2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
1IDJA 3VMWA 3ZSCA 1OGMX 1O8EA 1O8MA 3UW0A 1O8LA 1IB4A 2NTBA 1O8DA 4YEJA 1PLUA 1PE9A 2INVA 4YZAA 2BSPA 1IDKA 4YELA 3GQAA 1OOCA 1OFMA 1QJVA 4Z06A 4XLFA 4Z03A 5AMVA 2NT6A 4XKWA 5C1CA 2ODLA 4XMYA 4NK6A 4YZXA 2X6XA 1BN8A 4XNFA 3EQOA 4I84A 2PYHA 2O17A 2QX3A 2INUA 4OJLA 1O88A 4W8SA 1OFLA 2VJIA 3SUCA 1RWRA 4AVZA 4W8RA 1OGOX 1KCDA 2QXZA 4XLEA 4OJ6A 4XR6A 1O8IA 4XONA 3T9GA 4W8TA 3VSTA 1IA5A 4OJ5A 4XKVA 1BHEA 2PYGA 3GQ7A 2NSTA 4OZYA 1RMGA 2NTQA 4Z05A 2O1DA 2Z8GA 4XN0A 4XN3A 1O8GA 2PECA 4MXNA 1KCCA 3EQNA 4XLAA 2IQ7A 5C1EA 2QY1A 2UVEA 4MR0A 4YZ0A 3B90A 1XG2A 2VBMA 4URRA 4XLHA 4XL9A 2X6YA 3GQ9A 2NSPA 4XOTA 4XORA 3ZPPA 1HG8A 1NHCA 4W8QA 4OJOA 1O8JA 2X3HA 1EE6A 2O04A 3GQ8A 4OJPA 1RU4A 1JTAA 1JRGA 4NK8A 2VBEA 4PMHA 1DBOA 4YZQA 2O0WA 2O0VA 3B8YA 4XQFA 1DBGA 4XLCA 1O8KA 1WMRA 4U49A 1X0CA 4HWVA 1AIRA 1O8HA 2EWEA 2NTPA 3KRGA 1H80A 3VSVA 2UVFA 3VSUA 1CZFA 2VJJA 2X6WA 3JURA 2X85A 4OZZA 1VBLA 3VMVA 1O8FA 2VBKA 1K5CA 1PXZA 4C2LA 1GQ8A 4XM3A 4U4BA 1QCXA 3LMWA 3B4NA 3FY3A 4EW9A 3WWGA 4XOPA 3GRHA 2NZMA 2NT9A 1KTWA
chains in the Genus database with same CATH superfamily
3CUQC 4RD4A 1POGA 1WOPA 2BW3A 2YPRA 1ZHFA 3PENA 2W82A 3HRTA 3T56B 4KYWA 2VQGA 5FROA 1LJ9A 1G59A 5CDFA 4YIIA 3ASRA 3M8JA 1FDRA 5CVRA 4IX7A 1KK1A 4X0CA 2K85A 2DA3A 3DBRB 4OOXA 1R22A 4HSTA 4XKWA 1S29A 2WV1A 2GLOA 4B4DA 1I27A 4Z4WA 1SFEA 3IWZA 2ZL6A 5J40A 2FX3A 1IN5A 5FB2A 4B3GA 1ZAOA 1EV7A 2R5ZB 1H9TA 2PYHA 5EEAA 5HODA 1I3AA 4AIJA 1MNEA 3J81k 2QMUA 1RZ4A 3FXOA 2VJIA 3Q5FA 3G1MA 4M3GA 2F5VA 2YWHA 3PO3J 5EZGA 4BH9A 2QSFX 2CV2A 5GAGJ 1IG7A 3CCQI 5DCMA 1WOOA 1TYWA 3S14J 5HOOA 4UY8I 2A5YB 1JHFA 3KIOA 2GM4A 1BHEA 2C6YA 4PGHA 5J47A 4RAZA 2DA2A 3EYIA 3WTYC 4E7LA 3NWSA 2AQFA 2KDOA 3EUHC 4HRIA 4J19A 1JGSA 2G9WA 2RQPA 3OS2A 1FLIA 2J8IA 2A6EF 4KFCA 2IQ7A 4E7KA 1EFUA 4X7EA 3HRUA 2BBYA 5EMNA 2EFPA 1A5JA 4NC8A 1KTVA 4OP7A 5IYBJ 4A3CJ 1N78A 3K4MA 3PQKA 4RD2A 3P9IA 1YJ9I 1YITB 1MD0A 5IYNA 2MABA 3IRRA 3JRFA 5H2FC 1N06A 3E6MA 4OPWA 2UXXA 1IV6A 2Q6OA 2M7BA 2HEOA 1CQXA 2DCUA 1QZYA 1JJ2B 3RDIA 2VNJA 1WZ2A 1XG1A 4NNJA 1U0JA 2ECCA 4MFDA 2JQ7A 3ZMSA 2WZNA 1MIJA 5HKKA 1IF1A 5CVVA 3MMPA 3MQ0A 1UHWA 2NYXA 2AQEA 4MNUA 1JRGA 5F6FA 2DK8A 3HDDA 3MHPA 3O8HA 1X19A 1U9OA 3L7WA 2CK3A 2JJ1A 1LFBA 2WV0A 3H9NA 4OM9A 3MD2A 2DT6A 1OCZH 4HQEA 3S3NA 2VNKA 4J0QA 5CJ9A 1ACIA 2XB5A 3BY2A 1ETYA 1MW7A 3B8YA 1P6RA 4LK0F 2QENA 1W5CC 2XF7A 3PJRA 2W1OA 2FBHA 1GT0C 4BXXJ 4YHBA 5J35A 2BM5A 1H80A 4Y9RA 3M3YJ 3ZMVA 4DGWB 2L7ZA 4G6TB 1HBXG 1N05A 2YWEA 2X6WA 2GBYA 3PUFA 4KNYA 1X3UA 3EDPA 1VLOA 4IXAA 2GJKA 1CF7A 1FBSA 3GTKJ 3ULQB 4OOSA 5KNLA 5B3SH 3MAJA 5JHFA 3CC2I 3K69A 1YE9A 4OMZA 4GXOA 2K3PA 4U0WA 5ILUA 2YWFA 3H09A 2DMQA 2B7BA 1MMGA 2V31A 5FKNA 3OSFA 2C2WA 1AMOA 2LLKA 5L3FA 3GVJA 1IRXA 2VOPA 4PJLA 1N0VC 2FRHA 3QU6A 4G7HF 1D5YA 1ENHA 1EH7A 3LO8A 3S2WA 3OIOA 5TY0A 3VYRB 5EF6A 1Y0UA 4M3FA 1MDMB 2LTPA 4Q5SF 4Z4YA 3U2RA 2DDAA 1OFDA 2FNPA 2NVTJ 1YLOA 1XFOA 1FYMA 2L02A 2C78A 2XASA 3ZBUA 2K4BA 2OU2A 5C3EJ 3LSMA 4A6DA 1R4MB 4TT3A 4B3AA 2ME0A 3FXMA 1ZG5A 1I6HJ 3ERED 4A3GJ 2R7VA 4XMYA 4O3MA 2LVSA 4B3FX 3F9KA 4ON0A 4NK6A 2ID3A 2LBFA 2Q6LA 2L9VA 2DA6A 1IN7A 3FM5A 3TL4X 1LVKA 1QO0D 3LA7A 1BLIA 3KX2A 2WY8Q 1WORA 3WGHA 4W8RA 1OGOX 2KIUA 2VFMA 3MKLA 4M6XA 2K9SA 3LAPA 1PUFB 2XAHA 1D8TA 2DOEA 4S04A 4G7OF 1KU2A 3HC7A 4BXFA 3A1PA 4LGWA 1IJFA 1IA5A 1I5ZA 2HR3A 2LDUA 4X6AJ 2E1BA 2PYGA 3ONQA 3FXQA 2X3UA 2YUHA 1FSHA 1P7JA 1DGWY 2XPVA 4ZZDA 4B09A 2Y0SA 3IH2A 3GFIA 3N4MA 4UAJA 2V1NA 3FXRA 3EQNA 2VBZA 2JPBA 5IP9J 4E7HA 2WADA 2V4JC 2LF7A 2JN9A 1AWCA 3PSIA 1J7KA 1G3SA 1CF7B 2VBMA 3F8FA 3FMRA 2Z6BD 1KK3A 4XL9A 3ABUA 3GTOJ 1XMKA 4AD9A 3REOA 2YU9J 2JRMA 5FKOA 2NVUB 2QKMB 3HAGA 1SD6A 3QODA 3D26A 2OBPA 2VUMJ 2DFEA 3OYFA 4G1BA 4IO9F 3I56B 3G4SI 1VQ7I 3JREA 2HU9A 1XQBA 1XGOA 4ESFA 3G71B 3WYAA 1FNDA 3L2WA 4PFPA 3SDBA 1WSUA 3RYPA 3B6AA 2BY3A 1LEBA 2EINH 4MYUA 4PMHA 2NNNA 2A5WA 2CQKA 2DY1A 4WCGA 1KU7A 1DABA 3WU2C 3HGGA 1R49A 2GK7A 1N77A 3WG9A 2VQHA 2MLGA 4XQFA 3JRGA 3CLOA 3OYNA 2JA8J 1QFYA 2R9VA 2V1DA 5DDGA 2CWEA 4H9GA 1TQPA 3JRAA 1QRYA 4M72A 2FD5A 3OZVA 2ZTNA 2ZC2A 1T39A 3FXLA 3KEOA 4BQAA 1ZELA 2KPMA 2Y30A 4OIQF 2ZXIA 4N3NA 3K4KA 4RM2A 3OZUA 4Q4ZF 4WQMA 2LBFB 2RREA 3FHZA 1AOYA 1MNDA 2E7WA 2P7CB 2VIXA 2FXAA 3SHFA 1QPMA 3ONYA 3CP2A 4F55A 2WSSA 3BG5A 3JTHA 4CZZA 4RB3C 4P3YA 4C2TA 1EA0A 4TN1A 3SYTA 1K83J 3ZMTA 3CCRB 1NB0A 4OINF 1FJLA 3FY3A 1GXQA 1W7PA 4P26A 3MVPA 3F6OA 3KYCB 3SZTA 3CC4I 4RDLA 1ULYA 1USTA 4KIFA 2R7QA 4A5MA 3BQYA 1N08A 4HG2A 2TRTA 3W2WA 5JLVC 5E18F 1EH8A 4G7ZF 4DIQA 3GQBA 1NHAA 3OL3A 2PMDA 1T0FC 3TMOA 4KMFA 4RA2A 4C3HJ 1B2RA 4MQ9F 1COWA 3JSOA 4HX8A 1SMTA 3K1MA 2K9MA 2OTJB 2DMNA 1VQNI 4Z06A 3T0YA 3ZQQA 2XAFA 4ACAA 1WPKA 4I7HA 2ZBKA 3L09A 1CGPA 1H8EA 3ZZTA 3HKZA 4BQNA 3AVYA 3QQAA 4DQ2A 4QFMA 1DDNA 1BMFA 1YITI 1DQUA 2F2EA 4DK0A 3OJXA 1E63A 4HNUA 2RVCA 1ELOA 5F1JA 2B0LA 3TEDA 1ZG1A 2VE9A 4PZJA 4FWTA 1BR4A 3H1CA 4PJJA 4AVZA 2ZJQF 3CCMI 3ZQLA 1Z0XA 2ZKZA 3P4GA 3AGPA 3F8CA 2HQ5A 3F8BA 4XR6A 2JA2A 2QTZA 2VC1A 1X58A 1QVTA 2K86A 4WK8F 1QFZA 1OYWA 4TMVA 1KRHA 4M1KA 3JQQA 1SFOJ 3GTJJ 5LHHA 2VFPA 3T8RA 3GVAA 4XN0A 1IN6A 2PMZN 1LFUP 2OF7A 1Q9SA 3RPUD 3SEQA 1QFJA 5FIUA 4RB2C 3H94A 2DPDA 1A04A 1M1KD 1RR7A 3B90A 2CW5A 1XG2A 4FISA 1TNTA 5M5WJ 1C0WA 3K9TA 5GP9A 4XLHA 3HIFA 2V7XA 4XRSG 2PMHA 3HSEA 1GV5A 3OYJA 4HA8A 2AHQA 4CGZA 2PEXA 4P1WA 1NHCA 1H88C 2BYVE 1JKOC 5IK2A 1FOYA 4W8QA 1VQKB 4IZZA 5BQTA 1W7PB 2N8GA 2KJBA 3O3KA 3BR0A 1STZA 3A0BC 2FUG2 5LGTA 1W0TA 1EE6A 3SZEA 2MBFA 3C2HA 5E1XA 3KZZA 2E2HJ 2ZJRF 1IUFA 1TSPA 3E1YE 4G9YA 3A35A 3HBLA 2PE3A 3FBIB 1G4DA 4NK8A 2OZUA 3AAFA 2HVSA 3GTPJ 5KAIC 2NRAC 5F1RA 4LLLA 2EJRA 4UNOA 2M34A 5FKMA 2RQQA 3QFRA 4MTEA 2UZKA 1JA1A 4QV2A 2Q1ZB 3IHUA 3DTKA 2X51A 4FQGA 4FT8A 1VF9A 2WAQA 3N6ZA 3TO6A 2PJRA 4KKSA 2HXIA 4QSHA 1GAQA 3HUGA 2M7AA 3PNVA 1TP4A 3KP6A 3L2CA 3NAUA 3P9CA 2G0EA 3JURA 4RBOA 1EWYA 2Q0OA 3MEXA 2BY1A 1BR2A 1P9QC 1XPXA 3OEEA 5DNSA 4A6EA 2V4DA 3RQ4A 2DYIA 4EGZA 4P9SA 4CYCB 3J7AY 1MMDA 3R6JA 1Z05A 4M6VA 4XBFA 4E6KG 3DKWA 1QCXA 5IOZA 3LMWA 3PA2A 2A68F 4XOPA 4CUGA 4X05A 4HF2A 3ZMUA 2CUEA 1T98A 4MO7A 1JKPC 4BY1J 1TWGJ 4G7XA 3GRHA 4EJTA 4L9TA 5M5YJ 3NRVA 3OYIA 4Y7CA 1SD4A 3U1KA 5F08A 1WSRA 1J59A 3OYAA 4JOMA 1Y8RB 2HFHA 2QGUA 2GJPA 3A8JA 4RPBA 1WWXA 4G12A 1YFHA 2E1RA 3UW0A 2V7UA 1IB4A 2A69F 1D8KA 2MGQA 3DU5A 3RKWA 1FY7A 2BM7A 3RIQA 2EPFA 2OJED 1WKMA 2F6CA 1SANA 3PSFA 4P9FA 3GTLJ 2EZLA 3ASQA 4DYCA 3F21A 4PJNA 1DPRA 1VFCA 4V02C 4ETSA 5C44J 4AF7A 2XNJA 4HE5A 1S7OA 3HXLA 3L2VA 1N07A 1FOWA 1D5VA 1ZKGA 2X6XA 3VSLA 1XB4A 2UUZA 3DBHB 1FWZA 2MD0A 4RPDA 3T53B 2PMUA 1YIOA 3KE2A 4ZJZA 3H5RA 1T6XA 3E7LA 4ABZA 2QZ8A 2GJRA 2A61A 3H3UA 1W4MA 5HDKA 3I56I 3JAMZ 1YJWB 2PJPA 1SKQA 5DN6A 1Q86D 2HZDA 2L5QA 4XLEA 2PG4A 3G71I 1XB2A 1XCVA 3VSTA 3GVKA 4BYYA 2CFXA 2NSTA 2WB1A 4ASNA 5DM7F 2H8WA 4M3DA 2DXIA 4OPVA 1K8FA 4Z05A 2R7RA 1YX3A 1XS9A 2ZXJA 2IS6A 1U5TC 3HOSA 2KVOA 1MBEA 2E1MB 1T6SA 5D5UB 1N0UA 4Z4SA 3HGYA 2GIZA 4YZ0A 4CYDA 1BI2A 4DJAA 1ZH5A 3DCFA 1IV8A 2KLOA 4RMNA 3WY9A 1BIBA 4JX6A 1N25A 2F1MA 4RCYA 1REPC 4EVIA 1Y0NA 2E5NA 2F4OB 4UHTA 3TDZC 2W7NA 2QF7A 1J75A 3VB2A 4EM0B 2HGCA 1K8AD 4ZGNB 2KFDA 2TCTA 2GAUA 4RB0A 4DNRB 2XAQA 4KT5C 1HXDA 2LKPA 1WGXA 3GQ8A 4B48A 5H6RA 2XTWA 1NH3A 4FXUA 2JIZA 2FU4A 2KP6A 4CO8A 1KZLA 4LMYA 3OSGA 4RM0A 5FD6A 4IHTA 2CV0A 5FL7A 2D1VA 3ABTA 2EIJH 1I18A 3K1PA 4ENMA 4YZQA 4OMYA 3TDUC 3AKZA 4YAWA 5B1BH 1YJNB 1S0UA 3K4CA 1UAAA 1KQ8A 2ZZEA 3J81Z 3K70D 4CCNA 4ZYAA 4UB8C 3OOCA 5FLVA 2OTJI 4P22A 3S93A 4D9JA 2ZL7A 3JQRA 1CZFA 2WAFA 3R6SA 2JPCA 2JK3A 1VLYA 2W25A 2YUSA 4RGSA 1H85A 3ZIAA 5F4MA 2YR2A 2O7OA 3L2RA 2DI3A 4UB6C 5GAEJ 4M53A 2BF4A 1OR7C 1X1DA 2VXDA 3HJEA 4HNVA 2HDCA 5KW9A 1YIJB 2H6BA 5HDNA 3L2UA 2V1UA 3NE5B 5J8CA 4ESBA 4A3JJ 2LD5A 5DTDA 3QPSA 5HLGA 5LMZA 1ZRFA 3AL0B 2WJVA 4LB5A 4WZTA 4C0SA 2VJ5A 1TNSA 1T6YA 3DKYA 1O8LA 1B1BA 5AIQA 2L4AA 2XTYA 2Q6IA 4YEJA 3E6BA 2PBIA 4PJMA 1PJ7A 4AC0A 2BN4A 4I09A 2ZNZA 3GZ6A 5M3FJ 4KKTA 1YS7A 4II3A 4IRHA 1ETWA 1X1CA 2Y2ZA 3KPHA 4BE1A 4YFKF 3BR2A 1HKTA 1X1BA 1O4XA 1ZRCA 4YCQA 1W34A 4AIDA 1VQ8I 5C1CA 3IH4A 3W2AA 1DGRM 1PVEA 1L3LA 2PX9A 2I5UA 3CQZJ 1YYVA 1OFEA 3LFKA 1KC8D 2A3SA 3OS1A 2DFHA 2KIQA 5B5EC 5K5RA 2OYNA 3JRCA 5CPRB 2L01A 3VYUB 3Q0VA 5IOYA 1K28D 5D6FA 2X4HA 1B72A 2JJ2A 3SLDA 1MGTA 4IPAA 1YTYA 3VMFA 5FO5A 5DS0A 3LMMA 1MZBA 4M74A 1V55H 1FNNA 1V54H 2HTSA 2IXSA 2CUZA 2C5HA 4XKVA 2D9RA 3GLLA 2ELJA 2M2EA 3IKTA 4A3IJ 4NBQA 4FASD 2Z99A 1D1CA 2DT7B 4CZCA 3WBJA 3WGIA 3HRMA 4LLGF 3RPQA 2IW5A 2XPWA 1R1UA 1XMAA 3FWEA 3LQEA 5C1EA 3FXKA 4YXWA 3MN2A 5CKTA 4XICA 3W2HA 4P6VF 1UMKA 3CO7C 1S9HA 3A3GA 2F5CA 3V8LA 3CF5F 3RI4A 3ZP5A 2WAEA 3CD6I 1J5YA 4UV9A 4XORA 5HNFA 2J5OA 1R5HA 2VASA 3JSPA 4HF0A 2XZPA 4IHVA 4MFEA 3B82A 3QYEA 5KK1A 4OJOA 1R1VA 2KHMA 2L9SA 3TO9A 5A2QK 2NOJB 4QWQA 3KLNA 3KFWX 2OCCH 4PSWA 1WU8A 5J3LA 5FJ8J 5IT9Z 4BPRA 4BU2A 3ZOBA 3BG3A 4A69C 2V7WA 2VBWA 5DYMA 2XIGA 3R0AA 4TMXA 4R8HA 1KU3A 1WOSA 1XD7A 1K73D 1ZM4A 4UUTA 3SY2A 3JR9A 1YRNA 3HHHA 3OYCA 1ZARA 4M3BA 3K4NA 1VI0A 2WY7Q 1QHHD 2VJJA 4BBSJ 2QQ9A 2DJIA 4D7MA 4AF6A 5CVIA 4B43A 5E3NA 3HOYJ 4EQQA 3H92A 2UWMA 5JMCB 2R93J 5H20A 2XZOA 3V8JA 2K4JA 1WQ2A 2PIAA 3UKGA 4HEA2 2IOUG 4UUSB 1YJWI 4Y15A 2LG4A 4P96A 2R7UA 4YALA 4ZGQB 4JQFA 1MJAA 1MABA 4YRVA 1G3WA 3OOUA 2LMDA 2JA5J 2XAJA 2RGVA 1O8EA 2H1LA 1ORKA 4IHSA 2OPTA 4E70A 4G7WA 2OCEA 3KP5A 4ZTJA 4U87A 3CJNA 3GUDA 3DU1X 4C30A 4IF4A 3R6KA 2AO9A 1FMVA 1QZZA 2FX0A 2XF6A 3QPHA 3AG2H 4EEFG 2FBKA 2M3AA 4IKFA 3CMEB 3E5UA 2W00A 4NDLA 3MCAA 2OV7A 3RZOJ 1RPWA 1BN8A 1Z7LA 1IRZA 4YG2F 1T95A 4NQWA 1U8BA 4I84A 4C3IJ 1IXCA 3R4KA 1VQ4I 4B47A 1LKXA 2XGCA 4R79A 4P6YA 4W8SA 1YW9A 1OFLA 3SUCA 2BOLA 4UV8A 1MMAA 3K7AJ 2QXZA 1MH4A 3A0HC 3KLOA 3LWFA 3W6JB 3I1FA 1UELB 4IQ4A 1O8IA 1B59A 4M3EA 4WZLA 4XLPF 2VLAA 5FKLA 3WODF 1R71A 1EP3B 3OYBA 3BCDA 5E1WA 2NTQA 1QBJA 2M30A 1YJNI 1R9TJ 3V4GA 1YRNB 3S15J 3KEQA 1O8GA 1OQYA 3EQLF 1KA8A 5H59A 1IXRC 2P5KA 1R6RA 2DAOA 1D3YA 4MR0A 4X0GA 1RKWA 2DTZA 3G2BA 3CF2A 4B1RA 3PM1A 4W97A 1WJBA 2IA0A 2HYFA 2KZVA 1UFMA 5EEGA 1YIJI 4ACBA 4HLXA 1W87A 3FM3A 5J4VA 5F0HA 1X3ZB 2FQ4A 4TMZA 1O8JA 3CCEI 4RLZA 5DEQA 1T5EA 2VZLA 5F4JA 2CUJA 2LOOA 1FYKA 4L8JA 1AKHB 1EP2B 2WJYA 1DBOA 3F72A 2XROA 4P5OA 2MG4A 3W6KB 3U6KA 2EH3A 2WTEA 1Z7UA 2A6TA 5K5QA 3HOUJ 2IA2A 2O0VA 3K70C 2AXLA 4P55A 2CQQA 2DYRH 3CCJB 4HWVA 2V1XA 4A5NA 2R7OA 2ZJ2A 3E6DA 5EG0A 3DFGA 4E0FA 1LM1A 1B9NA 3VPRA 1DU6A 3HEFA 4NQWB 3FPKA 1RRJA 1VBLA 3FK7A 1PKVA 4C2MJ 4IHXA 1H8HA 5E17F 3TO7A 4XM3A 4PSXA 2GQFA 1HF0A 2BW3B 2FA5A 4WWVA 1O57A 2Y9YA 2HS5A 2XAGA 2FQ3A 3NWTA 4D0PA 2R7SA 1FTTA 4HPQA 2NZMA 5D5WB 3OV8A 2B63J 1YW7A 1QRCA 1E1RA 3BC8A 4BHPA 1HQCA 1R5GA 2NVQJ 3OYLA 2HDWA 3QPLA 3S8PA 3SZGA 3IV5A 1GJRA 2ZMEA 2DODA 2OAZA 2XRLA 3S3MA 1G8XA 3WTZA 4BEHA 4DNCA 2JJ7A 4CSWA 1YHQI 3E6CC 1NK2P 5B1AH 4FK8A 1VQ5B 3GW2A 2F4NA 2L54A 2HKOA 2X48A 4AIHA 4OPOA 5FO0A 2XGJA 3ZGKA 3J7YJ 4ANJA 1W7PD 3Q9SA 5HS9A 5LFAA 2ODLA 3FDYA 4BACA 3GFJA 5IP7J 3SQVA 4KIBA 4YZXA 2WPDA 4XNFA 3ONUA 1KQSB 1JHHA 3FMSA 4CCMA 1GDTA 3DLAA 5DCMB 5BPIA 3E5QA 2M45A 5M5XJ 1U6GA 1J0RA 5IYQA 4CQJA 4F52A 1MNMC 2DA5A 2L9NA 4AUXA 2XRNA 1X1PA 1BC7C 2YS9A 4MQVA 1P4XA 4BGDA 3OYEA 2QDXA 2P5LC 2R7DA 3Q39A 4Q47A 2E35A 3KP3A 2X1DA 4ZYGA 3KP7A 2CC2A 2ZSIB 2D3LA 3OFNA 4PK4A 1B9MA 4OZYA 2GQQA 1LB2A 3ECOA 4OPSA 3GIRA 3ASNH 1ETVA 2LKSA 4L9JA 2PI0A 1ZUNB 2MFZA 3RQIA 4CH7A 2P6SA 5EG0B 3WE2A 3QYFA 2VFQA 2YX4A 2BGIA 2BM4A 2FE3A 1F4KA 1Y39A 2HVRA 1KQ0A 1O7LA 5F27A 3S2DJ 2OBSA 3T5XA 1I1SA 2XZLA 3BR6A 1BJZA 3MMYB 2ZSHB 4NCNA 3OW2B 3ZPPA 4CDGA 4RD0A 1SAXA 3BH7B 3O2PE 2P8TA 3E3VA 3ZN0A 1ZM9A 3IAS2 1RUOA 3K2AA 4G8XA 1G7RA 4LBVA 4X06A 1MBKA 2JSPA 3O8GA 4KDPA 1T8IA 4YIRX 1D8JA 1YS6A 2YWGA 3FKIJ 1SD5A 1LUJB 1HW5A 1XDSA 5TRDA 2F5FA 4WXHA 4MIMA 5JVTA 4H4KC 4HSRA 5LD2C 4IJAA 1JNYA 4PC3A 3JW4A 3L00A 1YOVB 2W84A 3TOAA 3VEPA 1Y8QB 3I71A 4BEHB 1E3OC 4J00A 3RYRA 4GQNA 3M1EA 2JUCA 1WJEA 1JUMA 1XDUA 1O3RA 3VFZA 3BTLA 2NTPA 4LK1F 4BDZA 3D0SA 1TVCA 1VQ6B 1A36A 4L5EA 4RS8A 3JX8A 2LC2A 1TQIA 1IUYA 1IO2A 1U9NA 3E97A 3DU6A 4F92B 3VMVA 2BXZA 2QGGA 1HW2A 3BTCA 3H9JA 2XV4S 2ZZQA 3ROUA 2V9KA 1Z67A 3JRDA 1GQ8A 1L0OC 4BY7J 3GWZA 3K2ZA 2QA4B 1FP1D 2CS3A 2RC5A 4ENNA 4JP0A 5JFRA 2UXNA 1R5ID 3E5XA 1VQMB 4Y33A 1YLFA 5KSWB 3KZIC 1R4NB 1K9MD 5IY5H 1FT9A 2E60A 2IPQX 1FZPB 3TKYA 2HQNA 5IYDJ 1SM4A 4NHJA 5JVGF 1GV2A 3CCUB 2DTRA 3LSIA 2E1OA 3ZZ0A 4DOZA 1V5EA 3TOBA 4I76A 4I2OA 3BROA 1TYVA 5BSYA 2ICWG 3LNNA 3V76A 1OOCA 4O6JA 1EF4A 1ZQ3P 2FSWA 4RGUA 2L2OA 2FBIA 1SD7A 2LY1A 1DDIA 1XGSA 3ZN1A 4BUPA 1BIAA 2KRFA 3RTRA 2WWYA 1WHUA 1ZK8A 3OS0A 1TTTA 1OKRA 2DMUA 2ADUA 2KJCA 4LBZA 4PGOA 3KP4A 4E4HA 2IGMA 4L9VA 1VQPB 2VFNA 3C3WA 3HKZN 3X2QH 2RNGA 2NNYA 2CGPA 1O88A 2YSRA 3OR2C 3AVXA 4G6DA 2R5YA 1UCRA 1HLVA 1X1AA 1FPQA 1CNFA 1GHCA 4G1VA 5L3BA 3F3XA 1IRFA 2OZ6A 4OWRB 1ZG3A 3FISA 4XONA 4TKOB 3W5VA 1KYZA 2CH0A 1JUSA 3DV8A 2CRGA 4HDVA 2HDNB 4UVCA 3PETA 3VO2A 1IN8A 2PLFA 3LA2A 4U88A 2Z8GA 2OQGA 3B78A 4CA0A 1DG1G 4P2NA 3CCJI 1V0FA 2ESHA 2P7VB 2K3FA 4OIPF 2DOFA 3LVBA 3QFSA 2BVMA 1HDPA 3LFUA 1QX4A 1XSXA 3DWLE 1KMHA 2ZO4A 1Q1VA 2CO5A 1WJFA 1OB2A 1IDZA 2X53S 3Q6QA 4UZUA 3W5HA 3P27A 4YEIA 1KD1D 5JHUA 4JBAA 3W2GA 1I1GA 1X2NA 2HNHA 1EZGA 3BG7A 3QOEA 2D45A 3FK6A 1QQ1A 2DFFA 3HSFA 3WGGA 3TP3A 5EZHA 3GTGJ 2O04A 5FD5A 1IGNA 2O8XA 4OJPA 4E7IA 1IHMA 5HZBA 3LSTA 2COBA 1U2RA 2DLLA 2VBEA 1BX0A 3TP0A 4YIFA 2OK8A 4WXCA 4Q7JB 1U3EM 5CYVA 4JX5A 3BOQA 4OIOF 3CRZA 3BCAA 5FRNA 4DK1A 3C2BA 2LKXA 2GXBA 1VZ0A 1D2EA 1FC3A 2E71A 1K4TA 1VQ5I 1IJEA 4J01A 2LYCA 1EJ9A 1UG0A 1RQRA 1HC8A 4ZYEA 2DIEA 3LNQA 2ZCWA 1LDKB 5GADJ 4GRIA 3OYDA 5TV2A 1D0XA 1YI2B 2WAQN 3DF8A 3BDDA 4L18B 3D5LA 2B7EA 4OIRF 2OD5A 2XNCA 1MBFA 5M3MJ 1PXZA 3HRSA 4RLQA 2Z16A 4AYBN 1G7TA 2HOEA 2W6JA 3FJOA 1W5SA 4JRAC 2VL8A 3K0LA 1JKQC 1FX0A 1HSTA 1Q1HA 1KYWA 3M8FA 4CCJA 3JRIA 3S1NJ 1DARA 4CCKA 4HE6A 3WWGA 1FIPA 1YX5A 3GFLA 2EIMH 1SFUA 1BJKA 4BQOA 1U5TA 2JT1A 1E3ZA 1OB0A 1OISA 1IJWC 2NT9A 4MEXF 2EWNA 4OU0A 4BE2A 1R58A 1A35A 1ZR2A 2EFGA 2R7WA 2EILH 3MKZA 2MC3A 1ZLJA 3U6BA 3GQAA 1TUIA 3WTUC 2GPJA 1WTHD 1T08B 3KL9A 2QZAA 4G5GA 1FSEA 4F91B 4Z03A 2V7VA 2DU9A 3OPOA 4MLOA 3CMMA 3WU0A 3GZNB 3SFIA 2NV4A 4M4SA 2JN6A 2Z2SB 3ZQHA 4A0XA 4CCLA 5HNHA 4M0LA 2L7FP 3G6EB 4I02A 1LFPA 1WP6A 2XT4A 1F43A 1DU0A 3ISXA 2VBUA 2V6EA 4RM3A 1J9IA 2DN0A 3F22A 2CF4A 5D5XB 3ASPA 3B6CA 3V7RA 4PC6A 3WNBA 5K7ZA 1NBMA 2CFOA 1VQ9B 3IAM2 4A2UA 3EYYA 1BI0A 4OOIA 3OAAA 2QTLA 2R92J 2OTLB 5EJCA 3DTEA 2H94A 3QOPA 4HV5A 3WHCA 2DOAA 4YAFA 2H27A 2Y31A 5EDNA 1W1WE 5D4RA 3ASOH 3H9GA 1FNCA 3PSZA 1Z91A 5ICCA 2COMA 4Y13A 1OR7A 1E79A 2RC4A 2Y0MA 4QLCU 1VQ6I 2FMYA 2Z9OA 4KISA 4AVPA 2XSDC 3H9QA 3ZQIA 4AWXB 3M9AA 2V26A 1YW8A 1T56A 2X0LA 3IWFA 2Q8KA 3OOPA 3S32A 1LPQA 3IUOA 2P4WA 2R4GA 4L5IA 4RGXA 2DMTA 1BQEA 4LIUA 5GV7A 2QA4I 5LRSA 5HXBA 1BJAA 4BS9A 4Z6YA 3L9FA 4Y7NJ 1Z21A 1UB9A 2EQRA 1OGJA 1RQPA 1LNWA 1IXSB 1FIAA 3BH4A 1SEUA 1F9NA 2B9SA 1CQTA 5THXA 3B73A 1XSVA 1ZTRA 3KP2A 3W3CA 1JTAA 2W24A 3TGNA 2Z3YA 4EJOA 2ETHA 3NB2A 1NDHA 4RDKA 2PJRB 4Y4RA 1B6AA 2CRVA 2ZL5A 3HUGB 3I53A 5E8GA 2MLKA 3COAC 3N97A 2YU3A 1HCRA 2ZFUA 4YFNF 4IHWA 4R71A 1LDDA 1O8KA 1NK3P 1WMRA 4U49A 5EGOA 1O8HA 4QVJA 1H0MA 2WC2A 4RB1A 1VJSA 1Y1WJ 5FFXA 1OCOH 1QA6A 4BKXA 1V0EA 3I4NJ 2GK6A 3HSRA 1PJ5A 4KICA 3CCSB 5LGNA 3RY8A 2X85A 3CCRI 4N0BA 4A3LJ 1BN5A 3KEWA 1TYUA 1K5CA 1TC3C 5KCMA 4F7ZA 1S6LA 1HW1A 2DJNA 1VQPI 1XCBA 2RDPA 3K4LA 1X4PA 1V3FA 3IL2A 1BOBA 4FX0A 3GYHX 5HZAA 2QEXB 1S3JA 4FN5A 2STTA 3WTWC 3C1DA 3RPUA 1JT0A 4ZCMA 2E1MC 1D0ZA 1K4ZA 2QM3A 4WWCA 1OB5A 5FFZA 3WE3A 2Q2EA 1QZEA 3AG4H 3RZDJ 5IT3A 1KQ5A 2CNDA 1VTNC 2CMPA 2P81A 2DA1A 5JR3A 1AU7A 3Q3AA 4KIGA 2EV6A 2JVHA 3AK5A 2BSAA 3H0DA 3TH0A 1ZR4A 2XKOA 1E0EA 4NC7A 2XTXA 1OLTA 5DCFA 4ZDOA 5LEJA 1UHSA 4Z2YA 1W0JA 4P25A 1ZREA 1R5NA 3QPTA 3BCBA 4B3XA 4GFBA 3M4OJ 4LD5A 3CDLA 4PCQA 4LBWA 1WPCA 5F0CA 4O5VA 3J80K 1BL0A 3K10A 1KU9A 3MWMA 3S2HJ 4HBLA 1I8DA 5BS6A 1XX5A 3PNYA 3K4JA 4TV7A 4BJTA 1AHDP 3DEWA 4LLNA 5BSXA 4OJ6A 1EFTA 4S05A 2IRFG 3JQPA 4Z4VA 2E34A 2H8RA 2DFIA 5J4YA 4W8TA 3OIQA 3A02A 1W5TA 4OJ5A 4LFUA 4D1QA 2C4UA 3LSPA 2HXOA 2RNJA 4ESJA 1DP7P 3W2EA 3CCQB 3DEUA 3I64A 4PDKA 2XUBA 1I7PA 2NAZA 4U0VA 5EGOB 3BJ6A 3G73A 5HLIA 1KCCA 4BJ6C 1T38A 1TWCJ 2NS0A 2P6TA 1BW5A 2J8KA 4ZCLA 4PABA 1MJBA 1RNLA 1YI2I 2V9VA 2PFBA 2HQRA 1HSJA 1F36A 1SMYF 1VQKI 2NSPA 1MKMA 3AG1H 2VKVA 3AL0C 4RD6A 2IT0A 2XC7A 4TSFA 3BPVA 1WJAA 2GXGA 3BTIA 5JLXA 2G0YA 1I6XA 3ZMZA 4E7SA 3ISPA 5L3EA 1SFKA 2X3HA 2L7KA 5KAFC 3OWTA 3BZ6A 4HYEA 4K2EA 3S3OA 3CCLB 4G94A 4QIWN 1IZ1A 4QHYA 3Q6RA 3G1OA 2HKXA 2IBDA 5D4SA 3DEEA 1P4MA 2D74A 5DD4A 2EB7A 2E2JJ 4RCZA 5E20A 3BH6B 3ASSA 1V4RA 4Y17A 3AFHA 3GVLA 2A07F 2GREA 2O0WA 3I58A 3LSGA 2FOWA 2GIVA 3ML6A 4RDUA 2D5VA 2QUFA 4A3EJ 5GPAA 4MGRA 3FPPA 4KA4A 5E1ZB 3A3BA 9ANTA 6PAXA 3CUQA 2R7ZJ 2KRHA 3OY9A 2HPMA 4OZZA 5D8LB 3ZRGA 4D5CA 3G6EI 3WTTC 1PJ6A 4FE4A 4MEYF 3DPUA 3HYIA 4KMUX 2HOTA 2R6HA 2QQ8A 4Y52J 1A6QA 5A2QZ 3J7ZI 4QPQA 3QP6A 5IYRA 3BY6A 3M8EA 2EFNA 4EGYA 2L9RA 4I0BA 4ZDPA 1VQ9I 2IVMA 4DQKA 3HOWJ 2BY2A 2ISYA 1JI8A 1AIPA 5JLWA 2F4IA 4IQJA 1JT6A 5F04A 3OZWA 2FJ1A 2LNBA 5L3DA 1YO5C 3GMEA 1B8IA 2OTLI 3IKVA 3ZSCA 3SLNA 5CVUA 3H5NA 1R36A 2IEKA 1KK2A 1LQ1A 2I8DA 3GCMA 2IGOA 4R1HA 4E7JA 2FVGA 3BC9A 4NBSA 3E1SA 4YELA 5FLXK 4XLNF 2LRDA 3VDXA 3DKXA 1ZLKA 2XOKA 2CYYA 2HCJB 2QQBA 1VHEA 4XKCA 1LEAA 2ME6A 4AIKA 3QRFF 2DBBA 1QVUA 3LSHA 5AONA 1G7SA 4PFOA 2G7UA 2O6WA 1HKSA 1QNTA 3FKSA 1B72B 3CESA 4N4OB 2RV8A 2BHYA 3EUHA 3PIOF 2VBTA 2MC4A 1KGSA 1VQOB 2XHKA 3VSKA 3F0CA 3FHNA 4WXDA 4PC2A 3RKYA 1PJRA 1QGAA 1CLWA 1Z6RA 4G6QA 2MSYA 2EK5A 3MCZA 1K4SA 3GBGA 5FGMA 2M9HA 4EJUA 4LJZF 5LBQA 4A3MJ 1G7CA 3B8HA 1R1TA 3I3LA 2R5ZA 1DPUA 3FMQA 3T1BA 3HL2A 1W0KA 2CQNA 3I0TA 2CUFA 3CJTB 4HX4A 1WJ5A 4WZKA 2JWTA 4RD3A 3F23A 1ETOA 3Q0UA 1TYXA 1OMIA 3SQNA 2VBVA 3WU1B 4RAYA 2FNAA 4RJLA 1OCPA 2KMUA 4JMQA 2K7LA 5C4JJ 2K9QA 3H36A 2MYSA 4YFXF 3Q38A 2W4SA 4ENKA 3CUQB 3CTAA 3F6VA 3ABMH 2CW0F 5IYCJ 4URRA 2QSHX 3A4CA 5GTHC 3GQ9A 2O8KA 1G3TA 1SVLA 5L46A 4FX4A 1OJLA 3TW7A 3PQJA 3BTJA 1Z3YA 3JU4A 2M8GX 1JTYA 3R60A 4RGRA 4EV0A 4A3FJ 2VODA 5IPAA 2X6OA 3OIPA 3VYTB 2QEXI 1TL8A 1M90D 1HA3A 1EA3A 3BY1A 4XSZF 3NQOA 2KQRA 2V6CA 3O6BB 4HLYA 1B8IB 3P9KA 4M9ZA 2NS7A 2HVQA 1IN4A 1K6YA 3M07A 3KETA 4M2LA 1BC8C 1RI7A 1D0YA 1ONVA 5GTIC 2BM1A 2CW8A 1O3QA 3SJMA 3ZBTA 3FIWA 2O3FA 3RIRA 2CV1A 3NAWA 1A8PA 1E43A 1UD3A 3OJWA 4A93J 1WH5A 2OBRA 5GPCA 5HLHA 1F20A 3ZC3A 3NARA 4HAMA 4P9UA 3T8TA 1LE8A 3AVWA 2KL4A 5JI6A 3MZHA 1I3QJ 2KISA 2R7FA 5J6XA 1R7JA 3ZPLA 4GDFA 3LYCA 3ZQCA 3HZJA 3KCCA 3HOVJ 1P4WA 2ECBA 4KJZA 4G6IA 3BQJA 4IL6C 5F64A 1OCTC 5J8FA 3F8MA 2IA1A 1NB9A 3N90A 4BJ5C 3QU3A 1Q7YD 4B44A 2W6IA 4BBRJ 4FTHA 2QLZA 1K78A 3ZPNA 1WJCA 5LEKA 3CC4B 5ICFA 1QGYA 3JTGA 3W6VA 1E64A 2NVYJ 3R0JA 2EZHA 3ZZUA 4Y9UA 4YDTA 2YX7A 2JSCA 3BR3A 2VI6A 4IEJA 1I39A 2H1KA 3CMAB 4Z1MA 2LFBA 1JUPA 1MDMA 1OGIA 1ODDA 2HZTA 4XLFA 1TBXA 2HOSA 3I54A 2STWA 2ZNYA 2VONA 3A2KA 5AMVA 2BY0A 3WHBA 3CDIA 4B8XA 4KITB 3WG7H 1S5LC 4DW6A 5ERIA 3VWBA 1VQNB 4BQQA 3HOTA 3A1YA 5D8KB 4K1XA 2RAEA 3I4PA 1GLNA 1X3WB 4F7DA 2QX3A 3BG6A 1EFCA 1MRZA 2P3MA 4OJLA 4WF2A 1UHMA 3K6GA 3BR1A 4KN4X 5DV5A 1KQ9A 3RKXA 3I55B 3CC7B 2XGDA 3CCLI 1WFXA 1FNBA 2JDIA 1UJ8A 3Q3SA 5GV8A 3CJRB 2D3NA 2EFQA 3G1LA 4V19K 1IAWA 4M9SA 3CCMB 2VXZA 1TWHJ 3GSIA 4MYTA 1GXPA 5LGUA 3A8KA 5J1RA 3ZMDA 1YG2A 4W1UA 2V79A 4LB6B 1QHGA 5K1YA 1PUFA 1D1BA 4LG3A 2MW8A 2O1DA 2G7HA 3VODA 1E3HA 5LRRA 1UD5A 3GFMA 2IS4A 1KK0A 2R7XA 2D2WA 3VR6A 2R0QC 5B6IA 1ETKA 1P4AA 4C9YA 3CPXA 2V5IA 1LE8B 2LY2A 3PSSA 4L0ZB 4X7DA 4IHYA 3WQZA 2LK2A 2X6YA 3D5SC 4RAGA 5K5OA 2JA6J 1SVOA 1FBUA 1NJID 4XOTA 1R23A 2VC0A 3OEHA 4U7BA 3GTQJ 1QA1A 4DYRA 4I01A 4A0ZA 2J7KA 1BW6A 3LL7A 3VOEA 4N3GA 1LLWA 2EA2A 2F4MB 3QP5A 3HPGA 1BM9A 5TJJA 4X7CA 2KIFA 3OW7A 1RUNA 3BT9A 1K78B 1RU4A 3BQZA 2XVCA 4P1VA 2ZXWH 1WJDA 1H42A 3LJYA 5E3OA 3CMYA 3S1MJ 2MD5A 3H5AA 5KHDA 4PGGA 1S7EA 2BHZA 4M71A 3L1PA 1QG0A 2GWRA 2ID6A 4XLCA 2Y0SN 4YAOA 2W48A 2XGXA 4XK4A 3LAJA 3VSVA 3FXUA 3AGQA 2WZPP 4YAUA 3GF2A 1Y56A 2FF4A 3S17J 3CXCB 2W7ZA 3PFYA 4HDUA 1OFCX 2E5ZA 3NEUA 5ILVA 4NUBA 3OE7A 2VBKA 1T0FA 4D7NA 2BXYA 4DZPA 2AHOA 3GO5A 1VQOI 4X1EA 4HF1A 5IP6A 1W36D 5FA6A 1RR8C 1HDDC 3L2QA 3V7CA 1MMNA 5DUKA 2L4MA 1F1ZA 2DMPA 2ZMEB 1K6OA 3PIPF 3C18A 2EFWA 1QU3A 1ZM2A 5J1UA 2DW4A 1HVXA 1IDJA 1OGMX 2FEZA 2VKHA 1VNDA 3MZ8A 3AVTA 3H0GJ 4WZEA 1XC5A 4JK1X 4AM3A 2EV0A 4TMTA 2NTBA 4GYGA 3CMEI 1PP8F 2BSPA 1HF2A 2D1HA 1IDKA 1UZCA 3BJOA 3CCYA 2WBMA 5H5JA 3E0JB 4DBQA 4FCYA 1WXRA 2ELHA 3DPLC 2VNIA 5D6EA 3ELKA 4LITA 1ON2A 2Z33A 1S7AA 3OYHA 1G3YA 2X9DA 1MSFC 4PJ0C 2LH9A 3EQOA 5C4XJ 2P5VA 4QVAA 2ZMEC 3V8KA 3BZKA 4X8IA 3AVUA 5DS9A 1SKYB 2X0KA 2BM0A 1TQMA 2C77A 1TW3A 3CUOA 2Q6KA 4C3JJ 2F1LA 2C4TA 3SYJA 3GX4X 1UD8A 4EATA 1GAWA 4MHGA 3SZPA 1JGGA 1QVGB 5BOXA 3GQ7A 3LSJA 2IS2A 5CQGA 1RMGA 1GUUA 1SAUA 2F5EA 5AN9A 2E2IJ 2ZZFA 2CG4A 3FX3A 1EP1B 2XKPA 1PDNC 3BPXA 3HM5A 4XN3A 3OYMA 4IOCF 2VPLA 1AA7A 1NRKA 4L0YB 1WVRA 4GO1A 2M87A 2UV1A 2OQRA 4WX9A 3VNUA 1OPCA 4GGGA 2XF5A 5BNGA 1ETXA 3CW2A 5IYPA 3HOZJ 1FOKA 2VKDA 2R3SA 1J2XA 1EH6A 2Y75A 2KZGA 3CZ6A 4A3DJ 1ZM3A 1HA8A 1KZHA 5DUIA 1HKQA 2W85A 3UNGC 2O0YA 1DDGA 1V5FA 1UD4A 2RKHA 2ISZA 1BI1A 3S16J 2VKEA 2DCEA 3ZCOA 1QQIA 1BR1A 3HOXJ 3DDYA 2O03A 1Y0YA 4PUSA 1UD6A 2KKOA 1FOXA 2QE7A 2XPUA 4I6ZA 2K5CA 1R00A 3BR5A 5K7FA 2BGCA 3PUBA 1IRGA 3V7AA 1Z77A 2VT2A 4U9UA 4EM1A 3OYGA 2Y69H 4N9IA 2KDZA 3CMAI 4C2UA 2CQXA 1AIRA 1QA3A 3I9V2 4BL0B 1PP7U 4IRIA 3KRGA 3EUAA 1IDYA 2WR8A 2UVFA 3FZVA 3W2IA 3PVDA 2IS1A 4IVNA 2JVGA 4GCVA 4HQMA 2DK5A 2E36A 4ITVA 4XRSA 4ENJA 1Z1DA 3EETA 3R61A 4L5JA 1O7FA 4CHUA 3KYLA 2JUGA 3I55I 4N4NB 3CC7I 4EW9A 4BHCA 3N05A 3RSNA 1YQAA 5DSZA 4KKUA 4PC7A 4FHTA 2BPOA 3A8IA 1Q82D 3CP8A 2RC6A 5HS8A 1TWFJ 4CYCA 1K61A 3VMWA 1X2MA 3VYSB 3PUMA 3SXYA 4YFOA 1ZGAA 1JTXA 3OR1C 5ICGA 1O8DA 1PLUA 4YZAA 1FBQA 3U1DA 3MKWB 3F8NA 1WDTA 1OFMA 1K7AA 3D1NI 1QJVA 5DM6F 3Q0WA 2EV5A 4DNTB 2GOMA 3ZQGA 1LDJA 2OK7A 3J7AO 1JA0A 3QSYA 3WNCA 2EZKA 4QPOA 4H0EA 4M9XA 2R5YB 3HHGA 1J09A 3Q9VA 2ZITA 1H89C 2QWWA 1P92A 4BE0A 1G2HA 4HZFA 5TGTA 5LLQA 1S72B 2EZIA 2F48A 2M4KA 1VQ8B 1U2WA 2EIXA 3K1NA 3SJPA 2QBYA 2XGEA 5H6QA 1E62A 1ZGWA 1BPLA 1FRQA 2M0CA 1MBJA 2VQLA 3ZR8X 4LOCA 4CICA 5A88A 2F3LA 1Z9CA 2VB6A 3PUNA 4EMSA 2I10A 1UMQA 1VQLB 2F5DA 1LVAA 3CO6C 2HWVA 4BDYA 1E17A 2O5RA 2PMZA 1QGPA 4EH1A 2FMLA 4A3KJ 3U21A 2ZZGA 2OA4A 1E2XA 3CCVB 3LSKA 2BGJA 5A89A 3I5UA 2HYJA 1WI9A 5EYRA 1KJZA 2NS8A 4KT6A 2CW7A 3LQRA 4B4CA 4XIDA 2QKLB 2B7CA 4NB5A 2DPUA 1TLLA 2IGKA 3W2VA 2ZTGA 4Z4RA 3S1QJ 2QY1A 4DBRA 2UVEA 3EPZA 2DOGA 3M7GA 1BA5A 5J1YA 2E7XA 3W2FA 5EEHA 1XE1A 1LLZA 2NXNB 5CQEA 5HDGA 1HG8A 2KRCA 3PO2J 4UZFA 3RCOA 3KEYA 4AYBA 4EM2A 4UUVA 1EFRA 2ZBVA 1UG2A 3PA1A 2WYRA 2BVLA 2EBIA 1ITYA 2BX6A 2M8EA 2GZWA 3ASTA 3CD6B 4MTDA 3CLQA 2DYSH 2K40A 1JE8A 4X07A 4ZH4F 2PLYA 2HLDA 4NC6A 3A01A 2EA4A 2HPIA 2NOGA 2O6GE 3FKJA 1MH3A 1X4OA 3ZQFA 2VN2A 2XEXA 3H3ZA 1D1AA 2K27A 2WB1N 5BPDA 1DP3A 2ESNA 4ZCIA 1RIOH 3I4MJ 1WRJA 3EUKL 4TMWA 2M0MA 2X8KA 1DBGA 3E20A 2LY9A 2JA7J 2MH9A 4UVBA 2I1LA 2EWEA 3BJAA 4EJWA 3ABLH 1E1QA 1IB0A 5K7HA 2VPRA 5IYWA 1IW7F 3QYBA 4JX4A 2QYUA 4LBYA 1OHHA 1JB9A 3GTMJ 1UD2A 2BEOA 3B02A 2NVXJ 2ZBUA 3ZUGA 1VQMI 1OCCH 1U5TB 2CU7A 1FEXA 1QPIA 1W36C 4LG0A 2V7FA 3P26A 2QBYB 4UZEA 1H9GA 5BMZA 5E3LA 2MH2A 1O3TA 2QSGX 2H09A 1L1IA 3CCUI 2C5BA 3QFTA 1SFXA 3FXJA 1NG7A 1K79A 3JAMK 4FETA 2GA2A 2VT3A 3TQNA 3BCFA 3BNWA 3V7SA 1FX7A 2K02A 2LP0A 4HOBA 3G3ZA 3LQ6A 2BE5F 1FP2A 2L0KA 5HVQC 1O8MA 3BLYA 4PC1A 3FBNB 2QVOA 1GVHA 5ED4A 1G6NA 2HYGD 2M5WA 2WA0A 2ZXHA 1QH0A 2VBXA 3SKBA 3UR3C 4DZJA 1Y1VJ 4DYQA 1B23P 2IAIA 4KUMA 4OAZA 3WTVC 4A12A 2VOOA 4GYIA 1CNEA 2V7TA 3CPWB 3GXOA 2TDXA 2V9PA 1MBGA 2VJ4A 2XDVA 1TTYA 2RN7A 5CLSA 1P2FA 3SJZA 2INUA 3WBKA 2X1EA 4OAYA 5FNZA 4Z4UA 2Z1DA 1RWRA 3QWLA 2VE8A 1KCDA 1T33A 3A01B 1DUXC 4XRMA 1VQ4B 5E79C 2BMWA 4KN7X 2VFOA 4I98B 1W35A 1ON1A 5A8AA 1P7IA 3P5JA 1QRBA 1F60A 3KZYA 3VNVA 4BXUA 1BOAA 4L9NA 3PL8A 2XSJC 3LQQA 1D1NA 1M1EB 1Z3XA 3LOCA 2K9NA 4RAFA 3CJQB 4HV6A 1ZRDA 2M1BA 1I50J 2XAUA 2PQ8A 3BWGA 1XSDA 1H8AC 4I99C 1PUEE 1W9XA 2PECA 2VBSA 4UVAA 4XLAA 2HQAA 4KH3A 1U8RA 2LSOA 3J81K 5L3CA 2QN6A 4V2GA 4YC5A 4U7DA 1BX1A 2E1NA 4RLFA 3J80Z 2VNHA 1GVJA 1TZLA 2JMWA 3K4BA 4LG0B 2QYOA 5F0FA 3IRQA 2LF8A 2VYQA 4XRFA 2HMAA 4A3BJ 2CSOA 2B5OA 3ML3A 2DQLA 2BV6A 4V2FA 1F5TA 2HDDA 4QUZA 2GA1A 4D5FA 5FLMJ 3QE2A 2A6HF 3HTSB 1XTAA 2GXAA 1GVDA 1BI3A 1T2KA 4M73A 3RJPA 5J3OA 4A0YA 3CCEB 5AIPA 3SFZA 4M6YA 2P0WA 4HNTA 2R7TA 1MBHA 1XGMA 2ZJPF 4FE7A 4II2A 1MJ9A 3DBLB 2DT5A 4LC0A 3RKQA 1O3SA 2BV3A 1JKRC 1TWAJ 3H3VK 3HB9A 5L3GA 1USSA 1WSVA 3FF5A 1TT0A 4IW3B 5F4OA 4Q48A 5TISC 1XMXA 4ZYHA 4Y3OA 1MMSA 5GAHJ 3KYDB 3WTXC 1J9ZA 2BZTA 2X1CA 3LSRA 1FNMA 1NTCA 4ZTFA 1YJ9B 4IRGA 1W2BB 3ESWB 1O8FA 1MSEC 2HTJA 3TW6A 3SEZA 3JRHA 1S72I 4C2LA 4IOAF 4ZC3A 2PN6A 2LR8A 1PYVA 4OOVA 3W5UA 4XSXF 5E8IA 2Q2EB 5ILSA 1NG6A 3ZQ7A 1T6ZA 1VHOA 2B0RA 1Y0RA 2EFOA 2JTVA 3QAHA 1VQLI 5HLTA 2HI3A 3OKXA 3AG3H 2DA7A 2JZYA 3CDHA 2QCOA 3ES9A 2ACJA 2F43A 3ERMA 2JRTA 4BHBA 3P7NA 4UUSA 3IP4B 1TT5B 3CCVI 4ROXA 3A03A 2VQCA 2IJLA 3ZXSA 1APLC 1HZEA 4RD1A 1PE9A 2INVA 4I0AA 2XC1A 1RKTA 4HX7A 1TLHB 3D5RC 3HG9A 2DETA 5KVRA 1WI3A 2ELKA 2QQAA 3CB4A 4XKBA 2NPFA 1YHQB 2NT6A 1BBYA 1A31A 4EJVA 2Z5UA 3DP7A 3VO1A 2DQRA 2OC6A 1QUFA 3CC2B 4RDJA 1ERDA 2M5SA 2OBTA 1S8NA 5LHGA 2O17A 1OYYA 3DTIA 3GLXA 1TW2A 5E3MA 3PNTA 2AXTC 2IP2A 3M1CA 5FRMA 3JCUC 1FTZA 5JBQA 1Q81D 4UXNA 4S0HB 5ICEA 3LA3A 1QGZA 4CXFA 3WNDA 2XT2A 1ETQA 3ECHA 3I59A 4ZV4A 2IGNA 4Z4TA 3HPHA 1Y6IA 4XD7A 1FYLA 3T9GA 1U78A 4ASUA 2H6CA 3TBIA 2V7QA 3G05A 3HTUA 5E6TA 2XNDA 4BAYA 5FLXZ 1RESA 5IT9K 4JYKA 2HOAA 1KONA 3WTSC 2VBYA 3MKYB 1IC8A 2KIMA 4MXNA 2GOXB 1JJ8C 2EIKH 3JRBA 1A6IA 1QUEA 5CVJA 2AS5F 4ZYDA 2E1CA 3AVVA 1R5BA 2LREA 1QVFB 1ZGJA 1SC7A 2M4GA 1N8RD 4BNCA 1FRNA 2A05A 2MA3A 2O61A 1GO2A 3OMYA 3DQVC 5TR9A 3DXJF 2Y48A 3PFIA 3T51B 2KT0A 3C7JA 2BVNA 2E19A 1RC9A 3H35A 2K9LA 4PAAA 4P3IA 3SDGA 4Z4ZA 3BP8A 2DEUA 1OCRH 1WCMJ 3IC7A 2O9LA 3DLLF 3MZYA 2DO7A 3BZCA 1XN7A 1W0UA 2L3DA 1WH7A 3ABKH 3GZ5A 3DPTA 1GR1A 1S4MA 1RETA 2CBXA 1B4AA 3V42A 4ZZLA 1E3PA 5LHIA 4P12A 5FKKA 2ZB9A 1FMWA 5HS7A 1R5OA 4LIVA 1VF7A 4ZDLA 1AKHA 1N75A 1JJ6C 1HOMA 2J5PA 4HIZA 4C43A 3CCSI 4F93B 1X0CA 1E3XA 1OYIA 3OYKA 3U2QA 4HW0A 3MFKA 2CJJA 2ZFWA 3BG9A 3SEJA 1EKEA 1QA2A 3C2GA 3OP1A 2OUMA 1ZYRF 5B66C 3VSUA 1Z6TA 3WXMA 4E7ZA 4F3QA 4QTRA 2XB0X 1V5GA 4X7FA 2CQ7A 3GEZA 2Y9ZA 1EXMA 1XGNA 4U0YA 5DD8A 2DA4A 1SVMA 3QFCA 2LZJA 2FOKA 1V5VA 3U9GA 5D5VB 3S1RJ 1YX2A 2BM6A 4U4BA 5FO1A 3B4NA 4CCOA 3G4SB 1VQ7B 2W57A 3I59B 2DDBA 4DQLA 3IH3A 1ZN2A 3OL4A 4N9HA 4AC9A 2DERA 1JXSA 1KTWA 4AU7A 2L7MP
chains in the Genus database with same CATH topology
1HVXA 1IDJA 2VJ5A 1OGMX 2VKHA 2BW3A 3DKYA 2W82A 1O8LA 2R7WA 3MKZA 3T56B 2NTBA 2VQGA 4YEJA 5FROA 4PJMA 1G59A 5CDFA 2BSPA 1IDKA 3GQAA 4KKTA 4II3A 2WBMA 1WTHD 3E0JB 4DBQA 1X1CA 3M8JA 4IX7A 4BE1A 4F91B 4Z03A 3DPLC 3OPOA 1X1BA 4MLOA 3CMMA 4HSTA 4XKWA 4LITA 2Z2SB 5C1CA 3OYHA 1DGRM 3W2AA 4CCLA 5HNHA 2LH9A 4B3GA 1LFPA 1WP6A 3EQOA 2PYHA 3OS1A 1MNEA 2VJIA 2V6EA 4RM3A 5CPRB 3VYUB 2F5VA 1SKYB 1K28D 1NBMA 2CFOA 2JJ2A 3IAM2 2CV2A 3LMMA 3OAAA 1UD8A 5HOOA 4EATA 2IXSA 2CUZA 4XKVA 1BHEA 3DTEA 3GQ7A 2DOAA 2IS2A 2ELJA 5CQGA 1RMGA 4E7LA 3NWSA 1SAUA 2AQFA 2KDOA 3EUHC 4FASD 1D1CA 2DT7B 4CZCA 4HRIA 2ZZFA 3H9GA 3OS2A 4XN3A 3OYMA 2VPLA 1E79A 1AA7A 1NRKA 2IQ7A 5C1EA 4E7KA 4KISA 4YXWA 5CKTA 2UV1A 3H9QA 1S9HA 2XF5A 4NC8A 2V26A 3A3GA 1N78A 3K4MA 2VKDA 2WAEA 3S32A 2MABA 3IUOA 4XORA 2R4GA 3CZ6A 5HNFA 2VASA 1HA8A 4LIUA 2M7BA 2XZPA 3QYEA 3UNGC 2L9SA 2KHMA 4OJOA 1UD4A 1V5FA 4NNJA 1U0JA 2NOJB 1Z21A 4BS9A 3BH4A 5HKKA 2DCEA 4PSWA 3ZCOA 1BR1A 3DDYA 1JTAA 3W3CA 2AQEA 1JRGA 4PUSA 4BU2A 1UD6A 2QE7A 2PJRB 1X19A 4Y4RA 2CK3A 2JJ1A 3HUGB 3MD2A 2DT6A 2K5CA 3S3NA 2ZFUA 1MW7A 3PUBA 3B8YA 2XF7A 3PJRA 2W1OA 3OYGA 4C2UA 1O8KA 1WMRA 4U49A 1AIRA 1O8HA 3I9V2 4BL0B 3OYCA 3KRGA 1H80A 3EUAA 1VJSA 4DGWB 3K4NA 4G6TB 2UVFA 2WY7Q 1QHHD 1V0EA 2VJJA 2GK6A 2X6WA 2IS1A 2JVGA 2GJKA 2DJIA 2X85A 5KNLA 4B43A 4ITVA 5JHFA 3KEWA 1YE9A 2UWMA 1K5CA 5KCMA 2K3PA 2XZOA 1MMGA 3KYLA 3K4LA 2V31A 1X4PA 4HEA2 2JUGA 1BOBA 4N4NB 4EW9A 3N05A 3RSNA 3GVJA 1IRXA 4KKUA 4PJLA 2LG4A 2R7UA 4JQFA 1MABA 4YRVA 2E1MC 1D0ZA 3CP8A 3OOUA 3VYRB 3VMWA 3VYSB 1O8EA 3OR1C 2CMPA 1O8DA 1PLUA 4G7WA 4YZAA 3MKWB 4ZTJA 4U87A 2JVHA 1OFMA 4C30A 3H0DA 1QJVA 1FMVA 4DNTB 2XF6A 1E0EA 2GOMA 3LSMA 4NC7A 1OLTA 2M3AA 4IKFA 4TT3A 4QPOA 4ZDOA 2W00A 1W0JA 1J09A 2R7VA 4XMYA 4B3FX 2OV7A 4NK6A 3F9KA 4BE0A 1BN8A 1Z7LA 2LBFA 3BCBA 5TGTA 1T95A 4B3XA 4I84A 2M4KA 1WPCA 4B47A 1LKXA 3TL4X 4R79A 4W8SA 1OFLA 1LVKA 3K10A 1BLIA 3SUCA 2BOLA 2WY8Q 3KX2A 1MMAA 1I8DA 1OGOX 1BPLA 4W8RA 2QXZA 2VQLA 3PNYA 3ZR8X 3K4JA 4BJTA 2VB6A 4OJ6A 1O8IA 1UELB 4IQ4A 3HC7A 4BXFA 4W8TA 4BDYA 1IA5A 3OIQA 4OJ5A 2VLAA 2O5RA 2PMZA 4D1QA 2E1BA 2PYGA 2ZZGA 3ONQA 3U21A 3OYBA 3BCDA 2NTQA 3LSKA 1DGWY 4KT6A 2Y0SA 2CW7A 2V1NA 2QKLB 1O8GA 1KCCA 3EQNA 4BJ6C 4E7HA 2IGKA 2WADA 1R6RA 2V4JC 3W2VA 2ZTGA 4DBRA 2QY1A 2UVEA 4X0GA 4MR0A 3G2BA 3PSIA 2VBMA 3CF2A 3EPZA 2Z6BD 4XL9A 2NSPA 1WJBA 5CQEA 3AL0C 1HG8A 2KRCA 2QKMB 3HAGA 3RCOA 3KEYA 4AYBA 2KZVA 2XC7A 4TSFA 1WJAA 3QODA 1EFRA 2BVLA 4E7SA 3OYFA 1O8JA 1SFKA 2X3HA 2L7KA 3OWTA 1T5EA 2HU9A 3S3OA 2CUJA 2LOOA 2HLDA 4L8JA 3L2WA 4PFPA 2HPIA 3SDBA 2WJYA 3DEEA 3FKJA 1X4OA 4PMHA 1DBOA 2A5WA 4P5OA 1D1AA 1DP3A 2A6TA 3AFHA 3GVLA 2O0WA 3EUKL 2GK7A 2O0VA 1N77A 3K70C 4XQFA 2M0MA 2VQHA 3LSGA 2X8KA 1DBGA 3OYNA 2R9VA 4HWVA 2EWEA 2R7OA 1E1QA 3FPPA 2ZTNA 4E0FA 1ZELA 2KPMA 3A3BA 2ZXIA 3QYBA 3K4KA 2KRHA 4RM2A 3OY9A 2LBFB 2RREA 2HPMA 1OHHA 4NQWB 1MNDA 1VBLA 1UD2A 2VIXA 4OZZA 3ZRGA 1PKVA 3CP2A 4F55A 3DPUA 2WSSA 1H8HA 1W36C 4QPQA 4C2TA 2V7FA 4XM3A 4PSXA 3SYTA 2BW3B 3FY3A 4ZDPA 3NWTA 2R7SA 1JI8A 1NG7A 4HPQA 2R7QA 2NZMA 4HG2A 4FETA 2F4IA 3W2WA 3BCFA 1E1RA 3BC8A 4IQJA 3ZSCA 3OYLA 2HDWA 3S8PA 3SZGA 5HVQC 1O8MA 3H5NA 3BLYA 4DIQA 3GQBA 3FBNB 3OL3A 2I8DA 3S3MA 1T0FC 2IGOA 1G8XA 3TMOA 4BEHA 4E7JA 1COWA 3E1SA 3BC9A 4CSWA 4YELA 2LRDA 3VDXA 3DKXA 2K9MA 2WA0A 2XOKA 4Z06A 2ZXHA 2XGJA 3ZQQA 3ZGKA 4XKCA 3UR3C 4ANJA 1H8EA 3HKZA 3LSHA 4BQNA 4PFOA 5LFAA 3FDYA 4OAZA 4BACA 2ODLA 3FKSA 3CESA 4N4OB 1BMFA 4YZXA 2WPDA 1DQUA 4XNFA 4DK0A 2MC4A 2VJ4A 2XDVA 4HNUA 4CCMA 3VSKA 3DLAA 2INUA 3FHNA 2X1EA 4OAYA 1PJRA 1BR4A 2Z1DA 1RWRA 4F52A 4PJJA 4AVZA 2L9NA 1KCDA 3GBGA 3I3LA 4BGDA 3OYEA 1W0KA 4XR6A 3HL2A 2JA2A 2X1DA 2D3LA 3OFNA 1WJ5A 2ZSIB 3PL8A 4PK4A 2XSJC 4OZYA 1Z3XA 3CJQB 2XAUA 2KMUA 4JMQA 4XN0A 1W9XA 2PECA 2MFZA 4CH7A 3RPUD 4XLAA 2HQAA 2MYSA 3QYFA 3SEQA 2W4SA 3H94A 3B90A 1XG2A 2HVRA 4URRA 4XLHA 3A4CA 4RLFA 3GQ9A 2XZLA 3OYJA 3MMYB 1TZLA 2ZSHB 3K4BA 3ZPPA 4P1WA 1Z3YA 3JU4A 1NHCA 5IK2A 4W8QA 3IAS2 4IZZA 2JSPA 1EE6A 2FUG2 3OIPA 3VYTB 3C2HA 1EA3A 2KQRA 3A35A 5LD2C 4H4KC 4HSRA 3FBIB 4NK8A 2HVSA 2HVQA 2P0WA 1K6YA 4HNTA 2R7TA 4BEHB 4II2A 1D0YA 2RQQA 4J00A 4GQNA 2CW8A 2Q1ZB 3DTKA 2X51A 2CV1A 1WJEA 2WAQA 1E43A 1UD3A 2NTPA 2PJRA 4KKSA 4BDZA 1TT0A 2M7AA 3PNVA 4Y3OA 2LC2A 2KL4A 3JURA 2X1CA 3DU6A 4ZTFA 3OEEA 4F92B 1BR2A 1P9QC 3VMVA 1O8FA 3SEZA 3H9JA 2V4DA 3RQ4A 2ZZQA 1GQ8A 2V9KA 4C2LA 4KJZA 4ZC3A 4G6IA 3J7AY 1MMDA 1PYVA 4E6KG 2CS3A 1QCXA 2Q2EB 1NG6A 3LMWA 4Y33A 3ZIAA 4XOPA 4CUGA 4BJ5C 3GRHA 4G7XA 4B44A 2W6IA 5HLTA 2E60A 3OYIA 3OYAA 4JOMA 3ZPNA 1WJCA 2GJPA 2F43A 3UW0A 3IP4B 3LSIA 4DOZA 1IB4A 1V5EA 2VQCA 3ZXSA 1HZEA 1PE9A 2INVA 3DU5A 3LNNA 1OOCA 2F6CA 4Z1MA 3PSFA 3D5RC 3HG9A 4XLFA 3A2KA 2L2OA 4PJNA 5AMVA 2LY1A 4XKBA 2NT6A 4KITB 4BUPA 3VWBA 3HXLA 3L2VA 3RTRA 4BQQA 3HOTA 3A1YA 2OC6A 2X6XA 3OS0A 3VSLA 2UUZA 1ERDA 2M5SA 1GLNA 2MD0A 4E4HA 2IGMA 3T53B 2O17A 2QX3A 3BG6A 3DTIA 2RNGA 4ZJZA 3H5RA 3PNTA 3M1CA 3OR2C 1O88A 4OJLA 5FRMA 3K6GA 2GJRA 1X1AA 1WFXA 5DN6A 2HZDA 2JDIA 2L5QA 4XLEA 4OWRB 2IGNA 3HPHA 1Y6IA 3CJRB 4XONA 2D3NA 4TKOB 4XD7A 3T9GA 3VSTA 2CH0A 3GVKA 4ASUA 2VXZA 3TBIA 2V7QA 3G05A 2WB1A 2NSTA 2XNDA 2DXIA 1QHGA 4Z05A 1D1BA 1KONA 4LG3A 2O1DA 3MKYB 2Z8GA 2R7RA 1YX3A 2GOXB 4CA0A 2IS6A 4MXNA 1UD5A 3HOSA 2IS4A 2KVOA 2E1MB 2R7XA 1V0FA 3VR6A 4C9YA 4YZ0A 2LY2A 2LREA 4DJAA 2KLOA 2M4GA 4RMNA 2BVMA 3LFUA 2F1MA 3DWLE 3WQZA 2X6YA 2E5NA 3D5SC 2W7NA 1KMHA 3OMYA 3DQVC 1WJFA 4UZUA 2X53S 4XOTA 3T51B 3OEHA 4U7BA 2HNHA 3BG7A 3QOEA 4DNRB 3H35A 2K9LA 3LL7A 2O04A 3GQ8A 4B48A 3HPGA 4FXUA 4OJPA 4E7IA 3OW7A 2JIZA 1RU4A 2KP6A 1KZLA 1WJDA 2VBEA 2CV0A 3DPTA 5FL7A 3V42A 1I18A 3H5AA 4YZQA 3BCAA 3AKZA 5KHDA 5FRNA 4DK1A 1FMWA 4LIVA 1VF7A 1VZ0A 3K4CA 4ZDLA 1N75A 4XLCA 1UAAA 2ZZEA 3K70D 4CCNA 4HIZA 4F93B 4ZYAA 1E3XA 3OOCA 1X0CA 3OYKA 4J01A 2LYCA 4P22A 3VSVA 1UG0A 3S93A 4D9JA 2WZPP 3C2GA 2DIEA 2OUMA 1Y56A 1CZFA 1LDKB 2WAFA 3VSUA 4GRIA 4F3QA 4E7ZA 1D0XA 3OYDA 1VLYA 3PFYA 1V5GA 2E5ZA 3D5LA 4NUBA 3OE7A 2VBKA 3L2RA 1PXZA 1OR7C 1X1DA 2VXDA 2Z16A 4RLQA 1W36D 2LZJA 2W6JA 4U4BA 3L2QA 3L2UA 1MMNA 3NE5B 2VL8A 1FX0A 3B4NA 4CCOA 3WWGA 4CCJA 4CCKA 1YX5A 1QU3A 3OL4A 4BQOA 1OB0A 1E3ZA 2NT9A 3AL0B 1KTWA 2WJVA 4AU7A 4BE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  3VMW A;  3ZSC A;  1OGM X;  1O8E A;  1O8M A;  3UW0 A;  1O8L A;  1IB4 A;  2NTB A;  1O8D A;  4YEJ A;  1PLU A;  1PE9 A;  2INV A;  4YZA A;  2BSP A;  1IDK A;  4YEL A;  3GQA A;  1OOC A;  1OFM A;  1QJV A;  4Z06 A;  4XLF A;  4Z03 A;  5AMV A;  2NT6 A;  4XKW A;  5C1C A;  2ODL A;  4XMY A;  4NK6 A;  4YZX A;  2X6X A;  1BN8 A;  4XNF A;  3EQO A;  4I84 A;  2PYH A;  2O17 A;  2QX3 A;  2INU A;  4OJL A;  1O88 A;  4W8S A;  1OFL A;  2VJI A;  3SUC A;  1RWR A;  4AVZ A;  4W8R A;  1OGO X;  1KCD A;  2QXZ A;  4XLE A;  4OJ6 A;  4XR6 A;  1O8I A;  4XON A;  3T9G A;  4W8T A;  3VST A;  1IA5 A;  4OJ5 A;  4XKV A;  1BHE A;  2PYG A;  3GQ7 A;  2NST A;  4OZY A;  1RMG A;  2NTQ A;  4Z05 A;  2O1D A;  2Z8G A;  4XN0 A;  4XN3 A;  1O8G A;  2PEC A;  4MXN A;  1KCC A;  3EQN A;  4XLA A;  2IQ7 A;  5C1E A;  2QY1 A;  2UVE A;  4MR0 A;  4YZ0 A;  3B90 A;  1XG2 A;  2VBM A;  4URR A;  4XLH A;  4XL9 A;  2X6Y A;  3GQ9 A;  2NSP A;  4XOT A;  4XOR A;  3ZPP A;  1HG8 A;  1NHC A;  4W8Q A;  4OJO A;  1O8J A;  2X3H A;  1EE6 A;  2O04 A;  3GQ8 A;  4OJP A;  1RU4 A;  1JTA A;  1JRG A;  4NK8 A;  2VBE A;  4PMH A;  1DBO A;  4YZQ A;  2O0W A;  2O0V A;  3B8Y A;  4XQF A;  1DBG A;  4XLC A;  1O8K A;  1WMR A;  4U49 A;  1X0C A;  4HWV A;  1AIR A;  1O8H A;  2EWE A;  2NTP A;  3KRG A;  1H80 A;  3VSV A;  2UVF A;  3VSU A;  1CZF A;  2VJJ A;  2X6W A;  3JUR A;  2X85 A;  4OZZ A;  1VBL A;  3VMV A;  1O8F A;  2VBK A;  1K5C A;  1PXZ A;  4C2L A;  1GQ8 A;  4XM3 A;  4U4B A;  1QCX A;  3LMW A;  3B4N A;  3FY3 A;  4EW9 A;  3WWG A;  4XOP A;  3GRH A;  2NZM A;  2NT9 A;  1KTW A; 
#chains in the Genus database with same CATH topology
 3CUQ C;  4RD4 A;  1POG A;  1WOP A;  2BW3 A;  2YPR A;  1ZHF A;  3PEN A;  2W82 A;  3HRT A;  3T56 B;  4KYW A;  2VQG A;  5FRO A;  1LJ9 A;  1G59 A;  5CDF A;  4YII A;  3ASR A;  3M8J A;  1FDR A;  5CVR A;  4IX7 A;  1KK1 A;  4X0C A;  2K85 A;  2DA3 A;  3DBR B;  4OOX A;  1R22 A;  4HST A;  4XKW A;  1S29 A;  2WV1 A;  2GLO A;  4B4D A;  1I27 A;  4Z4W A;  1SFE A;  3IWZ A;  2ZL6 A;  5J40 A;  2FX3 A;  1IN5 A;  5FB2 A;  4B3G A;  1ZAO A;  1EV7 A;  2R5Z B;  1H9T A;  2PYH A;  5EEA A;  5HOD A;  1I3A A;  4AIJ A;  1MNE A;  3J81 k;  2QMU A;  1RZ4 A;  3FXO A;  2VJI A;  3Q5F A;  3G1M A;  4M3G A;  2F5V A;  2YWH A;  3PO3 J;  5EZG A;  4BH9 A;  2QSF X;  2CV2 A;  5GAG J;  1IG7 A;  3CCQ I;  5DCM A;  1WOO A;  1TYW A;  3S14 J;  5HOO A;  4UY8 I;  2A5Y B;  1JHF A;  3KIO A;  2GM4 A;  1BHE A;  2C6Y A;  4PGH A;  5J47 A;  4RAZ A;  2DA2 A;  3EYI A;  3WTY C;  4E7L A;  3NWS A;  2AQF A;  2KDO A;  3EUH C;  4HRI A;  4J19 A;  1JGS A;  2G9W A;  2RQP A;  3OS2 A;  1FLI A;  2J8I A;  2A6E F;  4KFC A;  2IQ7 A;  4E7K A;  1EFU A;  4X7E A;  3HRU A;  2BBY A;  5EMN A;  2EFP A;  1A5J A;  4NC8 A;  1KTV A;  4OP7 A;  5IYB J;  4A3C J;  1N78 A;  3K4M A;  3PQK A;  4RD2 A;  3P9I A;  1YJ9 I;  1YIT B;  1MD0 A;  5IYN A;  2MAB A;  3IRR A;  3JRF A;  5H2F C;  1N06 A;  3E6M A;  4OPW A;  2UXX A;  1IV6 A;  2Q6O A;  2M7B A;  2HEO A;  1CQX A;  2DCU A;  1QZY A;  1JJ2 B;  3RDI A;  2VNJ A;  1WZ2 A;  1XG1 A;  4NNJ A;  1U0J A;  2ECC A;  4MFD A;  2JQ7 A;  3ZMS A;  2WZN A;  1MIJ A;  5HKK A;  1IF1 A;  5CVV A;  3MMP A;  3MQ0 A;  1UHW A;  2NYX A;  2AQE A;  4MNU A;  1JRG A;  5F6F A;  2DK8 A;  3HDD A;  3MHP A;  3O8H A;  1X19 A;  1U9O A;  3L7W A;  2CK3 A;  2JJ1 A;  1LFB A;  2WV0 A;  3H9N A;  4OM9 A;  3MD2 A;  2DT6 A;  1OCZ H;  4HQE A;  3S3N A;  2VNK A;  4J0Q A;  5CJ9 A;  1ACI A;  2XB5 A;  3BY2 A;  1ETY A;  1MW7 A;  3B8Y A;  1P6R A;  4LK0 F;  2QEN A;  1W5C C;  2XF7 A;  3PJR A;  2W1O A;  2FBH A;  1GT0 C;  4BXX J;  4YHB A;  5J35 A;  2BM5 A;  1H80 A;  4Y9R A;  3M3Y J;  3ZMV A;  4DGW B;  2L7Z A;  4G6T B;  1HBX G;  1N05 A;  2YWE A;  2X6W A;  2GBY A;  3PUF A;  4KNY A;  1X3U A;  3EDP A;  1VLO A;  4IXA A;  2GJK A;  1CF7 A;  1FBS A;  3GTK J;  3ULQ B;  4OOS A;  5KNL A;  5B3S H;  3MAJ A;  5JHF A;  3CC2 I;  3K69 A;  1YE9 A;  4OMZ A;  4GXO A;  2K3P A;  4U0W A;  5ILU A;  2YWF A;  3H09 A;  2DMQ A;  2B7B A;  1MMG A;  2V31 A;  5FKN A;  3OSF A;  2C2W A;  1AMO A;  2LLK A;  5L3F A;  3GVJ A;  1IRX A;  2VOP A;  4PJL A;  1N0V C;  2FRH A;  3QU6 A;  4G7H F;  1D5Y A;  1ENH A;  1EH7 A;  3LO8 A;  3S2W A;  3OIO A;  5TY0 A;  3VYR B;  5EF6 A;  1Y0U A;  4M3F A;  1MDM B;  2LTP A;  4Q5S F;  4Z4Y A;  3U2R A;  2DDA A;  1OFD A;  2FNP A;  2NVT J;  1YLO A;  1XFO A;  1FYM A;  2L02 A;  2C78 A;  2XAS A;  3ZBU A;  2K4B A;  2OU2 A;  5C3E J;  3LSM A;  4A6D A;  1R4M B;  4TT3 A;  4B3A A;  2ME0 A;  3FXM A;  1ZG5 A;  1I6H J;  3ERE D;  4A3G J;  2R7V A;  4XMY A;  4O3M A;  2LVS A;  4B3F X;  3F9K A;  4ON0 A;  4NK6 A;  2ID3 A;  2LBF A;  2Q6L A;  2L9V A;  2DA6 A;  1IN7 A;  3FM5 A;  3TL4 X;  1LVK A;  1QO0 D;  3LA7 A;  1BLI A;  3KX2 A;  2WY8 Q;  1WOR A;  3WGH A;  4W8R A;  1OGO X;  2KIU A;  2VFM A;  3MKL A;  4M6X A;  2K9S A;  3LAP A;  1PUF B;  2XAH A;  1D8T A;  2DOE A;  4S04 A;  4G7O F;  1KU2 A;  3HC7 A;  4BXF A;  3A1P A;  4LGW A;  1IJF A;  1IA5 A;  1I5Z A;  2HR3 A;  2LDU A;  4X6A J;  2E1B A;  2PYG A;  3ONQ A;  3FXQ A;  2X3U A;  2YUH A;  1FSH A;  1P7J A;  1DGW Y;  2XPV A;  4ZZD A;  4B09 A;  2Y0S A;  3IH2 A;  3GFI A;  3N4M A;  4UAJ A;  2V1N A;  3FXR A;  3EQN A;  2VBZ A;  2JPB A;  5IP9 J;  4E7H A;  2WAD A;  2V4J C;  2LF7 A;  2JN9 A;  1AWC A;  3PSI A;  1J7K A;  1G3S A;  1CF7 B;  2VBM A;  3F8F A;  3FMR A;  2Z6B D;  1KK3 A;  4XL9 A;  3ABU A;  3GTO J;  1XMK A;  4AD9 A;  3REO A;  2YU9 J;  2JRM A;  5FKO A;  2NVU B;  2QKM B;  3HAG A;  1SD6 A;  3QOD A;  3D26 A;  2OBP A;  2VUM J;  2DFE A;  3OYF A;  4G1B A;  4IO9 F;  3I56 B;  3G4S I;  1VQ7 I;  3JRE A;  2HU9 A;  1XQB A;  1XGO A;  4ESF A;  3G71 B;  3WYA A;  1FND A;  3L2W A;  4PFP A;  3SDB A;  1WSU A;  3RYP A;  3B6A A;  2BY3 A;  1LEB A;  2EIN H;  4MYU A;  4PMH A;  2NNN A;  2A5W A;  2CQK A;  2DY1 A;  4WCG A;  1KU7 A;  1DAB A;  3WU2 C;  3HGG A;  1R49 A;  2GK7 A;  1N77 A;  3WG9 A;  2VQH A;  2MLG A;  4XQF A;  3JRG A;  3CLO A;  3OYN A;  2JA8 J;  1QFY A;  2R9V A;  2V1D A;  5DDG A;  2CWE A;  4H9G A;  1TQP A;  3JRA A;  1QRY A;  4M72 A;  2FD5 A;  3OZV A;  2ZTN A;  2ZC2 A;  1T39 A;  3FXL A;  3KEO A;  4BQA A;  1ZEL A;  2KPM A;  2Y30 A;  4OIQ F;  2ZXI A;  4N3N A;  3K4K A;  4RM2 A;  3OZU A;  4Q4Z F;  4WQM A;  2LBF B;  2RRE A;  3FHZ A;  1AOY A;  1MND A;  2E7W A;  2P7C B;  2VIX A;  2FXA A;  3SHF A;  1QPM A;  3ONY A;  3CP2 A;  4F55 A;  2WSS A;  3BG5 A;  3JTH A;  4CZZ A;  4RB3 C;  4P3Y A;  4C2T A;  1EA0 A;  4TN1 A;  3SYT A;  1K83 J;  3ZMT A;  3CCR B;  1NB0 A;  4OIN F;  1FJL A;  3FY3 A;  1GXQ A;  1W7P A;  4P26 A;  3MVP A;  3F6O A;  3KYC B;  3SZT A;  3CC4 I;  4RDL A;  1ULY A;  1UST A;  4KIF A;  2R7Q A;  4A5M A;  3BQY A;  1N08 A;  4HG2 A;  2TRT A;  3W2W A;  5JLV C;  5E18 F;  1EH8 A;  4G7Z F;  4DIQ A;  3GQB A;  1NHA A;  3OL3 A;  2PMD A;  1T0F C;  3TMO A;  4KMF A;  4RA2 A;  4C3H J;  1B2R A;  4MQ9 F;  1COW A;  3JSO A;  4HX8 A;  1SMT A;  3K1M A;  2K9M A;  2OTJ B;  2DMN A;  1VQN I;  4Z06 A;  3T0Y A;  3ZQQ A;  2XAF A;  4ACA A;  1WPK A;  4I7H A;  2ZBK A;  3L09 A;  1CGP A;  1H8E A;  3ZZT A;  3HKZ A;  4BQN A;  3AVY A;  3QQA A;  4DQ2 A;  4QFM A;  1DDN A;  1BMF A;  1YIT I;  1DQU A;  2F2E A;  4DK0 A;  3OJX A;  1E63 A;  4HNU A;  2RVC A;  1ELO A;  5F1J A;  2B0L A;  3TED A;  1ZG1 A;  2VE9 A;  4PZJ A;  4FWT A;  1BR4 A;  3H1C A;  4PJJ A;  4AVZ A;  2ZJQ F;  3CCM I;  3ZQL A;  1Z0X A;  2ZKZ A;  3P4G A;  3AGP A;  3F8C A;  2HQ5 A;  3F8B A;  4XR6 A;  2JA2 A;  2QTZ A;  2VC1 A;  1X58 A;  1QVT A;  2K86 A;  4WK8 F;  1QFZ A;  1OYW A;  4TMV A;  1KRH A;  4M1K A;  3JQQ A;  1SFO J;  3GTJ J;  5LHH A;  2VFP A;  3T8R A;  3GVA A;  4XN0 A;  1IN6 A;  2PMZ N;  1LFU P;  2OF7 A;  1Q9S A;  3RPU D;  3SEQ A;  1QFJ A;  5FIU A;  4RB2 C;  3H94 A;  2DPD A;  1A04 A;  1M1K D;  1RR7 A;  3B90 A;  2CW5 A;  1XG2 A;  4FIS A;  1TNT A;  5M5W J;  1C0W A;  3K9T A;  5GP9 A;  4XLH A;  3HIF A;  2V7X A;  4XRS G;  2PMH A;  3HSE A;  1GV5 A;  3OYJ A;  4HA8 A;  2AHQ A;  4CGZ A;  2PEX A;  4P1W A;  1NHC A;  1H88 C;  2BYV E;  1JKO C;  5IK2 A;  1FOY A;  4W8Q A;  1VQK B;  4IZZ A;  5BQT A;  1W7P B;  2N8G A;  2KJB A;  3O3K A;  3BR0 A;  1STZ A;  3A0B C;  2FUG 2;  5LGT A;  1W0T A;  1EE6 A;  3SZE A;  2MBF A;  3C2H A;  5E1X A;  3KZZ A;  2E2H J;  2ZJR F;  1IUF A;  1TSP A;  3E1Y E;  4G9Y A;  3A35 A;  3HBL A;  2PE3 A;  3FBI B;  1G4D A;  4NK8 A;  2OZU A;  3AAF A;  2HVS A;  3GTP J;  5KAI C;  2NRA C;  5F1R A;  4LLL A;  2EJR A;  4UNO A;  2M34 A;  5FKM A;  2RQQ A;  3QFR A;  4MTE A;  2UZK A;  1JA1 A;  4QV2 A;  2Q1Z B;  3IHU A;  3DTK A;  2X51 A;  4FQG A;  4FT8 A;  1VF9 A;  2WAQ A;  3N6Z A;  3TO6 A;  2PJR A;  4KKS A;  2HXI A;  4QSH A;  1GAQ A;  3HUG A;  2M7A A;  3PNV A;  1TP4 A;  3KP6 A;  3L2C A;  3NAU A;  3P9C A;  2G0E A;  3JUR A;  4RBO A;  1EWY A;  2Q0O A;  3MEX A;  2BY1 A;  1BR2 A;  1P9Q C;  1XPX A;  3OEE A;  5DNS A;  4A6E A;  2V4D A;  3RQ4 A;  2DYI A;  4EGZ A;  4P9S A;  4CYC B;  3J7A Y;  1MMD A;  3R6J A;  1Z05 A;  4M6V A;  4XBF A;  4E6K G;  3DKW A;  1QCX A;  5IOZ A;  3LMW A;  3PA2 A;  2A68 F;  4XOP A;  4CUG A;  4X05 A;  4HF2 A;  3ZMU A;  2CUE A;  1T98 A;  4MO7 A;  1JKP C;  4BY1 J;  1TWG J;  4G7X A;  3GRH A;  4EJT A;  4L9T A;  5M5Y J;  3NRV A;  3OYI A;  4Y7C A;  1SD4 A;  3U1K A;  5F08 A;  1WSR A;  1J59 A;  3OYA A;  4JOM A;  1Y8R B;  2HFH A;  2QGU A;  2GJP A;  3A8J A;  4RPB A;  1WWX A;  4G12 A;  1YFH A;  2E1R A;  3UW0 A;  2V7U A;  1IB4 A;  2A69 F;  1D8K A;  2MGQ A;  3DU5 A;  3RKW A;  1FY7 A;  2BM7 A;  3RIQ A;  2EPF A;  2OJE D;  1WKM A;  2F6C A;  1SAN A;  3PSF A;  4P9F A;  3GTL J;  2EZL A;  3ASQ A;  4DYC A;  3F21 A;  4PJN A;  1DPR A;  1VFC A;  4V02 C;  4ETS A;  5C44 J;  4AF7 A;  2XNJ A;  4HE5 A;  1S7O A;  3HXL A;  3L2V A;  1N07 A;  1FOW A;  1D5V A;  1ZKG A;  2X6X A;  3VSL A;  1XB4 A;  2UUZ A;  3DBH B;  1FWZ A;  2MD0 A;  4RPD A;  3T53 B;  2PMU A;  1YIO A;  3KE2 A;  4ZJZ A;  3H5R A;  1T6X A;  3E7L A;  4ABZ A;  2QZ8 A;  2GJR A;  2A61 A;  3H3U A;  1W4M A;  5HDK A;  3I56 I;  3JAM Z;  1YJW B;  2PJP A;  1SKQ A;  5DN6 A;  1Q86 D;  2HZD A;  2L5Q A;  4XLE A;  2PG4 A;  3G71 I;  1XB2 A;  1XCV A;  3VST A;  3GVK A;  4BYY A;  2CFX A;  2NST A;  2WB1 A;  4ASN A;  5DM7 F;  2H8W A;  4M3D A;  2DXI A;  4OPV A;  1K8F A;  4Z05 A;  2R7R A;  1YX3 A;  1XS9 A;  2ZXJ A;  2IS6 A;  1U5T C;  3HOS A;  2KVO A;  1MBE A;  2E1M B;  1T6S A;  5D5U B;  1N0U A;  4Z4S A;  3HGY A;  2GIZ A;  4YZ0 A;  4CYD A;  1BI2 A;  4DJA A;  1ZH5 A;  3DCF A;  1IV8 A;  2KLO A;  4RMN A;  3WY9 A;  1BIB A;  4JX6 A;  1N25 A;  2F1M A;  4RCY A;  1REP C;  4EVI A;  1Y0N A;  2E5N A;  2F4O B;  4UHT A;  3TDZ C;  2W7N A;  2QF7 A;  1J75 A;  3VB2 A;  4EM0 B;  2HGC A;  1K8A D;  4ZGN B;  2KFD A;  2TCT A;  2GAU A;  4RB0 A;  4DNR B;  2XAQ A;  4KT5 C;  1HXD A;  2LKP A;  1WGX A;  3GQ8 A;  4B48 A;  5H6R A;  2XTW A;  1NH3 A;  4FXU A;  2JIZ A;  2FU4 A;  2KP6 A;  4CO8 A;  1KZL A;  4LMY A;  3OSG A;  4RM0 A;  5FD6 A;  4IHT A;  2CV0 A;  5FL7 A;  2D1V A;  3ABT A;  2EIJ H;  1I18 A;  3K1P A;  4ENM A;  4YZQ A;  4OMY A;  3TDU C;  3AKZ A;  4YAW A;  5B1B H;  1YJN B;  1S0U A;  3K4C A;  1UAA A;  1KQ8 A;  2ZZE A;  3J81 Z;  3K70 D;  4CCN A;  4ZYA A;  4UB8 C;  3OOC A;  5FLV A;  2OTJ I;  4P22 A;  3S93 A;  4D9J A;  2ZL7 A;  3JQR A;  1CZF A;  2WAF A;  3R6S A;  2JPC A;  2JK3 A;  1VLY A;  2W25 A;  2YUS A;  4RGS A;  1H85 A;  3ZIA A;  5F4M A;  2YR2 A;  2O7O A;  3L2R A;  2DI3 A;  4UB6 C;  5GAE J;  4M53 A;  2BF4 A;  1OR7 C;  1X1D A;  2VXD A;  3HJE A;  4HNV A;  2HDC A;  5KW9 A;  1YIJ B;  2H6B A;  5HDN A;  3L2U A;  2V1U A;  3NE5 B;  5J8C A;  4ESB A;  4A3J J;  2LD5 A;  5DTD A;  3QPS A;  5HLG A;  5LMZ A;  1ZRF A;  3AL0 B;  2WJV A;  4LB5 A;  4WZT A;  4C0S A;  2VJ5 A;  1TNS A;  1T6Y A;  3DKY A;  1O8L A;  1B1B A;  5AIQ A;  2L4A A;  2XTY A;  2Q6I A;  4YEJ A;  3E6B A;  2PBI A;  4PJM A;  1PJ7 A;  4AC0 A;  2BN4 A;  4I09 A;  2ZNZ A;  3GZ6 A;  5M3F J;  4KKT A;  1YS7 A;  4II3 A;  4IRH A;  1ETW A;  1X1C A;  2Y2Z A;  3KPH A;  4BE1 A;  4YFK F;  3BR2 A;  1HKT A;  1X1B A;  1O4X A;  1ZRC A;  4YCQ A;  1W34 A;  4AID A;  1VQ8 I;  5C1C A;  3IH4 A;  3W2A A;  1DGR M;  1PVE A;  1L3L A;  2PX9 A;  2I5U A;  3CQZ J;  1YYV A;  1OFE A;  3LFK A;  1KC8 D;  2A3S A;  3OS1 A;  2DFH A;  2KIQ A;  5B5E C;  5K5R A;  2OYN A;  3JRC A;  5CPR B;  2L01 A;  3VYU B;  3Q0V A;  5IOY A;  1K28 D;  5D6F A;  2X4H A;  1B72 A;  2JJ2 A;  3SLD A;  1MGT A;  4IPA A;  1YTY A;  3VMF A;  5FO5 A;  5DS0 A;  3LMM A;  1MZB A;  4M74 A;  1V55 H;  1FNN A;  1V54 H;  2HTS A;  2IXS A;  2CUZ A;  2C5H A;  4XKV A;  2D9R A;  3GLL A;  2ELJ A;  2M2E A;  3IKT A;  4A3I J;  4NBQ A;  4FAS D;  2Z99 A;  1D1C A;  2DT7 B;  4CZC A;  3WBJ A;  3WGI A;  3HRM A;  4LLG F;  3RPQ A;  2IW5 A;  2XPW A;  1R1U A;  1XMA A;  3FWE A;  3LQE A;  5C1E A;  3FXK A;  4YXW A;  3MN2 A;  5CKT A;  4XIC A;  3W2H A;  4P6V F;  1UMK A;  3CO7 C;  1S9H A;  3A3G A;  2F5C A;  3V8L A;  3CF5 F;  3RI4 A;  3ZP5 A;  2WAE A;  3CD6 I;  1J5Y A;  4UV9 A;  4XOR A;  5HNF A;  2J5O A;  1R5H A;  2VAS A;  3JSP A;  4HF0 A;  2XZP A;  4IHV A;  4MFE A;  3B82 A;  3QYE A;  5KK1 A;  4OJO A;  1R1V A;  2KHM A;  2L9S A;  3TO9 A;  5A2Q K;  2NOJ B;  4QWQ A;  3KLN A;  3KFW X;  2OCC H;  4PSW A;  1WU8 A;  5J3L A;  5FJ8 J;  5IT9 Z;  4BPR A;  4BU2 A;  3ZOB A;  3BG3 A;  4A69 C;  2V7W A;  2VBW A;  5DYM A;  2XIG A;  3R0A A;  4TMX A;  4R8H A;  1KU3 A;  1WOS A;  1XD7 A;  1K73 D;  1ZM4 A;  4UUT A;  3SY2 A;  3JR9 A;  1YRN A;  3HHH A;  3OYC A;  1ZAR A;  4M3B A;  3K4N A;  1VI0 A;  2WY7 Q;  1QHH D;  2VJJ A;  4BBS J;  2QQ9 A;  2DJI A;  4D7M A;  4AF6 A;  5CVI A;  4B43 A;  5E3N A;  3HOY J;  4EQQ A;  3H92 A;  2UWM A;  5JMC B;  2R93 J;  5H20 A;  2XZO A;  3V8J A;  2K4J A;  1WQ2 A;  2PIA A;  3UKG A;  4HEA 2;  2IOU G;  4UUS B;  1YJW I;  4Y15 A;  2LG4 A;  4P96 A;  2R7U A;  4YAL A;  4ZGQ B;  4JQF A;  1MJA A;  1MAB A;  4YRV A;  1G3W A;  3OOU A;  2LMD A;  2JA5 J;  2XAJ A;  2RGV A;  1O8E A;  2H1L A;  1ORK A;  4IHS A;  2OPT A;  4E70 A;  4G7W A;  2OCE A;  3KP5 A;  4ZTJ A;  4U87 A;  3CJN A;  3GUD A;  3DU1 X;  4C30 A;  4IF4 A;  3R6K A;  2AO9 A;  1FMV A;  1QZZ A;  2FX0 A;  2XF6 A;  3QPH A;  3AG2 H;  4EEF G;  2FBK A;  2M3A A;  4IKF A;  3CME B;  3E5U A;  2W00 A;  4NDL A;  3MCA A;  2OV7 A;  3RZO J;  1RPW A;  1BN8 A;  1Z7L A;  1IRZ A;  4YG2 F;  1T95 A;  4NQW A;  1U8B A;  4I84 A;  4C3I J;  1IXC A;  3R4K A;  1VQ4 I;  4B47 A;  1LKX A;  2XGC A;  4R79 A;  4P6Y A;  4W8S A;  1YW9 A;  1OFL A;  3SUC A;  2BOL A;  4UV8 A;  1MMA A;  3K7A J;  2QXZ A;  1MH4 A;  3A0H C;  3KLO A;  3LWF A;  3W6J B;  3I1F A;  1UEL B;  4IQ4 A;  1O8I A;  1B59 A;  4M3E A;  4WZL A;  4XLP F;  2VLA A;  5FKL A;  3WOD F;  1R71 A;  1EP3 B;  3OYB A;  3BCD A;  5E1W A;  2NTQ A;  1QBJ A;  2M30 A;  1YJN I;  1R9T J;  3V4G A;  1YRN B;  3S15 J;  3KEQ A;  1O8G A;  1OQY A;  3EQL F;  1KA8 A;  5H59 A;  1IXR C;  2P5K A;  1R6R A;  2DAO A;  1D3Y A;  4MR0 A;  4X0G A;  1RKW A;  2DTZ A;  3G2B A;  3CF2 A;  4B1R A;  3PM1 A;  4W97 A;  1WJB A;  2IA0 A;  2HYF A;  2KZV A;  1UFM A;  5EEG A;  1YIJ I;  4ACB A;  4HLX A;  1W87 A;  3FM3 A;  5J4V A;  5F0H A;  1X3Z B;  2FQ4 A;  4TMZ A;  1O8J A;  3CCE I;  4RLZ A;  5DEQ A;  1T5E A;  2VZL A;  5F4J A;  2CUJ A;  2LOO A;  1FYK A;  4L8J A;  1AKH B;  1EP2 B;  2WJY A;  1DBO A;  3F72 A;  2XRO A;  4P5O A;  2MG4 A;  3W6K B;  3U6K A;  2EH3 A;  2WTE A;  1Z7U A;  2A6T A;  5K5Q A;  3HOU J;  2IA2 A;  2O0V A;  3K70 C;  2AXL A;  4P55 A;  2CQQ A;  2DYR H;  3CCJ B;  4HWV A;  2V1X A;  4A5N A;  2R7O A;  2ZJ2 A;  3E6D A;  5EG0 A;  3DFG A;  4E0F A;  1LM1 A;  1B9N A;  3VPR A;  1DU6 A;  3HEF A;  4NQW B;  3FPK A;  1RRJ A;  1VBL A;  3FK7 A;  1PKV A;  4C2M J;  4IHX A;  1H8H A;  5E17 F;  3TO7 A;  4XM3 A;  4PSX A;  2GQF A;  1HF0 A;  2BW3 B;  2FA5 A;  4WWV A;  1O57 A;  2Y9Y A;  2HS5 A;  2XAG A;  2FQ3 A;  3NWT A;  4D0P A;  2R7S A;  1FTT A;  4HPQ A;  2NZM A;  5D5W B;  3OV8 A;  2B63 J;  1YW7 A;  1QRC A;  1E1R A;  3BC8 A;  4BHP A;  1HQC A;  1R5G A;  2NVQ J;  3OYL A;  2HDW A;  3QPL A;  3S8P A;  3SZG A;  3IV5 A;  1GJR A;  2ZME A;  2DOD A;  2OAZ A;  2XRL A;  3S3M A;  1G8X A;  3WTZ A;  4BEH A;  4DNC A;  2JJ7 A;  4CSW A;  1YHQ I;  3E6C C;  1NK2 P;  5B1A H;  4FK8 A;  1VQ5 B;  3GW2 A;  2F4N A;  2L54 A;  2HKO A;  2X48 A;  4AIH A;  4OPO A;  5FO0 A;  2XGJ A;  3ZGK A;  3J7Y J;  4ANJ A;  1W7P D;  3Q9S A;  5HS9 A;  5LFA A;  2ODL A;  3FDY A;  4BAC A;  3GFJ A;  5IP7 J;  3SQV A;  4KIB A;  4YZX A;  2WPD A;  4XNF A;  3ONU A;  1KQS B;  1JHH A;  3FMS A;  4CCM A;  1GDT A;  3DLA A;  5DCM B;  5BPI A;  3E5Q A;  2M45 A;  5M5X J;  1U6G A;  1J0R A;  5IYQ A;  4CQJ A;  4F52 A;  1MNM C;  2DA5 A;  2L9N A;  4AUX A;  2XRN A;  1X1P A;  1BC7 C;  2YS9 A;  4MQV A;  1P4X A;  4BGD A;  3OYE A;  2QDX A;  2P5L C;  2R7D A;  3Q39 A;  4Q47 A;  2E35 A;  3KP3 A;  2X1D A;  4ZYG A;  3KP7 A;  2CC2 A;  2ZSI B;  2D3L A;  3OFN A;  4PK4 A;  1B9M A;  4OZY A;  2GQQ A;  1LB2 A;  3ECO A;  4OPS A;  3GIR A;  3ASN H;  1ETV A;  2LKS A;  4L9J A;  2PI0 A;  1ZUN B;  2MFZ A;  3RQI A;  4CH7 A;  2P6S A;  5EG0 B;  3WE2 A;  3QYF A;  2VFQ A;  2YX4 A;  2BGI A;  2BM4 A;  2FE3 A;  1F4K A;  1Y39 A;  2HVR A;  1KQ0 A;  1O7L A;  5F27 A;  3S2D J;  2OBS A;  3T5X A;  1I1S A;  2XZL A;  3BR6 A;  1BJZ A;  3MMY B;  2ZSH B;  4NCN A;  3OW2 B;  3ZPP A;  4CDG A;  4RD0 A;  1SAX A;  3BH7 B;  3O2P E;  2P8T A;  3E3V A;  3ZN0 A;  1ZM9 A;  3IAS 2;  1RUO A;  3K2A A;  4G8X A;  1G7R A;  4LBV A;  4X06 A;  1MBK A;  2JSP A;  3O8G A;  4KDP A;  1T8I A;  4YIR X;  1D8J A;  1YS6 A;  2YWG A;  3FKI J;  1SD5 A;  1LUJ B;  1HW5 A;  1XDS A;  5TRD A;  2F5F A;  4WXH A;  4MIM A;  5JVT A;  4H4K C;  4HSR A;  5LD2 C;  4IJA A;  1JNY A;  4PC3 A;  3JW4 A;  3L00 A;  1YOV B;  2W84 A;  3TOA A;  3VEP A;  1Y8Q B;  3I71 A;  4BEH B;  1E3O C;  4J00 A;  3RYR A;  4GQN A;  3M1E A;  2JUC A;  1WJE A;  1JUM A;  1XDU A;  1O3R A;  3VFZ A;  3BTL A;  2NTP A;  4LK1 F;  4BDZ A;  3D0S A;  1TVC A;  1VQ6 B;  1A36 A;  4L5E A;  4RS8 A;  3JX8 A;  2LC2 A;  1TQI A;  1IUY A;  1IO2 A;  1U9N A;  3E97 A;  3DU6 A;  4F92 B;  3VMV A;  2BXZ A;  2QGG A;  1HW2 A;  3BTC A;  3H9J A;  2XV4 S;  2ZZQ A;  3ROU A;  2V9K A;  1Z67 A;  3JRD A;  1GQ8 A;  1L0O C;  4BY7 J;  3GWZ A;  3K2Z A;  2QA4 B;  1FP1 D;  2CS3 A;  2RC5 A;  4ENN A;  4JP0 A;  5JFR A;  2UXN A;  1R5I D;  3E5X A;  1VQM B;  4Y33 A;  1YLF A;  5KSW B;  3KZI C;  1R4N B;  1K9M D;  5IY5 H;  1FT9 A;  2E60 A;  2IPQ X;  1FZP B;  3TKY A;  2HQN A;  5IYD J;  1SM4 A;  4NHJ A;  5JVG F;  1GV2 A;  3CCU B;  2DTR A;  3LSI A;  2E1O A;  3ZZ0 A;  4DOZ A;  1V5E A;  3TOB A;  4I76 A;  4I2O A;  3BRO A;  1TYV A;  5BSY A;  2ICW G;  3LNN A;  3V76 A;  1OOC A;  4O6J A;  1EF4 A;  1ZQ3 P;  2FSW A;  4RGU A;  2L2O A;  2FBI A;  1SD7 A;  2LY1 A;  1DDI A;  1XGS A;  3ZN1 A;  4BUP A;  1BIA A;  2KRF A;  3RTR A;  2WWY A;  1WHU A;  1ZK8 A;  3OS0 A;  1TTT A;  1OKR A;  2DMU A;  2ADU A;  2KJC A;  4LBZ A;  4PGO A;  3KP4 A;  4E4H A;  2IGM A;  4L9V A;  1VQP B;  2VFN A;  3C3W A;  3HKZ N;  3X2Q H;  2RNG A;  2NNY A;  2CGP A;  1O88 A;  2YSR A;  3OR2 C;  3AVX A;  4G6D A;  2R5Y A;  1UCR A;  1HLV A;  1X1A A;  1FPQ A;  1CNF A;  1GHC A;  4G1V A;  5L3B A;  3F3X A;  1IRF A;  2OZ6 A;  4OWR B;  1ZG3 A;  3FIS A;  4XON A;  4TKO B;  3W5V A;  1KYZ A;  2CH0 A;  1JUS A;  3DV8 A;  2CRG A;  4HDV A;  2HDN B;  4UVC A;  3PET A;  3VO2 A;  1IN8 A;  2PLF A;  3LA2 A;  4U88 A;  2Z8G A;  2OQG A;  3B78 A;  4CA0 A;  1DG1 G;  4P2N A;  3CCJ I;  1V0F A;  2ESH A;  2P7V B;  2K3F A;  4OIP F;  2DOF A;  3LVB A;  3QFS A;  2BVM A;  1HDP A;  3LFU A;  1QX4 A;  1XSX A;  3DWL E;  1KMH A;  2ZO4 A;  1Q1V A;  2CO5 A;  1WJF A;  1OB2 A;  1IDZ A;  2X53 S;  3Q6Q A;  4UZU A;  3W5H A;  3P27 A;  4YEI A;  1KD1 D;  5JHU A;  4JBA A;  3W2G A;  1I1G A;  1X2N A;  2HNH A;  1EZG A;  3BG7 A;  3QOE A;  2D45 A;  3FK6 A;  1QQ1 A;  2DFF A;  3HSF A;  3WGG A;  3TP3 A;  5EZH A;  3GTG J;  2O04 A;  5FD5 A;  1IGN A;  2O8X A;  4OJP A;  4E7I A;  1IHM A;  5HZB A;  3LST A;  2COB A;  1U2R A;  2DLL A;  2VBE A;  1BX0 A;  3TP0 A;  4YIF A;  2OK8 A;  4WXC A;  4Q7J B;  1U3E M;  5CYV A;  4JX5 A;  3BOQ A;  4OIO F;  3CRZ A;  3BCA A;  5FRN A;  4DK1 A;  3C2B A;  2LKX A;  2GXB A;  1VZ0 A;  1D2E A;  1FC3 A;  2E71 A;  1K4T A;  1VQ5 I;  1IJE A;  4J01 A;  2LYC A;  1EJ9 A;  1UG0 A;  1RQR A;  1HC8 A;  4ZYE A;  2DIE A;  3LNQ A;  2ZCW A;  1LDK B;  5GAD J;  4GRI A;  3OYD A;  5TV2 A;  1D0X A;  1YI2 B;  2WAQ N;  3DF8 A;  3BDD A;  4L18 B;  3D5L A;  2B7E A;  4OIR F;  2OD5 A;  2XNC A;  1MBF A;  5M3M J;  1PXZ A;  3HRS A;  4RLQ A;  2Z16 A;  4AYB N;  1G7T A;  2HOE A;  2W6J A;  3FJO A;  1W5S A;  4JRA C;  2VL8 A;  3K0L A;  1JKQ C;  1FX0 A;  1HST A;  1Q1H A;  1KYW A;  3M8F A;  4CCJ A;  3JRI A;  3S1N J;  1DAR A;  4CCK A;  4HE6 A;  3WWG A;  1FIP A;  1YX5 A;  3GFL A;  2EIM H;  1SFU A;  1BJK A;  4BQO A;  1U5T A;  2JT1 A;  1E3Z A;  1OB0 A;  1OIS A;  1IJW C;  2NT9 A;  4MEX F;  2EWN A;  4OU0 A;  4BE2 A;  1R58 A;  1A35 A;  1ZR2 A;  2EFG A;  2R7W A;  2EIL H;  3MKZ A;  2MC3 A;  1ZLJ A;  3U6B A;  3GQA A;  1TUI A;  3WTU C;  2GPJ A;  1WTH D;  1T08 B;  3KL9 A;  2QZA A;  4G5G A;  1FSE A;  4F91 B;  4Z03 A;  2V7V A;  2DU9 A;  3OPO A;  4MLO A;  3CMM A;  3WU0 A;  3GZN B;  3SFI A;  2NV4 A;  4M4S A;  2JN6 A;  2Z2S B;  3ZQH A;  4A0X A;  4CCL A;  5HNH A;  4M0L A;  2L7F P;  3G6E B;  4I02 A;  1LFP A;  1WP6 A;  2XT4 A;  1F43 A;  1DU0 A;  3ISX A;  2VBU A;  2V6E A;  4RM3 A;  1J9I A;  2DN0 A;  3F22 A;  2CF4 A;  5D5X B;  3ASP A;  3B6C A;  3V7R A;  4PC6 A;  3WNB A;  5K7Z A;  1NBM A;  2CFO A;  1VQ9 B;  3IAM 2;  4A2U A;  3EYY A;  1BI0 A;  4OOI A;  3OAA A;  2QTL A;  2R92 J;  2OTL B;  5EJC A;  3DTE A;  2H94 A;  3QOP A;  4HV5 A;  3WHC A;  2DOA A;  4YAF A;  2H27 A;  2Y31 A;  5EDN A;  1W1W E;  5D4R A;  3ASO H;  3H9G A;  1FNC A;  3PSZ A;  1Z91 A;  5ICC A;  2COM A;  4Y13 A;  1OR7 A;  1E79 A;  2RC4 A;  2Y0M A;  4QLC U;  1VQ6 I;  2FMY A;  2Z9O A;  4KIS A;  4AVP A;  2XSD C;  3H9Q A;  3ZQI A;  4AWX B;  3M9A A;  2V26 A;  1YW8 A;  1T56 A;  2X0L A;  3IWF A;  2Q8K A;  3OOP A;  3S32 A;  1LPQ A;  3IUO A;  2P4W A;  2R4G A;  4L5I A;  4RGX A;  2DMT A;  1BQE A;  4LIU A;  5GV7 A;  2QA4 I;  5LRS A;  5HXB A;  1BJA A;  4BS9 A;  4Z6Y A;  3L9F A;  4Y7N J;  1Z21 A;  1UB9 A;  2EQR A;  1OGJ A;  1RQP A;  1LNW A;  1IXS B;  1FIA A;  3BH4 A;  1SEU A;  1F9N A;  2B9S A;  1CQT A;  5THX A;  3B73 A;  1XSV A;  1ZTR A;  3KP2 A;  3W3C A;  1JTA A;  2W24 A;  3TGN A;  2Z3Y A;  4EJO A;  2ETH A;  3NB2 A;  1NDH A;  4RDK A;  2PJR B;  4Y4R A;  1B6A A;  2CRV A;  2ZL5 A;  3HUG B;  3I53 A;  5E8G A;  2MLK A;  3COA C;  3N97 A;  2YU3 A;  1HCR A;  2ZFU A;  4YFN F;  4IHW A;  4R71 A;  1LDD A;  1O8K A;  1NK3 P;  1WMR A;  4U49 A;  5EGO A;  1O8H A;  4QVJ A;  1H0M A;  2WC2 A;  4RB1 A;  1VJS A;  1Y1W J;  5FFX A;  1OCO H;  1QA6 A;  4BKX A;  1V0E A;  3I4N J;  2GK6 A;  3HSR A;  1PJ5 A;  4KIC A;  3CCS B;  5LGN A;  3RY8 A;  2X85 A;  3CCR I;  4N0B A;  4A3L J;  1BN5 A;  3KEW A;  1TYU A;  1K5C A;  1TC3 C;  5KCM A;  4F7Z A;  1S6L A;  1HW1 A;  2DJN A;  1VQP I;  1XCB A;  2RDP A;  3K4L A;  1X4P A;  1V3F A;  3IL2 A;  1BOB A;  4FX0 A;  3GYH X;  5HZA A;  2QEX B;  1S3J A;  4FN5 A;  2STT A;  3WTW C;  3C1D A;  3RPU A;  1JT0 A;  4ZCM A;  2E1M C;  1D0Z A;  1K4Z A;  2QM3 A;  4WWC A;  1OB5 A;  5FFZ A;  3WE3 A;  2Q2E A;  1QZE A;  3AG4 H;  3RZD J;  5IT3 A;  1KQ5 A;  2CND A;  1VTN C;  2CMP A;  2P81 A;  2DA1 A;  5JR3 A;  1AU7 A;  3Q3A A;  4KIG A;  2EV6 A;  2JVH A;  3AK5 A;  2BSA A;  3H0D A;  3TH0 A;  1ZR4 A;  2XKO A;  1E0E A;  4NC7 A;  2XTX A;  1OLT A;  5DCF A;  4ZDO A;  5LEJ A;  1UHS A;  4Z2Y A;  1W0J A;  4P25 A;  1ZRE A;  1R5N A;  3QPT A;  3BCB A;  4B3X A;  4GFB A;  3M4O J;  4LD5 A;  3CDL A;  4PCQ A;  4LBW A;  1WPC A;  5F0C A;  4O5V A;  3J80 K;  1BL0 A;  3K10 A;  1KU9 A;  3MWM A;  3S2H J;  4HBL A;  1I8D A;  5BS6 A;  1XX5 A;  3PNY A;  3K4J A;  4TV7 A;  4BJT A;  1AHD P;  3DEW A;  4LLN A;  5BSX A;  4OJ6 A;  1EFT A;  4S05 A;  2IRF G;  3JQP A;  4Z4V A;  2E34 A;  2H8R A;  2DFI A;  5J4Y A;  4W8T A;  3OIQ A;  3A02 A;  1W5T A;  4OJ5 A;  4LFU A;  4D1Q A;  2C4U A;  3LSP A;  2HXO A;  2RNJ A;  4ESJ A;  1DP7 P;  3W2E A;  3CCQ B;  3DEU A;  3I64 A;  4PDK A;  2XUB A;  1I7P A;  2NAZ A;  4U0V A;  5EGO B;  3BJ6 A;  3G73 A;  5HLI A;  1KCC A;  4BJ6 C;  1T38 A;  1TWC J;  2NS0 A;  2P6T A;  1BW5 A;  2J8K A;  4ZCL A;  4PAB A;  1MJB A;  1RNL A;  1YI2 I;  2V9V A;  2PFB A;  2HQR A;  1HSJ A;  1F36 A;  1SMY F;  1VQK I;  2NSP A;  1MKM A;  3AG1 H;  2VKV A;  3AL0 C;  4RD6 A;  2IT0 A;  2XC7 A;  4TSF A;  3BPV A;  1WJA A;  2GXG A;  3BTI A;  5JLX A;  2G0Y A;  1I6X A;  3ZMZ A;  4E7S A;  3ISP A;  5L3E A;  1SFK A;  2X3H A;  2L7K A;  5KAF C;  3OWT A;  3BZ6 A;  4HYE A;  4K2E A;  3S3O A;  3CCL B;  4G94 A;  4QIW N;  1IZ1 A;  4QHY A;  3Q6R A;  3G1O A;  2HKX A;  2IBD A;  5D4S A;  3DEE A;  1P4M A;  2D74 A;  5DD4 A;  2EB7 A;  2E2J J;  4RCZ A;  5E20 A;  3BH6 B;  3ASS A;  1V4R A;  4Y17 A;  3AFH A;  3GVL A;  2A07 F;  2GRE A;  2O0W A;  3I58 A;  3LSG A;  2FOW A;  2GIV A;  3ML6 A;  4RDU A;  2D5V A;  2QUF A;  4A3E J;  5GPA A;  4MGR A;  3FPP A;  4KA4 A;  5E1Z B;  3A3B A;  9ANT A;  6PAX A;  3CUQ A;  2R7Z J;  2KRH A;  3OY9 A;  2HPM A;  4OZZ A;  5D8L B;  3ZRG A;  4D5C A;  3G6E I;  3WTT C;  1PJ6 A;  4FE4 A;  4MEY F;  3DPU A;  3HYI A;  4KMU X;  2HOT A;  2R6H A;  2QQ8 A;  4Y52 J;  1A6Q A;  5A2Q Z;  3J7Z I;  4QPQ A;  3QP6 A;  5IYR A;  3BY6 A;  3M8E A;  2EFN A;  4EGY A;  2L9R A;  4I0B A;  4ZDP A;  1VQ9 I;  2IVM A;  4DQK A;  3HOW J;  2BY2 A;  2ISY A;  1JI8 A;  1AIP A;  5JLW A;  2F4I A;  4IQJ A;  1JT6 A;  5F04 A;  3OZW A;  2FJ1 A;  2LNB A;  5L3D A;  1YO5 C;  3GME A;  1B8I A;  2OTL I;  3IKV A;  3ZSC A;  3SLN A;  5CVU A;  3H5N A;  1R36 A;  2IEK A;  1KK2 A;  1LQ1 A;  2I8D A;  3GCM A;  2IGO A;  4R1H A;  4E7J A;  2FVG A;  3BC9 A;  4NBS A;  3E1S A;  4YEL A;  5FLX K;  4XLN F;  2LRD A;  3VDX A;  3DKX A;  1ZLK A;  2XOK A;  2CYY A;  2HCJ B;  2QQB A;  1VHE A;  4XKC A;  1LEA A;  2ME6 A;  4AIK A;  3QRF F;  2DBB A;  1QVU A;  3LSH A;  5AON A;  1G7S A;  4PFO A;  2G7U A;  2O6W A;  1HKS A;  1QNT A;  3FKS A;  1B72 B;  3CES A;  4N4O B;  2RV8 A;  2BHY A;  3EUH A;  3PIO F;  2VBT A;  2MC4 A;  1KGS A;  1VQO B;  2XHK A;  3VSK A;  3F0C A;  3FHN A;  4WXD A;  4PC2 A;  3RKY A;  1PJR A;  1QGA A;  1CLW A;  1Z6R A;  4G6Q A;  2MSY A;  2EK5 A;  3MCZ A;  1K4S A;  3GBG A;  5FGM A;  2M9H A;  4EJU A;  4LJZ F;  5LBQ A;  4A3M J;  1G7C A;  3B8H A;  1R1T A;  3I3L A;  2R5Z A;  1DPU A;  3FMQ A;  3T1B A;  3HL2 A;  1W0K A;  2CQN A;  3I0T A;  2CUF A;  3CJT B;  4HX4 A;  1WJ5 A;  4WZK A;  2JWT A;  4RD3 A;  3F23 A;  1ETO A;  3Q0U A;  1TYX A;  1OMI A;  3SQN A;  2VBV A;  3WU1 B;  4RAY A;  2FNA A;  4RJL A;  1OCP A;  2KMU A;  4JMQ A;  2K7L A;  5C4J J;  2K9Q A;  3H36 A;  2MYS A;  4YFX F;  3Q38 A;  2W4S A;  4ENK A;  3CUQ B;  3CTA A;  3F6V A;  3ABM H;  2CW0 F;  5IYC J;  4URR A;  2QSH X;  3A4C A;  5GTH C;  3GQ9 A;  2O8K A;  1G3T A;  1SVL A;  5L46 A;  4FX4 A;  1OJL A;  3TW7 A;  3PQJ A;  3BTJ A;  1Z3Y A;  3JU4 A;  2M8G X;  1JTY A;  3R60 A;  4RGR A;  4EV0 A;  4A3F J;  2VOD A;  5IPA A;  2X6O A;  3OIP A;  3VYT B;  2QEX I;  1TL8 A;  1M90 D;  1HA3 A;  1EA3 A;  3BY1 A;  4XSZ F;  3NQO A;  2KQR A;  2V6C A;  3O6B B;  4HLY A;  1B8I B;  3P9K A;  4M9Z A;  2NS7 A;  2HVQ A;  1IN4 A;  1K6Y A;  3M07 A;  3KET A;  4M2L A;  1BC8 C;  1RI7 A;  1D0Y A;  1ONV A;  5GTI C;  2BM1 A;  2CW8 A;  1O3Q A;  3SJM A;  3ZBT A;  3FIW A;  2O3F A;  3RIR A;  2CV1 A;  3NAW A;  1A8P A;  1E43 A;  1UD3 A;  3OJW A;  4A93 J;  1WH5 A;  2OBR A;  5GPC A;  5HLH A;  1F20 A;  3ZC3 A;  3NAR A;  4HAM A;  4P9U A;  3T8T A;  1LE8 A;  3AVW A;  2KL4 A;  5JI6 A;  3MZH A;  1I3Q J;  2KIS A;  2R7F A;  5J6X A;  1R7J A;  3ZPL A;  4GDF A;  3LYC A;  3ZQC A;  3HZJ A;  3KCC A;  3HOV J;  1P4W A;  2ECB A;  4KJZ A;  4G6I A;  3BQJ A;  4IL6 C;  5F64 A;  1OCT C;  5J8F A;  3F8M A;  2IA1 A;  1NB9 A;  3N90 A;  4BJ5 C;  3QU3 A;  1Q7Y D;  4B44 A;  2W6I A;  4BBR J;  4FTH A;  2QLZ A;  1K78 A;  3ZPN A;  1WJC A;  5LEK A;  3CC4 B;  5ICF A;  1QGY A;  3JTG A;  3W6V A;  1E64 A;  2NVY J;  3R0J A;  2EZH A;  3ZZU A;  4Y9U A;  4YDT A;  2YX7 A;  2JSC A;  3BR3 A;  2VI6 A;  4IEJ A;  1I39 A;  2H1K A;  3CMA B;  4Z1M A;  2LFB A;  1JUP A;  1MDM A;  1OGI A;  1ODD A;  2HZT A;  4XLF A;  1TBX A;  2HOS A;  3I54 A;  2STW A;  2ZNY A;  2VON A;  3A2K A;  5AMV A;  2BY0 A;  3WHB A;  3CDI A;  4B8X A;  4KIT B;  3WG7 H;  1S5L C;  4DW6 A;  5ERI A;  3VWB A;  1VQN B;  4BQQ A;  3HOT A;  3A1Y A;  5D8K B;  4K1X A;  2RAE A;  3I4P A;  1GLN A;  1X3W B;  4F7D A;  2QX3 A;  3BG6 A;  1EFC A;  1MRZ A;  2P3M A;  4OJL A;  4WF2 A;  1UHM A;  3K6G A;  3BR1 A;  4KN4 X;  5DV5 A;  1KQ9 A;  3RKX A;  3I55 B;  3CC7 B;  2XGD A;  3CCL I;  1WFX A;  1FNB A;  2JDI A;  1UJ8 A;  3Q3S A;  5GV8 A;  3CJR B;  2D3N A;  2EFQ A;  3G1L A;  4V19 K;  1IAW A;  4M9S A;  3CCM B;  2VXZ A;  1TWH J;  3GSI A;  4MYT A;  1GXP A;  5LGU A;  3A8K A;  5J1R A;  3ZMD A;  1YG2 A;  4W1U A;  2V79 A;  4LB6 B;  1QHG A;  5K1Y A;  1PUF A;  1D1B A;  4LG3 A;  2MW8 A;  2O1D A;  2G7H A;  3VOD A;  1E3H A;  5LRR A;  1UD5 A;  3GFM A;  2IS4 A;  1KK0 A;  2R7X A;  2D2W A;  3VR6 A;  2R0Q C;  5B6I A;  1ETK A;  1P4A A;  4C9Y A;  3CPX A;  2V5I A;  1LE8 B;  2LY2 A;  3PSS A;  4L0Z B;  4X7D A;  4IHY A;  3WQZ A;  2LK2 A;  2X6Y A;  3D5S C;  4RAG A;  5K5O A;  2JA6 J;  1SVO A;  1FBU A;  1NJI D;  4XOT A;  1R23 A;  2VC0 A;  3OEH A;  4U7B A;  3GTQ J;  1QA1 A;  4DYR A;  4I01 A;  4A0Z A;  2J7K A;  1BW6 A;  3LL7 A;  3VOE A;  4N3G A;  1LLW A;  2EA2 A;  2F4M B;  3QP5 A;  3HPG A;  1BM9 A;  5TJJ A;  4X7C A;  2KIF A;  3OW7 A;  1RUN A;  3BT9 A;  1K78 B;  1RU4 A;  3BQZ A;  2XVC A;  4P1V A;  2ZXW H;  1WJD A;  1H42 A;  3LJY A;  5E3O A;  3CMY A;  3S1M J;  2MD5 A;  3H5A A;  5KHD A;  4PGG A;  1S7E A;  2BHZ A;  4M71 A;  3L1P A;  1QG0 A;  2GWR A;  2ID6 A;  4XLC A;  2Y0S N;  4YAO A;  2W48 A;  2XGX A;  4XK4 A;  3LAJ A;  3VSV A;  3FXU A;  3AGQ A;  2WZP P;  4YAU A;  3GF2 A;  1Y56 A;  2FF4 A;  3S17 J;  3CXC B;  2W7Z A;  3PFY A;  4HDU A;  1OFC X;  2E5Z A;  3NEU A;  5ILV A;  4NUB A;  3OE7 A;  2VBK A;  1T0F A;  4D7N A;  2BXY A;  4DZP A;  2AHO A;  3GO5 A;  1VQO I;  4X1E A;  4HF1 A;  5IP6 A;  1W36 D;  5FA6 A;  1RR8 C;  1HDD C;  3L2Q A;  3V7C A;  1MMN A;  5DUK A;  2L4M A;  1F1Z A;  2DMP A;  2ZME B;  1K6O A;  3PIP F;  3C18 A;  2EFW A;  1QU3 A;  1ZM2 A;  5J1U A;  2DW4 A;  1HVX A;  1IDJ A;  1OGM X;  2FEZ A;  2VKH A;  1VND A;  3MZ8 A;  3AVT A;  3H0G J;  4WZE A;  1XC5 A;  4JK1 X;  4AM3 A;  2EV0 A;  4TMT A;  2NTB A;  4GYG A;  3CME I;  1PP8 F;  2BSP A;  1HF2 A;  2D1H A;  1IDK A;  1UZC A;  3BJO A;  3CCY A;  2WBM A;  5H5J A;  3E0J B;  4DBQ A;  4FCY A;  1WXR A;  2ELH A;  3DPL C;  2VNI A;  5D6E A;  3ELK A;  4LIT A;  1ON2 A;  2Z33 A;  1S7A A;  3OYH A;  1G3Y A;  2X9D A;  1MSF C;  4PJ0 C;  2LH9 A;  3EQO A;  5C4X J;  2P5V A;  4QVA A;  2ZME C;  3V8K A;  3BZK A;  4X8I A;  3AVU A;  5DS9 A;  1SKY B;  2X0K A;  2BM0 A;  1TQM A;  2C77 A;  1TW3 A;  3CUO A;  2Q6K A;  4C3J J;  2F1L A;  2C4T A;  3SYJ A;  3GX4 X;  1UD8 A;  4EAT A;  1GAW A;  4MHG A;  3SZP A;  1JGG A;  1QVG B;  5BOX A;  3GQ7 A;  3LSJ A;  2IS2 A;  5CQG A;  1RMG A;  1GUU A;  1SAU A;  2F5E A;  5AN9 A;  2E2I J;  2ZZF A;  2CG4 A;  3FX3 A;  1EP1 B;  2XKP A;  1PDN C;  3BPX A;  3HM5 A;  4XN3 A;  3OYM A;  4IOC F;  2VPL A;  1AA7 A;  1NRK A;  4L0Y B;  1WVR A;  4GO1 A;  2M87 A;  2UV1 A;  2OQR A;  4WX9 A;  3VNU A;  1OPC A;  4GGG A;  2XF5 A;  5BNG A;  1ETX A;  3CW2 A;  5IYP A;  3HOZ J;  1FOK A;  2VKD A;  2R3S A;  1J2X A;  1EH6 A;  2Y75 A;  2KZG A;  3CZ6 A;  4A3D J;  1ZM3 A;  1HA8 A;  1KZH A;  5DUI A;  1HKQ A;  2W85 A;  3UNG C;  2O0Y A;  1DDG A;  1V5F A;  1UD4 A;  2RKH A;  2ISZ A;  1BI1 A;  3S16 J;  2VKE A;  2DCE A;  3ZCO A;  1QQI A;  1BR1 A;  3HOX J;  3DDY A;  2O03 A;  1Y0Y A;  4PUS A;  1UD6 A;  2KKO A;  1FOX A;  2QE7 A;  2XPU A;  4I6Z A;  2K5C A;  1R00 A;  3BR5 A;  5K7F A;  2BGC A;  3PUB A;  1IRG A;  3V7A A;  1Z77 A;  2VT2 A;  4U9U A;  4EM1 A;  3OYG A;  2Y69 H;  4N9I A;  2KDZ A;  3CMA I;  4C2U A;  2CQX A;  1AIR A;  1QA3 A;  3I9V 2;  4BL0 B;  1PP7 U;  4IRI A;  3KRG A;  3EUA A;  1IDY A;  2WR8 A;  2UVF A;  3FZV A;  3W2I A;  3PVD A;  2IS1 A;  4IVN A;  2JVG A;  4GCV A;  4HQM A;  2DK5 A;  2E36 A;  4ITV A;  4XRS A;  4ENJ A;  1Z1D A;  3EET A;  3R61 A;  4L5J A;  1O7F A;  4CHU A;  3KYL A;  2JUG A;  3I55 I;  4N4N B;  3CC7 I;  4EW9 A;  4BHC A;  3N05 A;  3RSN A;  1YQA A;  5DSZ A;  4KKU A;  4PC7 A;  4FHT A;  2BPO A;  3A8I A;  1Q82 D;  3CP8 A;  2RC6 A;  5HS8 A;  1TWF J;  4CYC A;  1K61 A;  3VMW A;  1X2M A;  3VYS B;  3PUM A;  3SXY A;  4YFO A;  1ZGA A;  1JTX A;  3OR1 C;  5ICG A;  1O8D A;  1PLU A;  4YZA A;  1FBQ A;  3U1D A;  3MKW B;  3F8N A;  1WDT A;  1OFM A;  1K7A A;  3D1N I;  1QJV A;  5DM6 F;  3Q0W A;  2EV5 A;  4DNT B;  2GOM A;  3ZQG A;  1LDJ A;  2OK7 A;  3J7A O;  1JA0 A;  3QSY A;  3WNC A;  2EZK A;  4QPO A;  4H0E A;  4M9X A;  2R5Y B;  3HHG A;  1J09 A;  3Q9V A;  2ZIT A;  1H89 C;  2QWW A;  1P92 A;  4BE0 A;  1G2H A;  4HZF A;  5TGT A;  5LLQ A;  1S72 B;  2EZI A;  2F48 A;  2M4K A;  1VQ8 B;  1U2W A;  2EIX A;  3K1N A;  3SJP A;  2QBY A;  2XGE A;  5H6Q A;  1E62 A;  1ZGW A;  1BPL A;  1FRQ A;  2M0C A;  1MBJ A;  2VQL A;  3ZR8 X;  4LOC A;  4CIC A;  5A88 A;  2F3L A;  1Z9C A;  2VB6 A;  3PUN A;  4EMS A;  2I10 A;  1UMQ A;  1VQL B;  2F5D A;  1LVA A;  3CO6 C;  2HWV A;  4BDY A;  1E17 A;  2O5R A;  2PMZ A;  1QGP A;  4EH1 A;  2FML A;  4A3K J;  3U21 A;  2ZZG A;  2OA4 A;  1E2X A;  3CCV B;  3LSK A;  2BGJ A;  5A89 A;  3I5U A;  2HYJ A;  1WI9 A;  5EYR A;  1KJZ A;  2NS8 A;  4KT6 A;  2CW7 A;  3LQR A;  4B4C A;  4XID A;  2QKL B;  2B7C A;  4NB5 A;  2DPU A;  1TLL A;  2IGK A;  3W2V A;  2ZTG A;  4Z4R A;  3S1Q J;  2QY1 A;  4DBR A;  2UVE A;  3EPZ A;  2DOG A;  3M7G A;  1BA5 A;  5J1Y A;  2E7X A;  3W2F A;  5EEH A;  1XE1 A;  1LLZ A;  2NXN B;  5CQE A;  5HDG A;  1HG8 A;  2KRC A;  3PO2 J;  4UZF A;  3RCO A;  3KEY A;  4AYB A;  4EM2 A;  4UUV A;  1EFR A;  2ZBV A;  1UG2 A;  3PA1 A;  2WYR A;  2BVL A;  2EBI A;  1ITY A;  2BX6 A;  2M8E A;  2GZW A;  3AST A;  3CD6 B;  4MTD A;  3CLQ A;  2DYS H;  2K40 A;  1JE8 A;  4X07 A;  4ZH4 F;  2PLY A;  2HLD A;  4NC6 A;  3A01 A;  2EA4 A;  2HPI A;  2NOG A;  2O6G E;  3FKJ A;  1MH3 A;  1X4O A;  3ZQF A;  2VN2 A;  2XEX A;  3H3Z A;  1D1A A;  2K27 A;  2WB1 N;  5BPD A;  1DP3 A;  2ESN A;  4ZCI A;  1RIO H;  3I4M J;  1WRJ A;  3EUK L;  4TMW A;  2M0M A;  2X8K A;  1DBG A;  3E20 A;  2LY9 A;  2JA7 J;  2MH9 A;  4UVB A;  2I1L A;  2EWE A;  3BJA A;  4EJW A;  3ABL H;  1E1Q A;  1IB0 A;  5K7H A;  2VPR A;  5IYW A;  1IW7 F;  3QYB A;  4JX4 A;  2QYU A;  4LBY A;  1OHH A;  1JB9 A;  3GTM J;  1UD2 A;  2BEO A;  3B02 A;  2NVX J;  2ZBU A;  3ZUG A;  1VQM I;  1OCC H;  1U5T B;  2CU7 A;  1FEX A;  1QPI A;  1W36 C;  4LG0 A;  2V7F A;  3P26 A;  2QBY B;  4UZE A;  1H9G A;  5BMZ A;  5E3L A;  2MH2 A;  1O3T A;  2QSG X;  2H09 A;  1L1I A;  3CCU I;  2C5B A;  3QFT A;  1SFX A;  3FXJ A;  1NG7 A;  1K79 A;  3JAM K;  4FET A;  2GA2 A;  2VT3 A;  3TQN A;  3BCF A;  3BNW A;  3V7S A;  1FX7 A;  2K02 A;  2LP0 A;  4HOB A;  3G3Z A;  3LQ6 A;  2BE5 F;  1FP2 A;  2L0K A;  5HVQ C;  1O8M A;  3BLY A;  4PC1 A;  3FBN B;  2QVO A;  1GVH A;  5ED4 A;  1G6N A;  2HYG D;  2M5W A;  2WA0 A;  2ZXH A;  1QH0 A;  2VBX A;  3SKB A;  3UR3 C;  4DZJ A;  1Y1V J;  4DYQ A;  1B23 P;  2IAI A;  4KUM A;  4OAZ A;  3WTV C;  4A12 A;  2VOO A;  4GYI A;  1CNE A;  2V7T A;  3CPW B;  3GXO A;  2TDX A;  2V9P A;  1MBG A;  2VJ4 A;  2XDV A;  1TTY A;  2RN7 A;  5CLS A;  1P2F A;  3SJZ A;  2INU A;  3WBK A;  2X1E A;  4OAY A;  5FNZ A;  4Z4U A;  2Z1D A;  1RWR A;  3QWL A;  2VE8 A;  1KCD A;  1T33 A;  3A01 B;  1DUX C;  4XRM A;  1VQ4 B;  5E79 C;  2BMW A;  4KN7 X;  2VFO A;  4I98 B;  1W35 A;  1ON1 A;  5A8A A;  1P7I A;  3P5J A;  1QRB A;  1F60 A;  3KZY A;  3VNV A;  4BXU A;  1BOA A;  4L9N A;  3PL8 A;  2XSJ C;  3LQQ A;  1D1N A;  1M1E B;  1Z3X A;  3LOC A;  2K9N A;  4RAF A;  3CJQ B;  4HV6 A;  1ZRD A;  2M1B A;  1I50 J;  2XAU A;  2PQ8 A;  3BWG A;  1XSD A;  1H8A C;  4I99 C;  1PUE E;  1W9X A;  2PEC A;  2VBS A;  4UVA A;  4XLA A;  2HQA A;  4KH3 A;  1U8R A;  2LSO A;  3J81 K;  5L3C A;  2QN6 A;  4V2G A;  4YC5 A;  4U7D A;  1BX1 A;  2E1N A;  4RLF A;  3J80 Z;  2VNH A;  1GVJ A;  1TZL A;  2JMW A;  3K4B A;  4LG0 B;  2QYO A;  5F0F A;  3IRQ A;  2LF8 A;  2VYQ A;  4XRF A;  2HMA A;  4A3B J;  2CSO A;  2B5O A;  3ML3 A;  2DQL A;  2BV6 A;  4V2F A;  1F5T A;  2HDD A;  4QUZ A;  2GA1 A;  4D5F A;  5FLM J;  3QE2 A;  2A6H F;  3HTS B;  1XTA A;  2GXA A;  1GVD A;  1BI3 A;  1T2K A;  4M73 A;  3RJP A;  5J3O A;  4A0Y A;  3CCE B;  5AIP A;  3SFZ A;  4M6Y A;  2P0W A;  4HNT A;  2R7T A;  1MBH A;  1XGM A;  2ZJP F;  4FE7 A;  4II2 A;  1MJ9 A;  3DBL B;  2DT5 A;  4LC0 A;  3RKQ A;  1O3S A;  2BV3 A;  1JKR C;  1TWA J;  3H3V K;  3HB9 A;  5L3G A;  1USS A;  1WSV A;  3FF5 A;  1TT0 A;  4IW3 B;  5F4O A;  4Q48 A;  5TIS C;  1XMX A;  4ZYH A;  4Y3O A;  1MMS A;  5GAH J;  3KYD B;  3WTX C;  1J9Z A;  2BZT A;  2X1C A;  3LSR A;  1FNM A;  1NTC A;  4ZTF A;  1YJ9 B;  4IRG A;  1W2B B;  3ESW B;  1O8F A;  1MSE C;  2HTJ A;  3TW6 A;  3SEZ A;  3JRH A;  1S72 I;  4C2L A;  4IOA F;  4ZC3 A;  2PN6 A;  2LR8 A;  1PYV A;  4OOV A;  3W5U A;  4XSX F;  5E8I A;  2Q2E B;  5ILS A;  1NG6 A;  3ZQ7 A;  1T6Z A;  1VHO A;  2B0R A;  1Y0R A;  2EFO A;  2JTV A;  3QAH A;  1VQL I;  5HLT A;  2HI3 A;  3OKX A;  3AG3 H;  2DA7 A;  2JZY A;  3CDH A;  2QCO A;  3ES9 A;  2ACJ A;  2F43 A;  3ERM A;  2JRT A;  4BHB A;  3P7N A;  4UUS A;  3IP4 B;  1TT5 B;  3CCV I;  4ROX A;  3A03 A;  2VQC A;  2IJL A;  3ZXS A;  1APL C;  1HZE A;  4RD1 A;  1PE9 A;  2INV A;  4I0A A;  2XC1 A;  1RKT A;  4HX7 A;  1TLH B;  3D5R C;  3HG9 A;  2DET A;  5KVR A;  1WI3 A;  2ELK A;  2QQA A;  3CB4 A;  4XKB A;  2NPF A;  1YHQ B;  2NT6 A;  1BBY A;  1A31 A;  4EJV A;  2Z5U A;  3DP7 A;  3VO1 A;  2DQR A;  2OC6 A;  1QUF A;  3CC2 B;  4RDJ A;  1ERD A;  2M5S A;  2OBT A;  1S8N A;  5LHG A;  2O17 A;  1OYY A;  3DTI A;  3GLX A;  1TW2 A;  5E3M A;  3PNT A;  2AXT C;  2IP2 A;  3M1C A;  5FRM A;  3JCU C;  1FTZ A;  5JBQ A;  1Q81 D;  4UXN A;  4S0H B;  5ICE A;  3LA3 A;  1QGZ A;  4CXF A;  3WND A;  2XT2 A;  1ETQ A;  3ECH A;  3I59 A;  4ZV4 A;  2IGN A;  4Z4T A;  3HPH A;  1Y6I A;  4XD7 A;  1FYL A;  3T9G A;  1U78 A;  4ASU A;  2H6C A;  3TBI A;  2V7Q A;  3G05 A;  3HTU A;  5E6T A;  2XND A;  4BAY A;  5FLX Z;  1RES A;  5IT9 K;  4JYK A;  2HOA A;  1KON A;  3WTS C;  2VBY A;  3MKY B;  1IC8 A;  2KIM A;  4MXN A;  2GOX B;  1JJ8 C;  2EIK H;  3JRB A;  1A6I A;  1QUE A;  5CVJ A;  2AS5 F;  4ZYD A;  2E1C A;  3AVV A;  1R5B A;  2LRE A;  1QVF B;  1ZGJ A;  1SC7 A;  2M4G A;  1N8R D;  4BNC A;  1FRN A;  2A05 A;  2MA3 A;  2O61 A;  1GO2 A;  3OMY A;  3DQV C;  5TR9 A;  3DXJ F;  2Y48 A;  3PFI A;  3T51 B;  2KT0 A;  3C7J A;  2BVN A;  2E19 A;  1RC9 A;  3H35 A;  2K9L A;  4PAA A;  4P3I A;  3SDG A;  4Z4Z A;  3BP8 A;  2DEU A;  1OCR H;  1WCM J;  3IC7 A;  2O9L A;  3DLL F;  3MZY A;  2DO7 A;  3BZC A;  1XN7 A;  1W0U A;  2L3D A;  1WH7 A;  3ABK H;  3GZ5 A;  3DPT A;  1GR1 A;  1S4M A;  1RET A;  2CBX A;  1B4A A;  3V42 A;  4ZZL A;  1E3P A;  5LHI A;  4P12 A;  5FKK A;  2ZB9 A;  1FMW A;  5HS7 A;  1R5O A;  4LIV A;  1VF7 A;  4ZDL A;  1AKH A;  1N75 A;  1JJ6 C;  1HOM A;  2J5P A;  4HIZ A;  4C43 A;  3CCS I;  4F93 B;  1X0C A;  1E3X A;  1OYI A;  3OYK A;  3U2Q A;  4HW0 A;  3MFK A;  2CJJ A;  2ZFW A;  3BG9 A;  3SEJ A;  1EKE A;  1QA2 A;  3C2G A;  3OP1 A;  2OUM A;  1ZYR F;  5B66 C;  3VSU A;  1Z6T A;  3WXM A;  4E7Z A;  4F3Q A;  4QTR A;  2XB0 X;  1V5G A;  4X7F A;  2CQ7 A;  3GEZ A;  2Y9Z A;  1EXM A;  1XGN A;  4U0Y A;  5DD8 A;  2DA4 A;  1SVM A;  3QFC A;  2LZJ A;  2FOK A;  1V5V A;  3U9G A;  5D5V B;  3S1R J;  1YX2 A;  2BM6 A;  4U4B A;  5FO1 A;  3B4N A;  4CCO A;  3G4S B;  1VQ7 B;  2W57 A;  3I59 B;  2DDB A;  4DQL A;  3IH3 A;  1ZN2 A;  3OL4 A;  4N9H A;  4AC9 A;  2DER A;  1JXS A;  1KTW A;  4AU7 A;  2L7M P; 
#chains in the Genus database with same CATH homology
 1HVX A;  1IDJ A;  2VJ5 A;  1OGM X;  2VKH A;  2BW3 A;  3DKY A;  2W82 A;  1O8L A;  2R7W A;  3MKZ A;  3T56 B;  2NTB A;  2VQG A;  4YEJ A;  5FRO A;  4PJM A;  1G59 A;  5CDF A;  2BSP A;  1IDK A;  3GQA A;  4KKT A;  4II3 A;  2WBM A;  1WTH D;  3E0J B;  4DBQ A;  1X1C A;  3M8J A;  4IX7 A;  4BE1 A;  4F91 B;  4Z03 A;  3DPL C;  3OPO A;  1X1B A;  4MLO A;  3CMM A;  4HST A;  4XKW A;  4LIT A;  2Z2S B;  5C1C A;  3OYH A;  1DGR M;  3W2A A;  4CCL A;  5HNH A;  2LH9 A;  4B3G A;  1LFP A;  1WP6 A;  3EQO A;  2PYH A;  3OS1 A;  1MNE A;  2VJI A;  2V6E A;  4RM3 A;  5CPR B;  3VYU B;  2F5V A;  1SKY B;  1K28 D;  1NBM A;  2CFO A;  2JJ2 A;  3IAM 2;  2CV2 A;  3LMM A;  3OAA A;  1UD8 A;  5HOO A;  4EAT A;  2IXS A;  2CUZ A;  4XKV A;  1BHE A;  3DTE A;  3GQ7 A;  2DOA A;  2IS2 A;  2ELJ A;  5CQG A;  1RMG A;  4E7L A;  3NWS A;  1SAU A;  2AQF A;  2KDO A;  3EUH C;  4FAS D;  1D1C A;  2DT7 B;  4CZC A;  4HRI A;  2ZZF A;  3H9G A;  3OS2 A;  4XN3 A;  3OYM A;  2VPL A;  1E79 A;  1AA7 A;  1NRK A;  2IQ7 A;  5C1E A;  4E7K A;  4KIS A;  4YXW A;  5CKT A;  2UV1 A;  3H9Q A;  1S9H A;  2XF5 A;  4NC8 A;  2V26 A;  3A3G A;  1N78 A;  3K4M A;  2VKD A;  2WAE A;  3S32 A;  2MAB A;  3IUO A;  4XOR A;  2R4G A;  3CZ6 A;  5HNF A;  2VAS A;  1HA8 A;  4LIU A;  2M7B A;  2XZP A;  3QYE A;  3UNG C;  2L9S A;  2KHM A;  4OJO A;  1UD4 A;  1V5F A;  4NNJ A;  1U0J A;  2NOJ B;  1Z21 A;  4BS9 A;  3BH4 A;  5HKK A;  2DCE A;  4PSW A;  3ZCO A;  1BR1 A;  3DDY A;  1JTA A;  3W3C A;  2AQE A;  1JRG A;  4PUS A;  4BU2 A;  1UD6 A;  2QE7 A;  2PJR B;  1X19 A;  4Y4R A;  2CK3 A;  2JJ1 A;  3HUG B;  3MD2 A;  2DT6 A;  2K5C A;  3S3N A;  2ZFU A;  1MW7 A;  3PUB A;  3B8Y A;  2XF7 A;  3PJR A;  2W1O A;  3OYG A;  4C2U A;  1O8K A;  1WMR A;  4U49 A;  1AIR A;  1O8H A;  3I9V 2;  4BL0 B;  3OYC A;  3KRG A;  1H80 A;  3EUA A;  1VJS A;  4DGW B;  3K4N A;  4G6T B;  2UVF A;  2WY7 Q;  1QHH D;  1V0E A;  2VJJ A;  2GK6 A;  2X6W A;  2IS1 A;  2JVG A;  2GJK A;  2DJI A;  2X85 A;  5KNL A;  4B43 A;  4ITV A;  5JHF A;  3KEW A;  1YE9 A;  2UWM A;  1K5C A;  5KCM A;  2K3P A;  2XZO A;  1MMG A;  3KYL A;  3K4L A;  2V31 A;  1X4P A;  4HEA 2;  2JUG A;  1BOB A;  4N4N B;  4EW9 A;  3N05 A;  3RSN A;  3GVJ A;  1IRX A;  4KKU A;  4PJL A;  2LG4 A;  2R7U A;  4JQF A;  1MAB A;  4YRV A;  2E1M C;  1D0Z A;  3CP8 A;  3OOU A;  3VYR B;  3VMW A;  3VYS B;  1O8E A;  3OR1 C;  2CMP A;  1O8D A;  1PLU A;  4G7W A;  4YZA A;  3MKW B;  4ZTJ A;  4U87 A;  2JVH A;  1OFM A;  4C30 A;  3H0D A;  1QJV A;  1FMV A;  4DNT B;  2XF6 A;  1E0E A;  2GOM A;  3LSM A;  4NC7 A;  1OLT A;  2M3A A;  4IKF A;  4TT3 A;  4QPO A;  4ZDO A;  2W00 A;  1W0J A;  1J09 A;  2R7V A;  4XMY A;  4B3F X;  2OV7 A;  4NK6 A;  3F9K A;  4BE0 A;  1BN8 A;  1Z7L A;  2LBF A;  3BCB A;  5TGT A;  1T95 A;  4B3X A;  4I84 A;  2M4K A;  1WPC A;  4B47 A;  1LKX A;  3TL4 X;  4R79 A;  4W8S A;  1OFL A;  1LVK A;  3K10 A;  1BLI A;  3SUC A;  2BOL A;  2WY8 Q;  3KX2 A;  1MMA A;  1I8D A;  1OGO X;  1BPL A;  4W8R A;  2QXZ A;  2VQL A;  3PNY A;  3ZR8 X;  3K4J A;  4BJT A;  2VB6 A;  4OJ6 A;  1O8I A;  1UEL B;  4IQ4 A;  3HC7 A;  4BXF A;  4W8T A;  4BDY A;  1IA5 A;  3OIQ A;  4OJ5 A;  2VLA A;  2O5R A;  2PMZ A;  4D1Q A;  2E1B A;  2PYG A;  2ZZG A;  3ONQ A;  3U21 A;  3OYB A;  3BCD A;  2NTQ A;  3LSK A;  1DGW Y;  4KT6 A;  2Y0S A;  2CW7 A;  2V1N A;  2QKL B;  1O8G A;  1KCC A;  3EQN A;  4BJ6 C;  4E7H A;  2IGK A;  2WAD A;  1R6R A;  2V4J C;  3W2V A;  2ZTG A;  4DBR A;  2QY1 A;  2UVE A;  4X0G A;  4MR0 A;  3G2B A;  3PSI A;  2VBM A;  3CF2 A;  3EPZ A;  2Z6B D;  4XL9 A;  2NSP A;  1WJB A;  5CQE A;  3AL0 C;  1HG8 A;  2KRC A;  2QKM B;  3HAG A;  3RCO A;  3KEY A;  4AYB A;  2KZV A;  2XC7 A;  4TSF A;  1WJA A;  3QOD A;  1EFR A;  2BVL A;  4E7S A;  3OYF A;  1O8J A;  1SFK A;  2X3H A;  2L7K A;  3OWT A;  1T5E A;  2HU9 A;  3S3O A;  2CUJ A;  2LOO A;  2HLD A;  4L8J A;  3L2W A;  4PFP A;  2HPI A;  3SDB A;  2WJY A;  3DEE A;  3FKJ A;  1X4O A;  4PMH A;  1DBO A;  2A5W A;  4P5O A;  1D1A A;  1DP3 A;  2A6T A;  3AFH A;  3GVL A;  2O0W A;  3EUK L;  2GK7 A;  2O0V A;  1N77 A;  3K70 C;  4XQF A;  2M0M A;  2VQH A;  3LSG A;  2X8K A;  1DBG A;  3OYN A;  2R9V A;  4HWV A;  2EWE A;  2R7O A;  1E1Q A;  3FPP A;  2ZTN A;  4E0F A;  1ZEL A;  2KPM A;  3A3B A;  2ZXI A;  3QYB A;  3K4K A;  2KRH A;  4RM2 A;  3OY9 A;  2LBF B;  2RRE A;  2HPM A;  1OHH A;  4NQW B;  1MND A;  1VBL A;  1UD2 A;  2VIX A;  4OZZ A;  3ZRG A;  1PKV A;  3CP2 A;  4F55 A;  3DPU A;  2WSS A;  1H8H A;  1W36 C;  4QPQ A;  4C2T A;  2V7F A;  4XM3 A;  4PSX A;  3SYT A;  2BW3 B;  3FY3 A;  4ZDP A;  3NWT A;  2R7S A;  1JI8 A;  1NG7 A;  4HPQ A;  2R7Q A;  2NZM A;  4HG2 A;  4FET A;  2F4I A;  3W2W A;  3BCF A;  1E1R A;  3BC8 A;  4IQJ A;  3ZSC A;  3OYL A;  2HDW A;  3S8P A;  3SZG A;  5HVQ C;  1O8M A;  3H5N A;  3BLY A;  4DIQ A;  3GQB A;  3FBN B;  3OL3 A;  2I8D A;  3S3M A;  1T0F C;  2IGO A;  1G8X A;  3TMO A;  4BEH A;  4E7J A;  1COW A;  3E1S A;  3BC9 A;  4CSW A;  4YEL A;  2LRD A;  3VDX A;  3DKX A;  2K9M A;  2WA0 A;  2XOK A;  4Z06 A;  2ZXH A;  2XGJ A;  3ZQQ A;  3ZGK A;  4XKC A;  3UR3 C;  4ANJ A;  1H8E A;  3HKZ A;  3LSH A;  4BQN A;  4PFO A;  5LFA A;  3FDY A;  4OAZ A;  4BAC A;  2ODL A;  3FKS A;  3CES A;  4N4O B;  1BMF A;  4YZX A;  2WPD A;  1DQU A;  4XNF A;  4DK0 A;  2MC4 A;  2VJ4 A;  2XDV A;  4HNU A;  4CCM A;  3VSK A;  3DLA A;  2INU A;  3FHN A;  2X1E A;  4OAY A;  1PJR A;  1BR4 A;  2Z1D A;  1RWR A;  4F52 A;  4PJJ A;  4AVZ A;  2L9N A;  1KCD A;  3GBG A;  3I3L A;  4BGD A;  3OYE A;  1W0K A;  4XR6 A;  3HL2 A;  2JA2 A;  2X1D A;  2D3L A;  3OFN A;  1WJ5 A;  2ZSI B;  3PL8 A;  4PK4 A;  2XSJ C;  4OZY A;  1Z3X A;  3CJQ B;  2XAU A;  2KMU A;  4JMQ A;  4XN0 A;  1W9X A;  2PEC A;  2MFZ A;  4CH7 A;  3RPU D;  4XLA A;  2HQA A;  2MYS A;  3QYF A;  3SEQ A;  2W4S A;  3H94 A;  3B90 A;  1XG2 A;  2HVR A;  4URR A;  4XLH A;  3A4C A;  4RLF A;  3GQ9 A;  2XZL A;  3OYJ A;  3MMY B;  1TZL A;  2ZSH B;  3K4B A;  3ZPP A;  4P1W A;  1Z3Y A;  3JU4 A;  1NHC A;  5IK2 A;  4W8Q A;  3IAS 2;  4IZZ A;  2JSP A;  1EE6 A;  2FUG 2;  3OIP A;  3VYT B;  3C2H A;  1EA3 A;  2KQR A;  3A35 A;  5LD2 C;  4H4K C;  4HSR A;  3FBI B;  4NK8 A;  2HVS A;  2HVQ A;  2P0W A;  1K6Y A;  4HNT A;  2R7T A;  4BEH B;  4II2 A;  1D0Y A;  2RQQ A;  4J00 A;  4GQN A;  2CW8 A;  2Q1Z B;  3DTK A;  2X51 A;  2CV1 A;  1WJE A;  2WAQ A;  1E43 A;  1UD3 A;  2NTP A;  2PJR A;  4KKS A;  4BDZ A;  1TT0 A;  2M7A A;  3PNV A;  4Y3O A;  2LC2 A;  2KL4 A;  3JUR A;  2X1C A;  3DU6 A;  4ZTF A;  3OEE A;  4F92 B;  1BR2 A;  1P9Q C;  3VMV A;  1O8F A;  3SEZ A;  3H9J A;  2V4D A;  3RQ4 A;  2ZZQ A;  1GQ8 A;  2V9K A;  4C2L A;  4KJZ A;  4ZC3 A;  4G6I A;  3J7A Y;  1MMD A;  1PYV A;  4E6K G;  2CS3 A;  1QCX A;  2Q2E B;  1NG6 A;  3LMW A;  4Y33 A;  3ZIA A;  4XOP A;  4CUG A;  4BJ5 C;  3GRH A;  4G7X A;  4B44 A;  2W6I A;  5HLT A;  2E60 A;  3OYI A;  3OYA A;  4JOM A;  3ZPN A;  1WJC A;  2GJP A;  2F43 A;  3UW0 A;  3IP4 B;  3LSI A;  4DOZ A;  1IB4 A;  1V5E A;  2VQC A;  3ZXS A;  1HZE A;  1PE9 A;  2INV A;  3DU5 A;  3LNN A;  1OOC A;  2F6C A;  4Z1M A;  3PSF A;  3D5R C;  3HG9 A;  4XLF A;  3A2K A;  2L2O A;  4PJN A;  5AMV A;  2LY1 A;  4XKB A;  2NT6 A;  4KIT B;  4BUP A;  3VWB A;  3HXL A;  3L2V A;  3RTR A;  4BQQ A;  3HOT A;  3A1Y A;  2OC6 A;  2X6X A;  3OS0 A;  3VSL A;  2UUZ A;  1ERD A;  2M5S A;  1GLN A;  2MD0 A;  4E4H A;  2IGM A;  3T53 B;  2O17 A;  2QX3 A;  3BG6 A;  3DTI A;  2RNG A;  4ZJZ A;  3H5R A;  3PNT A;  3M1C A;  3OR2 C;  1O88 A;  4OJL A;  5FRM A;  3K6G A;  2GJR A;  1X1A A;  1WFX A;  5DN6 A;  2HZD A;  2JDI A;  2L5Q A;  4XLE A;  4OWR B;  2IGN A;  3HPH A;  1Y6I A;  3CJR B;  4XON A;  2D3N A;  4TKO B;  4XD7 A;  3T9G A;  3VST A;  2CH0 A;  3GVK A;  4ASU A;  2VXZ A;  3TBI A;  2V7Q A;  3G05 A;  2WB1 A;  2NST A;  2XND A;  2DXI A;  1QHG A;  4Z05 A;  1D1B A;  1KON A;  4LG3 A;  2O1D A;  3MKY B;  2Z8G A;  2R7R A;  1YX3 A;  2GOX B;  4CA0 A;  2IS6 A;  4MXN A;  1UD5 A;  3HOS A;  2IS4 A;  2KVO A;  2E1M B;  2R7X A;  1V0F A;  3VR6 A;  4C9Y A;  4YZ0 A;  2LY2 A;  2LRE A;  4DJA A;  2KLO A;  2M4G A;  4RMN A;  2BVM A;  3LFU A;  2F1M A;  3DWL E;  3WQZ A;  2X6Y A;  2E5N A;  3D5S C;  2W7N A;  1KMH A;  3OMY A;  3DQV C;  1WJF A;  4UZU A;  2X53 S;  4XOT A;  3T51 B;  3OEH A;  4U7B A;  2HNH A;  3BG7 A;  3QOE A;  4DNR B;  3H35 A;  2K9L A;  3LL7 A;  2O04 A;  3GQ8 A;  4B48 A;  3HPG A;  4FXU A;  4OJP A;  4E7I A;  3OW7 A;  2JIZ A;  1RU4 A;  2KP6 A;  1KZL A;  1WJD A;  2VBE A;  2CV0 A;  3DPT A;  5FL7 A;  3V42 A;  1I18 A;  3H5A A;  4YZQ A;  3BCA A;  3AKZ A;  5KHD A;  5FRN A;  4DK1 A;  1FMW A;  4LIV A;  1VF7 A;  1VZ0 A;  3K4C A;  4ZDL A;  1N75 A;  4XLC A;  1UAA A;  2ZZE A;  3K70 D;  4CCN A;  4HIZ A;  4F93 B;  4ZYA A;  1E3X A;  3OOC A;  1X0C A;  3OYK A;  4J01 A;  2LYC A;  4P22 A;  3VSV A;  1UG0 A;  3S93 A;  4D9J A;  2WZP P;  3C2G A;  2DIE A;  2OUM A;  1Y56 A;  1CZF A;  1LDK B;  2WAF A;  3VSU A;  4GRI A;  4F3Q A;  4E7Z A;  1D0X A;  3OYD A;  1VLY A;  3PFY A;  1V5G A;  2E5Z A;  3D5L A;  4NUB A;  3OE7 A;  2VBK A;  3L2R A;  1PXZ A;  1OR7 C;  1X1D A;  2VXD A;  2Z16 A;  4RLQ A;  1W36 D;  2LZJ A;  2W6J A;  4U4B A;  3L2Q A;  3L2U A;  1MMN A;  3NE5 B;  2VL8 A;  1FX0 A;  3B4N A;  4CCO A;  3WWG A;  4CCJ A;  4CCK A;  1YX5 A;  1QU3 A;  3OL4 A;  4BQO A;  1OB0 A;  1E3Z A;  2NT9 A;  3AL0 B;  1KTW A;  2WJV A;  4AU7 A;  4BE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...