4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
1KQ5A 1K4ZA 1HF2A 1K8FA 4V02C 2YUHA 3BH7B 2B0RA 2BX6A 3BH6B
chains in the Genus database with same CATH superfamily
1KQ5A 3ZSCA 4W8RA 1TYVA 1IB4A 3JX8A 4XLHA 1EE6A 1TYWA 2BSPA 2VBMA 3EQOA 4OJLA 1XG2A 2X6YA 1TSPA 4XR6A 1WMRA 3WWGA 2B0RA 2PYHA 4OZYA 2VFNA 1H80A 4KH3A 4YZXA 1QA1A 2XT2A 2XC1A 2VJIA 3EQNA 4W8TA 1JRGA 1QJVA 3N90A 3BH7B 3UW0A 1TYUA 3T9GA 1O8MA 3ML3A 2UVFA 4XN0A 1OGOX 2XTWA 3GQ8A 5AMVA 1CZFA 2VJJA 4I84A 1OOCA 2O1DA 2VBEA 4YZAA 2W7ZA 2QX3A 3SQVA 5DNSA 2EWEA 1QCXA 4YFOA 5C1CA 4MXNA 1PXZA 4YCQA 4YC5A 2X3HA 3VSUA 1QRBA 2VFMA 1WXRA 1O8IA 2NTPA 2O0VA 1O8HA 3SZEA 2QYUA 1CLWA 4V02C 4Z05A 4OPWA 2VFQA 2VBKA 4NK6A 2J8IA 3GRHA 2IQ7A 2ODLA 2VFPA 4C2LA 1EZGA 1LM1A 3GQ9A 2V5IA 4URRA 4XLAA 3B90A 1PLUA 1NHCA 4XORA 3VSTA 1RMGA 4YEIA 4XN3A 1KCCA 2INUA 4YZQA 1O88A 2F3LA 3LYCA 3LMWA 3VMVA 5C1EA 2G0YA 1BHEA 2J8KA 1O8DA 3B4NA 2BM6A 1K4ZA 2Z8GA 3N6ZA 2IOUG 4HWVA 2NTQA 1RU4A 1QQ1A 3P4GA 4YZ0A 2BX6A 4JRAC 3GQAA 2BM5A 4XKVA 1KTWA 4OM9A 1OFMA 2O0WA 2X6XA 3PSZA 5JMCB 2X6WA 4XOTA 1O8GA 1DABA 1GQ8A 1TYXA 4W8QA 1IDJA 4OJ6A 2O04A 2XTXA 4U4BA 2NSPA 4OZZA 1PE9A 1K8FA 2O6WA 4OJPA 2QXZA 1VBLA 4XNFA 4MR0A 2VFOA 2UVEA 2BM7A 3DU1X 2XTYA 3GQ7A 4XONA 4Z03A 3BH6B 3AK5A 1BN8A 2YUHA 3FY3A 4XLEA 1HG8A 2NT9A 4XKWA 3B8YA 1QA3A 1DBOA 1KCDA 1OFDA 1OGMX 2QY1A 3VSVA 2PECA 4NK8A 2XT4A 1AIRA 1OFLA 1X0CA 5JLVC 1O8LA 2NT6A 2X85A 3VMWA 4W8SA 3NAWA 1O8EA 4EW9A 4XM3A 4XLCA 1HF2A 2NSTA 1O8FA 4XOPA 4YDTA 4AVZA 1EA0A 4XLFA 1QA2A 1QRCA 2PYGA 4OJ5A 1OFEA 3TH0A 2NZMA 1L1IA 3NB2A 3LJYA 2NTBA 4XMYA 1O8JA 3SYJA 1LLWA 3H09A 1IA5A 2BM4A 4OJOA 1IDKA 4YELA 3KRGA 4PMHA 1LLZA 1RWRA 1DBGA 3PSSA 3RIQA 2INVA 3ZPPA 1JTAA 2O17A 3SY2A 3SUCA 2QZAA 4U49A 4Z06A 1O8KA 3JURA 4XQFA 4YEJA 3PETA 4XL9A 1K5CA
chains in the Genus database with same CATH topology
2BM6A 1KQ5A 1K4ZA 1TYVA 3N6ZA 2IOUG 5JLVC 1QRBA 1QQ1A 3JX8A 2VFMA 3P4GA 2BX6A 4JRAC 1WXRA 2BM5A 1TYWA 4OJLA 4OM9A 3SZEA 1CLWA 1HF2A 4V02C 1TSPA 5JMCB 4OPWA 1DABA 1QA2A 1QRCA 2B0RA 2VFQA 2VFNA 4OJ5A 2J8IA 4KH3A 1TYXA 1QA1A 4OJ6A 2XC1A 3TH0A 4OJPA 2VFPA 1K8FA 3N90A 2V5IA 3BH7B 3LJYA 1TYUA 2VFOA 3SYJA 2BM7A 3H09A 3ML3A 2BM4A 4OJOA 3BH6B 3AK5A 3RIQA 2YUHA 2F3LA 3LYCA 2W7ZA 2G0YA 1QA3A 3PETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ5 A;  1K4Z A;  1HF2 A;  1K8F A;  4V02 C;  2YUH A;  3BH7 B;  2B0R A;  2BX6 A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 1KQ5 A;  3ZSC A;  4W8R A;  1TYV A;  1IB4 A;  3JX8 A;  4XLH A;  1EE6 A;  1TYW A;  2BSP A;  2VBM A;  3EQO A;  4OJL A;  1XG2 A;  2X6Y A;  1TSP A;  4XR6 A;  1WMR A;  3WWG A;  2B0R A;  2PYH A;  4OZY A;  2VFN A;  1H80 A;  4KH3 A;  4YZX A;  1QA1 A;  2XT2 A;  2XC1 A;  2VJI A;  3EQN A;  4W8T A;  1JRG A;  1QJV A;  3N90 A;  3BH7 B;  3UW0 A;  1TYU A;  3T9G A;  1O8M A;  3ML3 A;  2UVF A;  4XN0 A;  1OGO X;  2XTW A;  3GQ8 A;  5AMV A;  1CZF A;  2VJJ A;  4I84 A;  1OOC A;  2O1D A;  2VBE A;  4YZA A;  2W7Z A;  2QX3 A;  3SQV A;  5DNS A;  2EWE A;  1QCX A;  4YFO A;  5C1C A;  4MXN A;  1PXZ A;  4YCQ A;  4YC5 A;  2X3H A;  3VSU A;  1QRB A;  2VFM A;  1WXR A;  1O8I A;  2NTP A;  2O0V A;  1O8H A;  3SZE A;  2QYU A;  1CLW A;  4V02 C;  4Z05 A;  4OPW A;  2VFQ A;  2VBK A;  4NK6 A;  2J8I A;  3GRH A;  2IQ7 A;  2ODL A;  2VFP A;  4C2L A;  1EZG A;  1LM1 A;  3GQ9 A;  2V5I A;  4URR A;  4XLA A;  3B90 A;  1PLU A;  1NHC A;  4XOR A;  3VST A;  1RMG A;  4YEI A;  4XN3 A;  1KCC A;  2INU A;  4YZQ A;  1O88 A;  2F3L A;  3LYC A;  3LMW A;  3VMV A;  5C1E A;  2G0Y A;  1BHE A;  2J8K A;  1O8D A;  3B4N A;  2BM6 A;  1K4Z A;  2Z8G A;  3N6Z A;  2IOU G;  4HWV A;  2NTQ A;  1RU4 A;  1QQ1 A;  3P4G A;  4YZ0 A;  2BX6 A;  4JRA C;  3GQA A;  2BM5 A;  4XKV A;  1KTW A;  4OM9 A;  1OFM A;  2O0W A;  2X6X A;  3PSZ A;  5JMC B;  2X6W A;  4XOT A;  1O8G A;  1DAB A;  1GQ8 A;  1TYX A;  4W8Q A;  1IDJ A;  4OJ6 A;  2O04 A;  2XTX A;  4U4B A;  2NSP A;  4OZZ A;  1PE9 A;  1K8F A;  2O6W A;  4OJP A;  2QXZ A;  1VBL A;  4XNF A;  4MR0 A;  2VFO A;  2UVE A;  2BM7 A;  3DU1 X;  2XTY A;  3GQ7 A;  4XON A;  4Z03 A;  3BH6 B;  3AK5 A;  1BN8 A;  2YUH A;  3FY3 A;  4XLE A;  1HG8 A;  2NT9 A;  4XKW A;  3B8Y A;  1QA3 A;  1DBO A;  1KCD A;  1OFD A;  1OGM X;  2QY1 A;  3VSV A;  2PEC A;  4NK8 A;  2XT4 A;  1AIR A;  1OFL A;  1X0C A;  5JLV C;  1O8L A;  2NT6 A;  2X85 A;  3VMW A;  4W8S A;  3NAW A;  1O8E A;  4EW9 A;  4XM3 A;  4XLC A;  1HF2 A;  2NST A;  1O8F A;  4XOP A;  4YDT A;  4AVZ A;  1EA0 A;  4XLF A;  1QA2 A;  1QRC A;  2PYG A;  4OJ5 A;  1OFE A;  3TH0 A;  2NZM A;  1L1I A;  3NB2 A;  3LJY A;  2NTB A;  4XMY A;  1O8J A;  3SYJ A;  1LLW A;  3H09 A;  1IA5 A;  2BM4 A;  4OJO A;  1IDK A;  4YEL A;  3KRG A;  4PMH A;  1LLZ A;  1RWR A;  1DBG A;  3PSS A;  3RIQ A;  2INV A;  3ZPP A;  1JTA A;  2O17 A;  3SY2 A;  3SUC A;  2QZA A;  4U49 A;  4Z06 A;  1O8K A;  3JUR A;  4XQF A;  4YEJ A;  3PET A;  4XL9 A;  1K5C A; 
#chains in the Genus database with same CATH homology
 2BM6 A;  1KQ5 A;  1K4Z A;  1TYV A;  3N6Z A;  2IOU G;  5JLV C;  1QRB A;  1QQ1 A;  3JX8 A;  2VFM A;  3P4G A;  2BX6 A;  4JRA C;  1WXR A;  2BM5 A;  1TYW A;  4OJL A;  4OM9 A;  3SZE A;  1CLW A;  1HF2 A;  4V02 C;  1TSP A;  5JMC B;  4OPW A;  1DAB A;  1QA2 A;  1QRC A;  2B0R A;  2VFQ A;  2VFN A;  4OJ5 A;  2J8I A;  4KH3 A;  1TYX A;  1QA1 A;  4OJ6 A;  2XC1 A;  3TH0 A;  4OJP A;  2VFP A;  1K8F A;  3N90 A;  2V5I A;  3BH7 B;  3LJY A;  1TYU A;  2VFO A;  3SYJ A;  2BM7 A;  3H09 A;  3ML3 A;  2BM4 A;  4OJO A;  3BH6 B;  3AK5 A;  3RIQ A;  2YUH A;  2F3L A;  3LYC A;  2W7Z A;  2G0Y A;  1QA3 A;  3PET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...