2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
4XLCA 3GQ9A 1BHEA 1CZFA 1QCXA 5AMVA 4XKWA 2IQ7A 4YZQA 2NT6A 4XNFA 4YEJA 4XM3A 2QXZA 4NK8A 2VBKA 1O8JA 4XKVA 3ZSCA 1IB4A 2O0VA 2O04A 2EWEA 1X0CA 1O8EA 4W8RA 3SUCA 1RU4A 1JTAA 2NTBA 2NSTA 1JRGA 2X6YA 4MXNA 1O8HA 1XG2A 1OFLA 4OJ5A 1IDKA 4XN3A 2NTQA 2QX3A 4XMYA 3GQ8A 4XLHA 2VBEA 3VMVA 4OJLA 1IA5A 1O8GA 2X3HA 4OZYA 4OJ6A 2O1DA 1BN8A 2PYGA 2X6WA 3GRHA 1O8LA 2BSPA 2UVEA 2PECA 4C2LA 1GQ8A 1O88A 3FY3A 1H80A 2X6XA 4OJPA 4XLEA 4U4BA 1RWRA 4YZ0A 4XONA 2Z8GA 1AIRA 1EE6A 1KCDA 4XR6A 2VBMA 4YELA 3LMWA 2UVFA 4OJOA 4XL9A 2INUA 3VMWA 4XORA 4Z05A 2VJJA 4XOTA 2ODLA 3KRGA 4PMHA 3GQAA 4YZXA 1DBGA 3VSUA 4Z03A 1KCCA 2NSPA 1RMGA 1IDJA 2O17A 4Z06A 1PE9A 2INVA 1O8DA 4YZAA 4U49A 4W8TA 4EW9A 3WWGA 5C1CA 1OGOX 1O8KA 3UW0A 1WMRA 4AVZA 4MR0A 3B90A 4W8QA 2NZMA 3GQ7A 4URRA 3EQOA 4OZZA 1HG8A 2VJIA 2PYHA 3ZPPA 5C1EA 3B4NA 4I84A 1O8IA 1PLUA 1QJVA 1OOCA 2O0WA 4W8SA 1NHCA 4XN0A 1O8FA 2QY1A 1O8MA 1PXZA 4NK6A 4XOPA 4XQFA 1KTWA 1VBLA 1DBOA 1OGMX 3B8YA 4XLFA 3VSTA 1K5CA 2NTPA 4HWVA 1OFMA 3JURA 4XLAA 3T9GA 2X85A 2NT9A 3EQNA 3VSVA
chains in the Genus database with same CATH superfamily
4ZDOA 3U1KA 3KYDB 1QA6A 1FDRA 5F4MA 4KIBA 1OB0A 3CP8A 5DDGA 1TWCJ 1I5ZA 3NWTA 4P9UA 2E19A 4FE7A 1QGAA 4RMNA 1WI3A 3OYLA 3W5VA 3OIQA 3ELKA 3SEQA 1BI0A 3I5UA 3R60A 1VFCA 4L5IA 2CS3A 1JE8A 3WNBA 1SEUA 4OPOA 3JSPA 1VF7A 5J40A 5B66C 2VUMJ 1JTYA 1EA0A 2HOTA 4CH7A 4M73A 3JRGA 4P3YA 2CO5A 3K4KA 4Q48A 2XF5A 4U0YA 4RB1A 3M3YJ 1I39A 1K4ZA 3JRFA 1YLOA 1TYUA 2RC6A 4ZCIA 2LTPA 2V9PA 4BBSJ 3BPVA 2Z2SB 3HYIA 1E3ZA 3JW4A 2PYGA 3JSOA 2JN9A 3KYCB 2JQ7A 5BOXA 2WY8Q 3W6JB 1ZAOA 4C2LA 3BCFA 4HQMA 1STZA 5KSWB 4DBRA 2JRMA 1R9TJ 1LQ1A 1Y8RB 3BQYA 5BMZA 2F5EA 1G6NA 4F92B 2Z8GA 3LSTA 1VQ8I 4S04A 2BBYA 3WTSC 3DDYA 4TMTA 3J81Z 2NS7A 2FU4A 5J1UA 3H3VK 3P9CA 4LBWA 1RKTA 2M0CA 2B0LA 4XORA 1OKRA 1X1DA 1I6HJ 5IYNA 4V2GA 1MGTA 1N0VC 1MMDA 2GIVA 5DYMA 4PMHA 3DPTA 3S16J 1VF9A 2HYGD 2P5KA 3ABKH 3I58A 3OAAA 3OV8A 2BY2A 3HZJA 1P4AA 2JJ7A 2M5SA 1B23P 2NSPA 1JJ8C 2DQRA 1ZG5A 2QBYB 3TP0A 1VQPB 3ERMA 2GXGA 2D45A 2Q2EA 4AYBN 5CLSA 3FXLA 3RI4A 1E1QA 1N8RD 3SY2A 4JX6A 2XGDA 1FBSA 2CW7A 3HBLA 3WWGA 2ZJPF 1ZM4A 3HSEA 2W4SA 3BTIA 3U6BA 1XCVA 2HDWA 2V9KA 1IN4A 2R7SA 1D0YA 1DPUA 1L1IA 3HIFA 1U5TC 3B73A 1VQLI 3LQRA 5E79C 1A04A 1U3EM 3ZMZA 4QUZA 2ID6A 2DIEA 3PIOF 2ZZFA 2HNHA 4ROXA 4RM3A 3ZUGA 3IAM2 5GPAA 4KICA 4WQMA 1OGIA 1PP7U 3O6BB 4EJVA 3JRAA 3CPWB 3WBKA 5J1YA 4FX0A 2FVGA 1BR4A 1OFCX 4EMSA 1B8IB 2P6TA 4LBVA 3CUOA 1R5NA 4L9VA 1ZARA 1FRQA 1UD8A 5K5OA 1Y56A 4OOSA 3HOWJ 4ACAA 3QPLA 2DO7A 2QMUA 3DU5A 3E6DA 3OMYA 1O8MA 1N75A 1VI0A 2QQAA 1DARA 3OZWA 4N4OB 4BHBA 5M3FJ 4X7DA 1G3YA 2Z1DA 1HW2A 3P27A 1DBOA 3DPLC 2GM4A 3GTGJ 2ZZEA 1IAWA 2VB6A 2NVYJ 4BBRJ 3DLLF 3DFGA 3N97A 2ZJQF 3BNWA 3JURA 2V7FA 1A8PA 2VBZA 3ZXSA 4CSWA 4E70A 4DBQA 2H8RA 1JB9A 3ONUA 2L7FP 5BSYA 1RESA 2GIZA 2CWEA 2DMTA 2QN6A 2WPDA 2XGJA 2FBKA 2DMNA 3CC7B 2DPDA 4XM3A 1Z0XA 2VJ5A 1MJAA 4BU2A 3HTSB 3BWGA 1YHQI 5EZHA 2P6SA 4EEFG 1N78A 4KH3A 1A6IA 3FKIJ 1D5YA 3CO7C 1ZGWA 4PZJA 5J8CA 5E3OA 2OBPA 2XPWA 3MCAA 1ORKA 3VOEA 4AU7A 4BAYA 2V7QA 3W2AA 2DCUA 2XB0X 4OJ5A 3VO2A 2FUG2 3CDIA 1Y0NA 2RC4A 3BTCA 5FJ8J 3Q6QA 1SD6A 4XMYA 3VPRA 3ABUA 1ZG1A 1FMWA 2YWHA 3A8IA 3BH6B 2RN7A 3QWLA 1POGA 2JVHA 3OSFA 1G7RA 3VO1A 4IL6C 4YFXF 4IHSA 1ONVA 1EF4A 3HOTA 4F7ZA 1MSEC 2E2HJ 2HOSA 1U2WA 3V7AA 1GQ8A 1B72B 3K6GA 2X48A 2MG4A 3LA3A 2JA5J 5IY5H 2XF6A 4N9IA 1FOXA 2R6HA 2MGQA 3J7YJ 1DUXC 1UD2A 2ELHA 2EFWA 1JKQC 1MMGA 1ZR2A 1SKYB 2X3UA 4Y7CA 2O9LA 3PQKA 2ZMEB 1J75A 2XKOA 4KFCA 2WWYA 1JGSA 2M34A 2IGOA 1YFHA 3L2RA 2DMUA 1YRNA 2YU9J 4IHYA 2F43A 1IG7A 3HHGA 2D9RA 3W2EA 3JRCA 2JT1A 2A6HF 2W00A 3MKYB 1S7EA 3GVJA 1HCRA 2DN0A 2XUBA 3UR3C 2XVCA 5FLXZ 3CD6I 2JRTA 4YZAA 2BY3A 2DODA 3GVKA 4G7HF 4L0YB 1D0XA 2FRHA 3ASPA 4M2LA 3F9KA 2R7RA 1R5GA 3DBLB 4ENJA 1FNBA 4N0BA 2RKHA 2NS0A 3B90A 2Y48A 3BT9A 3SQNA 4D0PA 1KRHA 2PBIA 2W7NA 2D3LA 3C1DA 1HG8A 1OFDA 2YSRA 3RDIA 2F5CA 1K79A 3KL9A 3MKWB 4B44A 2RNGA 1SFXA 4MFDA 5HS7A 2EV5A 2JJ2A 3G6EI 2EH3A 4L18B 2XGXA 3ASTA 4XD7A 1VQ8B 1FY7A 4HF2A 2PMZA 2GA1A 2UZKA 4DNRB 2AXLA 1F43A 3WY9A 1T6ZA 1PVEA 4RAZA 4OINF 1TP4A 3NAUA 1H88C 1AA7A 2Y0SA 2IS2A 5IYPA 2DA5A 5EJCA 3ZMUA 2Y69H 1OFEA 2FOKA 2E2IJ 2PJPA 1UMQA 4S0HB 1MH4A 1K5CA 4Y9UA 2Z16A 1YJNI 5ICEA 2VC0A 1XSXA 5LLQA 1VQ4I 3S15J 2BN4A 3T9GA 1FWZA 3E5XA 3K2ZA 4RBOA 2K40A 5DSZA 2QEXB 2OTLB 1MZBA 2VL8A 4YAOA 3GQ9A 3VSVA 3A0HC 1W1WE 4FK8A 2MLGA 1AU7A 2JJ1A 1CZFA 3ZZ0A 3WGGA 2OBRA 1G2HA 2EINH 3SFZA 1KJZA 4LD5A 3B78A 2D1VA 5LMZA 2JK3A 3LQ6A 4P55A 1O8EA 2XT4A 2LBFA 1JHHA 2JA7J 1J0RA 1ETWA 4KT6A 3ZMVA 4GGGA 1ETXA 5IYCJ 2H27A 3GTQJ 2K4BA 1QRCA 4LMYA 2KZGA 5LHHA 4IEJA 1Y0UA 5EEHA 2OTJI 1JJ6C 4G94A 1K7AA 3BG7A 3R6JA 3OYAA 2VOPA 2OZUA 4UZEA 2CQKA 3OIPA 2E1MC 1GJRA 1KQ9A 1MD0A 3FPPA 2VFPA 2X1CA 3CPXA 2R9VA 4G7XA 4BJTA 2HPMA 2EA4A 3PO2J 4EM2A 3WTTC 2VQGA 3Q3AA 3CCMB 3VYUB 2IGNA 1WOOA 4P3IA 2O8KA 1X2NA 2V5IA 2VFNA 3WTVC 3GBGA 1W36D 4DW6A 4ZC3A 5HLTA 3CJTB 1Z3YA 3JRHA 3SYTA 2D5VA 2ICWG 1TSPA 1S29A 4OWRB 2XRNA 2M5WA 3OYIA 1JT0A 2QTLA 2MH2A 2XB5A 1YJWI 2QTZA 3BC9A 4Z4UA 1AIRA 3E0JB 1KQ5A 3T0YA 2XC7A 1K73D 4XL9A 1JJ2B 1BMFA 2FSWA 2ODLA 3DPUA 1V5VA 1K28D 2F1MA 3LSJA 5J6XA 1T39A 2R5ZA 2H1KA 5FKKA 1EFCA 1CLWA 4P22A 1KQ0A 2LY9A 1S7AA 2ELKA 3CLOA 1ZYRF 4L9TA 2V79A 3CMEB 2PQ8A 5DNSA 2GK6A 2LOOA 5CVUA 2VE8A 1W9XA 4YXWA 4CQJA 4NDLA 2HEOA 3WTWC 1MNEA 3HXLA 4E0FA 1YYVA 2IGMA 4KKTA 4FETA 5D6EA 4OIQF 4FN5A 2LRDA 1S7OA 3DTKA 3TOBA 3ISXA 4A3DJ 4ENKA 2DTRA 3M7GA 2ZFWA 1Y1WJ 1BL0A 5JI6A 3R0AA 1EWYA 2F4OB 1QRYA 5TRDA 2XAQA 4L5JA 1JA1A 1F5TA 2PFBA 4IO9F 1WP6A 3SLNA 4UY8I 5BQTA 1PJ6A 3PM1A 1Z91A 1SMTA 1SMYF 4LITA 1W35A 2PYHA 4FHTA 4P5OA 3BCDA 1OLTA 2G7HA 3MHPA 2XZLA 4PUSA 1VQ7I 2OYNA 3B4NA 2ZKZA 5KK1A 2E5NA 4HEA2 2LREA 1MBKA 3V4GA 3AVUA 1XC5A 2MD0A 2Z3YA 3NAWA 2K4JA 1QZEA 3ZQFA 1IB0A 3V42A 1J7KA 2PMZN 2KFDA 1HKTA 2RVCA 3E20A 3BR3A 1PXZA 1YX3A 3CCYA 1I7PA 3R6SA 1F20A 2CF4A 1W0JA 2CQQA 1WJEA 4B3FX 2V4DA 3VYSB 3VSTA 3QAHA 3IRQA 4KKUA 2FD5A 3TW7A 2WZNA 5GADJ 3H5RA 2EFGA 3RPUA 4HE5A 3CCLI 3PO3J 4M53A 2WA0A 2EZHA 3O2PE 3CCEB 2E34A 1BA5A 4WF2A 4LB5A 4IF4A 2DFFA 4YZQA 1TTYA 4D7MA 4ZTJA 3CCRB 5L3DA 3LA2A 1Q1HA 2DOGA 2P5LC 1BPLA 2L01A 1IB4A 3P7NA 1X3WB 2EA2A 3NB2A 2FBHA 1QUEA 4U88A 3F8MA 2WV1A 4IJAA 3OJXA 2CUFA 1O57A 4D5CA 5B1BH 1W7PB 3ECOA 5H6QA 1BX1A 4MYUA 3PSZA 4S05A 3VYRB 3VNVA 5E18F 3AVYA 2LLKA 4LIUA 4CHUA 1E43A 1S4MA 3L2VA 5J3LA 4ZGNB 3HPGA 1OR7A 2L9RA 3L9FA 2ECBA 3QOEA 5JLWA 2GA2A 1QO0D 4M6YA 4YALA 3M9AA 4NBQA 1MABA 4C0SA 2VBEA 3VMVA 4M74A 2E35A 3H9QA 2ZXWH 1R23A 5BPIA 2IRFG 3S93A 1WPCA 2ZITA 1V55H 2Y31A 3OOUA 3FF5A 4HX4A 4II3A 4HLYA 3S14J 3VMFA 1B1BA 2ESNA 2BSPA 3F22A 1MMSA 2DA3A 3OYDA 3M1CA 4JP0A 1LE8B 2QGGA 3F72A 5JVGF 3KE2A 4NCNA 1USSA 3OS0A 1Y8QB 1H80A 4ON0A 3V8JA 1QQ1A 1E0EA 5JVTA 3OZVA 2K9MA 1BJZA 3BTJA 3IH4A 3MQ0A 1XDSA 4F3QA 3RPUD 1WJCA 2HOEA 1FZPB 3OW7A 4Y13A 1VHEA 5LRSA 2L7ZA 2JMWA 1QGPA 3R4KA 4B4DA 3TGNA 3LSHA 4X6AJ 1W34A 1KA8A 3CCSB 5J4VA 3RKQA 3BR0A 4HRIA 5LRRA 3G71I 2FMYA 2PEXA 3H9JA 3VDXA 4A3MJ 4Z4WA 5HS8A 1ZG3A 3ZCOA 1B59A 3J80K 1QG0A 1P6RA 4UZFA 4FX4A 4RD2A 1YJ9B 4PC7A 3O3KA 1QRBA 2P7CB 3GYHX 4CXFA 1T56A 4N3NA 5H59A 4I02A 4HX7A 5EEGA 4DK0A 3D5RC 1W5TA 5HLIA 1SFEA 1WPKA 5CVJA 4A0ZA 4JQFA 1ZK8A 3HKZN 4AIKA 1VQKI 3ZBTA 5D5XB 1YRNB 1Q81D 3OP1A 4JX5A 2UWMA 3W2WA 2ID3A 1XE1A 4WZEA 5HDGA 1ZH5A 3GWZA 4HYEA 2VIXA 3RIRA 1O3TA 1AHDP 5BSXA 4XK4A 2VYQA 2DFHA 1X1CA 2RV8A 1O8FA 4FTHA 2CUZA 1FSHA 3S3NA 1H8HA 2IT0A 2EZLA 3OR1C 3OKXA 1KC8D 1XGMA 3CMMA 1R58A 4CCOA 4Z6YA 4I6ZA 5F0CA 1XX5A 2DA1A 4Z4YA 4C3JJ 2DYIA 2AHQA 2DT7B 3BJAA 5H20A 1P7IA 1IN8A 5HXBA 2XSJC 1DG1G 5LD2C 1BM9A 3D0SA 1Z05A 3TO7A 5J1RA 3TO9A 3FPKA 4EQQA 2R0QC 3DKYA 3MKZA 4NQWB 2RQPA 1JXSA 3RIQA 3NARA 4LLGF 3QE2A 2XSDC 3A35A 3GQBA 3OPOA 2IQ7A 4KYWA 2XPUA 3LWFA 2O3FA 4Y33A 3I4MJ 4AD9A 4YEJA 2K27A 1SAUA 4ZJZA 1J9ZA 3CTAA 1O8JA 2O0VA 5E3NA 4MLOA 2I10A 4U0VA 4CUGA 2HGCA 3C2BA 5ILUA 1OPCA 3TDZC 1O3RA 2R7VA 1RU4A 2CRVA 5DM6F 4YIFA 5EMNA 4RGXA 3SZPA 1KQSB 2P3MA 1FJLA 3CCSI 2XDVA 2GJKA 3H09A 4BXFA 1LDDA 3ZOBA 3CB4A 2I5UA 4XN3A 4GO1A 1BIBA 4DIQA 4HSTA 3AVVA 3BG5A 2L4AA 2ELJA 3ERED 2PN6A 3FXMA 4LLLA 4ITVA 2JSPA 4DYRA 2KJBA 3BJOA 5IOYA 1AKHA 5KNLA 1G7SA 1OB5A 2C4TA 4LIVA 3LNNA 4OM9A 1S5LC 3WG7H 2R7OA 1KGSA 1V5FA 1IJFA 1OMIA 4H0EA 5AIPA 1SC7A 1HW5A 1R36A 1O88A 3MZ8A 2R5YB 4BHCA 4B47A 3VSKA 1TYXA 1ODDA 2V7XA 1T0FA 3AG4H 1OYWA 1UAAA 2BHYA 1N0UA 3E5UA 5EG0B 1X58A 3I64A 3ZRGA 3LSPA 3CO6C 1YO5C 5KHDA 2QKLB 2KZVA 3I55I 4E7KA 1N25A 2ZBKA 5HS9A 3FMSA 3CDHA 1Y6IA 4QFMA 3W2VA 1SFUA 3RYPA 1VQ5B 3S1MJ 1EFRA 1BJKA 5EYRA 2DETA 2X6OA 3V8KA 3FJOA 1WORA 1QUFA 4QIWN 4HF0A 3I4PA 1IN5A 2YX7A 1WZ2A 3P9IA 3IV5A 1R49A 2WAQN 3FXUA 4PK4A 4UZUA 3MEXA 1K83J 1COWA 1BIAA 2ADUA 2P5VA 2HVQA 3RQIA 1OB2A 3SXYA 3PUNA 1EXMA 1TYVA 3LYCA 5JHFA 1X4OA 5EGOB 4C2MJ 2HKOA 3KYLA 3HOYJ 1E3XA 1N07A 3FM3A 2VI6A 2ZO4A 2QYOA 4N9HA 1R5OA 2KVOA 2FNPA 2A69F 3C7JA 1FOKA 2QENA 4A3LJ 1WXRA 3U9GA 4BH9A 3BC8A 1KU9A 4BPRA 4I84A 4A6EA 4B4CA 3M4OJ 4Z1MA 2DU9A 4MYTA 3P5JA 1FYLA 2YU3A 4CYDA 1ZR4A 1H85A 3FDYA 2LFBA 5DEQA 3Q5FA 1KU2A 4FE4A 2R92J 3WYAA 1TNTA 4KJZA 3AFHA 3OYKA 3KP4A 2BV3A 1ZTRA 2X1EA 2NNYA 5FIUA 3L1PA 3FMRA 4DQ2A 2FQ3A 2O6GE 4XQFA 3JX8A 1B9MA 1PUFA 4I09A 4RCZA 1H8EA 1SVOA 1V54H 1KONA 5F6FA 4KT5C 1VQLB 3RYRA 2BXYA 4N3GA 3E6CC 4ACBA 1VZ0A 4EJWA 2IVMA 3TW6A 4OIOF 2IBDA 5FKMA 2OD5A 4XLCA 3TKYA 1YITI 1S6LA 1D3YA 5CJ9A 3SHFA 1ZRDA 5HDNA 2P0WA 3RKYA 3D5LA 4TT3A 5M5XJ 5FO5A 5IYBJ 3QSYA 1O4XA 1IN6A 2H1LA 4WCGA 3QPSA 2QXZA 4A2UA 1IUFA 4KMFA 3I53A 2R7XA 5A8AA 4RA2A 5KVRA 4PDKA 5ICFA 4HNVA 4JMQA 2HQRA 3SZTA 3HRTA 4MFEA 4E7JA 3JRBA 1K78B 4UNOA 1BOBA 2XRLA 1FIPA 3BG3A 1XGSA 2L7KA 3JQQA 4J01A 5THXA 4U0WA 2VBYA 2HDNB 5L3BA 3ZQ7A 5ERIA 2G9WA 1G3TA 2XAFA 3BR2A 3KETA 3BR5A 1O8GA 3MAJA 1E64A 1U8RA 2R7ZJ 3H92A 3K69A 2CV0A 3QU3A 4Q47A 3HUGB 3JTHA 4NBSA 1TWFJ 2M45A 3CCJI 1W0UA 2H09A 1IRXA 5JFRA 1UD4A 1CGPA 3G05A 2DERA 1YIJB 2LSOA 2VPRA 1UG2A 3R61A 2X6XA 4A3FJ 1WJDA 2Y9YA 2ZCWA 1VQ9I 1RRJA 1OYIA 1M1EB 3DXJF 2NPFA 4YELA 1R4MB 2L9SA 3BPXA 2WB1N 1BI2A 3DTEA 2OPTA 5K7FA 5DUIA 1CNFA 3O8GA 1KMHA 4A3IJ 1L3LA 4PJLA 3DU1X 1RC9A 4E7ZA 3ML3A 3F6VA 3CCRI 3F21A 1XSVA 1QA3A 3FK7A 3HRUA 1BN5A 2ZNZA 3S1RJ 3S8PA 1ELOA 3J7ZI 3OYFA 2R7QA 3P4GA 1MBEA 1MNDA 2H6CA 1ITYA 4DNTB 5JBQA 4M72A 3U21A 1OCZH 1I3AA 2NAZA 1UFMA 4P1WA 3SDBA 3TMOA 5LFAA 1BX0A 1D8JA 1VQKB 3PSSA 2QZ8A 3L7WA 3PNYA 2VBXA 2WYRA 2XT2A 1OQYA 4AVZA 1SFOJ 2VOOA 2JPBA 4TMZA 4E6KG 3KP6A 1FSEA 2L2OA 3GVAA 2L0KA 3WU2C 1IN7A 2BVMA 2GAUA 2FX3A 1LVKA 2LG4A 2AO9A 3F8CA 3OYMA 2FA5A 2I1LA 3ASQA 3DCFA 1FIAA 1OCRH 2KRCA 4BXUA 2NS8A 1VQNI 4I7HA 1QU3A 1QJVA 3ONQA 4XLPF 1IUYA 2GBYA 1YIJI 3GTPJ 1DDIA 5IP6A 1BI3A 3OFNA 2QBYA 1TWGJ 3MKLA 1WHUA 2NXNB 3F8NA 5FD6A 5IOZA 3J80Z 1GV5A 4U9UA 1Z77A 5FROA 2NV4A 2RREA 4XSXF 1JI8A 3TBIA 2NYXA 1DP3A 3I1FA 4ESFA 2O61A 1Z67A 3RPQA 2VKHA 1W2BB 1U0JA 1T0FC 2KIFA 1VNDA 2XV4S 4LG0A 1R6RA 3TO6A 2E1RA 3JQRA 2HI3A 5ILVA 5F4JA 5CQGA 5FKOA 2OQRA 3BLYA 2X85A 4RLFA 3IWZA 4JX4A 1LB2A 4XRSA 1ACIA 4EH1A 3QYEA 2NT9A 2O6WA 4WK8F 5L46A 2A07F 3CCLB 3GSIA 4KN7X 3CF5F 3LFKA 5B1AH 3MFKA 1BI1A 4G6QA 2P7VB 3BH7B 5CVVA 2CFXA 1LLWA 3P26A 2G0EA 2M8EA 4C2TA 4M9SA 3EUKL 3GZ6A 1OJLA 4M6XA 1X0CA 2JTVA 1IRFA 2QSFX 4WXCA 1VHOA 3IL2A 4QVAA 4LGWA 4W8RA 1D5VA 3OYHA 1K61A 4G6DA 2YWGA 1YITB 1VLYA 4IOCF 6PAXA 2C2WA 5H5JA 1J59A 2NSTA 4BEHB 4U7BA 1RUNA 3QQAA 2RC5A 2GWRA 2DFEA 3TOAA 1LM1A 1TZLA 2LKXA 1LFPA 5FFXA 2R7DA 3A8JA 1R4NB 2LDUA 2QQ8A 2K9NA 1I6XA 4V02C 2BGCA 3CZ6A 3U2RA 4OJ6A 1GVJA 1WI9A 4RPDA 2HDCA 5D4RA 4X8IA 2HVRA 3MVPA 2EILH 3H3UA 3GCMA 2WZPP 1FOWA 2D1HA 1DABA 4R79A 3B82A 1GVHA 2RAEA 2PJRA 1ZM3A 2Y0SN 4P26A 2LNBA 1HA8A 1GXQA 3K0LA 2TRTA 4MNUA 1TLHB 5KAIC 2VBMA 1UHMA 4Z4RA 1M90D 1R5HA 2V4JC 1EFUA 1QVFB 4Z05A 3BOQA 2ACJA 3K4LA 3U1DA 5IT9Z 4IOAF 4OOVA 2J8KA 1WVRA 2KLOA 3VODA 1T6SA 3ZQLA 1X3ZB 2GQFA 2GJRA 1W4MA 3DP7A 4X05A 3HC7A 4QSHA 3WU1B 4Y3OA 2MABA 4XRFA 1XS9A 4L5EA 1WWXA 2L3DA 2Q1ZB 2O0YA 5HDKA 2K3PA 1O8DA 4PAAA 2DDBA 3OIOA 4DGWB 2OTLI 5FL7A 4JK1X 2ISZA 4OPWA 2BV6A 3CF2A 1REPC 3GEZA 4G9YA 5LGTA 4HA8A 1YW7A 2JSCA 4G7ZF 1MNMC 1FX7A 1ZRCA 2GXAA 2L4MA 4CCMA 3WODF 2BM1A 3CCJB 1HSJA 5FO1A 2ZL7A 4OZZA 3K4BA 1YI2I 2V6EA 2L7MP 4XIDA 1HXDA 2M8GX 1HKSA 5D8LB 4ZYDA 1MDMB 3AVXA 5F0FA 3SZEA 2OJED 2AHOA 1U78A 4BY7J 1OCOH 3CCQB 5DM7F 2CFOA 1YE9A 3JRDA 1ZRFA 4ZYEA 4TN1A 4UVCA 3ZGKA 1RIOH 3OW2B 1K8AD 3BJ6A 2GOXB 4WZLA 3F23A 1RKWA 2P8TA 3HSFA 3BG9A 5KAFC 3NRVA 4ZZDA 5LEJA 3ZP5A 2ZL6A 3PA1A 4LBYA 1TWAJ 4EM0B 1DU0A 1PJ5A 2CC2A 2EK5A 2P81A 3SJZA 4HF1A 1IDYA 1Q9SA 4W1UA 5FO0A 2QA4I 2K85A 4UUSB 2PX9A 4L9JA 5B6IA 2H94A 4XLAA 4ZCMA 1GXPA 1R71A 4EGYA 3W5UA 2BY1A 1BW5A 2GQQA 3T56B 1QGZA 4Q7JB 2QF7A 1SD4A 2ZMEC 4HBLA 4UHTA 2BMWA 3RY8A 1U2RA 2XNDA 3CCMI 1LLZA 1JUSA 3CJQB 5F04A 1G7CA 4NK8A 2VXDA 4GCVA 2MC3A 4BL0B 4ASUA 2E60A 3JRIA 2KISA 1JGGA 3EPZA 3KCCA 2JA6J 4DK1A 2O04A 4A6DA 4HNTA 1VQMB 1TVCA 3KP3A 1FEXA 2YWFA 4WZTA 5M5YJ 1A36A 4HOBA 2QQBA 3TL4X 1H9GA 4DQKA 5IK2A 1M1KD 3AG2H 3HEFA 3BZKA 3OEHA 2VFMA 4LBZA 5EEAA 3H1CA 3IH3A 3KLOA 4I98B 4TV7A 1G4DA 1IA5A 4OZYA 1I18A 2HOAA 2E5ZA 3DF8A 1A31A 1IXCA 1MKMA 4BACA 1IZ1A 4DYQA 3S1NJ 1ZELA 2IOUG 2KIQA 3HRSA 4M6VA 2TCTA 3BCBA 2C6YA 3CC4I 1O3QA 4LC0A 2VXZA 3SZGA 5GV8A 2V1DA 4CCJA 4OJPA 3S1QJ 4G7OF 2G7UA 1QHGA 3DQVC 3VB2A 3LAJA 1WTHD 1BOAA 2OV7A 3PSIA 4PSWA 1IXRC 1QHHD 4BDYA 2M4GA 2W82A 1WJ5A 1OYYA 3FXOA 5C4JJ 1B2RA 4OJOA 3ONYA 2INUA 2EV0A 1QFJA 3KRGA 3UKGA 4YZXA 3T1BA 4ZYHA 3CP2A 1O7LA 2NVUB 1F4KA 1KCCA 2DYSH 1P4XA 4HG2A 4U7DA 3PJRA 2DCEA 4I2OA 4G1BA 3H9NA 2UXXA 2HKXA 4G6TB 1YG2A 2IA2A 3M07A 4MGRA 3M1EA 2IS6A 4YFOA 1KK0A 2EIMH 4CZCA 2BM4A 2LY1A 4X1EA 4AUXA 2O03A 1TT5B 2FMLA 1ERDA 2XAUA 3G3ZA 4AWXB 2KIUA 5TGTA 1WQ2A 2MH9A 3FZVA 1AOYA 1LDKB 4NB5A 2LKPA 4M9XA 3LSGA 4C3IJ 2XGCA 3WU0A 2IJLA 1KYZA 4OMZA 2Z6BD 2XGEA 5CVRA 1LKXA 2F4NA 3Q9VA 1YX2A 3S17J 1U5TB 1GHCA 1HQCA 2DA7A 2HMAA 4P6YA 3K1MA 2OC6A 3KPHA 4OP7A 3SYJA 4W8SA 2DA4A 1Z21A 5M5WJ 5B3SH 1MSFC 4ZZLA 2OU2A 2CH0A 1K6OA 2DW4A 2CRGA 3CC4B 2NOGA 2YUSA 1XDUA 1QH0A 4LOCA 3ML6A 3HOXJ 1LVAA 3GTJJ 1PP8F 4UAJA 2OAZA 4Y17A 3DBRB 1WSUA 3CRZA 1FBQA 2E7WA 3IKTA 3JTGA 2L9VA 1RR7A 2XHKA 4ABZA 2A5YB 4BJ6C 3LNQA 3BDDA 2RDPA 2KKOA 3WTUC 3GIRA 2FOWA 2ISYA 1BHEA 2JA8J 4BKXA 1QCXA 5AMVA 3M8FA 5BPDA 3HTUA 1ZGJA 4QTRA 4QV2A 1XMKA 2A6EF 2KP6A 4CYCA 1IJWC 3QFRA 2Y30A 3V7RA 3RJPA 4AC0A 5FLXK 3KEQA 2XTXA 2MFZA 1WH7A 4BQOA 3MD2A 4YC5A 1JRGA 1OISA 4RGUA 3OYEA 2X0KA 2KMUA 5IYRA 5EG0A 1PKVA 1W36C 2FBIA 3G1OA 3O8HA 1IDKA 4LG0B 1AKHB 4YAUA 1XPXA 4C2UA 2D74A 2B0RA 1BR2A 4ZYAA 1NK2P 2VQLA 2VE9A 3GQ8A 5J47A 3EUHA 2PI0A 2PE3A 1J5YA 4WXHA 2ZZGA 3GTMJ 1BN8A 2HLDA 1CNEA 1USTA 2HFHA 3A3GA 2X51A 3GRHA 2Z99A 4HE6A 3Q39A 3DEUA 2AQEA 1W5SA 2ZSHB 4MHGA 3SEJA 3CC2B 2MA3A 4LLNA 3IHUA 2LY2A 1YJ9I 1UELB 1P2FA 2AS5F 2WB1A 2NVQJ 4BEHA 1VQ6B 4ZV4A 3OZUA 1SVLA 1YX5A 3S3OA 4TMWA 4BYYA 4R71A 1X2MA 4RLQA 3V7CA 2DYRH 3L2WA 4H4KC 2A68F 2HU9A 3E1SA 3MMYB 3SDGA 4X07A 4RB2C 4RLZA 2IS1A 2VNJA 1DBGA 3VNUA 4A5NA 3FWEA 5FGMA 3P9KA 1TT0A 2H8WA 3LSIA 4KISA 2DMQA 2F6CA 1TYWA 1IDZA 2J5OA 1X19A 4KMUX 2RQQA 1WSVA 2CW0F 4EV0A 2DQLA 2R7WA 1OR7C 3W5HA 1ZN2A 4W97A 2E36A 3DKXA 5EDNA 2A3SA 4XRMA 2LVSA 4EW9A 2Y2ZA 2OQGA 4I01A 4JYKA 3ABMH 1JKRC 1WJBA 3H0DA 1S72B 2D2WA 3H94A 1Z1DA 2R7TA 4V2FA 5GAHJ 1EP1B 2I8DA 4BJ5C 2NZMA 3TQNA 3RSNA 5L3EA 2B9SA 4HV5A 2K5CA 3PA2A 1ETOA 1ZLJA 3FHNA 4LJZF 1JTXA 3AL0C 1NDHA 1WH5A 3COAC 2X9DA 5DCFA 1JNYA 1PLUA 2W57A 4LB6B 1RPWA 3LA7A 1OOCA 4G12A 1XMAA 4HV6A 2Q8KA 2V1NA 1JKPC 4ZH4F 1I50J 4HDUA 2ZJRF 3HKZA 1F1ZA 3MWMA 3CW2A 1PUFB 4M1KA 2X4HA 1TBXA 4XOPA 1R22A 1S72I 1YOVB 2P4WA 1JT6A 2EIJH 2FEZA 3PFIA 2BEOA 5IP7J 5FFZA 4AC9A 1IF1A 1APLC 3CUQA 3KEOA 5J4YA 1V4RA 1V5GA 1Z3XA 3BZ6A 2K9QA 2YWEA 5K5QA 3BR1A 1V3FA 2WAFA 4AVPA 4YRVA 1GAWA 3CC2I 2HCJB 2VBUA 3JREA 4XKWA 3FK6A 4UXNA 2VFOA 4L8JA 1MMNA 1CF7A 3ASSA 2NT6A 1LUJB 4YIIA 3AVTA 3E5QA 2LC2A 2WAEA 1MRZA 2K02A 2M30A 3HHHA 3Q0WA 2PG4A 3H3ZA 3B02A 2CYYA 3PUMA 4A3KJ 2HTJA 5L3FA 4RD3A 4JBAA 1SVMA 1EJ9A 2OBSA 3JCUC 3N05A 1KTVA 2VBVA 4CZZA 1Z9CA 1KK1A 2XASA 2A61A 3FXQA 4UUSA 1OFLA 1FTTA 2BHZA 5D5UB 4E7HA 2MBFA 1JUPA 2ZXIA 4P2NA 1XCBA 3E6BA 2GLOA 1Z7UA 1S0UA 1JHFA 3G1LA 3HUGA 5GTHC 2OA4A 4O6JA 1Y0YA 2CBXA 2FNAA 2BSAA 3LSMA 5IPAA 1OCTC 5TJJA 1O8LA 3MZYA 2KDZA 2PECA 1PJRA 3H5NA 3NWSA 1JKOC 2G0YA 3M8JA 4U4BA 3ZMDA 1QZZA 2RGVA 2V9VA 4LK1F 4E7SA 2ZL5A 5H2FC 3R6KA 4C43A 3CCVB 3BY1A 2IA0A 3QFCA 5H6RA 1H8AC 4XONA 2EFOA 5AONA 1F60A 3IC7A 4OAZA 2C5HA 3FBNB 2XEXA 3SQVA 3WHCA 1QVGB 3G73A 2CQXA 2UVFA 2FXAA 3OL3A 4Z4VA 4AIJA 2QUFA 3IUOA 3RQ4A 1D8TA 1QBJA 1RZ4A 2MC4A 3KP2A 3RZDJ 1ETKA 3RKWA 3W2GA 3CJRB 1FNDA 4GFBA 2OK8A 4OOIA 1IDJA 4P9SA 2V26A 2O17A 2HYJA 4B43A 1HKQA 4U49A 3A4CA 3BY2A 3HOSA 1XB2A 5DV5A 2VASA 4AYBA 4B8XA 3B8HA 2BW3B 1O8KA 1N08A 1TUIA 3QYBA 3A1YA 2IPQX 3I71A 2IGKA 2XC1A 4YDTA 1UZCA 4URRA 1SD5A 4TSFA 3JQPA 3ZQCA 2PIAA 2XZPA 4KNYA 3KX2A 2DJIA 4FISA 4A12A 2AXTC 2BXZA 2K9SA 5C1EA 4FT8A 2KRHA 4FQGA 1C0WA 2J5PA 4BUPA 4IQJA 2DXIA 2VQCA 2R5YA 3H9GA 1U6GA 2Q2EB 5GPCA 1NHCA 4TMVA 4HX8A 2BOLA 3LSRA 3M8EA 4R1HA 1LPQA 4B09A 1V5EA 4I0AA 4AF7A 1VQOB 3S2HJ 2E71A 4RD1A 1ZQ3P 4KN4X 5CPRB 3OSGA 3BR6A 3CDLA 4BE2A 3WNCA 4A0YA 2ZSIB 3HM5A 4UV9A 5LHGA 3A2KA 3K4MA 4Y7NJ 2LD5A 2Q6KA 3SKBA 1YJWB 3B8YA 2K7LA 3TEDA 3EYIA 4HWVA 4IVNA 4ESJA 1OFMA 5E8GA 1DDNA 1CF7B 5KW9A 2Z33A 4IZZA 1T8IA 1B8IA 2JN6A 3K4NA 3T5XA 4A69C 3I0TA 3FISA 1U5TA 2H6BA 3RKXA 3WQZA 1YW9A 1WSRA 5AIQA 3MZHA 3PENA 2HZTA 3F0CA 1YJNB 4CCLA 3T51B 4OU0A 1XQBA 3GTKJ 3F8BA 2K9LA 3PFYA 3HRMA 3K70C 1NJID 3ZQIA 2EWEA 1Y1VJ 2PJRB 1AIPA 2V7UA 3GFLA 1AMOA 3D5SC 1FC3A 2BVLA 2CUJA 2DFIA 1K4SA 2R7UA 1PDNC 1EFTA 2JWTA 4OOXA 2M3AA 4K2EA 5LHIA 3HOZJ 5IYWA 4MXNA 5FNZA 5E3MA 1XMXA 2BY0A 2JVGA 3CESA 5F08A 5F1JA 2E7XA 2COBA 3B6AA 5F1RA 3VR6A 3GO5A 3AGPA 1H0MA 2CW8A 2L02A 1E1RA 2QKMB 1PYVA 1FTZA 3HG9A 3LFUA 5FRMA 1QA1A 5JMCB 1HA3A 3GW2A 3PUBA 2XKPA 5FB2A 3K7AJ 4J19A 2ESHA 1XFOA 1RQRA 3Q6RA 1DPRA 3CUQC 4IXAA 4F52A 1SM4A 2DK8A 4WWVA 1DGRM 5KCMA 5GAGJ 2VFQA 2XPVA 5CQEA 4EJOA 2CSOA 1NB0A 1PJ7A 3DBHB 4Y15A 4RD6A 2VN2A 3IP4B 1LJ9A 3W6VA 2QE7A 3V76A 3CQZJ 1S9HA 3TH0A 4RAFA 5GTIC 3GTOJ 1KCDA 3S2DJ 1HF0A 2E1NA 4UVAA 3T8TA 2ME0A 4G6IA 1VTNC 1DGWY 2E2JJ 1UG0A 4Z2YA 1EH6A 1UHWA 3PNTA 4UVBA 3N6ZA 1VQOI 1MBFA 3JU4A 2HXIA 1MDMA 4FXUA 1K9MD 3WGHA 2OCEA 4Z03A 4YEIA 1BC8C 2E1CA 1FMVA 3BTLA 1IXSB 4EVIA 1E2XA 3IKVA 4NC8A 4RDLA 4DNCA 4OPVA 2LH9A 2ETHA 2INVA 2Y0MA 2EBIA 4PJMA 4W8TA 2W24A 2KQRA 1ZM9A 1ULYA 2DLLA 5IYDJ 4MO7A 2WJYA 1OGOX 2Q0OA 3KP5A 2E1BA 1HW1A 2ZZQA 5F64A 2QZAA 2CU7A 1TQIA 3OYBA 1VQ5I 1P7JA 1IRZA 5HKKA 1WMRA 2DTZA 1WRJA 3FKJA 1RQPA 1WCMJ 3QYFA 1XGNA 1X4PA 2VJIA 1FP1D 2ZXHA 3CLQA 1FPQA 1FYMA 5HLHA 2BF4A 3I55B 1TW2A 2V1XA 1IC8A 1I27A 4NUBA 1NK3P 3Q38A 2CGPA 1ZKGA 2F5DA 4YAWA 1XG1A 4I99C 1Q7YD 4CCNA 1O8IA 3MN2A 3LOCA 3PQJA 1R7JA 3GF2A 4BHPA 3A01B 4PCQA 4GDFA 1J9IA 2Q6IA 3G4SB 1U9NA 1G8XA 2HQNA 2STTA 3I56B 4DYCA 1P92A 3GX4X 3C18A 4ZGQB 3BH4A 1KTWA 1U8BA 3AG1H 2VNKA 3WHBA 2GZWA 4JRAC 1YIOA 1HDPA 4AIDA 2NNNA 1BR1A 4PC3A 4B48A 2LP0A 3L2UA 4WX9A 1FNMA 1MJ9A 1T08B 2A5WA 2ZXJA 4MIMA 3AGQA 3GQ7A 4I0BA 4XKBA 1N77A 1T2KA 1GT0C 3CMEI 2MSYA 2Y75A 4RDUA 3PIPF 1KU7A 1OCCH 4XKVA 2Z9OA 2LZJA 3VSLA 4QLCU 1SD7A 2OF7A 4IRIA 9ANTA 3SUCA 3QU6A 3CD6B 2OK7A 2HXOA 3Q0VA 3ROUA 3CJNA 3CXCB 4YCQA 2F4IA 2MD5A 3J81k 4DJAA 2VKDA 3ZBUA 3J81K 5A88A 2W7ZA 3K10A 4BGDA 2QX3A 4OAYA 5B5EC 2DJNA 2EFNA 1ZLKA 4XLHA 2WC2A 4F7DA 4BE1A 1FBUA 5D5VB 1TL8A 4RM0A 3CC7I 3KZZA 2X6WA 3KEYA 3WTYC 1X1BA 3I56I 1KK2A 1E3PA 2UVEA 1VLOA 3A3BA 1B4AA 3GFJA 4G8XA 2C78A 1H42A 4UB8C 1NB9A 2F1LA 4PGOA 2W84A 2M9HA 4HAMA 1VQ7B 1YQAA 2IP2A 4UUTA 5C3EJ 4X7EA 4A0XA 2DDAA 4O3MA 1E17A 4CDGA 2BPOA 2CV2A 4ZDPA 4FWTA 2BM7A 3LL7A 4DZPA 5LGUA 1UHSA 4XR6A 3B6CA 5ICGA 2LF8A 2VNIA 2F5FA 4X0CA 3F6OA 2ZFUA 1YI2B 3CMAI 1WJAA 2VBTA 5LGNA 1T33A 5E1WA 3VSUA 2NVXJ 1GAQA 1Y39A 1J2XA 2V7WA 4PC1A 3VEPA 2LF7A 2X1DA 5FD5A 1RNLA 3ZR8X 1RMGA 1YS6A 2K3FA 3HDDA 2VKVA 1PE9A 1VQ9B 2HWVA 2EPFA 3WBJA 2JUGA 2B7CA 2LK2A 1B6AA 4QWQA 1WKMA 2C4UA 2HR3A 4M3GA 5F0HA 5HNFA 5L3CA 5C1CA 4PJ0C 5HOOA 2DPUA 1I1GA 2EIKH 4B3XA 5A2QK 3U6KA 5DCMB 4EGZA 3CMAB 3BROA 5J3OA 1WOSA 2MLKA 5FA6A 2QM3A 4WZKA 1R5BA 3I9V2 1H9TA 1I3QJ 5IYQA 1EH8A 3LQEA 5E3LA 3FXRA 4M3DA 5LEKA 2YS9A 2XAGA 4CYCB 2DT5A 2E1MB 1R1VA 1QVTA 1N05A 1OGJA 5E8IA 1TLLA 2W6IA 1V0EA 5F4OA 4B3GA 1SANA 1KU3A 3SJMA 3ZQGA 4A3CJ 1QZYA 2WY7Q 3HB9A 4RPBA 1PUEE 4YHBA 2NTPA 3VYTB 2M2EA 1U9OA 5CYVA 2HQ5A 1LDJA 1P4WA 3I59B 4I76A 1GDTA 1HOMA 2XZOA 1MJBA 2OTJB 1QGYA 3PNVA 1MBHA 3EQNA 2CJJA 4F93B 1GVDA 4U87A 2VNHA 2ZBVA 4O5VA 5AN9A 4A3EJ 3RZOJ 5E20A 2A05A 3S2WA 5LBQA 4RDJA 2B7BA 3ZPNA 2HDDA 1DQUA 2F2EA 3EUAA 3DWLE 3KZYA 4HLXA 2QDXA 4E7LA 3REOA 4BS9A 2A6TA 3ZZUA 3OYGA 1I8DA 1W0KA 4ANJA 2XNJA 1YS7A 4P1VA 2QVOA 2WV0A 3WGIA 2NTBA 1ETVA 3OS2A 1VJSA 2X6YA 4C3HJ 4R8HA 1QVUA 3WTXC 2VJ4A 2W85A 1G3WA 3R0JA 5BNGA 2JDIA 3AAFA 2M1BA 2COMA 1LFUP 3E6MA 1YW8A 3IWFA 2GOMA 1IHMA 4ZDLA 4G5GA 2HVSA 3CCUB 1T6YA 1X1PA 1HZEA 3AKZA 1T98A 4NC6A 3ZN1A 1KD1D 1NH3A 1QFZA 2IA1A 2W48A 2XIGA 1SKQA 1YLFA 2ZBUA 3QOPA 1W87A 2STWA 4XLEA 4D7NA 2GK7A 4GRIA 1EZGA 1SFKA 2IXSA 3L00A 2MW8A 1UJ8A 1XB4A 2L5QA 5DCMA 4A93J 3LAPA 4G1VA 2ZTGA 2XROA 3J7AY 1FRNA 3VMWA 3K4CA 4JOMA 1ZUNB 3GQAA 5DD4A 4PC6A 3EYYA 3K2AA 2F48A 3HGGA 2KRFA 1BLIA 1KZLA 3OEEA 2QSHX 2BVNA 1T5EA 1E3HA 3L09A 3BY6A 1EV7A 1GR1A 4BQAA 2BZTA 1A6QA 1TQMA 4UB6C 3E1YE 1E63A 1ZHFA 3DEWA 3W6KB 1R5ID 1Z6RA 4MEYF 1TNSA 2EFQA 3D1NI 3GMEA 3ZN0A 4TMXA 2XTYA 4UV8A 2TDXA 1VQMI 1TW3A 1UB9A 3BQZA 4IPAA 3OE7A 2M7BA 3K4JA 4XSZF 4RJLA 3WG9A 1O3SA 5TY0A 2JZYA 5L3GA 2O8XA 2X8KA 2WADA 4RB0A 4PJJA 2B7EA 1FT9A 3LO8A 1LEAA 3K9TA 3OOCA 3RCOA 1KYWA 4CA0A 3S32A 1QPIA 4BQQA 3G6EB 4RCYA 3KEWA 5FRNA 1O7FA 3A1PA 1VQ4B 3OY9A 3PSFA 3X2QH 4NC7A 2QLZA 1FNCA 3E7LA 2OZ6A 3WTZA 3A8KA 2WSSA 1UMKA 2FQ4A 3DEEA 3QPTA 5HZBA 5HLGA 3ES9A 3EUHC 4YAFA 1FP2A 3ZQQA 3QRFF 1OGMX 3W2IA 5HZAA 4CO8A 2FF4A 2YR2A 1DU6A 3BZCA 3K70D 4BDZA 1W0TA 4NHJA 1Q1VA 5IT9K 2X53S 2UUZA 5ILSA 1IRGA 1TC3C 3CCQI 5E1XA 2AQFA 2R5ZB 3DLAA 1FNNA 4MTDA 4PSXA 2QA4B 2HZDA 5JLXA 3ZSCA 3ULQB 4PGGA 1RETA 5CKTA 2KT0A 5HNHA 4HQEA 1MBJA 3EDPA 4C30A 1GUUA 2Q6OA 4V19K 2W6JA 3FKSA 5IT3A 1UD5A 3ZPLA 4Q4ZF 3AG3H 3IH2A 1HF2A 3KIOA 3PVDA 3G1MA 3D26A 4Y9RA 2R7FA 1XG2A 1NHAA 2OCCH 1W5CC 2N8GA 4NQWA 3ECHA 2BGJA 3ZMSA 2VZLA 1E62A 5M3MJ 4IQ4A 4RB3C 1ZREA 4IHVA 4TKOB 2UV1A 3BCAA 3CCUI 2PLFA 4KITB 3GLXA 3NEUA 1WDTA 2JUCA 3BQJA 2YPRA 3JAMK 5TR9A 1WOPA 1AWCA 4ZTFA 1QQIA 4Z4SA 5DS0A 3C2GA 2LR8A 2W1OA 3ABLH 4PC2A 3H0GJ 2KIMA 3IAS2 1XN7A 4MQVA 4B3AA 4P25A 2M0MA 3KFWX 4M71A 2WJVA 1ENHA 4QVJA 1P9QC 3H36A 2RNJA 3G71B 1EE6A 3BP8A 3OS1A 2VT3A 4J00A 4M0LA 5K7ZA 3LMWA 2Q6LA 4IHTA 1MBGA 4II2A 3V7SA 5E6TA 4XOTA 2VBSA 3F3XA 4RGRA 2ZMEA 4KIGA 1MW7A 4RS8A 1LEBA 2PLYA 3U2QA 4KKSA 4WXDA 4M9ZA 5FLMJ 4CICA 2O7OA 5HODA 3L2CA 2DEUA 4YFKF 2F3LA 1IJEA 4ZYGA 3ZZTA 2F4MB 3SFIA 2EZIA 3IRRA 3PUFA 4OMYA 3AVWA 1NRKA 3KP7A 2ZC2A 1S3JA 1GV2A 3VFZA 2BX6A 5E1ZB 1Q82D 2VODA 1KZHA 2R93J 2JA2A 2C5BA 1J09A 1E3OC 3K1PA 5JHUA 4PGHA 2EFPA 1EH7A 2EIXA 1ETYA 4IHXA 4YG2F 1WGXA 2QEXI 2LMDA 1VQ6I 2M4KA 4D5FA 5CVIA 3Q0UA 2O0WA 2VBWA 3G4SI 2DMPA 2DOEA 4P6VF 1K8FA 5DTDA 3FM5A 2DA2A 2OUMA 4HIZA 1P4MA 3PL8A 5HVQC 5K7HA 1LE8A 1KQ8A 4KIFA 4C9YA 3ISPA 2CUEA 3JR9A 4XLFA 1LFBA 2V7TA 1D2EA 2UXNA 2VT2A 3ASOH 5DN6A 5C44J 1G59A 4D1QA 4OIPF 1VQPI 4IKFA 4ENNA 5J35A 2QYUA 4P96A 4EM1A 3OOPA 4EATA 1L0OC 4MTEA 5DS9A 1HDDC 4LG3A 2V7VA 4J0QA 4ZCLA 2XTWA 1D1AA 2Z5UA 2DT6A 5K1YA 1D8KA 3CCVI 1D1CA 1WU8A 4XNFA 2EV6A 2DBBA 5E17F 2VBKA 1TWHJ 4K1XA 2HQAA 1YHQB 4HSRA 1NG7A 4XBFA 1K6YA 1W7PD 4N4NB 4RAYA 2CMPA 2ECCA 3H5AA 1F36A 1B9NA 4PJNA 3OYCA 1XGOA 1WJFA 1O8HA 4PFOA 2VONA 2DY1A 2BW3A 3HOUJ 4GYGA 4X7CA 3GUDA 3H35A 3WNDA 2KPMA 3C3WA 4E7IA 3RTRA 3SLDA 4RD4A 2R4GA 3FX3A 4OJLA 2XAHA 5ED4A 2X3HA 2HS5A 2BGIA 4Z4ZA 4EJUA 1HLVA 5TISC 2O1DA 4HDVA 4X06A 4M3FA 3DU6A 1UCRA 3A0BC 2WTEA 5EZGA 1ZGAA 2EZKA 4OIRF 1XSDA 2GREA 2M87A 4AIHA 3OL4A 3FY3A 1IO2A 4RD0A 4XRSG 1FOYA 3CMYA 2L9NA 3I3LA 4IW3B 3HGYA 2QCOA 3OR2C 1Z7LA 4X0GA 3LJYA 4QPQA 2HTSA 1K78A 1T6XA 4X7FA 1RWRA 2GXBA 3HPHA 2XOKA 1R00A 1TTTA 2IAIA 3W3CA 4AM3A 4ETSA 5FLVA 4RGSA 1JUMA 4OPSA 4RM2A 5D4SA 3BG6A 3G2BA 5F27A 4FCYA 3QODA 2C77A 2CNDA 4ESBA 4CCKA 5FKNA 3I4NJ 4HPQA 3CCEI 5D6FA 4A3JJ 1N06A 3ZIAA 4Y52J 1VQNB 4QHYA 4Z06A 3AK5A 3C2HA 4H9GA 1R1TA 2JPCA 1ON1A 2KHMA 2XF7A 3FBIB 3ESWB 2PMDA 4IRHA 4GQNA 1W7PA 2QWWA 5A89A 1NG6A 4M3BA 3DTIA 4BY1J 3QFTA 1IW7F 1ETQA 1T95A 1G3SA 1JA0A 1DP7P 4EJTA 3NQOA 4A3BJ 3UW0A 1Z6TA 4RAGA 2B63J 3MCZA 1QX4A 1FYKA 4IHWA 2YX4A 3EQLF 3EQOA 4L0ZB 5JLVC 3WXMA 4NNJA 3TP3A 4GXOA 3N90A 5EF6A 2VKEA 3OYJA 1A5JA 1D1BA 5GP9A 3HOVJ 4A3GJ 2GPJA 5GV7A 1KK3A 3FHZA 2NOJB 3FXJA 3QP5A 4PABA 4HW0A 2YUHA 2LKSA 1LNWA 4XN0A 4BE0A 1TQPA 2EB7A 1MMAA 3Q9SA 4DQLA 1QPMA 3WE3A 3SJPA 1OHHA 2CV1A 5JR3A 2VPLA 3TDUC 5GAEJ 3K1NA 4MQ9F 1B72A 2WR8A 4NK6A 3VWBA 2MYSA 1VBLA 2J7KA 4QPOA 1ON2A 2EJRA 4FASD 4KA4A 3GVLA 2BM6A 4M3EA 5K5RA 3GXOA 3HJEA 2E1OA 4XLNF 5TV2A 4LK0F 4DZJA 3FMQA 2KL4A 3NE5B 2DOAA 2EQRA 3OWTA 3CUQB 1A35A 2CW5A 2W25A 2PMUA 1Y0RA 4RDKA 1E79A 2WAQA 3DV8A 3LMMA 4P9FA 3ABTA 1RUOA 3WE2A 1ZM2A 1EP2B 3OYNA 1F9NA 2HYFA 2V6CA 3MMPA 2DA6A 1GO2A 1K4TA 1JTAA 4XKCA 2NRAC 2X0LA 2K86A 2ME6A 4B1RA 5DUKA 1G7TA 3GZ5A 1SAXA 1H89C 1HC8A 2XAJA 4HNUA 2KJCA 5C4XJ 2ZNYA 5J8FA 3QPHA 2NVTJ 2BM0A 2NTQA 3GFIA 2QGUA 4KDPA 2FJ1A 4LFUA 3E3VA 1QA2A 4DOZA 3I54A 1BBYA 3FXKA 4F91B 5DD8A 4M4SA 3KZIC 1IV8A 1D1NA 3HSRA 1EKEA 1MIJA 4Q5SF 5BS6A 2IS4A 3AL0B 1BJAA 2BM5A 3A01A 2F5VA 1RI7A 3ZC3A 1OCPA 1X3UA 3OJWA 4AF6A 4PFPA 3EETA 1NTCA 2EWNA 3V8LA 5IP9J 2QSGX 4CGZA 1HSTA 2QQ9A 2WBMA 3E97A 4YZ0A 2ZB9A 4A5MA 1CQTA 5EGOA 5D5WB 1RR8C 4G7WA 3ASNH 3GTLJ 1UD6A 2XNCA 4KUMA 2CQNA 2KDOA 2BE5F 1XD7A 2PMHA 2VJJA 1T38A 2B5OA 4P12A 5CDFA 2HPIA 1EP3B 4Z4TA 3F8FA 1QFYA 2CQ7A 1MH3A 1R1UA 4WWCA 4IRGA 3UNGC 1CQXA 3J7AO 3T8RA 4YIRX 2FX0A 3KLNA 2CK3A 2ZTNA 2Y9ZA 3W2FA 2V1UA 1WFXA 2L54A 3N4MA 3ZMTA 2JIZA 3QFSA 2FE3A 3LSKA 4E4HA 3A03A 1IGNA 3T53B 1FX0A 5D8KB 4BNCA 1QNTA 5ICCA 2R3SA 3GLLA 1D0ZA 1EA3A 1UD3A 2LBFB 1BQEA 2V31A 4MR0A 1NBMA 4W8QA 1IV6A 1HBXG 2M7AA 2D3NA 3ZQHA 2DK5A 3L2QA 3ZPPA 4BQNA 3ASRA 3QP6A 2OBTA 2VC1A 1S8NA 3FIWA 3GZNB 3Q3SA 2ZJ2A 2CG4A 4ASNA 4BXXJ 2J8IA 1YTYA 1DDGA 4XICA 4UUVA 4L9NA 2DAOA 4D9JA 1BW6A 2O5RA 2DOFA 2LYCA 3S3MA 2QY1A 3HL2A 2VLAA 5FKLA 3SEZA 2BYVE 3A02A 4YFNF 4MEXF 1V0FA 3LVBA 4Y4RA 1BC7C 1HVXA 4IX7A 1FLIA 4ENMA 1Q86D 3PETA 3JAMZ 3I59A 4GYIA 3HAGA 3W2HA 4HZFA 5A2QZ 2IEKA 2GJPA 3GFMA 2IW5A 1GLNA 1XTAA 3DKWA 2DI3A 4F55A 2VQHA 1I1SA 1X1AA 3LQQA
chains in the Genus database with same CATH topology
4ZDOA 4F93B 4U87A 1BHEA 1QCXA 5AMVA 1OB0A 3CP8A 2IQ7A 3OPOA 3A35A 3GQBA 3NWTA 2KP6A 4Y33A 4YEJA 3ZPNA 1SAUA 4ZJZA 1DQUA 3EUAA 4RMNA 3DWLE 3OYLA 1O8JA 3OIQA 3SEQA 4E7LA 2O0VA 4MLOA 2A6TA 4BS9A 4CUGA 3OYGA 1I8DA 1W0KA 4ANJA 2R7VA 2CS3A 1RU4A 2MFZA 2NTBA 4BQOA 3OS2A 3MD2A 1VF7A 1VJSA 1JRGA 2X6YA 4CH7A 3OYEA 2KMUA 2XDVA 2GJKA 2VJ4A 3K4KA 1W36C 4BXFA 1PKVA 2XF5A 1IDKA 2JDIA 4XN3A 4DIQA 4HSTA 4C2UA 1BR2A 2ELJA 4ZYAA 2VQLA 2GOMA 3GQ8A 4ITVA 2JSPA 4ZDLA 2HVSA 5KNLA 2Z2SB 1HZEA 3AKZA 2ZZGA 1E3ZA 1BN8A 4LIVA 3LNNA 2HLDA 3A3GA 2PYGA 2X51A 3GRHA 2R7OA 1V5FA 2AQEA 2WY8Q 4C2LA 2ZSHB 3BCFA 1O88A 4B47A 3VSKA 4DBRA 2LY2A 1UELB 4XLEA 2GK7A 4GRIA 2WB1A 4F92B 1SFKA 1UAAA 2IXSA 4BEHA 3S3OA 1YX5A 2L5QA 2Z8GA 3DDYA 3ZRGA 4RLQA 3L2WA 2ZTGA 3J7AY 4H4KC 5KHDA 2QKLB 2KZVA 3VMWA 3K4CA 2HU9A 3E1SA 3MMYB 1X1DA 4JOMA 4XORA 4E7KA 4PMHA 1MMDA 2IS1A 1Y6IA 1DBGA 3GQAA 3DPTA 3W2VA 3OAAA 1TT0A 1EFRA 1BLIA 1KZLA 3OEEA 3LSIA 4KISA 2M5SA 2F6CA 1T5EA 2NSPA 1X19A 2RQQA 1E1QA 2R7WA 1OR7C 3DKXA 4PK4A 4UZUA 4EW9A 2CW7A 1COWA 3WWGA 2W4SA 1WJBA 3H0DA 2HVQA 2V9KA 2HDWA 2R7SA 3H94A 1D0YA 2R7TA 5JHFA 1X4OA 3OE7A 3KYLA 2M7BA 3K4JA 2I8DA 1E3XA 4BJ5C 2NZMA 2DIEA 3GQ7A 3RSNA 2ZZFA 2HNHA 4RM3A 2K5CA 2KVOA 3IAM2 2WADA 2X8KA 4PJJA 3FHNA 3AL0C 3BC8A 1BR4A 3OOCA 3RCOA 4CA0A 3S32A 4BQQA 4I84A 4Z1MA 1PLUA 3KEWA 1OOCA 1UD8A 5FRNA 2V1NA 1Y56A 3FDYA 3OY9A 3PSFA 4KJZA 3HKZA 3AFHA 4NC7A 3OYKA 3DU5A 3OMYA 2WSSA 2X1EA 1O8MA 1N75A 3DEEA 3EUHC 4XOPA 4N4OB 4XQFA 2Z1DA 3ZQQA 1DBOA 1OGMX 3DPLC 1H8EA 2ZZEA 1KONA 2VB6A 1V5GA 3K70D 3JURA 1Z3XA 2V7FA 1VZ0A 4BDZA 3ZXSA 4CSWA 4DBQA 2WAFA 4YRVA 4XLCA 2X53S 2UUZA 4XKWA 4L8JA 2P0WA 1MMNA 2AQFA 3D5LA 2WPDA 4TT3A 2XGJA 2NT6A 3DLAA 2QXZA 4PSXA 2LC2A 4XM3A 2WAEA 2HZDA 2VJ5A 4BU2A 3ZSCA 2R7XA 5CKTA 1N78A 5HNHA 4C30A 3FKSA 4JMQA 2W6JA 1UD5A 3N05A 4E7JA 1BOBA 4AU7A 2V7QA 3W2AA 1XG2A 1OFLA 4OJ5A 2L7KA 4J01A 2FUG2 4E7HA 4XMYA 2ZXIA 1FMWA 1O8GA 2JVHA 4IQ4A 4TKOB 2UV1A 3BCAA 4KITB 2CV0A 3HOTA 3LSMA 3HUGB 1O8LA 2PECA 1IRXA 1PJRA 3H5NA 3NWSA 1UD4A 3G05A 1GQ8A 3M8JA 3K6GA 4ZTFA 3C2GA 2W1OA 4E7SA 2XF6A 2X6XA 3IAS2 1WJDA 2M0MA 2WJVA 1UD2A 1P9QC 4XONA 4OAZA 1MMGA 1EE6A 1SKYB 3FBNB 3OS1A 4J00A 4YELA 2L9SA 3LMWA 2UVFA 3OL3A 4II2A 3IUOA 3DTEA 4XOTA 3RQ4A 2IGOA 1KMHA 1MW7A 2MC4A 3L2RA 2F43A 3CJRB 4KKSA 4PJLA 4E7ZA 2W00A 3MKYB 1IDJA 2O17A 2V26A 4B43A 3GVJA 3UR3C 3S8PA 3OYFA 2R7QA 1MNDA 4YZAA 4DNTB 4U49A 3U21A 5LFAA 3A4CA 3SDBA 3GVKA 1NRKA 4P1WA 3TMOA 1D0XA 3HOSA 2VASA 3F9KA 4AYBA 1O8KA 2BW3B 3PNYA 2R7RA 3QYBA 3A1YA 4AVZA 2IGKA 3B90A 2JA2A 1J09A 4E6KG 2D3LA 4URRA 2L2OA 2W7NA 4TSFA 1HG8A 2XZPA 2BVMA 3MKWB 4B44A 3KX2A 2RNGA 2DJIA 1LVKA 2LG4A 4XD7A 3OYMA 2JJ2A 2M4KA 5C1EA 2KRHA 2PMZA 2KRCA 1QU3A 1QJVA 4DNRB 4BUPA 4IQJA 2O0WA 2DXIA 3ONQA 2VQCA 1NHCA 3H9GA 2Q2EB 3OFNA 2BOLA 1AA7A 2OUMA 2Y0SA 1V5EA 2IS2A 4HIZA 5CPRB 5FROA 3PL8A 5HVQC 4BE2A 2RREA 4C9YA 1JI8A 3TBIA 2ZSIB 1DP3A 3A2KA 3K4MA 3B8YA 4XLFA 2VKHA 1K5CA 1U0JA 1T0FC 4HWVA 1R6RA 2Z16A 1OFMA 5DN6A 5CQGA 1G59A 3BLYA 4RLFA 2X85A 4D1QA 3T9GA 4IKFA 3QYEA 2NT9A 4IZZA 3VSVA 2VL8A 3GQ9A 3K4NA 4EATA 1CZFA 4LG3A 2JJ1A 3WQZA 1D1AA 2DT6A 1D1CA 4CCLA 3T51B 4XNFA 4C2TA 2VBKA 3EUKL 2HQAA 2K9LA 3PFYA 3K70C 4HSRA 2EWEA 1X0CA 1O8EA 1NG7A 2PJRB 2LBFA 4W8RA 1K6YA 3OYHA 4KT6A 3D5SC 4N4NB 1VLYA 2BVLA 2CUJA 2CMPA 2R7UA 2M3AA 3H5AA 2NSTA 4MXNA 4BEHB 4U7BA 3OYCA 4PJNA 1WJFA 1O8HA 4PFOA 2BW3A 2JVGA 3CESA 3BG7A 3H35A 3VR6A 3OYAA 2KPMA 1TZLA 4E7IA 1LFPA 2E1MC 2CW8A 3OIPA 3RTRA 1E1RA 3FPPA 2QKMB 1PYVA 2X1CA 2R4GA 3HG9A 3LFUA 4BJTA 2HPMA 3CZ6A 5FRMA 2R9VA 4G7XA 2X3HA 4OJLA 4OJ6A 2O1DA 3PUBA 2VQGA 3DU6A 3VYUB 2IGNA 2HVRA 3GBGA 4F52A 1W36D 2WZPP 4ZC3A 5HLTA 1DGRM 3OL4A 5KCMA 3FY3A 5CQEA 4R79A 1Z3YA 3SYTA 2L9NA 3I3LA 4U4BA 4X0GA 3OR2C 2PJRA 1Z7LA 3IP4B 4QPQA 2QE7A 4OWRB 1RWRA 3OYIA 1S9HA 1AIRA 1HA8A 3HPHA 2XOKA 3BC9A 1KCDA 3E0JB 2VBMA 3W3CA 2XC7A 4G6IA 1DGWY 4XL9A 1UG0A 2V4JC 4Z05A 3K4LA 1BMFA 3PNTA 2ODLA 3DPUA 4RM2A 2KLOA 3BG6A 3G2BA 1K28D 2F1MA 3QODA 3JU4A 4FXUA 4CCKA 4P22A 4HPQA 2GJRA 4Z03A 3HC7A 3ZIAA 4Y3OA 1FMVA 2MABA 4Z06A 3C2HA 4NC8A 2GK6A 2Q1ZB 2LOOA 2KHMA 2XF7A 3FBIB 2LH9A 2K3PA 1W9XA 4YXWA 1O8DA 2INVA 4PJMA 1MNEA 3HXLA 4GQNA 4E0FA 4DGWB 4W8TA 5FL7A 2IGMA 4KKTA 2KQRA 1NG6A 4FETA 3DTIA 3CF2A 2WJYA 1OGOX 1T95A 2LRDA 2E1BA 3DTKA 2ZZQA 3OYBA 5HKKA 1WMRA 4CCMA 3UW0A 3FKJA 3QYFA 1WP6A 3K4BA 3EQOA 1X4PA 2VJIA 4NNJA 2ZXHA 2V6EA 4OZZA 4LITA 2PYHA 3OYJA 1D1BA 4NUBA 4P5OA 3BCDA 1OLTA 2XZLA 2NOJB 2CFOA 1YE9A 4PUSA 4CCNA 1O8IA 3B4NA 3ZGKA 2E5NA 4HEA2 2LREA 2GOXB 4XN0A 2MD0A 4BE0A 1G8XA 1MMAA 3V42A 1OHHA 2CV1A 2VPLA 1PXZA 1YX3A 3BH4A 1W0JA 1WJEA 4NK6A 1KTWA 4B3FX 3VWBA 2MYSA 2V4DA 1VBLA 3VYSB 3VSTA 4QPOA 4KKUA 4FASD 3GVLA 3H5RA 2KL4A 4XLAA 1BR1A 3NE5B 2DOAA 4B48A 3L2UA 3OWTA 2A5WA 2WA0A 3T56B 4XKBA 2WAQA 3LMMA 1E79A 4YZQA 1N77A 2XNDA 4ZTJA 3CJQB 4NK8A 2VXDA 1BPLA 4XKVA 4BL0B 4ASUA 3OYNA 2E60A 1IB4A 2O04A 2LZJA 3EPZA 4DK1A 3VSLA 3SUCA 4HNTA 1JTAA 4XKCA 4BJ6C 2F4IA 4DJAA 2VKDA 3VYRB 4HNUA 4LIUA 1E43A 3TL4X 3L2VA 3K10A 4BGDA 2NTQA 2QX3A 4OAYA 3HPGA 3QOEA 5IK2A 4DOZA 1MABA 3OEHA 4XLHA 2VBEA 3VMVA 1IA5A 4BE1A 3H9QA 4OZYA 3S93A 1WPCA 4F91B 1I18A 3OOUA 2E5ZA 4II3A 2X6WA 3KEYA 2BSPA 1X1BA 4BACA 2UVEA 2IS4A 3OYDA 3A3BA 3AL0B 1ZELA 3M1CA 2F5VA 3BCBA 3OS0A 1H80A 2VXZA 4PFPA 3SZGA 4OJPA 4CCJA 1E0EA 1QHGA 2WBMA 3DQVC 2K9MA 4YZ0A 1WTHD 2CV2A 4ZDPA 4G7WA 2OV7A 3LL7A 4XR6A 3PSIA 4PSWA 1UD6A 1QHHD 4BDYA 2M4GA 2W82A 1WJ5A 4F3QA 4OJOA 3RPUD 1WJCA 2INUA 2KDOA 2ZFUA 3OW7A 2VJJA 1WJAA 5CDFA 3KRGA 2HPIA 4YZXA 3CP2A 3VSUA 1KCCA 3LSHA 2X1DA 4HG2A 3PJRA 2DCEA 3UNGC 3ZR8X 1RMGA 1PE9A 4HRIA 2CK3A 2ZTNA 3H9JA 4G6TB 3VDXA 1WFXA 2JUGA 3ZCOA 2IS6A 2JIZA 3T53B 3LSKA 4E4HA 1FX0A 4CZCA 5HNFA 2LY1A 5C1CA 1ERDA 1D0ZA 2XAUA 1EA3A 5HOOA 2LBFB 5TGTA 1UD3A 4B3XA 1LDKB 2V31A 4MR0A 1NBMA 3LSGA 4W8QA 4DK0A 3D5RC 2M7AA 2D3NA 2Z6BD 4JQFA 3I9V2 3L2QA 1LKXA 3ZPPA 4BQNA 2UWMA 3W2WA 2OC6A 4W8SA 1Z21A 2VIXA 2E1MB 4D9JA 2CH0A 2O5RA 2LYCA 3S3MA 1X1CA 1O8FA 2W6IA 2CUZA 2QY1A 3HL2A 3S3NA 2VLAA 1V0EA 3SEZA 4B3GA 1H8HA 1V0FA 3OR1C 4Y4RA 1HVXA 3CMMA 4IX7A 4CCOA 3HAGA 2WY7Q 2DT7B 2NTPA 2XSJC 3VYTB 5LD2C 2GJPA 2XZOA 1GLNA 4F55A 3PNVA 2VQHA 3DKYA 3EQNA 3MKZA 1X1AA 4NQWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  3GQ9 A;  1BHE A;  1CZF A;  1QCX A;  5AMV A;  4XKW A;  2IQ7 A;  4YZQ A;  2NT6 A;  4XNF A;  4YEJ A;  4XM3 A;  2QXZ A;  4NK8 A;  2VBK A;  1O8J A;  4XKV A;  3ZSC A;  1IB4 A;  2O0V A;  2O04 A;  2EWE A;  1X0C A;  1O8E A;  4W8R A;  3SUC A;  1RU4 A;  1JTA A;  2NTB A;  2NST A;  1JRG A;  2X6Y A;  4MXN A;  1O8H A;  1XG2 A;  1OFL A;  4OJ5 A;  1IDK A;  4XN3 A;  2NTQ A;  2QX3 A;  4XMY A;  3GQ8 A;  4XLH A;  2VBE A;  3VMV A;  4OJL A;  1IA5 A;  1O8G A;  2X3H A;  4OZY A;  4OJ6 A;  2O1D A;  1BN8 A;  2PYG A;  2X6W A;  3GRH A;  1O8L A;  2BSP A;  2UVE A;  2PEC A;  4C2L A;  1GQ8 A;  1O88 A;  3FY3 A;  1H80 A;  2X6X A;  4OJP A;  4XLE A;  4U4B A;  1RWR A;  4YZ0 A;  4XON A;  2Z8G A;  1AIR A;  1EE6 A;  1KCD A;  4XR6 A;  2VBM A;  4YEL A;  3LMW A;  2UVF A;  4OJO A;  4XL9 A;  2INU A;  3VMW A;  4XOR A;  4Z05 A;  2VJJ A;  4XOT A;  2ODL A;  3KRG A;  4PMH A;  3GQA A;  4YZX A;  1DBG A;  3VSU A;  4Z03 A;  1KCC A;  2NSP A;  1RMG A;  1IDJ A;  2O17 A;  4Z06 A;  1PE9 A;  2INV A;  1O8D A;  4YZA A;  4U49 A;  4W8T A;  4EW9 A;  3WWG A;  5C1C A;  1OGO X;  1O8K A;  3UW0 A;  1WMR A;  4AVZ A;  4MR0 A;  3B90 A;  4W8Q A;  2NZM A;  3GQ7 A;  4URR A;  3EQO A;  4OZZ A;  1HG8 A;  2VJI A;  2PYH A;  3ZPP A;  5C1E A;  3B4N A;  4I84 A;  1O8I A;  1PLU A;  1QJV A;  1OOC A;  2O0W A;  4W8S A;  1NHC A;  4XN0 A;  1O8F A;  2QY1 A;  1O8M A;  1PXZ A;  4NK6 A;  4XOP A;  4XQF A;  1KTW A;  1VBL A;  1DBO A;  1OGM X;  3B8Y A;  4XLF A;  3VST A;  1K5C A;  2NTP A;  4HWV A;  1OFM A;  3JUR A;  4XLA A;  3T9G A;  2X85 A;  2NT9 A;  3EQN A;  3VSV A; 
#chains in the Genus database with same CATH topology
 4ZDO A;  3U1K A;  3KYD B;  1QA6 A;  1FDR A;  5F4M A;  4KIB A;  1OB0 A;  3CP8 A;  5DDG A;  1TWC J;  1I5Z A;  3NWT A;  4P9U A;  2E19 A;  4FE7 A;  1QGA A;  4RMN A;  1WI3 A;  3OYL A;  3W5V A;  3OIQ A;  3ELK A;  3SEQ A;  1BI0 A;  3I5U A;  3R60 A;  1VFC A;  4L5I A;  2CS3 A;  1JE8 A;  3WNB A;  1SEU A;  4OPO A;  3JSP A;  1VF7 A;  5J40 A;  5B66 C;  2VUM J;  1JTY A;  1EA0 A;  2HOT A;  4CH7 A;  4M73 A;  3JRG A;  4P3Y A;  2CO5 A;  3K4K A;  4Q48 A;  2XF5 A;  4U0Y A;  4RB1 A;  3M3Y J;  1I39 A;  1K4Z A;  3JRF A;  1YLO A;  1TYU A;  2RC6 A;  4ZCI A;  2LTP A;  2V9P A;  4BBS J;  3BPV A;  2Z2S B;  3HYI A;  1E3Z A;  3JW4 A;  2PYG A;  3JSO A;  2JN9 A;  3KYC B;  2JQ7 A;  5BOX A;  2WY8 Q;  3W6J B;  1ZAO A;  4C2L A;  3BCF A;  4HQM A;  1STZ A;  5KSW B;  4DBR A;  2JRM A;  1R9T J;  1LQ1 A;  1Y8R B;  3BQY A;  5BMZ A;  2F5E A;  1G6N A;  4F92 B;  2Z8G A;  3LST A;  1VQ8 I;  4S04 A;  2BBY A;  3WTS C;  3DDY A;  4TMT A;  3J81 Z;  2NS7 A;  2FU4 A;  5J1U A;  3H3V K;  3P9C A;  4LBW A;  1RKT A;  2M0C A;  2B0L A;  4XOR A;  1OKR A;  1X1D A;  1I6H J;  5IYN A;  4V2G A;  1MGT A;  1N0V C;  1MMD A;  2GIV A;  5DYM A;  4PMH A;  3DPT A;  3S16 J;  1VF9 A;  2HYG D;  2P5K A;  3ABK H;  3I58 A;  3OAA A;  3OV8 A;  2BY2 A;  3HZJ A;  1P4A A;  2JJ7 A;  2M5S A;  1B23 P;  2NSP A;  1JJ8 C;  2DQR A;  1ZG5 A;  2QBY B;  3TP0 A;  1VQP B;  3ERM A;  2GXG A;  2D45 A;  2Q2E A;  4AYB N;  5CLS A;  3FXL A;  3RI4 A;  1E1Q A;  1N8R D;  3SY2 A;  4JX6 A;  2XGD A;  1FBS A;  2CW7 A;  3HBL A;  3WWG A;  2ZJP F;  1ZM4 A;  3HSE A;  2W4S A;  3BTI A;  3U6B A;  1XCV A;  2HDW A;  2V9K A;  1IN4 A;  2R7S A;  1D0Y A;  1DPU A;  1L1I A;  3HIF A;  1U5T C;  3B73 A;  1VQL I;  3LQR A;  5E79 C;  1A04 A;  1U3E M;  3ZMZ A;  4QUZ A;  2ID6 A;  2DIE A;  3PIO F;  2ZZF A;  2HNH A;  4ROX A;  4RM3 A;  3ZUG A;  3IAM 2;  5GPA A;  4KIC A;  4WQM A;  1OGI A;  1PP7 U;  3O6B B;  4EJV A;  3JRA A;  3CPW B;  3WBK A;  5J1Y A;  4FX0 A;  2FVG A;  1BR4 A;  1OFC X;  4EMS A;  1B8I B;  2P6T A;  4LBV A;  3CUO A;  1R5N A;  4L9V A;  1ZAR A;  1FRQ A;  1UD8 A;  5K5O A;  1Y56 A;  4OOS A;  3HOW J;  4ACA A;  3QPL A;  2DO7 A;  2QMU A;  3DU5 A;  3E6D A;  3OMY A;  1O8M A;  1N75 A;  1VI0 A;  2QQA A;  1DAR A;  3OZW A;  4N4O B;  4BHB A;  5M3F J;  4X7D A;  1G3Y A;  2Z1D A;  1HW2 A;  3P27 A;  1DBO A;  3DPL C;  2GM4 A;  3GTG J;  2ZZE A;  1IAW A;  2VB6 A;  2NVY J;  4BBR J;  3DLL F;  3DFG A;  3N97 A;  2ZJQ F;  3BNW A;  3JUR A;  2V7F A;  1A8P A;  2VBZ A;  3ZXS A;  4CSW A;  4E70 A;  4DBQ A;  2H8R A;  1JB9 A;  3ONU A;  2L7F P;  5BSY A;  1RES A;  2GIZ A;  2CWE A;  2DMT A;  2QN6 A;  2WPD A;  2XGJ A;  2FBK A;  2DMN A;  3CC7 B;  2DPD A;  4XM3 A;  1Z0X A;  2VJ5 A;  1MJA A;  4BU2 A;  3HTS B;  3BWG A;  1YHQ I;  5EZH A;  2P6S A;  4EEF G;  1N78 A;  4KH3 A;  1A6I A;  3FKI J;  1D5Y A;  3CO7 C;  1ZGW A;  4PZJ A;  5J8C A;  5E3O A;  2OBP A;  2XPW A;  3MCA A;  1ORK A;  3VOE A;  4AU7 A;  4BAY A;  2V7Q A;  3W2A A;  2DCU A;  2XB0 X;  4OJ5 A;  3VO2 A;  2FUG 2;  3CDI A;  1Y0N A;  2RC4 A;  3BTC A;  5FJ8 J;  3Q6Q A;  1SD6 A;  4XMY A;  3VPR A;  3ABU A;  1ZG1 A;  1FMW A;  2YWH A;  3A8I A;  3BH6 B;  2RN7 A;  3QWL A;  1POG A;  2JVH A;  3OSF A;  1G7R A;  3VO1 A;  4IL6 C;  4YFX F;  4IHS A;  1ONV A;  1EF4 A;  3HOT A;  4F7Z A;  1MSE C;  2E2H J;  2HOS A;  1U2W A;  3V7A A;  1GQ8 A;  1B72 B;  3K6G A;  2X48 A;  2MG4 A;  3LA3 A;  2JA5 J;  5IY5 H;  2XF6 A;  4N9I A;  1FOX A;  2R6H A;  2MGQ A;  3J7Y J;  1DUX C;  1UD2 A;  2ELH A;  2EFW A;  1JKQ C;  1MMG A;  1ZR2 A;  1SKY B;  2X3U A;  4Y7C A;  2O9L A;  3PQK A;  2ZME B;  1J75 A;  2XKO A;  4KFC A;  2WWY A;  1JGS A;  2M34 A;  2IGO A;  1YFH A;  3L2R A;  2DMU A;  1YRN A;  2YU9 J;  4IHY A;  2F43 A;  1IG7 A;  3HHG A;  2D9R A;  3W2E A;  3JRC A;  2JT1 A;  2A6H F;  2W00 A;  3MKY B;  1S7E A;  3GVJ A;  1HCR A;  2DN0 A;  2XUB A;  3UR3 C;  2XVC A;  5FLX Z;  3CD6 I;  2JRT A;  4YZA A;  2BY3 A;  2DOD A;  3GVK A;  4G7H F;  4L0Y B;  1D0X A;  2FRH A;  3ASP A;  4M2L A;  3F9K A;  2R7R A;  1R5G A;  3DBL B;  4ENJ A;  1FNB A;  4N0B A;  2RKH A;  2NS0 A;  3B90 A;  2Y48 A;  3BT9 A;  3SQN A;  4D0P A;  1KRH A;  2PBI A;  2W7N A;  2D3L A;  3C1D A;  1HG8 A;  1OFD A;  2YSR A;  3RDI A;  2F5C A;  1K79 A;  3KL9 A;  3MKW B;  4B44 A;  2RNG A;  1SFX A;  4MFD A;  5HS7 A;  2EV5 A;  2JJ2 A;  3G6E I;  2EH3 A;  4L18 B;  2XGX A;  3AST A;  4XD7 A;  1VQ8 B;  1FY7 A;  4HF2 A;  2PMZ A;  2GA1 A;  2UZK A;  4DNR B;  2AXL A;  1F43 A;  3WY9 A;  1T6Z A;  1PVE A;  4RAZ A;  4OIN F;  1TP4 A;  3NAU A;  1H88 C;  1AA7 A;  2Y0S A;  2IS2 A;  5IYP A;  2DA5 A;  5EJC A;  3ZMU A;  2Y69 H;  1OFE A;  2FOK A;  2E2I J;  2PJP A;  1UMQ A;  4S0H B;  1MH4 A;  1K5C A;  4Y9U A;  2Z16 A;  1YJN I;  5ICE A;  2VC0 A;  1XSX A;  5LLQ A;  1VQ4 I;  3S15 J;  2BN4 A;  3T9G A;  1FWZ A;  3E5X A;  3K2Z A;  4RBO A;  2K40 A;  5DSZ A;  2QEX B;  2OTL B;  1MZB A;  2VL8 A;  4YAO A;  3GQ9 A;  3VSV A;  3A0H C;  1W1W E;  4FK8 A;  2MLG A;  1AU7 A;  2JJ1 A;  1CZF A;  3ZZ0 A;  3WGG A;  2OBR A;  1G2H A;  2EIN H;  3SFZ A;  1KJZ A;  4LD5 A;  3B78 A;  2D1V A;  5LMZ A;  2JK3 A;  3LQ6 A;  4P55 A;  1O8E A;  2XT4 A;  2LBF A;  1JHH A;  2JA7 J;  1J0R A;  1ETW A;  4KT6 A;  3ZMV A;  4GGG A;  1ETX A;  5IYC J;  2H27 A;  3GTQ J;  2K4B A;  1QRC A;  4LMY A;  2KZG A;  5LHH A;  4IEJ A;  1Y0U A;  5EEH A;  2OTJ I;  1JJ6 C;  4G94 A;  1K7A A;  3BG7 A;  3R6J A;  3OYA A;  2VOP A;  2OZU A;  4UZE A;  2CQK A;  3OIP A;  2E1M C;  1GJR A;  1KQ9 A;  1MD0 A;  3FPP A;  2VFP A;  2X1C A;  3CPX A;  2R9V A;  4G7X A;  4BJT A;  2HPM A;  2EA4 A;  3PO2 J;  4EM2 A;  3WTT C;  2VQG A;  3Q3A A;  3CCM B;  3VYU B;  2IGN A;  1WOO A;  4P3I A;  2O8K A;  1X2N A;  2V5I A;  2VFN A;  3WTV C;  3GBG A;  1W36 D;  4DW6 A;  4ZC3 A;  5HLT A;  3CJT B;  1Z3Y A;  3JRH A;  3SYT A;  2D5V A;  2ICW G;  1TSP A;  1S29 A;  4OWR B;  2XRN A;  2M5W A;  3OYI A;  1JT0 A;  2QTL A;  2MH2 A;  2XB5 A;  1YJW I;  2QTZ A;  3BC9 A;  4Z4U A;  1AIR A;  3E0J B;  1KQ5 A;  3T0Y A;  2XC7 A;  1K73 D;  4XL9 A;  1JJ2 B;  1BMF A;  2FSW A;  2ODL A;  3DPU A;  1V5V A;  1K28 D;  2F1M A;  3LSJ A;  5J6X A;  1T39 A;  2R5Z A;  2H1K A;  5FKK A;  1EFC A;  1CLW A;  4P22 A;  1KQ0 A;  2LY9 A;  1S7A A;  2ELK A;  3CLO A;  1ZYR F;  4L9T A;  2V79 A;  3CME B;  2PQ8 A;  5DNS A;  2GK6 A;  2LOO A;  5CVU A;  2VE8 A;  1W9X A;  4YXW A;  4CQJ A;  4NDL A;  2HEO A;  3WTW C;  1MNE A;  3HXL A;  4E0F A;  1YYV A;  2IGM A;  4KKT A;  4FET A;  5D6E A;  4OIQ F;  4FN5 A;  2LRD A;  1S7O A;  3DTK A;  3TOB A;  3ISX A;  4A3D J;  4ENK A;  2DTR A;  3M7G A;  2ZFW A;  1Y1W J;  1BL0 A;  5JI6 A;  3R0A A;  1EWY A;  2F4O B;  1QRY A;  5TRD A;  2XAQ A;  4L5J A;  1JA1 A;  1F5T A;  2PFB A;  4IO9 F;  1WP6 A;  3SLN A;  4UY8 I;  5BQT A;  1PJ6 A;  3PM1 A;  1Z91 A;  1SMT A;  1SMY F;  4LIT A;  1W35 A;  2PYH A;  4FHT A;  4P5O A;  3BCD A;  1OLT A;  2G7H A;  3MHP A;  2XZL A;  4PUS A;  1VQ7 I;  2OYN A;  3B4N A;  2ZKZ A;  5KK1 A;  2E5N A;  4HEA 2;  2LRE A;  1MBK A;  3V4G A;  3AVU A;  1XC5 A;  2MD0 A;  2Z3Y A;  3NAW A;  2K4J A;  1QZE A;  3ZQF A;  1IB0 A;  3V42 A;  1J7K A;  2PMZ N;  2KFD A;  1HKT A;  2RVC A;  3E20 A;  3BR3 A;  1PXZ A;  1YX3 A;  3CCY A;  1I7P A;  3R6S A;  1F20 A;  2CF4 A;  1W0J A;  2CQQ A;  1WJE A;  4B3F X;  2V4D A;  3VYS B;  3VST A;  3QAH A;  3IRQ A;  4KKU A;  2FD5 A;  3TW7 A;  2WZN A;  5GAD J;  3H5R A;  2EFG A;  3RPU A;  4HE5 A;  3CCL I;  3PO3 J;  4M53 A;  2WA0 A;  2EZH A;  3O2P E;  3CCE B;  2E34 A;  1BA5 A;  4WF2 A;  4LB5 A;  4IF4 A;  2DFF A;  4YZQ A;  1TTY A;  4D7M A;  4ZTJ A;  3CCR B;  5L3D A;  3LA2 A;  1Q1H A;  2DOG A;  2P5L C;  1BPL A;  2L01 A;  1IB4 A;  3P7N A;  1X3W B;  2EA2 A;  3NB2 A;  2FBH A;  1QUE A;  4U88 A;  3F8M A;  2WV1 A;  4IJA A;  3OJX A;  2CUF A;  1O57 A;  4D5C A;  5B1B H;  1W7P B;  3ECO A;  5H6Q A;  1BX1 A;  4MYU A;  3PSZ A;  4S05 A;  3VYR B;  3VNV A;  5E18 F;  3AVY A;  2LLK A;  4LIU A;  4CHU A;  1E43 A;  1S4M A;  3L2V A;  5J3L A;  4ZGN B;  3HPG A;  1OR7 A;  2L9R A;  3L9F A;  2ECB A;  3QOE A;  5JLW A;  2GA2 A;  1QO0 D;  4M6Y A;  4YAL A;  3M9A A;  4NBQ A;  1MAB A;  4C0S A;  2VBE A;  3VMV A;  4M74 A;  2E35 A;  3H9Q A;  2ZXW H;  1R23 A;  5BPI A;  2IRF G;  3S93 A;  1WPC A;  2ZIT A;  1V55 H;  2Y31 A;  3OOU A;  3FF5 A;  4HX4 A;  4II3 A;  4HLY A;  3S14 J;  3VMF A;  1B1B A;  2ESN A;  2BSP A;  3F22 A;  1MMS A;  2DA3 A;  3OYD A;  3M1C A;  4JP0 A;  1LE8 B;  2QGG A;  3F72 A;  5JVG F;  3KE2 A;  4NCN A;  1USS A;  3OS0 A;  1Y8Q B;  1H80 A;  4ON0 A;  3V8J A;  1QQ1 A;  1E0E A;  5JVT A;  3OZV A;  2K9M A;  1BJZ A;  3BTJ A;  3IH4 A;  3MQ0 A;  1XDS A;  4F3Q A;  3RPU D;  1WJC A;  2HOE A;  1FZP B;  3OW7 A;  4Y13 A;  1VHE A;  5LRS A;  2L7Z A;  2JMW A;  1QGP A;  3R4K A;  4B4D A;  3TGN A;  3LSH A;  4X6A J;  1W34 A;  1KA8 A;  3CCS B;  5J4V A;  3RKQ A;  3BR0 A;  4HRI A;  5LRR A;  3G71 I;  2FMY A;  2PEX A;  3H9J A;  3VDX A;  4A3M J;  4Z4W A;  5HS8 A;  1ZG3 A;  3ZCO A;  1B59 A;  3J80 K;  1QG0 A;  1P6R A;  4UZF A;  4FX4 A;  4RD2 A;  1YJ9 B;  4PC7 A;  3O3K A;  1QRB A;  2P7C B;  3GYH X;  4CXF A;  1T56 A;  4N3N A;  5H59 A;  4I02 A;  4HX7 A;  5EEG A;  4DK0 A;  3D5R C;  1W5T A;  5HLI A;  1SFE A;  1WPK A;  5CVJ A;  4A0Z A;  4JQF A;  1ZK8 A;  3HKZ N;  4AIK A;  1VQK I;  3ZBT A;  5D5X B;  1YRN B;  1Q81 D;  3OP1 A;  4JX5 A;  2UWM A;  3W2W A;  2ID3 A;  1XE1 A;  4WZE A;  5HDG A;  1ZH5 A;  3GWZ A;  4HYE A;  2VIX A;  3RIR A;  1O3T A;  1AHD P;  5BSX A;  4XK4 A;  2VYQ A;  2DFH A;  1X1C A;  2RV8 A;  1O8F A;  4FTH A;  2CUZ A;  1FSH A;  3S3N A;  1H8H A;  2IT0 A;  2EZL A;  3OR1 C;  3OKX A;  1KC8 D;  1XGM A;  3CMM A;  1R58 A;  4CCO A;  4Z6Y A;  4I6Z A;  5F0C A;  1XX5 A;  2DA1 A;  4Z4Y A;  4C3J J;  2DYI A;  2AHQ A;  2DT7 B;  3BJA A;  5H20 A;  1P7I A;  1IN8 A;  5HXB A;  2XSJ C;  1DG1 G;  5LD2 C;  1BM9 A;  3D0S A;  1Z05 A;  3TO7 A;  5J1R A;  3TO9 A;  3FPK A;  4EQQ A;  2R0Q C;  3DKY A;  3MKZ A;  4NQW B;  2RQP A;  1JXS A;  3RIQ A;  3NAR A;  4LLG F;  3QE2 A;  2XSD C;  3A35 A;  3GQB A;  3OPO A;  2IQ7 A;  4KYW A;  2XPU A;  3LWF A;  2O3F A;  4Y33 A;  3I4M J;  4AD9 A;  4YEJ A;  2K27 A;  1SAU A;  4ZJZ A;  1J9Z A;  3CTA A;  1O8J A;  2O0V A;  5E3N A;  4MLO A;  2I10 A;  4U0V A;  4CUG A;  2HGC A;  3C2B A;  5ILU A;  1OPC A;  3TDZ C;  1O3R A;  2R7V A;  1RU4 A;  2CRV A;  5DM6 F;  4YIF A;  5EMN A;  4RGX A;  3SZP A;  1KQS B;  2P3M A;  1FJL A;  3CCS I;  2XDV A;  2GJK A;  3H09 A;  4BXF A;  1LDD A;  3ZOB A;  3CB4 A;  2I5U A;  4XN3 A;  4GO1 A;  1BIB A;  4DIQ A;  4HST A;  3AVV A;  3BG5 A;  2L4A A;  2ELJ A;  3ERE D;  2PN6 A;  3FXM A;  4LLL A;  4ITV A;  2JSP A;  4DYR A;  2KJB A;  3BJO A;  5IOY A;  1AKH A;  5KNL A;  1G7S A;  1OB5 A;  2C4T A;  4LIV A;  3LNN A;  4OM9 A;  1S5L C;  3WG7 H;  2R7O A;  1KGS A;  1V5F A;  1IJF A;  1OMI A;  4H0E A;  5AIP A;  1SC7 A;  1HW5 A;  1R36 A;  1O88 A;  3MZ8 A;  2R5Y B;  4BHC A;  4B47 A;  3VSK A;  1TYX A;  1ODD A;  2V7X A;  1T0F A;  3AG4 H;  1OYW A;  1UAA A;  2BHY A;  1N0U A;  3E5U A;  5EG0 B;  1X58 A;  3I64 A;  3ZRG A;  3LSP A;  3CO6 C;  1YO5 C;  5KHD A;  2QKL B;  2KZV A;  3I55 I;  4E7K A;  1N25 A;  2ZBK A;  5HS9 A;  3FMS A;  3CDH A;  1Y6I A;  4QFM A;  3W2V A;  1SFU A;  3RYP A;  1VQ5 B;  3S1M J;  1EFR A;  1BJK A;  5EYR A;  2DET A;  2X6O A;  3V8K A;  3FJO A;  1WOR A;  1QUF A;  4QIW N;  4HF0 A;  3I4P A;  1IN5 A;  2YX7 A;  1WZ2 A;  3P9I A;  3IV5 A;  1R49 A;  2WAQ N;  3FXU A;  4PK4 A;  4UZU A;  3MEX A;  1K83 J;  1COW A;  1BIA A;  2ADU A;  2P5V A;  2HVQ A;  3RQI A;  1OB2 A;  3SXY A;  3PUN A;  1EXM A;  1TYV A;  3LYC A;  5JHF A;  1X4O A;  5EGO B;  4C2M J;  2HKO A;  3KYL A;  3HOY J;  1E3X A;  1N07 A;  3FM3 A;  2VI6 A;  2ZO4 A;  2QYO A;  4N9H A;  1R5O A;  2KVO A;  2FNP A;  2A69 F;  3C7J A;  1FOK A;  2QEN A;  4A3L J;  1WXR A;  3U9G A;  4BH9 A;  3BC8 A;  1KU9 A;  4BPR A;  4I84 A;  4A6E A;  4B4C A;  3M4O J;  4Z1M A;  2DU9 A;  4MYT A;  3P5J A;  1FYL A;  2YU3 A;  4CYD A;  1ZR4 A;  1H85 A;  3FDY A;  2LFB A;  5DEQ A;  3Q5F A;  1KU2 A;  4FE4 A;  2R92 J;  3WYA A;  1TNT A;  4KJZ A;  3AFH A;  3OYK A;  3KP4 A;  2BV3 A;  1ZTR A;  2X1E A;  2NNY A;  5FIU A;  3L1P A;  3FMR A;  4DQ2 A;  2FQ3 A;  2O6G E;  4XQF A;  3JX8 A;  1B9M A;  1PUF A;  4I09 A;  4RCZ A;  1H8E A;  1SVO A;  1V54 H;  1KON A;  5F6F A;  4KT5 C;  1VQL B;  3RYR A;  2BXY A;  4N3G A;  3E6C C;  4ACB A;  1VZ0 A;  4EJW A;  2IVM A;  3TW6 A;  4OIO F;  2IBD A;  5FKM A;  2OD5 A;  4XLC A;  3TKY A;  1YIT I;  1S6L A;  1D3Y A;  5CJ9 A;  3SHF A;  1ZRD A;  5HDN A;  2P0W A;  3RKY A;  3D5L A;  4TT3 A;  5M5X J;  5FO5 A;  5IYB J;  3QSY A;  1O4X A;  1IN6 A;  2H1L A;  4WCG A;  3QPS A;  2QXZ A;  4A2U A;  1IUF A;  4KMF A;  3I53 A;  2R7X A;  5A8A A;  4RA2 A;  5KVR A;  4PDK A;  5ICF A;  4HNV A;  4JMQ A;  2HQR A;  3SZT A;  3HRT A;  4MFE A;  4E7J A;  3JRB A;  1K78 B;  4UNO A;  1BOB A;  2XRL A;  1FIP A;  3BG3 A;  1XGS A;  2L7K A;  3JQQ A;  4J01 A;  5THX A;  4U0W A;  2VBY A;  2HDN B;  5L3B A;  3ZQ7 A;  5ERI A;  2G9W A;  1G3T A;  2XAF A;  3BR2 A;  3KET A;  3BR5 A;  1O8G A;  3MAJ A;  1E64 A;  1U8R A;  2R7Z J;  3H92 A;  3K69 A;  2CV0 A;  3QU3 A;  4Q47 A;  3HUG B;  3JTH A;  4NBS A;  1TWF J;  2M45 A;  3CCJ I;  1W0U A;  2H09 A;  1IRX A;  5JFR A;  1UD4 A;  1CGP A;  3G05 A;  2DER A;  1YIJ B;  2LSO A;  2VPR A;  1UG2 A;  3R61 A;  2X6X A;  4A3F J;  1WJD A;  2Y9Y A;  2ZCW A;  1VQ9 I;  1RRJ A;  1OYI A;  1M1E B;  3DXJ F;  2NPF A;  4YEL A;  1R4M B;  2L9S A;  3BPX A;  2WB1 N;  1BI2 A;  3DTE A;  2OPT A;  5K7F A;  5DUI A;  1CNF A;  3O8G A;  1KMH A;  4A3I J;  1L3L A;  4PJL A;  3DU1 X;  1RC9 A;  4E7Z A;  3ML3 A;  3F6V A;  3CCR I;  3F21 A;  1XSV A;  1QA3 A;  3FK7 A;  3HRU A;  1BN5 A;  2ZNZ A;  3S1R J;  3S8P A;  1ELO A;  3J7Z I;  3OYF A;  2R7Q A;  3P4G A;  1MBE A;  1MND A;  2H6C A;  1ITY A;  4DNT B;  5JBQ A;  4M72 A;  3U21 A;  1OCZ H;  1I3A A;  2NAZ A;  1UFM A;  4P1W A;  3SDB A;  3TMO A;  5LFA A;  1BX0 A;  1D8J A;  1VQK B;  3PSS A;  2QZ8 A;  3L7W A;  3PNY A;  2VBX A;  2WYR A;  2XT2 A;  1OQY A;  4AVZ A;  1SFO J;  2VOO A;  2JPB A;  4TMZ A;  4E6K G;  3KP6 A;  1FSE A;  2L2O A;  3GVA A;  2L0K A;  3WU2 C;  1IN7 A;  2BVM A;  2GAU A;  2FX3 A;  1LVK A;  2LG4 A;  2AO9 A;  3F8C A;  3OYM A;  2FA5 A;  2I1L A;  3ASQ A;  3DCF A;  1FIA A;  1OCR H;  2KRC A;  4BXU A;  2NS8 A;  1VQN I;  4I7H A;  1QU3 A;  1QJV A;  3ONQ A;  4XLP F;  1IUY A;  2GBY A;  1YIJ I;  3GTP J;  1DDI A;  5IP6 A;  1BI3 A;  3OFN A;  2QBY A;  1TWG J;  3MKL A;  1WHU A;  2NXN B;  3F8N A;  5FD6 A;  5IOZ A;  3J80 Z;  1GV5 A;  4U9U A;  1Z77 A;  5FRO A;  2NV4 A;  2RRE A;  4XSX F;  1JI8 A;  3TBI A;  2NYX A;  1DP3 A;  3I1F A;  4ESF A;  2O61 A;  1Z67 A;  3RPQ A;  2VKH A;  1W2B B;  1U0J A;  1T0F C;  2KIF A;  1VND A;  2XV4 S;  4LG0 A;  1R6R A;  3TO6 A;  2E1R A;  3JQR A;  2HI3 A;  5ILV A;  5F4J A;  5CQG A;  5FKO A;  2OQR A;  3BLY A;  2X85 A;  4RLF A;  3IWZ A;  4JX4 A;  1LB2 A;  4XRS A;  1ACI A;  4EH1 A;  3QYE A;  2NT9 A;  2O6W A;  4WK8 F;  5L46 A;  2A07 F;  3CCL B;  3GSI A;  4KN7 X;  3CF5 F;  3LFK A;  5B1A H;  3MFK A;  1BI1 A;  4G6Q A;  2P7V B;  3BH7 B;  5CVV A;  2CFX A;  1LLW A;  3P26 A;  2G0E A;  2M8E A;  4C2T A;  4M9S A;  3EUK L;  3GZ6 A;  1OJL A;  4M6X A;  1X0C A;  2JTV A;  1IRF A;  2QSF X;  4WXC A;  1VHO A;  3IL2 A;  4QVA A;  4LGW A;  4W8R A;  1D5V A;  3OYH A;  1K61 A;  4G6D A;  2YWG A;  1YIT B;  1VLY A;  4IOC F;  6PAX A;  2C2W A;  5H5J A;  1J59 A;  2NST A;  4BEH B;  4U7B A;  1RUN A;  3QQA A;  2RC5 A;  2GWR A;  2DFE A;  3TOA A;  1LM1 A;  1TZL A;  2LKX A;  1LFP A;  5FFX A;  2R7D A;  3A8J A;  1R4N B;  2LDU A;  2QQ8 A;  2K9N A;  1I6X A;  4V02 C;  2BGC A;  3CZ6 A;  3U2R A;  4OJ6 A;  1GVJ A;  1WI9 A;  4RPD A;  2HDC A;  5D4R A;  4X8I A;  2HVR A;  3MVP A;  2EIL H;  3H3U A;  3GCM A;  2WZP P;  1FOW A;  2D1H A;  1DAB A;  4R79 A;  3B82 A;  1GVH A;  2RAE A;  2PJR A;  1ZM3 A;  2Y0S N;  4P26 A;  2LNB A;  1HA8 A;  1GXQ A;  3K0L A;  2TRT A;  4MNU A;  1TLH B;  5KAI C;  2VBM A;  1UHM A;  4Z4R A;  1M90 D;  1R5H A;  2V4J C;  1EFU A;  1QVF B;  4Z05 A;  3BOQ A;  2ACJ A;  3K4L A;  3U1D A;  5IT9 Z;  4IOA F;  4OOV A;  2J8K A;  1WVR A;  2KLO A;  3VOD A;  1T6S A;  3ZQL A;  1X3Z B;  2GQF A;  2GJR A;  1W4M A;  3DP7 A;  4X05 A;  3HC7 A;  4QSH A;  3WU1 B;  4Y3O A;  2MAB A;  4XRF A;  1XS9 A;  4L5E A;  1WWX A;  2L3D A;  2Q1Z B;  2O0Y A;  5HDK A;  2K3P A;  1O8D A;  4PAA A;  2DDB A;  3OIO A;  4DGW B;  2OTL I;  5FL7 A;  4JK1 X;  2ISZ A;  4OPW A;  2BV6 A;  3CF2 A;  1REP C;  3GEZ A;  4G9Y A;  5LGT A;  4HA8 A;  1YW7 A;  2JSC A;  4G7Z F;  1MNM C;  1FX7 A;  1ZRC A;  2GXA A;  2L4M A;  4CCM A;  3WOD F;  2BM1 A;  3CCJ B;  1HSJ A;  5FO1 A;  2ZL7 A;  4OZZ A;  3K4B A;  1YI2 I;  2V6E A;  2L7M P;  4XID A;  1HXD A;  2M8G X;  1HKS A;  5D8L B;  4ZYD A;  1MDM B;  3AVX A;  5F0F A;  3SZE A;  2OJE D;  2AHO A;  1U78 A;  4BY7 J;  1OCO H;  3CCQ B;  5DM7 F;  2CFO A;  1YE9 A;  3JRD A;  1ZRF A;  4ZYE A;  4TN1 A;  4UVC A;  3ZGK A;  1RIO H;  3OW2 B;  1K8A D;  3BJ6 A;  2GOX B;  4WZL A;  3F23 A;  1RKW A;  2P8T A;  3HSF A;  3BG9 A;  5KAF C;  3NRV A;  4ZZD A;  5LEJ A;  3ZP5 A;  2ZL6 A;  3PA1 A;  4LBY A;  1TWA J;  4EM0 B;  1DU0 A;  1PJ5 A;  2CC2 A;  2EK5 A;  2P81 A;  3SJZ A;  4HF1 A;  1IDY A;  1Q9S A;  4W1U A;  5FO0 A;  2QA4 I;  2K85 A;  4UUS B;  2PX9 A;  4L9J A;  5B6I A;  2H94 A;  4XLA A;  4ZCM A;  1GXP A;  1R71 A;  4EGY A;  3W5U A;  2BY1 A;  1BW5 A;  2GQQ A;  3T56 B;  1QGZ A;  4Q7J B;  2QF7 A;  1SD4 A;  2ZME C;  4HBL A;  4UHT A;  2BMW A;  3RY8 A;  1U2R A;  2XND A;  3CCM I;  1LLZ A;  1JUS A;  3CJQ B;  5F04 A;  1G7C A;  4NK8 A;  2VXD A;  4GCV A;  2MC3 A;  4BL0 B;  4ASU A;  2E60 A;  3JRI A;  2KIS A;  1JGG A;  3EPZ A;  3KCC A;  2JA6 J;  4DK1 A;  2O04 A;  4A6D A;  4HNT A;  1VQM B;  1TVC A;  3KP3 A;  1FEX A;  2YWF A;  4WZT A;  5M5Y J;  1A36 A;  4HOB A;  2QQB A;  3TL4 X;  1H9G A;  4DQK A;  5IK2 A;  1M1K D;  3AG2 H;  3HEF A;  3BZK A;  3OEH A;  2VFM A;  4LBZ A;  5EEA A;  3H1C A;  3IH3 A;  3KLO A;  4I98 B;  4TV7 A;  1G4D A;  1IA5 A;  4OZY A;  1I18 A;  2HOA A;  2E5Z A;  3DF8 A;  1A31 A;  1IXC A;  1MKM A;  4BAC A;  1IZ1 A;  4DYQ A;  3S1N J;  1ZEL A;  2IOU G;  2KIQ A;  3HRS A;  4M6V A;  2TCT A;  3BCB A;  2C6Y A;  3CC4 I;  1O3Q A;  4LC0 A;  2VXZ A;  3SZG A;  5GV8 A;  2V1D A;  4CCJ A;  4OJP A;  3S1Q J;  4G7O F;  2G7U A;  1QHG A;  3DQV C;  3VB2 A;  3LAJ A;  1WTH D;  1BOA A;  2OV7 A;  3PSI A;  4PSW A;  1IXR C;  1QHH D;  4BDY A;  2M4G A;  2W82 A;  1WJ5 A;  1OYY A;  3FXO A;  5C4J J;  1B2R A;  4OJO A;  3ONY A;  2INU A;  2EV0 A;  1QFJ A;  3KRG A;  3UKG A;  4YZX A;  3T1B A;  4ZYH A;  3CP2 A;  1O7L A;  2NVU B;  1F4K A;  1KCC A;  2DYS H;  1P4X A;  4HG2 A;  4U7D A;  3PJR A;  2DCE A;  4I2O A;  4G1B A;  3H9N A;  2UXX A;  2HKX A;  4G6T B;  1YG2 A;  2IA2 A;  3M07 A;  4MGR A;  3M1E A;  2IS6 A;  4YFO A;  1KK0 A;  2EIM H;  4CZC A;  2BM4 A;  2LY1 A;  4X1E A;  4AUX A;  2O03 A;  1TT5 B;  2FML A;  1ERD A;  2XAU A;  3G3Z A;  4AWX B;  2KIU A;  5TGT A;  1WQ2 A;  2MH9 A;  3FZV A;  1AOY A;  1LDK B;  4NB5 A;  2LKP A;  4M9X A;  3LSG A;  4C3I J;  2XGC A;  3WU0 A;  2IJL A;  1KYZ A;  4OMZ A;  2Z6B D;  2XGE A;  5CVR A;  1LKX A;  2F4N A;  3Q9V A;  1YX2 A;  3S17 J;  1U5T B;  1GHC A;  1HQC A;  2DA7 A;  2HMA A;  4P6Y A;  3K1M A;  2OC6 A;  3KPH A;  4OP7 A;  3SYJ A;  4W8S A;  2DA4 A;  1Z21 A;  5M5W J;  5B3S H;  1MSF C;  4ZZL A;  2OU2 A;  2CH0 A;  1K6O A;  2DW4 A;  2CRG A;  3CC4 B;  2NOG A;  2YUS A;  1XDU A;  1QH0 A;  4LOC A;  3ML6 A;  3HOX J;  1LVA A;  3GTJ J;  1PP8 F;  4UAJ A;  2OAZ A;  4Y17 A;  3DBR B;  1WSU A;  3CRZ A;  1FBQ A;  2E7W A;  3IKT A;  3JTG A;  2L9V A;  1RR7 A;  2XHK A;  4ABZ A;  2A5Y B;  4BJ6 C;  3LNQ A;  3BDD A;  2RDP A;  2KKO A;  3WTU C;  3GIR A;  2FOW A;  2ISY A;  1BHE A;  2JA8 J;  4BKX A;  1QCX A;  5AMV A;  3M8F A;  5BPD A;  3HTU A;  1ZGJ A;  4QTR A;  4QV2 A;  1XMK A;  2A6E F;  2KP6 A;  4CYC A;  1IJW C;  3QFR A;  2Y30 A;  3V7R A;  3RJP A;  4AC0 A;  5FLX K;  3KEQ A;  2XTX A;  2MFZ A;  1WH7 A;  4BQO A;  3MD2 A;  4YC5 A;  1JRG A;  1OIS A;  4RGU A;  3OYE A;  2X0K A;  2KMU A;  5IYR A;  5EG0 A;  1PKV A;  1W36 C;  2FBI A;  3G1O A;  3O8H A;  1IDK A;  4LG0 B;  1AKH B;  4YAU A;  1XPX A;  4C2U A;  2D74 A;  2B0R A;  1BR2 A;  4ZYA A;  1NK2 P;  2VQL A;  2VE9 A;  3GQ8 A;  5J47 A;  3EUH A;  2PI0 A;  2PE3 A;  1J5Y A;  4WXH A;  2ZZG A;  3GTM J;  1BN8 A;  2HLD A;  1CNE A;  1UST A;  2HFH A;  3A3G A;  2X51 A;  3GRH A;  2Z99 A;  4HE6 A;  3Q39 A;  3DEU A;  2AQE A;  1W5S A;  2ZSH B;  4MHG A;  3SEJ A;  3CC2 B;  2MA3 A;  4LLN A;  3IHU A;  2LY2 A;  1YJ9 I;  1UEL B;  1P2F A;  2AS5 F;  2WB1 A;  2NVQ J;  4BEH A;  1VQ6 B;  4ZV4 A;  3OZU A;  1SVL A;  1YX5 A;  3S3O A;  4TMW A;  4BYY A;  4R71 A;  1X2M A;  4RLQ A;  3V7C A;  2DYR H;  3L2W A;  4H4K C;  2A68 F;  2HU9 A;  3E1S A;  3MMY B;  3SDG A;  4X07 A;  4RB2 C;  4RLZ A;  2IS1 A;  2VNJ A;  1DBG A;  3VNU A;  4A5N A;  3FWE A;  5FGM A;  3P9K A;  1TT0 A;  2H8W A;  3LSI A;  4KIS A;  2DMQ A;  2F6C A;  1TYW A;  1IDZ A;  2J5O A;  1X19 A;  4KMU X;  2RQQ A;  1WSV A;  2CW0 F;  4EV0 A;  2DQL A;  2R7W A;  1OR7 C;  3W5H A;  1ZN2 A;  4W97 A;  2E36 A;  3DKX A;  5EDN A;  2A3S A;  4XRM A;  2LVS A;  4EW9 A;  2Y2Z A;  2OQG A;  4I01 A;  4JYK A;  3ABM H;  1JKR C;  1WJB A;  3H0D A;  1S72 B;  2D2W A;  3H94 A;  1Z1D A;  2R7T A;  4V2F A;  5GAH J;  1EP1 B;  2I8D A;  4BJ5 C;  2NZM A;  3TQN A;  3RSN A;  5L3E A;  2B9S A;  4HV5 A;  2K5C A;  3PA2 A;  1ETO A;  1ZLJ A;  3FHN A;  4LJZ F;  1JTX A;  3AL0 C;  1NDH A;  1WH5 A;  3COA C;  2X9D A;  5DCF A;  1JNY A;  1PLU A;  2W57 A;  4LB6 B;  1RPW A;  3LA7 A;  1OOC A;  4G12 A;  1XMA A;  4HV6 A;  2Q8K A;  2V1N A;  1JKP C;  4ZH4 F;  1I50 J;  4HDU A;  2ZJR F;  3HKZ A;  1F1Z A;  3MWM A;  3CW2 A;  1PUF B;  4M1K A;  2X4H A;  1TBX A;  4XOP A;  1R22 A;  1S72 I;  1YOV B;  2P4W A;  1JT6 A;  2EIJ H;  2FEZ A;  3PFI A;  2BEO A;  5IP7 J;  5FFZ A;  4AC9 A;  1IF1 A;  1APL C;  3CUQ A;  3KEO A;  5J4Y A;  1V4R A;  1V5G A;  1Z3X A;  3BZ6 A;  2K9Q A;  2YWE A;  5K5Q A;  3BR1 A;  1V3F A;  2WAF A;  4AVP A;  4YRV A;  1GAW A;  3CC2 I;  2HCJ B;  2VBU A;  3JRE A;  4XKW A;  3FK6 A;  4UXN A;  2VFO A;  4L8J A;  1MMN A;  1CF7 A;  3ASS A;  2NT6 A;  1LUJ B;  4YII A;  3AVT A;  3E5Q A;  2LC2 A;  2WAE A;  1MRZ A;  2K02 A;  2M30 A;  3HHH A;  3Q0W A;  2PG4 A;  3H3Z A;  3B02 A;  2CYY A;  3PUM A;  4A3K J;  2HTJ A;  5L3F A;  4RD3 A;  4JBA A;  1SVM A;  1EJ9 A;  2OBS A;  3JCU C;  3N05 A;  1KTV A;  2VBV A;  4CZZ A;  1Z9C A;  1KK1 A;  2XAS A;  2A61 A;  3FXQ A;  4UUS A;  1OFL A;  1FTT A;  2BHZ A;  5D5U B;  4E7H A;  2MBF A;  1JUP A;  2ZXI A;  4P2N A;  1XCB A;  3E6B A;  2GLO A;  1Z7U A;  1S0U A;  1JHF A;  3G1L A;  3HUG A;  5GTH C;  2OA4 A;  4O6J A;  1Y0Y A;  2CBX A;  2FNA A;  2BSA A;  3LSM A;  5IPA A;  1OCT C;  5TJJ A;  1O8L A;  3MZY A;  2KDZ A;  2PEC A;  1PJR A;  3H5N A;  3NWS A;  1JKO C;  2G0Y A;  3M8J A;  4U4B A;  3ZMD A;  1QZZ A;  2RGV A;  2V9V A;  4LK1 F;  4E7S A;  2ZL5 A;  5H2F C;  3R6K A;  4C43 A;  3CCV B;  3BY1 A;  2IA0 A;  3QFC A;  5H6R A;  1H8A C;  4XON A;  2EFO A;  5AON A;  1F60 A;  3IC7 A;  4OAZ A;  2C5H A;  3FBN B;  2XEX A;  3SQV A;  3WHC A;  1QVG B;  3G73 A;  2CQX A;  2UVF A;  2FXA A;  3OL3 A;  4Z4V A;  4AIJ A;  2QUF A;  3IUO A;  3RQ4 A;  1D8T A;  1QBJ A;  1RZ4 A;  2MC4 A;  3KP2 A;  3RZD J;  1ETK A;  3RKW A;  3W2G A;  3CJR B;  1FND A;  4GFB A;  2OK8 A;  4OOI A;  1IDJ A;  4P9S A;  2V26 A;  2O17 A;  2HYJ A;  4B43 A;  1HKQ A;  4U49 A;  3A4C A;  3BY2 A;  3HOS A;  1XB2 A;  5DV5 A;  2VAS A;  4AYB A;  4B8X A;  3B8H A;  2BW3 B;  1O8K A;  1N08 A;  1TUI A;  3QYB A;  3A1Y A;  2IPQ X;  3I71 A;  2IGK A;  2XC1 A;  4YDT A;  1UZC A;  4URR A;  1SD5 A;  4TSF A;  3JQP A;  3ZQC A;  2PIA A;  2XZP A;  4KNY A;  3KX2 A;  2DJI A;  4FIS A;  4A12 A;  2AXT C;  2BXZ A;  2K9S A;  5C1E A;  4FT8 A;  2KRH A;  4FQG A;  1C0W A;  2J5P A;  4BUP A;  4IQJ A;  2DXI A;  2VQC A;  2R5Y A;  3H9G A;  1U6G A;  2Q2E B;  5GPC A;  1NHC A;  4TMV A;  4HX8 A;  2BOL A;  3LSR A;  3M8E A;  4R1H A;  1LPQ A;  4B09 A;  1V5E A;  4I0A A;  4AF7 A;  1VQO B;  3S2H J;  2E71 A;  4RD1 A;  1ZQ3 P;  4KN4 X;  5CPR B;  3OSG A;  3BR6 A;  3CDL A;  4BE2 A;  3WNC A;  4A0Y A;  2ZSI B;  3HM5 A;  4UV9 A;  5LHG A;  3A2K A;  3K4M A;  4Y7N J;  2LD5 A;  2Q6K A;  3SKB A;  1YJW B;  3B8Y A;  2K7L A;  3TED A;  3EYI A;  4HWV A;  4IVN A;  4ESJ A;  1OFM A;  5E8G A;  1DDN A;  1CF7 B;  5KW9 A;  2Z33 A;  4IZZ A;  1T8I A;  1B8I A;  2JN6 A;  3K4N A;  3T5X A;  4A69 C;  3I0T A;  3FIS A;  1U5T A;  2H6B A;  3RKX A;  3WQZ A;  1YW9 A;  1WSR A;  5AIQ A;  3MZH A;  3PEN A;  2HZT A;  3F0C A;  1YJN B;  4CCL A;  3T51 B;  4OU0 A;  1XQB A;  3GTK J;  3F8B A;  2K9L A;  3PFY A;  3HRM A;  3K70 C;  1NJI D;  3ZQI A;  2EWE A;  1Y1V J;  2PJR B;  1AIP A;  2V7U A;  3GFL A;  1AMO A;  3D5S C;  1FC3 A;  2BVL A;  2CUJ A;  2DFI A;  1K4S A;  2R7U A;  1PDN C;  1EFT A;  2JWT A;  4OOX A;  2M3A A;  4K2E A;  5LHI A;  3HOZ J;  5IYW A;  4MXN A;  5FNZ A;  5E3M A;  1XMX A;  2BY0 A;  2JVG A;  3CES A;  5F08 A;  5F1J A;  2E7X A;  2COB A;  3B6A A;  5F1R A;  3VR6 A;  3GO5 A;  3AGP A;  1H0M A;  2CW8 A;  2L02 A;  1E1R A;  2QKM B;  1PYV A;  1FTZ A;  3HG9 A;  3LFU A;  5FRM A;  1QA1 A;  5JMC B;  1HA3 A;  3GW2 A;  3PUB A;  2XKP A;  5FB2 A;  3K7A J;  4J19 A;  2ESH A;  1XFO A;  1RQR A;  3Q6R A;  1DPR A;  3CUQ C;  4IXA A;  4F52 A;  1SM4 A;  2DK8 A;  4WWV A;  1DGR M;  5KCM A;  5GAG J;  2VFQ A;  2XPV A;  5CQE A;  4EJO A;  2CSO A;  1NB0 A;  1PJ7 A;  3DBH B;  4Y15 A;  4RD6 A;  2VN2 A;  3IP4 B;  1LJ9 A;  3W6V A;  2QE7 A;  3V76 A;  3CQZ J;  1S9H A;  3TH0 A;  4RAF A;  5GTI C;  3GTO J;  1KCD A;  3S2D J;  1HF0 A;  2E1N A;  4UVA A;  3T8T A;  2ME0 A;  4G6I A;  1VTN C;  1DGW Y;  2E2J J;  1UG0 A;  4Z2Y A;  1EH6 A;  1UHW A;  3PNT A;  4UVB A;  3N6Z A;  1VQO I;  1MBF A;  3JU4 A;  2HXI A;  1MDM A;  4FXU A;  1K9M D;  3WGH A;  2OCE A;  4Z03 A;  4YEI A;  1BC8 C;  2E1C A;  1FMV A;  3BTL A;  1IXS B;  4EVI A;  1E2X A;  3IKV A;  4NC8 A;  4RDL A;  4DNC A;  4OPV A;  2LH9 A;  2ETH A;  2INV A;  2Y0M A;  2EBI A;  4PJM A;  4W8T A;  2W24 A;  2KQR A;  1ZM9 A;  1ULY A;  2DLL A;  5IYD J;  4MO7 A;  2WJY A;  1OGO X;  2Q0O A;  3KP5 A;  2E1B A;  1HW1 A;  2ZZQ A;  5F64 A;  2QZA A;  2CU7 A;  1TQI A;  3OYB A;  1VQ5 I;  1P7J A;  1IRZ A;  5HKK A;  1WMR A;  2DTZ A;  1WRJ A;  3FKJ A;  1RQP A;  1WCM J;  3QYF A;  1XGN A;  1X4P A;  2VJI A;  1FP1 D;  2ZXH A;  3CLQ A;  1FPQ A;  1FYM A;  5HLH A;  2BF4 A;  3I55 B;  1TW2 A;  2V1X A;  1IC8 A;  1I27 A;  4NUB A;  1NK3 P;  3Q38 A;  2CGP A;  1ZKG A;  2F5D A;  4YAW A;  1XG1 A;  4I99 C;  1Q7Y D;  4CCN A;  1O8I A;  3MN2 A;  3LOC A;  3PQJ A;  1R7J A;  3GF2 A;  4BHP A;  3A01 B;  4PCQ A;  4GDF A;  1J9I A;  2Q6I A;  3G4S B;  1U9N A;  1G8X A;  2HQN A;  2STT A;  3I56 B;  4DYC A;  1P92 A;  3GX4 X;  3C18 A;  4ZGQ B;  3BH4 A;  1KTW A;  1U8B A;  3AG1 H;  2VNK A;  3WHB A;  2GZW A;  4JRA C;  1YIO A;  1HDP A;  4AID A;  2NNN A;  1BR1 A;  4PC3 A;  4B48 A;  2LP0 A;  3L2U A;  4WX9 A;  1FNM A;  1MJ9 A;  1T08 B;  2A5W A;  2ZXJ A;  4MIM A;  3AGQ A;  3GQ7 A;  4I0B A;  4XKB A;  1N77 A;  1T2K A;  1GT0 C;  3CME I;  2MSY A;  2Y75 A;  4RDU A;  3PIP F;  1KU7 A;  1OCC H;  4XKV A;  2Z9O A;  2LZJ A;  3VSL A;  4QLC U;  1SD7 A;  2OF7 A;  4IRI A;  9ANT A;  3SUC A;  3QU6 A;  3CD6 B;  2OK7 A;  2HXO A;  3Q0V A;  3ROU A;  3CJN A;  3CXC B;  4YCQ A;  2F4I A;  2MD5 A;  3J81 k;  4DJA A;  2VKD A;  3ZBU A;  3J81 K;  5A88 A;  2W7Z A;  3K10 A;  4BGD A;  2QX3 A;  4OAY A;  5B5E C;  2DJN A;  2EFN A;  1ZLK A;  4XLH A;  2WC2 A;  4F7D A;  4BE1 A;  1FBU A;  5D5V B;  1TL8 A;  4RM0 A;  3CC7 I;  3KZZ A;  2X6W A;  3KEY A;  3WTY C;  1X1B A;  3I56 I;  1KK2 A;  1E3P A;  2UVE A;  1VLO A;  3A3B A;  1B4A A;  3GFJ A;  4G8X A;  2C78 A;  1H42 A;  4UB8 C;  1NB9 A;  2F1L A;  4PGO A;  2W84 A;  2M9H A;  4HAM A;  1VQ7 B;  1YQA A;  2IP2 A;  4UUT A;  5C3E J;  4X7E A;  4A0X A;  2DDA A;  4O3M A;  1E17 A;  4CDG A;  2BPO A;  2CV2 A;  4ZDP A;  4FWT A;  2BM7 A;  3LL7 A;  4DZP A;  5LGU A;  1UHS A;  4XR6 A;  3B6C A;  5ICG A;  2LF8 A;  2VNI A;  2F5F A;  4X0C A;  3F6O A;  2ZFU A;  1YI2 B;  3CMA I;  1WJA A;  2VBT A;  5LGN A;  1T33 A;  5E1W A;  3VSU A;  2NVX J;  1GAQ A;  1Y39 A;  1J2X A;  2V7W A;  4PC1 A;  3VEP A;  2LF7 A;  2X1D A;  5FD5 A;  1RNL A;  3ZR8 X;  1RMG A;  1YS6 A;  2K3F A;  3HDD A;  2VKV A;  1PE9 A;  1VQ9 B;  2HWV A;  2EPF A;  3WBJ A;  2JUG A;  2B7C A;  2LK2 A;  1B6A A;  4QWQ A;  1WKM A;  2C4U A;  2HR3 A;  4M3G A;  5F0H A;  5HNF A;  5L3C A;  5C1C A;  4PJ0 C;  5HOO A;  2DPU A;  1I1G A;  2EIK H;  4B3X A;  5A2Q K;  3U6K A;  5DCM B;  4EGZ A;  3CMA B;  3BRO A;  5J3O A;  1WOS A;  2MLK A;  5FA6 A;  2QM3 A;  4WZK A;  1R5B A;  3I9V 2;  1H9T A;  1I3Q J;  5IYQ A;  1EH8 A;  3LQE A;  5E3L A;  3FXR A;  4M3D A;  5LEK A;  2YS9 A;  2XAG A;  4CYC B;  2DT5 A;  2E1M B;  1R1V A;  1QVT A;  1N05 A;  1OGJ A;  5E8I A;  1TLL A;  2W6I A;  1V0E A;  5F4O A;  4B3G A;  1SAN A;  1KU3 A;  3SJM A;  3ZQG A;  4A3C J;  1QZY A;  2WY7 Q;  3HB9 A;  4RPB A;  1PUE E;  4YHB A;  2NTP A;  3VYT B;  2M2E A;  1U9O A;  5CYV A;  2HQ5 A;  1LDJ A;  1P4W A;  3I59 B;  4I76 A;  1GDT A;  1HOM A;  2XZO A;  1MJB A;  2OTJ B;  1QGY A;  3PNV A;  1MBH A;  3EQN A;  2CJJ A;  4F93 B;  1GVD A;  4U87 A;  2VNH A;  2ZBV A;  4O5V A;  5AN9 A;  4A3E J;  3RZO J;  5E20 A;  2A05 A;  3S2W A;  5LBQ A;  4RDJ A;  2B7B A;  3ZPN A;  2HDD A;  1DQU A;  2F2E A;  3EUA A;  3DWL E;  3KZY A;  4HLX A;  2QDX A;  4E7L A;  3REO A;  4BS9 A;  2A6T A;  3ZZU A;  3OYG A;  1I8D A;  1W0K A;  4ANJ A;  2XNJ A;  1YS7 A;  4P1V A;  2QVO A;  2WV0 A;  3WGI A;  2NTB A;  1ETV A;  3OS2 A;  1VJS A;  2X6Y A;  4C3H J;  4R8H A;  1QVU A;  3WTX C;  2VJ4 A;  2W85 A;  1G3W A;  3R0J A;  5BNG A;  2JDI A;  3AAF A;  2M1B A;  2COM A;  1LFU P;  3E6M A;  1YW8 A;  3IWF A;  2GOM A;  1IHM A;  4ZDL A;  4G5G A;  2HVS A;  3CCU B;  1T6Y A;  1X1P A;  1HZE A;  3AKZ A;  1T98 A;  4NC6 A;  3ZN1 A;  1KD1 D;  1NH3 A;  1QFZ A;  2IA1 A;  2W48 A;  2XIG A;  1SKQ A;  1YLF A;  2ZBU A;  3QOP A;  1W87 A;  2STW A;  4XLE A;  4D7N A;  2GK7 A;  4GRI A;  1EZG A;  1SFK A;  2IXS A;  3L00 A;  2MW8 A;  1UJ8 A;  1XB4 A;  2L5Q A;  5DCM A;  4A93 J;  3LAP A;  4G1V A;  2ZTG A;  2XRO A;  3J7A Y;  1FRN A;  3VMW A;  3K4C A;  4JOM A;  1ZUN B;  3GQA A;  5DD4 A;  4PC6 A;  3EYY A;  3K2A A;  2F48 A;  3HGG A;  2KRF A;  1BLI A;  1KZL A;  3OEE A;  2QSH X;  2BVN A;  1T5E A;  1E3H A;  3L09 A;  3BY6 A;  1EV7 A;  1GR1 A;  4BQA A;  2BZT A;  1A6Q A;  1TQM A;  4UB6 C;  3E1Y E;  1E63 A;  1ZHF A;  3DEW A;  3W6K B;  1R5I D;  1Z6R A;  4MEY F;  1TNS A;  2EFQ A;  3D1N I;  3GME A;  3ZN0 A;  4TMX A;  2XTY A;  4UV8 A;  2TDX A;  1VQM I;  1TW3 A;  1UB9 A;  3BQZ A;  4IPA A;  3OE7 A;  2M7B A;  3K4J A;  4XSZ F;  4RJL A;  3WG9 A;  1O3S A;  5TY0 A;  2JZY A;  5L3G A;  2O8X A;  2X8K A;  2WAD A;  4RB0 A;  4PJJ A;  2B7E A;  1FT9 A;  3LO8 A;  1LEA A;  3K9T A;  3OOC A;  3RCO A;  1KYW A;  4CA0 A;  3S32 A;  1QPI A;  4BQQ A;  3G6E B;  4RCY A;  3KEW A;  5FRN A;  1O7F A;  3A1P A;  1VQ4 B;  3OY9 A;  3PSF A;  3X2Q H;  4NC7 A;  2QLZ A;  1FNC A;  3E7L A;  2OZ6 A;  3WTZ A;  3A8K A;  2WSS A;  1UMK A;  2FQ4 A;  3DEE A;  3QPT A;  5HZB A;  5HLG A;  3ES9 A;  3EUH C;  4YAF A;  1FP2 A;  3ZQQ A;  3QRF F;  1OGM X;  3W2I A;  5HZA A;  4CO8 A;  2FF4 A;  2YR2 A;  1DU6 A;  3BZC A;  3K70 D;  4BDZ A;  1W0T A;  4NHJ A;  1Q1V A;  5IT9 K;  2X53 S;  2UUZ A;  5ILS A;  1IRG A;  1TC3 C;  3CCQ I;  5E1X A;  2AQF A;  2R5Z B;  3DLA A;  1FNN A;  4MTD A;  4PSX A;  2QA4 B;  2HZD A;  5JLX A;  3ZSC A;  3ULQ B;  4PGG A;  1RET A;  5CKT A;  2KT0 A;  5HNH A;  4HQE A;  1MBJ A;  3EDP A;  4C30 A;  1GUU A;  2Q6O A;  4V19 K;  2W6J A;  3FKS A;  5IT3 A;  1UD5 A;  3ZPL A;  4Q4Z F;  3AG3 H;  3IH2 A;  1HF2 A;  3KIO A;  3PVD A;  3G1M A;  3D26 A;  4Y9R A;  2R7F A;  1XG2 A;  1NHA A;  2OCC H;  1W5C C;  2N8G A;  4NQW A;  3ECH A;  2BGJ A;  3ZMS A;  2VZL A;  1E62 A;  5M3M J;  4IQ4 A;  4RB3 C;  1ZRE A;  4IHV A;  4TKO B;  2UV1 A;  3BCA A;  3CCU I;  2PLF A;  4KIT B;  3GLX A;  3NEU A;  1WDT A;  2JUC A;  3BQJ A;  2YPR A;  3JAM K;  5TR9 A;  1WOP A;  1AWC A;  4ZTF A;  1QQI A;  4Z4S A;  5DS0 A;  3C2G A;  2LR8 A;  2W1O A;  3ABL H;  4PC2 A;  3H0G J;  2KIM A;  3IAS 2;  1XN7 A;  4MQV A;  4B3A A;  4P25 A;  2M0M A;  3KFW X;  4M71 A;  2WJV A;  1ENH A;  4QVJ A;  1P9Q C;  3H36 A;  2RNJ A;  3G71 B;  1EE6 A;  3BP8 A;  3OS1 A;  2VT3 A;  4J00 A;  4M0L A;  5K7Z A;  3LMW A;  2Q6L A;  4IHT A;  1MBG A;  4II2 A;  3V7S A;  5E6T A;  4XOT A;  2VBS A;  3F3X A;  4RGR A;  2ZME A;  4KIG A;  1MW7 A;  4RS8 A;  1LEB A;  2PLY A;  3U2Q A;  4KKS A;  4WXD A;  4M9Z A;  5FLM J;  4CIC A;  2O7O A;  5HOD A;  3L2C A;  2DEU A;  4YFK F;  2F3L A;  1IJE A;  4ZYG A;  3ZZT A;  2F4M B;  3SFI A;  2EZI A;  3IRR A;  3PUF A;  4OMY A;  3AVW A;  1NRK A;  3KP7 A;  2ZC2 A;  1S3J A;  1GV2 A;  3VFZ A;  2BX6 A;  5E1Z B;  1Q82 D;  2VOD A;  1KZH A;  2R93 J;  2JA2 A;  2C5B A;  1J09 A;  1E3O C;  3K1P A;  5JHU A;  4PGH A;  2EFP A;  1EH7 A;  2EIX A;  1ETY A;  4IHX A;  4YG2 F;  1WGX A;  2QEX I;  2LMD A;  1VQ6 I;  2M4K A;  4D5F A;  5CVI A;  3Q0U A;  2O0W A;  2VBW A;  3G4S I;  2DMP A;  2DOE A;  4P6V F;  1K8F A;  5DTD A;  3FM5 A;  2DA2 A;  2OUM A;  4HIZ A;  1P4M A;  3PL8 A;  5HVQ C;  5K7H A;  1LE8 A;  1KQ8 A;  4KIF A;  4C9Y A;  3ISP A;  2CUE A;  3JR9 A;  4XLF A;  1LFB A;  2V7T A;  1D2E A;  2UXN A;  2VT2 A;  3ASO H;  5DN6 A;  5C44 J;  1G59 A;  4D1Q A;  4OIP F;  1VQP I;  4IKF A;  4ENN A;  5J35 A;  2QYU A;  4P96 A;  4EM1 A;  3OOP A;  4EAT A;  1L0O C;  4MTE A;  5DS9 A;  1HDD C;  4LG3 A;  2V7V A;  4J0Q A;  4ZCL A;  2XTW A;  1D1A A;  2Z5U A;  2DT6 A;  5K1Y A;  1D8K A;  3CCV I;  1D1C A;  1WU8 A;  4XNF A;  2EV6 A;  2DBB A;  5E17 F;  2VBK A;  1TWH J;  4K1X A;  2HQA A;  1YHQ B;  4HSR A;  1NG7 A;  4XBF A;  1K6Y A;  1W7P D;  4N4N B;  4RAY A;  2CMP A;  2ECC A;  3H5A A;  1F36 A;  1B9N A;  4PJN A;  3OYC A;  1XGO A;  1WJF A;  1O8H A;  4PFO A;  2VON A;  2DY1 A;  2BW3 A;  3HOU J;  4GYG A;  4X7C A;  3GUD A;  3H35 A;  3WND A;  2KPM A;  3C3W A;  4E7I A;  3RTR A;  3SLD A;  4RD4 A;  2R4G A;  3FX3 A;  4OJL A;  2XAH A;  5ED4 A;  2X3H A;  2HS5 A;  2BGI A;  4Z4Z A;  4EJU A;  1HLV A;  5TIS C;  2O1D A;  4HDV A;  4X06 A;  4M3F A;  3DU6 A;  1UCR A;  3A0B C;  2WTE A;  5EZG A;  1ZGA A;  2EZK A;  4OIR F;  1XSD A;  2GRE A;  2M87 A;  4AIH A;  3OL4 A;  3FY3 A;  1IO2 A;  4RD0 A;  4XRS G;  1FOY A;  3CMY A;  2L9N A;  3I3L A;  4IW3 B;  3HGY A;  2QCO A;  3OR2 C;  1Z7L A;  4X0G A;  3LJY A;  4QPQ A;  2HTS A;  1K78 A;  1T6X A;  4X7F A;  1RWR A;  2GXB A;  3HPH A;  2XOK A;  1R00 A;  1TTT A;  2IAI A;  3W3C A;  4AM3 A;  4ETS A;  5FLV A;  4RGS A;  1JUM A;  4OPS A;  4RM2 A;  5D4S A;  3BG6 A;  3G2B A;  5F27 A;  4FCY A;  3QOD A;  2C77 A;  2CND A;  4ESB A;  4CCK A;  5FKN A;  3I4N J;  4HPQ A;  3CCE I;  5D6F A;  4A3J J;  1N06 A;  3ZIA A;  4Y52 J;  1VQN B;  4QHY A;  4Z06 A;  3AK5 A;  3C2H A;  4H9G A;  1R1T A;  2JPC A;  1ON1 A;  2KHM A;  2XF7 A;  3FBI B;  3ESW B;  2PMD A;  4IRH A;  4GQN A;  1W7P A;  2QWW A;  5A89 A;  1NG6 A;  4M3B A;  3DTI A;  4BY1 J;  3QFT A;  1IW7 F;  1ETQ A;  1T95 A;  1G3S A;  1JA0 A;  1DP7 P;  4EJT A;  3NQO A;  4A3B J;  3UW0 A;  1Z6T A;  4RAG A;  2B63 J;  3MCZ A;  1QX4 A;  1FYK A;  4IHW A;  2YX4 A;  3EQL F;  3EQO A;  4L0Z B;  5JLV C;  3WXM A;  4NNJ A;  3TP3 A;  4GXO A;  3N90 A;  5EF6 A;  2VKE A;  3OYJ A;  1A5J A;  1D1B A;  5GP9 A;  3HOV J;  4A3G J;  2GPJ A;  5GV7 A;  1KK3 A;  3FHZ A;  2NOJ B;  3FXJ A;  3QP5 A;  4PAB A;  4HW0 A;  2YUH A;  2LKS A;  1LNW A;  4XN0 A;  4BE0 A;  1TQP A;  2EB7 A;  1MMA A;  3Q9S A;  4DQL A;  1QPM A;  3WE3 A;  3SJP A;  1OHH A;  2CV1 A;  5JR3 A;  2VPL A;  3TDU C;  5GAE J;  3K1N A;  4MQ9 F;  1B72 A;  2WR8 A;  4NK6 A;  3VWB A;  2MYS A;  1VBL A;  2J7K A;  4QPO A;  1ON2 A;  2EJR A;  4FAS D;  4KA4 A;  3GVL A;  2BM6 A;  4M3E A;  5K5R A;  3GXO A;  3HJE A;  2E1O A;  4XLN F;  5TV2 A;  4LK0 F;  4DZJ A;  3FMQ A;  2KL4 A;  3NE5 B;  2DOA A;  2EQR A;  3OWT A;  3CUQ B;  1A35 A;  2CW5 A;  2W25 A;  2PMU A;  1Y0R A;  4RDK A;  1E79 A;  2WAQ A;  3DV8 A;  3LMM A;  4P9F A;  3ABT A;  1RUO A;  3WE2 A;  1ZM2 A;  1EP2 B;  3OYN A;  1F9N A;  2HYF A;  2V6C A;  3MMP A;  2DA6 A;  1GO2 A;  1K4T A;  1JTA A;  4XKC A;  2NRA C;  2X0L A;  2K86 A;  2ME6 A;  4B1R A;  5DUK A;  1G7T A;  3GZ5 A;  1SAX A;  1H89 C;  1HC8 A;  2XAJ A;  4HNU A;  2KJC A;  5C4X J;  2ZNY A;  5J8F A;  3QPH A;  2NVT J;  2BM0 A;  2NTQ A;  3GFI A;  2QGU A;  4KDP A;  2FJ1 A;  4LFU A;  3E3V A;  1QA2 A;  4DOZ A;  3I54 A;  1BBY A;  3FXK A;  4F91 B;  5DD8 A;  4M4S A;  3KZI C;  1IV8 A;  1D1N A;  3HSR A;  1EKE A;  1MIJ A;  4Q5S F;  5BS6 A;  2IS4 A;  3AL0 B;  1BJA A;  2BM5 A;  3A01 A;  2F5V A;  1RI7 A;  3ZC3 A;  1OCP A;  1X3U A;  3OJW A;  4AF6 A;  4PFP A;  3EET A;  1NTC A;  2EWN A;  3V8L A;  5IP9 J;  2QSG X;  4CGZ A;  1HST A;  2QQ9 A;  2WBM A;  3E97 A;  4YZ0 A;  2ZB9 A;  4A5M A;  1CQT A;  5EGO A;  5D5W B;  1RR8 C;  4G7W A;  3ASN H;  3GTL J;  1UD6 A;  2XNC A;  4KUM A;  2CQN A;  2KDO A;  2BE5 F;  1XD7 A;  2PMH A;  2VJJ A;  1T38 A;  2B5O A;  4P12 A;  5CDF A;  2HPI A;  1EP3 B;  4Z4T A;  3F8F A;  1QFY A;  2CQ7 A;  1MH3 A;  1R1U A;  4WWC A;  4IRG A;  3UNG C;  1CQX A;  3J7A O;  3T8R A;  4YIR X;  2FX0 A;  3KLN A;  2CK3 A;  2ZTN A;  2Y9Z A;  3W2F A;  2V1U A;  1WFX A;  2L54 A;  3N4M A;  3ZMT A;  2JIZ A;  3QFS A;  2FE3 A;  3LSK A;  4E4H A;  3A03 A;  1IGN A;  3T53 B;  1FX0 A;  5D8K B;  4BNC A;  1QNT A;  5ICC A;  2R3S A;  3GLL A;  1D0Z A;  1EA3 A;  1UD3 A;  2LBF B;  1BQE A;  2V31 A;  4MR0 A;  1NBM A;  4W8Q A;  1IV6 A;  1HBX G;  2M7A A;  2D3N A;  3ZQH A;  2DK5 A;  3L2Q A;  3ZPP A;  4BQN A;  3ASR A;  3QP6 A;  2OBT A;  2VC1 A;  1S8N A;  3FIW A;  3GZN B;  3Q3S A;  2ZJ2 A;  2CG4 A;  4ASN A;  4BXX J;  2J8I A;  1YTY A;  1DDG A;  4XIC A;  4UUV A;  4L9N A;  2DAO A;  4D9J A;  1BW6 A;  2O5R A;  2DOF A;  2LYC A;  3S3M A;  2QY1 A;  3HL2 A;  2VLA A;  5FKL A;  3SEZ A;  2BYV E;  3A02 A;  4YFN F;  4MEX F;  1V0F A;  3LVB A;  4Y4R A;  1BC7 C;  1HVX A;  4IX7 A;  1FLI A;  4ENM A;  1Q86 D;  3PET A;  3JAM Z;  3I59 A;  4GYI A;  3HAG A;  3W2H A;  4HZF A;  5A2Q Z;  2IEK A;  2GJP A;  3GFM A;  2IW5 A;  1GLN A;  1XTA A;  3DKW A;  2DI3 A;  4F55 A;  2VQH A;  1I1S A;  1X1A A;  3LQQ A; 
#chains in the Genus database with same CATH homology
 4ZDO A;  4F93 B;  4U87 A;  1BHE A;  1QCX A;  5AMV A;  1OB0 A;  3CP8 A;  2IQ7 A;  3OPO A;  3A35 A;  3GQB A;  3NWT A;  2KP6 A;  4Y33 A;  4YEJ A;  3ZPN A;  1SAU A;  4ZJZ A;  1DQU A;  3EUA A;  4RMN A;  3DWL E;  3OYL A;  1O8J A;  3OIQ A;  3SEQ A;  4E7L A;  2O0V A;  4MLO A;  2A6T A;  4BS9 A;  4CUG A;  3OYG A;  1I8D A;  1W0K A;  4ANJ A;  2R7V A;  2CS3 A;  1RU4 A;  2MFZ A;  2NTB A;  4BQO A;  3OS2 A;  3MD2 A;  1VF7 A;  1VJS A;  1JRG A;  2X6Y A;  4CH7 A;  3OYE A;  2KMU A;  2XDV A;  2GJK A;  2VJ4 A;  3K4K A;  1W36 C;  4BXF A;  1PKV A;  2XF5 A;  1IDK A;  2JDI A;  4XN3 A;  4DIQ A;  4HST A;  4C2U A;  1BR2 A;  2ELJ A;  4ZYA A;  2VQL A;  2GOM A;  3GQ8 A;  4ITV A;  2JSP A;  4ZDL A;  2HVS A;  5KNL A;  2Z2S B;  1HZE A;  3AKZ A;  2ZZG A;  1E3Z A;  1BN8 A;  4LIV A;  3LNN A;  2HLD A;  3A3G A;  2PYG A;  2X51 A;  3GRH A;  2R7O A;  1V5F A;  2AQE A;  2WY8 Q;  4C2L A;  2ZSH B;  3BCF A;  1O88 A;  4B47 A;  3VSK A;  4DBR A;  2LY2 A;  1UEL B;  4XLE A;  2GK7 A;  4GRI A;  2WB1 A;  4F92 B;  1SFK A;  1UAA A;  2IXS A;  4BEH A;  3S3O A;  1YX5 A;  2L5Q A;  2Z8G A;  3DDY A;  3ZRG A;  4RLQ A;  3L2W A;  2ZTG A;  3J7A Y;  4H4K C;  5KHD A;  2QKL B;  2KZV A;  3VMW A;  3K4C A;  2HU9 A;  3E1S A;  3MMY B;  1X1D A;  4JOM A;  4XOR A;  4E7K A;  4PMH A;  1MMD A;  2IS1 A;  1Y6I A;  1DBG A;  3GQA A;  3DPT A;  3W2V A;  3OAA A;  1TT0 A;  1EFR A;  1BLI A;  1KZL A;  3OEE A;  3LSI A;  4KIS A;  2M5S A;  2F6C A;  1T5E A;  2NSP A;  1X19 A;  2RQQ A;  1E1Q A;  2R7W A;  1OR7 C;  3DKX A;  4PK4 A;  4UZU A;  4EW9 A;  2CW7 A;  1COW A;  3WWG A;  2W4S A;  1WJB A;  3H0D A;  2HVQ A;  2V9K A;  2HDW A;  2R7S A;  3H94 A;  1D0Y A;  2R7T A;  5JHF A;  1X4O A;  3OE7 A;  3KYL A;  2M7B A;  3K4J A;  2I8D A;  1E3X A;  4BJ5 C;  2NZM A;  2DIE A;  3GQ7 A;  3RSN A;  2ZZF A;  2HNH A;  4RM3 A;  2K5C A;  2KVO A;  3IAM 2;  2WAD A;  2X8K A;  4PJJ A;  3FHN A;  3AL0 C;  3BC8 A;  1BR4 A;  3OOC A;  3RCO A;  4CA0 A;  3S32 A;  4BQQ A;  4I84 A;  4Z1M A;  1PLU A;  3KEW A;  1OOC A;  1UD8 A;  5FRN A;  2V1N A;  1Y56 A;  3FDY A;  3OY9 A;  3PSF A;  4KJZ A;  3HKZ A;  3AFH A;  4NC7 A;  3OYK A;  3DU5 A;  3OMY A;  2WSS A;  2X1E A;  1O8M A;  1N75 A;  3DEE A;  3EUH C;  4XOP A;  4N4O B;  4XQF A;  2Z1D A;  3ZQQ A;  1DBO A;  1OGM X;  3DPL C;  1H8E A;  2ZZE A;  1KON A;  2VB6 A;  1V5G A;  3K70 D;  3JUR A;  1Z3X A;  2V7F A;  1VZ0 A;  4BDZ A;  3ZXS A;  4CSW A;  4DBQ A;  2WAF A;  4YRV A;  4XLC A;  2X53 S;  2UUZ A;  4XKW A;  4L8J A;  2P0W A;  1MMN A;  2AQF A;  3D5L A;  2WPD A;  4TT3 A;  2XGJ A;  2NT6 A;  3DLA A;  2QXZ A;  4PSX A;  2LC2 A;  4XM3 A;  2WAE A;  2HZD A;  2VJ5 A;  4BU2 A;  3ZSC A;  2R7X A;  5CKT A;  1N78 A;  5HNH A;  4C30 A;  3FKS A;  4JMQ A;  2W6J A;  1UD5 A;  3N05 A;  4E7J A;  1BOB A;  4AU7 A;  2V7Q A;  3W2A A;  1XG2 A;  1OFL A;  4OJ5 A;  2L7K A;  4J01 A;  2FUG 2;  4E7H A;  4XMY A;  2ZXI A;  1FMW A;  1O8G A;  2JVH A;  4IQ4 A;  4TKO B;  2UV1 A;  3BCA A;  4KIT B;  2CV0 A;  3HOT A;  3LSM A;  3HUG B;  1O8L A;  2PEC A;  1IRX A;  1PJR A;  3H5N A;  3NWS A;  1UD4 A;  3G05 A;  1GQ8 A;  3M8J A;  3K6G A;  4ZTF A;  3C2G A;  2W1O A;  4E7S A;  2XF6 A;  2X6X A;  3IAS 2;  1WJD A;  2M0M A;  2WJV A;  1UD2 A;  1P9Q C;  4XON A;  4OAZ A;  1MMG A;  1EE6 A;  1SKY B;  3FBN B;  3OS1 A;  4J00 A;  4YEL A;  2L9S A;  3LMW A;  2UVF A;  3OL3 A;  4II2 A;  3IUO A;  3DTE A;  4XOT A;  3RQ4 A;  2IGO A;  1KMH A;  1MW7 A;  2MC4 A;  3L2R A;  2F43 A;  3CJR B;  4KKS A;  4PJL A;  4E7Z A;  2W00 A;  3MKY B;  1IDJ A;  2O17 A;  2V26 A;  4B43 A;  3GVJ A;  3UR3 C;  3S8P A;  3OYF A;  2R7Q A;  1MND A;  4YZA A;  4DNT B;  4U49 A;  3U21 A;  5LFA A;  3A4C A;  3SDB A;  3GVK A;  1NRK A;  4P1W A;  3TMO A;  1D0X A;  3HOS A;  2VAS A;  3F9K A;  4AYB A;  1O8K A;  2BW3 B;  3PNY A;  2R7R A;  3QYB A;  3A1Y A;  4AVZ A;  2IGK A;  3B90 A;  2JA2 A;  1J09 A;  4E6K G;  2D3L A;  4URR A;  2L2O A;  2W7N A;  4TSF A;  1HG8 A;  2XZP A;  2BVM A;  3MKW B;  4B44 A;  3KX2 A;  2RNG A;  2DJI A;  1LVK A;  2LG4 A;  4XD7 A;  3OYM A;  2JJ2 A;  2M4K A;  5C1E A;  2KRH A;  2PMZ A;  2KRC A;  1QU3 A;  1QJV A;  4DNR B;  4BUP A;  4IQJ A;  2O0W A;  2DXI A;  3ONQ A;  2VQC A;  1NHC A;  3H9G A;  2Q2E B;  3OFN A;  2BOL A;  1AA7 A;  2OUM A;  2Y0S A;  1V5E A;  2IS2 A;  4HIZ A;  5CPR B;  5FRO A;  3PL8 A;  5HVQ C;  4BE2 A;  2RRE A;  4C9Y A;  1JI8 A;  3TBI A;  2ZSI B;  1DP3 A;  3A2K A;  3K4M A;  3B8Y A;  4XLF A;  2VKH A;  1K5C A;  1U0J A;  1T0F C;  4HWV A;  1R6R A;  2Z16 A;  1OFM A;  5DN6 A;  5CQG A;  1G59 A;  3BLY A;  4RLF A;  2X85 A;  4D1Q A;  3T9G A;  4IKF A;  3QYE A;  2NT9 A;  4IZZ A;  3VSV A;  2VL8 A;  3GQ9 A;  3K4N A;  4EAT A;  1CZF A;  4LG3 A;  2JJ1 A;  3WQZ A;  1D1A A;  2DT6 A;  1D1C A;  4CCL A;  3T51 B;  4XNF A;  4C2T A;  2VBK A;  3EUK L;  2HQA A;  2K9L A;  3PFY A;  3K70 C;  4HSR A;  2EWE A;  1X0C A;  1O8E A;  1NG7 A;  2PJR B;  2LBF A;  4W8R A;  1K6Y A;  3OYH A;  4KT6 A;  3D5S C;  4N4N B;  1VLY A;  2BVL A;  2CUJ A;  2CMP A;  2R7U A;  2M3A A;  3H5A A;  2NST A;  4MXN A;  4BEH B;  4U7B A;  3OYC A;  4PJN A;  1WJF A;  1O8H A;  4PFO A;  2BW3 A;  2JVG A;  3CES A;  3BG7 A;  3H35 A;  3VR6 A;  3OYA A;  2KPM A;  1TZL A;  4E7I A;  1LFP A;  2E1M C;  2CW8 A;  3OIP A;  3RTR A;  1E1R A;  3FPP A;  2QKM B;  1PYV A;  2X1C A;  2R4G A;  3HG9 A;  3LFU A;  4BJT A;  2HPM A;  3CZ6 A;  5FRM A;  2R9V A;  4G7X A;  2X3H A;  4OJL A;  4OJ6 A;  2O1D A;  3PUB A;  2VQG A;  3DU6 A;  3VYU B;  2IGN A;  2HVR A;  3GBG A;  4F52 A;  1W36 D;  2WZP P;  4ZC3 A;  5HLT A;  1DGR M;  3OL4 A;  5KCM A;  3FY3 A;  5CQE A;  4R79 A;  1Z3Y A;  3SYT A;  2L9N A;  3I3L A;  4U4B A;  4X0G A;  3OR2 C;  2PJR A;  1Z7L A;  3IP4 B;  4QPQ A;  2QE7 A;  4OWR B;  1RWR A;  3OYI A;  1S9H A;  1AIR A;  1HA8 A;  3HPH A;  2XOK A;  3BC9 A;  1KCD A;  3E0J B;  2VBM A;  3W3C A;  2XC7 A;  4G6I A;  1DGW Y;  4XL9 A;  1UG0 A;  2V4J C;  4Z05 A;  3K4L A;  1BMF A;  3PNT A;  2ODL A;  3DPU A;  4RM2 A;  2KLO A;  3BG6 A;  3G2B A;  1K28 D;  2F1M A;  3QOD A;  3JU4 A;  4FXU A;  4CCK A;  4P22 A;  4HPQ A;  2GJR A;  4Z03 A;  3HC7 A;  3ZIA A;  4Y3O A;  1FMV A;  2MAB A;  4Z06 A;  3C2H A;  4NC8 A;  2GK6 A;  2Q1Z B;  2LOO A;  2KHM A;  2XF7 A;  3FBI B;  2LH9 A;  2K3P A;  1W9X A;  4YXW A;  1O8D A;  2INV A;  4PJM A;  1MNE A;  3HXL A;  4GQN A;  4E0F A;  4DGW B;  4W8T A;  5FL7 A;  2IGM A;  4KKT A;  2KQR A;  1NG6 A;  4FET A;  3DTI A;  3CF2 A;  2WJY A;  1OGO X;  1T95 A;  2LRD A;  2E1B A;  3DTK A;  2ZZQ A;  3OYB A;  5HKK A;  1WMR A;  4CCM A;  3UW0 A;  3FKJ A;  3QYF A;  1WP6 A;  3K4B A;  3EQO A;  1X4P A;  2VJI A;  4NNJ A;  2ZXH A;  2V6E A;  4OZZ A;  4LIT A;  2PYH A;  3OYJ A;  1D1B A;  4NUB A;  4P5O A;  3BCD A;  1OLT A;  2XZL A;  2NOJ B;  2CFO A;  1YE9 A;  4PUS A;  4CCN A;  1O8I A;  3B4N A;  3ZGK A;  2E5N A;  4HEA 2;  2LRE A;  2GOX B;  4XN0 A;  2MD0 A;  4BE0 A;  1G8X A;  1MMA A;  3V42 A;  1OHH A;  2CV1 A;  2VPL A;  1PXZ A;  1YX3 A;  3BH4 A;  1W0J A;  1WJE A;  4NK6 A;  1KTW A;  4B3F X;  3VWB A;  2MYS A;  2V4D A;  1VBL A;  3VYS B;  3VST A;  4QPO A;  4KKU A;  4FAS D;  3GVL A;  3H5R A;  2KL4 A;  4XLA A;  1BR1 A;  3NE5 B;  2DOA A;  4B48 A;  3L2U A;  3OWT A;  2A5W A;  2WA0 A;  3T56 B;  4XKB A;  2WAQ A;  3LMM A;  1E79 A;  4YZQ A;  1N77 A;  2XND A;  4ZTJ A;  3CJQ B;  4NK8 A;  2VXD A;  1BPL A;  4XKV A;  4BL0 B;  4ASU A;  3OYN A;  2E60 A;  1IB4 A;  2O04 A;  2LZJ A;  3EPZ A;  4DK1 A;  3VSL A;  3SUC A;  4HNT A;  1JTA A;  4XKC A;  4BJ6 C;  2F4I A;  4DJA A;  2VKD A;  3VYR B;  4HNU A;  4LIU A;  1E43 A;  3TL4 X;  3L2V A;  3K10 A;  4BGD A;  2NTQ A;  2QX3 A;  4OAY A;  3HPG A;  3QOE A;  5IK2 A;  4DOZ A;  1MAB A;  3OEH A;  4XLH A;  2VBE A;  3VMV A;  1IA5 A;  4BE1 A;  3H9Q A;  4OZY A;  3S93 A;  1WPC A;  4F91 B;  1I18 A;  3OOU A;  2E5Z A;  4II3 A;  2X6W A;  3KEY A;  2BSP A;  1X1B A;  4BAC A;  2UVE A;  2IS4 A;  3OYD A;  3A3B A;  3AL0 B;  1ZEL A;  3M1C A;  2F5V A;  3BCB A;  3OS0 A;  1H80 A;  2VXZ A;  4PFP A;  3SZG A;  4OJP A;  4CCJ A;  1E0E A;  1QHG A;  2WBM A;  3DQV C;  2K9M A;  4YZ0 A;  1WTH D;  2CV2 A;  4ZDP A;  4G7W A;  2OV7 A;  3LL7 A;  4XR6 A;  3PSI A;  4PSW A;  1UD6 A;  1QHH D;  4BDY A;  2M4G A;  2W82 A;  1WJ5 A;  4F3Q A;  4OJO A;  3RPU D;  1WJC A;  2INU A;  2KDO A;  2ZFU A;  3OW7 A;  2VJJ A;  1WJA A;  5CDF A;  3KRG A;  2HPI A;  4YZX A;  3CP2 A;  3VSU A;  1KCC A;  3LSH A;  2X1D A;  4HG2 A;  3PJR A;  2DCE A;  3UNG C;  3ZR8 X;  1RMG A;  1PE9 A;  4HRI A;  2CK3 A;  2ZTN A;  3H9J A;  4G6T B;  3VDX A;  1WFX A;  2JUG A;  3ZCO A;  2IS6 A;  2JIZ A;  3T53 B;  3LSK A;  4E4H A;  1FX0 A;  4CZC A;  5HNF A;  2LY1 A;  5C1C A;  1ERD A;  1D0Z A;  2XAU A;  1EA3 A;  5HOO A;  2LBF B;  5TGT A;  1UD3 A;  4B3X A;  1LDK B;  2V31 A;  4MR0 A;  1NBM A;  3LSG A;  4W8Q A;  4DK0 A;  3D5R C;  2M7A A;  2D3N A;  2Z6B D;  4JQF A;  3I9V 2;  3L2Q A;  1LKX A;  3ZPP A;  4BQN A;  2UWM A;  3W2W A;  2OC6 A;  4W8S A;  1Z21 A;  2VIX A;  2E1M B;  4D9J A;  2CH0 A;  2O5R A;  2LYC A;  3S3M A;  1X1C A;  1O8F A;  2W6I A;  2CUZ A;  2QY1 A;  3HL2 A;  3S3N A;  2VLA A;  1V0E A;  3SEZ A;  4B3G A;  1H8H A;  1V0F A;  3OR1 C;  4Y4R A;  1HVX A;  3CMM A;  4IX7 A;  4CCO A;  3HAG A;  2WY7 Q;  2DT7 B;  2NTP A;  2XSJ C;  3VYT B;  5LD2 C;  2GJP A;  2XZO A;  1GLN A;  4F55 A;  3PNV A;  2VQH A;  3DKY A;  3EQN A;  3MKZ A;  1X1A A;  4NQW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...