4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
1IA5A 4XKVA 1RMGA 2Z8GA 4YELA 2NTBA 4OJOA 4Z03A 4YZXA 1O8DA 2VBMA 3WWGA 1XG2A 2VJIA 4W8RA 4OZZA 2PYGA 1O8HA 2NZMA 1O8FA 2VBKA 3LMWA 4PMHA 1O8KA 1CZFA 5C1CA 3VSTA 2NSTA 4XONA 1O88A 4XQFA 3VMWA 2VBEA 1KTWA 4XKWA 2O1DA 1JRGA 2NT9A 2X6XA 2X6WA 2X6YA 4XR6A 1OFLA 1K5CA 4W8TA 2INUA 1DBGA 4AVZA 1EE6A 2O17A 4C2LA 4XLHA 1X0CA 1QJVA 1QCXA 2NTPA 1OOCA 4OJLA 1PXZA 1VBLA 3B8YA 1IDKA 3B90A 4EW9A 3FY3A 4U49A 1AIRA 4YZ0A 2NSPA 1O8JA 5C1EA 3ZSCA 2EWEA 1BHEA 3GRHA 4NK6A 1RU4A 3EQOA 3UW0A 3VSUA 1OGMX 2BSPA 2NTQA 4MXNA 2O04A 1KCCA 4XLFA 2QXZA 1NHCA 1IDJA 1O8EA 1O8GA 2O0WA 4XOTA 3T9GA 1WMRA 1O8IA 3ZPPA 4HWVA 4XN0A 2X3HA 1PLUA 2QY1A 4NK8A 2IQ7A 1JTAA 3EQNA 4MR0A 1OGOX 4XNFA 3GQ7A 3GQAA 1PE9A 3SUCA 2PECA 2UVFA 1OFMA 3GQ8A 2VJJA 1O8LA 4I84A 1IB4A 4XLEA 4YEJA 1RWRA 1DBOA 3GQ9A 2UVEA 4YZQA 4W8SA 2X85A 4XLCA 4U4BA 5AMVA 4W8QA 2INVA 2O0VA 2QX3A 3VSVA 4XOPA 4OZYA 1BN8A 4XMYA 4YZAA 4URRA 4OJPA 4XM3A 1O8MA 4XLAA 1H80A 1HG8A 3VMVA 2ODLA 4OJ5A 3KRGA 3B4NA 4XORA 4XN3A 2NT6A 4Z06A 4XL9A 1GQ8A 1KCDA 3JURA 4OJ6A 2PYHA 4Z05A
chains in the Genus database with same CATH superfamily
3JAMZ 2VNJA 4PC6A 1EFTA 3CCUB 3I56I 4RGRA 3VEPA 1VQ8I 4P9FA 1Z67A 4Z2YA 4AD9A 3JR9A 4FX0A 3WNDA 3HUGA 2ZJQF 4IRHA 3PFYA 1V0FA 5BS6A 2CYYA 3CCMI 2XTYA 4NC8A 5DCFA 2FOWA 4EJWA 3WHCA 3H3ZA 1M1EB 3FXMA 3FK6A 1K7AA 1VQLI 3FXRA 2QE7A 3H5NA 5ERIA 4XONA 5H59A 1D8TA 2WAQN 2FX3A 4LBVA 4HZFA 3PUNA 2CWEA 3J81Z 2CGPA 3ABTA 3BR5A 3KX2A 4IQ4A 4P96A 4MEXF 1VQ5I 3CJNA 2QYOA 2HPIA 3M8FA 3HDDA 2CW8A 1TTTA 2NOJB 4FX4A 5GAEJ 2RQPA 1YHQI 3WQZA 2EH3A 4IOCF 5C4XJ 1ZR2A 4KIBA 5E79C 5GAGJ 3K4LA 2INUA 1IN7A 3RIRA 3BPVA 1K78B 1GAWA 4TMTA 4ASUA 3SDGA 4PC1A 2CQNA 3LSHA 3NE5B 1JA1A 2LVSA 1BL0A 2E36A 2OBRA 1HKQA 3KEYA 1IDKA 1BOAA 4L5JA 4Q47A 3B90A 2ESNA 5GAHJ 3TDUC 1I1SA 3OYNA 1VQMI 1VF9A 4BQQA 1OMIA 3IRRA 1QRBA 1ZR4A 1ZELA 2HDWA 2NSPA 4XIDA 1RI7A 5M5WJ 1KYZA 3GWZA 4C2UA 2XGCA 4Y4RA 4B3FX 4C2MJ 4FTHA 2JA8J 4UVCA 1RU4A 2FE3A 4A5NA 1ETQA 2K9MA 5KNLA 1OCPA 2K40A 2LYCA 3VSLA 1OPCA 1HA8A 2V5IA 2QZAA 2BVMA 2KPMA 1SM4A 2H94A 4LG0B 2PQ8A 3HOSA 3AGPA 2FF4A 5F0HA 2DFEA 3R0AA 5F04A 5HDGA 1H9GA 1NTCA 1TQIA 2OBSA 2MBFA 3G6EB 3H9QA 1USSA 3KCCA 2GLOA 4N4OB 2YX7A 2DA3A 4QFMA 2X1CA 2GQQA 2RQQA 3IHUA 2OBPA 2VBZA 3KLOA 1GJRA 4I02A 2VPRA 4B48A 3B73A 3QP5A 1HKSA 4GQNA 1D0XA 3T1BA 5GADJ 3LVBA 1UHSA 1ZG1A 3S14J 1YJ9I 2HGCA 4PCQA 1NK2P 3M4OJ 2BV3A 3WYAA 4E70A 1TLLA 5FRNA 1RWRA 4OPOA 3KFWX 2W7NA 5IP7J 3MAJA 3H36A 1IV6A 3CW2A 2MSYA 4P6VF 2JPCA 2GOXB 4HA8A 1S0UA 3JTHA 4X7DA 2Q6KA 4B3AA 2NS7A 2XTWA 3CMAI 3I58A 2OYNA 3OYDA 4E0FA 5LHHA 1GDTA 2GJKA 2CUJA 1I5ZA 2HKOA 4YAFA 1OGIA 4QV2A 3MVPA 2P8TA 4MHGA 3FKJA 5J1YA 4PZJA 4TSFA 3PNYA 3ML6A 4CHUA 2OQGA 2K85A 4P6YA 1BIBA 2HTSA 4DOZA 4YHBA 2LY2A 1X1AA 5GPCA 1DP3A 4HG2A 5EEHA 1LLWA 2V31A 4AF7A 1LDDA 4CQJA 3K70D 3LA3A 5IK2A 4XKVA 3CJQB 4B09A 1YITB 1D3YA 2A6TA 3NQOA 2XF7A 4I76A 1PUEE 1J0RA 3LOCA 3OL4A 1MMDA 1ZRCA 1RKWA 3ZMTA 3LJYA 3CPWB 2M4KA 4E7IA 1HDDC 2NZMA 2XAHA 3MZ8A 1YQAA 1E1QA 3PO2J 4PMHA 3V7SA 4WZTA 4G7ZF 2HTJA 1N06A 2CNDA 2FBKA 3ZXSA 3IWZA 3PSSA 2YX4A 1R5HA 4Q4ZF 4FK8A 3BTLA 2L54A 2LRDA 3LSTA 3N05A 2EA2A 1W5TA 4KN7X 1ZGAA 4N4NB 3JW4A 1QA2A 2I8DA 2XV4S 3OWTA 1PJ6A 1BI2A 3SZGA 2Z16A 2EBIA 3R6KA 2QTZA 4BACA 1KONA 4AVZA 4R79A 5CPRB 1FOXA 2Y0SN 2XHKA 3GVLA 2KVOA 4RD6A 2E60A 3SYJA 5CKTA 3AG1H 3CC2I 2WWYA 2IXSA 1U2WA 2X9DA 2ZFWA 4W97A 5JHUA 3E20A 1MBFA 1VQ9I 2GZWA 3S2DJ 3SJPA 1A36A 3KE2A 1WH5A 2JSPA 1U5TA 2DT5A 3HC7A 4IXAA 2AS5F 4L18B 3HUGB 4RDKA 1EH7A 3WE3A 4IHWA 5LLQA 2W84A 2K4BA 2VBYA 3CLOA 5K1YA 2DA1A 2EIJH 4CXFA 4J00A 2FD5A 2EWEA 5CVIA 3L7WA 2HQ5A 1Q7YD 2HDDA 4QVJA 4NC7A 2KJCA 5J8FA 1QHGA 2EWNA 4Z6YA 1IUYA 5DM6F 3CCEB 2P6TA 1IDJA 3RQIA 5GTHC 2RC6A 1O8EA 3TH0A 1NHAA 3OFNA 3TP3A 3KP2A 1IDZA 1V0EA 2JIZA 2X3HA 3OIPA 4U7BA 3CF2A 1UD5A 2DMUA 1KQSB 2VFOA 1X3UA 2F48A 4YALA 1OHHA 3GTQJ 3ULQB 5BSYA 1OGOX 4B3XA 2X51A 2LKPA 2MC3A 3HPGA 3GQ7A 3RPUD 2HNHA 3VYSB 2ZSIB 1V3FA 3SDBA 4B1RA 5A2QK 2EZKA 3CESA 1WZ2A 3C3WA 1YW9A 2ZO4A 3NRVA 5BMZA 3G71B 2NNYA 5IT3A 1OCZH 1QU3A 1VQLB 2L9VA 4OMZA 1S9HA 1I3AA 4U87A 1IB0A 5DYMA 1ZLKA 4BNCA 2FVGA 1F36A 1V55H 1YI2I 2PX9A 3QOEA 2GOMA 5EZHA 5LEJA 3GBGA 2G0YA 3W5HA 4UZUA 4YIRX 1P92A 2F4IA 2FJ1A 3KRGA 2WBMA 4PGGA 1WSRA 2VONA 1KU3A 3DBHB 4M6VA 4X07A 3OR2C 1UMQA 4XICA 2WZNA 2V7VA 1UCRA 1UD6A 2C5HA 1TP4A 2BEOA 2VC1A 2DBBA 3W6VA 2EFQA 2NYXA 4YELA 3UNGC 1AHDP 2GXBA 4Z03A 5IP9J 3S1NJ 1UHMA 2E71A 3D0SA 3NEUA 3CCSI 2BY1A 1YX3A 3ECHA 3BCDA 3OY9A 4ESJA 2Q6IA 4LOCA 2D2WA 1SVMA 3BH7B 4FASD 4OZZA 2ZL7A 1SAUA 3VYTB 5HVQC 4WQMA 5DS0A 5FFXA 2B7BA 4LBWA 3VSTA 2BYVE 2IJLA 3HOTA 5CYVA 2OC6A 1A8PA 3K2AA 5J4VA 3S15J 1Q81D 3HRUA 1E3ZA 1OCCH 5E3MA 1FPQA 4XRFA 1OCOH 3K6GA 5LGNA 4ZGQB 4AIHA 3PIPF 1EJ9A 3G1LA 3W2EA 4P9UA 2ZXIA 1SC7A 1JKRC 2PMZA 3OS0A 3G1MA 1KQ0A 4HF2A 3JU4A 3HYIA 1G8XA 1TYVA 1Y6IA 3BQJA 3ZQQA 1WVRA 2DTZA 3FIWA 3JRIA 1QJVA 2XC1A 3ZMZA 3MKZA 2VYQA 3RY8A 4RAYA 3AL0C 1E62A 1COWA 2JVGA 4NBSA 2MD0A 3OYCA 1FY7A 3BR0A 1TW3A 3MN2A 1NJID 2JSCA 4DQ2A 1Z3YA 5CQGA 3OOCA 4Y7CA 1PUFA 2XF5A 3F22A 3B6CA 3H3UA 3HRSA 4Z4VA 3CDLA 1XG1A 1IJWC 2DPDA 2LMDA 4B8XA 3HOWJ 4XRMA 2VODA 4NHJA 4ZC3A 2DYRH 4MXNA 2M7AA 3VR6A 2NTQA 1VQPI 3SLNA 4BJTA 3P9IA 1DP7P 2J8IA 3GMEA 2EA4A 2XVCA 4ENKA 2A5WA 1SEUA 1N07A 1HSTA 3AVXA 3OOPA 1ZREA 3BY1A 3BY6A 3DKXA 3BJ6A 1DPRA 2ID6A 4WCGA 1LJ9A 2KIUA 3HB9A 1IGNA 2A3SA 3JSPA 2LF7A 3ISXA 1R36A 4N3GA 2A6EF 4WWVA 2RREA 2IA0A 4HQMA 2RNGA 3T56B 3BTCA 2BY0A 5DUKA 1DGRM 3SZPA 4HX4A 1QA3A 2DO7A 2DXIA 2PECA 4RB1A 1UZCA 5HS7A 2CFOA 1I8DA 4ZCIA 1O8LA 4XBFA 1JXSA 1U5TB 4M3DA 3N90A 1JA0A 3GQ9A 3HSEA 3HKZA 4IEJA 1KGSA 4PJJA 2EJRA 2EV6A 2VQCA 1WOSA 1HW1A 3QFSA 4N3NA 2IA2A 4XLCA 3CMEB 3CCVB 1YTYA 2EFGA 4QIWN 1N08A 4U0YA 3M9AA 1SVOA 2PG4A 5GV7A 1P2FA 1TWFJ 2L7MP 3IV5A 3I56B 5B66C 3GSIA 1DQUA 4HSTA 2Z9OA 2QF7A 3H1CA 4G6DA 5JR3A 3N4MA 5L46A 1J09A 2ODLA 1BMFA 1FMWA 1IN5A 4G6IA 2K9SA 4II3A 1W5SA 1G7TA 3SHFA 2VBTA 4UXNA 2ZSHB 4AF6A 3E5QA 3ZR8X 3SQNA 4AYBN 1JNYA 3ZMVA 1D8JA 2OK7A 3ZN1A 3GCMA 3HGYA 3BY2A 2FSWA 2PJRA 3I9V2 3K1NA 3J81k 5D4SA 1R58A 1OISA 1YS7A 1AOYA 1VQ5B 1KK1A 2C4TA 1WJCA 4C3HJ 1D8KA 1B9MA 1D2EA 4Z4RA 2HWVA 5F1JA 2BX6A 5HZBA 4JMQA 4RAZA 4DGWB 3LSIA 1AIPA 2YS9A 1O8FA 1OR7A 3I1FA 3IL2A 2HOTA 4CYCA 2FMLA 4GO1A 4WXCA 1KU7A 2ZBKA 2HR3A 3DBLB 1HC8A 3E3VA 2DA2A 2NNNA 2UXNA 4MEYF 3MKLA 3KPHA 1KTWA 1P9QC 3WU1B 2QUFA 4ZCMA 3ISPA 4P55A 4OOIA 3FX3A 2VE9A 4ZYDA 4KIGA 2XAUA 3A8JA 2X6YA 1B1BA 1FBUA 1HQCA 4IRGA 4BUPA 4OIQF 1KJZA 5B1AH 2OBTA 1SKYB 1P4AA 5J1UA 4IKFA 2OK8A 3HSFA 2EB7A 2TCTA 3PQKA 1VQKI 3HOVJ 2Z1DA 4XLHA 3MKYB 2LTPA 1MSFC 4M0LA 5K7HA 3OSGA 2BM6A 1G3YA 1MJ9A 5IYRA 2VKDA 3GVAA 1OB2A 1N75A 2IGNA 1G3WA 1OOCA 1FNNA 2HS5A 1T2KA 3B8YA 3SQVA 4GXOA 4KMUX 2VBXA 4DBRA 3ASOH 1KK3A 3BCAA 3ZP5A 3AG4H 3IKVA 3DU6A 1XE1A 4I09A 3SZTA 2FX0A 3SFZA 4HEA2 2FXAA 1J5YA 3WTWC 3BG3A 1WWXA 2DQLA 1QZZA 1BM9A 1W36C 5FFZA 2ZL6A 2JA7J 3LQQA 4AIDA 1RRJA 3WU0A 2O9LA 1ORKA 3FMRA 2V1DA 3A0BC 3PQJA 2V7WA 1QBJA 4CGZA 4E7KA 3BROA 3ZBTA 1S4MA 3FWEA 1YX5A 2XKOA 2M4GA 1K61A 1QVFB 2O7OA 2V4JC 1FBQA 2R5YA 1S8NA 4DQLA 2JRMA 1S5LC 3BQZA 1FLIA 4HX8A 1RESA 4RM0A 4ZYEA 2HZTA 2BGCA 2JVHA 1W0TA 3GFLA 3O2PE 4MGRA 4RB0A 4FE4A 2ZZEA 4XLEA 1EWYA 1MGTA 1QFJA 4G7XA 5FB2A 1YJWI 1F4KA 3BNWA 2MGQA 4IPAA 4H4KC 3OYKA 4E7JA 2K5CA 1W36D 3PSIA 3RKYA 2QEXI 3S3NA 2EZHA 4CCMA 3U21A 5KAFC 2V9PA 4UZEA 5A89A 3RIQA 1Z0XA 5H6QA 1GR1A 3VSVA 5E8IA 5JFRA 4OZYA 1ONVA 1BN8A 2M5WA 1OYYA 4AC9A 4XLAA 4BY7J 1K4TA 4LB6B 4B4CA 2XROA 4IHXA 3GF2A 4KH3A 3BC8A 5HOOA 2PFBA 1MBGA 1R22A 3FXKA 2A07F 4XORA 5HNHA 1E3HA 3DV8A 1MZBA 3E6MA 4OM9A 4TMZA 2XIGA 2GWRA 3TDZC 1HF2A 5H2FC 3W6JB 2UV1A 5EF6A 4RCZA 4TMVA 3H0DA 2PYHA 1S7AA 2QA4B 2TRTA 4UHTA 4ENNA 3WXMA 1XDSA 1GLNA 3RYRA 4CZZA 1JKOC 1YRNA 2UWMA 2K27A 5ICGA 4F92B 2V26A 1E17A 2JUGA 4CCKA 5CVUA 1OJLA 2CV1A 3Q0UA 4TMWA 4D7NA 5HLTA 1NB0A 1CLWA 3OYFA 1JGGA 1ZH5A 1JI8A 3E97A 3F0CA 4U7DA 3FXJA 1LPQA 2KISA 2M3AA 3DBRB 3CC2B 2R7SA 2I5UA 1QZEA 2M2EA 2BM0A 2XUBA 1FRNA 4A3JJ 3N97A 1FRQA 3FPPA 4E7LA 3S8PA 2IP2A 2KRCA 1O3SA 1EP2B 1SKQA 4PABA 1JRGA 4LLGF 2XZPA 5D8LB 2F5DA 1VQ4B 3F8BA 1D0YA 1I6XA 1VI0A 1N0UA 2CG4A 2A68F 1WFXA 2GM4A 4L0ZB 2O17A 3C2BA 3ASTA 3U6KA 1QRCA 4D0PA 3ZPLA 3ONYA 4YAOA 3BR6A 5HLHA 1M90D 1X0CA 1ZM3A 1X2MA 2R5ZA 2OTJB 3OYHA 1S6LA 3E6BA 1QCXA 2PJRB 3VPRA 3WHBA 1X1CA 2BY3A 2TDXA 3IC7A 5J3LA 1NG7A 3CZ6A 1Y8QB 2CV2A 1ZRFA 3M8JA 4UV8A 1G3SA 3W2IA 3SLDA 5CVRA 3TO7A 2QZ8A 4X7FA 1TT0A 3AG2H 1AIRA 3FMSA 4EM2A 2WV1A 4N9IA 1A31A 2VPLA 1YG2A 2AQFA 3OW7A 2Z5UA 2VL8A 4CYCB 5FKOA 5K7FA 3BP8A 3HKZN 4BHBA 3TBIA 1T8IA 1E0EA 3EQOA 2BBYA 4NQWA 1T98A 4RCYA 3BOQA 3AVYA 3TO6A 3AVTA 4NDLA 1F60A 3A4CA 1FIPA 4XOTA 3GYHX 2X3UA 1J9ZA 3RKWA 4JX6A 1Z3XA 5D6EA 3K1PA 1ZAOA 4BXFA 3DLAA 4Y33A 3MEXA 4Q5SF 2HQRA 2LH9A 4XK4A 1BOBA 4RDJA 1KU9A 2HFHA 5FIUA 2H8RA 2Z3YA 2YWFA 4RD0A 2P7VB 2JTVA 3PUFA 2A69F 4RGUA 4DZPA 4DQKA 5DCMA 4UZFA 1KQ9A 2VXZA 4LBYA 1BJAA 1FEXA 2B9SA 3LQ6A 1G4DA 1D5VA 2CO5A 3DU5A 3CUQA 3O8HA 2R7FA 5J40A 2CH0A 3HJEA 4HRIA 2NV4A 2M45A 5GP9A 4YFOA 2HDCA 2ZZFA 2UVEA 1R5BA 2GXAA 2ZZQA 2X85A 4LIUA 4MQ9F 5E1ZB 4ZDPA 1MBHA 3RJPA 1U78A 1N78A 2BSAA 4D5CA 1U9NA 2R9VA 1N25A 5E20A 1FTZA 1ACIA 1QH0A 2R7OA 1H42A 2AHOA 4BBRJ 5HXBA 1LKXA 1VTNC 4X0CA 2EZIA 1F43A 1D0ZA 4YFNF 2D5VA 4XM3A 3W2HA 4EJUA 3WTZA 1E2XA 2IEKA 2M8GX 4QPQA 1UELB 2VLAA 1VHOA 3ZRGA 2Y9ZA 3OYLA 2CS3A 3JRFA 3EUAA 4Z06A 1WJ5A 4HE5A 1P4MA 2JWTA 1ZKGA 5HDNA 1IJEA 1IA5A 1RMGA 4PFPA 4PJ0C 3K4NA 3LAJA 1XC5A 2HMAA 3A8IA 1FWZA 2NTBA 1RR7A 2CW7A 1EKEA 4JX5A 5JBQA 2ESHA 3EETA 3AG3H 1XX5A 4V2GA 3BG9A 4KKUA 1K6YA 1H88C 3ONUA 2KDOA 1O8KA 3T8RA 3BZCA 4P25A 2IRFG 1KMHA 1XSXA 2YWEA 2KRHA 1V4RA 3KYCB 3A1YA 1XB2A 2BXYA 2L9RA 2VIXA 4F7ZA 1POGA 2VBWA 3MZYA 4XKWA 1B2RA 2GK6A 2JRTA 3GTGJ 1V5GA 3CDIA 1DPUA 1TYWA 5DN6A 4LJZF 2FRHA 1RZ4A 3K4JA 5K5RA 1VNDA 3A3BA 3F9KA 3V7RA 1H89C 5DV5A 2QBYA 1AMOA 2LD5A 1WU8A 4R1HA 3V8JA 4JP0A 1JJ8C 2LOOA 3QODA 2HVSA 2M8EA 1TYXA 1TWAJ 2Y31A 4WXHA 5FRMA 3VNUA 1F1ZA 1TNSA 4X8IA 4BY1J 3P27A 2JPBA 1YYVA 3GLLA 1Y1WJ 4EW9A 2VFMA 2WB1A 2IGKA 5D8KB 1TL8A 1QA1A 5ED4A 5EZGA 4RB3C 3C2HA 4Y52J 1K79A 2XAFA 5GV8A 4YC5A 1WQ2A 3ASSA 4NUBA 4Y9RA 3OS1A 3U2QA 3JCUC 2E35A 3RSNA 5EGOA 1MIJA 1Z05A 1ULYA 1XMKA 3P9CA 2HCJB 2QQAA 3J81K 1Q9SA 2QXZA 1T6SA 1YOVB 3BH4A 3V7AA 1YIJI 3BTIA 4QHYA 4B43A 5C3EJ 4AVPA 1Z6TA 1ZQ3P 4BDZA 2D1VA 4P5OA 4XD7A 2BV6A 5F4OA 4EGZA 2FBHA 2VC0A 3J80Z 1FYMA 4L0YB 1R23A 5CVVA 1E79A 1WPCA 2PJPA 1ETWA 2R5ZB 2CRGA 3T8TA 1JT0A 1D1NA 5FLVA 1WH7A 4MTDA 5E3LA 1Y56A 2DDBA 2FNPA 1P4XA 2UVFA 2M5SA 4RB2C 3Q6RA 2Y0MA 1WXRA 1SD7A 1NG6A 2ZMEA 1R5NA 1XD7A 3FXQA 4FISA 2ACJA 2K4JA 2X6OA 5TISC 5BSXA 1T95A 1QX4A 3CC7B 2J5PA 3L2CA 4W8SA 4U4BA 3C18A 4A3DJ 5HLIA 2WJYA 2ELJA 4YIFA 3EYIA 4H9GA 1AA7A 2K9NA 4M3FA 5E1WA 3T0YA 1OYWA 3G1OA 3SKBA 1XDUA 4NQWB 1XPXA 4DYRA 4LK0F 4GYIA 2KZGA 4EH1A 1HG8A 4Z4UA 2O61A 3OKXA 5E3NA 2ELKA 3DWLE 4ZTJA 4ZDLA 1LE8A 3JQPA 4A2UA 3GZ5A 1BBYA 3K70C 2X0LA 2JDIA 4PJLA 3CF5F 4ZCLA 4IJAA 1NK3P 4KA4A 1LNWA 1DABA 1W35A 2WA0A 5DM7F 1NB9A 1R71A 4P2NA 2JJ7A 1EV7A 2X1EA 1O8DA 2MFZA 1LM1A 4KYWA 1G3TA 3RDIA 2AXLA 1S72B 3OJWA 1E63A 2VBVA 2H1LA 5LHGA 2X1DA 4K2EA 4RGSA 3QQAA 1DDNA 1VLOA 1IRXA 3ZGKA 1Q1VA 5E8GA 1QNTA 2NS8A 2MC4A 4ESFA 3WTYC 1R4NB 4NNJA 4M9ZA 3M7GA 1G7SA 4BBSJ 2NT9A 1E64A 2VBSA 4HLYA 2J7KA 5EEAA 1H8AC 3R61A 2H1KA 4L5IA 2CBXA 1MNDA 2WSSA 2Y48A 3DXJF 5IYCJ 2XSJC 3KLNA 5DD8A 1K8FA 2KP6A 2QKMB 1D1BA 4C2LA 3PUBA 3WY9A 4LB5A 2G7HA 2LBFA 4I98B 1L3LA 3BCBA 2IS4A 1T6XA 2L0KA 4G8XA 2C2WA 4OJLA 1Z91A 4I7HA 4R71A 4RAFA 3OZWA 5IY5H 4A12A 2VNIA 3HOZJ 3B6AA 3TEDA 2FUG2 4TKOB 2FQ4A 5L3GA 3H5RA 1H8EA 4X7CA 3WGGA 1KC8D 1Z7LA 5FL7A 5JMCB 4AU7A 2F4OB 4GFBA 2KIQA 5F0FA 1WSVA 1WOPA 3AVVA 2VN2A 2R93J 2Q8KA 2OTLB 1CNFA 3COAC 5E3OA 3JRDA 2FNAA 3W2WA 2NVTJ 5LGTA 5KSWB 3I53A 2O0WA 3V8KA 3T51B 2HDNB 3ZPPA 4JX4A 3TP0A 1UD2A 3HTSB 1QUEA 4BEHA 4C9YA 3AK5A 3LWFA 2V7FA 4NK8A 1TVCA 2XSDC 4PC7A 2QBYB 4BPRA 3LA7A 4OP7A 4M9XA 4Y15A 5KW9A 4EM0B 1PE9A 4RLFA 2KFDA 3P5JA 4BGDA 4V2FA 1MMNA 1ZUNB 2V1NA 3F23A 4OMYA 2YR2A 1QGZA 2VFQA 1ZK8A 3W2GA 1YJNB 3BG6A 4F3QA 3K9TA 5TGTA 4WWCA 3KEWA 3HEFA 3KZYA 2ZFUA 3B8HA 4C30A 1J7KA 2HU9A 1KD1D 2OJED 2F5VA 2M87A 3JREA 1H0MA 1UD8A 1RUNA 2BZTA 3J7AO 3U9GA 1R4MB 3GVKA 3IP4B 5EGOB 2QWWA 3CPXA 4YZAA 1NDHA 4RM2A 2WPDA 5F08A 3U1DA 3TGNA 1TW2A 3DCFA 2VJ4A 2E7XA 3E0JB 3IUOA 4X1EA 4BAYA 1IXCA 4B47A 3CCLI 5L3CA 3KP7A 5F1RA 1E3OC 3S17J 1VLYA 3HAGA 3QFTA 2JT1A 1WI9A 2WY7Q 2WC2A 3SJMA 2VB6A 4M9SA 2CFXA 3SXYA 4D7MA 3K1MA 2HYJA 4BXUA 1LQ1A 3U1KA 3I55I 2KMUA 4UV9A 4XRSA 2XGEA 3VO2A 3MZHA 2E2JJ 1GXPA 5FO5A 4X7EA 3DTEA 5A2QZ 3ZBUA 4UNOA 2ZMEB 3V8LA 1FOYA 1FNCA 2CQKA 4NBQA 6PAXA 1ERDA 3UR3C 3G4SI 1NBMA 1N0VC 1ZG3A 2A05A 1CZFA 3PVDA 2M1BA 2QN6A 3BTJA 1O88A 1OCRH 4DK0A 3PFIA 3RQ4A 2WV0A 1CF7A 3OAAA 4TV7A 2CU7A 4XLPF 1BR1A 1DGWY 4E4HA 2C5BA 2VFNA 4Z4TA 3V76A 3CCRB 4RLQA 1LFUP 3IKTA 2FEZA 3I4PA 5JVTA 5TJJA 2P6SA 4XR6A 5ICCA 4ANJA 2R7RA 4H0EA 4Y9UA 3K69A 1LE8B 2GA2A 3LNNA 3HTUA 5D5UB 2R7WA 2FMYA 1XB4A 3P4GA 4CCOA 5GTIC 1Y0YA 2W24A 2MH2A 2OCCH 4MFDA 4A0YA 3S1MJ 4A3GJ 1VQOI 1JJ2B 3KP6A 2O03A 3GVJA 2RDPA 3FISA 3PL8A 2Y30A 4IZZA 1ELOA 3U2RA 1H85A 3ZPNA 4L9NA 3EYYA 2QVOA 3QU3A 1QQIA 4ENMA 2CUZA 1TZLA 2X48A 1W5CC 3LQRA 5F64A 2P7CB 1HZEA 3BR3A 1JB9A 3SZEA 3K0LA 1X1BA 3KEOA 4A0ZA 4CDGA 3CTAA 2I1LA 4IO9F 4A3CJ 4KKTA 3L9FA 3GX4X 1VQ7I 4PC2A 1XGSA 4UAJA 1X4PA 4RBOA 4TT3A 1Q86D 5D5VB 5DD4A 3FJOA 4W1UA 2LNBA 3OYBA 2R7UA 5LD2C 1X3ZB 1CQTA 1AKHA 3LSMA 4U0WA 1SFOJ 3F6OA 3ELKA 3H5AA 2ETHA 1ZM2A 1ZM4A 2R4GA 3QSYA 3ESWB 5HODA 4UUSA 2DAOA 2XB0X 1WPKA 3WNCA 2PLFA 3F8CA 2LBFB 3QFRA 2C77A 2L02A 1P6RA 4YAUA 4G7OF 3VNVA 3HL2A 4ROXA 2GQFA 1OFMA 2UXXA 4GGGA 2KZVA 2L5QA 5FD5A 3GTMJ 3A3GA 3PETA 1QFZA 2E1CA 2E1BA 2DMPA 1OKRA 3ZMDA 4HF1A 3FHNA 2CSOA 1T39A 4XRSG 3GQBA 2ZKZA 5TR9A 2VI6A 1Z9CA 4XMYA 2K9QA 2H27A 2XAGA 4OJPA 2OUMA 4UUTA 2XTXA 1KYWA 3CJTB 3E5UA 1JHFA 4MIMA 1PP7U 1B6AA 4BEHB 4JYKA 3ZQ7A 5JLXA 4EJOA 3GIRA 5B6IA 1S7OA 4F93B 2OPTA 4XL9A 4JRAC 1KCDA 3JURA 1D1AA 2HI3A 1QRYA 1I7PA 3MHPA 1A04A 1WRJA 2VNHA 2XEXA 4FETA 1BR2A 2NPFA 2B63J 4BYYA 4G7HF 4Z1MA 2O8KA 4M71A 4P3YA 1BLIA 1WOOA 1QVUA 2Z99A 2DA6A 2OU2A 3ASNH 4BKXA 1GAQA 1VQNI 2E1NA 3A02A 3K4CA 2DW4A 3OSFA 3T53B 3MWMA 2W85A 2DEUA 1GVDA 2FQ3A 3BWGA 3D5RC 4LIVA 4UB6C 4Q48A 2DU9A 3CDHA 1JJ6C 1TC3C 4O3MA 5LFAA 1WDTA 5BNGA 1Z1DA 3S2HJ 2YU3A 3CRZA 1VQ8B 2LG4A 3IAM2 2IVMA 1JHHA 5TRDA 1HW2A 3L2QA 2IOUG 3CCMB 4BJ6C 2WR8A 1B4AA 2H09A 4JBAA 3BC9A 4RDUA 1XCBA 1FZPB 3KIOA 3EPZA 4G94A 2ISYA 4IF4A 2Y75A 2FBIA 1IDYA 4HAMA 3LSPA 4I01A 3MKWB 5ILVA 5EMNA 3BH6B 3H92A 2X6WA 3O6BB 1SMYF 2OF7A 2R7DA 1IN6A 2DERA 2F5FA 3OIQA 2B0RA 1XGNA 3NWTA 2W6JA 4NB5A 4KKSA 1K5CA 3NB2A 1HBXG 4P12A 2A5YB 5FGMA 2HVRA 4ZDOA 3A1PA 4IX7A 2AXTC 2NXNB 4IHVA 1YX2A 3CB4A 1FNBA 1YHQB 2NTPA 5K7ZA 3ABKH 4PGHA 5FKKA 2JMWA 2VQHA 3PIOF 2GREA 3C1DA 3ASQA 1S7EA 1A5JA 1PYVA 2LREA 3HGGA 2EFPA 1LEBA 2L4MA 2RAEA 2CF4A 4Q7JB 3F8NA 2D3NA 1LFPA 2YSRA 1GV5A 2E1MB 3MMPA 3VFZA 4NK6A 3M1EA 5M3MJ 3GRHA 1RPWA 2VFPA 2BM4A 2QLZA 1FYKA 2PIAA 3UW0A 2NAZA 3H3VK 4MQVA 3WODF 1KCCA 2R0QC 3G6EI 3ML3A 1V5EA 3OZUA 2BVNA 1PJ5A 4PJMA 2UUZA 1UHWA 1QO0D 5EJCA 4HW0A 4DJAA 1OCTC 1O8IA 3KZZA 3RKXA 3DEEA 3HSRA 1G7RA 2O8XA 3GTKJ 1K4ZA 3CO6C 3J7YJ 1UAAA 4DNRB 4XNFA 5IOZA 1UG2A 4YFKF 3PA1A 4MYUA 3GTPJ 5BQTA 2I10A 4HV6A 3PJRA 3MD2A 2DMTA 3FXOA 4HV5A 2VKEA 1FX7A 2BPOA 3HOXJ 5IT9K 1EF4A 2KKOA 1IB4A 2PEXA 1Y0UA 5AONA 3JX8A 3RTRA 2VT2A 1PVEA 1WJAA 5B3SH 4YZQA 2EILH 4A3MJ 1MMGA 4KITB 3H0GJ 3FXUA 2JQ7A 4QUZA 3WBKA 4FWTA 5AMVA 2JA2A 1YJ9B 3A0HC 2W4SA 2INVA 1I27A 4IHYA 1B9NA 2L7KA 4BH9A 1FNDA 2EFNA 2JN9A 3F6VA 1RNLA 3G05A 1ZM9A 1Z21A 9ANTA 4AIJA 1ENHA 1W0JA 3BQYA 3CMAB 1AKHB 2VOOA 4FT8A 3O8GA 4I0AA 4BU2A 4M53A 4LG3A 5DSZA 2YWHA 1KK2A 4M4SA 2D1HA 1GQ8A 4OIRF 4UUSB 4PFOA 1EH6A 3SY2A 4YAWA 4ITVA 4RDLA 2PMHA 5F27A 5GPAA 4C43A 1PUFB 4QLCU 3FKSA 4HNUA 3LL7A 1IG7A 4WK8F 3SEQA 3WGIA 2BGJA 4A6DA 2QGGA 3B82A 3BJOA 4HOBA 4W8RA 4BQOA 3GTJJ 2BN4A 3OEEA 4RLZA 5L3BA 2STWA 1HCRA 4S04A 2RGVA 3L2WA 3H9NA 1TWCJ 3VB2A 4RM3A 5DUIA 5ILSA 2V1XA 2NSTA 3OIOA 2B0LA 4MYTA 1ZYRF 3O3KA 5J35A 4ZYGA 3VMWA 1T0FC 3RKQA 3ZMSA 2WAQA 3KP5A 3S16J 2Y69H 4E7SA 4ZZLA 2ZXJA 2BF4A 2BOLA 1SFKA 2ZXWH 5DDGA 1IC8A 1UFMA 2PMZN 4CCNA 3ZQLA 2QQBA 1TWGJ 3BR2A 1DBGA 1UB9A 1MW7A 3CC4I 1T6YA 1P4WA 2DFFA 1IRZA 3Q3SA 5JHFA 1IV8A 2DQRA 3DDYA 4HX7A 1SFUA 3KETA 4HSRA 1AU7A 4IW3B 5AIPA 4RPBA 4KT5C 4E7ZA 4DZJA 2K7LA 2F4MB 4ZZDA 3WTTC 2JJ2A 4IQJA 3QPSA 3VWBA 4PAAA 3G3ZA 2HOAA 1VQ9B 1UMKA 1O8JA 2Z6BD 2WZPP 3CCYA 1REPC 4AUXA 1BI1A 4Z4SA 1FMVA 3BR1A 5IP6A 1CQXA 2L4AA 2DMQA 3LA2A 3OEHA 4BL0B 5M5YJ 2KL4A 2LY1A 3FM3A 4RMNA 5BPIA 4A3EJ 2JZYA 2ID3A 1ZG5A 3M3YJ 1J9IA 2L01A 1ETXA 4B44A 3OYMA 2D9RA 3RYPA 2ICWG 1ITYA 1WGXA 4O6JA 2Y9YA 2ZC2A 1J75A 1WJFA 4I6ZA 3DP7A 3WTUC 1B8IA 1XMXA 3WTSC 2IA1A 4D1QA 3G71I 3CO7C 3GQAA 1D5YA 2L7ZA 2VZLA 2XPWA 4CO8A 2ZL5A 2D3LA 1ETOA 3R60A 4MO7A 3GZ6A 2ZTGA 3ZUGA 2K9LA 3QPHA 2EZLA 4OAZA 3CCJI 4A93J 1UD3A 3BG5A 3GQ8A 3CCLB 3TQNA 3C7JA 2DFIA 2P4WA 2CC2A 2OA4A 2ZNYA 2MH9A 2COMA 3G2BA 3AVUA 3WBJA 1VQMB 2Q2EA 3J7AY 3E1SA 4M74A 5FD6A 1A35A 1QGYA 3OYGA 1U3EM 3CP2A 2E7WA 2AHQA 3ES9A 2O0VA 1GXQA 5HDKA 3I55B 2HOEA 1XTAA 2BXZA 5FLXZ 3ERED 2JUCA 4AC0A 2MA3A 1EFRA 2OZ6A 3BLYA 5IYNA 4Y17A 1LDKB 2LKSA 2IS2A 2GAUA 1HVXA 3GFMA 3G4SB 3I71A 3ZZ0A 1YI2B 3GZNB 1YO5C 4WF2A 2MG4A 4YRVA 1OLTA 3CP8A 1MBEA 4BHCA 5FO1A 4C0SA 3W2AA 3B78A 4G1VA 1OFDA 4ZYHA 2EFOA 1BX1A 4EM1A 5FLMJ 2Z8GA 4ETSA 1AWCA 2CQ7A 4EV0A 3FPKA 4OJOA 2WTEA 4CZCA 1JUSA 1PJRA 2BHZA 4G6TB 2E1RA 3K7AJ 4G7WA 3DEWA 4RD2A 3A01A 3CMYA 2V7QA 1Z7UA 1WHUA 2V6EA 3QYBA 3GXOA 3V7CA 2VQLA 4J19A 3CCSB 4PGOA 3VO1A 4MLOA 4HE6A 1VQOB 1RQRA 4FXUA 2KRFA 2PLYA 5E1XA 1J59A 3PUMA 5TV2A 4DYQA 1JKQC 4D9JA 2O1DA 2HYGD 3BDDA 2X0KA 1GUUA 1BR4A 2LFBA 3OR1C 2XOKA 4P3IA 5KHDA 2GXGA 2W1OA 2R7QA 5BPDA 2R5YB 3FXLA 3BZ6A 4KN4X 1Y0NA 2DODA 1ZRDA 3DQVC 5JI6A 4FE7A 1P7JA 4PUSA 2Y0SA 5JLVC 2YU9J 3GFIA 4LC0A 2V7XA 3WTVC 3DFGA 2MD5A 4P1WA 2ZITA 1HF0A 3TKYA 3ZQGA 4BS9A 1XFOA 3R6JA 3GLXA 2QYUA 1XN7A 1TUIA 4U49A 2GIVA 1QPIA 5H5JA 2DFHA 3L09A 1E3XA 4YZ0A 1YW7A 1DU0A 5C1EA 4I2OA 1FBSA 1R5OA 4OIOF 5L3FA 1MKMA 1BHEA 3CD6I 5E17F 3ZZTA 3A2KA 1IN8A 3HRTA 2E2IJ 4XLNF 1JTXA 1LB2A 5KCMA 1U2RA 1NHCA 1R7JA 1U5TC 4RAGA 3F21A 4K1XA 3NWSA 3ZN0A 5LHIA 3S32A 1I39A 4XN0A 3I4NJ 3OE7A 1PLUA 1VQPB 2XZLA 2DTRA 5CQEA 2EV0A 4CA0A 3QE2A 4F7DA 3P9KA 1I18A 3EQNA 2NVQJ 3JAMK 2QCOA 1OYIA 4M1KA 1PP8F 3LSGA 4XKCA 4KFCA 1MH4A 2LSOA 5ICFA 4CUGA 4BE1A 1YRNB 3PO3J 2J8KA 3QYEA 3WTXC 4BE0A 2KHMA 3OL3A 3JRGA 4RPDA 2L2OA 3ZC3A 2BHYA 4PJNA 3CMEI 4M72A 4ZJZA 5D5XB 4X06A 2VJJA 4NC6A 3BG7A 1SD6A 3RCOA 3DPUA 4KJZA 4PDKA 2XT4A 1LFBA 1R5ID 4J01A 1YIOA 4A69C 1JUMA 1DDIA 4YEIA 4ESBA 4P22A 4DK1A 1IUFA 3R6SA 2EFWA 3W3CA 2KT0A 3EUHA 2Q6LA 2FU4A 2VKHA 5DNSA 5JLWA 3ROUA 3ZQIA 1VQNB 2C4UA 1I50J 2O5RA 3EUKL 4A3LJ 1C0WA 5LRSA 2VNKA 2STTA 2CQQA 2NT6A 3KP3A 1YS6A 2W6IA 3ABUA 1MBJA 3PM1A 4R8HA 3U6BA 2BY2A 4GYGA 3J80K 1B8IB 1PDNC 3H9GA 2VBUA 1GV2A 2E1MC 4JOMA 3K10A 4LITA 4XKBA 4U0VA 2DOFA 5F4JA 2ZJRF 4WZLA 1ETYA 3ASPA 1Z6RA 2HLDA 1XG2A 1R5GA 1YE9A 1I6HJ 1WSUA 1LVAA 3ZQCA 1OQYA 3K4MA 3CLQA 1BQEA 4ZTFA 2Q2EB 1EP3B 3QFCA 2HOSA 1S29A 2M7BA 4YXWA 5C1CA 4M3EA 3OJXA 2DCEA 4B3GA 1TWHJ 4EJTA 1XGMA 4I0BA 4CYDA 1KA8A 3HOYJ 3ZZUA 5EDNA 2VBEA 2W82A 3FBNB 5FA6A 2VJ5A 3IH2A 4AM3A 1IXRC 3KEQA 2XRNA 2F43A 1B59A 4IL6C 2PMDA 1W1WE 2BMWA 2O6GE 3DPTA 1OFLA 5CDFA 1DARA 1OGJA 4W8TA 5C4JJ 3HRMA 3BCFA 3W5VA 3IRQA 5DCMB 5FNZA 3QPTA 4F52A 4OOSA 2UZKA 5LGUA 1W7PA 2EQRA 3K2ZA 2JJ1A 3CUQB 3OW2B 3N6ZA 3TL4X 2V1UA 4OAYA 4BE2A 1IRGA 1T6ZA 5ICEA 2WYRA 3PENA 2CRVA 2XNJA 1VQKB 1I1GA 2CJJA 1X1DA 3SYTA 1W0KA 2Z2SB 3LAPA 3AGQA 3W2VA 1UG0A 3WNBA 1LVKA 4AWXB 3FY3A 2G9WA 3AVWA 3A01B 3FDYA 3JSOA 4V19K 3OYJA 2LF8A 4G5GA 1MNMC 2X8KA 2VQGA 5D6FA 4HDUA 2BSPA 2Q0OA 2O04A 3L2VA 5LBQA 1JTYA 2V9KA 2CMPA 2P5KA 1XSDA 2OD5A 4LK1F 1QGPA 1GHCA 2YPRA 4LD5A 3JRCA 3K4BA 2QY1A 2IQ7A 1MRZA 3PSFA 3T5XA 4KIFA 1BC7C 2ZZGA 4QPOA 4OOVA 2BW3A 4D5FA 2CUEA 3E6CC 2YUHA 1IHMA 3H09A 2LY9A 3GFJA 5J6XA 2LR8A 2EV5A 5IYBJ 3RZDJ 4ABZA 4WX9A 3GW2A 3ZMUA 5IYPA 2E5ZA 4EMSA 5HS8A 2LZJA 2JK3A 5L3EA 1LLZA 2QDXA 4DNTB 1MNEA 3Q3AA 4II2A 5C44J 4X05A 3MMYB 4F55A 1O3QA 2H6CA 2OQRA 4ON0A 4A5MA 2XC7A 3I4MJ 4EVIA 1HOMA 2HZDA 5CLSA 3A35A 3RPQA 1LEAA 2H8WA 3DKYA 1GVHA 1XQBA 1FX0A 2DCUA 3Q39A 1YJWB 2QKLB 3D5LA 4LGWA 2M9HA 4HDVA 3S2WA 3VOEA 1MMSA 4HNVA 2QEXB 3VMVA 2QSFX 1KQ8A 3WU2C 4E6KG 1B72A 4M6YA 2H6BA 2QA4I 5IYQA 1A6QA 3DKWA 3DTKA 2FA5A 3ABMH 3KZIC 3S1RJ 2O6WA 2DA7A 2BVLA 3F8MA 3PA2A 4AYBA 2P5VA 2RKHA 1UD4A 3CQZJ 3H94A 3JQRA 3HXLA 1HXDA 1R1VA 1KK0A 3EDPA 4ZYAA 2K3FA 3D5SC 5FJ8J 2DPUA 5THXA 1ETVA 1I3QJ 2IW5A 2KLOA 3H9JA 3NAWA 3V4GA 1GT0C 3NAUA 3HOUJ 4Y3OA 3CC4B 3LMWA 3ONQA 3FHZA 1MABA 3E5XA 3I0TA 4FHTA 1LDJA 4UVAA 1FTTA 1K8AD 1ZGWA 3Q9SA 1VQ4I 3FF5A 5FKNA 2HQAA 1QQ1A 3TMOA 2NOGA 3WE2A 1Q82D 1N05A 3BPXA 3SEZA 4ZH4F 5AIQA 3Q5FA 4MFEA 5A8AA 3DF8A 2JN6A 2X6XA 2VT3A 2IBDA 3CJRB 1X19A 1GVJA 5M3FJ 2OTJI 5IYDJ 1OB5A 1LUJB 1IO2A 2K3PA 1W0UA 1OR7C 4P26A 1V54H 3VDXA 1N77A 1BN5A 3NARA 2QQ8A 2LC2A 2D74A 1HSJA 2QMUA 1IRFA 1CNEA 5AN9A 1STZA 1ON1A 2ZCWA 5D5WB 2XPVA 1WJDA 4EGYA 1VF7A 2R6HA 1TYUA 2W7ZA 1EA0A 5DTDA 4B4DA 4C2TA 2WB1N 1RUOA 3LFUA 4U88A 1H9TA 3BT9A 1KRHA 2C78A 2RVCA 2CK3A 1BI3A 1XCVA 5D4RA 5FKLA 3ASRA 5J3OA 3AKZA 4OIPF 1MBKA 2XKPA 4MNUA 1PKVA 2XF6A 2DYSH 4A3FJ 3VSUA 2ADUA 1FJLA 4HNTA 4IHTA 2HYFA 3CCJB 4EJVA 4XSZF 4HIZA 3JRBA 1QPMA 1WMRA 2HEOA 1T5EA 2O0YA 4OPVA 3CMMA 3HHGA 1DG1G 1WTHD 4IVNA 4L8JA 3Q9VA 2EIMH 3HZJA 4M6XA 4DBQA 2P5LC 4A0XA 4IHSA 1FT9A 3PNTA 2ZJ2A 3TO9A 1W7PB 3TOBA 5B1BH 3IAS2 4LFUA 1RQPA 1VQ6I 1K9MD 1SVLA 4RS8A 1APLC 2F3LA 1FOKA 3GEZA 4YEJA 4OPSA 3MCZA 1BX0A 3LSRA 4KISA 2GK7A 2ZB9A 4OWRB 5L3DA 5CVJA 4RJLA 3S93A 2WY8Q 4QWQA 5EEGA 1EXMA 1B23P 3J7ZI 4YDTA 2GJRA 3SUCA 1V5FA 1E3PA 3REOA 1WJBA 4UVBA 2DJNA 4X0GA 3E1YE 2QX3A 1XS9A 1R1UA 4N9HA 4ZGNB 3F3XA 1JT6A 3HG9A 3CCQI 1G7CA 1NRKA 2WJVA 3CXCB 3OMYA 2E2HJ 1KU2A 1BW6A 4BDYA 1W34A 2GIZA 5HLGA 3Q0WA 2F4NA 2EIKH 1KZHA 2HPMA 1SFEA 2RC5A 5J47A 2DMNA 1CGPA 4KNYA 4Z4ZA 4C3JJ 1BJKA 2BW3B 1FP2A 1FNMA 2B7CA 1VZ0A 3WG9A 5J1RA 4F91B 4OJ6A 3S1QJ 4Z05A 2P3MA 1DUXC 5K5OA 3EQLF 3W5UA 1Q1HA 1ZTRA 2VBMA 4RD1A 5KK1A 1YLOA 1MSEC 3SJZA 2XAQA 3OYEA 1E43A 5J4YA 4CH7A 3G73A 1QA6A 2V4DA 3A8KA 2ZBUA 3ZIAA 3C2GA 3OOUA 3IWFA 3M8EA 4XQFA 2ZTNA 1ZGJA 4M3BA 4HBLA 3CCUI 3JQQA 2GJPA 2K86A 2NVXJ 3GUDA 2WAFA 1PJ7A 4X6AJ 1ZLJA 1IXSB 5E6TA 4CICA 3FZVA 1B72B 1U0JA 2L7FP 5FKMA 1R1TA 2AO9A 3R4KA 2B7EA 2ECBA 3QOPA 3VYRB 5M5XJ 4PSWA 3CD6B 2DOGA 2LK2A 2LDUA 3I64A 1QUFA 1X3WB 3I59A 4G12A 2KIMA 3QPLA 4CCLA 1L1IA 2DK8A 1K4SA 4J0QA 1FP1D 1K83J 3OYAA 1TT5B 1TBXA 3LNQA 5KVRA 1A6IA 1MDMA 2ZBVA 3OYIA 3AFHA 2CW0F 3B02A 3BZKA 2GA1A 2M0MA 2BM7A 1ZN2A 3A03A 3H35A 1BJZA 4FN5A 2Q1ZB 2CQXA 4UB8C 3RPUA 2NRAC 3QU6A 5F0CA 5H6RA 5IYWA 2V7UA 4E7HA 2XAJA 1JUPA 2DA5A 3OV8A 2XDVA 2PE3A 3OPOA 3OP1A 4RD3A 2IGOA 1XGOA 3T9GA 2J5OA 4ZV4A 2RNJA 3GTLJ 1K28D 3VODA 4KUMA 3P7NA 3I5UA 3TOAA 2DT6A 1NH3A 2XNCA 1YIJB 2PN6A 4FCYA 1IAWA 4QVAA 4V02C 2KQRA 4Y13A 3FM5A 1Y39A 4EEFG 4ASNA 1SAXA 1FSHA 3UKGA 2D45A 3CC7I 5LMZA 1JGSA 2OAZA 4ACBA 3FBIB 1BC8C 2IPQX 1U9OA 4RA2A 2V7TA 1U8BA 3F8FA 2PMUA 3HIFA 4HF0A 3ECOA 2QENA 4DNCA 4UUVA 4BQAA 1O4XA 2DDAA 2L3DA 1DBOA 4Z4YA 1BIAA 4PC3A 2KJBA 2XGDA 1CF7B 3TW6A 2M30A 4Z4WA 4LLNA 1F9NA 1J2XA 3QYFA 2FOKA 3S3OA 1BPLA 3PSZA 2ME6A 2XZOA 2OV7A 1O8MA 2L9SA 1H80A 3FMQA 2E34A 4L9VA 2ZJPF 3D26A 3CUQC 2YUSA 1R00A 2DJIA 4ENJA 4BQNA 1TSPA 1WKMA 4LMYA 1O7LA 2RC4A 1FIAA 2DN0A 4EATA 3KP4A 1O7FA 3I3LA 2PI0A 1IW7F 3X2QH 2E19A 4I99C 1Z77A 1HLVA 2R7XA 5F6FA 4L9JA 1S72I 2BGIA 1Y1VJ 3S3MA 2F2EA 2W00A 2RN7A 4TMXA 2EK5A 2NVUB 4G1BA 2NVYJ 2DIEA 1SD5A 1BA5A 5HNFA 3L1PA 3I54A 1RETA 1FOWA 1USTA 2VJIA 1VHEA 1QVGB 4LLLA 1T08B 1QG0A 2QM3A 4UY8I 5ILUA 4A3BJ 1QFYA 4P9SA 2VBKA 2W25A 1RC9A 3LFKA 3E7LA 5JVGF 5IT9Z 2BM1A 4PSXA 2HVQA 2F1LA 3ABLH 2G0EA 3VYUB 2DY1A 1FDRA 1TQPA 2MYSA 2ME0A 2YWGA 1YITI 5CJ9A 1O57A 2LLKA 2V6CA 3WGHA 2R7TA 2P81A 3K4KA 4NCNA 3VMFA 2WAEA 2Z33A 4G6QA 4BHPA 2F1MA 4HLXA 1Y0RA 1YFHA 2PBIA 1WCMJ 2E5NA 2F5EA 2M34A 4HPQA 1EE6A 2HQNA 1F20A 1T38A 1OFCX 2VOPA 2F6CA 1IN4A 2B5OA 3Q38A 4YFXF 3DPLC 1X4OA 1XMAA 1PXZA 5E18F 1QGAA 1TNTA 1HW5A 4L9TA 4OINF 5IOYA 2OTLI 4MTEA 3E6DA 3KL9A 2XGXA 5EG0A 4M3GA 4L5EA 1L0OC 1X58A 1RR8C 1FSEA 1Y8RB 3KYDB 2HXOA 3SFIA 4A3IJ 3RZOJ 2LKXA 4GDFA 1V5VA 3M07A 3JRHA 5IPAA 1DU6A 2ELHA 4U9UA 1O8GA 5HS9A 4BXXJ 5TY0A 2BE5F 3JTGA 4IOAF 1KQ5A 2A61A 4S05A 5KAIC 5HKKA 4HWVA 2C6YA 5J8CA 2RV8A 4G9YA 4XSXF 1JTAA 4FQGA 2G7UA 4BJ5C 2IS6A 2HXIA 1GO2A 1R49A 1YJNI 4YG2F 4TN1A 4A3KJ 1G59A 1EFUA 3L00A 2XASA 2XPUA 3D1NI 3HM5A 2M0CA 1W4MA 1MMAA 4OOXA 1QZYA 2DA4A 2VXDA 5F4MA 1H8HA 2DK5A 3I59B 2DT7B 3CCEI 1X2NA 1FC3A 4I84A 1S3JA 2R7VA 1E1RA 3EUHC 1T56A 4Y7NJ 2N8GA 2VUMJ 1SANA 2A6HF 1WP6A 1MJAA 5K5QA 4CSWA 3W6KB 4JQFA 1MDMB 2NS0A 4LBZA 1TTYA 3R0JA 1ODDA 3SEJA 2XGJA 4W8QA 1ETKA 2XT2A 1MD0A 1MJBA 4IRIA 4KDPA 2K02A 2ZXHA 3GO5A 4XOPA 1YLFA 4S0HB 2IGMA 1P7IA 3OZVA 4URRA 2JA5J 3DEUA 3QWLA 4ACAA 2ZMEC 2W48A 2DOAA 2L9NA 5LEKA 3QAHA 2AQEA 2P0WA 2VASA 1SMTA 4QTRA 3TW7A 1N8RD 2R3SA 1K78A 4A6EA 3HPHA 1O3RA 4DIQA 2EINH 3FK7A 1KTVA 2F5CA 1IF1A 1EFCA 2DLLA 2KIFA 3BJAA 2R92J 1U6GA 4YZXA 1R9TJ 5FROA 3WWGA 3W2FA 4WZEA 1O3TA 5LRRA 2PYGA 1O8HA 2HKXA 3CCRI 1IZ1A 2DI3A 1EH8A 3ZQFA 1EZGA 2IT0A 4WZKA 2VKVA 4YIIA 3MFKA 3L2UA 2X4HA 4LG0A 5FLXK 1M1KD 4GRIA 2Y2ZA 3HHHA 4DW6A 2LP0A 4KMFA 2XB5A 1K6OA 1F5TA 5A88A 2DETA 1JKPC 4M73A 4WXDA 4AIKA 1SD4A 4N0BA 1TQMA 4GCVA 3ZQHA 4KICA 3MCAA 3DTIA 4M2LA 2QQ9A 2DOEA 3HBLA 3F72A 3LQEA 3PNVA 3ERMA 3WG7H 1W87A 2CV0A 2EPFA 2O3FA 3CUOA 3LSKA 5H20A 3LMMA 1FYLA 1W2BB 1VBLA 1R6RA 5HZAA 2GBYA 3IH3A 3MQ0A 1WI3A 3QP6A 1ZHFA 4OU0A 3LO8A 5FO0A 2XNDA 1EP1B 1TLHB 3V42A 4DYCA 2DYIA 3ZSCA 5B5EC 1IJFA 3Q0VA 3DLLF 2Q6OA 4PK4A 1OGMX 5EYRA 1XSVA 2ZNZA 1W7PD 2IS1A 3P26A 4XLFA 3FKIJ 1RIOH 1VQ6B 2OZUA 2WADA 5DEQA 1WORA 3AAFA 1OB0A 2MLGA 3ZCOA 1JE8A 1VQ7B 1G2HA 4YCQA 3L2RA 1QVTA 3IH4A 3KYLA 4HQEA 3QRFF 2R7ZJ 3OS2A 4OPWA 1MH3A 4CCJA 2MW8A 1D1CA 1BI0A 4RD4A 4MR0A 2EIXA 3VSKA 1U8RA 2V9VA 2V79A 3M1CA 2ECCA 3GTOJ 3LSJA 1KZLA 2ISZA 1WJEA 3LYCA 3JRAA 3CCQB 1OFEA 2QSGX 1HDPA 2X53S 1HKTA 4RGXA 1SFXA 4QSHA 1RKTA 2XRLA 4JK1X 2QGUA 5EG0B 1VJSA 3AL0B 1W9XA 1HA3A 4O5VA 5DS9A 3DU1X 1ON2A 2COBA 2KDZA 2CUFA 1K73D 1EA3A 2E1OA 2W57A 2MLKA 1BW5A 1G6NA 2OCEA 2QTLA 1YW8A 1T33A 2MABA 4P1VA 4OJ5A 2JA6J 3B4NA 2VE8A 2CW5A 3Q6QA 2QSHX 2IAIA 1QHHD 4XN3A 1DDGA 2BM5A 5BOXA 1ZARA 3CCVI 4EQQA 2GPJA 4C3IJ 4KT6A 4HYEA 1UJ8A 1VFCA 3RI4A 1X1PA 3ZOBA 1T0FA
chains in the Genus database with same CATH topology
1UD4A 1BLIA 3H94A 3HXLA 1GLNA 2UWMA 4F92B 3K4CA 2V26A 4ZYAA 2JUGA 3D5SC 4CCKA 3T53B 2CV1A 2KLOA 3D5RC 3H9JA 3PFYA 4LIVA 1V0FA 5HLTA 4NC8A 5LFAA 4Y3OA 3OYFA 1JI8A 3LMWA 3ONQA 1MABA 2LG4A 2M3AA 3IAM2 2QE7A 3H5NA 4XONA 2R7SA 3L2QA 2HQAA 3TMOA 3FPPA 4BJ6C 4E7LA 3S8PA 3BC9A 2KRCA 3KX2A 4IQ4A 3SEZA 3EPZA 2HPIA 1JRGA 3MKWB 2CW8A 2XZPA 2NOJB 2X6XA 2X6WA 3CJRB 1X19A 1D0YA 3WQZA 3OIQA 3NWTA 2K3PA 2W6JA 1WFXA 1OR7C 4KKSA 2INUA 3K4LA 3VDXA 2O17A 1K5CA 1N77A 2HVRA 4ASUA 4ZDOA 2LC2A 1X0CA 4IX7A 3OYHA 1QCXA 2NTPA 2PJRB 1WJDA 3LSHA 3NE5B 1VF7A 1X1CA 2VQHA 1NG7A 3CZ6A 3KEYA 4C2TA 2CV2A 1IDKA 3B90A 3M8JA 3LFUA 1PYVA 2LREA 3OYNA 4BQQA 2CK3A 1AIRA 1TT0A 3AKZA 1ZELA 2HDWA 2VPLA 1LFPA 2D3NA 4C2UA 2NSPA 2E1MB 2AQFA 3OW7A 4NK6A 3GRHA 1PKVA 2XF6A 2VL8A 4Y4RA 4B3FX 1RU4A 3EQOA 1E0EA 3UW0A 3TBIA 3VSUA 2K9MA 4HNTA 5KNLA 1KCCA 2LYCA 3VSLA 1HA8A 1V5EA 2BVMA 2KPMA 3A4CA 4PJMA 2UUZA 4XOTA 4DJAA 3HOSA 4HIZA 1O8IA 1WMRA 2PYHA 1T5EA 3CMMA 1Z3XA 3DEEA 4BXFA 1WTHD 4L8JA 3DLAA 3H9QA 4DBQA 4Y33A 4N4OB 2LH9A 1BOBA 1UAAA 4DNRB 2X1CA 4XNFA 2RQQA 3PNTA 4B48A 3PJRA 3MD2A 2VXZA 4GQNA 1D0XA 3IAS2 1IB4A 3DU5A 4YEJA 4HRIA 3RTRA 2CH0A 1RWRA 1WJAA 4KISA 5FRNA 2W7NA 2GK7A 2ZZFA 4OWRB 1MMGA 4KITB 2UVEA 2ZZQA 2X85A 4YZQA 2GOXB 4LIUA 3S93A 2WY8Q 4ZDPA 5AMVA 2JA2A 2GJRA 1N78A 1V5FA 2R9VA 2W4SA 2INVA 1WJBA 2R7OA 4X0GA 3OYDA 4E0FA 2L7KA 2QX3A 1LKXA 3HG9A 1NRKA 1D0ZA 2CUJA 2GJKA 4XM3A 1Z21A 2WJVA 3OMYA 3G05A 4BDYA 3FKJA 4QPQA 1W0JA 1UELB 2VLAA 3PNYA 2HPMA 3ZRGA 3OYLA 2CS3A 4BU2A 4LG3A 3EUAA 4Z06A 1WJ5A 4DOZA 1GQ8A 2LY2A 1X1AA 4PFOA 2BW3B 1DP3A 4HG2A 4OJ6A 1VZ0A 2V31A 4F91B 4Z05A 4ITVA 3K70D 1IA5A 5IK2A 4XKVA 3CJQB 1RMGA 4PFPA 2A6TA 3FKSA 3K4NA 4HNUA 3LL7A 2NTBA 2CW7A 2XF7A 3SEQA 2VBMA 3OL4A 4W8RA 1MMDA 4BQOA 3OEEA 2V4DA 2M4KA 3OYEA 4E7IA 4CH7A 1K6YA 3L2WA 1E43A 4KKUA 2NZMA 1E1QA 2KDOA 4PMHA 1O8KA 4RM3A 3C2GA 3ZIAA 3OOUA 2NSTA 3ZXSA 1KMHA 2KRHA 4XQFA 2ZTNA 3A1YA 1T0FC 3VMWA 2LRDA 2VIXA 2WAQA 3N05A 4XKWA 2GK6A 2GJPA 4E7SA 1V5GA 2WAFA 4N4NB 5DN6A 2I8DA 2BOLA 1SFKA 3K4JA 3OWTA 3A3BA 3F9KA 1U0JA 4CCNA 3SZGA 2Z16A 4BACA 1KONA 4AVZA 1MW7A 5CPRB 4R79A 3GVLA 4TSFA 3VYRB 2KVOA 1DBGA 2E60A 4PSWA 5CKTA 5JHFA 2LOOA 3QODA 2IXSA 2HVSA 3DDYA 5FRMA 4HSRA 4E7ZA 2JSPA 4CCLA 2JJ2A 4IQJA 3VWBA 3HC7A 4EW9A 3HUGB 2WB1A 3OYAA 2IGKA 3OYIA 3AFHA 3C2HA 1O8JA 2Z6BD 4J00A 2WZPP 1FMVA 2EWEA 2M0MA 4NUBA 3H35A 3OS1A 2Q1ZB 3OEHA 4BL0B 3RSNA 4NC7A 2KL4A 2LY1A 4RMNA 4E7HA 3OPOA 2XDVA 1QHGA 2QXZA 3BH4A 1IDJA 2IGOA 1O8EA 3T9GA 3OFNA 2JIZA 1V0EA 4B43A 4B44A 3OYMA 2X3HA 1K28D 3OIPA 4U7BA 3CF2A 1UD5A 4BDZA 4P5OA 4XD7A 1WJFA 1OHHA 2DT6A 1OGOX 4D1QA 4B3XA 2X51A 3HPGA 1E79A 1WPCA 3GQ7A 3GQAA 2KQRA 3RPUD 2HNHA 3VYSB 2ZSIB 3SDBA 2D3LA 3SUCA 2ZTGA 3FBIB 3CESA 1Y56A 2K9LA 4OAZA 2UVFA 2M5SA 3GQ8A 1UD3A 1NG6A 1QU3A 3G2BA 1DBOA 1T95A 4W8SA 3J7AY 3E1SA 1S9HA 4U4BA 2WJYA 4U87A 2ELJA 3OYGA 3CP2A 1AA7A 3QYFA 2O0VA 3S3OA 1BPLA 3QOEA 4NQWB 2GOMA 2XZOA 3GBGA 2OV7A 1EFRA 1O8MA 2L9SA 1H80A 4UZUA 3BLYA 1HG8A 1LDKB 2F4IA 2IS2A 2DJIA 3KRGA 2WBMA 4BQNA 1HVXA 3DWLE 4ZTJA 4ZDLA 4EATA 3OR2C 3I3LA 4YRVA 1OLTA 3CP8A 3W2AA 2R7XA 1UD6A 3K70C 2JDIA 4PJLA 3S3MA 2W00A 2Z8GA 2DIEA 3UNGC 2WA0A 4YELA 4OJOA 4Z03A 5HNFA 4CZCA 1PJRA 2X1EA 4G6TB 2MFZA 1O8DA 4G7WA 2VJIA 1YX3A 3BCDA 3OY9A 2V7QA 4OZZA 4FASD 2VBKA 1SAUA 3VYTB 3QYBA 5HVQC 2X1DA 2V6EA 4PSXA 2HVQA 3VSTA 2VQLA 1IRXA 3VYUB 3HOTA 2OC6A 3ZGKA 4MLOA 4FXUA 2MYSA 1E3ZA 2MC4A 4NNJA 4D9JA 3K6GA 2O1DA 2R7TA 2NT9A 3K4KA 1BR4A 3OR1C 2XOKA 2ZXIA 2WAEA 5KHDA 2W1OA 2R7QA 2F1MA 2PMZA 1MNDA 3OS0A 2WSSA 2E5NA 4HPQA 3JU4A 1EE6A 2XSJC 3DQVC 2KP6A 2QKMB 1D1BA 4C2LA 1G8XA 4PUSA 1Y6IA 2Y0SA 2F6CA 3PUBA 3ZQQA 2LBFA 1QJVA 3BCBA 2IS4A 3MKZA 3DPLC 1X4OA 3AL0C 1COWA 2JVGA 4OJLA 2MD0A 1PXZA 3OYCA 4P1WA 1Z3YA 5CQGA 3OOCA 4BS9A 2FUG2 4TKOB 3H5RA 4U49A 2XF5A 1H8EA 1E3XA 4YZ0A 5C1EA 1Z7LA 5FL7A 4AU7A 1BHEA 4ZC3A 3A2KA 4MXNA 2M7AA 3VR6A 2NTQA 4BJTA 5KCMA 3W2WA 1NHCA 2A5WA 1O8GA 2O0WA 3T51B 3ZPPA 3NWSA 1UD2A 4HWVA 5HKKA 3S32A 4BEHA 4XN0A 3DKXA 3OE7A 1PLUA 4C9YA 2V7FA 2XZLA 4NK8A 5CQEA 4CA0A 1JTAA 3EQNA 1I18A 4BJ5C 2IS6A 3LSGA 4XKCA 2RREA 1G59A 4BE1A 4CUGA 2RNGA 3QYEA 4BE0A 3T56B 2KHMA 3OL3A 1PE9A 1MMAA 1DGRM 2L2OA 4RLFA 2VXDA 4PJNA 4BGDA 1MMNA 2DXIA 2V1NA 1H8HA 2PECA 4ZJZA 1I8DA 2CFOA 2DT7B 2VJJA 3BG6A 3BG7A 1O8LA 4F3QA 4I84A 2R7VA 5TGTA 1E1RA 3EUHC 3RCOA 3KEWA 3DPUA 2ZFUA 4KJZA 1WP6A 3GQ9A 4C30A 3HKZA 4PJJA 4CSWA 4J01A 2VQCA 4JQFA 2HU9A 4XLCA 2F5VA 4P22A 1UD8A 2XGJA 4DK1A 4W8QA 3W3CA 3GVKA 2ZXHA 3IP4B 4XOPA 2VKHA 4YZAA 2IGMA 4URRA 1DQUA 4RM2A 4HSTA 2WPDA 1J09A 2ODLA 3E0JB 2O5RA 2VJ4A 2DOAA 1FMWA 3EUKL 2L9NA 3IUOA 4II3A 4B47A 1BMFA 1VLYA 3HAGA 4G6IA 2AQEA 2ZSHB 2NT6A 2P0WA 2VASA 2W6IA 2WY7Q 3ZR8X 2VB6A 3HPHA 4DIQA 3H9GA 3I9V2 2PJRA 2E1MC 4JOMA 3K10A 2KMUA 4LITA 4XKBA 1WJCA 4YZXA 2HLDA 5FROA 3DTEA 3WWGA 1XG2A 1YE9A 4JMQA 2PYGA 1ERDA 1NBMA 3UR3C 1O8HA 3K4MA 3LSIA 4DGWB 1O8FA 4ZTFA 2Q2EB 4YXWA 2M7BA 1CZFA 5C1CA 2DCEA 4B3GA 1O88A 4DK0A 2VBEA 1KTWA 3RQ4A 2W82A 1P9QC 3FBNB 2VJ5A 3OAAA 3L2UA 1BR1A 1DGWY 4E4HA 2F43A 4GRIA 4RLQA 2XAUA 2X6YA 4XR6A 4BUPA 3DPTA 4ANJA 2R7RA 1OFLA 1SKYB 5CDFA 4IKFA 4W8TA 3BCFA 2Z1DA 3DTIA 4XLHA 3LNNA 3MKYB 2R7WA 4F52A 4CCOA 2VKDA 3PNVA 1N75A 2JJ1A 2IGNA 1OOCA 3TL4X 3GVJA 4OAYA 4BE2A 3PL8A 2CV0A 4IZZA 3LSKA 1VBLA 3B8YA 3LMMA 1W0KA 3ZPNA 1X1DA 3SYTA 2Z2SB 1R6RA 4DBRA 3W2VA 1UG0A 2CUZA 1TZLA 1LVKA 3BCAA 3FY3A 3DU6A 1HZEA 3FDYA 2XNDA 3OYJA 4HEA2 3V42A 1X1BA 3ZSCA 4KKTA 2X8KA 2VQGA 4PK4A 1OGMX 2BSPA 1X4PA 2O04A 1W36C 3L2VA 4TT3A 2V9KA 2IS1A 2CMPA 4XLFA 2WADA 3OYBA 2R7UA 5LD2C 1OB0A 3ZCOA 3LSMA 3L2RA 3K4BA 3KYLA 3H5AA 2IQ7A 2QY1A 4E7KA 3PSFA 3OS2A 2ZZGA 4CCJA 2R4GA 4MR0A 1D1CA 1YX5A 4QPOA 2M4GA 2BW3A 2V4JC 3VSKA 3M1CA 2LBFB 1KZLA 1WJEA 3HL2A 2JVHA 1OFMA 2E5ZA 2KZVA 2LZJA 2L5QA 2X53S 2ZZEA 4XLEA 4G7XA 3A3GA 4DNTB 1MNEA 4II2A 2E1BA 3MMYB 4H4KC 3OYKA 4F55A 2K5CA 2XC7A 3PSIA 4E7JA 3S3NA 1W36D 3AL0B 1VJSA 1W9XA 3FHNA 2HZDA 4CCMA 3U21A 3A35A 3DKYA 3GQBA 1FX0A 2QKLB 3VSVA 3D5LA 4OZYA 1BN8A 1EA3A 4XMYA 4OJPA 2OUMA 4XLAA 3VMVA 4OJ5A 2MABA 4E6KG 3BC8A 5HOOA 3B4NA 4BEHB 4XORA 5HNHA 3DTKA 1QHHD 4XN3A 4F93B 4XL9A 1KCDA 2BVLA 1D1AA 3JURA 4AYBA 2UV1A 4KT6A 3H0DA 4FETA 1BR2A 4Z1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IA5 A;  4XKV A;  1RMG A;  2Z8G A;  4YEL A;  2NTB A;  4OJO A;  4Z03 A;  4YZX A;  1O8D A;  2VBM A;  3WWG A;  1XG2 A;  2VJI A;  4W8R A;  4OZZ A;  2PYG A;  1O8H A;  2NZM A;  1O8F A;  2VBK A;  3LMW A;  4PMH A;  1O8K A;  1CZF A;  5C1C A;  3VST A;  2NST A;  4XON A;  1O88 A;  4XQF A;  3VMW A;  2VBE A;  1KTW A;  4XKW A;  2O1D A;  1JRG A;  2NT9 A;  2X6X A;  2X6W A;  2X6Y A;  4XR6 A;  1OFL A;  1K5C A;  4W8T A;  2INU A;  1DBG A;  4AVZ A;  1EE6 A;  2O17 A;  4C2L A;  4XLH A;  1X0C A;  1QJV A;  1QCX A;  2NTP A;  1OOC A;  4OJL A;  1PXZ A;  1VBL A;  3B8Y A;  1IDK A;  3B90 A;  4EW9 A;  3FY3 A;  4U49 A;  1AIR A;  4YZ0 A;  2NSP A;  1O8J A;  5C1E A;  3ZSC A;  2EWE A;  1BHE A;  3GRH A;  4NK6 A;  1RU4 A;  3EQO A;  3UW0 A;  3VSU A;  1OGM X;  2BSP A;  2NTQ A;  4MXN A;  2O04 A;  1KCC A;  4XLF A;  2QXZ A;  1NHC A;  1IDJ A;  1O8E A;  1O8G A;  2O0W A;  4XOT A;  3T9G A;  1WMR A;  1O8I A;  3ZPP A;  4HWV A;  4XN0 A;  2X3H A;  1PLU A;  2QY1 A;  4NK8 A;  2IQ7 A;  1JTA A;  3EQN A;  4MR0 A;  1OGO X;  4XNF A;  3GQ7 A;  3GQA A;  1PE9 A;  3SUC A;  2PEC A;  2UVF A;  1OFM A;  3GQ8 A;  2VJJ A;  1O8L A;  4I84 A;  1IB4 A;  4XLE A;  4YEJ A;  1RWR A;  1DBO A;  3GQ9 A;  2UVE A;  4YZQ A;  4W8S A;  2X85 A;  4XLC A;  4U4B A;  5AMV A;  4W8Q A;  2INV A;  2O0V A;  2QX3 A;  3VSV A;  4XOP A;  4OZY A;  1BN8 A;  4XMY A;  4YZA A;  4URR A;  4OJP A;  4XM3 A;  1O8M A;  4XLA A;  1H80 A;  1HG8 A;  3VMV A;  2ODL A;  4OJ5 A;  3KRG A;  3B4N A;  4XOR A;  4XN3 A;  2NT6 A;  4Z06 A;  4XL9 A;  1GQ8 A;  1KCD A;  3JUR A;  4OJ6 A;  2PYH A;  4Z05 A; 
#chains in the Genus database with same CATH topology
 3JAM Z;  2VNJ A;  4PC6 A;  1EFT A;  3CCU B;  3I56 I;  4RGR A;  3VEP A;  1VQ8 I;  4P9F A;  1Z67 A;  4Z2Y A;  4AD9 A;  3JR9 A;  4FX0 A;  3WND A;  3HUG A;  2ZJQ F;  4IRH A;  3PFY A;  1V0F A;  5BS6 A;  2CYY A;  3CCM I;  2XTY A;  4NC8 A;  5DCF A;  2FOW A;  4EJW A;  3WHC A;  3H3Z A;  1M1E B;  3FXM A;  3FK6 A;  1K7A A;  1VQL I;  3FXR A;  2QE7 A;  3H5N A;  5ERI A;  4XON A;  5H59 A;  1D8T A;  2WAQ N;  2FX3 A;  4LBV A;  4HZF A;  3PUN A;  2CWE A;  3J81 Z;  2CGP A;  3ABT A;  3BR5 A;  3KX2 A;  4IQ4 A;  4P96 A;  4MEX F;  1VQ5 I;  3CJN A;  2QYO A;  2HPI A;  3M8F A;  3HDD A;  2CW8 A;  1TTT A;  2NOJ B;  4FX4 A;  5GAE J;  2RQP A;  1YHQ I;  3WQZ A;  2EH3 A;  4IOC F;  5C4X J;  1ZR2 A;  4KIB A;  5E79 C;  5GAG J;  3K4L A;  2INU A;  1IN7 A;  3RIR A;  3BPV A;  1K78 B;  1GAW A;  4TMT A;  4ASU A;  3SDG A;  4PC1 A;  2CQN A;  3LSH A;  3NE5 B;  1JA1 A;  2LVS A;  1BL0 A;  2E36 A;  2OBR A;  1HKQ A;  3KEY A;  1IDK A;  1BOA A;  4L5J A;  4Q47 A;  3B90 A;  2ESN A;  5GAH J;  3TDU C;  1I1S A;  3OYN A;  1VQM I;  1VF9 A;  4BQQ A;  1OMI A;  3IRR A;  1QRB A;  1ZR4 A;  1ZEL A;  2HDW A;  2NSP A;  4XID A;  1RI7 A;  5M5W J;  1KYZ A;  3GWZ A;  4C2U A;  2XGC A;  4Y4R A;  4B3F X;  4C2M J;  4FTH A;  2JA8 J;  4UVC A;  1RU4 A;  2FE3 A;  4A5N A;  1ETQ A;  2K9M A;  5KNL A;  1OCP A;  2K40 A;  2LYC A;  3VSL A;  1OPC A;  1HA8 A;  2V5I A;  2QZA A;  2BVM A;  2KPM A;  1SM4 A;  2H94 A;  4LG0 B;  2PQ8 A;  3HOS A;  3AGP A;  2FF4 A;  5F0H A;  2DFE A;  3R0A A;  5F04 A;  5HDG A;  1H9G A;  1NTC A;  1TQI A;  2OBS A;  2MBF A;  3G6E B;  3H9Q A;  1USS A;  3KCC A;  2GLO A;  4N4O B;  2YX7 A;  2DA3 A;  4QFM A;  2X1C A;  2GQQ A;  2RQQ A;  3IHU A;  2OBP A;  2VBZ A;  3KLO A;  1GJR A;  4I02 A;  2VPR A;  4B48 A;  3B73 A;  3QP5 A;  1HKS A;  4GQN A;  1D0X A;  3T1B A;  5GAD J;  3LVB A;  1UHS A;  1ZG1 A;  3S14 J;  1YJ9 I;  2HGC A;  4PCQ A;  1NK2 P;  3M4O J;  2BV3 A;  3WYA A;  4E70 A;  1TLL A;  5FRN A;  1RWR A;  4OPO A;  3KFW X;  2W7N A;  5IP7 J;  3MAJ A;  3H36 A;  1IV6 A;  3CW2 A;  2MSY A;  4P6V F;  2JPC A;  2GOX B;  4HA8 A;  1S0U A;  3JTH A;  4X7D A;  2Q6K A;  4B3A A;  2NS7 A;  2XTW A;  3CMA I;  3I58 A;  2OYN A;  3OYD A;  4E0F A;  5LHH A;  1GDT A;  2GJK A;  2CUJ A;  1I5Z A;  2HKO A;  4YAF A;  1OGI A;  4QV2 A;  3MVP A;  2P8T A;  4MHG A;  3FKJ A;  5J1Y A;  4PZJ A;  4TSF A;  3PNY A;  3ML6 A;  4CHU A;  2OQG A;  2K85 A;  4P6Y A;  1BIB A;  2HTS A;  4DOZ A;  4YHB A;  2LY2 A;  1X1A A;  5GPC A;  1DP3 A;  4HG2 A;  5EEH A;  1LLW A;  2V31 A;  4AF7 A;  1LDD A;  4CQJ A;  3K70 D;  3LA3 A;  5IK2 A;  4XKV A;  3CJQ B;  4B09 A;  1YIT B;  1D3Y A;  2A6T A;  3NQO A;  2XF7 A;  4I76 A;  1PUE E;  1J0R A;  3LOC A;  3OL4 A;  1MMD A;  1ZRC A;  1RKW A;  3ZMT A;  3LJY A;  3CPW B;  2M4K A;  4E7I A;  1HDD C;  2NZM A;  2XAH A;  3MZ8 A;  1YQA A;  1E1Q A;  3PO2 J;  4PMH A;  3V7S A;  4WZT A;  4G7Z F;  2HTJ A;  1N06 A;  2CND A;  2FBK A;  3ZXS A;  3IWZ A;  3PSS A;  2YX4 A;  1R5H A;  4Q4Z F;  4FK8 A;  3BTL A;  2L54 A;  2LRD A;  3LST A;  3N05 A;  2EA2 A;  1W5T A;  4KN7 X;  1ZGA A;  4N4N B;  3JW4 A;  1QA2 A;  2I8D A;  2XV4 S;  3OWT A;  1PJ6 A;  1BI2 A;  3SZG A;  2Z16 A;  2EBI A;  3R6K A;  2QTZ A;  4BAC A;  1KON A;  4AVZ A;  4R79 A;  5CPR B;  1FOX A;  2Y0S N;  2XHK A;  3GVL A;  2KVO A;  4RD6 A;  2E60 A;  3SYJ A;  5CKT A;  3AG1 H;  3CC2 I;  2WWY A;  2IXS A;  1U2W A;  2X9D A;  2ZFW A;  4W97 A;  5JHU A;  3E20 A;  1MBF A;  1VQ9 I;  2GZW A;  3S2D J;  3SJP A;  1A36 A;  3KE2 A;  1WH5 A;  2JSP A;  1U5T A;  2DT5 A;  3HC7 A;  4IXA A;  2AS5 F;  4L18 B;  3HUG B;  4RDK A;  1EH7 A;  3WE3 A;  4IHW A;  5LLQ A;  2W84 A;  2K4B A;  2VBY A;  3CLO A;  5K1Y A;  2DA1 A;  2EIJ H;  4CXF A;  4J00 A;  2FD5 A;  2EWE A;  5CVI A;  3L7W A;  2HQ5 A;  1Q7Y D;  2HDD A;  4QVJ A;  4NC7 A;  2KJC A;  5J8F A;  1QHG A;  2EWN A;  4Z6Y A;  1IUY A;  5DM6 F;  3CCE B;  2P6T A;  1IDJ A;  3RQI A;  5GTH C;  2RC6 A;  1O8E A;  3TH0 A;  1NHA A;  3OFN A;  3TP3 A;  3KP2 A;  1IDZ A;  1V0E A;  2JIZ A;  2X3H A;  3OIP A;  4U7B A;  3CF2 A;  1UD5 A;  2DMU A;  1KQS B;  2VFO A;  1X3U A;  2F48 A;  4YAL A;  1OHH A;  3GTQ J;  3ULQ B;  5BSY A;  1OGO X;  4B3X A;  2X51 A;  2LKP A;  2MC3 A;  3HPG A;  3GQ7 A;  3RPU D;  2HNH A;  3VYS B;  2ZSI B;  1V3F A;  3SDB A;  4B1R A;  5A2Q K;  2EZK A;  3CES A;  1WZ2 A;  3C3W A;  1YW9 A;  2ZO4 A;  3NRV A;  5BMZ A;  3G71 B;  2NNY A;  5IT3 A;  1OCZ H;  1QU3 A;  1VQL B;  2L9V A;  4OMZ A;  1S9H A;  1I3A A;  4U87 A;  1IB0 A;  5DYM A;  1ZLK A;  4BNC A;  2FVG A;  1F36 A;  1V55 H;  1YI2 I;  2PX9 A;  3QOE A;  2GOM A;  5EZH A;  5LEJ A;  3GBG A;  2G0Y A;  3W5H A;  4UZU A;  4YIR X;  1P92 A;  2F4I A;  2FJ1 A;  3KRG A;  2WBM A;  4PGG A;  1WSR A;  2VON A;  1KU3 A;  3DBH B;  4M6V A;  4X07 A;  3OR2 C;  1UMQ A;  4XIC A;  2WZN A;  2V7V A;  1UCR A;  1UD6 A;  2C5H A;  1TP4 A;  2BEO A;  2VC1 A;  2DBB A;  3W6V A;  2EFQ A;  2NYX A;  4YEL A;  3UNG C;  1AHD P;  2GXB A;  4Z03 A;  5IP9 J;  3S1N J;  1UHM A;  2E71 A;  3D0S A;  3NEU A;  3CCS I;  2BY1 A;  1YX3 A;  3ECH A;  3BCD A;  3OY9 A;  4ESJ A;  2Q6I A;  4LOC A;  2D2W A;  1SVM A;  3BH7 B;  4FAS D;  4OZZ A;  2ZL7 A;  1SAU A;  3VYT B;  5HVQ C;  4WQM A;  5DS0 A;  5FFX A;  2B7B A;  4LBW A;  3VST A;  2BYV E;  2IJL A;  3HOT A;  5CYV A;  2OC6 A;  1A8P A;  3K2A A;  5J4V A;  3S15 J;  1Q81 D;  3HRU A;  1E3Z A;  1OCC H;  5E3M A;  1FPQ A;  4XRF A;  1OCO H;  3K6G A;  5LGN A;  4ZGQ B;  4AIH A;  3PIP F;  1EJ9 A;  3G1L A;  3W2E A;  4P9U A;  2ZXI A;  1SC7 A;  1JKR C;  2PMZ A;  3OS0 A;  3G1M A;  1KQ0 A;  4HF2 A;  3JU4 A;  3HYI A;  1G8X A;  1TYV A;  1Y6I A;  3BQJ A;  3ZQQ A;  1WVR A;  2DTZ A;  3FIW A;  3JRI A;  1QJV A;  2XC1 A;  3ZMZ A;  3MKZ A;  2VYQ A;  3RY8 A;  4RAY A;  3AL0 C;  1E62 A;  1COW A;  2JVG A;  4NBS A;  2MD0 A;  3OYC A;  1FY7 A;  3BR0 A;  1TW3 A;  3MN2 A;  1NJI D;  2JSC A;  4DQ2 A;  1Z3Y A;  5CQG A;  3OOC A;  4Y7C A;  1PUF A;  2XF5 A;  3F22 A;  3B6C A;  3H3U A;  3HRS A;  4Z4V A;  3CDL A;  1XG1 A;  1IJW C;  2DPD A;  2LMD A;  4B8X A;  3HOW J;  4XRM A;  2VOD A;  4NHJ A;  4ZC3 A;  2DYR H;  4MXN A;  2M7A A;  3VR6 A;  2NTQ A;  1VQP I;  3SLN A;  4BJT A;  3P9I A;  1DP7 P;  2J8I A;  3GME A;  2EA4 A;  2XVC A;  4ENK A;  2A5W A;  1SEU A;  1N07 A;  1HST A;  3AVX A;  3OOP A;  1ZRE A;  3BY1 A;  3BY6 A;  3DKX A;  3BJ6 A;  1DPR A;  2ID6 A;  4WCG A;  1LJ9 A;  2KIU A;  3HB9 A;  1IGN A;  2A3S A;  3JSP A;  2LF7 A;  3ISX A;  1R36 A;  4N3G A;  2A6E F;  4WWV A;  2RRE A;  2IA0 A;  4HQM A;  2RNG A;  3T56 B;  3BTC A;  2BY0 A;  5DUK A;  1DGR M;  3SZP A;  4HX4 A;  1QA3 A;  2DO7 A;  2DXI A;  2PEC A;  4RB1 A;  1UZC A;  5HS7 A;  2CFO A;  1I8D A;  4ZCI A;  1O8L A;  4XBF A;  1JXS A;  1U5T B;  4M3D A;  3N90 A;  1JA0 A;  3GQ9 A;  3HSE A;  3HKZ A;  4IEJ A;  1KGS A;  4PJJ A;  2EJR A;  2EV6 A;  2VQC A;  1WOS A;  1HW1 A;  3QFS A;  4N3N A;  2IA2 A;  4XLC A;  3CME B;  3CCV B;  1YTY A;  2EFG A;  4QIW N;  1N08 A;  4U0Y A;  3M9A A;  1SVO A;  2PG4 A;  5GV7 A;  1P2F A;  1TWF J;  2L7M P;  3IV5 A;  3I56 B;  5B66 C;  3GSI A;  1DQU A;  4HST A;  2Z9O A;  2QF7 A;  3H1C A;  4G6D A;  5JR3 A;  3N4M A;  5L46 A;  1J09 A;  2ODL A;  1BMF A;  1FMW A;  1IN5 A;  4G6I A;  2K9S A;  4II3 A;  1W5S A;  1G7T A;  3SHF A;  2VBT A;  4UXN A;  2ZSH B;  4AF6 A;  3E5Q A;  3ZR8 X;  3SQN A;  4AYB N;  1JNY A;  3ZMV A;  1D8J A;  2OK7 A;  3ZN1 A;  3GCM A;  3HGY A;  3BY2 A;  2FSW A;  2PJR A;  3I9V 2;  3K1N A;  3J81 k;  5D4S A;  1R58 A;  1OIS A;  1YS7 A;  1AOY A;  1VQ5 B;  1KK1 A;  2C4T A;  1WJC A;  4C3H J;  1D8K A;  1B9M A;  1D2E A;  4Z4R A;  2HWV A;  5F1J A;  2BX6 A;  5HZB A;  4JMQ A;  4RAZ A;  4DGW B;  3LSI A;  1AIP A;  2YS9 A;  1O8F A;  1OR7 A;  3I1F A;  3IL2 A;  2HOT A;  4CYC A;  2FML A;  4GO1 A;  4WXC A;  1KU7 A;  2ZBK A;  2HR3 A;  3DBL B;  1HC8 A;  3E3V A;  2DA2 A;  2NNN A;  2UXN A;  4MEY F;  3MKL A;  3KPH A;  1KTW A;  1P9Q C;  3WU1 B;  2QUF A;  4ZCM A;  3ISP A;  4P55 A;  4OOI A;  3FX3 A;  2VE9 A;  4ZYD A;  4KIG A;  2XAU A;  3A8J A;  2X6Y A;  1B1B A;  1FBU A;  1HQC A;  4IRG A;  4BUP A;  4OIQ F;  1KJZ A;  5B1A H;  2OBT A;  1SKY B;  1P4A A;  5J1U A;  4IKF A;  2OK8 A;  3HSF A;  2EB7 A;  2TCT A;  3PQK A;  1VQK I;  3HOV J;  2Z1D A;  4XLH A;  3MKY B;  2LTP A;  1MSF C;  4M0L A;  5K7H A;  3OSG A;  2BM6 A;  1G3Y A;  1MJ9 A;  5IYR A;  2VKD A;  3GVA A;  1OB2 A;  1N75 A;  2IGN A;  1G3W A;  1OOC A;  1FNN A;  2HS5 A;  1T2K A;  3B8Y A;  3SQV A;  4GXO A;  4KMU X;  2VBX A;  4DBR A;  3ASO H;  1KK3 A;  3BCA A;  3ZP5 A;  3AG4 H;  3IKV A;  3DU6 A;  1XE1 A;  4I09 A;  3SZT A;  2FX0 A;  3SFZ A;  4HEA 2;  2FXA A;  1J5Y A;  3WTW C;  3BG3 A;  1WWX A;  2DQL A;  1QZZ A;  1BM9 A;  1W36 C;  5FFZ A;  2ZL6 A;  2JA7 J;  3LQQ A;  4AID A;  1RRJ A;  3WU0 A;  2O9L A;  1ORK A;  3FMR A;  2V1D A;  3A0B C;  3PQJ A;  2V7W A;  1QBJ A;  4CGZ A;  4E7K A;  3BRO A;  3ZBT A;  1S4M A;  3FWE A;  1YX5 A;  2XKO A;  2M4G A;  1K61 A;  1QVF B;  2O7O A;  2V4J C;  1FBQ A;  2R5Y A;  1S8N A;  4DQL A;  2JRM A;  1S5L C;  3BQZ A;  1FLI A;  4HX8 A;  1RES A;  4RM0 A;  4ZYE A;  2HZT A;  2BGC A;  2JVH A;  1W0T A;  3GFL A;  3O2P E;  4MGR A;  4RB0 A;  4FE4 A;  2ZZE A;  4XLE A;  1EWY A;  1MGT A;  1QFJ A;  4G7X A;  5FB2 A;  1YJW I;  1F4K A;  3BNW A;  2MGQ A;  4IPA A;  4H4K C;  3OYK A;  4E7J A;  2K5C A;  1W36 D;  3PSI A;  3RKY A;  2QEX I;  3S3N A;  2EZH A;  4CCM A;  3U21 A;  5KAF C;  2V9P A;  4UZE A;  5A89 A;  3RIQ A;  1Z0X A;  5H6Q A;  1GR1 A;  3VSV A;  5E8I A;  5JFR A;  4OZY A;  1ONV A;  1BN8 A;  2M5W A;  1OYY A;  4AC9 A;  4XLA A;  4BY7 J;  1K4T A;  4LB6 B;  4B4C A;  2XRO A;  4IHX A;  3GF2 A;  4KH3 A;  3BC8 A;  5HOO A;  2PFB A;  1MBG A;  1R22 A;  3FXK A;  2A07 F;  4XOR A;  5HNH A;  1E3H A;  3DV8 A;  1MZB A;  3E6M A;  4OM9 A;  4TMZ A;  2XIG A;  2GWR A;  3TDZ C;  1HF2 A;  5H2F C;  3W6J B;  2UV1 A;  5EF6 A;  4RCZ A;  4TMV A;  3H0D A;  2PYH A;  1S7A A;  2QA4 B;  2TRT A;  4UHT A;  4ENN A;  3WXM A;  1XDS A;  1GLN A;  3RYR A;  4CZZ A;  1JKO C;  1YRN A;  2UWM A;  2K27 A;  5ICG A;  4F92 B;  2V26 A;  1E17 A;  2JUG A;  4CCK A;  5CVU A;  1OJL A;  2CV1 A;  3Q0U A;  4TMW A;  4D7N A;  5HLT A;  1NB0 A;  1CLW A;  3OYF A;  1JGG A;  1ZH5 A;  1JI8 A;  3E97 A;  3F0C A;  4U7D A;  3FXJ A;  1LPQ A;  2KIS A;  2M3A A;  3DBR B;  3CC2 B;  2R7S A;  2I5U A;  1QZE A;  2M2E A;  2BM0 A;  2XUB A;  1FRN A;  4A3J J;  3N97 A;  1FRQ A;  3FPP A;  4E7L A;  3S8P A;  2IP2 A;  2KRC A;  1O3S A;  1EP2 B;  1SKQ A;  4PAB A;  1JRG A;  4LLG F;  2XZP A;  5D8L B;  2F5D A;  1VQ4 B;  3F8B A;  1D0Y A;  1I6X A;  1VI0 A;  1N0U A;  2CG4 A;  2A68 F;  1WFX A;  2GM4 A;  4L0Z B;  2O17 A;  3C2B A;  3AST A;  3U6K A;  1QRC A;  4D0P A;  3ZPL A;  3ONY A;  4YAO A;  3BR6 A;  5HLH A;  1M90 D;  1X0C A;  1ZM3 A;  1X2M A;  2R5Z A;  2OTJ B;  3OYH A;  1S6L A;  3E6B A;  1QCX A;  2PJR B;  3VPR A;  3WHB A;  1X1C A;  2BY3 A;  2TDX A;  3IC7 A;  5J3L A;  1NG7 A;  3CZ6 A;  1Y8Q B;  2CV2 A;  1ZRF A;  3M8J A;  4UV8 A;  1G3S A;  3W2I A;  3SLD A;  5CVR A;  3TO7 A;  2QZ8 A;  4X7F A;  1TT0 A;  3AG2 H;  1AIR A;  3FMS A;  4EM2 A;  2WV1 A;  4N9I A;  1A31 A;  2VPL A;  1YG2 A;  2AQF A;  3OW7 A;  2Z5U A;  2VL8 A;  4CYC B;  5FKO A;  5K7F A;  3BP8 A;  3HKZ N;  4BHB A;  3TBI A;  1T8I A;  1E0E A;  3EQO A;  2BBY A;  4NQW A;  1T98 A;  4RCY A;  3BOQ A;  3AVY A;  3TO6 A;  3AVT A;  4NDL A;  1F60 A;  3A4C A;  1FIP A;  4XOT A;  3GYH X;  2X3U A;  1J9Z A;  3RKW A;  4JX6 A;  1Z3X A;  5D6E A;  3K1P A;  1ZAO A;  4BXF A;  3DLA A;  4Y33 A;  3MEX A;  4Q5S F;  2HQR A;  2LH9 A;  4XK4 A;  1BOB A;  4RDJ A;  1KU9 A;  2HFH A;  5FIU A;  2H8R A;  2Z3Y A;  2YWF A;  4RD0 A;  2P7V B;  2JTV A;  3PUF A;  2A69 F;  4RGU A;  4DZP A;  4DQK A;  5DCM A;  4UZF A;  1KQ9 A;  2VXZ A;  4LBY A;  1BJA A;  1FEX A;  2B9S A;  3LQ6 A;  1G4D A;  1D5V A;  2CO5 A;  3DU5 A;  3CUQ A;  3O8H A;  2R7F A;  5J40 A;  2CH0 A;  3HJE A;  4HRI A;  2NV4 A;  2M45 A;  5GP9 A;  4YFO A;  2HDC A;  2ZZF A;  2UVE A;  1R5B A;  2GXA A;  2ZZQ A;  2X85 A;  4LIU A;  4MQ9 F;  5E1Z B;  4ZDP A;  1MBH A;  3RJP A;  1U78 A;  1N78 A;  2BSA A;  4D5C A;  1U9N A;  2R9V A;  1N25 A;  5E20 A;  1FTZ A;  1ACI A;  1QH0 A;  2R7O A;  1H42 A;  2AHO A;  4BBR J;  5HXB A;  1LKX A;  1VTN C;  4X0C A;  2EZI A;  1F43 A;  1D0Z A;  4YFN F;  2D5V A;  4XM3 A;  3W2H A;  4EJU A;  3WTZ A;  1E2X A;  2IEK A;  2M8G X;  4QPQ A;  1UEL B;  2VLA A;  1VHO A;  3ZRG A;  2Y9Z A;  3OYL A;  2CS3 A;  3JRF A;  3EUA A;  4Z06 A;  1WJ5 A;  4HE5 A;  1P4M A;  2JWT A;  1ZKG A;  5HDN A;  1IJE A;  1IA5 A;  1RMG A;  4PFP A;  4PJ0 C;  3K4N A;  3LAJ A;  1XC5 A;  2HMA A;  3A8I A;  1FWZ A;  2NTB A;  1RR7 A;  2CW7 A;  1EKE A;  4JX5 A;  5JBQ A;  2ESH A;  3EET A;  3AG3 H;  1XX5 A;  4V2G A;  3BG9 A;  4KKU A;  1K6Y A;  1H88 C;  3ONU A;  2KDO A;  1O8K A;  3T8R A;  3BZC A;  4P25 A;  2IRF G;  1KMH A;  1XSX A;  2YWE A;  2KRH A;  1V4R A;  3KYC B;  3A1Y A;  1XB2 A;  2BXY A;  2L9R A;  2VIX A;  4F7Z A;  1POG A;  2VBW A;  3MZY A;  4XKW A;  1B2R A;  2GK6 A;  2JRT A;  3GTG J;  1V5G A;  3CDI A;  1DPU A;  1TYW A;  5DN6 A;  4LJZ F;  2FRH A;  1RZ4 A;  3K4J A;  5K5R A;  1VND A;  3A3B A;  3F9K A;  3V7R A;  1H89 C;  5DV5 A;  2QBY A;  1AMO A;  2LD5 A;  1WU8 A;  4R1H A;  3V8J A;  4JP0 A;  1JJ8 C;  2LOO A;  3QOD A;  2HVS A;  2M8E A;  1TYX A;  1TWA J;  2Y31 A;  4WXH A;  5FRM A;  3VNU A;  1F1Z A;  1TNS A;  4X8I A;  4BY1 J;  3P27 A;  2JPB A;  1YYV A;  3GLL A;  1Y1W J;  4EW9 A;  2VFM A;  2WB1 A;  2IGK A;  5D8K B;  1TL8 A;  1QA1 A;  5ED4 A;  5EZG A;  4RB3 C;  3C2H A;  4Y52 J;  1K79 A;  2XAF A;  5GV8 A;  4YC5 A;  1WQ2 A;  3ASS A;  4NUB A;  4Y9R A;  3OS1 A;  3U2Q A;  3JCU C;  2E35 A;  3RSN A;  5EGO A;  1MIJ A;  1Z05 A;  1ULY A;  1XMK A;  3P9C A;  2HCJ B;  2QQA A;  3J81 K;  1Q9S A;  2QXZ A;  1T6S A;  1YOV B;  3BH4 A;  3V7A A;  1YIJ I;  3BTI A;  4QHY A;  4B43 A;  5C3E J;  4AVP A;  1Z6T A;  1ZQ3 P;  4BDZ A;  2D1V A;  4P5O A;  4XD7 A;  2BV6 A;  5F4O A;  4EGZ A;  2FBH A;  2VC0 A;  3J80 Z;  1FYM A;  4L0Y B;  1R23 A;  5CVV A;  1E79 A;  1WPC A;  2PJP A;  1ETW A;  2R5Z B;  2CRG A;  3T8T A;  1JT0 A;  1D1N A;  5FLV A;  1WH7 A;  4MTD A;  5E3L A;  1Y56 A;  2DDB A;  2FNP A;  1P4X A;  2UVF A;  2M5S A;  4RB2 C;  3Q6R A;  2Y0M A;  1WXR A;  1SD7 A;  1NG6 A;  2ZME A;  1R5N A;  1XD7 A;  3FXQ A;  4FIS A;  2ACJ A;  2K4J A;  2X6O A;  5TIS C;  5BSX A;  1T95 A;  1QX4 A;  3CC7 B;  2J5P A;  3L2C A;  4W8S A;  4U4B A;  3C18 A;  4A3D J;  5HLI A;  2WJY A;  2ELJ A;  4YIF A;  3EYI A;  4H9G A;  1AA7 A;  2K9N A;  4M3F A;  5E1W A;  3T0Y A;  1OYW A;  3G1O A;  3SKB A;  1XDU A;  4NQW B;  1XPX A;  4DYR A;  4LK0 F;  4GYI A;  2KZG A;  4EH1 A;  1HG8 A;  4Z4U A;  2O61 A;  3OKX A;  5E3N A;  2ELK A;  3DWL E;  4ZTJ A;  4ZDL A;  1LE8 A;  3JQP A;  4A2U A;  3GZ5 A;  1BBY A;  3K70 C;  2X0L A;  2JDI A;  4PJL A;  3CF5 F;  4ZCL A;  4IJA A;  1NK3 P;  4KA4 A;  1LNW A;  1DAB A;  1W35 A;  2WA0 A;  5DM7 F;  1NB9 A;  1R71 A;  4P2N A;  2JJ7 A;  1EV7 A;  2X1E A;  1O8D A;  2MFZ A;  1LM1 A;  4KYW A;  1G3T A;  3RDI A;  2AXL A;  1S72 B;  3OJW A;  1E63 A;  2VBV A;  2H1L A;  5LHG A;  2X1D A;  4K2E A;  4RGS A;  3QQA A;  1DDN A;  1VLO A;  1IRX A;  3ZGK A;  1Q1V A;  5E8G A;  1QNT A;  2NS8 A;  2MC4 A;  4ESF A;  3WTY C;  1R4N B;  4NNJ A;  4M9Z A;  3M7G A;  1G7S A;  4BBS J;  2NT9 A;  1E64 A;  2VBS A;  4HLY A;  2J7K A;  5EEA A;  1H8A C;  3R61 A;  2H1K A;  4L5I A;  2CBX A;  1MND A;  2WSS A;  2Y48 A;  3DXJ F;  5IYC J;  2XSJ C;  3KLN A;  5DD8 A;  1K8F A;  2KP6 A;  2QKM B;  1D1B A;  4C2L A;  3PUB A;  3WY9 A;  4LB5 A;  2G7H A;  2LBF A;  4I98 B;  1L3L A;  3BCB A;  2IS4 A;  1T6X A;  2L0K A;  4G8X A;  2C2W A;  4OJL A;  1Z91 A;  4I7H A;  4R71 A;  4RAF A;  3OZW A;  5IY5 H;  4A12 A;  2VNI A;  3HOZ J;  3B6A A;  3TED A;  2FUG 2;  4TKO B;  2FQ4 A;  5L3G A;  3H5R A;  1H8E A;  4X7C A;  3WGG A;  1KC8 D;  1Z7L A;  5FL7 A;  5JMC B;  4AU7 A;  2F4O B;  4GFB A;  2KIQ A;  5F0F A;  1WSV A;  1WOP A;  3AVV A;  2VN2 A;  2R93 J;  2Q8K A;  2OTL B;  1CNF A;  3COA C;  5E3O A;  3JRD A;  2FNA A;  3W2W A;  2NVT J;  5LGT A;  5KSW B;  3I53 A;  2O0W A;  3V8K A;  3T51 B;  2HDN B;  3ZPP A;  4JX4 A;  3TP0 A;  1UD2 A;  3HTS B;  1QUE A;  4BEH A;  4C9Y A;  3AK5 A;  3LWF A;  2V7F A;  4NK8 A;  1TVC A;  2XSD C;  4PC7 A;  2QBY B;  4BPR A;  3LA7 A;  4OP7 A;  4M9X A;  4Y15 A;  5KW9 A;  4EM0 B;  1PE9 A;  4RLF A;  2KFD A;  3P5J A;  4BGD A;  4V2F A;  1MMN A;  1ZUN B;  2V1N A;  3F23 A;  4OMY A;  2YR2 A;  1QGZ A;  2VFQ A;  1ZK8 A;  3W2G A;  1YJN B;  3BG6 A;  4F3Q A;  3K9T A;  5TGT A;  4WWC A;  3KEW A;  3HEF A;  3KZY A;  2ZFU A;  3B8H A;  4C30 A;  1J7K A;  2HU9 A;  1KD1 D;  2OJE D;  2F5V A;  2M87 A;  3JRE A;  1H0M A;  1UD8 A;  1RUN A;  2BZT A;  3J7A O;  3U9G A;  1R4M B;  3GVK A;  3IP4 B;  5EGO B;  2QWW A;  3CPX A;  4YZA A;  1NDH A;  4RM2 A;  2WPD A;  5F08 A;  3U1D A;  3TGN A;  1TW2 A;  3DCF A;  2VJ4 A;  2E7X A;  3E0J B;  3IUO A;  4X1E A;  4BAY A;  1IXC A;  4B47 A;  3CCL I;  5L3C A;  3KP7 A;  5F1R A;  1E3O C;  3S17 J;  1VLY A;  3HAG A;  3QFT A;  2JT1 A;  1WI9 A;  2WY7 Q;  2WC2 A;  3SJM A;  2VB6 A;  4M9S A;  2CFX A;  3SXY A;  4D7M A;  3K1M A;  2HYJ A;  4BXU A;  1LQ1 A;  3U1K A;  3I55 I;  2KMU A;  4UV9 A;  4XRS A;  2XGE A;  3VO2 A;  3MZH A;  2E2J J;  1GXP A;  5FO5 A;  4X7E A;  3DTE A;  5A2Q Z;  3ZBU A;  4UNO A;  2ZME B;  3V8L A;  1FOY A;  1FNC A;  2CQK A;  4NBQ A;  6PAX A;  1ERD A;  3UR3 C;  3G4S I;  1NBM A;  1N0V C;  1ZG3 A;  2A05 A;  1CZF A;  3PVD A;  2M1B A;  2QN6 A;  3BTJ A;  1O88 A;  1OCR H;  4DK0 A;  3PFI A;  3RQ4 A;  2WV0 A;  1CF7 A;  3OAA A;  4TV7 A;  2CU7 A;  4XLP F;  1BR1 A;  1DGW Y;  4E4H A;  2C5B A;  2VFN A;  4Z4T A;  3V76 A;  3CCR B;  4RLQ A;  1LFU P;  3IKT A;  2FEZ A;  3I4P A;  5JVT A;  5TJJ A;  2P6S A;  4XR6 A;  5ICC A;  4ANJ A;  2R7R A;  4H0E A;  4Y9U A;  3K69 A;  1LE8 B;  2GA2 A;  3LNN A;  3HTU A;  5D5U B;  2R7W A;  2FMY A;  1XB4 A;  3P4G A;  4CCO A;  5GTI C;  1Y0Y A;  2W24 A;  2MH2 A;  2OCC H;  4MFD A;  4A0Y A;  3S1M J;  4A3G J;  1VQO I;  1JJ2 B;  3KP6 A;  2O03 A;  3GVJ A;  2RDP A;  3FIS A;  3PL8 A;  2Y30 A;  4IZZ A;  1ELO A;  3U2R A;  1H85 A;  3ZPN A;  4L9N A;  3EYY A;  2QVO A;  3QU3 A;  1QQI A;  4ENM A;  2CUZ A;  1TZL A;  2X48 A;  1W5C C;  3LQR A;  5F64 A;  2P7C B;  1HZE A;  3BR3 A;  1JB9 A;  3SZE A;  3K0L A;  1X1B A;  3KEO A;  4A0Z A;  4CDG A;  3CTA A;  2I1L A;  4IO9 F;  4A3C J;  4KKT A;  3L9F A;  3GX4 X;  1VQ7 I;  4PC2 A;  1XGS A;  4UAJ A;  1X4P A;  4RBO A;  4TT3 A;  1Q86 D;  5D5V B;  5DD4 A;  3FJO A;  4W1U A;  2LNB A;  3OYB A;  2R7U A;  5LD2 C;  1X3Z B;  1CQT A;  1AKH A;  3LSM A;  4U0W A;  1SFO J;  3F6O A;  3ELK A;  3H5A A;  2ETH A;  1ZM2 A;  1ZM4 A;  2R4G A;  3QSY A;  3ESW B;  5HOD A;  4UUS A;  2DAO A;  2XB0 X;  1WPK A;  3WNC A;  2PLF A;  3F8C A;  2LBF B;  3QFR A;  2C77 A;  2L02 A;  1P6R A;  4YAU A;  4G7O F;  3VNV A;  3HL2 A;  4ROX A;  2GQF A;  1OFM A;  2UXX A;  4GGG A;  2KZV A;  2L5Q A;  5FD5 A;  3GTM J;  3A3G A;  3PET A;  1QFZ A;  2E1C A;  2E1B A;  2DMP A;  1OKR A;  3ZMD A;  4HF1 A;  3FHN A;  2CSO A;  1T39 A;  4XRS G;  3GQB A;  2ZKZ A;  5TR9 A;  2VI6 A;  1Z9C A;  4XMY A;  2K9Q A;  2H27 A;  2XAG A;  4OJP A;  2OUM A;  4UUT A;  2XTX A;  1KYW A;  3CJT B;  3E5U A;  1JHF A;  4MIM A;  1PP7 U;  1B6A A;  4BEH B;  4JYK A;  3ZQ7 A;  5JLX A;  4EJO A;  3GIR A;  5B6I A;  1S7O A;  4F93 B;  2OPT A;  4XL9 A;  4JRA C;  1KCD A;  3JUR A;  1D1A A;  2HI3 A;  1QRY A;  1I7P A;  3MHP A;  1A04 A;  1WRJ A;  2VNH A;  2XEX A;  4FET A;  1BR2 A;  2NPF A;  2B63 J;  4BYY A;  4G7H F;  4Z1M A;  2O8K A;  4M71 A;  4P3Y A;  1BLI A;  1WOO A;  1QVU A;  2Z99 A;  2DA6 A;  2OU2 A;  3ASN H;  4BKX A;  1GAQ A;  1VQN I;  2E1N A;  3A02 A;  3K4C A;  2DW4 A;  3OSF A;  3T53 B;  3MWM A;  2W85 A;  2DEU A;  1GVD A;  2FQ3 A;  3BWG A;  3D5R C;  4LIV A;  4UB6 C;  4Q48 A;  2DU9 A;  3CDH A;  1JJ6 C;  1TC3 C;  4O3M A;  5LFA A;  1WDT A;  5BNG A;  1Z1D A;  3S2H J;  2YU3 A;  3CRZ A;  1VQ8 B;  2LG4 A;  3IAM 2;  2IVM A;  1JHH A;  5TRD A;  1HW2 A;  3L2Q A;  2IOU G;  3CCM B;  4BJ6 C;  2WR8 A;  1B4A A;  2H09 A;  4JBA A;  3BC9 A;  4RDU A;  1XCB A;  1FZP B;  3KIO A;  3EPZ A;  4G94 A;  2ISY A;  4IF4 A;  2Y75 A;  2FBI A;  1IDY A;  4HAM A;  3LSP A;  4I01 A;  3MKW B;  5ILV A;  5EMN A;  3BH6 B;  3H92 A;  2X6W A;  3O6B B;  1SMY F;  2OF7 A;  2R7D A;  1IN6 A;  2DER A;  2F5F A;  3OIQ A;  2B0R A;  1XGN A;  3NWT A;  2W6J A;  4NB5 A;  4KKS A;  1K5C A;  3NB2 A;  1HBX G;  4P12 A;  2A5Y B;  5FGM A;  2HVR A;  4ZDO A;  3A1P A;  4IX7 A;  2AXT C;  2NXN B;  4IHV A;  1YX2 A;  3CB4 A;  1FNB A;  1YHQ B;  2NTP A;  5K7Z A;  3ABK H;  4PGH A;  5FKK A;  2JMW A;  2VQH A;  3PIO F;  2GRE A;  3C1D A;  3ASQ A;  1S7E A;  1A5J A;  1PYV A;  2LRE A;  3HGG A;  2EFP A;  1LEB A;  2L4M A;  2RAE A;  2CF4 A;  4Q7J B;  3F8N A;  2D3N A;  1LFP A;  2YSR A;  1GV5 A;  2E1M B;  3MMP A;  3VFZ A;  4NK6 A;  3M1E A;  5M3M J;  3GRH A;  1RPW A;  2VFP A;  2BM4 A;  2QLZ A;  1FYK A;  2PIA A;  3UW0 A;  2NAZ A;  3H3V K;  4MQV A;  3WOD F;  1KCC A;  2R0Q C;  3G6E I;  3ML3 A;  1V5E A;  3OZU A;  2BVN A;  1PJ5 A;  4PJM A;  2UUZ A;  1UHW A;  1QO0 D;  5EJC A;  4HW0 A;  4DJA A;  1OCT C;  1O8I A;  3KZZ A;  3RKX A;  3DEE A;  3HSR A;  1G7R A;  2O8X A;  3GTK J;  1K4Z A;  3CO6 C;  3J7Y J;  1UAA A;  4DNR B;  4XNF A;  5IOZ A;  1UG2 A;  4YFK F;  3PA1 A;  4MYU A;  3GTP J;  5BQT A;  2I10 A;  4HV6 A;  3PJR A;  3MD2 A;  2DMT A;  3FXO A;  4HV5 A;  2VKE A;  1FX7 A;  2BPO A;  3HOX J;  5IT9 K;  1EF4 A;  2KKO A;  1IB4 A;  2PEX A;  1Y0U A;  5AON A;  3JX8 A;  3RTR A;  2VT2 A;  1PVE A;  1WJA A;  5B3S H;  4YZQ A;  2EIL H;  4A3M J;  1MMG A;  4KIT B;  3H0G J;  3FXU A;  2JQ7 A;  4QUZ A;  3WBK A;  4FWT A;  5AMV A;  2JA2 A;  1YJ9 B;  3A0H C;  2W4S A;  2INV A;  1I27 A;  4IHY A;  1B9N A;  2L7K A;  4BH9 A;  1FND A;  2EFN A;  2JN9 A;  3F6V A;  1RNL A;  3G05 A;  1ZM9 A;  1Z21 A;  9ANT A;  4AIJ A;  1ENH A;  1W0J A;  3BQY A;  3CMA B;  1AKH B;  2VOO A;  4FT8 A;  3O8G A;  4I0A A;  4BU2 A;  4M53 A;  4LG3 A;  5DSZ A;  2YWH A;  1KK2 A;  4M4S A;  2D1H A;  1GQ8 A;  4OIR F;  4UUS B;  4PFO A;  1EH6 A;  3SY2 A;  4YAW A;  4ITV A;  4RDL A;  2PMH A;  5F27 A;  5GPA A;  4C43 A;  1PUF B;  4QLC U;  3FKS A;  4HNU A;  3LL7 A;  1IG7 A;  4WK8 F;  3SEQ A;  3WGI A;  2BGJ A;  4A6D A;  2QGG A;  3B82 A;  3BJO A;  4HOB A;  4W8R A;  4BQO A;  3GTJ J;  2BN4 A;  3OEE A;  4RLZ A;  5L3B A;  2STW A;  1HCR A;  4S04 A;  2RGV A;  3L2W A;  3H9N A;  1TWC J;  3VB2 A;  4RM3 A;  5DUI A;  5ILS A;  2V1X A;  2NST A;  3OIO A;  2B0L A;  4MYT A;  1ZYR F;  3O3K A;  5J35 A;  4ZYG A;  3VMW A;  1T0F C;  3RKQ A;  3ZMS A;  2WAQ A;  3KP5 A;  3S16 J;  2Y69 H;  4E7S A;  4ZZL A;  2ZXJ A;  2BF4 A;  2BOL A;  1SFK A;  2ZXW H;  5DDG A;  1IC8 A;  1UFM A;  2PMZ N;  4CCN A;  3ZQL A;  2QQB A;  1TWG J;  3BR2 A;  1DBG A;  1UB9 A;  1MW7 A;  3CC4 I;  1T6Y A;  1P4W A;  2DFF A;  1IRZ A;  3Q3S A;  5JHF A;  1IV8 A;  2DQR A;  3DDY A;  4HX7 A;  1SFU A;  3KET A;  4HSR A;  1AU7 A;  4IW3 B;  5AIP A;  4RPB A;  4KT5 C;  4E7Z A;  4DZJ A;  2K7L A;  2F4M B;  4ZZD A;  3WTT C;  2JJ2 A;  4IQJ A;  3QPS A;  3VWB A;  4PAA A;  3G3Z A;  2HOA A;  1VQ9 B;  1UMK A;  1O8J A;  2Z6B D;  2WZP P;  3CCY A;  1REP C;  4AUX A;  1BI1 A;  4Z4S A;  1FMV A;  3BR1 A;  5IP6 A;  1CQX A;  2L4A A;  2DMQ A;  3LA2 A;  3OEH A;  4BL0 B;  5M5Y J;  2KL4 A;  2LY1 A;  3FM3 A;  4RMN A;  5BPI A;  4A3E J;  2JZY A;  2ID3 A;  1ZG5 A;  3M3Y J;  1J9I A;  2L01 A;  1ETX A;  4B44 A;  3OYM A;  2D9R A;  3RYP A;  2ICW G;  1ITY A;  1WGX A;  4O6J A;  2Y9Y A;  2ZC2 A;  1J75 A;  1WJF A;  4I6Z A;  3DP7 A;  3WTU C;  1B8I A;  1XMX A;  3WTS C;  2IA1 A;  4D1Q A;  3G71 I;  3CO7 C;  3GQA A;  1D5Y A;  2L7Z A;  2VZL A;  2XPW A;  4CO8 A;  2ZL5 A;  2D3L A;  1ETO A;  3R60 A;  4MO7 A;  3GZ6 A;  2ZTG A;  3ZUG A;  2K9L A;  3QPH A;  2EZL A;  4OAZ A;  3CCJ I;  4A93 J;  1UD3 A;  3BG5 A;  3GQ8 A;  3CCL B;  3TQN A;  3C7J A;  2DFI A;  2P4W A;  2CC2 A;  2OA4 A;  2ZNY A;  2MH9 A;  2COM A;  3G2B A;  3AVU A;  3WBJ A;  1VQM B;  2Q2E A;  3J7A Y;  3E1S A;  4M74 A;  5FD6 A;  1A35 A;  1QGY A;  3OYG A;  1U3E M;  3CP2 A;  2E7W A;  2AHQ A;  3ES9 A;  2O0V A;  1GXQ A;  5HDK A;  3I55 B;  2HOE A;  1XTA A;  2BXZ A;  5FLX Z;  3ERE D;  2JUC A;  4AC0 A;  2MA3 A;  1EFR A;  2OZ6 A;  3BLY A;  5IYN A;  4Y17 A;  1LDK B;  2LKS A;  2IS2 A;  2GAU A;  1HVX A;  3GFM A;  3G4S B;  3I71 A;  3ZZ0 A;  1YI2 B;  3GZN B;  1YO5 C;  4WF2 A;  2MG4 A;  4YRV A;  1OLT A;  3CP8 A;  1MBE A;  4BHC A;  5FO1 A;  4C0S A;  3W2A A;  3B78 A;  4G1V A;  1OFD A;  4ZYH A;  2EFO A;  1BX1 A;  4EM1 A;  5FLM J;  2Z8G A;  4ETS A;  1AWC A;  2CQ7 A;  4EV0 A;  3FPK A;  4OJO A;  2WTE A;  4CZC A;  1JUS A;  1PJR A;  2BHZ A;  4G6T B;  2E1R A;  3K7A J;  4G7W A;  3DEW A;  4RD2 A;  3A01 A;  3CMY A;  2V7Q A;  1Z7U A;  1WHU A;  2V6E A;  3QYB A;  3GXO A;  3V7C A;  2VQL A;  4J19 A;  3CCS B;  4PGO A;  3VO1 A;  4MLO A;  4HE6 A;  1VQO B;  1RQR A;  4FXU A;  2KRF A;  2PLY A;  5E1X A;  1J59 A;  3PUM A;  5TV2 A;  4DYQ A;  1JKQ C;  4D9J A;  2O1D A;  2HYG D;  3BDD A;  2X0K A;  1GUU A;  1BR4 A;  2LFB A;  3OR1 C;  2XOK A;  4P3I A;  5KHD A;  2GXG A;  2W1O A;  2R7Q A;  5BPD A;  2R5Y B;  3FXL A;  3BZ6 A;  4KN4 X;  1Y0N A;  2DOD A;  1ZRD A;  3DQV C;  5JI6 A;  4FE7 A;  1P7J A;  4PUS A;  2Y0S A;  5JLV C;  2YU9 J;  3GFI A;  4LC0 A;  2V7X A;  3WTV C;  3DFG A;  2MD5 A;  4P1W A;  2ZIT A;  1HF0 A;  3TKY A;  3ZQG A;  4BS9 A;  1XFO A;  3R6J A;  3GLX A;  2QYU A;  1XN7 A;  1TUI A;  4U49 A;  2GIV A;  1QPI A;  5H5J A;  2DFH A;  3L09 A;  1E3X A;  4YZ0 A;  1YW7 A;  1DU0 A;  5C1E A;  4I2O A;  1FBS A;  1R5O A;  4OIO F;  5L3F A;  1MKM A;  1BHE A;  3CD6 I;  5E17 F;  3ZZT A;  3A2K A;  1IN8 A;  3HRT A;  2E2I J;  4XLN F;  1JTX A;  1LB2 A;  5KCM A;  1U2R A;  1NHC A;  1R7J A;  1U5T C;  4RAG A;  3F21 A;  4K1X A;  3NWS A;  3ZN0 A;  5LHI A;  3S32 A;  1I39 A;  4XN0 A;  3I4N J;  3OE7 A;  1PLU A;  1VQP B;  2XZL A;  2DTR A;  5CQE A;  2EV0 A;  4CA0 A;  3QE2 A;  4F7D A;  3P9K A;  1I18 A;  3EQN A;  2NVQ J;  3JAM K;  2QCO A;  1OYI A;  4M1K A;  1PP8 F;  3LSG A;  4XKC A;  4KFC A;  1MH4 A;  2LSO A;  5ICF A;  4CUG A;  4BE1 A;  1YRN B;  3PO3 J;  2J8K A;  3QYE A;  3WTX C;  4BE0 A;  2KHM A;  3OL3 A;  3JRG A;  4RPD A;  2L2O A;  3ZC3 A;  2BHY A;  4PJN A;  3CME I;  4M72 A;  4ZJZ A;  5D5X B;  4X06 A;  2VJJ A;  4NC6 A;  3BG7 A;  1SD6 A;  3RCO A;  3DPU A;  4KJZ A;  4PDK A;  2XT4 A;  1LFB A;  1R5I D;  4J01 A;  1YIO A;  4A69 C;  1JUM A;  1DDI A;  4YEI A;  4ESB A;  4P22 A;  4DK1 A;  1IUF A;  3R6S A;  2EFW A;  3W3C A;  2KT0 A;  3EUH A;  2Q6L A;  2FU4 A;  2VKH A;  5DNS A;  5JLW A;  3ROU A;  3ZQI A;  1VQN B;  2C4U A;  1I50 J;  2O5R A;  3EUK L;  4A3L J;  1C0W A;  5LRS A;  2VNK A;  2STT A;  2CQQ A;  2NT6 A;  3KP3 A;  1YS6 A;  2W6I A;  3ABU A;  1MBJ A;  3PM1 A;  4R8H A;  3U6B A;  2BY2 A;  4GYG A;  3J80 K;  1B8I B;  1PDN C;  3H9G A;  2VBU A;  1GV2 A;  2E1M C;  4JOM A;  3K10 A;  4LIT A;  4XKB A;  4U0V A;  2DOF A;  5F4J A;  2ZJR F;  4WZL A;  1ETY A;  3ASP A;  1Z6R A;  2HLD A;  1XG2 A;  1R5G A;  1YE9 A;  1I6H J;  1WSU A;  1LVA A;  3ZQC A;  1OQY A;  3K4M A;  3CLQ A;  1BQE A;  4ZTF A;  2Q2E B;  1EP3 B;  3QFC A;  2HOS A;  1S29 A;  2M7B A;  4YXW A;  5C1C A;  4M3E A;  3OJX A;  2DCE A;  4B3G A;  1TWH J;  4EJT A;  1XGM A;  4I0B A;  4CYD A;  1KA8 A;  3HOY J;  3ZZU A;  5EDN A;  2VBE A;  2W82 A;  3FBN B;  5FA6 A;  2VJ5 A;  3IH2 A;  4AM3 A;  1IXR C;  3KEQ A;  2XRN A;  2F43 A;  1B59 A;  4IL6 C;  2PMD A;  1W1W E;  2BMW A;  2O6G E;  3DPT A;  1OFL A;  5CDF A;  1DAR A;  1OGJ A;  4W8T A;  5C4J J;  3HRM A;  3BCF A;  3W5V A;  3IRQ A;  5DCM B;  5FNZ A;  3QPT A;  4F52 A;  4OOS A;  2UZK A;  5LGU A;  1W7P A;  2EQR A;  3K2Z A;  2JJ1 A;  3CUQ B;  3OW2 B;  3N6Z A;  3TL4 X;  2V1U A;  4OAY A;  4BE2 A;  1IRG A;  1T6Z A;  5ICE A;  2WYR A;  3PEN A;  2CRV A;  2XNJ A;  1VQK B;  1I1G A;  2CJJ A;  1X1D A;  3SYT A;  1W0K A;  2Z2S B;  3LAP A;  3AGQ A;  3W2V A;  1UG0 A;  3WNB A;  1LVK A;  4AWX B;  3FY3 A;  2G9W A;  3AVW A;  3A01 B;  3FDY A;  3JSO A;  4V19 K;  3OYJ A;  2LF8 A;  4G5G A;  1MNM C;  2X8K A;  2VQG A;  5D6F A;  4HDU A;  2BSP A;  2Q0O A;  2O04 A;  3L2V A;  5LBQ A;  1JTY A;  2V9K A;  2CMP A;  2P5K A;  1XSD A;  2OD5 A;  4LK1 F;  1QGP A;  1GHC A;  2YPR A;  4LD5 A;  3JRC A;  3K4B A;  2QY1 A;  2IQ7 A;  1MRZ A;  3PSF A;  3T5X A;  4KIF A;  1BC7 C;  2ZZG A;  4QPO A;  4OOV A;  2BW3 A;  4D5F A;  2CUE A;  3E6C C;  2YUH A;  1IHM A;  3H09 A;  2LY9 A;  3GFJ A;  5J6X A;  2LR8 A;  2EV5 A;  5IYB J;  3RZD J;  4ABZ A;  4WX9 A;  3GW2 A;  3ZMU A;  5IYP A;  2E5Z A;  4EMS A;  5HS8 A;  2LZJ A;  2JK3 A;  5L3E A;  1LLZ A;  2QDX A;  4DNT B;  1MNE A;  3Q3A A;  4II2 A;  5C44 J;  4X05 A;  3MMY B;  4F55 A;  1O3Q A;  2H6C A;  2OQR A;  4ON0 A;  4A5M A;  2XC7 A;  3I4M J;  4EVI A;  1HOM A;  2HZD A;  5CLS A;  3A35 A;  3RPQ A;  1LEA A;  2H8W A;  3DKY A;  1GVH A;  1XQB A;  1FX0 A;  2DCU A;  3Q39 A;  1YJW B;  2QKL B;  3D5L A;  4LGW A;  2M9H A;  4HDV A;  3S2W A;  3VOE A;  1MMS A;  4HNV A;  2QEX B;  3VMV A;  2QSF X;  1KQ8 A;  3WU2 C;  4E6K G;  1B72 A;  4M6Y A;  2H6B A;  2QA4 I;  5IYQ A;  1A6Q A;  3DKW A;  3DTK A;  2FA5 A;  3ABM H;  3KZI C;  3S1R J;  2O6W A;  2DA7 A;  2BVL A;  3F8M A;  3PA2 A;  4AYB A;  2P5V A;  2RKH A;  1UD4 A;  3CQZ J;  3H94 A;  3JQR A;  3HXL A;  1HXD A;  1R1V A;  1KK0 A;  3EDP A;  4ZYA A;  2K3F A;  3D5S C;  5FJ8 J;  2DPU A;  5THX A;  1ETV A;  1I3Q J;  2IW5 A;  2KLO A;  3H9J A;  3NAW A;  3V4G A;  1GT0 C;  3NAU A;  3HOU J;  4Y3O A;  3CC4 B;  3LMW A;  3ONQ A;  3FHZ A;  1MAB A;  3E5X A;  3I0T A;  4FHT A;  1LDJ A;  4UVA A;  1FTT A;  1K8A D;  1ZGW A;  3Q9S A;  1VQ4 I;  3FF5 A;  5FKN A;  2HQA A;  1QQ1 A;  3TMO A;  2NOG A;  3WE2 A;  1Q82 D;  1N05 A;  3BPX A;  3SEZ A;  4ZH4 F;  5AIQ A;  3Q5F A;  4MFE A;  5A8A A;  3DF8 A;  2JN6 A;  2X6X A;  2VT3 A;  2IBD A;  3CJR B;  1X19 A;  1GVJ A;  5M3F J;  2OTJ I;  5IYD J;  1OB5 A;  1LUJ B;  1IO2 A;  2K3P A;  1W0U A;  1OR7 C;  4P26 A;  1V54 H;  3VDX A;  1N77 A;  1BN5 A;  3NAR A;  2QQ8 A;  2LC2 A;  2D74 A;  1HSJ A;  2QMU A;  1IRF A;  1CNE A;  5AN9 A;  1STZ A;  1ON1 A;  2ZCW A;  5D5W B;  2XPV A;  1WJD A;  4EGY A;  1VF7 A;  2R6H A;  1TYU A;  2W7Z A;  1EA0 A;  5DTD A;  4B4D A;  4C2T A;  2WB1 N;  1RUO A;  3LFU A;  4U88 A;  1H9T A;  3BT9 A;  1KRH A;  2C78 A;  2RVC A;  2CK3 A;  1BI3 A;  1XCV A;  5D4R A;  5FKL A;  3ASR A;  5J3O A;  3AKZ A;  4OIP F;  1MBK A;  2XKP A;  4MNU A;  1PKV A;  2XF6 A;  2DYS H;  4A3F J;  3VSU A;  2ADU A;  1FJL A;  4HNT A;  4IHT A;  2HYF A;  3CCJ B;  4EJV A;  4XSZ F;  4HIZ A;  3JRB A;  1QPM A;  1WMR A;  2HEO A;  1T5E A;  2O0Y A;  4OPV A;  3CMM A;  3HHG A;  1DG1 G;  1WTH D;  4IVN A;  4L8J A;  3Q9V A;  2EIM H;  3HZJ A;  4M6X A;  4DBQ A;  2P5L C;  4A0X A;  4IHS A;  1FT9 A;  3PNT A;  2ZJ2 A;  3TO9 A;  1W7P B;  3TOB A;  5B1B H;  3IAS 2;  4LFU A;  1RQP A;  1VQ6 I;  1K9M D;  1SVL A;  4RS8 A;  1APL C;  2F3L A;  1FOK A;  3GEZ A;  4YEJ A;  4OPS A;  3MCZ A;  1BX0 A;  3LSR A;  4KIS A;  2GK7 A;  2ZB9 A;  4OWR B;  5L3D A;  5CVJ A;  4RJL A;  3S93 A;  2WY8 Q;  4QWQ A;  5EEG A;  1EXM A;  1B23 P;  3J7Z I;  4YDT A;  2GJR A;  3SUC A;  1V5F A;  1E3P A;  3REO A;  1WJB A;  4UVB A;  2DJN A;  4X0G A;  3E1Y E;  2QX3 A;  1XS9 A;  1R1U A;  4N9H A;  4ZGN B;  3F3X A;  1JT6 A;  3HG9 A;  3CCQ I;  1G7C A;  1NRK A;  2WJV A;  3CXC B;  3OMY A;  2E2H J;  1KU2 A;  1BW6 A;  4BDY A;  1W34 A;  2GIZ A;  5HLG A;  3Q0W A;  2F4N A;  2EIK H;  1KZH A;  2HPM A;  1SFE A;  2RC5 A;  5J47 A;  2DMN A;  1CGP A;  4KNY A;  4Z4Z A;  4C3J J;  1BJK A;  2BW3 B;  1FP2 A;  1FNM A;  2B7C A;  1VZ0 A;  3WG9 A;  5J1R A;  4F91 B;  4OJ6 A;  3S1Q J;  4Z05 A;  2P3M A;  1DUX C;  5K5O A;  3EQL F;  3W5U A;  1Q1H A;  1ZTR A;  2VBM A;  4RD1 A;  5KK1 A;  1YLO A;  1MSE C;  3SJZ A;  2XAQ A;  3OYE A;  1E43 A;  5J4Y A;  4CH7 A;  3G73 A;  1QA6 A;  2V4D A;  3A8K A;  2ZBU A;  3ZIA A;  3C2G A;  3OOU A;  3IWF A;  3M8E A;  4XQF A;  2ZTN A;  1ZGJ A;  4M3B A;  4HBL A;  3CCU I;  3JQQ A;  2GJP A;  2K86 A;  2NVX J;  3GUD A;  2WAF A;  1PJ7 A;  4X6A J;  1ZLJ A;  1IXS B;  5E6T A;  4CIC A;  3FZV A;  1B72 B;  1U0J A;  2L7F P;  5FKM A;  1R1T A;  2AO9 A;  3R4K A;  2B7E A;  2ECB A;  3QOP A;  3VYR B;  5M5X J;  4PSW A;  3CD6 B;  2DOG A;  2LK2 A;  2LDU A;  3I64 A;  1QUF A;  1X3W B;  3I59 A;  4G12 A;  2KIM A;  3QPL A;  4CCL A;  1L1I A;  2DK8 A;  1K4S A;  4J0Q A;  1FP1 D;  1K83 J;  3OYA A;  1TT5 B;  1TBX A;  3LNQ A;  5KVR A;  1A6I A;  1MDM A;  2ZBV A;  3OYI A;  3AFH A;  2CW0 F;  3B02 A;  3BZK A;  2GA1 A;  2M0M A;  2BM7 A;  1ZN2 A;  3A03 A;  3H35 A;  1BJZ A;  4FN5 A;  2Q1Z B;  2CQX A;  4UB8 C;  3RPU A;  2NRA C;  3QU6 A;  5F0C A;  5H6R A;  5IYW A;  2V7U A;  4E7H A;  2XAJ A;  1JUP A;  2DA5 A;  3OV8 A;  2XDV A;  2PE3 A;  3OPO A;  3OP1 A;  4RD3 A;  2IGO A;  1XGO A;  3T9G A;  2J5O A;  4ZV4 A;  2RNJ A;  3GTL J;  1K28 D;  3VOD A;  4KUM A;  3P7N A;  3I5U A;  3TOA A;  2DT6 A;  1NH3 A;  2XNC A;  1YIJ B;  2PN6 A;  4FCY A;  1IAW A;  4QVA A;  4V02 C;  2KQR A;  4Y13 A;  3FM5 A;  1Y39 A;  4EEF G;  4ASN A;  1SAX A;  1FSH A;  3UKG A;  2D45 A;  3CC7 I;  5LMZ A;  1JGS A;  2OAZ A;  4ACB A;  3FBI B;  1BC8 C;  2IPQ X;  1U9O A;  4RA2 A;  2V7T A;  1U8B A;  3F8F A;  2PMU A;  3HIF A;  4HF0 A;  3ECO A;  2QEN A;  4DNC A;  4UUV A;  4BQA A;  1O4X A;  2DDA A;  2L3D A;  1DBO A;  4Z4Y A;  1BIA A;  4PC3 A;  2KJB A;  2XGD A;  1CF7 B;  3TW6 A;  2M30 A;  4Z4W A;  4LLN A;  1F9N A;  1J2X A;  3QYF A;  2FOK A;  3S3O A;  1BPL A;  3PSZ A;  2ME6 A;  2XZO A;  2OV7 A;  1O8M A;  2L9S A;  1H80 A;  3FMQ A;  2E34 A;  4L9V A;  2ZJP F;  3D26 A;  3CUQ C;  2YUS A;  1R00 A;  2DJI A;  4ENJ A;  4BQN A;  1TSP A;  1WKM A;  4LMY A;  1O7L A;  2RC4 A;  1FIA A;  2DN0 A;  4EAT A;  3KP4 A;  1O7F A;  3I3L A;  2PI0 A;  1IW7 F;  3X2Q H;  2E19 A;  4I99 C;  1Z77 A;  1HLV A;  2R7X A;  5F6F A;  4L9J A;  1S72 I;  2BGI A;  1Y1V J;  3S3M A;  2F2E A;  2W00 A;  2RN7 A;  4TMX A;  2EK5 A;  2NVU B;  4G1B A;  2NVY J;  2DIE A;  1SD5 A;  1BA5 A;  5HNF A;  3L1P A;  3I54 A;  1RET A;  1FOW A;  1UST A;  2VJI A;  1VHE A;  1QVG B;  4LLL A;  1T08 B;  1QG0 A;  2QM3 A;  4UY8 I;  5ILU A;  4A3B J;  1QFY A;  4P9S A;  2VBK A;  2W25 A;  1RC9 A;  3LFK A;  3E7L A;  5JVG F;  5IT9 Z;  2BM1 A;  4PSX A;  2HVQ A;  2F1L A;  3ABL H;  2G0E A;  3VYU B;  2DY1 A;  1FDR A;  1TQP A;  2MYS A;  2ME0 A;  2YWG A;  1YIT I;  5CJ9 A;  1O57 A;  2LLK A;  2V6C A;  3WGH A;  2R7T A;  2P81 A;  3K4K A;  4NCN A;  3VMF A;  2WAE A;  2Z33 A;  4G6Q A;  4BHP A;  2F1M A;  4HLX A;  1Y0R A;  1YFH A;  2PBI A;  1WCM J;  2E5N A;  2F5E A;  2M34 A;  4HPQ A;  1EE6 A;  2HQN A;  1F20 A;  1T38 A;  1OFC X;  2VOP A;  2F6C A;  1IN4 A;  2B5O A;  3Q38 A;  4YFX F;  3DPL C;  1X4O A;  1XMA A;  1PXZ A;  5E18 F;  1QGA A;  1TNT A;  1HW5 A;  4L9T A;  4OIN F;  5IOY A;  2OTL I;  4MTE A;  3E6D A;  3KL9 A;  2XGX A;  5EG0 A;  4M3G A;  4L5E A;  1L0O C;  1X58 A;  1RR8 C;  1FSE A;  1Y8R B;  3KYD B;  2HXO A;  3SFI A;  4A3I J;  3RZO J;  2LKX A;  4GDF A;  1V5V A;  3M07 A;  3JRH A;  5IPA A;  1DU6 A;  2ELH A;  4U9U A;  1O8G A;  5HS9 A;  4BXX J;  5TY0 A;  2BE5 F;  3JTG A;  4IOA F;  1KQ5 A;  2A61 A;  4S05 A;  5KAI C;  5HKK A;  4HWV A;  2C6Y A;  5J8C A;  2RV8 A;  4G9Y A;  4XSX F;  1JTA A;  4FQG A;  2G7U A;  4BJ5 C;  2IS6 A;  2HXI A;  1GO2 A;  1R49 A;  1YJN I;  4YG2 F;  4TN1 A;  4A3K J;  1G59 A;  1EFU A;  3L00 A;  2XAS A;  2XPU A;  3D1N I;  3HM5 A;  2M0C A;  1W4M A;  1MMA A;  4OOX A;  1QZY A;  2DA4 A;  2VXD A;  5F4M A;  1H8H A;  2DK5 A;  3I59 B;  2DT7 B;  3CCE I;  1X2N A;  1FC3 A;  4I84 A;  1S3J A;  2R7V A;  1E1R A;  3EUH C;  1T56 A;  4Y7N J;  2N8G A;  2VUM J;  1SAN A;  2A6H F;  1WP6 A;  1MJA A;  5K5Q A;  4CSW A;  3W6K B;  4JQF A;  1MDM B;  2NS0 A;  4LBZ A;  1TTY A;  3R0J A;  1ODD A;  3SEJ A;  2XGJ A;  4W8Q A;  1ETK A;  2XT2 A;  1MD0 A;  1MJB A;  4IRI A;  4KDP A;  2K02 A;  2ZXH A;  3GO5 A;  4XOP A;  1YLF A;  4S0H B;  2IGM A;  1P7I A;  3OZV A;  4URR A;  2JA5 J;  3DEU A;  3QWL A;  4ACA A;  2ZME C;  2W48 A;  2DOA A;  2L9N A;  5LEK A;  3QAH A;  2AQE A;  2P0W A;  2VAS A;  1SMT A;  4QTR A;  3TW7 A;  1N8R D;  2R3S A;  1K78 A;  4A6E A;  3HPH A;  1O3R A;  4DIQ A;  2EIN H;  3FK7 A;  1KTV A;  2F5C A;  1IF1 A;  1EFC A;  2DLL A;  2KIF A;  3BJA A;  2R92 J;  1U6G A;  4YZX A;  1R9T J;  5FRO A;  3WWG A;  3W2F A;  4WZE A;  1O3T A;  5LRR A;  2PYG A;  1O8H A;  2HKX A;  3CCR I;  1IZ1 A;  2DI3 A;  1EH8 A;  3ZQF A;  1EZG A;  2IT0 A;  4WZK A;  2VKV A;  4YII A;  3MFK A;  3L2U A;  2X4H A;  4LG0 A;  5FLX K;  1M1K D;  4GRI A;  2Y2Z A;  3HHH A;  4DW6 A;  2LP0 A;  4KMF A;  2XB5 A;  1K6O A;  1F5T A;  5A88 A;  2DET A;  1JKP C;  4M73 A;  4WXD A;  4AIK A;  1SD4 A;  4N0B A;  1TQM A;  4GCV A;  3ZQH A;  4KIC A;  3MCA A;  3DTI A;  4M2L A;  2QQ9 A;  2DOE A;  3HBL A;  3F72 A;  3LQE A;  3PNV A;  3ERM A;  3WG7 H;  1W87 A;  2CV0 A;  2EPF A;  2O3F A;  3CUO A;  3LSK A;  5H20 A;  3LMM A;  1FYL A;  1W2B B;  1VBL A;  1R6R A;  5HZA A;  2GBY A;  3IH3 A;  3MQ0 A;  1WI3 A;  3QP6 A;  1ZHF A;  4OU0 A;  3LO8 A;  5FO0 A;  2XND A;  1EP1 B;  1TLH B;  3V42 A;  4DYC A;  2DYI A;  3ZSC A;  5B5E C;  1IJF A;  3Q0V A;  3DLL F;  2Q6O A;  4PK4 A;  1OGM X;  5EYR A;  1XSV A;  2ZNZ A;  1W7P D;  2IS1 A;  3P26 A;  4XLF A;  3FKI J;  1RIO H;  1VQ6 B;  2OZU A;  2WAD A;  5DEQ A;  1WOR A;  3AAF A;  1OB0 A;  2MLG A;  3ZCO A;  1JE8 A;  1VQ7 B;  1G2H A;  4YCQ A;  3L2R A;  1QVT A;  3IH4 A;  3KYL A;  4HQE A;  3QRF F;  2R7Z J;  3OS2 A;  4OPW A;  1MH3 A;  4CCJ A;  2MW8 A;  1D1C A;  1BI0 A;  4RD4 A;  4MR0 A;  2EIX A;  3VSK A;  1U8R A;  2V9V A;  2V79 A;  3M1C A;  2ECC A;  3GTO J;  3LSJ A;  1KZL A;  2ISZ A;  1WJE A;  3LYC A;  3JRA A;  3CCQ B;  1OFE A;  2QSG X;  1HDP A;  2X53 S;  1HKT A;  4RGX A;  1SFX A;  4QSH A;  1RKT A;  2XRL A;  4JK1 X;  2QGU A;  5EG0 B;  1VJS A;  3AL0 B;  1W9X A;  1HA3 A;  4O5V A;  5DS9 A;  3DU1 X;  1ON2 A;  2COB A;  2KDZ A;  2CUF A;  1K73 D;  1EA3 A;  2E1O A;  2W57 A;  2MLK A;  1BW5 A;  1G6N A;  2OCE A;  2QTL A;  1YW8 A;  1T33 A;  2MAB A;  4P1V A;  4OJ5 A;  2JA6 J;  3B4N A;  2VE8 A;  2CW5 A;  3Q6Q A;  2QSH X;  2IAI A;  1QHH D;  4XN3 A;  1DDG A;  2BM5 A;  5BOX A;  1ZAR A;  3CCV I;  4EQQ A;  2GPJ A;  4C3I J;  4KT6 A;  4HYE A;  1UJ8 A;  1VFC A;  3RI4 A;  1X1P A;  3ZOB A;  1T0F A; 
#chains in the Genus database with same CATH homology
 1UD4 A;  1BLI A;  3H94 A;  3HXL A;  1GLN A;  2UWM A;  4F92 B;  3K4C A;  2V26 A;  4ZYA A;  2JUG A;  3D5S C;  4CCK A;  3T53 B;  2CV1 A;  2KLO A;  3D5R C;  3H9J A;  3PFY A;  4LIV A;  1V0F A;  5HLT A;  4NC8 A;  5LFA A;  4Y3O A;  3OYF A;  1JI8 A;  3LMW A;  3ONQ A;  1MAB A;  2LG4 A;  2M3A A;  3IAM 2;  2QE7 A;  3H5N A;  4XON A;  2R7S A;  3L2Q A;  2HQA A;  3TMO A;  3FPP A;  4BJ6 C;  4E7L A;  3S8P A;  3BC9 A;  2KRC A;  3KX2 A;  4IQ4 A;  3SEZ A;  3EPZ A;  2HPI A;  1JRG A;  3MKW B;  2CW8 A;  2XZP A;  2NOJ B;  2X6X A;  2X6W A;  3CJR B;  1X19 A;  1D0Y A;  3WQZ A;  3OIQ A;  3NWT A;  2K3P A;  2W6J A;  1WFX A;  1OR7 C;  4KKS A;  2INU A;  3K4L A;  3VDX A;  2O17 A;  1K5C A;  1N77 A;  2HVR A;  4ASU A;  4ZDO A;  2LC2 A;  1X0C A;  4IX7 A;  3OYH A;  1QCX A;  2NTP A;  2PJR B;  1WJD A;  3LSH A;  3NE5 B;  1VF7 A;  1X1C A;  2VQH A;  1NG7 A;  3CZ6 A;  3KEY A;  4C2T A;  2CV2 A;  1IDK A;  3B90 A;  3M8J A;  3LFU A;  1PYV A;  2LRE A;  3OYN A;  4BQQ A;  2CK3 A;  1AIR A;  1TT0 A;  3AKZ A;  1ZEL A;  2HDW A;  2VPL A;  1LFP A;  2D3N A;  4C2U A;  2NSP A;  2E1M B;  2AQF A;  3OW7 A;  4NK6 A;  3GRH A;  1PKV A;  2XF6 A;  2VL8 A;  4Y4R A;  4B3F X;  1RU4 A;  3EQO A;  1E0E A;  3UW0 A;  3TBI A;  3VSU A;  2K9M A;  4HNT A;  5KNL A;  1KCC A;  2LYC A;  3VSL A;  1HA8 A;  1V5E A;  2BVM A;  2KPM A;  3A4C A;  4PJM A;  2UUZ A;  4XOT A;  4DJA A;  3HOS A;  4HIZ A;  1O8I A;  1WMR A;  2PYH A;  1T5E A;  3CMM A;  1Z3X A;  3DEE A;  4BXF A;  1WTH D;  4L8J A;  3DLA A;  3H9Q A;  4DBQ A;  4Y33 A;  4N4O B;  2LH9 A;  1BOB A;  1UAA A;  4DNR B;  2X1C A;  4XNF A;  2RQQ A;  3PNT A;  4B48 A;  3PJR A;  3MD2 A;  2VXZ A;  4GQN A;  1D0X A;  3IAS 2;  1IB4 A;  3DU5 A;  4YEJ A;  4HRI A;  3RTR A;  2CH0 A;  1RWR A;  1WJA A;  4KIS A;  5FRN A;  2W7N A;  2GK7 A;  2ZZF A;  4OWR B;  1MMG A;  4KIT B;  2UVE A;  2ZZQ A;  2X85 A;  4YZQ A;  2GOX B;  4LIU A;  3S93 A;  2WY8 Q;  4ZDP A;  5AMV A;  2JA2 A;  2GJR A;  1N78 A;  1V5F A;  2R9V A;  2W4S A;  2INV A;  1WJB A;  2R7O A;  4X0G A;  3OYD A;  4E0F A;  2L7K A;  2QX3 A;  1LKX A;  3HG9 A;  1NRK A;  1D0Z A;  2CUJ A;  2GJK A;  4XM3 A;  1Z21 A;  2WJV A;  3OMY A;  3G05 A;  4BDY A;  3FKJ A;  4QPQ A;  1W0J A;  1UEL B;  2VLA A;  3PNY A;  2HPM A;  3ZRG A;  3OYL A;  2CS3 A;  4BU2 A;  4LG3 A;  3EUA A;  4Z06 A;  1WJ5 A;  4DOZ A;  1GQ8 A;  2LY2 A;  1X1A A;  4PFO A;  2BW3 B;  1DP3 A;  4HG2 A;  4OJ6 A;  1VZ0 A;  2V31 A;  4F91 B;  4Z05 A;  4ITV A;  3K70 D;  1IA5 A;  5IK2 A;  4XKV A;  3CJQ B;  1RMG A;  4PFP A;  2A6T A;  3FKS A;  3K4N A;  4HNU A;  3LL7 A;  2NTB A;  2CW7 A;  2XF7 A;  3SEQ A;  2VBM A;  3OL4 A;  4W8R A;  1MMD A;  4BQO A;  3OEE A;  2V4D A;  2M4K A;  3OYE A;  4E7I A;  4CH7 A;  1K6Y A;  3L2W A;  1E43 A;  4KKU A;  2NZM A;  1E1Q A;  2KDO A;  4PMH A;  1O8K A;  4RM3 A;  3C2G A;  3ZIA A;  3OOU A;  2NST A;  3ZXS A;  1KMH A;  2KRH A;  4XQF A;  2ZTN A;  3A1Y A;  1T0F C;  3VMW A;  2LRD A;  2VIX A;  2WAQ A;  3N05 A;  4XKW A;  2GK6 A;  2GJP A;  4E7S A;  1V5G A;  2WAF A;  4N4N B;  5DN6 A;  2I8D A;  2BOL A;  1SFK A;  3K4J A;  3OWT A;  3A3B A;  3F9K A;  1U0J A;  4CCN A;  3SZG A;  2Z16 A;  4BAC A;  1KON A;  4AVZ A;  1MW7 A;  5CPR B;  4R79 A;  3GVL A;  4TSF A;  3VYR B;  2KVO A;  1DBG A;  2E60 A;  4PSW A;  5CKT A;  5JHF A;  2LOO A;  3QOD A;  2IXS A;  2HVS A;  3DDY A;  5FRM A;  4HSR A;  4E7Z A;  2JSP A;  4CCL A;  2JJ2 A;  4IQJ A;  3VWB A;  3HC7 A;  4EW9 A;  3HUG B;  2WB1 A;  3OYA A;  2IGK A;  3OYI A;  3AFH A;  3C2H A;  1O8J A;  2Z6B D;  4J00 A;  2WZP P;  1FMV A;  2EWE A;  2M0M A;  4NUB A;  3H35 A;  3OS1 A;  2Q1Z B;  3OEH A;  4BL0 B;  3RSN A;  4NC7 A;  2KL4 A;  2LY1 A;  4RMN A;  4E7H A;  3OPO A;  2XDV A;  1QHG A;  2QXZ A;  3BH4 A;  1IDJ A;  2IGO A;  1O8E A;  3T9G A;  3OFN A;  2JIZ A;  1V0E A;  4B43 A;  4B44 A;  3OYM A;  2X3H A;  1K28 D;  3OIP A;  4U7B A;  3CF2 A;  1UD5 A;  4BDZ A;  4P5O A;  4XD7 A;  1WJF A;  1OHH A;  2DT6 A;  1OGO X;  4D1Q A;  4B3X A;  2X51 A;  3HPG A;  1E79 A;  1WPC A;  3GQ7 A;  3GQA A;  2KQR A;  3RPU D;  2HNH A;  3VYS B;  2ZSI B;  3SDB A;  2D3L A;  3SUC A;  2ZTG A;  3FBI B;  3CES A;  1Y56 A;  2K9L A;  4OAZ A;  2UVF A;  2M5S A;  3GQ8 A;  1UD3 A;  1NG6 A;  1QU3 A;  3G2B A;  1DBO A;  1T95 A;  4W8S A;  3J7A Y;  3E1S A;  1S9H A;  4U4B A;  2WJY A;  4U87 A;  2ELJ A;  3OYG A;  3CP2 A;  1AA7 A;  3QYF A;  2O0V A;  3S3O A;  1BPL A;  3QOE A;  4NQW B;  2GOM A;  2XZO A;  3GBG A;  2OV7 A;  1EFR A;  1O8M A;  2L9S A;  1H80 A;  4UZU A;  3BLY A;  1HG8 A;  1LDK B;  2F4I A;  2IS2 A;  2DJI A;  3KRG A;  2WBM A;  4BQN A;  1HVX A;  3DWL E;  4ZTJ A;  4ZDL A;  4EAT A;  3OR2 C;  3I3L A;  4YRV A;  1OLT A;  3CP8 A;  3W2A A;  2R7X A;  1UD6 A;  3K70 C;  2JDI A;  4PJL A;  3S3M A;  2W00 A;  2Z8G A;  2DIE A;  3UNG C;  2WA0 A;  4YEL A;  4OJO A;  4Z03 A;  5HNF A;  4CZC A;  1PJR A;  2X1E A;  4G6T B;  2MFZ A;  1O8D A;  4G7W A;  2VJI A;  1YX3 A;  3BCD A;  3OY9 A;  2V7Q A;  4OZZ A;  4FAS D;  2VBK A;  1SAU A;  3VYT B;  3QYB A;  5HVQ C;  2X1D A;  2V6E A;  4PSX A;  2HVQ A;  3VST A;  2VQL A;  1IRX A;  3VYU B;  3HOT A;  2OC6 A;  3ZGK A;  4MLO A;  4FXU A;  2MYS A;  1E3Z A;  2MC4 A;  4NNJ A;  4D9J A;  3K6G A;  2O1D A;  2R7T A;  2NT9 A;  3K4K A;  1BR4 A;  3OR1 C;  2XOK A;  2ZXI A;  2WAE A;  5KHD A;  2W1O A;  2R7Q A;  2F1M A;  2PMZ A;  1MND A;  3OS0 A;  2WSS A;  2E5N A;  4HPQ A;  3JU4 A;  1EE6 A;  2XSJ C;  3DQV C;  2KP6 A;  2QKM B;  1D1B A;  4C2L A;  1G8X A;  4PUS A;  1Y6I A;  2Y0S A;  2F6C A;  3PUB A;  3ZQQ A;  2LBF A;  1QJV A;  3BCB A;  2IS4 A;  3MKZ A;  3DPL C;  1X4O A;  3AL0 C;  1COW A;  2JVG A;  4OJL A;  2MD0 A;  1PXZ A;  3OYC A;  4P1W A;  1Z3Y A;  5CQG A;  3OOC A;  4BS9 A;  2FUG 2;  4TKO B;  3H5R A;  4U49 A;  2XF5 A;  1H8E A;  1E3X A;  4YZ0 A;  5C1E A;  1Z7L A;  5FL7 A;  4AU7 A;  1BHE A;  4ZC3 A;  3A2K A;  4MXN A;  2M7A A;  3VR6 A;  2NTQ A;  4BJT A;  5KCM A;  3W2W A;  1NHC A;  2A5W A;  1O8G A;  2O0W A;  3T51 B;  3ZPP A;  3NWS A;  1UD2 A;  4HWV A;  5HKK A;  3S32 A;  4BEH A;  4XN0 A;  3DKX A;  3OE7 A;  1PLU A;  4C9Y A;  2V7F A;  2XZL A;  4NK8 A;  5CQE A;  4CA0 A;  1JTA A;  3EQN A;  1I18 A;  4BJ5 C;  2IS6 A;  3LSG A;  4XKC A;  2RRE A;  1G59 A;  4BE1 A;  4CUG A;  2RNG A;  3QYE A;  4BE0 A;  3T56 B;  2KHM A;  3OL3 A;  1PE9 A;  1MMA A;  1DGR M;  2L2O A;  4RLF A;  2VXD A;  4PJN A;  4BGD A;  1MMN A;  2DXI A;  2V1N A;  1H8H A;  2PEC A;  4ZJZ A;  1I8D A;  2CFO A;  2DT7 B;  2VJJ A;  3BG6 A;  3BG7 A;  1O8L A;  4F3Q A;  4I84 A;  2R7V A;  5TGT A;  1E1R A;  3EUH C;  3RCO A;  3KEW A;  3DPU A;  2ZFU A;  4KJZ A;  1WP6 A;  3GQ9 A;  4C30 A;  3HKZ A;  4PJJ A;  4CSW A;  4J01 A;  2VQC A;  4JQF A;  2HU9 A;  4XLC A;  2F5V A;  4P22 A;  1UD8 A;  2XGJ A;  4DK1 A;  4W8Q A;  3W3C A;  3GVK A;  2ZXH A;  3IP4 B;  4XOP A;  2VKH A;  4YZA A;  2IGM A;  4URR A;  1DQU A;  4RM2 A;  4HST A;  2WPD A;  1J09 A;  2ODL A;  3E0J B;  2O5R A;  2VJ4 A;  2DOA A;  1FMW A;  3EUK L;  2L9N A;  3IUO A;  4II3 A;  4B47 A;  1BMF A;  1VLY A;  3HAG A;  4G6I A;  2AQE A;  2ZSH B;  2NT6 A;  2P0W A;  2VAS A;  2W6I A;  2WY7 Q;  3ZR8 X;  2VB6 A;  3HPH A;  4DIQ A;  3H9G A;  3I9V 2;  2PJR A;  2E1M C;  4JOM A;  3K10 A;  2KMU A;  4LIT A;  4XKB A;  1WJC A;  4YZX A;  2HLD A;  5FRO A;  3DTE A;  3WWG A;  1XG2 A;  1YE9 A;  4JMQ A;  2PYG A;  1ERD A;  1NBM A;  3UR3 C;  1O8H A;  3K4M A;  3LSI A;  4DGW B;  1O8F A;  4ZTF A;  2Q2E B;  4YXW A;  2M7B A;  1CZF A;  5C1C A;  2DCE A;  4B3G A;  1O88 A;  4DK0 A;  2VBE A;  1KTW A;  3RQ4 A;  2W82 A;  1P9Q C;  3FBN B;  2VJ5 A;  3OAA A;  3L2U A;  1BR1 A;  1DGW Y;  4E4H A;  2F43 A;  4GRI A;  4RLQ A;  2XAU A;  2X6Y A;  4XR6 A;  4BUP A;  3DPT A;  4ANJ A;  2R7R A;  1OFL A;  1SKY B;  5CDF A;  4IKF A;  4W8T A;  3BCF A;  2Z1D A;  3DTI A;  4XLH A;  3LNN A;  3MKY B;  2R7W A;  4F52 A;  4CCO A;  2VKD A;  3PNV A;  1N75 A;  2JJ1 A;  2IGN A;  1OOC A;  3TL4 X;  3GVJ A;  4OAY A;  4BE2 A;  3PL8 A;  2CV0 A;  4IZZ A;  3LSK A;  1VBL A;  3B8Y A;  3LMM A;  1W0K A;  3ZPN A;  1X1D A;  3SYT A;  2Z2S B;  1R6R A;  4DBR A;  3W2V A;  1UG0 A;  2CUZ A;  1TZL A;  1LVK A;  3BCA A;  3FY3 A;  3DU6 A;  1HZE A;  3FDY A;  2XND A;  3OYJ A;  4HEA 2;  3V42 A;  1X1B A;  3ZSC A;  4KKT A;  2X8K A;  2VQG A;  4PK4 A;  1OGM X;  2BSP A;  1X4P A;  2O04 A;  1W36 C;  3L2V A;  4TT3 A;  2V9K A;  2IS1 A;  2CMP A;  4XLF A;  2WAD A;  3OYB A;  2R7U A;  5LD2 C;  1OB0 A;  3ZCO A;  3LSM A;  3L2R A;  3K4B A;  3KYL A;  3H5A A;  2IQ7 A;  2QY1 A;  4E7K A;  3PSF A;  3OS2 A;  2ZZG A;  4CCJ A;  2R4G A;  4MR0 A;  1D1C A;  1YX5 A;  4QPO A;  2M4G A;  2BW3 A;  2V4J C;  3VSK A;  3M1C A;  2LBF B;  1KZL A;  1WJE A;  3HL2 A;  2JVH A;  1OFM A;  2E5Z A;  2KZV A;  2LZJ A;  2L5Q A;  2X53 S;  2ZZE A;  4XLE A;  4G7X A;  3A3G A;  4DNT B;  1MNE A;  4II2 A;  2E1B A;  3MMY B;  4H4K C;  3OYK A;  4F55 A;  2K5C A;  2XC7 A;  3PSI A;  4E7J A;  3S3N A;  1W36 D;  3AL0 B;  1VJS A;  1W9X A;  3FHN A;  2HZD A;  4CCM A;  3U21 A;  3A35 A;  3DKY A;  3GQB A;  1FX0 A;  2QKL B;  3VSV A;  3D5L A;  4OZY A;  1BN8 A;  1EA3 A;  4XMY A;  4OJP A;  2OUM A;  4XLA A;  3VMV A;  4OJ5 A;  2MAB A;  4E6K G;  3BC8 A;  5HOO A;  3B4N A;  4BEH B;  4XOR A;  5HNH A;  3DTK A;  1QHH D;  4XN3 A;  4F93 B;  4XL9 A;  1KCD A;  2BVL A;  1D1A A;  3JUR A;  4AYB A;  2UV1 A;  4KT6 A;  3H0D A;  4FET A;  1BR2 A;  4Z1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...