W A;  5C1E A;  1O8H A;  2VJJ A;  4XKW A;  5C1C A;  1QCX A;  2O04 A;  2NTB A;  1DBG A;  1NHC A;  3EQN A;  4XN0 A;  4XR6 A;  2NT6 A;  3VSV A;  4C2L A;  4XLA A;  2NTQ A;  3KRG A;  4XOT A;  1IA5 A;  1O8J A;  4YZQ A;  4XON A;  4PMH A;  2NT9 A;  1OOC A;  4XKV A;  4XLH A;  4EW9 A;  4OJ5 A;  1IDJ A;  3B90 A;  2EWE A;  2NTP A;  2PYG A;  4YZX A;  1X0C A;  4W8R A;  1IDK A;  2NZM A;  1O8E A;  4W8Q A;  3GQA A;  1O8L A;  1VBL A;  2PYH A;  4Z06 A;  4OJP A;  4URR A;  2VBE A;  4NK6 A;  3JUR A;  2QX3 A; 
#chains in the Genus database with same CATH topology
 2O17 A;  1HG8 A;  1O8D A;  1TSP A;  1JRG A;  2YUH A;  2X3H A;  4OZZ A;  4XM3 A;  4XOR A;  2X6Y A;  3LMW A;  2PEC A;  3VSU A;  1L1I A;  1QA1 A;  4OJO A;  3VST A;  4KH3 A;  4OJ6 A;  3LJY A;  4U49 A;  4OJL A;  4W8S A;  2BM6 A;  2QZA A;  2ODL A;  2INU A;  3SUC A;  3TH0 A;  1OFE A;  2J8K A;  4OM9 A;  3PSS A;  1LM1 A;  2VFO A;  2INV A;  4YEL A;  3BH7 B;  2NST A;  1O8F A;  2J8I A;  2V5I A;  1OFD A;  2VJI A;  4MXN A;  4XNF A;  2VFN A;  3FY3 A;  1IB4 A;  4YZA A;  2B0R A;  3VMV A;  1OGO X;  2QYU A;  4YZ0 A;  1LLZ A;  3H09 A;  1O8G A;  1PXZ A;  1QRB A;  3PET A;  1H80 A;  4JRA C;  3B8Y A;  1O8K A;  4XLE A;  1EZG A;  3GQ9 A;  1RU4 A;  1AIR A;  1TYW A;  1TYU A;  3BH6 B;  1KCD A;  4W8T A;  4YCQ A;  1RMG A;  1XG2 A;  4XOP A;  4XL9 A;  1OFL A;  3GQ7 A;  4YC5 A;  1QRC A;  3EQO A;  4YFO A;  5DNS A;  1KQ5 A;  3GQ8 A;  1JTA A;  4OZY A;  3SYJ A;  2O1D A;  4I84 A;  3SQV A;  4AVZ A;  1WXR A;  2IQ7 A;  1KTW A;  2O0V A;  4XLC A;  2VFM A;  1BN8 A;  2XTX A;  4U4B A;  4Z03 A;  4XMY A;  5AMV A;  1TYV A;  3ML3 A;  3SZE A;  5JLV C;  4YEI A;  1O88 A;  1DAB A;  4NK8 A;  1KCC A;  2BSP A;  1QJV A;  2UVE A;  2XTW A;  1DBO A;  1CZF A;  1PLU A;  1O8I A;  4Z05 A;  1LLW A;  2XC1 A;  4YEJ A;  1BHE A;  2W7Z A;  4HWV A;  5JMC B;  4XQF A;  1EE6 A;  2VFQ A;  1PE9 A;  2QXZ A;  3GRH A;  3ZSC A;  4OPW A;  2QY1 A;  1O8M A;  3B4N A;  3NB2 A;  3NAW A;  3UW0 A;  4XLF A;  2UVF A;  4MR0 A;  3DU1 X;  1OGM X;  1HF2 A;  2VBM A;  2Z8G A;  3T9G A;  1RWR A;  2VBK A;  1K4Z A;  1GQ8 A;  4XN3 A;  3VMW A;  2BM4 A;  2VFP A;  2NSP A;  3WWG A;  2X85 A;  3ZPP A;  3AK5 A;  2O0W A;  1OFM A;  1QQ1 A;  2X6X A;  1K8F A;  1WMR A;  1K5C A;  2X6W A;  2XT4 A;  1O8H A;  5C1E A;  2VJJ A;  4XKW A;  5C1C A;  1QCX A;  2O04 A;  2NTB A;  1DBG A;  2XTY A;  3P4G A;  3PSZ A;  1NHC A;  3EQN A;  4XN0 A;  4XR6 A;  2NT6 A;  3VSV A;  4V02 C;  4C2L A;  4XLA A;  1QA2 A;  2NTQ A;  3KRG A;  4XOT A;  1IA5 A;  3N6Z A;  2G0Y A;  1O8J A;  2BX6 A;  4XON A;  4YZQ A;  4PMH A;  3RIQ A;  2F3L A;  2NT9 A;  1OOC A;  2BM5 A;  4XKV A;  4XLH A;  4EW9 A;  4OJ5 A;  1IDJ A;  3B90 A;  2EWE A;  3LYC A;  2NTP A;  2PYG A;  3JX8 A;  4YZX A;  1X0C A;  4W8R A;  1IDK A;  2BM7 A;  1TYX A;  2NZM A;  1O8E A;  4W8Q A;  4YDT A;  3GQA A;  1QA3 A;  1O8L A;  1VBL A;  2PYH A;  4Z06 A;  1EA0 A;  2O6W A;  4OJP A;  2XT2 A;  3N90 A;  4URR A;  2VBE A;  3SY2 A;  2IOU G;  4NK6 A;  3JUR A;  2QX3 A;  1CLW A; 
#chains in the Genus database with same CATH homology
 2O17 A;  1HG8 A;  1O8D A;  1JRG A;  2X3H A;  4OZZ A;  4XM3 A;  4XOR A;  2X6Y A;  3LMW A;  2PEC A;  3VSU A;  4OJO A;  3VST A;  4OJ6 A;  4U49 A;  4OJL A;  4W8S A;  2ODL A;  2INU A;  3SUC A;  2INV A;  4YEL A;  2NST A;  1O8F A;  2VJI A;  4MXN A;  4XNF A;  3FY3 A;  1IB4 A;  4YZA A;  3VMV A;  1OGO X;  4YZ0 A;  1O8G A;  1PXZ A;  1H80 A;  3B8Y A;  1O8K A;  4XLE A;  3GQ9 A;  1RU4 A;  1AIR A;  1KCD A;  4W8T A;  1RMG A;  1XG2 A;  4XOP A;  4XL9 A;  1OFL A;  3GQ7 A;  3EQO A;  4AVZ A;  3GQ8 A;  1JTA A;  4OZY A;  2O1D A;  4I84 A;  2IQ7 A;  1KTW A;  2O0V A;  4XLC A;  1BN8 A;  4U4B A;  4Z03 A;  4XMY A;  5AMV A;  1O88 A;  4NK8 A;  1KCC A;  2BSP A;  1QJV A;  2UVE A;  1DBO A;  1CZF A;  1PLU A;  1O8I A;  4Z05 A;  4YEJ A;  1BHE A;  4HWV A;  4XQF A;  1EE6 A;  3GRH A;  1PE9 A;  2QXZ A;  3ZSC A;  2QY1 A;  1O8M A;  3B4N A;  3UW0 A;  4XLF A;  2UVF A;  4MR0 A;  1OGM X;  2VBM A;  2Z8G A;  3T9G A;  1RWR A;  2VBK A;  1GQ8 A;  4XN3 A;  3VMW A;  2NSP A;  3WWG A;  2X85 A;  3ZPP A;  2O0W A;  1OFM A;  2X6X A;  1WMR A;  1K5C A;  2X6W A;  5C1E A;  1O8H A;  2VJJ A;  4XKW A;  5C1C A;  1QCX A;  2O04 A;  2NTB A;  1DBG A;  1NHC A;  3EQN A;  4XN0 A;  4XR6 A;  2NT6 A;  3VSV A;  4C2L A;  4XLA A;  2NTQ A;  3KRG A;  4XOT A;  1IA5 A;  1O8J A;  4YZQ A;  4XON A;  4PMH A;  2NT9 A;  1OOC A;  4XKV A;  4XLH A;  4EW9 A;  4OJ5 A;  1IDJ A;  3B90 A;  2EWE A;  2NTP A;  2PYG A;  4YZX A;  1X0C A;  4W8R A;  1IDK A;  2NZM A;  1O8E A;  4W8Q A;  3GQA A;  1O8L A;  1VBL A;  2PYH A;  4Z06 A;  4OJP A;  4URR A;  2VBE A;  4NK6 A;  3JUR A;  2QX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...