2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
4OZYA 3UW0A 5C1CA 2O04A 2NT9A 1O8LA 4XMYA 4XKWA 4URRA 1IDKA 3JURA 3VSTA 4OJ6A 2NT6A 1DBGA 2X6XA 2NTPA 4XORA 1WMRA 1VBLA 4W8TA 1KTWA 4Z06A 4XLHA 1O8DA 4HWVA 4XLCA 1GQ8A 1PXZA 4U49A 2NZMA 1KCCA 3GQ9A 2VBMA 2BSPA 4PMHA 2UVFA 2X85A 1O88A 4XQFA 3GQ8A 1BHEA 3KRGA 3VMVA 1O8IA 3GQ7A 4OJLA 1CZFA 2ODLA 1O8FA 2QY1A 4XLFA 4XN0A 1O8KA 1OOCA 4U4BA 4XR6A 4MXNA 2NSPA 1JRGA 1XG2A 4OJOA 2VJIA 1O8GA 1AIRA 2X6WA 4C2LA 3ZSCA 3LMWA 3VSVA 3EQNA 3WWGA 4XN3A 4NK8A 2EWEA 5AMVA 4YZQA 1IB4A 2PECA 4YZ0A 2O0VA 1QJVA 4Z05A 4YZXA 2NTQA 1BN8A 1NHCA 2VBEA 4MR0A 2INVA 2VJJA 3GQAA 4XL9A 2QX3A 1JTAA 1IA5A 3VSUA 4XKVA 2Z8GA 2PYGA 1QCXA 1DBOA 4AVZA 3ZPPA 3B8YA 4OJ5A 4XOPA 4YEJA 1O8HA 5C1EA 2NTBA 2O1DA 1KCDA 2NSTA 4NK6A 1EE6A 1OGOX 1RWRA 3T9GA 4OZZA 1OGMX 1PE9A 1IDJA 2INUA 2QXZA 1X0CA 4W8RA 1K5CA 1H80A 4W8QA 4XOTA 3VMWA 4W8SA 4XLAA 2IQ7A 1RMGA 1OFMA 4OJPA 3B4NA 4YELA 2VBKA 2X3HA 3B90A 4XNFA 1O8EA 4XONA 2X6YA 4XM3A 1O8JA 1PLUA 4Z03A 4YZAA 4XLEA 1RU4A 4EW9A 3SUCA 4I84A 3FY3A 3EQOA 2O0WA 2UVEA 2O17A 1HG8A 1OFLA 3GRHA 1O8MA 2PYHA
chains in the Genus database with same CATH superfamily
5AIQA 1T2KA 3JRFA 2CGPA 3ASRA 4WK8F 3A01B 3RSNA 1WJCA 5C1CA 4EJVA 4EVIA 5H2FC 1LVAA 4WF2A 5TGTA 5M5WJ 2DA6A 9ANTA 2ZBVA 1DABA 1R1VA 1I3QJ 2ESHA 2D3LA 1MDMB 4HNVA 1OISA 2GIVA 3PNTA 4LBYA 2YR2A 5FROA 3HAGA 3E1SA 2GIZA 3W5HA 1YQAA 3VODA 4G7OF 3LNNA 2DK8A 5FKLA 1VQ8I 2PQ8A 3OE7A 5IYNA 4G6IA 4MHGA 5IYPA 1KTWA 1LFBA 3WTUC 3ECOA 4HZFA 5B1AH 2E34A 4L5EA 3OYDA 4XLCA 3IRRA 2HU9A 2Q2EB 4UB6C 2DYIA 5D5XB 3S3NA 2EZLA 3KYDB 1PP8F 2K9MA 4BEHB 4Q4ZF 1PP7U 2KIQA 3H92A 2KJCA 2VXZA 1S4MA 5FL7A 1B9MA 3KPHA 1XE1A 2BM7A 5LEJA 4MFEA 2M1BA 3V7RA 1U2WA 2MC3A 2V4DA 3S3MA 4X7FA 2OTLB 3U2QA 2QBYA 1X4PA 2AHQA 2NVYJ 5D8KB 3OYFA 1O8GA 2EIJH 2HQAA 1TYVA 3JRCA 3R6SA 3SJMA 2MD0A 4PC2A 2JA5J 1LDKB 3GFMA 3EQNA 1J0RA 1J9ZA 4DQ2A 4F55A 1Y0RA 1BC7C 5CLSA 4BXXJ 4YZQA 1JTXA 4G6DA 1FRQA 2J8IA 5E17F 3DFGA 4D5FA 1VQNB 5GTIC 3GTPJ 4ENJA 2LF8A 1SAXA 3JSOA 2VFPA 1BN8A 2BBYA 2VBEA 1ETWA 2VOPA 1STZA 3BY2A 4E7HA 2Q6KA 3LYCA 3CC7I 5E3OA 1TVCA 4A93J 1QZZA 2QX3A 4AF6A 2CG4A 5E1XA 1W7PD 5ILVA 1D3YA 1DG1G 3VSUA 2FNPA 2R4GA 3GF2A 5E3LA 3E6BA 2PBIA 3ZOBA 5DM7F 1SD4A 3BTLA 1E0EA 2XC1A 1RIOH 3GEZA 5D6EA 2C5BA 4DNCA 2QF7A 2XC7A 1H8AC 3CW2A 4XICA 2EPFA 3CD6B 3ABMH 3F9KA 3ZXSA 4KA4A 3QFTA 2OBRA 2Q2EA 3LSKA 2E2IJ 2HI3A 1N0VC 3WBKA 2YS9A 5DDGA 2V9PA 1FT9A 1QVTA 4RDLA 1OGOX 1P92A 2EIMH 1XG1A 4RM0A 3IAM2 5JLXA 2OQRA 2VE9A 2B0RA 4XKCA 1WI9A 3I54A 5J3LA 1HC8A 3SJPA 5HKKA 2ZFUA 1W7PB 1ZGWA 3JCUC 4YEIA 3E20A 4U7BA 1K8FA 3E5XA 2JPCA 3QP5A 4LLNA 1QU3A 2F3LA 1O7FA 3S8PA 2VNKA 5D8LB 1YRNB 4DJAA 1I18A 2X3HA 1OR7C 3M8FA 2X6YA 2YU9J 3ZUGA 3E0JB 2UXNA 4XLEA 3K9TA 3VO2A 4B48A 3GX4X 2EH3A 4BS9A 1UD5A 1X1BA 2JMWA 2JWTA 2DAOA 1ZG1A 4KDPA 1S8NA 4M6YA 4Y3OA 1TBXA 2QGUA 4HSTA 5FRMA 3BZCA 1TWCJ 3ML6A 2EZIA 5CPRB 4DBQA 3LA3A 1BJKA 2F1MA 2BPOA 2KRCA 2LY2A 1XCVA 3CCUI 4HDVA 1WPKA 4ENMA 3Q5FA 4W8RA 1Z21A 3FISA 1YW8A 3S15J 3FXMA 3JREA 3BR3A 4L9JA 1XGNA 3UNGC 4B4CA 1JT6A 2BMWA 2FE3A 2XF7A 2XT4A 3SLDA 4L9VA 1LLWA 2VZLA 1FP2A 1N0UA 1MMGA 1IJWC 1YITI 1EP3B 2DQLA 1JUMA 3C18A 4ITVA 1O8DA 1TYXA 4HWVA 2ZC2A 4LIUA 1FNNA 4CCJA 4OMZA 5EZHA 5LRRA 4A3LJ 1MD0A 2F1LA 2E5ZA 3J7AO 3E6MA 1K4TA 1JB9A 3GTQJ 3E7LA 2X6OA 4UUSA 2GBYA 1G4DA 2X0LA 5B1BH 4C3IJ 3OY9A 4M4SA 4KT5C 4RAYA 2HDDA 2W6JA 3HSRA 4MO7A 4ZYHA 1B59A 1WPCA 3ASTA 1K6YA 2OJED 2DOGA 2XAFA 3G6EI 2DDAA 4UUTA 3RZOJ 2W25A 5IP7J 3A0BC 2F43A 3TO7A 3SXYA 4QLCU 4KIBA 5GPAA 4PABA 3F6OA 4WZTA 5FO1A 4ZCIA 3BDDA 1ETVA 2DMUA 2VT3A 1E2XA 2GOMA 4KT6A 1Z6RA 3BCDA 2ETHA 1I6XA 3BG9A 1Z7LA 1HA8A 2IGNA 2ZB9A 3BQYA 2ZXIA 5CVUA 1Y6IA 3WG9A 3ULQB 2YX7A 5B6IA 4X07A 4ZDLA 1U8BA 4LBZA 5L3BA 1BN5A 4QHYA 3ZQGA 1YI2B 2BGCA 4A3GJ 1FEXA 4I7HA 1DDGA 4WCGA 5CVVA 2B7BA 4KH3A 4QVAA 4WQMA 1Q7YD 1X2MA 1YYVA 2Q0OA 2H27A 4ENNA 3E3VA 2Y48A 3BCBA 3BG3A 1ZLJA 3OWTA 1XGSA 1W36D 1WZ2A 4YEJA 3ESWB 4PJNA 4A69C 3NE5B 3CC2I 2AHOA 4ZCLA 1RI7A 3HEFA 2HXOA 3JAMK 3OR1C 1I3AA 2XAGA 4G6TB 1HA3A 3K7AJ 4RD2A 2NSTA 1BI1A 2F4OB 2DMNA 4MLOA 4LB6B 4KMFA 2K40A 3KEYA 1RWRA 2NOGA 2RKHA 3FMSA 2GJRA 3KE2A 4I0BA 4X06A 3NARA 3CESA 3AVUA 2X1EA 3MMYB 4UXNA 5ICCA 1T0FA 3VMWA 4C9YA 2BW3A 3Q0UA 3KYLA 2DXIA 4YXWA 4Z4RA 5A89A 2CFXA 3I1FA 2VYQA 4BQNA 4P5OA 2VXDA 4L5IA 3B8HA 1O8EA 2FJ1A 4XM3A 4G1BA 1YIJB 2HQ5A 2ZL7A 5E3MA 1CNFA 1VQOB 4EW9A 3HIFA 2R7TA 4Q47A 4DK1A 1HLVA 1NB9A 2Z3YA 1TZLA 3DKXA 1H8EA 3O8HA 5FNZA 4JX6A 2IVMA 4RB2C 5FB2A 2EBIA 1ZKGA 1KZHA 4YRVA 3VFZA 3KLOA 3PL8A 3WTVC 3I0TA 1K6OA 2L7ZA 1FZPB 3WHCA 2A61A 2OCCH 3SJZA 4ZZLA 1G2HA 4B44A 1FP1D 4OOIA 4ETSA 4IHXA 3I4MJ 4C2UA 2DA3A 4ZYDA 3OZVA 4E7ZA 2DYSH 1LKXA 1FTZA 3COAC 4OOXA 3OYKA 1WMRA 2ELJA 4CGZA 1ZYRF 3OFNA 3BG6A 4JQFA 4TV7A 3SLNA 4Z06A 4M9ZA 3BQZA 2ZJPF 1R22A 3CZ6A 3A03A 3BC9A 3GTLJ 2QKLB 1R9TJ 4AM3A 3CMMA 3CXCB 2OC6A 2E2HJ 1TT5B 3NWTA 2EFNA 4PDKA 4PMHA 1FPQA 3FKIJ 2IA2A 3A8JA 3CCMI 1YO5C 3RPUD 2IRFG 1FNMA 2XGCA 1TUIA 5HZBA 4YFOA 4PSWA 3H1CA 3CUOA 4HF0A 4RB0A 2XTXA 2M4KA 5BSXA 3BC8A 2I8DA 2EINH 5CKTA 4HNUA 1R58A 1ZTRA 2LDUA 3OSFA 1U8RA 1HF0A 3U6KA 3GVLA 4RD0A 3OYEA 5F6FA 2X4HA 3K10A 1U3EM 4LBVA 2OAZA 5GP9A 2JSCA 2IGMA 1YLFA 2Y9YA 1MNEA 2FMYA 2P8TA 1Y39A 1O4XA 3F8FA 4C2MJ 5FD5A 3KIOA 2CQKA 4I2OA 2IS1A 1WH7A 1WJEA 5DCFA 2UXXA 2KDZA 1QFYA 2CBXA 2E1CA 4R1HA 2M30A 5KK1A 4RA2A 5J8FA 2NVTJ 1J9IA 1OYYA 1E43A 1BL0A 2CK3A 2E7XA 3J7ZI 3PJRA 2YPRA 1KU2A 3CCYA 2DO7A 1B6AA 1I50J 2DU9A 1FOYA 1KK0A 3ABUA 3EQOA 2L9SA 1JTAA 4OMYA 2ZNYA 2VI6A 3RY8A 5TR9A 2P6SA 3ZP5A 1XB4A 3ASNH 3LWFA 4RAFA 2ISZA 2EQRA 1VHEA 4HX4A 1MMDA 1LEBA 3B8YA 2HOEA 3CCJI 3G1MA 3LQRA 5AIPA 2RVCA 3BH4A 3JRBA 4U88A 2EIKH 1QPIA 1WDTA 1XMXA 2CJJA 4BJTA 4YIRX 2ISYA 4GQNA 3BZKA 4RB1A 3GVAA 3CO6C 2YX4A 2KJBA 3FKJA 1D8KA 2H1LA 2EFQA 2X48A 2Y31A 1KQ8A 3DDYA 4A5MA 4A2UA 4ASNA 4EM1A 2KMUA 2FF4A 2LVSA 4IHVA 1ACIA 2OK7A 2QA4B 1X0CA 1OCZH 5FLXZ 1FDRA 2ICWG 4XOTA 3ZPNA 3B78A 3ZZTA 3ZN1A 1W2BB 3OYCA 1JT0A 1OFMA 2DA7A 1NRKA 2YU3A 1VTNC 4O6JA 2OA4A 3G4SB 4Z03A 3GLXA 4A0XA 1ERDA 1V5EA 3DU1X 3KP3A 3D5LA 3L09A 4V19K 3GTGJ 3SKBA 1DPRA 3QAHA 1O57A 2A68F 3A02A 3DPLC 3LQ6A 1OFEA 1L3LA 2VASA 3DU6A 1BOBA 1HZEA 3SQNA 3RQIA 2HR3A 3FF5A 2V1XA 4QFMA 4HQMA 4CH7A 1G59A 1V5VA 5D4RA 1T6SA 3RYRA 1LNWA 3BOQA 3DEUA 1R36A 4DIQA 1X3UA 1GV5A 3BWGA 2VQHA 4DBRA 1TLLA 1UHSA 2BW3B 3FM3A 4DW6A 3W2AA 1T5EA 5F4OA 5EF6A 3KCCA 3ZQLA 1NDHA 3W2HA 3AG1H 1XS9A 3P9KA 3UKGA 1ZREA 2CW8A 3LOCA 3BPXA 1FBSA 2P5KA 2FNAA 3CJTB 1S72I 2CUZA 2VPLA 1YLOA 2W7NA 3L2VA 4LG0B 1W35A 1JGSA 2WY7Q 2OPTA 1YRNA 1PXZA 2PEXA 5GV8A 1M1KD 3CCJB 3FK7A 1WJBA 3F3XA 3ERMA 3JRHA 1AHDP 1GR1A 4L18B 2LTPA 5FIUA 1YJNB 2ODLA 3VNUA 3J80K 4QTRA 5J35A 5DS0A 2LD5A 4KKUA 2NSPA 3EYYA 3LSIA 3OOUA 4IZZA 4C2TA 4IOAF 5M5XJ 1N07A 3G2BA 3BR5A 2XGXA 1HOMA 1MRZA 3JRAA 3S17J 1EXMA 3OYBA 1O3RA 5DYMA 1O3QA 2Z5UA 1D8JA 3NB2A 1XCBA 2ZXHA 3CCEI 2LSOA 3HSFA 1LPQA 5FJ8J 1R71A 2LC2A 1TLHB 2V7QA 1V54H 1SAUA 3GZ6A 1QJVA 1VQLI 1WSRA 4YZXA 4HRIA 5H6RA 1PUEE 4PGHA 3AVWA 2V6CA 1ZR4A 4GXOA 4ZYAA 2V7WA 3PSSA 2DTZA 1IA5A 2VQLA 2VONA 2WAFA 2VJ5A 2Z9OA 4AVZA 3IKVA 2OBSA 4KKSA 3MZHA 3B6AA 2ZL6A 5DUIA 3PA2A 3PNVA 2IW5A 3OEHA 4BPRA 5KNLA 3MKWB 1O8HA 2ZBUA 1WHUA 2VN2A 5KAFC 1F36A 4CZZA 2NS8A 3EUAA 4P3YA 2XAJA 3A01A 2BM1A 1TQMA 3DCFA 2Y0MA 1UZCA 3OYIA 4RPBA 3FIWA 1V4RA 1Z9CA 1BI2A 1DGWY 3SEQA 3CMEB 2ZFWA 5IYQA 4L0ZB 1JUSA 3FK6A 1CGPA 1J5YA 5M3MJ 4NC8A 4Q7JB 1BOAA 1LDJA 3EUKL 2NRAC 2DEUA 3AKZA 2M34A 2XB0X 2FOWA 4DYQA 5LGTA 1JNYA 3W6JB 3FPPA 4RDKA 3AL0C 1GDTA 2KDOA 4NB5A 1QPMA 2F4IA 3HB9A 5KW9A 3K70C 3B90A 2E19A 4M2LA 1ITYA 2I5UA 2DCEA 2DK5A 2ECBA 4GGGA 4QSHA 1K83J 3ECHA 2L01A 1ENHA 1N25A 2JT1A 5EEAA 1H0MA 4Z4TA 4P26A 4LB5A 2I10A 1OFCX 4Z4SA 2R7WA 4ZDOA 2FOKA 1WTHD 3HOWJ 1I6HJ 1ULYA 5KCMA 1A6QA 1R23A 2ESNA 2QQAA 5KAIC 2QTZA 1O8LA 4R8HA 4ESBA 4L9NA 1DU0A 1XSVA 2P4WA 2Y69H 2P81A 1EWYA 3K69A 4D7MA 2NS7A 3QPHA 2NTPA 1BX1A 3PA1A 2R7XA 5IT9Z 5FRNA 3AG4H 1MABA 3U21A 2BVLA 1MNDA 5EGOA 2NVXJ 2M2EA 3RYPA 1UHWA 2XNDA 2M0CA 2O0YA 5CVJA 5TRDA 2E60A 4ESJA 1O8IA 5FA6A 1KK2A 2VC0A 1SFEA 3OYGA 3GQ7A 2KZGA 2HYGD 4KIGA 3KL9A 4S05A 4Y33A 4ACAA 4PFPA 2IOUG 1ETKA 3PQKA 2QSGX 1M90D 2VLAA 5IYDJ 1RKTA 4NBQA 1QNTA 1TSPA 4MXNA 3D5SC 3K2ZA 2CH0A 5FKNA 4OIQF 3D26A 3F0CA 3HGYA 1HCRA 1OYWA 3L2RA 1N77A 2K3FA 3V42A 1SFKA 3CD6I 2VFQA 2ZBKA 2O8XA 2ZTNA 4XN3A 3CCRI 2ELHA 5E1ZB 3A2KA 2XAUA 3S1RJ 3F8BA 3G1LA 4Q48A 3HOYJ 4HV5A 3PFYA 3VPRA 3TEDA 3ZZUA 1UAAA 4XD7A 5C44J 4DGWB 3I71A 1FSEA 3CMAI 4OINF 2E1OA 2OZUA 5J4VA 3K70D 2XF6A 4IKFA 2XOKA 2D1VA 3GCMA 3BH7B 2KRFA 3FHZA 1FOXA 2CS3A 4X8IA 2CNDA 2EFPA 1DBOA 5M3FJ 5BS6A 1JXSA 2HDNB 1IXRC 5AONA 1K61A 2NOJB 2COBA 4LIVA 2CUEA 1QG0A 1P7IA 2LF7A 1EFTA 1RR8C 1RPWA 2VNJA 4X05A 3K1PA 4HLXA 3IL2A 2W24A 3QOPA 1YFHA 3AK5A 2ZMEB 5J47A 3C7JA 4C3JJ 1A6IA 3QOEA 1W0KA 3OIQA 4KFCA 1N75A 4NC6A 2W7ZA 5IY5H 4Q5SF 1UD3A 1PE9A 1J75A 1KRHA 1WSVA 4DNTB 3LSJA 4HDUA 4GCVA 4PCQA 1IDJA 2X8KA 1LE8B 2EWNA 1VQPB 3CF2A 2R7QA 2IQ7A 3NEUA 5F4MA 5LMZA 2O9LA 1MJ9A 3TBIA 5EGOB 1ZRDA 4OJPA 3MWMA 4G94A 5IPAA 1RC9A 3L2UA 1DGRM 3FMQA 1BA5A 2BE5F 1WVRA 1T95A 4WZKA 3TH0A 3EDPA 3FKSA 1KQ5A 2HQNA 2Z16A 4X1EA 2DQRA 4E70A 2XEXA 2VB6A 3QYBA 4RPDA 1QGAA 2EZKA 4LGWA 2DFEA 1S7OA 3PVDA 2VJ4A 3KP5A 1KD1D 3MAJA 2Z33A 3P9IA 1P9QC 3EUHA 3W2VA 3Q9SA 4N4OB 3M9AA 2EA2A 2KQRA 4S04A 3ONQA 3IHUA 2A07F 1FLIA 4M3FA 1FC3A 1KU9A 5HS9A 2NVQJ 2WJYA 3VEPA 1VQ8B 3QRFF 3CCVB 1Q9SA 1DBGA 3CLQA 4HX7A 4ON0A 2VUMJ 4IQ4A 1DP3A 2G7UA 3C2BA 3F8CA 2WYRA 1VQ5B 4CCOA 3BLYA 3DPUA 2XAQA 1QBJA 3SZPA 1TQPA 4UY8I 4YCQA 4FE7A 1R5HA 4DQLA 1V0EA 3CC4I 1JTYA 3HTUA 2ID3A 1TWFJ 4BACA 2OV7A 1GXPA 3FMRA 3LSPA 4PJ0C 2OYNA 3X2QH 2FX0A 3WGHA 1FWZA 2BHYA 2HVQA 1YHQI 2GK7A 3CCLI 1Z3XA 1JJ2B 3FXKA 1NG6A 2VKDA 3K4LA 4J00A 2ZKZA 1E1RA 4P3IA 2G0YA 1BBYA 2Y30A 4H4KC 1A35A 5F0FA 3H0DA 1XTAA 4L8JA 2JRMA 3V7AA 1Z6TA 4JRAC 2DY1A 1T56A 5FLVA 1HW1A 5GAEJ 3LSRA 3J81Z 1HF2A 3CMAB 4BE1A 2MH9A 1DPUA 1VZ0A 2CQ7A 3ZCOA 2YWFA 4RGSA 3WGGA 3A8IA 3PSFA 2PECA 4RS8A 2WPDA 4UUVA 2FBHA 1OPCA 2LZJA 2V1NA 4BE0A 3I9V2 2WC2A 1OMIA 2CW0F 1WSUA 2HDCA 2W00A 4AWXB 3G3ZA 3K1MA 3HL2A 1SKQA 2HOTA 2MLGA 1U2RA 1D0XA 1TNSA 2V79A 2KFDA 2KLOA 2L4MA 4PZJA 3KETA 4JK1X 5E79C 2EIXA 3ZPPA 2J5PA 2XGJA 5J3OA 2J8KA 1ON1A 2P6TA 5F64A 3K4BA 4EQQA 1IC8A 1CF7B 1DARA 1VJSA 4IW3B 3CUQA 5FGMA 2CUJA 1E63A 2D3NA 3ASOH 4M74A 5LEKA 3T1BA 5JVTA 1TP4A 1KCDA 2HTSA 2WY8Q 4H0EA 4MTDA 1XPXA 3NAWA 1YJWI 4TMWA 5FO0A 6PAXA 4OPVA 5FO5A 4CYCA 1UMKA 3GXOA 2BHZA 2E5NA 2X0KA 4N4NB 5ILSA 2XPVA 1OLTA 5L46A 2E7WA 4EATA 1K5CA 1G7CA 1OB0A 2GWRA 1QA1A 3HXLA 1U9OA 1KK1A 2QYUA 2VNHA 2L3DA 2RC4A 4LLLA 3RKXA 1YW7A 3RPQA 2VPRA 5K7FA 4G6QA 1O8JA 1X1CA 3W5UA 2M7AA 4BYYA 4PUSA 4IO9F 2HVSA 1WQ2A 1Z0XA 3I3LA 5FLXK 1AKHA 5HDNA 3H3VK 2J7KA 2O0WA 4YG2F 3HBLA 2XIGA 1ELOA 3HDDA 3V8LA 1ZM3A 3IH3A 3PQJA 4XRMA 3QPTA 3PENA 2DA2A 3OJWA 4OZYA 5DV5A 3H9JA 3WTTC 5FKMA 3WODF 3MKLA 2HZTA 4D7NA 1S7AA 5L3DA 1XB2A 1IDKA 1E64A 1JA1A 3FXLA 2IGKA 2BYVE 1ZG5A 1WOOA 3KZZA 5F08A 1J09A 2KT0A 3HKZN 1ZGJA 2FX3A 4JBAA 3J7AY 3ZZ0A 4DNRB 3BP8A 4BBRJ 1LFUP 2N8GA 4Z2YA 3MKZA 3BJAA 4E7JA 1VQKI 1IN4A 4YAOA 2P0WA 3JU4A 4ZCMA 1O7LA 2QCOA 3GQBA 3CTAA 2FRHA 4B47A 3H0GJ 2DIEA 3OP1A 2BSPA 3BR0A 1PJ6A 2C2WA 3WXMA 3CCUB 2YWHA 3E1YE 2K9SA 3DBLB 4F92B 3S93A 2ZSIB 5F4JA 4RJLA 1CZFA 1CF7A 2HCJB 1W1WE 1TT0A 4BJ5C 4OWRB 3HRTA 4F91B 3QPLA 2RGVA 3FBIB 1VQ4I 2GXAA 2H8WA 1R5GA 1VQNI 4YDTA 1G3WA 1W7PA 2CQXA 3GTMJ 5H59A 3VSVA 2OK8A 1ETOA 1FYLA 2F48A 2QEXB 2WZPP 2HGCA 3D1NI 1JKRC 4ROXA 3TL4X 5AN9A 4D5CA 2O5RA 1QFJA 2BY0A 3W6VA 1ZLKA 4FCYA 3RTRA 4HOBA 3U6BA 1KQ0A 2VJJA 2B9SA 1FY7A 3GMEA 3S2DJ 1XD7A 4IRGA 1VQMB 1BIBA 3TGNA 4EH1A 1HXDA 2XRNA 3H5NA 4R79A 1TC3C 3WU0A 4KN4X 3HHHA 4W97A 4BHCA 5JI6A 2K27A 3SYTA 4CCMA 2XKPA 3BR1A 5J6XA 4XIDA 2V4JC 2HKOA 3RKYA 1XFOA 4I0AA 2M9HA 2LKSA 2H1KA 1J59A 2V7UA 4Y52J 3W2WA 1R1TA 2HQRA 1OGMX 3HRMA 2RAEA 3MKYB 3GFLA 2INUA 1SMYF 1YS6A 3AG2H 2VNIA 1ZM4A 2WBMA 4W8QA 3JTHA 1CQXA 2R7FA 5F04A 1QGZA 2JRTA 1T0FC 3W3CA 1PYVA 5HDKA 5LFAA 1QVFB 1R49A 1BW6A 1A5JA 3E5UA 4U0WA 1WKMA 3WNDA 1B9NA 1FOWA 4ACBA 3VYRB 2CQQA 3K0LA 4BEHA 2BY1A 2TDXA 3AVYA 3OS1A 4K2EA 2RC5A 3G71B 1HQCA 3OJXA 1VQ4B 4U0VA 1Z77A 1NHAA 3TO9A 4ZH4F 3S1MJ 2BV3A 3ZBTA 2ZITA 3TP3A 5J4YA 3DU5A 2JQ7A 2WJVA 1VQ9B 2JK3A 3ZMVA 3CMYA 3KZIC 5J1UA 4UB8C 2IXSA 3P9CA 2EFOA 3N4MA 1F5TA 4P1WA 5H6QA 1JJ8C 4QIWN 5J1YA 2O03A 4I6ZA 4F7DA 4OAYA 2XKOA 1REPC 3LSHA 2OCEA 3WTYC 2DPDA 2QE7A 1WU8A 1G3YA 2C4TA 1T98A 2D2WA 1TNTA 5IOZA 1TWAJ 1YE9A 1ZAOA 2L02A 3QWLA 2MH2A 4NBSA 3MZ8A 2BGJA 2BZTA 3I56B 4W8TA 3SYJA 1KMHA 3ABLH 1M1EB 3DKYA 3ZQHA 2VKHA 3J81K 5TV2A 1GQ8A 1D1AA 4HQEA 1H89C 3BCFA 1S9HA 3RPUA 4FE4A 1MSEC 4C43A 2X85A 3FXQA 3KRGA 1MIJA 2DDBA 1ZUNB 3ROUA 3FBNB 1EH6A 3IH4A 2KPMA 2QTLA 3CCSB 1O8FA 1QQ1A 4B3FX 3SHFA 1UG0A 4XR6A 5HODA 4BHBA 1YIOA 3AAFA 5LD2C 3ZQQA 4D9JA 4KNYA 1Z1DA 4AIDA 2A05A 1GO2A 4P6YA 3GFJA 3HPHA 3G73A 4M3BA 3PO2J 1T6YA 1IHMA 3ZPLA 4JX5A 4C2LA 2DA4A 1BJZA 1MBGA 1A04A 1X1AA 1D1NA 3W2FA 3LAJA 1FBQA 2IA1A 4IOCF 4HIZA 3HUGB 3WE3A 5AMVA 2X1DA 3BG7A 4RLZA 2DA5A 3JQQA 3H3UA 1IB4A 1OCOH 4CZCA 5K5RA 1IV6A 1F20A 4WZLA 4YZ0A 2F4NA 2QGGA 3HOTA 3BQJA 4RGUA 2VE8A 3NAUA 1JHHA 1IN7A 3AVXA 5F1JA 2K86A 3DEEA 3R0AA 1ZARA 3G71I 2L9RA 2ELKA 2GA1A 2XSDC 3F8NA 3VWBA 1OGIA 4P9SA 1YJWB 4CXFA 1HVXA 2PYGA 1I39A 2K02A 4UVAA 4AIJA 1VQ7B 4G7ZF 2OQGA 3VOEA 1K8AD 2LNBA 1KC8D 3WQZA 4LMYA 4FQGA 1QA6A 1EH7A 3N6ZA 3N97A 2QENA 1KJZA 4EGYA 2R5ZA 2R7SA 2JUCA 2PFBA 2YUSA 5LGNA 1Q1VA 4A0YA 3OMYA 2EK5A 1H8HA 4FXUA 5JLVC 3VR6A 3TW6A 3JW4A 3H36A 5DNSA 2TRTA 3M3YJ 4U87A 2R7OA 3SFZA 3SY2A 2GZWA 3OZWA 5JLWA 2J5OA 4RM2A 1VHOA 4UZUA 4II2A 1WXRA 2XDVA 1FX0A 1B4AA 2C6YA 3U1KA 2JJ1A 1BR1A 3H5AA 2ZXWH 2YSRA 1MNMC 1KU7A 2M5SA 4DZPA 1Y0NA 4II3A 4J19A 1K9MD 4YZAA 5M5YJ 5FD6A 2O3FA 3BG5A 1QRYA 1LDDA 1P7JA 2B63J 4FX4A 1XQBA 2EV5A 2DJNA 4M72A 1KTVA 3GLLA 1QZYA 4B09A 5LRSA 2JA7J 3MHPA 1F9NA 4YIFA 2Y9ZA 1G7SA 4Y4RA 2V1UA 1W9XA 2JTVA 2Y75A 2L4AA 3TW7A 3KEWA 5F1RA 1IW7F 1NB0A 2XASA 3FXJA 3HUGA 4OJ6A 3CP8A 2ZJQF 2VODA 1YX5A 3JRDA 3B73A 4JP0A 2DBBA 1K4SA 1D2EA 3HRUA 3CCMB 1XGMA 2P3MA 1D0YA 2DOEA 4HAMA 1KYWA 3BR6A 4PJLA 1AU7A 2C77A 2F6CA 3OYHA 2V31A 4WX9A 3SZTA 3GTKJ 1W5SA 2KISA 1MMNA 4BHPA 1G3TA 4IHYA 3JSPA 1A31A 3Q3SA 3VMVA 4UVCA 3IRQA 3A1PA 2DERA 3D5RC 4YFKF 4Z4VA 2W85A 4IX7A 3HPGA 5DEQA 2QA4I 1U5TB 3OL4A 1UHMA 1JE8A 2F5VA 3SDBA 2VJIA 4ESFA 2L9VA 2MC4A 2ZMEA 2X6WA 3J81k 2LKXA 1JKPC 1YOVB 2MABA 1EP1B 3QFCA 5FKOA 3WTSC 1IB0A 1ZRFA 1SD5A 2IT0A 5EEGA 3WWGA 1QRCA 2WV0A 3OYLA 1H85A 2L7MP 3HRSA 5DSZA 1IRXA 1NG7A 3CJRB 5CVRA 2B5OA 3HG9A 1L1IA 1LE8A 2PJPA 1PKVA 2JN6A 2ZMEC 2TCTA 5L3CA 2V9VA 4RD6A 2XNJA 4A3IJ 1YW9A 1GXQA 4CCLA 1AKHB 5KSWB 1NHCA 3QU6A 1HW5A 2GAUA 3LL7A 4OPOA 4KKTA 3RI4A 1ZK8A 2PIAA 2AQFA 4PGOA 3Q6QA 4ZGQB 3CUQC 2COMA 5JR3A 1R4NB 5L3EA 5DCMA 5DM6F 4UHTA 4F93B 2RREA 2HWVA 1OCCH 5HS8A 1MJAA 3CO7C 2R7UA 1E17A 1JKOC 3DTKA 1SVLA 4CSWA 4FHTA 2NTBA 3HOXJ 2BM0A 4F52A 3W2GA 4XKBA 1EF4A 1B1BA 4DZJA 1S72B 1R1UA 2QM3A 4MGRA 4XK4A 1U9NA 1S3JA 3ONUA 1VQLB 3IAS2 1S0UA 4AVPA 2FQ4A 3VDXA 2XPWA 2ID6A 2QXZA 1VLOA 4G7XA 1OB2A 1F43A 3VYUB 3G1OA 1HBXG 2LFBA 2OZ6A 2K3PA 4G7HF 2EA4A 2CW7A 4UV8A 1BC8C 2PX9A 4B4DA 3MCZA 3U2RA 5A2QK 2OUMA 3C2HA 2QQBA 3Q0VA 2WTEA 3BTIA 1I1GA 2QDXA 1W87A 4XBFA 4LD5A 2D74A 1G6NA 1UD8A 3PUNA 3CMEI 2O17A 4NHJA 2Y0SN 2HMAA 4V2FA 2DYRH 3DKWA 3EYIA 2L5QA 4OOSA 3CCLB 1LM1A 3H94A 4BJ6C 2IBDA 1QUEA 4XKWA 2DODA 1SFOJ 1IV8A 3CB4A 2B7EA 5CJ9A 2WR8A 2QBYB 4YAWA 3ZMUA 4ASUA 3JURA 3HSEA 4QWQA 1TW3A 1E3OC 4X6AJ 2D1HA 2AQEA 2QWWA 3IWZA 4A6DA 1VBLA 1WI3A 1RKWA 2MW8A 4CICA 1B23P 3CCQB 1ZN2A 2QQ8A 3M1EA 2R7VA 4YALA 2V26A 3AVVA 3LA7A 3D0SA 4RAGA 2IJLA 1NH3A 3P4GA 3GQ9A 4G5GA 3OPOA 2VBMA 3RIRA 2ME0A 1N06A 1FIAA 3RZDJ 2M8EA 2K85A 4WXHA 1QVGB 2CW5A 1S29A 1UD4A 2KVOA 2BY3A 4BKXA 3E97A 3I4PA 1WOPA 1RQPA 3L7WA 1VQOI 2EFGA 1O8KA 1H9TA 4A3MJ 1E3XA 1OOCA 3V8KA 4BAYA 3DTEA 1SFUA 4M73A 3OZUA 3WY9A 3QU3A 1U0JA 4DOZA 3KLNA 1MKMA 2ECCA 3DV8A 4G1VA 3ZSCA 3AG3H 4CYCB 1ETXA 2E1BA 2HS5A 3ZQ7A 5GPCA 2EV0A 1G7TA 3H9QA 4XSZF 1KZLA 4E6KG 4TT3A 1FNCA 3HZJA 1RQRA 2VBVA 2V7FA 3A8KA 3G05A 3WE2A 2DPUA 5J40A 2WB1N 3R4KA 1A8PA 1EKEA 3F23A 3ZGKA 2DFFA 2NTQA 3CLOA 2GREA 4BU2A 3GTOJ 3TDZC 4J01A 2W82A 3NRVA 4PK4A 2LY9A 4C0SA 2FQ3A 2IS6A 1W34A 1RUNA 4FK8A 2NAZA 1DDNA 4P22A 2KRHA 1POGA 1MBHA 1IXCA 4FETA 3V7CA 5TJJA 4HNTA 3KYCB 2JA6J 1FNDA 2MLKA 4MQVA 5IOYA 1IUFA 2VBUA 4TMXA 5JMCB 4DYRA 4M3DA 1FJLA 5DUKA 1WCMJ 1YG2A 3AL0B 4X7DA 2QZ8A 4C30A 4G12A 1R4MB 1PVEA 4OIPF 3ISXA 2PG4A 4X7CA 2X53S 3IC7A 4MEXF 3WTZA 1XDUA 2OBPA 2KL4A 3S1NJ 3L00A 1FRNA 3HTSB 5TY0A 4P9UA 1T6XA 1MMSA 2GJPA 4HPQA 3ZN0A 3OIOA 1B72A 3OYNA 4W8SA 4LK0F 4RMNA 4KUMA 5LHIA 1BW5A 2PMZA 4UUSB 2OTJI 1WGXA 4WXCA 1X58A 4ZC3A 4PJMA 4LG0A 3V4GA 1W36C 1MSFC 3BH6B 3OV8A 4E7SA 3GSIA 1AA7A 3SEJA 2ME6A 1ZM9A 1RR7A 1IRZA 2MG4A 3O3KA 1FOKA 4MYUA 1I27A 2EV6A 2MSYA 5B3SH 4UV9A 2UVEA 1BI0A 5HVQC 2FSWA 5EYRA 4I09A 1AWCA 2W6IA 2QMUA 4HW0A 1VQ6I 5E3NA 2P7VB 3R6KA 1RUOA 2DCUA 1VQPI 4JMQA 2H8RA 3J80Z 2KIUA 2GM4A 1SMTA 1QO0D 2F5FA 1MJBA 2EB7A 3FDYA 3OW7A 3ABTA 1HDPA 3KX2A 4RCYA 3K4NA 4QPQA 3AFHA 1YX3A 2FMLA 5D5WB 2HOSA 2NVUB 2LR8A 1QFZA 1I7PA 1N08A 4DYCA 5FFXA 2PLFA 2AXLA 1BIAA 1EJ9A 2H6BA 3CP2A 3S14J 1O3TA 2VQCA 5A88A 2NYXA 2UUZA 4Y15A 2VBXA 3LSGA 1T38A 4U9UA 5E6TA 3Q38A 1HKSA 2LY1A 1GVJA 3A1YA 3TO6A 4IRIA 3ZR8X 4KITB 2JZYA 1JGGA 2IS4A 2LKPA 2C5HA 5HXBA 1WH5A 4M6XA 4A6EA 2KKOA 5J1RA 3QODA 4NNJA 1CQTA 2LH9A 4CUGA 1Y8RB 2FBIA 3E6DA 2XZPA 1I5ZA 1P4MA 3R0JA 2DLLA 1LVKA 2VBZA 3QE2A 1WP6A 2R6HA 4IPAA 3ZRGA 4IHWA 1XC5A 2CQNA 5F27A 2A69F 4P6VF 1AIRA 3JX8A 2HKXA 1IUYA 1QVUA 1X1DA 2LRDA 4Z4WA 4L5JA 2LBFB 2Q6IA 3T8TA 1D1BA 3T8RA 3KEOA 4HV6A 3T51B 1KGSA 3OYJA 2QEXI 5HLHA 3VSKA 5K7HA 1Y56A 3QPSA 4N9HA 1B72B 3QP6A 2E1NA 2AO9A 3I4NJ 5DTDA 2X3UA 2HVRA 4NQWB 4AYBN 5ERIA 3VB2A 3R61A 2WB1A 4A0ZA 1F4KA 3N90A 4Z05A 2CV1A 3PNYA 2VOOA 4NDLA 1IXSB 3H3ZA 4AYBA 1BJAA 3HC7A 1U5TC 3E6CC 3FXOA 2CC2A 2PLYA 4E7KA 3O8GA 2Z8GA 1DDIA 2ZL5A 4B8XA 2PI0A 3VYSB 1ZH5A 4G9YA 2EZHA 1MZBA 3WG7H 4JX4A 5C1EA 2O1DA 4FWTA 3I55I 1X2NA 3KEQA 3BNWA 2V1DA 3PIPF 1MGTA 5JHUA 3W5VA 3P7NA 1VQ9I 1CLWA 4CDGA 2FEZA 1J2XA 5E1WA 3CC4B 1KONA 1V0FA 1KK3A 5EDNA 4BE2A 2RDPA 3BTJA 4FN5A 3OR2C 3V8JA 1D1CA 4A5NA 2K7LA 2R3SA 5L3GA 3ZQCA 4A3BJ 1VNDA 1H80A 2OTLI 2CV2A 4JOMA 1JJ6C 2JN9A 2DT5A 2RNGA 1BX0A 4E4HA 2VFMA 2YUHA 1JA0A 3WU2C 2HYFA 2KIFA 4M6VA 3T53B 1W5CC 4ZZDA 4HLYA 2OBTA 3RQ4A 5DCMB 1X3WB 1D5VA 2XZLA 2CFOA 4P55A 2WWYA 2XHKA 4YFNF 2WSSA 4QUZA 4B3AA 4UVBA 5DD8A 1Q86D 3ASSA 2Q1ZB 3M1CA 3CCVI 1OFLA 4BDYA 1ORKA 2QQ9A 3F8MA 2M45A 1HW2A 2G9WA 1OCTC 1Y0UA 2DW4A 2XV4S 2LMDA 4A3EJ 1YTYA 3KZYA 1YJ9I 3ELKA 2K9NA 2LLKA 3BZ6A 1ODDA 1BM9A 4GDFA 3N05A 4CA0A 2M87A 5LGUA 4TMZA 2R7ZJ 3BR2A 3QFRA 3OSGA 4EJTA 5BPDA 1G7RA 2BOLA 4RM3A 4MQ9F 5GAHJ 4UZEA 1EA0A 4BY7J 1Z67A 2F5EA 2HNHA 5EJCA 4MYTA 3FPKA 3VYTB 4RLQA 2KIMA 4K1XA 1QX4A 3RKWA 1F60A 4A3DJ 1S6LA 4PC3A 1VI0A 4CCKA 3I5UA 4MIMA 3AVTA 4MEYF 1TTYA 1TTTA 3CPXA 4Y9UA 1EFRA 1T39A 3A4CA 2M8GX 2C4UA 3GWZA 2WAQN 1W0JA 4EJWA 1KQ9A 3F21A 1TYUA 2STWA 2MA3A 2O7OA 2WAQA 5CYVA 3T0YA 1G8XA 1KYZA 3DPTA 3P26A 2HPIA 4KICA 4XN0A 3TP0A 2AS5F 3VMFA 4U4BA 1WJAA 1OCRH 2VQGA 1VQ7I 1D0ZA 1WOSA 1RETA 4RLFA 3CC7B 1ZGAA 1QHHD 2R7DA 3JRGA 2IA0A 2R5YA 1SVOA 2K9QA 5HZAA 1X3ZB 3P27A 5BSYA 2K4BA 5HLIA 3PIOF 3LMWA 5E8GA 1K28D 2HYJA 2DMPA 1NK3P 3ERED 3OEEA 3U9GA 2XROA 3GUDA 3SEZA 1XGOA 1OQYA 2DA1A 2JA2A 2L2OA 5KVRA 1R5OA 2B0LA 4ZGNB 1HSJA 4WWVA 1WJFA 2Y2ZA 4P12A 2M7BA 2XGDA 1VLYA 2UV1A 3G4SI 2LG4A 5HLGA 4P9FA 2P7CB 4E7IA 5JBQA 1IDZA 2INVA 4MR0A 2GOXB 2BY2A 2BV6A 1P4AA 4M53A 2LP0A 3DF8A 1XSDA 4H9GA 2STTA 4DQKA 1QCXA 1EV7A 2OU2A 5HOOA 2F4MB 3PSZA 1MW7A 2PMUA 2Z99A 4HEA2 5E20A 3WTWC 1YJ9B 1USTA 3RCOA 4Y13A 2E1MC 2JIZA 2XTYA 3PFIA 4Y7CA 4N0BA 3QSYA 3LFUA 2ACJA 1VQKB 3T56B 4IHSA 3ASPA 4JYKA 2H09A 4LC0A 4OPSA 1WWXA 1D8TA 5ICEA 2XGEA 3BJ6A 1R5ID 4M3GA 4FASD 2G7HA 3K6GA 4ZYEA 5ILUA 3M7GA 2YWEA 1FYKA 1IN8A 2F5CA 3AGQA 2DOFA 4GO1A 1LLZA 4XLAA 2X51A 4KMUX 2QKMB 3RDIA 1JI8A 1LFPA 3KP4A 1HSTA 5LBQA 4ABZA 4RD1A 2K9LA 1PJRA 1ZG3A 5IYRA 2FXAA 2PJRB 5EZGA 1GV2A 1T33A 1E3ZA 1RU4A 2EJRA 1FX7A 2VL8A 3F6VA 1HDDC 3TDUC 4BGDA 2XRLA 2JUGA 2D9RA 4TMTA 3GRHA 4PGGA 4QV2A 1GT0C 5A2QZ 3V76A 1KU3A 5HNFA 2XSJC 1YIJI 3DEWA 4L0YB 2WV1A 4ZTJA 1MBEA 1E1QA 4P2NA 4XMYA 1UD6A 5EEHA 1T6ZA 2ZZEA 3ZC3A 1AMOA 1G3SA 1XMKA 1BMFA 4URRA 3DBHB 2BVMA 3JRIA 4AC0A 1NBMA 4RGXA 1Z3YA 1FIPA 1R6RA 3K4JA 1OKRA 2V7VA 4CYDA 1JHFA 2W1OA 1T08B 2LBFA 3K4CA 1UG2A 3OIPA 5C3EJ 3S3OA 1FMWA 2L7FP 3C1DA 1DP7P 1NK2P 4HE6A 4AUXA 2XUBA 2NNNA 4FISA 3VSLA 2HTJA 2A3SA 5IP9J 1P6RA 4XRSG 1KCCA 2RV8A 3VO1A 2Z1DA 1XDSA 1PUFA 4N3NA 3W2EA 1RNLA 2CO5A 3GIRA 1SANA 2BEOA 2DI3A 3DTIA 3I58A 3O6BB 3FXUA 5FLMJ 4U7DA 5F0CA 3HOSA 4DK0A 2MGQA 1FYMA 4GFBA 4AU7A 4X0GA 1B8IA 1X1PA 2BGIA 4YAUA 1AIPA 4Z4ZA 4B43A 1YI2I 2DT7B 1K4ZA 5GTHC 1XG2A 1SD7A 2DMQA 4BBSJ 1V55H 1BQEA 3MEXA 2M4GA 3A3GA 2M5WA 3GFIA 3ES9A 5BNGA 4X7EA 1GJRA 3W2IA 3L2CA 3ZQIA 2VBYA 5E8IA 2X9DA 3DWLE 4Z1MA 5B66C 3L2WA 2CU7A 1R5BA 1OJLA 3GTJJ 2A6TA 1WJDA 3HJEA 4D1QA 2RC6A 4O3MA 4ZV4A 1Q82D 2A5WA 4C3HJ 2O6GE 1B2RA 1SKYB 4HSRA 1I8DA 2DOAA 3VNVA 2E36A 2A6EF 3A3BA 3TQNA 1Y1WJ 2WAEA 1IAWA 2CSOA 3PETA 1DU6A 2DETA 1U78A 3GQAA 3L1PA 4XL9A 1KQSB 4Y17A 3SZEA 4OOVA 1U5TA 3CQZJ 5IT3A 4D0PA 1X19A 2XVCA 3FX3A 3P5JA 4BUPA 4HBLA 3DQVC 4CCNA 2GPJA 5H20A 3ZIAA 4FX0A 1OGJA 4OJ5A 4XOPA 3GZ5A 3R6JA 1YHQB 2XB5A 4GYIA 3GBGA 4KIFA 3A35A 4M3EA 3OS2A 1K79A 1W4MA 1ZR2A 3HOVJ 4M1KA 1V5GA 3AGPA 4AF7A 1EZGA 1S7EA 4LOCA 3ZMTA 4Y7NJ 3PO3J 4F7ZA 3RKQA 2JVGA 2HLDA 3WBJA 4HYEA 3LAPA 5K5OA 3WTXC 2HFHA 1QGYA 4EEFG 4W1UA 3J7YJ 4LJZF 4PC1A 4PC7A 3H09A 4BY1J 2A5YB 4QPOA 3FXRA 2BF4A 3MVPA 3B4NA 2ZXJA 1VF9A 5EG0B 2VIXA 3SZGA 4AC9A 3CCQI 2V5IA 1GHCA 4XONA 1WFXA 5HS7A 1ZHFA 3ABKH 5GADJ 2VT2A 1USSA 2ZSHB 3CUQB 3IH2A 3LSTA 4ZJZA 4ZYGA 1BR2A 1ZRCA 4I84A 3EQLF 3HYIA 1B8IB 1HG8A 5IYWA 1Z91A 4KN7X 2DN0A 3A0HC 3RJPA 1QH0A 5JVGF 3UW0A 2E35A 3LQQA 3KP2A 4O5VA 3B02A 3R60A 2GXBA 3ZBUA 2XPUA 2MD5A 3OOCA 4LITA 3SDGA 4RB3C 3CCRB 2NT9A 2NNYA 1P2FA 4CHUA 3GVJA 3Q3AA 2IP2A 3CF5F 2XF5A 3DXJF 4QVJA 3GW2A 3VSTA 4BL0B 4ZTFA 1JKQC 2GK6A 2Q6OA 2VBTA 1BPLA 3K2AA 4XRFA 5CQEA 2QZAA 1PDNC 4TMVA 1PJ7A 3CDIA 1APLC 4HA8A 4A3CJ 1IO2A 1IDYA 3ZQFA 3DLAA 5LHGA 3HHGA 3S16J 1O3SA 1RESA 1R5NA 2RQPA 3MQ0A 4MFDA 4A12A 1UB9A 2R5ZB 4HX8A 2NZMA 4P25A 2VC1A 1QRBA 4GYGA 1JUPA 1QZEA 5JHFA 2M3AA 1R00A 3BROA 1O88A 3GQ8A 1IN5A 4FT8A 2IAIA 1SFXA 3PM1A 1UD2A 1Z05A 2L54A 4M9XA 3JAMZ 3OKXA 2KHMA 4EM2A 1AOYA 4OJOA 1OYIA 5IT9K 3MCAA 3BTCA 2OF7A 5B5EC 4IEJA 3ISPA 3G6EB 4ZDPA 4XSXF 2E1RA 4BXFA 3ZMDA 4RD4A 5C4XJ 3KP6A 3T5XA 1FMVA 5GV7A 1OFDA 2EWEA 1YITB 1OCPA 2HPMA 1P4WA 4I99C 4E7LA 2PMHA 4XLNF 2O8KA 2ZZFA 2CRVA 2UWMA 4LBWA 2O0VA 1ETYA 3MZYA 1GLNA 4S0HB 4YIIA 4AIHA 1Q1HA 5DN6A 2W48A 4M71A 1TL8A 1LEAA 3CRZA 3FJOA 1X4OA 3DLLF 1EFCA 5TISC 3HGGA 1Q81D 2L9NA 4XKVA 4GRIA 3C3WA 3CDHA 1QGPA 2Y0SA 2ZZQA 4PAAA 3KP7A 4OU0A 2QSFX 3OL3A 3IKTA 4WZEA 1FBUA 2BVNA 5FFZA 3TMOA 4EJUA 1UELB 1K7AA 4RGRA 3IP4B 3ZMZA 1GVHA 4TN1A 2CWEA 3UR3C 4IF4A 4ANJA 5C4JJ 3TOAA 3PUBA 2R0QC 1HKQA 1QHGA 5D6FA 2E2JJ 4U0YA 2JJ2A 3FZVA 3Q9VA 2XAHA 1N78A 5CQGA 3LJYA 3OOPA 2H6CA 3L9FA 1YJNI 1SD6A 2JVHA 1UJ8A 5L3FA 5CDFA 4I02A 2VFOA 1LJ9A 2IGOA 4PJJA 2I1LA 2NS0A 1H42A 3WNCA 2JDIA 4EM0B 1Z7UA 1SC7A 3K4KA 3JQPA 2L7KA 2VBKA 1S5LC 4B3GA 4G8XA 4XNFA 1H9GA 3H35A 1A36A 1PLUA 2GA2A 3F22A 2BM6A 3BJOA 1ZM2A 2R5YB 2ZNZA 3IV5A 3FY3A 3CC2B 1IN6A 3PUMA 3U1DA 4A3FJ 3HOZJ 4RCZA 3BY6A 3DP7A 3CCEB 3ML3A 3PSIA 4LG3A 1IJEA 4V2GA 2MYSA 1Y1VJ 2IS2A 2QYOA 2W4SA 3DBRB 3WYAA 1VQ6B 2QLZA 2EILH 3S32A 4BQAA 4NUBA 2Q8KA 5F0HA 5DS9A 3QYEA 4M9SA 2K5CA 2BN4A 3S2HJ 2VBWA 4I98B 2D45A 5CVIA 1W5TA 1EFUA 2NT6A 5EG0A 5JFRA 3FM5A 3WNBA 4XORA 5HLTA 1E79A 1WORA 1IZ1A 2HXIA 2QVOA 4UZFA 4NQWA 2VBSA 1ZELA 4YHBA 5H5JA 4XLHA 2NXNB 2ZJ2A 3PUFA 3Q6RA 1IGNA 1TWHJ 2V6EA 3I59A 2W57A 2CRGA 5THXA 3FHNA 4KJZA 5K7ZA 2NPFA 1K73D 2W84A 4I76A 2UVFA 2PJRA 4HF1A 1RZ4A 4XQFA 2WZNA 5D5UB 1QA2A 1QA3A 1IRFA 4OJLA 3B6CA 2QY1A 4XLFA 1QQIA 2KP6A 1QUFA 4RAZA 2A6HF 4P96A 2FA5A 3QYFA 2ZTGA 4EJOA 2ZCWA 2F5DA 1ETQA 2DFHA 5FKKA 2Z2SB 1Y8QB 2V9KA 3GYHX 1LQ1A 3I55B 1ONVA 5D5VB 4Y9RA 4TKOB 2RNJA 2BXZA 2P5LC 3MMPA 3GO5A 2GQFA 4BH9A 3Q0WA 4BXUA 3M07A 3EUHC 4RBOA 2O61A 2R92J 4UNOA 1KA8A 2PMZN 3M8JA 1COWA 3I56I 2ZJRF 4EGZA 3ASQA 2OD5A 2EFWA 4HE5A 2X1CA 3OAAA 5LLQA 3EETA 1GVDA 4IRHA 1PUFB 5EMNA 2FD5A 2M0MA 1EA3A 2D5VA 2HZDA 4EV0A 4OIRF 1IRGA 2BXYA 4BNCA 2FVGA 1ON2A 5K1YA 4EMSA 3S2WA 3H5RA 4Z6YA 2BM5A 2IPQX 3WHBA 2VKVA 2HDWA 4IL6C 3M8EA 5ICGA 2QN6A 5K5QA 4N3GA 3K4MA 2GQQA 1EE6A 4FTHA 1ZQ3P 2VFNA 2HEOA 4OZZA 3T9GA 5LHHA 2R93J 1R7JA 3Q39A 1H88C 2DMTA 2LK2A 4LFUA 4UAJA 4V02C 2L0KA 1EH8A 1LB2A 2DJIA 2VKEA 3LFKA 2R7RA 2AXTC 1SVMA 3ONYA 1MDMA 3WGIA 3WU1B 2QUFA 2MBFA 1RMGA 1GUUA 1XMAA 4XRSA 1HKTA 3CJQB 4OIOF 4RDJA 1OR7A 1WJ5A 4I01A 4KISA 3JTGA 2C78A 1V5FA 5BOXA 3W6KB 2CUFA 3BY1A 3TOBA 4RD3A 2DTRA 2DFIA 1BR4A 4IJAA 3E5QA 4PC6A 1N8RD 3M4OJ 2BSAA 1YS7A 3NQOA 2JSPA 3REOA 4Z4YA 4YC5A 1TWGJ 1FSHA 3LSMA 2KZVA 2CF4A 5D4SA 4MNUA 1O8MA 2XZOA 2PYHA 4IXAA 2GLOA 2PE3A 2O04A 4M0LA 1E3PA 5J8CA 1UMQA 3LA2A 4OM9A 2OTJB 1MBJA 2WA0A 4A3JJ 1D5YA 2X6XA 4YFXF 2YWGA 2BM4A 5BMZA 4CQJA 3SQVA 3MD2A 3K1NA 2NV4A 4OPWA 1VQMI 1MBFA 1IJFA 3O2PE 5E18F 1U6GA 2XT2A 2F2EA 4L9TA 4F3QA 2CV0A 1E62A 2PMDA 2FBKA 3HOUJ 2LYCA 4U49A 1DQUA 1NTCA 4NCNA 3RIQA 2MFZA 1LUJB 3F72A 1V3FA 3V7SA 1TW2A 2GXGA 2H94A 2RQQA 1GAQA 1BHEA 3SFIA 3LQEA 4J0QA 3QQAA 4IQJA 3NWSA 1W0TA 3TKYA 4KYWA 1CNEA 5IP6A 4HF2A 1UFMA 4AIKA 3C2GA 1K78A 1JRGA 3IWFA 1EP2B 2E71A 4G7WA 4X0CA 2UZKA 1NJID 3OW2B 1F1ZA 5A8AA 1PJ5A 1IF1A 4TSFA 1MMAA 4LLGF 3CJNA 4NC7A 4NK8A 1OHHA 3OYMA 1TQIA 5DD4A 1L0OC 3MN2A 5IYBJ 4BQQA 3OS0A 3LNQA 4OAZA 3KFWX 2HOAA 1P4XA 2ZZGA 2WADA 2R9VA 2IEKA 1DUXC 4YAFA 1TYWA 2QSHX 2LREA 1MH4A 4IHTA 1VF7A 4BDZA 3CDLA 3I53A 2PN6A 2JPBA 4E0FA 4RDUA 1FNBA 2XNCA 3ZMSA 1MH3A 1MBKA 2JJ7A 3B82A 3H9GA 2E1MB 4XLPF 1XN7A 3GVKA 2JA8J 4HG2A 1W0UA 3EPZA 4MTEA 3FWEA 2LOOA 3HM5A 2RN7A 1N05A 4WXDA 3OYAA 2CYYA 3LO8A 2ZO4A 4BQOA 2DT6A 2ADUA 3I64A 5HNHA 4WWCA 2V7TA 4B1RA 3LVBA 1XSXA 4PFOA 2P5VA 1UCRA 5KHDA 4NK6A 3S1QJ 5BQTA 1E3HA 1T8IA 2FUG2 3BCAA 5BPIA 1BLIA 2V7XA 1WRJA 4ENKA 1IG7A 2XTWA 5ICFA 5IK2A 4R71A 1VFCA 1XX5A 1SEUA 2K4JA 1K78B 3H9NA 3BPVA 3IUOA 3BT9A 5ED4A 1GAWA 2Q6LA 1Y0YA 2CMPA 4N9IA 3QFSA 4P1VA 1SM4A 2BX6A 4YELA 1OB5A 4PSXA 3GZNB 4AD9A 5HDGA 3JQRA 4Z4UA 3HKZA 3L2QA 2G0EA 4CO8A 2B7CA 1VQ5I 4A3KJ 3CCSI 1RRJA 1J7KA 2GJKA 2Z6BD 2O6WA 3SUCA 1YX2A 1FTTA 5GAGJ 3JR9A 3I59B 1C0WA 5IYCJ 1BI3A 4IVNA 4LK1F 1I1SA 3CPWB 3LMMA 2FU4A 4OP7A 3MFKA 4B3XA
chains in the Genus database with same CATH topology
1WTHD 5C1CA 3RSNA 1WJCA 2XSJC 5KCMA 5HNFA 4ZTJA 4Y4RA 5TGTA 1E1QA 1W9XA 1O8LA 4XMYA 1UD6A 2ZZEA 4URRA 3KEWA 2D3LA 1BMFA 2BVMA 3PNTA 4OJ6A 3CP8A 2NTPA 1YX5A 5FROA 1NBMA 1Z3YA 1R6RA 3E1SA 3K4JA 3HAGA 2W1OA 3K4CA 2LBFA 3OIPA 3S3OA 2R7XA 5FRNA 3LNNA 1FMWA 3OE7A 1KTWA 1MABA 4G6IA 3U21A 1D0YA 3VSLA 2BVLA 1MNDA 4PJLA 2V31A 3OYDA 2F6CA 4XLCA 3OYHA 2XNDA 2HU9A 2Q2EB 1KCCA 3S3NA 2E60A 2Z1DA 2K9MA 1MMNA 4BEHB 5FL7A 2VXZA 3VMVA 3DTIA 3OYGA 1O8IA 3GQ7A 4DK0A 3HOSA 3D5RC 4Y33A 2V4DA 4AU7A 4X0GA 4PFPA 3S3MA 4IX7A 3HPGA 2VLAA 4B43A 2DT7B 3OL4A 1X4PA 4MXNA 1XG2A 3D5SC 2F5VA 2CH0A 3SDBA 2VJIA 2M4GA 3OYFA 3A3GA 1O8GA 2HQAA 2MC4A 2X6WA 3L2RA 2MD0A 1N77A 3V42A 1SFKA 2MABA 1LDKB 3DWLE 4Z1MA 3L2WA 2ZTNA 3EQNA 4XN3A 3OYLA 3WWGA 2A6TA 1WJDA 4D1QA 3A2KA 1IRXA 1NG7A 2A5WA 2XAUA 4F55A 4YZQA 3CJRB 3HG9A 1SKYB 4HSRA 1I8DA 2DOAA 1PKVA 3A3BA 3PFYA 1UAAA 2WAEA 4CCLA 4XD7A 4DGWB 1BN8A 1NHCA 3LL7A 2VBEA 4KKTA 3GQAA 4E7HA 2AQFA 3K70D 2XF6A 4XL9A 4IKFA 2XOKA 2QX3A 3VSUA 1X19A 2CS3A 2R4GA 4BUPA 1DBOA 3DQVC 4CCNA 4F93B 2RREA 3ZIAA 1E0EA 4OJ5A 2NOJB 4XOPA 2R7UA 4LIVA 3DTKA 2XC7A 4CSWA 2NTBA 3GBGA 4F52A 3F9KA 4XKBA 3ZXSA 3A35A 3LSKA 3OS2A 1V5GA 3QOEA 1W0KA 3OIQA 1OGOX 1N75A 3IAS2 2JVGA 3IAM2 2HLDA 1UD3A 3VDXA 1PE9A 4DNTB 1IDJA 4XKCA 2QXZA 2X8KA 4G7XA 5HKKA 2ZFUA 3VYUB 3CF2A 2R7QA 4QPOA 4U7BA 2K3PA 2IQ7A 4OJPA 2CW7A 3TBIA 1QU3A 3B4NA 2VIXA 3SZGA 3S8PA 1DGRM 3L2UA 1I18A 2OUMA 1T95A 4DJAA 1OR7C 2X3HA 3C2HA 4XONA 1WFXA 2X6YA 2Z16A 3FKSA 4UZUA 2VB6A 3E0JB 3QYBA 2ZSHB 4XLEA 4ZJZA 1BR2A 4B48A 4I84A 4BS9A 1UD8A 1UD5A 1X1BA 2O17A 2VJ4A 1HG8A 4Y3OA 1P9QC 4HSTA 3W2VA 5FRMA 4N4OB 2KQRA 2L5QA 5CPRB 4DBQA 2F1MA 3UW0A 3H94A 4BJ6C 3ONQA 2KRCA 2LY2A 3OOCA 4LITA 2NT9A 1Z21A 4XKWA 2WJYA 3GVJA 4ASUA 3JURA 2XF5A 3VSTA 1DBGA 3UNGC 4BL0B 4ZTFA 1DP3A 2GK6A 2AQEA 4IQ4A 1BPLA 2XF7A 5CQEA 1VBLA 4CCOA 3BLYA 3DPUA 1MMGA 3DLAA 2R7VA 2V26A 4ITVA 1O8DA 4HWVA 4LIUA 1V0EA 4CCJA 2NZMA 4BACA 2OV7A 2VBMA 3OPOA 3GQ9A 2E5ZA 5JHFA 2M3AA 1O88A 3GQ8A 2HVQA 2GK7A 1UD4A 2KVOA 1UD2A 1Z3XA 1O8KA 1OOCA 3OY9A 1E3XA 1NG6A 2VKDA 3K4LA 4J00A 1E1RA 2KHMA 3DTEA 2W6JA 4H4KC 4OJOA 1WPCA 3H0DA 4L8JA 1K6YA 4ZDPA 1U0JA 4DOZA 3ZSCA 4BXFA 2F43A 4BE1A 2E1BA 1VZ0A 3ZCOA 1KZLA 3H9QA 1FMVA 4TT3A 4E6KG 2EWEA 4KT6A 3BCDA 2ZZFA 2HPMA 2GOMA 2V7FA 4E7LA 3PSFA 3G05A 2PECA 2WPDA 2LZJA 2V1NA 1Z7LA 2UWMA 1HA8A 2IGNA 4BE0A 2O0VA 1GLNA 2ZXIA 3ZGKA 1Y6IA 3I9V2 2NTQA 5DN6A 4BU2A 2W00A 4ZDLA 4J01A 2W82A 3HL2A 4PK4A 1X4OA 2IS6A 1D0XA 4P22A 2L9NA 4XKVA 4GRIA 2KLOA 2KRHA 3ZPPA 4FETA 2Y0SA 2ZZQA 3BCBA 2XGJA 4HNTA 3OWTA 3OL3A 3K4BA 1W36D 4YEJA 4PJNA 3NE5B 1VJSA 3TMOA 2CUJA 3OR1C 1UELB 4G6TB 2D3NA 3IP4B 1KCDA 3AL0B 2NSTA 4MLOA 4C30A 2WY8Q 3UR3C 4ANJA 3PUBA 1QHGA 3KEYA 1RWRA 2GJRA 2JJ2A 2X53S 1N78A 3CESA 2E5NA 5CQGA 2KL4A 2X1EA 4N4NB 1OLTA 2JVHA 4EATA 1K5CA 2GJPA 4HPQA 5CDFA 3MMYB 4PJJA 2IGOA 3VMWA 4C9YA 2BW3A 3OYNA 1OB0A 4W8SA 3KYLA 4RMNA 2DXIA 2PMZA 3HXLA 2JDIA 4YXWA 4ZC3A 3K4KA 1W36C 2L7KA 4PJMA 2VBKA 4BQNA 4P5OA 2VXDA 4E7SA 4B3GA 4XNFA 3H35A 1O8EA 4XM3A 1X1CA 1AA7A 1O8JA 1PLUA 2M7AA 4PUSA 2HVSA 4EW9A 3I3LA 2R7TA 4DK1A 3FY3A 2O0WA 2UVEA 1TZLA 3DKXA 1H8EA 5HVQC 3PSIA 4LG3A 2W6IA 2MYSA 4YRVA 2IS2A 4OZYA 2W4SA 3PL8A 3H9JA 4JMQA 3S32A 4NUBA 3QYEA 2K5CA 4B44A 3FDYA 3OW7A 4C2UA 1IDKA 2NT6A 2IGKA 3KX2A 3K4NA 4XORA 3AFHA 4QPQA 4E7ZA 1LKXA 5HLTA 1WMRA 1YX3A 3OYKA 1E79A 1J09A 2ELJA 3J7AY 4DNRB 1ZELA 3BG6A 4JQFA 3MKZA 3OFNA 4XLHA 4E7JA 4Z06A 3CZ6A 3CP2A 2P0WA 3JU4A 2V6EA 2QKLB 2VQCA 2UUZA 3CMMA 3LSGA 3GQBA 2OC6A 3FHNA 4KJZA 3NWTA 4B47A 2DIEA 2LY1A 2BSPA 4PMHA 3A1YA 2IS4A 2PJRA 3ZR8X 4KITB 2UVFA 4XQFA 4F92B 3S93A 2ZSIB 3RPUD 3QODA 4NNJA 2LH9A 4CUGA 4PSWA 1CZFA 4OJLA 2XZPA 2QY1A 4XLFA 2KP6A 2M4KA 3BC8A 2I8DA 1TT0A 1LVKA 5CKTA 4HNUA 1WP6A 4BJ5C 3QYFA 2ZTGA 3ZRGA 4OWRB 4F91B 3FBIB 3GVLA 1AIRA 2Z2SB 3OYEA 1X1DA 2LRDA 2V9KA 2LBFB 3K10A 3VSVA 4TKOB 2IGMA 3BC9A 1D1BA 1MNEA 3T56B 3T51B 2WZPP 2IS1A 3OYJA 3VSKA 1Y56A 3TL4X 1WJEA 3EUHC 2O5RA 2HVRA 4NQWB 1E43A 4KKSA 2WB1A 3M8JA 1COWA 2CK3A 4Z05A 2CV1A 3PNYA 3PJRA 3RTRA 2VJJA 4AYBA 2X1CA 3HC7A 3OAAA 2L9SA 1JTAA 4E7KA 2M0MA 1EA3A 2Z8GA 3H5NA 4R79A 2HZDA 3VYSB 1MMDA 4ZDOA 3B8YA 3SYTA 3H5RA 3BH4A 4CCMA 5C1EA 2O1DA 2HDWA 2V4JC 4BJTA 4GQNA 3K4MA 1EE6A 3W2WA 3T9GA 1KONA 1OGMX 4OZZA 1V0FA 4BE2A 3MKYB 3FKJA 3OR2C 1D1CA 3DDYA 2INUA 2DJIA 1X0CA 2KMUA 4W8RA 2R7RA 1H80A 2CV2A 2WBMA 4W8QA 4XOTA 3ZPNA 4JOMA 1T0FC 2RNGA 3OYCA 1RMGA 1OFMA 3W3CA 1PYVA 4E4HA 5LFAA 3CJQB 1NRKA 1WJ5A 4KISA 1V5FA 4Z03A 3VYRB 4BEHA 1ERDA 1V5EA 3T53B 3D5LA 3OS1A 3RQ4A 1BR4A 3DPLC 2XZLA 2CFOA 3EQOA 2WSSA 2VASA 3DU6A 1BOBA 1HZEA 2Q1ZB 3M1CA 1OFLA 2JSPA 4BDYA 1O8MA 3LSMA 2KZVA 3DU5A 4CH7A 2WJVA 2PYHA 2XZOA 1G59A 2IXSA 2O04A 4P1WA 4DIQA 2VQHA 3N05A 4CA0A 4DBRA 2BW3B 3W2AA 4OAYA 1T5EA 3LSHA 2WA0A 2QE7A 2X6XA 2BOLA 4RM3A 1YE9A 3MD2A 2CW8A 2HNHA 4W8TA 3VYTB 4RLQA 1KMHA 2CUZA 3DKYA 2VPLA 4F3QA 2VKHA 4CCKA 2W7NA 2CV0A 3L2VA 2LYCA 1GQ8A 2WY7Q 1D1AA 1PXZA 4U49A 1DQUA 3BCFA 1EFRA 2MFZA 3A4CA 1S9HA 1W0JA 2RQQA 1WJBA 2X85A 3KRGA 1BHEA 2WAQA 2ODLA 1G8XA 3FBNB 3DPTA 2KPMA 2HPIA 3NWSA 4XN0A 4IQJA 1O8FA 4B3FX 4U4BA 1WJAA 1UG0A 4XR6A 2VQGA 5LD2C 1D0ZA 4KKUA 3C2GA 4RLFA 3ZQQA 4D9JA 4G7WA 1JRGA 2NSPA 3LSIA 1QHHD 3OOUA 4IZZA 4C2TA 3G2BA 3HPHA 4C2LA 4TSFA 1MMAA 1X1AA 1K28D 3LMWA 3OYBA 4NC7A 4HIZA 4NK8A 3HUGB 1OHHA 3OYMA 3OEEA 5AMVA 4BQQA 3OS0A 2X1DA 3BG7A 3SEZA 2JA2A 2L2OA 2ZXHA 1IB4A 4CZCA 4YZ0A 4OAZA 2LC2A 2V7QA 3HOTA 1WJFA 1SAUA 1QJVA 2M7BA 1VLYA 4YZXA 2ZZGA 4HRIA 2UV1A 2WADA 2LG4A 3DEEA 2INVA 2R9VA 4E7IA 4MR0A 2GOXB 2LREA 3VWBA 4ZYAA 1VF7A 4BDZA 1IA5A 2VQLA 4E0FA 1HVXA 2WAFA 2VJ5A 1QCXA 2PYGA 4AVZA 3H9GA 2E1MB 5HOOA 3GVKA 4HG2A 3EPZA 3PNVA 2LOOA 1MW7A 3OEHA 3WQZA 4HEA2 3OYAA 3RCOA 5KNLA 3MKWB 2E1MC 2JIZA 1O8HA 4BQOA 2DT6A 5HNHA 3EUAA 3LFUA 4PFOA 2R7SA 4NK6A 5KHDA 3OYIA 1DGWY 3SEQA 3OMYA 1H8HA 2FUG2 3BCAA 4FXUA 4FASD 1BLIA 3K6GA 3VR6A 4NC8A 3EUKL 4U87A 5IK2A 2R7OA 3AKZA 3IUOA 4XLAA 4RM2A 3FPPA 2X51A 3AL0C 2CMPA 2QKMB 2XDVA 4II2A 2KDOA 1JI8A 1FX0A 1LFPA 2F4IA 4YELA 3K70C 2JJ1A 1BR1A 3H5AA 4PSXA 3B90A 2K9LA 1PJRA 2M5SA 2DCEA 3HKZA 4II3A 3L2QA 2PJRB 4YZAA 1E3ZA 2GJKA 2Z6BD 2VL8A 1RU4A 3SUCA 4BGDA 2JUGA 3GRHA 3LMMA 2R7WA 4B3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZY A;  3UW0 A;  5C1C A;  2O04 A;  2NT9 A;  1O8L A;  4XMY A;  4XKW A;  4URR A;  1IDK A;  3JUR A;  3VST A;  4OJ6 A;  2NT6 A;  1DBG A;  2X6X A;  2NTP A;  4XOR A;  1WMR A;  1VBL A;  4W8T A;  1KTW A;  4Z06 A;  4XLH A;  1O8D A;  4HWV A;  4XLC A;  1GQ8 A;  1PXZ A;  4U49 A;  2NZM A;  1KCC A;  3GQ9 A;  2VBM A;  2BSP A;  4PMH A;  2UVF A;  2X85 A;  1O88 A;  4XQF A;  3GQ8 A;  1BHE A;  3KRG A;  3VMV A;  1O8I A;  3GQ7 A;  4OJL A;  1CZF A;  2ODL A;  1O8F A;  2QY1 A;  4XLF A;  4XN0 A;  1O8K A;  1OOC A;  4U4B A;  4XR6 A;  4MXN A;  2NSP A;  1JRG A;  1XG2 A;  4OJO A;  2VJI A;  1O8G A;  1AIR A;  2X6W A;  4C2L A;  3ZSC A;  3LMW A;  3VSV A;  3EQN A;  3WWG A;  4XN3 A;  4NK8 A;  2EWE A;  5AMV A;  4YZQ A;  1IB4 A;  2PEC A;  4YZ0 A;  2O0V A;  1QJV A;  4Z05 A;  4YZX A;  2NTQ A;  1BN8 A;  1NHC A;  2VBE A;  4MR0 A;  2INV A;  2VJJ A;  3GQA A;  4XL9 A;  2QX3 A;  1JTA A;  1IA5 A;  3VSU A;  4XKV A;  2Z8G A;  2PYG A;  1QCX A;  1DBO A;  4AVZ A;  3ZPP A;  3B8Y A;  4OJ5 A;  4XOP A;  4YEJ A;  1O8H A;  5C1E A;  2NTB A;  2O1D A;  1KCD A;  2NST A;  4NK6 A;  1EE6 A;  1OGO X;  1RWR A;  3T9G A;  4OZZ A;  1OGM X;  1PE9 A;  1IDJ A;  2INU A;  2QXZ A;  1X0C A;  4W8R A;  1K5C A;  1H80 A;  4W8Q A;  4XOT A;  3VMW A;  4W8S A;  4XLA A;  2IQ7 A;  1RMG A;  1OFM A;  4OJP A;  3B4N A;  4YEL A;  2VBK A;  2X3H A;  3B90 A;  4XNF A;  1O8E A;  4XON A;  2X6Y A;  4XM3 A;  1O8J A;  1PLU A;  4Z03 A;  4YZA A;  4XLE A;  1RU4 A;  4EW9 A;  3SUC A;  4I84 A;  3FY3 A;  3EQO A;  2O0W A;  2UVE A;  2O17 A;  1HG8 A;  1OFL A;  3GRH A;  1O8M A;  2PYH A; 
#chains in the Genus database with same CATH topology
 5AIQ A;  1T2K A;  3JRF A;  2CGP A;  3ASR A;  4WK8 F;  3A01 B;  3RSN A;  1WJC A;  5C1C A;  4EJV A;  4EVI A;  5H2F C;  1LVA A;  4WF2 A;  5TGT A;  5M5W J;  2DA6 A;  9ANT A;  2ZBV A;  1DAB A;  1R1V A;  1I3Q J;  2ESH A;  2D3L A;  1MDM B;  4HNV A;  1OIS A;  2GIV A;  3PNT A;  4LBY A;  2YR2 A;  5FRO A;  3HAG A;  3E1S A;  2GIZ A;  3W5H A;  1YQA A;  3VOD A;  4G7O F;  3LNN A;  2DK8 A;  5FKL A;  1VQ8 I;  2PQ8 A;  3OE7 A;  5IYN A;  4G6I A;  4MHG A;  5IYP A;  1KTW A;  1LFB A;  3WTU C;  3ECO A;  4HZF A;  5B1A H;  2E34 A;  4L5E A;  3OYD A;  4XLC A;  3IRR A;  2HU9 A;  2Q2E B;  4UB6 C;  2DYI A;  5D5X B;  3S3N A;  2EZL A;  3KYD B;  1PP8 F;  2K9M A;  4BEH B;  4Q4Z F;  1PP7 U;  2KIQ A;  3H92 A;  2KJC A;  2VXZ A;  1S4M A;  5FL7 A;  1B9M A;  3KPH A;  1XE1 A;  2BM7 A;  5LEJ A;  4MFE A;  2M1B A;  3V7R A;  1U2W A;  2MC3 A;  2V4D A;  3S3M A;  4X7F A;  2OTL B;  3U2Q A;  2QBY A;  1X4P A;  2AHQ A;  2NVY J;  5D8K B;  3OYF A;  1O8G A;  2EIJ H;  2HQA A;  1TYV A;  3JRC A;  3R6S A;  3SJM A;  2MD0 A;  4PC2 A;  2JA5 J;  1LDK B;  3GFM A;  3EQN A;  1J0R A;  1J9Z A;  4DQ2 A;  4F55 A;  1Y0R A;  1BC7 C;  5CLS A;  4BXX J;  4YZQ A;  1JTX A;  4G6D A;  1FRQ A;  2J8I A;  5E17 F;  3DFG A;  4D5F A;  1VQN B;  5GTI C;  3GTP J;  4ENJ A;  2LF8 A;  1SAX A;  3JSO A;  2VFP A;  1BN8 A;  2BBY A;  2VBE A;  1ETW A;  2VOP A;  1STZ A;  3BY2 A;  4E7H A;  2Q6K A;  3LYC A;  3CC7 I;  5E3O A;  1TVC A;  4A93 J;  1QZZ A;  2QX3 A;  4AF6 A;  2CG4 A;  5E1X A;  1W7P D;  5ILV A;  1D3Y A;  1DG1 G;  3VSU A;  2FNP A;  2R4G A;  3GF2 A;  5E3L A;  3E6B A;  2PBI A;  3ZOB A;  5DM7 F;  1SD4 A;  3BTL A;  1E0E A;  2XC1 A;  1RIO H;  3GEZ A;  5D6E A;  2C5B A;  4DNC A;  2QF7 A;  2XC7 A;  1H8A C;  3CW2 A;  4XIC A;  2EPF A;  3CD6 B;  3ABM H;  3F9K A;  3ZXS A;  4KA4 A;  3QFT A;  2OBR A;  2Q2E A;  3LSK A;  2E2I J;  2HI3 A;  1N0V C;  3WBK A;  2YS9 A;  5DDG A;  2V9P A;  1FT9 A;  1QVT A;  4RDL A;  1OGO X;  1P92 A;  2EIM H;  1XG1 A;  4RM0 A;  3IAM 2;  5JLX A;  2OQR A;  2VE9 A;  2B0R A;  4XKC A;  1WI9 A;  3I54 A;  5J3L A;  1HC8 A;  3SJP A;  5HKK A;  2ZFU A;  1W7P B;  1ZGW A;  3JCU C;  4YEI A;  3E20 A;  4U7B A;  1K8F A;  3E5X A;  2JPC A;  3QP5 A;  4LLN A;  1QU3 A;  2F3L A;  1O7F A;  3S8P A;  2VNK A;  5D8L B;  1YRN B;  4DJA A;  1I18 A;  2X3H A;  1OR7 C;  3M8F A;  2X6Y A;  2YU9 J;  3ZUG A;  3E0J B;  2UXN A;  4XLE A;  3K9T A;  3VO2 A;  4B48 A;  3GX4 X;  2EH3 A;  4BS9 A;  1UD5 A;  1X1B A;  2JMW A;  2JWT A;  2DAO A;  1ZG1 A;  4KDP A;  1S8N A;  4M6Y A;  4Y3O A;  1TBX A;  2QGU A;  4HST A;  5FRM A;  3BZC A;  1TWC J;  3ML6 A;  2EZI A;  5CPR B;  4DBQ A;  3LA3 A;  1BJK A;  2F1M A;  2BPO A;  2KRC A;  2LY2 A;  1XCV A;  3CCU I;  4HDV A;  1WPK A;  4ENM A;  3Q5F A;  4W8R A;  1Z21 A;  3FIS A;  1YW8 A;  3S15 J;  3FXM A;  3JRE A;  3BR3 A;  4L9J A;  1XGN A;  3UNG C;  4B4C A;  1JT6 A;  2BMW A;  2FE3 A;  2XF7 A;  2XT4 A;  3SLD A;  4L9V A;  1LLW A;  2VZL A;  1FP2 A;  1N0U A;  1MMG A;  1IJW C;  1YIT I;  1EP3 B;  2DQL A;  1JUM A;  3C18 A;  4ITV A;  1O8D A;  1TYX A;  4HWV A;  2ZC2 A;  4LIU A;  1FNN A;  4CCJ A;  4OMZ A;  5EZH A;  5LRR A;  4A3L J;  1MD0 A;  2F1L A;  2E5Z A;  3J7A O;  3E6M A;  1K4T A;  1JB9 A;  3GTQ J;  3E7L A;  2X6O A;  4UUS A;  2GBY A;  1G4D A;  2X0L A;  5B1B H;  4C3I J;  3OY9 A;  4M4S A;  4KT5 C;  4RAY A;  2HDD A;  2W6J A;  3HSR A;  4MO7 A;  4ZYH A;  1B59 A;  1WPC A;  3AST A;  1K6Y A;  2OJE D;  2DOG A;  2XAF A;  3G6E I;  2DDA A;  4UUT A;  3RZO J;  2W25 A;  5IP7 J;  3A0B C;  2F43 A;  3TO7 A;  3SXY A;  4QLC U;  4KIB A;  5GPA A;  4PAB A;  3F6O A;  4WZT A;  5FO1 A;  4ZCI A;  3BDD A;  1ETV A;  2DMU A;  2VT3 A;  1E2X A;  2GOM A;  4KT6 A;  1Z6R A;  3BCD A;  2ETH A;  1I6X A;  3BG9 A;  1Z7L A;  1HA8 A;  2IGN A;  2ZB9 A;  3BQY A;  2ZXI A;  5CVU A;  1Y6I A;  3WG9 A;  3ULQ B;  2YX7 A;  5B6I A;  4X07 A;  4ZDL A;  1U8B A;  4LBZ A;  5L3B A;  1BN5 A;  4QHY A;  3ZQG A;  1YI2 B;  2BGC A;  4A3G J;  1FEX A;  4I7H A;  1DDG A;  4WCG A;  5CVV A;  2B7B A;  4KH3 A;  4QVA A;  4WQM A;  1Q7Y D;  1X2M A;  1YYV A;  2Q0O A;  2H27 A;  4ENN A;  3E3V A;  2Y48 A;  3BCB A;  3BG3 A;  1ZLJ A;  3OWT A;  1XGS A;  1W36 D;  1WZ2 A;  4YEJ A;  3ESW B;  4PJN A;  4A69 C;  3NE5 B;  3CC2 I;  2AHO A;  4ZCL A;  1RI7 A;  3HEF A;  2HXO A;  3JAM K;  3OR1 C;  1I3A A;  2XAG A;  4G6T B;  1HA3 A;  3K7A J;  4RD2 A;  2NST A;  1BI1 A;  2F4O B;  2DMN A;  4MLO A;  4LB6 B;  4KMF A;  2K40 A;  3KEY A;  1RWR A;  2NOG A;  2RKH A;  3FMS A;  2GJR A;  3KE2 A;  4I0B A;  4X06 A;  3NAR A;  3CES A;  3AVU A;  2X1E A;  3MMY B;  4UXN A;  5ICC A;  1T0F A;  3VMW A;  4C9Y A;  2BW3 A;  3Q0U A;  3KYL A;  2DXI A;  4YXW A;  4Z4R A;  5A89 A;  2CFX A;  3I1F A;  2VYQ A;  4BQN A;  4P5O A;  2VXD A;  4L5I A;  3B8H A;  1O8E A;  2FJ1 A;  4XM3 A;  4G1B A;  1YIJ B;  2HQ5 A;  2ZL7 A;  5E3M A;  1CNF A;  1VQO B;  4EW9 A;  3HIF A;  2R7T A;  4Q47 A;  4DK1 A;  1HLV A;  1NB9 A;  2Z3Y A;  1TZL A;  3DKX A;  1H8E A;  3O8H A;  5FNZ A;  4JX6 A;  2IVM A;  4RB2 C;  5FB2 A;  2EBI A;  1ZKG A;  1KZH A;  4YRV A;  3VFZ A;  3KLO A;  3PL8 A;  3WTV C;  3I0T A;  1K6O A;  2L7Z A;  1FZP B;  3WHC A;  2A61 A;  2OCC H;  3SJZ A;  4ZZL A;  1G2H A;  4B44 A;  1FP1 D;  4OOI A;  4ETS A;  4IHX A;  3I4M J;  4C2U A;  2DA3 A;  4ZYD A;  3OZV A;  4E7Z A;  2DYS H;  1LKX A;  1FTZ A;  3COA C;  4OOX A;  3OYK A;  1WMR A;  2ELJ A;  4CGZ A;  1ZYR F;  3OFN A;  3BG6 A;  4JQF A;  4TV7 A;  3SLN A;  4Z06 A;  4M9Z A;  3BQZ A;  2ZJP F;  1R22 A;  3CZ6 A;  3A03 A;  3BC9 A;  3GTL J;  2QKL B;  1R9T J;  4AM3 A;  3CMM A;  3CXC B;  2OC6 A;  2E2H J;  1TT5 B;  3NWT A;  2EFN A;  4PDK A;  4PMH A;  1FPQ A;  3FKI J;  2IA2 A;  3A8J A;  3CCM I;  1YO5 C;  3RPU D;  2IRF G;  1FNM A;  2XGC A;  1TUI A;  5HZB A;  4YFO A;  4PSW A;  3H1C A;  3CUO A;  4HF0 A;  4RB0 A;  2XTX A;  2M4K A;  5BSX A;  3BC8 A;  2I8D A;  2EIN H;  5CKT A;  4HNU A;  1R58 A;  1ZTR A;  2LDU A;  3OSF A;  1U8R A;  1HF0 A;  3U6K A;  3GVL A;  4RD0 A;  3OYE A;  5F6F A;  2X4H A;  3K10 A;  1U3E M;  4LBV A;  2OAZ A;  5GP9 A;  2JSC A;  2IGM A;  1YLF A;  2Y9Y A;  1MNE A;  2FMY A;  2P8T A;  1Y39 A;  1O4X A;  3F8F A;  4C2M J;  5FD5 A;  3KIO A;  2CQK A;  4I2O A;  2IS1 A;  1WH7 A;  1WJE A;  5DCF A;  2UXX A;  2KDZ A;  1QFY A;  2CBX A;  2E1C A;  4R1H A;  2M30 A;  5KK1 A;  4RA2 A;  5J8F A;  2NVT J;  1J9I A;  1OYY A;  1E43 A;  1BL0 A;  2CK3 A;  2E7X A;  3J7Z I;  3PJR A;  2YPR A;  1KU2 A;  3CCY A;  2DO7 A;  1B6A A;  1I50 J;  2DU9 A;  1FOY A;  1KK0 A;  3ABU A;  3EQO A;  2L9S A;  1JTA A;  4OMY A;  2ZNY A;  2VI6 A;  3RY8 A;  5TR9 A;  2P6S A;  3ZP5 A;  1XB4 A;  3ASN H;  3LWF A;  4RAF A;  2ISZ A;  2EQR A;  1VHE A;  4HX4 A;  1MMD A;  1LEB A;  3B8Y A;  2HOE A;  3CCJ I;  3G1M A;  3LQR A;  5AIP A;  2RVC A;  3BH4 A;  3JRB A;  4U88 A;  2EIK H;  1QPI A;  1WDT A;  1XMX A;  2CJJ A;  4BJT A;  4YIR X;  2ISY A;  4GQN A;  3BZK A;  4RB1 A;  3GVA A;  3CO6 C;  2YX4 A;  2KJB A;  3FKJ A;  1D8K A;  2H1L A;  2EFQ A;  2X48 A;  2Y31 A;  1KQ8 A;  3DDY A;  4A5M A;  4A2U A;  4ASN A;  4EM1 A;  2KMU A;  2FF4 A;  2LVS A;  4IHV A;  1ACI A;  2OK7 A;  2QA4 B;  1X0C A;  1OCZ H;  5FLX Z;  1FDR A;  2ICW G;  4XOT A;  3ZPN A;  3B78 A;  3ZZT A;  3ZN1 A;  1W2B B;  3OYC A;  1JT0 A;  1OFM A;  2DA7 A;  1NRK A;  2YU3 A;  1VTN C;  4O6J A;  2OA4 A;  3G4S B;  4Z03 A;  3GLX A;  4A0X A;  1ERD A;  1V5E A;  3DU1 X;  3KP3 A;  3D5L A;  3L09 A;  4V19 K;  3GTG J;  3SKB A;  1DPR A;  3QAH A;  1O57 A;  2A68 F;  3A02 A;  3DPL C;  3LQ6 A;  1OFE A;  1L3L A;  2VAS A;  3DU6 A;  1BOB A;  1HZE A;  3SQN A;  3RQI A;  2HR3 A;  3FF5 A;  2V1X A;  4QFM A;  4HQM A;  4CH7 A;  1G59 A;  1V5V A;  5D4R A;  1T6S A;  3RYR A;  1LNW A;  3BOQ A;  3DEU A;  1R36 A;  4DIQ A;  1X3U A;  1GV5 A;  3BWG A;  2VQH A;  4DBR A;  1TLL A;  1UHS A;  2BW3 B;  3FM3 A;  4DW6 A;  3W2A A;  1T5E A;  5F4O A;  5EF6 A;  3KCC A;  3ZQL A;  1NDH A;  3W2H A;  3AG1 H;  1XS9 A;  3P9K A;  3UKG A;  1ZRE A;  2CW8 A;  3LOC A;  3BPX A;  1FBS A;  2P5K A;  2FNA A;  3CJT B;  1S72 I;  2CUZ A;  2VPL A;  1YLO A;  2W7N A;  3L2V A;  4LG0 B;  1W35 A;  1JGS A;  2WY7 Q;  2OPT A;  1YRN A;  1PXZ A;  2PEX A;  5GV8 A;  1M1K D;  3CCJ B;  3FK7 A;  1WJB A;  3F3X A;  3ERM A;  3JRH A;  1AHD P;  1GR1 A;  4L18 B;  2LTP A;  5FIU A;  1YJN B;  2ODL A;  3VNU A;  3J80 K;  4QTR A;  5J35 A;  5DS0 A;  2LD5 A;  4KKU A;  2NSP A;  3EYY A;  3LSI A;  3OOU A;  4IZZ A;  4C2T A;  4IOA F;  5M5X J;  1N07 A;  3G2B A;  3BR5 A;  2XGX A;  1HOM A;  1MRZ A;  3JRA A;  3S17 J;  1EXM A;  3OYB A;  1O3R A;  5DYM A;  1O3Q A;  2Z5U A;  1D8J A;  3NB2 A;  1XCB A;  2ZXH A;  3CCE I;  2LSO A;  3HSF A;  1LPQ A;  5FJ8 J;  1R71 A;  2LC2 A;  1TLH B;  2V7Q A;  1V54 H;  1SAU A;  3GZ6 A;  1QJV A;  1VQL I;  1WSR A;  4YZX A;  4HRI A;  5H6R A;  1PUE E;  4PGH A;  3AVW A;  2V6C A;  1ZR4 A;  4GXO A;  4ZYA A;  2V7W A;  3PSS A;  2DTZ A;  1IA5 A;  2VQL A;  2VON A;  2WAF A;  2VJ5 A;  2Z9O A;  4AVZ A;  3IKV A;  2OBS A;  4KKS A;  3MZH A;  3B6A A;  2ZL6 A;  5DUI A;  3PA2 A;  3PNV A;  2IW5 A;  3OEH A;  4BPR A;  5KNL A;  3MKW B;  1O8H A;  2ZBU A;  1WHU A;  2VN2 A;  5KAF C;  1F36 A;  4CZZ A;  2NS8 A;  3EUA A;  4P3Y A;  2XAJ A;  3A01 A;  2BM1 A;  1TQM A;  3DCF A;  2Y0M A;  1UZC A;  3OYI A;  4RPB A;  3FIW A;  1V4R A;  1Z9C A;  1BI2 A;  1DGW Y;  3SEQ A;  3CME B;  2ZFW A;  5IYQ A;  4L0Z B;  1JUS A;  3FK6 A;  1CGP A;  1J5Y A;  5M3M J;  4NC8 A;  4Q7J B;  1BOA A;  1LDJ A;  3EUK L;  2NRA C;  2DEU A;  3AKZ A;  2M34 A;  2XB0 X;  2FOW A;  4DYQ A;  5LGT A;  1JNY A;  3W6J B;  3FPP A;  4RDK A;  3AL0 C;  1GDT A;  2KDO A;  4NB5 A;  1QPM A;  2F4I A;  3HB9 A;  5KW9 A;  3K70 C;  3B90 A;  2E19 A;  4M2L A;  1ITY A;  2I5U A;  2DCE A;  2DK5 A;  2ECB A;  4GGG A;  4QSH A;  1K83 J;  3ECH A;  2L01 A;  1ENH A;  1N25 A;  2JT1 A;  5EEA A;  1H0M A;  4Z4T A;  4P26 A;  4LB5 A;  2I10 A;  1OFC X;  4Z4S A;  2R7W A;  4ZDO A;  2FOK A;  1WTH D;  3HOW J;  1I6H J;  1ULY A;  5KCM A;  1A6Q A;  1R23 A;  2ESN A;  2QQA A;  5KAI C;  2QTZ A;  1O8L A;  4R8H A;  4ESB A;  4L9N A;  1DU0 A;  1XSV A;  2P4W A;  2Y69 H;  2P81 A;  1EWY A;  3K69 A;  4D7M A;  2NS7 A;  3QPH A;  2NTP A;  1BX1 A;  3PA1 A;  2R7X A;  5IT9 Z;  5FRN A;  3AG4 H;  1MAB A;  3U21 A;  2BVL A;  1MND A;  5EGO A;  2NVX J;  2M2E A;  3RYP A;  1UHW A;  2XND A;  2M0C A;  2O0Y A;  5CVJ A;  5TRD A;  2E60 A;  4ESJ A;  1O8I A;  5FA6 A;  1KK2 A;  2VC0 A;  1SFE A;  3OYG A;  3GQ7 A;  2KZG A;  2HYG D;  4KIG A;  3KL9 A;  4S05 A;  4Y33 A;  4ACA A;  4PFP A;  2IOU G;  1ETK A;  3PQK A;  2QSG X;  1M90 D;  2VLA A;  5IYD J;  1RKT A;  4NBQ A;  1QNT A;  1TSP A;  4MXN A;  3D5S C;  3K2Z A;  2CH0 A;  5FKN A;  4OIQ F;  3D26 A;  3F0C A;  3HGY A;  1HCR A;  1OYW A;  3L2R A;  1N77 A;  2K3F A;  3V42 A;  1SFK A;  3CD6 I;  2VFQ A;  2ZBK A;  2O8X A;  2ZTN A;  4XN3 A;  3CCR I;  2ELH A;  5E1Z B;  3A2K A;  2XAU A;  3S1R J;  3F8B A;  3G1L A;  4Q48 A;  3HOY J;  4HV5 A;  3PFY A;  3VPR A;  3TED A;  3ZZU A;  1UAA A;  4XD7 A;  5C44 J;  4DGW B;  3I71 A;  1FSE A;  3CMA I;  4OIN F;  2E1O A;  2OZU A;  5J4V A;  3K70 D;  2XF6 A;  4IKF A;  2XOK A;  2D1V A;  3GCM A;  3BH7 B;  2KRF A;  3FHZ A;  1FOX A;  2CS3 A;  4X8I A;  2CND A;  2EFP A;  1DBO A;  5M3F J;  5BS6 A;  1JXS A;  2HDN B;  1IXR C;  5AON A;  1K61 A;  2NOJ B;  2COB A;  4LIV A;  2CUE A;  1QG0 A;  1P7I A;  2LF7 A;  1EFT A;  1RR8 C;  1RPW A;  2VNJ A;  4X05 A;  3K1P A;  4HLX A;  3IL2 A;  2W24 A;  3QOP A;  1YFH A;  3AK5 A;  2ZME B;  5J47 A;  3C7J A;  4C3J J;  1A6I A;  3QOE A;  1W0K A;  3OIQ A;  4KFC A;  1N75 A;  4NC6 A;  2W7Z A;  5IY5 H;  4Q5S F;  1UD3 A;  1PE9 A;  1J75 A;  1KRH A;  1WSV A;  4DNT B;  3LSJ A;  4HDU A;  4GCV A;  4PCQ A;  1IDJ A;  2X8K A;  1LE8 B;  2EWN A;  1VQP B;  3CF2 A;  2R7Q A;  2IQ7 A;  3NEU A;  5F4M A;  5LMZ A;  2O9L A;  1MJ9 A;  3TBI A;  5EGO B;  1ZRD A;  4OJP A;  3MWM A;  4G94 A;  5IPA A;  1RC9 A;  3L2U A;  1DGR M;  3FMQ A;  1BA5 A;  2BE5 F;  1WVR A;  1T95 A;  4WZK A;  3TH0 A;  3EDP A;  3FKS A;  1KQ5 A;  2HQN A;  2Z16 A;  4X1E A;  2DQR A;  4E70 A;  2XEX A;  2VB6 A;  3QYB A;  4RPD A;  1QGA A;  2EZK A;  4LGW A;  2DFE A;  1S7O A;  3PVD A;  2VJ4 A;  3KP5 A;  1KD1 D;  3MAJ A;  2Z33 A;  3P9I A;  1P9Q C;  3EUH A;  3W2V A;  3Q9S A;  4N4O B;  3M9A A;  2EA2 A;  2KQR A;  4S04 A;  3ONQ A;  3IHU A;  2A07 F;  1FLI A;  4M3F A;  1FC3 A;  1KU9 A;  5HS9 A;  2NVQ J;  2WJY A;  3VEP A;  1VQ8 B;  3QRF F;  3CCV B;  1Q9S A;  1DBG A;  3CLQ A;  4HX7 A;  4ON0 A;  2VUM J;  4IQ4 A;  1DP3 A;  2G7U A;  3C2B A;  3F8C A;  2WYR A;  1VQ5 B;  4CCO A;  3BLY A;  3DPU A;  2XAQ A;  1QBJ A;  3SZP A;  1TQP A;  4UY8 I;  4YCQ A;  4FE7 A;  1R5H A;  4DQL A;  1V0E A;  3CC4 I;  1JTY A;  3HTU A;  2ID3 A;  1TWF J;  4BAC A;  2OV7 A;  1GXP A;  3FMR A;  3LSP A;  4PJ0 C;  2OYN A;  3X2Q H;  2FX0 A;  3WGH A;  1FWZ A;  2BHY A;  2HVQ A;  1YHQ I;  2GK7 A;  3CCL I;  1Z3X A;  1JJ2 B;  3FXK A;  1NG6 A;  2VKD A;  3K4L A;  4J00 A;  2ZKZ A;  1E1R A;  4P3I A;  2G0Y A;  1BBY A;  2Y30 A;  4H4K C;  1A35 A;  5F0F A;  3H0D A;  1XTA A;  4L8J A;  2JRM A;  3V7A A;  1Z6T A;  4JRA C;  2DY1 A;  1T56 A;  5FLV A;  1HW1 A;  5GAE J;  3LSR A;  3J81 Z;  1HF2 A;  3CMA B;  4BE1 A;  2MH9 A;  1DPU A;  1VZ0 A;  2CQ7 A;  3ZCO A;  2YWF A;  4RGS A;  3WGG A;  3A8I A;  3PSF A;  2PEC A;  4RS8 A;  2WPD A;  4UUV A;  2FBH A;  1OPC A;  2LZJ A;  2V1N A;  4BE0 A;  3I9V 2;  2WC2 A;  1OMI A;  2CW0 F;  1WSU A;  2HDC A;  2W00 A;  4AWX B;  3G3Z A;  3K1M A;  3HL2 A;  1SKQ A;  2HOT A;  2MLG A;  1U2R A;  1D0X A;  1TNS A;  2V79 A;  2KFD A;  2KLO A;  2L4M A;  4PZJ A;  3KET A;  4JK1 X;  5E79 C;  2EIX A;  3ZPP A;  2J5P A;  2XGJ A;  5J3O A;  2J8K A;  1ON1 A;  2P6T A;  5F64 A;  3K4B A;  4EQQ A;  1IC8 A;  1CF7 B;  1DAR A;  1VJS A;  4IW3 B;  3CUQ A;  5FGM A;  2CUJ A;  1E63 A;  2D3N A;  3ASO H;  4M74 A;  5LEK A;  3T1B A;  5JVT A;  1TP4 A;  1KCD A;  2HTS A;  2WY8 Q;  4H0E A;  4MTD A;  1XPX A;  3NAW A;  1YJW I;  4TMW A;  5FO0 A;  6PAX A;  4OPV A;  5FO5 A;  4CYC A;  1UMK A;  3GXO A;  2BHZ A;  2E5N A;  2X0K A;  4N4N B;  5ILS A;  2XPV A;  1OLT A;  5L46 A;  2E7W A;  4EAT A;  1K5C A;  1G7C A;  1OB0 A;  2GWR A;  1QA1 A;  3HXL A;  1U9O A;  1KK1 A;  2QYU A;  2VNH A;  2L3D A;  2RC4 A;  4LLL A;  3RKX A;  1YW7 A;  3RPQ A;  2VPR A;  5K7F A;  4G6Q A;  1O8J A;  1X1C A;  3W5U A;  2M7A A;  4BYY A;  4PUS A;  4IO9 F;  2HVS A;  1WQ2 A;  1Z0X A;  3I3L A;  5FLX K;  1AKH A;  5HDN A;  3H3V K;  2J7K A;  2O0W A;  4YG2 F;  3HBL A;  2XIG A;  1ELO A;  3HDD A;  3V8L A;  1ZM3 A;  3IH3 A;  3PQJ A;  4XRM A;  3QPT A;  3PEN A;  2DA2 A;  3OJW A;  4OZY A;  5DV5 A;  3H9J A;  3WTT C;  5FKM A;  3WOD F;  3MKL A;  2HZT A;  4D7N A;  1S7A A;  5L3D A;  1XB2 A;  1IDK A;  1E64 A;  1JA1 A;  3FXL A;  2IGK A;  2BYV E;  1ZG5 A;  1WOO A;  3KZZ A;  5F08 A;  1J09 A;  2KT0 A;  3HKZ N;  1ZGJ A;  2FX3 A;  4JBA A;  3J7A Y;  3ZZ0 A;  4DNR B;  3BP8 A;  4BBR J;  1LFU P;  2N8G A;  4Z2Y A;  3MKZ A;  3BJA A;  4E7J A;  1VQK I;  1IN4 A;  4YAO A;  2P0W A;  3JU4 A;  4ZCM A;  1O7L A;  2QCO A;  3GQB A;  3CTA A;  2FRH A;  4B47 A;  3H0G J;  2DIE A;  3OP1 A;  2BSP A;  3BR0 A;  1PJ6 A;  2C2W A;  3WXM A;  3CCU B;  2YWH A;  3E1Y E;  2K9S A;  3DBL B;  4F92 B;  3S93 A;  2ZSI B;  5F4J A;  4RJL A;  1CZF A;  1CF7 A;  2HCJ B;  1W1W E;  1TT0 A;  4BJ5 C;  4OWR B;  3HRT A;  4F91 B;  3QPL A;  2RGV A;  3FBI B;  1VQ4 I;  2GXA A;  2H8W A;  1R5G A;  1VQN I;  4YDT A;  1G3W A;  1W7P A;  2CQX A;  3GTM J;  5H59 A;  3VSV A;  2OK8 A;  1ETO A;  1FYL A;  2F48 A;  2QEX B;  2WZP P;  2HGC A;  3D1N I;  1JKR C;  4ROX A;  3TL4 X;  5AN9 A;  4D5C A;  2O5R A;  1QFJ A;  2BY0 A;  3W6V A;  1ZLK A;  4FCY A;  3RTR A;  4HOB A;  3U6B A;  1KQ0 A;  2VJJ A;  2B9S A;  1FY7 A;  3GME A;  3S2D J;  1XD7 A;  4IRG A;  1VQM B;  1BIB A;  3TGN A;  4EH1 A;  1HXD A;  2XRN A;  3H5N A;  4R79 A;  1TC3 C;  3WU0 A;  4KN4 X;  3HHH A;  4W97 A;  4BHC A;  5JI6 A;  2K27 A;  3SYT A;  4CCM A;  2XKP A;  3BR1 A;  5J6X A;  4XID A;  2V4J C;  2HKO A;  3RKY A;  1XFO A;  4I0A A;  2M9H A;  2LKS A;  2H1K A;  1J59 A;  2V7U A;  4Y52 J;  3W2W A;  1R1T A;  2HQR A;  1OGM X;  3HRM A;  2RAE A;  3MKY B;  3GFL A;  2INU A;  1SMY F;  1YS6 A;  3AG2 H;  2VNI A;  1ZM4 A;  2WBM A;  4W8Q A;  3JTH A;  1CQX A;  2R7F A;  5F04 A;  1QGZ A;  2JRT A;  1T0F C;  3W3C A;  1PYV A;  5HDK A;  5LFA A;  1QVF B;  1R49 A;  1BW6 A;  1A5J A;  3E5U A;  4U0W A;  1WKM A;  3WND A;  1B9N A;  1FOW A;  4ACB A;  3VYR B;  2CQQ A;  3K0L A;  4BEH A;  2BY1 A;  2TDX A;  3AVY A;  3OS1 A;  4K2E A;  2RC5 A;  3G71 B;  1HQC A;  3OJX A;  1VQ4 B;  4U0V A;  1Z77 A;  1NHA A;  3TO9 A;  4ZH4 F;  3S1M J;  2BV3 A;  3ZBT A;  2ZIT A;  3TP3 A;  5J4Y A;  3DU5 A;  2JQ7 A;  2WJV A;  1VQ9 B;  2JK3 A;  3ZMV A;  3CMY A;  3KZI C;  5J1U A;  4UB8 C;  2IXS A;  3P9C A;  2EFO A;  3N4M A;  1F5T A;  4P1W A;  5H6Q A;  1JJ8 C;  4QIW N;  5J1Y A;  2O03 A;  4I6Z A;  4F7D A;  4OAY A;  2XKO A;  1REP C;  3LSH A;  2OCE A;  3WTY C;  2DPD A;  2QE7 A;  1WU8 A;  1G3Y A;  2C4T A;  1T98 A;  2D2W A;  1TNT A;  5IOZ A;  1TWA J;  1YE9 A;  1ZAO A;  2L02 A;  3QWL A;  2MH2 A;  4NBS A;  3MZ8 A;  2BGJ A;  2BZT A;  3I56 B;  4W8T A;  3SYJ A;  1KMH A;  3ABL H;  1M1E B;  3DKY A;  3ZQH A;  2VKH A;  3J81 K;  5TV2 A;  1GQ8 A;  1D1A A;  4HQE A;  1H89 C;  3BCF A;  1S9H A;  3RPU A;  4FE4 A;  1MSE C;  4C43 A;  2X85 A;  3FXQ A;  3KRG A;  1MIJ A;  2DDB A;  1ZUN B;  3ROU A;  3FBN B;  1EH6 A;  3IH4 A;  2KPM A;  2QTL A;  3CCS B;  1O8F A;  1QQ1 A;  4B3F X;  3SHF A;  1UG0 A;  4XR6 A;  5HOD A;  4BHB A;  1YIO A;  3AAF A;  5LD2 C;  3ZQQ A;  4D9J A;  4KNY A;  1Z1D A;  4AID A;  2A05 A;  1GO2 A;  4P6Y A;  3GFJ A;  3HPH A;  3G73 A;  4M3B A;  3PO2 J;  1T6Y A;  1IHM A;  3ZPL A;  4JX5 A;  4C2L A;  2DA4 A;  1BJZ A;  1MBG A;  1A04 A;  1X1A A;  1D1N A;  3W2F A;  3LAJ A;  1FBQ A;  2IA1 A;  4IOC F;  4HIZ A;  3HUG B;  3WE3 A;  5AMV A;  2X1D A;  3BG7 A;  4RLZ A;  2DA5 A;  3JQQ A;  3H3U A;  1IB4 A;  1OCO H;  4CZC A;  5K5R A;  1IV6 A;  1F20 A;  4WZL A;  4YZ0 A;  2F4N A;  2QGG A;  3HOT A;  3BQJ A;  4RGU A;  2VE8 A;  3NAU A;  1JHH A;  1IN7 A;  3AVX A;  5F1J A;  2K86 A;  3DEE A;  3R0A A;  1ZAR A;  3G71 I;  2L9R A;  2ELK A;  2GA1 A;  2XSD C;  3F8N A;  3VWB A;  1OGI A;  4P9S A;  1YJW B;  4CXF A;  1HVX A;  2PYG A;  1I39 A;  2K02 A;  4UVA A;  4AIJ A;  1VQ7 B;  4G7Z F;  2OQG A;  3VOE A;  1K8A D;  2LNB A;  1KC8 D;  3WQZ A;  4LMY A;  4FQG A;  1QA6 A;  1EH7 A;  3N6Z A;  3N97 A;  2QEN A;  1KJZ A;  4EGY A;  2R5Z A;  2R7S A;  2JUC A;  2PFB A;  2YUS A;  5LGN A;  1Q1V A;  4A0Y A;  3OMY A;  2EK5 A;  1H8H A;  4FXU A;  5JLV C;  3VR6 A;  3TW6 A;  3JW4 A;  3H36 A;  5DNS A;  2TRT A;  3M3Y J;  4U87 A;  2R7O A;  3SFZ A;  3SY2 A;  2GZW A;  3OZW A;  5JLW A;  2J5O A;  4RM2 A;  1VHO A;  4UZU A;  4II2 A;  1WXR A;  2XDV A;  1FX0 A;  1B4A A;  2C6Y A;  3U1K A;  2JJ1 A;  1BR1 A;  3H5A A;  2ZXW H;  2YSR A;  1MNM C;  1KU7 A;  2M5S A;  4DZP A;  1Y0N A;  4II3 A;  4J19 A;  1K9M D;  4YZA A;  5M5Y J;  5FD6 A;  2O3F A;  3BG5 A;  1QRY A;  1LDD A;  1P7J A;  2B63 J;  4FX4 A;  1XQB A;  2EV5 A;  2DJN A;  4M72 A;  1KTV A;  3GLL A;  1QZY A;  4B09 A;  5LRS A;  2JA7 J;  3MHP A;  1F9N A;  4YIF A;  2Y9Z A;  1G7S A;  4Y4R A;  2V1U A;  1W9X A;  2JTV A;  2Y75 A;  2L4A A;  3TW7 A;  3KEW A;  5F1R A;  1IW7 F;  1NB0 A;  2XAS A;  3FXJ A;  3HUG A;  4OJ6 A;  3CP8 A;  2ZJQ F;  2VOD A;  1YX5 A;  3JRD A;  3B73 A;  4JP0 A;  2DBB A;  1K4S A;  1D2E A;  3HRU A;  3CCM B;  1XGM A;  2P3M A;  1D0Y A;  2DOE A;  4HAM A;  1KYW A;  3BR6 A;  4PJL A;  1AU7 A;  2C77 A;  2F6C A;  3OYH A;  2V31 A;  4WX9 A;  3SZT A;  3GTK J;  1W5S A;  2KIS A;  1MMN A;  4BHP A;  1G3T A;  4IHY A;  3JSP A;  1A31 A;  3Q3S A;  3VMV A;  4UVC A;  3IRQ A;  3A1P A;  2DER A;  3D5R C;  4YFK F;  4Z4V A;  2W85 A;  4IX7 A;  3HPG A;  5DEQ A;  2QA4 I;  1U5T B;  3OL4 A;  1UHM A;  1JE8 A;  2F5V A;  3SDB A;  2VJI A;  4ESF A;  2L9V A;  2MC4 A;  2ZME A;  2X6W A;  3J81 k;  2LKX A;  1JKP C;  1YOV B;  2MAB A;  1EP1 B;  3QFC A;  5FKO A;  3WTS C;  1IB0 A;  1ZRF A;  1SD5 A;  2IT0 A;  5EEG A;  3WWG A;  1QRC A;  2WV0 A;  3OYL A;  1H85 A;  2L7M P;  3HRS A;  5DSZ A;  1IRX A;  1NG7 A;  3CJR B;  5CVR A;  2B5O A;  3HG9 A;  1L1I A;  1LE8 A;  2PJP A;  1PKV A;  2JN6 A;  2ZME C;  2TCT A;  5L3C A;  2V9V A;  4RD6 A;  2XNJ A;  4A3I J;  1YW9 A;  1GXQ A;  4CCL A;  1AKH B;  5KSW B;  1NHC A;  3QU6 A;  1HW5 A;  2GAU A;  3LL7 A;  4OPO A;  4KKT A;  3RI4 A;  1ZK8 A;  2PIA A;  2AQF A;  4PGO A;  3Q6Q A;  4ZGQ B;  3CUQ C;  2COM A;  5JR3 A;  1R4N B;  5L3E A;  5DCM A;  5DM6 F;  4UHT A;  4F93 B;  2RRE A;  2HWV A;  1OCC H;  5HS8 A;  1MJA A;  3CO7 C;  2R7U A;  1E17 A;  1JKO C;  3DTK A;  1SVL A;  4CSW A;  4FHT A;  2NTB A;  3HOX J;  2BM0 A;  4F52 A;  3W2G A;  4XKB A;  1EF4 A;  1B1B A;  4DZJ A;  1S72 B;  1R1U A;  2QM3 A;  4MGR A;  4XK4 A;  1U9N A;  1S3J A;  3ONU A;  1VQL B;  3IAS 2;  1S0U A;  4AVP A;  2FQ4 A;  3VDX A;  2XPW A;  2ID6 A;  2QXZ A;  1VLO A;  4G7X A;  1OB2 A;  1F43 A;  3VYU B;  3G1O A;  1HBX G;  2LFB A;  2OZ6 A;  2K3P A;  4G7H F;  2EA4 A;  2CW7 A;  4UV8 A;  1BC8 C;  2PX9 A;  4B4D A;  3MCZ A;  3U2R A;  5A2Q K;  2OUM A;  3C2H A;  2QQB A;  3Q0V A;  2WTE A;  3BTI A;  1I1G A;  2QDX A;  1W87 A;  4XBF A;  4LD5 A;  2D74 A;  1G6N A;  1UD8 A;  3PUN A;  3CME I;  2O17 A;  4NHJ A;  2Y0S N;  2HMA A;  4V2F A;  2DYR H;  3DKW A;  3EYI A;  2L5Q A;  4OOS A;  3CCL B;  1LM1 A;  3H94 A;  4BJ6 C;  2IBD A;  1QUE A;  4XKW A;  2DOD A;  1SFO J;  1IV8 A;  3CB4 A;  2B7E A;  5CJ9 A;  2WR8 A;  2QBY B;  4YAW A;  3ZMU A;  4ASU A;  3JUR A;  3HSE A;  4QWQ A;  1TW3 A;  1E3O C;  4X6A J;  2D1H A;  2AQE A;  2QWW A;  3IWZ A;  4A6D A;  1VBL A;  1WI3 A;  1RKW A;  2MW8 A;  4CIC A;  1B23 P;  3CCQ B;  1ZN2 A;  2QQ8 A;  3M1E A;  2R7V A;  4YAL A;  2V26 A;  3AVV A;  3LA7 A;  3D0S A;  4RAG A;  2IJL A;  1NH3 A;  3P4G A;  3GQ9 A;  4G5G A;  3OPO A;  2VBM A;  3RIR A;  2ME0 A;  1N06 A;  1FIA A;  3RZD J;  2M8E A;  2K85 A;  4WXH A;  1QVG B;  2CW5 A;  1S29 A;  1UD4 A;  2KVO A;  2BY3 A;  4BKX A;  3E97 A;  3I4P A;  1WOP A;  1RQP A;  3L7W A;  1VQO I;  2EFG A;  1O8K A;  1H9T A;  4A3M J;  1E3X A;  1OOC A;  3V8K A;  4BAY A;  3DTE A;  1SFU A;  4M73 A;  3OZU A;  3WY9 A;  3QU3 A;  1U0J A;  4DOZ A;  3KLN A;  1MKM A;  2ECC A;  3DV8 A;  4G1V A;  3ZSC A;  3AG3 H;  4CYC B;  1ETX A;  2E1B A;  2HS5 A;  3ZQ7 A;  5GPC A;  2EV0 A;  1G7T A;  3H9Q A;  4XSZ F;  1KZL A;  4E6K G;  4TT3 A;  1FNC A;  3HZJ A;  1RQR A;  2VBV A;  2V7F A;  3A8K A;  3G05 A;  3WE2 A;  2DPU A;  5J40 A;  2WB1 N;  3R4K A;  1A8P A;  1EKE A;  3F23 A;  3ZGK A;  2DFF A;  2NTQ A;  3CLO A;  2GRE A;  4BU2 A;  3GTO J;  3TDZ C;  4J01 A;  2W82 A;  3NRV A;  4PK4 A;  2LY9 A;  4C0S A;  2FQ3 A;  2IS6 A;  1W34 A;  1RUN A;  4FK8 A;  2NAZ A;  1DDN A;  4P22 A;  2KRH A;  1POG A;  1MBH A;  1IXC A;  4FET A;  3V7C A;  5TJJ A;  4HNT A;  3KYC B;  2JA6 J;  1FND A;  2MLK A;  4MQV A;  5IOY A;  1IUF A;  2VBU A;  4TMX A;  5JMC B;  4DYR A;  4M3D A;  1FJL A;  5DUK A;  1WCM J;  1YG2 A;  3AL0 B;  4X7D A;  2QZ8 A;  4C30 A;  4G12 A;  1R4M B;  1PVE A;  4OIP F;  3ISX A;  2PG4 A;  4X7C A;  2X53 S;  3IC7 A;  4MEX F;  3WTZ A;  1XDU A;  2OBP A;  2KL4 A;  3S1N J;  3L00 A;  1FRN A;  3HTS B;  5TY0 A;  4P9U A;  1T6X A;  1MMS A;  2GJP A;  4HPQ A;  3ZN0 A;  3OIO A;  1B72 A;  3OYN A;  4W8S A;  4LK0 F;  4RMN A;  4KUM A;  5LHI A;  1BW5 A;  2PMZ A;  4UUS B;  2OTJ I;  1WGX A;  4WXC A;  1X58 A;  4ZC3 A;  4PJM A;  4LG0 A;  3V4G A;  1W36 C;  1MSF C;  3BH6 B;  3OV8 A;  4E7S A;  3GSI A;  1AA7 A;  3SEJ A;  2ME6 A;  1ZM9 A;  1RR7 A;  1IRZ A;  2MG4 A;  3O3K A;  1FOK A;  4MYU A;  1I27 A;  2EV6 A;  2MSY A;  5B3S H;  4UV9 A;  2UVE A;  1BI0 A;  5HVQ C;  2FSW A;  5EYR A;  4I09 A;  1AWC A;  2W6I A;  2QMU A;  4HW0 A;  1VQ6 I;  5E3N A;  2P7V B;  3R6K A;  1RUO A;  2DCU A;  1VQP I;  4JMQ A;  2H8R A;  3J80 Z;  2KIU A;  2GM4 A;  1SMT A;  1QO0 D;  2F5F A;  1MJB A;  2EB7 A;  3FDY A;  3OW7 A;  3ABT A;  1HDP A;  3KX2 A;  4RCY A;  3K4N A;  4QPQ A;  3AFH A;  1YX3 A;  2FML A;  5D5W B;  2HOS A;  2NVU B;  2LR8 A;  1QFZ A;  1I7P A;  1N08 A;  4DYC A;  5FFX A;  2PLF A;  2AXL A;  1BIA A;  1EJ9 A;  2H6B A;  3CP2 A;  3S14 J;  1O3T A;  2VQC A;  5A88 A;  2NYX A;  2UUZ A;  4Y15 A;  2VBX A;  3LSG A;  1T38 A;  4U9U A;  5E6T A;  3Q38 A;  1HKS A;  2LY1 A;  1GVJ A;  3A1Y A;  3TO6 A;  4IRI A;  3ZR8 X;  4KIT B;  2JZY A;  1JGG A;  2IS4 A;  2LKP A;  2C5H A;  5HXB A;  1WH5 A;  4M6X A;  4A6E A;  2KKO A;  5J1R A;  3QOD A;  4NNJ A;  1CQT A;  2LH9 A;  4CUG A;  1Y8R B;  2FBI A;  3E6D A;  2XZP A;  1I5Z A;  1P4M A;  3R0J A;  2DLL A;  1LVK A;  2VBZ A;  3QE2 A;  1WP6 A;  2R6H A;  4IPA A;  3ZRG A;  4IHW A;  1XC5 A;  2CQN A;  5F27 A;  2A69 F;  4P6V F;  1AIR A;  3JX8 A;  2HKX A;  1IUY A;  1QVU A;  1X1D A;  2LRD A;  4Z4W A;  4L5J A;  2LBF B;  2Q6I A;  3T8T A;  1D1B A;  3T8R A;  3KEO A;  4HV6 A;  3T51 B;  1KGS A;  3OYJ A;  2QEX I;  5HLH A;  3VSK A;  5K7H A;  1Y56 A;  3QPS A;  4N9H A;  1B72 B;  3QP6 A;  2E1N A;  2AO9 A;  3I4N J;  5DTD A;  2X3U A;  2HVR A;  4NQW B;  4AYB N;  5ERI A;  3VB2 A;  3R61 A;  2WB1 A;  4A0Z A;  1F4K A;  3N90 A;  4Z05 A;  2CV1 A;  3PNY A;  2VOO A;  4NDL A;  1IXS B;  3H3Z A;  4AYB A;  1BJA A;  3HC7 A;  1U5T C;  3E6C C;  3FXO A;  2CC2 A;  2PLY A;  4E7K A;  3O8G A;  2Z8G A;  1DDI A;  2ZL5 A;  4B8X A;  2PI0 A;  3VYS B;  1ZH5 A;  4G9Y A;  2EZH A;  1MZB A;  3WG7 H;  4JX4 A;  5C1E A;  2O1D A;  4FWT A;  3I55 I;  1X2N A;  3KEQ A;  3BNW A;  2V1D A;  3PIP F;  1MGT A;  5JHU A;  3W5V A;  3P7N A;  1VQ9 I;  1CLW A;  4CDG A;  2FEZ A;  1J2X A;  5E1W A;  3CC4 B;  1KON A;  1V0F A;  1KK3 A;  5EDN A;  4BE2 A;  2RDP A;  3BTJ A;  4FN5 A;  3OR2 C;  3V8J A;  1D1C A;  4A5N A;  2K7L A;  2R3S A;  5L3G A;  3ZQC A;  4A3B J;  1VND A;  1H80 A;  2OTL I;  2CV2 A;  4JOM A;  1JJ6 C;  2JN9 A;  2DT5 A;  2RNG A;  1BX0 A;  4E4H A;  2VFM A;  2YUH A;  1JA0 A;  3WU2 C;  2HYF A;  2KIF A;  4M6V A;  3T53 B;  1W5C C;  4ZZD A;  4HLY A;  2OBT A;  3RQ4 A;  5DCM B;  1X3W B;  1D5V A;  2XZL A;  2CFO A;  4P55 A;  2WWY A;  2XHK A;  4YFN F;  2WSS A;  4QUZ A;  4B3A A;  4UVB A;  5DD8 A;  1Q86 D;  3ASS A;  2Q1Z B;  3M1C A;  3CCV I;  1OFL A;  4BDY A;  1ORK A;  2QQ9 A;  3F8M A;  2M45 A;  1HW2 A;  2G9W A;  1OCT C;  1Y0U A;  2DW4 A;  2XV4 S;  2LMD A;  4A3E J;  1YTY A;  3KZY A;  1YJ9 I;  3ELK A;  2K9N A;  2LLK A;  3BZ6 A;  1ODD A;  1BM9 A;  4GDF A;  3N05 A;  4CA0 A;  2M87 A;  5LGU A;  4TMZ A;  2R7Z J;  3BR2 A;  3QFR A;  3OSG A;  4EJT A;  5BPD A;  1G7R A;  2BOL A;  4RM3 A;  4MQ9 F;  5GAH J;  4UZE A;  1EA0 A;  4BY7 J;  1Z67 A;  2F5E A;  2HNH A;  5EJC A;  4MYT A;  3FPK A;  3VYT B;  4RLQ A;  2KIM A;  4K1X A;  1QX4 A;  3RKW A;  1F60 A;  4A3D J;  1S6L A;  4PC3 A;  1VI0 A;  4CCK A;  3I5U A;  4MIM A;  3AVT A;  4MEY F;  1TTY A;  1TTT A;  3CPX A;  4Y9U A;  1EFR A;  1T39 A;  3A4C A;  2M8G X;  2C4U A;  3GWZ A;  2WAQ N;  1W0J A;  4EJW A;  1KQ9 A;  3F21 A;  1TYU A;  2STW A;  2MA3 A;  2O7O A;  2WAQ A;  5CYV A;  3T0Y A;  1G8X A;  1KYZ A;  3DPT A;  3P26 A;  2HPI A;  4KIC A;  4XN0 A;  3TP0 A;  2AS5 F;  3VMF A;  4U4B A;  1WJA A;  1OCR H;  2VQG A;  1VQ7 I;  1D0Z A;  1WOS A;  1RET A;  4RLF A;  3CC7 B;  1ZGA A;  1QHH D;  2R7D A;  3JRG A;  2IA0 A;  2R5Y A;  1SVO A;  2K9Q A;  5HZA A;  1X3Z B;  3P27 A;  5BSY A;  2K4B A;  5HLI A;  3PIO F;  3LMW A;  5E8G A;  1K28 D;  2HYJ A;  2DMP A;  1NK3 P;  3ERE D;  3OEE A;  3U9G A;  2XRO A;  3GUD A;  3SEZ A;  1XGO A;  1OQY A;  2DA1 A;  2JA2 A;  2L2O A;  5KVR A;  1R5O A;  2B0L A;  4ZGN B;  1HSJ A;  4WWV A;  1WJF A;  2Y2Z A;  4P12 A;  2M7B A;  2XGD A;  1VLY A;  2UV1 A;  3G4S I;  2LG4 A;  5HLG A;  4P9F A;  2P7C B;  4E7I A;  5JBQ A;  1IDZ A;  2INV A;  4MR0 A;  2GOX B;  2BY2 A;  2BV6 A;  1P4A A;  4M53 A;  2LP0 A;  3DF8 A;  1XSD A;  4H9G A;  2STT A;  4DQK A;  1QCX A;  1EV7 A;  2OU2 A;  5HOO A;  2F4M B;  3PSZ A;  1MW7 A;  2PMU A;  2Z99 A;  4HEA 2;  5E20 A;  3WTW C;  1YJ9 B;  1UST A;  3RCO A;  4Y13 A;  2E1M C;  2JIZ A;  2XTY A;  3PFI A;  4Y7C A;  4N0B A;  3QSY A;  3LFU A;  2ACJ A;  1VQK B;  3T56 B;  4IHS A;  3ASP A;  4JYK A;  2H09 A;  4LC0 A;  4OPS A;  1WWX A;  1D8T A;  5ICE A;  2XGE A;  3BJ6 A;  1R5I D;  4M3G A;  4FAS D;  2G7H A;  3K6G A;  4ZYE A;  5ILU A;  3M7G A;  2YWE A;  1FYK A;  1IN8 A;  2F5C A;  3AGQ A;  2DOF A;  4GO1 A;  1LLZ A;  4XLA A;  2X51 A;  4KMU X;  2QKM B;  3RDI A;  1JI8 A;  1LFP A;  3KP4 A;  1HST A;  5LBQ A;  4ABZ A;  4RD1 A;  2K9L A;  1PJR A;  1ZG3 A;  5IYR A;  2FXA A;  2PJR B;  5EZG A;  1GV2 A;  1T33 A;  1E3Z A;  1RU4 A;  2EJR A;  1FX7 A;  2VL8 A;  3F6V A;  1HDD C;  3TDU C;  4BGD A;  2XRL A;  2JUG A;  2D9R A;  4TMT A;  3GRH A;  4PGG A;  4QV2 A;  1GT0 C;  5A2Q Z;  3V76 A;  1KU3 A;  5HNF A;  2XSJ C;  1YIJ I;  3DEW A;  4L0Y B;  2WV1 A;  4ZTJ A;  1MBE A;  1E1Q A;  4P2N A;  4XMY A;  1UD6 A;  5EEH A;  1T6Z A;  2ZZE A;  3ZC3 A;  1AMO A;  1G3S A;  1XMK A;  1BMF A;  4URR A;  3DBH B;  2BVM A;  3JRI A;  4AC0 A;  1NBM A;  4RGX A;  1Z3Y A;  1FIP A;  1R6R A;  3K4J A;  1OKR A;  2V7V A;  4CYD A;  1JHF A;  2W1O A;  1T08 B;  2LBF A;  3K4C A;  1UG2 A;  3OIP A;  5C3E J;  3S3O A;  1FMW A;  2L7F P;  3C1D A;  1DP7 P;  1NK2 P;  4HE6 A;  4AUX A;  2XUB A;  2NNN A;  4FIS A;  3VSL A;  2HTJ A;  2A3S A;  5IP9 J;  1P6R A;  4XRS G;  1KCC A;  2RV8 A;  3VO1 A;  2Z1D A;  1XDS A;  1PUF A;  4N3N A;  3W2E A;  1RNL A;  2CO5 A;  3GIR A;  1SAN A;  2BEO A;  2DI3 A;  3DTI A;  3I58 A;  3O6B B;  3FXU A;  5FLM J;  4U7D A;  5F0C A;  3HOS A;  4DK0 A;  2MGQ A;  1FYM A;  4GFB A;  4AU7 A;  4X0G A;  1B8I A;  1X1P A;  2BGI A;  4YAU A;  1AIP A;  4Z4Z A;  4B43 A;  1YI2 I;  2DT7 B;  1K4Z A;  5GTH C;  1XG2 A;  1SD7 A;  2DMQ A;  4BBS J;  1V55 H;  1BQE A;  3MEX A;  2M4G A;  3A3G A;  2M5W A;  3GFI A;  3ES9 A;  5BNG A;  4X7E A;  1GJR A;  3W2I A;  3L2C A;  3ZQI A;  2VBY A;  5E8I A;  2X9D A;  3DWL E;  4Z1M A;  5B66 C;  3L2W A;  2CU7 A;  1R5B A;  1OJL A;  3GTJ J;  2A6T A;  1WJD A;  3HJE A;  4D1Q A;  2RC6 A;  4O3M A;  4ZV4 A;  1Q82 D;  2A5W A;  4C3H J;  2O6G E;  1B2R A;  1SKY B;  4HSR A;  1I8D A;  2DOA A;  3VNV A;  2E36 A;  2A6E F;  3A3B A;  3TQN A;  1Y1W J;  2WAE A;  1IAW A;  2CSO A;  3PET A;  1DU6 A;  2DET A;  1U78 A;  3GQA A;  3L1P A;  4XL9 A;  1KQS B;  4Y17 A;  3SZE A;  4OOV A;  1U5T A;  3CQZ J;  5IT3 A;  4D0P A;  1X19 A;  2XVC A;  3FX3 A;  3P5J A;  4BUP A;  4HBL A;  3DQV C;  4CCN A;  2GPJ A;  5H20 A;  3ZIA A;  4FX0 A;  1OGJ A;  4OJ5 A;  4XOP A;  3GZ5 A;  3R6J A;  1YHQ B;  2XB5 A;  4GYI A;  3GBG A;  4KIF A;  3A35 A;  4M3E A;  3OS2 A;  1K79 A;  1W4M A;  1ZR2 A;  3HOV J;  4M1K A;  1V5G A;  3AGP A;  4AF7 A;  1EZG A;  1S7E A;  4LOC A;  3ZMT A;  4Y7N J;  3PO3 J;  4F7Z A;  3RKQ A;  2JVG A;  2HLD A;  3WBJ A;  4HYE A;  3LAP A;  5K5O A;  3WTX C;  2HFH A;  1QGY A;  4EEF G;  4W1U A;  3J7Y J;  4LJZ F;  4PC1 A;  4PC7 A;  3H09 A;  4BY1 J;  2A5Y B;  4QPO A;  3FXR A;  2BF4 A;  3MVP A;  3B4N A;  2ZXJ A;  1VF9 A;  5EG0 B;  2VIX A;  3SZG A;  4AC9 A;  3CCQ I;  2V5I A;  1GHC A;  4XON A;  1WFX A;  5HS7 A;  1ZHF A;  3ABK H;  5GAD J;  2VT2 A;  1USS A;  2ZSH B;  3CUQ B;  3IH2 A;  3LST A;  4ZJZ A;  4ZYG A;  1BR2 A;  1ZRC A;  4I84 A;  3EQL F;  3HYI A;  1B8I B;  1HG8 A;  5IYW A;  1Z91 A;  4KN7 X;  2DN0 A;  3A0H C;  3RJP A;  1QH0 A;  5JVG F;  3UW0 A;  2E35 A;  3LQQ A;  3KP2 A;  4O5V A;  3B02 A;  3R60 A;  2GXB A;  3ZBU A;  2XPU A;  2MD5 A;  3OOC A;  4LIT A;  3SDG A;  4RB3 C;  3CCR B;  2NT9 A;  2NNY A;  1P2F A;  4CHU A;  3GVJ A;  3Q3A A;  2IP2 A;  3CF5 F;  2XF5 A;  3DXJ F;  4QVJ A;  3GW2 A;  3VST A;  4BL0 B;  4ZTF A;  1JKQ C;  2GK6 A;  2Q6O A;  2VBT A;  1BPL A;  3K2A A;  4XRF A;  5CQE A;  2QZA A;  1PDN C;  4TMV A;  1PJ7 A;  3CDI A;  1APL C;  4HA8 A;  4A3C J;  1IO2 A;  1IDY A;  3ZQF A;  3DLA A;  5LHG A;  3HHG A;  3S16 J;  1O3S A;  1RES A;  1R5N A;  2RQP A;  3MQ0 A;  4MFD A;  4A12 A;  1UB9 A;  2R5Z B;  4HX8 A;  2NZM A;  4P25 A;  2VC1 A;  1QRB A;  4GYG A;  1JUP A;  1QZE A;  5JHF A;  2M3A A;  1R00 A;  3BRO A;  1O88 A;  3GQ8 A;  1IN5 A;  4FT8 A;  2IAI A;  1SFX A;  3PM1 A;  1UD2 A;  1Z05 A;  2L54 A;  4M9X A;  3JAM Z;  3OKX A;  2KHM A;  4EM2 A;  1AOY A;  4OJO A;  1OYI A;  5IT9 K;  3MCA A;  3BTC A;  2OF7 A;  5B5E C;  4IEJ A;  3ISP A;  3G6E B;  4ZDP A;  4XSX F;  2E1R A;  4BXF A;  3ZMD A;  4RD4 A;  5C4X J;  3KP6 A;  3T5X A;  1FMV A;  5GV7 A;  1OFD A;  2EWE A;  1YIT B;  1OCP A;  2HPM A;  1P4W A;  4I99 C;  4E7L A;  2PMH A;  4XLN F;  2O8K A;  2ZZF A;  2CRV A;  2UWM A;  4LBW A;  2O0V A;  1ETY A;  3MZY A;  1GLN A;  4S0H B;  4YII A;  4AIH A;  1Q1H A;  5DN6 A;  2W48 A;  4M71 A;  1TL8 A;  1LEA A;  3CRZ A;  3FJO A;  1X4O A;  3DLL F;  1EFC A;  5TIS C;  3HGG A;  1Q81 D;  2L9N A;  4XKV A;  4GRI A;  3C3W A;  3CDH A;  1QGP A;  2Y0S A;  2ZZQ A;  4PAA A;  3KP7 A;  4OU0 A;  2QSF X;  3OL3 A;  3IKT A;  4WZE A;  1FBU A;  2BVN A;  5FFZ A;  3TMO A;  4EJU A;  1UEL B;  1K7A A;  4RGR A;  3IP4 B;  3ZMZ A;  1GVH A;  4TN1 A;  2CWE A;  3UR3 C;  4IF4 A;  4ANJ A;  5C4J J;  3TOA A;  3PUB A;  2R0Q C;  1HKQ A;  1QHG A;  5D6F A;  2E2J J;  4U0Y A;  2JJ2 A;  3FZV A;  3Q9V A;  2XAH A;  1N78 A;  5CQG A;  3LJY A;  3OOP A;  2H6C A;  3L9F A;  1YJN I;  1SD6 A;  2JVH A;  1UJ8 A;  5L3F A;  5CDF A;  4I02 A;  2VFO A;  1LJ9 A;  2IGO A;  4PJJ A;  2I1L A;  2NS0 A;  1H42 A;  3WNC A;  2JDI A;  4EM0 B;  1Z7U A;  1SC7 A;  3K4K A;  3JQP A;  2L7K A;  2VBK A;  1S5L C;  4B3G A;  4G8X A;  4XNF A;  1H9G A;  3H35 A;  1A36 A;  1PLU A;  2GA2 A;  3F22 A;  2BM6 A;  3BJO A;  1ZM2 A;  2R5Y B;  2ZNZ A;  3IV5 A;  3FY3 A;  3CC2 B;  1IN6 A;  3PUM A;  3U1D A;  4A3F J;  3HOZ J;  4RCZ A;  3BY6 A;  3DP7 A;  3CCE B;  3ML3 A;  3PSI A;  4LG3 A;  1IJE A;  4V2G A;  2MYS A;  1Y1V J;  2IS2 A;  2QYO A;  2W4S A;  3DBR B;  3WYA A;  1VQ6 B;  2QLZ A;  2EIL H;  3S32 A;  4BQA A;  4NUB A;  2Q8K A;  5F0H A;  5DS9 A;  3QYE A;  4M9S A;  2K5C A;  2BN4 A;  3S2H J;  2VBW A;  4I98 B;  2D45 A;  5CVI A;  1W5T A;  1EFU A;  2NT6 A;  5EG0 A;  5JFR A;  3FM5 A;  3WNB A;  4XOR A;  5HLT A;  1E79 A;  1WOR A;  1IZ1 A;  2HXI A;  2QVO A;  4UZF A;  4NQW A;  2VBS A;  1ZEL A;  4YHB A;  5H5J A;  4XLH A;  2NXN B;  2ZJ2 A;  3PUF A;  3Q6R A;  1IGN A;  1TWH J;  2V6E A;  3I59 A;  2W57 A;  2CRG A;  5THX A;  3FHN A;  4KJZ A;  5K7Z A;  2NPF A;  1K73 D;  2W84 A;  4I76 A;  2UVF A;  2PJR A;  4HF1 A;  1RZ4 A;  4XQF A;  2WZN A;  5D5U B;  1QA2 A;  1QA3 A;  1IRF A;  4OJL A;  3B6C A;  2QY1 A;  4XLF A;  1QQI A;  2KP6 A;  1QUF A;  4RAZ A;  2A6H F;  4P96 A;  2FA5 A;  3QYF A;  2ZTG A;  4EJO A;  2ZCW A;  2F5D A;  1ETQ A;  2DFH A;  5FKK A;  2Z2S B;  1Y8Q B;  2V9K A;  3GYH X;  1LQ1 A;  3I55 B;  1ONV A;  5D5V B;  4Y9R A;  4TKO B;  2RNJ A;  2BXZ A;  2P5L C;  3MMP A;  3GO5 A;  2GQF A;  4BH9 A;  3Q0W A;  4BXU A;  3M07 A;  3EUH C;  4RBO A;  2O61 A;  2R92 J;  4UNO A;  1KA8 A;  2PMZ N;  3M8J A;  1COW A;  3I56 I;  2ZJR F;  4EGZ A;  3ASQ A;  2OD5 A;  2EFW A;  4HE5 A;  2X1C A;  3OAA A;  5LLQ A;  3EET A;  1GVD A;  4IRH A;  1PUF B;  5EMN A;  2FD5 A;  2M0M A;  1EA3 A;  2D5V A;  2HZD A;  4EV0 A;  4OIR F;  1IRG A;  2BXY A;  4BNC A;  2FVG A;  1ON2 A;  5K1Y A;  4EMS A;  3S2W A;  3H5R A;  4Z6Y A;  2BM5 A;  2IPQ X;  3WHB A;  2VKV A;  2HDW A;  4IL6 C;  3M8E A;  5ICG A;  2QN6 A;  5K5Q A;  4N3G A;  3K4M A;  2GQQ A;  1EE6 A;  4FTH A;  1ZQ3 P;  2VFN A;  2HEO A;  4OZZ A;  3T9G A;  5LHH A;  2R93 J;  1R7J A;  3Q39 A;  1H88 C;  2DMT A;  2LK2 A;  4LFU A;  4UAJ A;  4V02 C;  2L0K A;  1EH8 A;  1LB2 A;  2DJI A;  2VKE A;  3LFK A;  2R7R A;  2AXT C;  1SVM A;  3ONY A;  1MDM A;  3WGI A;  3WU1 B;  2QUF A;  2MBF A;  1RMG A;  1GUU A;  1XMA A;  4XRS A;  1HKT A;  3CJQ B;  4OIO F;  4RDJ A;  1OR7 A;  1WJ5 A;  4I01 A;  4KIS A;  3JTG A;  2C78 A;  1V5F A;  5BOX A;  3W6K B;  2CUF A;  3BY1 A;  3TOB A;  4RD3 A;  2DTR A;  2DFI A;  1BR4 A;  4IJA A;  3E5Q A;  4PC6 A;  1N8R D;  3M4O J;  2BSA A;  1YS7 A;  3NQO A;  2JSP A;  3REO A;  4Z4Y A;  4YC5 A;  1TWG J;  1FSH A;  3LSM A;  2KZV A;  2CF4 A;  5D4S A;  4MNU A;  1O8M A;  2XZO A;  2PYH A;  4IXA A;  2GLO A;  2PE3 A;  2O04 A;  4M0L A;  1E3P A;  5J8C A;  1UMQ A;  3LA2 A;  4OM9 A;  2OTJ B;  1MBJ A;  2WA0 A;  4A3J J;  1D5Y A;  2X6X A;  4YFX F;  2YWG A;  2BM4 A;  5BMZ A;  4CQJ A;  3SQV A;  3MD2 A;  3K1N A;  2NV4 A;  4OPW A;  1VQM I;  1MBF A;  1IJF A;  3O2P E;  5E18 F;  1U6G A;  2XT2 A;  2F2E A;  4L9T A;  4F3Q A;  2CV0 A;  1E62 A;  2PMD A;  2FBK A;  3HOU J;  2LYC A;  4U49 A;  1DQU A;  1NTC A;  4NCN A;  3RIQ A;  2MFZ A;  1LUJ B;  3F72 A;  1V3F A;  3V7S A;  1TW2 A;  2GXG A;  2H94 A;  2RQQ A;  1GAQ A;  1BHE A;  3SFI A;  3LQE A;  4J0Q A;  3QQA A;  4IQJ A;  3NWS A;  1W0T A;  3TKY A;  4KYW A;  1CNE A;  5IP6 A;  4HF2 A;  1UFM A;  4AIK A;  3C2G A;  1K78 A;  1JRG A;  3IWF A;  1EP2 B;  2E71 A;  4G7W A;  4X0C A;  2UZK A;  1NJI D;  3OW2 B;  1F1Z A;  5A8A A;  1PJ5 A;  1IF1 A;  4TSF A;  1MMA A;  4LLG F;  3CJN A;  4NC7 A;  4NK8 A;  1OHH A;  3OYM A;  1TQI A;  5DD4 A;  1L0O C;  3MN2 A;  5IYB J;  4BQQ A;  3OS0 A;  3LNQ A;  4OAZ A;  3KFW X;  2HOA A;  1P4X A;  2ZZG A;  2WAD A;  2R9V A;  2IEK A;  1DUX C;  4YAF A;  1TYW A;  2QSH X;  2LRE A;  1MH4 A;  4IHT A;  1VF7 A;  4BDZ A;  3CDL A;  3I53 A;  2PN6 A;  2JPB A;  4E0F A;  4RDU A;  1FNB A;  2XNC A;  3ZMS A;  1MH3 A;  1MBK A;  2JJ7 A;  3B82 A;  3H9G A;  2E1M B;  4XLP F;  1XN7 A;  3GVK A;  2JA8 J;  4HG2 A;  1W0U A;  3EPZ A;  4MTE A;  3FWE A;  2LOO A;  3HM5 A;  2RN7 A;  1N05 A;  4WXD A;  3OYA A;  2CYY A;  3LO8 A;  2ZO4 A;  4BQO A;  2DT6 A;  2ADU A;  3I64 A;  5HNH A;  4WWC A;  2V7T A;  4B1R A;  3LVB A;  1XSX A;  4PFO A;  2P5V A;  1UCR A;  5KHD A;  4NK6 A;  3S1Q J;  5BQT A;  1E3H A;  1T8I A;  2FUG 2;  3BCA A;  5BPI A;  1BLI A;  2V7X A;  1WRJ A;  4ENK A;  1IG7 A;  2XTW A;  5ICF A;  5IK2 A;  4R71 A;  1VFC A;  1XX5 A;  1SEU A;  2K4J A;  1K78 B;  3H9N A;  3BPV A;  3IUO A;  3BT9 A;  5ED4 A;  1GAW A;  2Q6L A;  1Y0Y A;  2CMP A;  4N9I A;  3QFS A;  4P1V A;  1SM4 A;  2BX6 A;  4YEL A;  1OB5 A;  4PSX A;  3GZN B;  4AD9 A;  5HDG A;  3JQR A;  4Z4U A;  3HKZ A;  3L2Q A;  2G0E A;  4CO8 A;  2B7C A;  1VQ5 I;  4A3K J;  3CCS I;  1RRJ A;  1J7K A;  2GJK A;  2Z6B D;  2O6W A;  3SUC A;  1YX2 A;  1FTT A;  5GAG J;  3JR9 A;  3I59 B;  1C0W A;  5IYC J;  1BI3 A;  4IVN A;  4LK1 F;  1I1S A;  3CPW B;  3LMM A;  2FU4 A;  4OP7 A;  3MFK A;  4B3X A; 
#chains in the Genus database with same CATH homology
 1WTH D;  5C1C A;  3RSN A;  1WJC A;  2XSJ C;  5KCM A;  5HNF A;  4ZTJ A;  4Y4R A;  5TGT A;  1E1Q A;  1W9X A;  1O8L A;  4XMY A;  1UD6 A;  2ZZE A;  4URR A;  3KEW A;  2D3L A;  1BMF A;  2BVM A;  3PNT A;  4OJ6 A;  3CP8 A;  2NTP A;  1YX5 A;  5FRO A;  1NBM A;  1Z3Y A;  1R6R A;  3E1S A;  3K4J A;  3HAG A;  2W1O A;  3K4C A;  2LBF A;  3OIP A;  3S3O A;  2R7X A;  5FRN A;  3LNN A;  1FMW A;  3OE7 A;  1KTW A;  1MAB A;  4G6I A;  3U21 A;  1D0Y A;  3VSL A;  2BVL A;  1MND A;  4PJL A;  2V31 A;  3OYD A;  2F6C A;  4XLC A;  3OYH A;  2XND A;  2HU9 A;  2Q2E B;  1KCC A;  3S3N A;  2E60 A;  2Z1D A;  2K9M A;  1MMN A;  4BEH B;  5FL7 A;  2VXZ A;  3VMV A;  3DTI A;  3OYG A;  1O8I A;  3GQ7 A;  4DK0 A;  3HOS A;  3D5R C;  4Y33 A;  2V4D A;  4AU7 A;  4X0G A;  4PFP A;  3S3M A;  4IX7 A;  3HPG A;  2VLA A;  4B43 A;  2DT7 B;  3OL4 A;  1X4P A;  4MXN A;  1XG2 A;  3D5S C;  2F5V A;  2CH0 A;  3SDB A;  2VJI A;  2M4G A;  3OYF A;  3A3G A;  1O8G A;  2HQA A;  2MC4 A;  2X6W A;  3L2R A;  2MD0 A;  1N77 A;  3V42 A;  1SFK A;  2MAB A;  1LDK B;  3DWL E;  4Z1M A;  3L2W A;  2ZTN A;  3EQN A;  4XN3 A;  3OYL A;  3WWG A;  2A6T A;  1WJD A;  4D1Q A;  3A2K A;  1IRX A;  1NG7 A;  2A5W A;  2XAU A;  4F55 A;  4YZQ A;  3CJR B;  3HG9 A;  1SKY B;  4HSR A;  1I8D A;  2DOA A;  1PKV A;  3A3B A;  3PFY A;  1UAA A;  2WAE A;  4CCL A;  4XD7 A;  4DGW B;  1BN8 A;  1NHC A;  3LL7 A;  2VBE A;  4KKT A;  3GQA A;  4E7H A;  2AQF A;  3K70 D;  2XF6 A;  4XL9 A;  4IKF A;  2XOK A;  2QX3 A;  3VSU A;  1X19 A;  2CS3 A;  2R4G A;  4BUP A;  1DBO A;  3DQV C;  4CCN A;  4F93 B;  2RRE A;  3ZIA A;  1E0E A;  4OJ5 A;  2NOJ B;  4XOP A;  2R7U A;  4LIV A;  3DTK A;  2XC7 A;  4CSW A;  2NTB A;  3GBG A;  4F52 A;  3F9K A;  4XKB A;  3ZXS A;  3A35 A;  3LSK A;  3OS2 A;  1V5G A;  3QOE A;  1W0K A;  3OIQ A;  1OGO X;  1N75 A;  3IAS 2;  2JVG A;  3IAM 2;  2HLD A;  1UD3 A;  3VDX A;  1PE9 A;  4DNT B;  1IDJ A;  4XKC A;  2QXZ A;  2X8K A;  4G7X A;  5HKK A;  2ZFU A;  3VYU B;  3CF2 A;  2R7Q A;  4QPO A;  4U7B A;  2K3P A;  2IQ7 A;  4OJP A;  2CW7 A;  3TBI A;  1QU3 A;  3B4N A;  2VIX A;  3SZG A;  3S8P A;  1DGR M;  3L2U A;  1I18 A;  2OUM A;  1T95 A;  4DJA A;  1OR7 C;  2X3H A;  3C2H A;  4XON A;  1WFX A;  2X6Y A;  2Z16 A;  3FKS A;  4UZU A;  2VB6 A;  3E0J B;  3QYB A;  2ZSH B;  4XLE A;  4ZJZ A;  1BR2 A;  4B48 A;  4I84 A;  4BS9 A;  1UD8 A;  1UD5 A;  1X1B A;  2O17 A;  2VJ4 A;  1HG8 A;  4Y3O A;  1P9Q C;  4HST A;  3W2V A;  5FRM A;  4N4O B;  2KQR A;  2L5Q A;  5CPR B;  4DBQ A;  2F1M A;  3UW0 A;  3H94 A;  4BJ6 C;  3ONQ A;  2KRC A;  2LY2 A;  3OOC A;  4LIT A;  2NT9 A;  1Z21 A;  4XKW A;  2WJY A;  3GVJ A;  4ASU A;  3JUR A;  2XF5 A;  3VST A;  1DBG A;  3UNG C;  4BL0 B;  4ZTF A;  1DP3 A;  2GK6 A;  2AQE A;  4IQ4 A;  1BPL A;  2XF7 A;  5CQE A;  1VBL A;  4CCO A;  3BLY A;  3DPU A;  1MMG A;  3DLA A;  2R7V A;  2V26 A;  4ITV A;  1O8D A;  4HWV A;  4LIU A;  1V0E A;  4CCJ A;  2NZM A;  4BAC A;  2OV7 A;  2VBM A;  3OPO A;  3GQ9 A;  2E5Z A;  5JHF A;  2M3A A;  1O88 A;  3GQ8 A;  2HVQ A;  2GK7 A;  1UD4 A;  2KVO A;  1UD2 A;  1Z3X A;  1O8K A;  1OOC A;  3OY9 A;  1E3X A;  1NG6 A;  2VKD A;  3K4L A;  4J00 A;  1E1R A;  2KHM A;  3DTE A;  2W6J A;  4H4K C;  4OJO A;  1WPC A;  3H0D A;  4L8J A;  1K6Y A;  4ZDP A;  1U0J A;  4DOZ A;  3ZSC A;  4BXF A;  2F43 A;  4BE1 A;  2E1B A;  1VZ0 A;  3ZCO A;  1KZL A;  3H9Q A;  1FMV A;  4TT3 A;  4E6K G;  2EWE A;  4KT6 A;  3BCD A;  2ZZF A;  2HPM A;  2GOM A;  2V7F A;  4E7L A;  3PSF A;  3G05 A;  2PEC A;  2WPD A;  2LZJ A;  2V1N A;  1Z7L A;  2UWM A;  1HA8 A;  2IGN A;  4BE0 A;  2O0V A;  1GLN A;  2ZXI A;  3ZGK A;  1Y6I A;  3I9V 2;  2NTQ A;  5DN6 A;  4BU2 A;  2W00 A;  4ZDL A;  4J01 A;  2W82 A;  3HL2 A;  4PK4 A;  1X4O A;  2IS6 A;  1D0X A;  4P22 A;  2L9N A;  4XKV A;  4GRI A;  2KLO A;  2KRH A;  3ZPP A;  4FET A;  2Y0S A;  2ZZQ A;  3BCB A;  2XGJ A;  4HNT A;  3OWT A;  3OL3 A;  3K4B A;  1W36 D;  4YEJ A;  4PJN A;  3NE5 B;  1VJS A;  3TMO A;  2CUJ A;  3OR1 C;  1UEL B;  4G6T B;  2D3N A;  3IP4 B;  1KCD A;  3AL0 B;  2NST A;  4MLO A;  4C30 A;  2WY8 Q;  3UR3 C;  4ANJ A;  3PUB A;  1QHG A;  3KEY A;  1RWR A;  2GJR A;  2JJ2 A;  2X53 S;  1N78 A;  3CES A;  2E5N A;  5CQG A;  2KL4 A;  2X1E A;  4N4N B;  1OLT A;  2JVH A;  4EAT A;  1K5C A;  2GJP A;  4HPQ A;  5CDF A;  3MMY B;  4PJJ A;  2IGO A;  3VMW A;  4C9Y A;  2BW3 A;  3OYN A;  1OB0 A;  4W8S A;  3KYL A;  4RMN A;  2DXI A;  2PMZ A;  3HXL A;  2JDI A;  4YXW A;  4ZC3 A;  3K4K A;  1W36 C;  2L7K A;  4PJM A;  2VBK A;  4BQN A;  4P5O A;  2VXD A;  4E7S A;  4B3G A;  4XNF A;  3H35 A;  1O8E A;  4XM3 A;  1X1C A;  1AA7 A;  1O8J A;  1PLU A;  2M7A A;  4PUS A;  2HVS A;  4EW9 A;  3I3L A;  2R7T A;  4DK1 A;  3FY3 A;  2O0W A;  2UVE A;  1TZL A;  3DKX A;  1H8E A;  5HVQ C;  3PSI A;  4LG3 A;  2W6I A;  2MYS A;  4YRV A;  2IS2 A;  4OZY A;  2W4S A;  3PL8 A;  3H9J A;  4JMQ A;  3S32 A;  4NUB A;  3QYE A;  2K5C A;  4B44 A;  3FDY A;  3OW7 A;  4C2U A;  1IDK A;  2NT6 A;  2IGK A;  3KX2 A;  3K4N A;  4XOR A;  3AFH A;  4QPQ A;  4E7Z A;  1LKX A;  5HLT A;  1WMR A;  1YX3 A;  3OYK A;  1E79 A;  1J09 A;  2ELJ A;  3J7A Y;  4DNR B;  1ZEL A;  3BG6 A;  4JQF A;  3MKZ A;  3OFN A;  4XLH A;  4E7J A;  4Z06 A;  3CZ6 A;  3CP2 A;  2P0W A;  3JU4 A;  2V6E A;  2QKL B;  2VQC A;  2UUZ A;  3CMM A;  3LSG A;  3GQB A;  2OC6 A;  3FHN A;  4KJZ A;  3NWT A;  4B47 A;  2DIE A;  2LY1 A;  2BSP A;  4PMH A;  3A1Y A;  2IS4 A;  2PJR A;  3ZR8 X;  4KIT B;  2UVF A;  4XQF A;  4F92 B;  3S93 A;  2ZSI B;  3RPU D;  3QOD A;  4NNJ A;  2LH9 A;  4CUG A;  4PSW A;  1CZF A;  4OJL A;  2XZP A;  2QY1 A;  4XLF A;  2KP6 A;  2M4K A;  3BC8 A;  2I8D A;  1TT0 A;  1LVK A;  5CKT A;  4HNU A;  1WP6 A;  4BJ5 C;  3QYF A;  2ZTG A;  3ZRG A;  4OWR B;  4F91 B;  3FBI B;  3GVL A;  1AIR A;  2Z2S B;  3OYE A;  1X1D A;  2LRD A;  2V9K A;  2LBF B;  3K10 A;  3VSV A;  4TKO B;  2IGM A;  3BC9 A;  1D1B A;  1MNE A;  3T56 B;  3T51 B;  2WZP P;  2IS1 A;  3OYJ A;  3VSK A;  1Y56 A;  3TL4 X;  1WJE A;  3EUH C;  2O5R A;  2HVR A;  4NQW B;  1E43 A;  4KKS A;  2WB1 A;  3M8J A;  1COW A;  2CK3 A;  4Z05 A;  2CV1 A;  3PNY A;  3PJR A;  3RTR A;  2VJJ A;  4AYB A;  2X1C A;  3HC7 A;  3OAA A;  2L9S A;  1JTA A;  4E7K A;  2M0M A;  1EA3 A;  2Z8G A;  3H5N A;  4R79 A;  2HZD A;  3VYS B;  1MMD A;  4ZDO A;  3B8Y A;  3SYT A;  3H5R A;  3BH4 A;  4CCM A;  5C1E A;  2O1D A;  2HDW A;  2V4J C;  4BJT A;  4GQN A;  3K4M A;  1EE6 A;  3W2W A;  3T9G A;  1KON A;  1OGM X;  4OZZ A;  1V0F A;  4BE2 A;  3MKY B;  3FKJ A;  3OR2 C;  1D1C A;  3DDY A;  2INU A;  2DJI A;  1X0C A;  2KMU A;  4W8R A;  2R7R A;  1H80 A;  2CV2 A;  2WBM A;  4W8Q A;  4XOT A;  3ZPN A;  4JOM A;  1T0F C;  2RNG A;  3OYC A;  1RMG A;  1OFM A;  3W3C A;  1PYV A;  4E4H A;  5LFA A;  3CJQ B;  1NRK A;  1WJ5 A;  4KIS A;  1V5F A;  4Z03 A;  3VYR B;  4BEH A;  1ERD A;  1V5E A;  3T53 B;  3D5L A;  3OS1 A;  3RQ4 A;  1BR4 A;  3DPL C;  2XZL A;  2CFO A;  3EQO A;  2WSS A;  2VAS A;  3DU6 A;  1BOB A;  1HZE A;  2Q1Z B;  3M1C A;  1OFL A;  2JSP A;  4BDY A;  1O8M A;  3LSM A;  2KZV A;  3DU5 A;  4CH7 A;  2WJV A;  2PYH A;  2XZO A;  1G59 A;  2IXS A;  2O04 A;  4P1W A;  4DIQ A;  2VQH A;  3N05 A;  4CA0 A;  4DBR A;  2BW3 B;  3W2A A;  4OAY A;  1T5E A;  3LSH A;  2WA0 A;  2QE7 A;  2X6X A;  2BOL A;  4RM3 A;  1YE9 A;  3MD2 A;  2CW8 A;  2HNH A;  4W8T A;  3VYT B;  4RLQ A;  1KMH A;  2CUZ A;  3DKY A;  2VPL A;  4F3Q A;  2VKH A;  4CCK A;  2W7N A;  2CV0 A;  3L2V A;  2LYC A;  1GQ8 A;  2WY7 Q;  1D1A A;  1PXZ A;  4U49 A;  1DQU A;  3BCF A;  1EFR A;  2MFZ A;  3A4C A;  1S9H A;  1W0J A;  2RQQ A;  1WJB A;  2X85 A;  3KRG A;  1BHE A;  2WAQ A;  2ODL A;  1G8X A;  3FBN B;  3DPT A;  2KPM A;  2HPI A;  3NWS A;  4XN0 A;  4IQJ A;  1O8F A;  4B3F X;  4U4B A;  1WJA A;  1UG0 A;  4XR6 A;  2VQG A;  5LD2 C;  1D0Z A;  4KKU A;  3C2G A;  4RLF A;  3ZQQ A;  4D9J A;  4G7W A;  1JRG A;  2NSP A;  3LSI A;  1QHH D;  3OOU A;  4IZZ A;  4C2T A;  3G2B A;  3HPH A;  4C2L A;  4TSF A;  1MMA A;  1X1A A;  1K28 D;  3LMW A;  3OYB A;  4NC7 A;  4HIZ A;  4NK8 A;  3HUG B;  1OHH A;  3OYM A;  3OEE A;  5AMV A;  4BQQ A;  3OS0 A;  2X1D A;  3BG7 A;  3SEZ A;  2JA2 A;  2L2O A;  2ZXH A;  1IB4 A;  4CZC A;  4YZ0 A;  4OAZ A;  2LC2 A;  2V7Q A;  3HOT A;  1WJF A;  1SAU A;  1QJV A;  2M7B A;  1VLY A;  4YZX A;  2ZZG A;  4HRI A;  2UV1 A;  2WAD A;  2LG4 A;  3DEE A;  2INV A;  2R9V A;  4E7I A;  4MR0 A;  2GOX B;  2LRE A;  3VWB A;  4ZYA A;  1VF7 A;  4BDZ A;  1IA5 A;  2VQL A;  4E0F A;  1HVX A;  2WAF A;  2VJ5 A;  1QCX A;  2PYG A;  4AVZ A;  3H9G A;  2E1M B;  5HOO A;  3GVK A;  4HG2 A;  3EPZ A;  3PNV A;  2LOO A;  1MW7 A;  3OEH A;  3WQZ A;  4HEA 2;  3OYA A;  3RCO A;  5KNL A;  3MKW B;  2E1M C;  2JIZ A;  1O8H A;  4BQO A;  2DT6 A;  5HNH A;  3EUA A;  3LFU A;  4PFO A;  2R7S A;  4NK6 A;  5KHD A;  3OYI A;  1DGW Y;  3SEQ A;  3OMY A;  1H8H A;  2FUG 2;  3BCA A;  4FXU A;  4FAS D;  1BLI A;  3K6G A;  3VR6 A;  4NC8 A;  3EUK L;  4U87 A;  5IK2 A;  2R7O A;  3AKZ A;  3IUO A;  4XLA A;  4RM2 A;  3FPP A;  2X51 A;  3AL0 C;  2CMP A;  2QKM B;  2XDV A;  4II2 A;  2KDO A;  1JI8 A;  1FX0 A;  1LFP A;  2F4I A;  4YEL A;  3K70 C;  2JJ1 A;  1BR1 A;  3H5A A;  4PSX A;  3B90 A;  2K9L A;  1PJR A;  2M5S A;  2DCE A;  3HKZ A;  4II3 A;  3L2Q A;  2PJR B;  4YZA A;  1E3Z A;  2GJK A;  2Z6B D;  2VL8 A;  1RU4 A;  3SUC A;  4BGD A;  2JUG A;  3GRH A;  3LMM A;  2R7W A;  4B3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...