2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
3GQ8A 4YZ0A 4AVZA 4YZAA 1RU4A 2O0VA 1O8LA 1DBOA 4W8TA 4Z06A 4OZYA 4XLEA 1BN8A 4W8RA 1CZFA 3FY3A 2X6XA 2NTPA 1KTWA 2IQ7A 3B8YA 4Z05A 4YEJA 2X6YA 3JURA 1NHCA 3EQOA 4XN3A 3EQNA 3VSVA 1WMRA 4XLHA 1O8EA 4XORA 4OJLA 2ODLA 1H80A 2NT6A 4XMYA 4NK8A 1OOCA 4MR0A 3KRGA 2O0WA 2O1DA 2NT9A 1JTAA 1BHEA 2QXZA 4XL9A 2INUA 2NZMA 3VSTA 1RWRA 4MXNA 3VMVA 4OJOA 2X6WA 3UW0A 2QX3A 4NK6A 1QCXA 1O8IA 2VJIA 2VBEA 1OFMA 1QJVA 4XN0A 4W8QA 3VMWA 2VBKA 1O8HA 1EE6A 1PE9A 4XNFA 2NTBA 2X3HA 4W8SA 1O8FA 4U49A 1IA5A 4YZXA 2NTQA 3LMWA 2VBMA 4C2LA 1OFLA 4XKWA 2X85A 2UVFA 1JRGA 1OGMX 3T9GA 1IDKA 1KCDA 1O8JA 4PMHA 1O88A 1IB4A 1O8MA 4XOTA 4OJ5A 4EW9A 4XLFA 2NSPA 2BSPA 1VBLA 1PLUA 2Z8GA 4XQFA 1K5CA 4OJ6A 2PYHA 4Z03A 3B90A 3SUCA 4XM3A 3ZPPA 2O04A 4U4BA 1O8DA 4XLAA 1OGOX 3GQ9A 1RMGA 1PXZA 4I84A 1DBGA 2EWEA 3B4NA 1AIRA 2O17A 2VJJA 2NSTA 3VSUA 4URRA 1KCCA 5C1EA 1O8KA 4XONA 3ZSCA 4XOPA 1HG8A 3GQAA 4XKVA 1O8GA 2PYGA 1X0CA 2INVA 3GRHA 3GQ7A 1GQ8A 4OJPA 5AMVA 2QY1A 4XLCA 4HWVA 4YELA 2PECA 2UVEA 4XR6A 1XG2A 4YZQA 4OZZA 3WWGA 1IDJA 5C1CA
chains in the Genus database with same CATH superfamily
3JRHA 1E3ZA 3L1PA 1SVOA 3RQ4A 2P4WA 1E79A 4AVZA 2BGIA 3PVDA 2DA6A 3T51B 4HF2A 3GQBA 2LF7A 2R4GA 4BPRA 2Z1DA 5E1XA 5E3LA 3ONUA 4EEFG 3B78A 5FKNA 4IXAA 3S1MJ 2QSHX 1GVHA 2DETA 3S1RJ 1A6QA 2DOFA 1TYUA 5J8CA 3HSEA 3T8TA 2R6HA 3Q3SA 3Q3AA 2KPMA 3SDBA 3JURA 2L9SA 3LA3A 2LLKA 2KHMA 2QQBA 4YAFA 3GWZA 4MGRA 2ZXIA 2GXGA 2P7VB 1YS6A 1I18A 3E5UA 2E2IJ 4XN3A 2WSSA 1ETOA 1R22A 1MH3A 2JT1A 3PFYA 3KLOA 1LFUP 1FEXA 4ZCMA 2JN9A 2A5YB 2COBA 2XF7A 4M6VA 5LRRA 4KH3A 1K61A 2ZBVA 3GVAA 1T0FC 2IXSA 3BTIA 3VSLA 2PMHA 2C5HA 3BQZA 3HZJA 4RD1A 3TGNA 5A89A 1B9MA 2EK5A 3K4JA 5BS6A 3VMVA 5IYQA 3J80Z 2CWEA 3DEEA 4DYQA 1TTYA 4A3MJ 2W1OA 2OYNA 1B59A 1EH6A 4P96A 1FBUA 1GXQA 1OB5A 3PFIA 1VQ5B 3FF5A 1X3UA 4R71A 1JKQC 4EGYA 1RQRA 4F91B 3KETA 3N6ZA 3X2QH 1O8HA 4FE4A 1YW9A 3MMPA 2YWEA 4V2FA 2X3HA 3K69A 4W8SA 2KFDA 2WAQA 1QG0A 4FTHA 1ZGWA 4G1BA 1UELB 1G2HA 3I9V2 2X1EA 1FNCA 2OJED 2BV3A 3LQQA 1FLIA 4I7HA 3WG7H 4X1EA 2M45A 3BR6A 1MMNA 4E7SA 4PAAA 1N0UA 4P26A 5TRDA 1JT0A 2ZXHA 4DOZA 3KZYA 3A8KA 3VSKA 2NSPA 3RPQA 1ZTRA 1IB0A 2VFNA 2J8IA 3TMOA 1VQPB 3BZKA 3L09A 4LITA 1M1EB 4C3HJ 4HG2A 2DA7A 2A61A 2R7FA 5FD5A 4DZJA 4G7ZF 2BY0A 4U4BA 4XLAA 2X0KA 3HUGB 3NWTA 2PG4A 4A0YA 2YWHA 2QQAA 4YAUA 1RMGA 2ZXJA 3K4BA 1FPQA 3RKQA 4PABA 2XF6A 2WY7Q 4E7HA 4E7JA 4Z1MA 4DQLA 3OR1C 2M0CA 2VFQA 1ENHA 4AF7A 2EILH 1KK0A 3ZMTA 4CO8A 2DYRH 4A3IJ 2J8KA 2L5QA 2LBFB 5D4RA 1ULYA 2IEKA 3BG9A 5H20A 5FIUA 3F72A 1OLTA 3TW6A 1K6OA 3OYBA 1MDMA 5JFRA 1QFZA 4A93J 2KJCA 1ZYRF 4BQAA 2L7ZA 2ISYA 4CYCA 3J7AO 4MNUA 1SD4A 3HIFA 3QYFA 3F0CA 1YLFA 4N4OB 1KYZA 3NARA 3MKZA 3K70C 2R7TA 1R23A 4XD7A 3OYKA 1NG6A 4OZZA 3I59A 5EEAA 3PUNA 1LDKB 3G6EI 3CPXA 1OISA 2CMPA 3HEFA 2HZTA 3QOPA 1H42A 1W0KA 2DT7B 4P1WA 3TBIA 2CW0F 4IL6C 4IX7A 3ROUA 2A6EF 2L02A 1KJZA 2F5FA 3RKYA 4BUPA 5F0FA 4HIZA 3B73A 3R60A 4M9ZA 1E62A 4MYTA 1W5CC 4N4NB 4BJTA 4YFOA 2ZFUA 2VFPA 4PSXA 2ZBUA 2XAJA 5E6TA 4OPOA 2R7WA 1XTAA 5TGTA 5M5XJ 1HF2A 1Z7LA 2D2WA 4C3IJ 2CRVA 3H94A 3LQEA 4XLHA 1IDZA 1Y1WJ 4XORA 5E8GA 5L3BA 1VTNC 2DQLA 3DLAA 3E6BA 2OTJI 4NCNA 2FRHA 2H8WA 4N3GA 1QNTA 1I27A 3SLDA 1XMXA 1SFUA 2O0WA 1ZLJA 1CF7A 5CQEA 2JVGA 3I5UA 1GV5A 2HTSA 3LSPA 5HNFA 5FLVA 3V8JA 3Q38A 4CA0A 3P26A 1PJ5A 2VOOA 4XK4A 4L5JA 3HRTA 1V0EA 2X6WA 5FFZA 3ASRA 2MD0A 4TN1A 4OJOA 3UW0A 1NTCA 1I3AA 4Y3OA 2F48A 4U88A 4PC6A 1O8IA 4G1VA 2IAIA 2ISZA 4A3KJ 3W2HA 4A3JJ 5B6IA 2AHOA 4LLGF 1WOPA 5KAFC 4U9UA 2XTXA 1KQ8A 2G7UA 2JPCA 2VUMJ 1K6YA 4BHPA 4O5VA 2EA2A 4XNFA 5IY5H 1BW5A 3QP5A 3OOPA 2JTVA 1X1DA 2KRFA 2W00A 4LLNA 4YEIA 3KEQA 3ZOBA 5IT9K 4TMWA 3LMWA 1Z67A 4HPQA 2CS3A 3CQZJ 3A35A 2QM3A 3W5UA 2BHYA 3SZPA 1FTTA 2FA5A 5D8LB 4HNUA 3RZOJ 3EUHC 1PDNC 4Z4ZA 1N75A 4ZGQB 1Q7YD 3D5SC 2PLFA 2L2OA 2VC1A 1FNDA 4Y7CA 3OYGA 4OJ5A 4D9JA 3VDXA 3OSFA 2LYCA 2HKXA 4RJLA 2VNJA 5JBQA 1POGA 1ZRFA 4FWTA 2F2EA 2DJNA 1GLNA 2LF8A 1K4TA 2PYHA 5FFXA 1PP7U 4BH9A 4LLLA 3SUCA 1D3YA 1YOVB 1K4ZA 4HDUA 1O8DA 2XPWA 2DO7A 4P3YA 2QVOA 2A3SA 4HF1A 3G73A 1V4RA 2YX7A 3LNQA 1FP2A 4B48A 1W7PB 1BL0A 1ETQA 4QVJA 2X51A 3MEXA 3LAPA 1P7IA 1VQOI 2JPBA 5HZAA 1FWZA 1KC8D 2ID6A 3PO3J 3JRGA 1T95A 3K4LA 3CP2A 3LNNA 1LPQA 4ZDOA 1BI3A 2HYJA 4PC1A 3GFLA 3S8PA 1KK3A 2DCUA 5F04A 3FBIB 5F6FA 1D0ZA 4L5IA 4RAFA 1MH4A 4UHTA 1USTA 3V7CA 1OR7C 4RB2C 5IT9Z 4B43A 2E1CA 4AVPA 4L5EA 1MRZA 2DMTA 2HXOA 1QPMA 4A5MA 5JR3A 2A5WA 2LOOA 4NUBA 3CB4A 1HKTA 3WQZA 1OQYA 2DA4A 1FJLA 5M3MJ 1YITB 3I4PA 4HAMA 2HDCA 1DPUA 2PE3A 2NOGA 3WTZA 1LLWA 3HDDA 4BJ6C 4CCNA 5H6RA 1S29A 5HVQC 1T56A 5C44J 2XGCA 2CUFA 4OMYA 2M30A 5GAGJ 1F9NA 2XASA 4KMUX 4RB3C 5GTIC 2B7BA 3OSGA 2YSRA 4LG3A 4RGSA 1R4MB 3ZN0A 3IKTA 4KKTA 1NHCA 3J81Z 2VQLA 2W85A 3FK6A 3QPLA 5IPAA 1FTZA 3EQNA 1DGWY 4AC0A 3C7JA 5ED4A 3KCCA 2XNCA 3VYSB 4BXXJ 2OUMA 3H9QA 1YRNA 3J81k 1HW5A 4QV2A 4A6EA 1HXDA 1ZHFA 4FE7A 4JX4A 1BC8C 4X05A 1QVUA 3WE3A 2JUGA 3O6BB 4R79A 4HV6A 3A8IA 4YDTA 1ZN2A 1JJ8C 4J01A 4ZTFA 4E6KG 5K7ZA 2O5RA 2VQCA 3TL4X 1VFCA 1A35A 4BEHB 2DIEA 1WQ2A 4M74A 2G0EA 3LAJA 2V7WA 3W5VA 3GTOJ 4EM2A 2CV0A 3S2DJ 4M4SA 1EE6A 2IT0A 3HPGA 1YW8A 1K28D 3CC7I 1TWCJ 3WBJA 2KIFA 1ETYA 3CCVI 3DF8A 1IUYA 3E6CC 2KRHA 1QA2A 2XC7A 1JTYA 1YE9A 1EP2B 1KQ0A 4IHSA 1BOAA 2I10A 1JRGA 3OYNA 4RAYA 3H9NA 2NAZA 4ABZA 2PMZA 4CH7A 1SVLA 3PO2J 2V4JC 2EJRA 5EDNA 3S17J 1HOMA 4PMHA 5D6FA 1IJFA 2X1DA 3A2KA 2EFWA 1H89C 2O03A 2LK2A 3QAHA 2VNKA 1QGPA 1XB2A 2VZLA 2JA8J 2BM6A 2F1LA 4GFBA 1H8EA 3GFJA 3PL8A 2WV0A 2CU7A 3FXOA 4OMZA 1CNEA 2W24A 3JW4A 3WTYC 5FKLA 4Y52J 1BPLA 1EJ9A 3PUMA 4WQMA 4FX4A 3BH6B 1R1TA 2NVYJ 2ME6A 3U21A 3ABKH 1V5GA 4PC3A 3WXMA 2DFEA 3I71A 1B9NA 2E1MC 3HOTA 4HLXA 2VNIA 2FE3A 2EIXA 3V7SA 3S3NA 1G3WA 1BA5A 3LSKA 5BQTA 4YAOA 2O9LA 3D26A 1I39A 2W57A 2HWVA 1MGTA 2FX3A 1IN4A 1IDJA 1O8LA 2F5EA 2RQPA 2PJPA 3F8MA 2FD5A 2CC2A 2EBIA 2WAEA 2WZNA 1UHWA 3FMSA 3FKSA 4KISA 2WBMA 5A8AA 3OWTA 4P9SA 3PA1A 5DV5A 1EP1B 4OIOF 4ZJZA 1JHFA 1TWFJ 1MBFA 1BMFA 2ZMEA 4QSHA 2A68F 4IKFA 4YFKF 4QTRA 4ASNA 3AG1H 1S72B 4ZYEA 1VQ4B 2OZUA 3ASSA 1SFEA 3QQAA 3AK5A 1BR4A 2QLZA 2R7QA 1UFMA 1WI9A 5L3FA 4DK0A 2HOTA 4G7HF 2G9WA 2A6HF 5FKMA 1VQKB 2PEXA 2XKPA 2WJVA 1T6SA 1IN8A 1X1CA 1I1GA 4XIDA 2LKPA 5C4JJ 4KKSA 1CGPA 3HHGA 3SXYA 2R7UA 1WGXA 2B7EA 3CCEI 3ZQ7A 1T6ZA 2MLGA 4C2MJ 4FQGA 1Z9CA 1WXRA 2HOEA 5EGOA 5J40A 3F8CA 2EZIA 1QUFA 1WORA 3BJOA 5B66C 1I5ZA 3CDIA 2OCCH 3WHBA 4P9UA 5FNZA 1XS9A 1UMQA 4AF6A 1Y0UA 4A3EJ 2QX3A 4J19A 4WX9A 5B1AH 4LC0A 3D0SA 2QMUA 3M7GA 4RDLA 1H9GA 2LFBA 1ZGAA 2LC2A 2BXZA 2WV1A 4YIIA 5LEKA 2VBEA 2L3DA 1BW6A 3W5HA 1LQ1A 2OTLB 1SKYB 1J2XA 5D5WB 2WYRA 4M3EA 1A04A 1F60A 4E7KA 1DABA 2E5ZA 2M5WA 2E2HJ 2E1MB 5LHGA 2NVQJ 4H9GA 4U49A 3H9JA 4YZXA 1EFCA 2M8EA 1P9QC 4W1UA 1O3SA 4RS8A 2CQXA 1J75A 2XNDA 1YI2B 1Z6RA 2FBIA 4C2LA 3C2HA 3H5NA 4B09A 3BG3A 2NVUB 2QZAA 4V2GA 2BYVE 1OGMX 1H9TA 4F3QA 1YX5A 5DDGA 1P4MA 5L3CA 2WAQN 1TYWA 1PP8F 3SHFA 4AD9A 3E1SA 1HBXG 2ECBA 1ZREA 1ZGJA 1VQNB 1VQ7I 1R58A 1K5CA 4FISA 1FX7A 4JOMA 3BR0A 3OL3A 4Q4ZF 1HVXA 1QZYA 3BTCA 3M8EA 2RQQA 2L7KA 1DP3A 3OP1A 2FMLA 4ZGNB 2P3MA 3I1FA 2C5BA 1Q82D 2HCJB 1R49A 1O7LA 1Z0XA 2Y2ZA 4I02A 2R5YB 1W9XA 3R6KA 2DAOA 3MHPA 3OJWA 3ZBUA 4EQQA 1GDTA 5LGTA 3TO9A 1G3YA 1VQ9B 4CXFA 1QGYA 3M8FA 1WTHD 3GO5A 1YIOA 1IHMA 1WPCA 2VXZA 1E3PA 2HKOA 3FBNB 3GSIA 4CHUA 1B23P 2RDPA 3CLQA 4LJZF 5DUKA 4CSWA 3WTSC 1YJWI 2BM5A 2M9HA 4S04A 5BOXA 1TNSA 2BPOA 4QHYA 2RVCA 3AGPA 3DV8A 4P1VA 1QRCA 3CO7C 4A3FJ 4PC7A 1XMKA 3E0JB 1EFUA 4OPVA 2XDVA 1RU4A 1W5TA 4K1XA 3C3WA 4IHXA 3PSZA 1JGGA 3SY2A 2PFBA 4Y7NJ 2WPDA 4ZCLA 2VNHA 1KQ5A 3CD6I 1G7CA 2OD5A 4X0CA 3R6JA 2ZTGA 2AHQA 1KU9A 4MTDA 4X0GA 4Y4RA 2HLDA 3CTAA 3FY3A 2V1UA 5H5JA 3DU5A 4E0FA 4V19K 1P4XA 2IQ7A 4GO1A 4Q5SF 3ONYA 4OP7A 3TOBA 3GLLA 3LSGA 3M9AA 3V7AA 1LM1A 1JHHA 3LOCA 3RZDJ 4FXUA 2E35A 3IRQA 4TMXA 2VKHA 5HNHA 4U0VA 1GAWA 2QTZA 5LRSA 3ASPA 2BVLA 4LK0F 3E1YE 1N08A 2I8DA 3RIQA 4Q7JB 1HKQA 1FT9A 1J09A 1P7JA 1U6GA 5E1WA 4Z4RA 4U0WA 2LNBA 3HJEA 3HPHA 2BY3A 2ZJQF 2C6YA 5IYWA 2MFZA 4NHJA 3K70D 1S9HA 2IS4A 5J3OA 4G6DA 5FO0A 2YR2A 1R5ID 5DCFA 1D8KA 4II2A 1FC3A 2DMQA 2RNGA 2DYSH 2XV4S 4HNVA 1CNFA 1OHHA 4OM9A 2V7UA 4PDKA 1R5OA 4XN0A 3K2ZA 2HQRA 2P5KA 4BKXA 2K86A 3K4KA 1BX0A 2CF4A 2XT2A 3RSNA 3Q0VA 2BM7A 5CLSA 1GVDA 2QYOA 3A02A 4FETA 2M7AA 1ZR2A 4DK1A 5F4MA 3OFNA 1KGSA 1QUEA 4ZCIA 2HOSA 1IG7A 3CCMB 3WODF 2BOLA 3G4SB 3S1NJ 5D5XB 3ZIAA 4HE5A 1FBSA 2C4UA 1AMOA 1W7PD 2VXDA 5L3GA 4M6YA 3NAUA 3UNGC 2GLOA 1VQ6I 1JA0A 2D1VA 1G3TA 3T5XA 1PLUA 3H5RA 2EQRA 4Z03A 4XRSG 1Z21A 2YS9A 4EJUA 4B47A 1YIJI 4BBSJ 1QGAA 4IEJA 3UKGA 3ASNH 3ERMA 3GZ6A 1B72A 2IBDA 2STWA 2VODA 1B6AA 2UXXA 1EA3A 4PJLA 1ERDA 3VYUB 1JUPA 4D5CA 4A12A 1YYVA 4LMYA 3PNYA 5F1JA 1F36A 2CO5A 3OS1A 2VT3A 3VO1A 1WVRA 4CCMA 2PX9A 1Y39A 5LGUA 3OZWA 4DYRA 1O8KA 3WU0A 2GWRA 4Q47A 2JRMA 2L0KA 4HOBA 2NNYA 2YU9J 4E70A 3HRMA 4LIVA 3A01A 2INVA 3VFZA 3FWEA 2VBUA 2VBWA 2DFIA 3W6JB 4FN5A 3QFSA 3DEUA 1YJNB 1P2FA 2JA2A 4NC8A 1RR8C 2JQ7A 2KP6A 3SZGA 3MZYA 1I50J 3G71I 5LD2C 3SDGA 1F1ZA 3K4MA 2DT6A 2CNDA 1XGSA 1MBHA 2P0WA 3U1KA 2R7SA 3U6BA 4R8HA 3OW7A 3PNVA 4NNJA 3WBKA 1MW7A 1X3WB 3ESWB 3LWFA 4AIDA 3GF2A 3BR5A 2R7ZJ 4BE1A 3K4NA 2GXBA 2DDAA 1UG2A 3ISPA 3RDIA 2ACJA 3HHHA 1S7OA 3P9KA 2F5VA 1B4AA 2A05A 2XHKA 1LFBA 3G05A 2VC0A 3QPHA 4EJWA 3GTMJ 2ZCWA 3BPXA 2X8KA 3U1DA 2O3FA 1FIPA 4O3MA 1O8EA 3E6MA 4OIPF 4RDJA 2DK5A 2NT6A 1CQXA 4NK8A 2CJJA 1Z7UA 4G6QA 2BM0A 2YUSA 4AIHA 1JKPC 1KQSB 4M3GA 4MXNA 2G0YA 2RC5A 3PSIA 1FP1D 4BDZA 1TL8A 2UWMA 3I55B 2R7RA 4JBAA 3NEUA 2XRNA 2VT2A 3Q6RA 2Z33A 1J59A 1VQ8B 2V9PA 4MHGA 5E18F 4AM3A 3DTIA 3MN2A 1N8RD 5FLXK 1OFMA 2VPRA 5F27A 1MSEC 1SMTA 3EUAA 3TQNA 1Z1DA 4GYIA 5JVGF 1M1KD 1FY7A 3I53A 1PE9A 3DLLF 2Y9YA 2DA5A 5EG0A 3S15J 1O8FA 1GHCA 3K10A 2XGJA 2P5LC 2V5IA 2VI6A 3CCRI 3CXCB 3FMRA 2MLKA 2W6IA 3G3ZA 1HLVA 3ECOA 4E4HA 1TP4A 2L4AA 1K7AA 1E3XA 2G7HA 2QEXB 5JLXA 1O8JA 3ASOH 1KQ9A 3H92A 3TDUC 1JGSA 3S1QJ 3CC2I 2D45A 3TEDA 1G7TA 2BN4A 1YHQB 4B3FX 3DP7A 3H3UA 4XQFA 3OYIA 2R7VA 2NRAC 4Z4UA 2H94A 1QHGA 2JSCA 1USSA 1R5GA 2LREA 2PMUA 2XF5A 5JLWA 3WYAA 3DKXA 2V4DA 2KIMA 1XGMA 3B02A 1GUUA 2PMZN 2FOKA 2DMUA 3DBLB 2IGOA 4LG0A 1VF7A 3COAC 3MD2A 3REOA 3LSRA 3V8KA 3WTTC 2LKSA 3S14J 4ZC3A 1OFCX 2O17A 1RQPA 1OGIA 3CF2A 2JVHA 3JQPA 4AUXA 2UV1A 4C0SA 1T08B 2JJ1A 2VIXA 2M87A 5FLXZ 3ZQGA 4WXDA 1SD7A 5FJ8J 1N78A 3B82A 4RD3A 2N8GA 4HWVA 3AFHA 2K9SA 1UB9A 3FPKA 2MH2A 3VMFA 3NAWA 3W2AA 4OWRB 5THXA 2HGCA 1KZLA 2M0MA 2ZXWH 4RA2A 3H35A 1QRYA 1V3FA 1WJAA 2DPDA 1A36A 1EF4A 2V1XA 4EMSA 2VPLA 1DDGA 4QUZA 3S93A 4RD4A 1GV2A 2QA4I 3N90A 2JA5J 1W87A 5AONA 3HAGA 1EP3B 2D9RA 2DODA 3F21A 4M3FA 3GTLJ 2H1LA 3IKVA 1TW2A 3DQVC 4ENMA 5CDFA 2R93J 4OZYA 5HODA 5GPCA 4N9HA 4D0PA 1YS7A 2CV1A 3BT9A 3AVYA 1CQTA 1CZFA 4RD6A 1LJ9A 2EZHA 5DCMA 1OMIA 3ZQLA 1MDMB 4PC2A 1G6NA 2XB0X 4CYCB 3ZQCA 1WJDA 1RC9A 2VKVA 2WR8A 2QUFA 2VFOA 4IRIA 3EETA 2L54A 1AWCA 2Y30A 1GR1A 2ADUA 5JHUA 4ENNA 2ICWG 2Y31A 1PJ7A 4H0EA 4LBVA 3A0HC 5DS9A 2VJ5A 1H88C 1X58A 1QVGB 1DUXC 2CUZA 3LFKA 2NZMA 2WB1N 2OCEA 4UY8I 1N07A 2HS5A 3P4GA 2XB5A 4JQFA 1W34A 4ZYGA 4CCOA 3LL7A 1HA3A 4PCQA 1SAXA 4GXOA 1JI8A 3L2UA 3M8JA 1OCPA 3VYTB 2ELJA 1O4XA 5LEJA 2DFFA 3VEPA 4L8JA 3H9GA 4P9FA 3MKWB 4N0BA 1RESA 5JVTA 1DU6A 2XT4A 5CJ9A 2E5NA 2LDUA 4F92B 5IP9J 4IOCF 1EA0A 1T2KA 1ELOA 3L9FA 5E3NA 2CSOA 3CESA 2NXNB 3K1NA 5D5UB 2D5VA 4P22A 1KONA 2HVQA 2PBIA 2OBRA 1Z77A 3S3OA 2CGPA 4WZEA 1YFHA 1CF7B 1RUNA 2EIMH 3V76A 4RB1A 4G6TB 3DDYA 4L0ZB 2XGEA 4ZYDA 3BCDA 1YW7A 1QA3A 1MD0A 2HQNA 2JRTA 2HTJA 4JK1X 3DEWA 4B3XA 2H6CA 2E19A 1U9OA 3HOSA 5J35A 3ASTA 3JCUC 1ON2A 1N25A 5IYNA 4QVAA 2L9NA 2Z5UA 2ZSIB 3IC7A 4P12A 3W2WA 2M2EA 1J7KA 2AQFA 4YIRX 4OINF 1KU2A 2FOWA 1QQ1A 3KYCB 1Z3XA 4XKBA 4IW3B 2V9VA 4IQ4A 4M73A 3TKYA 1K83J 4OPWA 4I76A 2V31A 1L1IA 3JREA 1R71A 1KCCA 1EH7A 1PUFA 2KISA 5FRMA 2NPFA 2DA3A 1VQLI 4UAJA 1DDNA 2FNPA 3MWMA 4A0XA 3MFKA 1TYXA 2ZITA 3G6EB 4F93B 1BC7C 1XDUA 4PGOA 2GQFA 1SD6A 2V6EA 4KMFA 3ES9A 1XG2A 1RPWA 4G7WA 3E5XA 1QO0D 3QYEA 2VN2A 3FXLA 1X3ZB 1ODDA 4KN7X 3OOUA 3OY9A 5K7FA 2ZNZA 1RUOA 5IYDJ 1D0YA 3S3MA 5KCMA 2EV5A 4TMTA 4HW0A 2Y0SA 4CCJA 1WJCA 2W4SA 3FMQA 4PGHA 4XLPF 2W25A 3BR2A 3WU1B 1TZLA 1E1QA 1AOYA 4ZDLA 2Z6BD 3AVTA 1VZ0A 3OL4A 3WTWC 1KD1D 2Q6KA 2RREA 1K79A 2H09A 1YJ9I 3RYPA 2XAUA 2A07F 2OTJB 4NQWA 5FLMJ 2Y48A 4FX0A 2ECCA 3FKIJ 2X6YA 3PNTA 3PQKA 5J1YA 1XE1A 1SFKA 2NOJB 3O8GA 3HGGA 5IT3A 4WXCA 5L46A 1RETA 2F3LA 3BTJA 4RDUA 2IPQX 4HX4A 3TW7A 2LD5A 2DOAA 3KEWA 4LBZA 2BBYA 4RLFA 4Z4TA 1OOCA 2QE7A 4HBLA 2DERA 2NT9A 4EVIA 5J1UA 4G9YA 3G2BA 1E1RA 2Z99A 2R0QC 5ICEA 4PFPA 1SFOJ 2KIQA 4M3DA 4BACA 4P6VF 1B8IA 4NK6A 5KK1A 2J5OA 3HTSB 1QCXA 5GAEJ 3KEYA 5ILUA 2ZJRF 2KIUA 1SKQA 4MYUA 1F20A 2VJIA 1SFXA 2IVMA 3SQVA 1ZM3A 2ZC2A 3HRUA 2M7BA 3CCLB 1OCOH 3CCUI 3OYJA 1X1PA 1YO5C 1V5VA 3VO2A 3AGQA 4UZEA 3IRRA 5LBQA 2KMUA 4RAZA 2UXNA 2C2WA 1WOSA 5K5RA 3MKYB 4M2LA 3TP0A 4UUVA 2C78A 1MBGA 1YRNB 2EFPA 1Y0YA 2HNHA 1MMGA 1I8DA 4ACBA 5KHDA 2DXIA 4OIQF 1FRQA 1J5YA 1TQIA 3D5RC 5HS8A 1FSHA 3I56B 2YU3A 2ZNYA 3C1DA 1AHDP 2XRLA 4EW9A 4CDGA 2HI3A 1VNDA 3CMYA 3H09A 2XAQA 1QPIA 2BZTA 3PETA 4G12A 4FASD 2E34A 5DYMA 3AG3H 3FHZA 1UD6A 2E71A 1OCCH 2K7LA 2IS1A 1AA7A 5J4YA 1VQOB 3EDPA 2DJIA 2ZMEC 3ZQHA 3DXJF 1JKOC 1G59A 2CQQA 4RB0A 1T39A 2VKEA 2BE5F 2GQQA 1QA6A 4GRIA 3FIWA 3LSJA 4MFDA 2OBSA 4HX8A 1V0FA 2UUZA 3GFMA 1U5TA 3H3ZA 2TDXA 3ZR8X 3GYHX 3CCJI 3OZVA 3CCQI 4XOPA 3Q0UA 4BHBA 4A3LJ 4XKVA 3VNVA 4RGRA 1XQBA 2WTEA 3CW2A 3JRBA 3OAAA 2QZ8A 4TMVA 3K6GA 2OBTA 5AMVA 4YELA 5E20A 1VHEA 4WWVA 1S4MA 5CPRB 1LVKA 4OOXA 1T6YA 1WZ2A 1ZG5A 1B1BA 1KYWA 4I98B 3VPRA 1LLZA 1N05A 3OIPA 4RGXA 2PMDA 1MNDA 1R5BA 1WRJA 2IGKA 2EFGA 1TT0A 1ZH5A 4DGWB 2O0VA 1Z91A 4CGZA 4EV0A 2JJ7A 3L2VA 3SEJA 1IC8A 2H27A 4JRAC 1ZQ3P 2OZ6A 4A0ZA 3WHCA 4X7FA 1HW1A 4G6IA 4ZZDA 4Z06A 1NK2P 1ETWA 5ILVA 3BPVA 1XFOA 2ZTNA 2EPFA 2KQRA 5GV8A 3AG4H 2PJRA 4HQMA 1S7EA 2AO9A 3GUDA 2LSOA 3KP2A 5K7HA 1ORKA 1XSXA 5FROA 3N97A 3B8YA 2M8GX 1MNEA 1MNMC 2K9LA 2XGXA 2GA2A 3B6AA 2HYFA 2GJPA 1D1BA 2BY2A 2V1NA 5AIPA 3A3BA 1LVAA 4BHCA 2WJYA 4B4CA 1U2WA 4M71A 2VFMA 1WWXA 4AU7A 1IJWC 3LVBA 4M9SA 2QENA 4MEYF 3BQYA 3BZ6A 1COWA 1OGJA 1EH8A 4I99C 4LBYA 1WFXA 5CVRA 1BBYA 4IOAF 3GCMA 1IRZA 3DPTA 2DCEA 3H36A 3VSTA 3D5LA 2TCTA 2QGGA 1BR1A 3CMAI 2OF7A 3QOEA 4HQEA 4RMNA 4L18B 1Y6IA 1YI2I 3OYEA 4LIUA 2ZMEB 2JZYA 1K78A 1OYIA 3CC7B 3U9GA 5J3LA 4G7XA 2DLLA 3CCVB 1OB0A 2HPMA 3IH3A 4LBWA 4BY7J 2WB1A 3K9TA 5DD4A 1FOXA 1G7RA 4AYBA 1RNLA 1W35A 1IAWA 2XAFA 1ETXA 2FXAA 3RPUD 3VODA 3GVKA 3OYAA 1IA5A 4E7IA 4LB5A 2O6GE 3IWFA 3W6VA 2RV8A 4WF2A 4V02C 2DK8A 1P4AA 2VBMA 1H85A 2MC3A 3CDHA 2VBTA 3AVWA 1FX0A 2VQHA 4UVCA 5M5WJ 2IGMA 2BVNA 5EGOB 2FNAA 4B44A 1XDSA 2TRTA 3A1PA 3BR1A 3OYHA 5E1ZB 3AAFA 3W2GA 4UB6C 3T9GA 2K3FA 2VLAA 4E7LA 3KL9A 1D8JA 4RCZA 1O8MA 1OPCA 4II3A 2XC1A 2Q0OA 3DCFA 3HKZA 3PIPF 2K9QA 2BEOA 2VBVA 1QFJA 2GIZA 4DNCA 1KRHA 2KDOA 3QPTA 1L3LA 3KIOA 3I4MJ 1W2BB 3DFGA 4PUSA 3PQJA 1U8RA 4FT8A 3J7YJ 4WZKA 4GGGA 1A8PA 1PXZA 3PIOF 1OYYA 1LE8A 1SANA 2P7CB 2MYSA 4TT3A 1MZBA 1WH5A 4D1QA 2XZPA 5DSZA 3H1CA 3JRDA 2MG4A 4NBQA 5F64A 4A6DA 5EZHA 1JXSA 4GQNA 3VSUA 3WGIA 4N9IA 3IAM2 1R7JA 3V8LA 4UV9A 2JUCA 2L9RA 3OIQA 1QRBA 1XMAA 1X0CA 4A3DJ 2WY8Q 4X7DA 2QY1A 2QQ9A 2X4HA 3OE7A 2PECA 1IGNA 4BNCA 3CC4I 1IXRC 2DA2A 3SLNA 1TT5B 4TSFA 3BCFA 4C2TA 3GQ8A 3QODA 1F4KA 3SKBA 2NS7A 3KP3A 1R6RA 4UXNA 3CRZA 1ON1A 3TDZC 2FBHA 5IYCJ 1X1BA 2XZLA 1VQMI 2B5OA 2QTLA 5EEHA 5FO5A 3MVPA 3DWLE 4P5OA 1FBQA 5JMCB 2STTA 2EV0A 3T56B 1BJKA 1BN8A 4IQJA 2BGCA 2IW5A 2VE8A 3BJ6A 4BXUA 2GIVA 4HRIA 5BNGA 3JRIA 3VR6A 4L9NA 1TQMA 1XN7A 1RIOH 4JMQA 3ZN1A 2PLYA 4P25A 4ZV4A 3HM5A 4Y17A 3AL0C 4KIGA 4BGDA 4A5NA 4DBQA 1GJRA 4OAYA 4C43A 5A2QK 4ROXA 1J9IA 1PJRA 3T1BA 4Z4SA 3G1MA 2OK7A 3BC9A 1TLHB 4NB5A 1O3TA 1HDDC 2DMNA 2BY1A 3HXLA 4BQOA 2BX6A 4CICA 3LSHA 1FNMA 3QE2A 1JTAA 4XL9A 2DI3A 1LKXA 4KJZA 3JR9A 3L2CA 3IH2A 1UHSA 1V55H 1UG0A 1V5FA 1NHAA 2MH9A 2NNNA 1MMAA 5D8KB 2H8RA 1E63A 5H59A 2FQ3A 1U2RA 1NG7A 1OCZH 1U9NA 1VHOA 4RDKA 4U7DA 2X48A 2AQEA 3CMEI 1UD8A 4X06A 3ZUGA 3ABTA 3FXUA 5LMZA 3HGYA 2Q2EB 3GFIA 3VMWA 1S6LA 2VBKA 3NB2A 2X9DA 3B8HA 1FZPB 5FGMA 1JB9A 5FO1A 2GZWA 1FYMA 1ZM4A 1OJLA 3A4CA 1EWYA 3P7NA 1D5YA 1JJ2B 2FJ1A 3BG7A 2DPUA 4XKWA 1LEBA 2WZPP 2WAFA 2EH3A 1VQ7B 1BJAA 3LSMA 2DW4A 3CCSB 2AXLA 5TY0A 1KCDA 2Q8KA 3LYCA 2ZL7A 4CZZA 1W36C 3GBGA 1Z3YA 4MQVA 2XVCA 2IS6A 2Q6LA 4X6AJ 4BE2A 4ETSA 2EIKH 1S5LC 1I1SA 1UAAA 5E8IA 4G5GA 2H1KA 4IVNA 2IA1A 3BOQA 3DTKA 3HB9A 2ESNA 3JSOA 4OU0A 3Q9SA 4XM3A 1AIPA 1OB2A 2O04A 3ABLH 2CUJA 5AIQA 3F22A 2DTZA 3RIRA 5FRNA 1LDJA 4ACAA 3KPHA 1Z6TA 1SMYF 1REPC 2K5CA 5DTDA 1AKHA 4WWCA 1RKWA 2LMDA 3B4NA 1XG1A 4QPOA 2KLOA 1XPXA 2OU2A 1YJWB 2GK6A 3PSSA 2F1MA 1PJ6A 2BW3A 3AL0B 3GQAA 1BM9A 3IH4A 5JHFA 3MAJA 2PYGA 5HDKA 3DBHB 1CLWA 2CH0A 2LZJA 4CZCA 3CUQA 1LB2A 3E20A 2F5CA 1NDHA 4YZQA 1QZEA 4B3GA 3SJMA 3ZMUA 4MTEA 4F55A 2XTYA 1B72B 2V7VA 1T5EA 2ZKZA 5GPAA 1JTXA 1X19A 3SFIA 5J8FA 4RM3A 1E0EA 4UZFA 3A8JA 3OV8A 1Y0RA 2ZZEA 4PGGA 2R5ZA 2QBYA 1ZM2A 3GLXA 4I0BA 2X6OA 1KU7A 2WC2A 4E7ZA 2R92J 3CPWB 3HOUJ 4KN4X 4HE6A 4Z6YA 5GTHC 2YPRA 4HV5A 3EQLF 1G8XA 3R61A 3SFZA 1WKMA 1KTVA 2X53S 3MZ8A 1FMWA 1TQPA 3A01B 2IOUG 2JA7J 2HXIA 2P5VA 2QDXA 5HS9A 2Y0SN 4AIKA 3OYMA 1QGZA 1VI0A 2FBKA 4S05A 3RTRA 3OEEA 2DOEA 3KEOA 2XUBA 4IRGA 5HLTA 1WMRA 4XSXF 5BSXA 1P6RA 4RCYA 3SZEA 3F8FA 2XGDA 4XMYA 5FKOA 2EIJH 5JI6A 3L2WA 2JIZA 3TOAA 3GMEA 4UUSA 3HL2A 3KRGA 1DPRA 1XC5A 2FEZA 2LP0A 1DDIA 4WZLA 4DQ2A 4MLOA 2O61A 2DN0A 1RWRA 3LQ6A 2F4IA 1M90D 2DA1A 3CJTB 3W2FA 2IJLA 1IZ1A 2MD5A 1JA1A 1MJ9A 2CW5A 5D6EA 3L2QA 2QF7A 3OYLA 1G7SA 2QKMB 3I4NJ 3OOCA 2JSPA 2LY9A 5HLHA 2CFXA 1ZELA 5LLQA 3I64A 4X07A 3OPOA 3KP7A 5F4OA 1UD3A 1Y8RB 3FDYA 1VQ5I 4P3IA 3H0GJ 3QU3A 3KYDB 1VQ6B 3ZQIA 2DTRA 5H6QA 1LFPA 3IV5A 1ZK8A 2H6BA 2WADA 2AS5F 3L2RA 1R4NB 3M3YJ 4P6YA 5DS0A 2F43A 1IDKA 5CVVA 2GOMA 3J80K 2FVGA 1IRGA 4DW6A 1SM4A 1D8TA 4XLFA 3CDLA 2NS8A 1FYKA 3OKXA 3EYIA 1JE8A 1D5VA 1IUFA 1DG1G 4KDPA 1QA1A 3E7LA 4M1KA 2ZBKA 1F5TA 3BNWA 3GZ5A 2GAUA 2QSGX 5EF6A 2K3PA 2PQ8A 3CCYA 3RYRA 3GQ9A 3JAMK 1ZG1A 1JT6A 3ZMSA 4YIFA 5EG0B 3ASQA 1XCBA 5HOOA 1VQPI 4I01A 4D5FA 4Y33A 5DEQA 1HW2A 2GK7A 3QP6A 3ELKA 3BWGA 3WNBA 1S7AA 3BDDA 3MMYB 1R5NA 3NQOA 1JKRC 3ABUA 2VBXA 2KL4A 3G71B 2ZZQA 3I54A 1WSRA 2BF4A 2OQGA 4HSRA 4PK4A 4BL0B 4Y15A 2KKOA 5J47A 3ERED 1LEAA 3S2WA 2OAZA 5A88A 4J0QA 3SYJA 3RI4A 1NB9A 1R5HA 3FZVA 1Z05A 3FXMA 1X2NA 2NYXA 4KT5C 1BIBA 2EWNA 5C1CA 4YCQA 5ICCA 1BI1A 2VBSA 5F0CA 4NBSA 5FL7A 3U6KA 2BMWA 4GDFA 3QU6A 4HDVA 5BMZA 1RKTA 2J7KA 2K9MA 1DBOA 1K8FA 3D1NI 4X8IA 3PM1A 4LG0B 4W8TA 3RKWA 1MMDA 2OK8A 4TV7A 3BQJA 3NWSA 4XKCA 4XLEA 3RPUA 1TYVA 2CV2A 3WY9A 1QHHD 2AXTC 4LD5A 4IHVA 2X6XA 2NTPA 2ZZGA 1KTWA 5C1EA 2KVOA 2X1CA 2HZDA 3OYDA 5EJCA 4Q48A 4PJ0C 3ML6A 4A69C 3EQOA 2JWTA 1S8NA 2VJ4A 1TWAJ 3FHNA 1N0VC 3JAMZ 3W3CA 1YLOA 3QRFF 1HZEA 3FXKA 4U87A 3HBLA 3FPPA 1RRJA 3PENA 4RM0A 5AN9A 3ML3A 5FB2A 4A3BJ 3A0BC 4L9JA 5CVUA 1Q1VA 2O0YA 3GIRA 3F6VA 1MBKA 1GO2A 4CQJA 2VOPA 3KLNA 4P2NA 1TWHJ 5C4XJ 2XIGA 1I6HJ 2DOGA 2GJKA 1OCTC 2LG4A 1HF0A 5GP9A 3Q9VA 3WGHA 2V9KA 2GREA 2BVMA 4RLZA 1Q9SA 5JLVC 3EUKL 1BJZA 1FRNA 3SZTA 3O3KA 4FHTA 3JRAA 1KU3A 2Y9ZA 5DCMB 3GTKJ 3CCRB 2Q6OA 2M3AA 4W8QA 3E3VA 5BPIA 3HUGA 3PJRA 2LRDA 2NTBA 2XPUA 2E1BA 1SVMA 1BI2A 2CFOA 5HZBA 5B5EC 1U0JA 4JP0A 3WTXC 4JX6A 1IW7F 3I59B 4K2EA 1VJSA 4C2UA 4UUTA 1OFDA 3CC2B 2OPTA 2BM1A 2LBFA 1ZARA 2ZZFA 2X85A 4OAZA 3GVJA 5HLIA 1FSEA 1VLYA 4Y13A 3BC8A 3KP4A 5IK2A 3DTEA 4AYBN 2ETHA 3FXRA 4RPDA 3RY8A 2ZJPF 5M5YJ 3HG9A 4O6JA 5J1RA 1T0FA 1WH7A 4LB6B 2ELHA 2IGNA 4ZYHA 1WPKA 2YX4A 1KK1A 1VF9A 3B6CA 2DBBA 3KZIC 2UZKA 1NJID 2Z8GA 5IP7J 4B4DA 3F3XA 4IHWA 3LSTA 2C77A 2HMAA 3TO7A 1KZHA 1E2XA 1HSTA 4UNOA 3V7RA 5CYVA 1NB0A 2CQKA 2L4MA 3QPSA 2GOXB 3IUOA 1QH0A 2YUHA 3V4GA 2V26A 2E1NA 2OC6A 4XLNF 3F6OA 4RPBA 1D2EA 3HKZN 4BU2A 4ENKA 2EB7A 2RNJA 3F23A 3ZC3A 2ELKA 2VBYA 2GPJA 3HRSA 3HYIA 4M3BA 3VNUA 2ME0A 2HPIA 1HG8A 2LVSA 3HC7A 1QBJA 1QFYA 2CUEA 3M1CA 1ETKA 2OBPA 3RKXA 2QN6A 2C4TA 3HSFA 1WJ5A 5L3EA 2W48A 2NVXJ 1AU7A 3GQ7A 1XSVA 1ZRCA 2E36A 2QA4B 2DT5A 4C9YA 1Y8QB 1YG2A 4XR6A 4DZPA 1BIAA 2R7XA 5HDGA 3HOYJ 1MBJA 2HDNB 2W7NA 2CW7A 5E17F 1BHEA 3W2EA 4KUMA 1ZG3A 1BN5A 4ENJA 3M1EA 4DNRB 1WJBA 2EFOA 2MW8A 3E5QA 5EEGA 2FQ4A 9ANTA 2KJBA 1I3QJ 2JA6J 2Z9OA 3HOWJ 3ABMH 1WJEA 3OJXA 5TJJA 1I7PA 4DJAA 5IYRA 2ZO4A 3R4KA 1HQCA 1W0JA 2DEUA 1FOYA 3K2AA 3DKWA 1PUFB 2MC4A 1P4WA 1MSFC 4N3NA 4YXWA 4ASUA 2CRGA 4JYKA 1FMVA 2QCOA 1XCVA 2LY1A 1HKSA 2B0LA 1YITI 3S2HJ 5EMNA 1E17A 3GXOA 4ESJA 4Y9RA 2P8TA 2GBYA 3AKZA 4X7CA 4RD2A 3OS2A 2ZL5A 5DM7F 4I6ZA 2FMYA 2VQGA 4I2OA 3SJZA 3LA7A 5B1BH 1E3HA 1Q1HA 3S16J 2VE9A 1H80A 2CQNA 2CG4A 3UR3C 2ODLA 3QYBA 4MR0A 1W5SA 1N77A 4RD0A 1YX2A 3CJRB 3CCLI 3GTPJ 1Q86D 2IA2A 3JTHA 2O6WA 2A6TA 2MA3A 3OZUA 2HOAA 4WXHA 1IRXA 2QXZA 2VB6A 1Y56A 2F6CA 4IHTA 3KP5A 2PI0A 1FOWA 3H5AA 1UCRA 2DMPA 1EKEA 1I6XA 5B3SH 5EYRA 4BJ5C 1WOOA 3K4CA 2J5PA 4B3AA 4C3JJ 1W0UA 6PAXA 1LUJB 4L9VA 3JSPA 3G1LA 4ZZLA 2VL8A 1FNBA 1X4PA 4NQWB 5HS7A 3I56I 3QFCA 1QJVA 1TSPA 1S3JA 3ZXSA 4JX5A 1WU8A 3BH7B 1SD5A 3C2BA 4HF0A 2RGVA 1U5TC 2V1DA 3CLOA 3J81K 3BY2A 1GAQA 2M34A 4MIMA 1C0WA 2JJ2A 1K8AD 5J4VA 1XSDA 3LSIA 2KT0A 1HDPA 1W7PA 1TUIA 1JJ6C 3P9CA 4QFMA 4BQQA 2QSFX 2UVFA 5CVIA 3MZHA 3ZMDA 5TR9A 4GYGA 3DKYA 4A3CJ 4OOSA 1IV6A 1V5EA 1HCRA 5KSWB 3FM3A 4XOTA 4Z4VA 3ZP5A 4ON0A 1OCRH 1W0TA 2PIAA 3DU6A 4UB8C 1PYVA 3EPZA 4PFOA 3WE2A 1B8IB 1VBLA 3SJPA 3RQIA 3OYCA 3VWBA 5CKTA 1TNTA 2M1BA 1T6XA 3R0JA 5ICGA 1R1VA 4M53A 3LO8A 3ZPPA 1KMHA 3OIOA 4M6XA 3BH4A 2Z2SB 1VQLB 3WTVC 4CCKA 2FF4A 4L9TA 1J9ZA 4L0YB 3OS0A 1ZR4A 4I84A 1BOBA 1J0RA 1DBGA 1DGRM 1AIRA 5FKKA 4X7EA 3OW2B 2EZKA 2KZGA 1IN7A 4FCYA 2V6CA 2K02A 2YWFA 4HLYA 3H0DA 4U7BA 1BLIA 1G3SA 3ZQQA 1RI7A 4LOCA 1UMKA 5ICFA 1PVEA 1OYWA 3GRHA 1TWGJ 2WWYA 3DBRB 4R1HA 2DFHA 2RC4A 2UVEA 4CCLA 3CUOA 3GEZA 1MJAA 2NS0A 1H0MA 2HQAA 4UVAA 3EUHA 3ZZUA 1E3OC 2MABA 3C18A 4YFNF 4XICA 3T53B 2VBZA 3QFRA 4YZAA 1APLC 5E3MA 1YJ9B 2XAGA 2NVTJ 4EATA 1R9TJ 3JRFA 2E60A 3CP8A 4M72A 5L3DA 4YG2F 1W36D 4DBRA 3PUFA 4HNTA 1WSVA 4W8RA 2D74A 2HFHA 1U5TB 4OPSA 3A3GA 2FX0A 1ONVA 4BEHA 3V42A 5DNSA 1MABA 2OV7A 4HZFA 2OQRA 1SAUA 4QPQA 2LY2A 4Z05A 1WHUA 2E7XA 4MEXF 2B63J 3R0AA 3WNCA 3WG9A 3FXJA 3IP4B 4IRHA 3JQQA 2QYUA 4KFCA 4BDYA 4ZYAA 3VB2A 5F4JA 2K27A 1S72I 2XSDC 1VQ4I 2ZSHB 4UVBA 5GADJ 3MQ0A 3F8BA 5IYPA 5H2FC 3FJOA 3ZRGA 2EFNA 2E1OA 4NC6A 1QVFB 4DYCA 4WCGA 2O1DA 1K9MD 1VQKI 2NV4A 3CF5F 2INUA 1U78A 1KK2A 1OR7A 5TISC 3QFTA 1MBEA 2K4BA 2W82A 4KA4A 1O57A 3CCUB 3DPUA 2COMA 1ETVA 1XD7A 2XZOA 5DUIA 2VYQA 2PJRB 3BCBA 4AC9A 2F4OB 2GA1A 1TLLA 1DARA 4CUGA 1TC3C 4IJAA 1UHMA 5KW9A 4RBOA 2LR8A 1WI3A 1W4MA 5BPDA 4M9XA 1FNNA 3LJYA 2BV6A 4G7OF 1QQIA 3K1PA 1O3QA 3Q6QA 2RN7A 4QWQA 3P5JA 1E64A 1XGOA 3HSRA 2NTQA 3O8HA 1TW3A 3W2VA 2RAEA 3SEZA 4EJOA 3AVXA 2I5UA 3DPLC 2XOKA 2HYGD 2D3NA 2OTLI 3Q39A 2EFQA 2M4KA 3A1YA 4RGUA 1H8HA 2EV6A 3ZGKA 3WTUC 1HC8A 2XKOA 1UJ8A 1DQUA 2WA0A 2XTWA 4RLQA 5E3OA 1Y1VJ 3ZQFA 2Z3YA 3BCAA 1K78B 2EZLA 2M4GA 4ESBA 3Q5FA 3BTLA 3DU1X 3QWLA 2R3SA 1IXCA 3BY6A 1ZRDA 3CCJB 2JN6A 2L9VA 4A3GJ 4EM1A 2DDBA 2IRFG 3CCQB 2ID3A 1EV7A 4ZH4F 1VQNI 5F1RA 4IPAA 4YRVA 2MBFA 1BR2A 4FK8A 2KDZA 3N4MA 2RKHA 2VJJA 4BS9A 5HLGA 5GV7A 3F9KA 2L7FP 2OA4A 2DQRA 2BXYA 4EGZA 4URRA 2ZFWA 4HEA2 3HOVJ 3GZNB 1O8GA 1HA8A 4J00A 1HSJA 4B8XA 5F0HA 2HVRA 3AVUA 3IL2A 2P81A 2FU4A 4WZTA 1D1CA 4XLCA 5KVRA 5K5QA 2V7QA 4OJPA 2Y69H 3LQRA 5FD6A 2XAHA 3K0LA 1RZ4A 2K40A 4QIWN 1K73D 5IOZA 1VQ9I 3GTJJ 2PN6A 3WGGA 1MKMA 3KE2A 2Y75A 2KZVA 2L7MP 2W84A 2R7OA 1D1AA 4ESFA 3CO6C 1N06A 3ZPLA 3ZCOA 3MKLA 2V7FA 1WP6A 4I09A 1TVCA 1LE8B 2F5DA 3U2QA 1O7FA 3JQRA 3BP8A 5HKKA 3BLYA 3LA2A 1BI0A 1R00A 3ECHA 3JTGA 1XB4A 2DU9A 3I3LA 4XBFA 5LHIA 4EH1A 2Y0MA 1U8BA 3ZBTA 5DD8A 4QLCU 3BZCA 3I58A 4KIFA 4YHBA 3R6SA 1W1WE 4F7DA 4ANJA 4OOVA 4YEJA 1YTYA 4U0YA 1ZUNB 1OKRA 3W6KB 1IJEA 1NRKA 2I1LA 1V54H 5IOYA 3RJPA 4A2UA 1BX1A 3OEHA 5K1YA 1TTTA 2BHZA 3J7ZI 3ULQB 1ZM9A 2VKDA 4KICA 1EFRA 4HA8A 1FYLA 4XRFA 4BYYA 3CMAB 2ESHA 2X3UA 2D3LA 4DQKA 4BAYA 1KA8A 3SYTA 1YX3A 2BM4A 4HX7A 2VONA 2IP2A 2V79A 2X0LA 3IHUA 1Q81D 2CYYA 5HXBA 5D4SA 3LFUA 1STZA 3H3VK 2XNJA 2HDDA 5HDNA 3FK7A 3AG2H 1UD5A 2CBXA 5LHHA 1QU3A 2V7XA 3FISA 3CCSI 4Y9UA 4IF4A 4KIBA 4OIRF 3CCEB 3BROA 3J7AY 3RCOA 2V7TA 1NK3P 1SC7A 5CVJA 5LGNA 3M4OJ 4LFUA 2O7OA 4MQ9F 2R5YA 4IZZA 5KAIC 3IWZA 5LFAA 1Y0NA 3OR2C 2RC6A 4YC5A 4DNTB 3WNDA 1R36A 3CUQC 2EA4A 4BBRJ 3KFWX 3LMMA 3VOEA 1OFLA 3CZ6A 2P6TA 2R9VA 4UZUA 4YAWA 3ZZTA 1JUMA 3KZZA 3PSFA 4MFEA 4RM2A 3JU4A 1S0UA 1O88A 1IB4A 2XROA 3CCMI 4G94A 2ZJ2A 1SEUA 4OJ6A 3G4SI 3B90A 1D1NA 5J6XA 4HSTA 2B9SA 2K4JA 1WDTA 1OGOX 1JUSA 4ZTJA 1A5JA 4M0LA 1IN5A 1ITYA 3MCAA 1XGNA 3SEQA 3P9IA 3WU2C 4EM0B 4F7ZA 1L0OC 1IO2A 4ITVA 1BQEA 1EFTA 3ZMZA 3ZZ0A 1OFEA 1WCMJ 4G8XA 4W97A 4PZJA 3OMYA 4PJMA 2EWEA 2NSTA 1WSUA 4EJTA 3JX8A 5IYBJ 2E1RA 1D0XA 3NRVA 1XX5A 1LDDA 3GX4X 3A03A 4XONA 4F52A 3HOZJ 3CC4B 4Z4WA 2ZL6A 1VLOA 3T8RA 2CQ7A 2P6SA 4KYWA 1MMSA 1IRFA 1GXPA 2Q2EA 2VASA 4GCVA 2QGUA 5K5OA 4XRSA 2JMWA 2QQ8A 3ZPNA 1VQMB 2CW8A 3L00A 3WWGA 2HU9A 4S0HB 5A2QZ 1PUEE 1QVTA 2EINH 4YZ0A 2BGJA 4LGWA 5ERIA 5CQGA 5TV2A 4ZDPA 1YJNI 1T8IA 3C2GA 3FX3A 2E2JJ 4TKOB 1DP7P 4BE0A 3BY1A 2M5SA 5KNLA 3NE5B 1T33A 1AKHB 1X4OA 4KKUA 4D7NA 4H4KC 2W7ZA 1IDYA 2E7WA 4IO9F 3GW2A 3ZMVA 1QZZA 3N05A 3Q0WA 2W6JA 4MO7A 3P27A 1TBXA 2K85A 2Q6IA 2BW3B 2XEXA 2FSWA 4NDLA 2L01A 2LH9A 4UV8A 3GTQJ 2DY1A 4YALA 1IF1A 3CUQB 1LNWA 3FXQA 2GXAA 3VSVA 5BSYA 4PSWA 1UD4A 2FUG2 2Q1ZB 3KP6A 4P55A 2GM4A 3HOXJ 1JNYA 2HEOA 1PKVA 4OJLA 1H8AC 3KYLA 5E79C 4KITB 1UZCA 4HYEA 3S32A 3TO6A 3E6DA 3U2RA 3JRCA 4Z2YA 1MIJA 1X1AA 1U3EM 5F08A 3OYFA 3K7AJ 2HDWA 2HR3A 2R5ZB 3CMEB 2QBYB 2F4MB 3CJNA 4DIQA 3TP3A 4TMZA 1IN6A 2R7DA 2O8KA 4PJNA 1MJBA 1O3RA 2JK3A 4Z4YA 2LKXA 4C30A 3W2IA 3CD6B 5FA6A 5GAHJ 3FKJA 2D1HA 2ZB9A 3ISXA 2IS2A 1B2RA 2DYIA 1P92A 1G4DA 2MSYA 3BG6A 1T98A 4LK1F 3F8NA 1UD2A 3ONQA 2QKLB 4CYDA 4KT6A 3I55I 1K4SA 4BXFA 1EZGA 2A69F 4EJVA 1VQ8I 2BSAA 2CK3A 1WJFA 4AWXB 3AVVA 1A6IA 3G1OA 3L7WA 2F4NA 1GT0C 1F43A 1FIAA 3EYYA 3I0TA 1FOKA 3BG5A 1QX4A 4UUSB 4I0AA 4YFXF 2O8XA 3CJQB 3IAS2 4OOIA 3FM5A 4AIJA 5IP6A 4NC7A 1IV8A 3M07A 4PJJA 4XRMA 5D5VB 2MGQA 3PA2A 1YQAA 3O2PE 2BSPA 2IA0A 1ACIA 3CMMA 3SQNA 1RR7A 1ZAOA 4D7MA 2QEXI 5DM6F 2GJRA 2YWGA 2HQ5A 2K9NA 1DU0A 1ZLKA 1FDRA 2B7CA 1GVJA 1E43A 1YHQI 2QWWA 3T0YA 1NH3A 3VYRB 1NBMA 5DN6A 2B0RA 2KRCA 3QSYA 4BY1J 5M3FJ 3BJAA 3PUBA 1ZKGA 3E97A 4XSZF 4BQNA 1T38A 1X2MA 2Z16A 3ZSCA 2LTPA 1YIJB 1R1UA 2XPVA 5EZGA 3HTUA 3K1MA 2JDIA 3GVLA 2XSJC 1IXSB 1GQ8A 3BR3A 5ILSA 4RAGA 4IHYA 4KNYA 1EXMA 3MCZA 1A31A 3KX2A 5C3EJ 3GTGJ 4B1RA 3TH0A 4WK8F 2HVSA
chains in the Genus database with same CATH topology
1E3ZA 3OIPA 3RQ4A 1E79A 4AVZA 3T51B 1MNDA 3E0JB 1WJBA 3GQBA 2IGKA 2R4GA 1TT0A 2XDVA 4DNRB 2Z1DA 4DGWB 1RU4A 2O0VA 3L2VA 1WJEA 2WPDA 4Z06A 4G6IA 2ZTNA 4DJAA 2KQRA 1W0JA 2ZTGA 2PJRA 4X0GA 2KPMA 4Y4RA 2MC4A 3SDBA 2HLDA 2L9SA 4YXWA 4ASUA 5FROA 3DU5A 4E0FA 3B8YA 2KHMA 1FMVA 2IQ7A 3FY3A 1MNEA 2K9LA 2LY1A 2ZXIA 2GJPA 1D1BA 1I18A 3JURA 3LSGA 4FXUA 2V1NA 4XN3A 2WSSA 3AKZA 2VKHA 3A3BA 2WJYA 3OS2A 5HNHA 2VQGA 3PFYA 4AU7A 2ODLA 1H80A 2BVLA 2XF7A 3UR3C 1COWA 2I8DA 3QYBA 4MR0A 1WFXA 1T0FC 2IXSA 3VSLA 1N77A 3CJRB 1J09A 3DPTA 2DCEA 2QXZA 2A6TA 3VSTA 3D5LA 3K4JA 3VMVA 1IRXA 1BR1A 2VB6A 1Y56A 3HPHA 2F6CA 3DEEA 3QOEA 2W1OA 4RMNA 3H5AA 2MFZA 1Y6IA 3OYEA 2IS4A 3K70D 1S9HA 4LIUA 4BJ5C 3K4CA 4G7XA 4II2A 2RNGA 2HPMA 1OB0A 1OHHA 2VL8A 4F91B 1X4PA 4NQWB 2WB1A 1QJVA 4XN0A 3ZXSA 4AYBA 1O8HA 3RPUD 3GVKA 2X3HA 4W8SA 2WAQA 2JJ2A 3K4KA 3OYAA 1IA5A 4E7IA 3RSNA 3LSIA 1UELB 4FETA 3I9V2 2M7AA 4DK1A 2VBMA 2X1EA 4BQQA 2UVFA 3OFNA 1FX0A 2VQHA 2IGMA 4B44A 2BOLA 3DKYA 1MMNA 4E7SA 3OYHA 3T9GA 3ZIAA 2VLAA 4E7LA 2ZXHA 1V5EA 4DOZA 1O8MA 4II3A 4XOTA 2VXDA 3UNGC 3VSKA 2NSPA 3HKZA 3DU6A 1PYVA 3EPZA 4PFOA 1PLUA 1VBLA 3H5RA 3TMOA 3OYCA 2KDOA 3VWBA 1Z21A 4LITA 5CKTA 4B47A 4HG2A 4Z03A 3ZPPA 4PJLA 1EA3A 4XLAA 4PUSA 1ERDA 4U4BA 3VYUB 1KMHA 3BH4A 2Z2SB 3HUGB 3NWTA 4CCKA 1RMGA 1PXZA 3K4BA 3PNYA 3OS1A 3OS0A 2XF6A 2WY7Q 1BOBA 4E7HA 2MYSA 4E7JA 3OR1C 4D1QA 1DGRM 4CCMA 4TT3A 1AIRA 1DBGA 2XZPA 4GQNA 3H0DA 3VSUA 4U7BA 2L5QA 2LBFB 1BLIA 1O8KA 3ZQQA 3IAM2 1OLTA 3OIQA 3OYBA 1X0CA 2INVA 4LIVA 3GRHA 2WY8Q 3K70C 3QYFA 3MKZA 4N4OB 2QY1A 2R7TA 3OE7A 2PECA 2JA2A 2UVEA 4NC8A 4CCLA 4XD7A 3OYKA 1NG6A 2KP6A 3SZGA 5LD2C 4OZZA 2HQAA 4TSFA 3K4MA 2DT6A 2MABA 4C2TA 3BCFA 3GQ8A 1LDKB 2P0WA 3QODA 2R7SA 3T53B 2CMPA 4YZAA 1R6RA 1W0KA 3PNVA 4NNJA 3OW7A 1MW7A 2DT7B 1X1BA 4P1WA 3TBIA 2XZLA 4EATA 4IX7A 4BE1A 3K4NA 2E60A 3CP8A 3DWLE 4P5OA 4BUPA 1W36D 4HIZA 3T56B 1BN8A 4DBRA 4IQJA 4HNTA 4W8RA 4N4NB 4BJTA 3A3GA 2ZFUA 4BEHA 4HRIA 4PSXA 3V42A 2F5VA 1MABA 2OV7A 3VR6A 1SAUA 4QPQA 2LY2A 3G05A 4Z05A 2R7WA 3IP4B 5TGTA 4JMQA 4BDYA 4ZYAA 3AL0C 2X8KA 1Z7LA 3H94A 4BGDA 4XLHA 4DBQA 1O8EA 4XORA 2ZSHB 4OAYA 3DLAA 1PJRA 2NT6A 3BC9A 4NK8A 3ZRGA 2O0WA 3HXLA 4BQOA 2O1DA 5CQEA 2JVGA 3LSHA 1JTAA 4XL9A 5HNFA 2INUA 1LKXA 4KJZA 4MXNA 3PSIA 4BDZA 2UWMA 4CA0A 1V0EA 4OJOA 1UG0A 1V5FA 2W82A 2X6WA 2MD0A 3UW0A 2R7RA 1MMAA 3DPUA 4Y3OA 2XZOA 1O8IA 2PJRB 3BCBA 1NG7A 3DTIA 2AQEA 4CUGA 1UD8A 1OFMA 3EUAA 1K6YA 2Q2EB 3VMWA 2VBKA 1PE9A 4XNFA 1O8FA 1X1DA 3K10A 2XGJA 2W00A 2NTQA 3LMWA 3A4CA 3W2VA 3SEZA 4HPQA 2CS3A 3BG7A 3DPLC 2XOKA 2D3NA 3A35A 4XKWA 2WZPP 2WAFA 2W6IA 4E4HA 2M4KA 3LSMA 3A1YA 1E3XA 4HNUA 1KCDA 1H8HA 1O8JA 3EUHC 3ZGKA 1N75A 1W36C 3D5SC 1Z3YA 3GBGA 2L2OA 1DQUA 2WA0A 3OYGA 4RLQA 4D9JA 2IS6A 3VDXA 4BE2A 4OJ5A 2LYCA 4B3FX 3BCAA 4XQFA 1GLNA 3OYIA 2M4GA 2R7VA 1UAAA 2PYHA 1QHGA 2LREA 2XF5A 3SUCA 3DTKA 3DKXA 2V4DA 4XM3A 2O04A 1O8DA 2CUJA 5FRNA 2IGOA 1VF7A 2K5CA 3MD2A 4YRVA 1BR2A 3B4NA 4ZC3A 4B48A 2VJJA 2O17A 4QPOA 2KLOA 4BS9A 2X51A 3F9KA 2GK6A 3CF2A 4URRA 2JVHA 2F1MA 4HEA2 2BW3A 3AL0B 3GQAA 1O8GA 5JHFA 2UV1A 1HA8A 4J00A 2PYGA 4I84A 2JJ1A 2VIXA 1T95A 3K4LA 3CP2A 2HVRA 2CH0A 4ZDOA 2LZJA 1N78A 4CZCA 3LNNA 1D1CA 4XLCA 2V7QA 3AFHA 4HWVA 3S8PA 4OJPA 3FBIB 1D0ZA 4YZQA 4B3GA 3W2AA 4OWRB 1KZLA 2M0MA 1OR7C 3H35A 4B43A 4F55A 1WJAA 2KZVA 1T5EA 2R7OA 1X19A 2VPLA 1D1AA 4RM3A 1E0EA 3S93A 2A5WA 2LOOA 4NUBA 3ZCOA 2ZZEA 3HAGA 3WQZA 2V7FA 1WP6A 5HKKA 4E7ZA 4OZYA 3DQVC 5CDFA 3BLYA 4BJ6C 4CCNA 5HVQC 3I3LA 2CV1A 1HZEA 1CZFA 1G8XA 2X53S 4ANJA 1FMWA 4YEJA 4LG3A 4KKTA 1WJDA 1NRKA 1NHCA 3OEEA 3OYMA 2VQLA 3EQNA 3RTRA 3OEHA 1DGWY 5HLTA 1WMRA 2VKDA 1EFRA 3VYSB 4XMYA 2D3LA 2OUMA 3H9QA 3L2WA 2JIZA 3HL2A 3KRGA 3SYTA 1YX3A 2VJ5A 2CUZA 4MLOA 2NZMA 1RWRA 3LFUA 2JUGA 2F4IA 4R79A 4JQFA 4CCOA 4J01A 4ZTFA 3LL7A 4E6KG 1UD5A 2O5RA 1QU3A 1JI8A 2VQCA 3TL4X 3L2QA 3M8JA 3OYLA 3VYTB 4BEHB 2ELJA 3L2UA 2DIEA 4L8JA 2QKMB 3H9GA 3OOCA 3MKWB 2JSPA 3J7AY 3RCOA 2CV0A 1EE6A 1ZELA 2E5NA 4F92B 3OPOA 3HPGA 1K28D 1UD3A 3FDYA 4IZZA 5LFAA 3CESA 2KRHA 3OR2C 4P22A 2XC7A 1YE9A 4DNTB 1KONA 2HVQA 1OFLA 3LMMA 1LFPA 3S3OA 3CZ6A 3OYNA 1JRGA 2WADA 2R9VA 3L2RA 4UZUA 4RM2A 3PSFA 2PMZA 4CH7A 2F43A 1IDKA 4G6TB 2GOMA 2V4JC 3JU4A 1O88A 3DDYA 4PMHA 1IB4A 3BCDA 4XLFA 2X1DA 3A2KA 4B3XA 3HOSA 4OJ6A 3B90A 2L9NA 2ZSIB 4HSTA 3W2WA 2AQFA 1H8EA 1OGOX 4ZTJA 2K3PA 3GQ9A 3PL8A 1Z3XA 3SEQA 4ITVA 4XKBA 5HOOA 1BPLA 4Y33A 4IQ4A 2EWEA 2GK7A 3OMYA 4PJMA 2NSTA 2V31A 3MMYB 1D0XA 1KCCA 3U21A 1V5GA 4XONA 4F52A 5FRMA 2KL4A 2E1MC 3HOTA 2ZZQA 4HSRA 3S3NA 4PK4A 4BL0B 4F93B 3LSKA 2VASA 2V6EA 1XG2A 3ZPNA 2CW8A 4G7WA 3QYEA 3WWGA 2HU9A 1IDJA 1O8LA 5C1CA 3OOUA 4YZ0A 3OY9A 2WAEA 1D0YA 5CQGA 5FL7A 4ZDPA 3FKSA 4KISA 3C2GA 2WBMA 3S3MA 4TKOB 5KCMA 2K9MA 1DBOA 3OWTA 4BE0A 2M5SA 5KNLA 3NE5B 2Y0SA 4CCJA 1WJCA 2W4SA 4KKUA 1X4OA 4W8TA 4ZJZA 1MMDA 4H4KC 1BMFA 1TZLA 1E1QA 3NWSA 4XKCA 4XLEA 4ZDLA 2Z6BD 3N05A 4IKFA 1VZ0A 3OL4A 2W6JA 2RREA 2CV2A 1QHHD 2BW3B 2XAUA 2X6XA 2NTPA 2ZZGA 1KTWA 2KVOA 2X1CA 1BR4A 2R7QA 2HZDA 2LH9A 3OYDA 2X6YA 3PNTA 1SFKA 2NOJB 4DK0A 3EQOA 3FHNA 2VJ4A 3VSVA 4PSWA 3W3CA 2WJVA 1X1CA 1UD4A 4KKSA 2FUG2 2Q1ZB 4OJLA 1PKVA 2DOAA 4U87A 2R7UA 4RLFA 3KYLA 3FPPA 3KEWA 4KITB 3S32A 2QE7A 1OOCA 2NT9A 1X1AA 3OYFA 3G2BA 1E1RA 2HDWA 4PFPA 4DIQA 2GJKA 4BACA 2LG4A 2QX3A 4PJNA 4NK6A 2V9KA 2BVMA 4C30A 1QCXA 2LC2A 3KEYA 3EUKL 3FKJA 2VJIA 2VBEA 2IS2A 3BG6A 2M3AA 4W8QA 1UD2A 2M7BA 2QKLB 3ONQA 4KT6A 3PJRA 2LRDA 4BXFA 1SKYB 2E1BA 3OYJA 2NTBA 2CFOA 4E7KA 2E5ZA 4U49A 2E1MB 1U0JA 2CK3A 3H9JA 1WJFA 2KMUA 4YZXA 1VJSA 1P9QC 3MKYB 4C2UA 4Z1MA 2XNDA 4C2LA 2ZZFA 2LBFA 3C2HA 2X85A 4OAZA 3GVJA 2HNHA 3H5NA 1MMGA 1VLYA 1I8DA 3BC8A 3CJQB 5KHDA 2DXIA 5IK2A 3DTEA 3IAS2 1OGMX 3D5RC 4F3QA 1YX5A 4NC7A 4PJJA 4EW9A 3HG9A 3E1SA 2IGNA 2BSPA 2Z8GA 3CMMA 1K5CA 4JOMA 3OL3A 4FASD 2GJRA 1HVXA 1DP3A 2RQQA 2L7KA 1UD6A 2IS1A 1E43A 1AA7A 2DJIA 2GOXB 3IUOA 3VYRB 1G59A 1NBMA 5DN6A 2V26A 2W7NA 2OC6A 2KRCA 1W9XA 4GRIA 3PUBA 4BU2A 1V0FA 2UUZA 4BQNA 2Z16A 3ZR8X 5C1EA 3ZSCA 4XOPA 2HPIA 1HG8A 3HC7A 4XKVA 3M1CA 1WTHD 1WPCA 1WJ5A 2VXZA 2JDIA 3FBNB 3GVLA 3OAAA 2XSJC 3GQ7A 3K6GA 1GQ8A 5AMVA 4YELA 4CSWA 4C9YA 3KX2A 4XR6A 2R7XA 5CPRB 1LVKA 2CW7A 2HVSA 1BHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ8 A;  4YZ0 A;  4AVZ A;  4YZA A;  1RU4 A;  2O0V A;  1O8L A;  1DBO A;  4W8T A;  4Z06 A;  4OZY A;  4XLE A;  1BN8 A;  4W8R A;  1CZF A;  3FY3 A;  2X6X A;  2NTP A;  1KTW A;  2IQ7 A;  3B8Y A;  4Z05 A;  4YEJ A;  2X6Y A;  3JUR A;  1NHC A;  3EQO A;  4XN3 A;  3EQN A;  3VSV A;  1WMR A;  4XLH A;  1O8E A;  4XOR A;  4OJL A;  2ODL A;  1H80 A;  2NT6 A;  4XMY A;  4NK8 A;  1OOC A;  4MR0 A;  3KRG A;  2O0W A;  2O1D A;  2NT9 A;  1JTA A;  1BHE A;  2QXZ A;  4XL9 A;  2INU A;  2NZM A;  3VST A;  1RWR A;  4MXN A;  3VMV A;  4OJO A;  2X6W A;  3UW0 A;  2QX3 A;  4NK6 A;  1QCX A;  1O8I A;  2VJI A;  2VBE A;  1OFM A;  1QJV A;  4XN0 A;  4W8Q A;  3VMW A;  2VBK A;  1O8H A;  1EE6 A;  1PE9 A;  4XNF A;  2NTB A;  2X3H A;  4W8S A;  1O8F A;  4U49 A;  1IA5 A;  4YZX A;  2NTQ A;  3LMW A;  2VBM A;  4C2L A;  1OFL A;  4XKW A;  2X85 A;  2UVF A;  1JRG A;  1OGM X;  3T9G A;  1IDK A;  1KCD A;  1O8J A;  4PMH A;  1O88 A;  1IB4 A;  1O8M A;  4XOT A;  4OJ5 A;  4EW9 A;  4XLF A;  2NSP A;  2BSP A;  1VBL A;  1PLU A;  2Z8G A;  4XQF A;  1K5C A;  4OJ6 A;  2PYH A;  4Z03 A;  3B90 A;  3SUC A;  4XM3 A;  3ZPP A;  2O04 A;  4U4B A;  1O8D A;  4XLA A;  1OGO X;  3GQ9 A;  1RMG A;  1PXZ A;  4I84 A;  1DBG A;  2EWE A;  3B4N A;  1AIR A;  2O17 A;  2VJJ A;  2NST A;  3VSU A;  4URR A;  1KCC A;  5C1E A;  1O8K A;  4XON A;  3ZSC A;  4XOP A;  1HG8 A;  3GQA A;  4XKV A;  1O8G A;  2PYG A;  1X0C A;  2INV A;  3GRH A;  3GQ7 A;  1GQ8 A;  4OJP A;  5AMV A;  2QY1 A;  4XLC A;  4HWV A;  4YEL A;  2PEC A;  2UVE A;  4XR6 A;  1XG2 A;  4YZQ A;  4OZZ A;  3WWG A;  1IDJ A;  5C1C A; 
#chains in the Genus database with same CATH topology
 3JRH A;  1E3Z A;  3L1P A;  1SVO A;  3RQ4 A;  2P4W A;  1E79 A;  4AVZ A;  2BGI A;  3PVD A;  2DA6 A;  3T51 B;  4HF2 A;  3GQB A;  2LF7 A;  2R4G A;  4BPR A;  2Z1D A;  5E1X A;  5E3L A;  3ONU A;  4EEF G;  3B78 A;  5FKN A;  4IXA A;  3S1M J;  2QSH X;  1GVH A;  2DET A;  3S1R J;  1A6Q A;  2DOF A;  1TYU A;  5J8C A;  3HSE A;  3T8T A;  2R6H A;  3Q3S A;  3Q3A A;  2KPM A;  3SDB A;  3JUR A;  2L9S A;  3LA3 A;  2LLK A;  2KHM A;  2QQB A;  4YAF A;  3GWZ A;  4MGR A;  2ZXI A;  2GXG A;  2P7V B;  1YS6 A;  1I18 A;  3E5U A;  2E2I J;  4XN3 A;  2WSS A;  1ETO A;  1R22 A;  1MH3 A;  2JT1 A;  3PFY A;  3KLO A;  1LFU P;  1FEX A;  4ZCM A;  2JN9 A;  2A5Y B;  2COB A;  2XF7 A;  4M6V A;  5LRR A;  4KH3 A;  1K61 A;  2ZBV A;  3GVA A;  1T0F C;  2IXS A;  3BTI A;  3VSL A;  2PMH A;  2C5H A;  3BQZ A;  3HZJ A;  4RD1 A;  3TGN A;  5A89 A;  1B9M A;  2EK5 A;  3K4J A;  5BS6 A;  3VMV A;  5IYQ A;  3J80 Z;  2CWE A;  3DEE A;  4DYQ A;  1TTY A;  4A3M J;  2W1O A;  2OYN A;  1B59 A;  1EH6 A;  4P96 A;  1FBU A;  1GXQ A;  1OB5 A;  3PFI A;  1VQ5 B;  3FF5 A;  1X3U A;  4R71 A;  1JKQ C;  4EGY A;  1RQR A;  4F91 B;  3KET A;  3N6Z A;  3X2Q H;  1O8H A;  4FE4 A;  1YW9 A;  3MMP A;  2YWE A;  4V2F A;  2X3H A;  3K69 A;  4W8S A;  2KFD A;  2WAQ A;  1QG0 A;  4FTH A;  1ZGW A;  4G1B A;  1UEL B;  1G2H A;  3I9V 2;  2X1E A;  1FNC A;  2OJE D;  2BV3 A;  3LQQ A;  1FLI A;  4I7H A;  3WG7 H;  4X1E A;  2M45 A;  3BR6 A;  1MMN A;  4E7S A;  4PAA A;  1N0U A;  4P26 A;  5TRD A;  1JT0 A;  2ZXH A;  4DOZ A;  3KZY A;  3A8K A;  3VSK A;  2NSP A;  3RPQ A;  1ZTR A;  1IB0 A;  2VFN A;  2J8I A;  3TMO A;  1VQP B;  3BZK A;  3L09 A;  4LIT A;  1M1E B;  4C3H J;  4HG2 A;  2DA7 A;  2A61 A;  2R7F A;  5FD5 A;  4DZJ A;  4G7Z F;  2BY0 A;  4U4B A;  4XLA A;  2X0K A;  3HUG B;  3NWT A;  2PG4 A;  4A0Y A;  2YWH A;  2QQA A;  4YAU A;  1RMG A;  2ZXJ A;  3K4B A;  1FPQ A;  3RKQ A;  4PAB A;  2XF6 A;  2WY7 Q;  4E7H A;  4E7J A;  4Z1M A;  4DQL A;  3OR1 C;  2M0C A;  2VFQ A;  1ENH A;  4AF7 A;  2EIL H;  1KK0 A;  3ZMT A;  4CO8 A;  2DYR H;  4A3I J;  2J8K A;  2L5Q A;  2LBF B;  5D4R A;  1ULY A;  2IEK A;  3BG9 A;  5H20 A;  5FIU A;  3F72 A;  1OLT A;  3TW6 A;  1K6O A;  3OYB A;  1MDM A;  5JFR A;  1QFZ A;  4A93 J;  2KJC A;  1ZYR F;  4BQA A;  2L7Z A;  2ISY A;  4CYC A;  3J7A O;  4MNU A;  1SD4 A;  3HIF A;  3QYF A;  3F0C A;  1YLF A;  4N4O B;  1KYZ A;  3NAR A;  3MKZ A;  3K70 C;  2R7T A;  1R23 A;  4XD7 A;  3OYK A;  1NG6 A;  4OZZ A;  3I59 A;  5EEA A;  3PUN A;  1LDK B;  3G6E I;  3CPX A;  1OIS A;  2CMP A;  3HEF A;  2HZT A;  3QOP A;  1H42 A;  1W0K A;  2DT7 B;  4P1W A;  3TBI A;  2CW0 F;  4IL6 C;  4IX7 A;  3ROU A;  2A6E F;  2L02 A;  1KJZ A;  2F5F A;  3RKY A;  4BUP A;  5F0F A;  4HIZ A;  3B73 A;  3R60 A;  4M9Z A;  1E62 A;  4MYT A;  1W5C C;  4N4N B;  4BJT A;  4YFO A;  2ZFU A;  2VFP A;  4PSX A;  2ZBU A;  2XAJ A;  5E6T A;  4OPO A;  2R7W A;  1XTA A;  5TGT A;  5M5X J;  1HF2 A;  1Z7L A;  2D2W A;  4C3I J;  2CRV A;  3H94 A;  3LQE A;  4XLH A;  1IDZ A;  1Y1W J;  4XOR A;  5E8G A;  5L3B A;  1VTN C;  2DQL A;  3DLA A;  3E6B A;  2OTJ I;  4NCN A;  2FRH A;  2H8W A;  4N3G A;  1QNT A;  1I27 A;  3SLD A;  1XMX A;  1SFU A;  2O0W A;  1ZLJ A;  1CF7 A;  5CQE A;  2JVG A;  3I5U A;  1GV5 A;  2HTS A;  3LSP A;  5HNF A;  5FLV A;  3V8J A;  3Q38 A;  4CA0 A;  3P26 A;  1PJ5 A;  2VOO A;  4XK4 A;  4L5J A;  3HRT A;  1V0E A;  2X6W A;  5FFZ A;  3ASR A;  2MD0 A;  4TN1 A;  4OJO A;  3UW0 A;  1NTC A;  1I3A A;  4Y3O A;  2F48 A;  4U88 A;  4PC6 A;  1O8I A;  4G1V A;  2IAI A;  2ISZ A;  4A3K J;  3W2H A;  4A3J J;  5B6I A;  2AHO A;  4LLG F;  1WOP A;  5KAF C;  4U9U A;  2XTX A;  1KQ8 A;  2G7U A;  2JPC A;  2VUM J;  1K6Y A;  4BHP A;  4O5V A;  2EA2 A;  4XNF A;  5IY5 H;  1BW5 A;  3QP5 A;  3OOP A;  2JTV A;  1X1D A;  2KRF A;  2W00 A;  4LLN A;  4YEI A;  3KEQ A;  3ZOB A;  5IT9 K;  4TMW A;  3LMW A;  1Z67 A;  4HPQ A;  2CS3 A;  3CQZ J;  3A35 A;  2QM3 A;  3W5U A;  2BHY A;  3SZP A;  1FTT A;  2FA5 A;  5D8L B;  4HNU A;  3RZO J;  3EUH C;  1PDN C;  4Z4Z A;  1N75 A;  4ZGQ B;  1Q7Y D;  3D5S C;  2PLF A;  2L2O A;  2VC1 A;  1FND A;  4Y7C A;  3OYG A;  4OJ5 A;  4D9J A;  3VDX A;  3OSF A;  2LYC A;  2HKX A;  4RJL A;  2VNJ A;  5JBQ A;  1POG A;  1ZRF A;  4FWT A;  2F2E A;  2DJN A;  1GLN A;  2LF8 A;  1K4T A;  2PYH A;  5FFX A;  1PP7 U;  4BH9 A;  4LLL A;  3SUC A;  1D3Y A;  1YOV B;  1K4Z A;  4HDU A;  1O8D A;  2XPW A;  2DO7 A;  4P3Y A;  2QVO A;  2A3S A;  4HF1 A;  3G73 A;  1V4R A;  2YX7 A;  3LNQ A;  1FP2 A;  4B48 A;  1W7P B;  1BL0 A;  1ETQ A;  4QVJ A;  2X51 A;  3MEX A;  3LAP A;  1P7I A;  1VQO I;  2JPB A;  5HZA A;  1FWZ A;  1KC8 D;  2ID6 A;  3PO3 J;  3JRG A;  1T95 A;  3K4L A;  3CP2 A;  3LNN A;  1LPQ A;  4ZDO A;  1BI3 A;  2HYJ A;  4PC1 A;  3GFL A;  3S8P A;  1KK3 A;  2DCU A;  5F04 A;  3FBI B;  5F6F A;  1D0Z A;  4L5I A;  4RAF A;  1MH4 A;  4UHT A;  1UST A;  3V7C A;  1OR7 C;  4RB2 C;  5IT9 Z;  4B43 A;  2E1C A;  4AVP A;  4L5E A;  1MRZ A;  2DMT A;  2HXO A;  1QPM A;  4A5M A;  5JR3 A;  2A5W A;  2LOO A;  4NUB A;  3CB4 A;  1HKT A;  3WQZ A;  1OQY A;  2DA4 A;  1FJL A;  5M3M J;  1YIT B;  3I4P A;  4HAM A;  2HDC A;  1DPU A;  2PE3 A;  2NOG A;  3WTZ A;  1LLW A;  3HDD A;  4BJ6 C;  4CCN A;  5H6R A;  1S29 A;  5HVQ C;  1T56 A;  5C44 J;  2XGC A;  2CUF A;  4OMY A;  2M30 A;  5GAG J;  1F9N A;  2XAS A;  4KMU X;  4RB3 C;  5GTI C;  2B7B A;  3OSG A;  2YSR A;  4LG3 A;  4RGS A;  1R4M B;  3ZN0 A;  3IKT A;  4KKT A;  1NHC A;  3J81 Z;  2VQL A;  2W85 A;  3FK6 A;  3QPL A;  5IPA A;  1FTZ A;  3EQN A;  1DGW Y;  4AC0 A;  3C7J A;  5ED4 A;  3KCC A;  2XNC A;  3VYS B;  4BXX J;  2OUM A;  3H9Q A;  1YRN A;  3J81 k;  1HW5 A;  4QV2 A;  4A6E A;  1HXD A;  1ZHF A;  4FE7 A;  4JX4 A;  1BC8 C;  4X05 A;  1QVU A;  3WE3 A;  2JUG A;  3O6B B;  4R79 A;  4HV6 A;  3A8I A;  4YDT A;  1ZN2 A;  1JJ8 C;  4J01 A;  4ZTF A;  4E6K G;  5K7Z A;  2O5R A;  2VQC A;  3TL4 X;  1VFC A;  1A35 A;  4BEH B;  2DIE A;  1WQ2 A;  4M74 A;  2G0E A;  3LAJ A;  2V7W A;  3W5V A;  3GTO J;  4EM2 A;  2CV0 A;  3S2D J;  4M4S A;  1EE6 A;  2IT0 A;  3HPG A;  1YW8 A;  1K28 D;  3CC7 I;  1TWC J;  3WBJ A;  2KIF A;  1ETY A;  3CCV I;  3DF8 A;  1IUY A;  3E6C C;  2KRH A;  1QA2 A;  2XC7 A;  1JTY A;  1YE9 A;  1EP2 B;  1KQ0 A;  4IHS A;  1BOA A;  2I10 A;  1JRG A;  3OYN A;  4RAY A;  3H9N A;  2NAZ A;  4ABZ A;  2PMZ A;  4CH7 A;  1SVL A;  3PO2 J;  2V4J C;  2EJR A;  5EDN A;  3S17 J;  1HOM A;  4PMH A;  5D6F A;  1IJF A;  2X1D A;  3A2K A;  2EFW A;  1H89 C;  2O03 A;  2LK2 A;  3QAH A;  2VNK A;  1QGP A;  1XB2 A;  2VZL A;  2JA8 J;  2BM6 A;  2F1L A;  4GFB A;  1H8E A;  3GFJ A;  3PL8 A;  2WV0 A;  2CU7 A;  3FXO A;  4OMZ A;  1CNE A;  2W24 A;  3JW4 A;  3WTY C;  5FKL A;  4Y52 J;  1BPL A;  1EJ9 A;  3PUM A;  4WQM A;  4FX4 A;  3BH6 B;  1R1T A;  2NVY J;  2ME6 A;  3U21 A;  3ABK H;  1V5G A;  4PC3 A;  3WXM A;  2DFE A;  3I71 A;  1B9N A;  2E1M C;  3HOT A;  4HLX A;  2VNI A;  2FE3 A;  2EIX A;  3V7S A;  3S3N A;  1G3W A;  1BA5 A;  3LSK A;  5BQT A;  4YAO A;  2O9L A;  3D26 A;  1I39 A;  2W57 A;  2HWV A;  1MGT A;  2FX3 A;  1IN4 A;  1IDJ A;  1O8L A;  2F5E A;  2RQP A;  2PJP A;  3F8M A;  2FD5 A;  2CC2 A;  2EBI A;  2WAE A;  2WZN A;  1UHW A;  3FMS A;  3FKS A;  4KIS A;  2WBM A;  5A8A A;  3OWT A;  4P9S A;  3PA1 A;  5DV5 A;  1EP1 B;  4OIO F;  4ZJZ A;  1JHF A;  1TWF J;  1MBF A;  1BMF A;  2ZME A;  4QSH A;  2A68 F;  4IKF A;  4YFK F;  4QTR A;  4ASN A;  3AG1 H;  1S72 B;  4ZYE A;  1VQ4 B;  2OZU A;  3ASS A;  1SFE A;  3QQA A;  3AK5 A;  1BR4 A;  2QLZ A;  2R7Q A;  1UFM A;  1WI9 A;  5L3F A;  4DK0 A;  2HOT A;  4G7H F;  2G9W A;  2A6H F;  5FKM A;  1VQK B;  2PEX A;  2XKP A;  2WJV A;  1T6S A;  1IN8 A;  1X1C A;  1I1G A;  4XID A;  2LKP A;  5C4J J;  4KKS A;  1CGP A;  3HHG A;  3SXY A;  2R7U A;  1WGX A;  2B7E A;  3CCE I;  3ZQ7 A;  1T6Z A;  2MLG A;  4C2M J;  4FQG A;  1Z9C A;  1WXR A;  2HOE A;  5EGO A;  5J40 A;  3F8C A;  2EZI A;  1QUF A;  1WOR A;  3BJO A;  5B66 C;  1I5Z A;  3CDI A;  2OCC H;  3WHB A;  4P9U A;  5FNZ A;  1XS9 A;  1UMQ A;  4AF6 A;  1Y0U A;  4A3E J;  2QX3 A;  4J19 A;  4WX9 A;  5B1A H;  4LC0 A;  3D0S A;  2QMU A;  3M7G A;  4RDL A;  1H9G A;  2LFB A;  1ZGA A;  2LC2 A;  2BXZ A;  2WV1 A;  4YII A;  5LEK A;  2VBE A;  2L3D A;  1BW6 A;  3W5H A;  1LQ1 A;  2OTL B;  1SKY B;  1J2X A;  5D5W B;  2WYR A;  4M3E A;  1A04 A;  1F60 A;  4E7K A;  1DAB A;  2E5Z A;  2M5W A;  2E2H J;  2E1M B;  5LHG A;  2NVQ J;  4H9G A;  4U49 A;  3H9J A;  4YZX A;  1EFC A;  2M8E A;  1P9Q C;  4W1U A;  1O3S A;  4RS8 A;  2CQX A;  1J75 A;  2XND A;  1YI2 B;  1Z6R A;  2FBI A;  4C2L A;  3C2H A;  3H5N A;  4B09 A;  3BG3 A;  2NVU B;  2QZA A;  4V2G A;  2BYV E;  1OGM X;  1H9T A;  4F3Q A;  1YX5 A;  5DDG A;  1P4M A;  5L3C A;  2WAQ N;  1TYW A;  1PP8 F;  3SHF A;  4AD9 A;  3E1S A;  1HBX G;  2ECB A;  1ZRE A;  1ZGJ A;  1VQN B;  1VQ7 I;  1R58 A;  1K5C A;  4FIS A;  1FX7 A;  4JOM A;  3BR0 A;  3OL3 A;  4Q4Z F;  1HVX A;  1QZY A;  3BTC A;  3M8E A;  2RQQ A;  2L7K A;  1DP3 A;  3OP1 A;  2FML A;  4ZGN B;  2P3M A;  3I1F A;  2C5B A;  1Q82 D;  2HCJ B;  1R49 A;  1O7L A;  1Z0X A;  2Y2Z A;  4I02 A;  2R5Y B;  1W9X A;  3R6K A;  2DAO A;  3MHP A;  3OJW A;  3ZBU A;  4EQQ A;  1GDT A;  5LGT A;  3TO9 A;  1G3Y A;  1VQ9 B;  4CXF A;  1QGY A;  3M8F A;  1WTH D;  3GO5 A;  1YIO A;  1IHM A;  1WPC A;  2VXZ A;  1E3P A;  2HKO A;  3FBN B;  3GSI A;  4CHU A;  1B23 P;  2RDP A;  3CLQ A;  4LJZ F;  5DUK A;  4CSW A;  3WTS C;  1YJW I;  2BM5 A;  2M9H A;  4S04 A;  5BOX A;  1TNS A;  2BPO A;  4QHY A;  2RVC A;  3AGP A;  3DV8 A;  4P1V A;  1QRC A;  3CO7 C;  4A3F J;  4PC7 A;  1XMK A;  3E0J B;  1EFU A;  4OPV A;  2XDV A;  1RU4 A;  1W5T A;  4K1X A;  3C3W A;  4IHX A;  3PSZ A;  1JGG A;  3SY2 A;  2PFB A;  4Y7N J;  2WPD A;  4ZCL A;  2VNH A;  1KQ5 A;  3CD6 I;  1G7C A;  2OD5 A;  4X0C A;  3R6J A;  2ZTG A;  2AHQ A;  1KU9 A;  4MTD A;  4X0G A;  4Y4R A;  2HLD A;  3CTA A;  3FY3 A;  2V1U A;  5H5J A;  3DU5 A;  4E0F A;  4V19 K;  1P4X A;  2IQ7 A;  4GO1 A;  4Q5S F;  3ONY A;  4OP7 A;  3TOB A;  3GLL A;  3LSG A;  3M9A A;  3V7A A;  1LM1 A;  1JHH A;  3LOC A;  3RZD J;  4FXU A;  2E35 A;  3IRQ A;  4TMX A;  2VKH A;  5HNH A;  4U0V A;  1GAW A;  2QTZ A;  5LRS A;  3ASP A;  2BVL A;  4LK0 F;  3E1Y E;  1N08 A;  2I8D A;  3RIQ A;  4Q7J B;  1HKQ A;  1FT9 A;  1J09 A;  1P7J A;  1U6G A;  5E1W A;  4Z4R A;  4U0W A;  2LNB A;  3HJE A;  3HPH A;  2BY3 A;  2ZJQ F;  2C6Y A;  5IYW A;  2MFZ A;  4NHJ A;  3K70 D;  1S9H A;  2IS4 A;  5J3O A;  4G6D A;  5FO0 A;  2YR2 A;  1R5I D;  5DCF A;  1D8K A;  4II2 A;  1FC3 A;  2DMQ A;  2RNG A;  2DYS H;  2XV4 S;  4HNV A;  1CNF A;  1OHH A;  4OM9 A;  2V7U A;  4PDK A;  1R5O A;  4XN0 A;  3K2Z A;  2HQR A;  2P5K A;  4BKX A;  2K86 A;  3K4K A;  1BX0 A;  2CF4 A;  2XT2 A;  3RSN A;  3Q0V A;  2BM7 A;  5CLS A;  1GVD A;  2QYO A;  3A02 A;  4FET A;  2M7A A;  1ZR2 A;  4DK1 A;  5F4M A;  3OFN A;  1KGS A;  1QUE A;  4ZCI A;  2HOS A;  1IG7 A;  3CCM B;  3WOD F;  2BOL A;  3G4S B;  3S1N J;  5D5X B;  3ZIA A;  4HE5 A;  1FBS A;  2C4U A;  1AMO A;  1W7P D;  2VXD A;  5L3G A;  4M6Y A;  3NAU A;  3UNG C;  2GLO A;  1VQ6 I;  1JA0 A;  2D1V A;  1G3T A;  3T5X A;  1PLU A;  3H5R A;  2EQR A;  4Z03 A;  4XRS G;  1Z21 A;  2YS9 A;  4EJU A;  4B47 A;  1YIJ I;  4BBS J;  1QGA A;  4IEJ A;  3UKG A;  3ASN H;  3ERM A;  3GZ6 A;  1B72 A;  2IBD A;  2STW A;  2VOD A;  1B6A A;  2UXX A;  1EA3 A;  4PJL A;  1ERD A;  3VYU B;  1JUP A;  4D5C A;  4A12 A;  1YYV A;  4LMY A;  3PNY A;  5F1J A;  1F36 A;  2CO5 A;  3OS1 A;  2VT3 A;  3VO1 A;  1WVR A;  4CCM A;  2PX9 A;  1Y39 A;  5LGU A;  3OZW A;  4DYR A;  1O8K A;  3WU0 A;  2GWR A;  4Q47 A;  2JRM A;  2L0K A;  4HOB A;  2NNY A;  2YU9 J;  4E70 A;  3HRM A;  4LIV A;  3A01 A;  2INV A;  3VFZ A;  3FWE A;  2VBU A;  2VBW A;  2DFI A;  3W6J B;  4FN5 A;  3QFS A;  3DEU A;  1YJN B;  1P2F A;  2JA2 A;  4NC8 A;  1RR8 C;  2JQ7 A;  2KP6 A;  3SZG A;  3MZY A;  1I50 J;  3G71 I;  5LD2 C;  3SDG A;  1F1Z A;  3K4M A;  2DT6 A;  2CND A;  1XGS A;  1MBH A;  2P0W A;  3U1K A;  2R7S A;  3U6B A;  4R8H A;  3OW7 A;  3PNV A;  4NNJ A;  3WBK A;  1MW7 A;  1X3W B;  3ESW B;  3LWF A;  4AID A;  3GF2 A;  3BR5 A;  2R7Z J;  4BE1 A;  3K4N A;  2GXB A;  2DDA A;  1UG2 A;  3ISP A;  3RDI A;  2ACJ A;  3HHH A;  1S7O A;  3P9K A;  2F5V A;  1B4A A;  2A05 A;  2XHK A;  1LFB A;  3G05 A;  2VC0 A;  3QPH A;  4EJW A;  3GTM J;  2ZCW A;  3BPX A;  2X8K A;  3U1D A;  2O3F A;  1FIP A;  4O3M A;  1O8E A;  3E6M A;  4OIP F;  4RDJ A;  2DK5 A;  2NT6 A;  1CQX A;  4NK8 A;  2CJJ A;  1Z7U A;  4G6Q A;  2BM0 A;  2YUS A;  4AIH A;  1JKP C;  1KQS B;  4M3G A;  4MXN A;  2G0Y A;  2RC5 A;  3PSI A;  1FP1 D;  4BDZ A;  1TL8 A;  2UWM A;  3I55 B;  2R7R A;  4JBA A;  3NEU A;  2XRN A;  2VT2 A;  3Q6R A;  2Z33 A;  1J59 A;  1VQ8 B;  2V9P A;  4MHG A;  5E18 F;  4AM3 A;  3DTI A;  3MN2 A;  1N8R D;  5FLX K;  1OFM A;  2VPR A;  5F27 A;  1MSE C;  1SMT A;  3EUA A;  3TQN A;  1Z1D A;  4GYI A;  5JVG F;  1M1K D;  1FY7 A;  3I53 A;  1PE9 A;  3DLL F;  2Y9Y A;  2DA5 A;  5EG0 A;  3S15 J;  1O8F A;  1GHC A;  3K10 A;  2XGJ A;  2P5L C;  2V5I A;  2VI6 A;  3CCR I;  3CXC B;  3FMR A;  2MLK A;  2W6I A;  3G3Z A;  1HLV A;  3ECO A;  4E4H A;  1TP4 A;  2L4A A;  1K7A A;  1E3X A;  2G7H A;  2QEX B;  5JLX A;  1O8J A;  3ASO H;  1KQ9 A;  3H92 A;  3TDU C;  1JGS A;  3S1Q J;  3CC2 I;  2D45 A;  3TED A;  1G7T A;  2BN4 A;  1YHQ B;  4B3F X;  3DP7 A;  3H3U A;  4XQF A;  3OYI A;  2R7V A;  2NRA C;  4Z4U A;  2H94 A;  1QHG A;  2JSC A;  1USS A;  1R5G A;  2LRE A;  2PMU A;  2XF5 A;  5JLW A;  3WYA A;  3DKX A;  2V4D A;  2KIM A;  1XGM A;  3B02 A;  1GUU A;  2PMZ N;  2FOK A;  2DMU A;  3DBL B;  2IGO A;  4LG0 A;  1VF7 A;  3COA C;  3MD2 A;  3REO A;  3LSR A;  3V8K A;  3WTT C;  2LKS A;  3S14 J;  4ZC3 A;  1OFC X;  2O17 A;  1RQP A;  1OGI A;  3CF2 A;  2JVH A;  3JQP A;  4AUX A;  2UV1 A;  4C0S A;  1T08 B;  2JJ1 A;  2VIX A;  2M87 A;  5FLX Z;  3ZQG A;  4WXD A;  1SD7 A;  5FJ8 J;  1N78 A;  3B82 A;  4RD3 A;  2N8G A;  4HWV A;  3AFH A;  2K9S A;  1UB9 A;  3FPK A;  2MH2 A;  3VMF A;  3NAW A;  3W2A A;  4OWR B;  5THX A;  2HGC A;  1KZL A;  2M0M A;  2ZXW H;  4RA2 A;  3H35 A;  1QRY A;  1V3F A;  1WJA A;  2DPD A;  1A36 A;  1EF4 A;  2V1X A;  4EMS A;  2VPL A;  1DDG A;  4QUZ A;  3S93 A;  4RD4 A;  1GV2 A;  2QA4 I;  3N90 A;  2JA5 J;  1W87 A;  5AON A;  3HAG A;  1EP3 B;  2D9R A;  2DOD A;  3F21 A;  4M3F A;  3GTL J;  2H1L A;  3IKV A;  1TW2 A;  3DQV C;  4ENM A;  5CDF A;  2R93 J;  4OZY A;  5HOD A;  5GPC A;  4N9H A;  4D0P A;  1YS7 A;  2CV1 A;  3BT9 A;  3AVY A;  1CQT A;  1CZF A;  4RD6 A;  1LJ9 A;  2EZH A;  5DCM A;  1OMI A;  3ZQL A;  1MDM B;  4PC2 A;  1G6N A;  2XB0 X;  4CYC B;  3ZQC A;  1WJD A;  1RC9 A;  2VKV A;  2WR8 A;  2QUF A;  2VFO A;  4IRI A;  3EET A;  2L54 A;  1AWC A;  2Y30 A;  1GR1 A;  2ADU A;  5JHU A;  4ENN A;  2ICW G;  2Y31 A;  1PJ7 A;  4H0E A;  4LBV A;  3A0H C;  5DS9 A;  2VJ5 A;  1H88 C;  1X58 A;  1QVG B;  1DUX C;  2CUZ A;  3LFK A;  2NZM A;  2WB1 N;  2OCE A;  4UY8 I;  1N07 A;  2HS5 A;  3P4G A;  2XB5 A;  4JQF A;  1W34 A;  4ZYG A;  4CCO A;  3LL7 A;  1HA3 A;  4PCQ A;  1SAX A;  4GXO A;  1JI8 A;  3L2U A;  3M8J A;  1OCP A;  3VYT B;  2ELJ A;  1O4X A;  5LEJ A;  2DFF A;  3VEP A;  4L8J A;  3H9G A;  4P9F A;  3MKW B;  4N0B A;  1RES A;  5JVT A;  1DU6 A;  2XT4 A;  5CJ9 A;  2E5N A;  2LDU A;  4F92 B;  5IP9 J;  4IOC F;  1EA0 A;  1T2K A;  1ELO A;  3L9F A;  5E3N A;  2CSO A;  3CES A;  2NXN B;  3K1N A;  5D5U B;  2D5V A;  4P22 A;  1KON A;  2HVQ A;  2PBI A;  2OBR A;  1Z77 A;  3S3O A;  2CGP A;  4WZE A;  1YFH A;  1CF7 B;  1RUN A;  2EIM H;  3V76 A;  4RB1 A;  4G6T B;  3DDY A;  4L0Z B;  2XGE A;  4ZYD A;  3BCD A;  1YW7 A;  1QA3 A;  1MD0 A;  2HQN A;  2JRT A;  2HTJ A;  4JK1 X;  3DEW A;  4B3X A;  2H6C A;  2E19 A;  1U9O A;  3HOS A;  5J35 A;  3AST A;  3JCU C;  1ON2 A;  1N25 A;  5IYN A;  4QVA A;  2L9N A;  2Z5U A;  2ZSI B;  3IC7 A;  4P12 A;  3W2W A;  2M2E A;  1J7K A;  2AQF A;  4YIR X;  4OIN F;  1KU2 A;  2FOW A;  1QQ1 A;  3KYC B;  1Z3X A;  4XKB A;  4IW3 B;  2V9V A;  4IQ4 A;  4M73 A;  3TKY A;  1K83 J;  4OPW A;  4I76 A;  2V31 A;  1L1I A;  3JRE A;  1R71 A;  1KCC A;  1EH7 A;  1PUF A;  2KIS A;  5FRM A;  2NPF A;  2DA3 A;  1VQL I;  4UAJ A;  1DDN A;  2FNP A;  3MWM A;  4A0X A;  3MFK A;  1TYX A;  2ZIT A;  3G6E B;  4F93 B;  1BC7 C;  1XDU A;  4PGO A;  2GQF A;  1SD6 A;  2V6E A;  4KMF A;  3ES9 A;  1XG2 A;  1RPW A;  4G7W A;  3E5X A;  1QO0 D;  3QYE A;  2VN2 A;  3FXL A;  1X3Z B;  1ODD A;  4KN7 X;  3OOU A;  3OY9 A;  5K7F A;  2ZNZ A;  1RUO A;  5IYD J;  1D0Y A;  3S3M A;  5KCM A;  2EV5 A;  4TMT A;  4HW0 A;  2Y0S A;  4CCJ A;  1WJC A;  2W4S A;  3FMQ A;  4PGH A;  4XLP F;  2W25 A;  3BR2 A;  3WU1 B;  1TZL A;  1E1Q A;  1AOY A;  4ZDL A;  2Z6B D;  3AVT A;  1VZ0 A;  3OL4 A;  3WTW C;  1KD1 D;  2Q6K A;  2RRE A;  1K79 A;  2H09 A;  1YJ9 I;  3RYP A;  2XAU A;  2A07 F;  2OTJ B;  4NQW A;  5FLM J;  2Y48 A;  4FX0 A;  2ECC A;  3FKI J;  2X6Y A;  3PNT A;  3PQK A;  5J1Y A;  1XE1 A;  1SFK A;  2NOJ B;  3O8G A;  3HGG A;  5IT3 A;  4WXC A;  5L46 A;  1RET A;  2F3L A;  3BTJ A;  4RDU A;  2IPQ X;  4HX4 A;  3TW7 A;  2LD5 A;  2DOA A;  3KEW A;  4LBZ A;  2BBY A;  4RLF A;  4Z4T A;  1OOC A;  2QE7 A;  4HBL A;  2DER A;  2NT9 A;  4EVI A;  5J1U A;  4G9Y A;  3G2B A;  1E1R A;  2Z99 A;  2R0Q C;  5ICE A;  4PFP A;  1SFO J;  2KIQ A;  4M3D A;  4BAC A;  4P6V F;  1B8I A;  4NK6 A;  5KK1 A;  2J5O A;  3HTS B;  1QCX A;  5GAE J;  3KEY A;  5ILU A;  2ZJR F;  2KIU A;  1SKQ A;  4MYU A;  1F20 A;  2VJI A;  1SFX A;  2IVM A;  3SQV A;  1ZM3 A;  2ZC2 A;  3HRU A;  2M7B A;  3CCL B;  1OCO H;  3CCU I;  3OYJ A;  1X1P A;  1YO5 C;  1V5V A;  3VO2 A;  3AGQ A;  4UZE A;  3IRR A;  5LBQ A;  2KMU A;  4RAZ A;  2UXN A;  2C2W A;  1WOS A;  5K5R A;  3MKY B;  4M2L A;  3TP0 A;  4UUV A;  2C78 A;  1MBG A;  1YRN B;  2EFP A;  1Y0Y A;  2HNH A;  1MMG A;  1I8D A;  4ACB A;  5KHD A;  2DXI A;  4OIQ F;  1FRQ A;  1J5Y A;  1TQI A;  3D5R C;  5HS8 A;  1FSH A;  3I56 B;  2YU3 A;  2ZNY A;  3C1D A;  1AHD P;  2XRL A;  4EW9 A;  4CDG A;  2HI3 A;  1VND A;  3CMY A;  3H09 A;  2XAQ A;  1QPI A;  2BZT A;  3PET A;  4G12 A;  4FAS D;  2E34 A;  5DYM A;  3AG3 H;  3FHZ A;  1UD6 A;  2E71 A;  1OCC H;  2K7L A;  2IS1 A;  1AA7 A;  5J4Y A;  1VQO B;  3EDP A;  2DJI A;  2ZME C;  3ZQH A;  3DXJ F;  1JKO C;  1G59 A;  2CQQ A;  4RB0 A;  1T39 A;  2VKE A;  2BE5 F;  2GQQ A;  1QA6 A;  4GRI A;  3FIW A;  3LSJ A;  4MFD A;  2OBS A;  4HX8 A;  1V0F A;  2UUZ A;  3GFM A;  1U5T A;  3H3Z A;  2TDX A;  3ZR8 X;  3GYH X;  3CCJ I;  3OZV A;  3CCQ I;  4XOP A;  3Q0U A;  4BHB A;  4A3L J;  4XKV A;  3VNV A;  4RGR A;  1XQB A;  2WTE A;  3CW2 A;  3JRB A;  3OAA A;  2QZ8 A;  4TMV A;  3K6G A;  2OBT A;  5AMV A;  4YEL A;  5E20 A;  1VHE A;  4WWV A;  1S4M A;  5CPR B;  1LVK A;  4OOX A;  1T6Y A;  1WZ2 A;  1ZG5 A;  1B1B A;  1KYW A;  4I98 B;  3VPR A;  1LLZ A;  1N05 A;  3OIP A;  4RGX A;  2PMD A;  1MND A;  1R5B A;  1WRJ A;  2IGK A;  2EFG A;  1TT0 A;  1ZH5 A;  4DGW B;  2O0V A;  1Z91 A;  4CGZ A;  4EV0 A;  2JJ7 A;  3L2V A;  3SEJ A;  1IC8 A;  2H27 A;  4JRA C;  1ZQ3 P;  2OZ6 A;  4A0Z A;  3WHC A;  4X7F A;  1HW1 A;  4G6I A;  4ZZD A;  4Z06 A;  1NK2 P;  1ETW A;  5ILV A;  3BPV A;  1XFO A;  2ZTN A;  2EPF A;  2KQR A;  5GV8 A;  3AG4 H;  2PJR A;  4HQM A;  1S7E A;  2AO9 A;  3GUD A;  2LSO A;  3KP2 A;  5K7H A;  1ORK A;  1XSX A;  5FRO A;  3N97 A;  3B8Y A;  2M8G X;  1MNE A;  1MNM C;  2K9L A;  2XGX A;  2GA2 A;  3B6A A;  2HYF A;  2GJP A;  1D1B A;  2BY2 A;  2V1N A;  5AIP A;  3A3B A;  1LVA A;  4BHC A;  2WJY A;  4B4C A;  1U2W A;  4M71 A;  2VFM A;  1WWX A;  4AU7 A;  1IJW C;  3LVB A;  4M9S A;  2QEN A;  4MEY F;  3BQY A;  3BZ6 A;  1COW A;  1OGJ A;  1EH8 A;  4I99 C;  4LBY A;  1WFX A;  5CVR A;  1BBY A;  4IOA F;  3GCM A;  1IRZ A;  3DPT A;  2DCE A;  3H36 A;  3VST A;  3D5L A;  2TCT A;  2QGG A;  1BR1 A;  3CMA I;  2OF7 A;  3QOE A;  4HQE A;  4RMN A;  4L18 B;  1Y6I A;  1YI2 I;  3OYE A;  4LIU A;  2ZME B;  2JZY A;  1K78 A;  1OYI A;  3CC7 B;  3U9G A;  5J3L A;  4G7X A;  2DLL A;  3CCV B;  1OB0 A;  2HPM A;  3IH3 A;  4LBW A;  4BY7 J;  2WB1 A;  3K9T A;  5DD4 A;  1FOX A;  1G7R A;  4AYB A;  1RNL A;  1W35 A;  1IAW A;  2XAF A;  1ETX A;  2FXA A;  3RPU D;  3VOD A;  3GVK A;  3OYA A;  1IA5 A;  4E7I A;  4LB5 A;  2O6G E;  3IWF A;  3W6V A;  2RV8 A;  4WF2 A;  4V02 C;  2DK8 A;  1P4A A;  2VBM A;  1H85 A;  2MC3 A;  3CDH A;  2VBT A;  3AVW A;  1FX0 A;  2VQH A;  4UVC A;  5M5W J;  2IGM A;  2BVN A;  5EGO B;  2FNA A;  4B44 A;  1XDS A;  2TRT A;  3A1P A;  3BR1 A;  3OYH A;  5E1Z B;  3AAF A;  3W2G A;  4UB6 C;  3T9G A;  2K3F A;  2VLA A;  4E7L A;  3KL9 A;  1D8J A;  4RCZ A;  1O8M A;  1OPC A;  4II3 A;  2XC1 A;  2Q0O A;  3DCF A;  3HKZ A;  3PIP F;  2K9Q A;  2BEO A;  2VBV A;  1QFJ A;  2GIZ A;  4DNC A;  1KRH A;  2KDO A;  3QPT A;  1L3L A;  3KIO A;  3I4M J;  1W2B B;  3DFG A;  4PUS A;  3PQJ A;  1U8R A;  4FT8 A;  3J7Y J;  4WZK A;  4GGG A;  1A8P A;  1PXZ A;  3PIO F;  1OYY A;  1LE8 A;  1SAN A;  2P7C B;  2MYS A;  4TT3 A;  1MZB A;  1WH5 A;  4D1Q A;  2XZP A;  5DSZ A;  3H1C A;  3JRD A;  2MG4 A;  4NBQ A;  5F64 A;  4A6D A;  5EZH A;  1JXS A;  4GQN A;  3VSU A;  3WGI A;  4N9I A;  3IAM 2;  1R7J A;  3V8L A;  4UV9 A;  2JUC A;  2L9R A;  3OIQ A;  1QRB A;  1XMA A;  1X0C A;  4A3D J;  2WY8 Q;  4X7D A;  2QY1 A;  2QQ9 A;  2X4H A;  3OE7 A;  2PEC A;  1IGN A;  4BNC A;  3CC4 I;  1IXR C;  2DA2 A;  3SLN A;  1TT5 B;  4TSF A;  3BCF A;  4C2T A;  3GQ8 A;  3QOD A;  1F4K A;  3SKB A;  2NS7 A;  3KP3 A;  1R6R A;  4UXN A;  3CRZ A;  1ON1 A;  3TDZ C;  2FBH A;  5IYC J;  1X1B A;  2XZL A;  1VQM I;  2B5O A;  2QTL A;  5EEH A;  5FO5 A;  3MVP A;  3DWL E;  4P5O A;  1FBQ A;  5JMC B;  2STT A;  2EV0 A;  3T56 B;  1BJK A;  1BN8 A;  4IQJ A;  2BGC A;  2IW5 A;  2VE8 A;  3BJ6 A;  4BXU A;  2GIV A;  4HRI A;  5BNG A;  3JRI A;  3VR6 A;  4L9N A;  1TQM A;  1XN7 A;  1RIO H;  4JMQ A;  3ZN1 A;  2PLY A;  4P25 A;  4ZV4 A;  3HM5 A;  4Y17 A;  3AL0 C;  4KIG A;  4BGD A;  4A5N A;  4DBQ A;  1GJR A;  4OAY A;  4C43 A;  5A2Q K;  4ROX A;  1J9I A;  1PJR A;  3T1B A;  4Z4S A;  3G1M A;  2OK7 A;  3BC9 A;  1TLH B;  4NB5 A;  1O3T A;  1HDD C;  2DMN A;  2BY1 A;  3HXL A;  4BQO A;  2BX6 A;  4CIC A;  3LSH A;  1FNM A;  3QE2 A;  1JTA A;  4XL9 A;  2DI3 A;  1LKX A;  4KJZ A;  3JR9 A;  3L2C A;  3IH2 A;  1UHS A;  1V55 H;  1UG0 A;  1V5F A;  1NHA A;  2MH9 A;  2NNN A;  1MMA A;  5D8K B;  2H8R A;  1E63 A;  5H59 A;  2FQ3 A;  1U2R A;  1NG7 A;  1OCZ H;  1U9N A;  1VHO A;  4RDK A;  4U7D A;  2X48 A;  2AQE A;  3CME I;  1UD8 A;  4X06 A;  3ZUG A;  3ABT A;  3FXU A;  5LMZ A;  3HGY A;  2Q2E B;  3GFI A;  3VMW A;  1S6L A;  2VBK A;  3NB2 A;  2X9D A;  3B8H A;  1FZP B;  5FGM A;  1JB9 A;  5FO1 A;  2GZW A;  1FYM A;  1ZM4 A;  1OJL A;  3A4C A;  1EWY A;  3P7N A;  1D5Y A;  1JJ2 B;  2FJ1 A;  3BG7 A;  2DPU A;  4XKW A;  1LEB A;  2WZP P;  2WAF A;  2EH3 A;  1VQ7 B;  1BJA A;  3LSM A;  2DW4 A;  3CCS B;  2AXL A;  5TY0 A;  1KCD A;  2Q8K A;  3LYC A;  2ZL7 A;  4CZZ A;  1W36 C;  3GBG A;  1Z3Y A;  4MQV A;  2XVC A;  2IS6 A;  2Q6L A;  4X6A J;  4BE2 A;  4ETS A;  2EIK H;  1S5L C;  1I1S A;  1UAA A;  5E8I A;  4G5G A;  2H1K A;  4IVN A;  2IA1 A;  3BOQ A;  3DTK A;  3HB9 A;  2ESN A;  3JSO A;  4OU0 A;  3Q9S A;  4XM3 A;  1AIP A;  1OB2 A;  2O04 A;  3ABL H;  2CUJ A;  5AIQ A;  3F22 A;  2DTZ A;  3RIR A;  5FRN A;  1LDJ A;  4ACA A;  3KPH A;  1Z6T A;  1SMY F;  1REP C;  2K5C A;  5DTD A;  1AKH A;  4WWC A;  1RKW A;  2LMD A;  3B4N A;  1XG1 A;  4QPO A;  2KLO A;  1XPX A;  2OU2 A;  1YJW B;  2GK6 A;  3PSS A;  2F1M A;  1PJ6 A;  2BW3 A;  3AL0 B;  3GQA A;  1BM9 A;  3IH4 A;  5JHF A;  3MAJ A;  2PYG A;  5HDK A;  3DBH B;  1CLW A;  2CH0 A;  2LZJ A;  4CZC A;  3CUQ A;  1LB2 A;  3E20 A;  2F5C A;  1NDH A;  4YZQ A;  1QZE A;  4B3G A;  3SJM A;  3ZMU A;  4MTE A;  4F55 A;  2XTY A;  1B72 B;  2V7V A;  1T5E A;  2ZKZ A;  5GPA A;  1JTX A;  1X19 A;  3SFI A;  5J8F A;  4RM3 A;  1E0E A;  4UZF A;  3A8J A;  3OV8 A;  1Y0R A;  2ZZE A;  4PGG A;  2R5Z A;  2QBY A;  1ZM2 A;  3GLX A;  4I0B A;  2X6O A;  1KU7 A;  2WC2 A;  4E7Z A;  2R92 J;  3CPW B;  3HOU J;  4KN4 X;  4HE6 A;  4Z6Y A;  5GTH C;  2YPR A;  4HV5 A;  3EQL F;  1G8X A;  3R61 A;  3SFZ A;  1WKM A;  1KTV A;  2X53 S;  3MZ8 A;  1FMW A;  1TQP A;  3A01 B;  2IOU G;  2JA7 J;  2HXI A;  2P5V A;  2QDX A;  5HS9 A;  2Y0S N;  4AIK A;  3OYM A;  1QGZ A;  1VI0 A;  2FBK A;  4S05 A;  3RTR A;  3OEE A;  2DOE A;  3KEO A;  2XUB A;  4IRG A;  5HLT A;  1WMR A;  4XSX F;  5BSX A;  1P6R A;  4RCY A;  3SZE A;  3F8F A;  2XGD A;  4XMY A;  5FKO A;  2EIJ H;  5JI6 A;  3L2W A;  2JIZ A;  3TOA A;  3GME A;  4UUS A;  3HL2 A;  3KRG A;  1DPR A;  1XC5 A;  2FEZ A;  2LP0 A;  1DDI A;  4WZL A;  4DQ2 A;  4MLO A;  2O61 A;  2DN0 A;  1RWR A;  3LQ6 A;  2F4I A;  1M90 D;  2DA1 A;  3CJT B;  3W2F A;  2IJL A;  1IZ1 A;  2MD5 A;  1JA1 A;  1MJ9 A;  2CW5 A;  5D6E A;  3L2Q A;  2QF7 A;  3OYL A;  1G7S A;  2QKM B;  3I4N J;  3OOC A;  2JSP A;  2LY9 A;  5HLH A;  2CFX A;  1ZEL A;  5LLQ A;  3I64 A;  4X07 A;  3OPO A;  3KP7 A;  5F4O A;  1UD3 A;  1Y8R B;  3FDY A;  1VQ5 I;  4P3I A;  3H0G J;  3QU3 A;  3KYD B;  1VQ6 B;  3ZQI A;  2DTR A;  5H6Q A;  1LFP A;  3IV5 A;  1ZK8 A;  2H6B A;  2WAD A;  2AS5 F;  3L2R A;  1R4N B;  3M3Y J;  4P6Y A;  5DS0 A;  2F43 A;  1IDK A;  5CVV A;  2GOM A;  3J80 K;  2FVG A;  1IRG A;  4DW6 A;  1SM4 A;  1D8T A;  4XLF A;  3CDL A;  2NS8 A;  1FYK A;  3OKX A;  3EYI A;  1JE8 A;  1D5V A;  1IUF A;  1DG1 G;  4KDP A;  1QA1 A;  3E7L A;  4M1K A;  2ZBK A;  1F5T A;  3BNW A;  3GZ5 A;  2GAU A;  2QSG X;  5EF6 A;  2K3P A;  2PQ8 A;  3CCY A;  3RYR A;  3GQ9 A;  3JAM K;  1ZG1 A;  1JT6 A;  3ZMS A;  4YIF A;  5EG0 B;  3ASQ A;  1XCB A;  5HOO A;  1VQP I;  4I01 A;  4D5F A;  4Y33 A;  5DEQ A;  1HW2 A;  2GK7 A;  3QP6 A;  3ELK A;  3BWG A;  3WNB A;  1S7A A;  3BDD A;  3MMY B;  1R5N A;  3NQO A;  1JKR C;  3ABU A;  2VBX A;  2KL4 A;  3G71 B;  2ZZQ A;  3I54 A;  1WSR A;  2BF4 A;  2OQG A;  4HSR A;  4PK4 A;  4BL0 B;  4Y15 A;  2KKO A;  5J47 A;  3ERE D;  1LEA A;  3S2W A;  2OAZ A;  5A88 A;  4J0Q A;  3SYJ A;  3RI4 A;  1NB9 A;  1R5H A;  3FZV A;  1Z05 A;  3FXM A;  1X2N A;  2NYX A;  4KT5 C;  1BIB A;  2EWN A;  5C1C A;  4YCQ A;  5ICC A;  1BI1 A;  2VBS A;  5F0C A;  4NBS A;  5FL7 A;  3U6K A;  2BMW A;  4GDF A;  3QU6 A;  4HDV A;  5BMZ A;  1RKT A;  2J7K A;  2K9M A;  1DBO A;  1K8F A;  3D1N I;  4X8I A;  3PM1 A;  4LG0 B;  4W8T A;  3RKW A;  1MMD A;  2OK8 A;  4TV7 A;  3BQJ A;  3NWS A;  4XKC A;  4XLE A;  3RPU A;  1TYV A;  2CV2 A;  3WY9 A;  1QHH D;  2AXT C;  4LD5 A;  4IHV A;  2X6X A;  2NTP A;  2ZZG A;  1KTW A;  5C1E A;  2KVO A;  2X1C A;  2HZD A;  3OYD A;  5EJC A;  4Q48 A;  4PJ0 C;  3ML6 A;  4A69 C;  3EQO A;  2JWT A;  1S8N A;  2VJ4 A;  1TWA J;  3FHN A;  1N0V C;  3JAM Z;  3W3C A;  1YLO A;  3QRF F;  1HZE A;  3FXK A;  4U87 A;  3HBL A;  3FPP A;  1RRJ A;  3PEN A;  4RM0 A;  5AN9 A;  3ML3 A;  5FB2 A;  4A3B J;  3A0B C;  4L9J A;  5CVU A;  1Q1V A;  2O0Y A;  3GIR A;  3F6V A;  1MBK A;  1GO2 A;  4CQJ A;  2VOP A;  3KLN A;  4P2N A;  1TWH J;  5C4X J;  2XIG A;  1I6H J;  2DOG A;  2GJK A;  1OCT C;  2LG4 A;  1HF0 A;  5GP9 A;  3Q9V A;  3WGH A;  2V9K A;  2GRE A;  2BVM A;  4RLZ A;  1Q9S A;  5JLV C;  3EUK L;  1BJZ A;  1FRN A;  3SZT A;  3O3K A;  4FHT A;  3JRA A;  1KU3 A;  2Y9Z A;  5DCM B;  3GTK J;  3CCR B;  2Q6O A;  2M3A A;  4W8Q A;  3E3V A;  5BPI A;  3HUG A;  3PJR A;  2LRD A;  2NTB A;  2XPU A;  2E1B A;  1SVM A;  1BI2 A;  2CFO A;  5HZB A;  5B5E C;  1U0J A;  4JP0 A;  3WTX C;  4JX6 A;  1IW7 F;  3I59 B;  4K2E A;  1VJS A;  4C2U A;  4UUT A;  1OFD A;  3CC2 B;  2OPT A;  2BM1 A;  2LBF A;  1ZAR A;  2ZZF A;  2X85 A;  4OAZ A;  3GVJ A;  5HLI A;  1FSE A;  1VLY A;  4Y13 A;  3BC8 A;  3KP4 A;  5IK2 A;  3DTE A;  4AYB N;  2ETH A;  3FXR A;  4RPD A;  3RY8 A;  2ZJP F;  5M5Y J;  3HG9 A;  4O6J A;  5J1R A;  1T0F A;  1WH7 A;  4LB6 B;  2ELH A;  2IGN A;  4ZYH A;  1WPK A;  2YX4 A;  1KK1 A;  1VF9 A;  3B6C A;  2DBB A;  3KZI C;  2UZK A;  1NJI D;  2Z8G A;  5IP7 J;  4B4D A;  3F3X A;  4IHW A;  3LST A;  2C77 A;  2HMA A;  3TO7 A;  1KZH A;  1E2X A;  1HST A;  4UNO A;  3V7R A;  5CYV A;  1NB0 A;  2CQK A;  2L4M A;  3QPS A;  2GOX B;  3IUO A;  1QH0 A;  2YUH A;  3V4G A;  2V26 A;  2E1N A;  2OC6 A;  4XLN F;  3F6O A;  4RPB A;  1D2E A;  3HKZ N;  4BU2 A;  4ENK A;  2EB7 A;  2RNJ A;  3F23 A;  3ZC3 A;  2ELK A;  2VBY A;  2GPJ A;  3HRS A;  3HYI A;  4M3B A;  3VNU A;  2ME0 A;  2HPI A;  1HG8 A;  2LVS A;  3HC7 A;  1QBJ A;  1QFY A;  2CUE A;  3M1C A;  1ETK A;  2OBP A;  3RKX A;  2QN6 A;  2C4T A;  3HSF A;  1WJ5 A;  5L3E A;  2W48 A;  2NVX J;  1AU7 A;  3GQ7 A;  1XSV A;  1ZRC A;  2E36 A;  2QA4 B;  2DT5 A;  4C9Y A;  1Y8Q B;  1YG2 A;  4XR6 A;  4DZP A;  1BIA A;  2R7X A;  5HDG A;  3HOY J;  1MBJ A;  2HDN B;  2W7N A;  2CW7 A;  5E17 F;  1BHE A;  3W2E A;  4KUM A;  1ZG3 A;  1BN5 A;  4ENJ A;  3M1E A;  4DNR B;  1WJB A;  2EFO A;  2MW8 A;  3E5Q A;  5EEG A;  2FQ4 A;  9ANT A;  2KJB A;  1I3Q J;  2JA6 J;  2Z9O A;  3HOW J;  3ABM H;  1WJE A;  3OJX A;  5TJJ A;  1I7P A;  4DJA A;  5IYR A;  2ZO4 A;  3R4K A;  1HQC A;  1W0J A;  2DEU A;  1FOY A;  3K2A A;  3DKW A;  1PUF B;  2MC4 A;  1P4W A;  1MSF C;  4N3N A;  4YXW A;  4ASU A;  2CRG A;  4JYK A;  1FMV A;  2QCO A;  1XCV A;  2LY1 A;  1HKS A;  2B0L A;  1YIT I;  3S2H J;  5EMN A;  1E17 A;  3GXO A;  4ESJ A;  4Y9R A;  2P8T A;  2GBY A;  3AKZ A;  4X7C A;  4RD2 A;  3OS2 A;  2ZL5 A;  5DM7 F;  4I6Z A;  2FMY A;  2VQG A;  4I2O A;  3SJZ A;  3LA7 A;  5B1B H;  1E3H A;  1Q1H A;  3S16 J;  2VE9 A;  1H80 A;  2CQN A;  2CG4 A;  3UR3 C;  2ODL A;  3QYB A;  4MR0 A;  1W5S A;  1N77 A;  4RD0 A;  1YX2 A;  3CJR B;  3CCL I;  3GTP J;  1Q86 D;  2IA2 A;  3JTH A;  2O6W A;  2A6T A;  2MA3 A;  3OZU A;  2HOA A;  4WXH A;  1IRX A;  2QXZ A;  2VB6 A;  1Y56 A;  2F6C A;  4IHT A;  3KP5 A;  2PI0 A;  1FOW A;  3H5A A;  1UCR A;  2DMP A;  1EKE A;  1I6X A;  5B3S H;  5EYR A;  4BJ5 C;  1WOO A;  3K4C A;  2J5P A;  4B3A A;  4C3J J;  1W0U A;  6PAX A;  1LUJ B;  4L9V A;  3JSP A;  3G1L A;  4ZZL A;  2VL8 A;  1FNB A;  1X4P A;  4NQW B;  5HS7 A;  3I56 I;  3QFC A;  1QJV A;  1TSP A;  1S3J A;  3ZXS A;  4JX5 A;  1WU8 A;  3BH7 B;  1SD5 A;  3C2B A;  4HF0 A;  2RGV A;  1U5T C;  2V1D A;  3CLO A;  3J81 K;  3BY2 A;  1GAQ A;  2M34 A;  4MIM A;  1C0W A;  2JJ2 A;  1K8A D;  5J4V A;  1XSD A;  3LSI A;  2KT0 A;  1HDP A;  1W7P A;  1TUI A;  1JJ6 C;  3P9C A;  4QFM A;  4BQQ A;  2QSF X;  2UVF A;  5CVI A;  3MZH A;  3ZMD A;  5TR9 A;  4GYG A;  3DKY A;  4A3C J;  4OOS A;  1IV6 A;  1V5E A;  1HCR A;  5KSW B;  3FM3 A;  4XOT A;  4Z4V A;  3ZP5 A;  4ON0 A;  1OCR H;  1W0T A;  2PIA A;  3DU6 A;  4UB8 C;  1PYV A;  3EPZ A;  4PFO A;  3WE2 A;  1B8I B;  1VBL A;  3SJP A;  3RQI A;  3OYC A;  3VWB A;  5CKT A;  1TNT A;  2M1B A;  1T6X A;  3R0J A;  5ICG A;  1R1V A;  4M53 A;  3LO8 A;  3ZPP A;  1KMH A;  3OIO A;  4M6X A;  3BH4 A;  2Z2S B;  1VQL B;  3WTV C;  4CCK A;  2FF4 A;  4L9T A;  1J9Z A;  4L0Y B;  3OS0 A;  1ZR4 A;  4I84 A;  1BOB A;  1J0R A;  1DBG A;  1DGR M;  1AIR A;  5FKK A;  4X7E A;  3OW2 B;  2EZK A;  2KZG A;  1IN7 A;  4FCY A;  2V6C A;  2K02 A;  2YWF A;  4HLY A;  3H0D A;  4U7B A;  1BLI A;  1G3S A;  3ZQQ A;  1RI7 A;  4LOC A;  1UMK A;  5ICF A;  1PVE A;  1OYW A;  3GRH A;  1TWG J;  2WWY A;  3DBR B;  4R1H A;  2DFH A;  2RC4 A;  2UVE A;  4CCL A;  3CUO A;  3GEZ A;  1MJA A;  2NS0 A;  1H0M A;  2HQA A;  4UVA A;  3EUH A;  3ZZU A;  1E3O C;  2MAB A;  3C18 A;  4YFN F;  4XIC A;  3T53 B;  2VBZ A;  3QFR A;  4YZA A;  1APL C;  5E3M A;  1YJ9 B;  2XAG A;  2NVT J;  4EAT A;  1R9T J;  3JRF A;  2E60 A;  3CP8 A;  4M72 A;  5L3D A;  4YG2 F;  1W36 D;  4DBR A;  3PUF A;  4HNT A;  1WSV A;  4W8R A;  2D74 A;  2HFH A;  1U5T B;  4OPS A;  3A3G A;  2FX0 A;  1ONV A;  4BEH A;  3V42 A;  5DNS A;  1MAB A;  2OV7 A;  4HZF A;  2OQR A;  1SAU A;  4QPQ A;  2LY2 A;  4Z05 A;  1WHU A;  2E7X A;  4MEX F;  2B63 J;  3R0A A;  3WNC A;  3WG9 A;  3FXJ A;  3IP4 B;  4IRH A;  3JQQ A;  2QYU A;  4KFC A;  4BDY A;  4ZYA A;  3VB2 A;  5F4J A;  2K27 A;  1S72 I;  2XSD C;  1VQ4 I;  2ZSH B;  4UVB A;  5GAD J;  3MQ0 A;  3F8B A;  5IYP A;  5H2F C;  3FJO A;  3ZRG A;  2EFN A;  2E1O A;  4NC6 A;  1QVF B;  4DYC A;  4WCG A;  2O1D A;  1K9M D;  1VQK I;  2NV4 A;  3CF5 F;  2INU A;  1U78 A;  1KK2 A;  1OR7 A;  5TIS C;  3QFT A;  1MBE A;  2K4B A;  2W82 A;  4KA4 A;  1O57 A;  3CCU B;  3DPU A;  2COM A;  1ETV A;  1XD7 A;  2XZO A;  5DUI A;  2VYQ A;  2PJR B;  3BCB A;  4AC9 A;  2F4O B;  2GA1 A;  1TLL A;  1DAR A;  4CUG A;  1TC3 C;  4IJA A;  1UHM A;  5KW9 A;  4RBO A;  2LR8 A;  1WI3 A;  1W4M A;  5BPD A;  4M9X A;  1FNN A;  3LJY A;  2BV6 A;  4G7O F;  1QQI A;  3K1P A;  1O3Q A;  3Q6Q A;  2RN7 A;  4QWQ A;  3P5J A;  1E64 A;  1XGO A;  3HSR A;  2NTQ A;  3O8H A;  1TW3 A;  3W2V A;  2RAE A;  3SEZ A;  4EJO A;  3AVX A;  2I5U A;  3DPL C;  2XOK A;  2HYG D;  2D3N A;  2OTL I;  3Q39 A;  2EFQ A;  2M4K A;  3A1Y A;  4RGU A;  1H8H A;  2EV6 A;  3ZGK A;  3WTU C;  1HC8 A;  2XKO A;  1UJ8 A;  1DQU A;  2WA0 A;  2XTW A;  4RLQ A;  5E3O A;  1Y1V J;  3ZQF A;  2Z3Y A;  3BCA A;  1K78 B;  2EZL A;  2M4G A;  4ESB A;  3Q5F A;  3BTL A;  3DU1 X;  3QWL A;  2R3S A;  1IXC A;  3BY6 A;  1ZRD A;  3CCJ B;  2JN6 A;  2L9V A;  4A3G J;  4EM1 A;  2DDB A;  2IRF G;  3CCQ B;  2ID3 A;  1EV7 A;  4ZH4 F;  1VQN I;  5F1R A;  4IPA A;  4YRV A;  2MBF A;  1BR2 A;  4FK8 A;  2KDZ A;  3N4M A;  2RKH A;  2VJJ A;  4BS9 A;  5HLG A;  5GV7 A;  3F9K A;  2L7F P;  2OA4 A;  2DQR A;  2BXY A;  4EGZ A;  4URR A;  2ZFW A;  4HEA 2;  3HOV J;  3GZN B;  1O8G A;  1HA8 A;  4J00 A;  1HSJ A;  4B8X A;  5F0H A;  2HVR A;  3AVU A;  3IL2 A;  2P81 A;  2FU4 A;  4WZT A;  1D1C A;  4XLC A;  5KVR A;  5K5Q A;  2V7Q A;  4OJP A;  2Y69 H;  3LQR A;  5FD6 A;  2XAH A;  3K0L A;  1RZ4 A;  2K40 A;  4QIW N;  1K73 D;  5IOZ A;  1VQ9 I;  3GTJ J;  2PN6 A;  3WGG A;  1MKM A;  3KE2 A;  2Y75 A;  2KZV A;  2L7M P;  2W84 A;  2R7O A;  1D1A A;  4ESF A;  3CO6 C;  1N06 A;  3ZPL A;  3ZCO A;  3MKL A;  2V7F A;  1WP6 A;  4I09 A;  1TVC A;  1LE8 B;  2F5D A;  3U2Q A;  1O7F A;  3JQR A;  3BP8 A;  5HKK A;  3BLY A;  3LA2 A;  1BI0 A;  1R00 A;  3ECH A;  3JTG A;  1XB4 A;  2DU9 A;  3I3L A;  4XBF A;  5LHI A;  4EH1 A;  2Y0M A;  1U8B A;  3ZBT A;  5DD8 A;  4QLC U;  3BZC A;  3I58 A;  4KIF A;  4YHB A;  3R6S A;  1W1W E;  4F7D A;  4ANJ A;  4OOV A;  4YEJ A;  1YTY A;  4U0Y A;  1ZUN B;  1OKR A;  3W6K B;  1IJE A;  1NRK A;  2I1L A;  1V54 H;  5IOY A;  3RJP A;  4A2U A;  1BX1 A;  3OEH A;  5K1Y A;  1TTT A;  2BHZ A;  3J7Z I;  3ULQ B;  1ZM9 A;  2VKD A;  4KIC A;  1EFR A;  4HA8 A;  1FYL A;  4XRF A;  4BYY A;  3CMA B;  2ESH A;  2X3U A;  2D3L A;  4DQK A;  4BAY A;  1KA8 A;  3SYT A;  1YX3 A;  2BM4 A;  4HX7 A;  2VON A;  2IP2 A;  2V79 A;  2X0L A;  3IHU A;  1Q81 D;  2CYY A;  5HXB A;  5D4S A;  3LFU A;  1STZ A;  3H3V K;  2XNJ A;  2HDD A;  5HDN A;  3FK7 A;  3AG2 H;  1UD5 A;  2CBX A;  5LHH A;  1QU3 A;  2V7X A;  3FIS A;  3CCS I;  4Y9U A;  4IF4 A;  4KIB A;  4OIR F;  3CCE B;  3BRO A;  3J7A Y;  3RCO A;  2V7T A;  1NK3 P;  1SC7 A;  5CVJ A;  5LGN A;  3M4O J;  4LFU A;  2O7O A;  4MQ9 F;  2R5Y A;  4IZZ A;  5KAI C;  3IWZ A;  5LFA A;  1Y0N A;  3OR2 C;  2RC6 A;  4YC5 A;  4DNT B;  3WND A;  1R36 A;  3CUQ C;  2EA4 A;  4BBR J;  3KFW X;  3LMM A;  3VOE A;  1OFL A;  3CZ6 A;  2P6T A;  2R9V A;  4UZU A;  4YAW A;  3ZZT A;  1JUM A;  3KZZ A;  3PSF A;  4MFE A;  4RM2 A;  3JU4 A;  1S0U A;  1O88 A;  1IB4 A;  2XRO A;  3CCM I;  4G94 A;  2ZJ2 A;  1SEU A;  4OJ6 A;  3G4S I;  3B90 A;  1D1N A;  5J6X A;  4HST A;  2B9S A;  2K4J A;  1WDT A;  1OGO X;  1JUS A;  4ZTJ A;  1A5J A;  4M0L A;  1IN5 A;  1ITY A;  3MCA A;  1XGN A;  3SEQ A;  3P9I A;  3WU2 C;  4EM0 B;  4F7Z A;  1L0O C;  1IO2 A;  4ITV A;  1BQE A;  1EFT A;  3ZMZ A;  3ZZ0 A;  1OFE A;  1WCM J;  4G8X A;  4W97 A;  4PZJ A;  3OMY A;  4PJM A;  2EWE A;  2NST A;  1WSU A;  4EJT A;  3JX8 A;  5IYB J;  2E1R A;  1D0X A;  3NRV A;  1XX5 A;  1LDD A;  3GX4 X;  3A03 A;  4XON A;  4F52 A;  3HOZ J;  3CC4 B;  4Z4W A;  2ZL6 A;  1VLO A;  3T8R A;  2CQ7 A;  2P6S A;  4KYW A;  1MMS A;  1IRF A;  1GXP A;  2Q2E A;  2VAS A;  4GCV A;  2QGU A;  5K5O A;  4XRS A;  2JMW A;  2QQ8 A;  3ZPN A;  1VQM B;  2CW8 A;  3L00 A;  3WWG A;  2HU9 A;  4S0H B;  5A2Q Z;  1PUE E;  1QVT A;  2EIN H;  4YZ0 A;  2BGJ A;  4LGW A;  5ERI A;  5CQG A;  5TV2 A;  4ZDP A;  1YJN I;  1T8I A;  3C2G A;  3FX3 A;  2E2J J;  4TKO B;  1DP7 P;  4BE0 A;  3BY1 A;  2M5S A;  5KNL A;  3NE5 B;  1T33 A;  1AKH B;  1X4O A;  4KKU A;  4D7N A;  4H4K C;  2W7Z A;  1IDY A;  2E7W A;  4IO9 F;  3GW2 A;  3ZMV A;  1QZZ A;  3N05 A;  3Q0W A;  2W6J A;  4MO7 A;  3P27 A;  1TBX A;  2K85 A;  2Q6I A;  2BW3 B;  2XEX A;  2FSW A;  4NDL A;  2L01 A;  2LH9 A;  4UV8 A;  3GTQ J;  2DY1 A;  4YAL A;  1IF1 A;  3CUQ B;  1LNW A;  3FXQ A;  2GXA A;  3VSV A;  5BSY A;  4PSW A;  1UD4 A;  2FUG 2;  2Q1Z B;  3KP6 A;  4P55 A;  2GM4 A;  3HOX J;  1JNY A;  2HEO A;  1PKV A;  4OJL A;  1H8A C;  3KYL A;  5E79 C;  4KIT B;  1UZC A;  4HYE A;  3S32 A;  3TO6 A;  3E6D A;  3U2R A;  3JRC A;  4Z2Y A;  1MIJ A;  1X1A A;  1U3E M;  5F08 A;  3OYF A;  3K7A J;  2HDW A;  2HR3 A;  2R5Z B;  3CME B;  2QBY B;  2F4M B;  3CJN A;  4DIQ A;  3TP3 A;  4TMZ A;  1IN6 A;  2R7D A;  2O8K A;  4PJN A;  1MJB A;  1O3R A;  2JK3 A;  4Z4Y A;  2LKX A;  4C30 A;  3W2I A;  3CD6 B;  5FA6 A;  5GAH J;  3FKJ A;  2D1H A;  2ZB9 A;  3ISX A;  2IS2 A;  1B2R A;  2DYI A;  1P92 A;  1G4D A;  2MSY A;  3BG6 A;  1T98 A;  4LK1 F;  3F8N A;  1UD2 A;  3ONQ A;  2QKL B;  4CYD A;  4KT6 A;  3I55 I;  1K4S A;  4BXF A;  1EZG A;  2A69 F;  4EJV A;  1VQ8 I;  2BSA A;  2CK3 A;  1WJF A;  4AWX B;  3AVV A;  1A6I A;  3G1O A;  3L7W A;  2F4N A;  1GT0 C;  1F43 A;  1FIA A;  3EYY A;  3I0T A;  1FOK A;  3BG5 A;  1QX4 A;  4UUS B;  4I0A A;  4YFX F;  2O8X A;  3CJQ B;  3IAS 2;  4OOI A;  3FM5 A;  4AIJ A;  5IP6 A;  4NC7 A;  1IV8 A;  3M07 A;  4PJJ A;  4XRM A;  5D5V B;  2MGQ A;  3PA2 A;  1YQA A;  3O2P E;  2BSP A;  2IA0 A;  1ACI A;  3CMM A;  3SQN A;  1RR7 A;  1ZAO A;  4D7M A;  2QEX I;  5DM6 F;  2GJR A;  2YWG A;  2HQ5 A;  2K9N A;  1DU0 A;  1ZLK A;  1FDR A;  2B7C A;  1GVJ A;  1E43 A;  1YHQ I;  2QWW A;  3T0Y A;  1NH3 A;  3VYR B;  1NBM A;  5DN6 A;  2B0R A;  2KRC A;  3QSY A;  4BY1 J;  5M3F J;  3BJA A;  3PUB A;  1ZKG A;  3E97 A;  4XSZ F;  4BQN A;  1T38 A;  1X2M A;  2Z16 A;  3ZSC A;  2LTP A;  1YIJ B;  1R1U A;  2XPV A;  5EZG A;  3HTU A;  3K1M A;  2JDI A;  3GVL A;  2XSJ C;  1IXS B;  1GQ8 A;  3BR3 A;  5ILS A;  4RAG A;  4IHY A;  4KNY A;  1EXM A;  3MCZ A;  1A31 A;  3KX2 A;  5C3E J;  3GTG J;  4B1R A;  3TH0 A;  4WK8 F;  2HVS A; 
#chains in the Genus database with same CATH homology
 1E3Z A;  3OIP A;  3RQ4 A;  1E79 A;  4AVZ A;  3T51 B;  1MND A;  3E0J B;  1WJB A;  3GQB A;  2IGK A;  2R4G A;  1TT0 A;  2XDV A;  4DNR B;  2Z1D A;  4DGW B;  1RU4 A;  2O0V A;  3L2V A;  1WJE A;  2WPD A;  4Z06 A;  4G6I A;  2ZTN A;  4DJA A;  2KQR A;  1W0J A;  2ZTG A;  2PJR A;  4X0G A;  2KPM A;  4Y4R A;  2MC4 A;  3SDB A;  2HLD A;  2L9S A;  4YXW A;  4ASU A;  5FRO A;  3DU5 A;  4E0F A;  3B8Y A;  2KHM A;  1FMV A;  2IQ7 A;  3FY3 A;  1MNE A;  2K9L A;  2LY1 A;  2ZXI A;  2GJP A;  1D1B A;  1I18 A;  3JUR A;  3LSG A;  4FXU A;  2V1N A;  4XN3 A;  2WSS A;  3AKZ A;  2VKH A;  3A3B A;  2WJY A;  3OS2 A;  5HNH A;  2VQG A;  3PFY A;  4AU7 A;  2ODL A;  1H80 A;  2BVL A;  2XF7 A;  3UR3 C;  1COW A;  2I8D A;  3QYB A;  4MR0 A;  1WFX A;  1T0F C;  2IXS A;  3VSL A;  1N77 A;  3CJR B;  1J09 A;  3DPT A;  2DCE A;  2QXZ A;  2A6T A;  3VST A;  3D5L A;  3K4J A;  3VMV A;  1IRX A;  1BR1 A;  2VB6 A;  1Y56 A;  3HPH A;  2F6C A;  3DEE A;  3QOE A;  2W1O A;  4RMN A;  3H5A A;  2MFZ A;  1Y6I A;  3OYE A;  2IS4 A;  3K70 D;  1S9H A;  4LIU A;  4BJ5 C;  3K4C A;  4G7X A;  4II2 A;  2RNG A;  2HPM A;  1OB0 A;  1OHH A;  2VL8 A;  4F91 B;  1X4P A;  4NQW B;  2WB1 A;  1QJV A;  4XN0 A;  3ZXS A;  4AYB A;  1O8H A;  3RPU D;  3GVK A;  2X3H A;  4W8S A;  2WAQ A;  2JJ2 A;  3K4K A;  3OYA A;  1IA5 A;  4E7I A;  3RSN A;  3LSI A;  1UEL B;  4FET A;  3I9V 2;  2M7A A;  4DK1 A;  2VBM A;  2X1E A;  4BQQ A;  2UVF A;  3OFN A;  1FX0 A;  2VQH A;  2IGM A;  4B44 A;  2BOL A;  3DKY A;  1MMN A;  4E7S A;  3OYH A;  3T9G A;  3ZIA A;  2VLA A;  4E7L A;  2ZXH A;  1V5E A;  4DOZ A;  1O8M A;  4II3 A;  4XOT A;  2VXD A;  3UNG C;  3VSK A;  2NSP A;  3HKZ A;  3DU6 A;  1PYV A;  3EPZ A;  4PFO A;  1PLU A;  1VBL A;  3H5R A;  3TMO A;  3OYC A;  2KDO A;  3VWB A;  1Z21 A;  4LIT A;  5CKT A;  4B47 A;  4HG2 A;  4Z03 A;  3ZPP A;  4PJL A;  1EA3 A;  4XLA A;  4PUS A;  1ERD A;  4U4B A;  3VYU B;  1KMH A;  3BH4 A;  2Z2S B;  3HUG B;  3NWT A;  4CCK A;  1RMG A;  1PXZ A;  3K4B A;  3PNY A;  3OS1 A;  3OS0 A;  2XF6 A;  2WY7 Q;  1BOB A;  4E7H A;  2MYS A;  4E7J A;  3OR1 C;  4D1Q A;  1DGR M;  4CCM A;  4TT3 A;  1AIR A;  1DBG A;  2XZP A;  4GQN A;  3H0D A;  3VSU A;  4U7B A;  2L5Q A;  2LBF B;  1BLI A;  1O8K A;  3ZQQ A;  3IAM 2;  1OLT A;  3OIQ A;  3OYB A;  1X0C A;  2INV A;  4LIV A;  3GRH A;  2WY8 Q;  3K70 C;  3QYF A;  3MKZ A;  4N4O B;  2QY1 A;  2R7T A;  3OE7 A;  2PEC A;  2JA2 A;  2UVE A;  4NC8 A;  4CCL A;  4XD7 A;  3OYK A;  1NG6 A;  2KP6 A;  3SZG A;  5LD2 C;  4OZZ A;  2HQA A;  4TSF A;  3K4M A;  2DT6 A;  2MAB A;  4C2T A;  3BCF A;  3GQ8 A;  1LDK B;  2P0W A;  3QOD A;  2R7S A;  3T53 B;  2CMP A;  4YZA A;  1R6R A;  1W0K A;  3PNV A;  4NNJ A;  3OW7 A;  1MW7 A;  2DT7 B;  1X1B A;  4P1W A;  3TBI A;  2XZL A;  4EAT A;  4IX7 A;  4BE1 A;  3K4N A;  2E60 A;  3CP8 A;  3DWL E;  4P5O A;  4BUP A;  1W36 D;  4HIZ A;  3T56 B;  1BN8 A;  4DBR A;  4IQJ A;  4HNT A;  4W8R A;  4N4N B;  4BJT A;  3A3G A;  2ZFU A;  4BEH A;  4HRI A;  4PSX A;  3V42 A;  2F5V A;  1MAB A;  2OV7 A;  3VR6 A;  1SAU A;  4QPQ A;  2LY2 A;  3G05 A;  4Z05 A;  2R7W A;  3IP4 B;  5TGT A;  4JMQ A;  4BDY A;  4ZYA A;  3AL0 C;  2X8K A;  1Z7L A;  3H94 A;  4BGD A;  4XLH A;  4DBQ A;  1O8E A;  4XOR A;  2ZSH B;  4OAY A;  3DLA A;  1PJR A;  2NT6 A;  3BC9 A;  4NK8 A;  3ZRG A;  2O0W A;  3HXL A;  4BQO A;  2O1D A;  5CQE A;  2JVG A;  3LSH A;  1JTA A;  4XL9 A;  5HNF A;  2INU A;  1LKX A;  4KJZ A;  4MXN A;  3PSI A;  4BDZ A;  2UWM A;  4CA0 A;  1V0E A;  4OJO A;  1UG0 A;  1V5F A;  2W82 A;  2X6W A;  2MD0 A;  3UW0 A;  2R7R A;  1MMA A;  3DPU A;  4Y3O A;  2XZO A;  1O8I A;  2PJR B;  3BCB A;  1NG7 A;  3DTI A;  2AQE A;  4CUG A;  1UD8 A;  1OFM A;  3EUA A;  1K6Y A;  2Q2E B;  3VMW A;  2VBK A;  1PE9 A;  4XNF A;  1O8F A;  1X1D A;  3K10 A;  2XGJ A;  2W00 A;  2NTQ A;  3LMW A;  3A4C A;  3W2V A;  3SEZ A;  4HPQ A;  2CS3 A;  3BG7 A;  3DPL C;  2XOK A;  2D3N A;  3A35 A;  4XKW A;  2WZP P;  2WAF A;  2W6I A;  4E4H A;  2M4K A;  3LSM A;  3A1Y A;  1E3X A;  4HNU A;  1KCD A;  1H8H A;  1O8J A;  3EUH C;  3ZGK A;  1N75 A;  1W36 C;  3D5S C;  1Z3Y A;  3GBG A;  2L2O A;  1DQU A;  2WA0 A;  3OYG A;  4RLQ A;  4D9J A;  2IS6 A;  3VDX A;  4BE2 A;  4OJ5 A;  2LYC A;  4B3F X;  3BCA A;  4XQF A;  1GLN A;  3OYI A;  2M4G A;  2R7V A;  1UAA A;  2PYH A;  1QHG A;  2LRE A;  2XF5 A;  3SUC A;  3DTK A;  3DKX A;  2V4D A;  4XM3 A;  2O04 A;  1O8D A;  2CUJ A;  5FRN A;  2IGO A;  1VF7 A;  2K5C A;  3MD2 A;  4YRV A;  1BR2 A;  3B4N A;  4ZC3 A;  4B48 A;  2VJJ A;  2O17 A;  4QPO A;  2KLO A;  4BS9 A;  2X51 A;  3F9K A;  2GK6 A;  3CF2 A;  4URR A;  2JVH A;  2F1M A;  4HEA 2;  2BW3 A;  3AL0 B;  3GQA A;  1O8G A;  5JHF A;  2UV1 A;  1HA8 A;  4J00 A;  2PYG A;  4I84 A;  2JJ1 A;  2VIX A;  1T95 A;  3K4L A;  3CP2 A;  2HVR A;  2CH0 A;  4ZDO A;  2LZJ A;  1N78 A;  4CZC A;  3LNN A;  1D1C A;  4XLC A;  2V7Q A;  3AFH A;  4HWV A;  3S8P A;  4OJP A;  3FBI B;  1D0Z A;  4YZQ A;  4B3G A;  3W2A A;  4OWR B;  1KZL A;  2M0M A;  1OR7 C;  3H35 A;  4B43 A;  4F55 A;  1WJA A;  2KZV A;  1T5E A;  2R7O A;  1X19 A;  2VPL A;  1D1A A;  4RM3 A;  1E0E A;  3S93 A;  2A5W A;  2LOO A;  4NUB A;  3ZCO A;  2ZZE A;  3HAG A;  3WQZ A;  2V7F A;  1WP6 A;  5HKK A;  4E7Z A;  4OZY A;  3DQV C;  5CDF A;  3BLY A;  4BJ6 C;  4CCN A;  5HVQ C;  3I3L A;  2CV1 A;  1HZE A;  1CZF A;  1G8X A;  2X53 S;  4ANJ A;  1FMW A;  4YEJ A;  4LG3 A;  4KKT A;  1WJD A;  1NRK A;  1NHC A;  3OEE A;  3OYM A;  2VQL A;  3EQN A;  3RTR A;  3OEH A;  1DGW Y;  5HLT A;  1WMR A;  2VKD A;  1EFR A;  3VYS B;  4XMY A;  2D3L A;  2OUM A;  3H9Q A;  3L2W A;  2JIZ A;  3HL2 A;  3KRG A;  3SYT A;  1YX3 A;  2VJ5 A;  2CUZ A;  4MLO A;  2NZM A;  1RWR A;  3LFU A;  2JUG A;  2F4I A;  4R79 A;  4JQF A;  4CCO A;  4J01 A;  4ZTF A;  3LL7 A;  4E6K G;  1UD5 A;  2O5R A;  1QU3 A;  1JI8 A;  2VQC A;  3TL4 X;  3L2Q A;  3M8J A;  3OYL A;  3VYT B;  4BEH B;  2ELJ A;  3L2U A;  2DIE A;  4L8J A;  2QKM B;  3H9G A;  3OOC A;  3MKW B;  2JSP A;  3J7A Y;  3RCO A;  2CV0 A;  1EE6 A;  1ZEL A;  2E5N A;  4F92 B;  3OPO A;  3HPG A;  1K28 D;  1UD3 A;  3FDY A;  4IZZ A;  5LFA A;  3CES A;  2KRH A;  3OR2 C;  4P22 A;  2XC7 A;  1YE9 A;  4DNT B;  1KON A;  2HVQ A;  1OFL A;  3LMM A;  1LFP A;  3S3O A;  3CZ6 A;  3OYN A;  1JRG A;  2WAD A;  2R9V A;  3L2R A;  4UZU A;  4RM2 A;  3PSF A;  2PMZ A;  4CH7 A;  2F43 A;  1IDK A;  4G6T B;  2GOM A;  2V4J C;  3JU4 A;  1O88 A;  3DDY A;  4PMH A;  1IB4 A;  3BCD A;  4XLF A;  2X1D A;  3A2K A;  4B3X A;  3HOS A;  4OJ6 A;  3B90 A;  2L9N A;  2ZSI B;  4HST A;  3W2W A;  2AQF A;  1H8E A;  1OGO X;  4ZTJ A;  2K3P A;  3GQ9 A;  3PL8 A;  1Z3X A;  3SEQ A;  4ITV A;  4XKB A;  5HOO A;  1BPL A;  4Y33 A;  4IQ4 A;  2EWE A;  2GK7 A;  3OMY A;  4PJM A;  2NST A;  2V31 A;  3MMY B;  1D0X A;  1KCC A;  3U21 A;  1V5G A;  4XON A;  4F52 A;  5FRM A;  2KL4 A;  2E1M C;  3HOT A;  2ZZQ A;  4HSR A;  3S3N A;  4PK4 A;  4BL0 B;  4F93 B;  3LSK A;  2VAS A;  2V6E A;  1XG2 A;  3ZPN A;  2CW8 A;  4G7W A;  3QYE A;  3WWG A;  2HU9 A;  1IDJ A;  1O8L A;  5C1C A;  3OOU A;  4YZ0 A;  3OY9 A;  2WAE A;  1D0Y A;  5CQG A;  5FL7 A;  4ZDP A;  3FKS A;  4KIS A;  3C2G A;  2WBM A;  3S3M A;  4TKO B;  5KCM A;  2K9M A;  1DBO A;  3OWT A;  4BE0 A;  2M5S A;  5KNL A;  3NE5 B;  2Y0S A;  4CCJ A;  1WJC A;  2W4S A;  4KKU A;  1X4O A;  4W8T A;  4ZJZ A;  1MMD A;  4H4K C;  1BMF A;  1TZL A;  1E1Q A;  3NWS A;  4XKC A;  4XLE A;  4ZDL A;  2Z6B D;  3N05 A;  4IKF A;  1VZ0 A;  3OL4 A;  2W6J A;  2RRE A;  2CV2 A;  1QHH D;  2BW3 B;  2XAU A;  2X6X A;  2NTP A;  2ZZG A;  1KTW A;  2KVO A;  2X1C A;  1BR4 A;  2R7Q A;  2HZD A;  2LH9 A;  3OYD A;  2X6Y A;  3PNT A;  1SFK A;  2NOJ B;  4DK0 A;  3EQO A;  3FHN A;  2VJ4 A;  3VSV A;  4PSW A;  3W3C A;  2WJV A;  1X1C A;  1UD4 A;  4KKS A;  2FUG 2;  2Q1Z B;  4OJL A;  1PKV A;  2DOA A;  4U87 A;  2R7U A;  4RLF A;  3KYL A;  3FPP A;  3KEW A;  4KIT B;  3S32 A;  2QE7 A;  1OOC A;  2NT9 A;  1X1A A;  3OYF A;  3G2B A;  1E1R A;  2HDW A;  4PFP A;  4DIQ A;  2GJK A;  4BAC A;  2LG4 A;  2QX3 A;  4PJN A;  4NK6 A;  2V9K A;  2BVM A;  4C30 A;  1QCX A;  2LC2 A;  3KEY A;  3EUK L;  3FKJ A;  2VJI A;  2VBE A;  2IS2 A;  3BG6 A;  2M3A A;  4W8Q A;  1UD2 A;  2M7B A;  2QKL B;  3ONQ A;  4KT6 A;  3PJR A;  2LRD A;  4BXF A;  1SKY B;  2E1B A;  3OYJ A;  2NTB A;  2CFO A;  4E7K A;  2E5Z A;  4U49 A;  2E1M B;  1U0J A;  2CK3 A;  3H9J A;  1WJF A;  2KMU A;  4YZX A;  1VJS A;  1P9Q C;  3MKY B;  4C2U A;  4Z1M A;  2XND A;  4C2L A;  2ZZF A;  2LBF A;  3C2H A;  2X85 A;  4OAZ A;  3GVJ A;  2HNH A;  3H5N A;  1MMG A;  1VLY A;  1I8D A;  3BC8 A;  3CJQ B;  5KHD A;  2DXI A;  5IK2 A;  3DTE A;  3IAS 2;  1OGM X;  3D5R C;  4F3Q A;  1YX5 A;  4NC7 A;  4PJJ A;  4EW9 A;  3HG9 A;  3E1S A;  2IGN A;  2BSP A;  2Z8G A;  3CMM A;  1K5C A;  4JOM A;  3OL3 A;  4FAS D;  2GJR A;  1HVX A;  1DP3 A;  2RQQ A;  2L7K A;  1UD6 A;  2IS1 A;  1E43 A;  1AA7 A;  2DJI A;  2GOX B;  3IUO A;  3VYR B;  1G59 A;  1NBM A;  5DN6 A;  2V26 A;  2W7N A;  2OC6 A;  2KRC A;  1W9X A;  4GRI A;  3PUB A;  4BU2 A;  1V0F A;  2UUZ A;  4BQN A;  2Z16 A;  3ZR8 X;  5C1E A;  3ZSC A;  4XOP A;  2HPI A;  1HG8 A;  3HC7 A;  4XKV A;  3M1C A;  1WTH D;  1WPC A;  1WJ5 A;  2VXZ A;  2JDI A;  3FBN B;  3GVL A;  3OAA A;  2XSJ C;  3GQ7 A;  3K6G A;  1GQ8 A;  5AMV A;  4YEL A;  4CSW A;  4C9Y A;  3KX2 A;  4XR6 A;  2R7X A;  5CPR B;  1LVK A;  2CW7 A;  2HVS A;  1BHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...