4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
2UVFA 3ZSCA 4XNFA 2X6XA 4URRA 4YZQA 4XLAA 3T9GA 2X6YA 1IDJA 1O8FA 1RWRA 4XLCA 1O8LA 2VBEA 3B8YA 1RMGA 4XLHA 5AMVA 3VMVA 2EWEA 2X6WA 2O17A 4YZAA 3GQ8A 2QXZA 1O8GA 1X0CA 4HWVA 1VBLA 4XMYA 4XOPA 4AVZA 4MR0A 2BSPA 4W8TA 4XORA 1O88A 4XQFA 4XN0A 2NSPA 4OZYA 1QJVA 1AIRA 3B4NA 4OJPA 4C2LA 4XKWA 1DBOA 4Z03A 2PYGA 2QX3A 4OJ5A 1JRGA 4PMHA 1K5CA 2O0WA 1DBGA 3SUCA 1IB4A 4Z06A 4XKVA 4NK8A 3UW0A 4XOTA 4YEJA 2INUA 1OFMA 1O8EA 2VJJA 1O8JA 3WWGA 1WMRA 2NZMA 4XLEA 3GQ7A 3LMWA 2X85A 4XR6A 3VSTA 2NTBA 4W8RA 1EE6A 1O8HA 4YZXA 1OFLA 4YZ0A 4XL9A 4XM3A 1HG8A 2NSTA 2VJIA 5C1EA 1OOCA 2NTQA 2QY1A 3FY3A 4OJ6A 1O8IA 4W8SA 3ZPPA 2O0VA 5C1CA 2UVEA 4U4BA 1XG2A 2O04A 2VBKA 3EQNA 1NHCA 1O8DA 1IDKA 2NT6A 4I84A 3GQ9A 1PE9A 3EQOA 4YELA 3GRHA 2NT9A 2O1DA 2PYHA 1H80A 3JURA 1RU4A 3KRGA 1KCCA 2IQ7A 1O8MA 1GQ8A 4OJOA 1KTWA 3VSUA 1IA5A 1OGMX 1OGOX 3GQAA 2ODLA 2PECA 2X3HA 1CZFA 1PLUA 3VSVA 4Z05A 3VMWA 4XLFA 4XN3A 1JTAA 4W8QA 1QCXA 4EW9A 1KCDA 2VBMA 4OJLA 1BN8A 4MXNA 2Z8GA 4U49A 4XONA 1O8KA 1BHEA 1PXZA 2NTPA 2INVA 4NK6A 3B90A 4OZZA
chains in the Genus database with same CATH superfamily
3MCZA 3VSKA 4G6DA 3GIRA 2XNCA 2P7VB 2X6XA 1KYWA 1SEUA 3R61A 2IAIA 2TDXA 4KA4A 1K78B 9ANTA 1WJEA 2Z1DA 2FXAA 1VQ7I 1F36A 6PAXA 3IWFA 1YW7A 2M45A 1W7PB 4GYGA 3TKYA 3DPUA 2IT0A 4YZAA 3OL4A 3L1PA 3CPXA 4N0BA 3CMYA 2QZAA 5F0FA 4GGGA 5IYCJ 2YSRA 1FSHA 2IGMA 4JOMA 3G4SB 4W8TA 5J8FA 1MSFC 1VQNB 3I5UA 2AO9A 3TEDA 4LBVA 5JLXA 2AXTC 2GJPA 5TY0A 1YJ9B 4ZGNB 3TW7A 3WBKA 1R1VA 3H1CA 3SYTA 2K9SA 2X4HA 2K4JA 3HBLA 1KU7A 1DPUA 1O7FA 1GR1A 4RM2A 1PJ5A 5CVUA 3DTKA 2TRTA 4BQQA 1FIAA 2DA3A 3LA7A 1MNMC 3CCQB 3ZQCA 4N4NB 2K9MA 2BY2A 4BE2A 3WWGA 1WMRA 3BG5A 4YFNF 2PMUA 1G7RA 2QLZA 2PG4A 3BLYA 2JDIA 2Y48A 2D3LA 5HS9A 3J7AO 1EJ9A 5E3LA 4Y7CA 3ZMSA 3W2WA 2HU9A 1PP8F 1KU9A 2MG4A 4U7DA 3IH3A 3WTXC 1MMGA 1IN5A 3UR3C 1Q1HA 1OFDA 5C1EA 2QBYA 1ZGJA 4A3GJ 5JVTA 1VQ6I 5GAHJ 4JYKA 4MNUA 3GO5A 1U3EM 4W8SA 2CNDA 2EV0A 2JJ1A 1D0XA 1ON1A 1G3TA 4B1RA 3DU5A 3QE2A 4ZCLA 3RYPA 3FZVA 3K4CA 4Q7JB 1RR7A 1GUUA 2A5YB 1UB9A 5FLMJ 3OYFA 5HLIA 2P81A 4RJLA 3T56B 4W97A 3D1NI 3FDYA 4FASD 3JTGA 2QSHX 5LHGA 3I59A 2IS6A 4EGYA 3JAMK 2MSYA 3W5UA 2CYYA 3VSUA 2FEZA 3E7LA 4C2UA 4XRSA 5IT9Z 3Q3AA 2W1OA 5C4JJ 3E1YE 1T5EA 3C2HA 3ASOH 4ON0A 2HYFA 4X6AJ 1HW2A 1KK2A 2YWGA 3H9NA 2DFFA 4UVCA 4F3QA 1DP3A 2C2WA 3LMMA 1BC7C 1YO5C 2RQQA 1ZYRF 1H89C 3A02A 4R79A 4Z05A 5TISC 3ZQGA 5D5WB 2CBXA 5CVRA 1IXSB 4QWQA 4H0EA 3J7AY 2VB6A 4ITVA 5BSYA 2VN2A 2ZNZA 4JX5A 4QVAA 4C0SA 3PETA 1DGWY 3GTGJ 1I7PA 2LKSA 4QHYA 2RC6A 3RTRA 2JZYA 2KIFA 3R0JA 3RKXA 1S8NA 4P22A 4XRSG 3HOUJ 4NBSA 3E97A 2X6YA 1TZLA 5FKNA 2CK3A 2CUZA 2FX3A 5DEQA 2F6CA 4M3EA 4PGHA 4RM0A 3K4LA 3CUOA 1FDRA 1J2XA 2Q0OA 2YWEA 1WCMJ 1VI0A 3C2GA 1TLLA 1VF7A 2DERA 3VMVA 2M34A 3EUKL 3CO6C 3ABMH 1MSEC 2WTEA 3KP6A 5TR9A 2VIXA 4Q5SF 4RD6A 3IC7A 3QPHA 5DYMA 2DFHA 3ES9A 4KKSA 3KP5A 3ZGKA 2HQ5A 3PENA 2CQQA 5HLGA 1UD5A 4FK8A 2BYVE 5CVIA 3MKYB 5EZHA 5ICFA 4E7SA 3KEOA 3N4MA 4KKUA 3G1MA 4ZTJA 1YX3A 1VQ9B 2VFPA 3G4SI 2DA6A 4HOBA 2LBFA 1JI8A 2OF7A 1OYIA 3CCYA 1TYWA 2LNBA 3Q9VA 3B6AA 1T6SA 1IB4A 2LYCA 3E6BA 3L2QA 2XRNA 3WE2A 4U88A 4YEJA 3SZTA 3V42A 2R7ZJ 4PJLA 3IUOA 3CZ6A 2ZBVA 1ONVA 5BMZA 1I1GA 4HX8A 3Q9SA 2F5CA 1SKQA 3ZMDA 3OZWA 4PZJA 3G73A 1P92A 1HF0A 1M1KD 2IA1A 3S3NA 3TOBA 2HQNA 4CUGA 3BJ6A 3WNCA 3PNVA 3P4GA 2RREA 1HZEA 1OFLA 2PMZN 4RD3A 3P27A 4BJ6C 3MWMA 4HNVA 2JTVA 3BOQA 2VODA 2KVOA 3OEEA 2MLGA 2E1MC 2ZTNA 1OCZH 3H9JA 2LOOA 2F48A 3CTAA 2OPTA 2VYQA 2XSJC 2O8XA 2HOAA 5FLXK 4CCJA 2D74A 3KE2A 3OZVA 2OYNA 3B82A 1QZEA 3LL7A 2OBRA 1Y8RB 1MBHA 1XGMA 2E7XA 4WXDA 3TP0A 5LGNA 4G7WA 2QKMB 2YUHA 1OCCH 1XD7A 4YELA 4BGDA 4CSWA 4TMVA 1H80A 1OQYA 2LZJA 3HOZJ 1X4PA 5EEGA 2LP0A 1GQ8A 5KNLA 2KP6A 2XTWA 5IP7J 3I54A 3FM5A 4OPOA 3DP7A 1R7JA 2RNJA 1JB9A 4OM9A 3LAJA 1H9TA 3L9FA 5D5VB 1ZQ3P 3OPOA 3HSRA 1B72A 3HRTA 2KPMA 4E0FA 1VQLB 4P55A 1GV2A 4ENJA 1NK3P 1T38A 1RNLA 2QE7A 1KC8D 3A8IA 1UELB 1YW8A 2H6CA 1X2MA 2R7OA 1RUOA 4ESJA 2PFBA 3BG3A 3FXLA 3IAS2 5KK1A 3AVTA 1JGGA 4B3GA 5FD6A 1RKWA 2DAOA 3R6JA 2HVQA 4B3AA 4EJVA 4OINF 3T9GA 5L3DA 1TNTA 2BY3A 3C3WA 5ED4A 1YHQB 3CP8A 2ZFWA 3SYJA 3WTZA 1L1IA 2R7XA 2BF4A 5B5EC 1LB2A 3I58A 3CCUB 3GX4X 3CD6B 2OBPA 1JNYA 2GZWA 5HODA 2CQNA 3PSIA 3TMOA 4G1VA 4PABA 1MNDA 2E5ZA 4XMYA 3WBJA 5IYPA 1QQIA 4A3KJ 3LO8A 1K4SA 3ESWB 1EFTA 5GTHC 1ERDA 2EWNA 4OWRB 2OJED 4MFDA 2CV1A 2CJJA 4MIMA 1IXCA 5LFAA 1WSUA 1MMSA 4RGSA 1HKTA 1XDUA 1BX0A 1E43A 1G7SA 3QFTA 1LLZA 1ETYA 3BY1A 1R58A 1LDJA 2ZJRF 1COWA 4U9UA 1LKXA 1JRGA 2D2WA 3LA3A 2TCTA 3AG1H 1BPLA 2JA8J 2HR3A 4BEHA 5FKLA 2JRTA 1SAXA 2J7KA 5BSXA 1X3UA 3LSMA 2QGUA 3E3VA 5B1AH 5EG0A 2H1LA 3I9V2 5GTIC 2VJJA 1VQ9I 1E3PA 1B4AA 2PN6A 5H20A 3F8NA 1YRNA 1CF7A 2VONA 3GTPJ 2OK7A 4HPQA 1YJWB 3DTEA 2Y0SA 2VOPA 2HWVA 3PA1A 3PA2A 1M90D 1XN7A 1R36A 2HS5A 3B6CA 3HAGA 1TW2A 1STZA 3JTHA 4OU0A 1HG8A 1QG0A 2CW8A 1FNDA 2JA7J 1WSRA 5J4VA 2P7CB 3WNDA 1Y6IA 5LLQA 4CQJA 1RKTA 2C6YA 4GO1A 3S3MA 3FY3A 1J0RA 4EM1A 1QZZA 1KRHA 2E1MB 3H5NA 1ZM3A 1O3RA 2XAHA 2XSDC 3FMRA 4Z4YA 1U5TC 3OJXA 2P5KA 3CPWB 2QQ8A 1YFHA 4UB8C 1VQOI 2HDCA 1IDKA 3IRRA 3ZQIA 2F5VA 3CF5F 3EQOA 2K40A 4FTHA 1ZH5A 3GRHA 5GADJ 5LMZA 5EGOA 4BS9A 1ZGWA 3RI4A 2CC2A 3A3GA 5F4JA 2QEXB 1W5CC 2CW0F 2E7WA 2EFNA 4MEYF 3KRGA 1N0UA 3S15J 2I8DA 2FOKA 2ZMEC 2A68F 3IH2A 1O8MA 2BX6A 3TDUC 4U7BA 1P4AA 1QRYA 4BBRJ 4IO9F 3GQAA 2YUSA 4F91B 2K4BA 2O6WA 2NNNA 3FKIJ 5CQEA 3GTOJ 3AG4H 2GK6A 2YS9A 3DPLC 5E8GA 3ZMUA 3L2CA 5FL7A 3LVBA 3CC7B 3BH7B 1IV8A 3VSVA 3N05A 1D1AA 3PSSA 2XKOA 2KLOA 4BACA 4U49A 1YYVA 1T95A 2FD5A 3ABKH 5F1RA 3E0JB 4MTEA 3HRSA 4L5EA 4GDFA 1WOOA 4TMXA 4C3JJ 2EZLA 5JHFA 2ZITA 1FT9A 4HW0A 3F72A 1B1BA 1YS6A 3DF8A 3JRDA 2GA2A 1Z7UA 3GWZA 3PIPF 1A8PA 1MMNA 1D5YA 2DPDA 4QFMA 2CF4A 3K2ZA 2EA4A 3FF5A 1RIOH 4OIQF 5J8CA 4E7IA 4ENKA 2L9NA 3GLLA 4C2MJ 3EETA 1O8FA 4LK0F 2VBEA 3ZP5A 1QA3A 3FWEA 2X51A 3CJQB 3GF2A 1VHOA 3HUGB 4Y17A 3T53B 4F93B 4EVIA 4KDPA 3IKVA 1N0VC 2VBZA 4L5JA 3ABTA 2GBYA 2QTZA 4QVJA 3GQ8A 1WDTA 3PM1A 3ERMA 4HE5A 1WOPA 1YHQI 4M71A 1V0FA 2VBSA 2K9LA 4OPWA 4XN0A 4OZYA 4EGZA 2K02A 3UNGC 1U6GA 3A0BC 2Z99A 3K1PA 4UHTA 4WWCA 2PYGA 4U0WA 4AUXA 3OY9A 4L0ZB 1E1QA 4RGUA 5BOXA 3KP3A 3VEPA 1V4RA 1FOWA 2CQ7A 3KLOA 2R5ZA 3FPKA 2D1VA 3HSEA 1QNTA 2V1UA 4M3GA 4GFBA 4PMHA 1WJBA 2NVYJ 3JRBA 5J1UA 4YAOA 3WY9A 4ROXA 4EH1A 4NK8A 2I5UA 1G7TA 1GJRA 2D9RA 2DT7B 4XK4A 5D5XB 2FF4A 3LQRA 4RB3C 4PFOA 4B47A 4Y52J 1KD1D 1EH8A 2DQRA 3W2EA 4ZYEA 2X85A 3S17J 1IGNA 2X1DA 3DKXA 4DQKA 2Q6OA 5D4RA 4O3MA 1G3WA 3I53A 4LOCA 5JFRA 2A5WA 1CLWA 3IWZA 4HDUA 2R0QC 4X7FA 3E6CC 1KZLA 2XGEA 3MQ0A 4RAYA 3L2WA 1S3JA 3GSIA 2G7UA 3CP2A 2MBFA 1SD7A 3C2BA 4QV2A 3CCLI 2HFHA 5E1WA 5KCMA 4QLCU 3I56I 1TWHJ 5E18F 1SKYB 3AG3H 2OCEA 4G6IA 4M6XA 1T2KA 2XPVA 3BTLA 3EQNA 2A69F 1FOYA 3RPQA 4EM2A 3RY8A 2EV6A 1ZLKA 5FKOA 5IOZA 5LBQA 4HEA2 1U5TB 4QPQA 1CNEA 3OSGA 2NOJB 4LG0A 3SQNA 4HNTA 2R93J 4OPVA 4LLNA 2LMDA 1WJFA 4JX6A 2QA4I 1EA3A 1PP7U 4BXFA 3CC4B 1A6IA 2IQ7A 2XHKA 4OJOA 1WRJA 1YIOA 2XZOA 1KTWA 4BU2A 3GCMA 2HCJB 4GXOA 2J5OA 2ZMEB 4S04A 2X3HA 2CFXA 4TV7A 1S7OA 4DNCA 2BY1A 1FBQA 2MFZA 3GXOA 4ABZA 1PJ6A 4Z4SA 2CO5A 4E6KG 1FNBA 1R23A 3M1CA 2VNKA 2M87A 3ECOA 2O5RA 1R5GA 1KQ5A 3FIWA 4BY7J 4V19K 4QUZA 1QCXA 1JHFA 2WBMA 1IB0A 1J59A 3F8MA 1JTYA 3M4OJ 3G1LA 5E1XA 1O8KA 1NRKA 2XUBA 5HXBA 3VO2A 1TT5B 3SKBA 4DZPA 4OIOF 3HRMA 2OA4A 4FISA 2ADUA 1UMKA 3KEWA 3HGYA 2DCEA 3LSKA 4CZZA 2JN6A 2CU7A 4M9XA 5TRDA 2K86A 4XLCA 2NRAC 1GXQA 1XMAA 4ENNA 1E79A 3U6KA 3LSGA 1SFUA 1YQAA 2KL4A 3GVLA 4U0VA 5DN6A 5FRNA 3VR6A 5FRMA 1I3QJ 3PNYA 3KIOA 3TP3A 2CFOA 2LVSA 2JA2A 3CUQA 3LOCA 5H6RA 1X2NA 3S14J 1Q9SA 2M8EA 1X1BA 3CLQA 3L09A 2VFQA 1XMKA 3FXOA 4DW6A 4WZKA 1LM1A 1OKRA 3BTJA 1ZM9A 2L7MP 1IJWC 1UHSA 2IS4A 1I1SA 2NS8A 1IDYA 1UHMA 1BJZA 1SVOA 4A3LJ 1EA0A 5BS6A 3OFNA 3EDPA 3CC2I 1BIBA 5J40A 4I2OA 2RKHA 4Z06A 4LJZF 2GOMA 1K73D 2WA0A 3NARA 2NAZA 2OD5A 1KU2A 3BTCA 4BKXA 4NHJA 1OB5A 3ECHA 3HZJA 2QBYB 3OYKA 4UZUA 1HKSA 1FC3A 1DPRA 2KT0A 2XB5A 4FX4A 4YAUA 2X8KA 4HF0A 1ZR2A 5DS9A 4DQLA 4D7NA 2MYSA 3JR9A 3G71I 5BQTA 2ZL7A 4XR6A 3RZOJ 3VSTA 1MJBA 1R4MB 2EIMH 4IEJA 1O3QA 4G94A 2ACJA 2ESNA 2Y31A 3BZ6A 3U21A 2Y9YA 5DD4A 1EP3B 3J81k 4LG3A 1FNCA 1N78A 4A3JJ 2Q6KA 3HXLA 1ZARA 4Y9UA 2JMWA 3W3CA 4E70A 5A2QZ 2RN7A 2ZBKA 3HB9A 3PJRA 2ZZEA 5EJCA 5F4MA 3I59B 4CCNA 1G7CA 3WHCA 1QA2A 3V7AA 2A05A 5B6IA 4I99C 4PSXA 4Q4ZF 1HF2A 1W5TA 2GXGA 2ZJPF 3U6BA 1ETOA 3NB2A 3ASSA 1SFKA 4G7OF 3LSJA 2OZ6A 3OR1C 1FEXA 2ZL6A 1X1AA 2EV5A 3G05A 3AKZA 4V2FA 4K2EA 3MZYA 3QOPA 4BUPA 2JIZA 4IHVA 1JJ6C 3BZCA 3VNVA 4RM3A 2MD5A 3L2VA 1RU4A 2DYIA 4Y9RA 5LGUA 4IVNA 3WU1B 1JT0A 4B8XA 1YOVB 2H6BA 4D9JA 4P5OA 1V5EA 3BQYA 2N8GA 3CDLA 2B5OA 4U87A 3LYCA 3OOUA 1FYLA 2B0RA 1YS7A 5HDGA 1KMHA 3AVUA 5K5OA 3CCSI 1H8EA 3SEZA 4CDGA 5JLWA 1Y56A 2R92J 3GZNB 4E7HA 2WB1A 3VNUA 5HNFA 3HPHA 4I7HA 1YIJB 3F6OA 3F8FA 1S0UA 1XSVA 5DM7F 1WI3A 1ORKA 2EJRA 2J5PA 2JPBA 3CCRB 3V76A 2FUG2 4KNYA 1XCBA 4MQVA 3GFJA 4G5GA 1UG2A 2Z33A 1H9GA 1NBMA 1UHWA 2MC3A 4C3HJ 1BOAA 2V4JC 4NDLA 4CO8A 3CJRB 4Y13A 5J4YA 2UVFA 3M3YJ 2HVSA 4XNFA 5K1YA 4RBOA 3OOCA 1Q1VA 3O6BB 4ZC3A 1IDJA 2HTSA 3B90A 2P0WA 2IA2A 1LPQA 2ZC2A 4ZZLA 4AF7A 3Q39A 2PIAA 4BPRA 4HAMA 2LKXA 1RUNA 3KP4A 3GVKA 4YIFA 1EF4A 5H6QA 2LBFB 2Q6LA 3J80K 2HOTA 5EMNA 5IK2A 2FNPA 4XOPA 4LBYA 3I3LA 3SLNA 2ELKA 3DBHB 1MBGA 3KX2A 2R7UA 5ILVA 3S2WA 2DI3A 4XORA 2PLYA 2L2OA 2EBIA 2EINH 2ZO4A 4CHUA 2ZJ2A 1ZG3A 2E1NA 1S72I 4OOXA 2DQLA 2IJLA 2HXOA 1X1CA 1JKOC 2V9PA 5E6TA 4OJ5A 1N25A 2KJCA 1BX1A 2F43A 4OAYA 1TBXA 2F1MA 1JA1A 1DBGA 1WGXA 4RAFA 3LSHA 3BG6A 2X48A 2X0LA 2L4MA 4L9VA 5K7HA 3E5XA 2IS2A 1X0CA 4B4DA 3QRFF 2INUA 2DA1A 3UW0A 1H88C 1G59A 4TKOB 4Y3OA 1U9OA 3D5SC 4BQNA 1ZAOA 1ZKGA 5FO5A 3GZ6A 4XLEA 4DOZA 2XC1A 2CRGA 3GEZA 2R4GA 3QPTA 3V8LA 3ZUGA 3K4NA 1B2RA 5EF6A 1WPKA 1FBUA 1TQIA 2ZSHB 4J00A 1ZGAA 1KA8A 4QPOA 3NQOA 3ONUA 4PC6A 5M3FJ 2M1BA 2VKHA 3MAJA 5L3FA 1Z91A 4A3EJ 1GVJA 2VKDA 3EYYA 3LSTA 4KUMA 3OL3A 4JRAC 2DCUA 5HVQC 1NG7A 1JKRC 2CV0A 1VF9A 4A0XA 2WAEA 2FQ4A 3U2RA 3S1NJ 5ICEA 3H0DA 2KJBA 1X19A 4A0YA 2CGPA 2DA2A 2EIJH 2V9KA 1K8AD 2O0VA 2VPRA 3CQZJ 4MQ9F 2DXIA 2HYGD 2XAGA 5AONA 1XG2A 1I6HJ 2DDAA 3FMSA 2K9QA 3WTUC 3K70C 2R7RA 2VFOA 4RDLA 1WHUA 1X3WB 3KP7A 2I10A 2HKOA 1BOBA 4KN4X 3W2AA 4EQQA 2IEKA 1KU3A 1PKVA 1ENHA 1UD6A 1FRQA 1EFUA 4N3NA 1LVAA 3CCVB 3FK7A 4G1BA 1Z7LA 1B72B 1IF1A 2ZBUA 5L46A 2R7VA 4AC9A 2STTA 4X07A 2LFBA 2O8KA 4YAFA 3QPSA 4HLXA 2L4AA 5FNZA 4WWVA 1OGMX 1MH4A 2ODLA 4IRGA 2PECA 2P5VA 1W1WE 2DDBA 1IAWA 3OAAA 4PK4A 1CQXA 3OIOA 3TOAA 3B02A 3A8JA 3EUAA 1YJNI 1DG1G 5CPRB 1E64A 2A07F 5KSWB 3VPRA 3QYBA 4UNOA 1ON2A 2ME6A 5F6FA 1QRCA 3AVXA 4ZZDA 3HOYJ 1VNDA 1XGOA 1V5FA 2DT5A 2DODA 4CCMA 1OJLA 1UMQA 1YITI 4IF4A 4JK1X 1PUEE 5J6XA 3ZN0A 5LEJA 3S1RJ 3FXMA 3HGGA 3K9TA 5M5XJ 3NWSA 2YPRA 3BCAA 3ISPA 2GAUA 4MLOA 3PO3J 4PC1A 2OC6A 3FBIB 4D0PA 3IL2A 2MW8A 3OR2C 2E71A 3BC9A 5DTDA 3BPVA 2E60A 2QCOA 2Y9ZA 2V7VA 3BR6A 4NUBA 3BJAA 5TJJA 5HDKA 5DS0A 1TWCJ 3MKWB 3P9CA 3MN2A 5KAFC 2F3LA 1MZBA 3OSFA 4X1EA 3A3BA 4BEHB 4HWVA 2JRMA 1SD4A 4HSRA 2J8IA 3OEHA 2HDWA 1Y0NA 2KIQA 4NB5A 2HZDA 3EUHC 1Z1DA 5EG0B 1QUEA 4AD9A 2WYRA 1QVTA 2QYOA 4MR0A 3Q38A 3G6EI 2E1BA 2NSPA 1BBYA 4OOVA 4B3XA 4AM3A 3SDGA 2VQCA 4OJPA 2Z5UA 5DDGA 3MCAA 2PI0A 1YRNB 1CF7B 1HSTA 4L0YB 1WTHD 4A3CJ 1W2BB 2QX3A 2V6EA 3MMPA 4NNJA 5CDFA 1ZELA 4A6EA 2CH0A 3QU3A 3GTKJ 1VQ8I 1K5CA 1GVDA 1O57A 2H8RA 2ESHA 1E3OC 2HGCA 3SUCA 3FBNB 4A3IJ 2VFMA 3ASNH 4YRVA 3LJYA 4BQOA 3HL2A 1NH3A 2D3NA 4IRIA 2F4NA 2ZXJA 2HEOA 5HOOA 4LD5A 1WVRA 3H0GJ 4Y33A 2ECBA 1B8IA 3CESA 4IXAA 1D8JA 1DDNA 2NZMA 2NXNB 1FTTA 3M9AA 4LLLA 1DGRM 1TYXA 1P6RA 1SC7A 4EJWA 1IC8A 4A93J 3JAMZ 4DQ2A 4X05A 1FP1D 1SAUA 2OTJB 1HC8A 3SZGA 2R7TA 1EE6A 5H59A 2RQPA 2VBUA 2EILH 4N4OB 2DMPA 1Z9CA 1XG1A 1XPXA 2XF7A 4B43A 2LDUA 2G9WA 2VJ5A 5EGOB 3GYHX 4RD4A 1FP2A 1QVUA 1VJSA 2QN6A 1HCRA 3S16J 3P7NA 4HA8A 5FJ8J 1VQNI 3TO6A 1Q82D 3OYIA 3HOXJ 2WZPP 1KGSA 2XF5A 1KK0A 4EM0B 1OHHA 1VFCA 3VYSB 3AAFA 2FJ1A 5C1CA 1YJ9I 4DIQA 3S8PA 2B0LA 4AYBN 2RAEA 4RLFA 3RQIA 3BR2A 2Z2SB 2NVXJ 1SANA 1JE8A 4J0QA 5BNGA 1ETKA 3MKLA 3SJZA 3J81K 2K3PA 4N3GA 3W6KB 5D6FA 4RCYA 4YEIA 1XQBA 4A3FJ 1TUIA 1FMWA 2HOSA 4C2TA 3WXMA 2W25A 3CCQI 2X0KA 2VLAA 3GW2A 4QTRA 1OFCX 1HA8A 5FGMA 4YHBA 3ASPA 3ZQFA 2KRHA 3KCCA 4P9SA 1QGZA 1MBEA 2F5FA 3IRQA 5JI6A 5HKKA 1IN8A 3CDIA 2DN0A 4RB0A 2XEXA 2VQGA 5E8IA 1E3XA 4OJLA 2E1RA 1UZCA 1QU3A 4MGRA 2XASA 4P9FA 3ONYA 4UZFA 2DJNA 1BR1A 4H4KC 4JP0A 1W9XA 1FX7A 3CUQC 2PLFA 5BPDA 4G7HF 3T0YA 3MFKA 4NK6A 3H3VK 4NBQA 2LY2A 1AU7A 1UD3A 2ZSIB 4WZTA 3ZSCA 2ZZFA 3V8JA 3PVDA 2NNYA 2FBHA 4OIPF 2V7FA 2V7TA 1S9HA 5HS8A 5IP6A 2R5ZB 4R1HA 2BZTA 4ZJZA 2R9VA 3FMQA 4HQEA 5HNHA 4ZDPA 3TQNA 2P5LC 2W6IA 3GVJA 1WJAA 2CUJA 1IRGA 2E1CA 3ZPLA 2RC4A 1N05A 1NB9A 3RKYA 3TW6A 1ZG5A 3FXJA 3A01A 4L18B 4C2LA 3SLDA 3BP8A 5KHDA 2XC7A 2W4SA 3ZMTA 4ZV4A 2HKXA 1D8TA 1Q86D 1KQ8A 5FKKA 5FLXZ 3QFRA 4X8IA 5EDNA 1OR7A 1W7PD 4BHBA 2EFPA 3M8JA 1KZHA 2VZLA 2EK5A 4KIFA 4OMZA 2IGNA 3TBIA 3V4GA 3OKXA 2O0WA 3N90A 3W6JB 1Y0UA 4WZEA 2WAQN 3HM5A 4L9TA 3KYLA 3SHFA 1O8EA 1WFXA 3OYAA 3T1BA 5M5YJ 2F4OB 3HKZN 5KW9A 2NS0A 2VKEA 4LBWA 3BDDA 4M4SA 1ZR4A 2W7ZA 1ZUNB 2DFEA 5JR3A 2NTBA 4RA2A 5DCFA 4Z2YA 3D0SA 3VOEA 2OCCH 3ZOBA 3L2RA 3RQ4A 1E3ZA 3CW2A 5L3GA 3H09A 4XM3A 2FOWA 2WR8A 4LG0B 1YX2A 1P7JA 3RSNA 2V26A 3CMEB 3CMMA 3PO2J 2QY1A 4YG2F 4BYYA 3CRZA 1OCOH 2KRCA 3HTSB 1O8IA 2CQKA 3ZRGA 3ZZ0A 3ZPPA 1V3FA 4LIVA 2COMA 3KETA 4RAZA 3FXQA 3JRHA 2O61A 1UFMA 2F5EA 1Y0YA 1K8FA 4CCKA 3GTJJ 2O04A 2ID6A 4BHPA 3IV5A 1FMVA 2NT6A 3L00A 3J7YJ 4UY8I 3WNBA 2WZNA 2RGVA 1Y39A 1OCTC 3KPHA 3U9GA 1E17A 4W1UA 1WQ2A 1O3TA 1LE8A 1OB0A 4XBFA 1T39A 4OOIA 3RJPA 1TLHB 3E1SA 3PSFA 1SFEA 1RRJA 1IA5A 3W5HA 5IYRA 1FLIA 2VI6A 5DV5A 5THXA 4LFUA 2FBIA 1TYUA 2X1EA 3VMFA 5J1RA 3F21A 2QQAA 4A3BJ 4EW9A 4BBSJ 4MXNA 2OK8A 2Z8GA 4X7EA 1VQ5B 1YLFA 4DK0A 4GRIA 2ZFUA 3C18A 4PUSA 1BI0A 1K9MD 1KQ0A 4AIDA 3RIQA 5B66C 2DYSH 2WWYA 5GV8A 1D3YA 2XT4A 3LQEA 3ZIAA 2D1HA 1SVLA 2DA5A 3CUQB 2ZJQF 2HMAA 1TWAJ 2MH9A 2V31A 3GUDA 4KH3A 2W48A 2AQFA 2JVHA 1I50J 1U8RA 1EP1B 4CH7A 4GCVA 1F43A 1IJFA 2GREA 4ACBA 3F8BA 5AMVA 1W0KA 3WG9A 2OBTA 1U0JA 4ASUA 4IX7A 2HLDA 3SFIA 2LF7A 2LC2A 4YALA 1MJAA 2KZVA 2KIMA 2L7KA 4AVZA 1I6XA 1AWCA 1ELOA 4F7DA 4BY1J 5GAEJ 4KN7X 3K1NA 2FVGA 3I0TA 4HZFA 2WC2A 5A8AA 5GAGJ 4RGXA 3VWBA 1A6QA 2E19A 4AIJA 1YI2B 5B3SH 2DETA 3Q5FA 4Z4ZA 4Y7NJ 3V7CA 4UAJA 4M3FA 2DMUA 3I55B 4NC7A 1LFUP 1VQLI 2WADA 3K4JA 4Q48A 4Z4TA 5KAIC 1QZYA 1QRBA 1U2WA 5AIQA 2VT2A 3K4KA 2G7HA 5C3EJ 5CVJA 4RD1A 2BM6A 1JUMA 3W5VA 4TMZA 4FWTA 1VTNC 1FWZA 4KT6A 4KISA 3K4BA 3E20A 1IRXA 4LIUA 2CSOA 1MBKA 1D0ZA 2DOEA 3KEYA 1K4TA 2GLOA 1R22A 1XB4A 1KK3A 3SZPA 2CW5A 1G4DA 1TWGJ 1D1BA 1IUYA 1E3HA 4OP7A 2BOLA 2ME0A 5CQGA 3GTLJ 2IGKA 4EATA 3SJMA 3CCUI 4ZGQB 1ZRCA 3CD6I 3ASQA 1J09A 4O5VA 2DY1A 3BR1A 3MMYB 4HSTA 3DU6A 4TSFA 4XRFA 3VDXA 5FB2A 3E6DA 3O8GA 4RPBA 3F6VA 1GLNA 3R0AA 5FD5A 2Q8KA 4CYCA 4FXUA 3BG7A 3R4KA 4TMTA 3CLOA 3GVAA 1DDIA 3OWTA 3DBRB 3KEQA 1NHCA 5J47A 3EUHA 3BH4A 3HYIA 3Q3SA 4A0ZA 4B44A 2J8KA 1OGIA 1KJZA 3U1KA 2COBA 4BAYA 3AK5A 4PC3A 1IRZA 3L7WA 1Z05A 2ELJA 2WAFA 4NCNA 5HZAA 2KKOA 1OGOX 4HBLA 3LNNA 1WJ5A 1E0EA 2KFDA 2Q6IA 1YJWI 1R5NA 4PJMA 2NPFA 2XNDA 2H8WA 4HF1A 4FT8A 4HX4A 4FE4A 1DDGA 2QZ8A 4TMWA 2FA5A 1MABA 2BVMA 4ESFA 3I4MJ 1NTCA 1BQEA 3LQ6A 5J35A 3OW7A 4M3DA 4DYRA 4DYCA 3CJNA 1IHMA 2A3SA 2ECCA 1XGNA 1Z3XA 1T98A 2ZNYA 3RPUA 3JRAA 1BW5A 3AL0C 1BA5A 3VO1A 2L9VA 4G7XA 4A2UA 2L7FP 3MKZA 4KIGA 1ETVA 1W36C 2IRFG 3LQQA 3ZR8X 2VOOA 2V6CA 2XPWA 2LD5A 1EV7A 2B7BA 4YFXF 2VBVA 2OTLB 1RETA 2VNHA 2RDPA 3ASRA 3G3ZA 1RWRA 3BG9A 2K27A 1MJ9A 1JGSA 4ZCMA 3CCMB 2Q2EA 2FE3A 2QEXI 4XKBA 1ZHFA 2DU9A 2FRHA 2VC0A 2XNJA 2EWEA 1H8AC 2GQQA 1O8GA 1Z21A 1R5HA 1L3LA 1DARA 1YTYA 2DOGA 3I1FA 4NQWA 3OYDA 1BL0A 2BSPA 3VB2A 1O88A 2XGXA 4RD0A 3JQRA 4DGWB 3B4NA 3BJOA 1T08B 4BHCA 1QGAA 3KFWX 3CC7I 3MZ8A 1E2XA 1TTYA 3V7SA 2XAFA 4S05A 1DBOA 2Y0MA 4X0GA 2BSAA 1X4OA 2RVCA 3C1DA 5FROA 4MO7A 3IH4A 4YFOA 4HIZA 3ZMVA 1H8HA 4GQNA 4XKCA 3GFIA 4P9UA 2PQ8A 3K6GA 5F0HA 1AHDP 2LSOA 2LREA 3FKJA 1VQMB 4XKVA 3OMYA 1T56A 2JJ2A 1OFMA 5CKTA 5IOYA 3S3OA 2AHQA 1X1PA 2LY9A 4CCLA 2DOFA 3DU1X 5GPAA 1B23P 2HDDA 3BY2A 1GT0C 4WXCA 1AKHA 3GQ7A 1T6YA 1GHCA 4JX4A 4LGWA 5E3OA 4PDKA 4IHXA 2C78A 3H5RA 1I3AA 1F1ZA 2M0CA 4B09A 2L9RA 2VT3A 4G6QA 1XFOA 3O8HA 2ETHA 4OOSA 3OYHA 2PJRB 4M9ZA 2EIKH 3S32A 4P6VF 2PMZA 3WTYC 5FIUA 2XDVA 2W7NA 4M6YA 4C43A 2DO7A 4YIIA 1QA6A 3FJOA 2BM7A 1G3SA 3T51B 4MEXF 3HSFA 2XGDA 1O4XA 3JCUC 4I84A 1GVHA 3QOEA 1TTTA 5M5WJ 3AFHA 5DUKA 1MD0A 2WJVA 3OJWA 1VQ7B 2A6EF 1JXSA 1LJ9A 2X9DA 1EP2B 1R5BA 3ZBTA 2NT9A 4LMYA 1R9TJ 2K7LA 4C30A 2DK8A 2WV1A 4RAGA 3BC8A 3VFZA 3KYDB 1RQPA 1JKPC 4HG2A 4P1VA 2JVGA 5J3LA 2WV0A 1KYZA 2IGOA 4F92B 1OGJA 3A35A 5LD2C 3ZXSA 1A31A 4BE1A 1R5OA 3PSZA 3A8KA 2MLKA 2R7WA 4DBRA 1HSJA 1JUSA 2GIZA 5DCMA 1H0MA 2YR2A 4YFKF 2ZL5A 2EB7A 3Q6RA 3BPXA 4PGGA 3WU0A 5IYBJ 5FA6A 2CRVA 3KZIC 2ISYA 4LITA 3NAWA 1WXRA 2A61A 3H35A 4FE7A 4B3FX 4DK1A 5FO1A 3ML3A 1LNWA 4YDTA 1EXMA 1DP7P 2V7UA 5EEAA 3ERED 1PXZA 3A1YA 2VASA 1IN4A 2EZKA 2MC4A 2OQRA 2R7SA 2GJRA 4OZZA 3OS1A 5FFXA 3IKTA 3AL0B 2DK5A 2YU3A 3PUNA 1QVGB 2QUFA 4Z1MA 3DQVC 4EJOA 4IRHA 3TO7A 4A3MJ 2ZB9A 4XLAA 4I09A 4MHGA 1EFRA 4Z4UA 3ZBUA 2IOUG 4UVBA 1OR7C 3FXUA 1O8LA 3RDIA 1CNFA 2Y2ZA 2WJYA 3G2BA 4BNCA 4HF2A 2BGJA 1EH6A 3A03A 4AIHA 1X58A 4UV9A 5K7FA 5C4XJ 4D7MA 4L5IA 5GP9A 3CC4I 4DNRB 4J19A 4I01A 4X7DA 5JBQA 2P6SA 2LRDA 2JT1A 4M6VA 1LDKB 1T6ZA 2ICWG 3FKSA 2XT2A 2BW3A 2EQRA 4AIKA 4EJTA 5AN9A 4L8JA 1VQ6B 1ZG1A 4YCQA 1B8IB 5F27A 1DABA 1WKMA 4MTDA 1V5GA 2ELHA 1PYVA 1NDHA 2X6OA 1Z6RA 5K5RA 2VL8A 3H94A 4WCGA 3FK6A 2M5WA 2ZXIA 4Z6YA 3QPLA 1HDPA 1F4KA 1VQ4B 3WTSC 3J7ZI 1JUPA 2HDNB 2EH3A 1R1TA 4G8XA 4LB5A 4XOTA 2VQLA 4P3IA 1LFPA 2Y0SN 4HX7A 5EZGA 2LR8A 1FYKA 4JQFA 3M07A 4HLYA 3ZCOA 3PQKA 4D5FA 5DM6F 1SFXA 5DSZA 3DCFA 2V9VA 4IHWA 2BM5A 1R71A 2K5CA 2NS7A 1JT6A 5IP9J 4W8RA 2PE3A 1GAWA 1J5YA 3CO7C 1FNMA 2XOKA 1J7KA 2ZZQA 3AVWA 5C44J 1GXPA 4BXUA 1QH0A 3T8RA 1J9ZA 5TGTA 5H5JA 5D5UB 2XPUA 2F4IA 4FCYA 3GTQJ 4N9IA 2EZIA 2RV8A 1K6YA 2BY0A 1MDMA 1KQ9A 4I02A 3WHBA 1WPCA 3BROA 2XB0X 2FBKA 5ICCA 5J1YA 3F23A 3ZMZA 2GPJA 1N07A 1W4MA 3WYAA 3ZZTA 4U4BA 1B6AA 4BJTA 4ZCIA 3AG2H 1XB2A 3GMEA 3SFZA 4QIWN 1B9NA 4E7ZA 4M2LA 1P7IA 3IHUA 5E3MA 1UAAA 4DNTB 2OAZA 2M0MA 1Z3YA 3BCFA 1MNEA 4KMFA 1AMOA 1HBXG 3LA2A 3H3ZA 2ZZGA 3HOSA 2QENA 3WTWC 2KDZA 3KP2A 4CICA 2R5YA 1H42A 1W0JA 3K7AJ 4WX9A 2PX9A 4TN1A 1BM9A 2JSCA 1QBJA 5A89A 2KMUA 4ZDOA 2Z3YA 3R60A 2O3FA 5HLTA 3J80Z 2HTJA 4M9SA 3C7JA 3FX3A 3LNQA 3TH0A 2E1OA 2W24A 1OB2A 1Y8QB 2AXLA 4I98B 1K4ZA 3TO9A 4XLFA 2V7XA 5CYVA 5BPIA 5LRRA 4P25A 4XD7A 4OAZA 5K5QA 2ZXWH 4E7KA 1BR2A 1JKQC 4XICA 4KYWA 1U9NA 4A5MA 2XTYA 1I18A 2RNGA 4MYTA 2PJRA 4IKFA 4A6DA 1OYWA 5L3EA 1C0WA 1QUFA 1LVKA 4AC0A 1W34A 2GA1A 2ZKZA 5CJ9A 2FQ3A 1IUFA 3HHHA 3VSLA 2DMNA 3A01B 3W2HA 3OYMA 1U78A 2DOAA 2PMHA 3FISA 3W2IA 2NOGA 1WI9A 2VXZA 4XLHA 1HQCA 1WOSA 5IT9K 1LLWA 1NJID 1K7AA 4Y15A 5JVGF 5IYDJ 1YX5A 1JJ2B 4QSHA 4JBAA 3BQZA 4EEFG 2RC5A 3EQLF 4A69C 2NVTJ 1F20A 2BBYA 2O7OA 3ZQ7A 2M5SA 1VBLA 1Y1VJ 2VQHA 2BVNA 2H94A 3VYTB 2LK2A 3X2QH 2W6JA 1DU6A 3E6MA 2E5NA 1QJVA 2JUCA 5M3MJ 2HPIA 1EKEA 3SEQA 4BH9A 4II3A 3FXKA 4D5CA 4EJUA 3JREA 2CUFA 1FRNA 5HZBA 1A36A 2DPUA 1P4WA 2BHYA 3QSYA 2HYJA 5FFZA 5D8LB 1YIJI 1G8XA 2BMWA 1XGSA 5E20A 3CCRI 3OE7A 3K10A 2EZHA 2OQGA 1SMYF 4XIDA 1E62A 1ETXA 1NK2P 1QGYA 2OBSA 1UJ8A 1ZLJA 4BXXJ 1LEBA 2BGCA 1FZPB 4RB2C 1VQ4I 4NC8A 3H5AA 4CGZA 2VBWA 1FOXA 1P9QC 4G12A 1O8HA 1BI2A 1EH7A 1MW7A 3FHNA 3DEWA 3QU6A 3Q0VA 4P2NA 2M4KA 3W6VA 2NVUB 2PMDA 5GPCA 1XTAA 3DBLB 1OPCA 4WXHA 1J9IA 3BQJA 3HG9A 5E3NA 4PC7A 1N08A 4OJ6A 2CG4A 1ULYA 4V02C 4YC5A 2L0KA 1LE8B 3OYJA 2GXAA 1HVXA 3A4CA 3BH6B 2UVEA 4KITB 3CXCB 2PEXA 2CQXA 2NYXA 3A2KA 1XX5A 3TGNA 2VBKA 1P4XA 4YXWA 2JUGA 4DYQA 4AWXB 2A6TA 2DA7A 2X53S 4KMUX 4AU7A 1NB0A 3DFGA 2WPDA 1FX0A 4R71A 3HOTA 2Y75A 1VHEA 3PQJA 2C5HA 1BLIA 5HDNA 3DV8A 4Z4VA 1BI1A 2WY8Q 1AA7A 4ZH4F 1HOMA 2XVCA 3DWLE 1IG7A 3DEEA 2JA5J 1T0FA 1S6LA 1YG2A 2LY1A 4RMNA 3H36A 1S5LC 2M4GA 2QQ9A 3PNTA 2QF7A 2CWEA 1ETWA 3WGGA 1VQKB 4X06A 3GTMJ 1QHHD 1MRZA 3CJTB 2C4UA 4LB6B 3GFMA 1RI7A 3OS0A 2M7BA 4IQ4A 2VNJA 5JHUA 3CCEB 4MYUA 3MZHA 1X1DA 1BN8A 1R5ID 4P26A 1DQUA 3SZEA 2XROA 4HE6A 1W36D 1AOYA 3P9IA 4ZYGA 1R4NB 2YX7A 2L5QA 5ILSA 1ZK8A 2Q1ZB 4UVAA 1PUFA 1TP4A 2EFQA 2M2EA 2BEOA 4UUSA 1BJKA 5GV7A 2LF8A 2DIEA 4N9HA 4HNUA 3CB4A 2DLLA 2IXSA 5A88A 4ESBA 2PJPA 1Q7YD 1UD8A 2KDOA 4O6JA 2CV2A 4BQAA 3CCVI 3B73A 4M3BA 2R3SA 1K83J 3F0CA 3S2HJ 4BE0A 5FKMA 3SEJA 3ELKA 3KLNA 1I8DA 1MIJA 2EA2A 3NE5B 1PJ7A 3EYIA 2GM4A 1TL8A 1S29A 3S1MJ 2ISZA 1Z77A 2IVMA 2QKLB 1OYYA 1BR4A 1MMDA 4XLNF 1NG6A 1V55H 2FU4A 1K78A 1ODDA 2XAQA 3B78A 3Q0WA 1OFEA 1L0OC 1YLOA 3BR5A 4UZEA 3QWLA 1LFBA 1QQ1A 1O3SA 2YWFA 2IW5A 5ICGA 2LH9A 1VQOB 4BL0B 2EIXA 2GXBA 1W7PA 2DMTA 3O2PE 3PL8A 1QVFB 3OZUA 2IPQX 1UCRA 1ZM4A 4NC6A 2H1KA 3DPTA 3QP6A 1SD5A 2BV3A 2DFIA 3ML6A 3W2VA 2V4DA 2QTLA 1ZN2A 2JWTA 2XAUA 2F2EA 4S0HB 2L54A 4EV0A 3J81Z 3VYRB 3RZDJ 3NAUA 2DJIA 3FHZA 4CCOA 3REOA 3I71A 4CYCB 1XDSA 1PJRA 3LMWA 3RKQA 2VXDA 1HW5A 5D8KB 1SVMA 1YE9A 3RIRA 3LSRA 1A35A 3MD2A 1QGPA 4G9YA 4ASNA 1TQMA 4BDYA 2AS5F 4E4HA 3OYCA 1ACIA 1KK1A 3S93A 1RQRA 1USTA 1OISA 4KKTA 5IYQA 1XC5A 4B4CA 1OLTA 3PUMA 2NTQA 2B63J 2QDXA 4RDJA 5AIPA 3RKWA 1Y0RA 2GK7A 1VLYA 1WU8A 2M8GX 4RDUA 1W87A 3ZQQA 1LQ1A 1IJEA 2HZTA 3I64A 3JRFA 2P3MA 4ZDLA 3H9GA 3GQ9A 2JPCA 1FNNA 3WTVC 3D5LA 3JURA 5IT3A 2FSWA 2M7AA 3SJPA 3ROUA 2QWWA 2I1LA 2QMUA 2XTXA 1BI3A 1KCCA 4KJZA 3OW2B 3OYLA 3AGPA 4X7CA 2MA3A 2W82A 3VYUB 2JQ7A 3HPGA 1R1UA 4C3IJ 3KZZA 1D0YA 2BXZA 2LKPA 4HDVA 3COAC 3ASTA 4JMQA 4LBZA 2VFNA 4P3YA 1J75A 2WB1N 2ZXHA 2BE5F 4ZYDA 3BTIA 2OTJI 2LTPA 2A6HF 4F7ZA 2R7QA 2WY7Q 2Y30A 2KIUA 1IRFA 2XGCA 1SM4A 2V1DA 1U2RA 3CMAB 1PLUA 4XN3A 1P4MA 3SDBA 3ZQLA 1JTAA 2BM4A 2K85A 4UB6C 2GOXB 2Q2EB 4M72A 1WORA 2EFGA 1VQKI 3LSPA 2E2IJ 2VUMJ 5F4OA 2R6HA 4A12A 3K4MA 1JA0A 3JU4A 1KTVA 2NTPA 3D5RC 2INVA 3GLXA 4IW3B 2V1XA 5D4SA 1K61A 5FO0A 1IW7F 3H92A 3HOVJ 2JA6J 4NQWB 3CCEI 1BJAA 1BMFA 1TT0A 3BCBA 4Z4WA 1HA3A 3DKWA 3OYNA 3N97A 2UZKA 2QVOA 3M8FA 4UUVA 2DYRH 2OU2A 1CGPA 3V7RA 1IO2A 2KHMA 2BPOA 1RESA 2YU9J 2UXNA 2QSFX 1GV5A 2R7FA 4TT3A 2BV6A 2OV7A 1T8IA 1N06A 2JJ7A 3F22A 2IA0A 1SMTA 3BWGA 4AVPA 2MH2A 4G6TB 5F0CA 1TQPA 5DD8A 5DNSA 1G6NA 3F8CA 3CCLB 3DLLF 1QX4A 4A5NA 3I56B 1I27A 2YWHA 3F9KA 4Z03A 1XSDA 3JRIA 1E63A 3BCDA 1AKHB 3I4PA 2UUZA 3JRGA 1R00A 3VODA 1WJCA 1WJDA 5IPAA 3V8KA 1KQSB 3ONQA 2XF6A 1JHHA 3WODF 3SXYA 4ZYAA 2VBYA 4B48A 1WH5A 3WQZA 3PFYA 3BR0A 1QFYA 2QA4B 4XRMA 3ZQHA 3JW4A 3GBGA 1WSVA 4YIRX 3MVPA 2VNIA 2XZLA 4I76A 1USSA 3DEUA 4WF2A 1VZ0A 2KZGA 5CVVA 4FETA 1KONA 3N6ZA 3H9QA 1JJ8C 5LGTA 3OOPA 1FYMA 3HIFA 5B1BH 3JX8A 1IDZA 4PJNA 1RR8C 3JQQA 4YZ0A 2E35A 4XL9A 3IP4B 1VLOA 2K3FA 2O03A 2D45A 4GYIA 1OOCA 1W0TA 3QODA 5F1JA 2C5BA 1Z67A 2DT6A 1ZRFA 2DTRA 1RZ4A 4RLZA 4ACAA 1VQPB 5HS7A 4KIBA 2VBXA 4DZJA 1HW1A 3OYBA 3BT9A 4F55A 1G3YA 2VE9A 4IQJA 2V5IA 1S7AA 2ZTGA 5DCMB 1G2HA 5F04A 2X1CA 3P9KA 2L02A 3TL4X 2HNHA 4P1WA 4H9GA 2O1DA 2PYHA 5IYNA 3QP5A 3QYFA 2UWMA 3BZKA 3KZYA 3PUBA 3FPPA 4CYDA 2K9NA 3HHGA 3IAM2 1QPIA 2Z6BD 4LK1F 1HLVA 4EMSA 4E7JA 3ZPNA 2L7ZA 4UUTA 4ETSA 1M1EB 2O6GE 4OPSA 1ZRDA 5JMCB 1LUJB 2O0YA 4IHTA 2WSSA 1JTXA 1IXRC 3K70D 2EFOA 1TYVA 4YAWA 1WWXA 3VMWA 4W8QA 2BXYA 1BC8C 3E5UA 3QAHA 2VBMA 5IY5H 3P26A 2Y69H 1GO2A 4FHTA 1FTZA 2V79A 2YX4A 3CMEI 2CUEA 4WK8F 4XONA 3HDDA 3CC2B 1QHGA 1FBSA 1WZ2A 2KRFA 2GQFA 4ANJA 2BVLA 3HC7A 4I0BA 3CMAI 2BW3B 2V1NA 3WG7H 1K79A 2XZPA 1WP6A 2B7CA 2DBBA 1CQTA 4URRA 1K28D 2JK3A 1IZ1A 2JSPA 3T8TA 1V0EA 3SY2A 1S4MA 1ZTRA 1ZM2A 3G71B 2XRLA 3TDZC 3B8YA 2KISA 1RMGA 2FX0A 1IN7A 2XAJA 2AHOA 1FY7A 1XCVA 4LC0A 1GDTA 4UV8A 1ITYA 1N8RD 1WH7A 1D8KA 4IHYA 1TW3A 5ERIA 4BDZA 4I0AA 2F5DA 5E79C 3JRCA 4WQMA 2HQAA 1UD2A 1LEAA 3O3KA 2HI3A 1F5TA 3GZ5A 4BJ5C 4XQFA 2UV1A 3ZZUA 2HQRA 1S7EA 1AIRA 3LFUA 2GIVA 2MGQA 4XKWA 2VC1A 3D26A 1Z6TA 1VQ5I 4RDKA 4F52A 3MEXA 4P12A 1TSPA 3F3XA 3ABLH 4J01A 4M74A 1W35A 1HXDA 1D1CA 1Y1WJ 1D1NA 5JLVC 3WTTC 4P6YA 1TNSA 3U1DA 2XGJA 1MBFA 1RPWA 2QQBA 4PJ0C 2P6TA 2L3DA 4KICA 3OIQA 3NEUA 2B9SA 3DLAA 2PBIA 3KYCB 1MDMB 3S2DJ 1F9NA 1V5VA 4Y4RA 1ETQA 1OCPA 1OCRH 2GWRA 2Z9OA 5F64A 1N75A 2FMYA 3Q0UA 3PIOF 3W2GA 4M73A 3CCSB 4M53A 3GQBA 1XE1A 1T6XA 1B59A 4IPAA 1NHAA 3ISXA 4L9JA 1UG0A 1A5JA 3CCJB 2BM1A 2L01A 4FX0A 1T0FC 3JQPA 4Q47A 4K1XA 2VPLA 3M1EA 2ZCWA 4IL6C 4RB1A 1QFJA 3LWFA 2UXXA 3ULQB 2R5YB 4IZZA 2FNAA 4KT5C 1X3ZB 4WZLA 1O7LA 1YI2I 3CDHA 3JSPA 3RYRA 2VKVA 2HXIA 4XLPF 2F4MB 1W5SA 3BR3A 3G1OA 3HJEA 3I55I 1R49A 3OP1A 2VE8A 3HOWJ 4CA0A 4MFEA 4DBQA 1O8DA 2X3UA 3JSOA 1N77A 3RPUD 2NV4A 1F60A 2NVQJ 3QFSA 2STWA 1E1RA 2VJ4A 1IV6A 4RD2A 4AYBA 4D1QA 1TWFJ 2IBDA 1VQPI 1FPQA 5ILUA 2LLKA 2QGGA 4XSXF 1V54H 2AQEA 5LEKA 4KFCA 2CW7A 3UKGA 5J3OA 4PJJA 3ZC3A 2KQRA 3MHPA 1CZFA 3M7GA 3WE3A 3Q6QA 1IN6A 1S72B 5A2QK 2D5VA 3FM3A 3PFIA 2VBTA 5HLHA 3W2FA 1KCDA 3WGIA 2W00A 1MGTA 3A0HC 2OUMA 4RLQA 4CXFA 1W0UA 3SQVA 3DXJF 2DMQA 2L9SA 3L2UA 3AVVA 4HYEA 3PUFA 3LAPA 1D5VA 5K7ZA 1Q81D 4Z4RA 1XSXA 3ABUA 4YZQA 1HKQA 2QM3A 4X0CA 3U2QA 2XIGA 5EEHA 3OYEA 4HV5A 1SD6A 1T33A 4IOCF 1QPMA 4G7ZF 3DTIA 4ENMA 1MH3A 4PC2A 2MABA 4UXNA 5L3BA 1POGA 2BGIA 2IP2A 1MMAA 2C4TA 3K0LA 2X6WA 2P8TA 2HPMA 2O17A 1P2FA 2DEUA 4U0YA 2QXZA 3EPZA 1XS9A 4OMYA 5E1ZB 4M1KA 1YW9A 3RCOA 3OS2A 1MKMA 3R6KA 1R6RA 3R6SA 3K1MA 5LHIA 1K6OA 3H3UA 2ID3A 3E5QA 4PSWA 1U8BA 1RC9A 1UD4A 2M9HA 2F1LA 4IJAA 5KVRA 1QA1A 3K69A 1GAQA 3DDYA 2FMLA 1PDNC 3ZN1A 3A1PA 3HUGA 2B7EA 4P96A 4R8HA 3OV8A 1FJLA 4ZTFA 4FQGA 3K2AA 1BIAA 5E17F 4L9NA 4I6ZA 4XSZF 1APLC 2E2HJ 4PCQA 3DKYA 1I5ZA 2E2JJ 1A04A 1FOKA 1AIPA 3AGQA 5LRSA 1FSEA 3HRUA 5L3CA 4E7LA 3NRVA 1TVCA 5DUIA 4IOAF 3WGHA 3M8EA 3P5JA 5FLVA 2OTLI 1O8JA 1EWYA 1BW6A 2M30A 4LLGF 4FN5A 2W84A 2WAQA 2Z16A 4M0LA 2G0EA 2R7DA 1PVEA 2EPFA 5TV2A 2E36A 3CF2A 3CCMI 2CS3A 1QFZA 3GFLA 3HKZA 2CMPA 3FXRA 4RPDA 4YZXA 1BN5A 2OZUA 4C9YA 1YJNB 2M3AA 2H09A 1ZREA 4ZYHA 4HV6A 1DU0A 3B8HA 3S1QJ 2NSTA 2VJIA 3WU2C 1MBJA 2V7QA 2LG4A 3QYEA 1YITB 2E34A 2BM0A 3BNWA 1FIPA 3I4NJ 5D6EA 2DA4A 2C77A 3CCJI 3OIPA 4OIRF 3KL9A 1EZGA 2G0YA 5H2FC 2MD0A 4CZCA 1TC3C 2JN9A 1B9MA 2BHZA 3BY6A 1DUXC 1PE9A 3T5XA 2DW4A 4DJAA 5IYWA 3LSIA 3NWTA 4RCZA 1LDDA 4IHSA 1VQMI 3QQAA 1Z0XA 1OMIA 2EFWA 2HVRA 2W85A 2HOEA 3LFKA 2DTZA 4HQMA 4PGOA 4II2A 1EFCA 1XMXA 2IS1A 5LHHA 1I39A 4PFPA 3AVYA 1H85A 1PUFB 4AF6A 3G6EB 2XV4S 2V7WA 3HTUA 4UUSB 4A3DJ 2GJKA 3QFCA 2QSGX 2QYUA 2XKPA 4V2GA 1U5TA 1REPC 4RGRA 1SFOJ 4PAAA 5EYRA 1QO0D 3HEFA 2BN4A 4RS8A 2H27A 2P4WA 1VQ8B 1D2EA 4HRIA 2W57A 1BHEA 5F08A 3OYGA 2ZMEA 5CLSA 2O9LA 1HDDC
chains in the Genus database with same CATH topology
2Q1ZB 3VSKA 3KEWA 2X6XA 2DCEA 3LSKA 2V31A 2DIEA 4HNUA 2IXSA 1WJEA 2AQFA 2JVHA 2Z1DA 4XLCA 1UD8A 2KDOA 2CV2A 1E79A 4CH7A 4BE0A 3LSGA 5AMVA 1W0KA 4ASUA 1U0JA 1I8DA 2KL4A 3DPUA 4YZAA 3GVLA 3OL4A 4IX7A 3NE5B 2HLDA 5DN6A 5FRNA 2LC2A 3VR6A 5FRMA 2KZVA 3PNYA 2L7KA 4AVZA 2CFOA 2QKLB 2JA2A 2IGMA 1BR4A 1MMDA 4JOMA 4W8TA 1NG6A 3VWBA 1X1BA 2GJPA 2IS4A 4NC7A 3SYTA 2LH9A 2WADA 3K4JA 4BL0B 3PL8A 3OFNA 4RM2A 3DPTA 3K4KA 4Z06A 3DTKA 3W2VA 2GOMA 4BQQA 2WA0A 2V4DA 2XAUA 4UZUA 3OYKA 4KT6A 4N4NB 3K4BA 2K9MA 1IRXA 3VYRB 4LIUA 4BE2A 2DJIA 4KISA 1D0ZA 4CCOA 3KEYA 2X8KA 1WMRA 2MYSA 1PJRA 3LMWA 3BLYA 2VXDA 4XR6A 2JDIA 3VSTA 2D3LA 1D1BA 1YE9A 2BOLA 3MD2A 5CQGA 2IGKA 4EATA 3U21A 4LG3A 1N78A 3HXLA 3W2WA 4BDYA 2HU9A 4E4HA 3OYCA 1J09A 3S93A 1MMGA 3W3CA 3UR3C 4KKTA 5C1EA 2NTQA 2ZZEA 3PJRA 1OLTA 3MMYB 4HSTA 3DU6A 4TSFA 3VDXA 4W8SA 4CCNA 2JJ1A 2GK7A 1GLNA 1D0XA 1VLYA 4FXUA 4PSXA 3BG7A 3DU5A 3ZQQA 1SFKA 3OWTA 3OR1C 3K4CA 1NHCA 1X1AA 3BH4A 4ZDLA 3H9GA 3AKZA 3G05A 3GQ9A 3D5LA 3OYFA 4BUPA 2JIZA 3T56B 3JURA 2M7AA 4B44A 3FDYA 4RM3A 4FASD 1RU4A 3L2VA 1KCCA 4KJZA 3OYLA 2W82A 3VYUB 2IS6A 3HPGA 3VSUA 4C2UA 2ELJA 2WAFA 1D0YA 2W1OA 4D9JA 1OGOX 3LNNA 1WJ5A 1V5EA 3C2HA 4P5OA 1E0EA 1T5EA 2ZXHA 4U87A 4JMQA 3OOUA 4PJMA 2XNDA 1KMHA 1DP3A 4F3QA 1H8EA 3LMMA 3SEZA 1Y56A 2R7QA 2WY7Q 1PLUA 2RQQA 2BVMA 4E7HA 4R79A 1MABA 4Z05A 4XN3A 2WB1A 3SDBA 1JTAA 5HNFA 3HPHA 3OW7A 2GOXB 2Q2EB 3J7AY 2VB6A 4ITVA 1Z3XA 2FUG2 3K4MA 3AL0C 3JU4A 1DGWY 3D5RC 2INVA 4G7XA 2NTPA 1NBMA 3B90A 3MKZA 2V4JC 1W36C 3CJRB 4NQWB 2UVFA 2HVSA 3RTRA 4XNFA 3ZR8X 1TT0A 3BCBA 1BMFA 3OOCA 4P22A 4ZC3A 3OYNA 2X6YA 1TZLA 1IDJA 2CK3A 2CUZA 1RWRA 2F6CA 2P0WA 3K4LA 2KHMA 4XKBA 3VMVA 3C2GA 1VF7A 3GVKA 3EUKL 2EWEA 4TT3A 2OV7A 2LBFB 1O8GA 5IK2A 2VIXA 1Z21A 4XOPA 3I3LA 3OYDA 2R7UA 3KX2A 4G6TB 2BSPA 4XORA 1O88A 4KKSA 3ZGKA 4DGWB 2L2OA 3B4NA 3F9KA 4Z03A 1UD5A 3BCDA 1DBOA 1X1CA 3MKYB 2UUZA 4E7SA 4X0GA 4OJ5A 4KKUA 1X4OA 1WJCA 5FROA 4ZTJA 1WJDA 1YX3A 2F43A 3ONQA 4OAYA 2XF6A 4HIZA 4GQNA 1H8HA 2F1MA 2LBFA 4XKCA 4ZYAA 1JI8A 1DBGA 4B48A 3WQZA 3K6GA 3BG6A 3LSHA 3PFYA 2LREA 2IS2A 1X0CA 2LYCA 3FKJA 3L2QA 4XKVA 3OMYA 3UW0A 4YEJA 3V42A 2JJ2A 1G59A 5CKTA 4TKOB 4Y3OA 3S3OA 1OFMA 3D5SC 4PJLA 3IUOA 3CZ6A 4BQNA 4CCLA 3GBGA 2XZLA 4XLEA 1VZ0A 4DOZA 3GQ7A 2R4GA 4FETA 3K4NA 3S3NA 1KONA 3H9QA 2ZSHB 3H5RA 4CUGA 4J00A 4QPOA 3PNVA 2RREA 4PJNA 1HZEA 1OFLA 2VKHA 4YZ0A 4XL9A 2VKDA 3IP4B 4BJ6C 3OL3A 2KVOA 3OEEA 5HVQC 1NG7A 3OYHA 2CV0A 2E1MC 2ZTNA 2PJRB 1OOCA 3H9JA 2WAEA 2PMZA 2LOOA 3QODA 3S32A 3H0DA 2XSJC 2DT6A 1X19A 2XDVA 4CCJA 2V9KA 2W7NA 2O0VA 2DXIA 3T51B 3OYBA 3LL7A 1XG2A 4F55A 3K70C 2R7RA 4IQJA 4I84A 2ZTGA 3QOEA 1BOBA 3W2AA 3AFHA 4G7WA 2QKMB 2WJVA 2X1CA 1PKVA 4YELA 3TL4X 2HNHA 4P1WA 4BGDA 4CSWA 1UD6A 1H80A 2NT9A 2O1DA 3QYFA 2UWMA 2PYHA 2LZJA 3FPPA 1Z7LA 3PUBA 4C30A 1X4PA 2R7VA 3IAM2 2Z6BD 3BC8A 1GQ8A 4HG2A 5KNLA 2JVGA 2KP6A 4E7JA 3ZPNA 2IGOA 4F92B 3A35A 1OGMX 5LD2C 3ZXSA 2ODLA 4BE1A 2PECA 3OAAA 4PK4A 2WSSA 2R7WA 4DBRA 3EUAA 3OPOA 3K70D 5CPRB 3VMWA 4W8QA 4LITA 4E0FA 2KPMA 3QYBA 3H35A 4B3FX 2VBMA 4DK1A 2QE7A 4XONA 1V5FA 1QHGA 1UELB 1PXZA 4CCMA 2R7OA 2VASA 3A1YA 4ANJA 2BVLA 2MC4A 3IAS2 3HC7A 2R7SA 2GJRA 4OZZA 2V1NA 2BW3B 3NWSA 3BCAA 3OS1A 2XZPA 4MLOA 3AL0B 4B3GA 1WP6A 2OC6A 3FBIB 4URRA 4Z1MA 1K28D 2JSPA 2HVQA 3DQVC 1V0EA 4XLAA 3OR2C 1EFRA 3T9GA 1OR7C 3BC9A 1O8LA 3CP8A 2E60A 3B8YA 2WJYA 3WWGA 3G2BA 1RMGA 2R7XA 4NUBA 3MKWB 4DNRB 2LRDA 3A3BA 1LDKB 3PSIA 3TMOA 4HSRA 4BEHB 1MNDA 2E5ZA 4XMYA 3FKSA 2BW3A 2HDWA 3OEHA 4BDZA 2HZDA 3EUHC 4MR0A 4L8JA 2HQAA 1UD2A 2E1BA 4BJ5C 4XQFA 1ERDA 2UV1A 4OWRB 4B3XA 2CV1A 2NSPA 2VQCA 1AIRA 4OJPA 3LFUA 1V5GA 4XKWA 1PYVA 5LFAA 1WTHD 1E43A 2QX3A 2VL8A 2V6EA 1JRGA 4NNJA 1COWA 3H94A 1LKXA 5CDFA 1ZELA 2CH0A 4F52A 1K5CA 2ZXIA 1BPLA 4BEHA 3SUCA 4J01A 3FBNB 1D1CA 4YRVA 4BQOA 3LSMA 3HL2A 2D3NA 4XOTA 2VQLA 3I9V2 1LFPA 5HOOA 2XGJA 4JQFA 2VJJA 4Y33A 3CESA 3OIQA 3DLAA 3ZCOA 2NZMA 4Y4RA 1DGRM 4HPQA 1N75A 3DTEA 2Y0SA 2K5CA 1SAUA 4W8RA 3SZGA 2R7TA 3GQBA 2XOKA 2ZZQA 1EE6A 2INUA 4N4OB 1UG0A 5TGTA 2XF7A 3HAGA 4B43A 1HG8A 2CW8A 1T0FC 2F4IA 2VJ5A 2VPLA 1Y6IA 1VJSA 1K6YA 3FY3A 3S3MA 1WPCA 3OYIA 4IZZA 2WZPP 1OHHA 2XF5A 2E1MB 3H5NA 5C1CA 3VYSB 4U4BA 4DIQA 3S8PA 4RLFA 4BJTA 4CA0A 1IDKA 4DBQA 4DNTB 1O8DA 4E7ZA 2Z2SB 2F5VA 3RPUD 1N77A 1UAAA 3EQOA 2M0MA 1Z3YA 3BCFA 3GRHA 1MNEA 2K3PA 1E1RA 2VJ4A 4BS9A 4AYBA 4D1QA 3A3GA 2ZZGA 3KRGA 3HOSA 1FMWA 2I8DA 1O8MA 4C2TA 1W0JA 2AQEA 4U7BA 2VLAA 2CW7A 3GQAA 4PJJA 2KMUA 2KQRA 4F91B 4ZDOA 1HA8A 2KRHA 5HLTA 1CZFA 5CQEA 2GK6A 5HKKA 3DPLC 5FL7A 3VSVA 2VQGA 3N05A 1D1AA 4XLFA 1KCDA 2KLOA 4BACA 1E3XA 4OJLA 4U49A 1T95A 2W00A 1QU3A 3E0JB 2OUMA 4RLQA 4XD7A 4H4KC 1BR1A 4OAZA 1W9XA 5JHFA 4E7KA 1BR2A 2L9SA 3L2UA 4NK6A 1I18A 2RNGA 1MMNA 2PJRA 1UD3A 2LY2A 4IKFA 2ZSIB 3ZSCA 2ZZFA 1LVKA 4YZQA 3VSLA 4E7IA 2L9NA 2V7FA 3OYMA 1O8FA 3OYEA 2DOAA 2VBEA 1S9HA 2VXZA 2X51A 3CJQB 4XLHA 3HUGB 3T53B 4F93B 3DTIA 2MABA 1YX5A 4ZJZA 1MMAA 2R9VA 2X6WA 2O17A 5HNHA 2HPMA 3GQ8A 2QXZA 4ZDPA 3EPZA 2M5SA 2W6IA 3GVJA 1WJAA 2CUJA 3RCOA 1VBLA 2VQHA 3OS2A 1R6RA 3VYTB 1V0FA 2W6JA 2K9LA 4PSWA 4XN0A 4OZYA 2E5NA 1QJVA 1UD4A 4C2LA 2HPIA 3UNGC 3SEQA 4II3A 1IB4A 3DDYA 2PYGA 5KHDA 2XC7A 2W4SA 1E1QA 3OY9A 4ZTFA 1G8XA 3M8JA 4PMHA 3TBIA 1WJBA 2IGNA 3OE7A 3K10A 2O0WA 3DKYA 3KYLA 4NK8A 2DT7B 4E7LA 1O8EA 1WFXA 3OYAA 4PFOA 4B47A 1O8JA 2WAQA 2Z16A 2X85A 4NC8A 3CF2A 2NTBA 2CS3A 2X1DA 3DKXA 3H5AA 4HWVA 1P9QC 3HKZA 2CMPA 4YZXA 1O8HA 4C9YA 3L2RA 3RQ4A 1MW7A 3FHNA 2M3AA 1E3ZA 2A5WA 2M4KA 4XM3A 1KZLA 3L2WA 2VJIA 2NSTA 3RSNA 2V26A 3CMMA 2QY1A 2V7QA 3CP2A 3HG9A 4OJ6A 2LG4A 2KRCA 1O8IA 3QYEA 1HVXA 5KCMA 3OYJA 3ZRGA 3ZPPA 4LIVA 3A4CA 2UVEA 4KITB 1SKYB 3OIPA 4CCKA 4G6IA 3A2KA 2O04A 2VBKA 3EQNA 2MD0A 4CZCA 4YXWA 1FMVA 2JUGA 2NT6A 2A6TA 2X53S 1PE9A 4AU7A 4DJAA 2WPDA 4HEA2 4QPQA 3LSIA 3NWTA 1FX0A 2NOJB 3HOTA 4HNTA 1BLIA 1WJFA 2WY8Q 1AA7A 1EA3A 3DWLE 4BXFA 2HVRA 2IQ7A 3DEEA 4OJOA 2XZOA 1OB0A 1KTWA 4II2A 3E1SA 3PSFA 4BU2A 1IA5A 2LY1A 4RMNA 2IS1A 2M4GA 3PNTA 4PFPA 2X3HA 2MFZA 1QHHD 2GJKA 2X1EA 4E6KG 3M1CA 3OS0A 2M7BA 2O5RA 4IQ4A 4EW9A 1QCXA 2WBMA 1X1DA 1BN8A 4MXNA 2Z8GA 4DK0A 4GRIA 1DQUA 2ZFUA 4PUSA 4HRIA 1O8KA 1NRKA 1BHEA 1W36D 3OYGA 2L5QA 3ZIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  3ZSC A;  4XNF A;  2X6X A;  4URR A;  4YZQ A;  4XLA A;  3T9G A;  2X6Y A;  1IDJ A;  1O8F A;  1RWR A;  4XLC A;  1O8L A;  2VBE A;  3B8Y A;  1RMG A;  4XLH A;  5AMV A;  3VMV A;  2EWE A;  2X6W A;  2O17 A;  4YZA A;  3GQ8 A;  2QXZ A;  1O8G A;  1X0C A;  4HWV A;  1VBL A;  4XMY A;  4XOP A;  4AVZ A;  4MR0 A;  2BSP A;  4W8T A;  4XOR A;  1O88 A;  4XQF A;  4XN0 A;  2NSP A;  4OZY A;  1QJV A;  1AIR A;  3B4N A;  4OJP A;  4C2L A;  4XKW A;  1DBO A;  4Z03 A;  2PYG A;  2QX3 A;  4OJ5 A;  1JRG A;  4PMH A;  1K5C A;  2O0W A;  1DBG A;  3SUC A;  1IB4 A;  4Z06 A;  4XKV A;  4NK8 A;  3UW0 A;  4XOT A;  4YEJ A;  2INU A;  1OFM A;  1O8E A;  2VJJ A;  1O8J A;  3WWG A;  1WMR A;  2NZM A;  4XLE A;  3GQ7 A;  3LMW A;  2X85 A;  4XR6 A;  3VST A;  2NTB A;  4W8R A;  1EE6 A;  1O8H A;  4YZX A;  1OFL A;  4YZ0 A;  4XL9 A;  4XM3 A;  1HG8 A;  2NST A;  2VJI A;  5C1E A;  1OOC A;  2NTQ A;  2QY1 A;  3FY3 A;  4OJ6 A;  1O8I A;  4W8S A;  3ZPP A;  2O0V A;  5C1C A;  2UVE A;  4U4B A;  1XG2 A;  2O04 A;  2VBK A;  3EQN A;  1NHC A;  1O8D A;  1IDK A;  2NT6 A;  4I84 A;  3GQ9 A;  1PE9 A;  3EQO A;  4YEL A;  3GRH A;  2NT9 A;  2O1D A;  2PYH A;  1H80 A;  3JUR A;  1RU4 A;  3KRG A;  1KCC A;  2IQ7 A;  1O8M A;  1GQ8 A;  4OJO A;  1KTW A;  3VSU A;  1IA5 A;  1OGM X;  1OGO X;  3GQA A;  2ODL A;  2PEC A;  2X3H A;  1CZF A;  1PLU A;  3VSV A;  4Z05 A;  3VMW A;  4XLF A;  4XN3 A;  1JTA A;  4W8Q A;  1QCX A;  4EW9 A;  1KCD A;  2VBM A;  4OJL A;  1BN8 A;  4MXN A;  2Z8G A;  4U49 A;  4XON A;  1O8K A;  1BHE A;  1PXZ A;  2NTP A;  2INV A;  4NK6 A;  3B90 A;  4OZZ A; 
#chains in the Genus database with same CATH topology
 3MCZ A;  3VSK A;  4G6D A;  3GIR A;  2XNC A;  2P7V B;  2X6X A;  1KYW A;  1SEU A;  3R61 A;  2IAI A;  2TDX A;  4KA4 A;  1K78 B;  9ANT A;  1WJE A;  2Z1D A;  2FXA A;  1VQ7 I;  1F36 A;  6PAX A;  3IWF A;  1YW7 A;  2M45 A;  1W7P B;  4GYG A;  3TKY A;  3DPU A;  2IT0 A;  4YZA A;  3OL4 A;  3L1P A;  3CPX A;  4N0B A;  3CMY A;  2QZA A;  5F0F A;  4GGG A;  5IYC J;  2YSR A;  1FSH A;  2IGM A;  4JOM A;  3G4S B;  4W8T A;  5J8F A;  1MSF C;  1VQN B;  3I5U A;  2AO9 A;  3TED A;  4LBV A;  5JLX A;  2AXT C;  2GJP A;  5TY0 A;  1YJ9 B;  4ZGN B;  3TW7 A;  3WBK A;  1R1V A;  3H1C A;  3SYT A;  2K9S A;  2X4H A;  2K4J A;  3HBL A;  1KU7 A;  1DPU A;  1O7F A;  1GR1 A;  4RM2 A;  1PJ5 A;  5CVU A;  3DTK A;  2TRT A;  4BQQ A;  1FIA A;  2DA3 A;  3LA7 A;  1MNM C;  3CCQ B;  3ZQC A;  4N4N B;  2K9M A;  2BY2 A;  4BE2 A;  3WWG A;  1WMR A;  3BG5 A;  4YFN F;  2PMU A;  1G7R A;  2QLZ A;  2PG4 A;  3BLY A;  2JDI A;  2Y48 A;  2D3L A;  5HS9 A;  3J7A O;  1EJ9 A;  5E3L A;  4Y7C A;  3ZMS A;  3W2W A;  2HU9 A;  1PP8 F;  1KU9 A;  2MG4 A;  4U7D A;  3IH3 A;  3WTX C;  1MMG A;  1IN5 A;  3UR3 C;  1Q1H A;  1OFD A;  5C1E A;  2QBY A;  1ZGJ A;  4A3G J;  5JVT A;  1VQ6 I;  5GAH J;  4JYK A;  4MNU A;  3GO5 A;  1U3E M;  4W8S A;  2CND A;  2EV0 A;  2JJ1 A;  1D0X A;  1ON1 A;  1G3T A;  4B1R A;  3DU5 A;  3QE2 A;  4ZCL A;  3RYP A;  3FZV A;  3K4C A;  4Q7J B;  1RR7 A;  1GUU A;  2A5Y B;  1UB9 A;  5FLM J;  3OYF A;  5HLI A;  2P81 A;  4RJL A;  3T56 B;  4W97 A;  3D1N I;  3FDY A;  4FAS D;  3JTG A;  2QSH X;  5LHG A;  3I59 A;  2IS6 A;  4EGY A;  3JAM K;  2MSY A;  3W5U A;  2CYY A;  3VSU A;  2FEZ A;  3E7L A;  4C2U A;  4XRS A;  5IT9 Z;  3Q3A A;  2W1O A;  5C4J J;  3E1Y E;  1T5E A;  3C2H A;  3ASO H;  4ON0 A;  2HYF A;  4X6A J;  1HW2 A;  1KK2 A;  2YWG A;  3H9N A;  2DFF A;  4UVC A;  4F3Q A;  1DP3 A;  2C2W A;  3LMM A;  1BC7 C;  1YO5 C;  2RQQ A;  1ZYR F;  1H89 C;  3A02 A;  4R79 A;  4Z05 A;  5TIS C;  3ZQG A;  5D5W B;  2CBX A;  5CVR A;  1IXS B;  4QWQ A;  4H0E A;  3J7A Y;  2VB6 A;  4ITV A;  5BSY A;  2VN2 A;  2ZNZ A;  4JX5 A;  4QVA A;  4C0S A;  3PET A;  1DGW Y;  3GTG J;  1I7P A;  2LKS A;  4QHY A;  2RC6 A;  3RTR A;  2JZY A;  2KIF A;  3R0J A;  3RKX A;  1S8N A;  4P22 A;  4XRS G;  3HOU J;  4NBS A;  3E97 A;  2X6Y A;  1TZL A;  5FKN A;  2CK3 A;  2CUZ A;  2FX3 A;  5DEQ A;  2F6C A;  4M3E A;  4PGH A;  4RM0 A;  3K4L A;  3CUO A;  1FDR A;  1J2X A;  2Q0O A;  2YWE A;  1WCM J;  1VI0 A;  3C2G A;  1TLL A;  1VF7 A;  2DER A;  3VMV A;  2M34 A;  3EUK L;  3CO6 C;  3ABM H;  1MSE C;  2WTE A;  3KP6 A;  5TR9 A;  2VIX A;  4Q5S F;  4RD6 A;  3IC7 A;  3QPH A;  5DYM A;  2DFH A;  3ES9 A;  4KKS A;  3KP5 A;  3ZGK A;  2HQ5 A;  3PEN A;  2CQQ A;  5HLG A;  1UD5 A;  4FK8 A;  2BYV E;  5CVI A;  3MKY B;  5EZH A;  5ICF A;  4E7S A;  3KEO A;  3N4M A;  4KKU A;  3G1M A;  4ZTJ A;  1YX3 A;  1VQ9 B;  2VFP A;  3G4S I;  2DA6 A;  4HOB A;  2LBF A;  1JI8 A;  2OF7 A;  1OYI A;  3CCY A;  1TYW A;  2LNB A;  3Q9V A;  3B6A A;  1T6S A;  1IB4 A;  2LYC A;  3E6B A;  3L2Q A;  2XRN A;  3WE2 A;  4U88 A;  4YEJ A;  3SZT A;  3V42 A;  2R7Z J;  4PJL A;  3IUO A;  3CZ6 A;  2ZBV A;  1ONV A;  5BMZ A;  1I1G A;  4HX8 A;  3Q9S A;  2F5C A;  1SKQ A;  3ZMD A;  3OZW A;  4PZJ A;  3G73 A;  1P92 A;  1HF0 A;  1M1K D;  2IA1 A;  3S3N A;  3TOB A;  2HQN A;  4CUG A;  3BJ6 A;  3WNC A;  3PNV A;  3P4G A;  2RRE A;  1HZE A;  1OFL A;  2PMZ N;  4RD3 A;  3P27 A;  4BJ6 C;  3MWM A;  4HNV A;  2JTV A;  3BOQ A;  2VOD A;  2KVO A;  3OEE A;  2MLG A;  2E1M C;  2ZTN A;  1OCZ H;  3H9J A;  2LOO A;  2F48 A;  3CTA A;  2OPT A;  2VYQ A;  2XSJ C;  2O8X A;  2HOA A;  5FLX K;  4CCJ A;  2D74 A;  3KE2 A;  3OZV A;  2OYN A;  3B82 A;  1QZE A;  3LL7 A;  2OBR A;  1Y8R B;  1MBH A;  1XGM A;  2E7X A;  4WXD A;  3TP0 A;  5LGN A;  4G7W A;  2QKM B;  2YUH A;  1OCC H;  1XD7 A;  4YEL A;  4BGD A;  4CSW A;  4TMV A;  1H80 A;  1OQY A;  2LZJ A;  3HOZ J;  1X4P A;  5EEG A;  2LP0 A;  1GQ8 A;  5KNL A;  2KP6 A;  2XTW A;  5IP7 J;  3I54 A;  3FM5 A;  4OPO A;  3DP7 A;  1R7J A;  2RNJ A;  1JB9 A;  4OM9 A;  3LAJ A;  1H9T A;  3L9F A;  5D5V B;  1ZQ3 P;  3OPO A;  3HSR A;  1B72 A;  3HRT A;  2KPM A;  4E0F A;  1VQL B;  4P55 A;  1GV2 A;  4ENJ A;  1NK3 P;  1T38 A;  1RNL A;  2QE7 A;  1KC8 D;  3A8I A;  1UEL B;  1YW8 A;  2H6C A;  1X2M A;  2R7O A;  1RUO A;  4ESJ A;  2PFB A;  3BG3 A;  3FXL A;  3IAS 2;  5KK1 A;  3AVT A;  1JGG A;  4B3G A;  5FD6 A;  1RKW A;  2DAO A;  3R6J A;  2HVQ A;  4B3A A;  4EJV A;  4OIN F;  3T9G A;  5L3D A;  1TNT A;  2BY3 A;  3C3W A;  5ED4 A;  1YHQ B;  3CP8 A;  2ZFW A;  3SYJ A;  3WTZ A;  1L1I A;  2R7X A;  2BF4 A;  5B5E C;  1LB2 A;  3I58 A;  3CCU B;  3GX4 X;  3CD6 B;  2OBP A;  1JNY A;  2GZW A;  5HOD A;  2CQN A;  3PSI A;  3TMO A;  4G1V A;  4PAB A;  1MND A;  2E5Z A;  4XMY A;  3WBJ A;  5IYP A;  1QQI A;  4A3K J;  3LO8 A;  1K4S A;  3ESW B;  1EFT A;  5GTH C;  1ERD A;  2EWN A;  4OWR B;  2OJE D;  4MFD A;  2CV1 A;  2CJJ A;  4MIM A;  1IXC A;  5LFA A;  1WSU A;  1MMS A;  4RGS A;  1HKT A;  1XDU A;  1BX0 A;  1E43 A;  1G7S A;  3QFT A;  1LLZ A;  1ETY A;  3BY1 A;  1R58 A;  1LDJ A;  2ZJR F;  1COW A;  4U9U A;  1LKX A;  1JRG A;  2D2W A;  3LA3 A;  2TCT A;  3AG1 H;  1BPL A;  2JA8 J;  2HR3 A;  4BEH A;  5FKL A;  2JRT A;  1SAX A;  2J7K A;  5BSX A;  1X3U A;  3LSM A;  2QGU A;  3E3V A;  5B1A H;  5EG0 A;  2H1L A;  3I9V 2;  5GTI C;  2VJJ A;  1VQ9 I;  1E3P A;  1B4A A;  2PN6 A;  5H20 A;  3F8N A;  1YRN A;  1CF7 A;  2VON A;  3GTP J;  2OK7 A;  4HPQ A;  1YJW B;  3DTE A;  2Y0S A;  2VOP A;  2HWV A;  3PA1 A;  3PA2 A;  1M90 D;  1XN7 A;  1R36 A;  2HS5 A;  3B6C A;  3HAG A;  1TW2 A;  1STZ A;  3JTH A;  4OU0 A;  1HG8 A;  1QG0 A;  2CW8 A;  1FND A;  2JA7 J;  1WSR A;  5J4V A;  2P7C B;  3WND A;  1Y6I A;  5LLQ A;  4CQJ A;  1RKT A;  2C6Y A;  4GO1 A;  3S3M A;  3FY3 A;  1J0R A;  4EM1 A;  1QZZ A;  1KRH A;  2E1M B;  3H5N A;  1ZM3 A;  1O3R A;  2XAH A;  2XSD C;  3FMR A;  4Z4Y A;  1U5T C;  3OJX A;  2P5K A;  3CPW B;  2QQ8 A;  1YFH A;  4UB8 C;  1VQO I;  2HDC A;  1IDK A;  3IRR A;  3ZQI A;  2F5V A;  3CF5 F;  3EQO A;  2K40 A;  4FTH A;  1ZH5 A;  3GRH A;  5GAD J;  5LMZ A;  5EGO A;  4BS9 A;  1ZGW A;  3RI4 A;  2CC2 A;  3A3G A;  5F4J A;  2QEX B;  1W5C C;  2CW0 F;  2E7W A;  2EFN A;  4MEY F;  3KRG A;  1N0U A;  3S15 J;  2I8D A;  2FOK A;  2ZME C;  2A68 F;  3IH2 A;  1O8M A;  2BX6 A;  3TDU C;  4U7B A;  1P4A A;  1QRY A;  4BBR J;  4IO9 F;  3GQA A;  2YUS A;  4F91 B;  2K4B A;  2O6W A;  2NNN A;  3FKI J;  5CQE A;  3GTO J;  3AG4 H;  2GK6 A;  2YS9 A;  3DPL C;  5E8G A;  3ZMU A;  3L2C A;  5FL7 A;  3LVB A;  3CC7 B;  3BH7 B;  1IV8 A;  3VSV A;  3N05 A;  1D1A A;  3PSS A;  2XKO A;  2KLO A;  4BAC A;  4U49 A;  1YYV A;  1T95 A;  2FD5 A;  3ABK H;  5F1R A;  3E0J B;  4MTE A;  3HRS A;  4L5E A;  4GDF A;  1WOO A;  4TMX A;  4C3J J;  2EZL A;  5JHF A;  2ZIT A;  1FT9 A;  4HW0 A;  3F72 A;  1B1B A;  1YS6 A;  3DF8 A;  3JRD A;  2GA2 A;  1Z7U A;  3GWZ A;  3PIP F;  1A8P A;  1MMN A;  1D5Y A;  2DPD A;  4QFM A;  2CF4 A;  3K2Z A;  2EA4 A;  3FF5 A;  1RIO H;  4OIQ F;  5J8C A;  4E7I A;  4ENK A;  2L9N A;  3GLL A;  4C2M J;  3EET A;  1O8F A;  4LK0 F;  2VBE A;  3ZP5 A;  1QA3 A;  3FWE A;  2X51 A;  3CJQ B;  3GF2 A;  1VHO A;  3HUG B;  4Y17 A;  3T53 B;  4F93 B;  4EVI A;  4KDP A;  3IKV A;  1N0V C;  2VBZ A;  4L5J A;  3ABT A;  2GBY A;  2QTZ A;  4QVJ A;  3GQ8 A;  1WDT A;  3PM1 A;  3ERM A;  4HE5 A;  1WOP A;  1YHQ I;  4M71 A;  1V0F A;  2VBS A;  2K9L A;  4OPW A;  4XN0 A;  4OZY A;  4EGZ A;  2K02 A;  3UNG C;  1U6G A;  3A0B C;  2Z99 A;  3K1P A;  4UHT A;  4WWC A;  2PYG A;  4U0W A;  4AUX A;  3OY9 A;  4L0Z B;  1E1Q A;  4RGU A;  5BOX A;  3KP3 A;  3VEP A;  1V4R A;  1FOW A;  2CQ7 A;  3KLO A;  2R5Z A;  3FPK A;  2D1V A;  3HSE A;  1QNT A;  2V1U A;  4M3G A;  4GFB A;  4PMH A;  1WJB A;  2NVY J;  3JRB A;  5J1U A;  4YAO A;  3WY9 A;  4ROX A;  4EH1 A;  4NK8 A;  2I5U A;  1G7T A;  1GJR A;  2D9R A;  2DT7 B;  4XK4 A;  5D5X B;  2FF4 A;  3LQR A;  4RB3 C;  4PFO A;  4B47 A;  4Y52 J;  1KD1 D;  1EH8 A;  2DQR A;  3W2E A;  4ZYE A;  2X85 A;  3S17 J;  1IGN A;  2X1D A;  3DKX A;  4DQK A;  2Q6O A;  5D4R A;  4O3M A;  1G3W A;  3I53 A;  4LOC A;  5JFR A;  2A5W A;  1CLW A;  3IWZ A;  4HDU A;  2R0Q C;  4X7F A;  3E6C C;  1KZL A;  2XGE A;  3MQ0 A;  4RAY A;  3L2W A;  1S3J A;  3GSI A;  2G7U A;  3CP2 A;  2MBF A;  1SD7 A;  3C2B A;  4QV2 A;  3CCL I;  2HFH A;  5E1W A;  5KCM A;  4QLC U;  3I56 I;  1TWH J;  5E18 F;  1SKY B;  3AG3 H;  2OCE A;  4G6I A;  4M6X A;  1T2K A;  2XPV A;  3BTL A;  3EQN A;  2A69 F;  1FOY A;  3RPQ A;  4EM2 A;  3RY8 A;  2EV6 A;  1ZLK A;  5FKO A;  5IOZ A;  5LBQ A;  4HEA 2;  1U5T B;  4QPQ A;  1CNE A;  3OSG A;  2NOJ B;  4LG0 A;  3SQN A;  4HNT A;  2R93 J;  4OPV A;  4LLN A;  2LMD A;  1WJF A;  4JX6 A;  2QA4 I;  1EA3 A;  1PP7 U;  4BXF A;  3CC4 B;  1A6I A;  2IQ7 A;  2XHK A;  4OJO A;  1WRJ A;  1YIO A;  2XZO A;  1KTW A;  4BU2 A;  3GCM A;  2HCJ B;  4GXO A;  2J5O A;  2ZME B;  4S04 A;  2X3H A;  2CFX A;  4TV7 A;  1S7O A;  4DNC A;  2BY1 A;  1FBQ A;  2MFZ A;  3GXO A;  4ABZ A;  1PJ6 A;  4Z4S A;  2CO5 A;  4E6K G;  1FNB A;  1R23 A;  3M1C A;  2VNK A;  2M87 A;  3ECO A;  2O5R A;  1R5G A;  1KQ5 A;  3FIW A;  4BY7 J;  4V19 K;  4QUZ A;  1QCX A;  1JHF A;  2WBM A;  1IB0 A;  1J59 A;  3F8M A;  1JTY A;  3M4O J;  3G1L A;  5E1X A;  1O8K A;  1NRK A;  2XUB A;  5HXB A;  3VO2 A;  1TT5 B;  3SKB A;  4DZP A;  4OIO F;  3HRM A;  2OA4 A;  4FIS A;  2ADU A;  1UMK A;  3KEW A;  3HGY A;  2DCE A;  3LSK A;  4CZZ A;  2JN6 A;  2CU7 A;  4M9X A;  5TRD A;  2K86 A;  4XLC A;  2NRA C;  1GXQ A;  1XMA A;  4ENN A;  1E79 A;  3U6K A;  3LSG A;  1SFU A;  1YQA A;  2KL4 A;  3GVL A;  4U0V A;  5DN6 A;  5FRN A;  3VR6 A;  5FRM A;  1I3Q J;  3PNY A;  3KIO A;  3TP3 A;  2CFO A;  2LVS A;  2JA2 A;  3CUQ A;  3LOC A;  5H6R A;  1X2N A;  3S14 J;  1Q9S A;  2M8E A;  1X1B A;  3CLQ A;  3L09 A;  2VFQ A;  1XMK A;  3FXO A;  4DW6 A;  4WZK A;  1LM1 A;  1OKR A;  3BTJ A;  1ZM9 A;  2L7M P;  1IJW C;  1UHS A;  2IS4 A;  1I1S A;  2NS8 A;  1IDY A;  1UHM A;  1BJZ A;  1SVO A;  4A3L J;  1EA0 A;  5BS6 A;  3OFN A;  3EDP A;  3CC2 I;  1BIB A;  5J40 A;  4I2O A;  2RKH A;  4Z06 A;  4LJZ F;  2GOM A;  1K73 D;  2WA0 A;  3NAR A;  2NAZ A;  2OD5 A;  1KU2 A;  3BTC A;  4BKX A;  4NHJ A;  1OB5 A;  3ECH A;  3HZJ A;  2QBY B;  3OYK A;  4UZU A;  1HKS A;  1FC3 A;  1DPR A;  2KT0 A;  2XB5 A;  4FX4 A;  4YAU A;  2X8K A;  4HF0 A;  1ZR2 A;  5DS9 A;  4DQL A;  4D7N A;  2MYS A;  3JR9 A;  3G71 I;  5BQT A;  2ZL7 A;  4XR6 A;  3RZO J;  3VST A;  1MJB A;  1R4M B;  2EIM H;  4IEJ A;  1O3Q A;  4G94 A;  2ACJ A;  2ESN A;  2Y31 A;  3BZ6 A;  3U21 A;  2Y9Y A;  5DD4 A;  1EP3 B;  3J81 k;  4LG3 A;  1FNC A;  1N78 A;  4A3J J;  2Q6K A;  3HXL A;  1ZAR A;  4Y9U A;  2JMW A;  3W3C A;  4E70 A;  5A2Q Z;  2RN7 A;  2ZBK A;  3HB9 A;  3PJR A;  2ZZE A;  5EJC A;  5F4M A;  3I59 B;  4CCN A;  1G7C A;  3WHC A;  1QA2 A;  3V7A A;  2A05 A;  5B6I A;  4I99 C;  4PSX A;  4Q4Z F;  1HF2 A;  1W5T A;  2GXG A;  2ZJP F;  3U6B A;  1ETO A;  3NB2 A;  3ASS A;  1SFK A;  4G7O F;  3LSJ A;  2OZ6 A;  3OR1 C;  1FEX A;  2ZL6 A;  1X1A A;  2EV5 A;  3G05 A;  3AKZ A;  4V2F A;  4K2E A;  3MZY A;  3QOP A;  4BUP A;  2JIZ A;  4IHV A;  1JJ6 C;  3BZC A;  3VNV A;  4RM3 A;  2MD5 A;  3L2V A;  1RU4 A;  2DYI A;  4Y9R A;  5LGU A;  4IVN A;  3WU1 B;  1JT0 A;  4B8X A;  1YOV B;  2H6B A;  4D9J A;  4P5O A;  1V5E A;  3BQY A;  2N8G A;  3CDL A;  2B5O A;  4U87 A;  3LYC A;  3OOU A;  1FYL A;  2B0R A;  1YS7 A;  5HDG A;  1KMH A;  3AVU A;  5K5O A;  3CCS I;  1H8E A;  3SEZ A;  4CDG A;  5JLW A;  1Y56 A;  2R92 J;  3GZN B;  4E7H A;  2WB1 A;  3VNU A;  5HNF A;  3HPH A;  4I7H A;  1YIJ B;  3F6O A;  3F8F A;  1S0U A;  1XSV A;  5DM7 F;  1WI3 A;  1ORK A;  2EJR A;  2J5P A;  2JPB A;  3CCR B;  3V76 A;  2FUG 2;  4KNY A;  1XCB A;  4MQV A;  3GFJ A;  4G5G A;  1UG2 A;  2Z33 A;  1H9G A;  1NBM A;  1UHW A;  2MC3 A;  4C3H J;  1BOA A;  2V4J C;  4NDL A;  4CO8 A;  3CJR B;  4Y13 A;  5J4Y A;  2UVF A;  3M3Y J;  2HVS A;  4XNF A;  5K1Y A;  4RBO A;  3OOC A;  1Q1V A;  3O6B B;  4ZC3 A;  1IDJ A;  2HTS A;  3B90 A;  2P0W A;  2IA2 A;  1LPQ A;  2ZC2 A;  4ZZL A;  4AF7 A;  3Q39 A;  2PIA A;  4BPR A;  4HAM A;  2LKX A;  1RUN A;  3KP4 A;  3GVK A;  4YIF A;  1EF4 A;  5H6Q A;  2LBF B;  2Q6L A;  3J80 K;  2HOT A;  5EMN A;  5IK2 A;  2FNP A;  4XOP A;  4LBY A;  3I3L A;  3SLN A;  2ELK A;  3DBH B;  1MBG A;  3KX2 A;  2R7U A;  5ILV A;  3S2W A;  2DI3 A;  4XOR A;  2PLY A;  2L2O A;  2EBI A;  2EIN H;  2ZO4 A;  4CHU A;  2ZJ2 A;  1ZG3 A;  2E1N A;  1S72 I;  4OOX A;  2DQL A;  2IJL A;  2HXO A;  1X1C A;  1JKO C;  2V9P A;  5E6T A;  4OJ5 A;  1N25 A;  2KJC A;  1BX1 A;  2F43 A;  4OAY A;  1TBX A;  2F1M A;  1JA1 A;  1DBG A;  1WGX A;  4RAF A;  3LSH A;  3BG6 A;  2X48 A;  2X0L A;  2L4M A;  4L9V A;  5K7H A;  3E5X A;  2IS2 A;  1X0C A;  4B4D A;  3QRF F;  2INU A;  2DA1 A;  3UW0 A;  1H88 C;  1G59 A;  4TKO B;  4Y3O A;  1U9O A;  3D5S C;  4BQN A;  1ZAO A;  1ZKG A;  5FO5 A;  3GZ6 A;  4XLE A;  4DOZ A;  2XC1 A;  2CRG A;  3GEZ A;  2R4G A;  3QPT A;  3V8L A;  3ZUG A;  3K4N A;  1B2R A;  5EF6 A;  1WPK A;  1FBU A;  1TQI A;  2ZSH B;  4J00 A;  1ZGA A;  1KA8 A;  4QPO A;  3NQO A;  3ONU A;  4PC6 A;  5M3F J;  2M1B A;  2VKH A;  3MAJ A;  5L3F A;  1Z91 A;  4A3E J;  1GVJ A;  2VKD A;  3EYY A;  3LST A;  4KUM A;  3OL3 A;  4JRA C;  2DCU A;  5HVQ C;  1NG7 A;  1JKR C;  2CV0 A;  1VF9 A;  4A0X A;  2WAE A;  2FQ4 A;  3U2R A;  3S1N J;  5ICE A;  3H0D A;  2KJB A;  1X19 A;  4A0Y A;  2CGP A;  2DA2 A;  2EIJ H;  2V9K A;  1K8A D;  2O0V A;  2VPR A;  3CQZ J;  4MQ9 F;  2DXI A;  2HYG D;  2XAG A;  5AON A;  1XG2 A;  1I6H J;  2DDA A;  3FMS A;  2K9Q A;  3WTU C;  3K70 C;  2R7R A;  2VFO A;  4RDL A;  1WHU A;  1X3W B;  3KP7 A;  2I10 A;  2HKO A;  1BOB A;  4KN4 X;  3W2A A;  4EQQ A;  2IEK A;  1KU3 A;  1PKV A;  1ENH A;  1UD6 A;  1FRQ A;  1EFU A;  4N3N A;  1LVA A;  3CCV B;  3FK7 A;  4G1B A;  1Z7L A;  1B72 B;  1IF1 A;  2ZBU A;  5L46 A;  2R7V A;  4AC9 A;  2STT A;  4X07 A;  2LFB A;  2O8K A;  4YAF A;  3QPS A;  4HLX A;  2L4A A;  5FNZ A;  4WWV A;  1OGM X;  1MH4 A;  2ODL A;  4IRG A;  2PEC A;  2P5V A;  1W1W E;  2DDB A;  1IAW A;  3OAA A;  4PK4 A;  1CQX A;  3OIO A;  3TOA A;  3B02 A;  3A8J A;  3EUA A;  1YJN I;  1DG1 G;  5CPR B;  1E64 A;  2A07 F;  5KSW B;  3VPR A;  3QYB A;  4UNO A;  1ON2 A;  2ME6 A;  5F6F A;  1QRC A;  3AVX A;  4ZZD A;  3HOY J;  1VND A;  1XGO A;  1V5F A;  2DT5 A;  2DOD A;  4CCM A;  1OJL A;  1UMQ A;  1YIT I;  4IF4 A;  4JK1 X;  1PUE E;  5J6X A;  3ZN0 A;  5LEJ A;  3S1R J;  3FXM A;  3HGG A;  3K9T A;  5M5X J;  3NWS A;  2YPR A;  3BCA A;  3ISP A;  2GAU A;  4MLO A;  3PO3 J;  4PC1 A;  2OC6 A;  3FBI B;  4D0P A;  3IL2 A;  2MW8 A;  3OR2 C;  2E71 A;  3BC9 A;  5DTD A;  3BPV A;  2E60 A;  2QCO A;  2Y9Z A;  2V7V A;  3BR6 A;  4NUB A;  3BJA A;  5TJJ A;  5HDK A;  5DS0 A;  1TWC J;  3MKW B;  3P9C A;  3MN2 A;  5KAF C;  2F3L A;  1MZB A;  3OSF A;  4X1E A;  3A3B A;  4BEH B;  4HWV A;  2JRM A;  1SD4 A;  4HSR A;  2J8I A;  3OEH A;  2HDW A;  1Y0N A;  2KIQ A;  4NB5 A;  2HZD A;  3EUH C;  1Z1D A;  5EG0 B;  1QUE A;  4AD9 A;  2WYR A;  1QVT A;  2QYO A;  4MR0 A;  3Q38 A;  3G6E I;  2E1B A;  2NSP A;  1BBY A;  4OOV A;  4B3X A;  4AM3 A;  3SDG A;  2VQC A;  4OJP A;  2Z5U A;  5DDG A;  3MCA A;  2PI0 A;  1YRN B;  1CF7 B;  1HST A;  4L0Y B;  1WTH D;  4A3C J;  1W2B B;  2QX3 A;  2V6E A;  3MMP A;  4NNJ A;  5CDF A;  1ZEL A;  4A6E A;  2CH0 A;  3QU3 A;  3GTK J;  1VQ8 I;  1K5C A;  1GVD A;  1O57 A;  2H8R A;  2ESH A;  1E3O C;  2HGC A;  3SUC A;  3FBN B;  4A3I J;  2VFM A;  3ASN H;  4YRV A;  3LJY A;  4BQO A;  3HL2 A;  1NH3 A;  2D3N A;  4IRI A;  2F4N A;  2ZXJ A;  2HEO A;  5HOO A;  4LD5 A;  1WVR A;  3H0G J;  4Y33 A;  2ECB A;  1B8I A;  3CES A;  4IXA A;  1D8J A;  1DDN A;  2NZM A;  2NXN B;  1FTT A;  3M9A A;  4LLL A;  1DGR M;  1TYX A;  1P6R A;  1SC7 A;  4EJW A;  1IC8 A;  4A93 J;  3JAM Z;  4DQ2 A;  4X05 A;  1FP1 D;  1SAU A;  2OTJ B;  1HC8 A;  3SZG A;  2R7T A;  1EE6 A;  5H59 A;  2RQP A;  2VBU A;  2EIL H;  4N4O B;  2DMP A;  1Z9C A;  1XG1 A;  1XPX A;  2XF7 A;  4B43 A;  2LDU A;  2G9W A;  2VJ5 A;  5EGO B;  3GYH X;  4RD4 A;  1FP2 A;  1QVU A;  1VJS A;  2QN6 A;  1HCR A;  3S16 J;  3P7N A;  4HA8 A;  5FJ8 J;  1VQN I;  3TO6 A;  1Q82 D;  3OYI A;  3HOX J;  2WZP P;  1KGS A;  2XF5 A;  1KK0 A;  4EM0 B;  1OHH A;  1VFC A;  3VYS B;  3AAF A;  2FJ1 A;  5C1C A;  1YJ9 I;  4DIQ A;  3S8P A;  2B0L A;  4AYB N;  2RAE A;  4RLF A;  3RQI A;  3BR2 A;  2Z2S B;  2NVX J;  1SAN A;  1JE8 A;  4J0Q A;  5BNG A;  1ETK A;  3MKL A;  3SJZ A;  3J81 K;  2K3P A;  4N3G A;  3W6K B;  5D6F A;  4RCY A;  4YEI A;  1XQB A;  4A3F J;  1TUI A;  1FMW A;  2HOS A;  4C2T A;  3WXM A;  2W25 A;  3CCQ I;  2X0K A;  2VLA A;  3GW2 A;  4QTR A;  1OFC X;  1HA8 A;  5FGM A;  4YHB A;  3ASP A;  3ZQF A;  2KRH A;  3KCC A;  4P9S A;  1QGZ A;  1MBE A;  2F5F A;  3IRQ A;  5JI6 A;  5HKK A;  1IN8 A;  3CDI A;  2DN0 A;  4RB0 A;  2XEX A;  2VQG A;  5E8I A;  1E3X A;  4OJL A;  2E1R A;  1UZC A;  1QU3 A;  4MGR A;  2XAS A;  4P9F A;  3ONY A;  4UZF A;  2DJN A;  1BR1 A;  4H4K C;  4JP0 A;  1W9X A;  1FX7 A;  3CUQ C;  2PLF A;  5BPD A;  4G7H F;  3T0Y A;  3MFK A;  4NK6 A;  3H3V K;  4NBQ A;  2LY2 A;  1AU7 A;  1UD3 A;  2ZSI B;  4WZT A;  3ZSC A;  2ZZF A;  3V8J A;  3PVD A;  2NNY A;  2FBH A;  4OIP F;  2V7F A;  2V7T A;  1S9H A;  5HS8 A;  5IP6 A;  2R5Z B;  4R1H A;  2BZT A;  4ZJZ A;  2R9V A;  3FMQ A;  4HQE A;  5HNH A;  4ZDP A;  3TQN A;  2P5L C;  2W6I A;  3GVJ A;  1WJA A;  2CUJ A;  1IRG A;  2E1C A;  3ZPL A;  2RC4 A;  1N05 A;  1NB9 A;  3RKY A;  3TW6 A;  1ZG5 A;  3FXJ A;  3A01 A;  4L18 B;  4C2L A;  3SLD A;  3BP8 A;  5KHD A;  2XC7 A;  2W4S A;  3ZMT A;  4ZV4 A;  2HKX A;  1D8T A;  1Q86 D;  1KQ8 A;  5FKK A;  5FLX Z;  3QFR A;  4X8I A;  5EDN A;  1OR7 A;  1W7P D;  4BHB A;  2EFP A;  3M8J A;  1KZH A;  2VZL A;  2EK5 A;  4KIF A;  4OMZ A;  2IGN A;  3TBI A;  3V4G A;  3OKX A;  2O0W A;  3N90 A;  3W6J B;  1Y0U A;  4WZE A;  2WAQ N;  3HM5 A;  4L9T A;  3KYL A;  3SHF A;  1O8E A;  1WFX A;  3OYA A;  3T1B A;  5M5Y J;  2F4O B;  3HKZ N;  5KW9 A;  2NS0 A;  2VKE A;  4LBW A;  3BDD A;  4M4S A;  1ZR4 A;  2W7Z A;  1ZUN B;  2DFE A;  5JR3 A;  2NTB A;  4RA2 A;  5DCF A;  4Z2Y A;  3D0S A;  3VOE A;  2OCC H;  3ZOB A;  3L2R A;  3RQ4 A;  1E3Z A;  3CW2 A;  5L3G A;  3H09 A;  4XM3 A;  2FOW A;  2WR8 A;  4LG0 B;  1YX2 A;  1P7J A;  3RSN A;  2V26 A;  3CME B;  3CMM A;  3PO2 J;  2QY1 A;  4YG2 F;  4BYY A;  3CRZ A;  1OCO H;  2KRC A;  3HTS B;  1O8I A;  2CQK A;  3ZRG A;  3ZZ0 A;  3ZPP A;  1V3F A;  4LIV A;  2COM A;  3KET A;  4RAZ A;  3FXQ A;  3JRH A;  2O61 A;  1UFM A;  2F5E A;  1Y0Y A;  1K8F A;  4CCK A;  3GTJ J;  2O04 A;  2ID6 A;  4BHP A;  3IV5 A;  1FMV A;  2NT6 A;  3L00 A;  3J7Y J;  4UY8 I;  3WNB A;  2WZN A;  2RGV A;  1Y39 A;  1OCT C;  3KPH A;  3U9G A;  1E17 A;  4W1U A;  1WQ2 A;  1O3T A;  1LE8 A;  1OB0 A;  4XBF A;  1T39 A;  4OOI A;  3RJP A;  1TLH B;  3E1S A;  3PSF A;  1SFE A;  1RRJ A;  1IA5 A;  3W5H A;  5IYR A;  1FLI A;  2VI6 A;  5DV5 A;  5THX A;  4LFU A;  2FBI A;  1TYU A;  2X1E A;  3VMF A;  5J1R A;  3F21 A;  2QQA A;  4A3B J;  4EW9 A;  4BBS J;  4MXN A;  2OK8 A;  2Z8G A;  4X7E A;  1VQ5 B;  1YLF A;  4DK0 A;  4GRI A;  2ZFU A;  3C18 A;  4PUS A;  1BI0 A;  1K9M D;  1KQ0 A;  4AID A;  3RIQ A;  5B66 C;  2DYS H;  2WWY A;  5GV8 A;  1D3Y A;  2XT4 A;  3LQE A;  3ZIA A;  2D1H A;  1SVL A;  2DA5 A;  3CUQ B;  2ZJQ F;  2HMA A;  1TWA J;  2MH9 A;  2V31 A;  3GUD A;  4KH3 A;  2W48 A;  2AQF A;  2JVH A;  1I50 J;  1U8R A;  1EP1 B;  4CH7 A;  4GCV A;  1F43 A;  1IJF A;  2GRE A;  4ACB A;  3F8B A;  5AMV A;  1W0K A;  3WG9 A;  2OBT A;  1U0J A;  4ASU A;  4IX7 A;  2HLD A;  3SFI A;  2LF7 A;  2LC2 A;  4YAL A;  1MJA A;  2KZV A;  2KIM A;  2L7K A;  4AVZ A;  1I6X A;  1AWC A;  1ELO A;  4F7D A;  4BY1 J;  5GAE J;  4KN7 X;  3K1N A;  2FVG A;  3I0T A;  4HZF A;  2WC2 A;  5A8A A;  5GAG J;  4RGX A;  3VWB A;  1A6Q A;  2E19 A;  4AIJ A;  1YI2 B;  5B3S H;  2DET A;  3Q5F A;  4Z4Z A;  4Y7N J;  3V7C A;  4UAJ A;  4M3F A;  2DMU A;  3I55 B;  4NC7 A;  1LFU P;  1VQL I;  2WAD A;  3K4J A;  4Q48 A;  4Z4T A;  5KAI C;  1QZY A;  1QRB A;  1U2W A;  5AIQ A;  2VT2 A;  3K4K A;  2G7H A;  5C3E J;  5CVJ A;  4RD1 A;  2BM6 A;  1JUM A;  3W5V A;  4TMZ A;  4FWT A;  1VTN C;  1FWZ A;  4KT6 A;  4KIS A;  3K4B A;  3E20 A;  1IRX A;  4LIU A;  2CSO A;  1MBK A;  1D0Z A;  2DOE A;  3KEY A;  1K4T A;  2GLO A;  1R22 A;  1XB4 A;  1KK3 A;  3SZP A;  2CW5 A;  1G4D A;  1TWG J;  1D1B A;  1IUY A;  1E3H A;  4OP7 A;  2BOL A;  2ME0 A;  5CQG A;  3GTL J;  2IGK A;  4EAT A;  3SJM A;  3CCU I;  4ZGQ B;  1ZRC A;  3CD6 I;  3ASQ A;  1J09 A;  4O5V A;  2DY1 A;  3BR1 A;  3MMY B;  4HST A;  3DU6 A;  4TSF A;  4XRF A;  3VDX A;  5FB2 A;  3E6D A;  3O8G A;  4RPB A;  3F6V A;  1GLN A;  3R0A A;  5FD5 A;  2Q8K A;  4CYC A;  4FXU A;  3BG7 A;  3R4K A;  4TMT A;  3CLO A;  3GVA A;  1DDI A;  3OWT A;  3DBR B;  3KEQ A;  1NHC A;  5J47 A;  3EUH A;  3BH4 A;  3HYI A;  3Q3S A;  4A0Z A;  4B44 A;  2J8K A;  1OGI A;  1KJZ A;  3U1K A;  2COB A;  4BAY A;  3AK5 A;  4PC3 A;  1IRZ A;  3L7W A;  1Z05 A;  2ELJ A;  2WAF A;  4NCN A;  5HZA A;  2KKO A;  1OGO X;  4HBL A;  3LNN A;  1WJ5 A;  1E0E A;  2KFD A;  2Q6I A;  1YJW I;  1R5N A;  4PJM A;  2NPF A;  2XND A;  2H8W A;  4HF1 A;  4FT8 A;  4HX4 A;  4FE4 A;  1DDG A;  2QZ8 A;  4TMW A;  2FA5 A;  1MAB A;  2BVM A;  4ESF A;  3I4M J;  1NTC A;  1BQE A;  3LQ6 A;  5J35 A;  3OW7 A;  4M3D A;  4DYR A;  4DYC A;  3CJN A;  1IHM A;  2A3S A;  2ECC A;  1XGN A;  1Z3X A;  1T98 A;  2ZNY A;  3RPU A;  3JRA A;  1BW5 A;  3AL0 C;  1BA5 A;  3VO1 A;  2L9V A;  4G7X A;  4A2U A;  2L7F P;  3MKZ A;  4KIG A;  1ETV A;  1W36 C;  2IRF G;  3LQQ A;  3ZR8 X;  2VOO A;  2V6C A;  2XPW A;  2LD5 A;  1EV7 A;  2B7B A;  4YFX F;  2VBV A;  2OTL B;  1RET A;  2VNH A;  2RDP A;  3ASR A;  3G3Z A;  1RWR A;  3BG9 A;  2K27 A;  1MJ9 A;  1JGS A;  4ZCM A;  3CCM B;  2Q2E A;  2FE3 A;  2QEX I;  4XKB A;  1ZHF A;  2DU9 A;  2FRH A;  2VC0 A;  2XNJ A;  2EWE A;  1H8A C;  2GQQ A;  1O8G A;  1Z21 A;  1R5H A;  1L3L A;  1DAR A;  1YTY A;  2DOG A;  3I1F A;  4NQW A;  3OYD A;  1BL0 A;  2BSP A;  3VB2 A;  1O88 A;  2XGX A;  4RD0 A;  3JQR A;  4DGW B;  3B4N A;  3BJO A;  1T08 B;  4BHC A;  1QGA A;  3KFW X;  3CC7 I;  3MZ8 A;  1E2X A;  1TTY A;  3V7S A;  2XAF A;  4S05 A;  1DBO A;  2Y0M A;  4X0G A;  2BSA A;  1X4O A;  2RVC A;  3C1D A;  5FRO A;  4MO7 A;  3IH4 A;  4YFO A;  4HIZ A;  3ZMV A;  1H8H A;  4GQN A;  4XKC A;  3GFI A;  4P9U A;  2PQ8 A;  3K6G A;  5F0H A;  1AHD P;  2LSO A;  2LRE A;  3FKJ A;  1VQM B;  4XKV A;  3OMY A;  1T56 A;  2JJ2 A;  1OFM A;  5CKT A;  5IOY A;  3S3O A;  2AHQ A;  1X1P A;  2LY9 A;  4CCL A;  2DOF A;  3DU1 X;  5GPA A;  1B23 P;  2HDD A;  3BY2 A;  1GT0 C;  4WXC A;  1AKH A;  3GQ7 A;  1T6Y A;  1GHC A;  4JX4 A;  4LGW A;  5E3O A;  4PDK A;  4IHX A;  2C78 A;  3H5R A;  1I3A A;  1F1Z A;  2M0C A;  4B09 A;  2L9R A;  2VT3 A;  4G6Q A;  1XFO A;  3O8H A;  2ETH A;  4OOS A;  3OYH A;  2PJR B;  4M9Z A;  2EIK H;  3S32 A;  4P6V F;  2PMZ A;  3WTY C;  5FIU A;  2XDV A;  2W7N A;  4M6Y A;  4C43 A;  2DO7 A;  4YII A;  1QA6 A;  3FJO A;  2BM7 A;  1G3S A;  3T51 B;  4MEX F;  3HSF A;  2XGD A;  1O4X A;  3JCU C;  4I84 A;  1GVH A;  3QOE A;  1TTT A;  5M5W J;  3AFH A;  5DUK A;  1MD0 A;  2WJV A;  3OJW A;  1VQ7 B;  2A6E F;  1JXS A;  1LJ9 A;  2X9D A;  1EP2 B;  1R5B A;  3ZBT A;  2NT9 A;  4LMY A;  1R9T J;  2K7L A;  4C30 A;  2DK8 A;  2WV1 A;  4RAG A;  3BC8 A;  3VFZ A;  3KYD B;  1RQP A;  1JKP C;  4HG2 A;  4P1V A;  2JVG A;  5J3L A;  2WV0 A;  1KYZ A;  2IGO A;  4F92 B;  1OGJ A;  3A35 A;  5LD2 C;  3ZXS A;  1A31 A;  4BE1 A;  1R5O A;  3PSZ A;  3A8K A;  2MLK A;  2R7W A;  4DBR A;  1HSJ A;  1JUS A;  2GIZ A;  5DCM A;  1H0M A;  2YR2 A;  4YFK F;  2ZL5 A;  2EB7 A;  3Q6R A;  3BPX A;  4PGG A;  3WU0 A;  5IYB J;  5FA6 A;  2CRV A;  3KZI C;  2ISY A;  4LIT A;  3NAW A;  1WXR A;  2A61 A;  3H35 A;  4FE7 A;  4B3F X;  4DK1 A;  5FO1 A;  3ML3 A;  1LNW A;  4YDT A;  1EXM A;  1DP7 P;  2V7U A;  5EEA A;  3ERE D;  1PXZ A;  3A1Y A;  2VAS A;  1IN4 A;  2EZK A;  2MC4 A;  2OQR A;  2R7S A;  2GJR A;  4OZZ A;  3OS1 A;  5FFX A;  3IKT A;  3AL0 B;  2DK5 A;  2YU3 A;  3PUN A;  1QVG B;  2QUF A;  4Z1M A;  3DQV C;  4EJO A;  4IRH A;  3TO7 A;  4A3M J;  2ZB9 A;  4XLA A;  4I09 A;  4MHG A;  1EFR A;  4Z4U A;  3ZBU A;  2IOU G;  4UVB A;  1OR7 C;  3FXU A;  1O8L A;  3RDI A;  1CNF A;  2Y2Z A;  2WJY A;  3G2B A;  4BNC A;  4HF2 A;  2BGJ A;  1EH6 A;  3A03 A;  4AIH A;  1X58 A;  4UV9 A;  5K7F A;  5C4X J;  4D7M A;  4L5I A;  5GP9 A;  3CC4 I;  4DNR B;  4J19 A;  4I01 A;  4X7D A;  5JBQ A;  2P6S A;  2LRD A;  2JT1 A;  4M6V A;  1LDK B;  1T6Z A;  2ICW G;  3FKS A;  2XT2 A;  2BW3 A;  2EQR A;  4AIK A;  4EJT A;  5AN9 A;  4L8J A;  1VQ6 B;  1ZG1 A;  4YCQ A;  1B8I B;  5F27 A;  1DAB A;  1WKM A;  4MTD A;  1V5G A;  2ELH A;  1PYV A;  1NDH A;  2X6O A;  1Z6R A;  5K5R A;  2VL8 A;  3H94 A;  4WCG A;  3FK6 A;  2M5W A;  2ZXI A;  4Z6Y A;  3QPL A;  1HDP A;  1F4K A;  1VQ4 B;  3WTS C;  3J7Z I;  1JUP A;  2HDN B;  2EH3 A;  1R1T A;  4G8X A;  4LB5 A;  4XOT A;  2VQL A;  4P3I A;  1LFP A;  2Y0S N;  4HX7 A;  5EZG A;  2LR8 A;  1FYK A;  4JQF A;  3M07 A;  4HLY A;  3ZCO A;  3PQK A;  4D5F A;  5DM6 F;  1SFX A;  5DSZ A;  3DCF A;  2V9V A;  4IHW A;  2BM5 A;  1R71 A;  2K5C A;  2NS7 A;  1JT6 A;  5IP9 J;  4W8R A;  2PE3 A;  1GAW A;  1J5Y A;  3CO7 C;  1FNM A;  2XOK A;  1J7K A;  2ZZQ A;  3AVW A;  5C44 J;  1GXP A;  4BXU A;  1QH0 A;  3T8R A;  1J9Z A;  5TGT A;  5H5J A;  5D5U B;  2XPU A;  2F4I A;  4FCY A;  3GTQ J;  4N9I A;  2EZI A;  2RV8 A;  1K6Y A;  2BY0 A;  1MDM A;  1KQ9 A;  4I02 A;  3WHB A;  1WPC A;  3BRO A;  2XB0 X;  2FBK A;  5ICC A;  5J1Y A;  3F23 A;  3ZMZ A;  2GPJ A;  1N07 A;  1W4M A;  3WYA A;  3ZZT A;  4U4B A;  1B6A A;  4BJT A;  4ZCI A;  3AG2 H;  1XB2 A;  3GME A;  3SFZ A;  4QIW N;  1B9N A;  4E7Z A;  4M2L A;  1P7I A;  3IHU A;  5E3M A;  1UAA A;  4DNT B;  2OAZ A;  2M0M A;  1Z3Y A;  3BCF A;  1MNE A;  4KMF A;  1AMO A;  1HBX G;  3LA2 A;  3H3Z A;  2ZZG A;  3HOS A;  2QEN A;  3WTW C;  2KDZ A;  3KP2 A;  4CIC A;  2R5Y A;  1H42 A;  1W0J A;  3K7A J;  4WX9 A;  2PX9 A;  4TN1 A;  1BM9 A;  2JSC A;  1QBJ A;  5A89 A;  2KMU A;  4ZDO A;  2Z3Y A;  3R60 A;  2O3F A;  5HLT A;  3J80 Z;  2HTJ A;  4M9S A;  3C7J A;  3FX3 A;  3LNQ A;  3TH0 A;  2E1O A;  2W24 A;  1OB2 A;  1Y8Q B;  2AXL A;  4I98 B;  1K4Z A;  3TO9 A;  4XLF A;  2V7X A;  5CYV A;  5BPI A;  5LRR A;  4P25 A;  4XD7 A;  4OAZ A;  5K5Q A;  2ZXW H;  4E7K A;  1BR2 A;  1JKQ C;  4XIC A;  4KYW A;  1U9N A;  4A5M A;  2XTY A;  1I18 A;  2RNG A;  4MYT A;  2PJR A;  4IKF A;  4A6D A;  1OYW A;  5L3E A;  1C0W A;  1QUF A;  1LVK A;  4AC0 A;  1W34 A;  2GA1 A;  2ZKZ A;  5CJ9 A;  2FQ3 A;  1IUF A;  3HHH A;  3VSL A;  2DMN A;  3A01 B;  3W2H A;  3OYM A;  1U78 A;  2DOA A;  2PMH A;  3FIS A;  3W2I A;  2NOG A;  1WI9 A;  2VXZ A;  4XLH A;  1HQC A;  1WOS A;  5IT9 K;  1LLW A;  1NJI D;  1K7A A;  4Y15 A;  5JVG F;  5IYD J;  1YX5 A;  1JJ2 B;  4QSH A;  4JBA A;  3BQZ A;  4EEF G;  2RC5 A;  3EQL F;  4A69 C;  2NVT J;  1F20 A;  2BBY A;  2O7O A;  3ZQ7 A;  2M5S A;  1VBL A;  1Y1V J;  2VQH A;  2BVN A;  2H94 A;  3VYT B;  2LK2 A;  3X2Q H;  2W6J A;  1DU6 A;  3E6M A;  2E5N A;  1QJV A;  2JUC A;  5M3M J;  2HPI A;  1EKE A;  3SEQ A;  4BH9 A;  4II3 A;  3FXK A;  4D5C A;  4EJU A;  3JRE A;  2CUF A;  1FRN A;  5HZB A;  1A36 A;  2DPU A;  1P4W A;  2BHY A;  3QSY A;  2HYJ A;  5FFZ A;  5D8L B;  1YIJ I;  1G8X A;  2BMW A;  1XGS A;  5E20 A;  3CCR I;  3OE7 A;  3K10 A;  2EZH A;  2OQG A;  1SMY F;  4XID A;  1E62 A;  1ETX A;  1NK2 P;  1QGY A;  2OBS A;  1UJ8 A;  1ZLJ A;  4BXX J;  1LEB A;  2BGC A;  1FZP B;  4RB2 C;  1VQ4 I;  4NC8 A;  3H5A A;  4CGZ A;  2VBW A;  1FOX A;  1P9Q C;  4G12 A;  1O8H A;  1BI2 A;  1EH7 A;  1MW7 A;  3FHN A;  3DEW A;  3QU6 A;  3Q0V A;  4P2N A;  2M4K A;  3W6V A;  2NVU B;  2PMD A;  5GPC A;  1XTA A;  3DBL B;  1OPC A;  4WXH A;  1J9I A;  3BQJ A;  3HG9 A;  5E3N A;  4PC7 A;  1N08 A;  4OJ6 A;  2CG4 A;  1ULY A;  4V02 C;  4YC5 A;  2L0K A;  1LE8 B;  3OYJ A;  2GXA A;  1HVX A;  3A4C A;  3BH6 B;  2UVE A;  4KIT B;  3CXC B;  2PEX A;  2CQX A;  2NYX A;  3A2K A;  1XX5 A;  3TGN A;  2VBK A;  1P4X A;  4YXW A;  2JUG A;  4DYQ A;  4AWX B;  2A6T A;  2DA7 A;  2X53 S;  4KMU X;  4AU7 A;  1NB0 A;  3DFG A;  2WPD A;  1FX0 A;  4R71 A;  3HOT A;  2Y75 A;  1VHE A;  3PQJ A;  2C5H A;  1BLI A;  5HDN A;  3DV8 A;  4Z4V A;  1BI1 A;  2WY8 Q;  1AA7 A;  4ZH4 F;  1HOM A;  2XVC A;  3DWL E;  1IG7 A;  3DEE A;  2JA5 J;  1T0F A;  1S6L A;  1YG2 A;  2LY1 A;  4RMN A;  3H36 A;  1S5L C;  2M4G A;  2QQ9 A;  3PNT A;  2QF7 A;  2CWE A;  1ETW A;  3WGG A;  1VQK B;  4X06 A;  3GTM J;  1QHH D;  1MRZ A;  3CJT B;  2C4U A;  4LB6 B;  3GFM A;  1RI7 A;  3OS0 A;  2M7B A;  4IQ4 A;  2VNJ A;  5JHU A;  3CCE B;  4MYU A;  3MZH A;  1X1D A;  1BN8 A;  1R5I D;  4P26 A;  1DQU A;  3SZE A;  2XRO A;  4HE6 A;  1W36 D;  1AOY A;  3P9I A;  4ZYG A;  1R4N B;  2YX7 A;  2L5Q A;  5ILS A;  1ZK8 A;  2Q1Z B;  4UVA A;  1PUF A;  1TP4 A;  2EFQ A;  2M2E A;  2BEO A;  4UUS A;  1BJK A;  5GV7 A;  2LF8 A;  2DIE A;  4N9H A;  4HNU A;  3CB4 A;  2DLL A;  2IXS A;  5A88 A;  4ESB A;  2PJP A;  1Q7Y D;  1UD8 A;  2KDO A;  4O6J A;  2CV2 A;  4BQA A;  3CCV I;  3B73 A;  4M3B A;  2R3S A;  1K83 J;  3F0C A;  3S2H J;  4BE0 A;  5FKM A;  3SEJ A;  3ELK A;  3KLN A;  1I8D A;  1MIJ A;  2EA2 A;  3NE5 B;  1PJ7 A;  3EYI A;  2GM4 A;  1TL8 A;  1S29 A;  3S1M J;  2ISZ A;  1Z77 A;  2IVM A;  2QKL B;  1OYY A;  1BR4 A;  1MMD A;  4XLN F;  1NG6 A;  1V55 H;  2FU4 A;  1K78 A;  1ODD A;  2XAQ A;  3B78 A;  3Q0W A;  1OFE A;  1L0O C;  1YLO A;  3BR5 A;  4UZE A;  3QWL A;  1LFB A;  1QQ1 A;  1O3S A;  2YWF A;  2IW5 A;  5ICG A;  2LH9 A;  1VQO B;  4BL0 B;  2EIX A;  2GXB A;  1W7P A;  2DMT A;  3O2P E;  3PL8 A;  1QVF B;  3OZU A;  2IPQ X;  1UCR A;  1ZM4 A;  4NC6 A;  2H1K A;  3DPT A;  3QP6 A;  1SD5 A;  2BV3 A;  2DFI A;  3ML6 A;  3W2V A;  2V4D A;  2QTL A;  1ZN2 A;  2JWT A;  2XAU A;  2F2E A;  4S0H B;  2L54 A;  4EV0 A;  3J81 Z;  3VYR B;  3RZD J;  3NAU A;  2DJI A;  3FHZ A;  4CCO A;  3REO A;  3I71 A;  4CYC B;  1XDS A;  1PJR A;  3LMW A;  3RKQ A;  2VXD A;  1HW5 A;  5D8K B;  1SVM A;  1YE9 A;  3RIR A;  3LSR A;  1A35 A;  3MD2 A;  1QGP A;  4G9Y A;  4ASN A;  1TQM A;  4BDY A;  2AS5 F;  4E4H A;  3OYC A;  1ACI A;  1KK1 A;  3S93 A;  1RQR A;  1UST A;  1OIS A;  4KKT A;  5IYQ A;  1XC5 A;  4B4C A;  1OLT A;  3PUM A;  2NTQ A;  2B63 J;  2QDX A;  4RDJ A;  5AIP A;  3RKW A;  1Y0R A;  2GK7 A;  1VLY A;  1WU8 A;  2M8G X;  4RDU A;  1W87 A;  3ZQQ A;  1LQ1 A;  1IJE A;  2HZT A;  3I64 A;  3JRF A;  2P3M A;  4ZDL A;  3H9G A;  3GQ9 A;  2JPC A;  1FNN A;  3WTV C;  3D5L A;  3JUR A;  5IT3 A;  2FSW A;  2M7A A;  3SJP A;  3ROU A;  2QWW A;  2I1L A;  2QMU A;  2XTX A;  1BI3 A;  1KCC A;  4KJZ A;  3OW2 B;  3OYL A;  3AGP A;  4X7C A;  2MA3 A;  2W82 A;  3VYU B;  2JQ7 A;  3HPG A;  1R1U A;  4C3I J;  3KZZ A;  1D0Y A;  2BXZ A;  2LKP A;  4HDV A;  3COA C;  3AST A;  4JMQ A;  4LBZ A;  2VFN A;  4P3Y A;  1J75 A;  2WB1 N;  2ZXH A;  2BE5 F;  4ZYD A;  3BTI A;  2OTJ I;  2LTP A;  2A6H F;  4F7Z A;  2R7Q A;  2WY7 Q;  2Y30 A;  2KIU A;  1IRF A;  2XGC A;  1SM4 A;  2V1D A;  1U2R A;  3CMA B;  1PLU A;  4XN3 A;  1P4M A;  3SDB A;  3ZQL A;  1JTA A;  2BM4 A;  2K85 A;  4UB6 C;  2GOX B;  2Q2E B;  4M72 A;  1WOR A;  2EFG A;  1VQK I;  3LSP A;  2E2I J;  2VUM J;  5F4O A;  2R6H A;  4A12 A;  3K4M A;  1JA0 A;  3JU4 A;  1KTV A;  2NTP A;  3D5R C;  2INV A;  3GLX A;  4IW3 B;  2V1X A;  5D4S A;  1K61 A;  5FO0 A;  1IW7 F;  3H92 A;  3HOV J;  2JA6 J;  4NQW B;  3CCE I;  1BJA A;  1BMF A;  1TT0 A;  3BCB A;  4Z4W A;  1HA3 A;  3DKW A;  3OYN A;  3N97 A;  2UZK A;  2QVO A;  3M8F A;  4UUV A;  2DYR H;  2OU2 A;  1CGP A;  3V7R A;  1IO2 A;  2KHM A;  2BPO A;  1RES A;  2YU9 J;  2UXN A;  2QSF X;  1GV5 A;  2R7F A;  4TT3 A;  2BV6 A;  2OV7 A;  1T8I A;  1N06 A;  2JJ7 A;  3F22 A;  2IA0 A;  1SMT A;  3BWG A;  4AVP A;  2MH2 A;  4G6T B;  5F0C A;  1TQP A;  5DD8 A;  5DNS A;  1G6N A;  3F8C A;  3CCL B;  3DLL F;  1QX4 A;  4A5N A;  3I56 B;  1I27 A;  2YWH A;  3F9K A;  4Z03 A;  1XSD A;  3JRI A;  1E63 A;  3BCD A;  1AKH B;  3I4P A;  2UUZ A;  3JRG A;  1R00 A;  3VOD A;  1WJC A;  1WJD A;  5IPA A;  3V8K A;  1KQS B;  3ONQ A;  2XF6 A;  1JHH A;  3WOD F;  3SXY A;  4ZYA A;  2VBY A;  4B48 A;  1WH5 A;  3WQZ A;  3PFY A;  3BR0 A;  1QFY A;  2QA4 B;  4XRM A;  3ZQH A;  3JW4 A;  3GBG A;  1WSV A;  4YIR X;  3MVP A;  2VNI A;  2XZL A;  4I76 A;  1USS A;  3DEU A;  4WF2 A;  1VZ0 A;  2KZG A;  5CVV A;  4FET A;  1KON A;  3N6Z A;  3H9Q A;  1JJ8 C;  5LGT A;  3OOP A;  1FYM A;  3HIF A;  5B1B H;  3JX8 A;  1IDZ A;  4PJN A;  1RR8 C;  3JQQ A;  4YZ0 A;  2E35 A;  4XL9 A;  3IP4 B;  1VLO A;  2K3F A;  2O03 A;  2D45 A;  4GYI A;  1OOC A;  1W0T A;  3QOD A;  5F1J A;  2C5B A;  1Z67 A;  2DT6 A;  1ZRF A;  2DTR A;  1RZ4 A;  4RLZ A;  4ACA A;  1VQP B;  5HS7 A;  4KIB A;  2VBX A;  4DZJ A;  1HW1 A;  3OYB A;  3BT9 A;  4F55 A;  1G3Y A;  2VE9 A;  4IQJ A;  2V5I A;  1S7A A;  2ZTG A;  5DCM B;  1G2H A;  5F04 A;  2X1C A;  3P9K A;  2L02 A;  3TL4 X;  2HNH A;  4P1W A;  4H9G A;  2O1D A;  2PYH A;  5IYN A;  3QP5 A;  3QYF A;  2UWM A;  3BZK A;  3KZY A;  3PUB A;  3FPP A;  4CYD A;  2K9N A;  3HHG A;  3IAM 2;  1QPI A;  2Z6B D;  4LK1 F;  1HLV A;  4EMS A;  4E7J A;  3ZPN A;  2L7Z A;  4UUT A;  4ETS A;  1M1E B;  2O6G E;  4OPS A;  1ZRD A;  5JMC B;  1LUJ B;  2O0Y A;  4IHT A;  2WSS A;  1JTX A;  1IXR C;  3K70 D;  2EFO A;  1TYV A;  4YAW A;  1WWX A;  3VMW A;  4W8Q A;  2BXY A;  1BC8 C;  3E5U A;  3QAH A;  2VBM A;  5IY5 H;  3P26 A;  2Y69 H;  1GO2 A;  4FHT A;  1FTZ A;  2V79 A;  2YX4 A;  3CME I;  2CUE A;  4WK8 F;  4XON A;  3HDD A;  3CC2 B;  1QHG A;  1FBS A;  1WZ2 A;  2KRF A;  2GQF A;  4ANJ A;  2BVL A;  3HC7 A;  4I0B A;  3CMA I;  2BW3 B;  2V1N A;  3WG7 H;  1K79 A;  2XZP A;  1WP6 A;  2B7C A;  2DBB A;  1CQT A;  4URR A;  1K28 D;  2JK3 A;  1IZ1 A;  2JSP A;  3T8T A;  1V0E A;  3SY2 A;  1S4M A;  1ZTR A;  1ZM2 A;  3G71 B;  2XRL A;  3TDZ C;  3B8Y A;  2KIS A;  1RMG A;  2FX0 A;  1IN7 A;  2XAJ A;  2AHO A;  1FY7 A;  1XCV A;  4LC0 A;  1GDT A;  4UV8 A;  1ITY A;  1N8R D;  1WH7 A;  1D8K A;  4IHY A;  1TW3 A;  5ERI A;  4BDZ A;  4I0A A;  2F5D A;  5E79 C;  3JRC A;  4WQM A;  2HQA A;  1UD2 A;  1LEA A;  3O3K A;  2HI3 A;  1F5T A;  3GZ5 A;  4BJ5 C;  4XQF A;  2UV1 A;  3ZZU A;  2HQR A;  1S7E A;  1AIR A;  3LFU A;  2GIV A;  2MGQ A;  4XKW A;  2VC1 A;  3D26 A;  1Z6T A;  1VQ5 I;  4RDK A;  4F52 A;  3MEX A;  4P12 A;  1TSP A;  3F3X A;  3ABL H;  4J01 A;  4M74 A;  1W35 A;  1HXD A;  1D1C A;  1Y1W J;  1D1N A;  5JLV C;  3WTT C;  4P6Y A;  1TNS A;  3U1D A;  2XGJ A;  1MBF A;  1RPW A;  2QQB A;  4PJ0 C;  2P6T A;  2L3D A;  4KIC A;  3OIQ A;  3NEU A;  2B9S A;  3DLA A;  2PBI A;  3KYC B;  1MDM B;  3S2D J;  1F9N A;  1V5V A;  4Y4R A;  1ETQ A;  1OCP A;  1OCR H;  2GWR A;  2Z9O A;  5F64 A;  1N75 A;  2FMY A;  3Q0U A;  3PIO F;  3W2G A;  4M73 A;  3CCS B;  4M53 A;  3GQB A;  1XE1 A;  1T6X A;  1B59 A;  4IPA A;  1NHA A;  3ISX A;  4L9J A;  1UG0 A;  1A5J A;  3CCJ B;  2BM1 A;  2L01 A;  4FX0 A;  1T0F C;  3JQP A;  4Q47 A;  4K1X A;  2VPL A;  3M1E A;  2ZCW A;  4IL6 C;  4RB1 A;  1QFJ A;  3LWF A;  2UXX A;  3ULQ B;  2R5Y B;  4IZZ A;  2FNA A;  4KT5 C;  1X3Z B;  4WZL A;  1O7L A;  1YI2 I;  3CDH A;  3JSP A;  3RYR A;  2VKV A;  2HXI A;  4XLP F;  2F4M B;  1W5S A;  3BR3 A;  3G1O A;  3HJE A;  3I55 I;  1R49 A;  3OP1 A;  2VE8 A;  3HOW J;  4CA0 A;  4MFE A;  4DBQ A;  1O8D A;  2X3U A;  3JSO A;  1N77 A;  3RPU D;  2NV4 A;  1F60 A;  2NVQ J;  3QFS A;  2STW A;  1E1R A;  2VJ4 A;  1IV6 A;  4RD2 A;  4AYB A;  4D1Q A;  1TWF J;  2IBD A;  1VQP I;  1FPQ A;  5ILU A;  2LLK A;  2QGG A;  4XSX F;  1V54 H;  2AQE A;  5LEK A;  4KFC A;  2CW7 A;  3UKG A;  5J3O A;  4PJJ A;  3ZC3 A;  2KQR A;  3MHP A;  1CZF A;  3M7G A;  3WE3 A;  3Q6Q A;  1IN6 A;  1S72 B;  5A2Q K;  2D5V A;  3FM3 A;  3PFI A;  2VBT A;  5HLH A;  3W2F A;  1KCD A;  3WGI A;  2W00 A;  1MGT A;  3A0H C;  2OUM A;  4RLQ A;  4CXF A;  1W0U A;  3SQV A;  3DXJ F;  2DMQ A;  2L9S A;  3L2U A;  3AVV A;  4HYE A;  3PUF A;  3LAP A;  1D5V A;  5K7Z A;  1Q81 D;  4Z4R A;  1XSX A;  3ABU A;  4YZQ A;  1HKQ A;  2QM3 A;  4X0C A;  3U2Q A;  2XIG A;  5EEH A;  3OYE A;  4HV5 A;  1SD6 A;  1T33 A;  4IOC F;  1QPM A;  4G7Z F;  3DTI A;  4ENM A;  1MH3 A;  4PC2 A;  2MAB A;  4UXN A;  5L3B A;  1POG A;  2BGI A;  2IP2 A;  1MMA A;  2C4T A;  3K0L A;  2X6W A;  2P8T A;  2HPM A;  2O17 A;  1P2F A;  2DEU A;  4U0Y A;  2QXZ A;  3EPZ A;  1XS9 A;  4OMY A;  5E1Z B;  4M1K A;  1YW9 A;  3RCO A;  3OS2 A;  1MKM A;  3R6K A;  1R6R A;  3R6S A;  3K1M A;  5LHI A;  1K6O A;  3H3U A;  2ID3 A;  3E5Q A;  4PSW A;  1U8B A;  1RC9 A;  1UD4 A;  2M9H A;  2F1L A;  4IJA A;  5KVR A;  1QA1 A;  3K69 A;  1GAQ A;  3DDY A;  2FML A;  1PDN C;  3ZN1 A;  3A1P A;  3HUG A;  2B7E A;  4P96 A;  4R8H A;  3OV8 A;  1FJL A;  4ZTF A;  4FQG A;  3K2A A;  1BIA A;  5E17 F;  4L9N A;  4I6Z A;  4XSZ F;  1APL C;  2E2H J;  4PCQ A;  3DKY A;  1I5Z A;  2E2J J;  1A04 A;  1FOK A;  1AIP A;  3AGQ A;  5LRS A;  1FSE A;  3HRU A;  5L3C A;  4E7L A;  3NRV A;  1TVC A;  5DUI A;  4IOA F;  3WGH A;  3M8E A;  3P5J A;  5FLV A;  2OTL I;  1O8J A;  1EWY A;  1BW6 A;  2M30 A;  4LLG F;  4FN5 A;  2W84 A;  2WAQ A;  2Z16 A;  4M0L A;  2G0E A;  2R7D A;  1PVE A;  2EPF A;  5TV2 A;  2E36 A;  3CF2 A;  3CCM I;  2CS3 A;  1QFZ A;  3GFL A;  3HKZ A;  2CMP A;  3FXR A;  4RPD A;  4YZX A;  1BN5 A;  2OZU A;  4C9Y A;  1YJN B;  2M3A A;  2H09 A;  1ZRE A;  4ZYH A;  4HV6 A;  1DU0 A;  3B8H A;  3S1Q J;  2NST A;  2VJI A;  3WU2 C;  1MBJ A;  2V7Q A;  2LG4 A;  3QYE A;  1YIT B;  2E34 A;  2BM0 A;  3BNW A;  1FIP A;  3I4N J;  5D6E A;  2DA4 A;  2C77 A;  3CCJ I;  3OIP A;  4OIR F;  3KL9 A;  1EZG A;  2G0Y A;  5H2F C;  2MD0 A;  4CZC A;  1TC3 C;  2JN9 A;  1B9M A;  2BHZ A;  3BY6 A;  1DUX C;  1PE9 A;  3T5X A;  2DW4 A;  4DJA A;  5IYW A;  3LSI A;  3NWT A;  4RCZ A;  1LDD A;  4IHS A;  1VQM I;  3QQA A;  1Z0X A;  1OMI A;  2EFW A;  2HVR A;  2W85 A;  2HOE A;  3LFK A;  2DTZ A;  4HQM A;  4PGO A;  4II2 A;  1EFC A;  1XMX A;  2IS1 A;  5LHH A;  1I39 A;  4PFP A;  3AVY A;  1H85 A;  1PUF B;  4AF6 A;  3G6E B;  2XV4 S;  2V7W A;  3HTU A;  4UUS B;  4A3D J;  2GJK A;  3QFC A;  2QSG X;  2QYU A;  2XKP A;  4V2G A;  1U5T A;  1REP C;  4RGR A;  1SFO J;  4PAA A;  5EYR A;  1QO0 D;  3HEF A;  2BN4 A;  4RS8 A;  2H27 A;  2P4W A;  1VQ8 B;  1D2E A;  4HRI A;  2W57 A;  1BHE A;  5F08 A;  3OYG A;  2ZME A;  5CLS A;  2O9L A;  1HDD C; 
#chains in the Genus database with same CATH homology
 2Q1Z B;  3VSK A;  3KEW A;  2X6X A;  2DCE A;  3LSK A;  2V31 A;  2DIE A;  4HNU A;  2IXS A;  1WJE A;  2AQF A;  2JVH A;  2Z1D A;  4XLC A;  1UD8 A;  2KDO A;  2CV2 A;  1E79 A;  4CH7 A;  4BE0 A;  3LSG A;  5AMV A;  1W0K A;  4ASU A;  1U0J A;  1I8D A;  2KL4 A;  3DPU A;  4YZA A;  3GVL A;  3OL4 A;  4IX7 A;  3NE5 B;  2HLD A;  5DN6 A;  5FRN A;  2LC2 A;  3VR6 A;  5FRM A;  2KZV A;  3PNY A;  2L7K A;  4AVZ A;  2CFO A;  2QKL B;  2JA2 A;  2IGM A;  1BR4 A;  1MMD A;  4JOM A;  4W8T A;  1NG6 A;  3VWB A;  1X1B A;  2GJP A;  2IS4 A;  4NC7 A;  3SYT A;  2LH9 A;  2WAD A;  3K4J A;  4BL0 B;  3PL8 A;  3OFN A;  4RM2 A;  3DPT A;  3K4K A;  4Z06 A;  3DTK A;  3W2V A;  2GOM A;  4BQQ A;  2WA0 A;  2V4D A;  2XAU A;  4UZU A;  3OYK A;  4KT6 A;  4N4N B;  3K4B A;  2K9M A;  1IRX A;  3VYR B;  4LIU A;  4BE2 A;  2DJI A;  4KIS A;  1D0Z A;  4CCO A;  3KEY A;  2X8K A;  1WMR A;  2MYS A;  1PJR A;  3LMW A;  3BLY A;  2VXD A;  4XR6 A;  2JDI A;  3VST A;  2D3L A;  1D1B A;  1YE9 A;  2BOL A;  3MD2 A;  5CQG A;  2IGK A;  4EAT A;  3U21 A;  4LG3 A;  1N78 A;  3HXL A;  3W2W A;  4BDY A;  2HU9 A;  4E4H A;  3OYC A;  1J09 A;  3S93 A;  1MMG A;  3W3C A;  3UR3 C;  4KKT A;  5C1E A;  2NTQ A;  2ZZE A;  3PJR A;  1OLT A;  3MMY B;  4HST A;  3DU6 A;  4TSF A;  3VDX A;  4W8S A;  4CCN A;  2JJ1 A;  2GK7 A;  1GLN A;  1D0X A;  1VLY A;  4FXU A;  4PSX A;  3BG7 A;  3DU5 A;  3ZQQ A;  1SFK A;  3OWT A;  3OR1 C;  3K4C A;  1NHC A;  1X1A A;  3BH4 A;  4ZDL A;  3H9G A;  3AKZ A;  3G05 A;  3GQ9 A;  3D5L A;  3OYF A;  4BUP A;  2JIZ A;  3T56 B;  3JUR A;  2M7A A;  4B44 A;  3FDY A;  4RM3 A;  4FAS D;  1RU4 A;  3L2V A;  1KCC A;  4KJZ A;  3OYL A;  2W82 A;  3VYU B;  2IS6 A;  3HPG A;  3VSU A;  4C2U A;  2ELJ A;  2WAF A;  1D0Y A;  2W1O A;  4D9J A;  1OGO X;  3LNN A;  1WJ5 A;  1V5E A;  3C2H A;  4P5O A;  1E0E A;  1T5E A;  2ZXH A;  4U87 A;  4JMQ A;  3OOU A;  4PJM A;  2XND A;  1KMH A;  1DP3 A;  4F3Q A;  1H8E A;  3LMM A;  3SEZ A;  1Y56 A;  2R7Q A;  2WY7 Q;  1PLU A;  2RQQ A;  2BVM A;  4E7H A;  4R79 A;  1MAB A;  4Z05 A;  4XN3 A;  2WB1 A;  3SDB A;  1JTA A;  5HNF A;  3HPH A;  3OW7 A;  2GOX B;  2Q2E B;  3J7A Y;  2VB6 A;  4ITV A;  1Z3X A;  2FUG 2;  3K4M A;  3AL0 C;  3JU4 A;  1DGW Y;  3D5R C;  2INV A;  4G7X A;  2NTP A;  1NBM A;  3B90 A;  3MKZ A;  2V4J C;  1W36 C;  3CJR B;  4NQW B;  2UVF A;  2HVS A;  3RTR A;  4XNF A;  3ZR8 X;  1TT0 A;  3BCB A;  1BMF A;  3OOC A;  4P22 A;  4ZC3 A;  3OYN A;  2X6Y A;  1TZL A;  1IDJ A;  2CK3 A;  2CUZ A;  1RWR A;  2F6C A;  2P0W A;  3K4L A;  2KHM A;  4XKB A;  3VMV A;  3C2G A;  1VF7 A;  3GVK A;  3EUK L;  2EWE A;  4TT3 A;  2OV7 A;  2LBF B;  1O8G A;  5IK2 A;  2VIX A;  1Z21 A;  4XOP A;  3I3L A;  3OYD A;  2R7U A;  3KX2 A;  4G6T B;  2BSP A;  4XOR A;  1O88 A;  4KKS A;  3ZGK A;  4DGW B;  2L2O A;  3B4N A;  3F9K A;  4Z03 A;  1UD5 A;  3BCD A;  1DBO A;  1X1C A;  3MKY B;  2UUZ A;  4E7S A;  4X0G A;  4OJ5 A;  4KKU A;  1X4O A;  1WJC A;  5FRO A;  4ZTJ A;  1WJD A;  1YX3 A;  2F43 A;  3ONQ A;  4OAY A;  2XF6 A;  4HIZ A;  4GQN A;  1H8H A;  2F1M A;  2LBF A;  4XKC A;  4ZYA A;  1JI8 A;  1DBG A;  4B48 A;  3WQZ A;  3K6G A;  3BG6 A;  3LSH A;  3PFY A;  2LRE A;  2IS2 A;  1X0C A;  2LYC A;  3FKJ A;  3L2Q A;  4XKV A;  3OMY A;  3UW0 A;  4YEJ A;  3V42 A;  2JJ2 A;  1G59 A;  5CKT A;  4TKO B;  4Y3O A;  3S3O A;  1OFM A;  3D5S C;  4PJL A;  3IUO A;  3CZ6 A;  4BQN A;  4CCL A;  3GBG A;  2XZL A;  4XLE A;  1VZ0 A;  4DOZ A;  3GQ7 A;  2R4G A;  4FET A;  3K4N A;  3S3N A;  1KON A;  3H9Q A;  2ZSH B;  3H5R A;  4CUG A;  4J00 A;  4QPO A;  3PNV A;  2RRE A;  4PJN A;  1HZE A;  1OFL A;  2VKH A;  4YZ0 A;  4XL9 A;  2VKD A;  3IP4 B;  4BJ6 C;  3OL3 A;  2KVO A;  3OEE A;  5HVQ C;  1NG7 A;  3OYH A;  2CV0 A;  2E1M C;  2ZTN A;  2PJR B;  1OOC A;  3H9J A;  2WAE A;  2PMZ A;  2LOO A;  3QOD A;  3S32 A;  3H0D A;  2XSJ C;  2DT6 A;  1X19 A;  2XDV A;  4CCJ A;  2V9K A;  2W7N A;  2O0V A;  2DXI A;  3T51 B;  3OYB A;  3LL7 A;  1XG2 A;  4F55 A;  3K70 C;  2R7R A;  4IQJ A;  4I84 A;  2ZTG A;  3QOE A;  1BOB A;  3W2A A;  3AFH A;  4G7W A;  2QKM B;  2WJV A;  2X1C A;  1PKV A;  4YEL A;  3TL4 X;  2HNH A;  4P1W A;  4BGD A;  4CSW A;  1UD6 A;  1H80 A;  2NT9 A;  2O1D A;  3QYF A;  2UWM A;  2PYH A;  2LZJ A;  3FPP A;  1Z7L A;  3PUB A;  4C30 A;  1X4P A;  2R7V A;  3IAM 2;  2Z6B D;  3BC8 A;  1GQ8 A;  4HG2 A;  5KNL A;  2JVG A;  2KP6 A;  4E7J A;  3ZPN A;  2IGO A;  4F92 B;  3A35 A;  1OGM X;  5LD2 C;  3ZXS A;  2ODL A;  4BE1 A;  2PEC A;  3OAA A;  4PK4 A;  2WSS A;  2R7W A;  4DBR A;  3EUA A;  3OPO A;  3K70 D;  5CPR B;  3VMW A;  4W8Q A;  4LIT A;  4E0F A;  2KPM A;  3QYB A;  3H35 A;  4B3F X;  2VBM A;  4DK1 A;  2QE7 A;  4XON A;  1V5F A;  1QHG A;  1UEL B;  1PXZ A;  4CCM A;  2R7O A;  2VAS A;  3A1Y A;  4ANJ A;  2BVL A;  2MC4 A;  3IAS 2;  3HC7 A;  2R7S A;  2GJR A;  4OZZ A;  2V1N A;  2BW3 B;  3NWS A;  3BCA A;  3OS1 A;  2XZP A;  4MLO A;  3AL0 B;  4B3G A;  1WP6 A;  2OC6 A;  3FBI B;  4URR A;  4Z1M A;  1K28 D;  2JSP A;  2HVQ A;  3DQV C;  1V0E A;  4XLA A;  3OR2 C;  1EFR A;  3T9G A;  1OR7 C;  3BC9 A;  1O8L A;  3CP8 A;  2E60 A;  3B8Y A;  2WJY A;  3WWG A;  3G2B A;  1RMG A;  2R7X A;  4NUB A;  3MKW B;  4DNR B;  2LRD A;  3A3B A;  1LDK B;  3PSI A;  3TMO A;  4HSR A;  4BEH B;  1MND A;  2E5Z A;  4XMY A;  3FKS A;  2BW3 A;  2HDW A;  3OEH A;  4BDZ A;  2HZD A;  3EUH C;  4MR0 A;  4L8J A;  2HQA A;  1UD2 A;  2E1B A;  4BJ5 C;  4XQF A;  1ERD A;  2UV1 A;  4OWR B;  4B3X A;  2CV1 A;  2NSP A;  2VQC A;  1AIR A;  4OJP A;  3LFU A;  1V5G A;  4XKW A;  1PYV A;  5LFA A;  1WTH D;  1E43 A;  2QX3 A;  2VL8 A;  2V6E A;  1JRG A;  4NNJ A;  1COW A;  3H94 A;  1LKX A;  5CDF A;  1ZEL A;  2CH0 A;  4F52 A;  1K5C A;  2ZXI A;  1BPL A;  4BEH A;  3SUC A;  4J01 A;  3FBN B;  1D1C A;  4YRV A;  4BQO A;  3LSM A;  3HL2 A;  2D3N A;  4XOT A;  2VQL A;  3I9V 2;  1LFP A;  5HOO A;  2XGJ A;  4JQF A;  2VJJ A;  4Y33 A;  3CES A;  3OIQ A;  3DLA A;  3ZCO A;  2NZM A;  4Y4R A;  1DGR M;  4HPQ A;  1N75 A;  3DTE A;  2Y0S A;  2K5C A;  1SAU A;  4W8R A;  3SZG A;  2R7T A;  3GQB A;  2XOK A;  2ZZQ A;  1EE6 A;  2INU A;  4N4O B;  1UG0 A;  5TGT A;  2XF7 A;  3HAG A;  4B43 A;  1HG8 A;  2CW8 A;  1T0F C;  2F4I A;  2VJ5 A;  2VPL A;  1Y6I A;  1VJS A;  1K6Y A;  3FY3 A;  3S3M A;  1WPC A;  3OYI A;  4IZZ A;  2WZP P;  1OHH A;  2XF5 A;  2E1M B;  3H5N A;  5C1C A;  3VYS B;  4U4B A;  4DIQ A;  3S8P A;  4RLF A;  4BJT A;  4CA0 A;  1IDK A;  4DBQ A;  4DNT B;  1O8D A;  4E7Z A;  2Z2S B;  2F5V A;  3RPU D;  1N77 A;  1UAA A;  3EQO A;  2M0M A;  1Z3Y A;  3BCF A;  3GRH A;  1MNE A;  2K3P A;  1E1R A;  2VJ4 A;  4BS9 A;  4AYB A;  4D1Q A;  3A3G A;  2ZZG A;  3KRG A;  3HOS A;  1FMW A;  2I8D A;  1O8M A;  4C2T A;  1W0J A;  2AQE A;  4U7B A;  2VLA A;  2CW7 A;  3GQA A;  4PJJ A;  2KMU A;  2KQR A;  4F91 B;  4ZDO A;  1HA8 A;  2KRH A;  5HLT A;  1CZF A;  5CQE A;  2GK6 A;  5HKK A;  3DPL C;  5FL7 A;  3VSV A;  2VQG A;  3N05 A;  1D1A A;  4XLF A;  1KCD A;  2KLO A;  4BAC A;  1E3X A;  4OJL A;  4U49 A;  1T95 A;  2W00 A;  1QU3 A;  3E0J B;  2OUM A;  4RLQ A;  4XD7 A;  4H4K C;  1BR1 A;  4OAZ A;  1W9X A;  5JHF A;  4E7K A;  1BR2 A;  2L9S A;  3L2U A;  4NK6 A;  1I18 A;  2RNG A;  1MMN A;  2PJR A;  1UD3 A;  2LY2 A;  4IKF A;  2ZSI B;  3ZSC A;  2ZZF A;  1LVK A;  4YZQ A;  3VSL A;  4E7I A;  2L9N A;  2V7F A;  3OYM A;  1O8F A;  3OYE A;  2DOA A;  2VBE A;  1S9H A;  2VXZ A;  2X51 A;  3CJQ B;  4XLH A;  3HUG B;  3T53 B;  4F93 B;  3DTI A;  2MAB A;  1YX5 A;  4ZJZ A;  1MMA A;  2R9V A;  2X6W A;  2O17 A;  5HNH A;  2HPM A;  3GQ8 A;  2QXZ A;  4ZDP A;  3EPZ A;  2M5S A;  2W6I A;  3GVJ A;  1WJA A;  2CUJ A;  3RCO A;  1VBL A;  2VQH A;  3OS2 A;  1R6R A;  3VYT B;  1V0F A;  2W6J A;  2K9L A;  4PSW A;  4XN0 A;  4OZY A;  2E5N A;  1QJV A;  1UD4 A;  4C2L A;  2HPI A;  3UNG C;  3SEQ A;  4II3 A;  1IB4 A;  3DDY A;  2PYG A;  5KHD A;  2XC7 A;  2W4S A;  1E1Q A;  3OY9 A;  4ZTF A;  1G8X A;  3M8J A;  4PMH A;  3TBI A;  1WJB A;  2IGN A;  3OE7 A;  3K10 A;  2O0W A;  3DKY A;  3KYL A;  4NK8 A;  2DT7 B;  4E7L A;  1O8E A;  1WFX A;  3OYA A;  4PFO A;  4B47 A;  1O8J A;  2WAQ A;  2Z16 A;  2X85 A;  4NC8 A;  3CF2 A;  2NTB A;  2CS3 A;  2X1D A;  3DKX A;  3H5A A;  4HWV A;  1P9Q C;  3HKZ A;  2CMP A;  4YZX A;  1O8H A;  4C9Y A;  3L2R A;  3RQ4 A;  1MW7 A;  3FHN A;  2M3A A;  1E3Z A;  2A5W A;  2M4K A;  4XM3 A;  1KZL A;  3L2W A;  2VJI A;  2NST A;  3RSN A;  2V26 A;  3CMM A;  2QY1 A;  2V7Q A;  3CP2 A;  3HG9 A;  4OJ6 A;  2LG4 A;  2KRC A;  1O8I A;  3QYE A;  1HVX A;  5KCM A;  3OYJ A;  3ZRG A;  3ZPP A;  4LIV A;  3A4C A;  2UVE A;  4KIT B;  1SKY B;  3OIP A;  4CCK A;  4G6I A;  3A2K A;  2O04 A;  2VBK A;  3EQN A;  2MD0 A;  4CZC A;  4YXW A;  1FMV A;  2JUG A;  2NT6 A;  2A6T A;  2X53 S;  1PE9 A;  4AU7 A;  4DJA A;  2WPD A;  4HEA 2;  4QPQ A;  3LSI A;  3NWT A;  1FX0 A;  2NOJ B;  3HOT A;  4HNT A;  1BLI A;  1WJF A;  2WY8 Q;  1AA7 A;  1EA3 A;  3DWL E;  4BXF A;  2HVR A;  2IQ7 A;  3DEE A;  4OJO A;  2XZO A;  1OB0 A;  1KTW A;  4II2 A;  3E1S A;  3PSF A;  4BU2 A;  1IA5 A;  2LY1 A;  4RMN A;  2IS1 A;  2M4G A;  3PNT A;  4PFP A;  2X3H A;  2MFZ A;  1QHH D;  2GJK A;  2X1E A;  4E6K G;  3M1C A;  3OS0 A;  2M7B A;  2O5R A;  4IQ4 A;  4EW9 A;  1QCX A;  2WBM A;  1X1D A;  1BN8 A;  4MXN A;  2Z8G A;  4DK0 A;  4GRI A;  1DQU A;  2ZFU A;  4PUS A;  4HRI A;  1O8K A;  1NRK A;  1BHE A;  1W36 D;  3OYG A;  2L5Q A;  3ZIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...