3PETA

Crystal structure of a putative adhesin (bf0245) from bacteroides fragilis nctc 9343 at 2.07 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
218
structure length
218
Chain Sequence
GIQPSKKLITRDYKVKEFNKIDAGTVGNIYYTQSTDGKTDLQIYGPDNIVALIQVAVKDNTLFLSIDKSKKVRNFKKMKITITSPTLNGISFKGVGDVHIENGLTTDNLDIESKGVGNVDIQSLTCQKLNVQSMGVGDVKLEGTAQIAALHSKGVGNIEAGNLRANAVEASSQGVGDITCNATESIDAAVRGVGSIKYKGSPTIKSLSKKGVGTIKNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Cell adhesion
molecule keywords Putative adhesin
total genus 76
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3petA00
4OPWA 3PETA 3LJYA 3LYCA 3JX8A
chains in the Genus database with same CATH superfamily
2J8KA 2INVA 2NTPA 1HF2A 1OGOX 2QX3A 3BH7B 2VFOA 2QYUA 1IDJA 3EQOA 2XTWA 2UVFA 3GQ8A 1RWRA 1AIRA 2VFNA 3P4GA 1EZGA 2VJJA 1QJVA 3LMWA 1JTAA 2IOUG 4NK6A 4PMHA 1IDKA 1JRGA 2O1DA 3VSTA 2O04A 4EW9A 3GRHA 4YC5A 2EWEA 4NK8A 1PXZA 4OPWA 1O8JA 1LM1A 1O8LA 3BH6B 1O8HA 2J8IA 1PE9A 2NZMA 2O6WA 2XT4A 3N6ZA 4Z06A 2Z8GA 3B8YA 1QA3A 1TYVA 2ODLA 1QRCA 4XORA 1KQ5A 3H09A 3TH0A 1OGMX 3PETA 1OOCA 2X85A 4AVZA 1NHCA 2QXZA 2X3HA 3PSSA 1EA0A 1KCCA 1CZFA 3NAWA 1QQ1A 1VBLA 2VBKA 1L1IA 2PECA 2VFQA 2BX6A 2VFMA 2W7ZA 3EQNA 1RU4A 2BM7A 3GQAA 4XONA 4XR6A 4KH3A 4YCQA 1WXRA 3VMWA 1HG8A 1WMRA 4XN0A 1TYXA 2F3LA 1OFMA 4YDTA 3FY3A 2NSPA 1O8DA 1QRBA 2B0RA 1LLZA 1O8FA 2VFPA 1XG2A 1K4ZA 1EE6A 4Z03A 4MXNA 1O8IA 3VMVA 4YZAA 1IA5A 4XLHA 3N90A 3SZEA 1LLWA 5C1CA 4XKVA 4YZQA 3VSUA 2O0VA 4XNFA 2VBEA 4XLAA 3AK5A 2QZAA 3PSZA 4XLCA 2X6XA 3JX8A 3ML3A 3B4NA 4OZYA 4C2LA 4XQFA 3KRGA 5C1EA 2O0WA 1GQ8A 2NT6A 4JRAC 4XLFA 1BHEA 5DNSA 3UW0A 1CLWA 1RMGA 4OJ6A 2G0YA 1DBGA 4OJ5A 1QA1A 3SY2A 3T9GA 3B90A 3DU1X 2X6WA 1OFLA 4YZXA 3RIQA 1TYUA 2BM5A 2BM4A 3WWGA 1H80A 1OFDA 2PYGA 4MR0A 1QCXA 2VBMA 4HWVA 4I84A 2XTXA 2YUHA 3LJYA 4OZZA 4U4BA 1O8EA 4YFOA 1TSPA 1DABA 3SYJA 1DBOA 2INUA 3ZPPA 2X6YA 4U49A 1KTWA 1QA2A 4YEJA 5JLVC 3GQ7A 2XC1A 2NTBA 2VJIA 2XT2A 4YELA 4XLEA 3GQ9A 1O88A 5AMVA 4Z05A 4YZ0A 3VSVA 4V02C 1IB4A 3JURA 3ZSCA 2NT9A 1O8GA 4W8QA 3NB2A 1KCDA 4XOTA 4OM9A 3SUCA 4W8SA 4OJLA 1X0CA 1K8FA 4XN3A 1O8MA 4W8RA 1BN8A 4XMYA 1TYWA 4URRA 4XM3A 2QY1A 2V5IA 4OJOA 2XTYA 2UVEA 4W8TA 4OJPA 3SQVA 4XKWA 4YEIA 5JMCB 2IQ7A 3LYCA 4XOPA 2NTQA 2O17A 1O8KA 1K5CA 2BSPA 4XL9A 1PLUA 2NSTA 2PYHA 2BM6A 1OFEA
chains in the Genus database with same CATH topology
5JLVC 3JX8A 2XC1A 1HF2A 3BH7B 2VFOA 4JRAC 1QA2A 1QQ1A 4V02C 1CLWA 2VFQA 2BX6A 2VFMA 2W7ZA 2G0YA 4OJ6A 2BM7A 2VFNA 4OJ5A 1QA1A 3P4GA 4KH3A 1WXRA 4OM9A 2IOUG 3RIQA 1TYUA 2BM5A 1TYXA 4OJLA 2F3LA 2BM4A 1K8FA 4OPWA 1QRBA 1TYWA 2B0RA 2V5IA 2VFPA 3BH6B 4OJOA 1K4ZA 2J8IA 2YUHA 3LJYA 4OJPA 5JMCB 3N6ZA 3LYCA 1TSPA 3N90A 1DABA 3SZEA 1QA3A 1TYVA 3SYJA 1KQ5A 3AK5A 3H09A 3TH0A 3PETA 2BM6A 3ML3A 1QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPW A;  3PET A;  3LJY A;  3LYC A;  3JX8 A; 
#chains in the Genus database with same CATH topology
 2J8K A;  2INV A;  2NTP A;  1HF2 A;  1OGO X;  2QX3 A;  3BH7 B;  2VFO A;  2QYU A;  1IDJ A;  3EQO A;  2XTW A;  2UVF A;  3GQ8 A;  1RWR A;  1AIR A;  2VFN A;  3P4G A;  1EZG A;  2VJJ A;  1QJV A;  3LMW A;  1JTA A;  2IOU G;  4NK6 A;  4PMH A;  1IDK A;  1JRG A;  2O1D A;  3VST A;  2O04 A;  4EW9 A;  3GRH A;  4YC5 A;  2EWE A;  4NK8 A;  1PXZ A;  4OPW A;  1O8J A;  1LM1 A;  1O8L A;  3BH6 B;  1O8H A;  2J8I A;  1PE9 A;  2NZM A;  2O6W A;  2XT4 A;  3N6Z A;  4Z06 A;  2Z8G A;  3B8Y A;  1QA3 A;  1TYV A;  2ODL A;  1QRC A;  4XOR A;  1KQ5 A;  3H09 A;  3TH0 A;  1OGM X;  3PET A;  1OOC A;  2X85 A;  4AVZ A;  1NHC A;  2QXZ A;  2X3H A;  3PSS A;  1EA0 A;  1KCC A;  1CZF A;  3NAW A;  1QQ1 A;  1VBL A;  2VBK A;  1L1I A;  2PEC A;  2VFQ A;  2BX6 A;  2VFM A;  2W7Z A;  3EQN A;  1RU4 A;  2BM7 A;  3GQA A;  4XON A;  4XR6 A;  4KH3 A;  4YCQ A;  1WXR A;  3VMW A;  1HG8 A;  1WMR A;  4XN0 A;  1TYX A;  2F3L A;  1OFM A;  4YDT A;  3FY3 A;  2NSP A;  1O8D A;  1QRB A;  2B0R A;  1LLZ A;  1O8F A;  2VFP A;  1XG2 A;  1K4Z A;  1EE6 A;  4Z03 A;  4MXN A;  1O8I A;  3VMV A;  4YZA A;  1IA5 A;  4XLH A;  3N90 A;  3SZE A;  1LLW A;  5C1C A;  4XKV A;  4YZQ A;  3VSU A;  2O0V A;  4XNF A;  2VBE A;  4XLA A;  3AK5 A;  2QZA A;  3PSZ A;  4XLC A;  2X6X A;  3JX8 A;  3ML3 A;  3B4N A;  4OZY A;  4C2L A;  4XQF A;  3KRG A;  5C1E A;  2O0W A;  1GQ8 A;  2NT6 A;  4JRA C;  4XLF A;  1BHE A;  5DNS A;  3UW0 A;  1CLW A;  1RMG A;  4OJ6 A;  2G0Y A;  1DBG A;  4OJ5 A;  1QA1 A;  3SY2 A;  3T9G A;  3B90 A;  3DU1 X;  2X6W A;  1OFL A;  4YZX A;  3RIQ A;  1TYU A;  2BM5 A;  2BM4 A;  3WWG A;  1H80 A;  1OFD A;  2PYG A;  4MR0 A;  1QCX A;  2VBM A;  4HWV A;  4I84 A;  2XTX A;  2YUH A;  3LJY A;  4OZZ A;  4U4B A;  1O8E A;  4YFO A;  1TSP A;  1DAB A;  3SYJ A;  1DBO A;  2INU A;  3ZPP A;  2X6Y A;  4U49 A;  1KTW A;  1QA2 A;  4YEJ A;  5JLV C;  3GQ7 A;  2XC1 A;  2NTB A;  2VJI A;  2XT2 A;  4YEL A;  4XLE A;  3GQ9 A;  1O88 A;  5AMV A;  4Z05 A;  4YZ0 A;  3VSV A;  4V02 C;  1IB4 A;  3JUR A;  3ZSC A;  2NT9 A;  1O8G A;  4W8Q A;  3NB2 A;  1KCD A;  4XOT A;  4OM9 A;  3SUC A;  4W8S A;  4OJL A;  1X0C A;  1K8F A;  4XN3 A;  1O8M A;  4W8R A;  1BN8 A;  4XMY A;  1TYW A;  4URR A;  4XM3 A;  2QY1 A;  2V5I A;  4OJO A;  2XTY A;  2UVE A;  4W8T A;  4OJP A;  3SQV A;  4XKW A;  4YEI A;  5JMC B;  2IQ7 A;  3LYC A;  4XOP A;  2NTQ A;  2O17 A;  1O8K A;  1K5C A;  2BSP A;  4XL9 A;  1PLU A;  2NST A;  2PYH A;  2BM6 A;  1OFE A; 
#chains in the Genus database with same CATH homology
 5JLV C;  3JX8 A;  2XC1 A;  1HF2 A;  3BH7 B;  2VFO A;  4JRA C;  1QA2 A;  1QQ1 A;  4V02 C;  1CLW A;  2VFQ A;  2BX6 A;  2VFM A;  2W7Z A;  2G0Y A;  4OJ6 A;  2BM7 A;  2VFN A;  4OJ5 A;  1QA1 A;  3P4G A;  4KH3 A;  1WXR A;  4OM9 A;  2IOU G;  3RIQ A;  1TYU A;  2BM5 A;  1TYX A;  4OJL A;  2F3L A;  2BM4 A;  1K8F A;  4OPW A;  1QRB A;  1TYW A;  2B0R A;  2V5I A;  2VFP A;  3BH6 B;  4OJO A;  1K4Z A;  2J8I A;  2YUH A;  3LJY A;  4OJP A;  5JMC B;  3N6Z A;  3LYC A;  1TSP A;  3N90 A;  1DAB A;  3SZE A;  1QA3 A;  1TYV A;  3SYJ A;  1KQ5 A;  3AK5 A;  3H09 A;  3TH0 A;  3PET A;  2BM6 A;  3ML3 A;  1QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...