2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
4XKWA 1O8LA 4YELA 5AMVA 2VBEA 1O8EA 1QCXA 4OJ6A 2INVA 2IQ7A 4OZZA 2PYHA 2VJIA 1DBOA 1JTAA 4OJOA 4AVZA 4Z05A 2NTBA 4MXNA 2VBKA 1KCCA 1JRGA 1CZFA 4XN0A 3B8YA 2EWEA 4YZXA 1EE6A 2O0VA 2NTQA 3ZSCA 1OFLA 1BN8A 3B90A 3WWGA 1X0CA 1KCDA 4XM3A 1IDKA 1WMRA 1O8MA 4YZQA 2UVFA 3GQ9A 3VSTA 1K5CA 4XL9A 2PYGA 3VMWA 1GQ8A 1H80A 1O8JA 2QY1A 3T9GA 4XLFA 1IDJA 2BSPA 3JURA 1O8DA 3SUCA 2QX3A 2X6YA 2NT9A 3GQ8A 1OFMA 2X3HA 4URRA 1IA5A 4XLCA 4W8RA 1XG2A 4XOPA 1O8FA 2QXZA 4NK6A 1AIRA 2PECA 4U4BA 4XR6A 3EQNA 4W8TA 3GRHA 1RWRA 1BHEA 3VMVA 5C1EA 2X85A 2O04A 4U49A 2O0WA 4Z06A 1PE9A 4OJ5A 1O8GA 4HWVA 2VBMA 2UVEA 1IB4A 1QJVA 3VSUA 4EW9A 2NTPA 3B4NA 4XONA 4OJPA 4W8SA 4Z03A 1OOCA 4XKVA 4XN3A 4OJLA 4OZYA 3UW0A 1RMGA 1NHCA 3LMWA 3GQ7A 4XMYA 5C1CA 4C2LA 1RU4A 4XLAA 1OGMX 1KTWA 1VBLA 4XOTA 4YEJA 2ODLA 3VSVA 1PLUA 4W8QA 2O17A 3ZPPA 4XQFA 4XLHA 1HG8A 1O88A 3GQAA 1PXZA 3EQOA 4XNFA 1O8HA 4MR0A 2X6WA 4XORA 4NK8A 1DBGA 1OGOX 4I84A 3FY3A 4YZAA 2NZMA 4YZ0A 2NT6A 2VJJA 2INUA 2NSTA 2X6XA 1O8IA 2O1DA 2Z8GA 4XLEA 1O8KA 4PMHA 3KRGA 2NSPA
chains in the Genus database with same CATH superfamily
1DP7P 2B7BA 1T0FC 1YJNI 1AMOA 2WYRA 4OJ6A 3TEDA 4YAWA 3U6BA 2JJ7A 4NC8A 2JA6J 2XGDA 3KZYA 4CDGA 3H3UA 4J01A 4BQOA 1BI1A 1IDZA 5JVGF 4P22A 3S16J 5IYBJ 3VNVA 4BDYA 5D5XB 1MD0A 1GLNA 1WH7A 2PIAA 1X0CA 1FYLA 1OR7C 4F91B 1W35A 2AHOA 1VQOI 4QSHA 3QPLA 3HKZA 4LGWA 2VOOA 3PQKA 3BQJA 3ZQ7A 1Z05A 1GQ8A 1LKXA 3W5HA 2FE3A 2QZAA 5HOOA 2WV1A 4PC1A 3T9GA 4XICA 5LFAA 2CGPA 2IXSA 1R36A 3SUCA 1N75A 2BN4A 3BH4A 3GFLA 2D74A 1A31A 3I5UA 1VFCA 1UD4A 1Q82D 1E1RA 3BR1A 2X48A 5IP7J 2QKMB 2QENA 4PC6A 1J2XA 4RD3A 1TC3C 2DYIA 4O6JA 2AO9A 3F8MA 4UB6C 5LGUA 1IJEA 4RGUA 1D1CA 3BJOA 2MD5A 3F8CA 4I76A 3GYHX 3CCRI 2BM0A 3D26A 2Y31A 3VYRB 2F4NA 1BLIA 5E6TA 2C78A 3H35A 3BY2A 3NEUA 2C2WA 2HVRA 2M4GA 3AVTA 1I50J 1K78A 4OP7A 2VBUA 2K4JA 1I1SA 4EJUA 3LQRA 1M1EB 3IWZA 2VFNA 2M5WA 2Q0OA 1HDPA 3V7RA 2ZNZA 3O3KA 2CQNA 3FMQA 3GTKJ 1T0FA 1COWA 5E3NA 4KA4A 2VFMA 2DXIA 5CDFA 2BZTA 1NHCA 2ZB9A 3N4MA 3P9IA 5CPRB 5E3OA 4QVJA 1CNEA 3ZQFA 3ZQCA 1V5FA 3BTLA 4HF2A 4V2GA 3W5UA 3FISA 2FEZA 3OYLA 2W00A 5B3SH 1SEUA 4YAFA 4S05A 2JVGA 2QLZA 1KZLA 3DTIA 3WTVC 3GIRA 4P3IA 2B63J 1D8KA 4XQFA 4G6IA 4M2LA 1FDRA 5HZBA 1G7TA 4Z4YA 5LBQA 4G5GA 3CZ6A 5FFXA 1IRXA 4JX4A 5J1UA 2E1RA 4ZCIA 5CVRA 1IV6A 1QG0A 2ZSHB 3ZIAA 1B9MA 4IHSA 1VQPI 2HVQA 3T53B 4CH7A 5B1AH 3HRSA 3HKZN 1E63A 3PFIA 1VQMI 3WNDA 1QA2A 4LOCA 2NZMA 3HXLA 1H9GA 2NSTA 4ZZLA 5JLXA 3BCAA 3DEEA 2BE5F 3TO6A 1GV5A 1LDJA 2CUFA 3A02A 2Y69H 4BXFA 1YJNB 5LEKA 3RQIA 2OTLI 4PABA 3KP6A 1WRJA 1E62A 1OCRH 4NDLA 3O6BB 5GPAA 3K4NA 3RIRA 2VPLA 2XNCA 2OC6A 1ZR2A 2P8TA 3MKLA 3FXQA 1EFUA 1Z67A 2VN2A 5LD2C 3CC4B 2Y0SN 1ZK8A 3GLLA 2GJKA 2I1LA 3E7LA 1VQ9I 1ZAOA 2V7QA 3E5UA 1K79A 4QPOA 2FQ3A 2LLKA 1NK3P 1S7AA 2VBKA 1TYXA 4D7MA 2BW3A 2DYSH 2VC0A 3ABTA 3ZQQA 1N07A 3LO8A 3CC2B 2J8KA 2WAFA 2O0VA 4BY1J 3HEFA 5HKKA 1ETQA 3Q0UA 3FMRA 3G4SI 3PSFA 2BOLA 3LOCA 3JAMK 2VE8A 3AL0C 2L5QA 1X58A 3TO7A 5HDNA 2BXYA 1Z3XA 1R6RA 4ENKA 1V0FA 1N8RD 2HOTA 4A69C 1S7OA 4PJMA 4PFOA 1BJAA 2LP0A 3QPSA 2JRTA 1WI3A 3JRHA 3Q9VA 3MZHA 2IS1A 4XKBA 3K2ZA 4Y9UA 2H8WA 2QX3A 2HOEA 4WCGA 2QEXI 3R6SA 1TBXA 2OBSA 2NT9A 4YFXF 3I58A 4BE0A 1KK1A 3WG7H 2RC5A 1HA8A 3IH4A 4LB5A 4BHBA 3O8GA 1QGYA 3LFUA 1KK0A 2VONA 4U4BA 1S3JA 3QU6A 2F5EA 3PM1A 2LSOA 5J47A 1OMIA 3OYEA 5CLSA 3IV5A 4JQFA 2R0QC 2BVNA 2HDNB 2ZITA 2DA7A 3SEZA 1B2RA 5DNSA 1QUEA 1CLWA 3D5SC 5GPCA 2CW7A 5ILVA 1JT0A 1I18A 1USSA 3F9KA 3OIPA 1J75A 1Z1DA 2WZNA 2LY2A 3GUDA 2E1BA 2VOPA 3CESA 2DAOA 1KQSB 4IXAA 3Q0VA 1QRCA 4HOBA 2DEUA 5D4RA 1OOCA 4XKVA 2IT0A 4M3EA 1MH4A 4BYYA 4HEA2 1ZH5A 3AVYA 3DU5A 2L4MA 3PUFA 4FE7A 4G7XA 3CO7C 1VQNB 1Y0UA 3ULQB 2G0YA 4RDLA 5F6FA 3FHNA 1KQ0A 2EB7A 2CV0A 4Z4TA 4GO1A 1NRKA 1I6XA 3M8FA 3IKTA 1JGGA 4RPBA 4FT8A 1XGNA 4JP0A 1KTWA 1VBLA 1ON2A 2J7KA 2PMDA 1WPCA 3A8IA 3CC7B 2DJIA 2RVCA 2A69F 2HZDA 2EK5A 4RM2A 2HOAA 5FJ8J 4FTHA 4U7BA 1CQXA 3S32A 1E1QA 1N08A 2O3FA 4HZFA 4LK0F 3ZN0A 1P4WA 4CHUA 3OYMA 2VBVA 3CCUI 2K9NA 2K27A 2ZJRF 4DJAA 2M2EA 3U9GA 1VHEA 2OYNA 1U78A 3TOAA 3MKZA 3X2QH 4NK8A 3CUOA 4WXDA 2E1CA 4K1XA 2IP2A 1PP7U 3CMAI 5DD8A 3WU0A 4DZJA 3WBJA 2EA4A 2XAJA 4J00A 1UG2A 2OQGA 1RIOH 2FNAA 4AUXA 3LSHA 5IOZA 4C2TA 2QVOA 2E1MB 2VQHA 2EZIA 2KRCA 3RYRA 3LFKA 1LNWA 2QSFX 2IS6A 4DNTB 2A3SA 2G7HA 1EA3A 2VBYA 4L9JA 4YELA 2J8IA 4GFBA 2HOSA 4KICA 3JRIA 2WB1N 2EZKA 1SM4A 3CUQB 3LSPA 5M5YJ 2VKHA 3HOYJ 4AVZA 1KK3A 4JYKA 3I4MJ 4KIBA 1UFMA 2BVLA 2ZXIA 1LDDA 3G1OA 3HB9A 3S14J 2HLDA 2M0MA 2BV6A 2HI3A 3WTWC 2WTEA 2RN7A 3ZN1A 2P3MA 3QSYA 2NS7A 4BU2A 3KEOA 5IYDJ 2W6JA 2L9VA 1O3TA 3CF5F 3F6OA 1OB5A 3WWGA 1F4KA 5LRRA 2XAQA 2JVHA 1POGA 3IKVA 3JRGA 4TV7A 2JJ2A 1MZBA 4OPVA 1RKWA 2UUZA 4WF2A 2PYGA 4HLYA 1X4PA 4A6EA 3VMWA 2I5UA 1G3YA 1TQIA 1WQ2A 5DDGA 1JJ8C 1IDJA 1YW9A 5F0CA 3COAC 2NVYJ 4IKFA 3ERMA 1ELOA 3PUMA 2W24A 2EWNA 2OJED 3OY9A 3F8FA 3FM3A 4ZYEA 2NNYA 1T8IA 4HDUA 2DMTA 4PDKA 2RAEA 3BCBA 2DK5A 4IL6C 2LY9A 3RKYA 5K5RA 3J80Z 4XOPA 1MMSA 4XKCA 4NK6A 3CMMA 2PMZN 3FX3A 2BXZA 1GVJA 1A8PA 2Z5UA 1YLOA 3RJPA 1DDNA 1KMHA 3OEHA 2ZMEC 2ELJA 2FQ4A 4H4KC 1V5EA 4P9FA 4A2UA 3L2CA 1FNMA 3G05A 4B3FX 4AM3A 1JKRC 2W7NA 3L1PA 1G3WA 1K6YA 1I5ZA 3EUHA 1D0ZA 1FBSA 4ZYGA 2IW5A 4II3A 1WSUA 3OZWA 5DSZA 1O8GA 3LQEA 3WHBA 1UAAA 3H9GA 2C5HA 4PC3A 3RYPA 2OCCH 4EW9A 4LFUA 4OMYA 1FTTA 1FPQA 3CW2A 1D1NA 3OMYA 3IH2A 1LDKB 2IA0A 3ABUA 1G8XA 3GTQJ 4AIHA 3C7JA 1MDMA 4OZYA 1V55H 1YX5A 4LLGF 3W6KB 3HDDA 2PBIA 4RPDA 2OU2A 4P25A 4X7DA 3U1KA 2GAUA 3AFHA 4AC0A 4R79A 3PENA 2RGVA 2NXNB 3G1LA 2HDDA 2R92J 4NUBA 3GO5A 2DCUA 3CCSB 2C6YA 1GV2A 1TSPA 5FO1A 3GFJA 3GF2A 1LEAA 2G0EA 1Y56A 1MABA 1PJ7A 4QVAA 5JVTA 2JTVA 4XLHA 3MMYB 4UZEA 2ACJA 2BYVE 1QGPA 1JB9A 3H9JA 2COBA 2O8XA 2X53S 5H5JA 2FMLA 4RGXA 2Y9ZA 2STTA 2HU9A 2CW8A 2LMDA 3BG6A 1D1AA 3BT9A 3R61A 4DZPA 3L2UA 1OB2A 2P81A 3JQQA 4NQWA 4TT3A 2WADA 4G6TB 4HSRA 4E4HA 2VJJA 4MLOA 1FSEA 1XSVA 5F64A 3GTOJ 1FRQA 4KFCA 2QQAA 1FSHA 3SY2A 1Z7LA 5HLGA 2K85A 4CCMA 2PMHA 2VC1A 4O5VA 3JCUC 1YO5C 3AG4H 5LHGA 3C2BA 1GXPA 1ZUNB 3MHPA 5D8KB 3WTTC 2XGCA 1OPCA 2G9WA 1IUYA 1DGRM 2WY7Q 4Z05A 3OS0A 3HHHA 4ROXA 3I9V2 4ESJA 2ZSIB 1IZ1A 1MNDA 2F2EA 3BR0A 2R7OA 3S1RJ 4E0FA 5A2QZ 3M3YJ 2KDOA 4CXFA 1TW3A 2STWA 4E7IA 1W34A 2LZJA 3OP1A 4YFNF 1MBGA 5EYRA 5H59A 1JT6A 5J8FA 2EIKH 4DW6A 1K5CA 4FQGA 1VQLB 3JTHA 1X3UA 3QYFA 4XL9A 2DODA 1W1WE 3S3MA 4W1UA 4RDKA 2EA2A 4N9IA 5HLIA 1BA5A 4EVIA 3DP7A 3DPTA 4RAFA 1DDGA 3D5LA 5HZAA 1FRNA 3QFSA 4BACA 1K61A 1R71A 4RAZA 2DBBA 1BQEA 3T51B 3KE2A 3FHZA 1VLYA 2O0YA 2MBFA 1VF9A 2MABA 3A01A 1XQBA 3Q39A 5K5OA 1YITB 3NAUA 4LG0B 4N3GA 2BM7A 4G1BA 4EJVA 3OL3A 5HVQC 3V76A 4DQKA 4KN4X 2LG4A 1QPIA 3ABKH 3E6BA 2P7CB 2LBFB 4A5MA 3W2IA 1R00A 4BE1A 1VQ8I 3V42A 1MDMB 1TLLA 1AA7A 1B72B 4BPRA 2YSRA 1FWZA 4KKSA 4E7HA 1BX0A 1XG1A 2GK6A 5BSYA 1GJRA 3FPKA 1YW7A 2LK2A 4RLFA 2NRAC 2R9VA 2YWFA 3GSIA 3CCRB 1YS7A 2KJBA 2XAFA 1ZLKA 1R1VA 1X3WB 2DN0A 3CCJI 3CCEI 2IRFG 5FA6A 5LGNA 4A5NA 2O6WA 3MAJA 1U5TA 4FASD 3W2VA 1RUNA 2PE3A 5DM7F 2KJCA 3CC7I 3BCDA 2Q2EA 2IS2A 2O6GE 1UHMA 5FLMJ 3W2GA 1RMGA 1WWXA 3TO9A 1ZYRF 4P55A 4DNCA 3LMWA 1PDNC 2ME6A 1HF2A 1WOPA 1JA1A 2QM3A 1T6SA 4E7JA 2FD5A 4P5OA 1MJ9A 4BEHB 4A3GJ 2OA4A 2L02A 2VE9A 2HVSA 1U9OA 1TL8A 4EJWA 1LE8B 3VSVA 3DEUA 1W7PD 5JLWA 4UHTA 1TQMA 2RQQA 1R4NB 1WJBA 2VBSA 3OYBA 1BBYA 3RKXA 2JT1A 1JTXA 3I1FA 2Q1ZB 3GXOA 2M7AA 4B48A 5ICFA 2EFWA 4GQNA 4CQJA 2X6WA 3E1SA 4X7EA 3LYCA 5EZHA 3BR2A 1R5OA 5EMNA 1W5CC 1BI0A 1DBGA 2XTWA 3R0JA 1BW5A 1DP3A 3CP2A 1HLVA 3BQYA 5HS8A 2LC2A 4KJZA 3LWFA 5FKMA 1X19A 4YAUA 4PJJA 4XLPF 4PGHA 5F27A 2BM1A 1UHSA 3C18A 2WJVA 2X6XA 2HTJA 3ELKA 1X2NA 2L9RA 2O1DA 1FIAA 1JUPA 3PNYA 2XOKA 3MCAA 4EGZA 3SJMA 2VKDA 3KRGA 4NC6A 4N4NB 2DERA 1R23A 3OV8A 3RDIA 3I59A 3ZBUA 1R7JA 4X6AJ 2P6SA 3ZZUA 2DFIA 4L9NA 2DYRH 4OAZA 1ZHFA 1NB0A 3JRCA 3CCLI 1Y1WJ 2EFNA 5DUKA 4N0BA 4NBSA 1S72I 1I39A 3F8BA 2XASA 4G7HF 4C0SA 2H8RA 5J6XA 5DCMA 4X06A 5HDGA 1W0JA 2HXOA 2JPBA 3A01B 3VNUA 2DA4A 2K9LA 1LFPA 1NH3A 3RKWA 2WAQA 5IYWA 3KLOA 1UB9A 3ZQLA 2X9DA 1DABA 3VOEA 3LJYA 1Z77A 3T8TA 3FZVA 3HPHA 2LNBA 1HSJA 3KYDB 2X3HA 2AQFA 3BOQA 3GTMJ 1VJSA 1FNNA 2ETHA 2R5YA 2RDPA 2VLAA 2R93J 1ERDA 1AIRA 2M34A 3ZPLA 1WJDA 2ZJPF 1XD7A 2L0KA 1KTVA 4G9YA 2WR8A 1H89C 2JRMA 1W2BB 4GXOA 3OYAA 3HOSA 1S0UA 3S3NA 2GIVA 2FMYA 3FJOA 1IXSB 1MGTA 3HGGA 4WXCA 2VZLA 1M90D 4HV5A 1WSRA 3ZQHA 4PC2A 1IB4A 1T56A 3GFIA 3ZXSA 3DPLC 1H0MA 2QUFA 3D5RC 4XONA 1RR8C 1TWAJ 4D5FA 1Z3YA 2JN6A 3BJAA 4GCVA 3J80K 2LF7A 5ED4A 3HOXJ 2BSAA 4LIVA 1YW8A 2HMAA 4C3JJ 4YEIA 4YAOA 1QHGA 2ZZEA 1FNDA 3VB2A 2M45A 5KCMA 2VIXA 3H09A 1QUFA 1ACIA 2XF6A 1WH5A 4P26A 3W6VA 1OLTA 4H0EA 1KJZA 3B6AA 3OSGA 2X4HA 2R3SA 4Z4SA 4XOTA 5IOYA 1UD3A 2E7WA 3W2EA 1SKQA 3FF5A 4XK4A 4RB0A 4B3XA 2E71A 2Q6LA 3W2AA 3ZPPA 1XCVA 2V7XA 3FXOA 1PJRA 1SMTA 2NYXA 2K9QA 2WV0A 3A4CA 4KMUX 4UXNA 2O03A 3SZGA 3TQNA 1I7PA 4X0CA 1IN8A 4EJOA 3TMOA 1SFKA 4ON0A 2GLOA 2R7SA 1Q86D 3S8PA 4D7NA 4IX7A 2TCTA 2JA8J 5E17F 3PUNA 3E6DA 2O61A 5B6IA 3I4PA 1Y8RB 1G2HA 2CV1A 3N90A 5EGOB 4PJNA 3I59B 3FBIB 3Q6RA 4JOMA 1VHOA 1K9MD 2FOWA 3ZOBA 3BY1A 3SYJA 3ZMDA 2V9KA 3B78A 2EINH 1JJ2B 4X7CA 4HLXA 2K4BA 3K4KA 3R0AA 1XDSA 4OOIA 2VNHA 3TDUC 1D8JA 3JR9A 2XC1A 1BC7C 2QWWA 3CPXA 1R5NA 4LG0A 1RETA 5BMZA 4Z4WA 2VBEA 2VJ5A 3WTUC 4YALA 3KCCA 1BPLA 1W7PA 2HNHA 2RKHA 3NARA 1XDUA 2XZLA 1IG7A 2GA1A 5DTDA 3LSIA 4CYCB 4F7ZA 3KFWX 1JTAA 1LLWA 3DEWA 5GTIC 2JA5J 2DIEA 1OCZH 1ZRCA 4HDVA 2XC7A 2GQQA 2WAEA 1G59A 4PZJA 3L2QA 3A35A 4M9XA 2EWEA 5IYNA 1VQOB 1IN7A 3VEPA 3EUAA 2HYJA 5J4YA 2YU3A 2LKXA 3P9KA 1Q81D 3N05A 4PCQA 3DBRB 4XM3A 1ZG1A 4QHYA 2J5PA 1WGXA 3HAGA 4KDPA 3FK6A 1QRBA 4GYGA 3JW4A 4I98B 3ZP5A 3LSMA 1TP4A 1ZARA 5AONA 5EEGA 1JKPC 3SDGA 4UNOA 3CPWB 5HLTA 1NDHA 4XD7A 2FBHA 5GV8A 3C2GA 1FEXA 5IYQA 4CO8A 1P7JA 3LSGA 4IOAF 3GQ8A 3TOBA 3KEQA 2GOXB 5EDNA 4DK1A 5LEJA 4Q48A 1YJ9I 4HX4A 1U9NA 3HSEA 5FKLA 4G6QA 2ZXHA 4CSWA 2EILH 1UHWA 4Y13A 3LA2A 3GTPJ 3KP2A 2BM6A 1HQCA 3QP5A 3E3VA 4M9SA 4MGRA 3VMVA 1I1GA 2QA4I 3U2QA 5C1EA 2W4SA 4ETSA 1U8RA 1U2WA 2K5CA 2VNIA 3SLDA 4A3MJ 1T6XA 4A93J 1UMKA 2KVOA 1TNSA 2QGGA 2M7BA 2IGOA 4BJ6C 4R8HA 1PKVA 1E64A 1XB4A 4ZTFA 2CF4A 3VODA 2DETA 1WJAA 1WI9A 3E0JB 3HUGB 2KIFA 1SANA 4KT5C 3SXYA 4W8SA 4MTEA 5FFZA 1QVTA 2PMUA 2E36A 3A03A 3LSKA 3PSIA 2VL8A 4MFDA 5L3GA 3CO6C 1TUIA 1J9ZA 2W1OA 3QOEA 2E19A 1IUFA 3UW0A 3CCSI 1RQPA 2F1MA 1LPQA 3ASQA 5CQGA 4EH1A 3H94A 4G7WA 3GQ7A 1OCPA 4A6DA 5L3CA 1V0EA 1OCOH 3HSFA 2DA3A 2VQCA 3D1NI 3I4NJ 3ECOA 1ZGJA 3ASNH 3QFCA 4IRHA 3GQBA 2WZPP 2E1MC 1Q9SA 5BQTA 4QIWN 1PLUA 3KLNA 4RD4A 4Y17A 2RQPA 4M6VA 3S1NJ 2X1CA 4P9SA 2XRLA 1LVKA 2V9VA 5ILSA 3J7ZI 4P3YA 2WB1A 4KMFA 3GWZA 5HLHA 4ABZA 4PAAA 2YPRA 4HPQA 3PSSA 1FBQA 2DA6A 1OGJA 2RV8A 1YIJB 1OGOX 3WTYC 4OU0A 3ASRA 3BY6A 1D0YA 2W6IA 5IYCJ 3CLOA 3ZQGA 4RAGA 4BXXJ 1IXRC 1YOVB 2EZHA 3FXUA 3K1PA 3H3ZA 4XBFA 1ZM2A 1Q1VA 4UAJA 5KW9A 1L1IA 1HKSA 3MZYA 2BGCA 3MD2A 3IL2A 4ZV4A 2XV4S 1C0WA 3ASSA 4ESBA 1X4OA 4XKWA 3AVVA 3LAPA 4E7LA 1FJLA 5J8CA 4CGZA 1L0OC 2XAHA 4C3IJ 3H9NA 3KP7A 1G7SA 2QSHX 1QQIA 2DLLA 2VJIA 3F0CA 1FLIA 2Q6IA 3QFRA 1PUFB 5F4OA 3U2RA 4LK1F 5ICCA 3K1MA 3RKQA 1OYYA 4TMZA 3QYBA 1SFXA 1LLZA 1VQLI 5GTHC 3KYCB 1VTNC 4O3MA 2DFFA 3NQOA 3ASPA 5K7ZA 2X51A 3DKXA 4HAMA 3LQ6A 1IRGA 3PUBA 1DU6A 4RGSA 1IDKA 2P5VA 1KYWA 1VQ7I 4DGWB 4TSFA 4YZQA 4YHBA 1MJAA 3VYUB 2QE7A 2HFHA 1BMFA 2EFQA 3RSNA 3K4BA 5E20A 5L3BA 3WQZA 4N4OB 1XMAA 3BROA 1DGWY 2V9PA 1FYKA 1KQ5A 1O8JA 1FC3A 4TMXA 2BSPA 2NNNA 2EQRA 5CQEA 4Q7JB 2M8GX 1IJWC 4B3GA 2B0LA 2MC3A 4Y9RA 3NRVA 3JREA 4HW0A 3RCOA 1XS9A 4D9JA 3RPUA 4Z4UA 4N3NA 4W8RA 1IC8A 4CCOA 2CBXA 1HA3A 3TP0A 2JQ7A 4XLNF 2ZKZA 3EUKL 4Q47A 3HOWJ 3F6VA 2M30A 2HR3A 3CCVB 2KIMA 6PAXA 1RWRA 5HODA 2ECBA 1E2XA 1Y0NA 2EJRA 1W36D 2DOFA 2CQXA 4M6XA 4U0YA 5GADJ 3SQVA 1EH6A 3TW6A 2GBYA 1R58A 1LVAA 3J81Z 1IN4A 1R49A 2G7UA 2CJJA 2MA3A 2QQ9A 3IH3A 2R7RA 5FL7A 4L9VA 4IEJA 4YIRX 2B7EA 1U6GA 2XKPA 4UVAA 1P9QC 5DYMA 3ML6A 1XPXA 2CFOA 2X3UA 1OCTC 1HW1A 4WZKA 2CG4A 1ONVA 3DLAA 1BC8C 4UUVA 2D2WA 3S2HJ 3RQ4A 4U9UA 3R60A 3TDZC 3LSJA 5E3LA 3BH7B 1R1UA 2LDUA 2ZFWA 2P4WA 4BQNA 2CQQA 4AC9A 4BBSJ 4U0VA 1CQTA 1E3HA 4DYRA 4XRFA 5J1RA 1KZHA 5JLVC 2ODLA 4P96A 2XDVA 5F4JA 2BM5A 1E3PA 1TYVA 1N0UA 4EMSA 1Q7YD 1WJFA 3ISXA 1OQYA 3BP8A 4A3KJ 3WY9A 2NVUB 1RUOA 2FJ1A 2XEXA 3L2RA 1T2KA 1XTAA 3GZNB 1B8IB 5E3MA 2CQ7A 4WZLA 3HJEA 1O8HA 2NVXJ 5J40A 3I3LA 4MQVA 4XRMA 2WWYA 1ZGWA 3JSOA 1P92A 1STZA 2W85A 1AWCA 3U21A 4LG3A 2IS4A 3FY3A 2Q2EB 2IA2A 4YZAA 5M5XJ 2INUA 1PUFA 1EJ9A 3GX4X 1O8IA 5L46A 1KU9A 4AYBA 3RTRA 1HXDA 1JGSA 3FDYA 4OIQF 1F5TA 2OTLB 3OL4A 2OBPA 4Z6YA 1QGAA 2F48A 5IK2A 1MMGA 2DPUA 4ZGNB 3HZJA 2CMPA 1KRHA 5DM6F 2RNJA 3OEEA 2WY8Q 4RDUA 3MVPA 1DBOA 1MMNA 2JUCA 2XAGA 1YIJI 5DS0A 5M3MJ 4Z4RA 2HCJB 1YLFA 3A1PA 5LGTA 5FLXK 5THXA 2GXBA 3LSRA 4CCLA 3A8KA 3QFTA 2IGMA 5FNZA 2NOJB 1T5EA 1VQ5B 3CCUB 1V4RA 2CNDA 4L18B 4CA0A 2MYSA 2VT3A 1BN5A 4Y33A 3SEQA 2LKSA 1WJCA 1R4MB 1O8MA 4V02C 3M8EA 4A0XA 1EFRA 3GQ9A 2W84A 1QPMA 4LJZF 3PVDA 3WGGA 2PI0A 5F0FA 5C4JJ 5C3EJ 3GTJJ 2CC2A 3TH0A 4JMQA 3K70D 4UB8C 3RZDJ 3CUQC 4LD5A 3AL0B 1YJWB 3FXRA 4GRIA 2VNKA 1ZREA 1VQ9B 3SZEA 4AIDA 3L09A 3R6JA 3OIQA 5CKTA 2LREA 5H2FC 2R6HA 2X0LA 2XGJA 1Z91A 3SDBA 4L5EA 2CQKA 2ESHA 3CCQI 2YUHA 1Z6TA 3FKIJ 1MSEC 1CNFA 3F21A 4ENNA 1TT5B 2F5FA 3PNVA 1KA8A 1KU2A 5FKOA 3L2VA 4KKUA 2OV7A 4A0YA 3AG3H 1Z6RA 4W8TA 4M0LA 3CMAB 1BHEA 1FNCA 2QTLA 3QPHA 1EP2B 2VT2A 2B9SA 3FIWA 4OPOA 5FKKA 2NS0A 2XF7A 1VZ0A 1EV7A 4A3LJ 1SFEA 1UZCA 1UD8A 2ID6A 4RA2A 3W3CA 1WTHD 4RLZA 1X1DA 2E34A 4NNJA 1EKEA 1ZQ3P 3HOZJ 1Z7UA 2KKOA 2YWGA 2ZL5A 1E3XA 3P4GA 3MWMA 4QLCU 5TRDA 3WGIA 5EEHA 1Z21A 4A12A 4C2UA 4AYBN 2V31A 3PIOF 4BHPA 5J35A 3H92A 4FETA 3SYTA 3K4LA 3U1DA 2BMWA 3OYNA 2JK3A 1P6RA 2DA1A 4R1HA 3V8KA 1TTTA 3CMEB 2DI3A 2GIZA 3UNGC 2LD5A 3ONYA 4P2NA 2QQ8A 2KRHA 2EPFA 1EH8A 2X1EA 2YWEA 3T1BA 1Y1VJ 4BE2A 2HZTA 2Y2ZA 3K0LA 1TYWA 1HG8A 4Z1MA 1PXZA 2QKLB 1PYVA 4U7DA 3HHGA 4EATA 3Q3AA 3SHFA 2BVMA 4HQMA 4EGYA 4X8IA 3J81K 3DCFA 4G12A 2DTRA 1TNTA 4EV0A 5KAFC 2RNGA 4L5JA 4Y4RA 1JKOC 2PEXA 2KZVA 2M9HA 2XGEA 2FBIA 1JXSA 1L3LA 2NVQJ 2FVGA 1EA0A 5JFRA 3OYFA 5TGTA 1LFUP 1ETVA 3OYIA 1Y0RA 1KQ9A 4NBQA 2C4TA 1FT9A 3KL9A 3OW7A 1QNTA 1U0JA 2V7TA 2BM4A 2D3LA 5CYVA 2CH0A 4LC0A 1SVMA 3S17J 2H6BA 5FO0A 4QV2A 5AIPA 1R1TA 2CV2A 2DJNA 1TLHB 3EETA 2Z33A 5FIUA 3OOUA 1KD1D 4KN7X 4DNRB 2FUG2 2KFDA 3N97A 5HXBA 1I3AA 2ADUA 2EZLA 4XN0A 2HGCA 3OPOA 3JX8A 1T08B 3VO1A 2V5IA 2UWMA 4BL0B 5HS9A 2GK7A 2AQEA 2BPOA 3H0DA 3Q38A 2X0KA 4ENMA 4RS8A 2DFEA 3CC2I 2V4DA 4PJLA 3IAM2 4U87A 3CCLB 1OCCH 5IT9K 2ISZA 2QY1A 3BLYA 4EM0B 1MW7A 1KONA 5GP9A 1QZZA 2L7ZA 2ZFUA 1HKQA 1Y6IA 2FSWA 2L4AA 2FBKA 4RB3C 3CCMI 2R7XA 3KEWA 2KIQA 1KU3A 2X6YA 3VSLA 3OSFA 3ZCOA 3O2PE 1ITYA 4ZCLA 1BOAA 1I8DA 3FBNB 1IA5A 1XG2A 1YX2A 1P2FA 1IN5A 4HBLA 5K1YA 3CDLA 3VR6A 3BQZA 1XGMA 1B8IA 3G71I 4Z4ZA 2Z99A 1T33A 3VMFA 4ZCMA 2E7XA 2A05A 1OFDA 1V3FA 1OKRA 3R6KA 1JUSA 1IB0A 1BIAA 1IV8A 1ULYA 4OPWA 1JUMA 3R4KA 4RD6A 2OBTA 1VQPB 4Z06A 4CICA 2Y75A 3DXJF 3LAJA 3ERED 4LBZA 4PGOA 2YX4A 5DD4A 1TWGJ 1WU8A 3DTKA 2ELKA 1ETYA 3BR6A 3HIFA 3CJTB 2KDZA 1QH0A 4OJPA 4FWTA 1FP2A 5B5EC 2JWTA 2L7MP 3SZPA 4EEFG 4V19K 3HPGA 2PLFA 4AF6A 1VQ6I 4M71A 4E7SA 1WVRA 3BTJA 1MBFA 2PQ8A 2GPJA 3WTZA 4OPSA 3WODF 4A3DJ 4RM3A 5H6RA 2B7CA 1N05A 3N6ZA 4M3GA 2K40A 2GOMA 4KIFA 2K86A 1GXQA 3H9QA 1OGMX 3BJ6A 4NB5A 2BY2A 4M72A 5F04A 2JIZA 3OR2C 3ISPA 4UUTA 5FD6A 1VQ6B 1MIJA 2OTJB 4PK4A 1TWCJ 1RNLA 2FU4A 2B5OA 3AGPA 2LY1A 3BC9A 5CJ9A 4RCYA 3EQOA 3CCJB 4B8XA 4XNFA 1OFCX 2QQBA 1WJ5A 5F0HA 1FTZA 2LOOA 1V54H 3BDDA 3ESWB 3M8JA 1X1BA 4MR0A 3HYIA 1AHDP 1WJEA 2LH9A 1OYWA 2A5WA 3H1CA 2GXAA 3WU1B 3ZGKA 2PJRA 4UUSA 3NWTA 4Y7CA 2XZOA 1N78A 3ECHA 1E43A 1U8BA 4A3BJ 3P27A 1JJ6C 3V7CA 5ERIA 1F9NA 2AS5F 3FKSA 3T56B 4QUZA 4KITB 1MNMC 2L9NA 2VI6A 3SJPA 1O8KA 3IHUA 2F4IA 1SAXA 1ZM4A 2YS9A 3QOPA 3PA1A 5AN9A 1R5GA 2ISYA 2RREA 5AMVA 4HSTA 4P12A 4CUGA 4TKOB 2QBYA 2BGIA 1JTYA 1IGNA 1OGIA 4OZZA 1VLOA 3CDIA 1FMVA 4DIQA 3G3ZA 2M1BA 3RY8A 1ZRDA 3CXCB 3ZRGA 2ZZGA 4FK8A 4AWXB 4RB2C 4CZCA 3LA7A 1HBXG 4ZYHA 1VF7A 2MG4A 3MKWB 4OAYA 1LB2A 4IOCF 5LMZA 3AVWA 4HNTA 2L01A 5D4SA 3DBHB 1SD4A 3UR3C 3GVAA 4E7ZA 1KU7A 2B0RA 4B44A 2BGJA 4BJTA 1HDDC 1MBEA 2DK8A 3QYEA 4G1VA 2GWRA 4RB1A 4ITVA 4QTRA 2DDBA 2HQAA 3KIOA 3I55B 3ZMUA 2KQRA 3GBGA 3RPUD 1FMWA 1R5ID 1P7IA 3JRAA 2XT4A 1UG0A 1YRNB 3A1YA 4PSXA 4DQ2A 2XTXA 5FGMA 5K7HA 1YI2B 2V1NA 5E79C 4DOZA 4OWRB 5E1ZB 4X05A 2HWVA 3CQZJ 2MLKA 2COMA 4XRSA 5EEAA 4A3CJ 1S9HA 4ENJA 1I3QJ 2CU7A 2M87A 4L8JA 2CUZA 4YRVA 1QVFB 1T98A 2BBYA 2HS5A 2VODA 4L9TA 2ZMEA 1WPKA 2DT6A 3HRMA 5H20A 4AIJA 2DMQA 1FOKA 2IJLA 1QA3A 3TW7A 1GHCA 5EG0B 2EFGA 2A68F 2R7WA 3CRZA 4ZYDA 1BM9A 2EV0A 1MMAA 2IBDA 2JN9A 1NTCA 1YITI 3HL2A 1G4DA 4OJLA 3DBLB 3QPTA 2VKEA 1H85A 1W36C 2CW5A 1GAWA 4FCYA 1MJBA 2TDXA 1A04A 4YDTA 2FOKA 2LF8A 3GVJA 2KLOA 1Y8QB 2EIMH 2HYFA 4XSZF 3I71A 3BWGA 3WU2C 1REPC 1IHMA 1YHQI 2VFPA 3SJZA 3RZOJ 1WOSA 1QHHD 3G1MA 1HKTA 4RJLA 2PJRB 1G7CA 1QZEA 2I10A 2DA5A 2LKPA 3PETA 5IP6A 4UV8A 2H6CA 2E1OA 4MQ9F 3MFKA 3ZBTA 3HSRA 2MGQA 2D9RA 2VBWA 5FLXZ 4DBQA 5KSWB 2MD0A 2V4JC 3EDPA 3CB4A 1A6IA 1HSTA 4X0GA 5D6FA 3K70C 5LHIA 1WOOA 2K9MA 3KX2A 4S04A 4WWVA 2WA0A 2EIJH 1IW7F 1XGOA 1W0UA 1BX1A 3ZZTA 2NT6A 1RZ4A 2HYGD 4IPAA 4LBYA 3T8RA 2E5NA 4RCZA 1MBJA 1XCBA 4MEXF 2M5SA 2A5YB 3QU3A 4LMYA 3S93A 1U5TB 1TQPA 4KIGA 2AHQA 2XGXA 3CCQB 5TJJA 5DV5A 3VFZA 4YIFA 4ZH4F 1NK2P 3WHCA 1TYUA 4G8XA 1ZTRA 2OCEA 1GVDA 1N77A 1UJ8A 1KQ8A 4NQWB 2DQRA 2AXTC 1X3ZB 4ZDPA 3S15J 3PFYA 3FXJA 2NOGA 3CLQA 4IQ4A 3P7NA 4GYIA 4YC5A 3E1YE 5KVRA 4RD2A 3KETA 1TVCA 5CVJA 4M53A 4RD1A 4TMVA 3QRFF 2WPDA 2NTQA 1N25A 1T95A 1PVEA 3OR1C 3OE7A 5DN6A 5J3OA 4HX8A 5FKNA 1B6AA 1S4MA 2QGUA 3HC7A 3UKGA 1CF7A 2W25A 1HZEA 3HOTA 2FNPA 4JX6A 2XB0X 1S5LC 4D5CA 4RM0A 2KPMA 2W48A 3ASOH 4D0PA 1H80A 4RDJA 3KP3A 1K6OA 1RI7A 3ABMH 3JURA 3WTXC 3HOUJ 1DPUA 3P9CA 3Q0WA 1ZELA 5F1RA 2UV1A 1GO2A 1MNEA 4FHTA 2Q8KA 2LR8A 2OAZA 1EP1B 2PG4A 4XLCA 2KHMA 2DU9A 3CTAA 4LB6B 5IPAA 3W2HA 2XSJC 2QXZA 5EG0A 4PGGA 4PFPA 1QA6A 2H1KA 1KGSA 2QSGX 2R7VA 3A3GA 3E5QA 1XX5A 4DYCA 2A6TA 1FX7A 3GZ6A 5DUIA 3S1MJ 2LTPA 3GCMA 3GRHA 4JK1X 4B4CA 1HOMA 1A36A 1XN7A 4ACAA 3H36A 4I09A 3VDXA 4IHWA 5BS6A 1W4MA 2Y30A 3FKJA 1PE9A 3M9AA 3HM5A 2K3FA 4BJ5C 1XFOA 4C43A 1YFHA 1DDIA 5JBQA 2VBMA 3OYCA 2R7TA 1QJVA 1E17A 5CVVA 4IZZA 2CWEA 5KK1A 4ZDOA 3H5NA 1GVHA 1QX4A 2F4OB 4AIKA 2JUGA 1R9TJ 2DDAA 4OOSA 1HCRA 2WC2A 2WJYA 4MYUA 1YI2I 2QMUA 4PSWA 3HGYA 2R5ZB 1RQRA 3Q5FA 2OF7A 2IEKA 3IP4B 3LL7A 3AG2H 2VQGA 5B1BH 1F36A 1T6ZA 3L00A 2HPIA 1O57A 3I55I 4BQAA 5L3DA 3GTLJ 1OFEA 4TMWA 4KYWA 4FISA 3DDYA 4OINF 2IGNA 4AF7A 3HG9A 3BG3A 1DARA 4ASNA 3SZTA 3MKYB 2A6HF 2D1VA 4KUMA 4UV9A 3AGQA 2R7ZJ 1W9XA 4LITA 2VPRA 2XTYA 1VQ7B 1IJFA 2BX6A 3CJRB 1P4MA 1SKYB 3K9TA 2F6CA 1TW2A 3HRUA 2UZKA 1E0EA 4MFEA 2M8EA 4G94A 3JSPA 1FOYA 1K8AD 4BEHA 3PL8A 3IC7A 3IWFA 4Q5SF 2HKXA 1ETKA 1LE8A 1P4AA 2D1HA 1MRZA 4OIPF 1J7KA 3ZR8X 3V7AA 3H5AA 1T6YA 1S29A 4WXHA 3CC4I 1FYMA 2R7FA 4MHGA 5E1WA 3LVBA 1I27A 3DPUA 4WWCA 2JSPA 3CP8A 4BUPA 3KPHA 4A3EJ 1Z9CA 2OK7A 4ZTJA 5BNGA 2XKOA 2QEXB 2DMPA 1YG2A 2ZC2A 1AKHB 5FRMA 2INVA 2ZTNA 1R5BA 3A8JA 2IQ7A 1ODDA 2N8GA 2ZBUA 1LM1A 1WORA 2PYHA 1IO2A 3M07A 2XPUA 1K73D 3PSZA 3ASTA 1MBKA 2V7FA 4OJOA 2VB6A 1O3SA 2BHZA 2MW8A 1RC9A 3B6CA 1WHUA 1KK2A 1KCCA 3VPRA 2BEOA 4EM1A 5H6QA 1OISA 4L0ZB 2BF4A 3DLLF 1EE6A 1J0RA 1D5YA 1W87A 2IOUG 4KNYA 2FXAA 1E79A 1BN8A 3B90A 3ZSCA 3VSKA 3GMEA 2F5VA 1WMRA 2O5RA 4M3FA 2Y48A 4I0AA 1ON1A 1M1KD 4U88A 4MYTA 3E5XA 1BI3A 3TP3A 1WKMA 1BJZA 1ZGAA 2DOAA 3QQAA 3E6MA 2K9SA 1E3OC 5DS9A 2OBRA 2K02A 2HKOA 4RLQA 2CO5A 2A6EF 4MNUA 4DBRA 2R7UA 5A8AA 1GUUA 2BV3A 2QF7A 4BQQA 1MH3A 4X1EA 3OYJA 5D5WB 5J4VA 5LLQA 3OOPA 3CDHA 5F08A 2DT7B 3E6CC 4IHTA 3V8LA 5DCMB 2ZJQF 2ESNA 4BBRJ 3VWBA 1UD2A 4C30A 4E6KG 4FXUA 1UCRA 4CCNA 1O8FA 1EP3B 2EV6A 2XHKA 2VJ4A 3VO2A 3EQNA 2A07F 3ZMTA 3ZMVA 4DK0A 3TGNA 5FROA 2XF5A 4JX5A 4YIIA 2X85A 3A3BA 5ICEA 4CYCA 1UD5A 3WBKA 4FX0A 2NVTJ 2HQRA 3B73A 5IYRA 3KP5A 1K4ZA 1USTA 1W0KA 2VXDA 4BY7J 4ZJZA 1EWYA 1FOXA 1ZM9A 3BNWA 4C2MJ 1BR4A 1A35A 5JHFA 3HOVJ 1H8AC 4Z03A 2GA2A 2YU9J 3MQ0A 3P5JA 3OAAA 4NC7A 1ORKA 4HNUA 3HRTA 4ZYAA 1VQ4B 2PFBA 2PX9A 1IN6A 1YX3A 4M73A 2KRFA 3MZ8A 1J59A 1OHHA 1ZG5A 3BH6B 2MC4A 5HDKA 4XMYA 2JJ1A 3M4OJ 5BOXA 3FMSA 4BH9A 1T38A 1D2EA 4S0HB 3TL4X 2C5BA 4X7FA 5A88A 4M9ZA 3PQJA 3F22A 4ZZDA 5BSXA 1IDYA 3TBIA 2P7VB 1MBHA 3WG9A 1FX0A 4HE6A 5EJCA 3LNNA 2V1UA 4M1KA 1G6NA 2XRNA 2XIGA 3I56B 3A0HC 2R4GA 3GW2A 5C44J 2EIXA 3PO2J 4I84A 1XSXA 3ZZ0A 2V6CA 3DTEA 3G6EI 5GAGJ 2VUMJ 1K4TA 3G71B 2XNJA 3MN2A 1A6QA 2R7DA 4IO9F 2D45A 4YXWA 3QAHA 1B59A 5GV7A 3D0SA 3PA2A 5TR9A 1O8LA 1GT0C 3V7SA 3A2KA 2Z2SB 1EXMA 4TMTA 5BPDA 1IF1A 3CJQB 3W2WA 2DTZA 2H1LA 1WDTA 1GDTA 5EGOA 3L2WA 3SEJA 3SKBA 1H9TA 5LRSA 3GTGJ 1IAWA 3J7AO 4HF0A 2FA5A 3CMYA 4MXNA 2YR2A 5L3EA 3BZCA 4HA8A 2QDXA 3CCYA 5IT9Z 1X1CA 4YZXA 2AXLA 3LSTA 1ETOA 4WX9A 2XZPA 4OM9A 4II2A 2A61A 4QWQA 4I01A 3BZKA 4V2FA 5D6EA 1AU7A 4C9YA 4F3QA 4LIUA 1WXRA 3IUOA 2PN6A 2GREA 4BDZA 1TWHJ 1B9NA 4I7HA 1B1BA 1XGSA 1WSVA 1SVLA 5FRNA 1BW6A 2MH2A 4IQJA 2DT5A 4OOXA 3WXMA 2PJPA 4WQMA 2Y0MA 3H3VK 1Z0XA 2ID3A 2VASA 1CGPA 3DU6A 4OOVA 1SD7A 2QCOA 4YCQA 1XC5A 1QO0D 3RPQA 1W0TA 2F43A 4Q4ZF 2TRTA 2VBTA 2X1DA 2X6OA 2KISA 3LQQA 2PECA 3KYLA 2XNDA 5LHHA 4MEYF 2VYQA 5BPIA 2BW3B 2DW4A 3RI4A 1YTYA 4M6YA 5M3FJ 3ABLH 4A3JJ 4I6ZA 1RKTA 2ECCA 5KHDA 4I2OA 3BCFA 2O0WA 2Q6OA 1JNYA 2VNJA 2XVCA 2XPWA 1FY7A 2K7LA 2LYCA 3BR3A 1VQ8B 4Y52J 2F5DA 2IPQX 3GFMA 1SFOJ 1F60A 1YYVA 3DFGA 2V7UA 2DQLA 4LLLA 3OYHA 3K2AA 4XRSG 1HF0A 2W57A 3DV8A 2CRGA 5J1YA 1Y39A 4RBOA 2OTJI 4CYDA 5JI6A 5HS7A 3FM5A 4A0ZA 1JHFA 2HTSA 1MKMA 3IRRA 3BTCA 3CCMB 3AVUA 2FRHA 4Y3OA 4L5IA 5C1CA 1EZGA 1U2RA 1RU4A 4C2LA 3MMPA 2MFZA 5GAEJ 1EF4A 4KKTA 3K4JA 4EQQA 2H09A 4LBVA 2M0CA 3C1DA 2CFXA 4JBAA 1VQ4I 4NCNA 4WZEA 2QYUA 3K4CA 2EH3A 1IRFA 2E60A 1J09A 3LMMA 1QA1A 4IHXA 1VQKB 2WBMA 4KH3A 3S2DJ 1WFXA 2GZWA 1TT0A 3A0BC 4I99C 3AKZA 3ONUA 2W7ZA 4C3HJ 4UUSB 2HEOA 4L0YB 5IYPA 1FIPA 1XSDA 4E70A 2OZ6A 1DUXC 5ICGA 3ROUA 5F4MA 1SVOA 1NHAA 5D5VB 4BGDA 3PIPF 5GAHJ 3JQRA 4X07A 3VYTB 1JI8A 2VFQA 3L9FA 2F5CA 1O4XA 1ETWA 2F3LA 4M3DA 2D5VA 2ZXWH 2VKVA 3EQLF 2JDIA 2MH9A 4ACBA 1QVUA 4B09A 3NAWA 3V4GA 2Y0SA 2L54A 5IP9J 1QU3A 4OIOF 1YE9A 4YFKF 2L9SA 1QRYA 3OWTA 2CS3A 4CZZA 2RC4A 4WK8F 4EJTA 2OUMA 2DY1A 3OJXA 2XUBA 5L3FA 2NTBA 3QP6A 5B66C 1YJWI 3WTSC 1B72A 4DQLA 3M7GA 5HNFA 2NV4A 1V5GA 4W97A 3W2FA 3EPZA 3Q6QA 3EYIA 2E2HJ 2WSSA 3G2BA 5F1JA 3AK5A 1LJ9A 2GQFA 1QVGB 1EH7A 1VQ5I 3K69A 2ZZQA 5KNLA 2C4UA 2QYOA 2DPDA 2C77A 3VSTA 4PC7A 2DOGA 3BPXA 2R5YB 1K78B 1T39A 3LNQA 4GDFA 2CRVA 3CMEI 3OYGA 2GXGA 4KT6A 2Z6BD 3EUHC 1S8NA 1Y0YA 4XIDA 2R7QA 2M4KA 1OYIA 4YFOA 3WE2A 2DMUA 5K7FA 1YRNA 1NJID 3AAFA 2CUEA 3Q3SA 4F93B 4G7ZF 4IRIA 4IW3B 4HG2A 4ZGQB 1XMKA 4XR6A 1H88C 3CCEB 1PJ5A 3ZPNA 3G6EB 1QQ1A 1OR7A 4IVNA 2Z9OA 1AOYA 3DF8A 5CVIA 3REOA 3O8HA 4BXUA 1U3EM 4U49A 2OQRA 1H42A 3I56I 2YWHA 5FO5A 1YQAA 5DEQA 1FNBA 2P5LC 4HWVA 1VNDA 1QGZA 2UVEA 4OIRF 5HNHA 2V1XA 3G73A 4HF1A 1E3ZA 1H8HA 4E7KA 3NE5B 4HQEA 2ZBVA 4XN3A 2ZJ2A 2EFPA 3DQVC 4PJ0C 4BAYA 3S1QJ 2GM4A 2KZGA 3F3XA 4JRAC 1RRJA 1DU0A 1S7EA 1XE1A 3I0TA 2HPMA 2HDWA 3JQPA 1RR7A 2H27A 4IHVA 4F7DA 2HXIA 4MTDA 3HTUA 4YEJA 1D1BA 2QBYB 3OW2B 1IXCA 4IRGA 2L7KA 2HDCA 2XT2A 4ZC3A 1EFTA 5A2QK 1O88A 1ZLJA 1K28D 2IVMA 3F8NA 3S2WA 4BS9A 4HE5A 2DO7A 2PLYA 3NWSA 3BZ6A 4XORA 3SLNA 3ZUGA 4FE4A 4M74A 2YX7A 1WCMJ 3JU4A 2ZNYA 4I0BA 3QWLA 1F43A 3DKYA 2P6TA 4RGRA 4KISA 4YZ0A 2HQNA 3DU1X 1K7AA 3DKWA 2GJPA 3H0GJ 1JA0A 1H8EA 2DFHA 4FN5A 1G3TA 3W6JB 5TISC 2MLGA 3VYSB 3Q9SA 4XLEA 2XB5A 4AU7A 1JE8A 4J0QA 4R71A 3GVKA 2NSPA 1NG6A 3CUQA 3E20A 3OFNA 3C2HA 3B02A 1OB0A 3KZIC 4G6DA 2W82A 2D3NA 2QTZA 3OZVA 1FBUA 3KEYA 1RPWA 2XROA 5FD5A 4EM2A 4UY8I 1X1AA 4HX7A 1ZRFA 3BTIA 1G3SA 2ICWG 4A3IJ 3MEXA 1VI0A 5JHUA 3L7WA 1HW2A 1NG7A 2OK8A 4LBWA 1LFBA 1J9IA 3WYAA 1TWFJ 4TN1A 1SD6A 3ZMSA 3CD6B 2Z3YA 3K6GA 4AVPA 2V7VA 2HQ5A 5KAIC 9ANTA 1NBMA 5TY0A 3BG5A 4BKXA 2ZMEB 2UVFA 2O9LA 1DPRA 1FP1D 3HBLA 2LVSA 3PJRA 4I02A 4RMNA 1QZYA 4F92B 2K3PA 3J7AY 5DCFA 4XLFA 3ML3A 3OYKA 3FXLA 1BR1A 2JMWA 1BIBA 4IHYA 4MO7A 4UZUA 2KP6A 1P4XA 1SC7A 2KT0A 4URRA 2OPTA 2Z1DA 2CSOA 1MMDA 2L3DA 2L7FP 1LQ1A 2VBZA 1SFUA 3DWLE 3W5VA 1W5TA 2CYYA 1F20A 4AD9A 4Y7NJ 3V8JA 2ZL7A 2E5ZA 4B3AA 3JRDA 2WAQN 4MIMA 4G7OF 2ZZFA 2EFOA 3AVXA 1QFZA 2QA4B 2I8DA 3B82A 3OYDA 3VSUA 2DMNA 1IRZA 3CCVI 1I6HJ 2NTPA 3B4NA 3RIQA 5E8IA 1O3RA 4ANJA 2BY1A 5CVUA 1QFJA 2P0WA 2IAIA 1MSFC 4HV6A 4UVBA 3WE3A 2NS8A 3GZ5A 1D8TA 1W7PB 5EZGA 1YHQB 1R5HA 3I53A 1ZG3A 1BJKA 3IAS2 4U0WA 3PO3J 4RD0A 1S6LA 4Z4VA 5C4XJ 4XLAA 1JKQC 4IJAA 1YS6A 1VQNI 1EFCA 3ZQIA 4UVCA 4BHCA 1R22A 5E8GA 1FZPB 3GQAA 2ZO4A 5M5WJ 3BG7A 5J3LA 5IT3A 2CK3A 2V79A 3TKYA 3WNCA 2DOEA 4YG2F 1X1PA 3P26A 2FF4A 2VBXA 4BNCA 4P1VA 3K1NA 4IF4A 4QFMA 3AG1H 3QE2A 2DCEA 2F1LA 1DQUA 3FXKA 1SMYF 3OS2A 1ZKGA 4K2EA 3ES9A 2VXZA 1CF7B 2MSYA 3WGHA 1KC8D 3T5XA 4WZTA 2E2JJ 4F52A 1O7FA 4P1WA 4HNVA 1YJ9B 4D1QA 1X2MA 2Z8GA 4J19A 1BL0A 1QBJA 1PJ6A 4HYEA 2ELHA 3FWEA 5E1XA 1RESA 2JSCA 4H9GA 1O7LA 1O8EA 1DG1G 1QCXA 2Q6KA 4HIZA 1HW5A 1UMQA 1BOBA 4B1RA 1A5JA 2XAUA 2JZYA 4P9UA 1LEBA 4A3FJ 2DA2A 2ZTGA 1AKHA 4M4SA 3F72A 4B47A 4UZFA 1VQMB 3K7AJ 3LA3A 4QPQA 3U6KA 5IY5H 3I64A 4M3BA 1CZFA 1JRGA 3B8YA 4HRIA 2Z16A 2BY3A 5D5UB 3JRBA 1TTYA 1NB9A 1OFLA 4N9HA 4PUSA 1K4SA 3JRFA 1B23P 4F55A 3SQNA 2CW0F 3HUGA 3PNTA 1KYZA 5K5QA 3SFIA 5E18F 2GJRA 1KCDA 2F4MB 2M3AA 1YIOA 3CD6I 3J81k 2KIUA 2ME0A 2ZCWA 3S3OA 5D8LB 2FX3A 3QODA 1XMXA 5A89A 1UD6A 2NAZA 3OKXA 2QZ8A 2OD5A 1N0VC 2BY0A 2QN6A 1O8DA 4Y15A 1HC8A 2E1NA 2R5ZA 3KZZA 1PP8F 1D3YA 1U5TC 1W5SA 3KP4A 3BC8A 2X8KA 1OFMA 1PUEE 1JHHA 1UELB 2KL4A 3OJWA 3CF2A 4LLNA 2P5KA 2OZUA 2LBFA 2VQLA 3OOCA 2EV5A 3EYYA 1ZR4A 4B4DA 1WZ2A 1V5VA 1TZLA 2E35A 2RC6A 3F23A 1FOWA 2O7OA 2XPVA 3FK7A 2KMUA 5FLVA 4P6VF 3H5RA 3SFZA 2O04A 1APLC 3M1CA 2V6EA 3GEZA 4OJ5A 3BPVA 3IRQA 1J5YA 1ETXA 2ZXJA 3B8HA 4NHJA 3K10A 5JR3A 3FPPA 3M1EA 1GAQA 4GGGA 1LUJB 2JPCA 2E2IJ 3OIOA 3C3WA 2BHYA 3I54A 1G7RA 3JTGA 1VQKI 2VFOA 1D0XA 2UXXA 4RAYA 4P6YA 3WNBA 3HTSB 1BR2A 2ZL6A 1ENHA 2JA7J 3ZC3A 3NB2A 1OJLA 5JMCB 2UXNA 2NPFA 3K4MA 4XSXF 5EF6A 3OS1A 3CJNA 2LFBA 4ASUA 4Z2YA 1F1ZA 4ESFA 2IA1A 3BG9A 1AIPA 1Q1HA 2FX0A 5FB2A 2CUJA 1B4AA 2PMZA 4B43A 3JAMZ 2LRDA 4W8QA 3J7YJ 1BI2A 1SAUA 2XSDC 2O17A 2V26A 1GR1A 2V7WA 1N06A 3G4SB 2J5OA 2ZBKA 2EBIA 3T0YA 3GLXA 4DYQA 3E97A 1O3QA 1S72B 3FXMA 4CCKA 1XB2A 3GVLA 1ZM3A 2H94A 1WP6A 1ZN2A 2L2OA 3MCZA 5ILUA 4ZDLA 4FX4A 2O8KA 5TV2A 4OMZA 1HVXA 2V1DA 3ONQA 2YUSA 1K83J 1D5VA 3BR5A 4CCJA 3ZMZA 1K8FA 5AIQA 2JA2A 1SD5A 2IGKA 4PMHA 1QFYA 3OZUA 2Y9YA
chains in the Genus database with same CATH topology
4N4NB 2D3LA 1O8LA 2CH0A 3A2KA 2Z2SB 1T0FC 3CJQB 3W2WA 4OJ6A 3L2WA 4NC8A 2CV2A 4J01A 3KRGA 4OAZA 4BQOA 3OOUA 4P22A 4MXNA 4DNRB 2FUG2 4BDYA 4XN0A 1X1CA 4YZXA 1GLNA 3OPOA 2XZPA 2UWMA 4II2A 4BL0B 1X0CA 2GK7A 2AQEA 4C9YA 1OR7C 4F3QA 4F91B 4LIUA 3H0DA 1W0JA 3IUOA 2V4DA 3HKZA 4BDZA 4PJLA 2K9LA 3IAM2 1LFPA 4U87A 1GQ8A 1LKXA 2IS4A 2WAQA 5FRNA 5HOOA 2QY1A 4IQJA 3BLYA 3T9GA 1MW7A 1KONA 5LFAA 2IXSA 2ZFUA 3SUCA 1N75A 1Y6IA 3BH4A 2VASA 2R7XA 3KEWA 3HPHA 2X6YA 3VSLA 3DU6A 3ZCOA 1UD4A 2X3HA 2AQFA 1I8DA 1E1RA 3FBNB 1IA5A 2F43A 2QKMB 1XG2A 1VJSA 2X1DA 2VLAA 1ERDA 1AIRA 2PECA 3VR6A 3KYLA 2XNDA 1WJDA 2BW3B 1D1CA 3OYAA 3VYRB 3HOSA 5KHDA 1BLIA 2O0WA 3BCFA 3S3NA 3H35A 4Z06A 2HVRA 2M4GA 2LYCA 3DTKA 1IB4A 3ZXSA 3DPLC 2XOKA 3D5RC 4XONA 4OJPA 1Z3YA 3OYHA 3HPGA 4LIVA 4E7SA 1QHGA 1COWA 2ZZEA 2DXIA 5CDFA 1NHCA 5KCMA 2VIXA 5CPRB 2XF6A 4RM3A 4Y3OA 5C1CA 4C2LA 1RU4A 2GOMA 1V5FA 1OLTA 2MFZA 4KKTA 3H9QA 3K4JA 1OGMX 2JIZA 4XOTA 3OR2C 3OYLA 2W00A 3K4CA 1UD3A 2JVGA 1KZLA 3DTIA 3LMMA 2E60A 1J09A 4PK4A 4B3XA 3W2AA 4XQFA 2WBMA 3ZPPA 4G6IA 2LY1A 3BC9A 3EQOA 1WFXA 1PJRA 1TT0A 4XNFA 3CZ6A 3A4CA 1WJ5A 3AKZA 3SZGA 2LOOA 1IRXA 2R7SA 4MR0A 3M8JA 1SFKA 1X1BA 3TMOA 1WJEA 3S8PA 2ZSHB 4IX7A 3ZIAA 2LH9A 2A5WA 2HVQA 4BGDA 3T53B 4CH7A 3ZGKA 2PJRA 3NWTA 2CV1A 2XZOA 1N78A 4PJNA 3FBIB 3VYTB 1E43A 4JOMA 1JI8A 2NZMA 3HXLA 2NSTA 2V9KA 3BCAA 3DEEA 3FKSA 3T56B 3K4KA 4BXFA 4KITB 2L9NA 2JDIA 1O8KA 2F4IA 2Y0SA 2RREA 3K4NA 5AMVA 2VPLA 4HSTA 2OC6A 2VBEA 1QU3A 2VJ5A 1YE9A 4CUGA 4TKOB 1BPLA 4OZZA 2L9SA 2HNHA 5LD2C 2XZLA 3OWTA 2CS3A 2GJKA 3LSIA 2OUMA 2V7QA 1FMVA 4QPOA 1JTAA 4DIQA 2DIEA 2NTBA 2VBKA 5HNFA 2XC7A 2WAEA 1G59A 1V5GA 3ZRGA 2BW3A 3L2QA 3EPZA 3A35A 2ZZGA 2WSSA 3ZQQA 3G2BA 4CZCA 2EWEA 2O0VA 2WAFA 3EUAA 5HKKA 1VF7A 3MKWB 3N05A 4OAYA 4XM3A 4HNTA 3HAGA 3PSFA 3UR3C 2BOLA 2ZZQA 5KNLA 3VSTA 3AL0C 4E7ZA 2L5QA 3LSMA 4B44A 4BJTA 1Z3XA 3QYEA 1R6RA 1V0FA 5HLTA 4ITVA 2HQAA 3OYGA 4XD7A 4PJMA 4KT6A 4PFOA 2Z6BD 3C2GA 3EUHC 2KQRA 3GBGA 3RPUD 1FMWA 2IS1A 4XKBA 2R7QA 3LSGA 1UG0A 2QX3A 2NT9A 3A1YA 3GQ8A 4PSXA 2M4KA 4BE0A 2GOXB 1HA8A 4DK1A 2V1NA 4DOZA 4OWRB 3LFUA 4CSWA 4F93B 2ZXHA 4U4BA 4HG2A 1S9HA 4XR6A 3OYEA 3ZPNA 3VMVA 4L8JA 2CUZA 4YRVA 5C1EA 2W4SA 4JQFA 3SEZA 4U49A 2K5CA 2DT6A 3D5SC 2CW7A 2KVOA 1I18A 2M7BA 4HWVA 2IGOA 3F9KA 4BJ6C 3OIPA 1PKVA 2UVEA 5HNHA 4ZTFA 1WJAA 2LY2A 2E1BA 1H8HA 1E3ZA 2R7WA 3CESA 3E0JB 3HUGB 1MMAA 4E7KA 3NE5B 4W8SA 3PSIA 1OOCA 3LSKA 4XKVA 4XN3A 2VL8A 3DQVC 3HL2A 4OJLA 4HEA2 2W1OA 3QOEA 3DU5A 1W36C 4G7XA 3UW0A 2F1MA 5CQGA 3GVJA 3FHNA 3H94A 4G7WA 2KLOA 3GQ7A 1V0EA 2HPMA 2HDWA 2VQCA 2CV0A 1NRKA 3GQBA 1QHHD 1KTWA 1VBLA 4YEJA 2WZPP 1D1BA 2E1MC 2PJRB 1PLUA 1WPCA 2DJIA 2HZDA 2L7KA 4RM2A 2X1CA 4U7BA 3S32A 1E1QA 1LVKA 4ZC3A 1O88A 2WB1A 1K28D 4BS9A 3OYMA 4DJAA 4DBQA 2MD0A 2V4JC 1KCDA 3MKZA 3NWSA 4X0GA 4HPQA 4XORA 3K70C 4NK8A 3JU4A 1OGOX 2K9MA 3KX2A 3DKYA 1D0YA 4KISA 2WA0A 2W6IA 4YZ0A 2NT6A 2GJPA 2E5NA 4J00A 2M5SA 1H8EA 4C2TA 3LSHA 2E1MB 2VQHA 3MD2A 3S93A 3VYSB 4XLEA 4AU7A 2KRCA 3GVKA 2NSPA 2IS6A 4DNTB 1NG6A 1X4OA 4XKWA 1EA3A 4YELA 3C2HA 3OFNA 4E7LA 1OB0A 2D3NA 2W82A 1N77A 3KEYA 4NQWB 4ZDPA 1X1AA 2VJIA 2VKHA 3PFYA 4AVZA 2BVLA 2ZXIA 4IQ4A 3QYBA 2HLDA 2M0MA 1NG7A 2NTQA 2WPDA 4BU2A 2W6JA 2X51A 3DKXA 3K6GA 3WWGA 1T95A 3OR1C 3PUBA 1NBMA 3OE7A 5DN6A 1IDKA 4DGWB 4TSFA 2JVHA 2JJ2A 2UVFA 2QE7A 3VYUB 4YZQA 3HC7A 2UUZA 1BMFA 1HZEA 3RSNA 3HOTA 3K4BA 3PJRA 2PYGA 1X4PA 3WQZA 3VMWA 4N4OB 1DGWY 2KPMA 4RMNA 1H80A 4F92B 1O8JA 2K3PA 3J7AY 4XLFA 1IDJA 2BSPA 5CQEA 3JURA 4IKFA 3OYKA 1BR1A 4B3GA 1ZELA 3OY9A 4UZUA 2UV1A 1MNEA 3RCOA 2KP6A 4D9JA 4URRA 4XLCA 4W8RA 2KHMA 2Z1DA 1MMDA 3BCBA 4CCOA 2XSJC 4XOPA 2QXZA 4PFPA 4XKCA 4NK6A 3CMMA 3DWLE 3EUKL 2R7VA 3A3GA 1KMHA 2A6TA 3OEHA 4H4KC 2ELJA 3G05A 1V5EA 3GRHA 4B3FX 1RWRA 2W7NA 3VDXA 1K6YA 2E5ZA 1W36D 1D0ZA 3FKJA 1PE9A 4II3A 2ZZFA 4BJ5C 1O8GA 2VBMA 1UAAA 2I8DA 3H9GA 3OYCA 3OYDA 2R7TA 1QJVA 3VSUA 4EW9A 2NTPA 3B4NA 2R7RA 4IZZA 5FL7A 4ZDOA 3H5NA 4ANJA 1P9QC 2JUGA 3OMYA 2CFOA 1LDKB 2WJYA 1G8XA 2P0WA 3DLAA 4PSWA 4OZYA 1YX5A 3RQ4A 3IP4B 3LL7A 2VQGA 4R79A 3AFHA 3IAS2 3B90A 4BQNA 2HPIA 4XLAA 4NUBA 3DDYA 2ODLA 2IGNA 2XDVA 3HG9A 3MKYB 1WJFA 1MABA 1Y56A 1W9XA 4LITA 4XLHA 3MMYB 3CJRB 3GQAA 1SKYB 3BG7A 3L2RA 2F6CA 2CK3A 3H9JA 1E0EA 2X53S 1O8HA 2HU9A 2CW8A 3I3LA 3PL8A 4BEHA 3BG6A 1D1AA 3L2UA 2DCEA 3U21A 1DQUA 4TT3A 4LG3A 2WADA 3OS2A 4G6TB 2Q2EB 2VXZA 3H5AA 4HSRA 3ZR8X 2VJJA 4E4HA 4MLOA 2INUA 4YZAA 1Z7LA 4F52A 4CCMA 4P1WA 1O8IA 3DPUA 4D1QA 2JSPA 3CP8A 4AYBA 2Z8GA 3RTRA 4BUPA 3FDYA 3OL4A 4ZTJA 5IK2A 1MMGA 1O8EA 5FRMA 1QCXA 2INVA 2ZTNA 4HIZA 2CMPA 2IQ7A 3OEEA 2PYHA 1BOBA 2WY8Q 1DBOA 1DGRM 1MMNA 2WY7Q 2XAUA 2V7FA 2ZTGA 4OJOA 4Z05A 2VB6A 4B47A 3OS0A 3I9V2 4QPQA 1JRGA 1KCCA 2ZSIB 1CZFA 3B8YA 1MNDA 4HRIA 2Z16A 1EE6A 2R7OA 4E0FA 4CCLA 1OFLA 3ZSCA 4PUSA 2IGMA 2KDOA 2NOJB 1E79A 4F55A 4E7IA 1T5EA 2GJRA 3PNTA 3VSKA 4CA0A 2F5VA 2MYSA 4Y33A 2LZJA 3SEQA 2O5RA 2M3AA 1WJCA 1O8MA 1WMRA 3GQ9A 1EFRA 1K5CA 3S3OA 4XL9A 3QYFA 2DOAA 3S3MA 3QODA 3FY3A 4JMQA 3K70D 3AL0B 4GRIA 4RLQA 1UD6A 4DBRA 2R7UA 4BQQA 3DPTA 3OYJA 3D5LA 1O8DA 4BACA 2DT7B 3OIQA 2LREA 5CKTA 2XGJA 2X8KA 3T51B 3BC8A 1OFMA 3SDBA 3VWBA 1UELB 2KL4A 1UD2A 4C30A 1VLYA 3CF2A 2MABA 4E6KG 2LBFA 2VQLA 4CCNA 4FXUA 1O8FA 3OOCA 3OL3A 5HVQC 4KKUA 2VJ4A 3PNVA 3L2VA 2LG4A 3EQNA 1TZLA 4DK0A 2OV7A 2LBFB 4W8TA 4BE1A 5FROA 2XF5A 2KMUA 1BHEA 2X85A 3H5RA 3V42A 3A3BA 2O04A 1UD5A 3M1CA 2V6EA 1AA7A 4OJ5A 4KKSA 4E7HA 1W0KA 2GK6A 2VXDA 2XF7A 3K10A 4RLFA 1VZ0A 4ZJZA 2R9VA 3FPPA 1UD8A 1BR4A 5JHFA 3W3CA 1WTHD 4Z03A 4FASD 1X1DA 3W2VA 1D0XA 3OAAA 4NC7A 4NNJA 3BCDA 4HNUA 2IS2A 1BR2A 4ZYAA 1E3XA 2V31A 4C2UA 1YX3A 1Z21A 1OHHA 1RMGA 3K4MA 3LMWA 3OS1A 4FETA 3SYTA 2MC4A 3K4LA 4ASUA 1BN8A 4XMYA 3OYNA 2JJ1A 4E7JA 4P5OA 4BEHB 2CUJA 3UNGC 3TL4X 2HVSA 2PMZA 4B43A 2KRHA 2LRDA 3VSVA 4W8QA 1SAUA 2X1EA 2O17A 2RQQA 4BE2A 2V26A 1WJBA 3TBIA 3OYBA 4Z1MA 1HG8A 1PXZA 2QKLB 1PYVA 2Q1ZB 1FX0A 2M7AA 4EATA 3LNNA 4B48A 2BVMA 4GQNA 2X6WA 3E1SA 4CCKA 3GVLA 2R4GA 1DBGA 1WP6A 2RNGA 1DP3A 2L2OA 3CP2A 4Y4RA 4ZDLA 2LC2A 4KJZA 2KZVA 4I84A 1HVXA 1X19A 4PJJA 3ONQA 3DTEA 3OYFA 5TGTA 3OYIA 4CCJA 2WJVA 2X6XA 2JA2A 2O1DA 4YXWA 3OW7A 2IGKA 4PMHA 3PNYA 1U0JA 2VKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKW A;  1O8L A;  4YEL A;  5AMV A;  2VBE A;  1O8E A;  1QCX A;  4OJ6 A;  2INV A;  2IQ7 A;  4OZZ A;  2PYH A;  2VJI A;  1DBO A;  1JTA A;  4OJO A;  4AVZ A;  4Z05 A;  2NTB A;  4MXN A;  2VBK A;  1KCC A;  1JRG A;  1CZF A;  4XN0 A;  3B8Y A;  2EWE A;  4YZX A;  1EE6 A;  2O0V A;  2NTQ A;  3ZSC A;  1OFL A;  1BN8 A;  3B90 A;  3WWG A;  1X0C A;  1KCD A;  4XM3 A;  1IDK A;  1WMR A;  1O8M A;  4YZQ A;  2UVF A;  3GQ9 A;  3VST A;  1K5C A;  4XL9 A;  2PYG A;  3VMW A;  1GQ8 A;  1H80 A;  1O8J A;  2QY1 A;  3T9G A;  4XLF A;  1IDJ A;  2BSP A;  3JUR A;  1O8D A;  3SUC A;  2QX3 A;  2X6Y A;  2NT9 A;  3GQ8 A;  1OFM A;  2X3H A;  4URR A;  1IA5 A;  4XLC A;  4W8R A;  1XG2 A;  4XOP A;  1O8F A;  2QXZ A;  4NK6 A;  1AIR A;  2PEC A;  4U4B A;  4XR6 A;  3EQN A;  4W8T A;  3GRH A;  1RWR A;  1BHE A;  3VMV A;  5C1E A;  2X85 A;  2O04 A;  4U49 A;  2O0W A;  4Z06 A;  1PE9 A;  4OJ5 A;  1O8G A;  4HWV A;  2VBM A;  2UVE A;  1IB4 A;  1QJV A;  3VSU A;  4EW9 A;  2NTP A;  3B4N A;  4XON A;  4OJP A;  4W8S A;  4Z03 A;  1OOC A;  4XKV A;  4XN3 A;  4OJL A;  4OZY A;  3UW0 A;  1RMG A;  1NHC A;  3LMW A;  3GQ7 A;  4XMY A;  5C1C A;  4C2L A;  1RU4 A;  4XLA A;  1OGM X;  1KTW A;  1VBL A;  4XOT A;  4YEJ A;  2ODL A;  3VSV A;  1PLU A;  4W8Q A;  2O17 A;  3ZPP A;  4XQF A;  4XLH A;  1HG8 A;  1O88 A;  3GQA A;  1PXZ A;  3EQO A;  4XNF A;  1O8H A;  4MR0 A;  2X6W A;  4XOR A;  4NK8 A;  1DBG A;  1OGO X;  4I84 A;  3FY3 A;  4YZA A;  2NZM A;  4YZ0 A;  2NT6 A;  2VJJ A;  2INU A;  2NST A;  2X6X A;  1O8I A;  2O1D A;  2Z8G A;  4XLE A;  1O8K A;  4PMH A;  3KRG A;  2NSP A; 
#chains in the Genus database with same CATH topology
 1DP7 P;  2B7B A;  1T0F C;  1YJN I;  1AMO A;  2WYR A;  4OJ6 A;  3TED A;  4YAW A;  3U6B A;  2JJ7 A;  4NC8 A;  2JA6 J;  2XGD A;  3KZY A;  4CDG A;  3H3U A;  4J01 A;  4BQO A;  1BI1 A;  1IDZ A;  5JVG F;  4P22 A;  3S16 J;  5IYB J;  3VNV A;  4BDY A;  5D5X B;  1MD0 A;  1GLN A;  1WH7 A;  2PIA A;  1X0C A;  1FYL A;  1OR7 C;  4F91 B;  1W35 A;  2AHO A;  1VQO I;  4QSH A;  3QPL A;  3HKZ A;  4LGW A;  2VOO A;  3PQK A;  3BQJ A;  3ZQ7 A;  1Z05 A;  1GQ8 A;  1LKX A;  3W5H A;  2FE3 A;  2QZA A;  5HOO A;  2WV1 A;  4PC1 A;  3T9G A;  4XIC A;  5LFA A;  2CGP A;  2IXS A;  1R36 A;  3SUC A;  1N75 A;  2BN4 A;  3BH4 A;  3GFL A;  2D74 A;  1A31 A;  3I5U A;  1VFC A;  1UD4 A;  1Q82 D;  1E1R A;  3BR1 A;  2X48 A;  5IP7 J;  2QKM B;  2QEN A;  4PC6 A;  1J2X A;  4RD3 A;  1TC3 C;  2DYI A;  4O6J A;  2AO9 A;  3F8M A;  4UB6 C;  5LGU A;  1IJE A;  4RGU A;  1D1C A;  3BJO A;  2MD5 A;  3F8C A;  4I76 A;  3GYH X;  3CCR I;  2BM0 A;  3D26 A;  2Y31 A;  3VYR B;  2F4N A;  1BLI A;  5E6T A;  2C78 A;  3H35 A;  3BY2 A;  3NEU A;  2C2W A;  2HVR A;  2M4G A;  3AVT A;  1I50 J;  1K78 A;  4OP7 A;  2VBU A;  2K4J A;  1I1S A;  4EJU A;  3LQR A;  1M1E B;  3IWZ A;  2VFN A;  2M5W A;  2Q0O A;  1HDP A;  3V7R A;  2ZNZ A;  3O3K A;  2CQN A;  3FMQ A;  3GTK J;  1T0F A;  1COW A;  5E3N A;  4KA4 A;  2VFM A;  2DXI A;  5CDF A;  2BZT A;  1NHC A;  2ZB9 A;  3N4M A;  3P9I A;  5CPR B;  5E3O A;  4QVJ A;  1CNE A;  3ZQF A;  3ZQC A;  1V5F A;  3BTL A;  4HF2 A;  4V2G A;  3W5U A;  3FIS A;  2FEZ A;  3OYL A;  2W00 A;  5B3S H;  1SEU A;  4YAF A;  4S05 A;  2JVG A;  2QLZ A;  1KZL A;  3DTI A;  3WTV C;  3GIR A;  4P3I A;  2B63 J;  1D8K A;  4XQF A;  4G6I A;  4M2L A;  1FDR A;  5HZB A;  1G7T A;  4Z4Y A;  5LBQ A;  4G5G A;  3CZ6 A;  5FFX A;  1IRX A;  4JX4 A;  5J1U A;  2E1R A;  4ZCI A;  5CVR A;  1IV6 A;  1QG0 A;  2ZSH B;  3ZIA A;  1B9M A;  4IHS A;  1VQP I;  2HVQ A;  3T53 B;  4CH7 A;  5B1A H;  3HRS A;  3HKZ N;  1E63 A;  3PFI A;  1VQM I;  3WND A;  1QA2 A;  4LOC A;  2NZM A;  3HXL A;  1H9G A;  2NST A;  4ZZL A;  5JLX A;  3BCA A;  3DEE A;  2BE5 F;  3TO6 A;  1GV5 A;  1LDJ A;  2CUF A;  3A02 A;  2Y69 H;  4BXF A;  1YJN B;  5LEK A;  3RQI A;  2OTL I;  4PAB A;  3KP6 A;  1WRJ A;  1E62 A;  1OCR H;  4NDL A;  3O6B B;  5GPA A;  3K4N A;  3RIR A;  2VPL A;  2XNC A;  2OC6 A;  1ZR2 A;  2P8T A;  3MKL A;  3FXQ A;  1EFU A;  1Z67 A;  2VN2 A;  5LD2 C;  3CC4 B;  2Y0S N;  1ZK8 A;  3GLL A;  2GJK A;  2I1L A;  3E7L A;  1VQ9 I;  1ZAO A;  2V7Q A;  3E5U A;  1K79 A;  4QPO A;  2FQ3 A;  2LLK A;  1NK3 P;  1S7A A;  2VBK A;  1TYX A;  4D7M A;  2BW3 A;  2DYS H;  2VC0 A;  3ABT A;  3ZQQ A;  1N07 A;  3LO8 A;  3CC2 B;  2J8K A;  2WAF A;  2O0V A;  4BY1 J;  3HEF A;  5HKK A;  1ETQ A;  3Q0U A;  3FMR A;  3G4S I;  3PSF A;  2BOL A;  3LOC A;  3JAM K;  2VE8 A;  3AL0 C;  2L5Q A;  1X58 A;  3TO7 A;  5HDN A;  2BXY A;  1Z3X A;  1R6R A;  4ENK A;  1V0F A;  1N8R D;  2HOT A;  4A69 C;  1S7O A;  4PJM A;  4PFO A;  1BJA A;  2LP0 A;  3QPS A;  2JRT A;  1WI3 A;  3JRH A;  3Q9V A;  3MZH A;  2IS1 A;  4XKB A;  3K2Z A;  4Y9U A;  2H8W A;  2QX3 A;  2HOE A;  4WCG A;  2QEX I;  3R6S A;  1TBX A;  2OBS A;  2NT9 A;  4YFX F;  3I58 A;  4BE0 A;  1KK1 A;  3WG7 H;  2RC5 A;  1HA8 A;  3IH4 A;  4LB5 A;  4BHB A;  3O8G A;  1QGY A;  3LFU A;  1KK0 A;  2VON A;  4U4B A;  1S3J A;  3QU6 A;  2F5E A;  3PM1 A;  2LSO A;  5J47 A;  1OMI A;  3OYE A;  5CLS A;  3IV5 A;  4JQF A;  2R0Q C;  2BVN A;  2HDN B;  2ZIT A;  2DA7 A;  3SEZ A;  1B2R A;  5DNS A;  1QUE A;  1CLW A;  3D5S C;  5GPC A;  2CW7 A;  5ILV A;  1JT0 A;  1I18 A;  1USS A;  3F9K A;  3OIP A;  1J75 A;  1Z1D A;  2WZN A;  2LY2 A;  3GUD A;  2E1B A;  2VOP A;  3CES A;  2DAO A;  1KQS B;  4IXA A;  3Q0V A;  1QRC A;  4HOB A;  2DEU A;  5D4R A;  1OOC A;  4XKV A;  2IT0 A;  4M3E A;  1MH4 A;  4BYY A;  4HEA 2;  1ZH5 A;  3AVY A;  3DU5 A;  2L4M A;  3PUF A;  4FE7 A;  4G7X A;  3CO7 C;  1VQN B;  1Y0U A;  3ULQ B;  2G0Y A;  4RDL A;  5F6F A;  3FHN A;  1KQ0 A;  2EB7 A;  2CV0 A;  4Z4T A;  4GO1 A;  1NRK A;  1I6X A;  3M8F A;  3IKT A;  1JGG A;  4RPB A;  4FT8 A;  1XGN A;  4JP0 A;  1KTW A;  1VBL A;  1ON2 A;  2J7K A;  2PMD A;  1WPC A;  3A8I A;  3CC7 B;  2DJI A;  2RVC A;  2A69 F;  2HZD A;  2EK5 A;  4RM2 A;  2HOA A;  5FJ8 J;  4FTH A;  4U7B A;  1CQX A;  3S32 A;  1E1Q A;  1N08 A;  2O3F A;  4HZF A;  4LK0 F;  3ZN0 A;  1P4W A;  4CHU A;  3OYM A;  2VBV A;  3CCU I;  2K9N A;  2K27 A;  2ZJR F;  4DJA A;  2M2E A;  3U9G A;  1VHE A;  2OYN A;  1U78 A;  3TOA A;  3MKZ A;  3X2Q H;  4NK8 A;  3CUO A;  4WXD A;  2E1C A;  4K1X A;  2IP2 A;  1PP7 U;  3CMA I;  5DD8 A;  3WU0 A;  4DZJ A;  3WBJ A;  2EA4 A;  2XAJ A;  4J00 A;  1UG2 A;  2OQG A;  1RIO H;  2FNA A;  4AUX A;  3LSH A;  5IOZ A;  4C2T A;  2QVO A;  2E1M B;  2VQH A;  2EZI A;  2KRC A;  3RYR A;  3LFK A;  1LNW A;  2QSF X;  2IS6 A;  4DNT B;  2A3S A;  2G7H A;  1EA3 A;  2VBY A;  4L9J A;  4YEL A;  2J8I A;  4GFB A;  2HOS A;  4KIC A;  3JRI A;  2WB1 N;  2EZK A;  1SM4 A;  3CUQ B;  3LSP A;  5M5Y J;  2VKH A;  3HOY J;  4AVZ A;  1KK3 A;  4JYK A;  3I4M J;  4KIB A;  1UFM A;  2BVL A;  2ZXI A;  1LDD A;  3G1O A;  3HB9 A;  3S14 J;  2HLD A;  2M0M A;  2BV6 A;  2HI3 A;  3WTW C;  2WTE A;  2RN7 A;  3ZN1 A;  2P3M A;  3QSY A;  2NS7 A;  4BU2 A;  3KEO A;  5IYD J;  2W6J A;  2L9V A;  1O3T A;  3CF5 F;  3F6O A;  1OB5 A;  3WWG A;  1F4K A;  5LRR A;  2XAQ A;  2JVH A;  1POG A;  3IKV A;  3JRG A;  4TV7 A;  2JJ2 A;  1MZB A;  4OPV A;  1RKW A;  2UUZ A;  4WF2 A;  2PYG A;  4HLY A;  1X4P A;  4A6E A;  3VMW A;  2I5U A;  1G3Y A;  1TQI A;  1WQ2 A;  5DDG A;  1JJ8 C;  1IDJ A;  1YW9 A;  5F0C A;  3COA C;  2NVY J;  4IKF A;  3ERM A;  1ELO A;  3PUM A;  2W24 A;  2EWN A;  2OJE D;  3OY9 A;  3F8F A;  3FM3 A;  4ZYE A;  2NNY A;  1T8I A;  4HDU A;  2DMT A;  4PDK A;  2RAE A;  3BCB A;  2DK5 A;  4IL6 C;  2LY9 A;  3RKY A;  5K5R A;  3J80 Z;  4XOP A;  1MMS A;  4XKC A;  4NK6 A;  3CMM A;  2PMZ N;  3FX3 A;  2BXZ A;  1GVJ A;  1A8P A;  2Z5U A;  1YLO A;  3RJP A;  1DDN A;  1KMH A;  3OEH A;  2ZME C;  2ELJ A;  2FQ4 A;  4H4K C;  1V5E A;  4P9F A;  4A2U A;  3L2C A;  1FNM A;  3G05 A;  4B3F X;  4AM3 A;  1JKR C;  2W7N A;  3L1P A;  1G3W A;  1K6Y A;  1I5Z A;  3EUH A;  1D0Z A;  1FBS A;  4ZYG A;  2IW5 A;  4II3 A;  1WSU A;  3OZW A;  5DSZ A;  1O8G A;  3LQE A;  3WHB A;  1UAA A;  3H9G A;  2C5H A;  4PC3 A;  3RYP A;  2OCC H;  4EW9 A;  4LFU A;  4OMY A;  1FTT A;  1FPQ A;  3CW2 A;  1D1N A;  3OMY A;  3IH2 A;  1LDK B;  2IA0 A;  3ABU A;  1G8X A;  3GTQ J;  4AIH A;  3C7J A;  1MDM A;  4OZY A;  1V55 H;  1YX5 A;  4LLG F;  3W6K B;  3HDD A;  2PBI A;  4RPD A;  2OU2 A;  4P25 A;  4X7D A;  3U1K A;  2GAU A;  3AFH A;  4AC0 A;  4R79 A;  3PEN A;  2RGV A;  2NXN B;  3G1L A;  2HDD A;  2R92 J;  4NUB A;  3GO5 A;  2DCU A;  3CCS B;  2C6Y A;  1GV2 A;  1TSP A;  5FO1 A;  3GFJ A;  3GF2 A;  1LEA A;  2G0E A;  1Y56 A;  1MAB A;  1PJ7 A;  4QVA A;  5JVT A;  2JTV A;  4XLH A;  3MMY B;  4UZE A;  2ACJ A;  2BYV E;  1QGP A;  1JB9 A;  3H9J A;  2COB A;  2O8X A;  2X53 S;  5H5J A;  2FML A;  4RGX A;  2Y9Z A;  2STT A;  2HU9 A;  2CW8 A;  2LMD A;  3BG6 A;  1D1A A;  3BT9 A;  3R61 A;  4DZP A;  3L2U A;  1OB2 A;  2P81 A;  3JQQ A;  4NQW A;  4TT3 A;  2WAD A;  4G6T B;  4HSR A;  4E4H A;  2VJJ A;  4MLO A;  1FSE A;  1XSV A;  5F64 A;  3GTO J;  1FRQ A;  4KFC A;  2QQA A;  1FSH A;  3SY2 A;  1Z7L A;  5HLG A;  2K85 A;  4CCM A;  2PMH A;  2VC1 A;  4O5V A;  3JCU C;  1YO5 C;  3AG4 H;  5LHG A;  3C2B A;  1GXP A;  1ZUN B;  3MHP A;  5D8K B;  3WTT C;  2XGC A;  1OPC A;  2G9W A;  1IUY A;  1DGR M;  2WY7 Q;  4Z05 A;  3OS0 A;  3HHH A;  4ROX A;  3I9V 2;  4ESJ A;  2ZSI B;  1IZ1 A;  1MND A;  2F2E A;  3BR0 A;  2R7O A;  3S1R J;  4E0F A;  5A2Q Z;  3M3Y J;  2KDO A;  4CXF A;  1TW3 A;  2STW A;  4E7I A;  1W34 A;  2LZJ A;  3OP1 A;  4YFN F;  1MBG A;  5EYR A;  5H59 A;  1JT6 A;  5J8F A;  2EIK H;  4DW6 A;  1K5C A;  4FQG A;  1VQL B;  3JTH A;  1X3U A;  3QYF A;  4XL9 A;  2DOD A;  1W1W E;  3S3M A;  4W1U A;  4RDK A;  2EA2 A;  4N9I A;  5HLI A;  1BA5 A;  4EVI A;  3DP7 A;  3DPT A;  4RAF A;  1DDG A;  3D5L A;  5HZA A;  1FRN A;  3QFS A;  4BAC A;  1K61 A;  1R71 A;  4RAZ A;  2DBB A;  1BQE A;  3T51 B;  3KE2 A;  3FHZ A;  1VLY A;  2O0Y A;  2MBF A;  1VF9 A;  2MAB A;  3A01 A;  1XQB A;  3Q39 A;  5K5O A;  1YIT B;  3NAU A;  4LG0 B;  4N3G A;  2BM7 A;  4G1B A;  4EJV A;  3OL3 A;  5HVQ C;  3V76 A;  4DQK A;  4KN4 X;  2LG4 A;  1QPI A;  3ABK H;  3E6B A;  2P7C B;  2LBF B;  4A5M A;  3W2I A;  1R00 A;  4BE1 A;  1VQ8 I;  3V42 A;  1MDM B;  1TLL A;  1AA7 A;  1B72 B;  4BPR A;  2YSR A;  1FWZ A;  4KKS A;  4E7H A;  1BX0 A;  1XG1 A;  2GK6 A;  5BSY A;  1GJR A;  3FPK A;  1YW7 A;  2LK2 A;  4RLF A;  2NRA C;  2R9V A;  2YWF A;  3GSI A;  3CCR B;  1YS7 A;  2KJB A;  2XAF A;  1ZLK A;  1R1V A;  1X3W B;  2DN0 A;  3CCJ I;  3CCE I;  2IRF G;  5FA6 A;  5LGN A;  4A5N A;  2O6W A;  3MAJ A;  1U5T A;  4FAS D;  3W2V A;  1RUN A;  2PE3 A;  5DM7 F;  2KJC A;  3CC7 I;  3BCD A;  2Q2E A;  2IS2 A;  2O6G E;  1UHM A;  5FLM J;  3W2G A;  1RMG A;  1WWX A;  3TO9 A;  1ZYR F;  4P55 A;  4DNC A;  3LMW A;  1PDN C;  2ME6 A;  1HF2 A;  1WOP A;  1JA1 A;  2QM3 A;  1T6S A;  4E7J A;  2FD5 A;  4P5O A;  1MJ9 A;  4BEH B;  4A3G J;  2OA4 A;  2L02 A;  2VE9 A;  2HVS A;  1U9O A;  1TL8 A;  4EJW A;  1LE8 B;  3VSV A;  3DEU A;  1W7P D;  5JLW A;  4UHT A;  1TQM A;  2RQQ A;  1R4N B;  1WJB A;  2VBS A;  3OYB A;  1BBY A;  3RKX A;  2JT1 A;  1JTX A;  3I1F A;  2Q1Z B;  3GXO A;  2M7A A;  4B48 A;  5ICF A;  2EFW A;  4GQN A;  4CQJ A;  2X6W A;  3E1S A;  4X7E A;  3LYC A;  5EZH A;  3BR2 A;  1R5O A;  5EMN A;  1W5C C;  1BI0 A;  1DBG A;  2XTW A;  3R0J A;  1BW5 A;  1DP3 A;  3CP2 A;  1HLV A;  3BQY A;  5HS8 A;  2LC2 A;  4KJZ A;  3LWF A;  5FKM A;  1X19 A;  4YAU A;  4PJJ A;  4XLP F;  4PGH A;  5F27 A;  2BM1 A;  1UHS A;  3C18 A;  2WJV A;  2X6X A;  2HTJ A;  3ELK A;  1X2N A;  2L9R A;  2O1D A;  1FIA A;  1JUP A;  3PNY A;  2XOK A;  3MCA A;  4EGZ A;  3SJM A;  2VKD A;  3KRG A;  4NC6 A;  4N4N B;  2DER A;  1R23 A;  3OV8 A;  3RDI A;  3I59 A;  3ZBU A;  1R7J A;  4X6A J;  2P6S A;  3ZZU A;  2DFI A;  4L9N A;  2DYR H;  4OAZ A;  1ZHF A;  1NB0 A;  3JRC A;  3CCL I;  1Y1W J;  2EFN A;  5DUK A;  4N0B A;  4NBS A;  1S72 I;  1I39 A;  3F8B A;  2XAS A;  4G7H F;  4C0S A;  2H8R A;  5J6X A;  5DCM A;  4X06 A;  5HDG A;  1W0J A;  2HXO A;  2JPB A;  3A01 B;  3VNU A;  2DA4 A;  2K9L A;  1LFP A;  1NH3 A;  3RKW A;  2WAQ A;  5IYW A;  3KLO A;  1UB9 A;  3ZQL A;  2X9D A;  1DAB A;  3VOE A;  3LJY A;  1Z77 A;  3T8T A;  3FZV A;  3HPH A;  2LNB A;  1HSJ A;  3KYD B;  2X3H A;  2AQF A;  3BOQ A;  3GTM J;  1VJS A;  1FNN A;  2ETH A;  2R5Y A;  2RDP A;  2VLA A;  2R93 J;  1ERD A;  1AIR A;  2M34 A;  3ZPL A;  1WJD A;  2ZJP F;  1XD7 A;  2L0K A;  1KTV A;  4G9Y A;  2WR8 A;  1H89 C;  2JRM A;  1W2B B;  4GXO A;  3OYA A;  3HOS A;  1S0U A;  3S3N A;  2GIV A;  2FMY A;  3FJO A;  1IXS B;  1MGT A;  3HGG A;  4WXC A;  2VZL A;  1M90 D;  4HV5 A;  1WSR A;  3ZQH A;  4PC2 A;  1IB4 A;  1T56 A;  3GFI A;  3ZXS A;  3DPL C;  1H0M A;  2QUF A;  3D5R C;  4XON A;  1RR8 C;  1TWA J;  4D5F A;  1Z3Y A;  2JN6 A;  3BJA A;  4GCV A;  3J80 K;  2LF7 A;  5ED4 A;  3HOX J;  2BSA A;  4LIV A;  1YW8 A;  2HMA A;  4C3J J;  4YEI A;  4YAO A;  1QHG A;  2ZZE A;  1FND A;  3VB2 A;  2M45 A;  5KCM A;  2VIX A;  3H09 A;  1QUF A;  1ACI A;  2XF6 A;  1WH5 A;  4P26 A;  3W6V A;  1OLT A;  4H0E A;  1KJZ A;  3B6A A;  3OSG A;  2X4H A;  2R3S A;  4Z4S A;  4XOT A;  5IOY A;  1UD3 A;  2E7W A;  3W2E A;  1SKQ A;  3FF5 A;  4XK4 A;  4RB0 A;  4B3X A;  2E71 A;  2Q6L A;  3W2A A;  3ZPP A;  1XCV A;  2V7X A;  3FXO A;  1PJR A;  1SMT A;  2NYX A;  2K9Q A;  2WV0 A;  3A4C A;  4KMU X;  4UXN A;  2O03 A;  3SZG A;  3TQN A;  1I7P A;  4X0C A;  1IN8 A;  4EJO A;  3TMO A;  1SFK A;  4ON0 A;  2GLO A;  2R7S A;  1Q86 D;  3S8P A;  4D7N A;  4IX7 A;  2TCT A;  2JA8 J;  5E17 F;  3PUN A;  3E6D A;  2O61 A;  5B6I A;  3I4P A;  1Y8R B;  1G2H A;  2CV1 A;  3N90 A;  5EGO B;  4PJN A;  3I59 B;  3FBI B;  3Q6R A;  4JOM A;  1VHO A;  1K9M D;  2FOW A;  3ZOB A;  3BY1 A;  3SYJ A;  3ZMD A;  2V9K A;  3B78 A;  2EIN H;  1JJ2 B;  4X7C A;  4HLX A;  2K4B A;  3K4K A;  3R0A A;  1XDS A;  4OOI A;  2VNH A;  3TDU C;  1D8J A;  3JR9 A;  2XC1 A;  1BC7 C;  2QWW A;  3CPX A;  1R5N A;  4LG0 A;  1RET A;  5BMZ A;  4Z4W A;  2VBE A;  2VJ5 A;  3WTU C;  4YAL A;  3KCC A;  1BPL A;  1W7P A;  2HNH A;  2RKH A;  3NAR A;  1XDU A;  2XZL A;  1IG7 A;  2GA1 A;  5DTD A;  3LSI A;  4CYC B;  4F7Z A;  3KFW X;  1JTA A;  1LLW A;  3DEW A;  5GTI C;  2JA5 J;  2DIE A;  1OCZ H;  1ZRC A;  4HDV A;  2XC7 A;  2GQQ A;  2WAE A;  1G59 A;  4PZJ A;  3L2Q A;  3A35 A;  4M9X A;  2EWE A;  5IYN A;  1VQO B;  1IN7 A;  3VEP A;  3EUA A;  2HYJ A;  5J4Y A;  2YU3 A;  2LKX A;  3P9K A;  1Q81 D;  3N05 A;  4PCQ A;  3DBR B;  4XM3 A;  1ZG1 A;  4QHY A;  2J5P A;  1WGX A;  3HAG A;  4KDP A;  3FK6 A;  1QRB A;  4GYG A;  3JW4 A;  4I98 B;  3ZP5 A;  3LSM A;  1TP4 A;  1ZAR A;  5AON A;  5EEG A;  1JKP C;  3SDG A;  4UNO A;  3CPW B;  5HLT A;  1NDH A;  4XD7 A;  2FBH A;  5GV8 A;  3C2G A;  1FEX A;  5IYQ A;  4CO8 A;  1P7J A;  3LSG A;  4IOA F;  3GQ8 A;  3TOB A;  3KEQ A;  2GOX B;  5EDN A;  4DK1 A;  5LEJ A;  4Q48 A;  1YJ9 I;  4HX4 A;  1U9N A;  3HSE A;  5FKL A;  4G6Q A;  2ZXH A;  4CSW A;  2EIL H;  1UHW A;  4Y13 A;  3LA2 A;  3GTP J;  3KP2 A;  2BM6 A;  1HQC A;  3QP5 A;  3E3V A;  4M9S A;  4MGR A;  3VMV A;  1I1G A;  2QA4 I;  3U2Q A;  5C1E A;  2W4S A;  4ETS A;  1U8R A;  1U2W A;  2K5C A;  2VNI A;  3SLD A;  4A3M J;  1T6X A;  4A93 J;  1UMK A;  2KVO A;  1TNS A;  2QGG A;  2M7B A;  2IGO A;  4BJ6 C;  4R8H A;  1PKV A;  1E64 A;  1XB4 A;  4ZTF A;  2CF4 A;  3VOD A;  2DET A;  1WJA A;  1WI9 A;  3E0J B;  3HUG B;  2KIF A;  1SAN A;  4KT5 C;  3SXY A;  4W8S A;  4MTE A;  5FFZ A;  1QVT A;  2PMU A;  2E36 A;  3A03 A;  3LSK A;  3PSI A;  2VL8 A;  4MFD A;  5L3G A;  3CO6 C;  1TUI A;  1J9Z A;  2W1O A;  3QOE A;  2E19 A;  1IUF A;  3UW0 A;  3CCS I;  1RQP A;  2F1M A;  1LPQ A;  3ASQ A;  5CQG A;  4EH1 A;  3H94 A;  4G7W A;  3GQ7 A;  1OCP A;  4A6D A;  5L3C A;  1V0E A;  1OCO H;  3HSF A;  2DA3 A;  2VQC A;  3D1N I;  3I4N J;  3ECO A;  1ZGJ A;  3ASN H;  3QFC A;  4IRH A;  3GQB A;  2WZP P;  2E1M C;  1Q9S A;  5BQT A;  4QIW N;  1PLU A;  3KLN A;  4RD4 A;  4Y17 A;  2RQP A;  4M6V A;  3S1N J;  2X1C A;  4P9S A;  2XRL A;  1LVK A;  2V9V A;  5ILS A;  3J7Z I;  4P3Y A;  2WB1 A;  4KMF A;  3GWZ A;  5HLH A;  4ABZ A;  4PAA A;  2YPR A;  4HPQ A;  3PSS A;  1FBQ A;  2DA6 A;  1OGJ A;  2RV8 A;  1YIJ B;  1OGO X;  3WTY C;  4OU0 A;  3ASR A;  3BY6 A;  1D0Y A;  2W6I A;  5IYC J;  3CLO A;  3ZQG A;  4RAG A;  4BXX J;  1IXR C;  1YOV B;  2EZH A;  3FXU A;  3K1P A;  3H3Z A;  4XBF A;  1ZM2 A;  1Q1V A;  4UAJ A;  5KW9 A;  1L1I A;  1HKS A;  3MZY A;  2BGC A;  3MD2 A;  3IL2 A;  4ZV4 A;  2XV4 S;  1C0W A;  3ASS A;  4ESB A;  1X4O A;  4XKW A;  3AVV A;  3LAP A;  4E7L A;  1FJL A;  5J8C A;  4CGZ A;  1L0O C;  2XAH A;  4C3I J;  3H9N A;  3KP7 A;  1G7S A;  2QSH X;  1QQI A;  2DLL A;  2VJI A;  3F0C A;  1FLI A;  2Q6I A;  3QFR A;  1PUF B;  5F4O A;  3U2R A;  4LK1 F;  5ICC A;  3K1M A;  3RKQ A;  1OYY A;  4TMZ A;  3QYB A;  1SFX A;  1LLZ A;  1VQL I;  5GTH C;  3KYC B;  1VTN C;  4O3M A;  2DFF A;  3NQO A;  3ASP A;  5K7Z A;  2X51 A;  3DKX A;  4HAM A;  3LQ6 A;  1IRG A;  3PUB A;  1DU6 A;  4RGS A;  1IDK A;  2P5V A;  1KYW A;  1VQ7 I;  4DGW B;  4TSF A;  4YZQ A;  4YHB A;  1MJA A;  3VYU B;  2QE7 A;  2HFH A;  1BMF A;  2EFQ A;  3RSN A;  3K4B A;  5E20 A;  5L3B A;  3WQZ A;  4N4O B;  1XMA A;  3BRO A;  1DGW Y;  2V9P A;  1FYK A;  1KQ5 A;  1O8J A;  1FC3 A;  4TMX A;  2BSP A;  2NNN A;  2EQR A;  5CQE A;  4Q7J B;  2M8G X;  1IJW C;  4B3G A;  2B0L A;  2MC3 A;  4Y9R A;  3NRV A;  3JRE A;  4HW0 A;  3RCO A;  1XS9 A;  4D9J A;  3RPU A;  4Z4U A;  4N3N A;  4W8R A;  1IC8 A;  4CCO A;  2CBX A;  1HA3 A;  3TP0 A;  2JQ7 A;  4XLN F;  2ZKZ A;  3EUK L;  4Q47 A;  3HOW J;  3F6V A;  2M30 A;  2HR3 A;  3CCV B;  2KIM A;  6PAX A;  1RWR A;  5HOD A;  2ECB A;  1E2X A;  1Y0N A;  2EJR A;  1W36 D;  2DOF A;  2CQX A;  4M6X A;  4U0Y A;  5GAD J;  3SQV A;  1EH6 A;  3TW6 A;  2GBY A;  1R58 A;  1LVA A;  3J81 Z;  1IN4 A;  1R49 A;  2G7U A;  2CJJ A;  2MA3 A;  2QQ9 A;  3IH3 A;  2R7R A;  5FL7 A;  4L9V A;  4IEJ A;  4YIR X;  2B7E A;  1U6G A;  2XKP A;  4UVA A;  1P9Q C;  5DYM A;  3ML6 A;  1XPX A;  2CFO A;  2X3U A;  1OCT C;  1HW1 A;  4WZK A;  2CG4 A;  1ONV A;  3DLA A;  1BC8 C;  4UUV A;  2D2W A;  3S2H J;  3RQ4 A;  4U9U A;  3R60 A;  3TDZ C;  3LSJ A;  5E3L A;  3BH7 B;  1R1U A;  2LDU A;  2ZFW A;  2P4W A;  4BQN A;  2CQQ A;  4AC9 A;  4BBS J;  4U0V A;  1CQT A;  1E3H A;  4DYR A;  4XRF A;  5J1R A;  1KZH A;  5JLV C;  2ODL A;  4P96 A;  2XDV A;  5F4J A;  2BM5 A;  1E3P A;  1TYV A;  1N0U A;  4EMS A;  1Q7Y D;  1WJF A;  3ISX A;  1OQY A;  3BP8 A;  4A3K J;  3WY9 A;  2NVU B;  1RUO A;  2FJ1 A;  2XEX A;  3L2R A;  1T2K A;  1XTA A;  3GZN B;  1B8I B;  5E3M A;  2CQ7 A;  4WZL A;  3HJE A;  1O8H A;  2NVX J;  5J40 A;  3I3L A;  4MQV A;  4XRM A;  2WWY A;  1ZGW A;  3JSO A;  1P92 A;  1STZ A;  2W85 A;  1AWC A;  3U21 A;  4LG3 A;  2IS4 A;  3FY3 A;  2Q2E B;  2IA2 A;  4YZA A;  5M5X J;  2INU A;  1PUF A;  1EJ9 A;  3GX4 X;  1O8I A;  5L46 A;  1KU9 A;  4AYB A;  3RTR A;  1HXD A;  1JGS A;  3FDY A;  4OIQ F;  1F5T A;  2OTL B;  3OL4 A;  2OBP A;  4Z6Y A;  1QGA A;  2F48 A;  5IK2 A;  1MMG A;  2DPU A;  4ZGN B;  3HZJ A;  2CMP A;  1KRH A;  5DM6 F;  2RNJ A;  3OEE A;  2WY8 Q;  4RDU A;  3MVP A;  1DBO A;  1MMN A;  2JUC A;  2XAG A;  1YIJ I;  5DS0 A;  5M3M J;  4Z4R A;  2HCJ B;  1YLF A;  3A1P A;  5LGT A;  5FLX K;  5THX A;  2GXB A;  3LSR A;  4CCL A;  3A8K A;  3QFT A;  2IGM A;  5FNZ A;  2NOJ B;  1T5E A;  1VQ5 B;  3CCU B;  1V4R A;  2CND A;  4L18 B;  4CA0 A;  2MYS A;  2VT3 A;  1BN5 A;  4Y33 A;  3SEQ A;  2LKS A;  1WJC A;  1R4M B;  1O8M A;  4V02 C;  3M8E A;  4A0X A;  1EFR A;  3GQ9 A;  2W84 A;  1QPM A;  4LJZ F;  3PVD A;  3WGG A;  2PI0 A;  5F0F A;  5C4J J;  5C3E J;  3GTJ J;  2CC2 A;  3TH0 A;  4JMQ A;  3K70 D;  4UB8 C;  3RZD J;  3CUQ C;  4LD5 A;  3AL0 B;  1YJW B;  3FXR A;  4GRI A;  2VNK A;  1ZRE A;  1VQ9 B;  3SZE A;  4AID A;  3L09 A;  3R6J A;  3OIQ A;  5CKT A;  2LRE A;  5H2F C;  2R6H A;  2X0L A;  2XGJ A;  1Z91 A;  3SDB A;  4L5E A;  2CQK A;  2ESH A;  3CCQ I;  2YUH A;  1Z6T A;  3FKI J;  1MSE C;  1CNF A;  3F21 A;  4ENN A;  1TT5 B;  2F5F A;  3PNV A;  1KA8 A;  1KU2 A;  5FKO A;  3L2V A;  4KKU A;  2OV7 A;  4A0Y A;  3AG3 H;  1Z6R A;  4W8T A;  4M0L A;  3CMA B;  1BHE A;  1FNC A;  2QTL A;  3QPH A;  1EP2 B;  2VT2 A;  2B9S A;  3FIW A;  4OPO A;  5FKK A;  2NS0 A;  2XF7 A;  1VZ0 A;  1EV7 A;  4A3L J;  1SFE A;  1UZC A;  1UD8 A;  2ID6 A;  4RA2 A;  3W3C A;  1WTH D;  4RLZ A;  1X1D A;  2E34 A;  4NNJ A;  1EKE A;  1ZQ3 P;  3HOZ J;  1Z7U A;  2KKO A;  2YWG A;  2ZL5 A;  1E3X A;  3P4G A;  3MWM A;  4QLC U;  5TRD A;  3WGI A;  5EEH A;  1Z21 A;  4A12 A;  4C2U A;  4AYB N;  2V31 A;  3PIO F;  4BHP A;  5J35 A;  3H92 A;  4FET A;  3SYT A;  3K4L A;  3U1D A;  2BMW A;  3OYN A;  2JK3 A;  1P6R A;  2DA1 A;  4R1H A;  3V8K A;  1TTT A;  3CME B;  2DI3 A;  2GIZ A;  3UNG C;  2LD5 A;  3ONY A;  4P2N A;  2QQ8 A;  2KRH A;  2EPF A;  1EH8 A;  2X1E A;  2YWE A;  3T1B A;  1Y1V J;  4BE2 A;  2HZT A;  2Y2Z A;  3K0L A;  1TYW A;  1HG8 A;  4Z1M A;  1PXZ A;  2QKL B;  1PYV A;  4U7D A;  3HHG A;  4EAT A;  3Q3A A;  3SHF A;  2BVM A;  4HQM A;  4EGY A;  4X8I A;  3J81 K;  3DCF A;  4G12 A;  2DTR A;  1TNT A;  4EV0 A;  5KAF C;  2RNG A;  4L5J A;  4Y4R A;  1JKO C;  2PEX A;  2KZV A;  2M9H A;  2XGE A;  2FBI A;  1JXS A;  1L3L A;  2NVQ J;  2FVG A;  1EA0 A;  5JFR A;  3OYF A;  5TGT A;  1LFU P;  1ETV A;  3OYI A;  1Y0R A;  1KQ9 A;  4NBQ A;  2C4T A;  1FT9 A;  3KL9 A;  3OW7 A;  1QNT A;  1U0J A;  2V7T A;  2BM4 A;  2D3L A;  5CYV A;  2CH0 A;  4LC0 A;  1SVM A;  3S17 J;  2H6B A;  5FO0 A;  4QV2 A;  5AIP A;  1R1T A;  2CV2 A;  2DJN A;  1TLH B;  3EET A;  2Z33 A;  5FIU A;  3OOU A;  1KD1 D;  4KN7 X;  4DNR B;  2FUG 2;  2KFD A;  3N97 A;  5HXB A;  1I3A A;  2ADU A;  2EZL A;  4XN0 A;  2HGC A;  3OPO A;  3JX8 A;  1T08 B;  3VO1 A;  2V5I A;  2UWM A;  4BL0 B;  5HS9 A;  2GK7 A;  2AQE A;  2BPO A;  3H0D A;  3Q38 A;  2X0K A;  4ENM A;  4RS8 A;  2DFE A;  3CC2 I;  2V4D A;  4PJL A;  3IAM 2;  4U87 A;  3CCL B;  1OCC H;  5IT9 K;  2ISZ A;  2QY1 A;  3BLY A;  4EM0 B;  1MW7 A;  1KON A;  5GP9 A;  1QZZ A;  2L7Z A;  2ZFU A;  1HKQ A;  1Y6I A;  2FSW A;  2L4A A;  2FBK A;  4RB3 C;  3CCM I;  2R7X A;  3KEW A;  2KIQ A;  1KU3 A;  2X6Y A;  3VSL A;  3OSF A;  3ZCO A;  3O2P E;  1ITY A;  4ZCL A;  1BOA A;  1I8D A;  3FBN B;  1IA5 A;  1XG2 A;  1YX2 A;  1P2F A;  1IN5 A;  4HBL A;  5K1Y A;  3CDL A;  3VR6 A;  3BQZ A;  1XGM A;  1B8I A;  3G71 I;  4Z4Z A;  2Z99 A;  1T33 A;  3VMF A;  4ZCM A;  2E7X A;  2A05 A;  1OFD A;  1V3F A;  1OKR A;  3R6K A;  1JUS A;  1IB0 A;  1BIA A;  1IV8 A;  1ULY A;  4OPW A;  1JUM A;  3R4K A;  4RD6 A;  2OBT A;  1VQP B;  4Z06 A;  4CIC A;  2Y75 A;  3DXJ F;  3LAJ A;  3ERE D;  4LBZ A;  4PGO A;  2YX4 A;  5DD4 A;  1TWG J;  1WU8 A;  3DTK A;  2ELK A;  1ETY A;  3BR6 A;  3HIF A;  3CJT B;  2KDZ A;  1QH0 A;  4OJP A;  4FWT A;  1FP2 A;  5B5E C;  2JWT A;  2L7M P;  3SZP A;  4EEF G;  4V19 K;  3HPG A;  2PLF A;  4AF6 A;  1VQ6 I;  4M71 A;  4E7S A;  1WVR A;  3BTJ A;  1MBF A;  2PQ8 A;  2GPJ A;  3WTZ A;  4OPS A;  3WOD F;  4A3D J;  4RM3 A;  5H6R A;  2B7C A;  1N05 A;  3N6Z A;  4M3G A;  2K40 A;  2GOM A;  4KIF A;  2K86 A;  1GXQ A;  3H9Q A;  1OGM X;  3BJ6 A;  4NB5 A;  2BY2 A;  4M72 A;  5F04 A;  2JIZ A;  3OR2 C;  3ISP A;  4UUT A;  5FD6 A;  1VQ6 B;  1MIJ A;  2OTJ B;  4PK4 A;  1TWC J;  1RNL A;  2FU4 A;  2B5O A;  3AGP A;  2LY1 A;  3BC9 A;  5CJ9 A;  4RCY A;  3EQO A;  3CCJ B;  4B8X A;  4XNF A;  1OFC X;  2QQB A;  1WJ5 A;  5F0H A;  1FTZ A;  2LOO A;  1V54 H;  3BDD A;  3ESW B;  3M8J A;  1X1B A;  4MR0 A;  3HYI A;  1AHD P;  1WJE A;  2LH9 A;  1OYW A;  2A5W A;  3H1C A;  2GXA A;  3WU1 B;  3ZGK A;  2PJR A;  4UUS A;  3NWT A;  4Y7C A;  2XZO A;  1N78 A;  3ECH A;  1E43 A;  1U8B A;  4A3B J;  3P27 A;  1JJ6 C;  3V7C A;  5ERI A;  1F9N A;  2AS5 F;  3FKS A;  3T56 B;  4QUZ A;  4KIT B;  1MNM C;  2L9N A;  2VI6 A;  3SJP A;  1O8K A;  3IHU A;  2F4I A;  1SAX A;  1ZM4 A;  2YS9 A;  3QOP A;  3PA1 A;  5AN9 A;  1R5G A;  2ISY A;  2RRE A;  5AMV A;  4HST A;  4P12 A;  4CUG A;  4TKO B;  2QBY A;  2BGI A;  1JTY A;  1IGN A;  1OGI A;  4OZZ A;  1VLO A;  3CDI A;  1FMV A;  4DIQ A;  3G3Z A;  2M1B A;  3RY8 A;  1ZRD A;  3CXC B;  3ZRG A;  2ZZG A;  4FK8 A;  4AWX B;  4RB2 C;  4CZC A;  3LA7 A;  1HBX G;  4ZYH A;  1VF7 A;  2MG4 A;  3MKW B;  4OAY A;  1LB2 A;  4IOC F;  5LMZ A;  3AVW A;  4HNT A;  2L01 A;  5D4S A;  3DBH B;  1SD4 A;  3UR3 C;  3GVA A;  4E7Z A;  1KU7 A;  2B0R A;  4B44 A;  2BGJ A;  4BJT A;  1HDD C;  1MBE A;  2DK8 A;  3QYE A;  4G1V A;  2GWR A;  4RB1 A;  4ITV A;  4QTR A;  2DDB A;  2HQA A;  3KIO A;  3I55 B;  3ZMU A;  2KQR A;  3GBG A;  3RPU D;  1FMW A;  1R5I D;  1P7I A;  3JRA A;  2XT4 A;  1UG0 A;  1YRN B;  3A1Y A;  4PSX A;  4DQ2 A;  2XTX A;  5FGM A;  5K7H A;  1YI2 B;  2V1N A;  5E79 C;  4DOZ A;  4OWR B;  5E1Z B;  4X05 A;  2HWV A;  3CQZ J;  2MLK A;  2COM A;  4XRS A;  5EEA A;  4A3C J;  1S9H A;  4ENJ A;  1I3Q J;  2CU7 A;  2M87 A;  4L8J A;  2CUZ A;  4YRV A;  1QVF B;  1T98 A;  2BBY A;  2HS5 A;  2VOD A;  4L9T A;  2ZME A;  1WPK A;  2DT6 A;  3HRM A;  5H20 A;  4AIJ A;  2DMQ A;  1FOK A;  2IJL A;  1QA3 A;  3TW7 A;  1GHC A;  5EG0 B;  2EFG A;  2A68 F;  2R7W A;  3CRZ A;  4ZYD A;  1BM9 A;  2EV0 A;  1MMA A;  2IBD A;  2JN9 A;  1NTC A;  1YIT I;  3HL2 A;  1G4D A;  4OJL A;  3DBL B;  3QPT A;  2VKE A;  1H85 A;  1W36 C;  2CW5 A;  1GAW A;  4FCY A;  1MJB A;  2TDX A;  1A04 A;  4YDT A;  2FOK A;  2LF8 A;  3GVJ A;  2KLO A;  1Y8Q B;  2EIM H;  2HYF A;  4XSZ F;  3I71 A;  3BWG A;  3WU2 C;  1REP C;  1IHM A;  1YHQ I;  2VFP A;  3SJZ A;  3RZO J;  1WOS A;  1QHH D;  3G1M A;  1HKT A;  4RJL A;  2PJR B;  1G7C A;  1QZE A;  2I10 A;  2DA5 A;  2LKP A;  3PET A;  5IP6 A;  4UV8 A;  2H6C A;  2E1O A;  4MQ9 F;  3MFK A;  3ZBT A;  3HSR A;  2MGQ A;  2D9R A;  2VBW A;  5FLX Z;  4DBQ A;  5KSW B;  2MD0 A;  2V4J C;  3EDP A;  3CB4 A;  1A6I A;  1HST A;  4X0G A;  5D6F A;  3K70 C;  5LHI A;  1WOO A;  2K9M A;  3KX2 A;  4S04 A;  4WWV A;  2WA0 A;  2EIJ H;  1IW7 F;  1XGO A;  1W0U A;  1BX1 A;  3ZZT A;  2NT6 A;  1RZ4 A;  2HYG D;  4IPA A;  4LBY A;  3T8R A;  2E5N A;  4RCZ A;  1MBJ A;  1XCB A;  4MEX F;  2M5S A;  2A5Y B;  3QU3 A;  4LMY A;  3S93 A;  1U5T B;  1TQP A;  4KIG A;  2AHQ A;  2XGX A;  3CCQ B;  5TJJ A;  5DV5 A;  3VFZ A;  4YIF A;  4ZH4 F;  1NK2 P;  3WHC A;  1TYU A;  4G8X A;  1ZTR A;  2OCE A;  1GVD A;  1N77 A;  1UJ8 A;  1KQ8 A;  4NQW B;  2DQR A;  2AXT C;  1X3Z B;  4ZDP A;  3S15 J;  3PFY A;  3FXJ A;  2NOG A;  3CLQ A;  4IQ4 A;  3P7N A;  4GYI A;  4YC5 A;  3E1Y E;  5KVR A;  4RD2 A;  3KET A;  1TVC A;  5CVJ A;  4M53 A;  4RD1 A;  4TMV A;  3QRF F;  2WPD A;  2NTQ A;  1N25 A;  1T95 A;  1PVE A;  3OR1 C;  3OE7 A;  5DN6 A;  5J3O A;  4HX8 A;  5FKN A;  1B6A A;  1S4M A;  2QGU A;  3HC7 A;  3UKG A;  1CF7 A;  2W25 A;  1HZE A;  3HOT A;  2FNP A;  4JX6 A;  2XB0 X;  1S5L C;  4D5C A;  4RM0 A;  2KPM A;  2W48 A;  3ASO H;  4D0P A;  1H80 A;  4RDJ A;  3KP3 A;  1K6O A;  1RI7 A;  3ABM H;  3JUR A;  3WTX C;  3HOU J;  1DPU A;  3P9C A;  3Q0W A;  1ZEL A;  5F1R A;  2UV1 A;  1GO2 A;  1MNE A;  4FHT A;  2Q8K A;  2LR8 A;  2OAZ A;  1EP1 B;  2PG4 A;  4XLC A;  2KHM A;  2DU9 A;  3CTA A;  4LB6 B;  5IPA A;  3W2H A;  2XSJ C;  2QXZ A;  5EG0 A;  4PGG A;  4PFP A;  1QA6 A;  2H1K A;  1KGS A;  2QSG X;  2R7V A;  3A3G A;  3E5Q A;  1XX5 A;  4DYC A;  2A6T A;  1FX7 A;  3GZ6 A;  5DUI A;  3S1M J;  2LTP A;  3GCM A;  3GRH A;  4JK1 X;  4B4C A;  1HOM A;  1A36 A;  1XN7 A;  4ACA A;  3H36 A;  4I09 A;  3VDX A;  4IHW A;  5BS6 A;  1W4M A;  2Y30 A;  3FKJ A;  1PE9 A;  3M9A A;  3HM5 A;  2K3F A;  4BJ5 C;  1XFO A;  4C43 A;  1YFH A;  1DDI A;  5JBQ A;  2VBM A;  3OYC A;  2R7T A;  1QJV A;  1E17 A;  5CVV A;  4IZZ A;  2CWE A;  5KK1 A;  4ZDO A;  3H5N A;  1GVH A;  1QX4 A;  2F4O B;  4AIK A;  2JUG A;  1R9T J;  2DDA A;  4OOS A;  1HCR A;  2WC2 A;  2WJY A;  4MYU A;  1YI2 I;  2QMU A;  4PSW A;  3HGY A;  2R5Z B;  1RQR A;  3Q5F A;  2OF7 A;  2IEK A;  3IP4 B;  3LL7 A;  3AG2 H;  2VQG A;  5B1B H;  1F36 A;  1T6Z A;  3L00 A;  2HPI A;  1O57 A;  3I55 I;  4BQA A;  5L3D A;  3GTL J;  1OFE A;  4TMW A;  4KYW A;  4FIS A;  3DDY A;  4OIN F;  2IGN A;  4AF7 A;  3HG9 A;  3BG3 A;  1DAR A;  4ASN A;  3SZT A;  3MKY B;  2A6H F;  2D1V A;  4KUM A;  4UV9 A;  3AGQ A;  2R7Z J;  1W9X A;  4LIT A;  2VPR A;  2XTY A;  1VQ7 B;  1IJF A;  2BX6 A;  3CJR B;  1P4M A;  1SKY B;  3K9T A;  2F6C A;  1TW2 A;  3HRU A;  2UZK A;  1E0E A;  4MFE A;  2M8E A;  4G94 A;  3JSP A;  1FOY A;  1K8A D;  4BEH A;  3PL8 A;  3IC7 A;  3IWF A;  4Q5S F;  2HKX A;  1ETK A;  1LE8 A;  1P4A A;  2D1H A;  1MRZ A;  4OIP F;  1J7K A;  3ZR8 X;  3V7A A;  3H5A A;  1T6Y A;  1S29 A;  4WXH A;  3CC4 I;  1FYM A;  2R7F A;  4MHG A;  5E1W A;  3LVB A;  1I27 A;  3DPU A;  4WWC A;  2JSP A;  3CP8 A;  4BUP A;  3KPH A;  4A3E J;  1Z9C A;  2OK7 A;  4ZTJ A;  5BNG A;  2XKO A;  2QEX B;  2DMP A;  1YG2 A;  2ZC2 A;  1AKH B;  5FRM A;  2INV A;  2ZTN A;  1R5B A;  3A8J A;  2IQ7 A;  1ODD A;  2N8G A;  2ZBU A;  1LM1 A;  1WOR A;  2PYH A;  1IO2 A;  3M07 A;  2XPU A;  1K73 D;  3PSZ A;  3AST A;  1MBK A;  2V7F A;  4OJO A;  2VB6 A;  1O3S A;  2BHZ A;  2MW8 A;  1RC9 A;  3B6C A;  1WHU A;  1KK2 A;  1KCC A;  3VPR A;  2BEO A;  4EM1 A;  5H6Q A;  1OIS A;  4L0Z B;  2BF4 A;  3DLL F;  1EE6 A;  1J0R A;  1D5Y A;  1W87 A;  2IOU G;  4KNY A;  2FXA A;  1E79 A;  1BN8 A;  3B90 A;  3ZSC A;  3VSK A;  3GME A;  2F5V A;  1WMR A;  2O5R A;  4M3F A;  2Y48 A;  4I0A A;  1ON1 A;  1M1K D;  4U88 A;  4MYT A;  3E5X A;  1BI3 A;  3TP3 A;  1WKM A;  1BJZ A;  1ZGA A;  2DOA A;  3QQA A;  3E6M A;  2K9S A;  1E3O C;  5DS9 A;  2OBR A;  2K02 A;  2HKO A;  4RLQ A;  2CO5 A;  2A6E F;  4MNU A;  4DBR A;  2R7U A;  5A8A A;  1GUU A;  2BV3 A;  2QF7 A;  4BQQ A;  1MH3 A;  4X1E A;  3OYJ A;  5D5W B;  5J4V A;  5LLQ A;  3OOP A;  3CDH A;  5F08 A;  2DT7 B;  3E6C C;  4IHT A;  3V8L A;  5DCM B;  2ZJQ F;  2ESN A;  4BBR J;  3VWB A;  1UD2 A;  4C30 A;  4E6K G;  4FXU A;  1UCR A;  4CCN A;  1O8F A;  1EP3 B;  2EV6 A;  2XHK A;  2VJ4 A;  3VO2 A;  3EQN A;  2A07 F;  3ZMT A;  3ZMV A;  4DK0 A;  3TGN A;  5FRO A;  2XF5 A;  4JX5 A;  4YII A;  2X85 A;  3A3B A;  5ICE A;  4CYC A;  1UD5 A;  3WBK A;  4FX0 A;  2NVT J;  2HQR A;  3B73 A;  5IYR A;  3KP5 A;  1K4Z A;  1UST A;  1W0K A;  2VXD A;  4BY7 J;  4ZJZ A;  1EWY A;  1FOX A;  1ZM9 A;  3BNW A;  4C2M J;  1BR4 A;  1A35 A;  5JHF A;  3HOV J;  1H8A C;  4Z03 A;  2GA2 A;  2YU9 J;  3MQ0 A;  3P5J A;  3OAA A;  4NC7 A;  1ORK A;  4HNU A;  3HRT A;  4ZYA A;  1VQ4 B;  2PFB A;  2PX9 A;  1IN6 A;  1YX3 A;  4M73 A;  2KRF A;  3MZ8 A;  1J59 A;  1OHH A;  1ZG5 A;  3BH6 B;  2MC4 A;  5HDK A;  4XMY A;  2JJ1 A;  3M4O J;  5BOX A;  3FMS A;  4BH9 A;  1T38 A;  1D2E A;  4S0H B;  3TL4 X;  2C5B A;  4X7F A;  5A88 A;  4M9Z A;  3PQJ A;  3F22 A;  4ZZD A;  5BSX A;  1IDY A;  3TBI A;  2P7V B;  1MBH A;  3WG9 A;  1FX0 A;  4HE6 A;  5EJC A;  3LNN A;  2V1U A;  4M1K A;  1G6N A;  2XRN A;  2XIG A;  3I56 B;  3A0H C;  2R4G A;  3GW2 A;  5C44 J;  2EIX A;  3PO2 J;  4I84 A;  1XSX A;  3ZZ0 A;  2V6C A;  3DTE A;  3G6E I;  5GAG J;  2VUM J;  1K4T A;  3G71 B;  2XNJ A;  3MN2 A;  1A6Q A;  2R7D A;  4IO9 F;  2D45 A;  4YXW A;  3QAH A;  1B59 A;  5GV7 A;  3D0S A;  3PA2 A;  5TR9 A;  1O8L A;  1GT0 C;  3V7S A;  3A2K A;  2Z2S B;  1EXM A;  4TMT A;  5BPD A;  1IF1 A;  3CJQ B;  3W2W A;  2DTZ A;  2H1L A;  1WDT A;  1GDT A;  5EGO A;  3L2W A;  3SEJ A;  3SKB A;  1H9T A;  5LRS A;  3GTG J;  1IAW A;  3J7A O;  4HF0 A;  2FA5 A;  3CMY A;  4MXN A;  2YR2 A;  5L3E A;  3BZC A;  4HA8 A;  2QDX A;  3CCY A;  5IT9 Z;  1X1C A;  4YZX A;  2AXL A;  3LST A;  1ETO A;  4WX9 A;  2XZP A;  4OM9 A;  4II2 A;  2A61 A;  4QWQ A;  4I01 A;  3BZK A;  4V2F A;  5D6E A;  1AU7 A;  4C9Y A;  4F3Q A;  4LIU A;  1WXR A;  3IUO A;  2PN6 A;  2GRE A;  4BDZ A;  1TWH J;  1B9N A;  4I7H A;  1B1B A;  1XGS A;  1WSV A;  1SVL A;  5FRN A;  1BW6 A;  2MH2 A;  4IQJ A;  2DT5 A;  4OOX A;  3WXM A;  2PJP A;  4WQM A;  2Y0M A;  3H3V K;  1Z0X A;  2ID3 A;  2VAS A;  1CGP A;  3DU6 A;  4OOV A;  1SD7 A;  2QCO A;  4YCQ A;  1XC5 A;  1QO0 D;  3RPQ A;  1W0T A;  2F43 A;  4Q4Z F;  2TRT A;  2VBT A;  2X1D A;  2X6O A;  2KIS A;  3LQQ A;  2PEC A;  3KYL A;  2XND A;  5LHH A;  4MEY F;  2VYQ A;  5BPI A;  2BW3 B;  2DW4 A;  3RI4 A;  1YTY A;  4M6Y A;  5M3F J;  3ABL H;  4A3J J;  4I6Z A;  1RKT A;  2ECC A;  5KHD A;  4I2O A;  3BCF A;  2O0W A;  2Q6O A;  1JNY A;  2VNJ A;  2XVC A;  2XPW A;  1FY7 A;  2K7L A;  2LYC A;  3BR3 A;  1VQ8 B;  4Y52 J;  2F5D A;  2IPQ X;  3GFM A;  1SFO J;  1F60 A;  1YYV A;  3DFG A;  2V7U A;  2DQL A;  4LLL A;  3OYH A;  3K2A A;  4XRS G;  1HF0 A;  2W57 A;  3DV8 A;  2CRG A;  5J1Y A;  1Y39 A;  4RBO A;  2OTJ I;  4CYD A;  5JI6 A;  5HS7 A;  3FM5 A;  4A0Z A;  1JHF A;  2HTS A;  1MKM A;  3IRR A;  3BTC A;  3CCM B;  3AVU A;  2FRH A;  4Y3O A;  4L5I A;  5C1C A;  1EZG A;  1U2R A;  1RU4 A;  4C2L A;  3MMP A;  2MFZ A;  5GAE J;  1EF4 A;  4KKT A;  3K4J A;  4EQQ A;  2H09 A;  4LBV A;  2M0C A;  3C1D A;  2CFX A;  4JBA A;  1VQ4 I;  4NCN A;  4WZE A;  2QYU A;  3K4C A;  2EH3 A;  1IRF A;  2E60 A;  1J09 A;  3LMM A;  1QA1 A;  4IHX A;  1VQK B;  2WBM A;  4KH3 A;  3S2D J;  1WFX A;  2GZW A;  1TT0 A;  3A0B C;  4I99 C;  3AKZ A;  3ONU A;  2W7Z A;  4C3H J;  4UUS B;  2HEO A;  4L0Y B;  5IYP A;  1FIP A;  1XSD A;  4E70 A;  2OZ6 A;  1DUX C;  5ICG A;  3ROU A;  5F4M A;  1SVO A;  1NHA A;  5D5V B;  4BGD A;  3PIP F;  5GAH J;  3JQR A;  4X07 A;  3VYT B;  1JI8 A;  2VFQ A;  3L9F A;  2F5C A;  1O4X A;  1ETW A;  2F3L A;  4M3D A;  2D5V A;  2ZXW H;  2VKV A;  3EQL F;  2JDI A;  2MH9 A;  4ACB A;  1QVU A;  4B09 A;  3NAW A;  3V4G A;  2Y0S A;  2L54 A;  5IP9 J;  1QU3 A;  4OIO F;  1YE9 A;  4YFK F;  2L9S A;  1QRY A;  3OWT A;  2CS3 A;  4CZZ A;  2RC4 A;  4WK8 F;  4EJT A;  2OUM A;  2DY1 A;  3OJX A;  2XUB A;  5L3F A;  2NTB A;  3QP6 A;  5B66 C;  1YJW I;  3WTS C;  1B72 A;  4DQL A;  3M7G A;  5HNF A;  2NV4 A;  1V5G A;  4W97 A;  3W2F A;  3EPZ A;  3Q6Q A;  3EYI A;  2E2H J;  2WSS A;  3G2B A;  5F1J A;  3AK5 A;  1LJ9 A;  2GQF A;  1QVG B;  1EH7 A;  1VQ5 I;  3K69 A;  2ZZQ A;  5KNL A;  2C4U A;  2QYO A;  2DPD A;  2C77 A;  3VST A;  4PC7 A;  2DOG A;  3BPX A;  2R5Y B;  1K78 B;  1T39 A;  3LNQ A;  4GDF A;  2CRV A;  3CME I;  3OYG A;  2GXG A;  4KT6 A;  2Z6B D;  3EUH C;  1S8N A;  1Y0Y A;  4XID A;  2R7Q A;  2M4K A;  1OYI A;  4YFO A;  3WE2 A;  2DMU A;  5K7F A;  1YRN A;  1NJI D;  3AAF A;  2CUE A;  3Q3S A;  4F93 B;  4G7Z F;  4IRI A;  4IW3 B;  4HG2 A;  4ZGQ B;  1XMK A;  4XR6 A;  1H88 C;  3CCE B;  1PJ5 A;  3ZPN A;  3G6E B;  1QQ1 A;  1OR7 A;  4IVN A;  2Z9O A;  1AOY A;  3DF8 A;  5CVI A;  3REO A;  3O8H A;  4BXU A;  1U3E M;  4U49 A;  2OQR A;  1H42 A;  3I56 I;  2YWH A;  5FO5 A;  1YQA A;  5DEQ A;  1FNB A;  2P5L C;  4HWV A;  1VND A;  1QGZ A;  2UVE A;  4OIR F;  5HNH A;  2V1X A;  3G73 A;  4HF1 A;  1E3Z A;  1H8H A;  4E7K A;  3NE5 B;  4HQE A;  2ZBV A;  4XN3 A;  2ZJ2 A;  2EFP A;  3DQV C;  4PJ0 C;  4BAY A;  3S1Q J;  2GM4 A;  2KZG A;  3F3X A;  4JRA C;  1RRJ A;  1DU0 A;  1S7E A;  1XE1 A;  3I0T A;  2HPM A;  2HDW A;  3JQP A;  1RR7 A;  2H27 A;  4IHV A;  4F7D A;  2HXI A;  4MTD A;  3HTU A;  4YEJ A;  1D1B A;  2QBY B;  3OW2 B;  1IXC A;  4IRG A;  2L7K A;  2HDC A;  2XT2 A;  4ZC3 A;  1EFT A;  5A2Q K;  1O88 A;  1ZLJ A;  1K28 D;  2IVM A;  3F8N A;  3S2W A;  4BS9 A;  4HE5 A;  2DO7 A;  2PLY A;  3NWS A;  3BZ6 A;  4XOR A;  3SLN A;  3ZUG A;  4FE4 A;  4M74 A;  2YX7 A;  1WCM J;  3JU4 A;  2ZNY A;  4I0B A;  3QWL A;  1F43 A;  3DKY A;  2P6T A;  4RGR A;  4KIS A;  4YZ0 A;  2HQN A;  3DU1 X;  1K7A A;  3DKW A;  2GJP A;  3H0G J;  1JA0 A;  1H8E A;  2DFH A;  4FN5 A;  1G3T A;  3W6J B;  5TIS C;  2MLG A;  3VYS B;  3Q9S A;  4XLE A;  2XB5 A;  4AU7 A;  1JE8 A;  4J0Q A;  4R71 A;  3GVK A;  2NSP A;  1NG6 A;  3CUQ A;  3E20 A;  3OFN A;  3C2H A;  3B02 A;  1OB0 A;  3KZI C;  4G6D A;  2W82 A;  2D3N A;  2QTZ A;  3OZV A;  1FBU A;  3KEY A;  1RPW A;  2XRO A;  5FD5 A;  4EM2 A;  4UY8 I;  1X1A A;  4HX7 A;  1ZRF A;  3BTI A;  1G3S A;  2ICW G;  4A3I J;  3MEX A;  1VI0 A;  5JHU A;  3L7W A;  1HW2 A;  1NG7 A;  2OK8 A;  4LBW A;  1LFB A;  1J9I A;  3WYA A;  1TWF J;  4TN1 A;  1SD6 A;  3ZMS A;  3CD6 B;  2Z3Y A;  3K6G A;  4AVP A;  2V7V A;  2HQ5 A;  5KAI C;  9ANT A;  1NBM A;  5TY0 A;  3BG5 A;  4BKX A;  2ZME B;  2UVF A;  2O9L A;  1DPR A;  1FP1 D;  3HBL A;  2LVS A;  3PJR A;  4I02 A;  4RMN A;  1QZY A;  4F92 B;  2K3P A;  3J7A Y;  5DCF A;  4XLF A;  3ML3 A;  3OYK A;  3FXL A;  1BR1 A;  2JMW A;  1BIB A;  4IHY A;  4MO7 A;  4UZU A;  2KP6 A;  1P4X A;  1SC7 A;  2KT0 A;  4URR A;  2OPT A;  2Z1D A;  2CSO A;  1MMD A;  2L3D A;  2L7F P;  1LQ1 A;  2VBZ A;  1SFU A;  3DWL E;  3W5V A;  1W5T A;  2CYY A;  1F20 A;  4AD9 A;  4Y7N J;  3V8J A;  2ZL7 A;  2E5Z A;  4B3A A;  3JRD A;  2WAQ N;  4MIM A;  4G7O F;  2ZZF A;  2EFO A;  3AVX A;  1QFZ A;  2QA4 B;  2I8D A;  3B82 A;  3OYD A;  3VSU A;  2DMN A;  1IRZ A;  3CCV I;  1I6H J;  2NTP A;  3B4N A;  3RIQ A;  5E8I A;  1O3R A;  4ANJ A;  2BY1 A;  5CVU A;  1QFJ A;  2P0W A;  2IAI A;  1MSF C;  4HV6 A;  4UVB A;  3WE3 A;  2NS8 A;  3GZ5 A;  1D8T A;  1W7P B;  5EZG A;  1YHQ B;  1R5H A;  3I53 A;  1ZG3 A;  1BJK A;  3IAS 2;  4U0W A;  3PO3 J;  4RD0 A;  1S6L A;  4Z4V A;  5C4X J;  4XLA A;  1JKQ C;  4IJA A;  1YS6 A;  1VQN I;  1EFC A;  3ZQI A;  4UVC A;  4BHC A;  1R22 A;  5E8G A;  1FZP B;  3GQA A;  2ZO4 A;  5M5W J;  3BG7 A;  5J3L A;  5IT3 A;  2CK3 A;  2V79 A;  3TKY A;  3WNC A;  2DOE A;  4YG2 F;  1X1P A;  3P26 A;  2FF4 A;  2VBX A;  4BNC A;  4P1V A;  3K1N A;  4IF4 A;  4QFM A;  3AG1 H;  3QE2 A;  2DCE A;  2F1L A;  1DQU A;  3FXK A;  1SMY F;  3OS2 A;  1ZKG A;  4K2E A;  3ES9 A;  2VXZ A;  1CF7 B;  2MSY A;  3WGH A;  1KC8 D;  3T5X A;  4WZT A;  2E2J J;  4F52 A;  1O7F A;  4P1W A;  4HNV A;  1YJ9 B;  4D1Q A;  1X2M A;  2Z8G A;  4J19 A;  1BL0 A;  1QBJ A;  1PJ6 A;  4HYE A;  2ELH A;  3FWE A;  5E1X A;  1RES A;  2JSC A;  4H9G A;  1O7L A;  1O8E A;  1DG1 G;  1QCX A;  2Q6K A;  4HIZ A;  1HW5 A;  1UMQ A;  1BOB A;  4B1R A;  1A5J A;  2XAU A;  2JZY A;  4P9U A;  1LEB A;  4A3F J;  2DA2 A;  2ZTG A;  1AKH A;  4M4S A;  3F72 A;  4B47 A;  4UZF A;  1VQM B;  3K7A J;  3LA3 A;  4QPQ A;  3U6K A;  5IY5 H;  3I64 A;  4M3B A;  1CZF A;  1JRG A;  3B8Y A;  4HRI A;  2Z16 A;  2BY3 A;  5D5U B;  3JRB A;  1TTY A;  1NB9 A;  1OFL A;  4N9H A;  4PUS A;  1K4S A;  3JRF A;  1B23 P;  4F55 A;  3SQN A;  2CW0 F;  3HUG A;  3PNT A;  1KYZ A;  5K5Q A;  3SFI A;  5E18 F;  2GJR A;  1KCD A;  2F4M B;  2M3A A;  1YIO A;  3CD6 I;  3J81 k;  2KIU A;  2ME0 A;  2ZCW A;  3S3O A;  5D8L B;  2FX3 A;  3QOD A;  1XMX A;  5A89 A;  1UD6 A;  2NAZ A;  3OKX A;  2QZ8 A;  2OD5 A;  1N0V C;  2BY0 A;  2QN6 A;  1O8D A;  4Y15 A;  1HC8 A;  2E1N A;  2R5Z A;  3KZZ A;  1PP8 F;  1D3Y A;  1U5T C;  1W5S A;  3KP4 A;  3BC8 A;  2X8K A;  1OFM A;  1PUE E;  1JHH A;  1UEL B;  2KL4 A;  3OJW A;  3CF2 A;  4LLN A;  2P5K A;  2OZU A;  2LBF A;  2VQL A;  3OOC A;  2EV5 A;  3EYY A;  1ZR4 A;  4B4D A;  1WZ2 A;  1V5V A;  1TZL A;  2E35 A;  2RC6 A;  3F23 A;  1FOW A;  2O7O A;  2XPV A;  3FK7 A;  2KMU A;  5FLV A;  4P6V F;  3H5R A;  3SFZ A;  2O04 A;  1APL C;  3M1C A;  2V6E A;  3GEZ A;  4OJ5 A;  3BPV A;  3IRQ A;  1J5Y A;  1ETX A;  2ZXJ A;  3B8H A;  4NHJ A;  3K10 A;  5JR3 A;  3FPP A;  3M1E A;  1GAQ A;  4GGG A;  1LUJ B;  2JPC A;  2E2I J;  3OIO A;  3C3W A;  2BHY A;  3I54 A;  1G7R A;  3JTG A;  1VQK I;  2VFO A;  1D0X A;  2UXX A;  4RAY A;  4P6Y A;  3WNB A;  3HTS B;  1BR2 A;  2ZL6 A;  1ENH A;  2JA7 J;  3ZC3 A;  3NB2 A;  1OJL A;  5JMC B;  2UXN A;  2NPF A;  3K4M A;  4XSX F;  5EF6 A;  3OS1 A;  3CJN A;  2LFB A;  4ASU A;  4Z2Y A;  1F1Z A;  4ESF A;  2IA1 A;  3BG9 A;  1AIP A;  1Q1H A;  2FX0 A;  5FB2 A;  2CUJ A;  1B4A A;  2PMZ A;  4B43 A;  3JAM Z;  2LRD A;  4W8Q A;  3J7Y J;  1BI2 A;  1SAU A;  2XSD C;  2O17 A;  2V26 A;  1GR1 A;  2V7W A;  1N06 A;  3G4S B;  2J5O A;  2ZBK A;  2EBI A;  3T0Y A;  3GLX A;  4DYQ A;  3E97 A;  1O3Q A;  1S72 B;  3FXM A;  4CCK A;  1XB2 A;  3GVL A;  1ZM3 A;  2H94 A;  1WP6 A;  1ZN2 A;  2L2O A;  3MCZ A;  5ILU A;  4ZDL A;  4FX4 A;  2O8K A;  5TV2 A;  4OMZ A;  1HVX A;  2V1D A;  3ONQ A;  2YUS A;  1K83 J;  1D5V A;  3BR5 A;  4CCJ A;  3ZMZ A;  1K8F A;  5AIQ A;  2JA2 A;  1SD5 A;  2IGK A;  4PMH A;  1QFY A;  3OZU A;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 4N4N B;  2D3L A;  1O8L A;  2CH0 A;  3A2K A;  2Z2S B;  1T0F C;  3CJQ B;  3W2W A;  4OJ6 A;  3L2W A;  4NC8 A;  2CV2 A;  4J01 A;  3KRG A;  4OAZ A;  4BQO A;  3OOU A;  4P22 A;  4MXN A;  4DNR B;  2FUG 2;  4BDY A;  4XN0 A;  1X1C A;  4YZX A;  1GLN A;  3OPO A;  2XZP A;  2UWM A;  4II2 A;  4BL0 B;  1X0C A;  2GK7 A;  2AQE A;  4C9Y A;  1OR7 C;  4F3Q A;  4F91 B;  4LIU A;  3H0D A;  1W0J A;  3IUO A;  2V4D A;  3HKZ A;  4BDZ A;  4PJL A;  2K9L A;  3IAM 2;  1LFP A;  4U87 A;  1GQ8 A;  1LKX A;  2IS4 A;  2WAQ A;  5FRN A;  5HOO A;  2QY1 A;  4IQJ A;  3BLY A;  3T9G A;  1MW7 A;  1KON A;  5LFA A;  2IXS A;  2ZFU A;  3SUC A;  1N75 A;  1Y6I A;  3BH4 A;  2VAS A;  2R7X A;  3KEW A;  3HPH A;  2X6Y A;  3VSL A;  3DU6 A;  3ZCO A;  1UD4 A;  2X3H A;  2AQF A;  1I8D A;  1E1R A;  3FBN B;  1IA5 A;  2F43 A;  2QKM B;  1XG2 A;  1VJS A;  2X1D A;  2VLA A;  1ERD A;  1AIR A;  2PEC A;  3VR6 A;  3KYL A;  2XND A;  1WJD A;  2BW3 B;  1D1C A;  3OYA A;  3VYR B;  3HOS A;  5KHD A;  1BLI A;  2O0W A;  3BCF A;  3S3N A;  3H35 A;  4Z06 A;  2HVR A;  2M4G A;  2LYC A;  3DTK A;  1IB4 A;  3ZXS A;  3DPL C;  2XOK A;  3D5R C;  4XON A;  4OJP A;  1Z3Y A;  3OYH A;  3HPG A;  4LIV A;  4E7S A;  1QHG A;  1COW A;  2ZZE A;  2DXI A;  5CDF A;  1NHC A;  5KCM A;  2VIX A;  5CPR B;  2XF6 A;  4RM3 A;  4Y3O A;  5C1C A;  4C2L A;  1RU4 A;  2GOM A;  1V5F A;  1OLT A;  2MFZ A;  4KKT A;  3H9Q A;  3K4J A;  1OGM X;  2JIZ A;  4XOT A;  3OR2 C;  3OYL A;  2W00 A;  3K4C A;  1UD3 A;  2JVG A;  1KZL A;  3DTI A;  3LMM A;  2E60 A;  1J09 A;  4PK4 A;  4B3X A;  3W2A A;  4XQF A;  2WBM A;  3ZPP A;  4G6I A;  2LY1 A;  3BC9 A;  3EQO A;  1WFX A;  1PJR A;  1TT0 A;  4XNF A;  3CZ6 A;  3A4C A;  1WJ5 A;  3AKZ A;  3SZG A;  2LOO A;  1IRX A;  2R7S A;  4MR0 A;  3M8J A;  1SFK A;  1X1B A;  3TMO A;  1WJE A;  3S8P A;  2ZSH B;  4IX7 A;  3ZIA A;  2LH9 A;  2A5W A;  2HVQ A;  4BGD A;  3T53 B;  4CH7 A;  3ZGK A;  2PJR A;  3NWT A;  2CV1 A;  2XZO A;  1N78 A;  4PJN A;  3FBI B;  3VYT B;  1E43 A;  4JOM A;  1JI8 A;  2NZM A;  3HXL A;  2NST A;  2V9K A;  3BCA A;  3DEE A;  3FKS A;  3T56 B;  3K4K A;  4BXF A;  4KIT B;  2L9N A;  2JDI A;  1O8K A;  2F4I A;  2Y0S A;  2RRE A;  3K4N A;  5AMV A;  2VPL A;  4HST A;  2OC6 A;  2VBE A;  1QU3 A;  2VJ5 A;  1YE9 A;  4CUG A;  4TKO B;  1BPL A;  4OZZ A;  2L9S A;  2HNH A;  5LD2 C;  2XZL A;  3OWT A;  2CS3 A;  2GJK A;  3LSI A;  2OUM A;  2V7Q A;  1FMV A;  4QPO A;  1JTA A;  4DIQ A;  2DIE A;  2NTB A;  2VBK A;  5HNF A;  2XC7 A;  2WAE A;  1G59 A;  1V5G A;  3ZRG A;  2BW3 A;  3L2Q A;  3EPZ A;  3A35 A;  2ZZG A;  2WSS A;  3ZQQ A;  3G2B A;  4CZC A;  2EWE A;  2O0V A;  2WAF A;  3EUA A;  5HKK A;  1VF7 A;  3MKW B;  3N05 A;  4OAY A;  4XM3 A;  4HNT A;  3HAG A;  3PSF A;  3UR3 C;  2BOL A;  2ZZQ A;  5KNL A;  3VST A;  3AL0 C;  4E7Z A;  2L5Q A;  3LSM A;  4B44 A;  4BJT A;  1Z3X A;  3QYE A;  1R6R A;  1V0F A;  5HLT A;  4ITV A;  2HQA A;  3OYG A;  4XD7 A;  4PJM A;  4KT6 A;  4PFO A;  2Z6B D;  3C2G A;  3EUH C;  2KQR A;  3GBG A;  3RPU D;  1FMW A;  2IS1 A;  4XKB A;  2R7Q A;  3LSG A;  1UG0 A;  2QX3 A;  2NT9 A;  3A1Y A;  3GQ8 A;  4PSX A;  2M4K A;  4BE0 A;  2GOX B;  1HA8 A;  4DK1 A;  2V1N A;  4DOZ A;  4OWR B;  3LFU A;  4CSW A;  4F93 B;  2ZXH A;  4U4B A;  4HG2 A;  1S9H A;  4XR6 A;  3OYE A;  3ZPN A;  3VMV A;  4L8J A;  2CUZ A;  4YRV A;  5C1E A;  2W4S A;  4JQF A;  3SEZ A;  4U49 A;  2K5C A;  2DT6 A;  3D5S C;  2CW7 A;  2KVO A;  1I18 A;  2M7B A;  4HWV A;  2IGO A;  3F9K A;  4BJ6 C;  3OIP A;  1PKV A;  2UVE A;  5HNH A;  4ZTF A;  1WJA A;  2LY2 A;  2E1B A;  1H8H A;  1E3Z A;  2R7W A;  3CES A;  3E0J B;  3HUG B;  1MMA A;  4E7K A;  3NE5 B;  4W8S A;  3PSI A;  1OOC A;  3LSK A;  4XKV A;  4XN3 A;  2VL8 A;  3DQV C;  3HL2 A;  4OJL A;  4HEA 2;  2W1O A;  3QOE A;  3DU5 A;  1W36 C;  4G7X A;  3UW0 A;  2F1M A;  5CQG A;  3GVJ A;  3FHN A;  3H94 A;  4G7W A;  2KLO A;  3GQ7 A;  1V0E A;  2HPM A;  2HDW A;  2VQC A;  2CV0 A;  1NRK A;  3GQB A;  1QHH D;  1KTW A;  1VBL A;  4YEJ A;  2WZP P;  1D1B A;  2E1M C;  2PJR B;  1PLU A;  1WPC A;  2DJI A;  2HZD A;  2L7K A;  4RM2 A;  2X1C A;  4U7B A;  3S32 A;  1E1Q A;  1LVK A;  4ZC3 A;  1O88 A;  2WB1 A;  1K28 D;  4BS9 A;  3OYM A;  4DJA A;  4DBQ A;  2MD0 A;  2V4J C;  1KCD A;  3MKZ A;  3NWS A;  4X0G A;  4HPQ A;  4XOR A;  3K70 C;  4NK8 A;  3JU4 A;  1OGO X;  2K9M A;  3KX2 A;  3DKY A;  1D0Y A;  4KIS A;  2WA0 A;  2W6I A;  4YZ0 A;  2NT6 A;  2GJP A;  2E5N A;  4J00 A;  2M5S A;  1H8E A;  4C2T A;  3LSH A;  2E1M B;  2VQH A;  3MD2 A;  3S93 A;  3VYS B;  4XLE A;  4AU7 A;  2KRC A;  3GVK A;  2NSP A;  2IS6 A;  4DNT B;  1NG6 A;  1X4O A;  4XKW A;  1EA3 A;  4YEL A;  3C2H A;  3OFN A;  4E7L A;  1OB0 A;  2D3N A;  2W82 A;  1N77 A;  3KEY A;  4NQW B;  4ZDP A;  1X1A A;  2VJI A;  2VKH A;  3PFY A;  4AVZ A;  2BVL A;  2ZXI A;  4IQ4 A;  3QYB A;  2HLD A;  2M0M A;  1NG7 A;  2NTQ A;  2WPD A;  4BU2 A;  2W6J A;  2X51 A;  3DKX A;  3K6G A;  3WWG A;  1T95 A;  3OR1 C;  3PUB A;  1NBM A;  3OE7 A;  5DN6 A;  1IDK A;  4DGW B;  4TSF A;  2JVH A;  2JJ2 A;  2UVF A;  2QE7 A;  3VYU B;  4YZQ A;  3HC7 A;  2UUZ A;  1BMF A;  1HZE A;  3RSN A;  3HOT A;  3K4B A;  3PJR A;  2PYG A;  1X4P A;  3WQZ A;  3VMW A;  4N4O B;  1DGW Y;  2KPM A;  4RMN A;  1H80 A;  4F92 B;  1O8J A;  2K3P A;  3J7A Y;  4XLF A;  1IDJ A;  2BSP A;  5CQE A;  3JUR A;  4IKF A;  3OYK A;  1BR1 A;  4B3G A;  1ZEL A;  3OY9 A;  4UZU A;  2UV1 A;  1MNE A;  3RCO A;  2KP6 A;  4D9J A;  4URR A;  4XLC A;  4W8R A;  2KHM A;  2Z1D A;  1MMD A;  3BCB A;  4CCO A;  2XSJ C;  4XOP A;  2QXZ A;  4PFP A;  4XKC A;  4NK6 A;  3CMM A;  3DWL E;  3EUK L;  2R7V A;  3A3G A;  1KMH A;  2A6T A;  3OEH A;  4H4K C;  2ELJ A;  3G05 A;  1V5E A;  3GRH A;  4B3F X;  1RWR A;  2W7N A;  3VDX A;  1K6Y A;  2E5Z A;  1W36 D;  1D0Z A;  3FKJ A;  1PE9 A;  4II3 A;  2ZZF A;  4BJ5 C;  1O8G A;  2VBM A;  1UAA A;  2I8D A;  3H9G A;  3OYC A;  3OYD A;  2R7T A;  1QJV A;  3VSU A;  4EW9 A;  2NTP A;  3B4N A;  2R7R A;  4IZZ A;  5FL7 A;  4ZDO A;  3H5N A;  4ANJ A;  1P9Q C;  2JUG A;  3OMY A;  2CFO A;  1LDK B;  2WJY A;  1G8X A;  2P0W A;  3DLA A;  4PSW A;  4OZY A;  1YX5 A;  3RQ4 A;  3IP4 B;  3LL7 A;  2VQG A;  4R79 A;  3AFH A;  3IAS 2;  3B90 A;  4BQN A;  2HPI A;  4XLA A;  4NUB A;  3DDY A;  2ODL A;  2IGN A;  2XDV A;  3HG9 A;  3MKY B;  1WJF A;  1MAB A;  1Y56 A;  1W9X A;  4LIT A;  4XLH A;  3MMY B;  3CJR B;  3GQA A;  1SKY B;  3BG7 A;  3L2R A;  2F6C A;  2CK3 A;  3H9J A;  1E0E A;  2X53 S;  1O8H A;  2HU9 A;  2CW8 A;  3I3L A;  3PL8 A;  4BEH A;  3BG6 A;  1D1A A;  3L2U A;  2DCE A;  3U21 A;  1DQU A;  4TT3 A;  4LG3 A;  2WAD A;  3OS2 A;  4G6T B;  2Q2E B;  2VXZ A;  3H5A A;  4HSR A;  3ZR8 X;  2VJJ A;  4E4H A;  4MLO A;  2INU A;  4YZA A;  1Z7L A;  4F52 A;  4CCM A;  4P1W A;  1O8I A;  3DPU A;  4D1Q A;  2JSP A;  3CP8 A;  4AYB A;  2Z8G A;  3RTR A;  4BUP A;  3FDY A;  3OL4 A;  4ZTJ A;  5IK2 A;  1MMG A;  1O8E A;  5FRM A;  1QCX A;  2INV A;  2ZTN A;  4HIZ A;  2CMP A;  2IQ7 A;  3OEE A;  2PYH A;  1BOB A;  2WY8 Q;  1DBO A;  1DGR M;  1MMN A;  2WY7 Q;  2XAU A;  2V7F A;  2ZTG A;  4OJO A;  4Z05 A;  2VB6 A;  4B47 A;  3OS0 A;  3I9V 2;  4QPQ A;  1JRG A;  1KCC A;  2ZSI B;  1CZF A;  3B8Y A;  1MND A;  4HRI A;  2Z16 A;  1EE6 A;  2R7O A;  4E0F A;  4CCL A;  1OFL A;  3ZSC A;  4PUS A;  2IGM A;  2KDO A;  2NOJ B;  1E79 A;  4F55 A;  4E7I A;  1T5E A;  2GJR A;  3PNT A;  3VSK A;  4CA0 A;  2F5V A;  2MYS A;  4Y33 A;  2LZJ A;  3SEQ A;  2O5R A;  2M3A A;  1WJC A;  1O8M A;  1WMR A;  3GQ9 A;  1EFR A;  1K5C A;  3S3O A;  4XL9 A;  3QYF A;  2DOA A;  3S3M A;  3QOD A;  3FY3 A;  4JMQ A;  3K70 D;  3AL0 B;  4GRI A;  4RLQ A;  1UD6 A;  4DBR A;  2R7U A;  4BQQ A;  3DPT A;  3OYJ A;  3D5L A;  1O8D A;  4BAC A;  2DT7 B;  3OIQ A;  2LRE A;  5CKT A;  2XGJ A;  2X8K A;  3T51 B;  3BC8 A;  1OFM A;  3SDB A;  3VWB A;  1UEL B;  2KL4 A;  1UD2 A;  4C30 A;  1VLY A;  3CF2 A;  2MAB A;  4E6K G;  2LBF A;  2VQL A;  4CCN A;  4FXU A;  1O8F A;  3OOC A;  3OL3 A;  5HVQ C;  4KKU A;  2VJ4 A;  3PNV A;  3L2V A;  2LG4 A;  3EQN A;  1TZL A;  4DK0 A;  2OV7 A;  2LBF B;  4W8T A;  4BE1 A;  5FRO A;  2XF5 A;  2KMU A;  1BHE A;  2X85 A;  3H5R A;  3V42 A;  3A3B A;  2O04 A;  1UD5 A;  3M1C A;  2V6E A;  1AA7 A;  4OJ5 A;  4KKS A;  4E7H A;  1W0K A;  2GK6 A;  2VXD A;  2XF7 A;  3K10 A;  4RLF A;  1VZ0 A;  4ZJZ A;  2R9V A;  3FPP A;  1UD8 A;  1BR4 A;  5JHF A;  3W3C A;  1WTH D;  4Z03 A;  4FAS D;  1X1D A;  3W2V A;  1D0X A;  3OAA A;  4NC7 A;  4NNJ A;  3BCD A;  4HNU A;  2IS2 A;  1BR2 A;  4ZYA A;  1E3X A;  2V31 A;  4C2U A;  1YX3 A;  1Z21 A;  1OHH A;  1RMG A;  3K4M A;  3LMW A;  3OS1 A;  4FET A;  3SYT A;  2MC4 A;  3K4L A;  4ASU A;  1BN8 A;  4XMY A;  3OYN A;  2JJ1 A;  4E7J A;  4P5O A;  4BEH B;  2CUJ A;  3UNG C;  3TL4 X;  2HVS A;  2PMZ A;  4B43 A;  2KRH A;  2LRD A;  3VSV A;  4W8Q A;  1SAU A;  2X1E A;  2O17 A;  2RQQ A;  4BE2 A;  2V26 A;  1WJB A;  3TBI A;  3OYB A;  4Z1M A;  1HG8 A;  1PXZ A;  2QKL B;  1PYV A;  2Q1Z B;  1FX0 A;  2M7A A;  4EAT A;  3LNN A;  4B48 A;  2BVM A;  4GQN A;  2X6W A;  3E1S A;  4CCK A;  3GVL A;  2R4G A;  1DBG A;  1WP6 A;  2RNG A;  1DP3 A;  2L2O A;  3CP2 A;  4Y4R A;  4ZDL A;  2LC2 A;  4KJZ A;  2KZV A;  4I84 A;  1HVX A;  1X19 A;  4PJJ A;  3ONQ A;  3DTE A;  3OYF A;  5TGT A;  3OYI A;  4CCJ A;  2WJV A;  2X6X A;  2JA2 A;  2O1D A;  4YXW A;  3OW7 A;  2IGK A;  4PMH A;  3PNY A;  1U0J A;  2VKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...