4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Cell cycle
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
1K8FA 4V02C 1HF2A 2B0RA 1KQ5A 3BH7B 2BX6A 3BH6B 2YUHA 1K4ZA
chains in the Genus database with same CATH superfamily
4OJOA 1QQ1A 4W8QA 3RIQA 2ODLA 3KRGA 4MR0A 3SZEA 1O8JA 1O8DA 2X85A 2BM4A 1QRBA 1BN8A 1O8HA 1QJVA 4XORA 1IB4A 2XTXA 1TYXA 2NTPA 2QXZA 3DU1X 1LLZA 4XLFA 4XLAA 2O04A 4YEIA 4OJPA 3GQAA 4V02C 2EWEA 2XTYA 2X3HA 4YFOA 1QCXA 2NTBA 3VSTA 1L1IA 3B4NA 2BSPA 2VFMA 1DABA 2F3LA 2VBKA 1KTWA 1O8GA 1O88A 4PMHA 3ZPPA 4YZXA 3ML3A 1NHCA 4XR6A 3B90A 4NK6A 3VMVA 1XG2A 4XLCA 2NT6A 1K4ZA 1BHEA 4XKWA 4XLHA 1O8IA 1OGMX 2VFNA 2VFQA 1TYUA 3BH7B 4YC5A 4EW9A 2PYGA 4XMYA 4OM9A 3SYJA 3WWGA 3N6ZA 1QRCA 1OFDA 2IQ7A 5C1CA 1O8KA 2O1DA 4XOTA 3LJYA 1WXRA 2Z8GA 4Z06A 1O8FA 4XKVA 1IDKA 3SUCA 3LMWA 3UW0A 3N90A 2QX3A 1AIRA 1LM1A 2VJIA 2BM7A 1QA3A 2VFPA 4YZ0A 3ZSCA 2X6XA 3B8YA 2VFOA 3VSUA 1OGOX 1QA2A 1KQ5A 2QY1A 2NZMA 1KCDA 4XN3A 2BM6A 1O8MA 2O0VA 1OFEA 2YUHA 3NAWA 4XONA 4YELA 1KCCA 1RWRA 5C1EA 3GRHA 1VBLA 4HWVA 4OZYA 2O17A 3SY2A 1RMGA 2INUA 2J8IA 3BH6B 4W8RA 4U49A 3SQVA 2G0YA 2INVA 2NT9A 4OPWA 2XC1A 1IDJA 1LLWA 1PXZA 3JX8A 3PSSA 2IOUG 4YZAA 2X6YA 3PETA 4YDTA 2BX6A 3AK5A 1HG8A 2NSPA 4MXNA 2XT2A 3LYCA 2BM5A 2VBEA 1EE6A 2XTWA 2QYUA 3EQOA 3P4GA 3GQ8A 2UVFA 3FY3A 1DBGA 4XNFA 3GQ9A 2NTQA 2O0WA 1H80A 4YCQA 1X0CA 1O8LA 3TH0A 2UVEA 4XLEA 3T9GA 3VMWA 2PYHA 4XM3A 3EQNA 2X6WA 2V5IA 3H09A 4XL9A 4KH3A 4OZZA 2O6WA 3GQ7A 2VJJA 4OJLA 4URRA 4W8TA 1GQ8A 2XT4A 1O8EA 4W8SA 2PECA 4U4BA 4NK8A 1QA1A 1TYVA 1EZGA 1PLUA 2B0RA 4XOPA 5DNSA 1WMRA 4I84A 4YZQA 1K5CA 2VBMA 1TYWA 1HF2A 1DBOA 1OFMA 1IA5A 1JTAA 1PE9A 1OOCA 4XN0A 4Z05A 4OJ6A 5JMCB 1RU4A 4XQFA 4JRAC 5AMVA 1CLWA 2J8KA 1CZFA 4AVZA 2W7ZA 3NB2A 4C2LA 1K8FA 4YEJA 1EA0A 3VSVA 1TSPA 5JLVC 4OJ5A 1JRGA 3PSZA 2NSTA 4Z03A 1OFLA 3JURA 2QZAA
chains in the Genus database with same CATH topology
4OJOA 1QQ1A 3RIQA 2V5IA 2VFNA 2VFQA 3H09A 4KH3A 3SZEA 2BM4A 1TYUA 3BH7B 4OJLA 1QRBA 2J8IA 3BH6B 2G0YA 1QA1A 4OPWA 1TYVA 2XC1A 4OM9A 3JX8A 3SYJA 2B0RA 2IOUG 1TYXA 3N6ZA 1QRCA 2BX6A 3PETA 2YUHA 3AK5A 1TYWA 1HF2A 4OJPA 3LJYA 3LYCA 4V02C 1WXRA 2BM5A 5JMCB 3P4GA 4OJ6A 4JRAC 3N90A 1CLWA 1QA3A 2VFMA 1DABA 2BM7A 2F3LA 2VFPA 2W7ZA 1K8FA 2VFOA 1TSPA 3TH0A 3ML3A 5JLVC 1KQ5A 1QA2A 4OJ5A 2BM6A 1K4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8F A;  4V02 C;  1HF2 A;  2B0R A;  1KQ5 A;  3BH7 B;  2BX6 A;  3BH6 B;  2YUH A;  1K4Z A; 
#chains in the Genus database with same CATH topology
 4OJO A;  1QQ1 A;  4W8Q A;  3RIQ A;  2ODL A;  3KRG A;  4MR0 A;  3SZE A;  1O8J A;  1O8D A;  2X85 A;  2BM4 A;  1QRB A;  1BN8 A;  1O8H A;  1QJV A;  4XOR A;  1IB4 A;  2XTX A;  1TYX A;  2NTP A;  2QXZ A;  3DU1 X;  1LLZ A;  4XLF A;  4XLA A;  2O04 A;  4YEI A;  4OJP A;  3GQA A;  4V02 C;  2EWE A;  2XTY A;  2X3H A;  4YFO A;  1QCX A;  2NTB A;  3VST A;  1L1I A;  3B4N A;  2BSP A;  2VFM A;  1DAB A;  2F3L A;  2VBK A;  1KTW A;  1O8G A;  1O88 A;  4PMH A;  3ZPP A;  4YZX A;  3ML3 A;  1NHC A;  4XR6 A;  3B90 A;  4NK6 A;  3VMV A;  1XG2 A;  4XLC A;  2NT6 A;  1K4Z A;  1BHE A;  4XKW A;  4XLH A;  1O8I A;  1OGM X;  2VFN A;  2VFQ A;  1TYU A;  3BH7 B;  4YC5 A;  4EW9 A;  2PYG A;  4XMY A;  4OM9 A;  3SYJ A;  3WWG A;  3N6Z A;  1QRC A;  1OFD A;  2IQ7 A;  5C1C A;  1O8K A;  2O1D A;  4XOT A;  3LJY A;  1WXR A;  2Z8G A;  4Z06 A;  1O8F A;  4XKV A;  1IDK A;  3SUC A;  3LMW A;  3UW0 A;  3N90 A;  2QX3 A;  1AIR A;  1LM1 A;  2VJI A;  2BM7 A;  1QA3 A;  2VFP A;  4YZ0 A;  3ZSC A;  2X6X A;  3B8Y A;  2VFO A;  3VSU A;  1OGO X;  1QA2 A;  1KQ5 A;  2QY1 A;  2NZM A;  1KCD A;  4XN3 A;  2BM6 A;  1O8M A;  2O0V A;  1OFE A;  2YUH A;  3NAW A;  4XON A;  4YEL A;  1KCC A;  1RWR A;  5C1E A;  3GRH A;  1VBL A;  4HWV A;  4OZY A;  2O17 A;  3SY2 A;  1RMG A;  2INU A;  2J8I A;  3BH6 B;  4W8R A;  4U49 A;  3SQV A;  2G0Y A;  2INV A;  2NT9 A;  4OPW A;  2XC1 A;  1IDJ A;  1LLW A;  1PXZ A;  3JX8 A;  3PSS A;  2IOU G;  4YZA A;  2X6Y A;  3PET A;  4YDT A;  2BX6 A;  3AK5 A;  1HG8 A;  2NSP A;  4MXN A;  2XT2 A;  3LYC A;  2BM5 A;  2VBE A;  1EE6 A;  2XTW A;  2QYU A;  3EQO A;  3P4G A;  3GQ8 A;  2UVF A;  3FY3 A;  1DBG A;  4XNF A;  3GQ9 A;  2NTQ A;  2O0W A;  1H80 A;  4YCQ A;  1X0C A;  1O8L A;  3TH0 A;  2UVE A;  4XLE A;  3T9G A;  3VMW A;  2PYH A;  4XM3 A;  3EQN A;  2X6W A;  2V5I A;  3H09 A;  4XL9 A;  4KH3 A;  4OZZ A;  2O6W A;  3GQ7 A;  2VJJ A;  4OJL A;  4URR A;  4W8T A;  1GQ8 A;  2XT4 A;  1O8E A;  4W8S A;  2PEC A;  4U4B A;  4NK8 A;  1QA1 A;  1TYV A;  1EZG A;  1PLU A;  2B0R A;  4XOP A;  5DNS A;  1WMR A;  4I84 A;  4YZQ A;  1K5C A;  2VBM A;  1TYW A;  1HF2 A;  1DBO A;  1OFM A;  1IA5 A;  1JTA A;  1PE9 A;  1OOC A;  4XN0 A;  4Z05 A;  4OJ6 A;  5JMC B;  1RU4 A;  4XQF A;  4JRA C;  5AMV A;  1CLW A;  2J8K A;  1CZF A;  4AVZ A;  2W7Z A;  3NB2 A;  4C2L A;  1K8F A;  4YEJ A;  1EA0 A;  3VSV A;  1TSP A;  5JLV C;  4OJ5 A;  1JRG A;  3PSZ A;  2NST A;  4Z03 A;  1OFL A;  3JUR A;  2QZA A; 
#chains in the Genus database with same CATH homology
 4OJO A;  1QQ1 A;  3RIQ A;  2V5I A;  2VFN A;  2VFQ A;  3H09 A;  4KH3 A;  3SZE A;  2BM4 A;  1TYU A;  3BH7 B;  4OJL A;  1QRB A;  2J8I A;  3BH6 B;  2G0Y A;  1QA1 A;  4OPW A;  1TYV A;  2XC1 A;  4OM9 A;  3JX8 A;  3SYJ A;  2B0R A;  2IOU G;  1TYX A;  3N6Z A;  1QRC A;  2BX6 A;  3PET A;  2YUH A;  3AK5 A;  1TYW A;  1HF2 A;  4OJP A;  3LJY A;  3LYC A;  4V02 C;  1WXR A;  2BM5 A;  5JMC B;  3P4G A;  4OJ6 A;  4JRA C;  3N90 A;  1CLW A;  1QA3 A;  2VFM A;  1DAB A;  2BM7 A;  2F3L A;  2VFP A;  2W7Z A;  1K8F A;  2VFO A;  1TSP A;  3TH0 A;  3ML3 A;  5JLV C;  1KQ5 A;  1QA2 A;  4OJ5 A;  2BM6 A;  1K4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...