2BX6A

Crystal structure of the human retinitis pigmentosa protein 2 (rp2)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
311
Chain Sequence
KVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVLNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XRP2 PROTEIN
publication title Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transduction protein
total genus 103
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bx6A01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2bx6A02
4HR2A 3BBBA 3MPDA 2B8QA 1K8FA 1S57A 1S59A 3B54A 3EVWA 1W7WA 3BH7B 1XIQA 3ZTPA 2VU5A 1UCNA 1HF2A 1B99A 3EVOA 2B0RA 3EMTA 3FBEA 1KQ5A 2B8PA 3GPAA 3B6BA 3FCWA 3ZTOA 1BE4A 3EM1A 3R9LA 3FC9A 3NGTA 4WBFA 2BX6A 3BBCA 3FBBA 4UOHA 4DZ6A 4UOGA 4FKYA 4F4AA 3VVUA 1NCLA 2HVDA 1NSKL 3DDIA 3ZTSA 3NGSA 5BXIA 3ETMA 2DXFA 1NDKA 1WKLA 5IOLA 3ZTRA 2NCKL 3GP9A 2HVEA 3Q8YA 1WKKA 4UOFA 2AZ1A 3BBFA 1MN9A 3Q8VA 3ENAA 5CABA 1PKUA 3VGTA 1LEOA 3G2XA 3ZTQA 3PJ9A 3EVMA 4DUTA 1U8WA 2DYAA 4ANDA 2AZ3A 2DXDA 3PRVA 4EK2A 1WKJA 3VGUA 1NLKL 4ANCA 1BHNA 1KDNA 3FKBA 3BH6B 1S5ZA 4W98A 1LWXA 4ENOA 1F3FA 1NDLA 3VVTA 2HURA 1VYAA 3Q83A 1NSQA 1NB2A 2DY9A 1NPKA 1NDCA 1PAEX 1HLWA 3NGRA 4S0MA 3EICA 3Q86A 1NDPA 4V02C 2CWKA 3FBCA 4ANEA 3ELHA 1JXVA 1HHQA 2YUHA 4F36A 3Q8UA 4KPCA 1NUEA 3JS9A 3WX8A 3L7UA 3FCVA 1NSPA 3EE3A 3Q89A 4FKXA 3VGVA 4DI6A 1K4ZA 1B4SA 4CP5A 1HIYA 3NGUA 2ZUAA 1MN7A 1K44A 1EHWA 3EJMA 1ZS6A 2DXEA 5C7PA 3DKDA 2BEFA 4C6AA 4O0NA 1BUXA 3FBFA 1NHKL 1F6TA 3VGSA 1XQIA 5CAAA
chains in the Genus database with same CATH superfamily
5ETTA 4NASA 2C3YA 1LNQA 2JZ5A 3FJ2A 2NT6A 2AF6A 1W7WA 2B51A 1F5BA 3RB0A 2BYCA 3JAMY 3EZOA 3DCAA 2FC9A 4FN5A 3MECB 2A2DA 2R7QA 1S1UB 4EBEA 1UZHA 3VMWA 2DB1A 2KM8C 4N5SA 1FK9A 2Y9HA 3UWTA 4DV5F 4M5MA 1HWLA 3ETMA 2I5JB 1SH2A 3R2DJ 4DL0C 5C25A 3BO3A 1P9QC 4LT6A 4Q5VA 3CSKA 3HHLA 3U27A 4OPWA 3M32B 5KG3A 3NAIA 2W9CA 3G8TA 4S0MA 2JLGA 2WB4A 1ITPA 1H6KX 5LSLA 3ELHA 4C48A 1Y3JA 2V2QA 4AT1B 4WZQA 3NY0A 2HVZA 2R7RA 1G3OA 2ATLA 1QE1A 4CDIA 3PCOB 4YZAA 1C4CA 2BEFA 3WIVA 2C28A 5CXTA 2E7WA 1EETA 3TEGA 1SC3B 5F9NA 2MKIA 2JJ4D 5T41A 5L39A 3W60A 2JX2A 3JYTB 3AK5A 2J0SD 4Y28C 1DFDA 1RAHB 3IR5B 2W7AA 4V19X 4NLVA 4X2BA 1KOOA 3UVJB 2LDIA 1N52B 2D3UA 2WONA 2VG6A 3V6KA 3LW5C 3CDWA 3MMAB 4NK6A 5F8JA 3CIZA 2I9SA 1OFDA 1KVIA 4DSEA 1RTIB 5AMVA 1XTZA 3PO5A 1SC1B 1REGX 2XY7A 2J5AA 3NBPB 2KH9A 5L46A 3R5CA 3SQOP 5IS2A 1VQNS 5LJ5Y 3WX8A 3EE3A 1RCOB 1IQZA 1NM2A 4P6QA 5EX0A 2KTQA 4K4TA 2ASJA 1NK6A 2XO6A 2L48A 2ZH7A 1BLUA 1JB0C 1O5JA 2INUA 4LFBJ 2A1BA 4HR2A 2QN6B 1FJGF 4QBUA 1LQ9A 4DUYF 5L8RC 1UVJA 4LSNA 5K8MA 3K59A 1JIHA 1UP1A 3R7NB 1S0NA 3RU0A 4DDFA 5DDOC 2IDEA 2BM0A 1Y9OA 2J9DA 2FIUA 3PKMA 4WBFA 3UR3C 2QC3A 3OJUA 3KUGA 2D69A 4HACB 3MR5A 2BXJA 2R7UA 2HHTA 2BKNA 4DR3F 4WZMA 1PKUA 3ZZOA 3MMBB 3NOCA 3AOBA 1LWFA 2QG9B 3DHXA 4CT8A 2M4MA 3R5DA 4YZ0A 4O4GB 1TKZA 3GV5B 3S6EA 1YX2A 5A76A 4IRCA 2IA6A 1WDDA 5FIIA 4IDKB 3ZNJ1 2WB1D 1M5OC 1ZAXA 2W24A 3SXLA 2OPQB 1TUGB 2ZH6A 1QUPA 5ETVA 2IIHA 2KVQE 5DRKA 2KT2A 2CVEA 1WELA 4LSLB 1NK8A 2R3VA 2IRUA 4F3OA 4PEOA 1OQ3A 2E44A 3V4MA 3K0JA 2UU9F 5C24B 4OJ5A 5CZXA 2JVOA 2IVMA 4U6PA 1IUJA 1JLFA 5KFTA 4YZXA 2YY3A 3EDRB 3ENAA 4A8KA 1KQGB 3PFEA 5KFFA 1UVIA 2PO4A 1REVB 2VFQA 5LL6d 3LPYA 4FPIA 1OFMA 3T9ZA 1WG1A 1U4BA 2VG7B 2VHGA 3W9JA 1FRIA 1ZBTA 5H1SV 2CJBA 1RZMA 2G2ZA 3CJ5A 1Q5VA 1T05A 4DR7F 3BSOA 2INVA 3M8SA 4Z05A 3ZC4A 4OZNA 2DR5A 5CCLA 3RAQA 3NNCA 1M5PC 2CJKA 1IKVA 3UN5A 1BHEA 3DI6A 4A47A 1L3SA 2DGTA 4WP3A 3NKYA 4DLEA 2ZH4A 1G1XA 1UFWA 2IAJB 3M2VB 3A8EA 2MHEA 1BUXA 4FVMA 5D78A 3QWUA 3KMSA 2VC0A 3W5YA 3PJWA 3W2WB 5HROB 3K57A 1ELOA 2FDNA 3RRHA 2VODA 3N0VA 2AGOA 1B0VA 3CPWR 3FQKA 2IMWP 2A18A 2J0XA 1NHCA 1CULB 1PLUA 1K47A 2BJ1A 1DTTB 2CRLA 3TUIC 3OXLA 2GGPB 2AJ0A 2MEWA 4MK7A 4ALZA 1BWEA 4J5OA 1BQNB 4ZJLA 1UAWA 1F5AA 1HHSA 1U1LA 4DR5F 5HO4A 3NB2A 4X4OA 3DLKA 4DG1B 4RNNA 1IBMJ 5B0EA 3M05A 2YKAA 4OJLA 4I2PB 3T6JA 1K9MT 3Q83A 1QAYA 1X4FA 1B0TA 2X3HA 3FDSA 1S99A 1X4AA 4KBIA 2DNYA 5ETMA 3CIMA 3NLCA 3GWCA 3SFUA 4CO0A 4X4RA 4LMZA 1N5VA 3SSSA 2Z57B 3NGUA 2NUHA 8RUCA 1QY7A 3CD5A 2BZ2A 2GO9A 3UDLA 4UUWA 4U8YA 5K5MA 4OL8A 3AA9A 2Y1IA 1RISA 3KLGA 2E5LJ 2LQBA 2QLWA 3HKWA 4C8YA 2JLEA 2V5IA 2KKHA 2DGXA 2KO1A 5DO2A 3MTKA 1WEZA 3GPAA 4PYAA 4C8OA 2QMXA 3CE8A 4G1PA 1Q7YT 1WG5A 1CJVB 3V6JA 2E9RX 3NGSA 2P9CA 1T9VA 5K8OA 1RT2A 2BE2B 4FDFA 5GMEA 1H3DA 3PNIA 4J9OA 5CYMA 1HG8A 1M1GA 2J0WA 4KH0B 1BMQB 2DITA 3GTYX 3K5PA 5KAKA 5G0RB 2GJIA 4MR0A 1KQFB 1Y5NB 2EK1A 2V0NA 1RKIA 1T0TV 4C0OC 4MMOA 2WVEA 4E2FB 3HDSA 4FF1A 2XS7A 5T7LB 1QVFR 1IA5A 4CLZA 5K9FA 3Q89A 1HBMB 2XULA 2P8IA 1NXIA 1TKTA 2X1GA 1XMQF 4B9VA 4XKWA 3J7ZT 2D9PA 2O3DA 1RHRB 3CCTA 4DQSA 4IYQA 4ZCKA 3SQGB 1D8YA 4X4QA 1XQIA 3MAAB 1WORA 3BM7A 1Q82T 1HNZJ 3GIMA 1CJTB 3KNAA 2WHOA 2BJ8A 1WHXA 1JJHA 1S4EA 2H65B 2KFYA 1F2GA 4R0EA 3K17A 1GMWD 2IC3B 5HK4A 4OI2A 5E3QA 1CBKA 3BR8A 4DX5A 3K58A 2RDJA 3QSYB 1RT6B 3OT9A 2DD8S 2B6AA 4OHVA 2RQMA 2DYAA 3BKUA 2PYHA 2ZH2A 4DPYA 3BDEA 3W66A 3QIPA 3G86A 3IG1A 2UUWA 2KYXA 2HZAA 4J9VA 4YC5A 2QL5B 1DAXA 4KPYA 4QW9A 2XT2A 2NQPA 1N56A 3ITHA 3JQMA 5KFOA 2MY7A 1LXJA 1UL3A 4QR0A 3D1QA 3A8JA 4ED0A 3ENVA 1IBKJ 3VR1A 5IXUA 4TU7A 2AYEA 1UWBA 5L9XA 1U09A 2M2BA 4IR1A 4ED5A 5L9NA 3UNGC 4GKJJ 3ZSCA 4RW4A 4I84A 2CQHA 4DL6A 2I6WA 2X1FA 1TL3A 2J8IA 4OV6A 5F8HA 4DQIA 3DXBA 1H72C 2UUCF 1RU2A 3TUJC 4NA3A 4KGXB 2J6UA 3DU5A 1FFWB 4J90A 2HHXA 3T5LA 3IBCB 3PEJA 4OQJA 5AE1A 2VBWA 1O8DA 2BVZA 3CD6S 1SQGA 4OJ3A 1QM9A 3OV7A 3IRWP 2HFVA 4Y2KA 1FXRA 4AXIA 2G4BA 2IJRA 4OJGA 4L74A 4CLFA 2HEKA 1MU2A 3J81Y 2JWNA 1AZSA 3UDCA 5KFJA 3KLHB 1MROA 3I32A 3R6GB 4F2RA 2EFPA 1WWHA 1U0HB 1MNEA 5IWAF 4EYIB 3RRGA 2EWEA 4NLOA 4M94A 3SCJE 1TL5A 3HHKA 2QJ3A 1RK8A 4BWMA 3O5TB 4ZA1A 3I55S 2CJQA 4IO9Q 4LIWA 4Q43A 2CA9A 1TK5A 1NHKL 2YNHB 1O8HA 3BBBA 3M30B 1SUQB 4DOZA 3P4GA 5KG1A 2YKNB 5DM6Q 5KFZA 1RBOB 2XSJB 2UVFA 1U26A 2CPZA 2OP5A 4AUKA 4YUDA 2G9OA 1NRKA 5A6PA 1VRTA 2XI3A 4HDHA 1EP4B 3K89A 4WK3A 1KD1T 3PVXA 2RQCA 4NCAA 4QCLA 1Y5IB 3PW5A 4DPUA 2QLBB 4IO1A 3TAMB 1ZAVA 7FD1A 4F4KA 1X60A 1EAYC 3P3DA 2DXDA 4C2MA 3KJNB 2ZM6J 3C15B 2W2NP 3NG8A 1VGYA 3FFIB 1NDLA 1VISA 5I4MA 2IM0A 1VQ7S 1G4CA 2RHQB 4USKA 1GXLA 5I3PA 5JUMA 3C3LA 4LRDA 4TKTA 4DFPA 1UMJA 5KFEA 1X4DA 5SZTA 5C42B 2OELA 3VTIA 1HIYA 2QEXS 3LO3A 2BE9B 4M63A 4K2JA 1NH7A 2DCUB 2G2YA 3MM7B 4M5NA 4LR8A 2L9NA 2KU7A 3HT0A 2KXHA 2DGVA 1C0UB 3CNQP 1T9YA 1HBUB 3WBZA 1IDKA 1S9GB 1DARA 2ACMA 3ZXWA 3QO9B 4WKYA 1S1TA 3R5BA 1RT1A 1S12A 3OW2R 4X4PA 2IPOB 4RNOA 1TL7B 1HPZB 4OZ1A 1MMLA 3DDIA 3DLEA 2AJFE 4MKBA 2HHPA 4ICLA 4RNFA 2EBEA 3O3LA 4DPOA 3AAWB 3I6PA 5IQQA 3WIUA 1Q16B 2IM3A 1X9SA 4D3HA 4C11B 3QLHA 4I7FB 4NOHA 4C97A 1ULRA 3ISZA 2PIIA 4RW8A 1RABB 2UXCJ 1FESA 2FQQB 3SBMA 3JQJA 3ISNC 3QRRA 2ILZA 4RWWA 1C1BA 2ZJRQ 4ES1A 2JEIA 4G3IA 1VK3A 3EYZA 3V81B 3NS6A 2VASA 1FDBA 3R5GA 1BN8A 3GIJA 3OTBA 4PWUA 4JI4J 3HX9A 2W7OA 1RWPB 3OBIA 3I5CA 1NBEB 1RAFB 1DHMA 1QJHA 4WU2A 3B4DA 4LRFA 3SDEB 1LW2A 1C1CA 2PGCA 2FHOB 2DRDA 4ED4A 1S76D 4FYVB 3D6MB 2GHPA 1MN9A 1SKRA 1YVFA 2DR9A 2Y8YA 3W3SA 1RGVA 4EFAC 3M2RA 5F3ZA 4XR6A 1CZFA 4KH1B 1DTQB 1U6BA 4BDPA 3VSTA 2MKHA 2HFNA 4A48A 3ML3A 2QYUA 1JLGA 1UW9A 5BYQA 2P2CB 3CCSS 2XWYA 3J7AN 3R8YA 1ZZNA 4OZ0A 4PUOA 3M8PA 3H2LA 3GE9A 1QAXA 2Z8QA 1PIEA 1XNRJ 1FXDA 3TJAA 3OL8A 2B43A 4RNMA 4DFKA 4YQWA 2CG8A 2JDJA 2V4JB 2V9WA 4OX9J 2CPYA 3CCJS 2XZTB 2J7KA 3GQCA 2UXBJ 3RJMB 3POTB 1R8PA 1CJKB 4O3SA 1HF2A 2DNGA 4ZDNA 3VAGA 2MZ1A 4CO5A 3SV4A 2H1YA 2JSXA 4ZMMA 2VFUA 2WVCA 4OJ6A 3IO1A 3FBBA 2J8AA 3P6YC 3TJ8A 2E66A 4F4AA 1M5SA 2WTFA 1VRUA 3KG4A 1U45A 4F3MA 1O8IA 3CCMS 2HVEA 3GIRA 1CC7A 5A0YB 2HQ3A 2MYFA 2W9AA 2OH2A 1SJ1A 1YRXA 4X65J 4ZCIA 1VBLA 4U4BA 3JTOA 4LQ9A 1OQ6A 2GNKA 3OFGA 1T03A 1H73A 4P74A 4Q0BA 3F41A 3J7Z5 3CD0A 3S8SA 3KLEB 3CJQA 4O4RA 2G0CA 5L1JA 5EWEA 4FBTA 2BJ3A 1HA1A 2QA4G 2MQ8A 2X7IA 4WTOB 3EUNA 3P45B 4ZOSA 4USVA 1X8DA 2EKNA 3QZ8A 3V4IA 3VZHA 1YI2S 5C1EA 4CI0B 5ETKA 4CQ1A 1F9HA 3HHLD 2X1BA 3DOKA 5AT1B 4QU7A 2XS5A 2XCAA 2BJ9A 5J2PB 1VQKS 3MAHA 4L75A 2R7VA 1Q86T 1RT5B 1R6VA 1WDTA 3H59A 1N5QA 3PZPA 1QSLA 3EM1A 3HVRA 3EQNA 2EK6A 1Z2ZA 3X3UA 3QAUA 2VB6A 2HBYB 1VLOA 2WVBA 3IGNA 1N36J 3IP0A 1V3ZA 2DGQA 3DFEA 1Y3KA 1FT8A 5DQGA 1UJ5A 2DR8A 3DOLA 2CPHA 3ILOA 1QRCA 3ILJA 2UUAF 3CCWA 2C3MA 2HAIA 1NEEA 5C1CA 4A8XA 1VBZA 2E9TA 2RU3A 2DO0A 1GXUA 1R7IA 1U7LA 3TARA 1FVSA 4GKKJ 3NWRA 4KJIA 1NKEA 4PRFA 4Q2MA 2RRAA 2JVRA 3QRQA 1KQKA 3MUTP 3PEHA 2ZUGA 3VF0B 4WFBQ 4OJHA 1TELA 3EPGA 2FHMA 3U1LA 5HBMA 2HHHJ 2K1RA 3DM2A 5EGYA 1NB7A 3D6TB 3AJDA 4URRA 4OHYA 3EZ5A 2DGSA 4F4YA 3H09A 2UZAA 4J91A 1RWXB 3TO8A 3D1HA 3IWNC 3PW0A 2L3MA 2ZKTA 4QIGA 4OMFG 1OS5A 1FA0A 2ZEJA 2QYGA 2D3OR 1U02A 4JV5F 1UEVA 2QY1A 1KR4A 3AJ2A 3HCXA 4U49A 1S72S 3W63A 3M9NB 3GQ7A 2AQ4A 4F02A 5SUHA 4DR4J 2V4QA 4F04B 3N5BA 4NLDA 1WI8A 1KDNA 3RGIA 2JEGA 4LQ3A 1TAQA 2RKIB 2ZBPA 3L7PA 3E3XA 4IG3B 3Q8UA 4TLQA 4CH1A 2YWEA 4LBIA 3HZGA 1SJRA 2FJEB 1X0FA 2XT4A 3IA0A 3OLAA 1KHVA 5CCMA 3PTWA 1TU0B 4XK8C 3GJQB 4ZJQA 2VFMA 1EX8A 4ILMA 1YDLA 1AFIA 1IR0A 3RIQA 1FK9B 4F67A 4ILLA 2C3PA 3J80Y 2R7SA 4XONA 2V2ZA 3QGHA 2HWTA 1TSPA 4MIAA 2LFVA 1O51A 5C25B 2ZFHA 5A8WA 3MAQA 2NXEA 3HPOA 3HT3A 1OFLA 1RU4A 4IQMA 3HHLB 1NCLA 5K20B 2NXJA 2L9DA 5KFBA 2VC1A 2W9CB 1HMVA 4ED2A 2RU9A 5M2UA 4OYXA 3H98A 1P1LA 1T02A 2VQFF 2HGLA 1HNWJ 4P71A 3AY0A 1TV6A 4TQRA 1QE1B 2HRUA 2HURA 4B17A 1VYAA 4Q8EA 2I8EA 1NPKA 2GO8A 5ETOA 5KFGA 4JRAC 2PA3A 1RWWB 1JXVA 2J9CA 1AT1B 3ZO7A 2DISA 3NCQA 5B0AA 2M5YA 2DXEA 3K7RA 4B3RF 1SL1A 3T3FA 3LUYA 4DR6F 1V5VA 3BO4A 1HR0F 2D41A 3NWGA 4HKQA 4OI4A 1HNIA 1AB8A 4JV1A 2GQCA 4J9LA 5KFWA 4LVOP 4DN9A 1RYSA 2VG6B 1PO6A 3M8YA 1LWEA 4DCOB 2J76E 4XOTA 3H5XA 1FRXA 5DZ7A 1VIOA 3NMRA 3MF5A 2U1AA 4QW8A 2J7UA 3MD1A 1TR0A 5LT5A 2AMCB 2BM4A 2BACA 1VR6A 4HHJA 1VC6A 1IKWA 3BSNA 2YWGA 4WXOA 1B7YB 1TL4A 3KUHA 2YNIB 1ZZFA 5F8IA 4B08A 2Q79A 4KHMA 4B9MA 4IG0A 1S97A 3Q8PB 2C2OB 1JLQA 4N47A 4RJVA 2FJXA 3B90A 5CZVA 3DRPA 2J7WA 1WC5A 4AVZA 2IBKA 4LSNB 5ADZA 3M6WA 1GMVA 2E5IA 2KL8A 4LREA 3CEDA 2EVZA 1VC0A 3NNAA 1QJVA 4FXVA 1T9TA 5JJBA 4B3TF 3H0PA 2P5VA 5IQ6A 2KYZA 3BZQA 2GVDA 1Q79A 3X1LB 1ZM3A 5D3GA 4ID8A 2F4FA 1KFDA 4J9PA 2GHWA 3FC9A 4C8MA 1HNVA 4F0MA 1SV5A 1LWFB 1JQGA 2ZE2A 3I9V9 4QYZJ 1NDKA 1UTAA 3A3NB 1X4BA 1S6QA 2F5GA 4EZ6A 2DRBA 5GAGI 1JJCB 1PBAA 3OVBA 5EWFA 2MGZA 1H98A 5DS7A 2L41A 2UU9J 2QSFA 1BD6A 5ETNA 1NSAA 4O23A 1N33J 1HLWA 1Y0HA 2ZD1A 4LF8F 1IDJA 3RBEA 1PG5B 5AXKA 2EFQA 2NZCA 5EDWA 4TQSA 4DCPB 4JI0F 2RH3A 3AQPA 3OR2A 3LH2S 4Q8FA 1OSCA 4XOPA 4RZRA 1GAOA 2ROPA 3HFZB 5C7PA 4A8YA 2VJVA 3IAM9 1EIYB 1VHFA 2Z30B 4RL1A 2WZ1A 3AD9C 1JLFB 2QIFA 3FBEA 2W1BA 1IWAA 4XDCA 4PZVA 1XMBA 4ES3A 4ZLPA 4NEZA 2QGFB 4LFCF 2K3KA 3SV3A 2DY1A 2DT9A 4NLXA 3CCLS 2YKMB 1QVGR 1CS4A 3GYXB 4PYDA 2H3EB 4Y00A 5CABA 2QMUB 2WSEC 1T05B 3CGIA 4IH6A 4P7VA 4XO0A 1QQ1A 1JX4A 1IKVB 3MUVP 2DNRA 3LP1A 3DI6B 2HHVA 2YNGA 4KYZA 2HNZA 4DWIA 3MOZA 5KT4A 2IA0A 3KOAA 1T3NA 4B3MF 5B0FA 5A2QU 2ILYA 2HW3A 2CJXB 1S77D 3M2UA 4X62J 4I64A 4I56A 4DI6A 1JKHB 2CDRB 3G8QA 2ZZMA 3QT6A 2WOMA 2GIRA 1TUWA 4F2SA 1LOUA 3MM5B 4HLBA 1GH8A 3O1LA 2FGCA 3G87A 2FZGB 2ADBA 4Q7AA 3B78A 1QSSA 4GO7X 1HI1A 5DG8A 4ZIWA 2CDQA 2LQJA 1S6UA 4H4OB 4K5SA 2QLJB 4FPRA 4LF5F 1GQ8A 2J6TA 3ZZZA 1PJ5A 4K4ZA 5KFYA 1DQ8A 1ZAWA 4NA1A 2LU2A 3BBCA 4DV2F 4DR1J 1ZM4A 4ZHRB 4UOCA 3DLKB 4DR2J 1ROFA 5M2PA 5C2CA 3QPIA 3WX4A 2M8DB 2WW8A 4ED8A 4DUTA 5HMWA 1OY9A 1F9FA 1KVKA 3EPIA 1WG4A 1HI8A 4GVLA 3HJVA 2OSQA 4USWA 2U2FA 1WC0A 2CUYA 2AD9A 1X4CA 4USTA 2AIRB 1TZ0A 3LWLA 4LRBA 3RW7A 3NAHA 4CIOA 1AIRA 2X1AA 3OSNA 3KLGB 2DH8A 2IRYA 3KG1A 3C8YA 2YQ3A 4QPTA 2CQ4A 2HQGA 4YCQA 3CO0P 1I1GA 1I3OB 5IC4B 2A2CA 5BYRA 1N8RT 2I1RA 1U6ZA 3PIPQ 2ALZA 3JSMA 2F40A 3OL6A 2ZOGA 4WPAA 2LXFA 1D1UA 3NS7B 1FWPA 5CYMB 5AXNA 2RIJA 2W2PP 2EI5A 5H9EJ 4V1Ak 2DNZA 3A13A 5HQMA 3GQAA 2ZH9A 4DV4J 1VBXA 4YB7A 3T5JA 1N5YA 4Y3CA 4LF7F 3E01A 5LXRA 3AA8A 3BEGB 3QRPA 3TAQA 1JLAB 2NTQA 4ERDA 2E9ZA 5KFKA 1OFEA 4LF4F 2HFSA 2J0QD 3KMQA 4WXWA 3W7BA 4LSZB 3DRRA 5M2RA 1EHWA 2EXUA 4CO2A 3F44A 1M1KT 4QWDA 2YXLA 1FDNA 1UVMA 4JBCA 4C3KA 2X3DA 2Z0GA 2OMOA 1RWNB 1NK5A 5KG4A 2HKEA 4YY3J 2O04A 2JOQA 3THVA 2M9KA 2B5JA 2EFOA 1GX5A 1UEUA 3IG1B 4RW6A 2BM1A 3Q8YA 2KXFA 2IFXA 4WFXA 1HL6A 4JI3F 4EW9A 2MLZA 2V50A 2Z2YB 5ETPA 3BDPA 4I2QA 3IMQJ 1S79A 4KHPF 3LGMA 4LF9F 3D3CJ 4CO3A 5E0OA 5HANA 3HO1A 2VFSA 1WF1A 4PQAA 1JLEA 4NI2B 4RW4B 3BSAA 1RT3B 3ICLA 4KHRA 4PG5A 3D67A 3BF4A 1YZ6A 4LRAA 2XC1A 1G6BA 2W7PA 1VC5A 3DDNA 5KOXA 1WC3A 1FRHA 4LFAJ 4U95A 4QZVB 1SVDA 3R6LB 1RA6A 4X64F 4OJPA 3DRSA 4DSIA 2VFVA 3EVOA 3E2EA 2XEXA 2N82B 1DJ0A 1V3RA 3MR2A 3WQPA 4MKAA 1VRQC 3W62A 2H9ZA 4LF2A 3GR0A 4ITSA 1YBTA 1MU2B 1AZSB 2VKRA 4QWCA 1YK9A 3IR6B 1RADB 1IKXA 5A8RB 3WHIA 3Q8SB 4ELVA 2HBZB 3E51A 2KFNA 3GJSB 3NEKA 2FVQA 1VQ6S 1MWQA 4DQRA 3VALA 2MSSA 3QIDA 3T1HF 1E6YB 3KLVA 3FMBA 4Z7YA 3DU1X 4DV1F 2XY6A 5HI7A 1IR2A 3TP2A 3SYZA 1U6FA 4X66F 1O8GA 4X4VA 4EBDA 2KJWA 2KXNB 3G71S 4KR0B 4OZJA 4B3SF 4CP5A 5I3QA 2CJYB 1EJ7L 4JB8B 2BMBA 5CYQA 2HGMA 2B8QA 3D6HB 1OWXA 3NMAA 2JC0A 1OO0B 2DNHA 2W7ZA 1Q0NA 4X84A 3CJKB 1ZOTA 2YQ1A 1NJXA 3LYCA 4AE5A 2R8JA 1N34J 2WBMA 3CDEA 1OMSA 1NSKL 4IRKA 2UUBJ 2YH0A 2F63A 2DK2A 2CWXA 2HLTA 2V8PA 4USHA 4Z37A 4TY8A 5ETRA 1LLWA 2CQ3A 3TX0A 4C98A 5LMNJ 1SKUB 1WOOA 1WTBA 4WYLA 1Q95G 2NYHA 5GADI 1KLMB 3ADAC 4GMKA 2PMHA 1FX4A 3D7SB 1NMEB 3JAMU 2Z56B 1RAGB 4JI1F 5KFHA 1R27B 3JS9A 4CLTA 4NXNF 2XG8A 4J9MA 2VD3A 4XN0A 1LW0A 1ZH5A 3ET6B 4N76A 5F0WA 1S1TB 1FRMA 1RT1B 2OFGX 3V2UC 4ZP7A 4C3LA 2XGQA 3FVYA 4DX6A 1LLZA 1DBGA 4XTTA 2AKWB 1HHTP 3SCKE 3D4JA 1CQNA 2V8GA 2WAQD 3HSGA 3IC1A 1YIJS 2IVYA 1KNZA 4C8NA 1RWOB 2SXLA 1TKDA 1ZTTA 2VG5A 2RB7A 5F8NA 2IVFB 4MT1A 4B9LA 1KCDA 3KWMA 2RUSA 4CM0A 3MM9A 4ZP9A 1NJWA 3QLHB 4Y2IA 4LJMA 2FLPA 3MEEA 3CULA 3W8GA 4FXWA 3PDNA 3TR5A 4KC5A 4O3OA 4ZIVA 2XCPA 1N32F 1C1BB 2E29A 3I82A 2UVUA 1P1TA 2YUHA 1S1UA 4ZVPB 1JLBA 4B3OA 3MMCB 3FRZA 3L7UA 1I5OB 2QZAA 3GFXA 3MGJA 2BKOA 3M1VB 4OYIA 2MQPA 3JURA 3R1HA 2ASDA 4XAKA 2F4VJ 2BJEA 2MDAA 4XKVA 2OGUA 2AEFA 3NL0A 1S59A 3AH6A 1VS3A 4LRCA 3CJSA 1C1CB 4DZDA 4KRWA 2BR0A 1H2VZ 3SI8A 1XR6A 4DV7J 1M90T 2LECA 1X4EA 3HHLC 1I94J 1RXOB 2NSBA 3M2RB 2W8LA 5E3RA 4LR7A 1WKLA 4KGKA 4PPZA 3BBFA 1JLGB 4YB1P 1TFWA 4DV0J 3GYGA 2GIFA 1YKWA 5GAGU 4C8LA 4ZKAA 4F4WA 2YKPA 3M8PB 1TUVA 2O17A 2R8HA 3FSIA 1RMGA 5DG7A 3GFHA 1OIAA 3R27A 2V63A 4ZPVR 2OPRA 4BHQA 3PIOQ 1Q7LB 3UR0A 3OJSA 2C2EA 3DYAB 4X4UA 4BC9A 2VQEF 1S9EA 3A8IA 2W2OP 4U67Q 2OI2A 2CNOB 2AHOB 2AV5A 2CFXA 4ED6A 2HYIB 2XB2D 3M9OB 1OOCA 1VRUB 4KO0B 4MIBA 1SC4B 1RTIA 2XYHB 1R0AA 4R5PA 3B6BA 2B4VA 2CQIA 5KG5A 4YR0A 3G96A 3OL9A 3N5FA 3AHPA 1YG0A 3CMES 5B0BA 1FCAA 3MPYA 4NXMJ 1UWAA 4UUXA 4OJ1A 3PYGA 3W2VA 2HS4A 1RU1A 3IBWA 5JVHQ 2W4DA 3FKBA 3CJ3A 5J1NA 3KLIB 3LGNA 2V6AA 3KHRA 2M70A 3H4BA 3V4IB 4F4XA 5ITHA 2HMIA 5GAEI 3FEYB 1GTHA 1KKHA 5GVQA 3QSIA 2LQ8A 4N7TA 4OX6A 4W4MA 3KJVA 3FCVA 3DOKB 2OEMA 3SSRA 1P8GA 2KG0A 2DR6A 4LFBF 3EJMA 1N0UA 4AL6A 1NKCA 1VBYA 3VAHA 2DGWA 2MZSA 3FBFA 3A3PB 3BB5A 3M8QA 3PRBA 1AW0A 2NTPA 1X5PA 3H2UB 4AQYJ 2V4RA 1YSJA 2G0YA 4UTGA 4KFBA 4NLQA 1SI9A 1J5EJ 3DOLB 4UY85 2KN4A 4J7CA 2DCLA 1VQ9S 1NNDA 4WK1A 5KFMA 4ZN1A 3M6UA 4ED7A 1C2PA 1OGOX 2EKYA 2YX4A 1ZETA 4FBUA 4YHHF 4IDKA 5HVFA 1FVQA 1WKKA 3CUNA 2UUTA 4JI5J 2HLUA 4KKOA 4NZ7A 1WJ9A 3N4WA 4RW9A 1X9MA 4PMHA 2G0JA 2UVWA 1XN9A 5D77A 2HBQB 1RACB 2LA6A 2QYCA 4JI6J 2K1RB 5LXYA 4ID5A 2M7SA 1VQ4S 4DPWA 1WOSA 4B9SA 5IT4A 4PG4A 4LF6J 3DM2B 4AXJA 4URGA 1IVZA 3HVAA 2GMJA 2QX0A 3W9IA 3UNYA 2LEPA 2QA1A 1T11A 1REVA 1YWXA 2KFZA 5CYJA 1RJJA 2VG7A 2ZNYA 2X6WA 1SH3A 3GLJA 4NWBA 3I56S 4JI8J 4DU7A 3G6XA 2D3O1 3TA1A 3RUBL 3CJRA 2R7XA 2BKPA 1TYVA 2BJ7A 1LM1A 4HH1A 3F56A 2BM5A 1UEKA 3H40A 2GC8A 2EFNA 5KG0A 3QT7A 1S1XB 3Q24A 1WXRA 4MK8A 1Q8LA 3S1TA 3VGTA 4K50A 3HULA 2KT3A 4Z2XA 2LMIA 5HROA 1Q81T 1QCXA 2XI2A 3VHQA 2JHEA 4WE1B 1FDAA 4G1QA 3N79A 1NZAA 4ELUA 1NDPA 2B7BB 2KRBA 2MKSA 4M95A 4NLWA 1A0OB 4USUA 4X4SA 2VQFJ 5B0CA 3DOMA 3C16A 1RLCL 3RBZA 2PFDA 4Y2MA 3QFWA 1O8KA 1ZYQA 5MAOA 2F8HA 1N4LA 5A8WB 5KT6A 2VOOA 2PFFB 3P96A 2GMHA 4CRJA 3ZZYA 3M4XA 1SCJB 1LFWA 4XQFA 3IFEA 3LAMA 4UQTA 1TKXB 4I2PA 2GAHC 1UJ6A 4HH0A 3D54A 4XLEA 1HMVB 1U1QA 9ATCB 4XLAA 2MJNA 2I0XA 2IOUG 2Q3PA 2PYGA 4Q44A 4F3QA 4NLSA 1HR0J 1T9UA 4WFNQ 1H2UX 1RB0A 2CQCA 4N41A 4FXDA 2WW4A 2DTJA 3CTRA 3ZZTA 5DG9A 2N7CA 3HHEA 2PECA 4DL7A 3FSXA 2GHVC 3RBDA 3CT9A 4K4VA 3AXKA 1IBMF 3QNWB 1MG7A 4B9TA 2UXDJ 1TP7A 3U02A 1TQLA 3FGVA 4IFVA 3I87A 4OHXA 4J9SA 3A12A 1RAOA 4KV8B 2BW7A 1LK5A 4NZ6A 4GC7A 2XZDB 3UCUP 1S6PA 2HNDA 5KT5A 2XWXA 4ELTA 1HNIB 5D4PA 3TNVA 1KTVA 4NCGB 5EUHA 2ODLA 2B0GA 1DQ9A 2OMLA 1K44A 2QMWA 3R2CJ 1QSYA 3MD3A 1LWEB 2V68A 4QWBA 3HHDA 2ZH1A 4WF9Q 2VUGA 3N6LA 4JI2J 1UCNA 5IC6B 1URNA 4QWAA 3JXOA 1SJ3P 1XERA 3LALA 1OY8A 2QA4S 2ZWOA 4DL5A 1IKWB 2O5DA 4NZ0A 2HVDA 5LOQA 5KOWA 1HBMA 3ZTSA 2EW9A 4OZ2A 4KAIA 1RBLA 5G4DA 2EPIA 1FFGB 3PW2A 2O1DA 5IV3A 5DDPC 4DCJB 1LKZA 3SQGA 3LANA 2GQQA 4RU2A 4CZCA 2QT7A 3MM6B 1UVLA 4QU6A 2HSEB 3JTPA 1O8JA 4ZVRB 3MPWA 3PHEA 2CPJA 2K2PA 2MLYA 2NPIA 4JOUA 3EQOA 3NP5A 4KH3A 2V8DA 1NJZA 1HW8A 1PYOB 4QIEA 2PN6A 4H4KC 4OLOA 2PT0A 3KLFA 1XMOF 1NPPA 3PFOA 1FHTA 5AXLA 2F8MA 3BO2A 3H20A 1RT6A 3CJ8A 2YX7A 3M8WA 1Q8KA 3EGVA 5D3GB 2B9YA 1TYWA 2KZMA 3DGPA 1HNVB 1HNZF 1JXLA 2R2UA 1SV5B 2ZE2B 3C14A 1SL2A 3OR1A 3TW0A 3MPUB 3MR3A 2V2KA 4RBTA 5FJ4A 1S6QB 2CADA 2N3OA 3GV7B 1HWJA 1NHVA 2HFZA 1BQMA 3PYFA 2MGZB 2HBRB 1WF2A 3OFFA 4XLCA 1S1VA 1ZPWX 2BM6A 2OEJA 1N88A 1GK8A 4DV3F 2KJVA 3G2XA 4I6YA 4RU9A 2ZD1B 4RBUA 4XPCA 4QR2A 4LBHA 1V6HA 2BV3A 3P5TL 3ZZPA 1FTRA 5BJRA 3OR2B 5IZHA 4MTPA 4RO0A 1FRKA 4HHHA 1IR1A 3QJJA 5KFVA 5GADU 4JV2A 1NK0A 5AE2A 5HQ8A 4QR1A 2A3JA 4XNFA 1AUSL 1NUEA 2HHUA 2YVSA 4OI6A 4W92B 2QL9B 2LEAA 1QUVA 4GRSA 2QLFB 4GKJF 5A8KB 3QGIA 3NAWA 2UV8G 1NK7A 2K06A 1RHMB 2YBVA 1R3NA 4RLEA 4B3MJ 2ZNZA 3BN7A 1RTDA 1BQXA 2XQCA 1CS4B 1UVNA 4QWEA 4OJOA 2R9LA 3MM8A 4O3PA 2YWFA 2J8KA 1F1BB 3KXDA 2NPFA 1N6QB 3DRXA 4FKYA 4CCHA 2RDIA 1WNEA 3LP1B 2X51A 2YNGB 4AYBD 3LGHA 3S7RA 3QGPA 1DLOB 1BXNA 2IBOA 4C8KA 2VF3A 2ZHBA 4ED3A 4TLRA 2KZZA 3CJ0A 1E6VA 2YKNA 4W90B 2V8HA 1NPRA 2FPHX 4X4NA 1S6OA 1RSCA 2WOMB 2XC9A 2MKCA 1VQYA 3LP0B 2VPWB 3J81j 4IOAQ 2YWHA 1AUDA 3HVWA 1EZZB 4L3NA 3AOCA 4YR3A 4YMEA 4ZN3A 1B0PA 4GC6A 4FYYB 3GONA 4IKAA 1O8FA 4CLSA 4OZ3A 2RQ4A 3I0RA 4R8UB 4XN3A 4O0NA 1BWVA 2WK4A 1PSDA 4WYWA 2GA7A 1VQSA 3P5BP 4EGLA 2F3JA 3FZBA 2QSWA 2BANA 3G9CA 4PXCA 3T6BA 2RILA 3DDKA 2AJ2A 1TVRB 3T5HA 3CXCR 4OYWA 2HZVA 3D66A 4P10A 2QE5A 4QYZK 1RKJA 4BS2A 1Y11A 4LF1A 2XMWA 5A2QY 3MM7A 2D3ZA 3SEOA 3SUCA 1RQ0A 2ZM6F 4EK2A 4YFUA 4JV0A 1C0UA 1HBUA 4CYUB 3CCZA 3QO9A 3JSBA 4DV6J 4L73A 3TJ9A 4V02C 2HRYA 2GAGC 1WTFA 3U1MA 4USIA 3DC2A 1TL7A 5K14A 2ZHAA 2DR7A 4BC7A 1HPZA 1KTWA 4H4KA 2NLWA 1CC8A 2GMLA 5F8MA 4QYRA 3M8ZA 4CTAB 3JSMB 1W2BR 4XPEA 3PR4A 1UPPA 2K8GA 5KT2A 5CAAA 1ZM2A 1F5CA 1YQHA 3OD2A 2HK2A 2F1FA 4K0KJ 2VJJA 2CQ1A 5DETA 4FZVA 3JX8A 4C11A 4AL7A 3CDUA 4I7FA 2XTJP 1MMNA 1F3VA 1FX2A 3T5KA 1WMRA 4NK8A 5ETSA 5IT9U 4FF4A 4C0BA 1UA0A 1QD1A 2XLJA 3TQEA 4ZPWR 3QZ7A 1N5YB 2H5IB 3OXFA 1FF2A 3E01B 4YP3A 1RCXB 5J1EA 1HQUA 4AD6A 2LP4A 4J9RA 1F3FA 1J2VA 3NNHA 1Y5LB 1QRBA 2DY9A 3FK4A 4M8LA 1IJFB 2Y1JA 1NDCA 4FYXB 4QPXA 2HWHA 4G1IA 3BQ2A 2UXCF 5GMDA 4FYDA 1R0CB 3OTOJ 2Z4PA 3N28A 3OLBA 5F9LA 4ZPTR 3I4HX 3ILLA 5DZ6A 2XYGB 5C2GA 2B5JB 3BH7B 2OHDA 2P9GA 4O3NA 1DTQA 2PEBA 4JI4F 1C0TA 4DQQA 1B64A 2GZOA 4IFYA 3WC2A 2CPFA 3PYEA 3VQSA 1WC1A 4H4MA 5AXMA 4YB5A 3ULHA 2HAFA 2JRSA 2A6OA 4I2QB 3NRBA 3I5BA 3EZUA 3V6DA 2QV6A 3Q2SC 4OYPA 1HNXF 2C2RA 2CZVC 3GMGA 2MLXA 1EQMA 1JLEB 2IRXA 5ETLA 5FDLB 3HVTA 5LMUJ 1LWCA 2DGUA 5HAOA 3A4TA 2BDPA 1CJKA 1SC6A 4HDGA 1R8AA 1R43A 2Y1LB 3IRXA 2ZITA 3BYPA 4ZVOB 3JQKA 5F3TA 3DHWC 3CCVS 4ANEA 4XDDA 4KT0C 4I6AA 4AL5A 1EKRA 1XNRF 4RNHA 2QZ8A 5KT3A 2UVVA 1SIZA 2HQDA 3F73A 1X0CA 2F3LA 2Y0BB 2UXBF 1F6TA 1PC5A 5CH7B 1L3VA 4ZLLA 1X5SA 1IKXB 1YITS 4B3SJ 1RAEB 4P2SA 4B9UA 4CLPA 1FRLA 1UETA 3KJQB 2B4PA 8ATCB 4B9NA 2GV1A 2BSPA 2V69A 2HHSA 1HYSA 2WSCC 5H9EK 4OX7A 1L3UA 4X65F 4DX8H 1DBDA 3QBCA 4LR9A 1CLWA 1J27A 3D0IE 3BGFA 3L7OA 4ER8A 5HLFA 2VPZB 3HK2A 5MLCV 3GFZA 2P6SA 4U9RA 1YHQS 2CXEA 4KPCA 2AT1B 3BYRA 2HK3A 3VGVA 1FEEA 5KFXA 2XSFA 5U47A 1RHQB 2VBEA 2A10A 2RF2B 1A9NB 1SQEA 4ZVGA 1K8FA 4ZK7M 4ETZA 3CD7A 2CPEA 2AU0A 4DF4A 5J2MB 5FLXU 2MSTA 2X6YA 5CD4H 1GXTA 4TY8B 3K8VA 3NGTA 2ZVIA 3WDOA 2AJQA 2MKKA 3VSUA 1N36F 5I42A 3UI3A 3SSQA 4DFJA 2RQKA 2NCKL 3DGVA 1M0SA 1HBOB 2FUG9 1IM6A 4QJVA 2JC1A 1DQAA 2VA3A 3UW0A 3KKFA 1ZA1B 1ZTWA 2ZOMA 4TXSA 1H80A 4I69A 2JNJA 3R5JB 4RW7A 4YDDB 2NUUG 1LW0B 1R8BA 3J80U 2YKQA 4GKKF 3I96A 3HLUA 1X9WA 2VJIA 1BGXT 4P2FA 4CLYA 1VQOS 2APOA 3KYLA 2MXYA 2OPSA 2XHWA 5A6WA 3L9ZA 1YRTA 5CQGA 5KFCA 2DBBA 3TZWA 5L1LA 2CNLB 1FEHA 4DUZF 2HFUA 2HWIA 2YX1A 4PXBA 3KK1A 2VBZA 2P6TA 3MEDB 4EMDA 4HTIA 3PG9A 2RKIA 2M8HA 3HHNB 5DLGA 3MM9B 4IOCQ 4PG6A 4IG3A 2N7YA 3MEEB 3R5AA 4USMA 1UPMB 3GSDA 5IOLA 3T1YJ 2F9JA 1FKPA 2BUNA 1FNXH 2YNFB 8AT1B 4KTQA 4DR4F 3GQ8A 1TL1A 2ZKUA 1JLBB 1U1MA 3PRVA 4B3OB 1S1WB 1NLKL 3DNCA 1FD2A 3G4SS 3V6HA 3QAEA 4DL4A 2HQCA 1IJEB 2LDYA 2P9EA 2OTJS 2V9KA 2M52A 3BJYA 1Z4UA 5KT7A 4MFBB 4F50A 1Y10A 1C4AA 2MQLA 1RDRA 1U1KA 2C22A 1TK8A 5E3AA 2B3TB 3VAMA 3TEHB 2IJNA 4DLGA 4EO8A 4WP8A 3DXSX 1V3SA 3ZZUA 1XC9A 3GR1A 4Y0FA 1FXLA 3EGNA 3GFYA 2EG1A 1H7XA 2WBRA 1Q78A 2B0RA 2FHJA 3KK3B 3PX6A 2BW2A 2FZKB 4RUHA 3QJLA 1Q8IA 3D3BJ 2VQEJ 4FVCA 3OUYA 4OHZA 5HVHA 5JVGQ 4JYAJ 3ENQA 1FKAF 3JSYA 3ZZRA 1IBLF 1NK9A 3VCDA 1RTJA 5JMNA 3TUZC 1HNWF 2OPRB 2AYGA 1SXLA 3BV8A 1Y4ZB 2C3UA 3VVTA 4ECUA 2ADCA 4NX9A 4U7CA 1H38A 1S9EB 3RRKA 1IKYA 3TH0A 3F0NA 3PW4A 3BGUA 2LXIA 4P2MA 2Z2LA 3M6XA 4HWVA 2R8KA 3GSIA 5J2NA 4FKXA 3UPFA 3H5YA 2OEKA 2C2DA 3HF5A 3QT5A 1ZS6A 1R0AB 4R5PB 5IM0B 5D4NA 5E3PA 4WIIA 5BR8J 5DGBA 4DL3A 1FI4A 1WF0A 3KHLA 2ALYB 2WRMA 2QFJA 1SL0A 2HPUA 5L1KA 2YNIA 2DRAA 2HVHA 2H4YB 1VQPS 1B99A 2VBKA 1FE0A 2ZVSA 3TZXA 3W64A 1XNQF 1SIWB 5KFQA 3K8WA 1NAQA 3Q23A 2N4CA 4FF3A 5E7OB 3W2VB 3VVUA 3TX8A 1KRPA 2Z2MA 5HQLA 1UA1A 5KFAA 1EQ0A 1R31A 2H48B 4HEA9 2HMIB 4NYOA 1SH0A 3JTNA 4PR6A 3AFGA 5AJ3J 3KJVB 1U1NA 1YTYA 2MQQA 1RTZA 3GG1A 2IYGA 2XGPA 5H9FJ 4YHHJ 1T94A 3QYYA 1N5SA 4A8FA 4O44A 1D9FA 2CQ2A 5C5JA 4I0WA 1H2TZ 1FNMA 3M8QB 2VICA 1OY6A 3FRYA 4YFOA 4OZYA 1SBRA 1B4SA 2VBYA 4H54A 3UQSA 2DNLA 4KFBB 2YWWA 3WWGA 3QT8A 2K3IA 4Q45A 2PI4A 2KHDA 4CNZA 1PJ7A 4AFFA 3MCMA 3HP6A 1QTNB 1K8AT 2VDIA 3TRGA 2ABYA 4M5HA 2NS1B 1AFJA 1K1QA 2OD6A 3AJ1A 4KKOB 4GVBA 2AYMA 5EX3A 4RW9B 2OSRA 4UOHA 4EU0A 2JLFA 3R3TA 1RT4B 1Y00A 2GX8A 2CYYA 4ZP8A 3GRHA 1XR5A 3C46A 2RHSB 4MH8A 2W25A 4DV5J 4HT5A 3UE2A 3C6TA 4ID5B 1TYXA 3R7BB 3PETA 3WC0A 2ROEA 2ZJPQ 1HQEA 1N33F 5BYSA 2EC2A 1QA3A 4PKDB 3IM9A 3BGRA 5DLFA 1QDUB 3BN4A 2ZOFA 4KB7A 2EEYA 4A8OA 2YKMA 2XBPA 2IHR1 1VIXA 4CNYA 3VAFA 2FLNA 1G2EA 3BKTA 4PCQA 1L3KA 3NOGA 1KONA 2OIHA 3D9BA 4U96A 3DMJA 1PBUA 4F26A 1MSWD 1T8EA 1HBNA 2B7CB 4MAKA 1FKOA 4F0HA 4TYAA 3TYTA 1HFEL 3NXZA 1JKHA 4CLLA 1QA2A 2RS8A 1OPIA 3MM5A 4G1QB 1U1RA 2B9WA 2ZH3A 3GU0A 3Q2TC 2AJ4A 1EETB 2HNYA 4OI0A 2FVCA 4W8RA 3SMZA 1KLNA 2HFOA 3DOMB 3C16B 4H4OA 4OZLA 3CF5Q 1RP5A 4YB6A 1CPZA 2DPJA 4FS1A 2DNMA 3Q86A 3OTCA 1O8BA 4NMLA 1TFYA 1U1PA 1L5UA 4K4WA 4ZS6A 3UFCX 1YBUA 5JXSA 3MFIA 3DLHA 4X62F 1QTMA 1Q1KA 2E5GA 4ZHRA 3IS9A 1VJQA 2RT3A 4XM3A 1S7HA 2R7WA 3VAJA 2OO4A 4ZCLA 4ZCMA 4XLFA 2WONB 3HSDA 1RWKB 3I5AA 1EA0A 3EGWB 3SIPB 5HL7Q 4HHUA 3H7HB 3W61A 3Q22A 2WVDA 1FJGJ 1GT8A 4DUYJ 2DEJA 5E3CA 2NSPA 4M5KA 4NRUA 2B8PA 1M5VC 3TI0A 1FE4A 3EXYA 3RR8A 4DR1F 4I68A 1V9OA 4DR2F 1WHWA 4P72A 5B08A 4IFVB 2GJ2A 1RAAB 2ZC4A 4N8OA 4DR3J 1UFKA 4I6WA 4YEAA 3D0HE 1S6PB 2HNDB 4IOBA 3H25A 2VPYB 2WSFC 1KVJA 1NSQA 1X4GA 2MQOA 1VMBA 3KHHA 2Q43A 3IN5A 4DEZA 1I6JA 4MXNA 4C0HA 2MTLA 3UD3P 4XMYA 2PD1A 4WCEQ 2BABA 4C2LA 1TTHB 2BE7D 2F8EX 2E7XA 2Z2ZA 1XMOJ 1WSVA 1TKZB 1X7VA 4LVNP 2CKWA 4ZPDA 3MCSA 1YJWS 2FJDB 1JLAA 2RUGA 3QJPA 4MYTA 4Z7CA 1OSDA 5D0RA 2VA2A 3OVAA 2BRLA 2DNOA 3CJ2A 2ZDOA 2YKOA 4TU8A 4MIWA 4U8VA 1CQMA 4DSJA 2XNQA 3BS9A 4YDTA 1ZM9A 5GAHI 1HI0P 4WJBA 4OYOA 4DV4F 5L38A 1S0OA 3AT1B 2VIHA 3QWPA 3KLFB 1UKUA 4P9SA 5DQHA 4N8NA 2ZH5A 4ENOA 4IH5A 2W9BA 3TVKA 2ZH8A 1L1IA 4OI1A 1VDHA 2KT5A 4YZQA 2QLXA 3DGPB 5DDQC 4DV3J 2F65A 1Q53A 4DR7J 2L9WA 2ZHOA 4ED1A 3C14B 3OR1B 2MZQA 3T1AA 3DLJA 3KNGA 2FJBB 1VK8A 1BQMB 4K7QA 4TNOA 3ENWA 3GJRB 3OTEA 1S48A 1D09B 4EUVA 5KG7A 4MK9A 1IXKA 1S1VB 3DLGA 2FLLA 1XJWB 1K0VA 4MKYA 4YY3F 3L95X 4NI2A 1RT3A 5DQIA 4N56A 4M5JA 1H0HB 4EWTA 4OYAA 3MCNA 3GYNA 6AT1B 3A8KA 3W9HA 3PV8A 1YRUA 4A4JA 3FUYA 4HL9A 3MTJA 3GCXP 3N6ZA 2VBMA 1U8WA 2OUGA 4P75A 4DR5J 1QAJA 3T41A 3M7VA 3KHGA 2MHNA 4CH7A 5IT0A 4NA2A 1XWLA 4PXDA 1XK8A 4HTJA 3TZYA 1SJFA 4OLPA 1Q5YA 2B4OA 4A8SA 1RTDB 3N9UC 3R1LA 4LFAF 5A8RA 1FTCA 2KB2A 3MM8B 4RWXA 4U7UD 5LSRA 3RW6A 3PM9A 3IXQA 1U49A 2NREA 1E6YA 4EBCA 4KGMA 2AW0A 1YJ9S 2C2NA 2HHQA 2RAQA 4A8QA 3TOQA 2G1DA 4TVAB 3KTQA 2GVZA 1D9DA 2UV8A 3GG0A 4NYZA 2DJWA 1HD1A 1E6VB 3IAS9 2LQ9A 3MR7A 5EWGA 3KG0A 2UVRA 1J5OA 1ICEB 1GNKA 2RRNA 4L72B 3L4BC 1PAUB 5HMXA 1R8CA 3ZTQA 2D74B 1WHYA 3MEKA 4ANCA 2C2KB 5F8LA 2HQFA 2XYPB 4RKUC 2G1HA 2RNEA 3CJKA 1PAEX 1T3OA 3I0RB 2DVIA 4HI1A 1RHUB 1PILA 2DNPA 2VDHA 1WC6A 1NSPA 3PKYA 1FNOA 4URSA 1K4ZA 4NE9C 2BOPA 1F0XA 1EB0A 3PR5B 4ZP6A 4PG8A 1XMQJ 2XMMA 4KGVB 2BANB 3IWXA 1RT2B 3VGSA 1MLAA 2C2ZB 4YOEA 4J9NA 3MPDA 3LJYA 5HP1A 2BBEA 4NL5A 1APSA 2XMUA 2DNQA 3BQ0A 4PWDA 1KLMA 1VJWA 5I3UA 4ZVQB 1N34F 5B7WA 2MKYA 4J37A 2E7VA 1IN0A 2HHWA 4JI7F 2J8SA 1YBAA 2AEMA 3KDOA 2MQNA 2UUBF 2HS3A 2B9EA 1JRGA 1KHWA 1TKTB 1S49A 3TVZA 1PYTA 1L3TA 3PW7A 3ET6A 3OHAA 4K5RA 1KN6A 2PE8A 4E0DA 3SY2A 2MKJA 3AB2B 5K14B 1S7IA 3MUMP 5LMNF 3CDBA 1RWMB 3TAPA 1U8SA 3RB3A 1RI7A 1VQMS 1RT7A 4YN3B 2E1MC 4F36A 4IQXA 1F60B 1N5TA 1VHIA 3P4UB 2L08A 3Q0AA 3D2WA 2OPPA 4NEYA 4YS2A 2GW8A 4C4WA 2LQ5A 2B6AB 4E98A 1RWRA 3I0SA 4MJKA 4Y2CA 3K5MA 4OZZA 3QIPB 2EFGA 4F8RA 4WFZA 1A6LA 2NYIA 3FZ2A 2UUCJ 4A8MP 3ITHB 3G6ES 4UY8T 1Z1ZA 5J1EB 1HQUB 3UCGA 3MMCA 2BQUA 4Z03A 4OM9A 1UWBB 5KFPA 1JLCA 3LP2A 5EHHA 2CNKB 1OJ4A 3RG6A 3ZTRA 3M1VA 5CA5A 5KFIA 3Q8RB 4TN2A 1F2HA 2EFVA 3CWJA 3FQLA 4HI2A 4TU9A 1TL3B 3C6UA 4XL9A 1AYEA 5T14A 2K7KA 3ETOA 1O8LA 2BRKA 4PXEA 1OGMX 1WEYA 5FD1A 4RUAA 1HNXJ 2MZJA 2AGPA 2V2VA 2CWKA 2EBGA 2OAUA 1D3WA 3E8OA 1HQ2A 5IWAJ 5D0GA 3RAMA 5AE3A 3QMQA 3THTA 3MURP 2QA2A 4L6V3 2F4VF 3D5MA 1C0TB 4IFYB 2JEFA 1WACA 4NYPA 3GJTB 2GS8A 4H4MB 5IT9Y 3ZZ0A 3C19A 2D7SA 4FS2A 2DHAA 3MHYA 3V6DB 2ZZNA 1MROB 1D0EA 4DV7F 5HJYA 1RTHA 1I94F 2W4PA 3EX7B 1SB6A 3R7SB 4ZITA 4DS5A 1K1SA 3HVTB 3AXMA 4PQUA 3M8RA 2VONA 1LWCB 1RBAA 2A6MA 2J9DE 3H8YA 1GX6A 2Y1RI 4XORA 2JFDA 3NCRA 3IRXB 4BLGA 4DV0F 3HMJG 3DYAA 2PA8D 1FWKA 4ANDA 1JJ4A 2IM2A 4IR9A 2M3DA 2LA4A 5J2QA 4KO0A 2A0FB 9RUBA 3NGRA 3TVYA 2ASLA 1KC8T 1JWWA 2X85A 2CQDA 3MEGA 3ZFVA 3J7A1 1S9FA 5DDRC 5KFRA 1VRTB 1ZA2B 2VZ9A 1GFWB 4NLRA 4XLHA 3I4PA 4O3QA 2DHXA 3GZ7A 4M5DA 3LTOA 1NHUA 4I4BA 4A46A 3AOAA 1VQ5S 3OHBA 2YQ0A 1U48A 3EVWA 1XIQA 3HD1A 3KLIA 4ECZA 1H7WA 4O3RA 4HVZA 4J9UE 2CZ9A 1P27B 1HYSB 2E1RA 2FVRA 4WU3A 2VFNA 1YJNS 4PG7A 4TYBA 3H42A 3EGZA 2H5EA 1SKWA 4NXMF 4BWJA 5HLFB 2DNKA 4USJC 3G82A 2XZWA 1RLDA 3A3OB 3PJ9A 3D6FB 5LM7E 3KRGA 3TZZA 2DGOA 3BQ1A 1CJUA 2G0IA 4FNIA 3OFEA 2C3OA 3BH6B 2DO4A 2RMLA 1PJ6A 4DXLA 3GCWP 3P49B 2FHJD 3KK2A 2AX0A 2X3GA 1SQFA 2POKA 3DLEB 1M5HA 2YTCA 1Y7PA 4ICLB 2Q1LA 2XM3A 3LQVA 1KOHA 2W2QP 5HMYA 3B8YA 1AROP 3ILIA 3RAXA 1YJRA 4OFZA 4AQYF 2YPYA 5I42B 1BY9A 4N77A 1J5EF 3UN2A 1K73T 3VSVA 3PRDA 1IWGA 1LFPA 4RW8B 4DUZJ 3TQ1A 4KSEB 4DX7A 2DXFA 4JI5F 4OYBA 4RW7B 2COLA 2IY5B 1QA1A 2BJDA 3MECA 1SPBP 2QXZA 1K5CA 3VGUA 2FHKA 1BHNA 5K8NA 2H4WB 2O0VA 2I5JA 3MOJB 2OPSB 4JI6F 1KSPA 2ACYA 3NGDA 1IM4A 3P8BB 1NH8A 1NJYA 1RHKB 4LF6F 2CNNB 2R8GA 2XTWA 4YELA 1LW2B 2VFOA 3KK1B 3M32A 3B82A 5FLXY 1S1XA 1MN7A 4E8UA 1NO8A 3C66A 2JL9A 2NXUA 3DKDA 4OIXA 2W4CA 2KG1A 5CD4A 2K7JA 2FVPA 2GCFA 3VAKA 3N01A 4JI8F 2XMJA 2AYBA 4WE1A 2RJZA 2QX3A 2R7OA 1FKPB 1UW4A 4JP8A 2CQBA 2W2MP 1TL1B 3ZNUA 4PUOB 2RVJA 1CLFA 1HARA 3DN9A 2H54B 1TMMA 2ZC3A 4QIFA 2KRRA 3NCPA 2OKQA 3JYTA 2ZBRA 2XO7A 3HJFA 1S4FA 4ECRA 4TY9A 5D0HA 1YZ7A 5GAHU 5LJ3Y 1VFJA 4IUFA 3OPKA 3TWZA 4ZVHA 3BSCA 3PJXA 1TKXA 2C1EB 3HM9A 1T9WA 2LYVA 1MW7A 3UVJA 1S0MA 2PC6A 3EICA 4J9QA 3CJ4A 1TAUA 1IBLJ 1AA1B 3PHTA 2N3LA 2J6SA 1U47A 3MMAA 2KDOA 3A1YG 2FY1A 3EXCX 3OL7A 2ZUAA 3LWMA 3MZIA 3HXMA 3J7YI 1CSJA 3PX4A 3NBPA 4C6AA 3SCIE 1HWKA 1X4HA 4OV1A 2DHHA 1R89A 1R8HA 3OUYB 1DRZA 2I2YA 2CQPA 2ERRA 1RWVB 3D68A 2BQRA 1H74A 1T03B 1N0VC 4HYKA 4Q0BB 2F7VA 1N48A 4KV8A 2FVSA 1RTJB 3BKFA 4CWBA 3CW2C 4NCGA 2NSCA 5KFSA 2X6XA 3UD4P 4ZPBA 1N54B 3B4NA 3UD5A 5E5NA 2D1CA 3Q8VA 3UDEA 1XNQJ 2HGNA 3L3CA 3RYLA 4K4SA 1TMJA 4FP9A 1IKYB 3GILA 2FJWA 2MB0B 4NRTA 1S10A 5E33A 2UXDF 2VFTA 3HI9A 5J2NB 1FO1A 3IGVA 1JK9B 2UUAJ 1DABA 4HACA 1TK0A 3MFHA 1KP6A 4P7TA 4CM2A 2O6WA 1Z2LA 2OD4A 3MMBA 2AGQA 2PDAA 2CJAA 1YLXA 2HG4A 3PO4A 1O8EA 1U0SA 1RAIB 1Q4RA 4RUBA 4O4GA 5CHCB 1P6TA 4NLPA 2G13A 5RUBA 4OZ5A 1S57A 3DU6A 3MM6A 4JI2F 3V5RA 3ZTPA 1XR7A 3CC7S 4URQU 7AT1B 4ECWA 1VQLS 4ZJOA 3DLBA 3QATA 2OPQA 2E5JA 3D1OA 3ZTOA 4UF4A 4UZBA 2O67A 1KTQA 3T19A 4F4ZA 4LSLA 2ZBQA 2Q66A 4JV5J 1SJQA 5HBMB 2LVWA 2FY8A 4O44B 2LEBA 2H5JB 1D8ZA 4PWWA 4Z06A 5D0EA 2WCXA 3CDAA 5C24A 4FNHA 3TA2A 3HFKA 2HRTA 2RRBA 3RBXA 4Y2AA 3HSZA 1D9AA 4I67A 2YWKA 4CT9A 1JNZB 3US5A 3FBCA 2KHCA 3CMAS 2DHSA 3NS5A 3UDVA 4ECXA 2VOPA 2BOAA 1AXQA 4ETXA 4OI3A 1NK4A 1VBKA 4OYMA 4YEJA 3FEXB 4WWSA 4GVBB 2JEJA 2DPIA 2HIYA 4DFMA 4ZVSB 3RZAA 3OXGA 4ZVTB 4Q2LA 2IAJA 4NPOA 3M2VA 3H90A 3C6TB 3LAKA 1I51B 3W2WA 2V94A 2GQ2A 1HQEB 4ECSA 1O88A 2KM8B 4RPFA 4LUBA 3CVKA 5A8KA 1WHVA 1HKAA 3O2IA 1VQ8S 1CULA 5D4OA 1BC6A 4W8TA 3BGRB 3CO9A 1DTTA 3RTVA 2GGPA 1R6YA 4W8QA 1XG2A 1P9YA 2FC8A 1BQNA 4I1TA 2UP1A 4KIAA 3QGGA 1G7CB 4C7QA 2IM1A 3LOUA 4NLYA 1N6QA 2B4UA 2VH7A 3LF0A 4M1KA 2KI2A 3BREA 3CB4A 4DG1A 3OSPA 3HSJA 2VFRA 2FLOA 1TYUA 3DMJB 2CAJA 3BGOP 4KE5A 3K5OA 3GIIA 1HBNB 1DLOA 4ZLNA 2EWHA 3H5UA 5E41A 1FKOB 3G6VA 5HSPA 4B3RJ 3IM8A 2ZZTA 2HZCA 1T95A 4R25A 4DR6J 5HJXA 5HVGA 4DSFA 1TV6B 1WD6A 4QQBA 4ATNA 5THWA 2R7TA 1B70B 3QQCD 3GB0A 1M1HA 3LP0A 3MDFA 1WUUA 2AX1A 3H4DA 4EI2A 1W26A 2HNYB 3I9ZA 1PC4A 2J9EA 4G65A 1NU4A 3UN3A 4UOFA 4DBQA 3RB4A 1U2CA 2B56A 4R8UA 3G6YA 2VBXA 3AD7C 4G6VB 1CJVA 3ZPPA 1FJCA 1HW9A 1U24A 3IS9B 1SKSA 5B09A 2V34A 3MWBA 4GO5X 2D9OA 1S0VA 1JMTA 1JXEA 3PSSA 4JUZA 5H9FK 2BE2A 2RS2A 2E5LF 1TVRA 3MPVA 4O0IA 2JH3A 3H5SA 5G0RA 2DHGA 3PSZA 1UJ4A 4DL2A 2R2RA 2DEIA 3OTDA 4ECTA 2XMAA 4L76A 3G8SA 4W8SA 4A8WA 3NGKA 1MWYA 4C3MA 4IH7A 1PGZA 4X4TA 5T7LA 1U1OA 2MZRA 2ZBCA 3KUEA 4K4UA 1VLYA 3PY8A 5KFLA 5KTQA 2Q6CA 1JTAA 2C2MB 4CYUA 4B3TJ 2ZJQQ 5DGAA 1IBCB 2XNRA 4UW2A 4IG0B 4UZCA 1JLQB 3R9LA 1FJEB 3MAAA 2Y0SD 3DRPB 1V5IB 3N6MA 1CJTA 4DSLA 4CTAA 2O01C 3IBFB 4K59A 3BGLA 3FEZA 3S01A 2IC3A 2IDLA 4NLTA 3MXHP 4DN0A 3PYDA 2BQ3A 1NKBA 2CPXA 2M0GB 2GVDB 4DV6F 1JJ2R 2MY8A 3RB6A 5JLVC 3B8HA 4F7VA 4Y6IA 4LF8J 3VMVA 1KQSR 1NZ8A 4JI0J 3J81U 2IMOA 4FYWB 1Q8BA 1UVKA 1PXZA 3KDNA 2VJUA 2Q6BA 3AODA 3K5NA 3C2PA 4ES2A 2XS2A 2LLZA 4K0KF 3B54A 4L3KA 2GFFA 2VV5A 3CC4S 2NZ4A 3EMTA 2ATCB 4V19J 2MQMA 1U2RA 2DKOB 4XIUA 2PSZA 3JB9k 3Q8QB 4LFCJ 2W9BB 3FCHA 2H51B 2AJ1A 3TUPA 2QRRA 1RA7A 2EG2A 1IBKF 4PPDA 3TANA 2BA9A 3LPEA 1X5TA 1CVJA 4W98A 3U1NA 1FDDA 5EN1A 1EZGA 4DMZA 3W5XA 1MWZA 3N6NA 1WSRA 4RBVA 4K4YA 1DZ5A 3OTOF 1DURA 3PACA 3DLLQ 3HD2A 2OLWA 1CG2A 1KS2A 4DPTA 3KLHA 2CVIA 3DLGB 2W8KA 1U0HA 3W65A 1LK7A 2E1PA 2RE1A 5FDLA 1F9EB 4PAAA 5L1IA 1QAIA 1T7PA 4QOTA 2LKZA 3D0GE 3M6VA 3SZEA 5KG2A 3U7JA 4ILRA 2HNZB 2C42A 5D8HB 2B9XA 4LF5J 1WC4A 4K8RA 2YNHA 4M5IA 2GJFA 5E2QA 3M30A 2FYXA 1SUQA 5D6GA 1K0TA 3M2UB 3GV8B 4DV2J 1VCTA 4HT7A 4WFYA 2FJVA 1KBRA 4DS4A 4F25A 2XSJA 4EYHB 2AZ1A 3W1YC 2FZCB 1WEXA 1WOPA 5LMUF 1QLNA 2W01A 4WTYA 4Y65A 3WZ0A 3T9NA 4CLWA 1EP4A 1OYDA 2LCWA 4DSKA 2CQGA 2CJ9A 2CQ0A 1EE6A 4U7UK 4WP9A 3TAMA 2ZDPA 4DU8A 2V5HG 1GMWA 2V8VA 1EARA 3C15A 2R2TA 4YDXA 2M88A 1YJVA 3FFIA 3MMJA 3CCQS 3GQ9A 2PI5A 3CCES 2YH1A 2NR0A 2XMTA 3UCZP 3AB4B 2GVZB 2NZMA 2XTYA 4F0KA 1RWUA 1HWUA 2VFPA 5C42A 3LMWA 3IWLA 1OYEA 2R42A 1J5OB 1M5KC 3BPSP 2O0WA 1UFLA 4UOGA 3PX0A 1PCAA 2DH7A 2PMWA 1S9GA 2XY5A 2MMYA 4EO6A 4NLGA 5B0DA 3HKZD 2DIVA 2Y8WA 1PE9A 2MJUA 1KFSA 1LEOA 2RF2A 2OFHX 4YR2A 2KVIA 1WKJA 1IB4A 3HZEA 4ZVUB 3RR7A 3I31A 4JI7J 3IR7B 2XMKA 1XEZA 2QL7B 4K4XA 1U2FA 1NB2A 3D28A 5J2MA 1MMDA 4DJBA 2AWZA 4LF7J 6FD1A 4NLUA 1HHQA 1WI6A 2HIQA 5HP1B 4LF4J 4D3GA 1KCCA 1VI7A 1LV5A 4PWDB 3OFHA 4RUCA 5GMKa 5I3UB 1YJTA 1B7FA 3J7YU 1X0PA 2XHCA 2EC0A 1HBOA 2VKZG 1R0BG 1RE1B 2XLIA 3MCOA 2RDDA 1DBOA 2DH9A 3FNNA 1UZDA 4ECVA 1VOMA 3FY3A 4ZVFA 1RHJB 1BE4A 2RSQA 4DZ6A 1B3TA 4UQGA 2G2OA 2WVFA 3V81A 3OVSA 4NMXA 4KY3A 1A7GE 1ZPVA 2XLKA 2I38A 5BXIA 1X5OA 3DRRB 3GP9A 4NCBA 1T9XA 1RT7B 3K2YA 5KFDA 2E1AA 4OX8A 4JI3J 2NTBA 5IV4A 3M9MB 2HS0A 3EVMA 5GAEU 2CPIA 2R2SA 3SQVA 4ZPCA 3SDEA 4ZLJA 1YJ7A 2IQ7A 4EZ9A 2CIMA 3MEDA 4QIVA 2IJFA 5F41A 4PABA 4DHVA 2OPPB 3W5ZA 3UO0A 2DNNA 4KHPJ 1HWIA 2FGOA 1EKSA 4LF9J 3HFVA 1LXNA 4R0JA 1URRA 3I0SB 1IQTA 5K8PA 2NT9A 3L09A 5HN0A 4RW6B 2XTXA 2FJAB 1U25A 3VQTA 1YGYA 2YNFA 3T9GA 5J1PA 1O8MA 3UW1A 1S1WA 4UT4A 2NXCA 2ZWPA 4KGZB 5B0GA 1JLCB 3EWGA 3LP2B 4X64J 1CEZA 5F8GA 3K5LA 3ONQA 4OHWA 1PYSB 2V4JA 2ZBIA 1KEKA 3LA0A 3VZIA 3FCWA 3THPA 4BBYA 4MFBA 2CZ4A 2O66A 4CO1A 2E1CA 3CC2S 3POTA 2Z58B 1GMUA 3C6UB 3T1YF 4DQPA 3TA0A 3VV2B 5F0UA 2IYIA 5DJBA 1O0PA 2F9DA 5DNSA 4ECQA 3DRSB 3O8WA 5HATA 2MPUA 4ECYA 2OJ3A 3SCLE 3T1HJ 5A0YA 4OX9F 3KK3A 3FMWA 1W2IA 4DV1J 4WKRA 2LXUA 4QIWD 1FFSB 3ISND 3JSRA 2N4DA 4CLUA 4X66J 4J9KA 1YJUA 2R8IA 5DM7Q 2ASYA 3DRYA 2Z8GA 4B02A 1RTHB 2DIUA 3KLEA 3CJTA 3H2VE 1FRJA 3CCUS 2Y3YA 4PQUB 3FSYA 3SZ2A 5D15A 3VAIA 2XMVA 4FF2A 1X31C 3CCRS 1KQ5A 5JMCB 2BM7A 2GIQA 2ROGA 4P73A 4ZPAA 4JYAF 4ZVEA 4CO4A 4LIRA 4KQZA 4YEIA 2CPDA 4RR5A 2HVIA 5J2PA 5J2QB 3GIKA 4CH0S 4K2XA 2FB0A 5ETQA 1RT5A 4LBPA 1KWMA 4IRDA 5IM0A 1GTEA 1FD8A 5CYQB 3MEGB 3KJFB 2AZ3A 3AD8C 2CG4A 2PMZD 4WIQA 1S5ZA 1FWLA 2UVEA 1LWXA 5HMZA 1O6XA 3O44A 2NXNA 4M5DB 3N90A 2R4FA 4CLKA 1HD0A 4JI1J 4MKVA 2FD2A 5D4LA 2QFIA 4NXNJ 2RD5C 2VPXB 2OTLS 4Y34A 5BR8F 1GQEA 2LU1A 3KFWX 3BPDA 1RAJA 4RX6A 2V67A 4OYZA 3SYJA 2E5HA 2HQIA 3B4MA 4WFAQ 4EEYA 1FJ7A 2NSTA 1OPZA 4C9DA 1ACMB 3W8PA 2VU5A 2JFKA 4BCAA 5KFNA 1DY3A 3G82B 3SFGA 3MR6A 1W25A 2BX6A 1NJIT 1CJUB 2MZTA 4M5GA 3AQOA 3CMQA 2YPZA 3EDQB 1RUSA 3MI7X 4P2XA 2AP6A 3QFHA 3KK2B 4M5LA 4DF8A 5AJ3F 5IFMA 5KG6A 6FDRA 5LSOA 4DPXA 4MYUA 1XBWA 1FERA 7FDRA 2HHHF 2QTWA 1JNRB 1N32J 5KFUA 3OQ2A 2PEHA 1RYRA 1RT4A 2AEJA 2QO3A 1SJ4P 2O1PA 2VG5B 1GEHA 3BR9A 2VL1A 3R97A 4C8ZA 2FTRA 3PXGa 3VWSA 3O6QA 4P52A
chains in the Genus database with same CATH topology
4HR2A 3BBBA 3SYJA 3LJYA 2B8QA 3MPDA 1K8FA 1S57A 3RIQA 3P4GA 1S59A 3B54A 3EVWA 1W7WA 3BH7B 2J8IA 1XIQA 3ZTPA 4OJPA 2VFPA 2VU5A 3SZEA 1UCNA 1HF2A 2G0YA 1B99A 1TSPA 3EVOA 2V5IA 2W7ZA 2B0RA 3EMTA 3FBEA 3AK5A 3JX8A 4OJOA 1KQ5A 3H09A 2B8PA 5JMCB 3GPAA 3B6BA 2BM7A 3FCWA 2VFNA 3LYCA 2IOUG 1BE4A 3EM1A 3R9LA 3ZTOA 3FC9A 3NGTA 4WBFA 2BX6A 4OJ6A 3BBCA 3FBBA 4UOHA 4DZ6A 4FKYA 1TYVA 4UOGA 4F4AA 3VVUA 1NCLA 2HVDA 2BM5A 4OJ5A 1NSKL 4OM9A 3DDIA 3ZTSA 3NGSA 1QA2A 5BXIA 3ETMA 2DXFA 1NDKA 2BM6A 1WKLA 5IOLA 3ZTRA 2NCKL 3GP9A 2HVEA 3Q8YA 1WKKA 4UOFA 2AZ1A 1WXRA 3BBFA 1MN9A 3Q8VA 3ENAA 5CABA 1PKUA 3VGTA 1LEOA 2BM4A 1QA1A 3G2XA 3ZTQA 3PJ9A 3N6ZA 3EVMA 4DUTA 1U8WA 2DYAA 4ANDA 2AZ3A 2DXDA 3PRVA 4EK2A 1WKJA 3VGUA 1TYXA 2VFQA 1NLKL 4ANCA 1QRCA 1CLWA 4OPWA 3PETA 1BHNA 1QQ1A 1KDNA 3FKBA 3BH6B 1S5ZA 4W98A 1LWXA 4ENOA 1DABA 4OJLA 1F3FA 1NDLA 3VVTA 2HURA 1VYAA 3Q83A 1NSQA 1QRBA 1NB2A 2DY9A 1QA3A 1NPKA 3ML3A 1NDCA 1PAEX 1HLWA 3NGRA 4S0MA 3EICA 3Q86A 1NDPA 3N90A 4JRAC 4V02C 2CWKA 3FBCA 4ANEA 5JLVC 3TH0A 3ELHA 1JXVA 1HHQA 2YUHA 4KH3A 4F36A 3Q8UA 4KPCA 1NUEA 3JS9A 3WX8A 3L7UA 3FCVA 1NSPA 3EE3A 3Q89A 4FKXA 3VGVA 4DI6A 2VFOA 2XC1A 1K4ZA 1B4SA 1TYUA 4CP5A 1HIYA 3NGUA 2ZUAA 1MN7A 1K44A 1EHWA 3EJMA 1ZS6A 2DXEA 5C7PA 1TYWA 3DKDA 2BEFA 4C6AA 4O0NA 2F3LA 2VFMA 1BUXA 3FBFA 1NHKL 1F6TA 3VGSA 1XQIA 5CAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR2 A;  3BBB A;  3MPD A;  2B8Q A;  1K8F A;  1S57 A;  1S59 A;  3B54 A;  3EVW A;  1W7W A;  3BH7 B;  1XIQ A;  3ZTP A;  2VU5 A;  1UCN A;  1HF2 A;  1B99 A;  3EVO A;  2B0R A;  3EMT A;  3FBE A;  1KQ5 A;  2B8P A;  3GPA A;  3B6B A;  3FCW A;  3ZTO A;  1BE4 A;  3EM1 A;  3R9L A;  3FC9 A;  3NGT A;  4WBF A;  2BX6 A;  3BBC A;  3FBB A;  4UOH A;  4DZ6 A;  4UOG A;  4FKY A;  4F4A A;  3VVU A;  1NCL A;  2HVD A;  1NSK L;  3DDI A;  3ZTS A;  3NGS A;  5BXI A;  3ETM A;  2DXF A;  1NDK A;  1WKL A;  5IOL A;  3ZTR A;  2NCK L;  3GP9 A;  2HVE A;  3Q8Y A;  1WKK A;  4UOF A;  2AZ1 A;  3BBF A;  1MN9 A;  3Q8V A;  3ENA A;  5CAB A;  1PKU A;  3VGT A;  1LEO A;  3G2X A;  3ZTQ A;  3PJ9 A;  3EVM A;  4DUT A;  1U8W A;  2DYA A;  4AND A;  2AZ3 A;  2DXD A;  3PRV A;  4EK2 A;  1WKJ A;  3VGU A;  1NLK L;  4ANC A;  1BHN A;  1KDN A;  3FKB A;  3BH6 B;  1S5Z A;  4W98 A;  1LWX A;  4ENO A;  1F3F A;  1NDL A;  3VVT A;  2HUR A;  1VYA A;  3Q83 A;  1NSQ A;  1NB2 A;  2DY9 A;  1NPK A;  1NDC A;  1PAE X;  1HLW A;  3NGR A;  4S0M A;  3EIC A;  3Q86 A;  1NDP A;  4V02 C;  2CWK A;  3FBC A;  4ANE A;  3ELH A;  1JXV A;  1HHQ A;  2YUH A;  4F36 A;  3Q8U A;  4KPC A;  1NUE A;  3JS9 A;  3WX8 A;  3L7U A;  3FCV A;  1NSP A;  3EE3 A;  3Q89 A;  4FKX A;  3VGV A;  4DI6 A;  1K4Z A;  1B4S A;  4CP5 A;  1HIY A;  3NGU A;  2ZUA A;  1MN7 A;  1K44 A;  1EHW A;  3EJM A;  1ZS6 A;  2DXE A;  5C7P A;  3DKD A;  2BEF A;  4C6A A;  4O0N A;  1BUX A;  3FBF A;  1NHK L;  1F6T A;  3VGS A;  1XQI A;  5CAA A; 
#chains in the Genus database with same CATH topology
 5ETT A;  4NAS A;  2C3Y A;  1LNQ A;  2JZ5 A;  3FJ2 A;  2NT6 A;  2AF6 A;  1W7W A;  2B51 A;  1F5B A;  3RB0 A;  2BYC A;  3JAM Y;  3EZO A;  3DCA A;  2FC9 A;  4FN5 A;  3MEC B;  2A2D A;  2R7Q A;  1S1U B;  4EBE A;  1UZH A;  3VMW A;  2DB1 A;  2KM8 C;  4N5S A;  1FK9 A;  2Y9H A;  3UWT A;  4DV5 F;  4M5M A;  1HWL A;  3ETM A;  2I5J B;  1SH2 A;  3R2D J;  4DL0 C;  5C25 A;  3BO3 A;  1P9Q C;  4LT6 A;  4Q5V A;  3CSK A;  3HHL A;  3U27 A;  4OPW A;  3M32 B;  5KG3 A;  3NAI A;  2W9C A;  3G8T A;  4S0M A;  2JLG A;  2WB4 A;  1ITP A;  1H6K X;  5LSL A;  3ELH A;  4C48 A;  1Y3J A;  2V2Q A;  4AT1 B;  4WZQ A;  3NY0 A;  2HVZ A;  2R7R A;  1G3O A;  2ATL A;  1QE1 A;  4CDI A;  3PCO B;  4YZA A;  1C4C A;  2BEF A;  3WIV A;  2C28 A;  5CXT A;  2E7W A;  1EET A;  3TEG A;  1SC3 B;  5F9N A;  2MKI A;  2JJ4 D;  5T41 A;  5L39 A;  3W60 A;  2JX2 A;  3JYT B;  3AK5 A;  2J0S D;  4Y28 C;  1DFD A;  1RAH B;  3IR5 B;  2W7A A;  4V19 X;  4NLV A;  4X2B A;  1KOO A;  3UVJ B;  2LDI A;  1N52 B;  2D3U A;  2WON A;  2VG6 A;  3V6K A;  3LW5 C;  3CDW A;  3MMA B;  4NK6 A;  5F8J A;  3CIZ A;  2I9S A;  1OFD A;  1KVI A;  4DSE A;  1RTI B;  5AMV A;  1XTZ A;  3PO5 A;  1SC1 B;  1REG X;  2XY7 A;  2J5A A;  3NBP B;  2KH9 A;  5L46 A;  3R5C A;  3SQO P;  5IS2 A;  1VQN S;  5LJ5 Y;  3WX8 A;  3EE3 A;  1RCO B;  1IQZ A;  1NM2 A;  4P6Q A;  5EX0 A;  2KTQ A;  4K4T A;  2ASJ A;  1NK6 A;  2XO6 A;  2L48 A;  2ZH7 A;  1BLU A;  1JB0 C;  1O5J A;  2INU A;  4LFB J;  2A1B A;  4HR2 A;  2QN6 B;  1FJG F;  4QBU A;  1LQ9 A;  4DUY F;  5L8R C;  1UVJ A;  4LSN A;  5K8M A;  3K59 A;  1JIH A;  1UP1 A;  3R7N B;  1S0N A;  3RU0 A;  4DDF A;  5DDO C;  2IDE A;  2BM0 A;  1Y9O A;  2J9D A;  2FIU A;  3PKM A;  4WBF A;  3UR3 C;  2QC3 A;  3OJU A;  3KUG A;  2D69 A;  4HAC B;  3MR5 A;  2BXJ A;  2R7U A;  2HHT A;  2BKN A;  4DR3 F;  4WZM A;  1PKU A;  3ZZO A;  3MMB B;  3NOC A;  3AOB A;  1LWF A;  2QG9 B;  3DHX A;  4CT8 A;  2M4M A;  3R5D A;  4YZ0 A;  4O4G B;  1TKZ A;  3GV5 B;  3S6E A;  1YX2 A;  5A76 A;  4IRC A;  2IA6 A;  1WDD A;  5FII A;  4IDK B;  3ZNJ 1;  2WB1 D;  1M5O C;  1ZAX A;  2W24 A;  3SXL A;  2OPQ B;  1TUG B;  2ZH6 A;  1QUP A;  5ETV A;  2IIH A;  2KVQ E;  5DRK A;  2KT2 A;  2CVE A;  1WEL A;  4LSL B;  1NK8 A;  2R3V A;  2IRU A;  4F3O A;  4PEO A;  1OQ3 A;  2E44 A;  3V4M A;  3K0J A;  2UU9 F;  5C24 B;  4OJ5 A;  5CZX A;  2JVO A;  2IVM A;  4U6P A;  1IUJ A;  1JLF A;  5KFT A;  4YZX A;  2YY3 A;  3EDR B;  3ENA A;  4A8K A;  1KQG B;  3PFE A;  5KFF A;  1UVI A;  2PO4 A;  1REV B;  2VFQ A;  5LL6 d;  3LPY A;  4FPI A;  1OFM A;  3T9Z A;  1WG1 A;  1U4B A;  2VG7 B;  2VHG A;  3W9J A;  1FRI A;  1ZBT A;  5H1S V;  2CJB A;  1RZM A;  2G2Z A;  3CJ5 A;  1Q5V A;  1T05 A;  4DR7 F;  3BSO A;  2INV A;  3M8S A;  4Z05 A;  3ZC4 A;  4OZN A;  2DR5 A;  5CCL A;  3RAQ A;  3NNC A;  1M5P C;  2CJK A;  1IKV A;  3UN5 A;  1BHE A;  3DI6 A;  4A47 A;  1L3S A;  2DGT A;  4WP3 A;  3NKY A;  4DLE A;  2ZH4 A;  1G1X A;  1UFW A;  2IAJ B;  3M2V B;  3A8E A;  2MHE A;  1BUX A;  4FVM A;  5D78 A;  3QWU A;  3KMS A;  2VC0 A;  3W5Y A;  3PJW A;  3W2W B;  5HRO B;  3K57 A;  1ELO A;  2FDN A;  3RRH A;  2VOD A;  3N0V A;  2AGO A;  1B0V A;  3CPW R;  3FQK A;  2IMW P;  2A18 A;  2J0X A;  1NHC A;  1CUL B;  1PLU A;  1K47 A;  2BJ1 A;  1DTT B;  2CRL A;  3TUI C;  3OXL A;  2GGP B;  2AJ0 A;  2MEW A;  4MK7 A;  4ALZ A;  1BWE A;  4J5O A;  1BQN B;  4ZJL A;  1UAW A;  1F5A A;  1HHS A;  1U1L A;  4DR5 F;  5HO4 A;  3NB2 A;  4X4O A;  3DLK A;  4DG1 B;  4RNN A;  1IBM J;  5B0E A;  3M05 A;  2YKA A;  4OJL A;  4I2P B;  3T6J A;  1K9M T;  3Q83 A;  1QAY A;  1X4F A;  1B0T A;  2X3H A;  3FDS A;  1S99 A;  1X4A A;  4KBI A;  2DNY A;  5ETM A;  3CIM A;  3NLC A;  3GWC A;  3SFU A;  4CO0 A;  4X4R A;  4LMZ A;  1N5V A;  3SSS A;  2Z57 B;  3NGU A;  2NUH A;  8RUC A;  1QY7 A;  3CD5 A;  2BZ2 A;  2GO9 A;  3UDL A;  4UUW A;  4U8Y A;  5K5M A;  4OL8 A;  3AA9 A;  2Y1I A;  1RIS A;  3KLG A;  2E5L J;  2LQB A;  2QLW A;  3HKW A;  4C8Y A;  2JLE A;  2V5I A;  2KKH A;  2DGX A;  2KO1 A;  5DO2 A;  3MTK A;  1WEZ A;  3GPA A;  4PYA A;  4C8O A;  2QMX A;  3CE8 A;  4G1P A;  1Q7Y T;  1WG5 A;  1CJV B;  3V6J A;  2E9R X;  3NGS A;  2P9C A;  1T9V A;  5K8O A;  1RT2 A;  2BE2 B;  4FDF A;  5GME A;  1H3D A;  3PNI A;  4J9O A;  5CYM A;  1HG8 A;  1M1G A;  2J0W A;  4KH0 B;  1BMQ B;  2DIT A;  3GTY X;  3K5P A;  5KAK A;  5G0R B;  2GJI A;  4MR0 A;  1KQF B;  1Y5N B;  2EK1 A;  2V0N A;  1RKI A;  1T0T V;  4C0O C;  4MMO A;  2WVE A;  4E2F B;  3HDS A;  4FF1 A;  2XS7 A;  5T7L B;  1QVF R;  1IA5 A;  4CLZ A;  5K9F A;  3Q89 A;  1HBM B;  2XUL A;  2P8I A;  1NXI A;  1TKT A;  2X1G A;  1XMQ F;  4B9V A;  4XKW A;  3J7Z T;  2D9P A;  2O3D A;  1RHR B;  3CCT A;  4DQS A;  4IYQ A;  4ZCK A;  3SQG B;  1D8Y A;  4X4Q A;  1XQI A;  3MAA B;  1WOR A;  3BM7 A;  1Q82 T;  1HNZ J;  3GIM A;  1CJT B;  3KNA A;  2WHO A;  2BJ8 A;  1WHX A;  1JJH A;  1S4E A;  2H65 B;  2KFY A;  1F2G A;  4R0E A;  3K17 A;  1GMW D;  2IC3 B;  5HK4 A;  4OI2 A;  5E3Q A;  1CBK A;  3BR8 A;  4DX5 A;  3K58 A;  2RDJ A;  3QSY B;  1RT6 B;  3OT9 A;  2DD8 S;  2B6A A;  4OHV A;  2RQM A;  2DYA A;  3BKU A;  2PYH A;  2ZH2 A;  4DPY A;  3BDE A;  3W66 A;  3QIP A;  3G86 A;  3IG1 A;  2UUW A;  2KYX A;  2HZA A;  4J9V A;  4YC5 A;  2QL5 B;  1DAX A;  4KPY A;  4QW9 A;  2XT2 A;  2NQP A;  1N56 A;  3ITH A;  3JQM A;  5KFO A;  2MY7 A;  1LXJ A;  1UL3 A;  4QR0 A;  3D1Q A;  3A8J A;  4ED0 A;  3ENV A;  1IBK J;  3VR1 A;  5IXU A;  4TU7 A;  2AYE A;  1UWB A;  5L9X A;  1U09 A;  2M2B A;  4IR1 A;  4ED5 A;  5L9N A;  3UNG C;  4GKJ J;  3ZSC A;  4RW4 A;  4I84 A;  2CQH A;  4DL6 A;  2I6W A;  2X1F A;  1TL3 A;  2J8I A;  4OV6 A;  5F8H A;  4DQI A;  3DXB A;  1H72 C;  2UUC F;  1RU2 A;  3TUJ C;  4NA3 A;  4KGX B;  2J6U A;  3DU5 A;  1FFW B;  4J90 A;  2HHX A;  3T5L A;  3IBC B;  3PEJ A;  4OQJ A;  5AE1 A;  2VBW A;  1O8D A;  2BVZ A;  3CD6 S;  1SQG A;  4OJ3 A;  1QM9 A;  3OV7 A;  3IRW P;  2HFV A;  4Y2K A;  1FXR A;  4AXI A;  2G4B A;  2IJR A;  4OJG A;  4L74 A;  4CLF A;  2HEK A;  1MU2 A;  3J81 Y;  2JWN A;  1AZS A;  3UDC A;  5KFJ A;  3KLH B;  1MRO A;  3I32 A;  3R6G B;  4F2R A;  2EFP A;  1WWH A;  1U0H B;  1MNE A;  5IWA F;  4EYI B;  3RRG A;  2EWE A;  4NLO A;  4M94 A;  3SCJ E;  1TL5 A;  3HHK A;  2QJ3 A;  1RK8 A;  4BWM A;  3O5T B;  4ZA1 A;  3I55 S;  2CJQ A;  4IO9 Q;  4LIW A;  4Q43 A;  2CA9 A;  1TK5 A;  1NHK L;  2YNH B;  1O8H A;  3BBB A;  3M30 B;  1SUQ B;  4DOZ A;  3P4G A;  5KG1 A;  2YKN B;  5DM6 Q;  5KFZ A;  1RBO B;  2XSJ B;  2UVF A;  1U26 A;  2CPZ A;  2OP5 A;  4AUK A;  4YUD A;  2G9O A;  1NRK A;  5A6P A;  1VRT A;  2XI3 A;  4HDH A;  1EP4 B;  3K89 A;  4WK3 A;  1KD1 T;  3PVX A;  2RQC A;  4NCA A;  4QCL A;  1Y5I B;  3PW5 A;  4DPU A;  2QLB B;  4IO1 A;  3TAM B;  1ZAV A;  7FD1 A;  4F4K A;  1X60 A;  1EAY C;  3P3D A;  2DXD A;  4C2M A;  3KJN B;  2ZM6 J;  3C15 B;  2W2N P;  3NG8 A;  1VGY A;  3FFI B;  1NDL A;  1VIS A;  5I4M A;  2IM0 A;  1VQ7 S;  1G4C A;  2RHQ B;  4USK A;  1GXL A;  5I3P A;  5JUM A;  3C3L A;  4LRD A;  4TKT A;  4DFP A;  1UMJ A;  5KFE A;  1X4D A;  5SZT A;  5C42 B;  2OEL A;  3VTI A;  1HIY A;  2QEX S;  3LO3 A;  2BE9 B;  4M63 A;  4K2J A;  1NH7 A;  2DCU B;  2G2Y A;  3MM7 B;  4M5N A;  4LR8 A;  2L9N A;  2KU7 A;  3HT0 A;  2KXH A;  2DGV A;  1C0U B;  3CNQ P;  1T9Y A;  1HBU B;  3WBZ A;  1IDK A;  1S9G B;  1DAR A;  2ACM A;  3ZXW A;  3QO9 B;  4WKY A;  1S1T A;  3R5B A;  1RT1 A;  1S12 A;  3OW2 R;  4X4P A;  2IPO B;  4RNO A;  1TL7 B;  1HPZ B;  4OZ1 A;  1MML A;  3DDI A;  3DLE A;  2AJF E;  4MKB A;  2HHP A;  4ICL A;  4RNF A;  2EBE A;  3O3L A;  4DPO A;  3AAW B;  3I6P A;  5IQQ A;  3WIU A;  1Q16 B;  2IM3 A;  1X9S A;  4D3H A;  4C11 B;  3QLH A;  4I7F B;  4NOH A;  4C97 A;  1ULR A;  3ISZ A;  2PII A;  4RW8 A;  1RAB B;  2UXC J;  1FES A;  2FQQ B;  3SBM A;  3JQJ A;  3ISN C;  3QRR A;  2ILZ A;  4RWW A;  1C1B A;  2ZJR Q;  4ES1 A;  2JEI A;  4G3I A;  1VK3 A;  3EYZ A;  3V81 B;  3NS6 A;  2VAS A;  1FDB A;  3R5G A;  1BN8 A;  3GIJ A;  3OTB A;  4PWU A;  4JI4 J;  3HX9 A;  2W7O A;  1RWP B;  3OBI A;  3I5C A;  1NBE B;  1RAF B;  1DHM A;  1QJH A;  4WU2 A;  3B4D A;  4LRF A;  3SDE B;  1LW2 A;  1C1C A;  2PGC A;  2FHO B;  2DRD A;  4ED4 A;  1S76 D;  4FYV B;  3D6M B;  2GHP A;  1MN9 A;  1SKR A;  1YVF A;  2DR9 A;  2Y8Y A;  3W3S A;  1RGV A;  4EFA C;  3M2R A;  5F3Z A;  4XR6 A;  1CZF A;  4KH1 B;  1DTQ B;  1U6B A;  4BDP A;  3VST A;  2MKH A;  2HFN A;  4A48 A;  3ML3 A;  2QYU A;  1JLG A;  1UW9 A;  5BYQ A;  2P2C B;  3CCS S;  2XWY A;  3J7A N;  3R8Y A;  1ZZN A;  4OZ0 A;  4PUO A;  3M8P A;  3H2L A;  3GE9 A;  1QAX A;  2Z8Q A;  1PIE A;  1XNR J;  1FXD A;  3TJA A;  3OL8 A;  2B43 A;  4RNM A;  4DFK A;  4YQW A;  2CG8 A;  2JDJ A;  2V4J B;  2V9W A;  4OX9 J;  2CPY A;  3CCJ S;  2XZT B;  2J7K A;  3GQC A;  2UXB J;  3RJM B;  3POT B;  1R8P A;  1CJK B;  4O3S A;  1HF2 A;  2DNG A;  4ZDN A;  3VAG A;  2MZ1 A;  4CO5 A;  3SV4 A;  2H1Y A;  2JSX A;  4ZMM A;  2VFU A;  2WVC A;  4OJ6 A;  3IO1 A;  3FBB A;  2J8A A;  3P6Y C;  3TJ8 A;  2E66 A;  4F4A A;  1M5S A;  2WTF A;  1VRU A;  3KG4 A;  1U45 A;  4F3M A;  1O8I A;  3CCM S;  2HVE A;  3GIR A;  1CC7 A;  5A0Y B;  2HQ3 A;  2MYF A;  2W9A A;  2OH2 A;  1SJ1 A;  1YRX A;  4X65 J;  4ZCI A;  1VBL A;  4U4B A;  3JTO A;  4LQ9 A;  1OQ6 A;  2GNK A;  3OFG A;  1T03 A;  1H73 A;  4P74 A;  4Q0B A;  3F41 A;  3J7Z 5;  3CD0 A;  3S8S A;  3KLE B;  3CJQ A;  4O4R A;  2G0C A;  5L1J A;  5EWE A;  4FBT A;  2BJ3 A;  1HA1 A;  2QA4 G;  2MQ8 A;  2X7I A;  4WTO B;  3EUN A;  3P45 B;  4ZOS A;  4USV A;  1X8D A;  2EKN A;  3QZ8 A;  3V4I A;  3VZH A;  1YI2 S;  5C1E A;  4CI0 B;  5ETK A;  4CQ1 A;  1F9H A;  3HHL D;  2X1B A;  3DOK A;  5AT1 B;  4QU7 A;  2XS5 A;  2XCA A;  2BJ9 A;  5J2P B;  1VQK S;  3MAH A;  4L75 A;  2R7V A;  1Q86 T;  1RT5 B;  1R6V A;  1WDT A;  3H59 A;  1N5Q A;  3PZP A;  1QSL A;  3EM1 A;  3HVR A;  3EQN A;  2EK6 A;  1Z2Z A;  3X3U A;  3QAU A;  2VB6 A;  2HBY B;  1VLO A;  2WVB A;  3IGN A;  1N36 J;  3IP0 A;  1V3Z A;  2DGQ A;  3DFE A;  1Y3K A;  1FT8 A;  5DQG A;  1UJ5 A;  2DR8 A;  3DOL A;  2CPH A;  3ILO A;  1QRC A;  3ILJ A;  2UUA F;  3CCW A;  2C3M A;  2HAI A;  1NEE A;  5C1C A;  4A8X A;  1VBZ A;  2E9T A;  2RU3 A;  2DO0 A;  1GXU A;  1R7I A;  1U7L A;  3TAR A;  1FVS A;  4GKK J;  3NWR A;  4KJI A;  1NKE A;  4PRF A;  4Q2M A;  2RRA A;  2JVR A;  3QRQ A;  1KQK A;  3MUT P;  3PEH A;  2ZUG A;  3VF0 B;  4WFB Q;  4OJH A;  1TEL A;  3EPG A;  2FHM A;  3U1L A;  5HBM A;  2HHH J;  2K1R A;  3DM2 A;  5EGY A;  1NB7 A;  3D6T B;  3AJD A;  4URR A;  4OHY A;  3EZ5 A;  2DGS A;  4F4Y A;  3H09 A;  2UZA A;  4J91 A;  1RWX B;  3TO8 A;  3D1H A;  3IWN C;  3PW0 A;  2L3M A;  2ZKT A;  4QIG A;  4OMF G;  1OS5 A;  1FA0 A;  2ZEJ A;  2QYG A;  2D3O R;  1U02 A;  4JV5 F;  1UEV A;  2QY1 A;  1KR4 A;  3AJ2 A;  3HCX A;  4U49 A;  1S72 S;  3W63 A;  3M9N B;  3GQ7 A;  2AQ4 A;  4F02 A;  5SUH A;  4DR4 J;  2V4Q A;  4F04 B;  3N5B A;  4NLD A;  1WI8 A;  1KDN A;  3RGI A;  2JEG A;  4LQ3 A;  1TAQ A;  2RKI B;  2ZBP A;  3L7P A;  3E3X A;  4IG3 B;  3Q8U A;  4TLQ A;  4CH1 A;  2YWE A;  4LBI A;  3HZG A;  1SJR A;  2FJE B;  1X0F A;  2XT4 A;  3IA0 A;  3OLA A;  1KHV A;  5CCM A;  3PTW A;  1TU0 B;  4XK8 C;  3GJQ B;  4ZJQ A;  2VFM A;  1EX8 A;  4ILM A;  1YDL A;  1AFI A;  1IR0 A;  3RIQ A;  1FK9 B;  4F67 A;  4ILL A;  2C3P A;  3J80 Y;  2R7S A;  4XON A;  2V2Z A;  3QGH A;  2HWT A;  1TSP A;  4MIA A;  2LFV A;  1O51 A;  5C25 B;  2ZFH A;  5A8W A;  3MAQ A;  2NXE A;  3HPO A;  3HT3 A;  1OFL A;  1RU4 A;  4IQM A;  3HHL B;  1NCL A;  5K20 B;  2NXJ A;  2L9D A;  5KFB A;  2VC1 A;  2W9C B;  1HMV A;  4ED2 A;  2RU9 A;  5M2U A;  4OYX A;  3H98 A;  1P1L A;  1T02 A;  2VQF F;  2HGL A;  1HNW J;  4P71 A;  3AY0 A;  1TV6 A;  4TQR A;  1QE1 B;  2HRU A;  2HUR A;  4B17 A;  1VYA A;  4Q8E A;  2I8E A;  1NPK A;  2GO8 A;  5ETO A;  5KFG A;  4JRA C;  2PA3 A;  1RWW B;  1JXV A;  2J9C A;  1AT1 B;  3ZO7 A;  2DIS A;  3NCQ A;  5B0A A;  2M5Y A;  2DXE A;  3K7R A;  4B3R F;  1SL1 A;  3T3F A;  3LUY A;  4DR6 F;  1V5V A;  3BO4 A;  1HR0 F;  2D41 A;  3NWG A;  4HKQ A;  4OI4 A;  1HNI A;  1AB8 A;  4JV1 A;  2GQC A;  4J9L A;  5KFW A;  4LVO P;  4DN9 A;  1RYS A;  2VG6 B;  1PO6 A;  3M8Y A;  1LWE A;  4DCO B;  2J76 E;  4XOT A;  3H5X A;  1FRX A;  5DZ7 A;  1VIO A;  3NMR A;  3MF5 A;  2U1A A;  4QW8 A;  2J7U A;  3MD1 A;  1TR0 A;  5LT5 A;  2AMC B;  2BM4 A;  2BAC A;  1VR6 A;  4HHJ A;  1VC6 A;  1IKW A;  3BSN A;  2YWG A;  4WXO A;  1B7Y B;  1TL4 A;  3KUH A;  2YNI B;  1ZZF A;  5F8I A;  4B08 A;  2Q79 A;  4KHM A;  4B9M A;  4IG0 A;  1S97 A;  3Q8P B;  2C2O B;  1JLQ A;  4N47 A;  4RJV A;  2FJX A;  3B90 A;  5CZV A;  3DRP A;  2J7W A;  1WC5 A;  4AVZ A;  2IBK A;  4LSN B;  5ADZ A;  3M6W A;  1GMV A;  2E5I A;  2KL8 A;  4LRE A;  3CED A;  2EVZ A;  1VC0 A;  3NNA A;  1QJV A;  4FXV A;  1T9T A;  5JJB A;  4B3T F;  3H0P A;  2P5V A;  5IQ6 A;  2KYZ A;  3BZQ A;  2GVD A;  1Q79 A;  3X1L B;  1ZM3 A;  5D3G A;  4ID8 A;  2F4F A;  1KFD A;  4J9P A;  2GHW A;  3FC9 A;  4C8M A;  1HNV A;  4F0M A;  1SV5 A;  1LWF B;  1JQG A;  2ZE2 A;  3I9V 9;  4QYZ J;  1NDK A;  1UTA A;  3A3N B;  1X4B A;  1S6Q A;  2F5G A;  4EZ6 A;  2DRB A;  5GAG I;  1JJC B;  1PBA A;  3OVB A;  5EWF A;  2MGZ A;  1H98 A;  5DS7 A;  2L41 A;  2UU9 J;  2QSF A;  1BD6 A;  5ETN A;  1NSA A;  4O23 A;  1N33 J;  1HLW A;  1Y0H A;  2ZD1 A;  4LF8 F;  1IDJ A;  3RBE A;  1PG5 B;  5AXK A;  2EFQ A;  2NZC A;  5EDW A;  4TQS A;  4DCP B;  4JI0 F;  2RH3 A;  3AQP A;  3OR2 A;  3LH2 S;  4Q8F A;  1OSC A;  4XOP A;  4RZR A;  1GAO A;  2ROP A;  3HFZ B;  5C7P A;  4A8Y A;  2VJV A;  3IAM 9;  1EIY B;  1VHF A;  2Z30 B;  4RL1 A;  2WZ1 A;  3AD9 C;  1JLF B;  2QIF A;  3FBE A;  2W1B A;  1IWA A;  4XDC A;  4PZV A;  1XMB A;  4ES3 A;  4ZLP A;  4NEZ A;  2QGF B;  4LFC F;  2K3K A;  3SV3 A;  2DY1 A;  2DT9 A;  4NLX A;  3CCL S;  2YKM B;  1QVG R;  1CS4 A;  3GYX B;  4PYD A;  2H3E B;  4Y00 A;  5CAB A;  2QMU B;  2WSE C;  1T05 B;  3CGI A;  4IH6 A;  4P7V A;  4XO0 A;  1QQ1 A;  1JX4 A;  1IKV B;  3MUV P;  2DNR A;  3LP1 A;  3DI6 B;  2HHV A;  2YNG A;  4KYZ A;  2HNZ A;  4DWI A;  3MOZ A;  5KT4 A;  2IA0 A;  3KOA A;  1T3N A;  4B3M F;  5B0F A;  5A2Q U;  2ILY A;  2HW3 A;  2CJX B;  1S77 D;  3M2U A;  4X62 J;  4I64 A;  4I56 A;  4DI6 A;  1JKH B;  2CDR B;  3G8Q A;  2ZZM A;  3QT6 A;  2WOM A;  2GIR A;  1TUW A;  4F2S A;  1LOU A;  3MM5 B;  4HLB A;  1GH8 A;  3O1L A;  2FGC A;  3G87 A;  2FZG B;  2ADB A;  4Q7A A;  3B78 A;  1QSS A;  4GO7 X;  1HI1 A;  5DG8 A;  4ZIW A;  2CDQ A;  2LQJ A;  1S6U A;  4H4O B;  4K5S A;  2QLJ B;  4FPR A;  4LF5 F;  1GQ8 A;  2J6T A;  3ZZZ A;  1PJ5 A;  4K4Z A;  5KFY A;  1DQ8 A;  1ZAW A;  4NA1 A;  2LU2 A;  3BBC A;  4DV2 F;  4DR1 J;  1ZM4 A;  4ZHR B;  4UOC A;  3DLK B;  4DR2 J;  1ROF A;  5M2P A;  5C2C A;  3QPI A;  3WX4 A;  2M8D B;  2WW8 A;  4ED8 A;  4DUT A;  5HMW A;  1OY9 A;  1F9F A;  1KVK A;  3EPI A;  1WG4 A;  1HI8 A;  4GVL A;  3HJV A;  2OSQ A;  4USW A;  2U2F A;  1WC0 A;  2CUY A;  2AD9 A;  1X4C A;  4UST A;  2AIR B;  1TZ0 A;  3LWL A;  4LRB A;  3RW7 A;  3NAH A;  4CIO A;  1AIR A;  2X1A A;  3OSN A;  3KLG B;  2DH8 A;  2IRY A;  3KG1 A;  3C8Y A;  2YQ3 A;  4QPT A;  2CQ4 A;  2HQG A;  4YCQ A;  3CO0 P;  1I1G A;  1I3O B;  5IC4 B;  2A2C A;  5BYR A;  1N8R T;  2I1R A;  1U6Z A;  3PIP Q;  2ALZ A;  3JSM A;  2F40 A;  3OL6 A;  2ZOG A;  4WPA A;  2LXF A;  1D1U A;  3NS7 B;  1FWP A;  5CYM B;  5AXN A;  2RIJ A;  2W2P P;  2EI5 A;  5H9E J;  4V1A k;  2DNZ A;  3A13 A;  5HQM A;  3GQA A;  2ZH9 A;  4DV4 J;  1VBX A;  4YB7 A;  3T5J A;  1N5Y A;  4Y3C A;  4LF7 F;  3E01 A;  5LXR A;  3AA8 A;  3BEG B;  3QRP A;  3TAQ A;  1JLA B;  2NTQ A;  4ERD A;  2E9Z A;  5KFK A;  1OFE A;  4LF4 F;  2HFS A;  2J0Q D;  3KMQ A;  4WXW A;  3W7B A;  4LSZ B;  3DRR A;  5M2R A;  1EHW A;  2EXU A;  4CO2 A;  3F44 A;  1M1K T;  4QWD A;  2YXL A;  1FDN A;  1UVM A;  4JBC A;  4C3K A;  2X3D A;  2Z0G A;  2OMO A;  1RWN B;  1NK5 A;  5KG4 A;  2HKE A;  4YY3 J;  2O04 A;  2JOQ A;  3THV A;  2M9K A;  2B5J A;  2EFO A;  1GX5 A;  1UEU A;  3IG1 B;  4RW6 A;  2BM1 A;  3Q8Y A;  2KXF A;  2IFX A;  4WFX A;  1HL6 A;  4JI3 F;  4EW9 A;  2MLZ A;  2V50 A;  2Z2Y B;  5ETP A;  3BDP A;  4I2Q A;  3IMQ J;  1S79 A;  4KHP F;  3LGM A;  4LF9 F;  3D3C J;  4CO3 A;  5E0O A;  5HAN A;  3HO1 A;  2VFS A;  1WF1 A;  4PQA A;  1JLE A;  4NI2 B;  4RW4 B;  3BSA A;  1RT3 B;  3ICL A;  4KHR A;  4PG5 A;  3D67 A;  3BF4 A;  1YZ6 A;  4LRA A;  2XC1 A;  1G6B A;  2W7P A;  1VC5 A;  3DDN A;  5KOX A;  1WC3 A;  1FRH A;  4LFA J;  4U95 A;  4QZV B;  1SVD A;  3R6L B;  1RA6 A;  4X64 F;  4OJP A;  3DRS A;  4DSI A;  2VFV A;  3EVO A;  3E2E A;  2XEX A;  2N82 B;  1DJ0 A;  1V3R A;  3MR2 A;  3WQP A;  4MKA A;  1VRQ C;  3W62 A;  2H9Z A;  4LF2 A;  3GR0 A;  4ITS A;  1YBT A;  1MU2 B;  1AZS B;  2VKR A;  4QWC A;  1YK9 A;  3IR6 B;  1RAD B;  1IKX A;  5A8R B;  3WHI A;  3Q8S B;  4ELV A;  2HBZ B;  3E51 A;  2KFN A;  3GJS B;  3NEK A;  2FVQ A;  1VQ6 S;  1MWQ A;  4DQR A;  3VAL A;  2MSS A;  3QID A;  3T1H F;  1E6Y B;  3KLV A;  3FMB A;  4Z7Y A;  3DU1 X;  4DV1 F;  2XY6 A;  5HI7 A;  1IR2 A;  3TP2 A;  3SYZ A;  1U6F A;  4X66 F;  1O8G A;  4X4V A;  4EBD A;  2KJW A;  2KXN B;  3G71 S;  4KR0 B;  4OZJ A;  4B3S F;  4CP5 A;  5I3Q A;  2CJY B;  1EJ7 L;  4JB8 B;  2BMB A;  5CYQ A;  2HGM A;  2B8Q A;  3D6H B;  1OWX A;  3NMA A;  2JC0 A;  1OO0 B;  2DNH A;  2W7Z A;  1Q0N A;  4X84 A;  3CJK B;  1ZOT A;  2YQ1 A;  1NJX A;  3LYC A;  4AE5 A;  2R8J A;  1N34 J;  2WBM A;  3CDE A;  1OMS A;  1NSK L;  4IRK A;  2UUB J;  2YH0 A;  2F63 A;  2DK2 A;  2CWX A;  2HLT A;  2V8P A;  4USH A;  4Z37 A;  4TY8 A;  5ETR A;  1LLW A;  2CQ3 A;  3TX0 A;  4C98 A;  5LMN J;  1SKU B;  1WOO A;  1WTB A;  4WYL A;  1Q95 G;  2NYH A;  5GAD I;  1KLM B;  3ADA C;  4GMK A;  2PMH A;  1FX4 A;  3D7S B;  1NME B;  3JAM U;  2Z56 B;  1RAG B;  4JI1 F;  5KFH A;  1R27 B;  3JS9 A;  4CLT A;  4NXN F;  2XG8 A;  4J9M A;  2VD3 A;  4XN0 A;  1LW0 A;  1ZH5 A;  3ET6 B;  4N76 A;  5F0W A;  1S1T B;  1FRM A;  1RT1 B;  2OFG X;  3V2U C;  4ZP7 A;  4C3L A;  2XGQ A;  3FVY A;  4DX6 A;  1LLZ A;  1DBG A;  4XTT A;  2AKW B;  1HHT P;  3SCK E;  3D4J A;  1CQN A;  2V8G A;  2WAQ D;  3HSG A;  3IC1 A;  1YIJ S;  2IVY A;  1KNZ A;  4C8N A;  1RWO B;  2SXL A;  1TKD A;  1ZTT A;  2VG5 A;  2RB7 A;  5F8N A;  2IVF B;  4MT1 A;  4B9L A;  1KCD A;  3KWM A;  2RUS A;  4CM0 A;  3MM9 A;  4ZP9 A;  1NJW A;  3QLH B;  4Y2I A;  4LJM A;  2FLP A;  3MEE A;  3CUL A;  3W8G A;  4FXW A;  3PDN A;  3TR5 A;  4KC5 A;  4O3O A;  4ZIV A;  2XCP A;  1N32 F;  1C1B B;  2E29 A;  3I82 A;  2UVU A;  1P1T A;  2YUH A;  1S1U A;  4ZVP B;  1JLB A;  4B3O A;  3MMC B;  3FRZ A;  3L7U A;  1I5O B;  2QZA A;  3GFX A;  3MGJ A;  2BKO A;  3M1V B;  4OYI A;  2MQP A;  3JUR A;  3R1H A;  2ASD A;  4XAK A;  2F4V J;  2BJE A;  2MDA A;  4XKV A;  2OGU A;  2AEF A;  3NL0 A;  1S59 A;  3AH6 A;  1VS3 A;  4LRC A;  3CJS A;  1C1C B;  4DZD A;  4KRW A;  2BR0 A;  1H2V Z;  3SI8 A;  1XR6 A;  4DV7 J;  1M90 T;  2LEC A;  1X4E A;  3HHL C;  1I94 J;  1RXO B;  2NSB A;  3M2R B;  2W8L A;  5E3R A;  4LR7 A;  1WKL A;  4KGK A;  4PPZ A;  3BBF A;  1JLG B;  4YB1 P;  1TFW A;  4DV0 J;  3GYG A;  2GIF A;  1YKW A;  5GAG U;  4C8L A;  4ZKA A;  4F4W A;  2YKP A;  3M8P B;  1TUV A;  2O17 A;  2R8H A;  3FSI A;  1RMG A;  5DG7 A;  3GFH A;  1OIA A;  3R27 A;  2V63 A;  4ZPV R;  2OPR A;  4BHQ A;  3PIO Q;  1Q7L B;  3UR0 A;  3OJS A;  2C2E A;  3DYA B;  4X4U A;  4BC9 A;  2VQE F;  1S9E A;  3A8I A;  2W2O P;  4U67 Q;  2OI2 A;  2CNO B;  2AHO B;  2AV5 A;  2CFX A;  4ED6 A;  2HYI B;  2XB2 D;  3M9O B;  1OOC A;  1VRU B;  4KO0 B;  4MIB A;  1SC4 B;  1RTI A;  2XYH B;  1R0A A;  4R5P A;  3B6B A;  2B4V A;  2CQI A;  5KG5 A;  4YR0 A;  3G96 A;  3OL9 A;  3N5F A;  3AHP A;  1YG0 A;  3CME S;  5B0B A;  1FCA A;  3MPY A;  4NXM J;  1UWA A;  4UUX A;  4OJ1 A;  3PYG A;  3W2V A;  2HS4 A;  1RU1 A;  3IBW A;  5JVH Q;  2W4D A;  3FKB A;  3CJ3 A;  5J1N A;  3KLI B;  3LGN A;  2V6A A;  3KHR A;  2M70 A;  3H4B A;  3V4I B;  4F4X A;  5ITH A;  2HMI A;  5GAE I;  3FEY B;  1GTH A;  1KKH A;  5GVQ A;  3QSI A;  2LQ8 A;  4N7T A;  4OX6 A;  4W4M A;  3KJV A;  3FCV A;  3DOK B;  2OEM A;  3SSR A;  1P8G A;  2KG0 A;  2DR6 A;  4LFB F;  3EJM A;  1N0U A;  4AL6 A;  1NKC A;  1VBY A;  3VAH A;  2DGW A;  2MZS A;  3FBF A;  3A3P B;  3BB5 A;  3M8Q A;  3PRB A;  1AW0 A;  2NTP A;  1X5P A;  3H2U B;  4AQY J;  2V4R A;  1YSJ A;  2G0Y A;  4UTG A;  4KFB A;  4NLQ A;  1SI9 A;  1J5E J;  3DOL B;  4UY8 5;  2KN4 A;  4J7C A;  2DCL A;  1VQ9 S;  1NND A;  4WK1 A;  5KFM A;  4ZN1 A;  3M6U A;  4ED7 A;  1C2P A;  1OGO X;  2EKY A;  2YX4 A;  1ZET A;  4FBU A;  4YHH F;  4IDK A;  5HVF A;  1FVQ A;  1WKK A;  3CUN A;  2UUT A;  4JI5 J;  2HLU A;  4KKO A;  4NZ7 A;  1WJ9 A;  3N4W A;  4RW9 A;  1X9M A;  4PMH A;  2G0J A;  2UVW A;  1XN9 A;  5D77 A;  2HBQ B;  1RAC B;  2LA6 A;  2QYC A;  4JI6 J;  2K1R B;  5LXY A;  4ID5 A;  2M7S A;  1VQ4 S;  4DPW A;  1WOS A;  4B9S A;  5IT4 A;  4PG4 A;  4LF6 J;  3DM2 B;  4AXJ A;  4URG A;  1IVZ A;  3HVA A;  2GMJ A;  2QX0 A;  3W9I A;  3UNY A;  2LEP A;  2QA1 A;  1T11 A;  1REV A;  1YWX A;  2KFZ A;  5CYJ A;  1RJJ A;  2VG7 A;  2ZNY A;  2X6W A;  1SH3 A;  3GLJ A;  4NWB A;  3I56 S;  4JI8 J;  4DU7 A;  3G6X A;  2D3O 1;  3TA1 A;  3RUB L;  3CJR A;  2R7X A;  2BKP A;  1TYV A;  2BJ7 A;  1LM1 A;  4HH1 A;  3F56 A;  2BM5 A;  1UEK A;  3H40 A;  2GC8 A;  2EFN A;  5KG0 A;  3QT7 A;  1S1X B;  3Q24 A;  1WXR A;  4MK8 A;  1Q8L A;  3S1T A;  3VGT A;  4K50 A;  3HUL A;  2KT3 A;  4Z2X A;  2LMI A;  5HRO A;  1Q81 T;  1QCX A;  2XI2 A;  3VHQ A;  2JHE A;  4WE1 B;  1FDA A;  4G1Q A;  3N79 A;  1NZA A;  4ELU A;  1NDP A;  2B7B B;  2KRB A;  2MKS A;  4M95 A;  4NLW A;  1A0O B;  4USU A;  4X4S A;  2VQF J;  5B0C A;  3DOM A;  3C16 A;  1RLC L;  3RBZ A;  2PFD A;  4Y2M A;  3QFW A;  1O8K A;  1ZYQ A;  5MAO A;  2F8H A;  1N4L A;  5A8W B;  5KT6 A;  2VOO A;  2PFF B;  3P96 A;  2GMH A;  4CRJ A;  3ZZY A;  3M4X A;  1SCJ B;  1LFW A;  4XQF A;  3IFE A;  3LAM A;  4UQT A;  1TKX B;  4I2P A;  2GAH C;  1UJ6 A;  4HH0 A;  3D54 A;  4XLE A;  1HMV B;  1U1Q A;  9ATC B;  4XLA A;  2MJN A;  2I0X A;  2IOU G;  2Q3P A;  2PYG A;  4Q44 A;  4F3Q A;  4NLS A;  1HR0 J;  1T9U A;  4WFN Q;  1H2U X;  1RB0 A;  2CQC A;  4N41 A;  4FXD A;  2WW4 A;  2DTJ A;  3CTR A;  3ZZT A;  5DG9 A;  2N7C A;  3HHE A;  2PEC A;  4DL7 A;  3FSX A;  2GHV C;  3RBD A;  3CT9 A;  4K4V A;  3AXK A;  1IBM F;  3QNW B;  1MG7 A;  4B9T A;  2UXD J;  1TP7 A;  3U02 A;  1TQL A;  3FGV A;  4IFV A;  3I87 A;  4OHX A;  4J9S A;  3A12 A;  1RAO A;  4KV8 B;  2BW7 A;  1LK5 A;  4NZ6 A;  4GC7 A;  2XZD B;  3UCU P;  1S6P A;  2HND A;  5KT5 A;  2XWX A;  4ELT A;  1HNI B;  5D4P A;  3TNV A;  1KTV A;  4NCG B;  5EUH A;  2ODL A;  2B0G A;  1DQ9 A;  2OML A;  1K44 A;  2QMW A;  3R2C J;  1QSY A;  3MD3 A;  1LWE B;  2V68 A;  4QWB A;  3HHD A;  2ZH1 A;  4WF9 Q;  2VUG A;  3N6L A;  4JI2 J;  1UCN A;  5IC6 B;  1URN A;  4QWA A;  3JXO A;  1SJ3 P;  1XER A;  3LAL A;  1OY8 A;  2QA4 S;  2ZWO A;  4DL5 A;  1IKW B;  2O5D A;  4NZ0 A;  2HVD A;  5LOQ A;  5KOW A;  1HBM A;  3ZTS A;  2EW9 A;  4OZ2 A;  4KAI A;  1RBL A;  5G4D A;  2EPI A;  1FFG B;  3PW2 A;  2O1D A;  5IV3 A;  5DDP C;  4DCJ B;  1LKZ A;  3SQG A;  3LAN A;  2GQQ A;  4RU2 A;  4CZC A;  2QT7 A;  3MM6 B;  1UVL A;  4QU6 A;  2HSE B;  3JTP A;  1O8J A;  4ZVR B;  3MPW A;  3PHE A;  2CPJ A;  2K2P A;  2MLY A;  2NPI A;  4JOU A;  3EQO A;  3NP5 A;  4KH3 A;  2V8D A;  1NJZ A;  1HW8 A;  1PYO B;  4QIE A;  2PN6 A;  4H4K C;  4OLO A;  2PT0 A;  3KLF A;  1XMO F;  1NPP A;  3PFO A;  1FHT A;  5AXL A;  2F8M A;  3BO2 A;  3H20 A;  1RT6 A;  3CJ8 A;  2YX7 A;  3M8W A;  1Q8K A;  3EGV A;  5D3G B;  2B9Y A;  1TYW A;  2KZM A;  3DGP A;  1HNV B;  1HNZ F;  1JXL A;  2R2U A;  1SV5 B;  2ZE2 B;  3C14 A;  1SL2 A;  3OR1 A;  3TW0 A;  3MPU B;  3MR3 A;  2V2K A;  4RBT A;  5FJ4 A;  1S6Q B;  2CAD A;  2N3O A;  3GV7 B;  1HWJ A;  1NHV A;  2HFZ A;  1BQM A;  3PYF A;  2MGZ B;  2HBR B;  1WF2 A;  3OFF A;  4XLC A;  1S1V A;  1ZPW X;  2BM6 A;  2OEJ A;  1N88 A;  1GK8 A;  4DV3 F;  2KJV A;  3G2X A;  4I6Y A;  4RU9 A;  2ZD1 B;  4RBU A;  4XPC A;  4QR2 A;  4LBH A;  1V6H A;  2BV3 A;  3P5T L;  3ZZP A;  1FTR A;  5BJR A;  3OR2 B;  5IZH A;  4MTP A;  4RO0 A;  1FRK A;  4HHH A;  1IR1 A;  3QJJ A;  5KFV A;  5GAD U;  4JV2 A;  1NK0 A;  5AE2 A;  5HQ8 A;  4QR1 A;  2A3J A;  4XNF A;  1AUS L;  1NUE A;  2HHU A;  2YVS A;  4OI6 A;  4W92 B;  2QL9 B;  2LEA A;  1QUV A;  4GRS A;  2QLF B;  4GKJ F;  5A8K B;  3QGI A;  3NAW A;  2UV8 G;  1NK7 A;  2K06 A;  1RHM B;  2YBV A;  1R3N A;  4RLE A;  4B3M J;  2ZNZ A;  3BN7 A;  1RTD A;  1BQX A;  2XQC A;  1CS4 B;  1UVN A;  4QWE A;  4OJO A;  2R9L A;  3MM8 A;  4O3P A;  2YWF A;  2J8K A;  1F1B B;  3KXD A;  2NPF A;  1N6Q B;  3DRX A;  4FKY A;  4CCH A;  2RDI A;  1WNE A;  3LP1 B;  2X51 A;  2YNG B;  4AYB D;  3LGH A;  3S7R A;  3QGP A;  1DLO B;  1BXN A;  2IBO A;  4C8K A;  2VF3 A;  2ZHB A;  4ED3 A;  4TLR A;  2KZZ A;  3CJ0 A;  1E6V A;  2YKN A;  4W90 B;  2V8H A;  1NPR A;  2FPH X;  4X4N A;  1S6O A;  1RSC A;  2WOM B;  2XC9 A;  2MKC A;  1VQY A;  3LP0 B;  2VPW B;  3J81 j;  4IOA Q;  2YWH A;  1AUD A;  3HVW A;  1EZZ B;  4L3N A;  3AOC A;  4YR3 A;  4YME A;  4ZN3 A;  1B0P A;  4GC6 A;  4FYY B;  3GON A;  4IKA A;  1O8F A;  4CLS A;  4OZ3 A;  2RQ4 A;  3I0R A;  4R8U B;  4XN3 A;  4O0N A;  1BWV A;  2WK4 A;  1PSD A;  4WYW A;  2GA7 A;  1VQS A;  3P5B P;  4EGL A;  2F3J A;  3FZB A;  2QSW A;  2BAN A;  3G9C A;  4PXC A;  3T6B A;  2RIL A;  3DDK A;  2AJ2 A;  1TVR B;  3T5H A;  3CXC R;  4OYW A;  2HZV A;  3D66 A;  4P10 A;  2QE5 A;  4QYZ K;  1RKJ A;  4BS2 A;  1Y11 A;  4LF1 A;  2XMW A;  5A2Q Y;  3MM7 A;  2D3Z A;  3SEO A;  3SUC A;  1RQ0 A;  2ZM6 F;  4EK2 A;  4YFU A;  4JV0 A;  1C0U A;  1HBU A;  4CYU B;  3CCZ A;  3QO9 A;  3JSB A;  4DV6 J;  4L73 A;  3TJ9 A;  4V02 C;  2HRY A;  2GAG C;  1WTF A;  3U1M A;  4USI A;  3DC2 A;  1TL7 A;  5K14 A;  2ZHA A;  2DR7 A;  4BC7 A;  1HPZ A;  1KTW A;  4H4K A;  2NLW A;  1CC8 A;  2GML A;  5F8M A;  4QYR A;  3M8Z A;  4CTA B;  3JSM B;  1W2B R;  4XPE A;  3PR4 A;  1UPP A;  2K8G A;  5KT2 A;  5CAA A;  1ZM2 A;  1F5C A;  1YQH A;  3OD2 A;  2HK2 A;  2F1F A;  4K0K J;  2VJJ A;  2CQ1 A;  5DET A;  4FZV A;  3JX8 A;  4C11 A;  4AL7 A;  3CDU A;  4I7F A;  2XTJ P;  1MMN A;  1F3V A;  1FX2 A;  3T5K A;  1WMR A;  4NK8 A;  5ETS A;  5IT9 U;  4FF4 A;  4C0B A;  1UA0 A;  1QD1 A;  2XLJ A;  3TQE A;  4ZPW R;  3QZ7 A;  1N5Y B;  2H5I B;  3OXF A;  1FF2 A;  3E01 B;  4YP3 A;  1RCX B;  5J1E A;  1HQU A;  4AD6 A;  2LP4 A;  4J9R A;  1F3F A;  1J2V A;  3NNH A;  1Y5L B;  1QRB A;  2DY9 A;  3FK4 A;  4M8L A;  1IJF B;  2Y1J A;  1NDC A;  4FYX B;  4QPX A;  2HWH A;  4G1I A;  3BQ2 A;  2UXC F;  5GMD A;  4FYD A;  1R0C B;  3OTO J;  2Z4P A;  3N28 A;  3OLB A;  5F9L A;  4ZPT R;  3I4H X;  3ILL A;  5DZ6 A;  2XYG B;  5C2G A;  2B5J B;  3BH7 B;  2OHD A;  2P9G A;  4O3N A;  1DTQ A;  2PEB A;  4JI4 F;  1C0T A;  4DQQ A;  1B64 A;  2GZO A;  4IFY A;  3WC2 A;  2CPF A;  3PYE A;  3VQS A;  1WC1 A;  4H4M A;  5AXM A;  4YB5 A;  3ULH A;  2HAF A;  2JRS A;  2A6O A;  4I2Q B;  3NRB A;  3I5B A;  3EZU A;  3V6D A;  2QV6 A;  3Q2S C;  4OYP A;  1HNX F;  2C2R A;  2CZV C;  3GMG A;  2MLX A;  1EQM A;  1JLE B;  2IRX A;  5ETL A;  5FDL B;  3HVT A;  5LMU J;  1LWC A;  2DGU A;  5HAO A;  3A4T A;  2BDP A;  1CJK A;  1SC6 A;  4HDG A;  1R8A A;  1R43 A;  2Y1L B;  3IRX A;  2ZIT A;  3BYP A;  4ZVO B;  3JQK A;  5F3T A;  3DHW C;  3CCV S;  4ANE A;  4XDD A;  4KT0 C;  4I6A A;  4AL5 A;  1EKR A;  1XNR F;  4RNH A;  2QZ8 A;  5KT3 A;  2UVV A;  1SIZ A;  2HQD A;  3F73 A;  1X0C A;  2F3L A;  2Y0B B;  2UXB F;  1F6T A;  1PC5 A;  5CH7 B;  1L3V A;  4ZLL A;  1X5S A;  1IKX B;  1YIT S;  4B3S J;  1RAE B;  4P2S A;  4B9U A;  4CLP A;  1FRL A;  1UET A;  3KJQ B;  2B4P A;  8ATC B;  4B9N A;  2GV1 A;  2BSP A;  2V69 A;  2HHS A;  1HYS A;  2WSC C;  5H9E K;  4OX7 A;  1L3U A;  4X65 F;  4DX8 H;  1DBD A;  3QBC A;  4LR9 A;  1CLW A;  1J27 A;  3D0I E;  3BGF A;  3L7O A;  4ER8 A;  5HLF A;  2VPZ B;  3HK2 A;  5MLC V;  3GFZ A;  2P6S A;  4U9R A;  1YHQ S;  2CXE A;  4KPC A;  2AT1 B;  3BYR A;  2HK3 A;  3VGV A;  1FEE A;  5KFX A;  2XSF A;  5U47 A;  1RHQ B;  2VBE A;  2A10 A;  2RF2 B;  1A9N B;  1SQE A;  4ZVG A;  1K8F A;  4ZK7 M;  4ETZ A;  3CD7 A;  2CPE A;  2AU0 A;  4DF4 A;  5J2M B;  5FLX U;  2MST A;  2X6Y A;  5CD4 H;  1GXT A;  4TY8 B;  3K8V A;  3NGT A;  2ZVI A;  3WDO A;  2AJQ A;  2MKK A;  3VSU A;  1N36 F;  5I42 A;  3UI3 A;  3SSQ A;  4DFJ A;  2RQK A;  2NCK L;  3DGV A;  1M0S A;  1HBO B;  2FUG 9;  1IM6 A;  4QJV A;  2JC1 A;  1DQA A;  2VA3 A;  3UW0 A;  3KKF A;  1ZA1 B;  1ZTW A;  2ZOM A;  4TXS A;  1H80 A;  4I69 A;  2JNJ A;  3R5J B;  4RW7 A;  4YDD B;  2NUU G;  1LW0 B;  1R8B A;  3J80 U;  2YKQ A;  4GKK F;  3I96 A;  3HLU A;  1X9W A;  2VJI A;  1BGX T;  4P2F A;  4CLY A;  1VQO S;  2APO A;  3KYL A;  2MXY A;  2OPS A;  2XHW A;  5A6W A;  3L9Z A;  1YRT A;  5CQG A;  5KFC A;  2DBB A;  3TZW A;  5L1L A;  2CNL B;  1FEH A;  4DUZ F;  2HFU A;  2HWI A;  2YX1 A;  4PXB A;  3KK1 A;  2VBZ A;  2P6T A;  3MED B;  4EMD A;  4HTI A;  3PG9 A;  2RKI A;  2M8H A;  3HHN B;  5DLG A;  3MM9 B;  4IOC Q;  4PG6 A;  4IG3 A;  2N7Y A;  3MEE B;  3R5A A;  4USM A;  1UPM B;  3GSD A;  5IOL A;  3T1Y J;  2F9J A;  1FKP A;  2BUN A;  1FNX H;  2YNF B;  8AT1 B;  4KTQ A;  4DR4 F;  3GQ8 A;  1TL1 A;  2ZKU A;  1JLB B;  1U1M A;  3PRV A;  4B3O B;  1S1W B;  1NLK L;  3DNC A;  1FD2 A;  3G4S S;  3V6H A;  3QAE A;  4DL4 A;  2HQC A;  1IJE B;  2LDY A;  2P9E A;  2OTJ S;  2V9K A;  2M52 A;  3BJY A;  1Z4U A;  5KT7 A;  4MFB B;  4F50 A;  1Y10 A;  1C4A A;  2MQL A;  1RDR A;  1U1K A;  2C22 A;  1TK8 A;  5E3A A;  2B3T B;  3VAM A;  3TEH B;  2IJN A;  4DLG A;  4EO8 A;  4WP8 A;  3DXS X;  1V3S A;  3ZZU A;  1XC9 A;  3GR1 A;  4Y0F A;  1FXL A;  3EGN A;  3GFY A;  2EG1 A;  1H7X A;  2WBR A;  1Q78 A;  2B0R A;  2FHJ A;  3KK3 B;  3PX6 A;  2BW2 A;  2FZK B;  4RUH A;  3QJL A;  1Q8I A;  3D3B J;  2VQE J;  4FVC A;  3OUY A;  4OHZ A;  5HVH A;  5JVG Q;  4JYA J;  3ENQ A;  1FKA F;  3JSY A;  3ZZR A;  1IBL F;  1NK9 A;  3VCD A;  1RTJ A;  5JMN A;  3TUZ C;  1HNW F;  2OPR B;  2AYG A;  1SXL A;  3BV8 A;  1Y4Z B;  2C3U A;  3VVT A;  4ECU A;  2ADC A;  4NX9 A;  4U7C A;  1H38 A;  1S9E B;  3RRK A;  1IKY A;  3TH0 A;  3F0N A;  3PW4 A;  3BGU A;  2LXI A;  4P2M A;  2Z2L A;  3M6X A;  4HWV A;  2R8K A;  3GSI A;  5J2N A;  4FKX A;  3UPF A;  3H5Y A;  2OEK A;  2C2D A;  3HF5 A;  3QT5 A;  1ZS6 A;  1R0A B;  4R5P B;  5IM0 B;  5D4N A;  5E3P A;  4WII A;  5BR8 J;  5DGB A;  4DL3 A;  1FI4 A;  1WF0 A;  3KHL A;  2ALY B;  2WRM A;  2QFJ A;  1SL0 A;  2HPU A;  5L1K A;  2YNI A;  2DRA A;  2HVH A;  2H4Y B;  1VQP S;  1B99 A;  2VBK A;  1FE0 A;  2ZVS A;  3TZX A;  3W64 A;  1XNQ F;  1SIW B;  5KFQ A;  3K8W A;  1NAQ A;  3Q23 A;  2N4C A;  4FF3 A;  5E7O B;  3W2V B;  3VVU A;  3TX8 A;  1KRP A;  2Z2M A;  5HQL A;  1UA1 A;  5KFA A;  1EQ0 A;  1R31 A;  2H48 B;  4HEA 9;  2HMI B;  4NYO A;  1SH0 A;  3JTN A;  4PR6 A;  3AFG A;  5AJ3 J;  3KJV B;  1U1N A;  1YTY A;  2MQQ A;  1RTZ A;  3GG1 A;  2IYG A;  2XGP A;  5H9F J;  4YHH J;  1T94 A;  3QYY A;  1N5S A;  4A8F A;  4O44 A;  1D9F A;  2CQ2 A;  5C5J A;  4I0W A;  1H2T Z;  1FNM A;  3M8Q B;  2VIC A;  1OY6 A;  3FRY A;  4YFO A;  4OZY A;  1SBR A;  1B4S A;  2VBY A;  4H54 A;  3UQS A;  2DNL A;  4KFB B;  2YWW A;  3WWG A;  3QT8 A;  2K3I A;  4Q45 A;  2PI4 A;  2KHD A;  4CNZ A;  1PJ7 A;  4AFF A;  3MCM A;  3HP6 A;  1QTN B;  1K8A T;  2VDI A;  3TRG A;  2ABY A;  4M5H A;  2NS1 B;  1AFJ A;  1K1Q A;  2OD6 A;  3AJ1 A;  4KKO B;  4GVB A;  2AYM A;  5EX3 A;  4RW9 B;  2OSR A;  4UOH A;  4EU0 A;  2JLF A;  3R3T A;  1RT4 B;  1Y00 A;  2GX8 A;  2CYY A;  4ZP8 A;  3GRH A;  1XR5 A;  3C46 A;  2RHS B;  4MH8 A;  2W25 A;  4DV5 J;  4HT5 A;  3UE2 A;  3C6T A;  4ID5 B;  1TYX A;  3R7B B;  3PET A;  3WC0 A;  2ROE A;  2ZJP Q;  1HQE A;  1N33 F;  5BYS A;  2EC2 A;  1QA3 A;  4PKD B;  3IM9 A;  3BGR A;  5DLF A;  1QDU B;  3BN4 A;  2ZOF A;  4KB7 A;  2EEY A;  4A8O A;  2YKM A;  2XBP A;  2IHR 1;  1VIX A;  4CNY A;  3VAF A;  2FLN A;  1G2E A;  3BKT A;  4PCQ A;  1L3K A;  3NOG A;  1KON A;  2OIH A;  3D9B A;  4U96 A;  3DMJ A;  1PBU A;  4F26 A;  1MSW D;  1T8E A;  1HBN A;  2B7C B;  4MAK A;  1FKO A;  4F0H A;  4TYA A;  3TYT A;  1HFE L;  3NXZ A;  1JKH A;  4CLL A;  1QA2 A;  2RS8 A;  1OPI A;  3MM5 A;  4G1Q B;  1U1R A;  2B9W A;  2ZH3 A;  3GU0 A;  3Q2T C;  2AJ4 A;  1EET B;  2HNY A;  4OI0 A;  2FVC A;  4W8R A;  3SMZ A;  1KLN A;  2HFO A;  3DOM B;  3C16 B;  4H4O A;  4OZL A;  3CF5 Q;  1RP5 A;  4YB6 A;  1CPZ A;  2DPJ A;  4FS1 A;  2DNM A;  3Q86 A;  3OTC A;  1O8B A;  4NML A;  1TFY A;  1U1P A;  1L5U A;  4K4W A;  4ZS6 A;  3UFC X;  1YBU A;  5JXS A;  3MFI A;  3DLH A;  4X62 F;  1QTM A;  1Q1K A;  2E5G A;  4ZHR A;  3IS9 A;  1VJQ A;  2RT3 A;  4XM3 A;  1S7H A;  2R7W A;  3VAJ A;  2OO4 A;  4ZCL A;  4ZCM A;  4XLF A;  2WON B;  3HSD A;  1RWK B;  3I5A A;  1EA0 A;  3EGW B;  3SIP B;  5HL7 Q;  4HHU A;  3H7H B;  3W61 A;  3Q22 A;  2WVD A;  1FJG J;  1GT8 A;  4DUY J;  2DEJ A;  5E3C A;  2NSP A;  4M5K A;  4NRU A;  2B8P A;  1M5V C;  3TI0 A;  1FE4 A;  3EXY A;  3RR8 A;  4DR1 F;  4I68 A;  1V9O A;  4DR2 F;  1WHW A;  4P72 A;  5B08 A;  4IFV B;  2GJ2 A;  1RAA B;  2ZC4 A;  4N8O A;  4DR3 J;  1UFK A;  4I6W A;  4YEA A;  3D0H E;  1S6P B;  2HND B;  4IOB A;  3H25 A;  2VPY B;  2WSF C;  1KVJ A;  1NSQ A;  1X4G A;  2MQO A;  1VMB A;  3KHH A;  2Q43 A;  3IN5 A;  4DEZ A;  1I6J A;  4MXN A;  4C0H A;  2MTL A;  3UD3 P;  4XMY A;  2PD1 A;  4WCE Q;  2BAB A;  4C2L A;  1TTH B;  2BE7 D;  2F8E X;  2E7X A;  2Z2Z A;  1XMO J;  1WSV A;  1TKZ B;  1X7V A;  4LVN P;  2CKW A;  4ZPD A;  3MCS A;  1YJW S;  2FJD B;  1JLA A;  2RUG A;  3QJP A;  4MYT A;  4Z7C A;  1OSD A;  5D0R A;  2VA2 A;  3OVA A;  2BRL A;  2DNO A;  3CJ2 A;  2ZDO A;  2YKO A;  4TU8 A;  4MIW A;  4U8V A;  1CQM A;  4DSJ A;  2XNQ A;  3BS9 A;  4YDT A;  1ZM9 A;  5GAH I;  1HI0 P;  4WJB A;  4OYO A;  4DV4 F;  5L38 A;  1S0O A;  3AT1 B;  2VIH A;  3QWP A;  3KLF B;  1UKU A;  4P9S A;  5DQH A;  4N8N A;  2ZH5 A;  4ENO A;  4IH5 A;  2W9B A;  3TVK A;  2ZH8 A;  1L1I A;  4OI1 A;  1VDH A;  2KT5 A;  4YZQ A;  2QLX A;  3DGP B;  5DDQ C;  4DV3 J;  2F65 A;  1Q53 A;  4DR7 J;  2L9W A;  2ZHO A;  4ED1 A;  3C14 B;  3OR1 B;  2MZQ A;  3T1A A;  3DLJ A;  3KNG A;  2FJB B;  1VK8 A;  1BQM B;  4K7Q A;  4TNO A;  3ENW A;  3GJR B;  3OTE A;  1S48 A;  1D09 B;  4EUV A;  5KG7 A;  4MK9 A;  1IXK A;  1S1V B;  3DLG A;  2FLL A;  1XJW B;  1K0V A;  4MKY A;  4YY3 F;  3L95 X;  4NI2 A;  1RT3 A;  5DQI A;  4N56 A;  4M5J A;  1H0H B;  4EWT A;  4OYA A;  3MCN A;  3GYN A;  6AT1 B;  3A8K A;  3W9H A;  3PV8 A;  1YRU A;  4A4J A;  3FUY A;  4HL9 A;  3MTJ A;  3GCX P;  3N6Z A;  2VBM A;  1U8W A;  2OUG A;  4P75 A;  4DR5 J;  1QAJ A;  3T41 A;  3M7V A;  3KHG A;  2MHN A;  4CH7 A;  5IT0 A;  4NA2 A;  1XWL A;  4PXD A;  1XK8 A;  4HTJ A;  3TZY A;  1SJF A;  4OLP A;  1Q5Y A;  2B4O A;  4A8S A;  1RTD B;  3N9U C;  3R1L A;  4LFA F;  5A8R A;  1FTC A;  2KB2 A;  3MM8 B;  4RWX A;  4U7U D;  5LSR A;  3RW6 A;  3PM9 A;  3IXQ A;  1U49 A;  2NRE A;  1E6Y A;  4EBC A;  4KGM A;  2AW0 A;  1YJ9 S;  2C2N A;  2HHQ A;  2RAQ A;  4A8Q A;  3TOQ A;  2G1D A;  4TVA B;  3KTQ A;  2GVZ A;  1D9D A;  2UV8 A;  3GG0 A;  4NYZ A;  2DJW A;  1HD1 A;  1E6V B;  3IAS 9;  2LQ9 A;  3MR7 A;  5EWG A;  3KG0 A;  2UVR A;  1J5O A;  1ICE B;  1GNK A;  2RRN A;  4L72 B;  3L4B C;  1PAU B;  5HMX A;  1R8C A;  3ZTQ A;  2D74 B;  1WHY A;  3MEK A;  4ANC A;  2C2K B;  5F8L A;  2HQF A;  2XYP B;  4RKU C;  2G1H A;  2RNE A;  3CJK A;  1PAE X;  1T3O A;  3I0R B;  2DVI A;  4HI1 A;  1RHU B;  1PIL A;  2DNP A;  2VDH A;  1WC6 A;  1NSP A;  3PKY A;  1FNO A;  4URS A;  1K4Z A;  4NE9 C;  2BOP A;  1F0X A;  1EB0 A;  3PR5 B;  4ZP6 A;  4PG8 A;  1XMQ J;  2XMM A;  4KGV B;  2BAN B;  3IWX A;  1RT2 B;  3VGS A;  1MLA A;  2C2Z B;  4YOE A;  4J9N A;  3MPD A;  3LJY A;  5HP1 A;  2BBE A;  4NL5 A;  1APS A;  2XMU A;  2DNQ A;  3BQ0 A;  4PWD A;  1KLM A;  1VJW A;  5I3U A;  4ZVQ B;  1N34 F;  5B7W A;  2MKY A;  4J37 A;  2E7V A;  1IN0 A;  2HHW A;  4JI7 F;  2J8S A;  1YBA A;  2AEM A;  3KDO A;  2MQN A;  2UUB F;  2HS3 A;  2B9E A;  1JRG A;  1KHW A;  1TKT B;  1S49 A;  3TVZ A;  1PYT A;  1L3T A;  3PW7 A;  3ET6 A;  3OHA A;  4K5R A;  1KN6 A;  2PE8 A;  4E0D A;  3SY2 A;  2MKJ A;  3AB2 B;  5K14 B;  1S7I A;  3MUM P;  5LMN F;  3CDB A;  1RWM B;  3TAP A;  1U8S A;  3RB3 A;  1RI7 A;  1VQM S;  1RT7 A;  4YN3 B;  2E1M C;  4F36 A;  4IQX A;  1F60 B;  1N5T A;  1VHI A;  3P4U B;  2L08 A;  3Q0A A;  3D2W A;  2OPP A;  4NEY A;  4YS2 A;  2GW8 A;  4C4W A;  2LQ5 A;  2B6A B;  4E98 A;  1RWR A;  3I0S A;  4MJK A;  4Y2C A;  3K5M A;  4OZZ A;  3QIP B;  2EFG A;  4F8R A;  4WFZ A;  1A6L A;  2NYI A;  3FZ2 A;  2UUC J;  4A8M P;  3ITH B;  3G6E S;  4UY8 T;  1Z1Z A;  5J1E B;  1HQU B;  3UCG A;  3MMC A;  2BQU A;  4Z03 A;  4OM9 A;  1UWB B;  5KFP A;  1JLC A;  3LP2 A;  5EHH A;  2CNK B;  1OJ4 A;  3RG6 A;  3ZTR A;  3M1V A;  5CA5 A;  5KFI A;  3Q8R B;  4TN2 A;  1F2H A;  2EFV A;  3CWJ A;  3FQL A;  4HI2 A;  4TU9 A;  1TL3 B;  3C6U A;  4XL9 A;  1AYE A;  5T14 A;  2K7K A;  3ETO A;  1O8L A;  2BRK A;  4PXE A;  1OGM X;  1WEY A;  5FD1 A;  4RUA A;  1HNX J;  2MZJ A;  2AGP A;  2V2V A;  2CWK A;  2EBG A;  2OAU A;  1D3W A;  3E8O A;  1HQ2 A;  5IWA J;  5D0G A;  3RAM A;  5AE3 A;  3QMQ A;  3THT A;  3MUR P;  2QA2 A;  4L6V 3;  2F4V F;  3D5M A;  1C0T B;  4IFY B;  2JEF A;  1WAC A;  4NYP A;  3GJT B;  2GS8 A;  4H4M B;  5IT9 Y;  3ZZ0 A;  3C19 A;  2D7S A;  4FS2 A;  2DHA A;  3MHY A;  3V6D B;  2ZZN A;  1MRO B;  1D0E A;  4DV7 F;  5HJY A;  1RTH A;  1I94 F;  2W4P A;  3EX7 B;  1SB6 A;  3R7S B;  4ZIT A;  4DS5 A;  1K1S A;  3HVT B;  3AXM A;  4PQU A;  3M8R A;  2VON A;  1LWC B;  1RBA A;  2A6M A;  2J9D E;  3H8Y A;  1GX6 A;  2Y1R I;  4XOR A;  2JFD A;  3NCR A;  3IRX B;  4BLG A;  4DV0 F;  3HMJ G;  3DYA A;  2PA8 D;  1FWK A;  4AND A;  1JJ4 A;  2IM2 A;  4IR9 A;  2M3D A;  2LA4 A;  5J2Q A;  4KO0 A;  2A0F B;  9RUB A;  3NGR A;  3TVY A;  2ASL A;  1KC8 T;  1JWW A;  2X85 A;  2CQD A;  3MEG A;  3ZFV A;  3J7A 1;  1S9F A;  5DDR C;  5KFR A;  1VRT B;  1ZA2 B;  2VZ9 A;  1GFW B;  4NLR A;  4XLH A;  3I4P A;  4O3Q A;  2DHX A;  3GZ7 A;  4M5D A;  3LTO A;  1NHU A;  4I4B A;  4A46 A;  3AOA A;  1VQ5 S;  3OHB A;  2YQ0 A;  1U48 A;  3EVW A;  1XIQ A;  3HD1 A;  3KLI A;  4ECZ A;  1H7W A;  4O3R A;  4HVZ A;  4J9U E;  2CZ9 A;  1P27 B;  1HYS B;  2E1R A;  2FVR A;  4WU3 A;  2VFN A;  1YJN S;  4PG7 A;  4TYB A;  3H42 A;  3EGZ A;  2H5E A;  1SKW A;  4NXM F;  4BWJ A;  5HLF B;  2DNK A;  4USJ C;  3G82 A;  2XZW A;  1RLD A;  3A3O B;  3PJ9 A;  3D6F B;  5LM7 E;  3KRG A;  3TZZ A;  2DGO A;  3BQ1 A;  1CJU A;  2G0I A;  4FNI A;  3OFE A;  2C3O A;  3BH6 B;  2DO4 A;  2RML A;  1PJ6 A;  4DXL A;  3GCW P;  3P49 B;  2FHJ D;  3KK2 A;  2AX0 A;  2X3G A;  1SQF A;  2POK A;  3DLE B;  1M5H A;  2YTC A;  1Y7P A;  4ICL B;  2Q1L A;  2XM3 A;  3LQV A;  1KOH A;  2W2Q P;  5HMY A;  3B8Y A;  1ARO P;  3ILI A;  3RAX A;  1YJR A;  4OFZ A;  4AQY F;  2YPY A;  5I42 B;  1BY9 A;  4N77 A;  1J5E F;  3UN2 A;  1K73 T;  3VSV A;  3PRD A;  1IWG A;  1LFP A;  4RW8 B;  4DUZ J;  3TQ1 A;  4KSE B;  4DX7 A;  2DXF A;  4JI5 F;  4OYB A;  4RW7 B;  2COL A;  2IY5 B;  1QA1 A;  2BJD A;  3MEC A;  1SPB P;  2QXZ A;  1K5C A;  3VGU A;  2FHK A;  1BHN A;  5K8N A;  2H4W B;  2O0V A;  2I5J A;  3MOJ B;  2OPS B;  4JI6 F;  1KSP A;  2ACY A;  3NGD A;  1IM4 A;  3P8B B;  1NH8 A;  1NJY A;  1RHK B;  4LF6 F;  2CNN B;  2R8G A;  2XTW A;  4YEL A;  1LW2 B;  2VFO A;  3KK1 B;  3M32 A;  3B82 A;  5FLX Y;  1S1X A;  1MN7 A;  4E8U A;  1NO8 A;  3C66 A;  2JL9 A;  2NXU A;  3DKD A;  4OIX A;  2W4C A;  2KG1 A;  5CD4 A;  2K7J A;  2FVP A;  2GCF A;  3VAK A;  3N01 A;  4JI8 F;  2XMJ A;  2AYB A;  4WE1 A;  2RJZ A;  2QX3 A;  2R7O A;  1FKP B;  1UW4 A;  4JP8 A;  2CQB A;  2W2M P;  1TL1 B;  3ZNU A;  4PUO B;  2RVJ A;  1CLF A;  1HAR A;  3DN9 A;  2H54 B;  1TMM A;  2ZC3 A;  4QIF A;  2KRR A;  3NCP A;  2OKQ A;  3JYT A;  2ZBR A;  2XO7 A;  3HJF A;  1S4F A;  4ECR A;  4TY9 A;  5D0H A;  1YZ7 A;  5GAH U;  5LJ3 Y;  1VFJ A;  4IUF A;  3OPK A;  3TWZ A;  4ZVH A;  3BSC A;  3PJX A;  1TKX A;  2C1E B;  3HM9 A;  1T9W A;  2LYV A;  1MW7 A;  3UVJ A;  1S0M A;  2PC6 A;  3EIC A;  4J9Q A;  3CJ4 A;  1TAU A;  1IBL J;  1AA1 B;  3PHT A;  2N3L A;  2J6S A;  1U47 A;  3MMA A;  2KDO A;  3A1Y G;  2FY1 A;  3EXC X;  3OL7 A;  2ZUA A;  3LWM A;  3MZI A;  3HXM A;  3J7Y I;  1CSJ A;  3PX4 A;  3NBP A;  4C6A A;  3SCI E;  1HWK A;  1X4H A;  4OV1 A;  2DHH A;  1R89 A;  1R8H A;  3OUY B;  1DRZ A;  2I2Y A;  2CQP A;  2ERR A;  1RWV B;  3D68 A;  2BQR A;  1H74 A;  1T03 B;  1N0V C;  4HYK A;  4Q0B B;  2F7V A;  1N48 A;  4KV8 A;  2FVS A;  1RTJ B;  3BKF A;  4CWB A;  3CW2 C;  4NCG A;  2NSC A;  5KFS A;  2X6X A;  3UD4 P;  4ZPB A;  1N54 B;  3B4N A;  3UD5 A;  5E5N A;  2D1C A;  3Q8V A;  3UDE A;  1XNQ J;  2HGN A;  3L3C A;  3RYL A;  4K4S A;  1TMJ A;  4FP9 A;  1IKY B;  3GIL A;  2FJW A;  2MB0 B;  4NRT A;  1S10 A;  5E33 A;  2UXD F;  2VFT A;  3HI9 A;  5J2N B;  1FO1 A;  3IGV A;  1JK9 B;  2UUA J;  1DAB A;  4HAC A;  1TK0 A;  3MFH A;  1KP6 A;  4P7T A;  4CM2 A;  2O6W A;  1Z2L A;  2OD4 A;  3MMB A;  2AGQ A;  2PDA A;  2CJA A;  1YLX A;  2HG4 A;  3PO4 A;  1O8E A;  1U0S A;  1RAI B;  1Q4R A;  4RUB A;  4O4G A;  5CHC B;  1P6T A;  4NLP A;  2G13 A;  5RUB A;  4OZ5 A;  1S57 A;  3DU6 A;  3MM6 A;  4JI2 F;  3V5R A;  3ZTP A;  1XR7 A;  3CC7 S;  4URQ U;  7AT1 B;  4ECW A;  1VQL S;  4ZJO A;  3DLB A;  3QAT A;  2OPQ A;  2E5J A;  3D1O A;  3ZTO A;  4UF4 A;  4UZB A;  2O67 A;  1KTQ A;  3T19 A;  4F4Z A;  4LSL A;  2ZBQ A;  2Q66 A;  4JV5 J;  1SJQ A;  5HBM B;  2LVW A;  2FY8 A;  4O44 B;  2LEB A;  2H5J B;  1D8Z A;  4PWW A;  4Z06 A;  5D0E A;  2WCX A;  3CDA A;  5C24 A;  4FNH A;  3TA2 A;  3HFK A;  2HRT A;  2RRB A;  3RBX A;  4Y2A A;  3HSZ A;  1D9A A;  4I67 A;  2YWK A;  4CT9 A;  1JNZ B;  3US5 A;  3FBC A;  2KHC A;  3CMA S;  2DHS A;  3NS5 A;  3UDV A;  4ECX A;  2VOP A;  2BOA A;  1AXQ A;  4ETX A;  4OI3 A;  1NK4 A;  1VBK A;  4OYM A;  4YEJ A;  3FEX B;  4WWS A;  4GVB B;  2JEJ A;  2DPI A;  2HIY A;  4DFM A;  4ZVS B;  3RZA A;  3OXG A;  4ZVT B;  4Q2L A;  2IAJ A;  4NPO A;  3M2V A;  3H90 A;  3C6T B;  3LAK A;  1I51 B;  3W2W A;  2V94 A;  2GQ2 A;  1HQE B;  4ECS A;  1O88 A;  2KM8 B;  4RPF A;  4LUB A;  3CVK A;  5A8K A;  1WHV A;  1HKA A;  3O2I A;  1VQ8 S;  1CUL A;  5D4O A;  1BC6 A;  4W8T A;  3BGR B;  3CO9 A;  1DTT A;  3RTV A;  2GGP A;  1R6Y A;  4W8Q A;  1XG2 A;  1P9Y A;  2FC8 A;  1BQN A;  4I1T A;  2UP1 A;  4KIA A;  3QGG A;  1G7C B;  4C7Q A;  2IM1 A;  3LOU A;  4NLY A;  1N6Q A;  2B4U A;  2VH7 A;  3LF0 A;  4M1K A;  2KI2 A;  3BRE A;  3CB4 A;  4DG1 A;  3OSP A;  3HSJ A;  2VFR A;  2FLO A;  1TYU A;  3DMJ B;  2CAJ A;  3BGO P;  4KE5 A;  3K5O A;  3GII A;  1HBN B;  1DLO A;  4ZLN A;  2EWH A;  3H5U A;  5E41 A;  1FKO B;  3G6V A;  5HSP A;  4B3R J;  3IM8 A;  2ZZT A;  2HZC A;  1T95 A;  4R25 A;  4DR6 J;  5HJX A;  5HVG A;  4DSF A;  1TV6 B;  1WD6 A;  4QQB A;  4ATN A;  5THW A;  2R7T A;  1B70 B;  3QQC D;  3GB0 A;  1M1H A;  3LP0 A;  3MDF A;  1WUU A;  2AX1 A;  3H4D A;  4EI2 A;  1W26 A;  2HNY B;  3I9Z A;  1PC4 A;  2J9E A;  4G65 A;  1NU4 A;  3UN3 A;  4UOF A;  4DBQ A;  3RB4 A;  1U2C A;  2B56 A;  4R8U A;  3G6Y A;  2VBX A;  3AD7 C;  4G6V B;  1CJV A;  3ZPP A;  1FJC A;  1HW9 A;  1U24 A;  3IS9 B;  1SKS A;  5B09 A;  2V34 A;  3MWB A;  4GO5 X;  2D9O A;  1S0V A;  1JMT A;  1JXE A;  3PSS A;  4JUZ A;  5H9F K;  2BE2 A;  2RS2 A;  2E5L F;  1TVR A;  3MPV A;  4O0I A;  2JH3 A;  3H5S A;  5G0R A;  2DHG A;  3PSZ A;  1UJ4 A;  4DL2 A;  2R2R A;  2DEI A;  3OTD A;  4ECT A;  2XMA A;  4L76 A;  3G8S A;  4W8S A;  4A8W A;  3NGK A;  1MWY A;  4C3M A;  4IH7 A;  1PGZ A;  4X4T A;  5T7L A;  1U1O A;  2MZR A;  2ZBC A;  3KUE A;  4K4U A;  1VLY A;  3PY8 A;  5KFL A;  5KTQ A;  2Q6C A;  1JTA A;  2C2M B;  4CYU A;  4B3T J;  2ZJQ Q;  5DGA A;  1IBC B;  2XNR A;  4UW2 A;  4IG0 B;  4UZC A;  1JLQ B;  3R9L A;  1FJE B;  3MAA A;  2Y0S D;  3DRP B;  1V5I B;  3N6M A;  1CJT A;  4DSL A;  4CTA A;  2O01 C;  3IBF B;  4K59 A;  3BGL A;  3FEZ A;  3S01 A;  2IC3 A;  2IDL A;  4NLT A;  3MXH P;  4DN0 A;  3PYD A;  2BQ3 A;  1NKB A;  2CPX A;  2M0G B;  2GVD B;  4DV6 F;  1JJ2 R;  2MY8 A;  3RB6 A;  5JLV C;  3B8H A;  4F7V A;  4Y6I A;  4LF8 J;  3VMV A;  1KQS R;  1NZ8 A;  4JI0 J;  3J81 U;  2IMO A;  4FYW B;  1Q8B A;  1UVK A;  1PXZ A;  3KDN A;  2VJU A;  2Q6B A;  3AOD A;  3K5N A;  3C2P A;  4ES2 A;  2XS2 A;  2LLZ A;  4K0K F;  3B54 A;  4L3K A;  2GFF A;  2VV5 A;  3CC4 S;  2NZ4 A;  3EMT A;  2ATC B;  4V19 J;  2MQM A;  1U2R A;  2DKO B;  4XIU A;  2PSZ A;  3JB9 k;  3Q8Q B;  4LFC J;  2W9B B;  3FCH A;  2H51 B;  2AJ1 A;  3TUP A;  2QRR A;  1RA7 A;  2EG2 A;  1IBK F;  4PPD A;  3TAN A;  2BA9 A;  3LPE A;  1X5T A;  1CVJ A;  4W98 A;  3U1N A;  1FDD A;  5EN1 A;  1EZG A;  4DMZ A;  3W5X A;  1MWZ A;  3N6N A;  1WSR A;  4RBV A;  4K4Y A;  1DZ5 A;  3OTO F;  1DUR A;  3PAC A;  3DLL Q;  3HD2 A;  2OLW A;  1CG2 A;  1KS2 A;  4DPT A;  3KLH A;  2CVI A;  3DLG B;  2W8K A;  1U0H A;  3W65 A;  1LK7 A;  2E1P A;  2RE1 A;  5FDL A;  1F9E B;  4PAA A;  5L1I A;  1QAI A;  1T7P A;  4QOT A;  2LKZ A;  3D0G E;  3M6V A;  3SZE A;  5KG2 A;  3U7J A;  4ILR A;  2HNZ B;  2C42 A;  5D8H B;  2B9X A;  4LF5 J;  1WC4 A;  4K8R A;  2YNH A;  4M5I A;  2GJF A;  5E2Q A;  3M30 A;  2FYX A;  1SUQ A;  5D6G A;  1K0T A;  3M2U B;  3GV8 B;  4DV2 J;  1VCT A;  4HT7 A;  4WFY A;  2FJV A;  1KBR A;  4DS4 A;  4F25 A;  2XSJ A;  4EYH B;  2AZ1 A;  3W1Y C;  2FZC B;  1WEX A;  1WOP A;  5LMU F;  1QLN A;  2W01 A;  4WTY A;  4Y65 A;  3WZ0 A;  3T9N A;  4CLW A;  1EP4 A;  1OYD A;  2LCW A;  4DSK A;  2CQG A;  2CJ9 A;  2CQ0 A;  1EE6 A;  4U7U K;  4WP9 A;  3TAM A;  2ZDP A;  4DU8 A;  2V5H G;  1GMW A;  2V8V A;  1EAR A;  3C15 A;  2R2T A;  4YDX A;  2M88 A;  1YJV A;  3FFI A;  3MMJ A;  3CCQ S;  3GQ9 A;  2PI5 A;  3CCE S;  2YH1 A;  2NR0 A;  2XMT A;  3UCZ P;  3AB4 B;  2GVZ B;  2NZM A;  2XTY A;  4F0K A;  1RWU A;  1HWU A;  2VFP A;  5C42 A;  3LMW A;  3IWL A;  1OYE A;  2R42 A;  1J5O B;  1M5K C;  3BPS P;  2O0W A;  1UFL A;  4UOG A;  3PX0 A;  1PCA A;  2DH7 A;  2PMW A;  1S9G A;  2XY5 A;  2MMY A;  4EO6 A;  4NLG A;  5B0D A;  3HKZ D;  2DIV A;  2Y8W A;  1PE9 A;  2MJU A;  1KFS A;  1LEO A;  2RF2 A;  2OFH X;  4YR2 A;  2KVI A;  1WKJ A;  1IB4 A;  3HZE A;  4ZVU B;  3RR7 A;  3I31 A;  4JI7 J;  3IR7 B;  2XMK A;  1XEZ A;  2QL7 B;  4K4X A;  1U2F A;  1NB2 A;  3D28 A;  5J2M A;  1MMD A;  4DJB A;  2AWZ A;  4LF7 J;  6FD1 A;  4NLU A;  1HHQ A;  1WI6 A;  2HIQ A;  5HP1 B;  4LF4 J;  4D3G A;  1KCC A;  1VI7 A;  1LV5 A;  4PWD B;  3OFH A;  4RUC A;  5GMK a;  5I3U B;  1YJT A;  1B7F A;  3J7Y U;  1X0P A;  2XHC A;  2EC0 A;  1HBO A;  2VKZ G;  1R0B G;  1RE1 B;  2XLI A;  3MCO A;  2RDD A;  1DBO A;  2DH9 A;  3FNN A;  1UZD A;  4ECV A;  1VOM A;  3FY3 A;  4ZVF A;  1RHJ B;  1BE4 A;  2RSQ A;  4DZ6 A;  1B3T A;  4UQG A;  2G2O A;  2WVF A;  3V81 A;  3OVS A;  4NMX A;  4KY3 A;  1A7G E;  1ZPV A;  2XLK A;  2I38 A;  5BXI A;  1X5O A;  3DRR B;  3GP9 A;  4NCB A;  1T9X A;  1RT7 B;  3K2Y A;  5KFD A;  2E1A A;  4OX8 A;  4JI3 J;  2NTB A;  5IV4 A;  3M9M B;  2HS0 A;  3EVM A;  5GAE U;  2CPI A;  2R2S A;  3SQV A;  4ZPC A;  3SDE A;  4ZLJ A;  1YJ7 A;  2IQ7 A;  4EZ9 A;  2CIM A;  3MED A;  4QIV A;  2IJF A;  5F41 A;  4PAB A;  4DHV A;  2OPP B;  3W5Z A;  3UO0 A;  2DNN A;  4KHP J;  1HWI A;  2FGO A;  1EKS A;  4LF9 J;  3HFV A;  1LXN A;  4R0J A;  1URR A;  3I0S B;  1IQT A;  5K8P A;  2NT9 A;  3L09 A;  5HN0 A;  4RW6 B;  2XTX A;  2FJA B;  1U25 A;  3VQT A;  1YGY A;  2YNF A;  3T9G A;  5J1P A;  1O8M A;  3UW1 A;  1S1W A;  4UT4 A;  2NXC A;  2ZWP A;  4KGZ B;  5B0G A;  1JLC B;  3EWG A;  3LP2 B;  4X64 J;  1CEZ A;  5F8G A;  3K5L A;  3ONQ A;  4OHW A;  1PYS B;  2V4J A;  2ZBI A;  1KEK A;  3LA0 A;  3VZI A;  3FCW A;  3THP A;  4BBY A;  4MFB A;  2CZ4 A;  2O66 A;  4CO1 A;  2E1C A;  3CC2 S;  3POT A;  2Z58 B;  1GMU A;  3C6U B;  3T1Y F;  4DQP A;  3TA0 A;  3VV2 B;  5F0U A;  2IYI A;  5DJB A;  1O0P A;  2F9D A;  5DNS A;  4ECQ A;  3DRS B;  3O8W A;  5HAT A;  2MPU A;  4ECY A;  2OJ3 A;  3SCL E;  3T1H J;  5A0Y A;  4OX9 F;  3KK3 A;  3FMW A;  1W2I A;  4DV1 J;  4WKR A;  2LXU A;  4QIW D;  1FFS B;  3ISN D;  3JSR A;  2N4D A;  4CLU A;  4X66 J;  4J9K A;  1YJU A;  2R8I A;  5DM7 Q;  2ASY A;  3DRY A;  2Z8G A;  4B02 A;  1RTH B;  2DIU A;  3KLE A;  3CJT A;  3H2V E;  1FRJ A;  3CCU S;  2Y3Y A;  4PQU B;  3FSY A;  3SZ2 A;  5D15 A;  3VAI A;  2XMV A;  4FF2 A;  1X31 C;  3CCR S;  1KQ5 A;  5JMC B;  2BM7 A;  2GIQ A;  2ROG A;  4P73 A;  4ZPA A;  4JYA F;  4ZVE A;  4CO4 A;  4LIR A;  4KQZ A;  4YEI A;  2CPD A;  4RR5 A;  2HVI A;  5J2P A;  5J2Q B;  3GIK A;  4CH0 S;  4K2X A;  2FB0 A;  5ETQ A;  1RT5 A;  4LBP A;  1KWM A;  4IRD A;  5IM0 A;  1GTE A;  1FD8 A;  5CYQ B;  3MEG B;  3KJF B;  2AZ3 A;  3AD8 C;  2CG4 A;  2PMZ D;  4WIQ A;  1S5Z A;  1FWL A;  2UVE A;  1LWX A;  5HMZ A;  1O6X A;  3O44 A;  2NXN A;  4M5D B;  3N90 A;  2R4F A;  4CLK A;  1HD0 A;  4JI1 J;  4MKV A;  2FD2 A;  5D4L A;  2QFI A;  4NXN J;  2RD5 C;  2VPX B;  2OTL S;  4Y34 A;  5BR8 F;  1GQE A;  2LU1 A;  3KFW X;  3BPD A;  1RAJ A;  4RX6 A;  2V67 A;  4OYZ A;  3SYJ A;  2E5H A;  2HQI A;  3B4M A;  4WFA Q;  4EEY A;  1FJ7 A;  2NST A;  1OPZ A;  4C9D A;  1ACM B;  3W8P A;  2VU5 A;  2JFK A;  4BCA A;  5KFN A;  1DY3 A;  3G82 B;  3SFG A;  3MR6 A;  1W25 A;  2BX6 A;  1NJI T;  1CJU B;  2MZT A;  4M5G A;  3AQO A;  3CMQ A;  2YPZ A;  3EDQ B;  1RUS A;  3MI7 X;  4P2X A;  2AP6 A;  3QFH A;  3KK2 B;  4M5L A;  4DF8 A;  5AJ3 F;  5IFM A;  5KG6 A;  6FDR A;  5LSO A;  4DPX A;  4MYU A;  1XBW A;  1FER A;  7FDR A;  2HHH F;  2QTW A;  1JNR B;  1N32 J;  5KFU A;  3OQ2 A;  2PEH A;  1RYR A;  1RT4 A;  2AEJ A;  2QO3 A;  1SJ4 P;  2O1P A;  2VG5 B;  1GEH A;  3BR9 A;  2VL1 A;  3R97 A;  4C8Z A;  2FTR A;  3PXG a;  3VWS A;  3O6Q A;  4P52 A; 
#chains in the Genus database with same CATH homology
 4HR2 A;  3BBB A;  3SYJ A;  3LJY A;  2B8Q A;  3MPD A;  1K8F A;  1S57 A;  3RIQ A;  3P4G A;  1S59 A;  3B54 A;  3EVW A;  1W7W A;  3BH7 B;  2J8I A;  1XIQ A;  3ZTP A;  4OJP A;  2VFP A;  2VU5 A;  3SZE A;  1UCN A;  1HF2 A;  2G0Y A;  1B99 A;  1TSP A;  3EVO A;  2V5I A;  2W7Z A;  2B0R A;  3EMT A;  3FBE A;  3AK5 A;  3JX8 A;  4OJO A;  1KQ5 A;  3H09 A;  2B8P A;  5JMC B;  3GPA A;  3B6B A;  2BM7 A;  3FCW A;  2VFN A;  3LYC A;  2IOU G;  1BE4 A;  3EM1 A;  3R9L A;  3ZTO A;  3FC9 A;  3NGT A;  4WBF A;  2BX6 A;  4OJ6 A;  3BBC A;  3FBB A;  4UOH A;  4DZ6 A;  4FKY A;  1TYV A;  4UOG A;  4F4A A;  3VVU A;  1NCL A;  2HVD A;  2BM5 A;  4OJ5 A;  1NSK L;  4OM9 A;  3DDI A;  3ZTS A;  3NGS A;  1QA2 A;  5BXI A;  3ETM A;  2DXF A;  1NDK A;  2BM6 A;  1WKL A;  5IOL A;  3ZTR A;  2NCK L;  3GP9 A;  2HVE A;  3Q8Y A;  1WKK A;  4UOF A;  2AZ1 A;  1WXR A;  3BBF A;  1MN9 A;  3Q8V A;  3ENA A;  5CAB A;  1PKU A;  3VGT A;  1LEO A;  2BM4 A;  1QA1 A;  3G2X A;  3ZTQ A;  3PJ9 A;  3N6Z A;  3EVM A;  4DUT A;  1U8W A;  2DYA A;  4AND A;  2AZ3 A;  2DXD A;  3PRV A;  4EK2 A;  1WKJ A;  3VGU A;  1TYX A;  2VFQ A;  1NLK L;  4ANC A;  1QRC A;  1CLW A;  4OPW A;  3PET A;  1BHN A;  1QQ1 A;  1KDN A;  3FKB A;  3BH6 B;  1S5Z A;  4W98 A;  1LWX A;  4ENO A;  1DAB A;  4OJL A;  1F3F A;  1NDL A;  3VVT A;  2HUR A;  1VYA A;  3Q83 A;  1NSQ A;  1QRB A;  1NB2 A;  2DY9 A;  1QA3 A;  1NPK A;  3ML3 A;  1NDC A;  1PAE X;  1HLW A;  3NGR A;  4S0M A;  3EIC A;  3Q86 A;  1NDP A;  3N90 A;  4JRA C;  4V02 C;  2CWK A;  3FBC A;  4ANE A;  5JLV C;  3TH0 A;  3ELH A;  1JXV A;  1HHQ A;  2YUH A;  4KH3 A;  4F36 A;  3Q8U A;  4KPC A;  1NUE A;  3JS9 A;  3WX8 A;  3L7U A;  3FCV A;  1NSP A;  3EE3 A;  3Q89 A;  4FKX A;  3VGV A;  4DI6 A;  2VFO A;  2XC1 A;  1K4Z A;  1B4S A;  1TYU A;  4CP5 A;  1HIY A;  3NGU A;  2ZUA A;  1MN7 A;  1K44 A;  1EHW A;  3EJM A;  1ZS6 A;  2DXE A;  5C7P A;  1TYW A;  3DKD A;  2BEF A;  4C6A A;  4O0N A;  2F3L A;  2VFM A;  1BUX A;  3FBF A;  1NHK L;  1F6T A;  3VGS A;  1XQI A;  5CAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...