2BX6A

Crystal structure of the human retinitis pigmentosa protein 2 (rp2)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
311
Chain Sequence
KVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVLNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XRP2 PROTEIN
publication title Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transduction protein
total genus 103
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bx6A01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2bx6A02
2HVDA 3ZTOA 1WKLA 1HLWA 3VVUA 2AZ3A 3EJMA 1U8WA 4ANEA 3FBEA 4C6AA 2CWKA 3PRVA 1BHNA 1B99A 2HURA 3NGSA 3FBBA 3Q8UA 3Q83A 1ZS6A 3EMTA 1HF2A 3EICA 5C7PA 4S0MA 4CP5A 1K4ZA 1HIYA 2B8PA 4FKXA 1LEOA 1XQIA 1S57A 3VGTA 3R9LA 4UOHA 4DI6A 3BBBA 5IOLA 1MN7A 3ZTQA 3BH6B 3FKBA 4O0NA 3ZTSA 1KDNA 3L7UA 1WKKA 1S5ZA 2B8QA 3NGRA 3DKDA 3DDIA 3VVTA 4ENOA 3FCWA 3JS9A 3NGTA 1NHKL 1KQ5A 1LWXA 1NSPA 4KPCA 1S59A 4WBFA 3FCVA 3EVMA 2DXDA 2DY9A 3EVOA 4EK2A 2BEFA 1NCLA 2DYAA 4HR2A 2AZ1A 4ANCA 3FC9A 1NDPA 2DXEA 3BH7B 3WX8A 1NDCA 4V02C 1NDLA 3VGSA 1JXVA 1VYAA 1PKUA 1K44A 2BX6A 3BBFA 1NB2A 3B54A 3ETMA 1B4SA 1BUXA 1BE4A 3ENAA 3Q89A 1WKJA 1NLKL 3G2XA 1PAEX 4W98A 3ZTRA 1EHWA 1W7WA 3VGVA 1HHQA 3ZTPA 3GP9A 1F6TA 2VU5A 4FKYA 1NSQA 2NCKL 4F4AA 1NUEA 1F3FA 1NPKA 3Q86A 2B0RA 1UCNA 1NDKA 3VGUA 1K8FA 5CABA 4ANDA 3FBCA 3FBFA 2YUHA 3PJ9A 4UOGA 2HVEA 1XIQA 3BBCA 3EM1A 3Q8VA 3ELHA 1MN9A 3GPAA 4DUTA 3EE3A 3EVWA 3Q8YA 1NSKL 2ZUAA 4F36A 4DZ6A 5CAAA 3MPDA 4UOFA 3B6BA 5BXIA 2DXFA 3NGUA
chains in the Genus database with same CATH superfamily
4X84A 4USTA 2K2PA 3O6QA 1NBEB 2KT5A 4FDFA 1OGMX 5ETVA 3D1QA 2PEBA 1GQEA 2CJYB 2R7OA 1VBLA 1G2EA 1TMJA 3GJSB 2QV6A 2LCWA 3GFXA 5KFJA 3ZTSA 2JC0A 2XGPA 3M8YA 3A3PB 1KCCA 4TY8A 4LF7F 4C0HA 2VH7A 4OYXA 1RT3A 3QLHB 8AT1B 2VA2A 2ZBPA 1SQEA 2A1BA 1CULB 4EGLA 2W7AA 4DL2A 4HDHA 4GKJF 1YBUA 2ASYA 3CGIA 1C0TB 4QW9A 3VMWA 2ILYA 2MLZA 3BQ1A 2V2VA 1SC6A 1F6TA 4X65F 5D4NA 5KFPA 1LK7A 3QZ7A 2W25A 2X85A 1K8FA 3J7Z5 2KH9A 3JXOA 2HFZA 3MAQA 3D68A 4Q45A 4DV7F 1VRTA 1UWBA 5J1NA 1H80A 1MG7A 1XTZA 1N33F 1FNMA 3HD2A 2OFGX 4E0DA 2X51A 3CT9A 2XULA 2EK6A 1YDLA 5KFTA 3PYFA 2JEIA 3G9CA 1RZMA 2MTLA 3CCSS 3F44A 4DXLA 2BMBA 2BJDA 1VQNS 4OJHA 2HS0A 1U49A 2JWNA 2UUBJ 2UXCF 2WW4A 1YQHA 5B0AA 3K58A 2W7PA 2UU9J 1ROFA 2HZVA 4J9OA 1JK9B 1U1MA 3LMWA 4JI5J 1LFWA 4FNHA 1FDNA 5KFFA 4IFYB 2H48B 2XY7A 4YR2A 2DNLA 2XNRA 4B9NA 4M5LA 3HT3A 1G3OA 1OQ3A 1VISA 2DIVA 2DHAA 1SL2A 1NB7A 4RO0A 2R7RA 1KTQA 3B90A 2NXJA 4CLYA 4EO8A 4JI8F 4FBUA 2LECA 1FJGF 3M2VB 4URSA 2CNNB 3SZ2A 2BANA 1M1GA 5K8MA 3TA0A 2F8EX 4EYIB 4N76A 1XR6A 2BM0A 1H98A 3RIQA 2ZH2A 2OTLS 5DLGA 2R3VA 5A6PA 2VG5A 5KT7A 2HBQB 3HVTA 5HO4A 4O3PA 4ES2A 2OELA 3TAPA 3K7RA 3OTBA 3N6LA 3N9UC 4WBFA 3BV8A 1AFIA 3BO2A 4J9MA 3DDKA 1VC0A 3QT6A 5A6WA 4KHPF 1UKUA 2F40A 1XEZA 2GAHC 3PXGa 1IBLJ 3MR3A 4YB7A 1K0TA 4GKKJ 4C2MA 1C4AA 2BQUA 5HVHA 1Q5VA 3M7VA 3A3NB 4CYUA 1M5VC 2G4BA 3EXCX 2BE7D 4DUYJ 1LK5A 3M6UA 4WFXA 4DF8A 4ZPWR 1RWUA 2EFQA 3VHQA 2AZ3A 3C19A 3UNYA 3JYTB 1VQMS 1DQ9A 1EZGA 1L3VA 4XL9A 2AJ1A 1R8AA 3THPA 3G8QA 1HNIA 3I5BA 2G1DA 4WP8A 2B5JB 1FNOA 1FE0A 2B8PA 2X6YA 4DI6A 3KHLA 3DFEA 4OYPA 2ZC4A 4W4MA 1VBYA 4C48A 2MYFA 5I42B 3CO0P 3NMAA 2PMZD 3ILLA 3BPDA 3DHXA 1X4GA 2D9OA 4DR6F 3C6TB 3EVOA 4YOEA 2R8JA 2CPDA 5L1LA 3CO9A 2OMOA 2BDPA 5EDWA 3CC2S 4NI2A 1HW9A 3G2XA 3A8EA 4J9KA 1RAHB 2YH0A 3CDWA 2NR0A 1AFJA 1SVDA 2UVRA 2ROEA 2EG1A 2D1CA 3H20A 2VBYA 3QPIA 1VBKA 3UN3A 3Q8VA 3PX6A 5CD4H 3RB0A 1AW0A 1Y3JA 2HPUA 2RD5C 3ICLA 4NK8A 1LWEB 1S72S 3C15A 4B3MF 3MM8B 1KBRA 1Q7LB 2HVDA 1JXEA 2F8MA 3DHWC 1FK9A 4JI4J 1KRPA 1TL1A 3ZZYA 1RTJB 1MMDA 4KO0A 4P6QA 2C3UA 2VKRA 1FFSB 3FMBA 3PVXA 1IBMJ 4X2BA 4F3OA 2AHOB 2K7JA 4OYZA 4FNIA 1M1HA 3HDSA 1DURA 2OH2A 2V0NA 1KOOA 1EB0A 3DOLB 3IN5A 4XLHA 4O4GB 3KLEA 4DV5J 3NNCA 2XTXA 1QE1A 1KONA 4HT5A 2CQCA 3VGSA 2OPPA 1U6ZA 2DNRA 1SH2A 4X64J 3U1MA 1N5YA 1NPKA 4GVLA 5JXSA 4ANDA 1HQEA 1S7HA 3GG0A 1M1KT 2U1AA 1SH3A 1NK9A 4XQFA 4M5NA 4W8SA 4O23A 1TVRA 1TU0B 2YPZA 1S6QA 3M9MB 4JP8A 3GJTB 2MZRA 2K1RA 1SKUB 3C8YA 2OPRB 3IR6B 3RTVA 2CJ9A 4U95A 1KR4A 3CCZA 4IH7A 2VB6A 3TJ8A 1FX2A 4DU8A 1I5OB 2YWEA 4J9RA 2O1DA 3T1YF 1NJWA 5SZTA 5KFDA 3LAKA 3ZTQA 4DUZJ 4DR7J 1X0PA 3AY0A 2G2YA 1LXJA 4RW9B 4C0BA 3V6HA 2VBKA 4MKAA 3H4DA 3BDPA 3NLCA 4FS1A 2G0YA 3FRZA 5E3QA 1HNZF 2GIQA 3RW6A 3GJRB 2YWKA 5DO2A 4Z7CA 1SJRA 1Z4UA 1JXVA 1FDBA 3ISND 4V19X 1FWPA 3B4NA 2VKZG 4C8LA 1U0HA 2RMLA 4F04B 4F3MA 3CMES 4ILMA 2PD1A 4ITSA 2C1EB 1O8HA 1JLEB 4DSLA 3OR2B 3G6XA 2G1HA 3QT7A 5ETSA 4YDTA 3HCXA 2IDLA 3J7A1 4OZ3A 3UO0A 1XN9A 2L48A 1IKVB 3GFYA 4RL1A 1E6VA 3NCQA 1FJEB 3DLKA 2DGTA 3ZZOA 2RQKA 1Z2ZA 2VFQA 4NLQA 1G1XA 4RLEA 5C2CA 4XN3A 4HH0A 1Q7YT 2BSPA 2NUUG 3R9LA 3G6ES 2O5DA 3BH6B 3I9V9 3M1VA 1XWLA 5I3UA 2RVJA 1T03B 3AQPA 2CYYA 2NXEA 1EQMA 4CO4A 1WG1A 2LXFA 2CQ0A 3R2CJ 3PRBA 2LU1A 1F0XA 2R7QA 4DCJB 3M8RA 1W25A 3KJVB 3FMWA 2ATCB 2ATLA 3KK1A 2R8GA 3EM1A 1VK3A 4JRAC 4HTIA 5LMNJ 1MN9A 1PO6A 3W63A 4JI1J 4C3MA 5AJ3F 3DMJB 2GMLA 4EWTA 2YY3A 3W3SA 3SQOP 1BHEA 1JJCB 3LOUA 3ZTOA 1X4EA 2KDOA 4KSEB 2XLIA 1RACB 1HKAA 2RSQA 4MK7A 1H73A 4ZN3A 3P5TL 2RIJA 2DGVA 3ENVA 1N6QB 1V3RA 1WELA 4PWWA 4Y2KA 4ED7A 4OYMA 1FKPA 3HJFA 3V81A 2CQDA 2VA3A 5AXMA 1LWXA 4OHZA 1UW4A 2RKIA 3NAHA 4ZVOB 4TU8A 4AUKA 1AIRA 2AF6A 2V94A 1KWMA 1YWXA 4OQJA 2KFNA 3BH7B 1HWKA 1RWXB 1T11A 4RKUC 4F4XA 3J7YI 1I94F 1TYWA 4USKA 1FKOB 3M32B 3CDUA 3MMAB 1HR0J 3WDOA 2V4RA 3CCLS 5H9EK 1J27A 1XJWB 2R2RA 3M8SA 1Q82T 4JV0A 2VQEJ 1DBGA 2DB1A 3IRXA 1TQLA 1Y5LB 1F9EB 4ZJLA 3H90A 5K8NA 2QLWA 1S6PB 2JVOA 1TR0A 1JLGA 3QJPA 1NKBA 2GC8A 1RAOA 4TQSA 3AB4B 3OSNA 1B99A 1LOUA 2NPIA 4TN2A 1KVJA 2JH3A 1DTTB 3F73A 2O1PA 1P8GA 1VRUA 3VGTA 3GIIA 2NTBA 3PM9A 2F63A 2J9DE 2B8QA 4DV2F 1N0UA 1REVB 3K89A 3Q8QB 5F8NA 3F56A 1Y5NB 3UPFA 3PRDA 2DY9A 3NP5A 2I0XA 1T9UA 3PFEA 3GWCA 1NDCA 1UEVA 3OXGA 5D78A 1PC5A 1RLDA 5J2QB 3KLIA 3OVSA 2FDNA 1RT6B 3A4TA 5J1EB 2ZNZA 2KB2A 1U2RA 3FEYB 3M6XA 3O2IA 2YKMA 4KHMA 4F25A 5HVFA 4DDFA 2UVEA 5KFHA 1VGYA 3KLGA 4X4VA 3KLEB 3IRWP 3VQSA 2EXUA 5E0OA 2FJWA 4QU7A 1MNEA 3A8JA 4O44B 5D0EA 5LT5A 3BR8A 4JI2J 2RJZA 1HYSA 1TK0A 2CADA 3GYXB 3LP1A 4RWWA 3BGRA 4YN3B 1S10A 2MHNA 2AGQA 3FKBA 2HBZB 3D6FB 2JLEA 3BDEA 2R2UA 5HROA 3UD4P 1ZH5A 2WOMA 4N47A 3MUMP 4C2LA 3QT5A 1EP4B 3PACA 4LF2A 3RYLA 1S0MA 4LFCF 2YKOA 1LW0B 5FD1A 3VZHA 2IM0A 4K4XA 3JURA 3D67A 2KZZA 2M8HA 5HSPA 4QYRA 3HT0A 3DLEB 4P2MA 3MMCA 4L72B 4MAKA 4ZVGA 2MQQA 2O6WA 1W2IA 3E3XA 4Q8FA 1URNA 3NGKA 4K2XA 2WB4A 1HLWA 3SDEB 4J9VA 4L74A 1I51B 3TZYA 2DGXA 1TL7A 4AXIA 2A2DA 2GMHA 1VIOA 3P4GA 1FWLA 3DU6A 4DV1J 2HNZA 3CJ5A 5E7OB 3PW7A 4EZ6A 1RWVB 1F60B 5CXTA 1VQKS 1UVLA 3MDFA 3UI3A 2HHHJ 3EUNA 1QRBA 2R7WA 3WX8A 1IUJA 3HVAA 1VIXA 2CA9A 1TL5A 4KBIA 1O8MA 1N4LA 3ITHB 1NK0A 3NNHA 4B3TF 2A3JA 3HD1A 1DRZA 5IM0B 4J90A 4LSLB 4C0OC 4NOHA 3OLBA 5GAGU 1WMRA 3MTJA 4WPAA 2V69A 2E1PA 3FNNA 1S6OA 4W8RA 3TUZC 2FGOA 2NS1B 2YWWA 2XYPB 1M0SA 5I3UB 3BN7A 5T14A 3EDQB 4WU3A 1ZPVA 2BUNA 3G8TA 4LF9J 2HGMA 3ZO7A 3LO3A 4NMXA 1R27B 3BF4A 4X66J 3QBCA 2XYGB 4XDCA 4CLKA 4A8FA 3EYZA 2VG7A 3BSCA 4KQZA 4ICLB 5A8RB 3S01A 4ILLA 3UN5A 3KG0A 3ULHA 3TNVA 2JLGA 4O3NA 3FY3A 3DRSA 2FQQB 2CQ1A 3RBZA 2VBWA 3W2VB 3DRPB 4CTAB 3LF0A 3BGUA 3GJQB 3EX7B 4RU9A 2AZ1A 2C42A 1N34F 4DMZA 1ZPWX 2HMIA 4N5SA 2FHJD 3TZZA 1D09B 2UUCF 3KMQA 2E7WA 2LA6A 1SJQA 1TL3B 4AL7A 2OO4A 3MCSA 2RF2A 3JSBA 2BRKA 2ZHBA 3BB5A 1BXNA 1HG8A 2AWZA 1UEKA 3OT9A 4FXVA 4K4SA 1KHVA 3S6EA 4DN0A 4I64A 4F4YA 4WWSA 2BKPA 1IWGA 1APSA 2AYEA 5I3PA 3NGUA 1VQPS 3RRHA 1SQGA 3PZPA 2V2QA 2RRBA 3TX0A 1BQNB 1H2TZ 2BOAA 1HBNA 2M70A 5LMUJ 3D54A 4GVBB 4OX6A 2R7XA 4ED0A 3MCMA 2BM4A 1Q53A 2X6XA 3SCKE 4ZIVA 1WTFA 3W5YA 1IM6A 4PG5A 3QAEA 2MKYA 1FRXA 4CI0B 1NZ8A 2VBXA 2MQMA 1U1PA 4P52A 1R0BG 4IUFA 4LSZB 2H9ZA 4NLRA 2EFNA 3ETMA 5L8RC 1XMOF 3ZSCA 3NS7B 1TK8A 3FBCA 4RW7B 3D3CJ 4ZPVR 2F65A 3MAHA 4ZHRB 2DR8A 1HNWF 1FJ7A 4PG4A 2W2QP 3LA0A 2COLA 3LALA 2Q3PA 4H54A 3R3TA 3GQ8A 1R7IA 1QRCA 1RKIA 4PQUA 5M2UA 4DCPB 2FJDB 2IAJA 2P6SA 1WXRA 1YRUA 3GG1A 1GX6A 1PCAA 4KE5A 3NL0A 4ZPAA 3PDNA 2LQJA 2V8HA 4EBCA 2CRLA 3EPGA 4G1PA 2KFYA 3TUJC 2HQGA 1K0VA 2PYGA 1QAXA 4E2FB 2OMLA 3HHLA 2DEIA 1REGX 1GQ8A 4ECZA 1OWXA 1S1WA 4OI1A 3N28A 4KPYA 3W62A 4HR2A 2E5IA 1T8EA 2PI5A 3QSIA 2D41A 2HIQA 3DRRA 1O8IA 2OHDA 3POTA 2AEMA 2V63A 4B3RJ 1U26A 3FCHA 2DO4A 1WHVA 1HW8A 2DT9A 2RDJA 1KVKA 2I5JA 2UUAF 3JQJA 1Q86T 3BYPA 2B4PA 3DI6B 2JEJA 5FIIA 2HGLA 3MTKA 2W8KA 2RE1A 1BHNA 3US5A 5HJXA 4J7CA 6AT1B 1N8RT 3G82B 3RAXA 2O0VA 4X4TA 1U1LA 3ZXWA 5D0GA 2VQFJ 3HSGA 1SPBP 3H5SA 1SI9A 3M6VA 1VOMA 4F7VA 2XMWA 4C3KA 1YGYA 2QSWA 3NBPB 5HMZA 1KN6A 2QLBB 2BJ9A 1MSWD 2OEKA 1H72C 4A8OA 1G6BA 3JTPA 1SV5A 5IC4B 2W4DA 4ALZA 3M8QB 4I2PA 5IZHA 1NJXA 1JLAA 2IC3B 2H5JB 1T3NA 2VIHA 5M2PA 1Q0NA 1YRXA 3PO5A 2GW8A 4OX8A 1RT1B 4WIIA 2UV8G 1F3FA 3CCWA 2Z2YB 4M5DB 1TL7B 3DGPA 1UMJA 1EIYB 2CPJA 3KLFA 3I5AA 1WHWA 1XIQA 2B3TB 3N01A 2XMTA 3QZ8A 4KY3A 2ZM6J 4DSFA 3EXYA 3CCQS 3EE3A 4F4WA 1N5VA 3FK4A 1RADB 1P1TA 4BWMA 1U1RA 4K4YA 1IKYA 2RRAA 4O4RA 4RWXA 4Y6IA 2BACA 3MPWA 3IO1A 2ZH5A 2MKCA 4QBUA 5ETPA 4DR1F 1V5VA 4OZ1A 2RHQB 3LGNA 4HACA 3LP0B 5DLFA 1F5BA 2GQQA 3BGFA 4OFZA 3CTRA 3K59A 2P9EA 3AH6A 2DCLA 1SQFA 1M5SA 4DV3F 4YMEA 2GCFA 2OTJS 4LRCA 4YEAA 2C3OA 5E3RA 4B9MA 4XIUA 2K06A 4NA1A 3MMBB 3DM2B 1CZFA 2NSBA 4DV7J 1CLFA 4PCQA 2HQ3A 3K5LA 1L3KA 3TEHB 5I3QA 4FF1A 3AK5A 3K17A 4ECTA 1JJHA 4RUCA 1TUGB 2DXFA 4H4OA 1RJJA 1S1TA 3CVKA 2E1CA 2DGUA 4CT8A 2IM1A 4IG3B 1O8BA 5EX3A 2NXNA 1D1UA 2BR0A 1VQ8S 1X4DA 1QD1A 2QXZA 3SV3A 3GTYX 4OJPA 1HIYA 1YRTA 4ZCIA 1PE9A 5L9NA 1LM1A 3CIZA 2XS2A 4NLUA 4JI6J 4K59A 3OW2R 2DO0A 2X1FA 4F26A 4OZLA 2Z58B 4U6PA 4ZK7M 3LPYA 1DQAA 2MLXA 2GVDA 4MMOA 2HHPA 5F0WA 2D7SA 4CLTA 2V4QA 4DR2F 2CDQA 2GMJA 1RSCA 3HXMA 2FHOB 4HH1A 4WP3A 2C2NA 1M5OC 1WSRA 4JI0J 2Z8QA 1J5EF 3OTOF 1FJGJ 4CT9A 4G65A 2ZJRQ 2AYGA 1WOSA 4P72A 4ED4A 1KVIA 5EWFA 2J0SD 3PW0A 5KFKA 5FDLA 3OUYA 3JQMA 2KYZA 4OZJA 4ZVSB 4W8QA 1RBAA 4FPIA 2N7YA 1RAAB 4JV1A 3OLAA 4KGMA 3TA2A 5KFSA 5AXKA 2ZH4A 1IA5A 2PGCA 3QT8A 3KK3A 4BC7A 4QW8A 1ZAXA 3SSQA 4A48A 4KHPJ 4OZYA 2P5VA 2DXEA 4R8UA 1WF2A 3BREA 5A8WB 1VQ6S 2BJ1A 1CJTA 4ZCKA 2MQOA 3I82A 1S76D 4LSNB 1WORA 4CRJA 1XMQF 4PQUB 2OPQA 1U4BA 2W2OP 2FLPA 2N3LA 5L38A 1DFDA 4NK6A 3EGVA 3T9GA 4FN5A 4C9DA 3QIPB 3TVZA 3S7RA 2ZBIA 2R8HA 4JI3J 4OHYA 3VSUA 1X31C 4YR3A 2R4FA 1Y3KA 2DRDA 2QLFB 4PAAA 1QA2A 2XI2A 4I6YA 1FF2A 3UW0A 4C6AA 2VFOA 2Z57B 1NKCA 1RAIB 5GVQA 1GH8A 1Y4ZB 1K5CA 3FJ2A 2C3MA 1X9MA 2LKZA 5GAEI 2XZTB 2VASA 5LJ5Y 4RNOA 1KP6A 1RAGB 3MD1A 4KR0B 3TJ9A 3F0NA 3G71S 3AHPA 2AGOA 4AQYJ 3DDIA 3MF5A 1F2GA 2GQ2A 3FCWA 4DV4J 3KLVA 2I5JB 4KPCA 3MAAB 2MDAA 4YB6A 3CULA 2EFVA 4IKAA 1B0TA 2B4VA 1SC3B 5C5JA 1JLCA 4HWVA 2LEAA 2XTJP 5D0HA 2OSQA 3W9HA 5BJRA 3JTNA 1NH7A 2RILA 4NLTA 3JSMA 4RW6A 1HBMB 1T0TV 3BYRA 1EARA 3TW0A 2DNYA 2IA0A 4PR6A 3MPVA 4ERDA 1Q8BA 2DKOB 1T05B 4MYTA 1BQXA 2DR7A 2HW3A 2UUTA 3CB4A 2L41A 4OJ5A 1S1XB 2F1FA 1FFGB 5HL7Q 3CJKA 2RU9A 1C1BB 4YZAA 5B0GA 1HA1A 5D77A 1GK8A 3TWZA 2AT1B 1WOOA 2DIUA 3EMTA 2KTQA 4ATNA 3KK2B 2V6AA 2KVQE 2J9CA 3RBEA 2I6WA 4NA3A 4YDDB 1BC6A 2EEYA 4AXJA 3HO1A 4H4MA 4XPCA 3GIRA 4NPOA 4K0KF 5F0UA 4ZA1A 2QY1A 1UTAA 3AFGA 2R9LA 3M2RA 4IDKA 1HI1A 2W2PP 2YWHA 4UY8T 1RYSA 3BBFA 3GZ7A 1AB8A 2ZC3A 2CKWA 5DDOC 4DR4J 1IKXB 1NM2A 1VK8A 1VHIA 3IWXA 4DFPA 2AKWB 1PG5B 3C14A 2CVEA 2Z30B 4RPFA 3OFHA 1MU2B 4EBDA 3PEHA 2KL8A 2LLZA 3R1HA 4DHVA 4KHRA 4ED1A 3HKZD 1KQFB 4HACB 1Q78A 4ZPBA 2HVZA 3D6HB 2QIFA 2YNFB 1WNEA 4C3LA 1HMVA 3LH2S 3UDEA 4JUZA 3B78A 2ZHAA 4JI7F 3QQCD 4WTYA 3MM7A 4CLUA 3UCUP 1NHUA 1BGXT 5D15A 3W1YC 2GIRA 1RT5A 1S57A 4WE1B 3UWTA 4HHUA 3BO3A 4Z06A 2J0WA 3I31A 1JQGA 3WX4A 1T95A 1HNZJ 4NLSA 1B3TA 5EHHA 4M63A 2FYXA 4R5PA 2MY8A 4EK2A 5KG7A 1C1CB 3MFIA 4A46A 2BQRA 4YDXA 1NB2A 3Q2SC 1NXIA 1U8SA 4EMDA 1O8KA 2G0JA 3PW5A 4USIA 4LF8J 2VJVA 1BWEA 1BQMB 2AX1A 2XQCA 2WONA 4A8MP 1TFYA 3PFOA 1OSDA 4OZ0A 4RUBA 3K5PA 1IDKA 1WF0A 2E5LF 1RT4A 2KI2A 1UPPA 2GVDB 2ASLA 3T5LA 3CJ4A 1VQ7S 1WUUA 3W5ZA 1QJVA 2LEPA 3HJVA 1RWMB 3GIMA 2FD2A 3MM5A 2DNZA 3C46A 2R42A 1AROP 2PMWA 2E9RX 4TVAB 4NXNJ 4UOCA 3VVTA 1FX4A 2ZKTA 3RJMB 3M2UA 3OHBA 3BSNA 1IR1A 1HBUB 1KLNA 1YBAA 2DEJA 1NDPA 4XKVA 4XAKA 2MZJA 3I0RA 4DG1B 4ES3A 1VMBA 2WVBA 3MWBA 2B6AA 3A1YG 5FJ4A 2H54B 1S0OA 2Q79A 5DGBA 1M5PC 2BW7A 2MXYA 1LWFA 1U09A 5BR8F 1WACA 2YKPA 1U2CA 3MM9A 4ER8A 4ZVPB 2FJBB 4LUBA 3IS9A 3OV7A 2BJ8A 3GQ9A 1P9QC 3KK3B 4OX9J 4LF6J 3O3LA 3GE9A 1TYXA 5KOWA 2VJIA 4QPTA 3ZZTA 2Y0SD 3LWMA 2UVVA 1PYTA 1S1VB 1CJTB 3ISZA 1VQYA 2Q66A 1JKHB 1GMUA 3IR5B 1DBDA 2P6TA 1KDNA 1S5ZA 1FKAF 2OPQB 5IV3A 3JQKA 1VI7A 5LJ3Y 1RABB 3GR1A 4PMHA 3ZNJ1 2ACMA 1UW9A 2DCUB 4GO7X 2I38A 4JV5J 1U6FA 2DPIA 2W7OA 3H5YA 4V02C 2C2DA 3AD8C 2IIHA 2X1BA 4OLPA 3SQGB 2CJXB 5AXNA 3NAIA 1QDUB 1CULA 3AJ2A 5DNSA 2HFNA 2NCKL 1DBOA 1VC5A 3CXCR 1GEHA 1D8YA 4P2FA 1MW7A 1C0TA 4DX7A 4DV6J 4DPWA 5GMEA 4B9UA 2KN4A 2HFVA 2XMJA 2ZVIA 3UCZP 1V5IB 2J6TA 4U7CA 3R5BA 3NRBA 4HDGA 2XT4A 4WYLA 4OJ3A 3G96A 3KUHA 5B0DA 3OL9A 4ETXA 4ZKAA 1YZ7A 1DTQB 2J6SA 3GU0A 1OPIA 1JLCB 3BSOA 2NXUA 2HHXA 2PECA 4OMFG 4DV2J 2R7UA 5L1KA 4I56A 1MN7A 5HLFB 3P6YC 4ZVQB 4RW6B 4YFUA 3IWNC 2B9WA 4KKOB 2M9KA 4OHXA 4LFBF 5IT9Y 1NCLA 5KT2A 3F41A 1K47A 3SSSA 1TKZB 1T02A 1K44A 5MLCV 2QFJA 2Z2ZA 1OFEA 2IBOA 3ZTRA 1GMWD 4IFYA 3GP9A 5E33A 2UUBF 2J6UA 2J0QD 4YR0A 2NREA 4MFBB 1SJ1A 2UU9F 4NLVA 4JI5F 1UPMB 2CJQA 4URRA 4OZ5A 5ADZA 5T41A 2C3PA 2KZMA 4X62F 3E01B 4K8RA 3MEGB 3IBWA 1JLFB 1S48A 4H4MB 1XNRJ 3SCJE 2P9CA 4K4ZA 9ATCB 5A0YB 3R6GB 1HPZB 4Z03A 3NOGA 4ELVA 2CG8A 2WVEA 3M2VA 3KLHB 3ML3A 2LA4A 1X4HA 2GHVC 2ZHOA 2YQ3A 3SFGA 3KJQB 3NMRA 1XR5A 2XZDB 1WC1A 2O04A 1FRJA 2C2MB 1UJ6A 2BW2A 1Q8KA 4D3HA 2M88A 1I3OB 1WKKA 4P10A 2VBEA 1M90T 2HFOA 3NG8A 4V19J 4LT6A 4Y2MA 2BJ3A 2IHR1 4C8MA 2BE9B 5B0BA 4ZLNA 3MEEB 3UR3C 3K57A 3SY2A 2MMYA 2PN6A 3B54A 3FEZA 1YJRA 2HS3A 2UXBF 3RB6A 3C2PA 2V9KA 1GAOA 5GMDA 3G86A 3T9ZA 5KFMA 1AZSB 3L9ZA 3PHTA 2KHCA 2LQ8A 2DJWA 2ZZNA 2B56A 2FUG9 5U47A 4JBCA 3FZ2A 2VBMA 1D9AA 4DL5A 3WC2A 3QJLA 3EQNA 4F36A 2CPXA 1WF1A 1RWOB 5A2QU 2AMCB 1IBLF 1NHVA 2UVFA 3IXQA 1NRKA 1IJFB 4GKKF 4XK8C 4I7FB 3TVKA 5KFUA 4LRDA 2HHVA 2P9GA 1H6KX 4J9SA 1OO0B 2QMWA 2JC1A 3FRYA 3HSDA 3JYTA 2K3KA 4Q8EA 3OSPA 2QLJB 4DUYF 2B5JA 5ETNA 4CO3A 1XNQJ 4YZ0A 1RMGA 4J9QA 4LFAJ 2QFIA 2XCAA 3N79A 1S9EB 3MCOA 4NXMJ 3R7BB 3GV5B 4F4ZA 3PG9A 3T1AA 5I42A 2LXIA 1BN8A 3H2VE 2KXHA 3C6TA 3PEJA 2GJFA 1VQ9S 1RWNB 2QMXA 4TY9A 2EC0A 2O67A 4TYBA 1O8FA 5KFCA 2V5IA 3MFHA 4NL5A 4CLZA 3HHKA 4ELUA 2DNOA 2KXFA 5DQGA 3W60A 2HZCA 2FPHX 3H0PA 5C25B 1YX2A 1OJ4A 3QAUA 4DR3F 3QRPA 2PFFB 1ZOTA 3RUBL 5IWAF 2LVWA 2UP1A 2W2MP 4LQ9A 3HHDA 3CJ8A 3C16A 1LWEA 1VR6A 3MM8A 3CJ0A 3CC4S 2J7KA 2HBRB 1RTJA 4Y2IA 1JLBA 4S0MA 2ACYA 4Y65A 2Z2MA 3J81Y 3TUPA 1X0CA 5BYRA 1VRQC 2FY8A 1KC8T 5CCMA 4DR5F 5AMVA 3MR7A 2W9CB 1N34J 2L9DA 4J5OA 1Q4RA 3GRHA 3DOLA 2IA6A 5CD4A 2G9OA 3KOAA 3RAQA 2OPSA 1HNVA 1R0AB 4O4GA 4IH5A 2HWTA 1QAIA 3RBXA 2F9JA 2OKQA 2X6WA 1TKDA 2IRXA 3Q89A 2W9BB 2NSTA 4NEYA 5IQQA 2W4PA 1R6VA 1JLQB 4YC5A 4RW4B 1VC6A 1ZETA 2V2ZA 2J9EA 1TV6B 4DV5F 3MEKA 2POKA 3CJ3A 4KH1B 4DBQA 2CAJA 1X5SA 2VFNA 2LDIA 4CQ1A 3N4WA 3TEGA 3GIJA 1JRGA 3EZUA 4X64F 4C8OA 3PW4A 4RUHA 3FBBA 5F3TA 1CJKB 1JJ2R 1J5OA 2OPRA 2UVWA 1NEEA 4EYHB 4CP5A 2VF3A 2AIRB 2ZVSA 1IQZA 5AE3A 5IOLA 2XNQA 3Q23A 2J8KA 1UVIA 3GYNA 4ZIWA 3OHAA 2XTWA 1O0PA 4TYAA 1WG5A 3PIPQ 5EN1A 1TKXB 3FSXA 1U1QA 1JMTA 3KTQA 2CQ3A 3W65A 4RW9A 2XMUA 1OQ6A 3TZXA 4NLXA 4F3QA 4FF2A 2IVMA 2JOQA 3IBFB 1OGOX 1XMOJ 4OPWA 4PZVA 2XSJB 1B4SA 1BUXA 1Q8LA 2LDYA 2XMVA 1WKJA 4QZVB 4DUZF 1SJ3P 2ZH6A 4K50A 3UCGA 4DR7F 5JLVC 3TAQA 4ZVUB 3GCXP 3VQTA 2Z2LA 3BGOP 4M95A 5HMXA 1HARA 4YB5A 4CM0A 2FLOA 1SB6A 3AJDA 1J2VA 2LP4A 4WZQA 1HNWJ 1SUQA 4TLQA 1S1UB 1TAUA 4ZMMA 1JLEA 2E44A 3V6DB 3NGDA 4J37A 3OR2A 5D4PA 3LPEA 4C4WA 3I9ZA 2YBVA 4WKRA 2VV5A 2VFTA 3ADAC 3HSJA 5DRKA 3OD2A 2FC8A 1IKVA 3TARA 3M9NB 4MK8A 1NNDA 2EPIA 1K1QA 4UUXA 3M6WA 4ZS6A 4EO6A 1K8AT 3TANA 1Y9OA 1RGVA 2XWXA 5B0CA 2EW9A 5C42B 4DSJA 2CNKB 1T03A 4LVOP 3MI7X 2ZZMA 4RX6A 1RE1B 3MXHP 1EHWA 3PKYA 2VFVA 1YVFA 1LWCB 2M2BA 2V5HG 3KJVA 2ZBQA 4B9LA 1AYEA 2QL5B 2DHGA 3V6KA 4A8QA 4ECQA 4XORA 1PGZA 3EQOA 2Y1RI 3P4UB 1RHUB 3DMJA 2H65B 4W90B 2HWHA 2DHHA 1MWQA 4FS2A 5ETKA 1IBCB 3D6MB 3CCRS 3CC7S 3T1HJ 2ZOMA 1R0CB 1QJHA 5L46A 2QL9B 5LMNF 2VDHA 4JI1F 3ZZUA 1C2PA 2YKNA 4CDIA 2V4JB 2FTRA 1N6QA 5CYJA 4PUOB 3AD7C 4WK1A 1VFJA 1D9DA 5IT9U 3DLLQ 2ALZA 4ZP8A 4N8NA 4MK9A 2JVRA 4CH1A 5MAOA 5HQ8A 4HKQA 1RLCL 4H4KA 3ILIA 3OXLA 4X4SA 1FD2A 1T94A 4USMA 1X8DA 2CQBA 4YELA 2VU5A 1IR0A 5ETMA 1EETB 2ZH8A 3SEOA 3GQCA 5DJBA 3WQPA 1N52B 1MWYA 3Q24A 1O8EA 2DR6A 3WWGA 5KFAA 4QOTA 4C8KA 1FKOA 3M32A 1UETA 5GAGI 1QSSA 2HZAA 1IBKF 3MMAA 1Z2LA 1YJ7A 3BGLA 5LSOA 1DAXA 1L3TA 2KXNB 4RBVA 4DWIA 1S6PA 1MWZA 1L1IA 2M0GB 3WZ0A 1IKWA 1HR0F 4PXDA 4NZ6A 2V2KA 3H09A 3DLHA 1NHCA 1IN0A 4WJBA 2ZDPA 2VFPA 2DHXA 3TQ1A 3MURP 2CPHA 4O3RA 1DTTA 1U2FA 1HWLA 4OI2A 2WSFC 1IDJA 1R43A 4NRTA 5I4MA 3LGHA 4DV3J 1REVA 3QO9B 4R25A 3GYGA 1P9YA 2DYAA 2BOPA 3FC9A 1K1SA 2B51A 4DPYA 3I0SA 3W2WA 1PKUA 4A8XA 2OFHX 4YHHJ 2Y8YA 1PILA 2N3OA 3C16B 4ED8A 5KFNA 2HFSA 2B7BB 5KG3A 2IDEA 5E3PA 1UA0A 3AB2B 4E98A 4P2SA 5J2QA 3EGZA 2H5EA 3TOQA 4QIEA 1JLBB 1QUVA 4I2QB 3DOMB 1HWIA 2ZWOA 3M30B 4ID5B 4OYIA 1RT6A 2EBGA 5J1EA 3PX0A 4LBIA 4XTTA 3KYLA 4ECRA 3OXFA 4YS2A 3SI8A 2W2NP 3HVRA 4K4TA 3IMQJ 2CNOB 2OPSB 1HNVB 2BM1A 3KKFA 2MGZA 2QE5A 2DPJA 2BE2B 3BQ0A 2XS5A 4OJOA 2DITA 5LXRA 2WRMA 4NLDA 2EBEA 4O44A 1RT2B 3KJNB 3MPUB 2UUWA 4UY85 5CZVA 4M5JA 4KGKA 3RW7A 4WP9A 2FVCA 2DNMA 1TFWA 4JI2F 2UXDJ 3JAMY 2FJEB 4YZXA 1KEKA 1EP4A 2H4WB 1TSPA 5KAKA 4P74A 2FHJA 3DLGB 1SKRA 1J5EJ 1FE4A 3OTOJ 4HL9A 4M94A 1LW0A 1J5OB 5GAHU 1V3SA 5FLXU 2HG4A 5HMYA 5K8PA 2HBYB 3ZC4A 3C66A 1WC6A 3DLEA 3Q8YA 4Y2AA 3I56S 2YNIB 4M5IA 2Y8WA 4C98A 3U1LA 3MUVP 2FJVA 1WKLA 2IM3A 1U8WA 1VQSA 2HQIA 2K3IA 2HURA 3HZGA 1VBZA 1FXRA 3SDEA 4ELTA 4OYBA 3HPOA 4QWCA 4CZCA 2ZH9A 2XHWA 5KG4A 2YPYA 3J81U 1QSLA 2V8DA 3KG4A 5A8KB 4ZITA 1VQ4S 1UVNA 4XLAA 2GVZB 1R8CA 2V8VA 3N6ZA 1NSAA 4CCHA 3UDCA 3CCUS 3MEDA 3W7BA 2KKHA 4ES1A 3A8KA 1SCJB 1SUQB 2ROGA 1YJWS 1RK8A 4NA2A 1D0EA 4IFVB 2HGNA 4DV1F 4ZN1A 2JX2A 1NK4A 3GV8B 2RH3A 2HHHF 1OSCA 2M52A 3LWLA 3ITHA 4FXWA 2H5IB 2XWYA 3EVWA 5IM0A 4ZLLA 4LSLA 2MPUA 1RT7B 3JSYA 5J2MA 4B3SJ 2IVFB 1JNRB 4FVMA 5BXIA 4F8RA 3FQKA 2ABYA 3NNAA 1PBAA 2KJWA 2IFXA 4BLGA 4C11A 7FDRA 1K9MT 3VAKA 3CCVS 4A8WA 4B17A 4M1KA 1AUDA 5HP1B 4LF4F 5HQLA 5IQ6A 2JNJA 1PJ5A 3JTOA 1O5JA 3B8HA 3DKDA 4ICLA 1P27B 2QO3A 3PSSA 5A8RA 1CC7A 4Z37A 4URGA 4DV0J 2AJQA 2DGOA 3T3FA 2GGPB 3L7OA 1CEZA 2QRRA 4LF9F 4I84A 3OJUA 2HHSA 4LIRA 3W2VA 4X66F 4IRCA 3DRPA 4CTAA 1PIEA 3TR5A 4CH0S 3HP6A 2DBBA 4A8YA 3UFCX 2L9WA 2PEHA 2J0XA 4PXBA 2HNDB 2W24A 1TL3A 3W66A 2GJIA 2A6OA 2V50A 2MZ1A 2YKNB 1RTHB 1U7LA 4OM9A 2VHGA 4ZLPA 2O3DA 2E5HA 2ZE2B 2XBPA 4ETZA 3RR7A 4FYDA 2D3O1 5CCLA 4YY3J 2HFUA 1G7CB 4OI4A 3VAMA 2PDAA 4E8UA 1ITPA 4B3OB 4ANEA 2MKKA 2JHEA 3LANA 4NLOA 2Y1IA 1VQLS 1ACMB 1RXOB 3T6BA 2F7VA 1S4FA 4X4OA 1BQNA 3PETA 2ALYB 4QR1A 4Q7AA 3J81j 1WHYA 3L7UA 2QG9B 3NAWA 1S7IA 4GVBA 5LM7E 2E5JA 4USUA 3IA0A 4NYPA 4EFAC 2NYHA 2B9XA 5C24B 3R97A 1SJFA 3VALA 3DNCA 2LQBA 2H4YB 7AT1B 2HSEB 3V2UC 4DQRA 1CQMA 4IH6A 5IV4A 2W01A 2PYHA 3OR1A 3K5MA 3GV7B 1IKWB 2YX1A 2VJUA 4CH7A 1TK5A 2DTJA 3HHNB 1UJ5A 5F9LA 4ZVRB 4IQMA 4RW7A 2C3YA 2E7VA 2MQPA 2OUGA 4JI7J 2INVA 1CSJA 1TUVA 4ZHRA 1ZM3A 2ASDA 1DLOB 5IT4A 4UW2A 2OLWA 2QX3A 3R5CA 2GS8A 4DL3A 3I0SB 3W2WB 2X7IA 2CQIA 1BWVA 4N8OA 3ZPPA 5D0RA 2H51B 2Z8GA 1DHMA 2E1RA 1RHRB 3BBBA 1QY7A 3VAIA 3BSAA 2V9WA 5D3GB 3IFEA 4ZP7A 2KM8C 4KV8B 4AD6A 3PKMA 2ZBRA 2RDDA 2C22A 3HFZB 2PT0A 5DDPC 1PJ7A 2ZOFA 4QIFA 3QFWA 4NYZA 4DFMA 1W7WA 3ZTPA 1ZZFA 4NLWA 4Y3CA 1D9FA 1E6YB 4K7QA 2J7WA 3VGUA 4CLSA 2MGZB 3CJ2A 3KWMA 4XPEA 3MCNA 4BWJA 1RBLA 5T7LA 1NH8A 3ZZZA 3RU0A 2FC9A 1RQ0A 3MR5A 2AU0A 4BCAA 3EWGA 2BJEA 4WFZA 3OFEA 4NLGA 1U47A 4B3RF 3DI6A 1L3UA 2MKHA 3OL6A 3HKWA 3UW1A 3CWJA 1JIHA 1SH0A 3NGSA 1T9XA 1QTNB 3K5NA 4BS2A 2MZSA 2QJ3A 4ECVA 5F8IA 3G82A 2L3MA 2RAQA 3EZOA 1W26A 1OFDA 5BYSA 3ZZRA 4KC5A 3X3UA 4ZP9A 1R8BA 1NK6A 4DX5A 5ETTA 3DXSX 4LR7A 3NBPA 1FTCA 3R5AA 3C6UB 4KAIA 5J2PB 4ED5A 2GIFA 4QIVA 1URRA 2RRNA 4R0EA 1RAJA 2R8IA 2VJJA 4HYKA 4ID8A 1FRMA 3M8QA 4USHA 4DSEA 2IC3A 1NDKA 2DNPA 4OJGA 4LBPA 2HHUA 5ETQA 1CJVB 1O8LA 1RT1A 4C8ZA 3PSZA 1JWWA 4C7QA 2AD9A 2YNHB 2B9YA 5DM6Q 1HQUA 3M8ZA 4M5DA 4U8YA 2G2OA 6FDRA 1OYDA 4DLEA 2ZUAA 5JUMA 5DDQC 5J2NB 2YQ0A 2JFKA 1CC8A 1IJEB 2WCXA 3MECB 2FVRA 1X4FA 3WHIA 4U7UD 5LSLA 3MEDB 1QSYA 1B7YB 2DY1A 1RISA 3D7SB 1KTVA 3CD6S 3R2DJ 4ZPDA 5KFGA 2ZM6F 1VS3A 5CYMB 3D0IE 3GLJA 2FHKA 4DJBA 4UOHA 4YEJA 5HAOA 3BEGB 4O0NA 1Q95G 1GXLA 3OVAA 2VOOA 1FWKA 2DNNA 5HANA 3ENWA 4ED2A 2L9NA 5D8HB 2DRBA 3BN4A 4O0IA 2CXEA 4PWUA 1LXNA 1F1BB 3HZEA 3LP0A 3JAMU 3MPYA 2MKSA 5J2MB 5LXYA 4YCQA 4N7TA 4DSIA 2EWEA 1WC3A 1U6BA 4XR6A 4C11B 1X7VA 2FHMA 1U1KA 2YNGB 1UCNA 4HVZA 3N0VA 2B43A 4G1QB 1UL3A 1KHWA 3R7SB 1MMLA 1FESA 2KHDA 4QYZJ 1YITS 3MMBA 3DM2A 4P73A 1UFLA 1U1NA 1TUWA 2OJ3A 4J9PA 3B6BA 5HI7A 1AT1B 3M8PB 4WTOB 2WSEC 3FFIB 2QA4G 4KIAA 1ZBTA 3P8BB 4IG3A 2AEJA 1HHSA 3DU5A 1LW2B 4LFBJ 2F4FA 2GHWA 5DG9A 1K73T 3JX8A 4MXNA 2AJ4A 2CDRB 3PR5B 3GILA 2GNKA 1OYEA 1TKTB 1OS5A 3DYAB 3CE8A 5GADU 4P75A 4CWBA 2CJBA 5G0RA 1VYAA 1GNKA 1YSJA 5KFVA 4LRFA 4V1Ak 3MUTP 2X1GA 4JI6F 1SJ4P 3LJYA 5JMNA 4QWEA 3TO8A 4QQBA 4X62J 1WEZA 1KTWA 2Y3YA 3Q8SB 3RZAA 1MMNA 2I2YA 4AE5A 2RS8A 1HBOB 2V68A 4YZQA 1QCXA 4MIAA 1IB4A 1RWKB 1U0SA 3H98A 3N6NA 3A3OB 2VBZA 4IOCQ 1ZYQA 4M5GA 1RAFB 4JI0F 5D4OA 2RHSB 1R31A 3Q8UA 1EX8A 1PYOB 3NS5A 3LAMA 1AA1B 3HHLC 3H59A 2XYHB 4KTQA 4ZDNA 5HJYA 1S77D 4PQAA 2AP6A 3VWSA 3VAFA 1OFLA 2NQPA 1RTIB 1TYVA 2WBMA 3FVYA 4RW8B 3OR1B 1QLNA 4DEZA 2IQ7A 1WI6A 2Y0BB 1S99A 4IR1A 2RQCA 2PMHA 5F8MA 4Y28C 2OEMA 1OY9A 3J7AN 5HBMA 3GR0A 2UXBJ 1WDTA 1HI0P 3D0GE 3VSTA 3SXLA 2HAFA 3GB0A 3CD7A 5A8WA 2JLFA 1GMVA 2GHPA 1L5UA 3UVJB 3W8PA 2IJNA 4LSNA 2XLKA 2F3JA 4X4QA 1C0UB 3ILJA 1ULRA 4OX7A 2E7XA 3FSIA 2YH1A 2YTCA 2EWHA 3QIPA 2DRAA 1SKSA 4RU2A 2AJFE 4OYOA 4HHJA 3HMJG 1NK8A 2N7CA 1HL6A 4Q0BA 2AJ0A 2ZD1B 3PNIA 3I87A 5E41A 4EUVA 1RTDB 4LVNP 4ZLJA 1LEOA 2EK1A 4JI3F 4KYZA 1Q1KA 3S8SA 1RI7A 2DHSA 1FHTA 1CS4B 2N4DA 3TAMA 2OIHA 4KRWA 4XLEA 3CUNA 5K14B 5T7LB 4LF5J 3H42A 1GXUA 1XR7A 1EKSA 1T9VA 3MAAA 3IG1B 1XBWA 3CJTA 3T5JA 3FGVA 3R7NB 1N32F 2OGUA 2A18A 3D6TB 5KFXA 4AQYF 1QVFR 4USVA 1HI8A 4DV4F 2QEXS 2Y9HA 4DR3J 1A9NB 1HBMA 4ECXA 4EI2A 1WWHA 5IWAJ 4ZCLA 3UN2A 3PCOB 1V9OA 1NSKL 4MYUA 5CHCB 3N6MA 1HWJA 2PI4A 1T05A 2ZH1A 1CJUB 2QZ8A 1WOPA 4CO5A 2FVPA 5C1CA 3A8IA 1ZM4A 3BZQA 1S1XA 4YEIA 2NSPA 2RQ4A 4NRUA 4OJLA 4XLFA 1C1BA 1FI4A 2EFGA 1OFMA 4DR5J 2HIYA 3OL8A 4N41A 3P3DA 4KFBB 3KK2A 1N36J 3AOCA 3THVA 3IBCB 2CUYA 2MKIA 4AL5A 4X4RA 3RG6A 2QYGA 5CQGA 5IC6B 1FEHA 3KFWX 3UNGC 1HQUB 1GFWB 4GC7A 4DQIA 2ZH7A 2RUGA 2BV3A 1N88A 4JV2A 2CQPA 3ET6B 3QJJA 1TZ0A 1JB0C 4MT1A 3PX4A 3H7HB 4NCGA 5CYQB 2GX8A 1XK8A 3EDRB 1IKXA 2Q6BA 2ZOGA 2L08A 1MROB 3EGWB 2QLXA 1FVQA 4JYAF 2ZEJA 1BD6A 3ZNUA 3VTIA 2XEXA 1JX4A 1MU2A 3MR2A 2FJXA 3OTCA 3AOAA 3KHHA 3PJWA 1C4CA 4DR4F 4LF7J 3FQLA 4LRAA 2BJ7A 4A8KA 2Q43A 2YNFA 2Q1LA 2V8PA 1B0VA 1N48A 3CPWR 1NO8A 2CZ4A 4KH0B 2PA3A 2CPZA 4IQXA 1R89A 1YJ9S 4GKJJ 1SIWB 4TY8B 2E5GA 1RT3B 4X65J 2MQ8A 1RWWB 4NE9C 5BYQA 4WE1A 3P5BP 2IY5B 3NY0A 2E9ZA 4XLCA 5EWEA 2DR5A 2VODA 2BEFA 2FVSA 3PYDA 8RUCA 4PRFA 1RU4A 2DNHA 3R8YA 5IFMA 3E8OA 3DLJA 4FYXB 1N33J 5CA5A 1C1CA 3H5UA 3Q86A 3I96A 2YUHA 1VRTB 4ZPTR 2ADBA 1UWBB 3GQ7A 2WW8A 2HVEA 3Q0AA 3BKTA 2CJAA 4WU2A 1CQNA 2VFMA 2CFXA 3T5KA 3CJSA 5AT1B 5CZXA 1H7WA 1BQMA 3QATA 2UXCJ 4FPRA 1UAWA 1G4CA 4YQWA 4I6WA 4Y34A 4GC6A 4Q2LA 4Y0FA 1NZAA 4LF8F 2YKQA 5G0RB 1KSPA 3IAS9 1PLUA 3QSYB 2CWXA 2D9PA 3O5TB 3OJSA 4WFYA 2WTFA 2ADCA 4NMLA 2D74B 1HNXF 5KFIA 3ENQA 2J5AA 3H2UB 4JI8J 4OI3A 1SKWA 3RAMA 3E51A 1HBUA 2WVFA 2FJAB 2HK3A 3QNWB 3H4BA 1LV5A 4MH8A 1GXTA 3N90A 1NU4A 4NXNF 2BM7A 1D3WA 1H7XA 3RRGA 2DNGA 2J9DA 2VG6A 4DG1A 1GMWA 1HD0A 1R3NA 5KFWA 2UV8A 2BANB 4KB7A 2IPOB 3PV8A 3H5XA 3GONA 2RNEA 4QU6A 1N5SA 2UVUA 2LEBA 2MSTA 4NX9A 2I1RA 2BRLA 2VG5B 2XTYA 1KFSA 2YVSA 4Q5VA 5HBMB 2ZITA 3HVTB 4AT1B 3EICA 4CLPA 3N5FA 2XMKA 2H1YA 2G0IA 1Y00A 4ZVHA 1TP7A 3GFZA 5F9NA 4F2SA 1KD1T 5F8JA 1S1VA 4OV6A 5F3ZA 1V6HA 3DRXA 1JKHA 4OX9F 4LF6F 4MR0A 2RDIA 4HT7A 3JS9A 1UA1A 4FBTA 2DVIA 2VD3A 1UJ4A 2HRUA 1HQ2A 3FSYA 2XMMA 4PYDA 2C2RA 2HHQA 4U67Q 4AVZA 2EI5A 2GA7A 2PC6A 2CPFA 2CPYA 4U4BA 5F8HA 4FKYA 2I8EA 2NZMA 4CIOA 4KGZB 4CYUB 1SL0A 3SQGA 2M8DB 1NK7A 4Q0BB 1F2HA 4DQSA 5EGYA 1IBKJ 4JV5F 1X4CA 1RTZA 2XY5A 5F41A 2DGWA 2QSFA 4TLRA 3LGMA 1RHJB 5KFOA 1O6XA 4MTPA 2PFDA 4FYVB 3TAMB 4WK3A 2KJVA 1SBRA 3LUYA 4ZPCA 2D3ZA 1HNIB 5C2GA 3H2LA 3B4MA 4DR6J 2KG0A 3IP0A 5C7PA 4DV6F 1WC0A 4URQU 4X4PA 1DTQA 4R0JA 2AEFA 3IM9A 1LFPA 2HK2A 2WK4A 2ZJQQ 1DABA 2B4UA 3B4DA 1NHKL 5HLFA 5K20B 3HF5A 2DK2A 5SUHA 4PPDA 4NI2B 4KKOA 2DGSA 1M5KC 2QC3A 1X9WA 1F5CA 4CLLA 2ROPA 4B9VA 4PKDB 5H9FK 1L3SA 4B3MJ 1ELOA 2HRYA 4L3NA 2QGFB 1TKZA 2IM2A 4AFFA 2JDJA 3NCPA 2X1AA 3QGPA 5A2QY 4TQRA 2YXLA 3OVBA 2RU3A 2ERRA 1H3DA 2NYIA 3G6VA 3TRGA 2AV5A 2ZBCA 3EPIA 4OHWA 3C15B 1GX5A 5DDRC 3G4SS 4MFBA 1FK9B 1KCDA 4L76A 1AUSL 5DG8A 1TL1B 2WVDA 4KO0B 3MPDA 3UR0A 1U45A 3AA9A 3SYZA 2HQDA 2IYGA 2JSXA 1UVMA 4ECUA 3E01A 3MEGA 2Z0GA 2WB1D 1JLFA 2AQ4A 5K9FA 3BO4A 3O1LA 5A0YA 1HPZA 3KLHA 3W9JA 4OJ1A 3P45B 2AYMA 2K8GA 4I67A 1ZM2A 2DH9A 2NUHA 2PA8D 3HX9A 2KFZA 3Q2TC 4WFAQ 5DG7A 1XNRF 4NCGB 3HFKA 5KFQA 1QE1B 3QMQA 1RHMB 1OMSA 3V4IA 2QN6B 4U7UK 3GFHA 1TELA 4XM3A 2GFFA 2GJ2A 2OPPB 1CG2A 3KHGA 2H3EB 3QWPA 1UZDA 2XC9A 3U02A 2ZKUA 1N5YB 2MJUA 1S12A 3AAWB 1D8ZA 1HQEB 3MHYA 3PHEA 3MEEA 4NEZA 2B0RA 2HLUA 1U1OA 4ED3A 1RDRA 4C97A 2P2CB 1QA3A 1TVRB 2LQ9A 2DR9A 1S6QB 1U25A 2W1BA 4NCBA 3T1YJ 1AZSA 2K1RB 2GO8A 2G0CA 5D6GA 2KVIA 4DZ6A 3NB2A 1SXLA 2C2KB 2JJ4D 3W61A 3TP2A 1X5OA 2F4VF 1IXKA 1FCAA 1T9TA 3PYGA 3IM8A 1EE6A 5DGAA 2VICA 2ZWPA 1N5QA 2LYVA 3CNQP 4I7FA 1EAYC 1VHFA 4L6V3 2BZ2A 3O8WA 3B82A 1Y5IB 1FA0A 3GSIA 4HEA9 4WKYA 2AX0A 3VAHA 2R7VA 2CZ9A 1NAQA 4I6AA 1S9FA 3TI0A 2GAGC 3B8YA 1S9EA 3CD0A 1H2UX 1U0HB 3O44A 4RNHA 4WF9Q 2EKYA 2O0WA 3IAM9 1XNQF 5B0FA 1O51A 2YKAA 1KOHA 1AXQA 4LFAF 4NXMF 4WYWA 3BBCA 1FT8A 4LF1A 3L4BC 1RKJA 3IWLA 5EUHA 4DL0C 4ECWA 5AE2A 1RCXB 1Z1ZA 3MMJA 1KLMA 2QZAA 1YHQS 5C25A 1E6VB 3DLKB 1GT8A 1IM4A 1UZHA 3EJMA 4WZMA 1VBXA 4KH3A 2Z56B 2A6MA 2RQMA 5KTQA 3UD5A 4LF4J 1XERA 1YBTA 2XY6A 4FYWB 3M1VB 4Z2XA 3AODA 5M2RA 2MB0B 1LLWA 2AJ2A 3LW5C 1EJ7L 3CDBA 5E3CA 4XNFA 2PO4A 2FGCA 3BKUA 4AYBD 2FIUA 4IG0A 2VG6B 1VLYA 5B09A 3ZFVA 4ZOSA 2KT3A 2F8HA 4DPOA 2W9CA 4WFBQ 3Q22A 1VJWA 1S9GA 5B0EA 5AJ3J 3WC0A 2KYXA 3THTA 1QUPA 1SL1A 4Q43A 4XKWA 3A12A 5KT4A 1R0AA 4OHVA 2ZNYA 4RJVA 2R2SA 4M5HA 1LQ9A 2ODLA 1NSQA 3KK1B 5DZ7A 2NT6A 3KNAA 2W9BA 1S97A 1JLQA 4RW4A 3BKFA 1O8DA 1PJ6A 1HFEL 3VZIA 2CVIA 1X4BA 1TV6A 4UUWA 4UOFA 2RUSA 4FF3A 4ZP6A 5F8GA 1A6LA 3OFGA 5DETA 4K4WA 3DOKA 3ZZ0A 1QM9A 1FKPB 4RBTA 3V81B 1QA1A 4UF4A 4DQPA 2VUGA 3OQ2A 1CJKA 2V8GA 4NWBA 2RKIB 1I94J 2W8LA 1UFWA 1P6TA 4M5MA 5DQHA 3ONQA 4DU7A 2WHOA 4TU7A 3TVYA 2W9AA 2BXJA 3KHRA 3J80Y 1FERA 1WEXA 3CCJS 1TKXA 3QFHA 1YJVA 4QPXA 4M5KA 1HD1A 1S4EA 2BX6A 1PBUA 5H1SV 4EW9A 4K5SA 3QWUA 1B70B 1ZTWA 4BDPA 3T9NA 2G13A 3M05A 2XSJA 4CNZA 5IXUA 4Y00A 4Q44A 2XSFA 3IRXB 2J7UA 3ELHA 2A2CA 3R5GA 1JLGB 2F3LA 1TL4A 2BBEA 4I0WA 1R6YA 1CBKA 5CAAA 5G4DA 4WCEQ 3VV2B 7FD1A 1FJCA 5E5NA 1RP5A 3AT1B 1A0OB 4PPZA 1S1UA 2XC1A 4D3GA 1T9YA 3OFFA 3V6DA 2CPIA 1VRUB 3RB4A 4PXCA 4RNMA 3MZIA 1X5TA 4I68A 1LKZA 1NJIT 3LQVA 2X3GA 5KT5A 4NCAA 4BC9A 3AA8A 2HEKA 3NGTA 2FB0A 5THWA 1BMQB 4G1IA 5KG1A 2MY7A 3KLIB 2NSCA 3K5OA 1QTMA 1B0PA 1WC4A 2BYCA 3FUYA 1FDDA 4KGVB 2O66A 2BA9A 3SFUA 5C42A 4LBHA 1TTHB 3SMZA 5IS2A 1DQ8A 4QR0A 4OI0A 5CABA 1H0HB 2YKMB 2MQLA 3P49B 3D2WA 5GAHI 4UOGA 4OLOA 4OI6A 4P7TA 5H9EJ 1LWCA 1UP1A 2QYUA 3KLGB 4G3IA 4MIBA 4LMZA 3IR7B 3UDVA 3OL7A 4PWDA 1PYSB 2N4CA 3V4IB 1HYSB 3AOBA 5KOXA 3LP1B 3PRVA 2NXCA 3TJAA 3BGRB 2VPXB 3SCIE 4WFNQ 4RNNA 2FZKB 4LQ3A 1T9WA 2C2EA 4LFCJ 3GSDA 2WAQD 5HROB 4IYQA 5DS7A 3DU1X 2OD4A 2WOMB 5AE1A 4OIXA 2Z4PA 1KFDA 2XCPA 2VPWB 1KQ5A 2V4JA 5H9FJ 4DN9A 1RWRA 3TA1A 4QIWD 2NT9A 1KQSR 4PUOA 1IQTA 2IJRA 3ISNC 3T1HF 4IOAQ 4FYYB 2KM8B 5B08A 2XG8A 3LYCA 3SSRA 3G87A 1O8GA 3MM6A 2MJNA 2GO9A 3Q8RB 1UWAA 1PAEX 2MSSA 4EU0A 3CJRA 4F4KA 2CJKA 4B9TA 3AXKA 3MMCB 5KFRA 4MKYA 2Y1JA 4U9RA 2OI2A 1EETA 2KO1A 2LU2A 3QIDA 2J8AA 2J76E 2KRRA 2I9SA 4YB1P 3D1OA 4IRKA 2FLLA 1FXDA 1PXZA 4F0HA 2EVZA 3K0JA 1W2BR 4PG7A 2IRUA 3VR1A 4MKVA 4OL8A 4FP9A 1ICEB 1YKWA 2HNZB 2INUA 3L95X 1ZA2B 4Z7YA 3KUGA 3R6LB 2BVZA 3NWGA 3C3LA 1WJ9A 3AXMA 4PG6A 1RBOB 2CZVC 4NYOA 2R7SA 4IR9A 3MOJB 1H74A 4YUDA 3FDSA 2QA2A 4B3TJ 4XOTA 5L1IA 2HQFA 1XC9A 1TMMA 2D3OR 1VQ5S 5LOQA 1KLMB 5FLXY 3QO9A 3J7YU 5KT6A 2WBRA 2B7CB 3ILOA 3FEXB 1ZM9A 3TH0A 3TX8A 4TU9A 3GQAA 4UT4A 3D0HE 1T3OA 3BS9A 2HNYA 4B9SA 4EBEA 1Q8IA 4I2QA 3DOMA 4IG0B 4YHHF 3L7PA 3M30A 2K7KA 3U27A 4EZ9A 3J7ZT 2ZZTA 1Y0HA 4ID5A 2E1AA 1NJZA 2HVHA 3FBEA 2VG7B 4JI4F 3G6YA 1S9GB 3CF5Q 3Q8PB 3UDLA 2UUCJ 3DRSB 3CD5A 4QR2A 4RR5A 1IBMF 1RAEB 2EG2A 2BE2A 2CG4A 1X9SA 4J9UE 3CEDA 1NPPA 1NK5A 4QJVA 1RT2A 2HMIB 2FY1A 4K2JA 2O17A 2JRSA 2RF2B 2ZFHA 4K4VA 4L73A 2ZH3A 4IO1A 2QTWA 1O8JA 3D3BJ 2QT7A 2HRTA 4DS4A 3R27A 4NZ0A 4CM2A 2E9TA 2U2FA 2BQ3A 4MKBA 4UQGA 3DRYA 3DOKB 4OYWA 2FZGB 4IRDA 1VLOA 3DLGA 4ZVFA 3HM9A 1FNXH 1EKRA 2PIIA 2UXDF 1WI8A 2IBKA 5LSRA 2QYCA 3CMAS 1RWPB 4J9LA 4ECYA 4LREA 1HBNB 4CLWA 1Y7PA 2YNIA 2GQCA 4UZCA 3M9OB 1OPZA 3FZBA 2HVIA 4LJMA 1VJQA 2NZ4A 2C2OB 3LP2A 4UQTA 4FVCA 3MGJA 2FLNA 1KKHA 1N56A 5LL6d 4I69A 1SIZA 4NASA 5A8KA 4ILRA 2GVZA 1N5TA 3SV4A 1X60A 4USJC 1YLXA 4FF4A 3L3CA 5A76A 4ED6A 1ZZNA 2MEWA 1BE4A 2ASJA 2YWFA 1HHTP 3MD3A 1NUEA 4IFVA 2RS2A 4DX6A 4HTJA 4CO0A 3KDNA 1VDHA 1VQOS 4DPUA 1ZAVA 1EQ0A 1QAYA 1FEEA 4QCLA 2DISA 2IAJB 3SQVA 3VSVA 3T6JA 1RT7A 2VL1A 4F0KA 2KRBA 3U1NA 2LMIA 2VC0A 3Q83A 1YTYA 3RGIA 2OD6A 3I6PA 3IGVA 1S0NA 1YJNS 4XOPA 1O88A 1S6UA 4XO0A 3GIKA 1IWAA 3HHLB 5DM7Q 1FRHA 4B3SF 1H38A 5D4LA 5AXLA 3SZEA 1S1WB 5HP1A 3ZZPA 2VPYB 5L39A 4H4KC 3K8WA 2UZAA 1FRIA 1RB0A 2UUAJ 3EVMA 1UEUA 3J80U 3QGIA 1Y11A 3DRRB 3SBMA 3POTB 1RUSA 1N32J 2GGPA 2QMUB 1YI2S 4PWDB 1JXLA 5HMWA 3NCRA 3HVWA 4BHQA 9RUBA 2LFVA 2VC1A 2IJFA 4DV0F 3VMVA 1SC1B 2HNDA 3IC1A 4L75A 2QX0A 2XLJA 4KJIA 2LXUA 3CCMS 1RTHA 3SYJA 3CSKA 4RZRA 1IVZA 2ZE2A 2HQCA 2XHCA 4U8VA 3PYEA 1WEYA 4CO2A 4UZBA 4B3OA 2J8IA 4W92B 4UTGA 3RBDA 4Z05A 5L9XA 3MM6B 1YZ6A 4FKXA 1RU2A 1PAUB 1HWUA 1RA6A 8ATCB 1KQGB 3NOCA 5EX0A 4YY3F 3HI9A 4BBYA 1CVJA 1SV5B 1SC4B 4L3KA 3WIUA 5K5MA 4IO9Q 4I2PB 3FCVA 4PXEA 1F5AA 1JLAB 3DN9A 2BKNA 3D1HA 1DJ0A 1V3ZA 4NZ7A 2IYIA 3TQEA 3UQSA 5C24A 4QIGA 2V34A 3M4XA 2V67A 3DGPB 3KLFB 3DXBA 2APOA 1OY6A 1TAQA 3DLBA 1U24A 2MZTA 5KG2A 3CDEA 1R8HA 4MIWA 4JYAJ 3HLUA 2Y1LB 4LRBA 5B7WA 3H25A 3DC2A 4Y2CA 2XB2D 1FD8A 4DR1J 4DF4A 3RR8A 4Q2MA 1IKYB 3CMQA 2VQEF 2D3UA 4OZNA 4OZZA 1ZA1B 1LLZA 5JVHQ 4N56A 3MOZA 3PY8A 1DZ5A 4DFKA 3I5CA 1RHQB 3NWRA 4PG8A 4GO5X 2VOPA 1GTEA 1MLAA 3UE2A 1DLOA 3BJYA 4OZ2A 4PYAA 2NTPA 2NZCA 1OOCA 3HHLD 1N54B 2BM5A 5E3AA 2ZDOA 4USWA 1PC4A 1IR2A 2M7SA 1A7GE 1S59A 2AW0A 5D3GA 2DXDA 2IVYA 4B08A 1FDAA 2C2ZB 4ANCA 5GADI 2HNYB 4KV8A 5KFEA 3M8WA 4EEYA 2CQGA 4P9SA 1JNZB 1U02A 4DSKA 1NLKL 3KNGA 1HHQA 1U48A 2OP5A 2E1MC 4QWAA 2WZ1A 3HSZA 3WIVA 2KU7A 3R1LA 2GV1A 3D9BA 2XT2A 3DGVA 1E6YA 3V6JA 4DPTA 3CDAA 4H4OB 1S1TB 5CH7B 2IOUG 3IGNA 2HAIA 4F02A 4X4NA 3T5HA 4M8LA 2WSCC 1WD6A 4K4UA 3D66A 1FFWB 2HYIB 2F9DA 5KT3A 3G8SA 2EC2A 3VF0B 4A47A 4AL6A 1F9HA 3PO4A 2XGQA 2JEGA 1XQIA 4DR2J 4ZVEA 4JB8B 2XMAA 4CO1A 1HNXJ 1WTBA 3NGRA 1B64A 2DD8S 4O3OA 5KG0A 3VAGA 1RHKB 3CIMA 2VFSA 1NSPA 3S1TA 4YP3A 4U96A 2VFRA 2EFOA 4HHHA 2DH8A 1NDLA 2XZWA 1S49A 2DH7A 3C6UA 3W5XA 5J2PA 2NTQA 1OY8A 2VPZB 3PR4A 4CLFA 2CIMA 3I32A 4DS5A 4P71A 2KG1A 3CJQA 1Q16B 5KFZA 3FBFA 4X4UA 4QYZK 5KFLA 2FZCB 5ETLA 3LP2B 5L1JA 4WXOA 4DUTA 5FDLB 1UVKA 1CJVA 5HATA 1X4AA 2SXLA 4W8TA 3OUYB 3TZWA 2YNHA 2ILZA 4DX8H 4XN0A 3VAJA 5ETRA 2W7ZA 1WC5A 2BKOA 3VVUA 5HVGA 4RBUA 3QGGA 5J2NA 4KGXB 1FRLA 4F67A 5EWGA 3P96A 3MECA 4C8NA 2YX7A 2F5GA 3R5DA 2WVCA 1KQKA 4DCOB 3PJXA 4GRSA 3TUIC 3A13A 4ZJOA 3RRKA 3CCES 1XMQJ 5CYMA 5F8LA 4ENOA 1UFKA 3HULA 2KT2A 4R8UB 3V5RA 3ETOA 4DLGA 2PE8A 4A8SA 1P1LA 2D69A 4WIQA 2XM3A 1H2VZ 1JJ4A 3AD9C 2HHWA 4RUAA 4DL4A 4XMYA 3PJ9A 2OAUA 3GMGA 4F0MA 4O3QA 3QLHA 1F9FA 2YNGA 2CQ4A 1I6JA 1ZAWA 1CLWA 4G1QA 4DFJA 4XDDA 3CCTA 2MLYA 4WXWA 1WG4A 3NXZA 1TYUA 3T19A 3W64A 4LIWA 2HKEA 2MHEA 1NKEA 1NJYA 2G2ZA 3KRGA 1DARA 1FXLA 5E2QA 2DGQA 2YX4A 3M8PA 2PSZA 3FFIA 3KMSA 2B4OA 4DPXA 3CW2C 2M4MA 5GMKa 3QGHA 2JEFA 4OYAA 4F50A 2EFPA 4YFOA 1GTHA 3RB3A 5DQIA 1QVGR 1RCOB 3X1LB 3I55S 2IMOA 1LW2A 1RU1A 3PW2A 2XS7A 4FXDA 2VFUA 3AQOA 2HWIA 2AYBA 1N0VC 3JSMB 1TKTA 2ZUGA 1T7PA 4I1TA 3DYAA 3ENAA 3KJFB 4P7VA 5KG5A 4F4AA 2HLTA 2O01C 1I1GA 2R2TA 3D28A 3NKYA 3W9IA 3GPAA 1XG2A 2JL9A 3U7JA 3CJKB 3KDOA 1ZTTA 2MQNA 1BY9A 3BR9A 3BQ2A 1YK9A 4ZJQA 2VDIA 4K0KJ 1HBOA 2BM6A 2R8KA 4NLYA 1S79A 3AJ1A 1ZS6A 1QAJA 3TYTA 1UVJA 4HI2A 3MR6A 4RNFA 1EA0A 2CNLB 5LMUF 3NEKA 2X3HA 1YJUA 4ZVTB 2N82B 4PABA 3I4PA 4PEOA 4XONA 1RTIA 5KG6A 3M2RB 1KS2A 4IDKB 4RW8A 4GMKA 3HK2A 3K2YA 1RYRA 2B9EA 2X3DA 2IMWP 2OSRA 4O3SA 4OV1A 3BM7A 4OJ6A 2A10A 1S0VA 2VONA 4C8YA 3C14B 4W98A 1NMEB 3EZ5A 3VGVA 3W8GA 2QA1A 4J9NA 1XMBA 2E66A 2MKJA 3KG1A 4TXSA 4P2XA 3UVJA 1HMVB 1NPRA 4DQQA 2F4VJ 2LQ5A 1CPZA 1C0UA 2M5YA 3MM7B 1JTAA 4ZCMA 2A0FB 3DCAA 2FVQA 2CWKA 3SUCA 1QQ1A 4K5RA 1RT5B 2M3DA 3E2EA 4DL7A 2MZQA 2DNKA 3DDNA 5C1EA 4HI1A 1M5HA 2XI3A 5J1PA 4B02A 3OPKA 1WHXA 3KUEA 5KFYA 2QA4S 2XO7A 2ZD1A 4DL6A 1BLUA 1FTRA 1RTDA 4R5PB 3EGNA 2GZOA 4ECSA 2QL7B 4G6VB 2HS4A 4U49A 2RB7A 3PIOQ 5RUBA 2JFDA 1CS4A 2AGPA 2XO6A 3JSRA 3H8YA 3WBZA 3T41A 4QWDA 5K14A 3SIPB 3LTOA 5ITHA 5JVGQ 4HLBA 1Y10A 5K8OA 2ZJPQ 3V4MA 1LNQA 3HHEA 3OTEA 3IG1A 2E5LJ 1X0FA 2J8SA 2YQ1A 5HN0A 3HFVA 1WDDA 2C28A 3QRQA 1X5PA 3BPSP 3SCLE 5JMCB 3H40A 2WONB 4LF5F 5HK4A 3VCDA 1R8PA 1WSVA 1FVSA 3K8VA 1B7FA 4JOUA 3GCWP 1VCTA 1Q81T 1RT4B 2NPFA 4KT0C 1Q5YA 2JZ5A 2NLWA 4TKTA 2Q6CA 1KNZA 2IRYA 1Q79A 1YIJS 1EZZB 2R7TA 3MM5B 1CJUA 5KFBA 2DNQA 2HHTA 1HF2A 4MJKA 2P8IA 5GAEU 1K4ZA 1DY3A 3KXDA 5JJBA 1YJTA 2EKNA 3M2UB 2BABA 2VQFF 4DOZA 4IOBA 2B0GA 3OBIA 3N5BA 5BR8J 2OEJA 5IT0A 4QWBA 4KFBA 1F3VA 1OIAA 2CPEA 3I0RB 4A4JA 2B6AB 4DZDA 1FO1A 3PTWA 4J91A 1LWFB 4LR9A 3MM9B 3D4JA 6FD1A 2CQ2A 4FZVA 1N36F 4I4BA 3L09A 1YG0A 5HQMA 5ETOA 4LR8A 3IS9B 3ET6A 5DZ6A 3OTDA 2W4CA 4NLPA 2VZ9A 4F2RA 3QYYA 3UD3P 2E29A 3NS6A 1PSDA 4N77A 5CYQA 3JB9k 2YWGA 3I4HX 2CQHA 1FRKA 3R5JB 3QRRA 4CNYA 1MROA 1RA7A 2RT3A 3D5MA 4TNOA
chains in the Genus database with same CATH topology
2HVDA 3ZTOA 3SYJA 1WKLA 1TYUA 1QA2A 1HLWA 3VVUA 2AZ3A 3EJMA 1U8WA 3ML3A 4ANEA 3FBEA 4C6AA 2VFOA 1QRCA 2BM6A 2XC1A 2CWKA 3PRVA 1BHNA 1QQ1A 1TYXA 4KH3A 3RIQA 1B99A 2HURA 3NGSA 3FBBA 3Q8UA 3Q83A 2VFQA 1ZS6A 3EMTA 1HF2A 3EICA 5C7PA 1WXRA 2J8IA 4OJPA 4OJLA 4OJOA 1QA1A 4S0MA 3H09A 4CP5A 1K4ZA 1HIYA 2B8PA 4FKXA 1LEOA 1XQIA 3PETA 3P4GA 1S57A 3R9LA 3VGTA 2VFPA 2BM4A 4UOHA 4DI6A 3BBBA 5IOLA 1MN7A 3ZTQA 3BH6B 3FKBA 4O0NA 3ZTSA 1TYVA 1KDNA 3L7UA 1WKKA 1S5ZA 2B8QA 2BM5A 3SZEA 3NGRA 3DKDA 3DDIA 3VVTA 1DABA 3NGUA 4ENOA 3JX8A 3FCWA 3JS9A 3N6ZA 1NHKL 1KQ5A 3NGTA 1LWXA 1NSPA 4KPCA 2G0YA 1S59A 4WBFA 3FCVA 3EVMA 2DXDA 2DY9A 3EVOA 4EK2A 2BEFA 1NCLA 2DYAA 4HR2A 1QRBA 2AZ1A 4ANCA 3FC9A 1NDPA 2DXEA 3BH7B 3WX8A 1NDCA 3LYCA 4V02C 1NDLA 3VGSA 1JXVA 1VYAA 1PKUA 1K44A 4OPWA 2BX6A 4OJ6A 1NB2A 3BBFA 1TSPA 3B54A 3ETMA 1B4SA 1BUXA 1BE4A 3ENAA 3Q89A 3N90A 1WKJA 1NLKL 3G2XA 1PAEX 4W98A 3ZTRA 1EHWA 1W7WA 3VGVA 1HHQA 3ZTPA 2BM7A 3GP9A 1F6TA 1TYWA 2VU5A 4FKYA 1NSQA 2NCKL 2V5IA 4F4AA 1NUEA 1F3FA 3TH0A 5JLVC 1NPKA 3Q86A 2B0RA 1NDKA 1UCNA 3VGUA 1K8FA 5CABA 4ANDA 3LJYA 3FBCA 3FBFA 2YUHA 3PJ9A 5JMCB 4UOGA 1QA3A 2HVEA 1XIQA 3BBCA 3EM1A 3Q8VA 4JRAC 3ELHA 1MN9A 3GPAA 4DUTA 2VFMA 3EE3A 3EVWA 4OM9A 1CLWA 2IOUG 2VFNA 3Q8YA 2F3LA 1NSKL 2ZUAA 3AK5A 4F36A 4DZ6A 5CAAA 3MPDA 4UOFA 3B6BA 4OJ5A 5BXIA 2DXFA 2W7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVD A;  3ZTO A;  1WKL A;  1HLW A;  3VVU A;  2AZ3 A;  3EJM A;  1U8W A;  4ANE A;  3FBE A;  4C6A A;  2CWK A;  3PRV A;  1BHN A;  1B99 A;  2HUR A;  3NGS A;  3FBB A;  3Q8U A;  3Q83 A;  1ZS6 A;  3EMT A;  1HF2 A;  3EIC A;  5C7P A;  4S0M A;  4CP5 A;  1K4Z A;  1HIY A;  2B8P A;  4FKX A;  1LEO A;  1XQI A;  1S57 A;  3VGT A;  3R9L A;  4UOH A;  4DI6 A;  3BBB A;  5IOL A;  1MN7 A;  3ZTQ A;  3BH6 B;  3FKB A;  4O0N A;  3ZTS A;  1KDN A;  3L7U A;  1WKK A;  1S5Z A;  2B8Q A;  3NGR A;  3DKD A;  3DDI A;  3VVT A;  4ENO A;  3FCW A;  3JS9 A;  3NGT A;  1NHK L;  1KQ5 A;  1LWX A;  1NSP A;  4KPC A;  1S59 A;  4WBF A;  3FCV A;  3EVM A;  2DXD A;  2DY9 A;  3EVO A;  4EK2 A;  2BEF A;  1NCL A;  2DYA A;  4HR2 A;  2AZ1 A;  4ANC A;  3FC9 A;  1NDP A;  2DXE A;  3BH7 B;  3WX8 A;  1NDC A;  4V02 C;  1NDL A;  3VGS A;  1JXV A;  1VYA A;  1PKU A;  1K44 A;  2BX6 A;  3BBF A;  1NB2 A;  3B54 A;  3ETM A;  1B4S A;  1BUX A;  1BE4 A;  3ENA A;  3Q89 A;  1WKJ A;  1NLK L;  3G2X A;  1PAE X;  4W98 A;  3ZTR A;  1EHW A;  1W7W A;  3VGV A;  1HHQ A;  3ZTP A;  3GP9 A;  1F6T A;  2VU5 A;  4FKY A;  1NSQ A;  2NCK L;  4F4A A;  1NUE A;  1F3F A;  1NPK A;  3Q86 A;  2B0R A;  1UCN A;  1NDK A;  3VGU A;  1K8F A;  5CAB A;  4AND A;  3FBC A;  3FBF A;  2YUH A;  3PJ9 A;  4UOG A;  2HVE A;  1XIQ A;  3BBC A;  3EM1 A;  3Q8V A;  3ELH A;  1MN9 A;  3GPA A;  4DUT A;  3EE3 A;  3EVW A;  3Q8Y A;  1NSK L;  2ZUA A;  4F36 A;  4DZ6 A;  5CAA A;  3MPD A;  4UOF A;  3B6B A;  5BXI A;  2DXF A;  3NGU A; 
#chains in the Genus database with same CATH topology
 4X84 A;  4UST A;  2K2P A;  3O6Q A;  1NBE B;  2KT5 A;  4FDF A;  1OGM X;  5ETV A;  3D1Q A;  2PEB A;  1GQE A;  2CJY B;  2R7O A;  1VBL A;  1G2E A;  1TMJ A;  3GJS B;  2QV6 A;  2LCW A;  3GFX A;  5KFJ A;  3ZTS A;  2JC0 A;  2XGP A;  3M8Y A;  3A3P B;  1KCC A;  4TY8 A;  4LF7 F;  4C0H A;  2VH7 A;  4OYX A;  1RT3 A;  3QLH B;  8AT1 B;  2VA2 A;  2ZBP A;  1SQE A;  2A1B A;  1CUL B;  4EGL A;  2W7A A;  4DL2 A;  4HDH A;  4GKJ F;  1YBU A;  2ASY A;  3CGI A;  1C0T B;  4QW9 A;  3VMW A;  2ILY A;  2MLZ A;  3BQ1 A;  2V2V A;  1SC6 A;  1F6T A;  4X65 F;  5D4N A;  5KFP A;  1LK7 A;  3QZ7 A;  2W25 A;  2X85 A;  1K8F A;  3J7Z 5;  2KH9 A;  3JXO A;  2HFZ A;  3MAQ A;  3D68 A;  4Q45 A;  4DV7 F;  1VRT A;  1UWB A;  5J1N A;  1H80 A;  1MG7 A;  1XTZ A;  1N33 F;  1FNM A;  3HD2 A;  2OFG X;  4E0D A;  2X51 A;  3CT9 A;  2XUL A;  2EK6 A;  1YDL A;  5KFT A;  3PYF A;  2JEI A;  3G9C A;  1RZM A;  2MTL A;  3CCS S;  3F44 A;  4DXL A;  2BMB A;  2BJD A;  1VQN S;  4OJH A;  2HS0 A;  1U49 A;  2JWN A;  2UUB J;  2UXC F;  2WW4 A;  1YQH A;  5B0A A;  3K58 A;  2W7P A;  2UU9 J;  1ROF A;  2HZV A;  4J9O A;  1JK9 B;  1U1M A;  3LMW A;  4JI5 J;  1LFW A;  4FNH A;  1FDN A;  5KFF A;  4IFY B;  2H48 B;  2XY7 A;  4YR2 A;  2DNL A;  2XNR A;  4B9N A;  4M5L A;  3HT3 A;  1G3O A;  1OQ3 A;  1VIS A;  2DIV A;  2DHA A;  1SL2 A;  1NB7 A;  4RO0 A;  2R7R A;  1KTQ A;  3B90 A;  2NXJ A;  4CLY A;  4EO8 A;  4JI8 F;  4FBU A;  2LEC A;  1FJG F;  3M2V B;  4URS A;  2CNN B;  3SZ2 A;  2BAN A;  1M1G A;  5K8M A;  3TA0 A;  2F8E X;  4EYI B;  4N76 A;  1XR6 A;  2BM0 A;  1H98 A;  3RIQ A;  2ZH2 A;  2OTL S;  5DLG A;  2R3V A;  5A6P A;  2VG5 A;  5KT7 A;  2HBQ B;  3HVT A;  5HO4 A;  4O3P A;  4ES2 A;  2OEL A;  3TAP A;  3K7R A;  3OTB A;  3N6L A;  3N9U C;  4WBF A;  3BV8 A;  1AFI A;  3BO2 A;  4J9M A;  3DDK A;  1VC0 A;  3QT6 A;  5A6W A;  4KHP F;  1UKU A;  2F40 A;  1XEZ A;  2GAH C;  3PXG a;  1IBL J;  3MR3 A;  4YB7 A;  1K0T A;  4GKK J;  4C2M A;  1C4A A;  2BQU A;  5HVH A;  1Q5V A;  3M7V A;  3A3N B;  4CYU A;  1M5V C;  2G4B A;  3EXC X;  2BE7 D;  4DUY J;  1LK5 A;  3M6U A;  4WFX A;  4DF8 A;  4ZPW R;  1RWU A;  2EFQ A;  3VHQ A;  2AZ3 A;  3C19 A;  3UNY A;  3JYT B;  1VQM S;  1DQ9 A;  1EZG A;  1L3V A;  4XL9 A;  2AJ1 A;  1R8A A;  3THP A;  3G8Q A;  1HNI A;  3I5B A;  2G1D A;  4WP8 A;  2B5J B;  1FNO A;  1FE0 A;  2B8P A;  2X6Y A;  4DI6 A;  3KHL A;  3DFE A;  4OYP A;  2ZC4 A;  4W4M A;  1VBY A;  4C48 A;  2MYF A;  5I42 B;  3CO0 P;  3NMA A;  2PMZ D;  3ILL A;  3BPD A;  3DHX A;  1X4G A;  2D9O A;  4DR6 F;  3C6T B;  3EVO A;  4YOE A;  2R8J A;  2CPD A;  5L1L A;  3CO9 A;  2OMO A;  2BDP A;  5EDW A;  3CC2 S;  4NI2 A;  1HW9 A;  3G2X A;  3A8E A;  4J9K A;  1RAH B;  2YH0 A;  3CDW A;  2NR0 A;  1AFJ A;  1SVD A;  2UVR A;  2ROE A;  2EG1 A;  2D1C A;  3H20 A;  2VBY A;  3QPI A;  1VBK A;  3UN3 A;  3Q8V A;  3PX6 A;  5CD4 H;  3RB0 A;  1AW0 A;  1Y3J A;  2HPU A;  2RD5 C;  3ICL A;  4NK8 A;  1LWE B;  1S72 S;  3C15 A;  4B3M F;  3MM8 B;  1KBR A;  1Q7L B;  2HVD A;  1JXE A;  2F8M A;  3DHW C;  1FK9 A;  4JI4 J;  1KRP A;  1TL1 A;  3ZZY A;  1RTJ B;  1MMD A;  4KO0 A;  4P6Q A;  2C3U A;  2VKR A;  1FFS B;  3FMB A;  3PVX A;  1IBM J;  4X2B A;  4F3O A;  2AHO B;  2K7J A;  4OYZ A;  4FNI A;  1M1H A;  3HDS A;  1DUR A;  2OH2 A;  2V0N A;  1KOO A;  1EB0 A;  3DOL B;  3IN5 A;  4XLH A;  4O4G B;  3KLE A;  4DV5 J;  3NNC A;  2XTX A;  1QE1 A;  1KON A;  4HT5 A;  2CQC A;  3VGS A;  2OPP A;  1U6Z A;  2DNR A;  1SH2 A;  4X64 J;  3U1M A;  1N5Y A;  1NPK A;  4GVL A;  5JXS A;  4AND A;  1HQE A;  1S7H A;  3GG0 A;  1M1K T;  2U1A A;  1SH3 A;  1NK9 A;  4XQF A;  4M5N A;  4W8S A;  4O23 A;  1TVR A;  1TU0 B;  2YPZ A;  1S6Q A;  3M9M B;  4JP8 A;  3GJT B;  2MZR A;  2K1R A;  1SKU B;  3C8Y A;  2OPR B;  3IR6 B;  3RTV A;  2CJ9 A;  4U95 A;  1KR4 A;  3CCZ A;  4IH7 A;  2VB6 A;  3TJ8 A;  1FX2 A;  4DU8 A;  1I5O B;  2YWE A;  4J9R A;  2O1D A;  3T1Y F;  1NJW A;  5SZT A;  5KFD A;  3LAK A;  3ZTQ A;  4DUZ J;  4DR7 J;  1X0P A;  3AY0 A;  2G2Y A;  1LXJ A;  4RW9 B;  4C0B A;  3V6H A;  2VBK A;  4MKA A;  3H4D A;  3BDP A;  3NLC A;  4FS1 A;  2G0Y A;  3FRZ A;  5E3Q A;  1HNZ F;  2GIQ A;  3RW6 A;  3GJR B;  2YWK A;  5DO2 A;  4Z7C A;  1SJR A;  1Z4U A;  1JXV A;  1FDB A;  3ISN D;  4V19 X;  1FWP A;  3B4N A;  2VKZ G;  4C8L A;  1U0H A;  2RML A;  4F04 B;  4F3M A;  3CME S;  4ILM A;  2PD1 A;  4ITS A;  2C1E B;  1O8H A;  1JLE B;  4DSL A;  3OR2 B;  3G6X A;  2G1H A;  3QT7 A;  5ETS A;  4YDT A;  3HCX A;  2IDL A;  3J7A 1;  4OZ3 A;  3UO0 A;  1XN9 A;  2L48 A;  1IKV B;  3GFY A;  4RL1 A;  1E6V A;  3NCQ A;  1FJE B;  3DLK A;  2DGT A;  3ZZO A;  2RQK A;  1Z2Z A;  2VFQ A;  4NLQ A;  1G1X A;  4RLE A;  5C2C A;  4XN3 A;  4HH0 A;  1Q7Y T;  2BSP A;  2NUU G;  3R9L A;  3G6E S;  2O5D A;  3BH6 B;  3I9V 9;  3M1V A;  1XWL A;  5I3U A;  2RVJ A;  1T03 B;  3AQP A;  2CYY A;  2NXE A;  1EQM A;  4CO4 A;  1WG1 A;  2LXF A;  2CQ0 A;  3R2C J;  3PRB A;  2LU1 A;  1F0X A;  2R7Q A;  4DCJ B;  3M8R A;  1W25 A;  3KJV B;  3FMW A;  2ATC B;  2ATL A;  3KK1 A;  2R8G A;  3EM1 A;  1VK3 A;  4JRA C;  4HTI A;  5LMN J;  1MN9 A;  1PO6 A;  3W63 A;  4JI1 J;  4C3M A;  5AJ3 F;  3DMJ B;  2GML A;  4EWT A;  2YY3 A;  3W3S A;  3SQO P;  1BHE A;  1JJC B;  3LOU A;  3ZTO A;  1X4E A;  2KDO A;  4KSE B;  2XLI A;  1RAC B;  1HKA A;  2RSQ A;  4MK7 A;  1H73 A;  4ZN3 A;  3P5T L;  2RIJ A;  2DGV A;  3ENV A;  1N6Q B;  1V3R A;  1WEL A;  4PWW A;  4Y2K A;  4ED7 A;  4OYM A;  1FKP A;  3HJF A;  3V81 A;  2CQD A;  2VA3 A;  5AXM A;  1LWX A;  4OHZ A;  1UW4 A;  2RKI A;  3NAH A;  4ZVO B;  4TU8 A;  4AUK A;  1AIR A;  2AF6 A;  2V94 A;  1KWM A;  1YWX A;  4OQJ A;  2KFN A;  3BH7 B;  1HWK A;  1RWX B;  1T11 A;  4RKU C;  4F4X A;  3J7Y I;  1I94 F;  1TYW A;  4USK A;  1FKO B;  3M32 B;  3CDU A;  3MMA B;  1HR0 J;  3WDO A;  2V4R A;  3CCL S;  5H9E K;  1J27 A;  1XJW B;  2R2R A;  3M8S A;  1Q82 T;  4JV0 A;  2VQE J;  1DBG A;  2DB1 A;  3IRX A;  1TQL A;  1Y5L B;  1F9E B;  4ZJL A;  3H90 A;  5K8N A;  2QLW A;  1S6P B;  2JVO A;  1TR0 A;  1JLG A;  3QJP A;  1NKB A;  2GC8 A;  1RAO A;  4TQS A;  3AB4 B;  3OSN A;  1B99 A;  1LOU A;  2NPI A;  4TN2 A;  1KVJ A;  2JH3 A;  1DTT B;  3F73 A;  2O1P A;  1P8G A;  1VRU A;  3VGT A;  3GII A;  2NTB A;  3PM9 A;  2F63 A;  2J9D E;  2B8Q A;  4DV2 F;  1N0U A;  1REV B;  3K89 A;  3Q8Q B;  5F8N A;  3F56 A;  1Y5N B;  3UPF A;  3PRD A;  2DY9 A;  3NP5 A;  2I0X A;  1T9U A;  3PFE A;  3GWC A;  1NDC A;  1UEV A;  3OXG A;  5D78 A;  1PC5 A;  1RLD A;  5J2Q B;  3KLI A;  3OVS A;  2FDN A;  1RT6 B;  3A4T A;  5J1E B;  2ZNZ A;  2KB2 A;  1U2R A;  3FEY B;  3M6X A;  3O2I A;  2YKM A;  4KHM A;  4F25 A;  5HVF A;  4DDF A;  2UVE A;  5KFH A;  1VGY A;  3KLG A;  4X4V A;  3KLE B;  3IRW P;  3VQS A;  2EXU A;  5E0O A;  2FJW A;  4QU7 A;  1MNE A;  3A8J A;  4O44 B;  5D0E A;  5LT5 A;  3BR8 A;  4JI2 J;  2RJZ A;  1HYS A;  1TK0 A;  2CAD A;  3GYX B;  3LP1 A;  4RWW A;  3BGR A;  4YN3 B;  1S10 A;  2MHN A;  2AGQ A;  3FKB A;  2HBZ B;  3D6F B;  2JLE A;  3BDE A;  2R2U A;  5HRO A;  3UD4 P;  1ZH5 A;  2WOM A;  4N47 A;  3MUM P;  4C2L A;  3QT5 A;  1EP4 B;  3PAC A;  4LF2 A;  3RYL A;  1S0M A;  4LFC F;  2YKO A;  1LW0 B;  5FD1 A;  3VZH A;  2IM0 A;  4K4X A;  3JUR A;  3D67 A;  2KZZ A;  2M8H A;  5HSP A;  4QYR A;  3HT0 A;  3DLE B;  4P2M A;  3MMC A;  4L72 B;  4MAK A;  4ZVG A;  2MQQ A;  2O6W A;  1W2I A;  3E3X A;  4Q8F A;  1URN A;  3NGK A;  4K2X A;  2WB4 A;  1HLW A;  3SDE B;  4J9V A;  4L74 A;  1I51 B;  3TZY A;  2DGX A;  1TL7 A;  4AXI A;  2A2D A;  2GMH A;  1VIO A;  3P4G A;  1FWL A;  3DU6 A;  4DV1 J;  2HNZ A;  3CJ5 A;  5E7O B;  3PW7 A;  4EZ6 A;  1RWV B;  1F60 B;  5CXT A;  1VQK S;  1UVL A;  3MDF A;  3UI3 A;  2HHH J;  3EUN A;  1QRB A;  2R7W A;  3WX8 A;  1IUJ A;  3HVA A;  1VIX A;  2CA9 A;  1TL5 A;  4KBI A;  1O8M A;  1N4L A;  3ITH B;  1NK0 A;  3NNH A;  4B3T F;  2A3J A;  3HD1 A;  1DRZ A;  5IM0 B;  4J90 A;  4LSL B;  4C0O C;  4NOH A;  3OLB A;  5GAG U;  1WMR A;  3MTJ A;  4WPA A;  2V69 A;  2E1P A;  3FNN A;  1S6O A;  4W8R A;  3TUZ C;  2FGO A;  2NS1 B;  2YWW A;  2XYP B;  1M0S A;  5I3U B;  3BN7 A;  5T14 A;  3EDQ B;  4WU3 A;  1ZPV A;  2BUN A;  3G8T A;  4LF9 J;  2HGM A;  3ZO7 A;  3LO3 A;  4NMX A;  1R27 B;  3BF4 A;  4X66 J;  3QBC A;  2XYG B;  4XDC A;  4CLK A;  4A8F A;  3EYZ A;  2VG7 A;  3BSC A;  4KQZ A;  4ICL B;  5A8R B;  3S01 A;  4ILL A;  3UN5 A;  3KG0 A;  3ULH A;  3TNV A;  2JLG A;  4O3N A;  3FY3 A;  3DRS A;  2FQQ B;  2CQ1 A;  3RBZ A;  2VBW A;  3W2V B;  3DRP B;  4CTA B;  3LF0 A;  3BGU A;  3GJQ B;  3EX7 B;  4RU9 A;  2AZ1 A;  2C42 A;  1N34 F;  4DMZ A;  1ZPW X;  2HMI A;  4N5S A;  2FHJ D;  3TZZ A;  1D09 B;  2UUC F;  3KMQ A;  2E7W A;  2LA6 A;  1SJQ A;  1TL3 B;  4AL7 A;  2OO4 A;  3MCS A;  2RF2 A;  3JSB A;  2BRK A;  2ZHB A;  3BB5 A;  1BXN A;  1HG8 A;  2AWZ A;  1UEK A;  3OT9 A;  4FXV A;  4K4S A;  1KHV A;  3S6E A;  4DN0 A;  4I64 A;  4F4Y A;  4WWS A;  2BKP A;  1IWG A;  1APS A;  2AYE A;  5I3P A;  3NGU A;  1VQP S;  3RRH A;  1SQG A;  3PZP A;  2V2Q A;  2RRB A;  3TX0 A;  1BQN B;  1H2T Z;  2BOA A;  1HBN A;  2M70 A;  5LMU J;  3D54 A;  4GVB B;  4OX6 A;  2R7X A;  4ED0 A;  3MCM A;  2BM4 A;  1Q53 A;  2X6X A;  3SCK E;  4ZIV A;  1WTF A;  3W5Y A;  1IM6 A;  4PG5 A;  3QAE A;  2MKY A;  1FRX A;  4CI0 B;  1NZ8 A;  2VBX A;  2MQM A;  1U1P A;  4P52 A;  1R0B G;  4IUF A;  4LSZ B;  2H9Z A;  4NLR A;  2EFN A;  3ETM A;  5L8R C;  1XMO F;  3ZSC A;  3NS7 B;  1TK8 A;  3FBC A;  4RW7 B;  3D3C J;  4ZPV R;  2F65 A;  3MAH A;  4ZHR B;  2DR8 A;  1HNW F;  1FJ7 A;  4PG4 A;  2W2Q P;  3LA0 A;  2COL A;  3LAL A;  2Q3P A;  4H54 A;  3R3T A;  3GQ8 A;  1R7I A;  1QRC A;  1RKI A;  4PQU A;  5M2U A;  4DCP B;  2FJD B;  2IAJ A;  2P6S A;  1WXR A;  1YRU A;  3GG1 A;  1GX6 A;  1PCA A;  4KE5 A;  3NL0 A;  4ZPA A;  3PDN A;  2LQJ A;  2V8H A;  4EBC A;  2CRL A;  3EPG A;  4G1P A;  2KFY A;  3TUJ C;  2HQG A;  1K0V A;  2PYG A;  1QAX A;  4E2F B;  2OML A;  3HHL A;  2DEI A;  1REG X;  1GQ8 A;  4ECZ A;  1OWX A;  1S1W A;  4OI1 A;  3N28 A;  4KPY A;  3W62 A;  4HR2 A;  2E5I A;  1T8E A;  2PI5 A;  3QSI A;  2D41 A;  2HIQ A;  3DRR A;  1O8I A;  2OHD A;  3POT A;  2AEM A;  2V63 A;  4B3R J;  1U26 A;  3FCH A;  2DO4 A;  1WHV A;  1HW8 A;  2DT9 A;  2RDJ A;  1KVK A;  2I5J A;  2UUA F;  3JQJ A;  1Q86 T;  3BYP A;  2B4P A;  3DI6 B;  2JEJ A;  5FII A;  2HGL A;  3MTK A;  2W8K A;  2RE1 A;  1BHN A;  3US5 A;  5HJX A;  4J7C A;  6AT1 B;  1N8R T;  3G82 B;  3RAX A;  2O0V A;  4X4T A;  1U1L A;  3ZXW A;  5D0G A;  2VQF J;  3HSG A;  1SPB P;  3H5S A;  1SI9 A;  3M6V A;  1VOM A;  4F7V A;  2XMW A;  4C3K A;  1YGY A;  2QSW A;  3NBP B;  5HMZ A;  1KN6 A;  2QLB B;  2BJ9 A;  1MSW D;  2OEK A;  1H72 C;  4A8O A;  1G6B A;  3JTP A;  1SV5 A;  5IC4 B;  2W4D A;  4ALZ A;  3M8Q B;  4I2P A;  5IZH A;  1NJX A;  1JLA A;  2IC3 B;  2H5J B;  1T3N A;  2VIH A;  5M2P A;  1Q0N A;  1YRX A;  3PO5 A;  2GW8 A;  4OX8 A;  1RT1 B;  4WII A;  2UV8 G;  1F3F A;  3CCW A;  2Z2Y B;  4M5D B;  1TL7 B;  3DGP A;  1UMJ A;  1EIY B;  2CPJ A;  3KLF A;  3I5A A;  1WHW A;  1XIQ A;  2B3T B;  3N01 A;  2XMT A;  3QZ8 A;  4KY3 A;  2ZM6 J;  4DSF A;  3EXY A;  3CCQ S;  3EE3 A;  4F4W A;  1N5V A;  3FK4 A;  1RAD B;  1P1T A;  4BWM A;  1U1R A;  4K4Y A;  1IKY A;  2RRA A;  4O4R A;  4RWX A;  4Y6I A;  2BAC A;  3MPW A;  3IO1 A;  2ZH5 A;  2MKC A;  4QBU A;  5ETP A;  4DR1 F;  1V5V A;  4OZ1 A;  2RHQ B;  3LGN A;  4HAC A;  3LP0 B;  5DLF A;  1F5B A;  2GQQ A;  3BGF A;  4OFZ A;  3CTR A;  3K59 A;  2P9E A;  3AH6 A;  2DCL A;  1SQF A;  1M5S A;  4DV3 F;  4YME A;  2GCF A;  2OTJ S;  4LRC A;  4YEA A;  2C3O A;  5E3R A;  4B9M A;  4XIU A;  2K06 A;  4NA1 A;  3MMB B;  3DM2 B;  1CZF A;  2NSB A;  4DV7 J;  1CLF A;  4PCQ A;  2HQ3 A;  3K5L A;  1L3K A;  3TEH B;  5I3Q A;  4FF1 A;  3AK5 A;  3K17 A;  4ECT A;  1JJH A;  4RUC A;  1TUG B;  2DXF A;  4H4O A;  1RJJ A;  1S1T A;  3CVK A;  2E1C A;  2DGU A;  4CT8 A;  2IM1 A;  4IG3 B;  1O8B A;  5EX3 A;  2NXN A;  1D1U A;  2BR0 A;  1VQ8 S;  1X4D A;  1QD1 A;  2QXZ A;  3SV3 A;  3GTY X;  4OJP A;  1HIY A;  1YRT A;  4ZCI A;  1PE9 A;  5L9N A;  1LM1 A;  3CIZ A;  2XS2 A;  4NLU A;  4JI6 J;  4K59 A;  3OW2 R;  2DO0 A;  2X1F A;  4F26 A;  4OZL A;  2Z58 B;  4U6P A;  4ZK7 M;  3LPY A;  1DQA A;  2MLX A;  2GVD A;  4MMO A;  2HHP A;  5F0W A;  2D7S A;  4CLT A;  2V4Q A;  4DR2 F;  2CDQ A;  2GMJ A;  1RSC A;  3HXM A;  2FHO B;  4HH1 A;  4WP3 A;  2C2N A;  1M5O C;  1WSR A;  4JI0 J;  2Z8Q A;  1J5E F;  3OTO F;  1FJG J;  4CT9 A;  4G65 A;  2ZJR Q;  2AYG A;  1WOS A;  4P72 A;  4ED4 A;  1KVI A;  5EWF A;  2J0S D;  3PW0 A;  5KFK A;  5FDL A;  3OUY A;  3JQM A;  2KYZ A;  4OZJ A;  4ZVS B;  4W8Q A;  1RBA A;  4FPI A;  2N7Y A;  1RAA B;  4JV1 A;  3OLA A;  4KGM A;  3TA2 A;  5KFS A;  5AXK A;  2ZH4 A;  1IA5 A;  2PGC A;  3QT8 A;  3KK3 A;  4BC7 A;  4QW8 A;  1ZAX A;  3SSQ A;  4A48 A;  4KHP J;  4OZY A;  2P5V A;  2DXE A;  4R8U A;  1WF2 A;  3BRE A;  5A8W B;  1VQ6 S;  2BJ1 A;  1CJT A;  4ZCK A;  2MQO A;  3I82 A;  1S76 D;  4LSN B;  1WOR A;  4CRJ A;  1XMQ F;  4PQU B;  2OPQ A;  1U4B A;  2W2O P;  2FLP A;  2N3L A;  5L38 A;  1DFD A;  4NK6 A;  3EGV A;  3T9G A;  4FN5 A;  4C9D A;  3QIP B;  3TVZ A;  3S7R A;  2ZBI A;  2R8H A;  4JI3 J;  4OHY A;  3VSU A;  1X31 C;  4YR3 A;  2R4F A;  1Y3K A;  2DRD A;  2QLF B;  4PAA A;  1QA2 A;  2XI2 A;  4I6Y A;  1FF2 A;  3UW0 A;  4C6A A;  2VFO A;  2Z57 B;  1NKC A;  1RAI B;  5GVQ A;  1GH8 A;  1Y4Z B;  1K5C A;  3FJ2 A;  2C3M A;  1X9M A;  2LKZ A;  5GAE I;  2XZT B;  2VAS A;  5LJ5 Y;  4RNO A;  1KP6 A;  1RAG B;  3MD1 A;  4KR0 B;  3TJ9 A;  3F0N A;  3G71 S;  3AHP A;  2AGO A;  4AQY J;  3DDI A;  3MF5 A;  1F2G A;  2GQ2 A;  3FCW A;  4DV4 J;  3KLV A;  2I5J B;  4KPC A;  3MAA B;  2MDA A;  4YB6 A;  3CUL A;  2EFV A;  4IKA A;  1B0T A;  2B4V A;  1SC3 B;  5C5J A;  1JLC A;  4HWV A;  2LEA A;  2XTJ P;  5D0H A;  2OSQ A;  3W9H A;  5BJR A;  3JTN A;  1NH7 A;  2RIL A;  4NLT A;  3JSM A;  4RW6 A;  1HBM B;  1T0T V;  3BYR A;  1EAR A;  3TW0 A;  2DNY A;  2IA0 A;  4PR6 A;  3MPV A;  4ERD A;  1Q8B A;  2DKO B;  1T05 B;  4MYT A;  1BQX A;  2DR7 A;  2HW3 A;  2UUT A;  3CB4 A;  2L41 A;  4OJ5 A;  1S1X B;  2F1F A;  1FFG B;  5HL7 Q;  3CJK A;  2RU9 A;  1C1B B;  4YZA A;  5B0G A;  1HA1 A;  5D77 A;  1GK8 A;  3TWZ A;  2AT1 B;  1WOO A;  2DIU A;  3EMT A;  2KTQ A;  4ATN A;  3KK2 B;  2V6A A;  2KVQ E;  2J9C A;  3RBE A;  2I6W A;  4NA3 A;  4YDD B;  1BC6 A;  2EEY A;  4AXJ A;  3HO1 A;  4H4M A;  4XPC A;  3GIR A;  4NPO A;  4K0K F;  5F0U A;  4ZA1 A;  2QY1 A;  1UTA A;  3AFG A;  2R9L A;  3M2R A;  4IDK A;  1HI1 A;  2W2P P;  2YWH A;  4UY8 T;  1RYS A;  3BBF A;  3GZ7 A;  1AB8 A;  2ZC3 A;  2CKW A;  5DDO C;  4DR4 J;  1IKX B;  1NM2 A;  1VK8 A;  1VHI A;  3IWX A;  4DFP A;  2AKW B;  1PG5 B;  3C14 A;  2CVE A;  2Z30 B;  4RPF A;  3OFH A;  1MU2 B;  4EBD A;  3PEH A;  2KL8 A;  2LLZ A;  3R1H A;  4DHV A;  4KHR A;  4ED1 A;  3HKZ D;  1KQF B;  4HAC B;  1Q78 A;  4ZPB A;  2HVZ A;  3D6H B;  2QIF A;  2YNF B;  1WNE A;  4C3L A;  1HMV A;  3LH2 S;  3UDE A;  4JUZ A;  3B78 A;  2ZHA A;  4JI7 F;  3QQC D;  4WTY A;  3MM7 A;  4CLU A;  3UCU P;  1NHU A;  1BGX T;  5D15 A;  3W1Y C;  2GIR A;  1RT5 A;  1S57 A;  4WE1 B;  3UWT A;  4HHU A;  3BO3 A;  4Z06 A;  2J0W A;  3I31 A;  1JQG A;  3WX4 A;  1T95 A;  1HNZ J;  4NLS A;  1B3T A;  5EHH A;  4M63 A;  2FYX A;  4R5P A;  2MY8 A;  4EK2 A;  5KG7 A;  1C1C B;  3MFI A;  4A46 A;  2BQR A;  4YDX A;  1NB2 A;  3Q2S C;  1NXI A;  1U8S A;  4EMD A;  1O8K A;  2G0J A;  3PW5 A;  4USI A;  4LF8 J;  2VJV A;  1BWE A;  1BQM B;  2AX1 A;  2XQC A;  2WON A;  4A8M P;  1TFY A;  3PFO A;  1OSD A;  4OZ0 A;  4RUB A;  3K5P A;  1IDK A;  1WF0 A;  2E5L F;  1RT4 A;  2KI2 A;  1UPP A;  2GVD B;  2ASL A;  3T5L A;  3CJ4 A;  1VQ7 S;  1WUU A;  3W5Z A;  1QJV A;  2LEP A;  3HJV A;  1RWM B;  3GIM A;  2FD2 A;  3MM5 A;  2DNZ A;  3C46 A;  2R42 A;  1ARO P;  2PMW A;  2E9R X;  4TVA B;  4NXN J;  4UOC A;  3VVT A;  1FX4 A;  2ZKT A;  3RJM B;  3M2U A;  3OHB A;  3BSN A;  1IR1 A;  1HBU B;  1KLN A;  1YBA A;  2DEJ A;  1NDP A;  4XKV A;  4XAK A;  2MZJ A;  3I0R A;  4DG1 B;  4ES3 A;  1VMB A;  2WVB A;  3MWB A;  2B6A A;  3A1Y G;  5FJ4 A;  2H54 B;  1S0O A;  2Q79 A;  5DGB A;  1M5P C;  2BW7 A;  2MXY A;  1LWF A;  1U09 A;  5BR8 F;  1WAC A;  2YKP A;  1U2C A;  3MM9 A;  4ER8 A;  4ZVP B;  2FJB B;  4LUB A;  3IS9 A;  3OV7 A;  2BJ8 A;  3GQ9 A;  1P9Q C;  3KK3 B;  4OX9 J;  4LF6 J;  3O3L A;  3GE9 A;  1TYX A;  5KOW A;  2VJI A;  4QPT A;  3ZZT A;  2Y0S D;  3LWM A;  2UVV A;  1PYT A;  1S1V B;  1CJT B;  3ISZ A;  1VQY A;  2Q66 A;  1JKH B;  1GMU A;  3IR5 B;  1DBD A;  2P6T A;  1KDN A;  1S5Z A;  1FKA F;  2OPQ B;  5IV3 A;  3JQK A;  1VI7 A;  5LJ3 Y;  1RAB B;  3GR1 A;  4PMH A;  3ZNJ 1;  2ACM A;  1UW9 A;  2DCU B;  4GO7 X;  2I38 A;  4JV5 J;  1U6F A;  2DPI A;  2W7O A;  3H5Y A;  4V02 C;  2C2D A;  3AD8 C;  2IIH A;  2X1B A;  4OLP A;  3SQG B;  2CJX B;  5AXN A;  3NAI A;  1QDU B;  1CUL A;  3AJ2 A;  5DNS A;  2HFN A;  2NCK L;  1DBO A;  1VC5 A;  3CXC R;  1GEH A;  1D8Y A;  4P2F A;  1MW7 A;  1C0T A;  4DX7 A;  4DV6 J;  4DPW A;  5GME A;  4B9U A;  2KN4 A;  2HFV A;  2XMJ A;  2ZVI A;  3UCZ P;  1V5I B;  2J6T A;  4U7C A;  3R5B A;  3NRB A;  4HDG A;  2XT4 A;  4WYL A;  4OJ3 A;  3G96 A;  3KUH A;  5B0D A;  3OL9 A;  4ETX A;  4ZKA A;  1YZ7 A;  1DTQ B;  2J6S A;  3GU0 A;  1OPI A;  1JLC B;  3BSO A;  2NXU A;  2HHX A;  2PEC A;  4OMF G;  4DV2 J;  2R7U A;  5L1K A;  4I56 A;  1MN7 A;  5HLF B;  3P6Y C;  4ZVQ B;  4RW6 B;  4YFU A;  3IWN C;  2B9W A;  4KKO B;  2M9K A;  4OHX A;  4LFB F;  5IT9 Y;  1NCL A;  5KT2 A;  3F41 A;  1K47 A;  3SSS A;  1TKZ B;  1T02 A;  1K44 A;  5MLC V;  2QFJ A;  2Z2Z A;  1OFE A;  2IBO A;  3ZTR A;  1GMW D;  4IFY A;  3GP9 A;  5E33 A;  2UUB F;  2J6U A;  2J0Q D;  4YR0 A;  2NRE A;  4MFB B;  1SJ1 A;  2UU9 F;  4NLV A;  4JI5 F;  1UPM B;  2CJQ A;  4URR A;  4OZ5 A;  5ADZ A;  5T41 A;  2C3P A;  2KZM A;  4X62 F;  3E01 B;  4K8R A;  3MEG B;  3IBW A;  1JLF B;  1S48 A;  4H4M B;  1XNR J;  3SCJ E;  2P9C A;  4K4Z A;  9ATC B;  5A0Y B;  3R6G B;  1HPZ B;  4Z03 A;  3NOG A;  4ELV A;  2CG8 A;  2WVE A;  3M2V A;  3KLH B;  3ML3 A;  2LA4 A;  1X4H A;  2GHV C;  2ZHO A;  2YQ3 A;  3SFG A;  3KJQ B;  3NMR A;  1XR5 A;  2XZD B;  1WC1 A;  2O04 A;  1FRJ A;  2C2M B;  1UJ6 A;  2BW2 A;  1Q8K A;  4D3H A;  2M88 A;  1I3O B;  1WKK A;  4P10 A;  2VBE A;  1M90 T;  2HFO A;  3NG8 A;  4V19 J;  4LT6 A;  4Y2M A;  2BJ3 A;  2IHR 1;  4C8M A;  2BE9 B;  5B0B A;  4ZLN A;  3MEE B;  3UR3 C;  3K57 A;  3SY2 A;  2MMY A;  2PN6 A;  3B54 A;  3FEZ A;  1YJR A;  2HS3 A;  2UXB F;  3RB6 A;  3C2P A;  2V9K A;  1GAO A;  5GMD A;  3G86 A;  3T9Z A;  5KFM A;  1AZS B;  3L9Z A;  3PHT A;  2KHC A;  2LQ8 A;  2DJW A;  2ZZN A;  2B56 A;  2FUG 9;  5U47 A;  4JBC A;  3FZ2 A;  2VBM A;  1D9A A;  4DL5 A;  3WC2 A;  3QJL A;  3EQN A;  4F36 A;  2CPX A;  1WF1 A;  1RWO B;  5A2Q U;  2AMC B;  1IBL F;  1NHV A;  2UVF A;  3IXQ A;  1NRK A;  1IJF B;  4GKK F;  4XK8 C;  4I7F B;  3TVK A;  5KFU A;  4LRD A;  2HHV A;  2P9G A;  1H6K X;  4J9S A;  1OO0 B;  2QMW A;  2JC1 A;  3FRY A;  3HSD A;  3JYT A;  2K3K A;  4Q8E A;  3OSP A;  2QLJ B;  4DUY F;  2B5J A;  5ETN A;  4CO3 A;  1XNQ J;  4YZ0 A;  1RMG A;  4J9Q A;  4LFA J;  2QFI A;  2XCA A;  3N79 A;  1S9E B;  3MCO A;  4NXM J;  3R7B B;  3GV5 B;  4F4Z A;  3PG9 A;  3T1A A;  5I42 A;  2LXI A;  1BN8 A;  3H2V E;  2KXH A;  3C6T A;  3PEJ A;  2GJF A;  1VQ9 S;  1RWN B;  2QMX A;  4TY9 A;  2EC0 A;  2O67 A;  4TYB A;  1O8F A;  5KFC A;  2V5I A;  3MFH A;  4NL5 A;  4CLZ A;  3HHK A;  4ELU A;  2DNO A;  2KXF A;  5DQG A;  3W60 A;  2HZC A;  2FPH X;  3H0P A;  5C25 B;  1YX2 A;  1OJ4 A;  3QAU A;  4DR3 F;  3QRP A;  2PFF B;  1ZOT A;  3RUB L;  5IWA F;  2LVW A;  2UP1 A;  2W2M P;  4LQ9 A;  3HHD A;  3CJ8 A;  3C16 A;  1LWE A;  1VR6 A;  3MM8 A;  3CJ0 A;  3CC4 S;  2J7K A;  2HBR B;  1RTJ A;  4Y2I A;  1JLB A;  4S0M A;  2ACY A;  4Y65 A;  2Z2M A;  3J81 Y;  3TUP A;  1X0C A;  5BYR A;  1VRQ C;  2FY8 A;  1KC8 T;  5CCM A;  4DR5 F;  5AMV A;  3MR7 A;  2W9C B;  1N34 J;  2L9D A;  4J5O A;  1Q4R A;  3GRH A;  3DOL A;  2IA6 A;  5CD4 A;  2G9O A;  3KOA A;  3RAQ A;  2OPS A;  1HNV A;  1R0A B;  4O4G A;  4IH5 A;  2HWT A;  1QAI A;  3RBX A;  2F9J A;  2OKQ A;  2X6W A;  1TKD A;  2IRX A;  3Q89 A;  2W9B B;  2NST A;  4NEY A;  5IQQ A;  2W4P A;  1R6V A;  1JLQ B;  4YC5 A;  4RW4 B;  1VC6 A;  1ZET A;  2V2Z A;  2J9E A;  1TV6 B;  4DV5 F;  3MEK A;  2POK A;  3CJ3 A;  4KH1 B;  4DBQ A;  2CAJ A;  1X5S A;  2VFN A;  2LDI A;  4CQ1 A;  3N4W A;  3TEG A;  3GIJ A;  1JRG A;  3EZU A;  4X64 F;  4C8O A;  3PW4 A;  4RUH A;  3FBB A;  5F3T A;  1CJK B;  1JJ2 R;  1J5O A;  2OPR A;  2UVW A;  1NEE A;  4EYH B;  4CP5 A;  2VF3 A;  2AIR B;  2ZVS A;  1IQZ A;  5AE3 A;  5IOL A;  2XNQ A;  3Q23 A;  2J8K A;  1UVI A;  3GYN A;  4ZIW A;  3OHA A;  2XTW A;  1O0P A;  4TYA A;  1WG5 A;  3PIP Q;  5EN1 A;  1TKX B;  3FSX A;  1U1Q A;  1JMT A;  3KTQ A;  2CQ3 A;  3W65 A;  4RW9 A;  2XMU A;  1OQ6 A;  3TZX A;  4NLX A;  4F3Q A;  4FF2 A;  2IVM A;  2JOQ A;  3IBF B;  1OGO X;  1XMO J;  4OPW A;  4PZV A;  2XSJ B;  1B4S A;  1BUX A;  1Q8L A;  2LDY A;  2XMV A;  1WKJ A;  4QZV B;  4DUZ F;  1SJ3 P;  2ZH6 A;  4K50 A;  3UCG A;  4DR7 F;  5JLV C;  3TAQ A;  4ZVU B;  3GCX P;  3VQT A;  2Z2L A;  3BGO P;  4M95 A;  5HMX A;  1HAR A;  4YB5 A;  4CM0 A;  2FLO A;  1SB6 A;  3AJD A;  1J2V A;  2LP4 A;  4WZQ A;  1HNW J;  1SUQ A;  4TLQ A;  1S1U B;  1TAU A;  4ZMM A;  1JLE A;  2E44 A;  3V6D B;  3NGD A;  4J37 A;  3OR2 A;  5D4P A;  3LPE A;  4C4W A;  3I9Z A;  2YBV A;  4WKR A;  2VV5 A;  2VFT A;  3ADA C;  3HSJ A;  5DRK A;  3OD2 A;  2FC8 A;  1IKV A;  3TAR A;  3M9N B;  4MK8 A;  1NND A;  2EPI A;  1K1Q A;  4UUX A;  3M6W A;  4ZS6 A;  4EO6 A;  1K8A T;  3TAN A;  1Y9O A;  1RGV A;  2XWX A;  5B0C A;  2EW9 A;  5C42 B;  4DSJ A;  2CNK B;  1T03 A;  4LVO P;  3MI7 X;  2ZZM A;  4RX6 A;  1RE1 B;  3MXH P;  1EHW A;  3PKY A;  2VFV A;  1YVF A;  1LWC B;  2M2B A;  2V5H G;  3KJV A;  2ZBQ A;  4B9L A;  1AYE A;  2QL5 B;  2DHG A;  3V6K A;  4A8Q A;  4ECQ A;  4XOR A;  1PGZ A;  3EQO A;  2Y1R I;  3P4U B;  1RHU B;  3DMJ A;  2H65 B;  4W90 B;  2HWH A;  2DHH A;  1MWQ A;  4FS2 A;  5ETK A;  1IBC B;  3D6M B;  3CCR S;  3CC7 S;  3T1H J;  2ZOM A;  1R0C B;  1QJH A;  5L46 A;  2QL9 B;  5LMN F;  2VDH A;  4JI1 F;  3ZZU A;  1C2P A;  2YKN A;  4CDI A;  2V4J B;  2FTR A;  1N6Q A;  5CYJ A;  4PUO B;  3AD7 C;  4WK1 A;  1VFJ A;  1D9D A;  5IT9 U;  3DLL Q;  2ALZ A;  4ZP8 A;  4N8N A;  4MK9 A;  2JVR A;  4CH1 A;  5MAO A;  5HQ8 A;  4HKQ A;  1RLC L;  4H4K A;  3ILI A;  3OXL A;  4X4S A;  1FD2 A;  1T94 A;  4USM A;  1X8D A;  2CQB A;  4YEL A;  2VU5 A;  1IR0 A;  5ETM A;  1EET B;  2ZH8 A;  3SEO A;  3GQC A;  5DJB A;  3WQP A;  1N52 B;  1MWY A;  3Q24 A;  1O8E A;  2DR6 A;  3WWG A;  5KFA A;  4QOT A;  4C8K A;  1FKO A;  3M32 A;  1UET A;  5GAG I;  1QSS A;  2HZA A;  1IBK F;  3MMA A;  1Z2L A;  1YJ7 A;  3BGL A;  5LSO A;  1DAX A;  1L3T A;  2KXN B;  4RBV A;  4DWI A;  1S6P A;  1MWZ A;  1L1I A;  2M0G B;  3WZ0 A;  1IKW A;  1HR0 F;  4PXD A;  4NZ6 A;  2V2K A;  3H09 A;  3DLH A;  1NHC A;  1IN0 A;  4WJB A;  2ZDP A;  2VFP A;  2DHX A;  3TQ1 A;  3MUR P;  2CPH A;  4O3R A;  1DTT A;  1U2F A;  1HWL A;  4OI2 A;  2WSF C;  1IDJ A;  1R43 A;  4NRT A;  5I4M A;  3LGH A;  4DV3 J;  1REV A;  3QO9 B;  4R25 A;  3GYG A;  1P9Y A;  2DYA A;  2BOP A;  3FC9 A;  1K1S A;  2B51 A;  4DPY A;  3I0S A;  3W2W A;  1PKU A;  4A8X A;  2OFH X;  4YHH J;  2Y8Y A;  1PIL A;  2N3O A;  3C16 B;  4ED8 A;  5KFN A;  2HFS A;  2B7B B;  5KG3 A;  2IDE A;  5E3P A;  1UA0 A;  3AB2 B;  4E98 A;  4P2S A;  5J2Q A;  3EGZ A;  2H5E A;  3TOQ A;  4QIE A;  1JLB B;  1QUV A;  4I2Q B;  3DOM B;  1HWI A;  2ZWO A;  3M30 B;  4ID5 B;  4OYI A;  1RT6 A;  2EBG A;  5J1E A;  3PX0 A;  4LBI A;  4XTT A;  3KYL A;  4ECR A;  3OXF A;  4YS2 A;  3SI8 A;  2W2N P;  3HVR A;  4K4T A;  3IMQ J;  2CNO B;  2OPS B;  1HNV B;  2BM1 A;  3KKF A;  2MGZ A;  2QE5 A;  2DPJ A;  2BE2 B;  3BQ0 A;  2XS5 A;  4OJO A;  2DIT A;  5LXR A;  2WRM A;  4NLD A;  2EBE A;  4O44 A;  1RT2 B;  3KJN B;  3MPU B;  2UUW A;  4UY8 5;  5CZV A;  4M5J A;  4KGK A;  3RW7 A;  4WP9 A;  2FVC A;  2DNM A;  1TFW A;  4JI2 F;  2UXD J;  3JAM Y;  2FJE B;  4YZX A;  1KEK A;  1EP4 A;  2H4W B;  1TSP A;  5KAK A;  4P74 A;  2FHJ A;  3DLG B;  1SKR A;  1J5E J;  1FE4 A;  3OTO J;  4HL9 A;  4M94 A;  1LW0 A;  1J5O B;  5GAH U;  1V3S A;  5FLX U;  2HG4 A;  5HMY A;  5K8P A;  2HBY B;  3ZC4 A;  3C66 A;  1WC6 A;  3DLE A;  3Q8Y A;  4Y2A A;  3I56 S;  2YNI B;  4M5I A;  2Y8W A;  4C98 A;  3U1L A;  3MUV P;  2FJV A;  1WKL A;  2IM3 A;  1U8W A;  1VQS A;  2HQI A;  2K3I A;  2HUR A;  3HZG A;  1VBZ A;  1FXR A;  3SDE A;  4ELT A;  4OYB A;  3HPO A;  4QWC A;  4CZC A;  2ZH9 A;  2XHW A;  5KG4 A;  2YPY A;  3J81 U;  1QSL A;  2V8D A;  3KG4 A;  5A8K B;  4ZIT A;  1VQ4 S;  1UVN A;  4XLA A;  2GVZ B;  1R8C A;  2V8V A;  3N6Z A;  1NSA A;  4CCH A;  3UDC A;  3CCU S;  3MED A;  3W7B A;  2KKH A;  4ES1 A;  3A8K A;  1SCJ B;  1SUQ B;  2ROG A;  1YJW S;  1RK8 A;  4NA2 A;  1D0E A;  4IFV B;  2HGN A;  4DV1 F;  4ZN1 A;  2JX2 A;  1NK4 A;  3GV8 B;  2RH3 A;  2HHH F;  1OSC A;  2M52 A;  3LWL A;  3ITH A;  4FXW A;  2H5I B;  2XWY A;  3EVW A;  5IM0 A;  4ZLL A;  4LSL A;  2MPU A;  1RT7 B;  3JSY A;  5J2M A;  4B3S J;  2IVF B;  1JNR B;  4FVM A;  5BXI A;  4F8R A;  3FQK A;  2ABY A;  3NNA A;  1PBA A;  2KJW A;  2IFX A;  4BLG A;  4C11 A;  7FDR A;  1K9M T;  3VAK A;  3CCV S;  4A8W A;  4B17 A;  4M1K A;  1AUD A;  5HP1 B;  4LF4 F;  5HQL A;  5IQ6 A;  2JNJ A;  1PJ5 A;  3JTO A;  1O5J A;  3B8H A;  3DKD A;  4ICL A;  1P27 B;  2QO3 A;  3PSS A;  5A8R A;  1CC7 A;  4Z37 A;  4URG A;  4DV0 J;  2AJQ A;  2DGO A;  3T3F A;  2GGP B;  3L7O A;  1CEZ A;  2QRR A;  4LF9 F;  4I84 A;  3OJU A;  2HHS A;  4LIR A;  3W2V A;  4X66 F;  4IRC A;  3DRP A;  4CTA A;  1PIE A;  3TR5 A;  4CH0 S;  3HP6 A;  2DBB A;  4A8Y A;  3UFC X;  2L9W A;  2PEH A;  2J0X A;  4PXB A;  2HND B;  2W24 A;  1TL3 A;  3W66 A;  2GJI A;  2A6O A;  2V50 A;  2MZ1 A;  2YKN B;  1RTH B;  1U7L A;  4OM9 A;  2VHG A;  4ZLP A;  2O3D A;  2E5H A;  2ZE2 B;  2XBP A;  4ETZ A;  3RR7 A;  4FYD A;  2D3O 1;  5CCL A;  4YY3 J;  2HFU A;  1G7C B;  4OI4 A;  3VAM A;  2PDA A;  4E8U A;  1ITP A;  4B3O B;  4ANE A;  2MKK A;  2JHE A;  3LAN A;  4NLO A;  2Y1I A;  1VQL S;  1ACM B;  1RXO B;  3T6B A;  2F7V A;  1S4F A;  4X4O A;  1BQN A;  3PET A;  2ALY B;  4QR1 A;  4Q7A A;  3J81 j;  1WHY A;  3L7U A;  2QG9 B;  3NAW A;  1S7I A;  4GVB A;  5LM7 E;  2E5J A;  4USU A;  3IA0 A;  4NYP A;  4EFA C;  2NYH A;  2B9X A;  5C24 B;  3R97 A;  1SJF A;  3VAL A;  3DNC A;  2LQB A;  2H4Y B;  7AT1 B;  2HSE B;  3V2U C;  4DQR A;  1CQM A;  4IH6 A;  5IV4 A;  2W01 A;  2PYH A;  3OR1 A;  3K5M A;  3GV7 B;  1IKW B;  2YX1 A;  2VJU A;  4CH7 A;  1TK5 A;  2DTJ A;  3HHN B;  1UJ5 A;  5F9L A;  4ZVR B;  4IQM A;  4RW7 A;  2C3Y A;  2E7V A;  2MQP A;  2OUG A;  4JI7 J;  2INV A;  1CSJ A;  1TUV A;  4ZHR A;  1ZM3 A;  2ASD A;  1DLO B;  5IT4 A;  4UW2 A;  2OLW A;  2QX3 A;  3R5C A;  2GS8 A;  4DL3 A;  3I0S B;  3W2W B;  2X7I A;  2CQI A;  1BWV A;  4N8O A;  3ZPP A;  5D0R A;  2H51 B;  2Z8G A;  1DHM A;  2E1R A;  1RHR B;  3BBB A;  1QY7 A;  3VAI A;  3BSA A;  2V9W A;  5D3G B;  3IFE A;  4ZP7 A;  2KM8 C;  4KV8 B;  4AD6 A;  3PKM A;  2ZBR A;  2RDD A;  2C22 A;  3HFZ B;  2PT0 A;  5DDP C;  1PJ7 A;  2ZOF A;  4QIF A;  3QFW A;  4NYZ A;  4DFM A;  1W7W A;  3ZTP A;  1ZZF A;  4NLW A;  4Y3C A;  1D9F A;  1E6Y B;  4K7Q A;  2J7W A;  3VGU A;  4CLS A;  2MGZ B;  3CJ2 A;  3KWM A;  4XPE A;  3MCN A;  4BWJ A;  1RBL A;  5T7L A;  1NH8 A;  3ZZZ A;  3RU0 A;  2FC9 A;  1RQ0 A;  3MR5 A;  2AU0 A;  4BCA A;  3EWG A;  2BJE A;  4WFZ A;  3OFE A;  4NLG A;  1U47 A;  4B3R F;  3DI6 A;  1L3U A;  2MKH A;  3OL6 A;  3HKW A;  3UW1 A;  3CWJ A;  1JIH A;  1SH0 A;  3NGS A;  1T9X A;  1QTN B;  3K5N A;  4BS2 A;  2MZS A;  2QJ3 A;  4ECV A;  5F8I A;  3G82 A;  2L3M A;  2RAQ A;  3EZO A;  1W26 A;  1OFD A;  5BYS A;  3ZZR A;  4KC5 A;  3X3U A;  4ZP9 A;  1R8B A;  1NK6 A;  4DX5 A;  5ETT A;  3DXS X;  4LR7 A;  3NBP A;  1FTC A;  3R5A A;  3C6U B;  4KAI A;  5J2P B;  4ED5 A;  2GIF A;  4QIV A;  1URR A;  2RRN A;  4R0E A;  1RAJ A;  2R8I A;  2VJJ A;  4HYK A;  4ID8 A;  1FRM A;  3M8Q A;  4USH A;  4DSE A;  2IC3 A;  1NDK A;  2DNP A;  4OJG A;  4LBP A;  2HHU A;  5ETQ A;  1CJV B;  1O8L A;  1RT1 A;  4C8Z A;  3PSZ A;  1JWW A;  4C7Q A;  2AD9 A;  2YNH B;  2B9Y A;  5DM6 Q;  1HQU A;  3M8Z A;  4M5D A;  4U8Y A;  2G2O A;  6FDR A;  1OYD A;  4DLE A;  2ZUA A;  5JUM A;  5DDQ C;  5J2N B;  2YQ0 A;  2JFK A;  1CC8 A;  1IJE B;  2WCX A;  3MEC B;  2FVR A;  1X4F A;  3WHI A;  4U7U D;  5LSL A;  3MED B;  1QSY A;  1B7Y B;  2DY1 A;  1RIS A;  3D7S B;  1KTV A;  3CD6 S;  3R2D J;  4ZPD A;  5KFG A;  2ZM6 F;  1VS3 A;  5CYM B;  3D0I E;  3GLJ A;  2FHK A;  4DJB A;  4UOH A;  4YEJ A;  5HAO A;  3BEG B;  4O0N A;  1Q95 G;  1GXL A;  3OVA A;  2VOO A;  1FWK A;  2DNN A;  5HAN A;  3ENW A;  4ED2 A;  2L9N A;  5D8H B;  2DRB A;  3BN4 A;  4O0I A;  2CXE A;  4PWU A;  1LXN A;  1F1B B;  3HZE A;  3LP0 A;  3JAM U;  3MPY A;  2MKS A;  5J2M B;  5LXY A;  4YCQ A;  4N7T A;  4DSI A;  2EWE A;  1WC3 A;  1U6B A;  4XR6 A;  4C11 B;  1X7V A;  2FHM A;  1U1K A;  2YNG B;  1UCN A;  4HVZ A;  3N0V A;  2B43 A;  4G1Q B;  1UL3 A;  1KHW A;  3R7S B;  1MML A;  1FES A;  2KHD A;  4QYZ J;  1YIT S;  3MMB A;  3DM2 A;  4P73 A;  1UFL A;  1U1N A;  1TUW A;  2OJ3 A;  4J9P A;  3B6B A;  5HI7 A;  1AT1 B;  3M8P B;  4WTO B;  2WSE C;  3FFI B;  2QA4 G;  4KIA A;  1ZBT A;  3P8B B;  4IG3 A;  2AEJ A;  1HHS A;  3DU5 A;  1LW2 B;  4LFB J;  2F4F A;  2GHW A;  5DG9 A;  1K73 T;  3JX8 A;  4MXN A;  2AJ4 A;  2CDR B;  3PR5 B;  3GIL A;  2GNK A;  1OYE A;  1TKT B;  1OS5 A;  3DYA B;  3CE8 A;  5GAD U;  4P75 A;  4CWB A;  2CJB A;  5G0R A;  1VYA A;  1GNK A;  1YSJ A;  5KFV A;  4LRF A;  4V1A k;  3MUT P;  2X1G A;  4JI6 F;  1SJ4 P;  3LJY A;  5JMN A;  4QWE A;  3TO8 A;  4QQB A;  4X62 J;  1WEZ A;  1KTW A;  2Y3Y A;  3Q8S B;  3RZA A;  1MMN A;  2I2Y A;  4AE5 A;  2RS8 A;  1HBO B;  2V68 A;  4YZQ A;  1QCX A;  4MIA A;  1IB4 A;  1RWK B;  1U0S A;  3H98 A;  3N6N A;  3A3O B;  2VBZ A;  4IOC Q;  1ZYQ A;  4M5G A;  1RAF B;  4JI0 F;  5D4O A;  2RHS B;  1R31 A;  3Q8U A;  1EX8 A;  1PYO B;  3NS5 A;  3LAM A;  1AA1 B;  3HHL C;  3H59 A;  2XYH B;  4KTQ A;  4ZDN A;  5HJY A;  1S77 D;  4PQA A;  2AP6 A;  3VWS A;  3VAF A;  1OFL A;  2NQP A;  1RTI B;  1TYV A;  2WBM A;  3FVY A;  4RW8 B;  3OR1 B;  1QLN A;  4DEZ A;  2IQ7 A;  1WI6 A;  2Y0B B;  1S99 A;  4IR1 A;  2RQC A;  2PMH A;  5F8M A;  4Y28 C;  2OEM A;  1OY9 A;  3J7A N;  5HBM A;  3GR0 A;  2UXB J;  1WDT A;  1HI0 P;  3D0G E;  3VST A;  3SXL A;  2HAF A;  3GB0 A;  3CD7 A;  5A8W A;  2JLF A;  1GMV A;  2GHP A;  1L5U A;  3UVJ B;  3W8P A;  2IJN A;  4LSN A;  2XLK A;  2F3J A;  4X4Q A;  1C0U B;  3ILJ A;  1ULR A;  4OX7 A;  2E7X A;  3FSI A;  2YH1 A;  2YTC A;  2EWH A;  3QIP A;  2DRA A;  1SKS A;  4RU2 A;  2AJF E;  4OYO A;  4HHJ A;  3HMJ G;  1NK8 A;  2N7C A;  1HL6 A;  4Q0B A;  2AJ0 A;  2ZD1 B;  3PNI A;  3I87 A;  5E41 A;  4EUV A;  1RTD B;  4LVN P;  4ZLJ A;  1LEO A;  2EK1 A;  4JI3 F;  4KYZ A;  1Q1K A;  3S8S A;  1RI7 A;  2DHS A;  1FHT A;  1CS4 B;  2N4D A;  3TAM A;  2OIH A;  4KRW A;  4XLE A;  3CUN A;  5K14 B;  5T7L B;  4LF5 J;  3H42 A;  1GXU A;  1XR7 A;  1EKS A;  1T9V A;  3MAA A;  3IG1 B;  1XBW A;  3CJT A;  3T5J A;  3FGV A;  3R7N B;  1N32 F;  2OGU A;  2A18 A;  3D6T B;  5KFX A;  4AQY F;  1QVF R;  4USV A;  1HI8 A;  4DV4 F;  2QEX S;  2Y9H A;  4DR3 J;  1A9N B;  1HBM A;  4ECX A;  4EI2 A;  1WWH A;  5IWA J;  4ZCL A;  3UN2 A;  3PCO B;  1V9O A;  1NSK L;  4MYU A;  5CHC B;  3N6M A;  1HWJ A;  2PI4 A;  1T05 A;  2ZH1 A;  1CJU B;  2QZ8 A;  1WOP A;  4CO5 A;  2FVP A;  5C1C A;  3A8I A;  1ZM4 A;  3BZQ A;  1S1X A;  4YEI A;  2NSP A;  2RQ4 A;  4NRU A;  4OJL A;  4XLF A;  1C1B A;  1FI4 A;  2EFG A;  1OFM A;  4DR5 J;  2HIY A;  3OL8 A;  4N41 A;  3P3D A;  4KFB B;  3KK2 A;  1N36 J;  3AOC A;  3THV A;  3IBC B;  2CUY A;  2MKI A;  4AL5 A;  4X4R A;  3RG6 A;  2QYG A;  5CQG A;  5IC6 B;  1FEH A;  3KFW X;  3UNG C;  1HQU B;  1GFW B;  4GC7 A;  4DQI A;  2ZH7 A;  2RUG A;  2BV3 A;  1N88 A;  4JV2 A;  2CQP A;  3ET6 B;  3QJJ A;  1TZ0 A;  1JB0 C;  4MT1 A;  3PX4 A;  3H7H B;  4NCG A;  5CYQ B;  2GX8 A;  1XK8 A;  3EDR B;  1IKX A;  2Q6B A;  2ZOG A;  2L08 A;  1MRO B;  3EGW B;  2QLX A;  1FVQ A;  4JYA F;  2ZEJ A;  1BD6 A;  3ZNU A;  3VTI A;  2XEX A;  1JX4 A;  1MU2 A;  3MR2 A;  2FJX A;  3OTC A;  3AOA A;  3KHH A;  3PJW A;  1C4C A;  4DR4 F;  4LF7 J;  3FQL A;  4LRA A;  2BJ7 A;  4A8K A;  2Q43 A;  2YNF A;  2Q1L A;  2V8P A;  1B0V A;  1N48 A;  3CPW R;  1NO8 A;  2CZ4 A;  4KH0 B;  2PA3 A;  2CPZ A;  4IQX A;  1R89 A;  1YJ9 S;  4GKJ J;  1SIW B;  4TY8 B;  2E5G A;  1RT3 B;  4X65 J;  2MQ8 A;  1RWW B;  4NE9 C;  5BYQ A;  4WE1 A;  3P5B P;  2IY5 B;  3NY0 A;  2E9Z A;  4XLC A;  5EWE A;  2DR5 A;  2VOD A;  2BEF A;  2FVS A;  3PYD A;  8RUC A;  4PRF A;  1RU4 A;  2DNH A;  3R8Y A;  5IFM A;  3E8O A;  3DLJ A;  4FYX B;  1N33 J;  5CA5 A;  1C1C A;  3H5U A;  3Q86 A;  3I96 A;  2YUH A;  1VRT B;  4ZPT R;  2ADB A;  1UWB B;  3GQ7 A;  2WW8 A;  2HVE A;  3Q0A A;  3BKT A;  2CJA A;  4WU2 A;  1CQN A;  2VFM A;  2CFX A;  3T5K A;  3CJS A;  5AT1 B;  5CZX A;  1H7W A;  1BQM A;  3QAT A;  2UXC J;  4FPR A;  1UAW A;  1G4C A;  4YQW A;  4I6W A;  4Y34 A;  4GC6 A;  4Q2L A;  4Y0F A;  1NZA A;  4LF8 F;  2YKQ A;  5G0R B;  1KSP A;  3IAS 9;  1PLU A;  3QSY B;  2CWX A;  2D9P A;  3O5T B;  3OJS A;  4WFY A;  2WTF A;  2ADC A;  4NML A;  2D74 B;  1HNX F;  5KFI A;  3ENQ A;  2J5A A;  3H2U B;  4JI8 J;  4OI3 A;  1SKW A;  3RAM A;  3E51 A;  1HBU A;  2WVF A;  2FJA B;  2HK3 A;  3QNW B;  3H4B A;  1LV5 A;  4MH8 A;  1GXT A;  3N90 A;  1NU4 A;  4NXN F;  2BM7 A;  1D3W A;  1H7X A;  3RRG A;  2DNG A;  2J9D A;  2VG6 A;  4DG1 A;  1GMW A;  1HD0 A;  1R3N A;  5KFW A;  2UV8 A;  2BAN B;  4KB7 A;  2IPO B;  3PV8 A;  3H5X A;  3GON A;  2RNE A;  4QU6 A;  1N5S A;  2UVU A;  2LEB A;  2MST A;  4NX9 A;  2I1R A;  2BRL A;  2VG5 B;  2XTY A;  1KFS A;  2YVS A;  4Q5V A;  5HBM B;  2ZIT A;  3HVT B;  4AT1 B;  3EIC A;  4CLP A;  3N5F A;  2XMK A;  2H1Y A;  2G0I A;  1Y00 A;  4ZVH A;  1TP7 A;  3GFZ A;  5F9N A;  4F2S A;  1KD1 T;  5F8J A;  1S1V A;  4OV6 A;  5F3Z A;  1V6H A;  3DRX A;  1JKH A;  4OX9 F;  4LF6 F;  4MR0 A;  2RDI A;  4HT7 A;  3JS9 A;  1UA1 A;  4FBT A;  2DVI A;  2VD3 A;  1UJ4 A;  2HRU A;  1HQ2 A;  3FSY A;  2XMM A;  4PYD A;  2C2R A;  2HHQ A;  4U67 Q;  4AVZ A;  2EI5 A;  2GA7 A;  2PC6 A;  2CPF A;  2CPY A;  4U4B A;  5F8H A;  4FKY A;  2I8E A;  2NZM A;  4CIO A;  4KGZ B;  4CYU B;  1SL0 A;  3SQG A;  2M8D B;  1NK7 A;  4Q0B B;  1F2H A;  4DQS A;  5EGY A;  1IBK J;  4JV5 F;  1X4C A;  1RTZ A;  2XY5 A;  5F41 A;  2DGW A;  2QSF A;  4TLR A;  3LGM A;  1RHJ B;  5KFO A;  1O6X A;  4MTP A;  2PFD A;  4FYV B;  3TAM B;  4WK3 A;  2KJV A;  1SBR A;  3LUY A;  4ZPC A;  2D3Z A;  1HNI B;  5C2G A;  3H2L A;  3B4M A;  4DR6 J;  2KG0 A;  3IP0 A;  5C7P A;  4DV6 F;  1WC0 A;  4URQ U;  4X4P A;  1DTQ A;  4R0J A;  2AEF A;  3IM9 A;  1LFP A;  2HK2 A;  2WK4 A;  2ZJQ Q;  1DAB A;  2B4U A;  3B4D A;  1NHK L;  5HLF A;  5K20 B;  3HF5 A;  2DK2 A;  5SUH A;  4PPD A;  4NI2 B;  4KKO A;  2DGS A;  1M5K C;  2QC3 A;  1X9W A;  1F5C A;  4CLL A;  2ROP A;  4B9V A;  4PKD B;  5H9F K;  1L3S A;  4B3M J;  1ELO A;  2HRY A;  4L3N A;  2QGF B;  1TKZ A;  2IM2 A;  4AFF A;  2JDJ A;  3NCP A;  2X1A A;  3QGP A;  5A2Q Y;  4TQR A;  2YXL A;  3OVB A;  2RU3 A;  2ERR A;  1H3D A;  2NYI A;  3G6V A;  3TRG A;  2AV5 A;  2ZBC A;  3EPI A;  4OHW A;  3C15 B;  1GX5 A;  5DDR C;  3G4S S;  4MFB A;  1FK9 B;  1KCD A;  4L76 A;  1AUS L;  5DG8 A;  1TL1 B;  2WVD A;  4KO0 B;  3MPD A;  3UR0 A;  1U45 A;  3AA9 A;  3SYZ A;  2HQD A;  2IYG A;  2JSX A;  1UVM A;  4ECU A;  3E01 A;  3MEG A;  2Z0G A;  2WB1 D;  1JLF A;  2AQ4 A;  5K9F A;  3BO4 A;  3O1L A;  5A0Y A;  1HPZ A;  3KLH A;  3W9J A;  4OJ1 A;  3P45 B;  2AYM A;  2K8G A;  4I67 A;  1ZM2 A;  2DH9 A;  2NUH A;  2PA8 D;  3HX9 A;  2KFZ A;  3Q2T C;  4WFA Q;  5DG7 A;  1XNR F;  4NCG B;  3HFK A;  5KFQ A;  1QE1 B;  3QMQ A;  1RHM B;  1OMS A;  3V4I A;  2QN6 B;  4U7U K;  3GFH A;  1TEL A;  4XM3 A;  2GFF A;  2GJ2 A;  2OPP B;  1CG2 A;  3KHG A;  2H3E B;  3QWP A;  1UZD A;  2XC9 A;  3U02 A;  2ZKU A;  1N5Y B;  2MJU A;  1S12 A;  3AAW B;  1D8Z A;  1HQE B;  3MHY A;  3PHE A;  3MEE A;  4NEZ A;  2B0R A;  2HLU A;  1U1O A;  4ED3 A;  1RDR A;  4C97 A;  2P2C B;  1QA3 A;  1TVR B;  2LQ9 A;  2DR9 A;  1S6Q B;  1U25 A;  2W1B A;  4NCB A;  3T1Y J;  1AZS A;  2K1R B;  2GO8 A;  2G0C A;  5D6G A;  2KVI A;  4DZ6 A;  3NB2 A;  1SXL A;  2C2K B;  2JJ4 D;  3W61 A;  3TP2 A;  1X5O A;  2F4V F;  1IXK A;  1FCA A;  1T9T A;  3PYG A;  3IM8 A;  1EE6 A;  5DGA A;  2VIC A;  2ZWP A;  1N5Q A;  2LYV A;  3CNQ P;  4I7F A;  1EAY C;  1VHF A;  4L6V 3;  2BZ2 A;  3O8W A;  3B82 A;  1Y5I B;  1FA0 A;  3GSI A;  4HEA 9;  4WKY A;  2AX0 A;  3VAH A;  2R7V A;  2CZ9 A;  1NAQ A;  4I6A A;  1S9F A;  3TI0 A;  2GAG C;  3B8Y A;  1S9E A;  3CD0 A;  1H2U X;  1U0H B;  3O44 A;  4RNH A;  4WF9 Q;  2EKY A;  2O0W A;  3IAM 9;  1XNQ F;  5B0F A;  1O51 A;  2YKA A;  1KOH A;  1AXQ A;  4LFA F;  4NXM F;  4WYW A;  3BBC A;  1FT8 A;  4LF1 A;  3L4B C;  1RKJ A;  3IWL A;  5EUH A;  4DL0 C;  4ECW A;  5AE2 A;  1RCX B;  1Z1Z A;  3MMJ A;  1KLM A;  2QZA A;  1YHQ S;  5C25 A;  1E6V B;  3DLK B;  1GT8 A;  1IM4 A;  1UZH A;  3EJM A;  4WZM A;  1VBX A;  4KH3 A;  2Z56 B;  2A6M A;  2RQM A;  5KTQ A;  3UD5 A;  4LF4 J;  1XER A;  1YBT A;  2XY6 A;  4FYW B;  3M1V B;  4Z2X A;  3AOD A;  5M2R A;  2MB0 B;  1LLW A;  2AJ2 A;  3LW5 C;  1EJ7 L;  3CDB A;  5E3C A;  4XNF A;  2PO4 A;  2FGC A;  3BKU A;  4AYB D;  2FIU A;  4IG0 A;  2VG6 B;  1VLY A;  5B09 A;  3ZFV A;  4ZOS A;  2KT3 A;  2F8H A;  4DPO A;  2W9C A;  4WFB Q;  3Q22 A;  1VJW A;  1S9G A;  5B0E A;  5AJ3 J;  3WC0 A;  2KYX A;  3THT A;  1QUP A;  1SL1 A;  4Q43 A;  4XKW A;  3A12 A;  5KT4 A;  1R0A A;  4OHV A;  2ZNY A;  4RJV A;  2R2S A;  4M5H A;  1LQ9 A;  2ODL A;  1NSQ A;  3KK1 B;  5DZ7 A;  2NT6 A;  3KNA A;  2W9B A;  1S97 A;  1JLQ A;  4RW4 A;  3BKF A;  1O8D A;  1PJ6 A;  1HFE L;  3VZI A;  2CVI A;  1X4B A;  1TV6 A;  4UUW A;  4UOF A;  2RUS A;  4FF3 A;  4ZP6 A;  5F8G A;  1A6L A;  3OFG A;  5DET A;  4K4W A;  3DOK A;  3ZZ0 A;  1QM9 A;  1FKP B;  4RBT A;  3V81 B;  1QA1 A;  4UF4 A;  4DQP A;  2VUG A;  3OQ2 A;  1CJK A;  2V8G A;  4NWB A;  2RKI B;  1I94 J;  2W8L A;  1UFW A;  1P6T A;  4M5M A;  5DQH A;  3ONQ A;  4DU7 A;  2WHO A;  4TU7 A;  3TVY A;  2W9A A;  2BXJ A;  3KHR A;  3J80 Y;  1FER A;  1WEX A;  3CCJ S;  1TKX A;  3QFH A;  1YJV A;  4QPX A;  4M5K A;  1HD1 A;  1S4E A;  2BX6 A;  1PBU A;  5H1S V;  4EW9 A;  4K5S A;  3QWU A;  1B70 B;  1ZTW A;  4BDP A;  3T9N A;  2G13 A;  3M05 A;  2XSJ A;  4CNZ A;  5IXU A;  4Y00 A;  4Q44 A;  2XSF A;  3IRX B;  2J7U A;  3ELH A;  2A2C A;  3R5G A;  1JLG B;  2F3L A;  1TL4 A;  2BBE A;  4I0W A;  1R6Y A;  1CBK A;  5CAA A;  5G4D A;  4WCE Q;  3VV2 B;  7FD1 A;  1FJC A;  5E5N A;  1RP5 A;  3AT1 B;  1A0O B;  4PPZ A;  1S1U A;  2XC1 A;  4D3G A;  1T9Y A;  3OFF A;  3V6D A;  2CPI A;  1VRU B;  3RB4 A;  4PXC A;  4RNM A;  3MZI A;  1X5T A;  4I68 A;  1LKZ A;  1NJI T;  3LQV A;  2X3G A;  5KT5 A;  4NCA A;  4BC9 A;  3AA8 A;  2HEK A;  3NGT A;  2FB0 A;  5THW A;  1BMQ B;  4G1I A;  5KG1 A;  2MY7 A;  3KLI B;  2NSC A;  3K5O A;  1QTM A;  1B0P A;  1WC4 A;  2BYC A;  3FUY A;  1FDD A;  4KGV B;  2O66 A;  2BA9 A;  3SFU A;  5C42 A;  4LBH A;  1TTH B;  3SMZ A;  5IS2 A;  1DQ8 A;  4QR0 A;  4OI0 A;  5CAB A;  1H0H B;  2YKM B;  2MQL A;  3P49 B;  3D2W A;  5GAH I;  4UOG A;  4OLO A;  4OI6 A;  4P7T A;  5H9E J;  1LWC A;  1UP1 A;  2QYU A;  3KLG B;  4G3I A;  4MIB A;  4LMZ A;  3IR7 B;  3UDV A;  3OL7 A;  4PWD A;  1PYS B;  2N4C A;  3V4I B;  1HYS B;  3AOB A;  5KOX A;  3LP1 B;  3PRV A;  2NXC A;  3TJA A;  3BGR B;  2VPX B;  3SCI E;  4WFN Q;  4RNN A;  2FZK B;  4LQ3 A;  1T9W A;  2C2E A;  4LFC J;  3GSD A;  2WAQ D;  5HRO B;  4IYQ A;  5DS7 A;  3DU1 X;  2OD4 A;  2WOM B;  5AE1 A;  4OIX A;  2Z4P A;  1KFD A;  2XCP A;  2VPW B;  1KQ5 A;  2V4J A;  5H9F J;  4DN9 A;  1RWR A;  3TA1 A;  4QIW D;  2NT9 A;  1KQS R;  4PUO A;  1IQT A;  2IJR A;  3ISN C;  3T1H F;  4IOA Q;  4FYY B;  2KM8 B;  5B08 A;  2XG8 A;  3LYC A;  3SSR A;  3G87 A;  1O8G A;  3MM6 A;  2MJN A;  2GO9 A;  3Q8R B;  1UWA A;  1PAE X;  2MSS A;  4EU0 A;  3CJR A;  4F4K A;  2CJK A;  4B9T A;  3AXK A;  3MMC B;  5KFR A;  4MKY A;  2Y1J A;  4U9R A;  2OI2 A;  1EET A;  2KO1 A;  2LU2 A;  3QID A;  2J8A A;  2J76 E;  2KRR A;  2I9S A;  4YB1 P;  3D1O A;  4IRK A;  2FLL A;  1FXD A;  1PXZ A;  4F0H A;  2EVZ A;  3K0J A;  1W2B R;  4PG7 A;  2IRU A;  3VR1 A;  4MKV A;  4OL8 A;  4FP9 A;  1ICE B;  1YKW A;  2HNZ B;  2INU A;  3L95 X;  1ZA2 B;  4Z7Y A;  3KUG A;  3R6L B;  2BVZ A;  3NWG A;  3C3L A;  1WJ9 A;  3AXM A;  4PG6 A;  1RBO B;  2CZV C;  4NYO A;  2R7S A;  4IR9 A;  3MOJ B;  1H74 A;  4YUD A;  3FDS A;  2QA2 A;  4B3T J;  4XOT A;  5L1I A;  2HQF A;  1XC9 A;  1TMM A;  2D3O R;  1VQ5 S;  5LOQ A;  1KLM B;  5FLX Y;  3QO9 A;  3J7Y U;  5KT6 A;  2WBR A;  2B7C B;  3ILO A;  3FEX B;  1ZM9 A;  3TH0 A;  3TX8 A;  4TU9 A;  3GQA A;  4UT4 A;  3D0H E;  1T3O A;  3BS9 A;  2HNY A;  4B9S A;  4EBE A;  1Q8I A;  4I2Q A;  3DOM A;  4IG0 B;  4YHH F;  3L7P A;  3M30 A;  2K7K A;  3U27 A;  4EZ9 A;  3J7Z T;  2ZZT A;  1Y0H A;  4ID5 A;  2E1A A;  1NJZ A;  2HVH A;  3FBE A;  2VG7 B;  4JI4 F;  3G6Y A;  1S9G B;  3CF5 Q;  3Q8P B;  3UDL A;  2UUC J;  3DRS B;  3CD5 A;  4QR2 A;  4RR5 A;  1IBM F;  1RAE B;  2EG2 A;  2BE2 A;  2CG4 A;  1X9S A;  4J9U E;  3CED A;  1NPP A;  1NK5 A;  4QJV A;  1RT2 A;  2HMI B;  2FY1 A;  4K2J A;  2O17 A;  2JRS A;  2RF2 B;  2ZFH A;  4K4V A;  4L73 A;  2ZH3 A;  4IO1 A;  2QTW A;  1O8J A;  3D3B J;  2QT7 A;  2HRT A;  4DS4 A;  3R27 A;  4NZ0 A;  4CM2 A;  2E9T A;  2U2F A;  2BQ3 A;  4MKB A;  4UQG A;  3DRY A;  3DOK B;  4OYW A;  2FZG B;  4IRD A;  1VLO A;  3DLG A;  4ZVF A;  3HM9 A;  1FNX H;  1EKR A;  2PII A;  2UXD F;  1WI8 A;  2IBK A;  5LSR A;  2QYC A;  3CMA S;  1RWP B;  4J9L A;  4ECY A;  4LRE A;  1HBN B;  4CLW A;  1Y7P A;  2YNI A;  2GQC A;  4UZC A;  3M9O B;  1OPZ A;  3FZB A;  2HVI A;  4LJM A;  1VJQ A;  2NZ4 A;  2C2O B;  3LP2 A;  4UQT A;  4FVC A;  3MGJ A;  2FLN A;  1KKH A;  1N56 A;  5LL6 d;  4I69 A;  1SIZ A;  4NAS A;  5A8K A;  4ILR A;  2GVZ A;  1N5T A;  3SV4 A;  1X60 A;  4USJ C;  1YLX A;  4FF4 A;  3L3C A;  5A76 A;  4ED6 A;  1ZZN A;  2MEW A;  1BE4 A;  2ASJ A;  2YWF A;  1HHT P;  3MD3 A;  1NUE A;  4IFV A;  2RS2 A;  4DX6 A;  4HTJ A;  4CO0 A;  3KDN A;  1VDH A;  1VQO S;  4DPU A;  1ZAV A;  1EQ0 A;  1QAY A;  1FEE A;  4QCL A;  2DIS A;  2IAJ B;  3SQV A;  3VSV A;  3T6J A;  1RT7 A;  2VL1 A;  4F0K A;  2KRB A;  3U1N A;  2LMI A;  2VC0 A;  3Q83 A;  1YTY A;  3RGI A;  2OD6 A;  3I6P A;  3IGV A;  1S0N A;  1YJN S;  4XOP A;  1O88 A;  1S6U A;  4XO0 A;  3GIK A;  1IWA A;  3HHL B;  5DM7 Q;  1FRH A;  4B3S F;  1H38 A;  5D4L A;  5AXL A;  3SZE A;  1S1W B;  5HP1 A;  3ZZP A;  2VPY B;  5L39 A;  4H4K C;  3K8W A;  2UZA A;  1FRI A;  1RB0 A;  2UUA J;  3EVM A;  1UEU A;  3J80 U;  3QGI A;  1Y11 A;  3DRR B;  3SBM A;  3POT B;  1RUS A;  1N32 J;  2GGP A;  2QMU B;  1YI2 S;  4PWD B;  1JXL A;  5HMW A;  3NCR A;  3HVW A;  4BHQ A;  9RUB A;  2LFV A;  2VC1 A;  2IJF A;  4DV0 F;  3VMV A;  1SC1 B;  2HND A;  3IC1 A;  4L75 A;  2QX0 A;  2XLJ A;  4KJI A;  2LXU A;  3CCM S;  1RTH A;  3SYJ A;  3CSK A;  4RZR A;  1IVZ A;  2ZE2 A;  2HQC A;  2XHC A;  4U8V A;  3PYE A;  1WEY A;  4CO2 A;  4UZB A;  4B3O A;  2J8I A;  4W92 B;  4UTG A;  3RBD A;  4Z05 A;  5L9X A;  3MM6 B;  1YZ6 A;  4FKX A;  1RU2 A;  1PAU B;  1HWU A;  1RA6 A;  8ATC B;  1KQG B;  3NOC A;  5EX0 A;  4YY3 F;  3HI9 A;  4BBY A;  1CVJ A;  1SV5 B;  1SC4 B;  4L3K A;  3WIU A;  5K5M A;  4IO9 Q;  4I2P B;  3FCV A;  4PXE A;  1F5A A;  1JLA B;  3DN9 A;  2BKN A;  3D1H A;  1DJ0 A;  1V3Z A;  4NZ7 A;  2IYI A;  3TQE A;  3UQS A;  5C24 A;  4QIG A;  2V34 A;  3M4X A;  2V67 A;  3DGP B;  3KLF B;  3DXB A;  2APO A;  1OY6 A;  1TAQ A;  3DLB A;  1U24 A;  2MZT A;  5KG2 A;  3CDE A;  1R8H A;  4MIW A;  4JYA J;  3HLU A;  2Y1L B;  4LRB A;  5B7W A;  3H25 A;  3DC2 A;  4Y2C A;  2XB2 D;  1FD8 A;  4DR1 J;  4DF4 A;  3RR8 A;  4Q2M A;  1IKY B;  3CMQ A;  2VQE F;  2D3U A;  4OZN A;  4OZZ A;  1ZA1 B;  1LLZ A;  5JVH Q;  4N56 A;  3MOZ A;  3PY8 A;  1DZ5 A;  4DFK A;  3I5C A;  1RHQ B;  3NWR A;  4PG8 A;  4GO5 X;  2VOP A;  1GTE A;  1MLA A;  3UE2 A;  1DLO A;  3BJY A;  4OZ2 A;  4PYA A;  2NTP A;  2NZC A;  1OOC A;  3HHL D;  1N54 B;  2BM5 A;  5E3A A;  2ZDO A;  4USW A;  1PC4 A;  1IR2 A;  2M7S A;  1A7G E;  1S59 A;  2AW0 A;  5D3G A;  2DXD A;  2IVY A;  4B08 A;  1FDA A;  2C2Z B;  4ANC A;  5GAD I;  2HNY B;  4KV8 A;  5KFE A;  3M8W A;  4EEY A;  2CQG A;  4P9S A;  1JNZ B;  1U02 A;  4DSK A;  1NLK L;  3KNG A;  1HHQ A;  1U48 A;  2OP5 A;  2E1M C;  4QWA A;  2WZ1 A;  3HSZ A;  3WIV A;  2KU7 A;  3R1L A;  2GV1 A;  3D9B A;  2XT2 A;  3DGV A;  1E6Y A;  3V6J A;  4DPT A;  3CDA A;  4H4O B;  1S1T B;  5CH7 B;  2IOU G;  3IGN A;  2HAI A;  4F02 A;  4X4N A;  3T5H A;  4M8L A;  2WSC C;  1WD6 A;  4K4U A;  3D66 A;  1FFW B;  2HYI B;  2F9D A;  5KT3 A;  3G8S A;  2EC2 A;  3VF0 B;  4A47 A;  4AL6 A;  1F9H A;  3PO4 A;  2XGQ A;  2JEG A;  1XQI A;  4DR2 J;  4ZVE A;  4JB8 B;  2XMA A;  4CO1 A;  1HNX J;  1WTB A;  3NGR A;  1B64 A;  2DD8 S;  4O3O A;  5KG0 A;  3VAG A;  1RHK B;  3CIM A;  2VFS A;  1NSP A;  3S1T A;  4YP3 A;  4U96 A;  2VFR A;  2EFO A;  4HHH A;  2DH8 A;  1NDL A;  2XZW A;  1S49 A;  2DH7 A;  3C6U A;  3W5X A;  5J2P A;  2NTQ A;  1OY8 A;  2VPZ B;  3PR4 A;  4CLF A;  2CIM A;  3I32 A;  4DS5 A;  4P71 A;  2KG1 A;  3CJQ A;  1Q16 B;  5KFZ A;  3FBF A;  4X4U A;  4QYZ K;  5KFL A;  2FZC B;  5ETL A;  3LP2 B;  5L1J A;  4WXO A;  4DUT A;  5FDL B;  1UVK A;  1CJV A;  5HAT A;  1X4A A;  2SXL A;  4W8T A;  3OUY B;  3TZW A;  2YNH A;  2ILZ A;  4DX8 H;  4XN0 A;  3VAJ A;  5ETR A;  2W7Z A;  1WC5 A;  2BKO A;  3VVU A;  5HVG A;  4RBU A;  3QGG A;  5J2N A;  4KGX B;  1FRL A;  4F67 A;  5EWG A;  3P96 A;  3MEC A;  4C8N A;  2YX7 A;  2F5G A;  3R5D A;  2WVC A;  1KQK A;  4DCO B;  3PJX A;  4GRS A;  3TUI C;  3A13 A;  4ZJO A;  3RRK A;  3CCE S;  1XMQ J;  5CYM A;  5F8L A;  4ENO A;  1UFK A;  3HUL A;  2KT2 A;  4R8U B;  3V5R A;  3ETO A;  4DLG A;  2PE8 A;  4A8S A;  1P1L A;  2D69 A;  4WIQ A;  2XM3 A;  1H2V Z;  1JJ4 A;  3AD9 C;  2HHW A;  4RUA A;  4DL4 A;  4XMY A;  3PJ9 A;  2OAU A;  3GMG A;  4F0M A;  4O3Q A;  3QLH A;  1F9F A;  2YNG A;  2CQ4 A;  1I6J A;  1ZAW A;  1CLW A;  4G1Q A;  4DFJ A;  4XDD A;  3CCT A;  2MLY A;  4WXW A;  1WG4 A;  3NXZ A;  1TYU A;  3T19 A;  3W64 A;  4LIW A;  2HKE A;  2MHE A;  1NKE A;  1NJY A;  2G2Z A;  3KRG A;  1DAR A;  1FXL A;  5E2Q A;  2DGQ A;  2YX4 A;  3M8P A;  2PSZ A;  3FFI A;  3KMS A;  2B4O A;  4DPX A;  3CW2 C;  2M4M A;  5GMK a;  3QGH A;  2JEF A;  4OYA A;  4F50 A;  2EFP A;  4YFO A;  1GTH A;  3RB3 A;  5DQI A;  1QVG R;  1RCO B;  3X1L B;  3I55 S;  2IMO A;  1LW2 A;  1RU1 A;  3PW2 A;  2XS7 A;  4FXD A;  2VFU A;  3AQO A;  2HWI A;  2AYB A;  1N0V C;  3JSM B;  1TKT A;  2ZUG A;  1T7P A;  4I1T A;  3DYA A;  3ENA A;  3KJF B;  4P7V A;  5KG5 A;  4F4A A;  2HLT A;  2O01 C;  1I1G A;  2R2T A;  3D28 A;  3NKY A;  3W9I A;  3GPA A;  1XG2 A;  2JL9 A;  3U7J A;  3CJK B;  3KDO A;  1ZTT A;  2MQN A;  1BY9 A;  3BR9 A;  3BQ2 A;  1YK9 A;  4ZJQ A;  2VDI A;  4K0K J;  1HBO A;  2BM6 A;  2R8K A;  4NLY A;  1S79 A;  3AJ1 A;  1ZS6 A;  1QAJ A;  3TYT A;  1UVJ A;  4HI2 A;  3MR6 A;  4RNF A;  1EA0 A;  2CNL B;  5LMU F;  3NEK A;  2X3H A;  1YJU A;  4ZVT B;  2N82 B;  4PAB A;  3I4P A;  4PEO A;  4XON A;  1RTI A;  5KG6 A;  3M2R B;  1KS2 A;  4IDK B;  4RW8 A;  4GMK A;  3HK2 A;  3K2Y A;  1RYR A;  2B9E A;  2X3D A;  2IMW P;  2OSR A;  4O3S A;  4OV1 A;  3BM7 A;  4OJ6 A;  2A10 A;  1S0V A;  2VON A;  4C8Y A;  3C14 B;  4W98 A;  1NME B;  3EZ5 A;  3VGV A;  3W8G A;  2QA1 A;  4J9N A;  1XMB A;  2E66 A;  2MKJ A;  3KG1 A;  4TXS A;  4P2X A;  3UVJ A;  1HMV B;  1NPR A;  4DQQ A;  2F4V J;  2LQ5 A;  1CPZ A;  1C0U A;  2M5Y A;  3MM7 B;  1JTA A;  4ZCM A;  2A0F B;  3DCA A;  2FVQ A;  2CWK A;  3SUC A;  1QQ1 A;  4K5R A;  1RT5 B;  2M3D A;  3E2E A;  4DL7 A;  2MZQ A;  2DNK A;  3DDN A;  5C1E A;  4HI1 A;  1M5H A;  2XI3 A;  5J1P A;  4B02 A;  3OPK A;  1WHX A;  3KUE A;  5KFY A;  2QA4 S;  2XO7 A;  2ZD1 A;  4DL6 A;  1BLU A;  1FTR A;  1RTD A;  4R5P B;  3EGN A;  2GZO A;  4ECS A;  2QL7 B;  4G6V B;  2HS4 A;  4U49 A;  2RB7 A;  3PIO Q;  5RUB A;  2JFD A;  1CS4 A;  2AGP A;  2XO6 A;  3JSR A;  3H8Y A;  3WBZ A;  3T41 A;  4QWD A;  5K14 A;  3SIP B;  3LTO A;  5ITH A;  5JVG Q;  4HLB A;  1Y10 A;  5K8O A;  2ZJP Q;  3V4M A;  1LNQ A;  3HHE A;  3OTE A;  3IG1 A;  2E5L J;  1X0F A;  2J8S A;  2YQ1 A;  5HN0 A;  3HFV A;  1WDD A;  2C28 A;  3QRQ A;  1X5P A;  3BPS P;  3SCL E;  5JMC B;  3H40 A;  2WON B;  4LF5 F;  5HK4 A;  3VCD A;  1R8P A;  1WSV A;  1FVS A;  3K8V A;  1B7F A;  4JOU A;  3GCW P;  1VCT A;  1Q81 T;  1RT4 B;  2NPF A;  4KT0 C;  1Q5Y A;  2JZ5 A;  2NLW A;  4TKT A;  2Q6C A;  1KNZ A;  2IRY A;  1Q79 A;  1YIJ S;  1EZZ B;  2R7T A;  3MM5 B;  1CJU A;  5KFB A;  2DNQ A;  2HHT A;  1HF2 A;  4MJK A;  2P8I A;  5GAE U;  1K4Z A;  1DY3 A;  3KXD A;  5JJB A;  1YJT A;  2EKN A;  3M2U B;  2BAB A;  2VQF F;  4DOZ A;  4IOB A;  2B0G A;  3OBI A;  3N5B A;  5BR8 J;  2OEJ A;  5IT0 A;  4QWB A;  4KFB A;  1F3V A;  1OIA A;  2CPE A;  3I0R B;  4A4J A;  2B6A B;  4DZD A;  1FO1 A;  3PTW A;  4J91 A;  1LWF B;  4LR9 A;  3MM9 B;  3D4J A;  6FD1 A;  2CQ2 A;  4FZV A;  1N36 F;  4I4B A;  3L09 A;  1YG0 A;  5HQM A;  5ETO A;  4LR8 A;  3IS9 B;  3ET6 A;  5DZ6 A;  3OTD A;  2W4C A;  4NLP A;  2VZ9 A;  4F2R A;  3QYY A;  3UD3 P;  2E29 A;  3NS6 A;  1PSD A;  4N77 A;  5CYQ A;  3JB9 k;  2YWG A;  3I4H X;  2CQH A;  1FRK A;  3R5J B;  3QRR A;  4CNY A;  1MRO A;  1RA7 A;  2RT3 A;  3D5M A;  4TNO A; 
#chains in the Genus database with same CATH homology
 2HVD A;  3ZTO A;  3SYJ A;  1WKL A;  1TYU A;  1QA2 A;  1HLW A;  3VVU A;  2AZ3 A;  3EJM A;  1U8W A;  3ML3 A;  4ANE A;  3FBE A;  4C6A A;  2VFO A;  1QRC A;  2BM6 A;  2XC1 A;  2CWK A;  3PRV A;  1BHN A;  1QQ1 A;  1TYX A;  4KH3 A;  3RIQ A;  1B99 A;  2HUR A;  3NGS A;  3FBB A;  3Q8U A;  3Q83 A;  2VFQ A;  1ZS6 A;  3EMT A;  1HF2 A;  3EIC A;  5C7P A;  1WXR A;  2J8I A;  4OJP A;  4OJL A;  4OJO A;  1QA1 A;  4S0M A;  3H09 A;  4CP5 A;  1K4Z A;  1HIY A;  2B8P A;  4FKX A;  1LEO A;  1XQI A;  3PET A;  3P4G A;  1S57 A;  3R9L A;  3VGT A;  2VFP A;  2BM4 A;  4UOH A;  4DI6 A;  3BBB A;  5IOL A;  1MN7 A;  3ZTQ A;  3BH6 B;  3FKB A;  4O0N A;  3ZTS A;  1TYV A;  1KDN A;  3L7U A;  1WKK A;  1S5Z A;  2B8Q A;  2BM5 A;  3SZE A;  3NGR A;  3DKD A;  3DDI A;  3VVT A;  1DAB A;  3NGU A;  4ENO A;  3JX8 A;  3FCW A;  3JS9 A;  3N6Z A;  1NHK L;  1KQ5 A;  3NGT A;  1LWX A;  1NSP A;  4KPC A;  2G0Y A;  1S59 A;  4WBF A;  3FCV A;  3EVM A;  2DXD A;  2DY9 A;  3EVO A;  4EK2 A;  2BEF A;  1NCL A;  2DYA A;  4HR2 A;  1QRB A;  2AZ1 A;  4ANC A;  3FC9 A;  1NDP A;  2DXE A;  3BH7 B;  3WX8 A;  1NDC A;  3LYC A;  4V02 C;  1NDL A;  3VGS A;  1JXV A;  1VYA A;  1PKU A;  1K44 A;  4OPW A;  2BX6 A;  4OJ6 A;  1NB2 A;  3BBF A;  1TSP A;  3B54 A;  3ETM A;  1B4S A;  1BUX A;  1BE4 A;  3ENA A;  3Q89 A;  3N90 A;  1WKJ A;  1NLK L;  3G2X A;  1PAE X;  4W98 A;  3ZTR A;  1EHW A;  1W7W A;  3VGV A;  1HHQ A;  3ZTP A;  2BM7 A;  3GP9 A;  1F6T A;  1TYW A;  2VU5 A;  4FKY A;  1NSQ A;  2NCK L;  2V5I A;  4F4A A;  1NUE A;  1F3F A;  3TH0 A;  5JLV C;  1NPK A;  3Q86 A;  2B0R A;  1NDK A;  1UCN A;  3VGU A;  1K8F A;  5CAB A;  4AND A;  3LJY A;  3FBC A;  3FBF A;  2YUH A;  3PJ9 A;  5JMC B;  4UOG A;  1QA3 A;  2HVE A;  1XIQ A;  3BBC A;  3EM1 A;  3Q8V A;  4JRA C;  3ELH A;  1MN9 A;  3GPA A;  4DUT A;  2VFM A;  3EE3 A;  3EVW A;  4OM9 A;  1CLW A;  2IOU G;  2VFN A;  3Q8Y A;  2F3L A;  1NSK L;  2ZUA A;  3AK5 A;  4F36 A;  4DZ6 A;  5CAA A;  3MPD A;  4UOF A;  3B6B A;  4OJ5 A;  5BXI A;  2DXF A;  2W7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...