3PETA

Crystal structure of a putative adhesin (bf0245) from bacteroides fragilis nctc 9343 at 2.07 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
GIQPSKKLITRDYKVKEFNKIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKMKITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVGDVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSIKYKGSPTIKSLSKKGVGTIKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Cell adhesion
molecule keywords Putative adhesin
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3petA00
3LYCA 3PETA 3JX8A 3LJYA 4OPWA
chains in the Genus database with same CATH superfamily
1H80A 3EQNA 3VMVA 4U49A 1TYXA 1IDKA 1OFDA 1AIRA 2XTXA 3VSVA 2VBMA 3VMWA 1O8MA 3LJYA 2ODLA 2NTBA 2QYUA 3JURA 1K4ZA 1QA2A 2NSPA 4XKVA 3NAWA 3RIQA 5AMVA 2QXZA 1RMGA 3UW0A 1RWRA 2NTPA 4YZXA 4W8RA 2W7ZA 3WWGA 2O0WA 4YELA 2O17A 2NZMA 1O8LA 3P4GA 2XTYA 4OJLA 2EWEA 3LMWA 3BH6B 3SUCA 4YEIA 1OFMA 4OJ6A 4OJ5A 1CZFA 3T9GA 1O8EA 2BM6A 4OJOA 5DNSA 5C1EA 2PYGA 1QJVA 3BH7B 2BSPA 4YZQA 2O6WA 2QZAA 1O8DA 2INUA 2VBEA 2VJJA 3B8YA 4XLHA 4YC5A 3SQVA 4W8TA 3SZEA 2VFPA 2VBKA 1WMRA 1KTWA 4NK6A 2INVA 2VFQA 1QRBA 2J8IA 1L1IA 1JTAA 3FY3A 2PECA 2UVFA 2UVEA 2NSTA 4YCQA 5JMCB 4Z03A 4OJPA 1WXRA 1OGOX 2O1DA 1OGMX 4MR0A 4Z06A 3KRGA 3DU1X 4NK8A 5JLVC 1KCCA 2Z8GA 1QRCA 2YUHA 1O8FA 3ZPPA 1LM1A 2B0RA 1LLZA 1TYVA 2VFOA 4URRA 4MXNA 3B4NA 1QA1A 1TYWA 2NTQA 4XKWA 4XNFA 3PETA 1GQ8A 3JX8A 2XT4A 2X6WA 1HG8A 2X6XA 2BM7A 4XM3A 4YZAA 3VSTA 3VSUA 4HWVA 4XL9A 4XLCA 1DBOA 4YFOA 1NHCA 1O8KA 4XN3A 1EA0A 1K5CA 2F3LA 2J8KA 2XT2A 1X0CA 1VBLA 1IB4A 2BM5A 1HF2A 4AVZA 1QCXA 5C1CA 2NT9A 2VFNA 3GQAA 1PXZA 4XMYA 1QQ1A 3H09A 4PMHA 4XOPA 2O04A 2G0YA 2QY1A 4XLFA 4XORA 1KCDA 1K8FA 2NT6A 4W8SA 3ML3A 2BM4A 1IDJA 3EQOA 1O8GA 3GQ7A 2V5IA 4W8QA 1TYUA 1EZGA 1O8JA 1DABA 2XTWA 1XG2A 1BN8A 2O0VA 4OZZA 3PSSA 4OZYA 4XQFA 2QX3A 1DBGA 2XC1A 3LYCA 1TSPA 4YEJA 1BHEA 4I84A 1PLUA 1PE9A 2X3HA 4XLEA 4XONA 1O88A 1CLWA 3N6ZA 3SY2A 4KH3A 4XOTA 2PYHA 1O8HA 3NB2A 1OFLA 3SYJA 2X85A 4XR6A 1LLWA 2BX6A 4YZ0A 1JRGA 4YDTA 1IA5A 1RU4A 1O8IA 3B90A 2IOUG 4V02C 4JRAC 1EE6A 3N90A 3GQ9A 4OM9A 1QA3A 4XN0A 3TH0A 4U4BA 1OOCA 3ZSCA 3GQ8A 2VJIA 4EW9A 3PSZA 3AK5A 2VFMA 4C2LA 2X6YA 1OFEA 3GRHA 4XLAA 1KQ5A 2IQ7A 4Z05A 4OPWA
chains in the Genus database with same CATH topology
2BM7A 3BH7B 1TYXA 2XC1A 3LYCA 1TSPA 3SZEA 2VFPA 2F3LA 1CLWA 3LJYA 3N6ZA 4KH3A 3SYJA 2VFQA 2BM5A 1HF2A 1QRBA 2J8IA 1K4ZA 2BX6A 1QA2A 3RIQA 2VFNA 5JMCB 4OJPA 1WXRA 2W7ZA 5JLVC 1QQ1A 3H09A 2IOUG 4V02C 4JRAC 1QRCA 2YUHA 2G0YA 3N90A 1K8FA 2B0RA 3P4GA 4OM9A 1QA3A 1TYVA 3ML3A 2BM4A 4OJLA 3TH0A 2VFOA 1QA1A 3BH6B 1TYWA 2V5IA 1DABA 1TYUA 3AK5A 2VFMA 3PETA 4OJ6A 3JX8A 4OJ5A 1KQ5A 2BM6A 4OJOA 4OPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYC A;  3PET A;  3JX8 A;  3LJY A;  4OPW A; 
#chains in the Genus database with same CATH topology
 1H80 A;  3EQN A;  3VMV A;  4U49 A;  1TYX A;  1IDK A;  1OFD A;  1AIR A;  2XTX A;  3VSV A;  2VBM A;  3VMW A;  1O8M A;  3LJY A;  2ODL A;  2NTB A;  2QYU A;  3JUR A;  1K4Z A;  1QA2 A;  2NSP A;  4XKV A;  3NAW A;  3RIQ A;  5AMV A;  2QXZ A;  1RMG A;  3UW0 A;  1RWR A;  2NTP A;  4YZX A;  4W8R A;  2W7Z A;  3WWG A;  2O0W A;  4YEL A;  2O17 A;  2NZM A;  1O8L A;  3P4G A;  2XTY A;  4OJL A;  2EWE A;  3LMW A;  3BH6 B;  3SUC A;  4YEI A;  1OFM A;  4OJ6 A;  4OJ5 A;  1CZF A;  3T9G A;  1O8E A;  2BM6 A;  4OJO A;  5DNS A;  5C1E A;  2PYG A;  1QJV A;  3BH7 B;  2BSP A;  4YZQ A;  2O6W A;  2QZA A;  1O8D A;  2INU A;  2VBE A;  2VJJ A;  3B8Y A;  4XLH A;  4YC5 A;  3SQV A;  4W8T A;  3SZE A;  2VFP A;  2VBK A;  1WMR A;  1KTW A;  4NK6 A;  2INV A;  2VFQ A;  1QRB A;  2J8I A;  1L1I A;  1JTA A;  3FY3 A;  2PEC A;  2UVF A;  2UVE A;  2NST A;  4YCQ A;  5JMC B;  4Z03 A;  4OJP A;  1WXR A;  1OGO X;  2O1D A;  1OGM X;  4MR0 A;  4Z06 A;  3KRG A;  3DU1 X;  4NK8 A;  5JLV C;  1KCC A;  2Z8G A;  1QRC A;  2YUH A;  1O8F A;  3ZPP A;  1LM1 A;  2B0R A;  1LLZ A;  1TYV A;  2VFO A;  4URR A;  4MXN A;  3B4N A;  1QA1 A;  1TYW A;  2NTQ A;  4XKW A;  4XNF A;  3PET A;  1GQ8 A;  3JX8 A;  2XT4 A;  2X6W A;  1HG8 A;  2X6X A;  2BM7 A;  4XM3 A;  4YZA A;  3VST A;  3VSU A;  4HWV A;  4XL9 A;  4XLC A;  1DBO A;  4YFO A;  1NHC A;  1O8K A;  4XN3 A;  1EA0 A;  1K5C A;  2F3L A;  2J8K A;  2XT2 A;  1X0C A;  1VBL A;  1IB4 A;  2BM5 A;  1HF2 A;  4AVZ A;  1QCX A;  5C1C A;  2NT9 A;  2VFN A;  3GQA A;  1PXZ A;  4XMY A;  1QQ1 A;  3H09 A;  4PMH A;  4XOP A;  2O04 A;  2G0Y A;  2QY1 A;  4XLF A;  4XOR A;  1KCD A;  1K8F A;  2NT6 A;  4W8S A;  3ML3 A;  2BM4 A;  1IDJ A;  3EQO A;  1O8G A;  3GQ7 A;  2V5I A;  4W8Q A;  1TYU A;  1EZG A;  1O8J A;  1DAB A;  2XTW A;  1XG2 A;  1BN8 A;  2O0V A;  4OZZ A;  3PSS A;  4OZY A;  4XQF A;  2QX3 A;  1DBG A;  2XC1 A;  3LYC A;  1TSP A;  4YEJ A;  1BHE A;  4I84 A;  1PLU A;  1PE9 A;  2X3H A;  4XLE A;  4XON A;  1O88 A;  1CLW A;  3N6Z A;  3SY2 A;  4KH3 A;  4XOT A;  2PYH A;  1O8H A;  3NB2 A;  1OFL A;  3SYJ A;  2X85 A;  4XR6 A;  1LLW A;  2BX6 A;  4YZ0 A;  1JRG A;  4YDT A;  1IA5 A;  1RU4 A;  1O8I A;  3B90 A;  2IOU G;  4V02 C;  4JRA C;  1EE6 A;  3N90 A;  3GQ9 A;  4OM9 A;  1QA3 A;  4XN0 A;  3TH0 A;  4U4B A;  1OOC A;  3ZSC A;  3GQ8 A;  2VJI A;  4EW9 A;  3PSZ A;  3AK5 A;  2VFM A;  4C2L A;  2X6Y A;  1OFE A;  3GRH A;  4XLA A;  1KQ5 A;  2IQ7 A;  4Z05 A;  4OPW A; 
#chains in the Genus database with same CATH homology
 2BM7 A;  3BH7 B;  1TYX A;  2XC1 A;  3LYC A;  1TSP A;  3SZE A;  2VFP A;  2F3L A;  1CLW A;  3LJY A;  3N6Z A;  4KH3 A;  3SYJ A;  2VFQ A;  2BM5 A;  1HF2 A;  1QRB A;  2J8I A;  1K4Z A;  2BX6 A;  1QA2 A;  3RIQ A;  2VFN A;  5JMC B;  4OJP A;  1WXR A;  2W7Z A;  5JLV C;  1QQ1 A;  3H09 A;  2IOU G;  4V02 C;  4JRA C;  1QRC A;  2YUH A;  2G0Y A;  3N90 A;  1K8F A;  2B0R A;  3P4G A;  4OM9 A;  1QA3 A;  1TYV A;  3ML3 A;  2BM4 A;  4OJL A;  3TH0 A;  2VFO A;  1QA1 A;  3BH6 B;  1TYW A;  2V5I A;  1DAB A;  1TYU A;  3AK5 A;  2VFM A;  3PET A;  4OJ6 A;  3JX8 A;  4OJ5 A;  1KQ5 A;  2BM6 A;  4OJO A;  4OPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...