2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
1O8HA 2X6YA 3JURA 3SUCA 4Z05A 4XKVA 2NSTA 4XONA 2NT9A 1HG8A 1WMRA 1PE9A 2EWEA 4YELA 4XNFA 4HWVA 1OFMA 2NTBA 2UVEA 1O8DA 4YZXA 1PXZA 1K5CA 2NTPA 2VJIA 2QX3A 1RU4A 3B90A 4I84A 1KCDA 2X6WA 1O8JA 4YEJA 2O17A 4W8SA 1IDKA 1EE6A 3GQ8A 5C1EA 3VSVA 2VJJA 2QY1A 4OJ5A 4XKWA 4OZZA 2Z8GA 2O1DA 2X85A 4OJPA 2BSPA 2ODLA 2INVA 1NHCA 3GQ7A 1O8MA 5AMVA 1BHEA 1IDJA 4C2LA 1PLUA 1OFLA 2INUA 2X3HA 1JRGA 4XOTA 4XQFA 4PMHA 1O8EA 4AVZA 4XORA 1IB4A 2NSPA 1RMGA 1KCCA 2IQ7A 4NK6A 4YZ0A 4XN3A 4MR0A 4YZAA 2NZMA 1X0CA 2PYHA 4Z03A 4URRA 2QXZA 1H80A 4XN0A 4U49A 2O0WA 5C1CA 1KTWA 4XM3A 3ZSCA 4XLCA 3LMWA 3GQAA 3VMVA 3KRGA 1QCXA 4XLAA 2O04A 2X6XA 3T9GA 4W8QA 1BN8A 2NT6A 3VSTA 1VBLA 4OJLA 1GQ8A 1O8LA 1JTAA 4MXNA 1AIRA 1RWRA 3FY3A 3EQOA 3UW0A 2PYGA 1OGMX 4XMYA 3EQNA 4Z06A 3ZPPA 3B8YA 4OJ6A 1O8KA 4XLFA 1IA5A 1O8FA 4W8TA 4U4BA 4XLEA 1OGOX 3GQ9A 4EW9A 1OOCA 1XG2A 2O0VA 3GRHA 4XOPA 3VMWA 3VSUA 2VBKA 2UVFA 4XL9A 2NTQA 1CZFA 4OZYA 4XLHA 4YZQA 1DBGA 4OJOA 3B4NA 2VBEA 2PECA 4XR6A 4W8RA 1QJVA 3WWGA 1DBOA 2VBMA 1O8IA 1O88A 4NK8A 1O8GA
chains in the Genus database with same CATH superfamily
1O8HA 2QGGA 3H35A 1OGJA 5GV8A 2M5SA 4CYCA 2TRTA 3MZYA 1B6AA 1D0YA 3T53B 1TWGJ 2PJRA 3LQEA 4C9YA 2CV0A 2JUCA 1JKOC 5FROA 4P3IA 4CCJA 4X7DA 2CS3A 1HKTA 2VE8A 4AIKA 4CZZA 4HWVA 4S0HB 5TISC 1MSFC 5FL7A 3GVLA 2HR3A 3TOBA 1KMHA 1EE6A 3ROUA 3GQ8A 1FNNA 5CLSA 3PIOF 4A6DA 5HDGA 2V1NA 2YR2A 2QE7A 2JVHA 1FX7A 1TYUA 4A0ZA 1X1BA 2J5PA 3NEUA 2EIJH 2WAQA 4A2UA 1Q1VA 4EMSA 3WNDA 5DTDA 4RLFA 1FLIA 4X06A 2HKOA 5LMZA 4TV7A 4A3LJ 4A3GJ 3L2RA 4FTHA 2DTRA 2VBXA 4C3HJ 2ZZEA 4IRHA 3Q0WA 2W24A 1VHEA 1WU8A 4P55A 1L1IA 1RRJA 4TMTA 4LK1F 3S2DJ 4OU0A 2JA7J 1QFJA 1VQ5I 2WSSA 1JA1A 2X0KA 3MZHA 1VQ7I 4Y9RA 1AHDP 2ESHA 3PQJA 4CA0A 2XGCA 4G8XA 1DPRA 1E17A 1MABA 4Y9UA 3W2HA 5CVUA 2BOLA 3OS1A 4BE2A 2M0MA 3I4MJ 4U49A 3GFLA 3H3UA 2F5EA 1WZ2A 4C43A 1SANA 2JQ7A 2KDZA 1O4XA 3CC7I 3LMMA 3RDIA 4BE0A 5FKLA 5L3CA 2Q2EB 1GXPA 5E1ZB 2R7RA 2XTXA 2VKVA 2HDCA 1IXRC 5D6EA 3WTTC 3I53A 3P5JA 4OM9A 5F1RA 2P6TA 3CCSI 5GAHJ 2DK5A 2BF4A 1R4NB 1QNTA 2VC0A 4WZEA 2FVGA 2CUZA 2HDWA 1IGNA 1G3SA 5CJ9A 1WSRA 4P3YA 5DM6F 4RB2C 4ACAA 1HF2A 1T0FA 4E7LA 1WORA 3O8GA 2VXZA 2ZMEC 4WWCA 2EFOA 4UUVA 1LPQA 3F8FA 2Y0MA 2CRVA 1MRZA 4G94A 3H94A 3VSUA 2NS7A 2QYOA 1HQCA 1BIBA 4FCYA 1IJFA 5J1YA 2DMQA 3NWSA 1IRZA 4UXNA 2HLDA 2NTQA 4WZTA 1DBGA 4MYTA 1E79A 2WYRA 1YX2A 2A3SA 4RDJA 4BBSJ 2XGEA 3JQQA 2XZLA 5B1BH 4I6ZA 4JK1X 5HNHA 4GCVA 1LEAA 3R61A 1PYVA 4XRMA 1KD1D 4KISA 1X2NA 3V76A 3ML3A 1Y0NA 4PUSA 1BL0A 4I7HA 3AVWA 4PC7A 1KU9A 3G1OA 3CCQB 2E35A 1K83J 2D1VA 4UVBA 2EWEA 4WF2A 3CMEI 3AKZA 1OB0A 2VT3A 4OIRF 1E64A 3GSIA 5TY0A 1WFXA 4HAMA 1M90D 1NK3P 3FISA 4YAUA 3QP6A 1XGNA 1E62A 2MGQA 2LH9A 4ZDOA 4E6KG 5HKKA 2L9VA 5HVQC 4UVCA 4DZPA 1Z7LA 4D0PA 1E0EA 2FBHA 1PUFA 3G6EB 4ETSA 1F1ZA 4ENKA 2HGCA 2BVMA 2BX6A 4ZYAA 1IRFA 1S7OA 1USSA 1YW9A 3U1KA 1D1AA 3I3LA 1IUYA 3W3CA 3BQJA 3A2KA 3M7GA 2Y30A 4DYRA 2O6WA 2V9VA 1XGSA 2VONA 3BY2A 1D3YA 1TWHJ 3CMAB 4PMHA 3O3KA 4AVZA 3CCMI 3S1RJ 5GAEJ 3R6SA 2Q6KA 3K4NA 3BG6A 1GJRA 1ZQ3P 3LSJA 2MA3A 2JA6J 1X19A 3OYCA 5F64A 2KJBA 1T5EA 1YW8A 4FWTA 2E1MC 4YZ0A 4FISA 4A3FJ 1SAXA 2PIAA 5F4MA 4WQMA 3BH7B 1W1WE 1TWFJ 4B47A 4M6XA 4NQWB 3OS0A 2IS4A 2ZL5A 1JHHA 2QXZA 1IRXA 2GA1A 2QSFX 1GDTA 1FRQA 2DU9A 4RLQA 4R79A 3FMRA 1F5TA 3B73A 3DPUA 5JR3A 3LSPA 1Y1WJ 1I8DA 1JGGA 3HPHA 5GV7A 3G1LA 1ERDA 4EJWA 3G05A 2VLAA 4KIBA 3KEWA 4ZTFA 2DIEA 4RMNA 2RQPA 4ASNA 3GTLJ 4BQNA 4XRSA 2VOOA 3PUMA 3BCBA 2VBWA 1UHSA 5A2QK 3I71A 1OJLA 1TQIA 3U6BA 4RCYA 5D5WB 1QX4A 1T0FC 3OZUA 1VQKB 2A5WA 4OOSA 4RA2A 1HA8A 3BWGA 1X58A 4IF4A 1GT0C 1LB2A 3BR5A 1HF0A 2BW3B 2GOXB 3IUOA 2DERA 2B0LA 1JI8A 2RN7A 5H5JA 5C4JJ 4QIWN 4PAAA 1DABA 5HNFA 2GM4A 5J3OA 5E1XA 3R6KA 4KIFA 2XF7A 2R92J 2UVFA 4MO7A 1BI0A 4WCGA 4P1VA 3E7LA 3AVUA 4B4CA 1GO2A 1JUSA 2FE3A 2L4AA 3O2PE 4FHTA 4UV8A 4XLHA 2DETA 4RM2A 1AMOA 4ZDPA 4Y3OA 1QFYA 5IYPA 2EV6A 4C2TA 2VFQA 5M3MJ 1OQYA 1X1DA 2EZLA 3ONQA 2VFNA 5EGOA 2XGXA 3CF2A 4Y7NJ 1O8IA 3Q9SA 4M3FA 2M3AA 1F20A 2DN0A 2P5KA 3WHCA 2E36A 2K4JA 3GQBA 5J8FA 2M9HA 3PFYA 4KDPA 3W2EA 1UHWA 2X6YA 3ZIAA 1O8GA 3SUCA 1AU7A 4C3JJ 2ZMEA 1I5ZA 5GAGJ 3KZYA 2FOKA 1WMRA 4IVNA 1N8RD 1FYMA 4YEIA 5LRSA 3DPLC 3KP3A 1LFPA 3KYLA 1YFHA 1SD5A 3AL0B 3BR3A 4YIRX 4AU7A 3ML6A 1BW5A 3ZUGA 3BZKA 2GK6A 4UZUA 4Y7CA 3EETA 2DA2A 1LEBA 4YEJA 2PLFA 2PMDA 1H8AC 2ACJA 3JQPA 4AC0A 4PCQA 1VQ6B 2X1CA 1WRJA 3V7CA 4X1EA 5EDNA 4G6IA 4TN1A 1XSXA 2V4DA 4PABA 5IP6A 5D5VB 3A02A 4ENJA 1SEUA 2LY2A 1EFUA 2JRTA 3IRRA 3HSFA 2QCOA 1ZELA 3W2GA 1NHCA 1SMTA 3KCCA 1BHEA 4F52A 5FIUA 5J3LA 2ELHA 2ZMEB 3WU2C 1Y39A 2A07F 2H09A 3DPTA 4F3QA 1ONVA 5KNLA 1FTZA 5TRDA 1XB2A 1OFEA 1MJAA 4OPSA 5HODA 3FXMA 1TZLA 4KYWA 3LNQA 2IQ7A 4G6QA 1GXQA 2ZBKA 1UHMA 1QGPA 4IL6C 2IS2A 2MABA 4BBRJ 2JJ1A 3ZQFA 2FMYA 4Z03A 4E7JA 5E8GA 3ASRA 3U2QA 1EP1B 4RD4A 3W2IA 3MD2A 3IWZA 1OB2A 2ID6A 2P6SA 3W6JB 3WE3A 5LFAA 3OYLA 2V6EA 3CP2A 4FX4A 2EJRA 1PDNC 2DY1A 5TV2A 2W6IA 1LNWA 4EM2A 4WZLA 2OBTA 3OJXA 4B4DA 4ENMA 4RAZA 5FLMJ 1P9QC 3D5RC 3G4SB 3QOPA 3V8KA 4U88A 3FKJA 2DFFA 2I8DA 3M1EA 3A01B 1ZRCA 3JRHA 2Y31A 2M34A 2HZDA 3P26A 2JN6A 1FNDA 2QYUA 3LJYA 4AD9A 2HYGD 2R4GA 4N9HA 3U21A 2Y75A 2PX9A 1F4KA 3EQNA 2L7MP 1R4MB 3K6GA 3I59A 4OOIA 3ZCOA 4IHXA 2ZJPF 1CLWA 1O7FA 2KRHA 4B3XA 2Y0SN 2DFIA 2HPMA 3ECHA 1CQTA 2L2OA 1OGOX 3SY2A 2FJ1A 1B59A 1WDTA 4AYBA 3FM5A 4D1QA 2J7KA 2K4BA 4R8HA 1ZARA 4QPOA 4HSRA 2UV1A 1YOVB 5LLQA 1QPIA 3OYFA 2OBRA 1TSPA 3NRVA 4A3IJ 3HOVJ 2VJ5A 1TW3A 1ORKA 2GZWA 3OIOA 1YS6A 5HZAA 1D0XA 4AIHA 3C2BA 1ZGWA 2C6YA 1IN8A 2V79A 3OIPA 4HNTA 1PJ6A 3N05A 2HXOA 4RS8A 2ZBVA 1Q7YD 4KMFA 3K4MA 2IOUG 1P92A 5HS9A 2RKHA 3V4GA 4GYGA 2HDNB 5HZBA 1G2HA 1J2XA 1NG6A 3A0BC 3MKZA 2R5ZA 3A4CA 1ENHA 1JNYA 3CCLB 3S2WA 2PE3A 3MEXA 4BXFA 3BG5A 1X3UA 5FRNA 2GQFA 1UB9A 4RGRA 2WV1A 3K4CA 4H4KC 4K2EA 4Q47A 4BJ5C 3GYHX 5BMZA 2MG4A 1EP2B 2L7FP 3ZC3A 2BY1A 3H5AA 3CC2B 1WJFA 1AOYA 2K27A 1YI2I 4HX8A 1W0JA 5F0FA 4G6DA 3NB2A 3ERMA 4YFNF 2HXIA 3GTPJ 5C1EA 1IN4A 1UG0A 4RB0A 1FX0A 3RKQA 1T2KA 4RB1A 5FA6A 2QQAA 3LSMA 5FFZA 3BJOA 1G7TA 4TT3A 3SLDA 2O1DA 2W00A 1XPXA 2Z8GA 1DGRM 3TKYA 4JP0A 5F0CA 1X4PA 4A0XA 4KT6A 3ESWB 1O3TA 3BR1A 5E3LA 1OCOH 1OLTA 4O5VA 1I6XA 1ZH5A 2RVCA 4ZYEA 2VI6A 1N78A 2H6BA 1HBXG 3KE2A 2P8TA 3A1YA 1ZM9A 2X3HA 1F36A 1ZHFA 3ASSA 5DSZA 4ITVA 4J19A 1O8EA 2ZB9A 3L00A 1TQMA 1PKVA 3BR0A 3CCJI 4XORA 2VZLA 1W0TA 1G6NA 4EVIA 1ZUNB 1SD6A 1WI3A 2CF4A 1QRBA 3K7AJ 4EJTA 2MD5A 4UY8I 2XAFA 3PA2A 4QWQA 4XN3A 3ZMSA 1X2MA 4V2FA 1H9GA 3LSIA 3LQRA 3BLYA 2LREA 2DYSH 5JFRA 3E1YE 2ECCA 4DZJA 3OY9A 1K9MD 5E79C 3VYUB 1H42A 4LIVA 3PNTA 3MQ0A 4LD5A 2M5WA 3WGGA 3OS2A 2ZL7A 3A8KA 3UR3C 1GQ8A 4F7DA 2LKSA 3CD6B 4M4SA 4E7KA 1RWRA 1Z91A 1VQ6I 3E3VA 3SZTA 1SFKA 1UZCA 5IOZA 3LO8A 4X7EA 2BVNA 3PVDA 3VOEA 3ZPPA 1SVMA 3IHUA 3HUGB 4P6YA 2V5IA 2W25A 2JA5J 3A35A 4MNUA 4EEFG 4U4BA 2KKOA 3DKXA 1TL8A 2COBA 2NYXA 2JPCA 2FQ4A 3HJEA 5CVRA 1HW2A 4LBWA 4C3IJ 3CCEB 9ANTA 1YTYA 3VO2A 1JUMA 1O3RA 5AIPA 4PGOA 4G6TB 3SHFA 5AONA 3T1BA 2G7HA 2XF6A 2F1MA 1FIPA 3HC7A 5FLXZ 5A8AA 3PJRA 4CYCB 1RNLA 2Q0OA 4LFUA 3HPGA 1YO5C 5JHFA 2ZFWA 1W87A 5FO1A 3OYJA 3HG9A 1NH3A 2JDIA 2LKPA 3SDGA 3OYGA 4KN7X 2MSYA 3BC8A 1TQPA 2QTLA 5J47A 1YRNA 4RDKA 2EV5A 1S9HA 2ELJA 2R9VA 3LSRA 2QM3A 2EK5A 1ZREA 3A1PA 2DA3A 4M74A 3CB4A 5FO0A 3E6BA 4AIJA 2GIVA 4DIQA 4NCNA 2DYIA 3COAC 2BGIA 1MIJA 2DDBA 1S4MA 1KGSA 4LLLA 2BV6A 2M2EA 1Z9CA 2JK3A 3KZZA 2EZIA 1Q1HA 1ZM2A 1OFMA 3L2VA 3HGGA 4C30A 3SEZA 4E70A 2DA1A 4BNCA 1QGAA 2VBZA 3B90A 2L9NA 2F43A 5JBQA 1VFCA 3RKYA 4XBFA 4U9UA 1VLOA 2ZXIA 1R1UA 1GR1A 1ZGJA 1OCZH 3F0CA 3A3GA 1HSTA 1V54H 3VSVA 3K4KA 2QY1A 4BHPA 1VQNB 4N4NB 2L54A 3FIWA 1FOWA 2GAUA 4OZZA 3LSHA 5LD2C 1XGOA 4JBAA 2PMHA 3ZQGA 4IPAA 3OL4A 4CCKA 1VQ9I 4BE1A 1KU3A 2IGMA 2LLKA 3T8RA 2PJRB 5J1RA 3OSGA 2BY0A 3ASOH 1WJCA 5GTHC 5HS8A 2P81A 3E5UA 5H20A 5EYRA 3W5VA 1V0FA 1FZPB 4M53A 4X7FA 1LDJA 3TQNA 1Z7UA 1D5VA 1I1SA 2KPMA 4X7CA 3L09A 5EZGA 5K5RA 1HKQA 2GOMA 3J7ZI 3P27A 1QA1A 4HDUA 1BQEA 3SZPA 2B0RA 2PYHA 3SLNA 1RUNA 5J1UA 4G7XA 2QWWA 3CCLI 3K4BA 4N3GA 1IG7A 3DU1X 1K6YA 3W6VA 3ZSCA 4BYYA 2VNIA 3FPPA 3FK7A 2W6JA 1FY7A 2BPOA 4MFDA 4EH1A 3HDDA 4L9NA 4W8QA 1R58A 2QA4I 3TH0A 1ULYA 4BQOA 5LGTA 1FC3A 3C2GA 4P9SA 2EIKH 2O0YA 2WADA 4P9UA 1Q86D 3OEHA 3S15J 2HOEA 1AA7A 4MXNA 4AC9A 4XKCA 2HOAA 1DQUA 3OYKA 3TDUC 2V7TA 3AAFA 4XMYA 2BBYA 5EEGA 2QKLB 4EM0B 3D0SA 3LVBA 2V7VA 4JX4A 2GXGA 4OMZA 3WG9A 2AHQA 4Z4TA 1BM9A 2ZSHB 3E5XA 2HU9A 1RQRA 1BN5A 3ONYA 2V7QA 2PQ8A 2XC7A 3OAAA 2EPFA 3IAS2 1UAAA 2G9WA 3N4MA 3K2AA 5ICFA 1U9OA 1HDDC 3CRZA 3CUQC 2PLYA 3KEQA 4G9YA 2AQFA 3G2BA 4LITA 3OYBA 2CRGA 2H27A 3H36A 1R5ID 2B9SA 1MBJA 4OZYA 2HFHA 3WTYC 4I98B 2CJJA 4D9JA 4LBVA 2RC4A 3LWFA 3I55I 2M30A 4PK4A 3ASTA 4W8RA 5IT3A 3CCVI 1TW2A 4IHSA 4N4OB 4L0ZB 1TYVA 3FMQA 3SJZA 3JURA 2XAUA 1UCRA 2R7WA 3ZMZA 4ZCLA 3SKBA 1TT5B 1JGSA 4HV6A 5DCFA 1FBUA 3P4GA 2MFZA 1UMKA 4F92B 1ELOA 1ZM3A 3JU4A 1FMVA 1IDYA 4DJAA 3LOCA 3TL4X 4IRGA 3W2WA 5L3DA 1A36A 2CW5A 2Q6LA 1QVFB 3CQZJ 2NNNA 1P4AA 3ASPA 5D8KB 2XF5A 3H5NA 1KQ5A 4UZFA 1N05A 2E2JJ 2LRDA 1XN7A 2IVMA 3M1CA 2YWHA 4TMVA 2CUFA 2L0KA 4M3EA 5FKOA 1VQLB 1KCDA 3CJTB 5K5OA 3HRTA 2XDVA 3DDYA 4G1VA 1OFCX 1RR7A 4BY7J 1LM1A 3BZCA 4OJ5A 2HVQA 3T51B 3E0JB 4ZYDA 1HCRA 2NS0A 3O8HA 5EZHA 4GDFA 4C2MJ 4M3GA 2K9MA 1I3QJ 3CMAI 3CCMB 1ZM4A 2BSPA 2OZ6A 5FKNA 2R5YA 1YJWB 1ZN2A 2LKXA 1V3FA 3OR1C 2F5CA 4KICA 3DTEA 1SMYF 3FF5A 4MGRA 4L0YB 2C5HA 2D9RA 2GK7A 4NC7A 4M6VA 3ZXSA 5K7HA 2E60A 3VR6A 4WXDA 2IGNA 4HE5A 1KK1A 3JRDA 2K3FA 2F1LA 1VJSA 4LBZA 2JTVA 1QQIA 4BPRA 1SD4A 3MMYB 2XRNA 1RZ4A 3OYEA 2Q6IA 5FKMA 1KQ0A 5BPIA 3RI4A 2HOSA 1BLIA 1WSUA 4N3NA 2AO9A 3IKVA 1JT6A 5FD5A 3HB9A 3LSKA 4IOAF 5K7ZA 1QPMA 4B8XA 2ZTGA 3B78A 1R5GA 3OEEA 4MYUA 1FOYA 3WE2A 2XKOA 3QAHA 3WGHA 1N08A 1FRNA 3KRGA 2IA1A 4XLAA 2E1RA 5LGUA 3CXCB 4IZZA 4BACA 2PFBA 1JUPA 2WZPP 2ZFUA 5BSYA 2DQRA 1BC8C 1U3EM 2VOPA 4MQ9F 2FUG2 5GTIC 3ZP5A 1UD3A 4OJLA 1SVLA 4Z4UA 4LGWA 3WHBA 1ETKA 3ZR8X 2L7ZA 2JZYA 1GVHA 2UXXA 4RD3A 3EQOA 2QBYA 1S7AA 1Z21A 2W84A 1OGMX 2NVQJ 3UW0A 3H5RA 2XAGA 1H0MA 5J40A 4F7ZA 5BSXA 4PC2A 1WOSA 3JQRA 3H0DA 1FP2A 4U7BA 2C2WA 3EUHA 3PENA 3A8IA 3V7AA 2XNDA 2V7XA 1O8FA 2R7ZJ 3RKWA 5KK1A 1NK2P 3ONUA 2XVCA 3BTIA 2OC6A 5H2FC 1MMSA 1NJID 1EZGA 4LJZF 4LLGF 4PGGA 1A04A 1QZYA 4BU2A 4A3KJ 1XG1A 2CQXA 2R7DA 1QA2A 1E63A 1U6GA 2PG4A 3ZQHA 4ZV4A 3BOQA 3FJOA 3J81K 2QEXI 4BXXJ 3AK5A 2OTLB 1S29A 1OYWA 4O3MA 4OIOF 1B23P 3CESA 3SJPA 4YZQA 2K5CA 2R7QA 3RPUA 1VQ5B 3KLNA 3DFGA 4CCLA 3ZMTA 1OISA 2CH0A 2P7VB 5D4SA 4H9GA 3FXLA 2VKEA 5JLWA 2FD5A 4YZXA 1RR8C 1LDDA 3IC7A 2AQEA 4PJLA 1TLHB 3RPQA 5DCMB 1LQ1A 4GFBA 4OWRB 3WBKA 1F60A 1SKYB 4NHJA 1NBMA 2WBMA 3CC7B 2O6GE 1N0VC 2LBFA 4M2LA 4Z6YA 4BL0B 1K79A 1V5VA 2A69F 3LFUA 1S6LA 5F04A 2HYJA 3I56B 2M4GA 3LL7A 1FOKA 1BJKA 2OQRA 2CFOA 4CXFA 2GXAA 3CCQI 4ESJA 1GV2A 4XSZF 1QUEA 2X6WA 3C3WA 1O8JA 5FFXA 4QVAA 2M4KA 4YCQA 1OR7C 2WC2A 2M7AA 3DV8A 2XPVA 2G0EA 4MFEA 2IBDA 3QYFA 3G71I 1VQMI 1QBJA 4IHWA 4UNOA 2X3UA 4M1KA 2HQAA 3JTGA 3E97A 1F43A 2BV3A 1WOPA 1OHHA 3F6OA 3DEWA 1SM4A 1WHUA 2W82A 3B02A 3WXMA 4RD6A 4Q7JB 2BEOA 3ZZUA 3W5HA 2ZZFA 1WGXA 3OW7A 1IXSB 2Z2SB 3HL2A 1OFLA 3L7WA 2VFPA 5DCMA 1KK0A 1CQXA 2OBPA 4PJNA 3K4LA 3SXYA 4XQFA 1T8IA 4KIGA 3AVTA 2ZTNA 3CPXA 3BPVA 5C44J 3VYRB 1VQPI 3J80Z 1W7PD 2HNHA 2YWFA 4BKXA 3ZBUA 2BM5A 1FIAA 2JWTA 4E0FA 2B7EA 2JRMA 3CCRI 4WK8F 4U7DA 2EFNA 1A6QA 4CSWA 4L5JA 1YIOA 1QUFA 2JJ2A 2BM7A 3TP0A 2B63J 4GGGA 1OMIA 2D45A 1GAQA 3HTUA 2FNAA 2K9LA 1V5EA 5B1AH 2O04A 4HOBA 1AWCA 3A8JA 2XUBA 1OCCH 5BQTA 4FN5A 5KAFC 4YAOA 4DK0A 3HSEA 3S16J 1TWAJ 3MAJA 2FQ3A 2LR8A 3LSTA 2XIGA 4LB6B 3ZGKA 3L2UA 1KQ8A 1VBLA 5E18F 4MLOA 1KJZA 5HLHA 3S14J 2X1EA 3MKYB 1K7AA 2LY9A 1R36A 4HZFA 2MC3A 2WB1N 3C7JA 3G6EI 2DMUA 4P25A 1SAUA 1XQBA 4UVAA 2A5YB 4Z06A 3CZ6A 3F72A 5K7FA 3A03A 3A01A 1CNFA 3BTLA 3FWEA 3HYIA 2COMA 1ODDA 1SC7A 4P6VF 4G5GA 1ETXA 2GQQA 4O6JA 5DDGA 1ZG1A 4HQMA 5DV5A 2V1XA 3ZOBA 4I2OA 1H8EA 1XCBA 1BOBA 2GJRA 2F5FA 1XG2A 3LAJA 1YIJB 2WY8Q 3IH2A 2R7XA 1NRKA 1WPKA 4JX6A 3V8JA 2BY2A 1XSDA 1AKHB 3GXOA 2K7LA 1GV5A 5ED4A 1WKMA 1N25A 2CWEA 2MYSA 3IH4A 1KONA 3HBLA 5EEHA 3CO7C 3EUAA 1R49A 3E6MA 3F6VA 2XAQA 3BDDA 3MKLA 5F27A 2DMNA 1T6XA 1UG2A 2DFHA 4WXCA 3DLAA 2F3LA 2DLLA 3QYEA 1U78A 4YALA 3BH6B 4Y4RA 4G7HF 2CQQA 4Z05A 4ENNA 2JMWA 3P9IA 1XS9A 3WY9A 3D5LA 3HKZA 4JRAC 1HKSA 4XONA 1JT0A 2R7TA 4TKOB 4RBOA 4CHUA 3FXRA 1VF9A 1N06A 1TBXA 1B9NA 4I0BA 5J8CA 1WOOA 1LLZA 1P4WA 3G4SI 1MJBA 2WV0A 2HI3A 3RIRA 2FF4A 4BEHB 4UUTA 3KYDB 3WODF 5D8LB 2QQ9A 2KZGA 1QRYA 3FXUA 4X0CA 2ZC2A 1I7PA 3JRFA 3I59B 2DO7A 4DNCA 2DPDA 5DYMA 3FMSA 1X1CA 3GTJJ 5BNGA 4OAZA 1EP3B 2DCUA 2XZPA 1R00A 2ISYA 2LF7A 3GTGJ 3C1DA 4U0YA 3L2QA 1OB5A 2FBIA 1XE1A 2QSHX 1VLYA 2D1HA 2BHZA 5LHIA 2F4OB 3MHPA 4CCNA 2DMTA 2ELKA 4IO9F 1TTYA 2VBUA 1IDJA 2HTJA 2YWGA 3BG9A 4HX7A 2R7SA 5M5WJ 4RLZA 5L46A 1ON1A 1JKPC 3K4JA 1NHAA 2IA2A 2QF7A 3PM1A 1OFDA 3MFKA 2YWEA 2XTWA 2A05A 1DU0A 1WWXA 4PFPA 2W7NA 3AVYA 3DXJF 2VKHA 5E20A 3J7YJ 3EYIA 3JR9A 3QP5A 4C0SA 1TNSA 1H9TA 3QPHA 4LC0A 1PUEE 4ESBA 3MWMA 3Q9VA 2LC2A 3GFIA 3GVAA 1IDZA 1TWCJ 2BVLA 3Q38A 1ETOA 3K2ZA 3CUQB 4LG3A 5GPCA 2DT5A 2NAZA 2UWMA 1Q9SA 3Q39A 4PC6A 3KETA 1F9NA 3BCAA 3GQAA 3VMVA 1LE8A 4ZYGA 2EFPA 3QPTA 4BHCA 1S5LC 2KIMA 3CDIA 1QGYA 3NAWA 2HEOA 3I54A 1EH8A 3G73A 2V9PA 5C3EJ 1O3QA 3ASNH 2VYQA 5CYVA 2EH3A 4DW6A 1YI2B 4CQJA 2FU4A 2FNPA 2LZJA 4EV0A 5LHGA 3IRQA 2ZNZA 2O8KA 3IKTA 1AIRA 2QGUA 3G71B 2CV2A 2KQRA 2YPRA 1B1BA 4HIZA 1M1EB 2MC4A 3LA7A 1USTA 2KJCA 1DDGA 3TW7A 5IYBJ 1QZEA 1TUIA 3B8YA 5HLTA 5D5UB 2IS1A 4BUPA 2E1OA 1B72A 3RYPA 1EFRA 4RDLA 3CDLA 5HDKA 2PI0A 4Y33A 3JTHA 5KAIC 4XD7A 1EA0A 4ZJZA 2NS8A 2KFDA 1VQPB 1BW6A 2QMUA 2H6CA 3CC4I 4KKUA 1MNEA 2LMDA 5B3SH 1I27A 2L7KA 5H59A 2BM4A 2KIFA 2CBXA 1KQSB 1VQOB 3KIOA 1VQ4I 2ZL6A 5IYRA 4XR6A 3EUHC 2DAOA 2ISZA 3QYBA 2MW8A 1IN7A 1YRNB 4A0YA 1FJLA 3W2FA 4W1UA 3BP8A 3W5UA 5IT9K 2KT0A 4WWVA 1VQ8B 4XICA 2KLOA 3BY1A 1G4DA 3HXLA 4OIPF 3MCAA 5B6IA 1VQ7B 4HF0A 5HS7A 4ON0A 1MMGA 5EG0B 1HG8A 4IX7A 1Q81D 4FT8A 3BCDA 5CKTA 3HTSB 2IEKA 3VYTB 2OF7A 1T6YA 4ZCIA 4ACBA 3BQZA 4II3A 1IN6A 3JRAA 2OD5A 4JMQA 4HPQA 1RIOH 1K78A 2IGKA 1STZA 1YHQI 4YG2F 4I84A 4FE4A 2CUEA 3AG1H 2EIMH 3HUGA 3C18A 3T5XA 3VPRA 1D2EA 1BR1A 2IP2A 3LFKA 4W8SA 1BI1A 2O03A 1L3LA 1FSEA 3LNNA 4BDZA 2BGJA 2VJJA 2NVXJ 1DGWY 5JI6A 4HDVA 1XC5A 3RYRA 1GHCA 4RPBA 2X85A 2V9KA 2X8KA 4M9XA 2HDDA 2NV4A 1QVTA 1RPWA 2VQCA 3WTXC 1VHOA 4Q5SF 2K9SA 3RKXA 3OR2C 3SDBA 4UZEA 2DT6A 2XB0X 3ABLH 1KU7A 3DBHB 4Y13A 2DT7B 2VQGA 2F2EA 2ICWG 2CNDA 2Z99A 1VTNC 4RCZA 2BN4A 2BYVE 2MLGA 4QUZA 4Z4ZA 1E2XA 4U87A 3OE7A 2VC1A 4M9ZA 5DS0A 1EA3A 4X0GA 1LUJB 4G7OF 2DQLA 4JQFA 4NBQA 2FRHA 3BTCA 3CP8A 2O3FA 3HGYA 4LK0F 1SVOA 4OPVA 2K40A 1G7RA 1P4XA 2XSDC 1YS7A 2X6XA 3CCSB 3QFTA 1W35A 2DOFA 3QWLA 1FNMA 4KNYA 5A88A 2V7WA 5IPAA 2AS5F 4ASUA 2Q6OA 2EZKA 1ETQA 3CTAA 1B8IA 3QFSA 3IWFA 2VBYA 1S3JA 3QRFF 4AF7A 3VWBA 2NNYA 3GVKA 3PSZA 3HRSA 4GRIA 1ZAOA 3GMEA 4QLCU 1UFMA 1IN5A 1DP7P 3DU5A 2ZBUA 4HA8A 3OYMA 3BCFA 1IA5A 1J75A 1T39A 3HHGA 3ELKA 4XLEA 3M4OJ 3QPLA 3V42A 5F4JA 4DNRB 4XRFA 1ZRFA 2O0VA 4LG0A 3GRHA 3F21A 5JMCB 3VEPA 3QODA 2H8RA 2L3DA 1BX0A 2J8KA 4BJTA 2VE9A 2QLZA 4RGUA 5EG0A 2GREA 2A68F 2OK8A 2ZJQF 2DA4A 4YFOA 3R0AA 2BY3A 4F93B 3AG3H 1UD4A 4C2UA 1QA3A 1KC8D 2HQ5A 3Q5FA 1KK3A 4A3BJ 3RY8A 2VBMA 1S72B 2M0CA 5L3EA 2KDOA 3K1PA 1A35A 3WNBA 1H89C 2O5RA 2Z5UA 3J7AY 3I4NJ 2Y9ZA 2YUHA 3DKYA 1IJWC 3SQNA 4D7NA 3S3NA 4YAWA 2DOEA 3K10A 1YYVA 1ZLKA 3OW2B 1BA5A 2KVOA 3NAUA 4YELA 2Z1DA 3BR6A 2KHMA 2V1UA 1HOMA 1S8NA 1ETWA 1W2BB 2CGPA 2XTYA 1B72B 1EF4A 4A3MJ 1Z0XA 3HOSA 2Q8KA 3ERED 1D5YA 1MBEA 1HLVA 2VNKA 5IY5H 2D3NA 1YQAA 1LDKB 3DTKA 1SKQA 1E3PA 1HW1A 1IRGA 1E3HA 5GADJ 2R7UA 2L02A 2X6OA 3NARA 4IQJA 4Z4SA 1DU6A 3DKWA 3LYCA 3OPOA 5J4YA 1QZZA 4DGWB 3LSGA 2X9DA 4EQQA 3IAM2 1R5BA 3DF8A 4RGXA 1PLUA 1XTAA 1FBSA 3Q6RA 1IAWA 1BMFA 2WA0A 1ZK8A 1VQOI 4KFCA 1Y1VJ 3T8TA 3V7SA 1FOXA 3I55B 3DEUA 4M3DA 1HDPA 1MBKA 2DA7A 3I4PA 3PL8A 4FK8A 3WTWC 4EM1A 1Z77A 4P9FA 2YU9J 4AVPA 4EJOA 1WJAA 3JSOA 2QSGX 4AIDA 5EGOB 3H09A 5EF6A 3CJQB 4ANJA 5F0HA 3I5UA 1YX5A 4L5EA 4HSTA 4S05A 4B3GA 2VIXA 1P2FA 3K1MA 1X1AA 3CLQA 1UD2A 4ABZA 3M9AA 4IOCF 1DDNA 1QA6A 2HCJB 1W36D 4XM3A 5TJJA 4XLCA 3ZQ7A 4X07A 1IO2A 1CF7B 3WTUC 3WU0A 3QSYA 2E7WA 4F91B 3W2AA 2RNGA 1ACIA 2W57A 1MMDA 2QKMB 3H9GA 3JCUC 2P5LC 1ZGAA 4A3CJ 4Y52J 5CVVA 3B82A 1IW7F 4AWXB 2VASA 2XAHA 4NC8A 4V2GA 2CU7A 2BGCA 1W9XA 4Z1MA 5JLVC 4PJ0C 2I5UA 4V02C 2DA6A 2E1MB 4R1HA 2VPRA 2XT4A 2ZZQA 4CO8A 3HSRA 3KLOA 1GUUA 2BHYA 2JSPA 3NQOA 2V6CA 1XMXA 3PUFA 3K69A 3R4KA 3RQIA 3TP3A 3RJPA 6PAXA 3GZ5A 4PC3A 3T56B 1C0WA 2XNCA 2OTJI 1BJAA 1EH6A 3KFWX 3PQKA 4NNJA 4DNTB 1PVEA 1MGTA 2EILH 1I1GA 1CF7A 2ID3A 3ZMDA 5IP7J 3OYHA 3VMWA 3H1CA 1QQ1A 1XFOA 2MD0A 3GO5A 3GIRA 1K6OA 1M1KD 4BQAA 5IYDJ 2XGDA 3P9CA 2VBEA 1HSJA 3H0GJ 2VBVA 2PECA 4BQQA 1GVJA 2CK3A 2GIZA 1RKWA 1UELB 2W1OA 4P1WA 3RZDJ 3WTSC 4DQKA 2WJYA 2ZXJA 3QQAA 4ESFA 3JRIA 2IRFG 4HX4A 1MH4A 1MDMA 1JJ6C 3VO1A 5LHHA 2HWVA 4XKVA 5LEKA 2NT9A 4L18B 5FD6A 5HXBA 3KP6A 1PE9A 3HRUA 2L9SA 1AKHA 5B5EC 4ZTJA 4ZGQB 2WZNA 4FX0A 2WAEA 2JJ7A 2UXNA 1KQ9A 3CUOA 1Z1DA 2RREA 2QQBA 2VBTA 3S3OA 2XV4S 1O8DA 2NTBA 1UD6A 3DU6A 1K5CA 4QPQA 4UUSB 2QX3A 1RU4A 3HRMA 5CPRB 2Q1ZB 3CF5F 1W5TA 3VFZA 2BMWA 4XKBA 1IDKA 3F8BA 2H1LA 3PUNA 3KEYA 2VQHA 1PJ7A 1OPCA 4BAYA 1OCTC 2QVOA 4YIIA 2HS5A 5M5YJ 3A3BA 2R7FA 2LSOA 1E1RA 2DK8A 4ZH4F 2V7UA 3B8HA 2M7BA 2V4JC 1GVDA 3S1NJ 4B43A 3SQVA 2KL4A 4MIMA 2QEXB 5JVTA 1PP8F 1YJ9B 2XEXA 1J5YA 1JRGA 1LFBA 2KP6A 1D8JA 2OPTA 1TC3C 1KYZA 2KRFA 4QV2A 3FKIJ 4MTDA 1KYWA 3M8FA 2ZJRF 1LFUP 3I1FA 1ZYRF 4CCOA 2NVTJ 2VBSA 2LG4A 1OCRH 5EMNA 5IYWA 4TMXA 1MBFA 1MMAA 4P12A 4DQLA 5DM7F 1K73D 2NZMA 2QZAA 4MEXF 1N75A 2CG4A 3JRGA 1WSVA 2DI3A 4OOXA 1CGPA 3KX2A 5FB2A 2DXIA 1KTWA 3L2CA 2DPUA 5DN6A 1G3TA 2VPLA 2VT2A 5IYNA 2JUGA 4I99C 3MMPA 4OP7A 4HG2A 4FQGA 3JAMZ 2HOTA 3VSTA 3H3VK 2XC1A 3EDPA 4DQ2A 3AL0C 2XHKA 4XIDA 5M5XJ 4EJVA 4ZCMA 4HE6A 4M71A 5DUKA 3KP5A 2P5VA 3VDXA 2V1DA 2ETHA 4WXHA 5A2QZ 1FPQA 1KU2A 5KSWB 2R6HA 1LLWA 3JREA 5KW9A 4YC5A 4HYEA 4CYDA 4QHYA 1V55H 2KIQA 2NVUB 1FNCA 1N77A 1IZ1A 5ILUA 5HDNA 4W8TA 5D5XB 3BH4A 1POGA 3R6JA 3S8PA 4BS9A 3LAPA 4N9IA 1Z05A 3ZQQA 2OK7A 3GX4X 5ILSA 4KN4X 3ZMUA 2XKPA 3WG7H 4KA4A 3MZ8A 3CMYA 2RDPA 2FA5A 2LF8A 3ZMVA 2DMPA 1ZR4A 3MCZA 1DUXC 3DEEA 3ZRGA 2Y69H 1JTYA 3S1MJ 2QN6A 1U9NA 2STWA 4A5NA 3A0HC 2ECBA 3WGIA 5ICCA 1JKRC 1IC8A 1O7LA 4I76A 2NOGA 3J80K 1O88A 3AG4H 3VYSB 3WBJA 2P4WA 4NC6A 3VNVA 3FKSA 3W6KB 4JX5A 1I50J 1LJ9A 2A6EF 3RSNA 4KUMA 1T56A 5ICEA 4XK4A 2LYCA 1U8BA 3BJAA 2D5VA 1FSHA 3OKXA 3QOEA 1MZBA 4KITB 3J7AO 1DG1G 3FX3A 1EJ9A 2CUJA 2C5BA 1FBQA 4WX9A 1EXMA 5F1JA 1E3XA 1HZEA 2BM1A 2G7UA 4E4HA 4TMZA 4I02A 4YXWA 3D5SC 3ZQLA 1UD8A 3WTZA 5TR9A 2V26A 1JXSA 3F8NA 2O9LA 3FBNB 2LFBA 1HXDA 5DD8A 1KRHA 4GQNA 3H92A 4QSHA 1MJ9A 2FX0A 2FX3A 2LY1A 3Q3SA 4LIUA 1R5HA 4XKWA 1ZG3A 5ERIA 3Q0UA 1O3SA 1YW7A 4Z4RA 4JOMA 5H6RA 3M07A 1JKQC 5BPDA 1E3ZA 1X3WB 5DUIA 1OGIA 3OZVA 2LBFB 2GJPA 3GQ7A 1NB9A 1ZLJA 2M8EA 2VODA 2WAFA 2IXSA 5H6QA 1JE8A 4C2LA 5HLGA 2KMUA 1A5JA 1YLFA 2F5DA 4UB6C 2LP0A 2OBSA 2FBKA 1JTXA 2B7CA 4AYBN 4YHBA 1RKTA 1K61A 5FJ8J 3SEQA 2FSWA 1I39A 4NK6A 2C4UA 2CO5A 4H0EA 2Y0SA 3OYAA 3RZOJ 2HVRA 3SFIA 4MR0A 4YZAA 3S1QJ 1A8PA 2GJKA 1SFXA 4OPOA 4URRA 1N0UA 1VI0A 2PMUA 4HLXA 3L2WA 2DBBA 2EA4A 4XN0A 4RD1A 4DK1A 1H80A 2X51A 3OOCA 3U1DA 3RIQA 5C1CA 1QO0D 3GZ6A 3R60A 1XX5A 3NWTA 3DP7A 2HVSA 1TNTA 4Q4ZF 4YIFA 1DPUA 3PSSA 2C4TA 2JA8J 5IP9J 4Z4WA 2DEUA 3OIQA 1MW7A 1BI2A 3I0TA 4R71A 4IQ4A 3RPUD 2NOJB 1IHMA 4BDYA 2FMLA 1E43A 4KKSA 5HOOA 1ZG5A 4TMWA 4EGZA 3OV8A 1TVCA 1KA8A 1W5CC 2E5ZA 4J01A 3WQZA 3OP1A 5ICGA 3OYNA 3EUKL 2ZO4A 1DARA 2Y9YA 3QU6A 3CD6I 2XPUA 5DEQA 4QVJA 2Q2EA 3PUBA 3ECOA 1G3YA 3I9V2 4PFOA 4RAFA 4RJLA 1FWZA 3CLOA 2ZXHA 4II2A 2O61A 4U0WA 1RUOA 3F8MA 5JLXA 1LE8B 2VJ4A 1VQ4B 2D3LA 1XDUA 1XCVA 3C2HA 3PNVA 4MEYF 5K1YA 3AG2H 3GTQJ 2NPFA 3AVVA 2WY7Q 2BXZA 2LTPA 2XB5A 1Y0UA 3VMFA 2PJPA 5BOXA 1W4MA 1VQ8I 1HC8A 4G7ZF 3ZQIA 3WU1B 3S17J 3GLLA 5IYCJ 1T33A 3GFMA 4B09A 2VN2A 3AFHA 1IB0A 1Z67A 1U2WA 3P9KA 1EKEA 3J81k 5E6TA 3ABKH 3KP2A 3GEZA 1IV8A 2E1NA 3K70D 2JT1A 1BR4A 4S04A 2WR8A 3VSLA 2UUZA 1T08B 1Z6RA 4RM0A 4WZKA 3OJWA 3TOAA 3OOUA 1LVKA 3H3ZA 2CYYA 5GPAA 2RNJA 2YUSA 2X4HA 4XNFA 4OIQF 3OOPA 2OV7A 3FHZA 2ZSIB 1MSEC 2NTPA 2VJIA 2YX7A 1J7KA 2PBIA 5DD4A 4L9TA 3TO7A 1A31A 3CJNA 1FEXA 3HAGA 2F48A 2M1BA 2ME0A 3K9TA 4EATA 2L9RA 3P7NA 3OWTA 2X48A 4AM3A 5EEAA 2NXNB 2WPDA 1K78B 4FETA 3R0JA 3F3XA 3CC2I 3EQLF 1Y8QB 5FGMA 5JVGF 2ZITA 2Z3YA 4HQEA 2Z9OA 5FRMA 3RQ4A 5L3FA 2MH2A 4OJPA 5J6XA 3HOXJ 1QHGA 4I09A 5D4RA 2EA2A 1Y0RA 2ZCWA 3ZQCA 1MBHA 1WJEA 2CQ7A 3BC9A 4PC1A 3LQQA 2EFQA 1W34A 4YDTA 5IT9Z 1XMKA 2XNJA 1W7PB 1Y8RB 1NB0A 4L5IA 1YITI 2A6HF 1RMGA 1MD0A 4GYIA 1EFCA 4Y17A 3GW2A 1OYIA 5TGTA 4LMYA 3CCYA 4E7HA 1YE9A 1D1BA 3V7RA 5LRRA 4M0LA 1NG7A 1R6RA 3OFNA 1IUFA 5E1WA 5J35A 1J0RA 2VQLA 4IJAA 4PJMA 2ME6A 4X6AJ 3CMMA 3ISXA 2LDUA 3PSFA 1MNDA 1T38A 4UHTA 3HHHA 1IJEA 1QCXA 1R1TA 3CO6C 4G1BA 4HNVA 5CQGA 1RETA 4IKFA 1OYYA 1N07A 1LVAA 2LOOA 3GLXA 1T6ZA 2BW3A 1UMQA 5DNSA 4RB3C 2J5OA 4RGSA 3SZEA 3X2QH 3WYAA 2XAJA 1VQKI 1O8LA 2VFOA 4NB5A 2W48A 1J9IA 4P5OA 2CV1A 2STTA 1VQNI 3DBLB 5CVJA 5IK2A 1Y56A 4B48A 3CDHA 1O8KA 2K9NA 4IHYA 4OINF 3GVJA 4GXOA 3DBRB 3VSKA 4M6YA 1D8TA 1LKXA 1TYXA 3M8JA 1COWA 2OCEA 4NDLA 3L1PA 3GFJA 1BR2A 4P96A 4ZZLA 3RTRA 3ZZ0A 3DTIA 2E1CA 2K02A 1E3OC 3CUQA 3CCUI 2K9QA 4CH7A 2FEZA 1CZFA 3OMYA 4LOCA 2XGJA 1PJRA 2BXYA 5KCMA 3B6CA 1IF1A 1JB9A 3S3MA 3B4NA 1V5FA 5KVRA 3EYYA 2IAIA 3SEJA 1W5SA 2DOGA 4GO1A 4MHGA 2M45A 3WWGA 1R5OA 2R7OA 1QG0A 2VNJA 4X05A 4DYQA 3ZBTA 2CC2A 3LA3A 2I1LA 2R7VA 2E71A 3KP4A 1FNBA 1KZLA 1Q82D 1K28D 2L01A 4IEJA 1D8KA 1SFEA 3KPHA 2IW5A 2YX4A 1D1NA 2DJIA 2NSTA 1S0UA 3BR2A 1TTTA 3VNUA 2W7ZA 1Z6TA 1BC7C 2XZOA 3CPWB 1V4RA 2TDXA 1BX1A 3Q3AA 3I64A 5BS6A 2D2WA 2DYRH 3TDZC 4OPWA 3AGPA 1ETVA 4Y15A 1TYWA 1UD5A 4NUBA 2PEXA 4HLYA 1U2RA 2V31A 4P2NA 1PUFB 2E2IJ 2A61A 3CMEB 4ZGNB 1VZ0A 1D1CA 1RC9A 3BY6A 3EPZA 1U0JA 5ILVA 4RM3A 3S93A 2UZKA 1W0UA 2DCEA 2BM0A 3ZN0A 3HOWJ 4J0QA 2IS6A 2E1BA 1R9TJ 4DBRA 3ABTA 2OUMA 4BEHA 4KMUX 3QPSA 3PO2J 1X3ZB 1YG2A 5FO5A 3MN2A 3BT9A 1QGZA 4HEA2 1O8MA 1W0KA 4UB8C 2IJLA 2R0QC 1BPLA 5E3MA 4OAYA 3E6DA 3GWZA 5HLIA 3F8CA 3HOZJ 3SZGA 2MH9A 2RV8A 2LVSA 3PFIA 4W97A 3HM5A 2H1KA 1T95A 3IV5A 1G8XA 2OTLI 2OJED 1S72I 1Y6IA 1ON2A 4NQWA 3TW6A 2OYNA 4XSXF 4M73A 1IB4A 2NSPA 3Q6QA 1Y0YA 3JW4A 2CMPA 3PO3J 2M87A 3SYTA 3W2VA 4B1RA 1UJ8A 3SJMA 1P7IA 1E1QA 1QRCA 2AHOA 1O57A 1W7PA 3J81Z 2XOKA 2WAQN 1Z3XA 4G7WA 2I10A 4LG0B 1ZRDA 1G7SA 5L3BA 2ZJ2A 3KYCB 3M3YJ 4CDGA 2F4MB 4E7ZA 4BGDA 3T9GA 2WTEA 4PJJA 2NT6A 4D5CA 5CVIA 2GWRA 1XGMA 1VQLI 2OZUA 1KTVA 2VUMJ 2IA0A 1B9MA 1MMNA 1WH5A 1BJZA 4L8JA 2C78A 4TSFA 4ZZDA 5F4OA 2JN9A 1APLC 2XRLA 2OTJB 2PYGA 1I3AA 2JVGA 3ASQA 3ZZTA 2G0YA 3MKWB 3Q0VA 5E3OA 4KT5C 2XSJC 3QFRA 3KEOA 4M3BA 4PSXA 3T0YA 3TO9A 4QTRA 1YJWI 3U9GA 1WXRA 2DW4A 1NTCA 1RI7A 4HRIA 3FBIB 2PN6A 1JHFA 2QUFA 3H9JA 3KZIC 3HOYJ 2O7OA 1B2RA 2CW8A 3OZWA 1OOCA 2F6CA 1D0ZA 2O8XA 4P22A 4YFXF 2HQRA 2VBKA 2OAZA 3FM3A 3GF2A 2VNHA 2Z6BD 2F5VA 3B6AA 3V8LA 4AUXA 5FKKA 3TEDA 2OU2A 1EWYA 2R5ZB 2RC6A 1BBYA 4OJOA 3VODA 4F55A 3BG3A 2BSAA 1YITB 2PMZA 3ISPA 4I01A 4JYKA 1SFUA 1A6IA 2KISA 3I58A 5B66C 5LGNA 2E2HJ 4BY1J 4A3JJ 1PJ5A 2WB1A 2M8GX 1FTTA 5AIQA 2EZHA 1WJBA 2AXTC 4A5MA 2W4SA 3F23A 1H8HA 1WJDA 5DS9A 4UAJA 5M3FJ 3O6BB 3GTOJ 4B3AA 1VF7A 4AF6A 3GTKJ 3TBIA 1WH7A 3HOTA 2EQRA 2HMAA 4B3FX 1RESA 3K0LA 1I6HJ 2L4MA 3E5QA 3HIFA 1OKRA 2OA4A 1P6RA 3S2HJ 3U6KA 2KIUA 1R23A 3FZVA 3REOA 3WTVC 2A6TA 1S7EA 1TT0A 2WJVA 1JJ2B 4IHVA 2DJNA 5LBQA 2BE5F 2XPWA 1PXZA 2JSCA 2UVEA 1VQMB 1J09A 2VFMA 2E5NA 2GA2A 1XMAA 1WI9A 3F9KA 3FXOA 3FPKA 3AVXA 2O17A 1T6SA 1FYKA 5C4XJ 4D5FA 3S32A 1FP1D 1AIPA 1R1VA 4Z2YA 3KP7A 4ZYHA 1B8IB 2R93J 1L0OC 2XROA 4FASD 3HKZN 1IXCA 2DTZA 1ZR2A 1YJ9I 1J59A 1XDSA 5IOYA 2QENA 3DWLE 3PNYA 4E7SA 4A12A 2ODLA 4HF2A 4HBLA 3CCUB 2INVA 3CCJB 5AMVA 3JSPA 2RAEA 4BHBA 2INUA 4KH3A 3ABUA 3H9QA 4OOVA 3FDYA 1H85A 1RQPA 4ROXA 3F22A 3CCRB 1YJNB 4FE7A 2JPBA 2QDXA 5LEJA 5FNZA 4CCMA 2EWNA 3PIPF 4IHTA 5E8IA 2KRCA 1MNMC 5IYQA 1KCCA 2L5QA 2E7XA 5F08A 2ZKZA 1K4ZA 2X53S 3DCFA 1OR7A 3SFZA 1SFOJ 1X0CA 4QFMA 3BG7A 1NDHA 1WPCA 3OSFA 2CFXA 3NE5B 4XLNF 2O0WA 3LQ6A 2K86A 3TMOA 4RDUA 2DDAA 2EFWA 3LMWA 4EJUA 2E19A 2NVYJ 3I56I 1QH0A 4LBYA 1MKMA 5L3GA 1ZTRA 5FLVA 1VNDA 1FT9A 4M9SA 4RD2A 1YLOA 1X4OA 2AXLA 2W85A 5AN9A 2CQKA 4BH9A 4CGZA 3FXKA 1U5TC 4IRIA 3FY3A 1DP3A 2QBYB 1G59A 4RD0A 2OQGA 4Q48A 2IPQX 2RC5A 1HVXA 4DOZA 3LA2A 3TO6A 2K85A 1V0EA 2Z16A 4OJ6A 4XLPF 1YIJI 3IP4B 4U0VA 2F4IA 4XLFA 4XRSG 3OL3A 1CNEA 3JX8A 3K1NA 2WWYA 4LLNA 1QFZA 4A69C 1ETYA 1GLNA 5CDFA 3CC4B 2BM6A 3GQ9A 4L9JA 4IXAA 1K4TA 2FOWA 4OMYA 1QU3A 3CW2A 1MBGA 4XOPA 4ZC3A 1FMWA 4DYCA 3M8EA 1Z3YA 3JRBA 1PP7U 1VQ9B 4XL9A 3TGNA 4HV5A 4Z4VA 1TLLA 1G3WA 3BQYA 4HW0A 4CICA 4V19K 5THXA 3OYIA 1T98A 4YFKF 2P3MA 3GUDA 2ZNYA 4A3DJ 1QJVA 2V7FA 4HF1A 2MBFA 4CUGA 2FXAA 4E7IA 1U5TA 1ITYA 5A89A 2CW7A 2VKDA 1WVRA 1KK2A 1JA0A 4EW9A 4K1XA 3D1NI 4X8IA 2EV0A 3FXJA 2R3SA 1P4MA 1K8FA 1XSVA 2HZTA 3UNGC 2XT2A 4NBSA 3HEFA 3MVPA 4P26A 4Z4YA 1YHQB 2R5YB 2GBYA 5GP9A 5D6FA 4BXUA 2ZXWH 3AGQA 3VB2A 1P7JA 2ZZGA 1K4SA 1WP6A 1BI3A 3ES9A 2QA4B 3PSIA 2NRAC 5JHUA 3FXQA 1BOAA 1R7JA 3QE2A 1WJ5A 4PDKA 1FDRA 1EH7A 2F4NA 2EINH 2HTSA 2VXDA 2JIZA 4PSWA 4UUSA 1WCMJ 3RCOA 3ABMH 3ZPLA 2EIXA 3HOUJ 4UV9A 2HKXA 3HZJA 4ZDLA 2DFEA 1R71A 3FHNA 3G1MA 3BPXA 3JAMK 1XB4A 3QU3A 3U2RA 4KJZA 3WNCA 2ESNA 2JA2A 1QVUA 2RGVA 2EB7A 2TCTA 3G3ZA 1X1PA 4EGYA 2EBIA 3ZN1A 4XOTA 3DLLF 4A93J 5KHDA 3QFCA 2K3PA 4RAGA 2GPJA 3IL2A 2PMZN 2P0WA 4B44A 4YAFA 3BNWA 3E20A 3GBGA 4FXUA 4I0AA 2DOAA 2N8GA 4M72A 4D7MA 2QTZA 1YX3A 3SYJA 4HNUA 5EJCA 1QVGB 2H8WA 2OCCH 2Y2ZA 5J4VA 5FLXK 3KL9A 2MLKA 2YSRA 4L9VA 4CZCA 2LNBA 1R5NA 5E17F 2DA5A 4YRVA 1WTHD 3E6CC 1H88C 4KKTA 4DBQA 3GCMA 1J9ZA 2YU3A 2VB6A 1I18A 3GTMJ 4IW3B 2IT0A 1DDIA 1GAWA 4PZJA 2P7CB 2HQNA 3PA1A 3N97A 1BN8A 1R22A 2LK2A 4BJ6C 2QQ8A 2D74A 3H9NA 2J8IA 2QZ8A 3CJRB 1JTAA 1XD7A 1BIAA 4RAYA 4LB5A 1V5GA 4PGHA 2XASA 2CSOA 4RPDA 5F6FA 1IV6A 3IH3A 1B4AA 2DODA 2CW0F 2GXBA 1HA3A 1HW5A 3BZ6A 2Y48A 1OCPA 2GLOA 5E3NA 5K5QA 3L9FA 1FYLA 3BROA 3N90A 1SD7A 1TP4A 3GZNB 2C77A 1K8AD 3K70C 3N6ZA 2ADUA 2HPIA 2VL8A 1EFTA 3JRCA 2LD5A 1REPC 3BJ6A 1MH3A 2B7BA 2CQNA 1KZHA 3CCVB 3FK6A 1YJNI 2H94A 3D26A 2E34A 2KZVA 4A6EA 1JJ8C 3ULQB 1G7CA 2Z33A 2EFGA 3CCEI 1QHHD 2B5OA 4MQVA 4J00A 3DQVC 3E1SA 3PETA 1WQ2A 2HYFA 2YS9A 4MTEA 1MDMB 1EV7A 2RQQA 5CQEA 1ZKGA 3BTJA 4G12A 4A3EJ 1U8RA 3ZPNA 3UKGA 1DBOA 3OYDA 4N0BA 1U5TB 2BZTA 2X0LA 4NK8A 2IGOA 1W36C 2X1DA
chains in the Genus database with same CATH topology
1O8HA 3H35A 1S9HA 2ELJA 3K70D 2R9VA 2KLOA 2M5SA 3HXLA 1BR4A 3VSLA 1MMGA 2UUZA 1D0YA 3T53B 2PJRA 4IX7A 1HG8A 3BCDA 4C9YA 2CV0A 5CKTA 3OOUA 4DIQA 1LVKA 5FROA 3VYTB 4II3A 4CCJA 4XNFA 2CS3A 4HWVA 1OFMA 2OV7A 3L2VA 4JMQA 2ZSIB 4HPQA 4C30A 3SEZA 2IGKA 2VJIA 2NTPA 3B90A 4I84A 2L9NA 2F43A 5FL7A 3GVLA 3HAGA 4W8SA 1BR1A 2ZXIA 1KMHA 4EATA 1EE6A 3GQ8A 3OWTA 3A3GA 3LNNA 4BDZA 3VSVA 3K4KA 2VJJA 2QY1A 1DGWY 4N4NB 2V1NA 4FETA 2QE7A 2JVHA 4OZZA 3LSHA 5LD2C 5FRMA 1X1BA 2X85A 2V9KA 3RQ4A 2X8KA 4OJPA 3OL4A 1QHGA 4CCKA 2VQCA 2WAQA 4BE1A 2IGMA 4RLFA 2PJRB 3OR2C 3SDBA 2DT6A 1WJCA 1WJEA 3L2RA 3BC9A 2DT7B 2VQGA 2ZZEA 1V0FA 4U87A 3OE7A 1RMGA 2KPMA 1EA3A 3T9GA 4X0GA 2GOMA 5TGTA 2WSSA 4E7HA 1YE9A 1D1BA 1NG7A 4JQFA 1R6RA 4CA0A 1MABA 3OFNA 2PYHA 2VQLA 4PJMA 4G7XA 3CP8A 2BOLA 3CMMA 3OS1A 2M0MA 3K4BA 4BE2A 4U49A 1K6YA 3PSFA 3ZSCA 1MNDA 1QCXA 3FPPA 2W6JA 5CQGA 2X6XA 4IKFA 4W8QA 2LOOA 3LMMA 2BW3A 4BE0A 4BQOA 2Q2EB 3C2GA 2R7RA 2WADA 3OEHA 1O8LA 4MXNA 1AA7A 4ASUA 4XKCA 1DQUA 4P5OA 3OYKA 2CV1A 3VWBA 3GVKA 4XMYA 4GRIA 2QKLB 2CUZA 2HDWA 1Y56A 3DU5A 5IK2A 3OYMA 4B48A 1O8KA 2ZSHB 3BCFA 3GVJA 2HU9A 1IA5A 3VSKA 2V7QA 1LKXA 4E7LA 3M8JA 1COWA 2VXZA 2XC7A 4XLEA 3OAAA 3IAS2 3V42A 1UAAA 4DNRB 1BR2A 3RTRA 2O0VA 3GRHA 3DTIA 3H94A 3VSUA 3QODA 2AQFA 3G2BA 3NWSA 4LITA 4CH7A 3OMYA 4BJTA 3OYBA 1PJRA 2HLDA 2XGJA 1CZFA 4OZYA 5KCMA 1DBGA 3S3MA 3B4NA 1V5FA 1E79A 4D9JA 4F93B 1UD4A 4W8RA 4PK4A 4C2UA 2XZLA 3WWGA 2VBMA 2R7OA 5HNHA 2KDOA 4N4OB 2O5RA 2R7VA 1PYVA 1KZLA 4KISA 1K28D 3JURA 2XAUA 2R7WA 3J7AY 2MFZA 3DKYA 4PUSA 4F92B 3JU4A 1FMVA 2DJIA 3S3NA 2NSTA 4DJAA 3W2WA 3TL4X 3K10A 2KVOA 2EWEA 2XZOA 4YELA 2Z1DA 3AKZA 1OB0A 2KHMA 2XF5A 3H5NA 1WFXA 2LRDA 1UD5A 3M1CA 4NUBA 2V31A 1KCDA 2LH9A 3HOSA 1VZ0A 1D1CA 4ZDOA 4E6KG 3EPZA 1U0JA 5HKKA 4RM3A 3S93A 5HVQC 2DCEA 2XDVA 1Z7LA 2D3NA 1E0EA 1LDKB 3DTKA 4OJ5A 2IS6A 2E1BA 2HVQA 4DBRA 3T51B 2BVMA 2R7UA 3E0JB 2OUMA 4BEHA 4IQJA 4ZYAA 2K9MA 3OPOA 2BSPA 4DGWB 3LSGA 1D1AA 3I3LA 3IAM2 4HEA2 1O8MA 3W3CA 3OR1C 3DTEA 1W0KA 2GK7A 1BPLA 3A2KA 3VR6A 1PLUA 4NC7A 4OAYA 3ZXSA 2E60A 3SZGA 1BMFA 2WA0A 4PMHA 2IGNA 4AVZA 1T95A 3PL8A 1VJSA 1G8XA 3K4NA 1Y6IA 3BG6A 3MMYB 1IB4A 1WJAA 2NSPA 1X19A 3OYCA 2CMPA 1T5EA 3CJQB 4ANJA 3OYEA 2E1MC 4YZ0A 1YX5A 4HSTA 4B3GA 1BLIA 2VIXA 3SYTA 3W2VA 1X1AA 3LSKA 1E1QA 4B47A 1UD2A 4NQWB 3OS0A 2QXZA 2IS4A 2ZTGA 3OEEA 2XOKA 1IRXA 1W36D 4XM3A 1Z3XA 4RLQA 4XLCA 4G7WA 4R79A 3KRGA 3DPUA 4XLAA 1I8DA 4F91B 3HPHA 4E7ZA 4IZZA 4BACA 4BGDA 2RNGA 3W2AA 1ERDA 2ZFUA 2WZPP 1MMDA 2QKMB 3H9GA 4PJJA 2VLAA 3G05A 2NT6A 3KEWA 4ZTFA 2FUG2 2DIEA 4RMNA 1UD3A 4OJLA 1MMNA 2VASA 4NC8A 4BQNA 1W9XA 4L8JA 4Z1MA 3BCBA 3ZR8X 4TSFA 3UW0A 3EQOA 1Z21A 2PYGA 1OGMX 2JVGA 2E1MB 3H5RA 2ZZQA 3MKWB 1T0FC 2A5WA 2JSPA 3H0DA 2XSJC 4U7BA 1HA8A 4PSXA 2XNDA 3T56B 2BW3B 1O8FA 2GOXB 3IUOA 4HRIA 3FBIB 4NNJA 2OC6A 3H9JA 1JI8A 4DNTB 4EW9A 1OOCA 2CW8A 4BU2A 2F6CA 1D0ZA 5HNFA 4P22A 3OYHA 3VMWA 2VBKA 2XF7A 2UVFA 2Z6BD 2F5VA 2MD0A 4XLHA 4YZQA 3CESA 4OJOA 4F55A 2K5CA 4RM2A 2R7QA 4ZDPA 2NTQA 2PMZA 4Y3OA 2VBEA 2PECA 4C2TA 4BQQA 1X1DA 3ONQA 4CCLA 3CF2A 2WB1A 2CK3A 3DDYA 2CH0A 1O8IA 1WJBA 1H8HA 1UELB 2M3AA 2W1OA 2W4SA 4P1WA 1WJDA 2WJYA 3GQBA 4YZXA 3PFYA 1VF7A 1O8GA 3ZIAA 2X6YA 3SUCA 3TBIA 3HOTA 4B3FX 4XKVA 2AQEA 4PJLA 4OWRB 1SKYB 2NT9A 1NBMA 2WBMA 1WMRA 1PE9A 2L9SA 2LBFA 4BL0B 2A6TA 4ZTJA 1TT0A 2WJVA 3LFUA 2WAEA 2UVEA 2M4GA 3DPLC 3LL7A 1LFPA 2RREA 3KYLA 2NTBA 3S3OA 2CFOA 1O8DA 3AL0B 1UD6A 3DU6A 1J09A 1PXZA 2E5NA 4QPQA 4AU7A 2QX3A 1RU4A 2GK6A 4UZUA 5CPRB 2Q1ZB 2X6WA 3F9KA 1O8JA 4YEJA 2O17A 2M4KA 4XKBA 1IDKA 1OR7C 3S32A 2M7AA 3KEYA 2VQHA 3QYFA 2X1CA 4G6IA 2HQAA 2V4DA 4FASD 3A3BA 1E1RA 1OHHA 2LY2A 2M7BA 3DWLE 3PNYA 2V4JC 2W82A 4E7SA 2ODLA 4B43A 1ZELA 2KL4A 2INVA 1NHCA 5AMVA 2ZZFA 1BHEA 3OW7A 2Z2SB 4F52A 3HL2A 1OFLA 2INUA 3H9QA 4PJNA 1JRGA 3K4LA 4XQFA 3DPTA 3FDYA 2KP6A 4F3QA 5KNLA 2ZTNA 3VYRB 4CCMA 2HNHA 2KRCA 1TZLA 1KCCA 2IQ7A 2L5QA 4CCOA 4E0FA 2LG4A 2X53S 1MMAA 2IS2A 2NZMA 1X0CA 1N75A 2MABA 4Z03A 2JJ1A 3BG7A 4CSWA 4E7JA 1WPCA 2JJ2A 3NE5B 2O0WA 3KX2A 3MD2A 2DXIA 1KTWA 3TMOA 5LFAA 3OYLA 2V6EA 2K9LA 1V5EA 3CP2A 5DN6A 3LMWA 2O04A 2VPLA 2W6IA 2JUGA 4DK0A 2WPDA 4HG2A 3ZGKA 3L2UA 1P9QC 3VSTA 1VBLA 3D5RC 1X4OA 4MLOA 3AL0C 2X1EA 3FKJA 3MKYB 2I8DA 2HZDA 3FY3A 1SAUA 3VDXA 1DP3A 1G59A 2R4GA 3U21A 3EQNA 1HVXA 4DOZA 3CZ6A 4Z06A 3K6GA 1V0EA 2Z16A 3ZCOA 4OJ6A 2KRHA 3IP4B 4XLFA 2F4IA 4B3XA 1N77A 3OL3A 4W8TA 2HPMA 5CDFA 3BH4A 2L2OA 1GLNA 3S8PA 4BS9A 1OGOX 3GQ9A 3ZQQA 1H8EA 1QU3A 1BOBA 2GJRA 1XG2A 4AYBA 4XOPA 4ZC3A 1FMWA 4D1QA 4QPOA 1Z3YA 2WY8Q 4HSRA 2R7XA 4XL9A 1NRKA 2UV1A 3OYFA 3DEEA 2VJ5A 3ZRGA 3OYIA 2MYSA 1KONA 1D0XA 3EUAA 1QJVA 2V7FA 3OIPA 4HNTA 4CUGA 3N05A 4E7IA 3K4MA 2CW7A 2VKDA 3DLAA 1O88A 3QYEA 3VYSB 1K5CA 4Y4RA 3FKSA 4Z05A 3D5LA 1NG6A 3HKZA 3RSNA 3MKZA 4XONA 3A4CA 2R7TA 3UNGC 4TKOB 2LYCA 4BXFA 3QOEA 4KITB 2CUJA 5FRNA 2ZZGA 4BEHB 4BJ5C 3K4CA 4H4KC 1WP6A 1E3XA 1HZEA 4E4HA 3PSIA 3H5AA 1WJFA 4YXWA 1W0JA 3D5SC 1UD8A 2V26A 1WJ5A 3FBNB 5C1EA 1X1CA 1UG0A 2VXDA 4OAZA 4PSWA 2JIZA 2XZPA 4GQNA 2LY1A 4LIUA 3RCOA 1FX0A 4XKWA 3L2QA 3LSMA 2Z8GA 4JOMA 2O1DA 4TT3A 2W00A 1VLYA 1DGRM 4ZDLA 1X4PA 4KT6A 1E3ZA 3FHNA 4CCNA 2LBFB 2GJPA 1OLTA 3GQ7A 1IDJA 4KJZA 4C2LA 2WAFA 2IXSA 2JA2A 1N78A 2R7SA 2X3HA 3A1YA 2KMUA 3K4JA 4XOTA 5KHDA 2K3PA 1O8EA 4ITVA 2P0WA 4B44A 1PKVA 4XORA 2W7NA 3GBGA 2VKHA 4FXUA 2DOAA 3SEQA 1YX3A 4NK6A 4HNUA 2Y0SA 3OYAA 4XN3A 2HVRA 4MR0A 4YZAA 2LC2A 2GJKA 4CZCA 4URRA 2BVLA 4YRVA 3L2WA 1H80A 3LSIA 1WTHD 4DK1A 3BLYA 4XN0A 2LREA 2X51A 4LG3A 2UWMA 3OOCA 3OY9A 4DBQA 4KKTA 5C1CA 1I18A 2VB6A 3GQAA 3BCAA 3VMVA 3NWTA 3VYUB 2HVSA 4LIVA 1BN8A 3PNTA 3OIQA 1MW7A 4IQ4A 3RPUD 2NOJB 4BDYA 3OS2A 4BJ6C 3UR3C 1GQ8A 2LZJA 1E43A 3CJRB 4KKSA 5HOOA 1JTAA 4E7KA 1AIRA 1V5GA 1RWRA 2CV2A 2KQRA 4HIZA 1SFKA 2E5ZA 2MC4A 3WQZA 4J01A 3OYNA 3EUKL 3ZPPA 3B8YA 3HUGB 5HLTA 2IS1A 4BUPA 3PUBA 3I9V2 3A35A 4PFOA 3K70C 4U4BA 2ZXHA 4II2A 2HPIA 2VL8A 3DKXA 1EFRA 2VJ4A 2D3LA 3C2HA 4Y33A 4XD7A 3PNVA 4ZJZA 4G6TB 4KKUA 1MNEA 2KZVA 2WY7Q 2L7KA 2XF6A 2F1MA 3HC7A 3PJRA 1QHHD 4J00A 3DQVC 3E1SA 3HPGA 4XR6A 3EUHC 5JHFA 3OYJA 3HG9A 3QYBA 2RQQA 5CQEA 2JDIA 3ZPNA 1DBOA 3OYGA 3AFHA 3OYDA 3BC8A 4PFPA 4NK8A 2IGOA 1W36C 2X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8H A;  2X6Y A;  3JUR A;  3SUC A;  4Z05 A;  4XKV A;  2NST A;  4XON A;  2NT9 A;  1HG8 A;  1WMR A;  1PE9 A;  2EWE A;  4YEL A;  4XNF A;  4HWV A;  1OFM A;  2NTB A;  2UVE A;  1O8D A;  4YZX A;  1PXZ A;  1K5C A;  2NTP A;  2VJI A;  2QX3 A;  1RU4 A;  3B90 A;  4I84 A;  1KCD A;  2X6W A;  1O8J A;  4YEJ A;  2O17 A;  4W8S A;  1IDK A;  1EE6 A;  3GQ8 A;  5C1E A;  3VSV A;  2VJJ A;  2QY1 A;  4OJ5 A;  4XKW A;  4OZZ A;  2Z8G A;  2O1D A;  2X85 A;  4OJP A;  2BSP A;  2ODL A;  2INV A;  1NHC A;  3GQ7 A;  1O8M A;  5AMV A;  1BHE A;  1IDJ A;  4C2L A;  1PLU A;  1OFL A;  2INU A;  2X3H A;  1JRG A;  4XOT A;  4XQF A;  4PMH A;  1O8E A;  4AVZ A;  4XOR A;  1IB4 A;  2NSP A;  1RMG A;  1KCC A;  2IQ7 A;  4NK6 A;  4YZ0 A;  4XN3 A;  4MR0 A;  4YZA A;  2NZM A;  1X0C A;  2PYH A;  4Z03 A;  4URR A;  2QXZ A;  1H80 A;  4XN0 A;  4U49 A;  2O0W A;  5C1C A;  1KTW A;  4XM3 A;  3ZSC A;  4XLC A;  3LMW A;  3GQA A;  3VMV A;  3KRG A;  1QCX A;  4XLA A;  2O04 A;  2X6X A;  3T9G A;  4W8Q A;  1BN8 A;  2NT6 A;  3VST A;  1VBL A;  4OJL A;  1GQ8 A;  1O8L A;  1JTA A;  4MXN A;  1AIR A;  1RWR A;  3FY3 A;  3EQO A;  3UW0 A;  2PYG A;  1OGM X;  4XMY A;  3EQN A;  4Z06 A;  3ZPP A;  3B8Y A;  4OJ6 A;  1O8K A;  4XLF A;  1IA5 A;  1O8F A;  4W8T A;  4U4B A;  4XLE A;  1OGO X;  3GQ9 A;  4EW9 A;  1OOC A;  1XG2 A;  2O0V A;  3GRH A;  4XOP A;  3VMW A;  3VSU A;  2VBK A;  2UVF A;  4XL9 A;  2NTQ A;  1CZF A;  4OZY A;  4XLH A;  4YZQ A;  1DBG A;  4OJO A;  3B4N A;  2VBE A;  2PEC A;  4XR6 A;  4W8R A;  1QJV A;  3WWG A;  1DBO A;  2VBM A;  1O8I A;  1O88 A;  4NK8 A;  1O8G A; 
#chains in the Genus database with same CATH topology
 1O8H A;  2QGG A;  3H35 A;  1OGJ A;  5GV8 A;  2M5S A;  4CYC A;  2TRT A;  3MZY A;  1B6A A;  1D0Y A;  3T53 B;  1TWG J;  2PJR A;  3LQE A;  4C9Y A;  2CV0 A;  2JUC A;  1JKO C;  5FRO A;  4P3I A;  4CCJ A;  4X7D A;  2CS3 A;  1HKT A;  2VE8 A;  4AIK A;  4CZZ A;  4HWV A;  4S0H B;  5TIS C;  1MSF C;  5FL7 A;  3GVL A;  2HR3 A;  3TOB A;  1KMH A;  1EE6 A;  3ROU A;  3GQ8 A;  1FNN A;  5CLS A;  3PIO F;  4A6D A;  5HDG A;  2V1N A;  2YR2 A;  2QE7 A;  2JVH A;  1FX7 A;  1TYU A;  4A0Z A;  1X1B A;  2J5P A;  3NEU A;  2EIJ H;  2WAQ A;  4A2U A;  1Q1V A;  4EMS A;  3WND A;  5DTD A;  4RLF A;  1FLI A;  4X06 A;  2HKO A;  5LMZ A;  4TV7 A;  4A3L J;  4A3G J;  3L2R A;  4FTH A;  2DTR A;  2VBX A;  4C3H J;  2ZZE A;  4IRH A;  3Q0W A;  2W24 A;  1VHE A;  1WU8 A;  4P55 A;  1L1I A;  1RRJ A;  4TMT A;  4LK1 F;  3S2D J;  4OU0 A;  2JA7 J;  1QFJ A;  1VQ5 I;  2WSS A;  1JA1 A;  2X0K A;  3MZH A;  1VQ7 I;  4Y9R A;  1AHD P;  2ESH A;  3PQJ A;  4CA0 A;  2XGC A;  4G8X A;  1DPR A;  1E17 A;  1MAB A;  4Y9U A;  3W2H A;  5CVU A;  2BOL A;  3OS1 A;  4BE2 A;  2M0M A;  3I4M J;  4U49 A;  3GFL A;  3H3U A;  2F5E A;  1WZ2 A;  4C43 A;  1SAN A;  2JQ7 A;  2KDZ A;  1O4X A;  3CC7 I;  3LMM A;  3RDI A;  4BE0 A;  5FKL A;  5L3C A;  2Q2E B;  1GXP A;  5E1Z B;  2R7R A;  2XTX A;  2VKV A;  2HDC A;  1IXR C;  5D6E A;  3WTT C;  3I53 A;  3P5J A;  4OM9 A;  5F1R A;  2P6T A;  3CCS I;  5GAH J;  2DK5 A;  2BF4 A;  1R4N B;  1QNT A;  2VC0 A;  4WZE A;  2FVG A;  2CUZ A;  2HDW A;  1IGN A;  1G3S A;  5CJ9 A;  1WSR A;  4P3Y A;  5DM6 F;  4RB2 C;  4ACA A;  1HF2 A;  1T0F A;  4E7L A;  1WOR A;  3O8G A;  2VXZ A;  2ZME C;  4WWC A;  2EFO A;  4UUV A;  1LPQ A;  3F8F A;  2Y0M A;  2CRV A;  1MRZ A;  4G94 A;  3H94 A;  3VSU A;  2NS7 A;  2QYO A;  1HQC A;  1BIB A;  4FCY A;  1IJF A;  5J1Y A;  2DMQ A;  3NWS A;  1IRZ A;  4UXN A;  2HLD A;  2NTQ A;  4WZT A;  1DBG A;  4MYT A;  1E79 A;  2WYR A;  1YX2 A;  2A3S A;  4RDJ A;  4BBS J;  2XGE A;  3JQQ A;  2XZL A;  5B1B H;  4I6Z A;  4JK1 X;  5HNH A;  4GCV A;  1LEA A;  3R61 A;  1PYV A;  4XRM A;  1KD1 D;  4KIS A;  1X2N A;  3V76 A;  3ML3 A;  1Y0N A;  4PUS A;  1BL0 A;  4I7H A;  3AVW A;  4PC7 A;  1KU9 A;  3G1O A;  3CCQ B;  2E35 A;  1K83 J;  2D1V A;  4UVB A;  2EWE A;  4WF2 A;  3CME I;  3AKZ A;  1OB0 A;  2VT3 A;  4OIR F;  1E64 A;  3GSI A;  5TY0 A;  1WFX A;  4HAM A;  1M90 D;  1NK3 P;  3FIS A;  4YAU A;  3QP6 A;  1XGN A;  1E62 A;  2MGQ A;  2LH9 A;  4ZDO A;  4E6K G;  5HKK A;  2L9V A;  5HVQ C;  4UVC A;  4DZP A;  1Z7L A;  4D0P A;  1E0E A;  2FBH A;  1PUF A;  3G6E B;  4ETS A;  1F1Z A;  4ENK A;  2HGC A;  2BVM A;  2BX6 A;  4ZYA A;  1IRF A;  1S7O A;  1USS A;  1YW9 A;  3U1K A;  1D1A A;  3I3L A;  1IUY A;  3W3C A;  3BQJ A;  3A2K A;  3M7G A;  2Y30 A;  4DYR A;  2O6W A;  2V9V A;  1XGS A;  2VON A;  3BY2 A;  1D3Y A;  1TWH J;  3CMA B;  4PMH A;  3O3K A;  4AVZ A;  3CCM I;  3S1R J;  5GAE J;  3R6S A;  2Q6K A;  3K4N A;  3BG6 A;  1GJR A;  1ZQ3 P;  3LSJ A;  2MA3 A;  2JA6 J;  1X19 A;  3OYC A;  5F64 A;  2KJB A;  1T5E A;  1YW8 A;  4FWT A;  2E1M C;  4YZ0 A;  4FIS A;  4A3F J;  1SAX A;  2PIA A;  5F4M A;  4WQM A;  3BH7 B;  1W1W E;  1TWF J;  4B47 A;  4M6X A;  4NQW B;  3OS0 A;  2IS4 A;  2ZL5 A;  1JHH A;  2QXZ A;  1IRX A;  2GA1 A;  2QSF X;  1GDT A;  1FRQ A;  2DU9 A;  4RLQ A;  4R79 A;  3FMR A;  1F5T A;  3B73 A;  3DPU A;  5JR3 A;  3LSP A;  1Y1W J;  1I8D A;  1JGG A;  3HPH A;  5GV7 A;  3G1L A;  1ERD A;  4EJW A;  3G05 A;  2VLA A;  4KIB A;  3KEW A;  4ZTF A;  2DIE A;  4RMN A;  2RQP A;  4ASN A;  3GTL J;  4BQN A;  4XRS A;  2VOO A;  3PUM A;  3BCB A;  2VBW A;  1UHS A;  5A2Q K;  3I71 A;  1OJL A;  1TQI A;  3U6B A;  4RCY A;  5D5W B;  1QX4 A;  1T0F C;  3OZU A;  1VQK B;  2A5W A;  4OOS A;  4RA2 A;  1HA8 A;  3BWG A;  1X58 A;  4IF4 A;  1GT0 C;  1LB2 A;  3BR5 A;  1HF0 A;  2BW3 B;  2GOX B;  3IUO A;  2DER A;  2B0L A;  1JI8 A;  2RN7 A;  5H5J A;  5C4J J;  4QIW N;  4PAA A;  1DAB A;  5HNF A;  2GM4 A;  5J3O A;  5E1X A;  3R6K A;  4KIF A;  2XF7 A;  2R92 J;  2UVF A;  4MO7 A;  1BI0 A;  4WCG A;  4P1V A;  3E7L A;  3AVU A;  4B4C A;  1GO2 A;  1JUS A;  2FE3 A;  2L4A A;  3O2P E;  4FHT A;  4UV8 A;  4XLH A;  2DET A;  4RM2 A;  1AMO A;  4ZDP A;  4Y3O A;  1QFY A;  5IYP A;  2EV6 A;  4C2T A;  2VFQ A;  5M3M J;  1OQY A;  1X1D A;  2EZL A;  3ONQ A;  2VFN A;  5EGO A;  2XGX A;  3CF2 A;  4Y7N J;  1O8I A;  3Q9S A;  4M3F A;  2M3A A;  1F20 A;  2DN0 A;  2P5K A;  3WHC A;  2E36 A;  2K4J A;  3GQB A;  5J8F A;  2M9H A;  3PFY A;  4KDP A;  3W2E A;  1UHW A;  2X6Y A;  3ZIA A;  1O8G A;  3SUC A;  1AU7 A;  4C3J J;  2ZME A;  1I5Z A;  5GAG J;  3KZY A;  2FOK A;  1WMR A;  4IVN A;  1N8R D;  1FYM A;  4YEI A;  5LRS A;  3DPL C;  3KP3 A;  1LFP A;  3KYL A;  1YFH A;  1SD5 A;  3AL0 B;  3BR3 A;  4YIR X;  4AU7 A;  3ML6 A;  1BW5 A;  3ZUG A;  3BZK A;  2GK6 A;  4UZU A;  4Y7C A;  3EET A;  2DA2 A;  1LEB A;  4YEJ A;  2PLF A;  2PMD A;  1H8A C;  2ACJ A;  3JQP A;  4AC0 A;  4PCQ A;  1VQ6 B;  2X1C A;  1WRJ A;  3V7C A;  4X1E A;  5EDN A;  4G6I A;  4TN1 A;  1XSX A;  2V4D A;  4PAB A;  5IP6 A;  5D5V B;  3A02 A;  4ENJ A;  1SEU A;  2LY2 A;  1EFU A;  2JRT A;  3IRR A;  3HSF A;  2QCO A;  1ZEL A;  3W2G A;  1NHC A;  1SMT A;  3KCC A;  1BHE A;  4F52 A;  5FIU A;  5J3L A;  2ELH A;  2ZME B;  3WU2 C;  1Y39 A;  2A07 F;  2H09 A;  3DPT A;  4F3Q A;  1ONV A;  5KNL A;  1FTZ A;  5TRD A;  1XB2 A;  1OFE A;  1MJA A;  4OPS A;  5HOD A;  3FXM A;  1TZL A;  4KYW A;  3LNQ A;  2IQ7 A;  4G6Q A;  1GXQ A;  2ZBK A;  1UHM A;  1QGP A;  4IL6 C;  2IS2 A;  2MAB A;  4BBR J;  2JJ1 A;  3ZQF A;  2FMY A;  4Z03 A;  4E7J A;  5E8G A;  3ASR A;  3U2Q A;  1EP1 B;  4RD4 A;  3W2I A;  3MD2 A;  3IWZ A;  1OB2 A;  2ID6 A;  2P6S A;  3W6J B;  3WE3 A;  5LFA A;  3OYL A;  2V6E A;  3CP2 A;  4FX4 A;  2EJR A;  1PDN C;  2DY1 A;  5TV2 A;  2W6I A;  1LNW A;  4EM2 A;  4WZL A;  2OBT A;  3OJX A;  4B4D A;  4ENM A;  4RAZ A;  5FLM J;  1P9Q C;  3D5R C;  3G4S B;  3QOP A;  3V8K A;  4U88 A;  3FKJ A;  2DFF A;  2I8D A;  3M1E A;  3A01 B;  1ZRC A;  3JRH A;  2Y31 A;  2M34 A;  2HZD A;  3P26 A;  2JN6 A;  1FND A;  2QYU A;  3LJY A;  4AD9 A;  2HYG D;  2R4G A;  4N9H A;  3U21 A;  2Y75 A;  2PX9 A;  1F4K A;  3EQN A;  2L7M P;  1R4M B;  3K6G A;  3I59 A;  4OOI A;  3ZCO A;  4IHX A;  2ZJP F;  1CLW A;  1O7F A;  2KRH A;  4B3X A;  2Y0S N;  2DFI A;  2HPM A;  3ECH A;  1CQT A;  2L2O A;  1OGO X;  3SY2 A;  2FJ1 A;  1B59 A;  1WDT A;  4AYB A;  3FM5 A;  4D1Q A;  2J7K A;  2K4B A;  4R8H A;  1ZAR A;  4QPO A;  4HSR A;  2UV1 A;  1YOV B;  5LLQ A;  1QPI A;  3OYF A;  2OBR A;  1TSP A;  3NRV A;  4A3I J;  3HOV J;  2VJ5 A;  1TW3 A;  1ORK A;  2GZW A;  3OIO A;  1YS6 A;  5HZA A;  1D0X A;  4AIH A;  3C2B A;  1ZGW A;  2C6Y A;  1IN8 A;  2V79 A;  3OIP A;  4HNT A;  1PJ6 A;  3N05 A;  2HXO A;  4RS8 A;  2ZBV A;  1Q7Y D;  4KMF A;  3K4M A;  2IOU G;  1P92 A;  5HS9 A;  2RKH A;  3V4G A;  4GYG A;  2HDN B;  5HZB A;  1G2H A;  1J2X A;  1NG6 A;  3A0B C;  3MKZ A;  2R5Z A;  3A4C A;  1ENH A;  1JNY A;  3CCL B;  3S2W A;  2PE3 A;  3MEX A;  4BXF A;  3BG5 A;  1X3U A;  5FRN A;  2GQF A;  1UB9 A;  4RGR A;  2WV1 A;  3K4C A;  4H4K C;  4K2E A;  4Q47 A;  4BJ5 C;  3GYH X;  5BMZ A;  2MG4 A;  1EP2 B;  2L7F P;  3ZC3 A;  2BY1 A;  3H5A A;  3CC2 B;  1WJF A;  1AOY A;  2K27 A;  1YI2 I;  4HX8 A;  1W0J A;  5F0F A;  4G6D A;  3NB2 A;  3ERM A;  4YFN F;  2HXI A;  3GTP J;  5C1E A;  1IN4 A;  1UG0 A;  4RB0 A;  1FX0 A;  3RKQ A;  1T2K A;  4RB1 A;  5FA6 A;  2QQA A;  3LSM A;  5FFZ A;  3BJO A;  1G7T A;  4TT3 A;  3SLD A;  2O1D A;  2W00 A;  1XPX A;  2Z8G A;  1DGR M;  3TKY A;  4JP0 A;  5F0C A;  1X4P A;  4A0X A;  4KT6 A;  3ESW B;  1O3T A;  3BR1 A;  5E3L A;  1OCO H;  1OLT A;  4O5V A;  1I6X A;  1ZH5 A;  2RVC A;  4ZYE A;  2VI6 A;  1N78 A;  2H6B A;  1HBX G;  3KE2 A;  2P8T A;  3A1Y A;  1ZM9 A;  2X3H A;  1F36 A;  1ZHF A;  3ASS A;  5DSZ A;  4ITV A;  4J19 A;  1O8E A;  2ZB9 A;  3L00 A;  1TQM A;  1PKV A;  3BR0 A;  3CCJ I;  4XOR A;  2VZL A;  1W0T A;  1G6N A;  4EVI A;  1ZUN B;  1SD6 A;  1WI3 A;  2CF4 A;  1QRB A;  3K7A J;  4EJT A;  2MD5 A;  4UY8 I;  2XAF A;  3PA2 A;  4QWQ A;  4XN3 A;  3ZMS A;  1X2M A;  4V2F A;  1H9G A;  3LSI A;  3LQR A;  3BLY A;  2LRE A;  2DYS H;  5JFR A;  3E1Y E;  2ECC A;  4DZJ A;  3OY9 A;  1K9M D;  5E79 C;  3VYU B;  1H42 A;  4LIV A;  3PNT A;  3MQ0 A;  4LD5 A;  2M5W A;  3WGG A;  3OS2 A;  2ZL7 A;  3A8K A;  3UR3 C;  1GQ8 A;  4F7D A;  2LKS A;  3CD6 B;  4M4S A;  4E7K A;  1RWR A;  1Z91 A;  1VQ6 I;  3E3V A;  3SZT A;  1SFK A;  1UZC A;  5IOZ A;  3LO8 A;  4X7E A;  2BVN A;  3PVD A;  3VOE A;  3ZPP A;  1SVM A;  3IHU A;  3HUG B;  4P6Y A;  2V5I A;  2W25 A;  2JA5 J;  3A35 A;  4MNU A;  4EEF G;  4U4B A;  2KKO A;  3DKX A;  1TL8 A;  2COB A;  2NYX A;  2JPC A;  2FQ4 A;  3HJE A;  5CVR A;  1HW2 A;  4LBW A;  4C3I J;  3CCE B;  9ANT A;  1YTY A;  3VO2 A;  1JUM A;  1O3R A;  5AIP A;  4PGO A;  4G6T B;  3SHF A;  5AON A;  3T1B A;  2G7H A;  2XF6 A;  2F1M A;  1FIP A;  3HC7 A;  5FLX Z;  5A8A A;  3PJR A;  4CYC B;  1RNL A;  2Q0O A;  4LFU A;  3HPG A;  1YO5 C;  5JHF A;  2ZFW A;  1W87 A;  5FO1 A;  3OYJ A;  3HG9 A;  1NH3 A;  2JDI A;  2LKP A;  3SDG A;  3OYG A;  4KN7 X;  2MSY A;  3BC8 A;  1TQP A;  2QTL A;  5J47 A;  1YRN A;  4RDK A;  2EV5 A;  1S9H A;  2ELJ A;  2R9V A;  3LSR A;  2QM3 A;  2EK5 A;  1ZRE A;  3A1P A;  2DA3 A;  4M74 A;  3CB4 A;  5FO0 A;  3E6B A;  4AIJ A;  2GIV A;  4DIQ A;  4NCN A;  2DYI A;  3COA C;  2BGI A;  1MIJ A;  2DDB A;  1S4M A;  1KGS A;  4LLL A;  2BV6 A;  2M2E A;  1Z9C A;  2JK3 A;  3KZZ A;  2EZI A;  1Q1H A;  1ZM2 A;  1OFM A;  3L2V A;  3HGG A;  4C30 A;  3SEZ A;  4E70 A;  2DA1 A;  4BNC A;  1QGA A;  2VBZ A;  3B90 A;  2L9N A;  2F43 A;  5JBQ A;  1VFC A;  3RKY A;  4XBF A;  4U9U A;  1VLO A;  2ZXI A;  1R1U A;  1GR1 A;  1ZGJ A;  1OCZ H;  3F0C A;  3A3G A;  1HST A;  1V54 H;  3VSV A;  3K4K A;  2QY1 A;  4BHP A;  1VQN B;  4N4N B;  2L54 A;  3FIW A;  1FOW A;  2GAU A;  4OZZ A;  3LSH A;  5LD2 C;  1XGO A;  4JBA A;  2PMH A;  3ZQG A;  4IPA A;  3OL4 A;  4CCK A;  1VQ9 I;  4BE1 A;  1KU3 A;  2IGM A;  2LLK A;  3T8R A;  2PJR B;  5J1R A;  3OSG A;  2BY0 A;  3ASO H;  1WJC A;  5GTH C;  5HS8 A;  2P81 A;  3E5U A;  5H20 A;  5EYR A;  3W5V A;  1V0F A;  1FZP B;  4M53 A;  4X7F A;  1LDJ A;  3TQN A;  1Z7U A;  1D5V A;  1I1S A;  2KPM A;  4X7C A;  3L09 A;  5EZG A;  5K5R A;  1HKQ A;  2GOM A;  3J7Z I;  3P27 A;  1QA1 A;  4HDU A;  1BQE A;  3SZP A;  2B0R A;  2PYH A;  3SLN A;  1RUN A;  5J1U A;  4G7X A;  2QWW A;  3CCL I;  3K4B A;  4N3G A;  1IG7 A;  3DU1 X;  1K6Y A;  3W6V A;  3ZSC A;  4BYY A;  2VNI A;  3FPP A;  3FK7 A;  2W6J A;  1FY7 A;  2BPO A;  4MFD A;  4EH1 A;  3HDD A;  4L9N A;  4W8Q A;  1R58 A;  2QA4 I;  3TH0 A;  1ULY A;  4BQO A;  5LGT A;  1FC3 A;  3C2G A;  4P9S A;  2EIK H;  2O0Y A;  2WAD A;  4P9U A;  1Q86 D;  3OEH A;  3S15 J;  2HOE A;  1AA7 A;  4MXN A;  4AC9 A;  4XKC A;  2HOA A;  1DQU A;  3OYK A;  3TDU C;  2V7T A;  3AAF A;  4XMY A;  2BBY A;  5EEG A;  2QKL B;  4EM0 B;  3D0S A;  3LVB A;  2V7V A;  4JX4 A;  2GXG A;  4OMZ A;  3WG9 A;  2AHQ A;  4Z4T A;  1BM9 A;  2ZSH B;  3E5X A;  2HU9 A;  1RQR A;  1BN5 A;  3ONY A;  2V7Q A;  2PQ8 A;  2XC7 A;  3OAA A;  2EPF A;  3IAS 2;  1UAA A;  2G9W A;  3N4M A;  3K2A A;  5ICF A;  1U9O A;  1HDD C;  3CRZ A;  3CUQ C;  2PLY A;  3KEQ A;  4G9Y A;  2AQF A;  3G2B A;  4LIT A;  3OYB A;  2CRG A;  2H27 A;  3H36 A;  1R5I D;  2B9S A;  1MBJ A;  4OZY A;  2HFH A;  3WTY C;  4I98 B;  2CJJ A;  4D9J A;  4LBV A;  2RC4 A;  3LWF A;  3I55 I;  2M30 A;  4PK4 A;  3AST A;  4W8R A;  5IT3 A;  3CCV I;  1TW2 A;  4IHS A;  4N4O B;  4L0Z B;  1TYV A;  3FMQ A;  3SJZ A;  3JUR A;  2XAU A;  1UCR A;  2R7W A;  3ZMZ A;  4ZCL A;  3SKB A;  1TT5 B;  1JGS A;  4HV6 A;  5DCF A;  1FBU A;  3P4G A;  2MFZ A;  1UMK A;  4F92 B;  1ELO A;  1ZM3 A;  3JU4 A;  1FMV A;  1IDY A;  4DJA A;  3LOC A;  3TL4 X;  4IRG A;  3W2W A;  5L3D A;  1A36 A;  2CW5 A;  2Q6L A;  1QVF B;  3CQZ J;  2NNN A;  1P4A A;  3ASP A;  5D8K B;  2XF5 A;  3H5N A;  1KQ5 A;  4UZF A;  1N05 A;  2E2J J;  2LRD A;  1XN7 A;  2IVM A;  3M1C A;  2YWH A;  4TMV A;  2CUF A;  2L0K A;  4M3E A;  5FKO A;  1VQL B;  1KCD A;  3CJT B;  5K5O A;  3HRT A;  2XDV A;  3DDY A;  4G1V A;  1OFC X;  1RR7 A;  4BY7 J;  1LM1 A;  3BZC A;  4OJ5 A;  2HVQ A;  3T51 B;  3E0J B;  4ZYD A;  1HCR A;  2NS0 A;  3O8H A;  5EZH A;  4GDF A;  4C2M J;  4M3G A;  2K9M A;  1I3Q J;  3CMA I;  3CCM B;  1ZM4 A;  2BSP A;  2OZ6 A;  5FKN A;  2R5Y A;  1YJW B;  1ZN2 A;  2LKX A;  1V3F A;  3OR1 C;  2F5C A;  4KIC A;  3DTE A;  1SMY F;  3FF5 A;  4MGR A;  4L0Y B;  2C5H A;  2D9R A;  2GK7 A;  4NC7 A;  4M6V A;  3ZXS A;  5K7H A;  2E60 A;  3VR6 A;  4WXD A;  2IGN A;  4HE5 A;  1KK1 A;  3JRD A;  2K3F A;  2F1L A;  1VJS A;  4LBZ A;  2JTV A;  1QQI A;  4BPR A;  1SD4 A;  3MMY B;  2XRN A;  1RZ4 A;  3OYE A;  2Q6I A;  5FKM A;  1KQ0 A;  5BPI A;  3RI4 A;  2HOS A;  1BLI A;  1WSU A;  4N3N A;  2AO9 A;  3IKV A;  1JT6 A;  5FD5 A;  3HB9 A;  3LSK A;  4IOA F;  5K7Z A;  1QPM A;  4B8X A;  2ZTG A;  3B78 A;  1R5G A;  3OEE A;  4MYU A;  1FOY A;  3WE2 A;  2XKO A;  3QAH A;  3WGH A;  1N08 A;  1FRN A;  3KRG A;  2IA1 A;  4XLA A;  2E1R A;  5LGU A;  3CXC B;  4IZZ A;  4BAC A;  2PFB A;  1JUP A;  2WZP P;  2ZFU A;  5BSY A;  2DQR A;  1BC8 C;  1U3E M;  2VOP A;  4MQ9 F;  2FUG 2;  5GTI C;  3ZP5 A;  1UD3 A;  4OJL A;  1SVL A;  4Z4U A;  4LGW A;  3WHB A;  1ETK A;  3ZR8 X;  2L7Z A;  2JZY A;  1GVH A;  2UXX A;  4RD3 A;  3EQO A;  2QBY A;  1S7A A;  1Z21 A;  2W84 A;  1OGM X;  2NVQ J;  3UW0 A;  3H5R A;  2XAG A;  1H0M A;  5J40 A;  4F7Z A;  5BSX A;  4PC2 A;  1WOS A;  3JQR A;  3H0D A;  1FP2 A;  4U7B A;  2C2W A;  3EUH A;  3PEN A;  3A8I A;  3V7A A;  2XND A;  2V7X A;  1O8F A;  2R7Z J;  3RKW A;  5KK1 A;  1NK2 P;  3ONU A;  2XVC A;  3BTI A;  2OC6 A;  5H2F C;  1MMS A;  1NJI D;  1EZG A;  4LJZ F;  4LLG F;  4PGG A;  1A04 A;  1QZY A;  4BU2 A;  4A3K J;  1XG1 A;  2CQX A;  2R7D A;  1QA2 A;  1E63 A;  1U6G A;  2PG4 A;  3ZQH A;  4ZV4 A;  3BOQ A;  3FJO A;  3J81 K;  2QEX I;  4BXX J;  3AK5 A;  2OTL B;  1S29 A;  1OYW A;  4O3M A;  4OIO F;  1B23 P;  3CES A;  3SJP A;  4YZQ A;  2K5C A;  2R7Q A;  3RPU A;  1VQ5 B;  3KLN A;  3DFG A;  4CCL A;  3ZMT A;  1OIS A;  2CH0 A;  2P7V B;  5D4S A;  4H9G A;  3FXL A;  2VKE A;  5JLW A;  2FD5 A;  4YZX A;  1RR8 C;  1LDD A;  3IC7 A;  2AQE A;  4PJL A;  1TLH B;  3RPQ A;  5DCM B;  1LQ1 A;  4GFB A;  4OWR B;  3WBK A;  1F60 A;  1SKY B;  4NHJ A;  1NBM A;  2WBM A;  3CC7 B;  2O6G E;  1N0V C;  2LBF A;  4M2L A;  4Z6Y A;  4BL0 B;  1K79 A;  1V5V A;  2A69 F;  3LFU A;  1S6L A;  5F04 A;  2HYJ A;  3I56 B;  2M4G A;  3LL7 A;  1FOK A;  1BJK A;  2OQR A;  2CFO A;  4CXF A;  2GXA A;  3CCQ I;  4ESJ A;  1GV2 A;  4XSZ F;  1QUE A;  2X6W A;  3C3W A;  1O8J A;  5FFX A;  4QVA A;  2M4K A;  4YCQ A;  1OR7 C;  2WC2 A;  2M7A A;  3DV8 A;  2XPV A;  2G0E A;  4MFE A;  2IBD A;  3QYF A;  3G71 I;  1VQM I;  1QBJ A;  4IHW A;  4UNO A;  2X3U A;  4M1K A;  2HQA A;  3JTG A;  3E97 A;  1F43 A;  2BV3 A;  1WOP A;  1OHH A;  3F6O A;  3DEW A;  1SM4 A;  1WHU A;  2W82 A;  3B02 A;  3WXM A;  4RD6 A;  4Q7J B;  2BEO A;  3ZZU A;  3W5H A;  2ZZF A;  1WGX A;  3OW7 A;  1IXS B;  2Z2S B;  3HL2 A;  1OFL A;  3L7W A;  2VFP A;  5DCM A;  1KK0 A;  1CQX A;  2OBP A;  4PJN A;  3K4L A;  3SXY A;  4XQF A;  1T8I A;  4KIG A;  3AVT A;  2ZTN A;  3CPX A;  3BPV A;  5C44 J;  3VYR B;  1VQP I;  3J80 Z;  1W7P D;  2HNH A;  2YWF A;  4BKX A;  3ZBU A;  2BM5 A;  1FIA A;  2JWT A;  4E0F A;  2B7E A;  2JRM A;  3CCR I;  4WK8 F;  4U7D A;  2EFN A;  1A6Q A;  4CSW A;  4L5J A;  1YIO A;  1QUF A;  2JJ2 A;  2BM7 A;  3TP0 A;  2B63 J;  4GGG A;  1OMI A;  2D45 A;  1GAQ A;  3HTU A;  2FNA A;  2K9L A;  1V5E A;  5B1A H;  2O04 A;  4HOB A;  1AWC A;  3A8J A;  2XUB A;  1OCC H;  5BQT A;  4FN5 A;  5KAF C;  4YAO A;  4DK0 A;  3HSE A;  3S16 J;  1TWA J;  3MAJ A;  2FQ3 A;  2LR8 A;  3LST A;  2XIG A;  4LB6 B;  3ZGK A;  3L2U A;  1KQ8 A;  1VBL A;  5E18 F;  4MLO A;  1KJZ A;  5HLH A;  3S14 J;  2X1E A;  3MKY B;  1K7A A;  2LY9 A;  1R36 A;  4HZF A;  2MC3 A;  2WB1 N;  3C7J A;  3G6E I;  2DMU A;  4P25 A;  1SAU A;  1XQB A;  4UVA A;  2A5Y B;  4Z06 A;  3CZ6 A;  3F72 A;  5K7F A;  3A03 A;  3A01 A;  1CNF A;  3BTL A;  3FWE A;  3HYI A;  2COM A;  1ODD A;  1SC7 A;  4P6V F;  4G5G A;  1ETX A;  2GQQ A;  4O6J A;  5DDG A;  1ZG1 A;  4HQM A;  5DV5 A;  2V1X A;  3ZOB A;  4I2O A;  1H8E A;  1XCB A;  1BOB A;  2GJR A;  2F5F A;  1XG2 A;  3LAJ A;  1YIJ B;  2WY8 Q;  3IH2 A;  2R7X A;  1NRK A;  1WPK A;  4JX6 A;  3V8J A;  2BY2 A;  1XSD A;  1AKH B;  3GXO A;  2K7L A;  1GV5 A;  5ED4 A;  1WKM A;  1N25 A;  2CWE A;  2MYS A;  3IH4 A;  1KON A;  3HBL A;  5EEH A;  3CO7 C;  3EUA A;  1R49 A;  3E6M A;  3F6V A;  2XAQ A;  3BDD A;  3MKL A;  5F27 A;  2DMN A;  1T6X A;  1UG2 A;  2DFH A;  4WXC A;  3DLA A;  2F3L A;  2DLL A;  3QYE A;  1U78 A;  4YAL A;  3BH6 B;  4Y4R A;  4G7H F;  2CQQ A;  4Z05 A;  4ENN A;  2JMW A;  3P9I A;  1XS9 A;  3WY9 A;  3D5L A;  3HKZ A;  4JRA C;  1HKS A;  4XON A;  1JT0 A;  2R7T A;  4TKO B;  4RBO A;  4CHU A;  3FXR A;  1VF9 A;  1N06 A;  1TBX A;  1B9N A;  4I0B A;  5J8C A;  1WOO A;  1LLZ A;  1P4W A;  3G4S I;  1MJB A;  2WV0 A;  2HI3 A;  3RIR A;  2FF4 A;  4BEH B;  4UUT A;  3KYD B;  3WOD F;  5D8L B;  2QQ9 A;  2KZG A;  1QRY A;  3FXU A;  4X0C A;  2ZC2 A;  1I7P A;  3JRF A;  3I59 B;  2DO7 A;  4DNC A;  2DPD A;  5DYM A;  3FMS A;  1X1C A;  3GTJ J;  5BNG A;  4OAZ A;  1EP3 B;  2DCU A;  2XZP A;  1R00 A;  2ISY A;  2LF7 A;  3GTG J;  3C1D A;  4U0Y A;  3L2Q A;  1OB5 A;  2FBI A;  1XE1 A;  2QSH X;  1VLY A;  2D1H A;  2BHZ A;  5LHI A;  2F4O B;  3MHP A;  4CCN A;  2DMT A;  2ELK A;  4IO9 F;  1TTY A;  2VBU A;  1IDJ A;  2HTJ A;  2YWG A;  3BG9 A;  4HX7 A;  2R7S A;  5M5W J;  4RLZ A;  5L46 A;  1ON1 A;  1JKP C;  3K4J A;  1NHA A;  2IA2 A;  2QF7 A;  3PM1 A;  1OFD A;  3MFK A;  2YWE A;  2XTW A;  2A05 A;  1DU0 A;  1WWX A;  4PFP A;  2W7N A;  3AVY A;  3DXJ F;  2VKH A;  5E20 A;  3J7Y J;  3EYI A;  3JR9 A;  3QP5 A;  4C0S A;  1TNS A;  1H9T A;  3QPH A;  4LC0 A;  1PUE E;  4ESB A;  3MWM A;  3Q9V A;  2LC2 A;  3GFI A;  3GVA A;  1IDZ A;  1TWC J;  2BVL A;  3Q38 A;  1ETO A;  3K2Z A;  3CUQ B;  4LG3 A;  5GPC A;  2DT5 A;  2NAZ A;  2UWM A;  1Q9S A;  3Q39 A;  4PC6 A;  3KET A;  1F9N A;  3BCA A;  3GQA A;  3VMV A;  1LE8 A;  4ZYG A;  2EFP A;  3QPT A;  4BHC A;  1S5L C;  2KIM A;  3CDI A;  1QGY A;  3NAW A;  2HEO A;  3I54 A;  1EH8 A;  3G73 A;  2V9P A;  5C3E J;  1O3Q A;  3ASN H;  2VYQ A;  5CYV A;  2EH3 A;  4DW6 A;  1YI2 B;  4CQJ A;  2FU4 A;  2FNP A;  2LZJ A;  4EV0 A;  5LHG A;  3IRQ A;  2ZNZ A;  2O8K A;  3IKT A;  1AIR A;  2QGU A;  3G71 B;  2CV2 A;  2KQR A;  2YPR A;  1B1B A;  4HIZ A;  1M1E B;  2MC4 A;  3LA7 A;  1UST A;  2KJC A;  1DDG A;  3TW7 A;  5IYB J;  1QZE A;  1TUI A;  3B8Y A;  5HLT A;  5D5U B;  2IS1 A;  4BUP A;  2E1O A;  1B72 A;  3RYP A;  1EFR A;  4RDL A;  3CDL A;  5HDK A;  2PI0 A;  4Y33 A;  3JTH A;  5KAI C;  4XD7 A;  1EA0 A;  4ZJZ A;  2NS8 A;  2KFD A;  1VQP B;  1BW6 A;  2QMU A;  2H6C A;  3CC4 I;  4KKU A;  1MNE A;  2LMD A;  5B3S H;  1I27 A;  2L7K A;  5H59 A;  2BM4 A;  2KIF A;  2CBX A;  1KQS B;  1VQO B;  3KIO A;  1VQ4 I;  2ZL6 A;  5IYR A;  4XR6 A;  3EUH C;  2DAO A;  2ISZ A;  3QYB A;  2MW8 A;  1IN7 A;  1YRN B;  4A0Y A;  1FJL A;  3W2F A;  4W1U A;  3BP8 A;  3W5U A;  5IT9 K;  2KT0 A;  4WWV A;  1VQ8 B;  4XIC A;  2KLO A;  3BY1 A;  1G4D A;  3HXL A;  4OIP F;  3MCA A;  5B6I A;  1VQ7 B;  4HF0 A;  5HS7 A;  4ON0 A;  1MMG A;  5EG0 B;  1HG8 A;  4IX7 A;  1Q81 D;  4FT8 A;  3BCD A;  5CKT A;  3HTS B;  2IEK A;  3VYT B;  2OF7 A;  1T6Y A;  4ZCI A;  4ACB A;  3BQZ A;  4II3 A;  1IN6 A;  3JRA A;  2OD5 A;  4JMQ A;  4HPQ A;  1RIO H;  1K78 A;  2IGK A;  1STZ A;  1YHQ I;  4YG2 F;  4I84 A;  4FE4 A;  2CUE A;  3AG1 H;  2EIM H;  3HUG A;  3C18 A;  3T5X A;  3VPR A;  1D2E A;  1BR1 A;  2IP2 A;  3LFK A;  4W8S A;  1BI1 A;  2O03 A;  1L3L A;  1FSE A;  3LNN A;  4BDZ A;  2BGJ A;  2VJJ A;  2NVX J;  1DGW Y;  5JI6 A;  4HDV A;  1XC5 A;  3RYR A;  1GHC A;  4RPB A;  2X85 A;  2V9K A;  2X8K A;  4M9X A;  2HDD A;  2NV4 A;  1QVT A;  1RPW A;  2VQC A;  3WTX C;  1VHO A;  4Q5S F;  2K9S A;  3RKX A;  3OR2 C;  3SDB A;  4UZE A;  2DT6 A;  2XB0 X;  3ABL H;  1KU7 A;  3DBH B;  4Y13 A;  2DT7 B;  2VQG A;  2F2E A;  2ICW G;  2CND A;  2Z99 A;  1VTN C;  4RCZ A;  2BN4 A;  2BYV E;  2MLG A;  4QUZ A;  4Z4Z A;  1E2X A;  4U87 A;  3OE7 A;  2VC1 A;  4M9Z A;  5DS0 A;  1EA3 A;  4X0G A;  1LUJ B;  4G7O F;  2DQL A;  4JQF A;  4NBQ A;  2FRH A;  3BTC A;  3CP8 A;  2O3F A;  3HGY A;  4LK0 F;  1SVO A;  4OPV A;  2K40 A;  1G7R A;  1P4X A;  2XSD C;  1YS7 A;  2X6X A;  3CCS B;  3QFT A;  1W35 A;  2DOF A;  3QWL A;  1FNM A;  4KNY A;  5A88 A;  2V7W A;  5IPA A;  2AS5 F;  4ASU A;  2Q6O A;  2EZK A;  1ETQ A;  3CTA A;  1B8I A;  3QFS A;  3IWF A;  2VBY A;  1S3J A;  3QRF F;  4AF7 A;  3VWB A;  2NNY A;  3GVK A;  3PSZ A;  3HRS A;  4GRI A;  1ZAO A;  3GME A;  4QLC U;  1UFM A;  1IN5 A;  1DP7 P;  3DU5 A;  2ZBU A;  4HA8 A;  3OYM A;  3BCF A;  1IA5 A;  1J75 A;  1T39 A;  3HHG A;  3ELK A;  4XLE A;  3M4O J;  3QPL A;  3V42 A;  5F4J A;  4DNR B;  4XRF A;  1ZRF A;  2O0V A;  4LG0 A;  3GRH A;  3F21 A;  5JMC B;  3VEP A;  3QOD A;  2H8R A;  2L3D A;  1BX0 A;  2J8K A;  4BJT A;  2VE9 A;  2QLZ A;  4RGU A;  5EG0 A;  2GRE A;  2A68 F;  2OK8 A;  2ZJQ F;  2DA4 A;  4YFO A;  3R0A A;  2BY3 A;  4F93 B;  3AG3 H;  1UD4 A;  4C2U A;  1QA3 A;  1KC8 D;  2HQ5 A;  3Q5F A;  1KK3 A;  4A3B J;  3RY8 A;  2VBM A;  1S72 B;  2M0C A;  5L3E A;  2KDO A;  3K1P A;  1A35 A;  3WNB A;  1H89 C;  2O5R A;  2Z5U A;  3J7A Y;  3I4N J;  2Y9Z A;  2YUH A;  3DKY A;  1IJW C;  3SQN A;  4D7N A;  3S3N A;  4YAW A;  2DOE A;  3K10 A;  1YYV A;  1ZLK A;  3OW2 B;  1BA5 A;  2KVO A;  3NAU A;  4YEL A;  2Z1D A;  3BR6 A;  2KHM A;  2V1U A;  1HOM A;  1S8N A;  1ETW A;  1W2B B;  2CGP A;  2XTY A;  1B72 B;  1EF4 A;  4A3M J;  1Z0X A;  3HOS A;  2Q8K A;  3ERE D;  1D5Y A;  1MBE A;  1HLV A;  2VNK A;  5IY5 H;  2D3N A;  1YQA A;  1LDK B;  3DTK A;  1SKQ A;  1E3P A;  1HW1 A;  1IRG A;  1E3H A;  5GAD J;  2R7U A;  2L02 A;  2X6O A;  3NAR A;  4IQJ A;  4Z4S A;  1DU6 A;  3DKW A;  3LYC A;  3OPO A;  5J4Y A;  1QZZ A;  4DGW B;  3LSG A;  2X9D A;  4EQQ A;  3IAM 2;  1R5B A;  3DF8 A;  4RGX A;  1PLU A;  1XTA A;  1FBS A;  3Q6R A;  1IAW A;  1BMF A;  2WA0 A;  1ZK8 A;  1VQO I;  4KFC A;  1Y1V J;  3T8T A;  3V7S A;  1FOX A;  3I55 B;  3DEU A;  4M3D A;  1HDP A;  1MBK A;  2DA7 A;  3I4P A;  3PL8 A;  4FK8 A;  3WTW C;  4EM1 A;  1Z77 A;  4P9F A;  2YU9 J;  4AVP A;  4EJO A;  1WJA A;  3JSO A;  2QSG X;  4AID A;  5EGO B;  3H09 A;  5EF6 A;  3CJQ B;  4ANJ A;  5F0H A;  3I5U A;  1YX5 A;  4L5E A;  4HST A;  4S05 A;  4B3G A;  2VIX A;  1P2F A;  3K1M A;  1X1A A;  3CLQ A;  1UD2 A;  4ABZ A;  3M9A A;  4IOC F;  1DDN A;  1QA6 A;  2HCJ B;  1W36 D;  4XM3 A;  5TJJ A;  4XLC A;  3ZQ7 A;  4X07 A;  1IO2 A;  1CF7 B;  3WTU C;  3WU0 A;  3QSY A;  2E7W A;  4F91 B;  3W2A A;  2RNG A;  1ACI A;  2W57 A;  1MMD A;  2QKM B;  3H9G A;  3JCU C;  2P5L C;  1ZGA A;  4A3C J;  4Y52 J;  5CVV A;  3B82 A;  1IW7 F;  4AWX B;  2VAS A;  2XAH A;  4NC8 A;  4V2G A;  2CU7 A;  2BGC A;  1W9X A;  4Z1M A;  5JLV C;  4PJ0 C;  2I5U A;  4V02 C;  2DA6 A;  2E1M B;  4R1H A;  2VPR A;  2XT4 A;  2ZZQ A;  4CO8 A;  3HSR A;  3KLO A;  1GUU A;  2BHY A;  2JSP A;  3NQO A;  2V6C A;  1XMX A;  3PUF A;  3K69 A;  3R4K A;  3RQI A;  3TP3 A;  3RJP A;  6PAX A;  3GZ5 A;  4PC3 A;  3T56 B;  1C0W A;  2XNC A;  2OTJ I;  1BJA A;  1EH6 A;  3KFW X;  3PQK A;  4NNJ A;  4DNT B;  1PVE A;  1MGT A;  2EIL H;  1I1G A;  1CF7 A;  2ID3 A;  3ZMD A;  5IP7 J;  3OYH A;  3VMW A;  3H1C A;  1QQ1 A;  1XFO A;  2MD0 A;  3GO5 A;  3GIR A;  1K6O A;  1M1K D;  4BQA A;  5IYD J;  2XGD A;  3P9C A;  2VBE A;  1HSJ A;  3H0G J;  2VBV A;  2PEC A;  4BQQ A;  1GVJ A;  2CK3 A;  2GIZ A;  1RKW A;  1UEL B;  2W1O A;  4P1W A;  3RZD J;  3WTS C;  4DQK A;  2WJY A;  2ZXJ A;  3QQA A;  4ESF A;  3JRI A;  2IRF G;  4HX4 A;  1MH4 A;  1MDM A;  1JJ6 C;  3VO1 A;  5LHH A;  2HWV A;  4XKV A;  5LEK A;  2NT9 A;  4L18 B;  5FD6 A;  5HXB A;  3KP6 A;  1PE9 A;  3HRU A;  2L9S A;  1AKH A;  5B5E C;  4ZTJ A;  4ZGQ B;  2WZN A;  4FX0 A;  2WAE A;  2JJ7 A;  2UXN A;  1KQ9 A;  3CUO A;  1Z1D A;  2RRE A;  2QQB A;  2VBT A;  3S3O A;  2XV4 S;  1O8D A;  2NTB A;  1UD6 A;  3DU6 A;  1K5C A;  4QPQ A;  4UUS B;  2QX3 A;  1RU4 A;  3HRM A;  5CPR B;  2Q1Z B;  3CF5 F;  1W5T A;  3VFZ A;  2BMW A;  4XKB A;  1IDK A;  3F8B A;  2H1L A;  3PUN A;  3KEY A;  2VQH A;  1PJ7 A;  1OPC A;  4BAY A;  1OCT C;  2QVO A;  4YII A;  2HS5 A;  5M5Y J;  3A3B A;  2R7F A;  2LSO A;  1E1R A;  2DK8 A;  4ZH4 F;  2V7U A;  3B8H A;  2M7B A;  2V4J C;  1GVD A;  3S1N J;  4B43 A;  3SQV A;  2KL4 A;  4MIM A;  2QEX B;  5JVT A;  1PP8 F;  1YJ9 B;  2XEX A;  1J5Y A;  1JRG A;  1LFB A;  2KP6 A;  1D8J A;  2OPT A;  1TC3 C;  1KYZ A;  2KRF A;  4QV2 A;  3FKI J;  4MTD A;  1KYW A;  3M8F A;  2ZJR F;  1LFU P;  3I1F A;  1ZYR F;  4CCO A;  2NVT J;  2VBS A;  2LG4 A;  1OCR H;  5EMN A;  5IYW A;  4TMX A;  1MBF A;  1MMA A;  4P12 A;  4DQL A;  5DM7 F;  1K73 D;  2NZM A;  2QZA A;  4MEX F;  1N75 A;  2CG4 A;  3JRG A;  1WSV A;  2DI3 A;  4OOX A;  1CGP A;  3KX2 A;  5FB2 A;  2DXI A;  1KTW A;  3L2C A;  2DPU A;  5DN6 A;  1G3T A;  2VPL A;  2VT2 A;  5IYN A;  2JUG A;  4I99 C;  3MMP A;  4OP7 A;  4HG2 A;  4FQG A;  3JAM Z;  2HOT A;  3VST A;  3H3V K;  2XC1 A;  3EDP A;  4DQ2 A;  3AL0 C;  2XHK A;  4XID A;  5M5X J;  4EJV A;  4ZCM A;  4HE6 A;  4M71 A;  5DUK A;  3KP5 A;  2P5V A;  3VDX A;  2V1D A;  2ETH A;  4WXH A;  5A2Q Z;  1FPQ A;  1KU2 A;  5KSW B;  2R6H A;  1LLW A;  3JRE A;  5KW9 A;  4YC5 A;  4HYE A;  4CYD A;  4QHY A;  1V55 H;  2KIQ A;  2NVU B;  1FNC A;  1N77 A;  1IZ1 A;  5ILU A;  5HDN A;  4W8T A;  5D5X B;  3BH4 A;  1POG A;  3R6J A;  3S8P A;  4BS9 A;  3LAP A;  4N9I A;  1Z05 A;  3ZQQ A;  2OK7 A;  3GX4 X;  5ILS A;  4KN4 X;  3ZMU A;  2XKP A;  3WG7 H;  4KA4 A;  3MZ8 A;  3CMY A;  2RDP A;  2FA5 A;  2LF8 A;  3ZMV A;  2DMP A;  1ZR4 A;  3MCZ A;  1DUX C;  3DEE A;  3ZRG A;  2Y69 H;  1JTY A;  3S1M J;  2QN6 A;  1U9N A;  2STW A;  4A5N A;  3A0H C;  2ECB A;  3WGI A;  5ICC A;  1JKR C;  1IC8 A;  1O7L A;  4I76 A;  2NOG A;  3J80 K;  1O88 A;  3AG4 H;  3VYS B;  3WBJ A;  2P4W A;  4NC6 A;  3VNV A;  3FKS A;  3W6K B;  4JX5 A;  1I50 J;  1LJ9 A;  2A6E F;  3RSN A;  4KUM A;  1T56 A;  5ICE A;  4XK4 A;  2LYC A;  1U8B A;  3BJA A;  2D5V A;  1FSH A;  3OKX A;  3QOE A;  1MZB A;  4KIT B;  3J7A O;  1DG1 G;  3FX3 A;  1EJ9 A;  2CUJ A;  2C5B A;  1FBQ A;  4WX9 A;  1EXM A;  5F1J A;  1E3X A;  1HZE A;  2BM1 A;  2G7U A;  4E4H A;  4TMZ A;  4I02 A;  4YXW A;  3D5S C;  3ZQL A;  1UD8 A;  3WTZ A;  5TR9 A;  2V26 A;  1JXS A;  3F8N A;  2O9L A;  3FBN B;  2LFB A;  1HXD A;  5DD8 A;  1KRH A;  4GQN A;  3H92 A;  4QSH A;  1MJ9 A;  2FX0 A;  2FX3 A;  2LY1 A;  3Q3S A;  4LIU A;  1R5H A;  4XKW A;  1ZG3 A;  5ERI A;  3Q0U A;  1O3S A;  1YW7 A;  4Z4R A;  4JOM A;  5H6R A;  3M07 A;  1JKQ C;  5BPD A;  1E3Z A;  1X3W B;  5DUI A;  1OGI A;  3OZV A;  2LBF B;  2GJP A;  3GQ7 A;  1NB9 A;  1ZLJ A;  2M8E A;  2VOD A;  2WAF A;  2IXS A;  5H6Q A;  1JE8 A;  4C2L A;  5HLG A;  2KMU A;  1A5J A;  1YLF A;  2F5D A;  4UB6 C;  2LP0 A;  2OBS A;  2FBK A;  1JTX A;  2B7C A;  4AYB N;  4YHB A;  1RKT A;  1K61 A;  5FJ8 J;  3SEQ A;  2FSW A;  1I39 A;  4NK6 A;  2C4U A;  2CO5 A;  4H0E A;  2Y0S A;  3OYA A;  3RZO J;  2HVR A;  3SFI A;  4MR0 A;  4YZA A;  3S1Q J;  1A8P A;  2GJK A;  1SFX A;  4OPO A;  4URR A;  1N0U A;  1VI0 A;  2PMU A;  4HLX A;  3L2W A;  2DBB A;  2EA4 A;  4XN0 A;  4RD1 A;  4DK1 A;  1H80 A;  2X51 A;  3OOC A;  3U1D A;  3RIQ A;  5C1C A;  1QO0 D;  3GZ6 A;  3R60 A;  1XX5 A;  3NWT A;  3DP7 A;  2HVS A;  1TNT A;  4Q4Z F;  4YIF A;  1DPU A;  3PSS A;  2C4T A;  2JA8 J;  5IP9 J;  4Z4W A;  2DEU A;  3OIQ A;  1MW7 A;  1BI2 A;  3I0T A;  4R71 A;  4IQ4 A;  3RPU D;  2NOJ B;  1IHM A;  4BDY A;  2FML A;  1E43 A;  4KKS A;  5HOO A;  1ZG5 A;  4TMW A;  4EGZ A;  3OV8 A;  1TVC A;  1KA8 A;  1W5C C;  2E5Z A;  4J01 A;  3WQZ A;  3OP1 A;  5ICG A;  3OYN A;  3EUK L;  2ZO4 A;  1DAR A;  2Y9Y A;  3QU6 A;  3CD6 I;  2XPU A;  5DEQ A;  4QVJ A;  2Q2E A;  3PUB A;  3ECO A;  1G3Y A;  3I9V 2;  4PFO A;  4RAF A;  4RJL A;  1FWZ A;  3CLO A;  2ZXH A;  4II2 A;  2O61 A;  4U0W A;  1RUO A;  3F8M A;  5JLX A;  1LE8 B;  2VJ4 A;  1VQ4 B;  2D3L A;  1XDU A;  1XCV A;  3C2H A;  3PNV A;  4MEY F;  5K1Y A;  3AG2 H;  3GTQ J;  2NPF A;  3AVV A;  2WY7 Q;  2BXZ A;  2LTP A;  2XB5 A;  1Y0U A;  3VMF A;  2PJP A;  5BOX A;  1W4M A;  1VQ8 I;  1HC8 A;  4G7Z F;  3ZQI A;  3WU1 B;  3S17 J;  3GLL A;  5IYC J;  1T33 A;  3GFM A;  4B09 A;  2VN2 A;  3AFH A;  1IB0 A;  1Z67 A;  1U2W A;  3P9K A;  1EKE A;  3J81 k;  5E6T A;  3ABK H;  3KP2 A;  3GEZ A;  1IV8 A;  2E1N A;  3K70 D;  2JT1 A;  1BR4 A;  4S04 A;  2WR8 A;  3VSL A;  2UUZ A;  1T08 B;  1Z6R A;  4RM0 A;  4WZK A;  3OJW A;  3TOA A;  3OOU A;  1LVK A;  3H3Z A;  2CYY A;  5GPA A;  2RNJ A;  2YUS A;  2X4H A;  4XNF A;  4OIQ F;  3OOP A;  2OV7 A;  3FHZ A;  2ZSI B;  1MSE C;  2NTP A;  2VJI A;  2YX7 A;  1J7K A;  2PBI A;  5DD4 A;  4L9T A;  3TO7 A;  1A31 A;  3CJN A;  1FEX A;  3HAG A;  2F48 A;  2M1B A;  2ME0 A;  3K9T A;  4EAT A;  2L9R A;  3P7N A;  3OWT A;  2X48 A;  4AM3 A;  5EEA A;  2NXN B;  2WPD A;  1K78 B;  4FET A;  3R0J A;  3F3X A;  3CC2 I;  3EQL F;  1Y8Q B;  5FGM A;  5JVG F;  2ZIT A;  2Z3Y A;  4HQE A;  2Z9O A;  5FRM A;  3RQ4 A;  5L3F A;  2MH2 A;  4OJP A;  5J6X A;  3HOX J;  1QHG A;  4I09 A;  5D4R A;  2EA2 A;  1Y0R A;  2ZCW A;  3ZQC A;  1MBH A;  1WJE A;  2CQ7 A;  3BC9 A;  4PC1 A;  3LQQ A;  2EFQ A;  1W34 A;  4YDT A;  5IT9 Z;  1XMK A;  2XNJ A;  1W7P B;  1Y8R B;  1NB0 A;  4L5I A;  1YIT I;  2A6H F;  1RMG A;  1MD0 A;  4GYI A;  1EFC A;  4Y17 A;  3GW2 A;  1OYI A;  5TGT A;  4LMY A;  3CCY A;  4E7H A;  1YE9 A;  1D1B A;  3V7R A;  5LRR A;  4M0L A;  1NG7 A;  1R6R A;  3OFN A;  1IUF A;  5E1W A;  5J35 A;  1J0R A;  2VQL A;  4IJA A;  4PJM A;  2ME6 A;  4X6A J;  3CMM A;  3ISX A;  2LDU A;  3PSF A;  1MND A;  1T38 A;  4UHT A;  3HHH A;  1IJE A;  1QCX A;  1R1T A;  3CO6 C;  4G1B A;  4HNV A;  5CQG A;  1RET A;  4IKF A;  1OYY A;  1N07 A;  1LVA A;  2LOO A;  3GLX A;  1T6Z A;  2BW3 A;  1UMQ A;  5DNS A;  4RB3 C;  2J5O A;  4RGS A;  3SZE A;  3X2Q H;  3WYA A;  2XAJ A;  1VQK I;  1O8L A;  2VFO A;  4NB5 A;  2W48 A;  1J9I A;  4P5O A;  2CV1 A;  2STT A;  1VQN I;  3DBL B;  5CVJ A;  5IK2 A;  1Y56 A;  4B48 A;  3CDH A;  1O8K A;  2K9N A;  4IHY A;  4OIN F;  3GVJ A;  4GXO A;  3DBR B;  3VSK A;  4M6Y A;  1D8T A;  1LKX A;  1TYX A;  3M8J A;  1COW A;  2OCE A;  4NDL A;  3L1P A;  3GFJ A;  1BR2 A;  4P96 A;  4ZZL A;  3RTR A;  3ZZ0 A;  3DTI A;  2E1C A;  2K02 A;  1E3O C;  3CUQ A;  3CCU I;  2K9Q A;  4CH7 A;  2FEZ A;  1CZF A;  3OMY A;  4LOC A;  2XGJ A;  1PJR A;  2BXY A;  5KCM A;  3B6C A;  1IF1 A;  1JB9 A;  3S3M A;  3B4N A;  1V5F A;  5KVR A;  3EYY A;  2IAI A;  3SEJ A;  1W5S A;  2DOG A;  4GO1 A;  4MHG A;  2M45 A;  3WWG A;  1R5O A;  2R7O A;  1QG0 A;  2VNJ A;  4X05 A;  4DYQ A;  3ZBT A;  2CC2 A;  3LA3 A;  2I1L A;  2R7V A;  2E71 A;  3KP4 A;  1FNB A;  1KZL A;  1Q82 D;  1K28 D;  2L01 A;  4IEJ A;  1D8K A;  1SFE A;  3KPH A;  2IW5 A;  2YX4 A;  1D1N A;  2DJI A;  2NST A;  1S0U A;  3BR2 A;  1TTT A;  3VNU A;  2W7Z A;  1Z6T A;  1BC7 C;  2XZO A;  3CPW B;  1V4R A;  2TDX A;  1BX1 A;  3Q3A A;  3I64 A;  5BS6 A;  2D2W A;  2DYR H;  3TDZ C;  4OPW A;  3AGP A;  1ETV A;  4Y15 A;  1TYW A;  1UD5 A;  4NUB A;  2PEX A;  4HLY A;  1U2R A;  2V31 A;  4P2N A;  1PUF B;  2E2I J;  2A61 A;  3CME B;  4ZGN B;  1VZ0 A;  1D1C A;  1RC9 A;  3BY6 A;  3EPZ A;  1U0J A;  5ILV A;  4RM3 A;  3S93 A;  2UZK A;  1W0U A;  2DCE A;  2BM0 A;  3ZN0 A;  3HOW J;  4J0Q A;  2IS6 A;  2E1B A;  1R9T J;  4DBR A;  3ABT A;  2OUM A;  4BEH A;  4KMU X;  3QPS A;  3PO2 J;  1X3Z B;  1YG2 A;  5FO5 A;  3MN2 A;  3BT9 A;  1QGZ A;  4HEA 2;  1O8M A;  1W0K A;  4UB8 C;  2IJL A;  2R0Q C;  1BPL A;  5E3M A;  4OAY A;  3E6D A;  3GWZ A;  5HLI A;  3F8C A;  3HOZ J;  3SZG A;  2MH9 A;  2RV8 A;  2LVS A;  3PFI A;  4W97 A;  3HM5 A;  2H1K A;  1T95 A;  3IV5 A;  1G8X A;  2OTL I;  2OJE D;  1S72 I;  1Y6I A;  1ON2 A;  4NQW A;  3TW6 A;  2OYN A;  4XSX F;  4M73 A;  1IB4 A;  2NSP A;  3Q6Q A;  1Y0Y A;  3JW4 A;  2CMP A;  3PO3 J;  2M87 A;  3SYT A;  3W2V A;  4B1R A;  1UJ8 A;  3SJM A;  1P7I A;  1E1Q A;  1QRC A;  2AHO A;  1O57 A;  1W7P A;  3J81 Z;  2XOK A;  2WAQ N;  1Z3X A;  4G7W A;  2I10 A;  4LG0 B;  1ZRD A;  1G7S A;  5L3B A;  2ZJ2 A;  3KYC B;  3M3Y J;  4CDG A;  2F4M B;  4E7Z A;  4BGD A;  3T9G A;  2WTE A;  4PJJ A;  2NT6 A;  4D5C A;  5CVI A;  2GWR A;  1XGM A;  1VQL I;  2OZU A;  1KTV A;  2VUM J;  2IA0 A;  1B9M A;  1MMN A;  1WH5 A;  1BJZ A;  4L8J A;  2C78 A;  4TSF A;  4ZZD A;  5F4O A;  2JN9 A;  1APL C;  2XRL A;  2OTJ B;  2PYG A;  1I3A A;  2JVG A;  3ASQ A;  3ZZT A;  2G0Y A;  3MKW B;  3Q0V A;  5E3O A;  4KT5 C;  2XSJ C;  3QFR A;  3KEO A;  4M3B A;  4PSX A;  3T0Y A;  3TO9 A;  4QTR A;  1YJW I;  3U9G A;  1WXR A;  2DW4 A;  1NTC A;  1RI7 A;  4HRI A;  3FBI B;  2PN6 A;  1JHF A;  2QUF A;  3H9J A;  3KZI C;  3HOY J;  2O7O A;  1B2R A;  2CW8 A;  3OZW A;  1OOC A;  2F6C A;  1D0Z A;  2O8X A;  4P22 A;  4YFX F;  2HQR A;  2VBK A;  2OAZ A;  3FM3 A;  3GF2 A;  2VNH A;  2Z6B D;  2F5V A;  3B6A A;  3V8L A;  4AUX A;  5FKK A;  3TED A;  2OU2 A;  1EWY A;  2R5Z B;  2RC6 A;  1BBY A;  4OJO A;  3VOD A;  4F55 A;  3BG3 A;  2BSA A;  1YIT B;  2PMZ A;  3ISP A;  4I01 A;  4JYK A;  1SFU A;  1A6I A;  2KIS A;  3I58 A;  5B66 C;  5LGN A;  2E2H J;  4BY1 J;  4A3J J;  1PJ5 A;  2WB1 A;  2M8G X;  1FTT A;  5AIQ A;  2EZH A;  1WJB A;  2AXT C;  4A5M A;  2W4S A;  3F23 A;  1H8H A;  1WJD A;  5DS9 A;  4UAJ A;  5M3F J;  3O6B B;  3GTO J;  4B3A A;  1VF7 A;  4AF6 A;  3GTK J;  3TBI A;  1WH7 A;  3HOT A;  2EQR A;  2HMA A;  4B3F X;  1RES A;  3K0L A;  1I6H J;  2L4M A;  3E5Q A;  3HIF A;  1OKR A;  2OA4 A;  1P6R A;  3S2H J;  3U6K A;  2KIU A;  1R23 A;  3FZV A;  3REO A;  3WTV C;  2A6T A;  1S7E A;  1TT0 A;  2WJV A;  1JJ2 B;  4IHV A;  2DJN A;  5LBQ A;  2BE5 F;  2XPW A;  1PXZ A;  2JSC A;  2UVE A;  1VQM B;  1J09 A;  2VFM A;  2E5N A;  2GA2 A;  1XMA A;  1WI9 A;  3F9K A;  3FXO A;  3FPK A;  3AVX A;  2O17 A;  1T6S A;  1FYK A;  5C4X J;  4D5F A;  3S32 A;  1FP1 D;  1AIP A;  1R1V A;  4Z2Y A;  3KP7 A;  4ZYH A;  1B8I B;  2R93 J;  1L0O C;  2XRO A;  4FAS D;  3HKZ N;  1IXC A;  2DTZ A;  1ZR2 A;  1YJ9 I;  1J59 A;  1XDS A;  5IOY A;  2QEN A;  3DWL E;  3PNY A;  4E7S A;  4A12 A;  2ODL A;  4HF2 A;  4HBL A;  3CCU B;  2INV A;  3CCJ B;  5AMV A;  3JSP A;  2RAE A;  4BHB A;  2INU A;  4KH3 A;  3ABU A;  3H9Q A;  4OOV A;  3FDY A;  1H85 A;  1RQP A;  4ROX A;  3F22 A;  3CCR B;  1YJN B;  4FE7 A;  2JPB A;  2QDX A;  5LEJ A;  5FNZ A;  4CCM A;  2EWN A;  3PIP F;  4IHT A;  5E8I A;  2KRC A;  1MNM C;  5IYQ A;  1KCC A;  2L5Q A;  2E7X A;  5F08 A;  2ZKZ A;  1K4Z A;  2X53 S;  3DCF A;  1OR7 A;  3SFZ A;  1SFO J;  1X0C A;  4QFM A;  3BG7 A;  1NDH A;  1WPC A;  3OSF A;  2CFX A;  3NE5 B;  4XLN F;  2O0W A;  3LQ6 A;  2K86 A;  3TMO A;  4RDU A;  2DDA A;  2EFW A;  3LMW A;  4EJU A;  2E19 A;  2NVY J;  3I56 I;  1QH0 A;  4LBY A;  1MKM A;  5L3G A;  1ZTR A;  5FLV A;  1VND A;  1FT9 A;  4M9S A;  4RD2 A;  1YLO A;  1X4O A;  2AXL A;  2W85 A;  5AN9 A;  2CQK A;  4BH9 A;  4CGZ A;  3FXK A;  1U5T C;  4IRI A;  3FY3 A;  1DP3 A;  2QBY B;  1G59 A;  4RD0 A;  2OQG A;  4Q48 A;  2IPQ X;  2RC5 A;  1HVX A;  4DOZ A;  3LA2 A;  3TO6 A;  2K85 A;  1V0E A;  2Z16 A;  4OJ6 A;  4XLP F;  1YIJ I;  3IP4 B;  4U0V A;  2F4I A;  4XLF A;  4XRS G;  3OL3 A;  1CNE A;  3JX8 A;  3K1N A;  2WWY A;  4LLN A;  1QFZ A;  4A69 C;  1ETY A;  1GLN A;  5CDF A;  3CC4 B;  2BM6 A;  3GQ9 A;  4L9J A;  4IXA A;  1K4T A;  2FOW A;  4OMY A;  1QU3 A;  3CW2 A;  1MBG A;  4XOP A;  4ZC3 A;  1FMW A;  4DYC A;  3M8E A;  1Z3Y A;  3JRB A;  1PP7 U;  1VQ9 B;  4XL9 A;  3TGN A;  4HV5 A;  4Z4V A;  1TLL A;  1G3W A;  3BQY A;  4HW0 A;  4CIC A;  4V19 K;  5THX A;  3OYI A;  1T98 A;  4YFK F;  2P3M A;  3GUD A;  2ZNY A;  4A3D J;  1QJV A;  2V7F A;  4HF1 A;  2MBF A;  4CUG A;  2FXA A;  4E7I A;  1U5T A;  1ITY A;  5A89 A;  2CW7 A;  2VKD A;  1WVR A;  1KK2 A;  1JA0 A;  4EW9 A;  4K1X A;  3D1N I;  4X8I A;  2EV0 A;  3FXJ A;  2R3S A;  1P4M A;  1K8F A;  1XSV A;  2HZT A;  3UNG C;  2XT2 A;  4NBS A;  3HEF A;  3MVP A;  4P26 A;  4Z4Y A;  1YHQ B;  2R5Y B;  2GBY A;  5GP9 A;  5D6F A;  4BXU A;  2ZXW H;  3AGQ A;  3VB2 A;  1P7J A;  2ZZG A;  1K4S A;  1WP6 A;  1BI3 A;  3ES9 A;  2QA4 B;  3PSI A;  2NRA C;  5JHU A;  3FXQ A;  1BOA A;  1R7J A;  3QE2 A;  1WJ5 A;  4PDK A;  1FDR A;  1EH7 A;  2F4N A;  2EIN H;  2HTS A;  2VXD A;  2JIZ A;  4PSW A;  4UUS A;  1WCM J;  3RCO A;  3ABM H;  3ZPL A;  2EIX A;  3HOU J;  4UV9 A;  2HKX A;  3HZJ A;  4ZDL A;  2DFE A;  1R71 A;  3FHN A;  3G1M A;  3BPX A;  3JAM K;  1XB4 A;  3QU3 A;  3U2R A;  4KJZ A;  3WNC A;  2ESN A;  2JA2 A;  1QVU A;  2RGV A;  2EB7 A;  2TCT A;  3G3Z A;  1X1P A;  4EGY A;  2EBI A;  3ZN1 A;  4XOT A;  3DLL F;  4A93 J;  5KHD A;  3QFC A;  2K3P A;  4RAG A;  2GPJ A;  3IL2 A;  2PMZ N;  2P0W A;  4B44 A;  4YAF A;  3BNW A;  3E20 A;  3GBG A;  4FXU A;  4I0A A;  2DOA A;  2N8G A;  4M72 A;  4D7M A;  2QTZ A;  1YX3 A;  3SYJ A;  4HNU A;  5EJC A;  1QVG B;  2H8W A;  2OCC H;  2Y2Z A;  5J4V A;  5FLX K;  3KL9 A;  2MLK A;  2YSR A;  4L9V A;  4CZC A;  2LNB A;  1R5N A;  5E17 F;  2DA5 A;  4YRV A;  1WTH D;  3E6C C;  1H88 C;  4KKT A;  4DBQ A;  3GCM A;  1J9Z A;  2YU3 A;  2VB6 A;  1I18 A;  3GTM J;  4IW3 B;  2IT0 A;  1DDI A;  1GAW A;  4PZJ A;  2P7C B;  2HQN A;  3PA1 A;  3N97 A;  1BN8 A;  1R22 A;  2LK2 A;  4BJ6 C;  2QQ8 A;  2D74 A;  3H9N A;  2J8I A;  2QZ8 A;  3CJR B;  1JTA A;  1XD7 A;  1BIA A;  4RAY A;  4LB5 A;  1V5G A;  4PGH A;  2XAS A;  2CSO A;  4RPD A;  5F6F A;  1IV6 A;  3IH3 A;  1B4A A;  2DOD A;  2CW0 F;  2GXB A;  1HA3 A;  1HW5 A;  3BZ6 A;  2Y48 A;  1OCP A;  2GLO A;  5E3N A;  5K5Q A;  3L9F A;  1FYL A;  3BRO A;  3N90 A;  1SD7 A;  1TP4 A;  3GZN B;  2C77 A;  1K8A D;  3K70 C;  3N6Z A;  2ADU A;  2HPI A;  2VL8 A;  1EFT A;  3JRC A;  2LD5 A;  1REP C;  3BJ6 A;  1MH3 A;  2B7B A;  2CQN A;  1KZH A;  3CCV B;  3FK6 A;  1YJN I;  2H94 A;  3D26 A;  2E34 A;  2KZV A;  4A6E A;  1JJ8 C;  3ULQ B;  1G7C A;  2Z33 A;  2EFG A;  3CCE I;  1QHH D;  2B5O A;  4MQV A;  4J00 A;  3DQV C;  3E1S A;  3PET A;  1WQ2 A;  2HYF A;  2YS9 A;  4MTE A;  1MDM B;  1EV7 A;  2RQQ A;  5CQE A;  1ZKG A;  3BTJ A;  4G12 A;  4A3E J;  1U8R A;  3ZPN A;  3UKG A;  1DBO A;  3OYD A;  4N0B A;  1U5T B;  2BZT A;  2X0L A;  4NK8 A;  2IGO A;  1W36 C;  2X1D A; 
#chains in the Genus database with same CATH homology
 1O8H A;  3H35 A;  1S9H A;  2ELJ A;  3K70 D;  2R9V A;  2KLO A;  2M5S A;  3HXL A;  1BR4 A;  3VSL A;  1MMG A;  2UUZ A;  1D0Y A;  3T53 B;  2PJR A;  4IX7 A;  1HG8 A;  3BCD A;  4C9Y A;  2CV0 A;  5CKT A;  3OOU A;  4DIQ A;  1LVK A;  5FRO A;  3VYT B;  4II3 A;  4CCJ A;  4XNF A;  2CS3 A;  4HWV A;  1OFM A;  2OV7 A;  3L2V A;  4JMQ A;  2ZSI B;  4HPQ A;  4C30 A;  3SEZ A;  2IGK A;  2VJI A;  2NTP A;  3B90 A;  4I84 A;  2L9N A;  2F43 A;  5FL7 A;  3GVL A;  3HAG A;  4W8S A;  1BR1 A;  2ZXI A;  1KMH A;  4EAT A;  1EE6 A;  3GQ8 A;  3OWT A;  3A3G A;  3LNN A;  4BDZ A;  3VSV A;  3K4K A;  2VJJ A;  2QY1 A;  1DGW Y;  4N4N B;  2V1N A;  4FET A;  2QE7 A;  2JVH A;  4OZZ A;  3LSH A;  5LD2 C;  5FRM A;  1X1B A;  2X85 A;  2V9K A;  3RQ4 A;  2X8K A;  4OJP A;  3OL4 A;  1QHG A;  4CCK A;  2VQC A;  2WAQ A;  4BE1 A;  2IGM A;  4RLF A;  2PJR B;  3OR2 C;  3SDB A;  2DT6 A;  1WJC A;  1WJE A;  3L2R A;  3BC9 A;  2DT7 B;  2VQG A;  2ZZE A;  1V0F A;  4U87 A;  3OE7 A;  1RMG A;  2KPM A;  1EA3 A;  3T9G A;  4X0G A;  2GOM A;  5TGT A;  2WSS A;  4E7H A;  1YE9 A;  1D1B A;  1NG7 A;  4JQF A;  1R6R A;  4CA0 A;  1MAB A;  3OFN A;  2PYH A;  2VQL A;  4PJM A;  4G7X A;  3CP8 A;  2BOL A;  3CMM A;  3OS1 A;  2M0M A;  3K4B A;  4BE2 A;  4U49 A;  1K6Y A;  3PSF A;  3ZSC A;  1MND A;  1QCX A;  3FPP A;  2W6J A;  5CQG A;  2X6X A;  4IKF A;  4W8Q A;  2LOO A;  3LMM A;  2BW3 A;  4BE0 A;  4BQO A;  2Q2E B;  3C2G A;  2R7R A;  2WAD A;  3OEH A;  1O8L A;  4MXN A;  1AA7 A;  4ASU A;  4XKC A;  1DQU A;  4P5O A;  3OYK A;  2CV1 A;  3VWB A;  3GVK A;  4XMY A;  4GRI A;  2QKL B;  2CUZ A;  2HDW A;  1Y56 A;  3DU5 A;  5IK2 A;  3OYM A;  4B48 A;  1O8K A;  2ZSH B;  3BCF A;  3GVJ A;  2HU9 A;  1IA5 A;  3VSK A;  2V7Q A;  1LKX A;  4E7L A;  3M8J A;  1COW A;  2VXZ A;  2XC7 A;  4XLE A;  3OAA A;  3IAS 2;  3V42 A;  1UAA A;  4DNR B;  1BR2 A;  3RTR A;  2O0V A;  3GRH A;  3DTI A;  3H94 A;  3VSU A;  3QOD A;  2AQF A;  3G2B A;  3NWS A;  4LIT A;  4CH7 A;  3OMY A;  4BJT A;  3OYB A;  1PJR A;  2HLD A;  2XGJ A;  1CZF A;  4OZY A;  5KCM A;  1DBG A;  3S3M A;  3B4N A;  1V5F A;  1E79 A;  4D9J A;  4F93 B;  1UD4 A;  4W8R A;  4PK4 A;  4C2U A;  2XZL A;  3WWG A;  2VBM A;  2R7O A;  5HNH A;  2KDO A;  4N4O B;  2O5R A;  2R7V A;  1PYV A;  1KZL A;  4KIS A;  1K28 D;  3JUR A;  2XAU A;  2R7W A;  3J7A Y;  2MFZ A;  3DKY A;  4PUS A;  4F92 B;  3JU4 A;  1FMV A;  2DJI A;  3S3N A;  2NST A;  4DJA A;  3W2W A;  3TL4 X;  3K10 A;  2KVO A;  2EWE A;  2XZO A;  4YEL A;  2Z1D A;  3AKZ A;  1OB0 A;  2KHM A;  2XF5 A;  3H5N A;  1WFX A;  2LRD A;  1UD5 A;  3M1C A;  4NUB A;  2V31 A;  1KCD A;  2LH9 A;  3HOS A;  1VZ0 A;  1D1C A;  4ZDO A;  4E6K G;  3EPZ A;  1U0J A;  5HKK A;  4RM3 A;  3S93 A;  5HVQ C;  2DCE A;  2XDV A;  1Z7L A;  2D3N A;  1E0E A;  1LDK B;  3DTK A;  4OJ5 A;  2IS6 A;  2E1B A;  2HVQ A;  4DBR A;  3T51 B;  2BVM A;  2R7U A;  3E0J B;  2OUM A;  4BEH A;  4IQJ A;  4ZYA A;  2K9M A;  3OPO A;  2BSP A;  4DGW B;  3LSG A;  1D1A A;  3I3L A;  3IAM 2;  4HEA 2;  1O8M A;  3W3C A;  3OR1 C;  3DTE A;  1W0K A;  2GK7 A;  1BPL A;  3A2K A;  3VR6 A;  1PLU A;  4NC7 A;  4OAY A;  3ZXS A;  2E60 A;  3SZG A;  1BMF A;  2WA0 A;  4PMH A;  2IGN A;  4AVZ A;  1T95 A;  3PL8 A;  1VJS A;  1G8X A;  3K4N A;  1Y6I A;  3BG6 A;  3MMY B;  1IB4 A;  1WJA A;  2NSP A;  1X19 A;  3OYC A;  2CMP A;  1T5E A;  3CJQ B;  4ANJ A;  3OYE A;  2E1M C;  4YZ0 A;  1YX5 A;  4HST A;  4B3G A;  1BLI A;  2VIX A;  3SYT A;  3W2V A;  1X1A A;  3LSK A;  1E1Q A;  4B47 A;  1UD2 A;  4NQW B;  3OS0 A;  2QXZ A;  2IS4 A;  2ZTG A;  3OEE A;  2XOK A;  1IRX A;  1W36 D;  4XM3 A;  1Z3X A;  4RLQ A;  4XLC A;  4G7W A;  4R79 A;  3KRG A;  3DPU A;  4XLA A;  1I8D A;  4F91 B;  3HPH A;  4E7Z A;  4IZZ A;  4BAC A;  4BGD A;  2RNG A;  3W2A A;  1ERD A;  2ZFU A;  2WZP P;  1MMD A;  2QKM B;  3H9G A;  4PJJ A;  2VLA A;  3G05 A;  2NT6 A;  3KEW A;  4ZTF A;  2FUG 2;  2DIE A;  4RMN A;  1UD3 A;  4OJL A;  1MMN A;  2VAS A;  4NC8 A;  4BQN A;  1W9X A;  4L8J A;  4Z1M A;  3BCB A;  3ZR8 X;  4TSF A;  3UW0 A;  3EQO A;  1Z21 A;  2PYG A;  1OGM X;  2JVG A;  2E1M B;  3H5R A;  2ZZQ A;  3MKW B;  1T0F C;  2A5W A;  2JSP A;  3H0D A;  2XSJ C;  4U7B A;  1HA8 A;  4PSX A;  2XND A;  3T56 B;  2BW3 B;  1O8F A;  2GOX B;  3IUO A;  4HRI A;  3FBI B;  4NNJ A;  2OC6 A;  3H9J A;  1JI8 A;  4DNT B;  4EW9 A;  1OOC A;  2CW8 A;  4BU2 A;  2F6C A;  1D0Z A;  5HNF A;  4P22 A;  3OYH A;  3VMW A;  2VBK A;  2XF7 A;  2UVF A;  2Z6B D;  2F5V A;  2MD0 A;  4XLH A;  4YZQ A;  3CES A;  4OJO A;  4F55 A;  2K5C A;  4RM2 A;  2R7Q A;  4ZDP A;  2NTQ A;  2PMZ A;  4Y3O A;  2VBE A;  2PEC A;  4C2T A;  4BQQ A;  1X1D A;  3ONQ A;  4CCL A;  3CF2 A;  2WB1 A;  2CK3 A;  3DDY A;  2CH0 A;  1O8I A;  1WJB A;  1H8H A;  1UEL B;  2M3A A;  2W1O A;  2W4S A;  4P1W A;  1WJD A;  2WJY A;  3GQB A;  4YZX A;  3PFY A;  1VF7 A;  1O8G A;  3ZIA A;  2X6Y A;  3SUC A;  3TBI A;  3HOT A;  4B3F X;  4XKV A;  2AQE A;  4PJL A;  4OWR B;  1SKY B;  2NT9 A;  1NBM A;  2WBM A;  1WMR A;  1PE9 A;  2L9S A;  2LBF A;  4BL0 B;  2A6T A;  4ZTJ A;  1TT0 A;  2WJV A;  3LFU A;  2WAE A;  2UVE A;  2M4G A;  3DPL C;  3LL7 A;  1LFP A;  2RRE A;  3KYL A;  2NTB A;  3S3O A;  2CFO A;  1O8D A;  3AL0 B;  1UD6 A;  3DU6 A;  1J09 A;  1PXZ A;  2E5N A;  4QPQ A;  4AU7 A;  2QX3 A;  1RU4 A;  2GK6 A;  4UZU A;  5CPR B;  2Q1Z B;  2X6W A;  3F9K A;  1O8J A;  4YEJ A;  2O17 A;  2M4K A;  4XKB A;  1IDK A;  1OR7 C;  3S32 A;  2M7A A;  3KEY A;  2VQH A;  3QYF A;  2X1C A;  4G6I A;  2HQA A;  2V4D A;  4FAS D;  3A3B A;  1E1R A;  1OHH A;  2LY2 A;  2M7B A;  3DWL E;  3PNY A;  2V4J C;  2W82 A;  4E7S A;  2ODL A;  4B43 A;  1ZEL A;  2KL4 A;  2INV A;  1NHC A;  5AMV A;  2ZZF A;  1BHE A;  3OW7 A;  2Z2S B;  4F52 A;  3HL2 A;  1OFL A;  2INU A;  3H9Q A;  4PJN A;  1JRG A;  3K4L A;  4XQF A;  3DPT A;  3FDY A;  2KP6 A;  4F3Q A;  5KNL A;  2ZTN A;  3VYR B;  4CCM A;  2HNH A;  2KRC A;  1TZL A;  1KCC A;  2IQ7 A;  2L5Q A;  4CCO A;  4E0F A;  2LG4 A;  2X53 S;  1MMA A;  2IS2 A;  2NZM A;  1X0C A;  1N75 A;  2MAB A;  4Z03 A;  2JJ1 A;  3BG7 A;  4CSW A;  4E7J A;  1WPC A;  2JJ2 A;  3NE5 B;  2O0W A;  3KX2 A;  3MD2 A;  2DXI A;  1KTW A;  3TMO A;  5LFA A;  3OYL A;  2V6E A;  2K9L A;  1V5E A;  3CP2 A;  5DN6 A;  3LMW A;  2O04 A;  2VPL A;  2W6I A;  2JUG A;  4DK0 A;  2WPD A;  4HG2 A;  3ZGK A;  3L2U A;  1P9Q C;  3VST A;  1VBL A;  3D5R C;  1X4O A;  4MLO A;  3AL0 C;  2X1E A;  3FKJ A;  3MKY B;  2I8D A;  2HZD A;  3FY3 A;  1SAU A;  3VDX A;  1DP3 A;  1G59 A;  2R4G A;  3U21 A;  3EQN A;  1HVX A;  4DOZ A;  3CZ6 A;  4Z06 A;  3K6G A;  1V0E A;  2Z16 A;  3ZCO A;  4OJ6 A;  2KRH A;  3IP4 B;  4XLF A;  2F4I A;  4B3X A;  1N77 A;  3OL3 A;  4W8T A;  2HPM A;  5CDF A;  3BH4 A;  2L2O A;  1GLN A;  3S8P A;  4BS9 A;  1OGO X;  3GQ9 A;  3ZQQ A;  1H8E A;  1QU3 A;  1BOB A;  2GJR A;  1XG2 A;  4AYB A;  4XOP A;  4ZC3 A;  1FMW A;  4D1Q A;  4QPO A;  1Z3Y A;  2WY8 Q;  4HSR A;  2R7X A;  4XL9 A;  1NRK A;  2UV1 A;  3OYF A;  3DEE A;  2VJ5 A;  3ZRG A;  3OYI A;  2MYS A;  1KON A;  1D0X A;  3EUA A;  1QJV A;  2V7F A;  3OIP A;  4HNT A;  4CUG A;  3N05 A;  4E7I A;  3K4M A;  2CW7 A;  2VKD A;  3DLA A;  1O88 A;  3QYE A;  3VYS B;  1K5C A;  4Y4R A;  3FKS A;  4Z05 A;  3D5L A;  1NG6 A;  3HKZ A;  3RSN A;  3MKZ A;  4XON A;  3A4C A;  2R7T A;  3UNG C;  4TKO B;  2LYC A;  4BXF A;  3QOE A;  4KIT B;  2CUJ A;  5FRN A;  2ZZG A;  4BEH B;  4BJ5 C;  3K4C A;  4H4K C;  1WP6 A;  1E3X A;  1HZE A;  4E4H A;  3PSI A;  3H5A A;  1WJF A;  4YXW A;  1W0J A;  3D5S C;  1UD8 A;  2V26 A;  1WJ5 A;  3FBN B;  5C1E A;  1X1C A;  1UG0 A;  2VXD A;  4OAZ A;  4PSW A;  2JIZ A;  2XZP A;  4GQN A;  2LY1 A;  4LIU A;  3RCO A;  1FX0 A;  4XKW A;  3L2Q A;  3LSM A;  2Z8G A;  4JOM A;  2O1D A;  4TT3 A;  2W00 A;  1VLY A;  1DGR M;  4ZDL A;  1X4P A;  4KT6 A;  1E3Z A;  3FHN A;  4CCN A;  2LBF B;  2GJP A;  1OLT A;  3GQ7 A;  1IDJ A;  4KJZ A;  4C2L A;  2WAF A;  2IXS A;  2JA2 A;  1N78 A;  2R7S A;  2X3H A;  3A1Y A;  2KMU A;  3K4J A;  4XOT A;  5KHD A;  2K3P A;  1O8E A;  4ITV A;  2P0W A;  4B44 A;  1PKV A;  4XOR A;  2W7N A;  3GBG A;  2VKH A;  4FXU A;  2DOA A;  3SEQ A;  1YX3 A;  4NK6 A;  4HNU A;  2Y0S A;  3OYA A;  4XN3 A;  2HVR A;  4MR0 A;  4YZA A;  2LC2 A;  2GJK A;  4CZC A;  4URR A;  2BVL A;  4YRV A;  3L2W A;  1H80 A;  3LSI A;  1WTH D;  4DK1 A;  3BLY A;  4XN0 A;  2LRE A;  2X51 A;  4LG3 A;  2UWM A;  3OOC A;  3OY9 A;  4DBQ A;  4KKT A;  5C1C A;  1I18 A;  2VB6 A;  3GQA A;  3BCA A;  3VMV A;  3NWT A;  3VYU B;  2HVS A;  4LIV A;  1BN8 A;  3PNT A;  3OIQ A;  1MW7 A;  4IQ4 A;  3RPU D;  2NOJ B;  4BDY A;  3OS2 A;  4BJ6 C;  3UR3 C;  1GQ8 A;  2LZJ A;  1E43 A;  3CJR B;  4KKS A;  5HOO A;  1JTA A;  4E7K A;  1AIR A;  1V5G A;  1RWR A;  2CV2 A;  2KQR A;  4HIZ A;  1SFK A;  2E5Z A;  2MC4 A;  3WQZ A;  4J01 A;  3OYN A;  3EUK L;  3ZPP A;  3B8Y A;  3HUG B;  5HLT A;  2IS1 A;  4BUP A;  3PUB A;  3I9V 2;  3A35 A;  4PFO A;  3K70 C;  4U4B A;  2ZXH A;  4II2 A;  2HPI A;  2VL8 A;  3DKX A;  1EFR A;  2VJ4 A;  2D3L A;  3C2H A;  4Y33 A;  4XD7 A;  3PNV A;  4ZJZ A;  4G6T B;  4KKU A;  1MNE A;  2KZV A;  2WY7 Q;  2L7K A;  2XF6 A;  2F1M A;  3HC7 A;  3PJR A;  1QHH D;  4J00 A;  3DQV C;  3E1S A;  3HPG A;  4XR6 A;  3EUH C;  5JHF A;  3OYJ A;  3HG9 A;  3QYB A;  2RQQ A;  5CQE A;  2JDI A;  3ZPN A;  1DBO A;  3OYG A;  3AFH A;  3OYD A;  3BC8 A;  4PFP A;  4NK8 A;  2IGO A;  1W36 C;  2X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...