4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
molecule keywords SITE-DETERMINING PROTEIN
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
1KQ5A 1K4ZA 3BH7B 1K8FA 4V02C 1HF2A 2YUHA 2BX6A 3BH6B 2B0RA
chains in the Genus database with same CATH superfamily
4XKWA 3KRGA 2IQ7A 1NHCA 2VFPA 1OGOX 1IB4A 5JLVC 2VFMA 4EW9A 1TYXA 4URRA 3GQ8A 4YC5A 1PXZA 1TYUA 1O8DA 4MXNA 1K8FA 3PSSA 1WMRA 3RIQA 2O17A 2O1DA 2Z8GA 2BM6A 2VJIA 3H09A 1O8LA 4JRAC 2BSPA 4PMHA 2PECA 4OJ6A 3WWGA 2NSTA 3BH7B 1HG8A 1DABA 2X6XA 3ZSCA 1WXRA 1O8FA 4U4BA 3JX8A 4KH3A 5C1CA 4W8RA 1PLUA 1PE9A 3PETA 4W8TA 4YEIA 2XTYA 1O8KA 4OJPA 1KTWA 2BM7A 3GQAA 3VSVA 1CLWA 4HWVA 4OM9A 2BX6A 4I84A 2O04A 3LJYA 2VFQA 4XN3A 1TYVA 1X0CA 1IA5A 2PYHA 1O8EA 2QXZA 2XTXA 3LMWA 3GQ7A 4YZAA 1QA1A 3NB2A 4W8QA 4XLCA 2NT6A 2VJJA 1IDJA 2VFOA 1EE6A 1DBGA 1QRBA 2X6YA 4OJLA 2V5IA 1DBOA 2ODLA 3N6ZA 4Z06A 1O8MA 1HF2A 3EQNA 4XORA 2QX3A 5AMVA 1QQ1A 1RU4A 2INUA 3AK5A 4YEJA 1VBLA 2X6WA 3TH0A 2NTQA 1O8JA 1BN8A 4XR6A 1LM1A 4XNFA 4C2LA 2NT9A 2G0YA 1QJVA 3ML3A 4Z05A 4XOTA 4YCQA 1OGMX 4YZ0A 4NK8A 3VSUA 1K4ZA 3B4NA 3GQ9A 4V02C 4XMYA 2NZMA 4XLEA 3B90A 1EZGA 1TYWA 2X3HA 4XN0A 3ZPPA 4Z03A 4YZQA 2QZAA 3SZEA 1GQ8A 2IOUG 1TSPA 1IDKA 2EWEA 2NSPA 3JURA 2QYUA 1OFDA 1QRCA 2XTWA 4OZYA 4XONA 2PYGA 2VBKA 4U49A 1LLWA 1QA2A 4XLFA 3DU1X 1K5CA 4XKVA 2BM5A 1O8IA 5C1EA 1OFLA 4OJOA 4AVZA 4W8SA 5DNSA 2XT2A 3T9GA 4XLAA 1EA0A 1KCDA 1O8GA 2X85A 1KQ5A 4XLHA 3UW0A 3VMVA 2O0VA 1BHEA 2QY1A 2J8KA 1O8HA 3VSTA 3FY3A 2UVFA 2XC1A 2YUHA 3PSZA 1OOCA 2F3LA 2UVEA 2VBEA 2NTBA 1L1IA 4NK6A 4YDTA 1KCCA 2B0RA 1OFEA 1XG2A 2NTPA 2BM4A 2O6WA 3LYCA 3GRHA 2W7ZA 2XT4A 4YZXA 3SUCA 1H80A 3P4GA 1CZFA 1QCXA 1JTAA 2VBMA 3VMWA 5JMCB 4XM3A 3N90A 3NAWA 4OZZA 1OFMA 2J8IA 4XQFA 1AIRA 4OPWA 4XL9A 3SYJA 2VFNA 1JRGA 1LLZA 3SY2A 3SQVA 4MR0A 4OJ5A 2INVA 4YFOA 4YELA 3EQOA 1QA3A 3B8YA 1RMGA 1RWRA 2O0WA 3BH6B 1O88A 4XOPA
chains in the Genus database with same CATH topology
1TYVA 3SZEA 2IOUG 1TSPA 1QA1A 2VFPA 5JLVC 2VFMA 2VFOA 1TYXA 2B0RA 1QRCA 1TYUA 1QRBA 3LYCA 2BM4A 4OJLA 2V5IA 1K8FA 2W7ZA 3N6ZA 3RIQA 3P4GA 1QA2A 1HF2A 2BM6A 1QQ1A 3H09A 2BM5A 5JMCB 3AK5A 4JRAC 3TH0A 3N90A 4OJ6A 2J8IA 3BH7B 4OPWA 1DABA 4OJOA 1WXRA 3SYJA 2G0YA 2VFNA 3ML3A 3JX8A 4KH3A 1KQ5A 2VFQA 1K4ZA 3PETA 4OJ5A 4V02C 4OJPA 1QA3A 2BM7A 1TYWA 2XC1A 1CLWA 2YUHA 4OM9A 2BX6A 3BH6B 3LJYA 2F3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ5 A;  1K4Z A;  3BH7 B;  1K8F A;  4V02 C;  1HF2 A;  2YUH A;  2BX6 A;  3BH6 B;  2B0R A; 
#chains in the Genus database with same CATH topology
 4XKW A;  3KRG A;  2IQ7 A;  1NHC A;  2VFP A;  1OGO X;  1IB4 A;  5JLV C;  2VFM A;  4EW9 A;  1TYX A;  4URR A;  3GQ8 A;  4YC5 A;  1PXZ A;  1TYU A;  1O8D A;  4MXN A;  1K8F A;  3PSS A;  1WMR A;  3RIQ A;  2O17 A;  2O1D A;  2Z8G A;  2BM6 A;  2VJI A;  3H09 A;  1O8L A;  4JRA C;  2BSP A;  4PMH A;  2PEC A;  4OJ6 A;  3WWG A;  2NST A;  3BH7 B;  1HG8 A;  1DAB A;  2X6X A;  3ZSC A;  1WXR A;  1O8F A;  4U4B A;  3JX8 A;  4KH3 A;  5C1C A;  4W8R A;  1PLU A;  1PE9 A;  3PET A;  4W8T A;  4YEI A;  2XTY A;  1O8K A;  4OJP A;  1KTW A;  2BM7 A;  3GQA A;  3VSV A;  1CLW A;  4HWV A;  4OM9 A;  2BX6 A;  4I84 A;  2O04 A;  3LJY A;  2VFQ A;  4XN3 A;  1TYV A;  1X0C A;  1IA5 A;  2PYH A;  1O8E A;  2QXZ A;  2XTX A;  3LMW A;  3GQ7 A;  4YZA A;  1QA1 A;  3NB2 A;  4W8Q A;  4XLC A;  2NT6 A;  2VJJ A;  1IDJ A;  2VFO A;  1EE6 A;  1DBG A;  1QRB A;  2X6Y A;  4OJL A;  2V5I A;  1DBO A;  2ODL A;  3N6Z A;  4Z06 A;  1O8M A;  1HF2 A;  3EQN A;  4XOR A;  2QX3 A;  5AMV A;  1QQ1 A;  1RU4 A;  2INU A;  3AK5 A;  4YEJ A;  1VBL A;  2X6W A;  3TH0 A;  2NTQ A;  1O8J A;  1BN8 A;  4XR6 A;  1LM1 A;  4XNF A;  4C2L A;  2NT9 A;  2G0Y A;  1QJV A;  3ML3 A;  4Z05 A;  4XOT A;  4YCQ A;  1OGM X;  4YZ0 A;  4NK8 A;  3VSU A;  1K4Z A;  3B4N A;  3GQ9 A;  4V02 C;  4XMY A;  2NZM A;  4XLE A;  3B90 A;  1EZG A;  1TYW A;  2X3H A;  4XN0 A;  3ZPP A;  4Z03 A;  4YZQ A;  2QZA A;  3SZE A;  1GQ8 A;  2IOU G;  1TSP A;  1IDK A;  2EWE A;  2NSP A;  3JUR A;  2QYU A;  1OFD A;  1QRC A;  2XTW A;  4OZY A;  4XON A;  2PYG A;  2VBK A;  4U49 A;  1LLW A;  1QA2 A;  4XLF A;  3DU1 X;  1K5C A;  4XKV A;  2BM5 A;  1O8I A;  5C1E A;  1OFL A;  4OJO A;  4AVZ A;  4W8S A;  5DNS A;  2XT2 A;  3T9G A;  4XLA A;  1EA0 A;  1KCD A;  1O8G A;  2X85 A;  1KQ5 A;  4XLH A;  3UW0 A;  3VMV A;  2O0V A;  1BHE A;  2QY1 A;  2J8K A;  1O8H A;  3VST A;  3FY3 A;  2UVF A;  2XC1 A;  2YUH A;  3PSZ A;  1OOC A;  2F3L A;  2UVE A;  2VBE A;  2NTB A;  1L1I A;  4NK6 A;  4YDT A;  1KCC A;  2B0R A;  1OFE A;  1XG2 A;  2NTP A;  2BM4 A;  2O6W A;  3LYC A;  3GRH A;  2W7Z A;  2XT4 A;  4YZX A;  3SUC A;  1H80 A;  3P4G A;  1CZF A;  1QCX A;  1JTA A;  2VBM A;  3VMW A;  5JMC B;  4XM3 A;  3N90 A;  3NAW A;  4OZZ A;  1OFM A;  2J8I A;  4XQF A;  1AIR A;  4OPW A;  4XL9 A;  3SYJ A;  2VFN A;  1JRG A;  1LLZ A;  3SY2 A;  3SQV A;  4MR0 A;  4OJ5 A;  2INV A;  4YFO A;  4YEL A;  3EQO A;  1QA3 A;  3B8Y A;  1RMG A;  1RWR A;  2O0W A;  3BH6 B;  1O88 A;  4XOP A; 
#chains in the Genus database with same CATH homology
 1TYV A;  3SZE A;  2IOU G;  1TSP A;  1QA1 A;  2VFP A;  5JLV C;  2VFM A;  2VFO A;  1TYX A;  2B0R A;  1QRC A;  1TYU A;  1QRB A;  3LYC A;  2BM4 A;  4OJL A;  2V5I A;  1K8F A;  2W7Z A;  3N6Z A;  3RIQ A;  3P4G A;  1QA2 A;  1HF2 A;  2BM6 A;  1QQ1 A;  3H09 A;  2BM5 A;  5JMC B;  3AK5 A;  4JRA C;  3TH0 A;  3N90 A;  4OJ6 A;  2J8I A;  3BH7 B;  4OPW A;  1DAB A;  4OJO A;  1WXR A;  3SYJ A;  2G0Y A;  2VFN A;  3ML3 A;  3JX8 A;  4KH3 A;  1KQ5 A;  2VFQ A;  1K4Z A;  3PET A;  4OJ5 A;  4V02 C;  4OJP A;  1QA3 A;  2BM7 A;  1TYW A;  2XC1 A;  1CLW A;  2YUH A;  4OM9 A;  2BX6 A;  3BH6 B;  3LJY A;  2F3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...