4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
2O04A 2O17A 3KRGA 4YZXA 1BN8A 1XG2A 3GQAA 2IQ7A 4NK6A 4YZAA 3VSTA 1BHEA 1IDJA 2VBEA 4OJOA 4YZQA 2NSTA 1KCCA 4I84A 1KCDA 3JURA 1O8JA 2NTBA 1OFMA 4MXNA 4U4BA 2VJIA 1QJVA 4OJ5A 4Z05A 2X6WA 5C1CA 1CZFA 1VBLA 4Z06A 4U49A 3VSVA 2X6YA 1QCXA 5C1EA 4AVZA 4URRA 2NSPA 1PE9A 4XMYA 1IA5A 1NHCA 4OJLA 2UVFA 4XKWA 1O88A 4XOPA 4W8TA 4NK8A 2NTQA 4XLCA 3T9GA 1WMRA 2NT6A 1X0CA 1OFLA 1AIRA 3B8YA 3VMVA 2VBKA 4XLEA 2PYGA 4OZZA 2INUA 5AMVA 4XLAA 4Z03A 3GQ9A 4YZ0A 1O8HA 4XNFA 4XLHA 2QXZA 2X3HA 3B4NA 3EQOA 4XM3A 1HG8A 2O0VA 2X85A 4OJPA 4PMHA 4XN0A 1PLUA 1JRGA 1RWRA 3LMWA 4HWVA 1O8FA 1KTWA 2QY1A 2BSPA 1DBOA 2PECA 1IB4A 2NZMA 3VSUA 1IDKA 4XOTA 4XONA 1JTAA 2VBMA 3GQ7A 3EQNA 3VMWA 2ODLA 4EW9A 4XR6A 2PYHA 4XN3A 2Z8GA 2O1DA 1K5CA 4XORA 2O0WA 2QX3A 3ZSCA 4C2LA 2UVEA 3FY3A 1OGMX 1RU4A 2NTPA 1EE6A 4OJ6A 4XKVA 2EWEA 1OGOX 2X6XA 1O8LA 2VJJA 1O8KA 1H80A 2NT9A 4W8SA 4XQFA 3SUCA 4YELA 1O8EA 1O8MA 3GRHA 4XL9A 4W8RA 4OZYA 1DBGA 1O8DA 1RMGA 3B90A 3WWGA 3UW0A 4XLFA 1GQ8A 1O8GA 4W8QA 1OOCA 3GQ8A 2INVA 4MR0A 3ZPPA 1PXZA 4YEJA 1O8IA
chains in the Genus database with same CATH superfamily
4AIDA 3CXCB 4QTRA 4HNUA 1XG2A 1W7PD 2VBYA 3VODA 3FIWA 4NNJA 1RIOH 4M74A 5CQGA 1K78B 1EKEA 2A5WA 1WJ5A 4Y3OA 2PJRA 3EDPA 2ZL7A 2PX9A 2VBEA 1BA5A 3T51B 4Z4VA 4OJOA 1UELB 5H59A 1RKWA 2XT2A 1SFUA 3KLOA 2V6EA 4MHGA 3JURA 2X1DA 1VQOI 1R00A 2BY3A 3JW4A 3M8JA 1PUEE 3G6EI 2LDUA 4D0PA 1OR7A 5CQEA 2I1LA 3BP8A 1Q7YD 2XZLA 4OJ5A 2QEXB 1SKYB 5E20A 2P0WA 4FISA 4IHSA 1KTVA 3WTZA 1O3TA 3ZQQA 2DERA 4YFOA 4RD2A 1DU0A 1JI8A 3D5RC 2GIZA 1H9GA 3CZ6A 3AAFA 4L0YB 3O6BB 4U87A 2IGKA 3MKWB 1E3PA 2PI0A 1MBHA 1IA5A 1N0UA 2XGDA 4BJ5C 4DGWB 2J7KA 1FY7A 3PUMA 2FU4A 4LLGF 2HYFA 2BW3A 3LSJA 1A36A 2ZL5A 2AS5F 2LRDA 1AIRA 3MKYB 4BU2A 1JE8A 3E5UA 3H35A 4LC0A 1OCZH 2Z5UA 1IXSB 2XDVA 3M7GA 2F48A 2QWWA 2KLOA 3BG3A 4NQWB 4DK1A 3JRIA 3QOPA 1XGSA 3IKVA 4XLNF 1G3YA 4Q5SF 2WJVA 3P27A 2QKMB 2BVMA 3QPTA 2XOKA 5CDFA 2DJNA 1VQKB 2CW8A 1IG7A 4D1QA 1S7AA 2CUEA 1U78A 4A0YA 3HOTA 3PIPF 3CJRB 4M3BA 1Z77A 2OPTA 2ID3A 1N06A 1TQIA 2K40A 3E97A 1E3ZA 1ETWA 1IHMA 2PEXA 1Z67A 1MNDA 3UNGC 4A3IJ 3BNWA 2DETA 3EQLF 3HPHA 3S14J 2NZMA 3WGHA 4ZTFA 2ELJA 4G94A 3KP2A 2TDXA 1ZRFA 2HOSA 1GAQA 1N07A 5BNGA 1TYXA 5LHHA 1Z0XA 1U2RA 4EW9A 2QKLB 1ZM9A 2IA2A 1KQ9A 5IPAA 2DJIA 3NWSA 4ZCIA 4NQWA 2VASA 4TN1A 3HGYA 1HA8A 3T53B 5B1BH 3ZSCA 2WV1A 3OV8A 4PGOA 4X06A 4WZEA 3QSYA 2HFHA 4G1BA 5ERIA 1IC8A 3HRUA 4CYDA 4II3A 2QBYA 2R7DA 4HV5A 5IY5H 4OJ6A 4KICA 1DDNA 2QSFX 1Y0NA 1E2XA 3S16J 2IOUG 4NK8A 2L9VA 2RVCA 5FIUA 2V7TA 5LHGA 2AQFA 2ECBA 3LSMA 1VQ6B 2FNPA 1O8EA 4DYQA 2EIJH 2WTEA 3NARA 4KN7X 4RLZA 2P3MA 1WZ2A 4L5IA 2QA4I 2HZDA 3LOCA 3LWFA 1GQ8A 1OPCA 4ZYAA 1T56A 3JRGA 1R5HA 2VONA 5IYDJ 2QLZA 2W7ZA 2ZBUA 3B02A 5BMZA 2BYVE 4J0QA 3IH4A 2P7VB 2VKEA 1D1BA 2X85A 4RD4A 1POGA 3QWLA 5CJ9A 3GFMA 3LVBA 5H2FC 3WTYC 3FHNA 4R1HA 5K7ZA 3GCMA 4BS9A 2XGJA 4EATA 1SVMA 1TWHJ 4KIFA 5EMNA 2XASA 1ZR2A 3BC8A 2RC6A 5CPRB 1W35A 3CJNA 2CBXA 4D7NA 3PO3J 4RCZA 2R3SA 4E70A 1QHHD 1BW5A 1PJRA 3LFUA 4BYYA 2XIGA 5BS6A 3LNQA 1GHCA 2BHZA 2VKVA 5LLQA 4YHBA 1VBLA 3GF2A 1OHHA 2HPMA 1RR8C 5KHDA 3Q6RA 4XRMA 1P7JA 1CQTA 4WF2A 1IRFA 2F43A 2BX6A 5J8FA 4RA2A 3BQZA 4XKWA 2CQXA 4XIDA 2OTLI 2G7UA 1UCRA 5KK1A 2XAHA 3WTUC 3TOAA 2E60A 1PUFA 4JRAC 5LBQA 1WJEA 1KD1D 2R7ZJ 1B1BA 3MCZA 3HOZJ 3B6CA 3LYCA 4UZEA 5CVJA 4U88A 5FLXK 2ZNZA 3DKYA 1VLOA 2DMNA 2DMQA 2CF4A 4CQJA 2DA3A 5CVUA 4EM2A 2ZFUA 2V4DA 3WTVC 4WX9A 1ZREA 3BH4A 1DU6A 4WXCA 3I4MJ 3VR6A 2O0VA 1IXRC 3M07A 3I55B 3WTTC 2XTXA 2O7OA 5EGOA 2PBIA 1VQ8B 3IAM2 2DT6A 4CA0A 1FTZA 3SZTA 2YWGA 1LDKB 2JPBA 3M8FA 1AU7A 2E34A 3P5JA 2BSPA 1IUYA 3QP6A 4C2UA 2NVYJ 5FKKA 4BE0A 5BPIA 2WADA 2V79A 4PUSA 4ENMA 3BY6A 3G6EB 2PYHA 3F0CA 2H1KA 1M1EB 2QEXI 4CCJA 2JSCA 3V42A 2BF4A 1T2KA 1D1CA 2ZJPF 4G7XA 2D2WA 2YPRA 2VE8A 4BBRJ 4PGGA 4RGXA 3RZDJ 1AMOA 1GLNA 4WXHA 5D4RA 4DOZA 4L8JA 2VE9A 4EJOA 3QE2A 1B8IB 4DNRB 3RYPA 4XKVA 2E5ZA 5EGOB 2Z6BD 4RAZA 1FT9A 1GXQA 4I01A 2VUMJ 3CP2A 3BY2A 1PVEA 5E1ZB 2WB1N 3BG5A 4OPVA 2EIMH 3CMMA 5JHFA 5FO1A 1MZBA 4RLFA 3HOSA 4IL6C 1HF0A 4RM2A 1A35A 3MZ8A 3OYAA 4OZYA 2V1UA 1SMTA 4HYEA 1HBXG 4A3EJ 5IT9Z 5FNZA 2LOOA 3H3ZA 5FKMA 1ETOA 5H6QA 1MDMB 5EZHA 3AKZA 1EJ9A 3CCSI 1GVHA 4YZXA 3VOEA 2RC5A 1ZRDA 1J5YA 2L02A 4KA4A 4NC8A 3D5LA 4BHCA 1COWA 2RDPA 1EH7A 3I4PA 1BPLA 1STZA 5DV5A 4BEHB 1TC3C 1QUEA 2M9HA 1B8IA 2CYYA 1SD7A 4V2GA 2Y69H 2WAFA 2NSTA 4TV7A 2VFQA 4YG2F 1E62A 3FK6A 5K7HA 1NG6A 2AHQA 2PLYA 3BOQA 3A0HC 1LPQA 2OTLB 2NTBA 3RPUD 1H8HA 1QFJA 1OB5A 4UUTA 3WGIA 1I3QJ 4X7FA 3R61A 3I0TA 1WPKA 3HOWJ 1W5TA 3OSGA 5L3EA 2K85A 1FLIA 3GVKA 3VSVA 1VQ5B 2CW0F 2JRTA 2LK2A 5BPDA 3ZP5A 1E43A 5L46A 4C3IJ 2H27A 4URRA 1HOMA 4I99C 4W97A 3HKZA 2ZO4A 1ZH5A 2OTJB 3FM5A 2NTQA 2GXGA 2HS5A 3MQ0A 3QODA 3P26A 3FWEA 2DI3A 2GXBA 1Z3XA 4E4HA 1EXMA 2HVRA 5BSYA 2PYGA 2N8GA 5HOOA 3J7ZI 4LK1F 1JUSA 4D5FA 4WWVA 3GQBA 3GW2A 4I09A 2ELHA 3S1MJ 1SKQA 2QXZA 4I7HA 1H9TA 4C0SA 1TWCJ 3OL3A 3JREA 1W0JA 3DTIA 1P4WA 3CCMI 1NH3A 3OYMA 5IYBJ 3RI4A 1OQYA 1HVXA 3G05A 3Q38A 1J9ZA 1KU7A 2QSGX 2ESNA 3DTEA 3W2AA 3S8PA 2ZTGA 4KYWA 1SFKA 1Y8RB 1BJAA 4RM0A 2R7OA 1YI2B 3GX4X 2MLKA 2QENA 1XE1A 4A0ZA 2GREA 1V5EA 4OMZA 5GAHJ 2CWEA 4HA8A 5FFXA 3ZQIA 5IK2A 4W1UA 2VN2A 1YRNA 3CCLB 2VODA 4RB2C 2Y2ZA 4ZGQB 3LJYA 2V9VA 2O1DA 1R1TA 1NK2P 4B3AA 2O0WA 4PC7A 3BCAA 1HSJA 2E1NA 2W24A 4FTHA 2Y30A 3QFSA 1Y0YA 4CYCB 3DEWA 5TV2A 1WSUA 3G73A 1IN5A 1K78A 2BMWA 5TISC 3S1NJ 4IVNA 4RPDA 1BR2A 1YS7A 3IHUA 3ZZ0A 2Y31A 5D5WB 1NK3P 1OGOX 3OYEA 3PUFA 1ULYA 2QQ9A 4RD3A 1Y1WJ 4L5EA 3VNVA 3S93A 2KQRA 1MMDA 2DXIA 3NAWA 1QRYA 1IJEA 4M0LA 1FNBA 4O5VA 4ZYGA 3LAJA 2DW4A 4CUGA 4EVIA 1LVKA 4AIHA 5FJ8J 1R5NA 2DCUA 3VB2A 3F8CA 3M1EA 2K02A 5B3SH 1WRJA 2XC1A 1ETQA 2CV0A 3B78A 3H0GJ 1BN5A 2X48A 2LYCA 2BE5F 3P9CA 2ZJRF 2JIZA 2BW3B 2XPWA 2DT7B 5CVVA 4P25A 5K5RA 1BOAA 4U0YA 3CCRI 4EQQA 3H3UA 1QGAA 2YX4A 3L00A 3GYHX 2HVSA 1WSVA 1Z6RA 3OYNA 3OW2B 5FO5A 3HOXJ 4LBWA 4TSFA 3N4MA 2AXTC 3HTSB 1VI0A 2X0LA 1FBQA 1ZM2A 1FX0A 1FC3A 2DTRA 3H9JA 4E7SA 5M3FJ 3OYHA 3ZQLA 3TGNA 1MSEC 2JN9A 1D0YA 4I02A 3OYLA 1ZKGA 4J00A 3HG9A 1U8RA 3M8EA 4N9HA 1VF9A 1MH4A 1YITI 2R9VA 1WJAA 2Y0MA 1I7PA 3QFCA 3JQPA 4HE6A 1P4XA 1PYVA 1U9OA 2M87A 2JWTA 2P81A 2CNDA 1WH5A 2KMUA 3VMVA 3B8HA 1BIAA 1HDDC 4C30A 2VOPA 1X1BA 3O8GA 3PSIA 1MGTA 4UV9A 2WZNA 2A07F 4OMYA 3N05A 3H9GA 3SKBA 3W2HA 1TT5B 2KFDA 1JHFA 5J3LA 4O6JA 1R49A 3CQZJ 3F8BA 2VB6A 1IN8A 4ZZLA 1MSFC 3KETA 1QGPA 3HIFA 3DFGA 4CZZA 1Q86D 3TOBA 5LGUA 3G71I 3WHCA 4HWVA 4P96A 1OCCH 1FNMA 1HSTA 1B9NA 1YLFA 2HOEA 4PJLA 1KYZA 4EV0A 2EFWA 5J1UA 3GVJA 2GQFA 1I6HJ 1D1AA 2L7MP 4BHBA 1Y1VJ 3K2ZA 3OY9A 1IDKA 2IPQX 1WFXA 1GT0C 1XB4A 2DQLA 2XTWA 3GQ7A 2QUFA 2UV1A 4OU0A 5DD8A 2HPIA 5ICEA 5ICGA 3KEWA 1YX3A 4KJZA 1OYYA 4PC2A 1JJ8C 2F2EA 4HX7A 3LSHA 3SHFA 4EJVA 4XORA 2OZUA 4DJAA 3DU5A 1YW9A 3CMEB 1REPC 4X07A 4C3JJ 1RU4A 2EIXA 2ESHA 1SD6A 1Z7LA 3HRMA 1S72B 3PO2J 2CMPA 2L54A 2W48A 3FBIB 3PIOF 3HOVJ 1M90D 2R5ZB 2COBA 2F4NA 1U6GA 2BZTA 1DDGA 4Q7JB 3GUDA 3A0BC 2LLKA 1I27A 2X9DA 2IEKA 3OZVA 3ZIAA 4GFBA 4YC5A 2R7UA 4HPQA 1QGZA 3EPZA 2XAUA 3SUCA 5D6FA 1SVLA 1EZGA 4ZYHA 1JJ2B 2DYRH 2M2EA 2TCTA 1KZHA 3VYUB 1V3FA 2FNAA 3WWGA 2IS2A 1WCMJ 2VJ5A 1ZAOA 1YW8A 3NQOA 3V4GA 1LFBA 4J01A 5HLTA 2JQ7A 3TO9A 1CNEA 2X3UA 3Q39A 3K10A 1OFDA 2DA4A 1SAXA 5IYPA 1BN8A 3FF5A 4UVBA 3W2FA 2VLAA 2NS8A 4HG2A 3RKQA 2DU9A 3SEQA 2C78A 1Q82D 2F1LA 4AD9A 4MTDA 2EB7A 1PUFB 2R5ZA 1J9IA 2EH3A 3HDDA 3WNBA 2HQRA 2KRCA 4WZKA 4JX5A 3JTGA 5KW9A 3DQVC 1Z05A 3KZZA 4YAWA 2XRNA 1S8NA 2VYQA 3I56B 1N77A 4I84A 2L5QA 3MEXA 3FXQA 1XGNA 1XMAA 3PL8A 4KT6A 5JFRA 5KAIC 3MKLA 2FSWA 1LQ1A 3K6GA 4A3BJ 3K4KA 2KVOA 1M1KD 2EZIA 2VT3A 5C4XJ 2UZKA 2H8RA 1WXRA 4FCYA 3BC9A 1IZ1A 2HQNA 4BXXJ 4IJAA 4M2LA 2E1OA 2HDCA 4OIQF 2L4AA 4DNTB 3JRFA 4FX4A 1HF2A 1QCXA 3H9QA 4B1RA 3IL2A 1ZARA 4O3MA 1NHCA 5FKLA 2ZZGA 2QVOA 1X58A 4XOPA 1TL8A 2BY2A 3WNCA 1YW7A 3A4CA 1H88C 1N0VC 2UXXA 3KP5A 4FQGA 2L0KA 2R4GA 2GA2A 2XVCA 2K4BA 1GUUA 3BG9A 1UMKA 3LQEA 3ZMTA 1K4TA 1J75A 4CCMA 3FBNB 4AYBN 2F3LA 4EM1A 4E0FA 4MIMA 1E1RA 2EZKA 2C2WA 3ZQCA 4S0HB 2VPRA 1GR1A 2V7XA 1VQNB 4PGHA 4BE1A 2MBFA 5JR3A 1PJ5A 3HSRA 1Y0RA 3PQKA 2CG4A 2XNJA 1F5TA 1ZG5A 2GQQA 1YIJB 3OYKA 1MBKA 2DOGA 2JVGA 4A5MA 5A8AA 1VF7A 4X8IA 3L2UA 1EH8A 3V7CA 4DBQA 5D5VB 1QRBA 1MBEA 2JVHA 1R5ID 3L2VA 4FWTA 3PUNA 1ZG3A 3FDYA 2FQ4A 3Q3SA 1S72I 2X51A 2VI6A 2XAQA 3ZXSA 4WZTA 4XOTA 1Q1HA 2QCOA 3ZR8X 3FPKA 1B9MA 4HNTA 3BR0A 1RKTA 3WE3A 5GTIC 4P55A 4U7DA 2GJRA 4YIRX 5HXBA 4RBOA 3RQ4A 2DMTA 3H5NA 1K4SA 2R6HA 3FMQA 2E36A 1JKPC 4CXFA 3OJXA 4HAMA 2LNBA 2E7XA 1VQLI 4NC6A 1T6ZA 3N6ZA 3PSZA 2M4KA 1WTHD 5AIQA 3K4NA 1XB2A 3K1NA 5HLGA 1E64A 1ENHA 2F4MB 3CCQB 3S2HJ 5E8IA 1YJNB 5FGMA 2V4JC 3SDGA 2DEUA 1N75A 2ZXHA 2ISZA 3A8KA 4YXWA 4B4DA 1FPQA 2VXZA 3IRQA 1YI2I 3HRTA 1QVUA 3SQNA 3J81K 4F93B 3VNUA 2P4WA 2PE3A 2RQQA 2BM0A 4F91B 1TW2A 1XD7A 4ENKA 1V5GA 1USSA 4B47A 4YEIA 4N3NA 1BI2A 2Z33A 1FEXA 2AQEA 2MABA 3GFLA 3HEFA 4S05A 4UB6C 5THXA 3LSKA 4EJTA 2FRHA 3OS2A 3M4OJ 3QU3A 5DCFA 4Y9UA 5EZGA 3TH0A 3RTRA 4OPOA 2OTJI 2D74A 1T6SA 2MSYA 1O3SA 2GK7A 5IT9K 3G3ZA 5C1CA 1NHAA 3SFIA 2BXYA 4HRIA 1OB0A 4WZLA 3OW7A 2LBFA 2XAJA 1P9QC 2O8KA 3NE5B 5LRRA 4ACAA 2I5UA 4AM3A 2PN6A 2EQRA 2NVUB 1YE9A 1KA8A 3QQAA 3KX2A 2C5BA 3M9AA 5L3DA 5AIPA 1O3RA 4W8TA 1Q1VA 1AHDP 2B9SA 1H8EA 1QFYA 3K2AA 2JJ2A 2BPOA 1ZGAA 2HLDA 4E7HA 3SY2A 5F04A 4F92B 3UKGA 2NT6A 2OU2A 5KNLA 2DA2A 3DKXA 1JT0A 1L0OC 2F5FA 5KAFC 3ZBTA 2MH2A 1RR7A 2XROA 3GTGJ 1EFRA 2J5PA 3WG7H 1KK1A 1QX4A 3MMPA 2KJBA 4I6ZA 1GJRA 4Z4ZA 2AXLA 2GPJA 2EFPA 2K9SA 2W6IA 1YTYA 3AVVA 2Y75A 4Y7NJ 1W0UA 5LD2C 1T8IA 2OQRA 4CYCA 1TYWA 3CRZA 2D9RA 2F4IA 3WYAA 3G4SB 3OYIA 2O0YA 1BOBA 2ZMEB 3WNDA 2G0YA 1OISA 4RB0A 3IC7A 2LZJA 1ODDA 1S3JA 2XNDA 3AVUA 2VNIA 3K4MA 2ZZEA 4ENNA 1ZR4A 3KPHA 1Y39A 1D8JA 1SAUA 2DYIA 1XSDA 3LMWA 1S0UA 3MN2A 2D1HA 4RGUA 4R71A 3O8HA 3DDYA 4OP7A 3FXOA 4E7LA 2QTLA 4AC9A 2J8IA 2FMYA 1G7CA 2R7WA 4A5NA 3OYDA 1XCBA 2XKOA 4DQKA 5JBQA 3A3BA 1QPMA 3B82A 4AWXB 4QIWN 1WHUA 1XDSA 3GLXA 3E7LA 4M3GA 3H5RA 1X1PA 2ZC2A 5TGTA 1P2FA 2W85A 2YU3A 3LA7A 3BCBA 2XC7A 3MAJA 4DK0A 2H8WA 4F7DA 5HZAA 3F8NA 2VXDA 2NTPA 1UD8A 5J3OA 1KQ5A 4BL0B 2NYXA 2ZMEA 2RC4A 2JA7J 4A12A 4UY8I 4II2A 1ZGWA 2EWEA 3AVXA 1P92A 1D5VA 4Z1MA 1G7RA 2DOAA 3JSPA 1O8KA 3C7JA 2Z99A 3AG1H 2QDXA 2OCCH 2L7KA 1FNDA 5F08A 2K3PA 1LB2A 2ZTNA 4B48A 3HM5A 2DAOA 4WQMA 2OBTA 5CVRA 2EA4A 2X1CA 2DA7A 1TQMA 2ME0A 2DYSH 2ME6A 3S15J 1D0XA 3LSTA 3I54A 2NS7A 2ODLA 2V1NA 3PJRA 1S7OA 4DIQA 3S32A 3JAMZ 4DYRA 4WK8F 1DDIA 2CQKA 5EG0A 3N97A 4ZGNB 2QQ8A 1HZEA 1ETYA 1T0FC 3CC4B 4QFMA 3F72A 4M3EA 4PFPA 1XN7A 1KCCA 1RI7A 3CUQA 2CV2A 3EYIA 1FMWA 1W4MA 4MXNA 2F5VA 5L3CA 3FXLA 5FKOA 5C3EJ 4Z05A 5FLXZ 2DFEA 4Z06A 3LSPA 5FKNA 2BM6A 1FJLA 2CK3A 2LC2A 3GO5A 4PC6A 3E1YE 4PK4A 4ASUA 2M8GX 1QA6A 3ASTA 3U2RA 4HX8A 5ILVA 2RV8A 1MJ9A 5F4JA 5TY0A 1ZQ3P 2ETHA 3T9GA 4UNOA 5GP9A 4F52A 5IYWA 1DGRM 1X0CA 3B8YA 4BNCA 3OP1A 3IH3A 3CUQB 4JP0A 5IT3A 2JUGA 4Y17A 1ITYA 4ASNA 4C3HJ 3R6JA 4RPBA 4X7CA 2PFBA 2Z3YA 1QFZA 2KJCA 3TP3A 1QVGB 3I9V2 4U9UA 3BDDA 2EWNA 3H9NA 1T95A 2O6GE 1LLZA 2LY1A 3E6DA 2ISYA 5FL7A 2CQNA 3OYFA 4IZZA 3DEEA 3AGQA 1LE8A 4BQQA 3S3NA 3MCAA 1KTWA 3H92A 3L2QA 2DFFA 2V7FA 4C2MJ 3A01A 4A3DJ 2XEXA 4ENJA 3SFZA 1TTYA 3VMFA 4L9VA 1F9NA 1IO2A 4IOCF 2VBMA 1ZLJA 2XT4A 2V7VA 2RN7A 2JA2A 5AONA 3ES9A 2GM4A 5ICCA 5LRSA 3CO6C 2M0CA 1L1IA 2BGIA 3ZRGA 1W1WE 2KRHA 1QUFA 3D5SC 5J40A 1Z6TA 4BAYA 3PVDA 2MC4A 2RREA 2Q0OA 1G2HA 2DTZA 3SLNA 3VO2A 1EE6A 2FBIA 1R6RA 1HW1A 2IP2A 3TO7A 4UZUA 1V4RA 2E71A 2DODA 1KQ0A 4Q47A 1YHQI 2CUZA 3PM1A 4UZFA 4Z4SA 3ONQA 1ELOA 1O8MA 2LVSA 2M30A 4PAAA 1H8AC 3KYLA 2FOKA 4E7ZA 1MH3A 4M71A 5F1JA 1WORA 3TP0A 5CKTA 4DYCA 3AK5A 2JUCA 3ABKH 3PFYA 5FA6A 4ZDLA 4QPQA 2JA5J 3MZYA 4KNYA 2YX7A 3RIQA 2BHYA 1N05A 2ZBVA 3NEUA 5E18F 2DMUA 2OV7A 1FIAA 1N78A 2O04A 3IH2A 4LIVA 3E1SA 3JTHA 2X0KA 1KU9A 1VQNI 3K4BA 1APLC 3MD2A 2M1BA 3HZJA 4EJUA 4MO7A 4S04A 2IQ7A 3RDIA 2ZXWH 2HDNB 2XF5A 3DPUA 2FE3A 3R4KA 3BR3A 4YZQA 3CPXA 1BJZA 2X1EA 3Q3AA 1IDZA 4YFXF 3CMEI 4YRVA 5L3GA 2UWMA 3E3VA 1VFCA 4L9TA 3H36A 1MIJA 3CF5F 2BV3A 4LB5A 1O8JA 2Y48A 2DOFA 3HHHA 2VJIA 3KP4A 5DD4A 5DCMA 4DZPA 1H89C 2V31A 3U2QA 2O3FA 2NV4A 1OYIA 2E19A 3ZQ7A 5EEAA 4ESFA 4E7JA 5IYNA 4K2EA 3TQNA 3W6JB 2IGNA 4MLOA 4HNVA 2NVXJ 3GEZA 1X1AA 1U5TC 4RDLA 1D1NA 4U49A 4LB6B 1YG2A 2WJYA 3T0YA 1F43A 3BZCA 2ZCWA 3KP7A 2VKHA 4AF6A 3ASNH 1KU2A 4OIRF 2GJPA 2EZLA 3DEUA 2ADUA 2JSPA 3QYEA 3JRBA 1EF4A 1A6IA 4OAZA 1YFHA 1IN6A 4LK0F 3OL4A 3IWZA 4LFUA 3F22A 2HYGD 1TBXA 1XSXA 4P9FA 3OOPA 3SQVA 3BQJA 4LLLA 4MFDA 1YQAA 4B3FX 4P22A 1FBUA 2CH0A 3CMAI 3ZBUA 2KPMA 2P5VA 5IYQA 4Y13A 5DCMB 2OZ6A 2NPFA 4TKOB 5EYRA 3ASQA 1KU3A 1ZYRF 4XLHA 4XNFA 4WCGA 2JDIA 3DLAA 3IWFA 3QYFA 1UHMA 2XF7A 3I55I 3B4NA 1UAAA 1TTTA 3ECOA 3VDXA 5J6XA 3TDUC 2W1OA 3T1BA 4UVCA 2VQLA 3AL0B 1D0ZA 2DLLA 2R7QA 1GDTA 1OCPA 3MVPA 2V7QA 2LKSA 3FXJA 1SFXA 1KK2A 3ZGKA 1RWRA 1T98A 1B6AA 4KDPA 1IN7A 1K7AA 1DP3A 4P1VA 1BC8C 4YIFA 3QP5A 2M0MA 1JXSA 2EV0A 1XFOA 2IS4A 3J81k 3BLYA 3PNYA 4IRHA 3H94A 2YU9J 1O7FA 3SJPA 1PJ7A 3U6KA 1MBFA 4V2FA 1ZM4A 4A3KJ 2QTZA 2DIEA 2K27A 4XSXF 2GLOA 3DTKA 2V7UA 1TNSA 3ERMA 5E1XA 4M6XA 4M9ZA 1CF7A 4A3GJ 3EUHC 4ABZA 4YFKF 4D5CA 1S29A 1IW7F 4PC1A 2FF4A 4Z4WA 3ML6A 1V55H 3BROA 3J81Z 3HL2A 2Q6OA 1EH6A 3BPXA 3W2VA 3D1NI 5DUIA 1SEUA 3ZOBA 2PQ8A 5J1RA 2I8DA 5GAGJ 1VQOB 1P4AA 1VQPI 3VEPA 2IGOA 1T6XA 2O8XA 5CYVA 1L3LA 3BJ6A 1JB9A 4RS8A 4JX6A 1H85A 1VNDA 2PMDA 4P6YA 4UUSA 2M5WA 2O5RA 2LBFB 4CO8A 5E3MA 1PJ6A 4P9SA 1O8GA 1YX5A 1XPXA 4JYKA 3U1DA 1OOCA 1QVTA 1RPWA 5LHIA 2DOEA 3DPLC 5KVRA 3BR1A 2CGPA 4IHYA 5DS0A 5B5EC 1C0WA 3G2BA 2ID6A 1QA3A 2RAEA 2ACJA 3AGPA 1QZZA 1CF7B 3GQAA 4QLCU 3SYJA 4IX7A 2EIKH 2EPFA 2Z1DA 2PMUA 1B2RA 1CLWA 1VQ9B 4AC0A 4XKCA 1JKQC 2V7WA 4AIJA 1WJDA 3LFKA 1BBYA 1EA3A 3ZN0A 5L3FA 1VQ6I 3A3GA 5DSZA 2QYUA 1X19A 1DPUA 1K6YA 1MD0A 5M5XJ 3C2HA 3DCFA 1IB0A 1G8XA 4I0AA 5JVGF 4LG0B 3V7AA 4WWCA 2E2HJ 1RZ4A 3GIRA 5DN6A 1QJVA 1K4ZA 3HSEA 3PNVA 5IYCJ 4HE5A 2VFMA 4ZC3A 1Z1DA 4IHWA 1DABA 3E5XA 4I98B 2VJ4A 1FP1D 3G1LA 5IP6A 3ESWB 1SFOJ 1FOKA 1EFUA 3GTOJ 1SD5A 1NG7A 3TMOA 2R7SA 1GV2A 1I8DA 1KC8D 4RAFA 1NRKA 4FX0A 3S3MA 1LFUP 3ZZUA 2L2OA 1BR4A 5M5WJ 1QPIA 1E3XA 3JRHA 2V5IA 2LREA 1FX7A 4R79A 1JGSA 2MG4A 4E7IA 4YAOA 1XMKA 3FZVA 2WPDA 1K79A 3PUBA 3BJOA 4ESBA 2LKPA 4BGDA 2ZL6A 4M53A 3SZEA 1DPRA 1UD4A 1IJWC 2QGGA 4L9NA 3RKXA 4KN4X 2ECCA 2VBKA 4NHJA 4OZZA 4G7HF 4ZDOA 2JJ1A 4LG0A 3ASRA 2CC2A 1SMYF 2GBYA 4RDKA 4Z03A 2DBBA 2WAQA 2Z2SB 2V9KA 1TYVA 1XC5A 2JT1A 2LFBA 3A8JA 3E6MA 4HQEA 4G8XA 2CW7A 2W84A 5D8LB 5FB2A 2BEOA 1A5JA 5D6EA 1TNTA 2E2JJ 3KL9A 1T38A 2LY9A 4MQ9F 2M3AA 1OFCX 4F7ZA 5J47A 1FWZA 3LL7A 2HVQA 3E5QA 1GXPA 2BV6A 1HCRA 1V54H 1LEAA 3PA2A 3Q9SA 4FN5A 1WI3A 2IAIA 2K9LA 2KIMA 2VQHA 3ERED 2WBMA 3Q0WA 1R9TJ 4Y7CA 3VO1A 3SDBA 5JHUA 1XQBA 5HDGA 4G7WA 5ICFA 3OYGA 1Z91A 4PSXA 3ZMZA 4D7MA 1TWGJ 1BI1A 3P4GA 1B72B 2VQCA 5EG0B 1F60A 2YWFA 1VQ7B 1R22A 3KZYA 2WYRA 4XICA 1OGIA 1LKXA 2VBUA 3ASPA 5JMCB 2J5OA 1LJ9A 2BN4A 3DXJF 4QV2A 3Q0UA 1QZYA 3D0SA 1QZEA 5J1YA 2QF7A 3L2RA 1FNNA 4RDUA 3J80Z 4P9UA 4J19A 3BTJA 2PIAA 4GQNA 2E1CA 4HBLA 3C18A 4D9JA 2DO7A 2LTPA 3CMYA 1JKRC 4W8QA 2DK5A 2ICWG 3ZMVA 2JJ7A 5HS7A 2INVA 4HX4A 5E3NA 3U9GA 3CCVI 2PJPA 3HKZN 4YEJA 5GADJ 3KRGA 2A68F 1TYUA 4Y9RA 2IXSA 2GOMA 2RKHA 5K7FA 1B72A 4BQAA 1NB9A 1Z9CA 1XX5A 4KKUA 2CFXA 3ML3A 1T08B 4BE2A 3BG6A 2LY2A 3QPLA 4Z4YA 1I18A 1IDJA 2HWVA 1BIBA 3TW7A 4TMTA 2NXNB 4Y33A 3P7NA 3FKSA 3S2DJ 1KCDA 5E17F 1WKMA 2HI3A 3OIQA 2JPCA 1T5EA 2ZXJA 1EFCA 1FOYA 3RCOA 2OCEA 4HIZA 3SEJA 2C77A 5EEGA 3SZGA 2EINH 1BI3A 1YJ9B 5HNFA 1FSHA 3HAGA 3KZIC 4G12A 4Q4ZF 2KP6A 1RQRA 3NRVA 1HW2A 5JLWA 2M4GA 2ZMEC 3JAMK 4AVZA 4QUZA 1LE8B 3SZPA 2NSPA 4KFCA 2V26A 4RMNA 1VZ0A 4FHTA 2BBYA 3A01B 2MC3A 4RGRA 4UUVA 4P5OA 4PJNA 4M6YA 5FROA 4OOIA 3FKIJ 2FBKA 2A6HF 1U0JA 2HQAA 1E79A 1I1GA 1MABA 1S4MA 4IF4A 4M9SA 1E3OC 2OQGA 4RAYA 2JN6A 5TRDA 1UG2A 1E3HA 2QZ8A 5EEHA 4V19K 3CC2B 3HGGA 2P5KA 4HW0A 3E0JB 2OJED 4U0WA 1O8HA 3CTAA 3RIRA 1IXCA 3K1PA 2FOWA 3P9KA 4IPAA 5HNHA 4PDKA 2VKDA 2A3SA 3HBLA 4OJPA 3BCDA 3AG4H 3T5XA 2HNHA 1G3WA 2D1VA 2HYJA 1IUFA 4MYTA 1HDPA 1EA0A 5IOYA 4HDVA 1JTXA 2V1XA 4LD5A 3V7SA 1FRNA 3T8RA 3KEYA 4MGRA 4M72A 2NVQJ 2K5CA 3CJQB 1PDNC 1DBOA 1XG1A 4PCQA 1EP3B 4OAYA 3CC7I 3HPGA 2HQ5A 3CCJB 4ZYEA 2E7WA 4XONA 2XSDC 1R71A 9ANTA 3HOUJ 4A3MJ 2X8KA 1RETA 3EQNA 3RJPA 4HF0A 4RGSA 1ZUNB 5KSWB 3WBKA 1W36D 3T8TA 5F0CA 1BQEA 3ZUGA 2VFNA 1CGPA 1VQMB 2XRLA 5FD5A 2GJKA 1B59A 2FBHA 3PQJA 3FHZA 3W6VA 4NBSA 1OGMX 4LBVA 2K9MA 5JLXA 1HXDA 2H94A 1VQ9I 3R6SA 5J4VA 3F8MA 3KIOA 3BPVA 4RDJA 3B73A 4GCVA 3ISXA 1VQ8I 3GTQJ 2FEZA 2VJJA 1H80A 4TMXA 3CPWB 4BPRA 4YAFA 3CC7B 4N0BA 3H09A 1LEBA 2XKPA 3CDHA 5A88A 4ZCMA 2QQAA 4ZTJA 4Z2YA 3REOA 3ABMH 4FETA 5TR9A 4BXFA 4A3FJ 2ZJ2A 1TQPA 2L4MA 4AVPA 1W36C 3ZPPA 2DA5A 3CCUB 2OF7A 3I59B 4PJJA 4WXDA 3A2KA 4XKBA 3OZWA 5HODA 3IRRA 3ZZTA 4TMZA 5GAEJ 3A1PA 1UJ8A 3CLQA 4G6IA 2QQBA 3LO8A 4DBRA 4A3LJ 5F0FA 2VC1A 2BM5A 3DP7A 3AG3H 5M3MJ 4RD0A 4G7OF 1QQIA 2WZPP 1OCOH 1QA1A 3PFIA 4CHUA 2HDWA 4YCQA 1OCTC 3KYCB 2VNKA 4A3JJ 2RNGA 1GVDA 3L2WA 3ZN1A 4B3XA 2XF6A 1FYKA 1Y6IA 1CZFA 3OKXA 1A6QA 3KCCA 3KEOA 5DM6F 4HDUA 1A31A 2DPDA 4OM9A 1X3ZB 2CO5A 3CUOA 3OS0A 2ZSHB 3I1FA 1EP2B 1W2BB 4BH9A 1JNYA 3K0LA 5ED4A 2H6BA 1T6YA 1KJZA 2P7CB 4IQJA 1S5LC 2ZKZA 3LA2A 5EDNA 2CQQA 4EGZA 3ASOH 3RKWA 2O9LA 4AF7A 1R4NB 2RQPA 3MZHA 1EWYA 5F0HA 3LSGA 3KLNA 1V5FA 4YFNF 1ACIA 4XLEA 4OOXA 2EFOA 3GBGA 1A04A 3GZ6A 3WY9A 3HJEA 3LNNA 2P6TA 3BG7A 4XK4A 3WHBA 3CCEI 3BCFA 1QA2A 2NNNA 3CD6I 3ZPLA 2D3LA 3W2GA 1I39A 1A8PA 2HGCA 2QZAA 2O61A 2WAQN 4PMHA 1IRXA 4BXUA 3DU1X 1YOVB 3RYRA 3BJAA 4CCOA 2YSRA 1CQXA 1YO5C 5GV7A 1X1DA 2E5NA 2VZLA 2HDDA 4Y15A 3V8KA 2JK3A 4B44A 3V76A 3HC7A 4B43A 1GVJA 1ZRCA 2KZGA 4P6VF 3VSUA 2IJLA 4PSWA 2ZBKA 3S3OA 1PKVA 1ETVA 1WQ2A 4UUSB 2ZB9A 1J0RA 2MA3A 1VQ4I 3VMWA 5DTDA 1YX2A 2PMZA 3HSFA 2EFQA 1ETXA 1IRZA 1JHHA 4MFEA 1U5TA 4XN3A 5B66C 1ETKA 1K5CA 4FXUA 5A2QK 3WGGA 5C4JJ 4GGGA 2UVEA 1OJLA 3Q5FA 3T56B 1D8KA 2Z16A 3ABTA 1FYLA 4N9IA 3OZUA 3I71A 4BJTA 4LLNA 1E0EA 2HTSA 3JRDA 5K5QA 3E6CC 1V0EA 2M5SA 1G3TA 2IGMA 4CCKA 2VBVA 3N90A 5E6TA 2YUSA 1G59A 2IS6A 1WWXA 1RESA 2NT9A 3VWBA 3KP3A 4XQFA 3MKZA 2HZTA 3BZ6A 2R93J 1BX1A 2H09A 2E1BA 2KIFA 1VLYA 2QYOA 3CJTB 2VBTA 4NCNA 2FJ1A 3CDIA 1TSPA 1HKTA 1FOXA 5DYMA 5LEJA 3O3KA 3UW0A 3JQQA 1RNLA 4KMFA 2BM1A 1ZK8A 1MMGA 2XAGA 3O2PE 2O6WA 4MR0A 4A0XA 1YJWI 1U5TB 3RZOJ 1HQCA 4XLPF 2BY1A 1XS9A 3S2WA 2HU9A 4N3GA 1O8IA 4OPSA 1G7TA 4P1WA 1H42A 5FO0A 3GZ5A 3WODF 3WTSC 2KRFA 4B8XA 2XZOA 2EV5A 2DT5A 5E3OA 3VSTA 1BHEA 3MWMA 2TRTA 2X53S 4PZJA 2EK5A 3DF8A 1J2XA 2NRAC 5H20A 1X2MA 2KIUA 2LSOA 1UD5A 1OCRH 2WSSA 1JA0A 2J8KA 2HR3A 2L9NA 3OYCA 2BVNA 4U4BA 1KK0A 1E63A 3SLDA 2MLGA 2WB1A 2X6WA 4C2TA 2Q6KA 3SXYA 2VFPA 2DFIA 2VC0A 2VL8A 4OWRB 4RAGA 2GIVA 1MNMC 5D5XB 2OAZA 4RD1A 5J4YA 4P26A 2FX0A 1VQMI 3DBHB 4M3FA 1YS6A 1ZN2A 5C44J 1TUIA 1MMAA 1LVAA 2GK6A 1Z21A 4CCNA 4ESJA 1O3QA 1PE9A 4P3IA 2E35A 1O57A 5LGTA 3PA1A 1BMFA 3W2WA 4ZYDA 2EJRA 3F6VA 3I56I 5J35A 1Y0UA 2VIXA 3CCRB 3ECHA 5CVIA 1FBSA 3OYBA 2Q6LA 2NOGA 3PSFA 3EUAA 2INUA 4IRGA 4KIGA 1D2EA 2D45A 3LQ6A 5AMVA 3OAAA 2W00A 1G3SA 1UG0A 5FD6A 3WE2A 3GQ9A 1AA7A 5F64A 2NS0A 4ZJZA 5FRMA 1DP7P 2Y9ZA 5HLHA 2A69F 3F21A 2CSOA 3CD6B 4EMSA 3WU2C 1U9NA 2R0QC 1FYMA 4IOAF 1W87A 3V8LA 4XN0A 1MBGA 2Y0SN 2G9WA 4UXNA 1JRGA 5HZBA 3QFTA 4XBFA 2JRMA 4Z6YA 2CU7A 3DU6A 4PABA 4GXOA 1R58A 3NWTA 1VQ7I 3TDZC 2OBPA 3OFNA 3X2QH 1DQUA 1WVRA 2B5OA 2B7CA 1BM9A 5A89A 1TWFJ 1WGXA 2MD0A 4M4SA 4UHTA 3FMSA 1W0TA 4QVJA 2A5YB 1ZM3A 1Q81D 4B3GA 2R7TA 3K9TA 4X6AJ 3KEQA 2M34A 3ONUA 4P3YA 3MHPA 5DDGA 2PLFA 2GWRA 5F4MA 1F4KA 2FUG2 2RNJA 4C2LA 3DV8A 4AIKA 4L9JA 2XPUA 2XZPA 3GVAA 2F5EA 3BTIA 3AVTA 3WU0A 1YJ9I 1HA3A 1UHSA 3FPPA 3CC4I 1FNCA 3PSSA 2BOLA 1W5CC 3G71B 2DCEA 4HLXA 4PC3A 3WG9A 1OKRA 3TBIA 1NB0A 4W8SA 3CW2A 4G7ZF 5HVQC 2K9NA 2DY1A 3LMMA 3U1KA 3GRHA 1ZHFA 3F9KA 4XL9A 2GA1A 2XGCA 3S1RJ 3BT9A 2IBDA 2E2IJ 4I2OA 3PETA 4W8RA 3OYJA 3H1CA 1HKSA 1XDUA 2LF8A 2QN6A 2KISA 2W57A 3QAHA 3AVWA 5HDNA 4ZV4A 2CRVA 4BDZA 1LFPA 3LSRA 2F5CA 2QM3A 3C1DA 4XRSA 3MFKA 5BQTA 3A02A 1BJKA 2DMPA 2YR2A 1F1ZA 1XMXA 3QFRA 4X7DA 2WWYA 1NBMA 1IF1A 1ERDA 3KYDB 1BL0A 2B0LA 3OS1A 1V0FA 1P6RA 3VSKA 1W9XA 2OBRA 1QRCA 3CDLA 3WTXC 4FT8A 3KP6A 3J80K 2BSAA 4NUBA 3VSLA 1AKHB 4MYUA 1Q9SA 5BOXA 3S1QJ 5DM7F 2EA2A 2M45A 1OFMA 1ORKA 4CZCA 4C9YA 2L9SA 2IVMA 2PMHA 2XB5A 3DBRB 3A35A 5EJCA 2DDAA 1TW3A 2FXAA 3BY1A 4TT3A 1OYWA 2RGVA 3CB4A 1K9MD 4C43A 2OBSA 2X6YA 3TW6A 3P9IA 1W5SA 1IJFA 4HZFA 5C1EA 1ON2A 3AL0C 3BWGA 1UD3A 2MFZA 2ZZQA 4XMYA 3BR6A 5HLIA 1WSRA 2UVFA 2HXOA 3H5AA 4ROXA 3FXUA 1TP4A 1YYVA 2WAEA 5LMZA 1HC8A 5B1AH 2BVLA 3OR1C 4HOBA 4F55A 1ZG1A 3G1OA 1OFLA 2CUJA 1RC9A 1AKHA 2IRFG 4LBYA 3IUOA 2Q2EB 3EYYA 2R5YB 4NBQA 3ZC3A 4UV8A 2MYSA 2B7BA 1JUMA 4ACBA 2JA8J 3GFIA 3W3CA 3HXLA 4BKXA 1WDTA 1X3UA 1YJWB 2O03A 4XM3A 5E79C 2CUFA 3EETA 4EJWA 1IAWA 4OINF 5K5OA 1VQPB 2VT2A 2EFNA 4IHVA 4Q48A 1O8FA 1KYWA 1O7LA 3K4LA 3QU6A 1FDRA 6PAXA 1W7PB 4YDTA 4G6QA 4M1KA 5IYRA 2YS9A 1MJAA 3AFHA 3U21A 3IV5A 5E8GA 3SEZA 1FMVA 3CUQC 3GTMJ 1I3AA 5HS8A 1MKMA 3I53A 4JX4A 5FLMJ 4G6DA 3JSOA 3QOEA 2F1MA 4P12A 4BJ6C 4XR6A 2VQGA 2LR8A 3FXKA 1TZLA 1JKOC 2GXAA 1VHOA 4KKTA 4Z4RA 2MH9A 3LSIA 1QHGA 4CCLA 1TT0A 2BGJA 3BH7B 1FRQA 3I59A 4QPOA 3ZPNA 2OUMA 5E1WA 1S7EA 1Z7UA 2PMZN 2Q1ZB 3GSIA 3AVYA 4MEYF 1BR1A 5GPCA 1KK3A 3ULQB 2XGXA 2OYNA 5H5JA 2YUHA 2DN0A 3CCJI 3CCUI 1LNWA 2X6XA 1X2NA 1BI0A 1GV5A 3GLLA 4EH1A 1DARA 1W7PA 3C2BA 3GTKJ 3ONYA 3CCVB 4XRSG 2ZJQF 3SYTA 3BZKA 5HKKA 3I4NJ 3OEEA 1DGWY 2KKOA 1OMIA 1D3YA 2W4SA 3I5UA 1H0MA 4A93J 4FASD 2NNYA 1TLHB 1ZLKA 2FMLA 1WJCA 2ZFWA 3VYTB 4IHTA 2WA0A 2XB0X 3L7WA 4UAJA 3K70C 2I10A 4R8HA 4FE7A 3IAS2 3JRAA 2VNJA 1JTYA 2DDBA 1NDHA 1B23P 3GQ8A 4IRIA 4EM0B 2Q8KA 1KMHA 2B0RA 3RQIA 4BACA 3OJWA 2NVTJ 5DS9A 1KQ8A 3GMEA 4A6EA 1WOSA 2C4UA 5M5YJ 5D8KB 4YALA 2KL4A 2XUBA 2NAZA 1IN4A 4ZH4F 3OMYA 1O4XA 2DA1A 2M8EA 1MNEA 3C2GA 3J7YJ 1ON1A 1WJFA 1R7JA 4HQMA 2MD5A 4MTEA 5JI6A 4G9YA 3CCQI 1RUNA 3PENA 1XCVA 1R36A 1LM1A 4RM3A 5FLVA 1IRGA 2LP0A 2ELKA 4Y4RA 1Z3YA 2C4TA 3R6KA 4X0GA 1D5YA 3W2IA 3BQYA 1IV6A 1KGSA 1VJSA 4Z4UA 4L0ZB 2F5DA 4E6KG 1KZLA 1R5BA 1UFMA 2BM4A 3GXOA 2X6OA 2E1MC 3GZNB 3F23A 3A03A 1OGJA 5DEQA 4LBZA 1MMSA 1N08A 3RPUA 3OIPA 1UHWA 4ETSA 4HSRA 3CCLI 4IO9F 5AN9A 4YAUA 3JRCA 3B6AA 3G1MA 1HLVA 2XV4S 2HKOA 1MMNA 1R1VA 2BY0A 3I64A 4X7EA 2DA6A 2AHOA 3D26A 3KFWX 3JX8A 4XLAA 4LGWA 2CQ7A 3R0JA 3RSNA 1QNTA 4YZ0A 1F20A 1TVCA 1NJID 2KDZA 3EQOA 1YIJI 3K7AJ 3FX3A 1R1UA 1YHQB 1E1QA 3CESA 5JVTA 4B4CA 3OWTA 4TMWA 5GV8A 4U0VA 2EFGA 2QA4B 1PLUA 4I0BA 5JLVC 1UD2A 1S9HA 1U8BA 1Y8QB 2LH9A 2QY1A 3U6BA 1K8AD 3ZQHA 3DPTA 3WXMA 2LG4A 2PECA 2Y0SA 1J09A 2EV6A 2L01A 2L7ZA 1SM4A 4K1XA 2K9QA 2E1RA 4ZDPA 4CICA 4XRFA 3Q0VA 1YJNI 1YLOA 3FJOA 3ABLH 4ZZDA 2ZITA 1I5ZA 4KH3A 2P8TA 3JCUC 2GZWA 4KUMA 4AYBA 4IEJA 2GOXB 1K28D 2VOOA 2HCJB 1CNFA 4FK8A 5ILUA 4QHYA 1QU3A 2ZSIB 5IP9J 1KRHA 3QPHA 2QX3A 3J7AY 1VQLB 3HYIA 3CLOA 4DW6A 2OK7A 4JOMA 2HKXA 3GWZA 4RLQA 2D5VA 3ELKA 3CO7C 3MMYB 5CLSA 4KITB 3JR9A 4BHPA 3ROUA 3E20A 3BH6B 1TLLA 2R7FA 2W82A 3TEDA 3K1MA 3QYBA 4HEA2 4RJLA 1G7SA 5H6RA 1WH7A 3KE2A 3TL4X 3VPRA 1K61A 2L7FP 1USTA 3S17J 3DBLB 1JA1A 4GO1A 4N4NB 1DBGA 3BTCA 4NC7A 3OOUA 1O8DA 1RMGA 3SJZA 1MJBA 4BQNA 4XLFA 2OD5A 2B63J 2F4OB 2L9RA 3HB9A 3K4CA 2Q6IA 1RQPA 1FOWA 2EILH 1PXZA 1VTNC 3G4SI 2CW5A 3GTJJ 1I1SA 2P5LC 1K73D 2XTYA 2ZNYA 3CP8A 5EF6A 3ZCOA 2LKXA 3HUGB 1LLWA 1X4PA 1FZPB 3ISPA 2K4JA 4NK6A 4YZAA 2QBYB 1EP1B 1BW6A 3CC2I 3JU4A 3FISA 1R4MB 1VHEA 3L9FA 2R7XA 4MQVA 1RRJA 2STTA 2V1DA 3VFZA 3UR3C 3IKTA 2BGCA 1K83J 3BTLA 3LQQA 3GTLJ 1IV8A 1U2WA 4X05A 3R0AA 3K4JA 2HXIA 5FRNA 1UMQA 4LJZF 1AIPA 4HF2A 3GVLA 4UVAA 5FFZA 2HOTA 2FVGA 2MW8A 1F36A 4IXAA 4QVAA 3DKWA 2L3DA 2C6YA 4KISA 2VNHA 2YWHA 2EZHA 2HOAA 3OOCA 1I6XA 4Z4TA 4OJLA 1O88A 3HUGA 4YIIA 4XLCA 1J7KA 4KMUX 4L18B 3DWLE 1LUJB 1VQKI 1GAWA 2FD5A 2KDOA 2UUZA 5KCMA 4P2NA 2CJJA 3QRFF 1WJBA 3NB2A 1U3EM 1YIOA 1LDDA 2XAFA 2IW5A 4IHXA 2KHMA 2WY8Q 3FM3A 3M3YJ 2WC2A 2FX3A 3CMAB 4HSTA 3CF2A 3CCMB 3I58A 2X3HA 5LGNA 2R7VA 5GTHC 1FIPA 1QH0A 1DUXC 2KZVA 2VBXA 4JMQA 1SD4A 4HLYA 1P4MA 3H3VK 2WY7Q 3WTWC 4QSHA 2STWA 4RCYA 1WP6A 1HG8A 2XPVA 1WPCA 3CCEB 1V5VA 3LQRA 5F1RA 2Z9OA 3WU1B 3VYSB 4JQFA 2W7NA 3NAUA 2OK8A 4CGZA 2OA4A 2WV0A 2MGQA 2XHKA 4OPWA 4Y52J 1E17A 4BY7J 3GTPJ 2JZYA 4A3CJ 1HW5A 2W25A 1IGNA 4IQ4A 3BR2A 1XGMA 4V02C 3EUKL 4JK1X 1G4DA 1JTAA 1GO2A 5DUKA 1YITB 1SC7A 1S6LA 1B4AA 4PFOA 4ON0A 3WQZA 1WOOA 1NTCA 3ABUA 5GPAA 3Q6QA 5J8CA 1R5OA 4KT5C 3RPQA 2IA0A 3OPOA 3Q9VA 4BDYA 3CCYA 3IP4B 3RY8A 3WBJA 2QGUA 1G6NA 2EBIA 3LAPA 1SANA 3FXRA 2A6EF 2G0EA 2G7HA 3OR2C 4FE4A 1EV7A 3L09A 1P7IA 4IKFA 1UB9A 5D4SA 3RKYA 4PJMA 3TO6A 2F6CA 1BLIA 2AO9A 2W6JA 3SJMA 2QE7A 3GFJA 2CRGA 1XTAA 4BY1J 4GRIA 3W6KB 1W34A 2CFOA 3C3WA 3ZMUA 4F3QA 2PG4A 2JMWA 4AUXA 2GAUA 2CS3A 2V6CA 2O17A 3V7RA 2VFOA 2COMA 1PP8F 3OE7A 2A05A 1XSVA 2DK8A 2IA1A 4KIBA 1IDYA 3F6OA 5K1YA 1QBJA 3F8FA 4DNCA 4G6TB 3W5HA 3BR5A 4IW3B 2C5HA 2JA6J 4LOCA 1BC7C 3FXMA 4I76A 4UB8C 4HV6A 3JQRA 1SFEA 1Y56A 1OR7C 2Q2EA 2XSJC 2R5YA 2VPLA 3ZMSA 4M6VA 1AWCA 2XGEA 4U7BA 2P6SA 3W5VA 1JJ6C 1X1CA 3A8IA 1J59A 2DQRA 3L1PA 1R23A 3DLLF 5F6FA 5TJJA 4TMVA 3EUHA 5LFAA 1SVOA 1FTTA 2KIQA 3FK7A 1ZGJA 5E3LA 1AOYA 5B6IA 4X1EA 3K70D 1XGOA 4LIUA 4LG3A 2R7RA 1MDMA 2VBSA 1KONA 3HHGA 2XNCA 2A6TA 3M1CA 4QWQA 3AG2H 4A2UA 4OIOF 4N4OB 1QQ1A 1JT6A 2H6CA 2OC6A 2UXNA 3ZMDA 4CDGA 2HTJA 4BEHA 4CH7A 2QSHX 4NB5A 1MW7A 1I50J 2KT0A 4E7KA 3J7AO 1WMRA 4M73A 2IT0A 3F3XA 4OIPF 1MRZA 4OOSA 4RD6A 4ANJA 1KQSB 4KKSA 1TWAJ 5IP7J 5LEKA 1QO0D 2IS1A 4EEFG 4ZCLA 1OFEA 1DG1G 1QG0A 3HOYJ 4GYIA 1R5GA 3LA3A 4M3DA 2R92J 4NDLA 5IOZA 4X0CA 2HEOA 4HF1A 2K7LA 5HDKA 2LF7A 2X4HA 5A2QZ 1PP7U 5DNSA 2M7BA 4MNUA 3L2CA 4JBAA 2YWEA 2VBWA 4LITA 1HKQA 2E1MB 4B09A 2JTVA 1ZELA 1T0FA 4M9XA 3TKYA 1T33A 5HS9A 1X3WB 2BXZA 2BM7A 3I3LA 5BSXA 1OB2A 1MBJA 2K3FA 1UZCA 4DQLA 1WI9A 4DZJA 1WU8A 4G5GA 1IB4A 5L3BA 1W0KA 5ILSA 4AU7A 1D8TA 4PJ0C 4ITVA 1VQ5I 4CSWA 4XD7A 5F27A 1OLTA 4H9GA 3W2EA 4BBSJ 3H0DA 3PNTA 3OEHA 4GYGA 4XSZF 5F4OA 1ONVA 1JUPA 3FKJA 2Z8GA 2K86A 2HMAA 4MEXF 4OOVA 1RUOA 2D3NA 1K6OA 2CV1A 3FY3A 1WOPA 1QGYA 1QVFB 3FMRA 2Y9YA 4H4KC 1X4OA 3ZQGA 4RB3C 3VYRB 1UD6A 3W5UA 1N8RD 4L5JA 4RB1A 3ZQFA 4GDFA 1K8FA 3COAC 2PJRB 1N25A 2DFHA 3QPSA 4BUPA 2DPUA 2QMUA 2LMDA 2A61A 2ZZFA 4H0EA 1VQ4B 1FP2A 1O8LA 1LDJA 1T39A 3HTUA 1ZTRA 2H1LA 4A69C 1BX0A 4LMYA 3V8JA 2WR8A 3R60A 3ASSA 4EGYA 1JGGA 2NOJB 4YELA 3CCSB 2FQ3A 5D5UB 3OSFA 3OIOA 2VBZA 2ZXIA 3A1YA 4A6DA 1FSEA 3B90A 4DQ2A 2B7EA 3K69A 1YRNB 3HRSA 4G1VA 2LD5A 3E6BA 4BQOA 2M7AA 2FA5A 1EFTA 2V9PA
chains in the Genus database with same CATH topology
4BDZA 1LFPA 4HNUA 1BN8A 1XG2A 3GQAA 4NNJA 2VLAA 4IX7A 4HG2A 2Z1DA 5CQGA 3SEQA 1NBMA 2A5WA 4XKCA 1WJ5A 4Y3OA 2PJRA 1ERDA 3A3GA 1WJDA 3OS1A 3VSKA 1EA3A 1V0FA 1W9XA 2KRCA 3T51B 2VBEA 4OJOA 1X19A 1K6YA 1UELB 3DQVC 3C2HA 4I84A 4NUBA 3VSLA 1N77A 1G8XA 2L5QA 2V6EA 3JURA 2X1DA 3M8JA 4KT6A 5DN6A 1OFMA 3PL8A 4CZCA 2XZLA 5CQEA 4C9YA 2L9SA 1QJVA 4OJ5A 3PNVA 1SKYB 3K6GA 2P0WA 3K4KA 2KVOA 4ZC3A 3A35A 3BC9A 3ZQQA 2VJ4A 4TT3A 1I8DA 1NG7A 3TMOA 2R7SA 4DNTB 2X6YA 1QCXA 1JI8A 1NRKA 3D5RC 5C1EA 3S3MA 3H9QA 3AL0C 3CZ6A 1UD3A 4U87A 2IGKA 1BR4A 2L2OA 2MFZA 3MKWB 2ZZQA 4XMYA 1E3XA 1IA5A 2ZZGA 1NHCA 2LREA 4BJ5C 3H5AA 4DGWB 4R79A 4XOPA 4E7IA 4NK8A 2WAEA 2BW3A 2WPDA 3PUBA 3A4CA 4BGDA 1UD4A 2R4GA 2BVLA 3OR1C 2LRDA 4F55A 1AIRA 3MKYB 4BU2A 3FBNB 4CCMA 1OFLA 2CUJA 2VBKA 4OZZA 3H35A 4ZDOA 2JJ1A 4E0FA 3IUOA 1E1RA 2Q2EB 4DK1A 2XDVA 2KLOA 2MYSA 4NQWB 4Z03A 2WAQA 2Z2SB 2V9KA 4BE1A 2WJVA 2QKMB 3HXLA 2BVMA 3W3CA 2XOKA 5CDFA 2CW8A 4XM3A 4D1QA 2CW7A 3OYKA 2JVGA 3HOTA 1VF7A 3CJRB 3L2UA 1O8FA 2M3AA 4DBQA 3K4LA 2JVHA 3L2VA 3LL7A 2HVQA 1E3ZA 1MNDA 3UNGC 3HPHA 3FDYA 3U21A 3AFHA 2NZMA 4ZTFA 2ELJA 2X51A 3SEZA 3ZXSA 1FMVA 4XOTA 2K9LA 2VQHA 3ZR8X 2WBMA 3QOEA 2F1MA 4HNTA 4EW9A 2QKLB 2GJRA 3SDBA 4BJ6C 2DJIA 3NWSA 4XR6A 2VQGA 4KKTA 3RQ4A 1TZLA 3H5NA 4G7WA 2VASA 3LSIA 3OYGA 1QHGA 4PSXA 1TT0A 4CCLA 1HA8A 3T53B 3ZSCA 4QPOA 3ZPNA 2OUMA 2Q1ZB 2VQCA 1BR1A 2M4KA 1WTHD 1LKXA 3K4NA 4II3A 4OJ6A 2X6XA 3L2RA 2V4JC 2AQFA 3LSMA 1N75A 2ZXHA 3SYTA 4YXWA 5HKKA 3OEEA 1O8EA 1DGWY 2W4SA 2VXZA 4FASD 4GQNA 1WJCA 3VYTB 4F93B 2WA0A 2HZDA 4D9JA 1GQ8A 3K70C 4W8QA 2RQQA 4ZYAA 3IAS2 3GQ8A 2INVA 4F91B 1KMHA 1V5GA 4BACA 2X85A 4YEJA 1D1BA 4B47A 3KRGA 2IXSA 2GOMA 2KL4A 2AQEA 2MABA 4KKUA 3FHNA 3LSKA 3OMYA 3OS2A 4BS9A 2XGJA 1MNEA 3C2GA 4EATA 3BG6A 2LY2A 4BE2A 1I18A 1IDJA 1WJFA 4Y33A 3BC8A 3FKSA 5CPRB 1KCDA 3RTRA 4RM3A 3OIQA 4Y4RA 1T5EA 1QHHD 1Z3YA 3RCOA 1PJRA 3LFUA 4HIZA 2GK7A 4X0GA 5C1CA 1VJSA 3SZGA 1KZLA 4E6KG 1VBLA 4HRIA 1OB0A 1OHHA 5HNFA 3OW7A 2LBFA 2HPMA 3HAGA 5KHDA 3NE5B 1P9QC 2KP6A 2M4GA 2E1MC 4AVZA 2F43A 1YE9A 2NSPA 2V26A 4RMNA 1VZ0A 3KX2A 2UVFA 4XKWA 4P5OA 4PJNA 5FROA 4W8TA 3OIPA 1H8EA 2HQAA 1E79A 1U0JA 4HSRA 2JJ2A 2E60A 1MABA 2HLDA 4E7HA 1WJEA 4F92B 2NT6A 1MMNA 5KNLA 3DKXA 1EFRA 4XLAA 3DKYA 3RSNA 3E0JB 4YZ0A 1O8HA 2W6IA 3EQOA 2ZFUA 2V4DA 5LD2C 5HNHA 2VKDA 1E1QA 2F4IA 3CESA 3BH4A 3OYIA 2O0VA 1BOBA 4OJPA 3OWTA 3BCDA 2LZJA 2XNDA 2HNHA 1PLUA 3K4MA 2ZZEA 3LMWA 1UD2A 1S9HA 1SAUA 2LH9A 3IAM2 2DT6A 4CA0A 2QY1A 1LDKB 3KEYA 3DPTA 3DDYA 2LG4A 2K5CA 3CJQB 1DBOA 2Y0SA 2BSPA 2PECA 1J09A 4C2UA 4E7LA 4OAYA 3HPGA 4ZDPA 2R7WA 4BE0A 3OYDA 4XONA 2WADA 2X8KA 3A3BA 4PUSA 3EQNA 5TGTA 3H5RA 1W36D 4AYBA 2XC7A 2PYHA 2GOXB 3BCBA 1K28D 4CCJA 3V42A 1QU3A 2ZSIB 4DK0A 1D1CA 2QX3A 3J7AY 4G7XA 2VXDA 2GJKA 4JOMA 1OGMX 4RLQA 2K9MA 1GLNA 1UD8A 3MMYB 4KITB 2NTPA 4BL0B 4DOZA 4L8JA 4DNRB 2W82A 4XKVA 2E5ZA 4II2A 2EWEA 3QYBA 4HEA2 2Z6BD 4Z1MA 2VJJA 3CP2A 2DOAA 1H80A 1O8KA 3TL4X 3CMMA 2L7KA 5JHFA 2K3PA 4RLFA 3HOSA 4B48A 4RM2A 2ZTNA 4OZYA 4N4NB 3OYAA 1DBGA 4ZTJA 1O8DA 4NC7A 3OOUA 1RMGA 2X1CA 4BQNA 4XLFA 4FETA 4BXFA 2LOOA 3K4CA 1D0XA 1W36C 3ZPPA 1PXZA 2ODLA 3AKZA 2V1NA 3PJRA 4YZXA 4PJJA 4DIQA 3S32A 3A2KA 4XKBA 3CP8A 3ZCOA 3HUGB 4NC8A 3D5LA 1X4PA 1HZEA 1COWA 4G6IA 4NK6A 4YZAA 1T0FC 4BEHB 1BPLA 4DBRA 3JU4A 2R7XA 2WAFA 4PFPA 2NSTA 2WZPP 1KCCA 2CV2A 1FMWA 3UR3C 1NG6A 2HDWA 2NTBA 4MXNA 2F5VA 3RPUD 1H8HA 2RNGA 3L2WA 4B3XA 2XF6A 4Z05A 1Y6IA 3K4JA 5FRNA 1CZFA 4Z06A 2CK3A 2LC2A 3GVLA 3VSVA 3GVKA 4PK4A 3OS0A 1E43A 2ZSHB 4ASUA 4URRA 4KISA 3OOCA 4OJLA 1O88A 3HKZA 4IQJA 2NTQA 4XLCA 3T9GA 3QODA 3DWLE 4F52A 3LSGA 1DGRM 2KDOA 2UUZA 1V5FA 1Z3XA 5KCMA 4E4HA 1X0CA 3B8YA 2HVRA 4XLEA 2PYGA 1WJBA 5HOOA 3GBGA 2JUGA 2KHMA 2WY8Q 3GQBA 4HSTA 3LNNA 3CF2A 3BG7A 3BCFA 2X3HA 2R7VA 2QXZA 4JMQA 2KZVA 2D3LA 3I9V2 2WY7Q 3OL3A 1W0JA 3DTIA 1T95A 1WP6A 2LY1A 1HG8A 1WPCA 4PMHA 1IRXA 5FL7A 3OYFA 4IZZA 3DEEA 3VYSB 4JQFA 3OYMA 2W7NA 1HVXA 4CCOA 3G05A 4BQQA 3S3NA 3DTEA 3W2AA 1KTWA 3S8PA 2V7FA 3L2QA 2ZTGA 1SFKA 1X1DA 2E5NA 2R7OA 4B44A 3HC7A 4B43A 4IQ4A 3VSUA 3EUKL 1V5EA 4PSWA 1JTAA 2VBMA 3S3OA 1PKVA 5IK2A 2JA2A 3VMWA 4PFOA 2PMZA 4XN3A 2O1DA 1K5CA 4FXUA 3WQZA 3ZRGA 2O0WA 2KRHA 3BCAA 3D5SC 3OPOA 2UVEA 2MC4A 3T56B 2RREA 4BDYA 3IP4B 2Z16A 1EE6A 4BJTA 1E0EA 1R6RA 4UZUA 1V0EA 2M5SA 2IGMA 4CCKA 1BR2A 1OGOX 1G59A 3OR2C 3OYEA 2IS6A 2NT9A 3VWBA 2CUZA 4XQFA 3MKZA 4IKFA 3ONQA 2KQRA 1MMDA 3S93A 4PJMA 2DXIA 1VLYA 2E1BA 2F6CA 1BLIA 3KYLA 2W6JA 1O8MA 4E7ZA 2QE7A 5CKTA 3PFYA 4GRIA 3UW0A 4ZDLA 4CUGA 2CFOA 4QPQA 1LVKA 1MMGA 4F3QA 4MR0A 2OV7A 2HU9A 2CV0A 1N78A 2CS3A 1O8IA 2O04A 2O17A 4LIVA 4P1WA 3E1SA 3OE7A 3K4BA 2LYCA 2XZOA 3MD2A 2JIZA 2BW3B 2IQ7A 2DT7B 3VSTA 4G6TB 1BHEA 2XF5A 3DPUA 2X53S 4YZQA 2X1EA 1Y56A 4YRVA 2UWMA 2HVSA 1UD5A 1OR7C 3OYNA 2XSJC 2VPLA 2WSSA 2L9NA 3OYCA 4TSFA 1O8JA 4U7BA 2VJIA 4U4BA 2V31A 1X1CA 2WB1A 2X6WA 4C2TA 1FX0A 4E7JA 2VL8A 4OWRB 3H9JA 2IGNA 4MLOA 4E7SA 1X1AA 3OYHA 4U49A 5LFAA 1D0YA 2WJYA 3OYLA 1MMAA 2VKHA 4J00A 3K70D 2GK6A 1Z21A 3HG9A 4LG3A 4LIUA 4CCNA 2R7RA 2GJPA 1PE9A 1KONA 3QYEA 2JSPA 2A6TA 3M1CA 2R9VA 1WJAA 4OAZA 4N4OB 1BMFA 3W2WA 2OC6A 3OL4A 1PYVA 4CH7A 4BEHA 1MW7A 4E7KA 1WMRA 2KMUA 2VIXA 3VMVA 3OYBA 3PSFA 4B3FX 3EUAA 2INUA 4ANJA 4C30A 4KKSA 4P22A 2CH0A 2IS1A 1X1BA 2KPMA 5AMVA 3OAAA 2W00A 1UG0A 3PSIA 4TKOB 3GQ9A 1AA7A 4XLHA 4XNFA 3N05A 3H9GA 2JDIA 3DLAA 3QYFA 4ZJZA 2XF7A 5FRMA 3VR6A 3B4NA 1UAAA 2M7BA 3VDXA 2W1OA 4LITA 2E1MB 2VB6A 2VQLA 3AL0B 1D0ZA 2R7QA 4XN0A 2V7QA 1JRGA 1ZELA 3ZGKA 1RWRA 4HWVA 3DU6A 3I3LA 4PJLA 3NWTA 3GVJA 3OFNA 1DP3A 2M0MA 1DQUA 1IB4A 1D1AA 1W0KA 2IS4A 3OY9A 1IDKA 4AU7A 1WFXA 4ITVA 3BLYA 4CSWA 3GQ7A 4XD7A 2MD0A 1OLTA 3PNYA 2UV1A 3H94A 2HPIA 3H0DA 3KEWA 4B3GA 3PNTA 3OEHA 1YX3A 4KJZA 2R7TA 3FKJA 2Z8GA 2DIEA 3LSHA 3DTKA 4XORA 4DJAA 3DU5A 2D3NA 4C2LA 2CV1A 2FUG2 3FY3A 3EUHC 1RU4A 4H4KC 1X4OA 1Z7LA 1UD6A 3VYRB 2XZPA 2CMPA 3FBIB 3HL2A 2PJRB 4BUPA 3FPPA 3W2VA 2BOLA 2ZZFA 2DCEA 1O8LA 3TBIA 4W8SA 3ZIAA 2I8DA 2R7UA 4HPQA 3EPZA 2XAUA 5HVQC 2IGOA 3SUCA 2NOJB 3LMMA 4YELA 3GRHA 3F9KA 4XL9A 4W8RA 2ZXIA 3OYJA 3A1YA 3VYUB 3B90A 3WWGA 2O5RA 2LBFB 2IS2A 1O8GA 2VJ5A 1YX5A 1OOCA 4BQOA 2M7AA 4J01A 5HLTA 3DPLC 3K10A 3G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O04 A;  2O17 A;  3KRG A;  4YZX A;  1BN8 A;  1XG2 A;  3GQA A;  2IQ7 A;  4NK6 A;  4YZA A;  3VST A;  1BHE A;  1IDJ A;  2VBE A;  4OJO A;  4YZQ A;  2NST A;  1KCC A;  4I84 A;  1KCD A;  3JUR A;  1O8J A;  2NTB A;  1OFM A;  4MXN A;  4U4B A;  2VJI A;  1QJV A;  4OJ5 A;  4Z05 A;  2X6W A;  5C1C A;  1CZF A;  1VBL A;  4Z06 A;  4U49 A;  3VSV A;  2X6Y A;  1QCX A;  5C1E A;  4AVZ A;  4URR A;  2NSP A;  1PE9 A;  4XMY A;  1IA5 A;  1NHC A;  4OJL A;  2UVF A;  4XKW A;  1O88 A;  4XOP A;  4W8T A;  4NK8 A;  2NTQ A;  4XLC A;  3T9G A;  1WMR A;  2NT6 A;  1X0C A;  1OFL A;  1AIR A;  3B8Y A;  3VMV A;  2VBK A;  4XLE A;  2PYG A;  4OZZ A;  2INU A;  5AMV A;  4XLA A;  4Z03 A;  3GQ9 A;  4YZ0 A;  1O8H A;  4XNF A;  4XLH A;  2QXZ A;  2X3H A;  3B4N A;  3EQO A;  4XM3 A;  1HG8 A;  2O0V A;  2X85 A;  4OJP A;  4PMH A;  4XN0 A;  1PLU A;  1JRG A;  1RWR A;  3LMW A;  4HWV A;  1O8F A;  1KTW A;  2QY1 A;  2BSP A;  1DBO A;  2PEC A;  1IB4 A;  2NZM A;  3VSU A;  1IDK A;  4XOT A;  4XON A;  1JTA A;  2VBM A;  3GQ7 A;  3EQN A;  3VMW A;  2ODL A;  4EW9 A;  4XR6 A;  2PYH A;  4XN3 A;  2Z8G A;  2O1D A;  1K5C A;  4XOR A;  2O0W A;  2QX3 A;  3ZSC A;  4C2L A;  2UVE A;  3FY3 A;  1OGM X;  1RU4 A;  2NTP A;  1EE6 A;  4OJ6 A;  4XKV A;  2EWE A;  1OGO X;  2X6X A;  1O8L A;  2VJJ A;  1O8K A;  1H80 A;  2NT9 A;  4W8S A;  4XQF A;  3SUC A;  4YEL A;  1O8E A;  1O8M A;  3GRH A;  4XL9 A;  4W8R A;  4OZY A;  1DBG A;  1O8D A;  1RMG A;  3B90 A;  3WWG A;  3UW0 A;  4XLF A;  1GQ8 A;  1O8G A;  4W8Q A;  1OOC A;  3GQ8 A;  2INV A;  4MR0 A;  3ZPP A;  1PXZ A;  4YEJ A;  1O8I A; 
#chains in the Genus database with same CATH topology
 4AID A;  3CXC B;  4QTR A;  4HNU A;  1XG2 A;  1W7P D;  2VBY A;  3VOD A;  3FIW A;  4NNJ A;  1RIO H;  4M74 A;  5CQG A;  1K78 B;  1EKE A;  2A5W A;  1WJ5 A;  4Y3O A;  2PJR A;  3EDP A;  2ZL7 A;  2PX9 A;  2VBE A;  1BA5 A;  3T51 B;  4Z4V A;  4OJO A;  1UEL B;  5H59 A;  1RKW A;  2XT2 A;  1SFU A;  3KLO A;  2V6E A;  4MHG A;  3JUR A;  2X1D A;  1VQO I;  1R00 A;  2BY3 A;  3JW4 A;  3M8J A;  1PUE E;  3G6E I;  2LDU A;  4D0P A;  1OR7 A;  5CQE A;  2I1L A;  3BP8 A;  1Q7Y D;  2XZL A;  4OJ5 A;  2QEX B;  1SKY B;  5E20 A;  2P0W A;  4FIS A;  4IHS A;  1KTV A;  3WTZ A;  1O3T A;  3ZQQ A;  2DER A;  4YFO A;  4RD2 A;  1DU0 A;  1JI8 A;  3D5R C;  2GIZ A;  1H9G A;  3CZ6 A;  3AAF A;  4L0Y B;  3O6B B;  4U87 A;  2IGK A;  3MKW B;  1E3P A;  2PI0 A;  1MBH A;  1IA5 A;  1N0U A;  2XGD A;  4BJ5 C;  4DGW B;  2J7K A;  1FY7 A;  3PUM A;  2FU4 A;  4LLG F;  2HYF A;  2BW3 A;  3LSJ A;  1A36 A;  2ZL5 A;  2AS5 F;  2LRD A;  1AIR A;  3MKY B;  4BU2 A;  1JE8 A;  3E5U A;  3H35 A;  4LC0 A;  1OCZ H;  2Z5U A;  1IXS B;  2XDV A;  3M7G A;  2F48 A;  2QWW A;  2KLO A;  3BG3 A;  4NQW B;  4DK1 A;  3JRI A;  3QOP A;  1XGS A;  3IKV A;  4XLN F;  1G3Y A;  4Q5S F;  2WJV A;  3P27 A;  2QKM B;  2BVM A;  3QPT A;  2XOK A;  5CDF A;  2DJN A;  1VQK B;  2CW8 A;  1IG7 A;  4D1Q A;  1S7A A;  2CUE A;  1U78 A;  4A0Y A;  3HOT A;  3PIP F;  3CJR B;  4M3B A;  1Z77 A;  2OPT A;  2ID3 A;  1N06 A;  1TQI A;  2K40 A;  3E97 A;  1E3Z A;  1ETW A;  1IHM A;  2PEX A;  1Z67 A;  1MND A;  3UNG C;  4A3I J;  3BNW A;  2DET A;  3EQL F;  3HPH A;  3S14 J;  2NZM A;  3WGH A;  4ZTF A;  2ELJ A;  4G94 A;  3KP2 A;  2TDX A;  1ZRF A;  2HOS A;  1GAQ A;  1N07 A;  5BNG A;  1TYX A;  5LHH A;  1Z0X A;  1U2R A;  4EW9 A;  2QKL B;  1ZM9 A;  2IA2 A;  1KQ9 A;  5IPA A;  2DJI A;  3NWS A;  4ZCI A;  4NQW A;  2VAS A;  4TN1 A;  3HGY A;  1HA8 A;  3T53 B;  5B1B H;  3ZSC A;  2WV1 A;  3OV8 A;  4PGO A;  4X06 A;  4WZE A;  3QSY A;  2HFH A;  4G1B A;  5ERI A;  1IC8 A;  3HRU A;  4CYD A;  4II3 A;  2QBY A;  2R7D A;  4HV5 A;  5IY5 H;  4OJ6 A;  4KIC A;  1DDN A;  2QSF X;  1Y0N A;  1E2X A;  3S16 J;  2IOU G;  4NK8 A;  2L9V A;  2RVC A;  5FIU A;  2V7T A;  5LHG A;  2AQF A;  2ECB A;  3LSM A;  1VQ6 B;  2FNP A;  1O8E A;  4DYQ A;  2EIJ H;  2WTE A;  3NAR A;  4KN7 X;  4RLZ A;  2P3M A;  1WZ2 A;  4L5I A;  2QA4 I;  2HZD A;  3LOC A;  3LWF A;  1GQ8 A;  1OPC A;  4ZYA A;  1T56 A;  3JRG A;  1R5H A;  2VON A;  5IYD J;  2QLZ A;  2W7Z A;  2ZBU A;  3B02 A;  5BMZ A;  2BYV E;  4J0Q A;  3IH4 A;  2P7V B;  2VKE A;  1D1B A;  2X85 A;  4RD4 A;  1POG A;  3QWL A;  5CJ9 A;  3GFM A;  3LVB A;  5H2F C;  3WTY C;  3FHN A;  4R1H A;  5K7Z A;  3GCM A;  4BS9 A;  2XGJ A;  4EAT A;  1SVM A;  1TWH J;  4KIF A;  5EMN A;  2XAS A;  1ZR2 A;  3BC8 A;  2RC6 A;  5CPR B;  1W35 A;  3CJN A;  2CBX A;  4D7N A;  3PO3 J;  4RCZ A;  2R3S A;  4E70 A;  1QHH D;  1BW5 A;  1PJR A;  3LFU A;  4BYY A;  2XIG A;  5BS6 A;  3LNQ A;  1GHC A;  2BHZ A;  2VKV A;  5LLQ A;  4YHB A;  1VBL A;  3GF2 A;  1OHH A;  2HPM A;  1RR8 C;  5KHD A;  3Q6R A;  4XRM A;  1P7J A;  1CQT A;  4WF2 A;  1IRF A;  2F43 A;  2BX6 A;  5J8F A;  4RA2 A;  3BQZ A;  4XKW A;  2CQX A;  4XID A;  2OTL I;  2G7U A;  1UCR A;  5KK1 A;  2XAH A;  3WTU C;  3TOA A;  2E60 A;  1PUF A;  4JRA C;  5LBQ A;  1WJE A;  1KD1 D;  2R7Z J;  1B1B A;  3MCZ A;  3HOZ J;  3B6C A;  3LYC A;  4UZE A;  5CVJ A;  4U88 A;  5FLX K;  2ZNZ A;  3DKY A;  1VLO A;  2DMN A;  2DMQ A;  2CF4 A;  4CQJ A;  2DA3 A;  5CVU A;  4EM2 A;  2ZFU A;  2V4D A;  3WTV C;  4WX9 A;  1ZRE A;  3BH4 A;  1DU6 A;  4WXC A;  3I4M J;  3VR6 A;  2O0V A;  1IXR C;  3M07 A;  3I55 B;  3WTT C;  2XTX A;  2O7O A;  5EGO A;  2PBI A;  1VQ8 B;  3IAM 2;  2DT6 A;  4CA0 A;  1FTZ A;  3SZT A;  2YWG A;  1LDK B;  2JPB A;  3M8F A;  1AU7 A;  2E34 A;  3P5J A;  2BSP A;  1IUY A;  3QP6 A;  4C2U A;  2NVY J;  5FKK A;  4BE0 A;  5BPI A;  2WAD A;  2V79 A;  4PUS A;  4ENM A;  3BY6 A;  3G6E B;  2PYH A;  3F0C A;  2H1K A;  1M1E B;  2QEX I;  4CCJ A;  2JSC A;  3V42 A;  2BF4 A;  1T2K A;  1D1C A;  2ZJP F;  4G7X A;  2D2W A;  2YPR A;  2VE8 A;  4BBR J;  4PGG A;  4RGX A;  3RZD J;  1AMO A;  1GLN A;  4WXH A;  5D4R A;  4DOZ A;  4L8J A;  2VE9 A;  4EJO A;  3QE2 A;  1B8I B;  4DNR B;  3RYP A;  4XKV A;  2E5Z A;  5EGO B;  2Z6B D;  4RAZ A;  1FT9 A;  1GXQ A;  4I01 A;  2VUM J;  3CP2 A;  3BY2 A;  1PVE A;  5E1Z B;  2WB1 N;  3BG5 A;  4OPV A;  2EIM H;  3CMM A;  5JHF A;  5FO1 A;  1MZB A;  4RLF A;  3HOS A;  4IL6 C;  1HF0 A;  4RM2 A;  1A35 A;  3MZ8 A;  3OYA A;  4OZY A;  2V1U A;  1SMT A;  4HYE A;  1HBX G;  4A3E J;  5IT9 Z;  5FNZ A;  2LOO A;  3H3Z A;  5FKM A;  1ETO A;  5H6Q A;  1MDM B;  5EZH A;  3AKZ A;  1EJ9 A;  3CCS I;  1GVH A;  4YZX A;  3VOE A;  2RC5 A;  1ZRD A;  1J5Y A;  2L02 A;  4KA4 A;  4NC8 A;  3D5L A;  4BHC A;  1COW A;  2RDP A;  1EH7 A;  3I4P A;  1BPL A;  1STZ A;  5DV5 A;  4BEH B;  1TC3 C;  1QUE A;  2M9H A;  1B8I A;  2CYY A;  1SD7 A;  4V2G A;  2Y69 H;  2WAF A;  2NST A;  4TV7 A;  2VFQ A;  4YG2 F;  1E62 A;  3FK6 A;  5K7H A;  1NG6 A;  2AHQ A;  2PLY A;  3BOQ A;  3A0H C;  1LPQ A;  2OTL B;  2NTB A;  3RPU D;  1H8H A;  1QFJ A;  1OB5 A;  4UUT A;  3WGI A;  1I3Q J;  4X7F A;  3R61 A;  3I0T A;  1WPK A;  3HOW J;  1W5T A;  3OSG A;  5L3E A;  2K85 A;  1FLI A;  3GVK A;  3VSV A;  1VQ5 B;  2CW0 F;  2JRT A;  2LK2 A;  5BPD A;  3ZP5 A;  1E43 A;  5L46 A;  4C3I J;  2H27 A;  4URR A;  1HOM A;  4I99 C;  4W97 A;  3HKZ A;  2ZO4 A;  1ZH5 A;  2OTJ B;  3FM5 A;  2NTQ A;  2GXG A;  2HS5 A;  3MQ0 A;  3QOD A;  3P26 A;  3FWE A;  2DI3 A;  2GXB A;  1Z3X A;  4E4H A;  1EXM A;  2HVR A;  5BSY A;  2PYG A;  2N8G A;  5HOO A;  3J7Z I;  4LK1 F;  1JUS A;  4D5F A;  4WWV A;  3GQB A;  3GW2 A;  4I09 A;  2ELH A;  3S1M J;  1SKQ A;  2QXZ A;  4I7H A;  1H9T A;  4C0S A;  1TWC J;  3OL3 A;  3JRE A;  1W0J A;  3DTI A;  1P4W A;  3CCM I;  1NH3 A;  3OYM A;  5IYB J;  3RI4 A;  1OQY A;  1HVX A;  3G05 A;  3Q38 A;  1J9Z A;  1KU7 A;  2QSG X;  2ESN A;  3DTE A;  3W2A A;  3S8P A;  2ZTG A;  4KYW A;  1SFK A;  1Y8R B;  1BJA A;  4RM0 A;  2R7O A;  1YI2 B;  3GX4 X;  2MLK A;  2QEN A;  1XE1 A;  4A0Z A;  2GRE A;  1V5E A;  4OMZ A;  5GAH J;  2CWE A;  4HA8 A;  5FFX A;  3ZQI A;  5IK2 A;  4W1U A;  2VN2 A;  1YRN A;  3CCL B;  2VOD A;  4RB2 C;  2Y2Z A;  4ZGQ B;  3LJY A;  2V9V A;  2O1D A;  1R1T A;  1NK2 P;  4B3A A;  2O0W A;  4PC7 A;  3BCA A;  1HSJ A;  2E1N A;  2W24 A;  4FTH A;  2Y30 A;  3QFS A;  1Y0Y A;  4CYC B;  3DEW A;  5TV2 A;  1WSU A;  3G73 A;  1IN5 A;  1K78 A;  2BMW A;  5TIS C;  3S1N J;  4IVN A;  4RPD A;  1BR2 A;  1YS7 A;  3IHU A;  3ZZ0 A;  2Y31 A;  5D5W B;  1NK3 P;  1OGO X;  3OYE A;  3PUF A;  1ULY A;  2QQ9 A;  4RD3 A;  1Y1W J;  4L5E A;  3VNV A;  3S93 A;  2KQR A;  1MMD A;  2DXI A;  3NAW A;  1QRY A;  1IJE A;  4M0L A;  1FNB A;  4O5V A;  4ZYG A;  3LAJ A;  2DW4 A;  4CUG A;  4EVI A;  1LVK A;  4AIH A;  5FJ8 J;  1R5N A;  2DCU A;  3VB2 A;  3F8C A;  3M1E A;  2K02 A;  5B3S H;  1WRJ A;  2XC1 A;  1ETQ A;  2CV0 A;  3B78 A;  3H0G J;  1BN5 A;  2X48 A;  2LYC A;  2BE5 F;  3P9C A;  2ZJR F;  2JIZ A;  2BW3 B;  2XPW A;  2DT7 B;  5CVV A;  4P25 A;  5K5R A;  1BOA A;  4U0Y A;  3CCR I;  4EQQ A;  3H3U A;  1QGA A;  2YX4 A;  3L00 A;  3GYH X;  2HVS A;  1WSV A;  1Z6R A;  3OYN A;  3OW2 B;  5FO5 A;  3HOX J;  4LBW A;  4TSF A;  3N4M A;  2AXT C;  3HTS B;  1VI0 A;  2X0L A;  1FBQ A;  1ZM2 A;  1FX0 A;  1FC3 A;  2DTR A;  3H9J A;  4E7S A;  5M3F J;  3OYH A;  3ZQL A;  3TGN A;  1MSE C;  2JN9 A;  1D0Y A;  4I02 A;  3OYL A;  1ZKG A;  4J00 A;  3HG9 A;  1U8R A;  3M8E A;  4N9H A;  1VF9 A;  1MH4 A;  1YIT I;  2R9V A;  1WJA A;  2Y0M A;  1I7P A;  3QFC A;  3JQP A;  4HE6 A;  1P4X A;  1PYV A;  1U9O A;  2M87 A;  2JWT A;  2P81 A;  2CND A;  1WH5 A;  2KMU A;  3VMV A;  3B8H A;  1BIA A;  1HDD C;  4C30 A;  2VOP A;  1X1B A;  3O8G A;  3PSI A;  1MGT A;  4UV9 A;  2WZN A;  2A07 F;  4OMY A;  3N05 A;  3H9G A;  3SKB A;  3W2H A;  1TT5 B;  2KFD A;  1JHF A;  5J3L A;  4O6J A;  1R49 A;  3CQZ J;  3F8B A;  2VB6 A;  1IN8 A;  4ZZL A;  1MSF C;  3KET A;  1QGP A;  3HIF A;  3DFG A;  4CZZ A;  1Q86 D;  3TOB A;  5LGU A;  3G71 I;  3WHC A;  4HWV A;  4P96 A;  1OCC H;  1FNM A;  1HST A;  1B9N A;  1YLF A;  2HOE A;  4PJL A;  1KYZ A;  4EV0 A;  2EFW A;  5J1U A;  3GVJ A;  2GQF A;  1I6H J;  1D1A A;  2L7M P;  4BHB A;  1Y1V J;  3K2Z A;  3OY9 A;  1IDK A;  2IPQ X;  1WFX A;  1GT0 C;  1XB4 A;  2DQL A;  2XTW A;  3GQ7 A;  2QUF A;  2UV1 A;  4OU0 A;  5DD8 A;  2HPI A;  5ICE A;  5ICG A;  3KEW A;  1YX3 A;  4KJZ A;  1OYY A;  4PC2 A;  1JJ8 C;  2F2E A;  4HX7 A;  3LSH A;  3SHF A;  4EJV A;  4XOR A;  2OZU A;  4DJA A;  3DU5 A;  1YW9 A;  3CME B;  1REP C;  4X07 A;  4C3J J;  1RU4 A;  2EIX A;  2ESH A;  1SD6 A;  1Z7L A;  3HRM A;  1S72 B;  3PO2 J;  2CMP A;  2L54 A;  2W48 A;  3FBI B;  3PIO F;  3HOV J;  1M90 D;  2R5Z B;  2COB A;  2F4N A;  1U6G A;  2BZT A;  1DDG A;  4Q7J B;  3GUD A;  3A0B C;  2LLK A;  1I27 A;  2X9D A;  2IEK A;  3OZV A;  3ZIA A;  4GFB A;  4YC5 A;  2R7U A;  4HPQ A;  1QGZ A;  3EPZ A;  2XAU A;  3SUC A;  5D6F A;  1SVL A;  1EZG A;  4ZYH A;  1JJ2 B;  2DYR H;  2M2E A;  2TCT A;  1KZH A;  3VYU B;  1V3F A;  2FNA A;  3WWG A;  2IS2 A;  1WCM J;  2VJ5 A;  1ZAO A;  1YW8 A;  3NQO A;  3V4G A;  1LFB A;  4J01 A;  5HLT A;  2JQ7 A;  3TO9 A;  1CNE A;  2X3U A;  3Q39 A;  3K10 A;  1OFD A;  2DA4 A;  1SAX A;  5IYP A;  1BN8 A;  3FF5 A;  4UVB A;  3W2F A;  2VLA A;  2NS8 A;  4HG2 A;  3RKQ A;  2DU9 A;  3SEQ A;  2C78 A;  1Q82 D;  2F1L A;  4AD9 A;  4MTD A;  2EB7 A;  1PUF B;  2R5Z A;  1J9I A;  2EH3 A;  3HDD A;  3WNB A;  2HQR A;  2KRC A;  4WZK A;  4JX5 A;  3JTG A;  5KW9 A;  3DQV C;  1Z05 A;  3KZZ A;  4YAW A;  2XRN A;  1S8N A;  2VYQ A;  3I56 B;  1N77 A;  4I84 A;  2L5Q A;  3MEX A;  3FXQ A;  1XGN A;  1XMA A;  3PL8 A;  4KT6 A;  5JFR A;  5KAI C;  3MKL A;  2FSW A;  1LQ1 A;  3K6G A;  4A3B J;  3K4K A;  2KVO A;  1M1K D;  2EZI A;  2VT3 A;  5C4X J;  2UZK A;  2H8R A;  1WXR A;  4FCY A;  3BC9 A;  1IZ1 A;  2HQN A;  4BXX J;  4IJA A;  4M2L A;  2E1O A;  2HDC A;  4OIQ F;  2L4A A;  4DNT B;  3JRF A;  4FX4 A;  1HF2 A;  1QCX A;  3H9Q A;  4B1R A;  3IL2 A;  1ZAR A;  4O3M A;  1NHC A;  5FKL A;  2ZZG A;  2QVO A;  1X58 A;  4XOP A;  1TL8 A;  2BY2 A;  3WNC A;  1YW7 A;  3A4C A;  1H88 C;  1N0V C;  2UXX A;  3KP5 A;  4FQG A;  2L0K A;  2R4G A;  2GA2 A;  2XVC A;  2K4B A;  1GUU A;  3BG9 A;  1UMK A;  3LQE A;  3ZMT A;  1K4T A;  1J75 A;  4CCM A;  3FBN B;  4AYB N;  2F3L A;  4EM1 A;  4E0F A;  4MIM A;  1E1R A;  2EZK A;  2C2W A;  3ZQC A;  4S0H B;  2VPR A;  1GR1 A;  2V7X A;  1VQN B;  4PGH A;  4BE1 A;  2MBF A;  5JR3 A;  1PJ5 A;  3HSR A;  1Y0R A;  3PQK A;  2CG4 A;  2XNJ A;  1F5T A;  1ZG5 A;  2GQQ A;  1YIJ B;  3OYK A;  1MBK A;  2DOG A;  2JVG A;  4A5M A;  5A8A A;  1VF7 A;  4X8I A;  3L2U A;  1EH8 A;  3V7C A;  4DBQ A;  5D5V B;  1QRB A;  1MBE A;  2JVH A;  1R5I D;  3L2V A;  4FWT A;  3PUN A;  1ZG3 A;  3FDY A;  2FQ4 A;  3Q3S A;  1S72 I;  2X51 A;  2VI6 A;  2XAQ A;  3ZXS A;  4WZT A;  4XOT A;  1Q1H A;  2QCO A;  3ZR8 X;  3FPK A;  1B9M A;  4HNT A;  3BR0 A;  1RKT A;  3WE3 A;  5GTI C;  4P55 A;  4U7D A;  2GJR A;  4YIR X;  5HXB A;  4RBO A;  3RQ4 A;  2DMT A;  3H5N A;  1K4S A;  2R6H A;  3FMQ A;  2E36 A;  1JKP C;  4CXF A;  3OJX A;  4HAM A;  2LNB A;  2E7X A;  1VQL I;  4NC6 A;  1T6Z A;  3N6Z A;  3PSZ A;  2M4K A;  1WTH D;  5AIQ A;  3K4N A;  1XB2 A;  3K1N A;  5HLG A;  1E64 A;  1ENH A;  2F4M B;  3CCQ B;  3S2H J;  5E8I A;  1YJN B;  5FGM A;  2V4J C;  3SDG A;  2DEU A;  1N75 A;  2ZXH A;  2ISZ A;  3A8K A;  4YXW A;  4B4D A;  1FPQ A;  2VXZ A;  3IRQ A;  1YI2 I;  3HRT A;  1QVU A;  3SQN A;  3J81 K;  4F93 B;  3VNU A;  2P4W A;  2PE3 A;  2RQQ A;  2BM0 A;  4F91 B;  1TW2 A;  1XD7 A;  4ENK A;  1V5G A;  1USS A;  4B47 A;  4YEI A;  4N3N A;  1BI2 A;  2Z33 A;  1FEX A;  2AQE A;  2MAB A;  3GFL A;  3HEF A;  4S05 A;  4UB6 C;  5THX A;  3LSK A;  4EJT A;  2FRH A;  3OS2 A;  3M4O J;  3QU3 A;  5DCF A;  4Y9U A;  5EZG A;  3TH0 A;  3RTR A;  4OPO A;  2OTJ I;  2D74 A;  1T6S A;  2MSY A;  1O3S A;  2GK7 A;  5IT9 K;  3G3Z A;  5C1C A;  1NHA A;  3SFI A;  2BXY A;  4HRI A;  1OB0 A;  4WZL A;  3OW7 A;  2LBF A;  2XAJ A;  1P9Q C;  2O8K A;  3NE5 B;  5LRR A;  4ACA A;  2I5U A;  4AM3 A;  2PN6 A;  2EQR A;  2NVU B;  1YE9 A;  1KA8 A;  3QQA A;  3KX2 A;  2C5B A;  3M9A A;  5L3D A;  5AIP A;  1O3R A;  4W8T A;  1Q1V A;  1AHD P;  2B9S A;  1H8E A;  1QFY A;  3K2A A;  2JJ2 A;  2BPO A;  1ZGA A;  2HLD A;  4E7H A;  3SY2 A;  5F04 A;  4F92 B;  3UKG A;  2NT6 A;  2OU2 A;  5KNL A;  2DA2 A;  3DKX A;  1JT0 A;  1L0O C;  2F5F A;  5KAF C;  3ZBT A;  2MH2 A;  1RR7 A;  2XRO A;  3GTG J;  1EFR A;  2J5P A;  3WG7 H;  1KK1 A;  1QX4 A;  3MMP A;  2KJB A;  4I6Z A;  1GJR A;  4Z4Z A;  2AXL A;  2GPJ A;  2EFP A;  2K9S A;  2W6I A;  1YTY A;  3AVV A;  2Y75 A;  4Y7N J;  1W0U A;  5LD2 C;  1T8I A;  2OQR A;  4CYC A;  1TYW A;  3CRZ A;  2D9R A;  2F4I A;  3WYA A;  3G4S B;  3OYI A;  2O0Y A;  1BOB A;  2ZME B;  3WND A;  2G0Y A;  1OIS A;  4RB0 A;  3IC7 A;  2LZJ A;  1ODD A;  1S3J A;  2XND A;  3AVU A;  2VNI A;  3K4M A;  2ZZE A;  4ENN A;  1ZR4 A;  3KPH A;  1Y39 A;  1D8J A;  1SAU A;  2DYI A;  1XSD A;  3LMW A;  1S0U A;  3MN2 A;  2D1H A;  4RGU A;  4R71 A;  3O8H A;  3DDY A;  4OP7 A;  3FXO A;  4E7L A;  2QTL A;  4AC9 A;  2J8I A;  2FMY A;  1G7C A;  2R7W A;  4A5N A;  3OYD A;  1XCB A;  2XKO A;  4DQK A;  5JBQ A;  3A3B A;  1QPM A;  3B82 A;  4AWX B;  4QIW N;  1WHU A;  1XDS A;  3GLX A;  3E7L A;  4M3G A;  3H5R A;  1X1P A;  2ZC2 A;  5TGT A;  1P2F A;  2W85 A;  2YU3 A;  3LA7 A;  3BCB A;  2XC7 A;  3MAJ A;  4DK0 A;  2H8W A;  4F7D A;  5HZA A;  3F8N A;  2VXD A;  2NTP A;  1UD8 A;  5J3O A;  1KQ5 A;  4BL0 B;  2NYX A;  2ZME A;  2RC4 A;  2JA7 J;  4A12 A;  4UY8 I;  4II2 A;  1ZGW A;  2EWE A;  3AVX A;  1P92 A;  1D5V A;  4Z1M A;  1G7R A;  2DOA A;  3JSP A;  1O8K A;  3C7J A;  2Z99 A;  3AG1 H;  2QDX A;  2OCC H;  2L7K A;  1FND A;  5F08 A;  2K3P A;  1LB2 A;  2ZTN A;  4B48 A;  3HM5 A;  2DAO A;  4WQM A;  2OBT A;  5CVR A;  2EA4 A;  2X1C A;  2DA7 A;  1TQM A;  2ME0 A;  2DYS H;  2ME6 A;  3S15 J;  1D0X A;  3LST A;  3I54 A;  2NS7 A;  2ODL A;  2V1N A;  3PJR A;  1S7O A;  4DIQ A;  3S32 A;  3JAM Z;  4DYR A;  4WK8 F;  1DDI A;  2CQK A;  5EG0 A;  3N97 A;  4ZGN B;  2QQ8 A;  1HZE A;  1ETY A;  1T0F C;  3CC4 B;  4QFM A;  3F72 A;  4M3E A;  4PFP A;  1XN7 A;  1KCC A;  1RI7 A;  3CUQ A;  2CV2 A;  3EYI A;  1FMW A;  1W4M A;  4MXN A;  2F5V A;  5L3C A;  3FXL A;  5FKO A;  5C3E J;  4Z05 A;  5FLX Z;  2DFE A;  4Z06 A;  3LSP A;  5FKN A;  2BM6 A;  1FJL A;  2CK3 A;  2LC2 A;  3GO5 A;  4PC6 A;  3E1Y E;  4PK4 A;  4ASU A;  2M8G X;  1QA6 A;  3AST A;  3U2R A;  4HX8 A;  5ILV A;  2RV8 A;  1MJ9 A;  5F4J A;  5TY0 A;  1ZQ3 P;  2ETH A;  3T9G A;  4UNO A;  5GP9 A;  4F52 A;  5IYW A;  1DGR M;  1X0C A;  3B8Y A;  4BNC A;  3OP1 A;  3IH3 A;  3CUQ B;  4JP0 A;  5IT3 A;  2JUG A;  4Y17 A;  1ITY A;  4ASN A;  4C3H J;  3R6J A;  4RPB A;  4X7C A;  2PFB A;  2Z3Y A;  1QFZ A;  2KJC A;  3TP3 A;  1QVG B;  3I9V 2;  4U9U A;  3BDD A;  2EWN A;  3H9N A;  1T95 A;  2O6G E;  1LLZ A;  2LY1 A;  3E6D A;  2ISY A;  5FL7 A;  2CQN A;  3OYF A;  4IZZ A;  3DEE A;  3AGQ A;  1LE8 A;  4BQQ A;  3S3N A;  3MCA A;  1KTW A;  3H92 A;  3L2Q A;  2DFF A;  2V7F A;  4C2M J;  3A01 A;  4A3D J;  2XEX A;  4ENJ A;  3SFZ A;  1TTY A;  3VMF A;  4L9V A;  1F9N A;  1IO2 A;  4IOC F;  2VBM A;  1ZLJ A;  2XT4 A;  2V7V A;  2RN7 A;  2JA2 A;  5AON A;  3ES9 A;  2GM4 A;  5ICC A;  5LRS A;  3CO6 C;  2M0C A;  1L1I A;  2BGI A;  3ZRG A;  1W1W E;  2KRH A;  1QUF A;  3D5S C;  5J40 A;  1Z6T A;  4BAY A;  3PVD A;  2MC4 A;  2RRE A;  2Q0O A;  1G2H A;  2DTZ A;  3SLN A;  3VO2 A;  1EE6 A;  2FBI A;  1R6R A;  1HW1 A;  2IP2 A;  3TO7 A;  4UZU A;  1V4R A;  2E71 A;  2DOD A;  1KQ0 A;  4Q47 A;  1YHQ I;  2CUZ A;  3PM1 A;  4UZF A;  4Z4S A;  3ONQ A;  1ELO A;  1O8M A;  2LVS A;  2M30 A;  4PAA A;  1H8A C;  3KYL A;  2FOK A;  4E7Z A;  1MH3 A;  4M71 A;  5F1J A;  1WOR A;  3TP0 A;  5CKT A;  4DYC A;  3AK5 A;  2JUC A;  3ABK H;  3PFY A;  5FA6 A;  4ZDL A;  4QPQ A;  2JA5 J;  3MZY A;  4KNY A;  2YX7 A;  3RIQ A;  2BHY A;  1N05 A;  2ZBV A;  3NEU A;  5E18 F;  2DMU A;  2OV7 A;  1FIA A;  1N78 A;  2O04 A;  3IH2 A;  4LIV A;  3E1S A;  3JTH A;  2X0K A;  1KU9 A;  1VQN I;  3K4B A;  1APL C;  3MD2 A;  2M1B A;  3HZJ A;  4EJU A;  4MO7 A;  4S04 A;  2IQ7 A;  3RDI A;  2ZXW H;  2HDN B;  2XF5 A;  3DPU A;  2FE3 A;  3R4K A;  3BR3 A;  4YZQ A;  3CPX A;  1BJZ A;  2X1E A;  3Q3A A;  1IDZ A;  4YFX F;  3CME I;  4YRV A;  5L3G A;  2UWM A;  3E3V A;  1VFC A;  4L9T A;  3H36 A;  1MIJ A;  3CF5 F;  2BV3 A;  4LB5 A;  1O8J A;  2Y48 A;  2DOF A;  3HHH A;  2VJI A;  3KP4 A;  5DD4 A;  5DCM A;  4DZP A;  1H89 C;  2V31 A;  3U2Q A;  2O3F A;  2NV4 A;  1OYI A;  2E19 A;  3ZQ7 A;  5EEA A;  4ESF A;  4E7J A;  5IYN A;  4K2E A;  3TQN A;  3W6J B;  2IGN A;  4MLO A;  4HNV A;  2NVX J;  3GEZ A;  1X1A A;  1U5T C;  4RDL A;  1D1N A;  4U49 A;  4LB6 B;  1YG2 A;  2WJY A;  3T0Y A;  1F43 A;  3BZC A;  2ZCW A;  3KP7 A;  2VKH A;  4AF6 A;  3ASN H;  1KU2 A;  4OIR F;  2GJP A;  2EZL A;  3DEU A;  2ADU A;  2JSP A;  3QYE A;  3JRB A;  1EF4 A;  1A6I A;  4OAZ A;  1YFH A;  1IN6 A;  4LK0 F;  3OL4 A;  3IWZ A;  4LFU A;  3F22 A;  2HYG D;  1TBX A;  1XSX A;  4P9F A;  3OOP A;  3SQV A;  3BQJ A;  4LLL A;  4MFD A;  1YQA A;  4B3F X;  4P22 A;  1FBU A;  2CH0 A;  3CMA I;  3ZBU A;  2KPM A;  2P5V A;  5IYQ A;  4Y13 A;  5DCM B;  2OZ6 A;  2NPF A;  4TKO B;  5EYR A;  3ASQ A;  1KU3 A;  1ZYR F;  4XLH A;  4XNF A;  4WCG A;  2JDI A;  3DLA A;  3IWF A;  3QYF A;  1UHM A;  2XF7 A;  3I55 I;  3B4N A;  1UAA A;  1TTT A;  3ECO A;  3VDX A;  5J6X A;  3TDU C;  2W1O A;  3T1B A;  4UVC A;  2VQL A;  3AL0 B;  1D0Z A;  2DLL A;  2R7Q A;  1GDT A;  1OCP A;  3MVP A;  2V7Q A;  2LKS A;  3FXJ A;  1SFX A;  1KK2 A;  3ZGK A;  1RWR A;  1T98 A;  1B6A A;  4KDP A;  1IN7 A;  1K7A A;  1DP3 A;  4P1V A;  1BC8 C;  4YIF A;  3QP5 A;  2M0M A;  1JXS A;  2EV0 A;  1XFO A;  2IS4 A;  3J81 k;  3BLY A;  3PNY A;  4IRH A;  3H94 A;  2YU9 J;  1O7F A;  3SJP A;  1PJ7 A;  3U6K A;  1MBF A;  4V2F A;  1ZM4 A;  4A3K J;  2QTZ A;  2DIE A;  2K27 A;  4XSX F;  2GLO A;  3DTK A;  2V7U A;  1TNS A;  3ERM A;  5E1X A;  4M6X A;  4M9Z A;  1CF7 A;  4A3G J;  3EUH C;  4ABZ A;  4YFK F;  4D5C A;  1S29 A;  1IW7 F;  4PC1 A;  2FF4 A;  4Z4W A;  3ML6 A;  1V55 H;  3BRO A;  3J81 Z;  3HL2 A;  2Q6O A;  1EH6 A;  3BPX A;  3W2V A;  3D1N I;  5DUI A;  1SEU A;  3ZOB A;  2PQ8 A;  5J1R A;  2I8D A;  5GAG J;  1VQO B;  1P4A A;  1VQP I;  3VEP A;  2IGO A;  1T6X A;  2O8X A;  5CYV A;  1L3L A;  3BJ6 A;  1JB9 A;  4RS8 A;  4JX6 A;  1H85 A;  1VND A;  2PMD A;  4P6Y A;  4UUS A;  2M5W A;  2O5R A;  2LBF B;  4CO8 A;  5E3M A;  1PJ6 A;  4P9S A;  1O8G A;  1YX5 A;  1XPX A;  4JYK A;  3U1D A;  1OOC A;  1QVT A;  1RPW A;  5LHI A;  2DOE A;  3DPL C;  5KVR A;  3BR1 A;  2CGP A;  4IHY A;  5DS0 A;  5B5E C;  1C0W A;  3G2B A;  2ID6 A;  1QA3 A;  2RAE A;  2ACJ A;  3AGP A;  1QZZ A;  1CF7 B;  3GQA A;  4QLC U;  3SYJ A;  4IX7 A;  2EIK H;  2EPF A;  2Z1D A;  2PMU A;  1B2R A;  1CLW A;  1VQ9 B;  4AC0 A;  4XKC A;  1JKQ C;  2V7W A;  4AIJ A;  1WJD A;  3LFK A;  1BBY A;  1EA3 A;  3ZN0 A;  5L3F A;  1VQ6 I;  3A3G A;  5DSZ A;  2QYU A;  1X19 A;  1DPU A;  1K6Y A;  1MD0 A;  5M5X J;  3C2H A;  3DCF A;  1IB0 A;  1G8X A;  4I0A A;  5JVG F;  4LG0 B;  3V7A A;  4WWC A;  2E2H J;  1RZ4 A;  3GIR A;  5DN6 A;  1QJV A;  1K4Z A;  3HSE A;  3PNV A;  5IYC J;  4HE5 A;  2VFM A;  4ZC3 A;  1Z1D A;  4IHW A;  1DAB A;  3E5X A;  4I98 B;  2VJ4 A;  1FP1 D;  3G1L A;  5IP6 A;  3ESW B;  1SFO J;  1FOK A;  1EFU A;  3GTO J;  1SD5 A;  1NG7 A;  3TMO A;  2R7S A;  1GV2 A;  1I8D A;  1KC8 D;  4RAF A;  1NRK A;  4FX0 A;  3S3M A;  1LFU P;  3ZZU A;  2L2O A;  1BR4 A;  5M5W J;  1QPI A;  1E3X A;  3JRH A;  2V5I A;  2LRE A;  1FX7 A;  4R79 A;  1JGS A;  2MG4 A;  4E7I A;  4YAO A;  1XMK A;  3FZV A;  2WPD A;  1K79 A;  3PUB A;  3BJO A;  4ESB A;  2LKP A;  4BGD A;  2ZL6 A;  4M53 A;  3SZE A;  1DPR A;  1UD4 A;  1IJW C;  2QGG A;  4L9N A;  3RKX A;  4KN4 X;  2ECC A;  2VBK A;  4NHJ A;  4OZZ A;  4G7H F;  4ZDO A;  2JJ1 A;  4LG0 A;  3ASR A;  2CC2 A;  1SMY F;  2GBY A;  4RDK A;  4Z03 A;  2DBB A;  2WAQ A;  2Z2S B;  2V9K A;  1TYV A;  1XC5 A;  2JT1 A;  2LFB A;  3A8J A;  3E6M A;  4HQE A;  4G8X A;  2CW7 A;  2W84 A;  5D8L B;  5FB2 A;  2BEO A;  1A5J A;  5D6E A;  1TNT A;  2E2J J;  3KL9 A;  1T38 A;  2LY9 A;  4MQ9 F;  2M3A A;  1OFC X;  4F7Z A;  5J47 A;  1FWZ A;  3LL7 A;  2HVQ A;  3E5Q A;  1GXP A;  2BV6 A;  1HCR A;  1V54 H;  1LEA A;  3PA2 A;  3Q9S A;  4FN5 A;  1WI3 A;  2IAI A;  2K9L A;  2KIM A;  2VQH A;  3ERE D;  2WBM A;  3Q0W A;  1R9T J;  4Y7C A;  3VO1 A;  3SDB A;  5JHU A;  1XQB A;  5HDG A;  4G7W A;  5ICF A;  3OYG A;  1Z91 A;  4PSX A;  3ZMZ A;  4D7M A;  1TWG J;  1BI1 A;  3P4G A;  1B72 B;  2VQC A;  5EG0 B;  1F60 A;  2YWF A;  1VQ7 B;  1R22 A;  3KZY A;  2WYR A;  4XIC A;  1OGI A;  1LKX A;  2VBU A;  3ASP A;  5JMC B;  2J5O A;  1LJ9 A;  2BN4 A;  3DXJ F;  4QV2 A;  3Q0U A;  1QZY A;  3D0S A;  1QZE A;  5J1Y A;  2QF7 A;  3L2R A;  1FNN A;  4RDU A;  3J80 Z;  4P9U A;  4J19 A;  3BTJ A;  2PIA A;  4GQN A;  2E1C A;  4HBL A;  3C18 A;  4D9J A;  2DO7 A;  2LTP A;  3CMY A;  1JKR C;  4W8Q A;  2DK5 A;  2ICW G;  3ZMV A;  2JJ7 A;  5HS7 A;  2INV A;  4HX4 A;  5E3N A;  3U9G A;  3CCV I;  2PJP A;  3HKZ N;  4YEJ A;  5GAD J;  3KRG A;  2A68 F;  1TYU A;  4Y9R A;  2IXS A;  2GOM A;  2RKH A;  5K7F A;  1B72 A;  4BQA A;  1NB9 A;  1Z9C A;  1XX5 A;  4KKU A;  2CFX A;  3ML3 A;  1T08 B;  4BE2 A;  3BG6 A;  2LY2 A;  3QPL A;  4Z4Y A;  1I18 A;  1IDJ A;  2HWV A;  1BIB A;  3TW7 A;  4TMT A;  2NXN B;  4Y33 A;  3P7N A;  3FKS A;  3S2D J;  1KCD A;  5E17 F;  1WKM A;  2HI3 A;  3OIQ A;  2JPC A;  1T5E A;  2ZXJ A;  1EFC A;  1FOY A;  3RCO A;  2OCE A;  4HIZ A;  3SEJ A;  2C77 A;  5EEG A;  3SZG A;  2EIN H;  1BI3 A;  1YJ9 B;  5HNF A;  1FSH A;  3HAG A;  3KZI C;  4G12 A;  4Q4Z F;  2KP6 A;  1RQR A;  3NRV A;  1HW2 A;  5JLW A;  2M4G A;  2ZME C;  3JAM K;  4AVZ A;  4QUZ A;  1LE8 B;  3SZP A;  2NSP A;  4KFC A;  2V26 A;  4RMN A;  1VZ0 A;  4FHT A;  2BBY A;  3A01 B;  2MC3 A;  4RGR A;  4UUV A;  4P5O A;  4PJN A;  4M6Y A;  5FRO A;  4OOI A;  3FKI J;  2FBK A;  2A6H F;  1U0J A;  2HQA A;  1E79 A;  1I1G A;  1MAB A;  1S4M A;  4IF4 A;  4M9S A;  1E3O C;  2OQG A;  4RAY A;  2JN6 A;  5TRD A;  1UG2 A;  1E3H A;  2QZ8 A;  5EEH A;  4V19 K;  3CC2 B;  3HGG A;  2P5K A;  4HW0 A;  3E0J B;  2OJE D;  4U0W A;  1O8H A;  3CTA A;  3RIR A;  1IXC A;  3K1P A;  2FOW A;  3P9K A;  4IPA A;  5HNH A;  4PDK A;  2VKD A;  2A3S A;  3HBL A;  4OJP A;  3BCD A;  3AG4 H;  3T5X A;  2HNH A;  1G3W A;  2D1V A;  2HYJ A;  1IUF A;  4MYT A;  1HDP A;  1EA0 A;  5IOY A;  4HDV A;  1JTX A;  2V1X A;  4LD5 A;  3V7S A;  1FRN A;  3T8R A;  3KEY A;  4MGR A;  4M72 A;  2NVQ J;  2K5C A;  3CJQ B;  1PDN C;  1DBO A;  1XG1 A;  4PCQ A;  1EP3 B;  4OAY A;  3CC7 I;  3HPG A;  2HQ5 A;  3CCJ B;  4ZYE A;  2E7W A;  4XON A;  2XSD C;  1R71 A;  9ANT A;  3HOU J;  4A3M J;  2X8K A;  1RET A;  3EQN A;  3RJP A;  4HF0 A;  4RGS A;  1ZUN B;  5KSW B;  3WBK A;  1W36 D;  3T8T A;  5F0C A;  1BQE A;  3ZUG A;  2VFN A;  1CGP A;  1VQM B;  2XRL A;  5FD5 A;  2GJK A;  1B59 A;  2FBH A;  3PQJ A;  3FHZ A;  3W6V A;  4NBS A;  1OGM X;  4LBV A;  2K9M A;  5JLX A;  1HXD A;  2H94 A;  1VQ9 I;  3R6S A;  5J4V A;  3F8M A;  3KIO A;  3BPV A;  4RDJ A;  3B73 A;  4GCV A;  3ISX A;  1VQ8 I;  3GTQ J;  2FEZ A;  2VJJ A;  1H80 A;  4TMX A;  3CPW B;  4BPR A;  4YAF A;  3CC7 B;  4N0B A;  3H09 A;  1LEB A;  2XKP A;  3CDH A;  5A88 A;  4ZCM A;  2QQA A;  4ZTJ A;  4Z2Y A;  3REO A;  3ABM H;  4FET A;  5TR9 A;  4BXF A;  4A3F J;  2ZJ2 A;  1TQP A;  2L4M A;  4AVP A;  1W36 C;  3ZPP A;  2DA5 A;  3CCU B;  2OF7 A;  3I59 B;  4PJJ A;  4WXD A;  3A2K A;  4XKB A;  3OZW A;  5HOD A;  3IRR A;  3ZZT A;  4TMZ A;  5GAE J;  3A1P A;  1UJ8 A;  3CLQ A;  4G6I A;  2QQB A;  3LO8 A;  4DBR A;  4A3L J;  5F0F A;  2VC1 A;  2BM5 A;  3DP7 A;  3AG3 H;  5M3M J;  4RD0 A;  4G7O F;  1QQI A;  2WZP P;  1OCO H;  1QA1 A;  3PFI A;  4CHU A;  2HDW A;  4YCQ A;  1OCT C;  3KYC B;  2VNK A;  4A3J J;  2RNG A;  1GVD A;  3L2W A;  3ZN1 A;  4B3X A;  2XF6 A;  1FYK A;  1Y6I A;  1CZF A;  3OKX A;  1A6Q A;  3KCC A;  3KEO A;  5DM6 F;  4HDU A;  1A31 A;  2DPD A;  4OM9 A;  1X3Z B;  2CO5 A;  3CUO A;  3OS0 A;  2ZSH B;  3I1F A;  1EP2 B;  1W2B B;  4BH9 A;  1JNY A;  3K0L A;  5ED4 A;  2H6B A;  1T6Y A;  1KJZ A;  2P7C B;  4IQJ A;  1S5L C;  2ZKZ A;  3LA2 A;  5EDN A;  2CQQ A;  4EGZ A;  3ASO H;  3RKW A;  2O9L A;  4AF7 A;  1R4N B;  2RQP A;  3MZH A;  1EWY A;  5F0H A;  3LSG A;  3KLN A;  1V5F A;  4YFN F;  1ACI A;  4XLE A;  4OOX A;  2EFO A;  3GBG A;  1A04 A;  3GZ6 A;  3WY9 A;  3HJE A;  3LNN A;  2P6T A;  3BG7 A;  4XK4 A;  3WHB A;  3CCE I;  3BCF A;  1QA2 A;  2NNN A;  3CD6 I;  3ZPL A;  2D3L A;  3W2G A;  1I39 A;  1A8P A;  2HGC A;  2QZA A;  2O61 A;  2WAQ N;  4PMH A;  1IRX A;  4BXU A;  3DU1 X;  1YOV B;  3RYR A;  3BJA A;  4CCO A;  2YSR A;  1CQX A;  1YO5 C;  5GV7 A;  1X1D A;  2E5N A;  2VZL A;  2HDD A;  4Y15 A;  3V8K A;  2JK3 A;  4B44 A;  3V76 A;  3HC7 A;  4B43 A;  1GVJ A;  1ZRC A;  2KZG A;  4P6V F;  3VSU A;  2IJL A;  4PSW A;  2ZBK A;  3S3O A;  1PKV A;  1ETV A;  1WQ2 A;  4UUS B;  2ZB9 A;  1J0R A;  2MA3 A;  1VQ4 I;  3VMW A;  5DTD A;  1YX2 A;  2PMZ A;  3HSF A;  2EFQ A;  1ETX A;  1IRZ A;  1JHH A;  4MFE A;  1U5T A;  4XN3 A;  5B66 C;  1ETK A;  1K5C A;  4FXU A;  5A2Q K;  3WGG A;  5C4J J;  4GGG A;  2UVE A;  1OJL A;  3Q5F A;  3T56 B;  1D8K A;  2Z16 A;  3ABT A;  1FYL A;  4N9I A;  3OZU A;  3I71 A;  4BJT A;  4LLN A;  1E0E A;  2HTS A;  3JRD A;  5K5Q A;  3E6C C;  1V0E A;  2M5S A;  1G3T A;  2IGM A;  4CCK A;  2VBV A;  3N90 A;  5E6T A;  2YUS A;  1G59 A;  2IS6 A;  1WWX A;  1RES A;  2NT9 A;  3VWB A;  3KP3 A;  4XQF A;  3MKZ A;  2HZT A;  3BZ6 A;  2R93 J;  1BX1 A;  2H09 A;  2E1B A;  2KIF A;  1VLY A;  2QYO A;  3CJT B;  2VBT A;  4NCN A;  2FJ1 A;  3CDI A;  1TSP A;  1HKT A;  1FOX A;  5DYM A;  5LEJ A;  3O3K A;  3UW0 A;  3JQQ A;  1RNL A;  4KMF A;  2BM1 A;  1ZK8 A;  1MMG A;  2XAG A;  3O2P E;  2O6W A;  4MR0 A;  4A0X A;  1YJW I;  1U5T B;  3RZO J;  1HQC A;  4XLP F;  2BY1 A;  1XS9 A;  3S2W A;  2HU9 A;  4N3G A;  1O8I A;  4OPS A;  1G7T A;  4P1W A;  1H42 A;  5FO0 A;  3GZ5 A;  3WOD F;  3WTS C;  2KRF A;  4B8X A;  2XZO A;  2EV5 A;  2DT5 A;  5E3O A;  3VST A;  1BHE A;  3MWM A;  2TRT A;  2X53 S;  4PZJ A;  2EK5 A;  3DF8 A;  1J2X A;  2NRA C;  5H20 A;  1X2M A;  2KIU A;  2LSO A;  1UD5 A;  1OCR H;  2WSS A;  1JA0 A;  2J8K A;  2HR3 A;  2L9N A;  3OYC A;  2BVN A;  4U4B A;  1KK0 A;  1E63 A;  3SLD A;  2MLG A;  2WB1 A;  2X6W A;  4C2T A;  2Q6K A;  3SXY A;  2VFP A;  2DFI A;  2VC0 A;  2VL8 A;  4OWR B;  4RAG A;  2GIV A;  1MNM C;  5D5X B;  2OAZ A;  4RD1 A;  5J4Y A;  4P26 A;  2FX0 A;  1VQM I;  3DBH B;  4M3F A;  1YS6 A;  1ZN2 A;  5C44 J;  1TUI A;  1MMA A;  1LVA A;  2GK6 A;  1Z21 A;  4CCN A;  4ESJ A;  1O3Q A;  1PE9 A;  4P3I A;  2E35 A;  1O57 A;  5LGT A;  3PA1 A;  1BMF A;  3W2W A;  4ZYD A;  2EJR A;  3F6V A;  3I56 I;  5J35 A;  1Y0U A;  2VIX A;  3CCR B;  3ECH A;  5CVI A;  1FBS A;  3OYB A;  2Q6L A;  2NOG A;  3PSF A;  3EUA A;  2INU A;  4IRG A;  4KIG A;  1D2E A;  2D45 A;  3LQ6 A;  5AMV A;  3OAA A;  2W00 A;  1G3S A;  1UG0 A;  5FD6 A;  3WE2 A;  3GQ9 A;  1AA7 A;  5F64 A;  2NS0 A;  4ZJZ A;  5FRM A;  1DP7 P;  2Y9Z A;  5HLH A;  2A69 F;  3F21 A;  2CSO A;  3CD6 B;  4EMS A;  3WU2 C;  1U9N A;  2R0Q C;  1FYM A;  4IOA F;  1W87 A;  3V8L A;  4XN0 A;  1MBG A;  2Y0S N;  2G9W A;  4UXN A;  1JRG A;  5HZB A;  3QFT A;  4XBF A;  2JRM A;  4Z6Y A;  2CU7 A;  3DU6 A;  4PAB A;  4GXO A;  1R58 A;  3NWT A;  1VQ7 I;  3TDZ C;  2OBP A;  3OFN A;  3X2Q H;  1DQU A;  1WVR A;  2B5O A;  2B7C A;  1BM9 A;  5A89 A;  1TWF J;  1WGX A;  2MD0 A;  4M4S A;  4UHT A;  3FMS A;  1W0T A;  4QVJ A;  2A5Y B;  1ZM3 A;  1Q81 D;  4B3G A;  2R7T A;  3K9T A;  4X6A J;  3KEQ A;  2M34 A;  3ONU A;  4P3Y A;  3MHP A;  5DDG A;  2PLF A;  2GWR A;  5F4M A;  1F4K A;  2FUG 2;  2RNJ A;  4C2L A;  3DV8 A;  4AIK A;  4L9J A;  2XPU A;  2XZP A;  3GVA A;  2F5E A;  3BTI A;  3AVT A;  3WU0 A;  1YJ9 I;  1HA3 A;  1UHS A;  3FPP A;  3CC4 I;  1FNC A;  3PSS A;  2BOL A;  1W5C C;  3G71 B;  2DCE A;  4HLX A;  4PC3 A;  3WG9 A;  1OKR A;  3TBI A;  1NB0 A;  4W8S A;  3CW2 A;  4G7Z F;  5HVQ C;  2K9N A;  2DY1 A;  3LMM A;  3U1K A;  3GRH A;  1ZHF A;  3F9K A;  4XL9 A;  2GA1 A;  2XGC A;  3S1R J;  3BT9 A;  2IBD A;  2E2I J;  4I2O A;  3PET A;  4W8R A;  3OYJ A;  3H1C A;  1HKS A;  1XDU A;  2LF8 A;  2QN6 A;  2KIS A;  2W57 A;  3QAH A;  3AVW A;  5HDN A;  4ZV4 A;  2CRV A;  4BDZ A;  1LFP A;  3LSR A;  2F5C A;  2QM3 A;  3C1D A;  4XRS A;  3MFK A;  5BQT A;  3A02 A;  1BJK A;  2DMP A;  2YR2 A;  1F1Z A;  1XMX A;  3QFR A;  4X7D A;  2WWY A;  1NBM A;  1IF1 A;  1ERD A;  3KYD B;  1BL0 A;  2B0L A;  3OS1 A;  1V0F A;  1P6R A;  3VSK A;  1W9X A;  2OBR A;  1QRC A;  3CDL A;  3WTX C;  4FT8 A;  3KP6 A;  3J80 K;  2BSA A;  4NUB A;  3VSL A;  1AKH B;  4MYU A;  1Q9S A;  5BOX A;  3S1Q J;  5DM7 F;  2EA2 A;  2M45 A;  1OFM A;  1ORK A;  4CZC A;  4C9Y A;  2L9S A;  2IVM A;  2PMH A;  2XB5 A;  3DBR B;  3A35 A;  5EJC A;  2DDA A;  1TW3 A;  2FXA A;  3BY1 A;  4TT3 A;  1OYW A;  2RGV A;  3CB4 A;  1K9M D;  4C43 A;  2OBS A;  2X6Y A;  3TW6 A;  3P9I A;  1W5S A;  1IJF A;  4HZF A;  5C1E A;  1ON2 A;  3AL0 C;  3BWG A;  1UD3 A;  2MFZ A;  2ZZQ A;  4XMY A;  3BR6 A;  5HLI A;  1WSR A;  2UVF A;  2HXO A;  3H5A A;  4ROX A;  3FXU A;  1TP4 A;  1YYV A;  2WAE A;  5LMZ A;  1HC8 A;  5B1A H;  2BVL A;  3OR1 C;  4HOB A;  4F55 A;  1ZG1 A;  3G1O A;  1OFL A;  2CUJ A;  1RC9 A;  1AKH A;  2IRF G;  4LBY A;  3IUO A;  2Q2E B;  3EYY A;  2R5Y B;  4NBQ A;  3ZC3 A;  4UV8 A;  2MYS A;  2B7B A;  1JUM A;  4ACB A;  2JA8 J;  3GFI A;  3W3C A;  3HXL A;  4BKX A;  1WDT A;  1X3U A;  1YJW B;  2O03 A;  4XM3 A;  5E79 C;  2CUF A;  3EET A;  4EJW A;  1IAW A;  4OIN F;  5K5O A;  1VQP B;  2VT2 A;  2EFN A;  4IHV A;  4Q48 A;  1O8F A;  1KYW A;  1O7L A;  3K4L A;  3QU6 A;  1FDR A;  6PAX A;  1W7P B;  4YDT A;  4G6Q A;  4M1K A;  5IYR A;  2YS9 A;  1MJA A;  3AFH A;  3U21 A;  3IV5 A;  5E8G A;  3SEZ A;  1FMV A;  3CUQ C;  3GTM J;  1I3A A;  5HS8 A;  1MKM A;  3I53 A;  4JX4 A;  5FLM J;  4G6D A;  3JSO A;  3QOE A;  2F1M A;  4P12 A;  4BJ6 C;  4XR6 A;  2VQG A;  2LR8 A;  3FXK A;  1TZL A;  1JKO C;  2GXA A;  1VHO A;  4KKT A;  4Z4R A;  2MH9 A;  3LSI A;  1QHG A;  4CCL A;  1TT0 A;  2BGJ A;  3BH7 B;  1FRQ A;  3I59 A;  4QPO A;  3ZPN A;  2OUM A;  5E1W A;  1S7E A;  1Z7U A;  2PMZ N;  2Q1Z B;  3GSI A;  3AVY A;  4MEY F;  1BR1 A;  5GPC A;  1KK3 A;  3ULQ B;  2XGX A;  2OYN A;  5H5J A;  2YUH A;  2DN0 A;  3CCJ I;  3CCU I;  1LNW A;  2X6X A;  1X2N A;  1BI0 A;  1GV5 A;  3GLL A;  4EH1 A;  1DAR A;  1W7P A;  3C2B A;  3GTK J;  3ONY A;  3CCV B;  4XRS G;  2ZJQ F;  3SYT A;  3BZK A;  5HKK A;  3I4N J;  3OEE A;  1DGW Y;  2KKO A;  1OMI A;  1D3Y A;  2W4S A;  3I5U A;  1H0M A;  4A93 J;  4FAS D;  2NNY A;  1TLH B;  1ZLK A;  2FML A;  1WJC A;  2ZFW A;  3VYT B;  4IHT A;  2WA0 A;  2XB0 X;  3L7W A;  4UAJ A;  3K70 C;  2I10 A;  4R8H A;  4FE7 A;  3IAS 2;  3JRA A;  2VNJ A;  1JTY A;  2DDB A;  1NDH A;  1B23 P;  3GQ8 A;  4IRI A;  4EM0 B;  2Q8K A;  1KMH A;  2B0R A;  3RQI A;  4BAC A;  3OJW A;  2NVT J;  5DS9 A;  1KQ8 A;  3GME A;  4A6E A;  1WOS A;  2C4U A;  5M5Y J;  5D8K B;  4YAL A;  2KL4 A;  2XUB A;  2NAZ A;  1IN4 A;  4ZH4 F;  3OMY A;  1O4X A;  2DA1 A;  2M8E A;  1MNE A;  3C2G A;  3J7Y J;  1ON1 A;  1WJF A;  1R7J A;  4HQM A;  2MD5 A;  4MTE A;  5JI6 A;  4G9Y A;  3CCQ I;  1RUN A;  3PEN A;  1XCV A;  1R36 A;  1LM1 A;  4RM3 A;  5FLV A;  1IRG A;  2LP0 A;  2ELK A;  4Y4R A;  1Z3Y A;  2C4T A;  3R6K A;  4X0G A;  1D5Y A;  3W2I A;  3BQY A;  1IV6 A;  1KGS A;  1VJS A;  4Z4U A;  4L0Z B;  2F5D A;  4E6K G;  1KZL A;  1R5B A;  1UFM A;  2BM4 A;  3GXO A;  2X6O A;  2E1M C;  3GZN B;  3F23 A;  3A03 A;  1OGJ A;  5DEQ A;  4LBZ A;  1MMS A;  1N08 A;  3RPU A;  3OIP A;  1UHW A;  4ETS A;  4HSR A;  3CCL I;  4IO9 F;  5AN9 A;  4YAU A;  3JRC A;  3B6A A;  3G1M A;  1HLV A;  2XV4 S;  2HKO A;  1MMN A;  1R1V A;  2BY0 A;  3I64 A;  4X7E A;  2DA6 A;  2AHO A;  3D26 A;  3KFW X;  3JX8 A;  4XLA A;  4LGW A;  2CQ7 A;  3R0J A;  3RSN A;  1QNT A;  4YZ0 A;  1F20 A;  1TVC A;  1NJI D;  2KDZ A;  3EQO A;  1YIJ I;  3K7A J;  3FX3 A;  1R1U A;  1YHQ B;  1E1Q A;  3CES A;  5JVT A;  4B4C A;  3OWT A;  4TMW A;  5GV8 A;  4U0V A;  2EFG A;  2QA4 B;  1PLU A;  4I0B A;  5JLV C;  1UD2 A;  1S9H A;  1U8B A;  1Y8Q B;  2LH9 A;  2QY1 A;  3U6B A;  1K8A D;  3ZQH A;  3DPT A;  3WXM A;  2LG4 A;  2PEC A;  2Y0S A;  1J09 A;  2EV6 A;  2L01 A;  2L7Z A;  1SM4 A;  4K1X A;  2K9Q A;  2E1R A;  4ZDP A;  4CIC A;  4XRF A;  3Q0V A;  1YJN I;  1YLO A;  3FJO A;  3ABL H;  4ZZD A;  2ZIT A;  1I5Z A;  4KH3 A;  2P8T A;  3JCU C;  2GZW A;  4KUM A;  4AYB A;  4IEJ A;  2GOX B;  1K28 D;  2VOO A;  2HCJ B;  1CNF A;  4FK8 A;  5ILU A;  4QHY A;  1QU3 A;  2ZSI B;  5IP9 J;  1KRH A;  3QPH A;  2QX3 A;  3J7A Y;  1VQL B;  3HYI A;  3CLO A;  4DW6 A;  2OK7 A;  4JOM A;  2HKX A;  3GWZ A;  4RLQ A;  2D5V A;  3ELK A;  3CO7 C;  3MMY B;  5CLS A;  4KIT B;  3JR9 A;  4BHP A;  3ROU A;  3E20 A;  3BH6 B;  1TLL A;  2R7F A;  2W82 A;  3TED A;  3K1M A;  3QYB A;  4HEA 2;  4RJL A;  1G7S A;  5H6R A;  1WH7 A;  3KE2 A;  3TL4 X;  3VPR A;  1K61 A;  2L7F P;  1UST A;  3S17 J;  3DBL B;  1JA1 A;  4GO1 A;  4N4N B;  1DBG A;  3BTC A;  4NC7 A;  3OOU A;  1O8D A;  1RMG A;  3SJZ A;  1MJB A;  4BQN A;  4XLF A;  2OD5 A;  2B63 J;  2F4O B;  2L9R A;  3HB9 A;  3K4C A;  2Q6I A;  1RQP A;  1FOW A;  2EIL H;  1PXZ A;  1VTN C;  3G4S I;  2CW5 A;  3GTJ J;  1I1S A;  2P5L C;  1K73 D;  2XTY A;  2ZNY A;  3CP8 A;  5EF6 A;  3ZCO A;  2LKX A;  3HUG B;  1LLW A;  1X4P A;  1FZP B;  3ISP A;  2K4J A;  4NK6 A;  4YZA A;  2QBY B;  1EP1 B;  1BW6 A;  3CC2 I;  3JU4 A;  3FIS A;  1R4M B;  1VHE A;  3L9F A;  2R7X A;  4MQV A;  1RRJ A;  2STT A;  2V1D A;  3VFZ A;  3UR3 C;  3IKT A;  2BGC A;  1K83 J;  3BTL A;  3LQQ A;  3GTL J;  1IV8 A;  1U2W A;  4X05 A;  3R0A A;  3K4J A;  2HXI A;  5FRN A;  1UMQ A;  4LJZ F;  1AIP A;  4HF2 A;  3GVL A;  4UVA A;  5FFZ A;  2HOT A;  2FVG A;  2MW8 A;  1F36 A;  4IXA A;  4QVA A;  3DKW A;  2L3D A;  2C6Y A;  4KIS A;  2VNH A;  2YWH A;  2EZH A;  2HOA A;  3OOC A;  1I6X A;  4Z4T A;  4OJL A;  1O88 A;  3HUG A;  4YII A;  4XLC A;  1J7K A;  4KMU X;  4L18 B;  3DWL E;  1LUJ B;  1VQK I;  1GAW A;  2FD5 A;  2KDO A;  2UUZ A;  5KCM A;  4P2N A;  2CJJ A;  3QRF F;  1WJB A;  3NB2 A;  1U3E M;  1YIO A;  1LDD A;  2XAF A;  2IW5 A;  4IHX A;  2KHM A;  2WY8 Q;  3FM3 A;  3M3Y J;  2WC2 A;  2FX3 A;  3CMA B;  4HST A;  3CF2 A;  3CCM B;  3I58 A;  2X3H A;  5LGN A;  2R7V A;  5GTH C;  1FIP A;  1QH0 A;  1DUX C;  2KZV A;  2VBX A;  4JMQ A;  1SD4 A;  4HLY A;  1P4M A;  3H3V K;  2WY7 Q;  3WTW C;  4QSH A;  2STW A;  4RCY A;  1WP6 A;  1HG8 A;  2XPV A;  1WPC A;  3CCE B;  1V5V A;  3LQR A;  5F1R A;  2Z9O A;  3WU1 B;  3VYS B;  4JQF A;  2W7N A;  3NAU A;  2OK8 A;  4CGZ A;  2OA4 A;  2WV0 A;  2MGQ A;  2XHK A;  4OPW A;  4Y52 J;  1E17 A;  4BY7 J;  3GTP J;  2JZY A;  4A3C J;  1HW5 A;  2W25 A;  1IGN A;  4IQ4 A;  3BR2 A;  1XGM A;  4V02 C;  3EUK L;  4JK1 X;  1G4D A;  1JTA A;  1GO2 A;  5DUK A;  1YIT B;  1SC7 A;  1S6L A;  1B4A A;  4PFO A;  4ON0 A;  3WQZ A;  1WOO A;  1NTC A;  3ABU A;  5GPA A;  3Q6Q A;  5J8C A;  1R5O A;  4KT5 C;  3RPQ A;  2IA0 A;  3OPO A;  3Q9V A;  4BDY A;  3CCY A;  3IP4 B;  3RY8 A;  3WBJ A;  2QGU A;  1G6N A;  2EBI A;  3LAP A;  1SAN A;  3FXR A;  2A6E F;  2G0E A;  2G7H A;  3OR2 C;  4FE4 A;  1EV7 A;  3L09 A;  1P7I A;  4IKF A;  1UB9 A;  5D4S A;  3RKY A;  4PJM A;  3TO6 A;  2F6C A;  1BLI A;  2AO9 A;  2W6J A;  3SJM A;  2QE7 A;  3GFJ A;  2CRG A;  1XTA A;  4BY1 J;  4GRI A;  3W6K B;  1W34 A;  2CFO A;  3C3W A;  3ZMU A;  4F3Q A;  2PG4 A;  2JMW A;  4AUX A;  2GAU A;  2CS3 A;  2V6C A;  2O17 A;  3V7R A;  2VFO A;  2COM A;  1PP8 F;  3OE7 A;  2A05 A;  1XSV A;  2DK8 A;  2IA1 A;  4KIB A;  1IDY A;  3F6O A;  5K1Y A;  1QBJ A;  3F8F A;  4DNC A;  4G6T B;  3W5H A;  3BR5 A;  4IW3 B;  2C5H A;  2JA6 J;  4LOC A;  1BC7 C;  3FXM A;  4I76 A;  4UB8 C;  4HV6 A;  3JQR A;  1SFE A;  1Y56 A;  1OR7 C;  2Q2E A;  2XSJ C;  2R5Y A;  2VPL A;  3ZMS A;  4M6V A;  1AWC A;  2XGE A;  4U7B A;  2P6S A;  3W5V A;  1JJ6 C;  1X1C A;  3A8I A;  1J59 A;  2DQR A;  3L1P A;  1R23 A;  3DLL F;  5F6F A;  5TJJ A;  4TMV A;  3EUH A;  5LFA A;  1SVO A;  1FTT A;  2KIQ A;  3FK7 A;  1ZGJ A;  5E3L A;  1AOY A;  5B6I A;  4X1E A;  3K70 D;  1XGO A;  4LIU A;  4LG3 A;  2R7R A;  1MDM A;  2VBS A;  1KON A;  3HHG A;  2XNC A;  2A6T A;  3M1C A;  4QWQ A;  3AG2 H;  4A2U A;  4OIO F;  4N4O B;  1QQ1 A;  1JT6 A;  2H6C A;  2OC6 A;  2UXN A;  3ZMD A;  4CDG A;  2HTJ A;  4BEH A;  4CH7 A;  2QSH X;  4NB5 A;  1MW7 A;  1I50 J;  2KT0 A;  4E7K A;  3J7A O;  1WMR A;  4M73 A;  2IT0 A;  3F3X A;  4OIP F;  1MRZ A;  4OOS A;  4RD6 A;  4ANJ A;  1KQS B;  4KKS A;  1TWA J;  5IP7 J;  5LEK A;  1QO0 D;  2IS1 A;  4EEF G;  4ZCL A;  1OFE A;  1DG1 G;  1QG0 A;  3HOY J;  4GYI A;  1R5G A;  3LA3 A;  4M3D A;  2R92 J;  4NDL A;  5IOZ A;  4X0C A;  2HEO A;  4HF1 A;  2K7L A;  5HDK A;  2LF7 A;  2X4H A;  5A2Q Z;  1PP7 U;  5DNS A;  2M7B A;  4MNU A;  3L2C A;  4JBA A;  2YWE A;  2VBW A;  4LIT A;  1HKQ A;  2E1M B;  4B09 A;  2JTV A;  1ZEL A;  1T0F A;  4M9X A;  3TKY A;  1T33 A;  5HS9 A;  1X3W B;  2BXZ A;  2BM7 A;  3I3L A;  5BSX A;  1OB2 A;  1MBJ A;  2K3F A;  1UZC A;  4DQL A;  1WI9 A;  4DZJ A;  1WU8 A;  4G5G A;  1IB4 A;  5L3B A;  1W0K A;  5ILS A;  4AU7 A;  1D8T A;  4PJ0 C;  4ITV A;  1VQ5 I;  4CSW A;  4XD7 A;  5F27 A;  1OLT A;  4H9G A;  3W2E A;  4BBS J;  3H0D A;  3PNT A;  3OEH A;  4GYG A;  4XSZ F;  5F4O A;  1ONV A;  1JUP A;  3FKJ A;  2Z8G A;  2K86 A;  2HMA A;  4MEX F;  4OOV A;  1RUO A;  2D3N A;  1K6O A;  2CV1 A;  3FY3 A;  1WOP A;  1QGY A;  1QVF B;  3FMR A;  2Y9Y A;  4H4K C;  1X4O A;  3ZQG A;  4RB3 C;  3VYR B;  1UD6 A;  3W5U A;  1N8R D;  4L5J A;  4RB1 A;  3ZQF A;  4GDF A;  1K8F A;  3COA C;  2PJR B;  1N25 A;  2DFH A;  3QPS A;  4BUP A;  2DPU A;  2QMU A;  2LMD A;  2A61 A;  2ZZF A;  4H0E A;  1VQ4 B;  1FP2 A;  1O8L A;  1LDJ A;  1T39 A;  3HTU A;  1ZTR A;  2H1L A;  4A69 C;  1BX0 A;  4LMY A;  3V8J A;  2WR8 A;  3R60 A;  3ASS A;  4EGY A;  1JGG A;  2NOJ B;  4YEL A;  3CCS B;  2FQ3 A;  5D5U B;  3OSF A;  3OIO A;  2VBZ A;  2ZXI A;  3A1Y A;  4A6D A;  1FSE A;  3B90 A;  4DQ2 A;  2B7E A;  3K69 A;  1YRN B;  3HRS A;  4G1V A;  2LD5 A;  3E6B A;  4BQO A;  2M7A A;  2FA5 A;  1EFT A;  2V9P A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  1LFP A;  4HNU A;  1BN8 A;  1XG2 A;  3GQA A;  4NNJ A;  2VLA A;  4IX7 A;  4HG2 A;  2Z1D A;  5CQG A;  3SEQ A;  1NBM A;  2A5W A;  4XKC A;  1WJ5 A;  4Y3O A;  2PJR A;  1ERD A;  3A3G A;  1WJD A;  3OS1 A;  3VSK A;  1EA3 A;  1V0F A;  1W9X A;  2KRC A;  3T51 B;  2VBE A;  4OJO A;  1X19 A;  1K6Y A;  1UEL B;  3DQV C;  3C2H A;  4I84 A;  4NUB A;  3VSL A;  1N77 A;  1G8X A;  2L5Q A;  2V6E A;  3JUR A;  2X1D A;  3M8J A;  4KT6 A;  5DN6 A;  1OFM A;  3PL8 A;  4CZC A;  2XZL A;  5CQE A;  4C9Y A;  2L9S A;  1QJV A;  4OJ5 A;  3PNV A;  1SKY B;  3K6G A;  2P0W A;  3K4K A;  2KVO A;  4ZC3 A;  3A35 A;  3BC9 A;  3ZQQ A;  2VJ4 A;  4TT3 A;  1I8D A;  1NG7 A;  3TMO A;  2R7S A;  4DNT B;  2X6Y A;  1QCX A;  1JI8 A;  1NRK A;  3D5R C;  5C1E A;  3S3M A;  3H9Q A;  3AL0 C;  3CZ6 A;  1UD3 A;  4U87 A;  2IGK A;  1BR4 A;  2L2O A;  2MFZ A;  3MKW B;  2ZZQ A;  4XMY A;  1E3X A;  1IA5 A;  2ZZG A;  1NHC A;  2LRE A;  4BJ5 C;  3H5A A;  4DGW B;  4R79 A;  4XOP A;  4E7I A;  4NK8 A;  2WAE A;  2BW3 A;  2WPD A;  3PUB A;  3A4C A;  4BGD A;  1UD4 A;  2R4G A;  2BVL A;  3OR1 C;  2LRD A;  4F55 A;  1AIR A;  3MKY B;  4BU2 A;  3FBN B;  4CCM A;  1OFL A;  2CUJ A;  2VBK A;  4OZZ A;  3H35 A;  4ZDO A;  2JJ1 A;  4E0F A;  3IUO A;  1E1R A;  2Q2E B;  4DK1 A;  2XDV A;  2KLO A;  2MYS A;  4NQW B;  4Z03 A;  2WAQ A;  2Z2S B;  2V9K A;  4BE1 A;  2WJV A;  2QKM B;  3HXL A;  2BVM A;  3W3C A;  2XOK A;  5CDF A;  2CW8 A;  4XM3 A;  4D1Q A;  2CW7 A;  3OYK A;  2JVG A;  3HOT A;  1VF7 A;  3CJR B;  3L2U A;  1O8F A;  2M3A A;  4DBQ A;  3K4L A;  2JVH A;  3L2V A;  3LL7 A;  2HVQ A;  1E3Z A;  1MND A;  3UNG C;  3HPH A;  3FDY A;  3U21 A;  3AFH A;  2NZM A;  4ZTF A;  2ELJ A;  2X51 A;  3SEZ A;  3ZXS A;  1FMV A;  4XOT A;  2K9L A;  2VQH A;  3ZR8 X;  2WBM A;  3QOE A;  2F1M A;  4HNT A;  4EW9 A;  2QKL B;  2GJR A;  3SDB A;  4BJ6 C;  2DJI A;  3NWS A;  4XR6 A;  2VQG A;  4KKT A;  3RQ4 A;  1TZL A;  3H5N A;  4G7W A;  2VAS A;  3LSI A;  3OYG A;  1QHG A;  4PSX A;  1TT0 A;  4CCL A;  1HA8 A;  3T53 B;  3ZSC A;  4QPO A;  3ZPN A;  2OUM A;  2Q1Z B;  2VQC A;  1BR1 A;  2M4K A;  1WTH D;  1LKX A;  3K4N A;  4II3 A;  4OJ6 A;  2X6X A;  3L2R A;  2V4J C;  2AQF A;  3LSM A;  1N75 A;  2ZXH A;  3SYT A;  4YXW A;  5HKK A;  3OEE A;  1O8E A;  1DGW Y;  2W4S A;  2VXZ A;  4FAS D;  4GQN A;  1WJC A;  3VYT B;  4F93 B;  2WA0 A;  2HZD A;  4D9J A;  1GQ8 A;  3K70 C;  4W8Q A;  2RQQ A;  4ZYA A;  3IAS 2;  3GQ8 A;  2INV A;  4F91 B;  1KMH A;  1V5G A;  4BAC A;  2X85 A;  4YEJ A;  1D1B A;  4B47 A;  3KRG A;  2IXS A;  2GOM A;  2KL4 A;  2AQE A;  2MAB A;  4KKU A;  3FHN A;  3LSK A;  3OMY A;  3OS2 A;  4BS9 A;  2XGJ A;  1MNE A;  3C2G A;  4EAT A;  3BG6 A;  2LY2 A;  4BE2 A;  1I18 A;  1IDJ A;  1WJF A;  4Y33 A;  3BC8 A;  3FKS A;  5CPR B;  1KCD A;  3RTR A;  4RM3 A;  3OIQ A;  4Y4R A;  1T5E A;  1QHH D;  1Z3Y A;  3RCO A;  1PJR A;  3LFU A;  4HIZ A;  2GK7 A;  4X0G A;  5C1C A;  1VJS A;  3SZG A;  1KZL A;  4E6K G;  1VBL A;  4HRI A;  1OB0 A;  1OHH A;  5HNF A;  3OW7 A;  2LBF A;  2HPM A;  3HAG A;  5KHD A;  3NE5 B;  1P9Q C;  2KP6 A;  2M4G A;  2E1M C;  4AVZ A;  2F43 A;  1YE9 A;  2NSP A;  2V26 A;  4RMN A;  1VZ0 A;  3KX2 A;  2UVF A;  4XKW A;  4P5O A;  4PJN A;  5FRO A;  4W8T A;  3OIP A;  1H8E A;  2HQA A;  1E79 A;  1U0J A;  4HSR A;  2JJ2 A;  2E60 A;  1MAB A;  2HLD A;  4E7H A;  1WJE A;  4F92 B;  2NT6 A;  1MMN A;  5KNL A;  3DKX A;  1EFR A;  4XLA A;  3DKY A;  3RSN A;  3E0J B;  4YZ0 A;  1O8H A;  2W6I A;  3EQO A;  2ZFU A;  2V4D A;  5LD2 C;  5HNH A;  2VKD A;  1E1Q A;  2F4I A;  3CES A;  3BH4 A;  3OYI A;  2O0V A;  1BOB A;  4OJP A;  3OWT A;  3BCD A;  2LZJ A;  2XND A;  2HNH A;  1PLU A;  3K4M A;  2ZZE A;  3LMW A;  1UD2 A;  1S9H A;  1SAU A;  2LH9 A;  3IAM 2;  2DT6 A;  4CA0 A;  2QY1 A;  1LDK B;  3KEY A;  3DPT A;  3DDY A;  2LG4 A;  2K5C A;  3CJQ B;  1DBO A;  2Y0S A;  2BSP A;  2PEC A;  1J09 A;  4C2U A;  4E7L A;  4OAY A;  3HPG A;  4ZDP A;  2R7W A;  4BE0 A;  3OYD A;  4XON A;  2WAD A;  2X8K A;  3A3B A;  4PUS A;  3EQN A;  5TGT A;  3H5R A;  1W36 D;  4AYB A;  2XC7 A;  2PYH A;  2GOX B;  3BCB A;  1K28 D;  4CCJ A;  3V42 A;  1QU3 A;  2ZSI B;  4DK0 A;  1D1C A;  2QX3 A;  3J7A Y;  4G7X A;  2VXD A;  2GJK A;  4JOM A;  1OGM X;  4RLQ A;  2K9M A;  1GLN A;  1UD8 A;  3MMY B;  4KIT B;  2NTP A;  4BL0 B;  4DOZ A;  4L8J A;  4DNR B;  2W82 A;  4XKV A;  2E5Z A;  4II2 A;  2EWE A;  3QYB A;  4HEA 2;  2Z6B D;  4Z1M A;  2VJJ A;  3CP2 A;  2DOA A;  1H80 A;  1O8K A;  3TL4 X;  3CMM A;  2L7K A;  5JHF A;  2K3P A;  4RLF A;  3HOS A;  4B48 A;  4RM2 A;  2ZTN A;  4OZY A;  4N4N B;  3OYA A;  1DBG A;  4ZTJ A;  1O8D A;  4NC7 A;  3OOU A;  1RMG A;  2X1C A;  4BQN A;  4XLF A;  4FET A;  4BXF A;  2LOO A;  3K4C A;  1D0X A;  1W36 C;  3ZPP A;  1PXZ A;  2ODL A;  3AKZ A;  2V1N A;  3PJR A;  4YZX A;  4PJJ A;  4DIQ A;  3S32 A;  3A2K A;  4XKB A;  3CP8 A;  3ZCO A;  3HUG B;  4NC8 A;  3D5L A;  1X4P A;  1HZE A;  1COW A;  4G6I A;  4NK6 A;  4YZA A;  1T0F C;  4BEH B;  1BPL A;  4DBR A;  3JU4 A;  2R7X A;  2WAF A;  4PFP A;  2NST A;  2WZP P;  1KCC A;  2CV2 A;  1FMW A;  3UR3 C;  1NG6 A;  2HDW A;  2NTB A;  4MXN A;  2F5V A;  3RPU D;  1H8H A;  2RNG A;  3L2W A;  4B3X A;  2XF6 A;  4Z05 A;  1Y6I A;  3K4J A;  5FRN A;  1CZF A;  4Z06 A;  2CK3 A;  2LC2 A;  3GVL A;  3VSV A;  3GVK A;  4PK4 A;  3OS0 A;  1E43 A;  2ZSH B;  4ASU A;  4URR A;  4KIS A;  3OOC A;  4OJL A;  1O88 A;  3HKZ A;  4IQJ A;  2NTQ A;  4XLC A;  3T9G A;  3QOD A;  3DWL E;  4F52 A;  3LSG A;  1DGR M;  2KDO A;  2UUZ A;  1V5F A;  1Z3X A;  5KCM A;  4E4H A;  1X0C A;  3B8Y A;  2HVR A;  4XLE A;  2PYG A;  1WJB A;  5HOO A;  3GBG A;  2JUG A;  2KHM A;  2WY8 Q;  3GQB A;  4HST A;  3LNN A;  3CF2 A;  3BG7 A;  3BCF A;  2X3H A;  2R7V A;  2QXZ A;  4JMQ A;  2KZV A;  2D3L A;  3I9V 2;  2WY7 Q;  3OL3 A;  1W0J A;  3DTI A;  1T95 A;  1WP6 A;  2LY1 A;  1HG8 A;  1WPC A;  4PMH A;  1IRX A;  5FL7 A;  3OYF A;  4IZZ A;  3DEE A;  3VYS B;  4JQF A;  3OYM A;  2W7N A;  1HVX A;  4CCO A;  3G05 A;  4BQQ A;  3S3N A;  3DTE A;  3W2A A;  1KTW A;  3S8P A;  2V7F A;  3L2Q A;  2ZTG A;  1SFK A;  1X1D A;  2E5N A;  2R7O A;  4B44 A;  3HC7 A;  4B43 A;  4IQ4 A;  3VSU A;  3EUK L;  1V5E A;  4PSW A;  1JTA A;  2VBM A;  3S3O A;  1PKV A;  5IK2 A;  2JA2 A;  3VMW A;  4PFO A;  2PMZ A;  4XN3 A;  2O1D A;  1K5C A;  4FXU A;  3WQZ A;  3ZRG A;  2O0W A;  2KRH A;  3BCA A;  3D5S C;  3OPO A;  2UVE A;  2MC4 A;  3T56 B;  2RRE A;  4BDY A;  3IP4 B;  2Z16 A;  1EE6 A;  4BJT A;  1E0E A;  1R6R A;  4UZU A;  1V0E A;  2M5S A;  2IGM A;  4CCK A;  1BR2 A;  1OGO X;  1G59 A;  3OR2 C;  3OYE A;  2IS6 A;  2NT9 A;  3VWB A;  2CUZ A;  4XQF A;  3MKZ A;  4IKF A;  3ONQ A;  2KQR A;  1MMD A;  3S93 A;  4PJM A;  2DXI A;  1VLY A;  2E1B A;  2F6C A;  1BLI A;  3KYL A;  2W6J A;  1O8M A;  4E7Z A;  2QE7 A;  5CKT A;  3PFY A;  4GRI A;  3UW0 A;  4ZDL A;  4CUG A;  2CFO A;  4QPQ A;  1LVK A;  1MMG A;  4F3Q A;  4MR0 A;  2OV7 A;  2HU9 A;  2CV0 A;  1N78 A;  2CS3 A;  1O8I A;  2O04 A;  2O17 A;  4LIV A;  4P1W A;  3E1S A;  3OE7 A;  3K4B A;  2LYC A;  2XZO A;  3MD2 A;  2JIZ A;  2BW3 B;  2IQ7 A;  2DT7 B;  3VST A;  4G6T B;  1BHE A;  2XF5 A;  3DPU A;  2X53 S;  4YZQ A;  2X1E A;  1Y56 A;  4YRV A;  2UWM A;  2HVS A;  1UD5 A;  1OR7 C;  3OYN A;  2XSJ C;  2VPL A;  2WSS A;  2L9N A;  3OYC A;  4TSF A;  1O8J A;  4U7B A;  2VJI A;  4U4B A;  2V31 A;  1X1C A;  2WB1 A;  2X6W A;  4C2T A;  1FX0 A;  4E7J A;  2VL8 A;  4OWR B;  3H9J A;  2IGN A;  4MLO A;  4E7S A;  1X1A A;  3OYH A;  4U49 A;  5LFA A;  1D0Y A;  2WJY A;  3OYL A;  1MMA A;  2VKH A;  4J00 A;  3K70 D;  2GK6 A;  1Z21 A;  3HG9 A;  4LG3 A;  4LIU A;  4CCN A;  2R7R A;  2GJP A;  1PE9 A;  1KON A;  3QYE A;  2JSP A;  2A6T A;  3M1C A;  2R9V A;  1WJA A;  4OAZ A;  4N4O B;  1BMF A;  3W2W A;  2OC6 A;  3OL4 A;  1PYV A;  4CH7 A;  4BEH A;  1MW7 A;  4E7K A;  1WMR A;  2KMU A;  2VIX A;  3VMV A;  3OYB A;  3PSF A;  4B3F X;  3EUA A;  2INU A;  4ANJ A;  4C30 A;  4KKS A;  4P22 A;  2CH0 A;  2IS1 A;  1X1B A;  2KPM A;  5AMV A;  3OAA A;  2W00 A;  1UG0 A;  3PSI A;  4TKO B;  3GQ9 A;  1AA7 A;  4XLH A;  4XNF A;  3N05 A;  3H9G A;  2JDI A;  3DLA A;  3QYF A;  4ZJZ A;  2XF7 A;  5FRM A;  3VR6 A;  3B4N A;  1UAA A;  2M7B A;  3VDX A;  2W1O A;  4LIT A;  2E1M B;  2VB6 A;  2VQL A;  3AL0 B;  1D0Z A;  2R7Q A;  4XN0 A;  2V7Q A;  1JRG A;  1ZEL A;  3ZGK A;  1RWR A;  4HWV A;  3DU6 A;  3I3L A;  4PJL A;  3NWT A;  3GVJ A;  3OFN A;  1DP3 A;  2M0M A;  1DQU A;  1IB4 A;  1D1A A;  1W0K A;  2IS4 A;  3OY9 A;  1IDK A;  4AU7 A;  1WFX A;  4ITV A;  3BLY A;  4CSW A;  3GQ7 A;  4XD7 A;  2MD0 A;  1OLT A;  3PNY A;  2UV1 A;  3H94 A;  2HPI A;  3H0D A;  3KEW A;  4B3G A;  3PNT A;  3OEH A;  1YX3 A;  4KJZ A;  2R7T A;  3FKJ A;  2Z8G A;  2DIE A;  3LSH A;  3DTK A;  4XOR A;  4DJA A;  3DU5 A;  2D3N A;  4C2L A;  2CV1 A;  2FUG 2;  3FY3 A;  3EUH C;  1RU4 A;  4H4K C;  1X4O A;  1Z7L A;  1UD6 A;  3VYR B;  2XZP A;  2CMP A;  3FBI B;  3HL2 A;  2PJR B;  4BUP A;  3FPP A;  3W2V A;  2BOL A;  2ZZF A;  2DCE A;  1O8L A;  3TBI A;  4W8S A;  3ZIA A;  2I8D A;  2R7U A;  4HPQ A;  3EPZ A;  2XAU A;  5HVQ C;  2IGO A;  3SUC A;  2NOJ B;  3LMM A;  4YEL A;  3GRH A;  3F9K A;  4XL9 A;  4W8R A;  2ZXI A;  3OYJ A;  3A1Y A;  3VYU B;  3B90 A;  3WWG A;  2O5R A;  2LBF B;  2IS2 A;  1O8G A;  2VJ5 A;  1YX5 A;  1OOC A;  4BQO A;  2M7A A;  4J01 A;  5HLT A;  3DPL C;  3K10 A;  3G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...