2X85A

Tailspike protein of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVELHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords TAILSPIKE PROTEIN HK620
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2x85A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2x85A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2x85A02
1GQ8A 3GQ8A 4XM3A 1WMRA 2NTQA 4W8QA 3GQ7A 1OGMX 3JURA 3FY3A 1VBLA 2X6WA 5AMVA 4XN0A 2NSTA 1IDKA 4MR0A 2X85A 1XG2A 2O0WA 2X6XA 2Z8GA 3EQNA 1O88A 4OJLA 4YZ0A 4XMYA 4XL9A 4W8SA 1PXZA 1JRGA 1O8KA 2NT9A 3EQOA 2X6YA 1O8HA 2O1DA 1KCDA 2INVA 2VJIA 2QXZA 4HWVA 4XKVA 4OZZA 4XOPA 3VSUA 2NTPA 2O17A 2PYHA 3VMWA 1QJVA 1O8JA 4XLEA 3GQ9A 4W8RA 3ZPPA 1PE9A 3GRHA 1O8DA 5C1EA 1O8GA 4YEJA 1BHEA 1RWRA 1CZFA 2ODLA 1BN8A 4PMHA 1PLUA 2BSPA 1QCXA 1IDJA 1AIRA 2IQ7A 4YZAA 1KTWA 3VMVA 4XLAA 4I84A 4U4BA 2VJJA 3B4NA 3B8YA 2QY1A 1K5CA 3VSTA 2NTBA 4XLCA 4OJOA 4XONA 1OFLA 4YELA 3T9GA 4NK8A 1OOCA 1RU4A 2O0VA 1O8LA 4U49A 1IA5A 4NK6A 2PYGA 4XLFA 1EE6A 2UVFA 3GQAA 4C2LA 4XOTA 2NT6A 3SUCA 4Z06A 4W8TA 1HG8A 2QX3A 4YZQA 4URRA 1H80A 1DBGA 4XKWA 3LMWA 3B90A 1KCCA 1RMGA 4OJPA 4YZXA 4OZYA 1O8IA 4XLHA 2PECA 1IB4A 1X0CA 1NHCA 2EWEA 4XQFA 3WWGA 1O8EA 2NZMA 2X3HA 3KRGA 1OGOX 1OFMA 2INUA 4OJ5A 2NSPA 1JTAA 3UW0A 1O8MA 2UVEA 4XNFA 4XR6A 2VBKA 4XN3A 2VBEA 4MXNA 5C1CA 3ZSCA 4Z03A 3VSVA 1DBOA 4AVZA 4EW9A 1O8FA 4OJ6A 4Z05A 4XORA 2VBMA 2O04A
chains in the Genus database with same CATH superfamily
3W6KB 4KA4A 4M71A 3P9KA 3H92A 1JB9A 1W7PB 3ISPA 2HQNA 1OCPA 2F4NA 4UZUA 1X1BA 3AVTA 4W8QA 2IGMA 3BPVA 1FOWA 3J7AO 4GGGA 1UB9A 3TDUC 3TP0A 4XRSA 2UZKA 3CB4A 3OZUA 4LLGF 4BU2A 1ITYA 2XDVA 3LVBA 1OJLA 1KC8D 2HWVA 5JLVC 4RS8A 1O88A 3IC7A 3KP6A 2FEZA 4IVNA 1GUUA 3U1KA 2P3MA 2BW3A 3NARA 4MNUA 3SJMA 3MCAA 2FOKA 2RREA 2Y30A 4I76A 2B5OA 2AHQA 3PA1A 1IUYA 3FMQA 3VMFA 4LJZF 3QRFF 2GLOA 2P5KA 1T38A 2HXOA 4JMQA 3H0GJ 3JR9A 1GXPA 4Q47A 2XT2A 1J9IA 1XE1A 2I1LA 4NC7A 2IW5A 4PJ0C 3HUGB 2LF8A 3KIOA 2K9SA 2Z1DA 4AF7A 1HQCA 2QKLB 3H9NA 5FO0A 4HX7A 5C1EA 1FIPA 4UUVA 3REOA 2EILH 4ESFA 2M4KA 2J5PA 2PEXA 3BJOA 2OBSA 3GVKA 5KHDA 1A31A 5ILUA 1F43A 3BZKA 4EJVA 1O3TA 1Q7YD 3DEEA 4BH9A 1IDJA 2WYRA 4LBVA 3E5UA 3PQKA 4DW6A 3OYJA 4LIVA 2DJIA 1FYLA 3VDXA 2E71A 1MMGA 2JJ2A 4QPOA 5DCMA 1TNSA 1PJ6A 2K9MA 3GWZA 4HF2A 3DTIA 1F20A 4KICA 1QBJA 3ZBUA 1STZA 4LMYA 2MG4A 3GSIA 5DNSA 4PFOA 4H9GA 4HX4A 3SDBA 1ZGWA 1E1RA 3G6EB 4HSRA 2GXBA 3CW2A 1K73D 4MGRA 1FOYA 1FEXA 3NB2A 2EZIA 3GXOA 3RZDJ 2Q6OA 1EFCA 2JWTA 4KNYA 1P4MA 4OPVA 4PDKA 3K7AJ 2OPTA 3RKXA 1G7RA 1QA6A 2KIUA 2PMDA 1UZCA 4ZCMA 4I2OA 3LMWA 4WQMA 1YFHA 3CC2B 5HS8A 1UG2A 4BYYA 3DP7A 3CC4I 4TT3A 2DFIA 3ZQIA 4CDGA 2ADUA 3J7ZI 3VO1A 2PECA 4CA0A 4ON0A 3A8IA 5DD8A 4QHYA 3ZQGA 3MKWB 1KJZA 2LY9A 3I55B 4DBQA 1EH6A 3Q3AA 1Z0XA 1ONVA 4BEHA 4ACAA 1QUEA 4P1VA 2LK2A 3GX4X 2D2WA 1L1IA 3DPTA 1X4OA 2A3SA 4EEFG 3PIPF 3ERMA 2CG4A 4AVPA 2FMYA 3TGNA 4XR6A 4DNCA 2R7OA 3CCRI 2WA0A 1YW8A 1OB0A 2R0QC 2DYRH 4M9ZA 2I8DA 1K4TA 4A3GJ 2YWHA 2QQAA 4MEYF 1H8AC 2DT5A 2BGJA 1U5TA 2GJKA 1TLHB 3H35A 1ZN2A 1KTVA 2C4UA 3KEQA 4ZCIA 2FXAA 2EBIA 3I71A 1OGJA 4MFDA 9ANTA 1PUEE 1WJ5A 3ZQHA 3U1DA 5B3SH 5DM6F 4P9SA 3RTRA 4MQ9F 3PENA 2IS1A 3CF2A 4A3DJ 2NTQA 2E5ZA 1GVHA 1OGMX 2XZPA 4B47A 3HPHA 4NBSA 2DYSH 2HVRA 2DIEA 1MABA 3ISXA 3MZHA 1MMAA 3K4MA 1LB2A 2W25A 5C4XJ 4XLNF 4E7JA 4D1QA 4J19A 3ES9A 2VC1A 4IHWA 2CK3A 4RB3C 4BHPA 3RY8A 2XAJA 4E7IA 3LAPA 2ZKZA 4YEIA 1O8KA 2R93J 5BPDA 3JCUC 2VJ5A 5HDNA 1B9NA 1UG0A 3GW2A 3ABLH 1EWYA 3K69A 4AIJA 4N0BA 4IRIA 2F6CA 2V4JC 3A03A 3QPLA 1G3SA 1OYWA 4DIQA 2X0KA 1IAWA 3E20A 4Y33A 3BZ6A 3HYIA 4XLEA 2G7UA 3L2CA 1T6XA 1W2BB 3WTXC 2VBUA 4I0AA 2R7XA 1MBHA 1BIBA 1ZKGA 1BI3A 3IWZA 1YI2I 2GK6A 5ILSA 4HEA2 3AKZA 4BE1A 1FRNA 2M7BA 1XSDA 1SVMA 2CU7A 2V4DA 3M9AA 2R5ZB 2VXZA 2IP2A 2BY3A 2BVLA 3ZOBA 1TP4A 1HLVA 1EP1B 1QH0A 4QV2A 2R7RA 4XRSG 2DODA 4BXXJ 1WTHD 1FBUA 4RGUA 3WNBA 3BC9A 4YIRX 1BX0A 1E2XA 4RA2A 2IEKA 4NBQA 4EJUA 1JA0A 1N8RD 5A89A 1LVKA 2CUZA 2XGXA 4UZEA 1YJWI 3CCMB 1HSTA 3ZPLA 3LSIA 4MIMA 5J6XA 2IJLA 5D5VB 2BM0A 2M8EA 1VQ7I 4BJTA 3F8FA 5B1AH 2L7FP 3LSHA 5D8KB 3JRAA 4AIKA 2CUFA 3S1QJ 3I54A 4PJJA 5L3FA 1R7JA 2H6CA 3BR3A 2ZFUA 1IJWC 1XGNA 4DGWB 5J35A 5CVRA 4YFKF 2YWEA 2HQ5A 3LFUA 1K79A 4IZZA 1O8IA 2FQ4A 2O03A 1IB4A 3TO6A 1ZM9A 4RDLA 1IRXA 4U87A 2NOGA 1WJCA 2D45A 1IG7A 1P9QC 4XQFA 5E17F 1XSXA 2D1HA 2FBIA 2GXGA 1X3UA 3BTLA 3NEUA 2RNGA 3W3CA 2V7WA 1OFMA 3A3BA 1FYKA 2ZZQA 5HDKA 2OTJI 2VPRA 2IA2A 2X6OA 4DJAA 5BNGA 1DU0A 4M4SA 1ORKA 5FO1A 1IB0A 3WU1B 2BGCA 4CYDA 2EK5A 3V7SA 5L3BA 5JVTA 2K3FA 5M3FJ 4A3EJ 2PX9A 3E7LA 4LGWA 4BAYA 4HDUA 1K6YA 3HG9A 2C6YA 2DERA 2FF4A 1ZARA 3HDDA 3EUAA 1O8FA 5BSXA 2VFMA 3OIPA 2RC5A 3HAGA 4Z4VA 2BE5F 1HKSA 3H3UA 4DQ2A 1D5YA 2EIXA 1Z3YA 2PMUA 2P7CB 1JUPA 1R5ID 1N0UA 4WCGA 1S9HA 1B8IB 3TQNA 1SD7A 2O7OA 1BN5A 2WSSA 1IV6A 5CVVA 2F48A 3SEQA 1Y56A 2R92J 1VJSA 1VQPB 1ETQA 3OW2B 1YX2A 2DPDA 4XKBA 1QFYA 3CMAB 1D1NA 2A5WA 3OOUA 5EDNA 3ZGKA 2OYNA 2Z8GA 3P4GA 1MJ9A 2M8GX 2MYSA 4KN7X 1Z7UA 1UFMA 5E8GA 1QVFB 1H42A 4XRFA 5ICGA 2KP6A 3I53A 1ZQ3P 4U9UA 2X6YA 1P92A 5HZAA 4Y17A 2Q6IA 1S29A 3CJNA 2X4HA 3BH4A 2VJIA 4CCJA 3J7YJ 1MDMB 2QXZA 2JQ7A 3OYDA 4XKVA 1BMFA 4B09A 4ZCLA 1OQYA 1V55H 1ZGAA 3AL0C 2PLFA 4X05A 5J1UA 2HYGD 2VASA 4M74A 3JRHA 4CH7A 2LZJA 1D2EA 5TV2A 1CNFA 1V5VA 2DAOA 5JMCB 1JA1A 3ZQ7A 1O8GA 1UD3A 2FOWA 5IOYA 3E0JB 2YWFA 1AIRA 1Y39A 3BP8A 1BBYA 2DOAA 3GFLA 4XLAA 3VB2A 2O3FA 2VJJA 2MH9A 2AQEA 4OMYA 2Y2ZA 3RQ4A 3KLNA 3WTSC 3J7AY 2HCJB 4TMTA 3W5HA 1K5CA 2HPMA 2DPUA 2OAZA 3ZBTA 3LAJA 3V7AA 3RSNA 1RUOA 2PJRA 2E1NA 1MMDA 3FBIB 3VPRA 1OCTC 2CV0A 5L3GA 1SAXA 1BW6A 2VOPA 4KFCA 2BXZA 4QWQA 4A3KJ 2BZTA 5ERIA 2JDIA 1Y1VJ 5CYVA 1IXSB 1PVEA 3HSEA 1SFOJ 1GT0C 2H8RA 1N78A 2OCEA 1VQ4B 2V79A 2IVMA 1EP2B 3VO2A 5A88A 4BE0A 4FN5A 1TT5B 1U9NA 2DXIA 1RR7A 3ZC3A 1I3QJ 1AKHB 4F91B 2KVOA 3T0YA 1U78A 1QQIA 1S7OA 2LFBA 2JSPA 2IS2A 3LSJA 1SFEA 3ML6A 3K4NA 1R49A 2R7DA 1JT6A 2YX4A 3A0BC 4ENNA 1GDTA 4MYTA 1NHCA 4TMWA 1W0KA 2DT6A 4YFOA 3AK5A 2HOSA 2X3HA 5AONA 3HEFA 1YS7A 2RC4A 2WV0A 1O3SA 2R7TA 3DU5A 4KIBA 3ABKH 2QZAA 5DD4A 1KQ0A 2VT2A 2EV5A 3BH7B 3HIFA 3H5RA 2V7FA 3CUQC 1ZUNB 3VNVA 5ICCA 2CW0F 2EZKA 3K10A 1FJLA 3M8FA 1GAWA 3DQVC 1WJAA 5EJCA 4Y7NJ 3PO2J 4OJ6A 3CJTB 3OY9A 1MKMA 2DK8A 2QSHX 2XT4A 2A6TA 1FWZA 2GWRA 2NS8A 5GTHC 1QVGB 4LBZA 1AMOA 2DOFA 2HLDA 4Z4UA 1YHQB 4P2NA 3DDYA 4UXNA 1G3WA 3BROA 3F6OA 1YW7A 4ZYAA 4CCKA 1R9TJ 4IHYA 1HZEA 5DDGA 3M7GA 1IDKA 4MR0A 1TWAJ 1WJEA 2QM3A 3I58A 4RBOA 5EGOA 3WTTC 2V9PA 1B1BA 2PBIA 2X6XA 4XK4A 1D8JA 1QA1A 3R60A 3GTLJ 2XPUA 4EJWA 1AWCA 1OGIA 1RPWA 4TMZA 2MC4A 1JTXA 4ROXA 2O6GE 4HRIA 3DXJF 3FXMA 3OMYA 3Q5FA 4A2UA 2C5HA 2QVOA 1V5GA 2HDNB 2I10A 2GQQA 1EA3A 2G7HA 4W1UA 5TJJA 3RJPA 2NVXJ 1ZAOA 2YSRA 4Z4RA 4XOPA 3AVVA 4E4HA 2LY2A 1FBSA 1VHEA 3AVWA 1TQPA 4X1EA 2CRGA 5FLXK 1OHHA 3OE7A 4DOZA 3GQ9A 1MZBA 3T51B 3W2GA 1I18A 1NB0A 3I56I 4NCNA 4NHJA 2DMQA 2OTLI 3GRHA 2XF6A 2PLYA 1V0FA 2V1NA 3CCQI 2ZXIA 5FROA 4O5VA 4HNUA 3CZ6A 3BG7A 5DTDA 2V7QA 2RC6A 1MJBA 3ECOA 4IQ4A 1QCXA 4EM1A 5C44J 3RKQA 2IQ7A 2R4GA 3I1FA 4ENKA 1O7FA 1J2XA 3CC7B 3KL9A 4V2FA 2X51A 4HBLA 5D5UB 3RI4A 2L9RA 1T6SA 2P6TA 5EEAA 3FX3A 4X0CA 2O5RA 1R4MB 2DA5A 2EQRA 2LBFA 1QUFA 1UD2A 2XAGA 4KIFA 1HW1A 3FKSA 2QWWA 2LSOA 3F8BA 1BW5A 1KK3A 1T33A 4RLFA 2E1OA 3TBIA 3L09A 2ZITA 1D0XA 1XGSA 4Q48A 2D3NA 2E2JJ 1QRCA 2FNPA 2DMNA 4C2LA 4UVBA 4BY1J 2PI0A 5GP9A 4IHSA 3WY9A 2Y0SA 2ZXWH 1NB9A 4PCQA 5BS6A 4G6DA 4N3GA 1UHMA 2QDXA 2R7FA 4LBWA 4YZQA 1PP7U 1BOAA 1WZ2A 3GTGJ 2ZBUA 5IT9K 3ASSA 3RQIA 3LSRA 1OYIA 4MYUA 2E19A 1K83J 1BIAA 2V9KA 1S7EA 1DDNA 3CCJB 4OZYA 4YZXA 4GFBA 5HLGA 1YITI 4PGHA 1UD4A 2M34A 4K2EA 1W0TA 2IBDA 3CRZA 1VFCA 2EWEA 1RI7A 3LSKA 3HOZJ 1A6QA 3WWGA 5DS9A 2Y9ZA 1IRZA 3JSPA 2ZJPF 5LHHA 1M1KD 2L3DA 4B3XA 4LC0A 3RYPA 4U7DA 2B7BA 1O8MA 4A3IJ 1YTYA 3HOVJ 3HOTA 3H9GA 3NAUA 4A5NA 3S3OA 3CUQB 1WDTA 1U5TB 5TGTA 3L2QA 1BR4A 1YJNI 4GDFA 4Z4YA 3BCBA 3S17J 2YUHA 4L9NA 2XTXA 2OZ6A 5THXA 3OYNA 2MBFA 1I1SA 1JKOC 5LHIA 2WZPP 4CCLA 4RB1A 1QX4A 4EM0B 4OIOF 1E3XA 1TYXA 3CPWB 2VKDA 3MN2A 2ZZFA 1W7PA 2LVSA 4BEHB 1VTNC 4N4NB 1CGPA 2QGGA 3R6SA 3QE2A 1QQ1A 4UB6C 2R7SA 3W2FA 4LB6B 1J59A 3DTKA 4RAGA 1KZHA 3OYMA 1YRNA 2NSTA 2AHOA 3SYJA 1BC7C 4E7ZA 2VPLA 1R5NA 4OJLA 3R4KA 5L3EA 2CV2A 3BNWA 1PXZA 4J01A 2IS6A 5FB2A 3JRFA 4RD1A 4S05A 2ZMEC 1ZTRA 3Q6QA 4JX5A 1EV7A 1COWA 1YLOA 2A5YB 1MD0A 3P9CA 2WJYA 2VQCA 4P9FA 4U88A 2G9WA 4Y13A 1PP8F 2JA2A 1HVXA 1ZH5A 3HM5A 2O17A 4RGSA 3T8TA 4EQQA 4Y4RA 3OS2A 1A8PA 1O3RA 5HZBA 2GK7A 2ME0A 3LSTA 2ISZA 1KMHA 3CCQB 1FT9A 3MEXA 1IN8A 4G9YA 2H1LA 5DCMB 5BSYA 1VQOB 2IGKA 1B2RA 1JKPC 2VNJA 3OSGA 2FBKA 3BG9A 1LDKB 3CCRB 1KU9A 2GXAA 1NRKA 3JRIA 2CMPA 3M4OJ 2GIZA 1RNLA 3HGGA 5BPIA 2JRTA 2LMDA 5JLXA 3GVLA 3PJRA 2WTEA 3KFWX 4DYQA 4UV8A 3JQPA 3SFZA 3F23A 2ELKA 4KDPA 1DQUA 1X2NA 3L2RA 4D5CA 1E43A 2QSFX 5GV8A 4OJOA 1H0MA 2DCUA 2ZTGA 3RKWA 1ODDA 2XAUA 1EJ9A 4TSFA 5KNLA 5CQEA 1LVAA 1O8LA 1UHWA 3CCMI 1MBGA 1QRYA 2HI3A 2UUZA 2FUG2 4L9TA 2X1CA 1IJFA 1FNCA 1BJAA 3HHGA 4RAFA 2CW8A 3BR2A 3LA7A 3OL4A 5CPRB 2CH0A 4IO9F 1HCRA 3FPPA 1N0VC 1GXQA 1PYVA 4HX8A 1G59A 4URRA 2CQQA 3HGYA 4PGGA 2BW3B 2VL8A 2ZXJA 3GF2A 4JX4A 3B90A 3M1CA 4HV5A 4PJLA 1LEAA 3COAC 2CWEA 1JE8A 4LLNA 1DG1G 1RMGA 3WYAA 3SDGA 2QF7A 3B8HA 3DCFA 1QGAA 3CDHA 2E2IJ 1G7TA 1X3ZB 3F21A 3LNQA 3SEJA 3I4NJ 3JREA 4NNJA 1LFPA 2DFHA 4HA8A 1D5VA 2V31A 2GPJA 5FKKA 2HDCA 3CCUB 2L9NA 2WB1N 4W8TA 3U2QA 1KD1D 2HVQA 2H27A 1UCRA 4AC9A 3K0LA 5F08A 3BTCA 1I6XA 2ZMEA 1D0ZA 1IXCA 5LLQA 4IKFA 3S2HJ 3LO8A 1XX5A 3M07A 3MKYB 4R79A 5HXBA 5FRNA 3O2PE 4DYCA 3HRUA 2VBMA 1T98A 4PZJA 3CC7I 1ZK8A 2IPQX 2LF7A 2DW4A 4RD4A 3T5XA 2OBPA 2GIVA 5B1BH 4O3MA 2X3UA 3C3WA 1GQ8A 2P5VA 3W2IA 1WPCA 1J75A 4X8IA 3VYSB 2YWGA 5D6FA 3JTHA 3CCUI 4KUMA 3V76A 2F3LA 2XGDA 2PG4A 1Z9CA 1TQIA 4R1HA 2WBMA 2K9NA 2W00A 2X1DA 1WSRA 1XN7A 1B9MA 4F55A 2XTWA 5GAEJ 3BR6A 3RDIA 1H8HA 4KKSA 2XEXA 5IYBJ 3ONYA 4M6VA 4M9XA 4QVJA 3JRCA 3FXOA 1JTYA 2QTZA 3BR1A 5ILVA 2ZB9A 4LD5A 3BC8A 2KZVA 4UB8C 3DKXA 3BJAA 1B8IA 5DV5A 4JOMA 2O6WA 3AG2H 2OU2A 1GAQA 3CD6I 4HE5A 1BM9A 2V9VA 4ZTJA 1L0OC 1OLTA 5J8FA 1OYYA 1HDPA 1ZM2A 4GRIA 2BEOA 3DBRB 2P81A 4P12A 2EZHA 4BBRJ 3CCSB 1S72B 4C9YA 1YE9A 2UXXA 1T56A 2E60A 3A01B 1Z21A 1ZHFA 2CF4A 3SQVA 3OOCA 3WGGA 5AN9A 3FDYA 4RD3A 5JHUA 1QO0D 3MMYB 4M6YA 2MH2A 4ZJZA 1FTZA 2LY1A 1IXRC 2X1EA 3MD2A 3VMVA 3GEZA 1TUIA 2CQ7A 2K5CA 4NDLA 5EEGA 3VSTA 3P27A 2XSJC 5E18F 4CQJA 3UKGA 3A8JA 1QRBA 1BHEA 3A35A 4NK8A 4WZTA 1PJ7A 5GTIC 1KZLA 2DN0A 2ZC2A 4G6QA 4ABZA 1ZM4A 4XLFA 1EE6A 1E3OC 4KN4X 5L3DA 4FX4A 2PIAA 1F36A 2M7AA 4Z06A 4A93J 2BGIA 3ML3A 1O7LA 2KKOA 1F60A 1YJNB 2VBYA 2ZCWA 2AXTC 3MZYA 1VF7A 1SKQA 3TOBA 2ZTNA 2M87A 3G3ZA 1JT0A 4EGYA 3QAHA 5EZGA 2DA7A 2C4TA 1YG2A 1HSJA 1MH4A 1U0JA 3IV5A 4YIIA 1S6LA 5FKMA 1EFRA 1ZELA 1HKTA 3OYCA 2QEXB 3WNCA 4M1KA 2LTPA 4L5EA 3R0AA 3SHFA 4FHTA 3UW0A 3OAAA 1UMKA 2UVEA 4MLOA 3HXLA 3NRVA 1FMVA 2VKVA 4Y3OA 1ZRCA 4Y52J 2HOTA 2BM6A 2WAFA 4A0XA 1E79A 4YALA 1Q81D 3WGHA 4M0LA 1YX3A 1BPLA 2Q8KA 1VQ8B 2DDAA 1SC7A 1QFJA 5HODA 3CTAA 5ED4A 4P3IA 4JQFA 1T08B 5HNHA 2W4SA 1K4SA 1WRJA 3FXQA 2HTSA 4UVCA 3N4MA 3B82A 1P2FA 3KE2A 3G4SI 2A6EF 3J81k 3EYYA 2M1BA 5IPAA 3G05A 2NXNB 2JIZA 4R71A 1IGNA 1CF7B 5JBQA 2LH9A 2M9HA 5GPCA 3E1YE 4BQQA 4H0EA 3HTUA 2DMTA 4X0GA 4FK8A 2KPMA 5BQTA 1KK2A 5IYRA 1VQ7B 3CMYA 5AMVA 4D5FA 3PL8A 1T6YA 1VNDA 2B7EA 2PMZA 3FKIJ 2LYCA 3ZMSA 2OTJB 2VE9A 2VBSA 3PQJA 1WP6A 2EZLA 4W8SA 4AYBN 3CCJI 5LRSA 2L4MA 1YX5A 3EQOA 2O1DA 3PUMA 5HKKA 4L9JA 2EFPA 5IP7J 1Z05A 1LEBA 2ETHA 5GADJ 2HOAA 3G6EI 3HKZN 2V6EA 2EV0A 1IDZA 1R4NB 1QJVA 3EUHA 1O8JA 1FSHA 4ESBA 2F5FA 2Z2SB 4HV6A 2LR8A 4PC3A 4QTRA 5EF6A 1FYMA 2K7LA 1HXDA 4TMVA 2Y0SN 4UNOA 4RM0A 2GAUA 4L0ZB 1R5OA 3GBGA 2WY7Q 4RDKA 2LDUA 4OOSA 5GAHJ 1TTTA 3L2UA 2P6SA 2IS4A 4YRVA 3GTKJ 1XCBA 2HTJA 2CC2A 5DYMA 2IXSA 3GQ7A 2QY1A 1MH3A 2EB7A 2YX7A 3QU3A 2VLAA 4OM9A 4RPBA 1RESA 4XLPF 3AFHA 1ZG1A 4HG2A 1HBXG 2L9VA 1TVCA 1U2RA 5E3LA 5J8CA 3T56B 1I50J 1QVUA 1W34A 3M1EA 1YQAA 2QQ9A 2R6HA 2ZL5A 2GZWA 4G5GA 1VQLB 1XD7A 3R6JA 2XAHA 4G1VA 3TOAA 4RAYA 5HLIA 1MGTA 2VQGA 4XKWA 4ANJA 2F2EA 2ICWG 2E1MC 1GV5A 2W84A 1SM4A 3Q0WA 3W2AA 1JNYA 4BXUA 5KAIC 2LD5A 4XLHA 3SFIA 2WJVA 4P96A 4G94A 1LLZA 3K4KA 3G4SB 3ZXSA 2M5SA 2O9LA 2J5OA 2QEXI 3KP2A 3DFGA 2NZMA 2RAEA 1WORA 3QODA 3ERED 2O8KA 2BM1A 1OGOX 3G1MA 2ZSIB 2ZO4A 4EJTA 5B5EC 4TKOB 5IYWA 1XB2A 1R58A 4BBSJ 4ZYEA 3Q0UA 1S5LC 4DK1A 3ECHA 2V1DA 2NRAC 4B4DA 4DNTB 1EKEA 3ABUA 3LWFA 4M72A 4ZC3A 2G0YA 5C1CA 5HNFA 2QMUA 5HLTA 3OYIA 1HC8A 3GTJJ 2JPCA 1HW2A 3LSGA 2XNJA 2KIMA 1RETA 4WXCA 4S0HB 3CO6C 3SJPA 3FXLA 3HRTA 2A07F 3VSLA 2BYVE 2QGUA 2QE7A 5IP6A 1KQ8A 1JGSA 5EEHA 5TRDA 2VBTA 4AF6A 4Z05A 5D5XB 3I3LA 3AVYA 5K5RA 2CQNA 2O0YA 4ZYGA 1KQSB 2CUJA 3CC4B 3CMMA 2KRCA 5DEQA 4U0VA 1FTTA 3ZP5A 3G71I 1TW2A 4C3IJ 4G7WA 2BVNA 2XAFA 2DY1A 2QA4I 1FNBA 3QFRA 1WPKA 1G3YA 3PSZA 2ID6A 2QCOA 2BN4A 3DBHB 4LK1F 1KRHA 1TYUA 1QVTA 2XKOA 1JUSA 3AG1H 3S1RJ 1R1VA 1WHUA 4PC6A 1N08A 4DYRA 2KL4A 2RVCA 3F72A 3TL4X 3OJXA 3RCOA 2CV1A 4N3NA 2DA1A 3K4LA 3S3MA 4P6YA 5DS0A 4RM3A 2ZSHB 2NT9A 5F1JA 2MW8A 2JSCA 1FNDA 1YYVA 4IHVA 1ZRDA 2VE8A 2INVA 1N05A 3MZ8A 5IYPA 4E6KG 1EFTA 3FXKA 3I64A 1EXMA 3LMMA 2O61A 4EJOA 4E7HA 2OZUA 1FRQA 1R5HA 2MA3A 3ZMUA 3OKXA 4YAOA 1Z1DA 2XASA 4DQLA 2OC6A 2VJ4A 1CQTA 4W8RA 4YG2F 1BX1A 3T8RA 3BG6A 3OSFA 4UZFA 1S3JA 1U2WA 2FD5A 1VQOI 3AVUA 1QA3A 3SZEA 1R5GA 2L02A 3ZRGA 1W9XA 3TKYA 2NYXA 1I39A 2MGQA 4N4OB 2Y31A 5H6RA 1PLUA 3CMEI 1APLC 3ONUA 2QUFA 1POGA 3QOEA 1ZG3A 3FK7A 1FC3A 4L8JA 5EG0A 3OYGA 3S93A 4MO7A 3CQZJ 4FTHA 1SMTA 1ZREA 3B8YA 2R7VA 4KKTA 3GTMJ 3LFKA 4I7HA 1LM1A 4OIPF 4IPAA 2NS0A 2RN7A 3ZMDA 4BL0B 2PJPA 1R6RA 2ZJ2A 2XGEA 4C0SA 2XPWA 4A12A 2B63J 1E1QA 1RU4A 4KITB 3QYFA 4U49A 1WXRA 3S2WA 2AQFA 2VBXA 2BHYA 2OBRA 2F4IA 3WTVC 2D9RA 1ON1A 1Z77A 1WI3A 4XOTA 1LFUP 2WAEA 1VF9A 1EH8A 2KMUA 4F3QA 1H80A 1MSFC 2CYYA 3H94A 1QHGA 4ENJA 3HOUJ 3DKYA 3G2BA 4RB2C 3DKWA 1J0RA 1RR8C 2RV8A 4II2A 1A36A 3CUQA 3P7NA 2X53S 3K6GA 1N06A 1VQ9I 3Q39A 2F4MB 1DARA 1X58A 2YPRA 1YIJI 1OISA 4ESJA 2VIXA 1K78B 3JQQA 2GJRA 2EPFA 1O8EA 1F5TA 2OA4A 3R0JA 4BXFA 4YIFA 2E1MB 4U0WA 3U6BA 5H2FC 2QZ8A 4NC6A 2HKXA 4OWRB 3ZN1A 2P7VB 1W0UA 2W7NA 3SQNA 3I9V2 4YDTA 2VONA 5ICFA 4CGZA 4L5JA 1QGZA 2CFXA 3VR6A 1FNNA 3WHBA 4RB0A 1U9OA 2QYUA 1BOBA 1OCOH 2LLKA 1W7PD 4M3EA 3GZ6A 2DU9A 3PNVA 5CKTA 2Z9OA 4WXHA 3PM1A 1XB4A 2DO7A 4OMZA 2H1KA 2Y69H 3DU6A 3L2WA 2CSOA 2DOEA 2E35A 2IA1A 4FT8A 3CD6B 2MD0A 1SANA 2HNHA 3GMEA 1XCVA 5E3NA 4HQEA 1T0FC 5FIUA 1QPMA 2VB6A 2EA4A 2X9DA 2X85A 5KSWB 2O0WA 1Z7LA 4BPRA 3FISA 4LB5A 3BOQA 1NK3P 3N6ZA 4X7EA 2WZNA 4WF2A 1HF0A 3FIWA 1OR7A 4BDYA 3D5SC 4V2GA 3KP7A 3HOYJ 2KISA 1CQXA 1JRGA 2CW7A 1SMYF 2VC0A 3QWLA 3HSRA 1CLWA 1K28D 2PN6A 1MNEA 1Y8QB 1TWGJ 2EA2A 3KYDB 3WHCA 4KMUX 4Z4SA 3GZNB 5IYNA 4K1XA 2NV4A 1ACIA 1IRGA 2IT0A 4KKUA 4JBAA 3OS0A 1BI0A 3PA2A 4D0PA 1ZGJA 2M3AA 1G7SA 3WBJA 2KDZA 1P4AA 4FE7A 3HKZA 4P9UA 1ZYRF 2QQ8A 3K2ZA 1FPQA 4RCYA 4TMXA 2D74A 1R36A 3TW6A 1DUXC 3GZ5A 3I4PA 1Y0YA 2IRFG 5FRMA 4PC2A 3VFZA 1W5CC 3IUOA 2NPFA 2BBYA 2DDBA 3D26A 3C18A 5IYQA 2STWA 3SY2A 2BY0A 4RLQA 2KIFA 3C1DA 4XLCA 5TY0A 5IOZA 1JHHA 3MVPA 1T39A 1TLLA 1E3ZA 2BMWA 4QSHA 2BX6A 3CJQB 3FHZA 1A5JA 3ZCOA 2J8IA 1IA5A 4IOAF 1BJKA 5FD6A 2EJRA 3OEHA 3CCEB 3H36A 1BC8C 5E79C 1O4XA 3BY1A 3OZWA 4OAYA 2HOEA 1HG8A 3BWGA 4OU0A 3RIQA 3FHNA 2A69F 2DTRA 4PJNA 3X2QH 4O6JA 5EMNA 5F4MA 1VQ5B 2PQ8A 3OOPA 5IY5H 3GIRA 3JRGA 5JLWA 5AIQA 4AM3A 4A0YA 3AG4H 4CCMA 3ZPNA 1YJ9B 4PJMA 1FP1D 4MTEA 1WWXA 3S15J 2LKPA 2DA3A 4HAMA 2VFQA 3PETA 3PO3J 4I01A 5DCFA 2K02A 2GJPA 1RKWA 3S16J 2WR8A 4RD0A 2GA2A 3HJEA 5CJ9A 1MNMC 4DNRB 4XNFA 3W2HA 1S7AA 3HSFA 2D1VA 2DQRA 2I5UA 3P5JA 3AAFA 5FKLA 4HNTA 1AA7A 1SFXA 3ZMTA 5ICEA 1FOXA 3H1CA 5LGUA 3K1MA 1FBQA 2F4OB 3SLDA 3Q9VA 1HKQA 4EW9A 1G2HA 1MBJA 2RQPA 4G6IA 4M3DA 3MKLA 2W1OA 2STTA 3HL2A 5FNZA 1QNTA 3BR0A 5DSZA 3IH2A 2XRLA 5FGMA 6PAXA 1K8FA 2Q1ZB 4B3GA 3JURA 5J47A 3IKTA 2EH3A 3KPHA 5HS9A 1UD6A 2ZL7A 2BV3A 4RLZA 4AIDA 1WSVA 3LYCA 2WADA 5J4YA 4A6DA 1WGXA 2A61A 5LMZA 2ZNYA 1WJDA 2NS7A 1D1AA 4E7LA 4HF1A 1GO2A 1U3EM 1MMNA 1JUMA 3V8KA 1QGPA 3MKZA 1S8NA 4YC5A 2K85A 5FKOA 4OOVA 1KCDA 4X06A 2B7CA 4G7XA 2Z6BD 4X07A 1IDYA 2E36A 3ZMVA 4XICA 1LPQA 4B3FX 5IT3A 3OP1A 4IF4A 4KT6A 5CLSA 3U21A 3WBKA 3JAMZ 3FPKA 1VQNB 1H85A 5F1RA 4OIQF 4HDVA 1IJEA 4P6VF 5K5QA 2CQKA 1AHDP 4CZCA 2XOKA 2ZZGA 3Q0VA 2ZJQF 1K6OA 2DETA 1P7IA 4OPOA 4P1WA 4C3JJ 1IO2A 3IH3A 2W57A 2JA8J 3GUDA 1OFEA 3DU1X 4PUSA 3SZTA 1K8AD 4S04A 3WE3A 4PMHA 5LGNA 3KX2A 1VQ4I 3GCMA 2OK8A 2W82A 2W6IA 5D6EA 4U4BA 3B4NA 4PC7A 5KW9A 4AUXA 1FNMA 2M2EA 3C2BA 4ZYDA 3OR2C 5F4JA 1WH7A 1X19A 4E7SA 4P3YA 1QZZA 4GXOA 1IRFA 3A1PA 4DBRA 3OPOA 1OFLA 3I59B 1VHOA 3RKYA 3HOXJ 1TW3A 2VNIA 3CXCB 3SXYA 3QOPA 1LE8A 1VQ6B 3D0SA 4I02A 1V5FA 2LREA 5M5YJ 4I0BA 3GFIA 3S1NJ 4M3BA 4EVIA 1TZLA 2VFPA 3TDZC 3DTEA 2QBYA 4B3AA 1RQPA 3GTPJ 2QX3A 1RQRA 2J7KA 2BHZA 2HQRA 1JJ8C 2PE3A 1Q1VA 3ZQFA 4A3FJ 1ZR4A 4KYWA 5IT9Z 4YHBA 2EFOA 1LUJB 1MW7A 4P55A 5FFXA 5J3OA 2K86A 3QQAA 1KCCA 3LA3A 4WXDA 4FASD 3CLOA 3H9JA 1I8DA 2DYIA 1ULYA 3HPGA 3CCLI 3CCVI 1WOPA 1XQBA 1G6NA 5EG0B 2XUBA 3PUFA 5F0HA 3KETA 1VLOA 1H89C 4FCYA 3IAM2 3IWFA 3I55I 4H4KC 2OBTA 4B8XA 1T95A 4MEXF 2M30A 3CDIA 3I5UA 2R7ZJ 1LDJA 1T0FA 5GPAA 1ETWA 3OYAA 1JTAA 3TH0A 1VQKB 1Q1HA 1Y0RA 3VYTB 3GTQJ 3S8PA 2WB1A 1SAUA 4HSTA 5F04A 5J1YA 3S3NA 1YRNB 1WJBA 1DABA 3BDDA 3AG3H 3OYKA 2XGCA 4IXAA 5FFZA 4AD9A 4HF0A 2DT7B 4BACA 3HHHA 2JVGA 2RQQA 2WY8Q 1A6IA 2ME6A 5K7FA 1SFKA 1B23P 2J8KA 1U8RA 2F5VA 4GYIA 4LLLA 1QZYA 4CXFA 3DPUA 3O8GA 4Y15A 5D8LB 4NC8A 4C2MJ 2QBYB 2Q2EB 3EUKL 1VQNI 2ZJRF 3IH4A 1TQMA 2X6WA 2GBYA 3QYEA 1WFXA 2P4WA 1BLIA 5IYDJ 3GYHX 3T53B 2RNJA 1WCMJ 1R5BA 2L54A 4BE2A 4PSXA 3SLNA 1FIAA 2K9QA 4KT5C 4G1BA 5LFAA 1FP2A 4M2LA 4YZ0A 5JI6A 4OAZA 5CVUA 1NK2P 2OK7A 2NVQJ 3VOEA 3KCCA 3ZQCA 4P22A 1XG1A 3CCLB 1VQ9B 3JX8A 3Q3SA 1L3LA 2DOGA 3M8EA 3MFKA 5E3MA 3TEDA 4CICA 5A8AA 3NAWA 3K70D 2VKHA 2DMUA 2PMHA 4HYEA 1XDSA 3B02A 3WG9A 4AIHA 4HPQA 1H8EA 1W87A 2GQFA 3S2DJ 3M8JA 4D9JA 1KONA 2UV1A 3IRQA 1GV2A 5DM7F 2MLKA 1KA8A 4PGOA 3U6KA 3BH6B 1VZ0A 1CZFA 1QGYA 1QZEA 1Y8RB 2K40A 4I98B 1BN8A 1OCRH 4XIDA 2Y48A 4ASUA 4YZAA 3EDPA 1ETKA 5F0FA 2G0EA 4P5OA 4LIUA 2RGVA 1H9TA 1AU7A 2C77A 1DGRM 2CFOA 2NVYJ 1UD8A 3V7RA 2ZFWA 1RUNA 3WNDA 1W1WE 2DCEA 1P4WA 2Z16A 1K61A 1C0WA 5L46A 1SD6A 2JT1A 1BA5A 2OQGA 4LBYA 1UELB 2R7WA 3HUGA 3QPTA 4YELA 2XHKA 1VQ6I 3SYTA 5H5JA 3JAMK 1XMXA 2BXYA 1B59A 4XSXF 1EH7A 1EP3B 1T5EA 5KVRA 4F7DA 4NK6A 1OFCX 3K70C 3Q6RA 3TW7A 4D7NA 1HF2A 1ZRFA 2VFOA 4N9IA 4CYCB 3WU2C 5KAFC 3KYLA 3LQEA 3WTZA 2VI6A 1TWFJ 1DP3A 4ZDOA 3CPXA 3FMRA 2K3PA 2K9LA 1FOKA 1DBGA 3S32A 2QN6A 2JA5J 5FL7A 2CO5A 2HYFA 4P26A 3ONQA 2V26A 1AOYA 2JZYA 1MBKA 4BS9A 3H5AA 1W5SA 5H59A 5FLXZ 2VBZA 5HLHA 4HQMA 2WV1A 4B43A 3QPHA 4OP7A 2FVGA 3BZCA 3NQOA 2KHMA 2JA6J 4IRHA 4Z4ZA 3KRGA 2FNAA 1EF4A 5K5OA 3M3YJ 4YFXF 5E1WA 4RDUA 3HTSB 3H9QA 2V1XA 4RD6A 1IN5A 1YW9A 3OV8A 3KP5A 1OFDA 3ZSCA 2V7UA 4FWTA 4I99C 4AC0A 3NE5B 3L1PA 2E1CA 1X1PA 3ASPA 5GV7A 3UR3C 2HYJA 1Y6IA 3CC2I 4DQKA 2BM4A 2QLZA 2EFNA 2R3SA 1E62A 2KFDA 1NHAA 3C2HA 3J81K 5CDFA 1D3YA 3V4GA 1MDMA 2K27A 2NNNA 3RZOJ 1YJWB 4J00A 1WOSA 4W97A 4EV0A 3OIOA 1ETOA 4FQGA 1LDDA 5J40A 2VODA 4RMNA 1P4XA 2HDDA 2XV4S 1W5TA 4XMYA 3WU0A 4WWVA 2LOOA 3D5RC 4C2UA 5AIPA 3PSFA 4Y9UA 4NQWA 4CZZA 2AS5F 1NTCA 4M73A 3ESWB 1G4DA 5E3OA 4UAJA 2HKOA 2W85A 2NAZA 4FISA 2FQ3A 3RIRA 4UUSA 1T6ZA 3FM3A 4HWVA 4BHCA 1DDIA 5BOXA 3K4JA 2XB5A 2R7UA 2XC7A 5B6IA 1SKYB 3WTYC 1ENHA 4Y7CA 1BR1A 3ZPPA 2L01A 2L7KA 2OF7A 3W5VA 5CVJA 1I3AA 2DBBA 2CRVA 2QKMB 5BMZA 3MQ0A 3W6JB 2B0RA 3H3VK 3BCFA 4JRAC 1IV8A 1ZLJA 1LNWA 2VQHA 4HW0A 3FZVA 4FXUA 1T8IA 2RDPA 3OZVA 1R23A 1QFZA 1XS9A 3PSSA 2R5YB 3ASTA 2HXIA 1MIJA 2KJCA 1VQ8I 4M53A 2R7QA 4I84A 1QHHD 2ACJA 1YITB 5C4JJ 1E17A 2HS5A 2KLOA 3KYCB 4DZPA 1Y1WJ 3QYBA 4A3CJ 2Q6LA 5M5XJ 3QFCA 4ZV4A 3OS1A 2OD5A 3ZIAA 2LKXA 2YR2A 1FSEA 2HR3A 3FF5A 2V1UA 2PJRB 1TNTA 3TP3A 5FJ8J 1UAAA 5LBQA 3W5UA 4ZTFA 3GLLA 2ZBKA 3OWTA 1XGMA 1QPIA 1V5EA 2K4BA 1WI9A 3ROUA 3CCSI 1MBFA 2YUSA 3R61A 2DLLA 4JYKA 3ASOH 3E3VA 1E64A 1B72B 4LK0F 1ELOA 4U7BA 3WG7H 3MCZA 1J9ZA 1YI2B 1J5YA 1WVRA 3K9TA 3WGIA 1FLIA 2M4GA 5D4SA 3NWSA 5F27A 4CCOA 1NH3A 4P25A 3F3XA 1K7AA 5J1RA 3SJZA 4HLXA 4CHUA 2CUEA 4KJZA 2C5BA 1X1CA 3J80Z 3A02A 5D4RA 4U0YA 3ASQA 1ETVA 2IGNA 4FE4A 1W35A 1I5ZA 4OINF 2BVMA 1R00A 1D0YA 3SZGA 4KIGA 1OCCH 4PK4A 3JTGA 1KU7A 5EYRA 1WH5A 1BI2A 1WQ2A 2V7TA 1FDRA 1K78A 5K1YA 5JR3A 4QIWN 2QYOA 3RPUA 4PC1A 1TC3C 3WTWC 3WXMA 1OB2A 1MNDA 2Z5UA 4E70A 2KRHA 2COBA 3FXJA 3KZZA 3LA2A 4I6ZA 1K9MD 2ID3A 2M5WA 3F8NA 2TRTA 4HNVA 1YIOA 4NQWB 3GQ8A 4XM3A 1IF1A 3L2VA 3N05A 4A6EA 3QFSA 1OPCA 3N97A 1WMRA 4UUSB 4JX6A 1JJ6C 2YU3A 1FMWA 3PUBA 5LHGA 1REPC 2F5EA 3F8CA 1G3TA 3JRBA 4Y9RA 4MFEA 4XN0A 2BSPA 2TCTA 2BSAA 1IW7F 3I56B 4AYBA 3EPZA 4G12A 4OPWA 4YFNF 3O6BB 3VYUB 3BTJA 3BQZA 1T2KA 3W6VA 4UY8I 3C7JA 4MQVA 4QVAA 4RD2A 3J81Z 1V4RA 3BLYA 3AL0B 2KT0A 1LQ1A 5LRRA 1O3QA 3SKBA 2GA1A 1IZ1A 1R1UA 1SD4A 3H0DA 1W0JA 2Y75A 2QA4B 2NTPA 1BQEA 1IN4A 1S72I 1XC5A 1NDHA 3GFMA 1WKMA 2HZDA 3BCAA 3I0TA 3LL7A 4G7HF 1Z3XA 4YXWA 4CCNA 5CQGA 4IW3B 2XRNA 1B72A 1OMIA 3G1LA 1WOOA 1JI8A 1Z91A 2AXLA 1VQPI 2ODLA 3TO7A 3AGPA 1F9NA 2ECBA 5E1ZB 5HOOA 2L0KA 4X7FA 1TWCJ 1U6GA 3E5XA 4OIRF 5E8IA 3IKVA 1KTWA 4IOCF 4EH1A 2LRDA 3DLAA 3S1MJ 3GVJA 5LD2C 2GOMA 3E1SA 4Z4WA 1TT0A 4XRMA 2L2OA 2FRHA 4IHTA 3B6AA 1V0EA 2L4AA 2WAQA 3BY6A 2ZL6A 1GR1A 1N07A 2KZGA 4GO1A 2XNDA 4BJ6C 3ZZTA 2W6JA 5JFRA 2VNHA 2R5ZA 2O0VA 1IN7A 1X4PA 3QSYA 2ZBVA 4Z2YA 1XFOA 5E20A 1Q82D 3GQAA 3MAJA 1LKXA 4II3A 4L0YB 3EQLF 5IYCJ 4A3MJ 5TR9A 4RCZA 1OKRA 4OPSA 1EA0A 2K4JA 2XKPA 2BV6A 1PKVA 3HRMA 4RAZA 4RJLA 4FETA 2MLGA 2LG4A 1D1BA 4UUTA 3K4CA 1PDNC 1MRZA 1S4MA 3MHPA 5E6TA 1Z67A 4A3JJ 2IOUG 2V5IA 3LQ6A 2LC2A 4OJPA 4WZEA 1XSVA 4CO8A 3W2EA 3ZZ0A 1B6AA 3VODA 2Z33A 4ACBA 3L9FA 4G8XA 2BPOA 2EFGA 2FA5A 1Y0UA 5IK2A 3VEPA 4A5MA 4IQJA 2QSGX 3O8HA 2C2WA 3BCDA 4IEJA 3PNYA 4NUBA 1YO5C 1SFUA 3D1NI 3PFYA 1GHCA 2JN9A 3A8KA 2OCCH 2JJ1A 3IAS2 4B4CA 4EATA 1VQMI 1P6RA 1KGSA 1Y0NA 2CQXA 5DUKA 1R22A 4ZH4F 4ZDPA 2PMZN 2DQLA 2VBEA 2KQRA 5JVGF 3DEWA 1BJZA 3O3KA 2EV6A 4F52A 3I4MJ 1ZM3A 4AWXB 1RKTA 3CMAI 1YOVB 4ZGNB 1DDGA 1DBOA 4AVZA 3DV8A 4F7ZA 4J0QA 3CMEB 4C3HJ 4A3BJ 2CW5A 5IP9J 4RPDA 1JHFA 2JRMA 4ZZLA 4X6AJ 2RKHA 1X2MA 3Q9SA 4QPQA 2M0MA 3HBLA 3OEEA 2DA6A 2F1MA 1IHMA 4IRGA 4BGDA 3A4CA 3QP6A 2DTZA 3AGQA 3IRRA 3PIOF 1SD5A 2XVCA 3QPSA 4M3GA 1ZLKA 3PNTA 1KK1A 3CLQA 5F0CA 3JRDA 2JUCA 4BNCA 2H6BA 2E34A 2VT3A 1VQ5I 1B4AA 2P8TA 4IJAA 2P0WA 1SVLA 2JVHA 1I7PA 1N75A 4IL6C 1M90D 3VNUA 3WE2A 2BM7A 1FX0A 4JP0A 1YS6A 3BR5A 2H09A 2VBWA 3E6MA 2ISYA 3P26A 1USSA 2DI3A 2DA4A 3K1NA 1UMQA 4TV7A 3L00A 2IA0A 2FSWA 4OZZA 2TDXA 5HVQC 2XC1A 2XF5A 3E6DA 3VMWA 3A0HC 4JK1X 2UWMA 2KRFA 3VWBA 2X8KA 1W36C 3BG3A 4EGZA 1YHQI 3FJOA 3G71B 2XIGA 2KDOA 3PFIA 3MMPA 3R6KA 2HZTA 1NBMA 5KK1A 5D5WB 4GQNA 1O8DA 4LG0A 4BKXA 3ZN0A 1RWRA 3G1OA 4UV9A 3U2RA 1E3HA 1DPUA 1UD5A 5B66C 3L7WA 3KP4A 4WZKA 4Z6YA 1CNEA 3IP4B 4G6TB 1TYWA 3A3GA 3BPXA 2EIMH 4YCQA 3E97A 2XGJA 4WK8F 3V8JA 2CBXA 1Z6TA 2Y9YA 3VSKA 4C30A 4ZDLA 2NTBA 1W4MA 3BY2A 4M9SA 2PFBA 2E7WA 4ITVA 3P9IA 2GOXB 1KU2A 1LLWA 3K1PA 3V7CA 1ZR2A 1XMKA 2EFQA 2KJBA 4BQAA 2VNKA 3RPQA 4KMFA 2PYGA 1TTYA 2UVFA 4X7CA 2L7MP 3S14J 3BTIA 4Q4ZF 1HOMA 3SUCA 3N90A 1TWHJ 2JMWA 1J09A 5M5WJ 1I6HJ 1X1DA 4GYGA 4L18B 4Q5SF 2UXNA 1TSPA 2Y0MA 1IUFA 2D5VA 4HIZA 1ETXA 3E5QA 5K7HA 3FM5A 2LBFB 4XSZF 3EETA 4F93B 1LE8B 1JKQC 3K4BA 1KQ5A 3F22A 4YAFA 3F0CA 1X0CA 2XAQA 1AKHA 3MWMA 4CSWA 1V54H 3F8MA 2B0LA 2XZOA 2OQRA 3BQYA 1USTA 2KIQA 3HOSA 3QFTA 2WAQN 1P7JA 2BY2A 4WWCA 5LEJA 4RGXA 2INUA 2FX0A 1G8XA 2MSYA 2P5LC 1VLYA 3Q38A 2NVUB 2L5QA 3HRSA 2EINH 4XN3A 1G7CA 4MXNA 2ELJA 2MABA 2VQLA 4ENMA 1DP7P 2ECCA 2DMPA 1E0EA 2FX3A 1ZG5A 3B78A 2JJ7A 2LP0A 3B6CA 3UNGC 3WQZA 1X1AA 2BOLA 2Q2EA 3OL3A 2NNYA 3LJYA 2ZZEA 3FBNB 4XORA 1E63A 4PABA 3GFJA 1D1CA 4EMSA 2CS3A 4HE6A 1MBEA 3SEZA 1IN6A 1EFUA 3DLLF 1D8KA 2E7XA 3BG5A 3QP5A 2MFZA 3CF5F 1VQMB 2MC3A 1CF7A 4Z4TA 1YIJB 2W7ZA 5H6QA 3CESA 1KK0A 5LEKA 2XTYA 1GVJA 1VBLA 2D3LA 3WODF 4HZFA 4V19K 5EGOB 4A3LJ 3ABMH 2DEUA 4IX7A 4N9HA 1XG2A 1DPRA 4LG3A 3NWTA 1VQKI 1ERDA 2ESHA 3FWEA 3JW4A 4OOXA 3CCYA 2WPDA 1O57A 3BJ6A 4BJ5C 1TL8A 3F6VA 4XL9A 3LNNA 4XD7A 2QQBA 2L9SA 3HZJA 2A05A 3KLOA 5HDGA 4YAWA 1Q86D 2DK5A 3IHUA 2LKSA 1V3FA 5FA6A 1O8HA 1JJ2B 1UHSA 5EZHA 3GO5A 2R5YA 4LG0B 2EFWA 1XDUA 2ESNA 2XF7A 5A2QZ 5KCMA 4ASNA 3OIQA 2CNDA 2Q6KA 2JTVA 3VSUA 1WU8A 2PYHA 4M3FA 3A01A 1PJ5A 4B1RA 2VFNA 3FKJA 3OYBA 2CGPA 2R9VA 1H9GA 5GAGJ 4XBFA 5LGTA 4OOIA 1U8BA 1KYWA 2VXDA 2XZLA 2W48A 3V8LA 4QLCU 3AVXA 4I09A 2HGCA 2HEOA 3QU6A 4BHBA 3PUNA 3KZIC 1SEUA 2F5DA 2HQAA 5J4VA 1LJ9A 3WTUC 3H09A 3ZQLA 2QENA 5C3EJ 2B9SA 3GTOJ 3DPLC 4CUGA 4BDZA 4PSWA 4EM2A 1BL0A 3I59A 3C2GA 2AO9A 2DFFA 5A2QK 2QTLA 2FJ1A 3B73A 5J3LA 1RIOH 5DUIA 4QFMA 3BQJA 4RDJA 1F1ZA 4D7MA 4XONA 3T9GA 2A68F 2MD5A 3G73A 4G7ZF 2VOOA 3JU4A 1RZ4A 2M0CA 4Z1MA 1XPXA 2OJED 3ELKA 2OTLB 2FU4A 4ZZDA 3GQBA 2OUMA 5HS7A 4B48A 1NG6A 3LSPA 2A6HF 2HVSA 2C78A 2NT6A 2N8GA 1VI0A 1W36D 4F92B 2HDWA 4LFUA 5F64A 4PAAA 1K4ZA 4BUPA 5FO5A 1R71A 3HOWJ 3ZUGA 2M45A 2DJNA 2OV7A 3FXUA 3W2WA 1IC8A 3KEOA 1OCZH 2LNBA 4XKCA 3V42A 1J7KA 4GCVA 3DWLE 1BR2A 5JHFA 2O8XA 2HMAA 1PJRA 3DEUA 4B44A 2DA2A 3HC7A 2CJJA 2XSDC 4X7DA 2JUGA 3EUHC 5FLVA 3ASRA 3LOCA 4KISA 2X48A 2JPBA 1WSUA 1GJRA 4A0ZA 2NSPA 3ZZUA 2IAIA 5M3MJ 2ELHA 2VBKA 3DF8A 5H20A 4HLYA 2V7VA 4Z03A 2IGOA 3VSVA 3KZYA 2E1RA 3FXRA 2XNCA 4L5IA 2BF4A 3KEYA 4Q7JB 3CCVB 3E6CC 1TYVA 2O04A 1PUFB 2EIJH 4M6XA 1KU3A 1WJFA 1XMAA 5E1XA 4NB5A 3VYRB 3PVDA 1AIPA 5L3CA 3OFNA 1FX7A 2XROA 5F4OA 4AU7A 1UJ8A 4CYCA 3EYIA 2V6CA 1XGOA 3OYFA 2FMLA 3GLXA 2E1BA 2F1LA 2WC2A 2E2HJ 1F4KA 1ON2A 2HU9A 1Q9SA 3FY3A 1PUFA 3KP3A 2V7XA 1MSEC 1S0UA 2L7ZA 2GM4A 2Z3YA 4G7OF 3A2KA 3KEWA 1YLFA 4UHTA 1FZPB 4E0FA 3EQNA 1GLNA 2YS9A 2XPVA 3D5LA 2ZXHA 4HOBA 1HA8A 2ZMEB 3LSMA 4YAUA 1I27A 4C2TA 2NOJB 1E3PA 2E5NA 2NVTJ 4BY7J 1DU6A 4DZJA 4R8HA 3OR1C 1D8TA 1EZGA 3LQQA 3FK6A 1JXSA 3FMSA 5K7ZA 5FKNA 1NJID 3HB9A 1OB5A 3T1BA 1H88C 3H3ZA 4QUZA 3CUOA 3CJRB 4BQOA 1DGWY 3BT9A 1PE9A 5CVIA 2JA7J 4LITA 4YEJA 3CDLA 3JSOA 3CCEI 3CP8A 2VZLA 2BM5A 4FX0A 1A04A 1M1EB 3IL2A 1QG0A 4PFPA 4MTDA 2FE3A 3DBLB 3SZPA 1KYZA 2HFHA 3W2VA 3ZQQA 5FLMJ 3OYHA 1GVDA 3ULQB 3OYEA 4UVAA 2Z99A 1JGGA 3ABTA 1U5TC 4LOCA 1N25A 3F9KA 3RPUD 1N77A 2EWNA 2YU9J 1HW5A 2HPIA 3OW7A 4WZLA 1RRJA 1YJ9I 5F6FA 2GREA 1XTAA 4IHXA 3H5NA 4ZGQB 1OOCA 4ZYHA 3ZR8X 1X3WB 4V02C 2Q0OA 1BI1A 2F43A 2BY1A 3RYRA 1MJAA 1NG7A 1QU3A 2FBHA 4RM2A 1VQLI 1MMSA 3LQRA 1RC9A 2X0LA 1KQ9A 3CP2A 2DFEA 4MHGA 4KH3A 2VN2A 3J80K 3JQRA 3TO9A 2COMA 2W24A 2WWYA 5DN6A 5FD5A 1FY7A 4L9VA 1I1GA 3E6BA 1HDDC 2JK3A 4C43A 3A1YA 3TMOA 2EIKH 5TISC 1ETYA 3ASNH 3U9GA 4BQNA 1HA3A 2F5CA 3OYLA 4ETSA 4RGRA 4OJ5A 1R1TA 2H94A 1JKRC 1TBXA 2XB0X 1LFBA 3ZMZA 2VKEA 4TN1A 3PSIA 3GVAA 1A35A 4DK0A 3CO7C 4E7KA 2H8WA 4WX9A 1QA2A 2JN6A 2ZNZA 3OJWA 1OR7C 1Z6RA 4A69C 2VUMJ 2VYQA 3K2AA 1SVOA 2VBVA
chains in the Genus database with same CATH topology
4CCLA 4NQWB 1E3XA 3GQ8A 4XM3A 3L2VA 3N05A 3DU6A 3L2WA 1WMRA 4UZUA 2VKDA 1X1BA 2ZZFA 4W8QA 2IGMA 1FMWA 2MD0A 4N4NB 4BEHB 3GQ7A 3PUBA 2HNHA 2R7SA 3DTKA 1T0FC 4XN0A 3OYMA 2VB6A 2NSTA 4BU2A 2X85A 2XDVA 1Z7LA 2O0WA 4AYBA 3EPZA 4E7ZA 2VPLA 1O88A 4OJLA 4BDYA 3VYUB 2CV2A 3D5SC 1PXZA 2BW3A 4J01A 2IS6A 1JRGA 2CW7A 2RREA 3BLYA 3AL0B 1COWA 1K28D 1MNEA 4JMQA 2WJYA 2VQCA 3H0DA 2JA2A 1HVXA 1W0JA 2NTPA 2O17A 4NC7A 4KKUA 4Y4RA 3OS2A 3OS0A 3HUGB 2M3AA 2GK7A 2Z1DA 2HZDA 3BCAA 3HKZA 3LL7A 2QKLB 1Z3XA 1KMHA 4CCNA 4YXWA 5CQGA 5C1EA 2IGKA 1JI8A 2M4KA 1LDKB 2ODLA 3GVKA 1NRKA 5KHDA 5HOOA 2BSPA 1IDJA 2CMPA 3DEEA 3OYJA 5FRMA 1KTWA 4LIVA 2LRDA 2DJIA 3DLAA 3GVJA 3IUOA 3GVLA 3PJRA 5LD2C 3VDXA 2GOMA 1MMGA 3E1SA 1TT0A 2JJ2A 2L2OA 4QPOA 1V0EA 2K9MA 1DQUA 3L2RA 3DTIA 4RLQA 2WAQA 4XLCA 1E43A 2XNDA 4OJOA 4BJ6C 4PFOA 3SDBA 1E1RA 2W6JA 2ZTGA 1E3ZA 2XAUA 4TSFA 4HSRA 5KNLA 3CJQB 5CQEA 3ZCOA 1O8LA 2O0VA 1IA5A 1X4PA 2UUZA 2FUG2 3GQAA 2X1CA 3OEHA 1LKXA 2CW8A 4II3A 5CPRB 3OL4A 4OAYA 2CH0A 3FPPA 1PYVA 1HG8A 1G59A 4URRA 1PKVA 3FHNA 4FETA 2BW3B 4PJNA 2LG4A 1D1BA 3K4CA 2VL8A 3LMWA 3B90A 3M1CA 4PJLA 1RMGA 2LC2A 4OJPA 4TT3A 4CCMA 3ZPNA 5IK2A 2PECA 4PJMA 4CA0A 4IQJA 4NNJA 1LFPA 3MKWB 3BCDA 4DBQA 3PNYA 4NUBA 2V31A 3PFYA 4BEHA 2GJPA 2L9NA 2JJ1A 3IAS2 4EATA 3DPTA 2HVQA 1X4OA 4DNRB 4XNFA 4ZDPA 4XR6A 2R7OA 2VBEA 2KQRA 2WA0A 1OB0A 4HNTA 4F52A 1AA7A 2I8DA 1D0ZA 4IKFA 1DBOA 3MKYB 4AVZA 4R79A 4EW9A 2GJKA 5FRNA 3H35A 4G6IA 2VBMA 2W1OA 3HL2A 1GQ8A 4QPQA 1WJ5A 2M0MA 1WPCA 3OEEA 3RTRA 2F1MA 2IS1A 3CF2A 2NTQA 2Q1ZB 4BGDA 2E5ZA 3A4CA 3VYSB 1OGMX 2XZPA 4B47A 3HPHA 4B3GA 3JURA 2HVRA 1UD6A 2DIEA 1MABA 1MMAA 2WBMA 2W00A 3PNTA 3K4MA 2WADA 2X1DA 4F55A 4E7JA 4D1QA 1H8HA 1WJDA 4KKSA 1D1AA 2P0WA 4E7LA 2CK3A 2JVHA 1N75A 4E7IA 1MMNA 3MKZA 1O8KA 1FX0A 2VJ5A 1KCDA 3BC8A 1UG0A 4G7XA 2KZVA 2Z6BD 3DKXA 4B3FX 2F6CA 2V4JC 4JOMA 4DIQA 4KT6A 3U21A 4OZZA 5HVQC 4ZTJA 1OLTA 2XF5A 4Y33A 3VMWA 2UWMA 4XLEA 2XOKA 3VWBA 4CZCA 2X8KA 1W36C 2ZZGA 4GRIA 2KDOA 2R7XA 4P1WA 1YE9A 4C9YA 1NBMA 4GQNA 1O8DA 2E60A 2GK6A 4PUSA 1RWRA 1Z21A 4HEA2 3AKZA 4BE1A 1UD5A 4PMHA 3OOCA 2M7BA 3FDYA 3KX2A 3MMYB 2V4DA 4ZJZA 2LY1A 2VXZA 3IP4B 4G6TB 2BVLA 2W82A 2X1EA 3MD2A 2W6IA 3A3GA 3VMVA 4U4BA 2R7RA 2XGJA 3B4NA 1WTHD 2K5CA 3BC9A 3VSKA 3OR2C 3VSTA 4C30A 1X19A 4ZDLA 4E7SA 2XSJC 2NTBA 1LVKA 2CUZA 4DBRA 3OPOA 1OFLA 4ITVA 2GOXB 4NK8A 1BHEA 3A35A 3LSIA 1KZLA 1V5FA 2LREA 2PYGA 4XLFA 1EE6A 2UVFA 1TZLA 3SUCA 2M7AA 3DTEA 4Z06A 4BJTA 2QX3A 3LSHA 1J09A 1X1DA 4PJJA 2ZFUA 4DGWB 1MW7A 1VF7A 2ZTNA 1KCCA 4HIZA 3LFUA 4FASD 3H9JA 2LBFB 4IZZA 1O8IA 4F93B 1I8DA 3HPGA 3K4BA 1IB4A 1IRXA 4U87A 1X0CA 1WJCA 1U0JA 1P9QC 4CSWA 4XQFA 2XZOA 3HOSA 3IAM2 1EFRA 1ZELA 4H4KC 2RNGA 3OYCA 3W3CA 1T95A 1OFMA 2INUA 3A3BA 1G8XA 3OYAA 2ZZQA 1JTAA 3UW0A 3OAAA 1VLYA 4MLOA 3HXLA 4Y3OA 1FMVA 2L5QA 3VYTB 2UVEA 4DJAA 4XN3A 3S8PA 2WB1A 4MXNA 2WAFA 1SAUA 2ELJA 2MABA 2VQLA 4HSTA 3S3NA 1E79A 1E0EA 1WJBA 1ERDA 1YX3A 3OYKA 3UNGC 1BPLA 3WQZA 1K6YA 3HG9A 1X1AA 2DT7B 2BOLA 3OL3A 3EUAA 4JQFA 2W4SA 5HNHA 2JVGA 2RQQA 2WY8Q 1O8FA 2ZZEA 3FBNB 4XORA 1SFKA 1D1CA 3OIPA 2CS3A 2F5VA 3HAGA 3G05A 2JIZA 3SEZA 1Z3YA 3DPUA 2MFZA 4NC8A 1S9HA 2LH9A 2Q2EB 3EUKL 3CESA 4BQQA 2WSSA 3SEQA 1VBLA 4X0GA 2D3LA 2KPMA 1Y56A 2X6WA 3QYEA 1WFXA 5AMVA 1VJSA 1BLIA 3PL8A 3T53B 4IX7A 2PMZA 1XG2A 2LYCA 4LG3A 3NWTA 4PSXA 4XKBA 4BE2A 2A5WA 3OOUA 2Z8GA 3ZGKA 2WPDA 1WP6A 3LNNA 4BJ5C 5LFAA 2MYSA 4XL9A 4XD7A 4W8SA 4YZ0A 2L9SA 4OAZA 2KP6A 1YX5A 4P22A 3EQOA 2X6YA 1O8HA 2O1DA 5HKKA 3BH4A 2VJIA 4CCJA 2QXZA 3K70D 2VKHA 2XF7A 3OYDA 4XKVA 5KCMA 1BMFA 3OIQA 2V6EA 3AL0C 3VSUA 2PYHA 4HPQA 1H8EA 1O8JA 1QJVA 3M8JA 2VASA 4D9JA 4CH7A 1KONA 2UV1A 3FKJA 3OYBA 2LZJA 2R9VA 2Z2SB 2XZLA 2VXDA 1O8GA 1UD3A 1VZ0A 1CZFA 2HQAA 1BN8A 3GBGA 2WY7Q 3E0JB 1AIRA 4ASUA 4YZAA 2DOAA 3L2UA 3DPLC 4P5OA 4LIUA 4XLAA 4CUGA 4YRVA 4BDZA 1DGRM 2CFOA 2VJJA 4PSWA 2IS4A 2AQEA 3C2GA 1UD8A 2IXSA 3RQ4A 2DCEA 2Z16A 2VLAA 3J7AY 2QY1A 1K5CA 2HPMA 1UELB 2R7WA 3AFHA 4XONA 3RSNA 2PJRA 4YELA 4HG2A 3T9GA 3SYTA 1MMDA 3FBIB 3JU4A 3T56B 1T5EA 4Z1MA 2CV0A 4NK6A 3GQBA 3K70C 2OUMA 4B48A 1NG6A 2JDIA 2HVSA 1N78A 2NT6A 3KYLA 1W36D 4F92B 2HDWA 4BE0A 1DP3A 4BUPA 4ZDOA 2K3PA 2K9LA 2VQGA 2DXIA 1DBGA 4XKWA 3S32A 4ANJA 2E1MC 4F91B 2OV7A 3W2WA 3W2AA 2KVOA 5FL7A 3ONQA 2V26A 2JSPA 2IS2A 4XKCA 4XLHA 3V42A 4BS9A 2WJVA 3DWLE 1BR2A 3H5AA 3K4NA 5JHFA 3K4KA 3ZXSA 2M5SA 1NHCA 1PJRA 4B43A 4B44A 2DT6A 1W0KA 3HC7A 2NZMA 2KHMA 3QODA 2X3HA 2JUGA 3EUHC 1OGOX 3KRGA 2ZSIB 4KISA 4TKOB 2NSPA 2R7TA 3DU5A 4DK1A 3H9QA 4DNTB 2VBKA 4ZC3A 5C1CA 5HNFA 3H5RA 2V7FA 5HLTA 3OYIA 3ZSCA 3LSGA 4Z03A 2IGOA 3VSVA 3NE5B 3VSLA 3K10A 3DQVC 1WJAA 3KEYA 2QE7A 4OJ6A 4Z05A 3OY9A 3I3LA 2O04A 3UR3C 1Y6IA 1WJFA 2CUJA 2A6TA 3CMMA 2KRCA 3VYRB 3C2HA 5CDFA 3OFNA 2HLDA 4AU7A 4BACA 3DDYA 4G7WA 3OYFA 2E1BA 4ZYAA 4CCKA 4J00A 1HZEA 3FY3A 2HU9A 1IDKA 4MR0A 1WJEA 3KEWA 3A2KA 2X6XA 4RMNA 4E0FA 3EQNA 1GLNA 2KL4A 3D5LA 4XMYA 2ZXHA 3TL4X 3RCOA 2MC4A 2CV1A 1HA8A 2LOOA 3K4LA 3LSMA 3S3MA 4HRIA 3D5RC 4C2UA 4RM3A 2ZSHB 3OMYA 2NT9A 4C2TA 3PSFA 2NOJB 2INVA 2E5NA 1V5GA 3OR1C 1EA3A 4E6KG 4HWVA 3LMMA 4E7HA 4XOPA 4E4HA 2LY2A 2OC6A 2VJ4A 3K4JA 1OHHA 2R7UA 4W8RA 3GQ9A 2XC7A 4DOZA 3OE7A 1SKYB 3T51B 3BG6A 1BR1A 3CJRB 4BQOA 1DGWY 1I18A 3ZPPA 2L7KA 3ZRGA 1PE9A 1W9XA 3GRHA 2XF6A 1V0FA 2QKMB 2V1NA 2ZXIA 4LITA 4YEJA 5FROA 3BG7A 3CP8A 3CZ6A 4N4OB 4HNUA 2VQHA 2V7QA 3BCFA 4FXUA 1PLUA 4IQ4A 1QCXA 3QOEA 2IQ7A 2R4GA 4L8JA 2R7QA 4I84A 1QHHD 4PFPA 3OYGA 3S93A 2X51A 3W2VA 3ZQQA 2KLOA 3OYHA 3OYEA 3QYBA 3B8YA 2R7VA 4KKTA 2O5RA 3OS1A 3F9KA 1N77A 3RPUD 2LBFA 3ZIAA 2HPIA 3OW7A 1UD2A 3FKSA 3H5NA 4BL0B 2PJRB 1OOCA 1R6RA 4RLFA 1RU4A 3ZR8X 1UAAA 1E1QA 3TBIA 4U49A 4KITB 3QYFA 1D0XA 3OWTA 2AQFA 4ZTFA 2D3NA 2F43A 2F4IA 1V5EA 1NG7A 4C2LA 4XOTA 1QU3A 2Y0SA 4W8TA 2WAEA 4RM2A 2KMUA 4YZQA 4F3QA 1H80A 4U7BA 3H94A 1QHGA 3DKYA 3CP2A 2M4GA 3G2BA 3NWSA 4CCOA 2V9KA 4YZXA 4II2A 4OZYA 2X53S 3K6GA 5DN6A 4KJZA 1UD4A 1X1CA 2EWEA 3A1YA 3LSKA 2VIXA 3TMOA 3WWGA 2GJRA 1O8EA 2IGNA 4BQNA 4BXFA 2E1MB 3OYLA 2BVMA 4B3XA 1D0YA 3SZGA 4OJ5A 4OWRB 1O8MA 4PK4A 2W7NA 3I9V2 3PSIA 3HOTA 4DK0A 3H9GA 3S3OA 3VR6A 4E7KA 5TGTA 3L2QA 1BR4A 1BOBA 1MNDA 2KRHA 1OR7C 3BCBA 5CKTA 3PNVA 3OYNA 2WZPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ8 A;  3GQ8 A;  4XM3 A;  1WMR A;  2NTQ A;  4W8Q A;  3GQ7 A;  1OGM X;  3JUR A;  3FY3 A;  1VBL A;  2X6W A;  5AMV A;  4XN0 A;  2NST A;  1IDK A;  4MR0 A;  2X85 A;  1XG2 A;  2O0W A;  2X6X A;  2Z8G A;  3EQN A;  1O88 A;  4OJL A;  4YZ0 A;  4XMY A;  4XL9 A;  4W8S A;  1PXZ A;  1JRG A;  1O8K A;  2NT9 A;  3EQO A;  2X6Y A;  1O8H A;  2O1D A;  1KCD A;  2INV A;  2VJI A;  2QXZ A;  4HWV A;  4XKV A;  4OZZ A;  4XOP A;  3VSU A;  2NTP A;  2O17 A;  2PYH A;  3VMW A;  1QJV A;  1O8J A;  4XLE A;  3GQ9 A;  4W8R A;  3ZPP A;  1PE9 A;  3GRH A;  1O8D A;  5C1E A;  1O8G A;  4YEJ A;  1BHE A;  1RWR A;  1CZF A;  2ODL A;  1BN8 A;  4PMH A;  1PLU A;  2BSP A;  1QCX A;  1IDJ A;  1AIR A;  2IQ7 A;  4YZA A;  1KTW A;  3VMV A;  4XLA A;  4I84 A;  4U4B A;  2VJJ A;  3B4N A;  3B8Y A;  2QY1 A;  1K5C A;  3VST A;  2NTB A;  4XLC A;  4OJO A;  4XON A;  1OFL A;  4YEL A;  3T9G A;  4NK8 A;  1OOC A;  1RU4 A;  2O0V A;  1O8L A;  4U49 A;  1IA5 A;  4NK6 A;  2PYG A;  4XLF A;  1EE6 A;  2UVF A;  3GQA A;  4C2L A;  4XOT A;  2NT6 A;  3SUC A;  4Z06 A;  4W8T A;  1HG8 A;  2QX3 A;  4YZQ A;  4URR A;  1H80 A;  1DBG A;  4XKW A;  3LMW A;  3B90 A;  1KCC A;  1RMG A;  4OJP A;  4YZX A;  4OZY A;  1O8I A;  4XLH A;  2PEC A;  1IB4 A;  1X0C A;  1NHC A;  2EWE A;  4XQF A;  3WWG A;  1O8E A;  2NZM A;  2X3H A;  3KRG A;  1OGO X;  1OFM A;  2INU A;  4OJ5 A;  2NSP A;  1JTA A;  3UW0 A;  1O8M A;  2UVE A;  4XNF A;  4XR6 A;  2VBK A;  4XN3 A;  2VBE A;  4MXN A;  5C1C A;  3ZSC A;  4Z03 A;  3VSV A;  1DBO A;  4AVZ A;  4EW9 A;  1O8F A;  4OJ6 A;  4Z05 A;  4XOR A;  2VBM A;  2O04 A; 
#chains in the Genus database with same CATH topology
 3W6K B;  4KA4 A;  4M71 A;  3P9K A;  3H92 A;  1JB9 A;  1W7P B;  3ISP A;  2HQN A;  1OCP A;  2F4N A;  4UZU A;  1X1B A;  3AVT A;  4W8Q A;  2IGM A;  3BPV A;  1FOW A;  3J7A O;  4GGG A;  1UB9 A;  3TDU C;  3TP0 A;  4XRS A;  2UZK A;  3CB4 A;  3OZU A;  4LLG F;  4BU2 A;  1ITY A;  2XDV A;  3LVB A;  1OJL A;  1KC8 D;  2HWV A;  5JLV C;  4RS8 A;  1O88 A;  3IC7 A;  3KP6 A;  2FEZ A;  4IVN A;  1GUU A;  3U1K A;  2P3M A;  2BW3 A;  3NAR A;  4MNU A;  3SJM A;  3MCA A;  2FOK A;  2RRE A;  2Y30 A;  4I76 A;  2B5O A;  2AHQ A;  3PA1 A;  1IUY A;  3FMQ A;  3VMF A;  4LJZ F;  3QRF F;  2GLO A;  2P5K A;  1T38 A;  2HXO A;  4JMQ A;  3H0G J;  3JR9 A;  1GXP A;  4Q47 A;  2XT2 A;  1J9I A;  1XE1 A;  2I1L A;  4NC7 A;  2IW5 A;  4PJ0 C;  3HUG B;  2LF8 A;  3KIO A;  2K9S A;  2Z1D A;  4AF7 A;  1HQC A;  2QKL B;  3H9N A;  5FO0 A;  4HX7 A;  5C1E A;  1FIP A;  4UUV A;  3REO A;  2EIL H;  4ESF A;  2M4K A;  2J5P A;  2PEX A;  3BJO A;  2OBS A;  3GVK A;  5KHD A;  1A31 A;  5ILU A;  1F43 A;  3BZK A;  4EJV A;  1O3T A;  1Q7Y D;  3DEE A;  4BH9 A;  1IDJ A;  2WYR A;  4LBV A;  3E5U A;  3PQK A;  4DW6 A;  3OYJ A;  4LIV A;  2DJI A;  1FYL A;  3VDX A;  2E71 A;  1MMG A;  2JJ2 A;  4QPO A;  5DCM A;  1TNS A;  1PJ6 A;  2K9M A;  3GWZ A;  4HF2 A;  3DTI A;  1F20 A;  4KIC A;  1QBJ A;  3ZBU A;  1STZ A;  4LMY A;  2MG4 A;  3GSI A;  5DNS A;  4PFO A;  4H9G A;  4HX4 A;  3SDB A;  1ZGW A;  1E1R A;  3G6E B;  4HSR A;  2GXB A;  3CW2 A;  1K73 D;  4MGR A;  1FOY A;  1FEX A;  3NB2 A;  2EZI A;  3GXO A;  3RZD J;  2Q6O A;  1EFC A;  2JWT A;  4KNY A;  1P4M A;  4OPV A;  4PDK A;  3K7A J;  2OPT A;  3RKX A;  1G7R A;  1QA6 A;  2KIU A;  2PMD A;  1UZC A;  4ZCM A;  4I2O A;  3LMW A;  4WQM A;  1YFH A;  3CC2 B;  5HS8 A;  1UG2 A;  4BYY A;  3DP7 A;  3CC4 I;  4TT3 A;  2DFI A;  3ZQI A;  4CDG A;  2ADU A;  3J7Z I;  3VO1 A;  2PEC A;  4CA0 A;  4ON0 A;  3A8I A;  5DD8 A;  4QHY A;  3ZQG A;  3MKW B;  1KJZ A;  2LY9 A;  3I55 B;  4DBQ A;  1EH6 A;  3Q3A A;  1Z0X A;  1ONV A;  4BEH A;  4ACA A;  1QUE A;  4P1V A;  2LK2 A;  3GX4 X;  2D2W A;  1L1I A;  3DPT A;  1X4O A;  2A3S A;  4EEF G;  3PIP F;  3ERM A;  2CG4 A;  4AVP A;  2FMY A;  3TGN A;  4XR6 A;  4DNC A;  2R7O A;  3CCR I;  2WA0 A;  1YW8 A;  1OB0 A;  2R0Q C;  2DYR H;  4M9Z A;  2I8D A;  1K4T A;  4A3G J;  2YWH A;  2QQA A;  4MEY F;  1H8A C;  2DT5 A;  2BGJ A;  1U5T A;  2GJK A;  1TLH B;  3H35 A;  1ZN2 A;  1KTV A;  2C4U A;  3KEQ A;  4ZCI A;  2FXA A;  2EBI A;  3I71 A;  1OGJ A;  4MFD A;  9ANT A;  1PUE E;  1WJ5 A;  3ZQH A;  3U1D A;  5B3S H;  5DM6 F;  4P9S A;  3RTR A;  4MQ9 F;  3PEN A;  2IS1 A;  3CF2 A;  4A3D J;  2NTQ A;  2E5Z A;  1GVH A;  1OGM X;  2XZP A;  4B47 A;  3HPH A;  4NBS A;  2DYS H;  2HVR A;  2DIE A;  1MAB A;  3ISX A;  3MZH A;  1MMA A;  3K4M A;  1LB2 A;  2W25 A;  5C4X J;  4XLN F;  4E7J A;  4D1Q A;  4J19 A;  3ES9 A;  2VC1 A;  4IHW A;  2CK3 A;  4RB3 C;  4BHP A;  3RY8 A;  2XAJ A;  4E7I A;  3LAP A;  2ZKZ A;  4YEI A;  1O8K A;  2R93 J;  5BPD A;  3JCU C;  2VJ5 A;  5HDN A;  1B9N A;  1UG0 A;  3GW2 A;  3ABL H;  1EWY A;  3K69 A;  4AIJ A;  4N0B A;  4IRI A;  2F6C A;  2V4J C;  3A03 A;  3QPL A;  1G3S A;  1OYW A;  4DIQ A;  2X0K A;  1IAW A;  3E20 A;  4Y33 A;  3BZ6 A;  3HYI A;  4XLE A;  2G7U A;  3L2C A;  1T6X A;  1W2B B;  3WTX C;  2VBU A;  4I0A A;  2R7X A;  1MBH A;  1BIB A;  1ZKG A;  1BI3 A;  3IWZ A;  1YI2 I;  2GK6 A;  5ILS A;  4HEA 2;  3AKZ A;  4BE1 A;  1FRN A;  2M7B A;  1XSD A;  1SVM A;  2CU7 A;  2V4D A;  3M9A A;  2R5Z B;  2VXZ A;  2IP2 A;  2BY3 A;  2BVL A;  3ZOB A;  1TP4 A;  1HLV A;  1EP1 B;  1QH0 A;  4QV2 A;  2R7R A;  4XRS G;  2DOD A;  4BXX J;  1WTH D;  1FBU A;  4RGU A;  3WNB A;  3BC9 A;  4YIR X;  1BX0 A;  1E2X A;  4RA2 A;  2IEK A;  4NBQ A;  4EJU A;  1JA0 A;  1N8R D;  5A89 A;  1LVK A;  2CUZ A;  2XGX A;  4UZE A;  1YJW I;  3CCM B;  1HST A;  3ZPL A;  3LSI A;  4MIM A;  5J6X A;  2IJL A;  5D5V B;  2BM0 A;  2M8E A;  1VQ7 I;  4BJT A;  3F8F A;  5B1A H;  2L7F P;  3LSH A;  5D8K B;  3JRA A;  4AIK A;  2CUF A;  3S1Q J;  3I54 A;  4PJJ A;  5L3F A;  1R7J A;  2H6C A;  3BR3 A;  2ZFU A;  1IJW C;  1XGN A;  4DGW B;  5J35 A;  5CVR A;  4YFK F;  2YWE A;  2HQ5 A;  3LFU A;  1K79 A;  4IZZ A;  1O8I A;  2FQ4 A;  2O03 A;  1IB4 A;  3TO6 A;  1ZM9 A;  4RDL A;  1IRX A;  4U87 A;  2NOG A;  1WJC A;  2D45 A;  1IG7 A;  1P9Q C;  4XQF A;  5E17 F;  1XSX A;  2D1H A;  2FBI A;  2GXG A;  1X3U A;  3BTL A;  3NEU A;  2RNG A;  3W3C A;  2V7W A;  1OFM A;  3A3B A;  1FYK A;  2ZZQ A;  5HDK A;  2OTJ I;  2VPR A;  2IA2 A;  2X6O A;  4DJA A;  5BNG A;  1DU0 A;  4M4S A;  1ORK A;  5FO1 A;  1IB0 A;  3WU1 B;  2BGC A;  4CYD A;  2EK5 A;  3V7S A;  5L3B A;  5JVT A;  2K3F A;  5M3F J;  4A3E J;  2PX9 A;  3E7L A;  4LGW A;  4BAY A;  4HDU A;  1K6Y A;  3HG9 A;  2C6Y A;  2DER A;  2FF4 A;  1ZAR A;  3HDD A;  3EUA A;  1O8F A;  5BSX A;  2VFM A;  3OIP A;  2RC5 A;  3HAG A;  4Z4V A;  2BE5 F;  1HKS A;  3H3U A;  4DQ2 A;  1D5Y A;  2EIX A;  1Z3Y A;  2PMU A;  2P7C B;  1JUP A;  1R5I D;  1N0U A;  4WCG A;  1S9H A;  1B8I B;  3TQN A;  1SD7 A;  2O7O A;  1BN5 A;  2WSS A;  1IV6 A;  5CVV A;  2F48 A;  3SEQ A;  1Y56 A;  2R92 J;  1VJS A;  1VQP B;  1ETQ A;  3OW2 B;  1YX2 A;  2DPD A;  4XKB A;  1QFY A;  3CMA B;  1D1N A;  2A5W A;  3OOU A;  5EDN A;  3ZGK A;  2OYN A;  2Z8G A;  3P4G A;  1MJ9 A;  2M8G X;  2MYS A;  4KN7 X;  1Z7U A;  1UFM A;  5E8G A;  1QVF B;  1H42 A;  4XRF A;  5ICG A;  2KP6 A;  3I53 A;  1ZQ3 P;  4U9U A;  2X6Y A;  1P92 A;  5HZA A;  4Y17 A;  2Q6I A;  1S29 A;  3CJN A;  2X4H A;  3BH4 A;  2VJI A;  4CCJ A;  3J7Y J;  1MDM B;  2QXZ A;  2JQ7 A;  3OYD A;  4XKV A;  1BMF A;  4B09 A;  4ZCL A;  1OQY A;  1V55 H;  1ZGA A;  3AL0 C;  2PLF A;  4X05 A;  5J1U A;  2HYG D;  2VAS A;  4M74 A;  3JRH A;  4CH7 A;  2LZJ A;  1D2E A;  5TV2 A;  1CNF A;  1V5V A;  2DAO A;  5JMC B;  1JA1 A;  3ZQ7 A;  1O8G A;  1UD3 A;  2FOW A;  5IOY A;  3E0J B;  2YWF A;  1AIR A;  1Y39 A;  3BP8 A;  1BBY A;  2DOA A;  3GFL A;  4XLA A;  3VB2 A;  2O3F A;  2VJJ A;  2MH9 A;  2AQE A;  4OMY A;  2Y2Z A;  3RQ4 A;  3KLN A;  3WTS C;  3J7A Y;  2HCJ B;  4TMT A;  3W5H A;  1K5C A;  2HPM A;  2DPU A;  2OAZ A;  3ZBT A;  3LAJ A;  3V7A A;  3RSN A;  1RUO A;  2PJR A;  2E1N A;  1MMD A;  3FBI B;  3VPR A;  1OCT C;  2CV0 A;  5L3G A;  1SAX A;  1BW6 A;  2VOP A;  4KFC A;  2BXZ A;  4QWQ A;  4A3K J;  2BZT A;  5ERI A;  2JDI A;  1Y1V J;  5CYV A;  1IXS B;  1PVE A;  3HSE A;  1SFO J;  1GT0 C;  2H8R A;  1N78 A;  2OCE A;  1VQ4 B;  2V79 A;  2IVM A;  1EP2 B;  3VO2 A;  5A88 A;  4BE0 A;  4FN5 A;  1TT5 B;  1U9N A;  2DXI A;  1RR7 A;  3ZC3 A;  1I3Q J;  1AKH B;  4F91 B;  2KVO A;  3T0Y A;  1U78 A;  1QQI A;  1S7O A;  2LFB A;  2JSP A;  2IS2 A;  3LSJ A;  1SFE A;  3ML6 A;  3K4N A;  1R49 A;  2R7D A;  1JT6 A;  2YX4 A;  3A0B C;  4ENN A;  1GDT A;  4MYT A;  1NHC A;  4TMW A;  1W0K A;  2DT6 A;  4YFO A;  3AK5 A;  2HOS A;  2X3H A;  5AON A;  3HEF A;  1YS7 A;  2RC4 A;  2WV0 A;  1O3S A;  2R7T A;  3DU5 A;  4KIB A;  3ABK H;  2QZA A;  5DD4 A;  1KQ0 A;  2VT2 A;  2EV5 A;  3BH7 B;  3HIF A;  3H5R A;  2V7F A;  3CUQ C;  1ZUN B;  3VNV A;  5ICC A;  2CW0 F;  2EZK A;  3K10 A;  1FJL A;  3M8F A;  1GAW A;  3DQV C;  1WJA A;  5EJC A;  4Y7N J;  3PO2 J;  4OJ6 A;  3CJT B;  3OY9 A;  1MKM A;  2DK8 A;  2QSH X;  2XT4 A;  2A6T A;  1FWZ A;  2GWR A;  2NS8 A;  5GTH C;  1QVG B;  4LBZ A;  1AMO A;  2DOF A;  2HLD A;  4Z4U A;  1YHQ B;  4P2N A;  3DDY A;  4UXN A;  1G3W A;  3BRO A;  3F6O A;  1YW7 A;  4ZYA A;  4CCK A;  1R9T J;  4IHY A;  1HZE A;  5DDG A;  3M7G A;  1IDK A;  4MR0 A;  1TWA J;  1WJE A;  2QM3 A;  3I58 A;  4RBO A;  5EGO A;  3WTT C;  2V9P A;  1B1B A;  2PBI A;  2X6X A;  4XK4 A;  1D8J A;  1QA1 A;  3R60 A;  3GTL J;  2XPU A;  4EJW A;  1AWC A;  1OGI A;  1RPW A;  4TMZ A;  2MC4 A;  1JTX A;  4ROX A;  2O6G E;  4HRI A;  3DXJ F;  3FXM A;  3OMY A;  3Q5F A;  4A2U A;  2C5H A;  2QVO A;  1V5G A;  2HDN B;  2I10 A;  2GQQ A;  1EA3 A;  2G7H A;  4W1U A;  5TJJ A;  3RJP A;  2NVX J;  1ZAO A;  2YSR A;  4Z4R A;  4XOP A;  3AVV A;  4E4H A;  2LY2 A;  1FBS A;  1VHE A;  3AVW A;  1TQP A;  4X1E A;  2CRG A;  5FLX K;  1OHH A;  3OE7 A;  4DOZ A;  3GQ9 A;  1MZB A;  3T51 B;  3W2G A;  1I18 A;  1NB0 A;  3I56 I;  4NCN A;  4NHJ A;  2DMQ A;  2OTL I;  3GRH A;  2XF6 A;  2PLY A;  1V0F A;  2V1N A;  3CCQ I;  2ZXI A;  5FRO A;  4O5V A;  4HNU A;  3CZ6 A;  3BG7 A;  5DTD A;  2V7Q A;  2RC6 A;  1MJB A;  3ECO A;  4IQ4 A;  1QCX A;  4EM1 A;  5C44 J;  3RKQ A;  2IQ7 A;  2R4G A;  3I1F A;  4ENK A;  1O7F A;  1J2X A;  3CC7 B;  3KL9 A;  4V2F A;  2X51 A;  4HBL A;  5D5U B;  3RI4 A;  2L9R A;  1T6S A;  2P6T A;  5EEA A;  3FX3 A;  4X0C A;  2O5R A;  1R4M B;  2DA5 A;  2EQR A;  2LBF A;  1QUF A;  1UD2 A;  2XAG A;  4KIF A;  1HW1 A;  3FKS A;  2QWW A;  2LSO A;  3F8B A;  1BW5 A;  1KK3 A;  1T33 A;  4RLF A;  2E1O A;  3TBI A;  3L09 A;  2ZIT A;  1D0X A;  1XGS A;  4Q48 A;  2D3N A;  2E2J J;  1QRC A;  2FNP A;  2DMN A;  4C2L A;  4UVB A;  4BY1 J;  2PI0 A;  5GP9 A;  4IHS A;  3WY9 A;  2Y0S A;  2ZXW H;  1NB9 A;  4PCQ A;  5BS6 A;  4G6D A;  4N3G A;  1UHM A;  2QDX A;  2R7F A;  4LBW A;  4YZQ A;  1PP7 U;  1BOA A;  1WZ2 A;  3GTG J;  2ZBU A;  5IT9 K;  3ASS A;  3RQI A;  3LSR A;  1OYI A;  4MYU A;  2E19 A;  1K83 J;  1BIA A;  2V9K A;  1S7E A;  1DDN A;  3CCJ B;  4OZY A;  4YZX A;  4GFB A;  5HLG A;  1YIT I;  4PGH A;  1UD4 A;  2M34 A;  4K2E A;  1W0T A;  2IBD A;  3CRZ A;  1VFC A;  2EWE A;  1RI7 A;  3LSK A;  3HOZ J;  1A6Q A;  3WWG A;  5DS9 A;  2Y9Z A;  1IRZ A;  3JSP A;  2ZJP F;  5LHH A;  1M1K D;  2L3D A;  4B3X A;  4LC0 A;  3RYP A;  4U7D A;  2B7B A;  1O8M A;  4A3I J;  1YTY A;  3HOV J;  3HOT A;  3H9G A;  3NAU A;  4A5N A;  3S3O A;  3CUQ B;  1WDT A;  1U5T B;  5TGT A;  3L2Q A;  1BR4 A;  1YJN I;  4GDF A;  4Z4Y A;  3BCB A;  3S17 J;  2YUH A;  4L9N A;  2XTX A;  2OZ6 A;  5THX A;  3OYN A;  2MBF A;  1I1S A;  1JKO C;  5LHI A;  2WZP P;  4CCL A;  4RB1 A;  1QX4 A;  4EM0 B;  4OIO F;  1E3X A;  1TYX A;  3CPW B;  2VKD A;  3MN2 A;  2ZZF A;  1W7P A;  2LVS A;  4BEH B;  1VTN C;  4N4N B;  1CGP A;  2QGG A;  3R6S A;  3QE2 A;  1QQ1 A;  4UB6 C;  2R7S A;  3W2F A;  4LB6 B;  1J59 A;  3DTK A;  4RAG A;  1KZH A;  3OYM A;  1YRN A;  2NST A;  2AHO A;  3SYJ A;  1BC7 C;  4E7Z A;  2VPL A;  1R5N A;  4OJL A;  3R4K A;  5L3E A;  2CV2 A;  3BNW A;  1PXZ A;  4J01 A;  2IS6 A;  5FB2 A;  3JRF A;  4RD1 A;  4S05 A;  2ZME C;  1ZTR A;  3Q6Q A;  4JX5 A;  1EV7 A;  1COW A;  1YLO A;  2A5Y B;  1MD0 A;  3P9C A;  2WJY A;  2VQC A;  4P9F A;  4U88 A;  2G9W A;  4Y13 A;  1PP8 F;  2JA2 A;  1HVX A;  1ZH5 A;  3HM5 A;  2O17 A;  4RGS A;  3T8T A;  4EQQ A;  4Y4R A;  3OS2 A;  1A8P A;  1O3R A;  5HZB A;  2GK7 A;  2ME0 A;  3LST A;  2ISZ A;  1KMH A;  3CCQ B;  1FT9 A;  3MEX A;  1IN8 A;  4G9Y A;  2H1L A;  5DCM B;  5BSY A;  1VQO B;  2IGK A;  1B2R A;  1JKP C;  2VNJ A;  3OSG A;  2FBK A;  3BG9 A;  1LDK B;  3CCR B;  1KU9 A;  2GXA A;  1NRK A;  3JRI A;  2CMP A;  3M4O J;  2GIZ A;  1RNL A;  3HGG A;  5BPI A;  2JRT A;  2LMD A;  5JLX A;  3GVL A;  3PJR A;  2WTE A;  3KFW X;  4DYQ A;  4UV8 A;  3JQP A;  3SFZ A;  3F23 A;  2ELK A;  4KDP A;  1DQU A;  1X2N A;  3L2R A;  4D5C A;  1E43 A;  2QSF X;  5GV8 A;  4OJO A;  1H0M A;  2DCU A;  2ZTG A;  3RKW A;  1ODD A;  2XAU A;  1EJ9 A;  4TSF A;  5KNL A;  5CQE A;  1LVA A;  1O8L A;  1UHW A;  3CCM I;  1MBG A;  1QRY A;  2HI3 A;  2UUZ A;  2FUG 2;  4L9T A;  2X1C A;  1IJF A;  1FNC A;  1BJA A;  3HHG A;  4RAF A;  2CW8 A;  3BR2 A;  3LA7 A;  3OL4 A;  5CPR B;  2CH0 A;  4IO9 F;  1HCR A;  3FPP A;  1N0V C;  1GXQ A;  1PYV A;  4HX8 A;  1G59 A;  4URR A;  2CQQ A;  3HGY A;  4PGG A;  2BW3 B;  2VL8 A;  2ZXJ A;  3GF2 A;  4JX4 A;  3B90 A;  3M1C A;  4HV5 A;  4PJL A;  1LEA A;  3COA C;  2CWE A;  1JE8 A;  4LLN A;  1DG1 G;  1RMG A;  3WYA A;  3SDG A;  2QF7 A;  3B8H A;  3DCF A;  1QGA A;  3CDH A;  2E2I J;  1G7T A;  1X3Z B;  3F21 A;  3LNQ A;  3SEJ A;  3I4N J;  3JRE A;  4NNJ A;  1LFP A;  2DFH A;  4HA8 A;  1D5V A;  2V31 A;  2GPJ A;  5FKK A;  2HDC A;  3CCU B;  2L9N A;  2WB1 N;  4W8T A;  3U2Q A;  1KD1 D;  2HVQ A;  2H27 A;  1UCR A;  4AC9 A;  3K0L A;  5F08 A;  3BTC A;  1I6X A;  2ZME A;  1D0Z A;  1IXC A;  5LLQ A;  4IKF A;  3S2H J;  3LO8 A;  1XX5 A;  3M07 A;  3MKY B;  4R79 A;  5HXB A;  5FRN A;  3O2P E;  4DYC A;  3HRU A;  2VBM A;  1T98 A;  4PZJ A;  3CC7 I;  1ZK8 A;  2IPQ X;  2LF7 A;  2DW4 A;  4RD4 A;  3T5X A;  2OBP A;  2GIV A;  5B1B H;  4O3M A;  2X3U A;  3C3W A;  1GQ8 A;  2P5V A;  3W2I A;  1WPC A;  1J75 A;  4X8I A;  3VYS B;  2YWG A;  5D6F A;  3JTH A;  3CCU I;  4KUM A;  3V76 A;  2F3L A;  2XGD A;  2PG4 A;  1Z9C A;  1TQI A;  4R1H A;  2WBM A;  2K9N A;  2W00 A;  2X1D A;  1WSR A;  1XN7 A;  1B9M A;  4F55 A;  2XTW A;  5GAE J;  3BR6 A;  3RDI A;  1H8H A;  4KKS A;  2XEX A;  5IYB J;  3ONY A;  4M6V A;  4M9X A;  4QVJ A;  3JRC A;  3FXO A;  1JTY A;  2QTZ A;  3BR1 A;  5ILV A;  2ZB9 A;  4LD5 A;  3BC8 A;  2KZV A;  4UB8 C;  3DKX A;  3BJA A;  1B8I A;  5DV5 A;  4JOM A;  2O6W A;  3AG2 H;  2OU2 A;  1GAQ A;  3CD6 I;  4HE5 A;  1BM9 A;  2V9V A;  4ZTJ A;  1L0O C;  1OLT A;  5J8F A;  1OYY A;  1HDP A;  1ZM2 A;  4GRI A;  2BEO A;  3DBR B;  2P81 A;  4P12 A;  2EZH A;  4BBR J;  3CCS B;  1S72 B;  4C9Y A;  1YE9 A;  2UXX A;  1T56 A;  2E60 A;  3A01 B;  1Z21 A;  1ZHF A;  2CF4 A;  3SQV A;  3OOC A;  3WGG A;  5AN9 A;  3FDY A;  4RD3 A;  5JHU A;  1QO0 D;  3MMY B;  4M6Y A;  2MH2 A;  4ZJZ A;  1FTZ A;  2LY1 A;  1IXR C;  2X1E A;  3MD2 A;  3VMV A;  3GEZ A;  1TUI A;  2CQ7 A;  2K5C A;  4NDL A;  5EEG A;  3VST A;  3P27 A;  2XSJ C;  5E18 F;  4CQJ A;  3UKG A;  3A8J A;  1QRB A;  1BHE A;  3A35 A;  4NK8 A;  4WZT A;  1PJ7 A;  5GTI C;  1KZL A;  2DN0 A;  2ZC2 A;  4G6Q A;  4ABZ A;  1ZM4 A;  4XLF A;  1EE6 A;  1E3O C;  4KN4 X;  5L3D A;  4FX4 A;  2PIA A;  1F36 A;  2M7A A;  4Z06 A;  4A93 J;  2BGI A;  3ML3 A;  1O7L A;  2KKO A;  1F60 A;  1YJN B;  2VBY A;  2ZCW A;  2AXT C;  3MZY A;  1VF7 A;  1SKQ A;  3TOB A;  2ZTN A;  2M87 A;  3G3Z A;  1JT0 A;  4EGY A;  3QAH A;  5EZG A;  2DA7 A;  2C4T A;  1YG2 A;  1HSJ A;  1MH4 A;  1U0J A;  3IV5 A;  4YII A;  1S6L A;  5FKM A;  1EFR A;  1ZEL A;  1HKT A;  3OYC A;  2QEX B;  3WNC A;  4M1K A;  2LTP A;  4L5E A;  3R0A A;  3SHF A;  4FHT A;  3UW0 A;  3OAA A;  1UMK A;  2UVE A;  4MLO A;  3HXL A;  3NRV A;  1FMV A;  2VKV A;  4Y3O A;  1ZRC A;  4Y52 J;  2HOT A;  2BM6 A;  2WAF A;  4A0X A;  1E79 A;  4YAL A;  1Q81 D;  3WGH A;  4M0L A;  1YX3 A;  1BPL A;  2Q8K A;  1VQ8 B;  2DDA A;  1SC7 A;  1QFJ A;  5HOD A;  3CTA A;  5ED4 A;  4P3I A;  4JQF A;  1T08 B;  5HNH A;  2W4S A;  1K4S A;  1WRJ A;  3FXQ A;  2HTS A;  4UVC A;  3N4M A;  3B82 A;  1P2F A;  3KE2 A;  3G4S I;  2A6E F;  3J81 k;  3EYY A;  2M1B A;  5IPA A;  3G05 A;  2NXN B;  2JIZ A;  4R71 A;  1IGN A;  1CF7 B;  5JBQ A;  2LH9 A;  2M9H A;  5GPC A;  3E1Y E;  4BQQ A;  4H0E A;  3HTU A;  2DMT A;  4X0G A;  4FK8 A;  2KPM A;  5BQT A;  1KK2 A;  5IYR A;  1VQ7 B;  3CMY A;  5AMV A;  4D5F A;  3PL8 A;  1T6Y A;  1VND A;  2B7E A;  2PMZ A;  3FKI J;  2LYC A;  3ZMS A;  2OTJ B;  2VE9 A;  2VBS A;  3PQJ A;  1WP6 A;  2EZL A;  4W8S A;  4AYB N;  3CCJ I;  5LRS A;  2L4M A;  1YX5 A;  3EQO A;  2O1D A;  3PUM A;  5HKK A;  4L9J A;  2EFP A;  5IP7 J;  1Z05 A;  1LEB A;  2ETH A;  5GAD J;  2HOA A;  3G6E I;  3HKZ N;  2V6E A;  2EV0 A;  1IDZ A;  1R4N B;  1QJV A;  3EUH A;  1O8J A;  1FSH A;  4ESB A;  2F5F A;  2Z2S B;  4HV6 A;  2LR8 A;  4PC3 A;  4QTR A;  5EF6 A;  1FYM A;  2K7L A;  1HXD A;  4TMV A;  2Y0S N;  4UNO A;  4RM0 A;  2GAU A;  4L0Z B;  1R5O A;  3GBG A;  2WY7 Q;  4RDK A;  2LDU A;  4OOS A;  5GAH J;  1TTT A;  3L2U A;  2P6S A;  2IS4 A;  4YRV A;  3GTK J;  1XCB A;  2HTJ A;  2CC2 A;  5DYM A;  2IXS A;  3GQ7 A;  2QY1 A;  1MH3 A;  2EB7 A;  2YX7 A;  3QU3 A;  2VLA A;  4OM9 A;  4RPB A;  1RES A;  4XLP F;  3AFH A;  1ZG1 A;  4HG2 A;  1HBX G;  2L9V A;  1TVC A;  1U2R A;  5E3L A;  5J8C A;  3T56 B;  1I50 J;  1QVU A;  1W34 A;  3M1E A;  1YQA A;  2QQ9 A;  2R6H A;  2ZL5 A;  2GZW A;  4G5G A;  1VQL B;  1XD7 A;  3R6J A;  2XAH A;  4G1V A;  3TOA A;  4RAY A;  5HLI A;  1MGT A;  2VQG A;  4XKW A;  4ANJ A;  2F2E A;  2ICW G;  2E1M C;  1GV5 A;  2W84 A;  1SM4 A;  3Q0W A;  3W2A A;  1JNY A;  4BXU A;  5KAI C;  2LD5 A;  4XLH A;  3SFI A;  2WJV A;  4P96 A;  4G94 A;  1LLZ A;  3K4K A;  3G4S B;  3ZXS A;  2M5S A;  2O9L A;  2J5O A;  2QEX I;  3KP2 A;  3DFG A;  2NZM A;  2RAE A;  1WOR A;  3QOD A;  3ERE D;  2O8K A;  2BM1 A;  1OGO X;  3G1M A;  2ZSI B;  2ZO4 A;  4EJT A;  5B5E C;  4TKO B;  5IYW A;  1XB2 A;  1R58 A;  4BBS J;  4ZYE A;  3Q0U A;  1S5L C;  4DK1 A;  3ECH A;  2V1D A;  2NRA C;  4B4D A;  4DNT B;  1EKE A;  3ABU A;  3LWF A;  4M72 A;  4ZC3 A;  2G0Y A;  5C1C A;  5HNF A;  2QMU A;  5HLT A;  3OYI A;  1HC8 A;  3GTJ J;  2JPC A;  1HW2 A;  3LSG A;  2XNJ A;  2KIM A;  1RET A;  4WXC A;  4S0H B;  3CO6 C;  3SJP A;  3FXL A;  3HRT A;  2A07 F;  3VSL A;  2BYV E;  2QGU A;  2QE7 A;  5IP6 A;  1KQ8 A;  1JGS A;  5EEH A;  5TRD A;  2VBT A;  4AF6 A;  4Z05 A;  5D5X B;  3I3L A;  3AVY A;  5K5R A;  2CQN A;  2O0Y A;  4ZYG A;  1KQS B;  2CUJ A;  3CC4 B;  3CMM A;  2KRC A;  5DEQ A;  4U0V A;  1FTT A;  3ZP5 A;  3G71 I;  1TW2 A;  4C3I J;  4G7W A;  2BVN A;  2XAF A;  2DY1 A;  2QA4 I;  1FNB A;  3QFR A;  1WPK A;  1G3Y A;  3PSZ A;  2ID6 A;  2QCO A;  2BN4 A;  3DBH B;  4LK1 F;  1KRH A;  1TYU A;  1QVT A;  2XKO A;  1JUS A;  3AG1 H;  3S1R J;  1R1V A;  1WHU A;  4PC6 A;  1N08 A;  4DYR A;  2KL4 A;  2RVC A;  3F72 A;  3TL4 X;  3OJX A;  3RCO A;  2CV1 A;  4N3N A;  2DA1 A;  3K4L A;  3S3M A;  4P6Y A;  5DS0 A;  4RM3 A;  2ZSH B;  2NT9 A;  5F1J A;  2MW8 A;  2JSC A;  1FND A;  1YYV A;  4IHV A;  1ZRD A;  2VE8 A;  2INV A;  1N05 A;  3MZ8 A;  5IYP A;  4E6K G;  1EFT A;  3FXK A;  3I64 A;  1EXM A;  3LMM A;  2O61 A;  4EJO A;  4E7H A;  2OZU A;  1FRQ A;  1R5H A;  2MA3 A;  3ZMU A;  3OKX A;  4YAO A;  1Z1D A;  2XAS A;  4DQL A;  2OC6 A;  2VJ4 A;  1CQT A;  4W8R A;  4YG2 F;  1BX1 A;  3T8R A;  3BG6 A;  3OSF A;  4UZF A;  1S3J A;  1U2W A;  2FD5 A;  1VQO I;  3AVU A;  1QA3 A;  3SZE A;  1R5G A;  2L02 A;  3ZRG A;  1W9X A;  3TKY A;  2NYX A;  1I39 A;  2MGQ A;  4N4O B;  2Y31 A;  5H6R A;  1PLU A;  3CME I;  1APL C;  3ONU A;  2QUF A;  1POG A;  3QOE A;  1ZG3 A;  3FK7 A;  1FC3 A;  4L8J A;  5EG0 A;  3OYG A;  3S93 A;  4MO7 A;  3CQZ J;  4FTH A;  1SMT A;  1ZRE A;  3B8Y A;  2R7V A;  4KKT A;  3GTM J;  3LFK A;  4I7H A;  1LM1 A;  4OIP F;  4IPA A;  2NS0 A;  2RN7 A;  3ZMD A;  4BL0 B;  2PJP A;  1R6R A;  2ZJ2 A;  2XGE A;  4C0S A;  2XPW A;  4A12 A;  2B63 J;  1E1Q A;  1RU4 A;  4KIT B;  3QYF A;  4U49 A;  1WXR A;  3S2W A;  2AQF A;  2VBX A;  2BHY A;  2OBR A;  2F4I A;  3WTV C;  2D9R A;  1ON1 A;  1Z77 A;  1WI3 A;  4XOT A;  1LFU P;  2WAE A;  1VF9 A;  1EH8 A;  2KMU A;  4F3Q A;  1H80 A;  1MSF C;  2CYY A;  3H94 A;  1QHG A;  4ENJ A;  3HOU J;  3DKY A;  3G2B A;  4RB2 C;  3DKW A;  1J0R A;  1RR8 C;  2RV8 A;  4II2 A;  1A36 A;  3CUQ A;  3P7N A;  2X53 S;  3K6G A;  1N06 A;  1VQ9 I;  3Q39 A;  2F4M B;  1DAR A;  1X58 A;  2YPR A;  1YIJ I;  1OIS A;  4ESJ A;  2VIX A;  1K78 B;  3JQQ A;  2GJR A;  2EPF A;  1O8E A;  1F5T A;  2OA4 A;  3R0J A;  4BXF A;  4YIF A;  2E1M B;  4U0W A;  3U6B A;  5H2F C;  2QZ8 A;  4NC6 A;  2HKX A;  4OWR B;  3ZN1 A;  2P7V B;  1W0U A;  2W7N A;  3SQN A;  3I9V 2;  4YDT A;  2VON A;  5ICF A;  4CGZ A;  4L5J A;  1QGZ A;  2CFX A;  3VR6 A;  1FNN A;  3WHB A;  4RB0 A;  1U9O A;  2QYU A;  1BOB A;  1OCO H;  2LLK A;  1W7P D;  4M3E A;  3GZ6 A;  2DU9 A;  3PNV A;  5CKT A;  2Z9O A;  4WXH A;  3PM1 A;  1XB4 A;  2DO7 A;  4OMZ A;  2H1K A;  2Y69 H;  3DU6 A;  3L2W A;  2CSO A;  2DOE A;  2E35 A;  2IA1 A;  4FT8 A;  3CD6 B;  2MD0 A;  1SAN A;  2HNH A;  3GME A;  1XCV A;  5E3N A;  4HQE A;  1T0F C;  5FIU A;  1QPM A;  2VB6 A;  2EA4 A;  2X9D A;  2X85 A;  5KSW B;  2O0W A;  1Z7L A;  4BPR A;  3FIS A;  4LB5 A;  3BOQ A;  1NK3 P;  3N6Z A;  4X7E A;  2WZN A;  4WF2 A;  1HF0 A;  3FIW A;  1OR7 A;  4BDY A;  3D5S C;  4V2G A;  3KP7 A;  3HOY J;  2KIS A;  1CQX A;  1JRG A;  2CW7 A;  1SMY F;  2VC0 A;  3QWL A;  3HSR A;  1CLW A;  1K28 D;  2PN6 A;  1MNE A;  1Y8Q B;  1TWG J;  2EA2 A;  3KYD B;  3WHC A;  4KMU X;  4Z4S A;  3GZN B;  5IYN A;  4K1X A;  2NV4 A;  1ACI A;  1IRG A;  2IT0 A;  4KKU A;  4JBA A;  3OS0 A;  1BI0 A;  3PA2 A;  4D0P A;  1ZGJ A;  2M3A A;  1G7S A;  3WBJ A;  2KDZ A;  1P4A A;  4FE7 A;  3HKZ A;  4P9U A;  1ZYR F;  2QQ8 A;  3K2Z A;  1FPQ A;  4RCY A;  4TMX A;  2D74 A;  1R36 A;  3TW6 A;  1DUX C;  3GZ5 A;  3I4P A;  1Y0Y A;  2IRF G;  5FRM A;  4PC2 A;  3VFZ A;  1W5C C;  3IUO A;  2NPF A;  2BBY A;  2DDB A;  3D26 A;  3C18 A;  5IYQ A;  2STW A;  3SY2 A;  2BY0 A;  4RLQ A;  2KIF A;  3C1D A;  4XLC A;  5TY0 A;  5IOZ A;  1JHH A;  3MVP A;  1T39 A;  1TLL A;  1E3Z A;  2BMW A;  4QSH A;  2BX6 A;  3CJQ B;  3FHZ A;  1A5J A;  3ZCO A;  2J8I A;  1IA5 A;  4IOA F;  1BJK A;  5FD6 A;  2EJR A;  3OEH A;  3CCE B;  3H36 A;  1BC8 C;  5E79 C;  1O4X A;  3BY1 A;  3OZW A;  4OAY A;  2HOE A;  1HG8 A;  3BWG A;  4OU0 A;  3RIQ A;  3FHN A;  2A69 F;  2DTR A;  4PJN A;  3X2Q H;  4O6J A;  5EMN A;  5F4M A;  1VQ5 B;  2PQ8 A;  3OOP A;  5IY5 H;  3GIR A;  3JRG A;  5JLW A;  5AIQ A;  4AM3 A;  4A0Y A;  3AG4 H;  4CCM A;  3ZPN A;  1YJ9 B;  4PJM A;  1FP1 D;  4MTE A;  1WWX A;  3S15 J;  2LKP A;  2DA3 A;  4HAM A;  2VFQ A;  3PET A;  3PO3 J;  4I01 A;  5DCF A;  2K02 A;  2GJP A;  1RKW A;  3S16 J;  2WR8 A;  4RD0 A;  2GA2 A;  3HJE A;  5CJ9 A;  1MNM C;  4DNR B;  4XNF A;  3W2H A;  1S7A A;  3HSF A;  2D1V A;  2DQR A;  2I5U A;  3P5J A;  3AAF A;  5FKL A;  4HNT A;  1AA7 A;  1SFX A;  3ZMT A;  5ICE A;  1FOX A;  3H1C A;  5LGU A;  3K1M A;  1FBQ A;  2F4O B;  3SLD A;  3Q9V A;  1HKQ A;  4EW9 A;  1G2H A;  1MBJ A;  2RQP A;  4G6I A;  4M3D A;  3MKL A;  2W1O A;  2STT A;  3HL2 A;  5FNZ A;  1QNT A;  3BR0 A;  5DSZ A;  3IH2 A;  2XRL A;  5FGM A;  6PAX A;  1K8F A;  2Q1Z B;  4B3G A;  3JUR A;  5J47 A;  3IKT A;  2EH3 A;  3KPH A;  5HS9 A;  1UD6 A;  2ZL7 A;  2BV3 A;  4RLZ A;  4AID A;  1WSV A;  3LYC A;  2WAD A;  5J4Y A;  4A6D A;  1WGX A;  2A61 A;  5LMZ A;  2ZNY A;  1WJD A;  2NS7 A;  1D1A A;  4E7L A;  4HF1 A;  1GO2 A;  1U3E M;  1MMN A;  1JUM A;  3V8K A;  1QGP A;  3MKZ A;  1S8N A;  4YC5 A;  2K85 A;  5FKO A;  4OOV A;  1KCD A;  4X06 A;  2B7C A;  4G7X A;  2Z6B D;  4X07 A;  1IDY A;  2E36 A;  3ZMV A;  4XIC A;  1LPQ A;  4B3F X;  5IT3 A;  3OP1 A;  4IF4 A;  4KT6 A;  5CLS A;  3U21 A;  3WBK A;  3JAM Z;  3FPK A;  1VQN B;  1H85 A;  5F1R A;  4OIQ F;  4HDV A;  1IJE A;  4P6V F;  5K5Q A;  2CQK A;  1AHD P;  4CZC A;  2XOK A;  2ZZG A;  3Q0V A;  2ZJQ F;  1K6O A;  2DET A;  1P7I A;  4OPO A;  4P1W A;  4C3J J;  1IO2 A;  3IH3 A;  2W57 A;  2JA8 J;  3GUD A;  1OFE A;  3DU1 X;  4PUS A;  3SZT A;  1K8A D;  4S04 A;  3WE3 A;  4PMH A;  5LGN A;  3KX2 A;  1VQ4 I;  3GCM A;  2OK8 A;  2W82 A;  2W6I A;  5D6E A;  4U4B A;  3B4N A;  4PC7 A;  5KW9 A;  4AUX A;  1FNM A;  2M2E A;  3C2B A;  4ZYD A;  3OR2 C;  5F4J A;  1WH7 A;  1X19 A;  4E7S A;  4P3Y A;  1QZZ A;  4GXO A;  1IRF A;  3A1P A;  4DBR A;  3OPO A;  1OFL A;  3I59 B;  1VHO A;  3RKY A;  3HOX J;  1TW3 A;  2VNI A;  3CXC B;  3SXY A;  3QOP A;  1LE8 A;  1VQ6 B;  3D0S A;  4I02 A;  1V5F A;  2LRE A;  5M5Y J;  4I0B A;  3GFI A;  3S1N J;  4M3B A;  4EVI A;  1TZL A;  2VFP A;  3TDZ C;  3DTE A;  2QBY A;  4B3A A;  1RQP A;  3GTP J;  2QX3 A;  1RQR A;  2J7K A;  2BHZ A;  2HQR A;  1JJ8 C;  2PE3 A;  1Q1V A;  3ZQF A;  4A3F J;  1ZR4 A;  4KYW A;  5IT9 Z;  4YHB A;  2EFO A;  1LUJ B;  1MW7 A;  4P55 A;  5FFX A;  5J3O A;  2K86 A;  3QQA A;  1KCC A;  3LA3 A;  4WXD A;  4FAS D;  3CLO A;  3H9J A;  1I8D A;  2DYI A;  1ULY A;  3HPG A;  3CCL I;  3CCV I;  1WOP A;  1XQB A;  1G6N A;  5EG0 B;  2XUB A;  3PUF A;  5F0H A;  3KET A;  1VLO A;  1H89 C;  4FCY A;  3IAM 2;  3IWF A;  3I55 I;  4H4K C;  2OBT A;  4B8X A;  1T95 A;  4MEX F;  2M30 A;  3CDI A;  3I5U A;  2R7Z J;  1LDJ A;  1T0F A;  5GPA A;  1ETW A;  3OYA A;  1JTA A;  3TH0 A;  1VQK B;  1Q1H A;  1Y0R A;  3VYT B;  3GTQ J;  3S8P A;  2WB1 A;  1SAU A;  4HST A;  5F04 A;  5J1Y A;  3S3N A;  1YRN B;  1WJB A;  1DAB A;  3BDD A;  3AG3 H;  3OYK A;  2XGC A;  4IXA A;  5FFZ A;  4AD9 A;  4HF0 A;  2DT7 B;  4BAC A;  3HHH A;  2JVG A;  2RQQ A;  2WY8 Q;  1A6I A;  2ME6 A;  5K7F A;  1SFK A;  1B23 P;  2J8K A;  1U8R A;  2F5V A;  4GYI A;  4LLL A;  1QZY A;  4CXF A;  3DPU A;  3O8G A;  4Y15 A;  5D8L B;  4NC8 A;  4C2M J;  2QBY B;  2Q2E B;  3EUK L;  1VQN I;  2ZJR F;  3IH4 A;  1TQM A;  2X6W A;  2GBY A;  3QYE A;  1WFX A;  2P4W A;  1BLI A;  5IYD J;  3GYH X;  3T53 B;  2RNJ A;  1WCM J;  1R5B A;  2L54 A;  4BE2 A;  4PSX A;  3SLN A;  1FIA A;  2K9Q A;  4KT5 C;  4G1B A;  5LFA A;  1FP2 A;  4M2L A;  4YZ0 A;  5JI6 A;  4OAZ A;  5CVU A;  1NK2 P;  2OK7 A;  2NVQ J;  3VOE A;  3KCC A;  3ZQC A;  4P22 A;  1XG1 A;  3CCL B;  1VQ9 B;  3JX8 A;  3Q3S A;  1L3L A;  2DOG A;  3M8E A;  3MFK A;  5E3M A;  3TED A;  4CIC A;  5A8A A;  3NAW A;  3K70 D;  2VKH A;  2DMU A;  2PMH A;  4HYE A;  1XDS A;  3B02 A;  3WG9 A;  4AIH A;  4HPQ A;  1H8E A;  1W87 A;  2GQF A;  3S2D J;  3M8J A;  4D9J A;  1KON A;  2UV1 A;  3IRQ A;  1GV2 A;  5DM7 F;  2MLK A;  1KA8 A;  4PGO A;  3U6K A;  3BH6 B;  1VZ0 A;  1CZF A;  1QGY A;  1QZE A;  1Y8R B;  2K40 A;  4I98 B;  1BN8 A;  1OCR H;  4XID A;  2Y48 A;  4ASU A;  4YZA A;  3EDP A;  1ETK A;  5F0F A;  2G0E A;  4P5O A;  4LIU A;  2RGV A;  1H9T A;  1AU7 A;  2C77 A;  1DGR M;  2CFO A;  2NVY J;  1UD8 A;  3V7R A;  2ZFW A;  1RUN A;  3WND A;  1W1W E;  2DCE A;  1P4W A;  2Z16 A;  1K61 A;  1C0W A;  5L46 A;  1SD6 A;  2JT1 A;  1BA5 A;  2OQG A;  4LBY A;  1UEL B;  2R7W A;  3HUG A;  3QPT A;  4YEL A;  2XHK A;  1VQ6 I;  3SYT A;  5H5J A;  3JAM K;  1XMX A;  2BXY A;  1B59 A;  4XSX F;  1EH7 A;  1EP3 B;  1T5E A;  5KVR A;  4F7D A;  4NK6 A;  1OFC X;  3K70 C;  3Q6R A;  3TW7 A;  4D7N A;  1HF2 A;  1ZRF A;  2VFO A;  4N9I A;  4CYC B;  3WU2 C;  5KAF C;  3KYL A;  3LQE A;  3WTZ A;  2VI6 A;  1TWF J;  1DP3 A;  4ZDO A;  3CPX A;  3FMR A;  2K3P A;  2K9L A;  1FOK A;  1DBG A;  3S32 A;  2QN6 A;  2JA5 J;  5FL7 A;  2CO5 A;  2HYF A;  4P26 A;  3ONQ A;  2V26 A;  1AOY A;  2JZY A;  1MBK A;  4BS9 A;  3H5A A;  1W5S A;  5H59 A;  5FLX Z;  2VBZ A;  5HLH A;  4HQM A;  2WV1 A;  4B43 A;  3QPH A;  4OP7 A;  2FVG A;  3BZC A;  3NQO A;  2KHM A;  2JA6 J;  4IRH A;  4Z4Z A;  3KRG A;  2FNA A;  1EF4 A;  5K5O A;  3M3Y J;  4YFX F;  5E1W A;  4RDU A;  3HTS B;  3H9Q A;  2V1X A;  4RD6 A;  1IN5 A;  1YW9 A;  3OV8 A;  3KP5 A;  1OFD A;  3ZSC A;  2V7U A;  4FWT A;  4I99 C;  4AC0 A;  3NE5 B;  3L1P A;  2E1C A;  1X1P A;  3ASP A;  5GV7 A;  3UR3 C;  2HYJ A;  1Y6I A;  3CC2 I;  4DQK A;  2BM4 A;  2QLZ A;  2EFN A;  2R3S A;  1E62 A;  2KFD A;  1NHA A;  3C2H A;  3J81 K;  5CDF A;  1D3Y A;  3V4G A;  1MDM A;  2K27 A;  2NNN A;  3RZO J;  1YJW B;  4J00 A;  1WOS A;  4W97 A;  4EV0 A;  3OIO A;  1ETO A;  4FQG A;  1LDD A;  5J40 A;  2VOD A;  4RMN A;  1P4X A;  2HDD A;  2XV4 S;  1W5T A;  4XMY A;  3WU0 A;  4WWV A;  2LOO A;  3D5R C;  4C2U A;  5AIP A;  3PSF A;  4Y9U A;  4NQW A;  4CZZ A;  2AS5 F;  1NTC A;  4M73 A;  3ESW B;  1G4D A;  5E3O A;  4UAJ A;  2HKO A;  2W85 A;  2NAZ A;  4FIS A;  2FQ3 A;  3RIR A;  4UUS A;  1T6Z A;  3FM3 A;  4HWV A;  4BHC A;  1DDI A;  5BOX A;  3K4J A;  2XB5 A;  2R7U A;  2XC7 A;  5B6I A;  1SKY B;  3WTY C;  1ENH A;  4Y7C A;  1BR1 A;  3ZPP A;  2L01 A;  2L7K A;  2OF7 A;  3W5V A;  5CVJ A;  1I3A A;  2DBB A;  2CRV A;  2QKM B;  5BMZ A;  3MQ0 A;  3W6J B;  2B0R A;  3H3V K;  3BCF A;  4JRA C;  1IV8 A;  1ZLJ A;  1LNW A;  2VQH A;  4HW0 A;  3FZV A;  4FXU A;  1T8I A;  2RDP A;  3OZV A;  1R23 A;  1QFZ A;  1XS9 A;  3PSS A;  2R5Y B;  3AST A;  2HXI A;  1MIJ A;  2KJC A;  1VQ8 I;  4M53 A;  2R7Q A;  4I84 A;  1QHH D;  2ACJ A;  1YIT B;  5C4J J;  1E17 A;  2HS5 A;  2KLO A;  3KYC B;  4DZP A;  1Y1W J;  3QYB A;  4A3C J;  2Q6L A;  5M5X J;  3QFC A;  4ZV4 A;  3OS1 A;  2OD5 A;  3ZIA A;  2LKX A;  2YR2 A;  1FSE A;  2HR3 A;  3FF5 A;  2V1U A;  2PJR B;  1TNT A;  3TP3 A;  5FJ8 J;  1UAA A;  5LBQ A;  3W5U A;  4ZTF A;  3GLL A;  2ZBK A;  3OWT A;  1XGM A;  1QPI A;  1V5E A;  2K4B A;  1WI9 A;  3ROU A;  3CCS I;  1MBF A;  2YUS A;  3R61 A;  2DLL A;  4JYK A;  3ASO H;  3E3V A;  1E64 A;  1B72 B;  4LK0 F;  1ELO A;  4U7B A;  3WG7 H;  3MCZ A;  1J9Z A;  1YI2 B;  1J5Y A;  1WVR A;  3K9T A;  3WGI A;  1FLI A;  2M4G A;  5D4S A;  3NWS A;  5F27 A;  4CCO A;  1NH3 A;  4P25 A;  3F3X A;  1K7A A;  5J1R A;  3SJZ A;  4HLX A;  4CHU A;  2CUE A;  4KJZ A;  2C5B A;  1X1C A;  3J80 Z;  3A02 A;  5D4R A;  4U0Y A;  3ASQ A;  1ETV A;  2IGN A;  4FE4 A;  1W35 A;  1I5Z A;  4OIN F;  2BVM A;  1R00 A;  1D0Y A;  3SZG A;  4KIG A;  1OCC H;  4PK4 A;  3JTG A;  1KU7 A;  5EYR A;  1WH5 A;  1BI2 A;  1WQ2 A;  2V7T A;  1FDR A;  1K78 A;  5K1Y A;  5JR3 A;  4QIW N;  2QYO A;  3RPU A;  4PC1 A;  1TC3 C;  3WTW C;  3WXM A;  1OB2 A;  1MND A;  2Z5U A;  4E70 A;  2KRH A;  2COB A;  3FXJ A;  3KZZ A;  3LA2 A;  4I6Z A;  1K9M D;  2ID3 A;  2M5W A;  3F8N A;  2TRT A;  4HNV A;  1YIO A;  4NQW B;  3GQ8 A;  4XM3 A;  1IF1 A;  3L2V A;  3N05 A;  4A6E A;  3QFS A;  1OPC A;  3N97 A;  1WMR A;  4UUS B;  4JX6 A;  1JJ6 C;  2YU3 A;  1FMW A;  3PUB A;  5LHG A;  1REP C;  2F5E A;  3F8C A;  1G3T A;  3JRB A;  4Y9R A;  4MFE A;  4XN0 A;  2BSP A;  2TCT A;  2BSA A;  1IW7 F;  3I56 B;  4AYB A;  3EPZ A;  4G12 A;  4OPW A;  4YFN F;  3O6B B;  3VYU B;  3BTJ A;  3BQZ A;  1T2K A;  3W6V A;  4UY8 I;  3C7J A;  4MQV A;  4QVA A;  4RD2 A;  3J81 Z;  1V4R A;  3BLY A;  3AL0 B;  2KT0 A;  1LQ1 A;  5LRR A;  1O3Q A;  3SKB A;  2GA1 A;  1IZ1 A;  1R1U A;  1SD4 A;  3H0D A;  1W0J A;  2Y75 A;  2QA4 B;  2NTP A;  1BQE A;  1IN4 A;  1S72 I;  1XC5 A;  1NDH A;  3GFM A;  1WKM A;  2HZD A;  3BCA A;  3I0T A;  3LL7 A;  4G7H F;  1Z3X A;  4YXW A;  4CCN A;  5CQG A;  4IW3 B;  2XRN A;  1B72 A;  1OMI A;  3G1L A;  1WOO A;  1JI8 A;  1Z91 A;  2AXL A;  1VQP I;  2ODL A;  3TO7 A;  3AGP A;  1F9N A;  2ECB A;  5E1Z B;  5HOO A;  2L0K A;  4X7F A;  1TWC J;  1U6G A;  3E5X A;  4OIR F;  5E8I A;  3IKV A;  1KTW A;  4IOC F;  4EH1 A;  2LRD A;  3DLA A;  3S1M J;  3GVJ A;  5LD2 C;  2GOM A;  3E1S A;  4Z4W A;  1TT0 A;  4XRM A;  2L2O A;  2FRH A;  4IHT A;  3B6A A;  1V0E A;  2L4A A;  2WAQ A;  3BY6 A;  2ZL6 A;  1GR1 A;  1N07 A;  2KZG A;  4GO1 A;  2XND A;  4BJ6 C;  3ZZT A;  2W6J A;  5JFR A;  2VNH A;  2R5Z A;  2O0V A;  1IN7 A;  1X4P A;  3QSY A;  2ZBV A;  4Z2Y A;  1XFO A;  5E20 A;  1Q82 D;  3GQA A;  3MAJ A;  1LKX A;  4II3 A;  4L0Y B;  3EQL F;  5IYC J;  4A3M J;  5TR9 A;  4RCZ A;  1OKR A;  4OPS A;  1EA0 A;  2K4J A;  2XKP A;  2BV6 A;  1PKV A;  3HRM A;  4RAZ A;  4RJL A;  4FET A;  2MLG A;  2LG4 A;  1D1B A;  4UUT A;  3K4C A;  1PDN C;  1MRZ A;  1S4M A;  3MHP A;  5E6T A;  1Z67 A;  4A3J J;  2IOU G;  2V5I A;  3LQ6 A;  2LC2 A;  4OJP A;  4WZE A;  1XSV A;  4CO8 A;  3W2E A;  3ZZ0 A;  1B6A A;  3VOD A;  2Z33 A;  4ACB A;  3L9F A;  4G8X A;  2BPO A;  2EFG A;  2FA5 A;  1Y0U A;  5IK2 A;  3VEP A;  4A5M A;  4IQJ A;  2QSG X;  3O8H A;  2C2W A;  3BCD A;  4IEJ A;  3PNY A;  4NUB A;  1YO5 C;  1SFU A;  3D1N I;  3PFY A;  1GHC A;  2JN9 A;  3A8K A;  2OCC H;  2JJ1 A;  3IAS 2;  4B4C A;  4EAT A;  1VQM I;  1P6R A;  1KGS A;  1Y0N A;  2CQX A;  5DUK A;  1R22 A;  4ZH4 F;  4ZDP A;  2PMZ N;  2DQL A;  2VBE A;  2KQR A;  5JVG F;  3DEW A;  1BJZ A;  3O3K A;  2EV6 A;  4F52 A;  3I4M J;  1ZM3 A;  4AWX B;  1RKT A;  3CMA I;  1YOV B;  4ZGN B;  1DDG A;  1DBO A;  4AVZ A;  3DV8 A;  4F7Z A;  4J0Q A;  3CME B;  4C3H J;  4A3B J;  2CW5 A;  5IP9 J;  4RPD A;  1JHF A;  2JRM A;  4ZZL A;  4X6A J;  2RKH A;  1X2M A;  3Q9S A;  4QPQ A;  2M0M A;  3HBL A;  3OEE A;  2DA6 A;  2F1M A;  1IHM A;  4IRG A;  4BGD A;  3A4C A;  3QP6 A;  2DTZ A;  3AGQ A;  3IRR A;  3PIO F;  1SD5 A;  2XVC A;  3QPS A;  4M3G A;  1ZLK A;  3PNT A;  1KK1 A;  3CLQ A;  5F0C A;  3JRD A;  2JUC A;  4BNC A;  2H6B A;  2E34 A;  2VT3 A;  1VQ5 I;  1B4A A;  2P8T A;  4IJA A;  2P0W A;  1SVL A;  2JVH A;  1I7P A;  1N75 A;  4IL6 C;  1M90 D;  3VNU A;  3WE2 A;  2BM7 A;  1FX0 A;  4JP0 A;  1YS6 A;  3BR5 A;  2H09 A;  2VBW A;  3E6M A;  2ISY A;  3P26 A;  1USS A;  2DI3 A;  2DA4 A;  3K1N A;  1UMQ A;  4TV7 A;  3L00 A;  2IA0 A;  2FSW A;  4OZZ A;  2TDX A;  5HVQ C;  2XC1 A;  2XF5 A;  3E6D A;  3VMW A;  3A0H C;  4JK1 X;  2UWM A;  2KRF A;  3VWB A;  2X8K A;  1W36 C;  3BG3 A;  4EGZ A;  1YHQ I;  3FJO A;  3G71 B;  2XIG A;  2KDO A;  3PFI A;  3MMP A;  3R6K A;  2HZT A;  1NBM A;  5KK1 A;  5D5W B;  4GQN A;  1O8D A;  4LG0 A;  4BKX A;  3ZN0 A;  1RWR A;  3G1O A;  4UV9 A;  3U2R A;  1E3H A;  1DPU A;  1UD5 A;  5B66 C;  3L7W A;  3KP4 A;  4WZK A;  4Z6Y A;  1CNE A;  3IP4 B;  4G6T B;  1TYW A;  3A3G A;  3BPX A;  2EIM H;  4YCQ A;  3E97 A;  2XGJ A;  4WK8 F;  3V8J A;  2CBX A;  1Z6T A;  2Y9Y A;  3VSK A;  4C30 A;  4ZDL A;  2NTB A;  1W4M A;  3BY2 A;  4M9S A;  2PFB A;  2E7W A;  4ITV A;  3P9I A;  2GOX B;  1KU2 A;  1LLW A;  3K1P A;  3V7C A;  1ZR2 A;  1XMK A;  2EFQ A;  2KJB A;  4BQA A;  2VNK A;  3RPQ A;  4KMF A;  2PYG A;  1TTY A;  2UVF A;  4X7C A;  2L7M P;  3S14 J;  3BTI A;  4Q4Z F;  1HOM A;  3SUC A;  3N90 A;  1TWH J;  2JMW A;  1J09 A;  5M5W J;  1I6H J;  1X1D A;  4GYG A;  4L18 B;  4Q5S F;  2UXN A;  1TSP A;  2Y0M A;  1IUF A;  2D5V A;  4HIZ A;  1ETX A;  3E5Q A;  5K7H A;  3FM5 A;  2LBF B;  4XSZ F;  3EET A;  4F93 B;  1LE8 B;  1JKQ C;  3K4B A;  1KQ5 A;  3F22 A;  4YAF A;  3F0C A;  1X0C A;  2XAQ A;  1AKH A;  3MWM A;  4CSW A;  1V54 H;  3F8M A;  2B0L A;  2XZO A;  2OQR A;  3BQY A;  1UST A;  2KIQ A;  3HOS A;  3QFT A;  2WAQ N;  1P7J A;  2BY2 A;  4WWC A;  5LEJ A;  4RGX A;  2INU A;  2FX0 A;  1G8X A;  2MSY A;  2P5L C;  1VLY A;  3Q38 A;  2NVU B;  2L5Q A;  3HRS A;  2EIN H;  4XN3 A;  1G7C A;  4MXN A;  2ELJ A;  2MAB A;  2VQL A;  4ENM A;  1DP7 P;  2ECC A;  2DMP A;  1E0E A;  2FX3 A;  1ZG5 A;  3B78 A;  2JJ7 A;  2LP0 A;  3B6C A;  3UNG C;  3WQZ A;  1X1A A;  2BOL A;  2Q2E A;  3OL3 A;  2NNY A;  3LJY A;  2ZZE A;  3FBN B;  4XOR A;  1E63 A;  4PAB A;  3GFJ A;  1D1C A;  4EMS A;  2CS3 A;  4HE6 A;  1MBE A;  3SEZ A;  1IN6 A;  1EFU A;  3DLL F;  1D8K A;  2E7X A;  3BG5 A;  3QP5 A;  2MFZ A;  3CF5 F;  1VQM B;  2MC3 A;  1CF7 A;  4Z4T A;  1YIJ B;  2W7Z A;  5H6Q A;  3CES A;  1KK0 A;  5LEK A;  2XTY A;  1GVJ A;  1VBL A;  2D3L A;  3WOD F;  4HZF A;  4V19 K;  5EGO B;  4A3L J;  3ABM H;  2DEU A;  4IX7 A;  4N9H A;  1XG2 A;  1DPR A;  4LG3 A;  3NWT A;  1VQK I;  1ERD A;  2ESH A;  3FWE A;  3JW4 A;  4OOX A;  3CCY A;  2WPD A;  1O57 A;  3BJ6 A;  4BJ5 C;  1TL8 A;  3F6V A;  4XL9 A;  3LNN A;  4XD7 A;  2QQB A;  2L9S A;  3HZJ A;  2A05 A;  3KLO A;  5HDG A;  4YAW A;  1Q86 D;  2DK5 A;  3IHU A;  2LKS A;  1V3F A;  5FA6 A;  1O8H A;  1JJ2 B;  1UHS A;  5EZH A;  3GO5 A;  2R5Y A;  4LG0 B;  2EFW A;  1XDU A;  2ESN A;  2XF7 A;  5A2Q Z;  5KCM A;  4ASN A;  3OIQ A;  2CND A;  2Q6K A;  2JTV A;  3VSU A;  1WU8 A;  2PYH A;  4M3F A;  3A01 A;  1PJ5 A;  4B1R A;  2VFN A;  3FKJ A;  3OYB A;  2CGP A;  2R9V A;  1H9G A;  5GAG J;  4XBF A;  5LGT A;  4OOI A;  1U8B A;  1KYW A;  2VXD A;  2XZL A;  2W48 A;  3V8L A;  4QLC U;  3AVX A;  4I09 A;  2HGC A;  2HEO A;  3QU6 A;  4BHB A;  3PUN A;  3KZI C;  1SEU A;  2F5D A;  2HQA A;  5J4V A;  1LJ9 A;  3WTU C;  3H09 A;  3ZQL A;  2QEN A;  5C3E J;  2B9S A;  3GTO J;  3DPL C;  4CUG A;  4BDZ A;  4PSW A;  4EM2 A;  1BL0 A;  3I59 A;  3C2G A;  2AO9 A;  2DFF A;  5A2Q K;  2QTL A;  2FJ1 A;  3B73 A;  5J3L A;  1RIO H;  5DUI A;  4QFM A;  3BQJ A;  4RDJ A;  1F1Z A;  4D7M A;  4XON A;  3T9G A;  2A68 F;  2MD5 A;  3G73 A;  4G7Z F;  2VOO A;  3JU4 A;  1RZ4 A;  2M0C A;  4Z1M A;  1XPX A;  2OJE D;  3ELK A;  2OTL B;  2FU4 A;  4ZZD A;  3GQB A;  2OUM A;  5HS7 A;  4B48 A;  1NG6 A;  3LSP A;  2A6H F;  2HVS A;  2C78 A;  2NT6 A;  2N8G A;  1VI0 A;  1W36 D;  4F92 B;  2HDW A;  4LFU A;  5F64 A;  4PAA A;  1K4Z A;  4BUP A;  5FO5 A;  1R71 A;  3HOW J;  3ZUG A;  2M45 A;  2DJN A;  2OV7 A;  3FXU A;  3W2W A;  1IC8 A;  3KEO A;  1OCZ H;  2LNB A;  4XKC A;  3V42 A;  1J7K A;  4GCV A;  3DWL E;  1BR2 A;  5JHF A;  2O8X A;  2HMA A;  1PJR A;  3DEU A;  4B44 A;  2DA2 A;  3HC7 A;  2CJJ A;  2XSD C;  4X7D A;  2JUG A;  3EUH C;  5FLV A;  3ASR A;  3LOC A;  4KIS A;  2X48 A;  2JPB A;  1WSU A;  1GJR A;  4A0Z A;  2NSP A;  3ZZU A;  2IAI A;  5M3M J;  2ELH A;  2VBK A;  3DF8 A;  5H20 A;  4HLY A;  2V7V A;  4Z03 A;  2IGO A;  3VSV A;  3KZY A;  2E1R A;  3FXR A;  2XNC A;  4L5I A;  2BF4 A;  3KEY A;  4Q7J B;  3CCV B;  3E6C C;  1TYV A;  2O04 A;  1PUF B;  2EIJ H;  4M6X A;  1KU3 A;  1WJF A;  1XMA A;  5E1X A;  4NB5 A;  3VYR B;  3PVD A;  1AIP A;  5L3C A;  3OFN A;  1FX7 A;  2XRO A;  5F4O A;  4AU7 A;  1UJ8 A;  4CYC A;  3EYI A;  2V6C A;  1XGO A;  3OYF A;  2FML A;  3GLX A;  2E1B A;  2F1L A;  2WC2 A;  2E2H J;  1F4K A;  1ON2 A;  2HU9 A;  1Q9S A;  3FY3 A;  1PUF A;  3KP3 A;  2V7X A;  1MSE C;  1S0U A;  2L7Z A;  2GM4 A;  2Z3Y A;  4G7O F;  3A2K A;  3KEW A;  1YLF A;  4UHT A;  1FZP B;  4E0F A;  3EQN A;  1GLN A;  2YS9 A;  2XPV A;  3D5L A;  2ZXH A;  4HOB A;  1HA8 A;  2ZME B;  3LSM A;  4YAU A;  1I27 A;  4C2T A;  2NOJ B;  1E3P A;  2E5N A;  2NVT J;  4BY7 J;  1DU6 A;  4DZJ A;  4R8H A;  3OR1 C;  1D8T A;  1EZG A;  3LQQ A;  3FK6 A;  1JXS A;  3FMS A;  5K7Z A;  5FKN A;  1NJI D;  3HB9 A;  1OB5 A;  3T1B A;  1H88 C;  3H3Z A;  4QUZ A;  3CUO A;  3CJR B;  4BQO A;  1DGW Y;  3BT9 A;  1PE9 A;  5CVI A;  2JA7 J;  4LIT A;  4YEJ A;  3CDL A;  3JSO A;  3CCE I;  3CP8 A;  2VZL A;  2BM5 A;  4FX0 A;  1A04 A;  1M1E B;  3IL2 A;  1QG0 A;  4PFP A;  4MTD A;  2FE3 A;  3DBL B;  3SZP A;  1KYZ A;  2HFH A;  3W2V A;  3ZQQ A;  5FLM J;  3OYH A;  1GVD A;  3ULQ B;  3OYE A;  4UVA A;  2Z99 A;  1JGG A;  3ABT A;  1U5T C;  4LOC A;  1N25 A;  3F9K A;  3RPU D;  1N77 A;  2EWN A;  2YU9 J;  1HW5 A;  2HPI A;  3OW7 A;  4WZL A;  1RRJ A;  1YJ9 I;  5F6F A;  2GRE A;  1XTA A;  4IHX A;  3H5N A;  4ZGQ B;  1OOC A;  4ZYH A;  3ZR8 X;  1X3W B;  4V02 C;  2Q0O A;  1BI1 A;  2F43 A;  2BY1 A;  3RYR A;  1MJA A;  1NG7 A;  1QU3 A;  2FBH A;  4RM2 A;  1VQL I;  1MMS A;  3LQR A;  1RC9 A;  2X0L A;  1KQ9 A;  3CP2 A;  2DFE A;  4MHG A;  4KH3 A;  2VN2 A;  3J80 K;  3JQR A;  3TO9 A;  2COM A;  2W24 A;  2WWY A;  5DN6 A;  5FD5 A;  1FY7 A;  4L9V A;  1I1G A;  3E6B A;  1HDD C;  2JK3 A;  4C43 A;  3A1Y A;  3TMO A;  2EIK H;  5TIS C;  1ETY A;  3ASN H;  3U9G A;  4BQN A;  1HA3 A;  2F5C A;  3OYL A;  4ETS A;  4RGR A;  4OJ5 A;  1R1T A;  2H94 A;  1JKR C;  1TBX A;  2XB0 X;  1LFB A;  3ZMZ A;  2VKE A;  4TN1 A;  3PSI A;  3GVA A;  1A35 A;  4DK0 A;  3CO7 C;  4E7K A;  2H8W A;  4WX9 A;  1QA2 A;  2JN6 A;  2ZNZ A;  3OJW A;  1OR7 C;  1Z6R A;  4A69 C;  2VUM J;  2VYQ A;  3K2A A;  1SVO A;  2VBV A; 
#chains in the Genus database with same CATH homology
 4CCL A;  4NQW B;  1E3X A;  3GQ8 A;  4XM3 A;  3L2V A;  3N05 A;  3DU6 A;  3L2W A;  1WMR A;  4UZU A;  2VKD A;  1X1B A;  2ZZF A;  4W8Q A;  2IGM A;  1FMW A;  2MD0 A;  4N4N B;  4BEH B;  3GQ7 A;  3PUB A;  2HNH A;  2R7S A;  3DTK A;  1T0F C;  4XN0 A;  3OYM A;  2VB6 A;  2NST A;  4BU2 A;  2X85 A;  2XDV A;  1Z7L A;  2O0W A;  4AYB A;  3EPZ A;  4E7Z A;  2VPL A;  1O88 A;  4OJL A;  4BDY A;  3VYU B;  2CV2 A;  3D5S C;  1PXZ A;  2BW3 A;  4J01 A;  2IS6 A;  1JRG A;  2CW7 A;  2RRE A;  3BLY A;  3AL0 B;  1COW A;  1K28 D;  1MNE A;  4JMQ A;  2WJY A;  2VQC A;  3H0D A;  2JA2 A;  1HVX A;  1W0J A;  2NTP A;  2O17 A;  4NC7 A;  4KKU A;  4Y4R A;  3OS2 A;  3OS0 A;  3HUG B;  2M3A A;  2GK7 A;  2Z1D A;  2HZD A;  3BCA A;  3HKZ A;  3LL7 A;  2QKL B;  1Z3X A;  1KMH A;  4CCN A;  4YXW A;  5CQG A;  5C1E A;  2IGK A;  1JI8 A;  2M4K A;  1LDK B;  2ODL A;  3GVK A;  1NRK A;  5KHD A;  5HOO A;  2BSP A;  1IDJ A;  2CMP A;  3DEE A;  3OYJ A;  5FRM A;  1KTW A;  4LIV A;  2LRD A;  2DJI A;  3DLA A;  3GVJ A;  3IUO A;  3GVL A;  3PJR A;  5LD2 C;  3VDX A;  2GOM A;  1MMG A;  3E1S A;  1TT0 A;  2JJ2 A;  2L2O A;  4QPO A;  1V0E A;  2K9M A;  1DQU A;  3L2R A;  3DTI A;  4RLQ A;  2WAQ A;  4XLC A;  1E43 A;  2XND A;  4OJO A;  4BJ6 C;  4PFO A;  3SDB A;  1E1R A;  2W6J A;  2ZTG A;  1E3Z A;  2XAU A;  4TSF A;  4HSR A;  5KNL A;  3CJQ B;  5CQE A;  3ZCO A;  1O8L A;  2O0V A;  1IA5 A;  1X4P A;  2UUZ A;  2FUG 2;  3GQA A;  2X1C A;  3OEH A;  1LKX A;  2CW8 A;  4II3 A;  5CPR B;  3OL4 A;  4OAY A;  2CH0 A;  3FPP A;  1PYV A;  1HG8 A;  1G59 A;  4URR A;  1PKV A;  3FHN A;  4FET A;  2BW3 B;  4PJN A;  2LG4 A;  1D1B A;  3K4C A;  2VL8 A;  3LMW A;  3B90 A;  3M1C A;  4PJL A;  1RMG A;  2LC2 A;  4OJP A;  4TT3 A;  4CCM A;  3ZPN A;  5IK2 A;  2PEC A;  4PJM A;  4CA0 A;  4IQJ A;  4NNJ A;  1LFP A;  3MKW B;  3BCD A;  4DBQ A;  3PNY A;  4NUB A;  2V31 A;  3PFY A;  4BEH A;  2GJP A;  2L9N A;  2JJ1 A;  3IAS 2;  4EAT A;  3DPT A;  2HVQ A;  1X4O A;  4DNR B;  4XNF A;  4ZDP A;  4XR6 A;  2R7O A;  2VBE A;  2KQR A;  2WA0 A;  1OB0 A;  4HNT A;  4F52 A;  1AA7 A;  2I8D A;  1D0Z A;  4IKF A;  1DBO A;  3MKY B;  4AVZ A;  4R79 A;  4EW9 A;  2GJK A;  5FRN A;  3H35 A;  4G6I A;  2VBM A;  2W1O A;  3HL2 A;  1GQ8 A;  4QPQ A;  1WJ5 A;  2M0M A;  1WPC A;  3OEE A;  3RTR A;  2F1M A;  2IS1 A;  3CF2 A;  2NTQ A;  2Q1Z B;  4BGD A;  2E5Z A;  3A4C A;  3VYS B;  1OGM X;  2XZP A;  4B47 A;  3HPH A;  4B3G A;  3JUR A;  2HVR A;  1UD6 A;  2DIE A;  1MAB A;  1MMA A;  2WBM A;  2W00 A;  3PNT A;  3K4M A;  2WAD A;  2X1D A;  4F55 A;  4E7J A;  4D1Q A;  1H8H A;  1WJD A;  4KKS A;  1D1A A;  2P0W A;  4E7L A;  2CK3 A;  2JVH A;  1N75 A;  4E7I A;  1MMN A;  3MKZ A;  1O8K A;  1FX0 A;  2VJ5 A;  1KCD A;  3BC8 A;  1UG0 A;  4G7X A;  2KZV A;  2Z6B D;  3DKX A;  4B3F X;  2F6C A;  2V4J C;  4JOM A;  4DIQ A;  4KT6 A;  3U21 A;  4OZZ A;  5HVQ C;  4ZTJ A;  1OLT A;  2XF5 A;  4Y33 A;  3VMW A;  2UWM A;  4XLE A;  2XOK A;  3VWB A;  4CZC A;  2X8K A;  1W36 C;  2ZZG A;  4GRI A;  2KDO A;  2R7X A;  4P1W A;  1YE9 A;  4C9Y A;  1NBM A;  4GQN A;  1O8D A;  2E60 A;  2GK6 A;  4PUS A;  1RWR A;  1Z21 A;  4HEA 2;  3AKZ A;  4BE1 A;  1UD5 A;  4PMH A;  3OOC A;  2M7B A;  3FDY A;  3KX2 A;  3MMY B;  2V4D A;  4ZJZ A;  2LY1 A;  2VXZ A;  3IP4 B;  4G6T B;  2BVL A;  2W82 A;  2X1E A;  3MD2 A;  2W6I A;  3A3G A;  3VMV A;  4U4B A;  2R7R A;  2XGJ A;  3B4N A;  1WTH D;  2K5C A;  3BC9 A;  3VSK A;  3OR2 C;  3VST A;  4C30 A;  1X19 A;  4ZDL A;  4E7S A;  2XSJ C;  2NTB A;  1LVK A;  2CUZ A;  4DBR A;  3OPO A;  1OFL A;  4ITV A;  2GOX B;  4NK8 A;  1BHE A;  3A35 A;  3LSI A;  1KZL A;  1V5F A;  2LRE A;  2PYG A;  4XLF A;  1EE6 A;  2UVF A;  1TZL A;  3SUC A;  2M7A A;  3DTE A;  4Z06 A;  4BJT A;  2QX3 A;  3LSH A;  1J09 A;  1X1D A;  4PJJ A;  2ZFU A;  4DGW B;  1MW7 A;  1VF7 A;  2ZTN A;  1KCC A;  4HIZ A;  3LFU A;  4FAS D;  3H9J A;  2LBF B;  4IZZ A;  1O8I A;  4F93 B;  1I8D A;  3HPG A;  3K4B A;  1IB4 A;  1IRX A;  4U87 A;  1X0C A;  1WJC A;  1U0J A;  1P9Q C;  4CSW A;  4XQF A;  2XZO A;  3HOS A;  3IAM 2;  1EFR A;  1ZEL A;  4H4K C;  2RNG A;  3OYC A;  3W3C A;  1T95 A;  1OFM A;  2INU A;  3A3B A;  1G8X A;  3OYA A;  2ZZQ A;  1JTA A;  3UW0 A;  3OAA A;  1VLY A;  4MLO A;  3HXL A;  4Y3O A;  1FMV A;  2L5Q A;  3VYT B;  2UVE A;  4DJA A;  4XN3 A;  3S8P A;  2WB1 A;  4MXN A;  2WAF A;  1SAU A;  2ELJ A;  2MAB A;  2VQL A;  4HST A;  3S3N A;  1E79 A;  1E0E A;  1WJB A;  1ERD A;  1YX3 A;  3OYK A;  3UNG C;  1BPL A;  3WQZ A;  1K6Y A;  3HG9 A;  1X1A A;  2DT7 B;  2BOL A;  3OL3 A;  3EUA A;  4JQF A;  2W4S A;  5HNH A;  2JVG A;  2RQQ A;  2WY8 Q;  1O8F A;  2ZZE A;  3FBN B;  4XOR A;  1SFK A;  1D1C A;  3OIP A;  2CS3 A;  2F5V A;  3HAG A;  3G05 A;  2JIZ A;  3SEZ A;  1Z3Y A;  3DPU A;  2MFZ A;  4NC8 A;  1S9H A;  2LH9 A;  2Q2E B;  3EUK L;  3CES A;  4BQQ A;  2WSS A;  3SEQ A;  1VBL A;  4X0G A;  2D3L A;  2KPM A;  1Y56 A;  2X6W A;  3QYE A;  1WFX A;  5AMV A;  1VJS A;  1BLI A;  3PL8 A;  3T53 B;  4IX7 A;  2PMZ A;  1XG2 A;  2LYC A;  4LG3 A;  3NWT A;  4PSX A;  4XKB A;  4BE2 A;  2A5W A;  3OOU A;  2Z8G A;  3ZGK A;  2WPD A;  1WP6 A;  3LNN A;  4BJ5 C;  5LFA A;  2MYS A;  4XL9 A;  4XD7 A;  4W8S A;  4YZ0 A;  2L9S A;  4OAZ A;  2KP6 A;  1YX5 A;  4P22 A;  3EQO A;  2X6Y A;  1O8H A;  2O1D A;  5HKK A;  3BH4 A;  2VJI A;  4CCJ A;  2QXZ A;  3K70 D;  2VKH A;  2XF7 A;  3OYD A;  4XKV A;  5KCM A;  1BMF A;  3OIQ A;  2V6E A;  3AL0 C;  3VSU A;  2PYH A;  4HPQ A;  1H8E A;  1O8J A;  1QJV A;  3M8J A;  2VAS A;  4D9J A;  4CH7 A;  1KON A;  2UV1 A;  3FKJ A;  3OYB A;  2LZJ A;  2R9V A;  2Z2S B;  2XZL A;  2VXD A;  1O8G A;  1UD3 A;  1VZ0 A;  1CZF A;  2HQA A;  1BN8 A;  3GBG A;  2WY7 Q;  3E0J B;  1AIR A;  4ASU A;  4YZA A;  2DOA A;  3L2U A;  3DPL C;  4P5O A;  4LIU A;  4XLA A;  4CUG A;  4YRV A;  4BDZ A;  1DGR M;  2CFO A;  2VJJ A;  4PSW A;  2IS4 A;  2AQE A;  3C2G A;  1UD8 A;  2IXS A;  3RQ4 A;  2DCE A;  2Z16 A;  2VLA A;  3J7A Y;  2QY1 A;  1K5C A;  2HPM A;  1UEL B;  2R7W A;  3AFH A;  4XON A;  3RSN A;  2PJR A;  4YEL A;  4HG2 A;  3T9G A;  3SYT A;  1MMD A;  3FBI B;  3JU4 A;  3T56 B;  1T5E A;  4Z1M A;  2CV0 A;  4NK6 A;  3GQB A;  3K70 C;  2OUM A;  4B48 A;  1NG6 A;  2JDI A;  2HVS A;  1N78 A;  2NT6 A;  3KYL A;  1W36 D;  4F92 B;  2HDW A;  4BE0 A;  1DP3 A;  4BUP A;  4ZDO A;  2K3P A;  2K9L A;  2VQG A;  2DXI A;  1DBG A;  4XKW A;  3S32 A;  4ANJ A;  2E1M C;  4F91 B;  2OV7 A;  3W2W A;  3W2A A;  2KVO A;  5FL7 A;  3ONQ A;  2V26 A;  2JSP A;  2IS2 A;  4XKC A;  4XLH A;  3V42 A;  4BS9 A;  2WJV A;  3DWL E;  1BR2 A;  3H5A A;  3K4N A;  5JHF A;  3K4K A;  3ZXS A;  2M5S A;  1NHC A;  1PJR A;  4B43 A;  4B44 A;  2DT6 A;  1W0K A;  3HC7 A;  2NZM A;  2KHM A;  3QOD A;  2X3H A;  2JUG A;  3EUH C;  1OGO X;  3KRG A;  2ZSI B;  4KIS A;  4TKO B;  2NSP A;  2R7T A;  3DU5 A;  4DK1 A;  3H9Q A;  4DNT B;  2VBK A;  4ZC3 A;  5C1C A;  5HNF A;  3H5R A;  2V7F A;  5HLT A;  3OYI A;  3ZSC A;  3LSG A;  4Z03 A;  2IGO A;  3VSV A;  3NE5 B;  3VSL A;  3K10 A;  3DQV C;  1WJA A;  3KEY A;  2QE7 A;  4OJ6 A;  4Z05 A;  3OY9 A;  3I3L A;  2O04 A;  3UR3 C;  1Y6I A;  1WJF A;  2CUJ A;  2A6T A;  3CMM A;  2KRC A;  3VYR B;  3C2H A;  5CDF A;  3OFN A;  2HLD A;  4AU7 A;  4BAC A;  3DDY A;  4G7W A;  3OYF A;  2E1B A;  4ZYA A;  4CCK A;  4J00 A;  1HZE A;  3FY3 A;  2HU9 A;  1IDK A;  4MR0 A;  1WJE A;  3KEW A;  3A2K A;  2X6X A;  4RMN A;  4E0F A;  3EQN A;  1GLN A;  2KL4 A;  3D5L A;  4XMY A;  2ZXH A;  3TL4 X;  3RCO A;  2MC4 A;  2CV1 A;  1HA8 A;  2LOO A;  3K4L A;  3LSM A;  3S3M A;  4HRI A;  3D5R C;  4C2U A;  4RM3 A;  2ZSH B;  3OMY A;  2NT9 A;  4C2T A;  3PSF A;  2NOJ B;  2INV A;  2E5N A;  1V5G A;  3OR1 C;  1EA3 A;  4E6K G;  4HWV A;  3LMM A;  4E7H A;  4XOP A;  4E4H A;  2LY2 A;  2OC6 A;  2VJ4 A;  3K4J A;  1OHH A;  2R7U A;  4W8R A;  3GQ9 A;  2XC7 A;  4DOZ A;  3OE7 A;  1SKY B;  3T51 B;  3BG6 A;  1BR1 A;  3CJR B;  4BQO A;  1DGW Y;  1I18 A;  3ZPP A;  2L7K A;  3ZRG A;  1PE9 A;  1W9X A;  3GRH A;  2XF6 A;  1V0F A;  2QKM B;  2V1N A;  2ZXI A;  4LIT A;  4YEJ A;  5FRO A;  3BG7 A;  3CP8 A;  3CZ6 A;  4N4O B;  4HNU A;  2VQH A;  2V7Q A;  3BCF A;  4FXU A;  1PLU A;  4IQ4 A;  1QCX A;  3QOE A;  2IQ7 A;  2R4G A;  4L8J A;  2R7Q A;  4I84 A;  1QHH D;  4PFP A;  3OYG A;  3S93 A;  2X51 A;  3W2V A;  3ZQQ A;  2KLO A;  3OYH A;  3OYE A;  3QYB A;  3B8Y A;  2R7V A;  4KKT A;  2O5R A;  3OS1 A;  3F9K A;  1N77 A;  3RPU D;  2LBF A;  3ZIA A;  2HPI A;  3OW7 A;  1UD2 A;  3FKS A;  3H5N A;  4BL0 B;  2PJR B;  1OOC A;  1R6R A;  4RLF A;  1RU4 A;  3ZR8 X;  1UAA A;  1E1Q A;  3TBI A;  4U49 A;  4KIT B;  3QYF A;  1D0X A;  3OWT A;  2AQF A;  4ZTF A;  2D3N A;  2F43 A;  2F4I A;  1V5E A;  1NG7 A;  4C2L A;  4XOT A;  1QU3 A;  2Y0S A;  4W8T A;  2WAE A;  4RM2 A;  2KMU A;  4YZQ A;  4F3Q A;  1H80 A;  4U7B A;  3H94 A;  1QHG A;  3DKY A;  3CP2 A;  2M4G A;  3G2B A;  3NWS A;  4CCO A;  2V9K A;  4YZX A;  4II2 A;  4OZY A;  2X53 S;  3K6G A;  5DN6 A;  4KJZ A;  1UD4 A;  1X1C A;  2EWE A;  3A1Y A;  3LSK A;  2VIX A;  3TMO A;  3WWG A;  2GJR A;  1O8E A;  2IGN A;  4BQN A;  4BXF A;  2E1M B;  3OYL A;  2BVM A;  4B3X A;  1D0Y A;  3SZG A;  4OJ5 A;  4OWR B;  1O8M A;  4PK4 A;  2W7N A;  3I9V 2;  3PSI A;  3HOT A;  4DK0 A;  3H9G A;  3S3O A;  3VR6 A;  4E7K A;  5TGT A;  3L2Q A;  1BR4 A;  1BOB A;  1MND A;  2KRH A;  1OR7 C;  3BCB A;  5CKT A;  3PNV A;  3OYN A;  2WZP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...