4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
2UVFA 1HG8A 2QY1A 1QCXA 3ZSCA 1O8GA 2X85A 1PLUA 2ODLA 4OZYA 4MXNA 1O8FA 2QXZA 3VSUA 2X6YA 1DBGA 2QX3A 4XQFA 2X3HA 1O8JA 4OJPA 4AVZA 3GQAA 3GQ9A 1K5CA 4YELA 1PXZA 4XONA 4YZQA 4XN3A 3VMWA 4MR0A 4U49A 4OZZA 1GQ8A 2VBEA 3KRGA 1OOCA 4W8QA 1IDKA 1KCCA 3SUCA 4OJ6A 5C1EA 2O1DA 4XLEA 4W8RA 2UVEA 4HWVA 2VBMA 2PECA 2PYHA 2INVA 1KTWA 4Z03A 4XKWA 1O8HA 1QJVA 3GRHA 4XR6A 2NTQA 1OGOX 1IA5A 1OGMX 1DBOA 2NSPA 4PMHA 4XLCA 4NK8A 2VJJA 4Z06A 2INUA 1O8DA 2O17A 1BHEA 1IB4A 2X6XA 1XG2A 1OFMA 3EQOA 4XLAA 1RWRA 2IQ7A 4W8SA 1CZFA 4Z05A 2Z8GA 3EQNA 3LMWA 2VBKA 4OJOA 4XMYA 1H80A 4XLFA 1JRGA 2EWEA 4U4BA 2NT6A 4W8TA 3GQ8A 1O88A 4YZXA 4I84A 1O8EA 4YZAA 2X6WA 2BSPA 3GQ7A 1WMRA 2VJIA 2NTBA 4XLHA 4XL9A 4XORA 4XNFA 1RU4A 4C2LA 1EE6A 4NK6A 2PYGA 1AIRA 2NTPA 2NSTA 3VSVA 4XOTA 1IDJA 4OJ5A 1O8MA 1KCDA 1VBLA 3VSTA 4XOPA 3B8YA 4EW9A 3FY3A 3JURA 3WWGA 4YEJA 1RMGA 1OFLA 4XM3A 3VMVA 2NZMA 5AMVA 3UW0A 1O8LA 4XN0A 1X0CA 4OJLA 1O8IA 1O8KA 1BN8A 2O0WA 4XKVA 4YZ0A 3B90A 1PE9A 2NT9A 2O04A 3T9GA 2O0VA 3ZPPA 3B4NA 4URRA 5C1CA 1NHCA 1JTAA
chains in the Genus database with same CATH superfamily
4PABA 1JNYA 2VNHA 1GVDA 2EV0A 3KP5A 2NVUB 3MQ0A 3VDXA 2IS6A 1O8GA 2BM6A 2BGCA 2O7OA 1G3SA 3B02A 2H94A 2VJ5A 2M9HA 1EH8A 4BHBA 4Q4ZF 3KYLA 1WSUA 1VQ7B 4IHXA 5ILUA 1TVCA 3OYDA 1GVHA 2OK7A 2INUA 4AVZA 1I1SA 2KRFA 1PXZA 3E5QA 3LSPA 2R3SA 2E2HJ 2A61A 1T6XA 2CJJA 2K4JA 2DPDA 1CNFA 3ASRA 4AF7A 3HZJA 2VC0A 4DNCA 1BIBA 4HAMA 1PYVA 1J7KA 1WJBA 5IOYA 5D5WB 3MFKA 1QG0A 1TYWA 2LY9A 5BMZA 3K4NA 3G1LA 1W36C 1IDKA 2VT3A 3J7AY 1Z91A 2BW3A 2Y69H 1NDHA 4M0LA 4LIUA 2EZIA 3MZ8A 3WGIA 1M90D 3ZPLA 4DZJA 1WPKA 4A12A 4GFBA 1SFXA 4HWVA 3H0DA 2EA2A 3MVPA 1UJ8A 1JT0A 1U2WA 1E64A 5JLWA 2BV3A 1IJWC 3ISXA 4HV5A 3V7AA 2C78A 3AG3H 1AIPA 1HF0A 5TR9A 2DK8A 3FBNB 3PM1A 4Y7NJ 3FJOA 3L2RA 1R71A 1YHQI 3JRFA 5M5YJ 1ETYA 3HRUA 3CCUI 2CV1A 4UUSB 2ZJQF 3PJRA 2ISZA 2QE7A 1B23P 2C5BA 3H9JA 2NVQJ 1SD4A 4PJJA 3CCMI 4G9YA 4N9IA 2R5ZB 1I6HJ 2VNIA 3K10A 2E1MB 3CLOA 2OCEA 1MMSA 4PJNA 2XKPA 3HB9A 1JJ8C 4EMSA 4JMQA 3LMWA 1YJ9B 3GYHX 1Z6RA 1N78A 2LRDA 2QYUA 3N97A 2M34A 4RAZA 3CCLI 3LA3A 4ZTJA 1D1AA 3U9GA 1TTYA 2A68F 2Z3YA 1X2MA 3G71B 3E5XA 1OB0A 3OWTA 1ZG3A 4M3BA 3SEQA 4YIFA 1M1KD 1O88A 4HQMA 5AONA 4I0BA 3V7SA 1YJWI 2PLYA 3CD6B 3AAFA 2VUMJ 1YITI 2EIKH 1AKHB 4ENJA 2NTBA 4XORA 1QA2A 3I71A 4JOMA 3BR2A 4PGHA 1YW9A 2M45A 4IL6C 2P4WA 4IEJA 3QFCA 4ZZDA 4GQNA 3F9KA 2K3FA 4X0CA 3NAWA 1VJSA 3Q39A 2E2JJ 1K8FA 3A1YA 1X1DA 1N07A 1UG0A 4DBQA 4P25A 2TDXA 2DYRH 1IO2A 2LBFA 1GXPA 2L0KA 4NBQA 3JSPA 1HZEA 1K7AA 2GREA 4RDJA 3ABTA 1DU0A 3CDIA 2MABA 2HGCA 2ECCA 2QMUA 2HQNA 3WYAA 2OAZA 1UELB 2ISYA 3GW2A 3G3ZA 4XSZF 3H94A 4G1VA 1O57A 4B8XA 4ENKA 1FJLA 2Q6IA 2OF7A 4QHYA 3H35A 3A8KA 3RPUA 1YQAA 2DA5A 4W1UA 1IN7A 4XKVA 1U2RA 1WORA 2Y30A 4RD2A 4IHSA 4L0ZB 1YS6A 1GDTA 3OR1C 2B5OA 2JA2A 4EM0B 1ZLKA 3W5HA 3G2BA 3BZ6A 5EMNA 1JUMA 3EUHA 5K5RA 2HOAA 2OBSA 1R23A 1FPQA 4A3GJ 5DS0A 5CQGA 1XSXA 1LNWA 1OHHA 1H8EA 4WXDA 3O6BB 4FN5A 4WXCA 3REOA 1ZN2A 2E1RA 1Y0UA 4DZPA 5L3DA 2D3LA 4L9NA 2OBTA 2K9SA 2YWEA 1ZLJA 4YELA 2DODA 1DQUA 4XONA 4YZQA 1TWFJ 2COMA 2FMYA 1V5FA 2O5RA 3BTCA 3FF5A 1JTXA 5B6IA 3TDZC 3ZMTA 3JR9A 2J8KA 4IHVA 2X9DA 4IHTA 4M2LA 4F52A 2HVQA 2ESHA 4OIRF 3CCSI 3RKYA 2XUBA 2VBZA 1QUEA 1TYVA 2EH3A 1NJID 2HDCA 2ODLA 4A5NA 1BJKA 1DGWY 1X3WB 3BG6A 3I59B 3T56B 2BVLA 1YI2B 2QEXI 4BXUA 5CYVA 3H1CA 2KIMA 2PMZN 2KJCA 4X06A 3TP0A 1T56A 4AYBN 2EZLA 4EQQA 3F0CA 3NQOA 4A2UA 2A3SA 2KZGA 4A6EA 3ROUA 2FBIA 2MH2A 4L5JA 2GOMA 3FXMA 2HQAA 1WJDA 3I5UA 2STWA 5JLVC 1B72B 4WZKA 4IX7A 1A8PA 2YS9A 3LFUA 1TLLA 3AGQA 2V9KA 1H85A 1XC5A 4KDPA 2ADUA 2CYYA 1H88C 3H9GA 4FISA 4OOSA 3BT9A 1F60A 5CPRB 3LFKA 2QLZA 4X0GA 1VQ8B 2XGDA 1Z05A 5HXBA 2Z33A 3VR6A 1H8HA 1LUJB 5IT9Z 3S14J 3X2QH 5FD6A 1WI3A 3ASTA 1T0FC 1P4AA 1K61A 3Q38A 3Q0UA 2HWVA 2E1NA 2QA4I 1R5GA 2LF8A 3TEDA 4OIPF 2L7ZA 2VXZA 3OYCA 2PYGA 4XIDA 2NTPA 3VSVA 3BNWA 2C6YA 3OYFA 2BE5F 3L2UA 2WWYA 1QX4A 5KW9A 2QKLB 3S32A 4R79A 1P92A 3KP6A 3BWGA 1RIOH 3D5SC 4BE2A 1VQMI 2CG4A 2XPVA 5EEAA 3I56B 3RZOJ 2Z1DA 2XRNA 3QWLA 4QUZA 3WODF 1JHHA 4TMZA 2BF4A 5AMVA 2CO5A 4OINF 4BBRJ 5J40A 1FNDA 2LTPA 1WVRA 2V6EA 2JA8J 2JIZA 5FNZA 3H9QA 2W00A 1CQTA 4LG0A 3SEZA 3A0BC 1GV5A 1WWXA 5JLXA 4EJVA 2WJYA 1TNTA 4XKBA 4NB5A 3TP3A 4TMTA 2IJLA 3DTIA 3BG9A 3GQBA 3HG9A 1FNNA 2HPMA 3HYIA 4A69C 1HA3A 3KL9A 1Y56A 4I98B 2NAZA 3P4GA 5C1CA 1FP1D 1NHCA 1SAUA 1K4SA 4KJZA 1LJ9A 1KYZA 3ML6A 2DJIA 4P96A 1PP7U 1KU3A 4UV9A 4IZZA 2ZJPF 5BSXA 4EJWA 1N0UA 3W2HA 1BQEA 1HKQA 4Q5SF 4M9ZA 2BY3A 3GZNB 3CCQI 1R4NB 1R5BA 2HLDA 1XGMA 3O2PE 1VQ5I 1R00A 3VSUA 2X6YA 1YYVA 1R5NA 2EV6A 4IXAA 4OOXA 3CJNA 3ZQQA 2E7XA 4UNOA 3F8BA 4AWXB 5DYMA 4MQ9F 2CQKA 2JWTA 4ABZA 1VQKB 2E1BA 2WZPP 3H5RA 1SVLA 4LD5A 4NHJA 4A3BJ 1LLWA 1FMWA 1AU7A 3SLDA 1Z21A 2EINH 2H8WA 4ZTFA 2EBIA 4Y3OA 1OCPA 5HS7A 3T51B 2BY1A 2D1HA 5H2FC 1V0FA 1P4WA 3LJYA 5L3CA 2V7WA 5J1RA 3CMYA 3OJWA 4PC1A 1Z7LA 2NVYJ 3H36A 5GPAA 5DS9A 3K70C 1K78B 2GXAA 3BH4A 3PNYA 1UMQA 1OGOX 1N25A 1D8TA 3NRVA 4BPRA 4WWCA 1V5EA 5J4YA 2YX7A 1ZRDA 1VHEA 2CNDA 1PP8F 2ZZGA 2M3AA 5M3MJ 2VKEA 1IXSB 1QPIA 1SD7A 2AHOA 2QQBA 2PE3A 4WF2A 2P5KA 3LAPA 4FWTA 4DGWB 3CF2A 1BHEA 2FNPA 3OOUA 3SJMA 4M53A 3ZMDA 4HDUA 4LBWA 5GV8A 2CUJA 2QF7A 2CSOA 5D6FA 4MGRA 2HXOA 4JK1X 4Z05A 2DDAA 3F6OA 1YIJI 3BTIA 3FM5A 4AF6A 1R9TJ 4OJOA 3WTYC 1YLOA 4A0ZA 1Z77A 5K1YA 4XRFA 4CSWA 2DYIA 1HKTA 4BU2A 2YSRA 3LQEA 4W8TA 2M5WA 2C77A 3W6KB 1VQ6I 2XEXA 4U88A 4XRSG 5TRDA 3R6JA 5DSZA 3GQ8A 4I84A 2P8TA 3U6KA 4ANJA 3SYTA 1HXDA 3HUGA 3FMRA 5DCMB 2M7AA 2VQLA 3PA2A 4FXUA 3CCJB 2QGGA 4TMXA 3P5JA 3J81Z 4FX0A 1RETA 2JA6J 3HDDA 4WZLA 3C18A 4AIKA 1EP1B 5BNGA 4NK6A 2H8RA 3OYGA 2G9WA 1PVEA 4X7DA 1S7EA 3TBIA 2ZXHA 4UZUA 3VSTA 5F4OA 4XOPA 3KFWX 2J7KA 1EV7A 4P6VF 3NWTA 1VQLB 4YG2F 1TNSA 3JQQA 1FY7A 2JSPA 1KZHA 3WE3A 2L02A 5GAGJ 1TQPA 1VQ7I 2KPMA 1S3JA 3JU4A 4HE6A 2XAJA 4YAOA 3QPTA 5HLTA 4R71A 4UVAA 3WTUC 3C1DA 2QM3A 4GRIA 1FX0A 1YIOA 1BW6A 3T9GA 2R5YA 4P26A 5D5XB 4B3FX 3Q9SA 1W5SA 3D0SA 2JUGA 2A07F 1G7TA 4IRGA 5LD2C 1OR7C 1RKTA 4P2NA 2UVFA 3L7WA 3U1KA 1EFUA 2K3PA 3CJTB 4GO1A 1Q1HA 4QIWN 5L3BA 5CVRA 4NQWA 1O8FA 3IL2A 1QGZA 4Q47A 2E19A 1PUEE 5M5XJ 1JUSA 4N0BA 3Q0WA 1MBEA 1EFRA 4C3IJ 2ZL5A 4NUBA 2D74A 3U21A 1FBQA 2V1DA 3OIOA 1BI0A 2ZFUA 2L9RA 1KK0A 1P7IA 3BTLA 3AVUA 2R7QA 3OV8A 2W84A 3AVWA 2GXGA 3K1NA 2ELJA 4PDKA 2R7TA 1B2RA 1JB9A 3A1PA 5JVTA 4UZFA 3DKXA 2F48A 4JX5A 3A01A 1G3TA 2K86A 1D3YA 4OJ6A 2Y9YA 4PC6A 2YUHA 4ZYHA 1LE8A 3VYUB 3A3BA 2VPLA 1OYWA 3OYIA 3IUOA 4U7DA 4OWRB 3RY8A 4I01A 1D8KA 6PAXA 3QP6A 1YJ9I 2O6GE 3P26A 3BH6B 3SQNA 4A3JJ 2VQCA 3HKZN 5FO5A 4M6XA 5LHHA 2IS2A 1U6GA 1IA5A 3I0TA 3WBKA 3ECHA 2X4HA 1SKQA 3CD6I 2VJJA 4Z06A 2QBYA 2FMLA 3HTSB 3B82A 1OISA 1IRFA 3F8MA 3C2BA 3BC9A 4W97A 1XG2A 1B9MA 4CYCB 2VFQA 4IRHA 5KCMA 3OS2A 1HDDC 3AVXA 2VFOA 2IVMA 1UD8A 1VI0A 1MDMB 1SFEA 3O8GA 2YR2A 3H0GJ 3K6GA 4LGWA 3ABLH 2RKHA 2VB6A 4U87A 3PUMA 1D5VA 1J2XA 5EYRA 1BA5A 1IDZA 3BJAA 3HXLA 1JKOC 5FLXK 3ZMZA 4KKSA 5GP9A 1AWCA 1COWA 2XKOA 1IN6A 3HGYA 1QFZA 3HKZA 2FVGA 3CXCB 4LMYA 1WTHD 4DNTB 1YE9A 1QVFB 2DT6A 1I50J 3PUFA 1O8MA 1KCDA 3HAGA 4UUSA 3QPHA 1PUFB 3L2WA 5J8CA 2NOJB 1FOYA 2DBBA 3WBJA 4XRMA 2ZXJA 3BG7A 3RKWA 4V2GA 2R5ZA 1BX1A 2IS4A 3U1DA 2KJBA 1DU6A 1DDIA 1ZGJA 2K9MA 2A69F 1AA7A 2HS5A 5F27A 1NRKA 4X05A 1PJRA 1MJBA 1XD7A 3EDPA 1C0WA 2XC1A 3WY9A 3BG5A 4TN1A 1R5ID 3CCYA 2RNJA 3MAJA 5HOOA 1O8KA 2O0WA 1W35A 3L2VA 2D9RA 1QVGB 5FKLA 4LLLA 2NT9A 4DJAA 4BGDA 3IH2A 1KMHA 4MNUA 4BY7J 2GJRA 3HOUJ 2VBVA 3DBRB 3ZZUA 1Y8RB 1IHMA 1K73D 3TH0A 4Z1MA 2CQQA 2F3LA 3CO6C 1Q86D 2KDOA 1R7JA 5J47A 4ZYDA 1KA8A 5E18F 4OZYA 3A4CA 4ENNA 3DCFA 3OFNA 1Q82D 1W9XA 3PNTA 2DU9A 2BY0A 1GHCA 3P27A 1YI2I 2EFPA 4DYQA 3ERED 2GJKA 2Y0MA 2YWFA 3KP2A 4C2UA 2BM7A 2ID6A 5K7ZA 4QVAA 4UVBA 3VMWA 2WY8Q 4MFDA 5JHUA 2V7TA 2KVOA 3Q6RA 3PSZA 2M0MA 1FIAA 1QFJA 2V1UA 4RB2C 2E1OA 4M1KA 2BHZA 2ZBKA 1IV8A 3K4MA 1Y6IA 3V8JA 2UVEA 4L5IA 5HDNA 5THXA 1UD2A 1O8HA 4EJUA 5CVVA 2ZNYA 1H42A 2H1LA 1T08B 2L7KA 4XR6A 4Z2YA 2IW5A 1RUNA 1DDGA 1E79A 1W0KA 5EGOA 3HBLA 2FU4A 2OZ6A 1VQ8I 1RRJA 4PCQA 5E3NA 1ZUNB 5TY0A 4A6DA 4A3CJ 2DMPA 3W2GA 4CZCA 3BJ6A 1ZYRF 2CUFA 5J6XA 3O8HA 3VNVA 3D5LA 2ME6A 4E70A 3GVLA 3BTJA 1RESA 3V42A 3QOEA 2R7XA 5TV2A 3K7AJ 3F21A 1AOYA 2IQ7A 1BR1A 1DDNA 2IA2A 3JW4A 3ZZTA 3OYLA 4G12A 1ZG1A 4C2TA 1WOPA 4WWVA 2L3DA 2EWEA 3CJRB 1WP6A 3ONUA 1XN7A 4RDKA 1T33A 3ESWB 3LSGA 4ETSA 2RREA 3I56I 4YZAA 3ZIAA 1WOOA 2V7XA 4A3MJ 4RPBA 2ZFWA 3PUNA 1EA3A 3DEEA 1S6LA 1GT0C 1MJAA 4DBRA 3WTZA 5DM7F 1Z6TA 3HRSA 4H4KC 2DLLA 5B1BH 4BNCA 1JA1A 1EFTA 2E71A 3GMEA 3I3LA 1D0XA 2HXIA 1S7OA 4KT5C 4BH9A 3D5RC 4YAUA 1ZR2A 4IJAA 1IDJA 4WX9A 4I76A 2CQXA 1NH3A 5EG0B 3BPXA 4D7MA 2W57A 1GJRA 4M6VA 5JHFA 2VOOA 2MSYA 3DEUA 3QU6A 3BQJA 3R0JA 1F5TA 4A93J 3M07A 2LMDA 1O3SA 3HJEA 3WU2C 2DDBA 2V79A 3DU5A 3FHZA 3JRHA 2A6TA 4LBYA 4RLFA 3W2VA 2CMPA 1T6SA 1ON1A 3BROA 4DYRA 4EATA 1Z3XA 2ZSIB 1SFOJ 2TRTA 3KEQA 4A0XA 3QPLA 4XBFA 5BOXA 3WGHA 4YZ0A 2UXNA 1GR1A 2LOOA 1DPRA 3VYRB 4BEHB 1MMDA 2F2EA 1VQKI 5B66C 3UKGA 4BS9A 3CCRB 2HQRA 2O9LA 4TMWA 1T39A 1AHDP 4RA2A 1QGAA 3AG4H 1I5ZA 5HZBA 1WOSA 2R4GA 1IRZA 2LY2A 1PLUA 4BAYA 2B7BA 1FP2A 3GZ6A 2FEZA 1SAXA 2QX3A 2QSGX 3GCMA 1LEAA 5FRNA 5KSWB 4IW3B 4HNUA 4QFMA 4D7NA 4X6AJ 3ZQ7A 2KP6A 4XN3A 1WKMA 2GWRA 4P5OA 1EXMA 2V31A 3RIRA 4M3EA 2Q8KA 4Z4YA 3GO5A 4NC6A 4HA8A 2PJRA 4FCYA 5E3LA 4YHBA 3OYNA 1MD0A 2WB1N 3B78A 4IRIA 1VQ9B 3J80K 3ZBUA 2FX3A 1HVXA 2IA0A 2K9QA 3GTGJ 4EH1A 3E6MA 1Y0NA 5F0FA 2XB0X 3VYSB 2PECA 1FBSA 2HEOA 2I5UA 4BBSJ 1QZYA 2ZZEA 4XSXF 1ZREA 1P7JA 4FX4A 2DOEA 1FTTA 2KT0A 4PAAA 4XD7A 3CP8A 4UXNA 3GTKJ 4PC2A 1XMKA 2KDZA 4ZGNB 3PENA 1UD5A 2RVCA 2KQRA 3CUQB 2NSPA 2ME0A 2W1OA 5HLIA 4ZYGA 1WH7A 2V4DA 1S8NA 2AO9A 2QWWA 2BVNA 2OU2A 1OCOH 3MZHA 2K4BA 3CCJI 5GAEJ 1TC3C 4G7WA 3QYFA 5D5UB 1Q7YD 4XLAA 3J7ZI 3QPSA 2XAQA 3OL4A 4W8SA 1FYLA 3ULQB 3COAC 2VBKA 2HTSA 3DWLE 1H80A 3F8CA 3JCUC 3W2WA 4CCJA 2JT1A 2V7QA 3AG1H 2L2OA 2O8KA 4M73A 3VSLA 2WB1A 1XDSA 4U0VA 4CICA 1VQLI 1Z0XA 3T5XA 1T6YA 2Q6OA 4PC3A 4OIOF 3OY9A 2E7WA 3GQ7A 1H0MA 1B1BA 2KISA 2LNBA 4GCVA 3PQJA 4M6YA 3TW6A 1K78A 1D0YA 2OTJB 5E3OA 1YRNB 3EUHC 1EE6A 1A5JA 3EUKL 3MKLA 3JSOA 4CGZA 4S05A 3QE2A 3V76A 5FFXA 3P9IA 3G4SB 4I2OA 4BY1J 4OJ5A 5FKNA 1XQBA 1RQRA 4PSWA 3T0YA 5IYPA 5F1RA 4YIRX 2XASA 3FK7A 3HOSA 3MCAA 1WRJA 2H27A 1ZARA 3G1MA 1QBJA 3TO9A 3W2AA 2HU9A 5D5VB 3C7JA 4G94A 1EZGA 3FK6A 4BQAA 4RB0A 2NZMA 3SJPA 2STTA 4A3EJ 3BP8A 5B5EC 1EP2B 4KNYA 1BR2A 3AVYA 1W0TA 3FM3A 3HSFA 2YU9J 4YC5A 2P5VA 2UZKA 1DUXC 4O3MA 3DPLC 1BC7C 2ACJA 1XMAA 4X7FA 4UUTA 4LC0A 2BYVE 5FLVA 2ZO4A 3I58A 2QENA 2QKMB 3VNUA 1Y0RA 1MNMC 4IQ4A 2X85A 1RKWA 4CYDA 3GF2A 1F43A 2ZL7A 4WCGA 1FTZA 2DJNA 3GLLA 2O0YA 2WV1A 4UY8I 3A8IA 4B3AA 3KZZA 4G7OF 1JKPC 4OJPA 5GTHC 1KU9A 3SHFA 2GPJA 1A31A 4DQKA 2A05A 3SZGA 2CV0A 2CWEA 2LD5A 2J5OA 1BI1A 5FA6A 1ETKA 3B73A 2JJ2A 3BR3A 2VKVA 2EB7A 4B3GA 2VBEA 4YFNF 5E8IA 1R5HA 2RQQA 3S15J 4UV8A 2WSSA 3QU3A 2HVSA 2WPDA 4XLEA 2DOFA 2MC4A 3OW2B 4P9UA 2GQFA 1REPC 1S29A 3MZYA 3FXRA 2QGUA 3GRHA 3A02A 2VODA 3VB2A 3LSRA 4AVPA 1IN4A 1TWGJ 1KQ9A 5C3EJ 2XGEA 1XPXA 3MD2A 2QTLA 5EF6A 1POGA 2EZHA 2E1CA 1JGGA 3LWFA 3RTRA 4X7EA 3RIQA 2CK3A 4KKTA 1CGPA 4OAZA 2OCCH 2X48A 1XE1A 4DQ2A 5TISC 4P6YA 2HOTA 1P4XA 3OW7A 2WC2A 3BC8A 2FBHA 2NNNA 3MEXA 4CCMA 5CDFA 3E6DA 3QP5A 4UB6C 2GQQA 5FO0A 1FBUA 4IQJA 3BCBA 1HC8A 5FJ8J 2PLFA 1IXCA 3CMAB 3QYBA 1GVJA 3T1BA 3JREA 3K4CA 1WJAA 1NK2P 4TMVA 2OC6A 5IP6A 2IRFG 2X8KA 2EQRA 3ZR8X 2MA3A 1XS9A 2JJ1A 4QSHA 2ZXIA 2Y75A 1JKQC 2ZITA 4L8JA 1IRGA 2R93J 1O7LA 3V8LA 3PO3J 1G4DA 5HNHA 2WY7Q 1RU4A 1HLVA 3C2HA 4RDLA 2KKOA 4RLQA 3RQIA 2OZUA 3WHBA 4M72A 3WNCA 4II2A 4RCYA 2QQ8A 3OMYA 1MBHA 3BZCA 2DOAA 2VFNA 5BPDA 3LSMA 3HGGA 1YW8A 5LLQA 2GK6A 1OMIA 1QH0A 4EW9A 1A04A 3FZVA 4EJTA 2D1VA 4YEJA 1E43A 5HNFA 1KK3A 5H6RA 3A8JA 4CYCA 1RZ4A 2VQGA 2ZKZA 4IF4A 4FHTA 1Y1VJ 4F91B 2FUG2 4E7SA 1LLZA 1N8RD 1FOXA 4X07A 3BR1A 4I99C 5L46A 1TTTA 1MDMA 1WQ2A 1ETQA 3TKYA 1MNEA 4OP7A 4LB5A 2BX6A 2XTWA 2WAQA 1XB4A 4PJMA 1SMTA 3JTGA 3ZMVA 1ETOA 2OJED 3ZQCA 5KK1A 2RAEA 2G7UA 2VL8A 4KISA 3LVBA 2X0LA 1X1CA 2E5ZA 1ETWA 2R7OA 2L54A 2VZLA 4F92B 5J3LA 3L2QA 2IGOA 1FX7A 2NV4A 4MYUA 3LMMA 4FT8A 5EZHA 1U5TA 2VBTA 1KJZA 3M4OJ 1DGRM 1DP3A 3AVTA 2HI3A 1E3OC 1IB0A 3DEWA 2DYSH 2RC4A 1QO0D 1OFCX 4KN7X 3K9TA 1W87A 2XPUA 3P7NA 3ZZ0A 3IRQA 2QQAA 5H59A 3I54A 4KIFA 3CDLA 2CS3A 1JGSA 2NVXJ 3CPWB 1R1UA 5BSYA 1IDYA 4DYCA 3AGPA 2F5EA 2IGKA 5L3FA 1ZM3A 1M1EB 3CC7B 2CGPA 1SFUA 1KQ5A 1K6YA 1UAAA 2BVMA 5C1EA 4MYTA 3TO6A 2XTXA 3KP7A 4YXWA 4J00A 1WXRA 2JK3A 3H5NA 4ZJZA 3Q5FA 3TDUC 1O3TA 1U9NA 1K6OA 3QFSA 1YTYA 2DO7A 2GAUA 4LITA 4Z03A 1R22A 4ZCMA 2XT2A 2L4MA 2KLOA 3NEUA 2E2IJ 4BKXA 1ENHA 1YO5C 2DXIA 2NTQA 2I1LA 1J9ZA 3IKVA 2TCTA 4M3GA 4MLOA 2W7NA 1BOBA 4E0FA 3NE5B 2L01A 4EM1A 2PFBA 1WCMJ 4LOCA 2QQ9A 2CQ7A 2X3UA 1S0UA 4B4CA 1RPWA 3FKSA 3QFTA 1O8DA 2DA7A 4NBSA 1BX0A 4DNRB 1TWAJ 2FX0A 5KAIC 4V19K 1IB4A 3ZQHA 1KYWA 4F3QA 2DCUA 2XPWA 4I0AA 2DMUA 4C2MJ 3CMEB 2Y48A 2B7CA 4KUMA 4B4DA 1LQ1A 3L2CA 3HOXJ 2CW8A 5ERIA 4XMYA 4OMYA 1TUIA 2LR8A 1XX5A 3ERMA 1HDPA 4JRAC 1KGSA 1FYKA 1SD6A 3SDGA 3OEEA 1FEXA 1OQYA 2BW3B 4MTEA 4XLPF 1E2XA 1W36D 1QQIA 5F6FA 3FX3A 4BDYA 2BSPA 2FE3A 4YFXF 2COBA 3NARA 2MLGA 4DOZA 5LBQA 2R7WA 2VPRA 3KIOA 4OOIA 1HSJA 3GVKA 1W5CC 1BOAA 3F3XA 1B6AA 2EIXA 2CW7A 4XOTA 2A6EF 3EETA 2BY2A 4D5CA 2CU7A 1K83J 3I4MJ 2DT7B 3CLQA 4NDLA 5CQEA 3N4MA 2DFIA 2CQNA 2JVHA 3OYAA 3LNQA 3E97A 2XGXA 2XF5A 3IHUA 3CCRI 4BE0A 3S3NA 2AQFA 3JQRA 4ZDLA 4RD6A 2HZTA 2JSCA 3M1CA 1QNTA 1E3ZA 1FLIA 3EYYA 1OFLA 2Q2EA 3VMVA 4RAYA 3GTOJ 2F5CA 2OD5A 3RQ4A 1BIAA 1BMFA 1D2EA 4F93B 5A8AA 1IC8A 1ONVA 1CLWA 1X1PA 3R6SA 1TWCJ 1QGYA 1QZEA 3GFMA 2LVSA 4I6ZA 2O04A 2V9PA 4M9XA 3PA1A 3M7GA 1I3AA 4HX7A 3Q3SA 2ZTGA 5LGNA 4DK0A 3DF8A 1JT6A 4TV7A 1QCXA 3PSSA 2UWMA 1KONA 1VQ9I 2G0EA 3F22A 2F6CA 1SANA 1MH4A 1FWZA 5F1JA 1BL0A 2Y31A 3SZTA 3LQ6A 3DDYA 3BCDA 5DNSA 5EG0A 4LIVA 3JRIA 5TJJA 3ZP5A 2PG4A 3LSIA 2EZKA 2V7VA 2J5PA 1KQ8A 3DTEA 2LBFB 1PDNC 2GIZA 4GDFA 2R7FA 1UHWA 2YX4A 5FD5A 5ICGA 1KQSB 1ZG5A 2NXNB 2D5VA 1T95A 1O3QA 1MNDA 1GXQA 4D5FA 3ZQLA 1SKYB 3GFIA 3K0LA 2JN6A 5JVGF 1U9OA 4DQLA 1IXRC 3BR5A 1G8XA 5GADJ 3HHHA 2R7VA 3KYCB 3ES9A 2O3FA 2V4JC 5DDGA 4CCKA 1GAQA 3C2GA 5J3OA 4FE7A 4RGRA 3ASSA 4E7JA 2INVA 1XCBA 4Y9UA 2X1EA 1XCVA 1CF7A 2YWGA 3AFHA 2WV0A 3PUBA 1XDUA 4A3FJ 1BM9A 3GVAA 2VNJA 3W2EA 1HW5A 1WJFA 1B4AA 2VASA 3DKYA 2BMWA 1LKXA 3FMQA 2ZMEA 1DABA 3HPHA 2XSDC 4NK8A 4G7XA 4M3DA 2JN9A 2LREA 2LKPA 2K40A 4HPQA 1QFYA 4MHGA 3PVDA 4EVIA 2OBPA 4HG2A 4Z4ZA 2OTJI 3WU1B 4M3FA 1MABA 4KIBA 1H8AC 4YCQA 3KEYA 4JX6A 2X0KA 2GJPA 2IA1A 2XNDA 2HVRA 5JI6A 2V7UA 3WTTC 2KIFA 4XLFA 4G5GA 4PFPA 3DP7A 2L4AA 1W7PA 1K8AD 1OGIA 5LHIA 5H5JA 4PGGA 2E5NA 3CW2A 1A36A 1D1CA 5KVRA 1N77A 4BE1A 2EPFA 1I8DA 1X3ZB 4EEFG 1ETXA 4HEA2 3D1NI 1T6ZA 1YX3A 1SVMA 4LJZF 4G7ZF 3WTXC 3M9AA 4JX4A 3GTQJ 1I18A 2V1XA 3UR3C 3NB2A 1I3QJ 3WU0A 5IPAA 4RD0A 4ASUA 2VBSA 4AIJA 2KIQA 3LSJA 5H20A 1O4XA 3I53A 3CUQA 2DA3A 1HW2A 4L18B 1LDDA 2L7FP 1ZRCA 1T8IA 2FNAA 2XZPA 1Z9CA 3BG3A 2DMTA 3VO2A 1MMNA 2V1NA 2VE8A 2M4GA 3K4BA 4LLGF 1ON2A 1IV6A 1OKRA 1IF1A 5KNLA 3NAUA 1G59A 4HZFA 5BQTA 3J80Z 1XFOA 5CVJA 4XK4A 1NHAA 3GEZA 2IOUG 2QVOA 3ABUA 3OZVA 1KD1D 1HSTA 3Q3AA 1BW5A 1VLYA 4YAFA 3P9CA 4UUVA 1O8IA 3FXLA 3SFIA 5A2QK 4E7LA 1WH5A 1P4MA 4C30A 3BOQA 5DCFA 2ZB9A 4Z4UA 2P7VB 2HKOA 2W6IA 4RGSA 3ZOBA 3MHPA 4HLXA 2R7ZJ 1EWYA 1VQPB 5ICEA 1JTYA 1RUOA 3LA2A 1LFBA 4HV6A 2WZNA 1HG8A 3OR2C 3GTPJ 4ZYEA 2GIVA 2VN2A 2ZCWA 1YRNA 1K28D 4CXFA 4N9HA 4ACAA 4B1RA 1TQMA 1BJZA 1IJEA 2W48A 3I4NJ 2XV4S 4LK1F 3F23A 1TQIA 2XIGA 5FKOA 4KITB 3GTMJ 1N08A 3KLOA 3KLNA 2BEOA 4M9SA 4CHUA 3OAAA 2E36A 4KA4A 4PFOA 2M87A 3TL4X 5E17F 1ZR4A 2Q6LA 4Y13A 4AM3A 1U78A 1IG7A 1U8BA 3WTWC 1KZLA 1KCCA 1E3PA 2XROA 3SUCA 2NNYA 1ZTRA 4OAYA 3G05A 2CUZA 4W8RA 3ABKH 3OS1A 1K79A 2JDIA 1VQNB 1AKHA 3W6VA 2CC2A 1XTAA 3PFYA 4R8HA 3PO2J 1QRBA 3L09A 1UG2A 2F4OB 4QVJA 3ISPA 3CMAI 3SY2A 2WADA 1ZM4A 4ZDPA 2NYXA 1IN8A 3QQAA 1Q9SA 4Y15A 4CO8A 2UXXA 3FKJA 4HF2A 4S0HB 2F1LA 2P3MA 1DBOA 2AQEA 3HTUA 1VQ4B 2DFFA 2R0QC 3HOZJ 1G3YA 2BM1A 3R60A 3U6BA 1X1AA 2X6XA 3DLAA 2ELKA 4HBLA 4TSFA 3AK5A 4ZC3A 3V7CA 1RWRA 3OP1A 3QYEA 4H9GA 1ZELA 4X8IA 2VLAA 3ZPNA 3T53B 2HYFA 2BM5A 3CDHA 1XGSA 3RJPA 4QLCU 1X19A 3DU6A 1E63A 4UAJA 4RAFA 4ZCIA 1J5YA 1LVAA 4HNTA 5AN9A 1PJ6A 3ZUGA 3FISA 3IAM2 3IH4A 1UHMA 5CVIA 1S5LC 2WYRA 2ZJ2A 2VT2A 4PZJA 3KP4A 4EM2A 1WMRA 5E20A 2RC6A 2VJIA 5IYWA 2DA2A 3LSTA 2ZJRF 4U9UA 4E4HA 3ABMH 1TW3A 5E1XA 3K70D 2XAFA 5DV5A 3VFZA 5HZAA 4JYKA 4V2FA 4IPAA 1W0UA 1HW1A 1R1VA 1ULYA 3EQLF 3R4KA 3ASOH 2OYNA 1NTCA 1VTNC 2BN4A 3WHCA 3SDBA 2CH0A 4X1EA 1LDJA 4BJTA 1W2BB 1OB5A 1TYUA 2H1KA 1UD6A 1T38A 3DFGA 1RC9A 4MO7A 2R7RA 3Q6QA 2PJPA 4ROXA 2CFOA 4ASNA 1WJCA 4OU0A 1FSHA 5M3FJ 2P6TA 1RI7A 4QV2A 2FQ4A 4UVCA 4L9JA 5E8GA 1BC8C 3E5UA 3I59A 3LL7A 2W6JA 3J81k 1ZM9A 1ZK8A 1Z7UA 4AC0A 1QRYA 2WTEA 1UMKA 1IRXA 4D1QA 3R61A 1JTAA 2OTLB 3HUGB 3SZEA 3CC7I 2K27A 1BBYA 3OKXA 4OPSA 1LVKA 1R6RA 4BHPA 3U2QA 1JKRC 3MMYB 5FKKA 1YJNB 1OFEA 2EFNA 1MBJA 2GOXB 1FYMA 2G0YA 2NPFA 3BY2A 2JQ7A 1FIPA 5ILSA 1J09A 3IRRA 2Y2ZA 1B72A 3CRZA 1GLNA 3TOAA 3GQ9A 2XZOA 3FXJA 1DPUA 2R7UA 5IYDJ 5JBQA 1NBMA 2H6BA 3H3ZA 3K4KA 3N05A 1HA8A 1NB9A 3GBGA 4FK8A 5F4MA 4Z6YA 2KHMA 5H6QA 5HS9A 1NK3P 1OOCA 5L3GA 3VYTB 3S1MJ 4CQJA 3GLXA 2QCOA 4YIIA 4ESFA 5DM6F 1XGOA 2E34A 4HF0A 4ZYAA 2P5LC 3WXMA 2LSOA 3ASPA 3KCCA 3ZGKA 3CMEI 4CZZA 1WHUA 1QVUA 2VBUA 4HIZA 1WJ5A 3T8RA 5A89A 2R5YB 2NRAC 4A3IJ 3P9KA 2LFBA 5E1WA 1APLC 2JJ7A 5F4JA 1OB2A 5J4VA 4RBOA 3AL0C 4WZEA 3G6EB 2LY1A 2XOKA 1MMGA 4PMHA 4XLCA 5CLSA 2EIJH 3MWMA 2ESNA 3ONYA 4NQWB 2B9SA 1Y8QB 2HYGD 2QSFX 1F4KA 2JA5J 2DQRA 1N06A 2F5FA 2IXSA 1G6NA 2DAOA 2LF7A 4PC7A 2MH9A 4YFKF 1V0EA 4F55A 4ZDOA 2DK5A 5BPIA 4GGGA 2IBDA 3QODA 4IHYA 2EK5A 2XVCA 3M1EA 3SZPA 5HVQC 5IP7J 1VQOB 4U4BA 1XG1A 2JZYA 2PN6A 2NT6A 1TLHB 5EDNA 2Z6BD 3IKTA 3CP2A 4XLNF 1VHOA 4RGXA 1LB2A 5IT3A 2W24A 3N90A 3KZIC 4RAGA 1EJ9A 3CPXA 4M74A 1QHGA 5LHGA 4AC9A 1A35A 1H9TA 1LE8B 3DV8A 1D8JA 1JJ6C 1FNCA 4HX4A 4L0YB 1W0JA 3S93A 3F6VA 3CCVB 5ED4A 1K4ZA 1FDRA 2XAUA 3GTJJ 2HFHA 4B09A 1ODDA 3E1YE 4CCNA 1S72B 1B59A 2EFGA 2B0RA 3MMPA 2LC2A 4E7HA 2ZBUA 5GV7A 4V02C 3CTAA 2ETHA 3IC7A 5JFRA 2AXTC 2F4MB 2QBYB 2Y9ZA 2H09A 2ZXWH 1LDKB 3RDIA 3R6KA 4I7HA 3FBIB 2CW0F 2MBFA 1OPCA 2OUMA 4YEIA 5DUIA 2RDPA 4G6QA 2XGCA 3I1FA 3UW0A 1J75A 3ZN1A 4I02A 4U0WA 2PMUA 1Q1VA 3GUDA 1NB0A 1OYIA 5LRSA 2BXYA 3HL2A 3I55B 3F72A 1SMYF 2X1CA 3A2KA 4XKCA 1Z1DA 2W7ZA 2GA1A 2O03A 3OYEA 2EWNA 2GA2A 4KMUX 2MYSA 3M8FA 1QA1A 3LQQA 1SVOA 3K2ZA 1QHHD 3IAS2 3OSFA 4MXNA 1MH3A 2C2WA 3MKZA 3ZRGA 2EIMH 2JUCA 5F0HA 2JRMA 3A03A 2NS8A 2V7FA 2ZTNA 2I8DA 2F4NA 3CC4B 3VO1A 1FOWA 2XHKA 2E35A 2BGIA 2VQHA 4PGOA 1AMOA 2XNCA 3O3KA 1QA6A 4M4SA 2HOEA 4OPWA 2DN0A 5LFAA 4ACBA 1SC7A 3VODA 4RD3A 4OZZA 4U49A 2CF4A 4KICA 1R58A 5E6TA 4Z4TA 1E3XA 3PQKA 2R6HA 5DCMA 2VC1A 2FQ3A 4XICA 2LH9A 3CF5F 5D4RA 2DMNA 2M4KA 3RCOA 4B3XA 2DTZA 1P9QC 2DT5A 4EV0A 2Q1ZB 3RI4A 1ZGWA 5FRMA 2ZBVA 4PJLA 1UFMA 1R49A 2I10A 1L1IA 2DIEA 1JI8A 1USSA 1MKMA 2KFDA 5J1YA 4RJLA 5J8FA 3KX2A 3ASQA 1STZA 1TSPA 2K5CA 2MD0A 3HPGA 5C4JJ 4Y52J 1L3LA 1TW2A 2LP0A 1F9NA 3BQYA 1W5TA 2Y0SN 4E7IA 4A3LJ 3VWBA 4KT6A 2HZDA 3PIOF 3BR0A 1R5OA 1T5EA 1RR7A 1OFMA 1OJLA 3J7AO 4RMNA 2DEUA 1IW7F 1TWHJ 2H6CA 3E3VA 3GX4X 3HOVJ 3OEHA 1CZFA 2XF7A 3EQNA 2DA4A 1YW7A 5K5OA 3DLLF 4YFOA 1TP4A 3DKWA 5AIQA 5GTIC 2BXZA 2KMUA 2L9SA 5IP9J 2VYQA 2DA6A 1ITYA 3HOYJ 4WXHA 1S7AA 1DP7P 4YZXA 3SQVA 5D8KB 1R4MB 2M8GX 2PEXA 2HCJB 2VE9A 3MN2A 5FL7A 5BS6A 2CW5A 1D1BA 3S8PA 2FJ1A 1F1ZA 5FB2A 1JA0A 4YDTA 2GZWA 2W82A 1FRQA 3DPUA 4CA0A 1U5TC 5EGOB 3SFZA 3FHNA 3MKYB 1VF9A 1HBXG 1IUYA 3FPKA 3JTHA 1EH6A 2K7LA 1IGNA 1I7PA 2Y0SA 2C4UA 3W3CA 3BY1A 1MBGA 1VQPI 4RS8A 3WWGA 4B43A 1YLFA 2K85A 2VFMA 4KN4X 2WAQN 2XF6A 2FOKA 3H3VK 2OV7A 2IEKA 1YX5A 2Q6KA 4P12A 2RV8A 2JRTA 3V7RA 5F0CA 3G73A 2WR8A 1GAWA 1W4MA 1ERDA 4WZTA 2DETA 1IZ1A 3OPOA 3OZWA 1R1TA 4D9JA 3WQZA 1U0JA 2VIXA 1KK1A 2A5YB 3B90A 1N75A 2O0VA 2CUEA 2VFPA 1JE8A 4JP0A 2CV2A 3GTLJ 1DG1G 2D3NA 3QSYA 4LBZA 4NCNA 2M8EA 2GLOA 1XGNA 3JQPA 3OE7A 3FMSA 3PSIA 5B1AH 3QOPA 1CQXA 4HYEA 4OM9A 4KH3A 4FASD 5EJCA 2ID3A 3GZ5A 3LOCA 3CCEB 4GYGA 1BN8A 1VLOA 1VQNI 2B7EA 1NG6A 4C0SA 2QXZA 2OQRA 2X53S 5IYCJ 2RGVA 3VMFA 1QPMA 1X58A 1YOVB 2X51A 1BPLA 3H3UA 3LQRA 4B47A 2QSHX 3IP4B 5E79C 3ZQGA 2X1DA 4BXXJ 2Z9OA 2OQGA 4A3DJ 3UNGC 3IWZA 1K9MD 3R0AA 2MD5A 2JMWA 1V55H 3SLNA 2G7HA 1VQ4I 4Z4WA 4IHWA 2UUZA 1VF7A 1V5GA 3KP3A 4JQFA 1V3FA 1B8IB 5FO1A 1I6XA 2O1DA 3M8EA 4P22A 5K5QA 3DXJF 4HLYA 2L5QA 3QAHA 4WK8F 2PYHA 3ZC3A 1KTWA 4X7CA 3A3GA 3JAMK 3ZMUA 1Z67A 5IYRA 1FMVA 3CUOA 3W5UA 1KTVA 2F1MA 1ACIA 3GIRA 2DMQA 1OYYA 3ZN0A 4P1VA 3RSNA 4E7KA 4KFCA 1OFDA 1OCCH 1OGMX 2PX9A 1PUFA 2DCEA 2XAGA 2J8IA 4P55A 4HRIA 2PMZA 2PI0A 4ESJA 5K7HA 4MEXF 3RYRA 4AYBA 5FLXZ 3EUAA 4G6DA 3L1PA 3EQOA 1QUFA 4IOCF 5A2QZ 2P7CB 4FE4A 2KRCA 3DBLB 2BM0A 1V4RA 4II3A 3BR6A 4D0PA 2CBXA 2OK8A 4ZZLA 4QTRA 3LSHA 2PJRB 5IOZA 3KEOA 1BLIA 3BY6A 1UD4A 2YPRA 3DQVC 2HDWA 5DN6A 1Z3YA 1BJAA 2JVGA 1HCRA 4GXOA 3A35A 3TGNA 3F8NA 4NC7A 5D8LB 4I09A 4BQNA 1FNMA 3D26A 4HX8A 1ZM2A 3E6BA 1JXSA 3K1PA 1FRNA 3L00A 2W85A 3TOBA 1AIRA 1I39A 2NSTA 3EPZA 4ZGQB 1IJFA 2CRGA 2LK2A 5D6EA 5HS8A 4AU7A 1MRZA 1S9HA 3JX8A 2XZLA 2P6SA 2QZ8A 1J9IA 5GPCA 4EGYA 2OTLI 4IOAF 2ELHA 4BJ5C 2R92J 5IYQA 1YJNI 1W1WE 3E7LA 2DPUA 2HPIA 4OIQF 4DIQA 2VXDA 1HQCA 1V54H 2VBWA 3SKBA 1EFCA 1O8LA 3I4PA 1FNBA 1A6IA 1JHFA 2KL4A 1X0CA 4OJLA 1X2NA 3AVVA 1UCRA 5DTDA 3B6CA 4QPQA 2XTYA 2PMHA 1T0FA 2A6HF 5TGTA 5EZGA 3E20A 4P9SA 3HOTA 5HKKA 4MTDA 1PE9A 4N3NA 3HRMA 2EILH 2Q0OA 3LSKA 2MG4A 3PFIA 4ZH4F 1TYXA 4G8XA 5F64A 2YWHA 3PETA 3RPUD 3K4LA 1I27A 3CC2B 2GBYA 4GYIA 1VFCA 2VBXA 4EJOA 2DOGA 1ORKA 3A0HC 3G1OA 3AL0B 1GO2A 2IGNA 3Q9VA 5LMZA 1JUPA 2OPTA 2M30A 5FLMJ 1R36A 2HKXA 4MIMA 1QQ1A 1DBGA 2ZMEC 4DW6A 3OYJA 3HSEA 4XQFA 1O8JA 4F7ZA 3GQAA 1MZBA 1MSFC 4E6KG 4OPOA 2W25A 3G6EI 4MR0A 4TT3A 3HC7A 3KPHA 1MBKA 4BL0B 3HSRA 2BGJA 1ZKGA 1E17A 3KRGA 2UV1A 1N05A 2QUFA 3AKZA 4QPOA 1WJEA 2LLKA 4HF1A 3OIQA 4Z4SA 1BR4A 4UZEA 3MKWB 3DBHB 4EGZA 1KU2A 3OL3A 4OMZA 3L9FA 3BCFA 4XKWA 2Z2SB 3CQZJ 1VQOI 1QJVA 4YRVA 3VPRA 2XNJA 1EKEA 4A0YA 2EFOA 2NOGA 2PBIA 4QWQA 1XSDA 5JMCB 3FWEA 4RCZA 4RLZA 2QYOA 3IV5A 2WJVA 1HKSA 2ZZFA 3FKIJ 5EEGA 1G2HA 4IKFA 1G7SA 1FOKA 3IWFA 3ZQFA 3K2AA 2DFHA 1FZPB 1RR8C 2BOLA 2XRLA 3CUQC 2XC7A 4ENMA 1B8IA 2O61A 4Y7CA 3CCVI 4LB6B 1SD5A 5F08A 4S04A 3ZXSA 1H89C 4ZV4A 1S72I 3S1NJ 2R7SA 2M0CA 2XGJA 1KRHA 3LNNA 1QGPA 3Q0VA 2WBMA 3W2IA 2QZAA 1L0OC 3CJQB 3AG2H 2EV5A 4HOBA 3PL8A 3V4GA 4ZCLA 3HEFA 1KU7A 4L5EA 4BEHA 1YHQB 3ELKA 1SFKA 3CCUB 1OCZH 1LFPA 4L9VA 3I9V2 1QZZA 2F4IA 4PUSA 2IS1A 2HR3A 2X6WA 1XB2A 3LYCA 2NS7A 4RD1A 3S1QJ 3CCMB 3BDDA 3NWSA 3ONQA 2DQLA 5HLHA 4G7HF 2NVTJ 2Z16A 4PJ0C 2HMAA 4TKOB 3BH7B 1SM4A 2VNKA 4NNJA 3IH3A 3GVJA 4BQOA 1MW7A 3I55I 3PIPF 3KETA 4J0QA 4G6TB 3ECOA 1OCTC 2DY1A 3GFLA 3CCLB 2FXAA 2C4TA 3LA7A 4YALA 1QA3A 3C3WA 4LK0F 1LEBA 2AS5F 4MFEA 3G4SI 3OYHA 3FY3A 2E1MC 2KZVA 4HDVA 1F36A 3WG9A 5KAFC 2BBYA 3WTVC 5HLGA 1YJWB 2IT0A 3SEJA 1ETVA 3LO8A 4AIDA 4RB3C 1YITB 1Y39A 3WNDA 2W4SA 1Q81D 1RQPA 2OA4A 2RN7A 5M5WJ 3SYJA 3OYMA 2B63J 4Y9RA 2LKSA 1PKVA 1TZLA 4ESBA 2L9NA 4A3KJ 3CC4I 5ICCA 3OSGA 2ICWG 3DTKA 1ZH5A 2V6CA 3OZUA 4CCLA 4E7ZA 4RM2A 3I64A 3K4JA 2DW4A 3CESA 3K1MA 3KZYA 4L9TA 3VSKA 4URRA 2VI6A 5LEKA 2LYCA 4O5VA 3ASNH 2K02A 4RGUA 2D2WA 4O6JA 2BM4A 1SEUA 2KIUA 4NC8A 3ZSCA 1P2FA 2VJ4A 2MLKA 5LGUA 5IT9K 2YU3A 2HTJA 3W6JB 2K9NA 3ZMSA 3OS0A 2VBYA 1O7FA 1MSEC 1T98A 4MQVA 5KHDA 3B8HA 1J0RA 5L3EA 3FIWA 2HDNB 4ON0A 3RPQA 1G7RA 2BPOA 2M1BA 2CFXA 4KYWA 1XMXA 4G6IA 3E1SA 2DTRA 3FDYA 2NS0A 5IYBJ 2LKXA 5B3SH 1QVTA 2M5SA 4YAWA 1GQ8A 5FROA 3MCZA 1OLTA 3EYIA 2R7DA 4RM3A 5HODA 1YFHA 4ITVA 2WAFA 1WI9A 4BUPA 2Z99A 4B48A 2RQPA 2HQ5A 1X4PA 1OR7A 1ZAOA 4FQGA 4P9FA 1CNEA 4P1WA 3SXYA 3S17J 2HNHA 3BJOA 3U2RA 4B44A 2MC3A 2ECBA 3GFJA 5J1UA 3S2DJ 5E3MA 2N8GA 2LDUA 4RD4A 1U5TB 5HDKA 3N6ZA 5CJ9A 3HRTA 4BQQA 3GXOA 2FRHA 5HDGA 3S3OA 3CCSB 1FSEA 2ZL6A 2E60A 1D1NA 1B9NA 5JR3A 2VOPA 2IPQX 3S2HJ 4DK1A 3FXOA 4PK4A 1V5VA 1PJ5A 3TQNA 2O6WA 3WNBA 2XDVA 5IY5H 4Y4RA 4P3YA 2QEXB 4M71A 1UZCA 4LBVA 2FSWA 2Z8GA 4AIHA 2VKHA 4JBAA 1S4MA 1E62A 4LG0B 2PQ8A 2P0WA 5DUKA 4KKUA 4KIGA 1UD3A 1YX2A 1DARA 2F5VA 2XB5A 1O8EA 1X4OA 2C5HA 1TBXA 1ZRFA 2JTVA 1QU3A 3LAJA 1WSRA 4HW0A 3H09A 4BACA 2ZSHB 3BQZA 3WG7H 3KEWA 5LEJA 2BSAA 2FF4A 3PNVA 3CB4A 4UHTA 1BI2A 3E0JB 4P3IA 3VEPA 2XT4A 2K9LA 3S1RJ 2HOSA 1WFXA 3WE2A 1KC8D 2WA0A 5AIPA 4AD9A 2ZZQA 2XSJC 3KYDB 2IGMA 5IK2A 4F7DA 2FA5A 1T2KA 1VBLA 2B0LA 2JPBA 3CZ6A 5FFZA 1EH7A 1ZHFA 1MBFA 4BDZA 9ANTA 5ILVA 1RMGA 1LFUP 2P81A 4Y17A 3BPVA 1I1GA 2BZTA 3CCEI 2V5IA 3TO7A 4K1XA 1EA0A 1X1BA 4N4NB 2DERA 1GV2A 3ZQIA 5C44J 2QA4B 3M3YJ 4HSTA 1YS7A 2ZC2A 5DD8A 5EEHA 3E6CC 4Q7JB 1WDTA 3SJZA 5K7FA 3OJXA 2DI3A 3ZPPA 3KE2A 5FKMA 5C4XJ 3W5VA 3ZCOA 2QDXA 2MFZA 3W2FA 5LGTA 3V8KA 1VQMB 2FD5A 2QY1A 3JRBA 2BHYA 2AXLA 2EFWA 5DEQA 1MIJA 3RKQA 2L9VA 3B6AA 1USTA 2KRHA 4IO9F 2V9VA 3HM5A 4BJ6C 5A88A 3J7YJ 5F04A 3FXUA 3TMOA 1KK2A 3J81K 5GAHJ 3S3MA 1G3WA 2X3HA 1E0EA 2PMDA 2RC5A 4RB1A 1WU8A 1UB9A 2XAHA 1K4TA 1K5CA 5ICFA 2BV6A 2EJRA 3OOPA 3OYBA 2GM4A 1EP3B 4R1HA 4UB8C 1UHSA 2FBKA 2ZNZA 3CO7C 1MMAA 2Q2EB 1J59A 4W8QA 1LPQA 1O3RA 1WSVA 3QFRA 3ZBTA 3HHGA 4HE5A 1EF4A 1KQ0A 3OYKA 1E1QA 3DPTA 3H9NA 2IP2A 3BZKA 4LFUA 2MW8A 5LRRA 3JRCA 4Z4RA 3CCQB 1HF2A 1VQ5B 1LM1A 4Y33A 2VKDA 2VBMA 5E1ZB 1VZ0A 2F5DA 5D4SA 5J35A 2LZJA 4RPDA 3RZDJ 4KMFA 1N0VC 2V26A 3OOCA 2JA7J 3H5AA 3F8FA 2GXBA 2L7MP 3GSIA 3FXKA 1MJ9A 3S2WA 1W7PD 3RKXA 2PIAA 2QTZA 2VONA 4Q48A 1IUFA 1FC3A 4AUXA 4J01A 3OIPA 3HIFA 1U3EM 1FT9A 1MGTA 4BHCA 4G1BA 1Y0YA 2O17A 4FETA 3JRGA 2WAEA 2DFEA 4A5MA 4OPVA 2DA1A 2F43A 4CCOA 2JPCA 3WGGA 2D45A 3CMMA 3BLYA 3FPPA 1WGXA 2IAIA 4U7BA 1E3HA 4K2EA 1G7CA 1JJ2B 4Z4VA 2R9VA 3S16J 1IAWA 3VOEA 5FGMA 2CRVA 3K69A 4U0YA 1OCRH 1P6RA 1JRGA 2OBRA 5CKTA 3M8JA 4CH7A 1E1RA 1IN5A 1WPCA 1TT5B 3HOWJ 1D5YA 2EA4A 3BCAA 4HSRA 4C3HJ 3RYPA 1NG7A 1ZQ3P 1OGJA 3FXQA 3DU1X 3QRFF 4PSXA 4C3JJ 4N3GA 1QRCA 4MEYF 1HOMA 4XLHA 4XL9A 2YUSA 4XNFA 1VNDA 1XSVA 4OOVA 1BI3A 1D0ZA 4LG3A 4BXFA 1RNLA 1ZGAA 1BN5A 2MGQA 1CF7B 4C2LA 1H9GA 1U8RA 1W34A 1YIJB 5FIUA 3G71I 2M7BA 3WTSC 2HYJA 4RDUA 4CUGA 1Y1WJ 4RM0A 2ZMEB 1F20A 3B8YA 1WZ2A 2RNGA 2GK7A 2FOWA 4IVNA 1VQ6B 3JURA 4N4OB 4FTHA 3CC2I 1PJ7A 1YG2A 2QN6A 2EFQA 1TL8A 4XM3A 4BYYA 4C9YA 2A5WA 4WQMA 3H92A 3ML3A 3A01B 2X6OA 1TT0A 3TW7A 3T8TA 2AHQA 5DD4A 2LG4A 1GUUA 4XN0A 2HDDA 3JAMZ 4LLNA 1ELOA 4XRSA 4HNVA 2M2EA 1X3UA 4H0EA 1A6QA 4CDGA 1W7PB 5CVUA 4J19A 3JRDA 2Z5UA 2O8XA 3GWZA 5IYNA 3JRAA 3B4NA 4C43A 3PSFA 4HQEA
chains in the Genus database with same CATH topology
3PSIA 2KDOA 3VDXA 4FASD 1KONA 2IS6A 2UWMA 1O8GA 1QCXA 2F6CA 2ODLA 3KYLA 3A4CA 2VJ5A 3OFNA 4OZYA 1W9XA 3PNTA 1NG6A 2QXZA 2X53S 3DDYA 3BCDA 3OYDA 2GJKA 4LIVA 2X51A 4AVZA 4C2UA 1BPLA 4B47A 1PXZA 3LSIA 3IP4B 2X1DA 3DTEA 2LBFB 3VMWA 2WY8Q 3UNGC 2KVOA 1PYVA 1T95A 1WJBA 1MNDA 2M0MA 1SKYB 3K4NA 2UUZA 1W36C 1VF7A 1IDKA 1V5GA 3J7AY 1G8XA 4JQFA 2BW3A 2R7VA 2O1DA 4LIUA 4P22A 3K4MA 1Y6IA 2UVEA 2V4JC 4HWVA 2L5QA 4CCKA 3C2GA 2PYHA 3H0DA 1KTWA 4E7JA 2INVA 1UD2A 3A3GA 1O8HA 2X1EA 4XR6A 2L7KA 3AFHA 1FMVA 1E79A 1W0KA 3PUBA 2F1MA 3FBNB 3RSNA 1WJFA 3DKYA 2VASA 3L2RA 4E7KA 1LKXA 1OGMX 3HPHA 2DCEA 4NK8A 2CV1A 4G7XA 4HRIA 2LREA 4CZCA 3PJRA 2QE7A 2PMZA 3H9JA 4HPQA 4PJJA 3D5LA 3GVLA 4HG2A 4AYBA 3EUAA 2R7XA 3V42A 3QOEA 3EQOA 3K10A 2E1MB 1MABA 2IQ7A 4PJNA 1BR1A 3KEYA 2GJPA 3OYLA 4JMQA 2XNDA 3LMWA 2HVRA 2KRCA 2LRDA 1N78A 4XLFA 4C2TA 2EWEA 4II3A 4ZTJA 4PFPA 1D1AA 3CJRB 3LSHA 1WP6A 2PJRB 1OB0A 3OWTA 3SEQA 1BLIA 1UD4A 1O88A 2E5NA 3DQVC 2HDWA 2RREA 3LSGA 1D1CA 4YZAA 3ZIAA 1N77A 4BE1A 1I8DA 1Z3YA 5DN6A 2JVGA 1EA3A 3DEEA 3A35A 4HEA2 2NTBA 4NC7A 4BQNA 1YX3A 4XORA 4DBRA 4H4KC 4JOMA 3I3LA 1D0XA 1I18A 4GQNA 3UR3C 3D5RC 1AIRA 2NSTA 3F9KA 3EPZA 1IDJA 1VJSA 4ASUA 3A1YA 4AU7A 1X1DA 1S9HA 5JHFA 1UG0A 4DBQA 2XZLA 2LBFA 2XZPA 1MMNA 2V1NA 3K4BA 2M4GA 4BJ5C 1HZEA 5KNLA 1G59A 3DU5A 2MABA 2A6TA 4RLFA 3W2VA 2HPIA 2CMPA 1UELB 4DIQA 2VXDA 4EATA 3H94A 1Z3XA 2ZSIB 1O8LA 3H35A 2KL4A 1VLYA 1X0CA 4OJLA 1O8IA 4E7LA 4YZ0A 4XKVA 4QPQA 4C30A 5TGTA 2LOOA 5HKKA 1PE9A 3VYRB 3HOTA 3OR1C 4BEHB 1MMDA 2JA2A 2W6IA 3G2BA 3LSKA 4BS9A 3RPUD 3K4LA 1HG8A 3OR2C 5CQGA 1OHHA 3AL0B 1H8EA 2R4GA 1PLUA 2IGNA 2LY2A 1K28D 1DBGA 2QX3A 3OYJA 4XQFA 2D3LA 1O8JA 5FRNA 3GQAA 4YELA 4KITB 4XONA 1DQUA 4E6KG 4HNUA 4YZQA 2KP6A 4XN3A 3OAAA 1V5FA 2O5RA 4P5OA 4MR0A 4TT3A 2V31A 4PFOA 3TL4X 3HC7A 4BL0B 4F52A 2HVQA 2PJRA 3KRGA 2UV1A 1KZLA 3OYNA 1KCCA 3AKZA 3SUCA 4DK0A 4OAYA 3G05A 2CUZA 4QPOA 1WJEA 3OIQA 1HVXA 4W8RA 3OS1A 2JDIA 1BR4A 3VYSB 3MKWB 1DGWY 3PFYA 3OL3A 3T56B 3BG6A 3BCFA 2PECA 2BVLA 4XKWA 2ZZEA 2Z2SB 1QJVA 4YRVA 4XD7A 3CP8A 2WADA 4ZDPA 1UD5A 2WJVA 1DBOA 2KQRA 3FKJA 2NSPA 2W1OA 2ZZFA 2AQEA 2V4DA 4IKFA 2GOMA 2HQAA 1WJDA 3QYFA 1X1AA 4G7WA 2X6XA 2BOLA 3DLAA 2XC7A 4XLAA 4TSFA 4IX7A 4ZC3A 3LFUA 1RWRA 3OL4A 3QYEA 1ZELA 3ZXSA 2V9KA 4W8SA 2VLAA 2R7SA 3ZPNA 3T53B 2XGJA 3LNNA 2VBKA 2WBMA 3DWLE 1X19A 3DU6A 1H80A 3H9GA 3W2WA 4CCJA 3CJQB 5CPRB 3PL8A 4HNTA 4X0GA 2V7QA 2L2OA 4BEHA 3VSLA 2WB1A 3IAM2 1SFKA 1LFPA 3VR6A 3I9V2 1H8HA 2F4IA 4PUSA 2IS1A 3OY9A 2X6WA 3GQ7A 1WMRA 1T0FC 2VJIA 1D0YA 3ONQA 3NWSA 4E4HA 2Z16A 4TKOB 3K70D 3EUHC 2VXZA 4NNJA 3GVJA 1EE6A 3EUKL 3OYCA 4BQOA 2PYGA 1MW7A 2NTPA 3VSVA 3OYFA 3SDBA 3L2UA 2CH0A 4G6TB 4OJ5A 4BJTA 4PSWA 2QKLB 3S32A 4R79A 3HOSA 1UD6A 3FY3A 3D5SC 3OYHA 4BE2A 2E1MC 2KZVA 3W2AA 2HU9A 2R7RA 2Z1DA 2NZMA 5AMVA 2CFOA 2W4SA 1WJCA 1BR2A 2V6EA 2JIZA 3OYMA 3H9QA 2W00A 1PKVA 1TZLA 2L9NA 3SEZA 2WJYA 1BN8A 3LL7A 4XKBA 2W6JA 3DPLC 3DTKA 3DTIA 3GQBA 4CCLA 3HG9A 4RM2A 4E7ZA 2HPMA 3K4JA 3CESA 3VSKA 1IRXA 1Y56A 4URRA 4D1QA 5C1CA 1NHCA 1SAUA 1JTAA 2QKMB 4KJZA 3HUGB 2LYCA 1LVKA 1R6RA 2DJIA 4IZZA 3MMYB 4NC8A 2VJ4A 3ZSCA 2GOXB 4IQ4A 2X85A 3OS0A 2HLDA 1J09A 5KHDA 3VSUA 2X6YA 1GLNA 4OJPA 3GQ9A 3ZQQA 2XZOA 3SZGA 2CV0A 2R7UA 1NBMA 4G6IA 2JJ2A 3E1SA 1HA8A 3K4KA 3FDYA 3N05A 2E1BA 2WZPP 3H5RA 3GBGA 2M5SA 1GQ8A 2KHMA 5FROA 4B3GA 2VBEA 1OLTA 1FMWA 1OOCA 4RM3A 3VYTB 1Z21A 2RQQA 2WSSA 4ZTFA 4Y3OA 2HVSA 2WPDA 4XLEA 4ITVA 4ZYAA 3T51B 1V0FA 2WAFA 3ZGKA 4BUPA 4B48A 1Z7LA 2MC4A 3K70C 3BH4A 1X4PA 3PNYA 4HIZA 1WJ5A 3GRHA 4P1WA 2HNHA 4B44A 1OGOX 1V5EA 3AL0C 2LY1A 3MD2A 2ZZGA 2XOKA 1MMGA 2M3AA 4PMHA 4XLCA 4BQQA 3S3OA 3RTRA 4DGWB 2E60A 3CF2A 4NQWB 2CK3A 4KKTA 3OOUA 1BHEA 4OAZA 2CUJA 4DK1A 2IXSA 4PK4A 3OW7A 3BC8A 5CDFA 4CCMA 4Z05A 2XDVA 1V0EA 4F55A 4Y4RA 4ZDOA 2Z8GA 3QODA 4OJOA 4IQJA 3BCBA 2VKHA 5HVQC 4U4BA 3QYBA 4CSWA 4BU2A 3K4CA 1WJAA 2NT6A 2OC6A 2P0WA 2Z6BD 4W8TA 4KKUA 3CP2A 2X8KA 3ZR8X 3GQ8A 1UD3A 4I84A 2F5VA 1O8EA 2JJ1A 1X4OA 4ANJA 3SYTA 1QHGA 1QU3A 2ZXIA 4FXUA 2M7AA 2VQLA 4BACA 2ZSHB 4L8JA 3KEWA 3PNVA 1W0JA 5HNHA 3S93A 2WY7Q 3E0JB 1RU4A 2XAUA 2K9LA 3C2HA 4NK6A 4CCNA 1WFXA 4RLQA 3OYGA 2WA0A 2ZZQA 3TBIA 2LC2A 2XSJC 4E7HA 4II2A 2IGMA 5IK2A 3OMYA 2ZXHA 4UZUA 1VBLA 2DOAA 3VSTA 3CZ6A 4XOPA 3LSMA 4EW9A 2GK6A 3NWTA 4YEJA 1E43A 4BDZA 1LDKB 5HNFA 3FBIB 2VQGA 1RMGA 2JSPA 2OUMA 4F91B 2FUG2 4E7SA 1X1BA 4N4NB 2KPMA 3OE7A 3UW0A 3JU4A 1MNEA 4HSTA 5HLTA 2WAQA 4GRIA 4PJMA 3HL2A 1FX0A 4KISA 2VL8A 3T9GA 1X1CA 2E5ZA 2R7OA 2X1CA 3A2KA 4XKCA 4B3FX 3ZPPA 4F92B 3OYEA 3L2QA 2IGOA 3ZCOA 2MFZA 2JUGA 3LMMA 5LD2C 1OR7C 2UVFA 2MYSA 1DP3A 1DGRM 2QY1A 2K3PA 1QHHD 2KRHA 3IAS2 4BJ6C 4MXNA 1O8FA 3TMOA 3MKZA 3ZRGA 3S3MA 1EFRA 2X3HA 1E0EA 4NUBA 2V7FA 2ZTNA 2I8DA 3U21A 1K5CA 2ZFUA 2CS3A 2VQHA 3OYBA 2R7QA 2ELJA 2R7TA 5LFAA 4U49A 4OZZA 2IGKA 1MMAA 2Q2EB 3DKXA 4W8QA 1K6YA 1UAAA 2BVMA 1E3XA 4OJ6A 5C1EA 3OYKA 1E1QA 4J00A 3DPTA 4YXWA 2LH9A 3H5NA 4ZJZA 3VYUB 2M4KA 3A3BA 3RCOA 4B3XA 2VPLA 3OYIA 4Y33A 1P9QC 2VKDA 3IUOA 2VBMA 4OWRB 4LITA 2Q1ZB 1VZ0A 4Z03A 5FRMA 2KLOA 4PJLA 2DXIA 2LZJA 2DIEA 1JI8A 2NTQA 3OOCA 2V26A 2W7NA 2VQCA 3KX2A 4MLOA 1BOBA 3H5AA 3NE5B 2IS2A 4E0FA 2K5CA 2MD0A 3HPGA 1IA5A 2VJJA 3FKSA 4Z06A 4J01A 4E7IA 3VWBA 3OIPA 2HZDA 4KT6A 1O8DA 2INUA 4DNRB 3BC9A 2O17A 1T5EA 1IB4A 4FETA 1XG2A 1OFMA 2WAEA 5KCMA 3OS2A 4CCOA 2F43A 4RMNA 3CMMA 3BLYA 4F3QA 3FPPA 4U7BA 3OEHA 1CZFA 1UD8A 2XF7A 2R9VA 3EQNA 2CW8A 4XMYA 1JRGA 3K6GA 2KMUA 2L9SA 5CKTA 3M8JA 4CH7A 2VB6A 4U87A 1E1RA 1WPCA 3OEEA 3BCAA 4HSRA 4YZXA 3HXLA 4KKSA 2BW3B 1NG7A 1W36D 5FL7A 2BSPA 4PSXA 4BDYA 1COWA 1D1BA 3S8PA 4XLHA 4XL9A 4DOZA 2R7WA 2W82A 4XNFA 3DPUA 4CA0A 3GVKA 1D0ZA 4LG3A 4BXFA 4C2LA 3HKZA 2CW7A 4XOTA 3MKYB 3FHNA 1WTHD 4DNTB 2M7BA 1YE9A 2DT6A 2DT7B 5CQEA 4CUGA 1O8MA 1KCDA 3HAGA 2Y0SA 3L2WA 2JVHA 3OYAA 2NOJB 3W3CA 2RNGA 2GK7A 2XF5A 3B8YA 3JURA 4BE0A 3WWGA 4B43A 3BG7A 3S3NA 2AQFA 4N4OB 4ZDLA 3M1CA 2IS4A 1E3ZA 1OFLA 2XF6A 4XM3A 2OV7A 2A5WA 2K9MA 1AA7A 4C9YA 1NRKA 1YX5A 3VMVA 1PJRA 1TT0A 3RQ4A 1BMFA 4F93B 2LG4A 4XN0A 1ERDA 5HOOA 3OPOA 4D9JA 3WQZA 1U0JA 2VIXA 1O8KA 2O0WA 3B90A 3L2VA 2NT9A 2O04A 1N75A 4DJAA 4BGDA 1KMHA 2O0VA 2GJRA 2CV2A 3B4NA 3PSFA 2D3NA 4Z1MA 2ZTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  1HG8 A;  2QY1 A;  1QCX A;  3ZSC A;  1O8G A;  2X85 A;  1PLU A;  2ODL A;  4OZY A;  4MXN A;  1O8F A;  2QXZ A;  3VSU A;  2X6Y A;  1DBG A;  2QX3 A;  4XQF A;  2X3H A;  1O8J A;  4OJP A;  4AVZ A;  3GQA A;  3GQ9 A;  1K5C A;  4YEL A;  1PXZ A;  4XON A;  4YZQ A;  4XN3 A;  3VMW A;  4MR0 A;  4U49 A;  4OZZ A;  1GQ8 A;  2VBE A;  3KRG A;  1OOC A;  4W8Q A;  1IDK A;  1KCC A;  3SUC A;  4OJ6 A;  5C1E A;  2O1D A;  4XLE A;  4W8R A;  2UVE A;  4HWV A;  2VBM A;  2PEC A;  2PYH A;  2INV A;  1KTW A;  4Z03 A;  4XKW A;  1O8H A;  1QJV A;  3GRH A;  4XR6 A;  2NTQ A;  1OGO X;  1IA5 A;  1OGM X;  1DBO A;  2NSP A;  4PMH A;  4XLC A;  4NK8 A;  2VJJ A;  4Z06 A;  2INU A;  1O8D A;  2O17 A;  1BHE A;  1IB4 A;  2X6X A;  1XG2 A;  1OFM A;  3EQO A;  4XLA A;  1RWR A;  2IQ7 A;  4W8S A;  1CZF A;  4Z05 A;  2Z8G A;  3EQN A;  3LMW A;  2VBK A;  4OJO A;  4XMY A;  1H80 A;  4XLF A;  1JRG A;  2EWE A;  4U4B A;  2NT6 A;  4W8T A;  3GQ8 A;  1O88 A;  4YZX A;  4I84 A;  1O8E A;  4YZA A;  2X6W A;  2BSP A;  3GQ7 A;  1WMR A;  2VJI A;  2NTB A;  4XLH A;  4XL9 A;  4XOR A;  4XNF A;  1RU4 A;  4C2L A;  1EE6 A;  4NK6 A;  2PYG A;  1AIR A;  2NTP A;  2NST A;  3VSV A;  4XOT A;  1IDJ A;  4OJ5 A;  1O8M A;  1KCD A;  1VBL A;  3VST A;  4XOP A;  3B8Y A;  4EW9 A;  3FY3 A;  3JUR A;  3WWG A;  4YEJ A;  1RMG A;  1OFL A;  4XM3 A;  3VMV A;  2NZM A;  5AMV A;  3UW0 A;  1O8L A;  4XN0 A;  1X0C A;  4OJL A;  1O8I A;  1O8K A;  1BN8 A;  2O0W A;  4XKV A;  4YZ0 A;  3B90 A;  1PE9 A;  2NT9 A;  2O04 A;  3T9G A;  2O0V A;  3ZPP A;  3B4N A;  4URR A;  5C1C A;  1NHC A;  1JTA A; 
#chains in the Genus database with same CATH topology
 4PAB A;  1JNY A;  2VNH A;  1GVD A;  2EV0 A;  3KP5 A;  2NVU B;  3MQ0 A;  3VDX A;  2IS6 A;  1O8G A;  2BM6 A;  2BGC A;  2O7O A;  1G3S A;  3B02 A;  2H94 A;  2VJ5 A;  2M9H A;  1EH8 A;  4BHB A;  4Q4Z F;  3KYL A;  1WSU A;  1VQ7 B;  4IHX A;  5ILU A;  1TVC A;  3OYD A;  1GVH A;  2OK7 A;  2INU A;  4AVZ A;  1I1S A;  2KRF A;  1PXZ A;  3E5Q A;  3LSP A;  2R3S A;  2E2H J;  2A61 A;  1T6X A;  2CJJ A;  2K4J A;  2DPD A;  1CNF A;  3ASR A;  4AF7 A;  3HZJ A;  2VC0 A;  4DNC A;  1BIB A;  4HAM A;  1PYV A;  1J7K A;  1WJB A;  5IOY A;  5D5W B;  3MFK A;  1QG0 A;  1TYW A;  2LY9 A;  5BMZ A;  3K4N A;  3G1L A;  1W36 C;  1IDK A;  2VT3 A;  3J7A Y;  1Z91 A;  2BW3 A;  2Y69 H;  1NDH A;  4M0L A;  4LIU A;  2EZI A;  3MZ8 A;  3WGI A;  1M90 D;  3ZPL A;  4DZJ A;  1WPK A;  4A12 A;  4GFB A;  1SFX A;  4HWV A;  3H0D A;  2EA2 A;  3MVP A;  1UJ8 A;  1JT0 A;  1U2W A;  1E64 A;  5JLW A;  2BV3 A;  1IJW C;  3ISX A;  4HV5 A;  3V7A A;  2C78 A;  3AG3 H;  1AIP A;  1HF0 A;  5TR9 A;  2DK8 A;  3FBN B;  3PM1 A;  4Y7N J;  3FJO A;  3L2R A;  1R71 A;  1YHQ I;  3JRF A;  5M5Y J;  1ETY A;  3HRU A;  3CCU I;  2CV1 A;  4UUS B;  2ZJQ F;  3PJR A;  2ISZ A;  2QE7 A;  1B23 P;  2C5B A;  3H9J A;  2NVQ J;  1SD4 A;  4PJJ A;  3CCM I;  4G9Y A;  4N9I A;  2R5Z B;  1I6H J;  2VNI A;  3K10 A;  2E1M B;  3CLO A;  2OCE A;  1MMS A;  4PJN A;  2XKP A;  3HB9 A;  1JJ8 C;  4EMS A;  4JMQ A;  3LMW A;  1YJ9 B;  3GYH X;  1Z6R A;  1N78 A;  2LRD A;  2QYU A;  3N97 A;  2M34 A;  4RAZ A;  3CCL I;  3LA3 A;  4ZTJ A;  1D1A A;  3U9G A;  1TTY A;  2A68 F;  2Z3Y A;  1X2M A;  3G71 B;  3E5X A;  1OB0 A;  3OWT A;  1ZG3 A;  4M3B A;  3SEQ A;  4YIF A;  1M1K D;  1O88 A;  4HQM A;  5AON A;  4I0B A;  3V7S A;  1YJW I;  2PLY A;  3CD6 B;  3AAF A;  2VUM J;  1YIT I;  2EIK H;  1AKH B;  4ENJ A;  2NTB A;  4XOR A;  1QA2 A;  3I71 A;  4JOM A;  3BR2 A;  4PGH A;  1YW9 A;  2M45 A;  4IL6 C;  2P4W A;  4IEJ A;  3QFC A;  4ZZD A;  4GQN A;  3F9K A;  2K3F A;  4X0C A;  3NAW A;  1VJS A;  3Q39 A;  2E2J J;  1K8F A;  3A1Y A;  1X1D A;  1N07 A;  1UG0 A;  4DBQ A;  4P25 A;  2TDX A;  2DYR H;  1IO2 A;  2LBF A;  1GXP A;  2L0K A;  4NBQ A;  3JSP A;  1HZE A;  1K7A A;  2GRE A;  4RDJ A;  3ABT A;  1DU0 A;  3CDI A;  2MAB A;  2HGC A;  2ECC A;  2QMU A;  2HQN A;  3WYA A;  2OAZ A;  1UEL B;  2ISY A;  3GW2 A;  3G3Z A;  4XSZ F;  3H94 A;  4G1V A;  1O57 A;  4B8X A;  4ENK A;  1FJL A;  2Q6I A;  2OF7 A;  4QHY A;  3H35 A;  3A8K A;  3RPU A;  1YQA A;  2DA5 A;  4W1U A;  1IN7 A;  4XKV A;  1U2R A;  1WOR A;  2Y30 A;  4RD2 A;  4IHS A;  4L0Z B;  1YS6 A;  1GDT A;  3OR1 C;  2B5O A;  2JA2 A;  4EM0 B;  1ZLK A;  3W5H A;  3G2B A;  3BZ6 A;  5EMN A;  1JUM A;  3EUH A;  5K5R A;  2HOA A;  2OBS A;  1R23 A;  1FPQ A;  4A3G J;  5DS0 A;  5CQG A;  1XSX A;  1LNW A;  1OHH A;  1H8E A;  4WXD A;  3O6B B;  4FN5 A;  4WXC A;  3REO A;  1ZN2 A;  2E1R A;  1Y0U A;  4DZP A;  5L3D A;  2D3L A;  4L9N A;  2OBT A;  2K9S A;  2YWE A;  1ZLJ A;  4YEL A;  2DOD A;  1DQU A;  4XON A;  4YZQ A;  1TWF J;  2COM A;  2FMY A;  1V5F A;  2O5R A;  3BTC A;  3FF5 A;  1JTX A;  5B6I A;  3TDZ C;  3ZMT A;  3JR9 A;  2J8K A;  4IHV A;  2X9D A;  4IHT A;  4M2L A;  4F52 A;  2HVQ A;  2ESH A;  4OIR F;  3CCS I;  3RKY A;  2XUB A;  2VBZ A;  1QUE A;  1TYV A;  2EH3 A;  1NJI D;  2HDC A;  2ODL A;  4A5N A;  1BJK A;  1DGW Y;  1X3W B;  3BG6 A;  3I59 B;  3T56 B;  2BVL A;  1YI2 B;  2QEX I;  4BXU A;  5CYV A;  3H1C A;  2KIM A;  2PMZ N;  2KJC A;  4X06 A;  3TP0 A;  1T56 A;  4AYB N;  2EZL A;  4EQQ A;  3F0C A;  3NQO A;  4A2U A;  2A3S A;  2KZG A;  4A6E A;  3ROU A;  2FBI A;  2MH2 A;  4L5J A;  2GOM A;  3FXM A;  2HQA A;  1WJD A;  3I5U A;  2STW A;  5JLV C;  1B72 B;  4WZK A;  4IX7 A;  1A8P A;  2YS9 A;  3LFU A;  1TLL A;  3AGQ A;  2V9K A;  1H85 A;  1XC5 A;  4KDP A;  2ADU A;  2CYY A;  1H88 C;  3H9G A;  4FIS A;  4OOS A;  3BT9 A;  1F60 A;  5CPR B;  3LFK A;  2QLZ A;  4X0G A;  1VQ8 B;  2XGD A;  1Z05 A;  5HXB A;  2Z33 A;  3VR6 A;  1H8H A;  1LUJ B;  5IT9 Z;  3S14 J;  3X2Q H;  5FD6 A;  1WI3 A;  3AST A;  1T0F C;  1P4A A;  1K61 A;  3Q38 A;  3Q0U A;  2HWV A;  2E1N A;  2QA4 I;  1R5G A;  2LF8 A;  3TED A;  4OIP F;  2L7Z A;  2VXZ A;  3OYC A;  2PYG A;  4XID A;  2NTP A;  3VSV A;  3BNW A;  2C6Y A;  3OYF A;  2BE5 F;  3L2U A;  2WWY A;  1QX4 A;  5KW9 A;  2QKL B;  3S32 A;  4R79 A;  1P92 A;  3KP6 A;  3BWG A;  1RIO H;  3D5S C;  4BE2 A;  1VQM I;  2CG4 A;  2XPV A;  5EEA A;  3I56 B;  3RZO J;  2Z1D A;  2XRN A;  3QWL A;  4QUZ A;  3WOD F;  1JHH A;  4TMZ A;  2BF4 A;  5AMV A;  2CO5 A;  4OIN F;  4BBR J;  5J40 A;  1FND A;  2LTP A;  1WVR A;  2V6E A;  2JA8 J;  2JIZ A;  5FNZ A;  3H9Q A;  2W00 A;  1CQT A;  4LG0 A;  3SEZ A;  3A0B C;  1GV5 A;  1WWX A;  5JLX A;  4EJV A;  2WJY A;  1TNT A;  4XKB A;  4NB5 A;  3TP3 A;  4TMT A;  2IJL A;  3DTI A;  3BG9 A;  3GQB A;  3HG9 A;  1FNN A;  2HPM A;  3HYI A;  4A69 C;  1HA3 A;  3KL9 A;  1Y56 A;  4I98 B;  2NAZ A;  3P4G A;  5C1C A;  1FP1 D;  1NHC A;  1SAU A;  1K4S A;  4KJZ A;  1LJ9 A;  1KYZ A;  3ML6 A;  2DJI A;  4P96 A;  1PP7 U;  1KU3 A;  4UV9 A;  4IZZ A;  2ZJP F;  5BSX A;  4EJW A;  1N0U A;  3W2H A;  1BQE A;  1HKQ A;  4Q5S F;  4M9Z A;  2BY3 A;  3GZN B;  3CCQ I;  1R4N B;  1R5B A;  2HLD A;  1XGM A;  3O2P E;  1VQ5 I;  1R00 A;  3VSU A;  2X6Y A;  1YYV A;  1R5N A;  2EV6 A;  4IXA A;  4OOX A;  3CJN A;  3ZQQ A;  2E7X A;  4UNO A;  3F8B A;  4AWX B;  5DYM A;  4MQ9 F;  2CQK A;  2JWT A;  4ABZ A;  1VQK B;  2E1B A;  2WZP P;  3H5R A;  1SVL A;  4LD5 A;  4NHJ A;  4A3B J;  1LLW A;  1FMW A;  1AU7 A;  3SLD A;  1Z21 A;  2EIN H;  2H8W A;  4ZTF A;  2EBI A;  4Y3O A;  1OCP A;  5HS7 A;  3T51 B;  2BY1 A;  2D1H A;  5H2F C;  1V0F A;  1P4W A;  3LJY A;  5L3C A;  2V7W A;  5J1R A;  3CMY A;  3OJW A;  4PC1 A;  1Z7L A;  2NVY J;  3H36 A;  5GPA A;  5DS9 A;  3K70 C;  1K78 B;  2GXA A;  3BH4 A;  3PNY A;  1UMQ A;  1OGO X;  1N25 A;  1D8T A;  3NRV A;  4BPR A;  4WWC A;  1V5E A;  5J4Y A;  2YX7 A;  1ZRD A;  1VHE A;  2CND A;  1PP8 F;  2ZZG A;  2M3A A;  5M3M J;  2VKE A;  1IXS B;  1QPI A;  1SD7 A;  2AHO A;  2QQB A;  2PE3 A;  4WF2 A;  2P5K A;  3LAP A;  4FWT A;  4DGW B;  3CF2 A;  1BHE A;  2FNP A;  3OOU A;  3SJM A;  4M53 A;  3ZMD A;  4HDU A;  4LBW A;  5GV8 A;  2CUJ A;  2QF7 A;  2CSO A;  5D6F A;  4MGR A;  2HXO A;  4JK1 X;  4Z05 A;  2DDA A;  3F6O A;  1YIJ I;  3BTI A;  3FM5 A;  4AF6 A;  1R9T J;  4OJO A;  3WTY C;  1YLO A;  4A0Z A;  1Z77 A;  5K1Y A;  4XRF A;  4CSW A;  2DYI A;  1HKT A;  4BU2 A;  2YSR A;  3LQE A;  4W8T A;  2M5W A;  2C77 A;  3W6K B;  1VQ6 I;  2XEX A;  4U88 A;  4XRS G;  5TRD A;  3R6J A;  5DSZ A;  3GQ8 A;  4I84 A;  2P8T A;  3U6K A;  4ANJ A;  3SYT A;  1HXD A;  3HUG A;  3FMR A;  5DCM B;  2M7A A;  2VQL A;  3PA2 A;  4FXU A;  3CCJ B;  2QGG A;  4TMX A;  3P5J A;  3J81 Z;  4FX0 A;  1RET A;  2JA6 J;  3HDD A;  4WZL A;  3C18 A;  4AIK A;  1EP1 B;  5BNG A;  4NK6 A;  2H8R A;  3OYG A;  2G9W A;  1PVE A;  4X7D A;  1S7E A;  3TBI A;  2ZXH A;  4UZU A;  3VST A;  5F4O A;  4XOP A;  3KFW X;  2J7K A;  1EV7 A;  4P6V F;  3NWT A;  1VQL B;  4YG2 F;  1TNS A;  3JQQ A;  1FY7 A;  2JSP A;  1KZH A;  3WE3 A;  2L02 A;  5GAG J;  1TQP A;  1VQ7 I;  2KPM A;  1S3J A;  3JU4 A;  4HE6 A;  2XAJ A;  4YAO A;  3QPT A;  5HLT A;  4R71 A;  4UVA A;  3WTU C;  3C1D A;  2QM3 A;  4GRI A;  1FX0 A;  1YIO A;  1BW6 A;  3T9G A;  2R5Y A;  4P26 A;  5D5X B;  4B3F X;  3Q9S A;  1W5S A;  3D0S A;  2JUG A;  2A07 F;  1G7T A;  4IRG A;  5LD2 C;  1OR7 C;  1RKT A;  4P2N A;  2UVF A;  3L7W A;  3U1K A;  1EFU A;  2K3P A;  3CJT B;  4GO1 A;  1Q1H A;  4QIW N;  5L3B A;  5CVR A;  4NQW A;  1O8F A;  3IL2 A;  1QGZ A;  4Q47 A;  2E19 A;  1PUE E;  5M5X J;  1JUS A;  4N0B A;  3Q0W A;  1MBE A;  1EFR A;  4C3I J;  2ZL5 A;  4NUB A;  2D74 A;  3U21 A;  1FBQ A;  2V1D A;  3OIO A;  1BI0 A;  2ZFU A;  2L9R A;  1KK0 A;  1P7I A;  3BTL A;  3AVU A;  2R7Q A;  3OV8 A;  2W84 A;  3AVW A;  2GXG A;  3K1N A;  2ELJ A;  4PDK A;  2R7T A;  1B2R A;  1JB9 A;  3A1P A;  5JVT A;  4UZF A;  3DKX A;  2F48 A;  4JX5 A;  3A01 A;  1G3T A;  2K86 A;  1D3Y A;  4OJ6 A;  2Y9Y A;  4PC6 A;  2YUH A;  4ZYH A;  1LE8 A;  3VYU B;  3A3B A;  2VPL A;  1OYW A;  3OYI A;  3IUO A;  4U7D A;  4OWR B;  3RY8 A;  4I01 A;  1D8K A;  6PAX A;  3QP6 A;  1YJ9 I;  2O6G E;  3P26 A;  3BH6 B;  3SQN A;  4A3J J;  2VQC A;  3HKZ N;  5FO5 A;  4M6X A;  5LHH A;  2IS2 A;  1U6G A;  1IA5 A;  3I0T A;  3WBK A;  3ECH A;  2X4H A;  1SKQ A;  3CD6 I;  2VJJ A;  4Z06 A;  2QBY A;  2FML A;  3HTS B;  3B82 A;  1OIS A;  1IRF A;  3F8M A;  3C2B A;  3BC9 A;  4W97 A;  1XG2 A;  1B9M A;  4CYC B;  2VFQ A;  4IRH A;  5KCM A;  3OS2 A;  1HDD C;  3AVX A;  2VFO A;  2IVM A;  1UD8 A;  1VI0 A;  1MDM B;  1SFE A;  3O8G A;  2YR2 A;  3H0G J;  3K6G A;  4LGW A;  3ABL H;  2RKH A;  2VB6 A;  4U87 A;  3PUM A;  1D5V A;  1J2X A;  5EYR A;  1BA5 A;  1IDZ A;  3BJA A;  3HXL A;  1JKO C;  5FLX K;  3ZMZ A;  4KKS A;  5GP9 A;  1AWC A;  1COW A;  2XKO A;  1IN6 A;  3HGY A;  1QFZ A;  3HKZ A;  2FVG A;  3CXC B;  4LMY A;  1WTH D;  4DNT B;  1YE9 A;  1QVF B;  2DT6 A;  1I50 J;  3PUF A;  1O8M A;  1KCD A;  3HAG A;  4UUS A;  3QPH A;  1PUF B;  3L2W A;  5J8C A;  2NOJ B;  1FOY A;  2DBB A;  3WBJ A;  4XRM A;  2ZXJ A;  3BG7 A;  3RKW A;  4V2G A;  2R5Z A;  1BX1 A;  2IS4 A;  3U1D A;  2KJB A;  1DU6 A;  1DDI A;  1ZGJ A;  2K9M A;  2A69 F;  1AA7 A;  2HS5 A;  5F27 A;  1NRK A;  4X05 A;  1PJR A;  1MJB A;  1XD7 A;  3EDP A;  1C0W A;  2XC1 A;  3WY9 A;  3BG5 A;  4TN1 A;  1R5I D;  3CCY A;  2RNJ A;  3MAJ A;  5HOO A;  1O8K A;  2O0W A;  1W35 A;  3L2V A;  2D9R A;  1QVG B;  5FKL A;  4LLL A;  2NT9 A;  4DJA A;  4BGD A;  3IH2 A;  1KMH A;  4MNU A;  4BY7 J;  2GJR A;  3HOU J;  2VBV A;  3DBR B;  3ZZU A;  1Y8R B;  1IHM A;  1K73 D;  3TH0 A;  4Z1M A;  2CQQ A;  2F3L A;  3CO6 C;  1Q86 D;  2KDO A;  1R7J A;  5J47 A;  4ZYD A;  1KA8 A;  5E18 F;  4OZY A;  3A4C A;  4ENN A;  3DCF A;  3OFN A;  1Q82 D;  1W9X A;  3PNT A;  2DU9 A;  2BY0 A;  1GHC A;  3P27 A;  1YI2 I;  2EFP A;  4DYQ A;  3ERE D;  2GJK A;  2Y0M A;  2YWF A;  3KP2 A;  4C2U A;  2BM7 A;  2ID6 A;  5K7Z A;  4QVA A;  4UVB A;  3VMW A;  2WY8 Q;  4MFD A;  5JHU A;  2V7T A;  2KVO A;  3Q6R A;  3PSZ A;  2M0M A;  1FIA A;  1QFJ A;  2V1U A;  4RB2 C;  2E1O A;  4M1K A;  2BHZ A;  2ZBK A;  1IV8 A;  3K4M A;  1Y6I A;  3V8J A;  2UVE A;  4L5I A;  5HDN A;  5THX A;  1UD2 A;  1O8H A;  4EJU A;  5CVV A;  2ZNY A;  1H42 A;  2H1L A;  1T08 B;  2L7K A;  4XR6 A;  4Z2Y A;  2IW5 A;  1RUN A;  1DDG A;  1E79 A;  1W0K A;  5EGO A;  3HBL A;  2FU4 A;  2OZ6 A;  1VQ8 I;  1RRJ A;  4PCQ A;  5E3N A;  1ZUN B;  5TY0 A;  4A6D A;  4A3C J;  2DMP A;  3W2G A;  4CZC A;  3BJ6 A;  1ZYR F;  2CUF A;  5J6X A;  3O8H A;  3VNV A;  3D5L A;  2ME6 A;  4E70 A;  3GVL A;  3BTJ A;  1RES A;  3V42 A;  3QOE A;  2R7X A;  5TV2 A;  3K7A J;  3F21 A;  1AOY A;  2IQ7 A;  1BR1 A;  1DDN A;  2IA2 A;  3JW4 A;  3ZZT A;  3OYL A;  4G12 A;  1ZG1 A;  4C2T A;  1WOP A;  4WWV A;  2L3D A;  2EWE A;  3CJR B;  1WP6 A;  3ONU A;  1XN7 A;  4RDK A;  1T33 A;  3ESW B;  3LSG A;  4ETS A;  2RRE A;  3I56 I;  4YZA A;  3ZIA A;  1WOO A;  2V7X A;  4A3M J;  4RPB A;  2ZFW A;  3PUN A;  1EA3 A;  3DEE A;  1S6L A;  1GT0 C;  1MJA A;  4DBR A;  3WTZ A;  5DM7 F;  1Z6T A;  3HRS A;  4H4K C;  2DLL A;  5B1B H;  4BNC A;  1JA1 A;  1EFT A;  2E71 A;  3GME A;  3I3L A;  1D0X A;  2HXI A;  1S7O A;  4KT5 C;  4BH9 A;  3D5R C;  4YAU A;  1ZR2 A;  4IJA A;  1IDJ A;  4WX9 A;  4I76 A;  2CQX A;  1NH3 A;  5EG0 B;  3BPX A;  4D7M A;  2W57 A;  1GJR A;  4M6V A;  5JHF A;  2VOO A;  2MSY A;  3DEU A;  3QU6 A;  3BQJ A;  3R0J A;  1F5T A;  4A93 J;  3M07 A;  2LMD A;  1O3S A;  3HJE A;  3WU2 C;  2DDB A;  2V79 A;  3DU5 A;  3FHZ A;  3JRH A;  2A6T A;  4LBY A;  4RLF A;  3W2V A;  2CMP A;  1T6S A;  1ON1 A;  3BRO A;  4DYR A;  4EAT A;  1Z3X A;  2ZSI B;  1SFO J;  2TRT A;  3KEQ A;  4A0X A;  3QPL A;  4XBF A;  5BOX A;  3WGH A;  4YZ0 A;  2UXN A;  1GR1 A;  2LOO A;  1DPR A;  3VYR B;  4BEH B;  1MMD A;  2F2E A;  1VQK I;  5B66 C;  3UKG A;  4BS9 A;  3CCR B;  2HQR A;  2O9L A;  4TMW A;  1T39 A;  1AHD P;  4RA2 A;  1QGA A;  3AG4 H;  1I5Z A;  5HZB A;  1WOS A;  2R4G A;  1IRZ A;  2LY2 A;  1PLU A;  4BAY A;  2B7B A;  1FP2 A;  3GZ6 A;  2FEZ A;  1SAX A;  2QX3 A;  2QSG X;  3GCM A;  1LEA A;  5FRN A;  5KSW B;  4IW3 B;  4HNU A;  4QFM A;  4D7N A;  4X6A J;  3ZQ7 A;  2KP6 A;  4XN3 A;  1WKM A;  2GWR A;  4P5O A;  1EXM A;  2V31 A;  3RIR A;  4M3E A;  2Q8K A;  4Z4Y A;  3GO5 A;  4NC6 A;  4HA8 A;  2PJR A;  4FCY A;  5E3L A;  4YHB A;  3OYN A;  1MD0 A;  2WB1 N;  3B78 A;  4IRI A;  1VQ9 B;  3J80 K;  3ZBU A;  2FX3 A;  1HVX A;  2IA0 A;  2K9Q A;  3GTG J;  4EH1 A;  3E6M A;  1Y0N A;  5F0F A;  2XB0 X;  3VYS B;  2PEC A;  1FBS A;  2HEO A;  2I5U A;  4BBS J;  1QZY A;  2ZZE A;  4XSX F;  1ZRE A;  1P7J A;  4FX4 A;  2DOE A;  1FTT A;  2KT0 A;  4PAA A;  4XD7 A;  3CP8 A;  4UXN A;  3GTK J;  4PC2 A;  1XMK A;  2KDZ A;  4ZGN B;  3PEN A;  1UD5 A;  2RVC A;  2KQR A;  3CUQ B;  2NSP A;  2ME0 A;  2W1O A;  5HLI A;  4ZYG A;  1WH7 A;  2V4D A;  1S8N A;  2AO9 A;  2QWW A;  2BVN A;  2OU2 A;  1OCO H;  3MZH A;  2K4B A;  3CCJ I;  5GAE J;  1TC3 C;  4G7W A;  3QYF A;  5D5U B;  1Q7Y D;  4XLA A;  3J7Z I;  3QPS A;  2XAQ A;  3OL4 A;  4W8S A;  1FYL A;  3ULQ B;  3COA C;  2VBK A;  2HTS A;  3DWL E;  1H80 A;  3F8C A;  3JCU C;  3W2W A;  4CCJ A;  2JT1 A;  2V7Q A;  3AG1 H;  2L2O A;  2O8K A;  4M73 A;  3VSL A;  2WB1 A;  1XDS A;  4U0V A;  4CIC A;  1VQL I;  1Z0X A;  3T5X A;  1T6Y A;  2Q6O A;  4PC3 A;  4OIO F;  3OY9 A;  2E7W A;  3GQ7 A;  1H0M A;  1B1B A;  2KIS A;  2LNB A;  4GCV A;  3PQJ A;  4M6Y A;  3TW6 A;  1K78 A;  1D0Y A;  2OTJ B;  5E3O A;  1YRN B;  3EUH C;  1EE6 A;  1A5J A;  3EUK L;  3MKL A;  3JSO A;  4CGZ A;  4S05 A;  3QE2 A;  3V76 A;  5FFX A;  3P9I A;  3G4S B;  4I2O A;  4BY1 J;  4OJ5 A;  5FKN A;  1XQB A;  1RQR A;  4PSW A;  3T0Y A;  5IYP A;  5F1R A;  4YIR X;  2XAS A;  3FK7 A;  3HOS A;  3MCA A;  1WRJ A;  2H27 A;  1ZAR A;  3G1M A;  1QBJ A;  3TO9 A;  3W2A A;  2HU9 A;  5D5V B;  3C7J A;  4G94 A;  1EZG A;  3FK6 A;  4BQA A;  4RB0 A;  2NZM A;  3SJP A;  2STT A;  4A3E J;  3BP8 A;  5B5E C;  1EP2 B;  4KNY A;  1BR2 A;  3AVY A;  1W0T A;  3FM3 A;  3HSF A;  2YU9 J;  4YC5 A;  2P5V A;  2UZK A;  1DUX C;  4O3M A;  3DPL C;  1BC7 C;  2ACJ A;  1XMA A;  4X7F A;  4UUT A;  4LC0 A;  2BYV E;  5FLV A;  2ZO4 A;  3I58 A;  2QEN A;  2QKM B;  3VNU A;  1Y0R A;  1MNM C;  4IQ4 A;  2X85 A;  1RKW A;  4CYD A;  3GF2 A;  1F43 A;  2ZL7 A;  4WCG A;  1FTZ A;  2DJN A;  3GLL A;  2O0Y A;  2WV1 A;  4UY8 I;  3A8I A;  4B3A A;  3KZZ A;  4G7O F;  1JKP C;  4OJP A;  5GTH C;  1KU9 A;  3SHF A;  2GPJ A;  1A31 A;  4DQK A;  2A05 A;  3SZG A;  2CV0 A;  2CWE A;  2LD5 A;  2J5O A;  1BI1 A;  5FA6 A;  1ETK A;  3B73 A;  2JJ2 A;  3BR3 A;  2VKV A;  2EB7 A;  4B3G A;  2VBE A;  4YFN F;  5E8I A;  1R5H A;  2RQQ A;  3S15 J;  4UV8 A;  2WSS A;  3QU3 A;  2HVS A;  2WPD A;  4XLE A;  2DOF A;  2MC4 A;  3OW2 B;  4P9U A;  2GQF A;  1REP C;  1S29 A;  3MZY A;  3FXR A;  2QGU A;  3GRH A;  3A02 A;  2VOD A;  3VB2 A;  3LSR A;  4AVP A;  1IN4 A;  1TWG J;  1KQ9 A;  5C3E J;  2XGE A;  1XPX A;  3MD2 A;  2QTL A;  5EF6 A;  1POG A;  2EZH A;  2E1C A;  1JGG A;  3LWF A;  3RTR A;  4X7E A;  3RIQ A;  2CK3 A;  4KKT A;  1CGP A;  4OAZ A;  2OCC H;  2X48 A;  1XE1 A;  4DQ2 A;  5TIS C;  4P6Y A;  2HOT A;  1P4X A;  3OW7 A;  2WC2 A;  3BC8 A;  2FBH A;  2NNN A;  3MEX A;  4CCM A;  5CDF A;  3E6D A;  3QP5 A;  4UB6 C;  2GQQ A;  5FO0 A;  1FBU A;  4IQJ A;  3BCB A;  1HC8 A;  5FJ8 J;  2PLF A;  1IXC A;  3CMA B;  3QYB A;  1GVJ A;  3T1B A;  3JRE A;  3K4C A;  1WJA A;  1NK2 P;  4TMV A;  2OC6 A;  5IP6 A;  2IRF G;  2X8K A;  2EQR A;  3ZR8 X;  2MA3 A;  1XS9 A;  2JJ1 A;  4QSH A;  2ZXI A;  2Y75 A;  1JKQ C;  2ZIT A;  4L8J A;  1IRG A;  2R93 J;  1O7L A;  3V8L A;  3PO3 J;  1G4D A;  5HNH A;  2WY7 Q;  1RU4 A;  1HLV A;  3C2H A;  4RDL A;  2KKO A;  4RLQ A;  3RQI A;  2OZU A;  3WHB A;  4M72 A;  3WNC A;  4II2 A;  4RCY A;  2QQ8 A;  3OMY A;  1MBH A;  3BZC A;  2DOA A;  2VFN A;  5BPD A;  3LSM A;  3HGG A;  1YW8 A;  5LLQ A;  2GK6 A;  1OMI A;  1QH0 A;  4EW9 A;  1A04 A;  3FZV A;  4EJT A;  2D1V A;  4YEJ A;  1E43 A;  5HNF A;  1KK3 A;  5H6R A;  3A8J A;  4CYC A;  1RZ4 A;  2VQG A;  2ZKZ A;  4IF4 A;  4FHT A;  1Y1V J;  4F91 B;  2FUG 2;  4E7S A;  1LLZ A;  1N8R D;  1FOX A;  4X07 A;  3BR1 A;  4I99 C;  5L46 A;  1TTT A;  1MDM A;  1WQ2 A;  1ETQ A;  3TKY A;  1MNE A;  4OP7 A;  4LB5 A;  2BX6 A;  2XTW A;  2WAQ A;  1XB4 A;  4PJM A;  1SMT A;  3JTG A;  3ZMV A;  1ETO A;  2OJE D;  3ZQC A;  5KK1 A;  2RAE A;  2G7U A;  2VL8 A;  4KIS A;  3LVB A;  2X0L A;  1X1C A;  2E5Z A;  1ETW A;  2R7O A;  2L54 A;  2VZL A;  4F92 B;  5J3L A;  3L2Q A;  2IGO A;  1FX7 A;  2NV4 A;  4MYU A;  3LMM A;  4FT8 A;  5EZH A;  1U5T A;  2VBT A;  1KJZ A;  3M4O J;  1DGR M;  1DP3 A;  3AVT A;  2HI3 A;  1E3O C;  1IB0 A;  3DEW A;  2DYS H;  2RC4 A;  1QO0 D;  1OFC X;  4KN7 X;  3K9T A;  1W87 A;  2XPU A;  3P7N A;  3ZZ0 A;  3IRQ A;  2QQA A;  5H59 A;  3I54 A;  4KIF A;  3CDL A;  2CS3 A;  1JGS A;  2NVX J;  3CPW B;  1R1U A;  5BSY A;  1IDY A;  4DYC A;  3AGP A;  2F5E A;  2IGK A;  5L3F A;  1ZM3 A;  1M1E B;  3CC7 B;  2CGP A;  1SFU A;  1KQ5 A;  1K6Y A;  1UAA A;  2BVM A;  5C1E A;  4MYT A;  3TO6 A;  2XTX A;  3KP7 A;  4YXW A;  4J00 A;  1WXR A;  2JK3 A;  3H5N A;  4ZJZ A;  3Q5F A;  3TDU C;  1O3T A;  1U9N A;  1K6O A;  3QFS A;  1YTY A;  2DO7 A;  2GAU A;  4LIT A;  4Z03 A;  1R22 A;  4ZCM A;  2XT2 A;  2L4M A;  2KLO A;  3NEU A;  2E2I J;  4BKX A;  1ENH A;  1YO5 C;  2DXI A;  2NTQ A;  2I1L A;  1J9Z A;  3IKV A;  2TCT A;  4M3G A;  4MLO A;  2W7N A;  1BOB A;  4E0F A;  3NE5 B;  2L01 A;  4EM1 A;  2PFB A;  1WCM J;  4LOC A;  2QQ9 A;  2CQ7 A;  2X3U A;  1S0U A;  4B4C A;  1RPW A;  3FKS A;  3QFT A;  1O8D A;  2DA7 A;  4NBS A;  1BX0 A;  4DNR B;  1TWA J;  2FX0 A;  5KAI C;  4V19 K;  1IB4 A;  3ZQH A;  1KYW A;  4F3Q A;  2DCU A;  2XPW A;  4I0A A;  2DMU A;  4C2M J;  3CME B;  2Y48 A;  2B7C A;  4KUM A;  4B4D A;  1LQ1 A;  3L2C A;  3HOX J;  2CW8 A;  5ERI A;  4XMY A;  4OMY A;  1TUI A;  2LR8 A;  1XX5 A;  3ERM A;  1HDP A;  4JRA C;  1KGS A;  1FYK A;  1SD6 A;  3SDG A;  3OEE A;  1FEX A;  1OQY A;  2BW3 B;  4MTE A;  4XLP F;  1E2X A;  1W36 D;  1QQI A;  5F6F A;  3FX3 A;  4BDY A;  2BSP A;  2FE3 A;  4YFX F;  2COB A;  3NAR A;  2MLG A;  4DOZ A;  5LBQ A;  2R7W A;  2VPR A;  3KIO A;  4OOI A;  1HSJ A;  3GVK A;  1W5C C;  1BOA A;  3F3X A;  1B6A A;  2EIX A;  2CW7 A;  4XOT A;  2A6E F;  3EET A;  2BY2 A;  4D5C A;  2CU7 A;  1K83 J;  3I4M J;  2DT7 B;  3CLQ A;  4NDL A;  5CQE A;  3N4M A;  2DFI A;  2CQN A;  2JVH A;  3OYA A;  3LNQ A;  3E97 A;  2XGX A;  2XF5 A;  3IHU A;  3CCR I;  4BE0 A;  3S3N A;  2AQF A;  3JQR A;  4ZDL A;  4RD6 A;  2HZT A;  2JSC A;  3M1C A;  1QNT A;  1E3Z A;  1FLI A;  3EYY A;  1OFL A;  2Q2E A;  3VMV A;  4RAY A;  3GTO J;  2F5C A;  2OD5 A;  3RQ4 A;  1BIA A;  1BMF A;  1D2E A;  4F93 B;  5A8A A;  1IC8 A;  1ONV A;  1CLW A;  1X1P A;  3R6S A;  1TWC J;  1QGY A;  1QZE A;  3GFM A;  2LVS A;  4I6Z A;  2O04 A;  2V9P A;  4M9X A;  3PA1 A;  3M7G A;  1I3A A;  4HX7 A;  3Q3S A;  2ZTG A;  5LGN A;  4DK0 A;  3DF8 A;  1JT6 A;  4TV7 A;  1QCX A;  3PSS A;  2UWM A;  1KON A;  1VQ9 I;  2G0E A;  3F22 A;  2F6C A;  1SAN A;  1MH4 A;  1FWZ A;  5F1J A;  1BL0 A;  2Y31 A;  3SZT A;  3LQ6 A;  3DDY A;  3BCD A;  5DNS A;  5EG0 A;  4LIV A;  3JRI A;  5TJJ A;  3ZP5 A;  2PG4 A;  3LSI A;  2EZK A;  2V7V A;  2J5P A;  1KQ8 A;  3DTE A;  2LBF B;  1PDN C;  2GIZ A;  4GDF A;  2R7F A;  1UHW A;  2YX4 A;  5FD5 A;  5ICG A;  1KQS B;  1ZG5 A;  2NXN B;  2D5V A;  1T95 A;  1O3Q A;  1MND A;  1GXQ A;  4D5F A;  3ZQL A;  1SKY B;  3GFI A;  3K0L A;  2JN6 A;  5JVG F;  1U9O A;  4DQL A;  1IXR C;  3BR5 A;  1G8X A;  5GAD J;  3HHH A;  2R7V A;  3KYC B;  3ES9 A;  2O3F A;  2V4J C;  5DDG A;  4CCK A;  1GAQ A;  3C2G A;  5J3O A;  4FE7 A;  4RGR A;  3ASS A;  4E7J A;  2INV A;  1XCB A;  4Y9U A;  2X1E A;  1XCV A;  1CF7 A;  2YWG A;  3AFH A;  2WV0 A;  3PUB A;  1XDU A;  4A3F J;  1BM9 A;  3GVA A;  2VNJ A;  3W2E A;  1HW5 A;  1WJF A;  1B4A A;  2VAS A;  3DKY A;  2BMW A;  1LKX A;  3FMQ A;  2ZME A;  1DAB A;  3HPH A;  2XSD C;  4NK8 A;  4G7X A;  4M3D A;  2JN9 A;  2LRE A;  2LKP A;  2K40 A;  4HPQ A;  1QFY A;  4MHG A;  3PVD A;  4EVI A;  2OBP A;  4HG2 A;  4Z4Z A;  2OTJ I;  3WU1 B;  4M3F A;  1MAB A;  4KIB A;  1H8A C;  4YCQ A;  3KEY A;  4JX6 A;  2X0K A;  2GJP A;  2IA1 A;  2XND A;  2HVR A;  5JI6 A;  2V7U A;  3WTT C;  2KIF A;  4XLF A;  4G5G A;  4PFP A;  3DP7 A;  2L4A A;  1W7P A;  1K8A D;  1OGI A;  5LHI A;  5H5J A;  4PGG A;  2E5N A;  3CW2 A;  1A36 A;  1D1C A;  5KVR A;  1N77 A;  4BE1 A;  2EPF A;  1I8D A;  1X3Z B;  4EEF G;  1ETX A;  4HEA 2;  3D1N I;  1T6Z A;  1YX3 A;  1SVM A;  4LJZ F;  4G7Z F;  3WTX C;  3M9A A;  4JX4 A;  3GTQ J;  1I18 A;  2V1X A;  3UR3 C;  3NB2 A;  1I3Q J;  3WU0 A;  5IPA A;  4RD0 A;  4ASU A;  2VBS A;  4AIJ A;  2KIQ A;  3LSJ A;  5H20 A;  1O4X A;  3I53 A;  3CUQ A;  2DA3 A;  1HW2 A;  4L18 B;  1LDD A;  2L7F P;  1ZRC A;  1T8I A;  2FNA A;  2XZP A;  1Z9C A;  3BG3 A;  2DMT A;  3VO2 A;  1MMN A;  2V1N A;  2VE8 A;  2M4G A;  3K4B A;  4LLG F;  1ON2 A;  1IV6 A;  1OKR A;  1IF1 A;  5KNL A;  3NAU A;  1G59 A;  4HZF A;  5BQT A;  3J80 Z;  1XFO A;  5CVJ A;  4XK4 A;  1NHA A;  3GEZ A;  2IOU G;  2QVO A;  3ABU A;  3OZV A;  1KD1 D;  1HST A;  3Q3A A;  1BW5 A;  1VLY A;  4YAF A;  3P9C A;  4UUV A;  1O8I A;  3FXL A;  3SFI A;  5A2Q K;  4E7L A;  1WH5 A;  1P4M A;  4C30 A;  3BOQ A;  5DCF A;  2ZB9 A;  4Z4U A;  2P7V B;  2HKO A;  2W6I A;  4RGS A;  3ZOB A;  3MHP A;  4HLX A;  2R7Z J;  1EWY A;  1VQP B;  5ICE A;  1JTY A;  1RUO A;  3LA2 A;  1LFB A;  4HV6 A;  2WZN A;  1HG8 A;  3OR2 C;  3GTP J;  4ZYE A;  2GIV A;  2VN2 A;  2ZCW A;  1YRN A;  1K28 D;  4CXF A;  4N9H A;  4ACA A;  4B1R A;  1TQM A;  1BJZ A;  1IJE A;  2W48 A;  3I4N J;  2XV4 S;  4LK1 F;  3F23 A;  1TQI A;  2XIG A;  5FKO A;  4KIT B;  3GTM J;  1N08 A;  3KLO A;  3KLN A;  2BEO A;  4M9S A;  4CHU A;  3OAA A;  2E36 A;  4KA4 A;  4PFO A;  2M87 A;  3TL4 X;  5E17 F;  1ZR4 A;  2Q6L A;  4Y13 A;  4AM3 A;  1U78 A;  1IG7 A;  1U8B A;  3WTW C;  1KZL A;  1KCC A;  1E3P A;  2XRO A;  3SUC A;  2NNY A;  1ZTR A;  4OAY A;  3G05 A;  2CUZ A;  4W8R A;  3ABK H;  3OS1 A;  1K79 A;  2JDI A;  1VQN B;  1AKH A;  3W6V A;  2CC2 A;  1XTA A;  3PFY A;  4R8H A;  3PO2 J;  1QRB A;  3L09 A;  1UG2 A;  2F4O B;  4QVJ A;  3ISP A;  3CMA I;  3SY2 A;  2WAD A;  1ZM4 A;  4ZDP A;  2NYX A;  1IN8 A;  3QQA A;  1Q9S A;  4Y15 A;  4CO8 A;  2UXX A;  3FKJ A;  4HF2 A;  4S0H B;  2F1L A;  2P3M A;  1DBO A;  2AQE A;  3HTU A;  1VQ4 B;  2DFF A;  2R0Q C;  3HOZ J;  1G3Y A;  2BM1 A;  3R60 A;  3U6B A;  1X1A A;  2X6X A;  3DLA A;  2ELK A;  4HBL A;  4TSF A;  3AK5 A;  4ZC3 A;  3V7C A;  1RWR A;  3OP1 A;  3QYE A;  4H9G A;  1ZEL A;  4X8I A;  2VLA A;  3ZPN A;  3T53 B;  2HYF A;  2BM5 A;  3CDH A;  1XGS A;  3RJP A;  4QLC U;  1X19 A;  3DU6 A;  1E63 A;  4UAJ A;  4RAF A;  4ZCI A;  1J5Y A;  1LVA A;  4HNT A;  5AN9 A;  1PJ6 A;  3ZUG A;  3FIS A;  3IAM 2;  3IH4 A;  1UHM A;  5CVI A;  1S5L C;  2WYR A;  2ZJ2 A;  2VT2 A;  4PZJ A;  3KP4 A;  4EM2 A;  1WMR A;  5E20 A;  2RC6 A;  2VJI A;  5IYW A;  2DA2 A;  3LST A;  2ZJR F;  4U9U A;  4E4H A;  3ABM H;  1TW3 A;  5E1X A;  3K70 D;  2XAF A;  5DV5 A;  3VFZ A;  5HZA A;  4JYK A;  4V2F A;  4IPA A;  1W0U A;  1HW1 A;  1R1V A;  1ULY A;  3EQL F;  3R4K A;  3ASO H;  2OYN A;  1NTC A;  1VTN C;  2BN4 A;  3WHC A;  3SDB A;  2CH0 A;  4X1E A;  1LDJ A;  4BJT A;  1W2B B;  1OB5 A;  1TYU A;  2H1K A;  1UD6 A;  1T38 A;  3DFG A;  1RC9 A;  4MO7 A;  2R7R A;  3Q6Q A;  2PJP A;  4ROX A;  2CFO A;  4ASN A;  1WJC A;  4OU0 A;  1FSH A;  5M3F J;  2P6T A;  1RI7 A;  4QV2 A;  2FQ4 A;  4UVC A;  4L9J A;  5E8G A;  1BC8 C;  3E5U A;  3I59 A;  3LL7 A;  2W6J A;  3J81 k;  1ZM9 A;  1ZK8 A;  1Z7U A;  4AC0 A;  1QRY A;  2WTE A;  1UMK A;  1IRX A;  4D1Q A;  3R61 A;  1JTA A;  2OTL B;  3HUG B;  3SZE A;  3CC7 I;  2K27 A;  1BBY A;  3OKX A;  4OPS A;  1LVK A;  1R6R A;  4BHP A;  3U2Q A;  1JKR C;  3MMY B;  5FKK A;  1YJN B;  1OFE A;  2EFN A;  1MBJ A;  2GOX B;  1FYM A;  2G0Y A;  2NPF A;  3BY2 A;  2JQ7 A;  1FIP A;  5ILS A;  1J09 A;  3IRR A;  2Y2Z A;  1B72 A;  3CRZ A;  1GLN A;  3TOA A;  3GQ9 A;  2XZO A;  3FXJ A;  1DPU A;  2R7U A;  5IYD J;  5JBQ A;  1NBM A;  2H6B A;  3H3Z A;  3K4K A;  3N05 A;  1HA8 A;  1NB9 A;  3GBG A;  4FK8 A;  5F4M A;  4Z6Y A;  2KHM A;  5H6Q A;  5HS9 A;  1NK3 P;  1OOC A;  5L3G A;  3VYT B;  3S1M J;  4CQJ A;  3GLX A;  2QCO A;  4YII A;  4ESF A;  5DM6 F;  1XGO A;  2E34 A;  4HF0 A;  4ZYA A;  2P5L C;  3WXM A;  2LSO A;  3ASP A;  3KCC A;  3ZGK A;  3CME I;  4CZZ A;  1WHU A;  1QVU A;  2VBU A;  4HIZ A;  1WJ5 A;  3T8R A;  5A89 A;  2R5Y B;  2NRA C;  4A3I J;  3P9K A;  2LFB A;  5E1W A;  1APL C;  2JJ7 A;  5F4J A;  1OB2 A;  5J4V A;  4RBO A;  3AL0 C;  4WZE A;  3G6E B;  2LY1 A;  2XOK A;  1MMG A;  4PMH A;  4XLC A;  5CLS A;  2EIJ H;  3MWM A;  2ESN A;  3ONY A;  4NQW B;  2B9S A;  1Y8Q B;  2HYG D;  2QSF X;  1F4K A;  2JA5 J;  2DQR A;  1N06 A;  2F5F A;  2IXS A;  1G6N A;  2DAO A;  2LF7 A;  4PC7 A;  2MH9 A;  4YFK F;  1V0E A;  4F55 A;  4ZDO A;  2DK5 A;  5BPI A;  4GGG A;  2IBD A;  3QOD A;  4IHY A;  2EK5 A;  2XVC A;  3M1E A;  3SZP A;  5HVQ C;  5IP7 J;  1VQO B;  4U4B A;  1XG1 A;  2JZY A;  2PN6 A;  2NT6 A;  1TLH B;  5EDN A;  2Z6B D;  3IKT A;  3CP2 A;  4XLN F;  1VHO A;  4RGX A;  1LB2 A;  5IT3 A;  2W24 A;  3N90 A;  3KZI C;  4RAG A;  1EJ9 A;  3CPX A;  4M74 A;  1QHG A;  5LHG A;  4AC9 A;  1A35 A;  1H9T A;  1LE8 B;  3DV8 A;  1D8J A;  1JJ6 C;  1FNC A;  4HX4 A;  4L0Y B;  1W0J A;  3S93 A;  3F6V A;  3CCV B;  5ED4 A;  1K4Z A;  1FDR A;  2XAU A;  3GTJ J;  2HFH A;  4B09 A;  1ODD A;  3E1Y E;  4CCN A;  1S72 B;  1B59 A;  2EFG A;  2B0R A;  3MMP A;  2LC2 A;  4E7H A;  2ZBU A;  5GV7 A;  4V02 C;  3CTA A;  2ETH A;  3IC7 A;  5JFR A;  2AXT C;  2F4M B;  2QBY B;  2Y9Z A;  2H09 A;  2ZXW H;  1LDK B;  3RDI A;  3R6K A;  4I7H A;  3FBI B;  2CW0 F;  2MBF A;  1OPC A;  2OUM A;  4YEI A;  5DUI A;  2RDP A;  4G6Q A;  2XGC A;  3I1F A;  3UW0 A;  1J75 A;  3ZN1 A;  4I02 A;  4U0W A;  2PMU A;  1Q1V A;  3GUD A;  1NB0 A;  1OYI A;  5LRS A;  2BXY A;  3HL2 A;  3I55 B;  3F72 A;  1SMY F;  2X1C A;  3A2K A;  4XKC A;  1Z1D A;  2W7Z A;  2GA1 A;  2O03 A;  3OYE A;  2EWN A;  2GA2 A;  4KMU X;  2MYS A;  3M8F A;  1QA1 A;  3LQQ A;  1SVO A;  3K2Z A;  1QHH D;  3IAS 2;  3OSF A;  4MXN A;  1MH3 A;  2C2W A;  3MKZ A;  3ZRG A;  2EIM H;  2JUC A;  5F0H A;  2JRM A;  3A03 A;  2NS8 A;  2V7F A;  2ZTN A;  2I8D A;  2F4N A;  3CC4 B;  3VO1 A;  1FOW A;  2XHK A;  2E35 A;  2BGI A;  2VQH A;  4PGO A;  1AMO A;  2XNC A;  3O3K A;  1QA6 A;  4M4S A;  2HOE A;  4OPW A;  2DN0 A;  5LFA A;  4ACB A;  1SC7 A;  3VOD A;  4RD3 A;  4OZZ A;  4U49 A;  2CF4 A;  4KIC A;  1R58 A;  5E6T A;  4Z4T A;  1E3X A;  3PQK A;  2R6H A;  5DCM A;  2VC1 A;  2FQ3 A;  4XIC A;  2LH9 A;  3CF5 F;  5D4R A;  2DMN A;  2M4K A;  3RCO A;  4B3X A;  2DTZ A;  1P9Q C;  2DT5 A;  4EV0 A;  2Q1Z B;  3RI4 A;  1ZGW A;  5FRM A;  2ZBV A;  4PJL A;  1UFM A;  1R49 A;  2I10 A;  1L1I A;  2DIE A;  1JI8 A;  1USS A;  1MKM A;  2KFD A;  5J1Y A;  4RJL A;  5J8F A;  3KX2 A;  3ASQ A;  1STZ A;  1TSP A;  2K5C A;  2MD0 A;  3HPG A;  5C4J J;  4Y52 J;  1L3L A;  1TW2 A;  2LP0 A;  1F9N A;  3BQY A;  1W5T A;  2Y0S N;  4E7I A;  4A3L J;  3VWB A;  4KT6 A;  2HZD A;  3PIO F;  3BR0 A;  1R5O A;  1T5E A;  1RR7 A;  1OFM A;  1OJL A;  3J7A O;  4RMN A;  2DEU A;  1IW7 F;  1TWH J;  2H6C A;  3E3V A;  3GX4 X;  3HOV J;  3OEH A;  1CZF A;  2XF7 A;  3EQN A;  2DA4 A;  1YW7 A;  5K5O A;  3DLL F;  4YFO A;  1TP4 A;  3DKW A;  5AIQ A;  5GTI C;  2BXZ A;  2KMU A;  2L9S A;  5IP9 J;  2VYQ A;  2DA6 A;  1ITY A;  3HOY J;  4WXH A;  1S7A A;  1DP7 P;  4YZX A;  3SQV A;  5D8K B;  1R4M B;  2M8G X;  2PEX A;  2HCJ B;  2VE9 A;  3MN2 A;  5FL7 A;  5BS6 A;  2CW5 A;  1D1B A;  3S8P A;  2FJ1 A;  1F1Z A;  5FB2 A;  1JA0 A;  4YDT A;  2GZW A;  2W82 A;  1FRQ A;  3DPU A;  4CA0 A;  1U5T C;  5EGO B;  3SFZ A;  3FHN A;  3MKY B;  1VF9 A;  1HBX G;  1IUY A;  3FPK A;  3JTH A;  1EH6 A;  2K7L A;  1IGN A;  1I7P A;  2Y0S A;  2C4U A;  3W3C A;  3BY1 A;  1MBG A;  1VQP I;  4RS8 A;  3WWG A;  4B43 A;  1YLF A;  2K85 A;  2VFM A;  4KN4 X;  2WAQ N;  2XF6 A;  2FOK A;  3H3V K;  2OV7 A;  2IEK A;  1YX5 A;  2Q6K A;  4P12 A;  2RV8 A;  2JRT A;  3V7R A;  5F0C A;  3G73 A;  2WR8 A;  1GAW A;  1W4M A;  1ERD A;  4WZT A;  2DET A;  1IZ1 A;  3OPO A;  3OZW A;  1R1T A;  4D9J A;  3WQZ A;  1U0J A;  2VIX A;  1KK1 A;  2A5Y B;  3B90 A;  1N75 A;  2O0V A;  2CUE A;  2VFP A;  1JE8 A;  4JP0 A;  2CV2 A;  3GTL J;  1DG1 G;  2D3N A;  3QSY A;  4LBZ A;  4NCN A;  2M8E A;  2GLO A;  1XGN A;  3JQP A;  3OE7 A;  3FMS A;  3PSI A;  5B1A H;  3QOP A;  1CQX A;  4HYE A;  4OM9 A;  4KH3 A;  4FAS D;  5EJC A;  2ID3 A;  3GZ5 A;  3LOC A;  3CCE B;  4GYG A;  1BN8 A;  1VLO A;  1VQN I;  2B7E A;  1NG6 A;  4C0S A;  2QXZ A;  2OQR A;  2X53 S;  5IYC J;  2RGV A;  3VMF A;  1QPM A;  1X58 A;  1YOV B;  2X51 A;  1BPL A;  3H3U A;  3LQR A;  4B47 A;  2QSH X;  3IP4 B;  5E79 C;  3ZQG A;  2X1D A;  4BXX J;  2Z9O A;  2OQG A;  4A3D J;  3UNG C;  3IWZ A;  1K9M D;  3R0A A;  2MD5 A;  2JMW A;  1V55 H;  3SLN A;  2G7H A;  1VQ4 I;  4Z4W A;  4IHW A;  2UUZ A;  1VF7 A;  1V5G A;  3KP3 A;  4JQF A;  1V3F A;  1B8I B;  5FO1 A;  1I6X A;  2O1D A;  3M8E A;  4P22 A;  5K5Q A;  3DXJ F;  4HLY A;  2L5Q A;  3QAH A;  4WK8 F;  2PYH A;  3ZC3 A;  1KTW A;  4X7C A;  3A3G A;  3JAM K;  3ZMU A;  1Z67 A;  5IYR A;  1FMV A;  3CUO A;  3W5U A;  1KTV A;  2F1M A;  1ACI A;  3GIR A;  2DMQ A;  1OYY A;  3ZN0 A;  4P1V A;  3RSN A;  4E7K A;  4KFC A;  1OFD A;  1OCC H;  1OGM X;  2PX9 A;  1PUF A;  2DCE A;  2XAG A;  2J8I A;  4P55 A;  4HRI A;  2PMZ A;  2PI0 A;  4ESJ A;  5K7H A;  4MEX F;  3RYR A;  4AYB A;  5FLX Z;  3EUA A;  4G6D A;  3L1P A;  3EQO A;  1QUF A;  4IOC F;  5A2Q Z;  2P7C B;  4FE4 A;  2KRC A;  3DBL B;  2BM0 A;  1V4R A;  4II3 A;  3BR6 A;  4D0P A;  2CBX A;  2OK8 A;  4ZZL A;  4QTR A;  3LSH A;  2PJR B;  5IOZ A;  3KEO A;  1BLI A;  3BY6 A;  1UD4 A;  2YPR A;  3DQV C;  2HDW A;  5DN6 A;  1Z3Y A;  1BJA A;  2JVG A;  1HCR A;  4GXO A;  3A35 A;  3TGN A;  3F8N A;  4NC7 A;  5D8L B;  4I09 A;  4BQN A;  1FNM A;  3D26 A;  4HX8 A;  1ZM2 A;  3E6B A;  1JXS A;  3K1P A;  1FRN A;  3L00 A;  2W85 A;  3TOB A;  1AIR A;  1I39 A;  2NST A;  3EPZ A;  4ZGQ B;  1IJF A;  2CRG A;  2LK2 A;  5D6E A;  5HS8 A;  4AU7 A;  1MRZ A;  1S9H A;  3JX8 A;  2XZL A;  2P6S A;  2QZ8 A;  1J9I A;  5GPC A;  4EGY A;  2OTL I;  4IOA F;  2ELH A;  4BJ5 C;  2R92 J;  5IYQ A;  1YJN I;  1W1W E;  3E7L A;  2DPU A;  2HPI A;  4OIQ F;  4DIQ A;  2VXD A;  1HQC A;  1V54 H;  2VBW A;  3SKB A;  1EFC A;  1O8L A;  3I4P A;  1FNB A;  1A6I A;  1JHF A;  2KL4 A;  1X0C A;  4OJL A;  1X2N A;  3AVV A;  1UCR A;  5DTD A;  3B6C A;  4QPQ A;  2XTY A;  2PMH A;  1T0F A;  2A6H F;  5TGT A;  5EZG A;  3E20 A;  4P9S A;  3HOT A;  5HKK A;  4MTD A;  1PE9 A;  4N3N A;  3HRM A;  2EIL H;  2Q0O A;  3LSK A;  2MG4 A;  3PFI A;  4ZH4 F;  1TYX A;  4G8X A;  5F64 A;  2YWH A;  3PET A;  3RPU D;  3K4L A;  1I27 A;  3CC2 B;  2GBY A;  4GYI A;  1VFC A;  2VBX A;  4EJO A;  2DOG A;  1ORK A;  3A0H C;  3G1O A;  3AL0 B;  1GO2 A;  2IGN A;  3Q9V A;  5LMZ A;  1JUP A;  2OPT A;  2M30 A;  5FLM J;  1R36 A;  2HKX A;  4MIM A;  1QQ1 A;  1DBG A;  2ZME C;  4DW6 A;  3OYJ A;  3HSE A;  4XQF A;  1O8J A;  4F7Z A;  3GQA A;  1MZB A;  1MSF C;  4E6K G;  4OPO A;  2W25 A;  3G6E I;  4MR0 A;  4TT3 A;  3HC7 A;  3KPH A;  1MBK A;  4BL0 B;  3HSR A;  2BGJ A;  1ZKG A;  1E17 A;  3KRG A;  2UV1 A;  1N05 A;  2QUF A;  3AKZ A;  4QPO A;  1WJE A;  2LLK A;  4HF1 A;  3OIQ A;  4Z4S A;  1BR4 A;  4UZE A;  3MKW B;  3DBH B;  4EGZ A;  1KU2 A;  3OL3 A;  4OMZ A;  3L9F A;  3BCF A;  4XKW A;  2Z2S B;  3CQZ J;  1VQO I;  1QJV A;  4YRV A;  3VPR A;  2XNJ A;  1EKE A;  4A0Y A;  2EFO A;  2NOG A;  2PBI A;  4QWQ A;  1XSD A;  5JMC B;  3FWE A;  4RCZ A;  4RLZ A;  2QYO A;  3IV5 A;  2WJV A;  1HKS A;  2ZZF A;  3FKI J;  5EEG A;  1G2H A;  4IKF A;  1G7S A;  1FOK A;  3IWF A;  3ZQF A;  3K2A A;  2DFH A;  1FZP B;  1RR8 C;  2BOL A;  2XRL A;  3CUQ C;  2XC7 A;  4ENM A;  1B8I A;  2O61 A;  4Y7C A;  3CCV I;  4LB6 B;  1SD5 A;  5F08 A;  4S04 A;  3ZXS A;  1H89 C;  4ZV4 A;  1S72 I;  3S1N J;  2R7S A;  2M0C A;  2XGJ A;  1KRH A;  3LNN A;  1QGP A;  3Q0V A;  2WBM A;  3W2I A;  2QZA A;  1L0O C;  3CJQ B;  3AG2 H;  2EV5 A;  4HOB A;  3PL8 A;  3V4G A;  4ZCL A;  3HEF A;  1KU7 A;  4L5E A;  4BEH A;  1YHQ B;  3ELK A;  1SFK A;  3CCU B;  1OCZ H;  1LFP A;  4L9V A;  3I9V 2;  1QZZ A;  2F4I A;  4PUS A;  2IS1 A;  2HR3 A;  2X6W A;  1XB2 A;  3LYC A;  2NS7 A;  4RD1 A;  3S1Q J;  3CCM B;  3BDD A;  3NWS A;  3ONQ A;  2DQL A;  5HLH A;  4G7H F;  2NVT J;  2Z16 A;  4PJ0 C;  2HMA A;  4TKO B;  3BH7 B;  1SM4 A;  2VNK A;  4NNJ A;  3IH3 A;  3GVJ A;  4BQO A;  1MW7 A;  3I55 I;  3PIP F;  3KET A;  4J0Q A;  4G6T B;  3ECO A;  1OCT C;  2DY1 A;  3GFL A;  3CCL B;  2FXA A;  2C4T A;  3LA7 A;  4YAL A;  1QA3 A;  3C3W A;  4LK0 F;  1LEB A;  2AS5 F;  4MFE A;  3G4S I;  3OYH A;  3FY3 A;  2E1M C;  2KZV A;  4HDV A;  1F36 A;  3WG9 A;  5KAF C;  2BBY A;  3WTV C;  5HLG A;  1YJW B;  2IT0 A;  3SEJ A;  1ETV A;  3LO8 A;  4AID A;  4RB3 C;  1YIT B;  1Y39 A;  3WND A;  2W4S A;  1Q81 D;  1RQP A;  2OA4 A;  2RN7 A;  5M5W J;  3SYJ A;  3OYM A;  2B63 J;  4Y9R A;  2LKS A;  1PKV A;  1TZL A;  4ESB A;  2L9N A;  4A3K J;  3CC4 I;  5ICC A;  3OSG A;  2ICW G;  3DTK A;  1ZH5 A;  2V6C A;  3OZU A;  4CCL A;  4E7Z A;  4RM2 A;  3I64 A;  3K4J A;  2DW4 A;  3CES A;  3K1M A;  3KZY A;  4L9T A;  3VSK A;  4URR A;  2VI6 A;  5LEK A;  2LYC A;  4O5V A;  3ASN H;  2K02 A;  4RGU A;  2D2W A;  4O6J A;  2BM4 A;  1SEU A;  2KIU A;  4NC8 A;  3ZSC A;  1P2F A;  2VJ4 A;  2MLK A;  5LGU A;  5IT9 K;  2YU3 A;  2HTJ A;  3W6J B;  2K9N A;  3ZMS A;  3OS0 A;  2VBY A;  1O7F A;  1MSE C;  1T98 A;  4MQV A;  5KHD A;  3B8H A;  1J0R A;  5L3E A;  3FIW A;  2HDN B;  4ON0 A;  3RPQ A;  1G7R A;  2BPO A;  2M1B A;  2CFX A;  4KYW A;  1XMX A;  4G6I A;  3E1S A;  2DTR A;  3FDY A;  2NS0 A;  5IYB J;  2LKX A;  5B3S H;  1QVT A;  2M5S A;  4YAW A;  1GQ8 A;  5FRO A;  3MCZ A;  1OLT A;  3EYI A;  2R7D A;  4RM3 A;  5HOD A;  1YFH A;  4ITV A;  2WAF A;  1WI9 A;  4BUP A;  2Z99 A;  4B48 A;  2RQP A;  2HQ5 A;  1X4P A;  1OR7 A;  1ZAO A;  4FQG A;  4P9F A;  1CNE A;  4P1W A;  3SXY A;  3S17 J;  2HNH A;  3BJO A;  3U2R A;  4B44 A;  2MC3 A;  2ECB A;  3GFJ A;  5J1U A;  3S2D J;  5E3M A;  2N8G A;  2LDU A;  4RD4 A;  1U5T B;  5HDK A;  3N6Z A;  5CJ9 A;  3HRT A;  4BQQ A;  3GXO A;  2FRH A;  5HDG A;  3S3O A;  3CCS B;  1FSE A;  2ZL6 A;  2E60 A;  1D1N A;  1B9N A;  5JR3 A;  2VOP A;  2IPQ X;  3S2H J;  4DK1 A;  3FXO A;  4PK4 A;  1V5V A;  1PJ5 A;  3TQN A;  2O6W A;  3WNB A;  2XDV A;  5IY5 H;  4Y4R A;  4P3Y A;  2QEX B;  4M71 A;  1UZC A;  4LBV A;  2FSW A;  2Z8G A;  4AIH A;  2VKH A;  4JBA A;  1S4M A;  1E62 A;  4LG0 B;  2PQ8 A;  2P0W A;  5DUK A;  4KKU A;  4KIG A;  1UD3 A;  1YX2 A;  1DAR A;  2F5V A;  2XB5 A;  1O8E A;  1X4O A;  2C5H A;  1TBX A;  1ZRF A;  2JTV A;  1QU3 A;  3LAJ A;  1WSR A;  4HW0 A;  3H09 A;  4BAC A;  2ZSH B;  3BQZ A;  3WG7 H;  3KEW A;  5LEJ A;  2BSA A;  2FF4 A;  3PNV A;  3CB4 A;  4UHT A;  1BI2 A;  3E0J B;  4P3I A;  3VEP A;  2XT4 A;  2K9L A;  3S1R J;  2HOS A;  1WFX A;  3WE2 A;  1KC8 D;  2WA0 A;  5AIP A;  4AD9 A;  2ZZQ A;  2XSJ C;  3KYD B;  2IGM A;  5IK2 A;  4F7D A;  2FA5 A;  1T2K A;  1VBL A;  2B0L A;  2JPB A;  3CZ6 A;  5FFZ A;  1EH7 A;  1ZHF A;  1MBF A;  4BDZ A;  9ANT A;  5ILV A;  1RMG A;  1LFU P;  2P81 A;  4Y17 A;  3BPV A;  1I1G A;  2BZT A;  3CCE I;  2V5I A;  3TO7 A;  4K1X A;  1EA0 A;  1X1B A;  4N4N B;  2DER A;  1GV2 A;  3ZQI A;  5C44 J;  2QA4 B;  3M3Y J;  4HST A;  1YS7 A;  2ZC2 A;  5DD8 A;  5EEH A;  3E6C C;  4Q7J B;  1WDT A;  3SJZ A;  5K7F A;  3OJX A;  2DI3 A;  3ZPP A;  3KE2 A;  5FKM A;  5C4X J;  3W5V A;  3ZCO A;  2QDX A;  2MFZ A;  3W2F A;  5LGT A;  3V8K A;  1VQM B;  2FD5 A;  2QY1 A;  3JRB A;  2BHY A;  2AXL A;  2EFW A;  5DEQ A;  1MIJ A;  3RKQ A;  2L9V A;  3B6A A;  1UST A;  2KRH A;  4IO9 F;  2V9V A;  3HM5 A;  4BJ6 C;  5A88 A;  3J7Y J;  5F04 A;  3FXU A;  3TMO A;  1KK2 A;  3J81 K;  5GAH J;  3S3M A;  1G3W A;  2X3H A;  1E0E A;  2PMD A;  2RC5 A;  4RB1 A;  1WU8 A;  1UB9 A;  2XAH A;  1K4T A;  1K5C A;  5ICF A;  2BV6 A;  2EJR A;  3OOP A;  3OYB A;  2GM4 A;  1EP3 B;  4R1H A;  4UB8 C;  1UHS A;  2FBK A;  2ZNZ A;  3CO7 C;  1MMA A;  2Q2E B;  1J59 A;  4W8Q A;  1LPQ A;  1O3R A;  1WSV A;  3QFR A;  3ZBT A;  3HHG A;  4HE5 A;  1EF4 A;  1KQ0 A;  3OYK A;  1E1Q A;  3DPT A;  3H9N A;  2IP2 A;  3BZK A;  4LFU A;  2MW8 A;  5LRR A;  3JRC A;  4Z4R A;  3CCQ B;  1HF2 A;  1VQ5 B;  1LM1 A;  4Y33 A;  2VKD A;  2VBM A;  5E1Z B;  1VZ0 A;  2F5D A;  5D4S A;  5J35 A;  2LZJ A;  4RPD A;  3RZD J;  4KMF A;  1N0V C;  2V26 A;  3OOC A;  2JA7 J;  3H5A A;  3F8F A;  2GXB A;  2L7M P;  3GSI A;  3FXK A;  1MJ9 A;  3S2W A;  1W7P D;  3RKX A;  2PIA A;  2QTZ A;  2VON A;  4Q48 A;  1IUF A;  1FC3 A;  4AUX A;  4J01 A;  3OIP A;  3HIF A;  1U3E M;  1FT9 A;  1MGT A;  4BHC A;  4G1B A;  1Y0Y A;  2O17 A;  4FET A;  3JRG A;  2WAE A;  2DFE A;  4A5M A;  4OPV A;  2DA1 A;  2F43 A;  4CCO A;  2JPC A;  3WGG A;  2D45 A;  3CMM A;  3BLY A;  3FPP A;  1WGX A;  2IAI A;  4U7B A;  1E3H A;  4K2E A;  1G7C A;  1JJ2 B;  4Z4V A;  2R9V A;  3S16 J;  1IAW A;  3VOE A;  5FGM A;  2CRV A;  3K69 A;  4U0Y A;  1OCR H;  1P6R A;  1JRG A;  2OBR A;  5CKT A;  3M8J A;  4CH7 A;  1E1R A;  1IN5 A;  1WPC A;  1TT5 B;  3HOW J;  1D5Y A;  2EA4 A;  3BCA A;  4HSR A;  4C3H J;  3RYP A;  1NG7 A;  1ZQ3 P;  1OGJ A;  3FXQ A;  3DU1 X;  3QRF F;  4PSX A;  4C3J J;  4N3G A;  1QRC A;  4MEY F;  1HOM A;  4XLH A;  4XL9 A;  2YUS A;  4XNF A;  1VND A;  1XSV A;  4OOV A;  1BI3 A;  1D0Z A;  4LG3 A;  4BXF A;  1RNL A;  1ZGA A;  1BN5 A;  2MGQ A;  1CF7 B;  4C2L A;  1H9G A;  1U8R A;  1W34 A;  1YIJ B;  5FIU A;  3G71 I;  2M7B A;  3WTS C;  2HYJ A;  4RDU A;  4CUG A;  1Y1W J;  4RM0 A;  2ZME B;  1F20 A;  3B8Y A;  1WZ2 A;  2RNG A;  2GK7 A;  2FOW A;  4IVN A;  1VQ6 B;  3JUR A;  4N4O B;  4FTH A;  3CC2 I;  1PJ7 A;  1YG2 A;  2QN6 A;  2EFQ A;  1TL8 A;  4XM3 A;  4BYY A;  4C9Y A;  2A5W A;  4WQM A;  3H92 A;  3ML3 A;  3A01 B;  2X6O A;  1TT0 A;  3TW7 A;  3T8T A;  2AHQ A;  5DD4 A;  2LG4 A;  1GUU A;  4XN0 A;  2HDD A;  3JAM Z;  4LLN A;  1ELO A;  4XRS A;  4HNV A;  2M2E A;  1X3U A;  4H0E A;  1A6Q A;  4CDG A;  1W7P B;  5CVU A;  4J19 A;  3JRD A;  2Z5U A;  2O8X A;  3GWZ A;  5IYN A;  3JRA A;  3B4N A;  4C43 A;  3PSF A;  4HQE A; 
#chains in the Genus database with same CATH homology
 3PSI A;  2KDO A;  3VDX A;  4FAS D;  1KON A;  2IS6 A;  2UWM A;  1O8G A;  1QCX A;  2F6C A;  2ODL A;  3KYL A;  3A4C A;  2VJ5 A;  3OFN A;  4OZY A;  1W9X A;  3PNT A;  1NG6 A;  2QXZ A;  2X53 S;  3DDY A;  3BCD A;  3OYD A;  2GJK A;  4LIV A;  2X51 A;  4AVZ A;  4C2U A;  1BPL A;  4B47 A;  1PXZ A;  3LSI A;  3IP4 B;  2X1D A;  3DTE A;  2LBF B;  3VMW A;  2WY8 Q;  3UNG C;  2KVO A;  1PYV A;  1T95 A;  1WJB A;  1MND A;  2M0M A;  1SKY B;  3K4N A;  2UUZ A;  1W36 C;  1VF7 A;  1IDK A;  1V5G A;  3J7A Y;  1G8X A;  4JQF A;  2BW3 A;  2R7V A;  2O1D A;  4LIU A;  4P22 A;  3K4M A;  1Y6I A;  2UVE A;  2V4J C;  4HWV A;  2L5Q A;  4CCK A;  3C2G A;  2PYH A;  3H0D A;  1KTW A;  4E7J A;  2INV A;  1UD2 A;  3A3G A;  1O8H A;  2X1E A;  4XR6 A;  2L7K A;  3AFH A;  1FMV A;  1E79 A;  1W0K A;  3PUB A;  2F1M A;  3FBN B;  3RSN A;  1WJF A;  3DKY A;  2VAS A;  3L2R A;  4E7K A;  1LKX A;  1OGM X;  3HPH A;  2DCE A;  4NK8 A;  2CV1 A;  4G7X A;  4HRI A;  2LRE A;  4CZC A;  3PJR A;  2QE7 A;  2PMZ A;  3H9J A;  4HPQ A;  4PJJ A;  3D5L A;  3GVL A;  4HG2 A;  4AYB A;  3EUA A;  2R7X A;  3V42 A;  3QOE A;  3EQO A;  3K10 A;  2E1M B;  1MAB A;  2IQ7 A;  4PJN A;  1BR1 A;  3KEY A;  2GJP A;  3OYL A;  4JMQ A;  2XND A;  3LMW A;  2HVR A;  2KRC A;  2LRD A;  1N78 A;  4XLF A;  4C2T A;  2EWE A;  4II3 A;  4ZTJ A;  4PFP A;  1D1A A;  3CJR B;  3LSH A;  1WP6 A;  2PJR B;  1OB0 A;  3OWT A;  3SEQ A;  1BLI A;  1UD4 A;  1O88 A;  2E5N A;  3DQV C;  2HDW A;  2RRE A;  3LSG A;  1D1C A;  4YZA A;  3ZIA A;  1N77 A;  4BE1 A;  1I8D A;  1Z3Y A;  5DN6 A;  2JVG A;  1EA3 A;  3DEE A;  3A35 A;  4HEA 2;  2NTB A;  4NC7 A;  4BQN A;  1YX3 A;  4XOR A;  4DBR A;  4H4K C;  4JOM A;  3I3L A;  1D0X A;  1I18 A;  4GQN A;  3UR3 C;  3D5R C;  1AIR A;  2NST A;  3F9K A;  3EPZ A;  1IDJ A;  1VJS A;  4ASU A;  3A1Y A;  4AU7 A;  1X1D A;  1S9H A;  5JHF A;  1UG0 A;  4DBQ A;  2XZL A;  2LBF A;  2XZP A;  1MMN A;  2V1N A;  3K4B A;  2M4G A;  4BJ5 C;  1HZE A;  5KNL A;  1G59 A;  3DU5 A;  2MAB A;  2A6T A;  4RLF A;  3W2V A;  2HPI A;  2CMP A;  1UEL B;  4DIQ A;  2VXD A;  4EAT A;  3H94 A;  1Z3X A;  2ZSI B;  1O8L A;  3H35 A;  2KL4 A;  1VLY A;  1X0C A;  4OJL A;  1O8I A;  4E7L A;  4YZ0 A;  4XKV A;  4QPQ A;  4C30 A;  5TGT A;  2LOO A;  5HKK A;  1PE9 A;  3VYR B;  3HOT A;  3OR1 C;  4BEH B;  1MMD A;  2JA2 A;  2W6I A;  3G2B A;  3LSK A;  4BS9 A;  3RPU D;  3K4L A;  1HG8 A;  3OR2 C;  5CQG A;  1OHH A;  3AL0 B;  1H8E A;  2R4G A;  1PLU A;  2IGN A;  2LY2 A;  1K28 D;  1DBG A;  2QX3 A;  3OYJ A;  4XQF A;  2D3L A;  1O8J A;  5FRN A;  3GQA A;  4YEL A;  4KIT B;  4XON A;  1DQU A;  4E6K G;  4HNU A;  4YZQ A;  2KP6 A;  4XN3 A;  3OAA A;  1V5F A;  2O5R A;  4P5O A;  4MR0 A;  4TT3 A;  2V31 A;  4PFO A;  3TL4 X;  3HC7 A;  4BL0 B;  4F52 A;  2HVQ A;  2PJR A;  3KRG A;  2UV1 A;  1KZL A;  3OYN A;  1KCC A;  3AKZ A;  3SUC A;  4DK0 A;  4OAY A;  3G05 A;  2CUZ A;  4QPO A;  1WJE A;  3OIQ A;  1HVX A;  4W8R A;  3OS1 A;  2JDI A;  1BR4 A;  3VYS B;  3MKW B;  1DGW Y;  3PFY A;  3OL3 A;  3T56 B;  3BG6 A;  3BCF A;  2PEC A;  2BVL A;  4XKW A;  2ZZE A;  2Z2S B;  1QJV A;  4YRV A;  4XD7 A;  3CP8 A;  2WAD A;  4ZDP A;  1UD5 A;  2WJV A;  1DBO A;  2KQR A;  3FKJ A;  2NSP A;  2W1O A;  2ZZF A;  2AQE A;  2V4D A;  4IKF A;  2GOM A;  2HQA A;  1WJD A;  3QYF A;  1X1A A;  4G7W A;  2X6X A;  2BOL A;  3DLA A;  2XC7 A;  4XLA A;  4TSF A;  4IX7 A;  4ZC3 A;  3LFU A;  1RWR A;  3OL4 A;  3QYE A;  1ZEL A;  3ZXS A;  2V9K A;  4W8S A;  2VLA A;  2R7S A;  3ZPN A;  3T53 B;  2XGJ A;  3LNN A;  2VBK A;  2WBM A;  3DWL E;  1X19 A;  3DU6 A;  1H80 A;  3H9G A;  3W2W A;  4CCJ A;  3CJQ B;  5CPR B;  3PL8 A;  4HNT A;  4X0G A;  2V7Q A;  2L2O A;  4BEH A;  3VSL A;  2WB1 A;  3IAM 2;  1SFK A;  1LFP A;  3VR6 A;  3I9V 2;  1H8H A;  2F4I A;  4PUS A;  2IS1 A;  3OY9 A;  2X6W A;  3GQ7 A;  1WMR A;  1T0F C;  2VJI A;  1D0Y A;  3ONQ A;  3NWS A;  4E4H A;  2Z16 A;  4TKO B;  3K70 D;  3EUH C;  2VXZ A;  4NNJ A;  3GVJ A;  1EE6 A;  3EUK L;  3OYC A;  4BQO A;  2PYG A;  1MW7 A;  2NTP A;  3VSV A;  3OYF A;  3SDB A;  3L2U A;  2CH0 A;  4G6T B;  4OJ5 A;  4BJT A;  4PSW A;  2QKL B;  3S32 A;  4R79 A;  3HOS A;  1UD6 A;  3FY3 A;  3D5S C;  3OYH A;  4BE2 A;  2E1M C;  2KZV A;  3W2A A;  2HU9 A;  2R7R A;  2Z1D A;  2NZM A;  5AMV A;  2CFO A;  2W4S A;  1WJC A;  1BR2 A;  2V6E A;  2JIZ A;  3OYM A;  3H9Q A;  2W00 A;  1PKV A;  1TZL A;  2L9N A;  3SEZ A;  2WJY A;  1BN8 A;  3LL7 A;  4XKB A;  2W6J A;  3DPL C;  3DTK A;  3DTI A;  3GQB A;  4CCL A;  3HG9 A;  4RM2 A;  4E7Z A;  2HPM A;  3K4J A;  3CES A;  3VSK A;  1IRX A;  1Y56 A;  4URR A;  4D1Q A;  5C1C A;  1NHC A;  1SAU A;  1JTA A;  2QKM B;  4KJZ A;  3HUG B;  2LYC A;  1LVK A;  1R6R A;  2DJI A;  4IZZ A;  3MMY B;  4NC8 A;  2VJ4 A;  3ZSC A;  2GOX B;  4IQ4 A;  2X85 A;  3OS0 A;  2HLD A;  1J09 A;  5KHD A;  3VSU A;  2X6Y A;  1GLN A;  4OJP A;  3GQ9 A;  3ZQQ A;  2XZO A;  3SZG A;  2CV0 A;  2R7U A;  1NBM A;  4G6I A;  2JJ2 A;  3E1S A;  1HA8 A;  3K4K A;  3FDY A;  3N05 A;  2E1B A;  2WZP P;  3H5R A;  3GBG A;  2M5S A;  1GQ8 A;  2KHM A;  5FRO A;  4B3G A;  2VBE A;  1OLT A;  1FMW A;  1OOC A;  4RM3 A;  3VYT B;  1Z21 A;  2RQQ A;  2WSS A;  4ZTF A;  4Y3O A;  2HVS A;  2WPD A;  4XLE A;  4ITV A;  4ZYA A;  3T51 B;  1V0F A;  2WAF A;  3ZGK A;  4BUP A;  4B48 A;  1Z7L A;  2MC4 A;  3K70 C;  3BH4 A;  1X4P A;  3PNY A;  4HIZ A;  1WJ5 A;  3GRH A;  4P1W A;  2HNH A;  4B44 A;  1OGO X;  1V5E A;  3AL0 C;  2LY1 A;  3MD2 A;  2ZZG A;  2XOK A;  1MMG A;  2M3A A;  4PMH A;  4XLC A;  4BQQ A;  3S3O A;  3RTR A;  4DGW B;  2E60 A;  3CF2 A;  4NQW B;  2CK3 A;  4KKT A;  3OOU A;  1BHE A;  4OAZ A;  2CUJ A;  4DK1 A;  2IXS A;  4PK4 A;  3OW7 A;  3BC8 A;  5CDF A;  4CCM A;  4Z05 A;  2XDV A;  1V0E A;  4F55 A;  4Y4R A;  4ZDO A;  2Z8G A;  3QOD A;  4OJO A;  4IQJ A;  3BCB A;  2VKH A;  5HVQ C;  4U4B A;  3QYB A;  4CSW A;  4BU2 A;  3K4C A;  1WJA A;  2NT6 A;  2OC6 A;  2P0W A;  2Z6B D;  4W8T A;  4KKU A;  3CP2 A;  2X8K A;  3ZR8 X;  3GQ8 A;  1UD3 A;  4I84 A;  2F5V A;  1O8E A;  2JJ1 A;  1X4O A;  4ANJ A;  3SYT A;  1QHG A;  1QU3 A;  2ZXI A;  4FXU A;  2M7A A;  2VQL A;  4BAC A;  2ZSH B;  4L8J A;  3KEW A;  3PNV A;  1W0J A;  5HNH A;  3S93 A;  2WY7 Q;  3E0J B;  1RU4 A;  2XAU A;  2K9L A;  3C2H A;  4NK6 A;  4CCN A;  1WFX A;  4RLQ A;  3OYG A;  2WA0 A;  2ZZQ A;  3TBI A;  2LC2 A;  2XSJ C;  4E7H A;  4II2 A;  2IGM A;  5IK2 A;  3OMY A;  2ZXH A;  4UZU A;  1VBL A;  2DOA A;  3VST A;  3CZ6 A;  4XOP A;  3LSM A;  4EW9 A;  2GK6 A;  3NWT A;  4YEJ A;  1E43 A;  4BDZ A;  1LDK B;  5HNF A;  3FBI B;  2VQG A;  1RMG A;  2JSP A;  2OUM A;  4F91 B;  2FUG 2;  4E7S A;  1X1B A;  4N4N B;  2KPM A;  3OE7 A;  3UW0 A;  3JU4 A;  1MNE A;  4HST A;  5HLT A;  2WAQ A;  4GRI A;  4PJM A;  3HL2 A;  1FX0 A;  4KIS A;  2VL8 A;  3T9G A;  1X1C A;  2E5Z A;  2R7O A;  2X1C A;  3A2K A;  4XKC A;  4B3F X;  3ZPP A;  4F92 B;  3OYE A;  3L2Q A;  2IGO A;  3ZCO A;  2MFZ A;  2JUG A;  3LMM A;  5LD2 C;  1OR7 C;  2UVF A;  2MYS A;  1DP3 A;  1DGR M;  2QY1 A;  2K3P A;  1QHH D;  2KRH A;  3IAS 2;  4BJ6 C;  4MXN A;  1O8F A;  3TMO A;  3MKZ A;  3ZRG A;  3S3M A;  1EFR A;  2X3H A;  1E0E A;  4NUB A;  2V7F A;  2ZTN A;  2I8D A;  3U21 A;  1K5C A;  2ZFU A;  2CS3 A;  2VQH A;  3OYB A;  2R7Q A;  2ELJ A;  2R7T A;  5LFA A;  4U49 A;  4OZZ A;  2IGK A;  1MMA A;  2Q2E B;  3DKX A;  4W8Q A;  1K6Y A;  1UAA A;  2BVM A;  1E3X A;  4OJ6 A;  5C1E A;  3OYK A;  1E1Q A;  4J00 A;  3DPT A;  4YXW A;  2LH9 A;  3H5N A;  4ZJZ A;  3VYU B;  2M4K A;  3A3B A;  3RCO A;  4B3X A;  2VPL A;  3OYI A;  4Y33 A;  1P9Q C;  2VKD A;  3IUO A;  2VBM A;  4OWR B;  4LIT A;  2Q1Z B;  1VZ0 A;  4Z03 A;  5FRM A;  2KLO A;  4PJL A;  2DXI A;  2LZJ A;  2DIE A;  1JI8 A;  2NTQ A;  3OOC A;  2V26 A;  2W7N A;  2VQC A;  3KX2 A;  4MLO A;  1BOB A;  3H5A A;  3NE5 B;  2IS2 A;  4E0F A;  2K5C A;  2MD0 A;  3HPG A;  1IA5 A;  2VJJ A;  3FKS A;  4Z06 A;  4J01 A;  4E7I A;  3VWB A;  3OIP A;  2HZD A;  4KT6 A;  1O8D A;  2INU A;  4DNR B;  3BC9 A;  2O17 A;  1T5E A;  1IB4 A;  4FET A;  1XG2 A;  1OFM A;  2WAE A;  5KCM A;  3OS2 A;  4CCO A;  2F43 A;  4RMN A;  3CMM A;  3BLY A;  4F3Q A;  3FPP A;  4U7B A;  3OEH A;  1CZF A;  1UD8 A;  2XF7 A;  2R9V A;  3EQN A;  2CW8 A;  4XMY A;  1JRG A;  3K6G A;  2KMU A;  2L9S A;  5CKT A;  3M8J A;  4CH7 A;  2VB6 A;  4U87 A;  1E1R A;  1WPC A;  3OEE A;  3BCA A;  4HSR A;  4YZX A;  3HXL A;  4KKS A;  2BW3 B;  1NG7 A;  1W36 D;  5FL7 A;  2BSP A;  4PSX A;  4BDY A;  1COW A;  1D1B A;  3S8P A;  4XLH A;  4XL9 A;  4DOZ A;  2R7W A;  2W82 A;  4XNF A;  3DPU A;  4CA0 A;  3GVK A;  1D0Z A;  4LG3 A;  4BXF A;  4C2L A;  3HKZ A;  2CW7 A;  4XOT A;  3MKY B;  3FHN A;  1WTH D;  4DNT B;  2M7B A;  1YE9 A;  2DT6 A;  2DT7 B;  5CQE A;  4CUG A;  1O8M A;  1KCD A;  3HAG A;  2Y0S A;  3L2W A;  2JVH A;  3OYA A;  2NOJ B;  3W3C A;  2RNG A;  2GK7 A;  2XF5 A;  3B8Y A;  3JUR A;  4BE0 A;  3WWG A;  4B43 A;  3BG7 A;  3S3N A;  2AQF A;  4N4O B;  4ZDL A;  3M1C A;  2IS4 A;  1E3Z A;  1OFL A;  2XF6 A;  4XM3 A;  2OV7 A;  2A5W A;  2K9M A;  1AA7 A;  4C9Y A;  1NRK A;  1YX5 A;  3VMV A;  1PJR A;  1TT0 A;  3RQ4 A;  1BMF A;  4F93 B;  2LG4 A;  4XN0 A;  1ERD A;  5HOO A;  3OPO A;  4D9J A;  3WQZ A;  1U0J A;  2VIX A;  1O8K A;  2O0W A;  3B90 A;  3L2V A;  2NT9 A;  2O04 A;  1N75 A;  4DJA A;  4BGD A;  1KMH A;  2O0V A;  2GJR A;  2CV2 A;  3B4N A;  3PSF A;  2D3N A;  4Z1M A;  2ZTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...