3PETA

Crystal structure of a putative adhesin (bf0245) from bacteroides fragilis nctc 9343 at 2.07 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
GIQPSKKLITRDYKVKEFNKIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKMKITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVGDVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSIKYKGSPTIKSLSKKGVGTIKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative adhesin
publication title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Cell adhesion
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3petA00
3JX8A 4OPWA 3LYCA 3LJYA 3PETA
chains in the Genus database with same CATH superfamily
2O0WA 4NK8A 4W8RA 1IDJA 2BX6A 4XOTA 4Z06A 3VMWA 3EQOA 2VFOA 4JRAC 1L1IA 4XLAA 5C1CA 1OFMA 2J8IA 3GQ7A 2VFMA 2X6XA 1QRBA 1RWRA 2B0RA 2F3LA 2PYHA 1KTWA 3JX8A 3N6ZA 1LLZA 2BM4A 4MXNA 4W8TA 3TH0A 2NSPA 1RU4A 2NTPA 2VBKA 2UVFA 1AIRA 1JTAA 2BSPA 2O04A 4XLHA 1K5CA 4W8QA 3GQ8A 4OZZA 2INUA 2QXZA 3SZEA 1KCDA 2QY1A 4XQFA 4XN0A 1QRCA 4PMHA 4EW9A 2INVA 4XM3A 1QCXA 4YEJA 2G0YA 1BHEA 1RMGA 4XORA 4Z03A 2QX3A 1TYXA 1O8GA 1QA3A 2IOUG 1VBLA 4YZQA 1OGOX 1JRGA 4C2LA 4OM9A 1TYWA 3VMVA 2VFNA 2NTBA 2VBEA 1BN8A 2W7ZA 4KH3A 1DBOA 1OFEA 1K8FA 5C1EA 2XTYA 1WMRA 4YC5A 3VSVA 3PSSA 3SY2A 2EWEA 2IQ7A 1OFDA 3FY3A 4V02C 1O88A 3GRHA 1EE6A 1PXZA 2XTXA 4NK6A 4XLEA 5AMVA 1LLWA 4I84A 4YZ0A 1CLWA 2YUHA 4MR0A 4U49A 3BH7B 4OJ5A 4YCQA 2BM6A 3SUCA 2V5IA 3B90A 3ZPPA 4YZXA 4Z05A 1PLUA 2NSTA 2NT6A 1QA1A 3H09A 1O8IA 3LJYA 1KQ5A 3PSZA 1TYVA 2X6YA 2O17A 1DBGA 3N90A 1PE9A 4OJOA 1CZFA 1O8MA 4XONA 5JMCB 2VFPA 1XG2A 3RIQA 4XLFA 4HWVA 1HG8A 3VSUA 1DABA 1X0CA 2BM7A 3NAWA 3P4GA 1O8JA 1O8DA 2XC1A 3BH6B 3NB2A 2O0VA 1KCCA 2XT4A 3UW0A 5DNSA 2VBMA 2X85A 4YELA 1IDKA 1NHCA 1GQ8A 4XNFA 4OPWA 4XN3A 3DU1X 3LMWA 1TYUA 2X6WA 1QQ1A 3JURA 1K4ZA 4U4BA 3GQAA 1IA5A 3ZSCA 1HF2A 1O8LA 2O6WA 2VJIA 3LYCA 2VFQA 4XMYA 4YFOA 4YDTA 2QYUA 2XTWA 1EZGA 2PECA 3SYJA 1EA0A 1H80A 3SQVA 2PYGA 1O8EA 1QA2A 2J8KA 2XT2A 3WWGA 2O1DA 1O8HA 2X3HA 2NTQA 4OJPA 3B8YA 1TSPA 4XKVA 2VJJA 5JLVC 2BM5A 4OJLA 1OOCA 4URRA 4XKWA 3B4NA 3PETA 1LM1A 1O8KA 4XR6A 2UVEA 4XL9A 1O8FA 3T9GA 2NZMA 2QZAA 2ODLA 3AK5A 2NT9A 3KRGA 4YEIA 1QJVA 3EQNA 3ML3A 3GQ9A 4XOPA 1IB4A 4OZYA 1WXRA 2Z8GA 4YZAA 4W8SA 1OGMX 1OFLA 4XLCA 4OJ6A 4AVZA 3VSTA
chains in the Genus database with same CATH topology
2VFPA 1TYWA 4OM9A 2VFNA 2W7ZA 3RIQA 2BX6A 1QA2A 2VFOA 4JRAC 4KH3A 1DABA 4OJPA 2J8IA 1TSPA 1K8FA 2VFMA 2BM7A 1QRBA 5JLVC 2B0RA 2BM5A 2F3LA 3P4GA 2XC1A 3JX8A 3BH6B 3N6ZA 4OJLA 2BM4A 3PETA 3TH0A 4V02C 1QA3A 3AK5A 1CLWA 2YUHA 4OPWA 3BH7B 4OJ5A 3SZEA 3ML3A 2BM6A 1TYUA 2V5IA 1QQ1A 1QRCA 1K4ZA 1WXRA 1QA1A 1HF2A 3H09A 2G0YA 3LYCA 2VFQA 3LJYA 1TYXA 1KQ5A 4OJ6A 1TYVA 4OJOA 3N90A 2IOUG 3SYJA 5JMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  4OPW A;  3LYC A;  3LJY A;  3PET A; 
#chains in the Genus database with same CATH topology
 2O0W A;  4NK8 A;  4W8R A;  1IDJ A;  2BX6 A;  4XOT A;  4Z06 A;  3VMW A;  3EQO A;  2VFO A;  4JRA C;  1L1I A;  4XLA A;  5C1C A;  1OFM A;  2J8I A;  3GQ7 A;  2VFM A;  2X6X A;  1QRB A;  1RWR A;  2B0R A;  2F3L A;  2PYH A;  1KTW A;  3JX8 A;  3N6Z A;  1LLZ A;  2BM4 A;  4MXN A;  4W8T A;  3TH0 A;  2NSP A;  1RU4 A;  2NTP A;  2VBK A;  2UVF A;  1AIR A;  1JTA A;  2BSP A;  2O04 A;  4XLH A;  1K5C A;  4W8Q A;  3GQ8 A;  4OZZ A;  2INU A;  2QXZ A;  3SZE A;  1KCD A;  2QY1 A;  4XQF A;  4XN0 A;  1QRC A;  4PMH A;  4EW9 A;  2INV A;  4XM3 A;  1QCX A;  4YEJ A;  2G0Y A;  1BHE A;  1RMG A;  4XOR A;  4Z03 A;  2QX3 A;  1TYX A;  1O8G A;  1QA3 A;  2IOU G;  1VBL A;  4YZQ A;  1OGO X;  1JRG A;  4C2L A;  4OM9 A;  1TYW A;  3VMV A;  2VFN A;  2NTB A;  2VBE A;  1BN8 A;  2W7Z A;  4KH3 A;  1DBO A;  1OFE A;  1K8F A;  5C1E A;  2XTY A;  1WMR A;  4YC5 A;  3VSV A;  3PSS A;  3SY2 A;  2EWE A;  2IQ7 A;  1OFD A;  3FY3 A;  4V02 C;  1O88 A;  3GRH A;  1EE6 A;  1PXZ A;  2XTX A;  4NK6 A;  4XLE A;  5AMV A;  1LLW A;  4I84 A;  4YZ0 A;  1CLW A;  2YUH A;  4MR0 A;  4U49 A;  3BH7 B;  4OJ5 A;  4YCQ A;  2BM6 A;  3SUC A;  2V5I A;  3B90 A;  3ZPP A;  4YZX A;  4Z05 A;  1PLU A;  2NST A;  2NT6 A;  1QA1 A;  3H09 A;  1O8I A;  3LJY A;  1KQ5 A;  3PSZ A;  1TYV A;  2X6Y A;  2O17 A;  1DBG A;  3N90 A;  1PE9 A;  4OJO A;  1CZF A;  1O8M A;  4XON A;  5JMC B;  2VFP A;  1XG2 A;  3RIQ A;  4XLF A;  4HWV A;  1HG8 A;  3VSU A;  1DAB A;  1X0C A;  2BM7 A;  3NAW A;  3P4G A;  1O8J A;  1O8D A;  2XC1 A;  3BH6 B;  3NB2 A;  2O0V A;  1KCC A;  2XT4 A;  3UW0 A;  5DNS A;  2VBM A;  2X85 A;  4YEL A;  1IDK A;  1NHC A;  1GQ8 A;  4XNF A;  4OPW A;  4XN3 A;  3DU1 X;  3LMW A;  1TYU A;  2X6W A;  1QQ1 A;  3JUR A;  1K4Z A;  4U4B A;  3GQA A;  1IA5 A;  3ZSC A;  1HF2 A;  1O8L A;  2O6W A;  2VJI A;  3LYC A;  2VFQ A;  4XMY A;  4YFO A;  4YDT A;  2QYU A;  2XTW A;  1EZG A;  2PEC A;  3SYJ A;  1EA0 A;  1H80 A;  3SQV A;  2PYG A;  1O8E A;  1QA2 A;  2J8K A;  2XT2 A;  3WWG A;  2O1D A;  1O8H A;  2X3H A;  2NTQ A;  4OJP A;  3B8Y A;  1TSP A;  4XKV A;  2VJJ A;  5JLV C;  2BM5 A;  4OJL A;  1OOC A;  4URR A;  4XKW A;  3B4N A;  3PET A;  1LM1 A;  1O8K A;  4XR6 A;  2UVE A;  4XL9 A;  1O8F A;  3T9G A;  2NZM A;  2QZA A;  2ODL A;  3AK5 A;  2NT9 A;  3KRG A;  4YEI A;  1QJV A;  3EQN A;  3ML3 A;  3GQ9 A;  4XOP A;  1IB4 A;  4OZY A;  1WXR A;  2Z8G A;  4YZA A;  4W8S A;  1OGM X;  1OFL A;  4XLC A;  4OJ6 A;  4AVZ A;  3VST A; 
#chains in the Genus database with same CATH homology
 2VFP A;  1TYW A;  4OM9 A;  2VFN A;  2W7Z A;  3RIQ A;  2BX6 A;  1QA2 A;  2VFO A;  4JRA C;  4KH3 A;  1DAB A;  4OJP A;  2J8I A;  1TSP A;  1K8F A;  2VFM A;  2BM7 A;  1QRB A;  5JLV C;  2B0R A;  2BM5 A;  2F3L A;  3P4G A;  2XC1 A;  3JX8 A;  3BH6 B;  3N6Z A;  4OJL A;  2BM4 A;  3PET A;  3TH0 A;  4V02 C;  1QA3 A;  3AK5 A;  1CLW A;  2YUH A;  4OPW A;  3BH7 B;  4OJ5 A;  3SZE A;  3ML3 A;  2BM6 A;  1TYU A;  2V5I A;  1QQ1 A;  1QRC A;  1K4Z A;  1WXR A;  1QA1 A;  1HF2 A;  3H09 A;  2G0Y A;  3LYC A;  2VFQ A;  3LJY A;  1TYX A;  1KQ5 A;  4OJ6 A;  1TYV A;  4OJO A;  3N90 A;  2IOU G;  3SYJ A;  5JMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...