3PETA

Crystal structure of a putative adhesin (bf0245) from bacteroides fragilis nctc 9343 at 2.07 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
GIQPSKKLITRDYKVKEFNKIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKMKITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVGDVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSIKYKGSPTIKSLSKKGVGTIKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative adhesin
publication title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3petA00
3JX8A 3LJYA 3PETA 4OPWA 3LYCA
chains in the Genus database with same CATH superfamily
3EQOA 2G0YA 1PE9A 4YELA 1H80A 3T9GA 1IB4A 3BH6B 1CLWA 5DNSA 1QA3A 1AIRA 3GQAA 2NT6A 4YCQA 1QA2A 1RMGA 4MXNA 3SUCA 2PYGA 4U4BA 1L1IA 3EQNA 3SZEA 3ZPPA 1LM1A 1HG8A 4AVZA 1KTWA 3VSUA 1DBGA 1PXZA 2VFPA 1KCCA 1EA0A 1QRCA 4XQFA 2XC1A 2VBEA 1HF2A 1JRGA 2BSPA 3N6ZA 3NAWA 2QXZA 4XLCA 4W8QA 2INVA 5AMVA 2VFOA 4YC5A 2X6WA 2VBMA 1QA1A 2PYHA 2W7ZA 4NK6A 2O6WA 4I84A 1X0CA 2X85A 1OFDA 3JX8A 3LJYA 4YZQA 1O8LA 4OJ6A 3VMVA 2XT2A 4XLEA 1NHCA 4XMYA 3KRGA 3SYJA 2BM7A 2QY1A 4XLHA 2NTPA 4Z05A 2EWEA 1O88A 1DABA 2J8KA 1BHEA 1VBLA 4OM9A 1OFLA 4W8TA 4XKVA 1IDKA 2X6XA 3FY3A 3PSSA 1PLUA 4XN3A 1IA5A 1XG2A 2QYUA 4XKWA 2IQ7A 4OJOA 2NTBA 1QJVA 4OZZA 2O17A 2XTYA 5C1EA 4OJ5A 3PETA 1QRBA 2VBKA 4KH3A 4XR6A 2VJIA 4Z03A 3WWGA 3H09A 1OGOX 1DBOA 1TSPA 4EW9A 2NZMA 2NSTA 3B8YA 1QQ1A 2BX6A 4PMHA 2VFMA 4XM3A 2NT9A 3BH7B 3TH0A 1RWRA 1EE6A 2F3LA 2VFNA 4URRA 2YUHA 3ML3A 3GQ7A 2BM5A 2VFQA 1O8DA 1O8IA 4U49A 4YZ0A 4XORA 3SQVA 3JURA 4YZAA 1TYWA 2PECA 2B0RA 4JRAC 3N90A 3RIQA 4C2LA 1K8FA 1BN8A 4YEJA 4XOPA 5JLVC 3SY2A 1LLWA 1LLZA 4OZYA 3VSTA 4YDTA 2VJJA 4NK8A 4W8RA 1OGMX 3LMWA 4XLAA 1O8GA 1OFEA 1GQ8A 2O0WA 1OFMA 4XOTA 2O04A 1O8FA 2QX3A 1K5CA 1O8EA 1WMRA 2IOUG 1QCXA 2QZAA 3GRHA 2NTQA 2O1DA 2X6YA 3NB2A 4MR0A 4OPWA 5C1CA 2BM4A 3VMWA 1O8JA 3B4NA 3LYCA 2O0VA 4XL9A 3B90A 1OOCA 2XTXA 3GQ9A 3P4GA 1IDJA 2ODLA 4XLFA 2INUA 1TYXA 1RU4A 1TYUA 2XTWA 2Z8GA 3DU1X 4XNFA 1EZGA 2BM6A 4YZXA 1JTAA 4Z06A 3UW0A 3PSZA 3GQ8A 1K4ZA 4YEIA 2V5IA 1O8MA 4OJPA 4V02C 2XT4A 2UVEA 3AK5A 2NSPA 4OJLA 1KQ5A 3ZSCA 4YFOA 2X3HA 1CZFA 1O8KA 1TYVA 2J8IA 2UVFA 1O8HA 3VSVA 5JMCB 1WXRA 4XN0A 4W8SA 4XONA 1KCDA 4HWVA
chains in the Genus database with same CATH topology
3JX8A 2IOUG 1TSPA 3LJYA 4OJ6A 2G0YA 4OPWA 1QQ1A 2BM4A 2BM7A 2BX6A 2VFMA 3LYCA 3SYJA 3BH6B 3BH7B 3TH0A 3P4GA 1CLWA 2F3LA 2VFNA 1QA3A 2YUHA 1TYXA 3ML3A 1DABA 1TYUA 4OM9A 1QA2A 2BM5A 2VFQA 2BM6A 1K4ZA 2V5IA 3SZEA 4OJPA 1TYWA 4V02C 2B0RA 4JRAC 3AK5A 2VFPA 3N90A 3RIQA 1QRCA 1KQ5A 4OJLA 4OJOA 2XC1A 1K8FA 1HF2A 3N6ZA 2J8IA 1TYVA 5JLVC 2VFOA 1WXRA 5JMCB 2W7ZA 4OJ5A 3PETA 1QA1A 1QRBA 4KH3A 3H09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  3LJY A;  3PET A;  4OPW A;  3LYC A; 
#chains in the Genus database with same CATH topology
 3EQO A;  2G0Y A;  1PE9 A;  4YEL A;  1H80 A;  3T9G A;  1IB4 A;  3BH6 B;  1CLW A;  5DNS A;  1QA3 A;  1AIR A;  3GQA A;  2NT6 A;  4YCQ A;  1QA2 A;  1RMG A;  4MXN A;  3SUC A;  2PYG A;  4U4B A;  1L1I A;  3EQN A;  3SZE A;  3ZPP A;  1LM1 A;  1HG8 A;  4AVZ A;  1KTW A;  3VSU A;  1DBG A;  1PXZ A;  2VFP A;  1KCC A;  1EA0 A;  1QRC A;  4XQF A;  2XC1 A;  2VBE A;  1HF2 A;  1JRG A;  2BSP A;  3N6Z A;  3NAW A;  2QXZ A;  4XLC A;  4W8Q A;  2INV A;  5AMV A;  2VFO A;  4YC5 A;  2X6W A;  2VBM A;  1QA1 A;  2PYH A;  2W7Z A;  4NK6 A;  2O6W A;  4I84 A;  1X0C A;  2X85 A;  1OFD A;  3JX8 A;  3LJY A;  4YZQ A;  1O8L A;  4OJ6 A;  3VMV A;  2XT2 A;  4XLE A;  1NHC A;  4XMY A;  3KRG A;  3SYJ A;  2BM7 A;  2QY1 A;  4XLH A;  2NTP A;  4Z05 A;  2EWE A;  1O88 A;  1DAB A;  2J8K A;  1BHE A;  1VBL A;  4OM9 A;  1OFL A;  4W8T A;  4XKV A;  1IDK A;  2X6X A;  3FY3 A;  3PSS A;  1PLU A;  4XN3 A;  1IA5 A;  1XG2 A;  2QYU A;  4XKW A;  2IQ7 A;  4OJO A;  2NTB A;  1QJV A;  4OZZ A;  2O17 A;  2XTY A;  5C1E A;  4OJ5 A;  3PET A;  1QRB A;  2VBK A;  4KH3 A;  4XR6 A;  2VJI A;  4Z03 A;  3WWG A;  3H09 A;  1OGO X;  1DBO A;  1TSP A;  4EW9 A;  2NZM A;  2NST A;  3B8Y A;  1QQ1 A;  2BX6 A;  4PMH A;  2VFM A;  4XM3 A;  2NT9 A;  3BH7 B;  3TH0 A;  1RWR A;  1EE6 A;  2F3L A;  2VFN A;  4URR A;  2YUH A;  3ML3 A;  3GQ7 A;  2BM5 A;  2VFQ A;  1O8D A;  1O8I A;  4U49 A;  4YZ0 A;  4XOR A;  3SQV A;  3JUR A;  4YZA A;  1TYW A;  2PEC A;  2B0R A;  4JRA C;  3N90 A;  3RIQ A;  4C2L A;  1K8F A;  1BN8 A;  4YEJ A;  4XOP A;  5JLV C;  3SY2 A;  1LLW A;  1LLZ A;  4OZY A;  3VST A;  4YDT A;  2VJJ A;  4NK8 A;  4W8R A;  1OGM X;  3LMW A;  4XLA A;  1O8G A;  1OFE A;  1GQ8 A;  2O0W A;  1OFM A;  4XOT A;  2O04 A;  1O8F A;  2QX3 A;  1K5C A;  1O8E A;  1WMR A;  2IOU G;  1QCX A;  2QZA A;  3GRH A;  2NTQ A;  2O1D A;  2X6Y A;  3NB2 A;  4MR0 A;  4OPW A;  5C1C A;  2BM4 A;  3VMW A;  1O8J A;  3B4N A;  3LYC A;  2O0V A;  4XL9 A;  3B90 A;  1OOC A;  2XTX A;  3GQ9 A;  3P4G A;  1IDJ A;  2ODL A;  4XLF A;  2INU A;  1TYX A;  1RU4 A;  1TYU A;  2XTW A;  2Z8G A;  3DU1 X;  4XNF A;  1EZG A;  2BM6 A;  4YZX A;  1JTA A;  4Z06 A;  3UW0 A;  3PSZ A;  3GQ8 A;  1K4Z A;  4YEI A;  2V5I A;  1O8M A;  4OJP A;  4V02 C;  2XT4 A;  2UVE A;  3AK5 A;  2NSP A;  4OJL A;  1KQ5 A;  3ZSC A;  4YFO A;  2X3H A;  1CZF A;  1O8K A;  1TYV A;  2J8I A;  2UVF A;  1O8H A;  3VSV A;  5JMC B;  1WXR A;  4XN0 A;  4W8S A;  4XON A;  1KCD A;  4HWV A; 
#chains in the Genus database with same CATH homology
 3JX8 A;  2IOU G;  1TSP A;  3LJY A;  4OJ6 A;  2G0Y A;  4OPW A;  1QQ1 A;  2BM4 A;  2BM7 A;  2BX6 A;  2VFM A;  3LYC A;  3SYJ A;  3BH6 B;  3BH7 B;  3TH0 A;  3P4G A;  1CLW A;  2F3L A;  2VFN A;  1QA3 A;  2YUH A;  1TYX A;  3ML3 A;  1DAB A;  1TYU A;  4OM9 A;  1QA2 A;  2BM5 A;  2VFQ A;  2BM6 A;  1K4Z A;  2V5I A;  3SZE A;  4OJP A;  1TYW A;  4V02 C;  2B0R A;  4JRA C;  3AK5 A;  2VFP A;  3N90 A;  3RIQ A;  1QRC A;  1KQ5 A;  4OJL A;  4OJO A;  2XC1 A;  1K8F A;  1HF2 A;  3N6Z A;  2J8I A;  1TYV A;  5JLV C;  2VFO A;  1WXR A;  5JMC B;  2W7Z A;  4OJ5 A;  3PET A;  1QA1 A;  1QRB A;  4KH3 A;  3H09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...