4V02C

Minc:mind cell division protein complex, aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
SRLLIIERTLRAGQRIEHRGDILILGDVNKDAEVLAGGNIIVMGKLRGVAKAGLIGDHSAVIVALKMEPQLLQIGKKKAIMSEADRNSPGYPEVAKIEGEDIVLEPIEGAERWLKLLLGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SITE-DETERMINING PROTEIN
publication title Mincd Cell Division Proteins Form Alternating Copolymeric Cytomotive Filaments.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 34
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03775 MinC_C Septum formation inhibitor MinC, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 4v02C00
3BH7B 1KQ5A 1HF2A 2B0RA 2YUHA 2BX6A 1K4ZA 3BH6B 1K8FA 4V02C
chains in the Genus database with same CATH superfamily
3BH7B 1RMGA 4Z05A 1TYVA 4I84A 3B90A 4XONA 1KCDA 3GQ8A 3H09A 4U49A 4EW9A 2PYHA 3SUCA 1QCXA 1DBGA 1LLZA 1XG2A 4U4BA 4XLHA 2VFQA 3EQOA 1BN8A 2PECA 1O8EA 1OFLA 2X3HA 2XTYA 4XOPA 4YZ0A 1DABA 1EA0A 1O8KA 3GRHA 3NAWA 2NSPA 1OGOX 1OOCA 1RWRA 1K8FA 2XTXA 3GQAA 4JRAC 4V02C 4XKVA 4Z03A 1O8IA 3DU1X 4OPWA 3GQ7A 4OZYA 3ZSCA 1WXRA 2NT6A 1KTWA 1OFMA 3VMVA 1VBLA 4KH3A 4YDTA 2O1DA 3VSTA 2UVEA 2NZMA 3EQNA 2EWEA 2XC1A 2QZAA 3VMWA 4MXNA 4YEJA 4XQFA 1HG8A 4MR0A 1K5CA 1TSPA 3P4GA 1QRCA 4YZXA 1O8MA 1TYWA 2VBKA 4XKWA 5C1EA 1H80A 1NHCA 3SY2A 2QYUA 1QQ1A 1O88A 1OGMX 2NTQA 1PXZA 4YZQA 2INUA 3B8YA 1JRGA 3ML3A 4OM9A 4OJPA 1EE6A 3RIQA 3SYJA 3VSVA 4XLFA 1OFEA 1QA2A 3JX8A 1K4ZA 1GQ8A 2VFOA 4YCQA 3LMWA 5DNSA 2V5IA 1DBOA 1BHEA 1TYUA 4URRA 2VJJA 2O0VA 2XTWA 1O8DA 2ODLA 4XL9A 3TH0A 1O8JA 1TYXA 4XNFA 4HWVA 1LLWA 3N90A 2O04A 4OJOA 4W8TA 1X0CA 4PMHA 4XLCA 1LM1A 1IA5A 4NK6A 2O6WA 2J8IA 4NK8A 4XR6A 1IDKA 5C1CA 1EZGA 4Z06A 4AVZA 4OZZA 2UVFA 4YC5A 3PSZA 2INVA 2BM5A 4XLEA 2Z8GA 1O8GA 1PE9A 3PETA 1AIRA 3B4NA 3VSUA 3N6ZA 2NT9A 2QY1A 2XT2A 2QX3A 3AK5A 2X6XA 4C2LA 2QXZA 4W8SA 1O8HA 1O8FA 2B0RA 4XORA 2W7ZA 1QRBA 2X6YA 4W8RA 2VBEA 3GQ9A 4OJ5A 2BM6A 1CZFA 2VFPA 4W8QA 2PYGA 4XN3A 4XMYA 2NTBA 5JLVC 5AMVA 3LYCA 2NSTA 1IDJA 3NB2A 2YUHA 4XOTA 2IQ7A 1WMRA 2VFNA 2XT4A 3SQVA 1JTAA 1HF2A 3ZPPA 4OJ6A 3UW0A 2F3LA 4YZAA 4XN0A 1CLWA 3KRGA 2G0YA 3WWGA 2BM4A 2O0WA 2X6WA 3SZEA 2BM7A 2IOUG 4YEIA 5JMCB 2VBMA 4XM3A 1QA3A 2NTPA 4YELA 2VFMA 3JURA 3PSSA 1O8LA 3LJYA 2BX6A 2X85A 3BH6B 4YFOA 1L1IA 2J8KA 2O17A 1QJVA 1IB4A 1KQ5A 1OFDA 1QA1A 1RU4A 1KCCA 3FY3A 2VJIA 4XLAA 2BSPA 1PLUA 4OJLA 3T9GA
chains in the Genus database with same CATH topology
1TYXA 2XC1A 3BH7B 1TYVA 3LYCA 4OJOA 3N90A 1TSPA 2YUHA 3P4GA 1QRCA 2VFNA 3H09A 2J8IA 1TYWA 1HF2A 4OJ6A 2F3LA 1QQ1A 1CLWA 2VFQA 2G0YA 2VFPA 2BM4A 4OM9A 3RIQA 3SYJA 3ML3A 2BM7A 4OJPA 3SZEA 2IOUG 2BM5A 5JMCB 3PETA 1QA3A 1DABA 2VFMA 3N6ZA 1QA2A 3LJYA 2BX6A 1K4ZA 2VFOA 3BH6B 3JX8A 4JRAC 1K8FA 4V02C 3AK5A 2V5IA 1KQ5A 4OPWA 1TYUA 1QA1A 1WXRA 2B0RA 2W7ZA 1QRBA 4KH3A 4OJ5A 2BM6A 5JLVC 4OJLA 3TH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH7 B;  1KQ5 A;  1HF2 A;  2B0R A;  2YUH A;  2BX6 A;  1K4Z A;  3BH6 B;  1K8F A;  4V02 C; 
#chains in the Genus database with same CATH topology
 3BH7 B;  1RMG A;  4Z05 A;  1TYV A;  4I84 A;  3B90 A;  4XON A;  1KCD A;  3GQ8 A;  3H09 A;  4U49 A;  4EW9 A;  2PYH A;  3SUC A;  1QCX A;  1DBG A;  1LLZ A;  1XG2 A;  4U4B A;  4XLH A;  2VFQ A;  3EQO A;  1BN8 A;  2PEC A;  1O8E A;  1OFL A;  2X3H A;  2XTY A;  4XOP A;  4YZ0 A;  1DAB A;  1EA0 A;  1O8K A;  3GRH A;  3NAW A;  2NSP A;  1OGO X;  1OOC A;  1RWR A;  1K8F A;  2XTX A;  3GQA A;  4JRA C;  4V02 C;  4XKV A;  4Z03 A;  1O8I A;  3DU1 X;  4OPW A;  3GQ7 A;  4OZY A;  3ZSC A;  1WXR A;  2NT6 A;  1KTW A;  1OFM A;  3VMV A;  1VBL A;  4KH3 A;  4YDT A;  2O1D A;  3VST A;  2UVE A;  2NZM A;  3EQN A;  2EWE A;  2XC1 A;  2QZA A;  3VMW A;  4MXN A;  4YEJ A;  4XQF A;  1HG8 A;  4MR0 A;  1K5C A;  1TSP A;  3P4G A;  1QRC A;  4YZX A;  1O8M A;  1TYW A;  2VBK A;  4XKW A;  5C1E A;  1H80 A;  1NHC A;  3SY2 A;  2QYU A;  1QQ1 A;  1O88 A;  1OGM X;  2NTQ A;  1PXZ A;  4YZQ A;  2INU A;  3B8Y A;  1JRG A;  3ML3 A;  4OM9 A;  4OJP A;  1EE6 A;  3RIQ A;  3SYJ A;  3VSV A;  4XLF A;  1OFE A;  1QA2 A;  3JX8 A;  1K4Z A;  1GQ8 A;  2VFO A;  4YCQ A;  3LMW A;  5DNS A;  2V5I A;  1DBO A;  1BHE A;  1TYU A;  4URR A;  2VJJ A;  2O0V A;  2XTW A;  1O8D A;  2ODL A;  4XL9 A;  3TH0 A;  1O8J A;  1TYX A;  4XNF A;  4HWV A;  1LLW A;  3N90 A;  2O04 A;  4OJO A;  4W8T A;  1X0C A;  4PMH A;  4XLC A;  1LM1 A;  1IA5 A;  4NK6 A;  2O6W A;  2J8I A;  4NK8 A;  4XR6 A;  1IDK A;  5C1C A;  1EZG A;  4Z06 A;  4AVZ A;  4OZZ A;  2UVF A;  4YC5 A;  3PSZ A;  2INV A;  2BM5 A;  4XLE A;  2Z8G A;  1O8G A;  1PE9 A;  3PET A;  1AIR A;  3B4N A;  3VSU A;  3N6Z A;  2NT9 A;  2QY1 A;  2XT2 A;  2QX3 A;  3AK5 A;  2X6X A;  4C2L A;  2QXZ A;  4W8S A;  1O8H A;  1O8F A;  2B0R A;  4XOR A;  2W7Z A;  1QRB A;  2X6Y A;  4W8R A;  2VBE A;  3GQ9 A;  4OJ5 A;  2BM6 A;  1CZF A;  2VFP A;  4W8Q A;  2PYG A;  4XN3 A;  4XMY A;  2NTB A;  5JLV C;  5AMV A;  3LYC A;  2NST A;  1IDJ A;  3NB2 A;  2YUH A;  4XOT A;  2IQ7 A;  1WMR A;  2VFN A;  2XT4 A;  3SQV A;  1JTA A;  1HF2 A;  3ZPP A;  4OJ6 A;  3UW0 A;  2F3L A;  4YZA A;  4XN0 A;  1CLW A;  3KRG A;  2G0Y A;  3WWG A;  2BM4 A;  2O0W A;  2X6W A;  3SZE A;  2BM7 A;  2IOU G;  4YEI A;  5JMC B;  2VBM A;  4XM3 A;  1QA3 A;  2NTP A;  4YEL A;  2VFM A;  3JUR A;  3PSS A;  1O8L A;  3LJY A;  2BX6 A;  2X85 A;  3BH6 B;  4YFO A;  1L1I A;  2J8K A;  2O17 A;  1QJV A;  1IB4 A;  1KQ5 A;  1OFD A;  1QA1 A;  1RU4 A;  1KCC A;  3FY3 A;  2VJI A;  4XLA A;  2BSP A;  1PLU A;  4OJL A;  3T9G A; 
#chains in the Genus database with same CATH homology
 1TYX A;  2XC1 A;  3BH7 B;  1TYV A;  3LYC A;  4OJO A;  3N90 A;  1TSP A;  2YUH A;  3P4G A;  1QRC A;  2VFN A;  3H09 A;  2J8I A;  1TYW A;  1HF2 A;  4OJ6 A;  2F3L A;  1QQ1 A;  1CLW A;  2VFQ A;  2G0Y A;  2VFP A;  2BM4 A;  4OM9 A;  3RIQ A;  3SYJ A;  3ML3 A;  2BM7 A;  4OJP A;  3SZE A;  2IOU G;  2BM5 A;  5JMC B;  3PET A;  1QA3 A;  1DAB A;  2VFM A;  3N6Z A;  1QA2 A;  3LJY A;  2BX6 A;  1K4Z A;  2VFO A;  3BH6 B;  3JX8 A;  4JRA C;  1K8F A;  4V02 C;  3AK5 A;  2V5I A;  1KQ5 A;  4OPW A;  1TYU A;  1QA1 A;  1WXR A;  2B0R A;  2W7Z A;  1QRB A;  4KH3 A;  4OJ5 A;  2BM6 A;  5JLV C;  4OJL A;  3TH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...