4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
molecule keywords SITE-DETERMINING PROTEIN
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
3BH6B 1HF2A 2YUHA 3BH7B 4V02C 2BX6A 1KQ5A 2B0RA 1K8FA 1K4ZA
chains in the Genus database with same CATH superfamily
3UW0A 3BH7B 3PSSA 2NT6A 4XMYA 1IA5A 2VBKA 4XLHA 3SY2A 1HG8A 2NT9A 2B0RA 3ZPPA 4XKWA 2VFQA 3P4GA 2NZMA 1O8IA 2F3LA 4OZYA 2INUA 1EZGA 3NB2A 2XTWA 1WMRA 1QA3A 2BM4A 4XN3A 1OOCA 2UVEA 4XM3A 4YELA 1RMGA 2XT2A 3VSVA 2QYUA 2NTPA 2QXZA 2X6WA 1H80A 4OJ5A 4W8RA 1WXRA 4OJ6A 1PXZA 2INVA 4V02C 4XOPA 1O8GA 3B4NA 1O8JA 3JX8A 4YZQA 3JURA 3PETA 4NK8A 1QJVA 2NSPA 3B8YA 1O88A 1LLWA 1DBGA 2O1DA 3BH6B 4OZZA 3N6ZA 2BM7A 2O04A 2IOUG 3DU1X 3LJYA 5AMVA 1EE6A 1OFDA 1JRGA 1O8KA 3LYCA 4YEJA 1CLWA 4YZAA 3SZEA 3N90A 4YEIA 1PE9A 1L1IA 2XTYA 1QCXA 1IDKA 5C1CA 1NHCA 3GQ9A 4W8QA 1QA2A 2VBEA 2UVFA 2G0YA 1DBOA 1LM1A 2VJIA 2XC1A 4XLCA 4EW9A 4XOTA 4OPWA 1KTWA 4XQFA 2O0VA 1K5CA 1BHEA 1O8LA 4MXNA 2PYGA 4XORA 1IDJA 1OFLA 4I84A 3ZSCA 4Z03A 1O8MA 1OFEA 3WWGA 4AVZA 1QQ1A 1VBLA 3PSZA 2VJJA 2XT4A 5JLVC 1QRCA 1O8FA 1PLUA 1TYWA 2VBMA 2QZAA 3NAWA 4YZ0A 5JMCB 2W7ZA 2NTQA 1O8DA 3H09A 4XLEA 2VFPA 3EQOA 4MR0A 1TYVA 3TH0A 1CZFA 1O8EA 2J8IA 1EA0A 3LMWA 4PMHA 4U49A 4Z06A 2X3HA 3VSUA 4XN0A 1LLZA 2BSPA 2O0WA 3B90A 4OJLA 1O8HA 1OFMA 4YFOA 1X0CA 4NK6A 3GQ8A 1OGOX 4KH3A 1OGMX 4W8SA 4Z05A 5C1EA 3T9GA 2BX6A 4OM9A 1RU4A 4C2LA 3SUCA 1K4ZA 4YCQA 4XLAA 3FY3A 4U4BA 3GQAA 1XG2A 4OJOA 4URRA 1BN8A 2BM6A 2PYHA 2NTBA 3ML3A 2J8KA 4XONA 2IQ7A 2O17A 2VFMA 3EQNA 3GQ7A 1IB4A 4JRAC 3RIQA 2Z8GA 4XLFA 3VMVA 2YUHA 4YC5A 2NSTA 1DABA 3AK5A 1TSPA 2X6XA 2ODLA 2VFOA 3VMWA 4W8TA 1QA1A 1GQ8A 2BM5A 4HWVA 1KQ5A 2X6YA 4XL9A 4XNFA 4YDTA 4OJPA 2VFNA 4XKVA 5DNSA 2V5IA 1K8FA 1QRBA 1TYXA 1JTAA 2EWEA 2PECA 3SQVA 2X85A 3SYJA 3VSTA 2QX3A 2QY1A 1KCDA 1HF2A 1AIRA 1TYUA 1RWRA 2O6WA 3GRHA 4YZXA 3KRGA 1KCCA 2XTXA 4XR6A
chains in the Genus database with same CATH topology
2YUHA 2VFPA 3BH7B 3N90A 1DABA 3AK5A 1TSPA 1TYVA 2B0RA 3TH0A 2VFOA 1QA2A 2J8IA 2VFQA 2G0YA 2XC1A 3P4GA 1QA1A 2F3LA 2BM5A 1QA3A 1KQ5A 2BM4A 4OPWA 4OJLA 1WXRA 4OJPA 4OJ5A 2VFNA 4KH3A 4OJ6A 4V02C 2BX6A 3JX8A 2V5IA 1QQ1A 4OM9A 1K8FA 1QRBA 1TYXA 3PETA 1K4ZA 3SYJA 3BH6B 1HF2A 1TYUA 4OJOA 2BM6A 5JLVC 1QRCA 3ML3A 1TYWA 3N6ZA 2BM7A 2IOUG 3LJYA 5JMCB 2VFMA 3LYCA 2W7ZA 4JRAC 3RIQA 3H09A 1CLWA 3SZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  1HF2 A;  2YUH A;  3BH7 B;  4V02 C;  2BX6 A;  1KQ5 A;  2B0R A;  1K8F A;  1K4Z A; 
#chains in the Genus database with same CATH topology
 3UW0 A;  3BH7 B;  3PSS A;  2NT6 A;  4XMY A;  1IA5 A;  2VBK A;  4XLH A;  3SY2 A;  1HG8 A;  2NT9 A;  2B0R A;  3ZPP A;  4XKW A;  2VFQ A;  3P4G A;  2NZM A;  1O8I A;  2F3L A;  4OZY A;  2INU A;  1EZG A;  3NB2 A;  2XTW A;  1WMR A;  1QA3 A;  2BM4 A;  4XN3 A;  1OOC A;  2UVE A;  4XM3 A;  4YEL A;  1RMG A;  2XT2 A;  3VSV A;  2QYU A;  2NTP A;  2QXZ A;  2X6W A;  1H80 A;  4OJ5 A;  4W8R A;  1WXR A;  4OJ6 A;  1PXZ A;  2INV A;  4V02 C;  4XOP A;  1O8G A;  3B4N A;  1O8J A;  3JX8 A;  4YZQ A;  3JUR A;  3PET A;  4NK8 A;  1QJV A;  2NSP A;  3B8Y A;  1O88 A;  1LLW A;  1DBG A;  2O1D A;  3BH6 B;  4OZZ A;  3N6Z A;  2BM7 A;  2O04 A;  2IOU G;  3DU1 X;  3LJY A;  5AMV A;  1EE6 A;  1OFD A;  1JRG A;  1O8K A;  3LYC A;  4YEJ A;  1CLW A;  4YZA A;  3SZE A;  3N90 A;  4YEI A;  1PE9 A;  1L1I A;  2XTY A;  1QCX A;  1IDK A;  5C1C A;  1NHC A;  3GQ9 A;  4W8Q A;  1QA2 A;  2VBE A;  2UVF A;  2G0Y A;  1DBO A;  1LM1 A;  2VJI A;  2XC1 A;  4XLC A;  4EW9 A;  4XOT A;  4OPW A;  1KTW A;  4XQF A;  2O0V A;  1K5C A;  1BHE A;  1O8L A;  4MXN A;  2PYG A;  4XOR A;  1IDJ A;  1OFL A;  4I84 A;  3ZSC A;  4Z03 A;  1O8M A;  1OFE A;  3WWG A;  4AVZ A;  1QQ1 A;  1VBL A;  3PSZ A;  2VJJ A;  2XT4 A;  5JLV C;  1QRC A;  1O8F A;  1PLU A;  1TYW A;  2VBM A;  2QZA A;  3NAW A;  4YZ0 A;  5JMC B;  2W7Z A;  2NTQ A;  1O8D A;  3H09 A;  4XLE A;  2VFP A;  3EQO A;  4MR0 A;  1TYV A;  3TH0 A;  1CZF A;  1O8E A;  2J8I A;  1EA0 A;  3LMW A;  4PMH A;  4U49 A;  4Z06 A;  2X3H A;  3VSU A;  4XN0 A;  1LLZ A;  2BSP A;  2O0W A;  3B90 A;  4OJL A;  1O8H A;  1OFM A;  4YFO A;  1X0C A;  4NK6 A;  3GQ8 A;  1OGO X;  4KH3 A;  1OGM X;  4W8S A;  4Z05 A;  5C1E A;  3T9G A;  2BX6 A;  4OM9 A;  1RU4 A;  4C2L A;  3SUC A;  1K4Z A;  4YCQ A;  4XLA A;  3FY3 A;  4U4B A;  3GQA A;  1XG2 A;  4OJO A;  4URR A;  1BN8 A;  2BM6 A;  2PYH A;  2NTB A;  3ML3 A;  2J8K A;  4XON A;  2IQ7 A;  2O17 A;  2VFM A;  3EQN A;  3GQ7 A;  1IB4 A;  4JRA C;  3RIQ A;  2Z8G A;  4XLF A;  3VMV A;  2YUH A;  4YC5 A;  2NST A;  1DAB A;  3AK5 A;  1TSP A;  2X6X A;  2ODL A;  2VFO A;  3VMW A;  4W8T A;  1QA1 A;  1GQ8 A;  2BM5 A;  4HWV A;  1KQ5 A;  2X6Y A;  4XL9 A;  4XNF A;  4YDT A;  4OJP A;  2VFN A;  4XKV A;  5DNS A;  2V5I A;  1K8F A;  1QRB A;  1TYX A;  1JTA A;  2EWE A;  2PEC A;  3SQV A;  2X85 A;  3SYJ A;  3VST A;  2QX3 A;  2QY1 A;  1KCD A;  1HF2 A;  1AIR A;  1TYU A;  1RWR A;  2O6W A;  3GRH A;  4YZX A;  3KRG A;  1KCC A;  2XTX A;  4XR6 A; 
#chains in the Genus database with same CATH homology
 2YUH A;  2VFP A;  3BH7 B;  3N90 A;  1DAB A;  3AK5 A;  1TSP A;  1TYV A;  2B0R A;  3TH0 A;  2VFO A;  1QA2 A;  2J8I A;  2VFQ A;  2G0Y A;  2XC1 A;  3P4G A;  1QA1 A;  2F3L A;  2BM5 A;  1QA3 A;  1KQ5 A;  2BM4 A;  4OPW A;  4OJL A;  1WXR A;  4OJP A;  4OJ5 A;  2VFN A;  4KH3 A;  4OJ6 A;  4V02 C;  2BX6 A;  3JX8 A;  2V5I A;  1QQ1 A;  4OM9 A;  1K8F A;  1QRB A;  1TYX A;  3PET A;  1K4Z A;  3SYJ A;  3BH6 B;  1HF2 A;  1TYU A;  4OJO A;  2BM6 A;  5JLV C;  1QRC A;  3ML3 A;  1TYW A;  3N6Z A;  2BM7 A;  2IOU G;  3LJY A;  5JMC B;  2VFM A;  3LYC A;  2W7Z A;  4JRA C;  3RIQ A;  3H09 A;  1CLW A;  3SZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...