2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
2PECA 4XR6A 4MR0A 1PXZA 4NK6A 2Z8GA 2VJIA 4XM3A 4XNFA 1WMRA 4U49A 3FY3A 1DBOA 3KRGA 4I84A 2X6YA 5C1CA 1KCDA 2EWEA 3WWGA 1EE6A 4OJPA 4YZXA 1RU4A 4YZQA 5AMVA 4XONA 1JTAA 2INVA 4OZZA 1IDKA 1BN8A 1OGOX 2VBEA 3VSUA 4MXNA 1OGMX 3LMWA 2QX3A 1QJVA 4XLCA 3VSTA 2O1DA 4C2LA 2O04A 2NZMA 3B8YA 2O0WA 1O8HA 2O17A 3GQ7A 4XKWA 4HWVA 3T9GA 4XLHA 1NHCA 2QXZA 4NK8A 4YZ0A 1O8DA 1RMGA 3VMVA 3EQOA 2NTBA 3VMWA 2X85A 4XOPA 4URRA 4W8QA 2NTQA 4OZYA 1X0CA 4YEJA 3GRHA 1BHEA 4OJ6A 1OFLA 4XL9A 1AIRA 2BSPA 4W8TA 4Z05A 2VBKA 4PMHA 3GQ9A 2IQ7A 1PLUA 4XORA 2ODLA 1O8GA 3UW0A 3ZPPA 1KCCA 2X6XA 1O8KA 1O8LA 2PYGA 2INUA 3JURA 1O8IA 4XKVA 4YZAA 2QY1A 4YELA 1JRGA 4U4BA 4Z06A 1IA5A 1O88A 2NSPA 1H80A 1OOCA 3B4NA 4Z03A 4XN3A 2NTPA 4OJLA 1O8EA 1HG8A 2PYHA 1PE9A 1OFMA 2NSTA 1O8JA 4W8RA 1K5CA 2NT9A 1VBLA 4XOTA 1GQ8A 3SUCA 1O8FA 1KTWA 2O0VA 5C1EA 4XLAA 1XG2A 2X3HA 4XLFA 1O8MA 4OJOA 1DBGA 3VSVA 1RWRA 4OJ5A 4XN0A 1IDJA 2X6WA 2UVEA 3GQ8A 2VBMA 3EQNA 1QCXA 2VJJA 4XLEA 4W8SA 4EW9A 3ZSCA 3GQAA 3B90A 2NT6A 1CZFA 4XMYA 4AVZA 1IB4A 2UVFA 4XQFA
chains in the Genus database with same CATH superfamily
1YJWB 1I3AA 2Y0MA 4NNJA 4ZDLA 4A3CJ 3LFKA 4LD5A 2VNHA 4BPRA 1RC9A 4P9FA 2XC1A 3OZWA 2LREA 4LBWA 3BCDA 1HA3A 3DBHB 3EYIA 1FX7A 3VR6A 4I02A 3GTLJ 1USSA 4XONA 3OYLA 1XTAA 2RC4A 3RI4A 2O3FA 3EETA 2AHOA 1YW8A 3T8TA 4HSTA 3IKVA 4MYUA 3DTIA 3S93A 3C18A 3A8KA 2QQ9A 4HF1A 1BQEA 1Z1DA 3SEQA 3VSUA 3OSFA 1RQPA 4U0YA 2V7TA 1ZLJA 3CDLA 1QHHD 2DQLA 4PJMA 4BJTA 3BY1A 1K4TA 2OA4A 4C2LA 3CO7C 2IRFG 3MWMA 3JAMZ 3UNGC 4QPQA 4DOZA 1T6SA 3CCJI 2F5FA 2QMUA 1QZYA 3QYEA 5E3NA 1VHEA 2LBFB 1EFCA 1AKHA 3GTKJ 1CQTA 2ZC2A 1HKSA 4DYCA 4LC0A 4AWXB 1KA8A 2A5WA 1C0WA 3COAC 4EJVA 1D0XA 1I1SA 2VFPA 2CYYA 5FB2A 5E79C 1FOXA 5B66C 1IJWC 3RZDJ 3SJZA 4OJ6A 4W8TA 3ECHA 2A69F 3R0AA 3F8BA 3WTZA 1ON2A 3VYSB 2VFOA 2OK8A 1R5OA 4G6QA 1YIJB 3QP6A 2DMQA 5F4MA 4L5EA 1TQMA 2ZBKA 5C3EJ 2L3DA 2DYSH 5JVGF 3S1RJ 1QFZA 4CYDA 2V7XA 5L3GA 3PENA 1JHHA 4KYWA 1IRGA 3C7JA 3W5UA 4F7DA 1O8KA 2L7ZA 2X0KA 2JQ7A 4BE1A 3K70D 1XPXA 5EGOB 2L7MP 1VQNI 1UJ8A 2V31A 5D8KB 1B1BA 3PIOF 4LLNA 2F43A 2BY2A 2DBBA 3JX8A 1IN7A 3CUQA 4X0GA 3MMPA 2COBA 3BTCA 4DZPA 3G73A 1KONA 2GIVA 2L02A 2DTZA 3C3WA 5GV7A 3ASPA 4N3NA 1T6YA 4II3A 2EWNA 5CVRA 4PJLA 2F5CA 1XDUA 3LA2A 4P3YA 2M8GX 3ZMTA 3KEOA 2VNJA 2EFNA 2TRTA 2L4AA 5IYRA 3D5RC 1VQ4B 4OIOF 2R7XA 2KKOA 3RQ4A 1D5YA 1Y0YA 3DCFA 3PFIA 1S0UA 4O5VA 2PBIA 1DP3A 4EGYA 3QPTA 2X6WA 1IN8A 1WGXA 3ASNH 3HZJA 4LIUA 1FY7A 5HODA 2FEZA 2O61A 1O3RA 4GQNA 3W2HA 1ETKA 5FKMA 2VC0A 1RNLA 2CS3A 3MN2A 2YR2A 4V2FA 4AYBA 5HS8A 3E6BA 3TDZC 1FYKA 2HS5A 4XSZF 1BM9A 4KA4A 2I10A 3V8JA 4IHYA 2P5KA 3ASQA 3ZMSA 3OV8A 1IG7A 3OSGA 3CC7I 3HKZA 1BL0A 2FBHA 4TSFA 2KQRA 3ABMH 2OAZA 4KJZA 1K8AD 3FY3A 1I18A 4HW0A 4DZJA 2BM6A 3FKSA 4FWTA 3LO8A 2EPFA 5C1CA 4YIIA 1U5TC 2IEKA 1KCDA 2HU9A 2XF6A 4PJ0C 2ZSHB 3BJAA 4Y52J 2BV3A 4YZQA 3P9CA 1EV7A 4I98B 1ERDA 4OM9A 1PUFA 1W0JA 2F4NA 2O8KA 2QGUA 2KIMA 1B4AA 3PL8A 2CW0F 2GM4A 1XFOA 4KH3A 1HA8A 1P4AA 4TMWA 3ZPNA 1BIAA 1XGNA 3NRVA 5F6FA 2QX3A 1CF7B 1I39A 3KLNA 3MKLA 5GPCA 3I55B 3PUMA 1HSJA 1KQ9A 1W0TA 5M3FJ 2YU9J 1GJRA 2O0WA 3BCAA 1PVEA 2QM3A 1I27A 2F4OB 4XKWA 1TW2A 1OQYA 1ZAOA 1DU6A 3OIQA 2QXZA 2XRLA 4UZUA 3OL3A 3I59A 1ZARA 4EJWA 4Q4ZF 3EQOA 3LVBA 2LP0A 1QO0D 1O7FA 1YX3A 1KZHA 2DTRA 5KK1A 2M45A 4BUPA 4NC6A 1Y8RB 3CJRB 4OU0A 3HOTA 5DCMB 1WJCA 3F21A 1W36D 1OFLA 2O9LA 4CZCA 4MO7A 4U87A 4HX7A 4BE0A 3KP5A 1T39A 2FBKA 3FMQA 4LG3A 4XORA 5HS7A 1PLUA 1N06A 4E7SA 4RM2A 4J00A 4RDUA 2KLOA 2JDIA 5J47A 2B9SA 3BQZA 5M5WJ 5THXA 3V7AA 2FX3A 3KLOA 3S2WA 1GVHA 1YS7A 3AVYA 4M6VA 1WFXA 1Z3YA 3CD6B 3PUBA 3BR6A 4PDKA 4JX4A 1T38A 1H80A 5FO1A 4N3GA 2Q8KA 2VE9A 2STTA 3I0TA 4CCNA 1D1BA 3F8MA 4UVAA 1S6LA 2HVSA 2VOPA 3DU6A 1QA3A 4G6TB 3MKZA 1J75A 1BR4A 2JRMA 3ZGKA 1WHUA 3OYBA 4RPDA 1FNBA 2K27A 1X3WB 4GGGA 3GZ6A 2DK5A 1N0VC 1ZLKA 3ELKA 1S4MA 3OPOA 1R7JA 1N25A 1JGSA 2CQXA 2V6CA 3SZTA 2QBYB 1DBGA 5GAHJ 1PUFB 1KK0A 1EA0A 2F5EA 4AU7A 2R7SA 2FMLA 3GBGA 1IV6A 2XTYA 1ZRDA 3GTGJ 5GTIC 4HE6A 3KE2A 1I6XA 2B0LA 1N8RD 2IGKA 2VJJA 4ZDPA 4CGZA 2GXAA 2GJKA 2PLYA 2W7ZA 1STZA 2E1CA 4BXXJ 2LRDA 2VBWA 5TRDA 3FBNB 4LLGF 1EJ9A 2RNJA 4CXFA 2DOAA 1GXPA 1IJFA 4EM0B 3S32A 3DDYA 2XTWA 3BROA 3QPLA 3SEJA 3JRCA 1RPWA 3ONYA 1ETXA 3I59B 1Y0RA 3LOCA 1W0KA 4XNFA 4BAYA 1B72B 3M7GA 4KUMA 1EH8A 4A3FJ 1Z9CA 1R71A 3ZMDA 1XGMA 4BHPA 2DPDA 1VLOA 5IT9K 2XTXA 3H5RA 1GDTA 4PJNA 1WQ2A 4WWCA 3D26A 2GXGA 2EWEA 1WORA 1VQ9B 1W35A 1EE6A 3CO6C 2NRAC 3ONUA 1RKTA 3HOSA 1UD3A 4KDPA 1T6XA 1QPMA 4ON0A 1D3YA 4X7FA 2E5NA 1YLOA 2J5PA 2DDBA 1E64A 2DA1A 4Y13A 1PP7U 3HRTA 3VFZA 1OPCA 3OOUA 3PJRA 5BQTA 3CP8A 2BMWA 5EDNA 3OYEA 1QVFB 3TOBA 2LSOA 1ZYRF 4Q7JB 1RR7A 1EKEA 1VHOA 3H92A 1TW3A 3OWTA 2W57A 3V4GA 3TBIA 3OEHA 4RCZA 4XD7A 1DUXC 4P1WA 2Y0SA 4ASNA 4KMFA 2QA4B 1YHQB 3GQ7A 4I2OA 2E1NA 4RPBA 3IH2A 2OD5A 3ULQB 2HOSA 4A69C 1VQOB 2YX7A 3J7YJ 1O8DA 4MTDA 1TP4A 1WI3A 2DMPA 4A3EJ 1HW2A 1HCRA 3KZYA 1J0RA 5LEKA 1ETWA 2JA8J 4ZYHA 2RKHA 4A6EA 4ZZDA 3CC2I 2D1HA 2V79A 4DYRA 4BEHA 2J5OA 2CW5A 4P26A 4QHYA 3GRHA 2DYRH 5FKNA 1CNFA 1ZN2A 1EXMA 1MSEC 3GQ9A 2QQBA 5CYVA 4OPSA 3CLOA 2FA5A 3I54A 2V1NA 2VN2A 4UHTA 1O8GA 1HXDA 2Q0OA 2VL8A 3BT9A 2QLZA 2AS5F 2Q6KA 3W5HA 2G7UA 1Z21A 3KP4A 4Y9RA 3CF2A 4C43A 3FF5A 4ZGQB 3LNQA 3QYFA 2B63J 2CMPA 3F6OA 3OR2C 3HHGA 4HE5A 2VKVA 4IHTA 4RM0A 2KT0A 1IA5A 1NK3P 1VQ8I 4M3EA 5GAGJ 3BR5A 4IZZA 2XEXA 3ABUA 3ASSA 2QKMB 3OP1A 1UFMA 2KPMA 4DNCA 3A4CA 4DK1A 4ZZLA 4OJLA 2FE3A 3CW2A 4IHXA 2NSTA 4M0LA 1LKXA 2OQGA 1LDJA 2RNGA 4NDLA 2OF7A 5E8IA 2BY3A 2XGXA 3TW7A 1JB9A 1ZM3A 2DA2A 1FMVA 3HDDA 2PLFA 2DT6A 2R92J 2DT5A 3J7ZI 4CCKA 2J7KA 2P5VA 5B1BH 2XZPA 2CQ7A 3JRFA 5DSZA 3L09A 1OCOH 5EEGA 5F08A 2FBIA 5HLGA 2VFNA 4JK1X 2IGNA 2C4UA 1ZRFA 4OJ5A 3ABLH 1E3OC 3OJXA 2EILH 2WSSA 1N07A 3GQ8A 2MGQA 3GUDA 1HQCA 1SVMA 4AYBN 1XC5A 2J8IA 4QVAA 3DBRB 3GMEA 2IBDA 3RKWA 4RGXA 3IAS2 2YWHA 3BQYA 4HF2A 1IXRC 3V7RA 5GP9A 4RBOA 2FXAA 1XCVA 1VQMI 2P3MA 1KU9A 3LSIA 1M1EB 3WBJA 3HSFA 1IB4A 2DCEA 2EFPA 2OQRA 2Y48A 2DJIA 4RJLA 4YG2F 2EIKH 3IL2A 3IWFA 4Q47A 3JRGA 1KZLA 1UMKA 1HF2A 3O2PE 1UELB 3F8CA 2WJVA 1TT0A 2WR8A 1IXCA 4OIRF 4GDFA 3OKXA 2C6YA 4I84A 2ZL5A 1WP6A 3PNVA 4X1EA 3WGHA 2F1MA 3ZUGA 3C2HA 4DBRA 3OIPA 3VSLA 4BEHB 4XK4A 3D0SA 4YHBA 4WCGA 1N05A 4U0VA 2M87A 1S7OA 1JTAA 4TMVA 2GZWA 1UHMA 3S2HJ 3W5VA 5FNZA 4WXHA 5HLHA 4A0XA 4NCNA 4E7LA 3CJQB 1A36A 2ID3A 3WGGA 1A5JA 3ZOBA 1J9IA 4MQ9F 3LSKA 5IT9Z 1KYWA 3JQRA 1QA2A 4HQEA 2O04A 4M72A 3ONQA 4HBLA 3CRZA 1FRQA 3EUAA 4CICA 2R4GA 5J4VA 3MFKA 2GK7A 3SQNA 4EMSA 2C2WA 1S72B 2E34A 1D1CA 1LJ9A 2LOOA 1PYVA 1N0UA 3SZGA 2JPCA 5EZHA 3S8PA 2R7ZJ 3OE7A 3N90A 2MFZA 2H8RA 1RMGA 3FK6A 1WVRA 2JN6A 2EFOA 4CCOA 3AGQA 3REOA 1K9MD 4R71A 2WBMA 5D8LB 1H85A 2VOOA 3WGIA 3ABKH 5J1YA 4RD6A 4F52A 2LC2A 4YRVA 2XSDC 2LY2A 4E7HA 2CW7A 2XGDA 4P22A 2ID6A 3DPTA 4A3BJ 1OB2A 1Z7UA 5JLXA 4X06A 2YSRA 3BNWA 2HYGD 2R3SA 4PCQA 5KAIC 4HV5A 2QYUA 1U3EM 3E97A 2PYGA 3ERMA 1ENHA 1T98A 2Y75A 3I58A 4Z4WA 3OFNA 2NXNB 3H94A 2L2OA 5GTHC 5LHGA 2BM7A 5B3SH 4BJ5C 4JP0A 2IS4A 2NTPA 3BR0A 2K3FA 3WTVC 1YRNA 1K6YA 3BQJA 1HG8A 5KVRA 1K28D 1MH3A 1VQKB 2GBYA 1MSFC 3DEWA 4G7OF 2E1BA 4K1XA 2D2WA 3KPHA 4M3BA 3H0DA 3K6GA 1FIPA 1EF4A 2NPFA 1VBLA 2PJRB 2CGPA 3OYJA 1NBMA 1O8FA 2CBXA 3H5AA 2HTSA 2R7RA 4XLAA 2YWFA 1T6ZA 5DYMA 4Q5SF 1OGJA 3HJEA 1MRZA 3D5LA 3FX3A 4BYYA 3RDIA 1YI2B 4ZCLA 1PUEE 1TT5B 2A6HF 5CQEA 5LEJA 3K9TA 4IQJA 2WPDA 2GA2A 2BY1A 3KZZA 5K7HA 2ZSIB 1FWZA 2OTJB 4PSXA 2LMDA 2KVOA 4QFMA 1IJEA 1B2RA 3BDDA 4LG0A 4EGZA 4MNUA 4A93J 2MG4A 2W25A 3R4KA 3WE2A 4C3IJ 2WAEA 5BSXA 4ESFA 2DEUA 3K4KA 4KIFA 2PQ8A 3W3CA 2F5VA 3MMYB 5K7FA 4PC2A 3OS0A 3RTRA 4Z4VA 4X7EA 4M6XA 4IHVA 1KK1A 1MJBA 3MZHA 2QZAA 1BI1A 4RD2A 3IWZA 1G4DA 3NAUA 2I8DA 2XZLA 1O3QA 2K4JA 3H9QA 2M4KA 1EZGA 4RD4A 3WQZA 2BW3B 2ZJ2A 1CQXA 3LSMA 1R1UA 3TO9A 4YAFA 3IC7A 3WHBA 3I64A 2EH3A 1X19A 3F22A 2VQCA 5EG0B 2B5OA 4IF4A 1EH6A 2F5DA 2W00A 3TP0A 4FASD 4CYCA 1KJZA 1ZREA 2LKSA 2XF5A 2EFQA 1BOBA 5FLVA 1H42A 1DQUA 3KX2A 2DFFA 3LSHA 1U8BA 2VBTA 1QQ1A 1DDGA 2GQFA 1O8HA 1NK2P 4HLXA 1K78A 2O17A 1BW6A 2ZFWA 3FK7A 2WY7Q 3QPHA 4OINF 4ESBA 1YRNB 4L9TA 2ZZEA 3OW7A 4G1BA 1RZ4A 2OV7A 1Z05A 3LQRA 3AG2H 3G71I 2NTBA 2ACJA 3T0YA 2R5ZB 1QGPA 1WPKA 4IEJA 1XN7A 5LRRA 4XLPF 3HOYJ 3BR2A 4FHTA 3JQQA 3B6CA 4L5IA 2WV1A 1BJZA 3CMAI 2MC4A 4BH9A 2XIGA 1NH3A 1QA6A 2V7VA 2XNJA 4RB2C 4QUZA 3BCBA 1EP1B 4ZCMA 1CLWA 1ZG3A 1P7IA 1O7LA 2EB7A 1Q9SA 3OEEA 4AIDA 3OYFA 2VB6A 4FCYA 4L8JA 3S3OA 3MZ8A 3T53B 1N75A 1WJBA 1T33A 3W2WA 2VXDA 2DLLA 4OOVA 1YJNI 1RQRA 3MQ0A 4X7CA 3PSZA 4WXCA 3TDUC 2R7WA 1E2XA 3PVDA 3PQJA 3SYJA 5E3LA 1VQOI 3Q3SA 1L0OC 4LG0B 4LB6B 2JZYA 3BG9A 4GO1A 5K1YA 4EM1A 2GREA 2DO7A 2L7FP 1U2WA 5BPDA 2JK3A 3Q39A 2HR3A 3RPUD 2E7XA 1SANA 1QPIA 2W48A 4BHBA 1GV2A 2V7WA 5K5OA 2ME6A 1BW5A 5KSWB 4L9NA 2G9WA 1D2EA 2ECCA 3S15J 4JMQA 4HDVA 3AVUA 4BL0B 4G7ZF 2XAHA 4UZFA 3RSNA 4F3QA 2KRFA 1UD2A 1O8MA 2N8GA 1F43A 3ZR8X 1FNNA 3A1PA 1WJDA 1MBJA 1ITYA 1IDYA 1S9HA 2B7BA 1W0UA 4FISA 2MC3A 3BC9A 4RAYA 2KIUA 3M1CA 2VBMA 2CUEA 3LJYA 2HYFA 3SYTA 4W8SA 2EK5A 2XGCA 2K9LA 3FHZA 4AC9A 1FDRA 2CFOA 1RESA 2EIJH 2KRHA 3IV5A 3SJMA 2E36A 5HDKA 2GJRA 2FF4A 3U2QA 3CCEB 1VTNC 1TYWA 4GYGA 4PC1A 1K78B 3QOPA 1QU3A 4FXUA 3GSIA 4TMZA 3ASRA 2HDWA 3BLYA 1SD5A 2ZZGA 5JLVC 2XV4S 4MIMA 5A89A 3E0JB 4RLFA 2XC7A 5L3FA 4S04A 1YJ9B 4M3FA 3CESA 2Z8GA 5CVIA 4B44A 2C78A 1K4ZA 2A05A 4JYKA 2Q2EA 2M2EA 2VI6A 3N4MA 3KEWA 2X6YA 1G7CA 2C4TA 1VZ0A 1AWCA 2P7CB 2WWYA 2JA5J 2LF7A 5IYWA 2E7WA 3HUGA 2W85A 4OJPA 2EZLA 2JSCA 4M9XA 3H3UA 4YXWA 2ICWG 3VDXA 1XMKA 5AONA 2QZ8A 1BLIA 4AIHA 4CO8A 2CV1A 1BN8A 3JRIA 1ZGWA 5LHHA 5CKTA 2CV2A 1MMGA 1T56A 1OB5A 3LSJA 3WE3A 1X1AA 4B4CA 3I4NJ 4R1HA 4U0WA 4XKBA 3A1YA 3CB4A 1OYYA 1T8IA 3ZBTA 1QA1A 1TWHJ 4MEXF 2C5HA 4C0SA 1KU2A 1S5LC 1MDMA 2XAFA 3V8LA 5HVQC 1WJFA 2TDXA 4FX4A 1IO2A 1T5EA 5IT3A 2XKPA 5F4JA 4E0FA 3T9GA 2VPRA 2WV0A 4CCLA 2HOEA 4DGWB 1W87A 2VQLA 2F6CA 3E1SA 2DMUA 3VMVA 3RYRA 3F3XA 3HEFA 1XE1A 1JJ2B 1OCCH 2R5YA 5HOOA 1MBFA 1ZQ3P 5GPAA 3V42A 1D0YA 1ZUNB 3HBLA 3BPXA 5IP7J 2DK8A 2X48A 3VYRB 2EZIA 5ICFA 2D45A 3VYTB 4IKFA 4TN1A 1OKRA 2JJ2A 2L9SA 3DLAA 3GFLA 4BJ6C 1ZELA 1BI3A 2ZNYA 1E3XA 4L9JA 3T1BA 2X6XA 2V1UA 5JBQA 3J7AY 1QG0A 2V1XA 2VBVA 4A6DA 1SMTA 1R5BA 3P5JA 2K9SA 3ZQGA 2DN0A 4B3AA 1PJRA 2BHYA 4ASUA 3R6SA 2RDPA 1JRGA 2DA6A 3BPVA 3HM5A 1JKRC 5H59A 4CQJA 2NSPA 4YFXF 2MH2A 1TWGJ 4BXFA 2H94A 2KP6A 3OYAA 4LOCA 1JKQC 1TWCJ 1ETVA 2ZCWA 4QVJA 3BG7A 1JA1A 4KNYA 1PKVA 3VODA 1UD4A 2KJBA 3TL4X 3P26A 4RCYA 1TZLA 4H4KC 2FD5A 1U9NA 3SUCA 1I1GA 4I76A 1KYZA 3CJTB 4RDJA 5FO5A 3WTYC 1LUJB 4GXOA 1HC8A 2PJPA 3HUGB 2L5QA 3BTLA 3GX4X 2X9DA 1YO5C 1UD5A 2LNBA 3BOQA 1ZKGA 4PSWA 1K61A 3RZOJ 1EFTA 3I56B 5ICCA 3FIWA 2Z33A 3Q0UA 1B8IA 2K9MA 5KNLA 3NARA 1SVOA 1BJKA 1P9QC 5DTDA 1V0EA 3DP7A 4Y15A 4IRGA 3E5XA 5F0FA 2K3PA 2HI3A 1IXSB 2H1LA 3KL9A 3Q3AA 1RETA 3W2FA 2PX9A 4JOMA 3JREA 1EP2B 5J3OA 2BEOA 3FKIJ 5JFRA 3DLLF 2DW4A 2D9RA 4UVBA 1R4NB 5CDFA 1BMFA 1HW5A 3DF8A 2KZGA 2VQGA 4BHCA 4B3XA 2Q6OA 5D4SA 4U49A 3CC4B 3FMSA 5E1ZB 3GLXA 4WZEA 5LD2C 4Y7CA 3VYUB 1YW7A 2Y69H 3K70C 3M1EA 2HDDA 4RMNA 2XNCA 1HLVA 4HLYA 3QE2A 1YI2I 1BI2A 4CSWA 2MLGA 1B23P 1TLLA 1H8EA 1LDKB 2ETHA 4ENJA 4XLNF 4B4DA 2YWEA 1LPQA 4LJZF 1KQSB 1TL8A 1OCZH 4ZGNB 1G7TA 2LK2A 2V7QA 2RQQA 1BN5A 2VZLA 4L18B 2VUMJ 2ZTGA 1D1AA 2XAQA 3GVLA 5FA6A 3I3LA 2L01A 2D1VA 1APLC 1D1NA 1P6RA 1LFPA 3W2GA 2DFEA 3VSTA 3ZZUA 1OR7C 1QNTA 3ZBUA 3CCUB 3BG5A 4C9YA 1W5CC 1S8NA 2DI3A 2AQEA 1AKHB 2W4SA 1OISA 3PNTA 2DPUA 4V2GA 3GFIA 2X51A 2UZKA 1A31A 2BM0A 3CCMB 3ML3A 4Z4TA 4M74A 4TT3A 1ZG1A 2HXIA 1VQ6B 4HAMA 2PMHA 2QCOA 2BM1A 1Y0NA 2L9VA 1O3TA 2DJNA 2DOGA 5BS6A 3GWZA 4P12A 2NTQA 3RKXA 4GFBA 1K6OA 4KN7X 2HZTA 4G7XA 5JR3A 3ZQCA 2VNIA 4Z05A 1H8HA 1YS6A 2YUHA 4IQ4A 3DKYA 2KMUA 2F4IA 3U9GA 2HOTA 1WI9A 2QSFX 1N78A 4MHGA 4N4NB 1B8IB 2BVLA 4YIRX 3DPUA 2LF8A 2QEXB 4CDGA 1CNEA 1O8LA 1R22A 1TNTA 3ZPLA 4ZYEA 4ACAA 4G1VA 3X2QH 4M2LA 1ETQA 3CUQB 4E7JA 2KIQA 1LB2A 4H0EA 4KITB 3DKWA 1IW7F 4M71A 2BSAA 1VQLB 4YCQA 1KQ0A 1DDIA 3BC8A 3PO3J 4U4BA 5BOXA 1CGPA 1NG6A 3Q9VA 3SEZA 1G3WA 2AXTC 4PFPA 2PE3A 2CUZA 2VIXA 3P7NA 3Q6QA 1QVGB 4W8RA 5FGMA 1T0FA 2UWMA 1R6RA 4KICA 5TGTA 3GVJA 2M4GA 1BI0A 1XMXA 2JVHA 4PJJA 1IHMA 2VNKA 3VMFA 1FOWA 2KRCA 3RJPA 3ZN0A 4A3LJ 3AK5A 3MD2A 1P4WA 5F04A 4P9UA 1COWA 2R9VA 2WTEA 2CV0A 4OJOA 5H6QA 2CQQA 2RAEA 1ONVA 1XB4A 3I1FA 1V5VA 1LM1A 1JUSA 4XIDA 3S3NA 3EQNA 5FFZA 3ZMZA 1IN4A 1RI7A 1X3UA 2DA7A 4A3KJ 1UCRA 2EZKA 3HOUJ 3FM5A 1Y8QB 2K9NA 2RQPA 4B43A 3SY2A 2V4DA 1W36C 4QV2A 3CP2A 1K79A 1QUFA 3SLNA 4FE7A 5L3DA 2ELJA 2HPIA 3PNYA 3G4SB 4B3GA 2VLAA 5IK2A 3IHUA 3LSPA 1OCRH 1IN6A 3G2BA 5LGNA 5D5UB 2NNNA 9ANTA 1VQ7I 2KHMA 4D9JA 3F9KA 3SZEA 1IAWA 2XPVA 1NTCA 3RIQA 4YZXA 4B8XA 2R93J 3ZCOA 1O4XA 4QSHA 4RGUA 3R0JA 2P0WA 2HPMA 4EJTA 3B8HA 3ISPA 4AD9A 1FIAA 1J59A 4ITVA 4DW6A 2IJLA 3PA1A 3O8HA 2EA2A 2M9HA 3Q0VA 2D74A 2JUCA 2RC6A 1P4XA 5M5XJ 1FYMA 1PDNC 3GIRA 3VO2A 4A3JJ 4Z4ZA 2XAJA 3P9IA 1R1VA 5FKOA 1AA7A 5K5RA 5D5WB 1VQ5B 3OL4A 1VQPI 1YITI 4KKTA 1BBYA 2Q1ZB 3HRSA 1FP1D 5FKLA 2NVUB 2RV8A 1B9NA 4HA8A 3L2RA 1EH7A 4HWVA 2LLKA 3JRHA 3H0GJ 1D8TA 4HX4A 1W5TA 4RAGA 2KFDA 3WYAA 2ZXIA 5GAEJ 4ETSA 3OY9A 3JRAA 4P6YA 1FT9A 3WHCA 4P3IA 3AVXA 4URRA 1WOOA 3MCAA 2E2HJ 2QDXA 5IYPA 5J8FA 4EJUA 1EFRA 1BHEA 3Q6RA 1B59A 2XHKA 1BR1A 2CC2A 1QVTA 5CLSA 4ZH4F 1FTTA 1FLIA 2PMZA 5AN9A 3GTOJ 3NWSA 2V26A 3CTAA 2BF4A 3FM3A 2B7EA 5CVUA 1KCCA 2YWGA 1FOKA 1JUMA 1YJWI 2O6WA 5J3LA 3ZMVA 3H3ZA 1DABA 2DOEA 4M4SA 3BJ6A 1Y6IA 3QFCA 2QY1A 2QYOA 1M1KD 4PK4A 4DYQA 3O3KA 3EUHC 4OIQF 1BJAA 2CO5A 5J1UA 4B48A 4PGOA 3CCRB 1D8KA 3N97A 2E2JJ 1QHGA 2WY8Q 3NQOA 3CMMA 1GVDA 2CQKA 4WX9A 2FSWA 4LK1F 3PO2J 1YLFA 2OU2A 4C2UA 5FLXK 1DG1G 5DCFA 2K9QA 4E7IA 5HNFA 2VXZA 3HOVJ 2CK3A 1V0FA 3L7WA 3CCVB 3FBIB 3SXYA 1X4PA 1OYIA 3E5UA 3H5NA 1KTWA 5C1EA 3CCQB 1EA3A 5LGUA 3NWTA 1YE9A 2D3NA 1ODDA 1W7PA 3A2KA 2ELKA 4KFCA 1HW1A 2DOFA 3GO5A 3SHFA 4OMYA 2ZMEA 4H9GA 2KJCA 2YPRA 1RRJA 1IGNA 4I01A 2DFHA 5DEQA 3S3MA 2C77A 3DV8A 2CUJA 4IW3B 3W6KB 1TBXA 5E6TA 3CCLB 3IUOA 3GXOA 3E6DA 1PP8F 4HNVA 4HIZA 3JTHA 1O3SA 1QRBA 2GOXB 3U2RA 4EEFG 4DBQA 3WTUC 3H9JA 2AHQA 4AVZA 4YFKF 2MSYA 2L4MA 4IPAA 5HS9A 3ZRGA 3A3GA 5F64A 4X07A 1YIOA 3AVWA 3GVKA 1WSRA 1JXSA 4FE4A 4LLLA 1YIJI 1S29A 4RD0A 2DMTA 1A6QA 4AVPA 1SKYB 3CMEB 1WMRA 3BG6A 5HXBA 3DBLB 3M9AA 1WRJA 3ZIAA 3PQKA 1P7JA 1QGZA 1ZM9A 2OBTA 1NRKA 3I56I 3R6JA 2J8KA 2XGJA 3S17J 3AVVA 1Z67A 2BX6A 5B6IA 1KQ8A 1ZRCA 1TNSA 1MZBA 3K7AJ 2NVTJ 1U0JA 3ZZ0A 1R23A 3CCSB 3ZC3A 1T95A 4A2UA 1Z7LA 3OS1A 2A3SA 4IOAF 4I6ZA 4AF7A 2H6BA 1HDDC 3FZVA 3JTGA 3CUQC 1AMOA 3S2DJ 4M9SA 2A6TA 2HNHA 1VQ4I 1NHCA 2CFXA 1H9GA 2KDOA 4MLOA 5LGTA 4UUSA 4G8XA 4KMUX 3AG3H 4WQMA 5TR9A 3VB2A 4MFDA 2OBSA 1Q1VA 4P1VA 1V4RA 4Z6YA 2HGCA 4G5GA 4UB6C 1MBHA 4XL9A 2X1EA 2R6HA 4QLCU 3KP6A 2CG4A 1MJAA 4OAZA 1UB9A 3HB9A 4BY1J 2VFQA 5DM7F 4A3DJ 5DDGA 1QRCA 4J0QA 2YS9A 3JCUC 3UW0A 5ILSA 3ZPPA 1LLZA 3EQLF 4E70A 4HNUA 3GTJJ 3QQAA 2CQNA 1OB0A 2YUSA 2PN6A 2ZXHA 1MMSA 2GPJA 2VYQA 4MFEA 3SKBA 3OYIA 3OZUA 5CVJA 2INUA 3NAWA 3SLDA 4M3GA 1YOVB 3BWGA 3LSGA 2L7KA 3RCOA 1WKMA 5D5XB 1DARA 2FU4A 2HTJA 3S14J 4HG2A 4XN3A 5F4OA 2V4JC 1Z6TA 1O57A 4JBAA 1XX5A 4YEIA 1HDPA 1TVCA 3LSRA 5DD4A 4X7DA 2QVOA 1XSXA 1OFMA 1XGOA 3M8JA 2FOKA 3ASTA 1SFXA 1IB0A 3I4MJ 3AAFA 2VODA 1R1TA 2ME0A 5KW9A 4FETA 5GV8A 3CCJB 3QODA 4BNCA 4BXUA 3RY8A 3I55I 1WSUA 1OCTC 2X1DA 2LH9A 4F92B 2V6EA 1A6IA 4UUTA 1SD7A 4JRAC 3Q9SA 1FYLA 1F5TA 1HSTA 1VQLI 3BZ6A 1RIOH 5CJ9A 5FLXZ 4PABA 2QQ8A 4IJAA 3KYLA 3ZZTA 2W1OA 2L54A 4YIFA 4IO9F 1JKOC 4PGGA 3A8JA 4TMXA 1VLYA 2OUMA 2XASA 1E3PA 3K69A 1E3ZA 1FBQA 3CDIA 3FDYA 3ZQIA 2XZOA 2DA5A 2O03A 3PM1A 3MAJA 5AIPA 5FROA 4BBRJ 1Z77A 3K4NA 4CZZA 1U78A 1KTVA 3GFMA 4RD3A 1YTYA 3C2GA 1GUUA 1ZR4A 1LEAA 1QQIA 4U7DA 3EPZA 1DDNA 3F8FA 4ABZA 4BACA 4WK8F 2EV6A 4P96A 1Z6RA 4OAYA 3OW2B 1JTXA 1XS9A 4II2A 2W7NA 4UB8C 3WU0A 2WYRA 2VONA 1E1RA 3HYIA 2HWVA 4RA2A 5E3MA 3CD6I 4QWQA 2JMWA 1G3YA 2INVA 2JUGA 1KC8D 5FD6A 4GCVA 2D5VA 1WDTA 2JTVA 2X4HA 3W2VA 2FJ1A 1FNMA 4G6DA 3LSTA 5JMCB 5HKKA 3LMWA 3GEZA 2IS2A 3E6CC 5IYQA 3S16J 5IY5H 2NZMA 3FXMA 2QGGA 2NOJB 4LBVA 4LB5A 3HG9A 1G2HA 3AG4H 5JHUA 1MMAA 3AL0B 1LDDA 3FXKA 2VT2A 3LQQA 1I6HJ 1IDZA 1G3SA 4L5JA 4YAOA 2CWEA 2Z3YA 3HXLA 1ZGJA 3DEEA 2ZL6A 5DD8A 3CCYA 4G94A 4A3MJ 3H9NA 3NE5B 2ELHA 1M90D 3IRQA 5H20A 1SMYF 4OZYA 1X0CA 2K4BA 2W84A 2QENA 3KEYA 3T5XA 3CPWB 1U5TA 3AVTA 3GCMA 3JSOA 1W2BB 1QH0A 2PMZN 1A8PA 4M53A 1E63A 3WTXC 1KMHA 2EBIA 4NC7A 4UNOA 3ZN1A 2ODLA 2XNDA 1VQ5I 2K02A 3DU1X 1GHCA 4P5OA 5ERIA 5BNGA 4OPOA 2BV6A 4N9HA 5EF6A 2JRTA 3PIPF 1BPLA 5J8CA 3OOCA 4G7WA 3FJOA 3P9KA 2AXLA 3L2UA 4D0PA 2E1RA 3DXJF 5FKKA 3N6ZA 4N4OB 1FEXA 3K0LA 2X53S 3RYPA 4Z1MA 1X1BA 3G1MA 1JE8A 2DIEA 1DP7P 4EM2A 1VQ9I 4UUVA 2COMA 2CJJA 3O8GA 3CUOA 2NS8A 5EZGA 2VASA 3E3VA 5DM6F 1UG0A 1H9TA 1PJ7A 2CF4A 1KGSA 3M07A 2IXSA 2NT9A 1J2XA 4X05A 4GYIA 2QSGX 4KT6A 2VBUA 1XGSA 5C4XJ 2BXYA 2ZXJA 4NQWA 1SM4A 4P25A 2P6SA 2FMYA 4LIVA 3ZQFA 3JW4A 2EA4A 3V7SA 3VSVA 5TV2A 1IN5A 3H09A 1ORKA 2HQAA 3M8FA 2QA4I 3HIFA 1YHQI 1IDJA 1BX1A 1J7KA 3QPSA 3SQVA 2NS7A 1VF9A 4YALA 2HDCA 2R7OA 1E3HA 3R61A 4NBQA 1IUFA 4XLEA 3U1DA 5ILVA 1BC7C 3J81k 1EP3B 3DKXA 1SAXA 2CRVA 1E0EA 4F91B 1OGIA 4TMTA 4ZCIA 1OHHA 1SFUA 4LMYA 1NHAA 1W7PD 2RREA 1F36A 2DDAA 3QFRA 4HDUA 2Z99A 4LITA 1ZM4A 2OK7A 4AIKA 2Z1DA 3TKYA 2BVNA 3ZQ7A 3CCQI 2CW8A 1MKMA 3ZXSA 2JVGA 3HC7A 1TWAJ 3KP7A 3O6BB 2O6GE 3VO1A 1HOMA 3CXCB 3K2AA 3WWGA 4F7ZA 1U5TB 3C2BA 3ERED 4ZJZA 3AFHA 2ZL7A 2X6OA 1R5HA 2ZITA 1R36A 4OOXA 4CYCB 5TJJA 1Q86D 1ZG5A 2KISA 1NG7A 4ANJA 1R9TJ 4ENNA 1WOPA 1IV8A 2CU7A 4O6JA 2K86A 2JA7J 4AM3A 1OGOX 2VBEA 3LL7A 5FFXA 1OGMX 5F0CA 4D1QA 2VPLA 3HGYA 4B1RA 3K4MA 3OR1C 3G6EB 2W82A 3S1QJ 3ISXA 5L3CA 3M3YJ 1BA5A 2JA6J 2RC5A 2EIXA 1MABA 1ZTRA 2JJ1A 2M1BA 2VKDA 3TGNA 1GVJA 4FQGA 3DQVC 2EV5A 2WAFA 3KP2A 2STWA 2H09A 1HBXG 5H6RA 4YDTA 2A61A 1FSHA 3BH6B 1V5GA 4OOIA 4XOPA 3BY6A 2LBFA 3DTEA 1KQ5A 4Q48A 4IX7A 1F20A 4W1UA 1JA0A 1WCMJ 4NQWB 1OFEA 1AIRA 2EQRA 2QKLB 3OYCA 3Q5FA 2WAQN 1DGWY 5HDNA 1P92A 1T08B 2IA0A 3QFSA 3QRFF 2IT0A 3DFGA 4Z4RA 2DMNA 3CCSI 1F60A 1Q82D 4N9IA 2FUG2 2EV0A 3ML6A 1Y56A 2M30A 4EQQA 1ON1A 3MVPA 3L2WA 2Z6BD 4AC0A 5FRNA 2DERA 4RDKA 4YZAA 5JVTA 1JJ6C 4OPVA 1UHWA 2XAUA 4YELA 1SFOJ 1HKQA 4KN4X 3JRDA 2F48A 1U6GA 3CQZJ 3PUFA 4JX5A 4E7ZA 4E7KA 5B1AH 4BQAA 3B4NA 5JI6A 3PSIA 2FQ4A 4YAUA 1X1PA 3GZNB 6PAXA 1VNDA 5LRSA 3HPHA 2QSHX 4BS9A 5J40A 5IYDJ 3K1PA 4U88A 5FL7A 1GAQA 1LQ1A 4RAZA 4DJAA 4F55A 1SFKA 3VEPA 2W6IA 1QGYA 3QOEA 4RAFA 5HDGA 1VF7A 2LY1A 2H8WA 3C1DA 2MD5A 1TC3C 3RPQA 3IH4A 3QU6A 4I0AA 1S72I 4BU2A 1S3JA 1WSVA 2IP2A 5E8GA 3CC2B 3V7CA 3A8IA 1K7AA 3KCCA 5TISC 4A0ZA 3OS2A 1D0ZA 3K2ZA 1I5ZA 1LVAA 1K83J 2NT6A 5EYRA 1SFEA 1WJAA 2CH0A 3D5SC 4CCJA 1CZFA 4XMYA 1TSPA 2DQRA 5A2QK 2Q2EB 4C3HJ 2GXBA 3OYMA 4ROXA 3TW6A 5IP9J 2W24A 1W34A 2IA2A 2PECA 3WY9A 4WZTA 2IW5A 2X3UA 1U2RA 3V8KA 3AL0C 4CH7A 1WJEA 1REPC 1XDSA 1OCPA 2ZXWH 1A35A 1A04A 2PIAA 4X6AJ 1WJ5A 3F6VA 1KU7A 1VQ8B 3WNDA 1R58A 1Z3XA 2X0LA 4Y3OA 1E79A 2VJ4A 2GJPA 4V02C 5AMVA 1WH7A 2FX0A 5IPAA 1HF0A 4IHWA 5BPIA 4HSRA 3U6KA 3GW2A 4HPQA 4NBSA 3OMYA 2E19A 4HF0A 2DETA 3CJNA 1H88C 2DFIA 3FXRA 3L2VA 4NHJA 4Z4SA 2GQQA 4M73A 3J80K 4LBYA 1VQKI 1MDMB 4IRIA 1QJVA 1XCBA 2XOKA 2E35A 2IS6A 5F0HA 5JLWA 4HV6A 3ZP5A 1F4KA 2P6TA 3H1CA 3OZVA 1JGGA 4I7HA 3RKYA 2BPOA 3LA3A 4I99C 2HMAA 2P5LC 1CF7A 1MW7A 2V1DA 3A0HC 2R5YB 2V5IA 1YQAA 3OYNA 1UD6A 1VJSA 3KYCB 2GA1A 2OZUA 3OYKA 5E20A 4M1KA 5J1RA 4YFOA 1GAWA 2PI0A 3A35A 4DNTB 2GAUA 3LWFA 3QSYA 3VMWA 3K1NA 3L2CA 2KL4A 2G7HA 2HLDA 2NOGA 2GK6A 1Y39A 3TO7A 3MKYB 1VQMB 4YEJA 2OTJI 3B6AA 5FO0A 5LMZA 1ZK8A 3PSSA 2AQFA 2GIZA 2WB1N 4Y17A 2MABA 4ENMA 2BZTA 1V5FA 5L3EA 4D7NA 2I5UA 2HYJA 3K4BA 5DCMA 5GADJ 1LFUP 3MHPA 3GZ5A 4ZDOA 3WNBA 4PFOA 2ISYA 5ICEA 1AU7A 2G0EA 4HZFA 3L9FA 1G7SA 3BR1A 2V9PA 3QWLA 4XRFA 4RLZA 2BY0A 3WG9A 5K5QA 4PC3A 2QUFA 4PGHA 4ACBA 3L1PA 3HL2A 1E1QA 4RD1A 4IOCF 1N77A 3B82A 4Z06A 2OZ6A 2ZJRF 1O88A 2MLKA 3F0CA 3JQPA 3PUNA 1OFDA 1QUEA 2ZFUA 1FBUA 3MCZA 5HNHA 2XT2A 4XICA 2B0RA 2EIMH 1T2KA 1O8JA 1FTZA 4O3MA 3A02A 3VOEA 3LNNA 1QVUA 1DPUA 4CCMA 5J35A 1IF1A 4A3IJ 3A3BA 4FTHA 1YG2A 1J9ZA 2CSOA 4WZLA 2XPWA 2Y31A 1SAUA 2DT7B 2YU3A 3F23A 2G0YA 4BDYA 5DS9A 5D6EA 2ZBVA 2OCCH 4A3GJ 1OYWA 2QBYA 1ULYA 1AOYA 4E4HA 4D5CA 1R4MB 2O0YA 1MBGA 3WG7H 2DCUA 4DQLA 3GQAA 2LR8A 2E60A 1LVKA 2CUFA 2E1OA 4OOSA 2UV1A 2FQ3A 3IP4B 3G1OA 5B5EC 2WZNA 1UHSA 3KIOA 5LBQA 2FVGA 3FXUA 3CMYA 2VJ5A 3PA2A 2PMDA 4MR0A 4P9SA 4TKOB 2XB5A 2UXNA 2LYCA 1HKTA 2KIFA 2VJIA 2XF7A 1F1ZA 4RGSA 4WF2A 2DA4A 1U8RA 4ZV4A 2HVRA 4ZYDA 3UKGA 3WXMA 2P7VB 4BY7J 3HGGA 3HSEA 1B72A 2M7BA 2L9NA 3MKWB 1RU4A 3U1KA 5IP6A 2NVXJ 5A2QZ 4L0ZB 3R6KA 5LHIA 2GLOA 1IC8A 1IDKA 4OZZA 3TQNA 4YC5A 4XSXF 2CRGA 3K10A 1GXQA 2ZB9A 5E17F 5DNSA 1G8XA 1V3FA 3KZIC 3SDBA 2LDUA 3FHNA 2K7LA 2XB0X 3FXQA 2M5SA 4ZYGA 4Y9UA 2VBZA 3ZQQA 1G59A 2VBXA 3G1LA 1FRNA 3ESWB 1B6AA 4JX6A 2QWWA 5IOZA 1TYXA 5HLTA 1G6NA 3HRMA 3U21A 2XVCA 5A88A 3Q0WA 1MGTA 1TYUA 2OYNA 2OBRA 1JT0A 2LFBA 3HTSB 4PAAA 3J80Z 2X85A 3EUKL 4W8QA 2WA0A 3ES9A 4KT5C 5DV5A 1OFCX 5KAFC 2O5RA 1R5GA 4IXAA 3TEDA 2WJYA 1WPCA 5ILUA 3LYCA 2BXZA 2XKOA 4OMZA 1X3ZB 3CCEI 5ED4A 2A68F 2ZZFA 2BE5F 3KEQA 1E43A 2FNPA 2LD5A 3G6EI 1ETOA 3LAPA 3SJPA 1YJ9I 1O8IA 2IGMA 4XKVA 4EV0A 2VQHA 2DYIA 2BYVE 5HLIA 3RQIA 4MTEA 4EH1A 1KRHA 4C2MJ 1FBSA 3J81K 3JU4A 1ZGAA 4Z03A 3WU2C 3G05A 5FLMJ 1TYVA 4IHSA 1ZM2A 3BTIA 5E1WA 4E6KG 2RN7A 3SFIA 1LEBA 3BCFA 4RB1A 2WC2A 4FK8A 4DQ2A 2HZDA 3FKJA 1K5CA 2ESNA 3H36A 1V55H 3V76A 4XOTA 1MJ9A 3R60A 4L9VA 4G6IA 1SC7A 3F72A 2B7CA 2A6EF 4HYEA 2FRHA 3E20A 1X1CA 4A0YA 4RGRA 2X3HA 4XLFA 2ZJQF 2ZNZA 3K4CA 3K4LA 4WXDA 4Z2YA 2Y9YA 1RKWA 2M3AA 2RVCA 3Q38A 3G71B 4M3DA 3JSPA 4XN0A 4RDLA 2K85A 2E5ZA 5E18F 1K4SA 4DQKA 2VFMA 1QCXA 3CMAB 1NDHA 3VWBA 1H8AC 5EMNA 4DIQA 3A03A 4TV7A 4AF6A 1GO2A 1MMDA 1YYVA 2BHZA 4K2EA 3GTPJ 3B78A 3OYGA 1X2MA 2DA3A 1Z0XA 4G7HF 1JKPC 4HEA2 1W9XA 3F8NA 5TY0A 4UZEA 1YJNB 3ECOA 5E1XA 2ZTNA 4BKXA 2ZZQA 1LE8A 2LY9A 3E6MA 3BG3A 2NVQJ 4LBZA 5LFAA 3IKTA 2MYSA 2EJRA 2VT3A 4ZYAA 3KFWX 1MNEA 3FXJA 4I09A 1OMIA 3BH7B 3W2IA 3BZCA 3W6JB 2BGJA 1R49A 3PSFA 4RB0A 2DY1A 3G3ZA 3E5QA 1W4MA 4RM3A 4LK0F 4PUSA 1HVXA 2WZPP 2IS1A 4MXNA 1Y1VJ 3H3VK 2OJED 5LLQA 2JSPA 3ZQHA 1WU8A 3GQBA 3RPUA 4BDZA 5FIUA 3QP5A 3T56B 2F3LA 2OBPA 4XBFA 5IOYA 1ACIA 5C44J 2HCJB 5DS0A 4UV8A 2UXXA 3BR3A 1E62A 1TTYA 1IRZA 3IH3A 2JWTA 4NK8A 4AIJA 4YZ0A 1I50J 1Y1WJ 1QFJA 1NB0A 2PFBA 2VE8A 2DAOA 4KKSA 3E7LA 3SFZA 5IYCJ 4FT8A 2Z5UA 1X4OA 1PJ5A 2R7FA 2OC6A 1K8FA 1ETYA 2DODA 2ZKZA 3GVAA 3SZPA 2Z16A 3J7AO 4DK0A 2IOUG 3BP8A 1UG2A 3HTUA 2KDZA 3AGPA 2K5CA 2JPBA 4IL6C 2XROA 4Y4RA 5FRMA 2IQ7A 2V9VA 3H35A 4I0BA 2C5BA 2QTZA 2NS0A 1YX2A 2BM4A 1WH5A 2R7QA 4BE2A 2X8KA 1FNCA 2EFWA 2OTLB 5L3BA 3NB2A 1RUOA 4XRSA 3JURA 2BGIA 1UZCA 3CC4I 2Y2ZA 3FMRA 1XQBA 2XAGA 4CA0A 3OYDA 4X0CA 1KD1D 4Z4UA 2HVQA 2MH9A 4HX8A 3RIRA 1J09A 1BOAA 1YX5A 3A01A 1L3LA 2IPQX 2QN6A 2XUBA 1NB9A 1MBEA 2L0KA 2Z9OA 3M4OJ 4XKCA 2OPTA 1TLHB 5FJ8J 2HXOA 3HKZN 4HNTA 1MMNA 1JUPA 1LE8B 1GLNA 3HOXJ 1I3QJ 1W7PB 1NJID 3K4JA 2IAIA 2O8XA 3LQEA 4A5NA 1B9MA 1X1DA 2WAQA 2ZMEB 5CPRB 1ZR2A 2EFGA 1XG2A 2O0VA 2VBYA 2JT1A 1OJLA 2Z2SB 3J81Z 2Y9ZA 3CCUI 3LQ6A 2PJRA 3UR3C 1RWRA 3GYHX 3B73A 2E1MB 2WADA 3P4GA 3CCMI 3MZYA 5IYBJ 2R0QC 1DU0A 2V7FA 1VQ6I 2P4WA 4EW9A 3DPLC 4G12A 3JRBA 3L2QA 1TWFJ 1EWYA 4J01A 1FX0A 4BQNA 1FP2A 2MD0A 5F27A 3WTWC 3P27A 3I9V2 1POGA 4MYTA 2FOWA 4WZKA 2UUZA 1HZEA 1VFCA 2M0CA 4U9UA 3I53A 2XDVA 3PFYA 2QQAA 4XR6A 4NC8A 2DXIA 4NK6A 1FZPB 5HZBA 3BJOA 3DEUA 2NNYA 3I5UA 3BZKA 3W2AA 1DBOA 3KRGA 2QEXI 1MBKA 1YW9A 1FC3A 2MBFA 1JHFA 4RLQA 4BBSJ 4OPWA 3IRRA 1MNMC 2ESHA 2M34A 3A0BC 1MIJA 1USTA 3MEXA 3QYBA 1QX4A 3OJWA 3I71A 4F93B 1TUIA 1SVLA 2IGOA 1G7RA 2HQ5A 3D1NI 2HDNB 2Y30A 4P6VF 2K40A 1JJ8C 3GF2A 5D5VB 2LZJA 1XD7A 3WU1B 4MGRA 2BW3A 1VI0A 1D8JA 4UV9A 1H0MA 3TO6A 5KHDA 4D7MA 3EDPA 2XT4A 3I4PA 4XLCA 5EG0A 5E3OA 2H6CA 2O1DA 1K73D 3B8YA 1WXRA 1FSEA 2W6JA 1QFYA 5IYNA 2LVSA 4G9YA 3HPGA 4UVCA 3ROUA 2MW8A 2XGEA 5C4JJ 4XLHA 4UUSB 3A01B 3CF5F 3FXOA 1VQNB 2IA1A 4FX0A 1KK3A 3BH4A 1ZH5A 5J4YA 4KIBA 4KIGA 4RB3C 1GT0C 1SKQA 2ADUA 1T0FC 4A5MA 3W2EA 3WODF 5H5JA 2JA2A 3QFTA 5EJCA 4B09A 1YFHA 3TMOA 5F1JA 3S1MJ 1QZZA 5F1RA 1TQPA 2R5ZA 1OLTA 1GR1A 2Q6IA 4B47A 2BSPA 1WZ2A 2NVYJ 2EZHA 4N0BA 5DN6A 1W1WE 4PMHA 2KZVA 2R7VA 1SEUA 1IUYA 3JR9A 1P2FA 1D5VA 5DUIA 4NUBA 4UY8I 5EEAA 1H89C 5JHFA 1AHDP 2ISZA 3E1YE 4U7BA 3ZQLA 2LKPA 3AKZA 2BGCA 4W97A 4C30A 2M5WA 2M0MA 4P55A 3G4SI 2GWRA 3TH0A 3KETA 2A07F 4MEYF 3OYHA 1OR7A 1N08A 4LGWA 3HAGA 4ZTFA 2M7AA 2LKXA 1OOCA 4C3JJ 1R5ID 1KK2A 2HFHA 2Q6LA 2HKXA 2BM5A 4C2TA 4Y7NJ 1Y0UA 5M5YJ 2M8EA 2PYHA 3U6BA 1PE9A 2FNAA 3TP3A 5D4RA 2NV4A 2QTLA 1BC8C 4X8IA 2NAZA 3CC7B 4LFUA 4S0HB 2EINH 2RGVA 2AO9A 2PG4A 1QBJA 3CPXA 5L46A 2WB1A 2R7UA 1ZHFA 1ELOA 1WTHD 4KKUA 3CLQA 4L0YB 3FISA 3QAHA 3QU3A 3M8EA 4EATA 3CDHA 3GTQJ 2A5YB 5A8AA 2ECBA 3WBKA 4PZJA 5J6XA 3TOAA 1JI8A 4ESJA 4GRIA 2BOLA 2VC1A 3HHHA 3ZSCA 3HRUA 3B90A 3VSKA 4CHUA 2PEXA 2D3LA 2X1CA 3HSRA 4AUXA 1U9OA 3RKQA 3ABTA 2QE7A 3GTMJ 1S7AA 4IVNA 3LFUA 2Y0SN 4R79A 1Z91A 3BTJA 3OOPA 3H9GA 4V19K 1PXZA 4XRSG 1UMQA 4XM3A 5H2FC 2OCEA 2PMUA 1XG1A 4CUGA 1RUNA 4Z4YA 1MH4A 3N05A 2IVMA 3FXLA 2MA3A 2XPUA 4Y33A 4UXNA 3ZMUA 2HQRA 3JAMK 4UAJA 3GFJA 4ENKA 3FPPA 1BR2A 2BVMA 3T8RA 1P4MA 3EYYA 2LTPA 5DUKA 3KP3A 2ZJPF 1FJLA 2ZBUA 2V9KA 4IRHA 1XSVA 4R8HA 2VBSA 3VNUA 3VNVA 3CCRI 1R00A 4OWRB 1QZEA 4ZTJA 1FMWA 1BX0A 4M6YA 3OIOA 2H27A 3BY2A 2NYXA 2LG4A 3FPKA 1WOSA 3DWLE 4D5FA 2HOAA 3WNCA 1S7EA 2QF7A 1XMAA 5M3MJ 3ASOH 3CCVI 1J5YA 3LAJA 5D6FA 1WWXA 5BSYA 2F1LA 1Q1HA 3IAM2 4JQFA 4KISA 4WWVA 3FWEA 1IRXA 2XRNA 4QPOA 4RS8A 4YAWA 2BN4A 5BMZA 3L00A 4FN5A 2H1KA 1I8DA 1L1IA 5CVVA 3PETA 2VKHA 2HQNA 5AIQA 1I7PA 1JTYA 4PC7A 1JNYA 1DPRA 4OP7A 2L9RA 4OIPF 3CCLI 1Q81D 4ZC3A 3LMMA 2VBKA 4NB5A 2GOMA 4HQMA 4XRMA 1RR8C 2TCTA 1GV5A 2ZMEC 2HEOA 1EFUA 3WTSC 1QGAA 3HOWJ 1Q7YD 1VQ7B 5HZAA 2E1MC 1W5SA 3CMEI 1DGRM 1JT6A 2YX4A 2JIZA 1V54H 2BBYA 1UAAA 1KU3A 1PJ6A 2F2EA 1MNDA 4MQVA 4B3FX 4BQQA 3T51B 1TQIA 1F9NA 3NEUA 4J19A 2V7UA 2CNDA 4BGDA 2JN9A 3GLLA 5K7ZA 2P8TA 3AG1H 4EJOA 2E2IJ 1LNWA 1O8EA 1LFBA 3DTKA 3KYDB 3S1NJ 1IRFA 3WTTC 1FPQA 2I1LA 3LA7A 1YITB 1VQPB 4HOBA 1LLWA 4EVIA 2ZO4A 1GQ8A 2O7OA 3W6VA 4P2NA 4BQOA 1G3TA 4S05A 4M9ZA 4QTRA 4DNRB 3B02A 3K1MA 2VKEA 2HKOA 1E17A 2R7TA 1XB2A 2F4MB 2OTLI 1V5EA 1SD4A 3SDGA 1X58A 2UVEA 1SD6A 3DU5A 3VPRA 5EEHA 5KCMA 1FOYA 2DU9A 4PC6A 2XSJC 3HOZJ 1XSDA 3OAAA 5CQGA 1TTTA 5EGOA 1X2NA 1FNDA 1R5NA 2JJ7A 2P81A 2E71A 4A12A 1AIPA 3CZ6A 2R7DA 5FD5A 4QIWN 1IZ1A 3EUHA 4YFNF 5ICGA 2UVFA 1MD0A 1UD8A 1BIBA 1QRYA 4HRIA 4XQFA
chains in the Genus database with same CATH topology
2VJ5A 2F5VA 3MMYB 4NNJA 3W3CA 4ZDLA 3OS0A 3RTRA 2LYCA 1SKYB 4TKOB 2VJIA 3BG6A 2XF7A 1WMRA 2HVRA 3ZIAA 2LREA 3BCDA 1NRKA 2M7BA 2L9NA 2I8DA 3MKWB 3VR6A 3H9QA 2XZLA 2M4KA 2XGJA 3WQZA 1RU4A 2BW3B 4XONA 3OYLA 3LSMA 1X19A 4HSTA 1IDKA 3DTIA 3S93A 4OZZA 3K10A 2VQCA 1U0JA 3SEQA 3VSUA 2W00A 1G8XA 4FASD 3SDBA 1T95A 3FHNA 1QHHD 2XF5A 4PJMA 1Z7LA 1BOBA 4BJTA 3OS1A 2M5SA 3ZQQA 1DQUA 3KX2A 3LSHA 1G59A 4C2LA 3UNGC 1O8HA 2O17A 4QPQA 4DOZA 5HLTA 1NHCA 2A6TA 2HNHA 3U21A 2WY7Q 3QYEA 2LBFB 3OW7A 2ZZEA 2KDOA 2OV7A 4MLOA 2NTBA 2A5WA 2X85A 3EUKL 1D0XA 2WA0A 4W8QA 2O5RA 2MC4A 2WJYA 1WPCA 4OJ6A 3BCBA 4XL9A 2X1EA 4W8TA 4OAZA 3VYSB 3OEEA 2ZZFA 3OYFA 2VB6A 4L8JA 1E43A 3UW0A 3S3OA 3ZPPA 3T53B 1N75A 4HNUA 1WJBA 1OB0A 1O8KA 2ZXHA 3W2WA 2VXDA 2INUA 3OYIA 4BE1A 1O8IA 2IGMA 3K70D 4XKVA 2R7WA 2VQHA 3LSGA 2V31A 2L7KA 3RCOA 2F43A 3JU4A 4Z03A 4HG2A 4XN3A 3G05A 4X0GA 2V4JC 3RPUD 4E6KG 1KONA 3BCFA 1OFMA 3M8JA 2HZDA 3FKJA 1K5CA 4II3A 4JMQA 4XOTA 4PJLA 4G6IA 4BL0B 3RSNA 4FETA 1X1CA 4F3QA 3D5RC 3QODA 2X3HA 4XLFA 2R7XA 1UD2A 1O8MA 2X1DA 3RQ4A 2LH9A 3K4CA 3K4LA 3ZR8X 1WJDA 4F92B 2V6EA 2M3AA 1DP3A 1S9HA 4XN0A 3BC9A 2E5ZA 2X6WA 4LIUA 3M1CA 2VBMA 1QCXA 3SYTA 3VWBA 4W8SA 4GQNA 3KYLA 2K9LA 2W1OA 4DIQA 2CFOA 2KRHA 2GJRA 1MMDA 2CS3A 2OUMA 4AYBA 1VLYA 1E3ZA 3FDYA 3OYGA 2XZOA 1QU3A 4FXUA 2HDWA 3BLYA 2ZZGA 5FROA 3K4NA 3E0JB 4RLFA 2XC7A 4HEA2 3HKZA 1W9XA 4TSFA 3CESA 2KQRA 3C2GA 2Z8GA 4B44A 4KJZA 2ZTNA 2ZZQA 3FY3A 3EPZA 1I18A 3KEWA 5C1CA 2X6YA 4BACA 3FKSA 5LFAA 1VZ0A 4OAYA 2MYSA 1KCDA 4ZYAA 2HU9A 4II2A 2XF6A 2W7NA 1MNEA 2ZSHB 4OJPA 4YZQA 1E1RA 1ERDA 4YXWA 1W0JA 3VDXA 3PSFA 1BLIA 2INVA 2JUGA 2CV1A 4RM3A 3PL8A 1BN8A 4PUSA 1HA8A 5CKTA 1HVXA 3W2VA 2CV2A 1MMGA 2IS1A 2WZPP 3ZPNA 4MXNA 3GQBA 2JSPA 5HKKA 3LMWA 2QX3A 1X1AA 4BDZA 4XKBA 3A1YA 2IS2A 3T56B 2NZMA 2O0WA 2NOJB 3BCAA 3HG9A 5HVQC 1WJFA 4XKWA 1T5EA 3T9GA 1MMAA 4E0FA 3AL0B 3OIQA 4CCLA 4DGWB 2QXZA 2VQLA 2F6CA 3E1SA 3OL3A 4UZUA 4NK8A 3HXLA 4YZ0A 3DEEA 3VMVA 3EQOA 4KKSA 3NE5B 5HOOA 1X4OA 1YX3A 4OZYA 1X0CA 2OC6A 3V42A 1D0YA 4BUPA 4MR0A 3CJRB 3KEYA 3VYRB 2Z16A 4DK0A 3HOTA 1WJCA 1OFLA 1W36D 4CZCA 2K5CA 3VYTB 4U87A 4IKFA 5FRMA 4Y4RA 4BE0A 4NC7A 1KMHA 2JJ2A 1PLUA 2IQ7A 3H35A 2L9SA 3DLAA 4LG3A 4XORA 2ODLA 4BJ6C 4E7SA 1ZELA 2XNDA 4RM2A 4J00A 2KLOA 2JDIA 1E3XA 4P5OA 2R7QA 2X6XA 4BE2A 2X8KA 3J7AY 4G7WA 1BPLA 3OOCA 3JURA 1PJRA 4ASUA 3L2UA 4CA0A 3OYDA 4N4OB 1WFXA 2HVQA 1JRGA 1Z3YA 2X53S 3PUBA 4Z1MA 1J09A 1X1BA 2NSPA 1YX5A 1H80A 2DIEA 4BXFA 2KP6A 3OYAA 4CCNA 1D1BA 4XKCA 3BG7A 1PKVA 2HVSA 1UD4A 2VASA 3DU6A 1UG0A 4G6TB 4HNTA 3MKZA 3TL4X 1MMNA 1TZLA 2IXSA 2NT9A 1BR4A 4H4KC 1GLNA 4KT6A 3ZGKA 3OYBA 3SUCA 3K4JA 1X1DA 2WAQA 5CPRB 2O0VA 3OPOA 1XG2A 3HUGB 2L5QA 2Z2SB 4LIVA 1DBGA 1UD5A 3VSVA 2PJRA 4PSWA 3UR3C 1RWRA 2HQAA 2E1MB 4AU7A 2R7SA 3GBGA 1IDJA 2K9MA 5KNLA 2WADA 1P9QC 1V0EA 2V7FA 2IGKA 2VJJA 4ZDPA 2GJKA 2R7OA 4XLEA 4EW9A 3DPLC 2K3PA 3DKXA 3L2QA 1E0EA 1FX0A 4J01A 4BQNA 2LRDA 2MD0A 4F91B 3FBNB 3I9V2 2DOAA 1OHHA 3S32A 4JOMA 3DDYA 2RREA 2UUZA 5CDFA 1HZEA 4LITA 1BMFA 2XDVA 2VQGA 3PFYA 2Z1DA 4XR6A 4NC8A 2DXIA 4NK6A 4B3XA 4U49A 1W0KA 4XNFA 2CW8A 3W2AA 1DBOA 3KRGA 3ZXSA 5LD2C 3VYUB 5C1EA 3K70C 2JVGA 3HC7A 3H5RA 4RMNA 4PJNA 4RLQA 2EWEA 3WWGA 4CSWA 1EE6A 3QYBA 4ZJZA 3AFHA 1UD3A 3HOSA 1H8EA 1LDKB 4F93B 2IGOA 2E5NA 4ANJA 1NG7A 2LZJA 1OGOX 2BW3A 3OOUA 2VBEA 3LL7A 3PJRA 2RQQA 2V7QA 2ZTGA 3GVLA 3CP8A 1D1AA 5KHDA 1OGMX 3I3LA 3OYEA 4D1QA 2VPLA 3K4MA 1LFPA 4XLCA 3VSTA 1OR7C 3OR1C 2W82A 2O1DA 4C9YA 3B8YA 2AQEA 3OWTA 3OEHA 4XD7A 3TBIA 2W4SA 3PNTA 1MABA 2W6JA 4P1WA 2Y0SA 3HPGA 2VKDA 2JJ1A 3GQ7A 4XLHA 2X51A 3DQVC 3BH4A 4TT3A 1O8DA 2WAFA 1T0FC 1V5GA 4XOPA 2NTQA 2LBFA 2JA2A 3DTEA 4G7XA 4IX7A 3TMOA 4BEHA 3GRHA 1OLTA 4NQWB 2BSPA 4B47A 3OYCA 2QKLB 1H8HA 1AIRA 4Z05A 1DGWY 5DN6A 4IQ4A 4PMHA 3DKYA 2KZVA 2KMUA 2R7VA 3GQ9A 2F4IA 1N78A 2V1NA 4N4NB 4NUBA 1O8GA 5JHFA 2BVLA 3DPUA 2VL8A 4U7BA 2FUG2 3AKZA 4C30A 1O8LA 1Y56A 2M0MA 1Z21A 3L2WA 2Z6BD 5FRNA 3CF2A 3QYFA 4E7JA 3OYHA 4YZAA 2CMPA 4KITB 3OR2C 2XAUA 4YELA 3BC8A 4U4BA 3HAGA 1IA5A 4ZTFA 4E7ZA 2M7AA 4E7KA 1OOCA 3B4NA 3PSIA 4IZZA 1NG6A 3SEZA 2QKMB 4C2TA 2KPMA 4DK1A 3A4CA 4OJLA 4PFPA 2PYHA 1PE9A 2CUZA 2VIXA 3HPHA 2NSTA 4W8RA 1LKXA 4BS9A 2UWMA 2RNGA 1R6RA 5TGTA 3GVJA 2M4GA 2JVHA 4PJJA 5FL7A 1FMVA 2KRCA 2DT6A 4DJAA 4F55A 4CCKA 3MD2A 2XZPA 2WB1A 2R7UA 1COWA 1SFKA 2R9VA 2W6IA 2CV0A 3QOEA 1WTHD 4KKUA 4OJOA 1VF7A 2LY1A 2IGNA 4EATA 4OJ5A 2WSSA 4BU2A 3GQ8A 3S3NA 3EQNA 1JI8A 4GRIA 2BOLA 3ZSCA 3OS2A 1D0ZA 3B90A 3VSKA 3IAS2 4B43A 2NT6A 2V4DA 1W36C 2D3LA 3CP2A 1WJAA 2X1CA 2CH0A 3D5SC 4CCJA 3LSIA 1CZFA 2QE7A 4XMYA 1IB4A 2DCEA 2DJIA 3LFUA 2Q2EB 3OYMA 2ELJA 2HPIA 3PNYA 4B3GA 4R79A 2PECA 3H9GA 2VLAA 1KZLA 5IK2A 1PXZA 4XM3A 1UELB 3AL0C 2WJVA 4CUGA 1TT0A 4CH7A 1WJEA 4I84A 1WP6A 3G2BA 3N05A 3PNVA 2F1MA 2KHMA 1WJ5A 3C2HA 4DBRA 3OIPA 4Y33A 3VSLA 3F9KA 4BEHB 4D9JA 4YZXA 3FPPA 1BR2A 1Z3XA 4Y3OA 3ZCOA 2VJ4A 2HPMA 2BVMA 2P0WA 1E79A 2GJPA 5AMVA 1JTAA 2V9KA 4HSRA 4ITVA 4HPQA 3OMYA 4OWRB 4ZTJA 1FMWA 3L2VA 4E7LA 3CJQB 2LG4A 3LSKA 1QJVA 3DWLE 1AA7A 2XOKA 3OL4A 2IS6A 4KKTA 2Q1ZB 2O04A 3ONQA 3EUAA 2GK7A 2R4GA 3L2RA 1MW7A 4HWVA 4KISA 3IAM2 1D1CA 4JQFA 2LOOA 1PYVA 1IRXA 3OYNA 4QPOA 3SZGA 1UD6A 3S8PA 1VJSA 2ZXIA 3OE7A 2MFZA 1RMGA 3OYKA 1I8DA 3OY9A 3A35A 4CCOA 4DNTB 3VMWA 2WBMA 2KL4A 2VKHA 4URRA 2HLDA 2GK6A 3MKYB 4F52A 2LC2A 4YEJA 4YRVA 2LY2A 4E7HA 2CW7A 1EFRA 1BHEA 4P22A 3DPTA 4ZC3A 3LMMA 2AQFA 2VBKA 1BR1A 2MABA 1V5FA 2GOMA 2PMZA 3K4BA 3NWSA 2V26A 4ZDOA 4PFOA 1KCCA 2PYGA 2E1MC 1DGRM 2JIZA 1Y6IA 1UAAA 2QY1A 3HL2A 1E1QA 1MNDA 3H94A 3OFNA 4BQQA 2L2OA 4PK4A 1N77A 3T51B 4B3FX 4Z06A 1O88A 3EUHC 4BJ5C 4B48A 4BGDA 2IS4A 2ZFUA 2NTPA 1QHGA 5HNHA 2WY8Q 1K6YA 3CMMA 1O8EA 1HG8A 1K28D 3DTKA 1O8JA 4C2UA 2E1BA 1VBLA 3H0DA 3K6GA 4E7IA 3LNNA 5HNFA 2VXZA 1GQ8A 2CK3A 2PJRB 1V0FA 4CCMA 3FBIB 4BQOA 3OYJA 1X4PA 1NBMA 3H5NA 1KTWA 3H5AA 1O8FA 2R7RA 1EA3A 4XLAA 4DNRB 3NWTA 1YE9A 2D3NA 3A3BA 3A2KA 2R7TA 3D5LA 1SAUA 1V5EA 2DT7B 5CQEA 4IQJA 4BDYA 2WPDA 2UVEA 3DU5A 2ZSIB 5KCMA 4E4HA 3S3MA 2XSJC 4PSXA 3OAAA 5CQGA 2CUJA 3GQAA 2KVOA 3IUOA 2E60A 4HIZA 1LVKA 3CZ6A 2UV1A 2GOXB 3IP4B 4DBQA 3H9JA 4AVZA 3A3GA 2WAEA 3ZRGA 2UVFA 1UD8A 3GVKA 3K4KA 4HRIA 4XQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEC A;  4XR6 A;  4MR0 A;  1PXZ A;  4NK6 A;  2Z8G A;  2VJI A;  4XM3 A;  4XNF A;  1WMR A;  4U49 A;  3FY3 A;  1DBO A;  3KRG A;  4I84 A;  2X6Y A;  5C1C A;  1KCD A;  2EWE A;  3WWG A;  1EE6 A;  4OJP A;  4YZX A;  1RU4 A;  4YZQ A;  5AMV A;  4XON A;  1JTA A;  2INV A;  4OZZ A;  1IDK A;  1BN8 A;  1OGO X;  2VBE A;  3VSU A;  4MXN A;  1OGM X;  3LMW A;  2QX3 A;  1QJV A;  4XLC A;  3VST A;  2O1D A;  4C2L A;  2O04 A;  2NZM A;  3B8Y A;  2O0W A;  1O8H A;  2O17 A;  3GQ7 A;  4XKW A;  4HWV A;  3T9G A;  4XLH A;  1NHC A;  2QXZ A;  4NK8 A;  4YZ0 A;  1O8D A;  1RMG A;  3VMV A;  3EQO A;  2NTB A;  3VMW A;  2X85 A;  4XOP A;  4URR A;  4W8Q A;  2NTQ A;  4OZY A;  1X0C A;  4YEJ A;  3GRH A;  1BHE A;  4OJ6 A;  1OFL A;  4XL9 A;  1AIR A;  2BSP A;  4W8T A;  4Z05 A;  2VBK A;  4PMH A;  3GQ9 A;  2IQ7 A;  1PLU A;  4XOR A;  2ODL A;  1O8G A;  3UW0 A;  3ZPP A;  1KCC A;  2X6X A;  1O8K A;  1O8L A;  2PYG A;  2INU A;  3JUR A;  1O8I A;  4XKV A;  4YZA A;  2QY1 A;  4YEL A;  1JRG A;  4U4B A;  4Z06 A;  1IA5 A;  1O88 A;  2NSP A;  1H80 A;  1OOC A;  3B4N A;  4Z03 A;  4XN3 A;  2NTP A;  4OJL A;  1O8E A;  1HG8 A;  2PYH A;  1PE9 A;  1OFM A;  2NST A;  1O8J A;  4W8R A;  1K5C A;  2NT9 A;  1VBL A;  4XOT A;  1GQ8 A;  3SUC A;  1O8F A;  1KTW A;  2O0V A;  5C1E A;  4XLA A;  1XG2 A;  2X3H A;  4XLF A;  1O8M A;  4OJO A;  1DBG A;  3VSV A;  1RWR A;  4OJ5 A;  4XN0 A;  1IDJ A;  2X6W A;  2UVE A;  3GQ8 A;  2VBM A;  3EQN A;  1QCX A;  2VJJ A;  4XLE A;  4W8S A;  4EW9 A;  3ZSC A;  3GQA A;  3B90 A;  2NT6 A;  1CZF A;  4XMY A;  4AVZ A;  1IB4 A;  2UVF A;  4XQF A; 
#chains in the Genus database with same CATH topology
 1YJW B;  1I3A A;  2Y0M A;  4NNJ A;  4ZDL A;  4A3C J;  3LFK A;  4LD5 A;  2VNH A;  4BPR A;  1RC9 A;  4P9F A;  2XC1 A;  3OZW A;  2LRE A;  4LBW A;  3BCD A;  1HA3 A;  3DBH B;  3EYI A;  1FX7 A;  3VR6 A;  4I02 A;  3GTL J;  1USS A;  4XON A;  3OYL A;  1XTA A;  2RC4 A;  3RI4 A;  2O3F A;  3EET A;  2AHO A;  1YW8 A;  3T8T A;  4HST A;  3IKV A;  4MYU A;  3DTI A;  3S93 A;  3C18 A;  3A8K A;  2QQ9 A;  4HF1 A;  1BQE A;  1Z1D A;  3SEQ A;  3VSU A;  3OSF A;  1RQP A;  4U0Y A;  2V7T A;  1ZLJ A;  3CDL A;  1QHH D;  2DQL A;  4PJM A;  4BJT A;  3BY1 A;  1K4T A;  2OA4 A;  4C2L A;  3CO7 C;  2IRF G;  3MWM A;  3JAM Z;  3UNG C;  4QPQ A;  4DOZ A;  1T6S A;  3CCJ I;  2F5F A;  2QMU A;  1QZY A;  3QYE A;  5E3N A;  1VHE A;  2LBF B;  1EFC A;  1AKH A;  3GTK J;  1CQT A;  2ZC2 A;  1HKS A;  4DYC A;  4LC0 A;  4AWX B;  1KA8 A;  2A5W A;  1C0W A;  3COA C;  4EJV A;  1D0X A;  1I1S A;  2VFP A;  2CYY A;  5FB2 A;  5E79 C;  1FOX A;  5B66 C;  1IJW C;  3RZD J;  3SJZ A;  4OJ6 A;  4W8T A;  3ECH A;  2A69 F;  3R0A A;  3F8B A;  3WTZ A;  1ON2 A;  3VYS B;  2VFO A;  2OK8 A;  1R5O A;  4G6Q A;  1YIJ B;  3QP6 A;  2DMQ A;  5F4M A;  4L5E A;  1TQM A;  2ZBK A;  5C3E J;  2L3D A;  2DYS H;  5JVG F;  3S1R J;  1QFZ A;  4CYD A;  2V7X A;  5L3G A;  3PEN A;  1JHH A;  4KYW A;  1IRG A;  3C7J A;  3W5U A;  4F7D A;  1O8K A;  2L7Z A;  2X0K A;  2JQ7 A;  4BE1 A;  3K70 D;  1XPX A;  5EGO B;  2L7M P;  1VQN I;  1UJ8 A;  2V31 A;  5D8K B;  1B1B A;  3PIO F;  4LLN A;  2F43 A;  2BY2 A;  2DBB A;  3JX8 A;  1IN7 A;  3CUQ A;  4X0G A;  3MMP A;  2COB A;  3BTC A;  4DZP A;  3G73 A;  1KON A;  2GIV A;  2L02 A;  2DTZ A;  3C3W A;  5GV7 A;  3ASP A;  4N3N A;  1T6Y A;  4II3 A;  2EWN A;  5CVR A;  4PJL A;  2F5C A;  1XDU A;  3LA2 A;  4P3Y A;  2M8G X;  3ZMT A;  3KEO A;  2VNJ A;  2EFN A;  2TRT A;  2L4A A;  5IYR A;  3D5R C;  1VQ4 B;  4OIO F;  2R7X A;  2KKO A;  3RQ4 A;  1D5Y A;  1Y0Y A;  3DCF A;  3PFI A;  1S0U A;  4O5V A;  2PBI A;  1DP3 A;  4EGY A;  3QPT A;  2X6W A;  1IN8 A;  1WGX A;  3ASN H;  3HZJ A;  4LIU A;  1FY7 A;  5HOD A;  2FEZ A;  2O61 A;  1O3R A;  4GQN A;  3W2H A;  1ETK A;  5FKM A;  2VC0 A;  1RNL A;  2CS3 A;  3MN2 A;  2YR2 A;  4V2F A;  4AYB A;  5HS8 A;  3E6B A;  3TDZ C;  1FYK A;  2HS5 A;  4XSZ F;  1BM9 A;  4KA4 A;  2I10 A;  3V8J A;  4IHY A;  2P5K A;  3ASQ A;  3ZMS A;  3OV8 A;  1IG7 A;  3OSG A;  3CC7 I;  3HKZ A;  1BL0 A;  2FBH A;  4TSF A;  2KQR A;  3ABM H;  2OAZ A;  4KJZ A;  1K8A D;  3FY3 A;  1I18 A;  4HW0 A;  4DZJ A;  2BM6 A;  3FKS A;  4FWT A;  3LO8 A;  2EPF A;  5C1C A;  4YII A;  1U5T C;  2IEK A;  1KCD A;  2HU9 A;  2XF6 A;  4PJ0 C;  2ZSH B;  3BJA A;  4Y52 J;  2BV3 A;  4YZQ A;  3P9C A;  1EV7 A;  4I98 B;  1ERD A;  4OM9 A;  1PUF A;  1W0J A;  2F4N A;  2O8K A;  2QGU A;  2KIM A;  1B4A A;  3PL8 A;  2CW0 F;  2GM4 A;  1XFO A;  4KH3 A;  1HA8 A;  1P4A A;  4TMW A;  3ZPN A;  1BIA A;  1XGN A;  3NRV A;  5F6F A;  2QX3 A;  1CF7 B;  1I39 A;  3KLN A;  3MKL A;  5GPC A;  3I55 B;  3PUM A;  1HSJ A;  1KQ9 A;  1W0T A;  5M3F J;  2YU9 J;  1GJR A;  2O0W A;  3BCA A;  1PVE A;  2QM3 A;  1I27 A;  2F4O B;  4XKW A;  1TW2 A;  1OQY A;  1ZAO A;  1DU6 A;  3OIQ A;  2QXZ A;  2XRL A;  4UZU A;  3OL3 A;  3I59 A;  1ZAR A;  4EJW A;  4Q4Z F;  3EQO A;  3LVB A;  2LP0 A;  1QO0 D;  1O7F A;  1YX3 A;  1KZH A;  2DTR A;  5KK1 A;  2M45 A;  4BUP A;  4NC6 A;  1Y8R B;  3CJR B;  4OU0 A;  3HOT A;  5DCM B;  1WJC A;  3F21 A;  1W36 D;  1OFL A;  2O9L A;  4CZC A;  4MO7 A;  4U87 A;  4HX7 A;  4BE0 A;  3KP5 A;  1T39 A;  2FBK A;  3FMQ A;  4LG3 A;  4XOR A;  5HS7 A;  1PLU A;  1N06 A;  4E7S A;  4RM2 A;  4J00 A;  4RDU A;  2KLO A;  2JDI A;  5J47 A;  2B9S A;  3BQZ A;  5M5W J;  5THX A;  3V7A A;  2FX3 A;  3KLO A;  3S2W A;  1GVH A;  1YS7 A;  3AVY A;  4M6V A;  1WFX A;  1Z3Y A;  3CD6 B;  3PUB A;  3BR6 A;  4PDK A;  4JX4 A;  1T38 A;  1H80 A;  5FO1 A;  4N3G A;  2Q8K A;  2VE9 A;  2STT A;  3I0T A;  4CCN A;  1D1B A;  3F8M A;  4UVA A;  1S6L A;  2HVS A;  2VOP A;  3DU6 A;  1QA3 A;  4G6T B;  3MKZ A;  1J75 A;  1BR4 A;  2JRM A;  3ZGK A;  1WHU A;  3OYB A;  4RPD A;  1FNB A;  2K27 A;  1X3W B;  4GGG A;  3GZ6 A;  2DK5 A;  1N0V C;  1ZLK A;  3ELK A;  1S4M A;  3OPO A;  1R7J A;  1N25 A;  1JGS A;  2CQX A;  2V6C A;  3SZT A;  2QBY B;  1DBG A;  5GAH J;  1PUF B;  1KK0 A;  1EA0 A;  2F5E A;  4AU7 A;  2R7S A;  2FML A;  3GBG A;  1IV6 A;  2XTY A;  1ZRD A;  3GTG J;  5GTI C;  4HE6 A;  3KE2 A;  1I6X A;  2B0L A;  1N8R D;  2IGK A;  2VJJ A;  4ZDP A;  4CGZ A;  2GXA A;  2GJK A;  2PLY A;  2W7Z A;  1STZ A;  2E1C A;  4BXX J;  2LRD A;  2VBW A;  5TRD A;  3FBN B;  4LLG F;  1EJ9 A;  2RNJ A;  4CXF A;  2DOA A;  1GXP A;  1IJF A;  4EM0 B;  3S32 A;  3DDY A;  2XTW A;  3BRO A;  3QPL A;  3SEJ A;  3JRC A;  1RPW A;  3ONY A;  1ETX A;  3I59 B;  1Y0R A;  3LOC A;  1W0K A;  4XNF A;  4BAY A;  1B72 B;  3M7G A;  4KUM A;  1EH8 A;  4A3F J;  1Z9C A;  1R71 A;  3ZMD A;  1XGM A;  4BHP A;  2DPD A;  1VLO A;  5IT9 K;  2XTX A;  3H5R A;  1GDT A;  4PJN A;  1WQ2 A;  4WWC A;  3D26 A;  2GXG A;  2EWE A;  1WOR A;  1VQ9 B;  1W35 A;  1EE6 A;  3CO6 C;  2NRA C;  3ONU A;  1RKT A;  3HOS A;  1UD3 A;  4KDP A;  1T6X A;  1QPM A;  4ON0 A;  1D3Y A;  4X7F A;  2E5N A;  1YLO A;  2J5P A;  2DDB A;  1E64 A;  2DA1 A;  4Y13 A;  1PP7 U;  3HRT A;  3VFZ A;  1OPC A;  3OOU A;  3PJR A;  5BQT A;  3CP8 A;  2BMW A;  5EDN A;  3OYE A;  1QVF B;  3TOB A;  2LSO A;  1ZYR F;  4Q7J B;  1RR7 A;  1EKE A;  1VHO A;  3H92 A;  1TW3 A;  3OWT A;  2W57 A;  3V4G A;  3TBI A;  3OEH A;  4RCZ A;  4XD7 A;  1DUX C;  4P1W A;  2Y0S A;  4ASN A;  4KMF A;  2QA4 B;  1YHQ B;  3GQ7 A;  4I2O A;  2E1N A;  4RPB A;  3IH2 A;  2OD5 A;  3ULQ B;  2HOS A;  4A69 C;  1VQO B;  2YX7 A;  3J7Y J;  1O8D A;  4MTD A;  1TP4 A;  1WI3 A;  2DMP A;  4A3E J;  1HW2 A;  1HCR A;  3KZY A;  1J0R A;  5LEK A;  1ETW A;  2JA8 J;  4ZYH A;  2RKH A;  4A6E A;  4ZZD A;  3CC2 I;  2D1H A;  2V79 A;  4DYR A;  4BEH A;  2J5O A;  2CW5 A;  4P26 A;  4QHY A;  3GRH A;  2DYR H;  5FKN A;  1CNF A;  1ZN2 A;  1EXM A;  1MSE C;  3GQ9 A;  2QQB A;  5CYV A;  4OPS A;  3CLO A;  2FA5 A;  3I54 A;  2V1N A;  2VN2 A;  4UHT A;  1O8G A;  1HXD A;  2Q0O A;  2VL8 A;  3BT9 A;  2QLZ A;  2AS5 F;  2Q6K A;  3W5H A;  2G7U A;  1Z21 A;  3KP4 A;  4Y9R A;  3CF2 A;  4C43 A;  3FF5 A;  4ZGQ B;  3LNQ A;  3QYF A;  2B63 J;  2CMP A;  3F6O A;  3OR2 C;  3HHG A;  4HE5 A;  2VKV A;  4IHT A;  4RM0 A;  2KT0 A;  1IA5 A;  1NK3 P;  1VQ8 I;  4M3E A;  5GAG J;  3BR5 A;  4IZZ A;  2XEX A;  3ABU A;  3ASS A;  2QKM B;  3OP1 A;  1UFM A;  2KPM A;  4DNC A;  3A4C A;  4DK1 A;  4ZZL A;  4OJL A;  2FE3 A;  3CW2 A;  4IHX A;  2NST A;  4M0L A;  1LKX A;  2OQG A;  1LDJ A;  2RNG A;  4NDL A;  2OF7 A;  5E8I A;  2BY3 A;  2XGX A;  3TW7 A;  1JB9 A;  1ZM3 A;  2DA2 A;  1FMV A;  3HDD A;  2PLF A;  2DT6 A;  2R92 J;  2DT5 A;  3J7Z I;  4CCK A;  2J7K A;  2P5V A;  5B1B H;  2XZP A;  2CQ7 A;  3JRF A;  5DSZ A;  3L09 A;  1OCO H;  5EEG A;  5F08 A;  2FBI A;  5HLG A;  2VFN A;  4JK1 X;  2IGN A;  2C4U A;  1ZRF A;  4OJ5 A;  3ABL H;  1E3O C;  3OJX A;  2EIL H;  2WSS A;  1N07 A;  3GQ8 A;  2MGQ A;  3GUD A;  1HQC A;  1SVM A;  4AYB N;  1XC5 A;  2J8I A;  4QVA A;  3DBR B;  3GME A;  2IBD A;  3RKW A;  4RGX A;  3IAS 2;  2YWH A;  3BQY A;  4HF2 A;  1IXR C;  3V7R A;  5GP9 A;  4RBO A;  2FXA A;  1XCV A;  1VQM I;  2P3M A;  1KU9 A;  3LSI A;  1M1E B;  3WBJ A;  3HSF A;  1IB4 A;  2DCE A;  2EFP A;  2OQR A;  2Y48 A;  2DJI A;  4RJL A;  4YG2 F;  2EIK H;  3IL2 A;  3IWF A;  4Q47 A;  3JRG A;  1KZL A;  1UMK A;  1HF2 A;  3O2P E;  1UEL B;  3F8C A;  2WJV A;  1TT0 A;  2WR8 A;  1IXC A;  4OIR F;  4GDF A;  3OKX A;  2C6Y A;  4I84 A;  2ZL5 A;  1WP6 A;  3PNV A;  4X1E A;  3WGH A;  2F1M A;  3ZUG A;  3C2H A;  4DBR A;  3OIP A;  3VSL A;  4BEH B;  4XK4 A;  3D0S A;  4YHB A;  4WCG A;  1N05 A;  4U0V A;  2M87 A;  1S7O A;  1JTA A;  4TMV A;  2GZW A;  1UHM A;  3S2H J;  3W5V A;  5FNZ A;  4WXH A;  5HLH A;  4A0X A;  4NCN A;  4E7L A;  3CJQ B;  1A36 A;  2ID3 A;  3WGG A;  1A5J A;  3ZOB A;  1J9I A;  4MQ9 F;  3LSK A;  5IT9 Z;  1KYW A;  3JQR A;  1QA2 A;  4HQE A;  2O04 A;  4M72 A;  3ONQ A;  4HBL A;  3CRZ A;  1FRQ A;  3EUA A;  4CIC A;  2R4G A;  5J4V A;  3MFK A;  2GK7 A;  3SQN A;  4EMS A;  2C2W A;  1S72 B;  2E34 A;  1D1C A;  1LJ9 A;  2LOO A;  1PYV A;  1N0U A;  3SZG A;  2JPC A;  5EZH A;  3S8P A;  2R7Z J;  3OE7 A;  3N90 A;  2MFZ A;  2H8R A;  1RMG A;  3FK6 A;  1WVR A;  2JN6 A;  2EFO A;  4CCO A;  3AGQ A;  3REO A;  1K9M D;  4R71 A;  2WBM A;  5D8L B;  1H85 A;  2VOO A;  3WGI A;  3ABK H;  5J1Y A;  4RD6 A;  4F52 A;  2LC2 A;  4YRV A;  2XSD C;  2LY2 A;  4E7H A;  2CW7 A;  2XGD A;  4P22 A;  2ID6 A;  3DPT A;  4A3B J;  1OB2 A;  1Z7U A;  5JLX A;  4X06 A;  2YSR A;  3BNW A;  2HYG D;  2R3S A;  4PCQ A;  5KAI C;  4HV5 A;  2QYU A;  1U3E M;  3E97 A;  2PYG A;  3ERM A;  1ENH A;  1T98 A;  2Y75 A;  3I58 A;  4Z4W A;  3OFN A;  2NXN B;  3H94 A;  2L2O A;  5GTH C;  5LHG A;  2BM7 A;  5B3S H;  4BJ5 C;  4JP0 A;  2IS4 A;  2NTP A;  3BR0 A;  2K3F A;  3WTV C;  1YRN A;  1K6Y A;  3BQJ A;  1HG8 A;  5KVR A;  1K28 D;  1MH3 A;  1VQK B;  2GBY A;  1MSF C;  3DEW A;  4G7O F;  2E1B A;  4K1X A;  2D2W A;  3KPH A;  4M3B A;  3H0D A;  3K6G A;  1FIP A;  1EF4 A;  2NPF A;  1VBL A;  2PJR B;  2CGP A;  3OYJ A;  1NBM A;  1O8F A;  2CBX A;  3H5A A;  2HTS A;  2R7R A;  4XLA A;  2YWF A;  1T6Z A;  5DYM A;  4Q5S F;  1OGJ A;  3HJE A;  1MRZ A;  3D5L A;  3FX3 A;  4BYY A;  3RDI A;  1YI2 B;  4ZCL A;  1PUE E;  1TT5 B;  2A6H F;  5CQE A;  5LEJ A;  3K9T A;  4IQJ A;  2WPD A;  2GA2 A;  2BY1 A;  3KZZ A;  5K7H A;  2ZSI B;  1FWZ A;  2OTJ B;  4PSX A;  2LMD A;  2KVO A;  4QFM A;  1IJE A;  1B2R A;  3BDD A;  4LG0 A;  4EGZ A;  4MNU A;  4A93 J;  2MG4 A;  2W25 A;  3R4K A;  3WE2 A;  4C3I J;  2WAE A;  5BSX A;  4ESF A;  2DEU A;  3K4K A;  4KIF A;  2PQ8 A;  3W3C A;  2F5V A;  3MMY B;  5K7F A;  4PC2 A;  3OS0 A;  3RTR A;  4Z4V A;  4X7E A;  4M6X A;  4IHV A;  1KK1 A;  1MJB A;  3MZH A;  2QZA A;  1BI1 A;  4RD2 A;  3IWZ A;  1G4D A;  3NAU A;  2I8D A;  2XZL A;  1O3Q A;  2K4J A;  3H9Q A;  2M4K A;  1EZG A;  4RD4 A;  3WQZ A;  2BW3 B;  2ZJ2 A;  1CQX A;  3LSM A;  1R1U A;  3TO9 A;  4YAF A;  3IC7 A;  3WHB A;  3I64 A;  2EH3 A;  1X19 A;  3F22 A;  2VQC A;  5EG0 B;  2B5O A;  4IF4 A;  1EH6 A;  2F5D A;  2W00 A;  3TP0 A;  4FAS D;  4CYC A;  1KJZ A;  1ZRE A;  2LKS A;  2XF5 A;  2EFQ A;  1BOB A;  5FLV A;  1H42 A;  1DQU A;  3KX2 A;  2DFF A;  3LSH A;  1U8B A;  2VBT A;  1QQ1 A;  1DDG A;  2GQF A;  1O8H A;  1NK2 P;  4HLX A;  1K78 A;  2O17 A;  1BW6 A;  2ZFW A;  3FK7 A;  2WY7 Q;  3QPH A;  4OIN F;  4ESB A;  1YRN B;  4L9T A;  2ZZE A;  3OW7 A;  4G1B A;  1RZ4 A;  2OV7 A;  1Z05 A;  3LQR A;  3AG2 H;  3G71 I;  2NTB A;  2ACJ A;  3T0Y A;  2R5Z B;  1QGP A;  1WPK A;  4IEJ A;  1XN7 A;  5LRR A;  4XLP F;  3HOY J;  3BR2 A;  4FHT A;  3JQQ A;  3B6C A;  4L5I A;  2WV1 A;  1BJZ A;  3CMA I;  2MC4 A;  4BH9 A;  2XIG A;  1NH3 A;  1QA6 A;  2V7V A;  2XNJ A;  4RB2 C;  4QUZ A;  3BCB A;  1EP1 B;  4ZCM A;  1CLW A;  1ZG3 A;  1P7I A;  1O7L A;  2EB7 A;  1Q9S A;  3OEE A;  4AID A;  3OYF A;  2VB6 A;  4FCY A;  4L8J A;  3S3O A;  3MZ8 A;  3T53 B;  1N75 A;  1WJB A;  1T33 A;  3W2W A;  2VXD A;  2DLL A;  4OOV A;  1YJN I;  1RQR A;  3MQ0 A;  4X7C A;  3PSZ A;  4WXC A;  3TDU C;  2R7W A;  1E2X A;  3PVD A;  3PQJ A;  3SYJ A;  5E3L A;  1VQO I;  3Q3S A;  1L0O C;  4LG0 B;  4LB6 B;  2JZY A;  3BG9 A;  4GO1 A;  5K1Y A;  4EM1 A;  2GRE A;  2DO7 A;  2L7F P;  1U2W A;  5BPD A;  2JK3 A;  3Q39 A;  2HR3 A;  3RPU D;  2E7X A;  1SAN A;  1QPI A;  2W48 A;  4BHB A;  1GV2 A;  2V7W A;  5K5O A;  2ME6 A;  1BW5 A;  5KSW B;  4L9N A;  2G9W A;  1D2E A;  2ECC A;  3S15 J;  4JMQ A;  4HDV A;  3AVU A;  4BL0 B;  4G7Z F;  2XAH A;  4UZF A;  3RSN A;  4F3Q A;  2KRF A;  1UD2 A;  1O8M A;  2N8G A;  1F43 A;  3ZR8 X;  1FNN A;  3A1P A;  1WJD A;  1MBJ A;  1ITY A;  1IDY A;  1S9H A;  2B7B A;  1W0U A;  4FIS A;  2MC3 A;  3BC9 A;  4RAY A;  2KIU A;  3M1C A;  2VBM A;  2CUE A;  3LJY A;  2HYF A;  3SYT A;  4W8S A;  2EK5 A;  2XGC A;  2K9L A;  3FHZ A;  4AC9 A;  1FDR A;  2CFO A;  1RES A;  2EIJ H;  2KRH A;  3IV5 A;  3SJM A;  2E36 A;  5HDK A;  2GJR A;  2FF4 A;  3U2Q A;  3CCE B;  1VTN C;  1TYW A;  4GYG A;  4PC1 A;  1K78 B;  3QOP A;  1QU3 A;  4FXU A;  3GSI A;  4TMZ A;  3ASR A;  2HDW A;  3BLY A;  1SD5 A;  2ZZG A;  5JLV C;  2XV4 S;  4MIM A;  5A89 A;  3E0J B;  4RLF A;  2XC7 A;  5L3F A;  4S04 A;  1YJ9 B;  4M3F A;  3CES A;  2Z8G A;  5CVI A;  4B44 A;  2C78 A;  1K4Z A;  2A05 A;  4JYK A;  2Q2E A;  2M2E A;  2VI6 A;  3N4M A;  3KEW A;  2X6Y A;  1G7C A;  2C4T A;  1VZ0 A;  1AWC A;  2P7C B;  2WWY A;  2JA5 J;  2LF7 A;  5IYW A;  2E7W A;  3HUG A;  2W85 A;  4OJP A;  2EZL A;  2JSC A;  4M9X A;  3H3U A;  4YXW A;  2ICW G;  3VDX A;  1XMK A;  5AON A;  2QZ8 A;  1BLI A;  4AIH A;  4CO8 A;  2CV1 A;  1BN8 A;  3JRI A;  1ZGW A;  5LHH A;  5CKT A;  2CV2 A;  1MMG A;  1T56 A;  1OB5 A;  3LSJ A;  3WE3 A;  1X1A A;  4B4C A;  3I4N J;  4R1H A;  4U0W A;  4XKB A;  3A1Y A;  3CB4 A;  1OYY A;  1T8I A;  3ZBT A;  1QA1 A;  1TWH J;  4MEX F;  2C5H A;  4C0S A;  1KU2 A;  1S5L C;  1MDM A;  2XAF A;  3V8L A;  5HVQ C;  1WJF A;  2TDX A;  4FX4 A;  1IO2 A;  1T5E A;  5IT3 A;  2XKP A;  5F4J A;  4E0F A;  3T9G A;  2VPR A;  2WV0 A;  4CCL A;  2HOE A;  4DGW B;  1W87 A;  2VQL A;  2F6C A;  3E1S A;  2DMU A;  3VMV A;  3RYR A;  3F3X A;  3HEF A;  1XE1 A;  1JJ2 B;  1OCC H;  2R5Y A;  5HOO A;  1MBF A;  1ZQ3 P;  5GPA A;  3V42 A;  1D0Y A;  1ZUN B;  3HBL A;  3BPX A;  5IP7 J;  2DK8 A;  2X48 A;  3VYR B;  2EZI A;  5ICF A;  2D45 A;  3VYT B;  4IKF A;  4TN1 A;  1OKR A;  2JJ2 A;  2L9S A;  3DLA A;  3GFL A;  4BJ6 C;  1ZEL A;  1BI3 A;  2ZNY A;  1E3X A;  4L9J A;  3T1B A;  2X6X A;  2V1U A;  5JBQ A;  3J7A Y;  1QG0 A;  2V1X A;  2VBV A;  4A6D A;  1SMT A;  1R5B A;  3P5J A;  2K9S A;  3ZQG A;  2DN0 A;  4B3A A;  1PJR A;  2BHY A;  4ASU A;  3R6S A;  2RDP A;  1JRG A;  2DA6 A;  3BPV A;  3HM5 A;  1JKR C;  5H59 A;  4CQJ A;  2NSP A;  4YFX F;  2MH2 A;  1TWG J;  4BXF A;  2H94 A;  2KP6 A;  3OYA A;  4LOC A;  1JKQ C;  1TWC J;  1ETV A;  2ZCW A;  4QVJ A;  3BG7 A;  1JA1 A;  4KNY A;  1PKV A;  3VOD A;  1UD4 A;  2KJB A;  3TL4 X;  3P26 A;  4RCY A;  1TZL A;  4H4K C;  2FD5 A;  1U9N A;  3SUC A;  1I1G A;  4I76 A;  1KYZ A;  3CJT B;  4RDJ A;  5FO5 A;  3WTY C;  1LUJ B;  4GXO A;  1HC8 A;  2PJP A;  3HUG B;  2L5Q A;  3BTL A;  3GX4 X;  2X9D A;  1YO5 C;  1UD5 A;  2LNB A;  3BOQ A;  1ZKG A;  4PSW A;  1K61 A;  3RZO J;  1EFT A;  3I56 B;  5ICC A;  3FIW A;  2Z33 A;  3Q0U A;  1B8I A;  2K9M A;  5KNL A;  3NAR A;  1SVO A;  1BJK A;  1P9Q C;  5DTD A;  1V0E A;  3DP7 A;  4Y15 A;  4IRG A;  3E5X A;  5F0F A;  2K3P A;  2HI3 A;  1IXS B;  2H1L A;  3KL9 A;  3Q3A A;  1RET A;  3W2F A;  2PX9 A;  4JOM A;  3JRE A;  1EP2 B;  5J3O A;  2BEO A;  3FKI J;  5JFR A;  3DLL F;  2DW4 A;  2D9R A;  4UVB A;  1R4N B;  5CDF A;  1BMF A;  1HW5 A;  3DF8 A;  2KZG A;  2VQG A;  4BHC A;  4B3X A;  2Q6O A;  5D4S A;  4U49 A;  3CC4 B;  3FMS A;  5E1Z B;  3GLX A;  4WZE A;  5LD2 C;  4Y7C A;  3VYU B;  1YW7 A;  2Y69 H;  3K70 C;  3M1E A;  2HDD A;  4RMN A;  2XNC A;  1HLV A;  4HLY A;  3QE2 A;  1YI2 I;  1BI2 A;  4CSW A;  2MLG A;  1B23 P;  1TLL A;  1H8E A;  1LDK B;  2ETH A;  4ENJ A;  4XLN F;  4B4D A;  2YWE A;  1LPQ A;  4LJZ F;  1KQS B;  1TL8 A;  1OCZ H;  4ZGN B;  1G7T A;  2LK2 A;  2V7Q A;  2RQQ A;  1BN5 A;  2VZL A;  4L18 B;  2VUM J;  2ZTG A;  1D1A A;  2XAQ A;  3GVL A;  5FA6 A;  3I3L A;  2L01 A;  2D1V A;  1APL C;  1D1N A;  1P6R A;  1LFP A;  3W2G A;  2DFE A;  3VST A;  3ZZU A;  1OR7 C;  1QNT A;  3ZBU A;  3CCU B;  3BG5 A;  4C9Y A;  1W5C C;  1S8N A;  2DI3 A;  2AQE A;  1AKH B;  2W4S A;  1OIS A;  3PNT A;  2DPU A;  4V2G A;  3GFI A;  2X51 A;  2UZK A;  1A31 A;  2BM0 A;  3CCM B;  3ML3 A;  4Z4T A;  4M74 A;  4TT3 A;  1ZG1 A;  2HXI A;  1VQ6 B;  4HAM A;  2PMH A;  2QCO A;  2BM1 A;  1Y0N A;  2L9V A;  1O3T A;  2DJN A;  2DOG A;  5BS6 A;  3GWZ A;  4P12 A;  2NTQ A;  3RKX A;  4GFB A;  1K6O A;  4KN7 X;  2HZT A;  4G7X A;  5JR3 A;  3ZQC A;  2VNI A;  4Z05 A;  1H8H A;  1YS6 A;  2YUH A;  4IQ4 A;  3DKY A;  2KMU A;  2F4I A;  3U9G A;  2HOT A;  1WI9 A;  2QSF X;  1N78 A;  4MHG A;  4N4N B;  1B8I B;  2BVL A;  4YIR X;  3DPU A;  2LF8 A;  2QEX B;  4CDG A;  1CNE A;  1O8L A;  1R22 A;  1TNT A;  3ZPL A;  4ZYE A;  4ACA A;  4G1V A;  3X2Q H;  4M2L A;  1ETQ A;  3CUQ B;  4E7J A;  2KIQ A;  1LB2 A;  4H0E A;  4KIT B;  3DKW A;  1IW7 F;  4M71 A;  2BSA A;  1VQL B;  4YCQ A;  1KQ0 A;  1DDI A;  3BC8 A;  3PO3 J;  4U4B A;  5BOX A;  1CGP A;  1NG6 A;  3Q9V A;  3SEZ A;  1G3W A;  2AXT C;  4PFP A;  2PE3 A;  2CUZ A;  2VIX A;  3P7N A;  3Q6Q A;  1QVG B;  4W8R A;  5FGM A;  1T0F A;  2UWM A;  1R6R A;  4KIC A;  5TGT A;  3GVJ A;  2M4G A;  1BI0 A;  1XMX A;  2JVH A;  4PJJ A;  1IHM A;  2VNK A;  3VMF A;  1FOW A;  2KRC A;  3RJP A;  3ZN0 A;  4A3L J;  3AK5 A;  3MD2 A;  1P4W A;  5F04 A;  4P9U A;  1COW A;  2R9V A;  2WTE A;  2CV0 A;  4OJO A;  5H6Q A;  2CQQ A;  2RAE A;  1ONV A;  1XB4 A;  3I1F A;  1V5V A;  1LM1 A;  1JUS A;  4XID A;  3S3N A;  3EQN A;  5FFZ A;  3ZMZ A;  1IN4 A;  1RI7 A;  1X3U A;  2DA7 A;  4A3K J;  1UCR A;  2EZK A;  3HOU J;  3FM5 A;  1Y8Q B;  2K9N A;  2RQP A;  4B43 A;  3SY2 A;  2V4D A;  1W36 C;  4QV2 A;  3CP2 A;  1K79 A;  1QUF A;  3SLN A;  4FE7 A;  5L3D A;  2ELJ A;  2HPI A;  3PNY A;  3G4S B;  4B3G A;  2VLA A;  5IK2 A;  3IHU A;  3LSP A;  1OCR H;  1IN6 A;  3G2B A;  5LGN A;  5D5U B;  2NNN A;  9ANT A;  1VQ7 I;  2KHM A;  4D9J A;  3F9K A;  3SZE A;  1IAW A;  2XPV A;  1NTC A;  3RIQ A;  4YZX A;  4B8X A;  2R93 J;  3ZCO A;  1O4X A;  4QSH A;  4RGU A;  3R0J A;  2P0W A;  2HPM A;  4EJT A;  3B8H A;  3ISP A;  4AD9 A;  1FIA A;  1J59 A;  4ITV A;  4DW6 A;  2IJL A;  3PA1 A;  3O8H A;  2EA2 A;  2M9H A;  3Q0V A;  2D74 A;  2JUC A;  2RC6 A;  1P4X A;  5M5X J;  1FYM A;  1PDN C;  3GIR A;  3VO2 A;  4A3J J;  4Z4Z A;  2XAJ A;  3P9I A;  1R1V A;  5FKO A;  1AA7 A;  5K5R A;  5D5W B;  1VQ5 B;  3OL4 A;  1VQP I;  1YIT I;  4KKT A;  1BBY A;  2Q1Z B;  3HRS A;  1FP1 D;  5FKL A;  2NVU B;  2RV8 A;  1B9N A;  4HA8 A;  3L2R A;  1EH7 A;  4HWV A;  2LLK A;  3JRH A;  3H0G J;  1D8T A;  4HX4 A;  1W5T A;  4RAG A;  2KFD A;  3WYA A;  2ZXI A;  5GAE J;  4ETS A;  3OY9 A;  3JRA A;  4P6Y A;  1FT9 A;  3WHC A;  4P3I A;  3AVX A;  4URR A;  1WOO A;  3MCA A;  2E2H J;  2QDX A;  5IYP A;  5J8F A;  4EJU A;  1EFR A;  1BHE A;  3Q6R A;  1B59 A;  2XHK A;  1BR1 A;  2CC2 A;  1QVT A;  5CLS A;  4ZH4 F;  1FTT A;  1FLI A;  2PMZ A;  5AN9 A;  3GTO J;  3NWS A;  2V26 A;  3CTA A;  2BF4 A;  3FM3 A;  2B7E A;  5CVU A;  1KCC A;  2YWG A;  1FOK A;  1JUM A;  1YJW I;  2O6W A;  5J3L A;  3ZMV A;  3H3Z A;  1DAB A;  2DOE A;  4M4S A;  3BJ6 A;  1Y6I A;  3QFC A;  2QY1 A;  2QYO A;  1M1K D;  4PK4 A;  4DYQ A;  3O3K A;  3EUH C;  4OIQ F;  1BJA A;  2CO5 A;  5J1U A;  4B48 A;  4PGO A;  3CCR B;  1D8K A;  3N97 A;  2E2J J;  1QHG A;  2WY8 Q;  3NQO A;  3CMM A;  1GVD A;  2CQK A;  4WX9 A;  2FSW A;  4LK1 F;  3PO2 J;  1YLF A;  2OU2 A;  4C2U A;  5FLX K;  1DG1 G;  5DCF A;  2K9Q A;  4E7I A;  5HNF A;  2VXZ A;  3HOV J;  2CK3 A;  1V0F A;  3L7W A;  3CCV B;  3FBI B;  3SXY A;  1X4P A;  1OYI A;  3E5U A;  3H5N A;  1KTW A;  5C1E A;  3CCQ B;  1EA3 A;  5LGU A;  3NWT A;  1YE9 A;  2D3N A;  1ODD A;  1W7P A;  3A2K A;  2ELK A;  4KFC A;  1HW1 A;  2DOF A;  3GO5 A;  3SHF A;  4OMY A;  2ZME A;  4H9G A;  2KJC A;  2YPR A;  1RRJ A;  1IGN A;  4I01 A;  2DFH A;  5DEQ A;  3S3M A;  2C77 A;  3DV8 A;  2CUJ A;  4IW3 B;  3W6K B;  1TBX A;  5E6T A;  3CCL B;  3IUO A;  3GXO A;  3E6D A;  1PP8 F;  4HNV A;  4HIZ A;  3JTH A;  1O3S A;  1QRB A;  2GOX B;  3U2R A;  4EEF G;  4DBQ A;  3WTU C;  3H9J A;  2AHQ A;  4AVZ A;  4YFK F;  2MSY A;  2L4M A;  4IPA A;  5HS9 A;  3ZRG A;  3A3G A;  5F64 A;  4X07 A;  1YIO A;  3AVW A;  3GVK A;  1WSR A;  1JXS A;  4FE4 A;  4LLL A;  1YIJ I;  1S29 A;  4RD0 A;  2DMT A;  1A6Q A;  4AVP A;  1SKY B;  3CME B;  1WMR A;  3BG6 A;  5HXB A;  3DBL B;  3M9A A;  1WRJ A;  3ZIA A;  3PQK A;  1P7J A;  1QGZ A;  1ZM9 A;  2OBT A;  1NRK A;  3I56 I;  3R6J A;  2J8K A;  2XGJ A;  3S17 J;  3AVV A;  1Z67 A;  2BX6 A;  5B6I A;  1KQ8 A;  1ZRC A;  1TNS A;  1MZB A;  3K7A J;  2NVT J;  1U0J A;  3ZZ0 A;  1R23 A;  3CCS B;  3ZC3 A;  1T95 A;  4A2U A;  1Z7L A;  3OS1 A;  2A3S A;  4IOA F;  4I6Z A;  4AF7 A;  2H6B A;  1HDD C;  3FZV A;  3JTG A;  3CUQ C;  1AMO A;  3S2D J;  4M9S A;  2A6T A;  2HNH A;  1VQ4 I;  1NHC A;  2CFX A;  1H9G A;  2KDO A;  4MLO A;  5LGT A;  4UUS A;  4G8X A;  4KMU X;  3AG3 H;  4WQM A;  5TR9 A;  3VB2 A;  4MFD A;  2OBS A;  1Q1V A;  4P1V A;  1V4R A;  4Z6Y A;  2HGC A;  4G5G A;  4UB6 C;  1MBH A;  4XL9 A;  2X1E A;  2R6H A;  4QLC U;  3KP6 A;  2CG4 A;  1MJA A;  4OAZ A;  1UB9 A;  3HB9 A;  4BY1 J;  2VFQ A;  5DM7 F;  4A3D J;  5DDG A;  1QRC A;  4J0Q A;  2YS9 A;  3JCU C;  3UW0 A;  5ILS A;  3ZPP A;  1LLZ A;  3EQL F;  4E70 A;  4HNU A;  3GTJ J;  3QQA A;  2CQN A;  1OB0 A;  2YUS A;  2PN6 A;  2ZXH A;  1MMS A;  2GPJ A;  2VYQ A;  4MFE A;  3SKB A;  3OYI A;  3OZU A;  5CVJ A;  2INU A;  3NAW A;  3SLD A;  4M3G A;  1YOV B;  3BWG A;  3LSG A;  2L7K A;  3RCO A;  1WKM A;  5D5X B;  1DAR A;  2FU4 A;  2HTJ A;  3S14 J;  4HG2 A;  4XN3 A;  5F4O A;  2V4J C;  1Z6T A;  1O57 A;  4JBA A;  1XX5 A;  4YEI A;  1HDP A;  1TVC A;  3LSR A;  5DD4 A;  4X7D A;  2QVO A;  1XSX A;  1OFM A;  1XGO A;  3M8J A;  2FOK A;  3AST A;  1SFX A;  1IB0 A;  3I4M J;  3AAF A;  2VOD A;  1R1T A;  2ME0 A;  5KW9 A;  4FET A;  5GV8 A;  3CCJ B;  3QOD A;  4BNC A;  4BXU A;  3RY8 A;  3I55 I;  1WSU A;  1OCT C;  2X1D A;  2LH9 A;  4F92 B;  2V6E A;  1A6I A;  4UUT A;  1SD7 A;  4JRA C;  3Q9S A;  1FYL A;  1F5T A;  1HST A;  1VQL I;  3BZ6 A;  1RIO H;  5CJ9 A;  5FLX Z;  4PAB A;  2QQ8 A;  4IJA A;  3KYL A;  3ZZT A;  2W1O A;  2L54 A;  4YIF A;  4IO9 F;  1JKO C;  4PGG A;  3A8J A;  4TMX A;  1VLY A;  2OUM A;  2XAS A;  1E3P A;  3K69 A;  1E3Z A;  1FBQ A;  3CDI A;  3FDY A;  3ZQI A;  2XZO A;  2DA5 A;  2O03 A;  3PM1 A;  3MAJ A;  5AIP A;  5FRO A;  4BBR J;  1Z77 A;  3K4N A;  4CZZ A;  1U78 A;  1KTV A;  3GFM A;  4RD3 A;  1YTY A;  3C2G A;  1GUU A;  1ZR4 A;  1LEA A;  1QQI A;  4U7D A;  3EPZ A;  1DDN A;  3F8F A;  4ABZ A;  4BAC A;  4WK8 F;  2EV6 A;  4P96 A;  1Z6R A;  4OAY A;  3OW2 B;  1JTX A;  1XS9 A;  4II2 A;  2W7N A;  4UB8 C;  3WU0 A;  2WYR A;  2VON A;  1E1R A;  3HYI A;  2HWV A;  4RA2 A;  5E3M A;  3CD6 I;  4QWQ A;  2JMW A;  1G3Y A;  2INV A;  2JUG A;  1KC8 D;  5FD6 A;  4GCV A;  2D5V A;  1WDT A;  2JTV A;  2X4H A;  3W2V A;  2FJ1 A;  1FNM A;  4G6D A;  3LST A;  5JMC B;  5HKK A;  3LMW A;  3GEZ A;  2IS2 A;  3E6C C;  5IYQ A;  3S16 J;  5IY5 H;  2NZM A;  3FXM A;  2QGG A;  2NOJ B;  4LBV A;  4LB5 A;  3HG9 A;  1G2H A;  3AG4 H;  5JHU A;  1MMA A;  3AL0 B;  1LDD A;  3FXK A;  2VT2 A;  3LQQ A;  1I6H J;  1IDZ A;  1G3S A;  4L5J A;  4YAO A;  2CWE A;  2Z3Y A;  3HXL A;  1ZGJ A;  3DEE A;  2ZL6 A;  5DD8 A;  3CCY A;  4G94 A;  4A3M J;  3H9N A;  3NE5 B;  2ELH A;  1M90 D;  3IRQ A;  5H20 A;  1SMY F;  4OZY A;  1X0C A;  2K4B A;  2W84 A;  2QEN A;  3KEY A;  3T5X A;  3CPW B;  1U5T A;  3AVT A;  3GCM A;  3JSO A;  1W2B B;  1QH0 A;  2PMZ N;  1A8P A;  4M53 A;  1E63 A;  3WTX C;  1KMH A;  2EBI A;  4NC7 A;  4UNO A;  3ZN1 A;  2ODL A;  2XND A;  1VQ5 I;  2K02 A;  3DU1 X;  1GHC A;  4P5O A;  5ERI A;  5BNG A;  4OPO A;  2BV6 A;  4N9H A;  5EF6 A;  2JRT A;  3PIP F;  1BPL A;  5J8C A;  3OOC A;  4G7W A;  3FJO A;  3P9K A;  2AXL A;  3L2U A;  4D0P A;  2E1R A;  3DXJ F;  5FKK A;  3N6Z A;  4N4O B;  1FEX A;  3K0L A;  2X53 S;  3RYP A;  4Z1M A;  1X1B A;  3G1M A;  1JE8 A;  2DIE A;  1DP7 P;  4EM2 A;  1VQ9 I;  4UUV A;  2COM A;  2CJJ A;  3O8G A;  3CUO A;  2NS8 A;  5EZG A;  2VAS A;  3E3V A;  5DM6 F;  1UG0 A;  1H9T A;  1PJ7 A;  2CF4 A;  1KGS A;  3M07 A;  2IXS A;  2NT9 A;  1J2X A;  4X05 A;  4GYI A;  2QSG X;  4KT6 A;  2VBU A;  1XGS A;  5C4X J;  2BXY A;  2ZXJ A;  4NQW A;  1SM4 A;  4P25 A;  2P6S A;  2FMY A;  4LIV A;  3ZQF A;  3JW4 A;  2EA4 A;  3V7S A;  3VSV A;  5TV2 A;  1IN5 A;  3H09 A;  1ORK A;  2HQA A;  3M8F A;  2QA4 I;  3HIF A;  1YHQ I;  1IDJ A;  1BX1 A;  1J7K A;  3QPS A;  3SQV A;  2NS7 A;  1VF9 A;  4YAL A;  2HDC A;  2R7O A;  1E3H A;  3R61 A;  4NBQ A;  1IUF A;  4XLE A;  3U1D A;  5ILV A;  1BC7 C;  3J81 k;  1EP3 B;  3DKX A;  1SAX A;  2CRV A;  1E0E A;  4F91 B;  1OGI A;  4TMT A;  4ZCI A;  1OHH A;  1SFU A;  4LMY A;  1NHA A;  1W7P D;  2RRE A;  1F36 A;  2DDA A;  3QFR A;  4HDU A;  2Z99 A;  4LIT A;  1ZM4 A;  2OK7 A;  4AIK A;  2Z1D A;  3TKY A;  2BVN A;  3ZQ7 A;  3CCQ I;  2CW8 A;  1MKM A;  3ZXS A;  2JVG A;  3HC7 A;  1TWA J;  3KP7 A;  3O6B B;  2O6G E;  3VO1 A;  1HOM A;  3CXC B;  3K2A A;  3WWG A;  4F7Z A;  1U5T B;  3C2B A;  3ERE D;  4ZJZ A;  3AFH A;  2ZL7 A;  2X6O A;  1R5H A;  2ZIT A;  1R36 A;  4OOX A;  4CYC B;  5TJJ A;  1Q86 D;  1ZG5 A;  2KIS A;  1NG7 A;  4ANJ A;  1R9T J;  4ENN A;  1WOP A;  1IV8 A;  2CU7 A;  4O6J A;  2K86 A;  2JA7 J;  4AM3 A;  1OGO X;  2VBE A;  3LL7 A;  5FFX A;  1OGM X;  5F0C A;  4D1Q A;  2VPL A;  3HGY A;  4B1R A;  3K4M A;  3OR1 C;  3G6E B;  2W82 A;  3S1Q J;  3ISX A;  5L3C A;  3M3Y J;  1BA5 A;  2JA6 J;  2RC5 A;  2EIX A;  1MAB A;  1ZTR A;  2JJ1 A;  2M1B A;  2VKD A;  3TGN A;  1GVJ A;  4FQG A;  3DQV C;  2EV5 A;  2WAF A;  3KP2 A;  2STW A;  2H09 A;  1HBX G;  5H6R A;  4YDT A;  2A61 A;  1FSH A;  3BH6 B;  1V5G A;  4OOI A;  4XOP A;  3BY6 A;  2LBF A;  3DTE A;  1KQ5 A;  4Q48 A;  4IX7 A;  1F20 A;  4W1U A;  1JA0 A;  1WCM J;  4NQW B;  1OFE A;  1AIR A;  2EQR A;  2QKL B;  3OYC A;  3Q5F A;  2WAQ N;  1DGW Y;  5HDN A;  1P92 A;  1T08 B;  2IA0 A;  3QFS A;  3QRF F;  2IT0 A;  3DFG A;  4Z4R A;  2DMN A;  3CCS I;  1F60 A;  1Q82 D;  4N9I A;  2FUG 2;  2EV0 A;  3ML6 A;  1Y56 A;  2M30 A;  4EQQ A;  1ON1 A;  3MVP A;  3L2W A;  2Z6B D;  4AC0 A;  5FRN A;  2DER A;  4RDK A;  4YZA A;  5JVT A;  1JJ6 C;  4OPV A;  1UHW A;  2XAU A;  4YEL A;  1SFO J;  1HKQ A;  4KN4 X;  3JRD A;  2F48 A;  1U6G A;  3CQZ J;  3PUF A;  4JX5 A;  4E7Z A;  4E7K A;  5B1A H;  4BQA A;  3B4N A;  5JI6 A;  3PSI A;  2FQ4 A;  4YAU A;  1X1P A;  3GZN B;  6PAX A;  1VND A;  5LRS A;  3HPH A;  2QSH X;  4BS9 A;  5J40 A;  5IYD J;  3K1P A;  4U88 A;  5FL7 A;  1GAQ A;  1LQ1 A;  4RAZ A;  4DJA A;  4F55 A;  1SFK A;  3VEP A;  2W6I A;  1QGY A;  3QOE A;  4RAF A;  5HDG A;  1VF7 A;  2LY1 A;  2H8W A;  3C1D A;  2MD5 A;  1TC3 C;  3RPQ A;  3IH4 A;  3QU6 A;  4I0A A;  1S72 I;  4BU2 A;  1S3J A;  1WSV A;  2IP2 A;  5E8G A;  3CC2 B;  3V7C A;  3A8I A;  1K7A A;  3KCC A;  5TIS C;  4A0Z A;  3OS2 A;  1D0Z A;  3K2Z A;  1I5Z A;  1LVA A;  1K83 J;  2NT6 A;  5EYR A;  1SFE A;  1WJA A;  2CH0 A;  3D5S C;  4CCJ A;  1CZF A;  4XMY A;  1TSP A;  2DQR A;  5A2Q K;  2Q2E B;  4C3H J;  2GXB A;  3OYM A;  4ROX A;  3TW6 A;  5IP9 J;  2W24 A;  1W34 A;  2IA2 A;  2PEC A;  3WY9 A;  4WZT A;  2IW5 A;  2X3U A;  1U2R A;  3V8K A;  3AL0 C;  4CH7 A;  1WJE A;  1REP C;  1XDS A;  1OCP A;  2ZXW H;  1A35 A;  1A04 A;  2PIA A;  4X6A J;  1WJ5 A;  3F6V A;  1KU7 A;  1VQ8 B;  3WND A;  1R58 A;  1Z3X A;  2X0L A;  4Y3O A;  1E79 A;  2VJ4 A;  2GJP A;  4V02 C;  5AMV A;  1WH7 A;  2FX0 A;  5IPA A;  1HF0 A;  4IHW A;  5BPI A;  4HSR A;  3U6K A;  3GW2 A;  4HPQ A;  4NBS A;  3OMY A;  2E19 A;  4HF0 A;  2DET A;  3CJN A;  1H88 C;  2DFI A;  3FXR A;  3L2V A;  4NHJ A;  4Z4S A;  2GQQ A;  4M73 A;  3J80 K;  4LBY A;  1VQK I;  1MDM B;  4IRI A;  1QJV A;  1XCB A;  2XOK A;  2E35 A;  2IS6 A;  5F0H A;  5JLW A;  4HV6 A;  3ZP5 A;  1F4K A;  2P6T A;  3H1C A;  3OZV A;  1JGG A;  4I7H A;  3RKY A;  2BPO A;  3LA3 A;  4I99 C;  2HMA A;  2P5L C;  1CF7 A;  1MW7 A;  2V1D A;  3A0H C;  2R5Y B;  2V5I A;  1YQA A;  3OYN A;  1UD6 A;  1VJS A;  3KYC B;  2GA1 A;  2OZU A;  3OYK A;  5E20 A;  4M1K A;  5J1R A;  4YFO A;  1GAW A;  2PI0 A;  3A35 A;  4DNT B;  2GAU A;  3LWF A;  3QSY A;  3VMW A;  3K1N A;  3L2C A;  2KL4 A;  2G7H A;  2HLD A;  2NOG A;  2GK6 A;  1Y39 A;  3TO7 A;  3MKY B;  1VQM B;  4YEJ A;  2OTJ I;  3B6A A;  5FO0 A;  5LMZ A;  1ZK8 A;  3PSS A;  2AQF A;  2GIZ A;  2WB1 N;  4Y17 A;  2MAB A;  4ENM A;  2BZT A;  1V5F A;  5L3E A;  4D7N A;  2I5U A;  2HYJ A;  3K4B A;  5DCM A;  5GAD J;  1LFU P;  3MHP A;  3GZ5 A;  4ZDO A;  3WNB A;  4PFO A;  2ISY A;  5ICE A;  1AU7 A;  2G0E A;  4HZF A;  3L9F A;  1G7S A;  3BR1 A;  2V9P A;  3QWL A;  4XRF A;  4RLZ A;  2BY0 A;  3WG9 A;  5K5Q A;  4PC3 A;  2QUF A;  4PGH A;  4ACB A;  3L1P A;  3HL2 A;  1E1Q A;  4RD1 A;  4IOC F;  1N77 A;  3B82 A;  4Z06 A;  2OZ6 A;  2ZJR F;  1O88 A;  2MLK A;  3F0C A;  3JQP A;  3PUN A;  1OFD A;  1QUE A;  2ZFU A;  1FBU A;  3MCZ A;  5HNH A;  2XT2 A;  4XIC A;  2B0R A;  2EIM H;  1T2K A;  1O8J A;  1FTZ A;  4O3M A;  3A02 A;  3VOE A;  3LNN A;  1QVU A;  1DPU A;  4CCM A;  5J35 A;  1IF1 A;  4A3I J;  3A3B A;  4FTH A;  1YG2 A;  1J9Z A;  2CSO A;  4WZL A;  2XPW A;  2Y31 A;  1SAU A;  2DT7 B;  2YU3 A;  3F23 A;  2G0Y A;  4BDY A;  5DS9 A;  5D6E A;  2ZBV A;  2OCC H;  4A3G J;  1OYW A;  2QBY A;  1ULY A;  1AOY A;  4E4H A;  4D5C A;  1R4M B;  2O0Y A;  1MBG A;  3WG7 H;  2DCU A;  4DQL A;  3GQA A;  2LR8 A;  2E60 A;  1LVK A;  2CUF A;  2E1O A;  4OOS A;  2UV1 A;  2FQ3 A;  3IP4 B;  3G1O A;  5B5E C;  2WZN A;  1UHS A;  3KIO A;  5LBQ A;  2FVG A;  3FXU A;  3CMY A;  2VJ5 A;  3PA2 A;  2PMD A;  4MR0 A;  4P9S A;  4TKO B;  2XB5 A;  2UXN A;  2LYC A;  1HKT A;  2KIF A;  2VJI A;  2XF7 A;  1F1Z A;  4RGS A;  4WF2 A;  2DA4 A;  1U8R A;  4ZV4 A;  2HVR A;  4ZYD A;  3UKG A;  3WXM A;  2P7V B;  4BY7 J;  3HGG A;  3HSE A;  1B72 A;  2M7B A;  2L9N A;  3MKW B;  1RU4 A;  3U1K A;  5IP6 A;  2NVX J;  5A2Q Z;  4L0Z B;  3R6K A;  5LHI A;  2GLO A;  1IC8 A;  1IDK A;  4OZZ A;  3TQN A;  4YC5 A;  4XSX F;  2CRG A;  3K10 A;  1GXQ A;  2ZB9 A;  5E17 F;  5DNS A;  1G8X A;  1V3F A;  3KZI C;  3SDB A;  2LDU A;  3FHN A;  2K7L A;  2XB0 X;  3FXQ A;  2M5S A;  4ZYG A;  4Y9U A;  2VBZ A;  3ZQQ A;  1G59 A;  2VBX A;  3G1L A;  1FRN A;  3ESW B;  1B6A A;  4JX6 A;  2QWW A;  5IOZ A;  1TYX A;  5HLT A;  1G6N A;  3HRM A;  3U21 A;  2XVC A;  5A88 A;  3Q0W A;  1MGT A;  1TYU A;  2OYN A;  2OBR A;  1JT0 A;  2LFB A;  3HTS B;  4PAA A;  3J80 Z;  2X85 A;  3EUK L;  4W8Q A;  2WA0 A;  3ES9 A;  4KT5 C;  5DV5 A;  1OFC X;  5KAF C;  2O5R A;  1R5G A;  4IXA A;  3TED A;  2WJY A;  1WPC A;  5ILU A;  3LYC A;  2BXZ A;  2XKO A;  4OMZ A;  1X3Z B;  3CCE I;  5ED4 A;  2A68 F;  2ZZF A;  2BE5 F;  3KEQ A;  1E43 A;  2FNP A;  2LD5 A;  3G6E I;  1ETO A;  3LAP A;  3SJP A;  1YJ9 I;  1O8I A;  2IGM A;  4XKV A;  4EV0 A;  2VQH A;  2DYI A;  2BYV E;  5HLI A;  3RQI A;  4MTE A;  4EH1 A;  1KRH A;  4C2M J;  1FBS A;  3J81 K;  3JU4 A;  1ZGA A;  4Z03 A;  3WU2 C;  3G05 A;  5FLM J;  1TYV A;  4IHS A;  1ZM2 A;  3BTI A;  5E1W A;  4E6K G;  2RN7 A;  3SFI A;  1LEB A;  3BCF A;  4RB1 A;  2WC2 A;  4FK8 A;  4DQ2 A;  2HZD A;  3FKJ A;  1K5C A;  2ESN A;  3H36 A;  1V55 H;  3V76 A;  4XOT A;  1MJ9 A;  3R60 A;  4L9V A;  4G6I A;  1SC7 A;  3F72 A;  2B7C A;  2A6E F;  4HYE A;  2FRH A;  3E20 A;  1X1C A;  4A0Y A;  4RGR A;  2X3H A;  4XLF A;  2ZJQ F;  2ZNZ A;  3K4C A;  3K4L A;  4WXD A;  4Z2Y A;  2Y9Y A;  1RKW A;  2M3A A;  2RVC A;  3Q38 A;  3G71 B;  4M3D A;  3JSP A;  4XN0 A;  4RDL A;  2K85 A;  2E5Z A;  5E18 F;  1K4S A;  4DQK A;  2VFM A;  1QCX A;  3CMA B;  1NDH A;  3VWB A;  1H8A C;  5EMN A;  4DIQ A;  3A03 A;  4TV7 A;  4AF6 A;  1GO2 A;  1MMD A;  1YYV A;  2BHZ A;  4K2E A;  3GTP J;  3B78 A;  3OYG A;  1X2M A;  2DA3 A;  1Z0X A;  4G7H F;  1JKP C;  4HEA 2;  1W9X A;  3F8N A;  5TY0 A;  4UZE A;  1YJN B;  3ECO A;  5E1X A;  2ZTN A;  4BKX A;  2ZZQ A;  1LE8 A;  2LY9 A;  3E6M A;  3BG3 A;  2NVQ J;  4LBZ A;  5LFA A;  3IKT A;  2MYS A;  2EJR A;  2VT3 A;  4ZYA A;  3KFW X;  1MNE A;  3FXJ A;  4I09 A;  1OMI A;  3BH7 B;  3W2I A;  3BZC A;  3W6J B;  2BGJ A;  1R49 A;  3PSF A;  4RB0 A;  2DY1 A;  3G3Z A;  3E5Q A;  1W4M A;  4RM3 A;  4LK0 F;  4PUS A;  1HVX A;  2WZP P;  2IS1 A;  4MXN A;  1Y1V J;  3H3V K;  2OJE D;  5LLQ A;  2JSP A;  3ZQH A;  1WU8 A;  3GQB A;  3RPU A;  4BDZ A;  5FIU A;  3QP5 A;  3T56 B;  2F3L A;  2OBP A;  4XBF A;  5IOY A;  1ACI A;  5C44 J;  2HCJ B;  5DS0 A;  4UV8 A;  2UXX A;  3BR3 A;  1E62 A;  1TTY A;  1IRZ A;  3IH3 A;  2JWT A;  4NK8 A;  4AIJ A;  4YZ0 A;  1I50 J;  1Y1W J;  1QFJ A;  1NB0 A;  2PFB A;  2VE8 A;  2DAO A;  4KKS A;  3E7L A;  3SFZ A;  5IYC J;  4FT8 A;  2Z5U A;  1X4O A;  1PJ5 A;  2R7F A;  2OC6 A;  1K8F A;  1ETY A;  2DOD A;  2ZKZ A;  3GVA A;  3SZP A;  2Z16 A;  3J7A O;  4DK0 A;  2IOU G;  3BP8 A;  1UG2 A;  3HTU A;  2KDZ A;  3AGP A;  2K5C A;  2JPB A;  4IL6 C;  2XRO A;  4Y4R A;  5FRM A;  2IQ7 A;  2V9V A;  3H35 A;  4I0B A;  2C5B A;  2QTZ A;  2NS0 A;  1YX2 A;  2BM4 A;  1WH5 A;  2R7Q A;  4BE2 A;  2X8K A;  1FNC A;  2EFW A;  2OTL B;  5L3B A;  3NB2 A;  1RUO A;  4XRS A;  3JUR A;  2BGI A;  1UZC A;  3CC4 I;  2Y2Z A;  3FMR A;  1XQB A;  2XAG A;  4CA0 A;  3OYD A;  4X0C A;  1KD1 D;  4Z4U A;  2HVQ A;  2MH9 A;  4HX8 A;  3RIR A;  1J09 A;  1BOA A;  1YX5 A;  3A01 A;  1L3L A;  2IPQ X;  2QN6 A;  2XUB A;  1NB9 A;  1MBE A;  2L0K A;  2Z9O A;  3M4O J;  4XKC A;  2OPT A;  1TLH B;  5FJ8 J;  2HXO A;  3HKZ N;  4HNT A;  1MMN A;  1JUP A;  1LE8 B;  1GLN A;  3HOX J;  1I3Q J;  1W7P B;  1NJI D;  3K4J A;  2IAI A;  2O8X A;  3LQE A;  4A5N A;  1B9M A;  1X1D A;  2WAQ A;  2ZME B;  5CPR B;  1ZR2 A;  2EFG A;  1XG2 A;  2O0V A;  2VBY A;  2JT1 A;  1OJL A;  2Z2S B;  3J81 Z;  2Y9Z A;  3CCU I;  3LQ6 A;  2PJR A;  3UR3 C;  1RWR A;  3GYH X;  3B73 A;  2E1M B;  2WAD A;  3P4G A;  3CCM I;  3MZY A;  5IYB J;  2R0Q C;  1DU0 A;  2V7F A;  1VQ6 I;  2P4W A;  4EW9 A;  3DPL C;  4G12 A;  3JRB A;  3L2Q A;  1TWF J;  1EWY A;  4J01 A;  1FX0 A;  4BQN A;  1FP2 A;  2MD0 A;  5F27 A;  3WTW C;  3P27 A;  3I9V 2;  1POG A;  4MYT A;  2FOW A;  4WZK A;  2UUZ A;  1HZE A;  1VFC A;  2M0C A;  4U9U A;  3I53 A;  2XDV A;  3PFY A;  2QQA A;  4XR6 A;  4NC8 A;  2DXI A;  4NK6 A;  1FZP B;  5HZB A;  3BJO A;  3DEU A;  2NNY A;  3I5U A;  3BZK A;  3W2A A;  1DBO A;  3KRG A;  2QEX I;  1MBK A;  1YW9 A;  1FC3 A;  2MBF A;  1JHF A;  4RLQ A;  4BBS J;  4OPW A;  3IRR A;  1MNM C;  2ESH A;  2M34 A;  3A0B C;  1MIJ A;  1UST A;  3MEX A;  3QYB A;  1QX4 A;  3OJW A;  3I71 A;  4F93 B;  1TUI A;  1SVL A;  2IGO A;  1G7R A;  2HQ5 A;  3D1N I;  2HDN B;  2Y30 A;  4P6V F;  2K40 A;  1JJ8 C;  3GF2 A;  5D5V B;  2LZJ A;  1XD7 A;  3WU1 B;  4MGR A;  2BW3 A;  1VI0 A;  1D8J A;  4UV9 A;  1H0M A;  3TO6 A;  5KHD A;  4D7M A;  3EDP A;  2XT4 A;  3I4P A;  4XLC A;  5EG0 A;  5E3O A;  2H6C A;  2O1D A;  1K73 D;  3B8Y A;  1WXR A;  1FSE A;  2W6J A;  1QFY A;  5IYN A;  2LVS A;  4G9Y A;  3HPG A;  4UVC A;  3ROU A;  2MW8 A;  2XGE A;  5C4J J;  4XLH A;  4UUS B;  3A01 B;  3CF5 F;  3FXO A;  1VQN B;  2IA1 A;  4FX0 A;  1KK3 A;  3BH4 A;  1ZH5 A;  5J4Y A;  4KIB A;  4KIG A;  4RB3 C;  1GT0 C;  1SKQ A;  2ADU A;  1T0F C;  4A5M A;  3W2E A;  3WOD F;  5H5J A;  2JA2 A;  3QFT A;  5EJC A;  4B09 A;  1YFH A;  3TMO A;  5F1J A;  3S1M J;  1QZZ A;  5F1R A;  1TQP A;  2R5Z A;  1OLT A;  1GR1 A;  2Q6I A;  4B47 A;  2BSP A;  1WZ2 A;  2NVY J;  2EZH A;  4N0B A;  5DN6 A;  1W1W E;  4PMH A;  2KZV A;  2R7V A;  1SEU A;  1IUY A;  3JR9 A;  1P2F A;  1D5V A;  5DUI A;  4NUB A;  4UY8 I;  5EEA A;  1H89 C;  5JHF A;  1AHD P;  2ISZ A;  3E1Y E;  4U7B A;  3ZQL A;  2LKP A;  3AKZ A;  2BGC A;  4W97 A;  4C30 A;  2M5W A;  2M0M A;  4P55 A;  3G4S I;  2GWR A;  3TH0 A;  3KET A;  2A07 F;  4MEY F;  3OYH A;  1OR7 A;  1N08 A;  4LGW A;  3HAG A;  4ZTF A;  2M7A A;  2LKX A;  1OOC A;  4C3J J;  1R5I D;  1KK2 A;  2HFH A;  2Q6L A;  2HKX A;  2BM5 A;  4C2T A;  4Y7N J;  1Y0U A;  5M5Y J;  2M8E A;  2PYH A;  3U6B A;  1PE9 A;  2FNA A;  3TP3 A;  5D4R A;  2NV4 A;  2QTL A;  1BC8 C;  4X8I A;  2NAZ A;  3CC7 B;  4LFU A;  4S0H B;  2EIN H;  2RGV A;  2AO9 A;  2PG4 A;  1QBJ A;  3CPX A;  5L46 A;  2WB1 A;  2R7U A;  1ZHF A;  1ELO A;  1WTH D;  4KKU A;  3CLQ A;  4L0Y B;  3FIS A;  3QAH A;  3QU3 A;  3M8E A;  4EAT A;  3CDH A;  3GTQ J;  2A5Y B;  5A8A A;  2ECB A;  3WBK A;  4PZJ A;  5J6X A;  3TOA A;  1JI8 A;  4ESJ A;  4GRI A;  2BOL A;  2VC1 A;  3HHH A;  3ZSC A;  3HRU A;  3B90 A;  3VSK A;  4CHU A;  2PEX A;  2D3L A;  2X1C A;  3HSR A;  4AUX A;  1U9O A;  3RKQ A;  3ABT A;  2QE7 A;  3GTM J;  1S7A A;  4IVN A;  3LFU A;  2Y0S N;  4R79 A;  1Z91 A;  3BTJ A;  3OOP A;  3H9G A;  4V19 K;  1PXZ A;  4XRS G;  1UMQ A;  4XM3 A;  5H2F C;  2OCE A;  2PMU A;  1XG1 A;  4CUG A;  1RUN A;  4Z4Y A;  1MH4 A;  3N05 A;  2IVM A;  3FXL A;  2MA3 A;  2XPU A;  4Y33 A;  4UXN A;  3ZMU A;  2HQR A;  3JAM K;  4UAJ A;  3GFJ A;  4ENK A;  3FPP A;  1BR2 A;  2BVM A;  3T8R A;  1P4M A;  3EYY A;  2LTP A;  5DUK A;  3KP3 A;  2ZJP F;  1FJL A;  2ZBU A;  2V9K A;  4IRH A;  1XSV A;  4R8H A;  2VBS A;  3VNU A;  3VNV A;  3CCR I;  1R00 A;  4OWR B;  1QZE A;  4ZTJ A;  1FMW A;  1BX0 A;  4M6Y A;  3OIO A;  2H27 A;  3BY2 A;  2NYX A;  2LG4 A;  3FPK A;  1WOS A;  3DWL E;  4D5F A;  2HOA A;  3WNC A;  1S7E A;  2QF7 A;  1XMA A;  5M3M J;  3ASO H;  3CCV I;  1J5Y A;  3LAJ A;  5D6F A;  1WWX A;  5BSY A;  2F1L A;  1Q1H A;  3IAM 2;  4JQF A;  4KIS A;  4WWV A;  3FWE A;  1IRX A;  2XRN A;  4QPO A;  4RS8 A;  4YAW A;  2BN4 A;  5BMZ A;  3L00 A;  4FN5 A;  2H1K A;  1I8D A;  1L1I A;  5CVV A;  3PET A;  2VKH A;  2HQN A;  5AIQ A;  1I7P A;  1JTY A;  4PC7 A;  1JNY A;  1DPR A;  4OP7 A;  2L9R A;  4OIP F;  3CCL I;  1Q81 D;  4ZC3 A;  3LMM A;  2VBK A;  4NB5 A;  2GOM A;  4HQM A;  4XRM A;  1RR8 C;  2TCT A;  1GV5 A;  2ZME C;  2HEO A;  1EFU A;  3WTS C;  1QGA A;  3HOW J;  1Q7Y D;  1VQ7 B;  5HZA A;  2E1M C;  1W5S A;  3CME I;  1DGR M;  1JT6 A;  2YX4 A;  2JIZ A;  1V54 H;  2BBY A;  1UAA A;  1KU3 A;  1PJ6 A;  2F2E A;  1MND A;  4MQV A;  4B3F X;  4BQQ A;  3T51 B;  1TQI A;  1F9N A;  3NEU A;  4J19 A;  2V7U A;  2CND A;  4BGD A;  2JN9 A;  3GLL A;  5K7Z A;  2P8T A;  3AG1 H;  4EJO A;  2E2I J;  1LNW A;  1O8E A;  1LFB A;  3DTK A;  3KYD B;  3S1N J;  1IRF A;  3WTT C;  1FPQ A;  2I1L A;  3LA7 A;  1YIT B;  1VQP B;  4HOB A;  1LLW A;  4EVI A;  2ZO4 A;  1GQ8 A;  2O7O A;  3W6V A;  4P2N A;  4BQO A;  1G3T A;  4S05 A;  4M9Z A;  4QTR A;  4DNR B;  3B02 A;  3K1M A;  2VKE A;  2HKO A;  1E17 A;  2R7T A;  1XB2 A;  2F4M B;  2OTL I;  1V5E A;  1SD4 A;  3SDG A;  1X58 A;  2UVE A;  1SD6 A;  3DU5 A;  3VPR A;  5EEH A;  5KCM A;  1FOY A;  2DU9 A;  4PC6 A;  2XSJ C;  3HOZ J;  1XSD A;  3OAA A;  5CQG A;  1TTT A;  5EGO A;  1X2N A;  1FND A;  1R5N A;  2JJ7 A;  2P81 A;  2E71 A;  4A12 A;  1AIP A;  3CZ6 A;  2R7D A;  5FD5 A;  4QIW N;  1IZ1 A;  3EUH A;  4YFN F;  5ICG A;  2UVF A;  1MD0 A;  1UD8 A;  1BIB A;  1QRY A;  4HRI A;  4XQF A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2F5V A;  3MMY B;  4NNJ A;  3W3C A;  4ZDL A;  3OS0 A;  3RTR A;  2LYC A;  1SKY B;  4TKO B;  2VJI A;  3BG6 A;  2XF7 A;  1WMR A;  2HVR A;  3ZIA A;  2LRE A;  3BCD A;  1NRK A;  2M7B A;  2L9N A;  2I8D A;  3MKW B;  3VR6 A;  3H9Q A;  2XZL A;  2M4K A;  2XGJ A;  3WQZ A;  1RU4 A;  2BW3 B;  4XON A;  3OYL A;  3LSM A;  1X19 A;  4HST A;  1IDK A;  3DTI A;  3S93 A;  4OZZ A;  3K10 A;  2VQC A;  1U0J A;  3SEQ A;  3VSU A;  2W00 A;  1G8X A;  4FAS D;  3SDB A;  1T95 A;  3FHN A;  1QHH D;  2XF5 A;  4PJM A;  1Z7L A;  1BOB A;  4BJT A;  3OS1 A;  2M5S A;  3ZQQ A;  1DQU A;  3KX2 A;  3LSH A;  1G59 A;  4C2L A;  3UNG C;  1O8H A;  2O17 A;  4QPQ A;  4DOZ A;  5HLT A;  1NHC A;  2A6T A;  2HNH A;  3U21 A;  2WY7 Q;  3QYE A;  2LBF B;  3OW7 A;  2ZZE A;  2KDO A;  2OV7 A;  4MLO A;  2NTB A;  2A5W A;  2X85 A;  3EUK L;  1D0X A;  2WA0 A;  4W8Q A;  2O5R A;  2MC4 A;  2WJY A;  1WPC A;  4OJ6 A;  3BCB A;  4XL9 A;  2X1E A;  4W8T A;  4OAZ A;  3VYS B;  3OEE A;  2ZZF A;  3OYF A;  2VB6 A;  4L8J A;  1E43 A;  3UW0 A;  3S3O A;  3ZPP A;  3T53 B;  1N75 A;  4HNU A;  1WJB A;  1OB0 A;  1O8K A;  2ZXH A;  3W2W A;  2VXD A;  2INU A;  3OYI A;  4BE1 A;  1O8I A;  2IGM A;  3K70 D;  4XKV A;  2R7W A;  2VQH A;  3LSG A;  2V31 A;  2L7K A;  3RCO A;  2F43 A;  3JU4 A;  4Z03 A;  4HG2 A;  4XN3 A;  3G05 A;  4X0G A;  2V4J C;  3RPU D;  4E6K G;  1KON A;  3BCF A;  1OFM A;  3M8J A;  2HZD A;  3FKJ A;  1K5C A;  4II3 A;  4JMQ A;  4XOT A;  4PJL A;  4G6I A;  4BL0 B;  3RSN A;  4FET A;  1X1C A;  4F3Q A;  3D5R C;  3QOD A;  2X3H A;  4XLF A;  2R7X A;  1UD2 A;  1O8M A;  2X1D A;  3RQ4 A;  2LH9 A;  3K4C A;  3K4L A;  3ZR8 X;  1WJD A;  4F92 B;  2V6E A;  2M3A A;  1DP3 A;  1S9H A;  4XN0 A;  3BC9 A;  2E5Z A;  2X6W A;  4LIU A;  3M1C A;  2VBM A;  1QCX A;  3SYT A;  3VWB A;  4W8S A;  4GQN A;  3KYL A;  2K9L A;  2W1O A;  4DIQ A;  2CFO A;  2KRH A;  2GJR A;  1MMD A;  2CS3 A;  2OUM A;  4AYB A;  1VLY A;  1E3Z A;  3FDY A;  3OYG A;  2XZO A;  1QU3 A;  4FXU A;  2HDW A;  3BLY A;  2ZZG A;  5FRO A;  3K4N A;  3E0J B;  4RLF A;  2XC7 A;  4HEA 2;  3HKZ A;  1W9X A;  4TSF A;  3CES A;  2KQR A;  3C2G A;  2Z8G A;  4B44 A;  4KJZ A;  2ZTN A;  2ZZQ A;  3FY3 A;  3EPZ A;  1I18 A;  3KEW A;  5C1C A;  2X6Y A;  4BAC A;  3FKS A;  5LFA A;  1VZ0 A;  4OAY A;  2MYS A;  1KCD A;  4ZYA A;  2HU9 A;  4II2 A;  2XF6 A;  2W7N A;  1MNE A;  2ZSH B;  4OJP A;  4YZQ A;  1E1R A;  1ERD A;  4YXW A;  1W0J A;  3VDX A;  3PSF A;  1BLI A;  2INV A;  2JUG A;  2CV1 A;  4RM3 A;  3PL8 A;  1BN8 A;  4PUS A;  1HA8 A;  5CKT A;  1HVX A;  3W2V A;  2CV2 A;  1MMG A;  2IS1 A;  2WZP P;  3ZPN A;  4MXN A;  3GQB A;  2JSP A;  5HKK A;  3LMW A;  2QX3 A;  1X1A A;  4BDZ A;  4XKB A;  3A1Y A;  2IS2 A;  3T56 B;  2NZM A;  2O0W A;  2NOJ B;  3BCA A;  3HG9 A;  5HVQ C;  1WJF A;  4XKW A;  1T5E A;  3T9G A;  1MMA A;  4E0F A;  3AL0 B;  3OIQ A;  4CCL A;  4DGW B;  2QXZ A;  2VQL A;  2F6C A;  3E1S A;  3OL3 A;  4UZU A;  4NK8 A;  3HXL A;  4YZ0 A;  3DEE A;  3VMV A;  3EQO A;  4KKS A;  3NE5 B;  5HOO A;  1X4O A;  1YX3 A;  4OZY A;  1X0C A;  2OC6 A;  3V42 A;  1D0Y A;  4BUP A;  4MR0 A;  3CJR B;  3KEY A;  3VYR B;  2Z16 A;  4DK0 A;  3HOT A;  1WJC A;  1OFL A;  1W36 D;  4CZC A;  2K5C A;  3VYT B;  4U87 A;  4IKF A;  5FRM A;  4Y4R A;  4BE0 A;  4NC7 A;  1KMH A;  2JJ2 A;  1PLU A;  2IQ7 A;  3H35 A;  2L9S A;  3DLA A;  4LG3 A;  4XOR A;  2ODL A;  4BJ6 C;  4E7S A;  1ZEL A;  2XND A;  4RM2 A;  4J00 A;  2KLO A;  2JDI A;  1E3X A;  4P5O A;  2R7Q A;  2X6X A;  4BE2 A;  2X8K A;  3J7A Y;  4G7W A;  1BPL A;  3OOC A;  3JUR A;  1PJR A;  4ASU A;  3L2U A;  4CA0 A;  3OYD A;  4N4O B;  1WFX A;  2HVQ A;  1JRG A;  1Z3Y A;  2X53 S;  3PUB A;  4Z1M A;  1J09 A;  1X1B A;  2NSP A;  1YX5 A;  1H80 A;  2DIE A;  4BXF A;  2KP6 A;  3OYA A;  4CCN A;  1D1B A;  4XKC A;  3BG7 A;  1PKV A;  2HVS A;  1UD4 A;  2VAS A;  3DU6 A;  1UG0 A;  4G6T B;  4HNT A;  3MKZ A;  3TL4 X;  1MMN A;  1TZL A;  2IXS A;  2NT9 A;  1BR4 A;  4H4K C;  1GLN A;  4KT6 A;  3ZGK A;  3OYB A;  3SUC A;  3K4J A;  1X1D A;  2WAQ A;  5CPR B;  2O0V A;  3OPO A;  1XG2 A;  3HUG B;  2L5Q A;  2Z2S B;  4LIV A;  1DBG A;  1UD5 A;  3VSV A;  2PJR A;  4PSW A;  3UR3 C;  1RWR A;  2HQA A;  2E1M B;  4AU7 A;  2R7S A;  3GBG A;  1IDJ A;  2K9M A;  5KNL A;  2WAD A;  1P9Q C;  1V0E A;  2V7F A;  2IGK A;  2VJJ A;  4ZDP A;  2GJK A;  2R7O A;  4XLE A;  4EW9 A;  3DPL C;  2K3P A;  3DKX A;  3L2Q A;  1E0E A;  1FX0 A;  4J01 A;  4BQN A;  2LRD A;  2MD0 A;  4F91 B;  3FBN B;  3I9V 2;  2DOA A;  1OHH A;  3S32 A;  4JOM A;  3DDY A;  2RRE A;  2UUZ A;  5CDF A;  1HZE A;  4LIT A;  1BMF A;  2XDV A;  2VQG A;  3PFY A;  2Z1D A;  4XR6 A;  4NC8 A;  2DXI A;  4NK6 A;  4B3X A;  4U49 A;  1W0K A;  4XNF A;  2CW8 A;  3W2A A;  1DBO A;  3KRG A;  3ZXS A;  5LD2 C;  3VYU B;  5C1E A;  3K70 C;  2JVG A;  3HC7 A;  3H5R A;  4RMN A;  4PJN A;  4RLQ A;  2EWE A;  3WWG A;  4CSW A;  1EE6 A;  3QYB A;  4ZJZ A;  3AFH A;  1UD3 A;  3HOS A;  1H8E A;  1LDK B;  4F93 B;  2IGO A;  2E5N A;  4ANJ A;  1NG7 A;  2LZJ A;  1OGO X;  2BW3 A;  3OOU A;  2VBE A;  3LL7 A;  3PJR A;  2RQQ A;  2V7Q A;  2ZTG A;  3GVL A;  3CP8 A;  1D1A A;  5KHD A;  1OGM X;  3I3L A;  3OYE A;  4D1Q A;  2VPL A;  3K4M A;  1LFP A;  4XLC A;  3VST A;  1OR7 C;  3OR1 C;  2W82 A;  2O1D A;  4C9Y A;  3B8Y A;  2AQE A;  3OWT A;  3OEH A;  4XD7 A;  3TBI A;  2W4S A;  3PNT A;  1MAB A;  2W6J A;  4P1W A;  2Y0S A;  3HPG A;  2VKD A;  2JJ1 A;  3GQ7 A;  4XLH A;  2X51 A;  3DQV C;  3BH4 A;  4TT3 A;  1O8D A;  2WAF A;  1T0F C;  1V5G A;  4XOP A;  2NTQ A;  2LBF A;  2JA2 A;  3DTE A;  4G7X A;  4IX7 A;  3TMO A;  4BEH A;  3GRH A;  1OLT A;  4NQW B;  2BSP A;  4B47 A;  3OYC A;  2QKL B;  1H8H A;  1AIR A;  4Z05 A;  1DGW Y;  5DN6 A;  4IQ4 A;  4PMH A;  3DKY A;  2KZV A;  2KMU A;  2R7V A;  3GQ9 A;  2F4I A;  1N78 A;  2V1N A;  4N4N B;  4NUB A;  1O8G A;  5JHF A;  2BVL A;  3DPU A;  2VL8 A;  4U7B A;  2FUG 2;  3AKZ A;  4C30 A;  1O8L A;  1Y56 A;  2M0M A;  1Z21 A;  3L2W A;  2Z6B D;  5FRN A;  3CF2 A;  3QYF A;  4E7J A;  3OYH A;  4YZA A;  2CMP A;  4KIT B;  3OR2 C;  2XAU A;  4YEL A;  3BC8 A;  4U4B A;  3HAG A;  1IA5 A;  4ZTF A;  4E7Z A;  2M7A A;  4E7K A;  1OOC A;  3B4N A;  3PSI A;  4IZZ A;  1NG6 A;  3SEZ A;  2QKM B;  4C2T A;  2KPM A;  4DK1 A;  3A4C A;  4OJL A;  4PFP A;  2PYH A;  1PE9 A;  2CUZ A;  2VIX A;  3HPH A;  2NST A;  4W8R A;  1LKX A;  4BS9 A;  2UWM A;  2RNG A;  1R6R A;  5TGT A;  3GVJ A;  2M4G A;  2JVH A;  4PJJ A;  5FL7 A;  1FMV A;  2KRC A;  2DT6 A;  4DJA A;  4F55 A;  4CCK A;  3MD2 A;  2XZP A;  2WB1 A;  2R7U A;  1COW A;  1SFK A;  2R9V A;  2W6I A;  2CV0 A;  3QOE A;  1WTH D;  4KKU A;  4OJO A;  1VF7 A;  2LY1 A;  2IGN A;  4EAT A;  4OJ5 A;  2WSS A;  4BU2 A;  3GQ8 A;  3S3N A;  3EQN A;  1JI8 A;  4GRI A;  2BOL A;  3ZSC A;  3OS2 A;  1D0Z A;  3B90 A;  3VSK A;  3IAS 2;  4B43 A;  2NT6 A;  2V4D A;  1W36 C;  2D3L A;  3CP2 A;  1WJA A;  2X1C A;  2CH0 A;  3D5S C;  4CCJ A;  3LSI A;  1CZF A;  2QE7 A;  4XMY A;  1IB4 A;  2DCE A;  2DJI A;  3LFU A;  2Q2E B;  3OYM A;  2ELJ A;  2HPI A;  3PNY A;  4B3G A;  4R79 A;  2PEC A;  3H9G A;  2VLA A;  1KZL A;  5IK2 A;  1PXZ A;  4XM3 A;  1UEL B;  3AL0 C;  2WJV A;  4CUG A;  1TT0 A;  4CH7 A;  1WJE A;  4I84 A;  1WP6 A;  3G2B A;  3N05 A;  3PNV A;  2F1M A;  2KHM A;  1WJ5 A;  3C2H A;  4DBR A;  3OIP A;  4Y33 A;  3VSL A;  3F9K A;  4BEH B;  4D9J A;  4YZX A;  3FPP A;  1BR2 A;  1Z3X A;  4Y3O A;  3ZCO A;  2VJ4 A;  2HPM A;  2BVM A;  2P0W A;  1E79 A;  2GJP A;  5AMV A;  1JTA A;  2V9K A;  4HSR A;  4ITV A;  4HPQ A;  3OMY A;  4OWR B;  4ZTJ A;  1FMW A;  3L2V A;  4E7L A;  3CJQ B;  2LG4 A;  3LSK A;  1QJV A;  3DWL E;  1AA7 A;  2XOK A;  3OL4 A;  2IS6 A;  4KKT A;  2Q1Z B;  2O04 A;  3ONQ A;  3EUA A;  2GK7 A;  2R4G A;  3L2R A;  1MW7 A;  4HWV A;  4KIS A;  3IAM 2;  1D1C A;  4JQF A;  2LOO A;  1PYV A;  1IRX A;  3OYN A;  4QPO A;  3SZG A;  1UD6 A;  3S8P A;  1VJS A;  2ZXI A;  3OE7 A;  2MFZ A;  1RMG A;  3OYK A;  1I8D A;  3OY9 A;  3A35 A;  4CCO A;  4DNT B;  3VMW A;  2WBM A;  2KL4 A;  2VKH A;  4URR A;  2HLD A;  2GK6 A;  3MKY B;  4F52 A;  2LC2 A;  4YEJ A;  4YRV A;  2LY2 A;  4E7H A;  2CW7 A;  1EFR A;  1BHE A;  4P22 A;  3DPT A;  4ZC3 A;  3LMM A;  2AQF A;  2VBK A;  1BR1 A;  2MAB A;  1V5F A;  2GOM A;  2PMZ A;  3K4B A;  3NWS A;  2V26 A;  4ZDO A;  4PFO A;  1KCC A;  2PYG A;  2E1M C;  1DGR M;  2JIZ A;  1Y6I A;  1UAA A;  2QY1 A;  3HL2 A;  1E1Q A;  1MND A;  3H94 A;  3OFN A;  4BQQ A;  2L2O A;  4PK4 A;  1N77 A;  3T51 B;  4B3F X;  4Z06 A;  1O88 A;  3EUH C;  4BJ5 C;  4B48 A;  4BGD A;  2IS4 A;  2ZFU A;  2NTP A;  1QHG A;  5HNH A;  2WY8 Q;  1K6Y A;  3CMM A;  1O8E A;  1HG8 A;  1K28 D;  3DTK A;  1O8J A;  4C2U A;  2E1B A;  1VBL A;  3H0D A;  3K6G A;  4E7I A;  3LNN A;  5HNF A;  2VXZ A;  1GQ8 A;  2CK3 A;  2PJR B;  1V0F A;  4CCM A;  3FBI B;  4BQO A;  3OYJ A;  1X4P A;  1NBM A;  3H5N A;  1KTW A;  3H5A A;  1O8F A;  2R7R A;  1EA3 A;  4XLA A;  4DNR B;  3NWT A;  1YE9 A;  2D3N A;  3A3B A;  3A2K A;  2R7T A;  3D5L A;  1SAU A;  1V5E A;  2DT7 B;  5CQE A;  4IQJ A;  4BDY A;  2WPD A;  2UVE A;  3DU5 A;  2ZSI B;  5KCM A;  4E4H A;  3S3M A;  2XSJ C;  4PSX A;  3OAA A;  5CQG A;  2CUJ A;  3GQA A;  2KVO A;  3IUO A;  2E60 A;  4HIZ A;  1LVK A;  3CZ6 A;  2UV1 A;  2GOX B;  3IP4 B;  4DBQ A;  3H9J A;  4AVZ A;  3A3G A;  2WAE A;  3ZRG A;  2UVF A;  1UD8 A;  3GVK A;  3K4K A;  4HRI A;  4XQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...