2BX6A

Crystal structure of the human retinitis pigmentosa protein 2 (rp2)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
311
Chain Sequence
b'KVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVLNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XRP2 PROTEIN
publication title Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transduction protein
total genus 103
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bx6A01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2bx6A02
3NGRA 1K4ZA 1BHNA 1F3FA 1MN9A 1NDKA 2VU5A 3EJMA 3B54A 3FKBA 3Q89A 5CABA 1BE4A 1NPKA 1NSQA 4S0MA 1HF2A 4HR2A 4ENOA 3FCVA 1NUEA 5BXIA 1ZS6A 3EVMA 3PJ9A 2AZ3A 5IOLA 2DY9A 3EE3A 3PRVA 3ENAA 4KPCA 3R9LA 4V02C 3ZTRA 1S59A 3ZTSA 4EK2A 2ZUAA 2DXEA 3NGUA 2HVDA 2DXDA 1MN7A 2DYAA 3FC9A 3Q8YA 2BX6A 3ZTQA 1KDNA 1WKLA 4C6AA 4DZ6A 1K8FA 2B8QA 1EHWA 3EMTA 1WKJA 3NGSA 1S5ZA 3ELHA 2YUHA 3BH7B 1U8WA 2DXFA 3GPAA 1BUXA 1LWXA 1NSKL 4DI6A 2CWKA 1UCNA 3Q83A 3Q8UA 3BBCA 4DUTA 1F6TA 4UOHA 2AZ1A 3Q8VA 1JXVA 3EVOA 3FBBA 1WKKA 1W7WA 1NDPA 1LEOA 1HIYA 1XIQA 3Q86A 3B6BA 4F36A 1NDLA 3VGUA 1HLWA 1HHQA 3BBBA 4FKXA 1NCLA 1NSPA 3MPDA 3WX8A 1K44A 3DKDA 1B4SA 3EICA 3NGTA 4W98A 4WBFA 3ZTPA 4O0NA 2B8PA 4ANDA 4F4AA 1PKUA 3ETMA 3VVUA 3JS9A 2B0RA 3VGTA 3ZTOA 2HURA 1KQ5A 1NLKL 3G2XA 4ANEA 3VGSA 4FKYA 4ANCA 4UOGA 5CAAA 2HVEA 1VYAA 4CP5A 2BEFA 3VGVA 3EVWA 3FCWA 4UOFA 1PAEX 3BH6B 3EM1A 3L7UA 1S57A 3FBCA 3VVTA 3BBFA 1NHKL 3FBEA 3FBFA 5C7PA 3GP9A 1B99A 1XQIA 1NB2A 2NCKL 3DDIA 1NDCA
chains in the Genus database with same CATH superfamily
1YJTA 3KDNA 4OI6A 3DLLQ 2XSJB 3OR1B 4C8YA 4OYIA 4P71A 1GAOA 2BM7A 4MFBA 4YB7A 4DMZA 1OS5A 4M5GA 1EAYC 4AVZA 2HFVA 3KLFA 3GTYX 2UUTA 5JMCB 2W01A 2ADBA 4ILMA 5ETVA 2MHEA 2CQHA 3FJ2A 2BDPA 1RACB 3CCRS 1UA1A 2OFGX 1T0TV 1FKPA 1FXRA 4IQXA 4CO0A 2XBPA 1N8RT 4LF5F 1RP5A 1B7YB 1S99A 1OGMX 3LP2A 3Q24A 1HBNA 3R5AA 4JI8F 4JI7J 3SV3A 3G8TA 2J7KA 2K7JA 1MU2A 3ZTPA 2MGZB 1X4FA 5AJ3J 4KTQA 4ED0A 2CQPA 3GCWP 3EDQB 1SJQA 1NM2A 3RAQA 3UFCX 3G6VA 3PHTA 4U9RA 2UVRA 2RD5C 3QJJA 4IOAQ 1DJ0A 2DH7A 3A8EA 1GXLA 2RDJA 5HP1B 3UN2A 2ZBCA 3SV4A 2KXHA 2VU5A 1WXRA 4OIXA 4XLFA 1NEEA 5KG0A 3FDSA 4MR0A 2LECA 1CJKB 1VISA 3QATA 2CQ0A 5A8WB 3HJFA 2QZ8A 2D3O1 1X0CA 4DL4A 3PV8A 5L38A 1QY7A 3OVAA 2QN6B 1RHRB 5CXTA 2AQ4A 2KDOA 2YQ1A 4ZVTB 3MM9A 1J2VA 4J9SA 4W8TA 2D7SA 3HSDA 5HLFA 2GVZB 1LK5A 1VQMS 2W2PP 3KLIB 3DOMB 3ILLA 2W7OA 1VQSA 3TZYA 3LJYA 1NLKL 1WF2A 1BHEA 5DM6Q 2F3JA 4AQYF 1VYAA 3IGNA 1VRTB 1WHXA 2JRSA 3CNQP 2ZH2A 1PO6A 3NGKA 3MM6B 3CJ5A 2HMIB 5C42B 3J7A1 4L74A 3PKYA 4LFCF 3WIUA 5K9FA 2A6MA 4JI5F 3HKWA 1BE4A 2X7IA 2X6WA 2JVRA 2NPFA 1TSPA 2V5HG 4DQQA 5B0DA 2XTYA 2HVDA 5CYQA 4HDGA 3C2PA 5K8PA 2GVZA 4DSKA 1DY3A 2O1DA 2VD3A 1FKOB 5J2QA 3QAUA 3EQOA 1HKAA 4C97A 1NK8A 2R42A 4ELUA 4ZVGA 1VC6A 3B78A 3KK1A 2QO3A 1ZM2A 1XIQA 2BE7D 1N36F 3B6BA 2KRBA 3PFEA 1IBKF 2LP4A 1S1WA 1WC5A 1QQ1A 2C1EB 2W7PA 1SXLA 2XC1A 4IR9A 2UU9F 4YCQA 2CPDA 3G2XA 2YXLA 2EFGA 1EQMA 2Q43A 2HBZB 1CJTB 3WX4A 1Z2ZA 1W26A 1RT6B 5F8IA 2V2KA 3FBEA 5A8RB 1R7IA 1ZM3A 2IRUA 5LSRA 1HHSA 2GHPA 4F4YA 2ODLA 3DRSA 1IBCB 1AA1B 1RTHA 5IM0A 2ZJRQ 2WHOA 2KI2A 3T5LA 3PYEA 4GMKA 2W9AA 2B43A 1TK0A 1JKHB 2DXEA 3J7YU 4USMA 2DYAA 2YX4A 4Y28C 1HHTP 3SCJE 4N8OA 3W5YA 2VC1A 3PSZA 5HN0A 2DGQA 4Y65A 2KT2A 4OMFG 3DMJB 3PW4A 1DARA 1FEEA 4HHHA 2V50A 4ZPAA 1X9SA 2KKHA 3A13A 1RCOB 3VGUA 3TWZA 3R5DA 4NLYA 4MKAA 1P9YA 1ZPVA 1U6BA 1LFWA 3QIPB 5D3GB 4WFBQ 3TO8A 2IYGA 4MYTA 3VSTA 3SSQA 1FCAA 2ZZMA 4AL5A 2QMUB 1HARA 2D41A 2O01C 4B3RJ 1CG2A 2AD9A 1CJVA 2J0QD 2V94A 3S8SA 1IWGA 3ET6B 1SH0A 3C19A 3BO4A 1S4FA 4U95A 1R31A 3TA1A 2YNHB 3LTOA 2QA1A 1EARA 2INVA 3FEYB 2NT6A 3NCQA 2PEHA 3BSAA 2PDAA 5DDQC 1YBTA 2K8GA 1FTCA 1RHMB 2GHWA 3O6QA 3HHLC 1SUQB 3PJ9A 2CQCA 1R0AA 1J27A 4HH0A 4K59A 1M5PC 3U02A 2Q3PA 4PQAA 1KDNA 2ZHAA 3SBMA 3CC4S 2F8EX 3RRHA 2XTXA 2FHMA 4MMOA 2BM0A 4XK8C 2XTJP 3ULHA 2BW2A 1WI6A 4NRTA 1JLQA 2MQOA 5IT4A 4LF4F 2UUBF 2HFUA 3TZWA 3M2RB 2JSXA 2PT0A 1TFWA 4DV6F 2AYGA 4YEAA 2J9DE 4ZPVR 1FESA 2LXUA 2IM1A 5L9NA 4Y34A 4QW9A 3V4MA 4KKOB 4ANDA 2YWWA 2RUSA 5F0WA 1WELA 1AFIA 4Q0BB 1WOSA 1F0XA 3PRBA 1YITS 3O44A 4LBIA 4GO7X 4Y2CA 3CDAA 1JLEB 2AGQA 3MEEB 3HVAA 2DGVA 3I9ZA 1U1NA 1T9UA 5HQ8A 1R6VA 4BWMA 4H4KC 2MYFA 3VALA 1DFDA 3IS9A 4NLWA 4ED5A 4JV5F 5F8GA 2UVWA 4LFAJ 2J7UA 2NUHA 2K3IA 3Q8YA 2VJVA 1TYVA 4TVAB 2HNYB 4C6AA 4JI3J 3T6BA 2ZJPQ 2ACYA 4P6QA 4OI1A 2UVVA 3HKZD 1O8BA 5K8OA 3L7PA 5HJXA 3KDOA 5CD4H 2LDIA 2EG2A 1S1TB 4Z7CA 1ZM9A 3AB2B 4DX8H 2ZM6J 4A8YA 1GX6A 5DGAA 3TR5A 1JLEA 1YBUA 5EWGA 1A7GE 3ADAC 2KHDA 2QY1A 2BJ8A 1AZSB 1IKVB 3MAHA 4USVA 5DRKA 1K8AT 4ES1A 4JI7F 3TEHB 7FDRA 3CO0P 1MN9A 2UV8G 3HXMA 4DSEA 4KBIA 5AJ3F 4FYXB 1SIWB 5F41A 9RUBA 3AXMA 1U45A 2ZBRA 3V6DB 2NSBA 3FCVA 4UOCA 4IDKA 5HQLA 5JVHQ 1SV5A 2H48B 2BJ1A 4DV1J 4M1KA 4OZ1A 1MMNA 1TL1B 1X5SA 1T11A 4LVNP 1KHWA 4OYPA 4ZPWR 1ZA1B 4Q43A 4YR2A 4N7TA 4J9OA 3TX0A 2GGPB 3CO9A 2M52A 1NH7A 2YY3A 1JLBA 4OZ2A 4NPOA 4Q7AA 4DSFA 2RB7A 2OPSB 3QAEA 3IN5A 1KBRA 3MMJA 4DX5A 3FRYA 2IBKA 4OYBA 1DBOA 4ILRA 3V4IA 2CKWA 3W2WB 3MPWA 4C8KA 1S79A 1KHVA 3PY8A 4DR4F 2ZWPA 3TX8A 1TUVA 1O6XA 4J91A 1RAGB 3NBPB 4UOGA 5DQIA 5FJ4A 3BGFA 5FDLB 3FCWA 1UEUA 2MKCA 3ML3A 3IO1A 3DM2B 4I64A 2OTJS 1HPZA 2IM2A 1DQ8A 2Z2MA 1ZOTA 2QL9B 1CS4A 4IOBA 4ECYA 2D3ZA 1FVQA 5E33A 2XC9A 3HI9A 5IT9U 1HBOB 4O3PA 2XO6A 1YZ6A 2ZH5A 2XMKA 3PHEA 4ZK7M 4OYMA 2VC0A 2M70A 2RQ4A 4W92B 4Z7YA 1WHWA 2HSEB 5DG8A 3A8IA 3HHDA 3LOUA 1ZTWA 2B6AB 3OHAA 4NZ6A 4NLQA 3T9GA 2IRYA 4CWBA 1WF0A 3AT1B 1LV5A 3NAWA 2O1PA 2RMLA 1HL6A 2BV3A 2QLXA 1QAXA 1QTMA 3KNGA 3MAQA 1E6YB 1B0VA 1HI8A 4PEOA 5DZ7A 1IBMJ 4DPWA 4FF3A 3BO3A 3HP6A 2GW8A 1V3SA 3UDLA 1UETA 1KFSA 1I51B 2VPWB 4CT8A 4I6WA 5E0OA 2KYXA 2MSSA 3TNVA 3HHNB 2FLPA 4E2FB 1SJRA 2W24A 2PN6A 4C11B 2F63A 4HT5A 2YWKA 1NPKA 4XR6A 2IBOA 5IC4B 3AA8A 4H54A 3W8PA 4KHMA 2AW0A 1PAUB 3O2IA 3R5GA 2OP5A 3OTBA 4U49A 2ZDPA 4MIWA 1X60A 1NB7A 3P6YC 2APOA 1ULRA 1GT8A 2CNLB 2EKNA 3DOKA 5F8MA 2OO4A 2XMTA 2E9RX 3ZPPA 2DNKA 2QLJB 5HO4A 2E1PA 3V81A 2DO4A 3BB5A 4IO9Q 1CZFA 2JC1A 1OYDA 3C14A 2QZAA 1CJUB 1RBOB 3SZ2A 1O8JA 2B8PA 2QLWA 4PRFA 2VB6A 1N88A 3QT7A 5ETRA 4XLEA 1ZBTA 2J6SA 1TL3A 3I4PA 1LOUA 2W4CA 5B0AA 2PA8D 5LT5A 2ROEA 4QIWD 1R8HA 4WJBA 1LWCB 3PZPA 4YZXA 1TVRB 2QFIA 3MTKA 3HFKA 1VDHA 4ZVRB 4OZNA 2XCPA 4W8SA 3B4DA 3NL0A 5EHHA 1WG1A 2CJXB 3P45B 4WXWA 4Z2XA 2BW7A 2B5JB 2X51A 2XYPB 1N54B 3KLEA 4B3RF 3BM7A 4EI2A 1C0TA 1L3KA 4RNOA 4M95A 3T6JA 3OFGA 1FT8A 2J8KA 1QVGR 4WK1A 2HHXA 1TKZA 3Q8QB 3IR7B 2QJ3A 2BM6A 3HCXA 1Z4UA 4DEZA 3AD9C 1L3TA 2JOQA 1XEZA 2POKA 4P72A 1IKYA 5BR8J 4PWDA 4CLPA 1HWJA 1O8LA 5DQHA 3SQGA 3CCZA 1QA3A 2DBBA 1MSWD 2BVZA 4ID5B 4PABA 2RDIA 1N33J 3BQ1A 2HFNA 4DUYJ 2VH7A 4QYZK 3T1HJ 2Y9HA 2ZOGA 4LF9J 1ROFA 3A3PB 3OL8A 4B3OB 4C48A 2J0WA 3J81U 2IFXA 1UKUA 3D28A 1KTWA 3QJPA 1MMLA 4Y2AA 1DZ5A 3P8BB 3QPIA 4R5PB 1RWOB 2F7VA 2HAFA 5KAKA 3ZSCA 1IR2A 4LF8J 1S1VA 3FVYA 2WVFA 4ZP9A 3BN7A 4WFYA 1NJIT 4W90B 1N5SA 2BKPA 1JIHA 1C0UA 3KG1A 3H98A 2C2KB 3PW2A 4YB5A 2B4PA 3QNWB 4ZJQA 4DI6A 1T94A 3KJVB 2C28A 1FX2A 4USJC 2KM8C 1WORA 2BJDA 2OPPA 3M1VB 3M30B 5MAOA 1PJ6A 2V8DA 4LFAF 1VQ5S 4DU8A 1IR1A 4JI3F 5KT3A 2GAGC 3FMWA 4PG6A 3V2UC 4K5SA 2R7QA 4X4PA 4PQUA 2HZAA 2W25A 4XIUA 2KT3A 1GMWA 4RO0A 3DDIA 1TL7B 2IMWP 2MLXA 2PE8A 2BJ3A 4QZVB 5J2PB 2ZM6F 5ETKA 4K0KJ 1VRUB 2PC6A 2E29A 1XMOJ 5A6WA 1HF2A 1GMWD 2JFKA 2CYYA 3PCOB 5KFHA 2PIIA 3KNAA 1VBXA 4QR0A 2AJFE 2VIHA 3LWLA 4ZPTR 3I56S 3B90A 3G4SS 2W2MP 4H4MB 1SKWA 5K8MA 2NT9A 3ZFVA 2RAQA 4ZJOA 3W5XA 3GJSB 1FWKA 3K7RA 4ER8A 2JC0A 2PMZD 3Q86A 1H2UX 2C2NA 1W25A 3H4DA 1BD6A 3P5TL 1DLOB 5KFAA 4DV1F 4OPWA 1UJ6A 1RUSA 2N4CA 1J5OB 4KFBA 3CJ2A 2QGFB 1X4CA 3KYLA 4XN3A 5E3PA 1M5OC 3POTB 2WZ1A 2DNYA 1KQFB 1UTAA 1YLXA 4QU7A 3BBFA 2AWZA 3LP1A 4J5OA 4OJ3A 1NJYA 1KWMA 4QBUA 2OD6A 5EX0A 2QYCA 2ZH1A 1BQNA 3B54A 1EB0A 3MOZA 4DU7A 5IFMA 3QZ8A 4RW8B 3MFIA 4HYKA 3JAMY 3EZ5A 3ZTSA 2CZ4A 3ZZTA 1YJWS 2MPUA 4B9MA 1Q7LB 1BC6A 2X1AA 2QLBB 2MQPA 1X4DA 3R3TA 4G65A 1YQHA 1QTNB 3MPYA 4KHRA 2DRAA 4PR6A 2DGSA 1RJJA 5KT6A 1LWXA 5GAHI 3OTDA 4KO0B 2BJEA 4A46A 4EWTA 3LWMA 1F60B 2NYHA 3HSJA 5ETNA 4LR8A 4G1QA 4J9MA 3WX8A 2G0YA 5GADU 5GAGI 4WIQA 2B9EA 4DFJA 3DLHA 2HHHJ 2NZMA 3PW5A 3FSXA 2ALYB 2CJBA 3H09A 3DYAA 3PXGa 3HT0A 2X1BA 2IRXA 2HQIA 3RYLA 3PO4A 2J9DA 5L1LA 2OKQA 2EEYA 4JP8A 1BHNA 4ZPCA 3OFEA 3C16B 4KIAA 2O67A 4DJBA 5KFKA 3SYZA 1XMBA 1IBMF 3BDPA 2A2DA 1FK9B 4ZHRB 3DI6B 5KFOA 2J76E 3HPOA 2HYIB 1VQNS 2MSTA 2W4DA 2OMLA 4ED7A 1V3ZA 1R0CB 3W3SA 1RT2A 1UW9A 1KRPA 2BXJA 4I7FB 2AU0A 5A2QU 4OZZA 1PE9A 3DLJA 1RWWB 3OQ2A 1F6TA 2AZ1A 4F8RA 2Z2ZA 2XI2A 3U1MA 2K3KA 1R8CA 1C1BB 4OYAA 4EMDA 2IIHA 2W1BA 2MZQA 1A0OB 2YNFB 3UVJA 2AT1B 5J2NB 3U27A 3NGTA 1H98A 3QLHB 3WIVA 2R8IA 4XLHA 2DK2A 2G2ZA 3BYPA 3UE2A 4I6YA 1TL4A 5E5NA 4RW4A 5T7LA 5A6PA 4ECRA 1EQ0A 5KFLA 2WONB 2ZOMA 4ZP8A 2W7AA 5KFIA 4DF8A 4XKVA 3FBFA 3NCPA 2VKRA 3M6WA 4C9DA 4NWBA 4RUHA 3N01A 2Y0SD 1X4HA 3CJ8A 3CSKA 4E0DA 3OXLA 5ETTA 3MR2A 4EBDA 1VJWA 2IAJA 4I7FA 4Q44A 3JYTA 5F9LA 1HMVA 3C6TA 5LJ5Y 3TEGA 2WBMA 1RWNB 1EKRA 2YNFA 3GQ9A 4DL7A 3FUYA 4F7VA 2F3LA 2C3MA 3FK4A 4PYAA 2ZD1A 2LU1A 2I0XA 4CH0S 4M5LA 2WONA 4ILLA 2WW4A 3JSBA 3E51A 3FSYA 2XEXA 4PPZA 2QSFA 5F8HA 1KNZA 1G3OA 3ETMA 2Y1LB 3M32B 2LQ5A 5BR8F 3N5BA 1D8ZA 4CLWA 2IMOA 3CTRA 4ZN3A 3BN4A 1PC4A 1QUVA 1AYEA 4R8UA 4CO3A 2RQCA 2B4OA 3JSYA 1SH3A 2K1RA 1N33F 5CYMB 5EGYA 1WHVA 4DUYF 4HLBA 4XONA 3T1HF 4LF9F 1H2TZ 4M5MA 2DNZA 3EQNA 2VG5A 3C3LA 3NKYA 4TU9A 3THVA 3TQ1A 4DR5F 1MNEA 5KG7A 3ZXWA 1N5TA 2GHVC 5KFSA 2ZE2B 2ZUGA 1OMSA 4DL5A 3J80U 2VFRA 1CEZA 1S6QA 4LF8F 3L95X 4WE1A 1JLFA 4XLCA 3JTNA 2AGPA 3MDFA 2Z8QA 2KTQA 2GQCA 3OTEA 1O88A 2IQ7A 1UL3A 2E5LJ 2GIRA 2B56A 3MM5B 4FF1A 2VG7B 4IYQA 2VZ9A 1YJ7A 2K06A 1FD8A 4X4QA 3I96A 3JS9A 2JEGA 2B0RA 2W8KA 1TKTA 4HEA9 1VBKA 4DL0C 3RZAA 4UOFA 1YGYA 1WC1A 1Y7PA 1RKIA 1T9TA 4DR7J 1OSCA 3BGRA 4RJVA 1F5BA 3JQMA 2CWXA 5J1PA 3LANA 5THWA 1JQGA 2WOMA 1U7LA 2CJ9A 1WD6A 3MM7B 3FKBA 3HVTA 3ISND 4ENOA 2I38A 1HBUB 3RTVA 4PUOA 2HGLA 5HVFA 4XO0A 3ZZ0A 4O3NA 5K14B 2HAIA 2VG7A 4K0KF 1XMOF 1MWZA 2R7RA 3KG0A 1Q8IA 3PVXA 3Q8VA 1UWBA 1JWWA 2X85A 1NKBA 3MD1A 4C2LA 5L8RC 1S49A 2CPFA 4B17A 2HNZA 2V6AA 3QSYB 1RA7A 2YKAA 3UPFA 3MAAB 4RBVA 5D15A 4LSLB 2IVFB 2J9EA 2E7VA 2M3DA 2ZVIA 2RQKA 2GS8A 3KUGA 2MQMA 4B9SA 2DH9A 1DHMA 4ICLB 1FVSA 4USUA 2I5JA 3QGPA 4DR1J 4K4YA 2VA2A 5MLCV 4LJMA 2BM5A 1QLNA 4FVMA 1YRXA 4EFAC 3L9ZA 3MEGA 3D0HE 1NXIA 1B7FA 3PEJA 1MG7A 1XK8A 3M05A 3FSIA 2FZCB 3DRPA 3ZZPA 2ZC4A 3RAMA 5KT4A 2LLZA 2XMMA 2ERRA 2OEJA 5KFMA 4OZ0A 3TP2A 2N3OA 1KTVA 4C3LA 2L48A 1TAUA 1VI7A 2QE5A 3FRZA 1S1UB 4JRAC 4GVBB 2MKJA 3KUEA 3V6KA 2NXNA 4HI2A 3UD4P 3WHIA 4I1TA 2EBGA 2HQCA 3NMAA 2CPHA 3LW5C 1TMMA 3O8WA 5HATA 1U02A 2OI2A 3KHLA 3T41A 2RHQB 1QAYA 1N4LA 1BGXT 3LUYA 2W9BB 1SKSA 1BQXA 2HHHF 4P2XA 3CF5Q 3BO2A 1X4GA 2MB0B 4ZPBA 1PBAA 3DOLB 2ATLA 5C1EA 1TAQA 2R8KA 2I8EA 3GQAA 3LGMA 3R8YA 5D4PA 2ZUAA 3TUJC 2CIMA 2IDEA 1PGZA 3KHRA 2GNKA 3SCIE 4PKDB 1T7PA 2XB2D 2DNNA 1X8DA 4IRCA 3AHPA 3G82B 2RU3A 4EW9A 5KT7A 2AIRB 2OSRA 2WAQD 3LP0A 1T05B 4CRJA 3NWGA 1EE6A 2OTLS 2EWHA 3MTJA 4YDDB 1RYRA 2Y1RI 2R7OA 2E1MC 4PPDA 4CLLA 1U0HA 3I5BA 3W9HA 3MURP 5KFZA 4P52A 3H40A 2HKEA 4B9VA 1V5VA 3LO3A 1RT7B 3BGLA 2DR6A 4G3IA 3IWXA 1NB2A 1EP4A 4K4TA 3IWNC 3ITHA 4QOTA 4CLFA 1HNIB 2ZJQQ 4LQ3A 2DHHA 1T03A 3KTQA 4H4OB 3IA0A 1HNXJ 4QPXA 3I55S 4OQJA 1PYTA 1U26A 2GMHA 2AMCB 3W9IA 2QT7A 1LNQA 2A18A 1B0PA 1UW4A 2FUG9 2FVPA 1UVKA 3HJVA 3ZTQA 2UZAA 2C3PA 4FS2A 4NEZA 4WYLA 3TW0A 4QWDA 7AT1B 2H5EA 4KH1B 1FO1A 4RNFA 1LXJA 1MROA 3MMBB 3GRHA 1Q8KA 2KT5A 3RW6A 3MFHA 2XT4A 3NMRA 2LEAA 3GZ7A 2R2UA 1T9WA 5HBMB 5E3AA 3C15B 2YX1A 4A8SA 4U7UD 4IRKA 5RUBA 2KU7A 5KFGA 4OZJA 1OY6A 4AT1B 4MYUA 2NTQA 1UAWA 3EZUA 3U1LA 1Q82T 5KG2A 3FGVA 1FWPA 2YKMA 3W61A 1KVIA 3A3NB 2I6WA 4LRFA 5HANA 3ZO7A 2ZDOA 1HBMB 2UXBJ 4IO1A 1HW8A 4ECQA 5C24A 1DTTB 3ILJA 3OFHA 4OJGA 2XZWA 2DD8S 4KR0B 5KFXA 4USHA 3BDEA 2ASJA 4LSZB 1FRHA 4IFVB 2L3MA 2Q79A 3S7RA 4NA2A 1E6VA 4DL3A 3M7VA 1K73T 4L3NA 1YG0A 4ELTA 3E01B 3LALA 4QPTA 3H5UA 4X4TA 4A8KA 3ZZOA 4ALZA 2EKYA 4V19J 3SQVA 3DKDA 1NAQA 4MKVA 4HTIA 1RQ0A 4YELA 4F4AA 4DX7A 2N7CA 2B7BB 3QYYA 2CPEA 2H65B 1KQGB 3VGSA 3S01A 5LSLA 4A8QA 2A0FB 2HVEA 1SJ4P 3MOJB 2LA6A 5I42B 4KGMA 4NI2B 2M7SA 2VFOA 2MQQA 3FBCA 4P74A 1RWPB 2E5LF 1WDDA 1X31C 3PKMA 2AJ1A 1NDKA 1HYSB 3KWMA 4ZP7A 3GWCA 1WUUA 2FD2A 1F9FA 2MJNA 3T5HA 1YJNS 2CQ4A 3E01A 3MR7A 3ENAA 2E9ZA 1U1QA 2CZ9A 3T9ZA 4DR7F 5BYRA 5BYQA 4NYZA 2ZEJA 1JLGB 1NBEB 2V2VA 3N0VA 2NTPA 2EC2A 1FTRA 4WP9A 1RAJA 1RTDA 3P49B 1WKKA 1QRBA 4RW6B 1VC0A 2CQGA 5F3ZA 4TLRA 4BHQA 1JB0C 3D54A 2QIFA 1K44A 1BXNA 3A3OB 3BQ0A 1REVA 3W2VB 4ZVOB 3KK2B 3GSDA 3MMCA 2BKNA 3QO9B 2LXIA 4FYWB 2VG6B 4TXSA 1J5EJ 2D69A 5F8NA 3NGDA 4LQ9A 2M88A 3HHKA 3SIPB 2W9CB 2AKWB 1NDCA 4MTPA 1M1KT 3GG1A 4X65J 4NCGA 3GE9A 2ZNZA 3X1LB 3EJMA 1HQ2A 1Q53A 1QSLA 1JLGA 4LREA 1XNRJ 2N3LA 3TAMA 2GA7A 4ZVPB 5G4DA 4EBEA 3FY3A 3N5FA 1XR7A 4MJKA 3DDNA 3QWPA 2MY7A 5ETPA 1FXDA 5IC6B 4YEJA 2BZ2A 1N56A 4B3TJ 2J5AA 1D8YA 1HWLA 2WVBA 3K8VA 4DR1F 4KYZA 1S77D 4QU6A 2M2BA 1IUJA 3BH7B 1G1XA 4OHZA 1SJFA 1UA0A 2BM4A 1NZAA 1FEHA 1B3TA 5LL6d 1WEZA 2RF2B 5KT2A 1N32J 3LPYA 3MEKA 1F9HA 3QO9A 3H25A 3U7JA 5J1EA 1JTAA 3A12A 5IS2A 1S1XB 1A9NB 2O66A 4CT9A 3T5KA 1RAOA 3IRXB 2UXDJ 5JMNA 2QA4G 2LEBA 2Q6CA 4MIAA 2WSCC 1YJVA 4NMLA 2X3HA 1ZAWA 1F1BB 2DRDA 4X4RA 3SYJA 4OI3A 4CLUA 5AXKA 3OT9A 3PTWA 4ZITA 3F0NA 2VOOA 2R7UA 3IMQJ 5A8KA 5M2UA 2EBEA 3DLEB 3E3XA 5H9EJ 3RGIA 4CLYA 3R9LA 5GAEI 2RF2A 1N5YA 1L1IA 3M8RA 1KONA 3UNYA 1TZ0A 1CSJA 3D6HB 1OGOX 1W2BR 3EMTA 3BYRA 1HFEL 3Q8PB 1N6QB 2R7XA 3GR0A 2VJUA 2BQ3A 3FZBA 2XULA 2NR0A 3I0SB 2YH1A 4QJVA 1AFJA 1NDPA 4NLXA 2ZH3A 1NDLA 1JLAB 4N77A 1RMGA 2XO7A 1B70B 3H42A 2XI3A 3SMZA 1UWAA 4Z05A 3A4TA 4ZOSA 1RWMB 3G6XA 4QIGA 5EWEA 1EETB 3EXYA 3HD2A 4ZN1A 4RBTA 2M4MA 4ZVQB 3AOBA 4F3QA 1RTJA 4JYAJ 3TOQA 3HD1A 1FD2A 2JZ5A 2JNJA 1S72S 3D0GE 3I0RA 1TL5A 2G4BA 3KLHB 2V4JA 3VHQA 5C25B 2XSFA 4P7VA 3DGPB 4HT7A 4WIIA 1DURA 4FNIA 1VCTA 2RIJA 4WFZA 3IP0A 3ZNJ1 1WKJA 3ELHA 3R7NB 1KCCA 1RT3B 4E8UA 3H7HB 4O44A 2XMWA 3EZOA 4YHHJ 4QW8A 2KVIA 3OJUA 3H4BA 4GKKJ 2CPIA 2FYXA 2KRRA 1H38A 2EG1A 3JURA 1HI1A 1HD1A 3D3BJ 2IDLA 4FDFA 3J7YI 1X0FA 4CTAA 4WYWA 2XS5A 2ZHOA 1KOOA 4EGLA 4EZ9A 4LFBJ 1U6FA 3KLGB 3FNNA 4QIVA 1VRQC 3HZGA 1ACMB 1KP6A 2LQBA 2OUGA 3VV2B 4ZLNA 2KM8B 2ILZA 4M5NA 3VMVA 3CW2C 2CVIA 4I0WA 3EDRB 3NS5A 5HK4A 3SI8A 1PILA 1GEHA 2I2YA 1RTIB 5HROB 2DXDA 3AODA 2YBVA 1S9GB 3RUBL 1O8GA 4XKWA 4L6V3 2HHQA 3NNHA 3VSUA 2OPRA 3PW0A 2UXBF 4OI0A 3LAMA 2WSFC 3CC2S 2LDYA 2OELA 4GVLA 1U2RA 3C66A 3IC1A 1EX8A 2EPIA 1BN8A 3BQ2A 4N5SA 3CCTA 4M5DA 1O51A 2VODA 2GJ2A 1OSDA 3GIJA 4B3SJ 2YNGB 1FDDA 3RU0A 4X64J 1AXQA 2H3EB 3K59A 4NZ0A 5B0EA 2AYEA 4PG8A 1RU2A 2VQFJ 2HHWA 3NNCA 5AE1A 2BEFA 3OJSA 4AL6A 2KL8A 2D74B 2HQ3A 3GLJA 3IG1A 3M8PB 3F56A 4BC7A 2NS1B 2JL9A 4CI0B 2QA2A 2HIQA 3CJ0A 3SQOP 2CG4A 5KFBA 1SQEA 2JJ4D 1U49A 3KMSA 1C4CA 4XQFA 2YKNA 3OTOJ 2OPQB 2C2DA 3L3CA 5DZ6A 2BE2B 2CQIA 1B0TA 4UW2A 5HJYA 3T3FA 4JV1A 1VMBA 2DGOA 1JXLA 5EDWA 4O0IA 3K5LA 3HF5A 3CCJS 1UCNA 5HSPA 1NK6A 4I2PA 3MCMA 2IPOB 3ICLA 1F5CA 1VQ8S 2V8VA 3RBZA 3DLBA 2DNPA 4ID8A 1RT4B 4G1PA 3N6MA 4CDIA 1SL1A 3M8PA 1BQMB 3CJKB 2HFSA 2HFOA 3JSMB 1TR0A 2HS4A 3LYCA 4LVOP 3LF0A 4CP5A 1MWQA 3G9CA 3QRRA 1H6KX 4AL7A 3U1NA 4NLRA 4JI4J 4DFMA 1KEKA 2LCWA 4KQZA 2HFZA 2KG0A 1QSYA 4HTJA 3EGVA 1P1TA 4K8RA 1O8MA 5FIIA 1HR0J 3OR2B 1FFWB 2JLEA 5KFYA 2E1CA 4C0BA 4PG7A 2RKIB 4TQRA 5A0YB 2DCLA 1J5EF 4KV8B 2GQ2A 4DCPB 4X65F 4XORA 1FRLA 4C8ZA 3R5CA 4P10A 2B9YA 4RUCA 1XNRF 2X6YA 1CULA 1BLUA 1FRMA 2XSJA 3OR1A 4WFNQ 2IYIA 4WP3A 2QG9B 3K5NA 3K17A 1WC0A 2VFUA 1HHQA 2B4VA 2XMAA 3CMQA 5J2MB 4A8OA 4B9LA 4ECTA 3BGUA 3UWTA 1NNDA 4B3TF 2PFFB 4O0NA 2DH8A 2CNOB 4AE5A 3DU1X 3CD6S 2VPXB 3SXLA 1DQAA 1YI2S 1C4AA 1N32F 3CMES 1QUPA 3M2VB 1H73A 4WFAQ 3A1YG 4OX8A 1HI0P 2G9OA 3UQSA 4ZIWA 5KFJA 2WVDA 1SC3B 1NSQA 5KOXA 4KAIA 4IG3B 2VDIA 3PYDA 2OSQA 2UXDF 1T3OA 4DR4J 2M8HA 1HNVB 2MGZA 4A48A 5GAHU 2X3GA 3PRVA 1N48A 3DFEA 2V4QA 2KYZA 2F4VJ 4I6AA 2P9GA 4CLKA 3UNGC 5AMVA 2XZDB 5J2MA 3GFYA 5KG4A 1OQ3A 1VQ9S 4FZVA 1SH2A 3UDCA 4E98A 2PO4A 5HP1A 1SJ1A 4RW9B 2P6TA 1RDRA 2MZRA 5I4MA 2DRBA 2NSPA 4U67Q 1CJKA 3JSRA 4BCAA 4O3RA 4LF2A 5A8WA 1IKXB 1SC1B 3M2VA 3EX7B 3GJQB 4FF2A 1JNRB 2DNMA 2WCXA 3VGTA 4JUZA 2RJZA 2GO9A 2F4FA 2E44A 4HDHA 1KLMB 2JEJA 3HX9A 1WWHA 4WKYA 1RSCA 5F0UA 4HKQA 3L7UA 2MKHA 5E3QA 2V5IA 1XN9A 4PXEA 1QDUB 4TY8B 4TKTA 2YNIB 2LFVA 3PR4A 4DG1B 1TUWA 1K0VA 3KLIA 5BJRA 3DOMA 1SC4B 4ELVA 1NH8A 3MF5A 3THTA 3K58A 4C8NA 5DQGA 3RRGA 4NXMJ 5M2RA 1AROP 4FXWA 3OVSA 1EKSA 4C3MA 1K1QA 2Z2LA 4JYAF 2GQQA 1U24A 1VRTA 4O4GB 3FEZA 2EVZA 3ZZUA 2NZCA 3MM6A 2HMIA 5C42A 1P27B 1APSA 1VOMA 5EX3A 4OHYA 3AH6A 5L46A 1NSPA 4TQSA 1YIJS 4CH1A 3SSSA 4PG5A 2C2EA 3CEDA 2NPIA 2WVCA 3JX8A 1EA0A 2VFSA 2GCFA 2C42A 3K57A 1Z2LA 4M8LA 2RSQA 2U2FA 3DU6A 2HVZA 4YHHF 1FKOA 3PSSA 2NXEA 4GKKF 4NE9C 4IKAA 1NKCA 2WB1D 4IG0B 2H9ZA 1OO0B 4YP3A 3Q0AA 3H20A 3GQ8A 3DC2A 2HGNA 3RB3A 1Y3JA 4LFBF 3OL7A 3IBWA 2RVJA 2R8JA 4LRBA 5AXMA 1CJTA 1PCAA 3M9NB 1RT6A 5B7WA 2RH3A 1RAIB 5IXUA 3NG8A 2FJVA 4F02A 5A8RA 2FZKB 3Q83A 2H5JB 4ECWA 1NHCA 4LUBA 3NEKA 4TYBA 1NPRA 4KGKA 2C22A 1HG8A 2E5IA 2HWTA 2F8MA 2VBEA 2OHDA 2EFPA 3EICA 1XR6A 3GR1A 4IG0A 3PM9A 2V8PA 1IWAA 2CJQA 3TUPA 4ZKAA 1MWYA 3M8QB 1JKHA 1DTQB 3GYXB 2F1FA 2DPJA 1NPPA 1S9FA 4Y0FA 1UPPA 4DQSA 3NCRA 3TI0A 5HVGA 3DMJA 2V9WA 4OV1A 5LXRA 4JV2A 4B3SF 1GMVA 3PW7A 1UVIA 2B3TB 1KQKA 1K9MT 4XOTA 3UD3P 5IV3A 4X64F 3ETOA 4X4UA 3RG6A 2VQFF 3QIPA 2E66A 2OEMA 5D3GA 3D5MA 2R7WA 2HQFA 1WACA 3AJ1A 4LSNB 3L4BC 3I31A 1JK9B 1Y3KA 4DR6J 1IXKA 1GK8A 3R5BA 4YN3B 1RU1A 1U8SA 1MMDA 1TYWA 4ETXA 3ET6A 1OFEA 4L76A 3OTOF 1RCXB 2YNHA 4UQGA 3PIPQ 2HK3A 4F2RA 3Q23A 1H2VZ 3NRBA 4ZLJA 3PDNA 3KMQA 3MI7X 2R2SA 1SUQA 2W2QP 3DRYA 1ZAVA 4ATNA 1M5KC 2Y8WA 1QAJA 4NXNJ 1IN0A 4I2QB 1RBAA 3D9BA 2QSWA 1PAEX 3VVTA 2RU9A 1UVNA 3QRQA 1XQIA 1LWEB 3H59A 2OJ3A 3CJQA 4DV3J 2MLYA 1CC7A 1X5OA 4F26A 3RB6A 5B0FA 1C1CB 2MQ8A 3TRGA 4ZCIA 3M2RA 1RISA 3HSZA 4DL2A 1XWLA 3HFZB 4I4BA 1NJWA 4KKOA 3W65A 1U6ZA 4JI4F 4Q0BA 1M5SA 4YZQA 2U1AA 2ZC3A 3CWJA 2CNNB 4IFYB 4W4MA 1HR0F 5EWFA 3I87A 2CRLA 3MEEA 3KHHA 1I3OB 1S6PB 1EJ7L 3QGHA 1PSDA 5AXNA 2XYHB 2BOPA 3M2UB 2IHR1 4D3GA 2ZH9A 3UW0A 4YDXA 3ZTOA 2NXJA 2PMHA 4C4WA 2X1FA 1KLNA 2HNYA 2OFHX 1LW2B 1TV6B 3DRRB 4IUFA 4BWJA 3CJ3A 1UPMB 4V1Ak 4TN2A 4Q8EA 1P6TA 1LQ9A 4ED3A 3NS6A 3EPGA 1RT1B 3K0JA 1S1TA 1DRZA 3SDEB 3GQCA 4HR2A 3GU0A 3F41A 1FWLA 3W9JA 1XR5A 1RT5B 4K4ZA 3DLKB 3OBIA 3HMJG 1NSAA 2PI4A 1FI4A 4NMXA 1N0UA 1AZSA 1IKVA 2IA6A 3T1AA 4ES3A 4RPFA 4Y00A 4EBCA 4F0KA 4URGA 1F2HA 1EHWA 5CHCB 1M90T 3AK5A 1FKAF 3MGJA 2LYVA 4DPYA 3Q8UA 3L7OA 2MEWA 5E7OB 1M1HA 3QT6A 1D1UA 3G6ES 3CCES 1U4BA 2R7TA 1SB6A 1U1PA 2LA4A 5DM7Q 2YKOA 3QWUA 2F4VF 4X84A 2UVFA 5JXSA 1R6YA 2JVOA 3GV7B 3V6DA 4B9UA 1HWKA 1O8KA 3FCHA 4OHWA 2MQLA 2BR0A 4KH0B 1NMEB 1Q0NA 3BKFA 1KQ5A 1TL1A 3VAMA 1F2GA 3D66A 2FY1A 2M9KA 3AOCA 3KHGA 3MMAB 2BANB 5DDOC 2CPYA 4J9RA 1ELOA 3EPIA 3AB4B 1ZZNA 2GGPA 2MXYA 3I5CA 1RAAB 4M5IA 3MXHP 2OPSA 4WTOB 1U09A 2Q6BA 5GVQA 5KFNA 4EYHB 2ZWOA 3GV8B 1NK0A 3K8WA 2GIFA 2HIYA 4U6PA 3SSRA 3W2WA 3SZEA 2Q66A 4P2MA 3NBPA 4ZVSB 4PZVA 4MK7A 2ZH4A 3CD7A 5FDLA 2NUUG 3SFUA 5ETMA 1I5OB 3OV7A 4CLSA 3DM2A 2FJEB 2XLJA 1MW7A 2MZTA 4A4JA 2DHAA 4NXMF 3A8JA 1RAHB 2SXLA 2BACA 2CQ3A 3HDSA 5D4LA 4DDFA 2DR5A 3AD7C 1HBOA 1GTHA 3RRKA 1U25A 1Y5NB 4FYVB 1YX2A 2AJ4A 2HBYB 2CPZA 5I3PA 2DT9A 2MZ1A 4HHJA 1HNZF 2G13A 1ZPWX 3G6YA 1FF2A 3BH6B 4EO8A 3RR8A 2B6AA 1IA5A 2XWXA 2VFTA 5DO2A 2FGOA 2DR9A 3GIIA 4RWWA 3IAS9 1VK3A 2QEXS 2YKQA 5H9FK 3AQOA 2PECA 1TKXB 1ZZFA 1E6YA 1SC6A 1I1GA 3K5PA 5KG3A 2JEIA 2IVMA 3SCKE 1L3SA 1RHKB 4GO5X 5K8NA 3DHXA 1O0PA 2RILA 4USTA 1VHIA 2J0SD 2CQ2A 2HNDB 1W2IA 2KB2A 3MECB 4OJ5A 4TLQA 2R2RA 2V67A 1HQUB 1REGX 1WG4A 3CCLS 2MLZA 4NLUA 3N79A 4U8VA 4XDCA 4LT6A 2HHSA 2XNRA 2GVDB 2J7WA 2W4PA 3OD2A 3FBBA 3R97A 4C11A 1UP1A 5ETOA 4MAKA 1D9AA 4AYBD 4J90A 2BSPA 1GFWB 2NREA 3QSIA 2G0JA 5F3TA 5AXLA 2ASLA 2JLFA 2VBYA 1ITPA 1XG2A 4EUVA 4YFUA 3GB0A 3QQCD 2G1DA 3MEDB 4QR2A 2VKZG 5EUHA 1K4ZA 4TNOA 4O3OA 1CQMA 1GX5A 4OYOA 3OUYB 4RU2A 3ZC4A 1CJUA 4OI2A 1LLWA 2ATCB 1K47A 3HZEA 2DIUA 4CIOA 5BXIA 5K20B 2H4WB 3CCWA 1K5CA 3ILOA 3VAHA 1X4BA 1BWEA 4KC5A 4CQ1A 3FC9A 1VS3A 5SZTA 3N9UC 2G2YA 3H2VE 2FVQA 1WKLA 2ASYA 2J6TA 4YEIA 4DZ6A 1K8FA 3TAPA 1GNKA 1LWCA 3RR7A 2DNRA 1TVRA 4O4RA 1FE4A 1FJ7A 3JB9k 4DPUA 1V3RA 3R1LA 5LJ3Y 4B08A 2YWFA 1KSPA 3JTOA 2B5JA 2WK4A 4MFBB 2FLOA 1IDKA 2W8LA 4A8WA 4DR6F 4AFFA 2IM3A 4MT1A 2ZZTA 2GV1A 3KLFB 3P3DA 4DR5J 1RADB 4OJLA 4A8XA 2R4FA 4ED4A 1NJXA 3KK3B 1DQ9A 3BEGB 1X4AA 4ANCA 2FLNA 4JBCA 3TA2A 4EYIB 2CJAA 3HVWA 2O0WA 3EWGA 3QGIA 1F3FA 3KLVA 2WVEA 3LP2B 4OYWA 1UEKA 4AXIA 3N6NA 7FD1A 2I9SA 1VK8A 1HBNB 4U96A 4B9NA 1KOHA 3M8YA 3Q2TC 1SPBP 4PWWA 2J9CA 4NXNF 5KFWA 4MK8A 4F4XA 3LQVA 4ID5A 4IH6A 1I94J 5HI7A 2YWGA 5DJBA 3W5ZA 1WOPA 4L72B 2DEJA 4NCBA 1IJFB 3BKTA 4OM9A 3E2EA 2DTJA 4NASA 3MWBA 3G8SA 4QQBA 4DV3F 2B8QA 4DV7J 2HHVA 4B3OA 3CDBA 3PRDA 5KFRA 2XMUA 4YS2A 1Q7YT 3VWSA 3ZZZA 4Q45A 2F9DA 4RNHA 5HMWA 4YUDA 2G0CA 3KK3A 2RRNA 1S0NA 4R5PA 2HW3A 5GMDA 3R2CJ 3GCXP 3KKFA 1Q8LA 2XT2A 2BJ9A 5HQMA 2XGPA 2GJIA 5IQ6A 3TQEA 1AB8A 4UY85 1VHFA 4RUAA 3ISNC 4YZ0A 2H5IB 4J37A 4QYZJ 3MM9B 3KJVA 2DVIA 5D6GA 2BOAA 2VFPA 3BF4A 2B0GA 4FVCA 3M1VA 3M30A 4ETZA 1QJHA 1KC8T 5HLFB 5CABA 2RHSB 2VBKA 2VV5A 2XWYA 3ENQA 3VAFA 3GYNA 1XC9A 3AXKA 4A47A 2ZZNA 4EK2A 3D6TB 1TYXA 3KXDA 2XMVA 1JX4A 4YC5A 4XAKA 5C5JA 4KGZB 2N82B 4NOHA 3DXSX 4ECXA 9ATCB 1Q1KA 2XG8A 1TL7A 2QLFB 1YKWA 5E2QA 1JXVA 5J2PA 4ED1A 3KJQB 1NK4A 3ENVA 1VRUA 2HBQB 4RWXA 4FNHA 1R0BG 2MZJA 4AUKA 2Y1JA 4UT4A 2V8HA 2HRUA 4CNZA 1IR0A 1VFJA 2VHGA 3X3UA 1TMJA 2VFQA 4P2FA 2G1HA 1Q78A 5CYQB 4H4MA 1UJ4A 1QRCA 1NRKA 3UCUP 3EVWA 4NK6A 3DGVA 3CD0A 1RLCL 1P9QC 5J2QB 2HEKA 1Y5IB 3OL6A 1FRJA 1FJGJ 5HVHA 2L9WA 1LWFB 3GILA 4C0HA 1IB4A 4N56A 5GAEU 3GSIA 1U48A 3KK1B 1CQNA 1QJVA 3G8QA 1DLOA 1U2CA 4YZAA 3PR5B 5KFEA 1J5OA 1S1WB 1HA1A 1Q8BA 3CDWA 1U1RA 4P7TA 4ZA1A 3POTA 5FLXU 2ZFHA 3BSNA 1V5IB 3OPKA 2QTWA 1NJZA 3NGSA 4ZLLA 2DNQA 4DS5A 1VBYA 1DBDA 4CO4A 3TH0A 4X4NA 4XDDA 4BS2A 2DEIA 3DRSB 1IM6A 4XL9A 4RW8A 1RTHB 4DL6A 4KH3A 3A8KA 1JNZB 3R7SB 5IM0B 1LWFA 1FE0A 2EC0A 3CPWR 3WC0A 1CC8A 3NLCA 1VBZA 4DUZJ 2DR7A 3TJ8A 1G7CB 2C2RA 2RRBA 1L5UA 4PAAA 4IR1A 1TKDA 1WOOA 4KO0A 3MUTP 4RL1A 2P9CA 5D77A 1YZ7A 2L41A 4FXVA 1HW9A 1S0VA 5U47A 4C7QA 1N52B 1NK7A 4RU9A 1FNMA 2IY5B 4I69A 1U1MA 2BBEA 1ZS6A 4R25A 2VBXA 2DY9A 3W60A 2FLLA 2XLIA 1U0SA 4YB6A 3CCQS 3UD5A 3GFHA 2FY8A 3CCSS 1CJVB 2FIUA 3VAJA 2CWKA 2HRYA 2VASA 2E1AA 3D4JA 1UMJA 3C16A 4PMHA 1YDLA 3NS7B 2PYHA 3AJDA 3IR6B 4RZRA 1FK9A 4ZHRA 4OX7A 3DI6A 3G86A 3P4UB 2NYIA 1R0AB 4OZLA 1QM9A 2GAHC 2UV8A 1VQKS 2VFVA 2ZNYA 3EM1A 2LMIA 2XY7A 4DV4J 3M9MB 2NQPA 5KFPA 1JJ4A 3TVKA 1C1BA 1PYSB 1JLQB 4DWIA 1JRGA 4J9LA 5J2NA 2FTRA 3PO5A 3VTIA 1T02A 3QLHA 3QGGA 3EVMA 3N6ZA 1OPZA 5CYJA 4CCHA 1Q5VA 2HWIA 3L09A 1WJ9A 4NX9A 1CLFA 4DHVA 3CVKA 1X4EA 3KG4A 1K1SA 5ETLA 5HMYA 1U8WA 2Z0GA 2AV5A 4RNMA 4FXDA 2JHEA 1R8AA 3CJ4A 4KE5A 2A6OA 1UFLA 1BWVA 3R27A 1R8PA 6AT1B 2FC9A 4W98A 1A6LA 1YK9A 4K50A 1OFDA 1RWUA 3IS9B 2Z58B 4OI4A 2LEPA 3DXBA 3H2UB 2ZBQA 2CA9A 3CD5A 4F50A 1NK9A 4ZCMA 2HHUA 4ECUA 4C3KA 3TVYA 3QBCA 2XNQA 3IGVA 4JB8B 1SL2A 3MPVA 4Z37A 5EN1A 4X4SA 4HWVA 3PX0A 4CO1A 3UR3C 3CUNA 5AE2A 1RWVB 2G0IA 4OJOA 4JI0J 3M32A 4MKYA 4WFXA 3NGUA 4GRSA 2DNOA 3I6PA 4C98A 2KVQE 2MDAA 1YBAA 4W8QA 1Q81T 3W62A 4J9UE 1I94F 3WQPA 4LRDA 2X3DA 1UEVA 5DETA 2XS7A 3FQLA 3PX6A 5CYMA 2O6WA 4ZDNA 1WC6A 1QD1A 4IDKB 2DPIA 2AHOB 4DV7F 1BMQB 3NAIA 5CCMA 1SV5B 4WTYA 3G87A 3QFWA 3D68A 1NHVA 4DFKA 1FRXA 4CZCA 1LXNA 3NP5A 1FA0A 1FJEB 1SKRA 2ZE2A 2BRKA 4WZQA 2MKKA 1S7HA 2ZVSA 1H74A 2BM1A 1JLBB 2LQ9A 3GONA 1FDAA 2MY8A 3Q89A 2MKSA 4OL8A 1RAFB 3MM5A 2KXNB 2ZKTA 2VA3A 2OD4A 3EGZA 3V4IB 2R8HA 2KFYA 1RHJB 2ZBPA 3OXGA 3K5OA 4KRWA 2FHJA 2YUHA 2CUYA 1PBUA 2MKYA 1B64A 3CJTA 3AOAA 3EGWB 3QRPA 1HPZB 4DUTA 3TA0A 4B3MJ 1CS4B 1Y4ZB 4QWAA 1XERA 3MM7A 2FHJD 5F8LA 4EU0A 1PYOB 4K4XA 3PEHA 2E1RA 4DLEA 1HBUA 5B08A 3HT3A 1PKUA 3DHWC 3BV8A 2BQRA 4DSIA 2NSTA 2UUAJ 4ANEA 4FKYA 2A3JA 5K14A 1D3WA 2AJ2A 4ZVFA 3M4XA 3GJTB 4J9KA 2WTFA 4KGVB 1S76D 1O5JA 4CNYA 2VBWA 2P5VA 3J7Z5 4CM2A 3WBZA 2J8AA 3BZQA 4LBPA 4K7QA 4S0MA 4U7UK 1RZMA 1LM1A 2N4DA 4GC6A 1XBWA 5KTQA 3MAAA 2HLUA 2C2ZB 4JI2J 4DR2J 2KO1A 3GIMA 1FJGF 2VJIA 1CLWA 4LSLA 2XY5A 3E8OA 4F2SA 4HL9A 3G71S 1WEXA 2E7XA 3OTCA 2CDQA 2IJRA 1O8HA 2LKZA 4ICLA 3GMGA 3D3CJ 3WC2A 4NK8A 2IM0A 2IA0A 5DGBA 1T8EA 5LOQA 4ED6A 4NLDA 1HLWA 5KG1A 3VSVA 1ZETA 4C0OC 3LGHA 4OZ5A 4DV2J 4KSEB 1M5VC 4XNFA 5DLFA 3JQKA 4Q2MA 3AJ2A 3QFHA 3QJLA 1S48A 4DSLA 4X4OA 2E5HA 1TFYA 4IOCQ 2JH3A 3AAWB 2QFJA 3DRXA 4DPOA 4HH1A 1QE1B 5IV4A 3DOKB 3R2DJ 4OYZA 2O3DA 1QAIA 2COLA 2PA3A 2EW9A 3NGRA 1H72C 4EO6A 5D0GA 4P9SA 3CCUS 3V81B 2RQMA 1RWXB 4WXOA 2JLGA 1S1UA 2DITA 3SUCA 1N5QA 4GVBA 3C14B 4CO2A 4URQU 3OFFA 4DUZF 5FD1A 2AJQA 1OY8A 5CCLA 2GO8A 5I3QA 1P1LA 3RW7A 4DX6A 2QX0A 3CXCR 1TL3B 1HWIA 2HZVA 3HO1A 3CJSA 2DGTA 4DQRA 1M5HA 1KQSR 2FJDB 2KN4A 2AEJA 2O5DA 1FRKA 4OJHA 5KT5A 3BBCA 1LKZA 2W9BA 5KFTA 2XM3A 2G2OA 1KCDA 4WU3A 3HHLB 1NCLA 1QE1A 2NZ4A 4I68A 3VCDA 5A76A 3DOLA 3KLEB 1K0TA 3T1YJ 2F65A 4M5KA 1C0TB 4LRAA 2WB4A 4IH7A 2ZOFA 4IQMA 1FDNA 5CH7B 3G82A 1TKZB 2PYGA 3GP9A 2Z56B 1IBLJ 4DFPA 5CQGA 4A8MP 2CVEA 1IKYB 4PWDB 3PJXA 1T05A 3SEOA 3SQGB 3HVRA 1FFSB 1SQFA 1JJCB 2C3UA 4FYYB 3H5YA 4FYDA 5B0CA 1JXEA 3AFGA 3I82A 3ZZRA 2MJUA 1PG5B 5IOLA 2GMLA 4DR3J 4DV4F 3KRGA 2FJXA 3FQKA 1F5AA 3HHLA 3HLUA 1M0SA 1RK8A 4G6VB 1HNWJ 1RT7A 2YKPA 2E5JA 2AYMA 2V2ZA 2HVIA 4MK9A 4YR3A 3H8YA 2XZTB 3HHLD 2WBRA 2B7CB 2Z2YB 4ZJLA 3LAKA 1HNIA 4OX9J 2AEFA 4X4VA 3BREA 1BY9A 2MKIA 1IQTA 4H4OA 3NY0A 4XN0A 1S1VB 2HQGA 1S6UA 2ZH6A 4KT0C 1FNXH 1WG5A 3WWGA 2RS8A 2CJYB 3DNCA 5KFCA 1C0UB 3W64A 3EYZA 2QL7B 2VUGA 2HLTA 1H80A 2BE9B 1GQ8A 2N7YA 4O23A 3RBEA 2Q1LA 2HZCA 3BKUA 1GXUA 3MMBA 1VQ7S 2OPPB 3OL9A 5HBMA 3C15A 1KTQA 3S6EA 4YQWA 3NOCA 3CIMA 3MUMP 3EE3A 1S59A 1Q5YA 1Z1ZA 4H4KA 1S97A 2P8IA 3P96A 5CZVA 3GFXA 1R27B 2OMOA 4HACB 3I32A 3R6GB 5L39A 4TYAA 2KZMA 4PQUB 1HQEB 3ENWA 1S0OA 3RB0A 4M5HA 4K2XA 4CO5A 1HBMA 5D0EA 2VF3A 1DTTA 4ZPDA 4JI0F 2C3OA 5D0HA 1YTYA 1D0EA 4C8OA 4KGXB 2DO0A 3KJNB 1FRIA 5G0RB 3JXOA 2VOPA 3R5JB 3LH2S 3I4HX 1ZH5A 2B9XA 4IFVA 1VQLS 1FERA 2HQDA 3QT8A 2Z8GA 3TUZC 4FPRA 1OY9A 3GQ7A 4JI6J 1GXTA 2ZITA 2ZH7A 1FXLA 1DABA 4HACA 2VICA 1NZ8A 5LM7E 4XMYA 3OVBA 1HQEA 4HI1A 1P8GA 3VAIA 3LA0A 4KFBB 2KFNA 4CH7A 3PYGA 2HS0A 1X5PA 1LFPA 4K4WA 1YWXA 4RNNA 1RAEB 3PG9A 2OLWA 4YB1P 4ED8A 2RDDA 5I42A 4NI2A 3H2LA 3CCVS 1EIYB 2CQ1A 5G0RA 4XM3A 1BUXA 2MTLA 1YRUA 3LP1B 4X66J 1HYSA 1SCJB 1BQNB 4OX6A 3O3LA 1SKUB 2R7SA 4WPAA 4XTTA 2V69A 1AUSL 1QA1A 4DOZA 3GIRA 3GJRB 1GH8A 3M8SA 4OHVA 4NYOA 4LR7A 3VVUA 3W7BA 2X1GA 2BRLA 2DY1A 4CM0A 1O8FA 5KFDA 5B0GA 4ZCLA 3MUVP 4DCJB 4B3MF 3DCAA 3W1YC 4FBTA 1QA2A 3SFGA 1S57A 2M5YA 3D2WA 2KJVA 3N90A 3NB2A 1RWKB 2RRAA 4RW6A 3O1LA 2IC3B 3I5AA 4I56A 2JX2A 4G1QB 1SJ3P 2UUAF 3RB4A 3W66A 1PJ5A 2MQNA 3V6JA 2QMWA 4DV0J 3ISZA 3W2VA 5ADZA 4J9QA 1LK7A 3F73A 3KK2A 3DYAB 1XMQJ 1EZGA 3HSGA 1D9DA 2CFXA 2IVYA 2VG6A 3CB4A 1WEYA 1Q79A 1OFMA 4YR0A 3ONQA 1VLOA 2W9CA 2FDNA 3KUHA 3HHEA 2CG8A 4JI2F 1T9XA 4DR2F 2Y0BB 1LW0B 3BBBA 4WCEQ 3D67A 4WWSA 1IM4A 1RBLA 5LMNJ 1RTZA 4Z06A 2PGCA 2FVRA 1L3VA 1ICEB 2ADCA 1DBGA 4GKJJ 2IC3A 1WI8A 2K2PA 3MZIA 5ETSA 4Q5VA 4XLAA 1RT2B 1HWUA 2AEMA 1RABB 4L75A 2VPYB 2NXCA 1VIOA 2PEBA 1TU0B 4DV2F 2YPYA 4DPTA 2YWEA 1WSRA 4B02A 4X62J 1TYUA 5CA5A 1Q86T 3UVJB 3UW1A 3LPEA 1S0MA 1S1XA 4OZYA 4V02C 2NSCA 1VBLA 2HHPA 3OW2R 4LIRA 3IRXA 4RW4B 5T7LB 1LW0A 1S4EA 3VR1A 5D4OA 4C2MA 3QMQA 1SL0A 2VQEJ 3IXQA 1AW0A 2YPZA 4O3QA 1H3DA 2ZH8A 1WC3A 3B8HA 1W7WA 2CNKB 5B09A 1WSVA 1S10A 4KJIA 5L1IA 4CLZA 2KZZA 1S6OA 3DLEA 2IAJB 2XS2A 3PETA 2CAJA 2BQUA 3JYTB 2BYCA 3TAQA 3PJWA 2HWHA 1KVKA 1HMVB 3C6TB 2GFFA 4F67A 1R43A 2RT3A 3RBDA 4N8NA 1DAXA 3VGVA 2FHKA 4RX6A 1N6QA 2HK2A 2E7WA 2VPZB 1GMUA 3D1HA 3I0SA 4NL5A 3AY0A 1H0HB 2ZD1B 5IQQA 3T1YF 1JLAA 1AIRA 2UUCJ 1OJ4A 4NLOA 4Y6IA 1WMRA 4PXDA 3W63A 5ETQA 4UY8T 3ZTRA 3GYGA 2CJKA 4UF4A 1OYEA 1S12A 4L3KA 2GJFA 3TUIC 1IBLF 2MMYA 3HULA 1EETA 2ZBIA 3M6UA 1RKJA 1VQOS 4MH8A 3KOAA 4R8UB 3CMAS 4DR3F 1LLZA 2K1RB 3QIDA 2FJBB 3MPDA 1WF1A 3BJYA 1Y5LB 1TELA 3KLHA 3GIKA 4PCQA 2KJWA 1HNWF 5C25A 1QCXA 2BA9A 3DDKA 3DGPA 2VG5B 3IR5B 1X0PA 4DSJA 5DLGA 2XY6A 3AA9A 4OX9F 2EXUA 3CC7S 1IJEB 1RT3A 2AYBA 4I67A 1O8EA 1S6QB 3V6HA 2GMJA 4WE1B 1JLFB 3WZ0A 1CBKA 2EI5A 4OZ3A 5J1NA 3M9OB 2O17A 3MM8B 3BS9A 3VZHA 2RS2A 1Q95G 3MR6A 4KPCA 2I1RA 1AUDA 2BX6A 1TKTB 3RBXA 2A2CA 3KLGA 3VAKA 2F9JA 2R2TA 2HBRB 3UI3A 4URSA 4IH5A 4LR9A 3BGRB 4OLOA 4DBQA 4UOHA 4NEYA 1KVJA 2V2QA 1HIYA 5KFUA 2ACMA 1F3VA 2WOMB 4Y2MA 2DNGA 5KFFA 1X9MA 4Q2LA 1XNQJ 3J7AN 4A8FA 3HVTB 8RUCA 5F9NA 1KKHA 4OLPA 2FQQB 4WBFA 2UUWA 2J8SA 4IRDA 3TVZA 3CDEA 4PUOB 1RTIA 5HROA 1YJRA 3CIZA 2VONA 5IT0A 1S9GA 4NA1A 2LVWA 3QT5A 4MXNA 4OYXA 4PYDA 2H54B 3Q8RB 3MM8A 3CT9A 2UVUA 4ZIVA 3N4WA 5LMUJ 3RAXA 2ZHBA 5DS7A 2GC8A 1UWBB 2NLWA 3F44A 3MPUB 3IWLA 1V9OA 3M6XA 2HNZB 3CE8A 1JLCB 2YNGA 4MKBA 1YRTA 3TARA 1SVDA 1JJ2R 4YMEA 2PD1A 2HS3A 4JI6F 2YX7A 3B82A 5KG5A 4QWBA 1WTFA 5ITHA 4NRUA 2J0XA 1RXOB 1T3NA 2R3VA 4FN5A 3IAM9 2I5JB 1LEOA 1RLDA 2P6SA 1ZM4A 2QA4S 1X7VA 2OPQA 5HL7Q 3K5MA 2IJNA 2BE2A 3NWRA 2Y3YA 3MEGB 2DKOB 3IM9A 1F9EB 1VQYA 1O8IA 5C2GA 2W7ZA 4RR5A 2F5GA 1PC5A 4MIBA 3HFVA 4X66F 3OXFA 3T5JA 2HVHA 3DRPB 2M8DB 1JLCA 5B0BA 4NLSA 2RUGA 1B99A 1D09B 1T95A 2O0VA 2RNEA 1N34J 2VDHA 4P75A 3PNIA 2UP1A 1RT4A 4DV5J 5KFVA 5IT9Y 2UXCJ 5HMZA 1BQMA 3CJKA 3JSMA 1V6HA 4AXJA 2YH0A 3C46A 1S5ZA 1I6JA 2DXFA 3GPAA 2R7VA 2KFZA 5AE3A 2V63A 1FX4A 2UVEA 4Z03A 2DB1A 4ECSA 4DV0F 3OR2A 2MZSA 5E3RA 2VBMA 2RE1A 3H5SA 1XMQF 1U1LA 4N76A 2L08A 5D8HB 2GX8A 4WF9Q 1CPZA 2DHSA 3OLBA 2RKIA 4QYRA 5A0YA 2H51B 4KV8A 2QV6A 3PIOQ 1SIZA 3D7SB 3IRWP 3HK2A 2IJFA 1UVJA 3TYTA 2ILYA 5C1CA 2YVSA 4DN0A 3D1OA 2AP6A 3NXZA 3NAHA 1NU4A 5LMNF 4F4KA 2AX1A 1OQ6A 4RBUA 2Z57B 2KG1A 3LP0B 4EEYA 5DNSA 4O3SA 4JI1J 2CPJA 2BUNA 1CVJA 2A1BA 4GKJF 1ZA2B 2XHWA 5GAGU 4ZVEA 2CQDA 4J7CA 5DG9A 4NLPA 5L9XA 1U0HB 3PYFA 4NLVA 1MN7A 4JOUA 2K7KA 2KXFA 2YQ0A 2OIHA 4TU8A 1H7WA 4G1IA 5KOWA 4X62F 4OJ1A 3IFEA 2JEFA 2QC3A 1EP4B 3EXCX 4DQPA 5JVGQ 1UZDA 5E3CA 3ITHB 3OSNA 3NNAA 4K2JA 4IG3A 5F8JA 1T03B 1HNVA 2BABA 3N28A 4BBYA 3OLAA 1ZAXA 2VL1A 2VQEF 4F0MA 1FFGB 1RHUB 2XLKA 5E41A 3H90A 2HURA 1D9FA 2DIVA 2PI5A 4TU7A 3C6UB 2DGUA 4DCOB 4K5RA 3MCOA 4QWEA 3JAMU 1JMTA 4ZCKA 5DG7A 4BDPA 2CZVC 2ASDA 2HPUA 4RW9A 5BYSA 2FC8A 3M6VA 1N0VC 2LXFA 1MROB 2F8HA 1IVZA 1NO8A 3B8YA 2XGQA 3H5XA 1G4CA 3DU5A 4LBHA 4LRCA 4XPEA 3VF0B 1IKXA 4KHPJ 4ES2A 2DHGA 1Y10A 1HNZJ 4J9VA 3UN5A 3IBFB 3TZXA 2V9KA 1C2PA 3VZIA 4XPCA 1KLMA 3UCZP 3UO0A 2V34A 1VC5A 4YY3J 2Z4PA 1YSJA 4R0JA 3WDOA 4OHXA 2UUCF 2F40A 2YKMB 4URRA 2NXUA 1UFWA 3RJMB 4UTGA 1G6BA 3VMWA 3EVOA 4KY3A 4TY8A 1VQ4S 2YNIA 4D3HA 2FJWA 2EK1A 4FBUA 4DG1A 3R1HA 3C6UA 1ZTTA 5C24B 2DHXA 1KFDA 1WC4A 5LXYA 4FP9A 5JUMA 1XJWB 1VR6A 4RKUC 5L1KA 2X6XA 3B4NA 4DQIA 3P5BP 5H1SV 2Y1IA 1U1KA 1RI7A 2L9NA 1HD0A 3EGNA 5IWAJ 4OFZA 3VQSA 1E6VB 4O4GA 4LF6J 4B9TA 2FGCA 4OJPA 4LF1A 3J81Y 2DGWA 1Y11A 2CDRB 4NCAA 3I9V9 4F25A 3NOGA 4QCLA 1RA6A 1VQPS 1OFLA 1OOCA 4U8YA 4I84A 4AD6A 3BSOA 4QWCA 2JFDA 3MR3A 4LF7J 2L9DA 2C3YA 5I3UB 4M94A 2H1YA 2XMJA 4U7CA 3J7ZT 3GV5B 5D0RA 3GFZA 3P4GA 3ILIA 2JDJA 4ECVA 1UVLA 5IZHA 4FKXA 3GG0A 1UVMA 2XYGB 5JLVC 1GQEA 1RWRA 4YFOA 2HGMA 2DISA 5GMEA 1SQGA 4FPIA 1R89A 2D1CA 2OGUA 2B4UA 4N41A 1EZZB 1XNQF 3BPSP 3UCGA 2NCKL 1RTDB 1Y0HA 2PSZA 2D3OR 1M1GA 4WKRA 5I3UA 4V19X 3CCMS 3D1QA 1RB0A 4UZCA 4F3MA 1S9EB 5DDPC 1TK5A 3M8QA 5CZXA 3MD3A 4FS1A 1REVB 1DTQA 2DR8A 2A10A 5LMUF 1TP7A 3UN3A 5DDRC 3MMCB 2V0NA 3OHBA 2P9EA 2QRRA 2V4RA 2NTBA 2V8GA 1FDBA 4NCGB 4W8RA 1KS2A 2EFOA 4F36A 4ZMMA 1YJ9S 2H4YB 4WU2A 3TAMB 4UUWA 1PXZA 3G96A 1JJHA 3D6MB 4LSNA 1VIXA 2FVSA 2QX3A 2C2OB 5CAAA 1H7XA 4P2SA 3JQJA 4PXCA 2CADA 3JTPA 4NLGA 1S9EA 3RIQA 4ECZA 1Q16B 4DLGA 2E5GA 4ITSA 1RE1B 1VGYA 5H9EK 1WHYA 1WDTA 2D9PA 4LF5J 3SY2A 3PFOA 3DLGB 5J1EB 4PXBA 2B51A 3R6LB 2XQCA 4OV6A 3D0IE 1RU4A 4J9NA 4JI8J 2VJJA 2LQ8A 4QR1A 3MCNA 4I2QA 2XCAA 1FJCA 3TANA 1N34F 4RLEA 2EFVA 4K4VA 1MLAA 4BLGA 4U4BA 3EUNA 1LWEA 3CULA 8AT1B 4DV5F 1IKWB 4USIA 2UXCF 3TJAA 3PX4A 4DZDA 2R8GA 1X9WA 2YTCA 1C1CA 4NYPA 4PWUA 5A8KB 5FLXY 3KFWX 4F04B 5D78A 1UZHA 3AD8C 1YJUA 3C8YA 1AT1B 1U1OA 2D3UA 1N5YB 4DF4A 2XTWA 1UFKA 4CLTA 1ZYQA 2DNLA 4IFYA 1VJQA 2LQJA 3B4MA 3DLGA 1TK8A 5C7PA 3US5A 5D4NA 2FPHX 1VLYA 2Y8YA 1R3NA 1S6PA 2VFNA 4UQTA 5LSOA 3KJFB 4F3OA 4Y2KA 3N6LA 2EFNA 2D9OA 3DN9A 3ZZYA 3M2UA 4N47A 1NUEA 4HHUA 2QL5B 3ZNUA 1IKWA 2IOUG 1G2EA 1LW2A 1TV6A 3DRRA 2VFMA 5C2CA 2J6UA 3H0PA 2QYGA 4DPXA 4Y3CA 5M2PA 2GZOA 4JI1F 3Q22A 2PMWA 3M8ZA 6FD1A 3O5TB 1IQZA 2JWNA 5A2QY 1RTJB 4AQYJ 1RT1A 2W2NP 5KFQA 1QVFR 3SDEA 3FEXB 2LU2A 1QSSA 4M5JA 4PG4A 3UR0A 2QMXA 4DXLA 2QYUA 1RT5A 3I0RB 1FHTA 4FF4A 3DLKA 2ZKUA 2V4JB 2DCUB 4LFCJ 2EWEA 3LGNA 4JI5J 1UJ5A 2AF6A 2MHNA 3T9NA 3HM9A 3BGOP 3CGIA 3BR9A 3BPDA 3SCLE 1T9YA 5GADI 3BR8A 1YVFA 4O44B 2DNHA 4JV0A 1PIEA 4GC7A 4WP8A 1WTBA 3MR5A 2V68A 1R8BA 5SUHA 4ZVUB 2AJ0A 3IM8A 4QIEA 2CQBA 3FZ2A 1N36J 2ROGA 1IBKJ 1OWXA 3VAGA 3PACA 4QIFA 1S7IA 3THPA 5JJBA 2WRMA 3MMAA 2BANA 4CTAB 2AGOA 4XOPA 1OPIA 2UU9J 5K5MA 1RHQB 1U47A 4ZP6A 2FB0A 1WNEA 2QXZA 2BKOA 4F4WA 2DGXA 4KHPF 4K4SA 1B4SA 4YY3F 5CD4A 3UDEA 4J9PA 1N5VA 4USKA 1HNXF 4RW7B 4NLTA 1Q4RA 4LMZA 6FDRA 2WW8A 1NKEA 2HRTA 2PFDA 2OPRB 2YQ3A 2DJWA 4YDTA 1URRA 4F0HA 2BJ7A 2M0GB 1Y9OA 2EFQA 4WK3A 2ABYA 2BMBA 1SI9A 1OIAA 1TTHB 2CPXA 1RYSA 3R7BB 2OH2A 4ZLPA 4C8LA 5AT1B 4M5DB 2ALZA 1KN6A 5IWAF 1L3UA 4NA3A 4OJ6A 3AQPA 3MCSA 4UZBA 2E9TA 1U2FA 4HVZA 2AZ3A 4LF6F 4M63A 3Q8SB 4USWA 4TY9A 1XTZA 2CXEA 4RUBA 1NK5A 2ROPA 4ED2A 4KB7A 1Y00A 3Q2SC 2INUA 3T19A 1VQ6S 2VBZA 5GMKa 2FZGB 2B9WA 4P73A 2FJAB 1NSKL 2KHCA 3IG1B 1PLUA 3J80Y 4RW7A 2P2CB 1TKXA 4LF7F 2YKNB 2XHCA 4C8MA 4EZ6A 4UUXA 2OAUA 2C2MB 3FFIB 1YHQS 1NHUA 3OSPA 3V5RA 1URNA 2GIQA 2HNDA 3MECA 4Q8FA 3LMWA 3TJ9A 2J8IA 3S1TA 1HQUA 3IBCB 4DS4A 2HG4A 4WZMA 4F4ZA 3CJRA 2GVDA 3QZ7A 4I2PB 3M8WA 4R0EA 4L73A 3W8GA 3BSCA 4CYUB 5T14A 2KH9A 2Z30B 5HAOA 3CDUA 5H9FJ 1KD1T 1RGVA 1TQLA 2HHTA 4K4UA 4LF4J 2UUBJ 1SBRA 4ZVHA 4DV6J 2FVCA 4BC9A 2O04A 4DN9A 1T9VA 3MEDA 4ZS6A 1TUGB 3VQTA 3FMBA 3FFIA 3OUYA 4YOEA 4NZ7A 1GTEA 1O8DA 2W2OP 3UDVA 2FHOB 5HMXA 1FNOA 1FKPB 1X5TA 1IDJA 4ERDA 4KPYA 2WSEC 3D6FB 1PJ7A 8ATCB 3TZZA 2YWHA 5KG6A 2OEKA 5L1JA 2AX0A 2R9LA 3K2YA 4CYUA 4LIWA 3J81j 1KR4A 5T41A 4Y2IA 3MHYA 4JV5J 1NHKL 4X2BA 1MU2B 3K89A 2EK6A 1CULB
chains in the Genus database with same CATH topology
3NGRA 2VFPA 3SYJA 1K4ZA 1BHNA 1F3FA 1MN9A 1NDKA 2VU5A 1WXRA 2VFNA 3EJMA 3B54A 1DABA 2BM7A 3FKBA 1TYUA 3Q89A 5CABA 1BE4A 1NPKA 1NSQA 2BM5A 4S0MA 1HF2A 4HR2A 4ENOA 1TSPA 3FCVA 1NUEA 5BXIA 4OJ6A 1ZS6A 3EVMA 3PJ9A 5JMCB 2AZ3A 2DY9A 3EE3A 3N6ZA 3SZEA 4OJOA 3ENAA 4V02C 3PRVA 1S59A 4KPCA 3R9LA 3ZTSA 4EK2A 2ZUAA 2IOUG 2DXEA 1TYXA 2HVDA 1CLWA 3NGUA 2DXDA 1MN7A 2DYAA 4OM9A 3FC9A 3Q8YA 2BX6A 1TYVA 3ZTQA 1KDNA 2VFMA 1WKLA 4C6AA 4DZ6A 1K8FA 2B8QA 4OJ5A 1EHWA 3EMTA 1WKJA 3NGSA 1S5ZA 3ELHA 3AK5A 2YUHA 3BH7B 1U8WA 1TYWA 2DXFA 3GPAA 1BUXA 2BM6A 1LWXA 1NSKL 4DI6A 2F3LA 2CWKA 1UCNA 3Q83A 3Q8UA 3BBCA 4DUTA 2BM4A 3P4GA 1F6TA 4UOHA 2AZ1A 3TH0A 3Q8VA 1JXVA 3EVOA 3FBBA 1WKKA 1W7WA 1NDPA 1LEOA 1QRBA 1HIYA 1XIQA 3Q86A 3B6BA 4F36A 1NDLA 3VGUA 1HLWA 1HHQA 3BBBA 4FKXA 4KH3A 1NCLA 1NSPA 4JRAC 3MPDA 3WX8A 2G0YA 1K44A 3DKDA 4OPWA 1QA3A 5IOLA 1QA1A 1B4SA 3PETA 1NDCA 3EICA 1QQ1A 5JLVC 2XC1A 3NGTA 4W98A 4WBFA 3ZTPA 4O0NA 2B8PA 3JX8A 4ANDA 4F4AA 1PKUA 3ETMA 3VVUA 3JS9A 4OJLA 2B0RA 3H09A 2VFQA 3VGTA 3ZTOA 2HURA 1KQ5A 3LJYA 1NLKL 3G2XA 4ANEA 3VGSA 4FKYA 2W7ZA 4ANCA 3ZTRA 1QRCA 4UOGA 3LYCA 5CAAA 2HVEA 1VYAA 4CP5A 2BEFA 3VGVA 3EVWA 3FCWA 4UOFA 2J8IA 1QA2A 1PAEX 3BH6B 3EM1A 3ML3A 3L7UA 2VFOA 1S57A 4OJPA 3FBCA 3VVTA 3BBFA 2V5IA 1NHKL 3FBEA 3FBFA 5C7PA 3GP9A 3RIQA 1B99A 1XQIA 1NB2A 2NCKL 3DDIA 3N90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGR A;  1K4Z A;  1BHN A;  1F3F A;  1MN9 A;  1NDK A;  2VU5 A;  3EJM A;  3B54 A;  3FKB A;  3Q89 A;  5CAB A;  1BE4 A;  1NPK A;  1NSQ A;  4S0M A;  1HF2 A;  4HR2 A;  4ENO A;  3FCV A;  1NUE A;  5BXI A;  1ZS6 A;  3EVM A;  3PJ9 A;  2AZ3 A;  5IOL A;  2DY9 A;  3EE3 A;  3PRV A;  3ENA A;  4KPC A;  3R9L A;  4V02 C;  3ZTR A;  1S59 A;  3ZTS A;  4EK2 A;  2ZUA A;  2DXE A;  3NGU A;  2HVD A;  2DXD A;  1MN7 A;  2DYA A;  3FC9 A;  3Q8Y A;  2BX6 A;  3ZTQ A;  1KDN A;  1WKL A;  4C6A A;  4DZ6 A;  1K8F A;  2B8Q A;  1EHW A;  3EMT A;  1WKJ A;  3NGS A;  1S5Z A;  3ELH A;  2YUH A;  3BH7 B;  1U8W A;  2DXF A;  3GPA A;  1BUX A;  1LWX A;  1NSK L;  4DI6 A;  2CWK A;  1UCN A;  3Q83 A;  3Q8U A;  3BBC A;  4DUT A;  1F6T A;  4UOH A;  2AZ1 A;  3Q8V A;  1JXV A;  3EVO A;  3FBB A;  1WKK A;  1W7W A;  1NDP A;  1LEO A;  1HIY A;  1XIQ A;  3Q86 A;  3B6B A;  4F36 A;  1NDL A;  3VGU A;  1HLW A;  1HHQ A;  3BBB A;  4FKX A;  1NCL A;  1NSP A;  3MPD A;  3WX8 A;  1K44 A;  3DKD A;  1B4S A;  3EIC A;  3NGT A;  4W98 A;  4WBF A;  3ZTP A;  4O0N A;  2B8P A;  4AND A;  4F4A A;  1PKU A;  3ETM A;  3VVU A;  3JS9 A;  2B0R A;  3VGT A;  3ZTO A;  2HUR A;  1KQ5 A;  1NLK L;  3G2X A;  4ANE A;  3VGS A;  4FKY A;  4ANC A;  4UOG A;  5CAA A;  2HVE A;  1VYA A;  4CP5 A;  2BEF A;  3VGV A;  3EVW A;  3FCW A;  4UOF A;  1PAE X;  3BH6 B;  3EM1 A;  3L7U A;  1S57 A;  3FBC A;  3VVT A;  3BBF A;  1NHK L;  3FBE A;  3FBF A;  5C7P A;  3GP9 A;  1B99 A;  1XQI A;  1NB2 A;  2NCK L;  3DDI A;  1NDC A; 
#chains in the Genus database with same CATH topology
 1YJT A;  3KDN A;  4OI6 A;  3DLL Q;  2XSJ B;  3OR1 B;  4C8Y A;  4OYI A;  4P71 A;  1GAO A;  2BM7 A;  4MFB A;  4YB7 A;  4DMZ A;  1OS5 A;  4M5G A;  1EAY C;  4AVZ A;  2HFV A;  3KLF A;  3GTY X;  2UUT A;  5JMC B;  2W01 A;  2ADB A;  4ILM A;  5ETV A;  2MHE A;  2CQH A;  3FJ2 A;  2BDP A;  1RAC B;  3CCR S;  1UA1 A;  2OFG X;  1T0T V;  1FKP A;  1FXR A;  4IQX A;  4CO0 A;  2XBP A;  1N8R T;  4LF5 F;  1RP5 A;  1B7Y B;  1S99 A;  1OGM X;  3LP2 A;  3Q24 A;  1HBN A;  3R5A A;  4JI8 F;  4JI7 J;  3SV3 A;  3G8T A;  2J7K A;  2K7J A;  1MU2 A;  3ZTP A;  2MGZ B;  1X4F A;  5AJ3 J;  4KTQ A;  4ED0 A;  2CQP A;  3GCW P;  3EDQ B;  1SJQ A;  1NM2 A;  3RAQ A;  3UFC X;  3G6V A;  3PHT A;  4U9R A;  2UVR A;  2RD5 C;  3QJJ A;  4IOA Q;  1DJ0 A;  2DH7 A;  3A8E A;  1GXL A;  2RDJ A;  5HP1 B;  3UN2 A;  2ZBC A;  3SV4 A;  2KXH A;  2VU5 A;  1WXR A;  4OIX A;  4XLF A;  1NEE A;  5KG0 A;  3FDS A;  4MR0 A;  2LEC A;  1CJK B;  1VIS A;  3QAT A;  2CQ0 A;  5A8W B;  3HJF A;  2QZ8 A;  2D3O 1;  1X0C A;  4DL4 A;  3PV8 A;  5L38 A;  1QY7 A;  3OVA A;  2QN6 B;  1RHR B;  5CXT A;  2AQ4 A;  2KDO A;  2YQ1 A;  4ZVT B;  3MM9 A;  1J2V A;  4J9S A;  4W8T A;  2D7S A;  3HSD A;  5HLF A;  2GVZ B;  1LK5 A;  1VQM S;  2W2P P;  3KLI B;  3DOM B;  3ILL A;  2W7O A;  1VQS A;  3TZY A;  3LJY A;  1NLK L;  1WF2 A;  1BHE A;  5DM6 Q;  2F3J A;  4AQY F;  1VYA A;  3IGN A;  1VRT B;  1WHX A;  2JRS A;  3CNQ P;  2ZH2 A;  1PO6 A;  3NGK A;  3MM6 B;  3CJ5 A;  2HMI B;  5C42 B;  3J7A 1;  4L74 A;  3PKY A;  4LFC F;  3WIU A;  5K9F A;  2A6M A;  4JI5 F;  3HKW A;  1BE4 A;  2X7I A;  2X6W A;  2JVR A;  2NPF A;  1TSP A;  2V5H G;  4DQQ A;  5B0D A;  2XTY A;  2HVD A;  5CYQ A;  4HDG A;  3C2P A;  5K8P A;  2GVZ A;  4DSK A;  1DY3 A;  2O1D A;  2VD3 A;  1FKO B;  5J2Q A;  3QAU A;  3EQO A;  1HKA A;  4C97 A;  1NK8 A;  2R42 A;  4ELU A;  4ZVG A;  1VC6 A;  3B78 A;  3KK1 A;  2QO3 A;  1ZM2 A;  1XIQ A;  2BE7 D;  1N36 F;  3B6B A;  2KRB A;  3PFE A;  1IBK F;  2LP4 A;  1S1W A;  1WC5 A;  1QQ1 A;  2C1E B;  2W7P A;  1SXL A;  2XC1 A;  4IR9 A;  2UU9 F;  4YCQ A;  2CPD A;  3G2X A;  2YXL A;  2EFG A;  1EQM A;  2Q43 A;  2HBZ B;  1CJT B;  3WX4 A;  1Z2Z A;  1W26 A;  1RT6 B;  5F8I A;  2V2K A;  3FBE A;  5A8R B;  1R7I A;  1ZM3 A;  2IRU A;  5LSR A;  1HHS A;  2GHP A;  4F4Y A;  2ODL A;  3DRS A;  1IBC B;  1AA1 B;  1RTH A;  5IM0 A;  2ZJR Q;  2WHO A;  2KI2 A;  3T5L A;  3PYE A;  4GMK A;  2W9A A;  2B43 A;  1TK0 A;  1JKH B;  2DXE A;  3J7Y U;  4USM A;  2DYA A;  2YX4 A;  4Y28 C;  1HHT P;  3SCJ E;  4N8O A;  3W5Y A;  2VC1 A;  3PSZ A;  5HN0 A;  2DGQ A;  4Y65 A;  2KT2 A;  4OMF G;  3DMJ B;  3PW4 A;  1DAR A;  1FEE A;  4HHH A;  2V50 A;  4ZPA A;  1X9S A;  2KKH A;  3A13 A;  1RCO B;  3VGU A;  3TWZ A;  3R5D A;  4NLY A;  4MKA A;  1P9Y A;  1ZPV A;  1U6B A;  1LFW A;  3QIP B;  5D3G B;  4WFB Q;  3TO8 A;  2IYG A;  4MYT A;  3VST A;  3SSQ A;  1FCA A;  2ZZM A;  4AL5 A;  2QMU B;  1HAR A;  2D41 A;  2O01 C;  4B3R J;  1CG2 A;  2AD9 A;  1CJV A;  2J0Q D;  2V94 A;  3S8S A;  1IWG A;  3ET6 B;  1SH0 A;  3C19 A;  3BO4 A;  1S4F A;  4U95 A;  1R31 A;  3TA1 A;  2YNH B;  3LTO A;  2QA1 A;  1EAR A;  2INV A;  3FEY B;  2NT6 A;  3NCQ A;  2PEH A;  3BSA A;  2PDA A;  5DDQ C;  1YBT A;  2K8G A;  1FTC A;  1RHM B;  2GHW A;  3O6Q A;  3HHL C;  1SUQ B;  3PJ9 A;  2CQC A;  1R0A A;  1J27 A;  4HH0 A;  4K59 A;  1M5P C;  3U02 A;  2Q3P A;  4PQA A;  1KDN A;  2ZHA A;  3SBM A;  3CC4 S;  2F8E X;  3RRH A;  2XTX A;  2FHM A;  4MMO A;  2BM0 A;  4XK8 C;  2XTJ P;  3ULH A;  2BW2 A;  1WI6 A;  4NRT A;  1JLQ A;  2MQO A;  5IT4 A;  4LF4 F;  2UUB F;  2HFU A;  3TZW A;  3M2R B;  2JSX A;  2PT0 A;  1TFW A;  4DV6 F;  2AYG A;  4YEA A;  2J9D E;  4ZPV R;  1FES A;  2LXU A;  2IM1 A;  5L9N A;  4Y34 A;  4QW9 A;  3V4M A;  4KKO B;  4AND A;  2YWW A;  2RUS A;  5F0W A;  1WEL A;  1AFI A;  4Q0B B;  1WOS A;  1F0X A;  3PRB A;  1YIT S;  3O44 A;  4LBI A;  4GO7 X;  4Y2C A;  3CDA A;  1JLE B;  2AGQ A;  3MEE B;  3HVA A;  2DGV A;  3I9Z A;  1U1N A;  1T9U A;  5HQ8 A;  1R6V A;  4BWM A;  4H4K C;  2MYF A;  3VAL A;  1DFD A;  3IS9 A;  4NLW A;  4ED5 A;  4JV5 F;  5F8G A;  2UVW A;  4LFA J;  2J7U A;  2NUH A;  2K3I A;  3Q8Y A;  2VJV A;  1TYV A;  4TVA B;  2HNY B;  4C6A A;  4JI3 J;  3T6B A;  2ZJP Q;  2ACY A;  4P6Q A;  4OI1 A;  2UVV A;  3HKZ D;  1O8B A;  5K8O A;  3L7P A;  5HJX A;  3KDO A;  5CD4 H;  2LDI A;  2EG2 A;  1S1T B;  4Z7C A;  1ZM9 A;  3AB2 B;  4DX8 H;  2ZM6 J;  4A8Y A;  1GX6 A;  5DGA A;  3TR5 A;  1JLE A;  1YBU A;  5EWG A;  1A7G E;  3ADA C;  2KHD A;  2QY1 A;  2BJ8 A;  1AZS B;  1IKV B;  3MAH A;  4USV A;  5DRK A;  1K8A T;  4ES1 A;  4JI7 F;  3TEH B;  7FDR A;  3CO0 P;  1MN9 A;  2UV8 G;  3HXM A;  4DSE A;  4KBI A;  5AJ3 F;  4FYX B;  1SIW B;  5F41 A;  9RUB A;  3AXM A;  1U45 A;  2ZBR A;  3V6D B;  2NSB A;  3FCV A;  4UOC A;  4IDK A;  5HQL A;  5JVH Q;  1SV5 A;  2H48 B;  2BJ1 A;  4DV1 J;  4M1K A;  4OZ1 A;  1MMN A;  1TL1 B;  1X5S A;  1T11 A;  4LVN P;  1KHW A;  4OYP A;  4ZPW R;  1ZA1 B;  4Q43 A;  4YR2 A;  4N7T A;  4J9O A;  3TX0 A;  2GGP B;  3CO9 A;  2M52 A;  1NH7 A;  2YY3 A;  1JLB A;  4OZ2 A;  4NPO A;  4Q7A A;  4DSF A;  2RB7 A;  2OPS B;  3QAE A;  3IN5 A;  1KBR A;  3MMJ A;  4DX5 A;  3FRY A;  2IBK A;  4OYB A;  1DBO A;  4ILR A;  3V4I A;  2CKW A;  3W2W B;  3MPW A;  4C8K A;  1S79 A;  1KHV A;  3PY8 A;  4DR4 F;  2ZWP A;  3TX8 A;  1TUV A;  1O6X A;  4J91 A;  1RAG B;  3NBP B;  4UOG A;  5DQI A;  5FJ4 A;  3BGF A;  5FDL B;  3FCW A;  1UEU A;  2MKC A;  3ML3 A;  3IO1 A;  3DM2 B;  4I64 A;  2OTJ S;  1HPZ A;  2IM2 A;  1DQ8 A;  2Z2M A;  1ZOT A;  2QL9 B;  1CS4 A;  4IOB A;  4ECY A;  2D3Z A;  1FVQ A;  5E33 A;  2XC9 A;  3HI9 A;  5IT9 U;  1HBO B;  4O3P A;  2XO6 A;  1YZ6 A;  2ZH5 A;  2XMK A;  3PHE A;  4ZK7 M;  4OYM A;  2VC0 A;  2M70 A;  2RQ4 A;  4W92 B;  4Z7Y A;  1WHW A;  2HSE B;  5DG8 A;  3A8I A;  3HHD A;  3LOU A;  1ZTW A;  2B6A B;  3OHA A;  4NZ6 A;  4NLQ A;  3T9G A;  2IRY A;  4CWB A;  1WF0 A;  3AT1 B;  1LV5 A;  3NAW A;  2O1P A;  2RML A;  1HL6 A;  2BV3 A;  2QLX A;  1QAX A;  1QTM A;  3KNG A;  3MAQ A;  1E6Y B;  1B0V A;  1HI8 A;  4PEO A;  5DZ7 A;  1IBM J;  4DPW A;  4FF3 A;  3BO3 A;  3HP6 A;  2GW8 A;  1V3S A;  3UDL A;  1UET A;  1KFS A;  1I51 B;  2VPW B;  4CT8 A;  4I6W A;  5E0O A;  2KYX A;  2MSS A;  3TNV A;  3HHN B;  2FLP A;  4E2F B;  1SJR A;  2W24 A;  2PN6 A;  4C11 B;  2F63 A;  4HT5 A;  2YWK A;  1NPK A;  4XR6 A;  2IBO A;  5IC4 B;  3AA8 A;  4H54 A;  3W8P A;  4KHM A;  2AW0 A;  1PAU B;  3O2I A;  3R5G A;  2OP5 A;  3OTB A;  4U49 A;  2ZDP A;  4MIW A;  1X60 A;  1NB7 A;  3P6Y C;  2APO A;  1ULR A;  1GT8 A;  2CNL B;  2EKN A;  3DOK A;  5F8M A;  2OO4 A;  2XMT A;  2E9R X;  3ZPP A;  2DNK A;  2QLJ B;  5HO4 A;  2E1P A;  3V81 A;  2DO4 A;  3BB5 A;  4IO9 Q;  1CZF A;  2JC1 A;  1OYD A;  3C14 A;  2QZA A;  1CJU B;  1RBO B;  3SZ2 A;  1O8J A;  2B8P A;  2QLW A;  4PRF A;  2VB6 A;  1N88 A;  3QT7 A;  5ETR A;  4XLE A;  1ZBT A;  2J6S A;  1TL3 A;  3I4P A;  1LOU A;  2W4C A;  5B0A A;  2PA8 D;  5LT5 A;  2ROE A;  4QIW D;  1R8H A;  4WJB A;  1LWC B;  3PZP A;  4YZX A;  1TVR B;  2QFI A;  3MTK A;  3HFK A;  1VDH A;  4ZVR B;  4OZN A;  2XCP A;  4W8S A;  3B4D A;  3NL0 A;  5EHH A;  1WG1 A;  2CJX B;  3P45 B;  4WXW A;  4Z2X A;  2BW7 A;  2B5J B;  2X51 A;  2XYP B;  1N54 B;  3KLE A;  4B3R F;  3BM7 A;  4EI2 A;  1C0T A;  1L3K A;  4RNO A;  4M95 A;  3T6J A;  3OFG A;  1FT8 A;  2J8K A;  1QVG R;  4WK1 A;  2HHX A;  1TKZ A;  3Q8Q B;  3IR7 B;  2QJ3 A;  2BM6 A;  3HCX A;  1Z4U A;  4DEZ A;  3AD9 C;  1L3T A;  2JOQ A;  1XEZ A;  2POK A;  4P72 A;  1IKY A;  5BR8 J;  4PWD A;  4CLP A;  1HWJ A;  1O8L A;  5DQH A;  3SQG A;  3CCZ A;  1QA3 A;  2DBB A;  1MSW D;  2BVZ A;  4ID5 B;  4PAB A;  2RDI A;  1N33 J;  3BQ1 A;  2HFN A;  4DUY J;  2VH7 A;  4QYZ K;  3T1H J;  2Y9H A;  2ZOG A;  4LF9 J;  1ROF A;  3A3P B;  3OL8 A;  4B3O B;  4C48 A;  2J0W A;  3J81 U;  2IFX A;  1UKU A;  3D28 A;  1KTW A;  3QJP A;  1MML A;  4Y2A A;  1DZ5 A;  3P8B B;  3QPI A;  4R5P B;  1RWO B;  2F7V A;  2HAF A;  5KAK A;  3ZSC A;  1IR2 A;  4LF8 J;  1S1V A;  3FVY A;  2WVF A;  4ZP9 A;  3BN7 A;  4WFY A;  1NJI T;  4W90 B;  1N5S A;  2BKP A;  1JIH A;  1C0U A;  3KG1 A;  3H98 A;  2C2K B;  3PW2 A;  4YB5 A;  2B4P A;  3QNW B;  4ZJQ A;  4DI6 A;  1T94 A;  3KJV B;  2C28 A;  1FX2 A;  4USJ C;  2KM8 C;  1WOR A;  2BJD A;  2OPP A;  3M1V B;  3M30 B;  5MAO A;  1PJ6 A;  2V8D A;  4LFA F;  1VQ5 S;  4DU8 A;  1IR1 A;  4JI3 F;  5KT3 A;  2GAG C;  3FMW A;  4PG6 A;  3V2U C;  4K5S A;  2R7Q A;  4X4P A;  4PQU A;  2HZA A;  2W25 A;  4XIU A;  2KT3 A;  1GMW A;  4RO0 A;  3DDI A;  1TL7 B;  2IMW P;  2MLX A;  2PE8 A;  2BJ3 A;  4QZV B;  5J2P B;  2ZM6 F;  5ETK A;  4K0K J;  1VRU B;  2PC6 A;  2E29 A;  1XMO J;  5A6W A;  1HF2 A;  1GMW D;  2JFK A;  2CYY A;  3PCO B;  5KFH A;  2PII A;  3KNA A;  1VBX A;  4QR0 A;  2AJF E;  2VIH A;  3LWL A;  4ZPT R;  3I56 S;  3B90 A;  3G4S S;  2W2M P;  4H4M B;  1SKW A;  5K8M A;  2NT9 A;  3ZFV A;  2RAQ A;  4ZJO A;  3W5X A;  3GJS B;  1FWK A;  3K7R A;  4ER8 A;  2JC0 A;  2PMZ D;  3Q86 A;  1H2U X;  2C2N A;  1W25 A;  3H4D A;  1BD6 A;  3P5T L;  1DLO B;  5KFA A;  4DV1 F;  4OPW A;  1UJ6 A;  1RUS A;  2N4C A;  1J5O B;  4KFB A;  3CJ2 A;  2QGF B;  1X4C A;  3KYL A;  4XN3 A;  5E3P A;  1M5O C;  3POT B;  2WZ1 A;  2DNY A;  1KQF B;  1UTA A;  1YLX A;  4QU7 A;  3BBF A;  2AWZ A;  3LP1 A;  4J5O A;  4OJ3 A;  1NJY A;  1KWM A;  4QBU A;  2OD6 A;  5EX0 A;  2QYC A;  2ZH1 A;  1BQN A;  3B54 A;  1EB0 A;  3MOZ A;  4DU7 A;  5IFM A;  3QZ8 A;  4RW8 B;  3MFI A;  4HYK A;  3JAM Y;  3EZ5 A;  3ZTS A;  2CZ4 A;  3ZZT A;  1YJW S;  2MPU A;  4B9M A;  1Q7L B;  1BC6 A;  2X1A A;  2QLB B;  2MQP A;  1X4D A;  3R3T A;  4G65 A;  1YQH A;  1QTN B;  3MPY A;  4KHR A;  2DRA A;  4PR6 A;  2DGS A;  1RJJ A;  5KT6 A;  1LWX A;  5GAH I;  3OTD A;  4KO0 B;  2BJE A;  4A46 A;  4EWT A;  3LWM A;  1F60 B;  2NYH A;  3HSJ A;  5ETN A;  4LR8 A;  4G1Q A;  4J9M A;  3WX8 A;  2G0Y A;  5GAD U;  5GAG I;  4WIQ A;  2B9E A;  4DFJ A;  3DLH A;  2HHH J;  2NZM A;  3PW5 A;  3FSX A;  2ALY B;  2CJB A;  3H09 A;  3DYA A;  3PXG a;  3HT0 A;  2X1B A;  2IRX A;  2HQI A;  3RYL A;  3PO4 A;  2J9D A;  5L1L A;  2OKQ A;  2EEY A;  4JP8 A;  1BHN A;  4ZPC A;  3OFE A;  3C16 B;  4KIA A;  2O67 A;  4DJB A;  5KFK A;  3SYZ A;  1XMB A;  1IBM F;  3BDP A;  2A2D A;  1FK9 B;  4ZHR B;  3DI6 B;  5KFO A;  2J76 E;  3HPO A;  2HYI B;  1VQN S;  2MST A;  2W4D A;  2OML A;  4ED7 A;  1V3Z A;  1R0C B;  3W3S A;  1RT2 A;  1UW9 A;  1KRP A;  2BXJ A;  4I7F B;  2AU0 A;  5A2Q U;  4OZZ A;  1PE9 A;  3DLJ A;  1RWW B;  3OQ2 A;  1F6T A;  2AZ1 A;  4F8R A;  2Z2Z A;  2XI2 A;  3U1M A;  2K3K A;  1R8C A;  1C1B B;  4OYA A;  4EMD A;  2IIH A;  2W1B A;  2MZQ A;  1A0O B;  2YNF B;  3UVJ A;  2AT1 B;  5J2N B;  3U27 A;  3NGT A;  1H98 A;  3QLH B;  3WIV A;  2R8I A;  4XLH A;  2DK2 A;  2G2Z A;  3BYP A;  3UE2 A;  4I6Y A;  1TL4 A;  5E5N A;  4RW4 A;  5T7L A;  5A6P A;  4ECR A;  1EQ0 A;  5KFL A;  2WON B;  2ZOM A;  4ZP8 A;  2W7A A;  5KFI A;  4DF8 A;  4XKV A;  3FBF A;  3NCP A;  2VKR A;  3M6W A;  4C9D A;  4NWB A;  4RUH A;  3N01 A;  2Y0S D;  1X4H A;  3CJ8 A;  3CSK A;  4E0D A;  3OXL A;  5ETT A;  3MR2 A;  4EBD A;  1VJW A;  2IAJ A;  4I7F A;  4Q44 A;  3JYT A;  5F9L A;  1HMV A;  3C6T A;  5LJ5 Y;  3TEG A;  2WBM A;  1RWN B;  1EKR A;  2YNF A;  3GQ9 A;  4DL7 A;  3FUY A;  4F7V A;  2F3L A;  2C3M A;  3FK4 A;  4PYA A;  2ZD1 A;  2LU1 A;  2I0X A;  4CH0 S;  4M5L A;  2WON A;  4ILL A;  2WW4 A;  3JSB A;  3E51 A;  3FSY A;  2XEX A;  4PPZ A;  2QSF A;  5F8H A;  1KNZ A;  1G3O A;  3ETM A;  2Y1L B;  3M32 B;  2LQ5 A;  5BR8 F;  3N5B A;  1D8Z A;  4CLW A;  2IMO A;  3CTR A;  4ZN3 A;  3BN4 A;  1PC4 A;  1QUV A;  1AYE A;  4R8U A;  4CO3 A;  2RQC A;  2B4O A;  3JSY A;  1SH3 A;  2K1R A;  1N33 F;  5CYM B;  5EGY A;  1WHV A;  4DUY F;  4HLB A;  4XON A;  3T1H F;  4LF9 F;  1H2T Z;  4M5M A;  2DNZ A;  3EQN A;  2VG5 A;  3C3L A;  3NKY A;  4TU9 A;  3THV A;  3TQ1 A;  4DR5 F;  1MNE A;  5KG7 A;  3ZXW A;  1N5T A;  2GHV C;  5KFS A;  2ZE2 B;  2ZUG A;  1OMS A;  4DL5 A;  3J80 U;  2VFR A;  1CEZ A;  1S6Q A;  4LF8 F;  3L95 X;  4WE1 A;  1JLF A;  4XLC A;  3JTN A;  2AGP A;  3MDF A;  2Z8Q A;  2KTQ A;  2GQC A;  3OTE A;  1O88 A;  2IQ7 A;  1UL3 A;  2E5L J;  2GIR A;  2B56 A;  3MM5 B;  4FF1 A;  2VG7 B;  4IYQ A;  2VZ9 A;  1YJ7 A;  2K06 A;  1FD8 A;  4X4Q A;  3I96 A;  3JS9 A;  2JEG A;  2B0R A;  2W8K A;  1TKT A;  4HEA 9;  1VBK A;  4DL0 C;  3RZA A;  4UOF A;  1YGY A;  1WC1 A;  1Y7P A;  1RKI A;  1T9T A;  4DR7 J;  1OSC A;  3BGR A;  4RJV A;  1F5B A;  3JQM A;  2CWX A;  5J1P A;  3LAN A;  5THW A;  1JQG A;  2WOM A;  1U7L A;  2CJ9 A;  1WD6 A;  3MM7 B;  3FKB A;  3HVT A;  3ISN D;  4ENO A;  2I38 A;  1HBU B;  3RTV A;  4PUO A;  2HGL A;  5HVF A;  4XO0 A;  3ZZ0 A;  4O3N A;  5K14 B;  2HAI A;  2VG7 A;  4K0K F;  1XMO F;  1MWZ A;  2R7R A;  3KG0 A;  1Q8I A;  3PVX A;  3Q8V A;  1UWB A;  1JWW A;  2X85 A;  1NKB A;  3MD1 A;  4C2L A;  5L8R C;  1S49 A;  2CPF A;  4B17 A;  2HNZ A;  2V6A A;  3QSY B;  1RA7 A;  2YKA A;  3UPF A;  3MAA B;  4RBV A;  5D15 A;  4LSL B;  2IVF B;  2J9E A;  2E7V A;  2M3D A;  2ZVI A;  2RQK A;  2GS8 A;  3KUG A;  2MQM A;  4B9S A;  2DH9 A;  1DHM A;  4ICL B;  1FVS A;  4USU A;  2I5J A;  3QGP A;  4DR1 J;  4K4Y A;  2VA2 A;  5MLC V;  4LJM A;  2BM5 A;  1QLN A;  4FVM A;  1YRX A;  4EFA C;  3L9Z A;  3MEG A;  3D0H E;  1NXI A;  1B7F A;  3PEJ A;  1MG7 A;  1XK8 A;  3M05 A;  3FSI A;  2FZC B;  3DRP A;  3ZZP A;  2ZC4 A;  3RAM A;  5KT4 A;  2LLZ A;  2XMM A;  2ERR A;  2OEJ A;  5KFM A;  4OZ0 A;  3TP2 A;  2N3O A;  1KTV A;  4C3L A;  2L48 A;  1TAU A;  1VI7 A;  2QE5 A;  3FRZ A;  1S1U B;  4JRA C;  4GVB B;  2MKJ A;  3KUE A;  3V6K A;  2NXN A;  4HI2 A;  3UD4 P;  3WHI A;  4I1T A;  2EBG A;  2HQC A;  3NMA A;  2CPH A;  3LW5 C;  1TMM A;  3O8W A;  5HAT A;  1U02 A;  2OI2 A;  3KHL A;  3T41 A;  2RHQ B;  1QAY A;  1N4L A;  1BGX T;  3LUY A;  2W9B B;  1SKS A;  1BQX A;  2HHH F;  4P2X A;  3CF5 Q;  3BO2 A;  1X4G A;  2MB0 B;  4ZPB A;  1PBA A;  3DOL B;  2ATL A;  5C1E A;  1TAQ A;  2R8K A;  2I8E A;  3GQA A;  3LGM A;  3R8Y A;  5D4P A;  2ZUA A;  3TUJ C;  2CIM A;  2IDE A;  1PGZ A;  3KHR A;  2GNK A;  3SCI E;  4PKD B;  1T7P A;  2XB2 D;  2DNN A;  1X8D A;  4IRC A;  3AHP A;  3G82 B;  2RU3 A;  4EW9 A;  5KT7 A;  2AIR B;  2OSR A;  2WAQ D;  3LP0 A;  1T05 B;  4CRJ A;  3NWG A;  1EE6 A;  2OTL S;  2EWH A;  3MTJ A;  4YDD B;  1RYR A;  2Y1R I;  2R7O A;  2E1M C;  4PPD A;  4CLL A;  1U0H A;  3I5B A;  3W9H A;  3MUR P;  5KFZ A;  4P52 A;  3H40 A;  2HKE A;  4B9V A;  1V5V A;  3LO3 A;  1RT7 B;  3BGL A;  2DR6 A;  4G3I A;  3IWX A;  1NB2 A;  1EP4 A;  4K4T A;  3IWN C;  3ITH A;  4QOT A;  4CLF A;  1HNI B;  2ZJQ Q;  4LQ3 A;  2DHH A;  1T03 A;  3KTQ A;  4H4O B;  3IA0 A;  1HNX J;  4QPX A;  3I55 S;  4OQJ A;  1PYT A;  1U26 A;  2GMH A;  2AMC B;  3W9I A;  2QT7 A;  1LNQ A;  2A18 A;  1B0P A;  1UW4 A;  2FUG 9;  2FVP A;  1UVK A;  3HJV A;  3ZTQ A;  2UZA A;  2C3P A;  4FS2 A;  4NEZ A;  4WYL A;  3TW0 A;  4QWD A;  7AT1 B;  2H5E A;  4KH1 B;  1FO1 A;  4RNF A;  1LXJ A;  1MRO A;  3MMB B;  3GRH A;  1Q8K A;  2KT5 A;  3RW6 A;  3MFH A;  2XT4 A;  3NMR A;  2LEA A;  3GZ7 A;  2R2U A;  1T9W A;  5HBM B;  5E3A A;  3C15 B;  2YX1 A;  4A8S A;  4U7U D;  4IRK A;  5RUB A;  2KU7 A;  5KFG A;  4OZJ A;  1OY6 A;  4AT1 B;  4MYU A;  2NTQ A;  1UAW A;  3EZU A;  3U1L A;  1Q82 T;  5KG2 A;  3FGV A;  1FWP A;  2YKM A;  3W61 A;  1KVI A;  3A3N B;  2I6W A;  4LRF A;  5HAN A;  3ZO7 A;  2ZDO A;  1HBM B;  2UXB J;  4IO1 A;  1HW8 A;  4ECQ A;  5C24 A;  1DTT B;  3ILJ A;  3OFH A;  4OJG A;  2XZW A;  2DD8 S;  4KR0 B;  5KFX A;  4USH A;  3BDE A;  2ASJ A;  4LSZ B;  1FRH A;  4IFV B;  2L3M A;  2Q79 A;  3S7R A;  4NA2 A;  1E6V A;  4DL3 A;  3M7V A;  1K73 T;  4L3N A;  1YG0 A;  4ELT A;  3E01 B;  3LAL A;  4QPT A;  3H5U A;  4X4T A;  4A8K A;  3ZZO A;  4ALZ A;  2EKY A;  4V19 J;  3SQV A;  3DKD A;  1NAQ A;  4MKV A;  4HTI A;  1RQ0 A;  4YEL A;  4F4A A;  4DX7 A;  2N7C A;  2B7B B;  3QYY A;  2CPE A;  2H65 B;  1KQG B;  3VGS A;  3S01 A;  5LSL A;  4A8Q A;  2A0F B;  2HVE A;  1SJ4 P;  3MOJ B;  2LA6 A;  5I42 B;  4KGM A;  4NI2 B;  2M7S A;  2VFO A;  2MQQ A;  3FBC A;  4P74 A;  1RWP B;  2E5L F;  1WDD A;  1X31 C;  3PKM A;  2AJ1 A;  1NDK A;  1HYS B;  3KWM A;  4ZP7 A;  3GWC A;  1WUU A;  2FD2 A;  1F9F A;  2MJN A;  3T5H A;  1YJN S;  2CQ4 A;  3E01 A;  3MR7 A;  3ENA A;  2E9Z A;  1U1Q A;  2CZ9 A;  3T9Z A;  4DR7 F;  5BYR A;  5BYQ A;  4NYZ A;  2ZEJ A;  1JLG B;  1NBE B;  2V2V A;  3N0V A;  2NTP A;  2EC2 A;  1FTR A;  4WP9 A;  1RAJ A;  1RTD A;  3P49 B;  1WKK A;  1QRB A;  4RW6 B;  1VC0 A;  2CQG A;  5F3Z A;  4TLR A;  4BHQ A;  1JB0 C;  3D54 A;  2QIF A;  1K44 A;  1BXN A;  3A3O B;  3BQ0 A;  1REV A;  3W2V B;  4ZVO B;  3KK2 B;  3GSD A;  3MMC A;  2BKN A;  3QO9 B;  2LXI A;  4FYW B;  2VG6 B;  4TXS A;  1J5E J;  2D69 A;  5F8N A;  3NGD A;  4LQ9 A;  2M88 A;  3HHK A;  3SIP B;  2W9C B;  2AKW B;  1NDC A;  4MTP A;  1M1K T;  3GG1 A;  4X65 J;  4NCG A;  3GE9 A;  2ZNZ A;  3X1L B;  3EJM A;  1HQ2 A;  1Q53 A;  1QSL A;  1JLG A;  4LRE A;  1XNR J;  2N3L A;  3TAM A;  2GA7 A;  4ZVP B;  5G4D A;  4EBE A;  3FY3 A;  3N5F A;  1XR7 A;  4MJK A;  3DDN A;  3QWP A;  2MY7 A;  5ETP A;  1FXD A;  5IC6 B;  4YEJ A;  2BZ2 A;  1N56 A;  4B3T J;  2J5A A;  1D8Y A;  1HWL A;  2WVB A;  3K8V A;  4DR1 F;  4KYZ A;  1S77 D;  4QU6 A;  2M2B A;  1IUJ A;  3BH7 B;  1G1X A;  4OHZ A;  1SJF A;  1UA0 A;  2BM4 A;  1NZA A;  1FEH A;  1B3T A;  5LL6 d;  1WEZ A;  2RF2 B;  5KT2 A;  1N32 J;  3LPY A;  3MEK A;  1F9H A;  3QO9 A;  3H25 A;  3U7J A;  5J1E A;  1JTA A;  3A12 A;  5IS2 A;  1S1X B;  1A9N B;  2O66 A;  4CT9 A;  3T5K A;  1RAO A;  3IRX B;  2UXD J;  5JMN A;  2QA4 G;  2LEB A;  2Q6C A;  4MIA A;  2WSC C;  1YJV A;  4NML A;  2X3H A;  1ZAW A;  1F1B B;  2DRD A;  4X4R A;  3SYJ A;  4OI3 A;  4CLU A;  5AXK A;  3OT9 A;  3PTW A;  4ZIT A;  3F0N A;  2VOO A;  2R7U A;  3IMQ J;  5A8K A;  5M2U A;  2EBE A;  3DLE B;  3E3X A;  5H9E J;  3RGI A;  4CLY A;  3R9L A;  5GAE I;  2RF2 A;  1N5Y A;  1L1I A;  3M8R A;  1KON A;  3UNY A;  1TZ0 A;  1CSJ A;  3D6H B;  1OGO X;  1W2B R;  3EMT A;  3BYR A;  1HFE L;  3Q8P B;  1N6Q B;  2R7X A;  3GR0 A;  2VJU A;  2BQ3 A;  3FZB A;  2XUL A;  2NR0 A;  3I0S B;  2YH1 A;  4QJV A;  1AFJ A;  1NDP A;  4NLX A;  2ZH3 A;  1NDL A;  1JLA B;  4N77 A;  1RMG A;  2XO7 A;  1B70 B;  3H42 A;  2XI3 A;  3SMZ A;  1UWA A;  4Z05 A;  3A4T A;  4ZOS A;  1RWM B;  3G6X A;  4QIG A;  5EWE A;  1EET B;  3EXY A;  3HD2 A;  4ZN1 A;  4RBT A;  2M4M A;  4ZVQ B;  3AOB A;  4F3Q A;  1RTJ A;  4JYA J;  3TOQ A;  3HD1 A;  1FD2 A;  2JZ5 A;  2JNJ A;  1S72 S;  3D0G E;  3I0R A;  1TL5 A;  2G4B A;  3KLH B;  2V4J A;  3VHQ A;  5C25 B;  2XSF A;  4P7V A;  3DGP B;  4HT7 A;  4WII A;  1DUR A;  4FNI A;  1VCT A;  2RIJ A;  4WFZ A;  3IP0 A;  3ZNJ 1;  1WKJ A;  3ELH A;  3R7N B;  1KCC A;  1RT3 B;  4E8U A;  3H7H B;  4O44 A;  2XMW A;  3EZO A;  4YHH J;  4QW8 A;  2KVI A;  3OJU A;  3H4B A;  4GKK J;  2CPI A;  2FYX A;  2KRR A;  1H38 A;  2EG1 A;  3JUR A;  1HI1 A;  1HD1 A;  3D3B J;  2IDL A;  4FDF A;  3J7Y I;  1X0F A;  4CTA A;  4WYW A;  2XS5 A;  2ZHO A;  1KOO A;  4EGL A;  4EZ9 A;  4LFB J;  1U6F A;  3KLG B;  3FNN A;  4QIV A;  1VRQ C;  3HZG A;  1ACM B;  1KP6 A;  2LQB A;  2OUG A;  3VV2 B;  4ZLN A;  2KM8 B;  2ILZ A;  4M5N A;  3VMV A;  3CW2 C;  2CVI A;  4I0W A;  3EDR B;  3NS5 A;  5HK4 A;  3SI8 A;  1PIL A;  1GEH A;  2I2Y A;  1RTI B;  5HRO B;  2DXD A;  3AOD A;  2YBV A;  1S9G B;  3RUB L;  1O8G A;  4XKW A;  4L6V 3;  2HHQ A;  3NNH A;  3VSU A;  2OPR A;  3PW0 A;  2UXB F;  4OI0 A;  3LAM A;  2WSF C;  3CC2 S;  2LDY A;  2OEL A;  4GVL A;  1U2R A;  3C66 A;  3IC1 A;  1EX8 A;  2EPI A;  1BN8 A;  3BQ2 A;  4N5S A;  3CCT A;  4M5D A;  1O51 A;  2VOD A;  2GJ2 A;  1OSD A;  3GIJ A;  4B3S J;  2YNG B;  1FDD A;  3RU0 A;  4X64 J;  1AXQ A;  2H3E B;  3K59 A;  4NZ0 A;  5B0E A;  2AYE A;  4PG8 A;  1RU2 A;  2VQF J;  2HHW A;  3NNC A;  5AE1 A;  2BEF A;  3OJS A;  4AL6 A;  2KL8 A;  2D74 B;  2HQ3 A;  3GLJ A;  3IG1 A;  3M8P B;  3F56 A;  4BC7 A;  2NS1 B;  2JL9 A;  4CI0 B;  2QA2 A;  2HIQ A;  3CJ0 A;  3SQO P;  2CG4 A;  5KFB A;  1SQE A;  2JJ4 D;  1U49 A;  3KMS A;  1C4C A;  4XQF A;  2YKN A;  3OTO J;  2OPQ B;  2C2D A;  3L3C A;  5DZ6 A;  2BE2 B;  2CQI A;  1B0T A;  4UW2 A;  5HJY A;  3T3F A;  4JV1 A;  1VMB A;  2DGO A;  1JXL A;  5EDW A;  4O0I A;  3K5L A;  3HF5 A;  3CCJ S;  1UCN A;  5HSP A;  1NK6 A;  4I2P A;  3MCM A;  2IPO B;  3ICL A;  1F5C A;  1VQ8 S;  2V8V A;  3RBZ A;  3DLB A;  2DNP A;  4ID8 A;  1RT4 B;  4G1P A;  3N6M A;  4CDI A;  1SL1 A;  3M8P A;  1BQM B;  3CJK B;  2HFS A;  2HFO A;  3JSM B;  1TR0 A;  2HS4 A;  3LYC A;  4LVO P;  3LF0 A;  4CP5 A;  1MWQ A;  3G9C A;  3QRR A;  1H6K X;  4AL7 A;  3U1N A;  4NLR A;  4JI4 J;  4DFM A;  1KEK A;  2LCW A;  4KQZ A;  2HFZ A;  2KG0 A;  1QSY A;  4HTJ A;  3EGV A;  1P1T A;  4K8R A;  1O8M A;  5FII A;  1HR0 J;  3OR2 B;  1FFW B;  2JLE A;  5KFY A;  2E1C A;  4C0B A;  4PG7 A;  2RKI B;  4TQR A;  5A0Y B;  2DCL A;  1J5E F;  4KV8 B;  2GQ2 A;  4DCP B;  4X65 F;  4XOR A;  1FRL A;  4C8Z A;  3R5C A;  4P10 A;  2B9Y A;  4RUC A;  1XNR F;  2X6Y A;  1CUL A;  1BLU A;  1FRM A;  2XSJ A;  3OR1 A;  4WFN Q;  2IYI A;  4WP3 A;  2QG9 B;  3K5N A;  3K17 A;  1WC0 A;  2VFU A;  1HHQ A;  2B4V A;  2XMA A;  3CMQ A;  5J2M B;  4A8O A;  4B9L A;  4ECT A;  3BGU A;  3UWT A;  1NND A;  4B3T F;  2PFF B;  4O0N A;  2DH8 A;  2CNO B;  4AE5 A;  3DU1 X;  3CD6 S;  2VPX B;  3SXL A;  1DQA A;  1YI2 S;  1C4A A;  1N32 F;  3CME S;  1QUP A;  3M2V B;  1H73 A;  4WFA Q;  3A1Y G;  4OX8 A;  1HI0 P;  2G9O A;  3UQS A;  4ZIW A;  5KFJ A;  2WVD A;  1SC3 B;  1NSQ A;  5KOX A;  4KAI A;  4IG3 B;  2VDI A;  3PYD A;  2OSQ A;  2UXD F;  1T3O A;  4DR4 J;  2M8H A;  1HNV B;  2MGZ A;  4A48 A;  5GAH U;  2X3G A;  3PRV A;  1N48 A;  3DFE A;  2V4Q A;  2KYZ A;  2F4V J;  4I6A A;  2P9G A;  4CLK A;  3UNG C;  5AMV A;  2XZD B;  5J2M A;  3GFY A;  5KG4 A;  1OQ3 A;  1VQ9 S;  4FZV A;  1SH2 A;  3UDC A;  4E98 A;  2PO4 A;  5HP1 A;  1SJ1 A;  4RW9 B;  2P6T A;  1RDR A;  2MZR A;  5I4M A;  2DRB A;  2NSP A;  4U67 Q;  1CJK A;  3JSR A;  4BCA A;  4O3R A;  4LF2 A;  5A8W A;  1IKX B;  1SC1 B;  3M2V A;  3EX7 B;  3GJQ B;  4FF2 A;  1JNR B;  2DNM A;  2WCX A;  3VGT A;  4JUZ A;  2RJZ A;  2GO9 A;  2F4F A;  2E44 A;  4HDH A;  1KLM B;  2JEJ A;  3HX9 A;  1WWH A;  4WKY A;  1RSC A;  5F0U A;  4HKQ A;  3L7U A;  2MKH A;  5E3Q A;  2V5I A;  1XN9 A;  4PXE A;  1QDU B;  4TY8 B;  4TKT A;  2YNI B;  2LFV A;  3PR4 A;  4DG1 B;  1TUW A;  1K0V A;  3KLI A;  5BJR A;  3DOM A;  1SC4 B;  4ELV A;  1NH8 A;  3MF5 A;  3THT A;  3K58 A;  4C8N A;  5DQG A;  3RRG A;  4NXM J;  5M2R A;  1ARO P;  4FXW A;  3OVS A;  1EKS A;  4C3M A;  1K1Q A;  2Z2L A;  4JYA F;  2GQQ A;  1U24 A;  1VRT A;  4O4G B;  3FEZ A;  2EVZ A;  3ZZU A;  2NZC A;  3MM6 A;  2HMI A;  5C42 A;  1P27 B;  1APS A;  1VOM A;  5EX3 A;  4OHY A;  3AH6 A;  5L46 A;  1NSP A;  4TQS A;  1YIJ S;  4CH1 A;  3SSS A;  4PG5 A;  2C2E A;  3CED A;  2NPI A;  2WVC A;  3JX8 A;  1EA0 A;  2VFS A;  2GCF A;  2C42 A;  3K57 A;  1Z2L A;  4M8L A;  2RSQ A;  2U2F A;  3DU6 A;  2HVZ A;  4YHH F;  1FKO A;  3PSS A;  2NXE A;  4GKK F;  4NE9 C;  4IKA A;  1NKC A;  2WB1 D;  4IG0 B;  2H9Z A;  1OO0 B;  4YP3 A;  3Q0A A;  3H20 A;  3GQ8 A;  3DC2 A;  2HGN A;  3RB3 A;  1Y3J A;  4LFB F;  3OL7 A;  3IBW A;  2RVJ A;  2R8J A;  4LRB A;  5AXM A;  1CJT A;  1PCA A;  3M9N B;  1RT6 A;  5B7W A;  2RH3 A;  1RAI B;  5IXU A;  3NG8 A;  2FJV A;  4F02 A;  5A8R A;  2FZK B;  3Q83 A;  2H5J B;  4ECW A;  1NHC A;  4LUB A;  3NEK A;  4TYB A;  1NPR A;  4KGK A;  2C22 A;  1HG8 A;  2E5I A;  2HWT A;  2F8M A;  2VBE A;  2OHD A;  2EFP A;  3EIC A;  1XR6 A;  3GR1 A;  4IG0 A;  3PM9 A;  2V8P A;  1IWA A;  2CJQ A;  3TUP A;  4ZKA A;  1MWY A;  3M8Q B;  1JKH A;  1DTQ B;  3GYX B;  2F1F A;  2DPJ A;  1NPP A;  1S9F A;  4Y0F A;  1UPP A;  4DQS A;  3NCR A;  3TI0 A;  5HVG A;  3DMJ A;  2V9W A;  4OV1 A;  5LXR A;  4JV2 A;  4B3S F;  1GMV A;  3PW7 A;  1UVI A;  2B3T B;  1KQK A;  1K9M T;  4XOT A;  3UD3 P;  5IV3 A;  4X64 F;  3ETO A;  4X4U A;  3RG6 A;  2VQF F;  3QIP A;  2E66 A;  2OEM A;  5D3G A;  3D5M A;  2R7W A;  2HQF A;  1WAC A;  3AJ1 A;  4LSN B;  3L4B C;  3I31 A;  1JK9 B;  1Y3K A;  4DR6 J;  1IXK A;  1GK8 A;  3R5B A;  4YN3 B;  1RU1 A;  1U8S A;  1MMD A;  1TYW A;  4ETX A;  3ET6 A;  1OFE A;  4L76 A;  3OTO F;  1RCX B;  2YNH A;  4UQG A;  3PIP Q;  2HK3 A;  4F2R A;  3Q23 A;  1H2V Z;  3NRB A;  4ZLJ A;  3PDN A;  3KMQ A;  3MI7 X;  2R2S A;  1SUQ A;  2W2Q P;  3DRY A;  1ZAV A;  4ATN A;  1M5K C;  2Y8W A;  1QAJ A;  4NXN J;  1IN0 A;  4I2Q B;  1RBA A;  3D9B A;  2QSW A;  1PAE X;  3VVT A;  2RU9 A;  1UVN A;  3QRQ A;  1XQI A;  1LWE B;  3H59 A;  2OJ3 A;  3CJQ A;  4DV3 J;  2MLY A;  1CC7 A;  1X5O A;  4F26 A;  3RB6 A;  5B0F A;  1C1C B;  2MQ8 A;  3TRG A;  4ZCI A;  3M2R A;  1RIS A;  3HSZ A;  4DL2 A;  1XWL A;  3HFZ B;  4I4B A;  1NJW A;  4KKO A;  3W65 A;  1U6Z A;  4JI4 F;  4Q0B A;  1M5S A;  4YZQ A;  2U1A A;  2ZC3 A;  3CWJ A;  2CNN B;  4IFY B;  4W4M A;  1HR0 F;  5EWF A;  3I87 A;  2CRL A;  3MEE A;  3KHH A;  1I3O B;  1S6P B;  1EJ7 L;  3QGH A;  1PSD A;  5AXN A;  2XYH B;  2BOP A;  3M2U B;  2IHR 1;  4D3G A;  2ZH9 A;  3UW0 A;  4YDX A;  3ZTO A;  2NXJ A;  2PMH A;  4C4W A;  2X1F A;  1KLN A;  2HNY A;  2OFH X;  1LW2 B;  1TV6 B;  3DRR B;  4IUF A;  4BWJ A;  3CJ3 A;  1UPM B;  4V1A k;  4TN2 A;  4Q8E A;  1P6T A;  1LQ9 A;  4ED3 A;  3NS6 A;  3EPG A;  1RT1 B;  3K0J A;  1S1T A;  1DRZ A;  3SDE B;  3GQC A;  4HR2 A;  3GU0 A;  3F41 A;  1FWL A;  3W9J A;  1XR5 A;  1RT5 B;  4K4Z A;  3DLK B;  3OBI A;  3HMJ G;  1NSA A;  2PI4 A;  1FI4 A;  4NMX A;  1N0U A;  1AZS A;  1IKV A;  2IA6 A;  3T1A A;  4ES3 A;  4RPF A;  4Y00 A;  4EBC A;  4F0K A;  4URG A;  1F2H A;  1EHW A;  5CHC B;  1M90 T;  3AK5 A;  1FKA F;  3MGJ A;  2LYV A;  4DPY A;  3Q8U A;  3L7O A;  2MEW A;  5E7O B;  1M1H A;  3QT6 A;  1D1U A;  3G6E S;  3CCE S;  1U4B A;  2R7T A;  1SB6 A;  1U1P A;  2LA4 A;  5DM7 Q;  2YKO A;  3QWU A;  2F4V F;  4X84 A;  2UVF A;  5JXS A;  1R6Y A;  2JVO A;  3GV7 B;  3V6D A;  4B9U A;  1HWK A;  1O8K A;  3FCH A;  4OHW A;  2MQL A;  2BR0 A;  4KH0 B;  1NME B;  1Q0N A;  3BKF A;  1KQ5 A;  1TL1 A;  3VAM A;  1F2G A;  3D66 A;  2FY1 A;  2M9K A;  3AOC A;  3KHG A;  3MMA B;  2BAN B;  5DDO C;  2CPY A;  4J9R A;  1ELO A;  3EPI A;  3AB4 B;  1ZZN A;  2GGP A;  2MXY A;  3I5C A;  1RAA B;  4M5I A;  3MXH P;  2OPS A;  4WTO B;  1U09 A;  2Q6B A;  5GVQ A;  5KFN A;  4EYH B;  2ZWO A;  3GV8 B;  1NK0 A;  3K8W A;  2GIF A;  2HIY A;  4U6P A;  3SSR A;  3W2W A;  3SZE A;  2Q66 A;  4P2M A;  3NBP A;  4ZVS B;  4PZV A;  4MK7 A;  2ZH4 A;  3CD7 A;  5FDL A;  2NUU G;  3SFU A;  5ETM A;  1I5O B;  3OV7 A;  4CLS A;  3DM2 A;  2FJE B;  2XLJ A;  1MW7 A;  2MZT A;  4A4J A;  2DHA A;  4NXM F;  3A8J A;  1RAH B;  2SXL A;  2BAC A;  2CQ3 A;  3HDS A;  5D4L A;  4DDF A;  2DR5 A;  3AD7 C;  1HBO A;  1GTH A;  3RRK A;  1U25 A;  1Y5N B;  4FYV B;  1YX2 A;  2AJ4 A;  2HBY B;  2CPZ A;  5I3P A;  2DT9 A;  2MZ1 A;  4HHJ A;  1HNZ F;  2G13 A;  1ZPW X;  3G6Y A;  1FF2 A;  3BH6 B;  4EO8 A;  3RR8 A;  2B6A A;  1IA5 A;  2XWX A;  2VFT A;  5DO2 A;  2FGO A;  2DR9 A;  3GII A;  4RWW A;  3IAS 9;  1VK3 A;  2QEX S;  2YKQ A;  5H9F K;  3AQO A;  2PEC A;  1TKX B;  1ZZF A;  1E6Y A;  1SC6 A;  1I1G A;  3K5P A;  5KG3 A;  2JEI A;  2IVM A;  3SCK E;  1L3S A;  1RHK B;  4GO5 X;  5K8N A;  3DHX A;  1O0P A;  2RIL A;  4UST A;  1VHI A;  2J0S D;  2CQ2 A;  2HND B;  1W2I A;  2KB2 A;  3MEC B;  4OJ5 A;  4TLQ A;  2R2R A;  2V67 A;  1HQU B;  1REG X;  1WG4 A;  3CCL S;  2MLZ A;  4NLU A;  3N79 A;  4U8V A;  4XDC A;  4LT6 A;  2HHS A;  2XNR A;  2GVD B;  2J7W A;  2W4P A;  3OD2 A;  3FBB A;  3R97 A;  4C11 A;  1UP1 A;  5ETO A;  4MAK A;  1D9A A;  4AYB D;  4J90 A;  2BSP A;  1GFW B;  2NRE A;  3QSI A;  2G0J A;  5F3T A;  5AXL A;  2ASL A;  2JLF A;  2VBY A;  1ITP A;  1XG2 A;  4EUV A;  4YFU A;  3GB0 A;  3QQC D;  2G1D A;  3MED B;  4QR2 A;  2VKZ G;  5EUH A;  1K4Z A;  4TNO A;  4O3O A;  1CQM A;  1GX5 A;  4OYO A;  3OUY B;  4RU2 A;  3ZC4 A;  1CJU A;  4OI2 A;  1LLW A;  2ATC B;  1K47 A;  3HZE A;  2DIU A;  4CIO A;  5BXI A;  5K20 B;  2H4W B;  3CCW A;  1K5C A;  3ILO A;  3VAH A;  1X4B A;  1BWE A;  4KC5 A;  4CQ1 A;  3FC9 A;  1VS3 A;  5SZT A;  3N9U C;  2G2Y A;  3H2V E;  2FVQ A;  1WKL A;  2ASY A;  2J6T A;  4YEI A;  4DZ6 A;  1K8F A;  3TAP A;  1GNK A;  1LWC A;  3RR7 A;  2DNR A;  1TVR A;  4O4R A;  1FE4 A;  1FJ7 A;  3JB9 k;  4DPU A;  1V3R A;  3R1L A;  5LJ3 Y;  4B08 A;  2YWF A;  1KSP A;  3JTO A;  2B5J A;  2WK4 A;  4MFB B;  2FLO A;  1IDK A;  2W8L A;  4A8W A;  4DR6 F;  4AFF A;  2IM3 A;  4MT1 A;  2ZZT A;  2GV1 A;  3KLF B;  3P3D A;  4DR5 J;  1RAD B;  4OJL A;  4A8X A;  2R4F A;  4ED4 A;  1NJX A;  3KK3 B;  1DQ9 A;  3BEG B;  1X4A A;  4ANC A;  2FLN A;  4JBC A;  3TA2 A;  4EYI B;  2CJA A;  3HVW A;  2O0W A;  3EWG A;  3QGI A;  1F3F A;  3KLV A;  2WVE A;  3LP2 B;  4OYW A;  1UEK A;  4AXI A;  3N6N A;  7FD1 A;  2I9S A;  1VK8 A;  1HBN B;  4U96 A;  4B9N A;  1KOH A;  3M8Y A;  3Q2T C;  1SPB P;  4PWW A;  2J9C A;  4NXN F;  5KFW A;  4MK8 A;  4F4X A;  3LQV A;  4ID5 A;  4IH6 A;  1I94 J;  5HI7 A;  2YWG A;  5DJB A;  3W5Z A;  1WOP A;  4L72 B;  2DEJ A;  4NCB A;  1IJF B;  3BKT A;  4OM9 A;  3E2E A;  2DTJ A;  4NAS A;  3MWB A;  3G8S A;  4QQB A;  4DV3 F;  2B8Q A;  4DV7 J;  2HHV A;  4B3O A;  3CDB A;  3PRD A;  5KFR A;  2XMU A;  4YS2 A;  1Q7Y T;  3VWS A;  3ZZZ A;  4Q45 A;  2F9D A;  4RNH A;  5HMW A;  4YUD A;  2G0C A;  3KK3 A;  2RRN A;  1S0N A;  4R5P A;  2HW3 A;  5GMD A;  3R2C J;  3GCX P;  3KKF A;  1Q8L A;  2XT2 A;  2BJ9 A;  5HQM A;  2XGP A;  2GJI A;  5IQ6 A;  3TQE A;  1AB8 A;  4UY8 5;  1VHF A;  4RUA A;  3ISN C;  4YZ0 A;  2H5I B;  4J37 A;  4QYZ J;  3MM9 B;  3KJV A;  2DVI A;  5D6G A;  2BOA A;  2VFP A;  3BF4 A;  2B0G A;  4FVC A;  3M1V A;  3M30 A;  4ETZ A;  1QJH A;  1KC8 T;  5HLF B;  5CAB A;  2RHS B;  2VBK A;  2VV5 A;  2XWY A;  3ENQ A;  3VAF A;  3GYN A;  1XC9 A;  3AXK A;  4A47 A;  2ZZN A;  4EK2 A;  3D6T B;  1TYX A;  3KXD A;  2XMV A;  1JX4 A;  4YC5 A;  4XAK A;  5C5J A;  4KGZ B;  2N82 B;  4NOH A;  3DXS X;  4ECX A;  9ATC B;  1Q1K A;  2XG8 A;  1TL7 A;  2QLF B;  1YKW A;  5E2Q A;  1JXV A;  5J2P A;  4ED1 A;  3KJQ B;  1NK4 A;  3ENV A;  1VRU A;  2HBQ B;  4RWX A;  4FNH A;  1R0B G;  2MZJ A;  4AUK A;  2Y1J A;  4UT4 A;  2V8H A;  2HRU A;  4CNZ A;  1IR0 A;  1VFJ A;  2VHG A;  3X3U A;  1TMJ A;  2VFQ A;  4P2F A;  2G1H A;  1Q78 A;  5CYQ B;  4H4M A;  1UJ4 A;  1QRC A;  1NRK A;  3UCU P;  3EVW A;  4NK6 A;  3DGV A;  3CD0 A;  1RLC L;  1P9Q C;  5J2Q B;  2HEK A;  1Y5I B;  3OL6 A;  1FRJ A;  1FJG J;  5HVH A;  2L9W A;  1LWF B;  3GIL A;  4C0H A;  1IB4 A;  4N56 A;  5GAE U;  3GSI A;  1U48 A;  3KK1 B;  1CQN A;  1QJV A;  3G8Q A;  1DLO A;  1U2C A;  4YZA A;  3PR5 B;  5KFE A;  1J5O A;  1S1W B;  1HA1 A;  1Q8B A;  3CDW A;  1U1R A;  4P7T A;  4ZA1 A;  3POT A;  5FLX U;  2ZFH A;  3BSN A;  1V5I B;  3OPK A;  2QTW A;  1NJZ A;  3NGS A;  4ZLL A;  2DNQ A;  4DS5 A;  1VBY A;  1DBD A;  4CO4 A;  3TH0 A;  4X4N A;  4XDD A;  4BS2 A;  2DEI A;  3DRS B;  1IM6 A;  4XL9 A;  4RW8 A;  1RTH B;  4DL6 A;  4KH3 A;  3A8K A;  1JNZ B;  3R7S B;  5IM0 B;  1LWF A;  1FE0 A;  2EC0 A;  3CPW R;  3WC0 A;  1CC8 A;  3NLC A;  1VBZ A;  4DUZ J;  2DR7 A;  3TJ8 A;  1G7C B;  2C2R A;  2RRB A;  1L5U A;  4PAA A;  4IR1 A;  1TKD A;  1WOO A;  4KO0 A;  3MUT P;  4RL1 A;  2P9C A;  5D77 A;  1YZ7 A;  2L41 A;  4FXV A;  1HW9 A;  1S0V A;  5U47 A;  4C7Q A;  1N52 B;  1NK7 A;  4RU9 A;  1FNM A;  2IY5 B;  4I69 A;  1U1M A;  2BBE A;  1ZS6 A;  4R25 A;  2VBX A;  2DY9 A;  3W60 A;  2FLL A;  2XLI A;  1U0S A;  4YB6 A;  3CCQ S;  3UD5 A;  3GFH A;  2FY8 A;  3CCS S;  1CJV B;  2FIU A;  3VAJ A;  2CWK A;  2HRY A;  2VAS A;  2E1A A;  3D4J A;  1UMJ A;  3C16 A;  4PMH A;  1YDL A;  3NS7 B;  2PYH A;  3AJD A;  3IR6 B;  4RZR A;  1FK9 A;  4ZHR A;  4OX7 A;  3DI6 A;  3G86 A;  3P4U B;  2NYI A;  1R0A B;  4OZL A;  1QM9 A;  2GAH C;  2UV8 A;  1VQK S;  2VFV A;  2ZNY A;  3EM1 A;  2LMI A;  2XY7 A;  4DV4 J;  3M9M B;  2NQP A;  5KFP A;  1JJ4 A;  3TVK A;  1C1B A;  1PYS B;  1JLQ B;  4DWI A;  1JRG A;  4J9L A;  5J2N A;  2FTR A;  3PO5 A;  3VTI A;  1T02 A;  3QLH A;  3QGG A;  3EVM A;  3N6Z A;  1OPZ A;  5CYJ A;  4CCH A;  1Q5V A;  2HWI A;  3L09 A;  1WJ9 A;  4NX9 A;  1CLF A;  4DHV A;  3CVK A;  1X4E A;  3KG4 A;  1K1S A;  5ETL A;  5HMY A;  1U8W A;  2Z0G A;  2AV5 A;  4RNM A;  4FXD A;  2JHE A;  1R8A A;  3CJ4 A;  4KE5 A;  2A6O A;  1UFL A;  1BWV A;  3R27 A;  1R8P A;  6AT1 B;  2FC9 A;  4W98 A;  1A6L A;  1YK9 A;  4K50 A;  1OFD A;  1RWU A;  3IS9 B;  2Z58 B;  4OI4 A;  2LEP A;  3DXB A;  3H2U B;  2ZBQ A;  2CA9 A;  3CD5 A;  4F50 A;  1NK9 A;  4ZCM A;  2HHU A;  4ECU A;  4C3K A;  3TVY A;  3QBC A;  2XNQ A;  3IGV A;  4JB8 B;  1SL2 A;  3MPV A;  4Z37 A;  5EN1 A;  4X4S A;  4HWV A;  3PX0 A;  4CO1 A;  3UR3 C;  3CUN A;  5AE2 A;  1RWV B;  2G0I A;  4OJO A;  4JI0 J;  3M32 A;  4MKY A;  4WFX A;  3NGU A;  4GRS A;  2DNO A;  3I6P A;  4C98 A;  2KVQ E;  2MDA A;  1YBA A;  4W8Q A;  1Q81 T;  3W62 A;  4J9U E;  1I94 F;  3WQP A;  4LRD A;  2X3D A;  1UEV A;  5DET A;  2XS7 A;  3FQL A;  3PX6 A;  5CYM A;  2O6W A;  4ZDN A;  1WC6 A;  1QD1 A;  4IDK B;  2DPI A;  2AHO B;  4DV7 F;  1BMQ B;  3NAI A;  5CCM A;  1SV5 B;  4WTY A;  3G87 A;  3QFW A;  3D68 A;  1NHV A;  4DFK A;  1FRX A;  4CZC A;  1LXN A;  3NP5 A;  1FA0 A;  1FJE B;  1SKR A;  2ZE2 A;  2BRK A;  4WZQ A;  2MKK A;  1S7H A;  2ZVS A;  1H74 A;  2BM1 A;  1JLB B;  2LQ9 A;  3GON A;  1FDA A;  2MY8 A;  3Q89 A;  2MKS A;  4OL8 A;  1RAF B;  3MM5 A;  2KXN B;  2ZKT A;  2VA3 A;  2OD4 A;  3EGZ A;  3V4I B;  2R8H A;  2KFY A;  1RHJ B;  2ZBP A;  3OXG A;  3K5O A;  4KRW A;  2FHJ A;  2YUH A;  2CUY A;  1PBU A;  2MKY A;  1B64 A;  3CJT A;  3AOA A;  3EGW B;  3QRP A;  1HPZ B;  4DUT A;  3TA0 A;  4B3M J;  1CS4 B;  1Y4Z B;  4QWA A;  1XER A;  3MM7 A;  2FHJ D;  5F8L A;  4EU0 A;  1PYO B;  4K4X A;  3PEH A;  2E1R A;  4DLE A;  1HBU A;  5B08 A;  3HT3 A;  1PKU A;  3DHW C;  3BV8 A;  2BQR A;  4DSI A;  2NST A;  2UUA J;  4ANE A;  4FKY A;  2A3J A;  5K14 A;  1D3W A;  2AJ2 A;  4ZVF A;  3M4X A;  3GJT B;  4J9K A;  2WTF A;  4KGV B;  1S76 D;  1O5J A;  4CNY A;  2VBW A;  2P5V A;  3J7Z 5;  4CM2 A;  3WBZ A;  2J8A A;  3BZQ A;  4LBP A;  4K7Q A;  4S0M A;  4U7U K;  1RZM A;  1LM1 A;  2N4D A;  4GC6 A;  1XBW A;  5KTQ A;  3MAA A;  2HLU A;  2C2Z B;  4JI2 J;  4DR2 J;  2KO1 A;  3GIM A;  1FJG F;  2VJI A;  1CLW A;  4LSL A;  2XY5 A;  3E8O A;  4F2S A;  4HL9 A;  3G71 S;  1WEX A;  2E7X A;  3OTC A;  2CDQ A;  2IJR A;  1O8H A;  2LKZ A;  4ICL A;  3GMG A;  3D3C J;  3WC2 A;  4NK8 A;  2IM0 A;  2IA0 A;  5DGB A;  1T8E A;  5LOQ A;  4ED6 A;  4NLD A;  1HLW A;  5KG1 A;  3VSV A;  1ZET A;  4C0O C;  3LGH A;  4OZ5 A;  4DV2 J;  4KSE B;  1M5V C;  4XNF A;  5DLF A;  3JQK A;  4Q2M A;  3AJ2 A;  3QFH A;  3QJL A;  1S48 A;  4DSL A;  4X4O A;  2E5H A;  1TFY A;  4IOC Q;  2JH3 A;  3AAW B;  2QFJ A;  3DRX A;  4DPO A;  4HH1 A;  1QE1 B;  5IV4 A;  3DOK B;  3R2D J;  4OYZ A;  2O3D A;  1QAI A;  2COL A;  2PA3 A;  2EW9 A;  3NGR A;  1H72 C;  4EO6 A;  5D0G A;  4P9S A;  3CCU S;  3V81 B;  2RQM A;  1RWX B;  4WXO A;  2JLG A;  1S1U A;  2DIT A;  3SUC A;  1N5Q A;  4GVB A;  3C14 B;  4CO2 A;  4URQ U;  3OFF A;  4DUZ F;  5FD1 A;  2AJQ A;  1OY8 A;  5CCL A;  2GO8 A;  5I3Q A;  1P1L A;  3RW7 A;  4DX6 A;  2QX0 A;  3CXC R;  1TL3 B;  1HWI A;  2HZV A;  3HO1 A;  3CJS A;  2DGT A;  4DQR A;  1M5H A;  1KQS R;  2FJD B;  2KN4 A;  2AEJ A;  2O5D A;  1FRK A;  4OJH A;  5KT5 A;  3BBC A;  1LKZ A;  2W9B A;  5KFT A;  2XM3 A;  2G2O A;  1KCD A;  4WU3 A;  3HHL B;  1NCL A;  1QE1 A;  2NZ4 A;  4I68 A;  3VCD A;  5A76 A;  3DOL A;  3KLE B;  1K0T A;  3T1Y J;  2F65 A;  4M5K A;  1C0T B;  4LRA A;  2WB4 A;  4IH7 A;  2ZOF A;  4IQM A;  1FDN A;  5CH7 B;  3G82 A;  1TKZ B;  2PYG A;  3GP9 A;  2Z56 B;  1IBL J;  4DFP A;  5CQG A;  4A8M P;  2CVE A;  1IKY B;  4PWD B;  3PJX A;  1T05 A;  3SEO A;  3SQG B;  3HVR A;  1FFS B;  1SQF A;  1JJC B;  2C3U A;  4FYY B;  3H5Y A;  4FYD A;  5B0C A;  1JXE A;  3AFG A;  3I82 A;  3ZZR A;  2MJU A;  1PG5 B;  5IOL A;  2GML A;  4DR3 J;  4DV4 F;  3KRG A;  2FJX A;  3FQK A;  1F5A A;  3HHL A;  3HLU A;  1M0S A;  1RK8 A;  4G6V B;  1HNW J;  1RT7 A;  2YKP A;  2E5J A;  2AYM A;  2V2Z A;  2HVI A;  4MK9 A;  4YR3 A;  3H8Y A;  2XZT B;  3HHL D;  2WBR A;  2B7C B;  2Z2Y B;  4ZJL A;  3LAK A;  1HNI A;  4OX9 J;  2AEF A;  4X4V A;  3BRE A;  1BY9 A;  2MKI A;  1IQT A;  4H4O A;  3NY0 A;  4XN0 A;  1S1V B;  2HQG A;  1S6U A;  2ZH6 A;  4KT0 C;  1FNX H;  1WG5 A;  3WWG A;  2RS8 A;  2CJY B;  3DNC A;  5KFC A;  1C0U B;  3W64 A;  3EYZ A;  2QL7 B;  2VUG A;  2HLT A;  1H80 A;  2BE9 B;  1GQ8 A;  2N7Y A;  4O23 A;  3RBE A;  2Q1L A;  2HZC A;  3BKU A;  1GXU A;  3MMB A;  1VQ7 S;  2OPP B;  3OL9 A;  5HBM A;  3C15 A;  1KTQ A;  3S6E A;  4YQW A;  3NOC A;  3CIM A;  3MUM P;  3EE3 A;  1S59 A;  1Q5Y A;  1Z1Z A;  4H4K A;  1S97 A;  2P8I A;  3P96 A;  5CZV A;  3GFX A;  1R27 B;  2OMO A;  4HAC B;  3I32 A;  3R6G B;  5L39 A;  4TYA A;  2KZM A;  4PQU B;  1HQE B;  3ENW A;  1S0O A;  3RB0 A;  4M5H A;  4K2X A;  4CO5 A;  1HBM A;  5D0E A;  2VF3 A;  1DTT A;  4ZPD A;  4JI0 F;  2C3O A;  5D0H A;  1YTY A;  1D0E A;  4C8O A;  4KGX B;  2DO0 A;  3KJN B;  1FRI A;  5G0R B;  3JXO A;  2VOP A;  3R5J B;  3LH2 S;  3I4H X;  1ZH5 A;  2B9X A;  4IFV A;  1VQL S;  1FER A;  2HQD A;  3QT8 A;  2Z8G A;  3TUZ C;  4FPR A;  1OY9 A;  3GQ7 A;  4JI6 J;  1GXT A;  2ZIT A;  2ZH7 A;  1FXL A;  1DAB A;  4HAC A;  2VIC A;  1NZ8 A;  5LM7 E;  4XMY A;  3OVB A;  1HQE A;  4HI1 A;  1P8G A;  3VAI A;  3LA0 A;  4KFB B;  2KFN A;  4CH7 A;  3PYG A;  2HS0 A;  1X5P A;  1LFP A;  4K4W A;  1YWX A;  4RNN A;  1RAE B;  3PG9 A;  2OLW A;  4YB1 P;  4ED8 A;  2RDD A;  5I42 A;  4NI2 A;  3H2L A;  3CCV S;  1EIY B;  2CQ1 A;  5G0R A;  4XM3 A;  1BUX A;  2MTL A;  1YRU A;  3LP1 B;  4X66 J;  1HYS A;  1SCJ B;  1BQN B;  4OX6 A;  3O3L A;  1SKU B;  2R7S A;  4WPA A;  4XTT A;  2V69 A;  1AUS L;  1QA1 A;  4DOZ A;  3GIR A;  3GJR B;  1GH8 A;  3M8S A;  4OHV A;  4NYO A;  4LR7 A;  3VVU A;  3W7B A;  2X1G A;  2BRL A;  2DY1 A;  4CM0 A;  1O8F A;  5KFD A;  5B0G A;  4ZCL A;  3MUV P;  4DCJ B;  4B3M F;  3DCA A;  3W1Y C;  4FBT A;  1QA2 A;  3SFG A;  1S57 A;  2M5Y A;  3D2W A;  2KJV A;  3N90 A;  3NB2 A;  1RWK B;  2RRA A;  4RW6 A;  3O1L A;  2IC3 B;  3I5A A;  4I56 A;  2JX2 A;  4G1Q B;  1SJ3 P;  2UUA F;  3RB4 A;  3W66 A;  1PJ5 A;  2MQN A;  3V6J A;  2QMW A;  4DV0 J;  3ISZ A;  3W2V A;  5ADZ A;  4J9Q A;  1LK7 A;  3F73 A;  3KK2 A;  3DYA B;  1XMQ J;  1EZG A;  3HSG A;  1D9D A;  2CFX A;  2IVY A;  2VG6 A;  3CB4 A;  1WEY A;  1Q79 A;  1OFM A;  4YR0 A;  3ONQ A;  1VLO A;  2W9C A;  2FDN A;  3KUH A;  3HHE A;  2CG8 A;  4JI2 F;  1T9X A;  4DR2 F;  2Y0B B;  1LW0 B;  3BBB A;  4WCE Q;  3D67 A;  4WWS A;  1IM4 A;  1RBL A;  5LMN J;  1RTZ A;  4Z06 A;  2PGC A;  2FVR A;  1L3V A;  1ICE B;  2ADC A;  1DBG A;  4GKJ J;  2IC3 A;  1WI8 A;  2K2P A;  3MZI A;  5ETS A;  4Q5V A;  4XLA A;  1RT2 B;  1HWU A;  2AEM A;  1RAB B;  4L75 A;  2VPY B;  2NXC A;  1VIO A;  2PEB A;  1TU0 B;  4DV2 F;  2YPY A;  4DPT A;  2YWE A;  1WSR A;  4B02 A;  4X62 J;  1TYU A;  5CA5 A;  1Q86 T;  3UVJ B;  3UW1 A;  3LPE A;  1S0M A;  1S1X A;  4OZY A;  4V02 C;  2NSC A;  1VBL A;  2HHP A;  3OW2 R;  4LIR A;  3IRX A;  4RW4 B;  5T7L B;  1LW0 A;  1S4E A;  3VR1 A;  5D4O A;  4C2M A;  3QMQ A;  1SL0 A;  2VQE J;  3IXQ A;  1AW0 A;  2YPZ A;  4O3Q A;  1H3D A;  2ZH8 A;  1WC3 A;  3B8H A;  1W7W A;  2CNK B;  5B09 A;  1WSV A;  1S10 A;  4KJI A;  5L1I A;  4CLZ A;  2KZZ A;  1S6O A;  3DLE A;  2IAJ B;  2XS2 A;  3PET A;  2CAJ A;  2BQU A;  3JYT B;  2BYC A;  3TAQ A;  3PJW A;  2HWH A;  1KVK A;  1HMV B;  3C6T B;  2GFF A;  4F67 A;  1R43 A;  2RT3 A;  3RBD A;  4N8N A;  1DAX A;  3VGV A;  2FHK A;  4RX6 A;  1N6Q A;  2HK2 A;  2E7W A;  2VPZ B;  1GMU A;  3D1H A;  3I0S A;  4NL5 A;  3AY0 A;  1H0H B;  2ZD1 B;  5IQQ A;  3T1Y F;  1JLA A;  1AIR A;  2UUC J;  1OJ4 A;  4NLO A;  4Y6I A;  1WMR A;  4PXD A;  3W63 A;  5ETQ A;  4UY8 T;  3ZTR A;  3GYG A;  2CJK A;  4UF4 A;  1OYE A;  1S12 A;  4L3K A;  2GJF A;  3TUI C;  1IBL F;  2MMY A;  3HUL A;  1EET A;  2ZBI A;  3M6U A;  1RKJ A;  1VQO S;  4MH8 A;  3KOA A;  4R8U B;  3CMA S;  4DR3 F;  1LLZ A;  2K1R B;  3QID A;  2FJB B;  3MPD A;  1WF1 A;  3BJY A;  1Y5L B;  1TEL A;  3KLH A;  3GIK A;  4PCQ A;  2KJW A;  1HNW F;  5C25 A;  1QCX A;  2BA9 A;  3DDK A;  3DGP A;  2VG5 B;  3IR5 B;  1X0P A;  4DSJ A;  5DLG A;  2XY6 A;  3AA9 A;  4OX9 F;  2EXU A;  3CC7 S;  1IJE B;  1RT3 A;  2AYB A;  4I67 A;  1O8E A;  1S6Q B;  3V6H A;  2GMJ A;  4WE1 B;  1JLF B;  3WZ0 A;  1CBK A;  2EI5 A;  4OZ3 A;  5J1N A;  3M9O B;  2O17 A;  3MM8 B;  3BS9 A;  3VZH A;  2RS2 A;  1Q95 G;  3MR6 A;  4KPC A;  2I1R A;  1AUD A;  2BX6 A;  1TKT B;  3RBX A;  2A2C A;  3KLG A;  3VAK A;  2F9J A;  2R2T A;  2HBR B;  3UI3 A;  4URS A;  4IH5 A;  4LR9 A;  3BGR B;  4OLO A;  4DBQ A;  4UOH A;  4NEY A;  1KVJ A;  2V2Q A;  1HIY A;  5KFU A;  2ACM A;  1F3V A;  2WOM B;  4Y2M A;  2DNG A;  5KFF A;  1X9M A;  4Q2L A;  1XNQ J;  3J7A N;  4A8F A;  3HVT B;  8RUC A;  5F9N A;  1KKH A;  4OLP A;  2FQQ B;  4WBF A;  2UUW A;  2J8S A;  4IRD A;  3TVZ A;  3CDE A;  4PUO B;  1RTI A;  5HRO A;  1YJR A;  3CIZ A;  2VON A;  5IT0 A;  1S9G A;  4NA1 A;  2LVW A;  3QT5 A;  4MXN A;  4OYX A;  4PYD A;  2H54 B;  3Q8R B;  3MM8 A;  3CT9 A;  2UVU A;  4ZIV A;  3N4W A;  5LMU J;  3RAX A;  2ZHB A;  5DS7 A;  2GC8 A;  1UWB B;  2NLW A;  3F44 A;  3MPU B;  3IWL A;  1V9O A;  3M6X A;  2HNZ B;  3CE8 A;  1JLC B;  2YNG A;  4MKB A;  1YRT A;  3TAR A;  1SVD A;  1JJ2 R;  4YME A;  2PD1 A;  2HS3 A;  4JI6 F;  2YX7 A;  3B82 A;  5KG5 A;  4QWB A;  1WTF A;  5ITH A;  4NRU A;  2J0X A;  1RXO B;  1T3N A;  2R3V A;  4FN5 A;  3IAM 9;  2I5J B;  1LEO A;  1RLD A;  2P6S A;  1ZM4 A;  2QA4 S;  1X7V A;  2OPQ A;  5HL7 Q;  3K5M A;  2IJN A;  2BE2 A;  3NWR A;  2Y3Y A;  3MEG B;  2DKO B;  3IM9 A;  1F9E B;  1VQY A;  1O8I A;  5C2G A;  2W7Z A;  4RR5 A;  2F5G A;  1PC5 A;  4MIB A;  3HFV A;  4X66 F;  3OXF A;  3T5J A;  2HVH A;  3DRP B;  2M8D B;  1JLC A;  5B0B A;  4NLS A;  2RUG A;  1B99 A;  1D09 B;  1T95 A;  2O0V A;  2RNE A;  1N34 J;  2VDH A;  4P75 A;  3PNI A;  2UP1 A;  1RT4 A;  4DV5 J;  5KFV A;  5IT9 Y;  2UXC J;  5HMZ A;  1BQM A;  3CJK A;  3JSM A;  1V6H A;  4AXJ A;  2YH0 A;  3C46 A;  1S5Z A;  1I6J A;  2DXF A;  3GPA A;  2R7V A;  2KFZ A;  5AE3 A;  2V63 A;  1FX4 A;  2UVE A;  4Z03 A;  2DB1 A;  4ECS A;  4DV0 F;  3OR2 A;  2MZS A;  5E3R A;  2VBM A;  2RE1 A;  3H5S A;  1XMQ F;  1U1L A;  4N76 A;  2L08 A;  5D8H B;  2GX8 A;  4WF9 Q;  1CPZ A;  2DHS A;  3OLB A;  2RKI A;  4QYR A;  5A0Y A;  2H51 B;  4KV8 A;  2QV6 A;  3PIO Q;  1SIZ A;  3D7S B;  3IRW P;  3HK2 A;  2IJF A;  1UVJ A;  3TYT A;  2ILY A;  5C1C A;  2YVS A;  4DN0 A;  3D1O A;  2AP6 A;  3NXZ A;  3NAH A;  1NU4 A;  5LMN F;  4F4K A;  2AX1 A;  1OQ6 A;  4RBU A;  2Z57 B;  2KG1 A;  3LP0 B;  4EEY A;  5DNS A;  4O3S A;  4JI1 J;  2CPJ A;  2BUN A;  1CVJ A;  2A1B A;  4GKJ F;  1ZA2 B;  2XHW A;  5GAG U;  4ZVE A;  2CQD A;  4J7C A;  5DG9 A;  4NLP A;  5L9X A;  1U0H B;  3PYF A;  4NLV A;  1MN7 A;  4JOU A;  2K7K A;  2KXF A;  2YQ0 A;  2OIH A;  4TU8 A;  1H7W A;  4G1I A;  5KOW A;  4X62 F;  4OJ1 A;  3IFE A;  2JEF A;  2QC3 A;  1EP4 B;  3EXC X;  4DQP A;  5JVG Q;  1UZD A;  5E3C A;  3ITH B;  3OSN A;  3NNA A;  4K2J A;  4IG3 A;  5F8J A;  1T03 B;  1HNV A;  2BAB A;  3N28 A;  4BBY A;  3OLA A;  1ZAX A;  2VL1 A;  2VQE F;  4F0M A;  1FFG B;  1RHU B;  2XLK A;  5E41 A;  3H90 A;  2HUR A;  1D9F A;  2DIV A;  2PI5 A;  4TU7 A;  3C6U B;  2DGU A;  4DCO B;  4K5R A;  3MCO A;  4QWE A;  3JAM U;  1JMT A;  4ZCK A;  5DG7 A;  4BDP A;  2CZV C;  2ASD A;  2HPU A;  4RW9 A;  5BYS A;  2FC8 A;  3M6V A;  1N0V C;  2LXF A;  1MRO B;  2F8H A;  1IVZ A;  1NO8 A;  3B8Y A;  2XGQ A;  3H5X A;  1G4C A;  3DU5 A;  4LBH A;  4LRC A;  4XPE A;  3VF0 B;  1IKX A;  4KHP J;  4ES2 A;  2DHG A;  1Y10 A;  1HNZ J;  4J9V A;  3UN5 A;  3IBF B;  3TZX A;  2V9K A;  1C2P A;  3VZI A;  4XPC A;  1KLM A;  3UCZ P;  3UO0 A;  2V34 A;  1VC5 A;  4YY3 J;  2Z4P A;  1YSJ A;  4R0J A;  3WDO A;  4OHX A;  2UUC F;  2F40 A;  2YKM B;  4URR A;  2NXU A;  1UFW A;  3RJM B;  4UTG A;  1G6B A;  3VMW A;  3EVO A;  4KY3 A;  4TY8 A;  1VQ4 S;  2YNI A;  4D3H A;  2FJW A;  2EK1 A;  4FBU A;  4DG1 A;  3R1H A;  3C6U A;  1ZTT A;  5C24 B;  2DHX A;  1KFD A;  1WC4 A;  5LXY A;  4FP9 A;  5JUM A;  1XJW B;  1VR6 A;  4RKU C;  5L1K A;  2X6X A;  3B4N A;  4DQI A;  3P5B P;  5H1S V;  2Y1I A;  1U1K A;  1RI7 A;  2L9N A;  1HD0 A;  3EGN A;  5IWA J;  4OFZ A;  3VQS A;  1E6V B;  4O4G A;  4LF6 J;  4B9T A;  2FGC A;  4OJP A;  4LF1 A;  3J81 Y;  2DGW A;  1Y11 A;  2CDR B;  4NCA A;  3I9V 9;  4F25 A;  3NOG A;  4QCL A;  1RA6 A;  1VQP S;  1OFL A;  1OOC A;  4U8Y A;  4I84 A;  4AD6 A;  3BSO A;  4QWC A;  2JFD A;  3MR3 A;  4LF7 J;  2L9D A;  2C3Y A;  5I3U B;  4M94 A;  2H1Y A;  2XMJ A;  4U7C A;  3J7Z T;  3GV5 B;  5D0R A;  3GFZ A;  3P4G A;  3ILI A;  2JDJ A;  4ECV A;  1UVL A;  5IZH A;  4FKX A;  3GG0 A;  1UVM A;  2XYG B;  5JLV C;  1GQE A;  1RWR A;  4YFO A;  2HGM A;  2DIS A;  5GME A;  1SQG A;  4FPI A;  1R89 A;  2D1C A;  2OGU A;  2B4U A;  4N41 A;  1EZZ B;  1XNQ F;  3BPS P;  3UCG A;  2NCK L;  1RTD B;  1Y0H A;  2PSZ A;  2D3O R;  1M1G A;  4WKR A;  5I3U A;  4V19 X;  3CCM S;  3D1Q A;  1RB0 A;  4UZC A;  4F3M A;  1S9E B;  5DDP C;  1TK5 A;  3M8Q A;  5CZX A;  3MD3 A;  4FS1 A;  1REV B;  1DTQ A;  2DR8 A;  2A10 A;  5LMU F;  1TP7 A;  3UN3 A;  5DDR C;  3MMC B;  2V0N A;  3OHB A;  2P9E A;  2QRR A;  2V4R A;  2NTB A;  2V8G A;  1FDB A;  4NCG B;  4W8R A;  1KS2 A;  2EFO A;  4F36 A;  4ZMM A;  1YJ9 S;  2H4Y B;  4WU2 A;  3TAM B;  4UUW A;  1PXZ A;  3G96 A;  1JJH A;  3D6M B;  4LSN A;  1VIX A;  2FVS A;  2QX3 A;  2C2O B;  5CAA A;  1H7X A;  4P2S A;  3JQJ A;  4PXC A;  2CAD A;  3JTP A;  4NLG A;  1S9E A;  3RIQ A;  4ECZ A;  1Q16 B;  4DLG A;  2E5G A;  4ITS A;  1RE1 B;  1VGY A;  5H9E K;  1WHY A;  1WDT A;  2D9P A;  4LF5 J;  3SY2 A;  3PFO A;  3DLG B;  5J1E B;  4PXB A;  2B51 A;  3R6L B;  2XQC A;  4OV6 A;  3D0I E;  1RU4 A;  4J9N A;  4JI8 J;  2VJJ A;  2LQ8 A;  4QR1 A;  3MCN A;  4I2Q A;  2XCA A;  1FJC A;  3TAN A;  1N34 F;  4RLE A;  2EFV A;  4K4V A;  1MLA A;  4BLG A;  4U4B A;  3EUN A;  1LWE A;  3CUL A;  8AT1 B;  4DV5 F;  1IKW B;  4USI A;  2UXC F;  3TJA A;  3PX4 A;  4DZD A;  2R8G A;  1X9W A;  2YTC A;  1C1C A;  4NYP A;  4PWU A;  5A8K B;  5FLX Y;  3KFW X;  4F04 B;  5D78 A;  1UZH A;  3AD8 C;  1YJU A;  3C8Y A;  1AT1 B;  1U1O A;  2D3U A;  1N5Y B;  4DF4 A;  2XTW A;  1UFK A;  4CLT A;  1ZYQ A;  2DNL A;  4IFY A;  1VJQ A;  2LQJ A;  3B4M A;  3DLG A;  1TK8 A;  5C7P A;  3US5 A;  5D4N A;  2FPH X;  1VLY A;  2Y8Y A;  1R3N A;  1S6P A;  2VFN A;  4UQT A;  5LSO A;  3KJF B;  4F3O A;  4Y2K A;  3N6L A;  2EFN A;  2D9O A;  3DN9 A;  3ZZY A;  3M2U A;  4N47 A;  1NUE A;  4HHU A;  2QL5 B;  3ZNU A;  1IKW A;  2IOU G;  1G2E A;  1LW2 A;  1TV6 A;  3DRR A;  2VFM A;  5C2C A;  2J6U A;  3H0P A;  2QYG A;  4DPX A;  4Y3C A;  5M2P A;  2GZO A;  4JI1 F;  3Q22 A;  2PMW A;  3M8Z A;  6FD1 A;  3O5T B;  1IQZ A;  2JWN A;  5A2Q Y;  1RTJ B;  4AQY J;  1RT1 A;  2W2N P;  5KFQ A;  1QVF R;  3SDE A;  3FEX B;  2LU2 A;  1QSS A;  4M5J A;  4PG4 A;  3UR0 A;  2QMX A;  4DXL A;  2QYU A;  1RT5 A;  3I0R B;  1FHT A;  4FF4 A;  3DLK A;  2ZKU A;  2V4J B;  2DCU B;  4LFC J;  2EWE A;  3LGN A;  4JI5 J;  1UJ5 A;  2AF6 A;  2MHN A;  3T9N A;  3HM9 A;  3BGO P;  3CGI A;  3BR9 A;  3BPD A;  3SCL E;  1T9Y A;  5GAD I;  3BR8 A;  1YVF A;  4O44 B;  2DNH A;  4JV0 A;  1PIE A;  4GC7 A;  4WP8 A;  1WTB A;  3MR5 A;  2V68 A;  1R8B A;  5SUH A;  4ZVU B;  2AJ0 A;  3IM8 A;  4QIE A;  2CQB A;  3FZ2 A;  1N36 J;  2ROG A;  1IBK J;  1OWX A;  3VAG A;  3PAC A;  4QIF A;  1S7I A;  3THP A;  5JJB A;  2WRM A;  3MMA A;  2BAN A;  4CTA B;  2AGO A;  4XOP A;  1OPI A;  2UU9 J;  5K5M A;  1RHQ B;  1U47 A;  4ZP6 A;  2FB0 A;  1WNE A;  2QXZ A;  2BKO A;  4F4W A;  2DGX A;  4KHP F;  4K4S A;  1B4S A;  4YY3 F;  5CD4 A;  3UDE A;  4J9P A;  1N5V A;  4USK A;  1HNX F;  4RW7 B;  4NLT A;  1Q4R A;  4LMZ A;  6FDR A;  2WW8 A;  1NKE A;  2HRT A;  2PFD A;  2OPR B;  2YQ3 A;  2DJW A;  4YDT A;  1URR A;  4F0H A;  2BJ7 A;  2M0G B;  1Y9O A;  2EFQ A;  4WK3 A;  2ABY A;  2BMB A;  1SI9 A;  1OIA A;  1TTH B;  2CPX A;  1RYS A;  3R7B B;  2OH2 A;  4ZLP A;  4C8L A;  5AT1 B;  4M5D B;  2ALZ A;  1KN6 A;  5IWA F;  1L3U A;  4NA3 A;  4OJ6 A;  3AQP A;  3MCS A;  4UZB A;  2E9T A;  1U2F A;  4HVZ A;  2AZ3 A;  4LF6 F;  4M63 A;  3Q8S B;  4USW A;  4TY9 A;  1XTZ A;  2CXE A;  4RUB A;  1NK5 A;  2ROP A;  4ED2 A;  4KB7 A;  1Y00 A;  3Q2S C;  2INU A;  3T19 A;  1VQ6 S;  2VBZ A;  5GMK a;  2FZG B;  2B9W A;  4P73 A;  2FJA B;  1NSK L;  2KHC A;  3IG1 B;  1PLU A;  3J80 Y;  4RW7 A;  2P2C B;  1TKX A;  4LF7 F;  2YKN B;  2XHC A;  4C8M A;  4EZ6 A;  4UUX A;  2OAU A;  2C2M B;  3FFI B;  1YHQ S;  1NHU A;  3OSP A;  3V5R A;  1URN A;  2GIQ A;  2HND A;  3MEC A;  4Q8F A;  3LMW A;  3TJ9 A;  2J8I A;  3S1T A;  1HQU A;  3IBC B;  4DS4 A;  2HG4 A;  4WZM A;  4F4Z A;  3CJR A;  2GVD A;  3QZ7 A;  4I2P B;  3M8W A;  4R0E A;  4L73 A;  3W8G A;  3BSC A;  4CYU B;  5T14 A;  2KH9 A;  2Z30 B;  5HAO A;  3CDU A;  5H9F J;  1KD1 T;  1RGV A;  1TQL A;  2HHT A;  4K4U A;  4LF4 J;  2UUB J;  1SBR A;  4ZVH A;  4DV6 J;  2FVC A;  4BC9 A;  2O04 A;  4DN9 A;  1T9V A;  3MED A;  4ZS6 A;  1TUG B;  3VQT A;  3FMB A;  3FFI A;  3OUY A;  4YOE A;  4NZ7 A;  1GTE A;  1O8D A;  2W2O P;  3UDV A;  2FHO B;  5HMX A;  1FNO A;  1FKP B;  1X5T A;  1IDJ A;  4ERD A;  4KPY A;  2WSE C;  3D6F B;  1PJ7 A;  8ATC B;  3TZZ A;  2YWH A;  5KG6 A;  2OEK A;  5L1J A;  2AX0 A;  2R9L A;  3K2Y A;  4CYU A;  4LIW A;  3J81 j;  1KR4 A;  5T41 A;  4Y2I A;  3MHY A;  4JV5 J;  1NHK L;  4X2B A;  1MU2 B;  3K89 A;  2EK6 A;  1CUL B; 
#chains in the Genus database with same CATH homology
 3NGR A;  2VFP A;  3SYJ A;  1K4Z A;  1BHN A;  1F3F A;  1MN9 A;  1NDK A;  2VU5 A;  1WXR A;  2VFN A;  3EJM A;  3B54 A;  1DAB A;  2BM7 A;  3FKB A;  1TYU A;  3Q89 A;  5CAB A;  1BE4 A;  1NPK A;  1NSQ A;  2BM5 A;  4S0M A;  1HF2 A;  4HR2 A;  4ENO A;  1TSP A;  3FCV A;  1NUE A;  5BXI A;  4OJ6 A;  1ZS6 A;  3EVM A;  3PJ9 A;  5JMC B;  2AZ3 A;  2DY9 A;  3EE3 A;  3N6Z A;  3SZE A;  4OJO A;  3ENA A;  4V02 C;  3PRV A;  1S59 A;  4KPC A;  3R9L A;  3ZTS A;  4EK2 A;  2ZUA A;  2IOU G;  2DXE A;  1TYX A;  2HVD A;  1CLW A;  3NGU A;  2DXD A;  1MN7 A;  2DYA A;  4OM9 A;  3FC9 A;  3Q8Y A;  2BX6 A;  1TYV A;  3ZTQ A;  1KDN A;  2VFM A;  1WKL A;  4C6A A;  4DZ6 A;  1K8F A;  2B8Q A;  4OJ5 A;  1EHW A;  3EMT A;  1WKJ A;  3NGS A;  1S5Z A;  3ELH A;  3AK5 A;  2YUH A;  3BH7 B;  1U8W A;  1TYW A;  2DXF A;  3GPA A;  1BUX A;  2BM6 A;  1LWX A;  1NSK L;  4DI6 A;  2F3L A;  2CWK A;  1UCN A;  3Q83 A;  3Q8U A;  3BBC A;  4DUT A;  2BM4 A;  3P4G A;  1F6T A;  4UOH A;  2AZ1 A;  3TH0 A;  3Q8V A;  1JXV A;  3EVO A;  3FBB A;  1WKK A;  1W7W A;  1NDP A;  1LEO A;  1QRB A;  1HIY A;  1XIQ A;  3Q86 A;  3B6B A;  4F36 A;  1NDL A;  3VGU A;  1HLW A;  1HHQ A;  3BBB A;  4FKX A;  4KH3 A;  1NCL A;  1NSP A;  4JRA C;  3MPD A;  3WX8 A;  2G0Y A;  1K44 A;  3DKD A;  4OPW A;  1QA3 A;  5IOL A;  1QA1 A;  1B4S A;  3PET A;  1NDC A;  3EIC A;  1QQ1 A;  5JLV C;  2XC1 A;  3NGT A;  4W98 A;  4WBF A;  3ZTP A;  4O0N A;  2B8P A;  3JX8 A;  4AND A;  4F4A A;  1PKU A;  3ETM A;  3VVU A;  3JS9 A;  4OJL A;  2B0R A;  3H09 A;  2VFQ A;  3VGT A;  3ZTO A;  2HUR A;  1KQ5 A;  3LJY A;  1NLK L;  3G2X A;  4ANE A;  3VGS A;  4FKY A;  2W7Z A;  4ANC A;  3ZTR A;  1QRC A;  4UOG A;  3LYC A;  5CAA A;  2HVE A;  1VYA A;  4CP5 A;  2BEF A;  3VGV A;  3EVW A;  3FCW A;  4UOF A;  2J8I A;  1QA2 A;  1PAE X;  3BH6 B;  3EM1 A;  3ML3 A;  3L7U A;  2VFO A;  1S57 A;  4OJP A;  3FBC A;  3VVT A;  3BBF A;  2V5I A;  1NHK L;  3FBE A;  3FBF A;  5C7P A;  3GP9 A;  3RIQ A;  1B99 A;  1XQI A;  1NB2 A;  2NCK L;  3DDI A;  3N90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...