2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE PROTEIN HK620
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
1BN8A 2PECA 1KCDA 4I84A 1RU4A 3EQNA 4C2LA 1QJVA 4XMYA 2NSPA 2O1DA 4XN0A 1PLUA 1IDJA 4XM3A 1PE9A 2QX3A 2X3HA 4Z05A 4XLCA 1CZFA 1O8IA 3GQ8A 4OZYA 2NTPA 4XKVA 4XKWA 1XG2A 1O8KA 3GRHA 1KTWA 3B8YA 3VSUA 2BSPA 4EW9A 2VBMA 2VBEA 2EWEA 4Z03A 1O8EA 1O8LA 2IQ7A 3VMVA 2X85A 2NZMA 4OJPA 4XR6A 1O8FA 2PYHA 3EQOA 4OJOA 1OFMA 3KRGA 4W8SA 1K5CA 4AVZA 4XNFA 4Z06A 4XORA 1H80A 2UVFA 1X0CA 1NHCA 1OFLA 3UW0A 2NT6A 4PMHA 4U49A 4XLEA 1RWRA 1O8HA 4NK8A 1IA5A 4W8QA 5AMVA 4XOTA 2VJJA 1OOCA 4YELA 4MXNA 2X6WA 1QCXA 3GQAA 4OJ5A 3VSVA 4YEJA 1O8JA 3GQ9A 1O8MA 4URRA 1KCCA 1RMGA 1O88A 4U4BA 2UVEA 2ODLA 3GQ7A 4W8RA 5C1CA 4XN3A 1WMRA 4YZXA 2QXZA 1GQ8A 5C1EA 4XOPA 3SUCA 2Z8GA 2NSTA 2NT9A 4W8TA 4YZAA 2X6YA 3JURA 3ZPPA 4XQFA 2X6XA 2O0VA 4YZ0A 3B4NA 2O17A 3B90A 1O8GA 1HG8A 3T9GA 1PXZA 4XLAA 1DBOA 1EE6A 3ZSCA 1BHEA 1JTAA 3FY3A 4NK6A 2VJIA 2INUA 3LMWA 1VBLA 3VMWA 4OJLA 2NTBA 2QY1A 2NTQA 4XONA 2INVA 4XL9A 2PYGA 1IB4A 2VBKA 4XLFA 4YZQA 1IDKA 4OZZA 4XLHA 4OJ6A 3WWGA 2O0WA 2O04A 4MR0A 1OGOX 1O8DA 4HWVA 1JRGA 1OGMX 1DBGA 3VSTA 1AIRA
chains in the Genus database with same CATH superfamily
2OU2A 1W5SA 3BTJA 2M5WA 1KCDA 2ZBUA 2OV7A 3ABKH 1MGTA 2LF8A 3DBHB 1OKRA 2GJRA 2ZZFA 2WJVA 1VF7A 2PMUA 2R7TA 1CQXA 2DBBA 1EF4A 2BE5F 1TP4A 1IDJA 1W7PB 1E2XA 3E5XA 4C3JJ 3BZCA 4Z4VA 1FNBA 1O4XA 3J81Z 1CZFA 1XCBA 3A35A 1W34A 4HLXA 4E70A 2W4SA 4ZC3A 2CW8A 2FA5A 2CS3A 2OTJI 3FISA 1EWYA 2XAFA 3K2AA 4YAUA 3LSGA 3KYDB 4RGSA 2LK2A 4OMZA 3S16J 1E3PA 3MCAA 3KFWX 3KLNA 4Y17A 3ZMUA 4IRHA 1PUEE 1J0RA 3KZZA 1SD5A 3KL9A 1GDTA 2HU9A 1LE8B 2EZLA 3JSPA 3DKYA 4I0BA 2XF5A 1N75A 1R36A 1E63A 4M9ZA 2ME6A 2ELKA 4QVAA 3DFGA 3ASTA 3ASSA 1RKTA 4AIHA 4J19A 2CG4A 5TISC 1F4KA 1BI2A 4CCLA 4LFUA 1MMNA 2HDNB 4W8QA 4A0YA 2B7BA 3TDUC 4PGHA 1MD0A 4XBFA 3CMAI 4HF1A 3FXOA 2Z6BD 2X6WA 5M3FJ 1K78B 1MBKA 5F1JA 5LBQA 3I1FA 2DQLA 2BGIA 3Q0VA 5FL7A 2PMZN 1IW7F 2G7HA 1Z91A 5IT9Z 3H9NA 3GFIA 4YEIA 1D0ZA 3CLQA 2W82A 4CCKA 2VBZA 3CDLA 1T38A 2C78A 4AC9A 2UUZA 1YOVB 1W0KA 1YW9A 3UKGA 4PAAA 3WTZA 2NV4A 3K4NA 5DN6A 1WOSA 3U9GA 3LQRA 1FBQA 2XGCA 2X6YA 1OFDA 1W5TA 5EEHA 3L2RA 1LB2A 4L0YB 1V0EA 3P4GA 1ZLKA 2E71A 3QPLA 3TP0A 3IL2A 3CC2I 2A6TA 1N8RD 3B02A 2YX7A 4D9JA 5LGUA 2IAIA 2YWEA 1X1PA 3MKYB 3A2KA 4Z4WA 2E60A 3L2QA 2ACJA 1Q82D 3BTIA 3DEEA 1LFBA 4FTHA 2DK8A 2INUA 3LMWA 3BC9A 1ULYA 4HV5A 4YFOA 2Z16A 2KDZA 4OJLA 4H0EA 2ZFUA 5FLXZ 4QLCU 3ZMVA 4ZTJA 1QVTA 2C6YA 1TWCJ 1QGYA 2ZZGA 4QFMA 1XMKA 2RV8A 3DEWA 1LEAA 5E1XA 3WHCA 1D5YA 4CCMA 1D1AA 5FO5A 3TW7A 4YIFA 3CO7C 5CKTA 3GCMA 2DERA 3OYKA 3PENA 1M1KD 1J9IA 1TT0A 4WK8F 2MA3A 3A8JA 1YX5A 1TLLA 3FWEA 3H3VK 2VE8A 2GM4A 3TH0A 3HGGA 5JI6A 2VOPA 2R5ZA 1VNDA 1WQ2A 4PGOA 2IA0A 2WTEA 4LB5A 1E79A 1RU4A 4YALA 4M53A 4XK4A 3BH7B 3W2IA 4YAWA 4PFOA 2ZC2A 3QP5A 3OYCA 2C2WA 1W1WE 2TRTA 3NRVA 3W2EA 1UB9A 3CCUB 1V5FA 2JA6J 3CC7I 5ILSA 1OFCX 1RI7A 2DYSH 5AN9A 1KZLA 2Z99A 2XT4A 3CCLI 1BIBA 1LQ1A 5ILUA 3AVUA 2VBWA 3TKYA 4LIVA 5K5QA 3OMYA 1RUOA 2ZL6A 5F4JA 2XPVA 2VE9A 4FETA 3R0JA 2YWFA 1IN5A 2K5CA 4HA8A 3SEZA 2OCEA 3VYUB 3LOCA 1UAAA 2QEXB 3DU1X 2X85A 2ID6A 4PC7A 3GSIA 2DCEA 1U2RA 2EV0A 3OE7A 2OBRA 2F5EA 2L4MA 1I1SA 1LFPA 3E6BA 1VQOB 3E97A 4B4CA 1QZZA 4XLPF 2JRMA 1Z21A 2FQ3A 4U0WA 1H8AC 3NAUA 1X3UA 1FNDA 2ELJA 4M6XA 2BM0A 1O8HA 2E1NA 2B7CA 3G71I 3CPWB 1QQ1A 2DOEA 4OAYA 1Z67A 1T0FC 1MNDA 3L1PA 3G4SI 4RDKA 5D6FA 2CQ7A 1K8AD 1BX0A 2QUFA 2FMLA 4B3GA 2HVQA 1GVDA 4HRIA 3I58A 2K9QA 4KMUX 2HOAA 2VQLA 1QX4A 4TMTA 4CUGA 1WJ5A 1QHGA 2HNHA 3GQAA 2E2JJ 2QYUA 1Z3YA 3WE2A 4IHTA 5D5UB 1D0YA 2P7VB 1O8JA 2AHQA 2VC0A 3Q0UA 2L7KA 2F4MB 3JRBA 2K3FA 5FRMA 4Y9UA 1CLWA 4U4BA 5C1CA 3CCEI 1VQPB 2ETHA 3G1OA 4ZYEA 1Y8QB 3OW2B 4MEXF 4CDGA 3H1CA 4CQJA 2R0QC 1Q1VA 2ISYA 3KE2A 3IC7A 4RLFA 2NT9A 4J01A 4G6IA 1ETOA 2IS4A 4RM0A 3JURA 3FDYA 1HW5A 3VYRB 3ZBTA 1DG1G 5GAHJ 3UR3C 1NDHA 4B48A 1XDSA 3SZPA 1YJNB 1WU8A 3BQYA 2VQCA 4MIMA 2DT6A 1O8GA 3CF5F 2CQXA 3W6JB 4HOBA 2NAZA 2ME0A 4BHBA 3GZNB 3KP4A 4UNOA 1ZGWA 1I3AA 4RJLA 4IRIA 3OZVA 3FM3A 1YLFA 1ETVA 2HZTA 2QENA 3S32A 1JKQC 2XC1A 4P9UA 3SJMA 3AK5A 5HZBA 1MBFA 2ZJ2A 1FNCA 2BXZA 1D1BA 2BY1A 3GQBA 4RD2A 4WZLA 3AL0B 3GFLA 3QU6A 5CYVA 4ZDLA 1D2EA 2JJ7A 3HHHA 3CD6B 4A2UA 2MD0A 4HWVA 3HPHA 4Z2YA 2DMQA 1S8NA 4N3GA 4CSWA 1H88C 3HM5A 3VSTA 2XAHA 2B63J 3TMOA 1GT0C 3BCBA 3RDIA 1O7LA 1N05A 1DABA 1QVUA 2A05A 5FO1A 3H92A 2P3MA 5TV2A 1R5HA 2IVMA 1VQLI 3HOYJ 4P6VF 1G3YA 2KT0A 1EP1B 3E20A 2IP2A 2G9WA 2K4JA 3VEPA 5A8AA 4HDUA 3GQ8A 5LLQA 2XAJA 3WGGA 5E3NA 3TOBA 4LG0B 3PUNA 1K73D 3FXLA 2MC4A 3RQIA 1WXRA 3C1DA 4FXUA 3LQQA 4Q47A 3HOXJ 2VNJA 4LIUA 3MZHA 3S2DJ 2MBFA 3GLLA 1I18A 2IQ7A 2CV1A 2STWA 4F91B 2ZZQA 4Y13A 1OYWA 3WTYC 2GJPA 1HVXA 2LTPA 1TYUA 4G7OF 3BY2A 5CJ9A 4Z4YA 4HYEA 5DS9A 2EH3A 2P5VA 1YFHA 4M1KA 1H80A 2JSCA 4UVCA 2UVFA 3QYEA 1TL8A 1P9QC 3RTRA 2NVQJ 4OU0A 2GXAA 1GO2A 1RWRA 3FMQA 5J47A 1LFUP 2HXIA 2WB1A 4A3GJ 3AL0C 4ANJA 4IHVA 5IP6A 2XTWA 3E3VA 3OYJA 1L1IA 4IX7A 4IHWA 5H6RA 5E1ZB 3RYPA 5HLTA 4EEFG 2DT7B 1MW7A 3CMEB 2O3FA 4E0FA 3BY1A 3K6GA 2ZMEC 2JRTA 3A03A 4LITA 4GGGA 3ZR8X 1GXQA 1QPIA 2STTA 1JKOC 1Z05A 5DCMA 1NTCA 2QQ9A 5AIPA 1O8MA 3NEUA 1I6XA 5F6FA 1B9MA 1NG7A 5KK1A 4G9YA 2M4GA 2X1CA 3DTIA 1UFMA 3KIOA 3CCVI 1MJAA 5LD2C 1Y1WJ 4N3NA 1OB5A 1QVFB 4LJZF 4XOPA 2M5SA 2FU4A 1LNWA 4RD4A 5IYNA 2BX6A 1XCVA 2P8TA 3ZBUA 2E35A 2DMUA 4AYBA 3DBLB 2DLLA 3W5HA 3ZPNA 2XGJA 1ZARA 4IXAA 4RMNA 2VFPA 3IH4A 3HUGB 3BR5A 4YFKF 2OA4A 2NS0A 4PJLA 4NUBA 5EMNA 2F4OB 3LA2A 1YS6A 5DM6F 3ZQIA 2RNGA 3K1MA 4UVBA 3J80K 2M0MA 1MDMB 2CC2A 1R4NB 1MRZA 2KVOA 3T53B 3OIOA 3ASQA 1QVGB 4KN4X 5HXBA 3DTKA 4O5VA 1EFCA 3QE2A 1JTAA 3ZZUA 1TNSA 1ZUNB 1DP3A 3BDDA 3ECHA 4OIPF 1ZH5A 1Q1HA 5IYPA 1E1RA 2ZJRF 3LYCA 4H4KC 4TV7A 4BAYA 1KU2A 2DO7A 2INVA 3S1QJ 1VQMB 2X4HA 1K83J 1I5ZA 4I99C 1TLHB 2LKSA 3V4GA 2V1NA 1X1BA 4OZZA 2FX3A 4NC7A 4HX4A 3QODA 4JX6A 3I55I 3I4MJ 1TYVA 2ZNYA 3R4KA 2J5OA 4ON0A 1S0UA 3OOPA 1K4ZA 2GOXB 5FFZA 1VQ5I 3H9JA 4LK0F 4BE1A 2KL4A 3E6DA 2K9NA 3RIRA 5HLGA 5JLWA 4RPDA 5D4SA 1LJ9A 1N25A 3PUBA 2D45A 4Q5SF 4NCNA 1OYIA 1GV5A 1OB0A 2AHOA 3PETA 3PUFA 1G3WA 4CCJA 1BR2A 3FKIJ 4IW3B 1VQNI 2OC6A 2DPUA 3EUHA 2XAGA 4OPOA 5DCFA 2D3LA 2A69F 4XLCA 3HDDA 1SVOA 5C3EJ 1NBMA 1ZHFA 4A3DJ 4XKVA 4XKWA 1XE1A 2NTPA 2JVHA 1HBXG 1YHQB 3B6AA 3VSUA 1Y1VJ 4GCVA 1WFXA 4F52A 2EV5A 4II3A 5M5XJ 5K5OA 3BZ6A 3AVTA 1XGSA 2F2EA 1FMVA 1TTTA 2L5QA 2VC1A 3KCCA 4RD1A 5F27A 2K9MA 4KKTA 4ROXA 2A5WA 4OP7A 3EQOA 3LSIA 3L2UA 2EIKH 1K5CA 1S7AA 1IRGA 3BR0A 4PUSA 2KRCA 1U5TB 3OYEA 4ENMA 3OJXA 4YG2F 4I6ZA 1TTYA 3CMMA 1B23P 2H09A 1OYYA 3REOA 1ORKA 5D5XB 1JKRC 4L18B 1B72A 4P6YA 1Z6TA 9ANTA 4OAZA 4LGWA 4XOTA 2LD5A 2MYSA 2IEKA 1KU7A 2QGUA 5BPDA 2E1CA 1VQ8I 3HSFA 1OR7A 5C4JJ 2E7WA 4UUTA 5EZGA 4BYYA 2OJED 2DA1A 3D1NI 4UB8C 3E6MA 3PM1A 4BACA 4BE0A 3K4KA 2VT2A 1WGXA 2Z9OA 1IDZA 2VKHA 3GQ9A 3LMMA 4BH9A 5JBQA 1BBYA 2IGMA 4CYCA 4G1VA 1GQ8A 3F72A 2QXZA 4DYCA 2KKOA 1DQUA 4M6YA 4AF7A 2O6WA 4RGXA 4E7LA 2VFMA 1HCRA 5FKKA 1K61A 2B0RA 2FD5A 3HYIA 5J4VA 3DLLF 1OGIA 4ESFA 2YPRA 4IRGA 2V7FA 4RAYA 1X3ZB 2DTZA 3FPKA 4ACBA 1JGSA 1XD7A 2KIUA 5GAEJ 1REPC 2V31A 4M73A 3MVPA 4BQOA 3VYSB 3F23A 3LSMA 2BM5A 3HG9A 3E1YE 2VT3A 3I64A 3BT9A 5KAIC 3ZCOA 4HNTA 2QCOA 5EEAA 3U2RA 1E3OC 5DNSA 3ZSCA 1H0MA 4XD7A 3SQNA 5FKMA 2OTJB 1W87A 5HKKA 1HDDC 3K1NA 1UD4A 2IS1A 4XLNF 2BV3A 4LBVA 2Y9ZA 4P3IA 3WG9A 5TJJA 2QY1A 1UJ8A 5IYDJ 3OYBA 2ZXJA 1YJWI 3HRMA 3QOPA 3F6VA 5E8GA 5FB2A 2FXAA 3I0TA 1E62A 4YZQA 1D8TA 2Y0SA 5JHFA 2BW3B 1W35A 1FZPB 4V19K 5FNZA 4OPWA 1UZCA 1Q81D 2OCCH 4HX8A 3VSKA 3KLOA 5GV7A 2MC3A 1BL0A 4PZJA 3WQZA 4Q48A 4S0HB 1LVKA 4NHJA 2BXYA 4HEA2 1VJSA 3IP4B 1WKMA 1KK1A 4XN0A 2DA3A 2DYRH 3CMAB 3Q9SA 1JTXA 2KPMA 3NWTA 1ZELA 3E5UA 3JQRA 4QVJA 1MBEA 3I59A 1RR7A 2L02A 1W0JA 3FHZA 3BLYA 4O3MA 4XRFA 3J7ZI 1H85A 3LVBA 1H89C 2XIGA 1VQ7I 2HMAA 4RM2A 5J3LA 2XKOA 2Z3YA 2NS7A 1RPWA 3S14J 2KRFA 4UV9A 1FDRA 5EG0A 4G1BA 4RDUA 4KH3A 4F92B 3TO6A 3DPTA 2L3DA 5CVVA 2PJRA 4X7EA 1J9ZA 4OJPA 1XMAA 4U0YA 2EZHA 4H9GA 2VODA 2EK5A 1G4DA 1AKHB 2ZXHA 1COWA 3WY9A 2OBSA 5A2QZ 4A3FJ 2DMTA 4ZDOA 1Q7YD 3VNVA 1PUFB 2PIAA 1DP7P 2JTVA 3WTUC 3CC2B 4D0PA 2R7WA 2HQAA 1IC8A 4AWXB 1T6SA 3SEQA 3W2WA 2XT2A 3V8LA 1IXCA 3ZRGA 2FMYA 1ON2A 4KIGA 3VODA 2E19A 4G7HF 3BWGA 3WODF 1ZG5A 1QCXA 4RAFA 2LREA 5ICFA 4ZYHA 4DNTB 2ZXWH 2OD5A 3KZYA 4EM0B 3HOUJ 2MABA 2KZVA 4CHUA 1VLOA 4TKOB 4YEJA 2FE3A 3JRGA 4FQGA 4Y4RA 3JW4A 2E1OA 4OPSA 3ISPA 3LAJA 3VMFA 2UVEA 2RQPA 3IWFA 4ETSA 1FSEA 2YUHA 3IV5A 3LSHA 3FIWA 2DEUA 2JUGA 1DGWY 3CJTB 2NSTA 3GTQJ 3HTUA 4M3BA 4NB5A 4U7BA 3CCYA 3Q6RA 4IHYA 4BHCA 4G7XA 2IGKA 5JR3A 2CNDA 4IOAF 2ESNA 2AQFA 3BCAA 4LMYA 1QFYA 1MBHA 1KA8A 1R5OA 2VNKA 2J7KA 1SFOJ 1C0WA 3CUQA 3WTWC 1QGAA 2CRVA 2O17A 3H9GA 3WBJA 1U9NA 3VO1A 1D1CA 1FLIA 2OQRA 2ZSIB 4RD3A 3AG1H 4G8XA 5E18F 3A8IA 2E1RA 1IJWC 3GLXA 4HE6A 2HXOA 1YE9A 1WHUA 2XZLA 1DBOA 1LLZA 4EJOA 3CC7B 2F5VA 2R4GA 3CCLB 1YIJI 4HIZA 1MMSA 2GQQA 4I09A 2DDBA 4DIQA 1F1ZA 3W2FA 2DI3A 2JDIA 5HZAA 4MQVA 3FX3A 2R92J 1IG7A 4DK0A 4XONA 2F3LA 1HF0A 1BW5A 2MLKA 3S17J 3TEDA 1FYMA 1YLOA 4RD0A 4IEJA 1QRBA 3QYFA 1OGOX 3FK6A 1JRGA 3JQPA 2C4TA 1OISA 4GRIA 4PABA 1MBJA 1G3SA 1HQCA 5HDGA 2XSJC 3EQLF 3NE5B 4EJUA 1OLTA 2A68F 1WSRA 1NB0A 1WP6A 4QV2A 1AA7A 1X1CA 2P0WA 3A3GA 3G71B 1OB2A 1IHMA 3QRFF 3G4SB 4BEHA 5F0HA 4C2MJ 5J1UA 5FA6A 1XB2A 2TDXA 2I10A 4N0BA 2DODA 2HI3A 1UD2A 4GFBA 2VQHA 2CUEA 3P7NA 1E0EA 2QTZA 2BSPA 2VL8A 1XMXA 1FIAA 2Q2EA 1QA6A 3GZ5A 4BXXJ 3J7YJ 3IH3A 5KVRA 2DA7A 3DCFA 2PG4A 1HOMA 1T95A 3CCEB 2EZIA 4Q7JB 5HS8A 3BCFA 4C3IJ 3GIRA 4KT5C 3K4MA 3OWTA 4A0ZA 3R0AA 1YYVA 3JRCA 4XRSA 1N0UA 4OJOA 4OIQF 3SJZA 2WPDA 5HLHA 4BY7J 4KYWA 1U3EM 4CA0A 3F8CA 3I3LA 3HOTA 1K7AA 1MIJA 1XGOA 4V2GA 2VNIA 2G7UA 2E7XA 3BOQA 3AVXA 1IA5A 3J81K 1V55H 4E7HA 3CZ6A 3PIPF 2K9SA 2L9NA 3V8KA 2W84A 4MNUA 3ZQGA 3B78A 3LQ6A 1NJID 1IAWA 4RM3A 4XRSG 1Q86D 4PFPA 2ESHA 1Z3XA 2C4UA 3SFIA 1E3ZA 4II2A 1HLVA 3DLAA 5BSYA 3GVAA 2DTRA 4MQ9F 2HFHA 1RKWA 2E1BA 3DKWA 1O88A 4HG2A 2ODLA 2RGVA 3K9TA 2HQNA 2KJCA 3M1CA 3W2VA 2IJLA 3GW2A 1QBJA 5IPAA 1KQ8A 1HC8A 1VF9A 1IUYA 2FX0A 4LBYA 3M8EA 1GXPA 3HAGA 2L2OA 2F48A 5KNLA 3LFUA 5JVTA 3RQ4A 3GTGJ 3CP2A 4XQFA 1B6AA 5KCMA 2VFOA 1OQYA 3ISXA 1Y0NA 2X3UA 3ZZTA 3L2VA 1B8IA 3R6JA 4EQQA 1VQLB 1HG8A 1EH7A 3T9GA 2IXSA 4Z6YA 5EGOA 2YU9J 4WWVA 2CRGA 2F1MA 2W7NA 2VBTA 4IHSA 4XIDA 2RKHA 3HC7A 3GTOJ 5IT9K 3PJRA 2FBIA 3CCJI 1BJKA 2XAQA 1YRNB 1ZYRF 1D3YA 4IPAA 3H5AA 3HL2A 1ENHA 4HQEA 1MKMA 1X58A 2WADA 5FJ8J 1K28D 4BUPA 4KKSA 2OPTA 4MTEA 1QG0A 3I4PA 1G7TA 3V7RA 4A3LJ 1BOBA 5ICEA 3BTLA 1JA0A 3GYHX 3VSLA 2R5YA 1PDNC 1HDPA 3KETA 2V7QA 4FK8A 5CPRB 2BGCA 2Y75A 1RC9A 5HS7A 3JREA 4TMZA 1DGRM 2QE7A 3RIQA 1IB0A 2XF7A 3PIOF 4EJWA 4NBQA 1ELOA 2GWRA 1O8DA 2I1LA 4BS9A 5L3BA 3ZUGA 1BOAA 2W85A 4XKCA 5DEQA 1U8RA 1ZTRA 1KK3A 1BN8A 3SZTA 3B8HA 5BSXA 1OR7C 3GF2A 3G6EI 2O0YA 1XSVA 3JRHA 3ZMTA 2BHZA 1Y39A 5DYMA 4UUVA 2AO9A 4EV0A 3VOEA 2PFBA 2DMNA 1EV7A 1NRKA 2HZDA 3SDGA 2LR8A 1OCPA 2K9LA 4P25A 5ICCA 1JB9A 3BZKA 4IJAA 3W3CA 5BQTA 2R7SA 4BL0B 4DQKA 5HS9A 5FLXK 2ZITA 1KTWA 4P1WA 2BVNA 2NVUB 2XOKA 2MD5A 4HDVA 3MCZA 3WTSC 2O8XA 3F9KA 3I56I 3A01B 1Z7LA 5DD4A 5HLIA 1DU0A 2R93J 2FVGA 4D7MA 4X7FA 4B8XA 3CCVB 3IAS2 5JFRA 2FF4A 2X1DA 3T1BA 4F7ZA 1UMQA 1WVRA 4JX5A 4I7HA 2HQ5A 4WZTA 2NZMA 5LRSA 3CF2A 1BN5A 5J6XA 3OYGA 3OEEA 5E3MA 1V5EA 2X0KA 5K1YA 1NK2P 3H9QA 1K9MD 5E6TA 4MLOA 1ZM3A 3BY6A 2LFBA 2QQAA 2IRFG 4WF2A 3S1RJ 1TC3C 3HKZN 2QF7A 1UHWA 2V7VA 5E1WA 3SYJA 5M5YJ 2CV0A 1KZHA 1JUSA 1OGJA 4U0VA 3OZWA 5GPAA 2NYXA 3OSFA 2P7CB 3WU2C 2KP6A 1S6LA 4E7KA 2W00A 5BPIA 2BYVE 2VXDA 5IYRA 3VSVA 3EYYA 2WR8A 1QRCA 3K10A 2DMPA 1T2KA 1N77A 1K6OA 4URRA 3BR1A 3T8RA 2AQEA 1ETYA 2BY0A 5IP7J 4Y9RA 3MN2A 3SZEA 1EFRA 4M71A 4M74A 2O6GE 4KNYA 4XSZF 2PI0A 1WMRA 1E3XA 3I55B 1O3TA 2VIXA 4ZZDA 2EIMH 2Z8GA 3QOEA 4E4HA 2I8DA 4GYGA 1JI8A 4PC6A 4YFXF 1ZK8A 2HDCA 3LSRA 4B3FX 2V5IA 4LLLA 3ABLH 3QP6A 1ZKGA 1TWHJ 3O3KA 5J8CA 1SEUA 1JJ8C 1WCMJ 5J4YA 1NK3P 2X6OA 1E64A 1VQ5B 1UD5A 4CXFA 3M07A 3QSYA 3OW7A 5EEGA 4Z4TA 4UZUA 2JA8J 1BA5A 1VQNB 2QBYA 1QFJA 1USTA 3F21A 4XLAA 3SFZA 2DDAA 4AIJA 4FX4A 1JA1A 1B9NA 2O7OA 1J7KA 2V1DA 4FCYA 4OWRB 1S9HA 1Y0UA 4RB3C 3C2BA 2H1KA 3H3ZA 2Q6KA 1D5VA 1WZ2A 2Z2SB 5DUIA 2V79A 2F43A 3HZJA 1G6NA 4TT3A 4Y7NJ 3EUAA 3LSKA 4XL9A 3EDPA 1DPUA 2HCJB 5B1BH 3W2AA 1K6YA 2K7LA 4D1QA 4EJVA 2O0WA 4BE2A 2QA4I 3P9CA 4MR0A 3LA7A 2KQRA 2IA2A 3JTGA 1OHHA 4YCQA 4M3GA 1B2RA 3CPXA 3OYFA 5DDGA 5H2FC 4A12A 1LEBA 3W2GA 5KW9A 3OS2A 1G8XA 3MKZA 3B82A 3Q38A 2LBFB 1APLC 1FBSA 5THXA 3C2HA 5JVGF 2VBXA 3FMSA 1FT9A 4L9NA 4FE4A 4XKBA 3PUMA 3U6KA 4PC3A 2AXTC 3PQKA 4Y33A 1W5CC 2JJ1A 1S7EA 3FMRA 1TBXA 4ASNA 2VB6A 1RIOH 4UY8I 1T5EA 2K02A 2GK6A 2DT5A 3OR2C 3OEHA 2FBKA 2DAOA 2HYFA 1NH3A 2VBEA 2A3SA 1GVHA 2BPOA 5FGMA 3BQJA 2ZMEB 3WGIA 1UG2A 2CFOA 4KUMA 4UXNA 3H94A 3K2ZA 4PGGA 3OFNA 3G2BA 4A3MJ 4Z4UA 5CDFA 1KONA 2K4BA 3CUQC 2WV0A 3TO7A 2YS9A 4RA2A 2MH9A 2CGPA 1KJZA 2XTYA 1HSJA 1YW7A 2HGCA 2JVGA 2KIFA 2HKOA 5EZHA 4KA4A 3DU5A 1OFLA 2HTJA 3UW0A 3OSGA 2XPUA 2CQQA 1V3FA 1K8FA 3K0LA 1HA3A 2OZUA 3ZP5A 1FTTA 1TQMA 1G2HA 1CF7A 4LK1F 1STZA 1YJ9I 3TL4X 1G7RA 3BCDA 5LGNA 2D74A 1L3LA 2Q1ZB 5DM7F 1JUPA 2CW5A 1U9OA 2CBXA 1QQIA 3SYTA 1CNEA 5HDKA 1U78A 3SKBA 2L9VA 4CZZA 4PCQA 2PQ8A 1JJ6C 1YIOA 1YJWB 3T51B 1IJFA 1VQ9I 1SMTA 4GO1A 2NOJB 4ZYDA 1QH0A 3JU4A 1YW8A 3U2QA 5H20A 4LLNA 4XN3A 1HZEA 5A88A 3GQ7A 4PK4A 1B59A 2V7UA 1HKQA 2XAUA 1WORA 2IW5A 2VKVA 3ELKA 2M1BA 2XV4S 3DDYA 3DEUA 4A69C 4ZH4F 4OPVA 3M8JA 3OYLA 3D5RC 4N9HA 3MEXA 5IYQA 1MJBA 2X6XA 3ABUA 5DTDA 3OYIA 2PLYA 3B4NA 2EB7A 4CH7A 2CF4A 5E20A 2DK5A 1RNLA 1F5TA 2WAFA 3CXCB 1SD4A 3VB2A 1WWXA 4YFNF 3X2QH 3OS1A 5CVJA 2WV1A 1ZG1A 4L5EA 1ODDA 2JZYA 3GBGA 1USSA 4MTDA 1VQ7B 2VJIA 2GIZA 2L7FP 5FKOA 1NB9A 2ZL5A 3WXMA 4A3JJ 5DV5A 4D7NA 2EFGA 4DJAA 2WAEA 2R7UA 2M2EA 5CVIA 4K2EA 4G7WA 3BG7A 3R61A 4A6EA 1HF2A 2OBPA 1X4PA 5TRDA 1LLWA 4BQQA 4UZFA 2O04A 4DGWB 1TSPA 1V0FA 3C7JA 4OINF 3HRUA 3ZOBA 3ZQ7A 5D8LB 3ES9A 4RDLA 5IOZA 4WX9A 1SAXA 2QQ8A 4HF2A 1LDKB 2PN6A 3HGYA 3H5RA 4DZPA 3G3ZA 1UD3A 3GXOA 1EFUA 2Y31A 5GADJ 4C2LA 2NS8A 2ZO4A 1R1UA 3BC8A 2ZXIA 2EINH 3IH2A 3T5XA 3OZUA 4NBSA 5D5WB 1X4OA 1QGPA 3FK7A 3RI4A 2EA2A 2WYRA 2ICWG 2XNJA 3WNBA 3LAPA 3A1YA 5AIQA 3ZMDA 5F1RA 2QLZA 1TWAJ 1N06A 4TMXA 3TQNA 3W5VA 3AKZA 4WZKA 3RY8A 2VBMA 2R7ZJ 2CO5A 4LD5A 4B3AA 2QDXA 2VYQA 3U1DA 3M4OJ 2F5CA 2DA4A 1A04A 1I1GA 3DV8A 1QHHD 1Y0YA 5F4OA 2JWTA 3HOSA 3W6KB 1QRYA 1FOXA 3AVYA 2GAUA 4NQWA 2QEXI 4B09A 4IZZA 1IZ1A 3FHNA 3ZGKA 4F3QA 5KAFC 2R5ZB 5ILVA 2DY1A 1FSHA 2XGXA 4GQNA 3MD2A 3OYNA 3E0JB 1TWGJ 2B0LA 1IDYA 3F8BA 4I02A 2AXLA 2KZGA 3BPXA 1A8PA 4KITB 5ERIA 4NK8A 5BOXA 3CJQB 3RJPA 1SKQA 1T39A 5CLSA 1F43A 4QUZA 1YIJB 3V76A 3F3XA 3BG5A 5FD6A 5DD8A 1BW6A 3ULQB 1DUXC 3HOWJ 2RAEA 4QWQA 2JA7J 2ZJPF 2R7OA 1T98A 1VQKI 1N08A 2WJYA 3BR2A 2E1MC 4D5FA 1HW2A 3ZZ0A 2BY2A 1KQ5A 3DP7A 4LB6B 1TWFJ 5IY5H 5F0FA 2W1OA 3F22A 5FLVA 1GJRA 1ERDA 2QGGA 2WZPP 4ENJA 1A35A 3AG4H 2LY9A 1FMWA 1A6QA 3ZQLA 1BPLA 1WOPA 3D5SC 3P9KA 4HSTA 4F55A 5GTIC 2VN2A 4C30A 1R5NA 2IPQX 2HR3A 3OKXA 3FPPA 4YZ0A 4CGZA 2CQNA 1T56A 1ZM9A 2DJIA 3DU6A 3N97A 1QNTA 2QSFX 1XS9A 1BR4A 4IQ4A 1IJEA 4I0AA 3SEJA 1W7PA 3WTXC 3R6KA 5IOYA 1EE6A 4X7CA 3CC4I 4U7DA 1D0XA 4NK6A 3KPHA 2DQRA 3BTCA 3DWLE 1DDNA 5DUKA 3VMWA 1Z1DA 2M8GX 3V7SA 3GZ6A 2XTXA 2RN7A 4F93B 4X6AJ 2PYGA 1O7FA 5K5RA 1AU7A 5J35A 2X1EA 4XLFA 2MW8A 5JLXA 1QUFA 3OJWA 3N05A 4L5JA 4WWCA 1IF1A 2OYNA 5D8KB 3COAC 1LE8A 2GLOA 4Y52J 1N07A 2OK7A 3MMPA 2YWHA 2VZLA 3A3BA 3QQAA 4L9TA 2IOUG 4Z4ZA 1EKEA 2Y2ZA 3CLOA 4U88A 1SVMA 3BG3A 4C9YA 1EP2B 3H0GJ 2VNHA 2P81A 2EBIA 1TW3A 3FXUA 5K7ZA 1QZEA 2Y30A 1YTYA 4XM3A 2HKXA 2X51A 2M30A 1FJLA 2RQQA 4N4OB 4AVPA 1SAUA 2BVLA 4ABZA 5HODA 3R60A 4WCGA 4X07A 1TUIA 2CW7A 4EW9A 2PLFA 1CNFA 2PMZA 1MMDA 1CQTA 2QZAA 1J5YA 1O8EA 4XRMA 2DIEA 1MZBA 3CCQI 2OQGA 1J09A 1FBUA 4L9VA 3K70D 3FXJA 2EZKA 2F4NA 5FIUA 1OFMA 3I4NJ 4AVZA 4P3YA 2BSAA 3BJOA 3BR6A 3HSEA 4JK1X 1TYXA 2ZFWA 4A5MA 1UG0A 2LF7A 4PJMA 3R6SA 4Y7CA 2DFHA 5IYWA 4BDZA 2ZSHB 1QO0D 3ZQCA 1ZGJA 1D1NA 4DBRA 3H35A 3CRZA 2A07F 1K79A 1XQBA 3CCMI 4HAMA 4ZZLA 3LSJA 3ERMA 5ED4A 1GR1A 4J0QA 3NQOA 1LPQA 2O8KA 1PJ5A 4MXNA 2P4WA 3CCJB 2EPFA 4M72A 4ZJZA 1FOYA 4CCOA 2HOSA 1FP2A 3S3MA 1G59A 1AWCA 2E5ZA 4HLYA 2DA5A 2QQBA 1H42A 2QWWA 4ZV4A 2DOFA 5BS6A 2P5LC 2LG4A 2DU9A 2KLOA 4YZXA 1V5VA 2YX4A 3K69A 1FTZA 3FM5A 3HBLA 5A2QK 1FNMA 4YZAA 1J2XA 4M2LA 2UZKA 2IGNA 2CJJA 4G5GA 4ENKA 1P4XA 2LP0A 4P5OA 2GQFA 3U1KA 4MYTA 3PFYA 2O0VA 3KP5A 4HF0A 1BC8C 3HOZJ 2FRHA 2FQ4A 3VO2A 2LKPA 1U2WA 2WB1N 1SD7A 2PEXA 2HQRA 3CO6C 4FN5A 5TR9A 1QGZA 2IS6A 1E3HA 3ABMH 1KU9A 3DPLC 2XASA 3HOVJ 2BGJA 3HKZA 2XSDC 2BOLA 1OMIA 2R7DA 3K70C 2P6TA 3V8JA 2CUFA 3SHFA 5DCMB 3H36A 2E2IJ 1MBGA 2GK7A 1XC5A 4BPRA 1SKYB 3I56B 1Z0XA 1LM1A 1IXSB 1S5LC 2J5PA 4RDJA 1RESA 5E79C 3PNYA 4PSXA 3FBIB 4DQLA 5ICGA 2VJ5A 3BROA 3F8FA 4RB2C 2R7FA 3PFIA 3A0HC 5F0CA 4XLHA 3IKVA 4OJ6A 3WWGA 4AYBN 1F60A 4X05A 4PC2A 3G1LA 2NVYJ 1IXRC 2COMA 4DZJA 5B66C 2V26A 2Y48A 4OOVA 1JJ2B 1AIRA 2EFNA 2JPCA 2E2HJ 2R3SA 3B6CA 5IK2A 3F0CA 3ML6A 1GHCA 1IUFA 2NSPA 3HIFA 3BQZA 1BM9A 3OY9A 2ZBVA 2ECBA 2UWMA 1WOOA 4BJ6C 1PE9A 1ZR4A 3I9V2 2XNCA 4M0LA 4ZGNB 1BIAA 2QX3A 4Z05A 2QVOA 1XG1A 1XFOA 5L46A 3C3WA 3SY2A 1N78A 2O61A 1XGNA 4WZEA 4KJZA 3K4JA 2V9VA 3P5JA 4GYIA 3D5LA 1SANA 3NAWA 4B4DA 4YIIA 2Z5UA 1BR1A 4P12A 3VDXA 5FO0A 2VQGA 2CYYA 3GFMA 3M9AA 1KGSA 1FY7A 1YG2A 2YSRA 3H3UA 1ZN2A 3D0SA 2M0CA 5D5VB 1EFTA 3QPSA 1M1EB 4XNFA 3PA2A 4XORA 1K4TA 4Z1MA 2WY7Q 3KYCB 4XSXF 1YITI 1NHCA 1PP8F 3ZN1A 2N8GA 1WPKA 4PMHA 2ZL7A 2KMUA 4HW0A 3JRAA 3GO5A 4DOZA 2HEOA 2WSSA 3S2WA 1P4AA 5B5EC 1VFCA 3CW2A 1OCCH 2F5DA 1YI2I 3QFRA 1U6GA 3G1MA 3FJOA 1JT6A 2NXNB 4CO8A 2QKMB 1IV8A 3ML3A 4OJ5A 2ZCWA 1I8DA 2X53S 4RB0A 1KU3A 3PQJA 2BEOA 3CQZJ 4MGRA 4P2NA 2WAQN 4BY1J 2BBYA 3KEOA 3TBIA 3ESWB 1ZQ3P 3WTTC 1A31A 4IHXA 2BN4A 2XC7A 4EM2A 1Z9CA 3TOAA 3FBNB 4A3CJ 1ZRDA 4ASUA 3L09A 4G6TB 3JAMZ 2QA4B 1VQ4I 4PSWA 1Y56A 4G7ZF 1R5ID 2M8EA 5FD5A 4KFCA 4R71A 5CQEA 2DW4A 1I7PA 3ZN0A 1PJ6A 4P9SA 3PSZA 3E6CC 3F8NA 4W1UA 1B72B 2PMDA 2Q6LA 5F04A 2NNYA 4Q4ZF 4YXWA 3PO3J 1PJ7A 3PL8A 2EV6A 1ETKA 3PSFA 3TDZC 1IV6A 2R7QA 1WSVA 2J8IA 2BY3A 4FE7A 1HSTA 2G0YA 2IT0A 1JKPC 3FY3A 1T6ZA 1W7PD 4LC0A 1W4MA 4JQFA 2DPDA 4C43A 3ERED 4LG0A 1T8IA 2IA1A 4F7DA 1TW2A 2CH0A 4X1EA 4CYCB 1IB4A 1R4MB 2DA2A 2FNPA 1IDKA 3EUHC 5F08A 2H8RA 1X3WB 3KP3A 4KN7X 1A5JA 5GAGJ 2R9VA 2UV1A 1B1BA 4B44A 4IOCF 1BC7C 2Q6IA 1OGMX 3ONQA 1G7SA 4BQAA 1H8EA 2JK3A 3WBKA 1H9GA 1X19A 3O6BB 4EJTA 4I84A 3EQNA 1MSEC 5LHHA 2M87A 1RR8C 4W97A 5C4XJ 1YJ9B 1PLUA 1BI3A 4NC6A 2V6EA 2C5BA 4UZEA 4GDFA 2CQKA 4Z4RA 1QU3A 3T8TA 2LMDA 2IS2A 3K1PA 4OZYA 2L54A 1TNTA 1O8KA 1W36D 3BPVA 1VHOA 2E34A 2M7AA 3O2PE 2XF6A 3G05A 1VQ9B 1RQRA 1FNNA 1FOKA 4UHTA 2XGEA 2VPLA 4MO7A 4FASD 2Y0SN 2EWNA 1AHDP 2HTSA 4A3EJ 2VBUA 3ZXSA 4Z4SA 4KICA 4I98B 3ASRA 2F6CA 4BNCA 4ZCMA 2XB5A 4KKUA 3KX2A 5EJCA 2XEXA 2OTLI 2E36A 1JUMA 4YDTA 4C2TA 1E43A 3RPUA 3OR1C 5KHDA 3SLNA 4X7DA 2X9DA 5FRNA 4FWTA 2L9RA 1ON1A 2XPWA 1BX1A 3ONUA 1S72I 5H5JA 3IWZA 3HUGA 4LOCA 2HS5A 4XLEA 1VTNC 2RDPA 2DFEA 1Z6RA 2QZ8A 2KDOA 3K4BA 3I59B 3GTKJ 2W6IA 1OOCA 2BM4A 2LKXA 1W0TA 4DNRB 3A02A 3KEYA 3RSNA 1MDMA 2GXBA 4LBZA 3CJNA 1POGA 1WJBA 3W2HA 2F5FA 1WPCA 5EG0B 2D9RA 2XVCA 3HRTA 4ZCLA 3BG6A 1U8BA 3ZQHA 4HNUA 2PJRB 1E17A 5BMZA 5K7FA 4G12A 4M9XA 2D5VA 5GP9A 2ELHA 5A89A 4BBSJ 1WI3A 1V4RA 2YR2A 3SUCA 5JLVC 3Q9VA 2XROA 2CFXA 2OAZA 1MNEA 3FF5A 1R5GA 4N9IA 5GPCA 4NC8A 3SLDA 2VFNA 1JGGA 1FRNA 1ACIA 2CUZA 1P4WA 2MH2A 5F4MA 3JRFA 2C5HA 2JIZA 4DNCA 1W36C 3MFKA 2PE3A 4MFEA 1UD8A 3ZQFA 3B90A 3L7WA 1S3JA 1OCTC 3ZPLA 3MKLA 2IBDA 2JMWA 3CB4A 5GV8A 3WNDA 3OYHA 3RKWA 3BH4A 5L3FA 2P6SA 2CK3A 3E1SA 2Y69H 1CGPA 5EF6A 3U21A 1XTAA 2ZBKA 1I27A 2DXIA 1Z7UA 2PMHA 5LRRA 4BJ5C 3I54A 5B3SH 4XICA 2VJ4A 5IP9J 4IF4A 3LSPA 5LGTA 5D6EA 3WHBA 1VQ6I 3GVKA 4HSRA 5IT3A 1VBLA 2V1XA 1EA3A 4DK1A 3CCSI 2KIQA 2BMWA 5HVQC 1PKVA 2NTQA 4KIBA 2WWYA 3HTSB 3I71A 4RCYA 2BM6A 1X2MA 2JQ7A 2NVXJ 3AAFA 1LDDA 1ZGAA 2AS5F 2XZOA 2QSHX 4TMVA 4A6DA 2EFOA 1DARA 1FOWA 4UUSA 1A36A 4FISA 3P9IA 3LA3A 3AG2H 4B47A 1TVCA 2JN9A 3DPUA 4E7ZA 3KYLA 4BDYA 1E1QA 2VBVA 4AU7A 3CDHA 2C77A 1IN4A 3CUQB 4FHTA 5DS0A 2GJKA 1IN6A 1U5TA 2V4JC 4BQNA 4XMYA 3CDIA 3VNUA 3CMYA 2EIJH 4ZDPA 3S8PA 4MHGA 1NG6A 3RKYA 3ZC3A 3JCUC 3L00A 2Z1DA 1P6RA 4C2UA 4HPQA 2YUSA 3LFKA 4QPOA 2ZZEA 2PBIA 4FT8A 3F6OA 3MZ8A 1VQKB 1XG2A 2A6EF 3GRHA 1R00A 4MFDA 3NWSA 3B8YA 2HPMA 3M1EA 4UAJA 4RD6A 5AONA 2DCUA 4M3DA 5M5WJ 1IGNA 4AM3A 3LQEA 2ZJQF 2HDWA 2HVSA 5KSWB 2GBYA 2EA4A 2ID3A 3SJPA 3M7GA 2BM1A 5IYCJ 2RVCA 4ACAA 4XR6A 3AVWA 5GTHC 3CCRI 3KRGA 2W7ZA 5JHUA 4IKFA 3V7AA 2W57A 5HNFA 4QTRA 2ZNZA 3OV8A 5HOOA 1OPCA 2D3NA 2L4AA 4P9FA 1MH3A 3VWBA 1VQ8B 3PSSA 5LEKA 1FC3A 4N4NB 4BEHB 3OYAA 3JR9A 5J8FA 3U6BA 5L3DA 2GIVA 4S05A 3A0BC 1ZLJA 4YELA 3J7AO 1GV2A 1TZLA 5L3CA 1Y0RA 4V02C 5J1RA 3GVJA 3T56B 3CC4B 2CUJA 2XKPA 1PJRA 2LNBA 2Q2EB 2Z33A 1OCRH 1D8JA 5E3LA 2L7MP 2K40A 1F9NA 4I01A 2A6HF 3LWFA 3MWMA 1ZR2A 4RBOA 2GPJA 5FKNA 1RMGA 1KQ9A 1R1VA 4HZFA 4K1XA 5LEJA 2HOEA 2V7TA 1EXMA 2G0EA 3Q3SA 1XN7A 4AD9A 1ETXA 1ZM4A 4W8TA 3HEFA 1EH8A 5EDNA 2A5YB 2BW3A 3I5UA 3RKQA 4M4SA 2D1HA 1FX7A 2HVRA 4M6VA 5DSZA 4LBWA 3S1MJ 4QIWN 3S15J 2ZB9A 3QPHA 3LO8A 1PYVA 1OCOH 4PJNA 2CU7A 3ASPA 3HSRA 1MMGA 3KP2A 4X0CA 4AUXA 1EH6A 2BF4A 4HBLA 1O3SA 1PXZA 4OOXA 3VFZA 1M90D 2M3AA 2GREA 2VASA 3HRSA 3IKTA 1RQPA 2L9SA 3SQVA 2Y9YA 2CMPA 4B43A 3RKXA 2K27A 2ADUA 2XB0X 1T6YA 1OFEA 2DOAA 5H6QA 3TP3A 1IRZA 1DDIA 2WBMA 3JTHA 2VKDA 1WSUA 4RS8A 4ZYGA 1ETQA 1FPQA 4KIFA 2M34A 2V6CA 2VXZA 4U87A 1X1AA 1BI0A 5LHGA 3CCQB 2VBKA 2L0KA 2YU3A 1G7CA 3D26A 4P96A 1H9TA 1PP7U 4V2FA 1MJ9A 4AIKA 1JXSA 1VLYA 4JBAA 2WZNA 2MFZA 3FKJA 4M3FA 4DBQA 1DPRA 1S7OA 2R7XA 3AGQA 3HPGA 1AKHA 4L5IA 1DU6A 2PECA 1WJFA 2L01A 3WTVC 2JA5J 1MH4A 1B8IB 1TT5B 1JTYA 1PUFA 4BU2A 3K4CA 4TSFA 3RZOJ 4S04A 5EGOB 3ASOH 2XZPA 3CCMB 1B4AA 2O1DA 3OL3A 3HB9A 3W5UA 1I6HJ 2QYOA 3DTEA 1XGMA 2V4DA 5HDNA 3EYIA 1FX0A 4IVNA 3OOCA 3W6VA 1GLNA 1R1TA 4A0XA 1J59A 1WJCA 4X06A 5BNGA 1VI0A 1WJDA 5CVUA 1S4MA 2LYCA 2BZTA 4UB6C 2KISA 2RC4A 1D8KA 3QYBA 2R5YB 1OJLA 4HV6A 5FKLA 1KK2A 4ZGQB 4RCZA 2WA0A 1O8LA 4R1HA 1N0VC 2O9LA 4Z03A 1WRJA 2VLAA 2CW0F 3Q0WA 4CICA 1TYWA 2E1MB 1NHAA 4C0SA 4EATA 2D1VA 3OS0A 4W8SA 1V54H 2ISZA 3HJEA 4QSHA 2JPBA 1L0OC 4CYDA 2PJPA 1GVJA 3PSIA 1KTVA 4Z06A 2EILH 3OAAA 1X0CA 2OK8A 3DF8A 6PAXA 2DN0A 2ZTNA 1IN7A 4BGDA 3ZIAA 3KP6A 3RPUD 2V9PA 1HA8A 2JA2A 3WU0A 4BHPA 4WXHA 1ZM2A 4ZTFA 3MMYB 1W0UA 2R7RA 2W25A 3KP7A 3FXRA 4IO9F 2NVTJ 3NB2A 4A3BJ 3J80Z 1R22A 5E17F 1BI1A 3GEZA 3CCUI 1ITYA 4PJ0C 1YO5C 3L2CA 4M3EA 1R71A 1R5BA 3ZMZA 3GX4X 3CJRB 4RB1A 2LDUA 2L7ZA 5CQGA 4M9SA 5M3MJ 4E7JA 4P1VA 2LVSA 4AIDA 2ECCA 2MGQA 1R49A 4BBRJ 3JRIA 3DXJF 3TO9A 4UVAA 5C1EA 3IRRA 2VONA 2P5KA 1EZGA 1RZ4A 1O3QA 1KRHA 1ETWA 1KC8D 5JMCB 4RGRA 2PX9A 2Q8KA 1UELB 3MKWB 1WTHD 5HNHA 3P27A 1ONVA 1IN8A 2Y0MA 1VQOI 1P7JA 1Y8RB 2H6CA 1HKSA 1JNYA 5K7HA 1WJEA 2LLKA 4AC0A 3H5NA 4BKXA 4BXUA 1R7JA 2JSPA 1ZRCA 2RC5A 3FXKA 2DYIA 4P22A 4KT6A 1WDTA 4HE5A 2Q6OA 4E7IA 3HXLA 2XRNA 4R8HA 1X2NA 3WG7H 4EMSA 5FFXA 4I2OA 5E8IA 2XDVA 1P7IA 1SVLA 2JN6A 4G94A 1BHEA 2WC2A 3GUDA 3PNTA 3JQQA 1LKXA 3S2HJ 2HYGD 5FLMJ 4MEYF 3MAJA 1BLIA 3JSOA 2NTBA 5J3OA 1JT0A 3HHGA 1F20A 3PO2J 3H0DA 2WY8Q 3KEQA 1JHHA 1Z77A 3OIQA 3JX8A 1HW1A 1VQPI 2VBYA 3IHUA 1AOYA 1KMHA 2FUG2 3SZGA 3T0YA 2VI6A 2WAQA 3TGNA 4JYKA 3RZDJ 3I53A 1FYKA 2GZWA 1JE8A 2QN6A 4UUSB 1FWZA 1YITB 2ZKZA 1IO2A 1HKTA 2CV2A 1TQPA 3L2WA 1T08B 3QFCA 3M8FA 1QA1A 1YJNI 4OOIA 2QBYB 2VBSA 1IRXA 4ESBA 3A8KA 4MYUA 3OIPA 1XDUA 2FBHA 2W24A 3LJYA 2VFQA 3OP1A 2VOOA 2KHMA 2A61A 3CESA 1YI2B 3PA1A 1I3QJ 2X3HA 4WXDA 3QFTA 4G6QA 1O8IA 1QZYA 2DFFA 2X8KA 2W6JA 2H94A 2LC2A 1HXDA 2K3PA 4QPQA 2KFDA 3VR6A 2YWGA 1SMYF 1WI9A 2RNJA 1EP3B 3AGPA 1BMFA 2KJBA 2MLGA 2BV6A 3AVVA 3E5QA 2EJRA 3S93A 2MG4A 5F64A 1J75A 4OIOF 1KD1D 4DQ2A 3GFJA 2ZTGA 1VQ4B 1QUEA 3Q3AA 5E3OA 1O8FA 2QM3A 2J8KA 4D5CA 4EGZA 3CD6I 4U9UA 3Q6QA 4C3HJ 1XSXA 1UHSA 4QHYA 3NARA 4J00A 4JMQA 4E6KG 1R23A 4ENNA 3WE3A 2O03A 4DYQA 2NT6A 4A3IJ 3GVLA 4U49A 2GXGA 3OL4A 3ABTA 4L0ZB 1SFEA 2EFQA 3AFHA 3BJ6A 4P55A 4Y3OA 3V7CA 3BNWA 5AMVA 3J81k 2VJJA 1QA3A 1YQAA 2FJ1A 3JRDA 1K78A 3MHPA 3QU3A 4OIRF 1I39A 1T33A 2OUMA 4CCNA 1KYZA 4GXOA 4ZYAA 3E7LA 3OYDA 3J7AY 5J1YA 2IGOA 3LNNA 2LZJA 2RREA 2M7BA 1YRNA 1FIPA 1GAQA 2NRAC 1MSFC 1KCCA 3IAM2 3ZQQA 3MZYA 2BVMA 1MNMC 1JHFA 4W8RA 1FRQA 4G6DA 3P26A 1KQSB 1WH7A 3GTPJ 2OF7A 1SC7A 1U5TC 4HX7A 2MSYA 3O8GA 1O57A 2R6HA 2DETA 3ZPPA 2LOOA 4YAFA 4DW6A 3A1PA 4EVIA 2F1LA 2JT1A 1EA0A 4RGUA 4X0GA 1OCZH 4HQMA 4PDKA 4DYRA 3CTAA 1YX2A 1GAWA 2VKEA 1SFKA 3BR3A 3GWZA 4JRAC 2COBA 3K7AJ 2O5RA 3ECOA 1CF7B 1ZRFA 1R58A 1BQEA 3QFSA 5LMZA 4YC5A 3GTMJ 5LHIA 4YAOA 2JJ2A 3GMEA 3DKXA 1XPXA 4IL6C 4O6JA 3GTLJ 2HOTA 1I50J 2V9KA 4I76A 2NPFA 4B1RA 3OOUA 2RC6A 3WNCA 2HYJA 5IYBJ 1X1DA 4A3KJ 2B7EA 1FYLA 2UXXA 2H27A 3PVDA 2XGDA 2FOWA 3CMEI 1T0FA 1MABA 1PVEA 2V7WA 2Q0OA 4B3XA 2K85A 3WYAA 1FEXA 2DJNA 2TCTA 1WJAA 4IQJA 1UD6A 1QPMA 3A01A 1UMKA 2XUBA 2QMUA 1Q9SA 4WQMA 3A4CA 3LSTA 1SFXA 3EPZA 2EFWA 2OTLB 2NOGA 2FNAA 3G6EB 3WU1B 4AF6A 1S29A 5B6IA 3SXYA 1R6RA 3SDBA 4L8JA 3M3YJ 2KRHA 1H8HA 3FXQA 4JX4A 1P4MA 3S3NA 4PC1A 1S72B 3MQ0A 1V5GA 1F36A 3BP8A 2B9SA 4WXCA 1QJVA 1FP1D 3UNGC 1LUJB 2GOMA 2KIMA 3OYMA 2LY1A 2NNNA 2BM7A 2QTLA 4A5NA 4YRVA 4EM1A 1YX3A 5D4RA 1GUUA 2HWVA 2HLDA 2F4IA 4RPBA 3B73A 2EFPA 2V1UA 4A93J 4JP0A 3CP8A 2EWEA 5LFAA 1KQ0A 2X0LA 1W2BB 1P92A 3WGHA 2OBTA 3VMVA 1ZREA 4R79A 2K86A 1IRFA 1VQMI 3N4MA 4ITVA 4RAGA 4CZCA 2R7VA 1TQIA 1K4SA 4E7SA 2PYHA 2GA1A 2LH9A 1UHMA 4Y15A 2CSOA 1Y6IA 1T6XA 3EUKL 3ROUA 2BHYA 1A6IA 2V7XA 5FROA 3BG9A 4UV8A 3LNQA 3K4LA 3DQVC 1ZAOA 3QAHA 5EYRA 1AIPA 1O3RA 2HDDA 4BXFA 3LL7A 2DFIA 2M45A 5H59A 3Q5FA 2FSWA 4KISA 1WH5A 3N90A 4PJJA 1SD6A 2DA6A 2GA2A 3PNVA 4YIRX 2FEZA 2HPIA 1XSDA 2OZ6A 1SFUA 2DOGA 3ASNH 1VQ6B 2M4KA 4X8IA 1VHEA 2H6BA 3AG3H 3RPQA 1ZG3A 2M9HA 2FOKA 2JUCA 3L9FA 1RETA 2XHKA 1YHQI 3CCSB 3KEWA 3O8HA 4EGYA 3S3OA 4JOMA 1LDJA 1R9TJ 1W9XA 1XB4A 3FXMA 5TY0A 1MMAA 2VUMJ 1U0JA 4YHBA 2D2WA 1AMOA 4L9JA 2H1LA 1YS7A 4FX0A 4NDLA 5L3EA 4NQWB 3C2GA 2XRLA 2W48A 1SM4A 4KDPA 2CWEA 4TN1A 3ONYA 4HNVA 1QA2A 2X48A 4LG3A 1EJ9A 3S1NJ 4RAZA 5L3GA 2I5UA 1XX5A 1BJAA 2VPRA 1DDGA 1BJZA 2LY2A 2LBFA 5B1AH 2XNDA 4TMWA 3KZIC 3FKSA 2QKLB 3QPTA 1G3TA 1P2FA 3GTJJ 3IRQA 3RCOA 3VYTB 4EH1A 3Q39A 4BJTA 2H8WA 1KK0A 2EIXA 3OPOA 3EETA 5C44J 4OOSA 3BJAA 3CUOA 4RLQA 4RLZA 2UXNA 3BH6B 4ESJA 4OMYA 4OM9A 1VZ0A 2LSOA 3FZVA 5TGTA 3TW6A 3N6ZA 1QFZA 3ZMSA 3JAMK 2LRDA 2B5OA 3DBRB 4NNJA 1RRJA 5J40A 1UCRA 3C18A 5CVRA 2QSGX 4P26A 3IUOA 4KMFA 2ZMEA 1LVAA 3H09A 3CCRB 3V42A 3F8MA 4ZCIA 2EQRA 2E5NA 1RUNA 3VPRA 3G73A 3QWLA 1DBGA 4LLGF 1KYWA 3RYRA
chains in the Genus database with same CATH topology
1KCDA 3VSKA 3H5RA 2OV7A 1UD3A 2GJKA 2ZZFA 3WQZA 2V4JC 2GJRA 4C2LA 1LVKA 4HEA2 4BQNA 2WJVA 4XMYA 1VF7A 3BC8A 3IP4B 1VJSA 2ZXIA 2R7TA 4XN0A 4ZDPA 3S8PA 1NG6A 1IDJA 1X4OA 2Z1DA 2KPMA 3NWTA 1ZELA 3A1YA 4HPQA 4C2UA 1CZFA 3A35A 4QPOA 1W0JA 2ZZEA 3BLYA 2W4SA 4ZC3A 2CW8A 1XG2A 3GRHA 2CS3A 3NWSA 3B8YA 2HPMA 3AKZA 2VBMA 3LSGA 4RM2A 2HDWA 2HVSA 4F92B 3DPTA 1QHHD 2PJRA 3HOSA 4OJPA 2HU9A 4XR6A 3DKYA 3KRGA 2XF5A 1COWA 1N75A 2ZXHA 4IKFA 5HNFA 4IZZA 5HOOA 4ZDOA 3FHNA 3ZGKA 4F3QA 2D3NA 3VWBA 2R7WA 4GQNA 2HQAA 3MD2A 3OYNA 3E0JB 4N4NB 3SEQA 3W2WA 4BEHB 3OYAA 4NK8A 4CCLA 4KITB 1MMNA 3ZRGA 4W8QA 3CJQB 4YELA 2Z6BD 1TZLA 2X6WA 3GVJA 3T56B 1QCXA 2CUJA 4DNTB 2LREA 1PJRA 2Q2EB 5FL7A 2R7OA 2WJYA 2MABA 2KZVA 2E1MC 1D0ZA 4TKOB 4YEJA 4Y4RA 2W82A 4CCKA 1RMGA 2UUZA 1W0KA 2UVEA 2W1OA 2WZPP 1ERDA 5DN6A 3K4NA 3LSHA 1FMWA 2NSTA 2JUGA 1DGWY 4W8TA 2X6YA 1BPLA 2BW3A 3D5SC 4U7BA 3L2RA 4HSTA 4F55A 2HVRA 4G7XA 2IGKA 4C30A 1V0EA 2AQFA 3BCAA 3FPPA 4YZ0A 1PYVA 4PJNA 2O17A 1MMGA 3H9GA 2DJIA 3DU6A 1D1CA 2A6TA 2ZSIB 1PXZA 4D9JA 1BR4A 4IQ4A 1YE9A 2M3AA 2XZLA 2VASA 1DBOA 3MKYB 3A2KA 2E60A 2F5VA 2R4GA 3L2QA 2L9SA 1EE6A 1D0XA 3DEEA 4NK6A 2CMPA 4B43A 4HIZA 3DWLE 4DIQA 2INUA 3LMWA 3BC9A 2DOAA 2Z16A 2WBMA 2JDIA 2VKDA 4OJLA 3VMWA 2ZFUA 2VXZA 4U87A 4F93B 4DK0A 4XONA 4ZTJA 1X1AA 2PYGA 2ZZGA 2VBKA 2X1EA 4XLFA 4CCMA 3N05A 1D1AA 1VLYA 5CKTA 3QYFA 2MFZA 3FKJA 3OYKA 1OGOX 4DBQA 1JRGA 1TT0A 1YX5A 4GRIA 2R7XA 3A3BA 3HPGA 2PECA 1WJFA 2XSJC 3NE5B 1OLTA 4C9YA 1RU4A 1E79A 4TSFA 4BU2A 3K4CA 1WP6A 1AA7A 1X1CA 2P0WA 3A3GA 2XZPA 2O1DA 3OL3A 4PFOA 3OYCA 4BEHA 3DTEA 4XM3A 2V4DA 2X51A 1FX0A 3OOCA 2RQQA 4N4OB 1SAUA 1GLNA 2BVLA 1UD2A 1V5FA 2VQHA 1WJCA 1KZLA 1E0EA 1WJDA 2LYCA 2CW7A 2VL8A 2BSPA 4EW9A 4LIVA 2PMZA 3QYBA 1MMDA 3OMYA 4FETA 1T95A 2WA0A 2K5CA 3SEZA 1UAAA 2DIEA 3VYUB 1O8EA 1O8LA 3BCFA 2VLAA 2X85A 2E1MB 3K4MA 3OWTA 1J09A 2DCEA 3K70D 3OE7A 4OJOA 4EATA 1OFMA 3OS0A 4W8SA 2WPDA 1LFPA 4AVZA 4Z06A 3PSIA 1UG0A 4PJMA 4CA0A 3OAAA 1Z21A 1X0CA 3I3LA 4BDZA 2ZSHB 2ZTNA 4BGDA 3HOTA 3ZIAA 3RPUD 1HA8A 2ELJA 4DBRA 3H35A 2JA2A 1O8HA 1IA5A 4E7HA 4OAYA 3CZ6A 1T0FC 3MMYB 1MNDA 4ZTFA 2R7RA 2L9NA 4MXNA 4B3GA 2HVQA 4HRIA 4Z03A 4RM3A 2VQLA 4ZJZA 4CUGA 4PFPA 1WJ5A 1QHGA 2HNHA 3GQAA 1Z3XA 1Z3YA 4CCOA 1E3ZA 3S3MA 4II2A 3CJRB 1D0YA 3DLAA 1G59A 1O8JA 2E5ZA 5CQGA 4E7JA 2E1BA 2L7KA 1O88A 4HG2A 5FRMA 4U4BA 2LG4A 2ODLA 5C1CA 2KLOA 4YZXA 3M1CA 3W2VA 5C1EA 4YZAA 4RLFA 2NT9A 4J01A 4G6IA 2IGNA 2IS4A 3JURA 3FDYA 1UELB 3HAGA 3VYRB 2L2OA 3MKWB 5KNLA 4P5OA 3LFUA 3UR3C 3RQ4A 5HNHA 1WTHD 3CP2A 4B48A 4XQFA 3PFYA 2O0VA 5KCMA 2VQCA 3L2VA 2DT6A 1WJEA 1O8GA 3H5NA 4P22A 2JSPA 1HG8A 2IS6A 3T9GA 4KT6A 2IXSA 4E7IA 2F1MA 3HXLA 2W7NA 3DPLC 3HC7A 2XDVA 3HKZA 3PJRA 2BOLA 3K70C 1BHEA 3S32A 3PNTA 3HL2A 1LKXA 3H5AA 1K28D 2WADA 2GK7A 4BUPA 1BLIA 1SKYB 4KKSA 1D1BA 3GQBA 2NTBA 3AL0B 1BOBA 3PNYA 4PSXA 3FBIB 2WY8Q 3VSLA 3H0DA 2VJ5A 2V7QA 3OIQA 5CPRB 1DGRM 2QE7A 2XF7A 4XLHA 4ZDLA 2FUG2 1KMHA 4OJ6A 3SZGA 3WWGA 2WAQA 2MD0A 1O8DA 3HPHA 4HWVA 4BS9A 4CSWA 2V26A 3VSTA 4XKCA 1AIRA 3TMOA 1BN8A 2CV2A 5IK2A 3L2WA 3BCBA 1OR7C 1IRXA 2NSPA 3OY9A 3OIPA 2UWMA 4BJ6C 1PE9A 2KHMA 3CESA 3I9V2 1NRKA 2QX3A 2HZDA 2X3HA 4Z05A 2K9LA 1O8IA 3GQ8A 3W3CA 2R7SA 1N78A 4BL0B 2X8KA 4KJZA 3K4JA 2W6JA 1KTWA 4P1WA 2LC2A 2K3PA 2MC4A 4QPQA 3VR6A 2XOKA 3D5LA 4FXUA 3F9KA 1Z7LA 1BMFA 4LIUA 2IQ7A 1I18A 3IAS2 3S93A 2X1DA 2CV1A 4F91B 2ZZQA 1BR1A 2NZMA 3VDXA 2ZTGA 3CF2A 3OYGA 2VQGA 2GJPA 1HVXA 3OEEA 1O8FA 1V5EA 3H9QA 4MLOA 4J00A 4JMQA 4XNFA 4XORA 4E6KG 1H80A 4Z1MA 2UVFA 2WY7Q 3QYEA 1P9QC 3RTRA 1NHCA 2NT6A 3GVLA 4PMHA 4U49A 2KMUA 3OL4A 1RWRA 2WB1A 3AFHA 4Y3OA 2CV0A 4DOZA 3AL0C 4ANJA 2WSSA 5AMVA 2VJJA 3OYJA 2KP6A 4IX7A 4CCNA 2OUMA 3LNNA 3OYDA 4ZYAA 2QKMB 5HLTA 2DT7B 4E7KA 2IGOA 1MW7A 2W00A 3J7AY 2VXDA 2LZJA 4E0FA 4OJ5A 3VSVA 2RREA 2M7BA 3K6GA 1I8DA 2X53S 4LITA 3ZR8X 3K10A 1N77A 1KCCA 3IAM2 1O8MA 4URRA 3TBIA 3ZQQA 2BVMA 2AQEA 1NG7A 4W8RA 2M4GA 2X1CA 3DTIA 5LD2C 1EFRA 1WMRA 2XC7A 3FBNB 1E3XA 4ASUA 2VIXA 4G6TB 4XOPA 2M5SA 2Z8GA 3QOEA 4E4HA 2I8DA 1JI8A 4B3FX 4PSWA 1Y56A 4AYBA 3ZPPA 2LOOA 5CQEA 3ZPNA 2XGJA 4RMNA 1UD5A 3HUGB 4X0GA 3OW7A 4PJLA 4NUBA 1SFKA 4UZUA 2O5RA 2RNGA 4YXWA 3PL8A 2M0MA 3PSFA 2KVOA 3T53B 2JJ2A 3DKXA 4XLAA 2R7QA 2V9KA 3DTKA 3OOUA 1X1DA 1JTAA 3FY3A 4OWRB 1S9HA 1DP3A 4JQFA 1E1RA 1MABA 4H4KC 2Z2SB 2CH0A 4B3XA 2F43A 4TT3A 2INVA 3EUAA 3LSKA 1WJAA 4XL9A 4IQJA 1UD6A 1IB4A 1IDKA 2V1NA 1X1BA 3W2AA 3A4CA 1K6YA 4OZZA 4NC7A 4D1QA 3EUHC 3QODA 4BE2A 3EPZA 2O0WA 4MR0A 2KQRA 2R9VA 2UV1A 4B44A 1OHHA 1OGMX 1R6RA 3ONQA 3SDBA 4L8JA 1H8EA 3OYFA 2KRHA 2GOXB 3H9JA 3OS2A 1G8XA 2KL4A 3MKZA 1X19A 2LBFB 4BE1A 3S3NA 1H8HA 3EQNA 1V5GA 4I84A 1QJVA 3UNGC 2GOMA 3C2HA 3PUBA 3OYMA 1OB0A 4XKBA 2LY1A 1PLUA 4CCJA 1BR2A 2V6EA 4Y33A 2OC6A 4YRVA 2JJ1A 1QU3A 2D3LA 4XLCA 1YX3A 2VB6A 2IS2A 1NBMA 4OZYA 1T5EA 2GK6A 2HLDA 4XKVA 2F4IA 3OR2C 4XKWA 2JVHA 1W36D 1O8KA 2NTPA 3OEHA 3VSUA 2M7AA 3CP8A 2XF6A 1WFXA 4F52A 3G05A 5LFAA 2EWEA 2VBEA 4II3A 1FMVA 2VPLA 3VMVA 4FASD 2L5QA 2CFOA 4R79A 3H94A 3OFNA 3ZXSA 4ITVA 3G2BA 2K9MA 4KKTA 2F6CA 4CZCA 2R7VA 1KONA 5CDFA 2A5WA 4E7SA 2PYHA 3EQOA 2LH9A 3LSIA 4KKUA 3KX2A 3L2UA 1Y6IA 1K5CA 4PUSA 3EUKL 2JVGA 4C2TA 2KRCA 1E43A 3OYEA 3OR1C 5FROA 5KHDA 3CMMA 5FRNA 3DU5A 1OFLA 3UW0A 3K4LA 3DQVC 4XLEA 4BXFA 3LL7A 4OAZA 4XOTA 2KDOA 3K4BA 4KISA 2MYSA 2W6IA 1OOCA 3TL4X 3BCDA 4DNRB 4PJJA 3PNVA 3KEYA 3RSNA 2HPIA 2Q1ZB 2M4KA 3SYTA 1WJBA 4BACA 1WPCA 4BE0A 3K4KA 3KEWA 2VKHA 3S3OA 3T51B 3BG6A 4JOMA 1W9XA 2PJRB 4HNUA 3LMMA 3GQ9A 2NOJB 3JU4A 1MMAA 3GQ7A 1U0JA 4XN3A 1HZEA 2IGMA 4PK4A 2QXZA 1GQ8A 1DQUA 3SUCA 2XAUA 4E7LA 1MNEA 4NQWB 3C2GA 4NC8A 3DDYA 3M8JA 2CUZA 3OYLA 3D5RC 4LG3A 2X6XA 2V7FA 2JIZA 1W36C 3OYIA 3B4NA 1UD8A 2V31A 2LY2A 3B90A 2LBFA 4CH7A 4BQOA 2XNDA 3VYSB 3FKSA 3LSMA 2QKLB 3HG9A 2WAFA 3OYHA 3BH4A 2CK3A 3RCOA 3VYTB 3ZCOA 3E1SA 4HNTA 4BJTA 3OS1A 3OPOA 3U21A 3ZSCA 2DXIA 4BJ5C 4XD7A 3GBGA 2VJ4A 5HKKA 4RLQA 2VJIA 3GVKA 1UD4A 2IS1A 4HSRA 1VBLA 4DJAA 1EA3A 4DK1A 2WAEA 1VZ0A 5TGTA 2R7UA 2QY1A 5HVQC 1PKVA 2NTQA 3OYBA 2LRDA 4NNJA 4G7WA 3BG7A 3IUOA 4YZQA 1X4PA 2XZOA 2Y0SA 5JHFA 2BW3B 4BQQA 2O04A 4DGWB 3V42A 1V0FA 4B47A 2E5NA 3DPUA 4E7ZA 3KYLA 4BDYA 1E1QA 1DBGA 4AU7A 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  2PEC A;  1KCD A;  4I84 A;  1RU4 A;  3EQN A;  4C2L A;  1QJV A;  4XMY A;  2NSP A;  2O1D A;  4XN0 A;  1PLU A;  1IDJ A;  4XM3 A;  1PE9 A;  2QX3 A;  2X3H A;  4Z05 A;  4XLC A;  1CZF A;  1O8I A;  3GQ8 A;  4OZY A;  2NTP A;  4XKV A;  4XKW A;  1XG2 A;  1O8K A;  3GRH A;  1KTW A;  3B8Y A;  3VSU A;  2BSP A;  4EW9 A;  2VBM A;  2VBE A;  2EWE A;  4Z03 A;  1O8E A;  1O8L A;  2IQ7 A;  3VMV A;  2X85 A;  2NZM A;  4OJP A;  4XR6 A;  1O8F A;  2PYH A;  3EQO A;  4OJO A;  1OFM A;  3KRG A;  4W8S A;  1K5C A;  4AVZ A;  4XNF A;  4Z06 A;  4XOR A;  1H80 A;  2UVF A;  1X0C A;  1NHC A;  1OFL A;  3UW0 A;  2NT6 A;  4PMH A;  4U49 A;  4XLE A;  1RWR A;  1O8H A;  4NK8 A;  1IA5 A;  4W8Q A;  5AMV A;  4XOT A;  2VJJ A;  1OOC A;  4YEL A;  4MXN A;  2X6W A;  1QCX A;  3GQA A;  4OJ5 A;  3VSV A;  4YEJ A;  1O8J A;  3GQ9 A;  1O8M A;  4URR A;  1KCC A;  1RMG A;  1O88 A;  4U4B A;  2UVE A;  2ODL A;  3GQ7 A;  4W8R A;  5C1C A;  4XN3 A;  1WMR A;  4YZX A;  2QXZ A;  1GQ8 A;  5C1E A;  4XOP A;  3SUC A;  2Z8G A;  2NST A;  2NT9 A;  4W8T A;  4YZA A;  2X6Y A;  3JUR A;  3ZPP A;  4XQF A;  2X6X A;  2O0V A;  4YZ0 A;  3B4N A;  2O17 A;  3B90 A;  1O8G A;  1HG8 A;  3T9G A;  1PXZ A;  4XLA A;  1DBO A;  1EE6 A;  3ZSC A;  1BHE A;  1JTA A;  3FY3 A;  4NK6 A;  2VJI A;  2INU A;  3LMW A;  1VBL A;  3VMW A;  4OJL A;  2NTB A;  2QY1 A;  2NTQ A;  4XON A;  2INV A;  4XL9 A;  2PYG A;  1IB4 A;  2VBK A;  4XLF A;  4YZQ A;  1IDK A;  4OZZ A;  4XLH A;  4OJ6 A;  3WWG A;  2O0W A;  2O04 A;  4MR0 A;  1OGO X;  1O8D A;  4HWV A;  1JRG A;  1OGM X;  1DBG A;  3VST A;  1AIR A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  1W5S A;  3BTJ A;  2M5W A;  1KCD A;  2ZBU A;  2OV7 A;  3ABK H;  1MGT A;  2LF8 A;  3DBH B;  1OKR A;  2GJR A;  2ZZF A;  2WJV A;  1VF7 A;  2PMU A;  2R7T A;  1CQX A;  2DBB A;  1EF4 A;  2BE5 F;  1TP4 A;  1IDJ A;  1W7P B;  1E2X A;  3E5X A;  4C3J J;  3BZC A;  4Z4V A;  1FNB A;  1O4X A;  3J81 Z;  1CZF A;  1XCB A;  3A35 A;  1W34 A;  4HLX A;  4E70 A;  2W4S A;  4ZC3 A;  2CW8 A;  2FA5 A;  2CS3 A;  2OTJ I;  3FIS A;  1EWY A;  2XAF A;  3K2A A;  4YAU A;  3LSG A;  3KYD B;  4RGS A;  2LK2 A;  4OMZ A;  3S16 J;  1E3P A;  3MCA A;  3KFW X;  3KLN A;  4Y17 A;  3ZMU A;  4IRH A;  1PUE E;  1J0R A;  3KZZ A;  1SD5 A;  3KL9 A;  1GDT A;  2HU9 A;  1LE8 B;  2EZL A;  3JSP A;  3DKY A;  4I0B A;  2XF5 A;  1N75 A;  1R36 A;  1E63 A;  4M9Z A;  2ME6 A;  2ELK A;  4QVA A;  3DFG A;  3AST A;  3ASS A;  1RKT A;  4AIH A;  4J19 A;  2CG4 A;  5TIS C;  1F4K A;  1BI2 A;  4CCL A;  4LFU A;  1MMN A;  2HDN B;  4W8Q A;  4A0Y A;  2B7B A;  3TDU C;  4PGH A;  1MD0 A;  4XBF A;  3CMA I;  4HF1 A;  3FXO A;  2Z6B D;  2X6W A;  5M3F J;  1K78 B;  1MBK A;  5F1J A;  5LBQ A;  3I1F A;  2DQL A;  2BGI A;  3Q0V A;  5FL7 A;  2PMZ N;  1IW7 F;  2G7H A;  1Z91 A;  5IT9 Z;  3H9N A;  3GFI A;  4YEI A;  1D0Z A;  3CLQ A;  2W82 A;  4CCK A;  2VBZ A;  3CDL A;  1T38 A;  2C78 A;  4AC9 A;  2UUZ A;  1YOV B;  1W0K A;  1YW9 A;  3UKG A;  4PAA A;  3WTZ A;  2NV4 A;  3K4N A;  5DN6 A;  1WOS A;  3U9G A;  3LQR A;  1FBQ A;  2XGC A;  2X6Y A;  1OFD A;  1W5T A;  5EEH A;  3L2R A;  1LB2 A;  4L0Y B;  1V0E A;  3P4G A;  1ZLK A;  2E71 A;  3QPL A;  3TP0 A;  3IL2 A;  3CC2 I;  2A6T A;  1N8R D;  3B02 A;  2YX7 A;  4D9J A;  5LGU A;  2IAI A;  2YWE A;  1X1P A;  3MKY B;  3A2K A;  4Z4W A;  2E60 A;  3L2Q A;  2ACJ A;  1Q82 D;  3BTI A;  3DEE A;  1LFB A;  4FTH A;  2DK8 A;  2INU A;  3LMW A;  3BC9 A;  1ULY A;  4HV5 A;  4YFO A;  2Z16 A;  2KDZ A;  4OJL A;  4H0E A;  2ZFU A;  5FLX Z;  4QLC U;  3ZMV A;  4ZTJ A;  1QVT A;  2C6Y A;  1TWC J;  1QGY A;  2ZZG A;  4QFM A;  1XMK A;  2RV8 A;  3DEW A;  1LEA A;  5E1X A;  3WHC A;  1D5Y A;  4CCM A;  1D1A A;  5FO5 A;  3TW7 A;  4YIF A;  3CO7 C;  5CKT A;  3GCM A;  2DER A;  3OYK A;  3PEN A;  1M1K D;  1J9I A;  1TT0 A;  4WK8 F;  2MA3 A;  3A8J A;  1YX5 A;  1TLL A;  3FWE A;  3H3V K;  2VE8 A;  2GM4 A;  3TH0 A;  3HGG A;  5JI6 A;  2VOP A;  2R5Z A;  1VND A;  1WQ2 A;  4PGO A;  2IA0 A;  2WTE A;  4LB5 A;  1E79 A;  1RU4 A;  4YAL A;  4M53 A;  4XK4 A;  3BH7 B;  3W2I A;  4YAW A;  4PFO A;  2ZC2 A;  3QP5 A;  3OYC A;  2C2W A;  1W1W E;  2TRT A;  3NRV A;  3W2E A;  1UB9 A;  3CCU B;  1V5F A;  2JA6 J;  3CC7 I;  5ILS A;  1OFC X;  1RI7 A;  2DYS H;  5AN9 A;  1KZL A;  2Z99 A;  2XT4 A;  3CCL I;  1BIB A;  1LQ1 A;  5ILU A;  3AVU A;  2VBW A;  3TKY A;  4LIV A;  5K5Q A;  3OMY A;  1RUO A;  2ZL6 A;  5F4J A;  2XPV A;  2VE9 A;  4FET A;  3R0J A;  2YWF A;  1IN5 A;  2K5C A;  4HA8 A;  3SEZ A;  2OCE A;  3VYU B;  3LOC A;  1UAA A;  2QEX B;  3DU1 X;  2X85 A;  2ID6 A;  4PC7 A;  3GSI A;  2DCE A;  1U2R A;  2EV0 A;  3OE7 A;  2OBR A;  2F5E A;  2L4M A;  1I1S A;  1LFP A;  3E6B A;  1VQO B;  3E97 A;  4B4C A;  1QZZ A;  4XLP F;  2JRM A;  1Z21 A;  2FQ3 A;  4U0W A;  1H8A C;  3NAU A;  1X3U A;  1FND A;  2ELJ A;  4M6X A;  2BM0 A;  1O8H A;  2E1N A;  2B7C A;  3G71 I;  3CPW B;  1QQ1 A;  2DOE A;  4OAY A;  1Z67 A;  1T0F C;  1MND A;  3L1P A;  3G4S I;  4RDK A;  5D6F A;  2CQ7 A;  1K8A D;  1BX0 A;  2QUF A;  2FML A;  4B3G A;  2HVQ A;  1GVD A;  4HRI A;  3I58 A;  2K9Q A;  4KMU X;  2HOA A;  2VQL A;  1QX4 A;  4TMT A;  4CUG A;  1WJ5 A;  1QHG A;  2HNH A;  3GQA A;  2E2J J;  2QYU A;  1Z3Y A;  3WE2 A;  4IHT A;  5D5U B;  1D0Y A;  2P7V B;  1O8J A;  2AHQ A;  2VC0 A;  3Q0U A;  2L7K A;  2F4M B;  3JRB A;  2K3F A;  5FRM A;  4Y9U A;  1CLW A;  4U4B A;  5C1C A;  3CCE I;  1VQP B;  2ETH A;  3G1O A;  4ZYE A;  1Y8Q B;  3OW2 B;  4MEX F;  4CDG A;  3H1C A;  4CQJ A;  2R0Q C;  1Q1V A;  2ISY A;  3KE2 A;  3IC7 A;  4RLF A;  2NT9 A;  4J01 A;  4G6I A;  1ETO A;  2IS4 A;  4RM0 A;  3JUR A;  3FDY A;  1HW5 A;  3VYR B;  3ZBT A;  1DG1 G;  5GAH J;  3UR3 C;  1NDH A;  4B48 A;  1XDS A;  3SZP A;  1YJN B;  1WU8 A;  3BQY A;  2VQC A;  4MIM A;  2DT6 A;  1O8G A;  3CF5 F;  2CQX A;  3W6J B;  4HOB A;  2NAZ A;  2ME0 A;  4BHB A;  3GZN B;  3KP4 A;  4UNO A;  1ZGW A;  1I3A A;  4RJL A;  4IRI A;  3OZV A;  3FM3 A;  1YLF A;  1ETV A;  2HZT A;  2QEN A;  3S32 A;  1JKQ C;  2XC1 A;  4P9U A;  3SJM A;  3AK5 A;  5HZB A;  1MBF A;  2ZJ2 A;  1FNC A;  2BXZ A;  1D1B A;  2BY1 A;  3GQB A;  4RD2 A;  4WZL A;  3AL0 B;  3GFL A;  3QU6 A;  5CYV A;  4ZDL A;  1D2E A;  2JJ7 A;  3HHH A;  3CD6 B;  4A2U A;  2MD0 A;  4HWV A;  3HPH A;  4Z2Y A;  2DMQ A;  1S8N A;  4N3G A;  4CSW A;  1H88 C;  3HM5 A;  3VST A;  2XAH A;  2B63 J;  3TMO A;  1GT0 C;  3BCB A;  3RDI A;  1O7L A;  1N05 A;  1DAB A;  1QVU A;  2A05 A;  5FO1 A;  3H92 A;  2P3M A;  5TV2 A;  1R5H A;  2IVM A;  1VQL I;  3HOY J;  4P6V F;  1G3Y A;  2KT0 A;  1EP1 B;  3E20 A;  2IP2 A;  2G9W A;  2K4J A;  3VEP A;  5A8A A;  4HDU A;  3GQ8 A;  5LLQ A;  2XAJ A;  3WGG A;  5E3N A;  3TOB A;  4LG0 B;  3PUN A;  1K73 D;  3FXL A;  2MC4 A;  3RQI A;  1WXR A;  3C1D A;  4FXU A;  3LQQ A;  4Q47 A;  3HOX J;  2VNJ A;  4LIU A;  3MZH A;  3S2D J;  2MBF A;  3GLL A;  1I18 A;  2IQ7 A;  2CV1 A;  2STW A;  4F91 B;  2ZZQ A;  4Y13 A;  1OYW A;  3WTY C;  2GJP A;  1HVX A;  2LTP A;  1TYU A;  4G7O F;  3BY2 A;  5CJ9 A;  4Z4Y A;  4HYE A;  5DS9 A;  2EH3 A;  2P5V A;  1YFH A;  4M1K A;  1H80 A;  2JSC A;  4UVC A;  2UVF A;  3QYE A;  1TL8 A;  1P9Q C;  3RTR A;  2NVQ J;  4OU0 A;  2GXA A;  1GO2 A;  1RWR A;  3FMQ A;  5J47 A;  1LFU P;  2HXI A;  2WB1 A;  4A3G J;  3AL0 C;  4ANJ A;  4IHV A;  5IP6 A;  2XTW A;  3E3V A;  3OYJ A;  1L1I A;  4IX7 A;  4IHW A;  5H6R A;  5E1Z B;  3RYP A;  5HLT A;  4EEF G;  2DT7 B;  1MW7 A;  3CME B;  2O3F A;  4E0F A;  3BY1 A;  3K6G A;  2ZME C;  2JRT A;  3A03 A;  4LIT A;  4GGG A;  3ZR8 X;  1GXQ A;  1QPI A;  2STT A;  1JKO C;  1Z05 A;  5DCM A;  1NTC A;  2QQ9 A;  5AIP A;  1O8M A;  3NEU A;  1I6X A;  5F6F A;  1B9M A;  1NG7 A;  5KK1 A;  4G9Y A;  2M4G A;  2X1C A;  3DTI A;  1UFM A;  3KIO A;  3CCV I;  1MJA A;  5LD2 C;  1Y1W J;  4N3N A;  1OB5 A;  1QVF B;  4LJZ F;  4XOP A;  2M5S A;  2FU4 A;  1LNW A;  4RD4 A;  5IYN A;  2BX6 A;  1XCV A;  2P8T A;  3ZBU A;  2E35 A;  2DMU A;  4AYB A;  3DBL B;  2DLL A;  3W5H A;  3ZPN A;  2XGJ A;  1ZAR A;  4IXA A;  4RMN A;  2VFP A;  3IH4 A;  3HUG B;  3BR5 A;  4YFK F;  2OA4 A;  2NS0 A;  4PJL A;  4NUB A;  5EMN A;  2F4O B;  3LA2 A;  1YS6 A;  5DM6 F;  3ZQI A;  2RNG A;  3K1M A;  4UVB A;  3J80 K;  2M0M A;  1MDM B;  2CC2 A;  1R4N B;  1MRZ A;  2KVO A;  3T53 B;  3OIO A;  3ASQ A;  1QVG B;  4KN4 X;  5HXB A;  3DTK A;  4O5V A;  1EFC A;  3QE2 A;  1JTA A;  3ZZU A;  1TNS A;  1ZUN B;  1DP3 A;  3BDD A;  3ECH A;  4OIP F;  1ZH5 A;  1Q1H A;  5IYP A;  1E1R A;  2ZJR F;  3LYC A;  4H4K C;  4TV7 A;  4BAY A;  1KU2 A;  2DO7 A;  2INV A;  3S1Q J;  1VQM B;  2X4H A;  1K83 J;  1I5Z A;  4I99 C;  1TLH B;  2LKS A;  3V4G A;  2V1N A;  1X1B A;  4OZZ A;  2FX3 A;  4NC7 A;  4HX4 A;  3QOD A;  4JX6 A;  3I55 I;  3I4M J;  1TYV A;  2ZNY A;  3R4K A;  2J5O A;  4ON0 A;  1S0U A;  3OOP A;  1K4Z A;  2GOX B;  5FFZ A;  1VQ5 I;  3H9J A;  4LK0 F;  4BE1 A;  2KL4 A;  3E6D A;  2K9N A;  3RIR A;  5HLG A;  5JLW A;  4RPD A;  5D4S A;  1LJ9 A;  1N25 A;  3PUB A;  2D45 A;  4Q5S F;  4NCN A;  1OYI A;  1GV5 A;  1OB0 A;  2AHO A;  3PET A;  3PUF A;  1G3W A;  4CCJ A;  1BR2 A;  3FKI J;  4IW3 B;  1VQN I;  2OC6 A;  2DPU A;  3EUH A;  2XAG A;  4OPO A;  5DCF A;  2D3L A;  2A69 F;  4XLC A;  3HDD A;  1SVO A;  5C3E J;  1NBM A;  1ZHF A;  4A3D J;  4XKV A;  4XKW A;  1XE1 A;  2NTP A;  2JVH A;  1HBX G;  1YHQ B;  3B6A A;  3VSU A;  1Y1V J;  4GCV A;  1WFX A;  4F52 A;  2EV5 A;  4II3 A;  5M5X J;  5K5O A;  3BZ6 A;  3AVT A;  1XGS A;  2F2E A;  1FMV A;  1TTT A;  2L5Q A;  2VC1 A;  3KCC A;  4RD1 A;  5F27 A;  2K9M A;  4KKT A;  4ROX A;  2A5W A;  4OP7 A;  3EQO A;  3LSI A;  3L2U A;  2EIK H;  1K5C A;  1S7A A;  1IRG A;  3BR0 A;  4PUS A;  2KRC A;  1U5T B;  3OYE A;  4ENM A;  3OJX A;  4YG2 F;  4I6Z A;  1TTY A;  3CMM A;  1B23 P;  2H09 A;  1OYY A;  3REO A;  1ORK A;  5D5X B;  1JKR C;  4L18 B;  1B72 A;  4P6Y A;  1Z6T A;  9ANT A;  4OAZ A;  4LGW A;  4XOT A;  2LD5 A;  2MYS A;  2IEK A;  1KU7 A;  2QGU A;  5BPD A;  2E1C A;  1VQ8 I;  3HSF A;  1OR7 A;  5C4J J;  2E7W A;  4UUT A;  5EZG A;  4BYY A;  2OJE D;  2DA1 A;  3D1N I;  4UB8 C;  3E6M A;  3PM1 A;  4BAC A;  4BE0 A;  3K4K A;  2VT2 A;  1WGX A;  2Z9O A;  1IDZ A;  2VKH A;  3GQ9 A;  3LMM A;  4BH9 A;  5JBQ A;  1BBY A;  2IGM A;  4CYC A;  4G1V A;  1GQ8 A;  3F72 A;  2QXZ A;  4DYC A;  2KKO A;  1DQU A;  4M6Y A;  4AF7 A;  2O6W A;  4RGX A;  4E7L A;  2VFM A;  1HCR A;  5FKK A;  1K61 A;  2B0R A;  2FD5 A;  3HYI A;  5J4V A;  3DLL F;  1OGI A;  4ESF A;  2YPR A;  4IRG A;  2V7F A;  4RAY A;  1X3Z B;  2DTZ A;  3FPK A;  4ACB A;  1JGS A;  1XD7 A;  2KIU A;  5GAE J;  1REP C;  2V31 A;  4M73 A;  3MVP A;  4BQO A;  3VYS B;  3F23 A;  3LSM A;  2BM5 A;  3HG9 A;  3E1Y E;  2VT3 A;  3I64 A;  3BT9 A;  5KAI C;  3ZCO A;  4HNT A;  2QCO A;  5EEA A;  3U2R A;  1E3O C;  5DNS A;  3ZSC A;  1H0M A;  4XD7 A;  3SQN A;  5FKM A;  2OTJ B;  1W87 A;  5HKK A;  1HDD C;  3K1N A;  1UD4 A;  2IS1 A;  4XLN F;  2BV3 A;  4LBV A;  2Y9Z A;  4P3I A;  3WG9 A;  5TJJ A;  2QY1 A;  1UJ8 A;  5IYD J;  3OYB A;  2ZXJ A;  1YJW I;  3HRM A;  3QOP A;  3F6V A;  5E8G A;  5FB2 A;  2FXA A;  3I0T A;  1E62 A;  4YZQ A;  1D8T A;  2Y0S A;  5JHF A;  2BW3 B;  1W35 A;  1FZP B;  4V19 K;  5FNZ A;  4OPW A;  1UZC A;  1Q81 D;  2OCC H;  4HX8 A;  3VSK A;  3KLO A;  5GV7 A;  2MC3 A;  1BL0 A;  4PZJ A;  3WQZ A;  4Q48 A;  4S0H B;  1LVK A;  4NHJ A;  2BXY A;  4HEA 2;  1VJS A;  3IP4 B;  1WKM A;  1KK1 A;  4XN0 A;  2DA3 A;  2DYR H;  3CMA B;  3Q9S A;  1JTX A;  2KPM A;  3NWT A;  1ZEL A;  3E5U A;  3JQR A;  4QVJ A;  1MBE A;  3I59 A;  1RR7 A;  2L02 A;  1W0J A;  3FHZ A;  3BLY A;  4O3M A;  4XRF A;  3J7Z I;  1H85 A;  3LVB A;  1H89 C;  2XIG A;  1VQ7 I;  2HMA A;  4RM2 A;  5J3L A;  2XKO A;  2Z3Y A;  2NS7 A;  1RPW A;  3S14 J;  2KRF A;  4UV9 A;  1FDR A;  5EG0 A;  4G1B A;  4RDU A;  4KH3 A;  4F92 B;  3TO6 A;  3DPT A;  2L3D A;  5CVV A;  2PJR A;  4X7E A;  1J9Z A;  4OJP A;  1XMA A;  4U0Y A;  2EZH A;  4H9G A;  2VOD A;  2EK5 A;  1G4D A;  1AKH B;  2ZXH A;  1COW A;  3WY9 A;  2OBS A;  5A2Q Z;  4A3F J;  2DMT A;  4ZDO A;  1Q7Y D;  3VNV A;  1PUF B;  2PIA A;  1DP7 P;  2JTV A;  3WTU C;  3CC2 B;  4D0P A;  2R7W A;  2HQA A;  1IC8 A;  4AWX B;  1T6S A;  3SEQ A;  3W2W A;  2XT2 A;  3V8L A;  1IXC A;  3ZRG A;  2FMY A;  1ON2 A;  4KIG A;  3VOD A;  2E19 A;  4G7H F;  3BWG A;  3WOD F;  1ZG5 A;  1QCX A;  4RAF A;  2LRE A;  5ICF A;  4ZYH A;  4DNT B;  2ZXW H;  2OD5 A;  3KZY A;  4EM0 B;  3HOU J;  2MAB A;  2KZV A;  4CHU A;  1VLO A;  4TKO B;  4YEJ A;  2FE3 A;  3JRG A;  4FQG A;  4Y4R A;  3JW4 A;  2E1O A;  4OPS A;  3ISP A;  3LAJ A;  3VMF A;  2UVE A;  2RQP A;  3IWF A;  4ETS A;  1FSE A;  2YUH A;  3IV5 A;  3LSH A;  3FIW A;  2DEU A;  2JUG A;  1DGW Y;  3CJT B;  2NST A;  3GTQ J;  3HTU A;  4M3B A;  4NB5 A;  4U7B A;  3CCY A;  3Q6R A;  4IHY A;  4BHC A;  4G7X A;  2IGK A;  5JR3 A;  2CND A;  4IOA F;  2ESN A;  2AQF A;  3BCA A;  4LMY A;  1QFY A;  1MBH A;  1KA8 A;  1R5O A;  2VNK A;  2J7K A;  1SFO J;  1C0W A;  3CUQ A;  3WTW C;  1QGA A;  2CRV A;  2O17 A;  3H9G A;  3WBJ A;  1U9N A;  3VO1 A;  1D1C A;  1FLI A;  2OQR A;  2ZSI B;  4RD3 A;  3AG1 H;  4G8X A;  5E18 F;  3A8I A;  2E1R A;  1IJW C;  3GLX A;  4HE6 A;  2HXO A;  1YE9 A;  1WHU A;  2XZL A;  1DBO A;  1LLZ A;  4EJO A;  3CC7 B;  2F5V A;  2R4G A;  3CCL B;  1YIJ I;  4HIZ A;  1MMS A;  2GQQ A;  4I09 A;  2DDB A;  4DIQ A;  1F1Z A;  3W2F A;  2DI3 A;  2JDI A;  5HZA A;  4MQV A;  3FX3 A;  2R92 J;  1IG7 A;  4DK0 A;  4XON A;  2F3L A;  1HF0 A;  1BW5 A;  2MLK A;  3S17 J;  3TED A;  1FYM A;  1YLO A;  4RD0 A;  4IEJ A;  1QRB A;  3QYF A;  1OGO X;  3FK6 A;  1JRG A;  3JQP A;  2C4T A;  1OIS A;  4GRI A;  4PAB A;  1MBJ A;  1G3S A;  1HQC A;  5HDG A;  2XSJ C;  3EQL F;  3NE5 B;  4EJU A;  1OLT A;  2A68 F;  1WSR A;  1NB0 A;  1WP6 A;  4QV2 A;  1AA7 A;  1X1C A;  2P0W A;  3A3G A;  3G71 B;  1OB2 A;  1IHM A;  3QRF F;  3G4S B;  4BEH A;  5F0H A;  4C2M J;  5J1U A;  5FA6 A;  1XB2 A;  2TDX A;  2I10 A;  4N0B A;  2DOD A;  2HI3 A;  1UD2 A;  4GFB A;  2VQH A;  2CUE A;  3P7N A;  1E0E A;  2QTZ A;  2BSP A;  2VL8 A;  1XMX A;  1FIA A;  2Q2E A;  1QA6 A;  3GZ5 A;  4BXX J;  3J7Y J;  3IH3 A;  5KVR A;  2DA7 A;  3DCF A;  2PG4 A;  1HOM A;  1T95 A;  3CCE B;  2EZI A;  4Q7J B;  5HS8 A;  3BCF A;  4C3I J;  3GIR A;  4KT5 C;  3K4M A;  3OWT A;  4A0Z A;  3R0A A;  1YYV A;  3JRC A;  4XRS A;  1N0U A;  4OJO A;  4OIQ F;  3SJZ A;  2WPD A;  5HLH A;  4BY7 J;  4KYW A;  1U3E M;  4CA0 A;  3F8C A;  3I3L A;  3HOT A;  1K7A A;  1MIJ A;  1XGO A;  4V2G A;  2VNI A;  2G7U A;  2E7X A;  3BOQ A;  3AVX A;  1IA5 A;  3J81 K;  1V55 H;  4E7H A;  3CZ6 A;  3PIP F;  2K9S A;  2L9N A;  3V8K A;  2W84 A;  4MNU A;  3ZQG A;  3B78 A;  3LQ6 A;  1NJI D;  1IAW A;  4RM3 A;  4XRS G;  1Q86 D;  4PFP A;  2ESH A;  1Z3X A;  2C4U A;  3SFI A;  1E3Z A;  4II2 A;  1HLV A;  3DLA A;  5BSY A;  3GVA A;  2DTR A;  4MQ9 F;  2HFH A;  1RKW A;  2E1B A;  3DKW A;  1O88 A;  4HG2 A;  2ODL A;  2RGV A;  3K9T A;  2HQN A;  2KJC A;  3M1C A;  3W2V A;  2IJL A;  3GW2 A;  1QBJ A;  5IPA A;  1KQ8 A;  1HC8 A;  1VF9 A;  1IUY A;  2FX0 A;  4LBY A;  3M8E A;  1GXP A;  3HAG A;  2L2O A;  2F48 A;  5KNL A;  3LFU A;  5JVT A;  3RQ4 A;  3GTG J;  3CP2 A;  4XQF A;  1B6A A;  5KCM A;  2VFO A;  1OQY A;  3ISX A;  1Y0N A;  2X3U A;  3ZZT A;  3L2V A;  1B8I A;  3R6J A;  4EQQ A;  1VQL B;  1HG8 A;  1EH7 A;  3T9G A;  2IXS A;  4Z6Y A;  5EGO A;  2YU9 J;  4WWV A;  2CRG A;  2F1M A;  2W7N A;  2VBT A;  4IHS A;  4XID A;  2RKH A;  3HC7 A;  3GTO J;  5IT9 K;  3PJR A;  2FBI A;  3CCJ I;  1BJK A;  2XAQ A;  1YRN B;  1ZYR F;  1D3Y A;  4IPA A;  3H5A A;  3HL2 A;  1ENH A;  4HQE A;  1MKM A;  1X58 A;  2WAD A;  5FJ8 J;  1K28 D;  4BUP A;  4KKS A;  2OPT A;  4MTE A;  1QG0 A;  3I4P A;  1G7T A;  3V7R A;  4A3L J;  1BOB A;  5ICE A;  3BTL A;  1JA0 A;  3GYH X;  3VSL A;  2R5Y A;  1PDN C;  1HDP A;  3KET A;  2V7Q A;  4FK8 A;  5CPR B;  2BGC A;  2Y75 A;  1RC9 A;  5HS7 A;  3JRE A;  4TMZ A;  1DGR M;  2QE7 A;  3RIQ A;  1IB0 A;  2XF7 A;  3PIO F;  4EJW A;  4NBQ A;  1ELO A;  2GWR A;  1O8D A;  2I1L A;  4BS9 A;  5L3B A;  3ZUG A;  1BOA A;  2W85 A;  4XKC A;  5DEQ A;  1U8R A;  1ZTR A;  1KK3 A;  1BN8 A;  3SZT A;  3B8H A;  5BSX A;  1OR7 C;  3GF2 A;  3G6E I;  2O0Y A;  1XSV A;  3JRH A;  3ZMT A;  2BHZ A;  1Y39 A;  5DYM A;  4UUV A;  2AO9 A;  4EV0 A;  3VOE A;  2PFB A;  2DMN A;  1EV7 A;  1NRK A;  2HZD A;  3SDG A;  2LR8 A;  1OCP A;  2K9L A;  4P25 A;  5ICC A;  1JB9 A;  3BZK A;  4IJA A;  3W3C A;  5BQT A;  2R7S A;  4BL0 B;  4DQK A;  5HS9 A;  5FLX K;  2ZIT A;  1KTW A;  4P1W A;  2BVN A;  2NVU B;  2XOK A;  2MD5 A;  4HDV A;  3MCZ A;  3WTS C;  2O8X A;  3F9K A;  3I56 I;  3A01 B;  1Z7L A;  5DD4 A;  5HLI A;  1DU0 A;  2R93 J;  2FVG A;  4D7M A;  4X7F A;  4B8X A;  3CCV B;  3IAS 2;  5JFR A;  2FF4 A;  2X1D A;  3T1B A;  4F7Z A;  1UMQ A;  1WVR A;  4JX5 A;  4I7H A;  2HQ5 A;  4WZT A;  2NZM A;  5LRS A;  3CF2 A;  1BN5 A;  5J6X A;  3OYG A;  3OEE A;  5E3M A;  1V5E A;  2X0K A;  5K1Y A;  1NK2 P;  3H9Q A;  1K9M D;  5E6T A;  4MLO A;  1ZM3 A;  3BY6 A;  2LFB A;  2QQA A;  2IRF G;  4WF2 A;  3S1R J;  1TC3 C;  3HKZ N;  2QF7 A;  1UHW A;  2V7V A;  5E1W A;  3SYJ A;  5M5Y J;  2CV0 A;  1KZH A;  1JUS A;  1OGJ A;  4U0V A;  3OZW A;  5GPA A;  2NYX A;  3OSF A;  2P7C B;  3WU2 C;  2KP6 A;  1S6L A;  4E7K A;  2W00 A;  5BPI A;  2BYV E;  2VXD A;  5IYR A;  3VSV A;  3EYY A;  2WR8 A;  1QRC A;  3K10 A;  2DMP A;  1T2K A;  1N77 A;  1K6O A;  4URR A;  3BR1 A;  3T8R A;  2AQE A;  1ETY A;  2BY0 A;  5IP7 J;  4Y9R A;  3MN2 A;  3SZE A;  1EFR A;  4M71 A;  4M74 A;  2O6G E;  4KNY A;  4XSZ F;  2PI0 A;  1WMR A;  1E3X A;  3I55 B;  1O3T A;  2VIX A;  4ZZD A;  2EIM H;  2Z8G A;  3QOE A;  4E4H A;  2I8D A;  4GYG A;  1JI8 A;  4PC6 A;  4YFX F;  1ZK8 A;  2HDC A;  3LSR A;  4B3F X;  2V5I A;  4LLL A;  3ABL H;  3QP6 A;  1ZKG A;  1TWH J;  3O3K A;  5J8C A;  1SEU A;  1JJ8 C;  1WCM J;  5J4Y A;  1NK3 P;  2X6O A;  1E64 A;  1VQ5 B;  1UD5 A;  4CXF A;  3M07 A;  3QSY A;  3OW7 A;  5EEG A;  4Z4T A;  4UZU A;  2JA8 J;  1BA5 A;  1VQN B;  2QBY A;  1QFJ A;  1UST A;  3F21 A;  4XLA A;  3SFZ A;  2DDA A;  4AIJ A;  4FX4 A;  1JA1 A;  1B9N A;  2O7O A;  1J7K A;  2V1D A;  4FCY A;  4OWR B;  1S9H A;  1Y0U A;  4RB3 C;  3C2B A;  2H1K A;  3H3Z A;  2Q6K A;  1D5V A;  1WZ2 A;  2Z2S B;  5DUI A;  2V79 A;  2F43 A;  3HZJ A;  1G6N A;  4TT3 A;  4Y7N J;  3EUA A;  3LSK A;  4XL9 A;  3EDP A;  1DPU A;  2HCJ B;  5B1B H;  3W2A A;  1K6Y A;  2K7L A;  4D1Q A;  4EJV A;  2O0W A;  4BE2 A;  2QA4 I;  3P9C A;  4MR0 A;  3LA7 A;  2KQR A;  2IA2 A;  3JTG A;  1OHH A;  4YCQ A;  4M3G A;  1B2R A;  3CPX A;  3OYF A;  5DDG A;  5H2F C;  4A12 A;  1LEB A;  3W2G A;  5KW9 A;  3OS2 A;  1G8X A;  3MKZ A;  3B82 A;  3Q38 A;  2LBF B;  1APL C;  1FBS A;  5THX A;  3C2H A;  5JVG F;  2VBX A;  3FMS A;  1FT9 A;  4L9N A;  4FE4 A;  4XKB A;  3PUM A;  3U6K A;  4PC3 A;  2AXT C;  3PQK A;  4Y33 A;  1W5C C;  2JJ1 A;  1S7E A;  3FMR A;  1TBX A;  4ASN A;  2VB6 A;  1RIO H;  4UY8 I;  1T5E A;  2K02 A;  2GK6 A;  2DT5 A;  3OR2 C;  3OEH A;  2FBK A;  2DAO A;  2HYF A;  1NH3 A;  2VBE A;  2A3S A;  1GVH A;  2BPO A;  5FGM A;  3BQJ A;  2ZME B;  3WGI A;  1UG2 A;  2CFO A;  4KUM A;  4UXN A;  3H94 A;  3K2Z A;  4PGG A;  3OFN A;  3G2B A;  4A3M J;  4Z4U A;  5CDF A;  1KON A;  2K4B A;  3CUQ C;  2WV0 A;  3TO7 A;  2YS9 A;  4RA2 A;  2MH9 A;  2CGP A;  1KJZ A;  2XTY A;  1HSJ A;  1YW7 A;  2HGC A;  2JVG A;  2KIF A;  2HKO A;  5EZH A;  4KA4 A;  3DU5 A;  1OFL A;  2HTJ A;  3UW0 A;  3OSG A;  2XPU A;  2CQQ A;  1V3F A;  1K8F A;  3K0L A;  1HA3 A;  2OZU A;  3ZP5 A;  1FTT A;  1TQM A;  1G2H A;  1CF7 A;  4LK1 F;  1STZ A;  1YJ9 I;  3TL4 X;  1G7R A;  3BCD A;  5LGN A;  2D74 A;  1L3L A;  2Q1Z B;  5DM7 F;  1JUP A;  2CW5 A;  1U9O A;  2CBX A;  1QQI A;  3SYT A;  1CNE A;  5HDK A;  1U78 A;  3SKB A;  2L9V A;  4CZZ A;  4PCQ A;  2PQ8 A;  1JJ6 C;  1YIO A;  1YJW B;  3T51 B;  1IJF A;  1VQ9 I;  1SMT A;  4GO1 A;  2NOJ B;  4ZYD A;  1QH0 A;  3JU4 A;  1YW8 A;  3U2Q A;  5H20 A;  4LLN A;  4XN3 A;  1HZE A;  5A88 A;  3GQ7 A;  4PK4 A;  1B59 A;  2V7U A;  1HKQ A;  2XAU A;  1WOR A;  2IW5 A;  2VKV A;  3ELK A;  2M1B A;  2XV4 S;  3DDY A;  3DEU A;  4A69 C;  4ZH4 F;  4OPV A;  3M8J A;  3OYL A;  3D5R C;  4N9H A;  3MEX A;  5IYQ A;  1MJB A;  2X6X A;  3ABU A;  5DTD A;  3OYI A;  2PLY A;  3B4N A;  2EB7 A;  4CH7 A;  2CF4 A;  5E20 A;  2DK5 A;  1RNL A;  1F5T A;  2WAF A;  3CXC B;  1SD4 A;  3VB2 A;  1WWX A;  4YFN F;  3X2Q H;  3OS1 A;  5CVJ A;  2WV1 A;  1ZG1 A;  4L5E A;  1ODD A;  2JZY A;  3GBG A;  1USS A;  4MTD A;  1VQ7 B;  2VJI A;  2GIZ A;  2L7F P;  5FKO A;  1NB9 A;  2ZL5 A;  3WXM A;  4A3J J;  5DV5 A;  4D7N A;  2EFG A;  4DJA A;  2WAE A;  2R7U A;  2M2E A;  5CVI A;  4K2E A;  4G7W A;  3BG7 A;  3R61 A;  4A6E A;  1HF2 A;  2OBP A;  1X4P A;  5TRD A;  1LLW A;  4BQQ A;  4UZF A;  2O04 A;  4DGW B;  1TSP A;  1V0F A;  3C7J A;  4OIN F;  3HRU A;  3ZOB A;  3ZQ7 A;  5D8L B;  3ES9 A;  4RDL A;  5IOZ A;  4WX9 A;  1SAX A;  2QQ8 A;  4HF2 A;  1LDK B;  2PN6 A;  3HGY A;  3H5R A;  4DZP A;  3G3Z A;  1UD3 A;  3GXO A;  1EFU A;  2Y31 A;  5GAD J;  4C2L A;  2NS8 A;  2ZO4 A;  1R1U A;  3BC8 A;  2ZXI A;  2EIN H;  3IH2 A;  3T5X A;  3OZU A;  4NBS A;  5D5W B;  1X4O A;  1QGP A;  3FK7 A;  3RI4 A;  2EA2 A;  2WYR A;  2ICW G;  2XNJ A;  3WNB A;  3LAP A;  3A1Y A;  5AIQ A;  3ZMD A;  5F1R A;  2QLZ A;  1TWA J;  1N06 A;  4TMX A;  3TQN A;  3W5V A;  3AKZ A;  4WZK A;  3RY8 A;  2VBM A;  2R7Z J;  2CO5 A;  4LD5 A;  4B3A A;  2QDX A;  2VYQ A;  3U1D A;  3M4O J;  2F5C A;  2DA4 A;  1A04 A;  1I1G A;  3DV8 A;  1QHH D;  1Y0Y A;  5F4O A;  2JWT A;  3HOS A;  3W6K B;  1QRY A;  1FOX A;  3AVY A;  2GAU A;  4NQW A;  2QEX I;  4B09 A;  4IZZ A;  1IZ1 A;  3FHN A;  3ZGK A;  4F3Q A;  5KAF C;  2R5Z B;  5ILV A;  2DY1 A;  1FSH A;  2XGX A;  4GQN A;  3MD2 A;  3OYN A;  3E0J B;  1TWG J;  2B0L A;  1IDY A;  3F8B A;  4I02 A;  2AXL A;  2KZG A;  3BPX A;  1A8P A;  4KIT B;  5ERI A;  4NK8 A;  5BOX A;  3CJQ B;  3RJP A;  1SKQ A;  1T39 A;  5CLS A;  1F43 A;  4QUZ A;  1YIJ B;  3V76 A;  3F3X A;  3BG5 A;  5FD6 A;  5DD8 A;  1BW6 A;  3ULQ B;  1DUX C;  3HOW J;  2RAE A;  4QWQ A;  2JA7 J;  2ZJP F;  2R7O A;  1T98 A;  1VQK I;  1N08 A;  2WJY A;  3BR2 A;  2E1M C;  4D5F A;  1HW2 A;  3ZZ0 A;  2BY2 A;  1KQ5 A;  3DP7 A;  4LB6 B;  1TWF J;  5IY5 H;  5F0F A;  2W1O A;  3F22 A;  5FLV A;  1GJR A;  1ERD A;  2QGG A;  2WZP P;  4ENJ A;  1A35 A;  3AG4 H;  2LY9 A;  1FMW A;  1A6Q A;  3ZQL A;  1BPL A;  1WOP A;  3D5S C;  3P9K A;  4HST A;  4F55 A;  5GTI C;  2VN2 A;  4C30 A;  1R5N A;  2IPQ X;  2HR3 A;  3OKX A;  3FPP A;  4YZ0 A;  4CGZ A;  2CQN A;  1T56 A;  1ZM9 A;  2DJI A;  3DU6 A;  3N97 A;  1QNT A;  2QSF X;  1XS9 A;  1BR4 A;  4IQ4 A;  1IJE A;  4I0A A;  3SEJ A;  1W7P A;  3WTX C;  3R6K A;  5IOY A;  1EE6 A;  4X7C A;  3CC4 I;  4U7D A;  1D0X A;  4NK6 A;  3KPH A;  2DQR A;  3BTC A;  3DWL E;  1DDN A;  5DUK A;  3VMW A;  1Z1D A;  2M8G X;  3V7S A;  3GZ6 A;  2XTX A;  2RN7 A;  4F93 B;  4X6A J;  2PYG A;  1O7F A;  5K5R A;  1AU7 A;  5J35 A;  2X1E A;  4XLF A;  2MW8 A;  5JLX A;  1QUF A;  3OJW A;  3N05 A;  4L5J A;  4WWC A;  1IF1 A;  2OYN A;  5D8K B;  3COA C;  1LE8 A;  2GLO A;  4Y52 J;  1N07 A;  2OK7 A;  3MMP A;  2YWH A;  2VZL A;  3A3B A;  3QQA A;  4L9T A;  2IOU G;  4Z4Z A;  1EKE A;  2Y2Z A;  3CLO A;  4U88 A;  1SVM A;  3BG3 A;  4C9Y A;  1EP2 B;  3H0G J;  2VNH A;  2P81 A;  2EBI A;  1TW3 A;  3FXU A;  5K7Z A;  1QZE A;  2Y30 A;  1YTY A;  4XM3 A;  2HKX A;  2X51 A;  2M30 A;  1FJL A;  2RQQ A;  4N4O B;  4AVP A;  1SAU A;  2BVL A;  4ABZ A;  5HOD A;  3R60 A;  4WCG A;  4X07 A;  1TUI A;  2CW7 A;  4EW9 A;  2PLF A;  1CNF A;  2PMZ A;  1MMD A;  1CQT A;  2QZA A;  1J5Y A;  1O8E A;  4XRM A;  2DIE A;  1MZB A;  3CCQ I;  2OQG A;  1J09 A;  1FBU A;  4L9V A;  3K70 D;  3FXJ A;  2EZK A;  2F4N A;  5FIU A;  1OFM A;  3I4N J;  4AVZ A;  4P3Y A;  2BSA A;  3BJO A;  3BR6 A;  3HSE A;  4JK1 X;  1TYX A;  2ZFW A;  4A5M A;  1UG0 A;  2LF7 A;  4PJM A;  3R6S A;  4Y7C A;  2DFH A;  5IYW A;  4BDZ A;  2ZSH B;  1QO0 D;  3ZQC A;  1ZGJ A;  1D1N A;  4DBR A;  3H35 A;  3CRZ A;  2A07 F;  1K79 A;  1XQB A;  3CCM I;  4HAM A;  4ZZL A;  3LSJ A;  3ERM A;  5ED4 A;  1GR1 A;  4J0Q A;  3NQO A;  1LPQ A;  2O8K A;  1PJ5 A;  4MXN A;  2P4W A;  3CCJ B;  2EPF A;  4M72 A;  4ZJZ A;  1FOY A;  4CCO A;  2HOS A;  1FP2 A;  3S3M A;  1G59 A;  1AWC A;  2E5Z A;  4HLY A;  2DA5 A;  2QQB A;  1H42 A;  2QWW A;  4ZV4 A;  2DOF A;  5BS6 A;  2P5L C;  2LG4 A;  2DU9 A;  2KLO A;  4YZX A;  1V5V A;  2YX4 A;  3K69 A;  1FTZ A;  3FM5 A;  3HBL A;  5A2Q K;  1FNM A;  4YZA A;  1J2X A;  4M2L A;  2UZK A;  2IGN A;  2CJJ A;  4G5G A;  4ENK A;  1P4X A;  2LP0 A;  4P5O A;  2GQF A;  3U1K A;  4MYT A;  3PFY A;  2O0V A;  3KP5 A;  4HF0 A;  1BC8 C;  3HOZ J;  2FRH A;  2FQ4 A;  3VO2 A;  2LKP A;  1U2W A;  2WB1 N;  1SD7 A;  2PEX A;  2HQR A;  3CO6 C;  4FN5 A;  5TR9 A;  1QGZ A;  2IS6 A;  1E3H A;  3ABM H;  1KU9 A;  3DPL C;  2XAS A;  3HOV J;  2BGJ A;  3HKZ A;  2XSD C;  2BOL A;  1OMI A;  2R7D A;  3K70 C;  2P6T A;  3V8J A;  2CUF A;  3SHF A;  5DCM B;  3H36 A;  2E2I J;  1MBG A;  2GK7 A;  1XC5 A;  4BPR A;  1SKY B;  3I56 B;  1Z0X A;  1LM1 A;  1IXS B;  1S5L C;  2J5P A;  4RDJ A;  1RES A;  5E79 C;  3PNY A;  4PSX A;  3FBI B;  4DQL A;  5ICG A;  2VJ5 A;  3BRO A;  3F8F A;  4RB2 C;  2R7F A;  3PFI A;  3A0H C;  5F0C A;  4XLH A;  3IKV A;  4OJ6 A;  3WWG A;  4AYB N;  1F60 A;  4X05 A;  4PC2 A;  3G1L A;  2NVY J;  1IXR C;  2COM A;  4DZJ A;  5B66 C;  2V26 A;  2Y48 A;  4OOV A;  1JJ2 B;  1AIR A;  2EFN A;  2JPC A;  2E2H J;  2R3S A;  3B6C A;  5IK2 A;  3F0C A;  3ML6 A;  1GHC A;  1IUF A;  2NSP A;  3HIF A;  3BQZ A;  1BM9 A;  3OY9 A;  2ZBV A;  2ECB A;  2UWM A;  1WOO A;  4BJ6 C;  1PE9 A;  1ZR4 A;  3I9V 2;  2XNC A;  4M0L A;  4ZGN B;  1BIA A;  2QX3 A;  4Z05 A;  2QVO A;  1XG1 A;  1XFO A;  5L46 A;  3C3W A;  3SY2 A;  1N78 A;  2O61 A;  1XGN A;  4WZE A;  4KJZ A;  3K4J A;  2V9V A;  3P5J A;  4GYI A;  3D5L A;  1SAN A;  3NAW A;  4B4D A;  4YII A;  2Z5U A;  1BR1 A;  4P12 A;  3VDX A;  5FO0 A;  2VQG A;  2CYY A;  3GFM A;  3M9A A;  1KGS A;  1FY7 A;  1YG2 A;  2YSR A;  3H3U A;  1ZN2 A;  3D0S A;  2M0C A;  5D5V B;  1EFT A;  3QPS A;  1M1E B;  4XNF A;  3PA2 A;  4XOR A;  1K4T A;  4Z1M A;  2WY7 Q;  3KYC B;  4XSX F;  1YIT I;  1NHC A;  1PP8 F;  3ZN1 A;  2N8G A;  1WPK A;  4PMH A;  2ZL7 A;  2KMU A;  4HW0 A;  3JRA A;  3GO5 A;  4DOZ A;  2HEO A;  2WSS A;  3S2W A;  1P4A A;  5B5E C;  1VFC A;  3CW2 A;  1OCC H;  2F5D A;  1YI2 I;  3QFR A;  1U6G A;  3G1M A;  3FJO A;  1JT6 A;  2NXN B;  4CO8 A;  2QKM B;  1IV8 A;  3ML3 A;  4OJ5 A;  2ZCW A;  1I8D A;  2X53 S;  4RB0 A;  1KU3 A;  3PQJ A;  2BEO A;  3CQZ J;  4MGR A;  4P2N A;  2WAQ N;  4BY1 J;  2BBY A;  3KEO A;  3TBI A;  3ESW B;  1ZQ3 P;  3WTT C;  1A31 A;  4IHX A;  2BN4 A;  2XC7 A;  4EM2 A;  1Z9C A;  3TOA A;  3FBN B;  4A3C J;  1ZRD A;  4ASU A;  3L09 A;  4G6T B;  3JAM Z;  2QA4 B;  1VQ4 I;  4PSW A;  1Y56 A;  4G7Z F;  1R5I D;  2M8E A;  5FD5 A;  4KFC A;  4R71 A;  5CQE A;  2DW4 A;  1I7P A;  3ZN0 A;  1PJ6 A;  4P9S A;  3PSZ A;  3E6C C;  3F8N A;  4W1U A;  1B72 B;  2PMD A;  2Q6L A;  5F04 A;  2NNY A;  4Q4Z F;  4YXW A;  3PO3 J;  1PJ7 A;  3PL8 A;  2EV6 A;  1ETK A;  3PSF A;  3TDZ C;  1IV6 A;  2R7Q A;  1WSV A;  2J8I A;  2BY3 A;  4FE7 A;  1HST A;  2G0Y A;  2IT0 A;  1JKP C;  3FY3 A;  1T6Z A;  1W7P D;  4LC0 A;  1W4M A;  4JQF A;  2DPD A;  4C43 A;  3ERE D;  4LG0 A;  1T8I A;  2IA1 A;  4F7D A;  1TW2 A;  2CH0 A;  4X1E A;  4CYC B;  1IB4 A;  1R4M B;  2DA2 A;  2FNP A;  1IDK A;  3EUH C;  5F08 A;  2H8R A;  1X3W B;  3KP3 A;  4KN7 X;  1A5J A;  5GAG J;  2R9V A;  2UV1 A;  1B1B A;  4B44 A;  4IOC F;  1BC7 C;  2Q6I A;  1OGM X;  3ONQ A;  1G7S A;  4BQA A;  1H8E A;  2JK3 A;  3WBK A;  1H9G A;  1X19 A;  3O6B B;  4EJT A;  4I84 A;  3EQN A;  1MSE C;  5LHH A;  2M87 A;  1RR8 C;  4W97 A;  5C4X J;  1YJ9 B;  1PLU A;  1BI3 A;  4NC6 A;  2V6E A;  2C5B A;  4UZE A;  4GDF A;  2CQK A;  4Z4R A;  1QU3 A;  3T8T A;  2LMD A;  2IS2 A;  3K1P A;  4OZY A;  2L54 A;  1TNT A;  1O8K A;  1W36 D;  3BPV A;  1VHO A;  2E34 A;  2M7A A;  3O2P E;  2XF6 A;  3G05 A;  1VQ9 B;  1RQR A;  1FNN A;  1FOK A;  4UHT A;  2XGE A;  2VPL A;  4MO7 A;  4FAS D;  2Y0S N;  2EWN A;  1AHD P;  2HTS A;  4A3E J;  2VBU A;  3ZXS A;  4Z4S A;  4KIC A;  4I98 B;  3ASR A;  2F6C A;  4BNC A;  4ZCM A;  2XB5 A;  4KKU A;  3KX2 A;  5EJC A;  2XEX A;  2OTL I;  2E36 A;  1JUM A;  4YDT A;  4C2T A;  1E43 A;  3RPU A;  3OR1 C;  5KHD A;  3SLN A;  4X7D A;  2X9D A;  5FRN A;  4FWT A;  2L9R A;  1ON1 A;  2XPW A;  1BX1 A;  3ONU A;  1S72 I;  5H5J A;  3IWZ A;  3HUG A;  4LOC A;  2HS5 A;  4XLE A;  1VTN C;  2RDP A;  2DFE A;  1Z6R A;  2QZ8 A;  2KDO A;  3K4B A;  3I59 B;  3GTK J;  2W6I A;  1OOC A;  2BM4 A;  2LKX A;  1W0T A;  4DNR B;  3A02 A;  3KEY A;  3RSN A;  1MDM A;  2GXB A;  4LBZ A;  3CJN A;  1POG A;  1WJB A;  3W2H A;  2F5F A;  1WPC A;  5EG0 B;  2D9R A;  2XVC A;  3HRT A;  4ZCL A;  3BG6 A;  1U8B A;  3ZQH A;  4HNU A;  2PJR B;  1E17 A;  5BMZ A;  5K7F A;  4G12 A;  4M9X A;  2D5V A;  5GP9 A;  2ELH A;  5A89 A;  4BBS J;  1WI3 A;  1V4R A;  2YR2 A;  3SUC A;  5JLV C;  3Q9V A;  2XRO A;  2CFX A;  2OAZ A;  1MNE A;  3FF5 A;  1R5G A;  4N9I A;  5GPC A;  4NC8 A;  3SLD A;  2VFN A;  1JGG A;  1FRN A;  1ACI A;  2CUZ A;  1P4W A;  2MH2 A;  5F4M A;  3JRF A;  2C5H A;  2JIZ A;  4DNC A;  1W36 C;  3MFK A;  2PE3 A;  4MFE A;  1UD8 A;  3ZQF A;  3B90 A;  3L7W A;  1S3J A;  1OCT C;  3ZPL A;  3MKL A;  2IBD A;  2JMW A;  3CB4 A;  5GV8 A;  3WND A;  3OYH A;  3RKW A;  3BH4 A;  5L3F A;  2P6S A;  2CK3 A;  3E1S A;  2Y69 H;  1CGP A;  5EF6 A;  3U21 A;  1XTA A;  2ZBK A;  1I27 A;  2DXI A;  1Z7U A;  2PMH A;  5LRR A;  4BJ5 C;  3I54 A;  5B3S H;  4XIC A;  2VJ4 A;  5IP9 J;  4IF4 A;  3LSP A;  5LGT A;  5D6E A;  3WHB A;  1VQ6 I;  3GVK A;  4HSR A;  5IT3 A;  1VBL A;  2V1X A;  1EA3 A;  4DK1 A;  3CCS I;  2KIQ A;  2BMW A;  5HVQ C;  1PKV A;  2NTQ A;  4KIB A;  2WWY A;  3HTS B;  3I71 A;  4RCY A;  2BM6 A;  1X2M A;  2JQ7 A;  2NVX J;  3AAF A;  1LDD A;  1ZGA A;  2AS5 F;  2XZO A;  2QSH X;  4TMV A;  4A6D A;  2EFO A;  1DAR A;  1FOW A;  4UUS A;  1A36 A;  4FIS A;  3P9I A;  3LA3 A;  3AG2 H;  4B47 A;  1TVC A;  2JN9 A;  3DPU A;  4E7Z A;  3KYL A;  4BDY A;  1E1Q A;  2VBV A;  4AU7 A;  3CDH A;  2C77 A;  1IN4 A;  3CUQ B;  4FHT A;  5DS0 A;  2GJK A;  1IN6 A;  1U5T A;  2V4J C;  4BQN A;  4XMY A;  3CDI A;  3VNU A;  3CMY A;  2EIJ H;  4ZDP A;  3S8P A;  4MHG A;  1NG6 A;  3RKY A;  3ZC3 A;  3JCU C;  3L00 A;  2Z1D A;  1P6R A;  4C2U A;  4HPQ A;  2YUS A;  3LFK A;  4QPO A;  2ZZE A;  2PBI A;  4FT8 A;  3F6O A;  3MZ8 A;  1VQK B;  1XG2 A;  2A6E F;  3GRH A;  1R00 A;  4MFD A;  3NWS A;  3B8Y A;  2HPM A;  3M1E A;  4UAJ A;  4RD6 A;  5AON A;  2DCU A;  4M3D A;  5M5W J;  1IGN A;  4AM3 A;  3LQE A;  2ZJQ F;  2HDW A;  2HVS A;  5KSW B;  2GBY A;  2EA4 A;  2ID3 A;  3SJP A;  3M7G A;  2BM1 A;  5IYC J;  2RVC A;  4ACA A;  4XR6 A;  3AVW A;  5GTH C;  3CCR I;  3KRG A;  2W7Z A;  5JHU A;  4IKF A;  3V7A A;  2W57 A;  5HNF A;  4QTR A;  2ZNZ A;  3OV8 A;  5HOO A;  1OPC A;  2D3N A;  2L4A A;  4P9F A;  1MH3 A;  3VWB A;  1VQ8 B;  3PSS A;  5LEK A;  1FC3 A;  4N4N B;  4BEH B;  3OYA A;  3JR9 A;  5J8F A;  3U6B A;  5L3D A;  2GIV A;  4S05 A;  3A0B C;  1ZLJ A;  4YEL A;  3J7A O;  1GV2 A;  1TZL A;  5L3C A;  1Y0R A;  4V02 C;  5J1R A;  3GVJ A;  3T56 B;  3CC4 B;  2CUJ A;  2XKP A;  1PJR A;  2LNB A;  2Q2E B;  2Z33 A;  1OCR H;  1D8J A;  5E3L A;  2L7M P;  2K40 A;  1F9N A;  4I01 A;  2A6H F;  3LWF A;  3MWM A;  1ZR2 A;  4RBO A;  2GPJ A;  5FKN A;  1RMG A;  1KQ9 A;  1R1V A;  4HZF A;  4K1X A;  5LEJ A;  2HOE A;  2V7T A;  1EXM A;  2G0E A;  3Q3S A;  1XN7 A;  4AD9 A;  1ETX A;  1ZM4 A;  4W8T A;  3HEF A;  1EH8 A;  5EDN A;  2A5Y B;  2BW3 A;  3I5U A;  3RKQ A;  4M4S A;  2D1H A;  1FX7 A;  2HVR A;  4M6V A;  5DSZ A;  4LBW A;  3S1M J;  4QIW N;  3S15 J;  2ZB9 A;  3QPH A;  3LO8 A;  1PYV A;  1OCO H;  4PJN A;  2CU7 A;  3ASP A;  3HSR A;  1MMG A;  3KP2 A;  4X0C A;  4AUX A;  1EH6 A;  2BF4 A;  4HBL A;  1O3S A;  1PXZ A;  4OOX A;  3VFZ A;  1M90 D;  2M3A A;  2GRE A;  2VAS A;  3HRS A;  3IKT A;  1RQP A;  2L9S A;  3SQV A;  2Y9Y A;  2CMP A;  4B43 A;  3RKX A;  2K27 A;  2ADU A;  2XB0 X;  1T6Y A;  1OFE A;  2DOA A;  5H6Q A;  3TP3 A;  1IRZ A;  1DDI A;  2WBM A;  3JTH A;  2VKD A;  1WSU A;  4RS8 A;  4ZYG A;  1ETQ A;  1FPQ A;  4KIF A;  2M34 A;  2V6C A;  2VXZ A;  4U87 A;  1X1A A;  1BI0 A;  5LHG A;  3CCQ B;  2VBK A;  2L0K A;  2YU3 A;  1G7C A;  3D26 A;  4P96 A;  1H9T A;  1PP7 U;  4V2F A;  1MJ9 A;  4AIK A;  1JXS A;  1VLY A;  4JBA A;  2WZN A;  2MFZ A;  3FKJ A;  4M3F A;  4DBQ A;  1DPR A;  1S7O A;  2R7X A;  3AGQ A;  3HPG A;  1AKH A;  4L5I A;  1DU6 A;  2PEC A;  1WJF A;  2L01 A;  3WTV C;  2JA5 J;  1MH4 A;  1B8I B;  1TT5 B;  1JTY A;  1PUF A;  4BU2 A;  3K4C A;  4TSF A;  3RZO J;  4S04 A;  5EGO B;  3ASO H;  2XZP A;  3CCM B;  1B4A A;  2O1D A;  3OL3 A;  3HB9 A;  3W5U A;  1I6H J;  2QYO A;  3DTE A;  1XGM A;  2V4D A;  5HDN A;  3EYI A;  1FX0 A;  4IVN A;  3OOC A;  3W6V A;  1GLN A;  1R1T A;  4A0X A;  1J59 A;  1WJC A;  4X06 A;  5BNG A;  1VI0 A;  1WJD A;  5CVU A;  1S4M A;  2LYC A;  2BZT A;  4UB6 C;  2KIS A;  2RC4 A;  1D8K A;  3QYB A;  2R5Y B;  1OJL A;  4HV6 A;  5FKL A;  1KK2 A;  4ZGQ B;  4RCZ A;  2WA0 A;  1O8L A;  4R1H A;  1N0V C;  2O9L A;  4Z03 A;  1WRJ A;  2VLA A;  2CW0 F;  3Q0W A;  4CIC A;  1TYW A;  2E1M B;  1NHA A;  4C0S A;  4EAT A;  2D1V A;  3OS0 A;  4W8S A;  1V54 H;  2ISZ A;  3HJE A;  4QSH A;  2JPB A;  1L0O C;  4CYD A;  2PJP A;  1GVJ A;  3PSI A;  1KTV A;  4Z06 A;  2EIL H;  3OAA A;  1X0C A;  2OK8 A;  3DF8 A;  6PAX A;  2DN0 A;  2ZTN A;  1IN7 A;  4BGD A;  3ZIA A;  3KP6 A;  3RPU D;  2V9P A;  1HA8 A;  2JA2 A;  3WU0 A;  4BHP A;  4WXH A;  1ZM2 A;  4ZTF A;  3MMY B;  1W0U A;  2R7R A;  2W25 A;  3KP7 A;  3FXR A;  4IO9 F;  2NVT J;  3NB2 A;  4A3B J;  3J80 Z;  1R22 A;  5E17 F;  1BI1 A;  3GEZ A;  3CCU I;  1ITY A;  4PJ0 C;  1YO5 C;  3L2C A;  4M3E A;  1R71 A;  1R5B A;  3ZMZ A;  3GX4 X;  3CJR B;  4RB1 A;  2LDU A;  2L7Z A;  5CQG A;  4M9S A;  5M3M J;  4E7J A;  4P1V A;  2LVS A;  4AID A;  2ECC A;  2MGQ A;  1R49 A;  4BBR J;  3JRI A;  3DXJ F;  3TO9 A;  4UVA A;  5C1E A;  3IRR A;  2VON A;  2P5K A;  1EZG A;  1RZ4 A;  1O3Q A;  1KRH A;  1ETW A;  1KC8 D;  5JMC B;  4RGR A;  2PX9 A;  2Q8K A;  1UEL B;  3MKW B;  1WTH D;  5HNH A;  3P27 A;  1ONV A;  1IN8 A;  2Y0M A;  1VQO I;  1P7J A;  1Y8R B;  2H6C A;  1HKS A;  1JNY A;  5K7H A;  1WJE A;  2LLK A;  4AC0 A;  3H5N A;  4BKX A;  4BXU A;  1R7J A;  2JSP A;  1ZRC A;  2RC5 A;  3FXK A;  2DYI A;  4P22 A;  4KT6 A;  1WDT A;  4HE5 A;  2Q6O A;  4E7I A;  3HXL A;  2XRN A;  4R8H A;  1X2N A;  3WG7 H;  4EMS A;  5FFX A;  4I2O A;  5E8I A;  2XDV A;  1P7I A;  1SVL A;  2JN6 A;  4G94 A;  1BHE A;  2WC2 A;  3GUD A;  3PNT A;  3JQQ A;  1LKX A;  3S2H J;  2HYG D;  5FLM J;  4MEY F;  3MAJ A;  1BLI A;  3JSO A;  2NTB A;  5J3O A;  1JT0 A;  3HHG A;  1F20 A;  3PO2 J;  3H0D A;  2WY8 Q;  3KEQ A;  1JHH A;  1Z77 A;  3OIQ A;  3JX8 A;  1HW1 A;  1VQP I;  2VBY A;  3IHU A;  1AOY A;  1KMH A;  2FUG 2;  3SZG A;  3T0Y A;  2VI6 A;  2WAQ A;  3TGN A;  4JYK A;  3RZD J;  3I53 A;  1FYK A;  2GZW A;  1JE8 A;  2QN6 A;  4UUS B;  1FWZ A;  1YIT B;  2ZKZ A;  1IO2 A;  1HKT A;  2CV2 A;  1TQP A;  3L2W A;  1T08 B;  3QFC A;  3M8F A;  1QA1 A;  1YJN I;  4OOI A;  2QBY B;  2VBS A;  1IRX A;  4ESB A;  3A8K A;  4MYU A;  3OIP A;  1XDU A;  2FBH A;  2W24 A;  3LJY A;  2VFQ A;  3OP1 A;  2VOO A;  2KHM A;  2A61 A;  3CES A;  1YI2 B;  3PA1 A;  1I3Q J;  2X3H A;  4WXD A;  3QFT A;  4G6Q A;  1O8I A;  1QZY A;  2DFF A;  2X8K A;  2W6J A;  2H94 A;  2LC2 A;  1HXD A;  2K3P A;  4QPQ A;  2KFD A;  3VR6 A;  2YWG A;  1SMY F;  1WI9 A;  2RNJ A;  1EP3 B;  3AGP A;  1BMF A;  2KJB A;  2MLG A;  2BV6 A;  3AVV A;  3E5Q A;  2EJR A;  3S93 A;  2MG4 A;  5F64 A;  1J75 A;  4OIO F;  1KD1 D;  4DQ2 A;  3GFJ A;  2ZTG A;  1VQ4 B;  1QUE A;  3Q3A A;  5E3O A;  1O8F A;  2QM3 A;  2J8K A;  4D5C A;  4EGZ A;  3CD6 I;  4U9U A;  3Q6Q A;  4C3H J;  1XSX A;  1UHS A;  4QHY A;  3NAR A;  4J00 A;  4JMQ A;  4E6K G;  1R23 A;  4ENN A;  3WE3 A;  2O03 A;  4DYQ A;  2NT6 A;  4A3I J;  3GVL A;  4U49 A;  2GXG A;  3OL4 A;  3ABT A;  4L0Z B;  1SFE A;  2EFQ A;  3AFH A;  3BJ6 A;  4P55 A;  4Y3O A;  3V7C A;  3BNW A;  5AMV A;  3J81 k;  2VJJ A;  1QA3 A;  1YQA A;  2FJ1 A;  3JRD A;  1K78 A;  3MHP A;  3QU3 A;  4OIR F;  1I39 A;  1T33 A;  2OUM A;  4CCN A;  1KYZ A;  4GXO A;  4ZYA A;  3E7L A;  3OYD A;  3J7A Y;  5J1Y A;  2IGO A;  3LNN A;  2LZJ A;  2RRE A;  2M7B A;  1YRN A;  1FIP A;  1GAQ A;  2NRA C;  1MSF C;  1KCC A;  3IAM 2;  3ZQQ A;  3MZY A;  2BVM A;  1MNM C;  1JHF A;  4W8R A;  1FRQ A;  4G6D A;  3P26 A;  1KQS B;  1WH7 A;  3GTP J;  2OF7 A;  1SC7 A;  1U5T C;  4HX7 A;  2MSY A;  3O8G A;  1O57 A;  2R6H A;  2DET A;  3ZPP A;  2LOO A;  4YAF A;  4DW6 A;  3A1P A;  4EVI A;  2F1L A;  2JT1 A;  1EA0 A;  4RGU A;  4X0G A;  1OCZ H;  4HQM A;  4PDK A;  4DYR A;  3CTA A;  1YX2 A;  1GAW A;  2VKE A;  1SFK A;  3BR3 A;  3GWZ A;  4JRA C;  2COB A;  3K7A J;  2O5R A;  3ECO A;  1CF7 B;  1ZRF A;  1R58 A;  1BQE A;  3QFS A;  5LMZ A;  4YC5 A;  3GTM J;  5LHI A;  4YAO A;  2JJ2 A;  3GME A;  3DKX A;  1XPX A;  4IL6 C;  4O6J A;  3GTL J;  2HOT A;  1I50 J;  2V9K A;  4I76 A;  2NPF A;  4B1R A;  3OOU A;  2RC6 A;  3WNC A;  2HYJ A;  5IYB J;  1X1D A;  4A3K J;  2B7E A;  1FYL A;  2UXX A;  2H27 A;  3PVD A;  2XGD A;  2FOW A;  3CME I;  1T0F A;  1MAB A;  1PVE A;  2V7W A;  2Q0O A;  4B3X A;  2K85 A;  3WYA A;  1FEX A;  2DJN A;  2TCT A;  1WJA A;  4IQJ A;  1UD6 A;  1QPM A;  3A01 A;  1UMK A;  2XUB A;  2QMU A;  1Q9S A;  4WQM A;  3A4C A;  3LST A;  1SFX A;  3EPZ A;  2EFW A;  2OTL B;  2NOG A;  2FNA A;  3G6E B;  3WU1 B;  4AF6 A;  1S29 A;  5B6I A;  3SXY A;  1R6R A;  3SDB A;  4L8J A;  3M3Y J;  2KRH A;  1H8H A;  3FXQ A;  4JX4 A;  1P4M A;  3S3N A;  4PC1 A;  1S72 B;  3MQ0 A;  1V5G A;  1F36 A;  3BP8 A;  2B9S A;  4WXC A;  1QJV A;  1FP1 D;  3UNG C;  1LUJ B;  2GOM A;  2KIM A;  3OYM A;  2LY1 A;  2NNN A;  2BM7 A;  2QTL A;  4A5N A;  4YRV A;  4EM1 A;  1YX3 A;  5D4R A;  1GUU A;  2HWV A;  2HLD A;  2F4I A;  4RPB A;  3B73 A;  2EFP A;  2V1U A;  4A93 J;  4JP0 A;  3CP8 A;  2EWE A;  5LFA A;  1KQ0 A;  2X0L A;  1W2B B;  1P92 A;  3WGH A;  2OBT A;  3VMV A;  1ZRE A;  4R79 A;  2K86 A;  1IRF A;  1VQM I;  3N4M A;  4ITV A;  4RAG A;  4CZC A;  2R7V A;  1TQI A;  1K4S A;  4E7S A;  2PYH A;  2GA1 A;  2LH9 A;  1UHM A;  4Y15 A;  2CSO A;  1Y6I A;  1T6X A;  3EUK L;  3ROU A;  2BHY A;  1A6I A;  2V7X A;  5FRO A;  3BG9 A;  4UV8 A;  3LNQ A;  3K4L A;  3DQV C;  1ZAO A;  3QAH A;  5EYR A;  1AIP A;  1O3R A;  2HDD A;  4BXF A;  3LL7 A;  2DFI A;  2M45 A;  5H59 A;  3Q5F A;  2FSW A;  4KIS A;  1WH5 A;  3N90 A;  4PJJ A;  1SD6 A;  2DA6 A;  2GA2 A;  3PNV A;  4YIR X;  2FEZ A;  2HPI A;  1XSD A;  2OZ6 A;  1SFU A;  2DOG A;  3ASN H;  1VQ6 B;  2M4K A;  4X8I A;  1VHE A;  2H6B A;  3AG3 H;  3RPQ A;  1ZG3 A;  2M9H A;  2FOK A;  2JUC A;  3L9F A;  1RET A;  2XHK A;  1YHQ I;  3CCS B;  3KEW A;  3O8H A;  4EGY A;  3S3O A;  4JOM A;  1LDJ A;  1R9T J;  1W9X A;  1XB4 A;  3FXM A;  5TY0 A;  1MMA A;  2VUM J;  1U0J A;  4YHB A;  2D2W A;  1AMO A;  4L9J A;  2H1L A;  1YS7 A;  4FX0 A;  4NDL A;  5L3E A;  4NQW B;  3C2G A;  2XRL A;  2W48 A;  1SM4 A;  4KDP A;  2CWE A;  4TN1 A;  3ONY A;  4HNV A;  1QA2 A;  2X48 A;  4LG3 A;  1EJ9 A;  3S1N J;  4RAZ A;  5L3G A;  2I5U A;  1XX5 A;  1BJA A;  2VPR A;  1DDG A;  1BJZ A;  2LY2 A;  2LBF A;  5B1A H;  2XND A;  4TMW A;  3KZI C;  3FKS A;  2QKL B;  3QPT A;  1G3T A;  1P2F A;  3GTJ J;  3IRQ A;  3RCO A;  3VYT B;  4EH1 A;  3Q39 A;  4BJT A;  2H8W A;  1KK0 A;  2EIX A;  3OPO A;  3EET A;  5C44 J;  4OOS A;  3BJA A;  3CUO A;  4RLQ A;  4RLZ A;  2UXN A;  3BH6 B;  4ESJ A;  4OMY A;  4OM9 A;  1VZ0 A;  2LSO A;  3FZV A;  5TGT A;  3TW6 A;  3N6Z A;  1QFZ A;  3ZMS A;  3JAM K;  2LRD A;  2B5O A;  3DBR B;  4NNJ A;  1RRJ A;  5J40 A;  1UCR A;  3C18 A;  5CVR A;  2QSG X;  4P26 A;  3IUO A;  4KMF A;  2ZME A;  1LVA A;  3H09 A;  3CCR B;  3V42 A;  3F8M A;  4ZCI A;  2EQR A;  2E5N A;  1RUN A;  3VPR A;  3G73 A;  3QWL A;  1DBG A;  4LLG F;  1KYW A;  3RYR A; 
#chains in the Genus database with same CATH homology
 1KCD A;  3VSK A;  3H5R A;  2OV7 A;  1UD3 A;  2GJK A;  2ZZF A;  3WQZ A;  2V4J C;  2GJR A;  4C2L A;  1LVK A;  4HEA 2;  4BQN A;  2WJV A;  4XMY A;  1VF7 A;  3BC8 A;  3IP4 B;  1VJS A;  2ZXI A;  2R7T A;  4XN0 A;  4ZDP A;  3S8P A;  1NG6 A;  1IDJ A;  1X4O A;  2Z1D A;  2KPM A;  3NWT A;  1ZEL A;  3A1Y A;  4HPQ A;  4C2U A;  1CZF A;  3A35 A;  4QPO A;  1W0J A;  2ZZE A;  3BLY A;  2W4S A;  4ZC3 A;  2CW8 A;  1XG2 A;  3GRH A;  2CS3 A;  3NWS A;  3B8Y A;  2HPM A;  3AKZ A;  2VBM A;  3LSG A;  4RM2 A;  2HDW A;  2HVS A;  4F92 B;  3DPT A;  1QHH D;  2PJR A;  3HOS A;  4OJP A;  2HU9 A;  4XR6 A;  3DKY A;  3KRG A;  2XF5 A;  1COW A;  1N75 A;  2ZXH A;  4IKF A;  5HNF A;  4IZZ A;  5HOO A;  4ZDO A;  3FHN A;  3ZGK A;  4F3Q A;  2D3N A;  3VWB A;  2R7W A;  4GQN A;  2HQA A;  3MD2 A;  3OYN A;  3E0J B;  4N4N B;  3SEQ A;  3W2W A;  4BEH B;  3OYA A;  4NK8 A;  4CCL A;  4KIT B;  1MMN A;  3ZRG A;  4W8Q A;  3CJQ B;  4YEL A;  2Z6B D;  1TZL A;  2X6W A;  3GVJ A;  3T56 B;  1QCX A;  2CUJ A;  4DNT B;  2LRE A;  1PJR A;  2Q2E B;  5FL7 A;  2R7O A;  2WJY A;  2MAB A;  2KZV A;  2E1M C;  1D0Z A;  4TKO B;  4YEJ A;  4Y4R A;  2W82 A;  4CCK A;  1RMG A;  2UUZ A;  1W0K A;  2UVE A;  2W1O A;  2WZP P;  1ERD A;  5DN6 A;  3K4N A;  3LSH A;  1FMW A;  2NST A;  2JUG A;  1DGW Y;  4W8T A;  2X6Y A;  1BPL A;  2BW3 A;  3D5S C;  4U7B A;  3L2R A;  4HST A;  4F55 A;  2HVR A;  4G7X A;  2IGK A;  4C30 A;  1V0E A;  2AQF A;  3BCA A;  3FPP A;  4YZ0 A;  1PYV A;  4PJN A;  2O17 A;  1MMG A;  3H9G A;  2DJI A;  3DU6 A;  1D1C A;  2A6T A;  2ZSI B;  1PXZ A;  4D9J A;  1BR4 A;  4IQ4 A;  1YE9 A;  2M3A A;  2XZL A;  2VAS A;  1DBO A;  3MKY B;  3A2K A;  2E60 A;  2F5V A;  2R4G A;  3L2Q A;  2L9S A;  1EE6 A;  1D0X A;  3DEE A;  4NK6 A;  2CMP A;  4B43 A;  4HIZ A;  3DWL E;  4DIQ A;  2INU A;  3LMW A;  3BC9 A;  2DOA A;  2Z16 A;  2WBM A;  2JDI A;  2VKD A;  4OJL A;  3VMW A;  2ZFU A;  2VXZ A;  4U87 A;  4F93 B;  4DK0 A;  4XON A;  4ZTJ A;  1X1A A;  2PYG A;  2ZZG A;  2VBK A;  2X1E A;  4XLF A;  4CCM A;  3N05 A;  1D1A A;  1VLY A;  5CKT A;  3QYF A;  2MFZ A;  3FKJ A;  3OYK A;  1OGO X;  4DBQ A;  1JRG A;  1TT0 A;  1YX5 A;  4GRI A;  2R7X A;  3A3B A;  3HPG A;  2PEC A;  1WJF A;  2XSJ C;  3NE5 B;  1OLT A;  4C9Y A;  1RU4 A;  1E79 A;  4TSF A;  4BU2 A;  3K4C A;  1WP6 A;  1AA7 A;  1X1C A;  2P0W A;  3A3G A;  2XZP A;  2O1D A;  3OL3 A;  4PFO A;  3OYC A;  4BEH A;  3DTE A;  4XM3 A;  2V4D A;  2X51 A;  1FX0 A;  3OOC A;  2RQQ A;  4N4O B;  1SAU A;  1GLN A;  2BVL A;  1UD2 A;  1V5F A;  2VQH A;  1WJC A;  1KZL A;  1E0E A;  1WJD A;  2LYC A;  2CW7 A;  2VL8 A;  2BSP A;  4EW9 A;  4LIV A;  2PMZ A;  3QYB A;  1MMD A;  3OMY A;  4FET A;  1T95 A;  2WA0 A;  2K5C A;  3SEZ A;  1UAA A;  2DIE A;  3VYU B;  1O8E A;  1O8L A;  3BCF A;  2VLA A;  2X85 A;  2E1M B;  3K4M A;  3OWT A;  1J09 A;  2DCE A;  3K70 D;  3OE7 A;  4OJO A;  4EAT A;  1OFM A;  3OS0 A;  4W8S A;  2WPD A;  1LFP A;  4AVZ A;  4Z06 A;  3PSI A;  1UG0 A;  4PJM A;  4CA0 A;  3OAA A;  1Z21 A;  1X0C A;  3I3L A;  4BDZ A;  2ZSH B;  2ZTN A;  4BGD A;  3HOT A;  3ZIA A;  3RPU D;  1HA8 A;  2ELJ A;  4DBR A;  3H35 A;  2JA2 A;  1O8H A;  1IA5 A;  4E7H A;  4OAY A;  3CZ6 A;  1T0F C;  3MMY B;  1MND A;  4ZTF A;  2R7R A;  2L9N A;  4MXN A;  4B3G A;  2HVQ A;  4HRI A;  4Z03 A;  4RM3 A;  2VQL A;  4ZJZ A;  4CUG A;  4PFP A;  1WJ5 A;  1QHG A;  2HNH A;  3GQA A;  1Z3X A;  1Z3Y A;  4CCO A;  1E3Z A;  3S3M A;  4II2 A;  3CJR B;  1D0Y A;  3DLA A;  1G59 A;  1O8J A;  2E5Z A;  5CQG A;  4E7J A;  2E1B A;  2L7K A;  1O88 A;  4HG2 A;  5FRM A;  4U4B A;  2LG4 A;  2ODL A;  5C1C A;  2KLO A;  4YZX A;  3M1C A;  3W2V A;  5C1E A;  4YZA A;  4RLF A;  2NT9 A;  4J01 A;  4G6I A;  2IGN A;  2IS4 A;  3JUR A;  3FDY A;  1UEL B;  3HAG A;  3VYR B;  2L2O A;  3MKW B;  5KNL A;  4P5O A;  3LFU A;  3UR3 C;  3RQ4 A;  5HNH A;  1WTH D;  3CP2 A;  4B48 A;  4XQF A;  3PFY A;  2O0V A;  5KCM A;  2VQC A;  3L2V A;  2DT6 A;  1WJE A;  1O8G A;  3H5N A;  4P22 A;  2JSP A;  1HG8 A;  2IS6 A;  3T9G A;  4KT6 A;  2IXS A;  4E7I A;  2F1M A;  3HXL A;  2W7N A;  3DPL C;  3HC7 A;  2XDV A;  3HKZ A;  3PJR A;  2BOL A;  3K70 C;  1BHE A;  3S32 A;  3PNT A;  3HL2 A;  1LKX A;  3H5A A;  1K28 D;  2WAD A;  2GK7 A;  4BUP A;  1BLI A;  1SKY B;  4KKS A;  1D1B A;  3GQB A;  2NTB A;  3AL0 B;  1BOB A;  3PNY A;  4PSX A;  3FBI B;  2WY8 Q;  3VSL A;  3H0D A;  2VJ5 A;  2V7Q A;  3OIQ A;  5CPR B;  1DGR M;  2QE7 A;  2XF7 A;  4XLH A;  4ZDL A;  2FUG 2;  1KMH A;  4OJ6 A;  3SZG A;  3WWG A;  2WAQ A;  2MD0 A;  1O8D A;  3HPH A;  4HWV A;  4BS9 A;  4CSW A;  2V26 A;  3VST A;  4XKC A;  1AIR A;  3TMO A;  1BN8 A;  2CV2 A;  5IK2 A;  3L2W A;  3BCB A;  1OR7 C;  1IRX A;  2NSP A;  3OY9 A;  3OIP A;  2UWM A;  4BJ6 C;  1PE9 A;  2KHM A;  3CES A;  3I9V 2;  1NRK A;  2QX3 A;  2HZD A;  2X3H A;  4Z05 A;  2K9L A;  1O8I A;  3GQ8 A;  3W3C A;  2R7S A;  1N78 A;  4BL0 B;  2X8K A;  4KJZ A;  3K4J A;  2W6J A;  1KTW A;  4P1W A;  2LC2 A;  2K3P A;  2MC4 A;  4QPQ A;  3VR6 A;  2XOK A;  3D5L A;  4FXU A;  3F9K A;  1Z7L A;  1BMF A;  4LIU A;  2IQ7 A;  1I18 A;  3IAS 2;  3S93 A;  2X1D A;  2CV1 A;  4F91 B;  2ZZQ A;  1BR1 A;  2NZM A;  3VDX A;  2ZTG A;  3CF2 A;  3OYG A;  2VQG A;  2GJP A;  1HVX A;  3OEE A;  1O8F A;  1V5E A;  3H9Q A;  4MLO A;  4J00 A;  4JMQ A;  4XNF A;  4XOR A;  4E6K G;  1H80 A;  4Z1M A;  2UVF A;  2WY7 Q;  3QYE A;  1P9Q C;  3RTR A;  1NHC A;  2NT6 A;  3GVL A;  4PMH A;  4U49 A;  2KMU A;  3OL4 A;  1RWR A;  2WB1 A;  3AFH A;  4Y3O A;  2CV0 A;  4DOZ A;  3AL0 C;  4ANJ A;  2WSS A;  5AMV A;  2VJJ A;  3OYJ A;  2KP6 A;  4IX7 A;  4CCN A;  2OUM A;  3LNN A;  3OYD A;  4ZYA A;  2QKM B;  5HLT A;  2DT7 B;  4E7K A;  2IGO A;  1MW7 A;  2W00 A;  3J7A Y;  2VXD A;  2LZJ A;  4E0F A;  4OJ5 A;  3VSV A;  2RRE A;  2M7B A;  3K6G A;  1I8D A;  2X53 S;  4LIT A;  3ZR8 X;  3K10 A;  1N77 A;  1KCC A;  3IAM 2;  1O8M A;  4URR A;  3TBI A;  3ZQQ A;  2BVM A;  2AQE A;  1NG7 A;  4W8R A;  2M4G A;  2X1C A;  3DTI A;  5LD2 C;  1EFR A;  1WMR A;  2XC7 A;  3FBN B;  1E3X A;  4ASU A;  2VIX A;  4G6T B;  4XOP A;  2M5S A;  2Z8G A;  3QOE A;  4E4H A;  2I8D A;  1JI8 A;  4B3F X;  4PSW A;  1Y56 A;  4AYB A;  3ZPP A;  2LOO A;  5CQE A;  3ZPN A;  2XGJ A;  4RMN A;  1UD5 A;  3HUG B;  4X0G A;  3OW7 A;  4PJL A;  4NUB A;  1SFK A;  4UZU A;  2O5R A;  2RNG A;  4YXW A;  3PL8 A;  2M0M A;  3PSF A;  2KVO A;  3T53 B;  2JJ2 A;  3DKX A;  4XLA A;  2R7Q A;  2V9K A;  3DTK A;  3OOU A;  1X1D A;  1JTA A;  3FY3 A;  4OWR B;  1S9H A;  1DP3 A;  4JQF A;  1E1R A;  1MAB A;  4H4K C;  2Z2S B;  2CH0 A;  4B3X A;  2F43 A;  4TT3 A;  2INV A;  3EUA A;  3LSK A;  1WJA A;  4XL9 A;  4IQJ A;  1UD6 A;  1IB4 A;  1IDK A;  2V1N A;  1X1B A;  3W2A A;  3A4C A;  1K6Y A;  4OZZ A;  4NC7 A;  4D1Q A;  3EUH C;  3QOD A;  4BE2 A;  3EPZ A;  2O0W A;  4MR0 A;  2KQR A;  2R9V A;  2UV1 A;  4B44 A;  1OHH A;  1OGM X;  1R6R A;  3ONQ A;  3SDB A;  4L8J A;  1H8E A;  3OYF A;  2KRH A;  2GOX B;  3H9J A;  3OS2 A;  1G8X A;  2KL4 A;  3MKZ A;  1X19 A;  2LBF B;  4BE1 A;  3S3N A;  1H8H A;  3EQN A;  1V5G A;  4I84 A;  1QJV A;  3UNG C;  2GOM A;  3C2H A;  3PUB A;  3OYM A;  1OB0 A;  4XKB A;  2LY1 A;  1PLU A;  4CCJ A;  1BR2 A;  2V6E A;  4Y33 A;  2OC6 A;  4YRV A;  2JJ1 A;  1QU3 A;  2D3L A;  4XLC A;  1YX3 A;  2VB6 A;  2IS2 A;  1NBM A;  4OZY A;  1T5E A;  2GK6 A;  2HLD A;  4XKV A;  2F4I A;  3OR2 C;  4XKW A;  2JVH A;  1W36 D;  1O8K A;  2NTP A;  3OEH A;  3VSU A;  2M7A A;  3CP8 A;  2XF6 A;  1WFX A;  4F52 A;  3G05 A;  5LFA A;  2EWE A;  2VBE A;  4II3 A;  1FMV A;  2VPL A;  3VMV A;  4FAS D;  2L5Q A;  2CFO A;  4R79 A;  3H94 A;  3OFN A;  3ZXS A;  4ITV A;  3G2B A;  2K9M A;  4KKT A;  2F6C A;  4CZC A;  2R7V A;  1KON A;  5CDF A;  2A5W A;  4E7S A;  2PYH A;  3EQO A;  2LH9 A;  3LSI A;  4KKU A;  3KX2 A;  3L2U A;  1Y6I A;  1K5C A;  4PUS A;  3EUK L;  2JVG A;  4C2T A;  2KRC A;  1E43 A;  3OYE A;  3OR1 C;  5FRO A;  5KHD A;  3CMM A;  5FRN A;  3DU5 A;  1OFL A;  3UW0 A;  3K4L A;  3DQV C;  4XLE A;  4BXF A;  3LL7 A;  4OAZ A;  4XOT A;  2KDO A;  3K4B A;  4KIS A;  2MYS A;  2W6I A;  1OOC A;  3TL4 X;  3BCD A;  4DNR B;  4PJJ A;  3PNV A;  3KEY A;  3RSN A;  2HPI A;  2Q1Z B;  2M4K A;  3SYT A;  1WJB A;  4BAC A;  1WPC A;  4BE0 A;  3K4K A;  3KEW A;  2VKH A;  3S3O A;  3T51 B;  3BG6 A;  4JOM A;  1W9X A;  2PJR B;  4HNU A;  3LMM A;  3GQ9 A;  2NOJ B;  3JU4 A;  1MMA A;  3GQ7 A;  1U0J A;  4XN3 A;  1HZE A;  2IGM A;  4PK4 A;  2QXZ A;  1GQ8 A;  1DQU A;  3SUC A;  2XAU A;  4E7L A;  1MNE A;  4NQW B;  3C2G A;  4NC8 A;  3DDY A;  3M8J A;  2CUZ A;  3OYL A;  3D5R C;  4LG3 A;  2X6X A;  2V7F A;  2JIZ A;  1W36 C;  3OYI A;  3B4N A;  1UD8 A;  2V31 A;  2LY2 A;  3B90 A;  2LBF A;  4CH7 A;  4BQO A;  2XND A;  3VYS B;  3FKS A;  3LSM A;  2QKL B;  3HG9 A;  2WAF A;  3OYH A;  3BH4 A;  2CK3 A;  3RCO A;  3VYT B;  3ZCO A;  3E1S A;  4HNT A;  4BJT A;  3OS1 A;  3OPO A;  3U21 A;  3ZSC A;  2DXI A;  4BJ5 C;  4XD7 A;  3GBG A;  2VJ4 A;  5HKK A;  4RLQ A;  2VJI A;  3GVK A;  1UD4 A;  2IS1 A;  4HSR A;  1VBL A;  4DJA A;  1EA3 A;  4DK1 A;  2WAE A;  1VZ0 A;  5TGT A;  2R7U A;  2QY1 A;  5HVQ C;  1PKV A;  2NTQ A;  3OYB A;  2LRD A;  4NNJ A;  4G7W A;  3BG7 A;  3IUO A;  4YZQ A;  1X4P A;  2XZO A;  2Y0S A;  5JHF A;  2BW3 B;  4BQQ A;  2O04 A;  4DGW B;  3V42 A;  1V0F A;  4B47 A;  2E5N A;  3DPU A;  4E7Z A;  3KYL A;  4BDY A;  1E1Q A;  1DBG A;  4AU7 A;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...