3PETA

Crystal structure of a putative adhesin (bf0245) from bacteroides fragilis nctc 9343 at 2.07 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
b'GIQPSKKLITRDYKVKEFNKIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKMKITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVGDVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSIKYKGSPTIKSLSKKGVGTIKNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative adhesin
publication title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Cell adhesion
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3petA00
3LJYA 3PETA 3LYCA 3JX8A 4OPWA
chains in the Genus database with same CATH superfamily
4XR6A 3ML3A 3NAWA 2BSPA 1IA5A 1EE6A 2O17A 1O88A 2X3HA 1L1IA 2QYUA 1O8DA 3ZSCA 3T9GA 2O0VA 2VFPA 4XLFA 2VBKA 1DABA 1LM1A 1OFDA 3SUCA 4XKVA 1RWRA 2O6WA 2VFMA 1O8FA 1IB4A 2X6YA 1O8LA 1KQ5A 4XOPA 2XTWA 3JURA 1OFLA 1OGOX 4Z06A 1GQ8A 5JMCB 4EW9A 2XTXA 2QZAA 1X0CA 1PLUA 2PYGA 4YC5A 4YZAA 2XC1A 3GQ9A 2ODLA 2VJJA 2J8IA 1TYUA 3GRHA 1IDJA 4OM9A 3JX8A 5AMVA 1EZGA 3WWGA 1QRBA 3GQ7A 2X6XA 1JTAA 2QXZA 2VBEA 2VBMA 3PSZA 2V5IA 4YZQA 1AIRA 4HWVA 4W8SA 2YUHA 4OJ6A 4URRA 1RMGA 3SZEA 1WXRA 4MXNA 2QY1A 2Z8GA 1JRGA 4YZXA 4PMHA 2VFQA 2INVA 2X85A 1VBLA 3RIQA 1XG2A 1LLWA 1O8EA 3GQAA 1O8IA 4NK6A 2BX6A 4OPWA 4JRAC 1O8JA 4YFOA 4C2LA 4XQFA 2UVEA 4I84A 4XM3A 1QCXA 2NTPA 4XNFA 1CZFA 1LLZA 4OJOA 4W8RA 3EQOA 4Z05A 2IQ7A 1QRCA 4U49A 2XTYA 2BM7A 3KRGA 3VSUA 1KTWA 2B0RA 1O8HA 3EQNA 1OOCA 1IDKA 2G0YA 4U4BA 4NK8A 4XN3A 3VSVA 4YEIA 1KCCA 2F3LA 4YEJA 4XKWA 3PETA 3VMVA 1O8GA 2XT4A 2BM6A 4XLHA 1PE9A 1RU4A 3AK5A 2VJIA 1QA1A 2EWEA 2O0WA 1K4ZA 3NB2A 4OJLA 1QJVA 5JLVC 2NT9A 4YDTA 2VFOA 2X6WA 3N90A 1HF2A 1QA3A 1K8FA 4V02C 4XORA 1OFMA 2J8KA 3TH0A 3VMWA 1BHEA 4OZYA 2XT2A 1TSPA 2BM4A 3BH6B 1K5CA 2NSPA 1DBOA 1OFEA 2NTBA 1O8MA 2W7ZA 3B8YA 4KH3A 4OJPA 5DNSA 1EA0A 5C1EA 5C1CA 1O8KA 2O04A 4XMYA 3LMWA 4XOTA 4XONA 1DBGA 3GQ8A 4OZZA 4XLAA 3DU1X 3SY2A 4AVZA 1TYXA 3N6ZA 1WMRA 4W8QA 3SQVA 1BN8A 4MR0A 1H80A 4YCQA 1KCDA 2PYHA 3B4NA 2UVFA 3BH7B 1PXZA 3LYCA 2IOUG 2BM5A 4W8TA 3B90A 3FY3A 1HG8A 4XLEA 3ZPPA 2NSTA 3H09A 3P4GA 2QX3A 4XL9A 4YELA 3LJYA 1TYWA 4Z03A 2NZMA 2INUA 1CLWA 1QA2A 2NT6A 2O1DA 1NHCA 4XLCA 4XN0A 1OGMX 3VSTA 4OJ5A 4YZ0A 3UW0A 1TYVA 1QQ1A 2NTQA 2PECA 2VFNA 3SYJA 3PSSA
chains in the Genus database with same CATH topology
2B0RA 3ML3A 2G0YA 2F3LA 2V5IA 3PETA 4OM9A 2VFPA 2YUHA 1TYXA 2BM6A 4OJ6A 3N6ZA 3AK5A 3SZEA 1QA1A 1WXRA 1K4ZA 4OJLA 3BH7B 1DABA 3LYCA 2IOUG 2BM5A 5JLVC 2VFQA 2VFMA 3RIQA 1KQ5A 3H09A 2VFOA 3P4GA 3N90A 1HF2A 1TYWA 3LJYA 1QA3A 1K8FA 4V02C 2W7ZA 1CLWA 5JMCB 3SYJA 1QA2A 2BX6A 4OPWA 4JRAC 3TH0A 4OJPA 2XC1A 4OJ5A 2J8IA 1TSPA 2BM4A 1TYUA 3BH6B 1TYVA 1QQ1A 4OJOA 2VFNA 1QRCA 3JX8A 2BM7A 4KH3A 1QRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJY A;  3PET A;  3LYC A;  3JX8 A;  4OPW A; 
#chains in the Genus database with same CATH topology
 4XR6 A;  3ML3 A;  3NAW A;  2BSP A;  1IA5 A;  1EE6 A;  2O17 A;  1O88 A;  2X3H A;  1L1I A;  2QYU A;  1O8D A;  3ZSC A;  3T9G A;  2O0V A;  2VFP A;  4XLF A;  2VBK A;  1DAB A;  1LM1 A;  1OFD A;  3SUC A;  4XKV A;  1RWR A;  2O6W A;  2VFM A;  1O8F A;  1IB4 A;  2X6Y A;  1O8L A;  1KQ5 A;  4XOP A;  2XTW A;  3JUR A;  1OFL A;  1OGO X;  4Z06 A;  1GQ8 A;  5JMC B;  4EW9 A;  2XTX A;  2QZA A;  1X0C A;  1PLU A;  2PYG A;  4YC5 A;  4YZA A;  2XC1 A;  3GQ9 A;  2ODL A;  2VJJ A;  2J8I A;  1TYU A;  3GRH A;  1IDJ A;  4OM9 A;  3JX8 A;  5AMV A;  1EZG A;  3WWG A;  1QRB A;  3GQ7 A;  2X6X A;  1JTA A;  2QXZ A;  2VBE A;  2VBM A;  3PSZ A;  2V5I A;  4YZQ A;  1AIR A;  4HWV A;  4W8S A;  2YUH A;  4OJ6 A;  4URR A;  1RMG A;  3SZE A;  1WXR A;  4MXN A;  2QY1 A;  2Z8G A;  1JRG A;  4YZX A;  4PMH A;  2VFQ A;  2INV A;  2X85 A;  1VBL A;  3RIQ A;  1XG2 A;  1LLW A;  1O8E A;  3GQA A;  1O8I A;  4NK6 A;  2BX6 A;  4OPW A;  4JRA C;  1O8J A;  4YFO A;  4C2L A;  4XQF A;  2UVE A;  4I84 A;  4XM3 A;  1QCX A;  2NTP A;  4XNF A;  1CZF A;  1LLZ A;  4OJO A;  4W8R A;  3EQO A;  4Z05 A;  2IQ7 A;  1QRC A;  4U49 A;  2XTY A;  2BM7 A;  3KRG A;  3VSU A;  1KTW A;  2B0R A;  1O8H A;  3EQN A;  1OOC A;  1IDK A;  2G0Y A;  4U4B A;  4NK8 A;  4XN3 A;  3VSV A;  4YEI A;  1KCC A;  2F3L A;  4YEJ A;  4XKW A;  3PET A;  3VMV A;  1O8G A;  2XT4 A;  2BM6 A;  4XLH A;  1PE9 A;  1RU4 A;  3AK5 A;  2VJI A;  1QA1 A;  2EWE A;  2O0W A;  1K4Z A;  3NB2 A;  4OJL A;  1QJV A;  5JLV C;  2NT9 A;  4YDT A;  2VFO A;  2X6W A;  3N90 A;  1HF2 A;  1QA3 A;  1K8F A;  4V02 C;  4XOR A;  1OFM A;  2J8K A;  3TH0 A;  3VMW A;  1BHE A;  4OZY A;  2XT2 A;  1TSP A;  2BM4 A;  3BH6 B;  1K5C A;  2NSP A;  1DBO A;  1OFE A;  2NTB A;  1O8M A;  2W7Z A;  3B8Y A;  4KH3 A;  4OJP A;  5DNS A;  1EA0 A;  5C1E A;  5C1C A;  1O8K A;  2O04 A;  4XMY A;  3LMW A;  4XOT A;  4XON A;  1DBG A;  3GQ8 A;  4OZZ A;  4XLA A;  3DU1 X;  3SY2 A;  4AVZ A;  1TYX A;  3N6Z A;  1WMR A;  4W8Q A;  3SQV A;  1BN8 A;  4MR0 A;  1H80 A;  4YCQ A;  1KCD A;  2PYH A;  3B4N A;  2UVF A;  3BH7 B;  1PXZ A;  3LYC A;  2IOU G;  2BM5 A;  4W8T A;  3B90 A;  3FY3 A;  1HG8 A;  4XLE A;  3ZPP A;  2NST A;  3H09 A;  3P4G A;  2QX3 A;  4XL9 A;  4YEL A;  3LJY A;  1TYW A;  4Z03 A;  2NZM A;  2INU A;  1CLW A;  1QA2 A;  2NT6 A;  2O1D A;  1NHC A;  4XLC A;  4XN0 A;  1OGM X;  3VST A;  4OJ5 A;  4YZ0 A;  3UW0 A;  1TYV A;  1QQ1 A;  2NTQ A;  2PEC A;  2VFN A;  3SYJ A;  3PSS A; 
#chains in the Genus database with same CATH homology
 2B0R A;  3ML3 A;  2G0Y A;  2F3L A;  2V5I A;  3PET A;  4OM9 A;  2VFP A;  2YUH A;  1TYX A;  2BM6 A;  4OJ6 A;  3N6Z A;  3AK5 A;  3SZE A;  1QA1 A;  1WXR A;  1K4Z A;  4OJL A;  3BH7 B;  1DAB A;  3LYC A;  2IOU G;  2BM5 A;  5JLV C;  2VFQ A;  2VFM A;  3RIQ A;  1KQ5 A;  3H09 A;  2VFO A;  3P4G A;  3N90 A;  1HF2 A;  1TYW A;  3LJY A;  1QA3 A;  1K8F A;  4V02 C;  2W7Z A;  1CLW A;  5JMC B;  3SYJ A;  1QA2 A;  2BX6 A;  4OPW A;  4JRA C;  3TH0 A;  4OJP A;  2XC1 A;  4OJ5 A;  2J8I A;  1TSP A;  2BM4 A;  1TYU A;  3BH6 B;  1TYV A;  1QQ1 A;  4OJO A;  2VFN A;  1QRC A;  3JX8 A;  2BM7 A;  4KH3 A;  1QRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...