2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
2O04A 1NHCA 4W8SA 1AIRA 2UVEA 4OJLA 4XNFA 4OZZA 4Z05A 5C1EA 2X85A 2VBKA 4U4BA 1O8FA 3EQNA 4C2LA 1CZFA 4XKWA 3VMWA 5AMVA 4XORA 3B90A 2O17A 1PXZA 2INUA 4XM3A 3B4NA 2NTQA 1KCDA 4YELA 4EW9A 2NTBA 3SUCA 1IDJA 4HWVA 1IB4A 4W8TA 1OGOX 1VBLA 1O8KA 2O0VA 3VSVA 1H80A 4XOTA 4XL9A 1O8HA 2PECA 4W8QA 2BSPA 1GQ8A 1O8MA 1EE6A 3ZPPA 1BHEA 4U49A 3WWGA 4XN0A 4XOPA 3EQOA 1O8JA 4PMHA 3GQ7A 3UW0A 4XKVA 1OFLA 1OOCA 4YEJA 2INVA 1RMGA 3FY3A 4YZ0A 2PYHA 1IA5A 4YZXA 4XLAA 3VSTA 1IDKA 4NK6A 1O8DA 1KTWA 1RWRA 4XR6A 2X3HA 4URRA 1QJVA 2X6XA 1OFMA 3B8YA 1PLUA 1QCXA 2Z8GA 4W8RA 4XONA 2VJIA 4OZYA 2O0WA 2IQ7A 1O8GA 4NK8A 2NZMA 1DBGA 5C1CA 4XLHA 1O8IA 4AVZA 4OJ6A 4OJOA 3GQ8A 4YZAA 2QXZA 4OJ5A 3GRHA 2PYGA 3VMVA 1O8EA 4XMYA 3ZSCA 4MXNA 4OJPA 2NSTA 1DBOA 2NT9A 2ODLA 2QX3A 2EWEA 1WMRA 2VBMA 2VBEA 3GQAA 1K5CA 4XQFA 4Z03A 1JTAA 2UVFA 1KCCA 1O88A 3JURA 1PE9A 2QY1A 3LMWA 1XG2A 2NSPA 1RU4A 3T9GA 4XN3A 2X6YA 1OGMX 2VJJA 3VSUA 4XLFA 1O8LA 1HG8A 2NT6A 4XLCA 3KRGA 2NTPA 3GQ9A 1BN8A 2X6WA 4Z06A 1JRGA 2O1DA 4YZQA 4MR0A 1X0CA 4XLEA 4I84A
chains in the Genus database with same CATH superfamily
1VQOI 2QTLA 2ZTGA 2JVGA 1EP1B 1UMQA 4A3MJ 3NQOA 2H6CA 2Q0OA 1YE9A 2IBDA 5IT3A 3ZMTA 1J75A 1R5ID 2VBKA 4U4BA 1ZG1A 1P92A 1QFZA 1WVRA 3SZGA 1O8FA 4MFEA 4G9YA 3TOAA 3GFJA 1U3EM 3P26A 4JP0A 4A3KJ 3WTXC 1BLIA 2GXAA 1QG0A 2GQFA 2I8DA 2OD5A 4I0AA 4CDGA 2NS8A 5JFRA 3DFGA 1XDUA 3QPLA 2M0MA 1X1AA 3H5AA 2C2WA 2IS1A 4V02C 4GCVA 4XRSA 3VOEA 2K85A 5BPIA 3VMFA 1F36A 4E7SA 1XSDA 5GTHC 3T5XA 5BQTA 3JRAA 2GK6A 4QWQA 2NNYA 3TH0A 2OQGA 5FRNA 2BVLA 1H80A 3QAHA 3SFIA 2XNCA 1VQ6I 4JBAA 4LBWA 3AVVA 3A03A 2XZPA 4DQKA 2CU7A 3LYCA 1SANA 2DJIA 3K2ZA 4U49A 4Z6YA 3K70C 1T8IA 4H4KC 3CCUI 1Y0YA 3I0TA 3R60A 3HM5A 3JRIA 3S1RJ 2OBTA 5D5VB 2K86A 1AKHA 3CW2A 4I84A 1RMGA 3CCJB 2HEOA 3G71B 1K4ZA 3RY8A 1HF2A 2XPWA 1O8DA 2F5DA 3FHNA 1STZA 1IGNA 1TLLA 2PMUA 5AIPA 4HDVA 4JYKA 3B8YA 5LGNA 2LYCA 1RC9A 2DFEA 4HV6A 4UV8A 1W36C 4MLOA 2EK5A 4Q5SF 4NBQA 3U1DA 2OBRA 4UZUA 3HIFA 1SFEA 2FU4A 2RC4A 4D5FA 1H85A 1RQRA 1DBGA 1RRJA 2KFDA 2JA5J 2X9DA 1T08B 5GAEJ 3LSJA 2R4GA 1EH8A 2BM1A 1ORKA 3QWLA 4CA0A 2LZJA 3HOTA 5J6XA 1Q9SA 3GQ8A 3MHPA 4BEHA 5H5JA 2LF7A 2Z5UA 4E70A 1UD5A 2HI3A 3CPXA 5D6EA 4Z2YA 2LBFA 3WGGA 2LRDA 5FFZA 5GPAA 3CCLB 4NC8A 3JRGA 2Z33A 1XCVA 2NT9A 2ODLA 2WPDA 2IA1A 2Z2SB 4RGUA 1E17A 2CFXA 2VPLA 3FXJA 1HC8A 1D0XA 2R7FA 4KISA 1YW9A 4P9SA 4IPAA 4ZGQB 3PSSA 3I55B 4G6QA 2DA3A 4FE7A 1JKOC 1KQ5A 1ON2A 3CCYA 3JTGA 3GTKJ 4MTDA 4WZTA 5TR9A 1AKHB 3CO6C 5EGOA 3GBGA 3DU6A 4HG2A 4D7NA 3HL2A 1MW7A 4YAFA 3T1BA 2OCCH 5J4VA 3RIQA 3KP3A 3CC7I 2ICWG 2XV4S 2RNJA 4Z1MA 4I01A 1LDDA 1P7JA 5LD2C 1DARA 2C78A 4A3FJ 4NBSA 1IXSB 2FRHA 1U2RA 2GJRA 2M7BA 2KISA 2F5FA 4A0YA 4ZZDA 4HNTA 1ZGJA 1VQ7B 1J9IA 3OV8A 2VQHA 3KIOA 2XAJA 1QA1A 2FNAA 5BPDA 4MGRA 1HW1A 4QVJA 3FKIJ 1VQ6B 2R7ZJ 2BY1A 5CVIA 1D2EA 4UAJA 1R49A 3BR3A 4C2MJ 2WY8Q 3KZIC 5GAHJ 2EPFA 5HODA 4A3JJ 1ZRDA 3GCMA 2CW5A 1MRZA 3C2BA 2YR2A 3B90A 4Q4ZF 1GXPA 2XAQA 3QOPA 3RKXA 2V1UA 2ZSIB 5GADJ 3W2WA 1OCZH 1OB5A 3WYAA 3PIPF 2J8IA 4EW9A 2VBVA 1WJCA 3SLDA 3W2EA 5HKKA 2OUMA 1Z1DA 2C6YA 1OQYA 1SD7A 2IGKA 5L3FA 3R6KA 3IRRA 1OGOX 1J2XA 4C30A 3BLYA 3MCZA 4CZZA 2LK2A 3WODF 3FZVA 5E1WA 3JX8A 3OJXA 5EG0B 1FNDA 1LVKA 5HS7A 1N78A 1VNDA 1P4MA 1XGSA 1UD2A 3ZQLA 4RAYA 2VJ5A 3WU1B 3OSFA 1LB2A 1W5TA 2HZTA 3CCQI 3J7AY 4U0WA 3WTVC 2J8KA 1O8MA 2QUFA 4GGGA 1TWAJ 1CQXA 2E5NA 2HOEA 1CLWA 2GLOA 1G7RA 3RTRA 5F0FA 2EIMH 1NB9A 2BW3B 1D1AA 2PMHA 4CZCA 1HCRA 3CCVB 3UW0A 5TGTA 3ABMH 2JUCA 2R5ZA 3E20A 4Y13A 1NBMA 2IXSA 4X7CA 5A2QK 4IL6C 1O3RA 1WOOA 4Z4SA 2HDDA 1QUEA 3D1NI 3VODA 4A3LJ 1ODDA 1EWYA 4RMNA 1SMTA 5D5UB 2EFOA 1FX0A 4A3BJ 4Y7NJ 1QX4A 4HX8A 3V7CA 4MQ9F 4TMWA 3H3UA 1SFUA 3I56B 1IDZA 4AYBN 2E2JJ 4X0CA 1R1UA 2WSSA 5KK1A 2XPVA 2K5CA 3ECHA 3KYCB 1MD0A 1YLOA 3GTLJ 3NEUA 3GRHA 3PNTA 4OIPF 1LPQA 2JA8J 2Q6LA 2OF7A 2ETHA 1R6RA 4XIDA 4IQ4A 1ZLJA 1OGIA 3FK7A 5IT9Z 3CMAI 4BJ5C 1LJ9A 3JRHA 2W4SA 3E5XA 5LFAA 2DA5A 2K9LA 3LAPA 2XC1A 4RA2A 3WGHA 1T95A 1W0UA 3T9GA 3CCRB 1TL8A 2B7CA 4RCZA 2PLFA 3OR2C 2V79A 3M8EA 3QFCA 2KIMA 3PQJA 3V7AA 3BR0A 1XMAA 2XB5A 3K4KA 3JSOA 1OB2A 1N8RD 1QZEA 4G7HF 4BE2A 5CDFA 2AHOA 2ZB9A 4JX5A 4KITB 4MIMA 5LRRA 4ZYGA 3IH2A 4HV5A 4U7DA 4N9HA 2H8RA 3TDZC 5DNSA 3LSTA 1A35A 3MWMA 1EH6A 4NQWB 4O6JA 3HOUJ 4HPQA 3GZ6A 1VHOA 2ZXIA 2JA7J 2ZXWH 4B4CA 1HLVA 3DP7A 1HA8A 1UMKA 3F8CA 1VQLB 3I54A 2DOEA 4PC3A 5AIQA 3WY9A 2NTQA 1DU6A 2OU2A 1BW5A 5DN6A 2DETA 1MNEA 2L7FP 2CNDA 4AIHA 1D3YA 2LY2A 4JX6A 4LIVA 1L0OC 3KLNA 3ZIAA 2MBFA 1SFKA 1HKTA 2XTYA 3ZQCA 2BBYA 2X51A 1HVXA 1N06A 1JTYA 2VXZA 2R7XA 1U78A 5F64A 3NAWA 2ZMEB 3K1MA 1XB2A 2K9QA 4I6ZA 3ZMVA 4AUXA 3DKWA 3ZRGA 3ZC3A 1EXMA 1FOXA 5FKLA 4LGWA 1WGXA 2RV8A 4HZFA 4P12A 4U7BA 1LDKB 1MIJA 3H92A 3OZVA 2JTVA 2DPUA 2P0WA 2IA2A 3I71A 2LR8A 3NWSA 2E2IJ 2M4GA 2VASA 4YEJA 2F4MB 3LA2A 4DNTB 4EM2A 4YZXA 2WAFA 1QPMA 2VQLA 3KZZA 3ASOH 5EZHA 3HPGA 2CW0F 1TBXA 1GV2A 3DCFA 1C0WA 2X3HA 3J81K 3KEQA 2AQFA 3NARA 1R23A 1MBEA 2UZKA 2GREA 4RM3A 1J09A 1X4PA 4I99C 4BKXA 4IOAF 1A8PA 1S4MA 1IRGA 2JIZA 1ITYA 2K02A 3KL9A 2WYRA 5CQEA 3DQVC 4OIRF 2HFHA 5F27A 5ED4A 1E3ZA 5IYNA 3DKXA 5JHFA 2ZJPF 1JJ2B 1RKTA 1R1TA 5EMNA 2RQPA 1TWFJ 2LP0A 2XF5A 1O8EA 3ZSCA 1ZGWA 3IUOA 1J0RA 2DMQA 3TMOA 2PI0A 3FMSA 2ZBKA 4K2EA 3A8KA 3HAGA 3OOCA 1DPRA 4YIFA 1B4AA 1YIJI 4P1VA 3QE2A 1MMGA 2H1LA 2QCOA 1NDHA 3GEZA 2W00A 1ZARA 1O88A 3JURA 3WTUC 4HSRA 3MZHA 4IHXA 1MMSA 2V7WA 5A89A 3HZJA 4BBRJ 3VO2A 2IP2A 3S2WA 5IYQA 4A3CJ 3FXUA 3L2QA 3OYHA 5K7HA 3R0JA 3LSIA 4ZDLA 4OMYA 2XAHA 3KRGA 1FYLA 2NTPA 3ZBUA 3LA3A 1T56A 1KQ9A 2P4WA 3P9IA 3FMQA 3OYEA 1R5HA 3BTLA 3A01A 2YWEA 3ZP5A 4B3AA 3O8HA 2MH2A 1AIRA 3AGPA 2UVEA 2ELKA 3GTPJ 2BY2A 5FKNA 4EGYA 2R93J 5D8KB 3GF2A 5HLHA 1UD6A 4OZZA 4WQMA 3BPXA 2KPMA 3T56B 3S1MJ 2G9WA 4FCYA 1MH4A 3TKYA 1I39A 3HTSB 1QQIA 2VQCA 3BQYA 3LSHA 2DDAA 4XKWA 3BQZA 2EFPA 3VMWA 1JT0A 1Y39A 1P9QC 2O17A 2QEXI 2INUA 4BDYA 3A3BA 4UV9A 4TV7A 2AXTC 2WAQA 5FA6A 2QQBA 4LC0A 2LH9A 1XMKA 1GDTA 3QPHA 2GOMA 2F43A 4HWVA 5TV2A 5J47A 2CUJA 2JUGA 3LA7A 4FHTA 4MFDA 3SEZA 1IB4A 1BX0A 1SAXA 1R71A 3V8LA 5LRSA 2W57A 3G2BA 5FNZA 1QPIA 4OPVA 4BQNA 1T0FA 3TOBA 3LL7A 1NRKA 3LSMA 1UZCA 3AL0B 2VYQA 1FMVA 5E17F 4ASUA 2ZZQA 2NOGA 4MO7A 4XL9A 4CHUA 1YLFA 4ESJA 1IN5A 2Q6IA 2QBYA 2KDZA 2QQ8A 4AM3A 2DTRA 3PSFA 5D8LB 5ICEA 1JGGA 1UD3A 2QGGA 4Q47A 1DGWY 2BPOA 2QKLB 4XN0A 3OFNA 4M3DA 3K0LA 3EQOA 1B6AA 3ZR8X 3DLLF 4Y15A 3S1NJ 2MFZA 3HUGA 1ZK8A 3WHBA 2F2EA 1F1ZA 3WG9A 5JHUA 5FLMJ 2M3AA 3OYNA 4CYDA 4Z4YA 1KK3A 2NV4A 3VSTA 4AU7A 3PM1A 1QO0D 5K7ZA 2VNIA 1U9OA 3K4JA 1OFMA 4QHYA 3I4MJ 1VLYA 1QRBA 3W3CA 1SMYF 1G7CA 1NG7A 4IKFA 4XBFA 4UZEA 4UUSA 2EINH 5BMZA 2VJIA 3RI4A 1BC8C 5LHGA 3M4OJ 2V6CA 1KQSB 1TTTA 2V1NA 4MHGA 4E7JA 1I27A 3CLQA 3ZBTA 4RCYA 3DBRB 5H59A 3D5SC 3ZMSA 2HWVA 4OPOA 1O8IA 1SVMA 1QRYA 4L5EA 5HLTA 2L5QA 2PYGA 2RREA 3AK5A 2VNJA 2XZOA 1WRJA 3TGNA 1T2KA 2DA4A 1B9NA 2X3UA 1Z7LA 2FBHA 2DOAA 1MMDA 2ELJA 3MZYA 2G0YA 2MH9A 1GT0C 2EWEA 2ZFWA 1HSTA 2MD5A 3ZGKA 5IP9J 4RB2C 4A3EJ 4RD3A 1FY7A 3LSPA 1YJ9B 4PZJA 2HTSA 3RYPA 1B72A 3KEYA 3M07A 2MW8A 1WSVA 3PA1A 1R9TJ 1EFCA 1Z3YA 1GLNA 2WB1A 5BNGA 1G59A 2DFFA 1FOWA 1WWXA 3ABKH 3MN2A 4XLFA 2GJKA 4V2FA 2L7MP 4P5OA 3S93A 3OR1C 1KU2A 4F7ZA 2A6EF 2LNBA 1VQ8B 2QGUA 2TCTA 1U0JA 1K9MD 4EJOA 1LNWA 1QVTA 1X4OA 1TYXA 2B5OA 3M9AA 3ULQB 2HYGD 1S3JA 1E3HA 3H1CA 5CQGA 5E8GA 1NH3A 2GOXB 4B48A 1ZM4A 3SJPA 1VQPB 5E3OA 3L2RA 1RETA 1K78B 2XB0X 1B8IA 3I59A 5ERIA 4LBVA 3F6OA 2WZPP 1TZLA 1PXZA 2KRCA 3GX4X 3W6KB 4V2GA 3IRQA 3CCJI 4ZDOA 3OOPA 4AIKA 4M9SA 3MFKA 3G71I 3T53B 1SD6A 3PUBA 1OFCX 2VOOA 5KW9A 1P4XA 1Z6TA 4CYCA 1J5YA 2BEOA 1TLHB 5EDNA 1B72B 1BJKA 1T0FC 1DU0A 1VJSA 5EJCA 2E36A 2ZJ2A 5DDGA 2BSAA 2PIAA 1USTA 3ABUA 2X53S 2X1DA 4HLYA 1YI2B 3BC9A 1YIJB 5EEGA 2DW4A 3GLXA 2O6WA 2RAEA 5FLVA 4KIFA 2IPQX 3OS0A 2NVXJ 4F7DA 2LKPA 2LD5A 4S0HB 2D3NA 1ETKA 1LE8B 3GSIA 3LOCA 3COAC 1WDTA 3A4CA 3E6DA 4LBYA 5E3LA 1YS7A 1IJWC 3OWTA 1O8JA 3F6VA 1ZN2A 2EV6A 3OMYA 3CCLI 1OOCA 3Q9VA 3TBIA 2INVA 3BTJA 4ZH4F 4C2UA 1T38A 1XTAA 1SVLA 2VQGA 3QYEA 1KTWA 1I50J 1QZZA 1X3ZB 3PO3J 1IV8A 2FOKA 5CVUA 3I55I 1XD7A 5F1RA 4RLFA 2E71A 4PC7A 3FXQA 2X48A 2Y9ZA 3E1SA 3ISXA 3CC4B 1FLIA 3HBLA 1GAWA 5TISC 2Q8KA 4L5IA 2XPUA 1H42A 2WC2A 2C5BA 3CZ6A 3PUMA 1MNDA 3CD6B 2QSGX 3GFIA 3MZ8A 3KETA 3HHGA 1OGJA 2NS0A 2N8GA 3CMYA 4J01A 3JU4A 3AVXA 2BHZA 4D7MA 4KUMA 1VQ7I 1Q81D 4CCJA 2GK7A 2BOLA 1X1PA 2K40A 2UXNA 4QSHA 2M2EA 1YQAA 4IHTA 5F4MA 3O6BB 4KN4X 2M7AA 4J19A 3LMMA 2CW7A 4DYCA 3G4SB 1EF4A 1XG2A 2CUZA 3JSPA 1QVGB 2ZC2A 4G6TB 1WXRA 5E3NA 3DWLE 4LB5A 2V1XA 4DZJA 2C5HA 3C1DA 2ZNYA 2RKHA 4P55A 2CO5A 2MD0A 2X4HA 3NRVA 2V7VA 1KZHA 3BDDA 2BMWA 3C18A 2Z6BD 4MR0A 1ZYRF 4HEA2 2JVHA 3KFWX 1FBUA 1YJNB 3RZDJ 2EQRA 4G7OF 4B43A 2PMZA 2MYSA 1KQ0A 2UUZA 1E3OC 1W35A 4ENMA 2X0KA 1W5CC 1G3TA 2OPTA 4OP7A 1LLZA 3A2KA 1ZKGA 2ME0A 4C2LA 2MLGA 1AU7A 2VONA 1R4MB 2DT5A 2E1MC 4ENKA 4XORA 1SFOJ 3RPUD 2WAEA 3OL3A 4X6AJ 2LTPA 1OKRA 2DAOA 3V7SA 3J80Z 3CCVI 4C3IJ 1XQBA 2V7TA 2BXZA 5FROA 4KH3A 3LSKA 1W0KA 2VBXA 2CC2A 3P27A 1RR7A 1YIOA 1ERDA 2JJ2A 3PL8A 4BH9A 3RQIA 4KFCA 2W84A 4BPRA 4WZKA 4FXUA 2QZ8A 2QQ9A 2AXLA 3MD2A 2R7DA 3C7JA 3SXYA 1PUFB 3I56I 3WNBA 3CPWB 3BH7B 3EYIA 2FSWA 3E1YE 4EH1A 2K4JA 2Q6OA 4RJLA 5FD6A 4N3NA 2COBA 3OZWA 1G4DA 1BR2A 2KRHA 1TYUA 4HYEA 3R61A 1KK0A 1D8TA 3FX3A 3CUQC 1QGPA 2E35A 1HF0A 2EFWA 4KNYA 1X3UA 4XLAA 1I1GA 2W7NA 3HRSA 4NK6A 3SLNA 1RWRA 2DK8A 3OL4A 5TRDA 2HPMA 3UNGC 5IY5H 4A93J 3J80K 2EZIA 2DMPA 2V26A 5KAIC 1WOPA 4X7DA 4D1QA 1W87A 4D0PA 1RR8C 2V9PA 3CCRI 1R00A 2A5WA 3JRFA 1APLC 3HGYA 5LEKA 3ERMA 4EGZA 1T33A 1W7PD 2BVMA 3M1CA 2YS9A 1TT0A 3ZOBA 5FB2A 2HMAA 4OPSA 4QTRA 1WH5A 3FHZA 1W7PB 1FYKA 4OJ5A 2KQRA 4L8JA 1VQNB 2L3DA 4M3EA 4B3FX 1I1SA 1ZTRA 2FVGA 3BZ6A 3GYHX 2NYXA 2IW5A 2A3SA 2WJVA 2VBMA 2ZNZA 4M4SA 4PGOA 1UG2A 4ZGNB 1BJAA 1JT6A 3HSFA 2P5KA 1COWA 1KK2A 4PK4A 3DF8A 1MZBA 3FK6A 2GM4A 1FBSA 3GZNB 3VSLA 4YAUA 3MKLA 5L3DA 1VQLI 2VT2A 4HE5A 1LDJA 3BNWA 5D5XB 2ESNA 4KT5C 2JQ7A 3OPOA 2WWYA 3OJWA 2XGDA 3PETA 4M1KA 4HF1A 3SQNA 4P6YA 1HA3A 3LO8A 1WSRA 2ZL6A 1SKQA 1NB0A 3ZN0A 1YHQB 3A35A 1KYZA 1POGA 4XLNF 4EJTA 2O04A 2HXIA 3GW2A 1UHMA 4YXWA 3K4BA 3IH3A 1XC5A 4WXCA 1BIAA 3S3NA 3GVKA 4BL0B 5C1EA 1JHHA 5K5RA 1SKYB 1E3PA 4TMVA 3L1PA 4JQFA 2M4KA 2F1MA 2UXXA 1CZFA 2XNDA 1ZLKA 2PBIA 1ZAOA 3H3VK 1IXCA 4IHYA 3DDYA 1O57A 1X1BA 3CMMA 3ZQHA 3QOEA 4ETSA 1KD1D 3DBHB 3L2UA 3A1PA 3FXOA 4PSWA 4FTHA 1FSHA 1IN7A 3CP2A 3SUCA 3BP8A 5EYRA 4DJAA 1G7SA 4DOZA 4E4HA 3CCSB 2NRAC 1LLWA 3OYCA 2D1HA 2FQ4A 2WV1A 5CLSA 3H9GA 4CUGA 3O2PE 4B47A 2HQNA 1VBLA 1RZ4A 2XRNA 2DFIA 2P6TA 5AONA 1V0FA 1WPCA 3TO9A 2L02A 2B7BA 2R6HA 3BCDA 2KZVA 5IP7J 2PJRA 1XDSA 2LOOA 3TQNA 1I6XA 2MGQA 3BY6A 1MMNA 4BEHB 5A2QZ 3A1YA 1BHEA 2EV5A 4RB0A 1JGSA 2BM7A 3TO7A 2F5CA 5C4JJ 2VOPA 4G1VA 2NPFA 2LBFB 4G7XA 2FEZA 2DPDA 3BTCA 2Z3YA 3GQ7A 3WTTC 3QFRA 4G7ZF 2BY3A 1A6IA 4PJMA 5AN9A 2Y75A 1NHAA 5GV8A 4II2A 1GO2A 3OW2B 3U2QA 1YX5A 2XTWA 2XAGA 3GTOJ 3N97A 2JN9A 4A3IJ 2IGNA 5FGMA 3E6CC 4YC5A 5EGOB 1Y0RA 3RPQA 2VI6A 4CGZA 4QPOA 2BVNA 3GVJA 3ZPNA 3MAJA 3ZMUA 4OZYA 1OFDA 2M8GX 2B9SA 3A0HC 4I0BA 3OEHA 3GUDA 3A02A 2Y31A 2NOJB 1D5YA 1LM1A 5JLVC 2IAIA 4UXNA 1TVCA 3ONUA 1W1WE 2LLKA 2CG4A 2M8EA 3BG7A 4Y7CA 4Z4ZA 1I8DA 4RAGA 5CVVA 3F23A 5HVQC 4L18B 4KT6A 4HQEA 4HX7A 2ADUA 2EFNA 2PJRB 5BSXA 2CSOA 1WSUA 1B23P 1K5CA 4U88A 3M7GA 3FWEA 4HAMA 3AGQA 4P3YA 3S17J 1G7TA 2QDXA 4H9GA 2CV2A 4X05A 2BM5A 3E97A 3OYDA 1H8HA 2CBXA 3LMWA 2JSCA 2KIFA 1N75A 2P6SA 3O8GA 2VODA 1J9ZA 3QSYA 5DD4A 1O3TA 1BI3A 2HYJA 3LQRA 4M53A 3BPVA 4F92B 2DA6A 1DDGA 4LLLA 3EETA 1HDDC 4RPDA 3K69A 4NCNA 1FDRA 2QWWA 2A05A 2I5UA 4FISA 2Y9YA 4PCQA 5FFXA 5ILSA 5ICGA 2E7WA 1WCMJ 1Y1WJ 2DN0A 1UFMA 3B73A 1A36A 2R7OA 2ZXHA 3PQKA 2EJRA 5IPAA 3SEQA 1TC3C 3S1QJ 2BGIA 1MBKA 2DOFA 3H0DA 1Q82D 3AVWA 4ABZA 4ZYAA 3CJNA 2XSJC 4IQJA 1BM9A 4ESBA 3T51B 1PYVA 3OOUA 3BQJA 1VF9A 4RM2A 3EUHC 2X85A 4HOBA 3SEJA 4RD4A 3EQNA 2RDPA 2KZGA 3Q38A 1F5TA 4FX0A 3RKQA 2YX7A 1MBJA 4E7IA 2QE7A 2BM6A 2IGMA 5K5QA 1VQ5B 1RIOH 1FT9A 2R5ZB 2ZXJA 3R6SA 1JUPA 5KNLA 1OR7C 2K9SA 3AG2H 2XSDC 1HDPA 4P9FA 3ML3A 3ERED 3H9QA 1Q1VA 2ZFUA 4L0YB 2ZITA 5HS8A 1BPLA 2A07F 2DEUA 1TWCJ 4RDUA 4U9UA 2ZBVA 3IH4A 1D0YA 2M87A 3CC2B 1W0JA 2ISYA 2DO7A 3MCAA 4PC2A 4PSXA 3I4PA 4HA8A 3BJOA 1UHWA 1VI0A 3ESWB 3PFIA 5GP9A 4OM9A 3H3ZA 5F04A 2J5PA 1UD4A 3CB4A 3VR6A 2BSPA 5THXA 2R3SA 1JKRC 1PVEA 2UWMA 2FOWA 1BA5A 1KU3A 2WA0A 1ACIA 3HOSA 3E5QA 3OIQA 2DFHA 3J81Z 3L2WA 2DMNA 3AVUA 1AWCA 3VDXA 2XT2A 3ZPLA 2CQKA 2J5OA 4Z4WA 4A69C 1MDMA 2VUMJ 2PYHA 1KU9A 1HZEA 4BHBA 5B3SH 3IL2A 1I3AA 2EZHA 2YUSA 4M6YA 5E1ZB 1FRQA 3M8FA 3DTEA 1FPQA 2XC7A 3CF5F 1W5SA 6PAXA 1WOSA 1L1IA 2IS2A 1YJ9I 2IRFG 5IK2A 1TQMA 3JRBA 1TQIA 3WTZA 1U9NA 3C3WA 2ID6A 1WJDA 1E79A 2O0WA 4RDLA 2V4DA 4C3HJ 5DS9A 2BF4A 3ROUA 1FC3A 1V5FA 4LK0F 3QPSA 4XSXF 2E34A 4PABA 4OJ6A 2HVRA 2JA2A 2L9RA 2LC2A 2P7VB 3K9TA 2E19A 3CMEB 2QKMB 5DSZA 1VQ8I 3H5RA 1QA3A 2VZLA 1WI3A 4QUZA 1FWZA 1BQEA 2NSTA 4ROXA 3ZQGA 4A3DJ 4MYUA 2V9KA 4AIJA 4NDLA 1JI8A 5EEAA 3OAAA 2OZUA 2PLYA 1NG6A 3Q3AA 4S04A 1VQPI 1ZREA 3V42A 4FASD 1JKPC 1JTAA 2PEXA 4O5VA 1IV6A 1ZHFA 1FJLA 2LDUA 5F1JA 2R7QA 2GZWA 3JAMK 1R1VA 3QYBA 3D5RC 1ZRFA 4HBLA 2EA2A 3F0CA 2D74A 2FA5A 2QQAA 3H9NA 3L00A 3W2GA 2AS5F 3SJMA 4BY1J 2RVCA 2VBTA 2YUHA 3QP5A 1PJ7A 2NT6A 4TKOB 4RGSA 4XLCA 5A88A 1N25A 2VKVA 3SDGA 4ZJZA 4IRGA 4W97A 3E6MA 2WBMA 3ZQIA 2QYOA 3R4KA 1EJ9A 4ANJA 1E0EA 4M2LA 4WK8F 3B02A 1UHSA 2YU3A 4C3JJ 3ZQFA 4QLCU 2IA0A 1HW5A 3IKTA 1ZH5A 3KPHA 1N0VC 1V55H 1YI2I 1WKMA 3FMRA 4WZEA 4EMSA 2JPBA 2IEKA 2KRFA 5FLXZ 2ZZGA 2D3LA 1ZR4A 1OCCH 3LVBA 4LBZA 2IOUG 5AMVA 3DBLB 1QZYA 1S8NA 2O5RA 2HLDA 3ZMZA 2QSHX 2HDWA 3KP6A 3U21A 5D4RA 5E79C 2HR3A 1R4NB 4OAZA 2V7UA 5L3EA 3B8HA 1U5TA 4RB3C 1D1NA 1F43A 3QU3A 4EV0A 5DEQA 1I18A 5M3MJ 3KP7A 1KU7A 2HKXA 3IHUA 4HF0A 4ASNA 3E3VA 5EF6A 3CTAA 2DCUA 2IT0A 4RDJA 1J59A 3P4GA 4OU0A 5JLXA 3CC4I 4OOSA 4CO8A 2ECCA 3ABTA 4W8QA 5TY0A 2XASA 2CQQA 3W2VA 1JNYA 5KHDA 1DDNA 2DBBA 2P7CB 4P2NA 2L0KA 2K4BA 3MVPA 1FBQA 4XOPA 1K7AA 3CD6I 2P81A 2XZLA 2AHQA 2RNGA 5C4XJ 5FLXK 2C77A 5JMCB 3HKZN 5JLWA 4XK4A 1XFOA 4HE6A 2E1OA 2E7XA 4RD1A 1X58A 3I58A 2GPJA 1VQMB 4HDUA 1IRZA 1S7OA 4ZCLA 4I7HA 1IDYA 1D5VA 1KK1A 1Y56A 2OBSA 5L46A 4Y9RA 5JBQA 4GXOA 2L9SA 5B6IA 1QA2A 1K6YA 1RNLA 3G4SI 5H2FC 4BXUA 4Z4TA 1R5GA 4HRIA 2DA7A 2X6OA 3RQ4A 5E8IA 4EJVA 3F8BA 2H09A 4P9UA 2FF4A 1GAQA 1GV5A 1V5GA 4B44A 4HF2A 2GA2A 3K4LA 1F60A 3HPHA 1GUUA 4XLHA 1HKQA 1QFYA 2IJLA 2QXZA 2EV0A 2F4OB 3A01B 2IS6A 5FKKA 1TT5B 1YJNI 5IYDJ 2Y0SN 1CF7A 2K3FA 3G73A 1TNSA 4UVBA 2FX3A 3EPZA 1USSA 2JPCA 5LHHA 3E5UA 1K8FA 1B1BA 1OISA 3R0AA 4QPQA 1QGAA 3WU0A 1FNCA 4RD2A 5F0CA 4Q7JB 5J3LA 5F08A 2ID3A 3I3LA 4G7WA 2WAQN 2WY7Q 5HZAA 2FBKA 3F8NA 3Q9SA 4TMZA 4DNRB 4XN3A 2X6YA 2LREA 3RZOJ 4Y33A 3OEEA 3LJYA 4IOCF 1QGYA 1ETYA 1XSVA 4E7ZA 5IOZA 3BROA 3FBNB 3OYLA 2HOAA 5JI6A 1W0TA 1CNEA 2OQRA 3BR6A 5J1RA 5K7FA 1VF7A 1F20A 1LFPA 4A0XA 4ACBA 4XLEA 4KKTA 3OIOA 1Z7UA 5B66C 5CJ9A 3NB2A 1S29A 5DCMA 3CJRB 2QYUA 2DU9A 4XNFA 5HDGA 1VLOA 3TW7A 2WADA 2QBYB 2B0RA 2M0CA 2EIKH 1YTYA 1SEUA 2V1DA 3ISPA 5E1XA 1YRNA 2YWFA 5L3GA 4YDTA 1Q7YD 3HUGB 4A3GJ 1M1KD 4RGRA 4C43A 2ZZFA 4FK8A 3VYRB 3SY2A 2ELHA 3M3YJ 5HLGA 2D2WA 1U5TC 3VB2A 3OE7A 2DDBA 2DODA 5DTDA 2EH3A 3HC7A 3TP0A 5TJJA 2E2HJ 1R5NA 3WQZA 1HQCA 1MBHA 3CDIA 1TNTA 4M6VA 1S6LA 1W2BB 4UUSB 3GVAA 1E43A 2CQXA 3F8MA 4L9NA 2GAUA 3WE2A 3PUFA 1B59A 4GO1A 1XX5A 2VE8A 3ASPA 3DLAA 1FMWA 1IW7F 1UCRA 2VC0A 3B6CA 3JW4A 3AL0C 3S8PA 4EVIA 1I7PA 3WU2C 1ZRCA 1K4TA 2X8KA 2ZL5A 1VQNI 3JQRA 2OTLB 4HX4A 1EFRA 2NXNB 4DYRA 3DU5A 4PFOA 1SM4A 3NE5B 1VTNC 3SQVA 3CO7C 2VLAA 3FY3A 3G3ZA 4YZ0A 2ZSHB 3M8JA 2NVYJ 5M5WJ 4DK1A 4YCQA 2EA4A 4ZDPA 3PSZA 3GVLA 2L2OA 2VBYA 4XR6A 1QJVA 2LVSA 4Y4RA 1FNBA 4PC6A 3DU1X 2W1OA 1QHHD 3HTUA 1TP4A 4N4OB 3S2DJ 2VNKA 3RIRA 2CRGA 3L7WA 1BR4A 4PJJA 2BHYA 1WJBA 3RDIA 1SC7A 2STTA 4NK8A 2XIGA 1ZM2A 3PA2A 2VBWA 2R7WA 2Y69H 3CCMB 4PAAA 4NNJA 1WJ5A 3V76A 3VFZA 3CRZA 1VQKB 2DMUA 4BJ6C 3G05A 2LSOA 2TDXA 2BY0A 1WI9A 1OYYA 2VBZA 1YHQI 3PUNA 2V7QA 3NWTA 3VPRA 1IUYA 4N9IA 3GZ5A 2ZCWA 4KJZA 2M30A 3CUQA 3D5LA 2CF4A 1XS9A 2VB6A 2VBEA 4LG0A 1DUXC 1TW2A 2O7OA 3L09A 2KHMA 1R36A 3AAFA 4ESFA 4ITVA 1YJWB 2M9HA 1B8IB 3I59B 4S05A 1WPKA 3GO5A 1ZM9A 2VFMA 2E1MB 4AC9A 1B9MA 4JRAC 3FISA 3DPTA 3BR5A 3Q0WA 1E1RA 2HTJA 3BWGA 1E3XA 4M3GA 1GHCA 2W6IA 3AVTA 2VJ4A 3BOQA 3EUKL 2STWA 1G3WA 2CJJA 4Z4UA 2DK5A 4I2OA 4GRIA 4CYCB 2HOSA 4L0ZB 4Z06A 2E5ZA 2O8XA 3TEDA 3CCSI 2H6BA 4DBRA 5J1YA 4BBSJ 4AF7A 3BR2A 1OHHA 1A6QA 1AOYA 4R8HA 2PMDA 2M5WA 3CQZJ 4RS8A 4BACA 4OPWA 3I53A 2Q2EA 3SZPA 2A6HF 2KT0A 4R79A 2RC5A 3DTIA 1Y0UA 1BI2A 3T8RA 5HNFA 4RLQA 3G6EB 2VIXA 2VXDA 1BI1A 3KP5A 2EFQA 1IHMA 2WR8A 4CXFA 2A69F 1Z05A 3JRCA 2VKDA 2CQNA 2GIVA 2B7EA 3IWZA 4PDKA 4WX9A 4F91B 1JJ8C 4HNUA 1QA6A 3D26A 1MBGA 5DCFA 3GTGJ 1WQ2A 3I1FA 4BGDA 1DGRM 2VFPA 1IO2A 2LMDA 1D8KA 2KJCA 2XAUA 3GWZA 2KL4A 3FPPA 3CUQB 2KKOA 1BOAA 2NTBA 1P6RA 3RPUA 3ASSA 3C2HA 2HVSA 1O7FA 2FQ3A 1DG1G 2QLZA 4LG3A 2BN4A 3QFSA 4OOXA 2HYFA 4M73A 4QIWN 2RQQA 4X8IA 4G12A 2KIUA 3CJTB 4B8XA 3U9GA 4CCKA 5FIUA 1FTTA 4LFUA 5L3CA 3D0SA 1XCBA 3FBIB 1JA1A 4TMTA 4BQQA 3VSVA 4M74A 2BM0A 2K7LA 2Y0MA 1OJLA 4ZZLA 3CCEB 3K70D 3O3KA 5FD5A 3N6ZA 2PECA 1OPCA 3QP6A 2V5IA 3WTSC 1GQ8A 4II3A 5CYVA 4DIQA 1V3FA 2YWHA 3MMYB 3VNVA 3W6JB 3ZN1A 3WWGA 3OYMA 3R6JA 4L5JA 3BG6A 5HLIA 2CUEA 2OK8A 4J00A 3S16J 3GLLA 1YX2A 3ZZUA 4XKVA 2O3FA 1I5ZA 1T6SA 4PJNA 4BE1A 2R7TA 1JUMA 4RDKA 2GQQA 1K79A 2FJ1A 4IEJA 3BY1A 1MGTA 1W36D 1O4XA 2X6XA 5GAGJ 5BSYA 2I1LA 4PFPA 1PLUA 2EBIA 4XRSG 1X2MA 2DQLA 3ABLH 3PSIA 4XONA 5DV5A 4BAYA 4PC1A 3U6BA 3SZTA 4CICA 1KJZA 1V4RA 2NZMA 4XSZF 1K6OA 1QGZA 5E18F 3BG3A 3OS1A 3P5JA 1DPUA 3TL4X 2HDCA 4FQGA 1FSEA 2XF6A 1EKEA 4HQMA 1XMXA 4IO9F 3QU6A 3DV8A 3EDPA 4KN7X 3BT9A 5LMZA 3E7LA 1S9HA 2FMLA 3MEXA 5IYBJ 3LSRA 1IXRC 4B3XA 2L7ZA 3OS2A 4ENJA 4DQLA 3MQ0A 1V0EA 3VO1A 1ZM3A 1V54H 1BI0A 3AKZA 2F3LA 1KRHA 1KZLA 5H6QA 3SHFA 4EM1A 3W2FA 5FJ8J 3FM3A 2CV0A 2O9LA 4UUVA 1R7JA 4KDPA 3Q6QA 1K73D 2L9NA 1QRCA 4WCGA 1PE9A 5J1UA 5C3EJ 2V6EA 2QY1A 2DLLA 3HOZJ 1FYMA 4IHWA 1VZ0A 2QMUA 1VQ5I 5HS9A 2KLOA 2MG4A 3FDYA 1PP7U 2DTZA 3H5NA 3T8TA 3VSUA 2NVQJ 4I09A 5IYCJ 3GMEA 1DQUA 4DYQA 5L3BA 1LQ1A 1ON1A 1X0CA 2FXAA 1KTVA 3F3XA 3HRTA 2FMYA 2HNHA 3I5UA 4KICA 1T98A 2AO9A 4LD5A 2H8WA 5CVRA 3TO6A 3VYTB 4I76A 3CC2I 3W2IA 1YITB 5E20A 4W8SA 4CCMA 4Z4RA 2NAZA 1ELOA 4OJLA 2Z9OA 3F72A 2VC1A 3HXLA 1E62A 3F9KA 1PKVA 2VN2A 1KC8D 4N4NB 2CUFA 4F55A 4G5GA 4CSWA 1Z9CA 1E64A 1QUFA 2ZTNA 4UZFA 2NNNA 1TSPA 2E60A 1GJRA 1KGSA 3GFMA 2BV6A 3WE3A 1Y8RB 1E1QA 1N05A 4B1RA 2R7VA 2L4AA 1KCDA 4YELA 3T0YA 2X0LA 3S15J 1JB9A 1GXQA 3A3GA 2XVCA 4MEYF 4R1HA 2MC4A 2M34A 1BOBA 4PUSA 4XLPF 2YSRA 3HSEA 1X3WB 1HSJA 1VQ4B 1FP2A 3Q39A 2XROA 1GR1A 3RYRA 4U87A 1MH3A 2AQEA 2D1VA 5J8FA 3E6BA 2BE5F 2CYYA 4LB6B 3RSNA 1NK2P 1EP3B 4P26A 1TYVA 1RPWA 1FOKA 4EJUA 3EUHA 3K1PA 3KP4A 3MKWB 1RUOA 1Z21A 3W5VA 3LFUA 1LFBA 4B09A 1KONA 1MJAA 4P6VF 4XKCA 3WXMA 4GYIA 4UVCA 1LFUP 3CMEI 3LAJA 1LKXA 3VWBA 1G2HA 3OY9A 2Y2ZA 5FKMA 2XGJA 2Y30A 3OIPA 1OR7A 2RGVA 3PVDA 4IF4A 4TMXA 2JZYA 4Y3OA 5DD8A 5M5YJ 1IA5A 4YEIA 1OCOH 3V8JA 2O61A 3HG9A 4ZC3A 1LEBA 2A68F 5CKTA 2COMA 4PJLA 1S7EA 4RPBA 4DBQA 4M6XA 5KCMA 4AD9A 3PO2J 1X1CA 5IOYA 1XE1A 2QZAA 1RKWA 5EG0A 1ZELA 3HGGA 2HPIA 4UHTA 1RUNA 2H94A 3DPUA 3OZUA 1EZGA 3X2QH 1Y6IA 3BY2A 4K1XA 4I02A 2HCJB 2R0QC 3FF5A 5D5WB 3ML6A 1S0UA 2HQAA 2QENA 4XMYA 3K4NA 3MKZA 3RKYA 2BW3A 4ACAA 1FRNA 4X7FA 1MJBA 1AHDP 1IN8A 4OMZA 4IHVA 3WG7H 3LFKA 3IV5A 4ZYEA 4G1BA 4FN5A 3BJ6A 1OCTC 2UVFA 3U6KA 3DTKA 2R92J 2OTJB 1ONVA 4O3MA 2BZTA 4MQVA 5DYMA 3A8IA 2LG4A 4BYYA 1VQ9I 1K8AD 2ZJQF 2UV1A 1Y8QB 2G0EA 1P4WA 1LUJB 2M1BA 2GXBA 5M5XJ 1EH7A 2LKXA 1OMIA 1RESA 1TTYA 3GQ9A 3OYAA 2QA4B 3QODA 2X6WA 1P7IA 4IX7A 3CXCB 1FOYA 1K83J 3JTHA 4AYBA 4EJWA 4YZQA 1K61A 2K3PA 4W1UA 2F4NA 4A5NA 3QPTA 1T6YA 4QFMA 4RM0A 3AVYA 2EB7A 3JCUC 4JX4A 3N90A 2A61A 1G3SA 3CF2A 3HOWJ 3F8FA 2XAFA 2D45A 2K9NA 3HJEA 3SDBA 3PIOF 2Q1ZB 3K4CA 5K1YA 4JMQA 2P5VA 1MSFC 4UVAA 2Z1DA 4AF6A 5H20A 2P8TA 3IC7A 1CQTA 2JA6J 1N0UA 3IAS2 3RJPA 1QQ1A 5J4YA 2MABA 3W2AA 5CPRB 2I10A 3C2GA 1T6XA 4G6IA 1ENHA 2H1KA 2R5YA 4RAZA 3S3MA 2GJPA 2P5LC 4L9TA 4YHBA 4CH7A 5DUKA 1VQMI 5E6TA 3RKWA 3AG3H 2KIQA 2H27A 1IB0A 2OA4A 4F3QA 3SYJA 1XGMA 4W8TA 1QHGA 4RBOA 4DGWB 4L9VA 1PJ5A 4G94A 1HW2A 2DOGA 3K7AJ 4HIZA 4JK1X 3ZUGA 1HOMA 1VQOB 1H88C 3E0JB 4G8XA 3GIRA 1G3YA 1I6HJ 1RI7A 2O0VA 4WF2A 3V7RA 2NVUB 5DM6F 2HU9A 4EQQA 5GPCA 3I64A 2OBPA 3DXJF 3RCOA 1O8HA 2DYRH 4M3BA 4KKUA 4XD7A 2R9VA 3ZZ0A 3ZPPA 4KKSA 2V31A 1FIPA 2JDIA 1R22A 4N0BA 1YS6A 1R5BA 1IN4A 4LJZF 1KMHA 4NQWA 1BJZA 1VFCA 5B5EC 3LNQA 4Y52J 5LBQA 4AC0A 2O6GE 4UY8I 1QU3A 1MBFA 2IGOA 3KE2A 4G6DA 5EEHA 2YPRA 1JE8A 2VNHA 3CJQB 5B1AH 9ANTA 4LMYA 3FJOA 1SD5A 1ETXA 3VSKA 3S2HJ 3H09A 2XNJA 2XDVA 4X7EA 1BBYA 2XGCA 3LNNA 4QVAA 1QCXA 1JJ6C 2FBIA 3ASRA 5J35A 4NC6A 1JTXA 2FX0A 4M3FA 1F4KA 2ZZEA 2GA1A 3GTQJ 2R5YB 3KCCA 2L4MA 4R71A 4M72A 3WGIA 1EFUA 4Y9UA 4EM0B 3JREA 4UNOA 2ZMEA 2L54A 2LY9A 2DT7B 2D5VA 1V5EA 1SFXA 3OP1A 4E0FA 1Z77A 4E6KG 1FX7A 4U0YA 2ECBA 4BUPA 2EZLA 2W25A 1J7KA 4OJOA 4V19K 4LITA 1U8BA 3CCUB 2JN6A 3ZMDA 1FNMA 2Q6KA 2YU9J 4CQJA 3CDHA 5JVGF 2XRLA 3JAMZ 1UB9A 5LEJA 2K27A 4Y17A 4LK1F 1GVHA 2KDOA 1YX3A 2WZNA 2PN6A 2OJED 1U6GA 3FXKA 5ICFA 3ZQ7A 4EATA 3GTJJ 1IJFA 4Z03A 2ZBUA 5C44J 1NJID 2F48A 4IVNA 1O7LA 2F6CA 2LY1A 3A0BC 2DYSH 3H36A 2XEXA 3ONYA 3OYJA 3K6GA 4GFBA 1EP2B 1LEAA 2DCEA 3VYSB 4YAWA 1T5EA 3N05A 5IT9K 3KEWA 2JMWA 4TSFA 4KMUX 1A5JA 3ZZTA 3OYKA 2LF8A 2B0LA 1O3QA 2O1DA 1ZG5A 2PFBA 4IHSA 1TW3A 4C9YA 2Y48A 5BS6A 5FRMA 4EEFG 5FO5A 1GVJA 4CCOA 2EZKA 3KLOA 3ZQQA 1DP7P 4YALA 1DP3A 3L9FA 4DZPA 2XGEA 4M9ZA 3H0GJ 2C4TA 2QF7A 4HNVA 2FUG2 1ZG3A 3WHCA 4A0ZA 4PGGA 3FXLA 1JUSA 2CMPA 4BXXJ 2V7FA 2OAZA 4AVPA 2EIXA 1TUIA 2IS4A 2OTLI 1U8RA 2ZL7A 1XG1A 2W7ZA 1WH7A 1WORA 1MDMB 1YOVB 2MC3A 2QSFX 4IJAA 5H6RA 2DA1A 2O03A 3AG4H 5GTIC 2W82A 2NS7A 3M1EA 3CLOA 4DNCA 3JRDA 1FTZA 3CC7B 2L01A 1PJ6A 1OB0A 1YFHA 1JHFA 1BR1A 1D1CA 1AA7A 2ACJA 2XHKA 4Q48A 5FKOA 1Z3XA 4A5MA 4PGHA 3CUOA 2WV0A 4RAFA 4L9JA 1WP6A 1AIPA 4J0QA 1O8KA 1CGPA 4WZLA 2XF7A 4UUTA 4H0EA 2JRTA 1MSEC 1TYWA 4YFOA 2W6JA 1V5VA 4XOTA 1D0ZA 3CCMI 4A6DA 1VQKI 3P9CA 5F6FA 4YIRX 5J8CA 2J7KA 4YFKF 1VQ9B 3B6AA 1XPXA 1YO5C 5EZGA 3I4NJ 1JXSA 2CQ7A 3K4MA 2CK3A 5LGTA 3UKGA 3BCFA 5F4JA 1IRXA 4B4DA 4D9JA 4X07A 3UR3C 2RN7A 1ZR2A 2A5YB 3DEUA 4WXDA 4LOCA 1BMFA 1N07A 1PDNC 2QN6A 1JA0A 2W48A 3HKZA 4P96A 4TN1A 1PJRA 5HZBA 1YJWI 4BE0A 1IF1A 2ZO4A 3P7NA 4P1WA 3L2CA 2DERA 3BJAA 1YG2A 5FL7A 4W8RA 3J7AO 2FD5A 3LSGA 1LVAA 2ZMEC 3ECOA 3CCQB 3ASQA 1UELB 5C1CA 1ZGAA 3EYYA 4CCLA 2DA2A 1BC7C 3Q3SA 3W5UA 1MJ9A 1A04A 4NB5A 3JQPA 1JKQC 2ESHA 1XN7A 3BTIA 2BGJA 2QTZA 1X19A 5KAFC 4YZAA 2R7SA 4IZZA 3V4GA 3S14J 1REPC 2W24A 4CCNA 3HHHA 1K28D 1I3QJ 3MMPA 4ENNA 1BIBA 1DBOA 3BC8A 1OYWA 1PP8F 2JSPA 1PUEE 4GQNA 3LQEA 3LQQA 2VKEA 3JQQA 5A8AA 2OYNA 1KQ8A 2Y0SA 3G6EI 5FO0A 3W5HA 2ISZA 1HXDA 3CP8A 3OW7A 1KCCA 3FM5A 4XRFA 2BV3A 2HS5A 1GVDA 3VNUA 4MNUA 3BG5A 3I9V2 1WU8A 1WHUA 1S5LC 2V9VA 1OCRH 3HOVJ 3FKJA 5DUIA 3Q0VA 3KYLA 2VE9A 4RD0A 1IRFA 1TWGJ 1U5TB 1HG8A 1BN5A 4HW0A 1WJFA 5IP6A 2O0YA 1IG7A 3H35A 2JWTA 3DKYA 1BN8A 2DIEA 2HOTA 4WWCA 4ZCIA 2DMTA 4OIOF 4HSTA 2E1BA 3J7YJ 3B82A 3WNCA 4KYWA 3FXRA 1EV7A 5DM7F 2KMUA 2YX4A 4DK0A 1BL0A 4IRHA 4X0GA 4Z05A 3CCEI 3LQ6A 2D9RA 2DYIA 3CMAB 2PX9A 2DT6A 3QQAA 2ME6A 3HOXJ 4BNCA 1R5OA 1WTHD 1Q86D 3KYDB 3VEPA 4OAYA 4OIQF 1U2WA 1DABA 1UG0A 2MSYA 3F21A 2F5VA 4BXFA 1EA3A 2JT1A 2HVQA 3IKVA 4FX4A 2LKSA 4ZYDA 1SVOA 3B4NA 1OCPA 4KIBA 3DEWA 2VKHA 3DEEA 3N4MA 3KP2A 3FKSA 1X1DA 1M1EB 2HQ5A 2ZKZA 2KVOA 4DQ2A 1G8XA 1DDIA 1OLTA 2F5EA 3SYTA 2PG4A 3MKYB 3HOYJ 3EUAA 2Z99A 4ZTJA 1O3SA 4UB8C 1WZ2A 5DS0A 3S32A 4IRIA 3WTWC 4I98B 3WTYC 2DQRA 1XB4A 2M45A 1YYVA 3EQLF 3G1LA 1OFEA 1QNTA 2HQRA 1IN6A 2BYVE 1S72I 2XKOA 3W2HA 2M5SA 1ETOA 4MTEA 4YG2F 4A12A 2VBSA 1UJ8A 4E7HA 4YFNF 2DI3A 4FWTA 1EE6A 3PFYA 2A6TA 1M90D 2GWRA 2CH0A 1Z6RA 3KZYA 3OYGA 1K78A 3ES9A 1FZPB 1CF7B 2JJ1A 3WBJA 2G7HA 4M71A 1WJAA 2CW8A 1Z0XA 1MMAA 3BCAA 3FXMA 3QYFA 1H8EA 4FT8A 1XGNA 4OOVA 1OFLA 4KIGA 5D6FA 2VT3A 2L7KA 4BY7J 2KP6A 5ICCA 2VBUA 2C4UA 2F1LA 4A2UA 2FE3A 3REOA 3CDLA 3K10A 3ASNH 4URRA 5F4OA 5J40A 5KVRA 3TDUC 2DY1A 2OCEA 4MYTA 4RB1A 2BXYA 2OC6A 5CVJA 4P3IA 5LHIA 1ZQ3P 4UB6C 3IWFA 3OKXA 3WNDA 1P4AA 3BR1A 2IQ7A 5LGUA 4A6EA 2EILH 4F93B 2Z16A 4BHCA 3BH6B 4U0VA 2QM3A 4KMFA 4B3GA 2OV7A 2RC6A 3JR9A 2V7XA 2QVOA 4LLGF 5HXBA 4ON0A 4YIIA 3BG9A 1X2NA 4AVZA 3Q5FA 3B78A 1BW6A 3U1KA 4IW3B 5HDNA 1WFXA 3PENA 1LE8A 5DCMB 4HLXA 1F9NA 3AFHA 1QFJA 2NVTJ 4M9XA 4GYGA 2O8KA 4E7KA 1YITI 2BGCA 2QX3A 1H89C 4FETA 3NAUA 2CGPA 2BM4A 2XTXA 2GBYA 3V8KA 4XQFA 2WB1N 3DPLC 1YRNB 1ETVA 3AG1H 3GXOA 2XGXA 1MNMC 5IYWA 1FNNA 2CV1A 2FNPA 4OOIA 3FPKA 4C0SA 4P25A 1RU4A 4BJTA 1OGMX 4KA4A 2VJJA 2V4JC 5HOOA 1N08A 1FIAA 1O8LA 3H94A 2X1CA 2EIJH 3SJZA 2GIZA 1ETQA 1IJEA 3BCBA 3IP4B 3U2RA 3BZCA 2VPRA 5KSWB 3L2VA 1T6ZA 1WJEA 3KX2A 4AIDA 4X06A 2MLKA 2G7UA 5B1BH 4BU2A 4BQAA 2B63J 3ASTA 5J3OA 1VQ4I 2VFQA 1ULYA 2WJYA 1NHCA 1EA0A 1ETWA 3K2AA 1HBXG 4XRMA 2R7UA 3HDDA 3SFZA 3HSRA 4ZV4A 1QVUA 1R58A 3HB9A 2PQ8A 3OSGA 1YW8A 1IAWA 3KEOA 4OINF 1TQPA 4YFXF 2VFNA 5LLQA 4ZTFA 3VYUB 2EWNA 4X1EA 2HGCA 4RLZA 1K4SA 5FO1A 2XOKA 4ZYHA 1HKSA 1MKMA 5HDKA 2E1CA 4WXHA 4E7LA 4XM3A 5D4SA 2IVMA 3PNVA 2VFOA 3SKBA 1QBJA 4LIUA 1Y0NA 3WBKA 3ONQA 3HRUA 1SD4A 5ILUA 1IDJA 1SAUA 3H9JA 2X1EA 1QH0A 3S3OA 1UAAA 1E2XA 1Y1VJ 1W9XA 2CS3A 5K5OA 1D1BA 2GXGA 4D5CA 1B2RA 4ZCMA 1QVFB 3QRFF 2W85A 4DW6A 4QV2A 2MA3A 3K1NA 3PNYA 4OWRB 4NUBA 1IZ1A 2R7RA 1Z67A 2XT4A 4YRVA 3G1OA 2DJNA 4PJ0C 3BH4A 1NTCA 1H9TA 3ZCOA 4GDFA 4NC7A 2DXIA 4XKBA 4BQOA 4NHJA 4IXAA 3OYFA 3OYIA 3SZEA 1G6NA 4LLNA 2QEXB 3BZKA 2WTEA 3GFLA 1AMOA 4PMHA 1Q1HA 3IAM2 2HXOA 3CESA 3HEFA 3P9KA 4LG0B 1UD8A 2KJBA 3HYIA 1T39A 3F22A 2HDNB 1IDKA 2PJPA 3OYBA 5IYPA 2CFOA 1KYWA 1CNFA 1RQPA 1EFTA 1NK3P 2OTJI 2Z8GA 5F0HA 5ILVA 5HNHA 3FIWA 3Q6RA 3Q0UA 4JOMA 1H9GA 3HRMA 1XSXA 1H0MA 4TT3A 5IYRA 1O8GA 1OYIA 3TP3A 3GTMJ 4Z4VA 1PUFA 2EFGA 2QA4I 1KA8A 1TWHJ 5JVTA 4YAOA 4BS9A 2E1NA 2JRMA 3VMVA 2PE3A 2Q2EB 2LFBA 1BX1A 1MABA 4MXNA 4OJPA 1FP1D 1VHEA 1D8JA 3ZXSA 2JK3A 4F52A 4C2TA 3ELKA 1IUFA 3G1MA 3LWFA 2JJ7A 4XICA 1S7AA 2L9VA 1E63A 1W34A 1WMRA 4BHPA 1ZUNB 2F4IA 3J81k 3GQAA 2OK7A 2BX6A 4RGXA 2P3MA 2E1RA 1FEXA 3J7ZI 1L3LA 1P2FA 1XGOA 1Z91A 2ZJRF 5M3FJ 5E3MA 4MEXF 1A31A 4N3GA 4RD6A 5BOXA 2NSPA 2HKOA 1YW7A 2CWEA 5JR3A 1S72B 2TRTA 2HZDA 2OZ6A 2XUBA 3TW6A 5GV7A 3A8JA 4WWVA 1N77A 3W6VA 3PJRA 3GQBA 2PMZN 2VL8A 2K9MA 3QFTA 1JRGA 2YWGA 4AWXB 1H8AC 4P22A 2CRVA 4FE4A 4M0LA 2XKPA 1W7PA 1IC8A 4BDZA 1W4MA
chains in the Genus database with same CATH topology
1E0EA 2ZTGA 2JVGA 1X4OA 3CF2A 1YE9A 3SDBA 5CQGA 2Q1ZB 2ZZGA 2D3LA 2GOXB 4B48A 3K4CA 2VBKA 4U4BA 4JMQA 1O8FA 3SZGA 2Z1DA 3L2RA 5AMVA 3IAS2 2WZPP 1TZLA 2MABA 3W2AA 2O5RA 5CPRB 1PXZA 2HLDA 3C2GA 4G6IA 2KRCA 2HDWA 1BLIA 3S3MA 2I8DA 3U21A 2GJPA 4OAZA 4CH7A 4ZDOA 2M0MA 3H5AA 1X1AA 3T53B 3PUBA 2IS1A 4F3QA 1I18A 4W8TA 1QHGA 4DGWB 4HIZA 4E7SA 1T0FC 1VJSA 3E0JB 2GK6A 2X53S 2O0VA 2X1DA 2HU9A 5FRNA 3BC9A 2BVLA 1H80A 3RCOA 1O8HA 4W8QA 4KKUA 4XD7A 2R9VA 3W2VA 3OS0A 5KHDA 2XZPA 3ZPPA 2DJIA 4KKSA 4U49A 3K70C 4XOPA 2D3NA 4H4KC 2V31A 2JDIA 2XZLA 1KMHA 2RNGA 3A4CA 1O8JA 3OWTA 3OMYA 1OOCA 1QU3A 3TBIA 1RMGA 2IGOA 2INVA 3CJQB 4C2UA 2VQGA 1O8DA 3FHNA 3QYEA 1KTWA 3VSKA 1Y56A 2XDVA 3LNNA 2L9SA 3B8YA 1K6YA 2LYCA 1QCXA 4RLFA 4HRIA 2ZZEA 1W36C 4MLOA 3E1SA 3RQ4A 4UZUA 1DBGA 1V5GA 2DT7B 4B44A 1V5EA 2R4GA 3K4LA 4E6KG 4E0FA 4BUPA 3HPHA 4XLHA 4CA0A 2LZJA 3CZ6A 3HOTA 3GQ8A 4OJOA 1MNDA 4LITA 2QXZA 4BEHA 2IS6A 1UD5A 4J01A 3JU4A 2LBFA 2LRDA 4NC8A 3EPZA 2NT9A 2ODLA 4CCJA 2GK7A 2WPDA 2BOLA 2Z2SB 2KDOA 2VPLA 1YX3A 4QPQA 1D0XA 4EATA 2M7AA 4KISA 4Z03A 3LMMA 2CW7A 2F6CA 2LY1A 3I3LA 4G7WA 2WY7Q 1XG2A 2CUZA 3OYJA 3K6GA 4DNRB 4XN3A 2DCEA 2LREA 2X6YA 4Y33A 3VYSB 3OEEA 3GBGA 3DU6A 4G6TB 4HG2A 3HL2A 3N05A 1T5EA 3KEWA 3DWLE 1MW7A 4TSFA 3OYKA 4E7ZA 3OYLA 3FBNB 4Z1MA 2MD0A 2O1DA 5LD2C 2Z6BD 4C9YA 4MR0A 4HEA2 2JVHA 1VF7A 1LFPA 5FRMA 4XLEA 2GJRA 4KKTA 2M7BA 4B43A 4CCOA 3ZQQA 2PMZA 4HNTA 2MYSA 2VQHA 3CJRB 1DP3A 2UUZA 4XNFA 2WADA 2FUG2 3A2KA 4C2LA 2WY8Q 2CMPA 2V7FA 2E1MC 4XORA 3RPUD 2WAEA 3OL3A 3HUGB 2IS4A 3B90A 2ZZFA 3VYRB 2ZSIB 3W2WA 3OE7A 2W82A 4EW9A 5FROA 3LSKA 1WJCA 1W0KA 1OB0A 5HKKA 2OUMA 3HC7A 2IGKA 1BR1A 1D1CA 1ERDA 1AA7A 2JJ2A 3WQZA 1OGOX 3PL8A 4C30A 3BLYA 1Z3XA 4FXUA 1E43A 1UD2A 1LVKA 1WP6A 1N78A 1O8KA 2XF7A 3MD2A 2VJ5A 3DLAA 1FMWA 2W6JA 4XOTA 3AL0C 3J7AY 1D0ZA 3S8PA 1O8MA 2E5NA 2X8KA 3RTRA 3K4MA 1EFRA 1BR2A 2BW3B 2KRHA 2CK3A 1D1AA 3DU5A 4CZCA 4PFOA 3BCFA 5TGTA 1IRXA 3NE5B 4D9JA 2VLAA 3UR3C 3UW0A 3FY3A 4YZ0A 1NBMA 2ZSHB 3M8JA 4DK1A 2IXSA 1BMFA 4XLAA 2W7NA 4NK6A 4ZDPA 1RWRA 3HKZA 3OL4A 2L2OA 4XR6A 2HPMA 1PJRA 3GVLA 3UNGC 4BE0A 1QJVA 4Y4RA 4RMNA 4P1WA 2V26A 2W1OA 1QHHD 1FX0A 5FL7A 4D1QA 4N4OB 4W8RA 1BR4A 4PJJA 2A5WA 1WJBA 4NK8A 3LSGA 1UELB 2R7WA 5C1CA 4NNJA 1WJ5A 2BVMA 3M1CA 4CCLA 2WSSA 1TT0A 4BJ6C 3G05A 1X19A 4YZAA 2K5CA 4OJ5A 2KQRA 4IZZA 2R7SA 4L8JA 3GRHA 3PNTA 4CCNA 4B3FX 2V7QA 3NWTA 1K28D 1DBOA 3BC8A 1R6RA 4IQ4A 4KJZA 2JSPA 3D5LA 4GQNA 2VB6A 2WJVA 2VBMA 2VBEA 2Y0SA 2KHMA 4BJ5C 4ITVA 3CP8A 2W4SA 5LFAA 3OW7A 1KCCA 2K9LA 1COWA 2E1MB 4PK4A 3I9V2 1T95A 3DPTA 3T9GA 1E1RA 3VSLA 3FKJA 3KYLA 3OR2C 1E3XA 2W6IA 1HG8A 2VJ4A 3EUKL 1WJFA 3OPOA 3H35A 3DKYA 3K4KA 4GRIA 1BN8A 4Z06A 2E5ZA 2DIEA 4DBRA 1OHHA 4BE2A 5CDFA 3A35A 4HSTA 2E1BA 4KITB 4BACA 2O04A 4YXWA 3K4BA 4R79A 2KMUA 4DK0A 4Z05A 4X0GA 3DTIA 3S3NA 4BL0B 3GVKA 5HNFA 4RLQA 5C1EA 2VIXA 2VXDA 1SKYB 4JQFA 2DT6A 1WTHD 2M4KA 2F1MA 2VKDA 4OAYA 1CZFA 1UG0A 4F91B 4NQWB 4HNUA 2XNDA 2F5VA 3DDYA 4HPQA 4BXFA 4BGDA 1X1BA 1DGRM 1EA3A 2ZXIA 2HVQA 3CMMA 3QOEA 1HA8A 3B4NA 2XAUA 2KL4A 3FPPA 2VKHA 3DEEA 2NTQA 5DN6A 3L2UA 3FKSA 4PSWA 1X1DA 1MNEA 2NTBA 2KVOA 2LY2A 4LIVA 1G8XA 3CP2A 3SUCA 3C2HA 2HVSA 4DJAA 4DOZA 4E4HA 1OLTA 4LG3A 3SYTA 3ZIAA 3MKYB 1SFKA 2RQQA 3OYCA 3EUAA 4CCKA 3H9GA 4CUGA 4ZTJA 2X51A 1HVXA 3S32A 4B47A 1VBLA 1V0FA 3FBIB 1WPCA 2VXZA 3BCDA 4BQQA 3VSVA 2R7XA 2KZVA 2PJRA 2M5SA 3K70D 2LOOA 2PECA 3ZRGA 4E7HA 1GQ8A 4II3A 1EE6A 1MMNA 4BEHB 4DIQA 3A1YA 2A6TA 3MMYB 3PFYA 2CH0A 1BHEA 3WWGA 3OYMA 4U7BA 1LDKB 3OYGA 2JJ1A 3BG6A 2LBFB 1H8EA 1WJAA 2CW8A 3BCAA 1MMAA 2P0WA 3QYFA 4J00A 3NWSA 4G7XA 3GQ7A 2M4GA 4XKVA 1OFLA 2VASA 4YEJA 2L7KA 4PJNA 4BE1A 2R7TA 4DNTB 2KP6A 4YZXA 2WAFA 2VQLA 4PJMA 3HPGA 3K10A 4II2A 1YX5A 2X3HA 1W36D 4URRA 2X6XA 2AQFA 4PFPA 1PLUA 2IGNA 2OC6A 4RM3A 1J09A 3PSIA 4XONA 1X4PA 2JIZA 4QPOA 3GVJA 3ZPNA 4OZYA 2IQ7A 2NZMA 4F93B 2Z16A 5CQEA 3DQVC 1E3ZA 3OEHA 4B3GA 2OV7A 3OS1A 2NOJB 3DKXA 3TL4X 5JHFA 2XF6A 4AVZA 1WFXA 1S9HA 4B3XA 2XF5A 3OS2A 1O8EA 3ZSCA 3BG7A 1V0EA 3AFHA 3IUOA 1I8DA 4E7KA 3TMOA 3AKZA 3HAGA 5HVQC 3OOCA 4KT6A 2QX3A 2PJRB 4FETA 1KZLA 1MMGA 1K5CA 4XQFA 2CV0A 3DPLC 2W00A 2CV2A 2L9NA 1O88A 3JURA 3OYDA 4HSRA 2CV1A 2V6EA 1H8HA 1PE9A 2QY1A 3LMWA 1RU4A 1N75A 1VZ0A 4BJTA 1OGMX 2VJJA 2V4JC 2KLOA 3FDYA 5HOOA 3OYHA 3H5NA 3L2QA 1O8LA 3VSUA 3LSIA 3H94A 2X1CA 4ZDLA 4F92B 1DQUA 3KRGA 2NTPA 3BCBA 3IP4B 3L2VA 1X0CA 1WJEA 3KX2A 2HNHA 3OYEA 2R7OA 2ZXHA 4BU2A 4I84A 1NHCA 3VYTB 4W8SA 2WJYA 1AIRA 3SEQA 2UVEA 2R7UA 4CCMA 3H0DA 1UD6A 4ZYAA 4IQJA 2XSJC 3T51B 4OZZA 3HXLA 4OJLA 2KPMA 1PYVA 3OOUA 3T56B 3F9KA 3EUHC 2X85A 4RM2A 1PKVA 4N4NB 4F55A 4CSWA 2VQCA 3LSHA 3EQNA 4ZTFA 3VYUB 4XKWA 3VMWA 2ZTNA 2XOKA 2E60A 4E7IA 2QE7A 1P9QC 2O17A 4E7LA 2IGMA 2INUA 4XM3A 4BDYA 3A3BA 5KNLA 2WAQA 1E1QA 1OR7C 3PNVA 2R7VA 1KCDA 4LIUA 4YELA 3H9QA 2LH9A 3ONQA 2ZFUA 3A3GA 2GOMA 2F43A 1IDJA 4HWVA 1BPLA 1SAUA 2CUJA 2JUGA 2MC4A 3H9JA 3SEZA 1IB4A 2X1EA 3S3OA 1UAAA 1W9XA 1BOBA 4PUSA 2CS3A 1D1BA 3G2BA 1D0YA 1W0JA 4BQNA 1NRKA 3LL7A 3LSMA 4U87A 2AQEA 3PNYA 4OWRB 4PSXA 3AL0B 3RSNA 1FMVA 4NUBA 4ASUA 2R7RA 2ZZQA 4XL9A 4YRVA 1UD4A 1UD3A 3VR6A 3BH4A 3MKWB 3PSFA 1Z21A 2BSPA 3LFUA 3ZCOA 4NC7A 2DXIA 1KONA 1DGWY 4XKBA 2QKLB 4XKCA 4BQOA 4XN0A 2UWMA 3OYFA 3OYIA 3OFNA 2WA0A 3ZR8X 3EQOA 3HOSA 3OIQA 3L2WA 1LKXA 2MFZA 3VWBA 3OY9A 4PMHA 3VDXA 2XGJA 3IAM2 3CESA 3OIPA 1UD8A 4Y3OA 2M3AA 3OYNA 2PYHA 1IA5A 1HZEA 3VSTA 1IDKA 3HG9A 4AU7A 4ZC3A 3DTEA 2XC7A 3OYBA 3K4JA 2IS2A 2CFOA 4PJLA 5CKTA 1VLYA 5IK2A 4DBQA 3W3CA 1OFMA 5KCMA 1X1CA 2Z8GA 1NG7A 4IKFA 5HNHA 2VJIA 1WJDA 1ZELA 1E79A 4JOMA 2HPIA 1O8GA 2O0WA 4TT3A 2V1NA 4E7JA 2V4DA 3DPUA 1Y6IA 1V5FA 3D5SC 1O8IA 4OJ6A 2HVRA 2JA2A 2LC2A 5HLTA 4BS9A 2L5QA 2QKMB 2PYGA 2RREA 3VMVA 2HQAA 3H5RA 4XMYA 2XZOA 2Q2EB 3K4NA 3MKZA 1MABA 4MXNA 4OJPA 2NSTA 2BW3A 1Z7LA 3ZXSA 2DOAA 1MMDA 2ELJA 4F52A 2V9KA 4C2TA 1JI8A 3OAAA 2EWEA 1WMRA 1NG6A 3ZGKA 3GQAA 2F4IA 3V42A 4FASD 1JTAA 2UVFA 3DTKA 2R7QA 3KEYA 3QYBA 3D5RC 2NSPA 1Z3YA 2LG4A 1GLNA 2WB1A 2UV1A 1G59A 4XLFA 2HZDA 2GJKA 2NT6A 4P5OA 4TKOB 4XLCA 3S93A 1N77A 3OYAA 3GQ9A 3PJRA 3OR1C 3QODA 2X6WA 3GQBA 2VL8A 2K9MA 4ZJZA 1JRGA 4IX7A 4YZQA 4P22A 4AYBA 2WBMA 2K3PA 4BDZA 1U0JA 4ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  1NHC A;  4W8S A;  1AIR A;  2UVE A;  4OJL A;  4XNF A;  4OZZ A;  4Z05 A;  5C1E A;  2X85 A;  2VBK A;  4U4B A;  1O8F A;  3EQN A;  4C2L A;  1CZF A;  4XKW A;  3VMW A;  5AMV A;  4XOR A;  3B90 A;  2O17 A;  1PXZ A;  2INU A;  4XM3 A;  3B4N A;  2NTQ A;  1KCD A;  4YEL A;  4EW9 A;  2NTB A;  3SUC A;  1IDJ A;  4HWV A;  1IB4 A;  4W8T A;  1OGO X;  1VBL A;  1O8K A;  2O0V A;  3VSV A;  1H80 A;  4XOT A;  4XL9 A;  1O8H A;  2PEC A;  4W8Q A;  2BSP A;  1GQ8 A;  1O8M A;  1EE6 A;  3ZPP A;  1BHE A;  4U49 A;  3WWG A;  4XN0 A;  4XOP A;  3EQO A;  1O8J A;  4PMH A;  3GQ7 A;  3UW0 A;  4XKV A;  1OFL A;  1OOC A;  4YEJ A;  2INV A;  1RMG A;  3FY3 A;  4YZ0 A;  2PYH A;  1IA5 A;  4YZX A;  4XLA A;  3VST A;  1IDK A;  4NK6 A;  1O8D A;  1KTW A;  1RWR A;  4XR6 A;  2X3H A;  4URR A;  1QJV A;  2X6X A;  1OFM A;  3B8Y A;  1PLU A;  1QCX A;  2Z8G A;  4W8R A;  4XON A;  2VJI A;  4OZY A;  2O0W A;  2IQ7 A;  1O8G A;  4NK8 A;  2NZM A;  1DBG A;  5C1C A;  4XLH A;  1O8I A;  4AVZ A;  4OJ6 A;  4OJO A;  3GQ8 A;  4YZA A;  2QXZ A;  4OJ5 A;  3GRH A;  2PYG A;  3VMV A;  1O8E A;  4XMY A;  3ZSC A;  4MXN A;  4OJP A;  2NST A;  1DBO A;  2NT9 A;  2ODL A;  2QX3 A;  2EWE A;  1WMR A;  2VBM A;  2VBE A;  3GQA A;  1K5C A;  4XQF A;  4Z03 A;  1JTA A;  2UVF A;  1KCC A;  1O88 A;  3JUR A;  1PE9 A;  2QY1 A;  3LMW A;  1XG2 A;  2NSP A;  1RU4 A;  3T9G A;  4XN3 A;  2X6Y A;  1OGM X;  2VJJ A;  3VSU A;  4XLF A;  1O8L A;  1HG8 A;  2NT6 A;  4XLC A;  3KRG A;  2NTP A;  3GQ9 A;  1BN8 A;  2X6W A;  4Z06 A;  1JRG A;  2O1D A;  4YZQ A;  4MR0 A;  1X0C A;  4XLE A;  4I84 A; 
#chains in the Genus database with same CATH topology
 1VQO I;  2QTL A;  2ZTG A;  2JVG A;  1EP1 B;  1UMQ A;  4A3M J;  3NQO A;  2H6C A;  2Q0O A;  1YE9 A;  2IBD A;  5IT3 A;  3ZMT A;  1J75 A;  1R5I D;  2VBK A;  4U4B A;  1ZG1 A;  1P92 A;  1QFZ A;  1WVR A;  3SZG A;  1O8F A;  4MFE A;  4G9Y A;  3TOA A;  3GFJ A;  1U3E M;  3P26 A;  4JP0 A;  4A3K J;  3WTX C;  1BLI A;  2GXA A;  1QG0 A;  2GQF A;  2I8D A;  2OD5 A;  4I0A A;  4CDG A;  2NS8 A;  5JFR A;  3DFG A;  1XDU A;  3QPL A;  2M0M A;  1X1A A;  3H5A A;  2C2W A;  2IS1 A;  4V02 C;  4GCV A;  4XRS A;  3VOE A;  2K85 A;  5BPI A;  3VMF A;  1F36 A;  4E7S A;  1XSD A;  5GTH C;  3T5X A;  5BQT A;  3JRA A;  2GK6 A;  4QWQ A;  2NNY A;  3TH0 A;  2OQG A;  5FRN A;  2BVL A;  1H80 A;  3QAH A;  3SFI A;  2XNC A;  1VQ6 I;  4JBA A;  4LBW A;  3AVV A;  3A03 A;  2XZP A;  4DQK A;  2CU7 A;  3LYC A;  1SAN A;  2DJI A;  3K2Z A;  4U49 A;  4Z6Y A;  3K70 C;  1T8I A;  4H4K C;  3CCU I;  1Y0Y A;  3I0T A;  3R60 A;  3HM5 A;  3JRI A;  3S1R J;  2OBT A;  5D5V B;  2K86 A;  1AKH A;  3CW2 A;  4I84 A;  1RMG A;  3CCJ B;  2HEO A;  3G71 B;  1K4Z A;  3RY8 A;  1HF2 A;  2XPW A;  1O8D A;  2F5D A;  3FHN A;  1STZ A;  1IGN A;  1TLL A;  2PMU A;  5AIP A;  4HDV A;  4JYK A;  3B8Y A;  5LGN A;  2LYC A;  1RC9 A;  2DFE A;  4HV6 A;  4UV8 A;  1W36 C;  4MLO A;  2EK5 A;  4Q5S F;  4NBQ A;  3U1D A;  2OBR A;  4UZU A;  3HIF A;  1SFE A;  2FU4 A;  2RC4 A;  4D5F A;  1H85 A;  1RQR A;  1DBG A;  1RRJ A;  2KFD A;  2JA5 J;  2X9D A;  1T08 B;  5GAE J;  3LSJ A;  2R4G A;  1EH8 A;  2BM1 A;  1ORK A;  3QWL A;  4CA0 A;  2LZJ A;  3HOT A;  5J6X A;  1Q9S A;  3GQ8 A;  3MHP A;  4BEH A;  5H5J A;  2LF7 A;  2Z5U A;  4E70 A;  1UD5 A;  2HI3 A;  3CPX A;  5D6E A;  4Z2Y A;  2LBF A;  3WGG A;  2LRD A;  5FFZ A;  5GPA A;  3CCL B;  4NC8 A;  3JRG A;  2Z33 A;  1XCV A;  2NT9 A;  2ODL A;  2WPD A;  2IA1 A;  2Z2S B;  4RGU A;  1E17 A;  2CFX A;  2VPL A;  3FXJ A;  1HC8 A;  1D0X A;  2R7F A;  4KIS A;  1YW9 A;  4P9S A;  4IPA A;  4ZGQ B;  3PSS A;  3I55 B;  4G6Q A;  2DA3 A;  4FE7 A;  1JKO C;  1KQ5 A;  1ON2 A;  3CCY A;  3JTG A;  3GTK J;  4MTD A;  4WZT A;  5TR9 A;  1AKH B;  3CO6 C;  5EGO A;  3GBG A;  3DU6 A;  4HG2 A;  4D7N A;  3HL2 A;  1MW7 A;  4YAF A;  3T1B A;  2OCC H;  5J4V A;  3RIQ A;  3KP3 A;  3CC7 I;  2ICW G;  2XV4 S;  2RNJ A;  4Z1M A;  4I01 A;  1LDD A;  1P7J A;  5LD2 C;  1DAR A;  2C78 A;  4A3F J;  4NBS A;  1IXS B;  2FRH A;  1U2R A;  2GJR A;  2M7B A;  2KIS A;  2F5F A;  4A0Y A;  4ZZD A;  4HNT A;  1ZGJ A;  1VQ7 B;  1J9I A;  3OV8 A;  2VQH A;  3KIO A;  2XAJ A;  1QA1 A;  2FNA A;  5BPD A;  4MGR A;  1HW1 A;  4QVJ A;  3FKI J;  1VQ6 B;  2R7Z J;  2BY1 A;  5CVI A;  1D2E A;  4UAJ A;  1R49 A;  3BR3 A;  4C2M J;  2WY8 Q;  3KZI C;  5GAH J;  2EPF A;  5HOD A;  4A3J J;  1ZRD A;  3GCM A;  2CW5 A;  1MRZ A;  3C2B A;  2YR2 A;  3B90 A;  4Q4Z F;  1GXP A;  2XAQ A;  3QOP A;  3RKX A;  2V1U A;  2ZSI B;  5GAD J;  3W2W A;  1OCZ H;  1OB5 A;  3WYA A;  3PIP F;  2J8I A;  4EW9 A;  2VBV A;  1WJC A;  3SLD A;  3W2E A;  5HKK A;  2OUM A;  1Z1D A;  2C6Y A;  1OQY A;  1SD7 A;  2IGK A;  5L3F A;  3R6K A;  3IRR A;  1OGO X;  1J2X A;  4C30 A;  3BLY A;  3MCZ A;  4CZZ A;  2LK2 A;  3WOD F;  3FZV A;  5E1W A;  3JX8 A;  3OJX A;  5EG0 B;  1FND A;  1LVK A;  5HS7 A;  1N78 A;  1VND A;  1P4M A;  1XGS A;  1UD2 A;  3ZQL A;  4RAY A;  2VJ5 A;  3WU1 B;  3OSF A;  1LB2 A;  1W5T A;  2HZT A;  3CCQ I;  3J7A Y;  4U0W A;  3WTV C;  2J8K A;  1O8M A;  2QUF A;  4GGG A;  1TWA J;  1CQX A;  2E5N A;  2HOE A;  1CLW A;  2GLO A;  1G7R A;  3RTR A;  5F0F A;  2EIM H;  1NB9 A;  2BW3 B;  1D1A A;  2PMH A;  4CZC A;  1HCR A;  3CCV B;  3UW0 A;  5TGT A;  3ABM H;  2JUC A;  2R5Z A;  3E20 A;  4Y13 A;  1NBM A;  2IXS A;  4X7C A;  5A2Q K;  4IL6 C;  1O3R A;  1WOO A;  4Z4S A;  2HDD A;  1QUE A;  3D1N I;  3VOD A;  4A3L J;  1ODD A;  1EWY A;  4RMN A;  1SMT A;  5D5U B;  2EFO A;  1FX0 A;  4A3B J;  4Y7N J;  1QX4 A;  4HX8 A;  3V7C A;  4MQ9 F;  4TMW A;  3H3U A;  1SFU A;  3I56 B;  1IDZ A;  4AYB N;  2E2J J;  4X0C A;  1R1U A;  2WSS A;  5KK1 A;  2XPV A;  2K5C A;  3ECH A;  3KYC B;  1MD0 A;  1YLO A;  3GTL J;  3NEU A;  3GRH A;  3PNT A;  4OIP F;  1LPQ A;  2JA8 J;  2Q6L A;  2OF7 A;  2ETH A;  1R6R A;  4XID A;  4IQ4 A;  1ZLJ A;  1OGI A;  3FK7 A;  5IT9 Z;  3CMA I;  4BJ5 C;  1LJ9 A;  3JRH A;  2W4S A;  3E5X A;  5LFA A;  2DA5 A;  2K9L A;  3LAP A;  2XC1 A;  4RA2 A;  3WGH A;  1T95 A;  1W0U A;  3T9G A;  3CCR B;  1TL8 A;  2B7C A;  4RCZ A;  2PLF A;  3OR2 C;  2V79 A;  3M8E A;  3QFC A;  2KIM A;  3PQJ A;  3V7A A;  3BR0 A;  1XMA A;  2XB5 A;  3K4K A;  3JSO A;  1OB2 A;  1N8R D;  1QZE A;  4G7H F;  4BE2 A;  5CDF A;  2AHO A;  2ZB9 A;  4JX5 A;  4KIT B;  4MIM A;  5LRR A;  4ZYG A;  3IH2 A;  4HV5 A;  4U7D A;  4N9H A;  2H8R A;  3TDZ C;  5DNS A;  3LST A;  1A35 A;  3MWM A;  1EH6 A;  4NQW B;  4O6J A;  3HOU J;  4HPQ A;  3GZ6 A;  1VHO A;  2ZXI A;  2JA7 J;  2ZXW H;  4B4C A;  1HLV A;  3DP7 A;  1HA8 A;  1UMK A;  3F8C A;  1VQL B;  3I54 A;  2DOE A;  4PC3 A;  5AIQ A;  3WY9 A;  2NTQ A;  1DU6 A;  2OU2 A;  1BW5 A;  5DN6 A;  2DET A;  1MNE A;  2L7F P;  2CND A;  4AIH A;  1D3Y A;  2LY2 A;  4JX6 A;  4LIV A;  1L0O C;  3KLN A;  3ZIA A;  2MBF A;  1SFK A;  1HKT A;  2XTY A;  3ZQC A;  2BBY A;  2X51 A;  1HVX A;  1N06 A;  1JTY A;  2VXZ A;  2R7X A;  1U78 A;  5F64 A;  3NAW A;  2ZME B;  3K1M A;  1XB2 A;  2K9Q A;  4I6Z A;  3ZMV A;  4AUX A;  3DKW A;  3ZRG A;  3ZC3 A;  1EXM A;  1FOX A;  5FKL A;  4LGW A;  1WGX A;  2RV8 A;  4HZF A;  4P12 A;  4U7B A;  1LDK B;  1MIJ A;  3H92 A;  3OZV A;  2JTV A;  2DPU A;  2P0W A;  2IA2 A;  3I71 A;  2LR8 A;  3NWS A;  2E2I J;  2M4G A;  2VAS A;  4YEJ A;  2F4M B;  3LA2 A;  4DNT B;  4EM2 A;  4YZX A;  2WAF A;  1QPM A;  2VQL A;  3KZZ A;  3ASO H;  5EZH A;  3HPG A;  2CW0 F;  1TBX A;  1GV2 A;  3DCF A;  1C0W A;  2X3H A;  3J81 K;  3KEQ A;  2AQF A;  3NAR A;  1R23 A;  1MBE A;  2UZK A;  2GRE A;  4RM3 A;  1J09 A;  1X4P A;  4I99 C;  4BKX A;  4IOA F;  1A8P A;  1S4M A;  1IRG A;  2JIZ A;  1ITY A;  2K02 A;  3KL9 A;  2WYR A;  5CQE A;  3DQV C;  4OIR F;  2HFH A;  5F27 A;  5ED4 A;  1E3Z A;  5IYN A;  3DKX A;  5JHF A;  2ZJP F;  1JJ2 B;  1RKT A;  1R1T A;  5EMN A;  2RQP A;  1TWF J;  2LP0 A;  2XF5 A;  1O8E A;  3ZSC A;  1ZGW A;  3IUO A;  1J0R A;  2DMQ A;  3TMO A;  2PI0 A;  3FMS A;  2ZBK A;  4K2E A;  3A8K A;  3HAG A;  3OOC A;  1DPR A;  4YIF A;  1B4A A;  1YIJ I;  4P1V A;  3QE2 A;  1MMG A;  2H1L A;  2QCO A;  1NDH A;  3GEZ A;  2W00 A;  1ZAR A;  1O88 A;  3JUR A;  3WTU C;  4HSR A;  3MZH A;  4IHX A;  1MMS A;  2V7W A;  5A89 A;  3HZJ A;  4BBR J;  3VO2 A;  2IP2 A;  3S2W A;  5IYQ A;  4A3C J;  3FXU A;  3L2Q A;  3OYH A;  5K7H A;  3R0J A;  3LSI A;  4ZDL A;  4OMY A;  2XAH A;  3KRG A;  1FYL A;  2NTP A;  3ZBU A;  3LA3 A;  1T56 A;  1KQ9 A;  2P4W A;  3P9I A;  3FMQ A;  3OYE A;  1R5H A;  3BTL A;  3A01 A;  2YWE A;  3ZP5 A;  4B3A A;  3O8H A;  2MH2 A;  1AIR A;  3AGP A;  2UVE A;  2ELK A;  3GTP J;  2BY2 A;  5FKN A;  4EGY A;  2R93 J;  5D8K B;  3GF2 A;  5HLH A;  1UD6 A;  4OZZ A;  4WQM A;  3BPX A;  2KPM A;  3T56 B;  3S1M J;  2G9W A;  4FCY A;  1MH4 A;  3TKY A;  1I39 A;  3HTS B;  1QQI A;  2VQC A;  3BQY A;  3LSH A;  2DDA A;  4XKW A;  3BQZ A;  2EFP A;  3VMW A;  1JT0 A;  1Y39 A;  1P9Q C;  2O17 A;  2QEX I;  2INU A;  4BDY A;  3A3B A;  4UV9 A;  4TV7 A;  2AXT C;  2WAQ A;  5FA6 A;  2QQB A;  4LC0 A;  2LH9 A;  1XMK A;  1GDT A;  3QPH A;  2GOM A;  2F43 A;  4HWV A;  5TV2 A;  5J47 A;  2CUJ A;  2JUG A;  3LA7 A;  4FHT A;  4MFD A;  3SEZ A;  1IB4 A;  1BX0 A;  1SAX A;  1R71 A;  3V8L A;  5LRS A;  2W57 A;  3G2B A;  5FNZ A;  1QPI A;  4OPV A;  4BQN A;  1T0F A;  3TOB A;  3LL7 A;  1NRK A;  3LSM A;  1UZC A;  3AL0 B;  2VYQ A;  1FMV A;  5E17 F;  4ASU A;  2ZZQ A;  2NOG A;  4MO7 A;  4XL9 A;  4CHU A;  1YLF A;  4ESJ A;  1IN5 A;  2Q6I A;  2QBY A;  2KDZ A;  2QQ8 A;  4AM3 A;  2DTR A;  3PSF A;  5D8L B;  5ICE A;  1JGG A;  1UD3 A;  2QGG A;  4Q47 A;  1DGW Y;  2BPO A;  2QKL B;  4XN0 A;  3OFN A;  4M3D A;  3K0L A;  3EQO A;  1B6A A;  3ZR8 X;  3DLL F;  4Y15 A;  3S1N J;  2MFZ A;  3HUG A;  1ZK8 A;  3WHB A;  2F2E A;  1F1Z A;  3WG9 A;  5JHU A;  5FLM J;  2M3A A;  3OYN A;  4CYD A;  4Z4Y A;  1KK3 A;  2NV4 A;  3VST A;  4AU7 A;  3PM1 A;  1QO0 D;  5K7Z A;  2VNI A;  1U9O A;  3K4J A;  1OFM A;  4QHY A;  3I4M J;  1VLY A;  1QRB A;  3W3C A;  1SMY F;  1G7C A;  1NG7 A;  4IKF A;  4XBF A;  4UZE A;  4UUS A;  2EIN H;  5BMZ A;  2VJI A;  3RI4 A;  1BC8 C;  5LHG A;  3M4O J;  2V6C A;  1KQS B;  1TTT A;  2V1N A;  4MHG A;  4E7J A;  1I27 A;  3CLQ A;  3ZBT A;  4RCY A;  3DBR B;  5H59 A;  3D5S C;  3ZMS A;  2HWV A;  4OPO A;  1O8I A;  1SVM A;  1QRY A;  4L5E A;  5HLT A;  2L5Q A;  2PYG A;  2RRE A;  3AK5 A;  2VNJ A;  2XZO A;  1WRJ A;  3TGN A;  1T2K A;  2DA4 A;  1B9N A;  2X3U A;  1Z7L A;  2FBH A;  2DOA A;  1MMD A;  2ELJ A;  3MZY A;  2G0Y A;  2MH9 A;  1GT0 C;  2EWE A;  2ZFW A;  1HST A;  2MD5 A;  3ZGK A;  5IP9 J;  4RB2 C;  4A3E J;  4RD3 A;  1FY7 A;  3LSP A;  1YJ9 B;  4PZJ A;  2HTS A;  3RYP A;  1B72 A;  3KEY A;  3M07 A;  2MW8 A;  1WSV A;  3PA1 A;  1R9T J;  1EFC A;  1Z3Y A;  1GLN A;  2WB1 A;  5BNG A;  1G59 A;  2DFF A;  1FOW A;  1WWX A;  3ABK H;  3MN2 A;  4XLF A;  2GJK A;  4V2F A;  2L7M P;  4P5O A;  3S93 A;  3OR1 C;  1KU2 A;  4F7Z A;  2A6E F;  2LNB A;  1VQ8 B;  2QGU A;  2TCT A;  1U0J A;  1K9M D;  4EJO A;  1LNW A;  1QVT A;  1X4O A;  1TYX A;  2B5O A;  3M9A A;  3ULQ B;  2HYG D;  1S3J A;  1E3H A;  3H1C A;  5CQG A;  5E8G A;  1NH3 A;  2GOX B;  4B48 A;  1ZM4 A;  3SJP A;  1VQP B;  5E3O A;  3L2R A;  1RET A;  1K78 B;  2XB0 X;  1B8I A;  3I59 A;  5ERI A;  4LBV A;  3F6O A;  2WZP P;  1TZL A;  1PXZ A;  2KRC A;  3GX4 X;  3W6K B;  4V2G A;  3IRQ A;  3CCJ I;  4ZDO A;  3OOP A;  4AIK A;  4M9S A;  3MFK A;  3G71 I;  3T53 B;  1SD6 A;  3PUB A;  1OFC X;  2VOO A;  5KW9 A;  1P4X A;  1Z6T A;  4CYC A;  1J5Y A;  2BEO A;  1TLH B;  5EDN A;  1B72 B;  1BJK A;  1T0F C;  1DU0 A;  1VJS A;  5EJC A;  2E36 A;  2ZJ2 A;  5DDG A;  2BSA A;  2PIA A;  1UST A;  3ABU A;  2X53 S;  2X1D A;  4HLY A;  1YI2 B;  3BC9 A;  1YIJ B;  5EEG A;  2DW4 A;  3GLX A;  2O6W A;  2RAE A;  5FLV A;  4KIF A;  2IPQ X;  3OS0 A;  2NVX J;  4F7D A;  2LKP A;  2LD5 A;  4S0H B;  2D3N A;  1ETK A;  1LE8 B;  3GSI A;  3LOC A;  3COA C;  1WDT A;  3A4C A;  3E6D A;  4LBY A;  5E3L A;  1YS7 A;  1IJW C;  3OWT A;  1O8J A;  3F6V A;  1ZN2 A;  2EV6 A;  3OMY A;  3CCL I;  1OOC A;  3Q9V A;  3TBI A;  2INV A;  3BTJ A;  4ZH4 F;  4C2U A;  1T38 A;  1XTA A;  1SVL A;  2VQG A;  3QYE A;  1KTW A;  1I50 J;  1QZZ A;  1X3Z B;  3PO3 J;  1IV8 A;  2FOK A;  5CVU A;  3I55 I;  1XD7 A;  5F1R A;  4RLF A;  2E71 A;  4PC7 A;  3FXQ A;  2X48 A;  2Y9Z A;  3E1S A;  3ISX A;  3CC4 B;  1FLI A;  3HBL A;  1GAW A;  5TIS C;  2Q8K A;  4L5I A;  2XPU A;  1H42 A;  2WC2 A;  2C5B A;  3CZ6 A;  3PUM A;  1MND A;  3CD6 B;  2QSG X;  3GFI A;  3MZ8 A;  3KET A;  3HHG A;  1OGJ A;  2NS0 A;  2N8G A;  3CMY A;  4J01 A;  3JU4 A;  3AVX A;  2BHZ A;  4D7M A;  4KUM A;  1VQ7 I;  1Q81 D;  4CCJ A;  2GK7 A;  2BOL A;  1X1P A;  2K40 A;  2UXN A;  4QSH A;  2M2E A;  1YQA A;  4IHT A;  5F4M A;  3O6B B;  4KN4 X;  2M7A A;  4J19 A;  3LMM A;  2CW7 A;  4DYC A;  3G4S B;  1EF4 A;  1XG2 A;  2CUZ A;  3JSP A;  1QVG B;  2ZC2 A;  4G6T B;  1WXR A;  5E3N A;  3DWL E;  4LB5 A;  2V1X A;  4DZJ A;  2C5H A;  3C1D A;  2ZNY A;  2RKH A;  4P55 A;  2CO5 A;  2MD0 A;  2X4H A;  3NRV A;  2V7V A;  1KZH A;  3BDD A;  2BMW A;  3C18 A;  2Z6B D;  4MR0 A;  1ZYR F;  4HEA 2;  2JVH A;  3KFW X;  1FBU A;  1YJN B;  3RZD J;  2EQR A;  4G7O F;  4B43 A;  2PMZ A;  2MYS A;  1KQ0 A;  2UUZ A;  1E3O C;  1W35 A;  4ENM A;  2X0K A;  1W5C C;  1G3T A;  2OPT A;  4OP7 A;  1LLZ A;  3A2K A;  1ZKG A;  2ME0 A;  4C2L A;  2MLG A;  1AU7 A;  2VON A;  1R4M B;  2DT5 A;  2E1M C;  4ENK A;  4XOR A;  1SFO J;  3RPU D;  2WAE A;  3OL3 A;  4X6A J;  2LTP A;  1OKR A;  2DAO A;  3V7S A;  3J80 Z;  3CCV I;  4C3I J;  1XQB A;  2V7T A;  2BXZ A;  5FRO A;  4KH3 A;  3LSK A;  1W0K A;  2VBX A;  2CC2 A;  3P27 A;  1RR7 A;  1YIO A;  1ERD A;  2JJ2 A;  3PL8 A;  4BH9 A;  3RQI A;  4KFC A;  2W84 A;  4BPR A;  4WZK A;  4FXU A;  2QZ8 A;  2QQ9 A;  2AXL A;  3MD2 A;  2R7D A;  3C7J A;  3SXY A;  1PUF B;  3I56 I;  3WNB A;  3CPW B;  3BH7 B;  3EYI A;  2FSW A;  3E1Y E;  4EH1 A;  2K4J A;  2Q6O A;  4RJL A;  5FD6 A;  4N3N A;  2COB A;  3OZW A;  1G4D A;  1BR2 A;  2KRH A;  1TYU A;  4HYE A;  3R61 A;  1KK0 A;  1D8T A;  3FX3 A;  3CUQ C;  1QGP A;  2E35 A;  1HF0 A;  2EFW A;  4KNY A;  1X3U A;  4XLA A;  1I1G A;  2W7N A;  3HRS A;  4NK6 A;  3SLN A;  1RWR A;  2DK8 A;  3OL4 A;  5TRD A;  2HPM A;  3UNG C;  5IY5 H;  4A93 J;  3J80 K;  2EZI A;  2DMP A;  2V26 A;  5KAI C;  1WOP A;  4X7D A;  4D1Q A;  1W87 A;  4D0P A;  1RR8 C;  2V9P A;  3CCR I;  1R00 A;  2A5W A;  3JRF A;  1APL C;  3HGY A;  5LEK A;  3ERM A;  4EGZ A;  1T33 A;  1W7P D;  2BVM A;  3M1C A;  2YS9 A;  1TT0 A;  3ZOB A;  5FB2 A;  2HMA A;  4OPS A;  4QTR A;  1WH5 A;  3FHZ A;  1W7P B;  1FYK A;  4OJ5 A;  2KQR A;  4L8J A;  1VQN B;  2L3D A;  4M3E A;  4B3F X;  1I1S A;  1ZTR A;  2FVG A;  3BZ6 A;  3GYH X;  2NYX A;  2IW5 A;  2A3S A;  2WJV A;  2VBM A;  2ZNZ A;  4M4S A;  4PGO A;  1UG2 A;  4ZGN B;  1BJA A;  1JT6 A;  3HSF A;  2P5K A;  1COW A;  1KK2 A;  4PK4 A;  3DF8 A;  1MZB A;  3FK6 A;  2GM4 A;  1FBS A;  3GZN B;  3VSL A;  4YAU A;  3MKL A;  5L3D A;  1VQL I;  2VT2 A;  4HE5 A;  1LDJ A;  3BNW A;  5D5X B;  2ESN A;  4KT5 C;  2JQ7 A;  3OPO A;  2WWY A;  3OJW A;  2XGD A;  3PET A;  4M1K A;  4HF1 A;  3SQN A;  4P6Y A;  1HA3 A;  3LO8 A;  1WSR A;  2ZL6 A;  1SKQ A;  1NB0 A;  3ZN0 A;  1YHQ B;  3A35 A;  1KYZ A;  1POG A;  4XLN F;  4EJT A;  2O04 A;  2HXI A;  3GW2 A;  1UHM A;  4YXW A;  3K4B A;  3IH3 A;  1XC5 A;  4WXC A;  1BIA A;  3S3N A;  3GVK A;  4BL0 B;  5C1E A;  1JHH A;  5K5R A;  1SKY B;  1E3P A;  4TMV A;  3L1P A;  4JQF A;  2M4K A;  2F1M A;  2UXX A;  1CZF A;  2XND A;  1ZLK A;  2PBI A;  1ZAO A;  3H3V K;  1IXC A;  4IHY A;  3DDY A;  1O57 A;  1X1B A;  3CMM A;  3ZQH A;  3QOE A;  4ETS A;  1KD1 D;  3DBH B;  3L2U A;  3A1P A;  3FXO A;  4PSW A;  4FTH A;  1FSH A;  1IN7 A;  3CP2 A;  3SUC A;  3BP8 A;  5EYR A;  4DJA A;  1G7S A;  4DOZ A;  4E4H A;  3CCS B;  2NRA C;  1LLW A;  3OYC A;  2D1H A;  2FQ4 A;  2WV1 A;  5CLS A;  3H9G A;  4CUG A;  3O2P E;  4B47 A;  2HQN A;  1VBL A;  1RZ4 A;  2XRN A;  2DFI A;  2P6T A;  5AON A;  1V0F A;  1WPC A;  3TO9 A;  2L02 A;  2B7B A;  2R6H A;  3BCD A;  2KZV A;  5IP7 J;  2PJR A;  1XDS A;  2LOO A;  3TQN A;  1I6X A;  2MGQ A;  3BY6 A;  1MMN A;  4BEH B;  5A2Q Z;  3A1Y A;  1BHE A;  2EV5 A;  4RB0 A;  1JGS A;  2BM7 A;  3TO7 A;  2F5C A;  5C4J J;  2VOP A;  4G1V A;  2NPF A;  2LBF B;  4G7X A;  2FEZ A;  2DPD A;  3BTC A;  2Z3Y A;  3GQ7 A;  3WTT C;  3QFR A;  4G7Z F;  2BY3 A;  1A6I A;  4PJM A;  5AN9 A;  2Y75 A;  1NHA A;  5GV8 A;  4II2 A;  1GO2 A;  3OW2 B;  3U2Q A;  1YX5 A;  2XTW A;  2XAG A;  3GTO J;  3N97 A;  2JN9 A;  4A3I J;  2IGN A;  5FGM A;  3E6C C;  4YC5 A;  5EGO B;  1Y0R A;  3RPQ A;  2VI6 A;  4CGZ A;  4QPO A;  2BVN A;  3GVJ A;  3ZPN A;  3MAJ A;  3ZMU A;  4OZY A;  1OFD A;  2M8G X;  2B9S A;  3A0H C;  4I0B A;  3OEH A;  3GUD A;  3A02 A;  2Y31 A;  2NOJ B;  1D5Y A;  1LM1 A;  5JLV C;  2IAI A;  4UXN A;  1TVC A;  3ONU A;  1W1W E;  2LLK A;  2CG4 A;  2M8E A;  3BG7 A;  4Y7C A;  4Z4Z A;  1I8D A;  4RAG A;  5CVV A;  3F23 A;  5HVQ C;  4L18 B;  4KT6 A;  4HQE A;  4HX7 A;  2ADU A;  2EFN A;  2PJR B;  5BSX A;  2CSO A;  1WSU A;  1B23 P;  1K5C A;  4U88 A;  3M7G A;  3FWE A;  4HAM A;  3AGQ A;  4P3Y A;  3S17 J;  1G7T A;  2QDX A;  4H9G A;  2CV2 A;  4X05 A;  2BM5 A;  3E97 A;  3OYD A;  1H8H A;  2CBX A;  3LMW A;  2JSC A;  2KIF A;  1N75 A;  2P6S A;  3O8G A;  2VOD A;  1J9Z A;  3QSY A;  5DD4 A;  1O3T A;  1BI3 A;  2HYJ A;  3LQR A;  4M53 A;  3BPV A;  4F92 B;  2DA6 A;  1DDG A;  4LLL A;  3EET A;  1HDD C;  4RPD A;  3K69 A;  4NCN A;  1FDR A;  2QWW A;  2A05 A;  2I5U A;  4FIS A;  2Y9Y A;  4PCQ A;  5FFX A;  5ILS A;  5ICG A;  2E7W A;  1WCM J;  1Y1W J;  2DN0 A;  1UFM A;  3B73 A;  1A36 A;  2R7O A;  2ZXH A;  3PQK A;  2EJR A;  5IPA A;  3SEQ A;  1TC3 C;  3S1Q J;  2BGI A;  1MBK A;  2DOF A;  3H0D A;  1Q82 D;  3AVW A;  4ABZ A;  4ZYA A;  3CJN A;  2XSJ C;  4IQJ A;  1BM9 A;  4ESB A;  3T51 B;  1PYV A;  3OOU A;  3BQJ A;  1VF9 A;  4RM2 A;  3EUH C;  2X85 A;  4HOB A;  3SEJ A;  4RD4 A;  3EQN A;  2RDP A;  2KZG A;  3Q38 A;  1F5T A;  4FX0 A;  3RKQ A;  2YX7 A;  1MBJ A;  4E7I A;  2QE7 A;  2BM6 A;  2IGM A;  5K5Q A;  1VQ5 B;  1RIO H;  1FT9 A;  2R5Z B;  2ZXJ A;  3R6S A;  1JUP A;  5KNL A;  1OR7 C;  2K9S A;  3AG2 H;  2XSD C;  1HDP A;  4P9F A;  3ML3 A;  3ERE D;  3H9Q A;  1Q1V A;  2ZFU A;  4L0Y B;  2ZIT A;  5HS8 A;  1BPL A;  2A07 F;  2DEU A;  1TWC J;  4RDU A;  4U9U A;  2ZBV A;  3IH4 A;  1D0Y A;  2M87 A;  3CC2 B;  1W0J A;  2ISY A;  2DO7 A;  3MCA A;  4PC2 A;  4PSX A;  3I4P A;  4HA8 A;  3BJO A;  1UHW A;  1VI0 A;  3ESW B;  3PFI A;  5GP9 A;  4OM9 A;  3H3Z A;  5F04 A;  2J5P A;  1UD4 A;  3CB4 A;  3VR6 A;  2BSP A;  5THX A;  2R3S A;  1JKR C;  1PVE A;  2UWM A;  2FOW A;  1BA5 A;  1KU3 A;  2WA0 A;  1ACI A;  3HOS A;  3E5Q A;  3OIQ A;  2DFH A;  3J81 Z;  3L2W A;  2DMN A;  3AVU A;  1AWC A;  3VDX A;  2XT2 A;  3ZPL A;  2CQK A;  2J5O A;  4Z4W A;  4A69 C;  1MDM A;  2VUM J;  2PYH A;  1KU9 A;  1HZE A;  4BHB A;  5B3S H;  3IL2 A;  1I3A A;  2EZH A;  2YUS A;  4M6Y A;  5E1Z B;  1FRQ A;  3M8F A;  3DTE A;  1FPQ A;  2XC7 A;  3CF5 F;  1W5S A;  6PAX A;  1WOS A;  1L1I A;  2IS2 A;  1YJ9 I;  2IRF G;  5IK2 A;  1TQM A;  3JRB A;  1TQI A;  3WTZ A;  1U9N A;  3C3W A;  2ID6 A;  1WJD A;  1E79 A;  2O0W A;  4RDL A;  2V4D A;  4C3H J;  5DS9 A;  2BF4 A;  3ROU A;  1FC3 A;  1V5F A;  4LK0 F;  3QPS A;  4XSX F;  2E34 A;  4PAB A;  4OJ6 A;  2HVR A;  2JA2 A;  2L9R A;  2LC2 A;  2P7V B;  3K9T A;  2E19 A;  3CME B;  2QKM B;  5DSZ A;  1VQ8 I;  3H5R A;  1QA3 A;  2VZL A;  1WI3 A;  4QUZ A;  1FWZ A;  1BQE A;  2NST A;  4ROX A;  3ZQG A;  4A3D J;  4MYU A;  2V9K A;  4AIJ A;  4NDL A;  1JI8 A;  5EEA A;  3OAA A;  2OZU A;  2PLY A;  1NG6 A;  3Q3A A;  4S04 A;  1VQP I;  1ZRE A;  3V42 A;  4FAS D;  1JKP C;  1JTA A;  2PEX A;  4O5V A;  1IV6 A;  1ZHF A;  1FJL A;  2LDU A;  5F1J A;  2R7Q A;  2GZW A;  3JAM K;  1R1V A;  3QYB A;  3D5R C;  1ZRF A;  4HBL A;  2EA2 A;  3F0C A;  2D74 A;  2FA5 A;  2QQA A;  3H9N A;  3L00 A;  3W2G A;  2AS5 F;  3SJM A;  4BY1 J;  2RVC A;  2VBT A;  2YUH A;  3QP5 A;  1PJ7 A;  2NT6 A;  4TKO B;  4RGS A;  4XLC A;  5A88 A;  1N25 A;  2VKV A;  3SDG A;  4ZJZ A;  4IRG A;  4W97 A;  3E6M A;  2WBM A;  3ZQI A;  2QYO A;  3R4K A;  1EJ9 A;  4ANJ A;  1E0E A;  4M2L A;  4WK8 F;  3B02 A;  1UHS A;  2YU3 A;  4C3J J;  3ZQF A;  4QLC U;  2IA0 A;  1HW5 A;  3IKT A;  1ZH5 A;  3KPH A;  1N0V C;  1V55 H;  1YI2 I;  1WKM A;  3FMR A;  4WZE A;  4EMS A;  2JPB A;  2IEK A;  2KRF A;  5FLX Z;  2ZZG A;  2D3L A;  1ZR4 A;  1OCC H;  3LVB A;  4LBZ A;  2IOU G;  5AMV A;  3DBL B;  1QZY A;  1S8N A;  2O5R A;  2HLD A;  3ZMZ A;  2QSH X;  2HDW A;  3KP6 A;  3U21 A;  5D4R A;  5E79 C;  2HR3 A;  1R4N B;  4OAZ A;  2V7U A;  5L3E A;  3B8H A;  1U5T A;  4RB3 C;  1D1N A;  1F43 A;  3QU3 A;  4EV0 A;  5DEQ A;  1I18 A;  5M3M J;  3KP7 A;  1KU7 A;  2HKX A;  3IHU A;  4HF0 A;  4ASN A;  3E3V A;  5EF6 A;  3CTA A;  2DCU A;  2IT0 A;  4RDJ A;  1J59 A;  3P4G A;  4OU0 A;  5JLX A;  3CC4 I;  4OOS A;  4CO8 A;  2ECC A;  3ABT A;  4W8Q A;  5TY0 A;  2XAS A;  2CQQ A;  3W2V A;  1JNY A;  5KHD A;  1DDN A;  2DBB A;  2P7C B;  4P2N A;  2L0K A;  2K4B A;  3MVP A;  1FBQ A;  4XOP A;  1K7A A;  3CD6 I;  2P81 A;  2XZL A;  2AHQ A;  2RNG A;  5C4X J;  5FLX K;  2C77 A;  5JMC B;  3HKZ N;  5JLW A;  4XK4 A;  1XFO A;  4HE6 A;  2E1O A;  2E7X A;  4RD1 A;  1X58 A;  3I58 A;  2GPJ A;  1VQM B;  4HDU A;  1IRZ A;  1S7O A;  4ZCL A;  4I7H A;  1IDY A;  1D5V A;  1KK1 A;  1Y56 A;  2OBS A;  5L46 A;  4Y9R A;  5JBQ A;  4GXO A;  2L9S A;  5B6I A;  1QA2 A;  1K6Y A;  1RNL A;  3G4S I;  5H2F C;  4BXU A;  4Z4T A;  1R5G A;  4HRI A;  2DA7 A;  2X6O A;  3RQ4 A;  5E8I A;  4EJV A;  3F8B A;  2H09 A;  4P9U A;  2FF4 A;  1GAQ A;  1GV5 A;  1V5G A;  4B44 A;  4HF2 A;  2GA2 A;  3K4L A;  1F60 A;  3HPH A;  1GUU A;  4XLH A;  1HKQ A;  1QFY A;  2IJL A;  2QXZ A;  2EV0 A;  2F4O B;  3A01 B;  2IS6 A;  5FKK A;  1TT5 B;  1YJN I;  5IYD J;  2Y0S N;  1CF7 A;  2K3F A;  3G73 A;  1TNS A;  4UVB A;  2FX3 A;  3EPZ A;  1USS A;  2JPC A;  5LHH A;  3E5U A;  1K8F A;  1B1B A;  1OIS A;  3R0A A;  4QPQ A;  1QGA A;  3WU0 A;  1FNC A;  4RD2 A;  5F0C A;  4Q7J B;  5J3L A;  5F08 A;  2ID3 A;  3I3L A;  4G7W A;  2WAQ N;  2WY7 Q;  5HZA A;  2FBK A;  3F8N A;  3Q9S A;  4TMZ A;  4DNR B;  4XN3 A;  2X6Y A;  2LRE A;  3RZO J;  4Y33 A;  3OEE A;  3LJY A;  4IOC F;  1QGY A;  1ETY A;  1XSV A;  4E7Z A;  5IOZ A;  3BRO A;  3FBN B;  3OYL A;  2HOA A;  5JI6 A;  1W0T A;  1CNE A;  2OQR A;  3BR6 A;  5J1R A;  5K7F A;  1VF7 A;  1F20 A;  1LFP A;  4A0X A;  4ACB A;  4XLE A;  4KKT A;  3OIO A;  1Z7U A;  5B66 C;  5CJ9 A;  3NB2 A;  1S29 A;  5DCM A;  3CJR B;  2QYU A;  2DU9 A;  4XNF A;  5HDG A;  1VLO A;  3TW7 A;  2WAD A;  2QBY B;  2B0R A;  2M0C A;  2EIK H;  1YTY A;  1SEU A;  2V1D A;  3ISP A;  5E1X A;  1YRN A;  2YWF A;  5L3G A;  4YDT A;  1Q7Y D;  3HUG B;  4A3G J;  1M1K D;  4RGR A;  4C43 A;  2ZZF A;  4FK8 A;  3VYR B;  3SY2 A;  2ELH A;  3M3Y J;  5HLG A;  2D2W A;  1U5T C;  3VB2 A;  3OE7 A;  2DDB A;  2DOD A;  5DTD A;  2EH3 A;  3HC7 A;  3TP0 A;  5TJJ A;  2E2H J;  1R5N A;  3WQZ A;  1HQC A;  1MBH A;  3CDI A;  1TNT A;  4M6V A;  1S6L A;  1W2B B;  4UUS B;  3GVA A;  1E43 A;  2CQX A;  3F8M A;  4L9N A;  2GAU A;  3WE2 A;  3PUF A;  1B59 A;  4GO1 A;  1XX5 A;  2VE8 A;  3ASP A;  3DLA A;  1FMW A;  1IW7 F;  1UCR A;  2VC0 A;  3B6C A;  3JW4 A;  3AL0 C;  3S8P A;  4EVI A;  1I7P A;  3WU2 C;  1ZRC A;  1K4T A;  2X8K A;  2ZL5 A;  1VQN I;  3JQR A;  2OTL B;  4HX4 A;  1EFR A;  2NXN B;  4DYR A;  3DU5 A;  4PFO A;  1SM4 A;  3NE5 B;  1VTN C;  3SQV A;  3CO7 C;  2VLA A;  3FY3 A;  3G3Z A;  4YZ0 A;  2ZSH B;  3M8J A;  2NVY J;  5M5W J;  4DK1 A;  4YCQ A;  2EA4 A;  4ZDP A;  3PSZ A;  3GVL A;  2L2O A;  2VBY A;  4XR6 A;  1QJV A;  2LVS A;  4Y4R A;  1FNB A;  4PC6 A;  3DU1 X;  2W1O A;  1QHH D;  3HTU A;  1TP4 A;  4N4O B;  3S2D J;  2VNK A;  3RIR A;  2CRG A;  3L7W A;  1BR4 A;  4PJJ A;  2BHY A;  1WJB A;  3RDI A;  1SC7 A;  2STT A;  4NK8 A;  2XIG A;  1ZM2 A;  3PA2 A;  2VBW A;  2R7W A;  2Y69 H;  3CCM B;  4PAA A;  4NNJ A;  1WJ5 A;  3V76 A;  3VFZ A;  3CRZ A;  1VQK B;  2DMU A;  4BJ6 C;  3G05 A;  2LSO A;  2TDX A;  2BY0 A;  1WI9 A;  1OYY A;  2VBZ A;  1YHQ I;  3PUN A;  2V7Q A;  3NWT A;  3VPR A;  1IUY A;  4N9I A;  3GZ5 A;  2ZCW A;  4KJZ A;  2M30 A;  3CUQ A;  3D5L A;  2CF4 A;  1XS9 A;  2VB6 A;  2VBE A;  4LG0 A;  1DUX C;  1TW2 A;  2O7O A;  3L09 A;  2KHM A;  1R36 A;  3AAF A;  4ESF A;  4ITV A;  1YJW B;  2M9H A;  1B8I B;  3I59 B;  4S05 A;  1WPK A;  3GO5 A;  1ZM9 A;  2VFM A;  2E1M B;  4AC9 A;  1B9M A;  4JRA C;  3FIS A;  3DPT A;  3BR5 A;  3Q0W A;  1E1R A;  2HTJ A;  3BWG A;  1E3X A;  4M3G A;  1GHC A;  2W6I A;  3AVT A;  2VJ4 A;  3BOQ A;  3EUK L;  2STW A;  1G3W A;  2CJJ A;  4Z4U A;  2DK5 A;  4I2O A;  4GRI A;  4CYC B;  2HOS A;  4L0Z B;  4Z06 A;  2E5Z A;  2O8X A;  3TED A;  3CCS I;  2H6B A;  4DBR A;  5J1Y A;  4BBS J;  4AF7 A;  3BR2 A;  1OHH A;  1A6Q A;  1AOY A;  4R8H A;  2PMD A;  2M5W A;  3CQZ J;  4RS8 A;  4BAC A;  4OPW A;  3I53 A;  2Q2E A;  3SZP A;  2A6H F;  2KT0 A;  4R79 A;  2RC5 A;  3DTI A;  1Y0U A;  1BI2 A;  3T8R A;  5HNF A;  4RLQ A;  3G6E B;  2VIX A;  2VXD A;  1BI1 A;  3KP5 A;  2EFQ A;  1IHM A;  2WR8 A;  4CXF A;  2A69 F;  1Z05 A;  3JRC A;  2VKD A;  2CQN A;  2GIV A;  2B7E A;  3IWZ A;  4PDK A;  4WX9 A;  4F91 B;  1JJ8 C;  4HNU A;  1QA6 A;  3D26 A;  1MBG A;  5DCF A;  3GTG J;  1WQ2 A;  3I1F A;  4BGD A;  1DGR M;  2VFP A;  1IO2 A;  2LMD A;  1D8K A;  2KJC A;  2XAU A;  3GWZ A;  2KL4 A;  3FPP A;  3CUQ B;  2KKO A;  1BOA A;  2NTB A;  1P6R A;  3RPU A;  3ASS A;  3C2H A;  2HVS A;  1O7F A;  2FQ3 A;  1DG1 G;  2QLZ A;  4LG3 A;  2BN4 A;  3QFS A;  4OOX A;  2HYF A;  4M73 A;  4QIW N;  2RQQ A;  4X8I A;  4G12 A;  2KIU A;  3CJT B;  4B8X A;  3U9G A;  4CCK A;  5FIU A;  1FTT A;  4LFU A;  5L3C A;  3D0S A;  1XCB A;  3FBI B;  1JA1 A;  4TMT A;  4BQQ A;  3VSV A;  4M74 A;  2BM0 A;  2K7L A;  2Y0M A;  1OJL A;  4ZZL A;  3CCE B;  3K70 D;  3O3K A;  5FD5 A;  3N6Z A;  2PEC A;  1OPC A;  3QP6 A;  2V5I A;  3WTS C;  1GQ8 A;  4II3 A;  5CYV A;  4DIQ A;  1V3F A;  2YWH A;  3MMY B;  3VNV A;  3W6J B;  3ZN1 A;  3WWG A;  3OYM A;  3R6J A;  4L5J A;  3BG6 A;  5HLI A;  2CUE A;  2OK8 A;  4J00 A;  3S16 J;  3GLL A;  1YX2 A;  3ZZU A;  4XKV A;  2O3F A;  1I5Z A;  1T6S A;  4PJN A;  4BE1 A;  2R7T A;  1JUM A;  4RDK A;  2GQQ A;  1K79 A;  2FJ1 A;  4IEJ A;  3BY1 A;  1MGT A;  1W36 D;  1O4X A;  2X6X A;  5GAG J;  5BSY A;  2I1L A;  4PFP A;  1PLU A;  2EBI A;  4XRS G;  1X2M A;  2DQL A;  3ABL H;  3PSI A;  4XON A;  5DV5 A;  4BAY A;  4PC1 A;  3U6B A;  3SZT A;  4CIC A;  1KJZ A;  1V4R A;  2NZM A;  4XSZ F;  1K6O A;  1QGZ A;  5E18 F;  3BG3 A;  3OS1 A;  3P5J A;  1DPU A;  3TL4 X;  2HDC A;  4FQG A;  1FSE A;  2XF6 A;  1EKE A;  4HQM A;  1XMX A;  4IO9 F;  3QU6 A;  3DV8 A;  3EDP A;  4KN7 X;  3BT9 A;  5LMZ A;  3E7L A;  1S9H A;  2FML A;  3MEX A;  5IYB J;  3LSR A;  1IXR C;  4B3X A;  2L7Z A;  3OS2 A;  4ENJ A;  4DQL A;  3MQ0 A;  1V0E A;  3VO1 A;  1ZM3 A;  1V54 H;  1BI0 A;  3AKZ A;  2F3L A;  1KRH A;  1KZL A;  5H6Q A;  3SHF A;  4EM1 A;  3W2F A;  5FJ8 J;  3FM3 A;  2CV0 A;  2O9L A;  4UUV A;  1R7J A;  4KDP A;  3Q6Q A;  1K73 D;  2L9N A;  1QRC A;  4WCG A;  1PE9 A;  5J1U A;  5C3E J;  2V6E A;  2QY1 A;  2DLL A;  3HOZ J;  1FYM A;  4IHW A;  1VZ0 A;  2QMU A;  1VQ5 I;  5HS9 A;  2KLO A;  2MG4 A;  3FDY A;  1PP7 U;  2DTZ A;  3H5N A;  3T8T A;  3VSU A;  2NVQ J;  4I09 A;  5IYC J;  3GME A;  1DQU A;  4DYQ A;  5L3B A;  1LQ1 A;  1ON1 A;  1X0C A;  2FXA A;  1KTV A;  3F3X A;  3HRT A;  2FMY A;  2HNH A;  3I5U A;  4KIC A;  1T98 A;  2AO9 A;  4LD5 A;  2H8W A;  5CVR A;  3TO6 A;  3VYT B;  4I76 A;  3CC2 I;  3W2I A;  1YIT B;  5E20 A;  4W8S A;  4CCM A;  4Z4R A;  2NAZ A;  1ELO A;  4OJL A;  2Z9O A;  3F72 A;  2VC1 A;  3HXL A;  1E62 A;  3F9K A;  1PKV A;  2VN2 A;  1KC8 D;  4N4N B;  2CUF A;  4F55 A;  4G5G A;  4CSW A;  1Z9C A;  1E64 A;  1QUF A;  2ZTN A;  4UZF A;  2NNN A;  1TSP A;  2E60 A;  1GJR A;  1KGS A;  3GFM A;  2BV6 A;  3WE3 A;  1Y8R B;  1E1Q A;  1N05 A;  4B1R A;  2R7V A;  2L4A A;  1KCD A;  4YEL A;  3T0Y A;  2X0L A;  3S15 J;  1JB9 A;  1GXQ A;  3A3G A;  2XVC A;  4MEY F;  4R1H A;  2MC4 A;  2M34 A;  1BOB A;  4PUS A;  4XLP F;  2YSR A;  3HSE A;  1X3W B;  1HSJ A;  1VQ4 B;  1FP2 A;  3Q39 A;  2XRO A;  1GR1 A;  3RYR A;  4U87 A;  1MH3 A;  2AQE A;  2D1V A;  5J8F A;  3E6B A;  2BE5 F;  2CYY A;  4LB6 B;  3RSN A;  1NK2 P;  1EP3 B;  4P26 A;  1TYV A;  1RPW A;  1FOK A;  4EJU A;  3EUH A;  3K1P A;  3KP4 A;  3MKW B;  1RUO A;  1Z21 A;  3W5V A;  3LFU A;  1LFB A;  4B09 A;  1KON A;  1MJA A;  4P6V F;  4XKC A;  3WXM A;  4GYI A;  4UVC A;  1LFU P;  3CME I;  3LAJ A;  1LKX A;  3VWB A;  1G2H A;  3OY9 A;  2Y2Z A;  5FKM A;  2XGJ A;  2Y30 A;  3OIP A;  1OR7 A;  2RGV A;  3PVD A;  4IF4 A;  4TMX A;  2JZY A;  4Y3O A;  5DD8 A;  5M5Y J;  1IA5 A;  4YEI A;  1OCO H;  3V8J A;  2O61 A;  3HG9 A;  4ZC3 A;  1LEB A;  2A68 F;  5CKT A;  2COM A;  4PJL A;  1S7E A;  4RPB A;  4DBQ A;  4M6X A;  5KCM A;  4AD9 A;  3PO2 J;  1X1C A;  5IOY A;  1XE1 A;  2QZA A;  1RKW A;  5EG0 A;  1ZEL A;  3HGG A;  2HPI A;  4UHT A;  1RUN A;  2H94 A;  3DPU A;  3OZU A;  1EZG A;  3X2Q H;  1Y6I A;  3BY2 A;  4K1X A;  4I02 A;  2HCJ B;  2R0Q C;  3FF5 A;  5D5W B;  3ML6 A;  1S0U A;  2HQA A;  2QEN A;  4XMY A;  3K4N A;  3MKZ A;  3RKY A;  2BW3 A;  4ACA A;  1FRN A;  4X7F A;  1MJB A;  1AHD P;  1IN8 A;  4OMZ A;  4IHV A;  3WG7 H;  3LFK A;  3IV5 A;  4ZYE A;  4G1B A;  4FN5 A;  3BJ6 A;  1OCT C;  2UVF A;  3U6K A;  3DTK A;  2R92 J;  2OTJ B;  1ONV A;  4O3M A;  2BZT A;  4MQV A;  5DYM A;  3A8I A;  2LG4 A;  4BYY A;  1VQ9 I;  1K8A D;  2ZJQ F;  2UV1 A;  1Y8Q B;  2G0E A;  1P4W A;  1LUJ B;  2M1B A;  2GXB A;  5M5X J;  1EH7 A;  2LKX A;  1OMI A;  1RES A;  1TTY A;  3GQ9 A;  3OYA A;  2QA4 B;  3QOD A;  2X6W A;  1P7I A;  4IX7 A;  3CXC B;  1FOY A;  1K83 J;  3JTH A;  4AYB A;  4EJW A;  4YZQ A;  1K61 A;  2K3P A;  4W1U A;  2F4N A;  4A5N A;  3QPT A;  1T6Y A;  4QFM A;  4RM0 A;  3AVY A;  2EB7 A;  3JCU C;  4JX4 A;  3N90 A;  2A61 A;  1G3S A;  3CF2 A;  3HOW J;  3F8F A;  2XAF A;  2D45 A;  2K9N A;  3HJE A;  3SDB A;  3PIO F;  2Q1Z B;  3K4C A;  5K1Y A;  4JMQ A;  2P5V A;  1MSF C;  4UVA A;  2Z1D A;  4AF6 A;  5H20 A;  2P8T A;  3IC7 A;  1CQT A;  2JA6 J;  1N0U A;  3IAS 2;  3RJP A;  1QQ1 A;  5J4Y A;  2MAB A;  3W2A A;  5CPR B;  2I10 A;  3C2G A;  1T6X A;  4G6I A;  1ENH A;  2H1K A;  2R5Y A;  4RAZ A;  3S3M A;  2GJP A;  2P5L C;  4L9T A;  4YHB A;  4CH7 A;  5DUK A;  1VQM I;  5E6T A;  3RKW A;  3AG3 H;  2KIQ A;  2H27 A;  1IB0 A;  2OA4 A;  4F3Q A;  3SYJ A;  1XGM A;  4W8T A;  1QHG A;  4RBO A;  4DGW B;  4L9V A;  1PJ5 A;  4G94 A;  1HW2 A;  2DOG A;  3K7A J;  4HIZ A;  4JK1 X;  3ZUG A;  1HOM A;  1VQO B;  1H88 C;  3E0J B;  4G8X A;  3GIR A;  1G3Y A;  1I6H J;  1RI7 A;  2O0V A;  4WF2 A;  3V7R A;  2NVU B;  5DM6 F;  2HU9 A;  4EQQ A;  5GPC A;  3I64 A;  2OBP A;  3DXJ F;  3RCO A;  1O8H A;  2DYR H;  4M3B A;  4KKU A;  4XD7 A;  2R9V A;  3ZZ0 A;  3ZPP A;  4KKS A;  2V31 A;  1FIP A;  2JDI A;  1R22 A;  4N0B A;  1YS6 A;  1R5B A;  1IN4 A;  4LJZ F;  1KMH A;  4NQW A;  1BJZ A;  1VFC A;  5B5E C;  3LNQ A;  4Y52 J;  5LBQ A;  4AC0 A;  2O6G E;  4UY8 I;  1QU3 A;  1MBF A;  2IGO A;  3KE2 A;  4G6D A;  5EEH A;  2YPR A;  1JE8 A;  2VNH A;  3CJQ B;  5B1A H;  9ANT A;  4LMY A;  3FJO A;  1SD5 A;  1ETX A;  3VSK A;  3S2H J;  3H09 A;  2XNJ A;  2XDV A;  4X7E A;  1BBY A;  2XGC A;  3LNN A;  4QVA A;  1QCX A;  1JJ6 C;  2FBI A;  3ASR A;  5J35 A;  4NC6 A;  1JTX A;  2FX0 A;  4M3F A;  1F4K A;  2ZZE A;  2GA1 A;  3GTQ J;  2R5Y B;  3KCC A;  2L4M A;  4R71 A;  4M72 A;  3WGI A;  1EFU A;  4Y9U A;  4EM0 B;  3JRE A;  4UNO A;  2ZME A;  2L54 A;  2LY9 A;  2DT7 B;  2D5V A;  1V5E A;  1SFX A;  3OP1 A;  4E0F A;  1Z77 A;  4E6K G;  1FX7 A;  4U0Y A;  2ECB A;  4BUP A;  2EZL A;  2W25 A;  1J7K A;  4OJO A;  4V19 K;  4LIT A;  1U8B A;  3CCU B;  2JN6 A;  3ZMD A;  1FNM A;  2Q6K A;  2YU9 J;  4CQJ A;  3CDH A;  5JVG F;  2XRL A;  3JAM Z;  1UB9 A;  5LEJ A;  2K27 A;  4Y17 A;  4LK1 F;  1GVH A;  2KDO A;  1YX3 A;  2WZN A;  2PN6 A;  2OJE D;  1U6G A;  3FXK A;  5ICF A;  3ZQ7 A;  4EAT A;  3GTJ J;  1IJF A;  4Z03 A;  2ZBU A;  5C44 J;  1NJI D;  2F48 A;  4IVN A;  1O7L A;  2F6C A;  2LY1 A;  3A0B C;  2DYS H;  3H36 A;  2XEX A;  3ONY A;  3OYJ A;  3K6G A;  4GFB A;  1EP2 B;  1LEA A;  2DCE A;  3VYS B;  4YAW A;  1T5E A;  3N05 A;  5IT9 K;  3KEW A;  2JMW A;  4TSF A;  4KMU X;  1A5J A;  3ZZT A;  3OYK A;  2LF8 A;  2B0L A;  1O3Q A;  2O1D A;  1ZG5 A;  2PFB A;  4IHS A;  1TW3 A;  4C9Y A;  2Y48 A;  5BS6 A;  5FRM A;  4EEF G;  5FO5 A;  1GVJ A;  4CCO A;  2EZK A;  3KLO A;  3ZQQ A;  1DP7 P;  4YAL A;  1DP3 A;  3L9F A;  4DZP A;  2XGE A;  4M9Z A;  3H0G J;  2C4T A;  2QF7 A;  4HNV A;  2FUG 2;  1ZG3 A;  3WHC A;  4A0Z A;  4PGG A;  3FXL A;  1JUS A;  2CMP A;  4BXX J;  2V7F A;  2OAZ A;  4AVP A;  2EIX A;  1TUI A;  2IS4 A;  2OTL I;  1U8R A;  2ZL7 A;  1XG1 A;  2W7Z A;  1WH7 A;  1WOR A;  1MDM B;  1YOV B;  2MC3 A;  2QSF X;  4IJA A;  5H6R A;  2DA1 A;  2O03 A;  3AG4 H;  5GTI C;  2W82 A;  2NS7 A;  3M1E A;  3CLO A;  4DNC A;  3JRD A;  1FTZ A;  3CC7 B;  2L01 A;  1PJ6 A;  1OB0 A;  1YFH A;  1JHF A;  1BR1 A;  1D1C A;  1AA7 A;  2ACJ A;  2XHK A;  4Q48 A;  5FKO A;  1Z3X A;  4A5M A;  4PGH A;  3CUO A;  2WV0 A;  4RAF A;  4L9J A;  1WP6 A;  1AIP A;  4J0Q A;  1O8K A;  1CGP A;  4WZL A;  2XF7 A;  4UUT A;  4H0E A;  2JRT A;  1MSE C;  1TYW A;  4YFO A;  2W6J A;  1V5V A;  4XOT A;  1D0Z A;  3CCM I;  4A6D A;  1VQK I;  3P9C A;  5F6F A;  4YIR X;  5J8C A;  2J7K A;  4YFK F;  1VQ9 B;  3B6A A;  1XPX A;  1YO5 C;  5EZG A;  3I4N J;  1JXS A;  2CQ7 A;  3K4M A;  2CK3 A;  5LGT A;  3UKG A;  3BCF A;  5F4J A;  1IRX A;  4B4D A;  4D9J A;  4X07 A;  3UR3 C;  2RN7 A;  1ZR2 A;  2A5Y B;  3DEU A;  4WXD A;  4LOC A;  1BMF A;  1N07 A;  1PDN C;  2QN6 A;  1JA0 A;  2W48 A;  3HKZ A;  4P96 A;  4TN1 A;  1PJR A;  5HZB A;  1YJW I;  4BE0 A;  1IF1 A;  2ZO4 A;  3P7N A;  4P1W A;  3L2C A;  2DER A;  3BJA A;  1YG2 A;  5FL7 A;  4W8R A;  3J7A O;  2FD5 A;  3LSG A;  1LVA A;  2ZME C;  3ECO A;  3CCQ B;  3ASQ A;  1UEL B;  5C1C A;  1ZGA A;  3EYY A;  4CCL A;  2DA2 A;  1BC7 C;  3Q3S A;  3W5U A;  1MJ9 A;  1A04 A;  4NB5 A;  3JQP A;  1JKQ C;  2ESH A;  1XN7 A;  3BTI A;  2BGJ A;  2QTZ A;  1X19 A;  5KAF C;  4YZA A;  2R7S A;  4IZZ A;  3V4G A;  3S14 J;  1REP C;  2W24 A;  4CCN A;  3HHH A;  1K28 D;  1I3Q J;  3MMP A;  4ENN A;  1BIB A;  1DBO A;  3BC8 A;  1OYW A;  1PP8 F;  2JSP A;  1PUE E;  4GQN A;  3LQE A;  3LQQ A;  2VKE A;  3JQQ A;  5A8A A;  2OYN A;  1KQ8 A;  2Y0S A;  3G6E I;  5FO0 A;  3W5H A;  2ISZ A;  1HXD A;  3CP8 A;  3OW7 A;  1KCC A;  3FM5 A;  4XRF A;  2BV3 A;  2HS5 A;  1GVD A;  3VNU A;  4MNU A;  3BG5 A;  3I9V 2;  1WU8 A;  1WHU A;  1S5L C;  2V9V A;  1OCR H;  3HOV J;  3FKJ A;  5DUI A;  3Q0V A;  3KYL A;  2VE9 A;  4RD0 A;  1IRF A;  1TWG J;  1U5T B;  1HG8 A;  1BN5 A;  4HW0 A;  1WJF A;  5IP6 A;  2O0Y A;  1IG7 A;  3H35 A;  2JWT A;  3DKY A;  1BN8 A;  2DIE A;  2HOT A;  4WWC A;  4ZCI A;  2DMT A;  4OIO F;  4HST A;  2E1B A;  3J7Y J;  3B82 A;  3WNC A;  4KYW A;  3FXR A;  1EV7 A;  5DM7 F;  2KMU A;  2YX4 A;  4DK0 A;  1BL0 A;  4IRH A;  4X0G A;  4Z05 A;  3CCE I;  3LQ6 A;  2D9R A;  2DYI A;  3CMA B;  2PX9 A;  2DT6 A;  3QQA A;  2ME6 A;  3HOX J;  4BNC A;  1R5O A;  1WTH D;  1Q86 D;  3KYD B;  3VEP A;  4OAY A;  4OIQ F;  1U2W A;  1DAB A;  1UG0 A;  2MSY A;  3F21 A;  2F5V A;  4BXF A;  1EA3 A;  2JT1 A;  2HVQ A;  3IKV A;  4FX4 A;  2LKS A;  4ZYD A;  1SVO A;  3B4N A;  1OCP A;  4KIB A;  3DEW A;  2VKH A;  3DEE A;  3N4M A;  3KP2 A;  3FKS A;  1X1D A;  1M1E B;  2HQ5 A;  2ZKZ A;  2KVO A;  4DQ2 A;  1G8X A;  1DDI A;  1OLT A;  2F5E A;  3SYT A;  2PG4 A;  3MKY B;  3HOY J;  3EUA A;  2Z99 A;  4ZTJ A;  1O3S A;  4UB8 C;  1WZ2 A;  5DS0 A;  3S32 A;  4IRI A;  3WTW C;  4I98 B;  3WTY C;  2DQR A;  1XB4 A;  2M45 A;  1YYV A;  3EQL F;  3G1L A;  1OFE A;  1QNT A;  2HQR A;  1IN6 A;  2BYV E;  1S72 I;  2XKO A;  3W2H A;  2M5S A;  1ETO A;  4MTE A;  4YG2 F;  4A12 A;  2VBS A;  1UJ8 A;  4E7H A;  4YFN F;  2DI3 A;  4FWT A;  1EE6 A;  3PFY A;  2A6T A;  1M90 D;  2GWR A;  2CH0 A;  1Z6R A;  3KZY A;  3OYG A;  1K78 A;  3ES9 A;  1FZP B;  1CF7 B;  2JJ1 A;  3WBJ A;  2G7H A;  4M71 A;  1WJA A;  2CW8 A;  1Z0X A;  1MMA A;  3BCA A;  3FXM A;  3QYF A;  1H8E A;  4FT8 A;  1XGN A;  4OOV A;  1OFL A;  4KIG A;  5D6F A;  2VT3 A;  2L7K A;  4BY7 J;  2KP6 A;  5ICC A;  2VBU A;  2C4U A;  2F1L A;  4A2U A;  2FE3 A;  3REO A;  3CDL A;  3K10 A;  3ASN H;  4URR A;  5F4O A;  5J40 A;  5KVR A;  3TDU C;  2DY1 A;  2OCE A;  4MYT A;  4RB1 A;  2BXY A;  2OC6 A;  5CVJ A;  4P3I A;  5LHI A;  1ZQ3 P;  4UB6 C;  3IWF A;  3OKX A;  3WND A;  1P4A A;  3BR1 A;  2IQ7 A;  5LGU A;  4A6E A;  2EIL H;  4F93 B;  2Z16 A;  4BHC A;  3BH6 B;  4U0V A;  2QM3 A;  4KMF A;  4B3G A;  2OV7 A;  2RC6 A;  3JR9 A;  2V7X A;  2QVO A;  4LLG F;  5HXB A;  4ON0 A;  4YII A;  3BG9 A;  1X2N A;  4AVZ A;  3Q5F A;  3B78 A;  1BW6 A;  3U1K A;  4IW3 B;  5HDN A;  1WFX A;  3PEN A;  1LE8 A;  5DCM B;  4HLX A;  1F9N A;  3AFH A;  1QFJ A;  2NVT J;  4M9X A;  4GYG A;  2O8K A;  4E7K A;  1YIT I;  2BGC A;  2QX3 A;  1H89 C;  4FET A;  3NAU A;  2CGP A;  2BM4 A;  2XTX A;  2GBY A;  3V8K A;  4XQF A;  2WB1 N;  3DPL C;  1YRN B;  1ETV A;  3AG1 H;  3GXO A;  2XGX A;  1MNM C;  5IYW A;  1FNN A;  2CV1 A;  2FNP A;  4OOI A;  3FPK A;  4C0S A;  4P25 A;  1RU4 A;  4BJT A;  1OGM X;  4KA4 A;  2VJJ A;  2V4J C;  5HOO A;  1N08 A;  1FIA A;  1O8L A;  3H94 A;  2X1C A;  2EIJ H;  3SJZ A;  2GIZ A;  1ETQ A;  1IJE A;  3BCB A;  3IP4 B;  3U2R A;  3BZC A;  2VPR A;  5KSW B;  3L2V A;  1T6Z A;  1WJE A;  3KX2 A;  4AID A;  4X06 A;  2MLK A;  2G7U A;  5B1B H;  4BU2 A;  4BQA A;  2B63 J;  3AST A;  5J3O A;  1VQ4 I;  2VFQ A;  1ULY A;  2WJY A;  1NHC A;  1EA0 A;  1ETW A;  3K2A A;  1HBX G;  4XRM A;  2R7U A;  3HDD A;  3SFZ A;  3HSR A;  4ZV4 A;  1QVU A;  1R58 A;  3HB9 A;  2PQ8 A;  3OSG A;  1YW8 A;  1IAW A;  3KEO A;  4OIN F;  1TQP A;  4YFX F;  2VFN A;  5LLQ A;  4ZTF A;  3VYU B;  2EWN A;  4X1E A;  2HGC A;  4RLZ A;  1K4S A;  5FO1 A;  2XOK A;  4ZYH A;  1HKS A;  1MKM A;  5HDK A;  2E1C A;  4WXH A;  4E7L A;  4XM3 A;  5D4S A;  2IVM A;  3PNV A;  2VFO A;  3SKB A;  1QBJ A;  4LIU A;  1Y0N A;  3WBK A;  3ONQ A;  3HRU A;  1SD4 A;  5ILU A;  1IDJ A;  1SAU A;  3H9J A;  2X1E A;  1QH0 A;  3S3O A;  1UAA A;  1E2X A;  1Y1V J;  1W9X A;  2CS3 A;  5K5O A;  1D1B A;  2GXG A;  4D5C A;  1B2R A;  4ZCM A;  1QVF B;  3QRF F;  2W85 A;  4DW6 A;  4QV2 A;  2MA3 A;  3K1N A;  3PNY A;  4OWR B;  4NUB A;  1IZ1 A;  2R7R A;  1Z67 A;  2XT4 A;  4YRV A;  3G1O A;  2DJN A;  4PJ0 C;  3BH4 A;  1NTC A;  1H9T A;  3ZCO A;  4GDF A;  4NC7 A;  2DXI A;  4XKB A;  4BQO A;  4NHJ A;  4IXA A;  3OYF A;  3OYI A;  3SZE A;  1G6N A;  4LLN A;  2QEX B;  3BZK A;  2WTE A;  3GFL A;  1AMO A;  4PMH A;  1Q1H A;  3IAM 2;  2HXO A;  3CES A;  3HEF A;  3P9K A;  4LG0 B;  1UD8 A;  2KJB A;  3HYI A;  1T39 A;  3F22 A;  2HDN B;  1IDK A;  2PJP A;  3OYB A;  5IYP A;  2CFO A;  1KYW A;  1CNF A;  1RQP A;  1EFT A;  1NK3 P;  2OTJ I;  2Z8G A;  5F0H A;  5ILV A;  5HNH A;  3FIW A;  3Q6R A;  3Q0U A;  4JOM A;  1H9G A;  3HRM A;  1XSX A;  1H0M A;  4TT3 A;  5IYR A;  1O8G A;  1OYI A;  3TP3 A;  3GTM J;  4Z4V A;  1PUF A;  2EFG A;  2QA4 I;  1KA8 A;  1TWH J;  5JVT A;  4YAO A;  4BS9 A;  2E1N A;  2JRM A;  3VMV A;  2PE3 A;  2Q2E B;  2LFB A;  1BX1 A;  1MAB A;  4MXN A;  4OJP A;  1FP1 D;  1VHE A;  1D8J A;  3ZXS A;  2JK3 A;  4F52 A;  4C2T A;  3ELK A;  1IUF A;  3G1M A;  3LWF A;  2JJ7 A;  4XIC A;  1S7A A;  2L9V A;  1E63 A;  1W34 A;  1WMR A;  4BHP A;  1ZUN B;  2F4I A;  3J81 k;  3GQA A;  2OK7 A;  2BX6 A;  4RGX A;  2P3M A;  2E1R A;  1FEX A;  3J7Z I;  1L3L A;  1P2F A;  1XGO A;  1Z91 A;  2ZJR F;  5M3F J;  5E3M A;  4MEX F;  1A31 A;  4N3G A;  4RD6 A;  5BOX A;  2NSP A;  2HKO A;  1YW7 A;  2CWE A;  5JR3 A;  1S72 B;  2TRT A;  2HZD A;  2OZ6 A;  2XUB A;  3TW6 A;  5GV7 A;  3A8J A;  4WWV A;  1N77 A;  3W6V A;  3PJR A;  3GQB A;  2PMZ N;  2VL8 A;  2K9M A;  3QFT A;  1JRG A;  2YWG A;  4AWX B;  1H8A C;  4P22 A;  2CRV A;  4FE4 A;  4M0L A;  2XKP A;  1W7P A;  1IC8 A;  4BDZ A;  1W4M A; 
#chains in the Genus database with same CATH homology
 1E0E A;  2ZTG A;  2JVG A;  1X4O A;  3CF2 A;  1YE9 A;  3SDB A;  5CQG A;  2Q1Z B;  2ZZG A;  2D3L A;  2GOX B;  4B48 A;  3K4C A;  2VBK A;  4U4B A;  4JMQ A;  1O8F A;  3SZG A;  2Z1D A;  3L2R A;  5AMV A;  3IAS 2;  2WZP P;  1TZL A;  2MAB A;  3W2A A;  2O5R A;  5CPR B;  1PXZ A;  2HLD A;  3C2G A;  4G6I A;  2KRC A;  2HDW A;  1BLI A;  3S3M A;  2I8D A;  3U21 A;  2GJP A;  4OAZ A;  4CH7 A;  4ZDO A;  2M0M A;  3H5A A;  1X1A A;  3T53 B;  3PUB A;  2IS1 A;  4F3Q A;  1I18 A;  4W8T A;  1QHG A;  4DGW B;  4HIZ A;  4E7S A;  1T0F C;  1VJS A;  3E0J B;  2GK6 A;  2X53 S;  2O0V A;  2X1D A;  2HU9 A;  5FRN A;  3BC9 A;  2BVL A;  1H80 A;  3RCO A;  1O8H A;  4W8Q A;  4KKU A;  4XD7 A;  2R9V A;  3W2V A;  3OS0 A;  5KHD A;  2XZP A;  3ZPP A;  2DJI A;  4KKS A;  4U49 A;  3K70 C;  4XOP A;  2D3N A;  4H4K C;  2V31 A;  2JDI A;  2XZL A;  1KMH A;  2RNG A;  3A4C A;  1O8J A;  3OWT A;  3OMY A;  1OOC A;  1QU3 A;  3TBI A;  1RMG A;  2IGO A;  2INV A;  3CJQ B;  4C2U A;  2VQG A;  1O8D A;  3FHN A;  3QYE A;  1KTW A;  3VSK A;  1Y56 A;  2XDV A;  3LNN A;  2L9S A;  3B8Y A;  1K6Y A;  2LYC A;  1QCX A;  4RLF A;  4HRI A;  2ZZE A;  1W36 C;  4MLO A;  3E1S A;  3RQ4 A;  4UZU A;  1DBG A;  1V5G A;  2DT7 B;  4B44 A;  1V5E A;  2R4G A;  3K4L A;  4E6K G;  4E0F A;  4BUP A;  3HPH A;  4XLH A;  4CA0 A;  2LZJ A;  3CZ6 A;  3HOT A;  3GQ8 A;  4OJO A;  1MND A;  4LIT A;  2QXZ A;  4BEH A;  2IS6 A;  1UD5 A;  4J01 A;  3JU4 A;  2LBF A;  2LRD A;  4NC8 A;  3EPZ A;  2NT9 A;  2ODL A;  4CCJ A;  2GK7 A;  2WPD A;  2BOL A;  2Z2S B;  2KDO A;  2VPL A;  1YX3 A;  4QPQ A;  1D0X A;  4EAT A;  2M7A A;  4KIS A;  4Z03 A;  3LMM A;  2CW7 A;  2F6C A;  2LY1 A;  3I3L A;  4G7W A;  2WY7 Q;  1XG2 A;  2CUZ A;  3OYJ A;  3K6G A;  4DNR B;  4XN3 A;  2DCE A;  2LRE A;  2X6Y A;  4Y33 A;  3VYS B;  3OEE A;  3GBG A;  3DU6 A;  4G6T B;  4HG2 A;  3HL2 A;  3N05 A;  1T5E A;  3KEW A;  3DWL E;  1MW7 A;  4TSF A;  3OYK A;  4E7Z A;  3OYL A;  3FBN B;  4Z1M A;  2MD0 A;  2O1D A;  5LD2 C;  2Z6B D;  4C9Y A;  4MR0 A;  4HEA 2;  2JVH A;  1VF7 A;  1LFP A;  5FRM A;  4XLE A;  2GJR A;  4KKT A;  2M7B A;  4B43 A;  4CCO A;  3ZQQ A;  2PMZ A;  4HNT A;  2MYS A;  2VQH A;  3CJR B;  1DP3 A;  2UUZ A;  4XNF A;  2WAD A;  2FUG 2;  3A2K A;  4C2L A;  2WY8 Q;  2CMP A;  2V7F A;  2E1M C;  4XOR A;  3RPU D;  2WAE A;  3OL3 A;  3HUG B;  2IS4 A;  3B90 A;  2ZZF A;  3VYR B;  2ZSI B;  3W2W A;  3OE7 A;  2W82 A;  4EW9 A;  5FRO A;  3LSK A;  1WJC A;  1W0K A;  1OB0 A;  5HKK A;  2OUM A;  3HC7 A;  2IGK A;  1BR1 A;  1D1C A;  1ERD A;  1AA7 A;  2JJ2 A;  3WQZ A;  1OGO X;  3PL8 A;  4C30 A;  3BLY A;  1Z3X A;  4FXU A;  1E43 A;  1UD2 A;  1LVK A;  1WP6 A;  1N78 A;  1O8K A;  2XF7 A;  3MD2 A;  2VJ5 A;  3DLA A;  1FMW A;  2W6J A;  4XOT A;  3AL0 C;  3J7A Y;  1D0Z A;  3S8P A;  1O8M A;  2E5N A;  2X8K A;  3RTR A;  3K4M A;  1EFR A;  1BR2 A;  2BW3 B;  2KRH A;  2CK3 A;  1D1A A;  3DU5 A;  4CZC A;  4PFO A;  3BCF A;  5TGT A;  1IRX A;  3NE5 B;  4D9J A;  2VLA A;  3UR3 C;  3UW0 A;  3FY3 A;  4YZ0 A;  1NBM A;  2ZSH B;  3M8J A;  4DK1 A;  2IXS A;  1BMF A;  4XLA A;  2W7N A;  4NK6 A;  4ZDP A;  1RWR A;  3HKZ A;  3OL4 A;  2L2O A;  4XR6 A;  2HPM A;  1PJR A;  3GVL A;  3UNG C;  4BE0 A;  1QJV A;  4Y4R A;  4RMN A;  4P1W A;  2V26 A;  2W1O A;  1QHH D;  1FX0 A;  5FL7 A;  4D1Q A;  4N4O B;  4W8R A;  1BR4 A;  4PJJ A;  2A5W A;  1WJB A;  4NK8 A;  3LSG A;  1UEL B;  2R7W A;  5C1C A;  4NNJ A;  1WJ5 A;  2BVM A;  3M1C A;  4CCL A;  2WSS A;  1TT0 A;  4BJ6 C;  3G05 A;  1X19 A;  4YZA A;  2K5C A;  4OJ5 A;  2KQR A;  4IZZ A;  2R7S A;  4L8J A;  3GRH A;  3PNT A;  4CCN A;  4B3F X;  2V7Q A;  3NWT A;  1K28 D;  1DBO A;  3BC8 A;  1R6R A;  4IQ4 A;  4KJZ A;  2JSP A;  3D5L A;  4GQN A;  2VB6 A;  2WJV A;  2VBM A;  2VBE A;  2Y0S A;  2KHM A;  4BJ5 C;  4ITV A;  3CP8 A;  2W4S A;  5LFA A;  3OW7 A;  1KCC A;  2K9L A;  1COW A;  2E1M B;  4PK4 A;  3I9V 2;  1T95 A;  3DPT A;  3T9G A;  1E1R A;  3VSL A;  3FKJ A;  3KYL A;  3OR2 C;  1E3X A;  2W6I A;  1HG8 A;  2VJ4 A;  3EUK L;  1WJF A;  3OPO A;  3H35 A;  3DKY A;  3K4K A;  4GRI A;  1BN8 A;  4Z06 A;  2E5Z A;  2DIE A;  4DBR A;  1OHH A;  4BE2 A;  5CDF A;  3A35 A;  4HST A;  2E1B A;  4KIT B;  4BAC A;  2O04 A;  4YXW A;  3K4B A;  4R79 A;  2KMU A;  4DK0 A;  4Z05 A;  4X0G A;  3DTI A;  3S3N A;  4BL0 B;  3GVK A;  5HNF A;  4RLQ A;  5C1E A;  2VIX A;  2VXD A;  1SKY B;  4JQF A;  2DT6 A;  1WTH D;  2M4K A;  2F1M A;  2VKD A;  4OAY A;  1CZF A;  1UG0 A;  4F91 B;  4NQW B;  4HNU A;  2XND A;  2F5V A;  3DDY A;  4HPQ A;  4BXF A;  4BGD A;  1X1B A;  1DGR M;  1EA3 A;  2ZXI A;  2HVQ A;  3CMM A;  3QOE A;  1HA8 A;  3B4N A;  2XAU A;  2KL4 A;  3FPP A;  2VKH A;  3DEE A;  2NTQ A;  5DN6 A;  3L2U A;  3FKS A;  4PSW A;  1X1D A;  1MNE A;  2NTB A;  2KVO A;  2LY2 A;  4LIV A;  1G8X A;  3CP2 A;  3SUC A;  3C2H A;  2HVS A;  4DJA A;  4DOZ A;  4E4H A;  1OLT A;  4LG3 A;  3SYT A;  3ZIA A;  3MKY B;  1SFK A;  2RQQ A;  3OYC A;  3EUA A;  4CCK A;  3H9G A;  4CUG A;  4ZTJ A;  2X51 A;  1HVX A;  3S32 A;  4B47 A;  1VBL A;  1V0F A;  3FBI B;  1WPC A;  2VXZ A;  3BCD A;  4BQQ A;  3VSV A;  2R7X A;  2KZV A;  2PJR A;  2M5S A;  3K70 D;  2LOO A;  2PEC A;  3ZRG A;  4E7H A;  1GQ8 A;  4II3 A;  1EE6 A;  1MMN A;  4BEH B;  4DIQ A;  3A1Y A;  2A6T A;  3MMY B;  3PFY A;  2CH0 A;  1BHE A;  3WWG A;  3OYM A;  4U7B A;  1LDK B;  3OYG A;  2JJ1 A;  3BG6 A;  2LBF B;  1H8E A;  1WJA A;  2CW8 A;  3BCA A;  1MMA A;  2P0W A;  3QYF A;  4J00 A;  3NWS A;  4G7X A;  3GQ7 A;  2M4G A;  4XKV A;  1OFL A;  2VAS A;  4YEJ A;  2L7K A;  4PJN A;  4BE1 A;  2R7T A;  4DNT B;  2KP6 A;  4YZX A;  2WAF A;  2VQL A;  4PJM A;  3HPG A;  3K10 A;  4II2 A;  1YX5 A;  2X3H A;  1W36 D;  4URR A;  2X6X A;  2AQF A;  4PFP A;  1PLU A;  2IGN A;  2OC6 A;  4RM3 A;  1J09 A;  3PSI A;  4XON A;  1X4P A;  2JIZ A;  4QPO A;  3GVJ A;  3ZPN A;  4OZY A;  2IQ7 A;  2NZM A;  4F93 B;  2Z16 A;  5CQE A;  3DQV C;  1E3Z A;  3OEH A;  4B3G A;  2OV7 A;  3OS1 A;  2NOJ B;  3DKX A;  3TL4 X;  5JHF A;  2XF6 A;  4AVZ A;  1WFX A;  1S9H A;  4B3X A;  2XF5 A;  3OS2 A;  1O8E A;  3ZSC A;  3BG7 A;  1V0E A;  3AFH A;  3IUO A;  1I8D A;  4E7K A;  3TMO A;  3AKZ A;  3HAG A;  5HVQ C;  3OOC A;  4KT6 A;  2QX3 A;  2PJR B;  4FET A;  1KZL A;  1MMG A;  1K5C A;  4XQF A;  2CV0 A;  3DPL C;  2W00 A;  2CV2 A;  2L9N A;  1O88 A;  3JUR A;  3OYD A;  4HSR A;  2CV1 A;  2V6E A;  1H8H A;  1PE9 A;  2QY1 A;  3LMW A;  1RU4 A;  1N75 A;  1VZ0 A;  4BJT A;  1OGM X;  2VJJ A;  2V4J C;  2KLO A;  3FDY A;  5HOO A;  3OYH A;  3H5N A;  3L2Q A;  1O8L A;  3VSU A;  3LSI A;  3H94 A;  2X1C A;  4ZDL A;  4F92 B;  1DQU A;  3KRG A;  2NTP A;  3BCB A;  3IP4 B;  3L2V A;  1X0C A;  1WJE A;  3KX2 A;  2HNH A;  3OYE A;  2R7O A;  2ZXH A;  4BU2 A;  4I84 A;  1NHC A;  3VYT B;  4W8S A;  2WJY A;  1AIR A;  3SEQ A;  2UVE A;  2R7U A;  4CCM A;  3H0D A;  1UD6 A;  4ZYA A;  4IQJ A;  2XSJ C;  3T51 B;  4OZZ A;  3HXL A;  4OJL A;  2KPM A;  1PYV A;  3OOU A;  3T56 B;  3F9K A;  3EUH C;  2X85 A;  4RM2 A;  1PKV A;  4N4N B;  4F55 A;  4CSW A;  2VQC A;  3LSH A;  3EQN A;  4ZTF A;  3VYU B;  4XKW A;  3VMW A;  2ZTN A;  2XOK A;  2E60 A;  4E7I A;  2QE7 A;  1P9Q C;  2O17 A;  4E7L A;  2IGM A;  2INU A;  4XM3 A;  4BDY A;  3A3B A;  5KNL A;  2WAQ A;  1E1Q A;  1OR7 C;  3PNV A;  2R7V A;  1KCD A;  4LIU A;  4YEL A;  3H9Q A;  2LH9 A;  3ONQ A;  2ZFU A;  3A3G A;  2GOM A;  2F43 A;  1IDJ A;  4HWV A;  1BPL A;  1SAU A;  2CUJ A;  2JUG A;  2MC4 A;  3H9J A;  3SEZ A;  1IB4 A;  2X1E A;  3S3O A;  1UAA A;  1W9X A;  1BOB A;  4PUS A;  2CS3 A;  1D1B A;  3G2B A;  1D0Y A;  1W0J A;  4BQN A;  1NRK A;  3LL7 A;  3LSM A;  4U87 A;  2AQE A;  3PNY A;  4OWR B;  4PSX A;  3AL0 B;  3RSN A;  1FMV A;  4NUB A;  4ASU A;  2R7R A;  2ZZQ A;  4XL9 A;  4YRV A;  1UD4 A;  1UD3 A;  3VR6 A;  3BH4 A;  3MKW B;  3PSF A;  1Z21 A;  2BSP A;  3LFU A;  3ZCO A;  4NC7 A;  2DXI A;  1KON A;  1DGW Y;  4XKB A;  2QKL B;  4XKC A;  4BQO A;  4XN0 A;  2UWM A;  3OYF A;  3OYI A;  3OFN A;  2WA0 A;  3ZR8 X;  3EQO A;  3HOS A;  3OIQ A;  3L2W A;  1LKX A;  2MFZ A;  3VWB A;  3OY9 A;  4PMH A;  3VDX A;  2XGJ A;  3IAM 2;  3CES A;  3OIP A;  1UD8 A;  4Y3O A;  2M3A A;  3OYN A;  2PYH A;  1IA5 A;  1HZE A;  3VST A;  1IDK A;  3HG9 A;  4AU7 A;  4ZC3 A;  3DTE A;  2XC7 A;  3OYB A;  3K4J A;  2IS2 A;  2CFO A;  4PJL A;  5CKT A;  1VLY A;  5IK2 A;  4DBQ A;  3W3C A;  1OFM A;  5KCM A;  1X1C A;  2Z8G A;  1NG7 A;  4IKF A;  5HNH A;  2VJI A;  1WJD A;  1ZEL A;  1E79 A;  4JOM A;  2HPI A;  1O8G A;  2O0W A;  4TT3 A;  2V1N A;  4E7J A;  2V4D A;  3DPU A;  1Y6I A;  1V5F A;  3D5S C;  1O8I A;  4OJ6 A;  2HVR A;  2JA2 A;  2LC2 A;  5HLT A;  4BS9 A;  2L5Q A;  2QKM B;  2PYG A;  2RRE A;  3VMV A;  2HQA A;  3H5R A;  4XMY A;  2XZO A;  2Q2E B;  3K4N A;  3MKZ A;  1MAB A;  4MXN A;  4OJP A;  2NST A;  2BW3 A;  1Z7L A;  3ZXS A;  2DOA A;  1MMD A;  2ELJ A;  4F52 A;  2V9K A;  4C2T A;  1JI8 A;  3OAA A;  2EWE A;  1WMR A;  1NG6 A;  3ZGK A;  3GQA A;  2F4I A;  3V42 A;  4FAS D;  1JTA A;  2UVF A;  3DTK A;  2R7Q A;  3KEY A;  3QYB A;  3D5R C;  2NSP A;  1Z3Y A;  2LG4 A;  1GLN A;  2WB1 A;  2UV1 A;  1G59 A;  4XLF A;  2HZD A;  2GJK A;  2NT6 A;  4P5O A;  4TKO B;  4XLC A;  3S93 A;  1N77 A;  3OYA A;  3GQ9 A;  3PJR A;  3OR1 C;  3QOD A;  2X6W A;  3GQB A;  2VL8 A;  2K9M A;  4ZJZ A;  1JRG A;  4IX7 A;  4YZQ A;  4P22 A;  4AYB A;  2WBM A;  2K3P A;  4BDZ A;  1U0J A;  4ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...