2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
4AVZA 4EW9A 2UVFA 1O8HA 5C1CA 4XORA 4YZQA 4C2LA 4XLEA 1OOCA 3GRHA 4XLHA 2O0WA 4U4BA 4NK8A 4XN0A 2X6WA 3VMWA 3GQ8A 2UVEA 2QX3A 1EE6A 4URRA 2VJJA 1OFMA 1QCXA 2NSTA 1WMRA 4XLCA 3WWGA 1VBLA 4XMYA 4YEJA 2X3HA 2VBMA 4OJLA 4OJPA 1O8LA 2VBKA 1IA5A 4XOPA 2VBEA 4HWVA 1KCDA 4W8SA 3FY3A 4YELA 1DBOA 1O8MA 4XL9A 1O8FA 1JRGA 2O0VA 4U49A 1DBGA 1OGOX 4NK6A 3LMWA 4Z03A 4YZ0A 2NTBA 4OZYA 2PYHA 3GQ9A 4W8QA 4XKWA 2QY1A 4MR0A 4XN3A 3JURA 2EWEA 3VSUA 3ZPPA 2X6YA 4Z06A 1PE9A 2QXZA 2BSPA 1AIRA 4W8RA 2PYGA 4OJ6A 2O1DA 2NTPA 3VSTA 1XG2A 4PMHA 1IDJA 1JTAA 2INUA 4XOTA 4OJ5A 3EQNA 2NT6A 1X0CA 1O8DA 1GQ8A 1K5CA 1RMGA 1KCCA 4XLAA 2ODLA 4XM3A 2NTQA 1BN8A 4I84A 1BHEA 1OGMX 2VJIA 1QJVA 1O8GA 2O17A 3B90A 5C1EA 3T9GA 1KTWA 2X6XA 4YZXA 2X85A 3B8YA 3KRGA 1HG8A 3VMVA 2Z8GA 3VSVA 1RWRA 1O8JA 1NHCA 2O04A 1H80A 1IDKA 3GQ7A 5AMVA 3SUCA 2NSPA 3GQAA 1O8KA 2NZMA 1CZFA 4OJOA 4XQFA 3B4NA 4XKVA 4XNFA 4OZZA 1PXZA 2PECA 4XR6A 4XONA 2IQ7A 4MXNA 4YZAA 1O8EA 1O8IA 1RU4A 4W8TA 1O88A 3EQOA 1PLUA 4Z05A 4XLFA 3UW0A 2INVA 2NT9A 1IB4A 1OFLA 3ZSCA
chains in the Genus database with same CATH superfamily
1MD0A 1FJLA 5HDNA 1QZZA 1XB4A 3E6MA 2KLOA 1IN8A 1KU7A 1IAWA 3RJPA 2CF4A 4BBSJ 1KTVA 1IRFA 3P9CA 2OBRA 2F43A 2JT1A 2QKMB 1JHFA 4B48A 2QM3A 5IP6A 5CVVA 1Y39A 3GSIA 3BT9A 4PJMA 4RGXA 4WQMA 2J8IA 2VKHA 3FXKA 3ASPA 5FNZA 3HTUA 3ONYA 1V5GA 4Z4VA 2QCOA 3PJRA 2NSTA 5IY5H 2X4HA 1DDNA 3RPQA 4II3A 5DCMB 4BJTA 3CCQI 1KD1D 2HYJA 4U0YA 1ZG3A 1U78A 4OMYA 4UNOA 1QQ1A 2M4GA 2JSCA 1T38A 1R6RA 4PABA 3QOPA 5LHHA 2E2HJ 2HXIA 4B4CA 2HOSA 4HPQA 3V4GA 2KQRA 3FK6A 1AHDP 3BG6A 3MKZA 3LAJA 3SLNA 2OTJB 1F43A 2O0VA 2DFIA 1P9QC 2M4KA 4A6EA 5K5OA 1X1AA 4BU2A 1IDYA 1SKQA 4PC6A 2KISA 3JRDA 3PUMA 3UR3C 4EVIA 3V7CA 1JNYA 1TLHB 4IO9F 1QG0A 3F6OA 2LBFA 4KISA 1YTYA 3OL3A 4XN3A 3GYHX 4IF4A 1AWCA 3JURA 3AKZA 2YX4A 1E1QA 5JLWA 4Z06A 4Y4RA 4YFNF 1PE9A 2R5ZB 1Q82D 4XLPF 2UXNA 4I99C 2PYGA 2HOTA 5ICFA 2NTPA 2VFMA 2KMUA 3ASQA 2VBYA 3H3VK 2A5YB 2DFFA 2HVQA 3JTGA 5LHIA 1ZTRA 1ON1A 2R7FA 2VNIA 1SC7A 3BR0A 5D6FA 2FSWA 5ED4A 1O8DA 3I5UA 1G8XA 4MEYF 3VYRB 3BH7B 3N97A 1FC3A 4DQKA 2OAZA 2NTQA 4YALA 3E1YE 1IHMA 3VO1A 1O3TA 2BM0A 2CH0A 2H6BA 2JA5J 1KK0A 4HF1A 1D1CA 2PJRA 1BC8C 3BOQA 1HF0A 2M7BA 3VSLA 3AG3H 2M8GX 2XNJA 3H9QA 4HYEA 2OPTA 2LOOA 3SFZA 1YW8A 2R7RA 2XVCA 1T39A 3FXQA 2OA4A 3K4JA 4HBLA 4M3DA 3CMEI 1C0WA 1J9IA 1OYIA 1K4ZA 3LA7A 1G4DA 2HWVA 2C78A 5HS7A 5FD5A 4XRFA 2BE5F 1JKRC 4PC1A 1X1BA 3FMQA 2EZLA 1FBUA 5GTHC 3AVYA 5FKMA 3G3ZA 3JAMZ 3MKLA 4Y9UA 1V55H 4N0BA 3U2QA 2BEOA 2X0KA 2DK8A 3ZQIA 4W8TA 2MH9A 4BUPA 4DW6A 4G1VA 4YRVA 4A3GJ 3ZIAA 3NB2A 4KJZA 1BR1A 1UHMA 4ESJA 3CUOA 4RD6A 3JRAA 1H0MA 1YW9A 4OPWA 1O8HA 4UUSA 1E43A 4H9GA 1M1EB 3V42A 3Q9SA 2LR8A 1IRZA 1IG7A 2IS1A 2NVYJ 2ZO4A 1MSFC 4M72A 2NS0A 1XMKA 2KRFA 4C9YA 3WODF 1R7JA 4M3EA 5J4VA 1FSHA 2XGCA 2OZ6A 3LSIA 1RQRA 3KFWX 4EM0B 3HBLA 1BC7C 1SD5A 4NBQA 4MFEA 3ZMUA 1A35A 3M8FA 1HC8A 1XD7A 5LGTA 2VFNA 4RD4A 1EZGA 4MLOA 2IAIA 1A5JA 3BROA 1R5OA 2FA5A 4IXAA 3C2HA 3WXMA 4Z4WA 1K4SA 4MHGA 2K7LA 2K9MA 4HA8A 2RC4A 4G12A 3HIFA 2DLLA 3HZJA 3SXYA 2R7WA 2XNCA 1K7AA 1B59A 3HOSA 3J80Z 3FXRA 1J9ZA 1UZCA 4ESBA 1EH7A 2V31A 3QYEA 5LRSA 5IOYA 2RC5A 1I50J 4FE4A 4MTDA 2R7SA 4MFDA 2EFPA 3N4MA 3CF2A 4RS8A 4CH7A 1VQ4B 3RKWA 1SEUA 4KDPA 3J81K 2Z9OA 4V02C 3ZQCA 3LNNA 4NNJA 3CCVI 1XPXA 1HKSA 2ZL5A 3BCAA 2MGQA 2NVTJ 2O1DA 2VBSA 4B3GA 2O0YA 3G6EB 1XCBA 3ONUA 3WQZA 1EFTA 1UELB 2KIUA 2CNDA 4Y7NJ 1W5CC 2NT6A 1JT0A 1K79A 5K7FA 4X0GA 3K4MA 1JJ6C 2Y0MA 4PSWA 4KKSA 1F5TA 3G71B 1XGNA 2Z3YA 4ZYEA 4N3NA 4G94A 3RZDJ 1LLZA 5CQEA 1XC5A 3CJQB 1FMVA 3A03A 4CSWA 1ACIA 2IJLA 3MMYB 1KJZA 2VKEA 3O8GA 4XKBA 3HGYA 1U5TC 1KQ9A 2CRGA 4CXFA 1OCZH 3EUHC 3V7SA 4EV0A 3VNVA 1BI0A 2V1NA 2BV6A 2DQRA 1TW3A 2KIMA 1H9GA 2RQPA 1NDHA 2J5PA 5L3GA 2X1DA 2R5YB 1IF1A 1YW7A 3DKYA 1COWA 3ESWB 1DDGA 1IDKA 1OR7A 1V4RA 1ZGJA 3F22A 3ZN0A 3SUCA 2LLKA 5B66C 5CYVA 5EEHA 1CZFA 2PE3A 1N78A 3L7WA 2ZMEA 4XKVA 3B4NA 3DEWA 2LY9A 1VQMI 4OZZA 1Y8QB 2E1BA 1HW2A 4X06A 4D5FA 4YIFA 4PGGA 3QODA 2ESHA 3U2RA 1CF7B 3DU5A 4BL0B 2V4DA 1JTYA 4IHYA 4L5EA 2Q8KA 2WSSA 5A88A 1CLWA 1FYKA 3FM5A 2R92J 1FTTA 2W82A 1MKMA 4DK1A 3QP5A 4IRGA 4UV8A 1K28D 1R5BA 2GQQA 2VBTA 1FWZA 1TP4A 3GLLA 4PC3A 3W2FA 4GQNA 1JI8A 3WGHA 2B7BA 1BQEA 5EF6A 3BR2A 3BJOA 2PMHA 1RR8C 5IYPA 5C1CA 2ZTNA 2GK7A 2VFOA 3QU3A 1HLVA 2BM4A 4TMXA 3CCSB 1ZG5A 2ZKZA 1VQKI 4XLHA 3SQNA 5CDFA 2W48A 4RA2A 1AKHB 3UNGC 2D3NA 2XKPA 1TWFJ 1YJ9I 1TWAJ 4WWCA 2M34A 1N08A 3LSHA 1G7RA 3HYIA 1ZELA 2H8WA 3OIPA 3L09A 3LQRA 2HXOA 3JTHA 2F4OB 2JN9A 3HHHA 1E3PA 1LDJA 1SD7A 4ITVA 5JHFA 3S3OA 4X7EA 3WWGA 3F6VA 2DIEA 4ZCLA 1TZLA 2V6CA 1ZG1A 2Q6KA 3ZQ7A 3WBJA 1MMSA 1GO2A 3DEUA 1YLOA 5DEQA 2VBKA 1LM1A 2XT2A 2FX0A 2PFBA 1ETXA 1DU6A 4OIPF 2PX9A 4C30A 2C5HA 1R5HA 2CV0A 3DU1X 3GLXA 5AIQA 3RPUD 2IBDA 4YZ0A 2OV7A 1FX7A 4IVNA 2EFGA 3WE2A 4G6TB 4E7HA 3HEFA 2IW5A 2KHMA 3EETA 4Z2YA 4OAYA 2EWEA 1TQIA 4IX7A 3BQZA 4I0BA 4A0ZA 2HTSA 3HKZN 3QE2A 2L54A 1AIRA 2CMPA 2OTLI 3S14J 3OW2B 3M07A 5DDGA 2K27A 3M1EA 3F23A 1X2MA 3PSZA 4PMHA 3ZPNA 2EJRA 3WY9A 2O6WA 4DOZA 3MEXA 3E6CC 3ZZUA 2XPUA 1EA0A 1R4MB 3EUAA 4ACAA 3I1FA 1RESA 1A8PA 3D5RC 4N3GA 4UV9A 1B8IB 1OCTC 3BJ6A 1LLWA 4A3KJ 3LQEA 2J7KA 2FMYA 1E3OC 1ZAOA 3BC8A 1ZYRF 4D5CA 5DD4A 3CO7C 4QV2A 1TSPA 3PM1A 1LE8B 1VHEA 1V5FA 4DQ2A 1VQ8B 1STZA 2FUG2 1QFJA 1B72A 3QOEA 3H36A 2JSPA 1F4KA 4A3LJ 4A3JJ 1G7CA 3SLDA 2K4JA 3WG9A 1U8BA 1HG8A 4BEHB 5ICCA 2E5NA 3AVXA 3PSIA 5D5VB 2BVNA 3RDIA 2NXNB 1YIOA 4KICA 3ECOA 3K10A 3RKYA 3BG7A 3HL2A 2HOEA 4H0EA 1VQNI 2VOOA 1W35A 2LF8A 3HHGA 1WSUA 5AMVA 1J2XA 3R60A 4FCYA 2DDBA 2M87A 3GW2A 1K78A 2M5SA 1TTTA 1CGPA 2LYCA 4XQFA 1WRJA 3A01B 2CFXA 2VE9A 4ENJA 3G05A 4UB6C 3PUFA 2Y31A 2CQNA 2ZXWH 4IJAA 2VKDA 2YSRA 3DCFA 1W7PB 3E5QA 3ROUA 3LNQA 4IRIA 4LGWA 3PIOF 3HOXJ 3ML6A 1O8IA 2F4IA 2CW0F 2YWHA 1O88A 3EQOA 3FK7A 1FYMA 3I0TA 2PLFA 4A12A 1NB9A 5IT9Z 1YRNA 2HQNA 3BTIA 3VSKA 5A2QK 1FOKA 3I59B 1XGSA 2HDWA 4QWQA 4RDKA 4ZCMA 4UXNA 2GOMA 2XHKA 3ULQB 3VPRA 1CQTA 1GAWA 3OL4A 1MRZA 2O0WA 3MAJA 1GUUA 4EJOA 3CCMI 3B82A 2WWYA 3OYDA 4CYCB 2W7ZA 3SYJA 4WZTA 3SYTA 2Z16A 4C2MJ 1G3WA 2DI3A 2BZTA 2FEZA 3WHBA 1WH7A 2DDAA 3WNDA 3G1MA 2DCEA 3ZQLA 4XLCA 1WMRA 2ECCA 3H1CA 2DODA 4PJNA 1IGNA 1HCRA 5C44J 2PJPA 1QFYA 3BCDA 2QQ9A 3EPZA 4RM0A 4TMZA 1O8LA 3MWMA 1KU3A 1MNDA 4TSFA 4E70A 1TBXA 1N77A 1TNTA 1QFZA 2QE7A 1X3ZB 2HMAA 1Y0UA 2QUFA 4PC2A 3H5RA 3ASRA 3X2QH 2ZSHB 3SDGA 1MSEC 1S9HA 2R7TA 1KQ5A 1SVLA 1QRYA 4BBRJ 2O3FA 4L5IA 3K1PA 5B1BH 4HW0A 4D0PA 2K9QA 5KCMA 2DXIA 1XN7A 3K69A 3Q0UA 2L2OA 1NG7A 5FKLA 2R7OA 4YXWA 3W2AA 4IOAF 1ZHFA 4F52A 2XAJA 4UHTA 3CMEB 2OBSA 2WTEA 2MH2A 4NQWA 1HW5A 2I1LA 3ZMZA 3HKZA 3V7AA 4BHPA 1R49A 4NBSA 2LMDA 4B3AA 3WTSC 4KT5C 2BX6A 5H5JA 2DY1A 1JB9A 2B0LA 1REPC 3O6BB 3IH4A 3Q3SA 1EKEA 4AF7A 4IHVA 4AU7A 2KZVA 3CC4B 2F5DA 2QQ8A 4NC7A 1YG2A 3H3ZA 4GGGA 3DTEA 4PJJA 4M9ZA 4XM3A 2HDDA 2R7ZJ 2COMA 2WJYA 1T2KA 1POGA 5DCFA 5F0CA 3I71A 2VQCA 2EIKH 1B6AA 3GF2A 4N9HA 3LSRA 1WU8A 2VBVA 4D9JA 4KKTA 2DK5A 3H5NA 1BI2A 3GTGJ 2IS6A 4IQ4A 1W0UA 1BX1A 2E34A 4RB0A 5GAHJ 2M7AA 1BJAA 1NK2P 5D5UB 2P7VB 1ZH5A 4IZZA 1HVXA 3R61A 2QTLA 3PNVA 4R8HA 1W36D 5H59A 1XSXA 3D5LA 2J8KA 2CQXA 3GEZA 4RD1A 3H09A 3ZQQA 3S1RJ 3OY9A 3FXUA 2V1UA 3R6SA 1QU3A 2NNNA 2PECA 2QWWA 3ERMA 3SJMA 1N25A 4WZLA 3CC2I 4XR6A 1IV8A 3LOCA 3W6JB 3CDHA 3P7NA 3A0HC 1O8EA 2ZJ2A 2HYGD 4EATA 1RU4A 2XB0X 2EV0A 2LD5A 3DLAA 2PMDA 3OZUA 2XTYA 1J59A 4EJTA 5HLTA 2ICWG 3AG4H 4LJZF 3KZIC 2IOUG 2XUBA 4G6QA 1OB0A 1T08B 1CQXA 3MMPA 2QGGA 3E6BA 4YAUA 2IXSA 4I0AA 1E64A 4I02A 3ES9A 3HOVJ 3CXCB 1HSJA 3QAHA 1IRGA 4KMUX 2KIQA 2ZXHA 1ZUNB 5JVGF 4ENNA 4RPBA 5DUIA 1USTA 5K7HA 3HDDA 1FTZA 2DA3A 2OU2A 2XF7A 3DPTA 1MH3A 3K4CA 1JHHA 3WGIA 3JU4A 1FRQA 3TOAA 4Z4SA 3AVVA 3HRMA 3IH3A 5FLXZ 2QX3A 1SMTA 2XGJA 3CCVB 2EIMH 3PFYA 4UB8C 3DTIA 1I1GA 3GTKJ 2M0CA 1OFMA 1GXQA 3S16J 3DTKA 2ZBUA 3AVUA 4G8XA 3B73A 2KRHA 1FBSA 1SKYB 5HNHA 2Q2EB 4OJLA 4G7HF 1LB2A 1UMKA 1S5LC 4Q47A 3WU0A 4AC0A 5E18F 2STWA 4BY1J 2BY2A 1U5TB 4BDYA 2XF6A 2WADA 5IK2A 4YCQA 3VB2A 4DBQA 1V5VA 1BJZA 3VODA 1QA3A 4ETSA 5F1JA 2CRVA 3UKGA 2ZITA 2PI0A 2GLOA 4Z4ZA 4AIJA 4YAWA 4ZCIA 4BHBA 2EQRA 2FJ1A 3GWZA 3TDUC 4TT3A 3SKBA 3SZGA 4KNYA 3BCBA 2V7VA 2PYHA 5J1UA 1VLOA 2EK5A 4P55A 2Y30A 2QA4I 4I2OA 4IHSA 4LC0A 1TQMA 4RB2C 1NK3P 4D7NA 3VNUA 5F04A 4XRSA 3GVJA 1W34A 4AF6A 1W87A 2PN6A 1OB2A 4FWTA 2XNDA 2ZJRF 2JK3A 2HQAA 3I56I 4ACBA 2P7CB 3I3LA 2HZDA 2CV2A 2NOGA 1IDJA 3GVKA 2DTRA 4XOTA 3CCEI 1VQMB 3N6ZA 2M30A 2O8XA 4RDJA 1K5CA 4XLAA 2V9PA 3JRHA 3WU2C 1PVEA 2YUHA 4YDTA 1EXMA 4I84A 3GBGA 3KZZA 1PDNC 3I9V2 2FQ3A 5C3EJ 2Y0SN 1QO0D 3K4LA 3L2RA 1NTCA 2K9LA 4CZCA 1QJVA 4LLGF 3FX3A 1MMAA 5KVRA 5BPIA 2XC7A 4X7DA 3RIRA 1IN6A 3S17J 1OGJA 3Q3AA 5JFRA 4WF2A 2HNHA 4RD0A 2D1HA 4F93B 3K2ZA 3HAGA 3OOUA 1VQKB 4MGRA 1ELOA 2KFDA 2MYSA 2PMZN 1QGZA 3LFKA 1LVKA 3OFNA 2VOPA 1YJ9B 2GOXB 4P26A 5J8CA 1FIPA 4CCLA 4A3MJ 2IPQX 4CCOA 1GVDA 3DBHB 2XTWA 2C5BA 1DDIA 4HSRA 3CCLI 2JRTA 2EA2A 4HQEA 1ZLJA 4LK1F 3LSPA 3AK5A 4GDFA 2LK2A 5KHDA 4E7SA 1TNSA 3W6VA 1FBQA 1RI7A 2D2WA 2KPMA 5FKKA 1Y0YA 3OEEA 1VQLI 1Z3XA 1HDPA 5B6IA 1MDMB 2YS9A 4U0VA 2V7TA 3R4KA 2DMPA 2DT6A 3DXJF 4PCQA 5JR3A 1VQ5I 3H35A 3PQJA 2ZB9A 4EM1A 2XROA 1VJSA 1FLIA 3OYHA 3OAAA 1Y0NA 2D45A 4K1XA 1KZHA 4R79A 5TRDA 2K3PA 1M1KD 2W7NA 4HDUA 2VBXA 4MQ9F 3IRRA 2XAFA 3OSFA 4P22A 2MBFA 3ML3A 4U4BA 1WSRA 2ZSIB 1TUIA 4NC8A 4E7LA 2K4BA 1F20A 1VZ0A 5EGOB 1XSDA 1W7PD 2M0MA 2RNJA 3WTZA 3WYAA 2PG4A 2KRCA 1R9TJ 4S0HB 1S7OA 5LMZA 4M74A 5L46A 4L0YB 3ZMVA 3ZMTA 1QCXA 4HF2A 3PVDA 3RY8A 2OTLB 1PXZA 4CQJA 1EA3A 1VBLA 2XPVA 1OFCX 2P4WA 3SFIA 1MBHA 1QGAA 3GFIA 2VN2A 3TQNA 2EFQA 2B5OA 4I09A 1NBMA 3LA2A 2E7XA 3A1PA 4ZJZA 5LLQA 5HODA 3OIOA 2EV5A 2XRLA 3V76A 1YJNB 2CSOA 4U7DA 4RMNA 3R6KA 2QGUA 1WQ2A 2BBYA 4UZFA 2DTZA 4QPQA 1WOSA 2XAHA 3OS1A 2ACJA 4X7FA 3FDYA 1ZLKA 3ECHA 5H6RA 1O8MA 3E6DA 1SVMA 4JX5A 4KH3A 2XZOA 1FP2A 3OYBA 2J5OA 4D1QA 1UHWA 1Z0XA 1ZRFA 3KE2A 2P6SA 3L2QA 1PUFB 1FT9A 3V7RA 4R1HA 4BXXJ 1XMXA 1GDTA 1TYUA 4KIBA 1VQNB 1BN5A 4TMVA 3MFKA 3LSJA 1A6QA 1PJRA 2GIZA 3H5AA 2STTA 1LNWA 3S1MJ 4C2TA 2LC2A 5IYRA 2MA3A 4DBRA 2B63J 4Z4YA 1LFBA 2R9VA 3HB9A 4BXUA 2OYNA 2FRHA 3IAS2 1O57A 1RETA 1TLLA 4HX4A 3R0JA 2L9SA 4LOCA 2XSDC 3P5JA 5FL7A 3KP6A 2H6CA 1SANA 2RQQA 1D5YA 3S93A 4ANJA 2JJ7A 2UZKA 3COAC 3T9GA 2PQ8A 2Y0SA 2CW7A 5K5QA 3ZBTA 2LDUA 1WJ5A 3PUNA 3W2WA 4EGYA 3OYGA 1QH0A 2Z8GA 3GUDA 5B5EC 1IV6A 4OOXA 1K6YA 4GYIA 1TWGJ 4L8JA 1F9NA 3WTYC 2IGOA 3CUQA 3T53B 2D74A 3FF5A 5IYCJ 3CCMB 3FXMA 2HOAA 4BE1A 2PMZA 5IPAA 2PEXA 1P4WA 2K02A 4F91B 1XSVA 4IL6C 1NJID 2BF4A 4PGOA 2BOLA 3MKYB 3DWLE 3PETA 1K73D 1D0XA 3T56B 2V1DA 4MXNA 1WJCA 3KZYA 4U0WA 1WJAA 2OUMA 5F1RA 2BYVE 3OYJA 2AXLA 3MQ0A 4BS9A 4E4HA 4I98B 3BR6A 2V6EA 2QLZA 2YR2A 2WV0A 2HI3A 3JAMK 4AVZA 1MGTA 2GIVA 3L2CA 2L9VA 3H0DA 1Z21A 3PFIA 2Q6IA 3TW6A 5J1YA 4G7XA 2UVFA 3P4GA 4KMFA 2BW3B 3BZ6A 2KP6A 1KYWA 3QRFF 1H8AC 5GPCA 2WPDA 3FHZA 3SZPA 1I6HJ 2XDVA 2ZMEC 2P0WA 3D26A 1IXCA 1EH6A 1X3UA 2M2EA 2MLKA 5D4SA 3ZN1A 4F7ZA 3ZP5A 1N06A 2L7FP 1IJWC 4CHUA 4A0XA 5TV2A 3W5HA 3HOUJ 3AG2H 2EV6A 1OCCH 3HXLA 5DYMA 1WI9A 4CA0A 3HOZJ 1KQ8A 2X6OA 4HV5A 4CCKA 1FNNA 2YU9J 2FMLA 1XGMA 3QPTA 3MN2A 2DJNA 3JQPA 2L02A 1KGSA 1WHUA 2IP2A 2L9NA 3CDIA 4Q48A 5CVJA 2ZBVA 2FOWA 3N90A 1R4NB 1T6XA 4A3IJ 4EEFG 2CUFA 1EF4A 4NK6A 2C4TA 2ZBKA 4WXCA 1P7IA 3AG1H 1UJ8A 3OW7A 2XGXA 3I55I 2IA0A 1IW7F 2DA5A 4HNVA 4JOMA 5HNFA 2L7ZA 1MW7A 1WH5A 1VQ9I 1KZLA 1EFCA 2TCTA 2GJPA 3T8TA 4NB5A 5CVRA 3J80K 2R7QA 1D0ZA 1RNLA 2LF7A 3QPLA 3S1QJ 1X19A 5AN9A 1AU7A 3RTRA 1GXPA 2K85A 4ZDLA 5B1AH 4O6JA 2GBYA 3CCRI 3OZVA 3N05A 2TDXA 5IP7J 1XG2A 2BVLA 3EQLF 4XD7A 1KA8A 4DJAA 4G7ZF 3BG9A 4LB6B 4HQMA 3PO2J 4DNTB 2E2IJ 2XF5A 4P12A 4OPOA 4HLYA 3CC2B 1RMGA 2DA1A 2Z6BD 2DO7A 3VDXA 2D5VA 4HAMA 1E3HA 1ORKA 4A6DA 4ZTFA 3O2PE 3MD2A 3FJOA 1LVAA 3L2WA 2JVGA 2VJIA 3MZYA 2VNJA 2CQ7A 5CVIA 3Q6QA 3RQIA 3C2GA 1SFUA 3AGPA 4A5NA 3BQJA 2VBZA 5KSWB 2DW4A 3FZVA 1W0TA 2L4AA 1TWCJ 2A6TA 3P26A 2QYOA 3S2WA 2VPLA 1FX0A 3GZNB 2O04A 3L1PA 4AYBN 1VHOA 1N75A 2XEXA 3A4CA 1UD4A 3ZQGA 4B44A 4B09A 5EG0B 1BI3A 1Q1HA 4KT6A 3GTJJ 4V2GA 3CJNA 4N4NB 4ZC3A 2NAZA 4CUGA 3U9GA 1WZ2A 5F08A 2PBIA 4Y52J 1GT0C 4PJLA 1OCRH 4E7KA 3B02A 4U88A 4II2A 5J35A 1FOXA 4P2NA 4P5OA 3H94A 1N0VC 2H94A 4A3CJ 1P92A 2M9HA 3CDLA 2MLGA 4RM3A 2LG4A 2UV1A 5FKOA 3H9NA 2IA2A 1PLUA 4UVAA 4EH1A 4ON0A 4HF0A 4OMZA 4CZZA 1JT6A 1YHQI 5FLVA 2INVA 2ZXJA 2GJKA 2FNAA 1KRHA 5JMCB 4CO8A 2JVHA 1V5EA 5F6FA 2W85A 1JGGA 2EZHA 1YX5A 2HYFA 5HZBA 4MQVA 2A05A 1I3AA 2P81A 3OR1C 1QHGA 1Y6IA 4LG0A 1ETYA 3HOYJ 1BJKA 5LRRA 3GRHA 4U9UA 3GTMJ 4ABZA 3KP5A 3GFLA 2QA4B 3IUOA 3E3VA 1ZM2A 3VMWA 2BY0A 1Q1VA 2UXXA 1SFOJ 3CP8A 2VXZA 5M5XJ 1EE6A 4URRA 4HNUA 1FSEA 3J81k 1ETOA 4PUSA 1E0EA 2CYYA 2W6JA 3I56B 1U8RA 3A2KA 1UD2A 4N4OB 1G59A 4B4DA 3KEYA 2XGEA 5HZAA 4OJPA 4K2EA 3CCEB 2VNKA 3I4MJ 3TO7A 5FRNA 3K9TA 2ZNYA 3C3WA 4P96A 1ONVA 4ZZLA 3HOTA 2DYIA 3G4SI 2GZWA 1QBJA 2GREA 2ZCWA 2VJ5A 4W8SA 2LP0A 2OCCH 1DBOA 3GZ6A 3VR6A 2I10A 3OPOA 1ODDA 4WWVA 3AAFA 1LEBA 1ZR2A 2OK7A 2V79A 4QVAA 1R00A 1BA5A 5FFZA 1H85A 3HSEA 1OGIA 4OOSA 2PIAA 3REOA 1WI3A 2NYXA 3Q6RA 2WZPP 5FFXA 2O03A 3K4BA 1N0UA 4L9VA 3D1NI 2DA2A 4L0ZB 3A8JA 4ZYGA 3WNCA 2ZFWA 2K40A 3GXOA 2F5VA 2X6YA 3H9GA 4BYYA 2W6IA 4M0LA 4CCNA 4X05A 4EJWA 4Z4UA 2WZNA 3IHUA 3AGQA 3D5SC 2V7QA 2W4SA 2PJRB 4LFUA 1TTYA 2XAQA 2GJRA 3PIPF 1YJWI 1OYWA 1BBYA 2NVXJ 1IDZA 4G1BA 2XSJC 3SJZA 3K70C 4G6IA 3NRVA 1MBFA 3CCLB 4ZZDA 4CCJA 3JRCA 4M6VA 5DV5A 1KU9A 3KLOA 4P9SA 4ROXA 3VMFA 2F3LA 6PAXA 3BNWA 2M1BA 1MJAA 3SEJA 1Z1DA 2RN7A 3M4OJ 3QYFA 3QQAA 1BI1A 3G1OA 2DPUA 1VQLB 1W0JA 2CW5A 3FPPA 2R7VA 2LZJA 3S2DJ 1ZGAA 2QBYA 1VQ5B 2HDCA 2CW8A 3HSRA 2KJBA 3WE3A 4B1RA 2JA7J 3LJYA 4JMQA 1RWRA 1MBKA 2CUZA 2DYRH 3IKVA 4U7BA 3WHCA 4IOCF 1T0FA 3E7LA 4DNCA 1NRKA 3LO8A 3SZEA 4HSTA 1KK3A 4AYBA 2MC4A 3Q5FA 3M7GA 3TL4X 1HSTA 1R22A 3WBKA 4OIOF 5TGTA 2QSGX 5K5RA 4F55A 3I58A 2R3SA 3FHNA 2DFHA 4UUSB 1FOYA 2VT2A 4XONA 1U6GA 2HEOA 3GQBA 5DN6A 2W25A 2G7HA 5BOXA 5GADJ 2D1VA 3CLQA 4FE7A 3H0GJ 4KIFA 4XIDA 2ZJQF 3AL0C 2BM6A 4XLFA 3IL2A 5B3SH 2FU4A 1OQYA 2XB5A 3CF5F 2XZPA 2W00A 3C2BA 3NWSA 2R7UA 1IXSB 3IP4B 1GHCA 1PJ5A 1GV2A 3OV8A 3GTPJ 1VF9A 1W4MA 3BY6A 3JRBA 5E3NA 3V8JA 3T0YA 4XLEA 4BXFA 3S3MA 2B0RA 2DA4A 3TP0A 1XDSA 3DLLF 4BDZA 4YFOA 1HW1A 1YI2I 3S1NJ 5IT9K 2LKPA 1WPKA 2A69F 3ZGKA 1IC8A 1GV5A 4PDKA 4FK8A 1TW2A 1I3QJ 1RKWA 4KN4X 5J4YA 3CCQB 2DU9A 3KP3A 3EUHA 2HPMA 4RLQA 3W6KB 3RYPA 3BLYA 1YX3A 4EMSA 5J40A 3K1MA 2FNPA 2EILH 1ETQA 1HA8A 3S32A 1HF2A 2IA1A 3BPVA 1WXRA 2FBKA 1QUFA 4FQGA 1ETKA 2NV4A 3VYTB 3WNBA 5LEJA 3S15J 4M6YA 4XL9A 1FMWA 4Y17A 5E3LA 2H1LA 2FX3A 2DQLA 1X4PA 2WAFA 3HTSB 4OIRF 1RRJA 2Y48A 4QUZA 2LKSA 1D8TA 3NE5B 4P1VA 3KP2A 3EDPA 3TEDA 4OZYA 4AC9A 1DPUA 1X1DA 3GQ9A 1PYVA 1QNTA 4NC6A 4W8QA 2M3AA 1QA1A 4BQQA 4ZV4A 3AFHA 3R0AA 4LLLA 4IHWA 1EP3B 1DGWY 1I1SA 2BM5A 2QKLB 4HNTA 3DKWA 1Z77A 4P6YA 5LBQA 3FKJA 2F6CA 4KN7X 3E97A 1T33A 2K5CA 3DP7A 1TT5B 2Y69H 3Q39A 3RSNA 3KIOA 2GXBA 4G7WA 4PJ0C 3L9FA 4RDLA 4Y33A 1ENHA 1ZM4A 2NVUB 2VJ4A 2LY2A 1X0CA 2TRTA 1TWHJ 2O8KA 3SDBA 1OCOH 3ASNH 5KK1A 1R1TA 2E36A 1HXDA 2ZJPF 4Z6YA 1BN8A 5FKNA 4OINF 4PAAA 1QVUA 4PSXA 1T6ZA 2GAUA 5D8KB 2A68F 2RREA 2VODA 2VC1A 1ZR4A 2Z5UA 1QA2A 1DU0A 2ZMEB 2I8DA 4PZJA 5IP9J 4YZXA 1MMDA 4P9FA 1G3YA 4PFOA 4QHYA 3DBLB 3OYFA 5F64A 1JKOC 1XGOA 3VSVA 1J7KA 1U9NA 3BTLA 2V9KA 1BX0A 4EM2A 1OPCA 1IRXA 4EJUA 5L3EA 3PA2A 5F4OA 1QX4A 2VFQA 2PLYA 3RCOA 2L4MA 1YYVA 2DOEA 1BM9A 3J7AO 1U2RA 4ZYDA 5E20A 2NVQJ 4RBOA 5EYRA 2CQQA 2XIGA 2FE3A 2ME0A 1IZ1A 1KQSB 1ZRDA 1JJ2B 1YIJI 3OZWA 3E1SA 1KK1A 4QIWN 1GAQA 2ELJA 2KDZA 5JVTA 2JA8J 3PO3J 3CC7I 3ASTA 4BH9A 4Z05A 5IT3A 2O9LA 2PMUA 2JQ7A 4M2LA 2FD5A 4JX6A 1BPLA 3ZMDA 2Q0OA 4HIZA 2HVSA 4TKOB 3ZXSA 1H9TA 3SJPA 3U6KA 3PSSA 1LUJB 1ZREA 4P25A 2K9SA 3QYBA 1UMQA 2DMUA 3I55B 3BG5A 1ZK8A 3QPHA 2V7FA 4GXOA 2V7WA 1KC8D 3JQRA 2GA1A 4FXUA 4F7DA 2F1MA 1VQ9B 4XN0A 1RIOH 4L5JA 3IWZA 3LQ6A 3JX8A 5KW9A 2UVEA 2XASA 3LFUA 4AIKA 5FRMA 3TGNA 3M8JA 1NHAA 2BPOA 2CQKA 1TT0A 4FTHA 2ZFUA 4F92B 4P3YA 1QZEA 1VFCA 4G5GA 3CCRB 4XMYA 1UG0A 2VC0A 2JTVA 4FT8A 1BL0A 3ZC3A 4JYKA 1OMIA 3CMYA 5FLXK 1NG6A 3NARA 3KEOA 2W24A 4E7ZA 4G7OF 1X1PA 4RM2A 3RPUA 4LB5A 3LSGA 3H9JA 5E3MA 1IJEA 2HCJB 4P9UA 3TW7A 2ID3A 1O4XA 2IS4A 2ELKA 2QTZA 2E1MC 1ETWA 3QFCA 2QYUA 1P6RA 1ZKGA 2MW8A 3HJEA 5DCMA 3S8PA 3JREA 3J7YJ 1UD6A 3CPXA 3K0LA 3RKQA 2WYRA 2MABA 3OYNA 3NAWA 1MIJA 3FPKA 3C1DA 5HOOA 1CNFA 5CLSA 2QXZA 1J0RA 3BJAA 3JRFA 3MKWB 1FNBA 1D1AA 3ZZTA 1R71A 1BLIA 1Z6RA 1HZEA 1S72I 3S2HJ 1XX5A 2C2WA 3A3GA 1B72B 5HS9A 1YLFA 2BHZA 4YC5A 2MD5A 3G73A 1I27A 3IWFA 1BR2A 1DQUA 4R71A 3JRIA 2CS3A 2JUCA 2K9NA 3CESA 1FRNA 2XC1A 3BG3A 3TH0A 1FYLA 2QZ8A 1ZGWA 1E62A 3LL7A 2R5ZA 5DS0A 4GCVA 2Z2SB 3HC7A 2BMWA 1OFEA 2JA2A 1K78B 2V9VA 3B90A 1R5GA 3C18A 1YHQB 1GLNA 3K4NA 1P4XA 3A8KA 3PNYA 4YAOA 1YQAA 4Y13A 2RAEA 3LWFA 5EZGA 3ONQA 4UVBA 4WXHA 4E0FA 4XSZF 5A89A 3A35A 3IV5A 2B7EA 3O8HA 3R6JA 5HLIA 1T95A 2NZMA 2IRFG 1AOYA 2GWRA 2DFEA 3ABUA 3CCUI 5E1XA 5ICEA 1YRNB 4EJVA 4OPVA 4BJ5C 3DKXA 3CMMA 3FBNB 1G6NA 2UWMA 2ETHA 4FHTA 2DMTA 4I01A 5THXA 1P7JA 1Y1VJ 1LEAA 1Z7UA 3LSTA 1R5NA 2XOKA 1OHHA 3FMSA 1RPWA 3BH4A 2A61A 2MG4A 4C2UA 5JLXA 3LMMA 4AM3A 5BSYA 2NT9A 1IB4A 5E1ZB 2XZLA 4RD2A 1X4OA 3G4SB 4RAGA 1XS9A 5FJ8J 1T5EA 2EWNA 4EW9A 1RR7A 1ITYA 5GAEJ 1J09A 4IHTA 4C2LA 2E7WA 5EZHA 5AONA 3CMAI 3SQVA 5D4RA 2AQEA 4XK4A 3IAM2 2E19A 2Q6LA 4X0CA 3T51B 1VQOI 3CCSI 1DP3A 1E2XA 4JP0A 4P1WA 3HUGB 4NK8A 2YWEA 3GQ8A 2L0KA 3BH6B 1JTXA 5LD2C 2MD0A 1Z91A 4JX4A 3JSPA 1SFKA 3M1CA 5K7ZA 3QFTA 4Z4RA 1IO2A 4TMTA 1UD3A 2W84A 4OWRB 1YO5C 1V0FA 3GMEA 1A6IA 3B8HA 3CRZA 2OCEA 4YIRX 4YEJA 4QLCU 4LIVA 4DZPA 4BQAA 2XKOA 3F72A 2YX7A 5IYDJ 3CJRB 4L18B 2F48A 1X58A 3DBRB 4G9YA 2AS5F 4YFXF 5TR9A 2JJ1A 1S0UA 3CD6I 1D3YA 4NHJA 1MBGA 4DNRB 3OYMA 2QVOA 3K6GA 3PSFA 4LLNA 2BGIA 4KYWA 2YWGA 4NQWB 1FNCA 4ASUA 4BE2A 4N9IA 3OKXA 2N8GA 1H8HA 2ISYA 5IYBJ 3CP2A 1ETVA 4M53A 4UAJA 2AHQA 2KT0A 3ABMH 1UD8A 5EEAA 2AHOA 5J3OA 1SAUA 1ERDA 3HPGA 2P5KA 2QY1A 5LGNA 5E17F 4AVPA 2E35A 3KEWA 2R6HA 1BOAA 5D5WB 3FBIB 1EH8A 3LA3A 2P6TA 3MCAA 4M71A 3OS0A 3IRQA 5M5YJ 5FO5A 1AA7A 2F2EA 3M8EA 3OOPA 4P3IA 3J7ZI 3NAUA 4QFMA 3AL0B 2DT5A 2CK3A 4RGUA 3DQVC 3GFJA 4BQNA 4A3BJ 2KDOA 4CDGA 4JQFA 3VOEA 2ODLA 4FASD 1UG2A 2CO5A 2EIXA 3OE7A 2COBA 4OIQF 3BZKA 4QTRA 1QGYA 3DF8A 4RLZA 3BQYA 3CJTB 2H8RA 4BE0A 3FXJA 4RAFA 5KNLA 3B78A 1QPMA 2AO9A 1O8JA 4IEJA 1SFXA 4LITA 1VQPI 3ELKA 1O7FA 2EINH 3HSFA 2FBIA 2RGVA 2ZTGA 1SD4A 3W5VA 5ILVA 1YI2B 3L2VA 3FKSA 4Z1MA 5CPRB 4MEXF 3FMRA 2ZZQA 1S8NA 2P5VA 4CICA 5KAFC 1DUXC 4KIGA 2DAOA 4OAZA 4BGDA 4BAYA 2ESNA 1R58A 4RGSA 4KFCA 2WV1A 4O3MA 5CKTA 3JQQA 3NEUA 2WAEA 2R5YA 4XBFA 1W1WE 4YIIA 4X1EA 2Z99A 5H6QA 4M4SA 4MTEA 3QP6A 3KYCB 2DYSH 5GAGJ 3FXLA 2RV8A 4ZGNB 1EFRA 4A5MA 3DPLC 2F4NA 1SM4A 3CB4A 2HU9A 4M9SA 1CF7A 2G0EA 3CW2A 4DGWB 2LREA 4KA4A 5FO0A 3AVTA 2X1EA 4YAFA 3WU1B 2E60A 2IGKA 5FIUA 1ZARA 2E1NA 2VL8A 4D7MA 2JDIA 2X6WA 2EIJH 4FX0A 2HVRA 3KLNA 3T8RA 1VQ6I 2ZL7A 3T1BA 2EFNA 5DUKA 1Z05A 2HQ5A 2WC2A 3RIQA 4LBVA 2F5EA 1B4AA 2LH9A 4DYQA 1K8FA 3VYSB 4ZDPA 3SZTA 5M5WJ 1BW5A 2BXYA 4BY7J 1KYZA 2QEXI 1AKHA 2EH3A 1Q7YD 1UAAA 2A6EF 4PK4A 3VFZA 5LFAA 4WZKA 3OYEA 1WTHD 1LJ9A 1GVJA 5M3FJ 3ABLH 4LBYA 3C7JA 3MCZA 1OR7C 1R1VA 1MH4A 1OKRA 2HTJA 1J5YA 2NOJB 1DP7P 4B43A 2WBMA 1LFUP 4X6AJ 1D8JA 3BY2A 2QENA 4DYRA 2ID6A 2VNHA 3Q38A 1D8KA 2P3MA 2X3UA 2Q1ZB 1MBEA 3K2AA 2RC6A 2O61A 5CJ9A 2E2JJ 1PJ6A 4Z03A 3W3CA 4HE5A 2XAGA 2HLDA 3AVWA 4FISA 3MHPA 1FIAA 1VLYA 4HV6A 3F9KA 4DZJA 3NWTA 2VLAA 4ZDOA 4JRAC 2BN4A 3EUKL 2CUEA 2BSPA 1D1BA 4OJ6A 2L7MP 3K7AJ 5DS9A 1DG1G 3KCCA 1FZPB 5C4XJ 1XFOA 1E63A 4I76A 4MYTA 2DA7A 4RB3C 1QVFB 3A0BC 2INUA 2VZLA 4E7IA 1XTAA 2G7UA 1XQBA 1Z67A 1GQ8A 3BY1A 1YIJB 4Q5SF 2YU3A 1UFMA 2BM1A 5D8LB 3WTTC 2F4MB 2DEUA 2LNBA 3CC4I 1WKMA 2HR3A 2HS5A 3KETA 1RQPA 1Y56A 2A07F 3KYLA 2QQAA 1WJFA 3CC7B 1T56A 2YUSA 5L3FA 1V0EA 1QZYA 2L7KA 3U21A 4O5VA 3FKIJ 3D0SA 3HGGA 5C1EA 5BMZA 1ULYA 2HDNB 1JXSA 2DOGA 3PQKA 2X53S 2IGMA 1F36A 4XRMA 1H89C 3KRGA 4UUTA 4U87A 4HE6A 3ASOH 5J3LA 5A8AA 1HBXG 1B8IA 1D1NA 3JCUC 2XTXA 4HEA2 1RUNA 2V1XA 3GQ7A 5ILUA 4L9NA 1R1UA 2NS8A 1UB9A 3BR5A 3QPSA 1LE8A 1O8KA 3V8LA 1W5TA 4ASNA 5HLHA 1E79A 3ZQFA 1ZM9A 1K4TA 1B9MA 3SEZA 4RCZA 2VKVA 2E1RA 2NPFA 3HRSA 3W2IA 5JI6A 2M8EA 3CCYA 1IUFA 4BEHA 3VWBA 2IVMA 3PUBA 3OJWA 1DPRA 2DBBA 5EJCA 4ZGQB 2IQ7A 1U2WA 2W57A 3TDZC 2JPCA 2E1MB 4UZEA 1M90D 2OC6A 1WJEA 5F0FA 2HPIA 2JJ2A 5HXBA 2VQHA 3ZCOA 1K8AD 3ISPA 3I54A 4QPOA 3HRTA 3GVAA 2ME6A 2JUGA 3J7AY 1T6SA 4OU0A 4RPDA 2DETA 3A01A 1T6YA 3ASSA 3ZSCA 3OEHA 1ON2A 1S4MA 1T0FC 1VQ7I 3TP3A 1W7PA 2XGDA 2I5UA 2BGCA 1L0OC 4FX4A 4P6VF 2RVCA 4AIHA 2V26A 1JE8A 2WB1N 2JIZA 2F5CA 3OYAA 1JKPC 2X8KA 4YEIA 3S3NA 5EDNA 1K6OA 1YS6A 1YFHA 2KJCA 2VI6A 2R0QC 4E7JA 3FXOA 3ZQHA 3I59A 1X1CA 3M3YJ 4C43A 2V4JC 3B6CA 5F4JA 5LGUA 3OYLA 1QVTA 5HS8A 2Q6OA 1S72B 1SVOA 1WOPA 4Y9RA 2X51A 4I6ZA 3TMOA 5TISC 3BCFA 5E8IA 5E3OA 3DV8A 3OJXA 3I4NJ 4XSXF 5IYNA 3OP1A 2KL4A 1ZN2A 2GK6A 1TQPA 4CYCA 2VBEA 3BWGA 2EBIA 3GO5A 3QU6A 4HWVA 1KCDA 1TVCA 4C0SA 1QGPA 3J81Z 3ERED 1MABA 1BOBA 1AMOA 3A8IA 1XCVA 4HOBA 3LMWA 2RNGA 2B7CA 3K70D 2XT4A 1X2NA 4OOIA 1I18A 1G2HA 4RAYA 1IB0A 9ANTA 1YX2A 2JN6A 3VSUA 5M3MJ 2F5FA 2CG4A 3TBIA 2OF7A 1SAXA 2IT0A 4M1KA 5CQGA 2QN6A 5GV7A 1JJ8C 4X7CA 3RI4A 4L9JA 1JA0A 1KONA 2QQBA 2QDXA 2LBFB 3CZ6A 1BMFA 1VF7A 2CJJA 3CCUB 4OJ5A 3CCJI 1D2EA 2OQGA 5E1WA 4KKUA 1SD6A 2LY1A 4GRIA 4LMYA 2E71A 4ZTJA 4X8IA 3MVPA 1MBJA 2LRDA 2HFHA 4YG2F 2ECBA 2YWFA 3CUQB 1WPCA 4WK8F 4AIDA 1N8RD 1O3RA 1K61A 3GIRA 5H2FC 1W0KA 5F4MA 4B3XA 5ICGA 2O17A 1XMAA 1U0JA 1B2RA 3W2EA 4MYUA 4C3IJ 2GM4A 1Q9SA 2BV3A 4IQJA 2OD5A 1PJ7A 2DJIA 5FGMA 2V7XA 2VT3A 3KYDB 4L9TA 2D9RA 2HZTA 1KU2A 2CFOA 4BHCA 1JUMA 3CMAB 2M5WA 5IOZA 1FDRA 1VQOB 3W2HA 2G9WA 1APLC 3GQAA 2BM7A 2JA6J 1W9XA 5E8GA 2BY1A 1OJLA 5L3BA 2MSYA 3CQZJ 1RZ4A 3LQQA 4LK0F 5GTIC 1MZBA 2DCUA 1Q86D 1UD5A 1YOVB 1I6XA 4M9XA 1CNEA 2O6GE 4YZAA 5J6XA 3HM5A 3M9AA 2H09A 3JW4A 4CCMA 4Y3OA 3IKTA 2FVGA 2A3SA 3CD6B 2ZXIA 4BPRA 1E3XA 3HG9A 1RKTA 1JKQC 5FROA 4BACA 3OSGA 3OYIA 3OYKA 4RCYA 1UCRA 4XORA 4QVJA 4NDLA 1I39A 1YITI 2Y75A 3JRGA 4J01A 2P5LC 3E20A 1OOCA 4ENMA 1P4AA 2VQGA 2HQRA 1Z7LA 1TL8A 3BTCA 1USSA 4A3FJ 2VBUA 2WJVA 2A6HF 2WB1A 1BIBA 1G3SA 1YE9A 1WWXA 2L9RA 3OS2A 1EP2B 1D0YA 1XB2A 2DN0A 1BIAA 5L3CA 3LSKA 2WAQN 2ZZEA 1U9OA 2DMQA 3FISA 2VBMA 2X3HA 5HKKA 3ZUGA 2XV4S 4PFPA 2G0YA 1PKVA 4LD5A 4LBWA 1F1ZA 2H27A 1HA3A 2LSOA 2X9DA 2B9SA 4XOPA 4A3DJ 4YFKF 1Z3YA 1MJBA 1K83J 1IXRC 4YELA 1F60A 3FY3A 1HKTA 3BR1A 1O3QA 3WTVC 3VO2A 3Q0VA 1YJNI 4MNUA 2DOAA 5DM6F 1DARA 1HDDC 1N07A 2EFWA 1W2BB 5J1RA 1O3SA 1R23A 2Q2EA 1T98A 4QSHA 3GZ5A 3F21A 3BR3A 4XKWA 1Y0RA 3BZCA 4LBZA 3RKXA 1U5TA 2NRAC 3ZPPA 3K4KA 2GA2A 5KAIC 1GR1A 5IYQA 1VQPB 3DFGA 3KPHA 1O7LA 2ZNZA 4W8RA 3EYIA 4B3FX 5JBQA 5AIPA 2VFPA 1TYVA 1Y1WJ 3VSTA 1V54H 2DERA 2ADUA 2YPRA 3FM3A 4M3FA 1QRBA 1LDDA 1Z9CA 2CC2A 3I53A 4OP7A 1GVHA 2VQLA 3H3UA 4WX9A 1OFDA 2VE8A 3QFRA 1JGSA 3KP7A 3EYYA 1VTNC 2ZL6A 3PA1A 5HVQC 2V7UA 5TJJA 3LSMA 5E79C 4M6XA 1Q81D 1QQIA 2OTJI 4UVCA 2GPJA 2K86A 3MZ8A 3U1DA 1VNDA 3HRUA 4GO1A 5BQTA 4F3QA 1A31A 1H42A 4RLFA 3SEQA 2VBWA 3W2VA 3BC9A 5JLVC 1KTWA 5HLGA 1WGXA 3F8CA 2C6YA 5DM7F 2FQ4A 2VXDA 3TO6A 3K1NA 1RUOA 2OBTA 3A3BA 1B9NA 2CU7A 3GTQJ 1WSVA 1NHCA 1IN7A 2ZZFA 2V5IA 3BTJA 3GCMA 2ZZGA 2IGNA 4RDUA 1R5ID 2R7XA 4XICA 5FD6A 1DGRM 3GTLJ 5FB2A 1WOOA 4XKCA 3H92A 4XNFA 5D6EA 4JBAA 1MJ9A 1S7EA 1VQ6B 1KCCA 2OZUA 2R4GA 1B1BA 2JWTA 2JMWA 4LIUA 1LPQA 3PNTA 5A2QZ 1QA6A 3PENA 1XG1A 2CGPA 4ESFA 4LG0B 3GTOJ 3G1LA 3CLOA 4A3EJ 2QEXB 2EZIA 1HKQA 3KP4A 5F27A 2WY7Q 2XPWA 2EZKA 3U1KA 3V8KA 2JRMA 4M3GA 1EV7A 2KVOA 4DK0A 3UW0A 2AQFA 1OFLA 2GXGA 2IEKA 5ERIA 1HOMA 5TY0A 1FNMA 3HUGA 3QFSA 4EGZA 2HKXA 1EP1B 4HZFA 4J00A 3F8FA 1WVRA 2VIXA 4XRSG 1ZRCA 2ZC2A 4EQQA 1S6LA 3HPHA 1FEXA 2CBXA 5GV8A 4A69C 1LQ1A 3LYCA 5GP9A 5ILSA 4CYDA 1MDMA 4HG2A 1JUSA 3ISXA 2QSFX 3RYRA 3QSYA 3KL9A 4PC7A 1KK2A 3FIWA 2VUMJ 3W5UA 1QRCA 4I7HA 2VONA 4BQOA 3HOWJ 2LVSA 2WAQA 3QWLA 4DQLA 4UZUA 5BSXA 4C3JJ 2W1OA 5FO1A 2OK8A 5EGOA 3DPUA 1SFEA 1K9MD 1FOWA 1MMNA 3P9KA 1O8FA 4U49A 2RDPA 1OGOX 1PP7U 2Z1DA 4OOVA 1JA1A 4V19K 2QMUA 2O7OA 1G3TA 3W2GA 2NTBA 5BPDA 5FA6A 4AD9A 3E0JB 4M3BA 2DA6A 4PGHA 2JPBA 4MR0A 4S04A 3KEQA 2CWEA 2F1LA 4ZH4F 5CVUA 3BPXA 3Q9VA 2DMNA 1TYWA 3FWEA 2M45A 3IC7A 3SHFA 3ZRGA 1EJ9A 2FOKA 2L3DA 2QF7A 1QVGB 2VASA 4JK1X 2KKOA 2K3FA 1JUPA 1JTAA 4Q4ZF 2QBYB 5F0HA 2BSAA 3DU6A 1WJDA 1G7TA 1PUFA 1WFXA 2HKOA 4H4KC 3L2UA 4UUVA 4NUBA 3P27A 1IUYA 1ZM3A 1V3FA 5BS6A 3I64A 3B6AA 2KZGA 1BHEA 4HX7A 1OGMX 1A36A 3SY2A 4ZYAA 4RJLA 3WTWC 1Y8RB 1RC9A 1IJFA 4OM9A 2X6XA 1H88C 1FY7A 1S29A 3E5XA 1VQ4I 1I8DA 1SMYF 4MIMA 4M73A 3WG7H 4W97A 2A5WA 3ZOBA 4BKXA 2H1KA 3VMVA 1OCPA 2EA4A 4Q7JB 1NB0A 1VQ7B 4NCNA 1XDUA 2Y9YA 1T8IA 3VEPA 4S05A 2CV1A 1H80A 4IW3B 5K1YA 2E5ZA 3WTXC 4HRIA 5C4JJ 2L01A 3G6EI 2NSPA 4RGRA 3ABKH 1IN4A 3CO6C 3TKYA 2VYQA 1E3ZA 5J8FA 4B8XA 2BGJA 4BNCA 4UY8I 1LKXA 1W5SA 4RAZA 4BJ6C 4B47A 4ZYHA 4FN5A 2E1CA 2GXAA 3IH2A 1WP6A 2BHYA 4A93J 3G71I 4IHXA 3ZBUA 5J47A 5DNSA 4A2UA 4DYCA 3A02A 4DIQA 1W36C 4IPAA 3ZR8X 4HDVA 1EWYA 1B23P 1A04A 2XRNA 4RB1A 2FBHA 5HDKA 1TC3C 4KITB 3KX2A 2MC3A 2D3LA 2OBPA 2WA0A 3A1YA 4J19A 2ELHA 1Z6TA 5DTDA 4KUMA 2L5QA 2E1OA 4YZQA 4HX8A 5DD8A 3GX4X 2BVMA 3OYCA 2WY8Q 2BXZA 1U3EM 2C77A 3OR2C 4Y7CA 4LG3A 4TMWA 2ISZA 3NQOA 2DT7B 1VI0A 5BNGA 1QHHD 1BR4A 1EFUA 1X3WB 2DOFA 2VJJA 2EPFA 4J0QA 1FP1D 2MFZA 1P4MA 2BW3A 1MNMC 4ENKA 1MMGA 2AXTC 5HDGA 3JR9A 4YHBA 2OJED 2P8TA 4WCGA 3WTUC 2QZAA 4X07A 3CCJB 2Y2ZA 3OWTA 1DABA 3E5UA 4AWXB 4WXDA 2NNYA 1IA5A 3RZOJ 1L3LA 3F8NA 1PP8F 3VYUB 2R7DA 3OMYA 5JHUA 1TYXA 4HLXA 2EFOA 3CUQC 3T5XA 1JRGA 3LVBA 1DBGA 1WDTA 1J75A 2WR8A 2NS7A 1WJBA 2BY3A 2DPDA 4GYGA 1NH3A 1UHSA 2X48A 2HGCA 5LEKA 1G7SA 1P2FA 3GFMA 1S3JA 4W1UA 1E1RA 3ZZ0A 1GJRA 1KMHA 4Z4TA 1BW6A 1YJWB 5LHGA 1WCMJ 3TO9A 4AUXA 2CUJA 5EEGA 3G2BA 4GFBA 1PUEE 5H20A 4XLNF 4WZEA 3EQNA 1R36A 3DEEA 3WGGA 3BDDA 4Y15A 2JZYA 1OYYA 3F3XA 1QPIA 2GQFA 5IYWA 4IRHA 2X0LA 4E6KG 3GVLA 2KIFA 5E6TA 1ZQ3P 2C4UA 1MNEA 2RKHA 3LAPA 1LDKB 3JSOA 2VB6A 2FXAA 1QUEA 3BP8A 1XE1A 1O8GA 1L1IA 3F0CA 3TOBA 3CTAA 3ZPLA 2X85A 4TV7A 3B8YA 2QSHX 3PL8A 3P9IA 1YS7A 1OLTA 1I7PA 1FPQA 1I5ZA 3L00A 1IN5A 3F8MA 3ZMSA 1YITB 2X1CA 4V2FA 4G6DA 4CGZA 1E17A 3I4PA 3O3KA 3CPWB 4IKFA 2LFBA 2FF4A 2OQRA 2O5RA 5L3DA 3F8BA 5D5XB 2LKXA 2Y9ZA 4OJOA 1LFPA 5FLMJ 3MZHA 3U6BA 1HQCA 2UUZA 1AIPA 5GPAA 1H8EA 1N05A 1FNDA 3Q0WA 3OOCA 2VPRA 4TN1A 3OIQA 1KQ0A 5DSZA 2EB7A 4C3HJ 1OB5A 4FETA 2XAUA 4OPSA 1D5VA 3ABTA 4MO7A 1VQ8I 1OISA 3RQ4A 2LTPA 5EG0A 1WORA 3DDYA 5EMNA 2R93J 2IS2A 4A0YA 1S7AA 4RD3A 2Z33A
chains in the Genus database with same CATH topology
2IXSA 1T0FC 2KLOA 2ZXHA 4XLEA 4BXFA 3S3MA 2V26A 4BDZA 2F43A 2QKMB 2JIZA 3OYAA 2XF7A 3DPTA 3K4CA 4B48A 2X8KA 3JU4A 3S3NA 4PJMA 3ZGKA 2VKHA 2QX3A 4E7JA 2XGJA 1V5GA 3PFYA 1X1CA 3DTIA 1OFMA 2V4JC 3PJRA 2NSTA 2HPMA 3OYLA 3DTKA 4RLQA 4II3A 4BJTA 3BLYA 2KRHA 1YX3A 1SKYB 5HNHA 2Q2EB 4OJLA 2X51A 3BCFA 3TMOA 2M4GA 1R6RA 1HA8A 3S32A 2KL4A 2GK6A 4HPQA 2KQRA 2VBEA 4BDYA 2XF6A 2WADA 5IK2A 4HWVA 3BG6A 3VYTB 3MKZA 1KCDA 4DBQA 4XL9A 1FMWA 1MABA 2O0VA 2M4KA 1P9QC 1X1AA 1BOBA 1X4PA 2WAFA 4BU2A 3LMWA 2RNGA 4TT3A 3K70D 3NE5B 3OEHA 3SZGA 3BCBA 3UR3C 4OZYA 2PYHA 1X1DA 3GQ9A 1PYVA 4W8QA 1I18A 2M3AA 2LBFA 4KISA 3OL3A 4BQQA 3AFHA 4XN3A 3JURA 3AKZA 1E1QA 1DGWY 3VSUA 4Z06A 2QKLB 4Y4RA 4HNTA 3GVJA 1PE9A 3FKJA 2F6CA 3TBIA 2PYGA 2K5CA 5CQGA 2XNDA 2NTPA 2HQAA 3RSNA 2KMUA 4G7WA 1KONA 2HVQA 3I3LA 2LBFB 2HZDA 3CZ6A 2CV2A 4Y33A 1BMFA 1VF7A 3GVKA 1IDJA 4XOTA 4OJ5A 2VJ4A 2LY2A 1X0CA 1O8DA 4KKUA 1K5CA 1G8XA 2LY1A 4GRIA 3SDBA 4XLAA 3VYRB 4ZTJA 2LRDA 2NTQA 1BN8A 2CH0A 4PSXA 1WPCA 1D1CA 4I84A 3GBGA 2PJRA 3I9V2 2RREA 1W0KA 2M7BA 3K4LA 3VSLA 4B3XA 2K9LA 4CZCA 3L2RA 2I8DA 1QJVA 2O17A 4YZXA 1MMAA 1MMDA 1U0JA 3H9QA 4PFOA 2XC7A 2LOOA 3OYFA 4IQJA 2DJIA 2R7RA 3VSVA 2HNHA 3K4JA 2CFOA 4F93B 3HAGA 2V9KA 3OOUA 1IRXA 2MYSA 1LVKA 3RCOA 3OFNA 3GQAA 2GOXB 1W9XA 4CCLA 4CCOA 1X1BA 4HSRA 1UD5A 3E1SA 2ELJA 5KHDA 4YZAA 4E7SA 4W8TA 2KPMA 3OEEA 4CCMA 4BUPA 4Y3OA 1Z3XA 4Z05A 4YRVA 3ZIAA 4KJZA 2ZXIA 1BR1A 2DT6A 1E3XA 3HG9A 3H35A 1BPLA 5FROA 1VJSA 4HIZA 2HVSA 4TKOB 3ZXSA 1O8HA 3OYHA 4BACA 3OYIA 3OYKA 1E43A 4XORA 3OAAA 3V42A 4R79A 4J01A 2K3PA 3QYBA 1OOCA 2W7NA 4P22A 2VQGA 1Z7LA 2V7FA 2IS1A 4U4BA 4FXUA 2ZSIB 2F1MA 2WJVA 4NC8A 4XN0A 4E7LA 4C9YA 1VZ0A 2WB1A 2UVEA 3LFUA 2M0MA 5FRMA 1YE9A 3LSIA 3M8JA 3OS2A 2KRCA 1TT0A 1QCXA 2ZFUA 4F92B 1D0YA 1EA3A 1VBLA 4XMYA 1UG0A 3LSKA 2ZZEA 2X3HA 2VBMA 5HKKA 1NG6A 4PFPA 4MLOA 1PKVA 1NBMA 4E7ZA 4ZJZA 4XOPA 3C2HA 4RM2A 2K9MA 3LSGA 3H9JA 1Z3YA 3FY3A 4YELA 2R7WA 4RMNA 2IS4A 2E1MC 3HOSA 4QPQA 2DOAA 3OS1A 3S8PA 2V31A 3QYEA 3FDYA 1UD6A 2R7SA 2XZOA 3CF2A 4CH7A 3OYBA 4XKWA 4D1QA 2MABA 3OYNA 3L2QA 5HOOA 3ZPPA 3K4KA 4NNJA 3LNNA 2QXZA 3BCAA 3MKWB 4W8RA 4B3FX 2O1DA 1D1AA 3VSTA 1PJRA 4B3GA 1BLIA 3H5AA 1HZEA 3WQZA 4C2TA 3A3GA 2LC2A 4DBRA 1UELB 2VQLA 1BR2A 2NT6A 2R9VA 1DQUA 3IAS2 4X0GA 2CS3A 3K4MA 4PSWA 3CESA 4KKSA 2L9SA 5HVQC 3LSMA 5FL7A 3LL7A 2Z2SB 2RQQA 3HC7A 5CQEA 2JA2A 3CJQB 1FMVA 3S93A 4ANJA 4F3QA 4RLFA 3SEQA 4CSWA 3W2VA 3MMYB 3BC9A 3B90A 1GLNA 3K4NA 4XKBA 2Y0SA 1KTWA 2CW7A 3T9GA 3PNYA 1WJ5A 3EUHC 3W2WA 3ONQA 2V1NA 3OYGA 2Z8GA 4E0FA 2VXDA 3A3BA 3A35A 1NHCA 2X1DA 1K6YA 2ZZFA 3DKYA 1COWA 4L8JA 1IDKA 2IGOA 2ZZGA 2IGNA 3T53B 2R7XA 3SUCA 4BE1A 1T95A 2NZMA 1DGRM 2PMZA 1CZFA 1N78A 4XKCA 4XKVA 4XNFA 3B4NA 4F91B 4OZZA 2E1BA 2R4GA 3DKXA 4BJ5C 3CMMA 3FBNB 2UWMA 2BOLA 3QODA 3DWLE 3MKYB 1D0XA 4LIUA 3T56B 3PNTA 3DU5A 4BL0B 2V4DA 2XOKA 4MXNA 1WJCA 1OHHA 2WSSA 1WJAA 2OUMA 3BH4A 3OYJA 2W82A 2WY7Q 4DK1A 1K28D 4C2UA 4BS9A 2KVOA 3LMMA 4E4HA 4DK0A 2AQFA 1OFLA 2NT9A 3UW0A 2XZLA 2V6EA 4GQNA 1IB4A 1X4OA 1JI8A 4AVZA 1T5EA 4EW9A 3H0DA 1Z21A 2UVFA 4J00A 1J09A 4G7XA 5C1CA 2ZTNA 2BW3B 2GK7A 4C2LA 2KP6A 2VIXA 2AQEA 2WPDA 3HPHA 3IAM2 3T51B 4XLHA 5CDFA 3UNGC 2XDVA 1DP3A 2P0WA 2D3NA 4P1WA 3HUGB 4NK8A 3LSHA 3GQ8A 4HG2A 5LD2C 2MD0A 1ZELA 3OIPA 1SFKA 3M1CA 3HXLA 1UD3A 4OWRB 4CA0A 1V0FA 4ITVA 3S3OA 5JHFA 2XZPA 3WWGA 4YEJA 4LIVA 4BQOA 2R7UA 4CCKA 2DIEA 2WAQA 1TZLA 3CJRB 4UZUA 2W1OA 2VBKA 2JJ1A 2L9NA 3DPUA 4DNRB 3OYMA 3K6GA 3PSFA 1MMNA 4NQWB 4ASUA 1O8FA 4BE2A 4U49A 4C30A 2CV0A 1OGOX 1H8HA 4NK6A 3CP2A 2Z1DA 3OW7A 1UD8A 3RPUD 4YZ0A 2OV7A 2NTBA 1SAUA 1ERDA 5HNFA 4JOMA 1MW7A 3HPGA 3E0JB 4G6TB 4E7HA 1KZLA 2GJPA 2QY1A 2KHMA 4MR0A 4OAYA 3KEWA 2EWEA 2R7QA 1D0ZA 3FBIB 4IX7A 1X19A 1AIRA 3RTRA 2CMPA 3ZRGA 3OS0A 4ZDLA 1AA7A 3N05A 1XG2A 2BVLA 2VASA 4PMHA 3ZPNA 4XD7A 4DOZA 3AL0B 4DJAA 1JTAA 2CK3A 4DNTB 3DQVC 2XF5A 3EUAA 4BQNA 3DU6A 1WJDA 2KDOA 3D5RC 1RMGA 1KCCA 1WFXA 4H4KC 4JQFA 3L2UA 2Z6BD 4NUBA 4FASD 2ODLA 3VDXA 3BC8A 4ZTFA 3OE7A 3MD2A 1BHEA 1OGMX 3L2WA 2JVGA 1V5FA 2VJIA 4ZYAA 2FUG2 3QOEA 2JSPA 2X6XA 3C2GA 1I8DA 1HG8A 4BEHB 4BE0A 3VMVA 2A5WA 2E5NA 3PSIA 5KNLA 2A6TA 3HL2A 1O8JA 3K10A 3BG7A 4LITA 2VPLA 1FX0A 2O04A 2CV1A 1H80A 2ZTGA 1N75A 5AMVA 2E5ZA 4HRIA 3A4CA 2NSPA 3L2VA 4B44A 1UD4A 3FKSA 2M5SA 4Z1MA 4KT6A 2LYCA 5CPRB 4XQFA 2ZZQA 4N4NB 4ZC3A 3G05A 4CUGA 1E3ZA 1PXZA 4OAZA 1LKXA 4BJ6C 4BGDA 4PJLA 4B47A 4E7KA 2VKDA 4II2A 1WP6A 4P5OA 5CKTA 3H94A 2WAEA 1O8IA 2F4IA 4DIQA 1O88A 4RM3A 1W36C 2LG4A 2UV1A 3ZR8X 1PLUA 3EQOA 2INVA 4KITB 2GJKA 3KX2A 2D3LA 2WA0A 3A1YA 3VSKA 1EFRA 2JVHA 1V5EA 2HDWA 3DPLC 2GOMA 2HU9A 1YX5A 2L5QA 4YZQA 4DGWB 2LREA 3OR1C 2BVMA 3OL4A 1QHGA 1Y6IA 2X1EA 2WY8Q 3OYCA 2O0WA 3GRHA 2E60A 2IGKA 2VL8A 3OR2C 2JDIA 2X6WA 3OYDA 3IUOA 4LG3A 3VMWA 3SYTA 2Z16A 2DT7B 2VXZA 3CP8A 2HVRA 1EE6A 4URRA 1QHHD 1BR4A 4HNUA 2VJJA 4PUSA 1E0EA 2DCEA 1WMRA 4XLCA 2MFZA 2LH9A 2BW3A 2W6JA 3A2KA 4PJNA 1MMGA 3VYSB 4ZDPA 1UD2A 4N4OB 1G59A 3BCDA 3KEYA 3EPZA 4OJPA 1UAAA 1O8LA 4PK4A 1MNDA 5LFAA 4TSFA 3OWTA 3OYEA 1N77A 5FRNA 1WTHD 1IA5A 2QE7A 3HOTA 3VYUB 3OMYA 4W8SA 2VJ5A 1OR7C 3H5RA 1DBOA 1O8MA 2NOJB 3VR6A 2ZSHB 2WBMA 4B43A 1S9HA 2R7TA 3OPOA 1DBGA 1JRGA 2Q1ZB 5KCMA 1WJBA 2DXIA 2WZPP 4Z03A 2L2OA 3K4BA 3W3CA 2HLDA 1NG7A 2R7OA 1VLYA 3F9KA 4YXWA 2VLAA 3NWTA 4ZDOA 3W2AA 2W6IA 2F5VA 2X6YA 3H9GA 4F52A 3EUKL 1E1RA 4CCNA 2BSPA 1KMHA 1D1BA 4OJ6A 3D5SC 2V7QA 3HKZA 2W4SA 2PJRB 2GJRA 2CUJA 3G2BA 2INUA 2XSJC 3K70C 3DEEA 4G6IA 3EQNA 4E7IA 4AU7A 2KZVA 1GQ8A 4CCJA 4NC7A 4PJJA 4E6KG 3DTEA 3GVLA 4XM3A 1MNEA 2WJYA 1LDKB 1Y56A 3KYLA 2VB6A 1WJFA 2VQCA 3QYFA 1V0EA 2L7KA 1W0JA 3U21A 4D9JA 4KKTA 3FPPA 3H5NA 2IS6A 1O8GA 2R7VA 5C1EA 4IQ4A 2LZJA 2X53S 2X85A 2IGMA 3B8YA 2CW8A 3PL8A 3KRGA 4U87A 1OLTA 2M7AA 4JMQA 1RWRA 2CUZA 4IZZA 1HVXA 2X1CA 4HEA2 3PNVA 1W36D 4U7BA 1NRKA 3GQ7A 3D5LA 4HSTA 4IKFA 4AYBA 2MC4A 2O5RA 1O8KA 3ZQQA 3TL4X 4OJOA 3OY9A 1E79A 1QU3A 5TGTA 3SEZA 1LFPA 4F55A 2PECA 2UUZA 3FHNA 4BEHA 3PUBA 4XR6A 3VWBA 1H8EA 4XONA 3GQBA 3OOCA 5DN6A 2IQ7A 3OIQA 2E1MB 1O8EA 2OC6A 1WJEA 2HPIA 4EATA 4FETA 1RU4A 2JJ2A 2XAUA 3DLAA 2VQHA 3ZCOA 3AL0C 4XLFA 3RQ4A 5HLTA 4QPOA 3DDYA 3J7AY 2JUGA 2IS2A 1OB0A 2W00A 3NWSA 3ZSCA 3IP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVZ A;  4EW9 A;  2UVF A;  1O8H A;  5C1C A;  4XOR A;  4YZQ A;  4C2L A;  4XLE A;  1OOC A;  3GRH A;  4XLH A;  2O0W A;  4U4B A;  4NK8 A;  4XN0 A;  2X6W A;  3VMW A;  3GQ8 A;  2UVE A;  2QX3 A;  1EE6 A;  4URR A;  2VJJ A;  1OFM A;  1QCX A;  2NST A;  1WMR A;  4XLC A;  3WWG A;  1VBL A;  4XMY A;  4YEJ A;  2X3H A;  2VBM A;  4OJL A;  4OJP A;  1O8L A;  2VBK A;  1IA5 A;  4XOP A;  2VBE A;  4HWV A;  1KCD A;  4W8S A;  3FY3 A;  4YEL A;  1DBO A;  1O8M A;  4XL9 A;  1O8F A;  1JRG A;  2O0V A;  4U49 A;  1DBG A;  1OGO X;  4NK6 A;  3LMW A;  4Z03 A;  4YZ0 A;  2NTB A;  4OZY A;  2PYH A;  3GQ9 A;  4W8Q A;  4XKW A;  2QY1 A;  4MR0 A;  4XN3 A;  3JUR A;  2EWE A;  3VSU A;  3ZPP A;  2X6Y A;  4Z06 A;  1PE9 A;  2QXZ A;  2BSP A;  1AIR A;  4W8R A;  2PYG A;  4OJ6 A;  2O1D A;  2NTP A;  3VST A;  1XG2 A;  4PMH A;  1IDJ A;  1JTA A;  2INU A;  4XOT A;  4OJ5 A;  3EQN A;  2NT6 A;  1X0C A;  1O8D A;  1GQ8 A;  1K5C A;  1RMG A;  1KCC A;  4XLA A;  2ODL A;  4XM3 A;  2NTQ A;  1BN8 A;  4I84 A;  1BHE A;  1OGM X;  2VJI A;  1QJV A;  1O8G A;  2O17 A;  3B90 A;  5C1E A;  3T9G A;  1KTW A;  2X6X A;  4YZX A;  2X85 A;  3B8Y A;  3KRG A;  1HG8 A;  3VMV A;  2Z8G A;  3VSV A;  1RWR A;  1O8J A;  1NHC A;  2O04 A;  1H80 A;  1IDK A;  3GQ7 A;  5AMV A;  3SUC A;  2NSP A;  3GQA A;  1O8K A;  2NZM A;  1CZF A;  4OJO A;  4XQF A;  3B4N A;  4XKV A;  4XNF A;  4OZZ A;  1PXZ A;  2PEC A;  4XR6 A;  4XON A;  2IQ7 A;  4MXN A;  4YZA A;  1O8E A;  1O8I A;  1RU4 A;  4W8T A;  1O88 A;  3EQO A;  1PLU A;  4Z05 A;  4XLF A;  3UW0 A;  2INV A;  2NT9 A;  1IB4 A;  1OFL A;  3ZSC A; 
#chains in the Genus database with same CATH topology
 1MD0 A;  1FJL A;  5HDN A;  1QZZ A;  1XB4 A;  3E6M A;  2KLO A;  1IN8 A;  1KU7 A;  1IAW A;  3RJP A;  2CF4 A;  4BBS J;  1KTV A;  1IRF A;  3P9C A;  2OBR A;  2F43 A;  2JT1 A;  2QKM B;  1JHF A;  4B48 A;  2QM3 A;  5IP6 A;  5CVV A;  1Y39 A;  3GSI A;  3BT9 A;  4PJM A;  4RGX A;  4WQM A;  2J8I A;  2VKH A;  3FXK A;  3ASP A;  5FNZ A;  3HTU A;  3ONY A;  1V5G A;  4Z4V A;  2QCO A;  3PJR A;  2NST A;  5IY5 H;  2X4H A;  1DDN A;  3RPQ A;  4II3 A;  5DCM B;  4BJT A;  3CCQ I;  1KD1 D;  2HYJ A;  4U0Y A;  1ZG3 A;  1U78 A;  4OMY A;  4UNO A;  1QQ1 A;  2M4G A;  2JSC A;  1T38 A;  1R6R A;  4PAB A;  3QOP A;  5LHH A;  2E2H J;  2HXI A;  4B4C A;  2HOS A;  4HPQ A;  3V4G A;  2KQR A;  3FK6 A;  1AHD P;  3BG6 A;  3MKZ A;  3LAJ A;  3SLN A;  2OTJ B;  1F43 A;  2O0V A;  2DFI A;  1P9Q C;  2M4K A;  4A6E A;  5K5O A;  1X1A A;  4BU2 A;  1IDY A;  1SKQ A;  4PC6 A;  2KIS A;  3JRD A;  3PUM A;  3UR3 C;  4EVI A;  3V7C A;  1JNY A;  1TLH B;  4IO9 F;  1QG0 A;  3F6O A;  2LBF A;  4KIS A;  1YTY A;  3OL3 A;  4XN3 A;  3GYH X;  4IF4 A;  1AWC A;  3JUR A;  3AKZ A;  2YX4 A;  1E1Q A;  5JLW A;  4Z06 A;  4Y4R A;  4YFN F;  1PE9 A;  2R5Z B;  1Q82 D;  4XLP F;  2UXN A;  4I99 C;  2PYG A;  2HOT A;  5ICF A;  2NTP A;  2VFM A;  2KMU A;  3ASQ A;  2VBY A;  3H3V K;  2A5Y B;  2DFF A;  2HVQ A;  3JTG A;  5LHI A;  1ZTR A;  1ON1 A;  2R7F A;  2VNI A;  1SC7 A;  3BR0 A;  5D6F A;  2FSW A;  5ED4 A;  1O8D A;  3I5U A;  1G8X A;  4MEY F;  3VYR B;  3BH7 B;  3N97 A;  1FC3 A;  4DQK A;  2OAZ A;  2NTQ A;  4YAL A;  3E1Y E;  1IHM A;  3VO1 A;  1O3T A;  2BM0 A;  2CH0 A;  2H6B A;  2JA5 J;  1KK0 A;  4HF1 A;  1D1C A;  2PJR A;  1BC8 C;  3BOQ A;  1HF0 A;  2M7B A;  3VSL A;  3AG3 H;  2M8G X;  2XNJ A;  3H9Q A;  4HYE A;  2OPT A;  2LOO A;  3SFZ A;  1YW8 A;  2R7R A;  2XVC A;  1T39 A;  3FXQ A;  2OA4 A;  3K4J A;  4HBL A;  4M3D A;  3CME I;  1C0W A;  1J9I A;  1OYI A;  1K4Z A;  3LA7 A;  1G4D A;  2HWV A;  2C78 A;  5HS7 A;  5FD5 A;  4XRF A;  2BE5 F;  1JKR C;  4PC1 A;  1X1B A;  3FMQ A;  2EZL A;  1FBU A;  5GTH C;  3AVY A;  5FKM A;  3G3Z A;  3JAM Z;  3MKL A;  4Y9U A;  1V55 H;  4N0B A;  3U2Q A;  2BEO A;  2X0K A;  2DK8 A;  3ZQI A;  4W8T A;  2MH9 A;  4BUP A;  4DW6 A;  4G1V A;  4YRV A;  4A3G J;  3ZIA A;  3NB2 A;  4KJZ A;  1BR1 A;  1UHM A;  4ESJ A;  3CUO A;  4RD6 A;  3JRA A;  1H0M A;  1YW9 A;  4OPW A;  1O8H A;  4UUS A;  1E43 A;  4H9G A;  1M1E B;  3V42 A;  3Q9S A;  2LR8 A;  1IRZ A;  1IG7 A;  2IS1 A;  2NVY J;  2ZO4 A;  1MSF C;  4M72 A;  2NS0 A;  1XMK A;  2KRF A;  4C9Y A;  3WOD F;  1R7J A;  4M3E A;  5J4V A;  1FSH A;  2XGC A;  2OZ6 A;  3LSI A;  1RQR A;  3KFW X;  4EM0 B;  3HBL A;  1BC7 C;  1SD5 A;  4NBQ A;  4MFE A;  3ZMU A;  1A35 A;  3M8F A;  1HC8 A;  1XD7 A;  5LGT A;  2VFN A;  4RD4 A;  1EZG A;  4MLO A;  2IAI A;  1A5J A;  3BRO A;  1R5O A;  2FA5 A;  4IXA A;  3C2H A;  3WXM A;  4Z4W A;  1K4S A;  4MHG A;  2K7L A;  2K9M A;  4HA8 A;  2RC4 A;  4G12 A;  3HIF A;  2DLL A;  3HZJ A;  3SXY A;  2R7W A;  2XNC A;  1K7A A;  1B59 A;  3HOS A;  3J80 Z;  3FXR A;  1J9Z A;  1UZC A;  4ESB A;  1EH7 A;  2V31 A;  3QYE A;  5LRS A;  5IOY A;  2RC5 A;  1I50 J;  4FE4 A;  4MTD A;  2R7S A;  4MFD A;  2EFP A;  3N4M A;  3CF2 A;  4RS8 A;  4CH7 A;  1VQ4 B;  3RKW A;  1SEU A;  4KDP A;  3J81 K;  2Z9O A;  4V02 C;  3ZQC A;  3LNN A;  4NNJ A;  3CCV I;  1XPX A;  1HKS A;  2ZL5 A;  3BCA A;  2MGQ A;  2NVT J;  2O1D A;  2VBS A;  4B3G A;  2O0Y A;  3G6E B;  1XCB A;  3ONU A;  3WQZ A;  1EFT A;  1UEL B;  2KIU A;  2CND A;  4Y7N J;  1W5C C;  2NT6 A;  1JT0 A;  1K79 A;  5K7F A;  4X0G A;  3K4M A;  1JJ6 C;  2Y0M A;  4PSW A;  4KKS A;  1F5T A;  3G71 B;  1XGN A;  2Z3Y A;  4ZYE A;  4N3N A;  4G94 A;  3RZD J;  1LLZ A;  5CQE A;  1XC5 A;  3CJQ B;  1FMV A;  3A03 A;  4CSW A;  1ACI A;  2IJL A;  3MMY B;  1KJZ A;  2VKE A;  3O8G A;  4XKB A;  3HGY A;  1U5T C;  1KQ9 A;  2CRG A;  4CXF A;  1OCZ H;  3EUH C;  3V7S A;  4EV0 A;  3VNV A;  1BI0 A;  2V1N A;  2BV6 A;  2DQR A;  1TW3 A;  2KIM A;  1H9G A;  2RQP A;  1NDH A;  2J5P A;  5L3G A;  2X1D A;  2R5Y B;  1IF1 A;  1YW7 A;  3DKY A;  1COW A;  3ESW B;  1DDG A;  1IDK A;  1OR7 A;  1V4R A;  1ZGJ A;  3F22 A;  3ZN0 A;  3SUC A;  2LLK A;  5B66 C;  5CYV A;  5EEH A;  1CZF A;  2PE3 A;  1N78 A;  3L7W A;  2ZME A;  4XKV A;  3B4N A;  3DEW A;  2LY9 A;  1VQM I;  4OZZ A;  1Y8Q B;  2E1B A;  1HW2 A;  4X06 A;  4D5F A;  4YIF A;  4PGG A;  3QOD A;  2ESH A;  3U2R A;  1CF7 B;  3DU5 A;  4BL0 B;  2V4D A;  1JTY A;  4IHY A;  4L5E A;  2Q8K A;  2WSS A;  5A88 A;  1CLW A;  1FYK A;  3FM5 A;  2R92 J;  1FTT A;  2W82 A;  1MKM A;  4DK1 A;  3QP5 A;  4IRG A;  4UV8 A;  1K28 D;  1R5B A;  2GQQ A;  2VBT A;  1FWZ A;  1TP4 A;  3GLL A;  4PC3 A;  3W2F A;  4GQN A;  1JI8 A;  3WGH A;  2B7B A;  1BQE A;  5EF6 A;  3BR2 A;  3BJO A;  2PMH A;  1RR8 C;  5IYP A;  5C1C A;  2ZTN A;  2GK7 A;  2VFO A;  3QU3 A;  1HLV A;  2BM4 A;  4TMX A;  3CCS B;  1ZG5 A;  2ZKZ A;  1VQK I;  4XLH A;  3SQN A;  5CDF A;  2W48 A;  4RA2 A;  1AKH B;  3UNG C;  2D3N A;  2XKP A;  1TWF J;  1YJ9 I;  1TWA J;  4WWC A;  2M34 A;  1N08 A;  3LSH A;  1G7R A;  3HYI A;  1ZEL A;  2H8W A;  3OIP A;  3L09 A;  3LQR A;  2HXO A;  3JTH A;  2F4O B;  2JN9 A;  3HHH A;  1E3P A;  1LDJ A;  1SD7 A;  4ITV A;  5JHF A;  3S3O A;  4X7E A;  3WWG A;  3F6V A;  2DIE A;  4ZCL A;  1TZL A;  2V6C A;  1ZG1 A;  2Q6K A;  3ZQ7 A;  3WBJ A;  1MMS A;  1GO2 A;  3DEU A;  1YLO A;  5DEQ A;  2VBK A;  1LM1 A;  2XT2 A;  2FX0 A;  2PFB A;  1ETX A;  1DU6 A;  4OIP F;  2PX9 A;  4C30 A;  2C5H A;  1R5H A;  2CV0 A;  3DU1 X;  3GLX A;  5AIQ A;  3RPU D;  2IBD A;  4YZ0 A;  2OV7 A;  1FX7 A;  4IVN A;  2EFG A;  3WE2 A;  4G6T B;  4E7H A;  3HEF A;  2IW5 A;  2KHM A;  3EET A;  4Z2Y A;  4OAY A;  2EWE A;  1TQI A;  4IX7 A;  3BQZ A;  4I0B A;  4A0Z A;  2HTS A;  3HKZ N;  3QE2 A;  2L54 A;  1AIR A;  2CMP A;  2OTL I;  3S14 J;  3OW2 B;  3M07 A;  5DDG A;  2K27 A;  3M1E A;  3F23 A;  1X2M A;  3PSZ A;  4PMH A;  3ZPN A;  2EJR A;  3WY9 A;  2O6W A;  4DOZ A;  3MEX A;  3E6C C;  3ZZU A;  2XPU A;  1EA0 A;  1R4M B;  3EUA A;  4ACA A;  3I1F A;  1RES A;  1A8P A;  3D5R C;  4N3G A;  4UV9 A;  1B8I B;  1OCT C;  3BJ6 A;  1LLW A;  4A3K J;  3LQE A;  2J7K A;  2FMY A;  1E3O C;  1ZAO A;  3BC8 A;  1ZYR F;  4D5C A;  5DD4 A;  3CO7 C;  4QV2 A;  1TSP A;  3PM1 A;  1LE8 B;  1VHE A;  1V5F A;  4DQ2 A;  1VQ8 B;  1STZ A;  2FUG 2;  1QFJ A;  1B72 A;  3QOE A;  3H36 A;  2JSP A;  1F4K A;  4A3L J;  4A3J J;  1G7C A;  3SLD A;  2K4J A;  3WG9 A;  1U8B A;  1HG8 A;  4BEH B;  5ICC A;  2E5N A;  3AVX A;  3PSI A;  5D5V B;  2BVN A;  3RDI A;  2NXN B;  1YIO A;  4KIC A;  3ECO A;  3K10 A;  3RKY A;  3BG7 A;  3HL2 A;  2HOE A;  4H0E A;  1VQN I;  2VOO A;  1W35 A;  2LF8 A;  3HHG A;  1WSU A;  5AMV A;  1J2X A;  3R60 A;  4FCY A;  2DDB A;  2M87 A;  3GW2 A;  1K78 A;  2M5S A;  1TTT A;  1CGP A;  2LYC A;  4XQF A;  1WRJ A;  3A01 B;  2CFX A;  2VE9 A;  4ENJ A;  3G05 A;  4UB6 C;  3PUF A;  2Y31 A;  2CQN A;  2ZXW H;  4IJA A;  2VKD A;  2YSR A;  3DCF A;  1W7P B;  3E5Q A;  3ROU A;  3LNQ A;  4IRI A;  4LGW A;  3PIO F;  3HOX J;  3ML6 A;  1O8I A;  2F4I A;  2CW0 F;  2YWH A;  1O88 A;  3EQO A;  3FK7 A;  1FYM A;  3I0T A;  2PLF A;  4A12 A;  1NB9 A;  5IT9 Z;  1YRN A;  2HQN A;  3BTI A;  3VSK A;  5A2Q K;  1FOK A;  3I59 B;  1XGS A;  2HDW A;  4QWQ A;  4RDK A;  4ZCM A;  4UXN A;  2GOM A;  2XHK A;  3ULQ B;  3VPR A;  1CQT A;  1GAW A;  3OL4 A;  1MRZ A;  2O0W A;  3MAJ A;  1GUU A;  4EJO A;  3CCM I;  3B82 A;  2WWY A;  3OYD A;  4CYC B;  2W7Z A;  3SYJ A;  4WZT A;  3SYT A;  2Z16 A;  4C2M J;  1G3W A;  2DI3 A;  2BZT A;  2FEZ A;  3WHB A;  1WH7 A;  2DDA A;  3WND A;  3G1M A;  2DCE A;  3ZQL A;  4XLC A;  1WMR A;  2ECC A;  3H1C A;  2DOD A;  4PJN A;  1IGN A;  1HCR A;  5C44 J;  2PJP A;  1QFY A;  3BCD A;  2QQ9 A;  3EPZ A;  4RM0 A;  4TMZ A;  1O8L A;  3MWM A;  1KU3 A;  1MND A;  4TSF A;  4E70 A;  1TBX A;  1N77 A;  1TNT A;  1QFZ A;  2QE7 A;  1X3Z B;  2HMA A;  1Y0U A;  2QUF A;  4PC2 A;  3H5R A;  3ASR A;  3X2Q H;  2ZSH B;  3SDG A;  1MSE C;  1S9H A;  2R7T A;  1KQ5 A;  1SVL A;  1QRY A;  4BBR J;  2O3F A;  4L5I A;  3K1P A;  5B1B H;  4HW0 A;  4D0P A;  2K9Q A;  5KCM A;  2DXI A;  1XN7 A;  3K69 A;  3Q0U A;  2L2O A;  1NG7 A;  5FKL A;  2R7O A;  4YXW A;  3W2A A;  4IOA F;  1ZHF A;  4F52 A;  2XAJ A;  4UHT A;  3CME B;  2OBS A;  2WTE A;  2MH2 A;  4NQW A;  1HW5 A;  2I1L A;  3ZMZ A;  3HKZ A;  3V7A A;  4BHP A;  1R49 A;  4NBS A;  2LMD A;  4B3A A;  3WTS C;  4KT5 C;  2BX6 A;  5H5J A;  2DY1 A;  1JB9 A;  2B0L A;  1REP C;  3O6B B;  3IH4 A;  3Q3S A;  1EKE A;  4AF7 A;  4IHV A;  4AU7 A;  2KZV A;  3CC4 B;  2F5D A;  2QQ8 A;  4NC7 A;  1YG2 A;  3H3Z A;  4GGG A;  3DTE A;  4PJJ A;  4M9Z A;  4XM3 A;  2HDD A;  2R7Z J;  2COM A;  2WJY A;  1T2K A;  1POG A;  5DCF A;  5F0C A;  3I71 A;  2VQC A;  2EIK H;  1B6A A;  3GF2 A;  4N9H A;  3LSR A;  1WU8 A;  2VBV A;  4D9J A;  4KKT A;  2DK5 A;  3H5N A;  1BI2 A;  3GTG J;  2IS6 A;  4IQ4 A;  1W0U A;  1BX1 A;  2E34 A;  4RB0 A;  5GAH J;  2M7A A;  1BJA A;  1NK2 P;  5D5U B;  2P7V B;  1ZH5 A;  4IZZ A;  1HVX A;  3R61 A;  2QTL A;  3PNV A;  4R8H A;  1W36 D;  5H59 A;  1XSX A;  3D5L A;  2J8K A;  2CQX A;  3GEZ A;  4RD1 A;  3H09 A;  3ZQQ A;  3S1R J;  3OY9 A;  3FXU A;  2V1U A;  3R6S A;  1QU3 A;  2NNN A;  2PEC A;  2QWW A;  3ERM A;  3SJM A;  1N25 A;  4WZL A;  3CC2 I;  4XR6 A;  1IV8 A;  3LOC A;  3W6J B;  3CDH A;  3P7N A;  3A0H C;  1O8E A;  2ZJ2 A;  2HYG D;  4EAT A;  1RU4 A;  2XB0 X;  2EV0 A;  2LD5 A;  3DLA A;  2PMD A;  3OZU A;  2XTY A;  1J59 A;  4EJT A;  5HLT A;  2ICW G;  3AG4 H;  4LJZ F;  3KZI C;  2IOU G;  2XUB A;  4G6Q A;  1OB0 A;  1T08 B;  1CQX A;  3MMP A;  2QGG A;  3E6B A;  4YAU A;  2IXS A;  4I0A A;  1E64 A;  4I02 A;  3ES9 A;  3HOV J;  3CXC B;  1HSJ A;  3QAH A;  1IRG A;  4KMU X;  2KIQ A;  2ZXH A;  1ZUN B;  5JVG F;  4ENN A;  4RPB A;  5DUI A;  1UST A;  5K7H A;  3HDD A;  1FTZ A;  2DA3 A;  2OU2 A;  2XF7 A;  3DPT A;  1MH3 A;  3K4C A;  1JHH A;  3WGI A;  3JU4 A;  1FRQ A;  3TOA A;  4Z4S A;  3AVV A;  3HRM A;  3IH3 A;  5FLX Z;  2QX3 A;  1SMT A;  2XGJ A;  3CCV B;  2EIM H;  3PFY A;  4UB8 C;  3DTI A;  1I1G A;  3GTK J;  2M0C A;  1OFM A;  1GXQ A;  3S16 J;  3DTK A;  2ZBU A;  3AVU A;  4G8X A;  3B73 A;  2KRH A;  1FBS A;  1SKY B;  5HNH A;  2Q2E B;  4OJL A;  4G7H F;  1LB2 A;  1UMK A;  1S5L C;  4Q47 A;  3WU0 A;  4AC0 A;  5E18 F;  2STW A;  4BY1 J;  2BY2 A;  1U5T B;  4BDY A;  2XF6 A;  2WAD A;  5IK2 A;  4YCQ A;  3VB2 A;  4DBQ A;  1V5V A;  1BJZ A;  3VOD A;  1QA3 A;  4ETS A;  5F1J A;  2CRV A;  3UKG A;  2ZIT A;  2PI0 A;  2GLO A;  4Z4Z A;  4AIJ A;  4YAW A;  4ZCI A;  4BHB A;  2EQR A;  2FJ1 A;  3GWZ A;  3TDU C;  4TT3 A;  3SKB A;  3SZG A;  4KNY A;  3BCB A;  2V7V A;  2PYH A;  5J1U A;  1VLO A;  2EK5 A;  4P55 A;  2Y30 A;  2QA4 I;  4I2O A;  4IHS A;  4LC0 A;  1TQM A;  4RB2 C;  1NK3 P;  4D7N A;  3VNU A;  5F04 A;  4XRS A;  3GVJ A;  1W34 A;  4AF6 A;  1W87 A;  2PN6 A;  1OB2 A;  4FWT A;  2XND A;  2ZJR F;  2JK3 A;  2HQA A;  3I56 I;  4ACB A;  2P7C B;  3I3L A;  2HZD A;  2CV2 A;  2NOG A;  1IDJ A;  3GVK A;  2DTR A;  4XOT A;  3CCE I;  1VQM B;  3N6Z A;  2M30 A;  2O8X A;  4RDJ A;  1K5C A;  4XLA A;  2V9P A;  3JRH A;  3WU2 C;  1PVE A;  2YUH A;  4YDT A;  1EXM A;  4I84 A;  3GBG A;  3KZZ A;  1PDN C;  3I9V 2;  2FQ3 A;  5C3E J;  2Y0S N;  1QO0 D;  3K4L A;  3L2R A;  1NTC A;  2K9L A;  4CZC A;  1QJV A;  4LLG F;  3FX3 A;  1MMA A;  5KVR A;  5BPI A;  2XC7 A;  4X7D A;  3RIR A;  1IN6 A;  3S17 J;  1OGJ A;  3Q3A A;  5JFR A;  4WF2 A;  2HNH A;  4RD0 A;  2D1H A;  4F93 B;  3K2Z A;  3HAG A;  3OOU A;  1VQK B;  4MGR A;  1ELO A;  2KFD A;  2MYS A;  2PMZ N;  1QGZ A;  3LFK A;  1LVK A;  3OFN A;  2VOP A;  1YJ9 B;  2GOX B;  4P26 A;  5J8C A;  1FIP A;  4CCL A;  4A3M J;  2IPQ X;  4CCO A;  1GVD A;  3DBH B;  2XTW A;  2C5B A;  1DDI A;  4HSR A;  3CCL I;  2JRT A;  2EA2 A;  4HQE A;  1ZLJ A;  4LK1 F;  3LSP A;  3AK5 A;  4GDF A;  2LK2 A;  5KHD A;  4E7S A;  1TNS A;  3W6V A;  1FBQ A;  1RI7 A;  2D2W A;  2KPM A;  5FKK A;  1Y0Y A;  3OEE A;  1VQL I;  1Z3X A;  1HDP A;  5B6I A;  1MDM B;  2YS9 A;  4U0V A;  2V7T A;  3R4K A;  2DMP A;  2DT6 A;  3DXJ F;  4PCQ A;  5JR3 A;  1VQ5 I;  3H35 A;  3PQJ A;  2ZB9 A;  4EM1 A;  2XRO A;  1VJS A;  1FLI A;  3OYH A;  3OAA A;  1Y0N A;  2D45 A;  4K1X A;  1KZH A;  4R79 A;  5TRD A;  2K3P A;  1M1K D;  2W7N A;  4HDU A;  2VBX A;  4MQ9 F;  3IRR A;  2XAF A;  3OSF A;  4P22 A;  2MBF A;  3ML3 A;  4U4B A;  1WSR A;  2ZSI B;  1TUI A;  4NC8 A;  4E7L A;  2K4B A;  1F20 A;  1VZ0 A;  5EGO B;  1XSD A;  1W7P D;  2M0M A;  2RNJ A;  3WTZ A;  3WYA A;  2PG4 A;  2KRC A;  1R9T J;  4S0H B;  1S7O A;  5LMZ A;  4M74 A;  5L46 A;  4L0Y B;  3ZMV A;  3ZMT A;  1QCX A;  4HF2 A;  3PVD A;  3RY8 A;  2OTL B;  1PXZ A;  4CQJ A;  1EA3 A;  1VBL A;  2XPV A;  1OFC X;  2P4W A;  3SFI A;  1MBH A;  1QGA A;  3GFI A;  2VN2 A;  3TQN A;  2EFQ A;  2B5O A;  4I09 A;  1NBM A;  3LA2 A;  2E7X A;  3A1P A;  4ZJZ A;  5LLQ A;  5HOD A;  3OIO A;  2EV5 A;  2XRL A;  3V76 A;  1YJN B;  2CSO A;  4U7D A;  4RMN A;  3R6K A;  2QGU A;  1WQ2 A;  2BBY A;  4UZF A;  2DTZ A;  4QPQ A;  1WOS A;  2XAH A;  3OS1 A;  2ACJ A;  4X7F A;  3FDY A;  1ZLK A;  3ECH A;  5H6R A;  1O8M A;  3E6D A;  1SVM A;  4JX5 A;  4KH3 A;  2XZO A;  1FP2 A;  3OYB A;  2J5O A;  4D1Q A;  1UHW A;  1Z0X A;  1ZRF A;  3KE2 A;  2P6S A;  3L2Q A;  1PUF B;  1FT9 A;  3V7R A;  4R1H A;  4BXX J;  1XMX A;  1GDT A;  1TYU A;  4KIB A;  1VQN B;  1BN5 A;  4TMV A;  3MFK A;  3LSJ A;  1A6Q A;  1PJR A;  2GIZ A;  3H5A A;  2STT A;  1LNW A;  3S1M J;  4C2T A;  2LC2 A;  5IYR A;  2MA3 A;  4DBR A;  2B63 J;  4Z4Y A;  1LFB A;  2R9V A;  3HB9 A;  4BXU A;  2OYN A;  2FRH A;  3IAS 2;  1O57 A;  1RET A;  1TLL A;  4HX4 A;  3R0J A;  2L9S A;  4LOC A;  2XSD C;  3P5J A;  5FL7 A;  3KP6 A;  2H6C A;  1SAN A;  2RQQ A;  1D5Y A;  3S93 A;  4ANJ A;  2JJ7 A;  2UZK A;  3COA C;  3T9G A;  2PQ8 A;  2Y0S A;  2CW7 A;  5K5Q A;  3ZBT A;  2LDU A;  1WJ5 A;  3PUN A;  3W2W A;  4EGY A;  3OYG A;  1QH0 A;  2Z8G A;  3GUD A;  5B5E C;  1IV6 A;  4OOX A;  1K6Y A;  4GYI A;  1TWG J;  4L8J A;  1F9N A;  3WTY C;  2IGO A;  3CUQ A;  3T53 B;  2D74 A;  3FF5 A;  5IYC J;  3CCM B;  3FXM A;  2HOA A;  4BE1 A;  2PMZ A;  5IPA A;  2PEX A;  1P4W A;  2K02 A;  4F91 B;  1XSV A;  4IL6 C;  1NJI D;  2BF4 A;  4PGO A;  2BOL A;  3MKY B;  3DWL E;  3PET A;  1K73 D;  1D0X A;  3T56 B;  2V1D A;  4MXN A;  1WJC A;  3KZY A;  4U0W A;  1WJA A;  2OUM A;  5F1R A;  2BYV E;  3OYJ A;  2AXL A;  3MQ0 A;  4BS9 A;  4E4H A;  4I98 B;  3BR6 A;  2V6E A;  2QLZ A;  2YR2 A;  2WV0 A;  2HI3 A;  3JAM K;  4AVZ A;  1MGT A;  2GIV A;  3L2C A;  2L9V A;  3H0D A;  1Z21 A;  3PFI A;  2Q6I A;  3TW6 A;  5J1Y A;  4G7X A;  2UVF A;  3P4G A;  4KMF A;  2BW3 B;  3BZ6 A;  2KP6 A;  1KYW A;  3QRF F;  1H8A C;  5GPC A;  2WPD A;  3FHZ A;  3SZP A;  1I6H J;  2XDV A;  2ZME C;  2P0W A;  3D26 A;  1IXC A;  1EH6 A;  1X3U A;  2M2E A;  2MLK A;  5D4S A;  3ZN1 A;  4F7Z A;  3ZP5 A;  1N06 A;  2L7F P;  1IJW C;  4CHU A;  4A0X A;  5TV2 A;  3W5H A;  3HOU J;  3AG2 H;  2EV6 A;  1OCC H;  3HXL A;  5DYM A;  1WI9 A;  4CA0 A;  3HOZ J;  1KQ8 A;  2X6O A;  4HV5 A;  4CCK A;  1FNN A;  2YU9 J;  2FML A;  1XGM A;  3QPT A;  3MN2 A;  2DJN A;  3JQP A;  2L02 A;  1KGS A;  1WHU A;  2IP2 A;  2L9N A;  3CDI A;  4Q48 A;  5CVJ A;  2ZBV A;  2FOW A;  3N90 A;  1R4N B;  1T6X A;  4A3I J;  4EEF G;  2CUF A;  1EF4 A;  4NK6 A;  2C4T A;  2ZBK A;  4WXC A;  1P7I A;  3AG1 H;  1UJ8 A;  3OW7 A;  2XGX A;  3I55 I;  2IA0 A;  1IW7 F;  2DA5 A;  4HNV A;  4JOM A;  5HNF A;  2L7Z A;  1MW7 A;  1WH5 A;  1VQ9 I;  1KZL A;  1EFC A;  2TCT A;  2GJP A;  3T8T A;  4NB5 A;  5CVR A;  3J80 K;  2R7Q A;  1D0Z A;  1RNL A;  2LF7 A;  3QPL A;  3S1Q J;  1X19 A;  5AN9 A;  1AU7 A;  3RTR A;  1GXP A;  2K85 A;  4ZDL A;  5B1A H;  4O6J A;  2GBY A;  3CCR I;  3OZV A;  3N05 A;  2TDX A;  5IP7 J;  1XG2 A;  2BVL A;  3EQL F;  4XD7 A;  1KA8 A;  4DJA A;  4G7Z F;  3BG9 A;  4LB6 B;  4HQM A;  3PO2 J;  4DNT B;  2E2I J;  2XF5 A;  4P12 A;  4OPO A;  4HLY A;  3CC2 B;  1RMG A;  2DA1 A;  2Z6B D;  2DO7 A;  3VDX A;  2D5V A;  4HAM A;  1E3H A;  1ORK A;  4A6D A;  4ZTF A;  3O2P E;  3MD2 A;  3FJO A;  1LVA A;  3L2W A;  2JVG A;  2VJI A;  3MZY A;  2VNJ A;  2CQ7 A;  5CVI A;  3Q6Q A;  3RQI A;  3C2G A;  1SFU A;  3AGP A;  4A5N A;  3BQJ A;  2VBZ A;  5KSW B;  2DW4 A;  3FZV A;  1W0T A;  2L4A A;  1TWC J;  2A6T A;  3P26 A;  2QYO A;  3S2W A;  2VPL A;  1FX0 A;  3GZN B;  2O04 A;  3L1P A;  4AYB N;  1VHO A;  1N75 A;  2XEX A;  3A4C A;  1UD4 A;  3ZQG A;  4B44 A;  4B09 A;  5EG0 B;  1BI3 A;  1Q1H A;  4KT6 A;  3GTJ J;  4V2G A;  3CJN A;  4N4N B;  4ZC3 A;  2NAZ A;  4CUG A;  3U9G A;  1WZ2 A;  5F08 A;  2PBI A;  4Y52 J;  1GT0 C;  4PJL A;  1OCR H;  4E7K A;  3B02 A;  4U88 A;  4II2 A;  5J35 A;  1FOX A;  4P2N A;  4P5O A;  3H94 A;  1N0V C;  2H94 A;  4A3C J;  1P92 A;  2M9H A;  3CDL A;  2MLG A;  4RM3 A;  2LG4 A;  2UV1 A;  5FKO A;  3H9N A;  2IA2 A;  1PLU A;  4UVA A;  4EH1 A;  4ON0 A;  4HF0 A;  4OMZ A;  4CZZ A;  1JT6 A;  1YHQ I;  5FLV A;  2INV A;  2ZXJ A;  2GJK A;  2FNA A;  1KRH A;  5JMC B;  4CO8 A;  2JVH A;  1V5E A;  5F6F A;  2W85 A;  1JGG A;  2EZH A;  1YX5 A;  2HYF A;  5HZB A;  4MQV A;  2A05 A;  1I3A A;  2P81 A;  3OR1 C;  1QHG A;  1Y6I A;  4LG0 A;  1ETY A;  3HOY J;  1BJK A;  5LRR A;  3GRH A;  4U9U A;  3GTM J;  4ABZ A;  3KP5 A;  3GFL A;  2QA4 B;  3IUO A;  3E3V A;  1ZM2 A;  3VMW A;  2BY0 A;  1Q1V A;  2UXX A;  1SFO J;  3CP8 A;  2VXZ A;  5M5X J;  1EE6 A;  4URR A;  4HNU A;  1FSE A;  3J81 k;  1ETO A;  4PUS A;  1E0E A;  2CYY A;  2W6J A;  3I56 B;  1U8R A;  3A2K A;  1UD2 A;  4N4O B;  1G59 A;  4B4D A;  3KEY A;  2XGE A;  5HZA A;  4OJP A;  4K2E A;  3CCE B;  2VNK A;  3I4M J;  3TO7 A;  5FRN A;  3K9T A;  2ZNY A;  3C3W A;  4P96 A;  1ONV A;  4ZZL A;  3HOT A;  2DYI A;  3G4S I;  2GZW A;  1QBJ A;  2GRE A;  2ZCW A;  2VJ5 A;  4W8S A;  2LP0 A;  2OCC H;  1DBO A;  3GZ6 A;  3VR6 A;  2I10 A;  3OPO A;  1ODD A;  4WWV A;  3AAF A;  1LEB A;  1ZR2 A;  2OK7 A;  2V79 A;  4QVA A;  1R00 A;  1BA5 A;  5FFZ A;  1H85 A;  3HSE A;  1OGI A;  4OOS A;  2PIA A;  3REO A;  1WI3 A;  2NYX A;  3Q6R A;  2WZP P;  5FFX A;  2O03 A;  3K4B A;  1N0U A;  4L9V A;  3D1N I;  2DA2 A;  4L0Z B;  3A8J A;  4ZYG A;  3WNC A;  2ZFW A;  2K40 A;  3GXO A;  2F5V A;  2X6Y A;  3H9G A;  4BYY A;  2W6I A;  4M0L A;  4CCN A;  4X05 A;  4EJW A;  4Z4U A;  2WZN A;  3IHU A;  3AGQ A;  3D5S C;  2V7Q A;  2W4S A;  2PJR B;  4LFU A;  1TTY A;  2XAQ A;  2GJR A;  3PIP F;  1YJW I;  1OYW A;  1BBY A;  2NVX J;  1IDZ A;  4G1B A;  2XSJ C;  3SJZ A;  3K70 C;  4G6I A;  3NRV A;  1MBF A;  3CCL B;  4ZZD A;  4CCJ A;  3JRC A;  4M6V A;  5DV5 A;  1KU9 A;  3KLO A;  4P9S A;  4ROX A;  3VMF A;  2F3L A;  6PAX A;  3BNW A;  2M1B A;  1MJA A;  3SEJ A;  1Z1D A;  2RN7 A;  3M4O J;  3QYF A;  3QQA A;  1BI1 A;  3G1O A;  2DPU A;  1VQL B;  1W0J A;  2CW5 A;  3FPP A;  2R7V A;  2LZJ A;  3S2D J;  1ZGA A;  2QBY A;  1VQ5 B;  2HDC A;  2CW8 A;  3HSR A;  2KJB A;  3WE3 A;  4B1R A;  2JA7 J;  3LJY A;  4JMQ A;  1RWR A;  1MBK A;  2CUZ A;  2DYR H;  3IKV A;  4U7B A;  3WHC A;  4IOC F;  1T0F A;  3E7L A;  4DNC A;  1NRK A;  3LO8 A;  3SZE A;  4HST A;  1KK3 A;  4AYB A;  2MC4 A;  3Q5F A;  3M7G A;  3TL4 X;  1HST A;  1R22 A;  3WBK A;  4OIO F;  5TGT A;  2QSG X;  5K5R A;  4F55 A;  3I58 A;  2R3S A;  3FHN A;  2DFH A;  4UUS B;  1FOY A;  2VT2 A;  4XON A;  1U6G A;  2HEO A;  3GQB A;  5DN6 A;  2W25 A;  2G7H A;  5BOX A;  5GAD J;  2D1V A;  3CLQ A;  4FE7 A;  3H0G J;  4KIF A;  4XID A;  2ZJQ F;  3AL0 C;  2BM6 A;  4XLF A;  3IL2 A;  5B3S H;  2FU4 A;  1OQY A;  2XB5 A;  3CF5 F;  2XZP A;  2W00 A;  3C2B A;  3NWS A;  2R7U A;  1IXS B;  3IP4 B;  1GHC A;  1PJ5 A;  1GV2 A;  3OV8 A;  3GTP J;  1VF9 A;  1W4M A;  3BY6 A;  3JRB A;  5E3N A;  3V8J A;  3T0Y A;  4XLE A;  4BXF A;  3S3M A;  2B0R A;  2DA4 A;  3TP0 A;  1XDS A;  3DLL F;  4BDZ A;  4YFO A;  1HW1 A;  1YI2 I;  3S1N J;  5IT9 K;  2LKP A;  1WPK A;  2A69 F;  3ZGK A;  1IC8 A;  1GV5 A;  4PDK A;  4FK8 A;  1TW2 A;  1I3Q J;  1RKW A;  4KN4 X;  5J4Y A;  3CCQ B;  2DU9 A;  3KP3 A;  3EUH A;  2HPM A;  4RLQ A;  3W6K B;  3RYP A;  3BLY A;  1YX3 A;  4EMS A;  5J40 A;  3K1M A;  2FNP A;  2EIL H;  1ETQ A;  1HA8 A;  3S32 A;  1HF2 A;  2IA1 A;  3BPV A;  1WXR A;  2FBK A;  1QUF A;  4FQG A;  1ETK A;  2NV4 A;  3VYT B;  3WNB A;  5LEJ A;  3S15 J;  4M6Y A;  4XL9 A;  1FMW A;  4Y17 A;  5E3L A;  2H1L A;  2FX3 A;  2DQL A;  1X4P A;  2WAF A;  3HTS B;  4OIR F;  1RRJ A;  2Y48 A;  4QUZ A;  2LKS A;  1D8T A;  3NE5 B;  4P1V A;  3KP2 A;  3EDP A;  3TED A;  4OZY A;  4AC9 A;  1DPU A;  1X1D A;  3GQ9 A;  1PYV A;  1QNT A;  4NC6 A;  4W8Q A;  2M3A A;  1QA1 A;  4BQQ A;  4ZV4 A;  3AFH A;  3R0A A;  4LLL A;  4IHW A;  1EP3 B;  1DGW Y;  1I1S A;  2BM5 A;  2QKL B;  4HNT A;  3DKW A;  1Z77 A;  4P6Y A;  5LBQ A;  3FKJ A;  2F6C A;  4KN7 X;  3E97 A;  1T33 A;  2K5C A;  3DP7 A;  1TT5 B;  2Y69 H;  3Q39 A;  3RSN A;  3KIO A;  2GXB A;  4G7W A;  4PJ0 C;  3L9F A;  4RDL A;  4Y33 A;  1ENH A;  1ZM4 A;  2NVU B;  2VJ4 A;  2LY2 A;  1X0C A;  2TRT A;  1TWH J;  2O8K A;  3SDB A;  1OCO H;  3ASN H;  5KK1 A;  1R1T A;  2E36 A;  1HXD A;  2ZJP F;  4Z6Y A;  1BN8 A;  5FKN A;  4OIN F;  4PAA A;  1QVU A;  4PSX A;  1T6Z A;  2GAU A;  5D8K B;  2A68 F;  2RRE A;  2VOD A;  2VC1 A;  1ZR4 A;  2Z5U A;  1QA2 A;  1DU0 A;  2ZME B;  2I8D A;  4PZJ A;  5IP9 J;  4YZX A;  1MMD A;  4P9F A;  1G3Y A;  4PFO A;  4QHY A;  3DBL B;  3OYF A;  5F64 A;  1JKO C;  1XGO A;  3VSV A;  1J7K A;  1U9N A;  3BTL A;  2V9K A;  1BX0 A;  4EM2 A;  1OPC A;  1IRX A;  4EJU A;  5L3E A;  3PA2 A;  5F4O A;  1QX4 A;  2VFQ A;  2PLY A;  3RCO A;  2L4M A;  1YYV A;  2DOE A;  1BM9 A;  3J7A O;  1U2R A;  4ZYD A;  5E20 A;  2NVQ J;  4RBO A;  5EYR A;  2CQQ A;  2XIG A;  2FE3 A;  2ME0 A;  1IZ1 A;  1KQS B;  1ZRD A;  1JJ2 B;  1YIJ I;  3OZW A;  3E1S A;  1KK1 A;  4QIW N;  1GAQ A;  2ELJ A;  2KDZ A;  5JVT A;  2JA8 J;  3PO3 J;  3CC7 I;  3AST A;  4BH9 A;  4Z05 A;  5IT3 A;  2O9L A;  2PMU A;  2JQ7 A;  4M2L A;  2FD5 A;  4JX6 A;  1BPL A;  3ZMD A;  2Q0O A;  4HIZ A;  2HVS A;  4TKO B;  3ZXS A;  1H9T A;  3SJP A;  3U6K A;  3PSS A;  1LUJ B;  1ZRE A;  4P25 A;  2K9S A;  3QYB A;  1UMQ A;  2DMU A;  3I55 B;  3BG5 A;  1ZK8 A;  3QPH A;  2V7F A;  4GXO A;  2V7W A;  1KC8 D;  3JQR A;  2GA1 A;  4FXU A;  4F7D A;  2F1M A;  1VQ9 B;  4XN0 A;  1RIO H;  4L5J A;  3IWZ A;  3LQ6 A;  3JX8 A;  5KW9 A;  2UVE A;  2XAS A;  3LFU A;  4AIK A;  5FRM A;  3TGN A;  3M8J A;  1NHA A;  2BPO A;  2CQK A;  1TT0 A;  4FTH A;  2ZFU A;  4F92 B;  4P3Y A;  1QZE A;  1VFC A;  4G5G A;  3CCR B;  4XMY A;  1UG0 A;  2VC0 A;  2JTV A;  4FT8 A;  1BL0 A;  3ZC3 A;  4JYK A;  1OMI A;  3CMY A;  5FLX K;  1NG6 A;  3NAR A;  3KEO A;  2W24 A;  4E7Z A;  4G7O F;  1X1P A;  4RM2 A;  3RPU A;  4LB5 A;  3LSG A;  3H9J A;  5E3M A;  1IJE A;  2HCJ B;  4P9U A;  3TW7 A;  2ID3 A;  1O4X A;  2IS4 A;  2ELK A;  2QTZ A;  2E1M C;  1ETW A;  3QFC A;  2QYU A;  1P6R A;  1ZKG A;  2MW8 A;  3HJE A;  5DCM A;  3S8P A;  3JRE A;  3J7Y J;  1UD6 A;  3CPX A;  3K0L A;  3RKQ A;  2WYR A;  2MAB A;  3OYN A;  3NAW A;  1MIJ A;  3FPK A;  3C1D A;  5HOO A;  1CNF A;  5CLS A;  2QXZ A;  1J0R A;  3BJA A;  3JRF A;  3MKW B;  1FNB A;  1D1A A;  3ZZT A;  1R71 A;  1BLI A;  1Z6R A;  1HZE A;  1S72 I;  3S2H J;  1XX5 A;  2C2W A;  3A3G A;  1B72 B;  5HS9 A;  1YLF A;  2BHZ A;  4YC5 A;  2MD5 A;  3G73 A;  1I27 A;  3IWF A;  1BR2 A;  1DQU A;  4R71 A;  3JRI A;  2CS3 A;  2JUC A;  2K9N A;  3CES A;  1FRN A;  2XC1 A;  3BG3 A;  3TH0 A;  1FYL A;  2QZ8 A;  1ZGW A;  1E62 A;  3LL7 A;  2R5Z A;  5DS0 A;  4GCV A;  2Z2S B;  3HC7 A;  2BMW A;  1OFE A;  2JA2 A;  1K78 B;  2V9V A;  3B90 A;  1R5G A;  3C18 A;  1YHQ B;  1GLN A;  3K4N A;  1P4X A;  3A8K A;  3PNY A;  4YAO A;  1YQA A;  4Y13 A;  2RAE A;  3LWF A;  5EZG A;  3ONQ A;  4UVB A;  4WXH A;  4E0F A;  4XSZ F;  5A89 A;  3A35 A;  3IV5 A;  2B7E A;  3O8H A;  3R6J A;  5HLI A;  1T95 A;  2NZM A;  2IRF G;  1AOY A;  2GWR A;  2DFE A;  3ABU A;  3CCU I;  5E1X A;  5ICE A;  1YRN B;  4EJV A;  4OPV A;  4BJ5 C;  3DKX A;  3CMM A;  3FBN B;  1G6N A;  2UWM A;  2ETH A;  4FHT A;  2DMT A;  4I01 A;  5THX A;  1P7J A;  1Y1V J;  1LEA A;  1Z7U A;  3LST A;  1R5N A;  2XOK A;  1OHH A;  3FMS A;  1RPW A;  3BH4 A;  2A61 A;  2MG4 A;  4C2U A;  5JLX A;  3LMM A;  4AM3 A;  5BSY A;  2NT9 A;  1IB4 A;  5E1Z B;  2XZL A;  4RD2 A;  1X4O A;  3G4S B;  4RAG A;  1XS9 A;  5FJ8 J;  1T5E A;  2EWN A;  4EW9 A;  1RR7 A;  1ITY A;  5GAE J;  1J09 A;  4IHT A;  4C2L A;  2E7W A;  5EZH A;  5AON A;  3CMA I;  3SQV A;  5D4R A;  2AQE A;  4XK4 A;  3IAM 2;  2E19 A;  2Q6L A;  4X0C A;  3T51 B;  1VQO I;  3CCS I;  1DP3 A;  1E2X A;  4JP0 A;  4P1W A;  3HUG B;  4NK8 A;  2YWE A;  3GQ8 A;  2L0K A;  3BH6 B;  1JTX A;  5LD2 C;  2MD0 A;  1Z91 A;  4JX4 A;  3JSP A;  1SFK A;  3M1C A;  5K7Z A;  3QFT A;  4Z4R A;  1IO2 A;  4TMT A;  1UD3 A;  2W84 A;  4OWR B;  1YO5 C;  1V0F A;  3GME A;  1A6I A;  3B8H A;  3CRZ A;  2OCE A;  4YIR X;  4YEJ A;  4QLC U;  4LIV A;  4DZP A;  4BQA A;  2XKO A;  3F72 A;  2YX7 A;  5IYD J;  3CJR B;  4L18 B;  2F48 A;  1X58 A;  3DBR B;  4G9Y A;  2AS5 F;  4YFX F;  5TR9 A;  2JJ1 A;  1S0U A;  3CD6 I;  1D3Y A;  4NHJ A;  1MBG A;  4DNR B;  3OYM A;  2QVO A;  3K6G A;  3PSF A;  4LLN A;  2BGI A;  4KYW A;  2YWG A;  4NQW B;  1FNC A;  4ASU A;  4BE2 A;  4N9I A;  3OKX A;  2N8G A;  1H8H A;  2ISY A;  5IYB J;  3CP2 A;  1ETV A;  4M53 A;  4UAJ A;  2AHQ A;  2KT0 A;  3ABM H;  1UD8 A;  5EEA A;  2AHO A;  5J3O A;  1SAU A;  1ERD A;  3HPG A;  2P5K A;  2QY1 A;  5LGN A;  5E17 F;  4AVP A;  2E35 A;  3KEW A;  2R6H A;  1BOA A;  5D5W B;  3FBI B;  1EH8 A;  3LA3 A;  2P6T A;  3MCA A;  4M71 A;  3OS0 A;  3IRQ A;  5M5Y J;  5FO5 A;  1AA7 A;  2F2E A;  3M8E A;  3OOP A;  4P3I A;  3J7Z I;  3NAU A;  4QFM A;  3AL0 B;  2DT5 A;  2CK3 A;  4RGU A;  3DQV C;  3GFJ A;  4BQN A;  4A3B J;  2KDO A;  4CDG A;  4JQF A;  3VOE A;  2ODL A;  4FAS D;  1UG2 A;  2CO5 A;  2EIX A;  3OE7 A;  2COB A;  4OIQ F;  3BZK A;  4QTR A;  1QGY A;  3DF8 A;  4RLZ A;  3BQY A;  3CJT B;  2H8R A;  4BE0 A;  3FXJ A;  4RAF A;  5KNL A;  3B78 A;  1QPM A;  2AO9 A;  1O8J A;  4IEJ A;  1SFX A;  4LIT A;  1VQP I;  3ELK A;  1O7F A;  2EIN H;  3HSF A;  2FBI A;  2RGV A;  2ZTG A;  1SD4 A;  3W5V A;  5ILV A;  1YI2 B;  3L2V A;  3FKS A;  4Z1M A;  5CPR B;  4MEX F;  3FMR A;  2ZZQ A;  1S8N A;  2P5V A;  4CIC A;  5KAF C;  1DUX C;  4KIG A;  2DAO A;  4OAZ A;  4BGD A;  4BAY A;  2ESN A;  1R58 A;  4RGS A;  4KFC A;  2WV1 A;  4O3M A;  5CKT A;  3JQQ A;  3NEU A;  2WAE A;  2R5Y A;  4XBF A;  1W1W E;  4YII A;  4X1E A;  2Z99 A;  5H6Q A;  4M4S A;  4MTE A;  3QP6 A;  3KYC B;  2DYS H;  5GAG J;  3FXL A;  2RV8 A;  4ZGN B;  1EFR A;  4A5M A;  3DPL C;  2F4N A;  1SM4 A;  3CB4 A;  2HU9 A;  4M9S A;  1CF7 A;  2G0E A;  3CW2 A;  4DGW B;  2LRE A;  4KA4 A;  5FO0 A;  3AVT A;  2X1E A;  4YAF A;  3WU1 B;  2E60 A;  2IGK A;  5FIU A;  1ZAR A;  2E1N A;  2VL8 A;  4D7M A;  2JDI A;  2X6W A;  2EIJ H;  4FX0 A;  2HVR A;  3KLN A;  3T8R A;  1VQ6 I;  2ZL7 A;  3T1B A;  2EFN A;  5DUK A;  1Z05 A;  2HQ5 A;  2WC2 A;  3RIQ A;  4LBV A;  2F5E A;  1B4A A;  2LH9 A;  4DYQ A;  1K8F A;  3VYS B;  4ZDP A;  3SZT A;  5M5W J;  1BW5 A;  2BXY A;  4BY7 J;  1KYZ A;  2QEX I;  1AKH A;  2EH3 A;  1Q7Y D;  1UAA A;  2A6E F;  4PK4 A;  3VFZ A;  5LFA A;  4WZK A;  3OYE A;  1WTH D;  1LJ9 A;  1GVJ A;  5M3F J;  3ABL H;  4LBY A;  3C7J A;  3MCZ A;  1OR7 C;  1R1V A;  1MH4 A;  1OKR A;  2HTJ A;  1J5Y A;  2NOJ B;  1DP7 P;  4B43 A;  2WBM A;  1LFU P;  4X6A J;  1D8J A;  3BY2 A;  2QEN A;  4DYR A;  2ID6 A;  2VNH A;  3Q38 A;  1D8K A;  2P3M A;  2X3U A;  2Q1Z B;  1MBE A;  3K2A A;  2RC6 A;  2O61 A;  5CJ9 A;  2E2J J;  1PJ6 A;  4Z03 A;  3W3C A;  4HE5 A;  2XAG A;  2HLD A;  3AVW A;  4FIS A;  3MHP A;  1FIA A;  1VLY A;  4HV6 A;  3F9K A;  4DZJ A;  3NWT A;  2VLA A;  4ZDO A;  4JRA C;  2BN4 A;  3EUK L;  2CUE A;  2BSP A;  1D1B A;  4OJ6 A;  2L7M P;  3K7A J;  5DS9 A;  1DG1 G;  3KCC A;  1FZP B;  5C4X J;  1XFO A;  1E63 A;  4I76 A;  4MYT A;  2DA7 A;  4RB3 C;  1QVF B;  3A0B C;  2INU A;  2VZL A;  4E7I A;  1XTA A;  2G7U A;  1XQB A;  1Z67 A;  1GQ8 A;  3BY1 A;  1YIJ B;  4Q5S F;  2YU3 A;  1UFM A;  2BM1 A;  5D8L B;  3WTT C;  2F4M B;  2DEU A;  2LNB A;  3CC4 I;  1WKM A;  2HR3 A;  2HS5 A;  3KET A;  1RQP A;  1Y56 A;  2A07 F;  3KYL A;  2QQA A;  1WJF A;  3CC7 B;  1T56 A;  2YUS A;  5L3F A;  1V0E A;  1QZY A;  2L7K A;  3U21 A;  4O5V A;  3FKI J;  3D0S A;  3HGG A;  5C1E A;  5BMZ A;  1ULY A;  2HDN B;  1JXS A;  2DOG A;  3PQK A;  2X53 S;  2IGM A;  1F36 A;  4XRM A;  1H89 C;  3KRG A;  4UUT A;  4U87 A;  4HE6 A;  3ASO H;  5J3L A;  5A8A A;  1HBX G;  1B8I A;  1D1N A;  3JCU C;  2XTX A;  4HEA 2;  1RUN A;  2V1X A;  3GQ7 A;  5ILU A;  4L9N A;  1R1U A;  2NS8 A;  1UB9 A;  3BR5 A;  3QPS A;  1LE8 A;  1O8K A;  3V8L A;  1W5T A;  4ASN A;  5HLH A;  1E79 A;  3ZQF A;  1ZM9 A;  1K4T A;  1B9M A;  3SEZ A;  4RCZ A;  2VKV A;  2E1R A;  2NPF A;  3HRS A;  3W2I A;  5JI6 A;  2M8E A;  3CCY A;  1IUF A;  4BEH A;  3VWB A;  2IVM A;  3PUB A;  3OJW A;  1DPR A;  2DBB A;  5EJC A;  4ZGQ B;  2IQ7 A;  1U2W A;  2W57 A;  3TDZ C;  2JPC A;  2E1M B;  4UZE A;  1M90 D;  2OC6 A;  1WJE A;  5F0F A;  2HPI A;  2JJ2 A;  5HXB A;  2VQH A;  3ZCO A;  1K8A D;  3ISP A;  3I54 A;  4QPO A;  3HRT A;  3GVA A;  2ME6 A;  2JUG A;  3J7A Y;  1T6S A;  4OU0 A;  4RPD A;  2DET A;  3A01 A;  1T6Y A;  3ASS A;  3ZSC A;  3OEH A;  1ON2 A;  1S4M A;  1T0F C;  1VQ7 I;  3TP3 A;  1W7P A;  2XGD A;  2I5U A;  2BGC A;  1L0O C;  4FX4 A;  4P6V F;  2RVC A;  4AIH A;  2V26 A;  1JE8 A;  2WB1 N;  2JIZ A;  2F5C A;  3OYA A;  1JKP C;  2X8K A;  4YEI A;  3S3N A;  5EDN A;  1K6O A;  1YS6 A;  1YFH A;  2KJC A;  2VI6 A;  2R0Q C;  4E7J A;  3FXO A;  3ZQH A;  3I59 A;  1X1C A;  3M3Y J;  4C43 A;  2V4J C;  3B6C A;  5F4J A;  5LGU A;  3OYL A;  1QVT A;  5HS8 A;  2Q6O A;  1S72 B;  1SVO A;  1WOP A;  4Y9R A;  2X51 A;  4I6Z A;  3TMO A;  5TIS C;  3BCF A;  5E8I A;  5E3O A;  3DV8 A;  3OJX A;  3I4N J;  4XSX F;  5IYN A;  3OP1 A;  2KL4 A;  1ZN2 A;  2GK6 A;  1TQP A;  4CYC A;  2VBE A;  3BWG A;  2EBI A;  3GO5 A;  3QU6 A;  4HWV A;  1KCD A;  1TVC A;  4C0S A;  1QGP A;  3J81 Z;  3ERE D;  1MAB A;  1BOB A;  1AMO A;  3A8I A;  1XCV A;  4HOB A;  3LMW A;  2RNG A;  2B7C A;  3K70 D;  2XT4 A;  1X2N A;  4OOI A;  1I18 A;  1G2H A;  4RAY A;  1IB0 A;  9ANT A;  1YX2 A;  2JN6 A;  3VSU A;  5M3M J;  2F5F A;  2CG4 A;  3TBI A;  2OF7 A;  1SAX A;  2IT0 A;  4M1K A;  5CQG A;  2QN6 A;  5GV7 A;  1JJ8 C;  4X7C A;  3RI4 A;  4L9J A;  1JA0 A;  1KON A;  2QQB A;  2QDX A;  2LBF B;  3CZ6 A;  1BMF A;  1VF7 A;  2CJJ A;  3CCU B;  4OJ5 A;  3CCJ I;  1D2E A;  2OQG A;  5E1W A;  4KKU A;  1SD6 A;  2LY1 A;  4GRI A;  4LMY A;  2E71 A;  4ZTJ A;  4X8I A;  3MVP A;  1MBJ A;  2LRD A;  2HFH A;  4YG2 F;  2ECB A;  2YWF A;  3CUQ B;  1WPC A;  4WK8 F;  4AID A;  1N8R D;  1O3R A;  1K61 A;  3GIR A;  5H2F C;  1W0K A;  5F4M A;  4B3X A;  5ICG A;  2O17 A;  1XMA A;  1U0J A;  1B2R A;  3W2E A;  4MYU A;  4C3I J;  2GM4 A;  1Q9S A;  2BV3 A;  4IQJ A;  2OD5 A;  1PJ7 A;  2DJI A;  5FGM A;  2V7X A;  2VT3 A;  3KYD B;  4L9T A;  2D9R A;  2HZT A;  1KU2 A;  2CFO A;  4BHC A;  1JUM A;  3CMA B;  2M5W A;  5IOZ A;  1FDR A;  1VQO B;  3W2H A;  2G9W A;  1APL C;  3GQA A;  2BM7 A;  2JA6 J;  1W9X A;  5E8G A;  2BY1 A;  1OJL A;  5L3B A;  2MSY A;  3CQZ J;  1RZ4 A;  3LQQ A;  4LK0 F;  5GTI C;  1MZB A;  2DCU A;  1Q86 D;  1UD5 A;  1YOV B;  1I6X A;  4M9X A;  1CNE A;  2O6G E;  4YZA A;  5J6X A;  3HM5 A;  3M9A A;  2H09 A;  3JW4 A;  4CCM A;  4Y3O A;  3IKT A;  2FVG A;  2A3S A;  3CD6 B;  2ZXI A;  4BPR A;  1E3X A;  3HG9 A;  1RKT A;  1JKQ C;  5FRO A;  4BAC A;  3OSG A;  3OYI A;  3OYK A;  4RCY A;  1UCR A;  4XOR A;  4QVJ A;  4NDL A;  1I39 A;  1YIT I;  2Y75 A;  3JRG A;  4J01 A;  2P5L C;  3E20 A;  1OOC A;  4ENM A;  1P4A A;  2VQG A;  2HQR A;  1Z7L A;  1TL8 A;  3BTC A;  1USS A;  4A3F J;  2VBU A;  2WJV A;  2A6H F;  2WB1 A;  1BIB A;  1G3S A;  1YE9 A;  1WWX A;  2L9R A;  3OS2 A;  1EP2 B;  1D0Y A;  1XB2 A;  2DN0 A;  1BIA A;  5L3C A;  3LSK A;  2WAQ N;  2ZZE A;  1U9O A;  2DMQ A;  3FIS A;  2VBM A;  2X3H A;  5HKK A;  3ZUG A;  2XV4 S;  4PFP A;  2G0Y A;  1PKV A;  4LD5 A;  4LBW A;  1F1Z A;  2H27 A;  1HA3 A;  2LSO A;  2X9D A;  2B9S A;  4XOP A;  4A3D J;  4YFK F;  1Z3Y A;  1MJB A;  1K83 J;  1IXR C;  4YEL A;  1F60 A;  3FY3 A;  1HKT A;  3BR1 A;  1O3Q A;  3WTV C;  3VO2 A;  3Q0V A;  1YJN I;  4MNU A;  2DOA A;  5DM6 F;  1DAR A;  1HDD C;  1N07 A;  2EFW A;  1W2B B;  5J1R A;  1O3S A;  1R23 A;  2Q2E A;  1T98 A;  4QSH A;  3GZ5 A;  3F21 A;  3BR3 A;  4XKW A;  1Y0R A;  3BZC A;  4LBZ A;  3RKX A;  1U5T A;  2NRA C;  3ZPP A;  3K4K A;  2GA2 A;  5KAI C;  1GR1 A;  5IYQ A;  1VQP B;  3DFG A;  3KPH A;  1O7L A;  2ZNZ A;  4W8R A;  3EYI A;  4B3F X;  5JBQ A;  5AIP A;  2VFP A;  1TYV A;  1Y1W J;  3VST A;  1V54 H;  2DER A;  2ADU A;  2YPR A;  3FM3 A;  4M3F A;  1QRB A;  1LDD A;  1Z9C A;  2CC2 A;  3I53 A;  4OP7 A;  1GVH A;  2VQL A;  3H3U A;  4WX9 A;  1OFD A;  2VE8 A;  3QFR A;  1JGS A;  3KP7 A;  3EYY A;  1VTN C;  2ZL6 A;  3PA1 A;  5HVQ C;  2V7U A;  5TJJ A;  3LSM A;  5E79 C;  4M6X A;  1Q81 D;  1QQI A;  2OTJ I;  4UVC A;  2GPJ A;  2K86 A;  3MZ8 A;  3U1D A;  1VND A;  3HRU A;  4GO1 A;  5BQT A;  4F3Q A;  1A31 A;  1H42 A;  4RLF A;  3SEQ A;  2VBW A;  3W2V A;  3BC9 A;  5JLV C;  1KTW A;  5HLG A;  1WGX A;  3F8C A;  2C6Y A;  5DM7 F;  2FQ4 A;  2VXD A;  3TO6 A;  3K1N A;  1RUO A;  2OBT A;  3A3B A;  1B9N A;  2CU7 A;  3GTQ J;  1WSV A;  1NHC A;  1IN7 A;  2ZZF A;  2V5I A;  3BTJ A;  3GCM A;  2ZZG A;  2IGN A;  4RDU A;  1R5I D;  2R7X A;  4XIC A;  5FD6 A;  1DGR M;  3GTL J;  5FB2 A;  1WOO A;  4XKC A;  3H92 A;  4XNF A;  5D6E A;  4JBA A;  1MJ9 A;  1S7E A;  1VQ6 B;  1KCC A;  2OZU A;  2R4G A;  1B1B A;  2JWT A;  2JMW A;  4LIU A;  1LPQ A;  3PNT A;  5A2Q Z;  1QA6 A;  3PEN A;  1XG1 A;  2CGP A;  4ESF A;  4LG0 B;  3GTO J;  3G1L A;  3CLO A;  4A3E J;  2QEX B;  2EZI A;  1HKQ A;  3KP4 A;  5F27 A;  2WY7 Q;  2XPW A;  2EZK A;  3U1K A;  3V8K A;  2JRM A;  4M3G A;  1EV7 A;  2KVO A;  4DK0 A;  3UW0 A;  2AQF A;  1OFL A;  2GXG A;  2IEK A;  5ERI A;  1HOM A;  5TY0 A;  1FNM A;  3HUG A;  3QFS A;  4EGZ A;  2HKX A;  1EP1 B;  4HZF A;  4J00 A;  3F8F A;  1WVR A;  2VIX A;  4XRS G;  1ZRC A;  2ZC2 A;  4EQQ A;  1S6L A;  3HPH A;  1FEX A;  2CBX A;  5GV8 A;  4A69 C;  1LQ1 A;  3LYC A;  5GP9 A;  5ILS A;  4CYD A;  1MDM A;  4HG2 A;  1JUS A;  3ISX A;  2QSF X;  3RYR A;  3QSY A;  3KL9 A;  4PC7 A;  1KK2 A;  3FIW A;  2VUM J;  3W5U A;  1QRC A;  4I7H A;  2VON A;  4BQO A;  3HOW J;  2LVS A;  2WAQ A;  3QWL A;  4DQL A;  4UZU A;  5BSX A;  4C3J J;  2W1O A;  5FO1 A;  2OK8 A;  5EGO A;  3DPU A;  1SFE A;  1K9M D;  1FOW A;  1MMN A;  3P9K A;  1O8F A;  4U49 A;  2RDP A;  1OGO X;  1PP7 U;  2Z1D A;  4OOV A;  1JA1 A;  4V19 K;  2QMU A;  2O7O A;  1G3T A;  3W2G A;  2NTB A;  5BPD A;  5FA6 A;  4AD9 A;  3E0J B;  4M3B A;  2DA6 A;  4PGH A;  2JPB A;  4MR0 A;  4S04 A;  3KEQ A;  2CWE A;  2F1L A;  4ZH4 F;  5CVU A;  3BPX A;  3Q9V A;  2DMN A;  1TYW A;  3FWE A;  2M45 A;  3IC7 A;  3SHF A;  3ZRG A;  1EJ9 A;  2FOK A;  2L3D A;  2QF7 A;  1QVG B;  2VAS A;  4JK1 X;  2KKO A;  2K3F A;  1JUP A;  1JTA A;  4Q4Z F;  2QBY B;  5F0H A;  2BSA A;  3DU6 A;  1WJD A;  1G7T A;  1PUF A;  1WFX A;  2HKO A;  4H4K C;  3L2U A;  4UUV A;  4NUB A;  3P27 A;  1IUY A;  1ZM3 A;  1V3F A;  5BS6 A;  3I64 A;  3B6A A;  2KZG A;  1BHE A;  4HX7 A;  1OGM X;  1A36 A;  3SY2 A;  4ZYA A;  4RJL A;  3WTW C;  1Y8R B;  1RC9 A;  1IJF A;  4OM9 A;  2X6X A;  1H88 C;  1FY7 A;  1S29 A;  3E5X A;  1VQ4 I;  1I8D A;  1SMY F;  4MIM A;  4M73 A;  3WG7 H;  4W97 A;  2A5W A;  3ZOB A;  4BKX A;  2H1K A;  3VMV A;  1OCP A;  2EA4 A;  4Q7J B;  1NB0 A;  1VQ7 B;  4NCN A;  1XDU A;  2Y9Y A;  1T8I A;  3VEP A;  4S05 A;  2CV1 A;  1H80 A;  4IW3 B;  5K1Y A;  2E5Z A;  3WTX C;  4HRI A;  5C4J J;  2L01 A;  3G6E I;  2NSP A;  4RGR A;  3ABK H;  1IN4 A;  3CO6 C;  3TKY A;  2VYQ A;  1E3Z A;  5J8F A;  4B8X A;  2BGJ A;  4BNC A;  4UY8 I;  1LKX A;  1W5S A;  4RAZ A;  4BJ6 C;  4B47 A;  4ZYH A;  4FN5 A;  2E1C A;  2GXA A;  3IH2 A;  1WP6 A;  2BHY A;  4A93 J;  3G71 I;  4IHX A;  3ZBU A;  5J47 A;  5DNS A;  4A2U A;  4DYC A;  3A02 A;  4DIQ A;  1W36 C;  4IPA A;  3ZR8 X;  4HDV A;  1EWY A;  1B23 P;  1A04 A;  2XRN A;  4RB1 A;  2FBH A;  5HDK A;  1TC3 C;  4KIT B;  3KX2 A;  2MC3 A;  2D3L A;  2OBP A;  2WA0 A;  3A1Y A;  4J19 A;  2ELH A;  1Z6T A;  5DTD A;  4KUM A;  2L5Q A;  2E1O A;  4YZQ A;  4HX8 A;  5DD8 A;  3GX4 X;  2BVM A;  3OYC A;  2WY8 Q;  2BXZ A;  1U3E M;  2C77 A;  3OR2 C;  4Y7C A;  4LG3 A;  4TMW A;  2ISZ A;  3NQO A;  2DT7 B;  1VI0 A;  5BNG A;  1QHH D;  1BR4 A;  1EFU A;  1X3W B;  2DOF A;  2VJJ A;  2EPF A;  4J0Q A;  1FP1 D;  2MFZ A;  1P4M A;  2BW3 A;  1MNM C;  4ENK A;  1MMG A;  2AXT C;  5HDG A;  3JR9 A;  4YHB A;  2OJE D;  2P8T A;  4WCG A;  3WTU C;  2QZA A;  4X07 A;  3CCJ B;  2Y2Z A;  3OWT A;  1DAB A;  3E5U A;  4AWX B;  4WXD A;  2NNY A;  1IA5 A;  3RZO J;  1L3L A;  3F8N A;  1PP8 F;  3VYU B;  2R7D A;  3OMY A;  5JHU A;  1TYX A;  4HLX A;  2EFO A;  3CUQ C;  3T5X A;  1JRG A;  3LVB A;  1DBG A;  1WDT A;  1J75 A;  2WR8 A;  2NS7 A;  1WJB A;  2BY3 A;  2DPD A;  4GYG A;  1NH3 A;  1UHS A;  2X48 A;  2HGC A;  5LEK A;  1G7S A;  1P2F A;  3GFM A;  1S3J A;  4W1U A;  1E1R A;  3ZZ0 A;  1GJR A;  1KMH A;  4Z4T A;  1BW6 A;  1YJW B;  5LHG A;  1WCM J;  3TO9 A;  4AUX A;  2CUJ A;  5EEG A;  3G2B A;  4GFB A;  1PUE E;  5H20 A;  4XLN F;  4WZE A;  3EQN A;  1R36 A;  3DEE A;  3WGG A;  3BDD A;  4Y15 A;  2JZY A;  1OYY A;  3F3X A;  1QPI A;  2GQF A;  5IYW A;  4IRH A;  2X0L A;  4E6K G;  3GVL A;  2KIF A;  5E6T A;  1ZQ3 P;  2C4U A;  1MNE A;  2RKH A;  3LAP A;  1LDK B;  3JSO A;  2VB6 A;  2FXA A;  1QUE A;  3BP8 A;  1XE1 A;  1O8G A;  1L1I A;  3F0C A;  3TOB A;  3CTA A;  3ZPL A;  2X85 A;  4TV7 A;  3B8Y A;  2QSH X;  3PL8 A;  3P9I A;  1YS7 A;  1OLT A;  1I7P A;  1FPQ A;  1I5Z A;  3L00 A;  1IN5 A;  3F8M A;  3ZMS A;  1YIT B;  2X1C A;  4V2F A;  4G6D A;  4CGZ A;  1E17 A;  3I4P A;  3O3K A;  3CPW B;  4IKF A;  2LFB A;  2FF4 A;  2OQR A;  2O5R A;  5L3D A;  3F8B A;  5D5X B;  2LKX A;  2Y9Z A;  4OJO A;  1LFP A;  5FLM J;  3MZH A;  3U6B A;  1HQC A;  2UUZ A;  1AIP A;  5GPA A;  1H8E A;  1N05 A;  1FND A;  3Q0W A;  3OOC A;  2VPR A;  4TN1 A;  3OIQ A;  1KQ0 A;  5DSZ A;  2EB7 A;  4C3H J;  1OB5 A;  4FET A;  2XAU A;  4OPS A;  1D5V A;  3ABT A;  4MO7 A;  1VQ8 I;  1OIS A;  3RQ4 A;  2LTP A;  5EG0 A;  1WOR A;  3DDY A;  5EMN A;  2R93 J;  2IS2 A;  4A0Y A;  1S7A A;  4RD3 A;  2Z33 A; 
#chains in the Genus database with same CATH homology
 2IXS A;  1T0F C;  2KLO A;  2ZXH A;  4XLE A;  4BXF A;  3S3M A;  2V26 A;  4BDZ A;  2F43 A;  2QKM B;  2JIZ A;  3OYA A;  2XF7 A;  3DPT A;  3K4C A;  4B48 A;  2X8K A;  3JU4 A;  3S3N A;  4PJM A;  3ZGK A;  2VKH A;  2QX3 A;  4E7J A;  2XGJ A;  1V5G A;  3PFY A;  1X1C A;  3DTI A;  1OFM A;  2V4J C;  3PJR A;  2NST A;  2HPM A;  3OYL A;  3DTK A;  4RLQ A;  4II3 A;  4BJT A;  3BLY A;  2KRH A;  1YX3 A;  1SKY B;  5HNH A;  2Q2E B;  4OJL A;  2X51 A;  3BCF A;  3TMO A;  2M4G A;  1R6R A;  1HA8 A;  3S32 A;  2KL4 A;  2GK6 A;  4HPQ A;  2KQR A;  2VBE A;  4BDY A;  2XF6 A;  2WAD A;  5IK2 A;  4HWV A;  3BG6 A;  3VYT B;  3MKZ A;  1KCD A;  4DBQ A;  4XL9 A;  1FMW A;  1MAB A;  2O0V A;  2M4K A;  1P9Q C;  1X1A A;  1BOB A;  1X4P A;  2WAF A;  4BU2 A;  3LMW A;  2RNG A;  4TT3 A;  3K70 D;  3NE5 B;  3OEH A;  3SZG A;  3BCB A;  3UR3 C;  4OZY A;  2PYH A;  1X1D A;  3GQ9 A;  1PYV A;  4W8Q A;  1I18 A;  2M3A A;  2LBF A;  4KIS A;  3OL3 A;  4BQQ A;  3AFH A;  4XN3 A;  3JUR A;  3AKZ A;  1E1Q A;  1DGW Y;  3VSU A;  4Z06 A;  2QKL B;  4Y4R A;  4HNT A;  3GVJ A;  1PE9 A;  3FKJ A;  2F6C A;  3TBI A;  2PYG A;  2K5C A;  5CQG A;  2XND A;  2NTP A;  2HQA A;  3RSN A;  2KMU A;  4G7W A;  1KON A;  2HVQ A;  3I3L A;  2LBF B;  2HZD A;  3CZ6 A;  2CV2 A;  4Y33 A;  1BMF A;  1VF7 A;  3GVK A;  1IDJ A;  4XOT A;  4OJ5 A;  2VJ4 A;  2LY2 A;  1X0C A;  1O8D A;  4KKU A;  1K5C A;  1G8X A;  2LY1 A;  4GRI A;  3SDB A;  4XLA A;  3VYR B;  4ZTJ A;  2LRD A;  2NTQ A;  1BN8 A;  2CH0 A;  4PSX A;  1WPC A;  1D1C A;  4I84 A;  3GBG A;  2PJR A;  3I9V 2;  2RRE A;  1W0K A;  2M7B A;  3K4L A;  3VSL A;  4B3X A;  2K9L A;  4CZC A;  3L2R A;  2I8D A;  1QJV A;  2O17 A;  4YZX A;  1MMA A;  1MMD A;  1U0J A;  3H9Q A;  4PFO A;  2XC7 A;  2LOO A;  3OYF A;  4IQJ A;  2DJI A;  2R7R A;  3VSV A;  2HNH A;  3K4J A;  2CFO A;  4F93 B;  3HAG A;  2V9K A;  3OOU A;  1IRX A;  2MYS A;  1LVK A;  3RCO A;  3OFN A;  3GQA A;  2GOX B;  1W9X A;  4CCL A;  4CCO A;  1X1B A;  4HSR A;  1UD5 A;  3E1S A;  2ELJ A;  5KHD A;  4YZA A;  4E7S A;  4W8T A;  2KPM A;  3OEE A;  4CCM A;  4BUP A;  4Y3O A;  1Z3X A;  4Z05 A;  4YRV A;  3ZIA A;  4KJZ A;  2ZXI A;  1BR1 A;  2DT6 A;  1E3X A;  3HG9 A;  3H35 A;  1BPL A;  5FRO A;  1VJS A;  4HIZ A;  2HVS A;  4TKO B;  3ZXS A;  1O8H A;  3OYH A;  4BAC A;  3OYI A;  3OYK A;  1E43 A;  4XOR A;  3OAA A;  3V42 A;  4R79 A;  4J01 A;  2K3P A;  3QYB A;  1OOC A;  2W7N A;  4P22 A;  2VQG A;  1Z7L A;  2V7F A;  2IS1 A;  4U4B A;  4FXU A;  2ZSI B;  2F1M A;  2WJV A;  4NC8 A;  4XN0 A;  4E7L A;  4C9Y A;  1VZ0 A;  2WB1 A;  2UVE A;  3LFU A;  2M0M A;  5FRM A;  1YE9 A;  3LSI A;  3M8J A;  3OS2 A;  2KRC A;  1TT0 A;  1QCX A;  2ZFU A;  4F92 B;  1D0Y A;  1EA3 A;  1VBL A;  4XMY A;  1UG0 A;  3LSK A;  2ZZE A;  2X3H A;  2VBM A;  5HKK A;  1NG6 A;  4PFP A;  4MLO A;  1PKV A;  1NBM A;  4E7Z A;  4ZJZ A;  4XOP A;  3C2H A;  4RM2 A;  2K9M A;  3LSG A;  3H9J A;  1Z3Y A;  3FY3 A;  4YEL A;  2R7W A;  4RMN A;  2IS4 A;  2E1M C;  3HOS A;  4QPQ A;  2DOA A;  3OS1 A;  3S8P A;  2V31 A;  3QYE A;  3FDY A;  1UD6 A;  2R7S A;  2XZO A;  3CF2 A;  4CH7 A;  3OYB A;  4XKW A;  4D1Q A;  2MAB A;  3OYN A;  3L2Q A;  5HOO A;  3ZPP A;  3K4K A;  4NNJ A;  3LNN A;  2QXZ A;  3BCA A;  3MKW B;  4W8R A;  4B3F X;  2O1D A;  1D1A A;  3VST A;  1PJR A;  4B3G A;  1BLI A;  3H5A A;  1HZE A;  3WQZ A;  4C2T A;  3A3G A;  2LC2 A;  4DBR A;  1UEL B;  2VQL A;  1BR2 A;  2NT6 A;  2R9V A;  1DQU A;  3IAS 2;  4X0G A;  2CS3 A;  3K4M A;  4PSW A;  3CES A;  4KKS A;  2L9S A;  5HVQ C;  3LSM A;  5FL7 A;  3LL7 A;  2Z2S B;  2RQQ A;  3HC7 A;  5CQE A;  2JA2 A;  3CJQ B;  1FMV A;  3S93 A;  4ANJ A;  4F3Q A;  4RLF A;  3SEQ A;  4CSW A;  3W2V A;  3MMY B;  3BC9 A;  3B90 A;  1GLN A;  3K4N A;  4XKB A;  2Y0S A;  1KTW A;  2CW7 A;  3T9G A;  3PNY A;  1WJ5 A;  3EUH C;  3W2W A;  3ONQ A;  2V1N A;  3OYG A;  2Z8G A;  4E0F A;  2VXD A;  3A3B A;  3A35 A;  1NHC A;  2X1D A;  1K6Y A;  2ZZF A;  3DKY A;  1COW A;  4L8J A;  1IDK A;  2IGO A;  2ZZG A;  2IGN A;  3T53 B;  2R7X A;  3SUC A;  4BE1 A;  1T95 A;  2NZM A;  1DGR M;  2PMZ A;  1CZF A;  1N78 A;  4XKC A;  4XKV A;  4XNF A;  3B4N A;  4F91 B;  4OZZ A;  2E1B A;  2R4G A;  3DKX A;  4BJ5 C;  3CMM A;  3FBN B;  2UWM A;  2BOL A;  3QOD A;  3DWL E;  3MKY B;  1D0X A;  4LIU A;  3T56 B;  3PNT A;  3DU5 A;  4BL0 B;  2V4D A;  2XOK A;  4MXN A;  1WJC A;  1OHH A;  2WSS A;  1WJA A;  2OUM A;  3BH4 A;  3OYJ A;  2W82 A;  2WY7 Q;  4DK1 A;  1K28 D;  4C2U A;  4BS9 A;  2KVO A;  3LMM A;  4E4H A;  4DK0 A;  2AQF A;  1OFL A;  2NT9 A;  3UW0 A;  2XZL A;  2V6E A;  4GQN A;  1IB4 A;  1X4O A;  1JI8 A;  4AVZ A;  1T5E A;  4EW9 A;  3H0D A;  1Z21 A;  2UVF A;  4J00 A;  1J09 A;  4G7X A;  5C1C A;  2ZTN A;  2BW3 B;  2GK7 A;  4C2L A;  2KP6 A;  2VIX A;  2AQE A;  2WPD A;  3HPH A;  3IAM 2;  3T51 B;  4XLH A;  5CDF A;  3UNG C;  2XDV A;  1DP3 A;  2P0W A;  2D3N A;  4P1W A;  3HUG B;  4NK8 A;  3LSH A;  3GQ8 A;  4HG2 A;  5LD2 C;  2MD0 A;  1ZEL A;  3OIP A;  1SFK A;  3M1C A;  3HXL A;  1UD3 A;  4OWR B;  4CA0 A;  1V0F A;  4ITV A;  3S3O A;  5JHF A;  2XZP A;  3WWG A;  4YEJ A;  4LIV A;  4BQO A;  2R7U A;  4CCK A;  2DIE A;  2WAQ A;  1TZL A;  3CJR B;  4UZU A;  2W1O A;  2VBK A;  2JJ1 A;  2L9N A;  3DPU A;  4DNR B;  3OYM A;  3K6G A;  3PSF A;  1MMN A;  4NQW B;  4ASU A;  1O8F A;  4BE2 A;  4U49 A;  4C30 A;  2CV0 A;  1OGO X;  1H8H A;  4NK6 A;  3CP2 A;  2Z1D A;  3OW7 A;  1UD8 A;  3RPU D;  4YZ0 A;  2OV7 A;  2NTB A;  1SAU A;  1ERD A;  5HNF A;  4JOM A;  1MW7 A;  3HPG A;  3E0J B;  4G6T B;  4E7H A;  1KZL A;  2GJP A;  2QY1 A;  2KHM A;  4MR0 A;  4OAY A;  3KEW A;  2EWE A;  2R7Q A;  1D0Z A;  3FBI B;  4IX7 A;  1X19 A;  1AIR A;  3RTR A;  2CMP A;  3ZRG A;  3OS0 A;  4ZDL A;  1AA7 A;  3N05 A;  1XG2 A;  2BVL A;  2VAS A;  4PMH A;  3ZPN A;  4XD7 A;  4DOZ A;  3AL0 B;  4DJA A;  1JTA A;  2CK3 A;  4DNT B;  3DQV C;  2XF5 A;  3EUA A;  4BQN A;  3DU6 A;  1WJD A;  2KDO A;  3D5R C;  1RMG A;  1KCC A;  1WFX A;  4H4K C;  4JQF A;  3L2U A;  2Z6B D;  4NUB A;  4FAS D;  2ODL A;  3VDX A;  3BC8 A;  4ZTF A;  3OE7 A;  3MD2 A;  1BHE A;  1OGM X;  3L2W A;  2JVG A;  1V5F A;  2VJI A;  4ZYA A;  2FUG 2;  3QOE A;  2JSP A;  2X6X A;  3C2G A;  1I8D A;  1HG8 A;  4BEH B;  4BE0 A;  3VMV A;  2A5W A;  2E5N A;  3PSI A;  5KNL A;  2A6T A;  3HL2 A;  1O8J A;  3K10 A;  3BG7 A;  4LIT A;  2VPL A;  1FX0 A;  2O04 A;  2CV1 A;  1H80 A;  2ZTG A;  1N75 A;  5AMV A;  2E5Z A;  4HRI A;  3A4C A;  2NSP A;  3L2V A;  4B44 A;  1UD4 A;  3FKS A;  2M5S A;  4Z1M A;  4KT6 A;  2LYC A;  5CPR B;  4XQF A;  2ZZQ A;  4N4N B;  4ZC3 A;  3G05 A;  4CUG A;  1E3Z A;  1PXZ A;  4OAZ A;  1LKX A;  4BJ6 C;  4BGD A;  4PJL A;  4B47 A;  4E7K A;  2VKD A;  4II2 A;  1WP6 A;  4P5O A;  5CKT A;  3H94 A;  2WAE A;  1O8I A;  2F4I A;  4DIQ A;  1O88 A;  4RM3 A;  1W36 C;  2LG4 A;  2UV1 A;  3ZR8 X;  1PLU A;  3EQO A;  2INV A;  4KIT B;  2GJK A;  3KX2 A;  2D3L A;  2WA0 A;  3A1Y A;  3VSK A;  1EFR A;  2JVH A;  1V5E A;  2HDW A;  3DPL C;  2GOM A;  2HU9 A;  1YX5 A;  2L5Q A;  4YZQ A;  4DGW B;  2LRE A;  3OR1 C;  2BVM A;  3OL4 A;  1QHG A;  1Y6I A;  2X1E A;  2WY8 Q;  3OYC A;  2O0W A;  3GRH A;  2E60 A;  2IGK A;  2VL8 A;  3OR2 C;  2JDI A;  2X6W A;  3OYD A;  3IUO A;  4LG3 A;  3VMW A;  3SYT A;  2Z16 A;  2DT7 B;  2VXZ A;  3CP8 A;  2HVR A;  1EE6 A;  4URR A;  1QHH D;  1BR4 A;  4HNU A;  2VJJ A;  4PUS A;  1E0E A;  2DCE A;  1WMR A;  4XLC A;  2MFZ A;  2LH9 A;  2BW3 A;  2W6J A;  3A2K A;  4PJN A;  1MMG A;  3VYS B;  4ZDP A;  1UD2 A;  4N4O B;  1G59 A;  3BCD A;  3KEY A;  3EPZ A;  4OJP A;  1UAA A;  1O8L A;  4PK4 A;  1MND A;  5LFA A;  4TSF A;  3OWT A;  3OYE A;  1N77 A;  5FRN A;  1WTH D;  1IA5 A;  2QE7 A;  3HOT A;  3VYU B;  3OMY A;  4W8S A;  2VJ5 A;  1OR7 C;  3H5R A;  1DBO A;  1O8M A;  2NOJ B;  3VR6 A;  2ZSH B;  2WBM A;  4B43 A;  1S9H A;  2R7T A;  3OPO A;  1DBG A;  1JRG A;  2Q1Z B;  5KCM A;  1WJB A;  2DXI A;  2WZP P;  4Z03 A;  2L2O A;  3K4B A;  3W3C A;  2HLD A;  1NG7 A;  2R7O A;  1VLY A;  3F9K A;  4YXW A;  2VLA A;  3NWT A;  4ZDO A;  3W2A A;  2W6I A;  2F5V A;  2X6Y A;  3H9G A;  4F52 A;  3EUK L;  1E1R A;  4CCN A;  2BSP A;  1KMH A;  1D1B A;  4OJ6 A;  3D5S C;  2V7Q A;  3HKZ A;  2W4S A;  2PJR B;  2GJR A;  2CUJ A;  3G2B A;  2INU A;  2XSJ C;  3K70 C;  3DEE A;  4G6I A;  3EQN A;  4E7I A;  4AU7 A;  2KZV A;  1GQ8 A;  4CCJ A;  4NC7 A;  4PJJ A;  4E6K G;  3DTE A;  3GVL A;  4XM3 A;  1MNE A;  2WJY A;  1LDK B;  1Y56 A;  3KYL A;  2VB6 A;  1WJF A;  2VQC A;  3QYF A;  1V0E A;  2L7K A;  1W0J A;  3U21 A;  4D9J A;  4KKT A;  3FPP A;  3H5N A;  2IS6 A;  1O8G A;  2R7V A;  5C1E A;  4IQ4 A;  2LZJ A;  2X53 S;  2X85 A;  2IGM A;  3B8Y A;  2CW8 A;  3PL8 A;  3KRG A;  4U87 A;  1OLT A;  2M7A A;  4JMQ A;  1RWR A;  2CUZ A;  4IZZ A;  1HVX A;  2X1C A;  4HEA 2;  3PNV A;  1W36 D;  4U7B A;  1NRK A;  3GQ7 A;  3D5L A;  4HST A;  4IKF A;  4AYB A;  2MC4 A;  2O5R A;  1O8K A;  3ZQQ A;  3TL4 X;  4OJO A;  3OY9 A;  1E79 A;  1QU3 A;  5TGT A;  3SEZ A;  1LFP A;  4F55 A;  2PEC A;  2UUZ A;  3FHN A;  4BEH A;  3PUB A;  4XR6 A;  3VWB A;  1H8E A;  4XON A;  3GQB A;  3OOC A;  5DN6 A;  2IQ7 A;  3OIQ A;  2E1M B;  1O8E A;  2OC6 A;  1WJE A;  2HPI A;  4EAT A;  4FET A;  1RU4 A;  2JJ2 A;  2XAU A;  3DLA A;  2VQH A;  3ZCO A;  3AL0 C;  4XLF A;  3RQ4 A;  5HLT A;  4QPO A;  3DDY A;  3J7A Y;  2JUG A;  2IS2 A;  1OB0 A;  2W00 A;  3NWS A;  3ZSC A;  3IP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...