4XNFA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620
Total Genus 234
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
234
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 234
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xnfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xnfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xnfA02
1JRGA 5C1CA 3VSTA 2NTPA 1K5CA 4XOPA 1OFLA 1OGMX 3GQ7A 2O1DA 1OOCA 2VBEA 1PLUA 1DBOA 2NTBA 1HG8A 4XR6A 1RMGA 2EWEA 3JURA 2X85A 4Z05A 3UW0A 1O8IA 1IDJA 2Z8GA 4W8QA 4PMHA 3ZSCA 4Z06A 3VMVA 1IDKA 1OGOX 3GQ9A 2PYHA 1O88A 4C2LA 5AMVA 4XM3A 2QXZA 2UVFA 4W8SA 1O8JA 4OJ6A 1O8FA 1O8EA 3GQ8A 1AIRA 1O8DA 2PYGA 4XKVA 1PE9A 1EE6A 1GQ8A 2QY1A 3VMWA 1O8KA 2NSTA 2QX3A 2VBMA 4XONA 3EQOA 5C1EA 3GQAA 1IB4A 3VSUA 4XL9A 4I84A 1O8LA 1QJVA 4XNFA 1PXZA 4XORA 4Z03A 3WWGA 4U4BA 2X6XA 4YZ0A 4XLEA 2NSPA 4NK6A 3EQNA 2NTQA 1KCDA 4YELA 2BSPA 1H80A 1O8HA 3ZPPA 2ODLA 2O04A 4URRA 2O17A 2NT6A 3SUCA 4OJOA 4U49A 4XKWA 1XG2A 3T9GA 1VBLA 1X0CA 1CZFA 4OJLA 2NZMA 2VBKA 4W8RA 2UVEA 1WMRA 4XN3A 4HWVA 2VJJA 4YEJA 1DBGA 2O0VA 4MR0A 4XLAA 1O8MA 2IQ7A 2INUA 1OFMA 2X6YA 3GRHA 2PECA 3B8YA 1KCCA 3VSVA 3B90A 3B4NA 3FY3A 4OZYA 4XN0A 4OZZA 1KTWA 1RU4A 2X6WA 4EW9A 2NT9A 4YZXA 4XLCA 1RWRA 4OJPA 1O8GA 2O0WA 2INVA 4XQFA 1JTAA 3KRGA 4XOTA 1BHEA 4YZQA 4OJ5A 4XLFA 4AVZA 1QCXA 4XMYA 1BN8A 4XLHA 2X3HA 3LMWA 4NK8A 1NHCA 2VJIA 4MXNA 1IA5A 4W8TA 4YZAA
chains in the Genus database with same CATH superfamily
1O7LA 2HCJB 3GBGA 3K69A 3KCCA 1DDNA 2WA0A 2R7VA 1EZGA 3BH7B 5CQGA 1WJAA 2R7FA 2XPWA 1R71A 1FNDA 1MH4A 1XX5A 2F4IA 2Q6IA 3IWFA 3QWLA 4WXCA 3RIRA 2H8RA 4KT5C 1FT9A 1GLNA 2MLGA 2D1VA 1SFOJ 3I64A 4RM0A 2JDIA 4U7BA 1S4MA 2L9VA 3V76A 4RAZA 3DTKA 3KZYA 2C4TA 3U6BA 1OGOX 2DO7A 4ZZLA 3A1PA 2BZTA 5LRRA 3ZMDA 3NAWA 2P81A 1CQTA 1G7RA 4FE7A 1OCPA 4HQEA 3PSSA 2EZIA 3WBJA 1G3SA 3K4CA 5L3DA 1QUEA 2HOSA 4KIFA 4DYQA 4QV2A 2LFBA 2NXNB 3PO3J 3QP5A 3W6VA 1E3ZA 5BSYA 4E7HA 4UUTA 3ZMVA 3JU4A 3BY6A 1XB4A 1A8PA 5L46A 4X6AJ 1GQ8A 3RJPA 1BN5A 3LSJA 2PMHA 3P9CA 2VC1A 3OW7A 2W25A 2VBZA 3KP6A 4EJUA 4Y13A 3LO8A 1K83J 2JZYA 1IAWA 2EA2A 5JI6A 1N07A 3A8IA 1PXZA 1IZ1A 2EFWA 3NARA 4CSWA 1Z7LA 3HXLA 2P5LC 4BDZA 3I4NJ 5HZBA 1UELB 1R9TJ 1FSEA 3W2GA 3QPTA 2F6CA 3CMEI 4EGYA 2DIEA 2V31A 5IYWA 2V7QA 2L02A 3ZMTA 1K7AA 5HS8A 3GZ5A 4G6QA 3BC8A 2DA4A 1NBMA 4DNRB 4ENKA 2FX3A 5DV5A 1HDPA 1OISA 2X48A 1K4SA 2ODLA 3MMPA 1MMNA 2B7EA 2PBIA 1KC8D 4BYYA 4ZTFA 4PZJA 2P4WA 3ZQIA 2IOUG 4HZFA 1YW8A 4CCNA 1SEUA 3SJMA 2GPJA 1V4RA 4BY7J 1S3JA 4XN3A 1O3RA 1G2HA 5E17F 2VBUA 4YEJA 2L7FP 4Q5SF 2W7ZA 1XD7A 1VNDA 2FBHA 4M72A 5HVQC 4HA8A 3F23A 1ZM4A 4G6DA 5FIUA 1MZBA 1DP7P 1FDRA 2CGPA 2HDDA 4IHSA 3DU1X 1TYWA 2VKDA 3M4OJ 2EINH 2E1NA 1NB0A 4DZJA 3HUGB 3LQQA 2DYIA 2PMZN 2CU7A 5EEAA 2OBTA 2G9WA 1MIJA 3CMEB 4A3MJ 1TWCJ 2BVMA 1ZG1A 2HWVA 4L9TA 3F9KA 4ZDPA 2NT9A 1NK3P 5FKMA 1FLIA 3LMMA 4ABZA 1LPQA 3BR5A 3SDGA 3VFZA 4Z4VA 3CCLI 2INVA 3GTMJ 3BR3A 1BHEA 3H9GA 3ZRGA 2KIMA 3DBLB 2F4NA 1FP2A 5JLWA 2CQXA 4B43A 2XSJC 1Z0XA 1IA5A 4PC6A 1XE1A 4A0XA 1WHUA 1V5FA 2CK3A 3L2VA 1T5EA 1LLWA 2K02A 2ISYA 3ONQA 2QQAA 3WTUC 3PFYA 3U1KA 1HG8A 2R5ZA 3BJAA 4RA2A 4GFBA 4JRAC 5GP9A 5K5OA 3ZBTA 3SJZA 2KZGA 3KEOA 3AKZA 1IDJA 1UB9A 2ELHA 1BJZA 2HTJA 5D5WB 4CHUA 1K78B 3LFKA 2DQLA 2PEXA 3BWGA 5GPCA 1QA1A 3ECOA 2BV3A 1BW5A 2M0MA 3FKJA 1F36A 3CUQC 3CCLB 1ETOA 4LC0A 5KCMA 1X19A 3JAMZ 2BY0A 2D2WA 3CCQB 2ZO4A 2MG4A 4FQGA 4V2GA 1O7FA 1XSVA 3CTAA 5JVGF 2V5IA 5EDNA 4G7HF 1WPKA 3E7LA 4U87A 5TGTA 1I7PA 4FHTA 3K2AA 2B5OA 4G1VA 2M7BA 1MABA 3AVUA 1JUSA 4BBRJ 2WAEA 2JT1A 3LAJA 1GT0C 3TP0A 1Z7UA 2OPTA 4MEYF 3VEPA 2H6CA 2VZLA 2VQGA 1HBXG 5IP6A 1MJAA 2HXOA 1QNTA 4AVPA 4M3DA 1W87A 3O6BB 1BI0A 2W1OA 2LBFB 4R1HA 3VYTB 3OSFA 2QTZA 2LKPA 4BE1A 4XRSG 1TC3C 5ILUA 1BI1A 1QGPA 2ZFUA 3IKVA 3MZYA 5FLXZ 3HEFA 2CV1A 1W2BB 4OJOA 2CQKA 4U49A 3HUGA 3RYRA 1BX0A 4NBSA 2TRTA 3J7AO 1GV5A 2CW7A 1W35A 4GYGA 4MFDA 3HPGA 2L3DA 1M1EB 3H5NA 2WWYA 1LJ9A 2O0VA 3GTGJ 2UXXA 1TP4A 5FFXA 4RDJA 1X2MA 4UB8C 1WH5A 4J00A 3BTLA 4AIJA 1R5BA 2DDBA 2INUA 4Q4ZF 4OMYA 5LHGA 1X1PA 1EFTA 1XMKA 3OIOA 2PECA 2WZNA 2A3SA 5M3MJ 3K4BA 1KCCA 4DK1A 1X1CA 2FA5A 4XIDA 4M4SA 4XICA 1R5NA 3DU5A 1FYKA 2OQRA 3LA7A 4H9GA 2E1RA 3IHUA 3AG4H 4OZZA 4J0QA 1TLHB 2FMLA 3FHNA 1VQMI 4XLNF 5CDFA 3CDIA 4X05A 3WE2A 2FNAA 4RS8A 2ZJ2A 4MTEA 2LREA 3CCYA 3QODA 2BMWA 1QPIA 1PP8F 1XG1A 4TT3A 2GIZA 3AK5A 2LDUA 4Q7JB 1WXRA 2E5NA 2CRGA 5FB2A 1K78A 2CW5A 3IUOA 5DYMA 2VE9A 2NVTJ 2DMNA 4KA4A 1VHEA 3OSGA 2M9HA 3CCJI 1WCMJ 2VLAA 2W7NA 2FNPA 2OD5A 1W34A 4Z4RA 2E35A 3BTJA 3QP6A 4GYIA 4YC5A 3JURA 1YIOA 3FBIB 3DF8A 1D5YA 2BYVE 1XC5A 2DI3A 5AN9A 3HRUA 3ASPA 1IJEA 4PMHA 4G7ZF 2VKVA 2BV6A 3O8HA 1V5EA 3N05A 1E43A 4I6ZA 3VMVA 2LF8A 2W84A 3HKZA 1AIPA 3G6EI 1UD6A 4M1KA 5TY0A 1VQMB 1I6HJ 4G6IA 1PVEA 3OYKA 2GXAA 3I9V2 2QF7A 5F1RA 2GZWA 4EQQA 1TW3A 3BR6A 4PJ0C 2LF7A 4LGWA 3GQ8A 2KIUA 3JSPA 1AIRA 1U6GA 5EEGA 4ANJA 2IVMA 2LYCA 1E63A 4DK0A 2LBFA 2OU2A 4IQ4A 4G1BA 3T8TA 1FEXA 1R7JA 2CS3A 3OIPA 4Z4YA 2BN4A 1BOBA 1QRYA 4F92B 2QLZA 3CCJB 1IB4A 5HZAA 3JR9A 1FYMA 2M8GX 1GJRA 2YWHA 2MC3A 5DUIA 3HGGA 3IL2A 1IXCA 1YFHA 1E2XA 2NSPA 3KLOA 3FIWA 5LEJA 2Q6OA 4NQWA 1OB2A 3PA2A 4DJAA 2HPMA 5FROA 4MHGA 2BGIA 1QVGB 1SKYB 4YIRX 5IYNA 3WODF 4KT6A 1IRGA 3RZOJ 2DK8A 4R8HA 3S1RJ 3HZJA 2A6HF 4B44A 1SANA 1K61A 1KQ8A 2XTWA 4UZEA 3T9GA 2O61A 3S93A 2WAQN 1KGSA 5D4RA 2DA3A 3MCAA 3HTSB 3G1MA 2FOWA 3K70D 2V9KA 1LEAA 3E1SA 3HG9A 1IHMA 4L0YB 1Y8RB 1E1RA 3GXOA 4P3IA 4ZGNB 3ZXSA 5F04A 5DEQA 2P6SA 3DPTA 2D45A 1JT0A 3S15J 2WY8Q 1O8MA 2A68F 3M8FA 5LMZA 4U0YA 5IK2A 3GRHA 1E64A 4BXFA 1VF9A 2QENA 1V5VA 4EJWA 1DGWY 4M9SA 5JFRA 2V1UA 3V8LA 3ZQCA 1J09A 4ZYEA 3H35A 9ANTA 1GHCA 3B4NA 4XRSA 4IO9F 4O6JA 3ASRA 5TR9A 3W2HA 4C2UA 2KIQA 2COMA 4YAUA 2Q8KA 1OGJA 2FSWA 3CCEI 2Y31A 2CQNA 5DCFA 4RBOA 1CNEA 4U9UA 1MDMB 1XDSA 1BW6A 2JA5J 1T0FA 2BW3B 1G4DA 2DERA 3G2BA 4Y33A 4RJLA 3FISA 5CJ9A 2OTLI 2Y0SN 4Y4RA 1G7TA 4CCMA 4HIZA 3E6BA 4AUXA 4PC7A 4ESBA 4XMYA 4BACA 4YXWA 4OJ5A 2ZFWA 4A69C 2FU4A 3BCBA 4IOCF 3SLNA 2EV6A 3OR2C 4Y9RA 3B78A 2WAFA 3HOZJ 4QUZA 3H1CA 3O8GA 4DOZA 1G7CA 4P3YA 1D0XA 1QGZA 3PENA 5LRSA 4IOAF 1A6IA 3NWSA 3BG9A 5DCMA 1H8EA 3GFIA 3BCDA 5CVVA 2O5RA 4EMSA 1RMGA 1DQUA 5E1XA 1QX4A 5B1BH 4BHPA 1OCTC 3ERMA 4U0VA 1J75A 2L9NA 1FX0A 2IJLA 1S6LA 3ZQGA 5HNHA 5HDKA 3MHPA 4Z06A 3GCMA 5FKOA 3MN2A 1V0FA 1JUMA 4OIPF 2STWA 4L9NA 2L54A 4O5VA 3BTIA 1QHGA 3GMEA 4KIGA 3AGPA 5E1ZB 4TSFA 1JTYA 2ZZGA 3PUNA 4Y7CA 2VFQA 4PSXA 3NB2A 2LTPA 2OTLB 5FJ8J 2IA0A 2XGCA 4LBZA 4IHTA 2XSDC 1WDTA 3J7ZI 4B48A 2LD5A 1YTYA 1EE6A 2DBBA 2XRLA 4B3XA 2EBIA 3L2WA 5TRDA 3GTQJ 1VQKB 1O8KA 1X4PA 2VASA 1OFDA 2WC2A 3GO5A 1WTHD 4YCQA 2JIZA 2P7VB 4P26A 1T6ZA 2VI6A 2ZJRF 1QUFA 3P9IA 3A4CA 2X6XA 3GTOJ 5KW9A 4BQQA 4I02A 4XLEA 1W7PB 1FBUA 2YUSA 2ZTNA 3AGQA 5J6XA 1QHHD 2XDVA 4RCYA 4W97A 3S14J 1OCOH 4G12A 3S1MJ 1SMTA 4PK4A 3PJRA 3AFHA 4EJVA 1HSJA 3H94A 1X1AA 1DDGA 1EV7A 2ZXHA 4RPBA 1I39A 2LP0A 3OOPA 2JRTA 2K85A 3FMSA 4XKWA 2F4MB 3FZVA 2Q6LA 4JX4A 3FKSA 4OJLA 2ECBA 3VDXA 3MFKA 5M5WJ 1EH6A 1UD8A 3DLAA 1EWYA 1ETYA 1SD7A 1MDMA 2GQFA 1XGMA 4BJ6C 1BBYA 2RREA 4LG3A 3V7CA 2BW3A 2WJYA 2E1BA 1ODDA 4MR0A 2VN2A 3I55I 3U9GA 2BVNA 1NTCA 1WPCA 1WI3A 4U88A 3ELKA 5L3CA 5BMZA 3H3ZA 3EYIA 3JSOA 4EH1A 3WNCA 2BOLA 4RAFA 2MFZA 1AHDP 3CJRB 3ABMH 2O8KA 5K7FA 2RAEA 4NBQA 1MMSA 3EETA 3FXQA 1OB5A 4F55A 3KEYA 2GK6A 4M3GA 2XNCA 3HGYA 1XPXA 3F0CA 3BJ6A 3TOAA 2F5CA 2LRDA 1BI2A 1QPMA 3E0JB 2P5KA 4ZC3A 1BA5A 4LIVA 1JKOC 2K9SA 5J1YA 2ZNZA 1JHFA 2DOEA 5C4JJ 1R22A 1SAXA 2ZTGA 4OOIA 2HPIA 4M6XA 1PDNC 1VJSA 2EILH 1MKMA 4LG0A 1GR1A 2JVGA 3ASOH 3MQ0A 2FD5A 1JUPA 2DA5A 1RR7A 4OAZA 2MLKA 1S72I 5CVIA 3W2FA 2BY3A 2OJED 1U2WA 3GVJA 1XMAA 2XOKA 1WZ2A 5J3LA 2DMQA 2VODA 3I55B 2L0KA 2R92J 2O1DA 3FM3A 1OOCA 3I71A 2BXYA 2E36A 2KJBA 1D0ZA 1P4AA 5D5XB 2W24A 1TYXA 1WJCA 1SD6A 3FXJA 5F0HA 1E62A 4CH7A 2QYOA 4C3HJ 1ZGWA 4BBSJ 5D8LB 3RI4A 2KLOA 2V4JC 3V8KA 3KP3A 2A61A 5E3OA 3G4SI 3HOVJ 4ENMA 4HE5A 3JCUC 2HOAA 3TW6A 4RLQA 3DV8A 4MNUA 2I5UA 2CWEA 4IPAA 1Z05A 2VJ4A 3Q0WA 3OFNA 1T2KA 3QU6A 4PGOA 2XVCA 3CC7B 2DCUA 1WFXA 2F43A 3D5RC 2XAFA 4XKVA 3ZQHA 1O57A 2HS5A 4Y3OA 3WTVC 2ZXIA 2YPRA 2GIVA 1SD5A 1TBXA 3CP2A 2ID6A 2E7WA 2CV2A 4EVIA 3CESA 2VBMA 1AOYA 3DDYA 1ORKA 4RGXA 4CA0A 3E6DA 4XNFA 2K9NA 4YG2F 5FRNA 1LFBA 4Z03A 2WB1N 4ON0A 1A36A 4M6YA 2QEXI 3S3NA 2EWNA 2LMDA 3CO6C 4YDTA 1ITYA 2GBYA 2CW8A 2LG4A 1R1TA 1T33A 2Y0MA 4BHBA 4YELA 1P4MA 3WYAA 3G4SB 3MWMA 1QGYA 5H59A 3A3GA 1U2RA 5FRMA 5F08A 1IDZA 4OOSA 5B66C 2WYRA 3MZHA 2D74A 3DEEA 1VBLA 1UD2A 2ZXJA 2LSOA 5GPAA 2DJIA 1WSVA 1X3ZB 1WQ2A 4Y17A 1FOYA 4ESFA 4HDVA 1DBGA 2BM6A 2F5VA 2PN6A 4RPDA 2VNJA 2LNBA 4U7DA 3LAPA 1DP3A 3JRIA 2DFIA 5BOXA 3PL8A 1GXPA 1PUEE 3ZPLA 2Y9YA 2G7UA 3OOCA 5FKKA 3V8JA 5GTHC 4IL6C 2YSRA 3OOUA 4WZLA 3AVTA 3OL4A 3UKGA 3GQBA 1KA8A 2JA7J 5C3EJ 2QEXB 1R00A 2VJ5A 1ZHFA 1X4OA 5A2QK 1KJZA 3LSMA 1D1AA 3B82A 4AYBA 2BM5A 2VFNA 4L5IA 4JX5A 4M53A 1IN6A 1J2XA 4AIKA 3M9AA 2A07F 4M3BA 4WXDA 2WR8A 3MVPA 3HM5A 4XLFA 4AVZA 2K3PA 4E7LA 1QCXA 4XKCA 2FX0A 3IRQA 2DDAA 2DMUA 4OIOF 2C6YA 1K8FA 4PFOA 4XLHA 5BPDA 2PE3A 4X06A 1SVMA 4P6YA 1M1KD 1FC3A 3U21A 1I1GA 2IPQX 1R49A 1DG1G 2MC4A 1FBQA 4O3MA 3GQ7A 4LK1F 2EFQA 2M87A 3J80K 4N4OB 4KIBA 3HAGA 1NDHA 3CMMA 4XR6A 3ZCOA 5HXBA 2VBWA 4KJZA 5FA6A 1RKWA 3CJNA 2ME6A 4Z2YA 1FMVA 3S1QJ 1WSRA 4BH9A 1TSPA 1IV6A 5B1AH 1BR4A 5LBQA 1VQ8I 4P1VA 1FYLA 2JMWA 1XFOA 3CUOA 3OYIA 4BY1J 4A5MA 3ASTA 1XCVA 4D0PA 3H92A 2VBSA 3QFCA 1Y8QB 3L2QA 1IO2A 2QXZA 1W1WE 3C2BA 3GFJA 1AKHB 4NC7A 4C3JJ 1LE8B 1XGSA 1FP1D 1RUNA 1DARA 3OEEA 2MW8A 1F43A 2B7BA 2QWWA 1WI9A 3MAJA 1ONVA 3GZ6A 4ACAA 3PSZA 3SQVA 1FMWA 4QFMA 2R0QC 4ZCIA 2ZBVA 4PABA 4CCKA 2KHMA 1R5ID 5J4YA 4PJNA 4BE0A 3KIOA 4BGDA 1R5OA 1QRCA 3R0JA 3B73A 3D5LA 4N4NB 3QSYA 4FETA 4G7WA 3VSUA 2ZSHB 4XL9A 4I84A 2DT5A 2V9VA 4UHTA 3ASQA 4TMZA 2X51A 3BG6A 4Z4ZA 1STZA 3WGIA 4EGZA 4IKFA 4NCNA 3BZCA 2ELJA 2ME0A 2W6JA 1BX1A 3WE3A 2FJ1A 2XAJA 4ZYAA 3SEJA 2L4AA 2QZ8A 2X4HA 1VQ8B 4ACBA 3DBRB 5ERIA 1G3WA 4U0WA 1PJ7A 2GK7A 3TO6A 2V6CA 3BZKA 3OYDA 4LOCA 4UV9A 3FDYA 4UUVA 2QUFA 2L9SA 2KT0A 1IUYA 4RD1A 2R5ZB 4E7ZA 3HJEA 3ABUA 1UAAA 1CQXA 3SZGA 2O6GE 3SZEA 5IYBJ 2KDOA 3QOPA 2HQRA 2K7LA 1X0CA 1S9HA 4FX4A 2A5WA 2KJCA 4JOMA 2VBKA 1H42A 3DXJF 5E3NA 1TZLA 3BROA 1U8RA 1WOPA 4HWVA 2VJJA 2O9LA 2MGQA 4NC6A 2FRHA 2NV4A 2QMUA 2LC2A 3SQNA 3BG5A 4M6VA 4LB5A 4HSRA 2M0CA 4HF2A 2NVXJ 2EZKA 3ML6A 4X8IA 1W5TA 1BJKA 1RZ4A 3BQJA 1OCCH 1UMQA 5HOOA 2MSYA 2YU3A 4HF0A 1VQNI 5FLMJ 2BM1A 1QFJA 3FKIJ 2XF5A 2HI3A 4YFXF 2FEZA 1QU3A 4M0LA 1YJWI 2Q0OA 5IP9J 1FOWA 2CNDA 4DQKA 2ZL5A 2HNHA 3P9KA 1F4KA 3D0SA 5HODA 2O0WA 4XBFA 4PC3A 2BX6A 3E5UA 5ILVA 2AXTC 4XQFA 1JTAA 5JMCB 4FWTA 1D1CA 1KK1A 1FIAA 1E3HA 1Z1DA 2FQ4A 2RV8A 5EZGA 1EA0A 1YS6A 3DQVC 1MBJA 1VHOA 3I1FA 1JA1A 3CCSI 2NRAC 4MXNA 2ZITA 4HV6A 4JQFA 3CCUI 3NAUA 1AKHA 2R7RA 5C1CA 2HVSA 3K4MA 1LE8A 4KYWA 2DMPA 1YX5A 2DPDA 2F5DA 1HA8A 2VBEA 1KONA 2FE3A 1XGNA 3G1OA 3JRCA 3BPVA 1T0FC 1XN7A 1FNBA 1IUFA 3TEDA 1N75A 4WZKA 3FX3A 3N97A 1JT6A 2CUFA 2EV0A 4A6EA 1MSEC 3LL7A 1ZR4A 5A88A 1VQNB 2R7DA 2CQQA 1R36A 1UD4A 2G0YA 3DPUA 1HKSA 2P6TA 1QA6A 4AF7A 3BDDA 4G94A 4RAGA 1IDKA 3GQ9A 6PAXA 1YJNI 1YJWB 3I4MJ 3OY9A 4KKTA 1GVDA 1ENHA 3CO7C 3DCFA 2XASA 1D8JA 2M7AA 1R6RA 1I3QJ 4B47A 2NNYA 2GM4A 3CCSB 2DA6A 5J8FA 1MJ9A 3EQLF 3VB2A 1WSUA 1Y0YA 1ZYRF 3EUHA 1VTNC 4P12A 2L2OA 4ROXA 3CCUB 4C30A 2A6EF 2EB7A 4HX7A 2HTSA 5K1YA 1Z9CA 1E79A 1DU0A 2LKXA 1AU7A 2E2HJ 4M2LA 1D1NA 2WB1A 4N9HA 5HDNA 1VLOA 3CCVI 2R7OA 2B7CA 5DN6A 3MKWB 4CICA 1J59A 3F72A 4QTRA 3HOTA 3H9JA 3C3WA 1E0EA 4YAFA 1P7JA 3VSKA 2JSPA 4EM2A 4YIFA 3H09A 3FXLA 1BMFA 1YJNB 4RB3C 5BS6A 1V55H 1ZAOA 2CG4A 4G8XA 4V2FA 1OHHA 1REPC 1XG2A 5HLTA 2KRHA 2LY9A 2NZMA 2HGCA 1R4NB 2DFHA 2CFXA 4TV7A 1A04A 1NRKA 1WMRA 2OZ6A 1XSDA 3K0LA 2VOOA 3VWBA 4P9UA 1EF4A 3MD2A 2V7TA 2XC7A 3D26A 1L1IA 1IDYA 3BNWA 1Q81D 1IN7A 3FF5A 5HLHA 3WXMA 4IVNA 2DT6A 1W9XA 2CC2A 3V42A 2CBXA 3B90A 2VNIA 1LDJA 2VONA 5IYRA 3CCVB 5H2FC 1RUOA 4ZH4F 1N8RD 2L7KA 2MYSA 3HSFA 4NUBA 1EP1B 3SFZA 3J81K 4HNUA 4A0YA 1I8DA 3HOWJ 2XB5A 3BCAA 3K70C 2I1LA 2RNGA 3GFMA 1OLTA 3DBHB 1ACIA 3F8FA 2KP6A 4CCJA 1JKPC 3FM5A 5BSXA 3P5JA 4A3IJ 4XOTA 2CQ7A 2W00A 2DPUA 1SM4A 4IRIA 3ZMSA 4NQWB 3E6CC 4A3GJ 1UHSA 3WHCA 4R79A 3CZ6A 4CUGA 4NK8A 2KPMA 1UHWA 4A3BJ 1EFRA 4W8TA 4J19A 5E8IA 1OFCX 1MBFA 3K1NA 1R23A 1WKMA 2V26A 1POGA 3E97A 3ML3A 4Y52J 2J5OA 2MH9A 1VQ6I 1I3AA 4OP7A 5H5JA 3SYTA 1PLUA 3K6GA 3VO1A 5IT3A 3CXCB 4G9YA 4PJMA 1EFUA 2HR3A 3JRGA 4Z05A 3JRAA 1EH7A 1X2NA 1K8AD 3UW0A 5GAGJ 5EGOA 2R7XA 3B02A 2F48A 2PIAA 2XKOA 1VQPI 1HCRA 1MNMC 2V7VA 2X1DA 2KVOA 3P27A 2QGUA 3K4LA 1SKQA 3ZIAA 3RPQA 3G73A 3U1DA 4C43A 1B9MA 1I6XA 4GO1A 4RDUA 2Y9ZA 3PNVA 1IC8A 1DPUA 2PYGA 1EP3B 2HXIA 4LD5A 3H3UA 2GREA 4B3FX 3WTTC 2WADA 3AG2H 3QAHA 4MO7A 2PLFA 4Y7NJ 1IRFA 4DQ2A 2C4UA 1VQ7I 3VO2A 5FD6A 1B9NA 1U3EM 1BR2A 2JVHA 4L0ZB 4C0SA 1Y56A 4XSXF 5F4MA 4BEHA 2OBPA 2CW0F 3PSFA 3A01B 4NHJA 3HBLA 1VI0A 3CC2I 3WTSC 2XGJA 2PMUA 1J7KA 3MZ8A 4R71A 1YLOA 1VQ6B 3FWEA 1VQLI 1VZ0A 2JSCA 5E8GA 3AG3H 4YZ0A 4HBLA 4DIQA 3DTEA 3VODA 2XNDA 1Q9SA 5GADJ 4D7MA 2DODA 1P4XA 2Z33A 4MLOA 4MYUA 2DW4A 1VQPB 3KYCB 3LFUA 4JX6A 4A93J 5HS9A 4PGHA 3H0DA 5DCMB 1W4MA 2HLDA 1COWA 3BT9A 1AMOA 3RZDJ 2E2JJ 4XD7A 4M71A 1DABA 3F8NA 2PJPA 1UZCA 1MD0A 2X6OA 2ZXWH 3QOEA 3GTKJ 5AONA 3WG7H 3H9NA 1H8HA 3DEWA 4FXUA 3OMYA 5L3BA 2QBYB 1BR1A 1YRNA 1VQ7B 2B63J 4KUMA 1LUJB 2EIMH 1U9NA 4KICA 4N0BA 3GZNB 2DA2A 3KP4A 1ZK8A 2X1CA 5J8CA 1T6SA 2X6YA 2LZJA 4M9XA 1H8AC 1E1QA 3CC2B 2GXGA 2QN6A 1VQLB 4E6KG 3R4KA 1H85A 1QFYA 2QA4I 2FOKA 1ULYA 4ZTJA 4Y15A 3LQRA 1DGRM 2RN7A 3G6EB 1S29A 2DN0A 4HX8A 1U8BA 5JR3A 1FJLA 3GVKA 1QVTA 2P3MA 4X7DA 3TQNA 3BG7A 2BHZA 2KRFA 2IS2A 3VNUA 3TP3A 3RYPA 2F2EA 3F8BA 4NNJA 4QVAA 1WORA 4EV0A 2ID3A 2VC0A 4Z4SA 1KQ5A 1OFEA 2DJNA 3OEHA 5JBQA 4F7DA 4ZYGA 4WWCA 1WOOA 3HHHA 2ZNYA 3QPHA 4EATA 4YZAA 5KHDA 4UZUA 1HQCA 5IOZA 1BL0A 2XF6A 3GWZA 4BQOA 4IX7A 4UY8I 3S1NJ 4X7CA 1X3WB 4UAJA 1YW9A 1R58A 1OFLA 4HX4A 3LSRA 1QGAA 2PMZA 2JJ1A 2GXBA 3V7RA 1TW2A 2EIJH 2WPDA 4G5GA 1EH8A 2EFNA 1V5GA 5CPRB 1YHQI 3J81k 3T8RA 3MKLA 3KETA 1OCZH 2HYJA 1MBEA 4AM3A 2QA4B 5GTIC 3BP8A 2M45A 4BS9A 3A02A 3A01A 5ICGA 2O03A 2GJKA 3Q9SA 2X53S 2VBYA 3OIQA 3Q38A 1HKTA 5IT9K 4RGUA 1WGXA 3COAC 1FNMA 1AA7A 4QSHA 4WF2A 4I76A 1VQ5I 5L3GA 4KH3A 5DM6F 4IHXA 2EJRA 3KZIC 2ZB9A 2IXSA 3OYGA 1L3LA 2EQRA 2RDPA 2R5YA 1SC7A 2Z6BD 2QY1A 4GCVA 3VMWA 2ZJQF 2LLKA 2R3SA 2DT7B 4E0FA 4RM2A 1EP2B 1H0MA 3CB4A 2D1HA 1JNYA 2UXNA 4P25A 2OCEA 4PDKA 1KQSB 3QPLA 4LLGF 3ZQ7A 3IH2A 3CCMI 3PSIA 5CVJA 4LG0B 5KVRA 3OZWA 3GSIA 3RY8A 2CF4A 1IRZA 2WTEA 4Z4TA 2NS7A 2EPFA 3TOBA 3CW2A 3Q6QA 2JK3A 1YHQB 4X0CA 5JHFA 3CCEB 1T6YA 4HG2A 2QBYA 5FNZA 1EXMA 2EFPA 4B1RA 1Y0UA 1RESA 1ZGAA 5DUKA 2OZUA 4BNCA 1KK0A 2BSPA 4X1EA 2ZZQA 3LYCA 3ZPPA 1IN5A 2Z99A 4F93B 4CDGA 3F21A 1O3SA 2M4GA 3IH3A 3PIOF 2O04A 4URRA 4A3KJ 2BPOA 3SUCA 1TYVA 3BPXA 5EG0B 2R7UA 4A3FJ 3T0YA 2CSOA 3OS1A 2D5VA 1GAWA 5GAHJ 3K1MA 1ON2A 1JTXA 4B4CA 4EJOA 5F0FA 2VBTA 3MCZA 5IOYA 1N0VC 3R6KA 4WZTA 2RC5A 4CZCA 5KSWB 2DY1A 5DD8A 4RD3A 1JGGA 1NG7A 1SFXA 5EEHA 1TQPA 2IGKA 3HOUJ 1TVCA 4RDLA 1XDUA 1V0EA 3CCMB 3VSVA 5TJJA 4TKOB 3LSPA 1ZRDA 2JUCA 2YUHA 1V54H 3NRVA 4ESJA 3QU3A 4AC0A 4HLYA 3AL0B 4P9FA 4RB1A 3ZBUA 4UXNA 2VBXA 4QVJA 5JLXA 2AQFA 3CPWB 5E1WA 3BH4A 4FCYA 2K4BA 3IRRA 3ZP5A 4HDUA 2V7WA 1XSXA 3B8HA 5CYVA 4ZYHA 2BM4A 5IYQA 4BJTA 1QZZA 4DQLA 2DTRA 1F60A 3GX4X 5DNSA 3GW2A 1B8IA 2Y48A 1N06A 3L2UA 1WJ5A 3OYBA 2PI0A 4YALA 4CQJA 1ZRCA 1RQRA 1NG6A 3RKWA 2HVQA 1T95A 2WY7Q 2VT3A 4G6TB 2R6HA 4ZZDA 1R5GA 3DEUA 4YFKF 3I54A 4D9JA 5A2QZ 1OGMX 2XAHA 4ENNA 5KK1A 3K4JA 3BR2A 4L5JA 3K4KA 4LIUA 2OK7A 1QA2A 3R6SA 2F4OB 3CMAI 2W4SA 2E34A 1D3YA 1H88C 1O8IA 2GA1A 4W8QA 2M34A 4HYEA 4X7EA 2XB0X 2KZVA 3HB9A 1G7SA 3ZSCA 2P8TA 2BGJA 1OR7C 3M1CA 4HPQA 3ONYA 4AF6A 1S7EA 2H8WA 1D2EA 3KPHA 3GF2A 4QIWN 1ETWA 3W2WA 2UVFA 5D5UB 4P6VF 2QSGX 2L9RA 2CFOA 1GDTA 2V79A 1TQIA 3EYYA 3OV8A 4XKBA 3K10A 4I2OA 4YAWA 3J80Z 3WTWC 3WU2C 3C7JA 2XGEA 1A6QA 4RGSA 4BQNA 3A03A 5THXA 4JYKA 4LFUA 3VPRA 2H09A 2QGGA 1O3TA 1B59A 4BL0B 2EK5A 3WNDA 2OF7A 5EG0A 1UD3A 5GV7A 5H20A 2XPUA 2DK5A 1NHAA 5K7ZA 1MBKA 3F6OA 3BR1A 5H6QA 1YG2A 3HDDA 2JPCA 3W2VA 1PKVA 1QH0A 3CMAB 5JLVC 2BY1A 2QYUA 1D5VA 2J8KA 4KMUX 1MGTA 2OCCH 4P5OA 5JHUA 4FE4A 4WX9A 3CMYA 2VPLA 2YX7A 4RMNA 4DNCA 4KNYA 4QPOA 3CLOA 3EUHC 2ZBUA 4OPSA 3KX2A 4DW6A 3OYNA 2O7OA 2AS5F 4PCQA 3ZN0A 2UWMA 2C5BA 5BNGA 2O17A 1W0TA 1S72B 2O3FA 2K86A 1OMIA 1YX3A 2H1LA 3CP8A 2B9SA 3SZPA 3RQ4A 3PNTA 3HHGA 3Q3SA 4TMVA 4GQNA 1HKQA 2CUZA 2F5FA 1JGSA 2YX4A 4YRVA 3W2IA 1TNSA 1Z67A 5J3OA 1N77A 3L09A 3CCRI 1SAUA 1JJ8C 1BC8C 3U6KA 1OFMA 3FK7A 4FTHA 1K6OA 2PG4A 2Z3YA 3OR1C 1LVAA 1LB2A 5KAIC 3JRFA 1RETA 3TO7A 1ZREA 2K40A 1DPRA 2RVCA 4L8JA 1IF1A 2V7FA 1LVKA 4I98B 4YIIA 3OW2B 5M3FJ 2D9RA 1MRZA 2JA2A 2WAQA 3FXOA 4YZXA 5CKTA 2HQAA 2X1EA 1O8GA 1QZEA 5J1RA 3LNQA 3QE2A 1Z3YA 2ZMEB 2HKOA 3DFGA 3EPZA 3M8EA 5F4JA 4GRIA 5F0CA 2DA7A 3O3KA 3GLXA 4C9YA 3DTIA 1BN8A 2RNJA 2KFDA 2H1KA 3L2CA 1JI8A 1Y39A 1BC7C 1LEBA 3N90A 3R61A 4OPOA 4QPQA 2DMTA 1KU3A 3H5AA 2F3LA 4FASD 3FBNB 3L1PA 3GTJJ 3JRBA 3QYBA 2W48A 1G3TA 1YQAA 2MD0A 2I8DA 5F27A 3FXRA 3TL4X 1YW7A 1P7IA 4HRIA 2KL4A 3K1PA 2Y0SA 1IW7F 5E79C 2ETHA 4HNVA 5J4VA 3AAFA 2VBVA 2FVGA 3BG3A 2KDZA 2FQ3A 2JRMA 1VF7A 4CYDA 2MA3A 3PA1A 2XF7A 1NJID 4KKUA 1GUUA 1HC8A 1HF0A 3ISPA 2M8EA 2M5WA 2RC6A 4OM9A 1FTZA 2DAOA 3HL2A 5J35A 1PE9A 1OPCA 5EJCA 1KU9A 1SVLA 2E1MB 4II2A 3RKYA 5DSZA 3ZZ0A 4P96A 5L3EA 1CF7B 1YYVA 2DTZA 1IJWC 2XTYA 3O2PE 4YHBA 3T56B 4RLZA 2BF4A 1D0YA 2XUBA 3RKXA 2QSFX 3X2QH 4ENJA 4UVCA 1DUXC 1VQ9I 3ASSA 2VNHA 2X0LA 1TWHJ 3NE5B 3SY2A 5LGNA 3VYSB 1YI2I 5E3LA 2BVLA 2WZPP 2X0KA 3DKXA 4CZZA 2VE8A 4ETSA 1I50J 5ILSA 1MMDA 4N3GA 4ZJZA 2HZTA 2PX9A 1UG0A 3Q0VA 2OK8A 1RRJA 4V02C 2Y69H 1YIJI 2C5HA 1TWAJ 1IGNA 2JA8J 2JN6A 3TBIA 4EM0B 3HSEA 1E17A 3ONUA 4BKXA 2CJJA 5FGMA 4Z4UA 2R7TA 3SLDA 5F1JA 3D1NI 1G59A 4A2UA 1RIOH 4WZEA 5E6TA 3E5QA 2M30A 4BDYA 1YJ9I 1B72B 1HDDC 3PQKA 3A3BA 3W6JB 3WTXC 5F6FA 3ZZUA 2L7ZA 3KYLA 1LKXA 1FIPA 2ZMEA 4OWRB 1USSA 5D8KB 1Y6IA 3IKTA 3LSGA 4FK8A 3QYFA 1MBGA 4RD0A 3WBKA 3P4GA 4DYCA 3ZN1A 1SD4A 3EUKL 5IPAA 1TT0A 1ETKA 2CH0A 4HOBA 1F20A 1HZEA 3ERED 2ADUA 3SKBA 1VQ9B 2E5ZA 1FWZA 4LLNA 1YI2B 1ZG3A 4B3AA 1FNCA 2O0YA 2IW5A 4FISA 1K73D 1HXDA 4L9VA 1J0RA 5M5YJ 1N05A 1RWRA 1PP7U 4BU2A 2JJ2A 3OAAA 4XLPF 2DQRA 3ZQFA 1BI3A 1ZM3A 4L9JA 1OQYA 4YAOA 4YZQA 1WVRA 1YIJB 3OL3A 4IQJA 3ZMUA 1TTYA 1R4MB 4E7SA 4RB0A 3HKZN 2GJRA 3RCOA 3LSHA 4C3IJ 3OP1A 4HQMA 1U5TA 3IH4A 2BSAA 3RIQA 1UJ8A 4BAYA 2VQLA 4LK0F 1YJ9B 3D5SC 5E18F 4KDPA 4QLCU 2VFOA 5TV2A 1W36D 1K5CA 4I7HA 3B6AA 3CF2A 3J81Z 2VIXA 2QQ8A 1OYYA 2MBFA 5EYRA 1MNEA 1H9GA 2PJRB 2W57A 4Q47A 2V1NA 4ASUA 1TWGJ 1X3UA 1SMYF 3I53A 3Q9VA 3VSLA 1QVFB 2GJPA 4WQMA 1CF7A 4J01A 2E19A 4HLXA 4E7KA 3K4NA 3DP7A 4L5EA 1ZGJA 1A35A 4JK1X 3SZTA 2PYHA 2NS8A 5AIPA 1MMGA 2DU9A 4PSWA 3K7AJ 1UFMA 1OR7A 3M8JA 3L00A 2XAGA 1A5JA 2Q2EA 4EEFG 2BEOA 1O8EA 1B1BA 4A3LJ 4WK8F 2B0LA 2NAZA 1WRJA 3CDLA 3MEXA 4B09A 2KQRA 2XGDA 5C4XJ 1T6XA 3PFIA 4UVBA 2AHOA 4OU0A 2NPFA 3ULQB 3HOSA 2QE7A 1W5CC 3R60A 3ISXA 3KFWX 3JW4A 5GV8A 3LA3A 2IGMA 4LJZF 2FMYA 1O8LA 4L18B 2XKPA 3GVAA 3S32A 3A8KA 1TLLA 2V1XA 1IJFA 3WWGA 3OYCA 4GXOA 4IHWA 1FRNA 3TMOA 4U4BA 3ABLH 2NOGA 3HYIA 1B72A 2BE5F 1EKEA 1GO2A 2R9VA 3ES9A 3FPKA 2V7XA 5IYCJ 1EJ9A 4B8XA 2VXDA 4MIMA 4LB6B 4BUPA 4RM3A 3LWFA 3OYJA 1MBHA 3E1YE 5F4OA 5ICCA 1KYZA 2K4JA 2O8XA 3NEUA 2OC6A 1YS7A 4IRGA 3Q39A 4RAYA 1F1ZA 5KAFC 2HMAA 4HV5A 4FT8A 3ABKH 5EGOB 1ZH5A 3MKYB 3T51B 4M3EA 2VKHA 3PIPF 4ZGQB 3WGHA 5DDGA 2V9PA 2H27A 2Y30A 3HRTA 4ZYDA 1MH3A 1W5SA 1YOVB 3EUAA 2STTA 4RDKA 3ASNH 2OTJI 3CCQI 2V6EA 2YWEA 5A8AA 3AVWA 4A3DJ 3LSTA 1D8TA 4E4HA 4XLAA 3KEWA 2W6IA 4IHYA 2XNJA 4P9SA 1LM1A 5LFAA 1G6NA 2E71A 2IS1A 2J8IA 2QDXA 1ETQA 2BM7A 1W0JA 3IWZA 2NS0A 2ELKA 5BQTA 2ZJPF 5TISC 1O3QA 3QFRA 2KRCA 3W6KB 1KRHA 3CQZJ 1NK2P 2VB6A 5FO1A 4PJLA 3JTHA 5A89A 2VFPA 4NDLA 4GGGA 2N8GA 5AIQA 4IXAA 4BEHB 4AIDA 2UV1A 1UMKA 4RCZA 1KYWA 2BXZA 3ZC3A 2ESHA 5HKKA 3LJYA 2EFOA 2PJRA 4AWXB 2DCEA 3A1YA 1DDIA 1KK2A 3RTRA 5DTDA 2HDNB 3GUDA 4YFOA 2K9LA 2JWTA 3KE2A 4F7ZA 2QQBA 1MNDA 4QWQA 1V3FA 1VLYA 2NNNA 3QFSA 4TMTA 2X3HA 1NHCA 3WG9A 3U2RA 2DXIA 2Z5UA 3W3CA 3IV5A 2AO9A 1FTTA 2QCOA 4JP0A 4BJ5C 4MTDA 4E7IA 4OOVA 2OTJB 1JRGA 2Z2SB 1FNNA 1W0UA 2XZPA 5FO0A 2JTVA 4OMZA 5CQEA 3OYAA 3JREA 2C78A 2NVYJ 5FKNA 4UB6C 4OIRF 1DBOA 2NTBA 2EWEA 1HOMA 1BLIA 2OBRA 1OKRA 3S16J 2Q6KA 4IZZA 1H89C 2YS9A 1SFKA 3FPPA 1YRNB 1RR8C 3ESWB 5F64A 1IV8A 1YX2A 4A0ZA 1O88A 1FX7A 4C2LA 4CGZA 4RD6A 5AMVA 2EFGA 2CUJA 4PC2A 4XM3A 4W8SA 5ED4A 1T56A 2NVUB 4Z6YA 2XAUA 1OB0A 1TYUA 3V7AA 1T8IA 4HSTA 2IBDA 3WY9A 3PQJA 2FXAA 1R5HA 1GV2A 4D5CA 2RQPA 4UUSB 3GFLA 4Z4WA 2D3NA 4P22A 1JHHA 3M7GA 4EM1A 5BPIA 3BZ6A 5EF6A 4K2EA 1WP6A 2J7KA 4UNOA 1K79A 3PNYA 3TH0A 3KZZA 4WXHA 3RDIA 3REOA 3ZMZA 2QVOA 1Y0RA 1KQ0A 4XONA 3CF5F 4DNTB 3N4MA 1A31A 3BQYA 4OINF 1IN4A 1L0OC 1XCBA 3FHZA 1HW5A 4B3GA 2VQCA 1QJVA 2XAQA 2BHYA 3OYMA 1ZELA 4OPVA 2G0EA 4PUSA 1KZLA 5EMNA 3WHBA 5IT9Z 2LR8A 1SFUA 2MD5A 5D5VB 2W85A 1HSTA 5HLIA 3FMQA 2NTQA 4KKSA 2DOGA 4OOXA 1QBJA 3H9QA 1Z6RA 4CCOA 1B6AA 1O8HA 1BIBA 3KYDB 4Q48A 4X7FA 1Q1VA 1GXQA 5LGUA 3EDPA 5DM7F 1JXSA 1XMXA 2IS4A 1WOSA 2NT6A 2IA2A 3WTYC 1PYVA 2CYYA 2VOPA 2WBMA 2XGXA 3VR6A 4W8RA 3S2WA 2KMUA 1VQ4I 3T1BA 3UR3C 3DKYA 4MYTA 2UZKA 1ETXA 3KL9A 3JQPA 2O6WA 3A2KA 2OAZA 1N78A 1VQOI 3JRDA 2DYRH 2WSSA 1KMHA 2VKEA 3FK6A 1K28D 5FL7A 2G7HA 3PO2J 2W82A 3CPXA 4XRFA 2FUG2 2XPVA 1WJBA 2Z1DA 1BQEA 1ZKGA 3B8YA 2QM3A 2JJ7A 4KMFA 1P2FA 3H36A 2R5YB 2CO5A 3SEZA 1NH3A 2XROA 3AL0C 1I1SA 1XGOA 4IRHA 1GVHA 4K1XA 1KZHA 4PJJA 1N0UA 1UD5A 2QTLA 1I18A 3WU0A 4HE6A 2VQHA 4OZYA 1RNLA 1P6RA 3A35A 4Y9UA 1JJ2B 1S7AA 1KTWA 1H9TA 3OZVA 4AU7A 2YR2A 3L2RA 1WJFA 2EH3A 4ITVA 2XV4S 4XLCA 3W2AA 1AWCA 3GVLA 2IRFG 2QSHX 1Q1HA 1P92A 3LSIA 3OS2A 3GTPJ 1TUIA 1KQ9A 3S17J 5HS7A 2Z9OA 4HEA2 1MW7A 3CJQB 1Q82D 3LMWA 3KP5A 3JRHA 1VQ4B 2VFMA 1QO0D 3IC7A 1ZARA 3T53B 2AHQA 4RGRA 5IYPA 3JQQA 1U78A 2M4KA 3E20A 2QKLB 1ON1A 1PJ5A 1FPQA 1VQOB 4PGGA 2YU9J 2FBIA 5LD2C 5D6EA 3JAMK 2UVEA 4CCLA 3WNBA 3CD6I 2TDXA 1QA3A 4UUSA 2DOAA 5B6IA 1F5TA 4B4DA 3S8PA 2HU9A 3OYFA 2X85A 2M1BA 1EA3A 2KISA 3H0GJ 3ZOBA 4D7NA 3DKWA 1KTVA 2H94A 4JMQA 4CO8A 2L01A 2ACJA 2F5EA 2BY2A 2LY2A 2P5VA 3S3MA 3IAS2 1YO5C 2EIXA 3ZR8X 4ZV4A 1BM9A 2AXLA 2E1OA 2IGOA 2C2WA 2PQ8A 1FOKA 5DS9A 3CUQB 3V4GA 3MMYB 2V1DA 3OYEA 4D5FA 1HVXA 2ZZEA 3HTUA 3SXYA 3S2DJ 2K9MA 3ECHA 3W5HA 1X58A 2R7SA 4PAAA 4TMWA 5LGTA 2WV1A 1K4ZA 4YFNF 1LFUP 3I59B 1BIAA 1IXRC 2IS6A 1TTTA 3ROUA 2LK2A 3AVVA 2JPBA 5FLXK 3E6MA 3A0BC 1J9ZA 4DZPA 4S05A 2HQNA 2IEKA 4KN7X 3CD6B 1TWFJ 1ZR2A 1B8IB 2GOMA 5LLQA 3L9FA 3FJOA 4M9ZA 3F3XA 3GEZA 4HW0A 1PJ6A 2VYQA 3BTCA 2ZCWA 2E2IJ 1K6YA 1Z6TA 1LFPA 3C18A 3SDBA 4F91B 4A3JJ 1JJ6C 1J9IA 3F8CA 4ZCLA 4M74A 4S04A 3P7NA 2ZC2A 2XRNA 4RB2C 1ZTRA 3DWLE 2KIFA 1ZUNB 4YEIA 3KP2A 2JA6J 1WJEA 1P9QC 2KKOA 4A5NA 1IG7A 3VMFA 3PUFA 2VL8A 4AYBN 1N08A 2BM0A 2YWFA 1CZFA 5HLGA 3OJXA 5DD4A 4FX0A 2XZOA 2Z16A 2COBA 5HDGA 4A12A 3TDZC 1OGIA 2OQGA 2NYXA 1WJDA 3BOQA 2Y75A 4WCGA 4G7XA 1G3YA 3LVBA 1HA3A 3BY1A 5C44J 4X0GA 3I56I 2CMPA 4DGWB 1GAQA 1QRBA 3AVYA 1N25A 3T5XA 1X1BA 1RQPA 2XEXA 3BY2A 1Y0NA 2JQ7A 1VQKI 1MJBA 3TO9A 1QZYA 2J5PA 2OUMA 2C77A 1I27A 3F22A 1CNFA 3N6ZA 1T98A 5CVRA 1DU6A 4ASNA 3FY3A 2R7ZJ 4EJTA 4KFCA 3DPLC 3DU6A 4AD9A 1FZPB 4I99C 1ERDA 3P26A 4RD2A 2X6WA 1RU4A 1X1DA 2HZDA 2D3LA 4OJPA 4BXUA 2LVSA 1VQ5B 3QQAA 1TT5B 4FN5A 3G05A 2DFEA 4OIQF 4G7OF 4HNTA 3V7SA 2Q1ZB 3FXKA 1E3OC 1XB2A 2ZMEC 1OJLA 4H4KC 4ZDOA 3R6JA 1YITI 1TL8A 3A0HC 1ZLJA 3ZUGA 3PVDA 5FFZA 3LQ6A 3LSKA 3TGNA 4C2TA 1W7PD 4XRMA 1UHMA 2MABA 4HF1A 3RPUD 1S0UA 2E7XA 1CLWA 3CRZA 2OA4A 1S7OA 2E1CA 3I56B 3I58A 1TNTA 4XOPA 3CUQA 3OPOA 2CRVA 2HOTA 4AC9A 1MMAA 3BQZA 4QHYA 1ETVA 3VYRB 2WV0A 5ICFA 3ZQQA 3I59A 4DYRA 2HKXA 4HAMA 1FOXA 2UUZA 1ZM9A 1D1BA 4KISA 2GAUA 3M1EA 2A5YB 3TKYA 1P4WA 1XS9A 2ISZA 1R1VA 1OYIA 2LOOA 1U5TC 1Q86D 1JB9A 2FF4A 2XIGA 1D8KA 3GLLA 3OZUA 2ZL7A 4F3QA 4ZCMA 4RLFA 1JA0A 1RC9A 1UG2A 2RQQA 5J40A 4E70A 4IHVA 4PFPA 1OYWA 2M3AA 1O8JA 4KITB 4OJ6A 2EIKH 1RKTA 2X8KA 4TN1A 1GVJA 5B5EC 1USTA 2IT0A 1O4XA 3JTGA 3HOXJ 2X9DA 5B3SH 4DBQA 1APLC 2HEOA 1YITB 3LA2A 2PLYA 3C2GA 3K2ZA 1I5ZA 3HOYJ 2E1MC 3GYHX 3GIRA 4XSZF 4BE2A 2CUEA 3BJOA 3HPHA 4IJAA 2V4DA 5M5XJ 4TMXA 3GQAA 1IN8A 4AIHA 3BLYA 3G71I 3ZZTA 2VUMJ 2VXZA 4XORA 3NWTA 3ZQLA 3TDUC 1QQ1A 1LDKB 4UV8A 4CYCB 4N3NA 2HDWA 3HSRA 1G8XA 3J7YJ 3OYLA 4NK6A 2DLLA 5IP7J 3EQNA 1ZG5A 2HVRA 3M3YJ 3FXUA 1U0JA 3KP7A 3OJWA 1H80A 4MQVA 1ZLKA 3WTZA 4MGRA 1F9NA 4W1UA 2LH9A 2F1LA 1OCRH 2DA1A 3IAM2 3PM1A 4A3CJ 1KU7A 3I4PA 2IP2A 1WU8A 2EV5A 1LQ1A 4A3EJ 1KK3A 2QQ9A 1FSHA 2F1MA 5LEKA 3WGGA 3AVXA 2K9QA 3PETA 3FXMA 3J7AY 2DEUA 4LITA 1ELOA 3CC7I 2JN9A 1FBSA 1T38A 3U2QA 3CDHA 3ZPNA 4NB5A 2IA1A 2EZLA 2M2EA 4BQAA 2NVQJ 1BJAA 3LQEA 4NC8A 2L5QA 3AG1H 1LLZA 2VPRA 3HRMA 4F52A 3G71B 2XTXA 5E20A 4X07A 3PUBA 4UZFA 3QYEA 3B6CA 1PJRA 4I09A 1QFZA 2Y2ZA 3NQOA 2E60A 1S8NA 2EZHA 3KLNA 1ZM2A 1VFCA 2OYNA 2JUGA 3I5UA 4XN0A 2VT2A 4DBRA 2CV0A 1YLFA 2GQQA 5K5RA 2PFBA 5IYDJ 2QZAA 5KNLA 3KEQA 5CLSA 3RSNA 5FLVA 5E3MA 3ZGKA 5FD5A 2DYSH 1O8DA 2LKSA 3LNNA 5L3FA 3OWTA 1ZRFA 1W0KA 3QRFF 1TQMA 4LMYA 1K4TA 2R7QA 4IEJA 3VYUB 5FKLA 1HW1A 3MKZA 2RGVA 4CXFA 4IW3B 4BXXJ 3VOEA 4JBAA 2VJIA 3OKXA 2XC1A 1W7PA 1B2RA 1Z91A 2HQ5A 3RPUA 4BPRA 4GDFA 1Y1WJ 1BOAA 4PC1A 2ZKZA 2X3UA 1WWXA 2NTPA 3VSTA 1IB0A 2IAIA 3W5VA 5H6RA 5EZHA 3QFTA 1PUFB 1KU2A 2TCTA 3Q3AA 1KD1D 3WQZA 1B4AA 4KN4X 2BBYA 2ECCA 3SHFA 2P7CB 3JX8A 1R1UA 4LBYA 3Q6RA 4M3FA 1K9MD 2Z8GA 3OE7A 2BGCA 2MH2A 3S3OA 4ZDLA 4BHCA 2FBKA 5LHHA 4LLLA 2HFHA 2XZLA 2I10A 2L4MA 1ZN2A 1Y1VJ 3HC7A 3QPSA 3H3VK 4Z1MA 3OYHA 4V19K 2HYFA 4CYCA 1W36C 1O8FA 3BC9A 3DLLF 1Q7YD 4N9IA 1MSFC 2ESNA 4I0BA 3HRSA 4IF4A 2V7UA 2ZBKA 2ZZFA 1LNWA 1S5LC 5HNFA 1RI7A 5K7HA 1XQBA 3JQRA 2GWRA 3Q0UA 4E7JA 2K3FA 1M90D 3CCRB 5J47A 1T39A 4MFEA 1J5YA 4C2MJ 1JKRC 2NSTA 2QX3A 5CVUA 5C1EA 2P0WA 3EQOA 2QKMB 4A6DA 1IXSB 3W2EA 2ZL6A 2HDCA 2A69F 3C2HA 2B0RA 3RKQA 2YWGA 2IGNA 5IY5H 2RKHA 3F8MA 4WWVA 1NB9A 1YE9A 2H6BA 1U5TB 4MQ9F 4XK4A 5D4SA 1Z77A 5K5QA 1C0WA 4LBWA 3TW7A 2HOEA 3GTLJ 4LBVA 4I01A 1KCDA 5FO5A 3CC4I 3Q5FA 1QQIA 1JE8A 1BPLA 2ZSIB 1CGPA 3E5XA 3L7WA 3SJPA 2ICWG 3W5UA 2OBSA 4P55A 2HYGD 1B23P 4OAYA 3H5RA 2DOFA 4I0AA 3BCFA 2AQEA 3ABTA 5J1UA 4P1WA 4D1QA 2R7WA 1E3XA 3PUMA 5D6FA 1HW2A 2A6TA 3OS0A 1QG0A 1T08B 1IRXA 3E3VA 2GLOA 1U9OA 1FY7A 2WJVA 3BR0A 3M07A 1HLVA 5JVTA 2XHKA 3G1LA 3LOCA 4H0EA 2A05A 1ZQ3P 3C1DA 3SFIA 2VNKA 2IQ7A 2Q2EB 2XT2A 4MEXF 1UCRA 2RC4A 2DETA 4II3A 2K27A 2NOJB 1XTAA 2R4GA 3CLQA 2K5CA 3G3ZA 4S0HB 1EFCA 5ICEA 2XT4A 3K9TA 1SVOA 1JKQC 2GA2A 2LY1A 2R93J 1LDDA 2M5SA 1HF2A 1QVUA 4OPWA 3SYJA 3HIFA 3CJTB 4M73A 1Z3XA 2EA4A 1FRQA 2PMDA 3CC4B 3S2HJ 4EW9A 3WU1B 1PUFA 3F6VA 5LHIA 4P2NA 3UNGC 4RD4A 3SEQA 1WH7A 3KRGA 3I3LA 5DS0A 1E3PA 3RQIA 3IP4B 2GOXB 3FMRA 1SFEA 2OV7A 3I0TA 3A8JA 1Z21A 3VNVA 2L7MP 3R0AA 3BH6B 2DFFA 5GAEJ 1RPWA 4UVAA
chains in the Genus database with same CATH topology
2XF6A 3GBGA 4BQOA 4IX7A 2Z2SB 4E7IA 2WA0A 2R7VA 2XOKA 2XZPA 5CQGA 1WJAA 1OFLA 5CQEA 2PMZA 3OYAA 2JJ1A 1OOCA 2O1DA 2F4IA 2WPDA 1DBOA 2NTBA 5CPRB 1D0ZA 1V5GA 2EWEA 1BLIA 1GLNA 1WJCA 4IZZA 4CH7A 2JDIA 4U7BA 1SFKA 4BS9A 3FPPA 2KLOA 2V4JC 3GVJA 3DTKA 1OGOX 2GJKA 2X53S 1O88A 3OIQA 4RLQA 5AMVA 4C2LA 2CUJA 4XM3A 4W8SA 1OB0A 2VJ4A 2XAUA 3K4CA 3OFNA 1AA7A 4HSTA 1E3ZA 1WFXA 4E7HA 2IXSA 3OYGA 2D3NA 2F43A 3D5RC 4XKVA 3JU4A 4P22A 2Z6BD 4Y3OA 2ZXIA 2QY1A 1GQ8A 3CP2A 1WP6A 3VMWA 3PNYA 3OW7A 2CV2A 2DT7B 4E0FA 3CESA 4RM2A 2VBMA 4XONA 4DNTB 3DDYA 4CA0A 4B3GA 1QJVA 2VQCA 4XNFA 5FRNA 1PXZA 3PSIA 3OYMA 1ZELA 4Z03A 4CSWA 1Z7LA 3HXLA 4PUSA 4BDZA 1KZLA 1UELB 3S3NA 5JHFA 2F6CA 2V31A 4HG2A 2DIEA 2NTQA 4KKSA 2CW8A 2LG4A 2V7QA 3H9QA 4YELA 4CCOA 2ZZQA 2BSPA 1O8HA 3ZPPA 3BC8A 3A3GA 4F93B 1NBMA 4DNRB 2M4GA 2ODLA 1MMNA 2O04A 5FRMA 2IS4A 4URRA 2NT6A 3SUCA 4ZTFA 2R7UA 3DEEA 1VBLA 1UD2A 1PYVA 2WBMA 4CCNA 2DJIA 3OS1A 3VR6A 4W8RA 2KMUA 3UR3C 3DKYA 4XN3A 4YEJA 1DBGA 2F5VA 3A2KA 5HVQC 1N78A 1DP3A 2WSSA 4CZCA 4UZUA 1KMHA 1K28D 1NG7A 5FL7A 2W82A 3PL8A 2IGKA 2FUG2 2Z1DA 1WJBA 1V0EA 3OOCA 3B8YA 3OOUA 3VSVA 4TKOB 3OL4A 3GQBA 2VKDA 3SEZA 3AL0C 3AL0B 4PJJA 1UD5A 3HUGB 1I18A 2VJ5A 2VQHA 4OZYA 1X4OA 2AQFA 3A35A 3LSMA 3BH4A 2BVMA 1KTWA 1D1AA 4AU7A 4AYBA 3F9KA 4ZDPA 1WJFA 3L2RA 4ITVA 4XLCA 3W2AA 2NT9A 3GVLA 3LMMA 2INVA 3LSIA 3OS2A 4BJTA 3H9GA 1BHEA 4XLFA 4AVZA 2K3PA 4E7LA 3ZRGA 4XKCA 1QCXA 4HEA2 1MW7A 3CJQB 4B43A 4PFOA 4XLHA 1WJ5A 3OYBA 2XSJC 3L2UA 3LMWA 1IA5A 1NG6A 3T53B 2HVQA 1T95A 1V5FA 2CK3A 2WY7Q 3L2VA 4G6TB 3U21A 2M4KA 1T5EA 2QKLB 3ONQA 2MC4A 5LD2C 4D9JA 1OGMX 3GQ7A 4CCLA 3K4JA 3PFYA 4LIUA 3K4KA 4N4OB 2DOAA 3HAGA 1HG8A 3CMMA 4XR6A 3S8PA 3ZCOA 2HU9A 3OYFA 2W4SA 2X85A 4KJZA 1O8IA 1FMVA 3AKZA 1IDJA 1EA3A 4W8QA 1BR4A 3ZSCA 2KZVA 4JMQA 3OYIA 1OR7C 3M1CA 4HPQA 2LY2A 3S3MA 3IAS2 3L2QA 3ZR8X 3W2WA 2IGOA 2UVFA 2QXZA 4NC7A 2M0MA 2CFOA 3FKJA 3OEEA 3MMYB 5KCMA 3OYEA 1X19A 4XKBA 1HVXA 3K10A 2ZZEA 2K9MA 2R7SA 1FMWA 4BQNA 2IS6A 4CCKA 2KHMA 4BE0A 4PJNA 4BGDA 3D5LA 4N4NB 4FETA 4U87A 5TGTA 4BL0B 2ZSHB 4XL9A 4G7WA 4I84A 3VSUA 1UD3A 2M7BA 2X51A 3BG6A 1MABA 4IKFA 1JRGA 2WAEA 2GOMA 2ELJA 3W2VA 1PKVA 2W6JA 2VQGA 4ZYAA 1K6YA 1LFPA 3SDBA 4F91B 4P5OA 2LBFB 2VPLA 2W1OA 4RMNA 4G6IA 2GK7A 3OYDA 3VYTB 4QPOA 3EUHC 3FDYA 4BE1A 3KX2A 2L9SA 3DWLE 3OYNA 2UWMA 4E7ZA 2ZFUA 1UAAA 3SZGA 2O17A 1WJEA 1P9QC 2CV1A 4OJOA 4U49A 2KDOA 1YX3A 2VL8A 1CZFA 1X0CA 3CP8A 2CW7A 1S9HA 2A5WA 2VBKA 4JOMA 3RQ4A 3PNTA 2Z16A 2XZOA 1TZLA 2UVEA 4GQNA 3HPGA 1WJDA 4HWVA 2CUZA 2VJJA 3H5NA 4YRVA 4G7XA 2O0VA 2LC2A 4X0GA 2CMPA 4HSRA 4DGWB 4J00A 1N77A 1X1BA 2INUA 1SAUA 1OFMA 3OR1C 2PECA 3K4BA 1KCCA 4DK1A 1X1CA 2OUMA 5HOOA 3DU5A 4L8JA 2V7FA 3FY3A 1LVKA 3DPLC 2XF5A 3DU6A 1QU3A 4OZZA 1ERDA 1RU4A 2X6WA 1X1DA 2JA2A 3FHNA 2HZDA 2WAQA 2D3LA 4OJPA 2HNHA 5CKTA 2HQAA 2X1EA 5CDFA 1O8GA 4YZXA 3G05A 2O0WA 4HNTA 2Q1ZB 1Z3YA 4XQFA 1JTAA 2LREA 1D1CA 3QODA 4H4KC 4ZDOA 3EPZA 4TT3A 4GRIA 3DQVC 4C9YA 2E5NA 3DTIA 3LSKA 1BN8A 3IUOA 4C2TA 4MXNA 2MABA 3RPUD 4JQFA 1JI8A 2VLAA 2R7RA 5C1CA 2HVSA 3K4MA 2W7NA 4QPQA 4XOPA 3H5AA 3OPOA 4FASD 1YX5A 3FBNB 1HA8A 2VBEA 1KONA 1MMAA 1T0FC 3QYBA 3VYRB 3JURA 1N75A 3FBIB 3ZQQA 2MD0A 2I8DA 2UUZA 3LL7A 1D1BA 4KISA 3TL4X 4PMHA 1UD4A 3DPUA 1V5EA 4HRIA 2KL4A 3N05A 2LOOA 2Y0SA 1E43A 3VMVA 1IDKA 3GQ9A 4F3QA 3HKZA 1UD6A 4RLFA 3OY9A 4KKTA 2RQQA 1VF7A 3OYKA 3I9V2 2XF7A 4PFPA 2M3AA 1O8JA 2M7AA 1R6RA 4KITB 4KKUA 4OJ6A 2X8KA 3GQ8A 4B47A 1AIRA 4DBQA 4ANJA 3HL2A 2LYCA 3C2GA 4DK0A 1PE9A 2LBFA 4IQ4A 2E1MC 2CS3A 2E1MB 3OIPA 4II2A 1BOBA 4BE2A 2L2OA 4F92B 3HPHA 2V4DA 1IB4A 4C30A 3T56B 3GQAA 1E79A 1D0YA 3BLYA 2VXZA 2WB1A 3NWTA 4XORA 3NE5B 2R7OA 1LDKB 3VYSB 5DN6A 2HDWA 2BVLA 1G8XA 3OYLA 3MKWB 2WZPP 2NSPA 4NK6A 3EQNA 3DKXA 3HOTA 3H9JA 1E0EA 2HVRA 4DJAA 1MMDA 1U0JA 5FROA 3VSKA 4ZJZA 2JSPA 2HPMA 1UG0A 1H80A 1SKYB 1BMFA 2LH9A 4KT6A 3IAM2 4B44A 1OHHA 1XG2A 3T9GA 3TBIA 3S93A 5HLTA 2R7TA 2KRHA 2F1MA 2NZMA 1G59A 3K70D 2V9KA 3J7AY 1NRKA 1WMRA 3E1SA 3HG9A 4LITA 4BDYA 1E1RA 3A3BA 3ZXSA 3VWBA 3ZPNA 3DPTA 3MD2A 2WY8Q 2XC7A 1LKXA 4OWRB 3KYLA 1O8MA 1Y6IA 4NC8A 3LSGA 2L5QA 3QYFA 3GRHA 5IK2A 4BXFA 2DT6A 3EUKL 4F52A 3V42A 1TT0A 1W9XA 2CH0A 3PUBA 1DGWY 3QYEA 1HZEA 1PJRA 3B90A 2E5ZA 1J09A 3H35A 2E60A 3B4NA 2L7KA 2MYSA 4NUBA 4C2UA 2JUGA 4HNUA 4XN0A 4DBRA 1I8DA 2CV0A 3BCAA 3K70C 2RNGA 5KNLA 3RSNA 1RWRA 1OLTA 3ZGKA 4BU2A 2JJ2A 2BW3B 2KP6A 4CCJA 3G2BA 3OWTA 3LNNA 1W0KA 3OAAA 4Y33A 4XOTA 2W00A 4Y4RA 4HIZA 4CCMA 4YXWA 3OL3A 4IQJA 4OJ5A 4YZQA 2R7QA 4XMYA 3VYUB 4E7SA 4NQWB 4BACA 2GJRA 3MKZA 3BCBA 3RCOA 3LSHA 4R79A 3CZ6A 3OR2C 4CUGA 4NK8A 2VJIA 2KPMA 1EFRA 2WAFA 4W8TA 2VQLA 3D5SC 4DOZA 2V26A 1D0XA 3VSTA 2NTPA 1W36D 1K5CA 3CF2A 3NWSA 2VIXA 1H8EA 3SYTA 3BCDA 1PLUA 3K6GA 2O5RA 1MNEA 3WQZA 1RMGA 4PJMA 1DQUA 2PJRB 4Z05A 2V1NA 1FX0A 4ASUA 3UW0A 3VSLA 2L9NA 3OE7A 2Z8GA 2GJPA 5HNHA 4J01A 3S3OA 2R7XA 4ZDLA 4E7KA 4Z06A 3K4NA 1V0FA 2XZLA 2PYHA 2X1DA 3HC7A 2KVOA 1MMGA 4PSWA 4Z1MA 4TSFA 1QHGA 3OYHA 3K4LA 3M8JA 2ZZGA 3ZIAA 1W36C 1O8FA 3BC9A 1O8EA 4PSXA 3PNVA 2ZZFA 1O8DA 2PYGA 5HNFA 4B3FX 2KQRA 4E7JA 2WADA 4B48A 1EE6A 4B3XA 3L2WA 1BR2A 3HOSA 2JVHA 2QE7A 1O8KA 1Y56A 1X4PA 2VASA 2P0WA 4BEHA 2QKMB 2NSTA 2QX3A 3EQOA 3PSFA 5C1EA 1WTHD 2IGMA 1O8LA 2JIZA 3C2HA 2XGJA 2IGNA 3S32A 1VZ0A 3WWGA 1YE9A 2X6XA 3A4CA 3OYCA 3TMOA 4BQQA 4U4BA 4YZ0A 4XLEA 4DIQA 3DTEA 2XNDA 2ZTNA 2R9VA 1QHHD 2XDVA 1KCDA 2VXDA 4PK4A 4BUPA 4MLOA 3AFHA 4RM3A 3PJRA 1BPLA 2ZSIB 3LFUA 1X1AA 3OYJA 2HLDA 3H94A 3H0DA 1COWA 2ZXHA 4XD7A 2OC6A 4OAYA 3H5RA 3BCFA 2AQEA 4XKWA 4P1WA 3T51B 4D1QA 3MKYB 2R7WA 3FKSA 3QOEA 2VKHA 4OJLA 1E3XA 3VDXA 1UD8A 2A6TA 3OS0A 3DLAA 3EUAA 1H8HA 1IRXA 4FXUA 3OMYA 4BJ6C 2RREA 4MR0A 4LG3A 2V6EA 1BR1A 2BW3A 2E1BA 2WJVA 2WJYA 4E4HA 4XLAA 1WPCA 2W6IA 3KEWA 2IQ7A 2Q2EB 2X1CA 2X6YA 2NOJB 4II3A 5LFAA 2IS1A 1E1QA 2LZJA 2BOLA 2R4GA 2K5CA 2MFZA 1W0JA 3CJRB 4E6KG 4ZTJA 2KRCA 2LY1A 1DGRM 2VB6A 4PJLA 3KEYA 4F55A 2GK6A 2M5SA 1Z3XA 4BEHB 5HKKA 2UV1A 4EW9A 2LRDA 3GVKA 3E0JB 4ZC3A 3BG7A 4LIVA 2IS2A 2PJRA 3UNGC 3SEQA 3KRGA 2ZTGA 2DCEA 3A1YA 3I3LA 2HPIA 3RTRA 4NNJA 1VJSA 3IP4B 2K9LA 2GOXB 3OEHA 2OV7A 2JVGA 1VLYA 1MNDA 2X3HA 1NHCA 4OAZA 4EATA 1Z21A 5KHDA 2DXIA 3W3CA 4YZAA 4BJ5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRG A;  5C1C A;  3VST A;  2NTP A;  1K5C A;  4XOP A;  1OFL A;  1OGM X;  3GQ7 A;  2O1D A;  1OOC A;  2VBE A;  1PLU A;  1DBO A;  2NTB A;  1HG8 A;  4XR6 A;  1RMG A;  2EWE A;  3JUR A;  2X85 A;  4Z05 A;  3UW0 A;  1O8I A;  1IDJ A;  2Z8G A;  4W8Q A;  4PMH A;  3ZSC A;  4Z06 A;  3VMV A;  1IDK A;  1OGO X;  3GQ9 A;  2PYH A;  1O88 A;  4C2L A;  5AMV A;  4XM3 A;  2QXZ A;  2UVF A;  4W8S A;  1O8J A;  4OJ6 A;  1O8F A;  1O8E A;  3GQ8 A;  1AIR A;  1O8D A;  2PYG A;  4XKV A;  1PE9 A;  1EE6 A;  1GQ8 A;  2QY1 A;  3VMW A;  1O8K A;  2NST A;  2QX3 A;  2VBM A;  4XON A;  3EQO A;  5C1E A;  3GQA A;  1IB4 A;  3VSU A;  4XL9 A;  4I84 A;  1O8L A;  1QJV A;  4XNF A;  1PXZ A;  4XOR A;  4Z03 A;  3WWG A;  4U4B A;  2X6X A;  4YZ0 A;  4XLE A;  2NSP A;  4NK6 A;  3EQN A;  2NTQ A;  1KCD A;  4YEL A;  2BSP A;  1H80 A;  1O8H A;  3ZPP A;  2ODL A;  2O04 A;  4URR A;  2O17 A;  2NT6 A;  3SUC A;  4OJO A;  4U49 A;  4XKW A;  1XG2 A;  3T9G A;  1VBL A;  1X0C A;  1CZF A;  4OJL A;  2NZM A;  2VBK A;  4W8R A;  2UVE A;  1WMR A;  4XN3 A;  4HWV A;  2VJJ A;  4YEJ A;  1DBG A;  2O0V A;  4MR0 A;  4XLA A;  1O8M A;  2IQ7 A;  2INU A;  1OFM A;  2X6Y A;  3GRH A;  2PEC A;  3B8Y A;  1KCC A;  3VSV A;  3B90 A;  3B4N A;  3FY3 A;  4OZY A;  4XN0 A;  4OZZ A;  1KTW A;  1RU4 A;  2X6W A;  4EW9 A;  2NT9 A;  4YZX A;  4XLC A;  1RWR A;  4OJP A;  1O8G A;  2O0W A;  2INV A;  4XQF A;  1JTA A;  3KRG A;  4XOT A;  1BHE A;  4YZQ A;  4OJ5 A;  4XLF A;  4AVZ A;  1QCX A;  4XMY A;  1BN8 A;  4XLH A;  2X3H A;  3LMW A;  4NK8 A;  1NHC A;  2VJI A;  4MXN A;  1IA5 A;  4W8T A;  4YZA A; 
#chains in the Genus database with same CATH topology
 1O7L A;  2HCJ B;  3GBG A;  3K69 A;  3KCC A;  1DDN A;  2WA0 A;  2R7V A;  1EZG A;  3BH7 B;  5CQG A;  1WJA A;  2R7F A;  2XPW A;  1R71 A;  1FND A;  1MH4 A;  1XX5 A;  2F4I A;  2Q6I A;  3IWF A;  3QWL A;  4WXC A;  3RIR A;  2H8R A;  4KT5 C;  1FT9 A;  1GLN A;  2MLG A;  2D1V A;  1SFO J;  3I64 A;  4RM0 A;  2JDI A;  4U7B A;  1S4M A;  2L9V A;  3V76 A;  4RAZ A;  3DTK A;  3KZY A;  2C4T A;  3U6B A;  1OGO X;  2DO7 A;  4ZZL A;  3A1P A;  2BZT A;  5LRR A;  3ZMD A;  3NAW A;  2P81 A;  1CQT A;  1G7R A;  4FE7 A;  1OCP A;  4HQE A;  3PSS A;  2EZI A;  3WBJ A;  1G3S A;  3K4C A;  5L3D A;  1QUE A;  2HOS A;  4KIF A;  4DYQ A;  4QV2 A;  2LFB A;  2NXN B;  3PO3 J;  3QP5 A;  3W6V A;  1E3Z A;  5BSY A;  4E7H A;  4UUT A;  3ZMV A;  3JU4 A;  3BY6 A;  1XB4 A;  1A8P A;  5L46 A;  4X6A J;  1GQ8 A;  3RJP A;  1BN5 A;  3LSJ A;  2PMH A;  3P9C A;  2VC1 A;  3OW7 A;  2W25 A;  2VBZ A;  3KP6 A;  4EJU A;  4Y13 A;  3LO8 A;  1K83 J;  2JZY A;  1IAW A;  2EA2 A;  5JI6 A;  1N07 A;  3A8I A;  1PXZ A;  1IZ1 A;  2EFW A;  3NAR A;  4CSW A;  1Z7L A;  3HXL A;  2P5L C;  4BDZ A;  3I4N J;  5HZB A;  1UEL B;  1R9T J;  1FSE A;  3W2G A;  3QPT A;  2F6C A;  3CME I;  4EGY A;  2DIE A;  2V31 A;  5IYW A;  2V7Q A;  2L02 A;  3ZMT A;  1K7A A;  5HS8 A;  3GZ5 A;  4G6Q A;  3BC8 A;  2DA4 A;  1NBM A;  4DNR B;  4ENK A;  2FX3 A;  5DV5 A;  1HDP A;  1OIS A;  2X48 A;  1K4S A;  2ODL A;  3MMP A;  1MMN A;  2B7E A;  2PBI A;  1KC8 D;  4BYY A;  4ZTF A;  4PZJ A;  2P4W A;  3ZQI A;  2IOU G;  4HZF A;  1YW8 A;  4CCN A;  1SEU A;  3SJM A;  2GPJ A;  1V4R A;  4BY7 J;  1S3J A;  4XN3 A;  1O3R A;  1G2H A;  5E17 F;  2VBU A;  4YEJ A;  2L7F P;  4Q5S F;  2W7Z A;  1XD7 A;  1VND A;  2FBH A;  4M72 A;  5HVQ C;  4HA8 A;  3F23 A;  1ZM4 A;  4G6D A;  5FIU A;  1MZB A;  1DP7 P;  1FDR A;  2CGP A;  2HDD A;  4IHS A;  3DU1 X;  1TYW A;  2VKD A;  3M4O J;  2EIN H;  2E1N A;  1NB0 A;  4DZJ A;  3HUG B;  3LQQ A;  2DYI A;  2PMZ N;  2CU7 A;  5EEA A;  2OBT A;  2G9W A;  1MIJ A;  3CME B;  4A3M J;  1TWC J;  2BVM A;  1ZG1 A;  2HWV A;  4L9T A;  3F9K A;  4ZDP A;  2NT9 A;  1NK3 P;  5FKM A;  1FLI A;  3LMM A;  4ABZ A;  1LPQ A;  3BR5 A;  3SDG A;  3VFZ A;  4Z4V A;  3CCL I;  2INV A;  3GTM J;  3BR3 A;  1BHE A;  3H9G A;  3ZRG A;  2KIM A;  3DBL B;  2F4N A;  1FP2 A;  5JLW A;  2CQX A;  4B43 A;  2XSJ C;  1Z0X A;  1IA5 A;  4PC6 A;  1XE1 A;  4A0X A;  1WHU A;  1V5F A;  2CK3 A;  3L2V A;  1T5E A;  1LLW A;  2K02 A;  2ISY A;  3ONQ A;  2QQA A;  3WTU C;  3PFY A;  3U1K A;  1HG8 A;  2R5Z A;  3BJA A;  4RA2 A;  4GFB A;  4JRA C;  5GP9 A;  5K5O A;  3ZBT A;  3SJZ A;  2KZG A;  3KEO A;  3AKZ A;  1IDJ A;  1UB9 A;  2ELH A;  1BJZ A;  2HTJ A;  5D5W B;  4CHU A;  1K78 B;  3LFK A;  2DQL A;  2PEX A;  3BWG A;  5GPC A;  1QA1 A;  3ECO A;  2BV3 A;  1BW5 A;  2M0M A;  3FKJ A;  1F36 A;  3CUQ C;  3CCL B;  1ETO A;  4LC0 A;  5KCM A;  1X19 A;  3JAM Z;  2BY0 A;  2D2W A;  3CCQ B;  2ZO4 A;  2MG4 A;  4FQG A;  4V2G A;  1O7F A;  1XSV A;  3CTA A;  5JVG F;  2V5I A;  5EDN A;  4G7H F;  1WPK A;  3E7L A;  4U87 A;  5TGT A;  1I7P A;  4FHT A;  3K2A A;  2B5O A;  4G1V A;  2M7B A;  1MAB A;  3AVU A;  1JUS A;  4BBR J;  2WAE A;  2JT1 A;  3LAJ A;  1GT0 C;  3TP0 A;  1Z7U A;  2OPT A;  4MEY F;  3VEP A;  2H6C A;  2VZL A;  2VQG A;  1HBX G;  5IP6 A;  1MJA A;  2HXO A;  1QNT A;  4AVP A;  4M3D A;  1W87 A;  3O6B B;  1BI0 A;  2W1O A;  2LBF B;  4R1H A;  3VYT B;  3OSF A;  2QTZ A;  2LKP A;  4BE1 A;  4XRS G;  1TC3 C;  5ILU A;  1BI1 A;  1QGP A;  2ZFU A;  3IKV A;  3MZY A;  5FLX Z;  3HEF A;  2CV1 A;  1W2B B;  4OJO A;  2CQK A;  4U49 A;  3HUG A;  3RYR A;  1BX0 A;  4NBS A;  2TRT A;  3J7A O;  1GV5 A;  2CW7 A;  1W35 A;  4GYG A;  4MFD A;  3HPG A;  2L3D A;  1M1E B;  3H5N A;  2WWY A;  1LJ9 A;  2O0V A;  3GTG J;  2UXX A;  1TP4 A;  5FFX A;  4RDJ A;  1X2M A;  4UB8 C;  1WH5 A;  4J00 A;  3BTL A;  4AIJ A;  1R5B A;  2DDB A;  2INU A;  4Q4Z F;  4OMY A;  5LHG A;  1X1P A;  1EFT A;  1XMK A;  3OIO A;  2PEC A;  2WZN A;  2A3S A;  5M3M J;  3K4B A;  1KCC A;  4DK1 A;  1X1C A;  2FA5 A;  4XID A;  4M4S A;  4XIC A;  1R5N A;  3DU5 A;  1FYK A;  2OQR A;  3LA7 A;  4H9G A;  2E1R A;  3IHU A;  3AG4 H;  4OZZ A;  4J0Q A;  1TLH B;  2FML A;  3FHN A;  1VQM I;  4XLN F;  5CDF A;  3CDI A;  4X05 A;  3WE2 A;  2FNA A;  4RS8 A;  2ZJ2 A;  4MTE A;  2LRE A;  3CCY A;  3QOD A;  2BMW A;  1QPI A;  1PP8 F;  1XG1 A;  4TT3 A;  2GIZ A;  3AK5 A;  2LDU A;  4Q7J B;  1WXR A;  2E5N A;  2CRG A;  5FB2 A;  1K78 A;  2CW5 A;  3IUO A;  5DYM A;  2VE9 A;  2NVT J;  2DMN A;  4KA4 A;  1VHE A;  3OSG A;  2M9H A;  3CCJ I;  1WCM J;  2VLA A;  2W7N A;  2FNP A;  2OD5 A;  1W34 A;  4Z4R A;  2E35 A;  3BTJ A;  3QP6 A;  4GYI A;  4YC5 A;  3JUR A;  1YIO A;  3FBI B;  3DF8 A;  1D5Y A;  2BYV E;  1XC5 A;  2DI3 A;  5AN9 A;  3HRU A;  3ASP A;  1IJE A;  4PMH A;  4G7Z F;  2VKV A;  2BV6 A;  3O8H A;  1V5E A;  3N05 A;  1E43 A;  4I6Z A;  3VMV A;  2LF8 A;  2W84 A;  3HKZ A;  1AIP A;  3G6E I;  1UD6 A;  4M1K A;  5TY0 A;  1VQM B;  1I6H J;  4G6I A;  1PVE A;  3OYK A;  2GXA A;  3I9V 2;  2QF7 A;  5F1R A;  2GZW A;  4EQQ A;  1TW3 A;  3BR6 A;  4PJ0 C;  2LF7 A;  4LGW A;  3GQ8 A;  2KIU A;  3JSP A;  1AIR A;  1U6G A;  5EEG A;  4ANJ A;  2IVM A;  2LYC A;  1E63 A;  4DK0 A;  2LBF A;  2OU2 A;  4IQ4 A;  4G1B A;  3T8T A;  1FEX A;  1R7J A;  2CS3 A;  3OIP A;  4Z4Y A;  2BN4 A;  1BOB A;  1QRY A;  4F92 B;  2QLZ A;  3CCJ B;  1IB4 A;  5HZA A;  3JR9 A;  1FYM A;  2M8G X;  1GJR A;  2YWH A;  2MC3 A;  5DUI A;  3HGG A;  3IL2 A;  1IXC A;  1YFH A;  1E2X A;  2NSP A;  3KLO A;  3FIW A;  5LEJ A;  2Q6O A;  4NQW A;  1OB2 A;  3PA2 A;  4DJA A;  2HPM A;  5FRO A;  4MHG A;  2BGI A;  1QVG B;  1SKY B;  4YIR X;  5IYN A;  3WOD F;  4KT6 A;  1IRG A;  3RZO J;  2DK8 A;  4R8H A;  3S1R J;  3HZJ A;  2A6H F;  4B44 A;  1SAN A;  1K61 A;  1KQ8 A;  2XTW A;  4UZE A;  3T9G A;  2O61 A;  3S93 A;  2WAQ N;  1KGS A;  5D4R A;  2DA3 A;  3MCA A;  3HTS B;  3G1M A;  2FOW A;  3K70 D;  2V9K A;  1LEA A;  3E1S A;  3HG9 A;  1IHM A;  4L0Y B;  1Y8R B;  1E1R A;  3GXO A;  4P3I A;  4ZGN B;  3ZXS A;  5F04 A;  5DEQ A;  2P6S A;  3DPT A;  2D45 A;  1JT0 A;  3S15 J;  2WY8 Q;  1O8M A;  2A68 F;  3M8F A;  5LMZ A;  4U0Y A;  5IK2 A;  3GRH A;  1E64 A;  4BXF A;  1VF9 A;  2QEN A;  1V5V A;  4EJW A;  1DGW Y;  4M9S A;  5JFR A;  2V1U A;  3V8L A;  3ZQC A;  1J09 A;  4ZYE A;  3H35 A;  9ANT A;  1GHC A;  3B4N A;  4XRS A;  4IO9 F;  4O6J A;  3ASR A;  5TR9 A;  3W2H A;  4C2U A;  2KIQ A;  2COM A;  4YAU A;  2Q8K A;  1OGJ A;  2FSW A;  3CCE I;  2Y31 A;  2CQN A;  5DCF A;  4RBO A;  1CNE A;  4U9U A;  1MDM B;  1XDS A;  1BW6 A;  2JA5 J;  1T0F A;  2BW3 B;  1G4D A;  2DER A;  3G2B A;  4Y33 A;  4RJL A;  3FIS A;  5CJ9 A;  2OTL I;  2Y0S N;  4Y4R A;  1G7T A;  4CCM A;  4HIZ A;  3E6B A;  4AUX A;  4PC7 A;  4ESB A;  4XMY A;  4BAC A;  4YXW A;  4OJ5 A;  2ZFW A;  4A69 C;  2FU4 A;  3BCB A;  4IOC F;  3SLN A;  2EV6 A;  3OR2 C;  4Y9R A;  3B78 A;  2WAF A;  3HOZ J;  4QUZ A;  3H1C A;  3O8G A;  4DOZ A;  1G7C A;  4P3Y A;  1D0X A;  1QGZ A;  3PEN A;  5LRS A;  4IOA F;  1A6I A;  3NWS A;  3BG9 A;  5DCM A;  1H8E A;  3GFI A;  3BCD A;  5CVV A;  2O5R A;  4EMS A;  1RMG A;  1DQU A;  5E1X A;  1QX4 A;  5B1B H;  4BHP A;  1OCT C;  3ERM A;  4U0V A;  1J75 A;  2L9N A;  1FX0 A;  2IJL A;  1S6L A;  3ZQG A;  5HNH A;  5HDK A;  3MHP A;  4Z06 A;  3GCM A;  5FKO A;  3MN2 A;  1V0F A;  1JUM A;  4OIP F;  2STW A;  4L9N A;  2L54 A;  4O5V A;  3BTI A;  1QHG A;  3GME A;  4KIG A;  3AGP A;  5E1Z B;  4TSF A;  1JTY A;  2ZZG A;  3PUN A;  4Y7C A;  2VFQ A;  4PSX A;  3NB2 A;  2LTP A;  2OTL B;  5FJ8 J;  2IA0 A;  2XGC A;  4LBZ A;  4IHT A;  2XSD C;  1WDT A;  3J7Z I;  4B48 A;  2LD5 A;  1YTY A;  1EE6 A;  2DBB A;  2XRL A;  4B3X A;  2EBI A;  3L2W A;  5TRD A;  3GTQ J;  1VQK B;  1O8K A;  1X4P A;  2VAS A;  1OFD A;  2WC2 A;  3GO5 A;  1WTH D;  4YCQ A;  2JIZ A;  2P7V B;  4P26 A;  1T6Z A;  2VI6 A;  2ZJR F;  1QUF A;  3P9I A;  3A4C A;  2X6X A;  3GTO J;  5KW9 A;  4BQQ A;  4I02 A;  4XLE A;  1W7P B;  1FBU A;  2YUS A;  2ZTN A;  3AGQ A;  5J6X A;  1QHH D;  2XDV A;  4RCY A;  4W97 A;  3S14 J;  1OCO H;  4G12 A;  3S1M J;  1SMT A;  4PK4 A;  3PJR A;  3AFH A;  4EJV A;  1HSJ A;  3H94 A;  1X1A A;  1DDG A;  1EV7 A;  2ZXH A;  4RPB A;  1I39 A;  2LP0 A;  3OOP A;  2JRT A;  2K85 A;  3FMS A;  4XKW A;  2F4M B;  3FZV A;  2Q6L A;  4JX4 A;  3FKS A;  4OJL A;  2ECB A;  3VDX A;  3MFK A;  5M5W J;  1EH6 A;  1UD8 A;  3DLA A;  1EWY A;  1ETY A;  1SD7 A;  1MDM A;  2GQF A;  1XGM A;  4BJ6 C;  1BBY A;  2RRE A;  4LG3 A;  3V7C A;  2BW3 A;  2WJY A;  2E1B A;  1ODD A;  4MR0 A;  2VN2 A;  3I55 I;  3U9G A;  2BVN A;  1NTC A;  1WPC A;  1WI3 A;  4U88 A;  3ELK A;  5L3C A;  5BMZ A;  3H3Z A;  3EYI A;  3JSO A;  4EH1 A;  3WNC A;  2BOL A;  4RAF A;  2MFZ A;  1AHD P;  3CJR B;  3ABM H;  2O8K A;  5K7F A;  2RAE A;  4NBQ A;  1MMS A;  3EET A;  3FXQ A;  1OB5 A;  4F55 A;  3KEY A;  2GK6 A;  4M3G A;  2XNC A;  3HGY A;  1XPX A;  3F0C A;  3BJ6 A;  3TOA A;  2F5C A;  2LRD A;  1BI2 A;  1QPM A;  3E0J B;  2P5K A;  4ZC3 A;  1BA5 A;  4LIV A;  1JKO C;  2K9S A;  5J1Y A;  2ZNZ A;  1JHF A;  2DOE A;  5C4J J;  1R22 A;  1SAX A;  2ZTG A;  4OOI A;  2HPI A;  4M6X A;  1PDN C;  1VJS A;  2EIL H;  1MKM A;  4LG0 A;  1GR1 A;  2JVG A;  3ASO H;  3MQ0 A;  2FD5 A;  1JUP A;  2DA5 A;  1RR7 A;  4OAZ A;  2MLK A;  1S72 I;  5CVI A;  3W2F A;  2BY3 A;  2OJE D;  1U2W A;  3GVJ A;  1XMA A;  2XOK A;  1WZ2 A;  5J3L A;  2DMQ A;  2VOD A;  3I55 B;  2L0K A;  2R92 J;  2O1D A;  3FM3 A;  1OOC A;  3I71 A;  2BXY A;  2E36 A;  2KJB A;  1D0Z A;  1P4A A;  5D5X B;  2W24 A;  1TYX A;  1WJC A;  1SD6 A;  3FXJ A;  5F0H A;  1E62 A;  4CH7 A;  2QYO A;  4C3H J;  1ZGW A;  4BBS J;  5D8L B;  3RI4 A;  2KLO A;  2V4J C;  3V8K A;  3KP3 A;  2A61 A;  5E3O A;  3G4S I;  3HOV J;  4ENM A;  4HE5 A;  3JCU C;  2HOA A;  3TW6 A;  4RLQ A;  3DV8 A;  4MNU A;  2I5U A;  2CWE A;  4IPA A;  1Z05 A;  2VJ4 A;  3Q0W A;  3OFN A;  1T2K A;  3QU6 A;  4PGO A;  2XVC A;  3CC7 B;  2DCU A;  1WFX A;  2F43 A;  3D5R C;  2XAF A;  4XKV A;  3ZQH A;  1O57 A;  2HS5 A;  4Y3O A;  3WTV C;  2ZXI A;  2YPR A;  2GIV A;  1SD5 A;  1TBX A;  3CP2 A;  2ID6 A;  2E7W A;  2CV2 A;  4EVI A;  3CES A;  2VBM A;  1AOY A;  3DDY A;  1ORK A;  4RGX A;  4CA0 A;  3E6D A;  4XNF A;  2K9N A;  4YG2 F;  5FRN A;  1LFB A;  4Z03 A;  2WB1 N;  4ON0 A;  1A36 A;  4M6Y A;  2QEX I;  3S3N A;  2EWN A;  2LMD A;  3CO6 C;  4YDT A;  1ITY A;  2GBY A;  2CW8 A;  2LG4 A;  1R1T A;  1T33 A;  2Y0M A;  4BHB A;  4YEL A;  1P4M A;  3WYA A;  3G4S B;  3MWM A;  1QGY A;  5H59 A;  3A3G A;  1U2R A;  5FRM A;  5F08 A;  1IDZ A;  4OOS A;  5B66 C;  2WYR A;  3MZH A;  2D74 A;  3DEE A;  1VBL A;  1UD2 A;  2ZXJ A;  2LSO A;  5GPA A;  2DJI A;  1WSV A;  1X3Z B;  1WQ2 A;  4Y17 A;  1FOY A;  4ESF A;  4HDV A;  1DBG A;  2BM6 A;  2F5V A;  2PN6 A;  4RPD A;  2VNJ A;  2LNB A;  4U7D A;  3LAP A;  1DP3 A;  3JRI A;  2DFI A;  5BOX A;  3PL8 A;  1GXP A;  1PUE E;  3ZPL A;  2Y9Y A;  2G7U A;  3OOC A;  5FKK A;  3V8J A;  5GTH C;  4IL6 C;  2YSR A;  3OOU A;  4WZL A;  3AVT A;  3OL4 A;  3UKG A;  3GQB A;  1KA8 A;  2JA7 J;  5C3E J;  2QEX B;  1R00 A;  2VJ5 A;  1ZHF A;  1X4O A;  5A2Q K;  1KJZ A;  3LSM A;  1D1A A;  3B82 A;  4AYB A;  2BM5 A;  2VFN A;  4L5I A;  4JX5 A;  4M53 A;  1IN6 A;  1J2X A;  4AIK A;  3M9A A;  2A07 F;  4M3B A;  4WXD A;  2WR8 A;  3MVP A;  3HM5 A;  4XLF A;  4AVZ A;  2K3P A;  4E7L A;  1QCX A;  4XKC A;  2FX0 A;  3IRQ A;  2DDA A;  2DMU A;  4OIO F;  2C6Y A;  1K8F A;  4PFO A;  4XLH A;  5BPD A;  2PE3 A;  4X06 A;  1SVM A;  4P6Y A;  1M1K D;  1FC3 A;  3U21 A;  1I1G A;  2IPQ X;  1R49 A;  1DG1 G;  2MC4 A;  1FBQ A;  4O3M A;  3GQ7 A;  4LK1 F;  2EFQ A;  2M87 A;  3J80 K;  4N4O B;  4KIB A;  3HAG A;  1NDH A;  3CMM A;  4XR6 A;  3ZCO A;  5HXB A;  2VBW A;  4KJZ A;  5FA6 A;  1RKW A;  3CJN A;  2ME6 A;  4Z2Y A;  1FMV A;  3S1Q J;  1WSR A;  4BH9 A;  1TSP A;  1IV6 A;  5B1A H;  1BR4 A;  5LBQ A;  1VQ8 I;  4P1V A;  1FYL A;  2JMW A;  1XFO A;  3CUO A;  3OYI A;  4BY1 J;  4A5M A;  3AST A;  1XCV A;  4D0P A;  3H92 A;  2VBS A;  3QFC A;  1Y8Q B;  3L2Q A;  1IO2 A;  2QXZ A;  1W1W E;  3C2B A;  3GFJ A;  1AKH B;  4NC7 A;  4C3J J;  1LE8 B;  1XGS A;  1FP1 D;  1RUN A;  1DAR A;  3OEE A;  2MW8 A;  1F43 A;  2B7B A;  2QWW A;  1WI9 A;  3MAJ A;  1ONV A;  3GZ6 A;  4ACA A;  3PSZ A;  3SQV A;  1FMW A;  4QFM A;  2R0Q C;  4ZCI A;  2ZBV A;  4PAB A;  4CCK A;  2KHM A;  1R5I D;  5J4Y A;  4PJN A;  4BE0 A;  3KIO A;  4BGD A;  1R5O A;  1QRC A;  3R0J A;  3B73 A;  3D5L A;  4N4N B;  3QSY A;  4FET A;  4G7W A;  3VSU A;  2ZSH B;  4XL9 A;  4I84 A;  2DT5 A;  2V9V A;  4UHT A;  3ASQ A;  4TMZ A;  2X51 A;  3BG6 A;  4Z4Z A;  1STZ A;  3WGI A;  4EGZ A;  4IKF A;  4NCN A;  3BZC A;  2ELJ A;  2ME0 A;  2W6J A;  1BX1 A;  3WE3 A;  2FJ1 A;  2XAJ A;  4ZYA A;  3SEJ A;  2L4A A;  2QZ8 A;  2X4H A;  1VQ8 B;  4ACB A;  3DBR B;  5ERI A;  1G3W A;  4U0W A;  1PJ7 A;  2GK7 A;  3TO6 A;  2V6C A;  3BZK A;  3OYD A;  4LOC A;  4UV9 A;  3FDY A;  4UUV A;  2QUF A;  2L9S A;  2KT0 A;  1IUY A;  4RD1 A;  2R5Z B;  4E7Z A;  3HJE A;  3ABU A;  1UAA A;  1CQX A;  3SZG A;  2O6G E;  3SZE A;  5IYB J;  2KDO A;  3QOP A;  2HQR A;  2K7L A;  1X0C A;  1S9H A;  4FX4 A;  2A5W A;  2KJC A;  4JOM A;  2VBK A;  1H42 A;  3DXJ F;  5E3N A;  1TZL A;  3BRO A;  1U8R A;  1WOP A;  4HWV A;  2VJJ A;  2O9L A;  2MGQ A;  4NC6 A;  2FRH A;  2NV4 A;  2QMU A;  2LC2 A;  3SQN A;  3BG5 A;  4M6V A;  4LB5 A;  4HSR A;  2M0C A;  4HF2 A;  2NVX J;  2EZK A;  3ML6 A;  4X8I A;  1W5T A;  1BJK A;  1RZ4 A;  3BQJ A;  1OCC H;  1UMQ A;  5HOO A;  2MSY A;  2YU3 A;  4HF0 A;  1VQN I;  5FLM J;  2BM1 A;  1QFJ A;  3FKI J;  2XF5 A;  2HI3 A;  4YFX F;  2FEZ A;  1QU3 A;  4M0L A;  1YJW I;  2Q0O A;  5IP9 J;  1FOW A;  2CND A;  4DQK A;  2ZL5 A;  2HNH A;  3P9K A;  1F4K A;  3D0S A;  5HOD A;  2O0W A;  4XBF A;  4PC3 A;  2BX6 A;  3E5U A;  5ILV A;  2AXT C;  4XQF A;  1JTA A;  5JMC B;  4FWT A;  1D1C A;  1KK1 A;  1FIA A;  1E3H A;  1Z1D A;  2FQ4 A;  2RV8 A;  5EZG A;  1EA0 A;  1YS6 A;  3DQV C;  1MBJ A;  1VHO A;  3I1F A;  1JA1 A;  3CCS I;  2NRA C;  4MXN A;  2ZIT A;  4HV6 A;  4JQF A;  3CCU I;  3NAU A;  1AKH A;  2R7R A;  5C1C A;  2HVS A;  3K4M A;  1LE8 A;  4KYW A;  2DMP A;  1YX5 A;  2DPD A;  2F5D A;  1HA8 A;  2VBE A;  1KON A;  2FE3 A;  1XGN A;  3G1O A;  3JRC A;  3BPV A;  1T0F C;  1XN7 A;  1FNB A;  1IUF A;  3TED A;  1N75 A;  4WZK A;  3FX3 A;  3N97 A;  1JT6 A;  2CUF A;  2EV0 A;  4A6E A;  1MSE C;  3LL7 A;  1ZR4 A;  5A88 A;  1VQN B;  2R7D A;  2CQQ A;  1R36 A;  1UD4 A;  2G0Y A;  3DPU A;  1HKS A;  2P6T A;  1QA6 A;  4AF7 A;  3BDD A;  4G94 A;  4RAG A;  1IDK A;  3GQ9 A;  6PAX A;  1YJN I;  1YJW B;  3I4M J;  3OY9 A;  4KKT A;  1GVD A;  1ENH A;  3CO7 C;  3DCF A;  2XAS A;  1D8J A;  2M7A A;  1R6R A;  1I3Q J;  4B47 A;  2NNY A;  2GM4 A;  3CCS B;  2DA6 A;  5J8F A;  1MJ9 A;  3EQL F;  3VB2 A;  1WSU A;  1Y0Y A;  1ZYR F;  3EUH A;  1VTN C;  4P12 A;  2L2O A;  4ROX A;  3CCU B;  4C30 A;  2A6E F;  2EB7 A;  4HX7 A;  2HTS A;  5K1Y A;  1Z9C A;  1E79 A;  1DU0 A;  2LKX A;  1AU7 A;  2E2H J;  4M2L A;  1D1N A;  2WB1 A;  4N9H A;  5HDN A;  1VLO A;  3CCV I;  2R7O A;  2B7C A;  5DN6 A;  3MKW B;  4CIC A;  1J59 A;  3F72 A;  4QTR A;  3HOT A;  3H9J A;  3C3W A;  1E0E A;  4YAF A;  1P7J A;  3VSK A;  2JSP A;  4EM2 A;  4YIF A;  3H09 A;  3FXL A;  1BMF A;  1YJN B;  4RB3 C;  5BS6 A;  1V55 H;  1ZAO A;  2CG4 A;  4G8X A;  4V2F A;  1OHH A;  1REP C;  1XG2 A;  5HLT A;  2KRH A;  2LY9 A;  2NZM A;  2HGC A;  1R4N B;  2DFH A;  2CFX A;  4TV7 A;  1A04 A;  1NRK A;  1WMR A;  2OZ6 A;  1XSD A;  3K0L A;  2VOO A;  3VWB A;  4P9U A;  1EF4 A;  3MD2 A;  2V7T A;  2XC7 A;  3D26 A;  1L1I A;  1IDY A;  3BNW A;  1Q81 D;  1IN7 A;  3FF5 A;  5HLH A;  3WXM A;  4IVN A;  2DT6 A;  1W9X A;  2CC2 A;  3V42 A;  2CBX A;  3B90 A;  2VNI A;  1LDJ A;  2VON A;  5IYR A;  3CCV B;  5H2F C;  1RUO A;  4ZH4 F;  1N8R D;  2L7K A;  2MYS A;  3HSF A;  4NUB A;  1EP1 B;  3SFZ A;  3J81 K;  4HNU A;  4A0Y A;  1I8D A;  3HOW J;  2XB5 A;  3BCA A;  3K70 C;  2I1L A;  2RNG A;  3GFM A;  1OLT A;  3DBH B;  1ACI A;  3F8F A;  2KP6 A;  4CCJ A;  1JKP C;  3FM5 A;  5BSX A;  3P5J A;  4A3I J;  4XOT A;  2CQ7 A;  2W00 A;  2DPU A;  1SM4 A;  4IRI A;  3ZMS A;  4NQW B;  3E6C C;  4A3G J;  1UHS A;  3WHC A;  4R79 A;  3CZ6 A;  4CUG A;  4NK8 A;  2KPM A;  1UHW A;  4A3B J;  1EFR A;  4W8T A;  4J19 A;  5E8I A;  1OFC X;  1MBF A;  3K1N A;  1R23 A;  1WKM A;  2V26 A;  1POG A;  3E97 A;  3ML3 A;  4Y52 J;  2J5O A;  2MH9 A;  1VQ6 I;  1I3A A;  4OP7 A;  5H5J A;  3SYT A;  1PLU A;  3K6G A;  3VO1 A;  5IT3 A;  3CXC B;  4G9Y A;  4PJM A;  1EFU A;  2HR3 A;  3JRG A;  4Z05 A;  3JRA A;  1EH7 A;  1X2N A;  1K8A D;  3UW0 A;  5GAG J;  5EGO A;  2R7X A;  3B02 A;  2F48 A;  2PIA A;  2XKO A;  1VQP I;  1HCR A;  1MNM C;  2V7V A;  2X1D A;  2KVO A;  3P27 A;  2QGU A;  3K4L A;  1SKQ A;  3ZIA A;  3RPQ A;  3G73 A;  3U1D A;  4C43 A;  1B9M A;  1I6X A;  4GO1 A;  4RDU A;  2Y9Z A;  3PNV A;  1IC8 A;  1DPU A;  2PYG A;  1EP3 B;  2HXI A;  4LD5 A;  3H3U A;  2GRE A;  4B3F X;  3WTT C;  2WAD A;  3AG2 H;  3QAH A;  4MO7 A;  2PLF A;  4Y7N J;  1IRF A;  4DQ2 A;  2C4U A;  1VQ7 I;  3VO2 A;  5FD6 A;  1B9N A;  1U3E M;  1BR2 A;  2JVH A;  4L0Z B;  4C0S A;  1Y56 A;  4XSX F;  5F4M A;  4BEH A;  2OBP A;  2CW0 F;  3PSF A;  3A01 B;  4NHJ A;  3HBL A;  1VI0 A;  3CC2 I;  3WTS C;  2XGJ A;  2PMU A;  1J7K A;  3MZ8 A;  4R71 A;  1YLO A;  1VQ6 B;  3FWE A;  1VQL I;  1VZ0 A;  2JSC A;  5E8G A;  3AG3 H;  4YZ0 A;  4HBL A;  4DIQ A;  3DTE A;  3VOD A;  2XND A;  1Q9S A;  5GAD J;  4D7M A;  2DOD A;  1P4X A;  2Z33 A;  4MLO A;  4MYU A;  2DW4 A;  1VQP B;  3KYC B;  3LFU A;  4JX6 A;  4A93 J;  5HS9 A;  4PGH A;  3H0D A;  5DCM B;  1W4M A;  2HLD A;  1COW A;  3BT9 A;  1AMO A;  3RZD J;  2E2J J;  4XD7 A;  4M71 A;  1DAB A;  3F8N A;  2PJP A;  1UZC A;  1MD0 A;  2X6O A;  2ZXW H;  3QOE A;  3GTK J;  5AON A;  3WG7 H;  3H9N A;  1H8H A;  3DEW A;  4FXU A;  3OMY A;  5L3B A;  2QBY B;  1BR1 A;  1YRN A;  1VQ7 B;  2B63 J;  4KUM A;  1LUJ B;  2EIM H;  1U9N A;  4KIC A;  4N0B A;  3GZN B;  2DA2 A;  3KP4 A;  1ZK8 A;  2X1C A;  5J8C A;  1T6S A;  2X6Y A;  2LZJ A;  4M9X A;  1H8A C;  1E1Q A;  3CC2 B;  2GXG A;  2QN6 A;  1VQL B;  4E6K G;  3R4K A;  1H85 A;  1QFY A;  2QA4 I;  2FOK A;  1ULY A;  4ZTJ A;  4Y15 A;  3LQR A;  1DGR M;  2RN7 A;  3G6E B;  1S29 A;  2DN0 A;  4HX8 A;  1U8B A;  5JR3 A;  1FJL A;  3GVK A;  1QVT A;  2P3M A;  4X7D A;  3TQN A;  3BG7 A;  2BHZ A;  2KRF A;  2IS2 A;  3VNU A;  3TP3 A;  3RYP A;  2F2E A;  3F8B A;  4NNJ A;  4QVA A;  1WOR A;  4EV0 A;  2ID3 A;  2VC0 A;  4Z4S A;  1KQ5 A;  1OFE A;  2DJN A;  3OEH A;  5JBQ A;  4F7D A;  4ZYG A;  4WWC A;  1WOO A;  3HHH A;  2ZNY A;  3QPH A;  4EAT A;  4YZA A;  5KHD A;  4UZU A;  1HQC A;  5IOZ A;  1BL0 A;  2XF6 A;  3GWZ A;  4BQO A;  4IX7 A;  4UY8 I;  3S1N J;  4X7C A;  1X3W B;  4UAJ A;  1YW9 A;  1R58 A;  1OFL A;  4HX4 A;  3LSR A;  1QGA A;  2PMZ A;  2JJ1 A;  2GXB A;  3V7R A;  1TW2 A;  2EIJ H;  2WPD A;  4G5G A;  1EH8 A;  2EFN A;  1V5G A;  5CPR B;  1YHQ I;  3J81 k;  3T8R A;  3MKL A;  3KET A;  1OCZ H;  2HYJ A;  1MBE A;  4AM3 A;  2QA4 B;  5GTI C;  3BP8 A;  2M45 A;  4BS9 A;  3A02 A;  3A01 A;  5ICG A;  2O03 A;  2GJK A;  3Q9S A;  2X53 S;  2VBY A;  3OIQ A;  3Q38 A;  1HKT A;  5IT9 K;  4RGU A;  1WGX A;  3COA C;  1FNM A;  1AA7 A;  4QSH A;  4WF2 A;  4I76 A;  1VQ5 I;  5L3G A;  4KH3 A;  5DM6 F;  4IHX A;  2EJR A;  3KZI C;  2ZB9 A;  2IXS A;  3OYG A;  1L3L A;  2EQR A;  2RDP A;  2R5Y A;  1SC7 A;  2Z6B D;  2QY1 A;  4GCV A;  3VMW A;  2ZJQ F;  2LLK A;  2R3S A;  2DT7 B;  4E0F A;  4RM2 A;  1EP2 B;  1H0M A;  3CB4 A;  2D1H A;  1JNY A;  2UXN A;  4P25 A;  2OCE A;  4PDK A;  1KQS B;  3QPL A;  4LLG F;  3ZQ7 A;  3IH2 A;  3CCM I;  3PSI A;  5CVJ A;  4LG0 B;  5KVR A;  3OZW A;  3GSI A;  3RY8 A;  2CF4 A;  1IRZ A;  2WTE A;  4Z4T A;  2NS7 A;  2EPF A;  3TOB A;  3CW2 A;  3Q6Q A;  2JK3 A;  1YHQ B;  4X0C A;  5JHF A;  3CCE B;  1T6Y A;  4HG2 A;  2QBY A;  5FNZ A;  1EXM A;  2EFP A;  4B1R A;  1Y0U A;  1RES A;  1ZGA A;  5DUK A;  2OZU A;  4BNC A;  1KK0 A;  2BSP A;  4X1E A;  2ZZQ A;  3LYC A;  3ZPP A;  1IN5 A;  2Z99 A;  4F93 B;  4CDG A;  3F21 A;  1O3S A;  2M4G A;  3IH3 A;  3PIO F;  2O04 A;  4URR A;  4A3K J;  2BPO A;  3SUC A;  1TYV A;  3BPX A;  5EG0 B;  2R7U A;  4A3F J;  3T0Y A;  2CSO A;  3OS1 A;  2D5V A;  1GAW A;  5GAH J;  3K1M A;  1ON2 A;  1JTX A;  4B4C A;  4EJO A;  5F0F A;  2VBT A;  3MCZ A;  5IOY A;  1N0V C;  3R6K A;  4WZT A;  2RC5 A;  4CZC A;  5KSW B;  2DY1 A;  5DD8 A;  4RD3 A;  1JGG A;  1NG7 A;  1SFX A;  5EEH A;  1TQP A;  2IGK A;  3HOU J;  1TVC A;  4RDL A;  1XDU A;  1V0E A;  3CCM B;  3VSV A;  5TJJ A;  4TKO B;  3LSP A;  1ZRD A;  2JUC A;  2YUH A;  1V54 H;  3NRV A;  4ESJ A;  3QU3 A;  4AC0 A;  4HLY A;  3AL0 B;  4P9F A;  4RB1 A;  3ZBU A;  4UXN A;  2VBX A;  4QVJ A;  5JLX A;  2AQF A;  3CPW B;  5E1W A;  3BH4 A;  4FCY A;  2K4B A;  3IRR A;  3ZP5 A;  4HDU A;  2V7W A;  1XSX A;  3B8H A;  5CYV A;  4ZYH A;  2BM4 A;  5IYQ A;  4BJT A;  1QZZ A;  4DQL A;  2DTR A;  1F60 A;  3GX4 X;  5DNS A;  3GW2 A;  1B8I A;  2Y48 A;  1N06 A;  3L2U A;  1WJ5 A;  3OYB A;  2PI0 A;  4YAL A;  4CQJ A;  1ZRC A;  1RQR A;  1NG6 A;  3RKW A;  2HVQ A;  1T95 A;  2WY7 Q;  2VT3 A;  4G6T B;  2R6H A;  4ZZD A;  1R5G A;  3DEU A;  4YFK F;  3I54 A;  4D9J A;  5A2Q Z;  1OGM X;  2XAH A;  4ENN A;  5KK1 A;  3K4J A;  3BR2 A;  4L5J A;  3K4K A;  4LIU A;  2OK7 A;  1QA2 A;  3R6S A;  2F4O B;  3CMA I;  2W4S A;  2E34 A;  1D3Y A;  1H88 C;  1O8I A;  2GA1 A;  4W8Q A;  2M34 A;  4HYE A;  4X7E A;  2XB0 X;  2KZV A;  3HB9 A;  1G7S A;  3ZSC A;  2P8T A;  2BGJ A;  1OR7 C;  3M1C A;  4HPQ A;  3ONY A;  4AF6 A;  1S7E A;  2H8W A;  1D2E A;  3KPH A;  3GF2 A;  4QIW N;  1ETW A;  3W2W A;  2UVF A;  5D5U B;  4P6V F;  2QSG X;  2L9R A;  2CFO A;  1GDT A;  2V79 A;  1TQI A;  3EYY A;  3OV8 A;  4XKB A;  3K10 A;  4I2O A;  4YAW A;  3J80 Z;  3WTW C;  3WU2 C;  3C7J A;  2XGE A;  1A6Q A;  4RGS A;  4BQN A;  3A03 A;  5THX A;  4JYK A;  4LFU A;  3VPR A;  2H09 A;  2QGG A;  1O3T A;  1B59 A;  4BL0 B;  2EK5 A;  3WND A;  2OF7 A;  5EG0 A;  1UD3 A;  5GV7 A;  5H20 A;  2XPU A;  2DK5 A;  1NHA A;  5K7Z A;  1MBK A;  3F6O A;  3BR1 A;  5H6Q A;  1YG2 A;  3HDD A;  2JPC A;  3W2V A;  1PKV A;  1QH0 A;  3CMA B;  5JLV C;  2BY1 A;  2QYU A;  1D5V A;  2J8K A;  4KMU X;  1MGT A;  2OCC H;  4P5O A;  5JHU A;  4FE4 A;  4WX9 A;  3CMY A;  2VPL A;  2YX7 A;  4RMN A;  4DNC A;  4KNY A;  4QPO A;  3CLO A;  3EUH C;  2ZBU A;  4OPS A;  3KX2 A;  4DW6 A;  3OYN A;  2O7O A;  2AS5 F;  4PCQ A;  3ZN0 A;  2UWM A;  2C5B A;  5BNG A;  2O17 A;  1W0T A;  1S72 B;  2O3F A;  2K86 A;  1OMI A;  1YX3 A;  2H1L A;  3CP8 A;  2B9S A;  3SZP A;  3RQ4 A;  3PNT A;  3HHG A;  3Q3S A;  4TMV A;  4GQN A;  1HKQ A;  2CUZ A;  2F5F A;  1JGS A;  2YX4 A;  4YRV A;  3W2I A;  1TNS A;  1Z67 A;  5J3O A;  1N77 A;  3L09 A;  3CCR I;  1SAU A;  1JJ8 C;  1BC8 C;  3U6K A;  1OFM A;  3FK7 A;  4FTH A;  1K6O A;  2PG4 A;  2Z3Y A;  3OR1 C;  1LVA A;  1LB2 A;  5KAI C;  3JRF A;  1RET A;  3TO7 A;  1ZRE A;  2K40 A;  1DPR A;  2RVC A;  4L8J A;  1IF1 A;  2V7F A;  1LVK A;  4I98 B;  4YII A;  3OW2 B;  5M3F J;  2D9R A;  1MRZ A;  2JA2 A;  2WAQ A;  3FXO A;  4YZX A;  5CKT A;  2HQA A;  2X1E A;  1O8G A;  1QZE A;  5J1R A;  3LNQ A;  3QE2 A;  1Z3Y A;  2ZME B;  2HKO A;  3DFG A;  3EPZ A;  3M8E A;  5F4J A;  4GRI A;  5F0C A;  2DA7 A;  3O3K A;  3GLX A;  4C9Y A;  3DTI A;  1BN8 A;  2RNJ A;  2KFD A;  2H1K A;  3L2C A;  1JI8 A;  1Y39 A;  1BC7 C;  1LEB A;  3N90 A;  3R61 A;  4OPO A;  4QPQ A;  2DMT A;  1KU3 A;  3H5A A;  2F3L A;  4FAS D;  3FBN B;  3L1P A;  3GTJ J;  3JRB A;  3QYB A;  2W48 A;  1G3T A;  1YQA A;  2MD0 A;  2I8D A;  5F27 A;  3FXR A;  3TL4 X;  1YW7 A;  1P7I A;  4HRI A;  2KL4 A;  3K1P A;  2Y0S A;  1IW7 F;  5E79 C;  2ETH A;  4HNV A;  5J4V A;  3AAF A;  2VBV A;  2FVG A;  3BG3 A;  2KDZ A;  2FQ3 A;  2JRM A;  1VF7 A;  4CYD A;  2MA3 A;  3PA1 A;  2XF7 A;  1NJI D;  4KKU A;  1GUU A;  1HC8 A;  1HF0 A;  3ISP A;  2M8E A;  2M5W A;  2RC6 A;  4OM9 A;  1FTZ A;  2DAO A;  3HL2 A;  5J35 A;  1PE9 A;  1OPC A;  5EJC A;  1KU9 A;  1SVL A;  2E1M B;  4II2 A;  3RKY A;  5DSZ A;  3ZZ0 A;  4P96 A;  5L3E A;  1CF7 B;  1YYV A;  2DTZ A;  1IJW C;  2XTY A;  3O2P E;  4YHB A;  3T56 B;  4RLZ A;  2BF4 A;  1D0Y A;  2XUB A;  3RKX A;  2QSF X;  3X2Q H;  4ENJ A;  4UVC A;  1DUX C;  1VQ9 I;  3ASS A;  2VNH A;  2X0L A;  1TWH J;  3NE5 B;  3SY2 A;  5LGN A;  3VYS B;  1YI2 I;  5E3L A;  2BVL A;  2WZP P;  2X0K A;  3DKX A;  4CZZ A;  2VE8 A;  4ETS A;  1I50 J;  5ILS A;  1MMD A;  4N3G A;  4ZJZ A;  2HZT A;  2PX9 A;  1UG0 A;  3Q0V A;  2OK8 A;  1RRJ A;  4V02 C;  2Y69 H;  1YIJ I;  2C5H A;  1TWA J;  1IGN A;  2JA8 J;  2JN6 A;  3TBI A;  4EM0 B;  3HSE A;  1E17 A;  3ONU A;  4BKX A;  2CJJ A;  5FGM A;  4Z4U A;  2R7T A;  3SLD A;  5F1J A;  3D1N I;  1G59 A;  4A2U A;  1RIO H;  4WZE A;  5E6T A;  3E5Q A;  2M30 A;  4BDY A;  1YJ9 I;  1B72 B;  1HDD C;  3PQK A;  3A3B A;  3W6J B;  3WTX C;  5F6F A;  3ZZU A;  2L7Z A;  3KYL A;  1LKX A;  1FIP A;  2ZME A;  4OWR B;  1USS A;  5D8K B;  1Y6I A;  3IKT A;  3LSG A;  4FK8 A;  3QYF A;  1MBG A;  4RD0 A;  3WBK A;  3P4G A;  4DYC A;  3ZN1 A;  1SD4 A;  3EUK L;  5IPA A;  1TT0 A;  1ETK A;  2CH0 A;  4HOB A;  1F20 A;  1HZE A;  3ERE D;  2ADU A;  3SKB A;  1VQ9 B;  2E5Z A;  1FWZ A;  4LLN A;  1YI2 B;  1ZG3 A;  4B3A A;  1FNC A;  2O0Y A;  2IW5 A;  4FIS A;  1K73 D;  1HXD A;  4L9V A;  1J0R A;  5M5Y J;  1N05 A;  1RWR A;  1PP7 U;  4BU2 A;  2JJ2 A;  3OAA A;  4XLP F;  2DQR A;  3ZQF A;  1BI3 A;  1ZM3 A;  4L9J A;  1OQY A;  4YAO A;  4YZQ A;  1WVR A;  1YIJ B;  3OL3 A;  4IQJ A;  3ZMU A;  1TTY A;  1R4M B;  4E7S A;  4RB0 A;  3HKZ N;  2GJR A;  3RCO A;  3LSH A;  4C3I J;  3OP1 A;  4HQM A;  1U5T A;  3IH4 A;  2BSA A;  3RIQ A;  1UJ8 A;  4BAY A;  2VQL A;  4LK0 F;  1YJ9 B;  3D5S C;  5E18 F;  4KDP A;  4QLC U;  2VFO A;  5TV2 A;  1W36 D;  1K5C A;  4I7H A;  3B6A A;  3CF2 A;  3J81 Z;  2VIX A;  2QQ8 A;  1OYY A;  2MBF A;  5EYR A;  1MNE A;  1H9G A;  2PJR B;  2W57 A;  4Q47 A;  2V1N A;  4ASU A;  1TWG J;  1X3U A;  1SMY F;  3I53 A;  3Q9V A;  3VSL A;  1QVF B;  2GJP A;  4WQM A;  1CF7 A;  4J01 A;  2E19 A;  4HLX A;  4E7K A;  3K4N A;  3DP7 A;  4L5E A;  1ZGJ A;  1A35 A;  4JK1 X;  3SZT A;  2PYH A;  2NS8 A;  5AIP A;  1MMG A;  2DU9 A;  4PSW A;  3K7A J;  1UFM A;  1OR7 A;  3M8J A;  3L00 A;  2XAG A;  1A5J A;  2Q2E A;  4EEF G;  2BEO A;  1O8E A;  1B1B A;  4A3L J;  4WK8 F;  2B0L A;  2NAZ A;  1WRJ A;  3CDL A;  3MEX A;  4B09 A;  2KQR A;  2XGD A;  5C4X J;  1T6X A;  3PFI A;  4UVB A;  2AHO A;  4OU0 A;  2NPF A;  3ULQ B;  3HOS A;  2QE7 A;  1W5C C;  3R60 A;  3ISX A;  3KFW X;  3JW4 A;  5GV8 A;  3LA3 A;  2IGM A;  4LJZ F;  2FMY A;  1O8L A;  4L18 B;  2XKP A;  3GVA A;  3S32 A;  3A8K A;  1TLL A;  2V1X A;  1IJF A;  3WWG A;  3OYC A;  4GXO A;  4IHW A;  1FRN A;  3TMO A;  4U4B A;  3ABL H;  2NOG A;  3HYI A;  1B72 A;  2BE5 F;  1EKE A;  1GO2 A;  2R9V A;  3ES9 A;  3FPK A;  2V7X A;  5IYC J;  1EJ9 A;  4B8X A;  2VXD A;  4MIM A;  4LB6 B;  4BUP A;  4RM3 A;  3LWF A;  3OYJ A;  1MBH A;  3E1Y E;  5F4O A;  5ICC A;  1KYZ A;  2K4J A;  2O8X A;  3NEU A;  2OC6 A;  1YS7 A;  4IRG A;  3Q39 A;  4RAY A;  1F1Z A;  5KAF C;  2HMA A;  4HV5 A;  4FT8 A;  3ABK H;  5EGO B;  1ZH5 A;  3MKY B;  3T51 B;  4M3E A;  2VKH A;  3PIP F;  4ZGQ B;  3WGH A;  5DDG A;  2V9P A;  2H27 A;  2Y30 A;  3HRT A;  4ZYD A;  1MH3 A;  1W5S A;  1YOV B;  3EUA A;  2STT A;  4RDK A;  3ASN H;  2OTJ I;  3CCQ I;  2V6E A;  2YWE A;  5A8A A;  3AVW A;  4A3D J;  3LST A;  1D8T A;  4E4H A;  4XLA A;  3KEW A;  2W6I A;  4IHY A;  2XNJ A;  4P9S A;  1LM1 A;  5LFA A;  1G6N A;  2E71 A;  2IS1 A;  2J8I A;  2QDX A;  1ETQ A;  2BM7 A;  1W0J A;  3IWZ A;  2NS0 A;  2ELK A;  5BQT A;  2ZJP F;  5TIS C;  1O3Q A;  3QFR A;  2KRC A;  3W6K B;  1KRH A;  3CQZ J;  1NK2 P;  2VB6 A;  5FO1 A;  4PJL A;  3JTH A;  5A89 A;  2VFP A;  4NDL A;  4GGG A;  2N8G A;  5AIQ A;  4IXA A;  4BEH B;  4AID A;  2UV1 A;  1UMK A;  4RCZ A;  1KYW A;  2BXZ A;  3ZC3 A;  2ESH A;  5HKK A;  3LJY A;  2EFO A;  2PJR A;  4AWX B;  2DCE A;  3A1Y A;  1DDI A;  1KK2 A;  3RTR A;  5DTD A;  2HDN B;  3GUD A;  4YFO A;  2K9L A;  2JWT A;  3KE2 A;  4F7Z A;  2QQB A;  1MND A;  4QWQ A;  1V3F A;  1VLY A;  2NNN A;  3QFS A;  4TMT A;  2X3H A;  1NHC A;  3WG9 A;  3U2R A;  2DXI A;  2Z5U A;  3W3C A;  3IV5 A;  2AO9 A;  1FTT A;  2QCO A;  4JP0 A;  4BJ5 C;  4MTD A;  4E7I A;  4OOV A;  2OTJ B;  1JRG A;  2Z2S B;  1FNN A;  1W0U A;  2XZP A;  5FO0 A;  2JTV A;  4OMZ A;  5CQE A;  3OYA A;  3JRE A;  2C78 A;  2NVY J;  5FKN A;  4UB6 C;  4OIR F;  1DBO A;  2NTB A;  2EWE A;  1HOM A;  1BLI A;  2OBR A;  1OKR A;  3S16 J;  2Q6K A;  4IZZ A;  1H89 C;  2YS9 A;  1SFK A;  3FPP A;  1YRN B;  1RR8 C;  3ESW B;  5F64 A;  1IV8 A;  1YX2 A;  4A0Z A;  1O88 A;  1FX7 A;  4C2L A;  4CGZ A;  4RD6 A;  5AMV A;  2EFG A;  2CUJ A;  4PC2 A;  4XM3 A;  4W8S A;  5ED4 A;  1T56 A;  2NVU B;  4Z6Y A;  2XAU A;  1OB0 A;  1TYU A;  3V7A A;  1T8I A;  4HST A;  2IBD A;  3WY9 A;  3PQJ A;  2FXA A;  1R5H A;  1GV2 A;  4D5C A;  2RQP A;  4UUS B;  3GFL A;  4Z4W A;  2D3N A;  4P22 A;  1JHH A;  3M7G A;  4EM1 A;  5BPI A;  3BZ6 A;  5EF6 A;  4K2E A;  1WP6 A;  2J7K A;  4UNO A;  1K79 A;  3PNY A;  3TH0 A;  3KZZ A;  4WXH A;  3RDI A;  3REO A;  3ZMZ A;  2QVO A;  1Y0R A;  1KQ0 A;  4XON A;  3CF5 F;  4DNT B;  3N4M A;  1A31 A;  3BQY A;  4OIN F;  1IN4 A;  1L0O C;  1XCB A;  3FHZ A;  1HW5 A;  4B3G A;  2VQC A;  1QJV A;  2XAQ A;  2BHY A;  3OYM A;  1ZEL A;  4OPV A;  2G0E A;  4PUS A;  1KZL A;  5EMN A;  3WHB A;  5IT9 Z;  2LR8 A;  1SFU A;  2MD5 A;  5D5V B;  2W85 A;  1HST A;  5HLI A;  3FMQ A;  2NTQ A;  4KKS A;  2DOG A;  4OOX A;  1QBJ A;  3H9Q A;  1Z6R A;  4CCO A;  1B6A A;  1O8H A;  1BIB A;  3KYD B;  4Q48 A;  4X7F A;  1Q1V A;  1GXQ A;  5LGU A;  3EDP A;  5DM7 F;  1JXS A;  1XMX A;  2IS4 A;  1WOS A;  2NT6 A;  2IA2 A;  3WTY C;  1PYV A;  2CYY A;  2VOP A;  2WBM A;  2XGX A;  3VR6 A;  4W8R A;  3S2W A;  2KMU A;  1VQ4 I;  3T1B A;  3UR3 C;  3DKY A;  4MYT A;  2UZK A;  1ETX A;  3KL9 A;  3JQP A;  2O6W A;  3A2K A;  2OAZ A;  1N78 A;  1VQO I;  3JRD A;  2DYR H;  2WSS A;  1KMH A;  2VKE A;  3FK6 A;  1K28 D;  5FL7 A;  2G7H A;  3PO2 J;  2W82 A;  3CPX A;  4XRF A;  2FUG 2;  2XPV A;  1WJB A;  2Z1D A;  1BQE A;  1ZKG A;  3B8Y A;  2QM3 A;  2JJ7 A;  4KMF A;  1P2F A;  3H36 A;  2R5Y B;  2CO5 A;  3SEZ A;  1NH3 A;  2XRO A;  3AL0 C;  1I1S A;  1XGO A;  4IRH A;  1GVH A;  4K1X A;  1KZH A;  4PJJ A;  1N0U A;  1UD5 A;  2QTL A;  1I18 A;  3WU0 A;  4HE6 A;  2VQH A;  4OZY A;  1RNL A;  1P6R A;  3A35 A;  4Y9U A;  1JJ2 B;  1S7A A;  1KTW A;  1H9T A;  3OZV A;  4AU7 A;  2YR2 A;  3L2R A;  1WJF A;  2EH3 A;  4ITV A;  2XV4 S;  4XLC A;  3W2A A;  1AWC A;  3GVL A;  2IRF G;  2QSH X;  1Q1H A;  1P92 A;  3LSI A;  3OS2 A;  3GTP J;  1TUI A;  1KQ9 A;  3S17 J;  5HS7 A;  2Z9O A;  4HEA 2;  1MW7 A;  3CJQ B;  1Q82 D;  3LMW A;  3KP5 A;  3JRH A;  1VQ4 B;  2VFM A;  1QO0 D;  3IC7 A;  1ZAR A;  3T53 B;  2AHQ A;  4RGR A;  5IYP A;  3JQQ A;  1U78 A;  2M4K A;  3E20 A;  2QKL B;  1ON1 A;  1PJ5 A;  1FPQ A;  1VQO B;  4PGG A;  2YU9 J;  2FBI A;  5LD2 C;  5D6E A;  3JAM K;  2UVE A;  4CCL A;  3WNB A;  3CD6 I;  2TDX A;  1QA3 A;  4UUS A;  2DOA A;  5B6I A;  1F5T A;  4B4D A;  3S8P A;  2HU9 A;  3OYF A;  2X85 A;  2M1B A;  1EA3 A;  2KIS A;  3H0G J;  3ZOB A;  4D7N A;  3DKW A;  1KTV A;  2H94 A;  4JMQ A;  4CO8 A;  2L01 A;  2ACJ A;  2F5E A;  2BY2 A;  2LY2 A;  2P5V A;  3S3M A;  3IAS 2;  1YO5 C;  2EIX A;  3ZR8 X;  4ZV4 A;  1BM9 A;  2AXL A;  2E1O A;  2IGO A;  2C2W A;  2PQ8 A;  1FOK A;  5DS9 A;  3CUQ B;  3V4G A;  3MMY B;  2V1D A;  3OYE A;  4D5F A;  1HVX A;  2ZZE A;  3HTU A;  3SXY A;  3S2D J;  2K9M A;  3ECH A;  3W5H A;  1X58 A;  2R7S A;  4PAA A;  4TMW A;  5LGT A;  2WV1 A;  1K4Z A;  4YFN F;  1LFU P;  3I59 B;  1BIA A;  1IXR C;  2IS6 A;  1TTT A;  3ROU A;  2LK2 A;  3AVV A;  2JPB A;  5FLX K;  3E6M A;  3A0B C;  1J9Z A;  4DZP A;  4S05 A;  2HQN A;  2IEK A;  4KN7 X;  3CD6 B;  1TWF J;  1ZR2 A;  1B8I B;  2GOM A;  5LLQ A;  3L9F A;  3FJO A;  4M9Z A;  3F3X A;  3GEZ A;  4HW0 A;  1PJ6 A;  2VYQ A;  3BTC A;  2ZCW A;  2E2I J;  1K6Y A;  1Z6T A;  1LFP A;  3C18 A;  3SDB A;  4F91 B;  4A3J J;  1JJ6 C;  1J9I A;  3F8C A;  4ZCL A;  4M74 A;  4S04 A;  3P7N A;  2ZC2 A;  2XRN A;  4RB2 C;  1ZTR A;  3DWL E;  2KIF A;  1ZUN B;  4YEI A;  3KP2 A;  2JA6 J;  1WJE A;  1P9Q C;  2KKO A;  4A5N A;  1IG7 A;  3VMF A;  3PUF A;  2VL8 A;  4AYB N;  1N08 A;  2BM0 A;  2YWF A;  1CZF A;  5HLG A;  3OJX A;  5DD4 A;  4FX0 A;  2XZO A;  2Z16 A;  2COB A;  5HDG A;  4A12 A;  3TDZ C;  1OGI A;  2OQG A;  2NYX A;  1WJD A;  3BOQ A;  2Y75 A;  4WCG A;  4G7X A;  1G3Y A;  3LVB A;  1HA3 A;  3BY1 A;  5C44 J;  4X0G A;  3I56 I;  2CMP A;  4DGW B;  1GAQ A;  1QRB A;  3AVY A;  1N25 A;  3T5X A;  1X1B A;  1RQP A;  2XEX A;  3BY2 A;  1Y0N A;  2JQ7 A;  1VQK I;  1MJB A;  3TO9 A;  1QZY A;  2J5P A;  2OUM A;  2C77 A;  1I27 A;  3F22 A;  1CNF A;  3N6Z A;  1T98 A;  5CVR A;  1DU6 A;  4ASN A;  3FY3 A;  2R7Z J;  4EJT A;  4KFC A;  3DPL C;  3DU6 A;  4AD9 A;  1FZP B;  4I99 C;  1ERD A;  3P26 A;  4RD2 A;  2X6W A;  1RU4 A;  1X1D A;  2HZD A;  2D3L A;  4OJP A;  4BXU A;  2LVS A;  1VQ5 B;  3QQA A;  1TT5 B;  4FN5 A;  3G05 A;  2DFE A;  4OIQ F;  4G7O F;  4HNT A;  3V7S A;  2Q1Z B;  3FXK A;  1E3O C;  1XB2 A;  2ZME C;  1OJL A;  4H4K C;  4ZDO A;  3R6J A;  1YIT I;  1TL8 A;  3A0H C;  1ZLJ A;  3ZUG A;  3PVD A;  5FFZ A;  3LQ6 A;  3LSK A;  3TGN A;  4C2T A;  1W7P D;  4XRM A;  1UHM A;  2MAB A;  4HF1 A;  3RPU D;  1S0U A;  2E7X A;  1CLW A;  3CRZ A;  2OA4 A;  1S7O A;  2E1C A;  3I56 B;  3I58 A;  1TNT A;  4XOP A;  3CUQ A;  3OPO A;  2CRV A;  2HOT A;  4AC9 A;  1MMA A;  3BQZ A;  4QHY A;  1ETV A;  3VYR B;  2WV0 A;  5ICF A;  3ZQQ A;  3I59 A;  4DYR A;  2HKX A;  4HAM A;  1FOX A;  2UUZ A;  1ZM9 A;  1D1B A;  4KIS A;  2GAU A;  3M1E A;  2A5Y B;  3TKY A;  1P4W A;  1XS9 A;  2ISZ A;  1R1V A;  1OYI A;  2LOO A;  1U5T C;  1Q86 D;  1JB9 A;  2FF4 A;  2XIG A;  1D8K A;  3GLL A;  3OZU A;  2ZL7 A;  4F3Q A;  4ZCM A;  4RLF A;  1JA0 A;  1RC9 A;  1UG2 A;  2RQQ A;  5J40 A;  4E70 A;  4IHV A;  4PFP A;  1OYW A;  2M3A A;  1O8J A;  4KIT B;  4OJ6 A;  2EIK H;  1RKT A;  2X8K A;  4TN1 A;  1GVJ A;  5B5E C;  1UST A;  2IT0 A;  1O4X A;  3JTG A;  3HOX J;  2X9D A;  5B3S H;  4DBQ A;  1APL C;  2HEO A;  1YIT B;  3LA2 A;  2PLY A;  3C2G A;  3K2Z A;  1I5Z A;  3HOY J;  2E1M C;  3GYH X;  3GIR A;  4XSZ F;  4BE2 A;  2CUE A;  3BJO A;  3HPH A;  4IJA A;  2V4D A;  5M5X J;  4TMX A;  3GQA A;  1IN8 A;  4AIH A;  3BLY A;  3G71 I;  3ZZT A;  2VUM J;  2VXZ A;  4XOR A;  3NWT A;  3ZQL A;  3TDU C;  1QQ1 A;  1LDK B;  4UV8 A;  4CYC B;  4N3N A;  2HDW A;  3HSR A;  1G8X A;  3J7Y J;  3OYL A;  4NK6 A;  2DLL A;  5IP7 J;  3EQN A;  1ZG5 A;  2HVR A;  3M3Y J;  3FXU A;  1U0J A;  3KP7 A;  3OJW A;  1H80 A;  4MQV A;  1ZLK A;  3WTZ A;  4MGR A;  1F9N A;  4W1U A;  2LH9 A;  2F1L A;  1OCR H;  2DA1 A;  3IAM 2;  3PM1 A;  4A3C J;  1KU7 A;  3I4P A;  2IP2 A;  1WU8 A;  2EV5 A;  1LQ1 A;  4A3E J;  1KK3 A;  2QQ9 A;  1FSH A;  2F1M A;  5LEK A;  3WGG A;  3AVX A;  2K9Q A;  3PET A;  3FXM A;  3J7A Y;  2DEU A;  4LIT A;  1ELO A;  3CC7 I;  2JN9 A;  1FBS A;  1T38 A;  3U2Q A;  3CDH A;  3ZPN A;  4NB5 A;  2IA1 A;  2EZL A;  2M2E A;  4BQA A;  2NVQ J;  1BJA A;  3LQE A;  4NC8 A;  2L5Q A;  3AG1 H;  1LLZ A;  2VPR A;  3HRM A;  4F52 A;  3G71 B;  2XTX A;  5E20 A;  4X07 A;  3PUB A;  4UZF A;  3QYE A;  3B6C A;  1PJR A;  4I09 A;  1QFZ A;  2Y2Z A;  3NQO A;  2E60 A;  1S8N A;  2EZH A;  3KLN A;  1ZM2 A;  1VFC A;  2OYN A;  2JUG A;  3I5U A;  4XN0 A;  2VT2 A;  4DBR A;  2CV0 A;  1YLF A;  2GQQ A;  5K5R A;  2PFB A;  5IYD J;  2QZA A;  5KNL A;  3KEQ A;  5CLS A;  3RSN A;  5FLV A;  5E3M A;  3ZGK A;  5FD5 A;  2DYS H;  1O8D A;  2LKS A;  3LNN A;  5L3F A;  3OWT A;  1ZRF A;  1W0K A;  3QRF F;  1TQM A;  4LMY A;  1K4T A;  2R7Q A;  4IEJ A;  3VYU B;  5FKL A;  1HW1 A;  3MKZ A;  2RGV A;  4CXF A;  4IW3 B;  4BXX J;  3VOE A;  4JBA A;  2VJI A;  3OKX A;  2XC1 A;  1W7P A;  1B2R A;  1Z91 A;  2HQ5 A;  3RPU A;  4BPR A;  4GDF A;  1Y1W J;  1BOA A;  4PC1 A;  2ZKZ A;  2X3U A;  1WWX A;  2NTP A;  3VST A;  1IB0 A;  2IAI A;  3W5V A;  5H6R A;  5EZH A;  3QFT A;  1PUF B;  1KU2 A;  2TCT A;  3Q3A A;  1KD1 D;  3WQZ A;  1B4A A;  4KN4 X;  2BBY A;  2ECC A;  3SHF A;  2P7C B;  3JX8 A;  1R1U A;  4LBY A;  3Q6R A;  4M3F A;  1K9M D;  2Z8G A;  3OE7 A;  2BGC A;  2MH2 A;  3S3O A;  4ZDL A;  4BHC A;  2FBK A;  5LHH A;  4LLL A;  2HFH A;  2XZL A;  2I10 A;  2L4M A;  1ZN2 A;  1Y1V J;  3HC7 A;  3QPS A;  3H3V K;  4Z1M A;  3OYH A;  4V19 K;  2HYF A;  4CYC A;  1W36 C;  1O8F A;  3BC9 A;  3DLL F;  1Q7Y D;  4N9I A;  1MSF C;  2ESN A;  4I0B A;  3HRS A;  4IF4 A;  2V7U A;  2ZBK A;  2ZZF A;  1LNW A;  1S5L C;  5HNF A;  1RI7 A;  5K7H A;  1XQB A;  3JQR A;  2GWR A;  3Q0U A;  4E7J A;  2K3F A;  1M90 D;  3CCR B;  5J47 A;  1T39 A;  4MFE A;  1J5Y A;  4C2M J;  1JKR C;  2NST A;  2QX3 A;  5CVU A;  5C1E A;  2P0W A;  3EQO A;  2QKM B;  4A6D A;  1IXS B;  3W2E A;  2ZL6 A;  2HDC A;  2A69 F;  3C2H A;  2B0R A;  3RKQ A;  2YWG A;  2IGN A;  5IY5 H;  2RKH A;  3F8M A;  4WWV A;  1NB9 A;  1YE9 A;  2H6B A;  1U5T B;  4MQ9 F;  4XK4 A;  5D4S A;  1Z77 A;  5K5Q A;  1C0W A;  4LBW A;  3TW7 A;  2HOE A;  3GTL J;  4LBV A;  4I01 A;  1KCD A;  5FO5 A;  3CC4 I;  3Q5F A;  1QQI A;  1JE8 A;  1BPL A;  2ZSI B;  1CGP A;  3E5X A;  3L7W A;  3SJP A;  2ICW G;  3W5U A;  2OBS A;  4P55 A;  2HYG D;  1B23 P;  4OAY A;  3H5R A;  2DOF A;  4I0A A;  3BCF A;  2AQE A;  3ABT A;  5J1U A;  4P1W A;  4D1Q A;  2R7W A;  1E3X A;  3PUM A;  5D6F A;  1HW2 A;  2A6T A;  3OS0 A;  1QG0 A;  1T08 B;  1IRX A;  3E3V A;  2GLO A;  1U9O A;  1FY7 A;  2WJV A;  3BR0 A;  3M07 A;  1HLV A;  5JVT A;  2XHK A;  3G1L A;  3LOC A;  4H0E A;  2A05 A;  1ZQ3 P;  3C1D A;  3SFI A;  2VNK A;  2IQ7 A;  2Q2E B;  2XT2 A;  4MEX F;  1UCR A;  2RC4 A;  2DET A;  4II3 A;  2K27 A;  2NOJ B;  1XTA A;  2R4G A;  3CLQ A;  2K5C A;  3G3Z A;  4S0H B;  1EFC A;  5ICE A;  2XT4 A;  3K9T A;  1SVO A;  1JKQ C;  2GA2 A;  2LY1 A;  2R93 J;  1LDD A;  2M5S A;  1HF2 A;  1QVU A;  4OPW A;  3SYJ A;  3HIF A;  3CJT B;  4M73 A;  1Z3X A;  2EA4 A;  1FRQ A;  2PMD A;  3CC4 B;  3S2H J;  4EW9 A;  3WU1 B;  1PUF A;  3F6V A;  5LHI A;  4P2N A;  3UNG C;  4RD4 A;  3SEQ A;  1WH7 A;  3KRG A;  3I3L A;  5DS0 A;  1E3P A;  3RQI A;  3IP4 B;  2GOX B;  3FMR A;  1SFE A;  2OV7 A;  3I0T A;  3A8J A;  1Z21 A;  3VNV A;  2L7M P;  3R0A A;  3BH6 B;  2DFF A;  5GAE J;  1RPW A;  4UVA A; 
#chains in the Genus database with same CATH homology
 2XF6 A;  3GBG A;  4BQO A;  4IX7 A;  2Z2S B;  4E7I A;  2WA0 A;  2R7V A;  2XOK A;  2XZP A;  5CQG A;  1WJA A;  1OFL A;  5CQE A;  2PMZ A;  3OYA A;  2JJ1 A;  1OOC A;  2O1D A;  2F4I A;  2WPD A;  1DBO A;  2NTB A;  5CPR B;  1D0Z A;  1V5G A;  2EWE A;  1BLI A;  1GLN A;  1WJC A;  4IZZ A;  4CH7 A;  2JDI A;  4U7B A;  1SFK A;  4BS9 A;  3FPP A;  2KLO A;  2V4J C;  3GVJ A;  3DTK A;  1OGO X;  2GJK A;  2X53 S;  1O88 A;  3OIQ A;  4RLQ A;  5AMV A;  4C2L A;  2CUJ A;  4XM3 A;  4W8S A;  1OB0 A;  2VJ4 A;  2XAU A;  3K4C A;  3OFN A;  1AA7 A;  4HST A;  1E3Z A;  1WFX A;  4E7H A;  2IXS A;  3OYG A;  2D3N A;  2F43 A;  3D5R C;  4XKV A;  3JU4 A;  4P22 A;  2Z6B D;  4Y3O A;  2ZXI A;  2QY1 A;  1GQ8 A;  3CP2 A;  1WP6 A;  3VMW A;  3PNY A;  3OW7 A;  2CV2 A;  2DT7 B;  4E0F A;  3CES A;  4RM2 A;  2VBM A;  4XON A;  4DNT B;  3DDY A;  4CA0 A;  4B3G A;  1QJV A;  2VQC A;  4XNF A;  5FRN A;  1PXZ A;  3PSI A;  3OYM A;  1ZEL A;  4Z03 A;  4CSW A;  1Z7L A;  3HXL A;  4PUS A;  4BDZ A;  1KZL A;  1UEL B;  3S3N A;  5JHF A;  2F6C A;  2V31 A;  4HG2 A;  2DIE A;  2NTQ A;  4KKS A;  2CW8 A;  2LG4 A;  2V7Q A;  3H9Q A;  4YEL A;  4CCO A;  2ZZQ A;  2BSP A;  1O8H A;  3ZPP A;  3BC8 A;  3A3G A;  4F93 B;  1NBM A;  4DNR B;  2M4G A;  2ODL A;  1MMN A;  2O04 A;  5FRM A;  2IS4 A;  4URR A;  2NT6 A;  3SUC A;  4ZTF A;  2R7U A;  3DEE A;  1VBL A;  1UD2 A;  1PYV A;  2WBM A;  4CCN A;  2DJI A;  3OS1 A;  3VR6 A;  4W8R A;  2KMU A;  3UR3 C;  3DKY A;  4XN3 A;  4YEJ A;  1DBG A;  2F5V A;  3A2K A;  5HVQ C;  1N78 A;  1DP3 A;  2WSS A;  4CZC A;  4UZU A;  1KMH A;  1K28 D;  1NG7 A;  5FL7 A;  2W82 A;  3PL8 A;  2IGK A;  2FUG 2;  2Z1D A;  1WJB A;  1V0E A;  3OOC A;  3B8Y A;  3OOU A;  3VSV A;  4TKO B;  3OL4 A;  3GQB A;  2VKD A;  3SEZ A;  3AL0 C;  3AL0 B;  4PJJ A;  1UD5 A;  3HUG B;  1I18 A;  2VJ5 A;  2VQH A;  4OZY A;  1X4O A;  2AQF A;  3A35 A;  3LSM A;  3BH4 A;  2BVM A;  1KTW A;  1D1A A;  4AU7 A;  4AYB A;  3F9K A;  4ZDP A;  1WJF A;  3L2R A;  4ITV A;  4XLC A;  3W2A A;  2NT9 A;  3GVL A;  3LMM A;  2INV A;  3LSI A;  3OS2 A;  4BJT A;  3H9G A;  1BHE A;  4XLF A;  4AVZ A;  2K3P A;  4E7L A;  3ZRG A;  4XKC A;  1QCX A;  4HEA 2;  1MW7 A;  3CJQ B;  4B43 A;  4PFO A;  4XLH A;  1WJ5 A;  3OYB A;  2XSJ C;  3L2U A;  3LMW A;  1IA5 A;  1NG6 A;  3T53 B;  2HVQ A;  1T95 A;  1V5F A;  2CK3 A;  2WY7 Q;  3L2V A;  4G6T B;  3U21 A;  2M4K A;  1T5E A;  2QKL B;  3ONQ A;  2MC4 A;  5LD2 C;  4D9J A;  1OGM X;  3GQ7 A;  4CCL A;  3K4J A;  3PFY A;  4LIU A;  3K4K A;  4N4O B;  2DOA A;  3HAG A;  1HG8 A;  3CMM A;  4XR6 A;  3S8P A;  3ZCO A;  2HU9 A;  3OYF A;  2W4S A;  2X85 A;  4KJZ A;  1O8I A;  1FMV A;  3AKZ A;  1IDJ A;  1EA3 A;  4W8Q A;  1BR4 A;  3ZSC A;  2KZV A;  4JMQ A;  3OYI A;  1OR7 C;  3M1C A;  4HPQ A;  2LY2 A;  3S3M A;  3IAS 2;  3L2Q A;  3ZR8 X;  3W2W A;  2IGO A;  2UVF A;  2QXZ A;  4NC7 A;  2M0M A;  2CFO A;  3FKJ A;  3OEE A;  3MMY B;  5KCM A;  3OYE A;  1X19 A;  4XKB A;  1HVX A;  3K10 A;  2ZZE A;  2K9M A;  2R7S A;  1FMW A;  4BQN A;  2IS6 A;  4CCK A;  2KHM A;  4BE0 A;  4PJN A;  4BGD A;  3D5L A;  4N4N B;  4FET A;  4U87 A;  5TGT A;  4BL0 B;  2ZSH B;  4XL9 A;  4G7W A;  4I84 A;  3VSU A;  1UD3 A;  2M7B A;  2X51 A;  3BG6 A;  1MAB A;  4IKF A;  1JRG A;  2WAE A;  2GOM A;  2ELJ A;  3W2V A;  1PKV A;  2W6J A;  2VQG A;  4ZYA A;  1K6Y A;  1LFP A;  3SDB A;  4F91 B;  4P5O A;  2LBF B;  2VPL A;  2W1O A;  4RMN A;  4G6I A;  2GK7 A;  3OYD A;  3VYT B;  4QPO A;  3EUH C;  3FDY A;  4BE1 A;  3KX2 A;  2L9S A;  3DWL E;  3OYN A;  2UWM A;  4E7Z A;  2ZFU A;  1UAA A;  3SZG A;  2O17 A;  1WJE A;  1P9Q C;  2CV1 A;  4OJO A;  4U49 A;  2KDO A;  1YX3 A;  2VL8 A;  1CZF A;  1X0C A;  3CP8 A;  2CW7 A;  1S9H A;  2A5W A;  2VBK A;  4JOM A;  3RQ4 A;  3PNT A;  2Z16 A;  2XZO A;  1TZL A;  2UVE A;  4GQN A;  3HPG A;  1WJD A;  4HWV A;  2CUZ A;  2VJJ A;  3H5N A;  4YRV A;  4G7X A;  2O0V A;  2LC2 A;  4X0G A;  2CMP A;  4HSR A;  4DGW B;  4J00 A;  1N77 A;  1X1B A;  2INU A;  1SAU A;  1OFM A;  3OR1 C;  2PEC A;  3K4B A;  1KCC A;  4DK1 A;  1X1C A;  2OUM A;  5HOO A;  3DU5 A;  4L8J A;  2V7F A;  3FY3 A;  1LVK A;  3DPL C;  2XF5 A;  3DU6 A;  1QU3 A;  4OZZ A;  1ERD A;  1RU4 A;  2X6W A;  1X1D A;  2JA2 A;  3FHN A;  2HZD A;  2WAQ A;  2D3L A;  4OJP A;  2HNH A;  5CKT A;  2HQA A;  2X1E A;  5CDF A;  1O8G A;  4YZX A;  3G05 A;  2O0W A;  4HNT A;  2Q1Z B;  1Z3Y A;  4XQF A;  1JTA A;  2LRE A;  1D1C A;  3QOD A;  4H4K C;  4ZDO A;  3EPZ A;  4TT3 A;  4GRI A;  3DQV C;  4C9Y A;  2E5N A;  3DTI A;  3LSK A;  1BN8 A;  3IUO A;  4C2T A;  4MXN A;  2MAB A;  3RPU D;  4JQF A;  1JI8 A;  2VLA A;  2R7R A;  5C1C A;  2HVS A;  3K4M A;  2W7N A;  4QPQ A;  4XOP A;  3H5A A;  3OPO A;  4FAS D;  1YX5 A;  3FBN B;  1HA8 A;  2VBE A;  1KON A;  1MMA A;  1T0F C;  3QYB A;  3VYR B;  3JUR A;  1N75 A;  3FBI B;  3ZQQ A;  2MD0 A;  2I8D A;  2UUZ A;  3LL7 A;  1D1B A;  4KIS A;  3TL4 X;  4PMH A;  1UD4 A;  3DPU A;  1V5E A;  4HRI A;  2KL4 A;  3N05 A;  2LOO A;  2Y0S A;  1E43 A;  3VMV A;  1IDK A;  3GQ9 A;  4F3Q A;  3HKZ A;  1UD6 A;  4RLF A;  3OY9 A;  4KKT A;  2RQQ A;  1VF7 A;  3OYK A;  3I9V 2;  2XF7 A;  4PFP A;  2M3A A;  1O8J A;  2M7A A;  1R6R A;  4KIT B;  4KKU A;  4OJ6 A;  2X8K A;  3GQ8 A;  4B47 A;  1AIR A;  4DBQ A;  4ANJ A;  3HL2 A;  2LYC A;  3C2G A;  4DK0 A;  1PE9 A;  2LBF A;  4IQ4 A;  2E1M C;  2CS3 A;  2E1M B;  3OIP A;  4II2 A;  1BOB A;  4BE2 A;  2L2O A;  4F92 B;  3HPH A;  2V4D A;  1IB4 A;  4C30 A;  3T56 B;  3GQA A;  1E79 A;  1D0Y A;  3BLY A;  2VXZ A;  2WB1 A;  3NWT A;  4XOR A;  3NE5 B;  2R7O A;  1LDK B;  3VYS B;  5DN6 A;  2HDW A;  2BVL A;  1G8X A;  3OYL A;  3MKW B;  2WZP P;  2NSP A;  4NK6 A;  3EQN A;  3DKX A;  3HOT A;  3H9J A;  1E0E A;  2HVR A;  4DJA A;  1MMD A;  1U0J A;  5FRO A;  3VSK A;  4ZJZ A;  2JSP A;  2HPM A;  1UG0 A;  1H80 A;  1SKY B;  1BMF A;  2LH9 A;  4KT6 A;  3IAM 2;  4B44 A;  1OHH A;  1XG2 A;  3T9G A;  3TBI A;  3S93 A;  5HLT A;  2R7T A;  2KRH A;  2F1M A;  2NZM A;  1G59 A;  3K70 D;  2V9K A;  3J7A Y;  1NRK A;  1WMR A;  3E1S A;  3HG9 A;  4LIT A;  4BDY A;  1E1R A;  3A3B A;  3ZXS A;  3VWB A;  3ZPN A;  3DPT A;  3MD2 A;  2WY8 Q;  2XC7 A;  1LKX A;  4OWR B;  3KYL A;  1O8M A;  1Y6I A;  4NC8 A;  3LSG A;  2L5Q A;  3QYF A;  3GRH A;  5IK2 A;  4BXF A;  2DT6 A;  3EUK L;  4F52 A;  3V42 A;  1TT0 A;  1W9X A;  2CH0 A;  3PUB A;  1DGW Y;  3QYE A;  1HZE A;  1PJR A;  3B90 A;  2E5Z A;  1J09 A;  3H35 A;  2E60 A;  3B4N A;  2L7K A;  2MYS A;  4NUB A;  4C2U A;  2JUG A;  4HNU A;  4XN0 A;  4DBR A;  1I8D A;  2CV0 A;  3BCA A;  3K70 C;  2RNG A;  5KNL A;  3RSN A;  1RWR A;  1OLT A;  3ZGK A;  4BU2 A;  2JJ2 A;  2BW3 B;  2KP6 A;  4CCJ A;  3G2B A;  3OWT A;  3LNN A;  1W0K A;  3OAA A;  4Y33 A;  4XOT A;  2W00 A;  4Y4R A;  4HIZ A;  4CCM A;  4YXW A;  3OL3 A;  4IQJ A;  4OJ5 A;  4YZQ A;  2R7Q A;  4XMY A;  3VYU B;  4E7S A;  4NQW B;  4BAC A;  2GJR A;  3MKZ A;  3BCB A;  3RCO A;  3LSH A;  4R79 A;  3CZ6 A;  3OR2 C;  4CUG A;  4NK8 A;  2VJI A;  2KPM A;  1EFR A;  2WAF A;  4W8T A;  2VQL A;  3D5S C;  4DOZ A;  2V26 A;  1D0X A;  3VST A;  2NTP A;  1W36 D;  1K5C A;  3CF2 A;  3NWS A;  2VIX A;  1H8E A;  3SYT A;  3BCD A;  1PLU A;  3K6G A;  2O5R A;  1MNE A;  3WQZ A;  1RMG A;  4PJM A;  1DQU A;  2PJR B;  4Z05 A;  2V1N A;  1FX0 A;  4ASU A;  3UW0 A;  3VSL A;  2L9N A;  3OE7 A;  2Z8G A;  2GJP A;  5HNH A;  4J01 A;  3S3O A;  2R7X A;  4ZDL A;  4E7K A;  4Z06 A;  3K4N A;  1V0F A;  2XZL A;  2PYH A;  2X1D A;  3HC7 A;  2KVO A;  1MMG A;  4PSW A;  4Z1M A;  4TSF A;  1QHG A;  3OYH A;  3K4L A;  3M8J A;  2ZZG A;  3ZIA A;  1W36 C;  1O8F A;  3BC9 A;  1O8E A;  4PSX A;  3PNV A;  2ZZF A;  1O8D A;  2PYG A;  5HNF A;  4B3F X;  2KQR A;  4E7J A;  2WAD A;  4B48 A;  1EE6 A;  4B3X A;  3L2W A;  1BR2 A;  3HOS A;  2JVH A;  2QE7 A;  1O8K A;  1Y56 A;  1X4P A;  2VAS A;  2P0W A;  4BEH A;  2QKM B;  2NST A;  2QX3 A;  3EQO A;  3PSF A;  5C1E A;  1WTH D;  2IGM A;  1O8L A;  2JIZ A;  3C2H A;  2XGJ A;  2IGN A;  3S32 A;  1VZ0 A;  3WWG A;  1YE9 A;  2X6X A;  3A4C A;  3OYC A;  3TMO A;  4BQQ A;  4U4B A;  4YZ0 A;  4XLE A;  4DIQ A;  3DTE A;  2XND A;  2ZTN A;  2R9V A;  1QHH D;  2XDV A;  1KCD A;  2VXD A;  4PK4 A;  4BUP A;  4MLO A;  3AFH A;  4RM3 A;  3PJR A;  1BPL A;  2ZSI B;  3LFU A;  1X1A A;  3OYJ A;  2HLD A;  3H94 A;  3H0D A;  1COW A;  2ZXH A;  4XD7 A;  2OC6 A;  4OAY A;  3H5R A;  3BCF A;  2AQE A;  4XKW A;  4P1W A;  3T51 B;  4D1Q A;  3MKY B;  2R7W A;  3FKS A;  3QOE A;  2VKH A;  4OJL A;  1E3X A;  3VDX A;  1UD8 A;  2A6T A;  3OS0 A;  3DLA A;  3EUA A;  1H8H A;  1IRX A;  4FXU A;  3OMY A;  4BJ6 C;  2RRE A;  4MR0 A;  4LG3 A;  2V6E A;  1BR1 A;  2BW3 A;  2E1B A;  2WJV A;  2WJY A;  4E4H A;  4XLA A;  1WPC A;  2W6I A;  3KEW A;  2IQ7 A;  2Q2E B;  2X1C A;  2X6Y A;  2NOJ B;  4II3 A;  5LFA A;  2IS1 A;  1E1Q A;  2LZJ A;  2BOL A;  2R4G A;  2K5C A;  2MFZ A;  1W0J A;  3CJR B;  4E6K G;  4ZTJ A;  2KRC A;  2LY1 A;  1DGR M;  2VB6 A;  4PJL A;  3KEY A;  4F55 A;  2GK6 A;  2M5S A;  1Z3X A;  4BEH B;  5HKK A;  2UV1 A;  4EW9 A;  2LRD A;  3GVK A;  3E0J B;  4ZC3 A;  3BG7 A;  4LIV A;  2IS2 A;  2PJR A;  3UNG C;  3SEQ A;  3KRG A;  2ZTG A;  2DCE A;  3A1Y A;  3I3L A;  2HPI A;  3RTR A;  4NNJ A;  1VJS A;  3IP4 B;  2K9L A;  2GOX B;  3OEH A;  2OV7 A;  2JVG A;  1VLY A;  1MND A;  2X3H A;  1NHC A;  4OAZ A;  4EAT A;  1Z21 A;  5KHD A;  2DXI A;  3W3C A;  4YZA A;  4BJ5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...