4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
2YUHA 2B0RA 4V02C 1HF2A 3BH6B 1KQ5A 1K4ZA 2BX6A 1K8FA 3BH7B
chains in the Genus database with same CATH superfamily
1IA5A 1X0CA 2ODLA 4YDTA 3EQOA 2NTPA 3ZSCA 4XOPA 3SUCA 2X6XA 3VSUA 4HWVA 2J8IA 1TYVA 3TH0A 3SZEA 2PYGA 2IQ7A 2NZMA 4W8SA 2XT4A 1TYUA 4OM9A 1KCDA 2NTBA 2VBEA 2QYUA 3PETA 1HF2A 4XKWA 1O8DA 1KCCA 2NSTA 2QZAA 2F3LA 1EZGA 3JX8A 2O0WA 2VBMA 1VBLA 2BSPA 3FY3A 4I84A 1OFDA 4EW9A 1GQ8A 4XM3A 1TYXA 1WMRA 1OOCA 1KQ5A 1XG2A 1TSPA 4XLEA 2UVEA 1TYWA 3B90A 1IB4A 1PLUA 3BH7B 4PMHA 4XKVA 1DABA 1QA3A 2X85A 1RU4A 1QRCA 4URRA 2XT2A 4OJPA 1QQ1A 4NK8A 1O8JA 1QJVA 3GRHA 3ML3A 4YZQA 4XORA 1PE9A 3UW0A 4YCQA 3SQVA 3DU1X 1O8IA 4OJLA 3VSTA 1OFEA 4XLHA 1O8EA 4XONA 1QRBA 1IDKA 1LLZA 1AIRA 1O88A 1IDJA 1OGMX 3GQ9A 2J8KA 2QY1A 2VFOA 1JTAA 1OGOX 4YEJA 1HG8A 4Z03A 4XOTA 1LM1A 1QCXA 3LMWA 4Z06A 1LLWA 4NK6A 2VJIA 4V02C 4JRAC 3BH6B 2X3HA 3LYCA 4C2LA 4Z05A 1JRGA 1RWRA 1L1IA 2V5IA 3KRGA 4YEIA 4XN3A 2VFQA 3VMVA 2BM4A 4XLFA 2YUHA 4XR6A 2VFNA 2VFPA 4W8RA 1EE6A 2VJJA 2Z8GA 4MR0A 4OJOA 2QXZA 1O8HA 2O1DA 5DNSA 1NHCA 3VSVA 1CZFA 5JLVC 1O8FA 2G0YA 1RMGA 3T9GA 4XQFA 2VBKA 3GQ8A 1K4ZA 5C1CA 3SY2A 3P4GA 3N6ZA 2X6WA 3NAWA 2QX3A 1BHEA 2INVA 2XTWA 2BM5A 5JMCB 4YELA 4U49A 5AMVA 2XTYA 4OJ6A 3LJYA 1OFLA 2O6WA 3VMWA 3ZPPA 3GQAA 4U4BA 2PECA 2O04A 1O8MA 2NT9A 4MXNA 2BM6A 1K5CA 4OZZA 4XL9A 5C1EA 4KH3A 1QA1A 3PSSA 3H09A 1K8FA 2UVFA 1CLWA 3N90A 2NT6A 3GQ7A 2W7ZA 4XMYA 2BX6A 4W8QA 4YZ0A 1H80A 4YZXA 4XLAA 1QA2A 2B0RA 3B4NA 1O8LA 2NTQA 1KTWA 1DBOA 1OFMA 2PYHA 2XC1A 2XTXA 3PSZA 4YZAA 1O8KA 2X6YA 1BN8A 1O8GA 3JURA 3EQNA 4W8TA 3SYJA 1WXRA 2INUA 4OJ5A 3NB2A 4OZYA 4AVZA 1PXZA 2IOUG 4XLCA 2NSPA 4OPWA 3B8YA 2EWEA 1DBGA 2VFMA 4XN0A 4XNFA 3AK5A 1EA0A 3RIQA 3WWGA 2O0VA 4YFOA 2O17A 2BM7A 4YC5A
chains in the Genus database with same CATH topology
2YUHA 1DABA 2VFNA 2VFPA 3N90A 1QA3A 1QRCA 2W7ZA 4OJOA 4OJPA 1QQ1A 2BX6A 3ML3A 5JLVC 1QA2A 2G0YA 2B0RA 2J8IA 1TYVA 4OJLA 2XC1A 3TH0A 1K4ZA 3SZEA 1QRBA 3N6ZA 1K8FA 1TYUA 3BH7B 3P4GA 4OM9A 3SYJA 3PETA 1HF2A 2BM5A 2VFOA 1WXRA 2F3LA 4OJ5A 5JMCB 3JX8A 2IOUG 4OJ6A 3LJYA 4OPWA 3AK5A 2VFMA 1TYXA 4V02C 4JRAC 3BH6B 2BM6A 3LYCA 1KQ5A 3RIQA 4KH3A 1TSPA 2V5IA 1QA1A 2VFQA 1TYWA 2BM4A 3H09A 2BM7A 1CLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUH A;  2B0R A;  4V02 C;  1HF2 A;  3BH6 B;  1KQ5 A;  1K4Z A;  2BX6 A;  1K8F A;  3BH7 B; 
#chains in the Genus database with same CATH topology
 1IA5 A;  1X0C A;  2ODL A;  4YDT A;  3EQO A;  2NTP A;  3ZSC A;  4XOP A;  3SUC A;  2X6X A;  3VSU A;  4HWV A;  2J8I A;  1TYV A;  3TH0 A;  3SZE A;  2PYG A;  2IQ7 A;  2NZM A;  4W8S A;  2XT4 A;  1TYU A;  4OM9 A;  1KCD A;  2NTB A;  2VBE A;  2QYU A;  3PET A;  1HF2 A;  4XKW A;  1O8D A;  1KCC A;  2NST A;  2QZA A;  2F3L A;  1EZG A;  3JX8 A;  2O0W A;  2VBM A;  1VBL A;  2BSP A;  3FY3 A;  4I84 A;  1OFD A;  4EW9 A;  1GQ8 A;  4XM3 A;  1TYX A;  1WMR A;  1OOC A;  1KQ5 A;  1XG2 A;  1TSP A;  4XLE A;  2UVE A;  1TYW A;  3B90 A;  1IB4 A;  1PLU A;  3BH7 B;  4PMH A;  4XKV A;  1DAB A;  1QA3 A;  2X85 A;  1RU4 A;  1QRC A;  4URR A;  2XT2 A;  4OJP A;  1QQ1 A;  4NK8 A;  1O8J A;  1QJV A;  3GRH A;  3ML3 A;  4YZQ A;  4XOR A;  1PE9 A;  3UW0 A;  4YCQ A;  3SQV A;  3DU1 X;  1O8I A;  4OJL A;  3VST A;  1OFE A;  4XLH A;  1O8E A;  4XON A;  1QRB A;  1IDK A;  1LLZ A;  1AIR A;  1O88 A;  1IDJ A;  1OGM X;  3GQ9 A;  2J8K A;  2QY1 A;  2VFO A;  1JTA A;  1OGO X;  4YEJ A;  1HG8 A;  4Z03 A;  4XOT A;  1LM1 A;  1QCX A;  3LMW A;  4Z06 A;  1LLW A;  4NK6 A;  2VJI A;  4V02 C;  4JRA C;  3BH6 B;  2X3H A;  3LYC A;  4C2L A;  4Z05 A;  1JRG A;  1RWR A;  1L1I A;  2V5I A;  3KRG A;  4YEI A;  4XN3 A;  2VFQ A;  3VMV A;  2BM4 A;  4XLF A;  2YUH A;  4XR6 A;  2VFN A;  2VFP A;  4W8R A;  1EE6 A;  2VJJ A;  2Z8G A;  4MR0 A;  4OJO A;  2QXZ A;  1O8H A;  2O1D A;  5DNS A;  1NHC A;  3VSV A;  1CZF A;  5JLV C;  1O8F A;  2G0Y A;  1RMG A;  3T9G A;  4XQF A;  2VBK A;  3GQ8 A;  1K4Z A;  5C1C A;  3SY2 A;  3P4G A;  3N6Z A;  2X6W A;  3NAW A;  2QX3 A;  1BHE A;  2INV A;  2XTW A;  2BM5 A;  5JMC B;  4YEL A;  4U49 A;  5AMV A;  2XTY A;  4OJ6 A;  3LJY A;  1OFL A;  2O6W A;  3VMW A;  3ZPP A;  3GQA A;  4U4B A;  2PEC A;  2O04 A;  1O8M A;  2NT9 A;  4MXN A;  2BM6 A;  1K5C A;  4OZZ A;  4XL9 A;  5C1E A;  4KH3 A;  1QA1 A;  3PSS A;  3H09 A;  1K8F A;  2UVF A;  1CLW A;  3N90 A;  2NT6 A;  3GQ7 A;  2W7Z A;  4XMY A;  2BX6 A;  4W8Q A;  4YZ0 A;  1H80 A;  4YZX A;  4XLA A;  1QA2 A;  2B0R A;  3B4N A;  1O8L A;  2NTQ A;  1KTW A;  1DBO A;  1OFM A;  2PYH A;  2XC1 A;  2XTX A;  3PSZ A;  4YZA A;  1O8K A;  2X6Y A;  1BN8 A;  1O8G A;  3JUR A;  3EQN A;  4W8T A;  3SYJ A;  1WXR A;  2INU A;  4OJ5 A;  3NB2 A;  4OZY A;  4AVZ A;  1PXZ A;  2IOU G;  4XLC A;  2NSP A;  4OPW A;  3B8Y A;  2EWE A;  1DBG A;  2VFM A;  4XN0 A;  4XNF A;  3AK5 A;  1EA0 A;  3RIQ A;  3WWG A;  2O0V A;  4YFO A;  2O17 A;  2BM7 A;  4YC5 A; 
#chains in the Genus database with same CATH homology
 2YUH A;  1DAB A;  2VFN A;  2VFP A;  3N90 A;  1QA3 A;  1QRC A;  2W7Z A;  4OJO A;  4OJP A;  1QQ1 A;  2BX6 A;  3ML3 A;  5JLV C;  1QA2 A;  2G0Y A;  2B0R A;  2J8I A;  1TYV A;  4OJL A;  2XC1 A;  3TH0 A;  1K4Z A;  3SZE A;  1QRB A;  3N6Z A;  1K8F A;  1TYU A;  3BH7 B;  3P4G A;  4OM9 A;  3SYJ A;  3PET A;  1HF2 A;  2BM5 A;  2VFO A;  1WXR A;  2F3L A;  4OJ5 A;  5JMC B;  3JX8 A;  2IOU G;  4OJ6 A;  3LJY A;  4OPW A;  3AK5 A;  2VFM A;  1TYX A;  4V02 C;  4JRA C;  3BH6 B;  2BM6 A;  3LYC A;  1KQ5 A;  3RIQ A;  4KH3 A;  1TSP A;  2V5I A;  1QA1 A;  2VFQ A;  1TYW A;  2BM4 A;  3H09 A;  2BM7 A;  1CLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...