4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
3GQ9A 2O0WA 3T9GA 4MXNA 4U49A 4XL9A 4OJ5A 4NK8A 3VMVA 4C2LA 4W8QA 3SUCA 4YZAA 4XLHA 2INUA 4XOTA 2O17A 1O8GA 3VMWA 3VSTA 2BSPA 2Z8GA 2O04A 2VJIA 1H80A 2PYGA 1RMGA 4W8RA 1GQ8A 3JURA 3B4NA 4XLCA 4YZ0A 1O8LA 3VSVA 1X0CA 1BN8A 4W8SA 1HG8A 1O8IA 1WMRA 5C1EA 3KRGA 4OJLA 3B8YA 2PYHA 4OZYA 3EQNA 4OJPA 4NK6A 1O88A 1IDJA 4AVZA 1PXZA 4U4BA 1DBGA 4Z05A 4XOPA 2NZMA 4YZQA 3GQ7A 1IDKA 4EW9A 2NT9A 3VSUA 4XN0A 4MR0A 1CZFA 4I84A 4XKVA 2QXZA 3GQ8A 3EQOA 3ZPPA 1O8DA 2PECA 4XLFA 1BHEA 4XONA 1QJVA 2NSTA 2O0VA 4XKWA 2VBEA 4Z03A 1AIRA 1OFLA 1O8MA 2INVA 2UVFA 4Z06A 5C1CA 1RWRA 1NHCA 4XORA 4XNFA 4PMHA 2NSPA 4XM3A 1OFMA 1EE6A 4OJ6A 2QX3A 4YZXA 4XLEA 1O8EA 1O8HA 4URRA 1PE9A 1RU4A 3UW0A 2IQ7A 2VBKA 1OGOX 2QY1A 4OZZA 1KCCA 3FY3A 1IB4A 4HWVA 1PLUA 3GQAA 1XG2A 2VBMA 4OJOA 2X3HA 1KCDA 5AMVA 4XLAA 4W8TA 1OOCA 4XQFA 2X6XA 2NTBA 3GRHA 1OGMX 2EWEA 1IA5A 3LMWA 3B90A 1JRGA 1QCXA 1KTWA 1VBLA 2X6YA 2NTPA 1JTAA 1O8JA 2ODLA 2X6WA 4YELA 3ZSCA 2VJJA 4XR6A 1DBOA 4XMYA 3WWGA 2NT6A 2UVEA 1O8FA 2NTQA 2O1DA 2X85A 1K5CA 4YEJA 4XN3A 1O8KA
chains in the Genus database with same CATH superfamily
1OB0A 3PSIA 2PG4A 3DKXA 1E64A 2R7WA 1QA3A 1UD5A 5IOYA 3QPSA 5E17F 1N78A 3WU1B 1E62A 3G05A 2M4GA 3WTZA 4A2UA 1T0FC 3JREA 3FPKA 4L5EA 1MJ9A 5E79C 5BNGA 1BX1A 2K3FA 3QQAA 1SD4A 4L9NA 4YAUA 4HNTA 1S3JA 1HLVA 4X07A 2AHQA 3CC2B 2ZXIA 2A3SA 3KFWX 5CPRB 3C2HA 4YFKF 1LKXA 2H94A 2HDDA 5KAFC 3FJOA 2WADA 3UKGA 4UV9A 1BIAA 1XGNA 2LSOA 1LUJB 1N77A 4ROXA 3W2FA 4PUSA 2X1EA 2VODA 1XCBA 1YJWB 4CDGA 4F52A 1NBMA 1NTCA 1WZ2A 1YLOA 1FMVA 2LYCA 3I71A 3BPVA 2A68F 3R0AA 1V5FA 4A5MA 1B72B 3ZZTA 3J81k 5GP9A 2DK5A 4BU2A 4CYCA 4A3KJ 1CF7B 4IRIA 1N8RD 1VJSA 5J4VA 1QU3A 2HQRA 1TVCA 3B8YA 2ZL5A 4O5VA 5BOXA 2HI3A 3S93A 4OINF 3JCUC 1IDZA 1XB2A 4EH1A 2XZOA 2DK8A 4UHTA 2XF5A 3EUAA 3LA7A 5EJCA 1KK2A 1OYYA 3FISA 3OYHA 4NBQA 3OP1A 2VNHA 1K6YA 2H8RA 4XIDA 2JVHA 4ZCMA 2VI6A 2Z1DA 5FKOA 3ZGKA 4D1QA 3COAC 4A3JJ 2VXZA 3D5RC 1UMQA 2FXAA 4LB5A 1V5GA 4P9UA 2L3DA 5D6EA 4B48A 1X1BA 1QGAA 1MNDA 4YIRX 5HLGA 3PFIA 4M6XA 3C3WA 3LYCA 3K4CA 5M3FJ 2JPCA 1T8IA 1MZBA 1JXSA 2NVYJ 2V26A 3KZYA 3DV8A 5C1CA 1A5JA 2CQNA 1P4WA 1QGPA 5J3LA 2HOTA 4BY1J 1E3XA 1VF7A 3C2GA 3TP3A 1ITYA 4M3FA 5GAGJ 1I1SA 5BSXA 4BJ5C 5JBQA 2L02A 5FFZA 4Z2YA 1T6ZA 3HB9A 1MABA 2X8KA 1RPWA 4XRFA 4GFBA 4FX0A 3WE2A 1IJWC 2JTVA 2QYUA 4M1KA 3WNDA 3KP7A 3GTMJ 5F64A 1APLC 3PJRA 3R6KA 4ZYAA 4KKTA 1FX7A 2XC7A 4CO8A 1FP1D 1BLIA 3ZZUA 3DEWA 5FROA 1OR7C 4MGRA 5DV5A 1YITI 1KK0A 1JT6A 4JX4A 2ADUA 2LKXA 1NK2P 1YJNB 4AIJA 2EZIA 1JRGA 2H09A 2DBBA 3F22A 1YJNI 1OCCH 4CZZA 2HCJB 1UD2A 1XG1A 3JRIA 3ZQCA 2DOAA 1UJ8A 1YX2A 4RB1A 2V6EA 3HEFA 1IXSB 4BNCA 4IHTA 1P7IA 1R71A 2NTQA 4N9IA 1EFTA 4HSTA 4ZV4A 2LC2A 1ONVA 1D2EA 3VODA 3ABLH 2CQKA 2KZVA 4FXUA 2CFXA 4G7OF 5HS7A 4U88A 3MZ8A 3DU5A 5EEHA 2BV3A 4W8QA 5C4JJ 3RZDJ 1ORKA 1IHMA 3E20A 3KIOA 4I76A 1MNEA 1V5VA 4KYWA 2MC3A 4HSRA 2H8WA 2C4TA 4C0SA 3B73A 4GXOA 4RDLA 3IAM2 1HVXA 2RNJA 3K4JA 4RD3A 4M4SA 2K27A 3B4NA 4K2EA 4F92B 2XAGA 4YZ0A 4ZYHA 5ED4A 1MD0A 2BXYA 2V7UA 1D1NA 4AYBA 1O8LA 4DGWB 2FJ1A 2X4HA 2VBTA 2IS1A 3SEZA 2ZJRF 3ZUGA 3ECHA 2BY3A 2BZTA 2X0LA 3MZHA 1YRNA 1KTVA 3QFSA 1H8HA 4XSZF 1D0XA 1E3HA 2B0LA 2DFFA 2DYRH 1Q9SA 3AGPA 1R4MB 1MSFC 1TW2A 5FB2A 1QZZA 3G1MA 4MQVA 4YALA 4KA4A 4RCYA 1Z91A 2J7KA 1AKHA 3BT9A 3ONUA 3M8EA 3CCEB 5J3OA 1LEBA 2HKXA 5M5XJ 2HOSA 5LHIA 1FP2A 2BW3B 3FF5A 2HOEA 4PCQA 4Z4RA 4BEHB 1KZHA 3CD6B 3PENA 2EPFA 5F27A 1TZLA 3BZ6A 2W25A 3CMYA 2O61A 4LBZA 5LRSA 3T53B 3HHHA 3KZIC 1HOMA 1AU7A 1QZYA 1Z21A 2C2WA 4DNTB 3ZMTA 1NHCA 2W84A 3O8GA 3PQJA 1IJFA 4OOSA 4PJMA 3OFNA 3KYDB 1TWAJ 2M87A 2EFQA 5E1XA 1Z7LA 1WI9A 2IS6A 1Z3YA 3LSGA 4JK1X 1ZREA 1W0JA 1KQSB 3E6CC 1W34A 4R79A 3CJTB 1D5YA 2QF7A 2AXLA 4OAZA 1IUYA 3E7LA 2BSAA 2MGQA 5ILVA 3G4SI 5ICEA 1RZ4A 3Q39A 1VQ7B 2F43A 3E6MA 1PLUA 1POGA 2RC6A 1MH4A 3K1MA 1XMXA 2BVMA 1Q7YD 3QRFF 1GHCA 4AF7A 2VBMA 3G2BA 4A3GJ 1TT0A 2XPVA 2IRFG 1K61A 1G3YA 2JRMA 4HF1A 4KJZA 2DYSH 2HNHA 3O2PE 2RREA 2YX4A 3CCVI 1RR8C 1PP7U 1EXMA 1XDSA 1Y0YA 3B6AA 2ZZGA 1WJEA 2EBIA 4ENKA 3JRFA 4EJUA 3LMWA 3HOZJ 4G5GA 1O7LA 3E97A 1OR7A 1IJEA 2X6WA 2MH2A 3F0CA 1YIOA 5TRDA 4WZKA 1DBOA 4YIIA 3HGGA 1GO2A 3SLDA 4OIQF 3OOUA 3JR9A 1BM9A 2E1RA 1PYVA 1OPCA 2RC4A 4CCNA 3VDXA 3OS0A 1LE8A 3U9GA 4ABZA 1DU0A 2C4UA 3W6VA 5A2QK 4ZYGA 3LAJA 2A61A 3OYEA 4PGOA 1YI2I 4LLNA 1G3TA 1GVJA 4U49A 2MABA 3ZQQA 3VMVA 4NK8A 3BDDA 2EIMH 1XFOA 3SLNA 1OCPA 4LK0F 1XGSA 3SUCA 3H92A 2K4BA 2KRCA 2L4AA 5J1UA 3LO8A 1SAUA 4PDKA 2DW4A 3G6EB 3RSNA 3IHUA 4UXNA 3DXJF 1Z67A 1MJAA 1LB2A 3CC7B 4ZGNB 1WH7A 3G1OA 3QFRA 5A88A 1GQ8A 3AG3H 2VKDA 3CJRB 5K5OA 2NVQJ 1E3ZA 3UNGC 3ZBTA 1HF2A 1OFEA 4HIZA 4U0WA 1LJ9A 3SFZA 2CYYA 1J9ZA 3U6KA 3VOEA 5BQTA 2KLOA 2W24A 1UHWA 4NBSA 4W8SA 1FYMA 1SFEA 2MSYA 1E1RA 4IO9F 3WTUC 1T98A 2FOKA 3KRGA 1GVHA 1BL0A 4FWTA 3QODA 2PYHA 5FLMJ 1LFPA 1RESA 5F4MA 4OJPA 4KH3A 1Q81D 1IDJA 2P3MA 2Z16A 1CQXA 1IAWA 4ESFA 5DCFA 2EWNA 3SJMA 2LLKA 3PNTA 2F48A 5FJ8J 3OYBA 3ROUA 1R5HA 2NYXA 2NRAC 4XN0A 3LA2A 2EINH 4QSHA 2R5YB 2QM3A 4M6VA 1G8XA 4AM3A 3K10A 3SZPA 3W2WA 3DFGA 3K2ZA 2XB5A 4B47A 2CFOA 2JK3A 4XONA 3ZQ7A 2HFHA 1ETOA 2OV7A 2VT2A 1BR1A 3IC7A 3K0LA 4RM3A 5F0CA 4EV0A 5HOOA 1ELOA 3A35A 3BC9A 3GVLA 2MD0A 1EA0A 1FMWA 2DFIA 3BQYA 4UVCA 4WZTA 2W7ZA 4EQQA 2X9DA 3LOCA 5J8CA 2QENA 3D0SA 3OYDA 1UD6A 2Q6KA 1AKHB 3QOEA 3WE3A 5HNFA 3S32A 4NCNA 3T1BA 3HSRA 3JSPA 2QBYA 2F6CA 2ZBKA 1FEXA 5EZHA 4URRA 3M8JA 2XSDC 2UXXA 2DJIA 4IVNA 1YW8A 1I1GA 2BHZA 4BS9A 3OS1A 3KX2A 5F4JA 2VFNA 2GAUA 2VQGA 3A0HC 2VE8A 3AL0B 4WQMA 3MN2A 3BJ6A 3V7CA 1IDYA 1T95A 3NEUA 2B7EA 1H89C 3AGQA 5JLVC 3OYJA 5JLXA 4AIKA 4C30A 4CZCA 2E7WA 1TWHJ 4I01A 2B9SA 3HBLA 1ETVA 4E7KA 2HVSA 2OTJI 1OCZH 1T33A 1FRQA 5EGOA 2KDOA 1S72I 3MZYA 4YCQA 3EUHA 3QFTA 2E7XA 2HR3A 4PFPA 1TWCJ 1P4MA 2NT6A 4PJ0C 2K5CA 1A6QA 2WV1A 4DYRA 3CPXA 4YEJA 2QCOA 4M9ZA 1WOSA 3E3VA 1EH6A 2B0RA 5GV8A 3CCUB 4AC9A 2DTZA 2HS5A 2MA3A 3MKWB 3F6OA 1X1PA 1WJAA 2L9SA 1Z05A 3W6KB 1R5OA 1VQKB 4X7EA 1X4OA 2ID3A 3T5XA 3TW6A 1FRNA 2MW8A 3LQQA 5IY5H 2Y0SN 4RS8A 2L7FP 3DF8A 4X05A 1RRJA 2FVGA 3VSTA 2JSCA 3I64A 4C2UA 4IOAF 3LFKA 4DBRA 3MKYB 1H80A 3IWFA 4BPRA 1V55H 1QRYA 4I99C 3KP4A 4A3LJ 3S1QJ 2X53S 2QA4B 4IQ4A 2LVSA 2LF8A 3KCCA 2XRLA 2CW5A 1ETYA 1TUIA 3H35A 4DQ2A 3L2UA 1R4NB 2E1BA 1NJID 1VQ4B 2LREA 2R7DA 3D5LA 1BI0A 5HS9A 2W85A 1MJBA 3QE2A 1ZRFA 3HZJA 5L3DA 3OS2A 2JN9A 3JTHA 4L8JA 1DP3A 4WXCA 1ZGWA 1DPUA 1W0TA 5BPDA 4IHVA 1BX0A 4PABA 4JRAC 1EFRA 1S7OA 4YIFA 1OQYA 2M8GX 5B1BH 3OKXA 5L3CA 1AA7A 3WG9A 4BDZA 4YAOA 1MMNA 2NNNA 4YC5A 4FISA 2QN6A 2OAZA 4EW9A 1OMIA 3WTYC 3CCQI 1EFUA 2X3UA 2XF6A 1B2RA 1LQ1A 2JA2A 2HOAA 3Q9VA 4XKVA 1WDTA 5THXA 4JQFA 4PZJA 3VO1A 1TBXA 4L18B 1EH7A 1WSRA 3S1MJ 2XPUA 1ZK8A 3F8MA 2GM4A 1OYWA 2GREA 1IXRC 5J6XA 1FZPB 4A93J 2INVA 2HPIA 3F8CA 1LPQA 4V02C 2UV1A 1YO5C 3VR6A 3W2HA 2EIJH 4XORA 1JNYA 3BH6B 3SQNA 4N4OB 3VSLA 1P92A 3JRAA 1B6AA 4HPQA 2BM7A 2DT6A 2Z3YA 1W5SA 3A1YA 5L3FA 3N90A 4ACAA 3OZUA 2IA0A 2EH3A 1O8HA 1FTZA 2STTA 4B1RA 4X7FA 3FMSA 4NC6A 4UUVA 1BMFA 5DD4A 1IZ1A 1MIJA 1QRBA 2E2JJ 1W2BB 3J81Z 2GQQA 1QHHD 2L9VA 2G0EA 2L7ZA 2YX7A 2BMWA 2YWEA 2M1BA 2WV0A 4WZEA 5L3EA 4HA8A 2DI3A 4KKUA 5GTIC 2R4GA 4DYCA 4I02A 2NNYA 5CKTA 3WODF 5FD6A 3LAPA 1KYZA 1OYIA 4BY7J 1WORA 2B5OA 4RB0A 2VBXA 3DU1X 5CVVA 4XRMA 2QMUA 4OOIA 2P7VB 2AO9A 2PMDA 4Y33A 2F4MB 5HNHA 5FLVA 4G12A 4V2GA 1FNMA 3V8JA 1Y56A 3AFHA 2JSPA 3HOXJ 2BHYA 2ZMEA 1ZG5A 1FIPA 2O0WA 4HV5A 4CXFA 1EA3A 5IOZA 1G3WA 4ETSA 1HDDC 2NVUB 4A6EA 3JQQA 1ON1A 4BQQA 1RUOA 2DQRA 2Q6IA 4YFOA 4RGRA 1ZGAA 4EVIA 4YZAA 4DNCA 4P2NA 4MEYF 3HTSB 5ERIA 2K9MA 4LITA 3RPUD 4QIWN 3S16J 3S1RJ 4EGYA 1X58A 2Z8GA 2DPDA 3GCMA 1WJDA 3H0GJ 3Q9SA 4C3JJ 1N0UA 1E2XA 1FYLA 4QVJA 1OCRH 5FL7A 2J8IA 4PSXA 1E43A 2W82A 1SFOJ 3ABTA 1NG6A 4KICA 3J80K 1FNCA 3IKTA 3D1NI 3OOCA 4LG0B 4UB8C 3R60A 4ZTFA 2BXZA 3PUFA 5J8FA 4IX7A 4I0BA 4NNJA 1IC8A 3PQKA 1SVLA 1WHUA 4OZYA 4CH7A 2YUSA 1ETXA 5LGNA 3CRZA 5JI6A 1JKQC 1Z9CA 1N07A 2JZYA 1SEUA 1F4KA 1DUXC 1D3YA 3CQZJ 4OIOF 5DS0A 1K6OA 2DFEA 4HX7A 1BJKA 2WAQA 3KP2A 3ASQA 1V4RA 3CMEB 1GLNA 3PO2J 2NOGA 2DT7B 3ZC3A 1KD1D 2QGGA 1PUFB 1VQLI 2NT9A 1TLHB 1OLTA 1BI1A 2X51A 9ANTA 1BC7C 1YG2A 4V2FA 1G4DA 2QXZA 3S1NJ 2OBSA 3ULQB 4BYYA 2Q1ZB 3P9CA 3RQ4A 1I3QJ 1W7PD 2ECCA 2QYOA 3SFIA 2VFMA 4BE0A 3WY9A 1FDRA 1FBQA 1UHSA 1JJ8C 4KMFA 2WB1A 4G1BA 2WAQN 2FX0A 3FM5A 1RIOH 1TLLA 4PK4A 5E3LA 1ACIA 2NSPA 2V5IA 5ICGA 2Z33A 3PSSA 3L1PA 2XROA 1UHMA 3HKZN 2DMUA 2CS3A 3LWFA 1HKTA 2ZJPF 1WVRA 2HVRA 2BF4A 4YFXF 2OQGA 5B1AH 1WTHD 5CDFA 3Q0UA 1U5TB 2OC6A 5ILUA 1E3OC 1FLIA 1JA1A 1VQOB 3OWTA 3L2CA 1P9QC 2LY1A 2BM6A 3FY3A 3U2QA 2QEXI 1FBUA 5BSYA 2ACJA 3M4OJ 4HWVA 1JA0A 1BW6A 2KIFA 1XG2A 1COWA 1USSA 4P9FA 5LGUA 3FHZA 1R1TA 2X3HA 2NS7A 4DZJA 1ZTRA 4D9JA 3L2WA 2HMAA 1HSTA 4W8TA 1O3TA 1K8AD 1TYWA 2BOLA 3JRDA 1NB9A 1UG0A 3ONQA 3VPRA 2QE7A 3FHNA 5AIQA 3S2HJ 2I10A 3CC2I 2Q8KA 2LD5A 2GIVA 3J80Z 2QDXA 2O03A 2LG4A 4KIBA 1LDJA 3K9TA 3ZMUA 2ME0A 2BY0A 4BKXA 2OCCH 3ASPA 1SKYB 4MQ9F 3ZCOA 4CGZA 2L5QA 4D5CA 3BJAA 4Y7NJ 2VKEA 2A6HF 3MKLA 3L7WA 5A8AA 3SEQA 1QGZA 2EIKH 2BW3A 1H9GA 4NC8A 4UUSA 4U0VA 2K9NA 3DQVC 2XEXA 3GIRA 2VONA 2OZ6A 5HDGA 2O7OA 1D0ZA 2M45A 3A0BC 4LGWA 4OIRF 2Y0SA 1FNBA 1PJ7A 4HE6A 2GA2A 2BM5A 2BY2A 1K8FA 1N75A 3WTSC 1WU8A 5FA6A 2GJRA 1DABA 1SD7A 1WXRA 4D0PA 3PIPF 3GTKJ 1DQUA 4RJLA 3ZBUA 2ELHA 4W8RA 1RQRA 1XTAA 1HCRA 1WWXA 3I9V2 2E1MB 3OJXA 5TJJA 5FRNA 3SZEA 3P4GA 2HPMA 3EPZA 3ZZ0A 1VQ6B 3E1SA 1E3PA 2D2WA 1GXPA 3RKQA 5B6IA 4XK4A 2RC5A 3BCFA 4YDTA 2H27A 1WMRA 5EZGA 4KN4X 1I3AA 2NOJB 2F4OB 4OJLA 3EQNA 3D26A 4CCLA 4NK6A 3ZQHA 3Q6QA 4MYUA 2FBIA 4QV2A 2ZTNA 1S0UA 1TNTA 1PXZA 1HXDA 3U1DA 1VQNI 3GBGA 3K6GA 5F1RA 2CC2A 3H0DA 4DQLA 4I0AA 4OPSA 4I09A 2VBSA 4O3MA 5DDGA 2VB6A 1RNLA 1WOOA 4RMNA 3W6JB 2E19A 4MR0A 3R6JA 5HKKA 4P5OA 5CVUA 4AF6A 2JIZA 2R7TA 4ON0A 5LHHA 1KMHA 3CO6C 1I18A 1YJ9B 3AG1H 2O8KA 3GFLA 1V3FA 1ZUNB 2EFGA 1QA1A 3I59A 1I39A 5H6RA 3ZIAA 2XAFA 2IGKA 2A6EF 5EDNA 4LMYA 1O8MA 1LDDA 1G7CA 2XTYA 3JX8A 1HW5A 2LNBA 3PFYA 3RZOJ 5KSWB 3CMEI 1TP4A 3E5UA 1OGIA 3AVWA 3FXKA 2EJRA 2TDXA 2V7WA 3WGGA 3FKJA 3LA3A 3O6BB 2NVTJ 4BBRJ 4S04A 4LG3A 3KLOA 3LSRA 2K86A 2VNIA 3R61A 3GMEA 3BNWA 5EF6A 3B78A 3F3XA 3I4NJ 2BGCA 1OGOX 1ERDA 1MH3A 4CICA 1CNFA 4ZGQB 5EEAA 2NVXJ 5A89A 2GZWA 4TSFA 1BJZA 3IAS2 5LMZA 2WY8Q 2P8TA 4NUBA 2PN6A 4KUMA 4XLAA 2JUGA 2ZB9A 2PJRA 3E5XA 3GXOA 1WSUA 1J75A 4C3IJ 4MNUA 1WH5A 2LKPA 4GRIA 1ZLJA 4CYDA 2DA7A 5E1ZB 3ZQFA 1IRXA 2HGCA 1SVMA 4MLOA 5JVGF 2OTLI 4I2OA 5DN6A 3I58A 3TP0A 3ASTA 3NWTA 3S2WA 2DJNA 4QWQA 3RI4A 4A3IJ 1GT0C 2V1UA 2XC1A 3QFCA 3E1YE 2ZITA 4GO1A 5H20A 4C3HJ 1JJ6C 1LVKA 2BM1A 3MCAA 1XGMA 4LBYA 2VJ5A 4C2MJ 1W87A 3CCJB 5GPAA 5FKNA 2VIXA 3AVTA 2VBZA 1P2FA 3T9GA 2DMQA 4B3AA 4H0EA 2AQFA 1QA2A 3BTLA 4Y13A 2ISZA 1DDGA 4HBLA 2M4KA 3IH3A 3HC7A 4HG2A 4ZDLA 3BG3A 1YX5A 5LHGA 2QTZA 5LFAA 3KETA 1REPC 3W2GA 4EJWA 1QPMA 3R0JA 2XGDA 1PUFA 3KYCB 2CGPA 3F21A 2VN2A 2JT1A 2ZZFA 4LOCA 3BG7A 3MMYB 4Y3OA 4ZZDA 1TYVA 3IH4A 4XLCA 1QO0D 5HLTA 2LH9A 4RDUA 4B3GA 3HL2A 2B7BA 3GW2A 3CCYA 1HG8A 1JB9A 2JMWA 2C6YA 1YJWI 1F20A 3ECOA 3NAUA 3CCRB 2QVOA 3CCRI 2XZLA 2JA6J 1TQPA 5K5RA 4WX9A 2Y2ZA 2COMA 2M7BA 2L9NA 2DOEA 1W7PA 1HC8A 1VI0A 1PJ5A 2ZCWA 1VQ7I 1Z7UA 4U4BA 1ZR2A 4DZPA 3B02A 4W1UA 1OISA 3DKWA 2JA5J 3LQRA 4LIUA 5LEJA 4PJNA 3TDUC 3SJPA 4OAYA 5DSZA 3TO7A 3CO7C 2Z6BD 1KU9A 2OD5A 3TGNA 4HOBA 1QNTA 4KT5C 4MO7A 2VPLA 1G7SA 2YWHA 1LFBA 3PNYA 2CJJA 2W4SA 3SJZA 2H6BA 2IBDA 4Q48A 4Z03A 4G7ZF 4P6YA 1XMAA 3L09A 3ZR8X 4LG0A 1WP6A 1BN5A 1H0MA 1FBSA 4KIFA 3OYFA 1Y1WJ 1J2XA 3ZPLA 2JN6A 2DERA 3MWMA 1EP1B 4WWVA 2FMYA 3WTWC 4Y17A 2E34A 4OU0A 1YW7A 4YXWA 1DARA 3H9QA 4D5FA 4N3NA 3GVAA 3HHGA 3H5NA 4F55A 2ZSHB 5D5XB 1HW2A 4UZEA 1JUMA 5IP6A 1SKQA 4BE2A 2VBKA 4CUGA 2UZKA 2O6WA 2RDPA 2CW8A 2HZTA 3BG9A 1BBYA 1WGXA 1UCRA 2UUZA 1QUFA 3BH7B 1FYKA 1KA8A 1BI2A 3I56B 4Y9UA 2RVCA 3CDHA 4BGDA 4G6DA 2HEOA 3GQAA 2WR8A 1N05A 1DG1G 4JP0A 3NARA 1LNWA 2LF7A 3F23A 2HDWA 3CMAB 4A3EJ 1HF0A 1OFCX 1OB2A 3ERMA 4AIHA 3S3NA 2EV6A 1E0EA 2VQCA 5DEQA 3CCSI 1JUPA 2XAQA 3GRHA 5GADJ 2R5ZA 3HUGB 5HS8A 4DQKA 2OF7A 1Y8RB 3ZPNA 1TWGJ 1MMAA 4J01A 4ENNA 2ELJA 2XAHA 1QH0A 3U2RA 5K7HA 4IEJA 1DGRM 1GV5A 3BR2A 3MKZA 3ZN0A 4KFCA 5KW9A 2O1DA 4R8HA 4P96A 2DPUA 5H5JA 2PI0A 1GXQA 3HGYA 3FXMA 1YYVA 3BCAA 4MXNA 3U21A 1D1AA 1T0FA 2ZFWA 3M8FA 3EUHC 1W0KA 1BQEA 3CW2A 5E20A 3DP7A 1U9OA 4AWXB 3OEHA 3V76A 3N4MA 1R58A 3S3OA 4BAYA 4YAFA 2PJPA 2OTLB 4UUSB 2O17A 3OPOA 2WZPP 3LSJA 4HLXA 3LVBA 1JGSA 2VBYA 3H36A 1I6HJ 2RV8A 1WJCA 4TT3A 4C43A 3G71I 3NWSA 5CVRA 2BN4A 3BTJA 1ETKA 1HW1A 2ZNYA 1LM1A 4P12A 2E1CA 2GIZA 1QGYA 3SKBA 5EG0B 1NH3A 3VSVA 1X1CA 3GTOJ 1R5BA 2VPRA 1V0EA 2HTSA 2G9WA 1QA6A 3LNQA 4XLPF 5B5EC 4P6VF 4HNUA 4OPWA 4Q4ZF 1L3LA 2VBUA 4RB3C 5J47A 2L9RA 2Y31A 4UAJA 1N08A 1T6SA 4A3MJ 1HDPA 1WFXA 4AC0A 1H9TA 3WWGA 1TL8A 4PC3A 2GQFA 2R93J 4FT8A 1EWYA 4H9GA 1KZLA 3W2AA 3OMYA 5E18F 1Z6TA 2E1MC 1IRGA 2ZMEC 5F6FA 2LZJA 2RKHA 1NHAA 2XT4A 3GQ7A 1IG7A 1MBFA 5FKLA 3I4MJ 2FBHA 3DU6A 2LDUA 2XTXA 3I55I 4PC2A 3B8HA 1B59A 2XZPA 4YHBA 1R1VA 1QVTA 1BHEA 2M34A 3ASSA 3LSPA 2C77A 3LL7A 1SFKA 5D8LB 3FM3A 3OZWA 1CGPA 4GDFA 2UVFA 3MD2A 3J7ZI 4Z4WA 2EFPA 4EEFG 4HRIA 3G73A 4YRVA 4Z1MA 2CRVA 2P0WA 2VNKA 2VFQA 2QKLB 1HBXG 4XKBA 1TQIA 3O3KA 3OYNA 4A12A 5IK2A 3S8PA 2GOMA 4TMVA 3MEXA 1ZKGA 3HOSA 3M3YJ 4N4NB 2L4MA 3ZXSA 3ML6A 4KITB 2P5LC 5K7ZA 4IJAA 4M0LA 1KGSA 4A3DJ 3VNVA 2BM4A 5EEGA 3WGIA 2HZDA 1KRHA 1BR4A 2VOOA 2FQ4A 4JX5A 4RGUA 4RM2A 3JRGA 4OJOA 2XDVA 1T2KA 1LLWA 1XN7A 1U8RA 2C78A 2Q2EA 2YSRA 4UVAA 5IYCJ 2E1NA 2FD5A 1IA5A 3FMQA 1YQAA 5FGMA 2LTPA 5HXBA 1VF9A 3HRSA 1RQPA 1JI8A 3R4KA 1KTWA 1JTAA 2ODLA 5M5WJ 1MDMB 4XR6A 4ANJA 5JVTA 3HG9A 2VL8A 1OCOH 1JHFA 4HAMA 3KP5A 2ESNA 1H8AC 4GCVA 3IH2A 1N0VC 3S15J 3OYCA 1ETQA 4XN3A 2QLZA 1U2WA 2IXSA 3LSTA 3EYIA 3CCVB 4X6AJ 1T08B 2ZZQA 2KT0A 3VMFA 4H4KC 4C2LA 3CCQB 2D1HA 1VQ5B 1P4AA 1R9TJ 2KMUA 4RGXA 2E5NA 1T38A 3AAFA 1UD3A 1ZH5A 2DU9A 3BLYA 2A69F 1I8DA 5F0FA 1F9NA 1F36A 2Y9ZA 5GAHJ 2WBMA 1RKWA 4U87A 1KYWA 2MFZA 2O04A 3FZVA 1TWFJ 3K70D 2A5YB 3BR5A 2PMHA 3BOQA 4GYIA 2V7VA 3FDYA 1ETWA 1T56A 2H1LA 5FO5A 3V8LA 3OL4A 4ENJA 3JURA 3QPHA 1VLOA 1W9XA 2V31A 4Z4SA 3N05A 4MHGA 4ZTJA 1Z3XA 4KKSA 2DLLA 4II3A 2ZSIB 5DTDA 3SZGA 5LGTA 1EP2B 2R7OA 2QSHX 1GAQA 1O8IA 1J7KA 2Q6LA 5TV2A 1YX3A 3FK7A 3CP8A 3JRHA 2KDZA 1CQTA 3M1CA 2E5ZA 4A3CJ 1O88A 3NE5B 3PNVA 2WC2A 2QEXB 1CF7A 3FIWA 1NB0A 1R5GA 4RD1A 4CCJA 2CBXA 4G1VA 1K83J 2PFBA 5IYRA 3F8BA 1ZM2A 2DFHA 1TQMA 3PL8A 4Q5SF 1P6RA 1CZFA 1B23P 1ZM9A 4RD0A 4TMTA 3VWBA 1VQMI 1R49A 5FO1A 4HYEA 1IO2A 2VBVA 2L7KA 4RD2A 4RLQA 2EIXA 2VBEA 2E2HJ 1RETA 4FX4A 2GLOA 1AIRA 4P25A 1XS9A 2CV1A 2ZNZA 3NAWA 5B3SH 2Y0MA 4CCOA 3IP4B 2QQ9A 4XD7A 1OB5A 1X19A 2DDBA 1ZAOA 5KNLA 4PMHA 2DYIA 3OYMA 5IP7J 4L0YB 1LEAA 2KIUA 4HX4A 5E3MA 4TMXA 3C2BA 5D4RA 4RB2C 1Q86D 1TYUA 1TC3C 3I5UA 3RYRA 1BPLA 1I7PA 2XKPA 4TMWA 1VLYA 2D5VA 3OV8A 1Y39A 3A1PA 4Q7JB 2CMPA 2PX9A 3OY9A 4TKOB 4IXAA 1B9NA 2KRHA 2QY1A 2L54A 4OZZA 1KCCA 3CCMB 5JFRA 3BY6A 3QPLA 3OYAA 1PUEE 1W4MA 3CP2A 4B09A 2DA5A 2FBKA 2V7FA 4UY8I 3CD6I 2VQHA 4P55A 2F1MA 1IN5A 1W7PB 1TNSA 3T56B 5CQGA 1W1WE 1SFUA 3DDYA 1OOCA 3ELKA 4AD9A 3FKIJ 3QSYA 5ILSA 2JJ1A 2P6SA 3P9IA 4MFEA 3L9FA 5FLXZ 2PMZA 6PAXA 2GPJA 5LLQA 4P22A 1QCXA 2O5RA 3AVVA 4MEXF 2KISA 5JHFA 1O8JA 3V8KA 2DMNA 4D7NA 3ZSCA 2VJJA 4HX8A 3TEDA 2XRNA 1TYXA 4X7CA 1I5ZA 4NQWA 2LR8A 3MHPA 2JJ2A 3VFZA 4RD4A 2FSWA 2X1CA 1JHHA 1M1KD 3AK5A 1VQ8I 3ZMZA 2VQLA 3A03A 4XICA 2DXIA 1FOWA 1UD4A 3LNNA 3OEEA 4AYBN 5AN9A 5E3OA 2WZNA 3DLAA 2R0QC 2F4IA 1EJ9A 1WOPA 3CCLI 2FU4A 5FNZA 4CQJA 3BQJA 1VQNB 3S14J 3A2KA 2CO5A 1QG0A 2HYJA 3DWLE 3L00A 1TTYA 2CW7A 4G94A 5DM7F 4PGHA 2VJIA 5C3EJ 2DQLA 5L3BA 2XNJA 3RJPA 2HWVA 1NG7A 3DEUA 4MTEA 5DYMA 4FCYA 1NK3P 2BVNA 2OYNA 5D6FA 1TSPA 2STWA 1RI7A 3TH0A 4RAZA 4EATA 2K85A 3OZVA 4BUPA 2W7NA 4RLFA 5IT9K 1T5EA 3GYHX 4MYTA 1A8PA 2W00A 1UZCA 1IW7F 1DDNA 1R7JA 3DTIA 3M9AA 4PJJA 2CF4A 1T39A 2OBRA 2RQPA 4A0ZA 2IAIA 2QSGX 2X6OA 2DT5A 1J5YA 1R23A 1IV8A 1VQ4I 1IXCA 2QGUA 3PUBA 1K79A 4RAYA 1K78B 2A07F 2WB1N 4XLNF 2YPRA 1FT9A 2TCTA 2FA5A 1B4AA 1MW7A 1QFYA 4G6IA 4ZDPA 2JQ7A 1VZ0A 3GUDA 3GLXA 4LD5A 1Z1DA 2VUMJ 2V9PA 2G0YA 2F5FA 2IPQX 4ZCIA 1XD7A 3B6CA 3GQ8A 4ESBA 1EP3B 2IS4A 2PIAA 2EQRA 1S5LC 4WCGA 1O8DA 4M3BA 4BHCA 4M2LA 3CDIA 4XLFA 2Q2EB 1Q82D 3P9KA 4EMSA 5DD8A 2BYVE 2KP6A 3GFJA 1ZARA 3TW7A 3TOAA 3ZMDA 1SAXA 3FKSA 1U6GA 1N25A 2CNDA 1FNNA 3BCDA 1W5CC 3V7AA 1STZA 3ZQLA 3PVDA 1PJRA 3BTCA 1MKMA 3GTPJ 5LRRA 1UB9A 3BR0A 4A3FJ 2KJBA 3RPQA 1Y1VJ 1PJ6A 4OJ6A 4UZUA 3ZOBA 3WTXC 2PEXA 3ABMH 1MBGA 3Q5FA 4DNRB 1LFUP 3K4NA 2R7VA 3UW0A 2DTRA 2WTEA 3EQLF 5FKKA 3JW4A 3NRVA 4I6ZA 4BACA 5FO0A 3AG2H 3HM5A 2QQBA 3IWZA 3VYSB 3IRQA 1Q1HA 2DO7A 2EV5A 2P5KA 1XPXA 1ZQ3P 3DPLC 4L5JA 1YI2B 2RAEA 2ZC2A 2QA4I 2IJLA 4EJTA 4IHSA 3H5AA 3OW2B 2MH9A 5AMVA 4HF0A 3W5UA 4KDPA 2R7ZJ 3T8TA 4X0CA 2XTWA 2FEZA 4XQFA 2EB7A 3KEOA 4LLGF 4QHYA 3IKVA 5L46A 2DODA 1MBJA 3LFUA 3G1LA 5IT9Z 2I1LA 4WXHA 1U5TA 2PJRB 1Y8QB 1SFXA 2OZUA 5FKMA 5K7FA 2VYQA 1EKEA 3BZCA 4WXDA 1UELB 4A69C 1T6YA 2OA4A 1R1UA 3T8RA 4HQMA 3MQ0A 4IOCF 1FTTA 3E6BA 4AVPA 4LBWA 1HZEA 1KU3A 1MDMA 4RA2A 2Y75A 4L9VA 2LBFB 2A6TA 4IQJA 3A8JA 5TR9A 3GQ9A 3WG7H 3JSOA 1W0UA 1LVAA 1J59A 4QTRA 3GTJJ 1RUNA 2GXBA 2VC0A 4Z4TA 2LBFA 4RBOA 3CCEI 1MNMC 3G4SB 2ETHA 3GF2A 4G7HF 1EV7A 4F7DA 2V7XA 4XLHA 5J1RA 1YRNB 4BDYA 4M73A 1O8GA 1OJLA 1JKRC 2CU7A 4LC0A 2CG4A 1KJZA 4II2A 4X0GA 3H5RA 1KQ8A 3H9JA 3ABKH 3A4CA 4P3IA 3WBKA 5GAEJ 1JGGA 2HVQA 4L9TA 4XRSG 3HRTA 3A8IA 4HV6A 2QKMB 4I98B 2MBFA 5BMZA 3L2VA 2Q0OA 1PDNC 1R22A 4HDUA 1HKSA 1MGTA 3CCUI 2W6JA 5DNSA 1AHDP 2I8DA 3QWLA 2CUFA 2HU9A 2XUBA 3F6VA 2LKSA 3RQIA 5H2FC 5D5VB 4EJVA 2VFPA 1H85A 3J81K 1O3RA 4RAFA 5DS9A 4A0YA 1ON2A 1IN8A 1S9HA 4M74A 4AVZA 1P4XA 3D5SC 2HDCA 4B4CA 4Q47A 4HZFA 3RPUA 3ZQIA 2R7QA 4YFNF 3Q38A 3K2AA 1DBGA 4N3GA 4Z05A 2R3SA 5M5YJ 3VSKA 4QUZA 4IHXA 2D45A 3RKYA 3GLLA 4LIVA 4RPDA 3G6EI 4RCZA 3KP3A 1YHQI 4XBFA 3C7JA 4F91B 4OM9A 2XPWA 1YJ9I 3OSFA 2GK7A 2CQ7A 3SYTA 5IYNA 2L2OA 1VQMB 4Y9RA 4IRHA 4ITVA 4P1WA 4ZYDA 1KK3A 2ZFUA 1MSEC 1VQ8B 1RWRA 3I1FA 1B9MA 2FNPA 1OGJA 3FBNB 1QVUA 3HKZA 1VTNC 1X1DA 3G3ZA 3K7AJ 2WSSA 1WI3A 2IA2A 4EM1A 3CUQC 3CCLB 3HPHA 2VNJA 1Y0UA 2R7RA 4RGSA 2QZ8A 5JLWA 4IHWA 1LDKB 2I5UA 2PLFA 2K02A 1U2RA 4EJOA 2JDIA 2RN7A 1YOVB 4ENMA 4TMZA 2DCUA 1IN4A 3U1KA 1CLWA 3QU3A 3HOWJ 3K1PA 5LEKA 2ZBVA 4KN7X 3A02A 4E6KG 3CCMI 2XNCA 3DTKA 1VFCA 2FMLA 3Q0VA 3RDIA 4HDVA 2XOKA 2VFOA 2X6XA 1WCMJ 3I56I 2YUHA 1X3ZB 4ASUA 4BXUA 4UNOA 2X6YA 4E7HA 4ZC3A 2YWFA 2NTPA 4YELA 2Z5UA 3FBIB 2M0CA 2V4JC 2K7LA 2R7FA 3BWGA 1EF4A 3U6BA 2FQ3A 3BR1A 5JHUA 4IKFA 4BBSJ 2DMTA 2WY7Q 1A6IA 2VZLA 4OP7A 2UVEA 3OYKA 1QFJA 3Q6RA 4WK8F 2ZL7A 4OMYA 4L5IA 5CQEA 2C5BA 5IYQA 5CJ9A 1H42A 1VQ6I 2VE9A 5D5WB 1U3EM 2KVOA 3PUMA 3Q0WA 2J5PA 5HDNA 3JRBA 4YEIA 2K4JA 2XVCA 4ZJZA 2W57A 3DPUA 4XRSA 1U0JA 1SMTA 5E8GA 3FXQA 3IL2A 3WTVC 3JTGA 2VLAA 2B7CA 3OR1C 2KL4A 3BJOA 4HEA2 1X3WB 3SZTA 4G6QA 1SM4A 2F5VA 2NV4A 3KPHA 3TDZC 5HVQC 1FSEA 1QQIA 5E6TA 2JWTA 3RCOA 2K9SA 3QPTA 1GJRA 5IYBJ 5K1YA 2MLKA 4HW0A 1YS7A 1UD8A 1BN8A 1QRCA 5KCMA 1X0CA 3H3VK 3OE7A 1K78A 1J9IA 1VQOI 4RD6A 4FQGA 2W48A 3BG5A 2QQ8A 4Z4VA 3HOYJ 2G7HA 3F72A 1WJ5A 3FXLA 1LLZA 3HXLA 5M3MJ 4E7SA 3GZ6A 2V1DA 1Q1VA 1EH8A 1NDHA 1D5VA 1MMGA 2RQQA 2YS9A 1ZHFA 3H09A 2XIGA 5GV7A 3BY1A 3LSIA 1VQKI 2BX6A 4CHUA 3VSUA 1B72A 3RKXA 2YWGA 2M5WA 4PAAA 5E8IA 2X0KA 4DK1A 1W5TA 2EZKA 3E6DA 1I6XA 2ZL6A 1IRFA 3CDLA 4A6DA 2D3NA 2Y30A 2OU2A 1W35A 1MRZA 3OAAA 1U8BA 4UB6C 1QJVA 2NSTA 2O0VA 3I0TA 1K7AA 2EFNA 2FE3A 3GTLJ 2P4WA 2ZO4A 3HDDA 5KK1A 3B82A 3VO2A 1WJFA 5H6QA 5ICFA 5D4SA 1KQ5A 3WNBA 1B1BA 4IF4A 1AIPA 1NRKA 2PMUA 3CMMA 1S8NA 1S72B 3BTIA 1FOKA 1ZGJA 1X1AA 2X48A 1EE6A 1OFDA 2E2IJ 4NC7A 1BOAA 3BP8A 3AVUA 5EG0A 3QYFA 2NXNB 1FPQA 2XGEA 4BE1A 1PVEA 3HOUJ 1K73D 3WQZA 4FK8A 3GSIA 2DMPA 2V7TA 2V6CA 3CTAA 2JPBA 3RY8A 3ZN1A 2EZLA 2WJYA 4RPBA 4F7ZA 2CWEA 2ELKA 2HDNB 1FIAA 1WKMA 3CJQB 4R71A 4ZCLA 4IZZA 1ZYRF 5BS6A 2XAJA 3PIOF 4QPQA 4CCMA 3KLNA 2IA1A 3HRMA 2GWRA 5JR3A 3V7RA 1FSHA 4JMQA 4QPOA 4LK1F 5HZAA 1F1ZA 1E1QA 3H1CA 1XSXA 1JUSA 3Q3AA 1XSVA 4EM0B 5ICCA 4HLYA 3RIQA 1GV2A 2R9VA 1R5NA 3WU2C 1N06A 4V19K 4PFOA 1U78A 2GK6A 2WPDA 2ZXJA 2RGVA 1BW5A 4OPOA 1Z6RA 3V42A 3DPTA 2XB0X 2H1KA 1GR1A 4WWCA 1O57A 1QPIA 3ISXA 4E7LA 2XGXA 3QP6A 4RLZA 5FLXK 1Y0RA 2DIEA 3BY2A 2XASA 1MBKA 1O8KA 1USTA 3P27A 2XV4S 1DGWY 1HKQA 4UVBA 1H88C 3IUOA 1QBJA 4LBVA 4RM0A 1U5TC 1YITB 1XC5A 3N97A 1SD5A 3ABUA 1G3SA 2VASA 2R5ZB 1JTXA 2HQNA 3DBRB 4XSXF 1IF1A 3CUQA 1HA3A 3VNUA 4KT6A 1JTYA 1RKTA 1VQPI 2O9LA 1FWZA 4O6JA 3H3ZA 3TKYA 4BHPA 5D5UB 2INUA 2V1NA 1WPKA 3H3UA 3HOVJ 2BSPA 3OSGA 2VXDA 4A0XA 3BR3A 4RDJA 4E70A 2OBTA 3PUNA 4DK0A 3J7AY 3WYAA 1QUEA 4P9SA 4U9UA 3CXCB 2CQXA 1XX5A 1YTYA 3W5HA 3T51B 5BPIA 3W3CA 1P7JA 2EV0A 1DDIA 4ZYEA 1S4MA 3PA1A 1DPRA 1XGOA 1YW9A 2KHMA 3CJNA 3RTRA 3FXOA 4NB5A 3A3GA 4D7MA 5C1EA 2RNGA 1XDUA 3VYRB 1SVOA 4M9XA 3GTQJ 3Q3SA 4AUXA 2ZZEA 2M0MA 4MFDA 4FTHA 4B4DA 1OCTC 2AQEA 3FK6A 2XAUA 4X06A 1A04A 2L7MP 4FASD 2JA7J 1D1BA 2WAEA 3NB2A 3I3LA 4Y7CA 2ZTGA 2VOPA 1YE9A 3EUKL 4XOPA 4E4HA 5HZBA 1UMKA 1K28D 2FNAA 2OUMA 3EETA 2CK3A 3PO3J 4I84A 3IV5A 4G7WA 1L1IA 3OYLA 3CPWB 3EQOA 5JMCB 4X1EA 3BQZA 3OOPA 3HRUA 3ASRA 3OR2C 1V54H 4IHYA 4OMZA 3OIOA 2JRTA 2ESHA 3BROA 3HTUA 3VYUB 3REOA 3KEWA 4Z06A 4Z4YA 4LJZF 2F4NA 1FOYA 2R7XA 1E17A 3WGHA 1S7EA 3TO6A 3TQNA 4M3GA 2QSFX 4BL0B 2ZXWH 4BQAA 2M5SA 1R36A 2GBYA 3GEZA 4BXXJ 2QX3A 1D8JA 4XLEA 5J40A 1XMKA 1F60A 5C44J 2W6IA 2DY1A 1BI3A 2IQ7A 1ZG3A 4M72A 3GZ5A 1FNDA 2JVGA 4CYCB 1DP7P 3P26A 2Q6OA 1YLFA 3F8NA 1C0WA 1E79A 3VYTB 2Z99A 3E0JB 5TGTA 2IT0A 2VKVA 3FMRA 1FOXA 3CF2A 3S2DJ 1VQ5I 1JKOC 3CC4I 3KEQA 3HOTA 2BBYA 3ZMSA 1SC7A 2CRGA 1X2NA 3LQ6A 2KJCA 4ZH4F 3RIRA 1ODDA 4F93B 1ZELA 5F08A 1M90D 3CUQB 2XT2A 3M07A 2MYSA 2O0YA 3A01B 3CLOA 2PE3A 3HUGA 3MVPA 4KNYA 3DTEA 4UV8A 4P1VA 2CUJA 4ZZLA 1BOBA 3MCZA 1O8FA 3HSFA 1ZN2A 1FC3A 2IGNA 2ZXHA 2DDAA 3DBHB 3CMAI 1F5TA 2PLYA 2UWMA 2VC1A 2GJPA 3LSMA 2ECBA 2GJKA 3LJYA 2ID6A 2M8EA 2Y48A 3JAMZ 2D74A 3DBLB 4XL9A 3C18A 4E7ZA 2IS2A 1D0YA 2C5HA 2K9QA 1UFMA 3PA2A 1OHHA 1VQLB 5CLSA 4B3XA 3KP6A 2LOOA 3J7AO 5GPCA 3BC8A 2P81A 4XOTA 2CW0F 3OIQA 2XSJC 2EK5A 4GGGA 2AS5F 3P7NA 4ACBA 2IGOA 3MFKA 4WF2A 3I4PA 4BJ6C 4FN5A 1IB0A 3CC4B 1IGNA 1B8IA 2Y69H 3SHFA 1HQCA 1K4TA 2QQAA 2NPFA 1ZRDA 2HQAA 1ZR4A 3KL9A 5CVIA 1A36A 1GVDA 1PP8F 4TN1A 2R5YA 3FXRA 1IN6A 3TO9A 5HLHA 3PSZA 2NAZA 3UR3C 3BR6A 5KHDA 4C9YA 4K1XA 4BQNA 3A01A 4J0QA 3KZZA 1TT5B 4U7BA 1BA5A 2WJVA 3WBJA 4C2TA 3FX3A 3ZMVA 3K70C 3M7GA 5J4YA 4JBAA 2NZMA 1ENHA 3AG4H 1WJBA 2BE5F 2DA2A 2IEKA 1IDKA 3PETA 2HQ5A 2OBPA 2CH0A 3V4GA 3QU6A 2ZBUA 3PSFA 4GQNA 2E36A 2XNDA 4UZFA 5EMNA 3H9NA 5HLIA 5LBQA 4ESJA 4PSWA 2FOWA 3DEEA 4FHTA 5GTHC 4OOVA 3VB2A 4AU7A 1V0FA 3L2QA 4S05A 3EYYA 2ZMEB 4B3FX 2V4DA 5H59A 5F0HA 4Z6YA 4IL6C 2BPOA 2HXOA 2VKHA 4LFUA 2FUG2 2NS0A 5DUKA 1XE1A 1A31A 1OFMA 3C1DA 3W2EA 3CUOA 2EA4A 1B8IB 2WWYA 4MTDA 1E63A 2OTJB 3GFMA 3NQOA 4JYKA 2GOXB 3JAMK 1GAWA 2VT3A 3W5VA 3WHBA 2V7QA 1RU4A 2MC4A 2J8KA 2XGCA 1AMOA 4PC1A 1RC9A 1XSDA 2D3LA 3GVKA 3G71B 3HSEA 3TL4X 3ZP5A 1QVGB 2D1VA 2DA3A 2DN0A 3GO5A 2V1XA 5FFXA 2LRDA 2WAFA 2IP2A 4L9JA 3T0YA 4DYQA 3MMPA 4G8XA 1KCDA 1MMSA 4CSWA 1MBEA 2LK2A 5DUIA 1GDTA 3WTTC 4IW3B 2QUFA 2ICWG 1CNEA 2NTBA 3AKZA 1WQ2A 2EWEA 1R5ID 3OYIA 5L3GA 2X1DA 2N8GA 1GUUA 2QZAA 1K4ZA 3B90A 1SMYF 5E1WA 4ZDOA 3CB4A 2OJED 1YIJB 1H8EA 3M1EA 2M9HA 4NDLA 1W36D 3OJWA 1VQ9B 4BJTA 5HODA 2KIMA 5TY0A 2GXAA 3N6ZA 3I59B 1W36C 2E71A 2V9KA 2HXIA 2K40A 2XF7A 4A5NA 1G59A 3SYJA 1BR2A 5E3NA 4XKCA 1S6LA 2PQ8A 3GFIA 3ERED 3L2RA 2AHOA 2DCEA 5CYVA 4CCKA 3BG6A 5AIPA 2VBWA 4X8IA 2LP0A 2M30A 2OK8A 3LSKA 3OIPA 2F5CA 1X3UA 4QFMA 2D9RA 3KYLA 4AIDA 4TV7A 4Y4RA 3A8KA 5CVJA 3VMWA 4S0HB 3GZNB 3VEPA 5DM6F 4M71A 1U9NA 2JJ7A 1K4SA 4PJLA 2WA0A 2PYGA 3FXUA 3DKYA 2H6CA 3CZ6A 4B44A 2LY2A 2MD5A 4DIQA 3ISPA 2WYRA 2QWWA 4KIGA 4YAWA 3KEYA 3ESWB 3QOPA 5EYRA 1G6NA 2CUZA 1Y6IA 1EFCA 3QYBA 2HLDA 5F04A 4F3QA 1O3QA 2BGIA 5DCMB 1KC8D 2Z2SB 4B43A 2VJ4A 5F1JA 4QVAA 1JJ2B 2O3FA 1D1CA 2XKOA 3KE2A 3K4MA 1JT0A 1S29A 1QVFB 4DW6A 1BJAA 2YR2A 2KQRA 2O8XA 3W2VA 1YS6A 1KU7A 1IRZA 3HYIA 3WHCA 2EFWA 2IOUG 4Y52J 4OOXA 1FX0A 4RDKA 5J35A 4X7DA 2LY9A 1MBHA 4E7IA 3K4LA 2V9VA 4LB6B 1ZM3A 2CQQA 4WZLA 4KISA 2XGJA 3QP5A 1BC8C 2Z9OA 4HQEA 2ZKZA 2O6GE 5K5QA 2F5EA 3ZPPA 2PECA 1D8KA 1S7AA 4OWRB 3ONYA 1ZM4A 3H94A 2NS8A 1ZG1A 2Y9YA 1G2HA 1OFLA 2R6HA 1SD6A 4J19A 1G7RA 4G7XA 4DOZA 2F2EA 2R7UA 4XNFA 2A05A 4G9YA 1FY7A 4JX6A 5IPAA 3ML3A 2MLGA 2OQRA 3IRRA 2LMDA 2KZGA 4N9HA 1EZGA 2IVMA 4E7JA 2M3AA 4N0BA 4BQOA 2E60A 4EM2A 4YZXA 2KRFA 1O8EA 3BH4A 4RAGA 4OPVA 1PE9A 2E1OA 2W1OA 3ASOH 3V7SA 4U7DA 1HA8A 1I27A 2DA1A 4ASNA 4BH9A 5IT3A 5FD5A 1F43A 2HKOA 3HAGA 3HJEA 1XQBA 1X4PA 4HNVA 5KAIC 4IPAA 1TTTA 1L0OC 2GXGA 3I53A 1VNDA 1MMDA 2BY1A 3I54A 4FE4A 3DLLF 2R7SA 2ISYA 1IN7A 2BEOA 3F9KA 2F1LA 2DETA 3P5JA 1TW3A 3JQRA 2K3PA 3GTGJ 2DA6A 1KQ0A 2OK7A 3LQEA 2KKOA 1WPCA 4NHJA 3CF5F 1QFZA 4NQWB 1R6RA 4B8XA 1RR7A 3FPPA 2PMZN 1VBLA 2UXNA 3LMMA 1ZLKA 5FIUA 2L0KA 2M7AA 1UG2A 2K9LA 1VQ9I 2COBA 4J00A 3OL3A 2DOFA 5HDKA 1AWCA 2QBYB 2X85A 1K5CA 3JRCA 2AXTC 4BHBA 5J1YA 1FJLA 1ZRCA 2BV6A 1UAAA 5FRMA 3QYEA 1XB4A 4OJ5A 1AOYA 1D8TA 1JE8A 1DU6A 2A5WA 2TRTA 4A3BJ 2LFBA 3JU4A 3OYGA 1KU2A 1X2MA 5KVRA 4QLCU 4DBQA 1Z77A 2JUCA 4I7HA 3ES9A 3F8FA 3TOBA 3SDGA 3I55B 1R00A 2DA4A 3S3MA 3JQPA 4M6YA 3QAHA 3SXYA 1WRJA 4M3EA 3BZKA 1RMGA 5B66C 3HIFA 5TISC 5D8KB 3HPGA 1J0RA 2KIQA 2V79A 4OIPF 3E5QA 2L01A 5C4XJ 4U0YA 2MG4A 3GQBA 3AVXA 4M53A 2BVLA 4GYGA 3OW7A 4UUTA 5IYDJ 2CUEA 1I50J 2BGJA 4FE7A 2YU3A 4PGGA 4PC7A 1XCVA 2P6TA 4DJAA 4Z4UA 1BIBA 1KONA 3CESA 1YHQB 3FXJA 3EDPA 3LSHA 5EGOB 4HF2A 1PKVA 2DEUA 3WU0A 2EA2A 3O8HA 4L0ZB 1O4XA 2ZJ2A 1YIJI 3SEJA 1V5EA 2IW5A 3W2IA 5IYWA 3FWEA 3A3BA 2PBIA 3AL0C 4BXFA 3CCJI 2KFDA 4W97A 3BCBA 4JOMA 3SDBA 2DOGA 3ZRGA 4YZQA 2HYGD 2G7UA 4HE5A 1IV6A 2FX3A 2J5OA 3GX4X 2YU9J 3AVYA 2IGMA 1O3SA 2JA8J 4P26A 5IYPA 2CV2A 1Y0NA 1KQ9A 3K69A 3J7YJ 2CSOA 2HTJA 3K4BA 1QHGA 4XKWA 3RYPA 2R92J 3DCFA 2F5DA 4MIMA 2FF4A 2ZJQF 2KPMA 3SQVA 2BM0A 1J09A 4M3DA 3H9GA 3CC7I 1Z0XA 4XM3A 2CV0A 2P7CB 4P3YA 4E0FA 4YG2F 2B63J 4LLLA 3BPXA 4G6TB 1QQ1A 1A35A 4Z4ZA 1LE8B 3CCSB 3S17J 2HYFA 5IP9J 2EZHA 3GWZA 1IUFA 3K1NA 1VQPB 4R1HA 5LD2C 4EGZA 3SY2A 2GA1A 1O7FA 5AONA 3MAJA 1IB4A 4IRGA 1QZEA 3ZQGA 1QX4A 4PC6A 1VHEA 2XHKA 4Y15A 4FETA 3WXMA 3PM1A 4BEHA 1KK1A 3GVJA 2F3LA 5F4OA 2EFOA 2P5VA 1WSVA 4KMUX 2QTLA 2FRHA 2OCEA 3X2QH 4CA0A 5A2QZ 2OPTA 1OGMX 3TMOA 1OKRA 1VHOA 3ASNH 1JKPC 1SANA 1ULYA 2DAOA 1G7TA 1M1EB 2EILH 4M9SA 3R6SA 3RKWA 2M2EA 4XMYA 1T6XA 1YFHA 3K4KA 1K9MD 2ME6A 2E35A 3CLQA 3WNCA 1HSJA 3TBIA 5DCMA
chains in the Genus database with same CATH topology
2JSPA 3PSIA 3DKXA 1OB0A 2O0WA 1DGWY 2R7WA 1UD5A 2IXSA 3IUOA 1EA3A 1N78A 2VASA 2ZZQA 4H4KC 4BQQA 3G05A 2M4GA 4C2LA 2KMUA 2E5NA 4KT6A 4YZAA 1T0FC 1UD3A 2INUA 3BLYA 2V1NA 1I8DA 2K9MA 4LITA 3RPUD 4HNTA 2BSPA 2WBMA 2VXDA 2ZXIA 4U87A 2Z8GA 2MFZA 2O04A 5CPRB 3C2HA 3K70D 1LKXA 4DK0A 3J7AY 3OEHA 3FDYA 1WJDA 2WADA 3OL4A 3JURA 1W9XA 2V31A 3N05A 1N77A 3W3CA 4PUSA 2X1EA 4ZTJA 1Z3XA 4KKSA 5FL7A 4F52A 4PSXA 1NBMA 1E43A 2W82A 4II3A 1NG6A 1FMVA 2LYCA 2ZSIB 2KHMA 3RTRA 1V5FA 3SZGA 2R7OA 3OOCA 3A3GA 1O8IA 5C1EA 2RNGA 4ZTFA 4IX7A 4BU2A 1YX3A 4NNJA 3VYRB 3CP8A 2ZZEA 2M0MA 1VJSA 1QU3A 3B8YA 3M1CA 2AQEA 4CH7A 4OZYA 2E5ZA 3S93A 2XZOA 2XAUA 1O88A 3NE5B 3PNVA 2XF5A 3EUAA 4FASD 4CCJA 1D1BA 2WAEA 3OYHA 3I3LA 2ZTGA 1K6YA 2WAQA 1GLNA 1YE9A 3EUKL 2DT7B 2JVHA 3PL8A 4XOPA 2Z1DA 4E4HA 3ZGKA 2OUMA 4D1QA 1K28D 2CK3A 1CZFA 2NT9A 1OLTA 2VXZA 3D5RC 2X51A 4I84A 3VWBA 4G7WA 1V5GA 2QXZA 3OYLA 4B48A 3EQOA 1X1BA 1MNDA 2L7KA 2Q1ZB 4RLQA 3RQ4A 3K4CA 3OR2C 2VBEA 4BE0A 1AIRA 3KEWA 3VYUB 2CV1A 2V26A 2WB1A 3IP4B 4CCOA 4XD7A 4Z06A 5C1CA 1X19A 2R7XA 4PK4A 5KNLA 4PMHA 2NSPA 3OYMA 1E3XA 4BL0B 1VF7A 2M5SA 3C2GA 2CS3A 4BJ5C 2QX3A 1BPLA 4XLEA 2HVRA 1VLYA 2W6IA 1MABA 1WTHD 2X8KA 5CDFA 2CMPA 3OY9A 4TKOB 2IQ7A 2JVGA 2KRHA 2OC6A 2QY1A 4OZZA 1KCCA 3OWTA 3OYAA 1P9QC 2LY1A 3PJRA 3FY3A 4HWVA 3CP2A 1E79A 3VYTB 2V7FA 3E0JB 4ZYAA 2VQHA 5TGTA 1COWA 2F1MA 4KKTA 1XG2A 2XC7A 3CF2A 2X3HA 3T56B 4D9JA 3L2WA 5CQGA 1BLIA 3HOTA 4W8TA 3DDYA 1OOCA 5FROA 2BOLA 1OR7C 2QE7A 1UG0A 3ONQA 2JJ1A 4F93B 1ZELA 3FHNA 2PMZA 1JRGA 1QCXA 2O5RA 2MYSA 5JHFA 1O8JA 3ZSCA 2LG4A 2VJJA 1UD2A 3DTEA 2DOAA 2V6EA 2CUJA 2JJ2A 1BOBA 1SKYB 1O8FA 2X1CA 2NTQA 2ZXHA 2IGNA 4HSTA 2L5QA 3ZCOA 2UWMA 2LC2A 2GJPA 3LSMA 2KZVA 3SEQA 2GJKA 4FXUA 2BW3A 4XL9A 2VQLA 4NC8A 4E7ZA 2IS2A 3DQVC 2DXIA 1D0YA 1UD4A 3LNNA 1OHHA 3DU5A 4B3XA 3OEEA 4W8QA 1D0ZA 2Y0SA 3DLAA 2LOOA 2F4IA 3BC8A 1N75A 4XOTA 2GJRA 3OIQA 2XSJC 1MNEA 3A2KA 3DWLE 2CW7A 1DQUA 2VJIA 2IGOA 4HSRA 4BJ6C 1NG7A 4W8RA 3IAM2 3I9V2 1HVXA 2E1MB 3K4JA 3B4NA 4F92B 4EATA 5FRNA 4YZ0A 4BUPA 2W7NA 4RLFA 1T5EA 2HQAA 2HPMA 1O8LA 3EPZA 4AYBA 3E1SA 4DGWB 2W00A 2IS1A 3SEZA 3BCFA 1WMRA 3DTIA 2NOJB 4PJJA 3UR3C 4OJLA 1H8HA 3EQNA 1D0XA 4C9YA 5KHDA 4CCLA 4NK6A 3PUBA 4BQNA 2ZTNA 1PXZA 3GBGA 1MW7A 3K6GA 4U7BA 2WJVA 3H0DA 4ZDPA 3K70C 4C2TA 4G6IA 1VZ0A 2VB6A 2NZMA 4RMNA 1WJBA 1IDKA 4MR0A 2CH0A 5HKKA 4P5OA 2JIZA 2BW3B 2R7TA 3GQ8A 3PSFA 4GQNA 2IS4A 4BEHB 1KMHA 1O8DA 1I18A 4XLFA 2XNDA 2Q2EB 4PSWA 3DEEA 1TZLA 2KP6A 3ZIAA 2IGKA 4AU7A 1V0FA 3T53B 3L2QA 1O8MA 3FKSA 3BCDA 4B3FX 4DNTB 1Z21A 3PFYA 2V4DA 1NHCA 1PJRA 2VKHA 2FUG2 4PJMA 3OFNA 1Z7LA 2IS6A 1OFMA 1Z3YA 3LSGA 1W0JA 3FKJA 4OJ6A 4UZUA 4LG3A 4R79A 2GOXB 4OAZA 4DNRB 2R7VA 3K4NA 1RU4A 2V7QA 3UW0A 2MC4A 1OGOX 1ERDA 4BACA 2D3LA 3GVKA 3TL4X 2F43A 1PLUA 3VYSB 2BVMA 4TSFA 3IAS2 3DPLC 2VBMA 3G2BA 1TT0A 2LRDA 2WAFA 2WY8Q 4NUBA 1KCDA 3H5AA 5AMVA 4CSWA 4XLAA 2JUGA 2HNHA 4KJZA 2PJRA 2RREA 4XQFA 2NTBA 1WJEA 3AKZA 2EWEA 3OYIA 3LMWA 3LFUA 4GRIA 2X1DA 3B90A 2PJRB 1IRXA 4ZDOA 2X6WA 4MLOA 1DBOA 1UELB 5DN6A 1H8EA 3NWTA 1W36D 3OOUA 4BJTA 3WWGA 1PYVA 4CCNA 1HZEA 1LVKA 3VDXA 3OS0A 1W36C 2VJ5A 2V9KA 2XF7A 1G59A 2VIXA 2LBFB 2A6TA 4IQJA 1BR2A 4XKCA 3OYEA 3L2RA 3GQ9A 3T9GA 2DCEA 4CCKA 3BG6A 2AQFA 4U49A 2MABA 3ZQQA 3VMVA 4NK8A 2M4KA 2LBFA 3HC7A 4HG2A 4ZDLA 1YX5A 3LSKA 3OIPA 3SUCA 5LFAA 2KRCA 4XLHA 1SAUA 3KYLA 4Y4RA 4BDYA 1O8GA 3RSNA 3VMWA 4PJLA 4II2A 4X0GA 2WA0A 2ZZFA 3H5RA 2PYGA 3DKYA 3H9JA 3BG7A 3A4CA 3MMYB 4Y3OA 1GQ8A 3CJRB 2VKDA 3CZ6A 4XLCA 2HVQA 2LY2A 4B44A 1E3ZA 3UNGC 4DIQA 2QKMB 4HIZA 5HLTA 2LH9A 3KEYA 3L2VA 2KLOA 3HL2A 4B3GA 2CUZA 4W8SA 1Y6IA 1HG8A 3QYBA 2W6JA 1E1RA 2HLDA 2I8DA 4F3QA 2HU9A 3KRGA 2Z2SB 4B43A 2VJ4A 2XZLA 2PYHA 3QODA 1D1CA 1LFPA 4OJPA 2M7BA 2L9NA 3K4MA 1IDJA 1S9HA 2Z16A 4AVZA 3D5SC 4U4BA 2KQRA 2R7QA 3W2VA 4LIUA 3PNTA 1DBGA 4Z05A 3OYBA 1FX0A 4PJNA 3VSKA 4XN0A 4E7IA 3K4LA 4OAYA 1G8XA 4LIVA 3K10A 4KISA 3W2WA 2Z6BD 2XGJA 4B47A 4F91B 3ZPPA 2CFOA 2VPLA 2GK7A 2PECA 4XONA 3PNYA 4OWRB 2OV7A 3SYTA 3H94A 1BR1A 2L2OA 4RM3A 5HOOA 3A35A 2W4SA 3BC9A 3GVLA 3T51B 2MD0A 1OFLA 4Z03A 4ITVA 1FMWA 4P1WA 2ZFUA 4G7XA 1WP6A 3ZR8X 1RWRA 4DOZA 2R7UA 3OYDA 4XNFA 3OYFA 1UD6A 3QOEA 5HNFA 3S32A 3FBNB 4E7JA 3HKZA 2M3AA 4BQOA 1X1DA 2E60A 4YXWA 3H9QA 2WSSA 4YZXA 1O8EA 2F6CA 3H5NA 4F55A 3HPHA 2ZSHB 3BH4A 4URRA 3M8JA 1PE9A 2R7RA 2W1OA 2DJIA 4BE2A 2VBKA 1LDKB 4CUGA 1HA8A 2CW8A 2JDIA 2UUZA 4BS9A 3OS1A 3KX2A 3HAGA 2VQGA 4BGDA 3GQAA 1X4PA 3AL0B 4E6KG 1T95A 2R7SA 2ZZGA 1MMDA 4P22A 3OYJA 2HDWA 3DTKA 3F9KA 4C30A 4CZCA 2K3PA 3S3NA 2XOKA 4E7KA 1E0EA 2VQCA 2HVSA 2X6XA 1WPCA 3GRHA 3HUGB 4ASUA 3ZPNA 4NQWB 1R6RA 2KDOA 1MMAA 4J01A 2ELJA 3FPPA 2X6YA 4E7HA 4ZC3A 1VBLA 2NTPA 3LMMA 4YELA 1DGRM 3FBIB 2V4JC 4PFPA 2M7AA 2K9LA 3MKZA 4IKFA 2WY7Q 4J00A 3OL3A 2NT6A 3OYKA 2K5CA 2UVEA 2O1DA 2X85A 1K5CA 4YEJA 1UAAA 5CQEA 5FRMA 3QYEA 3BCAA 4MXNA 3U21A 1D1AA 3MKWB 1W0KA 4OJ5A 3EUHC 2KVOA 2A5WA 2L9SA 1WJAA 3JU4A 3OYGA 1X4OA 3S3OA 4DBQA 4ZJZA 2O17A 3DPUA 3OPOA 2WZPP 1U0JA 3VSTA 3S3MA 2VLAA 1WJCA 4TT3A 4C2UA 3OR1C 2KL4A 3NWSA 4DBRA 3MKYB 1H80A 4HEA2 1RMGA 3HPGA 2F5VA 5HVQC 2X53S 3GQBA 4IQ4A 3RCOA 2BVLA 3VSVA 1X1CA 3H35A 1UD8A 3OW7A 1X0CA 3L2UA 1V0EA 5KCMA 2E1BA 1BN8A 2LREA 4DJAA 3OE7A 3D5LA 1KONA 3CESA 4HNUA 1PKVA 3LSHA 3OS2A 1WJ5A 1DP3A 4L8JA 3HXLA 4E7SA 1WFXA 1EFRA 1V5EA 1MMGA 2RQQA 3A3BA 1KZLA 3AL0C 3W2AA 3OMYA 4BXFA 1AA7A 2E1MC 4BDZA 1MMNA 3BCBA 4JOMA 3SDBA 2LZJA 3ZRGA 4YZQA 3GQ7A 3LSIA 4EW9A 3VSUA 2XF6A 3DU6A 4DK1A 2JA2A 4XKVA 4JQFA 2XZPA 2D3NA 2IGMA 3OAAA 1BHEA 1QJVA 2CV2A 2NSTA 2O0VA 3K4BA 4XKWA 3LL7A 1QHGA 1SFKA 2INVA 2UVFA 1WJFA 2HPIA 2KPMA 3MD2A 2UV1A 3VR6A 4HRIA 1J09A 4XORA 4YRVA 4Z1MA 2P0WA 3VSLA 4N4OB 1NRKA 3H9GA 4HPQA 3CMMA 2DT6A 4XM3A 2QKLB 2CV0A 3A1YA 4XKBA 4E0FA 4G6TB 1X1AA 1EE6A 3OYNA 5IK2A 4NC7A 3S8PA 1O8HA 2GOMA 3QYFA 4BE1A 1BMFA 3HOSA 4N4NB 3WQZA 5LD2C 3ZXSA 4KITB 1QHHD 1IB4A 2WJYA 2HZDA 1BR4A 3CJQB 4FETA 4RM2A 4OJOA 2XDVA 4KKUA 4IZZA 4BEHA 2R4GA 4QPQA 4CCMA 3GVJA 5CKTA 4CA0A 4JMQA 4QPOA 1OGMX 3TMOA 1IA5A 1E1QA 1JI8A 1KTWA 2R9VA 1JTAA 2ODLA 4XR6A 4ANJA 4PFOA 3HG9A 2GK6A 2VL8A 2WPDA 4XMYA 4Y33A 3V42A 5HNHA 3DPTA 3K4KA 4E7LA 2DIEA 3TBIA 3OYCA 4XN3A 1Y56A 1O8KA 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  2O0W A;  3T9G A;  4MXN A;  4U49 A;  4XL9 A;  4OJ5 A;  4NK8 A;  3VMV A;  4C2L A;  4W8Q A;  3SUC A;  4YZA A;  4XLH A;  2INU A;  4XOT A;  2O17 A;  1O8G A;  3VMW A;  3VST A;  2BSP A;  2Z8G A;  2O04 A;  2VJI A;  1H80 A;  2PYG A;  1RMG A;  4W8R A;  1GQ8 A;  3JUR A;  3B4N A;  4XLC A;  4YZ0 A;  1O8L A;  3VSV A;  1X0C A;  1BN8 A;  4W8S A;  1HG8 A;  1O8I A;  1WMR A;  5C1E A;  3KRG A;  4OJL A;  3B8Y A;  2PYH A;  4OZY A;  3EQN A;  4OJP A;  4NK6 A;  1O88 A;  1IDJ A;  4AVZ A;  1PXZ A;  4U4B A;  1DBG A;  4Z05 A;  4XOP A;  2NZM A;  4YZQ A;  3GQ7 A;  1IDK A;  4EW9 A;  2NT9 A;  3VSU A;  4XN0 A;  4MR0 A;  1CZF A;  4I84 A;  4XKV A;  2QXZ A;  3GQ8 A;  3EQO A;  3ZPP A;  1O8D A;  2PEC A;  4XLF A;  1BHE A;  4XON A;  1QJV A;  2NST A;  2O0V A;  4XKW A;  2VBE A;  4Z03 A;  1AIR A;  1OFL A;  1O8M A;  2INV A;  2UVF A;  4Z06 A;  5C1C A;  1RWR A;  1NHC A;  4XOR A;  4XNF A;  4PMH A;  2NSP A;  4XM3 A;  1OFM A;  1EE6 A;  4OJ6 A;  2QX3 A;  4YZX A;  4XLE A;  1O8E A;  1O8H A;  4URR A;  1PE9 A;  1RU4 A;  3UW0 A;  2IQ7 A;  2VBK A;  1OGO X;  2QY1 A;  4OZZ A;  1KCC A;  3FY3 A;  1IB4 A;  4HWV A;  1PLU A;  3GQA A;  1XG2 A;  2VBM A;  4OJO A;  2X3H A;  1KCD A;  5AMV A;  4XLA A;  4W8T A;  1OOC A;  4XQF A;  2X6X A;  2NTB A;  3GRH A;  1OGM X;  2EWE A;  1IA5 A;  3LMW A;  3B90 A;  1JRG A;  1QCX A;  1KTW A;  1VBL A;  2X6Y A;  2NTP A;  1JTA A;  1O8J A;  2ODL A;  2X6W A;  4YEL A;  3ZSC A;  2VJJ A;  4XR6 A;  1DBO A;  4XMY A;  3WWG A;  2NT6 A;  2UVE A;  1O8F A;  2NTQ A;  2O1D A;  2X85 A;  1K5C A;  4YEJ A;  4XN3 A;  1O8K A; 
#chains in the Genus database with same CATH topology
 1OB0 A;  3PSI A;  2PG4 A;  3DKX A;  1E64 A;  2R7W A;  1QA3 A;  1UD5 A;  5IOY A;  3QPS A;  5E17 F;  1N78 A;  3WU1 B;  1E62 A;  3G05 A;  2M4G A;  3WTZ A;  4A2U A;  1T0F C;  3JRE A;  3FPK A;  4L5E A;  1MJ9 A;  5E79 C;  5BNG A;  1BX1 A;  2K3F A;  3QQA A;  1SD4 A;  4L9N A;  4YAU A;  4HNT A;  1S3J A;  1HLV A;  4X07 A;  2AHQ A;  3CC2 B;  2ZXI A;  2A3S A;  3KFW X;  5CPR B;  3C2H A;  4YFK F;  1LKX A;  2H94 A;  2HDD A;  5KAF C;  3FJO A;  2WAD A;  3UKG A;  4UV9 A;  1BIA A;  1XGN A;  2LSO A;  1LUJ B;  1N77 A;  4ROX A;  3W2F A;  4PUS A;  2X1E A;  2VOD A;  1XCB A;  1YJW B;  4CDG A;  4F52 A;  1NBM A;  1NTC A;  1WZ2 A;  1YLO A;  1FMV A;  2LYC A;  3I71 A;  3BPV A;  2A68 F;  3R0A A;  1V5F A;  4A5M A;  1B72 B;  3ZZT A;  3J81 k;  5GP9 A;  2DK5 A;  4BU2 A;  4CYC A;  4A3K J;  1CF7 B;  4IRI A;  1N8R D;  1VJS A;  5J4V A;  1QU3 A;  2HQR A;  1TVC A;  3B8Y A;  2ZL5 A;  4O5V A;  5BOX A;  2HI3 A;  3S93 A;  4OIN F;  3JCU C;  1IDZ A;  1XB2 A;  4EH1 A;  2XZO A;  2DK8 A;  4UHT A;  2XF5 A;  3EUA A;  3LA7 A;  5EJC A;  1KK2 A;  1OYY A;  3FIS A;  3OYH A;  4NBQ A;  3OP1 A;  2VNH A;  1K6Y A;  2H8R A;  4XID A;  2JVH A;  4ZCM A;  2VI6 A;  2Z1D A;  5FKO A;  3ZGK A;  4D1Q A;  3COA C;  4A3J J;  2VXZ A;  3D5R C;  1UMQ A;  2FXA A;  4LB5 A;  1V5G A;  4P9U A;  2L3D A;  5D6E A;  4B48 A;  1X1B A;  1QGA A;  1MND A;  4YIR X;  5HLG A;  3PFI A;  4M6X A;  3C3W A;  3LYC A;  3K4C A;  5M3F J;  2JPC A;  1T8I A;  1MZB A;  1JXS A;  2NVY J;  2V26 A;  3KZY A;  3DV8 A;  5C1C A;  1A5J A;  2CQN A;  1P4W A;  1QGP A;  5J3L A;  2HOT A;  4BY1 J;  1E3X A;  1VF7 A;  3C2G A;  3TP3 A;  1ITY A;  4M3F A;  5GAG J;  1I1S A;  5BSX A;  4BJ5 C;  5JBQ A;  2L02 A;  5FFZ A;  4Z2Y A;  1T6Z A;  3HB9 A;  1MAB A;  2X8K A;  1RPW A;  4XRF A;  4GFB A;  4FX0 A;  3WE2 A;  1IJW C;  2JTV A;  2QYU A;  4M1K A;  3WND A;  3KP7 A;  3GTM J;  5F64 A;  1APL C;  3PJR A;  3R6K A;  4ZYA A;  4KKT A;  1FX7 A;  2XC7 A;  4CO8 A;  1FP1 D;  1BLI A;  3ZZU A;  3DEW A;  5FRO A;  1OR7 C;  4MGR A;  5DV5 A;  1YIT I;  1KK0 A;  1JT6 A;  4JX4 A;  2ADU A;  2LKX A;  1NK2 P;  1YJN B;  4AIJ A;  2EZI A;  1JRG A;  2H09 A;  2DBB A;  3F22 A;  1YJN I;  1OCC H;  4CZZ A;  2HCJ B;  1UD2 A;  1XG1 A;  3JRI A;  3ZQC A;  2DOA A;  1UJ8 A;  1YX2 A;  4RB1 A;  2V6E A;  3HEF A;  1IXS B;  4BNC A;  4IHT A;  1P7I A;  1R71 A;  2NTQ A;  4N9I A;  1EFT A;  4HST A;  4ZV4 A;  2LC2 A;  1ONV A;  1D2E A;  3VOD A;  3ABL H;  2CQK A;  2KZV A;  4FXU A;  2CFX A;  4G7O F;  5HS7 A;  4U88 A;  3MZ8 A;  3DU5 A;  5EEH A;  2BV3 A;  4W8Q A;  5C4J J;  3RZD J;  1ORK A;  1IHM A;  3E20 A;  3KIO A;  4I76 A;  1MNE A;  1V5V A;  4KYW A;  2MC3 A;  4HSR A;  2H8W A;  2C4T A;  4C0S A;  3B73 A;  4GXO A;  4RDL A;  3IAM 2;  1HVX A;  2RNJ A;  3K4J A;  4RD3 A;  4M4S A;  2K27 A;  3B4N A;  4K2E A;  4F92 B;  2XAG A;  4YZ0 A;  4ZYH A;  5ED4 A;  1MD0 A;  2BXY A;  2V7U A;  1D1N A;  4AYB A;  1O8L A;  4DGW B;  2FJ1 A;  2X4H A;  2VBT A;  2IS1 A;  3SEZ A;  2ZJR F;  3ZUG A;  3ECH A;  2BY3 A;  2BZT A;  2X0L A;  3MZH A;  1YRN A;  1KTV A;  3QFS A;  1H8H A;  4XSZ F;  1D0X A;  1E3H A;  2B0L A;  2DFF A;  2DYR H;  1Q9S A;  3AGP A;  1R4M B;  1MSF C;  1TW2 A;  5FB2 A;  1QZZ A;  3G1M A;  4MQV A;  4YAL A;  4KA4 A;  4RCY A;  1Z91 A;  2J7K A;  1AKH A;  3BT9 A;  3ONU A;  3M8E A;  3CCE B;  5J3O A;  1LEB A;  2HKX A;  5M5X J;  2HOS A;  5LHI A;  1FP2 A;  2BW3 B;  3FF5 A;  2HOE A;  4PCQ A;  4Z4R A;  4BEH B;  1KZH A;  3CD6 B;  3PEN A;  2EPF A;  5F27 A;  1TZL A;  3BZ6 A;  2W25 A;  3CMY A;  2O61 A;  4LBZ A;  5LRS A;  3T53 B;  3HHH A;  3KZI C;  1HOM A;  1AU7 A;  1QZY A;  1Z21 A;  2C2W A;  4DNT B;  3ZMT A;  1NHC A;  2W84 A;  3O8G A;  3PQJ A;  1IJF A;  4OOS A;  4PJM A;  3OFN A;  3KYD B;  1TWA J;  2M87 A;  2EFQ A;  5E1X A;  1Z7L A;  1WI9 A;  2IS6 A;  1Z3Y A;  3LSG A;  4JK1 X;  1ZRE A;  1W0J A;  1KQS B;  3E6C C;  1W34 A;  4R79 A;  3CJT B;  1D5Y A;  2QF7 A;  2AXL A;  4OAZ A;  1IUY A;  3E7L A;  2BSA A;  2MGQ A;  5ILV A;  3G4S I;  5ICE A;  1RZ4 A;  3Q39 A;  1VQ7 B;  2F43 A;  3E6M A;  1PLU A;  1POG A;  2RC6 A;  1MH4 A;  3K1M A;  1XMX A;  2BVM A;  1Q7Y D;  3QRF F;  1GHC A;  4AF7 A;  2VBM A;  3G2B A;  4A3G J;  1TT0 A;  2XPV A;  2IRF G;  1K61 A;  1G3Y A;  2JRM A;  4HF1 A;  4KJZ A;  2DYS H;  2HNH A;  3O2P E;  2RRE A;  2YX4 A;  3CCV I;  1RR8 C;  1PP7 U;  1EXM A;  1XDS A;  1Y0Y A;  3B6A A;  2ZZG A;  1WJE A;  2EBI A;  4ENK A;  3JRF A;  4EJU A;  3LMW A;  3HOZ J;  4G5G A;  1O7L A;  3E97 A;  1OR7 A;  1IJE A;  2X6W A;  2MH2 A;  3F0C A;  1YIO A;  5TRD A;  4WZK A;  1DBO A;  4YII A;  3HGG A;  1GO2 A;  3SLD A;  4OIQ F;  3OOU A;  3JR9 A;  1BM9 A;  2E1R A;  1PYV A;  1OPC A;  2RC4 A;  4CCN A;  3VDX A;  3OS0 A;  1LE8 A;  3U9G A;  4ABZ A;  1DU0 A;  2C4U A;  3W6V A;  5A2Q K;  4ZYG A;  3LAJ A;  2A61 A;  3OYE A;  4PGO A;  1YI2 I;  4LLN A;  1G3T A;  1GVJ A;  4U49 A;  2MAB A;  3ZQQ A;  3VMV A;  4NK8 A;  3BDD A;  2EIM H;  1XFO A;  3SLN A;  1OCP A;  4LK0 F;  1XGS A;  3SUC A;  3H92 A;  2K4B A;  2KRC A;  2L4A A;  5J1U A;  3LO8 A;  1SAU A;  4PDK A;  2DW4 A;  3G6E B;  3RSN A;  3IHU A;  4UXN A;  3DXJ F;  1Z67 A;  1MJA A;  1LB2 A;  3CC7 B;  4ZGN B;  1WH7 A;  3G1O A;  3QFR A;  5A88 A;  1GQ8 A;  3AG3 H;  2VKD A;  3CJR B;  5K5O A;  2NVQ J;  1E3Z A;  3UNG C;  3ZBT A;  1HF2 A;  1OFE A;  4HIZ A;  4U0W A;  1LJ9 A;  3SFZ A;  2CYY A;  1J9Z A;  3U6K A;  3VOE A;  5BQT A;  2KLO A;  2W24 A;  1UHW A;  4NBS A;  4W8S A;  1FYM A;  1SFE A;  2MSY A;  1E1R A;  4IO9 F;  3WTU C;  1T98 A;  2FOK A;  3KRG A;  1GVH A;  1BL0 A;  4FWT A;  3QOD A;  2PYH A;  5FLM J;  1LFP A;  1RES A;  5F4M A;  4OJP A;  4KH3 A;  1Q81 D;  1IDJ A;  2P3M A;  2Z16 A;  1CQX A;  1IAW A;  4ESF A;  5DCF A;  2EWN A;  3SJM A;  2LLK A;  3PNT A;  2F48 A;  5FJ8 J;  3OYB A;  3ROU A;  1R5H A;  2NYX A;  2NRA C;  4XN0 A;  3LA2 A;  2EIN H;  4QSH A;  2R5Y B;  2QM3 A;  4M6V A;  1G8X A;  4AM3 A;  3K10 A;  3SZP A;  3W2W A;  3DFG A;  3K2Z A;  2XB5 A;  4B47 A;  2CFO A;  2JK3 A;  4XON A;  3ZQ7 A;  2HFH A;  1ETO A;  2OV7 A;  2VT2 A;  1BR1 A;  3IC7 A;  3K0L A;  4RM3 A;  5F0C A;  4EV0 A;  5HOO A;  1ELO A;  3A35 A;  3BC9 A;  3GVL A;  2MD0 A;  1EA0 A;  1FMW A;  2DFI A;  3BQY A;  4UVC A;  4WZT A;  2W7Z A;  4EQQ A;  2X9D A;  3LOC A;  5J8C A;  2QEN A;  3D0S A;  3OYD A;  1UD6 A;  2Q6K A;  1AKH B;  3QOE A;  3WE3 A;  5HNF A;  3S32 A;  4NCN A;  3T1B A;  3HSR A;  3JSP A;  2QBY A;  2F6C A;  2ZBK A;  1FEX A;  5EZH A;  4URR A;  3M8J A;  2XSD C;  2UXX A;  2DJI A;  4IVN A;  1YW8 A;  1I1G A;  2BHZ A;  4BS9 A;  3OS1 A;  3KX2 A;  5F4J A;  2VFN A;  2GAU A;  2VQG A;  3A0H C;  2VE8 A;  3AL0 B;  4WQM A;  3MN2 A;  3BJ6 A;  3V7C A;  1IDY A;  1T95 A;  3NEU A;  2B7E A;  1H89 C;  3AGQ A;  5JLV C;  3OYJ A;  5JLX A;  4AIK A;  4C30 A;  4CZC A;  2E7W A;  1TWH J;  4I01 A;  2B9S A;  3HBL A;  1ETV A;  4E7K A;  2HVS A;  2OTJ I;  1OCZ H;  1T33 A;  1FRQ A;  5EGO A;  2KDO A;  1S72 I;  3MZY A;  4YCQ A;  3EUH A;  3QFT A;  2E7X A;  2HR3 A;  4PFP A;  1TWC J;  1P4M A;  2NT6 A;  4PJ0 C;  2K5C A;  1A6Q A;  2WV1 A;  4DYR A;  3CPX A;  4YEJ A;  2QCO A;  4M9Z A;  1WOS A;  3E3V A;  1EH6 A;  2B0R A;  5GV8 A;  3CCU B;  4AC9 A;  2DTZ A;  2HS5 A;  2MA3 A;  3MKW B;  3F6O A;  1X1P A;  1WJA A;  2L9S A;  1Z05 A;  3W6K B;  1R5O A;  1VQK B;  4X7E A;  1X4O A;  2ID3 A;  3T5X A;  3TW6 A;  1FRN A;  2MW8 A;  3LQQ A;  5IY5 H;  2Y0S N;  4RS8 A;  2L7F P;  3DF8 A;  4X05 A;  1RRJ A;  2FVG A;  3VST A;  2JSC A;  3I64 A;  4C2U A;  4IOA F;  3LFK A;  4DBR A;  3MKY B;  1H80 A;  3IWF A;  4BPR A;  1V55 H;  1QRY A;  4I99 C;  3KP4 A;  4A3L J;  3S1Q J;  2X53 S;  2QA4 B;  4IQ4 A;  2LVS A;  2LF8 A;  3KCC A;  2XRL A;  2CW5 A;  1ETY A;  1TUI A;  3H35 A;  4DQ2 A;  3L2U A;  1R4N B;  2E1B A;  1NJI D;  1VQ4 B;  2LRE A;  2R7D A;  3D5L A;  1BI0 A;  5HS9 A;  2W85 A;  1MJB A;  3QE2 A;  1ZRF A;  3HZJ A;  5L3D A;  3OS2 A;  2JN9 A;  3JTH A;  4L8J A;  1DP3 A;  4WXC A;  1ZGW A;  1DPU A;  1W0T A;  5BPD A;  4IHV A;  1BX0 A;  4PAB A;  4JRA C;  1EFR A;  1S7O A;  4YIF A;  1OQY A;  2M8G X;  5B1B H;  3OKX A;  5L3C A;  1AA7 A;  3WG9 A;  4BDZ A;  4YAO A;  1MMN A;  2NNN A;  4YC5 A;  4FIS A;  2QN6 A;  2OAZ A;  4EW9 A;  1OMI A;  3WTY C;  3CCQ I;  1EFU A;  2X3U A;  2XF6 A;  1B2R A;  1LQ1 A;  2JA2 A;  2HOA A;  3Q9V A;  4XKV A;  1WDT A;  5THX A;  4JQF A;  4PZJ A;  3VO1 A;  1TBX A;  4L18 B;  1EH7 A;  1WSR A;  3S1M J;  2XPU A;  1ZK8 A;  3F8M A;  2GM4 A;  1OYW A;  2GRE A;  1IXR C;  5J6X A;  1FZP B;  4A93 J;  2INV A;  2HPI A;  3F8C A;  1LPQ A;  4V02 C;  2UV1 A;  1YO5 C;  3VR6 A;  3W2H A;  2EIJ H;  4XOR A;  1JNY A;  3BH6 B;  3SQN A;  4N4O B;  3VSL A;  1P92 A;  3JRA A;  1B6A A;  4HPQ A;  2BM7 A;  2DT6 A;  2Z3Y A;  1W5S A;  3A1Y A;  5L3F A;  3N90 A;  4ACA A;  3OZU A;  2IA0 A;  2EH3 A;  1O8H A;  1FTZ A;  2STT A;  4B1R A;  4X7F A;  3FMS A;  4NC6 A;  4UUV A;  1BMF A;  5DD4 A;  1IZ1 A;  1MIJ A;  1QRB A;  2E2J J;  1W2B B;  3J81 Z;  2GQQ A;  1QHH D;  2L9V A;  2G0E A;  2L7Z A;  2YX7 A;  2BMW A;  2YWE A;  2M1B A;  2WV0 A;  4WZE A;  5L3E A;  4HA8 A;  2DI3 A;  4KKU A;  5GTI C;  2R4G A;  4DYC A;  4I02 A;  2NNY A;  5CKT A;  3WOD F;  5FD6 A;  3LAP A;  1KYZ A;  1OYI A;  4BY7 J;  1WOR A;  2B5O A;  4RB0 A;  2VBX A;  3DU1 X;  5CVV A;  4XRM A;  2QMU A;  4OOI A;  2P7V B;  2AO9 A;  2PMD A;  4Y33 A;  2F4M B;  5HNH A;  5FLV A;  4G12 A;  4V2G A;  1FNM A;  3V8J A;  1Y56 A;  3AFH A;  2JSP A;  3HOX J;  2BHY A;  2ZME A;  1ZG5 A;  1FIP A;  2O0W A;  4HV5 A;  4CXF A;  1EA3 A;  5IOZ A;  1G3W A;  4ETS A;  1HDD C;  2NVU B;  4A6E A;  3JQQ A;  1ON1 A;  4BQQ A;  1RUO A;  2DQR A;  2Q6I A;  4YFO A;  4RGR A;  1ZGA A;  4EVI A;  4YZA A;  4DNC A;  4P2N A;  4MEY F;  3HTS B;  5ERI A;  2K9M A;  4LIT A;  3RPU D;  4QIW N;  3S16 J;  3S1R J;  4EGY A;  1X58 A;  2Z8G A;  2DPD A;  3GCM A;  1WJD A;  3H0G J;  3Q9S A;  4C3J J;  1N0U A;  1E2X A;  1FYL A;  4QVJ A;  1OCR H;  5FL7 A;  2J8I A;  4PSX A;  1E43 A;  2W82 A;  1SFO J;  3ABT A;  1NG6 A;  4KIC A;  3J80 K;  1FNC A;  3IKT A;  3D1N I;  3OOC A;  4LG0 B;  4UB8 C;  3R60 A;  4ZTF A;  2BXZ A;  3PUF A;  5J8F A;  4IX7 A;  4I0B A;  4NNJ A;  1IC8 A;  3PQK A;  1SVL A;  1WHU A;  4OZY A;  4CH7 A;  2YUS A;  1ETX A;  5LGN A;  3CRZ A;  5JI6 A;  1JKQ C;  1Z9C A;  1N07 A;  2JZY A;  1SEU A;  1F4K A;  1DUX C;  1D3Y A;  3CQZ J;  4OIO F;  5DS0 A;  1K6O A;  2DFE A;  4HX7 A;  1BJK A;  2WAQ A;  3KP2 A;  3ASQ A;  1V4R A;  3CME B;  1GLN A;  3PO2 J;  2NOG A;  2DT7 B;  3ZC3 A;  1KD1 D;  2QGG A;  1PUF B;  1VQL I;  2NT9 A;  1TLH B;  1OLT A;  1BI1 A;  2X51 A;  9ANT A;  1BC7 C;  1YG2 A;  4V2F A;  1G4D A;  2QXZ A;  3S1N J;  2OBS A;  3ULQ B;  4BYY A;  2Q1Z B;  3P9C A;  3RQ4 A;  1I3Q J;  1W7P D;  2ECC A;  2QYO A;  3SFI A;  2VFM A;  4BE0 A;  3WY9 A;  1FDR A;  1FBQ A;  1UHS A;  1JJ8 C;  4KMF A;  2WB1 A;  4G1B A;  2WAQ N;  2FX0 A;  3FM5 A;  1RIO H;  1TLL A;  4PK4 A;  5E3L A;  1ACI A;  2NSP A;  2V5I A;  5ICG A;  2Z33 A;  3PSS A;  3L1P A;  2XRO A;  1UHM A;  3HKZ N;  2DMU A;  2CS3 A;  3LWF A;  1HKT A;  2ZJP F;  1WVR A;  2HVR A;  2BF4 A;  4YFX F;  2OQG A;  5B1A H;  1WTH D;  5CDF A;  3Q0U A;  1U5T B;  2OC6 A;  5ILU A;  1E3O C;  1FLI A;  1JA1 A;  1VQO B;  3OWT A;  3L2C A;  1P9Q C;  2LY1 A;  2BM6 A;  3FY3 A;  3U2Q A;  2QEX I;  1FBU A;  5BSY A;  2ACJ A;  3M4O J;  4HWV A;  1JA0 A;  1BW6 A;  2KIF A;  1XG2 A;  1COW A;  1USS A;  4P9F A;  5LGU A;  3FHZ A;  1R1T A;  2X3H A;  2NS7 A;  4DZJ A;  1ZTR A;  4D9J A;  3L2W A;  2HMA A;  1HST A;  4W8T A;  1O3T A;  1K8A D;  1TYW A;  2BOL A;  3JRD A;  1NB9 A;  1UG0 A;  3ONQ A;  3VPR A;  2QE7 A;  3FHN A;  5AIQ A;  3S2H J;  2I10 A;  3CC2 I;  2Q8K A;  2LD5 A;  2GIV A;  3J80 Z;  2QDX A;  2O03 A;  2LG4 A;  4KIB A;  1LDJ A;  3K9T A;  3ZMU A;  2ME0 A;  2BY0 A;  4BKX A;  2OCC H;  3ASP A;  1SKY B;  4MQ9 F;  3ZCO A;  4CGZ A;  2L5Q A;  4D5C A;  3BJA A;  4Y7N J;  2VKE A;  2A6H F;  3MKL A;  3L7W A;  5A8A A;  3SEQ A;  1QGZ A;  2EIK H;  2BW3 A;  1H9G A;  4NC8 A;  4UUS A;  4U0V A;  2K9N A;  3DQV C;  2XEX A;  3GIR A;  2VON A;  2OZ6 A;  5HDG A;  2O7O A;  1D0Z A;  2M45 A;  3A0B C;  4LGW A;  4OIR F;  2Y0S A;  1FNB A;  1PJ7 A;  4HE6 A;  2GA2 A;  2BM5 A;  2BY2 A;  1K8F A;  1N75 A;  3WTS C;  1WU8 A;  5FA6 A;  2GJR A;  1DAB A;  1SD7 A;  1WXR A;  4D0P A;  3PIP F;  3GTK J;  1DQU A;  4RJL A;  3ZBU A;  2ELH A;  4W8R A;  1RQR A;  1XTA A;  1HCR A;  1WWX A;  3I9V 2;  2E1M B;  3OJX A;  5TJJ A;  5FRN A;  3SZE A;  3P4G A;  2HPM A;  3EPZ A;  3ZZ0 A;  1VQ6 B;  3E1S A;  1E3P A;  2D2W A;  1GXP A;  3RKQ A;  5B6I A;  4XK4 A;  2RC5 A;  3BCF A;  4YDT A;  2H27 A;  1WMR A;  5EZG A;  4KN4 X;  1I3A A;  2NOJ B;  2F4O B;  4OJL A;  3EQN A;  3D26 A;  4CCL A;  4NK6 A;  3ZQH A;  3Q6Q A;  4MYU A;  2FBI A;  4QV2 A;  2ZTN A;  1S0U A;  1TNT A;  1PXZ A;  1HXD A;  3U1D A;  1VQN I;  3GBG A;  3K6G A;  5F1R A;  2CC2 A;  3H0D A;  4DQL A;  4I0A A;  4OPS A;  4I09 A;  2VBS A;  4O3M A;  5DDG A;  2VB6 A;  1RNL A;  1WOO A;  4RMN A;  3W6J B;  2E19 A;  4MR0 A;  3R6J A;  5HKK A;  4P5O A;  5CVU A;  4AF6 A;  2JIZ A;  2R7T A;  4ON0 A;  5LHH A;  1KMH A;  3CO6 C;  1I18 A;  1YJ9 B;  3AG1 H;  2O8K A;  3GFL A;  1V3F A;  1ZUN B;  2EFG A;  1QA1 A;  3I59 A;  1I39 A;  5H6R A;  3ZIA A;  2XAF A;  2IGK A;  2A6E F;  5EDN A;  4LMY A;  1O8M A;  1LDD A;  1G7C A;  2XTY A;  3JX8 A;  1HW5 A;  2LNB A;  3PFY A;  3RZO J;  5KSW B;  3CME I;  1TP4 A;  3E5U A;  1OGI A;  3AVW A;  3FXK A;  2EJR A;  2TDX A;  2V7W A;  3WGG A;  3FKJ A;  3LA3 A;  3O6B B;  2NVT J;  4BBR J;  4S04 A;  4LG3 A;  3KLO A;  3LSR A;  2K86 A;  2VNI A;  3R61 A;  3GME A;  3BNW A;  5EF6 A;  3B78 A;  3F3X A;  3I4N J;  2BGC A;  1OGO X;  1ERD A;  1MH3 A;  4CIC A;  1CNF A;  4ZGQ B;  5EEA A;  2NVX J;  5A89 A;  2GZW A;  4TSF A;  1BJZ A;  3IAS 2;  5LMZ A;  2WY8 Q;  2P8T A;  4NUB A;  2PN6 A;  4KUM A;  4XLA A;  2JUG A;  2ZB9 A;  2PJR A;  3E5X A;  3GXO A;  1WSU A;  1J75 A;  4C3I J;  4MNU A;  1WH5 A;  2LKP A;  4GRI A;  1ZLJ A;  4CYD A;  2DA7 A;  5E1Z B;  3ZQF A;  1IRX A;  2HGC A;  1SVM A;  4MLO A;  5JVG F;  2OTL I;  4I2O A;  5DN6 A;  3I58 A;  3TP0 A;  3AST A;  3NWT A;  3S2W A;  2DJN A;  4QWQ A;  3RI4 A;  4A3I J;  1GT0 C;  2V1U A;  2XC1 A;  3QFC A;  3E1Y E;  2ZIT A;  4GO1 A;  5H20 A;  4C3H J;  1JJ6 C;  1LVK A;  2BM1 A;  3MCA A;  1XGM A;  4LBY A;  2VJ5 A;  4C2M J;  1W87 A;  3CCJ B;  5GPA A;  5FKN A;  2VIX A;  3AVT A;  2VBZ A;  1P2F A;  3T9G A;  2DMQ A;  4B3A A;  4H0E A;  2AQF A;  1QA2 A;  3BTL A;  4Y13 A;  2ISZ A;  1DDG A;  4HBL A;  2M4K A;  3IH3 A;  3HC7 A;  4HG2 A;  4ZDL A;  3BG3 A;  1YX5 A;  5LHG A;  2QTZ A;  5LFA A;  3KET A;  1REP C;  3W2G A;  4EJW A;  1QPM A;  3R0J A;  2XGD A;  1PUF A;  3KYC B;  2CGP A;  3F21 A;  2VN2 A;  2JT1 A;  2ZZF A;  4LOC A;  3BG7 A;  3MMY B;  4Y3O A;  4ZZD A;  1TYV A;  3IH4 A;  4XLC A;  1QO0 D;  5HLT A;  2LH9 A;  4RDU A;  4B3G A;  3HL2 A;  2B7B A;  3GW2 A;  3CCY A;  1HG8 A;  1JB9 A;  2JMW A;  2C6Y A;  1YJW I;  1F20 A;  3ECO A;  3NAU A;  3CCR B;  2QVO A;  3CCR I;  2XZL A;  2JA6 J;  1TQP A;  5K5R A;  4WX9 A;  2Y2Z A;  2COM A;  2M7B A;  2L9N A;  2DOE A;  1W7P A;  1HC8 A;  1VI0 A;  1PJ5 A;  2ZCW A;  1VQ7 I;  1Z7U A;  4U4B A;  1ZR2 A;  4DZP A;  3B02 A;  4W1U A;  1OIS A;  3DKW A;  2JA5 J;  3LQR A;  4LIU A;  5LEJ A;  4PJN A;  3TDU C;  3SJP A;  4OAY A;  5DSZ A;  3TO7 A;  3CO7 C;  2Z6B D;  1KU9 A;  2OD5 A;  3TGN A;  4HOB A;  1QNT A;  4KT5 C;  4MO7 A;  2VPL A;  1G7S A;  2YWH A;  1LFB A;  3PNY A;  2CJJ A;  2W4S A;  3SJZ A;  2H6B A;  2IBD A;  4Q48 A;  4Z03 A;  4G7Z F;  4P6Y A;  1XMA A;  3L09 A;  3ZR8 X;  4LG0 A;  1WP6 A;  1BN5 A;  1H0M A;  1FBS A;  4KIF A;  3OYF A;  1Y1W J;  1J2X A;  3ZPL A;  2JN6 A;  2DER A;  3MWM A;  1EP1 B;  4WWV A;  2FMY A;  3WTW C;  4Y17 A;  2E34 A;  4OU0 A;  1YW7 A;  4YXW A;  1DAR A;  3H9Q A;  4D5F A;  4N3N A;  3GVA A;  3HHG A;  3H5N A;  4F55 A;  2ZSH B;  5D5X B;  1HW2 A;  4UZE A;  1JUM A;  5IP6 A;  1SKQ A;  4BE2 A;  2VBK A;  4CUG A;  2UZK A;  2O6W A;  2RDP A;  2CW8 A;  2HZT A;  3BG9 A;  1BBY A;  1WGX A;  1UCR A;  2UUZ A;  1QUF A;  3BH7 B;  1FYK A;  1KA8 A;  1BI2 A;  3I56 B;  4Y9U A;  2RVC A;  3CDH A;  4BGD A;  4G6D A;  2HEO A;  3GQA A;  2WR8 A;  1N05 A;  1DG1 G;  4JP0 A;  3NAR A;  1LNW A;  2LF7 A;  3F23 A;  2HDW A;  3CMA B;  4A3E J;  1HF0 A;  1OFC X;  1OB2 A;  3ERM A;  4AIH A;  3S3N A;  2EV6 A;  1E0E A;  2VQC A;  5DEQ A;  3CCS I;  1JUP A;  2XAQ A;  3GRH A;  5GAD J;  2R5Z A;  3HUG B;  5HS8 A;  4DQK A;  2OF7 A;  1Y8R B;  3ZPN A;  1TWG J;  1MMA A;  4J01 A;  4ENN A;  2ELJ A;  2XAH A;  1QH0 A;  3U2R A;  5K7H A;  4IEJ A;  1DGR M;  1GV5 A;  3BR2 A;  3MKZ A;  3ZN0 A;  4KFC A;  5KW9 A;  2O1D A;  4R8H A;  4P96 A;  2DPU A;  5H5J A;  2PI0 A;  1GXQ A;  3HGY A;  3FXM A;  1YYV A;  3BCA A;  4MXN A;  3U21 A;  1D1A A;  1T0F A;  2ZFW A;  3M8F A;  3EUH C;  1W0K A;  1BQE A;  3CW2 A;  5E20 A;  3DP7 A;  1U9O A;  4AWX B;  3OEH A;  3V76 A;  3N4M A;  1R58 A;  3S3O A;  4BAY A;  4YAF A;  2PJP A;  2OTL B;  4UUS B;  2O17 A;  3OPO A;  2WZP P;  3LSJ A;  4HLX A;  3LVB A;  1JGS A;  2VBY A;  3H36 A;  1I6H J;  2RV8 A;  1WJC A;  4TT3 A;  4C43 A;  3G71 I;  3NWS A;  5CVR A;  2BN4 A;  3BTJ A;  1ETK A;  1HW1 A;  2ZNY A;  1LM1 A;  4P12 A;  2E1C A;  2GIZ A;  1QGY A;  3SKB A;  5EG0 B;  1NH3 A;  3VSV A;  1X1C A;  3GTO J;  1R5B A;  2VPR A;  1V0E A;  2HTS A;  2G9W A;  1QA6 A;  3LNQ A;  4XLP F;  5B5E C;  4P6V F;  4HNU A;  4OPW A;  4Q4Z F;  1L3L A;  2VBU A;  4RB3 C;  5J47 A;  2L9R A;  2Y31 A;  4UAJ A;  1N08 A;  1T6S A;  4A3M J;  1HDP A;  1WFX A;  4AC0 A;  1H9T A;  3WWG A;  1TL8 A;  4PC3 A;  2GQF A;  2R93 J;  4FT8 A;  1EWY A;  4H9G A;  1KZL A;  3W2A A;  3OMY A;  5E18 F;  1Z6T A;  2E1M C;  1IRG A;  2ZME C;  5F6F A;  2LZJ A;  2RKH A;  1NHA A;  2XT4 A;  3GQ7 A;  1IG7 A;  1MBF A;  5FKL A;  3I4M J;  2FBH A;  3DU6 A;  2LDU A;  2XTX A;  3I55 I;  4PC2 A;  3B8H A;  1B59 A;  2XZP A;  4YHB A;  1R1V A;  1QVT A;  1BHE A;  2M34 A;  3ASS A;  3LSP A;  2C77 A;  3LL7 A;  1SFK A;  5D8L B;  3FM3 A;  3OZW A;  1CGP A;  4GDF A;  2UVF A;  3MD2 A;  3J7Z I;  4Z4W A;  2EFP A;  4EEF G;  4HRI A;  3G73 A;  4YRV A;  4Z1M A;  2CRV A;  2P0W A;  2VNK A;  2VFQ A;  2QKL B;  1HBX G;  4XKB A;  1TQI A;  3O3K A;  3OYN A;  4A12 A;  5IK2 A;  3S8P A;  2GOM A;  4TMV A;  3MEX A;  1ZKG A;  3HOS A;  3M3Y J;  4N4N B;  2L4M A;  3ZXS A;  3ML6 A;  4KIT B;  2P5L C;  5K7Z A;  4IJA A;  4M0L A;  1KGS A;  4A3D J;  3VNV A;  2BM4 A;  5EEG A;  3WGI A;  2HZD A;  1KRH A;  1BR4 A;  2VOO A;  2FQ4 A;  4JX5 A;  4RGU A;  4RM2 A;  3JRG A;  4OJO A;  2XDV A;  1T2K A;  1LLW A;  1XN7 A;  1U8R A;  2C78 A;  2Q2E A;  2YSR A;  4UVA A;  5IYC J;  2E1N A;  2FD5 A;  1IA5 A;  3FMQ A;  1YQA A;  5FGM A;  2LTP A;  5HXB A;  1VF9 A;  3HRS A;  1RQP A;  1JI8 A;  3R4K A;  1KTW A;  1JTA A;  2ODL A;  5M5W J;  1MDM B;  4XR6 A;  4ANJ A;  5JVT A;  3HG9 A;  2VL8 A;  1OCO H;  1JHF A;  4HAM A;  3KP5 A;  2ESN A;  1H8A C;  4GCV A;  3IH2 A;  1N0V C;  3S15 J;  3OYC A;  1ETQ A;  4XN3 A;  2QLZ A;  1U2W A;  2IXS A;  3LST A;  3EYI A;  3CCV B;  4X6A J;  1T08 B;  2ZZQ A;  2KT0 A;  3VMF A;  4H4K C;  4C2L A;  3CCQ B;  2D1H A;  1VQ5 B;  1P4A A;  1R9T J;  2KMU A;  4RGX A;  2E5N A;  1T38 A;  3AAF A;  1UD3 A;  1ZH5 A;  2DU9 A;  3BLY A;  2A69 F;  1I8D A;  5F0F A;  1F9N A;  1F36 A;  2Y9Z A;  5GAH J;  2WBM A;  1RKW A;  4U87 A;  1KYW A;  2MFZ A;  2O04 A;  3FZV A;  1TWF J;  3K70 D;  2A5Y B;  3BR5 A;  2PMH A;  3BOQ A;  4GYI A;  2V7V A;  3FDY A;  1ETW A;  1T56 A;  2H1L A;  5FO5 A;  3V8L A;  3OL4 A;  4ENJ A;  3JUR A;  3QPH A;  1VLO A;  1W9X A;  2V31 A;  4Z4S A;  3N05 A;  4MHG A;  4ZTJ A;  1Z3X A;  4KKS A;  2DLL A;  4II3 A;  2ZSI B;  5DTD A;  3SZG A;  5LGT A;  1EP2 B;  2R7O A;  2QSH X;  1GAQ A;  1O8I A;  1J7K A;  2Q6L A;  5TV2 A;  1YX3 A;  3FK7 A;  3CP8 A;  3JRH A;  2KDZ A;  1CQT A;  3M1C A;  2E5Z A;  4A3C J;  1O88 A;  3NE5 B;  3PNV A;  2WC2 A;  2QEX B;  1CF7 A;  3FIW A;  1NB0 A;  1R5G A;  4RD1 A;  4CCJ A;  2CBX A;  4G1V A;  1K83 J;  2PFB A;  5IYR A;  3F8B A;  1ZM2 A;  2DFH A;  1TQM A;  3PL8 A;  4Q5S F;  1P6R A;  1CZF A;  1B23 P;  1ZM9 A;  4RD0 A;  4TMT A;  3VWB A;  1VQM I;  1R49 A;  5FO1 A;  4HYE A;  1IO2 A;  2VBV A;  2L7K A;  4RD2 A;  4RLQ A;  2EIX A;  2VBE A;  2E2H J;  1RET A;  4FX4 A;  2GLO A;  1AIR A;  4P25 A;  1XS9 A;  2CV1 A;  2ZNZ A;  3NAW A;  5B3S H;  2Y0M A;  4CCO A;  3IP4 B;  2QQ9 A;  4XD7 A;  1OB5 A;  1X19 A;  2DDB A;  1ZAO A;  5KNL A;  4PMH A;  2DYI A;  3OYM A;  5IP7 J;  4L0Y B;  1LEA A;  2KIU A;  4HX4 A;  5E3M A;  4TMX A;  3C2B A;  5D4R A;  4RB2 C;  1Q86 D;  1TYU A;  1TC3 C;  3I5U A;  3RYR A;  1BPL A;  1I7P A;  2XKP A;  4TMW A;  1VLY A;  2D5V A;  3OV8 A;  1Y39 A;  3A1P A;  4Q7J B;  2CMP A;  2PX9 A;  3OY9 A;  4TKO B;  4IXA A;  1B9N A;  2KRH A;  2QY1 A;  2L54 A;  4OZZ A;  1KCC A;  3CCM B;  5JFR A;  3BY6 A;  3QPL A;  3OYA A;  1PUE E;  1W4M A;  3CP2 A;  4B09 A;  2DA5 A;  2FBK A;  2V7F A;  4UY8 I;  3CD6 I;  2VQH A;  4P55 A;  2F1M A;  1IN5 A;  1W7P B;  1TNS A;  3T56 B;  5CQG A;  1W1W E;  1SFU A;  3DDY A;  1OOC A;  3ELK A;  4AD9 A;  3FKI J;  3QSY A;  5ILS A;  2JJ1 A;  2P6S A;  3P9I A;  4MFE A;  3L9F A;  5FLX Z;  2PMZ A;  6PAX A;  2GPJ A;  5LLQ A;  4P22 A;  1QCX A;  2O5R A;  3AVV A;  4MEX F;  2KIS A;  5JHF A;  1O8J A;  3V8K A;  2DMN A;  4D7N A;  3ZSC A;  2VJJ A;  4HX8 A;  3TED A;  2XRN A;  1TYX A;  4X7C A;  1I5Z A;  4NQW A;  2LR8 A;  3MHP A;  2JJ2 A;  3VFZ A;  4RD4 A;  2FSW A;  2X1C A;  1JHH A;  1M1K D;  3AK5 A;  1VQ8 I;  3ZMZ A;  2VQL A;  3A03 A;  4XIC A;  2DXI A;  1FOW A;  1UD4 A;  3LNN A;  3OEE A;  4AYB N;  5AN9 A;  5E3O A;  2WZN A;  3DLA A;  2R0Q C;  2F4I A;  1EJ9 A;  1WOP A;  3CCL I;  2FU4 A;  5FNZ A;  4CQJ A;  3BQJ A;  1VQN B;  3S14 J;  3A2K A;  2CO5 A;  1QG0 A;  2HYJ A;  3DWL E;  3L00 A;  1TTY A;  2CW7 A;  4G94 A;  5DM7 F;  4PGH A;  2VJI A;  5C3E J;  2DQL A;  5L3B A;  2XNJ A;  3RJP A;  2HWV A;  1NG7 A;  3DEU A;  4MTE A;  5DYM A;  4FCY A;  1NK3 P;  2BVN A;  2OYN A;  5D6F A;  1TSP A;  2STW A;  1RI7 A;  3TH0 A;  4RAZ A;  4EAT A;  2K85 A;  3OZV A;  4BUP A;  2W7N A;  4RLF A;  5IT9 K;  1T5E A;  3GYH X;  4MYT A;  1A8P A;  2W00 A;  1UZC A;  1IW7 F;  1DDN A;  1R7J A;  3DTI A;  3M9A A;  4PJJ A;  2CF4 A;  1T39 A;  2OBR A;  2RQP A;  4A0Z A;  2IAI A;  2QSG X;  2X6O A;  2DT5 A;  1J5Y A;  1R23 A;  1IV8 A;  1VQ4 I;  1IXC A;  2QGU A;  3PUB A;  1K79 A;  4RAY A;  1K78 B;  2A07 F;  2WB1 N;  4XLN F;  2YPR A;  1FT9 A;  2TCT A;  2FA5 A;  1B4A A;  1MW7 A;  1QFY A;  4G6I A;  4ZDP A;  2JQ7 A;  1VZ0 A;  3GUD A;  3GLX A;  4LD5 A;  1Z1D A;  2VUM J;  2V9P A;  2G0Y A;  2F5F A;  2IPQ X;  4ZCI A;  1XD7 A;  3B6C A;  3GQ8 A;  4ESB A;  1EP3 B;  2IS4 A;  2PIA A;  2EQR A;  1S5L C;  4WCG A;  1O8D A;  4M3B A;  4BHC A;  4M2L A;  3CDI A;  4XLF A;  2Q2E B;  1Q82 D;  3P9K A;  4EMS A;  5DD8 A;  2BYV E;  2KP6 A;  3GFJ A;  1ZAR A;  3TW7 A;  3TOA A;  3ZMD A;  1SAX A;  3FKS A;  1U6G A;  1N25 A;  2CND A;  1FNN A;  3BCD A;  1W5C C;  3V7A A;  1STZ A;  3ZQL A;  3PVD A;  1PJR A;  3BTC A;  1MKM A;  3GTP J;  5LRR A;  1UB9 A;  3BR0 A;  4A3F J;  2KJB A;  3RPQ A;  1Y1V J;  1PJ6 A;  4OJ6 A;  4UZU A;  3ZOB A;  3WTX C;  2PEX A;  3ABM H;  1MBG A;  3Q5F A;  4DNR B;  1LFU P;  3K4N A;  2R7V A;  3UW0 A;  2DTR A;  2WTE A;  3EQL F;  5FKK A;  3JW4 A;  3NRV A;  4I6Z A;  4BAC A;  5FO0 A;  3AG2 H;  3HM5 A;  2QQB A;  3IWZ A;  3VYS B;  3IRQ A;  1Q1H A;  2DO7 A;  2EV5 A;  2P5K A;  1XPX A;  1ZQ3 P;  3DPL C;  4L5J A;  1YI2 B;  2RAE A;  2ZC2 A;  2QA4 I;  2IJL A;  4EJT A;  4IHS A;  3H5A A;  3OW2 B;  2MH9 A;  5AMV A;  4HF0 A;  3W5U A;  4KDP A;  2R7Z J;  3T8T A;  4X0C A;  2XTW A;  2FEZ A;  4XQF A;  2EB7 A;  3KEO A;  4LLG F;  4QHY A;  3IKV A;  5L46 A;  2DOD A;  1MBJ A;  3LFU A;  3G1L A;  5IT9 Z;  2I1L A;  4WXH A;  1U5T A;  2PJR B;  1Y8Q B;  1SFX A;  2OZU A;  5FKM A;  5K7F A;  2VYQ A;  1EKE A;  3BZC A;  4WXD A;  1UEL B;  4A69 C;  1T6Y A;  2OA4 A;  1R1U A;  3T8R A;  4HQM A;  3MQ0 A;  4IOC F;  1FTT A;  3E6B A;  4AVP A;  4LBW A;  1HZE A;  1KU3 A;  1MDM A;  4RA2 A;  2Y75 A;  4L9V A;  2LBF B;  2A6T A;  4IQJ A;  3A8J A;  5TR9 A;  3GQ9 A;  3WG7 H;  3JSO A;  1W0U A;  1LVA A;  1J59 A;  4QTR A;  3GTJ J;  1RUN A;  2GXB A;  2VC0 A;  4Z4T A;  2LBF A;  4RBO A;  3CCE I;  1MNM C;  3G4S B;  2ETH A;  3GF2 A;  4G7H F;  1EV7 A;  4F7D A;  2V7X A;  4XLH A;  5J1R A;  1YRN B;  4BDY A;  4M73 A;  1O8G A;  1OJL A;  1JKR C;  2CU7 A;  4LC0 A;  2CG4 A;  1KJZ A;  4II2 A;  4X0G A;  3H5R A;  1KQ8 A;  3H9J A;  3ABK H;  3A4C A;  4P3I A;  3WBK A;  5GAE J;  1JGG A;  2HVQ A;  4L9T A;  4XRS G;  3HRT A;  3A8I A;  4HV6 A;  2QKM B;  4I98 B;  2MBF A;  5BMZ A;  3L2V A;  2Q0O A;  1PDN C;  1R22 A;  4HDU A;  1HKS A;  1MGT A;  3CCU I;  2W6J A;  5DNS A;  1AHD P;  2I8D A;  3QWL A;  2CUF A;  2HU9 A;  2XUB A;  3F6V A;  2LKS A;  3RQI A;  5H2F C;  5D5V B;  4EJV A;  2VFP A;  1H85 A;  3J81 K;  1O3R A;  4RAF A;  5DS9 A;  4A0Y A;  1ON2 A;  1IN8 A;  1S9H A;  4M74 A;  4AVZ A;  1P4X A;  3D5S C;  2HDC A;  4B4C A;  4Q47 A;  4HZF A;  3RPU A;  3ZQI A;  2R7Q A;  4YFN F;  3Q38 A;  3K2A A;  1DBG A;  4N3G A;  4Z05 A;  2R3S A;  5M5Y J;  3VSK A;  4QUZ A;  4IHX A;  2D45 A;  3RKY A;  3GLL A;  4LIV A;  4RPD A;  3G6E I;  4RCZ A;  3KP3 A;  1YHQ I;  4XBF A;  3C7J A;  4F91 B;  4OM9 A;  2XPW A;  1YJ9 I;  3OSF A;  2GK7 A;  2CQ7 A;  3SYT A;  5IYN A;  2L2O A;  1VQM B;  4Y9R A;  4IRH A;  4ITV A;  4P1W A;  4ZYD A;  1KK3 A;  2ZFU A;  1MSE C;  1VQ8 B;  1RWR A;  3I1F A;  1B9M A;  2FNP A;  1OGJ A;  3FBN B;  1QVU A;  3HKZ A;  1VTN C;  1X1D A;  3G3Z A;  3K7A J;  2WSS A;  1WI3 A;  2IA2 A;  4EM1 A;  3CUQ C;  3CCL B;  3HPH A;  2VNJ A;  1Y0U A;  2R7R A;  4RGS A;  2QZ8 A;  5JLW A;  4IHW A;  1LDK B;  2I5U A;  2PLF A;  2K02 A;  1U2R A;  4EJO A;  2JDI A;  2RN7 A;  1YOV B;  4ENM A;  4TMZ A;  2DCU A;  1IN4 A;  3U1K A;  1CLW A;  3QU3 A;  3HOW J;  3K1P A;  5LEK A;  2ZBV A;  4KN7 X;  3A02 A;  4E6K G;  3CCM I;  2XNC A;  3DTK A;  1VFC A;  2FML A;  3Q0V A;  3RDI A;  4HDV A;  2XOK A;  2VFO A;  2X6X A;  1WCM J;  3I56 I;  2YUH A;  1X3Z B;  4ASU A;  4BXU A;  4UNO A;  2X6Y A;  4E7H A;  4ZC3 A;  2YWF A;  2NTP A;  4YEL A;  2Z5U A;  3FBI B;  2M0C A;  2V4J C;  2K7L A;  2R7F A;  3BWG A;  1EF4 A;  3U6B A;  2FQ3 A;  3BR1 A;  5JHU A;  4IKF A;  4BBS J;  2DMT A;  2WY7 Q;  1A6I A;  2VZL A;  4OP7 A;  2UVE A;  3OYK A;  1QFJ A;  3Q6R A;  4WK8 F;  2ZL7 A;  4OMY A;  4L5I A;  5CQE A;  2C5B A;  5IYQ A;  5CJ9 A;  1H42 A;  1VQ6 I;  2VE9 A;  5D5W B;  1U3E M;  2KVO A;  3PUM A;  3Q0W A;  2J5P A;  5HDN A;  3JRB A;  4YEI A;  2K4J A;  2XVC A;  4ZJZ A;  2W57 A;  3DPU A;  4XRS A;  1U0J A;  1SMT A;  5E8G A;  3FXQ A;  3IL2 A;  3WTV C;  3JTG A;  2VLA A;  2B7C A;  3OR1 C;  2KL4 A;  3BJO A;  4HEA 2;  1X3W B;  3SZT A;  4G6Q A;  1SM4 A;  2F5V A;  2NV4 A;  3KPH A;  3TDZ C;  5HVQ C;  1FSE A;  1QQI A;  5E6T A;  2JWT A;  3RCO A;  2K9S A;  3QPT A;  1GJR A;  5IYB J;  5K1Y A;  2MLK A;  4HW0 A;  1YS7 A;  1UD8 A;  1BN8 A;  1QRC A;  5KCM A;  1X0C A;  3H3V K;  3OE7 A;  1K78 A;  1J9I A;  1VQO I;  4RD6 A;  4FQG A;  2W48 A;  3BG5 A;  2QQ8 A;  4Z4V A;  3HOY J;  2G7H A;  3F72 A;  1WJ5 A;  3FXL A;  1LLZ A;  3HXL A;  5M3M J;  4E7S A;  3GZ6 A;  2V1D A;  1Q1V A;  1EH8 A;  1NDH A;  1D5V A;  1MMG A;  2RQQ A;  2YS9 A;  1ZHF A;  3H09 A;  2XIG A;  5GV7 A;  3BY1 A;  3LSI A;  1VQK I;  2BX6 A;  4CHU A;  3VSU A;  1B72 A;  3RKX A;  2YWG A;  2M5W A;  4PAA A;  5E8I A;  2X0K A;  4DK1 A;  1W5T A;  2EZK A;  3E6D A;  1I6X A;  2ZL6 A;  1IRF A;  3CDL A;  4A6D A;  2D3N A;  2Y30 A;  2OU2 A;  1W35 A;  1MRZ A;  3OAA A;  1U8B A;  4UB6 C;  1QJV A;  2NST A;  2O0V A;  3I0T A;  1K7A A;  2EFN A;  2FE3 A;  3GTL J;  2P4W A;  2ZO4 A;  3HDD A;  5KK1 A;  3B82 A;  3VO2 A;  1WJF A;  5H6Q A;  5ICF A;  5D4S A;  1KQ5 A;  3WNB A;  1B1B A;  4IF4 A;  1AIP A;  1NRK A;  2PMU A;  3CMM A;  1S8N A;  1S72 B;  3BTI A;  1FOK A;  1ZGJ A;  1X1A A;  2X48 A;  1EE6 A;  1OFD A;  2E2I J;  4NC7 A;  1BOA A;  3BP8 A;  3AVU A;  5EG0 A;  3QYF A;  2NXN B;  1FPQ A;  2XGE A;  4BE1 A;  1PVE A;  3HOU J;  1K73 D;  3WQZ A;  4FK8 A;  3GSI A;  2DMP A;  2V7T A;  2V6C A;  3CTA A;  2JPB A;  3RY8 A;  3ZN1 A;  2EZL A;  2WJY A;  4RPB A;  4F7Z A;  2CWE A;  2ELK A;  2HDN B;  1FIA A;  1WKM A;  3CJQ B;  4R71 A;  4ZCL A;  4IZZ A;  1ZYR F;  5BS6 A;  2XAJ A;  3PIO F;  4QPQ A;  4CCM A;  3KLN A;  2IA1 A;  3HRM A;  2GWR A;  5JR3 A;  3V7R A;  1FSH A;  4JMQ A;  4QPO A;  4LK1 F;  5HZA A;  1F1Z A;  1E1Q A;  3H1C A;  1XSX A;  1JUS A;  3Q3A A;  1XSV A;  4EM0 B;  5ICC A;  4HLY A;  3RIQ A;  1GV2 A;  2R9V A;  1R5N A;  3WU2 C;  1N06 A;  4V19 K;  4PFO A;  1U78 A;  2GK6 A;  2WPD A;  2ZXJ A;  2RGV A;  1BW5 A;  4OPO A;  1Z6R A;  3V42 A;  3DPT A;  2XB0 X;  2H1K A;  1GR1 A;  4WWC A;  1O57 A;  1QPI A;  3ISX A;  4E7L A;  2XGX A;  3QP6 A;  4RLZ A;  5FLX K;  1Y0R A;  2DIE A;  3BY2 A;  2XAS A;  1MBK A;  1O8K A;  1UST A;  3P27 A;  2XV4 S;  1DGW Y;  1HKQ A;  4UVB A;  1H88 C;  3IUO A;  1QBJ A;  4LBV A;  4RM0 A;  1U5T C;  1YIT B;  1XC5 A;  3N97 A;  1SD5 A;  3ABU A;  1G3S A;  2VAS A;  2R5Z B;  1JTX A;  2HQN A;  3DBR B;  4XSX F;  1IF1 A;  3CUQ A;  1HA3 A;  3VNU A;  4KT6 A;  1JTY A;  1RKT A;  1VQP I;  2O9L A;  1FWZ A;  4O6J A;  3H3Z A;  3TKY A;  4BHP A;  5D5U B;  2INU A;  2V1N A;  1WPK A;  3H3U A;  3HOV J;  2BSP A;  3OSG A;  2VXD A;  4A0X A;  3BR3 A;  4RDJ A;  4E70 A;  2OBT A;  3PUN A;  4DK0 A;  3J7A Y;  3WYA A;  1QUE A;  4P9S A;  4U9U A;  3CXC B;  2CQX A;  1XX5 A;  1YTY A;  3W5H A;  3T51 B;  5BPI A;  3W3C A;  1P7J A;  2EV0 A;  1DDI A;  4ZYE A;  1S4M A;  3PA1 A;  1DPR A;  1XGO A;  1YW9 A;  2KHM A;  3CJN A;  3RTR A;  3FXO A;  4NB5 A;  3A3G A;  4D7M A;  5C1E A;  2RNG A;  1XDU A;  3VYR B;  1SVO A;  4M9X A;  3GTQ J;  3Q3S A;  4AUX A;  2ZZE A;  2M0M A;  4MFD A;  4FTH A;  4B4D A;  1OCT C;  2AQE A;  3FK6 A;  2XAU A;  4X06 A;  1A04 A;  2L7M P;  4FAS D;  2JA7 J;  1D1B A;  2WAE A;  3NB2 A;  3I3L A;  4Y7C A;  2ZTG A;  2VOP A;  1YE9 A;  3EUK L;  4XOP A;  4E4H A;  5HZB A;  1UMK A;  1K28 D;  2FNA A;  2OUM A;  3EET A;  2CK3 A;  3PO3 J;  4I84 A;  3IV5 A;  4G7W A;  1L1I A;  3OYL A;  3CPW B;  3EQO A;  5JMC B;  4X1E A;  3BQZ A;  3OOP A;  3HRU A;  3ASR A;  3OR2 C;  1V54 H;  4IHY A;  4OMZ A;  3OIO A;  2JRT A;  2ESH A;  3BRO A;  3HTU A;  3VYU B;  3REO A;  3KEW A;  4Z06 A;  4Z4Y A;  4LJZ F;  2F4N A;  1FOY A;  2R7X A;  1E17 A;  3WGH A;  1S7E A;  3TO6 A;  3TQN A;  4M3G A;  2QSF X;  4BL0 B;  2ZXW H;  4BQA A;  2M5S A;  1R36 A;  2GBY A;  3GEZ A;  4BXX J;  2QX3 A;  1D8J A;  4XLE A;  5J40 A;  1XMK A;  1F60 A;  5C44 J;  2W6I A;  2DY1 A;  1BI3 A;  2IQ7 A;  1ZG3 A;  4M72 A;  3GZ5 A;  1FND A;  2JVG A;  4CYC B;  1DP7 P;  3P26 A;  2Q6O A;  1YLF A;  3F8N A;  1C0W A;  1E79 A;  3VYT B;  2Z99 A;  3E0J B;  5TGT A;  2IT0 A;  2VKV A;  3FMR A;  1FOX A;  3CF2 A;  3S2D J;  1VQ5 I;  1JKO C;  3CC4 I;  3KEQ A;  3HOT A;  2BBY A;  3ZMS A;  1SC7 A;  2CRG A;  1X2N A;  3LQ6 A;  2KJC A;  4ZH4 F;  3RIR A;  1ODD A;  4F93 B;  1ZEL A;  5F08 A;  1M90 D;  3CUQ B;  2XT2 A;  3M07 A;  2MYS A;  2O0Y A;  3A01 B;  3CLO A;  2PE3 A;  3HUG A;  3MVP A;  4KNY A;  3DTE A;  4UV8 A;  4P1V A;  2CUJ A;  4ZZL A;  1BOB A;  3MCZ A;  1O8F A;  3HSF A;  1ZN2 A;  1FC3 A;  2IGN A;  2ZXH A;  2DDA A;  3DBH B;  3CMA I;  1F5T A;  2PLY A;  2UWM A;  2VC1 A;  2GJP A;  3LSM A;  2ECB A;  2GJK A;  3LJY A;  2ID6 A;  2M8E A;  2Y48 A;  3JAM Z;  2D74 A;  3DBL B;  4XL9 A;  3C18 A;  4E7Z A;  2IS2 A;  1D0Y A;  2C5H A;  2K9Q A;  1UFM A;  3PA2 A;  1OHH A;  1VQL B;  5CLS A;  4B3X A;  3KP6 A;  2LOO A;  3J7A O;  5GPC A;  3BC8 A;  2P81 A;  4XOT A;  2CW0 F;  3OIQ A;  2XSJ C;  2EK5 A;  4GGG A;  2AS5 F;  3P7N A;  4ACB A;  2IGO A;  3MFK A;  4WF2 A;  3I4P A;  4BJ6 C;  4FN5 A;  1IB0 A;  3CC4 B;  1IGN A;  1B8I A;  2Y69 H;  3SHF A;  1HQC A;  1K4T A;  2QQA A;  2NPF A;  1ZRD A;  2HQA A;  1ZR4 A;  3KL9 A;  5CVI A;  1A36 A;  1GVD A;  1PP8 F;  4TN1 A;  2R5Y A;  3FXR A;  1IN6 A;  3TO9 A;  5HLH A;  3PSZ A;  2NAZ A;  3UR3 C;  3BR6 A;  5KHD A;  4C9Y A;  4K1X A;  4BQN A;  3A01 A;  4J0Q A;  3KZZ A;  1TT5 B;  4U7B A;  1BA5 A;  2WJV A;  3WBJ A;  4C2T A;  3FX3 A;  3ZMV A;  3K70 C;  3M7G A;  5J4Y A;  4JBA A;  2NZM A;  1ENH A;  3AG4 H;  1WJB A;  2BE5 F;  2DA2 A;  2IEK A;  1IDK A;  3PET A;  2HQ5 A;  2OBP A;  2CH0 A;  3V4G A;  3QU6 A;  2ZBU A;  3PSF A;  4GQN A;  2E36 A;  2XND A;  4UZF A;  5EMN A;  3H9N A;  5HLI A;  5LBQ A;  4ESJ A;  4PSW A;  2FOW A;  3DEE A;  4FHT A;  5GTH C;  4OOV A;  3VB2 A;  4AU7 A;  1V0F A;  3L2Q A;  4S05 A;  3EYY A;  2ZME B;  4B3F X;  2V4D A;  5H59 A;  5F0H A;  4Z6Y A;  4IL6 C;  2BPO A;  2HXO A;  2VKH A;  4LFU A;  2FUG 2;  2NS0 A;  5DUK A;  1XE1 A;  1A31 A;  1OFM A;  3C1D A;  3W2E A;  3CUO A;  2EA4 A;  1B8I B;  2WWY A;  4MTD A;  1E63 A;  2OTJ B;  3GFM A;  3NQO A;  4JYK A;  2GOX B;  3JAM K;  1GAW A;  2VT3 A;  3W5V A;  3WHB A;  2V7Q A;  1RU4 A;  2MC4 A;  2J8K A;  2XGC A;  1AMO A;  4PC1 A;  1RC9 A;  1XSD A;  2D3L A;  3GVK A;  3G71 B;  3HSE A;  3TL4 X;  3ZP5 A;  1QVG B;  2D1V A;  2DA3 A;  2DN0 A;  3GO5 A;  2V1X A;  5FFX A;  2LRD A;  2WAF A;  2IP2 A;  4L9J A;  3T0Y A;  4DYQ A;  3MMP A;  4G8X A;  1KCD A;  1MMS A;  4CSW A;  1MBE A;  2LK2 A;  5DUI A;  1GDT A;  3WTT C;  4IW3 B;  2QUF A;  2ICW G;  1CNE A;  2NTB A;  3AKZ A;  1WQ2 A;  2EWE A;  1R5I D;  3OYI A;  5L3G A;  2X1D A;  2N8G A;  1GUU A;  2QZA A;  1K4Z A;  3B90 A;  1SMY F;  5E1W A;  4ZDO A;  3CB4 A;  2OJE D;  1YIJ B;  1H8E A;  3M1E A;  2M9H A;  4NDL A;  1W36 D;  3OJW A;  1VQ9 B;  4BJT A;  5HOD A;  2KIM A;  5TY0 A;  2GXA A;  3N6Z A;  3I59 B;  1W36 C;  2E71 A;  2V9K A;  2HXI A;  2K40 A;  2XF7 A;  4A5N A;  1G59 A;  3SYJ A;  1BR2 A;  5E3N A;  4XKC A;  1S6L A;  2PQ8 A;  3GFI A;  3ERE D;  3L2R A;  2AHO A;  2DCE A;  5CYV A;  4CCK A;  3BG6 A;  5AIP A;  2VBW A;  4X8I A;  2LP0 A;  2M30 A;  2OK8 A;  3LSK A;  3OIP A;  2F5C A;  1X3U A;  4QFM A;  2D9R A;  3KYL A;  4AID A;  4TV7 A;  4Y4R A;  3A8K A;  5CVJ A;  3VMW A;  4S0H B;  3GZN B;  3VEP A;  5DM6 F;  4M71 A;  1U9N A;  2JJ7 A;  1K4S A;  4PJL A;  2WA0 A;  2PYG A;  3FXU A;  3DKY A;  2H6C A;  3CZ6 A;  4B44 A;  2LY2 A;  2MD5 A;  4DIQ A;  3ISP A;  2WYR A;  2QWW A;  4KIG A;  4YAW A;  3KEY A;  3ESW B;  3QOP A;  5EYR A;  1G6N A;  2CUZ A;  1Y6I A;  1EFC A;  3QYB A;  2HLD A;  5F04 A;  4F3Q A;  1O3Q A;  2BGI A;  5DCM B;  1KC8 D;  2Z2S B;  4B43 A;  2VJ4 A;  5F1J A;  4QVA A;  1JJ2 B;  2O3F A;  1D1C A;  2XKO A;  3KE2 A;  3K4M A;  1JT0 A;  1S29 A;  1QVF B;  4DW6 A;  1BJA A;  2YR2 A;  2KQR A;  2O8X A;  3W2V A;  1YS6 A;  1KU7 A;  1IRZ A;  3HYI A;  3WHC A;  2EFW A;  2IOU G;  4Y52 J;  4OOX A;  1FX0 A;  4RDK A;  5J35 A;  4X7D A;  2LY9 A;  1MBH A;  4E7I A;  3K4L A;  2V9V A;  4LB6 B;  1ZM3 A;  2CQQ A;  4WZL A;  4KIS A;  2XGJ A;  3QP5 A;  1BC8 C;  2Z9O A;  4HQE A;  2ZKZ A;  2O6G E;  5K5Q A;  2F5E A;  3ZPP A;  2PEC A;  1D8K A;  1S7A A;  4OWR B;  3ONY A;  1ZM4 A;  3H94 A;  2NS8 A;  1ZG1 A;  2Y9Y A;  1G2H A;  1OFL A;  2R6H A;  1SD6 A;  4J19 A;  1G7R A;  4G7X A;  4DOZ A;  2F2E A;  2R7U A;  4XNF A;  2A05 A;  4G9Y A;  1FY7 A;  4JX6 A;  5IPA A;  3ML3 A;  2MLG A;  2OQR A;  3IRR A;  2LMD A;  2KZG A;  4N9H A;  1EZG A;  2IVM A;  4E7J A;  2M3A A;  4N0B A;  4BQO A;  2E60 A;  4EM2 A;  4YZX A;  2KRF A;  1O8E A;  3BH4 A;  4RAG A;  4OPV A;  1PE9 A;  2E1O A;  2W1O A;  3ASO H;  3V7S A;  4U7D A;  1HA8 A;  1I27 A;  2DA1 A;  4ASN A;  4BH9 A;  5IT3 A;  5FD5 A;  1F43 A;  2HKO A;  3HAG A;  3HJE A;  1XQB A;  1X4P A;  4HNV A;  5KAI C;  4IPA A;  1TTT A;  1L0O C;  2GXG A;  3I53 A;  1VND A;  1MMD A;  2BY1 A;  3I54 A;  4FE4 A;  3DLL F;  2R7S A;  2ISY A;  1IN7 A;  2BEO A;  3F9K A;  2F1L A;  2DET A;  3P5J A;  1TW3 A;  3JQR A;  2K3P A;  3GTG J;  2DA6 A;  1KQ0 A;  2OK7 A;  3LQE A;  2KKO A;  1WPC A;  4NHJ A;  3CF5 F;  1QFZ A;  4NQW B;  1R6R A;  4B8X A;  1RR7 A;  3FPP A;  2PMZ N;  1VBL A;  2UXN A;  3LMM A;  1ZLK A;  5FIU A;  2L0K A;  2M7A A;  1UG2 A;  2K9L A;  1VQ9 I;  2COB A;  4J00 A;  3OL3 A;  2DOF A;  5HDK A;  1AWC A;  2QBY B;  2X85 A;  1K5C A;  3JRC A;  2AXT C;  4BHB A;  5J1Y A;  1FJL A;  1ZRC A;  2BV6 A;  1UAA A;  5FRM A;  3QYE A;  1XB4 A;  4OJ5 A;  1AOY A;  1D8T A;  1JE8 A;  1DU6 A;  2A5W A;  2TRT A;  4A3B J;  2LFB A;  3JU4 A;  3OYG A;  1KU2 A;  1X2M A;  5KVR A;  4QLC U;  4DBQ A;  1Z77 A;  2JUC A;  4I7H A;  3ES9 A;  3F8F A;  3TOB A;  3SDG A;  3I55 B;  1R00 A;  2DA4 A;  3S3M A;  3JQP A;  4M6Y A;  3QAH A;  3SXY A;  1WRJ A;  4M3E A;  3BZK A;  1RMG A;  5B66 C;  3HIF A;  5TIS C;  5D8K B;  3HPG A;  1J0R A;  2KIQ A;  2V79 A;  4OIP F;  3E5Q A;  2L01 A;  5C4X J;  4U0Y A;  2MG4 A;  3GQB A;  3AVX A;  4M53 A;  2BVL A;  4GYG A;  3OW7 A;  4UUT A;  5IYD J;  2CUE A;  1I50 J;  2BGJ A;  4FE7 A;  2YU3 A;  4PGG A;  4PC7 A;  1XCV A;  2P6T A;  4DJA A;  4Z4U A;  1BIB A;  1KON A;  3CES A;  1YHQ B;  3FXJ A;  3EDP A;  3LSH A;  5EGO B;  4HF2 A;  1PKV A;  2DEU A;  3WU0 A;  2EA2 A;  3O8H A;  4L0Z B;  1O4X A;  2ZJ2 A;  1YIJ I;  3SEJ A;  1V5E A;  2IW5 A;  3W2I A;  5IYW A;  3FWE A;  3A3B A;  2PBI A;  3AL0 C;  4BXF A;  3CCJ I;  2KFD A;  4W97 A;  3BCB A;  4JOM A;  3SDB A;  2DOG A;  3ZRG A;  4YZQ A;  2HYG D;  2G7U A;  4HE5 A;  1IV6 A;  2FX3 A;  2J5O A;  3GX4 X;  2YU9 J;  3AVY A;  2IGM A;  1O3S A;  2JA8 J;  4P26 A;  5IYP A;  2CV2 A;  1Y0N A;  1KQ9 A;  3K69 A;  3J7Y J;  2CSO A;  2HTJ A;  3K4B A;  1QHG A;  4XKW A;  3RYP A;  2R92 J;  3DCF A;  2F5D A;  4MIM A;  2FF4 A;  2ZJQ F;  2KPM A;  3SQV A;  2BM0 A;  1J09 A;  4M3D A;  3H9G A;  3CC7 I;  1Z0X A;  4XM3 A;  2CV0 A;  2P7C B;  4P3Y A;  4E0F A;  4YG2 F;  2B63 J;  4LLL A;  3BPX A;  4G6T B;  1QQ1 A;  1A35 A;  4Z4Z A;  1LE8 B;  3CCS B;  3S17 J;  2HYF A;  5IP9 J;  2EZH A;  3GWZ A;  1IUF A;  3K1N A;  1VQP B;  4R1H A;  5LD2 C;  4EGZ A;  3SY2 A;  2GA1 A;  1O7F A;  5AON A;  3MAJ A;  1IB4 A;  4IRG A;  1QZE A;  3ZQG A;  1QX4 A;  4PC6 A;  1VHE A;  2XHK A;  4Y15 A;  4FET A;  3WXM A;  3PM1 A;  4BEH A;  1KK1 A;  3GVJ A;  2F3L A;  5F4O A;  2EFO A;  2P5V A;  1WSV A;  4KMU X;  2QTL A;  2FRH A;  2OCE A;  3X2Q H;  4CA0 A;  5A2Q Z;  2OPT A;  1OGM X;  3TMO A;  1OKR A;  1VHO A;  3ASN H;  1JKP C;  1SAN A;  1ULY A;  2DAO A;  1G7T A;  1M1E B;  2EIL H;  4M9S A;  3R6S A;  3RKW A;  2M2E A;  4XMY A;  1T6X A;  1YFH A;  3K4K A;  1K9M D;  2ME6 A;  2E35 A;  3CLQ A;  3WNC A;  1HSJ A;  3TBI A;  5DCM A; 
#chains in the Genus database with same CATH homology
 2JSP A;  3PSI A;  3DKX A;  1OB0 A;  2O0W A;  1DGW Y;  2R7W A;  1UD5 A;  2IXS A;  3IUO A;  1EA3 A;  1N78 A;  2VAS A;  2ZZQ A;  4H4K C;  4BQQ A;  3G05 A;  2M4G A;  4C2L A;  2KMU A;  2E5N A;  4KT6 A;  4YZA A;  1T0F C;  1UD3 A;  2INU A;  3BLY A;  2V1N A;  1I8D A;  2K9M A;  4LIT A;  3RPU D;  4HNT A;  2BSP A;  2WBM A;  2VXD A;  2ZXI A;  4U87 A;  2Z8G A;  2MFZ A;  2O04 A;  5CPR B;  3C2H A;  3K70 D;  1LKX A;  4DK0 A;  3J7A Y;  3OEH A;  3FDY A;  1WJD A;  2WAD A;  3OL4 A;  3JUR A;  1W9X A;  2V31 A;  3N05 A;  1N77 A;  3W3C A;  4PUS A;  2X1E A;  4ZTJ A;  1Z3X A;  4KKS A;  5FL7 A;  4F52 A;  4PSX A;  1NBM A;  1E43 A;  2W82 A;  4II3 A;  1NG6 A;  1FMV A;  2LYC A;  2ZSI B;  2KHM A;  3RTR A;  1V5F A;  3SZG A;  2R7O A;  3OOC A;  3A3G A;  1O8I A;  5C1E A;  2RNG A;  4ZTF A;  4IX7 A;  4BU2 A;  1YX3 A;  4NNJ A;  3VYR B;  3CP8 A;  2ZZE A;  2M0M A;  1VJS A;  1QU3 A;  3B8Y A;  3M1C A;  2AQE A;  4CH7 A;  4OZY A;  2E5Z A;  3S93 A;  2XZO A;  2XAU A;  1O88 A;  3NE5 B;  3PNV A;  2XF5 A;  3EUA A;  4FAS D;  4CCJ A;  1D1B A;  2WAE A;  3OYH A;  3I3L A;  2ZTG A;  1K6Y A;  2WAQ A;  1GLN A;  1YE9 A;  3EUK L;  2DT7 B;  2JVH A;  3PL8 A;  4XOP A;  2Z1D A;  4E4H A;  3ZGK A;  2OUM A;  4D1Q A;  1K28 D;  2CK3 A;  1CZF A;  2NT9 A;  1OLT A;  2VXZ A;  3D5R C;  2X51 A;  4I84 A;  3VWB A;  4G7W A;  1V5G A;  2QXZ A;  3OYL A;  4B48 A;  3EQO A;  1X1B A;  1MND A;  2L7K A;  2Q1Z B;  4RLQ A;  3RQ4 A;  3K4C A;  3OR2 C;  2VBE A;  4BE0 A;  1AIR A;  3KEW A;  3VYU B;  2CV1 A;  2V26 A;  2WB1 A;  3IP4 B;  4CCO A;  4XD7 A;  4Z06 A;  5C1C A;  1X19 A;  2R7X A;  4PK4 A;  5KNL A;  4PMH A;  2NSP A;  3OYM A;  1E3X A;  4BL0 B;  1VF7 A;  2M5S A;  3C2G A;  2CS3 A;  4BJ5 C;  2QX3 A;  1BPL A;  4XLE A;  2HVR A;  1VLY A;  2W6I A;  1MAB A;  1WTH D;  2X8K A;  5CDF A;  2CMP A;  3OY9 A;  4TKO B;  2IQ7 A;  2JVG A;  2KRH A;  2OC6 A;  2QY1 A;  4OZZ A;  1KCC A;  3OWT A;  3OYA A;  1P9Q C;  2LY1 A;  3PJR A;  3FY3 A;  4HWV A;  3CP2 A;  1E79 A;  3VYT B;  2V7F A;  3E0J B;  4ZYA A;  2VQH A;  5TGT A;  1COW A;  2F1M A;  4KKT A;  1XG2 A;  2XC7 A;  3CF2 A;  2X3H A;  3T56 B;  4D9J A;  3L2W A;  5CQG A;  1BLI A;  3HOT A;  4W8T A;  3DDY A;  1OOC A;  5FRO A;  2BOL A;  1OR7 C;  2QE7 A;  1UG0 A;  3ONQ A;  2JJ1 A;  4F93 B;  1ZEL A;  3FHN A;  2PMZ A;  1JRG A;  1QCX A;  2O5R A;  2MYS A;  5JHF A;  1O8J A;  3ZSC A;  2LG4 A;  2VJJ A;  1UD2 A;  3DTE A;  2DOA A;  2V6E A;  2CUJ A;  2JJ2 A;  1BOB A;  1SKY B;  1O8F A;  2X1C A;  2NTQ A;  2ZXH A;  2IGN A;  4HST A;  2L5Q A;  3ZCO A;  2UWM A;  2LC2 A;  2GJP A;  3LSM A;  2KZV A;  3SEQ A;  2GJK A;  4FXU A;  2BW3 A;  4XL9 A;  2VQL A;  4NC8 A;  4E7Z A;  2IS2 A;  3DQV C;  2DXI A;  1D0Y A;  1UD4 A;  3LNN A;  1OHH A;  3DU5 A;  4B3X A;  3OEE A;  4W8Q A;  1D0Z A;  2Y0S A;  3DLA A;  2LOO A;  2F4I A;  3BC8 A;  1N75 A;  4XOT A;  2GJR A;  3OIQ A;  2XSJ C;  1MNE A;  3A2K A;  3DWL E;  2CW7 A;  1DQU A;  2VJI A;  2IGO A;  4HSR A;  4BJ6 C;  1NG7 A;  4W8R A;  3IAM 2;  3I9V 2;  1HVX A;  2E1M B;  3K4J A;  3B4N A;  4F92 B;  4EAT A;  5FRN A;  4YZ0 A;  4BUP A;  2W7N A;  4RLF A;  1T5E A;  2HQA A;  2HPM A;  1O8L A;  3EPZ A;  4AYB A;  3E1S A;  4DGW B;  2W00 A;  2IS1 A;  3SEZ A;  3BCF A;  1WMR A;  3DTI A;  2NOJ B;  4PJJ A;  3UR3 C;  4OJL A;  1H8H A;  3EQN A;  1D0X A;  4C9Y A;  5KHD A;  4CCL A;  4NK6 A;  3PUB A;  4BQN A;  2ZTN A;  1PXZ A;  3GBG A;  1MW7 A;  3K6G A;  4U7B A;  2WJV A;  3H0D A;  4ZDP A;  3K70 C;  4C2T A;  4G6I A;  1VZ0 A;  2VB6 A;  2NZM A;  4RMN A;  1WJB A;  1IDK A;  4MR0 A;  2CH0 A;  5HKK A;  4P5O A;  2JIZ A;  2BW3 B;  2R7T A;  3GQ8 A;  3PSF A;  4GQN A;  2IS4 A;  4BEH B;  1KMH A;  1O8D A;  1I18 A;  4XLF A;  2XND A;  2Q2E B;  4PSW A;  3DEE A;  1TZL A;  2KP6 A;  3ZIA A;  2IGK A;  4AU7 A;  1V0F A;  3T53 B;  3L2Q A;  1O8M A;  3FKS A;  3BCD A;  4B3F X;  4DNT B;  1Z21 A;  3PFY A;  2V4D A;  1NHC A;  1PJR A;  2VKH A;  2FUG 2;  4PJM A;  3OFN A;  1Z7L A;  2IS6 A;  1OFM A;  1Z3Y A;  3LSG A;  1W0J A;  3FKJ A;  4OJ6 A;  4UZU A;  4LG3 A;  4R79 A;  2GOX B;  4OAZ A;  4DNR B;  2R7V A;  3K4N A;  1RU4 A;  2V7Q A;  3UW0 A;  2MC4 A;  1OGO X;  1ERD A;  4BAC A;  2D3L A;  3GVK A;  3TL4 X;  2F43 A;  1PLU A;  3VYS B;  2BVM A;  4TSF A;  3IAS 2;  3DPL C;  2VBM A;  3G2B A;  1TT0 A;  2LRD A;  2WAF A;  2WY8 Q;  4NUB A;  1KCD A;  3H5A A;  5AMV A;  4CSW A;  4XLA A;  2JUG A;  2HNH A;  4KJZ A;  2PJR A;  2RRE A;  4XQF A;  2NTB A;  1WJE A;  3AKZ A;  2EWE A;  3OYI A;  3LMW A;  3LFU A;  4GRI A;  2X1D A;  3B90 A;  2PJR B;  1IRX A;  4ZDO A;  2X6W A;  4MLO A;  1DBO A;  1UEL B;  5DN6 A;  1H8E A;  3NWT A;  1W36 D;  3OOU A;  4BJT A;  3WWG A;  1PYV A;  4CCN A;  1HZE A;  1LVK A;  3VDX A;  3OS0 A;  1W36 C;  2VJ5 A;  2V9K A;  2XF7 A;  1G59 A;  2VIX A;  2LBF B;  2A6T A;  4IQJ A;  1BR2 A;  4XKC A;  3OYE A;  3L2R A;  3GQ9 A;  3T9G A;  2DCE A;  4CCK A;  3BG6 A;  2AQF A;  4U49 A;  2MAB A;  3ZQQ A;  3VMV A;  4NK8 A;  2M4K A;  2LBF A;  3HC7 A;  4HG2 A;  4ZDL A;  1YX5 A;  3LSK A;  3OIP A;  3SUC A;  5LFA A;  2KRC A;  4XLH A;  1SAU A;  3KYL A;  4Y4R A;  4BDY A;  1O8G A;  3RSN A;  3VMW A;  4PJL A;  4II2 A;  4X0G A;  2WA0 A;  2ZZF A;  3H5R A;  2PYG A;  3DKY A;  3H9J A;  3BG7 A;  3A4C A;  3MMY B;  4Y3O A;  1GQ8 A;  3CJR B;  2VKD A;  3CZ6 A;  4XLC A;  2HVQ A;  2LY2 A;  4B44 A;  1E3Z A;  3UNG C;  4DIQ A;  2QKM B;  4HIZ A;  5HLT A;  2LH9 A;  3KEY A;  3L2V A;  2KLO A;  3HL2 A;  4B3G A;  2CUZ A;  4W8S A;  1Y6I A;  1HG8 A;  3QYB A;  2W6J A;  1E1R A;  2HLD A;  2I8D A;  4F3Q A;  2HU9 A;  3KRG A;  2Z2S B;  4B43 A;  2VJ4 A;  2XZL A;  2PYH A;  3QOD A;  1D1C A;  1LFP A;  4OJP A;  2M7B A;  2L9N A;  3K4M A;  1IDJ A;  1S9H A;  2Z16 A;  4AVZ A;  3D5S C;  4U4B A;  2KQR A;  2R7Q A;  3W2V A;  4LIU A;  3PNT A;  1DBG A;  4Z05 A;  3OYB A;  1FX0 A;  4PJN A;  3VSK A;  4XN0 A;  4E7I A;  3K4L A;  4OAY A;  1G8X A;  4LIV A;  3K10 A;  4KIS A;  3W2W A;  2Z6B D;  2XGJ A;  4B47 A;  4F91 B;  3ZPP A;  2CFO A;  2VPL A;  2GK7 A;  2PEC A;  4XON A;  3PNY A;  4OWR B;  2OV7 A;  3SYT A;  3H94 A;  1BR1 A;  2L2O A;  4RM3 A;  5HOO A;  3A35 A;  2W4S A;  3BC9 A;  3GVL A;  3T51 B;  2MD0 A;  1OFL A;  4Z03 A;  4ITV A;  1FMW A;  4P1W A;  2ZFU A;  4G7X A;  1WP6 A;  3ZR8 X;  1RWR A;  4DOZ A;  2R7U A;  3OYD A;  4XNF A;  3OYF A;  1UD6 A;  3QOE A;  5HNF A;  3S32 A;  3FBN B;  4E7J A;  3HKZ A;  2M3A A;  4BQO A;  1X1D A;  2E60 A;  4YXW A;  3H9Q A;  2WSS A;  4YZX A;  1O8E A;  2F6C A;  3H5N A;  4F55 A;  3HPH A;  2ZSH B;  3BH4 A;  4URR A;  3M8J A;  1PE9 A;  2R7R A;  2W1O A;  2DJI A;  4BE2 A;  2VBK A;  1LDK B;  4CUG A;  1HA8 A;  2CW8 A;  2JDI A;  2UUZ A;  4BS9 A;  3OS1 A;  3KX2 A;  3HAG A;  2VQG A;  4BGD A;  3GQA A;  1X4P A;  3AL0 B;  4E6K G;  1T95 A;  2R7S A;  2ZZG A;  1MMD A;  4P22 A;  3OYJ A;  2HDW A;  3DTK A;  3F9K A;  4C30 A;  4CZC A;  2K3P A;  3S3N A;  2XOK A;  4E7K A;  1E0E A;  2VQC A;  2HVS A;  2X6X A;  1WPC A;  3GRH A;  3HUG B;  4ASU A;  3ZPN A;  4NQW B;  1R6R A;  2KDO A;  1MMA A;  4J01 A;  2ELJ A;  3FPP A;  2X6Y A;  4E7H A;  4ZC3 A;  1VBL A;  2NTP A;  3LMM A;  4YEL A;  1DGR M;  3FBI B;  2V4J C;  4PFP A;  2M7A A;  2K9L A;  3MKZ A;  4IKF A;  2WY7 Q;  4J00 A;  3OL3 A;  2NT6 A;  3OYK A;  2K5C A;  2UVE A;  2O1D A;  2X85 A;  1K5C A;  4YEJ A;  1UAA A;  5CQE A;  5FRM A;  3QYE A;  3BCA A;  4MXN A;  3U21 A;  1D1A A;  3MKW B;  1W0K A;  4OJ5 A;  3EUH C;  2KVO A;  2A5W A;  2L9S A;  1WJA A;  3JU4 A;  3OYG A;  1X4O A;  3S3O A;  4DBQ A;  4ZJZ A;  2O17 A;  3DPU A;  3OPO A;  2WZP P;  1U0J A;  3VST A;  3S3M A;  2VLA A;  1WJC A;  4TT3 A;  4C2U A;  3OR1 C;  2KL4 A;  3NWS A;  4DBR A;  3MKY B;  1H80 A;  4HEA 2;  1RMG A;  3HPG A;  2F5V A;  5HVQ C;  2X53 S;  3GQB A;  4IQ4 A;  3RCO A;  2BVL A;  3VSV A;  1X1C A;  3H35 A;  1UD8 A;  3OW7 A;  1X0C A;  3L2U A;  1V0E A;  5KCM A;  2E1B A;  1BN8 A;  2LRE A;  4DJA A;  3OE7 A;  3D5L A;  1KON A;  3CES A;  4HNU A;  1PKV A;  3LSH A;  3OS2 A;  1WJ5 A;  1DP3 A;  4L8J A;  3HXL A;  4E7S A;  1WFX A;  1EFR A;  1V5E A;  1MMG A;  2RQQ A;  3A3B A;  1KZL A;  3AL0 C;  3W2A A;  3OMY A;  4BXF A;  1AA7 A;  2E1M C;  4BDZ A;  1MMN A;  3BCB A;  4JOM A;  3SDB A;  2LZJ A;  3ZRG A;  4YZQ A;  3GQ7 A;  3LSI A;  4EW9 A;  3VSU A;  2XF6 A;  3DU6 A;  4DK1 A;  2JA2 A;  4XKV A;  4JQF A;  2XZP A;  2D3N A;  2IGM A;  3OAA A;  1BHE A;  1QJV A;  2CV2 A;  2NST A;  2O0V A;  3K4B A;  4XKW A;  3LL7 A;  1QHG A;  1SFK A;  2INV A;  2UVF A;  1WJF A;  2HPI A;  2KPM A;  3MD2 A;  2UV1 A;  3VR6 A;  4HRI A;  1J09 A;  4XOR A;  4YRV A;  4Z1M A;  2P0W A;  3VSL A;  4N4O B;  1NRK A;  3H9G A;  4HPQ A;  3CMM A;  2DT6 A;  4XM3 A;  2QKL B;  2CV0 A;  3A1Y A;  4XKB A;  4E0F A;  4G6T B;  1X1A A;  1EE6 A;  3OYN A;  5IK2 A;  4NC7 A;  3S8P A;  1O8H A;  2GOM A;  3QYF A;  4BE1 A;  1BMF A;  3HOS A;  4N4N B;  3WQZ A;  5LD2 C;  3ZXS A;  4KIT B;  1QHH D;  1IB4 A;  2WJY A;  2HZD A;  1BR4 A;  3CJQ B;  4FET A;  4RM2 A;  4OJO A;  2XDV A;  4KKU A;  4IZZ A;  4BEH A;  2R4G A;  4QPQ A;  4CCM A;  3GVJ A;  5CKT A;  4CA0 A;  4JMQ A;  4QPO A;  1OGM X;  3TMO A;  1IA5 A;  1E1Q A;  1JI8 A;  1KTW A;  2R9V A;  1JTA A;  2ODL A;  4XR6 A;  4ANJ A;  4PFO A;  3HG9 A;  2GK6 A;  2VL8 A;  2WPD A;  4XMY A;  4Y33 A;  3V42 A;  5HNH A;  3DPT A;  3K4K A;  4E7L A;  2DIE A;  3TBI A;  3OYC A;  4XN3 A;  1Y56 A;  1O8K A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...