2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
4YZAA 1OGOX 1O8KA 4XKVA 4XNFA 1O8IA 3GQ8A 4NK8A 4OZZA 1DBOA 4XLEA 1PE9A 4I84A 2O1DA 1BN8A 4OJPA 1RWRA 2O0VA 2NT6A 4YZ0A 2ODLA 1WMRA 4OJOA 2VBMA 4XQFA 2Z8GA 3KRGA 2X6YA 2O0WA 3EQNA 2X3HA 4XM3A 2VJJA 4Z06A 1QCXA 2NTBA 2PECA 3B8YA 2EWEA 2NTQA 4NK6A 3VSVA 1EE6A 1GQ8A 1KCCA 4XR6A 1KCDA 3GQ9A 1IB4A 2VBEA 3EQOA 3GQAA 3VSUA 1O88A 2VJIA 2INVA 2INUA 4W8QA 1JRGA 2X6WA 4OJ5A 1RU4A 2O04A 4OJ6A 1DBGA 2QX3A 2VBKA 4XN3A 1OFLA 4MR0A 1O8JA 1VBLA 1IA5A 1PLUA 1O8MA 4YZXA 1O8LA 4XLAA 4XMYA 3B90A 4XORA 4URRA 2X85A 1OFMA 1XG2A 3ZPPA 4W8RA 2QXZA 5C1EA 4PMHA 4Z05A 1JTAA 2O17A 3B4NA 4XONA 4Z03A 3WWGA 1H80A 1HG8A 1O8EA 3GRHA 5AMVA 4U4BA 1IDKA 2UVEA 2NTPA 1RMGA 2NT9A 4XL9A 4XN0A 3UW0A 1NHCA 4AVZA 1IDJA 1BHEA 2BSPA 1X0CA 1K5CA 2NSPA 3GQ7A 1OOCA 5C1CA 4XKWA 4EW9A 1O8FA 1OGMX 1CZFA 4MXNA 1O8HA 1PXZA 1QJVA 2NZMA 4OJLA 2X6XA 2UVFA 4W8SA 4XOTA 3LMWA 3JURA 3SUCA 4YEJA 3VMVA 4XOPA 2PYGA 2NSTA 4U49A 2PYHA 4XLFA 3VSTA 1O8GA 4C2LA 3T9GA 3FY3A 3ZSCA 2QY1A 4OZYA 1O8DA 4XLHA 1KTWA 4XLCA 4YELA 4YZQA 2IQ7A 4HWVA 4W8TA 3VMWA 1AIRA
chains in the Genus database with same CATH superfamily
2V1UA 2ECCA 3KEYA 1XSVA 2V79A 1OHHA 3TO9A 1T6XA 3LNNA 2LREA 5HLTA 1SM4A 3C3WA 3R0AA 2YUHA 1TZLA 1MNDA 3CJNA 4BQOA 2K40A 3CC4I 1KJZA 5DCMA 3LSRA 2HXIA 1VQNI 2VNKA 3P27A 3ERED 1S72I 3HSFA 3JRCA 4G6TB 1KK3A 3JRBA 2AQFA 3KRGA 2O0YA 2DAOA 3L2RA 1JNYA 4UNOA 2OF7A 3ZN0A 3G6EB 3GLLA 4ON0A 2W24A 1ETQA 1O3TA 1QRYA 4MEXF 4XKBA 4CGZA 2VQCA 1G3WA 4KIGA 2WWYA 1ZQ3P 4OIQF 1MD0A 1KMHA 1HDDC 3TO7A 3CCJB 2DEUA 1FIAA 1Y56A 1LEAA 3S2HJ 2AQEA 4MQVA 5ICCA 1VHEA 1QGYA 3HXLA 3S1MJ 2HNHA 2R5ZB 4OIRF 2PG4A 3VSKA 1MBHA 5ILVA 4IHYA 5EJCA 1NTCA 3F23A 3LQ6A 3H36A 4MR0A 1S3JA 4G7OF 2ZL6A 3M1EA 3A8KA 1R4MB 1XGMA 1JUSA 1MH4A 4PABA 4YDTA 1Z7UA 3A0HC 2LY1A 1ZR4A 3K7AJ 3RCOA 2F48A 4H0EA 2F1LA 3HEFA 3BY2A 3CO6C 2ME0A 1O4XA 2KJBA 3BR1A 2QBYB 3VYUB 1OPCA 2XB0X 3FHZA 2XTXA 3T1BA 4Z4TA 1RR8C 3RIQA 3GBGA 1FYMA 2QTZA 1XC5A 3GRHA 3JRAA 4ZV4A 2N8GA 2IA1A 2X0KA 4RM3A 4B4CA 2E2JJ 2K3FA 5GAHJ 1FMVA 1FNNA 2XC7A 3DPTA 1O7FA 2BSAA 2QYOA 5J35A 1DP7P 2PEXA 3LFUA 2OTLI 4X0CA 2YR2A 3GTGJ 2B7CA 5FO1A 2WJYA 1BHEA 1ZELA 2BSPA 3CCUB 1R5GA 1YS6A 1R1TA 1VHOA 3E7LA 3O2PE 3VDXA 2M0CA 2W82A 4A5MA 1RR7A 5DS9A 4L18B 3CUQA 3CMAB 3GWZA 1QJVA 1JI8A 3ZP5A 3SZEA 1FX7A 1NDHA 1IN4A 2R6HA 2AS5F 2E35A 5CVUA 2OBPA 3CC2I 4HRIA 2NVXJ 4UUTA 3KETA 3VMVA 2PIAA 1FBSA 3IRQA 1RKWA 5ICGA 2VQLA 4NQWB 1JKPC 3I3LA 4M6VA 4YXWA 1YX3A 1SFOJ 2VIXA 1W7PB 5J3OA 4A3DJ 4OOIA 2KP6A 4TKOB 4H4KC 2DIEA 5JMCB 4P55A 4YELA 3GTMJ 2C5HA 3GIRA 1H88C 3RIRA 5F64A 1G7RA 2WAEA 3KYCB 2IXSA 1ZRFA 3JX8A 1QNTA 4P3IA 4S0HB 1PP7U 4CSWA 2ZMEC 2XGJA 3WQZA 3J81Z 2CF4A 3LSTA 2BBYA 3A8IA 1OB2A 4E7HA 1FOKA 2L4AA 3FMSA 4BXUA 4Y52J 1TW3A 1Y6IA 2KT0A 1LVAA 2QA4I 1BR1A 1UMQA 2JUCA 3ECHA 3OSFA 2ZTNA 4E0FA 3JRDA 2D5VA 1QO0D 3A3BA 4MO7A 4GXOA 1T08B 2GIZA 2G7UA 3A2KA 1WOOA 4XM3A 2WZPP 3VNVA 1OFEA 4U7DA 2DDAA 5L3CA 2OAZA 1Z91A 5B1BH 3ZBUA 2F5DA 3GO5A 1BL0A 1YITB 2HOEA 2L2OA 3RKWA 4PGOA 4M3FA 1R4NB 2OV7A 2DI3A 2ELHA 4J01A 1V55H 3WNCA 2BXZA 2D3LA 4HA8A 1G8XA 2CFOA 2WB1A 2R5YA 2XKPA 3G1MA 4Z6YA 1R1UA 1E3HA 3S1NJ 4OIPF 1MMDA 2JQ7A 3MZHA 3GQAA 3IWFA 2MD5A 1WQ2A 5FFZA 3HDDA 3K4CA 1IB0A 1N07A 3OYDA 1JRGA 2HPMA 3F0CA 1QHHD 2E1RA 3SLDA 3CJTB 3HUGB 4DK0A 2XAGA 1GHCA 1OYWA 1QPMA 1ZAOA 3ZQGA 2B63J 2P5KA 1YHQB 3W2WA 1R1VA 4N9HA 4A3BJ 4BJ6C 1O8LA 2WBMA 1XE1A 3B90A 4NC7A 3QWLA 3I0TA 3QE2A 4Q4ZF 4P22A 3CB4A 2HLDA 1DU6A 1N75A 1U5TC 2X48A 1BW5A 4F92B 3G2BA 2E60A 5CPRB 3ZMSA 1XQBA 4IVNA 4WF2A 2NS8A 5BOXA 2WY8Q 4U9UA 2X0LA 5E8GA 4A6EA 2X8KA 1KQ8A 3E1YE 5AMVA 1IGNA 2BM6A 2R7RA 1IDKA 4KMFA 1WJ5A 4BYYA 3BR6A 4DIQA 2D3NA 1ZGAA 3PUBA 2L9SA 2FEZA 3J81k 4RGUA 4AVZA 1JKRC 2O61A 2BW3B 1UELB 3DKXA 1MBJA 1VQ5I 3CDHA 2FOWA 2VI6A 4UVBA 3U1DA 4LLGF 4PSWA 4UB6C 2IEKA 1TW2A 1Q1HA 2MFZA 3TOAA 5M5YJ 4B3AA 1LB2A 1OB0A 2OK7A 3P4GA 5JI6A 2NS0A 1MJBA 5DUIA 2HOTA 1IXRC 4FCYA 5F04A 1GVHA 5DNSA 3SZPA 1N05A 4N4OB 5E1ZB 4C9YA 4ACAA 5JLVC 4M72A 5JHUA 1DPRA 3MCZA 3N05A 4X8IA 3L1PA 2MBFA 2VKEA 2NVYJ 1ETVA 3ZSCA 4L0YB 3OJWA 2QY1A 2IBDA 4ZH4F 3OOCA 2COMA 4B47A 5FKLA 2CRVA 2VBUA 4G7XA 5IYPA 4MQ9F 2I1LA 3KP6A 4B3XA 4L5JA 2HGCA 1N0UA 1Z67A 4IF4A 4YIFA 1ORKA 5IT9Z 1IRGA 2DTZA 1OMIA 1J5YA 1I1SA 2R9VA 2E1CA 5LBQA 4D5FA 1T95A 3JAMZ 3ZPNA 5L46A 5E79C 1DBOA 2AXLA 3G71B 3G3ZA 3BG6A 3KEWA 5B1AH 3FIWA 2J8KA 5JLWA 2NT6A 2RAEA 1F1ZA 4BY1J 1K8AD 4HDVA 3MFKA 2DA7A 4NUBA 1M1EB 1MZBA 4LC0A 3CDIA 1GXQA 2FOKA 1R5BA 1TWHJ 2CUJA 5M5WJ 3BTJA 3V7AA 1QUEA 1MMSA 4Z06A 2DJIA 3WTTC 3B8YA 1MRZA 4YC5A 3QYFA 1YIOA 1P4WA 3OW2B 2R7SA 2F1MA 4AF7A 1TC3C 4LBWA 1WP6A 1B9MA 2V1XA 1GQ8A 1H89C 3Q3SA 3K4MA 2BGIA 2BM1A 1YW7A 1IB4A 1XD7A 3BTCA 2NNNA 3QQAA 5IP7J 3AFHA 2EB7A 3SY2A 3KZYA 4F7ZA 3AGQA 3CMAI 3W6JB 2G7HA 1F60A 4YFOA 2INUA 1U2WA 4AIKA 2Y2ZA 4M3GA 3ISPA 4WK8F 4WXCA 1WVRA 4M3EA 1VQ7I 5GV7A 2CG4A 2V5IA 1O7LA 5KNLA 2V7TA 4I76A 3WNDA 2R7TA 1IO2A 2FUG2 3FJOA 1AMOA 3CCSB 1WPCA 3BCFA 1V0FA 3I4PA 2L5QA 4XSXF 3KLOA 1BIBA 4ZYDA 1W87A 3OYKA 1DGWY 2X1DA 1MMNA 1Q82D 3CUQB 4RGXA 1D0XA 3J80Z 1R5OA 3PSIA 4Y13A 3HOSA 3QPTA 3DDYA 3ZC3A 1TT5B 3VNUA 3B4NA 2ZZFA 3ASTA 2HOAA 5CDFA 4I7HA 4R1HA 2HXOA 1YTYA 5J8FA 4X6AJ 3OYMA 3SZGA 4L9TA 4NHJA 1WDTA 2J8IA 2NT9A 4A2UA 1APLC 1YE9A 5EZHA 3S8PA 4ENMA 2K9QA 3MWMA 3M8EA 4FQGA 5TGTA 1NHCA 3MEXA 4I99C 3SXYA 2ECBA 3GFIA 1K5CA 3GQ7A 2EFWA 3M3YJ 4HQEA 1O8FA 3CXCB 2KVOA 1J9ZA 3BCDA 2WY7Q 5KCMA 4AYBN 2EIKH 2JT1A 2NZMA 4P9UA 3V76A 2UVFA 2VBSA 3K70D 1MSEC 4ZTFA 3SZTA 3GTJJ 3ERMA 4F3QA 2NXNB 1T33A 5J1UA 4WCGA 4XLFA 4ZYGA 2FJ1A 5KAIC 2KZVA 4BJ5C 2PLFA 1M1KD 2OTJB 4HF0A 1UHMA 1Z0XA 2KDOA 1CNFA 2VJ5A 4TMXA 3T51B 2VB6A 1R71A 4AU7A 1O8DA 3PSZA 1D0YA 1UZCA 2F5VA 4ZCIA 3CRZA 1IJFA 3LA3A 1YW9A 5DYMA 3GTOJ 4RDJA 1OCTC 4MHGA 2Q8KA 4X0GA 1LJ9A 2NNYA 1TWGJ 4PC2A 1SVMA 2L02A 4ROXA 1UB9A 3K70C 3N90A 3JSPA 3AKZA 4IRGA 3EUAA 4F7DA 3O8HA 2UZKA 1NBMA 2O0VA 2QENA 3H92A 2DA6A 1RKTA 3KP2A 2ZSIB 4N3NA 3A8JA 4PAAA 2DLLA 3AG3H 2X6YA 4UB8C 2QCOA 5CYVA 3W2GA 4Y15A 5DUKA 1AU7A 2OZUA 2YX7A 4G6DA 1MDMA 3SYTA 1PJRA 3MZ8A 1TWAJ 1T2KA 3EETA 3WXMA 2YSRA 3AG1H 2KJCA 3I58A 1WJAA 2O6WA 3H5NA 4EQQA 2IT0A 3R4KA 1QVTA 3SFIA 5DDGA 2R7FA 3JRIA 1MGTA 4IHSA 4BQNA 4Q5SF 3OZUA 3KEQA 1WRJA 3OR2C 4XLPF 4W8QA 3I59A 4Z1MA 2R7WA 3DBRB 2NVUB 3SQVA 3Q0VA 1IV6A 5BPDA 4Y33A 3MKLA 1OFLA 3CD6I 3CW2A 4NDLA 1LEBA 1U6GA 2Y75A 1A5JA 1WH7A 1DDGA 4B1RA 4HBLA 2JA6J 4P1WA 3CCRI 1IRXA 5FO5A 1QFYA 3C2BA 1FRNA 2HU9A 2W57A 3CJQB 3KLNA 3FXUA 1FTZA 2V1DA 3H3VK 3ZQLA 4XONA 2VASA 1WKMA 1GV2A 1X3UA 4M71A 4B48A 3BJAA 3PSFA 1OR7C 2BY3A 3PO2J 5EG0B 5E3OA 1BQEA 1RQPA 4Q48A 5C4XJ 3HPGA 1IDYA 1B72B 3A03A 3MMPA 1QRCA 5FLXK 2FMLA 2E1BA 4ZGNB 4Z4SA 2UXXA 4C0SA 2M5WA 3K4KA 5KW9A 2C5BA 3ABUA 3HOZJ 3Q0UA 3VEPA 4LK0F 3S15J 2ZXHA 3F6VA 1R5NA 4DNRB 2LZJA 4NBQA 5K5OA 1YO5C 2OCEA 4EW9A 1VQLI 3Q38A 2E2IJ 1UD6A 1CZFA 3LSIA 2V6CA 3RTRA 4C2TA 2Z99A 1TNTA 1W7PA 2L54A 3E6BA 4BE0A 1JUPA 2W1OA 4XOTA 3JURA 3PETA 4LK1F 2FX0A 3BP8A 3CCEI 3WU2C 1TWCJ 5IY5H 3A01A 2VFOA 4M6YA 3IV5A 1USSA 2M3AA 5D8LB 3B73A 4UVCA 1FTTA 2PYHA 2MYSA 2ZBVA 1X2MA 2JTVA 3IH4A 4ZJZA 1TYXA 2JRTA 3EUHC 1Y1WJ 1YJWI 1Q81D 1EWYA 2P6SA 1EH6A 4W1UA 5LGNA 1JA1A 2O8KA 4BU2A 3P9KA 4RS8A 1HA8A 2RVCA 2IQ7A 4BEHA 1QQIA 4P2NA 3J7YJ 2P8TA 4IPAA 1RC9A 4UZFA 1OGOX 1VLOA 3BY1A 1HW2A 1SD7A 4P12A 4R79A 3DU5A 3Q9SA 2CO5A 5K5RA 1KONA 2GIVA 1JB9A 1ETOA 4KYWA 1XB4A 5TY0A 4GYIA 5IYCJ 3AG4H 1RWRA 3LSGA 1N0VC 1SD5A 1ZHFA 2JJ1A 2Z8GA 2NOJB 1E2XA 2KZGA 4Y9UA 1DPUA 2AXTC 4G7ZF 1BOAA 5BMZA 3GTQJ 2K9LA 1W34A 4RCZA 3WTUC 3GVKA 2QKMB 4EM1A 1AA7A 5ICFA 3WTYC 1Z9CA 1ACIA 5BNGA 3DQVC 1ETWA 1GAWA 4EJVA 5E6TA 5JLXA 1KRHA 1A04A 2DCUA 1VQPI 4JYKA 2QTLA 3UKGA 3H94A 1CQXA 2R7OA 3FF5A 3ZZUA 3VSVA 2DYRH 1VTNC 2VL8A 2ZITA 3AL0C 1RIOH 2V26A 2KPMA 3HZJA 4O5VA 3OYAA 4DYCA 4OP7A 3VO1A 4U88A 3PIPF 2HS5A 4RD0A 5D4RA 5E3LA 5LHHA 3T56B 1I50J 2INVA 4EJWA 1J59A 2A6EF 5HS9A 2M4GA 3ZQ7A 1G59A 2R7VA 3H0DA 2QSHX 2M87A 5HNFA 3ABLH 1T5EA 2JA5J 2F6CA 2BN4A 1BC8C 1L3LA 4P9SA 3BJOA 1WCMJ 5FKKA 4LG3A 1PUFA 2VNIA 1Q1VA 2L4MA 1A31A 2GA1A 2M9HA 4HV5A 4HNUA 4B09A 5IPAA 5LGTA 2JMWA 2DETA 1V0EA 5FL7A 4RPDA 3K4JA 4HW0A 4ACBA 3G4SI 2PFBA 3BY6A 4MFEA 3OYJA 4BS9A 3ZQHA 4BHCA 4J00A 4RAZA 4ZYAA 4IW3B 3WBJA 5IT3A 2BM5A 1HLVA 4W8RA 3BH6B 3I55B 3ML3A 3BH4A 1R58A 2MA3A 4HSRA 5KK1A 1S29A 2KHMA 2XZOA 4I09A 4E7LA 2UVEA 1J7KA 5THXA 1RESA 1E0EA 4B4DA 1LKXA 1YHQI 1FSEA 4PC7A 2HWVA 2LFBA 1H8EA 4FE7A 3EYIA 2M34A 3IKVA 4L9JA 2H8WA 3WTZA 3OFNA 4OOXA 1TNSA 1QZYA 2F4OB 2L7MP 4RPBA 1OQYA 1C0WA 1FBUA 4D7MA 1JJ2B 1IAWA 4OOSA 5FFXA 3OP1A 4OJLA 2CQKA 2X6XA 1QQ1A 2IS4A 1LQ1A 1RUNA 3V42A 4U7BA 1HA3A 2HKXA 5LMZA 1QH0A 4P26A 1BJZA 1KC8D 2JUGA 1MJ9A 2XF6A 3MKZA 1VQPB 1RQRA 1AHDP 2K3PA 1I3AA 1BIAA 1V5EA 3RZDJ 1GAQA 1OLTA 1H8HA 3TDZC 1OKRA 1R5HA 1UG0A 3PNVA 3LAPA 5E17F 4ENKA 3OIPA 3OKXA 3R6KA 2V9KA 2Y9YA 3BNWA 3PM1A 2R0QC 2VYQA 1X1BA 2D9RA 1USTA 3OW7A 1D1NA 5HLIA 1EFTA 2W85A 3JSOA 1IW7F 2BYVE 3WODF 1MW7A 1EFUA 1A35A 2GK6A 2P4WA 2XAJA 4LFUA 3W2AA 1YQAA 1G6NA 2LBFB 1WJEA 5CVVA 4Q7JB 2F4NA 4KKUA 1I7PA 2E2HJ 2Y0MA 2V9VA 2Q6IA 3Q39A 3OS0A 5K5QA 2LF8A 3F22A 3ULQB 1JKQC 1LM1A 4UV8A 2Y48A 4ETSA 1MNMC 2ADUA 2H6CA 2PMZA 4IHVA 1KQ5A 2BX6A 4OM9A 3L2VA 3HL2A 3V7CA 5CQGA 1B4AA 2NTQA 3MD2A 1P7JA 1O3SA 1S4MA 3CC2B 2CUFA 3GXOA 3OR1C 2KIMA 1FC3A 3GQ9A 2PMHA 5FJ8J 3FKSA 1H8AC 2PQ8A 1H9GA 4G7HF 4JBAA 4CCLA 2V7WA 4TT3A 4WX9A 4A3MJ 3QPSA 2VBYA 1ZRDA 3DTIA 5D5VB 3T8RA 2O04A 3U2QA 3K69A 4RD2A 1D1BA 1QX4A 1JKOC 3CCEB 5HLHA 2L9VA 3Q3AA 5DM7F 3PFIA 5E1WA 3A01B 3R6SA 1IUYA 4RD3A 1Y8QB 2M2EA 2LTPA 2XSJC 3ELKA 4XORA 3TBIA 4X7CA 2MC4A 3LO8A 2X6OA 3W6KB 2W7ZA 3BR0A 3HYIA 3BPVA 1U8BA 1WI3A 1ZN2A 2CMPA 4WXHA 4HG2A 4YALA 5IYWA 2CRGA 2GLOA 3OS1A 4EATA 2LY2A 3WWGA 2XGEA 3LSKA 3B6CA 2YWGA 5FA6A 3H5AA 5EZGA 1XDSA 4E7SA 5AIPA 3OY9A 1S9HA 2DOAA 2KDZA 1IC8A 3E6CC 4P6YA 4XL9A 3HM5A 3BG7A 4G8XA 5HZAA 2W00A 2HOSA 4OPWA 1HSJA 3GTLJ 2LH9A 5M5XJ 4A5NA 3S2DJ 3QOEA 4A3CJ 1JA0A 3CCVB 5C1CA 3A02A 2HYFA 5B6IA 3K9TA 3JRFA 4ITVA 5C4JJ 2XT4A 2BOLA 2B7EA 3V8LA 2GJRA 4PC3A 1O8HA 2OA4A 1OJLA 1R6RA 2OD5A 1TL8A 1ZM9A 1XSXA 1A8PA 4BPRA 3HGGA 3KYLA 3LMWA 1HKQA 4XOPA 5F1RA 1OYYA 2FQ4A 3TH0A 2IA0A 4OWRB 4QVJA 1OR7A 1V5FA 3AVUA 1I27A 1A36A 5LEKA 2AHQA 1EZGA 4IRIA 4C2LA 1KU3A 5IP6A 3FK7A 1MH3A 4HDUA 4DNTB 2NYXA 4FX0A 3E5XA 1S7EA 1XG1A 1MBGA 3AAFA 3T9GA 2BY1A 3OSGA 2QUFA 2JPCA 2IJLA 3LA2A 3O6BB 2P5LC 4LG0A 1WXRA 3GZ5A 3F8NA 3GF2A 2Y0SN 3ZMVA 2D45A 2FE3A 1Z77A 1YJ9I 2BV3A 5F4OA 5J6XA 4Y17A 2DFHA 5F4JA 2DK5A 1B59A 3HHGA 2MLGA 1B8IB 1KK0A 1X2NA 5JR3A 2E34A 1V3FA 2ZMEA 2BHYA 3BLYA 3R60A 4IX7A 4BBSJ 3GVJA 4Z4VA 2GWRA 2K5CA 5TJJA 4OOVA 2Q6LA 5BS6A 2DA1A 2DODA 2H09A 1TLLA 1IXCA 3NWTA 1YX5A 4LLLA 3KP5A 2ODLA 4OJOA 4XQFA 3GTKJ 3P26A 1T98A 1P7IA 2BPOA 2OBTA 1R00A 1ZGJA 3LOCA 1WSRA 4YHBA 3QFRA 2XF7A 2O5RA 1FBQA 1U5TB 1Z7LA 4EJTA 2XASA 1HSTA 1B23P 4N3GA 4QHYA 1UMKA 4KN4X 5LGUA 3LSMA 3J7AO 1FYKA 1Z3XA 3GSIA 3I1FA 2JDIA 3VSLA 3TEDA 1VQ9I 4OZYA 4HLYA 3FBIB 1S6LA 4YFKF 1IN6A 4F55A 3F3XA 2ACJA 1DABA 3PSSA 2ZJ2A 2KLOA 3P9CA 2RKHA 1MDMB 2VUMJ 5CJ9A 3OYHA 2VPLA 2IP2A 1QRBA 2VFPA 3WU0A 5IYBJ 2QQ9A 4KH3A 4OMYA 3KIOA 2OTJI 2XZPA 2RN7A 1FY7A 4KFCA 2CQ7A 2DQLA 2XAFA 1PDNC 5D4SA 4DOZA 4XN3A 1KA8A 2JN6A 4O6JA 1QA6A 4RD6A 3I53A 4Z4RA 1SFEA 4FXUA 3ZGKA 4IJAA 4CCJA 3WTXC 1WTHD 2WZNA 2HYJA 2Z3YA 1VQKB 3HSEA 2XPWA 3AVWA 2A05A 3CMYA 2HDCA 3CF5F 2WSSA 2ZL5A 1BOBA 3ABTA 5HODA 2WYRA 4X7FA 1MKMA 4ZZLA 2O6GE 1W2BB 1OFMA 3M9AA 4KT5C 5IOYA 1SKQA 3OYFA 2COBA 4Z4WA 2O7OA 3GW2A 4MYTA 3PNYA 3JW4A 1UD2A 3H3ZA 3FMQA 2E7WA 1W0KA 3GCMA 2VKVA 1G4DA 1KD1D 4JQFA 1K8FA 3QYEA 3DFGA 2HDWA 1VLYA 4G1VA 2D2WA 5J8CA 2WTEA 3SEQA 1X1CA 5E1XA 1OGJA 1EFCA 5FKOA 1SAUA 1ZUNB 2KIQA 4OMZA 4BAYA 1XCBA 5F0CA 1YJNI 4A69C 5C3EJ 1E64A 2BM0A 2L9RA 4RAFA 1SVOA 1OOCA 1OGMX 2Z16A 4G6IA 5BSYA 1WJBA 1FDRA 3ABKH 3ES9A 1KQ0A 4B8XA 1ZR2A 1ZARA 2VNHA 1QPIA 2WV0A 2PJPA 2DA4A 4CZZA 1HF0A 2NSTA 3BG3A 4OAYA 3PL8A 1GT0C 2HVQA 2V4DA 1VQ7B 1BJAA 5B5EC 5FKMA 2DOFA 1IV8A 2A5WA 4AIJA 4D0PA 2DA2A 4JMQA 1Z6TA 4HV6A 3C2HA 5CKTA 2P6TA 3K10A 5CVIA 2DO7A 4DW6A 1PUEE 3HKZA 1VFCA 3GYHX 2WPDA 4CXFA 1OCOH 3WG7H 5D8KB 2RNGA 4DYQA 3KEOA 1QG0A 3NARA 3G71I 4IO9F 3GFMA 3OYLA 2H1KA 1O8IA 3GQ8A 1YLOA 2VLAA 2YU3A 2R4GA 3CCYA 4PJ0C 2XAQA 1F36A 2TCTA 2KQRA 1XPXA 1LLWA 2PYGA 2ZB9A 3DU6A 1SMTA 1X19A 1B1BA 1TQMA 4RM2A 3ZR8X 1U8RA 1GO2A 1ETYA 1W36D 4MLOA 2XROA 4N9IA 5D5XB 4X05A 5GADJ 1YI2I 1JXSA 1RI7A 4MNUA 3I54A 3EQNA 3E0JB 5FGMA 1TYWA 2LR8A 2OJED 4GDFA 4BE2A 2A3SA 4DBQA 4ZYEA 2ISZA 4WQMA 3SLNA 3ZCOA 2E71A 2K9MA 1RRJA 3DKYA 3JQQA 1YIJI 4HEA2 3TOBA 4YFXF 2R7UA 3ZUGA 2IPQX 4CDGA 2Q2EA 1HW1A 1ZYRF 2QE7A 4V02C 1QHGA 2WAFA 4E7KA 3LA7A 3NAUA 1A6IA 1LUJB 4PGGA 3SEZA 4BJTA 2ESNA 1HZEA 1PKVA 5F0FA 4AF6A 2IAIA 3GZNB 2VFQA 5E18F 3H35A 4Q47A 5HDNA 4P1VA 4U0VA 4DBRA 4HPQA 2LDUA 3QU6A 2EH3A 2ELJA 4L5EA 5TISC 2GPJA 2E1OA 2XV4S 4FT8A 3X2QH 1Q7YD 2M5SA 2A6HF 3EPZA 4OPVA 3JTGA 1JGSA 3BQJA 1QVUA 3HBLA 3QU3A 3A3GA 3QSYA 5IYRA 3BDDA 3M7GA 4AWXB 4A3EJ 3RJPA 3GVAA 2HI3A 2W4SA 4MYUA 2ETHA 2VZLA 5L3FA 1K9MD 4RBOA 3FM3A 3OPOA 2DW4A 2XGDA 5AONA 3F6OA 3A35A 3CPXA 2A69F 3IAS2 3REOA 1E1QA 3JU4A 1JTAA 1TYVA 4Y3OA 3DPLC 3J81K 1XB2A 3ZMUA 4JP0A 1N77A 2OBRA 2XOKA 3SYJA 3HOXJ 3ABMH 1WH5A 3P5JA 3G4SB 2I8DA 4EM2A 1NH3A 4KKTA 3W5HA 3ZOBA 3BQYA 1FP2A 3E6DA 2KFDA 5ED4A 2O3FA 4UHTA 2CC2A 2A07F 2RREA 1LE8A 3DBHB 1NJID 2KKOA 2XTWA 2VJ4A 3OAAA 2QQBA 4RB1A 4D7NA 3GTPJ 3BCAA 2DXIA 3ASOH 2ZZQA 2XTYA 1L1IA 3CZ6A 1XDUA 3A1YA 3QPHA 3I55I 1HVXA 3VODA 2NSPA 3CO7C 1ELOA 3BC9A 3RKYA 3CCMI 1ZH5A 4X07A 4JX4A 1GUUA 2ZBUA 2NVTJ 1BI1A 3AVXA 1PXZA 1Z3YA 4M74A 4CQJA 3LQEA 3CMEB 3KZZA 1UD4A 2DYSH 2IS6A 1LFPA 4UZUA 2EV6A 2DA3A 3WYAA 5F6FA 4BXFA 5J4VA 4GRIA 1BPLA 2GK7A 1XS9A 2ZO4A 2K27A 1SFUA 1H0MA 2VBXA 3F9KA 2EZIA 4Y4RA 2BXYA 1O8GA 2FQ3A 4I98B 4FETA 2WA0A 1R22A 3ZZTA 4KUMA 3DP7A 3QFSA 1HC8A 4DK1A 5J1YA 1R9TJ 1WJDA 2D1VA 1E17A 2HQAA 4CH7A 5M3MJ 2C4UA 2TRTA 4ESBA 1W7PD 4BQQA 1X4PA 2ZNZA 1BI0A 2LBFA 1FP1D 2HKOA 1WU8A 1O57A 2CQNA 3FKJA 1BI3A 4Z4UA 4YZAA 3P7NA 5L3BA 1O8KA 3HOYJ 2RC4A 2LD5A 1GVJA 2DK8A 3G1LA 3DTEA 3L2WA 1AKHB 2QN6A 2KL4A 4HE5A 4PZJA 2DOEA 4LB5A 3ZN1A 3SJPA 4N0BA 4IHTA 2HPIA 4CICA 1WZ2A 2V7VA 2BV6A 2VT2A 2DMPA 5DEQA 4E70A 2BY0A 2ID3A 4A3KJ 1J0RA 2F4MB 5EMNA 1YI2B 3VOEA 2RGVA 4E7ZA 2V6EA 1W1WE 2QQAA 2LVSA 4QPQA 3OYNA 2M1BA 2MC3A 3PJRA 2V7XA 4A12A 1WSVA 4S04A 3U21A 5LRSA 1ZLKA 4OPSA 1T56A 2NTBA 1TSPA 3DEUA 4V2GA 3W2HA 2L0KA 5HS7A 2IS1A 2BMWA 4L5IA 2DA5A 4M9ZA 3WHBA 1BX1A 3OYCA 4C2UA 3I56I 2I5UA 2ZL7A 2Y30A 3HTSB 3FX3A 1K6OA 1OCCH 3OEEA 2WADA 3ONYA 1I6XA 5C44J 4I02A 1D5VA 2JVGA 4P9FA 1DG1G 2XDVA 5M3FJ 2VBKA 2L3DA 1KU9A 3MMYB 1FOWA 1IA5A 3QP5A 1WWXA 2E1MC 4EJUA 4I0BA 1QU3A 5IYDJ 4YZXA 4FISA 1Y39A 3HG9A 4JRAC 1XMKA 4WXDA 4XLAA 4QSHA 5JFRA 1I8DA 3SKBA 4KIBA 1F43A 1G3TA 2X85A 5IT9K 2DPDA 4CCMA 2IVMA 3TP3A 1I3QJ 3S32A 3BT9A 1RNLA 2EFGA 2F43A 4RCYA 5C1EA 3S16J 4NC6A 4F52A 2IW5A 3AL0B 1P4XA 5FD5A 3CQZJ 3HIFA 1SKYB 3CCRB 3I4MJ 1IXSB 4LBZA 2VPRA 2R7QA 1IN7A 1TQIA 1HW5A 3K1MA 4PJJA 3H0GJ 1XN7A 2XSDC 1G7CA 3O3KA 4I01A 2FF4A 3Q5FA 4CCKA 5TR9A 5DM6F 3BCBA 2QSGX 1MBFA 1CNEA 5ICEA 3FHNA 3B02A 1HDPA 4Z4ZA 3WGIA 1VQOB 4LLNA 2VE8A 3H5RA 3KZIC 4CCOA 1W0UA 2Z9OA 2CK3A 1VQMB 1D1AA 2MD0A 3E97A 4XKWA 1SVLA 3K1NA 1ZM3A 1EKEA 1FT9A 3WE3A 3CCJI 2CQXA 5A2QK 4WZEA 4K2EA 2QGUA 1QA2A 5F4MA 1I18A 3MQ0A 5L3DA 3AVVA 3SUCA 3ONQA 3UNGC 3OL3A 2HCJB 4TMWA 2DFEA 4UUSB 3GVLA 3LJYA 1CLWA 1TTYA 2DBBA 3MZYA 4M4SA 4IXAA 3ROUA 2EILH 1G7SA 3QP6A 2Q6OA 3V8KA 2STWA 3FDYA 3NWSA 2QZ8A 4GO1A 2CS3A 2PBIA 2CV2A 1T8IA 2R93J 4J19A 3OS2A 1R23A 4IQ4A 4G12A 1DGRM 4KMUX 3WG9A 4ENNA 3N6ZA 4RJLA 5KSWB 2DOGA 2EFNA 2CUEA 1JHFA 4RDKA 3DPUA 3EYYA 2NPFA 3RSNA 3QYBA 2DYIA 3DEEA 4XKVA 3E5QA 3BC8A 2EJRA 3OL4A 4XNFA 4XLNF 3KPHA 3SHFA 2V7UA 3J80K 1PE9A 4IEJA 1T39A 2NOGA 3TW7A 1BW6A 4OJPA 3HOVJ 3WGGA 3QFTA 4TMTA 2VBMA 2XAUA 2LP0A 2M4KA 3IH2A 4P96A 2LC2A 1SFXA 2XPVA 4ZDOA 1XMXA 4BUPA 4KT6A 4YFNF 1N78A 2EZLA 1WJFA 4XSZF 1ONVA 2JVHA 1SC7A 1VQNB 1GR1A 3P9IA 3ASRA 3T8TA 1LDDA 4EVIA 3WE2A 3PNTA 4NK6A 2P7VB 3LQRA 2EV5A 1BX0A 2JZYA 2DMUA 2W84A 3O8GA 4DYRA 1SEUA 2XRLA 3HRUA 2HZDA 4XR6A 2OQRA 4QIWN 1COWA 4GFBA 3DU1X 1YJ9B 2E5NA 4S05A 2ZFWA 4OPOA 2ESHA 2Z2SB 2JJ2A 3CPWB 1WORA 2ELKA 3OWTA 4BH9A 3IRRA 2W25A 2XEXA 3HHHA 1EP3B 2PI0A 4IHXA 3W2EA 3AVTA 1QFJA 2X6WA 3LL7A 3GQBA 3GFLA 3JQRA 3DXJF 3LFKA 1MBKA 2HYGD 3CCLI 1FZPB 3C7JA 3CLQA 4E6KG 2CW7A 4ZGQB 3EUKL 1LDKB 4D5CA 2WAQA 2LRDA 3ZQCA 4XMYA 4BDYA 3BG5A 1T6YA 4AC9A 4EH1A 3MN2A 1EH8A 3GLXA 4II3A 4PGHA 2VONA 1IJEA 4YAWA 4ZDPA 4M3DA 2EFQA 3R61A 1VQ6B 3K4NA 1AWCA 2C78A 5H6RA 3I64A 3H9JA 2XF5A 4PMHA 1JT6A 1MBEA 3H9NA 4AYBA 2X53S 1VQ6I 3G05A 3RPUA 5FKNA 6PAXA 5HNHA 1HG8A 2JN9A 3HGYA 5L3EA 1UD3A 1CF7B 4PCQA 3ECOA 5JBQA 1KYZA 3I9V2 4YG2F 3U6KA 4XKCA 3VPRA 2JA2A 1R7JA 3I71A 1DU0A 1E1RA 3HPHA 3RDIA 3NEUA 2QEXI 3CCLB 2DERA 2OBSA 1R5ID 1RMGA 2GQFA 2LKPA 5DN6A 5CVJA 1IDJA 2GXGA 2DDBA 3RPQA 1OGIA 2VQGA 3U9GA 1H85A 3VFZA 3C18A 2EA4A 1T38A 4HX7A 4BACA 2FD5A 2PMDA 3NQOA 4IQJA 4BL0B 3NAWA 3ZQFA 2FU4A 4HAMA 2PMZN 1Z6RA 2YPRA 1GV5A 2PX9A 3J7AY 2CH0A 3FXMA 1CGPA 2CV1A 2H8RA 1YW8A 4PUSA 3D0SA 3HRSA 1PP8F 2JK3A 1ZG3A 2V7QA 2KRCA 1U9NA 2LF7A 2FNPA 3H9GA 2EQRA 4X7DA 2JWTA 3BZ6A 1KTWA 3PQKA 1TYUA 5F08A 3ISXA 1TUIA 1R36A 5KAFC 2GOMA 1IN8A 3DLAA 5GTHC 2QF7A 1VJSA 1S7OA 3LWFA 1G7TA 3AK5A 4LBYA 3RY8A 1LFUP 4A3JJ 4XLEA 1JUMA 1T0FC 3WTVC 3LNQA 4V2FA 2M0MA 5AIQA 3HOUJ 3FXJA 2BW3A 1G3SA 1E79A 3ZBTA 2DFFA 1AIPA 4LBVA 1OCRH 3H9QA 4AIHA 4A0YA 3TMOA 5FLXZ 4X1EA 4A3IJ 2PJRB 2KRFA 2DY1A 2FSWA 5LHGA 1YFHA 2HDNB 3KP4A 3GMEA 1U78A 1XGOA 1XGSA 2HR3A 2ISYA 2R5YB 2JJ7A 2A61A 1KGSA 1BMFA 4J0QA 4ASNA 4ASUA 3W2VA 4PJLA 1Z05A 2PMUA 5E20A 4FTHA 4AM3A 4M3BA 1P4AA 1KU7A 4ZDLA 4RLZA 3GEZA 3AVYA 1HXDA 4E7IA 2XUBA 3S2WA 2MH2A 2B7BA 4BKXA 1FMWA 5EG0A 1UG2A 2FA5A 2CGPA 4HQMA 5H2FC 2W6JA 4IRHA 4ZTJA 1BA5A 1PJ7A 4DQLA 3CP2A 2X9DA 2XGXA 3BWGA 1F5TA 2GZWA 2GREA 1R49A 1VQMI 1TQPA 3FXOA 1RU4A 4GGGA 1HOMA 4OJ6A 2OCCH 5E3NA 2B0LA 4BNCA 1KK1A 3BR5A 2WJVA 3MKWB 1D8TA 1P4MA 1YOVB 1OISA 1W0JA 1EP1B 3LYCA 2E19A 2K86A 2OZ6A 4UUSA 2ZTGA 4NNJA 4BXXJ 1U0JA 3CMEI 2PN6A 3OIQA 4G94A 1QGAA 4B3FX 2LG4A 1Q86D 1S0UA 4L9VA 4RDUA 4YAOA 2DMQA 2VODA 2L9NA 1OCZH 2CJJA 3CCMB 1VQ5B 2K9NA 4YRVA 3FMRA 2IGMA 2DCEA 5BQTA 2CSOA 2Q0OA 3PUMA 1YLFA 1O8EA 2VFNA 2VOOA 3BQZA 3FXKA 2K4BA 2R7DA 2VKHA 4Z4YA 1LVKA 2NTPA 3DEWA 3JTHA 4KKSA 2XRNA 4XN0A 4BEHB 4BBRJ 3HSRA 3OYBA 3LVBA 4H9GA 4WZTA 5JVTA 3IUOA 4LD5A 3L00A 5K7FA 3KX2A 3TW6A 1AKHA 4PC6A 1REPC 3V8JA 3WU1B 2C2WA 3BH7B 3TGNA 1SAXA 1Z21A 4KICA 3S17J 4PFPA 5B3SH 2M8GX 1NG6A 1K78B 2ZC2A 5HVQC 1W0TA 4RLFA 4QLCU 1MABA 3B82A 4HIZA 4DZJA 3VMFA 3D5SC 5FLMJ 1M90D 1HCRA 2B0RA 1KQ9A 1YITI 4A93J 1D8KA 4RLQA 2D1HA 2V7FA 4D9JA 1YX2A 3UR3C 3QODA 3IC7A 1J75A 1VF9A 2GXAA 3S14J 2GXBA 2DT7B 2LOOA 3MKYB 2CUZA 2VN2A 3K2ZA 1AIRA 4L8JA 1OYIA 1D2EA 2X4HA 3F8BA 3VB2A 4RB3C 2H94A 1IJWC 1YIJB 3BZKA 3E5UA 2H6BA 1ZTRA 2WB1N 1MMAA 5D5UB 4I84A 2O1DA 1UD8A 3ZMZA 4IOCF 4FWTA 1UCRA 3R0JA 1WOPA 1O3RA 4UY8I 2ZBKA 4LITA 1BM9A 2WV1A 2YWEA 1WPKA 3FXLA 3D5RC 2QA4B 3U6BA 2O0WA 2X3HA 3F21A 4DNCA 2MH9A 3JRGA 3RPUD 1H42A 1NRKA 2HQ5A 1TBXA 2YWFA 4L9NA 5F0HA 3LAJA 3D1NI 2FXAA 2ZJRF 1GVDA 5KHDA 5HS8A 1K79A 4OINF 2X1CA 1I1GA 1GXPA 1QVFB 2FMYA 3C2GA 4QPOA 4P3YA 1ETXA 1P2FA 4M6XA 2L7ZA 3D5LA 2Z1DA 2FVGA 4FK8A 1N06A 3AGPA 1EE6A 2ZJQF 1YRNB 2CFXA 2XNDA 1KCDA 4LOCA 4XRMA 3OJXA 1K4TA 2VBEA 4A6DA 4OAZA 4C30A 2HFHA 2HDDA 1GLNA 1TWFJ 2OK8A 1NK3P 1P92A 3VSUA 2XIGA 1WOSA 5ILSA 1BR2A 1X1DA 2H1LA 3CJRB 3QPLA 2R7ZJ 3ZMDA 3ZIAA 1X3WB 4TV7A 1JE8A 2OTLB 1DBGA 2DT5A 4M9XA 3MHPA 1F9NA 4YAFA 2QZAA 2AHOA 3BR2A 4YEIA 4EMSA 3U1KA 2YUSA 3KP7A 3L2QA 5J4YA 2MW8A 1D1CA 3PUNA 1FIPA 1FNMA 5EEGA 4QFMA 3WBKA 5GAEJ 5IP9J 4IOAF 3WY9A 2XZLA 2VT3A 2DMTA 4FE4A 3U2RA 5ILUA 4TMVA 5FB2A 3CESA 3CCUI 3JAMK 5K7ZA 1MSFC 1QBJA 1ZM2A 1AOYA 4KDPA 5IYQA 1ODDA 3DF8A 2GQQA 1W5CC 3Q9VA 4ENJA 2BGCA 3CMMA 5BSXA 2RDPA 4K1XA 3WNBA 3M4OJ 2KRHA 2HQNA 4TMZA 3UW0A 1ULYA 3V7SA 4IHWA 1Y0UA 1I6HJ 2DPUA 1IHMA 1UFMA 5GPAA 3TL4X 4M1KA 5LFAA 3LSJA 3V4GA 3VO2A 1FPQA 3CUQC 4ZC3A 2HVRA 1OFDA 1XGNA 1VQKI 2B9SA 4M73A 4QTRA 2W6IA 2WR8A 3IAM2 1EF4A 3M8JA 4XRFA 4U49A 2V31A 2R92J 2P5VA 2RV8A 1SFKA 3SDGA 1FEXA 2C4TA 1E3OC 3VYRB 5L3GA 3S3NA 4B3GA 4RDLA 3CCQB 2QM3A 5IYNA 1FRQA 4G6QA 3V7RA 2Z6BD 3B8HA 1UD5A 4LB6B 2BM4A 2F3LA 1ZREA 2X51A 2DT6A 3OEHA 4HWVA 1ZG5A 1GDTA 2VC1A 4L0ZB 5H6QA 1WI9A 5DSZA 1VQ8B 1DUXC 2Q1ZB 5DCFA 1BI2A 2Y69H 3FPPA 2KISA 1Y1VJ 4KIFA 2FBKA 2VBTA 3Q0WA 3RKXA 3KE2A 2E36A 2MSYA 3W5UA 4Y9RA 4ZYHA 4HZFA 1UJ8A 2EINH 3CF2A 1VZ0A 1RUOA 1XMAA 3VYTB 3G1OA 2QLZA 2TDXA 2Y0SA 2OPTA 3BOQA 4CCNA 3PA1A 4QWQA 5GV8A 3BTLA 1XSDA 4B44A 4A3LJ 3SJMA 3ONUA 1S72B 3K4LA 3E20A 2EPFA 2ZCWA 3SFZA 3QOPA 1EA0A 1N8RD 1DARA 2PECA 2BE5F 3FPKA 2P81A 3PUFA 2LNBA 4RM0A 2ZXWH 3N97A 2JA7J 3MAJA 2IGOA 3IL2A 4CYCA 1ETKA 1GJRA 3EQOA 2EIJH 4XRSG 2WC2A 2C6YA 2XNCA 2DJNA 3HOWJ 1YJNB 3GX4X 5FD6A 2XGCA 3DV8A 5E8IA 4MIMA 2ICWG 4E4HA 1LPQA 4UUVA 1FNDA 1N08A 3LMMA 3VWBA 2L7KA 3IH3A 4DZPA 3NRVA 5FLVA 2RNJA 1LLZA 1VBLA 1J9IA 2OU2A 2YWHA 5IK2A 1K73D 2EBIA 2Y31A 1V5GA 4A0XA 3I59B 3K1PA 2WAQN 3EQLF 3BZCA 1TT0A 3KYDB 4PK4A 2VKDA 1LDJA 2DN0A 3BPXA 4RB0A 2BGJA 2PE3A 3SEJA 1SANA 3BJ6A 1K28D 4AUXA 2GA2A 3CCVI 3RKQA 2VFMA 2IOUG 5EGOA 1FOXA 2FX3A 4X7EA 1IN5A 2FBIA 2YX4A 4A0ZA 4GQNA 3FKIJ 2BHZA 1P6RA 1ENHA 3FM5A 4HYEA 2ZKZA 5J40A 5GAGJ 2QSFX 1DDIA 1EJ9A 1PUFB 4UVAA 4II2A 2YU9J 4RD4A 2EZKA 4CA0A 1X1AA 1P9QC 3A4CA 3PQJA 3W3CA 2MLKA 2VBVA 3Q6RA 5FIUA 3I4NJ 3JQPA 1VQ4I 4I0AA 4ESJA 2E7XA 3IWZA 2I10A 1W35A 2BF4A 4R71A 4QUZA 2ZMEB 4ABZA 4ZZDA 1JJ6C 1LNWA 2K4JA 2XKOA 1FYLA 2EFPA 4M53A 4BHBA 1HF2A 5HLGA 1PJ5A 2G0EA 1E63A 2JPBA 3T53B 3CCSI 3F8MA 1U2RA 1POGA 1JJ8C 3T0YA 3ZMTA 1VQ9B 2QMUA 3PVDA 2M30A 3F8CA 1SD4A 1EP2B 1TLHB 4GYGA 2F5FA 4WWVA 4NC8A 5DTDA 4M0LA 3JREA 4RD1A 4UZEA 3S3MA 2K9SA 2W7NA 3FXQA 1E62A 1MMGA 1KTVA 4EV0A 2AO9A 1HKTA 5F1JA 1E3ZA 4WZKA 3DCFA 3CUOA 5FNZA 5D6EA 2G9WA 1W5TA 4R8HA 5AN9A 4W8TA 1TP4A 4PFOA 2V1NA 5HOOA 1HQCA 1T6SA 3H09A 4BDZA 4JOMA 5GTIC 2BZTA 2A6TA 4KN7X 4OZZA 1V54H 1EV7A 3KCCA 3RI4A 4QVAA 2R5ZA 1V5VA 3R6JA 1BN8A 1XTAA 1DP3A 2RC5A 2E1MB 3EDPA 3OV8A 5A89A 4YZ0A 1ON1A 4PJNA 2XVCA 4XD7A 2PLYA 3W2IA 1FNBA 1IG7A 3L2CA 1XFOA 3S1QJ 1FLIA 4UAJA 2FNAA 2GM4A 5DS0A 4OIOF 3L2UA 2VJJA 4G5GA 2QDXA 4HX8A 1ZM4A 2EWEA 4UV9A 4D1QA 2VE9A 2ZZEA 4DQ2A 2RQQA 1KZHA 3ZXSA 1QVGB 4DGWB 2IGKA 2XPUA 3TQNA 1VQ8I 2VC0A 1KCCA 4KITB 4BGDA 2FBHA 1FOYA 5EF6A 4HF2A 4CZCA 1IRFA 5JVGF 3LQQA 3LSPA 3FWEA 1K7AA 3CCQI 4C43A 2EFOA 1VQOI 5DCMB 4AC0A 1T6ZA 3OE7A 2ZFUA 4MGRA 1SMYF 2J5PA 2XT2A 3TO6A 1IDZA 3RQ4A 1KK2A 1VNDA 2GBYA 2QQ8A 3HTUA 3BTIA 2PJRA 5D6FA 1O8MA 1G3YA 4C3HJ 3G73A 4QV2A 1BR4A 5A8AA 3DKWA 1QGPA 2FRHA 2NV4A 2ID6A 4LJZF 5IOZA 4CUGA 4HLXA 4WZLA 3ZPPA 2F4IA 4BE1A 2CWEA 3T5XA 3WTWC 3FK6A 4PC1A 4FHTA 4Z03A 3COAC 5LEJA 4HF1A 2GJPA 1D0ZA 3H3UA 2CNDA 2HEOA 1WFXA 1NB9A 2ZZGA 1EH7A 3ZRGA 5HXBA 4YIRX 3CC7B 1FNCA 5H59A 4AIDA 2QVOA 2ZJPF 1D8JA 2QYUA 2R7XA 3BG9A 2IRFG 5J3LA 2BVLA 4ESFA 1A6QA 2KMUA 4EM0B 2LKXA 1O3QA 1UAAA 1TVCA 1E43A 3JCUC 2HMAA 1IZ1A 2A68F 2V4JC 4NB5A 2ME6A 2KIFA 4LG0B 2RC6A 4U0YA 2J7KA 1F4KA 3IKTA 3I56B 4MXNA 2F5EA 4M9SA 5F27A 4M2LA 3IP4B 1B8IA 4W8SA 4KJZA 5DD8A 3GFJA 1B2RA 1QZEA 3WTSC 1I39A 3FXRA 1JTYA 5J47A 2XB5A 1W5SA 2VNJA 3SJZA 2X3UA 5CVRA 3A1PA 5E3MA 3HRTA 4WWCA 3PIOF 2V9PA 2M45A 2HQRA 4N4NB 3ZZ0A 2MABA 3OYIA 4Y7CA 1PVEA 2W48A 3FBNB 1B9NA 3FY3A 1ON2A 4O3MA 3PFYA 4XLHA 5HDKA 2XNJA 3PO3J 4KNYA 3J7ZI 2JSCA 4YZQA 4NQWA 2H27A 2STTA 1CF7A 2NAZA 4HOBA 2GOXB 4RMNA 2CW0F 4Z2YA 1U3EM 4A3GJ 1B72A 5EEHA 3MCAA 3E6MA 1WHUA 2EWNA 2XHKA 1WJCA 2LMDA 5TRDA 4NK8A 5KVRA 2B5OA 1K6YA 2LSOA 1LFBA 3W6VA 3OZVA 2VXZA 4AVPA 5GP9A 1D5YA 3GUDA 3CLOA 2DTRA 1K78A 1QZZA 1WMRA 3K0LA 2C77A 5EYRA 2EK5A 5LD2C 3CP8A 5DV5A 1Q9SA 3LSHA 4B43A 2O9LA 3WHCA 1J2XA 3KFWX 2DMNA 3NE5B 1X4OA 1WGXA 1U9OA 1DQUA 1X3ZB 3M07A 4G9YA 4UXNA 3WGHA 3I5UA 2Z33A 1Y0RA 3JRHA 2ZXJA 4XBFA 3ASQA 1ZKGA 3ASNH 1VF7A 3TKYA 3S3OA 3QFCA 4ZCLA 1W9XA 4LIUA 3NB2A 2DQRA 3F8FA 1FX0A 2Y9ZA 2DU9A 1RETA 2OC6A 4G1BA 2BVMA 1QFZA 4NCNA 1ZLJA 1HKSA 2P0WA 1BLIA 4XIDA 4HE6A 2O8XA 4TN1A 1O88A 4FASD 2RQPA 5LRRA 1IRZA 3K2AA 1E3XA 1KZLA 2EIXA 4OU0A 2UV1A 1DDNA 4P25A 4OJ5A 5H5JA 2Q2EB 1TTTA 2CU7A 9ANTA 1E3PA 2YS9A 4BHPA 4X06A 1XCVA 1F20A 4EEFG 1O8JA 3OIOA 5FROA 1Y8RB 2M7AA 4I2OA 4KISA 2VXDA 5TV2A 2CYYA 2HTSA 2NVQJ 1K4SA 3QAHA 3GZ6A 3RZOJ 4U87A 1QUFA 1QA3A 3HUGA 3ESWB 3SQNA 2BVNA 3OOUA 1XG2A 2Q6KA 2QXZA 4YCQA 1FWZA 2VBZA 2BY2A 4RA2A 1T0FA 1H80A 3OYGA 4ZCMA 1EFRA 1FSHA 3W5VA 1SD6A 4PSXA 1L0OC 4MEYF 4CO8A 4Y7NJ 5HKKA 3BR3A 3CC7I 2O17A 1MJAA 3DLLF 5BPIA 5B66C 5EEAA 3DWLE 3AG2H 3ZPLA 4I6ZA 4JK1X 2BM7A 5K7HA 4RAGA 1W4MA 2L01A 4JX5A 4XK4A 2EV0A 3OMYA 1K83J 2LK2A 1QGZA 4A3FJ 5EDNA 1I5ZA 4E7JA 2CW5A 3HAGA 5GPCA 2NRAC 5EGOB 1OFCX 1W36C 4DQKA 2JA8J 2R3SA 1EA3A 4EGZA 1OB5A 2F2EA 2CQQA 4CYDA 3S1RJ 4BQAA 4C3JJ 3CTAA 4YEJA 3L9FA 4RGSA 3KP3A 4XRSA 3B78A 3HJEA 4HNTA 1Y0NA 3CD6B 5ERIA 2QKLB 3VSTA 1FJLA 2MGQA 1NG7A 5D5WB 2HVSA 1HBXG 5A88A 2J5OA 3HB9A 4RAYA 2QBYA 3VYSB 4XLCA 5H20A 2CW8A 2VBWA 4KA4A 3VMWA 4RGRA 4IKFA 5FRMA 1B6AA 2Z5UA 3M8FA 3N4MA 2UXNA 1XX5A 2LLKA 2OUMA 4CYCB 1BJKA 3ASSA 1UHSA 3Q6QA 2GAUA 2E1NA 1OCPA 1N25A 2IGNA 1WSUA 1ZK8A 4HX4A 2X1EA 3G6EI 1QA1A 2ZSHB 2BEOA 3HC7A 1X58A 1IUFA 4U0WA 1YYVA 4PDKA 4V19K 3ASPA 3VR6A 2ZXIA 4MTDA 1D3YA 4LMYA 1EXMA 1JT0A 4HSTA 3K6GA 3CC4B 1YJWB 4ANJA 2L7FP 3HKZN 3DBLB 1QCXA 1J09A 4IL6C 2EIMH 1CQTA 1PYVA 4F91B 2EZHA 3BROA 4MTEA 4NBSA 1S5LC 4DJAA 3C1DA 3DTKA 3SDBA 1JGGA 4F93B 3RQIA 1U5TA 2OQGA 2CV0A 5A2QZ 2P7CB 4YIIA 2LY9A 2EA2A 3HRMA 1ZRCA 5CLSA 3QRFF 1BC7C 2M8EA 4FN5A 1ITYA 3A0BC 2VJIA 4G7WA 4W97A 1K4ZA 2M7BA 4P6VF 3TP0A 5K1YA 1X1PA 2G0YA 2QWWA 1VQ4B 2UUZA 3D26A 2K02A 4PJMA 2QX3A 4CHUA 2HZTA 3M1CA 1H9TA 1MNEA 1LE8B 2IS2A 1JTXA 1PLUA 1YG2A 1RPWA 5CQEA 1G2HA 1YRNA 3S93A 2UWMA 2JIZA 4YAUA 2HTJA 3CDLA 1MIJA 1YS7A 4URRA 2XC1A 5LHIA 1PJ6A 1NB0A 2OYNA 1KQSB 2JSPA 2CBXA 4LGWA 3ZQIA 4P5OA 1VI0A 1RZ4A 5FRNA 4HNVA 4Z05A 5FO0A 2K85A 1BBYA 2VQHA 3MVPA 4C2MJ 4C3IJ 2D74A 4LIVA 3E3VA 2LYCA 5JHFA 4U4BA 1VQLB 3FISA 4RB2C 2QEXB 2K7LA 1S7AA 1IF1A 4GCVA 2VOPA 3EUHA 5DD4A 2F5CA 3F72A 2E5ZA 3E1SA 2IA2A 3L09A 4AD9A 3RYRA 2GJKA 3ML6A 1K61A 3ZQQA 1X0CA 1NK2P 1NHAA 4TSFA 5HDGA 1UHWA 1Z1DA 3JR9A 3H1CA 1KU2A 2O03A 3W2FA 3OOPA 3L7WA 3PA2A 3OYEA 2ZNYA 4FX4A 3OZWA 4JX6A 2A5YB 2MG4A 1ZG1A 1JHHA 1BN5A 1ERDA 1Y0YA 3IHUA 2P3MA 3RYPA 4BY7J 2KIUA 4IZZA 5HZBA 2QGGA 1S8NA 3K4BA 3KL9A 3HOTA 4XICA 4EJOA 5LLQA 3B6AA 2XAHA 1STZA 2NS7A 4MFDA 2JRMA 1V4RA 3TDUC 4EGYA 5J1RA 3FZVA 1KYWA 2LKSA 1ZGWA 3PENA 2DFIA
chains in the Genus database with same CATH topology
4YZAA 2Q1ZB 1OGOX 3KEYA 1O8KA 3FPPA 3L2WA 3DTEA 1OHHA 3LNNA 2LREA 2KL4A 4R79A 5HLTA 3DU5A 1KONA 1TZLA 1MNDA 4BQOA 2HPIA 1RWRA 3CF2A 1VZ0A 3LSGA 2JJ1A 3VYTB 2Z8GA 2NOJB 2Y0SA 4G6TB 4CCNA 2AQFA 3KRGA 4E7ZA 2V6EA 3PJRA 2K9LA 4QPQA 3OYNA 3L2RA 4B44A 3GVKA 2QKMB 3K4LA 1AA7A 3U21A 3DQVC 2NTBA 2PECA 4XKBA 2VQCA 2R7OA 3VSVA 2VL8A 2IS1A 3AL0C 2V26A 2KPMA 3OYAA 1KMHA 3OYCA 2IGOA 4C2UA 1Y56A 3EQOA 2AQEA 3T56B 3HXLA 2INVA 3OEEA 2HNHA 2WADA 4E4HA 2M4GA 1G59A 2R7VA 3H0DA 3LMMA 3VSKA 3VWBA 5HNFA 1T5EA 2L7KA 2JVGA 2F6CA 2XDVA 2VBKA 3MMYB 4LG3A 1VBLA 4MR0A 1IA5A 2E1MC 5IK2A 1QU3A 4HNUA 4YZXA 3HG9A 1V5GA 1V0EA 3H94A 4XLAA 4DJAA 5FL7A 3K4JA 1TT0A 4PK4A 2LY1A 2VKDA 1I8DA 3RCOA 2X85A 1K28D 3OYJA 4BS9A 4CCMA 4W8RA 4J00A 4ZYAA 3VYUB 3S32A 5C1EA 2F43A 4F52A 3AL0B 3GBGA 3BH4A 1SKYB 3GRHA 4GQNA 2R7QA 4HSRA 2KHMA 4PJJA 2XZOA 4E7LA 4RM3A 2UVEA 4II2A 1FMVA 2XC7A 1LKXA 3DPTA 4CCKA 1E0EA 3BCBA 1X1AA 1P9QC 3A4CA 4CA0A 3W3CA 3FHNA 3LFUA 1H8EA 2CK3A 4CCOA 3H5RA 1ZELA 2WJYA 1BHEA 3OFNA 2BSPA 1D1AA 2MD0A 3VDXA 2W82A 4XKWA 1QJVA 1JI8A 3T53B 4OJLA 2X6XA 2IS4A 1I18A 3V42A 3SUCA 3ONQA 3UNGC 3OL3A 4U7BA 4HRIA 3VMVA 3GVLA 2JUGA 2VQLA 2XF6A 4NQWB 3MKZA 3I3LA 4YXWA 1YX3A 4NC8A 2VIXA 2K3PA 3FDYA 3NWSA 1V5EA 3S3MA 1OLTA 2KP6A 1H8HA 2CS3A 3PNVA 2W7NA 1UG0A 2CV2A 4OZYA 1MMGA 3OIPA 4TKOB 2V9KA 3OS2A 4H4KC 4IQ4A 1DGRM 1E3ZA 4YELA 2DIEA 1X1BA 4W8TA 3OW7A 4PFOA 3DPUA 2V1NA 2WAEA 5HOOA 2IXSA 3RSNA 3QYBA 3DEEA 4XKVA 1MW7A 3BC8A 3OL4A 4XNFA 4CSWA 4JOMA 4BDZA 2GK6A 2XGJA 4OZZA 2A6TA 3WQZA 1PE9A 3W2AA 2LBFB 1WJEA 4E7HA 1BN8A 4OJPA 1DP3A 4KKUA 2E1MB 4YZ0A 4PJNA 2VBMA 1Y6IA 2XAUA 2M4KA 3OS0A 1BR1A 2LC2A 4ZDOA 4XD7A 4E0FA 2ZTNA 4BUPA 3A3BA 4KT6A 1N78A 3A2KA 1WJFA 2JVHA 4XM3A 2WZPP 3L2UA 2VJJA 2PMZA 3L2VA 2EWEA 3HL2A 4D1QA 3PNTA 2ZZEA 2L2OA 5CQGA 2NTQA 4NK6A 2RQQA 3ZXSA 3MD2A 4DGWB 2IGKA 2OV7A 4J01A 2D3LA 3OR1C 1KCCA 2HZDA 1G8XA 2CFOA 2WB1A 4XR6A 1COWA 3GQ9A 4KITB 4BGDA 3FKSA 2E5NA 2Z2SB 2JJ2A 4CCLA 1MMDA 3OWTA 4CZCA 4TT3A 3GQAA 3K4CA 3DTIA 3OYDA 1JRGA 2HPMA 1QHHD 2X6WA 3LL7A 3GQBA 3OE7A 3HUGB 4DK0A 2ZFUA 2O04A 1D1BA 3RQ4A 4E6KG 3W2WA 2CW7A 2PJRA 3EUKL 1LDKB 1O8MA 4BJ6C 1O8LA 2WBMA 1BR4A 2WAQA 2LRDA 4XMYA 4NC7A 4BDYA 3B90A 2XSJC 4XORA 4II3A 3TBIA 4CUGA 2MC4A 4ZDPA 4P22A 2HLDA 3ZPPA 3K4NA 1N75A 2F4IA 4BE1A 4F92B 3H9JA 2XF5A 2CMPA 2E60A 3G2BA 4HG2A 5CPRB 4PMHA 4AYBA 2X53S 2WY8Q 3OS1A 4EATA 2LY2A 3G05A 4Z03A 5HNHA 1HG8A 3WWGA 2GJPA 3LSKA 1D0ZA 2X8KA 3H5AA 1UD3A 1WFXA 5AMVA 2ZZGA 2R7RA 3ZRGA 1IDKA 3I9V2 1WJ5A 4E7SA 4XKCA 3OY9A 1S9HA 2DOAA 2JA2A 1E1RA 3HPHA 2R7XA 1RMGA 4DIQA 2D3NA 4XL9A 2BVLA 3BG7A 3PUBA 5DN6A 2L9SA 2W00A 2KMUA 4AVZA 1UAAA 1IDJA 2BW3B 1UELB 3DKXA 2LH9A 2VQGA 1E43A 3QOEA 5C1CA 2V4JC 4BACA 4ITVA 4IQJA 4PSWA 4MXNA 2BOLA 2MFZA 1O8HA 1OB0A 4BL0B 2GJRA 1R6RA 3IP4B 4W8SA 3KYLA 3LMWA 4KJZA 4XOPA 2PYGA 3J7AY 2CH0A 2CV1A 4OWRB 4N4OB 1V5FA 4PUSA 4C9YA 4N4NB 2MABA 2V7QA 4C2LA 3OYIA 3N05A 2KRCA 4DNTB 3FBNB 3T9GA 3FY3A 3ZSCA 3H9GA 2QY1A 3PFYA 4XLHA 3OOCA 4B47A 4G7XA 1KTWA 4YZQA 4B3XA 2GOMA 3DLAA 2GOXB 4RMNA 1VJSA 3BLYA 4IX7A 3GVJA 2R9VA 1WJCA 4NK8A 2K5CA 1T95A 3ZPNA 1DBOA 4XLEA 1T0FC 1K6YA 3BG6A 2M0MA 3KEWA 2VXZA 3NWTA 2NT6A 1YX5A 2BW3A 1E79A 2ODLA 1WMRA 4OJOA 4XQFA 4NUBA 3H9QA 5LD2C 3CP8A 3LSHA 4B43A 3TMOA 2PJRB 2O5RA 2XF7A 2CUJA 1Z7LA 3NE5B 2X3HA 1X4OA 1DQUA 1BMFA 4Z06A 4ASUA 2DJIA 3B8YA 3QYFA 3W2VA 3LSMA 4PJLA 2R7SA 1Z3XA 1VF7A 3S3OA 2F1MA 2JDIA 1W9XA 4LIUA 3VSLA 1WP6A 1FX0A 3FBIB 4ZDLA 1GQ8A 3K4MA 4E7IA 1IB4A 2OC6A 4F55A 1FMWA 2BVMA 2KLOA 3AFHA 2W6JA 2VPLA 2P0WA 3OYHA 1BLIA 4ZTJA 1O88A 4FASD 3CP2A 1KZLA 1E3XA 2INUA 2UV1A 4OJ5A 1RU4A 2Q2EB 2XZPA 4OJ6A 4DOZA 4XN3A 2WJVA 5KNLA 1O8JA 3MKWB 5FROA 2M7AA 4KISA 3ZGKA 2R7TA 1W0JA 2VXDA 4FXUA 2ZTGA 2FUG2 4CCJA 1WTHD 4NNJA 1U0JA 3OIQA 4U87A 1WPCA 3BCFA 2LG4A 1V0FA 1BOBA 2L5QA 2WSSA 4B3FX 1OFMA 3OOUA 1XG2A 2L9NA 3OYFA 3OYKA 1DGWY 2QXZA 2X1DA 1MMNA 4YRVA 1D0XA 2IGMA 2DCEA 3PSIA 3HOSA 3B4NA 3PNYA 3DDYA 1H80A 2ZZFA 3OYGA 1UD2A 1O8EA 1EFRA 5CDFA 4PSXA 1W0KA 2VKHA 4JQFA 1LVKA 3OYMA 2NTPA 3QYEA 5HKKA 3SZGA 2HDWA 1VLYA 3SEQA 1X1CA 2NT9A 4KKSA 1YE9A 3DWLE 4XN0A 3S8PA 4BEHB 3OYBA 5TGTA 1SAUA 3IUOA 1NHCA 1K5CA 3KX2A 3OMYA 3GQ7A 3HAGA 4E7JA 1OOCA 1O8FA 2Z16A 1W36C 4G6IA 1OGMX 1WJBA 1Z21A 2KVOA 4PFPA 3BCDA 2WY7Q 1EA3A 5KCMA 2NZMA 1NG6A 2UVFA 5HVQC 3K70D 4RLFA 4YEJA 1MABA 4ZTFA 2NSTA 4HIZA 4HNTA 3D5SC 4OAYA 4F3QA 3PL8A 2QKLB 2HVQA 4XLFA 3VSTA 2V4DA 1NG7A 4BJ5C 2KZVA 2HVSA 4RLQA 2A5WA 2V7FA 4JMQA 2KDOA 4D9JA 2VJ5A 3T51B 2VB6A 3VYSB 4AU7A 3C2HA 3UR3C 3QODA 1D0YA 1O8DA 2F5VA 5CKTA 3K10A 4XLCA 2CW8A 2DT7B 2LOOA 3HKZA 3VMWA 3MKYB 4IKFA 5FRMA 2CUZA 2WPDA 1AIRA 2RNGA 4L8JA 2OUMA 4X0GA 3OYLA 1O8IA 3GQ8A 2VLAA 2R4GA 2IGNA 3K70C 1MMAA 4I84A 3AKZA 2KQRA 1UD8A 3EUAA 2O1DA 1NBMA 3DU6A 1X19A 2X1EA 2O0VA 3ZR8X 2ZSHB 4RM2A 4LITA 3HC7A 1W36D 2ZSIB 4MLOA 3VR6A 3D5RC 2ZXIA 2X6YA 2O0WA 3EQNA 3E0JB 3RPUD 1NRKA 4BE2A 4HSTA 3K6GA 4ANJA 4DBQA 1QCXA 1J09A 3ZCOA 5KHDA 3SYTA 2K9MA 1PJRA 1PYVA 3DKYA 4F91B 2X1CA 3C2GA 4HEA2 4QPOA 3DTKA 3SDBA 2R7UA 3D5LA 2Z1DA 4F93B 1EE6A 2CV0A 1WJAA 3H5NA 2QE7A 2XNDA 1KCDA 2VBEA 1QHGA 2WAFA 4E7KA 3SEZA 4OAZA 4BJTA 4C30A 1GLNA 1HZEA 4BQNA 1PKVA 3OR2C 3VSUA 2VJIA 4G7WA 3H35A 1BR2A 1X1DA 2M7BA 3CJRB 4W8QA 4Z1MA 4DBRA 2R7WA 4HPQA 3ZIAA 2UUZA 2ELJA 4PJMA 1DBGA 2QX3A 4Y33A 1OFLA 2M5SA 3EPZA 3M1CA 1MNEA 2IS2A 1PLUA 3A3GA 5CQEA 3L2QA 3S93A 2UWMA 1D1CA 2JIZA 4URRA 4P1WA 1IRXA 2W4SA 3OPOA 2XZLA 2HU9A 2JSPA 3CJQB 3A35A 4P5OA 3IAS2 1E1QA 5FRNA 3JU4A 3CESA 4Z05A 1JTAA 2O17A 4Y3OA 2VQHA 3DPLC 2XOKA 4XONA 1N77A 4LIVA 2VASA 4B48A 2LYCA 3PSFA 1OR7C 2I8DA 5JHFA 4KKTA 4U4BA 3HPGA 3CMMA 2RREA 2E1BA 3E1SA 2E5ZA 2KRHA 2VJ4A 2GJKA 3OAAA 3K4KA 3UW0A 3BCAA 2DXIA 2ZZQA 3CZ6A 3A1YA 4DNRB 2ZXHA 3ZQQA 2LZJA 1HVXA 1X0CA 2NSPA 4TSFA 3BC9A 3TL4X 5LFAA 4EW9A 1CZFA 1UD6A 3LSIA 3RTRA 1Z3YA 4C2TA 4ZC3A 3OYEA 2HVRA 1PXZA 1UD4A 4BE0A 2W1OA 4XOTA 2IS6A 2W6IA 3JURA 1LFPA 3IAM2 4UZUA 3M8JA 4BXFA 4U49A 2V31A 4GRIA 1BPLA 2GK7A 1SFKA 3F9KA 2M3AA 1ERDA 2PYHA 4Y4RA 1O8GA 2MYSA 3VYRB 4ZJZA 3S3NA 3EUHC 4FETA 2WA0A 4B3GA 4IZZA 4DK1A 2Z6BD 1WJDA 3K4BA 2HQAA 4CH7A 3HOTA 1UD5A 4BU2A 4BQQA 1X4PA 2X51A 2DT6A 2LBFA 1HA8A 3OEHA 2IQ7A 4HWVA 4BEHA 3FKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  1OGO X;  1O8K A;  4XKV A;  4XNF A;  1O8I A;  3GQ8 A;  4NK8 A;  4OZZ A;  1DBO A;  4XLE A;  1PE9 A;  4I84 A;  2O1D A;  1BN8 A;  4OJP A;  1RWR A;  2O0V A;  2NT6 A;  4YZ0 A;  2ODL A;  1WMR A;  4OJO A;  2VBM A;  4XQF A;  2Z8G A;  3KRG A;  2X6Y A;  2O0W A;  3EQN A;  2X3H A;  4XM3 A;  2VJJ A;  4Z06 A;  1QCX A;  2NTB A;  2PEC A;  3B8Y A;  2EWE A;  2NTQ A;  4NK6 A;  3VSV A;  1EE6 A;  1GQ8 A;  1KCC A;  4XR6 A;  1KCD A;  3GQ9 A;  1IB4 A;  2VBE A;  3EQO A;  3GQA A;  3VSU A;  1O88 A;  2VJI A;  2INV A;  2INU A;  4W8Q A;  1JRG A;  2X6W A;  4OJ5 A;  1RU4 A;  2O04 A;  4OJ6 A;  1DBG A;  2QX3 A;  2VBK A;  4XN3 A;  1OFL A;  4MR0 A;  1O8J A;  1VBL A;  1IA5 A;  1PLU A;  1O8M A;  4YZX A;  1O8L A;  4XLA A;  4XMY A;  3B90 A;  4XOR A;  4URR A;  2X85 A;  1OFM A;  1XG2 A;  3ZPP A;  4W8R A;  2QXZ A;  5C1E A;  4PMH A;  4Z05 A;  1JTA A;  2O17 A;  3B4N A;  4XON A;  4Z03 A;  3WWG A;  1H80 A;  1HG8 A;  1O8E A;  3GRH A;  5AMV A;  4U4B A;  1IDK A;  2UVE A;  2NTP A;  1RMG A;  2NT9 A;  4XL9 A;  4XN0 A;  3UW0 A;  1NHC A;  4AVZ A;  1IDJ A;  1BHE A;  2BSP A;  1X0C A;  1K5C A;  2NSP A;  3GQ7 A;  1OOC A;  5C1C A;  4XKW A;  4EW9 A;  1O8F A;  1OGM X;  1CZF A;  4MXN A;  1O8H A;  1PXZ A;  1QJV A;  2NZM A;  4OJL A;  2X6X A;  2UVF A;  4W8S A;  4XOT A;  3LMW A;  3JUR A;  3SUC A;  4YEJ A;  3VMV A;  4XOP A;  2PYG A;  2NST A;  4U49 A;  2PYH A;  4XLF A;  3VST A;  1O8G A;  4C2L A;  3T9G A;  3FY3 A;  3ZSC A;  2QY1 A;  4OZY A;  1O8D A;  4XLH A;  1KTW A;  4XLC A;  4YEL A;  4YZQ A;  2IQ7 A;  4HWV A;  4W8T A;  3VMW A;  1AIR A; 
#chains in the Genus database with same CATH topology
 2V1U A;  2ECC A;  3KEY A;  1XSV A;  2V79 A;  1OHH A;  3TO9 A;  1T6X A;  3LNN A;  2LRE A;  5HLT A;  1SM4 A;  3C3W A;  3R0A A;  2YUH A;  1TZL A;  1MND A;  3CJN A;  4BQO A;  2K40 A;  3CC4 I;  1KJZ A;  5DCM A;  3LSR A;  2HXI A;  1VQN I;  2VNK A;  3P27 A;  3ERE D;  1S72 I;  3HSF A;  3JRC A;  4G6T B;  1KK3 A;  3JRB A;  2AQF A;  3KRG A;  2O0Y A;  2DAO A;  3L2R A;  1JNY A;  4UNO A;  2OF7 A;  3ZN0 A;  3G6E B;  3GLL A;  4ON0 A;  2W24 A;  1ETQ A;  1O3T A;  1QRY A;  4MEX F;  4XKB A;  4CGZ A;  2VQC A;  1G3W A;  4KIG A;  2WWY A;  1ZQ3 P;  4OIQ F;  1MD0 A;  1KMH A;  1HDD C;  3TO7 A;  3CCJ B;  2DEU A;  1FIA A;  1Y56 A;  1LEA A;  3S2H J;  2AQE A;  4MQV A;  5ICC A;  1VHE A;  1QGY A;  3HXL A;  3S1M J;  2HNH A;  2R5Z B;  4OIR F;  2PG4 A;  3VSK A;  1MBH A;  5ILV A;  4IHY A;  5EJC A;  1NTC A;  3F23 A;  3LQ6 A;  3H36 A;  4MR0 A;  1S3J A;  4G7O F;  2ZL6 A;  3M1E A;  3A8K A;  1R4M B;  1XGM A;  1JUS A;  1MH4 A;  4PAB A;  4YDT A;  1Z7U A;  3A0H C;  2LY1 A;  1ZR4 A;  3K7A J;  3RCO A;  2F48 A;  4H0E A;  2F1L A;  3HEF A;  3BY2 A;  3CO6 C;  2ME0 A;  1O4X A;  2KJB A;  3BR1 A;  2QBY B;  3VYU B;  1OPC A;  2XB0 X;  3FHZ A;  2XTX A;  3T1B A;  4Z4T A;  1RR8 C;  3RIQ A;  3GBG A;  1FYM A;  2QTZ A;  1XC5 A;  3GRH A;  3JRA A;  4ZV4 A;  2N8G A;  2IA1 A;  2X0K A;  4RM3 A;  4B4C A;  2E2J J;  2K3F A;  5GAH J;  1FMV A;  1FNN A;  2XC7 A;  3DPT A;  1O7F A;  2BSA A;  2QYO A;  5J35 A;  1DP7 P;  2PEX A;  3LFU A;  2OTL I;  4X0C A;  2YR2 A;  3GTG J;  2B7C A;  5FO1 A;  2WJY A;  1BHE A;  1ZEL A;  2BSP A;  3CCU B;  1R5G A;  1YS6 A;  1R1T A;  1VHO A;  3E7L A;  3O2P E;  3VDX A;  2M0C A;  2W82 A;  4A5M A;  1RR7 A;  5DS9 A;  4L18 B;  3CUQ A;  3CMA B;  3GWZ A;  1QJV A;  1JI8 A;  3ZP5 A;  3SZE A;  1FX7 A;  1NDH A;  1IN4 A;  2R6H A;  2AS5 F;  2E35 A;  5CVU A;  2OBP A;  3CC2 I;  4HRI A;  2NVX J;  4UUT A;  3KET A;  3VMV A;  2PIA A;  1FBS A;  3IRQ A;  1RKW A;  5ICG A;  2VQL A;  4NQW B;  1JKP C;  3I3L A;  4M6V A;  4YXW A;  1YX3 A;  1SFO J;  2VIX A;  1W7P B;  5J3O A;  4A3D J;  4OOI A;  2KP6 A;  4TKO B;  4H4K C;  2DIE A;  5JMC B;  4P55 A;  4YEL A;  3GTM J;  2C5H A;  3GIR A;  1H88 C;  3RIR A;  5F64 A;  1G7R A;  2WAE A;  3KYC B;  2IXS A;  1ZRF A;  3JX8 A;  1QNT A;  4P3I A;  4S0H B;  1PP7 U;  4CSW A;  2ZME C;  2XGJ A;  3WQZ A;  3J81 Z;  2CF4 A;  3LST A;  2BBY A;  3A8I A;  1OB2 A;  4E7H A;  1FOK A;  2L4A A;  3FMS A;  4BXU A;  4Y52 J;  1TW3 A;  1Y6I A;  2KT0 A;  1LVA A;  2QA4 I;  1BR1 A;  1UMQ A;  2JUC A;  3ECH A;  3OSF A;  2ZTN A;  4E0F A;  3JRD A;  2D5V A;  1QO0 D;  3A3B A;  4MO7 A;  4GXO A;  1T08 B;  2GIZ A;  2G7U A;  3A2K A;  1WOO A;  4XM3 A;  2WZP P;  3VNV A;  1OFE A;  4U7D A;  2DDA A;  5L3C A;  2OAZ A;  1Z91 A;  5B1B H;  3ZBU A;  2F5D A;  3GO5 A;  1BL0 A;  1YIT B;  2HOE A;  2L2O A;  3RKW A;  4PGO A;  4M3F A;  1R4N B;  2OV7 A;  2DI3 A;  2ELH A;  4J01 A;  1V55 H;  3WNC A;  2BXZ A;  2D3L A;  4HA8 A;  1G8X A;  2CFO A;  2WB1 A;  2R5Y A;  2XKP A;  3G1M A;  4Z6Y A;  1R1U A;  1E3H A;  3S1N J;  4OIP F;  1MMD A;  2JQ7 A;  3MZH A;  3GQA A;  3IWF A;  2MD5 A;  1WQ2 A;  5FFZ A;  3HDD A;  3K4C A;  1IB0 A;  1N07 A;  3OYD A;  1JRG A;  2HPM A;  3F0C A;  1QHH D;  2E1R A;  3SLD A;  3CJT B;  3HUG B;  4DK0 A;  2XAG A;  1GHC A;  1OYW A;  1QPM A;  1ZAO A;  3ZQG A;  2B63 J;  2P5K A;  1YHQ B;  3W2W A;  1R1V A;  4N9H A;  4A3B J;  4BJ6 C;  1O8L A;  2WBM A;  1XE1 A;  3B90 A;  4NC7 A;  3QWL A;  3I0T A;  3QE2 A;  4Q4Z F;  4P22 A;  3CB4 A;  2HLD A;  1DU6 A;  1N75 A;  1U5T C;  2X48 A;  1BW5 A;  4F92 B;  3G2B A;  2E60 A;  5CPR B;  3ZMS A;  1XQB A;  4IVN A;  4WF2 A;  2NS8 A;  5BOX A;  2WY8 Q;  4U9U A;  2X0L A;  5E8G A;  4A6E A;  2X8K A;  1KQ8 A;  3E1Y E;  5AMV A;  1IGN A;  2BM6 A;  2R7R A;  1IDK A;  4KMF A;  1WJ5 A;  4BYY A;  3BR6 A;  4DIQ A;  2D3N A;  1ZGA A;  3PUB A;  2L9S A;  2FEZ A;  3J81 k;  4RGU A;  4AVZ A;  1JKR C;  2O61 A;  2BW3 B;  1UEL B;  3DKX A;  1MBJ A;  1VQ5 I;  3CDH A;  2FOW A;  2VI6 A;  4UVB A;  3U1D A;  4LLG F;  4PSW A;  4UB6 C;  2IEK A;  1TW2 A;  1Q1H A;  2MFZ A;  3TOA A;  5M5Y J;  4B3A A;  1LB2 A;  1OB0 A;  2OK7 A;  3P4G A;  5JI6 A;  2NS0 A;  1MJB A;  5DUI A;  2HOT A;  1IXR C;  4FCY A;  5F04 A;  1GVH A;  5DNS A;  3SZP A;  1N05 A;  4N4O B;  5E1Z B;  4C9Y A;  4ACA A;  5JLV C;  4M72 A;  5JHU A;  1DPR A;  3MCZ A;  3N05 A;  4X8I A;  3L1P A;  2MBF A;  2VKE A;  2NVY J;  1ETV A;  3ZSC A;  4L0Y B;  3OJW A;  2QY1 A;  2IBD A;  4ZH4 F;  3OOC A;  2COM A;  4B47 A;  5FKL A;  2CRV A;  2VBU A;  4G7X A;  5IYP A;  4MQ9 F;  2I1L A;  3KP6 A;  4B3X A;  4L5J A;  2HGC A;  1N0U A;  1Z67 A;  4IF4 A;  4YIF A;  1ORK A;  5IT9 Z;  1IRG A;  2DTZ A;  1OMI A;  1J5Y A;  1I1S A;  2R9V A;  2E1C A;  5LBQ A;  4D5F A;  1T95 A;  3JAM Z;  3ZPN A;  5L46 A;  5E79 C;  1DBO A;  2AXL A;  3G71 B;  3G3Z A;  3BG6 A;  3KEW A;  5B1A H;  3FIW A;  2J8K A;  5JLW A;  2NT6 A;  2RAE A;  1F1Z A;  4BY1 J;  1K8A D;  4HDV A;  3MFK A;  2DA7 A;  4NUB A;  1M1E B;  1MZB A;  4LC0 A;  3CDI A;  1GXQ A;  2FOK A;  1R5B A;  1TWH J;  2CUJ A;  5M5W J;  3BTJ A;  3V7A A;  1QUE A;  1MMS A;  4Z06 A;  2DJI A;  3WTT C;  3B8Y A;  1MRZ A;  4YC5 A;  3QYF A;  1YIO A;  1P4W A;  3OW2 B;  2R7S A;  2F1M A;  4AF7 A;  1TC3 C;  4LBW A;  1WP6 A;  1B9M A;  2V1X A;  1GQ8 A;  1H89 C;  3Q3S A;  3K4M A;  2BGI A;  2BM1 A;  1YW7 A;  1IB4 A;  1XD7 A;  3BTC A;  2NNN A;  3QQA A;  5IP7 J;  3AFH A;  2EB7 A;  3SY2 A;  3KZY A;  4F7Z A;  3AGQ A;  3CMA I;  3W6J B;  2G7H A;  1F60 A;  4YFO A;  2INU A;  1U2W A;  4AIK A;  2Y2Z A;  4M3G A;  3ISP A;  4WK8 F;  4WXC A;  1WVR A;  4M3E A;  1VQ7 I;  5GV7 A;  2CG4 A;  2V5I A;  1O7L A;  5KNL A;  2V7T A;  4I76 A;  3WND A;  2R7T A;  1IO2 A;  2FUG 2;  3FJO A;  1AMO A;  3CCS B;  1WPC A;  3BCF A;  1V0F A;  3I4P A;  2L5Q A;  4XSX F;  3KLO A;  1BIB A;  4ZYD A;  1W87 A;  3OYK A;  1DGW Y;  2X1D A;  1MMN A;  1Q82 D;  3CUQ B;  4RGX A;  1D0X A;  3J80 Z;  1R5O A;  3PSI A;  4Y13 A;  3HOS A;  3QPT A;  3DDY A;  3ZC3 A;  1TT5 B;  3VNU A;  3B4N A;  2ZZF A;  3AST A;  2HOA A;  5CDF A;  4I7H A;  4R1H A;  2HXO A;  1YTY A;  5J8F A;  4X6A J;  3OYM A;  3SZG A;  4L9T A;  4NHJ A;  1WDT A;  2J8I A;  2NT9 A;  4A2U A;  1APL C;  1YE9 A;  5EZH A;  3S8P A;  4ENM A;  2K9Q A;  3MWM A;  3M8E A;  4FQG A;  5TGT A;  1NHC A;  3MEX A;  4I99 C;  3SXY A;  2ECB A;  3GFI A;  1K5C A;  3GQ7 A;  2EFW A;  3M3Y J;  4HQE A;  1O8F A;  3CXC B;  2KVO A;  1J9Z A;  3BCD A;  2WY7 Q;  5KCM A;  4AYB N;  2EIK H;  2JT1 A;  2NZM A;  4P9U A;  3V76 A;  2UVF A;  2VBS A;  3K70 D;  1MSE C;  4ZTF A;  3SZT A;  3GTJ J;  3ERM A;  4F3Q A;  2NXN B;  1T33 A;  5J1U A;  4WCG A;  4XLF A;  4ZYG A;  2FJ1 A;  5KAI C;  2KZV A;  4BJ5 C;  2PLF A;  1M1K D;  2OTJ B;  4HF0 A;  1UHM A;  1Z0X A;  2KDO A;  1CNF A;  2VJ5 A;  4TMX A;  3T51 B;  2VB6 A;  1R71 A;  4AU7 A;  1O8D A;  3PSZ A;  1D0Y A;  1UZC A;  2F5V A;  4ZCI A;  3CRZ A;  1IJF A;  3LA3 A;  1YW9 A;  5DYM A;  3GTO J;  4RDJ A;  1OCT C;  4MHG A;  2Q8K A;  4X0G A;  1LJ9 A;  2NNY A;  1TWG J;  4PC2 A;  1SVM A;  2L02 A;  4ROX A;  1UB9 A;  3K70 C;  3N90 A;  3JSP A;  3AKZ A;  4IRG A;  3EUA A;  4F7D A;  3O8H A;  2UZK A;  1NBM A;  2O0V A;  2QEN A;  3H92 A;  2DA6 A;  1RKT A;  3KP2 A;  2ZSI B;  4N3N A;  3A8J A;  4PAA A;  2DLL A;  3AG3 H;  2X6Y A;  4UB8 C;  2QCO A;  5CYV A;  3W2G A;  4Y15 A;  5DUK A;  1AU7 A;  2OZU A;  2YX7 A;  4G6D A;  1MDM A;  3SYT A;  1PJR A;  3MZ8 A;  1TWA J;  1T2K A;  3EET A;  3WXM A;  2YSR A;  3AG1 H;  2KJC A;  3I58 A;  1WJA A;  2O6W A;  3H5N A;  4EQQ A;  2IT0 A;  3R4K A;  1QVT A;  3SFI A;  5DDG A;  2R7F A;  3JRI A;  1MGT A;  4IHS A;  4BQN A;  4Q5S F;  3OZU A;  3KEQ A;  1WRJ A;  3OR2 C;  4XLP F;  4W8Q A;  3I59 A;  4Z1M A;  2R7W A;  3DBR B;  2NVU B;  3SQV A;  3Q0V A;  1IV6 A;  5BPD A;  4Y33 A;  3MKL A;  1OFL A;  3CD6 I;  3CW2 A;  4NDL A;  1LEB A;  1U6G A;  2Y75 A;  1A5J A;  1WH7 A;  1DDG A;  4B1R A;  4HBL A;  2JA6 J;  4P1W A;  3CCR I;  1IRX A;  5FO5 A;  1QFY A;  3C2B A;  1FRN A;  2HU9 A;  2W57 A;  3CJQ B;  3KLN A;  3FXU A;  1FTZ A;  2V1D A;  3H3V K;  3ZQL A;  4XON A;  2VAS A;  1WKM A;  1GV2 A;  1X3U A;  4M71 A;  4B48 A;  3BJA A;  3PSF A;  1OR7 C;  2BY3 A;  3PO2 J;  5EG0 B;  5E3O A;  1BQE A;  1RQP A;  4Q48 A;  5C4X J;  3HPG A;  1IDY A;  1B72 B;  3A03 A;  3MMP A;  1QRC A;  5FLX K;  2FML A;  2E1B A;  4ZGN B;  4Z4S A;  2UXX A;  4C0S A;  2M5W A;  3K4K A;  5KW9 A;  2C5B A;  3ABU A;  3HOZ J;  3Q0U A;  3VEP A;  4LK0 F;  3S15 J;  2ZXH A;  3F6V A;  1R5N A;  4DNR B;  2LZJ A;  4NBQ A;  5K5O A;  1YO5 C;  2OCE A;  4EW9 A;  1VQL I;  3Q38 A;  2E2I J;  1UD6 A;  1CZF A;  3LSI A;  2V6C A;  3RTR A;  4C2T A;  2Z99 A;  1TNT A;  1W7P A;  2L54 A;  3E6B A;  4BE0 A;  1JUP A;  2W1O A;  4XOT A;  3JUR A;  3PET A;  4LK1 F;  2FX0 A;  3BP8 A;  3CCE I;  3WU2 C;  1TWC J;  5IY5 H;  3A01 A;  2VFO A;  4M6Y A;  3IV5 A;  1USS A;  2M3A A;  5D8L B;  3B73 A;  4UVC A;  1FTT A;  2PYH A;  2MYS A;  2ZBV A;  1X2M A;  2JTV A;  3IH4 A;  4ZJZ A;  1TYX A;  2JRT A;  3EUH C;  1Y1W J;  1YJW I;  1Q81 D;  1EWY A;  2P6S A;  1EH6 A;  4W1U A;  5LGN A;  1JA1 A;  2O8K A;  4BU2 A;  3P9K A;  4RS8 A;  1HA8 A;  2RVC A;  2IQ7 A;  4BEH A;  1QQI A;  4P2N A;  3J7Y J;  2P8T A;  4IPA A;  1RC9 A;  4UZF A;  1OGO X;  1VLO A;  3BY1 A;  1HW2 A;  1SD7 A;  4P12 A;  4R79 A;  3DU5 A;  3Q9S A;  2CO5 A;  5K5R A;  1KON A;  2GIV A;  1JB9 A;  1ETO A;  4KYW A;  1XB4 A;  5TY0 A;  4GYI A;  5IYC J;  3AG4 H;  1RWR A;  3LSG A;  1N0V C;  1SD5 A;  1ZHF A;  2JJ1 A;  2Z8G A;  2NOJ B;  1E2X A;  2KZG A;  4Y9U A;  1DPU A;  2AXT C;  4G7Z F;  1BOA A;  5BMZ A;  3GTQ J;  2K9L A;  1W34 A;  4RCZ A;  3WTU C;  3GVK A;  2QKM B;  4EM1 A;  1AA7 A;  5ICF A;  3WTY C;  1Z9C A;  1ACI A;  5BNG A;  3DQV C;  1ETW A;  1GAW A;  4EJV A;  5E6T A;  5JLX A;  1KRH A;  1A04 A;  2DCU A;  1VQP I;  4JYK A;  2QTL A;  3UKG A;  3H94 A;  1CQX A;  2R7O A;  3FF5 A;  3ZZU A;  3VSV A;  2DYR H;  1VTN C;  2VL8 A;  2ZIT A;  3AL0 C;  1RIO H;  2V26 A;  2KPM A;  3HZJ A;  4O5V A;  3OYA A;  4DYC A;  4OP7 A;  3VO1 A;  4U88 A;  3PIP F;  2HS5 A;  4RD0 A;  5D4R A;  5E3L A;  5LHH A;  3T56 B;  1I50 J;  2INV A;  4EJW A;  1J59 A;  2A6E F;  5HS9 A;  2M4G A;  3ZQ7 A;  1G59 A;  2R7V A;  3H0D A;  2QSH X;  2M87 A;  5HNF A;  3ABL H;  1T5E A;  2JA5 J;  2F6C A;  2BN4 A;  1BC8 C;  1L3L A;  4P9S A;  3BJO A;  1WCM J;  5FKK A;  4LG3 A;  1PUF A;  2VNI A;  1Q1V A;  2L4M A;  1A31 A;  2GA1 A;  2M9H A;  4HV5 A;  4HNU A;  4B09 A;  5IPA A;  5LGT A;  2JMW A;  2DET A;  1V0E A;  5FL7 A;  4RPD A;  3K4J A;  4HW0 A;  4ACB A;  3G4S I;  2PFB A;  3BY6 A;  4MFE A;  3OYJ A;  4BS9 A;  3ZQH A;  4BHC A;  4J00 A;  4RAZ A;  4ZYA A;  4IW3 B;  3WBJ A;  5IT3 A;  2BM5 A;  1HLV A;  4W8R A;  3BH6 B;  3I55 B;  3ML3 A;  3BH4 A;  1R58 A;  2MA3 A;  4HSR A;  5KK1 A;  1S29 A;  2KHM A;  2XZO A;  4I09 A;  4E7L A;  2UVE A;  1J7K A;  5THX A;  1RES A;  1E0E A;  4B4D A;  1LKX A;  1YHQ I;  1FSE A;  4PC7 A;  2HWV A;  2LFB A;  1H8E A;  4FE7 A;  3EYI A;  2M34 A;  3IKV A;  4L9J A;  2H8W A;  3WTZ A;  3OFN A;  4OOX A;  1TNS A;  1QZY A;  2F4O B;  2L7M P;  4RPB A;  1OQY A;  1C0W A;  1FBU A;  4D7M A;  1JJ2 B;  1IAW A;  4OOS A;  5FFX A;  3OP1 A;  4OJL A;  2CQK A;  2X6X A;  1QQ1 A;  2IS4 A;  1LQ1 A;  1RUN A;  3V42 A;  4U7B A;  1HA3 A;  2HKX A;  5LMZ A;  1QH0 A;  4P26 A;  1BJZ A;  1KC8 D;  2JUG A;  1MJ9 A;  2XF6 A;  3MKZ A;  1VQP B;  1RQR A;  1AHD P;  2K3P A;  1I3A A;  1BIA A;  1V5E A;  3RZD J;  1GAQ A;  1OLT A;  1H8H A;  3TDZ C;  1OKR A;  1R5H A;  1UG0 A;  3PNV A;  3LAP A;  5E17 F;  4ENK A;  3OIP A;  3OKX A;  3R6K A;  2V9K A;  2Y9Y A;  3BNW A;  3PM1 A;  2R0Q C;  2VYQ A;  1X1B A;  2D9R A;  1UST A;  3OW7 A;  1D1N A;  5HLI A;  1EFT A;  2W85 A;  3JSO A;  1IW7 F;  2BYV E;  3WOD F;  1MW7 A;  1EFU A;  1A35 A;  2GK6 A;  2P4W A;  2XAJ A;  4LFU A;  3W2A A;  1YQA A;  1G6N A;  2LBF B;  1WJE A;  5CVV A;  4Q7J B;  2F4N A;  4KKU A;  1I7P A;  2E2H J;  2Y0M A;  2V9V A;  2Q6I A;  3Q39 A;  3OS0 A;  5K5Q A;  2LF8 A;  3F22 A;  3ULQ B;  1JKQ C;  1LM1 A;  4UV8 A;  2Y48 A;  4ETS A;  1MNM C;  2ADU A;  2H6C A;  2PMZ A;  4IHV A;  1KQ5 A;  2BX6 A;  4OM9 A;  3L2V A;  3HL2 A;  3V7C A;  5CQG A;  1B4A A;  2NTQ A;  3MD2 A;  1P7J A;  1O3S A;  1S4M A;  3CC2 B;  2CUF A;  3GXO A;  3OR1 C;  2KIM A;  1FC3 A;  3GQ9 A;  2PMH A;  5FJ8 J;  3FKS A;  1H8A C;  2PQ8 A;  1H9G A;  4G7H F;  4JBA A;  4CCL A;  2V7W A;  4TT3 A;  4WX9 A;  4A3M J;  3QPS A;  2VBY A;  1ZRD A;  3DTI A;  5D5V B;  3T8R A;  2O04 A;  3U2Q A;  3K69 A;  4RD2 A;  1D1B A;  1QX4 A;  1JKO C;  3CCE B;  5HLH A;  2L9V A;  3Q3A A;  5DM7 F;  3PFI A;  5E1W A;  3A01 B;  3R6S A;  1IUY A;  4RD3 A;  1Y8Q B;  2M2E A;  2LTP A;  2XSJ C;  3ELK A;  4XOR A;  3TBI A;  4X7C A;  2MC4 A;  3LO8 A;  2X6O A;  3W6K B;  2W7Z A;  3BR0 A;  3HYI A;  3BPV A;  1U8B A;  1WI3 A;  1ZN2 A;  2CMP A;  4WXH A;  4HG2 A;  4YAL A;  5IYW A;  2CRG A;  2GLO A;  3OS1 A;  4EAT A;  2LY2 A;  3WWG A;  2XGE A;  3LSK A;  3B6C A;  2YWG A;  5FA6 A;  3H5A A;  5EZG A;  1XDS A;  4E7S A;  5AIP A;  3OY9 A;  1S9H A;  2DOA A;  2KDZ A;  1IC8 A;  3E6C C;  4P6Y A;  4XL9 A;  3HM5 A;  3BG7 A;  4G8X A;  5HZA A;  2W00 A;  2HOS A;  4OPW A;  1HSJ A;  3GTL J;  2LH9 A;  5M5X J;  4A5N A;  3S2D J;  3QOE A;  4A3C J;  1JA0 A;  3CCV B;  5C1C A;  3A02 A;  2HYF A;  5B6I A;  3K9T A;  3JRF A;  4ITV A;  5C4J J;  2XT4 A;  2BOL A;  2B7E A;  3V8L A;  2GJR A;  4PC3 A;  1O8H A;  2OA4 A;  1OJL A;  1R6R A;  2OD5 A;  1TL8 A;  1ZM9 A;  1XSX A;  1A8P A;  4BPR A;  3HGG A;  3KYL A;  3LMW A;  1HKQ A;  4XOP A;  5F1R A;  1OYY A;  2FQ4 A;  3TH0 A;  2IA0 A;  4OWR B;  4QVJ A;  1OR7 A;  1V5F A;  3AVU A;  1I27 A;  1A36 A;  5LEK A;  2AHQ A;  1EZG A;  4IRI A;  4C2L A;  1KU3 A;  5IP6 A;  3FK7 A;  1MH3 A;  4HDU A;  4DNT B;  2NYX A;  4FX0 A;  3E5X A;  1S7E A;  1XG1 A;  1MBG A;  3AAF A;  3T9G A;  2BY1 A;  3OSG A;  2QUF A;  2JPC A;  2IJL A;  3LA2 A;  3O6B B;  2P5L C;  4LG0 A;  1WXR A;  3GZ5 A;  3F8N A;  3GF2 A;  2Y0S N;  3ZMV A;  2D45 A;  2FE3 A;  1Z77 A;  1YJ9 I;  2BV3 A;  5F4O A;  5J6X A;  4Y17 A;  2DFH A;  5F4J A;  2DK5 A;  1B59 A;  3HHG A;  2MLG A;  1B8I B;  1KK0 A;  1X2N A;  5JR3 A;  2E34 A;  1V3F A;  2ZME A;  2BHY A;  3BLY A;  3R60 A;  4IX7 A;  4BBS J;  3GVJ A;  4Z4V A;  2GWR A;  2K5C A;  5TJJ A;  4OOV A;  2Q6L A;  5BS6 A;  2DA1 A;  2DOD A;  2H09 A;  1TLL A;  1IXC A;  3NWT A;  1YX5 A;  4LLL A;  3KP5 A;  2ODL A;  4OJO A;  4XQF A;  3GTK J;  3P26 A;  1T98 A;  1P7I A;  2BPO A;  2OBT A;  1R00 A;  1ZGJ A;  3LOC A;  1WSR A;  4YHB A;  3QFR A;  2XF7 A;  2O5R A;  1FBQ A;  1U5T B;  1Z7L A;  4EJT A;  2XAS A;  1HST A;  1B23 P;  4N3G A;  4QHY A;  1UMK A;  4KN4 X;  5LGU A;  3LSM A;  3J7A O;  1FYK A;  1Z3X A;  3GSI A;  3I1F A;  2JDI A;  3VSL A;  3TED A;  1VQ9 I;  4OZY A;  4HLY A;  3FBI B;  1S6L A;  4YFK F;  1IN6 A;  4F55 A;  3F3X A;  2ACJ A;  1DAB A;  3PSS A;  2ZJ2 A;  2KLO A;  3P9C A;  2RKH A;  1MDM B;  2VUM J;  5CJ9 A;  3OYH A;  2VPL A;  2IP2 A;  1QRB A;  2VFP A;  3WU0 A;  5IYB J;  2QQ9 A;  4KH3 A;  4OMY A;  3KIO A;  2OTJ I;  2XZP A;  2RN7 A;  1FY7 A;  4KFC A;  2CQ7 A;  2DQL A;  2XAF A;  1PDN C;  5D4S A;  4DOZ A;  4XN3 A;  1KA8 A;  2JN6 A;  4O6J A;  1QA6 A;  4RD6 A;  3I53 A;  4Z4R A;  1SFE A;  4FXU A;  3ZGK A;  4IJA A;  4CCJ A;  3WTX C;  1WTH D;  2WZN A;  2HYJ A;  2Z3Y A;  1VQK B;  3HSE A;  2XPW A;  3AVW A;  2A05 A;  3CMY A;  2HDC A;  3CF5 F;  2WSS A;  2ZL5 A;  1BOB A;  3ABT A;  5HOD A;  2WYR A;  4X7F A;  1MKM A;  4ZZL A;  2O6G E;  1W2B B;  1OFM A;  3M9A A;  4KT5 C;  5IOY A;  1SKQ A;  3OYF A;  2COB A;  4Z4W A;  2O7O A;  3GW2 A;  4MYT A;  3PNY A;  3JW4 A;  1UD2 A;  3H3Z A;  3FMQ A;  2E7W A;  1W0K A;  3GCM A;  2VKV A;  1G4D A;  1KD1 D;  4JQF A;  1K8F A;  3QYE A;  3DFG A;  2HDW A;  1VLY A;  4G1V A;  2D2W A;  5J8C A;  2WTE A;  3SEQ A;  1X1C A;  5E1X A;  1OGJ A;  1EFC A;  5FKO A;  1SAU A;  1ZUN B;  2KIQ A;  4OMZ A;  4BAY A;  1XCB A;  5F0C A;  1YJN I;  4A69 C;  5C3E J;  1E64 A;  2BM0 A;  2L9R A;  4RAF A;  1SVO A;  1OOC A;  1OGM X;  2Z16 A;  4G6I A;  5BSY A;  1WJB A;  1FDR A;  3ABK H;  3ES9 A;  1KQ0 A;  4B8X A;  1ZR2 A;  1ZAR A;  2VNH A;  1QPI A;  2WV0 A;  2PJP A;  2DA4 A;  4CZZ A;  1HF0 A;  2NST A;  3BG3 A;  4OAY A;  3PL8 A;  1GT0 C;  2HVQ A;  2V4D A;  1VQ7 B;  1BJA A;  5B5E C;  5FKM A;  2DOF A;  1IV8 A;  2A5W A;  4AIJ A;  4D0P A;  2DA2 A;  4JMQ A;  1Z6T A;  4HV6 A;  3C2H A;  5CKT A;  2P6T A;  3K10 A;  5CVI A;  2DO7 A;  4DW6 A;  1PUE E;  3HKZ A;  1VFC A;  3GYH X;  2WPD A;  4CXF A;  1OCO H;  3WG7 H;  5D8K B;  2RNG A;  4DYQ A;  3KEO A;  1QG0 A;  3NAR A;  3G71 I;  4IO9 F;  3GFM A;  3OYL A;  2H1K A;  1O8I A;  3GQ8 A;  1YLO A;  2VLA A;  2YU3 A;  2R4G A;  3CCY A;  4PJ0 C;  2XAQ A;  1F36 A;  2TCT A;  2KQR A;  1XPX A;  1LLW A;  2PYG A;  2ZB9 A;  3DU6 A;  1SMT A;  1X19 A;  1B1B A;  1TQM A;  4RM2 A;  3ZR8 X;  1U8R A;  1GO2 A;  1ETY A;  1W36 D;  4MLO A;  2XRO A;  4N9I A;  5D5X B;  4X05 A;  5GAD J;  1YI2 I;  1JXS A;  1RI7 A;  4MNU A;  3I54 A;  3EQN A;  3E0J B;  5FGM A;  1TYW A;  2LR8 A;  2OJE D;  4GDF A;  4BE2 A;  2A3S A;  4DBQ A;  4ZYE A;  2ISZ A;  4WQM A;  3SLN A;  3ZCO A;  2E71 A;  2K9M A;  1RRJ A;  3DKY A;  3JQQ A;  1YIJ I;  4HEA 2;  3TOB A;  4YFX F;  2R7U A;  3ZUG A;  2IPQ X;  4CDG A;  2Q2E A;  1HW1 A;  1ZYR F;  2QE7 A;  4V02 C;  1QHG A;  2WAF A;  4E7K A;  3LA7 A;  3NAU A;  1A6I A;  1LUJ B;  4PGG A;  3SEZ A;  4BJT A;  2ESN A;  1HZE A;  1PKV A;  5F0F A;  4AF6 A;  2IAI A;  3GZN B;  2VFQ A;  5E18 F;  3H35 A;  4Q47 A;  5HDN A;  4P1V A;  4U0V A;  4DBR A;  4HPQ A;  2LDU A;  3QU6 A;  2EH3 A;  2ELJ A;  4L5E A;  5TIS C;  2GPJ A;  2E1O A;  2XV4 S;  4FT8 A;  3X2Q H;  1Q7Y D;  2M5S A;  2A6H F;  3EPZ A;  4OPV A;  3JTG A;  1JGS A;  3BQJ A;  1QVU A;  3HBL A;  3QU3 A;  3A3G A;  3QSY A;  5IYR A;  3BDD A;  3M7G A;  4AWX B;  4A3E J;  3RJP A;  3GVA A;  2HI3 A;  2W4S A;  4MYU A;  2ETH A;  2VZL A;  5L3F A;  1K9M D;  4RBO A;  3FM3 A;  3OPO A;  2DW4 A;  2XGD A;  5AON A;  3F6O A;  3A35 A;  3CPX A;  2A69 F;  3IAS 2;  3REO A;  1E1Q A;  3JU4 A;  1JTA A;  1TYV A;  4Y3O A;  3DPL C;  3J81 K;  1XB2 A;  3ZMU A;  4JP0 A;  1N77 A;  2OBR A;  2XOK A;  3SYJ A;  3HOX J;  3ABM H;  1WH5 A;  3P5J A;  3G4S B;  2I8D A;  4EM2 A;  1NH3 A;  4KKT A;  3W5H A;  3ZOB A;  3BQY A;  1FP2 A;  3E6D A;  2KFD A;  5ED4 A;  2O3F A;  4UHT A;  2CC2 A;  2A07 F;  2RRE A;  1LE8 A;  3DBH B;  1NJI D;  2KKO A;  2XTW A;  2VJ4 A;  3OAA A;  2QQB A;  4RB1 A;  4D7N A;  3GTP J;  3BCA A;  2DXI A;  3ASO H;  2ZZQ A;  2XTY A;  1L1I A;  3CZ6 A;  1XDU A;  3A1Y A;  3QPH A;  3I55 I;  1HVX A;  3VOD A;  2NSP A;  3CO7 C;  1ELO A;  3BC9 A;  3RKY A;  3CCM I;  1ZH5 A;  4X07 A;  4JX4 A;  1GUU A;  2ZBU A;  2NVT J;  1BI1 A;  3AVX A;  1PXZ A;  1Z3Y A;  4M74 A;  4CQJ A;  3LQE A;  3CME B;  3KZZ A;  1UD4 A;  2DYS H;  2IS6 A;  1LFP A;  4UZU A;  2EV6 A;  2DA3 A;  3WYA A;  5F6F A;  4BXF A;  5J4V A;  4GRI A;  1BPL A;  2GK7 A;  1XS9 A;  2ZO4 A;  2K27 A;  1SFU A;  1H0M A;  2VBX A;  3F9K A;  2EZI A;  4Y4R A;  2BXY A;  1O8G A;  2FQ3 A;  4I98 B;  4FET A;  2WA0 A;  1R22 A;  3ZZT A;  4KUM A;  3DP7 A;  3QFS A;  1HC8 A;  4DK1 A;  5J1Y A;  1R9T J;  1WJD A;  2D1V A;  1E17 A;  2HQA A;  4CH7 A;  5M3M J;  2C4U A;  2TRT A;  4ESB A;  1W7P D;  4BQQ A;  1X4P A;  2ZNZ A;  1BI0 A;  2LBF A;  1FP1 D;  2HKO A;  1WU8 A;  1O57 A;  2CQN A;  3FKJ A;  1BI3 A;  4Z4U A;  4YZA A;  3P7N A;  5L3B A;  1O8K A;  3HOY J;  2RC4 A;  2LD5 A;  1GVJ A;  2DK8 A;  3G1L A;  3DTE A;  3L2W A;  1AKH B;  2QN6 A;  2KL4 A;  4HE5 A;  4PZJ A;  2DOE A;  4LB5 A;  3ZN1 A;  3SJP A;  4N0B A;  4IHT A;  2HPI A;  4CIC A;  1WZ2 A;  2V7V A;  2BV6 A;  2VT2 A;  2DMP A;  5DEQ A;  4E70 A;  2BY0 A;  2ID3 A;  4A3K J;  1J0R A;  2F4M B;  5EMN A;  1YI2 B;  3VOE A;  2RGV A;  4E7Z A;  2V6E A;  1W1W E;  2QQA A;  2LVS A;  4QPQ A;  3OYN A;  2M1B A;  2MC3 A;  3PJR A;  2V7X A;  4A12 A;  1WSV A;  4S04 A;  3U21 A;  5LRS A;  1ZLK A;  4OPS A;  1T56 A;  2NTB A;  1TSP A;  3DEU A;  4V2G A;  3W2H A;  2L0K A;  5HS7 A;  2IS1 A;  2BMW A;  4L5I A;  2DA5 A;  4M9Z A;  3WHB A;  1BX1 A;  3OYC A;  4C2U A;  3I56 I;  2I5U A;  2ZL7 A;  2Y30 A;  3HTS B;  3FX3 A;  1K6O A;  1OCC H;  3OEE A;  2WAD A;  3ONY A;  1I6X A;  5C44 J;  4I02 A;  1D5V A;  2JVG A;  4P9F A;  1DG1 G;  2XDV A;  5M3F J;  2VBK A;  2L3D A;  1KU9 A;  3MMY B;  1FOW A;  1IA5 A;  3QP5 A;  1WWX A;  2E1M C;  4EJU A;  4I0B A;  1QU3 A;  5IYD J;  4YZX A;  4FIS A;  1Y39 A;  3HG9 A;  4JRA C;  1XMK A;  4WXD A;  4XLA A;  4QSH A;  5JFR A;  1I8D A;  3SKB A;  4KIB A;  1F43 A;  1G3T A;  2X85 A;  5IT9 K;  2DPD A;  4CCM A;  2IVM A;  3TP3 A;  1I3Q J;  3S32 A;  3BT9 A;  1RNL A;  2EFG A;  2F43 A;  4RCY A;  5C1E A;  3S16 J;  4NC6 A;  4F52 A;  2IW5 A;  3AL0 B;  1P4X A;  5FD5 A;  3CQZ J;  3HIF A;  1SKY B;  3CCR B;  3I4M J;  1IXS B;  4LBZ A;  2VPR A;  2R7Q A;  1IN7 A;  1TQI A;  1HW5 A;  3K1M A;  4PJJ A;  3H0G J;  1XN7 A;  2XSD C;  1G7C A;  3O3K A;  4I01 A;  2FF4 A;  3Q5F A;  4CCK A;  5TR9 A;  5DM6 F;  3BCB A;  2QSG X;  1MBF A;  1CNE A;  5ICE A;  3FHN A;  3B02 A;  1HDP A;  4Z4Z A;  3WGI A;  1VQO B;  4LLN A;  2VE8 A;  3H5R A;  3KZI C;  4CCO A;  1W0U A;  2Z9O A;  2CK3 A;  1VQM B;  1D1A A;  2MD0 A;  3E97 A;  4XKW A;  1SVL A;  3K1N A;  1ZM3 A;  1EKE A;  1FT9 A;  3WE3 A;  3CCJ I;  2CQX A;  5A2Q K;  4WZE A;  4K2E A;  2QGU A;  1QA2 A;  5F4M A;  1I18 A;  3MQ0 A;  5L3D A;  3AVV A;  3SUC A;  3ONQ A;  3UNG C;  3OL3 A;  2HCJ B;  4TMW A;  2DFE A;  4UUS B;  3GVL A;  3LJY A;  1CLW A;  1TTY A;  2DBB A;  3MZY A;  4M4S A;  4IXA A;  3ROU A;  2EIL H;  1G7S A;  3QP6 A;  2Q6O A;  3V8K A;  2STW A;  3FDY A;  3NWS A;  2QZ8 A;  4GO1 A;  2CS3 A;  2PBI A;  2CV2 A;  1T8I A;  2R93 J;  4J19 A;  3OS2 A;  1R23 A;  4IQ4 A;  4G12 A;  1DGR M;  4KMU X;  3WG9 A;  4ENN A;  3N6Z A;  4RJL A;  5KSW B;  2DOG A;  2EFN A;  2CUE A;  1JHF A;  4RDK A;  3DPU A;  3EYY A;  2NPF A;  3RSN A;  3QYB A;  2DYI A;  3DEE A;  4XKV A;  3E5Q A;  3BC8 A;  2EJR A;  3OL4 A;  4XNF A;  4XLN F;  3KPH A;  3SHF A;  2V7U A;  3J80 K;  1PE9 A;  4IEJ A;  1T39 A;  2NOG A;  3TW7 A;  1BW6 A;  4OJP A;  3HOV J;  3WGG A;  3QFT A;  4TMT A;  2VBM A;  2XAU A;  2LP0 A;  2M4K A;  3IH2 A;  4P96 A;  2LC2 A;  1SFX A;  2XPV A;  4ZDO A;  1XMX A;  4BUP A;  4KT6 A;  4YFN F;  1N78 A;  2EZL A;  1WJF A;  4XSZ F;  1ONV A;  2JVH A;  1SC7 A;  1VQN B;  1GR1 A;  3P9I A;  3ASR A;  3T8T A;  1LDD A;  4EVI A;  3WE2 A;  3PNT A;  4NK6 A;  2P7V B;  3LQR A;  2EV5 A;  1BX0 A;  2JZY A;  2DMU A;  2W84 A;  3O8G A;  4DYR A;  1SEU A;  2XRL A;  3HRU A;  2HZD A;  4XR6 A;  2OQR A;  4QIW N;  1COW A;  4GFB A;  3DU1 X;  1YJ9 B;  2E5N A;  4S05 A;  2ZFW A;  4OPO A;  2ESH A;  2Z2S B;  2JJ2 A;  3CPW B;  1WOR A;  2ELK A;  3OWT A;  4BH9 A;  3IRR A;  2W25 A;  2XEX A;  3HHH A;  1EP3 B;  2PI0 A;  4IHX A;  3W2E A;  3AVT A;  1QFJ A;  2X6W A;  3LL7 A;  3GQB A;  3GFL A;  3JQR A;  3DXJ F;  3LFK A;  1MBK A;  2HYG D;  3CCL I;  1FZP B;  3C7J A;  3CLQ A;  4E6K G;  2CW7 A;  4ZGQ B;  3EUK L;  1LDK B;  4D5C A;  2WAQ A;  2LRD A;  3ZQC A;  4XMY A;  4BDY A;  3BG5 A;  1T6Y A;  4AC9 A;  4EH1 A;  3MN2 A;  1EH8 A;  3GLX A;  4II3 A;  4PGH A;  2VON A;  1IJE A;  4YAW A;  4ZDP A;  4M3D A;  2EFQ A;  3R61 A;  1VQ6 B;  3K4N A;  1AWC A;  2C78 A;  5H6R A;  3I64 A;  3H9J A;  2XF5 A;  4PMH A;  1JT6 A;  1MBE A;  3H9N A;  4AYB A;  2X53 S;  1VQ6 I;  3G05 A;  3RPU A;  5FKN A;  6PAX A;  5HNH A;  1HG8 A;  2JN9 A;  3HGY A;  5L3E A;  1UD3 A;  1CF7 B;  4PCQ A;  3ECO A;  5JBQ A;  1KYZ A;  3I9V 2;  4YG2 F;  3U6K A;  4XKC A;  3VPR A;  2JA2 A;  1R7J A;  3I71 A;  1DU0 A;  1E1R A;  3HPH A;  3RDI A;  3NEU A;  2QEX I;  3CCL B;  2DER A;  2OBS A;  1R5I D;  1RMG A;  2GQF A;  2LKP A;  5DN6 A;  5CVJ A;  1IDJ A;  2GXG A;  2DDB A;  3RPQ A;  1OGI A;  2VQG A;  3U9G A;  1H85 A;  3VFZ A;  3C18 A;  2EA4 A;  1T38 A;  4HX7 A;  4BAC A;  2FD5 A;  2PMD A;  3NQO A;  4IQJ A;  4BL0 B;  3NAW A;  3ZQF A;  2FU4 A;  4HAM A;  2PMZ N;  1Z6R A;  2YPR A;  1GV5 A;  2PX9 A;  3J7A Y;  2CH0 A;  3FXM A;  1CGP A;  2CV1 A;  2H8R A;  1YW8 A;  4PUS A;  3D0S A;  3HRS A;  1PP8 F;  2JK3 A;  1ZG3 A;  2V7Q A;  2KRC A;  1U9N A;  2LF7 A;  2FNP A;  3H9G A;  2EQR A;  4X7D A;  2JWT A;  3BZ6 A;  1KTW A;  3PQK A;  1TYU A;  5F08 A;  3ISX A;  1TUI A;  1R36 A;  5KAF C;  2GOM A;  1IN8 A;  3DLA A;  5GTH C;  2QF7 A;  1VJS A;  1S7O A;  3LWF A;  1G7T A;  3AK5 A;  4LBY A;  3RY8 A;  1LFU P;  4A3J J;  4XLE A;  1JUM A;  1T0F C;  3WTV C;  3LNQ A;  4V2F A;  2M0M A;  5AIQ A;  3HOU J;  3FXJ A;  2BW3 A;  1G3S A;  1E79 A;  3ZBT A;  2DFF A;  1AIP A;  4LBV A;  1OCR H;  3H9Q A;  4AIH A;  4A0Y A;  3TMO A;  5FLX Z;  4X1E A;  4A3I J;  2PJR B;  2KRF A;  2DY1 A;  2FSW A;  5LHG A;  1YFH A;  2HDN B;  3KP4 A;  3GME A;  1U78 A;  1XGO A;  1XGS A;  2HR3 A;  2ISY A;  2R5Y B;  2JJ7 A;  2A61 A;  1KGS A;  1BMF A;  4J0Q A;  4ASN A;  4ASU A;  3W2V A;  4PJL A;  1Z05 A;  2PMU A;  5E20 A;  4FTH A;  4AM3 A;  4M3B A;  1P4A A;  1KU7 A;  4ZDL A;  4RLZ A;  3GEZ A;  3AVY A;  1HXD A;  4E7I A;  2XUB A;  3S2W A;  2MH2 A;  2B7B A;  4BKX A;  1FMW A;  5EG0 A;  1UG2 A;  2FA5 A;  2CGP A;  4HQM A;  5H2F C;  2W6J A;  4IRH A;  4ZTJ A;  1BA5 A;  1PJ7 A;  4DQL A;  3CP2 A;  2X9D A;  2XGX A;  3BWG A;  1F5T A;  2GZW A;  2GRE A;  1R49 A;  1VQM I;  1TQP A;  3FXO A;  1RU4 A;  4GGG A;  1HOM A;  4OJ6 A;  2OCC H;  5E3N A;  2B0L A;  4BNC A;  1KK1 A;  3BR5 A;  2WJV A;  3MKW B;  1D8T A;  1P4M A;  1YOV B;  1OIS A;  1W0J A;  1EP1 B;  3LYC A;  2E19 A;  2K86 A;  2OZ6 A;  4UUS A;  2ZTG A;  4NNJ A;  4BXX J;  1U0J A;  3CME I;  2PN6 A;  3OIQ A;  4G94 A;  1QGA A;  4B3F X;  2LG4 A;  1Q86 D;  1S0U A;  4L9V A;  4RDU A;  4YAO A;  2DMQ A;  2VOD A;  2L9N A;  1OCZ H;  2CJJ A;  3CCM B;  1VQ5 B;  2K9N A;  4YRV A;  3FMR A;  2IGM A;  2DCE A;  5BQT A;  2CSO A;  2Q0O A;  3PUM A;  1YLF A;  1O8E A;  2VFN A;  2VOO A;  3BQZ A;  3FXK A;  2K4B A;  2R7D A;  2VKH A;  4Z4Y A;  1LVK A;  2NTP A;  3DEW A;  3JTH A;  4KKS A;  2XRN A;  4XN0 A;  4BEH B;  4BBR J;  3HSR A;  3OYB A;  3LVB A;  4H9G A;  4WZT A;  5JVT A;  3IUO A;  4LD5 A;  3L00 A;  5K7F A;  3KX2 A;  3TW6 A;  1AKH A;  4PC6 A;  1REP C;  3V8J A;  3WU1 B;  2C2W A;  3BH7 B;  3TGN A;  1SAX A;  1Z21 A;  4KIC A;  3S17 J;  4PFP A;  5B3S H;  2M8G X;  1NG6 A;  1K78 B;  2ZC2 A;  5HVQ C;  1W0T A;  4RLF A;  4QLC U;  1MAB A;  3B82 A;  4HIZ A;  4DZJ A;  3VMF A;  3D5S C;  5FLM J;  1M90 D;  1HCR A;  2B0R A;  1KQ9 A;  1YIT I;  4A93 J;  1D8K A;  4RLQ A;  2D1H A;  2V7F A;  4D9J A;  1YX2 A;  3UR3 C;  3QOD A;  3IC7 A;  1J75 A;  1VF9 A;  2GXA A;  3S14 J;  2GXB A;  2DT7 B;  2LOO A;  3MKY B;  2CUZ A;  2VN2 A;  3K2Z A;  1AIR A;  4L8J A;  1OYI A;  1D2E A;  2X4H A;  3F8B A;  3VB2 A;  4RB3 C;  2H94 A;  1IJW C;  1YIJ B;  3BZK A;  3E5U A;  2H6B A;  1ZTR A;  2WB1 N;  1MMA A;  5D5U B;  4I84 A;  2O1D A;  1UD8 A;  3ZMZ A;  4IOC F;  4FWT A;  1UCR A;  3R0J A;  1WOP A;  1O3R A;  4UY8 I;  2ZBK A;  4LIT A;  1BM9 A;  2WV1 A;  2YWE A;  1WPK A;  3FXL A;  3D5R C;  2QA4 B;  3U6B A;  2O0W A;  2X3H A;  3F21 A;  4DNC A;  2MH9 A;  3JRG A;  3RPU D;  1H42 A;  1NRK A;  2HQ5 A;  1TBX A;  2YWF A;  4L9N A;  5F0H A;  3LAJ A;  3D1N I;  2FXA A;  2ZJR F;  1GVD A;  5KHD A;  5HS8 A;  1K79 A;  4OIN F;  2X1C A;  1I1G A;  1GXP A;  1QVF B;  2FMY A;  3C2G A;  4QPO A;  4P3Y A;  1ETX A;  1P2F A;  4M6X A;  2L7Z A;  3D5L A;  2Z1D A;  2FVG A;  4FK8 A;  1N06 A;  3AGP A;  1EE6 A;  2ZJQ F;  1YRN B;  2CFX A;  2XND A;  1KCD A;  4LOC A;  4XRM A;  3OJX A;  1K4T A;  2VBE A;  4A6D A;  4OAZ A;  4C30 A;  2HFH A;  2HDD A;  1GLN A;  1TWF J;  2OK8 A;  1NK3 P;  1P92 A;  3VSU A;  2XIG A;  1WOS A;  5ILS A;  1BR2 A;  1X1D A;  2H1L A;  3CJR B;  3QPL A;  2R7Z J;  3ZMD A;  3ZIA A;  1X3W B;  4TV7 A;  1JE8 A;  2OTL B;  1DBG A;  2DT5 A;  4M9X A;  3MHP A;  1F9N A;  4YAF A;  2QZA A;  2AHO A;  3BR2 A;  4YEI A;  4EMS A;  3U1K A;  2YUS A;  3KP7 A;  3L2Q A;  5J4Y A;  2MW8 A;  1D1C A;  3PUN A;  1FIP A;  1FNM A;  5EEG A;  4QFM A;  3WBK A;  5GAE J;  5IP9 J;  4IOA F;  3WY9 A;  2XZL A;  2VT3 A;  2DMT A;  4FE4 A;  3U2R A;  5ILU A;  4TMV A;  5FB2 A;  3CES A;  3CCU I;  3JAM K;  5K7Z A;  1MSF C;  1QBJ A;  1ZM2 A;  1AOY A;  4KDP A;  5IYQ A;  1ODD A;  3DF8 A;  2GQQ A;  1W5C C;  3Q9V A;  4ENJ A;  2BGC A;  3CMM A;  5BSX A;  2RDP A;  4K1X A;  3WNB A;  3M4O J;  2KRH A;  2HQN A;  4TMZ A;  3UW0 A;  1ULY A;  3V7S A;  4IHW A;  1Y0U A;  1I6H J;  2DPU A;  1IHM A;  1UFM A;  5GPA A;  3TL4 X;  4M1K A;  5LFA A;  3LSJ A;  3V4G A;  3VO2 A;  1FPQ A;  3CUQ C;  4ZC3 A;  2HVR A;  1OFD A;  1XGN A;  1VQK I;  2B9S A;  4M73 A;  4QTR A;  2W6I A;  2WR8 A;  3IAM 2;  1EF4 A;  3M8J A;  4XRF A;  4U49 A;  2V31 A;  2R92 J;  2P5V A;  2RV8 A;  1SFK A;  3SDG A;  1FEX A;  2C4T A;  1E3O C;  3VYR B;  5L3G A;  3S3N A;  4B3G A;  4RDL A;  3CCQ B;  2QM3 A;  5IYN A;  1FRQ A;  4G6Q A;  3V7R A;  2Z6B D;  3B8H A;  1UD5 A;  4LB6 B;  2BM4 A;  2F3L A;  1ZRE A;  2X51 A;  2DT6 A;  3OEH A;  4HWV A;  1ZG5 A;  1GDT A;  2VC1 A;  4L0Z B;  5H6Q A;  1WI9 A;  5DSZ A;  1VQ8 B;  1DUX C;  2Q1Z B;  5DCF A;  1BI2 A;  2Y69 H;  3FPP A;  2KIS A;  1Y1V J;  4KIF A;  2FBK A;  2VBT A;  3Q0W A;  3RKX A;  3KE2 A;  2E36 A;  2MSY A;  3W5U A;  4Y9R A;  4ZYH A;  4HZF A;  1UJ8 A;  2EIN H;  3CF2 A;  1VZ0 A;  1RUO A;  1XMA A;  3VYT B;  3G1O A;  2QLZ A;  2TDX A;  2Y0S A;  2OPT A;  3BOQ A;  4CCN A;  3PA1 A;  4QWQ A;  5GV8 A;  3BTL A;  1XSD A;  4B44 A;  4A3L J;  3SJM A;  3ONU A;  1S72 B;  3K4L A;  3E20 A;  2EPF A;  2ZCW A;  3SFZ A;  3QOP A;  1EA0 A;  1N8R D;  1DAR A;  2PEC A;  2BE5 F;  3FPK A;  2P81 A;  3PUF A;  2LNB A;  4RM0 A;  2ZXW H;  3N97 A;  2JA7 J;  3MAJ A;  2IGO A;  3IL2 A;  4CYC A;  1ETK A;  1GJR A;  3EQO A;  2EIJ H;  4XRS G;  2WC2 A;  2C6Y A;  2XNC A;  2DJN A;  3HOW J;  1YJN B;  3GX4 X;  5FD6 A;  2XGC A;  3DV8 A;  5E8I A;  4MIM A;  2ICW G;  4E4H A;  1LPQ A;  4UUV A;  1FND A;  1N08 A;  3LMM A;  3VWB A;  2L7K A;  3IH3 A;  4DZP A;  3NRV A;  5FLV A;  2RNJ A;  1LLZ A;  1VBL A;  1J9I A;  2OU2 A;  2YWH A;  5IK2 A;  1K73 D;  2EBI A;  2Y31 A;  1V5G A;  4A0X A;  3I59 B;  3K1P A;  2WAQ N;  3EQL F;  3BZC A;  1TT0 A;  3KYD B;  4PK4 A;  2VKD A;  1LDJ A;  2DN0 A;  3BPX A;  4RB0 A;  2BGJ A;  2PE3 A;  3SEJ A;  1SAN A;  3BJ6 A;  1K28 D;  4AUX A;  2GA2 A;  3CCV I;  3RKQ A;  2VFM A;  2IOU G;  5EGO A;  1FOX A;  2FX3 A;  4X7E A;  1IN5 A;  2FBI A;  2YX4 A;  4A0Z A;  4GQN A;  3FKI J;  2BHZ A;  1P6R A;  1ENH A;  3FM5 A;  4HYE A;  2ZKZ A;  5J40 A;  5GAG J;  2QSF X;  1DDI A;  1EJ9 A;  1PUF B;  4UVA A;  4II2 A;  2YU9 J;  4RD4 A;  2EZK A;  4CA0 A;  1X1A A;  1P9Q C;  3A4C A;  3PQJ A;  3W3C A;  2MLK A;  2VBV A;  3Q6R A;  5FIU A;  3I4N J;  3JQP A;  1VQ4 I;  4I0A A;  4ESJ A;  2E7X A;  3IWZ A;  2I10 A;  1W35 A;  2BF4 A;  4R71 A;  4QUZ A;  2ZME B;  4ABZ A;  4ZZD A;  1JJ6 C;  1LNW A;  2K4J A;  2XKO A;  1FYL A;  2EFP A;  4M53 A;  4BHB A;  1HF2 A;  5HLG A;  1PJ5 A;  2G0E A;  1E63 A;  2JPB A;  3T53 B;  3CCS I;  3F8M A;  1U2R A;  1POG A;  1JJ8 C;  3T0Y A;  3ZMT A;  1VQ9 B;  2QMU A;  3PVD A;  2M30 A;  3F8C A;  1SD4 A;  1EP2 B;  1TLH B;  4GYG A;  2F5F A;  4WWV A;  4NC8 A;  5DTD A;  4M0L A;  3JRE A;  4RD1 A;  4UZE A;  3S3M A;  2K9S A;  2W7N A;  3FXQ A;  1E62 A;  1MMG A;  1KTV A;  4EV0 A;  2AO9 A;  1HKT A;  5F1J A;  1E3Z A;  4WZK A;  3DCF A;  3CUO A;  5FNZ A;  5D6E A;  2G9W A;  1W5T A;  4R8H A;  5AN9 A;  4W8T A;  1TP4 A;  4PFO A;  2V1N A;  5HOO A;  1HQC A;  1T6S A;  3H09 A;  4BDZ A;  4JOM A;  5GTI C;  2BZT A;  2A6T A;  4KN7 X;  4OZZ A;  1V54 H;  1EV7 A;  3KCC A;  3RI4 A;  4QVA A;  2R5Z A;  1V5V A;  3R6J A;  1BN8 A;  1XTA A;  1DP3 A;  2RC5 A;  2E1M B;  3EDP A;  3OV8 A;  5A89 A;  4YZ0 A;  1ON1 A;  4PJN A;  2XVC A;  4XD7 A;  2PLY A;  3W2I A;  1FNB A;  1IG7 A;  3L2C A;  1XFO A;  3S1Q J;  1FLI A;  4UAJ A;  2FNA A;  2GM4 A;  5DS0 A;  4OIO F;  3L2U A;  2VJJ A;  4G5G A;  2QDX A;  4HX8 A;  1ZM4 A;  2EWE A;  4UV9 A;  4D1Q A;  2VE9 A;  2ZZE A;  4DQ2 A;  2RQQ A;  1KZH A;  3ZXS A;  1QVG B;  4DGW B;  2IGK A;  2XPU A;  3TQN A;  1VQ8 I;  2VC0 A;  1KCC A;  4KIT B;  4BGD A;  2FBH A;  1FOY A;  5EF6 A;  4HF2 A;  4CZC A;  1IRF A;  5JVG F;  3LQQ A;  3LSP A;  3FWE A;  1K7A A;  3CCQ I;  4C43 A;  2EFO A;  1VQO I;  5DCM B;  4AC0 A;  1T6Z A;  3OE7 A;  2ZFU A;  4MGR A;  1SMY F;  2J5P A;  2XT2 A;  3TO6 A;  1IDZ A;  3RQ4 A;  1KK2 A;  1VND A;  2GBY A;  2QQ8 A;  3HTU A;  3BTI A;  2PJR A;  5D6F A;  1O8M A;  1G3Y A;  4C3H J;  3G73 A;  4QV2 A;  1BR4 A;  5A8A A;  3DKW A;  1QGP A;  2FRH A;  2NV4 A;  2ID6 A;  4LJZ F;  5IOZ A;  4CUG A;  4HLX A;  4WZL A;  3ZPP A;  2F4I A;  4BE1 A;  2CWE A;  3T5X A;  3WTW C;  3FK6 A;  4PC1 A;  4FHT A;  4Z03 A;  3COA C;  5LEJ A;  4HF1 A;  2GJP A;  1D0Z A;  3H3U A;  2CND A;  2HEO A;  1WFX A;  1NB9 A;  2ZZG A;  1EH7 A;  3ZRG A;  5HXB A;  4YIR X;  3CC7 B;  1FNC A;  5H59 A;  4AID A;  2QVO A;  2ZJP F;  1D8J A;  2QYU A;  2R7X A;  3BG9 A;  2IRF G;  5J3L A;  2BVL A;  4ESF A;  1A6Q A;  2KMU A;  4EM0 B;  2LKX A;  1O3Q A;  1UAA A;  1TVC A;  1E43 A;  3JCU C;  2HMA A;  1IZ1 A;  2A68 F;  2V4J C;  4NB5 A;  2ME6 A;  2KIF A;  4LG0 B;  2RC6 A;  4U0Y A;  2J7K A;  1F4K A;  3IKT A;  3I56 B;  4MXN A;  2F5E A;  4M9S A;  5F27 A;  4M2L A;  3IP4 B;  1B8I A;  4W8S A;  4KJZ A;  5DD8 A;  3GFJ A;  1B2R A;  1QZE A;  3WTS C;  1I39 A;  3FXR A;  1JTY A;  5J47 A;  2XB5 A;  1W5S A;  2VNJ A;  3SJZ A;  2X3U A;  5CVR A;  3A1P A;  5E3M A;  3HRT A;  4WWC A;  3PIO F;  2V9P A;  2M45 A;  2HQR A;  4N4N B;  3ZZ0 A;  2MAB A;  3OYI A;  4Y7C A;  1PVE A;  2W48 A;  3FBN B;  1B9N A;  3FY3 A;  1ON2 A;  4O3M A;  3PFY A;  4XLH A;  5HDK A;  2XNJ A;  3PO3 J;  4KNY A;  3J7Z I;  2JSC A;  4YZQ A;  4NQW A;  2H27 A;  2STT A;  1CF7 A;  2NAZ A;  4HOB A;  2GOX B;  4RMN A;  2CW0 F;  4Z2Y A;  1U3E M;  4A3G J;  1B72 A;  5EEH A;  3MCA A;  3E6M A;  1WHU A;  2EWN A;  2XHK A;  1WJC A;  2LMD A;  5TRD A;  4NK8 A;  5KVR A;  2B5O A;  1K6Y A;  2LSO A;  1LFB A;  3W6V A;  3OZV A;  2VXZ A;  4AVP A;  5GP9 A;  1D5Y A;  3GUD A;  3CLO A;  2DTR A;  1K78 A;  1QZZ A;  1WMR A;  3K0L A;  2C77 A;  5EYR A;  2EK5 A;  5LD2 C;  3CP8 A;  5DV5 A;  1Q9S A;  3LSH A;  4B43 A;  2O9L A;  3WHC A;  1J2X A;  3KFW X;  2DMN A;  3NE5 B;  1X4O A;  1WGX A;  1U9O A;  1DQU A;  1X3Z B;  3M07 A;  4G9Y A;  4UXN A;  3WGH A;  3I5U A;  2Z33 A;  1Y0R A;  3JRH A;  2ZXJ A;  4XBF A;  3ASQ A;  1ZKG A;  3ASN H;  1VF7 A;  3TKY A;  3S3O A;  3QFC A;  4ZCL A;  1W9X A;  4LIU A;  3NB2 A;  2DQR A;  3F8F A;  1FX0 A;  2Y9Z A;  2DU9 A;  1RET A;  2OC6 A;  4G1B A;  2BVM A;  1QFZ A;  4NCN A;  1ZLJ A;  1HKS A;  2P0W A;  1BLI A;  4XID A;  4HE6 A;  2O8X A;  4TN1 A;  1O88 A;  4FAS D;  2RQP A;  5LRR A;  1IRZ A;  3K2A A;  1E3X A;  1KZL A;  2EIX A;  4OU0 A;  2UV1 A;  1DDN A;  4P25 A;  4OJ5 A;  5H5J A;  2Q2E B;  1TTT A;  2CU7 A;  9ANT A;  1E3P A;  2YS9 A;  4BHP A;  4X06 A;  1XCV A;  1F20 A;  4EEF G;  1O8J A;  3OIO A;  5FRO A;  1Y8R B;  2M7A A;  4I2O A;  4KIS A;  2VXD A;  5TV2 A;  2CYY A;  2HTS A;  2NVQ J;  1K4S A;  3QAH A;  3GZ6 A;  3RZO J;  4U87 A;  1QUF A;  1QA3 A;  3HUG A;  3ESW B;  3SQN A;  2BVN A;  3OOU A;  1XG2 A;  2Q6K A;  2QXZ A;  4YCQ A;  1FWZ A;  2VBZ A;  2BY2 A;  4RA2 A;  1T0F A;  1H80 A;  3OYG A;  4ZCM A;  1EFR A;  1FSH A;  3W5V A;  1SD6 A;  4PSX A;  1L0O C;  4MEY F;  4CO8 A;  4Y7N J;  5HKK A;  3BR3 A;  3CC7 I;  2O17 A;  1MJA A;  3DLL F;  5BPI A;  5B66 C;  5EEA A;  3DWL E;  3AG2 H;  3ZPL A;  4I6Z A;  4JK1 X;  2BM7 A;  5K7H A;  4RAG A;  1W4M A;  2L01 A;  4JX5 A;  4XK4 A;  2EV0 A;  3OMY A;  1K83 J;  2LK2 A;  1QGZ A;  4A3F J;  5EDN A;  1I5Z A;  4E7J A;  2CW5 A;  3HAG A;  5GPC A;  2NRA C;  5EGO B;  1OFC X;  1W36 C;  4DQK A;  2JA8 J;  2R3S A;  1EA3 A;  4EGZ A;  1OB5 A;  2F2E A;  2CQQ A;  4CYD A;  3S1R J;  4BQA A;  4C3J J;  3CTA A;  4YEJ A;  3L9F A;  4RGS A;  3KP3 A;  4XRS A;  3B78 A;  3HJE A;  4HNT A;  1Y0N A;  3CD6 B;  5ERI A;  2QKL B;  3VST A;  1FJL A;  2MGQ A;  1NG7 A;  5D5W B;  2HVS A;  1HBX G;  5A88 A;  2J5O A;  3HB9 A;  4RAY A;  2QBY A;  3VYS B;  4XLC A;  5H20 A;  2CW8 A;  2VBW A;  4KA4 A;  3VMW A;  4RGR A;  4IKF A;  5FRM A;  1B6A A;  2Z5U A;  3M8F A;  3N4M A;  2UXN A;  1XX5 A;  2LLK A;  2OUM A;  4CYC B;  1BJK A;  3ASS A;  1UHS A;  3Q6Q A;  2GAU A;  2E1N A;  1OCP A;  1N25 A;  2IGN A;  1WSU A;  1ZK8 A;  4HX4 A;  2X1E A;  3G6E I;  1QA1 A;  2ZSH B;  2BEO A;  3HC7 A;  1X58 A;  1IUF A;  4U0W A;  1YYV A;  4PDK A;  4V19 K;  3ASP A;  3VR6 A;  2ZXI A;  4MTD A;  1D3Y A;  4LMY A;  1EXM A;  1JT0 A;  4HST A;  3K6G A;  3CC4 B;  1YJW B;  4ANJ A;  2L7F P;  3HKZ N;  3DBL B;  1QCX A;  1J09 A;  4IL6 C;  2EIM H;  1CQT A;  1PYV A;  4F91 B;  2EZH A;  3BRO A;  4MTE A;  4NBS A;  1S5L C;  4DJA A;  3C1D A;  3DTK A;  3SDB A;  1JGG A;  4F93 B;  3RQI A;  1U5T A;  2OQG A;  2CV0 A;  5A2Q Z;  2P7C B;  4YII A;  2LY9 A;  2EA2 A;  3HRM A;  1ZRC A;  5CLS A;  3QRF F;  1BC7 C;  2M8E A;  4FN5 A;  1ITY A;  3A0B C;  2VJI A;  4G7W A;  4W97 A;  1K4Z A;  2M7B A;  4P6V F;  3TP0 A;  5K1Y A;  1X1P A;  2G0Y A;  2QWW A;  1VQ4 B;  2UUZ A;  3D26 A;  2K02 A;  4PJM A;  2QX3 A;  4CHU A;  2HZT A;  3M1C A;  1H9T A;  1MNE A;  1LE8 B;  2IS2 A;  1JTX A;  1PLU A;  1YG2 A;  1RPW A;  5CQE A;  1G2H A;  1YRN A;  3S93 A;  2UWM A;  2JIZ A;  4YAU A;  2HTJ A;  3CDL A;  1MIJ A;  1YS7 A;  4URR A;  2XC1 A;  5LHI A;  1PJ6 A;  1NB0 A;  2OYN A;  1KQS B;  2JSP A;  2CBX A;  4LGW A;  3ZQI A;  4P5O A;  1VI0 A;  1RZ4 A;  5FRN A;  4HNV A;  4Z05 A;  5FO0 A;  2K85 A;  1BBY A;  2VQH A;  3MVP A;  4C2M J;  4C3I J;  2D74 A;  4LIV A;  3E3V A;  2LYC A;  5JHF A;  4U4B A;  1VQL B;  3FIS A;  4RB2 C;  2QEX B;  2K7L A;  1S7A A;  1IF1 A;  4GCV A;  2VOP A;  3EUH A;  5DD4 A;  2F5C A;  3F72 A;  2E5Z A;  3E1S A;  2IA2 A;  3L09 A;  4AD9 A;  3RYR A;  2GJK A;  3ML6 A;  1K61 A;  3ZQQ A;  1X0C A;  1NK2 P;  1NHA A;  4TSF A;  5HDG A;  1UHW A;  1Z1D A;  3JR9 A;  3H1C A;  1KU2 A;  2O03 A;  3W2F A;  3OOP A;  3L7W A;  3PA2 A;  3OYE A;  2ZNY A;  4FX4 A;  3OZW A;  4JX6 A;  2A5Y B;  2MG4 A;  1ZG1 A;  1JHH A;  1BN5 A;  1ERD A;  1Y0Y A;  3IHU A;  2P3M A;  3RYP A;  4BY7 J;  2KIU A;  4IZZ A;  5HZB A;  2QGG A;  1S8N A;  3K4B A;  3KL9 A;  3HOT A;  4XIC A;  4EJO A;  5LLQ A;  3B6A A;  2XAH A;  1STZ A;  2NS7 A;  4MFD A;  2JRM A;  1V4R A;  3TDU C;  4EGY A;  5J1R A;  3FZV A;  1KYW A;  2LKS A;  1ZGW A;  3PEN A;  2DFI A; 
#chains in the Genus database with same CATH homology
 4YZA A;  2Q1Z B;  1OGO X;  3KEY A;  1O8K A;  3FPP A;  3L2W A;  3DTE A;  1OHH A;  3LNN A;  2LRE A;  2KL4 A;  4R79 A;  5HLT A;  3DU5 A;  1KON A;  1TZL A;  1MND A;  4BQO A;  2HPI A;  1RWR A;  3CF2 A;  1VZ0 A;  3LSG A;  2JJ1 A;  3VYT B;  2Z8G A;  2NOJ B;  2Y0S A;  4G6T B;  4CCN A;  2AQF A;  3KRG A;  4E7Z A;  2V6E A;  3PJR A;  2K9L A;  4QPQ A;  3OYN A;  3L2R A;  4B44 A;  3GVK A;  2QKM B;  3K4L A;  1AA7 A;  3U21 A;  3DQV C;  2NTB A;  2PEC A;  4XKB A;  2VQC A;  2R7O A;  3VSV A;  2VL8 A;  2IS1 A;  3AL0 C;  2V26 A;  2KPM A;  3OYA A;  1KMH A;  3OYC A;  2IGO A;  4C2U A;  1Y56 A;  3EQO A;  2AQE A;  3T56 B;  3HXL A;  2INV A;  3OEE A;  2HNH A;  2WAD A;  4E4H A;  2M4G A;  1G59 A;  2R7V A;  3H0D A;  3LMM A;  3VSK A;  3VWB A;  5HNF A;  1T5E A;  2L7K A;  2JVG A;  2F6C A;  2XDV A;  2VBK A;  3MMY B;  4LG3 A;  1VBL A;  4MR0 A;  1IA5 A;  2E1M C;  5IK2 A;  1QU3 A;  4HNU A;  4YZX A;  3HG9 A;  1V5G A;  1V0E A;  3H94 A;  4XLA A;  4DJA A;  5FL7 A;  3K4J A;  1TT0 A;  4PK4 A;  2LY1 A;  2VKD A;  1I8D A;  3RCO A;  2X85 A;  1K28 D;  3OYJ A;  4BS9 A;  4CCM A;  4W8R A;  4J00 A;  4ZYA A;  3VYU B;  3S32 A;  5C1E A;  2F43 A;  4F52 A;  3AL0 B;  3GBG A;  3BH4 A;  1SKY B;  3GRH A;  4GQN A;  2R7Q A;  4HSR A;  2KHM A;  4PJJ A;  2XZO A;  4E7L A;  4RM3 A;  2UVE A;  4II2 A;  1FMV A;  2XC7 A;  1LKX A;  3DPT A;  4CCK A;  1E0E A;  3BCB A;  1X1A A;  1P9Q C;  3A4C A;  4CA0 A;  3W3C A;  3FHN A;  3LFU A;  1H8E A;  2CK3 A;  4CCO A;  3H5R A;  1ZEL A;  2WJY A;  1BHE A;  3OFN A;  2BSP A;  1D1A A;  2MD0 A;  3VDX A;  2W82 A;  4XKW A;  1QJV A;  1JI8 A;  3T53 B;  4OJL A;  2X6X A;  2IS4 A;  1I18 A;  3V42 A;  3SUC A;  3ONQ A;  3UNG C;  3OL3 A;  4U7B A;  4HRI A;  3VMV A;  3GVL A;  2JUG A;  2VQL A;  2XF6 A;  4NQW B;  3MKZ A;  3I3L A;  4YXW A;  1YX3 A;  4NC8 A;  2VIX A;  2K3P A;  3FDY A;  3NWS A;  1V5E A;  3S3M A;  1OLT A;  2KP6 A;  1H8H A;  2CS3 A;  3PNV A;  2W7N A;  1UG0 A;  2CV2 A;  4OZY A;  1MMG A;  3OIP A;  4TKO B;  2V9K A;  3OS2 A;  4H4K C;  4IQ4 A;  1DGR M;  1E3Z A;  4YEL A;  2DIE A;  1X1B A;  4W8T A;  3OW7 A;  4PFO A;  3DPU A;  2V1N A;  2WAE A;  5HOO A;  2IXS A;  3RSN A;  3QYB A;  3DEE A;  4XKV A;  1MW7 A;  3BC8 A;  3OL4 A;  4XNF A;  4CSW A;  4JOM A;  4BDZ A;  2GK6 A;  2XGJ A;  4OZZ A;  2A6T A;  3WQZ A;  1PE9 A;  3W2A A;  2LBF B;  1WJE A;  4E7H A;  1BN8 A;  4OJP A;  1DP3 A;  4KKU A;  2E1M B;  4YZ0 A;  4PJN A;  2VBM A;  1Y6I A;  2XAU A;  2M4K A;  3OS0 A;  1BR1 A;  2LC2 A;  4ZDO A;  4XD7 A;  4E0F A;  2ZTN A;  4BUP A;  3A3B A;  4KT6 A;  1N78 A;  3A2K A;  1WJF A;  2JVH A;  4XM3 A;  2WZP P;  3L2U A;  2VJJ A;  2PMZ A;  3L2V A;  2EWE A;  3HL2 A;  4D1Q A;  3PNT A;  2ZZE A;  2L2O A;  5CQG A;  2NTQ A;  4NK6 A;  2RQQ A;  3ZXS A;  3MD2 A;  4DGW B;  2IGK A;  2OV7 A;  4J01 A;  2D3L A;  3OR1 C;  1KCC A;  2HZD A;  1G8X A;  2CFO A;  2WB1 A;  4XR6 A;  1COW A;  3GQ9 A;  4KIT B;  4BGD A;  3FKS A;  2E5N A;  2Z2S B;  2JJ2 A;  4CCL A;  1MMD A;  3OWT A;  4CZC A;  4TT3 A;  3GQA A;  3K4C A;  3DTI A;  3OYD A;  1JRG A;  2HPM A;  1QHH D;  2X6W A;  3LL7 A;  3GQB A;  3OE7 A;  3HUG B;  4DK0 A;  2ZFU A;  2O04 A;  1D1B A;  3RQ4 A;  4E6K G;  3W2W A;  2CW7 A;  2PJR A;  3EUK L;  1LDK B;  1O8M A;  4BJ6 C;  1O8L A;  2WBM A;  1BR4 A;  2WAQ A;  2LRD A;  4XMY A;  4NC7 A;  4BDY A;  3B90 A;  2XSJ C;  4XOR A;  4II3 A;  3TBI A;  4CUG A;  2MC4 A;  4ZDP A;  4P22 A;  2HLD A;  3ZPP A;  3K4N A;  1N75 A;  2F4I A;  4BE1 A;  4F92 B;  3H9J A;  2XF5 A;  2CMP A;  2E60 A;  3G2B A;  4HG2 A;  5CPR B;  4PMH A;  4AYB A;  2X53 S;  2WY8 Q;  3OS1 A;  4EAT A;  2LY2 A;  3G05 A;  4Z03 A;  5HNH A;  1HG8 A;  3WWG A;  2GJP A;  3LSK A;  1D0Z A;  2X8K A;  3H5A A;  1UD3 A;  1WFX A;  5AMV A;  2ZZG A;  2R7R A;  3ZRG A;  1IDK A;  3I9V 2;  1WJ5 A;  4E7S A;  4XKC A;  3OY9 A;  1S9H A;  2DOA A;  2JA2 A;  1E1R A;  3HPH A;  2R7X A;  1RMG A;  4DIQ A;  2D3N A;  4XL9 A;  2BVL A;  3BG7 A;  3PUB A;  5DN6 A;  2L9S A;  2W00 A;  2KMU A;  4AVZ A;  1UAA A;  1IDJ A;  2BW3 B;  1UEL B;  3DKX A;  2LH9 A;  2VQG A;  1E43 A;  3QOE A;  5C1C A;  2V4J C;  4BAC A;  4ITV A;  4IQJ A;  4PSW A;  4MXN A;  2BOL A;  2MFZ A;  1O8H A;  1OB0 A;  4BL0 B;  2GJR A;  1R6R A;  3IP4 B;  4W8S A;  3KYL A;  3LMW A;  4KJZ A;  4XOP A;  2PYG A;  3J7A Y;  2CH0 A;  2CV1 A;  4OWR B;  4N4O B;  1V5F A;  4PUS A;  4C9Y A;  4N4N B;  2MAB A;  2V7Q A;  4C2L A;  3OYI A;  3N05 A;  2KRC A;  4DNT B;  3FBN B;  3T9G A;  3FY3 A;  3ZSC A;  3H9G A;  2QY1 A;  3PFY A;  4XLH A;  3OOC A;  4B47 A;  4G7X A;  1KTW A;  4YZQ A;  4B3X A;  2GOM A;  3DLA A;  2GOX B;  4RMN A;  1VJS A;  3BLY A;  4IX7 A;  3GVJ A;  2R9V A;  1WJC A;  4NK8 A;  2K5C A;  1T95 A;  3ZPN A;  1DBO A;  4XLE A;  1T0F C;  1K6Y A;  3BG6 A;  2M0M A;  3KEW A;  2VXZ A;  3NWT A;  2NT6 A;  1YX5 A;  2BW3 A;  1E79 A;  2ODL A;  1WMR A;  4OJO A;  4XQF A;  4NUB A;  3H9Q A;  5LD2 C;  3CP8 A;  3LSH A;  4B43 A;  3TMO A;  2PJR B;  2O5R A;  2XF7 A;  2CUJ A;  1Z7L A;  3NE5 B;  2X3H A;  1X4O A;  1DQU A;  1BMF A;  4Z06 A;  4ASU A;  2DJI A;  3B8Y A;  3QYF A;  3W2V A;  3LSM A;  4PJL A;  2R7S A;  1Z3X A;  1VF7 A;  3S3O A;  2F1M A;  2JDI A;  1W9X A;  4LIU A;  3VSL A;  1WP6 A;  1FX0 A;  3FBI B;  4ZDL A;  1GQ8 A;  3K4M A;  4E7I A;  1IB4 A;  2OC6 A;  4F55 A;  1FMW A;  2BVM A;  2KLO A;  3AFH A;  2W6J A;  2VPL A;  2P0W A;  3OYH A;  1BLI A;  4ZTJ A;  1O88 A;  4FAS D;  3CP2 A;  1KZL A;  1E3X A;  2INU A;  2UV1 A;  4OJ5 A;  1RU4 A;  2Q2E B;  2XZP A;  4OJ6 A;  4DOZ A;  4XN3 A;  2WJV A;  5KNL A;  1O8J A;  3MKW B;  5FRO A;  2M7A A;  4KIS A;  3ZGK A;  2R7T A;  1W0J A;  2VXD A;  4FXU A;  2ZTG A;  2FUG 2;  4CCJ A;  1WTH D;  4NNJ A;  1U0J A;  3OIQ A;  4U87 A;  1WPC A;  3BCF A;  2LG4 A;  1V0F A;  1BOB A;  2L5Q A;  2WSS A;  4B3F X;  1OFM A;  3OOU A;  1XG2 A;  2L9N A;  3OYF A;  3OYK A;  1DGW Y;  2QXZ A;  2X1D A;  1MMN A;  4YRV A;  1D0X A;  2IGM A;  2DCE A;  3PSI A;  3HOS A;  3B4N A;  3PNY A;  3DDY A;  1H80 A;  2ZZF A;  3OYG A;  1UD2 A;  1O8E A;  1EFR A;  5CDF A;  4PSX A;  1W0K A;  2VKH A;  4JQF A;  1LVK A;  3OYM A;  2NTP A;  3QYE A;  5HKK A;  3SZG A;  2HDW A;  1VLY A;  3SEQ A;  1X1C A;  2NT9 A;  4KKS A;  1YE9 A;  3DWL E;  4XN0 A;  3S8P A;  4BEH B;  3OYB A;  5TGT A;  1SAU A;  3IUO A;  1NHC A;  1K5C A;  3KX2 A;  3OMY A;  3GQ7 A;  3HAG A;  4E7J A;  1OOC A;  1O8F A;  2Z16 A;  1W36 C;  4G6I A;  1OGM X;  1WJB A;  1Z21 A;  2KVO A;  4PFP A;  3BCD A;  2WY7 Q;  1EA3 A;  5KCM A;  2NZM A;  1NG6 A;  2UVF A;  5HVQ C;  3K70 D;  4RLF A;  4YEJ A;  1MAB A;  4ZTF A;  2NST A;  4HIZ A;  4HNT A;  3D5S C;  4OAY A;  4F3Q A;  3PL8 A;  2QKL B;  2HVQ A;  4XLF A;  3VST A;  2V4D A;  1NG7 A;  4BJ5 C;  2KZV A;  2HVS A;  4RLQ A;  2A5W A;  2V7F A;  4JMQ A;  2KDO A;  4D9J A;  2VJ5 A;  3T51 B;  2VB6 A;  3VYS B;  4AU7 A;  3C2H A;  3UR3 C;  3QOD A;  1D0Y A;  1O8D A;  2F5V A;  5CKT A;  3K10 A;  4XLC A;  2CW8 A;  2DT7 B;  2LOO A;  3HKZ A;  3VMW A;  3MKY B;  4IKF A;  5FRM A;  2CUZ A;  2WPD A;  1AIR A;  2RNG A;  4L8J A;  2OUM A;  4X0G A;  3OYL A;  1O8I A;  3GQ8 A;  2VLA A;  2R4G A;  2IGN A;  3K70 C;  1MMA A;  4I84 A;  3AKZ A;  2KQR A;  1UD8 A;  3EUA A;  2O1D A;  1NBM A;  3DU6 A;  1X19 A;  2X1E A;  2O0V A;  3ZR8 X;  2ZSH B;  4RM2 A;  4LIT A;  3HC7 A;  1W36 D;  2ZSI B;  4MLO A;  3VR6 A;  3D5R C;  2ZXI A;  2X6Y A;  2O0W A;  3EQN A;  3E0J B;  3RPU D;  1NRK A;  4BE2 A;  4HST A;  3K6G A;  4ANJ A;  4DBQ A;  1QCX A;  1J09 A;  3ZCO A;  5KHD A;  3SYT A;  2K9M A;  1PJR A;  1PYV A;  3DKY A;  4F91 B;  2X1C A;  3C2G A;  4HEA 2;  4QPO A;  3DTK A;  3SDB A;  2R7U A;  3D5L A;  2Z1D A;  4F93 B;  1EE6 A;  2CV0 A;  1WJA A;  3H5N A;  2QE7 A;  2XND A;  1KCD A;  2VBE A;  1QHG A;  2WAF A;  4E7K A;  3SEZ A;  4OAZ A;  4BJT A;  4C30 A;  1GLN A;  1HZE A;  4BQN A;  1PKV A;  3OR2 C;  3VSU A;  2VJI A;  4G7W A;  3H35 A;  1BR2 A;  1X1D A;  2M7B A;  3CJR B;  4W8Q A;  4Z1M A;  4DBR A;  2R7W A;  4HPQ A;  3ZIA A;  2UUZ A;  2ELJ A;  4PJM A;  1DBG A;  2QX3 A;  4Y33 A;  1OFL A;  2M5S A;  3EPZ A;  3M1C A;  1MNE A;  2IS2 A;  1PLU A;  3A3G A;  5CQE A;  3L2Q A;  3S93 A;  2UWM A;  1D1C A;  2JIZ A;  4URR A;  4P1W A;  1IRX A;  2W4S A;  3OPO A;  2XZL A;  2HU9 A;  2JSP A;  3CJQ B;  3A35 A;  4P5O A;  3IAS 2;  1E1Q A;  5FRN A;  3JU4 A;  3CES A;  4Z05 A;  1JTA A;  2O17 A;  4Y3O A;  2VQH A;  3DPL C;  2XOK A;  4XON A;  1N77 A;  4LIV A;  2VAS A;  4B48 A;  2LYC A;  3PSF A;  1OR7 C;  2I8D A;  5JHF A;  4KKT A;  4U4B A;  3HPG A;  3CMM A;  2RRE A;  2E1B A;  3E1S A;  2E5Z A;  2KRH A;  2VJ4 A;  2GJK A;  3OAA A;  3K4K A;  3UW0 A;  3BCA A;  2DXI A;  2ZZQ A;  3CZ6 A;  3A1Y A;  4DNR B;  2ZXH A;  3ZQQ A;  2LZJ A;  1HVX A;  1X0C A;  2NSP A;  4TSF A;  3BC9 A;  3TL4 X;  5LFA A;  4EW9 A;  1CZF A;  1UD6 A;  3LSI A;  3RTR A;  1Z3Y A;  4C2T A;  4ZC3 A;  3OYE A;  2HVR A;  1PXZ A;  1UD4 A;  4BE0 A;  2W1O A;  4XOT A;  2IS6 A;  2W6I A;  3JUR A;  1LFP A;  3IAM 2;  4UZU A;  3M8J A;  4BXF A;  4U49 A;  2V31 A;  4GRI A;  1BPL A;  2GK7 A;  1SFK A;  3F9K A;  2M3A A;  1ERD A;  2PYH A;  4Y4R A;  1O8G A;  2MYS A;  3VYR B;  4ZJZ A;  3S3N A;  3EUH C;  4FET A;  2WA0 A;  4B3G A;  4IZZ A;  4DK1 A;  2Z6B D;  1WJD A;  3K4B A;  2HQA A;  4CH7 A;  3HOT A;  1UD5 A;  4BU2 A;  4BQQ A;  1X4P A;  2X51 A;  2DT6 A;  2LBF A;  1HA8 A;  3OEH A;  2IQ7 A;  4HWV A;  4BEH A;  3FKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...