2X6YA

Tailspike protein mutant d339a of e.coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 232
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x6yA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x6yA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x6yA02
2PECA 3SUCA 4XMYA 4XR6A 2O1DA 4YZXA 4XLCA 2X3HA 3VSUA 1PLUA 3WWGA 2NTQA 2NZMA 2VBMA 4XKWA 2O04A 2QXZA 3KRGA 1EE6A 4XOTA 1RWRA 2NSPA 1O8GA 4OJOA 4U49A 2X6WA 1GQ8A 3T9GA 1KCDA 1O8KA 3B8YA 1IDJA 3ZPPA 1QJVA 1AIRA 4YZ0A 1BN8A 2BSPA 2QY1A 4NK8A 2VBEA 2INUA 4AVZA 2EWEA 2NT6A 1O88A 4YEJA 1DBOA 4MR0A 4OJPA 4XORA 1RMGA 1OFMA 4XKVA 3FY3A 1KCCA 1O8HA 2PYHA 4U4BA 5AMVA 2VJIA 3GQAA 1BHEA 2IQ7A 4OZYA 1K5CA 1KTWA 1OGMX 2X6YA 1OOCA 1PE9A 3JURA 4PMHA 4XN3A 1OFLA 1XG2A 1O8JA 1O8MA 4W8SA 5C1CA 1O8LA 2NT9A 4XM3A 4NK6A 1H80A 1O8IA 2O0WA 4XLEA 3EQOA 4Z05A 4OJLA 1O8DA 2X6XA 4OJ5A 4XONA 4XNFA 3ZSCA 2O17A 2VBKA 3VMVA 2NTBA 3GQ9A 1NHCA 2UVEA 1JRGA 2NSTA 4W8TA 4Z03A 3UW0A 4W8QA 4XL9A 3GQ8A 4MXNA 3B4NA 2Z8GA 4YZQA 1O8FA 2X85A 3VMWA 2VJJA 4W8RA 3GRHA 1O8EA 4OZZA 4HWVA 4YELA 1RU4A 2ODLA 1PXZA 1DBGA 4OJ6A 1OGOX 1QCXA 4EW9A 4I84A 5C1EA 4XLAA 3GQ7A 1IA5A 4XLHA 4XOPA 4Z06A 3B90A 2PYGA 2O0VA 3VSVA 1HG8A 2UVFA 4XN0A 2NTPA 4XQFA 1CZFA 1IB4A 4URRA 3VSTA 4XLFA 3EQNA 3LMWA 1IDKA 4YZAA 1JTAA 2QX3A 4C2LA 1X0CA 1WMRA 1VBLA 2INVA
chains in the Genus database with same CATH superfamily
3CMEI 2PECA 4JX4A 3JSPA 4XIDA 4P2NA 2F3LA 4HLXA 2LTPA 5D6EA 1KRHA 3OYNA 2LZJA 2ZMEA 2NTQA 4LOCA 1QVGB 3GO5A 4XKWA 2R7ZJ 2DOEA 2LRDA 1S5LC 4ZCLA 3SYTA 5GPCA 3Q6QA 4YAWA 4GDFA 1T95A 4PJLA 5IYCJ 4G1VA 2F5EA 1NB0A 1YRNB 3H35A 4HQMA 2RQPA 2DYRH 2UXNA 3JW4A 4WF2A 4F3QA 2B63J 2PEXA 4M1KA 4EJWA 3ELKA 2HNHA 1OR7A 1Q1VA 5E3LA 3CCSI 1G7CA 4QIWN 2UXXA 3I5UA 1BJZA 3GF2A 5GTIC 3RQIA 1E62A 5H5JA 1J59A 1ZN2A 2ZL6A 1KU7A 2J8IA 2Y31A 1HSJA 4GGGA 1YS6A 3ONYA 2VJIA 3VNVA 1VFCA 2EFGA 1WWXA 2XHKA 4TSFA 2BM6A 2QZAA 3IUOA 1JE8A 4RD0A 3WBJA 3OYGA 1H85A 2WR8A 4ZYEA 2CV0A 2HVQA 1RUNA 2NVTJ 2BOLA 1PVEA 2WB1A 4RBOA 2JK3A 3FWEA 3G1MA 4G94A 2FBHA 1K61A 2QCOA 3F8MA 4BY7J 3PIOF 2O0WA 1VQ6B 1FPQA 1O8DA 3A01A 4HDVA 3BR0A 1GVJA 1ULYA 2ZL5A 4M3DA 2C77A 3KP3A 2A5WA 1TW2A 3HGYA 5J3LA 2QN6A 3K4JA 3FM5A 3FJOA 5KAIC 4Q48A 1HVXA 4M53A 2ZXWH 1DDIA 3VFZA 4I0AA 1D2EA 2P81A 1OKRA 1D1BA 5FIUA 4OPSA 3ZQFA 4G8XA 4PK4A 3D5RC 2IGMA 4OOVA 1LFPA 3HPHA 4LLLA 3BG5A 4D7MA 1QFJA 2XNCA 2MLGA 1K78A 2HOAA 2Z1DA 4J00A 1VQ9I 4X07A 4E6KG 2X85A 2DFEA 1V5GA 3Q3SA 1Z6TA 1BI0A 1GDTA 4NK6A 3A2KA 3HPGA 1RRJA 2GJPA 1Q86D 4RLQA 1FC3A 3Q0VA 4ZYAA 1UCRA 1K79A 1W34A 3U6KA 2WZNA 3AVUA 1YFHA 1S4MA 5J4VA 1DBGA 1T0FC 1KA8A 2NXNB 4JRAC 2P8TA 4YFNF 2GZWA 2Q6OA 1KQSB 1WJFA 4LB6B 4BH9A 4WZKA 3SQVA 4DYRA 4AM3A 4OOXA 2W6JA 5CVRA 3CC4I 4AC0A 4XSZF 4CGZA 3KZZA 2FBKA 4LG0A 3PUNA 2PX9A 1R36A 3H0DA 1XG1A 5LHIA 3I55B 4M6YA 1A04A 2M45A 3HHHA 5ICGA 1U2WA 1OCRH 1IXRC 2FD5A 5JVGF 1CZFA 2MH9A 2LLKA 4IF4A 2W24A 1L1IA 2B0LA 4IRGA 4FASD 4RM2A 1X1BA 2VNIA 2XF5A 3H0GJ 3GLXA 2VBUA 3EQNA 2VJ5A 3R6KA 1W9XA 3HJEA 5DN6A 3F6OA 3CC7B 2KJCA 4M74A 3J81Z 1FLIA 2CW7A 4WXDA 2QBYB 1WMRA 4ITVA 3H9NA 2V9VA 3HUGB 3SUCA 1UMQA 3QPTA 3MKLA 1J2XA 4YHBA 5J6XA 2BM0A 2LR8A 3OEHA 3WWGA 2G0EA 2CUZA 4BAYA 3WHCA 3HTSB 3O2PE 2QQBA 3KRGA 4NCNA 3OYAA 4GXOA 3CLQA 3FMQA 3U6BA 3BOQA 2JPCA 3K7AJ 5GP9A 3VYRB 2GA2A 2JMWA 3ULQB 2HYGD 1K7AA 1OCCH 2K40A 4QPQA 1ORKA 1QJVA 4RM3A 1WH5A 1VF7A 3ZQIA 3OYHA 1JHFA 2STTA 3HBLA 1I50J 2O0YA 4ZZDA 3W2VA 2XT4A 3T8TA 3S3MA 4MFEA 5FRNA 2H09A 4K1XA 5EZGA 2HOSA 2HVSA 1HA3A 2BM5A 5CLSA 3NARA 3V7CA 3HHGA 1Y8QB 4BQNA 5CVIA 3ABKH 2L7FP 2RVCA 1S8NA 1YJNI 4YDTA 4A5MA 4X8IA 1AA7A 1K6YA 2KFDA 4LBVA 1SD5A 1ITYA 2E1CA 4YXWA 2ZBVA 3ZQCA 3DKXA 1BBYA 2KDOA 5F64A 4IZZA 1JUMA 4B48A 1LPQA 3V7RA 3F8BA 3BJOA 3H3VK 5HDGA 3C18A 4Z4RA 3CPWB 3DLAA 4ON0A 1QPIA 1MBGA 1KJZA 3QP6A 2M8GX 4UVBA 1MH4A 2XRNA 1EXMA 2CS3A 1MMNA 1MSEC 2K3PA 4Y9RA 2MH2A 2VT2A 2DMTA 4UUVA 5H20A 3E6MA 5K1YA 1PP7U 1USTA 3BQZA 4HX7A 2NRAC 1XN7A 2QQ8A 1IN5A 1KQ8A 3VMVA 5DTDA 1IC8A 1AKHA 1JRGA 2C6YA 2NSTA 1WI9A 5JHUA 4XL9A 2QTLA 3G6EB 1SVOA 2R7DA 1MJAA 2VQHA 2XT2A 2A5YB 2CU7A 2F4MB 3CJRB 4MYUA 1O8FA 4A3LJ 2OTLB 1VQKB 1F20A 4ACBA 1ZM9A 2F2EA 1T6ZA 3GXOA 3CCSB 4HWVA 3MZYA 4YELA 3GEZA 1P4WA 2TDXA 3EYYA 4OZZA 3AVYA 2ODLA 1QO0D 4YCQA 3ZZTA 3A8KA 2M30A 2CRGA 2ME6A 2W7NA 4RD6A 3AG3H 3HOTA 2IS1A 4DK0A 3LO8A 1KQ0A 2OD5A 3GZ5A 3PQJA 4A6DA 2LY2A 4G12A 4DW6A 3H1CA 3LSGA 3SJZA 2H1LA 1MIJA 2K27A 4Y15A 1E2XA 4PABA 4LD5A 1OISA 3S93A 3OYBA 2LKPA 2L9NA 2R7WA 1X3ZB 1POGA 1FSHA 1JI8A 3G1LA 1ONVA 2FF4A 1X4OA 1TLLA 3TKYA 3OL4A 1YJWI 3D0SA 3U2RA 2Y30A 2F4NA 1XSVA 4N3GA 3LJYA 2OTJB 3ZMDA 4C43A 5DDGA 3S1QJ 2VE8A 2E1BA 1YIJB 3VNUA 4K2EA 2DOAA 5B1AH 3FHNA 4XR6A 5CYVA 4L8JA 3FM3A 1K4TA 2JSCA 2X3HA 1FMWA 4RDLA 4KN7X 2HEOA 2MG4A 4YFOA 2LF7A 4YAUA 3I56B 3H5RA 2K86A 1LE8A 3I4MJ 3WNDA 4ESFA 3A1PA 3A02A 3L1PA 3EYIA 1RWRA 4OIQF 1IUYA 2JA8J 5LFAA 2X6WA 2ZJRF 2CFXA 3HOUJ 3H3UA 3F72A 4IL6C 1Y1WJ 1CGPA 1IDZA 2W7ZA 3ABUA 2V5IA 1E3PA 3A01B 4EEFG 3E20A 1D5VA 1PUEE 4RD4A 4FETA 4A0XA 3TW6A 1U6GA 3OYLA 2QY1A 4NK8A 2QENA 3B6CA 1IXSB 2IT0A 3WTSC 5CVVA 4DK1A 3GBGA 1F5TA 1Z7UA 2EWEA 4HRIA 1W4MA 1FEXA 1V5EA 4DGWB 4XKVA 2DA6A 5B66C 1KU9A 1LEBA 1EA3A 3HC7A 3ESWB 2NS8A 5L46A 1XSXA 4KT6A 2M4KA 3QAHA 3E6DA 1B9MA 4B8XA 2XB5A 4X7FA 3BR6A 2ZC2A 2BEOA 4B3XA 4KKSA 1I18A 4OZYA 3P5JA 1IN7A 4XD7A 1Z1DA 1XGMA 4BHCA 2D5VA 1LKXA 2YWEA 3JURA 1R1VA 3CCRB 2XGEA 1FOYA 3ZMUA 1RQRA 2M1BA 2ICWG 2OZUA 3BPVA 3DXJF 3I4PA 4N9IA 4XICA 2L54A 5B1BH 4HF2A 1QU3A 1BR1A 2VBVA 1Z21A 1X1DA 1Z0XA 1JA1A 4Z1MA 3OV8A 2EIMH 3CCYA 1WJDA 1AHDP 2VFNA 5F4OA 5F08A 4IHSA 4NQWB 2FQ4A 2LH9A 3N6ZA 1XMXA 2EV0A 4DOZA 2F43A 5HDNA 1R4MB 3PA2A 1QPMA 3WTZA 2P7VB 1U0JA 2NTBA 4EM2A 1YX2A 2HDCA 3RCOA 2COMA 1YJ9B 4W8TA 4II2A 1FMVA 2W00A 3QP5A 1EFRA 3CDLA 1TT5B 3HEFA 1LE8B 1GXPA 2DN0A 4DNCA 4EVIA 3LSPA 3CXCB 1G3TA 3F0CA 3BTLA 1WDTA 3OL3A 3BZ6A 4PGOA 4PC3A 4D9JA 2XC7A 2DQLA 5IY5H 4QWQA 4HEA2 1GVDA 1W0UA 2XOKA 2NOGA 2DI3A 3K2ZA 2CW0F 1BR2A 1PDNC 3BG3A 3PETA 1LUJB 3P9KA 4RB1A 1FP1D 2GWRA 2HQ5A 4IRIA 1GVHA 3DTIA 4CCOA 3PFYA 1YJNB 4I84A 1Z7LA 1JB9A 2QKLB 2BMWA 4P3YA 1LM1A 3JTGA 2E60A 5KNLA 1QUFA 1JT0A 2F5DA 1MJ9A 2CUEA 3LSKA 2PYGA 1R22A 1HDPA 2TCTA 1U3EM 4BJ6C 1F36A 3SY2A 1LNWA 1KTVA 1U8BA 3QSYA 5DNSA 3ZR8X 2GLOA 1WOPA 2ZSHB 2MFZA 4P25A 5DM6F 3MWMA 2RGVA 1RIOH 3S8PA 1SC7A 3GVAA 3KCCA 4BBRJ 4IRHA 3M8JA 3ERMA 1TNSA 4FX0A 5J8CA 2R7UA 3OZUA 1WHUA 1BJKA 5TR9A 2ZSIB 4ZV4A 2JRTA 1F60A 4TMWA 4XMYA 2E2IJ 2F4OB 3W2FA 4M71A 2ID6A 4KICA 1QX4A 4QV2A 1U78A 5BS6A 1OPCA 3Q0UA 1BPLA 3L2QA 1MD0A 4J01A 3LFUA 3QYFA 2L9SA 4I7HA 1R9TJ 2R92J 1JXSA 3KL9A 2Z5UA 3FKIJ 2CV1A 3WTXC 4X7EA 3OZVA 1ZG5A 4CA0A 2QMUA 4PC6A 1O8GA 2HDDA 4F92B 1O3RA 2DFIA 2CMPA 1BMFA 1OB2A 1QGAA 4X7CA 1EP3B 2E1MC 3QQAA 2KVOA 1QH0A 3VO1A 4HQEA 2XPVA 4H4KC 1Y56A 3HRUA 2FE3A 2JTVA 2LP0A 1UG0A 1UD5A 2LC2A 1Y6IA 1O88A 4YEJA 2ZZEA 3ASPA 4NBQA 2HDNB 3AFHA 3TW7A 1XFOA 1KYZA 1QZEA 5FA6A 1OFDA 2HI3A 3J81k 5D6FA 1MH3A 2ID3A 4RB2C 3S2DJ 3E1YE 3CCQI 4Y13A 2FSWA 4ZYGA 5JI6A 2KDZA 4PC1A 2LFBA 3RPUA 1VQ8I 5DCMA 3J7YJ 2OYNA 3MVPA 5DCFA 1BN5A 2ZKZA 2V9PA 3V4GA 3BZCA 2EK5A 2XZOA 2VONA 1T5EA 3E97A 4LIVA 5CVUA 3ZRGA 1YI2I 5TRDA 2BF4A 2Z16A 1YQAA 3ZQQA 2E1RA 5IYRA 1O8JA 1NK2P 2QSHX 1YLOA 3Q39A 1QRYA 2JQ7A 4P3IA 1TT0A 3VYSB 2XEXA 3G05A 4UZEA 3G71B 1NHAA 4OMZA 5E8GA 3W3CA 2L4AA 3RI4A 2O6GE 1D3YA 4XNFA 3B78A 4IXAA 2OC6A 1E64A 4B1RA 3OYJA 2HCJB 3ASTA 2DW4A 4HE5A 3ROUA 1K4ZA 1REPC 4E70A 4GFBA 5EJCA 4Z6YA 1I27A 4YRVA 4OPWA 4Y7NJ 1JA0A 2X51A 1TYVA 2HMAA 2XPUA 3CMEB 2AXTC 2PIAA 1S29A 4D5FA 1YRNA 4B44A 2VJJA 3BY6A 4WZLA 3RPUD 3E6CC 1HZEA 3CTAA 2AHOA 1WKMA 2FMLA 2DMUA 2PMHA 3BWGA 1YTYA 1J75A 1QQ1A 2XZLA 2HXOA 2DBBA 2P6SA 2RV8A 2V9KA 3IAM2 3GWZA 1G6NA 3CF2A 1NH3A 4YAFA 4S04A 3R60A 5CJ9A 3PFIA 3AG1H 2BW3A 2GM4A 1KZHA 1TWAJ 5IYPA 1HF2A 1OGOX 2VOOA 4M6VA 3PSZA 3ABMH 3L9FA 3ZMSA 4LK1F 1V3FA 2YWGA 5TV2A 4H0EA 4XOPA 1MGTA 2R7XA 3VSVA 2FU4A 1Y0UA 3MZ8A 2WB1N 5DCMB 1LVKA 1H89C 4UUSB 2KJBA 1BX1A 3HOWJ 3UNGC 1LDKB 3E3VA 1TP4A 2VXDA 3QPHA 4XLFA 4OIOF 1O57A 3RQ4A 4LB5A 3DKYA 3PA1A 2CQXA 4Y7CA 2NYXA 2QSFX 1H8AC 4Q5SF 3MKWB 2D45A 1R49A 1ZGWA 2NVQJ 2M87A 3OYDA 2AQEA 1LFBA 3TOAA 3KEYA 3ASOH 3U1KA 2LKSA 4ZH4F 2J5OA 1X1CA 3H9JA 1G7TA 1G59A 1H8EA 3O6BB 3MMPA 3AVVA 2BV6A 2VBMA 4HV6A 2XGXA 2VN2A 3ZQGA 3SDBA 2Y2ZA 3FXLA 4RS8A 2OQGA 3MHPA 2JRMA 3VDXA 2FOKA 4C3IJ 1K9MD 3PNTA 2OK8A 4C0SA 2JVGA 1IDJA 2YPRA 2GQQA 1Z67A 2V7FA 2ZNYA 1A35A 1BIBA 1BQEA 3AL0C 3QU6A 2XNDA 4YZ0A 1ZTRA 4TMXA 2LBFB 4JX6A 2W4SA 5EGOB 2VKEA 3JR9A 2FX3A 1ZM3A 4MTDA 4C2UA 1N0UA 2CQQA 3S32A 4MR0A 2P5KA 4OINF 2GJRA 2EIJH 1OYWA 1DPRA 3KP4A 2CG4A 3CMMA 3JAMK 2QEXB 2O5RA 2QSGX 1ETYA 3C2HA 2XB0X 3GCMA 4UZFA 5EF6A 4BQAA 2A3SA 5EDNA 4PSXA 5BQTA 1OGMX 4I0BA 2MYSA 2ZB9A 4O6JA 3JRDA 3MQ0A 2ACJA 4IW3B 2DDAA 1OCPA 1XC5A 2BGIA 2RKHA 4ENMA 1FWZA 1SM4A 2BV3A 3FPKA 5ICEA 1U9OA 4OAYA 4UV9A 5C1CA 2JN6A 3IP4B 2XDVA 1DDGA 1VLYA 2GPJA 1OB5A 2MD0A 3GVJA 2X53S 1TYXA 3GVKA 2DQRA 4KISA 5ICCA 1WGXA 4PJNA 1E79A 1VF9A 1W36D 4GCVA 4MLOA 3EDPA 1DP7P 1P4XA 3WQZA 3CJNA 2ZMEC 3GQ9A 1B1BA 2P0WA 2PMUA 2HKXA 4HX8A 3CCJI 4A93J 2QLZA 3KP5A 1R5ID 2WTEA 4DBRA 1LFUP 4AYBN 3B4NA 4UV8A 4ZC3A 3SYJA 4Y9UA 4WCGA 3GTMJ 2VB6A 4WK8F 4FTHA 4P6VF 3V7SA 5F1RA 1ODDA 3I59A 4ENKA 3E5XA 4RD3A 3ZMTA 1JTYA 1QNTA 2HYFA 2PQ8A 3BR1A 3JRHA 3OP1A 2OCEA 3H3ZA 2DLLA 2VBYA 4Y52J 3JQQA 3NE5B 4S0HB 2E2JJ 3QYEA 4EJOA 5M5YJ 4UNOA 1V54H 1R4NB 1V4RA 3Q9VA 3N4MA 1U5TC 1MW7A 2K9MA 4XRFA 1AWCA 2MW8A 3PO3J 4B09A 5GV7A 2DK8A 1F1ZA 3A0BC 1HG8A 3GTGJ 2O0VA 4CICA 5KSWB 2XNJA 1MBEA 1W1WE 1R58A 1FNDA 1JGGA 3HM5A 1R23A 2NVYJ 5EZHA 3CCMI 3ZP5A 3PVDA 1VQNB 1SMYF 4U88A 3LMMA 1T38A 3CCLB 3OEEA 1VQPB 3H36A 1Y0NA 4UB8C 3FMSA 3K1PA 2IBDA 4Q47A 1WJCA 2JIZA 3GTPJ 1IJEA 2ELJA 1ETXA 1LDJA 1D8JA 1VQLB 3ZZ0A 4ZYHA 1AMOA 3PIPF 2VKDA 3H9GA 4O5VA 5ILUA 1ZRCA 4DQ2A 3G4SI 2FX0A 2Y48A 1PLUA 4KMFA 3JCUC 1B8IB 1TBXA 1EH7A 2DEUA 3OW2B 4AIKA 3M3YJ 5EMNA 1WFXA 5JLVC 5AIQA 4FK8A 5D8KB 1W87A 5HLTA 4RB3C 2DCEA 1EE6A 1HBXG 1OCTC 3DBLB 1N77A 1QA2A 1TQMA 4H9GA 3CD6I 1S7EA 2VFMA 1AU7A 3FKSA 3I59B 4NDLA 4CCLA 2JJ2A 3C2BA 2ZBUA 2LDUA 1K4SA 1SFEA 4JK1X 3ZIAA 2GXGA 4RD2A 3W5UA 2ZJPF 1HKSA 2C4UA 3CCUI 3CCEB 3FY3A 4RAFA 1O3TA 2ZZQA 1CF7A 4RAZA 2LKXA 5FFXA 4DJAA 3OWTA 2C2WA 4M73A 2H6BA 3CDIA 2QUFA 4L9VA 5DUIA 2ZNZA 1YHQI 3ZZUA 2E36A 4D1QA 1OOCA 3C1DA 2UUZA 4OOIA 2W25A 3E0JB 5D5WB 5H6RA 4XKBA 3FK7A 5BOXA 5JHFA 5L3EA 4HLYA 1IRFA 4ZJZA 4AYBA 1EP2B 3CB4A 3R4KA 4FE7A 2GJKA 2O8XA 3BTCA 3F3XA 3LSJA 5DS9A 2PG4A 1OJLA 4HSRA 1MBKA 1T39A 3I58A 4ZDLA 6PAXA 2P6TA 4Z2YA 4X6AJ 3ZSCA 5FL7A 4WWCA 2HZTA 4MEXF 4HZFA 4M3BA 5M3FJ 1A6IA 5B3SH 3OIQA 5JVTA 4JOMA 1W0KA 2RC6A 4RD1A 1FBUA 1ZRDA 2GA1A 2UZKA 3AKZA 2LD5A 1YG2A 1R7JA 3S14J 2CUJA 1LB2A 3COAC 2KHMA 2AO9A 1A8PA 1O7FA 2QE7A 3DBHB 3CLOA 2QM3A 1CNEA 2W84A 3O3KA 4BKXA 1U8RA 2CBXA 3WYAA 2Z99A 2Y0SA 2ZL7A 1VHEA 5IYWA 3JTHA 3F8NA 1UJ8A 3U2QA 1U5TB 1GXQA 4WX9A 5KVRA 2V7XA 3OAAA 2ZMEB 3L7WA 3KEOA 3JQPA 1QHHD 3S2HJ 4WXCA 1WJBA 2P4WA 2A07F 3PSSA 3TP0A 3SFIA 4HPQA 3HSFA 2JZYA 4G6TB 1YIOA 1SFUA 3EETA 5F4JA 1KQ5A 5AIPA 1SEUA 3CMAI 3FXOA 1YE9A 4DNTB 4AU7A 1UHWA 2MC3A 2V7WA 3K4NA 2CNDA 1IDKA 1KYWA 5HVQC 1YOVB 3OE7A 3OIOA 4TMVA 3T56B 5HODA 1UELB 5DYMA 1RNLA 5K7ZA 3AVWA 3BH7B 4NC6A 5KCMA 4KFCA 4IQJA 1PJ5A 4D0PA 2BGCA 3DCFA 3GQBA 5H59A 2L9VA 1G2HA 2OBSA 3ZC3A 2WAQA 2V7QA 2A6TA 4BDZA 2WZPP 2NZMA 2ECBA 4A3IJ 3IRQA 4HBLA 4OIRF 4DZPA 2QGUA 2R3SA 4I2OA 4KDPA 3QE2A 4EJVA 4HG2A 4OP7A 3DPUA 1MBHA 5FJ8J 4U49A 3SJMA 1FNBA 4G6IA 3PSFA 4CUGA 2DO7A 5A2QK 3CD6B 1NTCA 5IPAA 2R5YA 5FLVA 4PC7A 3NRVA 3SLNA 3ZPPA 4EGYA 3Q6RA 1KK1A 1YJ9I 2VBEA 1E3HA 1WCMJ 2EFQA 1AIPA 3FXMA 5E79C 1S7OA 1O4XA 2HTJA 4CHUA 1JJ6C 3GTLJ 4OJPA 3F6VA 4A3DJ 3MN2A 4HIZA 2YUSA 3HAGA 3EUHA 4OU0A 4FX4A 1Y39A 1SVLA 1R71A 2L7MP 4P9FA 2VNKA 2W6IA 4V19K 3X2QH 1YHQB 4OM9A 3GTJJ 2PN6A 5HLHA 2QGGA 3JAMZ 3OOUA 1ZREA 3CC2B 2B7BA 4Z4VA 4ZCMA 2BM1A 2QVOA 4I98B 4YIRX 4DQKA 1QZYA 3DTKA 4KIBA 3PSIA 3JREA 4E7JA 1E3OC 4ROXA 1O8IA 3ZQ7A 1NRKA 3QOPA 4N0BA 4U0WA 3DWLE 2VQGA 1ZUNB 4PUSA 4OWRB 3QPSA 1JT6A 1DGRM 3T0YA 3ZOBA 3DPLC 3IWFA 3OYFA 1DARA 4G1BA 3JX8A 2RNGA 1NG6A 2Y9YA 1UD3A 1VQ6I 1BI2A 1X3UA 4A69C 5IOYA 1DPUA 2MC4A 5LHGA 2EIXA 1X2MA 2YU9J 2NNYA 2BBYA 4MHGA 4Z4SA 2QQAA 2QA4I 1ZLKA 2FNPA 1MZBA 4AF7A 4E7LA 2OBRA 1Z3XA 1FX7A 1YLFA 2YX4A 3KFWX 3TGNA 3JRIA 4KKTA 2BHYA 2LVSA 1RZ4A 2BXZA 4I99C 1K78B 4W8RA 2R5YB 4X0CA 3MAJA 4PC2A 2LMDA 2HDWA 3QFSA 2L01A 2B0RA 3WTTC 5IP9J 3FXRA 3PL8A 3VSLA 1YW9A 4OMYA 4OJ6A 2ZXIA 4LIUA 3WHBA 3AAFA 1B4AA 2X0LA 4JYKA 2L5QA 3JRGA 2GK7A 2DA2A 1OR7C 2ZBKA 3Q5FA 3BCAA 1SVMA 3E1SA 4G5GA 1DABA 3B90A 1TWFJ 1CNFA 1XE1A 2EH3A 4XQFA 3B02A 2I5UA 2R5ZB 3EUAA 1R6RA 1N05A 1KC8D 2R7VA 3GFMA 2QZ8A 1DP3A 3WE2A 3RKQA 4YZAA 4A0ZA 2VBWA 5IYNA 5IYDJ 3CCQB 4OIPF 5DM7F 2R4GA 3M9AA 3OS2A 1PJRA 3CUOA 1MJBA 1V5VA 4QHYA 2L7ZA 1FRNA 2FOWA 3C3WA 3ZPLA 4A3GJ 5FRMA 2XZPA 2ISZA 2PI0A 3SLDA 2QKMB 4LK0F 1T0FA 3I71A 1CQXA 2O6WA 5EEAA 2OUMA 3HOVJ 2DDBA 2MLKA 1JGSA 1EH6A 1R1UA 4HNUA 5H6QA 1MRZA 2MBFA 4BXUA 2YWHA 2VASA 4XRMA 1MMAA 5L3FA 2UWMA 2VOPA 2E5NA 3A35A 3SHFA 4BE0A 3B8YA 2R7RA 5BMZA 3W6KB 1FYMA 5C3EJ 1KZLA 4LBWA 4DQLA 4MO7A 3SFZA 2A05A 4X7DA 4ENNA 1TZLA 3K4MA 4BHPA 3P4GA 3WNBA 3BJAA 4F7ZA 4ZTFA 1FNCA 4JBAA 1DU6A 2Q8KA 1IO2A 1MDMA 4RJLA 4IJAA 2KQRA 4EATA 5E18F 3E6BA 4F93B 1BC8C 1BL0A 2V1UA 1ZM4A 1M1KD 3W2EA 5D4SA 1QHGA 4NHJA 2V7UA 2JSPA 3AVXA 3LL7A 3CUQB 5JBQA 5D8LB 2PBIA 2KLOA 1YI2B 3WBKA 3PJRA 4A3KJ 3HTUA 2AHQA 4EMSA 2EZKA 1FP2A 3BR2A 3HDDA 2HWVA 2BE5F 4RB0A 1VI0A 4XN3A 3FHZA 1F43A 2CQKA 5HLIA 5K7FA 1OFLA 3RKXA 4RAYA 5HS8A 1GJRA 1FOWA 4BY1J 3GTOJ 1ERDA 2L0KA 3D5SC 3FZVA 4D5CA 1GUUA 3WE3A 4NUBA 4XLEA 1O3SA 2M5SA 1SD6A 3KLNA 1MNMC 3EQOA 4OJLA 4Z05A 2EIKH 1N06A 1SD4A 1JKPC 4II3A 4EH1A 5FNZA 2RC4A 5D5XB 1JUSA 2WBMA 1MKMA 1D8TA 3ZQHA 4ZTJA 2WY8Q 1ZG3A 5E1XA 4GO1A 2FRHA 2H8WA 5GAGJ 3FPPA 1OCZH 5FROA 1STZA 1T56A 1B2RA 3F8FA 4N9HA 5K5OA 2Z8GA 2ZZFA 4NC7A 1HF0A 1Q82D 5D4RA 5KHDA 1B6AA 3PO2J 5E8IA 3GRHA 4I09A 2R7TA 3SZPA 1WH7A 3G6EI 2P5LC 1WQ2A 1ZGJA 5EGOA 1IAWA 2KL4A 2O61A 3WNCA 3HGGA 1UG2A 4HNTA 2OTLI 4P5OA 1COWA 3LSMA 3MMYB 4HW0A 1R5HA 3LQQA 4RDJA 1NJID 4A3BJ 1QCXA 2CUFA 3N97A 3FBNB 5ERIA 3L2CA 2Q2EB 2CO5A 3PUBA 4ESBA 3HYIA 3A0HC 2ZTNA 2NS7A 3NAUA 5BSXA 3ML3A 5DD8A 1ETVA 2ESHA 1IB4A 3AL0B 2YUHA 2V31A 3R6JA 4BYYA 1K6OA 1R5BA 2I10A 5LBQA 3WTWC 3J7AY 1EFCA 5J8FA 2KIUA 1UZCA 1ZM2A 1GR1A 3W6JB 1TL8A 1RESA 1UD4A 4QPOA 1GAWA 2VNJA 1QGZA 2DXIA 1G3SA 4R1HA 1XPXA 1I6HJ 3Q9SA 4YZXA 4B43A 2YX7A 5A2QZ 2LBFA 2CC2A 1PYVA 2Y69H 3OR2C 4XOTA 1W7PA 3A8JA 1USSA 4XSXF 4P26A 2ZFWA 4M9XA 2PLFA 2V6EA 2FJ1A 2IA0A 3T53B 2STWA 3JRAA 4Q4ZF 4FQGA 5IYQA 2JA2A 3OJXA 4KJZA 2M8EA 3F21A 1QG0A 2YSRA 3DFGA 2IAIA 3TQNA 3OY9A 5IK2A 2QEXI 2JUGA 2DTRA 4ESJA 5LEJA 3P9IA 1XMKA 2DYIA 2V1XA 1XQBA 1N0VC 2E34A 2ZCWA 1KMHA 4ACAA 4A3MJ 1KK0A 4U4BA 2ISYA 1W5TA 5GADJ 1GV2A 2IQ7A 2H1KA 3QU3A 1IGNA 1GAQA 2GAUA 1QQIA 3WU0A 1QBJA 4AF6A 2LY9A 1J5YA 4BEHA 1APLC 1I1SA 3GIRA 4CCMA 4HAMA 4DNRB 2CSOA 3RYRA 3VYTB 1W5CC 1FX0A 1O8LA 2NT9A 2KIQA 5GV8A 3J80Z 4YEIA 5FKKA 4Y3OA 4IHYA 3K1MA 1Y1VJ 4PJ0C 4UY8I 2O17A 2EFWA 1W36C 2CF4A 1OLTA 3EPZA 3K4BA 1WSRA 4FE4A 5K5RA 4HE6A 2M34A 4B47A 2COBA 1BI3A 5JFRA 3UW0A 5C4JJ 4KIFA 2DA1A 1E3XA 1RUOA 2DAOA 4YZQA 3R0JA 1Y0RA 4PFPA 4LJZF 1TWHJ 4C3JJ 4TMTA 4UXNA 2FQ3A 4LG3A 3QFTA 1RR7A 4BUPA 2L7KA 2XSJC 4C9YA 3K4LA 5E3NA 4L5IA 5FD6A 1XDUA 3VEPA 3M8FA 2PMZA 2EQRA 2VFOA 4XRSA 4BL0B 3I53A 1UAAA 1SANA 1E63A 2HLDA 2LG4A 3JQRA 2HKOA 1O7LA 3CP8A 3IAS2 9ANTA 5FFZA 1OQYA 3FK6A 2QYUA 5LLQA 5ICFA 4AIHA 3LQ6A 5FO1A 3RIQA 2DFHA 3EQLF 1U2RA 4MEYF 1S9HA 3BCBA 3LSIA 1K28D 2XAGA 3PQKA 1E17A 1A6QA 2VQLA 1SAUA 2RN7A 4E7IA 3RSNA 2XUBA 2IXSA 1M1EB 1X1AA 2W82A 2R7FA 5JMCB 4RPBA 2XSDC 1Z05A 4LLGF 1F9NA 1GV5A 1TNTA 1ETKA 4C2LA 1J09A 1VQ5I 3U9GA 2EINH 3ASQA 1WJ5A 5CQGA 3V8KA 2WADA 1BOBA 5GAHJ 1MABA 1SFKA 4HF1A 3K0LA 5CDFA 4HOBA 4BU2A 3FX3A 3VSUA 3IH2A 3CW2A 2XAJA 2WWYA 1RI7A 1DUXC 3BCFA 2KISA 1VQ4I 1VQMB 4R79A 5JLWA 2ZXJA 1Z77A 3H92A 5L3BA 3JRFA 2QXZA 3HB9A 3F9KA 2EZIA 3AG4H 3D1NI 4L9JA 1VQKI 2CW5A 4E7KA 3A3GA 2NS0A 2QF7A 5B6IA 4E7HA 4HA8A 4Q7JB 4YALA 4OPVA 1X19A 1FDRA 2KKOA 2XROA 4BE2A 2FVGA 3MKYB 1AIRA 2DK5A 2DODA 4U87A 2PE3A 1B23P 2CWEA 3CJTB 2M5WA 1EKEA 1FJLA 2WAQN 4KIGA 4BXFA 2C5BA 1F4KA 2K02A 1C0WA 2WPDA 5HNHA 1ETOA 4HF0A 2DCUA 4Z4ZA 5D5VB 2PMDA 1BW6A 2DA5A 4A3FJ 4QFMA 3OMYA 4WWVA 2PYHA 4AC9A 1ZELA 4ZCIA 2XTWA 3GZ6A 1PUFA 1T6SA 1OHHA 2DOGA 1K5CA 3CCVI 1KTWA 1N75A 3LNQA 3CP2A 3AGQA 3A4CA 3MD2A 4QUZA 4PMHA 1X2NA 1P2FA 3JSOA 3OFNA 1IJFA 2E7WA 1CQTA 1FNMA 1VQ8B 3KZIC 4C2TA 1IZ1A 4MNUA 4X06A 1EP1B 4IHXA 4XM3A 2HQNA 2NV4A 1IDYA 4Z4YA 2KIFA 3G2BA 5EEHA 3A8IA 3J7ZI 1HSTA 2M7BA 4AUXA 2VZLA 2Z6BD 4MQ9F 2ELHA 1H9TA 2IOUG 4A3JJ 3D5LA 4BHBA 2JT1A 2KP6A 2V6CA 5J47A 2HS5A 2GIZA 1OGJA 1YW7A 2G9WA 3L2VA 5C44J 1WJEA 4MQVA 4W8QA 3NWTA 1A31A 3WG9A 3LFKA 2DMNA 2QYOA 1IG7A 1EZGA 4PGGA 4ASUA 1MBFA 4PZJA 3S1NJ 5ILVA 3VMWA 3PM1A 1XS9A 2IVMA 1ZQ3P 3TEDA 2Y9ZA 3ML6A 1O8EA 1QGYA 3W6VA 3RZOJ 2D3NA 2M0MA 2WY7Q 4IHWA 3BPXA 1IN4A 3SDGA 4LFUA 5HKKA 3H9QA 4AVPA 2D74A 3V76A 3L2UA 1EA0A 1SFOJ 4FHTA 4A0YA 4HX4A 3TL4X 5K7HA 1B9NA 2N8GA 1TQPA 3E5QA 1IA5A 2BHZA 2JN9A 2WYRA 4G6QA 5KW9A 4XLHA 4JX5A 4BS9A 2O8KA 4V2FA 2OU2A 3MKZA 3CCRI 5LRSA 1I7PA 1PP8F 2HZDA 2X0KA 3ZUGA 2UVFA 4HNVA 3KYCB 2IP2A 2MD5A 1XGSA 1ETWA 2VL8A 4C3HJ 2DIEA 4P22A 2IA2A 3BT9A 3B82A 2BX6A 2D2WA 4LBZA 3VWBA 2O03A 2Q6IA 5F0HA 3ONUA 2IA1A 2Z33A 2DT6A 1HW1A 2C5HA 4U7DA 3W5HA 4YIIA 2D9RA 2GIVA 3HG9A 5JLXA 1R1TA 1JKQC 1ZR4A 1VNDA 2DJIA 2JJ7A 1TW3A 3KP2A 3BC8A 3N05A 4KUMA 4BJ5C 1BM9A 3RYPA 1EH8A 3CESA 4WZEA 4F52A 3G4SB 2V26A 3AG2H 4A3EJ 1Q7YD 2VPLA 3HZJA 2KIMA 4RLZA 3K1NA 2KRFA 1D0ZA 5KK1A 2BY3A 2Q2EA 3WG7H 1HXDA 1JKOC 2G7UA 4QVJA 1ZG1A 1ETQA 2Z2SB 1E3ZA 1GQ8A 1Z6RA 3ECOA 1BW5A 3ASRA 3WGHA 3QOEA 4UUSA 2BSPA 4UZUA 1I6XA 3B73A 4TV7A 2DJNA 5FGMA 2W1OA 2M9HA 1X58A 1R00A 2F5FA 2XPWA 2HOTA 1FT9A 4IQ4A 3VYUB 3P26A 3SZEA 1XGOA 2X6OA 2NT6A 4ZYDA 3FXKA 2ADUA 4XORA 4P9SA 1NG7A 4UVCA 1J9ZA 2ZO4A 2NTPA 3GQAA 1BHEA 3DEWA 3U21A 2LOOA 4JQFA 1V55H 4RGSA 1ELOA 3SQNA 4RM0A 2EV6A 1YO5C 1NK3P 3S15J 3KPHA 3OPOA 3QWLA 3OKXA 1IW7F 5FO0A 2I8DA 1TQIA 2EV5A 2VNHA 5IOZA 1GHCA 3CC4B 3LA3A 4W8SA 1KK3A 4PJJA 1ON2A 3DP7A 3WU2C 2L9RA 3IRRA 4MGRA 1P4AA 5AONA 5L3CA 2JA5J 3WODF 3PUMA 5AN9A 3ZN0A 3FF5A 3F23A 1I39A 2CQ7A 1UHMA 1K8FA 1J0RA 1VQ9B 4M6XA 2OJED 3BR5A 5M5XJ 2H94A 2PFBA 4E7ZA 3GSIA 1T6XA 1OFCX 2E2HJ 3ES9A 5TY0A 3SZTA 1VLOA 3K4KA 2BYVE 1ZGAA 3GFLA 1NB9A 2BSAA 2OPTA 2VBSA 4ZGQB 1A5JA 1D0YA 5F0FA 2OV7A 5E6TA 5HZBA 2VC1A 3LA7A 4CSWA 1LDDA 1RKWA 4O3MA 2A68F 1QRBA 1HDDC 4GRIA 1B59A 4R8HA 4MTEA 4LITA 1QRCA 2E1NA 3OS1A 3GZNB 5L3GA 4IHVA 2L2OA 2X8KA 3VMFA 3ECHA 2VFPA 2KPMA 3NB2A 1X3WB 1N78A 2KRHA 3HRMA 3ZMZA 3WTYC 2HPIA 5IP7J 1JNYA 2DT7B 3S1RJ 1HA8A 4J19A 4Z06A 1IRZA 4QLCU 3LQRA 2L02A 5HDKA 1D1CA 3V8JA 3GYHX 3B8HA 4LG0B 4D7NA 4MYTA 3NEUA 2PMZN 1J9IA 4X1EA 4G6DA 2JJ1A 3DQVC 3OR1C 3OYMA 4M2LA 2VXZA 5IYBJ 1HLVA 1JTAA 3LMWA 3G71I 2XAUA 3TBIA 1MMSA 3ZN1A 5HLGA 3BNWA 1E1QA 1NBMA 1G3WA 2P5VA 1IN8A 3H09A 4EGZA 2LNBA 4L9NA 4MIMA 4G7HF 1B8IA 1IUFA 2INVA 3TH0A 2DT5A 3KEQA 3V7AA 2BGJA 4NB5A 3U1DA 3P9CA 4XLPF 2F1MA 4RCYA 2YWFA 2E35A 3DV8A 2J7KA 3OSGA 2EZLA 5A89A 3TO7A 1FRQA 3VOEA 2HQAA 3S2WA 2CFOA 3KETA 3BQJA 3OSFA 2J8KA 2RQQA 5E3OA 2F5VA 1HQCA 3DF8A 3VSKA 3RPQA 5M3MJ 2Y75A 3HSEA 3DLLF 2PJPA 2KMUA 4U0VA 2VT3A 5EG0A 3NQOA 4AVZA 3F22A 1KD1D 1ZKGA 4FISA 3T51B 2EBIA 3LVBA 1VQ7B 5E17F 3C2GA 1FNNA 5KAFC 1XB4A 5IT9Z 1TLHB 3HOZJ 5L3DA 1HOMA 4XRSG 2AXLA 2R9VA 1JTXA 3OW7A 2A61A 2HFHA 4N4OB 2NNNA 3FISA 3ABTA 2DFFA 3WGIA 2GBYA 4KA4A 2X48A 2I1LA 1PKVA 3W2AA 1CF7B 3CCEI 3CCUB 2CW8A 1SMTA 3UKGA 2C4TA 2EFNA 2WSSA 2NVXJ 1SAXA 3BQYA 3MFKA 1O8MA 2XC1A 2DTZA 4U7BA 1FY7A 2ZXHA 3F8CA 2KRCA 4CDGA 2IGOA 4BBSJ 3VPRA 5J1RA 4RGXA 3G73A 4X05A 2C78A 5LMZA 1NDHA 1QA1A 1UFMA 2KZGA 1N8RD 1X4PA 1RQPA 1WI3A 2FMYA 2XKOA 1W5SA 1EFUA 1ZRFA 1XGNA 2IW5A 2R7OA 1S6LA 4M3EA 4BDYA 3QPLA 1K8AD 1WOSA 2K9LA 2VKHA 2JA7J 2VI6A 2NOJB 4RMNA 3HOXJ 3BG6A 3ZQLA 1FZPB 2BZTA 2Q1ZB 4ZDPA 3SEJA 1V5FA 3DEEA 4IEJA 4G7WA 3I54A 1IF1A 4E7SA 4P55A 1I3AA 3EUHC 1P6RA 1LVAA 4LGWA 4X0GA 4P96A 2B7CA 4WZTA 4LBYA 3IHUA 3BP8A 3OIPA 4PAAA 2A6EF 2K4BA 3RJPA 3GTKJ 1W0TA 1WSVA 3R61A 4EW9A 3BROA 4L5JA 1UD8A 2WC2A 3KP6A 3S17J 4XKCA 5TJJA 3BH6B 2ZJ2A 3ZGKA 1HC8A 2WV0A 3BTJA 3DEUA 1YJWB 2X1CA 2VJ4A 3GW2A 2OTJI 1AKHB 3GVLA 5F6FA 4UB6C 4URRA 1TUIA 1UD6A 3WTVC 1H9GA 4G7ZF 5F4MA 1UMKA 5DUKA 2Z3YA 1FYLA 3ZPNA 3C7JA 2XAQA 3ZCOA 2P3MA 2OBPA 1T33A 4BNCA 3BG7A 5IT3A 1B72A 4A3CJ 2FUG2 2EB7A 4NNJA 5J35A 2F6CA 3QRFF 1WZ2A 1SKYB 2DERA 1T2KA 3ERED 4B4DA 3ABLH 3K69A 3CCJB 2K7LA 1QA6A 3LSTA 4YIFA 3IKVA 2ZTGA 3M8EA 2OF7A 1JUPA 2CV2A 1UD2A 2LSOA 1D1NA 3W2IA 3TO6A 4OJOA 1ZYRF 2RDPA 3BTIA 1KCDA 2HR3A 3QODA 5FO5A 1JHHA 2W85A 1QFYA 3BY2A 4Y4RA 3OYCA 3RZDJ 5DD4A 1V0FA 1BN8A 1HKQA 1RETA 2YR2A 3H5AA 2VBZA 3IH3A 1K83J 5HOOA 2V1NA 2HVRA 1KGSA 3H5NA 3OJWA 2VBXA 4G9YA 3Q38A 2BW3B 3KP7A 3OYIA 5LEKA 3L2RA 5D5UB 3HXLA 2E5ZA 2A6HF 1I3QJ 1IN6A 2ZFUA 3L00A 2CK3A 2X9DA 4AIDA 3FKJA 3H94A 2VQCA 1MNDA 2Q0OA 2DY1A 3HOSA 1VZ0A 5THXA 3V8LA 3W2HA 2IS4A 1IRXA 4I76A 4KKUA 1AOYA 1XG2A 1QUEA 3CO7C 4P1WA 1TTTA 2XTYA 5CKTA 3T8RA 3IV5A 3K2AA 4G7OF 4UVAA 3M07A 3O8GA 2WAEA 5B5EC 3K70C 2XTXA 4YG2F 2L4MA 5CPRB 2K9QA 4EQQA 3M4OJ 2RREA 2VPRA 3KLOA 4OJ5A 4XONA 1XTAA 3GLLA 2LF8A 1DU0A 2VE9A 4C2MJ 4RLFA 3A1YA 2XAFA 2MABA 2BY2A 2WJVA 1Q1HA 3TMOA 2K5CA 1LJ9A 1MNEA 2WA0A 3MCZA 4Z03A 3W2GA 1OYIA 2CH0A 3TOBA 4R71A 1QZZA 5H2FC 2M3AA 3QYBA 3GQ8A 4OOSA 2NAZA 3ASNH 4CZZA 5LHHA 1P7IA 3BR3A 4ABZA 1RR8C 2E71A 3LQEA 4ZGNB 1FIAA 3RKWA 1FSEA 3GTQJ 3P7NA 5F0CA 2OCCH 2HXIA 1FYKA 1WOOA 2DMPA 5DV5A 1PXZA 1WRJA 2FXAA 1I5ZA 3FXUA 1S0UA 1TYUA 2FA5A 2PJRB 3CC2I 1WTHD 1TTYA 2EWNA 2XVCA 1TVCA 1YX5A 1KONA 2XGCA 3FMRA 4IO9F 5TISC 2IEKA 4ANJA 3HOYJ 4QVAA 3PNYA 2K4JA 1YS7A 4HV5A 1DDNA 1EV7A 3JRBA 5FKMA 2HQRA 2E1OA 1T98A 2EFOA 4Y33A 2DA7A 3TDZC 2P7CB 3S1MJ 4M4SA 3WXMA 2BY0A 1TWGJ 1MDMB 4UHTA 4GQNA 3I55I 4IX7A 2QX3A 4EM0B 1IHMA 2GREA 3WGGA 3M7GA 1YIJI 1ZH5A 3OS0A 1EWYA 4AD9A 3PENA 1VBLA 1JKRC 2VLAA 2MGQA 5J3OA 4IOAF 3E5UA 2ZZGA 1OB0A 4BJTA 1UB9A 2XGDA 2X1EA 1E0EA 3Q3AA 4P12A 5M5WJ 1HW2A 3NAWA 3HKZA 3DPTA 3I4NJ 3R6SA 1IRGA 2ZITA 5HNFA 1YW8A 3KYDB 4HDUA 4B3GA 3T1BA 3JU4A 2QBYA 3DDYA 2NSPA 1XCBA 4RCZA 3LYCA 3QFRA 2DA3A 5C4XJ 1R5OA 2WJYA 3HSRA 3ZBTA 2DMQA 1WPKA 2XRLA 2VUMJ 3I64A 1XMAA 1CLWA 4RGUA 3SEQA 2R5ZA 1JJ2B 4CCKA 2OAZA 4HSTA 1Q9SA 1LLWA 1FIPA 1DBOA 1FTTA 3P27A 1YYVA 3PNVA 4QSHA 3LSHA 4HYEA 4AIJA 3I3LA 4AWXB 5FLMJ 2OBTA 1KCCA 4M3GA 1S3JA 1G4DA 5AMVA 2Q6LA 3J80K 1FBQA 4BE1A 2X3UA 1P4MA 4IPAA 1Z9CA 3MEXA 3CMAB 1A36A 3CO6C 2X6YA 2E1MB 3CUQA 2EZHA 2K3FA 5GTHC 3K70D 2BM7A 4KYWA 3FXQA 3OOPA 1U9NA 3WU1B 4WXHA 3G1OA 1W2BB 3VR6A 1BI1A 3CCLI 2IGKA 4BQQA 4CYCB 2WV1A 1S7AA 1FBSA 2DU9A 3GX4X 3MZHA 3SJPA 1XCVA 5F27A 3EUKL 4BQOA 1XD7A 4QTRA 4M3FA 1VQOI 3LWFA 4CXFA 5EYRA 3CDHA 4EM1A 1FOKA 2E19A 2VBKA 3PUFA 1WPCA 3VODA 2FNAA 4F91B 2VODA 4FXUA 2H27A 5HXBA 2X4HA 5BPDA 1BOAA 4E4HA 3CZ6A 3BY1A 3QFCA 2FBIA 3RY8A 1T6YA 1UHSA 4OAZA 4PFOA 5E20A 1T08B 1OMIA 3A3BA 5IT9K 2XIGA 3BH4A 1Y8RB 4CH7A 2M7AA 3MCAA 3DU5A 2YU3A 3IKTA 2V7TA 5LGUA 1BX0A 1D5YA 4TT3A 2BM4A 4N3NA 3N90A 2H6CA 5HS9A 2FEZA 2J5PA 1BJAA 4EJUA 5ED4A 3BG9A 2ZJQF 4P1VA 3BCDA 2ME0A 4CCNA 3KE2A 2R93J 3M1CA 4MFDA 4TKOB 5J1UA 2IS2A 2E7XA 4PCQA 2QQ9A 2LYCA 3DKWA 4C30A 4BPRA 1XSDA 1XB2A 4FT8A 1TSPA 4N4NB 4P6YA 1M90D 1E1RA 2GXAA 2XASA 2QDXA 3HRTA 4CYCA 1D8KA 3CPXA 4IOCF 1H0MA 4EJTA 2BVNA 3AK5A 2K9NA 1W0JA 2OK7A 1WVRA 3K4CA 2MSYA 4PSWA 3RKYA 2G0YA 3DTEA 4RDUA 4DZJA 2BXYA 2EFPA 1YX3A 2R7QA 3NWSA 5LGTA 1ACIA 1HKTA 2CRVA 3FBIB 2O1DA 4I01A 2DPUA 4RGRA 4BEHB 4RAGA 3REOA 1XDSA 1OFEA 1P9QC 3J81K 5A88A 1S72I 3HRSA 4JMQA 3W2WA 5JR3A 2WAFA 2EA4A 3ONQA 1FTZA 1WP6A 2DETA 2HGCA 3IWZA 2V4DA 5BSYA 3I56I 4LMYA 1O8KA 3OOCA 5EEGA 3HIFA 5BNGA 2GK6A 1ZAOA 1QVFB 1P92A 2GOMA 2VC0A 1QA3A 4Y17A 4JP0A 4ZZLA 4FCYA 4ENJA 1LQ1A 2GXBA 2XGJA 2INUA 4A12A 1IV8A 3CF5F 3KX2A 3CQZJ 3BC9A 1Z3YA 3S3NA 5CQEA 5DEQA 4IKFA 5HS7A 4V2GA 3A03A 1OFMA 2JPBA 1RMGA 2NPFA 4F7DA 1O8HA 3LOCA 1H88C 4OPOA 3KZYA 3K6GA 4KMUX 2M0CA 4NC8A 2YS9A 4E0FA 3B6AA 5F1JA 4NQWA 2DYSH 2ECCA 1G8XA 3CCVB 3RIRA 2H8RA 4YFXF 1I8DA 4L0ZB 2DPDA 1PE9A 1MMGA 4NBSA 1EJ9A 2TRTA 4XBFA 2AQFA 1GT0C 3JRCA 2PLYA 1W7PB 1L0OC 2OZ6A 3K9TA 1H80A 1OCOH 5ILSA 1WORA 4WQMA 1VQOB 3ISXA 1T8IA 2X6XA 3K10A 4M0LA 1TYWA 2XF6A 3HKZN 4I02A 4DYCA 1H42A 4RPDA 2X1DA 2B9SA 5FKLA 1QFZA 1LLZA 4DYQA 4EV0A 4B3AA 2XKPA 3CJQB 2W48A 5J4YA 3BZKA 2Y0SN 1TWCJ 5FLXK 2D1HA 4YFKF 4V02C 3TO9A 2UVEA 2V1DA 2LREA 1NHCA 1KQ9A 1BLIA 2F4IA 4PGHA 5HZAA 4YC5A 4L5EA 4CZCA 4BACA 3LSRA 3VO2A 4ETSA 1SKQA 1N08A 4MXNA 1MBJA 3TDUC 1Z91A 2OA4A 4M9ZA 1VQLI 3KYLA 2QWWA 2EJRA 3HUGA 1IXCA 3KIOA 5FKOA 2IS6A 3DU1X 2R0QC 4KH3A 2PJRA 1N25A 1RC9A 2EILH 2O7OA 2JVHA 2JWTA 4XLNF 5GAEJ 1BA5A 4KT5C 2XAHA 2L3DA 4GYGA 2AS5F 4YAOA 4XLAA 5C1EA 3BJ6A 3GQ7A 2V4JC 1Q81D 4KN4X 3CCMB 2EA2A 3E7LA 4L9TA 4B4CA 4CO8A 3LAJA 2ESNA 4TN1A 1J7KA 2HU9A 2K9SA 2ELKA 4CCJA 5E3MA 3RTRA 2F5CA 4FN5A 3J7AO 3OZWA 4RA2A 1MSFC 3ZMVA 1VQ7I 4P9UA 3M1EA 2JUCA 1ENHA 2O3FA 1ZK8A 4KNYA 1ON1A 1KK2A 2BPOA 3WTUC 1R5GA 1WJAA 3SXYA 2ETHA 4CQJA 5FKNA 4GYIA 2R7SA 2HTSA 2UV1A 2A69F 2IRFG 2BY1A 2QTZA 3WY9A 1ZHFA 1PUFB 2IPQX 2JA6J 3O8HA 2CQNA 4UAJA 4G7XA 1YITB 1D0XA 4XLCA 5J40A 4IVNA 2D1VA 1VQ5B 1QVTA 3VB2A 1MMDA 3SKBA 2EPFA 3BDDA 3ISPA 2XV4S 1P7JA 5EG0B 3IL2A 2O04A 1WSUA 2BVMA 5J1YA 5FD5A 3OYEA 1WU8A 2GQFA 2QA4B 3GFJA 2B7EA 3T9GA 2RNJA 5F04A 1VQMI 1KU2A 1PJ6A 4B3FX 3GMEA 2CYYA 2F48A 1VQ4B 5CVJA 2V79A 4XK4A 4UUTA 1GLNA 1VHOA 1FOXA 3G3ZA 4PDKA 4A2UA 1EFTA 1XX5A 1IJWC 3SEZA 1JJ8C 2HYJA 4FWTA 3I1FA 5K5QA 1RPWA 4BXXJ 5E1ZB 3W5VA 4Z4WA 2VBTA 3OYKA 4Z4TA 1N07A 1G3YA 1PJ7A 3SZGA 3T5XA 1O3QA 2DA4A 1V0EA 5DS0A 4S05A 4LLNA 1SD7A 3ZBUA 3S3OA 1ZR2A 2LK2A 1GO2A 1OYYA 3D26A 5BPIA 3V42A 2F1LA 1HCRA 3LAPA 1HW5A 3I0TA 1G7SA 1IV6A 1OGIA 2MA3A 1RKTA 3DU6A 3IH4A 3I9V2 1R5NA 1D1AA 4LC0A 1BR4A 2CJJA 2KZVA 2VKVA 1B72B 2Y0MA 5FB2A 3GFIA 3ASSA 1DG1G 4DIQA 4L0YB 1W7PD 4TMZA 2DOFA 1H8HA 2LY1A 3FIWA 4PJMA 4W1UA 1E43A 1L3LA 4M72A 5LGNA 1W35A 1S72B 3HL2A 1ZARA 4ZDOA 4IHTA 3CMYA 1ZLJA 5E1WA 4F55A 1SFXA 3LA2A 1EF4A 1Y0YA 2M2EA 3L09A 2JDIA 3DBRB 5GPAA 4Z4UA 2VIXA 1TC3C 4U9UA 2V7VA 5FLXZ 4DBQA 3ZXSA 2NVUB 4I6ZA 1RU4A 2OQRA 5IP6A 2O9LA 2BVLA 4M9SA 2B5OA 4L18B 3BLYA 2HPMA 1VJSA 4CYDA 2VYQA 1WXRA 3CRZA 3FXJA 4W97A 1G7RA 2HOEA 2R6HA 2W57A 3GUDA 1K73D 1U5TA 3RDIA 1I1GA 4ASNA 3UR3C 5LD2C 2CGPA 5TGTA 4A6EA 3S16J 5DSZA 1QVUA 3R0AA 4XN0A 1X1PA 1BIAA 4J0QA 3L2WA 1DQUA 2IJLA 2XF7A 4BGDA 2RAEA 1VQNI 2RC5A 1IB0A 4RDKA 5A8AA 3AVTA 3LNNA 1VTNC 2K85A 4U0YA 3VSTA 3TP3A 5LRRA 1VQPI 3Q0WA 1KU3A 2D3LA 1DGWY 1LEAA 3FDYA 3IC7A 3KEWA 2VFQA 4A5NA 2Q6KA 4KITB 3CC7I 1X0CA 2KT0A 2Z9OA 2M4GA 2BN4A 2GOXB 2IGNA 3CUQC 3AGPA 1BC7C 2G7HA 1YITI 1QGPA
chains in the Genus database with same CATH topology
2F6CA 1SKYB 3KEYA 2PECA 4YZXA 1X1CA 3H9JA 3OYDA 1G59A 1H8EA 4B43A 2NTQA 3OYNA 2LZJA 2ZTGA 2VBMA 2LBFA 4XKWA 2LRDA 3SDBA 1PYVA 3OR2C 4XOTA 3SYTA 2CV2A 1UD2A 1T95A 3VDXA 4PJLA 4OJOA 1KCDA 3QODA 2V6EA 3T53B 3PNTA 1IDJA 2JVGA 3H35A 4Y4RA 4F3QA 3OYCA 2V7FA 2JA2A 1V0FA 1BN8A 3AL0C 4KJZA 2XNDA 4YZ0A 2HNHA 3H5AA 5HOOA 2LBFB 2V1NA 2W4SA 3OY9A 2HVRA 5IK2A 3H5NA 4C2UA 2JUGA 3S32A 4MR0A 2BW3B 3OYIA 2GJRA 3L2RA 1KMHA 3CMMA 3HXLA 2E5ZA 4U4BA 2VJIA 2O5RA 2CK3A 2ZFUA 3C2HA 4TSFA 3IUOA 2IQ7A 3OYGA 4PSXA 3FKJA 1OGMX 2CV0A 3H94A 2HVQA 2MYSA 2VQCA 1MNDA 4BEHA 3HOSA 1VZ0A 4CCMA 2BOLA 2WB1A 4DNRB 2IS4A 1IRXA 1FX0A 4KKUA 3VYTB 1XG2A 4P1WA 4OAYA 5C1CA 5CKTA 1O8LA 3IP4B 2XDVA 1VLYA 2NT9A 2O0WA 2MD0A 2WAEA 3K70C 4Y3OA 2X53S 3GVKA 3GVJA 5CPRB 4KISA 1O8DA 2RREA 4OJ5A 4PJNA 4XONA 1E79A 2A5WA 1W36C 1W36D 2O17A 4MLOA 3K4JA 1OLTA 3EPZA 3K4BA 4RLFA 1HVXA 3WQZA 3A1YA 3GQ9A 2MABA 1D1BA 2P0WA 4B47A 2WJVA 4PK4A 3D5RC 2IGMA 1MNEA 2K5CA 1LFPA 2WA0A 3HPHA 3TMOA 4Z03A 3UW0A 2CH0A 2M3AA 4DBRA 3QYBA 1E3XA 3GQ8A 2Z1DA 4J00A 3B4NA 4YZQA 4ZC3A 4E6KG 2X85A 4PFPA 1V5GA 2VB6A 4LG3A 4BUPA 3A2KA 2L7KA 3HPGA 2GJPA 2XSJC 4RLQA 3K4LA 4C9YA 4ZYAA 2PMZA 1PXZA 4BL0B 1DBGA 1T0FC 1UAAA 2HLDA 2LG4A 3NE5B 2PJRB 3CP8A 3QYEA 3IAS2 1WJFA 1WTHD 1YX5A 1KONA 2W6JA 4ANJA 1MW7A 2K9MA 3PNYA 2O0VA 3H0DA 1HG8A 1S9HA 2NTPA 3BCBA 3LSIA 1K28D 1CZFA 2VQLA 1SAUA 4Y33A 4E7IA 4FASD 3RSNA 4RM2A 1X1BA 2IXSA 3LMMA 2XF5A 3OEEA 1X1AA 2W82A 3EQNA 2VJ5A 4GQNA 1W9XA 5DN6A 4IX7A 2QX3A 4C2LA 1J09A 1WJCA 3OS0A 2CW7A 2JIZA 1WMRA 4ITVA 1VBLA 3HUGB 2ELJA 2VLAA 1WJ5A 5CQGA 1MABA 2WADA 1BOBA 3SUCA 1SFKA 2VKDA 3H9GA 2ZZGA 5CDFA 1OB0A 4BJTA 4BU2A 2X1EA 1E0EA 3VSUA 3OEHA 1PLUA 3BCFA 3WWGA 2CUZA 3HKZA 3DPTA 4R79A 5HNFA 1WFXA 3KRGA 2QXZA 4B3GA 1EE6A 3F9KA 5HLTA 3JU4A 2DCEA 3OYAA 3DDYA 2NSPA 4E7KA 3A3GA 3VYRB 1N77A 4E7HA 2WJYA 1X19A 1QJVA 4QPQA 4BE2A 3MKYB 4RM3A 1AIRA 1VF7A 3FKSA 4U87A 3SEQA 3OYHA 4CCKA 4HSTA 4CCLA 3W2VA 2JJ2A 3S3MA 4BXFA 5FRNA 1DBOA 2WPDA 3ZIAA 3PNVA 5HNHA 2HVSA 3LSHA 3I3LA 4BQNA 3FY3A 3OMYA 1KCCA 2PYHA 5AMVA 2ZZQA 4BE1A 1AA7A 1K6YA 1ZELA 4DJAA 3OWTA 1OHHA 1K5CA 1KTWA 1N75A 4YXWA 3CP2A 2X6YA 3DKXA 2E1MB 4D1QA 3A4CA 3MD2A 2KDOA 3K70D 2UUZA 4IZZA 3E0JB 4B48A 1OOCA 4PMHA 4XKBA 3OFNA 3DLAA 5JHFA 4C2TA 3VR6A 4ZJZA 4AYBA 2IGKA 4XM3A 4BQQA 2CS3A 1MMNA 4NK6A 2K3PA 3G2BA 4BQOA 3EUKL 2GJKA 2M7BA 2Z6BD 4HSRA 4ZDLA 3ZSCA 2VBKA 3D5LA 5FL7A 3VMVA 1WPCA 2KP6A 4F91B 1JRGA 3OIQA 4JOMA 1W0KA 4FXUA 2NSTA 3L2VA 1WJEA 4W8QA 3NWTA 3AKZA 4XL9A 4E4HA 2CUJA 3CZ6A 2KHMA 2VQHA 4ASUA 3CJRB 2QE7A 1O8FA 3VMWA 4OAZA 4PFOA 3A3BA 1O8EA 4OZZA 4HWVA 4YELA 3BH4A 2D3NA 4CH7A 2M7AA 2Y0SA 2M0MA 2WY7Q 3DU5A 2ODLA 4TT3A 5HKKA 3H9QA 3OAAA 2W7NA 3L2UA 3HOTA 2IS1A 4DK0A 3TL4X 1QHHD 2LY2A 1WJBA 3LSGA 1IA5A 3BCDA 4CCNA 4TKOB 3M1CA 4HPQA 4XLHA 3S93A 3OYBA 4BS9A 2IS2A 4G6TB 3MKZA 2L9NA 2HZDA 2R7WA 2UVFA 2LYCA 2VL8A 1JI8A 4C30A 1YE9A 2DIEA 4P22A 4AU7A 1X4OA 4DNTB 3K4NA 4N4NB 3VWBA 1IDKA 3OL4A 1E1RA 5HVQC 3OE7A 3T56B 1UELB 2DT6A 2E1BA 1W0JA 3K4CA 5KCMA 4IQJA 4PSWA 2DOAA 3DTEA 3HG9A 3GQBA 2DJIA 3FHNA 4XR6A 2R7QA 3N05A 1YX3A 3BC8A 3NWSA 4L8JA 2O1DA 2X3HA 3FBIB 4BJ5C 1FMWA 3CESA 4BEHB 4F52A 2V26A 2WAQA 2V7QA 2A6TA 4BDZA 3H5RA 2WZPP 2NZMA 1P9QC 2VPLA 4JMQA 1D0ZA 1RWRA 3W2WA 4HG2A 2WAFA 3DPUA 3ONQA 5LFAA 2X6WA 1WP6A 1GQ8A 1E3ZA 4U49A 2Z2SB 2V4DA 4G6IA 1O8KA 3PSFA 4CUGA 3OOCA 3ZPPA 2GK6A 3QOEA 2GOMA 4FETA 4UZUA 2BSPA 2QY1A 3OYLA 2VBEA 2XGJA 2W1OA 2INUA 4NK8A 3KX2A 4IQ4A 3GBGA 3VYUB 3BC9A 4DK1A 1Z3YA 2EWEA 2NT6A 3S3NA 4HRIA 4OJPA 5CQEA 4IKFA 4XORA 1RMGA 1V5EA 4DGWB 4XKVA 1OFMA 1EA3A 3HC7A 1NG7A 1O8HA 4HIZA 4KT6A 3K6GA 2M4KA 4NC8A 3HAGA 4E0FA 3GQAA 1BHEA 3U21A 4B3XA 2W6IA 2LOOA 1G8XA 4JQFA 4KKSA 1I18A 4OZYA 4XD7A 1I8DA 1LKXA 3OPOA 3JURA 1PE9A 1MMGA 2I8DA 3OOUA 1QU3A 2AQFA 4Z1MA 1BR1A 1Z21A 1X1DA 3DTKA 4E7JA 3PSIA 4W8SA 1WJDA 4PJJA 1H80A 1O8IA 4NQWB 1NRKA 2LH9A 3DWLE 2VQGA 2X6XA 3K10A 4OWRB 4PUSA 4DOZA 1DGRM 2XF6A 3OYFA 3DPLC 2F43A 2X1DA 2RNGA 1U0JA 1NG6A 3CJQB 2NTBA 1UD3A 1NHCA 2UVEA 2MC4A 3RCOA 2LREA 1BLIA 4II2A 4E7ZA 1FMVA 4W8TA 2F4IA 2W00A 1EFRA 4CZCA 4BACA 4MXNA 4E7LA 3K4KA 1Z3XA 3KYLA 1D0YA 4KKTA 2OV7A 3OL3A 4W8RA 2IS6A 4CSWA 4D9JA 2XC7A 2HDWA 4HEA2 2PJRA 2XOKA 2DXIA 4GRIA 1BR2A 4LITA 2JVHA 3PL8A 3OS1A 3VSLA 4OJ6A 2ZXIA 2L2OA 4LIUA 2X8KA 3DTIA 4CCOA 2KPMA 2L5QA 3PFYA 2GK7A 1OR7C 4I84A 3BCAA 4XLAA 1N78A 1Z7LA 2KRHA 2QKLB 2V4JC 3E1SA 3GQ7A 5C1EA 2HPIA 2DT7B 2E60A 5KNLA 1HA8A 4Z06A 2HU9A 3B90A 4CCJA 3LSKA 2PYGA 3RTRA 1D1CA 4XQFA 4BJ6C 3EUAA 1R6RA 3ZR8X 2R7VA 2ZSHB 1DP3A 2MFZA 2JJ1A 3DQVC 3OR1C 3OYMA 3LMWA 2VXZA 4YZAA 3S8PA 1JTAA 2XAUA 3TBIA 2R4GA 1WJAA 3M8JA 3OS2A 1ERDA 1PJRA 1E1QA 2R7UA 1NBMA 2R7SA 2UV1A 2ZSIB 5FRMA 2XZPA 2INVA 4XMYA 2QKMB 4G7XA 1D0XA 4XLCA 2OUMA 1MMDA 1BPLA 2F1MA 3L2QA 4J01A 3LFUA 3QYFA 2L9SA 4HNUA 2O04A 2VASA 2CV1A 2BVMA 1MMAA 2HQAA 4CA0A 2CFOA 3OYEA 2UWMA 1O8GA 4F92B 3T9GA 2E5NA 3A35A 4B3FX 2CMPA 2RQQA 4BE0A 2F5VA 1BMFA 3B8YA 2R7RA 3VSKA 1GLNA 1KZLA 2E1MC 2KVOA 1TZLA 3K4MA 2KMUA 4H4KC 1Y56A 3SEZA 4AVZA 4ZTFA 1UG0A 1UD5A 2LC2A 1Y6IA 2KQRA 4YEJA 4EATA 2ZZEA 3T51B 3C2GA 1O88A 4F93B 3AFHA 1QHGA 3OYKA 2R9VA 3OW7A 4N4OB 2JSPA 3LL7A 3SZGA 2KLOA 3PJRA 1V0EA 1PKVA 3W2AA 3S3OA 2CW8A 2XZOA 2WSSA 1T5EA 4LIVA 4XN3A 3V42A 3ZRGA 2Z16A 1OFLA 3ZQQA 1O8JA 1O8MA 4U7BA 2ZXHA 1TT0A 3DU6A 2KRCA 3D5SC 2IGOA 1D1AA 3I9V2 1BR4A 4NUBA 3VYSB 2KZVA 4XLEA 2M5SA 3G05A 3EQOA 4OJLA 4Z05A 3W3CA 4II3A 4DIQA 4XNFA 1H8HA 1X4PA 2LY1A 2OC6A 4PJMA 2WBMA 1E43A 4ZTJA 2R7OA 4BDYA 2WY8Q 3OYJA 3HL2A 4ZDOA 2K9LA 4YRVA 2VKHA 3FPPA 5FROA 4F55A 2JDIA 2NOJB 2X51A 4RMNA 2Z8GA 2ZZFA 4NC7A 3BG6A 5KHDA 2Q1ZB 4ZDPA 2VIXA 2VJJA 1V5FA 3DEEA 4B44A 4G7WA 3GRHA 3RPUD 1HZEA 4E7SA 2R7TA 4DBQA 3ZXSA 1RU4A 3EUHC 2XZLA 4X0GA 2BVLA 2V9KA 2KL4A 3CF2A 3BLYA 3IAM2 3OIPA 2HPMA 1VJSA 4HNTA 1COWA 4P5OA 3LSMA 3MMYB 2BW3A 1OGOX 1QCXA 4EW9A 1UD8A 3FBNB 4XKCA 2Q2EB 3UR3C 3PUBA 5LD2C 4XOPA 5TGTA 3ZGKA 2ZTNA 2R7XA 3VSVA 4XN0A 2X1CA 1LVKA 2VJ4A 3L2WA 1DQUA 2XF7A 3UNGC 4BGDA 3GVLA 1IB4A 1LDKB 3AL0B 2V31A 2VXDA 3LNNA 4URRA 3VSTA 4XLFA 1UD6A 2D3LA 3RQ4A 1DGWY 3DKYA 3J7AY 3FDYA 3ZPNA 3KEWA 3ZCOA 4KITB 3MKWB 1X0CA 1UD4A 4QPOA 2M4GA 3BG7A 2GOXB 2IGNA 2AQEA 2FUG2 4NNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEC A;  3SUC A;  4XMY A;  4XR6 A;  2O1D A;  4YZX A;  4XLC A;  2X3H A;  3VSU A;  1PLU A;  3WWG A;  2NTQ A;  2NZM A;  2VBM A;  4XKW A;  2O04 A;  2QXZ A;  3KRG A;  1EE6 A;  4XOT A;  1RWR A;  2NSP A;  1O8G A;  4OJO A;  4U49 A;  2X6W A;  1GQ8 A;  3T9G A;  1KCD A;  1O8K A;  3B8Y A;  1IDJ A;  3ZPP A;  1QJV A;  1AIR A;  4YZ0 A;  1BN8 A;  2BSP A;  2QY1 A;  4NK8 A;  2VBE A;  2INU A;  4AVZ A;  2EWE A;  2NT6 A;  1O88 A;  4YEJ A;  1DBO A;  4MR0 A;  4OJP A;  4XOR A;  1RMG A;  1OFM A;  4XKV A;  3FY3 A;  1KCC A;  1O8H A;  2PYH A;  4U4B A;  5AMV A;  2VJI A;  3GQA A;  1BHE A;  2IQ7 A;  4OZY A;  1K5C A;  1KTW A;  1OGM X;  2X6Y A;  1OOC A;  1PE9 A;  3JUR A;  4PMH A;  4XN3 A;  1OFL A;  1XG2 A;  1O8J A;  1O8M A;  4W8S A;  5C1C A;  1O8L A;  2NT9 A;  4XM3 A;  4NK6 A;  1H80 A;  1O8I A;  2O0W A;  4XLE A;  3EQO A;  4Z05 A;  4OJL A;  1O8D A;  2X6X A;  4OJ5 A;  4XON A;  4XNF A;  3ZSC A;  2O17 A;  2VBK A;  3VMV A;  2NTB A;  3GQ9 A;  1NHC A;  2UVE A;  1JRG A;  2NST A;  4W8T A;  4Z03 A;  3UW0 A;  4W8Q A;  4XL9 A;  3GQ8 A;  4MXN A;  3B4N A;  2Z8G A;  4YZQ A;  1O8F A;  2X85 A;  3VMW A;  2VJJ A;  4W8R A;  3GRH A;  1O8E A;  4OZZ A;  4HWV A;  4YEL A;  1RU4 A;  2ODL A;  1PXZ A;  1DBG A;  4OJ6 A;  1OGO X;  1QCX A;  4EW9 A;  4I84 A;  5C1E A;  4XLA A;  3GQ7 A;  1IA5 A;  4XLH A;  4XOP A;  4Z06 A;  3B90 A;  2PYG A;  2O0V A;  3VSV A;  1HG8 A;  2UVF A;  4XN0 A;  2NTP A;  4XQF A;  1CZF A;  1IB4 A;  4URR A;  3VST A;  4XLF A;  3EQN A;  3LMW A;  1IDK A;  4YZA A;  1JTA A;  2QX3 A;  4C2L A;  1X0C A;  1WMR A;  1VBL A;  2INV A; 
#chains in the Genus database with same CATH topology
 3CME I;  2PEC A;  4JX4 A;  3JSP A;  4XID A;  4P2N A;  2F3L A;  4HLX A;  2LTP A;  5D6E A;  1KRH A;  3OYN A;  2LZJ A;  2ZME A;  2NTQ A;  4LOC A;  1QVG B;  3GO5 A;  4XKW A;  2R7Z J;  2DOE A;  2LRD A;  1S5L C;  4ZCL A;  3SYT A;  5GPC A;  3Q6Q A;  4YAW A;  4GDF A;  1T95 A;  4PJL A;  5IYC J;  4G1V A;  2F5E A;  1NB0 A;  1YRN B;  3H35 A;  4HQM A;  2RQP A;  2DYR H;  2UXN A;  3JW4 A;  4WF2 A;  4F3Q A;  2B63 J;  2PEX A;  4M1K A;  4EJW A;  3ELK A;  2HNH A;  1OR7 A;  1Q1V A;  5E3L A;  3CCS I;  1G7C A;  4QIW N;  2UXX A;  3I5U A;  1BJZ A;  3GF2 A;  5GTI C;  3RQI A;  1E62 A;  5H5J A;  1J59 A;  1ZN2 A;  2ZL6 A;  1KU7 A;  2J8I A;  2Y31 A;  1HSJ A;  4GGG A;  1YS6 A;  3ONY A;  2VJI A;  3VNV A;  1VFC A;  2EFG A;  1WWX A;  2XHK A;  4TSF A;  2BM6 A;  2QZA A;  3IUO A;  1JE8 A;  4RD0 A;  3WBJ A;  3OYG A;  1H85 A;  2WR8 A;  4ZYE A;  2CV0 A;  2HVQ A;  1RUN A;  2NVT J;  2BOL A;  1PVE A;  2WB1 A;  4RBO A;  2JK3 A;  3FWE A;  3G1M A;  4G94 A;  2FBH A;  1K61 A;  2QCO A;  3F8M A;  4BY7 J;  3PIO F;  2O0W A;  1VQ6 B;  1FPQ A;  1O8D A;  3A01 A;  4HDV A;  3BR0 A;  1GVJ A;  1ULY A;  2ZL5 A;  4M3D A;  2C77 A;  3KP3 A;  2A5W A;  1TW2 A;  3HGY A;  5J3L A;  2QN6 A;  3K4J A;  3FM5 A;  3FJO A;  5KAI C;  4Q48 A;  1HVX A;  4M53 A;  2ZXW H;  1DDI A;  3VFZ A;  4I0A A;  1D2E A;  2P81 A;  1OKR A;  1D1B A;  5FIU A;  4OPS A;  3ZQF A;  4G8X A;  4PK4 A;  3D5R C;  2IGM A;  4OOV A;  1LFP A;  3HPH A;  4LLL A;  3BG5 A;  4D7M A;  1QFJ A;  2XNC A;  2MLG A;  1K78 A;  2HOA A;  2Z1D A;  4J00 A;  1VQ9 I;  4X07 A;  4E6K G;  2X85 A;  2DFE A;  1V5G A;  3Q3S A;  1Z6T A;  1BI0 A;  1GDT A;  4NK6 A;  3A2K A;  3HPG A;  1RRJ A;  2GJP A;  1Q86 D;  4RLQ A;  1FC3 A;  3Q0V A;  4ZYA A;  1UCR A;  1K79 A;  1W34 A;  3U6K A;  2WZN A;  3AVU A;  1YFH A;  1S4M A;  5J4V A;  1DBG A;  1T0F C;  1KA8 A;  2NXN B;  4JRA C;  2P8T A;  4YFN F;  2GZW A;  2Q6O A;  1KQS B;  1WJF A;  4LB6 B;  4BH9 A;  4WZK A;  3SQV A;  4DYR A;  4AM3 A;  4OOX A;  2W6J A;  5CVR A;  3CC4 I;  4AC0 A;  4XSZ F;  4CGZ A;  3KZZ A;  2FBK A;  4LG0 A;  3PUN A;  2PX9 A;  1R36 A;  3H0D A;  1XG1 A;  5LHI A;  3I55 B;  4M6Y A;  1A04 A;  2M45 A;  3HHH A;  5ICG A;  1U2W A;  1OCR H;  1IXR C;  2FD5 A;  5JVG F;  1CZF A;  2MH9 A;  2LLK A;  4IF4 A;  2W24 A;  1L1I A;  2B0L A;  4IRG A;  4FAS D;  4RM2 A;  1X1B A;  2VNI A;  2XF5 A;  3H0G J;  3GLX A;  2VBU A;  3EQN A;  2VJ5 A;  3R6K A;  1W9X A;  3HJE A;  5DN6 A;  3F6O A;  3CC7 B;  2KJC A;  4M74 A;  3J81 Z;  1FLI A;  2CW7 A;  4WXD A;  2QBY B;  1WMR A;  4ITV A;  3H9N A;  2V9V A;  3HUG B;  3SUC A;  1UMQ A;  3QPT A;  3MKL A;  1J2X A;  4YHB A;  5J6X A;  2BM0 A;  2LR8 A;  3OEH A;  3WWG A;  2G0E A;  2CUZ A;  4BAY A;  3WHC A;  3HTS B;  3O2P E;  2QQB A;  3KRG A;  4NCN A;  3OYA A;  4GXO A;  3CLQ A;  3FMQ A;  3U6B A;  3BOQ A;  2JPC A;  3K7A J;  5GP9 A;  3VYR B;  2GA2 A;  2JMW A;  3ULQ B;  2HYG D;  1K7A A;  1OCC H;  2K40 A;  4QPQ A;  1ORK A;  1QJV A;  4RM3 A;  1WH5 A;  1VF7 A;  3ZQI A;  3OYH A;  1JHF A;  2STT A;  3HBL A;  1I50 J;  2O0Y A;  4ZZD A;  3W2V A;  2XT4 A;  3T8T A;  3S3M A;  4MFE A;  5FRN A;  2H09 A;  4K1X A;  5EZG A;  2HOS A;  2HVS A;  1HA3 A;  2BM5 A;  5CLS A;  3NAR A;  3V7C A;  3HHG A;  1Y8Q B;  4BQN A;  5CVI A;  3ABK H;  2L7F P;  2RVC A;  1S8N A;  1YJN I;  4YDT A;  4A5M A;  4X8I A;  1AA7 A;  1K6Y A;  2KFD A;  4LBV A;  1SD5 A;  1ITY A;  2E1C A;  4YXW A;  2ZBV A;  3ZQC A;  3DKX A;  1BBY A;  2KDO A;  5F64 A;  4IZZ A;  1JUM A;  4B48 A;  1LPQ A;  3V7R A;  3F8B A;  3BJO A;  3H3V K;  5HDG A;  3C18 A;  4Z4R A;  3CPW B;  3DLA A;  4ON0 A;  1QPI A;  1MBG A;  1KJZ A;  3QP6 A;  2M8G X;  4UVB A;  1MH4 A;  2XRN A;  1EXM A;  2CS3 A;  1MMN A;  1MSE C;  2K3P A;  4Y9R A;  2MH2 A;  2VT2 A;  2DMT A;  4UUV A;  5H20 A;  3E6M A;  5K1Y A;  1PP7 U;  1UST A;  3BQZ A;  4HX7 A;  2NRA C;  1XN7 A;  2QQ8 A;  1IN5 A;  1KQ8 A;  3VMV A;  5DTD A;  1IC8 A;  1AKH A;  1JRG A;  2C6Y A;  2NST A;  1WI9 A;  5JHU A;  4XL9 A;  2QTL A;  3G6E B;  1SVO A;  2R7D A;  1MJA A;  2VQH A;  2XT2 A;  2A5Y B;  2CU7 A;  2F4M B;  3CJR B;  4MYU A;  1O8F A;  4A3L J;  2OTL B;  1VQK B;  1F20 A;  4ACB A;  1ZM9 A;  2F2E A;  1T6Z A;  3GXO A;  3CCS B;  4HWV A;  3MZY A;  4YEL A;  3GEZ A;  1P4W A;  2TDX A;  3EYY A;  4OZZ A;  3AVY A;  2ODL A;  1QO0 D;  4YCQ A;  3ZZT A;  3A8K A;  2M30 A;  2CRG A;  2ME6 A;  2W7N A;  4RD6 A;  3AG3 H;  3HOT A;  2IS1 A;  4DK0 A;  3LO8 A;  1KQ0 A;  2OD5 A;  3GZ5 A;  3PQJ A;  4A6D A;  2LY2 A;  4G12 A;  4DW6 A;  3H1C A;  3LSG A;  3SJZ A;  2H1L A;  1MIJ A;  2K27 A;  4Y15 A;  1E2X A;  4PAB A;  4LD5 A;  1OIS A;  3S93 A;  3OYB A;  2LKP A;  2L9N A;  2R7W A;  1X3Z B;  1POG A;  1FSH A;  1JI8 A;  3G1L A;  1ONV A;  2FF4 A;  1X4O A;  1TLL A;  3TKY A;  3OL4 A;  1YJW I;  3D0S A;  3U2R A;  2Y30 A;  2F4N A;  1XSV A;  4N3G A;  3LJY A;  2OTJ B;  3ZMD A;  4C43 A;  5DDG A;  3S1Q J;  2VE8 A;  2E1B A;  1YIJ B;  3VNU A;  4K2E A;  2DOA A;  5B1A H;  3FHN A;  4XR6 A;  5CYV A;  4L8J A;  3FM3 A;  1K4T A;  2JSC A;  2X3H A;  1FMW A;  4RDL A;  4KN7 X;  2HEO A;  2MG4 A;  4YFO A;  2LF7 A;  4YAU A;  3I56 B;  3H5R A;  2K86 A;  1LE8 A;  3I4M J;  3WND A;  4ESF A;  3A1P A;  3A02 A;  3L1P A;  3EYI A;  1RWR A;  4OIQ F;  1IUY A;  2JA8 J;  5LFA A;  2X6W A;  2ZJR F;  2CFX A;  3HOU J;  3H3U A;  3F72 A;  4IL6 C;  1Y1W J;  1CGP A;  1IDZ A;  2W7Z A;  3ABU A;  2V5I A;  1E3P A;  3A01 B;  4EEF G;  3E20 A;  1D5V A;  1PUE E;  4RD4 A;  4FET A;  4A0X A;  3TW6 A;  1U6G A;  3OYL A;  2QY1 A;  4NK8 A;  2QEN A;  3B6C A;  1IXS B;  2IT0 A;  3WTS C;  5CVV A;  4DK1 A;  3GBG A;  1F5T A;  1Z7U A;  2EWE A;  4HRI A;  1W4M A;  1FEX A;  1V5E A;  4DGW B;  4XKV A;  2DA6 A;  5B66 C;  1KU9 A;  1LEB A;  1EA3 A;  3HC7 A;  3ESW B;  2NS8 A;  5L46 A;  1XSX A;  4KT6 A;  2M4K A;  3QAH A;  3E6D A;  1B9M A;  4B8X A;  2XB5 A;  4X7F A;  3BR6 A;  2ZC2 A;  2BEO A;  4B3X A;  4KKS A;  1I18 A;  4OZY A;  3P5J A;  1IN7 A;  4XD7 A;  1Z1D A;  1XGM A;  4BHC A;  2D5V A;  1LKX A;  2YWE A;  3JUR A;  1R1V A;  3CCR B;  2XGE A;  1FOY A;  3ZMU A;  1RQR A;  2M1B A;  2ICW G;  2OZU A;  3BPV A;  3DXJ F;  3I4P A;  4N9I A;  4XIC A;  2L54 A;  5B1B H;  4HF2 A;  1QU3 A;  1BR1 A;  2VBV A;  1Z21 A;  1X1D A;  1Z0X A;  1JA1 A;  4Z1M A;  3OV8 A;  2EIM H;  3CCY A;  1WJD A;  1AHD P;  2VFN A;  5F4O A;  5F08 A;  4IHS A;  4NQW B;  2FQ4 A;  2LH9 A;  3N6Z A;  1XMX A;  2EV0 A;  4DOZ A;  2F43 A;  5HDN A;  1R4M B;  3PA2 A;  1QPM A;  3WTZ A;  2P7V B;  1U0J A;  2NTB A;  4EM2 A;  1YX2 A;  2HDC A;  3RCO A;  2COM A;  1YJ9 B;  4W8T A;  4II2 A;  1FMV A;  2W00 A;  3QP5 A;  1EFR A;  3CDL A;  1TT5 B;  3HEF A;  1LE8 B;  1GXP A;  2DN0 A;  4DNC A;  4EVI A;  3LSP A;  3CXC B;  1G3T A;  3F0C A;  3BTL A;  1WDT A;  3OL3 A;  3BZ6 A;  4PGO A;  4PC3 A;  4D9J A;  2XC7 A;  2DQL A;  5IY5 H;  4QWQ A;  4HEA 2;  1GVD A;  1W0U A;  2XOK A;  2NOG A;  2DI3 A;  3K2Z A;  2CW0 F;  1BR2 A;  1PDN C;  3BG3 A;  3PET A;  1LUJ B;  3P9K A;  4RB1 A;  1FP1 D;  2GWR A;  2HQ5 A;  4IRI A;  1GVH A;  3DTI A;  4CCO A;  3PFY A;  1YJN B;  4I84 A;  1Z7L A;  1JB9 A;  2QKL B;  2BMW A;  4P3Y A;  1LM1 A;  3JTG A;  2E60 A;  5KNL A;  1QUF A;  1JT0 A;  2F5D A;  1MJ9 A;  2CUE A;  3LSK A;  2PYG A;  1R22 A;  1HDP A;  2TCT A;  1U3E M;  4BJ6 C;  1F36 A;  3SY2 A;  1LNW A;  1KTV A;  1U8B A;  3QSY A;  5DNS A;  3ZR8 X;  2GLO A;  1WOP A;  2ZSH B;  2MFZ A;  4P25 A;  5DM6 F;  3MWM A;  2RGV A;  1RIO H;  3S8P A;  1SC7 A;  3GVA A;  3KCC A;  4BBR J;  4IRH A;  3M8J A;  3ERM A;  1TNS A;  4FX0 A;  5J8C A;  2R7U A;  3OZU A;  1WHU A;  1BJK A;  5TR9 A;  2ZSI B;  4ZV4 A;  2JRT A;  1F60 A;  4TMW A;  4XMY A;  2E2I J;  2F4O B;  3W2F A;  4M71 A;  2ID6 A;  4KIC A;  1QX4 A;  4QV2 A;  1U78 A;  5BS6 A;  1OPC A;  3Q0U A;  1BPL A;  3L2Q A;  1MD0 A;  4J01 A;  3LFU A;  3QYF A;  2L9S A;  4I7H A;  1R9T J;  2R92 J;  1JXS A;  3KL9 A;  2Z5U A;  3FKI J;  2CV1 A;  3WTX C;  4X7E A;  3OZV A;  1ZG5 A;  4CA0 A;  2QMU A;  4PC6 A;  1O8G A;  2HDD A;  4F92 B;  1O3R A;  2DFI A;  2CMP A;  1BMF A;  1OB2 A;  1QGA A;  4X7C A;  1EP3 B;  2E1M C;  3QQA A;  2KVO A;  1QH0 A;  3VO1 A;  4HQE A;  2XPV A;  4H4K C;  1Y56 A;  3HRU A;  2FE3 A;  2JTV A;  2LP0 A;  1UG0 A;  1UD5 A;  2LC2 A;  1Y6I A;  1O88 A;  4YEJ A;  2ZZE A;  3ASP A;  4NBQ A;  2HDN B;  3AFH A;  3TW7 A;  1XFO A;  1KYZ A;  1QZE A;  5FA6 A;  1OFD A;  2HI3 A;  3J81 k;  5D6F A;  1MH3 A;  2ID3 A;  4RB2 C;  3S2D J;  3E1Y E;  3CCQ I;  4Y13 A;  2FSW A;  4ZYG A;  5JI6 A;  2KDZ A;  4PC1 A;  2LFB A;  3RPU A;  1VQ8 I;  5DCM A;  3J7Y J;  2OYN A;  3MVP A;  5DCF A;  1BN5 A;  2ZKZ A;  2V9P A;  3V4G A;  3BZC A;  2EK5 A;  2XZO A;  2VON A;  1T5E A;  3E97 A;  4LIV A;  5CVU A;  3ZRG A;  1YI2 I;  5TRD A;  2BF4 A;  2Z16 A;  1YQA A;  3ZQQ A;  2E1R A;  5IYR A;  1O8J A;  1NK2 P;  2QSH X;  1YLO A;  3Q39 A;  1QRY A;  2JQ7 A;  4P3I A;  1TT0 A;  3VYS B;  2XEX A;  3G05 A;  4UZE A;  3G71 B;  1NHA A;  4OMZ A;  5E8G A;  3W3C A;  2L4A A;  3RI4 A;  2O6G E;  1D3Y A;  4XNF A;  3B78 A;  4IXA A;  2OC6 A;  1E64 A;  4B1R A;  3OYJ A;  2HCJ B;  3AST A;  2DW4 A;  4HE5 A;  3ROU A;  1K4Z A;  1REP C;  4E70 A;  4GFB A;  5EJC A;  4Z6Y A;  1I27 A;  4YRV A;  4OPW A;  4Y7N J;  1JA0 A;  2X51 A;  1TYV A;  2HMA A;  2XPU A;  3CME B;  2AXT C;  2PIA A;  1S29 A;  4D5F A;  1YRN A;  4B44 A;  2VJJ A;  3BY6 A;  4WZL A;  3RPU D;  3E6C C;  1HZE A;  3CTA A;  2AHO A;  1WKM A;  2FML A;  2DMU A;  2PMH A;  3BWG A;  1YTY A;  1J75 A;  1QQ1 A;  2XZL A;  2HXO A;  2DBB A;  2P6S A;  2RV8 A;  2V9K A;  3IAM 2;  3GWZ A;  1G6N A;  3CF2 A;  1NH3 A;  4YAF A;  4S04 A;  3R60 A;  5CJ9 A;  3PFI A;  3AG1 H;  2BW3 A;  2GM4 A;  1KZH A;  1TWA J;  5IYP A;  1HF2 A;  1OGO X;  2VOO A;  4M6V A;  3PSZ A;  3ABM H;  3L9F A;  3ZMS A;  4LK1 F;  1V3F A;  2YWG A;  5TV2 A;  4H0E A;  4XOP A;  1MGT A;  2R7X A;  3VSV A;  2FU4 A;  1Y0U A;  3MZ8 A;  2WB1 N;  5DCM B;  1LVK A;  1H89 C;  4UUS B;  2KJB A;  1BX1 A;  3HOW J;  3UNG C;  1LDK B;  3E3V A;  1TP4 A;  2VXD A;  3QPH A;  4XLF A;  4OIO F;  1O57 A;  3RQ4 A;  4LB5 A;  3DKY A;  3PA1 A;  2CQX A;  4Y7C A;  2NYX A;  2QSF X;  1H8A C;  4Q5S F;  3MKW B;  2D45 A;  1R49 A;  1ZGW A;  2NVQ J;  2M87 A;  3OYD A;  2AQE A;  1LFB A;  3TOA A;  3KEY A;  3ASO H;  3U1K A;  2LKS A;  4ZH4 F;  2J5O A;  1X1C A;  3H9J A;  1G7T A;  1G59 A;  1H8E A;  3O6B B;  3MMP A;  3AVV A;  2BV6 A;  2VBM A;  4HV6 A;  2XGX A;  2VN2 A;  3ZQG A;  3SDB A;  2Y2Z A;  3FXL A;  4RS8 A;  2OQG A;  3MHP A;  2JRM A;  3VDX A;  2FOK A;  4C3I J;  1K9M D;  3PNT A;  2OK8 A;  4C0S A;  2JVG A;  1IDJ A;  2YPR A;  2GQQ A;  1Z67 A;  2V7F A;  2ZNY A;  1A35 A;  1BIB A;  1BQE A;  3AL0 C;  3QU6 A;  2XND A;  4YZ0 A;  1ZTR A;  4TMX A;  2LBF B;  4JX6 A;  2W4S A;  5EGO B;  2VKE A;  3JR9 A;  2FX3 A;  1ZM3 A;  4MTD A;  4C2U A;  1N0U A;  2CQQ A;  3S32 A;  4MR0 A;  2P5K A;  4OIN F;  2GJR A;  2EIJ H;  1OYW A;  1DPR A;  3KP4 A;  2CG4 A;  3CMM A;  3JAM K;  2QEX B;  2O5R A;  2QSG X;  1ETY A;  3C2H A;  2XB0 X;  3GCM A;  4UZF A;  5EF6 A;  4BQA A;  2A3S A;  5EDN A;  4PSX A;  5BQT A;  1OGM X;  4I0B A;  2MYS A;  2ZB9 A;  4O6J A;  3JRD A;  3MQ0 A;  2ACJ A;  4IW3 B;  2DDA A;  1OCP A;  1XC5 A;  2BGI A;  2RKH A;  4ENM A;  1FWZ A;  1SM4 A;  2BV3 A;  3FPK A;  5ICE A;  1U9O A;  4OAY A;  4UV9 A;  5C1C A;  2JN6 A;  3IP4 B;  2XDV A;  1DDG A;  1VLY A;  2GPJ A;  1OB5 A;  2MD0 A;  3GVJ A;  2X53 S;  1TYX A;  3GVK A;  2DQR A;  4KIS A;  5ICC A;  1WGX A;  4PJN A;  1E79 A;  1VF9 A;  1W36 D;  4GCV A;  4MLO A;  3EDP A;  1DP7 P;  1P4X A;  3WQZ A;  3CJN A;  2ZME C;  3GQ9 A;  1B1B A;  2P0W A;  2PMU A;  2HKX A;  4HX8 A;  3CCJ I;  4A93 J;  2QLZ A;  3KP5 A;  1R5I D;  2WTE A;  4DBR A;  1LFU P;  4AYB N;  3B4N A;  4UV8 A;  4ZC3 A;  3SYJ A;  4Y9U A;  4WCG A;  3GTM J;  2VB6 A;  4WK8 F;  4FTH A;  4P6V F;  3V7S A;  5F1R A;  1ODD A;  3I59 A;  4ENK A;  3E5X A;  4RD3 A;  3ZMT A;  1JTY A;  1QNT A;  2HYF A;  2PQ8 A;  3BR1 A;  3JRH A;  3OP1 A;  2OCE A;  3H3Z A;  2DLL A;  2VBY A;  4Y52 J;  3JQQ A;  3NE5 B;  4S0H B;  2E2J J;  3QYE A;  4EJO A;  5M5Y J;  4UNO A;  1V54 H;  1R4N B;  1V4R A;  3Q9V A;  3N4M A;  1U5T C;  1MW7 A;  2K9M A;  4XRF A;  1AWC A;  2MW8 A;  3PO3 J;  4B09 A;  5GV7 A;  2DK8 A;  1F1Z A;  3A0B C;  1HG8 A;  3GTG J;  2O0V A;  4CIC A;  5KSW B;  2XNJ A;  1MBE A;  1W1W E;  1R58 A;  1FND A;  1JGG A;  3HM5 A;  1R23 A;  2NVY J;  5EZH A;  3CCM I;  3ZP5 A;  3PVD A;  1VQN B;  1SMY F;  4U88 A;  3LMM A;  1T38 A;  3CCL B;  3OEE A;  1VQP B;  3H36 A;  1Y0N A;  4UB8 C;  3FMS A;  3K1P A;  2IBD A;  4Q47 A;  1WJC A;  2JIZ A;  3GTP J;  1IJE A;  2ELJ A;  1ETX A;  1LDJ A;  1D8J A;  1VQL B;  3ZZ0 A;  4ZYH A;  1AMO A;  3PIP F;  2VKD A;  3H9G A;  4O5V A;  5ILU A;  1ZRC A;  4DQ2 A;  3G4S I;  2FX0 A;  2Y48 A;  1PLU A;  4KMF A;  3JCU C;  1B8I B;  1TBX A;  1EH7 A;  2DEU A;  3OW2 B;  4AIK A;  3M3Y J;  5EMN A;  1WFX A;  5JLV C;  5AIQ A;  4FK8 A;  5D8K B;  1W87 A;  5HLT A;  4RB3 C;  2DCE A;  1EE6 A;  1HBX G;  1OCT C;  3DBL B;  1N77 A;  1QA2 A;  1TQM A;  4H9G A;  3CD6 I;  1S7E A;  2VFM A;  1AU7 A;  3FKS A;  3I59 B;  4NDL A;  4CCL A;  2JJ2 A;  3C2B A;  2ZBU A;  2LDU A;  1K4S A;  1SFE A;  4JK1 X;  3ZIA A;  2GXG A;  4RD2 A;  3W5U A;  2ZJP F;  1HKS A;  2C4U A;  3CCU I;  3CCE B;  3FY3 A;  4RAF A;  1O3T A;  2ZZQ A;  1CF7 A;  4RAZ A;  2LKX A;  5FFX A;  4DJA A;  3OWT A;  2C2W A;  4M73 A;  2H6B A;  3CDI A;  2QUF A;  4L9V A;  5DUI A;  2ZNZ A;  1YHQ I;  3ZZU A;  2E36 A;  4D1Q A;  1OOC A;  3C1D A;  2UUZ A;  4OOI A;  2W25 A;  3E0J B;  5D5W B;  5H6R A;  4XKB A;  3FK7 A;  5BOX A;  5JHF A;  5L3E A;  4HLY A;  1IRF A;  4ZJZ A;  4AYB A;  1EP2 B;  3CB4 A;  3R4K A;  4FE7 A;  2GJK A;  2O8X A;  3BTC A;  3F3X A;  3LSJ A;  5DS9 A;  2PG4 A;  1OJL A;  4HSR A;  1MBK A;  1T39 A;  3I58 A;  4ZDL A;  6PAX A;  2P6T A;  4Z2Y A;  4X6A J;  3ZSC A;  5FL7 A;  4WWC A;  2HZT A;  4MEX F;  4HZF A;  4M3B A;  5M3F J;  1A6I A;  5B3S H;  3OIQ A;  5JVT A;  4JOM A;  1W0K A;  2RC6 A;  4RD1 A;  1FBU A;  1ZRD A;  2GA1 A;  2UZK A;  3AKZ A;  2LD5 A;  1YG2 A;  1R7J A;  3S14 J;  2CUJ A;  1LB2 A;  3COA C;  2KHM A;  2AO9 A;  1A8P A;  1O7F A;  2QE7 A;  3DBH B;  3CLO A;  2QM3 A;  1CNE A;  2W84 A;  3O3K A;  4BKX A;  1U8R A;  2CBX A;  3WYA A;  2Z99 A;  2Y0S A;  2ZL7 A;  1VHE A;  5IYW A;  3JTH A;  3F8N A;  1UJ8 A;  3U2Q A;  1U5T B;  1GXQ A;  4WX9 A;  5KVR A;  2V7X A;  3OAA A;  2ZME B;  3L7W A;  3KEO A;  3JQP A;  1QHH D;  3S2H J;  4WXC A;  1WJB A;  2P4W A;  2A07 F;  3PSS A;  3TP0 A;  3SFI A;  4HPQ A;  3HSF A;  2JZY A;  4G6T B;  1YIO A;  1SFU A;  3EET A;  5F4J A;  1KQ5 A;  5AIP A;  1SEU A;  3CMA I;  3FXO A;  1YE9 A;  4DNT B;  4AU7 A;  1UHW A;  2MC3 A;  2V7W A;  3K4N A;  2CND A;  1IDK A;  1KYW A;  5HVQ C;  1YOV B;  3OE7 A;  3OIO A;  4TMV A;  3T56 B;  5HOD A;  1UEL B;  5DYM A;  1RNL A;  5K7Z A;  3AVW A;  3BH7 B;  4NC6 A;  5KCM A;  4KFC A;  4IQJ A;  1PJ5 A;  4D0P A;  2BGC A;  3DCF A;  3GQB A;  5H59 A;  2L9V A;  1G2H A;  2OBS A;  3ZC3 A;  2WAQ A;  2V7Q A;  2A6T A;  4BDZ A;  2WZP P;  2NZM A;  2ECB A;  4A3I J;  3IRQ A;  4HBL A;  4OIR F;  4DZP A;  2QGU A;  2R3S A;  4I2O A;  4KDP A;  3QE2 A;  4EJV A;  4HG2 A;  4OP7 A;  3DPU A;  1MBH A;  5FJ8 J;  4U49 A;  3SJM A;  1FNB A;  4G6I A;  3PSF A;  4CUG A;  2DO7 A;  5A2Q K;  3CD6 B;  1NTC A;  5IPA A;  2R5Y A;  5FLV A;  4PC7 A;  3NRV A;  3SLN A;  3ZPP A;  4EGY A;  3Q6R A;  1KK1 A;  1YJ9 I;  2VBE A;  1E3H A;  1WCM J;  2EFQ A;  1AIP A;  3FXM A;  5E79 C;  1S7O A;  1O4X A;  2HTJ A;  4CHU A;  1JJ6 C;  3GTL J;  4OJP A;  3F6V A;  4A3D J;  3MN2 A;  4HIZ A;  2YUS A;  3HAG A;  3EUH A;  4OU0 A;  4FX4 A;  1Y39 A;  1SVL A;  1R71 A;  2L7M P;  4P9F A;  2VNK A;  2W6I A;  4V19 K;  3X2Q H;  1YHQ B;  4OM9 A;  3GTJ J;  2PN6 A;  5HLH A;  2QGG A;  3JAM Z;  3OOU A;  1ZRE A;  3CC2 B;  2B7B A;  4Z4V A;  4ZCM A;  2BM1 A;  2QVO A;  4I98 B;  4YIR X;  4DQK A;  1QZY A;  3DTK A;  4KIB A;  3PSI A;  3JRE A;  4E7J A;  1E3O C;  4ROX A;  1O8I A;  3ZQ7 A;  1NRK A;  3QOP A;  4N0B A;  4U0W A;  3DWL E;  2VQG A;  1ZUN B;  4PUS A;  4OWR B;  3QPS A;  1JT6 A;  1DGR M;  3T0Y A;  3ZOB A;  3DPL C;  3IWF A;  3OYF A;  1DAR A;  4G1B A;  3JX8 A;  2RNG A;  1NG6 A;  2Y9Y A;  1UD3 A;  1VQ6 I;  1BI2 A;  1X3U A;  4A69 C;  5IOY A;  1DPU A;  2MC4 A;  5LHG A;  2EIX A;  1X2M A;  2YU9 J;  2NNY A;  2BBY A;  4MHG A;  4Z4S A;  2QQA A;  2QA4 I;  1ZLK A;  2FNP A;  1MZB A;  4AF7 A;  4E7L A;  2OBR A;  1Z3X A;  1FX7 A;  1YLF A;  2YX4 A;  3KFW X;  3TGN A;  3JRI A;  4KKT A;  2BHY A;  2LVS A;  1RZ4 A;  2BXZ A;  4I99 C;  1K78 B;  4W8R A;  2R5Y B;  4X0C A;  3MAJ A;  4PC2 A;  2LMD A;  2HDW A;  3QFS A;  2L01 A;  2B0R A;  3WTT C;  5IP9 J;  3FXR A;  3PL8 A;  3VSL A;  1YW9 A;  4OMY A;  4OJ6 A;  2ZXI A;  4LIU A;  3WHB A;  3AAF A;  1B4A A;  2X0L A;  4JYK A;  2L5Q A;  3JRG A;  2GK7 A;  2DA2 A;  1OR7 C;  2ZBK A;  3Q5F A;  3BCA A;  1SVM A;  3E1S A;  4G5G A;  1DAB A;  3B90 A;  1TWF J;  1CNF A;  1XE1 A;  2EH3 A;  4XQF A;  3B02 A;  2I5U A;  2R5Z B;  3EUA A;  1R6R A;  1N05 A;  1KC8 D;  2R7V A;  3GFM A;  2QZ8 A;  1DP3 A;  3WE2 A;  3RKQ A;  4YZA A;  4A0Z A;  2VBW A;  5IYN A;  5IYD J;  3CCQ B;  4OIP F;  5DM7 F;  2R4G A;  3M9A A;  3OS2 A;  1PJR A;  3CUO A;  1MJB A;  1V5V A;  4QHY A;  2L7Z A;  1FRN A;  2FOW A;  3C3W A;  3ZPL A;  4A3G J;  5FRM A;  2XZP A;  2ISZ A;  2PI0 A;  3SLD A;  2QKM B;  4LK0 F;  1T0F A;  3I71 A;  1CQX A;  2O6W A;  5EEA A;  2OUM A;  3HOV J;  2DDB A;  2MLK A;  1JGS A;  1EH6 A;  1R1U A;  4HNU A;  5H6Q A;  1MRZ A;  2MBF A;  4BXU A;  2YWH A;  2VAS A;  4XRM A;  1MMA A;  5L3F A;  2UWM A;  2VOP A;  2E5N A;  3A35 A;  3SHF A;  4BE0 A;  3B8Y A;  2R7R A;  5BMZ A;  3W6K B;  1FYM A;  5C3E J;  1KZL A;  4LBW A;  4DQL A;  4MO7 A;  3SFZ A;  2A05 A;  4X7D A;  4ENN A;  1TZL A;  3K4M A;  4BHP A;  3P4G A;  3WNB A;  3BJA A;  4F7Z A;  4ZTF A;  1FNC A;  4JBA A;  1DU6 A;  2Q8K A;  1IO2 A;  1MDM A;  4RJL A;  4IJA A;  2KQR A;  4EAT A;  5E18 F;  3E6B A;  4F93 B;  1BC8 C;  1BL0 A;  2V1U A;  1ZM4 A;  1M1K D;  3W2E A;  5D4S A;  1QHG A;  4NHJ A;  2V7U A;  2JSP A;  3AVX A;  3LL7 A;  3CUQ B;  5JBQ A;  5D8L B;  2PBI A;  2KLO A;  1YI2 B;  3WBK A;  3PJR A;  4A3K J;  3HTU A;  2AHQ A;  4EMS A;  2EZK A;  1FP2 A;  3BR2 A;  3HDD A;  2HWV A;  2BE5 F;  4RB0 A;  1VI0 A;  4XN3 A;  3FHZ A;  1F43 A;  2CQK A;  5HLI A;  5K7F A;  1OFL A;  3RKX A;  4RAY A;  5HS8 A;  1GJR A;  1FOW A;  4BY1 J;  3GTO J;  1ERD A;  2L0K A;  3D5S C;  3FZV A;  4D5C A;  1GUU A;  3WE3 A;  4NUB A;  4XLE A;  1O3S A;  2M5S A;  1SD6 A;  3KLN A;  1MNM C;  3EQO A;  4OJL A;  4Z05 A;  2EIK H;  1N06 A;  1SD4 A;  1JKP C;  4II3 A;  4EH1 A;  5FNZ A;  2RC4 A;  5D5X B;  1JUS A;  2WBM A;  1MKM A;  1D8T A;  3ZQH A;  4ZTJ A;  2WY8 Q;  1ZG3 A;  5E1X A;  4GO1 A;  2FRH A;  2H8W A;  5GAG J;  3FPP A;  1OCZ H;  5FRO A;  1STZ A;  1T56 A;  1B2R A;  3F8F A;  4N9H A;  5K5O A;  2Z8G A;  2ZZF A;  4NC7 A;  1HF0 A;  1Q82 D;  5D4R A;  5KHD A;  1B6A A;  3PO2 J;  5E8I A;  3GRH A;  4I09 A;  2R7T A;  3SZP A;  1WH7 A;  3G6E I;  2P5L C;  1WQ2 A;  1ZGJ A;  5EGO A;  1IAW A;  2KL4 A;  2O61 A;  3WNC A;  3HGG A;  1UG2 A;  4HNT A;  2OTL I;  4P5O A;  1COW A;  3LSM A;  3MMY B;  4HW0 A;  1R5H A;  3LQQ A;  4RDJ A;  1NJI D;  4A3B J;  1QCX A;  2CUF A;  3N97 A;  3FBN B;  5ERI A;  3L2C A;  2Q2E B;  2CO5 A;  3PUB A;  4ESB A;  3HYI A;  3A0H C;  2ZTN A;  2NS7 A;  3NAU A;  5BSX A;  3ML3 A;  5DD8 A;  1ETV A;  2ESH A;  1IB4 A;  3AL0 B;  2YUH A;  2V31 A;  3R6J A;  4BYY A;  1K6O A;  1R5B A;  2I10 A;  5LBQ A;  3WTW C;  3J7A Y;  1EFC A;  5J8F A;  2KIU A;  1UZC A;  1ZM2 A;  1GR1 A;  3W6J B;  1TL8 A;  1RES A;  1UD4 A;  4QPO A;  1GAW A;  2VNJ A;  1QGZ A;  2DXI A;  1G3S A;  4R1H A;  1XPX A;  1I6H J;  3Q9S A;  4YZX A;  4B43 A;  2YX7 A;  5A2Q Z;  2LBF A;  2CC2 A;  1PYV A;  2Y69 H;  3OR2 C;  4XOT A;  1W7P A;  3A8J A;  1USS A;  4XSX F;  4P26 A;  2ZFW A;  4M9X A;  2PLF A;  2V6E A;  2FJ1 A;  2IA0 A;  3T53 B;  2STW A;  3JRA A;  4Q4Z F;  4FQG A;  5IYQ A;  2JA2 A;  3OJX A;  4KJZ A;  2M8E A;  3F21 A;  1QG0 A;  2YSR A;  3DFG A;  2IAI A;  3TQN A;  3OY9 A;  5IK2 A;  2QEX I;  2JUG A;  2DTR A;  4ESJ A;  5LEJ A;  3P9I A;  1XMK A;  2DYI A;  2V1X A;  1XQB A;  1N0V C;  2E34 A;  2ZCW A;  1KMH A;  4ACA A;  4A3M J;  1KK0 A;  4U4B A;  2ISY A;  1W5T A;  5GAD J;  1GV2 A;  2IQ7 A;  2H1K A;  3QU3 A;  1IGN A;  1GAQ A;  2GAU A;  1QQI A;  3WU0 A;  1QBJ A;  4AF6 A;  2LY9 A;  1J5Y A;  4BEH A;  1APL C;  1I1S A;  3GIR A;  4CCM A;  4HAM A;  4DNR B;  2CSO A;  3RYR A;  3VYT B;  1W5C C;  1FX0 A;  1O8L A;  2NT9 A;  2KIQ A;  5GV8 A;  3J80 Z;  4YEI A;  5FKK A;  4Y3O A;  4IHY A;  3K1M A;  1Y1V J;  4PJ0 C;  4UY8 I;  2O17 A;  2EFW A;  1W36 C;  2CF4 A;  1OLT A;  3EPZ A;  3K4B A;  1WSR A;  4FE4 A;  5K5R A;  4HE6 A;  2M34 A;  4B47 A;  2COB A;  1BI3 A;  5JFR A;  3UW0 A;  5C4J J;  4KIF A;  2DA1 A;  1E3X A;  1RUO A;  2DAO A;  4YZQ A;  3R0J A;  1Y0R A;  4PFP A;  4LJZ F;  1TWH J;  4C3J J;  4TMT A;  4UXN A;  2FQ3 A;  4LG3 A;  3QFT A;  1RR7 A;  4BUP A;  2L7K A;  2XSJ C;  4C9Y A;  3K4L A;  5E3N A;  4L5I A;  5FD6 A;  1XDU A;  3VEP A;  3M8F A;  2PMZ A;  2EQR A;  2VFO A;  4XRS A;  4BL0 B;  3I53 A;  1UAA A;  1SAN A;  1E63 A;  2HLD A;  2LG4 A;  3JQR A;  2HKO A;  1O7L A;  3CP8 A;  3IAS 2;  9ANT A;  5FFZ A;  1OQY A;  3FK6 A;  2QYU A;  5LLQ A;  5ICF A;  4AIH A;  3LQ6 A;  5FO1 A;  3RIQ A;  2DFH A;  3EQL F;  1U2R A;  4MEY F;  1S9H A;  3BCB A;  3LSI A;  1K28 D;  2XAG A;  3PQK A;  1E17 A;  1A6Q A;  2VQL A;  1SAU A;  2RN7 A;  4E7I A;  3RSN A;  2XUB A;  2IXS A;  1M1E B;  1X1A A;  2W82 A;  2R7F A;  5JMC B;  4RPB A;  2XSD C;  1Z05 A;  4LLG F;  1F9N A;  1GV5 A;  1TNT A;  1ETK A;  4C2L A;  1J09 A;  1VQ5 I;  3U9G A;  2EIN H;  3ASQ A;  1WJ5 A;  5CQG A;  3V8K A;  2WAD A;  1BOB A;  5GAH J;  1MAB A;  1SFK A;  4HF1 A;  3K0L A;  5CDF A;  4HOB A;  4BU2 A;  3FX3 A;  3VSU A;  3IH2 A;  3CW2 A;  2XAJ A;  2WWY A;  1RI7 A;  1DUX C;  3BCF A;  2KIS A;  1VQ4 I;  1VQM B;  4R79 A;  5JLW A;  2ZXJ A;  1Z77 A;  3H92 A;  5L3B A;  3JRF A;  2QXZ A;  3HB9 A;  3F9K A;  2EZI A;  3AG4 H;  3D1N I;  4L9J A;  1VQK I;  2CW5 A;  4E7K A;  3A3G A;  2NS0 A;  2QF7 A;  5B6I A;  4E7H A;  4HA8 A;  4Q7J B;  4YAL A;  4OPV A;  1X19 A;  1FDR A;  2KKO A;  2XRO A;  4BE2 A;  2FVG A;  3MKY B;  1AIR A;  2DK5 A;  2DOD A;  4U87 A;  2PE3 A;  1B23 P;  2CWE A;  3CJT B;  2M5W A;  1EKE A;  1FJL A;  2WAQ N;  4KIG A;  4BXF A;  2C5B A;  1F4K A;  2K02 A;  1C0W A;  2WPD A;  5HNH A;  1ETO A;  4HF0 A;  2DCU A;  4Z4Z A;  5D5V B;  2PMD A;  1BW6 A;  2DA5 A;  4A3F J;  4QFM A;  3OMY A;  4WWV A;  2PYH A;  4AC9 A;  1ZEL A;  4ZCI A;  2XTW A;  3GZ6 A;  1PUF A;  1T6S A;  1OHH A;  2DOG A;  1K5C A;  3CCV I;  1KTW A;  1N75 A;  3LNQ A;  3CP2 A;  3AGQ A;  3A4C A;  3MD2 A;  4QUZ A;  4PMH A;  1X2N A;  1P2F A;  3JSO A;  3OFN A;  1IJF A;  2E7W A;  1CQT A;  1FNM A;  1VQ8 B;  3KZI C;  4C2T A;  1IZ1 A;  4MNU A;  4X06 A;  1EP1 B;  4IHX A;  4XM3 A;  2HQN A;  2NV4 A;  1IDY A;  4Z4Y A;  2KIF A;  3G2B A;  5EEH A;  3A8I A;  3J7Z I;  1HST A;  2M7B A;  4AUX A;  2VZL A;  2Z6B D;  4MQ9 F;  2ELH A;  1H9T A;  2IOU G;  4A3J J;  3D5L A;  4BHB A;  2JT1 A;  2KP6 A;  2V6C A;  5J47 A;  2HS5 A;  2GIZ A;  1OGJ A;  1YW7 A;  2G9W A;  3L2V A;  5C44 J;  1WJE A;  4MQV A;  4W8Q A;  3NWT A;  1A31 A;  3WG9 A;  3LFK A;  2DMN A;  2QYO A;  1IG7 A;  1EZG A;  4PGG A;  4ASU A;  1MBF A;  4PZJ A;  3S1N J;  5ILV A;  3VMW A;  3PM1 A;  1XS9 A;  2IVM A;  1ZQ3 P;  3TED A;  2Y9Z A;  3ML6 A;  1O8E A;  1QGY A;  3W6V A;  3RZO J;  2D3N A;  2M0M A;  2WY7 Q;  4IHW A;  3BPX A;  1IN4 A;  3SDG A;  4LFU A;  5HKK A;  3H9Q A;  4AVP A;  2D74 A;  3V76 A;  3L2U A;  1EA0 A;  1SFO J;  4FHT A;  4A0Y A;  4HX4 A;  3TL4 X;  5K7H A;  1B9N A;  2N8G A;  1TQP A;  3E5Q A;  1IA5 A;  2BHZ A;  2JN9 A;  2WYR A;  4G6Q A;  5KW9 A;  4XLH A;  4JX5 A;  4BS9 A;  2O8K A;  4V2F A;  2OU2 A;  3MKZ A;  3CCR I;  5LRS A;  1I7P A;  1PP8 F;  2HZD A;  2X0K A;  3ZUG A;  2UVF A;  4HNV A;  3KYC B;  2IP2 A;  2MD5 A;  1XGS A;  1ETW A;  2VL8 A;  4C3H J;  2DIE A;  4P22 A;  2IA2 A;  3BT9 A;  3B82 A;  2BX6 A;  2D2W A;  4LBZ A;  3VWB A;  2O03 A;  2Q6I A;  5F0H A;  3ONU A;  2IA1 A;  2Z33 A;  2DT6 A;  1HW1 A;  2C5H A;  4U7D A;  3W5H A;  4YII A;  2D9R A;  2GIV A;  3HG9 A;  5JLX A;  1R1T A;  1JKQ C;  1ZR4 A;  1VND A;  2DJI A;  2JJ7 A;  1TW3 A;  3KP2 A;  3BC8 A;  3N05 A;  4KUM A;  4BJ5 C;  1BM9 A;  3RYP A;  1EH8 A;  3CES A;  4WZE A;  4F52 A;  3G4S B;  2V26 A;  3AG2 H;  4A3E J;  1Q7Y D;  2VPL A;  3HZJ A;  2KIM A;  4RLZ A;  3K1N A;  2KRF A;  1D0Z A;  5KK1 A;  2BY3 A;  2Q2E A;  3WG7 H;  1HXD A;  1JKO C;  2G7U A;  4QVJ A;  1ZG1 A;  1ETQ A;  2Z2S B;  1E3Z A;  1GQ8 A;  1Z6R A;  3ECO A;  1BW5 A;  3ASR A;  3WGH A;  3QOE A;  4UUS A;  2BSP A;  4UZU A;  1I6X A;  3B73 A;  4TV7 A;  2DJN A;  5FGM A;  2W1O A;  2M9H A;  1X58 A;  1R00 A;  2F5F A;  2XPW A;  2HOT A;  1FT9 A;  4IQ4 A;  3VYU B;  3P26 A;  3SZE A;  1XGO A;  2X6O A;  2NT6 A;  4ZYD A;  3FXK A;  2ADU A;  4XOR A;  4P9S A;  1NG7 A;  4UVC A;  1J9Z A;  2ZO4 A;  2NTP A;  3GQA A;  1BHE A;  3DEW A;  3U21 A;  2LOO A;  4JQF A;  1V55 H;  4RGS A;  1ELO A;  3SQN A;  4RM0 A;  2EV6 A;  1YO5 C;  1NK3 P;  3S15 J;  3KPH A;  3OPO A;  3QWL A;  3OKX A;  1IW7 F;  5FO0 A;  2I8D A;  1TQI A;  2EV5 A;  2VNH A;  5IOZ A;  1GHC A;  3CC4 B;  3LA3 A;  4W8S A;  1KK3 A;  4PJJ A;  1ON2 A;  3DP7 A;  3WU2 C;  2L9R A;  3IRR A;  4MGR A;  1P4A A;  5AON A;  5L3C A;  2JA5 J;  3WOD F;  3PUM A;  5AN9 A;  3ZN0 A;  3FF5 A;  3F23 A;  1I39 A;  2CQ7 A;  1UHM A;  1K8F A;  1J0R A;  1VQ9 B;  4M6X A;  2OJE D;  3BR5 A;  5M5X J;  2H94 A;  2PFB A;  4E7Z A;  3GSI A;  1T6X A;  1OFC X;  2E2H J;  3ES9 A;  5TY0 A;  3SZT A;  1VLO A;  3K4K A;  2BYV E;  1ZGA A;  3GFL A;  1NB9 A;  2BSA A;  2OPT A;  2VBS A;  4ZGQ B;  1A5J A;  1D0Y A;  5F0F A;  2OV7 A;  5E6T A;  5HZB A;  2VC1 A;  3LA7 A;  4CSW A;  1LDD A;  1RKW A;  4O3M A;  2A68 F;  1QRB A;  1HDD C;  4GRI A;  1B59 A;  4R8H A;  4MTE A;  4LIT A;  1QRC A;  2E1N A;  3OS1 A;  3GZN B;  5L3G A;  4IHV A;  2L2O A;  2X8K A;  3VMF A;  3ECH A;  2VFP A;  2KPM A;  3NB2 A;  1X3W B;  1N78 A;  2KRH A;  3HRM A;  3ZMZ A;  3WTY C;  2HPI A;  5IP7 J;  1JNY A;  2DT7 B;  3S1R J;  1HA8 A;  4J19 A;  4Z06 A;  1IRZ A;  4QLC U;  3LQR A;  2L02 A;  5HDK A;  1D1C A;  3V8J A;  3GYH X;  3B8H A;  4LG0 B;  4D7N A;  4MYT A;  3NEU A;  2PMZ N;  1J9I A;  4X1E A;  4G6D A;  2JJ1 A;  3DQV C;  3OR1 C;  3OYM A;  4M2L A;  2VXZ A;  5IYB J;  1HLV A;  1JTA A;  3LMW A;  3G71 I;  2XAU A;  3TBI A;  1MMS A;  3ZN1 A;  5HLG A;  3BNW A;  1E1Q A;  1NBM A;  1G3W A;  2P5V A;  1IN8 A;  3H09 A;  4EGZ A;  2LNB A;  4L9N A;  4MIM A;  4G7H F;  1B8I A;  1IUF A;  2INV A;  3TH0 A;  2DT5 A;  3KEQ A;  3V7A A;  2BGJ A;  4NB5 A;  3U1D A;  3P9C A;  4XLP F;  2F1M A;  4RCY A;  2YWF A;  2E35 A;  3DV8 A;  2J7K A;  3OSG A;  2EZL A;  5A89 A;  3TO7 A;  1FRQ A;  3VOE A;  2HQA A;  3S2W A;  2CFO A;  3KET A;  3BQJ A;  3OSF A;  2J8K A;  2RQQ A;  5E3O A;  2F5V A;  1HQC A;  3DF8 A;  3VSK A;  3RPQ A;  5M3M J;  2Y75 A;  3HSE A;  3DLL F;  2PJP A;  2KMU A;  4U0V A;  2VT3 A;  5EG0 A;  3NQO A;  4AVZ A;  3F22 A;  1KD1 D;  1ZKG A;  4FIS A;  3T51 B;  2EBI A;  3LVB A;  1VQ7 B;  5E17 F;  3C2G A;  1FNN A;  5KAF C;  1XB4 A;  5IT9 Z;  1TLH B;  3HOZ J;  5L3D A;  1HOM A;  4XRS G;  2AXL A;  2R9V A;  1JTX A;  3OW7 A;  2A61 A;  2HFH A;  4N4O B;  2NNN A;  3FIS A;  3ABT A;  2DFF A;  3WGI A;  2GBY A;  4KA4 A;  2X48 A;  2I1L A;  1PKV A;  3W2A A;  1CF7 B;  3CCE I;  3CCU B;  2CW8 A;  1SMT A;  3UKG A;  2C4T A;  2EFN A;  2WSS A;  2NVX J;  1SAX A;  3BQY A;  3MFK A;  1O8M A;  2XC1 A;  2DTZ A;  4U7B A;  1FY7 A;  2ZXH A;  3F8C A;  2KRC A;  4CDG A;  2IGO A;  4BBS J;  3VPR A;  5J1R A;  4RGX A;  3G73 A;  4X05 A;  2C78 A;  5LMZ A;  1NDH A;  1QA1 A;  1UFM A;  2KZG A;  1N8R D;  1X4P A;  1RQP A;  1WI3 A;  2FMY A;  2XKO A;  1W5S A;  1EFU A;  1ZRF A;  1XGN A;  2IW5 A;  2R7O A;  1S6L A;  4M3E A;  4BDY A;  3QPL A;  1K8A D;  1WOS A;  2K9L A;  2VKH A;  2JA7 J;  2VI6 A;  2NOJ B;  4RMN A;  3HOX J;  3BG6 A;  3ZQL A;  1FZP B;  2BZT A;  2Q1Z B;  4ZDP A;  3SEJ A;  1V5F A;  3DEE A;  4IEJ A;  4G7W A;  3I54 A;  1IF1 A;  4E7S A;  4P55 A;  1I3A A;  3EUH C;  1P6R A;  1LVA A;  4LGW A;  4X0G A;  4P96 A;  2B7C A;  4WZT A;  4LBY A;  3IHU A;  3BP8 A;  3OIP A;  4PAA A;  2A6E F;  2K4B A;  3RJP A;  3GTK J;  1W0T A;  1WSV A;  3R61 A;  4EW9 A;  3BRO A;  4L5J A;  1UD8 A;  2WC2 A;  3KP6 A;  3S17 J;  4XKC A;  5TJJ A;  3BH6 B;  2ZJ2 A;  3ZGK A;  1HC8 A;  2WV0 A;  3BTJ A;  3DEU A;  1YJW B;  2X1C A;  2VJ4 A;  3GW2 A;  2OTJ I;  1AKH B;  3GVL A;  5F6F A;  4UB6 C;  4URR A;  1TUI A;  1UD6 A;  3WTV C;  1H9G A;  4G7Z F;  5F4M A;  1UMK A;  5DUK A;  2Z3Y A;  1FYL A;  3ZPN A;  3C7J A;  2XAQ A;  3ZCO A;  2P3M A;  2OBP A;  1T33 A;  4BNC A;  3BG7 A;  5IT3 A;  1B72 A;  4A3C J;  2FUG 2;  2EB7 A;  4NNJ A;  5J35 A;  2F6C A;  3QRF F;  1WZ2 A;  1SKY B;  2DER A;  1T2K A;  3ERE D;  4B4D A;  3ABL H;  3K69 A;  3CCJ B;  2K7L A;  1QA6 A;  3LST A;  4YIF A;  3IKV A;  2ZTG A;  3M8E A;  2OF7 A;  1JUP A;  2CV2 A;  1UD2 A;  2LSO A;  1D1N A;  3W2I A;  3TO6 A;  4OJO A;  1ZYR F;  2RDP A;  3BTI A;  1KCD A;  2HR3 A;  3QOD A;  5FO5 A;  1JHH A;  2W85 A;  1QFY A;  3BY2 A;  4Y4R A;  3OYC A;  3RZD J;  5DD4 A;  1V0F A;  1BN8 A;  1HKQ A;  1RET A;  2YR2 A;  3H5A A;  2VBZ A;  3IH3 A;  1K83 J;  5HOO A;  2V1N A;  2HVR A;  1KGS A;  3H5N A;  3OJW A;  2VBX A;  4G9Y A;  3Q38 A;  2BW3 B;  3KP7 A;  3OYI A;  5LEK A;  3L2R A;  5D5U B;  3HXL A;  2E5Z A;  2A6H F;  1I3Q J;  1IN6 A;  2ZFU A;  3L00 A;  2CK3 A;  2X9D A;  4AID A;  3FKJ A;  3H94 A;  2VQC A;  1MND A;  2Q0O A;  2DY1 A;  3HOS A;  1VZ0 A;  5THX A;  3V8L A;  3W2H A;  2IS4 A;  1IRX A;  4I76 A;  4KKU A;  1AOY A;  1XG2 A;  1QUE A;  3CO7 C;  4P1W A;  1TTT A;  2XTY A;  5CKT A;  3T8R A;  3IV5 A;  3K2A A;  4G7O F;  4UVA A;  3M07 A;  3O8G A;  2WAE A;  5B5E C;  3K70 C;  2XTX A;  4YG2 F;  2L4M A;  5CPR B;  2K9Q A;  4EQQ A;  3M4O J;  2RRE A;  2VPR A;  3KLO A;  4OJ5 A;  4XON A;  1XTA A;  3GLL A;  2LF8 A;  1DU0 A;  2VE9 A;  4C2M J;  4RLF A;  3A1Y A;  2XAF A;  2MAB A;  2BY2 A;  2WJV A;  1Q1H A;  3TMO A;  2K5C A;  1LJ9 A;  1MNE A;  2WA0 A;  3MCZ A;  4Z03 A;  3W2G A;  1OYI A;  2CH0 A;  3TOB A;  4R71 A;  1QZZ A;  5H2F C;  2M3A A;  3QYB A;  3GQ8 A;  4OOS A;  2NAZ A;  3ASN H;  4CZZ A;  5LHH A;  1P7I A;  3BR3 A;  4ABZ A;  1RR8 C;  2E71 A;  3LQE A;  4ZGN B;  1FIA A;  3RKW A;  1FSE A;  3GTQ J;  3P7N A;  5F0C A;  2OCC H;  2HXI A;  1FYK A;  1WOO A;  2DMP A;  5DV5 A;  1PXZ A;  1WRJ A;  2FXA A;  1I5Z A;  3FXU A;  1S0U A;  1TYU A;  2FA5 A;  2PJR B;  3CC2 I;  1WTH D;  1TTY A;  2EWN A;  2XVC A;  1TVC A;  1YX5 A;  1KON A;  2XGC A;  3FMR A;  4IO9 F;  5TIS C;  2IEK A;  4ANJ A;  3HOY J;  4QVA A;  3PNY A;  2K4J A;  1YS7 A;  4HV5 A;  1DDN A;  1EV7 A;  3JRB A;  5FKM A;  2HQR A;  2E1O A;  1T98 A;  2EFO A;  4Y33 A;  2DA7 A;  3TDZ C;  2P7C B;  3S1M J;  4M4S A;  3WXM A;  2BY0 A;  1TWG J;  1MDM B;  4UHT A;  4GQN A;  3I55 I;  4IX7 A;  2QX3 A;  4EM0 B;  1IHM A;  2GRE A;  3WGG A;  3M7G A;  1YIJ I;  1ZH5 A;  3OS0 A;  1EWY A;  4AD9 A;  3PEN A;  1VBL A;  1JKR C;  2VLA A;  2MGQ A;  5J3O A;  4IOA F;  3E5U A;  2ZZG A;  1OB0 A;  4BJT A;  1UB9 A;  2XGD A;  2X1E A;  1E0E A;  3Q3A A;  4P12 A;  5M5W J;  1HW2 A;  3NAW A;  3HKZ A;  3DPT A;  3I4N J;  3R6S A;  1IRG A;  2ZIT A;  5HNF A;  1YW8 A;  3KYD B;  4HDU A;  4B3G A;  3T1B A;  3JU4 A;  2QBY A;  3DDY A;  2NSP A;  1XCB A;  4RCZ A;  3LYC A;  3QFR A;  2DA3 A;  5C4X J;  1R5O A;  2WJY A;  3HSR A;  3ZBT A;  2DMQ A;  1WPK A;  2XRL A;  2VUM J;  3I64 A;  1XMA A;  1CLW A;  4RGU A;  3SEQ A;  2R5Z A;  1JJ2 B;  4CCK A;  2OAZ A;  4HST A;  1Q9S A;  1LLW A;  1FIP A;  1DBO A;  1FTT A;  3P27 A;  1YYV A;  3PNV A;  4QSH A;  3LSH A;  4HYE A;  4AIJ A;  3I3L A;  4AWX B;  5FLM J;  2OBT A;  1KCC A;  4M3G A;  1S3J A;  1G4D A;  5AMV A;  2Q6L A;  3J80 K;  1FBQ A;  4BE1 A;  2X3U A;  1P4M A;  4IPA A;  1Z9C A;  3MEX A;  3CMA B;  1A36 A;  3CO6 C;  2X6Y A;  2E1M B;  3CUQ A;  2EZH A;  2K3F A;  5GTH C;  3K70 D;  2BM7 A;  4KYW A;  3FXQ A;  3OOP A;  1U9N A;  3WU1 B;  4WXH A;  3G1O A;  1W2B B;  3VR6 A;  1BI1 A;  3CCL I;  2IGK A;  4BQQ A;  4CYC B;  2WV1 A;  1S7A A;  1FBS A;  2DU9 A;  3GX4 X;  3MZH A;  3SJP A;  1XCV A;  5F27 A;  3EUK L;  4BQO A;  1XD7 A;  4QTR A;  4M3F A;  1VQO I;  3LWF A;  4CXF A;  5EYR A;  3CDH A;  4EM1 A;  1FOK A;  2E19 A;  2VBK A;  3PUF A;  1WPC A;  3VOD A;  2FNA A;  4F91 B;  2VOD A;  4FXU A;  2H27 A;  5HXB A;  2X4H A;  5BPD A;  1BOA A;  4E4H A;  3CZ6 A;  3BY1 A;  3QFC A;  2FBI A;  3RY8 A;  1T6Y A;  1UHS A;  4OAZ A;  4PFO A;  5E20 A;  1T08 B;  1OMI A;  3A3B A;  5IT9 K;  2XIG A;  3BH4 A;  1Y8R B;  4CH7 A;  2M7A A;  3MCA A;  3DU5 A;  2YU3 A;  3IKT A;  2V7T A;  5LGU A;  1BX0 A;  1D5Y A;  4TT3 A;  2BM4 A;  4N3N A;  3N90 A;  2H6C A;  5HS9 A;  2FEZ A;  2J5P A;  1BJA A;  4EJU A;  5ED4 A;  3BG9 A;  2ZJQ F;  4P1V A;  3BCD A;  2ME0 A;  4CCN A;  3KE2 A;  2R93 J;  3M1C A;  4MFD A;  4TKO B;  5J1U A;  2IS2 A;  2E7X A;  4PCQ A;  2QQ9 A;  2LYC A;  3DKW A;  4C30 A;  4BPR A;  1XSD A;  1XB2 A;  4FT8 A;  1TSP A;  4N4N B;  4P6Y A;  1M90 D;  1E1R A;  2GXA A;  2XAS A;  2QDX A;  3HRT A;  4CYC A;  1D8K A;  3CPX A;  4IOC F;  1H0M A;  4EJT A;  2BVN A;  3AK5 A;  2K9N A;  1W0J A;  2OK7 A;  1WVR A;  3K4C A;  2MSY A;  4PSW A;  3RKY A;  2G0Y A;  3DTE A;  4RDU A;  4DZJ A;  2BXY A;  2EFP A;  1YX3 A;  2R7Q A;  3NWS A;  5LGT A;  1ACI A;  1HKT A;  2CRV A;  3FBI B;  2O1D A;  4I01 A;  2DPU A;  4RGR A;  4BEH B;  4RAG A;  3REO A;  1XDS A;  1OFE A;  1P9Q C;  3J81 K;  5A88 A;  1S72 I;  3HRS A;  4JMQ A;  3W2W A;  5JR3 A;  2WAF A;  2EA4 A;  3ONQ A;  1FTZ A;  1WP6 A;  2DET A;  2HGC A;  3IWZ A;  2V4D A;  5BSY A;  3I56 I;  4LMY A;  1O8K A;  3OOC A;  5EEG A;  3HIF A;  5BNG A;  2GK6 A;  1ZAO A;  1QVF B;  1P92 A;  2GOM A;  2VC0 A;  1QA3 A;  4Y17 A;  4JP0 A;  4ZZL A;  4FCY A;  4ENJ A;  1LQ1 A;  2GXB A;  2XGJ A;  2INU A;  4A12 A;  1IV8 A;  3CF5 F;  3KX2 A;  3CQZ J;  3BC9 A;  1Z3Y A;  3S3N A;  5CQE A;  5DEQ A;  4IKF A;  5HS7 A;  4V2G A;  3A03 A;  1OFM A;  2JPB A;  1RMG A;  2NPF A;  4F7D A;  1O8H A;  3LOC A;  1H88 C;  4OPO A;  3KZY A;  3K6G A;  4KMU X;  2M0C A;  4NC8 A;  2YS9 A;  4E0F A;  3B6A A;  5F1J A;  4NQW A;  2DYS H;  2ECC A;  1G8X A;  3CCV B;  3RIR A;  2H8R A;  4YFX F;  1I8D A;  4L0Z B;  2DPD A;  1PE9 A;  1MMG A;  4NBS A;  1EJ9 A;  2TRT A;  4XBF A;  2AQF A;  1GT0 C;  3JRC A;  2PLY A;  1W7P B;  1L0O C;  2OZ6 A;  3K9T A;  1H80 A;  1OCO H;  5ILS A;  1WOR A;  4WQM A;  1VQO B;  3ISX A;  1T8I A;  2X6X A;  3K10 A;  4M0L A;  1TYW A;  2XF6 A;  3HKZ N;  4I02 A;  4DYC A;  1H42 A;  4RPD A;  2X1D A;  2B9S A;  5FKL A;  1QFZ A;  1LLZ A;  4DYQ A;  4EV0 A;  4B3A A;  2XKP A;  3CJQ B;  2W48 A;  5J4Y A;  3BZK A;  2Y0S N;  1TWC J;  5FLX K;  2D1H A;  4YFK F;  4V02 C;  3TO9 A;  2UVE A;  2V1D A;  2LRE A;  1NHC A;  1KQ9 A;  1BLI A;  2F4I A;  4PGH A;  5HZA A;  4YC5 A;  4L5E A;  4CZC A;  4BAC A;  3LSR A;  3VO2 A;  4ETS A;  1SKQ A;  1N08 A;  4MXN A;  1MBJ A;  3TDU C;  1Z91 A;  2OA4 A;  4M9Z A;  1VQL I;  3KYL A;  2QWW A;  2EJR A;  3HUG A;  1IXC A;  3KIO A;  5FKO A;  2IS6 A;  3DU1 X;  2R0Q C;  4KH3 A;  2PJR A;  1N25 A;  1RC9 A;  2EIL H;  2O7O A;  2JVH A;  2JWT A;  4XLN F;  5GAE J;  1BA5 A;  4KT5 C;  2XAH A;  2L3D A;  4GYG A;  2AS5 F;  4YAO A;  4XLA A;  5C1E A;  3BJ6 A;  3GQ7 A;  2V4J C;  1Q81 D;  4KN4 X;  3CCM B;  2EA2 A;  3E7L A;  4L9T A;  4B4C A;  4CO8 A;  3LAJ A;  2ESN A;  4TN1 A;  1J7K A;  2HU9 A;  2K9S A;  2ELK A;  4CCJ A;  5E3M A;  3RTR A;  2F5C A;  4FN5 A;  3J7A O;  3OZW A;  4RA2 A;  1MSF C;  3ZMV A;  1VQ7 I;  4P9U A;  3M1E A;  2JUC A;  1ENH A;  2O3F A;  1ZK8 A;  4KNY A;  1ON1 A;  1KK2 A;  2BPO A;  3WTU C;  1R5G A;  1WJA A;  3SXY A;  2ETH A;  4CQJ A;  5FKN A;  4GYI A;  2R7S A;  2HTS A;  2UV1 A;  2A69 F;  2IRF G;  2BY1 A;  2QTZ A;  3WY9 A;  1ZHF A;  1PUF B;  2IPQ X;  2JA6 J;  3O8H A;  2CQN A;  4UAJ A;  4G7X A;  1YIT B;  1D0X A;  4XLC A;  5J40 A;  4IVN A;  2D1V A;  1VQ5 B;  1QVT A;  3VB2 A;  1MMD A;  3SKB A;  2EPF A;  3BDD A;  3ISP A;  2XV4 S;  1P7J A;  5EG0 B;  3IL2 A;  2O04 A;  1WSU A;  2BVM A;  5J1Y A;  5FD5 A;  3OYE A;  1WU8 A;  2GQF A;  2QA4 B;  3GFJ A;  2B7E A;  3T9G A;  2RNJ A;  5F04 A;  1VQM I;  1KU2 A;  1PJ6 A;  4B3F X;  3GME A;  2CYY A;  2F48 A;  1VQ4 B;  5CVJ A;  2V79 A;  4XK4 A;  4UUT A;  1GLN A;  1VHO A;  1FOX A;  3G3Z A;  4PDK A;  4A2U A;  1EFT A;  1XX5 A;  1IJW C;  3SEZ A;  1JJ8 C;  2HYJ A;  4FWT A;  3I1F A;  5K5Q A;  1RPW A;  4BXX J;  5E1Z B;  3W5V A;  4Z4W A;  2VBT A;  3OYK A;  4Z4T A;  1N07 A;  1G3Y A;  1PJ7 A;  3SZG A;  3T5X A;  1O3Q A;  2DA4 A;  1V0E A;  5DS0 A;  4S05 A;  4LLN A;  1SD7 A;  3ZBU A;  3S3O A;  1ZR2 A;  2LK2 A;  1GO2 A;  1OYY A;  3D26 A;  5BPI A;  3V42 A;  2F1L A;  1HCR A;  3LAP A;  1HW5 A;  3I0T A;  1G7S A;  1IV6 A;  1OGI A;  2MA3 A;  1RKT A;  3DU6 A;  3IH4 A;  3I9V 2;  1R5N A;  1D1A A;  4LC0 A;  1BR4 A;  2CJJ A;  2KZV A;  2VKV A;  1B72 B;  2Y0M A;  5FB2 A;  3GFI A;  3ASS A;  1DG1 G;  4DIQ A;  4L0Y B;  1W7P D;  4TMZ A;  2DOF A;  1H8H A;  2LY1 A;  3FIW A;  4PJM A;  4W1U A;  1E43 A;  1L3L A;  4M72 A;  5LGN A;  1W35 A;  1S72 B;  3HL2 A;  1ZAR A;  4ZDO A;  4IHT A;  3CMY A;  1ZLJ A;  5E1W A;  4F55 A;  1SFX A;  3LA2 A;  1EF4 A;  1Y0Y A;  2M2E A;  3L09 A;  2JDI A;  3DBR B;  5GPA A;  4Z4U A;  2VIX A;  1TC3 C;  4U9U A;  2V7V A;  5FLX Z;  4DBQ A;  3ZXS A;  2NVU B;  4I6Z A;  1RU4 A;  2OQR A;  5IP6 A;  2O9L A;  2BVL A;  4M9S A;  2B5O A;  4L18 B;  3BLY A;  2HPM A;  1VJS A;  4CYD A;  2VYQ A;  1WXR A;  3CRZ A;  3FXJ A;  4W97 A;  1G7R A;  2HOE A;  2R6H A;  2W57 A;  3GUD A;  1K73 D;  1U5T A;  3RDI A;  1I1G A;  4ASN A;  3UR3 C;  5LD2 C;  2CGP A;  5TGT A;  4A6E A;  3S16 J;  5DSZ A;  1QVU A;  3R0A A;  4XN0 A;  1X1P A;  1BIA A;  4J0Q A;  3L2W A;  1DQU A;  2IJL A;  2XF7 A;  4BGD A;  2RAE A;  1VQN I;  2RC5 A;  1IB0 A;  4RDK A;  5A8A A;  3AVT A;  3LNN A;  1VTN C;  2K85 A;  4U0Y A;  3VST A;  3TP3 A;  5LRR A;  1VQP I;  3Q0W A;  1KU3 A;  2D3L A;  1DGW Y;  1LEA A;  3FDY A;  3IC7 A;  3KEW A;  2VFQ A;  4A5N A;  2Q6K A;  4KIT B;  3CC7 I;  1X0C A;  2KT0 A;  2Z9O A;  2M4G A;  2BN4 A;  2GOX B;  2IGN A;  3CUQ C;  3AGP A;  1BC7 C;  2G7H A;  1YIT I;  1QGP A; 
#chains in the Genus database with same CATH homology
 2F6C A;  1SKY B;  3KEY A;  2PEC A;  4YZX A;  1X1C A;  3H9J A;  3OYD A;  1G59 A;  1H8E A;  4B43 A;  2NTQ A;  3OYN A;  2LZJ A;  2ZTG A;  2VBM A;  2LBF A;  4XKW A;  2LRD A;  3SDB A;  1PYV A;  3OR2 C;  4XOT A;  3SYT A;  2CV2 A;  1UD2 A;  1T95 A;  3VDX A;  4PJL A;  4OJO A;  1KCD A;  3QOD A;  2V6E A;  3T53 B;  3PNT A;  1IDJ A;  2JVG A;  3H35 A;  4Y4R A;  4F3Q A;  3OYC A;  2V7F A;  2JA2 A;  1V0F A;  1BN8 A;  3AL0 C;  4KJZ A;  2XND A;  4YZ0 A;  2HNH A;  3H5A A;  5HOO A;  2LBF B;  2V1N A;  2W4S A;  3OY9 A;  2HVR A;  5IK2 A;  3H5N A;  4C2U A;  2JUG A;  3S32 A;  4MR0 A;  2BW3 B;  3OYI A;  2GJR A;  3L2R A;  1KMH A;  3CMM A;  3HXL A;  2E5Z A;  4U4B A;  2VJI A;  2O5R A;  2CK3 A;  2ZFU A;  3C2H A;  4TSF A;  3IUO A;  2IQ7 A;  3OYG A;  4PSX A;  3FKJ A;  1OGM X;  2CV0 A;  3H94 A;  2HVQ A;  2MYS A;  2VQC A;  1MND A;  4BEH A;  3HOS A;  1VZ0 A;  4CCM A;  2BOL A;  2WB1 A;  4DNR B;  2IS4 A;  1IRX A;  1FX0 A;  4KKU A;  3VYT B;  1XG2 A;  4P1W A;  4OAY A;  5C1C A;  5CKT A;  1O8L A;  3IP4 B;  2XDV A;  1VLY A;  2NT9 A;  2O0W A;  2MD0 A;  2WAE A;  3K70 C;  4Y3O A;  2X53 S;  3GVK A;  3GVJ A;  5CPR B;  4KIS A;  1O8D A;  2RRE A;  4OJ5 A;  4PJN A;  4XON A;  1E79 A;  2A5W A;  1W36 C;  1W36 D;  2O17 A;  4MLO A;  3K4J A;  1OLT A;  3EPZ A;  3K4B A;  4RLF A;  1HVX A;  3WQZ A;  3A1Y A;  3GQ9 A;  2MAB A;  1D1B A;  2P0W A;  4B47 A;  2WJV A;  4PK4 A;  3D5R C;  2IGM A;  1MNE A;  2K5C A;  1LFP A;  2WA0 A;  3HPH A;  3TMO A;  4Z03 A;  3UW0 A;  2CH0 A;  2M3A A;  4DBR A;  3QYB A;  1E3X A;  3GQ8 A;  2Z1D A;  4J00 A;  3B4N A;  4YZQ A;  4ZC3 A;  4E6K G;  2X85 A;  4PFP A;  1V5G A;  2VB6 A;  4LG3 A;  4BUP A;  3A2K A;  2L7K A;  3HPG A;  2GJP A;  2XSJ C;  4RLQ A;  3K4L A;  4C9Y A;  4ZYA A;  2PMZ A;  1PXZ A;  4BL0 B;  1DBG A;  1T0F C;  1UAA A;  2HLD A;  2LG4 A;  3NE5 B;  2PJR B;  3CP8 A;  3QYE A;  3IAS 2;  1WJF A;  1WTH D;  1YX5 A;  1KON A;  2W6J A;  4ANJ A;  1MW7 A;  2K9M A;  3PNY A;  2O0V A;  3H0D A;  1HG8 A;  1S9H A;  2NTP A;  3BCB A;  3LSI A;  1K28 D;  1CZF A;  2VQL A;  1SAU A;  4Y33 A;  4E7I A;  4FAS D;  3RSN A;  4RM2 A;  1X1B A;  2IXS A;  3LMM A;  2XF5 A;  3OEE A;  1X1A A;  2W82 A;  3EQN A;  2VJ5 A;  4GQN A;  1W9X A;  5DN6 A;  4IX7 A;  2QX3 A;  4C2L A;  1J09 A;  1WJC A;  3OS0 A;  2CW7 A;  2JIZ A;  1WMR A;  4ITV A;  1VBL A;  3HUG B;  2ELJ A;  2VLA A;  1WJ5 A;  5CQG A;  1MAB A;  2WAD A;  1BOB A;  3SUC A;  1SFK A;  2VKD A;  3H9G A;  2ZZG A;  5CDF A;  1OB0 A;  4BJT A;  4BU2 A;  2X1E A;  1E0E A;  3VSU A;  3OEH A;  1PLU A;  3BCF A;  3WWG A;  2CUZ A;  3HKZ A;  3DPT A;  4R79 A;  5HNF A;  1WFX A;  3KRG A;  2QXZ A;  4B3G A;  1EE6 A;  3F9K A;  5HLT A;  3JU4 A;  2DCE A;  3OYA A;  3DDY A;  2NSP A;  4E7K A;  3A3G A;  3VYR B;  1N77 A;  4E7H A;  2WJY A;  1X19 A;  1QJV A;  4QPQ A;  4BE2 A;  3MKY B;  4RM3 A;  1AIR A;  1VF7 A;  3FKS A;  4U87 A;  3SEQ A;  3OYH A;  4CCK A;  4HST A;  4CCL A;  3W2V A;  2JJ2 A;  3S3M A;  4BXF A;  5FRN A;  1DBO A;  2WPD A;  3ZIA A;  3PNV A;  5HNH A;  2HVS A;  3LSH A;  3I3L A;  4BQN A;  3FY3 A;  3OMY A;  1KCC A;  2PYH A;  5AMV A;  2ZZQ A;  4BE1 A;  1AA7 A;  1K6Y A;  1ZEL A;  4DJA A;  3OWT A;  1OHH A;  1K5C A;  1KTW A;  1N75 A;  4YXW A;  3CP2 A;  2X6Y A;  3DKX A;  2E1M B;  4D1Q A;  3A4C A;  3MD2 A;  2KDO A;  3K70 D;  2UUZ A;  4IZZ A;  3E0J B;  4B48 A;  1OOC A;  4PMH A;  4XKB A;  3OFN A;  3DLA A;  5JHF A;  4C2T A;  3VR6 A;  4ZJZ A;  4AYB A;  2IGK A;  4XM3 A;  4BQQ A;  2CS3 A;  1MMN A;  4NK6 A;  2K3P A;  3G2B A;  4BQO A;  3EUK L;  2GJK A;  2M7B A;  2Z6B D;  4HSR A;  4ZDL A;  3ZSC A;  2VBK A;  3D5L A;  5FL7 A;  3VMV A;  1WPC A;  2KP6 A;  4F91 B;  1JRG A;  3OIQ A;  4JOM A;  1W0K A;  4FXU A;  2NST A;  3L2V A;  1WJE A;  4W8Q A;  3NWT A;  3AKZ A;  4XL9 A;  4E4H A;  2CUJ A;  3CZ6 A;  2KHM A;  2VQH A;  4ASU A;  3CJR B;  2QE7 A;  1O8F A;  3VMW A;  4OAZ A;  4PFO A;  3A3B A;  1O8E A;  4OZZ A;  4HWV A;  4YEL A;  3BH4 A;  2D3N A;  4CH7 A;  2M7A A;  2Y0S A;  2M0M A;  2WY7 Q;  3DU5 A;  2ODL A;  4TT3 A;  5HKK A;  3H9Q A;  3OAA A;  2W7N A;  3L2U A;  3HOT A;  2IS1 A;  4DK0 A;  3TL4 X;  1QHH D;  2LY2 A;  1WJB A;  3LSG A;  1IA5 A;  3BCD A;  4CCN A;  4TKO B;  3M1C A;  4HPQ A;  4XLH A;  3S93 A;  3OYB A;  4BS9 A;  2IS2 A;  4G6T B;  3MKZ A;  2L9N A;  2HZD A;  2R7W A;  2UVF A;  2LYC A;  2VL8 A;  1JI8 A;  4C30 A;  1YE9 A;  2DIE A;  4P22 A;  4AU7 A;  1X4O A;  4DNT B;  3K4N A;  4N4N B;  3VWB A;  1IDK A;  3OL4 A;  1E1R A;  5HVQ C;  3OE7 A;  3T56 B;  1UEL B;  2DT6 A;  2E1B A;  1W0J A;  3K4C A;  5KCM A;  4IQJ A;  4PSW A;  2DOA A;  3DTE A;  3HG9 A;  3GQB A;  2DJI A;  3FHN A;  4XR6 A;  2R7Q A;  3N05 A;  1YX3 A;  3BC8 A;  3NWS A;  4L8J A;  2O1D A;  2X3H A;  3FBI B;  4BJ5 C;  1FMW A;  3CES A;  4BEH B;  4F52 A;  2V26 A;  2WAQ A;  2V7Q A;  2A6T A;  4BDZ A;  3H5R A;  2WZP P;  2NZM A;  1P9Q C;  2VPL A;  4JMQ A;  1D0Z A;  1RWR A;  3W2W A;  4HG2 A;  2WAF A;  3DPU A;  3ONQ A;  5LFA A;  2X6W A;  1WP6 A;  1GQ8 A;  1E3Z A;  4U49 A;  2Z2S B;  2V4D A;  4G6I A;  1O8K A;  3PSF A;  4CUG A;  3OOC A;  3ZPP A;  2GK6 A;  3QOE A;  2GOM A;  4FET A;  4UZU A;  2BSP A;  2QY1 A;  3OYL A;  2VBE A;  2XGJ A;  2W1O A;  2INU A;  4NK8 A;  3KX2 A;  4IQ4 A;  3GBG A;  3VYU B;  3BC9 A;  4DK1 A;  1Z3Y A;  2EWE A;  2NT6 A;  3S3N A;  4HRI A;  4OJP A;  5CQE A;  4IKF A;  4XOR A;  1RMG A;  1V5E A;  4DGW B;  4XKV A;  1OFM A;  1EA3 A;  3HC7 A;  1NG7 A;  1O8H A;  4HIZ A;  4KT6 A;  3K6G A;  2M4K A;  4NC8 A;  3HAG A;  4E0F A;  3GQA A;  1BHE A;  3U21 A;  4B3X A;  2W6I A;  2LOO A;  1G8X A;  4JQF A;  4KKS A;  1I18 A;  4OZY A;  4XD7 A;  1I8D A;  1LKX A;  3OPO A;  3JUR A;  1PE9 A;  1MMG A;  2I8D A;  3OOU A;  1QU3 A;  2AQF A;  4Z1M A;  1BR1 A;  1Z21 A;  1X1D A;  3DTK A;  4E7J A;  3PSI A;  4W8S A;  1WJD A;  4PJJ A;  1H80 A;  1O8I A;  4NQW B;  1NRK A;  2LH9 A;  3DWL E;  2VQG A;  2X6X A;  3K10 A;  4OWR B;  4PUS A;  4DOZ A;  1DGR M;  2XF6 A;  3OYF A;  3DPL C;  2F43 A;  2X1D A;  2RNG A;  1U0J A;  1NG6 A;  3CJQ B;  2NTB A;  1UD3 A;  1NHC A;  2UVE A;  2MC4 A;  3RCO A;  2LRE A;  1BLI A;  4II2 A;  4E7Z A;  1FMV A;  4W8T A;  2F4I A;  2W00 A;  1EFR A;  4CZC A;  4BAC A;  4MXN A;  4E7L A;  3K4K A;  1Z3X A;  3KYL A;  1D0Y A;  4KKT A;  2OV7 A;  3OL3 A;  4W8R A;  2IS6 A;  4CSW A;  4D9J A;  2XC7 A;  2HDW A;  4HEA 2;  2PJR A;  2XOK A;  2DXI A;  4GRI A;  1BR2 A;  4LIT A;  2JVH A;  3PL8 A;  3OS1 A;  3VSL A;  4OJ6 A;  2ZXI A;  2L2O A;  4LIU A;  2X8K A;  3DTI A;  4CCO A;  2KPM A;  2L5Q A;  3PFY A;  2GK7 A;  1OR7 C;  4I84 A;  3BCA A;  4XLA A;  1N78 A;  1Z7L A;  2KRH A;  2QKL B;  2V4J C;  3E1S A;  3GQ7 A;  5C1E A;  2HPI A;  2DT7 B;  2E60 A;  5KNL A;  1HA8 A;  4Z06 A;  2HU9 A;  3B90 A;  4CCJ A;  3LSK A;  2PYG A;  3RTR A;  1D1C A;  4XQF A;  4BJ6 C;  3EUA A;  1R6R A;  3ZR8 X;  2R7V A;  2ZSH B;  1DP3 A;  2MFZ A;  2JJ1 A;  3DQV C;  3OR1 C;  3OYM A;  3LMW A;  2VXZ A;  4YZA A;  3S8P A;  1JTA A;  2XAU A;  3TBI A;  2R4G A;  1WJA A;  3M8J A;  3OS2 A;  1ERD A;  1PJR A;  1E1Q A;  2R7U A;  1NBM A;  2R7S A;  2UV1 A;  2ZSI B;  5FRM A;  2XZP A;  2INV A;  4XMY A;  2QKM B;  4G7X A;  1D0X A;  4XLC A;  2OUM A;  1MMD A;  1BPL A;  2F1M A;  3L2Q A;  4J01 A;  3LFU A;  3QYF A;  2L9S A;  4HNU A;  2O04 A;  2VAS A;  2CV1 A;  2BVM A;  1MMA A;  2HQA A;  4CA0 A;  2CFO A;  3OYE A;  2UWM A;  1O8G A;  4F92 B;  3T9G A;  2E5N A;  3A35 A;  4B3F X;  2CMP A;  2RQQ A;  4BE0 A;  2F5V A;  1BMF A;  3B8Y A;  2R7R A;  3VSK A;  1GLN A;  1KZL A;  2E1M C;  2KVO A;  1TZL A;  3K4M A;  2KMU A;  4H4K C;  1Y56 A;  3SEZ A;  4AVZ A;  4ZTF A;  1UG0 A;  1UD5 A;  2LC2 A;  1Y6I A;  2KQR A;  4YEJ A;  4EAT A;  2ZZE A;  3T51 B;  3C2G A;  1O88 A;  4F93 B;  3AFH A;  1QHG A;  3OYK A;  2R9V A;  3OW7 A;  4N4O B;  2JSP A;  3LL7 A;  3SZG A;  2KLO A;  3PJR A;  1V0E A;  1PKV A;  3W2A A;  3S3O A;  2CW8 A;  2XZO A;  2WSS A;  1T5E A;  4LIV A;  4XN3 A;  3V42 A;  3ZRG A;  2Z16 A;  1OFL A;  3ZQQ A;  1O8J A;  1O8M A;  4U7B A;  2ZXH A;  1TT0 A;  3DU6 A;  2KRC A;  3D5S C;  2IGO A;  1D1A A;  3I9V 2;  1BR4 A;  4NUB A;  3VYS B;  2KZV A;  4XLE A;  2M5S A;  3G05 A;  3EQO A;  4OJL A;  4Z05 A;  3W3C A;  4II3 A;  4DIQ A;  4XNF A;  1H8H A;  1X4P A;  2LY1 A;  2OC6 A;  4PJM A;  2WBM A;  1E43 A;  4ZTJ A;  2R7O A;  4BDY A;  2WY8 Q;  3OYJ A;  3HL2 A;  4ZDO A;  2K9L A;  4YRV A;  2VKH A;  3FPP A;  5FRO A;  4F55 A;  2JDI A;  2NOJ B;  2X51 A;  4RMN A;  2Z8G A;  2ZZF A;  4NC7 A;  3BG6 A;  5KHD A;  2Q1Z B;  4ZDP A;  2VIX A;  2VJJ A;  1V5F A;  3DEE A;  4B44 A;  4G7W A;  3GRH A;  3RPU D;  1HZE A;  4E7S A;  2R7T A;  4DBQ A;  3ZXS A;  1RU4 A;  3EUH C;  2XZL A;  4X0G A;  2BVL A;  2V9K A;  2KL4 A;  3CF2 A;  3BLY A;  3IAM 2;  3OIP A;  2HPM A;  1VJS A;  4HNT A;  1COW A;  4P5O A;  3LSM A;  3MMY B;  2BW3 A;  1OGO X;  1QCX A;  4EW9 A;  1UD8 A;  3FBN B;  4XKC A;  2Q2E B;  3UR3 C;  3PUB A;  5LD2 C;  4XOP A;  5TGT A;  3ZGK A;  2ZTN A;  2R7X A;  3VSV A;  4XN0 A;  2X1C A;  1LVK A;  2VJ4 A;  3L2W A;  1DQU A;  2XF7 A;  3UNG C;  4BGD A;  3GVL A;  1IB4 A;  1LDK B;  3AL0 B;  2V31 A;  2VXD A;  3LNN A;  4URR A;  3VST A;  4XLF A;  1UD6 A;  2D3L A;  3RQ4 A;  1DGW Y;  3DKY A;  3J7A Y;  3FDY A;  3ZPN A;  3KEW A;  3ZCO A;  4KIT B;  3MKW B;  1X0C A;  1UD4 A;  4QPO A;  2M4G A;  3BG7 A;  2GOX B;  2IGN A;  2AQE A;  2FUG 2;  4NNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...