2NT9A

Crystal structure of pectin methylesterase d178a mutant in complex with hexasaccharide iv
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
342
structure length
342
Chain Sequence
b'ATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFVILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAKDFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQATLYVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQKYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIYGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGDWTPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectinesterase A
publication title Molecular basis of the activity of the phytopathogen pectin methylesterase.
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 127
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.11: Pectinesterase.
pdb deposition date 2006-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01095 Pectinesterase Pectinesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2nt9A00
2PYGA 4Z06A 4XLEA 1BHEA 1PXZA 4W8TA 1BN8A 1O8KA 4XKWA 3VSUA 1NHCA 1H80A 1OGOX 4XOPA 1JRGA 4NK8A 4YELA 2IQ7A 4W8RA 3VMVA 4XN0A 4W8SA 4YEJA 2NTPA 4Z03A 4OZYA 1O8JA 2O0VA 1KCCA 4XM3A 4XR6A 4W8QA 5C1EA 4XQFA 3JURA 1O8EA 3KRGA 1O8LA 4OJOA 1OFLA 2X85A 1AIRA 4Z05A 2NTBA 4U4BA 2BSPA 3WWGA 2X6YA 3GQ8A 4XN3A 4YZ0A 1VBLA 2VJIA 2VBEA 2NZMA 2NSPA 1O88A 2PECA 2X3HA 1O8FA 1IA5A 1QJVA 3VSVA 1IDKA 1XG2A 4OJPA 1QCXA 2NT9A 4OJ6A 2QX3A 1OOCA 1O8HA 1CZFA 3FY3A 2O0WA 4C2LA 3UW0A 2QY1A 1IDJA 3LMWA 2QXZA 2O1DA 3GQAA 4XLAA 4I84A 1OFMA 4YZQA 2UVEA 2INVA 1O8DA 2VBKA 1O8GA 2INUA 1O8IA 2O04A 1RWRA 1JTAA 4XLHA 1WMRA 1K5CA 2EWEA 3T9GA 2ODLA 4EW9A 4PMHA 3ZPPA 1PE9A 2X6WA 3EQOA 1PLUA 3VMWA 4XKVA 3B4NA 4XORA 4OJ5A 4OZZA 2X6XA 1GQ8A 1RU4A 3EQNA 4URRA 2NTQA 3SUCA 4MXNA 2PYHA 4XL9A 2UVFA 3GRHA 5AMVA 4NK6A 3GQ7A 1O8MA 4MR0A 1DBOA 5C1CA 1RMGA 1KTWA 4XNFA 1EE6A 1OGMX 2NSTA 4XMYA 3B8YA 2Z8GA 3VSTA 1IB4A 4OJLA 3B90A 2O17A 4YZAA 4XONA 1DBGA 2NT6A 4XLCA 2VJJA 4HWVA 1KCDA 4XLFA 4AVZA 1X0CA 3GQ9A 1HG8A 3ZSCA 2VBMA 4YZXA 4U49A 4XOTA
chains in the Genus database with same CATH superfamily
2PYGA 4Z06A 1QRBA 2B0RA 4XLEA 1BHEA 1PXZA 3LYCA 1K4ZA 2XTYA 4W8TA 4V02C 1BN8A 1O8KA 3SQVA 4XKWA 3VSUA 1NHCA 1H80A 1OGOX 4XOPA 1JRGA 3H09A 4NK8A 3LJYA 1OFDA 4YELA 4KH3A 2IQ7A 4W8RA 5JMCB 1DABA 1TYXA 3VMVA 3RIQA 2YUHA 2XT2A 4W8SA 1EZGA 4XN0A 4YEJA 2NTPA 4Z03A 4OZYA 4YCQA 3SY2A 1O8JA 2G0YA 2BX6A 2O0VA 3PSZA 1K8FA 1KCCA 4XM3A 4XR6A 2BM4A 4W8QA 4YDTA 5C1EA 4XQFA 3JURA 1O8EA 1LLWA 3KRGA 2IOUG 1O8LA 4OJOA 1KQ5A 1OFLA 2J8KA 2X85A 1TYUA 1AIRA 4Z05A 2NTBA 4U4BA 1TSPA 2BSPA 3WWGA 2VFPA 2X6YA 1TYVA 3GQ8A 4XN3A 4YEIA 1VBLA 4U49A 4YZ0A 2VJIA 1QA2A 1QA3A 2VBEA 1QA1A 2NZMA 2F3LA 1O88A 2NSPA 2PECA 1O8FA 2X3HA 1IA5A 1QJVA 3VSVA 1IDKA 1XG2A 4XNFA 3SYJA 4OJPA 1QCXA 2NT9A 4OJ6A 2QX3A 1OOCA 2V5IA 2QYUA 1O8HA 3N90A 1CZFA 2XTXA 3FY3A 2O0WA 4C2LA 3UW0A 2QY1A 1IDJA 3LMWA 3PETA 2QXZA 2O1DA 1CLWA 2BM6A 3GQAA 4I84A 1OFMA 4XLAA 4YZQA 5DNSA 2UVEA 2INVA 2XTWA 2BM7A 1O8DA 2VBKA 1O8GA 2INUA 4YC5A 1L1IA 1O8IA 2O04A 1RWRA 1JTAA 3BH7B 2VFOA 4XOTA 4XLHA 4OPWA 1WMRA 1QRCA 1K5CA 2EWEA 3PSSA 2XC1A 3T9GA 2ODLA 2VFNA 4EW9A 4PMHA 3BH6B 3P4GA 1EA0A 2BM5A 3ZPPA 1WXRA 1PE9A 2X6WA 3EQOA 1PLUA 3VMWA 2QZAA 2O6WA 4XKVA 3B4NA 4XORA 4OJ5A 4OZZA 2X6XA 1GQ8A 1RU4A 3EQNA 4URRA 2NTQA 3SUCA 4MXNA 4OM9A 2PYHA 1HF2A 4XL9A 2UVFA 2VFQA 3GRHA 5AMVA 4NK6A 2XT4A 3GQ7A 1TYWA 1O8MA 4MR0A 1DBOA 1QQ1A 1LM1A 5C1CA 1RMGA 1KTWA 4JRAC 1EE6A 3ML3A 1OGMX 2NSTA 3DU1X 1OFEA 3B8YA 2Z8GA 2J8IA 3N6ZA 4XMYA 3SZEA 3VSTA 5JLVC 1IB4A 3NAWA 4OJLA 1LLZA 3B90A 3JX8A 3TH0A 2O17A 2VFMA 4YZAA 4XONA 1DBGA 2NT6A 4XLCA 4YFOA 2VJJA 4HWVA 1KCDA 4XLFA 4AVZA 1X0CA 3GQ9A 1HG8A 3ZSCA 2VBMA 4YZXA 3AK5A 3NB2A 2W7ZA
chains in the Genus database with same CATH topology
2PYGA 4Z06A 4XLEA 1BHEA 1PXZA 4W8TA 1BN8A 1O8KA 4XKWA 3VSUA 1NHCA 1H80A 1OGOX 4XOPA 1JRGA 4NK8A 4YELA 2IQ7A 4W8RA 3VMVA 4XN0A 4W8SA 4YEJA 2NTPA 4Z03A 4OZYA 1O8JA 2O0VA 1KCCA 4XM3A 4XR6A 4W8QA 5C1EA 4XQFA 3JURA 1O8EA 3KRGA 1O8LA 4OJOA 1OFLA 2X85A 1AIRA 4Z05A 2NTBA 4U4BA 2BSPA 3WWGA 2X6YA 3GQ8A 4XN3A 4YZ0A 1VBLA 2VJIA 2VBEA 2NZMA 2NSPA 1O88A 2PECA 2X3HA 1O8FA 1IA5A 1QJVA 3VSVA 1IDKA 1XG2A 4OJPA 1QCXA 2NT9A 4OJ6A 2QX3A 1OOCA 1O8HA 1CZFA 3FY3A 2O0WA 4C2LA 3UW0A 2QY1A 1IDJA 3LMWA 2QXZA 2O1DA 3GQAA 4XLAA 4I84A 1OFMA 4YZQA 2UVEA 2INVA 1O8DA 2VBKA 1O8GA 2INUA 1O8IA 2O04A 1RWRA 1JTAA 4XLHA 1WMRA 1K5CA 2EWEA 3T9GA 2ODLA 4EW9A 4PMHA 3ZPPA 1PE9A 2X6WA 3EQOA 1PLUA 3VMWA 4XKVA 3B4NA 4XORA 4OJ5A 4OZZA 2X6XA 1GQ8A 1RU4A 3EQNA 4URRA 2NTQA 3SUCA 4MXNA 2PYHA 4XL9A 2UVFA 3GRHA 5AMVA 4NK6A 3GQ7A 1O8MA 4MR0A 1DBOA 5C1CA 1RMGA 1KTWA 4XNFA 1EE6A 1OGMX 2NSTA 4XMYA 3B8YA 2Z8GA 3VSTA 1IB4A 4OJLA 3B90A 2O17A 4YZAA 4XONA 1DBGA 2NT6A 4XLCA 2VJJA 4HWVA 1KCDA 4XLFA 4AVZA 1X0CA 3GQ9A 1HG8A 3ZSCA 2VBMA 4YZXA 4U49A 4XOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYG A;  4Z06 A;  4XLE A;  1BHE A;  1PXZ A;  4W8T A;  1BN8 A;  1O8K A;  4XKW A;  3VSU A;  1NHC A;  1H80 A;  1OGO X;  4XOP A;  1JRG A;  4NK8 A;  4YEL A;  2IQ7 A;  4W8R A;  3VMV A;  4XN0 A;  4W8S A;  4YEJ A;  2NTP A;  4Z03 A;  4OZY A;  1O8J A;  2O0V A;  1KCC A;  4XM3 A;  4XR6 A;  4W8Q A;  5C1E A;  4XQF A;  3JUR A;  1O8E A;  3KRG A;  1O8L A;  4OJO A;  1OFL A;  2X85 A;  1AIR A;  4Z05 A;  2NTB A;  4U4B A;  2BSP A;  3WWG A;  2X6Y A;  3GQ8 A;  4XN3 A;  4YZ0 A;  1VBL A;  2VJI A;  2VBE A;  2NZM A;  2NSP A;  1O88 A;  2PEC A;  2X3H A;  1O8F A;  1IA5 A;  1QJV A;  3VSV A;  1IDK A;  1XG2 A;  4OJP A;  1QCX A;  2NT9 A;  4OJ6 A;  2QX3 A;  1OOC A;  1O8H A;  1CZF A;  3FY3 A;  2O0W A;  4C2L A;  3UW0 A;  2QY1 A;  1IDJ A;  3LMW A;  2QXZ A;  2O1D A;  3GQA A;  4XLA A;  4I84 A;  1OFM A;  4YZQ A;  2UVE A;  2INV A;  1O8D A;  2VBK A;  1O8G A;  2INU A;  1O8I A;  2O04 A;  1RWR A;  1JTA A;  4XLH A;  1WMR A;  1K5C A;  2EWE A;  3T9G A;  2ODL A;  4EW9 A;  4PMH A;  3ZPP A;  1PE9 A;  2X6W A;  3EQO A;  1PLU A;  3VMW A;  4XKV A;  3B4N A;  4XOR A;  4OJ5 A;  4OZZ A;  2X6X A;  1GQ8 A;  1RU4 A;  3EQN A;  4URR A;  2NTQ A;  3SUC A;  4MXN A;  2PYH A;  4XL9 A;  2UVF A;  3GRH A;  5AMV A;  4NK6 A;  3GQ7 A;  1O8M A;  4MR0 A;  1DBO A;  5C1C A;  1RMG A;  1KTW A;  4XNF A;  1EE6 A;  1OGM X;  2NST A;  4XMY A;  3B8Y A;  2Z8G A;  3VST A;  1IB4 A;  4OJL A;  3B90 A;  2O17 A;  4YZA A;  4XON A;  1DBG A;  2NT6 A;  4XLC A;  2VJJ A;  4HWV A;  1KCD A;  4XLF A;  4AVZ A;  1X0C A;  3GQ9 A;  1HG8 A;  3ZSC A;  2VBM A;  4YZX A;  4U49 A;  4XOT A; 
#chains in the Genus database with same CATH topology
 2PYG A;  4Z06 A;  1QRB A;  2B0R A;  4XLE A;  1BHE A;  1PXZ A;  3LYC A;  1K4Z A;  2XTY A;  4W8T A;  4V02 C;  1BN8 A;  1O8K A;  3SQV A;  4XKW A;  3VSU A;  1NHC A;  1H80 A;  1OGO X;  4XOP A;  1JRG A;  3H09 A;  4NK8 A;  3LJY A;  1OFD A;  4YEL A;  4KH3 A;  2IQ7 A;  4W8R A;  5JMC B;  1DAB A;  1TYX A;  3VMV A;  3RIQ A;  2YUH A;  2XT2 A;  4W8S A;  1EZG A;  4XN0 A;  4YEJ A;  2NTP A;  4Z03 A;  4OZY A;  4YCQ A;  3SY2 A;  1O8J A;  2G0Y A;  2BX6 A;  2O0V A;  3PSZ A;  1K8F A;  1KCC A;  4XM3 A;  4XR6 A;  2BM4 A;  4W8Q A;  4YDT A;  5C1E A;  4XQF A;  3JUR A;  1O8E A;  1LLW A;  3KRG A;  2IOU G;  1O8L A;  4OJO A;  1KQ5 A;  1OFL A;  2J8K A;  2X85 A;  1TYU A;  1AIR A;  4Z05 A;  2NTB A;  4U4B A;  1TSP A;  2BSP A;  3WWG A;  2VFP A;  2X6Y A;  1TYV A;  3GQ8 A;  4XN3 A;  4YEI A;  1VBL A;  4U49 A;  4YZ0 A;  2VJI A;  1QA2 A;  1QA3 A;  2VBE A;  1QA1 A;  2NZM A;  2F3L A;  1O88 A;  2NSP A;  2PEC A;  1O8F A;  2X3H A;  1IA5 A;  1QJV A;  3VSV A;  1IDK A;  1XG2 A;  4XNF A;  3SYJ A;  4OJP A;  1QCX A;  2NT9 A;  4OJ6 A;  2QX3 A;  1OOC A;  2V5I A;  2QYU A;  1O8H A;  3N90 A;  1CZF A;  2XTX A;  3FY3 A;  2O0W A;  4C2L A;  3UW0 A;  2QY1 A;  1IDJ A;  3LMW A;  3PET A;  2QXZ A;  2O1D A;  1CLW A;  2BM6 A;  3GQA A;  4I84 A;  1OFM A;  4XLA A;  4YZQ A;  5DNS A;  2UVE A;  2INV A;  2XTW A;  2BM7 A;  1O8D A;  2VBK A;  1O8G A;  2INU A;  4YC5 A;  1L1I A;  1O8I A;  2O04 A;  1RWR A;  1JTA A;  3BH7 B;  2VFO A;  4XOT A;  4XLH A;  4OPW A;  1WMR A;  1QRC A;  1K5C A;  2EWE A;  3PSS A;  2XC1 A;  3T9G A;  2ODL A;  2VFN A;  4EW9 A;  4PMH A;  3BH6 B;  3P4G A;  1EA0 A;  2BM5 A;  3ZPP A;  1WXR A;  1PE9 A;  2X6W A;  3EQO A;  1PLU A;  3VMW A;  2QZA A;  2O6W A;  4XKV A;  3B4N A;  4XOR A;  4OJ5 A;  4OZZ A;  2X6X A;  1GQ8 A;  1RU4 A;  3EQN A;  4URR A;  2NTQ A;  3SUC A;  4MXN A;  4OM9 A;  2PYH A;  1HF2 A;  4XL9 A;  2UVF A;  2VFQ A;  3GRH A;  5AMV A;  4NK6 A;  2XT4 A;  3GQ7 A;  1TYW A;  1O8M A;  4MR0 A;  1DBO A;  1QQ1 A;  1LM1 A;  5C1C A;  1RMG A;  1KTW A;  4JRA C;  1EE6 A;  3ML3 A;  1OGM X;  2NST A;  3DU1 X;  1OFE A;  3B8Y A;  2Z8G A;  2J8I A;  3N6Z A;  4XMY A;  3SZE A;  3VST A;  5JLV C;  1IB4 A;  3NAW A;  4OJL A;  1LLZ A;  3B90 A;  3JX8 A;  3TH0 A;  2O17 A;  2VFM A;  4YZA A;  4XON A;  1DBG A;  2NT6 A;  4XLC A;  4YFO A;  2VJJ A;  4HWV A;  1KCD A;  4XLF A;  4AVZ A;  1X0C A;  3GQ9 A;  1HG8 A;  3ZSC A;  2VBM A;  4YZX A;  3AK5 A;  3NB2 A;  2W7Z A; 
#chains in the Genus database with same CATH homology
 2PYG A;  4Z06 A;  4XLE A;  1BHE A;  1PXZ A;  4W8T A;  1BN8 A;  1O8K A;  4XKW A;  3VSU A;  1NHC A;  1H80 A;  1OGO X;  4XOP A;  1JRG A;  4NK8 A;  4YEL A;  2IQ7 A;  4W8R A;  3VMV A;  4XN0 A;  4W8S A;  4YEJ A;  2NTP A;  4Z03 A;  4OZY A;  1O8J A;  2O0V A;  1KCC A;  4XM3 A;  4XR6 A;  4W8Q A;  5C1E A;  4XQF A;  3JUR A;  1O8E A;  3KRG A;  1O8L A;  4OJO A;  1OFL A;  2X85 A;  1AIR A;  4Z05 A;  2NTB A;  4U4B A;  2BSP A;  3WWG A;  2X6Y A;  3GQ8 A;  4XN3 A;  4YZ0 A;  1VBL A;  2VJI A;  2VBE A;  2NZM A;  2NSP A;  1O88 A;  2PEC A;  2X3H A;  1O8F A;  1IA5 A;  1QJV A;  3VSV A;  1IDK A;  1XG2 A;  4OJP A;  1QCX A;  2NT9 A;  4OJ6 A;  2QX3 A;  1OOC A;  1O8H A;  1CZF A;  3FY3 A;  2O0W A;  4C2L A;  3UW0 A;  2QY1 A;  1IDJ A;  3LMW A;  2QXZ A;  2O1D A;  3GQA A;  4XLA A;  4I84 A;  1OFM A;  4YZQ A;  2UVE A;  2INV A;  1O8D A;  2VBK A;  1O8G A;  2INU A;  1O8I A;  2O04 A;  1RWR A;  1JTA A;  4XLH A;  1WMR A;  1K5C A;  2EWE A;  3T9G A;  2ODL A;  4EW9 A;  4PMH A;  3ZPP A;  1PE9 A;  2X6W A;  3EQO A;  1PLU A;  3VMW A;  4XKV A;  3B4N A;  4XOR A;  4OJ5 A;  4OZZ A;  2X6X A;  1GQ8 A;  1RU4 A;  3EQN A;  4URR A;  2NTQ A;  3SUC A;  4MXN A;  2PYH A;  4XL9 A;  2UVF A;  3GRH A;  5AMV A;  4NK6 A;  3GQ7 A;  1O8M A;  4MR0 A;  1DBO A;  5C1C A;  1RMG A;  1KTW A;  4XNF A;  1EE6 A;  1OGM X;  2NST A;  4XMY A;  3B8Y A;  2Z8G A;  3VST A;  1IB4 A;  4OJL A;  3B90 A;  2O17 A;  4YZA A;  4XON A;  1DBG A;  2NT6 A;  4XLC A;  2VJJ A;  4HWV A;  1KCD A;  4XLF A;  4AVZ A;  1X0C A;  3GQ9 A;  1HG8 A;  3ZSC A;  2VBM A;  4YZX A;  4U49 A;  4XOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...