2BX6A

Crystal structure of the human retinitis pigmentosa protein 2 (rp2)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
311
Chain Sequence
KVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVLNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transduction protein
molecule keywords XRP2 PROTEIN
total genus 103
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bx6A01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2bx6A02
3G2XA 3VGUA 3Q86A 4KPCA 3ZTOA 1LEOA 3NGSA 2BX6A 4HR2A 1WKLA 3BBFA 3WX8A 3FKBA 2B8PA 3VVTA 3FBCA 1NSKL 2DXEA 5BXIA 1KDNA 5C7PA 1HLWA 3ZTPA 3EVOA 3Q83A 2NCKL 3VVUA 4FKYA 4F36A 1NLKL 3NGTA 4W98A 1HIYA 1HF2A 1MN9A 3ENAA 1K8FA 2B8QA 3FCVA 1NSQA 4WBFA 4UOFA 3ELHA 1F6TA 3BBBA 1F3FA 2YUHA 2HURA 3GPAA 1W7WA 1BE4A 5IOLA 1NDPA 3ZTRA 1B4SA 3B54A 3FBBA 1VYAA 1HHQA 5CAAA 3EM1A 1NSPA 3BBCA 2ZUAA 4F4AA 1XIQA 3R9LA 3ETMA 1U8WA 3VGVA 3FCWA 4V02C 5CABA 3JS9A 3BH7B 1BHNA 4ANCA 4DZ6A 1S59A 1WKJA 3MPDA 1S57A 3L7UA 1NDKA 3ZTSA 4UOHA 1JXVA 3Q8UA 2CWKA 2AZ3A 1NDCA 1S5ZA 3FC9A 2DXDA 1NB2A 1BUXA 2DXFA 1NDLA 3Q8YA 3DDIA 1UCNA 1WKKA 3NGUA 4DI6A 3Q89A 3EVWA 2AZ1A 3EJMA 2HVEA 2B0RA 1MN7A 1XQIA 3PRVA 1EHWA 3EVMA 3EICA 1PKUA 1LWXA 3BH6B 1B99A 1ZS6A 3NGRA 4UOGA 4FKXA 4C6AA 4ENOA 3PJ9A 1NHKL 1K44A 2DYAA 4CP5A 3B6BA 4S0MA 3Q8VA 3ZTQA 3VGTA 3EE3A 2HVDA 2BEFA 1NUEA 3GP9A 2VU5A 1NCLA 1KQ5A 4ANEA 1PAEX 2DY9A 3VGSA 3FBEA 4ANDA 4DUTA 1K4ZA 3EMTA 3FBFA 4EK2A 3DKDA 4O0NA 1NPKA
chains in the Genus database with same CATH superfamily
1K1QA 2L08A 3SSSA 1YHQS 3EGNA 3KDNA 1U47A 1EQ0A 2ZWOA 1FDAA 1N0VC 3DRSB 4TN2A 3M2RA 4LF5J 1HQEA 3BBFA 4ZJQA 4KJIA 3SYJA 3KG4A 3WX8A 2A18A 1TTHB 5B0BA 4ED2A 1U02A 4JV2A 4PG7A 1CJVB 1TL1B 3B4MA 4EBEA 3DOLA 2FVQA 5BXIA 5M2PA 1AUSL 1RSCA 2ZE2B 3I56S 2CJAA 2ZH7A 3PJXA 3CIMA 3TVKA 2Y9HA 4WP3A 4K4WA 2DNLA 1CLWA 3JSYA 2BA9A 5DETA 3WHIA 4B02A 2MZSA 3CO9A 4CLUA 3MR2A 4IKAA 4X4NA 3RAXA 4QYRA 2NXNA 1UFKA 1Y9OA 2BBEA 2YKNB 2QMUB 5EUHA 1VRTA 4JI8F 1MN9A 3C15A 4C48A 5F8JA 1F5CA 1AROP 4U9RA 3J81Y 3C8YA 3G71S 3BSOA 1Q82T 2IYGA 4M8LA 2HS4A 4DSEA 2W7ZA 1S1WA 1EZZB 2ZITA 2HMIB 2V68A 1TMJA 2YXLA 5I42B 3VSVA 2XYHB 4XLEA 4CLTA 5KTQA 3OL6A 1JLQB 4ECRA 2CJ9A 1FJEB 2ZZTA 2K7JA 1V5VA 1H7XA 1IKVA 2VH7A 3E01B 1FJGF 1MMLA 5KFVA 4K7QA 2RB7A 3MFIA 1RAGB 1IKWB 4C8NA 4KC5A 3TA2A 2MGZB 1YLXA 1U6BA 3B54A 4MFBB 5ADZA 3HPOA 3MEGB 2C2ZB 1U1QA 3FSXA 1IN0A 1FERA 1OPZA 4B9NA 3MEEA 4PYAA 5KFHA 4XL9A 5KFPA 3ETMA 4RW8A 3RBZA 4ZP6A 4WP9A 2PC6A 1YJ9S 2RDIA 5CABA 1MU2B 2C42A 2ROPA 4PG6A 4FNHA 4D3HA 3G8SA 3JSMA 2V69A 1IBKJ 4UY85 1NAQA 1SL1A 3OT9A 4OFZA 2MZQA 3EXYA 3SZEA 1H2TZ 1HI8A 1KHWA 3SY2A 3MZIA 1UP1A 1QA2A 3P5BP 1P27B 5D15A 1SC6A 3NWRA 4Y0FA 2OPQA 5G0RB 4R5PA 4JI5J 3MM9A 2Z8GA 4WYWA 4F0KA 4J9QA 3DRRB 3MAAA 2GW8A 1QAXA 2HFVA 1TU0B 1RUSA 2NSCA 3DOMB 3QIDA 4UZBA 3PY8A 1N5TA 1VI7A 4JV0A 3P49B 2FJAB 2NSTA 1SPBP 4DXLA 3UW0A 4YZXA 2UUAF 4C8LA 2OLWA 2JDJA 3SCKE 4YB1P 3SUCA 3L4BC 4ED0A 1EJ7L 3Q8UA 4WPAA 4LSNB 1EETB 2BE9B 3T6JA 2KHDA 5HQ8A 5AXKA 4I6WA 4PZVA 1TUGB 4CNZA 2G1HA 1JRGA 3HVWA 3LQVA 3NBPB 5A8RA 4JYAJ 2ABYA 3JSBA 5E3RA 3RIQA 5KG4A 1AA1B 1RI7A 3KLHB 1Z1ZA 3MMCA 4YDXA 5KFLA 4RBTA 3HXMA 1VLOA 2CNKB 4NCBA 3W3SA 2V8GA 4FXDA 3D6MB 3Q89A 2GIFA 5D0RA 2Y0SD 2CNOB 3DXSX 4J7CA 2OEJA 4USUA 4ZVPB 4OX9J 1NK6A 2A0FB 2EKNA 1D09B 1NHUA 2WB1D 1Y00A 1RU4A 3KMQA 3C6TB 1JLCA 1HMVB 2H54B 2F4FA 2CJQA 3CC7S 4CT8A 2OGUA 3CC2S 5C2GA 4LF2A 1IBMJ 1ZS6A 1RHKB 2I5JB 2D74B 3IAM9 3OTOJ 2ZHBA 4ALZA 2VBYA 3LMWA 1X4BA 3PJ9A 1FRMA 4NZ6A 1VQKS 5IXUA 2EBGA 4LVOP 3BZQA 1RK8A 1YRUA 3B6BA 3AQOA 4NASA 3EX7B 2DNGA 3D67A 2HVDA 2BEFA 2V8DA 3HVTB 3MM8B 4E8UA 1VQLS 1JLEA 1JX4A 3FVYA 4H4KC 1VC6A 4R0EA 5DQIA 1JNZB 3CD5A 4R0JA 2BJEA 2GHVC 1RTIB 2R4FA 2VQFJ 3DLLQ 1DAXA 2HQCA 4DV6J 2GJFA 2IVYA 2HZVA 2JNJA 4NLSA 3DDNA 1OJ4A 3RB6A 1SJ3P 3M8QA 4DV5J 1G2EA 4YQWA 4DFJA 4LBIA 5F8GA 3KLHA 2QV6A 3GRHA 3MAQA 1DBDA 1RT1A 2VKZG 3MFHA 1QUPA 1S6QB 4ID5A 4RO0A 4A4JA 3A3OB 5GMDA 1AT1B 1M5OC 3ZZOA 4DS4A 3V4IB 3GG1A 1LWEA 2DGXA 2JEGA 3GJTB 1GH8A 4E0DA 4YELA 4B3TJ 1TFYA 2F8MA 5L1JA 1WSVA 2J8SA 1D1UA 4DG1A 1A9NB 3NCRA 5ETOA 3ZNUA 3CCLS 3ENAA 1HBMB 1U1MA 1FNXH 4ELVA 4H4MB 2ZOMA 2KXFA 4NEYA 2YVSA 3TWZA 1NKCA 1U8SA 2HHHJ 4PR6A 2HFUA 1U48A 3H59A 1HNXF 3QNWB 1KKHA 3W9IA 1KP6A 1N34J 3MOJB 4YY3J 3BBBA 1VQNS 3KHGA 2HRYA 2OO4A 3UI3A 4MTPA 4BWJA 2ZH1A 2I5JA 2NXEA 4X64J 2UV8G 4YFOA 1RE1B 2G0JA 3ZTRA 2F1FA 3FBBA 4USHA 4M5MA 1IM6A 2K1RB 5KFYA 2YNHA 1FE4A 3D1HA 3QGIA 5HANA 3NOGA 2XM3A 1R8CA 4DR7J 1ZM3A 1Q16B 3Q8YA 2NPIA 3H7HB 1WI8A 3HHKA 3R9LA 3OV7A 3FFIA 4J9RA 2FJVA 4K8RA 4OZ1A 5F8IA 2IVMA 3VMWA 1RCXB 4KH3A 3PEHA 5DDQC 4CRJA 3PIPQ 1N36F 3GV5B 2CFXA 2RT3A 3AY0A 3LWMA 4I69A 4OHWA 3VAHA 5D3GB 4ZN1A 3BO3A 2HQGA 4F26A 4DV4J 1X9SA 5D78A 1SJRA 2VOOA 4RZRA 1U1PA 1QLNA 1S1WB 2IYIA 1KWMA 2CG4A 5AMVA 1TZ0A 2FD2A 2FHJD 2VHGA 2EFNA 1R43A 3M30A 3ISNC 5KT5A 1TL7A 1VDHA 2CYYA 4PCQA 4UOCA 2BANA 1RT5B 2UXBF 1S77D 2V67A 4NA2A 4Q8EA 3V5RA 4P6QA 3TEHB 3WC0A 5DQGA 3BDPA 4FYXB 2CAJA 2JH3A 2V8HA 2AZ3A 1DLOB 1LWFA 3PO5A 2AF6A 3DOKB 4XNFA 3LP0B 4V1Ak 4OI1A 2DNMA 3BREA 1NDLA 1CJKA 2E29A 2Z0GA 3DDIA 1LM1A 4NLQA 2XNQA 4P10A 4CYUB 1BGXT 4C4WA 2JWNA 2NUUG 4YCQA 3TJ8A 2RKIA 5JJBA 3PR5B 3RRHA 2GMHA 3UD4P 2FGCA 2ZJRQ 1UL3A 1XQIA 4MKYA 3GLJA 2U1AA 1FCAA 2KZMA 3JAMU 1WOOA 3A4TA 2B5JB 5HP1A 2HBYB 5JXSA 5IT9U 1TYVA 1Y5IB 4CQ1A 4DUYF 3LGHA 3RG6A 4JV5F 4OHZA 2FZCB 4OI0A 3D1QA 4DU8A 5L38A 1T9UA 4OYPA 1YITS 5F0UA 2JOQA 3BR9A 3C15B 5ETSA 4BCAA 2L48A 3F41A 4RU2A 4P74A 1FRJA 3QRRA 2DGWA 1Y11A 2QN6B 1R6VA 3EMTA 3I82A 4NYZA 4DQSA 4FP9A 1YBUA 1NHVA 4DU7A 4HH0A 3VV2B 4RW6A 1GEHA 2NYHA 2OIHA 4ZIWA 1ZA2B 4OJHA 1HNWF 3SCJE 4J9SA 2J0SD 4LBPA 2I1RA 1HQEB 5CD4A 3FUYA 2W24A 2ZH4A 3GYXB 3TZZA 5LSOA 3IMQJ 1RWWB 1YG0A 1XMOJ 3CD6S 2VBKA 3IFEA 4MK8A 4XOPA 2NXUA 1HLWA 4Y65A 2FHOB 5DDRC 3FSIA 2LMIA 2R8JA 2DRAA 1UEVA 2N4CA 2E5GA 3TAMA 5KFCA 1M1KT 4J9MA 2RU3A 1VC5A 4I64A 3TA0A 3AB4B 5A6WA 2KZZA 4IOCQ 3IGVA 3NS5A 2RRBA 4F3MA 4LQ9A 1S7IA 3TZXA 1TAUA 2CIMA 3J80U 2H9ZA 2VG5A 2FJDB 3JURA 2V5IA 1UWBB 1JLBA 3CJQA 4TXSA 2QSFA 3L09A 1TUWA 1UVKA 5IC6B 5ETTA 1HR0F 3PEJA 3Q2SC 3W65A 5DG8A 2VFNA 2G0CA 4JI0F 4JI3F 2PFDA 4BWMA 3W2WB 4KHPF 2Q1LA 3OPKA 1FDDA 4HHHA 2K06A 4DSKA 1W2BR 5K14B 4N41A 4CH0S 1C1CB 1X4GA 5LMNJ 4RW7B 4USJC 4X65F 2VPYB 2WSFC 2MSSA 1H74A 2MY7A 1QAJA 4H4MA 2R9LA 1FT8A 2HNYA 3TJ9A 5K8OA 1KONA 2H4WB 2NZCA 2B9EA 3VAIA 1T9YA 4WIIA 1HFEL 1R6YA 2O3DA 3N0VA 5ETVA 3V4MA 3N01A 4C3LA 1RT4B 2GFFA 2QJ3A 3AJ1A 2IM2A 4AUKA 5J1EB 4L73A 1J5OB 2Y1IA 3BH7B 1G7CB 3FZ2A 3SZ2A 5I3UA 1E6VA 4X4QA 4LT6A 3ZO7A 3DLJA 2M5YA 5BJRA 2E1MC 2GHWA 2PO4A 4DPWA 1F5BA 5SZTA 1N32F 4NLGA 2ZDPA 2RQ4A 2B7CB 2I9SA 4GVBA 3ZNJ1 4ZLLA 4X4TA 4M63A 3ZXWA 5JUMA 3FY3A 3OD2A 4MKVA 4WK3A 2P6TA 3RGIA 4ED4A 4Q0BA 3V6KA 1FXDA 1HNIA 2YPYA 2B0GA 4P7TA 4FNIA 3IM9A 4DV2J 4DHVA 2INVA 5JLVC 3DM2A 3RBEA 1H72C 4OZ5A 5A76A 2L3MA 1NB2A 3BGLA 3CJ8A 5BYQA 2E1AA 2CPDA 1UVMA 5J2MB 3NKYA 4CWBA 3KYLA 5K5MA 1FJGJ 1K73T 2DNNA 1JLEB 4DI6A 3IBCB 1HKAA 4K4UA 1UVJA 1YK9A 5C25B 3GQAA 3MM9B 2X1AA 3PACA 4FF3A 1TYWA 3NCQA 1UMJA 2H48B 2QMWA 2KXNB 4O3SA 4GO5X 3N6ZA 3OL9A 2HQ3A 3GILA 2DGSA 1R8AA 2KT5A 3N9UC 3CSKA 3JSMB 3GQCA 4O3RA 1X5SA 4DL5A 5MAOA 1JLCB 1HMVA 2HWTA 1D0EA 1Q78A 1REVA 4XLHA 1TVRB 3WWGA 1X5PA 3DN9A 5KFDA 2BM1A 2XBPA 3ZZRA 3MM6A 4ES1A 4TQRA 3CCWA 1VQYA 2ALZA 4C8OA 1R0AA 4MH8A 4JI5F 4ZPWR 4NLXA 1IKWA 2GC8A 4FVCA 4CO0A 4ED7A 2A2DA 5EWFA 3QFHA 3C2PA 1QTMA 2DR9A 3TJAA 2XY6A 4FYYB 2P8IA 3Q23A 1K4ZA 3PFOA 8AT1B 2YWEA 1O8BA 2MQPA 1WKLA 2WVEA 1H38A 3AQPA 4W4MA 1HI1A 3DC2A 1PYSB 1WTFA 1OFMA 1LEOA 2LDIA 2WVBA 3PRDA 3W63A 4J9KA 5K9FA 1N33F 2Z30B 3ET6A 2VFUA 1NB7A 4ECSA 5J2MA 3GJQB 4YR2A 4JI1J 4C11B 3IO1A 2PT0A 1KQKA 5L9XA 2PA3A 4IRDA 4ILMA 3K5PA 4CLWA 4PUOA 3MAAB 1RQ0A 1RP5A 2YX1A 2YY3A 5KFSA 4A48A 3GIKA 4WZMA 1M0SA 2DGTA 3UCGA 2ZM6F 1OYEA 3NS6A 2XTYA 2JLGA 1RB0A 4OX9F 2N82B 3GB0A 2YNIB 4MYUA 3IR7B 5A8KA 1I94J 1GAOA 3NGTA 4N8OA 4CO3A 2MQQA 2DPJA 4JI4J 2YX7A 4NPOA 1RHMB 2EFQA 2DNPA 4QWBA 3W5ZA 5IV3A 3V81B 5J2NA 2L9DA 3IM8A 5J2QA 4RW8B 1WF0A 4DFMA 4LSZB 2FIUA 4KSEB 2D3OR 1QRBA 4FF4A 2GQCA 3MM6B 3MTKA 4KFBA 2GGPB 1V5IB 3D0GE 4CLKA 1FKOA 1TVRA 2VD3A 3BSAA 5SUHA 2CPYA 4O3NA 4ECXA 1SXLA 4LF5F 1BXNA 1M5HA 3BGFA 4QOTA 1V6HA 3I32A 4NWBA 4URQU 3QGPA 4WFYA 3DLEB 2AEFA 2DISA 2HHQA 2GVZB 2OD4A 4O3PA 3NG8A 2CUYA 3QLHB 3RAQA 5GAEU 1Z4UA 2E5LJ 1K0TA 1GX6A 2JVRA 2QA1A 3O3LA 2XMUA 2ZEJA 3N79A 5GMKa 5H9EJ 2V9KA 1B64A 1R3NA 2LP4A 1TKZB 2DH9A 1GQ8A 2CA9A 2XZWA 1X4DA 3NXZA 4P2XA 4U8YA 3UVJB 4DV6F 5H9EK 4DPUA 3VSTA 1UWAA 2Z2MA 2N4DA 4OIXA 3KTQA 1WC1A 2MPUA 4IH7A 4V02C 3EGWB 2COLA 3GIMA 5E3AA 1YJ7A 1RWPB 1C0TB 2EW9A 5HMZA 1SUQA 2ZNYA 1KTWA 2OJ3A 4QU7A 5HROB 1JLBB 2B7BB 4IG0A 3IGNA 2YQ0A 2AGQA 5H1SV 4Q43A 2VG5B 4UW2A 1X4AA 2KT2A 4YEJA 1VHIA 2XYPB 4EW9A 4CO2A 3BGOP 4DV3F 2ILZA 2IRXA 4A8MP 1HBNB 1C2PA 4DFKA 4B3TF 4DV1J 2W8KA 1SCJB 1HPZA 3EZ5A 2PSZA 5D0EA 1SL2A 3AOBA 2UVUA 4DCJB 4IOBA 2GJ2A 5GMEA 4X4PA 2EG1A 3LF0A 3WBZA 1L3SA 2PFFB 3BEGB 5HBMB 3KHRA 1FXRA 3MF5A 3KK2B 2HHHF 3KRGA 1UAWA 3CCMS 3VAKA 4CI0B 3CCTA 2VBZA 1LK7A 2XWYA 1SI9A 1RT4A 1P9QC 1UFLA 2F3JA 5LMUJ 2ADBA 1J5OA 1XNQJ 2VFVA 4RUCA 2Y1JA 3JXOA 1JQGA 1VQ5S 4ED5A 3AB2B 3MUTP 4Y2IA 1VLYA 3UR0A 5DM6Q 1R7IA 3KNAA 4EZ6A 2FJXA 3SQOP 2H65B 1XC9A 1TUVA 1RT7A 1Z2ZA 5CYJA 1E6YA 1A0OB 4K59A 1NU4A 2LXIA 4MIBA 1NRKA 4PRFA 3R5JB 2HK3A 4FZVA 4ES3A 3QT5A 2C2MB 3BH6B 4DV0J 2J6UA 2PMZD 1C1BB 3HFVA 1P6TA 2AHOB 2CQIA 5CYMB 3PIOQ 2WRMA 5AE2A 3MURP 3GMGA 2AT1B 2R2UA 2R7RA 2YQ3A 1AXQA 4DCPB 4F25A 1O8KA 2JLEA 3PYDA 5IQ6A 2XQCA 3OVSA 1FE0A 2VFMA 1FEHA 4JBCA 3FEYB 2UXDJ 2XMWA 4S0MA 4AT1B 2OPSA 1KCCA 3UN2A 4U7CA 4ZPVR 4Q44A 4AE5A 1RU2A 2CJKA 1S1TA 2RUSA 2BUNA 3B82A 4TNOA 1NUEA 4WXOA 3PHTA 2FVPA 3POTB 3ILLA 4LFAF 4FYDA 1KQ5A 3M1VA 4LR7A 2K3KA 1O0PA 3R8YA 2MKHA 3FMWA 2BKNA 3V6HA 1YDLA 2G13A 3UE2A 2IM0A 4I1TA 5K20B 2VZ9A 5T41A 3KK2A 4DLGA 3TANA 3G2XA 4A8OA 1T9TA 2MZJA 3NAHA 2UVWA 4BS2A 3H40A 3CMES 3G82B 1S1XA 1ZAXA 3W62A 3MHYA 1ICEB 1VRQC 2OD6A 5LL6d 3CMQA 3A8JA 1YIJS 2QY1A 1UJ5A 1B0VA 3KG0A 1FX2A 2CNLB 4USWA 4ZCMA 4WFNQ 3J80Y 3BQ2A 2QYGA 1N5YA 1WNEA 3B8YA 3CW2C 1X4HA 2DR8A 3AA9A 3K7RA 3RBXA 3BPSP 3I4HX 1NZ8A 1U0HA 4I7FA 1QJHA 4KYZA 4J9UE 4TLRA 4IG0B 3S7RA 3ZTPA 2B9XA 4GVLA 2W7PA 3VVUA 3GIIA 3TA1A 3BKTA 3THPA 3X1LB 2V2VA 3TO8A 2R2RA 2HS0A 4MYTA 4WE1B 5HI7A 5L1LA 1RTDA 4UUWA 4LUBA 5HJXA 3TUIC 3CDAA 1OY6A 2ZC3A 3IRXB 2CZ9A 4YS2A 1HNZF 3ULHA 2FVSA 3I96A 3R1HA 3MD1A 2DNQA 4DUYJ 3OR2A 4JV5J 1S9FA 4FDFA 1Y10A 3JQJA 2RQCA 3T1YJ 4IR1A 3ILIA 2DEIA 3O5TB 3KK1B 2LECA 2BABA 3TQ1A 4JUZA 1RTZA 2CQ3A 1W7WA 2CQBA 2WCXA 1Q7LB 4H4OB 2W2OP 4IDKA 1TAQA 4ED6A 2ZZNA 1RTJA 1CULA 2Q3PA 3H8YA 2C3PA 2PN6A 3DLEA 3GU0A 4UZCA 3OLBA 4ECQA 1XMQF 3RR8A 3J7A1 2CG8A 2FLNA 3M4XA 3FRZA 1Y3JA 3W5XA 5D4NA 1S9GB 1UJ6A 2P6SA 3KUGA 4F3OA 3EUNA 4FBTA 2BJ1A 4NCAA 3FEZA 4I84A 4MKAA 2MJUA 3G9CA 3C16B 2F4VJ 1H7WA 2HHXA 5E3CA 1URNA 4I2PB 5LM7E 3UO0A 4LRFA 1FNMA 1L1IA 2QX3A 1OS5A 2H5EA 5FD1A 3TX0A 2BKPA 2R7OA 3MPYA 4L3KA 2YKQA 3BV8A 4P9SA 3T9ZA 3CMAS 2RDJA 2EG2A 3EQNA 2AEMA 2KT3A 2NUHA 1TKXB 3ILOA 2H51B 2QRRA 4AFFA 5CA5A 5DGBA 5AT1B 2M8HA 4ER8A 3PX4A 2RNEA 1RAHB 2UV8A 4YR0A 2ZHOA 4ED8A 4OZNA 3M2VA 3J7YI 4H54A 3IWXA 1GMWD 4NI2B 3R5GA 1JXVA 5ETRA 4WCEQ 4X4RA 3SV3A 2J9CA 1S10A 4JRAC 4J9OA 2ZHAA 3H20A 2VG7B 4LSLB 2QGFB 1IB4A 4PXBA 3OTDA 3KLFB 3OW2R 1T3NA 2IY5B 3DU6A 3M7VA 4OJLA 4TYAA 3U7JA 1VBLA 5KT4A 3R5BA 3T5KA 3UCZP 2R7WA 2J9EA 2XULA 3RB3A 4F0MA 1UCNA 3DHWC 1S79A 3UFCX 4C2LA 3VAGA 4J9PA 2BM7A 3W2VA 4F04B 1IKYB 3EVWA 2DR7A 5HAOA 2UU9F 3W9JA 2VIHA 2GHPA 3EJMA 3P6YC 4OX8A 1CC8A 1LWCA 4I56A 1E6VB 2WB4A 3HKWA 4KBIA 4L6V3 4AD6A 5J2PB 4OI6A 4PQUA 1BC6A 4YB7A 2DHSA 3HF5A 1F0XA 1ZPWX 2ROGA 1O8GA 4UQTA 4XIUA 4Y2CA 1X4EA 4OLPA 1VIOA 3GIRA 5HLFA 2VQEF 1B99A 3M8PA 3HMJG 2BRLA 3Q8PB 3K8VA 4HWVA 1S12A 1XMBA 2Z2YB 3MM8A 4DUZJ 1NM2A 2NXCA 3TZYA 1HW9A 3HHLA 1F2HA 1T9XA 3TVYA 4WTYA 5M2UA 1BQXA 1LNQA 3W2WA 2FVRA 3K59A 5KOWA 4U49A 4RNMA 3M8PB 3N6LA 2V8VA 1TMMA 4LFCF 4C9DA 2HHWA 4ELTA 1PAEX 3RRGA 3HZGA 3C6TA 4BDPA 3D28A 2ZH3A 3E8OA 1RZMA 3L95X 1S0NA 1P9YA 1B7YB 2LA6A 1S0MA 3JTOA 1MSWD 2F65A 3SQGB 4MKBA 2BJDA 3DHXA 3Q24A 4BLGA 1KTVA 3VALA 1JIHA 2XTXA 4ZVSB 2O0VA 1UPPA 1WG4A 2YWWA 2BM5A 2YNGA 3BDEA 1HWJA 4G1QB 4GVBB 4RBUA 4UUXA 3ZZ0A 4EMDA 1QVFR 4DR5F 2VJJA 2AEJA 2DXEA 4CO4A 4DX5A 2ROEA 1QSYA 1I3OB 2ZWPA 3MEKA 3MD3A 4C8MA 3EGVA 9RUBA 2A1BA 3SYZA 2WW8A 5T7LA 4FKYA 4C98A 3C14A 3MECB 2OPPB 5A8WA 5LXRA 4NXMF 4NI2A 2EFGA 3BKUA 4HDHA 2ZH8A 4LF9J 1F9FA 2F9DA 3N6NA 2ZOGA 2E7WA 3M2VB 4EEYA 2X6WA 1RTHB 4MIAA 2HFOA 3VQSA 3AAWB 5GAHI 1LXJA 2HNZB 1HNVA 2MMYA 4HH1A 2W01A 2C1EB 5KFAA 1WORA 3GFZA 4RJVA 4CT9A 2VICA 2CPJA 4QPXA 2NZ4A 3QT7A 1UPMB 5B0DA 4KRWA 2ADCA 1G1XA 2R8IA 3DGPB 3WDOA 1W2IA 4DR6J 1QE1B 3MTJA 3QIPB 2ATLA 2SXLA 1T9WA 2HGLA 2KXHA 3DRXA 4DUZF 1GXLA 2MKJA 1O5JA 2MHEA 5ITHA 1F2GA 3MEEB 1TL5A 4HT7A 1HHTP 1RWMB 2UUCJ 4O4GA 3RB0A 1FJCA 1S9GA 2BMBA 3PO4A 3MEGA 4ZLPA 1U8WA 1H0HB 3OFGA 1WF2A 3IS9A 3O2IA 5DRKA 4ZPTR 1KS2A 2DB1A 3MMCB 2R8HA 4K0KF 4MR0A 1DARA 5THWA 1N33J 2INUA 2B56A 4PEOA 5A8RB 2JVOA 4JI1F 3T5JA 1U1OA 2KTQA 4UQGA 2QEXS 1WXRA 1LOUA 3KLFA 4NK6A 4KGXB 1QSSA 1EIYB 1UTAA 3KOAA 1CS4A 3MPDA 2RKIB 2JEIA 1IM4A 2DHHA 3M05A 4JYAF 4QZVB 3L3CA 2FJWA 4ED1A 1JNRB 3R97A 4EBDA 3U27A 2LEPA 2FHJA 5HQMA 3KK3A 1WC5A 2JFKA 1DRZA 1MROA 2DNRA 4NLYA 3K57A 2KFYA 3CTRA 3CCUS 4ECVA 4DL6A 1VJWA 4DR2F 3VMVA 2DNOA 2RJZA 3HCXA 4O23A 1YQHA 4WXWA 3P8BB 2O17A 4USTA 3H0PA 1IBMF 3W8GA 4KO0A 4DJBA 1FX4A 3LP2A 5HMXA 4OJ1A 1HL6A 2LQ9A 5HN0A 3H2UB 1SQGA 3IP0A 1S6OA 1MU2A 2C2OB 1PXZA 5F8LA 1YJVA 4UT4A 2C2RA 4PABA 3SSQA 2MB0B 3GG0A 2VJVA 2ODLA 1I1GA 1RKJA 1VQOS 1CG2A 1I5OB 1VQ6S 1CPZA 2IA0A 3PW0A 2VQFF 1WC3A 5KFGA 1RADB 1J27A 4DL0C 2RD5C 2M4MA 1LW2A 1Q4RA 3FK4A 1NSAA 2MGZA 3ZC4A 2XMJA 5D4LA 3VHQA 1ZH5A 4QBUA 1FRXA 3BO4A 5IC4B 5CCMA 1FVQA 4NE9C 4PQAA 3ZZUA 2DCLA 3MCSA 2DH8A 4NZ7A 1MMDA 4C6AA 2FGOA 4DV5F 5A0YB 2CPEA 3GSDA 3QQCD 4MJKA 4EO8A 1L3VA 4M5HA 4ZPAA 4DN0A 3Q8VA 3VGTA 1O8HA 2YNHB 3EE3A 4YP3A 4XN3A 2AKWB 4IFYB 2X7IA 1EZGA 2MKCA 2CQGA 3HFZB 4DV3J 1EA0A 5KFZA 3HK2A 3OXGA 3DGPA 4DV1F 1X7VA 1FO1A 3O44A 5EX0A 4DUTA 5KFFA 3HM9A 1B3TA 1KCDA 1YJNS 2EVZA 3I4PA 5ETKA 3SEOA 3MXHP 1H73A 2KFNA 1PJ5A 3C6UA 3GJRB 2DVIA 4IUFA 4XPEA 3E2EA 2BX6A 1URRA 4URSA 5D8HB 4U4BA 2LXFA 4RUAA 3CXCR 3J7YU 1KC8T 3OUYA 1WEZA 1RT3B 2AJ4A 4URRA 2B3TB 2QC3A 3FKBA 4FPIA 2CQCA 5BR8J 1S1XB 5CH7B 5K8NA 3RR7A 1HNXJ 4MIWA 3MDFA 1VBXA 3RTVA 3DU1X 2MHNA 4TKTA 3ZZZA 1VJQA 2ZKUA 4XONA 3ENVA 2EEYA 4U7UD 4P2MA 3QWPA 2AU0A 2BQRA 3KLEA 4X64F 5D3GA 2NCKL 5IT9Y 3HSGA 3D3CJ 1TYXA 3E51A 4PKDB 1FRLA 3T9GA 4JI6F 4DR7F 1HW8A 1Q5YA 1RT2B 3W66A 4DV0F 2B8QA 2OMOA 1U2RA 2R42A 1Q81T 4IQMA 1OY8A 4ZVTB 5HMYA 4GKJJ 4X4UA 2WVDA 1VRUB 3B90A 2GIRA 4OPWA 2APOA 2HG4A 2E5JA 1F3FA 1SV5B 1Q8IA 3BR8A 3S1TA 3PYFA 3M8YA 3GPAA 3TNVA 5AXMA 4GC7A 3K89A 1HYSB 2VB6A 1S72S 4DCOB 2LEAA 3CCVS 2CPXA 2J7WA 1SH2A 1UFWA 3CCSS 4XDDA 4E98A 4JI7J 1LXNA 2EK6A 4XK8C 1DZ5A 3D0IE 3OFEA 1JWWA 1N56A 1PE9A 4HVZA 4F4AA 2ZH2A 3OTCA 2YWFA 2D7SA 3DLGA 1B70B 4HLBA 3IRWP 4AL5A 3HSZA 4GC6A 1IBLF 1FFWB 3BQ1A 5MLCV 3KJNB 4DG1B 1DY3A 4IOAQ 2V2ZA 3HJFA 3D6TB 3JS9A 5BYSA 3BSNA 2O04A 2ZH5A 4DR4F 4WJBA 4RW4A 1ITPA 2HAFA 4KGMA 4Y2AA 4PXDA 1VFJA 4WP8A 5CD4H 1AYEA 1IKYA 7AT1B 2DNYA 2JX2A 2XMVA 4EI2A 3ZTSA 1PCAA 4M5JA 1BN8A 1HHSA 2H4YB 4ZLJA 3JYTB 3TAQA 2ZJQQ 3VAFA 2C3MA 3I0SA 4YDTA 3MPVA 2ERRA 4C8KA 4CZCA 3RYLA 2JEJA 2M9KA 2MQLA 4OL8A 4U6PA 1FD2A 2G2ZA 1N52B 4ZVEA 2PD1A 3Q8SB 4GRSA 1FEEA 3GYGA 4B3MJ 1M5KC 2MTLA 2VFRA 4PXEA 4RLEA 5DDPC 3QBCA 2DITA 1WEYA 3R6GB 4N47A 2ZZMA 5GAEI 3ET6B 2HEKA 4YDDB 2QTWA 1Y7PA 2A6OA 2ZUGA 3SDEB 3UVJA 2ZJPQ 3UW1A 1M5VC 3H2VE 2I0XA 2PMHA 4FYWB 1KBRA 2QLJB 1H6KX 3PRVA 2ZKTA 2WAQD 3MR6A 3Q0AA 5FJ4A 1ZZNA 4PWWA 4K4ZA 2LFVA 2NZMA 3ML3A 1FTRA 2C2NA 1REGX 4W8SA 3QGGA 2BE2A 3EZOA 4FKXA 5F41A 4BC9A 4CTAA 4ENOA 4P75A 3EYZA 1X9WA 3W5YA 5DG9A 5LT5A 1SJ4P 1NHCA 3LPYA 3U1LA 4F8RA 5HATA 1S7HA 1IKXB 2VG6B 1K8AT 1RKIA 3PSSA 2AJ0A 1HA1A 5J2NB 2G0YA 1FD8A 4LFBF 2EWHA 1GXUA 2HLTA 2VU5A 2KO1A 4ZJLA 5CQGA 3MPUB 2QLBB 3IR5B 4FF1A 2IJFA 2KB2A 1XMOF 1N48A 2ACMA 1OOCA 2HSEB 1Q5VA 4M5NA 2LU1A 2MLZA 4M5IA 1X31C 2W8LA 4TU8A 4NYPA 5KFEA 4B17A 2XI3A 3UDVA 4LSNA 4NLUA 4CO1A 1WJ9A 3M6VA 5RUBA 4PUOB 4ZCIA 3OR1B 2W4DA 3PX0A 3QSIA 2KYXA 2OSQA 1C0UA 1NSKL 1RXOB 2K7KA 5HK4A 4U7UK 4DDFA 1KNZA 2FC9A 1UJ4A 3UWTA 2HQDA 1IDKA 4KGKA 2A2CA 6FD1A 1QJVA 1OQ6A 3I9ZA 5GAHU 1Q8LA 2IIHA 2UU9J 5FLXY 5F9NA 4DL4A 3NMRA 1KVIA 1N5YB 4G1PA 1SC1B 1HR0J 3GR0A 1BQMA 4U67Q 4ILLA 2F7VA 3FSYA 2QZ8A 3CJ4A 4NZ0A 3QZ7A 4LF7J 1HF2A 4XO0A 4OYWA 3U02A 3QRQA 4X84A 3W60A 4YB6A 2XYGB 4NLPA 3R5DA 3AHPA 4NMLA 5B7WA 4EUVA 4B3RF 4QIGA 4EFAC 1ZZFA 1PC4A 1HWLA 4LF6J 3Q22A 1SKUB 1QAYA 4ZVRB 1ZBTA 2IRUA 2J7KA 2V34A 4MK9A 1W26A 4M1KA 3M1VB 1HBUB 2DKOB 3QJJA 3GSIA 1RWNB 4LFCJ 1RHQB 1R0BG 1VGYA 2J9DE 1O8EA 1C1CA 5IS2A 3FCHA 4QWCA 3QT8A 1IR2A 1N32J 2KFZA 3D6HB 2KG1A 1D8YA 1IQTA 4BBYA 1JXLA 3G8QA 3CD0A 5IWAJ 4UTGA 1KOOA 3CCQS 2V9WA 2OEMA 1IXKA 5DM7Q 1RAAB 2VFTA 2YKNA 1TL3B 3MUMP 1OPIA 2XG8A 2JJ4D 1K1SA 1T11A 4R8UB 2BOPA 1OWXA 2HKEA 3I31A 1SV5A 5B0AA 2ASDA 1AW0A 5DLGA 4KH1B 4DR5J 1Y5NB 2XY7A 1U0HB 4I7FB 1NJZA 1A7GE 2QT7A 1CVJA 5DJBA 3W61A 3SFGA 4USKA 1H3DA 2VPWB 3LA0A 3DOLB 3JB9k 2MKSA 3I0SB 5KG6A 3SBMA 3LPEA 3MOZA 3KUEA 4QIWD 5LMNF 4YZAA 3JYTA 1VQ7S 1XNRJ 3DRSA 3UD3P 1UZHA 2F5GA 4LF9F 4DV7F 1OFEA 1NK5A 2YKPA 5KFBA 5E41A 4QW9A 1N8RT 4JOUA 2D1CA 4ATNA 4C3KA 2CZ4A 2Z2LA 5HL7Q 1U45A 3RW6A 2CQHA 2R7XA 4K4YA 1S5ZA 2AYEA 1BLUA 5LXYA 4FYVB 3THVA 2XO7A 2B9YA 2FQQB 2IC3B 3NS7B 4C2MA 3AT1B 2AYMA 3AK5A 3POTA 4KPYA 3QJLA 2JLFA 4K2JA 3DLGB 4Z7YA 2XMAA 3DRPB 1VQSA 2QYUA 2HGNA 4LIWA 2W25A 4QIEA 3ENQA 4ERDA 2HPUA 1KVJA 4R25A 2RVJA 3DLKA 3B8HA 1KQFB 3GONA 3T3FA 1TL3A 2FPHX 2QMXA 2AV5A 4UF4A 2CJBA 1SH3A 4ID8A 4QIFA 3A12A 5E5NA 1HYSA 2CDRB 2XI2A 3DLKB 4C0OC 3UDLA 1CEZA 2IHR1 2VJIA 4NA3A 1WD6A 4I67A 1DQ9A 2BQUA 2UZAA 2J0XA 4DPYA 2XLKA 1IWAA 3EXCX 1S97A 2HVIA 1FFGB 2VL1A 4H4KA 2P9GA 3LOUA 2KJVA 2MJNA 1NCLA 3UN3A 2ACYA 1SQFA 3EDQB 1IJEB 1KQSR 4NXNJ 2VODA 1WDTA 1NO8A 2E5IA 3QATA 2PEHA 3TAMB 6FDRA 2Y0BB 3G8TA 2MXYA 1FKOB 2ASYA 5ETLA 2CRLA 5KG7A 2ZM6J 1DQAA 2ZNZA 2E9ZA 3SXLA 3LH2S 2GNKA 2V6AA 4XKVA 1SC3B 3VGUA 1H80A 2J5AA 3WX4A 4WFBQ 1I94F 3PKMA 2PMWA 5M2RA 4ZIVA 4OYAA 1YKWA 4HTJA 2J8IA 5GADI 2R8KA 4QPTA 1CC7A 3L9ZA 2AW0A 2PGCA 4PWDB 1PG5B 4OLOA 2V4RA 2RS2A 1LLWA 1KLMB 1WWHA 3VTIA 5GAGI 2UUBF 4DR6F 4L72B 1RACB 4OYIA 2XT2A 3IA0A 4ZDNA 4PXCA 5J1PA 5AXNA 1AUDA 3J7AN 1GMWA 3H25A 4F02A 2O0WA 2X3DA 1EX8A 1DURA 3ITHA 2I8EA 2NSPA 3EVOA 1IR0A 3HD2A 1O8IA 4XR6A 1FKPB 1GTEA 2BV3A 4LRAA 2EC2A 1XR6A 4CH7A 4YN3B 3MEDA 3H5XA 1RAOA 1Y3KA 3SIPB 3PW7A 3RUBL 3M32B 4WFXA 2GQQA 1Q95G 2QX0A 4YFUA 1JLAB 2HFZA 4PG5A 3HKZD 2LQJA 3Q8QB 4RUHA 4UOFA 2JRSA 4JI2J 2CVIA 3D0HE 4G65A 4MXNA 4YR3A 3NCPA 4LF1A 4NK8A 2HS3A 4OYMA 4LMZA 3MM5B 3QLHA 4YHHJ 1QDUB 4DPXA 2E5HA 4J9VA 5KG2A 2DO4A 4D3GA 1IQZA 2CQ4A 3TZWA 2RMLA 5KFMA 3DNCA 1LW2B 4N76A 3FFIB 2BW2A 1PSDA 5CAAA 3AA8A 3VF0B 3D5MA 2MLYA 3WC2A 2V4JB 3LAMA 1UA1A 1WEXA 3NAWA 4EU0A 1H2UX 2AP6A 2HQIA 1JLFA 4OJGA 4USIA 3GIJA 1R0CB 3IBWA 2MLXA 1RWVB 4PG8A 1ROFA 2XLIA 1RLCL 1APSA 4WTOB 5C42B 3G4SS 3HVRA 1ZM9A 3O6QA 5C1EA 3PJWA 5BR8F 1BHNA 1DLOA 4TQSA 3HHNB 1B0TA 1DHMA 2EWEA 2ZBCA 4XMYA 3AXMA 3DRYA 2FZGB 5FIIA 5LMUF 1M90T 2XS7A 2Q6BA 3GZ7A 2GX8A 3T5HA 3QT6A 2DHXA 5IT0A 1GX5A 4MAKA 3C14B 3MECA 4J5OA 3R27A 2HHUA 4N8NA 4FN5A 1SIZA 2XEXA 3CO0P 3DMJB 3I5BA 1T94A 4NL5A 4ZCKA 1CS4B 1BQNA 3PR4A 5U47A 3V4IA 4HI2A 4PWUA 4GKJF 3OL7A 2KH9A 1NDCA 3CJRA 5C2CA 1RAIB 1XN9A 1T03B 1JKHB 5DG7A 4G1QA 1IA5A 3PTWA 4TVAB 1JMTA 4ECWA 1CQNA 4A46A 1NK8A 1KFSA 3VZIA 2VC0A 2V2KA 1FDNA 2N3OA 4O4GB 1DJ0A 3M6XA 3H09A 2DGOA 4RW4B 4HDGA 3V6DB 3T6BA 1RTIA 4FXWA 3LYCA 1WOSA 3EICA 2YTCA 4YC5A 4LFAJ 1V3ZA 2F63A 2J6SA 2OPRB 4OX7A 1HQUB 3NGRA 5KFIA 2XMMA 1LW0A 2NT9A 1U0SA 2HNYB 1TK5A 1IBLJ 1MW7A 1RWUA 3SQVA 4NLVA 1XK8A 4U96A 4ZMMA 3RBDA 1FDBA 2O1DA 1R8BA 4LJMA 2YNFB 3KWMA 5KFJA 4FVMA 1XR5A 2HNZA 3HT3A 4QYZK 2CQPA 2WOMB 3MUVP 1U1LA 2B9WA 1X8DA 1N54B 3GP9A 1HBMA 4HYKA 2LA4A 2YX4A 2ZD1B 4TU7A 1FRHA 3PW2A 3SI8A 2OFGX 4I2QB 3SSRA 3FBEA 4DR3J 3CT9A 3G87A 2U2FA 2ZFHA 3RW7A 4NOHA 2X85A 1SIWB 1NPKA 3C46A 4Q0BB 1TR0A 3PNIA 4NLTA 3ADAC 4URGA 2F8HA 1RT2A 4NLRA 3H5UA 3A8EA 3CNQP 1JTAA 4OZYA 1RT1B 3DFEA 2M7SA 4N77A 4PPZA 4Y28C 3US5A 5LJ5Y 1WTBA 3CULA 3VVTA 2VASA 1X5TA 1HNZJ 3VAMA 5B0EA 2D3UA 1KHVA 2FZKB 3QAUA 1OFLA 4QJVA 4A8YA 4YZ0A 3R5AA 3T1YF 1N6QA 5C5JA 2VFPA 1YBAA 3B4DA 1U25A 1PBAA 2KDOA 2HHSA 5KT2A 2IFXA 5J1EA 1Q8BA 1PYOB 1YJRA 2BXJA 1FRIA 1NLKL 2DBBA 4NLOA 5IM0A 5KT3A 1XMQJ 2R3VA 2VBWA 1FI4A 2IQ7A 4OYZA 1VQ4S 1OSDA 4RBVA 3ENWA 4RW6B 5I3PA 5K8PA 3KLEB 4W92B 1LFPA 1X0FA 1UVLA 1MG7A 2LXUA 4WBFA 4O0IA 3ZFVA 4QWDA 3CDEA 3ELHA 5AE1A 1TFWA 2P9CA 3CE8A 1RBLA 5KFWA 3R3TA 2AJ1A 1UKUA 1U6FA 5EWEA 1LW0B 3TQEA 2BKOA 3NAIA 2I6WA 3MAHA 4B9UA 5HLFB 4MK7A 2RDDA 4RPFA 3VWSA 1VYAA 2V4JA 2J8KA 3CC4S 3HO1A 4DL3A 3FMBA 1RCOB 1Q0NA 2L9NA 3CGIA 1M5PC 1VC0A 4ZP8A 1U1KA 3RJMB 1S6UA 5B0CA 2VJUA 2E9RX 3K8WA 2JC0A 2HIYA 2LQBA 1GK8A 4WFZA 5B0FA 1PJ6A 5B08A 4QR1A 5JMNA 4DL2A 1U26A 3GFXA 1JJHA 2G2YA 4Z7CA 5D4PA 2VFQA 1IUJA 5CYQB 4CLZA 1KTQA 4WKRA 3VR1A 1FXLA 2CQDA 2O6WA 2VKRA 1BY9A 3DMJA 3BGUA 3L7UA 4JP8A 5HVGA 4FBUA 1JLAA 1NDKA 1S0VA 5L1IA 2J0WA 3CCES 3CEDA 2UXCF 4LF7F 3LP0A 1FF2A 2IM1A 2VV5A 2Y3YA 3AD7C 3FGVA 5IZHA 2F40A 1WHXA 3C6UB 3QGHA 3RAMA 4M5LA 5E0OA 2QFIA 4WU3A 3PHEA 3K0JA 2J9DA 4B3RJ 2WBMA 1IJFB 4C0BA 4KAIA 4OX6A 5KG5A 3KMSA 2VQEJ 3QPIA 4Y6IA 1VK8A 1S4FA 2Q43A 3LGMA 4LF6F 1CJUA 3LUYA 2PA8D 3MGJA 5HSPA 3R2DJ 3PM9A 4RX6A 4LIRA 1ZAVA 3D3BJ 4ZVFA 2YQ1A 1K9MT 1N88A 2BM4A 3I9V9 1RBOB 5D6GA 2Z57B 2HVEA 4I6AA 1TL4A 3QWUA 4ETXA 2WK4A 3A8IA 3AJ2A 5A0YA 4DQRA 3SV4A 4J91A 5KOXA 5T14A 2B5JA 2C28A 5IWAF 2AYBA 2EBEA 4UOGA 2I2YA 4RKUC 4IDKB 4WK1A 5DLFA 1S1TB 1T9VA 3IS9B 2ATCB 2FHKA 3CWJA 3K5NA 1JJ2R 5KFRA 2R7VA 4IG3A 1R89A 2O01C 2UUWA 4OZ0A 2R8GA 3ZTQA 3MWBA 3CCJS 4DF4A 1L3TA 3QYYA 4P73A 4KGVB 5HJYA 1UETA 1U2CA 4CYUA 2M8DB 3M2UA 4ZP9A 3M32A 1RHRB 5EGYA 4KV8B 4WFAQ 3KUHA 4OZLA 3KG1A 4J90A 1Z2LA 2LVWA 3IXQA 1JJ4A 4NCGB 1RT6A 1FK9B 2WTFA 3FBFA 4CM2A 1V3RA 3DKDA 2QL9B 4DV7J 2BE7D 4DQPA 2OTLS 3DGVA 3OXFA 4O4RA 2HBRB 4NXMJ 2W2QP 3NP5A 1TL1A 1WC0A 1U6ZA 2E66A 3DCAA 4XKWA 1XJWB 4U95A 1TK8A 4DSIA 2RILA 3CDBA 2H5JB 3FBCA 5IM0B 2XGQA 4OYOA 1U09A 1CJTB 3R7BB 3M30B 3MR3A 3KHLA 2WVFA 1KDNA 3PYEA 3J81j 2E44A 4KKOB 1HWUA 4N7TA 5KG3A 4DQQA 3ISND 1LV5A 3C3LA 2E1PA 3G86A 3KLIB 4B9VA 3NNHA 1PIEA 1XWLA 5CYQA 3UDEA 2XC9A 3D2WA 3EPGA 1HARA 2NT6A 2AD9A 2GV1A 2W9CB 4M5GA 2BYCA 2H1YA 2HRTA 2MZ1A 2X6YA 2AGPA 1S9EB 3UCUP 4I0WA 1HIYA 1F5AA 4DFPA 4J9LA 2GQ2A 1O51A 2CZVC 2P9EA 4K4XA 2OPSB 5C1CA 2UUCF 1NSQA 3NL0A 4KGZB 4DSLA 4EYHB 1N36J 3HVAA 3BYPA 3UDCA 4XLCA 1YX2A 4ZJOA 4A8QA 1NK0A 3CJKA 4M5DB 1YJTA 3M8SA 2UVVA 1RWXB 2M52A 2V94A 2V63A 3TUPA 1C0TA 5KFOA 1O88A 4JI2F 1T02A 1EP4B 1N5VA 1S6PA 4LBHA 5IOLA 4Q8FA 2BW7A 1WACA 4NEZA 3UNYA 4G1IA 5D4OA 4DR1F 4EZ9A 2AX1A 3OHBA 4C7QA 2N7CA 1ZTWA 4NXNF 1HHQA 1BD6A 2D9OA 4F3QA 4ICLA 1QSLA 2G1DA 2CDQA 4K2XA 3VGVA 3CJSA 5FLXU 1KRPA 3HJVA 1MWYA 2A10A 2AJ2A 3H98A 4F50A 3FDSA 2HHPA 4ZS6A 4X62J 4RU9A 2OPPA 5A8WB 3X3UA 4DR2J 1T3OA 4CLFA 1ZM4A 3G6XA 4P52A 4GKKF 4DZ6A 3HD1A 5LSLA 2UUBJ 1S59A 4KFBB 1WKJA 2X3GA 1WMRA 3HZEA 1RJJA 2OI2A 1EE6A 4KTQA 2GMLA 5ETQA 3DI6A 2M2BA 5F8MA 3N6MA 2JHEA 4L75A 3VCDA 5ETNA 1SQEA 1UZDA 1BQMB 2QE5A 3AOCA 1D9FA 4LF8F 1KOHA 3V6DA 3SQGA 5DDOC 3AODA 4IQXA 3M8QB 3JTPA 4XTTA 1RGVA 3H4DA 5CCLA 3LWLA 3TAPA 2GVDA 1GTHA 2ZC4A 2XTJP 2VDHA 2W7AA 3FC9A 3ZZYA 8ATCB 1SUQB 4DL7A 2MQNA 1U49A 2JEFA 2XS5A 2G2OA 4DSFA 3NB2A 2HVZA 4NX9A 3NWGA 1DTTA 1FTCA 2HQFA 5DS7A 2PIIA 5AXLA 3PXGa 4YHHF 3T1HF 2KM8C 2OAUA 1YJWS 1FNOA 4FXVA 1BWEA 1BMQB 2OPQB 4R5PB 3BQ0A 1VBZA 1IWGA 2EXUA 3KKFA 3PSZA 5G4DA 2W4PA 3EVMA 2K8GA 4KHMA 3M6UA 4I2PA 2NR0A 2NPFA 9ATCB 3UN5A 2DT9A 4XOTA 2VPZB 2Z8QA 2BZ2A 3C16A 3V6JA 1L3KA 4O44A 4DQIA 1EQMA 4X62F 1IKXA 2DNKA 2OSRA 1YBTA 2RF2A 2VG6A 2Y1RI 3WIVA 1LWCB 3CCRS 2KN4A 3HHLC 1VQMS 2C22A 4DPTA 5E2QA 3A3NB 3S8SA 3EQOA 2QYCA 7FDRA 2QFJA 5J2QB 4CLYA 2B4OA 1TKTA 2A3JA 2X6XA 4LF4J 1KN6A 4P7VA 4C8ZA 1NMEB 5B09A 4AVZA 1R8HA 2BACA 5D77A 4XN0A 2YNIA 4NLDA 2NS1B 2PEBA 4Z06A 5A8KB 2MZTA 2XY5A 2B4PA 3KK1A 1VISA 4B9LA 3OHAA 1FJ7A 2IMOA 4I68A 3TW0A 2YKAA 5DZ7A 1BQNB 3UNGC 2GO9A 2XMTA 5C25A 5ETMA 2DHGA 4OYXA 2MZRA 4TLQA 4F7VA 3NGSA 2IJNA 4OMFG 2VC1A 4O3OA 4Q5VA 1J5EJ 4WE1A 4PG4A 1NXIA 1EB0A 1TP7A 1IBCB 1D9DA 4JI6J 2MDAA 3CJ0A 3DOMA 4IH6A 1RABB 3P45B 3SCLE 4Y00A 3M8ZA 4OZ3A 3KDOA 2B43A 1JB0C 1HD0A 5LOQA 4B9MA 5C7PA 1WC6A 5G0RA 3PG9A 1D9AA 1IR1A 3EDRB 1JXEA 3Q83A 4HT5A 4YEAA 1TKDA 3Q8RB 2N3LA 5C24A 1T95A 1Y0HA 2NLWA 1UEKA 2O5DA 5L46A 5F8HA 1KVKA 1PYTA 2N7YA 5H9FJ 2FY8A 2FB0A 2IJRA 2C2DA 4JI7F 1I6JA 2UVRA 3G82A 2IVFB 4KY3A 2FLPA 3TYTA 3FCVA 3MI7X 3IWLA 2D3O1 4ZA1A 3WZ0A 1WHVA 4EYIB 2ASJA 4E2FB 2BJ7A 2BVZA 3CIZA 2D69A 2YUHA 3LGNA 4O44B 3W9HA 3KXDA 3W7BA 2IAJA 4OV6A 1IDJA 2FY1A 5F3ZA 1IKVB 1NDPA 3E01A 3M9OB 4DR4J 2HWHA 1SL0A 1KLNA 4JI8J 2FJBB 2F9JA 2QL5B 3G6ES 2YKOA 4K4VA 2RE1A 7FD1A 1TV6A 4PMHA 2B4VA 2HVHA 4AXJA 1UW4A 1O8JA 1RAFB 2IBOA 3TEGA 1PJ7A 1S1UA 3FCWA 4ZOSA 3TR5A 5DGAA 1DTTB 4J37A 2FTRA 4LR8A 2LEBA 4HKQA 4YMEA 1AZSA 2KRBA 4DOZA 2WSCC 2E1CA 4C0HA 2XS2A 1OGOX 1FKPA 2RSQA 3L7PA 5FDLB 1ZM2A 4QW8A 4M5DA 3CJKB 2XO6A 1ZAWA 3PCOB 2D3ZA 1RT7B 1VRUA 4XLFA 1V9OA 1WG1A 1XR7A 3CVKA 4X2BA 2POKA 4W90B 5ETPA 4B3MF 2LQ8A 4K5SA 1O8LA 2WSEC 1EAYC 3OFFA 2EFVA 4RR5A 3O8WA 4ZP7A 4LRDA 1IBKF 2CJXB 3MM7A 3T1AA 2F3LA 3GQ9A 2ZBPA 3D7SB 2YWKA 2YWGA 3IG1B 3IAS9 5CXTA 3W8PA 1DBGA 2YPZA 5IV4A 5KFKA 1JJCB 1PBUA 2JC1A 5HBMA 3VZHA 3W1YC 5I3UB 4EGLA 4CO5A 1P1TA 3MM7B 4KIAA 5LJ3Y 2Q66A 4F4YA 1RWOB 4IR9A 1H98A 2AYGA 5KFQA 3OUYB 3FRYA 2E9TA 3BSCA 4IO1A 1L3UA 4M94A 4IFVB 2ZVIA 3NGUA 1KFDA 2DK2A 2IA6A 2UUAJ 1T05B 3K5LA 2FHMA 4FS1A 4RW7A 2AZ1A 4DS5A 4DSJA 2DJWA 3FQLA 1YI2S 1VS3A 1A6LA 1AB8A 1DQ8A 2L9WA 3I5AA 5K14A 2BDPA 4QU6A 2VFOA 1RT6B 4NCGA 4LFBJ 1QUVA 2VF3A 2M70A 2QIFA 1C1BA 3F56A 1EP4A 1G4CA 1S6PB 2G4BA 4K50A 2Y1LB 2HYIB 5L1KA 3BF4A 4DF8A 2X1FA 3PETA 1S1UB 5F0WA 2BJ8A 2CPZA 1C4AA 1S4EA 2BRKA 1E6YB 1AIRA 1UWBA 2RS8A 3NY0A 4MMOA 4DX8H 5GAGU 2DYAA 1TKZA 2X3HA 3PFEA 1S1VA 4Y2KA 2OUGA 3TVZA 4DLEA 2GCFA 1NJWA 3CB4A 3H4BA 1UEUA 4YZQA 2HWIA 2OHDA 1TSPA 3NOCA 4A8SA 1NK9A 3EGZA 4XORA 1U24A 5AJ3J 3VGSA 3PW4A 2W9CA 2ZBQA 1LLZA 2C3YA 2H5IB 4ECYA 2DRDA 3VQTA 2LDYA 2XSFA 1ACMB 3OTOF 4X66J 4X4SA 4YEIA 4OJPA 4EK2A 2D9PA 2C2EA 4OQJA 2IPOB 1Q1KA 1O6XA 1X0CA 2LCWA 3Q86A 2MEWA 4KPCA 3U1MA 3ZTOA 3OL8A 3CDUA 1NKBA 3JTNA 2W9BB 2NTPA 3DLBA 2HHTA 3M6WA 2DNZA 4HL9A 1RHUB 4EBCA 3V81A 1CJKB 1SJFA 1HPZB 3QJPA 2CPFA 2PI5A 3LP1B 5IQQA 2MKKA 2HGMA 2QLXA 3U1NA 3DOKA 4WF9Q 2FVCA 3AJDA 1YRTA 1QTNB 5KG0A 2DIVA 3MMAA 5KT7A 2HHVA 3W64A 1DTQB 5KFUA 3FNNA 3FJ2A 1U1RA 1MWQA 2K2PA 2QZAA 3K17A 1HWKA 2KVIA 3G6YA 4K4SA 3O1LA 3TX8A 3GFYA 2AWZA 3KJQB 3UPFA 4DZDA 1AZSB 2XWXA 3CJTA 4C11A 3MMJA 4OI2A 2XGPA 2RIJA 1G3OA 5IT4A 3HHLD 4IFYA 4ZVGA 1RYSA 4LRCA 1RAEB 1TELA 1GT8A 1PLUA 1WC4A 1WHYA 4IH5A 2KRRA 1OGMX 3ZZTA 4RNFA 2V2QA 4K4TA 1QA3A 2P5VA 5KAKA 2CJYB 4ES2A 2VBEA 4NA1A 3OQ2A 3WQPA 5HVHA 1FWKA 1ULRA 2HURA 3A1YG 4IRKA 2I38A 3HP6A 5HP1B 3KLGB 2KG0A 1R31A 2IAJB 2WZ1A 4ECUA 3BKFA 1TKTB 3CUNA 3JSRA 2OELA 3CCZA 4Q2MA 3PX6A 1NSPA 2GGPA 4NYOA 3THTA 2BQ3A 1XIQA 2GZOA 2RF2B 1N34F 2W9AA 1J2VA 2BE2B 2DPIA 4YY3F 4P2FA 3HFKA 1XNRF 4ECZA 1WUUA 4ZHRB 1PILA 2EFPA 4G3IA 4USVA 2KVQE 1GMUA 4WU2A 2QXZA 3DDKA 3GJSB 3RU0A 2YKMB 1S48A 2HK2A 4PPDA 2G0IA 1NJXA 3R2CJ 1NPRA 4QR0A 5I4MA 4X4VA 1R27B 1N0UA 3MCMA 3OJUA 1MROB 1C0UB 3IR6B 4QYZJ 1OMSA 2JZ5A 1RT5A 4A8WA 2VOPA 2OFHX 2WONB 1U4BA 1EARA 1TL7B 2NXJA 4A8KA 2RRAA 2R7SA 1IVZA 3NNCA 2E7XA 4LREA 1HG8A 2DO0A 5I3QA 1O8FA 2GVDB 3IN5A 4DV4F 3GYNA 3NEKA 2FDNA 2GS8A 4IRCA 3HHEA 2MQOA 1NJIT 4U8VA 3TUJC 1UW9A 4L74A 1MLAA 1C4CA 1YWXA 4DMZA 1OYDA 2KYZA 2H3EB 5L39A 3TARA 4CM0A 3OSPA 4P71A 4NRTA 1NKEA 2EC0A 4WIQA 1Y5LB 3JQMA 5A2QU 4OZ2A 3OSNA 2ZDOA 1EKSA 4QWAA 4OHYA 1OSCA 1MN7A 1RISA 1KQGB 4HACA 4ITSA 1KSPA 4XAKA 1RDRA 4CTAB 2WHOA 4AL7A 4OM9A 4ZVOB 4YOEA 4I2QA 4FF2A 1LWXA 1QE1A 2V8PA 3QIPA 2CWXA 2EKYA 3AH6A 3NNAA 3PZPA 1KR4A 1M1GA 2RQMA 1K44A 2B4UA 2Q79A 2VBXA 2MQ8A 1Q86T 5GVQA 4ELUA 3I0RB 3LANA 2HIQA 2M88A 3I5CA 1NPPA 1RLDA 1WF1A 3L7OA 2DH7A 4C97A 2DY9A 2Z4PA 1XERA 4ANDA 2FLOA 2Z56B 5J2PA 4LF8J 5HVFA 2KI2A 1LWEB 2AJFE 2JL9A 2GAHC 4LR9A 4O3QA 2X1GA 1HWIA 4OI4A 2ZOFA 4HR2A 1Q8KA 2J76E 2HZAA 2RQKA 2ZBRA 3K5MA 4W8RA 1G6BA 1ZA1B 2W2NP 2YNGB 3CD7A 3NLCA 4P2SA 2AIRB 2B8PA 2LLZA 3AD9C 3V2UC 3IWNC 2ZBIA 2WW4A 1OIAA 2IDEA 4QIVA 4ZK7M 2B6AA 5KT6A 5GADU 4XPCA 1ZTTA 1SJ1A 2B51A 1FVSA 3MCNA 4I4BA 5F3TA 1F9EB 1EETA 1N5QA 4ZVQB 1U1NA 2XSJB 2MY8A 4Y3CA 2XLJA 1HQ2A 1MWZA 4A47A 3IC1A 4QCLA 3TP2A 1O8MA 2GAGC 2WONA 4B3SF 3FZBA 3R7NB 5L8RC 3ZPPA 4KQZA 2ZH6A 2DIUA 3P4GA 2HNDB 2CKWA 2UUTA 3DYAB 1K8FA 3ISZA 3PKYA 5JVGQ 4K5RA 1K5CA 2FYXA 3H90A 3S01A 3R1LA 8RUCA 1VQPS 1PO6A 1TKXA 3A3PB 4OZZA 2NTBA 1NNDA 4ZVHA 1YZ6A 4ILRA 5BYRA 2W1BA 4ED3A 1SKWA 1FKAF 3QRPA 2M0GB 4ZPDA 4KV8A 3QFWA 1HQUA 4YB5A 4ZN3A 4RNNA 2K3IA 4XQFA 3M2UB 1RYRA 4RW9B 3OVBA 2PYGA 2LQ5A 3IBFB 3GE9A 2DTJA 2CQ0A 4FPRA 3C66A 4KE5A 4M5KA 4IYQA 1S0OA 1CLFA 4AYBD 2E7VA 4DR3F 2VA3A 3MCOA 1KEKA 1CULB 3GQ7A 1W25A 2X1BA 1J5EF 1NH7A 2F8EX 3DXBA 3HSDA 1JLQA 3A8KA 1CSJA 5B0GA 4JI0J 4KB7A 1Q53A 1QM9A 3UR3C 3KLIA 4HI1A 1B7FA 3K5OA 2J6TA 3EZUA 1WOPA 4TY9A 4W8TA 2A6MA 2RRNA 4KKOA 4CLSA 3IRXA 1RAJA 2Z58B 2HBQB 4A8XA 2R7UA 5KG1A 4XDCA 3HX9A 4PWDA 1VBYA 3FEXB 5AE3A 4Z37A 3LTOA 1RT3A 4AQYF 3NGDA 1GMVA 2RHQB 4KO0B 3G6VA 1LFWA 2QL7B 3DRRA 4OZJA 2W2MP 2QA4G 3MMBA 5HO4A 4CIOA 4F4XA 2J8AA 2YKMA 1FESA 2G9OA 3LAKA 3CF5Q 1FK9A 4N56A 1T7PA 2OTJS 3T41A 5CZVA 1KLMA 3MR7A 2DGUA 4OI3A 3OXLA 2BANB 2RH3A 1NEEA 4V19X 2IMWP 3BN7A 1S99A 1JLFB 2HRUA 1ELOA 2AX0A 1WKKA 1H2VZ 3AOAA 3HULA 3ONQA 2W9BA 3KHHA 4IO9Q 4AL6A 3HHDA 2AGOA 1SKSA 1QVGR 4B9TA 2L41A 4IG3B 4ECTA 1M5SA 4DV2F 3HDSA 4MFBA 5EDWA 1QA1A 3NMAA 2ILYA 3D66A 4CLLA 3ICLA 4C3MA 2IRYA 3OTEA 2QLFB 2PYHA 1B0PA 4FS2A 3B4NA 3HSJA 3SCIE 5LSRA 3N28A 1NHKL 2EPIA 4CP5A 3OR2B 2FUG9 2VPXB 2W2PP 2MKIA 3G96A 2EI5A 1TYUA 3DU5A 4CCHA 2E1RA 3TUZC 1CQMA 1CJUB 3KLVA 3FQKA 1JK9B 5EWGA 3LP2B 2YBVA 2RHSB 1XBWA 1LWFB 2XZTB 3VSUA 4DEZA 1QRCA 1VIXA 1DABA 1D3WA 2MSTA 3VAJA 2VUGA 2XZDB 2AJQA 3MMBB 3SFUA 2ZE2A 2JSXA 4CLPA 3BS9A 3QZ8A 1X0PA 1YSJA 4TY8A 1RTHA 3TOQA 1BHEA 3GR1A 3LP1A 2IC3A 3WIUA 3KK3B 2BJ3A 1TQLA 2O1PA 1O8DA 2FJEB 1FFSB 2R7QA 2XSJA 5EX3A 1F9HA 2AQ4A 3C19A 2BSPA 2UVEA 1JLGA 2RUGA 3R6LB 4AQYJ 1N6QB 2B6AB 3IG1A 5A6PA 3OTBA 4B3OA 1SB6A 4OHXA 4Q2LA 3GWCA 4PAAA 1SC4B 1S6QA 2XHCA 4ID5B 4BC7A 4ZKAA 3N90A 1WELA 5KFNA 1VQ9S 2HFNA 1SJQA 2R2TA 2CNNB 1ZOTA 5IFMA 1D8ZA 3BGRA 2VDIA 2EK1A 4Y34A 1PAUB 4X4OA 2MQMA 3QSYB 1S1VB 4WZQA 1RBAA 1VR6A 3D1OA 3EWGA 2UVFA 4HHJA 4B08A 4DX6A 2EFOA 4CH1A 1OFDA 3GV8B 3UQSA 4KT0C 1LKZA 2YWHA 4Y2MA 2HW3A 2K1RA 2Z2ZA 2QA4S 2HMIA 3TH0A 5FDLA 1QCXA 4RW9A 2LU2A 4R8UA 5CYMA 3QAEA 2KM8B 4TU9A 1QQ1A 3DLHA 4M95A 3PYGA 1X4CA 2ZD1A 4JI4F 5H9FK 4WYLA 4F4WA 2C3OA 4LVNP 1B4SA 3HVTA 5AJ3F 4EO6A 4RL1A 3KNGA 1NK4A 1X9MA 1VMBA 3EM1A 2Q6CA 4OJOA 2DNHA 4X66F 4LQ3A 2XT4A 1HNVB 1DBOA 1SH0A 2GMJA 2O67A 2O66A 2RU9A 2KU7A 3DRPA 3ETOA 1OY9A 2JFDA 3BB5A 3DYAA 2HNDA 3PDNA 4NMXA 2DHAA 4OYBA 1QY7A 3RZAA 2QLWA 1N4LA 2Y8WA 2QA2A 2UXCJ 1MMNA 1GNKA 2OPRA 2XC1A 3OFHA 2IOUG 1RA7A 2DRBA 5T7LB 2QG9B 4KR0B 4QWEA 2E5LF 2NREA 3BPDA 2R7TA 3T19A 2LKZA 4HACB 2YH1A 3D4JA 3Q2TC 2HZCA 3JQKA 2GO8A 1X4FA 1VQ8S 2DR5A 4NLWA 1P1LA 1FWLA 3HLUA 3QO9A 2PECA 4BHQA 3RB4A 1ZYQA 2P2CB 4V19J 1HI0P 4B9SA 1XEZA 4UOHA 4P72A 2VBMA 5C24B 2YH0A 1T03A 3QMQA 2ZH9A 2BOAA 4EWTA 2BM0A 1CBKA 1QD1A 2V5HG 3H42A 2CWKA 4RUBA 1AFJA 1RHJB 1YZ7A 4Z2XA 3GCWP 2CADA 3BM7A 4QR2A 3SMZA 2HFSA 5EHHA 3GV7B 1UA0A 1SKRA 1RMGA 2DXFA 5CZXA 2CQ1A 3CJ3A 1GFWB 1WHWA 3H2LA 3KJVB 4OV1A 3I0RA 4HHUA 5JMCB 2DGVA 4F2RA 4XLAA 2WOMA 2XMKA 4ZPCA 2ASLA 4A8FA 2QSWA 1UVIA 2YNFA 3CJ5A 2B0RA 1LK5A 5J1NA 1FRKA 2DGQA 1M1HA 2CPHA 2OMLA 3HHLB 3KFWX 4XM3A 2ALYB 1T8EA 3OBIA 5F8NA 3PVXA 2MYFA 3T5LA 2DR6A 2KKHA 1FA0A 1I51B 3AD8C 1GQEA 5EN1A 1HBUA 1VHFA 2KHCA 3N4WA 4ZHRA 1XNQF 1AFIA 3R7SB 1Q7YT 1NBEB 4DN9A 2W4CA 4PQUB 1WI6A 2BM6A 4TYBA 2M3DA 3J81U 3I6PA 2RAQA 4UY8T 2HBZB 1REVB 3W2VB 1U2FA 2V4QA 3BYRA 3OLAA 5CHCB 5E3QA 2PDAA 2W7OA 5JVHQ 1RTJB 4F2SA 1Q79A 1WSRA 4ANEA 3KLGA 1NH8A 2DCUB 1FWPA 2OEKA 1JKHA 2ZVSA 3K2YA 3MM5A 3N5BA 3NBPA 2QO3A 4LRBA 4I6YA 4AXIA 2AMCB 5E7OB 1MNEA 4JB8B 5F9LA 3B78A 5A2QY 2VG7A 4LSLA 4K0KJ 2XCPA 2XNRA 4Q45A 2KJWA 3SDEA 1XG2A 3TRGA 2IDLA 2XHWA 2UXDF 3LJYA 1VRTB 3BN4A 4ETZA 3KJVA 2R2SA 5DNSA 1WDDA 1X60A 1Y4ZB 3MEDB 3OR1A 2PE8A 3PW5A 3I55S 4KHRA 1L5UA 2DY1A 3LALA 2NSBA 3ITHB 3N5FA 3D6FB 4G6VB 4CNYA 2X51A 5HQLA 4OHVA 3J7Z5 2GIQA 3M9NB 4N5SA 1OQ3A 4ZPBA 1QAIA 4OJ5A 4C8YA 3H5SA 4ZITA 4QQBA 5C42A 4HEA9 5K8MA 1CJVA 4F36A 4Z05A 3GCXP 3GTYX 4W98A 2UXBJ 1U7LA 2IM3A 4DPOA 1GXTA 4DR1J 3CJ2A 3QO9B 3AXKA 1YRXA 2VA2A 3DI6B 1SVDA 2BJ9A 4DBQA 1R0AB 4DWIA 3P5TL 3CDWA 4W8QA 2KL8A 3R5CA 4PYDA 3T9NA 4GO7X 3UD5A 4F0HA 1F6TA 3CPWR 1VOMA 1RWKB 3LO3A 4YUDA 1S76D 1YGYA 1DFDA 2LYVA 5DO2A 1BE4A 2VFSA 2FC8A 1K47A 2CXEA 4H4OA 5KFXA 4GKKJ 3HI9A 3D54A 3JAMY 3M9MB 1PC5A 3D9BA 1NZAA 5I42A 2BR0A 3ILJA 1OO0B 4ICLB 4USMA 1N5SA 2OKQA 3BBCA 1F1BB 2ZUAA 3AFGA 3P4UB 5D0HA 4F67A 3A13A 3KJFB 3OJSA 1RTDB 1WG5A 2UP1A 4WKYA 1S49A 2XB2D 3ZZPA 3F73A 1FHTA 4JV1A 1TK0A 3K58A 2V50A 2FLLA 3F44A 2GJIA 3DM2B 4OJ3A 1VCTA 4RWWA 4ANCA 2XCAA 3M8RA 2VONA 1DTQA 1XTZA 1EKRA 1HNIB 1S57A 2DEJA 3MMAB 4CDIA 2J7UA 3NGKA 4DX7A 2OH2A 3EPIA 5DZ6A 2XTWA 6AT1B 1UVNA 2V0NA 3T1HJ 2F4VF 3J7ZT 3M2RB 3PRBA 4WWSA 3OVAA 1V3SA 2NTQA 1VK3A 1NJYA 4B3SJ 4RNOA 1BWVA 3MPWA 4ZCLA 3S6EA 2D41A 3PV8A 3I87A 4RWXA 1JLGB 4B3OB 2NQPA 1SBRA 1R8PA 4L76A 5KFTA 2IBKA 1HNWJ 3F0NA 5HMWA 4Q7AA 1CJTA 2HLUA 2DD8S 3JX8A 2DXDA 1YJUA 1BUXA 2NYIA 3BO2A 4HTIA 1HBNA 4OJ6A 3BJYA 4TY8B 4J9NA 1HBOA 3ZSCA 5E3PA 1NK7A 1X5OA 1VBKA 4KH0B 4ZVUB 2PI4A 4LF4F 1ZETA 3P96A 1EHWA 5HROA 1K0VA 3M8WA 1CZFA 1ZPVA 4F4KA 2Y8YA 4ZLNA 1PKUA 1RU1A 3NRBA 3GQ8A 2WVCA 4L3NA 1PGZA 2CVEA 1F3VA 3P3DA 4MT1A 3GFHA 5L9NA 1YTYA 4RNHA 1F60B 3RRKA 3H5YA 2C3UA 2OP5A 4GMKA 1LQ9A 1T0TV 1TV6B 2CPIA 5D0GA 5DQHA 1P8GA 1HBOB 2C2KB 3HT0A 3E3XA 1T05A 4IFVA 1HD1A 1RA6A 4F4ZA 3BGRB 4NRUA 4Z03A 1RWRA 1S9EA 2GVZA 2WBRA 3TI0A 2MKYA 5E33A 3MR5A 4JI3J 4KHPJ 1KD1T 2GA7A 2J0QD 2CQ2A 1YVFA 3LW5C 2HAIA 3D68A 4O0NA 4X65J
chains in the Genus database with same CATH topology
3G2XA 3VGUA 3Q86A 4KPCA 3ZTOA 1LEOA 3NGSA 2BX6A 4HR2A 2J8IA 3BBFA 3LJYA 3SYJA 3WX8A 3FKBA 2BM5A 2B8PA 3VVTA 3FBCA 1NSKL 2DXEA 5BXIA 1KDNA 5C7PA 2VFPA 1HLWA 3ZTPA 1CLWA 4OJ5A 3EVOA 3Q83A 2NCKL 3VVUA 4FKYA 3N90A 1NLKL 3NGTA 4W98A 4F36A 1TYXA 1HIYA 1HF2A 1MN9A 3ENAA 3P4GA 1K8FA 2B8QA 3FCVA 1NSQA 4WBFA 1QRBA 2W7ZA 4UOFA 1QA3A 3ELHA 1F6TA 4OPWA 2V5IA 3BBBA 1F3FA 3DKDA 2YUHA 3TH0A 2HURA 3GPAA 1W7WA 4EK2A 1QQ1A 1BE4A 5IOLA 1NDPA 2VFNA 3ZTRA 1B4SA 3B54A 3FBBA 1VYAA 1HHQA 5CAAA 3EM1A 1NSPA 4OJOA 3BBCA 2ZUAA 4F4AA 1XIQA 3R9LA 3ETMA 1U8WA 3VGVA 3FCWA 4V02C 5CABA 4KH3A 2XC1A 2IOUG 3SZEA 3JS9A 2VFQA 3BH7B 1QA2A 1WXRA 1BHNA 4ANCA 4DZ6A 1S59A 1WKJA 3MPDA 1S57A 3L7UA 1NDKA 3ZTSA 4UOHA 1JXVA 4JRAC 2F3LA 3Q8UA 2CWKA 2AZ3A 1NDCA 5JLVC 1S5ZA 4OJLA 3FC9A 3JX8A 2DXDA 1NB2A 1BUXA 2DXFA 3RIQA 1NDLA 3Q8YA 3DDIA 3AK5A 1UCNA 1WKKA 4OJ6A 3NGUA 5JMCB 4DI6A 2BM7A 3Q89A 2BM4A 3EVWA 2AZ1A 3EJMA 2HVEA 2B0RA 3H09A 1MN7A 1TYWA 2VFOA 1XQIA 3PRVA 1EHWA 3LYCA 3EVMA 1QA1A 3EICA 3N6ZA 4OM9A 1PKUA 1LWXA 3BH6B 1B99A 3ML3A 1ZS6A 3NGRA 4UOGA 1TYVA 3PETA 4FKXA 4C6AA 4ENOA 3PJ9A 2BM6A 1NHKL 2VFMA 1K44A 2DYAA 4CP5A 3B6BA 4S0MA 3Q8VA 3ZTQA 3VGTA 3EE3A 2HVDA 2BEFA 1TYUA 2G0YA 1NUEA 3GP9A 2VU5A 1NCLA 1TSPA 1KQ5A 4ANEA 1PAEX 2DY9A 3VGSA 3FBEA 4ANDA 4DUTA 1K4ZA 3EMTA 3FBFA 4OJPA 1QRCA 1DABA 1WKLA 4O0NA 1NPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2X A;  3VGU A;  3Q86 A;  4KPC A;  3ZTO A;  1LEO A;  3NGS A;  2BX6 A;  4HR2 A;  1WKL A;  3BBF A;  3WX8 A;  3FKB A;  2B8P A;  3VVT A;  3FBC A;  1NSK L;  2DXE A;  5BXI A;  1KDN A;  5C7P A;  1HLW A;  3ZTP A;  3EVO A;  3Q83 A;  2NCK L;  3VVU A;  4FKY A;  4F36 A;  1NLK L;  3NGT A;  4W98 A;  1HIY A;  1HF2 A;  1MN9 A;  3ENA A;  1K8F A;  2B8Q A;  3FCV A;  1NSQ A;  4WBF A;  4UOF A;  3ELH A;  1F6T A;  3BBB A;  1F3F A;  2YUH A;  2HUR A;  3GPA A;  1W7W A;  1BE4 A;  5IOL A;  1NDP A;  3ZTR A;  1B4S A;  3B54 A;  3FBB A;  1VYA A;  1HHQ A;  5CAA A;  3EM1 A;  1NSP A;  3BBC A;  2ZUA A;  4F4A A;  1XIQ A;  3R9L A;  3ETM A;  1U8W A;  3VGV A;  3FCW A;  4V02 C;  5CAB A;  3JS9 A;  3BH7 B;  1BHN A;  4ANC A;  4DZ6 A;  1S59 A;  1WKJ A;  3MPD A;  1S57 A;  3L7U A;  1NDK A;  3ZTS A;  4UOH A;  1JXV A;  3Q8U A;  2CWK A;  2AZ3 A;  1NDC A;  1S5Z A;  3FC9 A;  2DXD A;  1NB2 A;  1BUX A;  2DXF A;  1NDL A;  3Q8Y A;  3DDI A;  1UCN A;  1WKK A;  3NGU A;  4DI6 A;  3Q89 A;  3EVW A;  2AZ1 A;  3EJM A;  2HVE A;  2B0R A;  1MN7 A;  1XQI A;  3PRV A;  1EHW A;  3EVM A;  3EIC A;  1PKU A;  1LWX A;  3BH6 B;  1B99 A;  1ZS6 A;  3NGR A;  4UOG A;  4FKX A;  4C6A A;  4ENO A;  3PJ9 A;  1NHK L;  1K44 A;  2DYA A;  4CP5 A;  3B6B A;  4S0M A;  3Q8V A;  3ZTQ A;  3VGT A;  3EE3 A;  2HVD A;  2BEF A;  1NUE A;  3GP9 A;  2VU5 A;  1NCL A;  1KQ5 A;  4ANE A;  1PAE X;  2DY9 A;  3VGS A;  3FBE A;  4AND A;  4DUT A;  1K4Z A;  3EMT A;  3FBF A;  4EK2 A;  3DKD A;  4O0N A;  1NPK A; 
#chains in the Genus database with same CATH topology
 1K1Q A;  2L08 A;  3SSS A;  1YHQ S;  3EGN A;  3KDN A;  1U47 A;  1EQ0 A;  2ZWO A;  1FDA A;  1N0V C;  3DRS B;  4TN2 A;  3M2R A;  4LF5 J;  1HQE A;  3BBF A;  4ZJQ A;  4KJI A;  3SYJ A;  3KG4 A;  3WX8 A;  2A18 A;  1TTH B;  5B0B A;  4ED2 A;  1U02 A;  4JV2 A;  4PG7 A;  1CJV B;  1TL1 B;  3B4M A;  4EBE A;  3DOL A;  2FVQ A;  5BXI A;  5M2P A;  1AUS L;  1RSC A;  2ZE2 B;  3I56 S;  2CJA A;  2ZH7 A;  3PJX A;  3CIM A;  3TVK A;  2Y9H A;  4WP3 A;  4K4W A;  2DNL A;  1CLW A;  3JSY A;  2BA9 A;  5DET A;  3WHI A;  4B02 A;  2MZS A;  3CO9 A;  4CLU A;  3MR2 A;  4IKA A;  4X4N A;  3RAX A;  4QYR A;  2NXN A;  1UFK A;  1Y9O A;  2BBE A;  2YKN B;  2QMU B;  5EUH A;  1VRT A;  4JI8 F;  1MN9 A;  3C15 A;  4C48 A;  5F8J A;  1F5C A;  1ARO P;  4U9R A;  3J81 Y;  3C8Y A;  3G71 S;  3BSO A;  1Q82 T;  2IYG A;  4M8L A;  2HS4 A;  4DSE A;  2W7Z A;  1S1W A;  1EZZ B;  2ZIT A;  2HMI B;  2V68 A;  1TMJ A;  2YXL A;  5I42 B;  3VSV A;  2XYH B;  4XLE A;  4CLT A;  5KTQ A;  3OL6 A;  1JLQ B;  4ECR A;  2CJ9 A;  1FJE B;  2ZZT A;  2K7J A;  1V5V A;  1H7X A;  1IKV A;  2VH7 A;  3E01 B;  1FJG F;  1MML A;  5KFV A;  4K7Q A;  2RB7 A;  3MFI A;  1RAG B;  1IKW B;  4C8N A;  4KC5 A;  3TA2 A;  2MGZ B;  1YLX A;  1U6B A;  3B54 A;  4MFB B;  5ADZ A;  3HPO A;  3MEG B;  2C2Z B;  1U1Q A;  3FSX A;  1IN0 A;  1FER A;  1OPZ A;  4B9N A;  3MEE A;  4PYA A;  5KFH A;  4XL9 A;  5KFP A;  3ETM A;  4RW8 A;  3RBZ A;  4ZP6 A;  4WP9 A;  2PC6 A;  1YJ9 S;  2RDI A;  5CAB A;  1MU2 B;  2C42 A;  2ROP A;  4PG6 A;  4FNH A;  4D3H A;  3G8S A;  3JSM A;  2V69 A;  1IBK J;  4UY8 5;  1NAQ A;  1SL1 A;  3OT9 A;  4OFZ A;  2MZQ A;  3EXY A;  3SZE A;  1H2T Z;  1HI8 A;  1KHW A;  3SY2 A;  3MZI A;  1UP1 A;  1QA2 A;  3P5B P;  1P27 B;  5D15 A;  1SC6 A;  3NWR A;  4Y0F A;  2OPQ A;  5G0R B;  4R5P A;  4JI5 J;  3MM9 A;  2Z8G A;  4WYW A;  4F0K A;  4J9Q A;  3DRR B;  3MAA A;  2GW8 A;  1QAX A;  2HFV A;  1TU0 B;  1RUS A;  2NSC A;  3DOM B;  3QID A;  4UZB A;  3PY8 A;  1N5T A;  1VI7 A;  4JV0 A;  3P49 B;  2FJA B;  2NST A;  1SPB P;  4DXL A;  3UW0 A;  4YZX A;  2UUA F;  4C8L A;  2OLW A;  2JDJ A;  3SCK E;  4YB1 P;  3SUC A;  3L4B C;  4ED0 A;  1EJ7 L;  3Q8U A;  4WPA A;  4LSN B;  1EET B;  2BE9 B;  3T6J A;  2KHD A;  5HQ8 A;  5AXK A;  4I6W A;  4PZV A;  1TUG B;  4CNZ A;  2G1H A;  1JRG A;  3HVW A;  3LQV A;  3NBP B;  5A8R A;  4JYA J;  2ABY A;  3JSB A;  5E3R A;  3RIQ A;  5KG4 A;  1AA1 B;  1RI7 A;  3KLH B;  1Z1Z A;  3MMC A;  4YDX A;  5KFL A;  4RBT A;  3HXM A;  1VLO A;  2CNK B;  4NCB A;  3W3S A;  2V8G A;  4FXD A;  3D6M B;  3Q89 A;  2GIF A;  5D0R A;  2Y0S D;  2CNO B;  3DXS X;  4J7C A;  2OEJ A;  4USU A;  4ZVP B;  4OX9 J;  1NK6 A;  2A0F B;  2EKN A;  1D09 B;  1NHU A;  2WB1 D;  1Y00 A;  1RU4 A;  3KMQ A;  3C6T B;  1JLC A;  1HMV B;  2H54 B;  2F4F A;  2CJQ A;  3CC7 S;  4CT8 A;  2OGU A;  3CC2 S;  5C2G A;  4LF2 A;  1IBM J;  1ZS6 A;  1RHK B;  2I5J B;  2D74 B;  3IAM 9;  3OTO J;  2ZHB A;  4ALZ A;  2VBY A;  3LMW A;  1X4B A;  3PJ9 A;  1FRM A;  4NZ6 A;  1VQK S;  5IXU A;  2EBG A;  4LVO P;  3BZQ A;  1RK8 A;  1YRU A;  3B6B A;  3AQO A;  4NAS A;  3EX7 B;  2DNG A;  3D67 A;  2HVD A;  2BEF A;  2V8D A;  3HVT B;  3MM8 B;  4E8U A;  1VQL S;  1JLE A;  1JX4 A;  3FVY A;  4H4K C;  1VC6 A;  4R0E A;  5DQI A;  1JNZ B;  3CD5 A;  4R0J A;  2BJE A;  2GHV C;  1RTI B;  2R4F A;  2VQF J;  3DLL Q;  1DAX A;  2HQC A;  4DV6 J;  2GJF A;  2IVY A;  2HZV A;  2JNJ A;  4NLS A;  3DDN A;  1OJ4 A;  3RB6 A;  1SJ3 P;  3M8Q A;  4DV5 J;  1G2E A;  4YQW A;  4DFJ A;  4LBI A;  5F8G A;  3KLH A;  2QV6 A;  3GRH A;  3MAQ A;  1DBD A;  1RT1 A;  2VKZ G;  3MFH A;  1QUP A;  1S6Q B;  4ID5 A;  4RO0 A;  4A4J A;  3A3O B;  5GMD A;  1AT1 B;  1M5O C;  3ZZO A;  4DS4 A;  3V4I B;  3GG1 A;  1LWE A;  2DGX A;  2JEG A;  3GJT B;  1GH8 A;  4E0D A;  4YEL A;  4B3T J;  1TFY A;  2F8M A;  5L1J A;  1WSV A;  2J8S A;  1D1U A;  4DG1 A;  1A9N B;  3NCR A;  5ETO A;  3ZNU A;  3CCL S;  3ENA A;  1HBM B;  1U1M A;  1FNX H;  4ELV A;  4H4M B;  2ZOM A;  2KXF A;  4NEY A;  2YVS A;  3TWZ A;  1NKC A;  1U8S A;  2HHH J;  4PR6 A;  2HFU A;  1U48 A;  3H59 A;  1HNX F;  3QNW B;  1KKH A;  3W9I A;  1KP6 A;  1N34 J;  3MOJ B;  4YY3 J;  3BBB A;  1VQN S;  3KHG A;  2HRY A;  2OO4 A;  3UI3 A;  4MTP A;  4BWJ A;  2ZH1 A;  2I5J A;  2NXE A;  4X64 J;  2UV8 G;  4YFO A;  1RE1 B;  2G0J A;  3ZTR A;  2F1F A;  3FBB A;  4USH A;  4M5M A;  1IM6 A;  2K1R B;  5KFY A;  2YNH A;  1FE4 A;  3D1H A;  3QGI A;  5HAN A;  3NOG A;  2XM3 A;  1R8C A;  4DR7 J;  1ZM3 A;  1Q16 B;  3Q8Y A;  2NPI A;  3H7H B;  1WI8 A;  3HHK A;  3R9L A;  3OV7 A;  3FFI A;  4J9R A;  2FJV A;  4K8R A;  4OZ1 A;  5F8I A;  2IVM A;  3VMW A;  1RCX B;  4KH3 A;  3PEH A;  5DDQ C;  4CRJ A;  3PIP Q;  1N36 F;  3GV5 B;  2CFX A;  2RT3 A;  3AY0 A;  3LWM A;  4I69 A;  4OHW A;  3VAH A;  5D3G B;  4ZN1 A;  3BO3 A;  2HQG A;  4F26 A;  4DV4 J;  1X9S A;  5D78 A;  1SJR A;  2VOO A;  4RZR A;  1U1P A;  1QLN A;  1S1W B;  2IYI A;  1KWM A;  2CG4 A;  5AMV A;  1TZ0 A;  2FD2 A;  2FHJ D;  2VHG A;  2EFN A;  1R43 A;  3M30 A;  3ISN C;  5KT5 A;  1TL7 A;  1VDH A;  2CYY A;  4PCQ A;  4UOC A;  2BAN A;  1RT5 B;  2UXB F;  1S77 D;  2V67 A;  4NA2 A;  4Q8E A;  3V5R A;  4P6Q A;  3TEH B;  3WC0 A;  5DQG A;  3BDP A;  4FYX B;  2CAJ A;  2JH3 A;  2V8H A;  2AZ3 A;  1DLO B;  1LWF A;  3PO5 A;  2AF6 A;  3DOK B;  4XNF A;  3LP0 B;  4V1A k;  4OI1 A;  2DNM A;  3BRE A;  1NDL A;  1CJK A;  2E29 A;  2Z0G A;  3DDI A;  1LM1 A;  4NLQ A;  2XNQ A;  4P10 A;  4CYU B;  1BGX T;  4C4W A;  2JWN A;  2NUU G;  4YCQ A;  3TJ8 A;  2RKI A;  5JJB A;  3PR5 B;  3RRH A;  2GMH A;  3UD4 P;  2FGC A;  2ZJR Q;  1UL3 A;  1XQI A;  4MKY A;  3GLJ A;  2U1A A;  1FCA A;  2KZM A;  3JAM U;  1WOO A;  3A4T A;  2B5J B;  5HP1 A;  2HBY B;  5JXS A;  5IT9 U;  1TYV A;  1Y5I B;  4CQ1 A;  4DUY F;  3LGH A;  3RG6 A;  4JV5 F;  4OHZ A;  2FZC B;  4OI0 A;  3D1Q A;  4DU8 A;  5L38 A;  1T9U A;  4OYP A;  1YIT S;  5F0U A;  2JOQ A;  3BR9 A;  3C15 B;  5ETS A;  4BCA A;  2L48 A;  3F41 A;  4RU2 A;  4P74 A;  1FRJ A;  3QRR A;  2DGW A;  1Y11 A;  2QN6 B;  1R6V A;  3EMT A;  3I82 A;  4NYZ A;  4DQS A;  4FP9 A;  1YBU A;  1NHV A;  4DU7 A;  4HH0 A;  3VV2 B;  4RW6 A;  1GEH A;  2NYH A;  2OIH A;  4ZIW A;  1ZA2 B;  4OJH A;  1HNW F;  3SCJ E;  4J9S A;  2J0S D;  4LBP A;  2I1R A;  1HQE B;  5CD4 A;  3FUY A;  2W24 A;  2ZH4 A;  3GYX B;  3TZZ A;  5LSO A;  3IMQ J;  1RWW B;  1YG0 A;  1XMO J;  3CD6 S;  2VBK A;  3IFE A;  4MK8 A;  4XOP A;  2NXU A;  1HLW A;  4Y65 A;  2FHO B;  5DDR C;  3FSI A;  2LMI A;  2R8J A;  2DRA A;  1UEV A;  2N4C A;  2E5G A;  3TAM A;  5KFC A;  1M1K T;  4J9M A;  2RU3 A;  1VC5 A;  4I64 A;  3TA0 A;  3AB4 B;  5A6W A;  2KZZ A;  4IOC Q;  3IGV A;  3NS5 A;  2RRB A;  4F3M A;  4LQ9 A;  1S7I A;  3TZX A;  1TAU A;  2CIM A;  3J80 U;  2H9Z A;  2VG5 A;  2FJD B;  3JUR A;  2V5I A;  1UWB B;  1JLB A;  3CJQ A;  4TXS A;  2QSF A;  3L09 A;  1TUW A;  1UVK A;  5IC6 B;  5ETT A;  1HR0 F;  3PEJ A;  3Q2S C;  3W65 A;  5DG8 A;  2VFN A;  2G0C A;  4JI0 F;  4JI3 F;  2PFD A;  4BWM A;  3W2W B;  4KHP F;  2Q1L A;  3OPK A;  1FDD A;  4HHH A;  2K06 A;  4DSK A;  1W2B R;  5K14 B;  4N41 A;  4CH0 S;  1C1C B;  1X4G A;  5LMN J;  4RW7 B;  4USJ C;  4X65 F;  2VPY B;  2WSF C;  2MSS A;  1H74 A;  2MY7 A;  1QAJ A;  4H4M A;  2R9L A;  1FT8 A;  2HNY A;  3TJ9 A;  5K8O A;  1KON A;  2H4W B;  2NZC A;  2B9E A;  3VAI A;  1T9Y A;  4WII A;  1HFE L;  1R6Y A;  2O3D A;  3N0V A;  5ETV A;  3V4M A;  3N01 A;  4C3L A;  1RT4 B;  2GFF A;  2QJ3 A;  3AJ1 A;  2IM2 A;  4AUK A;  5J1E B;  4L73 A;  1J5O B;  2Y1I A;  3BH7 B;  1G7C B;  3FZ2 A;  3SZ2 A;  5I3U A;  1E6V A;  4X4Q A;  4LT6 A;  3ZO7 A;  3DLJ A;  2M5Y A;  5BJR A;  2E1M C;  2GHW A;  2PO4 A;  4DPW A;  1F5B A;  5SZT A;  1N32 F;  4NLG A;  2ZDP A;  2RQ4 A;  2B7C B;  2I9S A;  4GVB A;  3ZNJ 1;  4ZLL A;  4X4T A;  4M63 A;  3ZXW A;  5JUM A;  3FY3 A;  3OD2 A;  4MKV A;  4WK3 A;  2P6T A;  3RGI A;  4ED4 A;  4Q0B A;  3V6K A;  1FXD A;  1HNI A;  2YPY A;  2B0G A;  4P7T A;  4FNI A;  3IM9 A;  4DV2 J;  4DHV A;  2INV A;  5JLV C;  3DM2 A;  3RBE A;  1H72 C;  4OZ5 A;  5A76 A;  2L3M A;  1NB2 A;  3BGL A;  3CJ8 A;  5BYQ A;  2E1A A;  2CPD A;  1UVM A;  5J2M B;  3NKY A;  4CWB A;  3KYL A;  5K5M A;  1FJG J;  1K73 T;  2DNN A;  1JLE B;  4DI6 A;  3IBC B;  1HKA A;  4K4U A;  1UVJ A;  1YK9 A;  5C25 B;  3GQA A;  3MM9 B;  2X1A A;  3PAC A;  4FF3 A;  1TYW A;  3NCQ A;  1UMJ A;  2H48 B;  2QMW A;  2KXN B;  4O3S A;  4GO5 X;  3N6Z A;  3OL9 A;  2HQ3 A;  3GIL A;  2DGS A;  1R8A A;  2KT5 A;  3N9U C;  3CSK A;  3JSM B;  3GQC A;  4O3R A;  1X5S A;  4DL5 A;  5MAO A;  1JLC B;  1HMV A;  2HWT A;  1D0E A;  1Q78 A;  1REV A;  4XLH A;  1TVR B;  3WWG A;  1X5P A;  3DN9 A;  5KFD A;  2BM1 A;  2XBP A;  3ZZR A;  3MM6 A;  4ES1 A;  4TQR A;  3CCW A;  1VQY A;  2ALZ A;  4C8O A;  1R0A A;  4MH8 A;  4JI5 F;  4ZPW R;  4NLX A;  1IKW A;  2GC8 A;  4FVC A;  4CO0 A;  4ED7 A;  2A2D A;  5EWF A;  3QFH A;  3C2P A;  1QTM A;  2DR9 A;  3TJA A;  2XY6 A;  4FYY B;  2P8I A;  3Q23 A;  1K4Z A;  3PFO A;  8AT1 B;  2YWE A;  1O8B A;  2MQP A;  1WKL A;  2WVE A;  1H38 A;  3AQP A;  4W4M A;  1HI1 A;  3DC2 A;  1PYS B;  1WTF A;  1OFM A;  1LEO A;  2LDI A;  2WVB A;  3PRD A;  3W63 A;  4J9K A;  5K9F A;  1N33 F;  2Z30 B;  3ET6 A;  2VFU A;  1NB7 A;  4ECS A;  5J2M A;  3GJQ B;  4YR2 A;  4JI1 J;  4C11 B;  3IO1 A;  2PT0 A;  1KQK A;  5L9X A;  2PA3 A;  4IRD A;  4ILM A;  3K5P A;  4CLW A;  4PUO A;  3MAA B;  1RQ0 A;  1RP5 A;  2YX1 A;  2YY3 A;  5KFS A;  4A48 A;  3GIK A;  4WZM A;  1M0S A;  2DGT A;  3UCG A;  2ZM6 F;  1OYE A;  3NS6 A;  2XTY A;  2JLG A;  1RB0 A;  4OX9 F;  2N82 B;  3GB0 A;  2YNI B;  4MYU A;  3IR7 B;  5A8K A;  1I94 J;  1GAO A;  3NGT A;  4N8O A;  4CO3 A;  2MQQ A;  2DPJ A;  4JI4 J;  2YX7 A;  4NPO A;  1RHM B;  2EFQ A;  2DNP A;  4QWB A;  3W5Z A;  5IV3 A;  3V81 B;  5J2N A;  2L9D A;  3IM8 A;  5J2Q A;  4RW8 B;  1WF0 A;  4DFM A;  4LSZ B;  2FIU A;  4KSE B;  2D3O R;  1QRB A;  4FF4 A;  2GQC A;  3MM6 B;  3MTK A;  4KFB A;  2GGP B;  1V5I B;  3D0G E;  4CLK A;  1FKO A;  1TVR A;  2VD3 A;  3BSA A;  5SUH A;  2CPY A;  4O3N A;  4ECX A;  1SXL A;  4LF5 F;  1BXN A;  1M5H A;  3BGF A;  4QOT A;  1V6H A;  3I32 A;  4NWB A;  4URQ U;  3QGP A;  4WFY A;  3DLE B;  2AEF A;  2DIS A;  2HHQ A;  2GVZ B;  2OD4 A;  4O3P A;  3NG8 A;  2CUY A;  3QLH B;  3RAQ A;  5GAE U;  1Z4U A;  2E5L J;  1K0T A;  1GX6 A;  2JVR A;  2QA1 A;  3O3L A;  2XMU A;  2ZEJ A;  3N79 A;  5GMK a;  5H9E J;  2V9K A;  1B64 A;  1R3N A;  2LP4 A;  1TKZ B;  2DH9 A;  1GQ8 A;  2CA9 A;  2XZW A;  1X4D A;  3NXZ A;  4P2X A;  4U8Y A;  3UVJ B;  4DV6 F;  5H9E K;  4DPU A;  3VST A;  1UWA A;  2Z2M A;  2N4D A;  4OIX A;  3KTQ A;  1WC1 A;  2MPU A;  4IH7 A;  4V02 C;  3EGW B;  2COL A;  3GIM A;  5E3A A;  1YJ7 A;  1RWP B;  1C0T B;  2EW9 A;  5HMZ A;  1SUQ A;  2ZNY A;  1KTW A;  2OJ3 A;  4QU7 A;  5HRO B;  1JLB B;  2B7B B;  4IG0 A;  3IGN A;  2YQ0 A;  2AGQ A;  5H1S V;  4Q43 A;  2VG5 B;  4UW2 A;  1X4A A;  2KT2 A;  4YEJ A;  1VHI A;  2XYP B;  4EW9 A;  4CO2 A;  3BGO P;  4DV3 F;  2ILZ A;  2IRX A;  4A8M P;  1HBN B;  1C2P A;  4DFK A;  4B3T F;  4DV1 J;  2W8K A;  1SCJ B;  1HPZ A;  3EZ5 A;  2PSZ A;  5D0E A;  1SL2 A;  3AOB A;  2UVU A;  4DCJ B;  4IOB A;  2GJ2 A;  5GME A;  4X4P A;  2EG1 A;  3LF0 A;  3WBZ A;  1L3S A;  2PFF B;  3BEG B;  5HBM B;  3KHR A;  1FXR A;  3MF5 A;  3KK2 B;  2HHH F;  3KRG A;  1UAW A;  3CCM S;  3VAK A;  4CI0 B;  3CCT A;  2VBZ A;  1LK7 A;  2XWY A;  1SI9 A;  1RT4 A;  1P9Q C;  1UFL A;  2F3J A;  5LMU J;  2ADB A;  1J5O A;  1XNQ J;  2VFV A;  4RUC A;  2Y1J A;  3JXO A;  1JQG A;  1VQ5 S;  4ED5 A;  3AB2 B;  3MUT P;  4Y2I A;  1VLY A;  3UR0 A;  5DM6 Q;  1R7I A;  3KNA A;  4EZ6 A;  2FJX A;  3SQO P;  2H65 B;  1XC9 A;  1TUV A;  1RT7 A;  1Z2Z A;  5CYJ A;  1E6Y A;  1A0O B;  4K59 A;  1NU4 A;  2LXI A;  4MIB A;  1NRK A;  4PRF A;  3R5J B;  2HK3 A;  4FZV A;  4ES3 A;  3QT5 A;  2C2M B;  3BH6 B;  4DV0 J;  2J6U A;  2PMZ D;  1C1B B;  3HFV A;  1P6T A;  2AHO B;  2CQI A;  5CYM B;  3PIO Q;  2WRM A;  5AE2 A;  3MUR P;  3GMG A;  2AT1 B;  2R2U A;  2R7R A;  2YQ3 A;  1AXQ A;  4DCP B;  4F25 A;  1O8K A;  2JLE A;  3PYD A;  5IQ6 A;  2XQC A;  3OVS A;  1FE0 A;  2VFM A;  1FEH A;  4JBC A;  3FEY B;  2UXD J;  2XMW A;  4S0M A;  4AT1 B;  2OPS A;  1KCC A;  3UN2 A;  4U7C A;  4ZPV R;  4Q44 A;  4AE5 A;  1RU2 A;  2CJK A;  1S1T A;  2RUS A;  2BUN A;  3B82 A;  4TNO A;  1NUE A;  4WXO A;  3PHT A;  2FVP A;  3POT B;  3ILL A;  4LFA F;  4FYD A;  1KQ5 A;  3M1V A;  4LR7 A;  2K3K A;  1O0P A;  3R8Y A;  2MKH A;  3FMW A;  2BKN A;  3V6H A;  1YDL A;  2G13 A;  3UE2 A;  2IM0 A;  4I1T A;  5K20 B;  2VZ9 A;  5T41 A;  3KK2 A;  4DLG A;  3TAN A;  3G2X A;  4A8O A;  1T9T A;  2MZJ A;  3NAH A;  2UVW A;  4BS2 A;  3H40 A;  3CME S;  3G82 B;  1S1X A;  1ZAX A;  3W62 A;  3MHY A;  1ICE B;  1VRQ C;  2OD6 A;  5LL6 d;  3CMQ A;  3A8J A;  1YIJ S;  2QY1 A;  1UJ5 A;  1B0V A;  3KG0 A;  1FX2 A;  2CNL B;  4USW A;  4ZCM A;  4WFN Q;  3J80 Y;  3BQ2 A;  2QYG A;  1N5Y A;  1WNE A;  3B8Y A;  3CW2 C;  1X4H A;  2DR8 A;  3AA9 A;  3K7R A;  3RBX A;  3BPS P;  3I4H X;  1NZ8 A;  1U0H A;  4I7F A;  1QJH A;  4KYZ A;  4J9U E;  4TLR A;  4IG0 B;  3S7R A;  3ZTP A;  2B9X A;  4GVL A;  2W7P A;  3VVU A;  3GII A;  3TA1 A;  3BKT A;  3THP A;  3X1L B;  2V2V A;  3TO8 A;  2R2R A;  2HS0 A;  4MYT A;  4WE1 B;  5HI7 A;  5L1L A;  1RTD A;  4UUW A;  4LUB A;  5HJX A;  3TUI C;  3CDA A;  1OY6 A;  2ZC3 A;  3IRX B;  2CZ9 A;  4YS2 A;  1HNZ F;  3ULH A;  2FVS A;  3I96 A;  3R1H A;  3MD1 A;  2DNQ A;  4DUY J;  3OR2 A;  4JV5 J;  1S9F A;  4FDF A;  1Y10 A;  3JQJ A;  2RQC A;  3T1Y J;  4IR1 A;  3ILI A;  2DEI A;  3O5T B;  3KK1 B;  2LEC A;  2BAB A;  3TQ1 A;  4JUZ A;  1RTZ A;  2CQ3 A;  1W7W A;  2CQB A;  2WCX A;  1Q7L B;  4H4O B;  2W2O P;  4IDK A;  1TAQ A;  4ED6 A;  2ZZN A;  1RTJ A;  1CUL A;  2Q3P A;  3H8Y A;  2C3P A;  2PN6 A;  3DLE A;  3GU0 A;  4UZC A;  3OLB A;  4ECQ A;  1XMQ F;  3RR8 A;  3J7A 1;  2CG8 A;  2FLN A;  3M4X A;  3FRZ A;  1Y3J A;  3W5X A;  5D4N A;  1S9G B;  1UJ6 A;  2P6S A;  3KUG A;  4F3O A;  3EUN A;  4FBT A;  2BJ1 A;  4NCA A;  3FEZ A;  4I84 A;  4MKA A;  2MJU A;  3G9C A;  3C16 B;  2F4V J;  1H7W A;  2HHX A;  5E3C A;  1URN A;  4I2P B;  5LM7 E;  3UO0 A;  4LRF A;  1FNM A;  1L1I A;  2QX3 A;  1OS5 A;  2H5E A;  5FD1 A;  3TX0 A;  2BKP A;  2R7O A;  3MPY A;  4L3K A;  2YKQ A;  3BV8 A;  4P9S A;  3T9Z A;  3CMA S;  2RDJ A;  2EG2 A;  3EQN A;  2AEM A;  2KT3 A;  2NUH A;  1TKX B;  3ILO A;  2H51 B;  2QRR A;  4AFF A;  5CA5 A;  5DGB A;  5AT1 B;  2M8H A;  4ER8 A;  3PX4 A;  2RNE A;  1RAH B;  2UV8 A;  4YR0 A;  2ZHO A;  4ED8 A;  4OZN A;  3M2V A;  3J7Y I;  4H54 A;  3IWX A;  1GMW D;  4NI2 B;  3R5G A;  1JXV A;  5ETR A;  4WCE Q;  4X4R A;  3SV3 A;  2J9C A;  1S10 A;  4JRA C;  4J9O A;  2ZHA A;  3H20 A;  2VG7 B;  4LSL B;  2QGF B;  1IB4 A;  4PXB A;  3OTD A;  3KLF B;  3OW2 R;  1T3N A;  2IY5 B;  3DU6 A;  3M7V A;  4OJL A;  4TYA A;  3U7J A;  1VBL A;  5KT4 A;  3R5B A;  3T5K A;  3UCZ P;  2R7W A;  2J9E A;  2XUL A;  3RB3 A;  4F0M A;  1UCN A;  3DHW C;  1S79 A;  3UFC X;  4C2L A;  3VAG A;  4J9P A;  2BM7 A;  3W2V A;  4F04 B;  1IKY B;  3EVW A;  2DR7 A;  5HAO A;  2UU9 F;  3W9J A;  2VIH A;  2GHP A;  3EJM A;  3P6Y C;  4OX8 A;  1CC8 A;  1LWC A;  4I56 A;  1E6V B;  2WB4 A;  3HKW A;  4KBI A;  4L6V 3;  4AD6 A;  5J2P B;  4OI6 A;  4PQU A;  1BC6 A;  4YB7 A;  2DHS A;  3HF5 A;  1F0X A;  1ZPW X;  2ROG A;  1O8G A;  4UQT A;  4XIU A;  4Y2C A;  1X4E A;  4OLP A;  1VIO A;  3GIR A;  5HLF A;  2VQE F;  1B99 A;  3M8P A;  3HMJ G;  2BRL A;  3Q8P B;  3K8V A;  4HWV A;  1S12 A;  1XMB A;  2Z2Y B;  3MM8 A;  4DUZ J;  1NM2 A;  2NXC A;  3TZY A;  1HW9 A;  3HHL A;  1F2H A;  1T9X A;  3TVY A;  4WTY A;  5M2U A;  1BQX A;  1LNQ A;  3W2W A;  2FVR A;  3K59 A;  5KOW A;  4U49 A;  4RNM A;  3M8P B;  3N6L A;  2V8V A;  1TMM A;  4LFC F;  4C9D A;  2HHW A;  4ELT A;  1PAE X;  3RRG A;  3HZG A;  3C6T A;  4BDP A;  3D28 A;  2ZH3 A;  3E8O A;  1RZM A;  3L95 X;  1S0N A;  1P9Y A;  1B7Y B;  2LA6 A;  1S0M A;  3JTO A;  1MSW D;  2F65 A;  3SQG B;  4MKB A;  2BJD A;  3DHX A;  3Q24 A;  4BLG A;  1KTV A;  3VAL A;  1JIH A;  2XTX A;  4ZVS B;  2O0V A;  1UPP A;  1WG4 A;  2YWW A;  2BM5 A;  2YNG A;  3BDE A;  1HWJ A;  4G1Q B;  4GVB B;  4RBU A;  4UUX A;  3ZZ0 A;  4EMD A;  1QVF R;  4DR5 F;  2VJJ A;  2AEJ A;  2DXE A;  4CO4 A;  4DX5 A;  2ROE A;  1QSY A;  1I3O B;  2ZWP A;  3MEK A;  3MD3 A;  4C8M A;  3EGV A;  9RUB A;  2A1B A;  3SYZ A;  2WW8 A;  5T7L A;  4FKY A;  4C98 A;  3C14 A;  3MEC B;  2OPP B;  5A8W A;  5LXR A;  4NXM F;  4NI2 A;  2EFG A;  3BKU A;  4HDH A;  2ZH8 A;  4LF9 J;  1F9F A;  2F9D A;  3N6N A;  2ZOG A;  2E7W A;  3M2V B;  4EEY A;  2X6W A;  1RTH B;  4MIA A;  2HFO A;  3VQS A;  3AAW B;  5GAH I;  1LXJ A;  2HNZ B;  1HNV A;  2MMY A;  4HH1 A;  2W01 A;  2C1E B;  5KFA A;  1WOR A;  3GFZ A;  4RJV A;  4CT9 A;  2VIC A;  2CPJ A;  4QPX A;  2NZ4 A;  3QT7 A;  1UPM B;  5B0D A;  4KRW A;  2ADC A;  1G1X A;  2R8I A;  3DGP B;  3WDO A;  1W2I A;  4DR6 J;  1QE1 B;  3MTJ A;  3QIP B;  2ATL A;  2SXL A;  1T9W A;  2HGL A;  2KXH A;  3DRX A;  4DUZ F;  1GXL A;  2MKJ A;  1O5J A;  2MHE A;  5ITH A;  1F2G A;  3MEE B;  1TL5 A;  4HT7 A;  1HHT P;  1RWM B;  2UUC J;  4O4G A;  3RB0 A;  1FJC A;  1S9G A;  2BMB A;  3PO4 A;  3MEG A;  4ZLP A;  1U8W A;  1H0H B;  3OFG A;  1WF2 A;  3IS9 A;  3O2I A;  5DRK A;  4ZPT R;  1KS2 A;  2DB1 A;  3MMC B;  2R8H A;  4K0K F;  4MR0 A;  1DAR A;  5THW A;  1N33 J;  2INU A;  2B56 A;  4PEO A;  5A8R B;  2JVO A;  4JI1 F;  3T5J A;  1U1O A;  2KTQ A;  4UQG A;  2QEX S;  1WXR A;  1LOU A;  3KLF A;  4NK6 A;  4KGX B;  1QSS A;  1EIY B;  1UTA A;  3KOA A;  1CS4 A;  3MPD A;  2RKI B;  2JEI A;  1IM4 A;  2DHH A;  3M05 A;  4JYA F;  4QZV B;  3L3C A;  2FJW A;  4ED1 A;  1JNR B;  3R97 A;  4EBD A;  3U27 A;  2LEP A;  2FHJ A;  5HQM A;  3KK3 A;  1WC5 A;  2JFK A;  1DRZ A;  1MRO A;  2DNR A;  4NLY A;  3K57 A;  2KFY A;  3CTR A;  3CCU S;  4ECV A;  4DL6 A;  1VJW A;  4DR2 F;  3VMV A;  2DNO A;  2RJZ A;  3HCX A;  4O23 A;  1YQH A;  4WXW A;  3P8B B;  2O17 A;  4UST A;  3H0P A;  1IBM F;  3W8G A;  4KO0 A;  4DJB A;  1FX4 A;  3LP2 A;  5HMX A;  4OJ1 A;  1HL6 A;  2LQ9 A;  5HN0 A;  3H2U B;  1SQG A;  3IP0 A;  1S6O A;  1MU2 A;  2C2O B;  1PXZ A;  5F8L A;  1YJV A;  4UT4 A;  2C2R A;  4PAB A;  3SSQ A;  2MB0 B;  3GG0 A;  2VJV A;  2ODL A;  1I1G A;  1RKJ A;  1VQO S;  1CG2 A;  1I5O B;  1VQ6 S;  1CPZ A;  2IA0 A;  3PW0 A;  2VQF F;  1WC3 A;  5KFG A;  1RAD B;  1J27 A;  4DL0 C;  2RD5 C;  2M4M A;  1LW2 A;  1Q4R A;  3FK4 A;  1NSA A;  2MGZ A;  3ZC4 A;  2XMJ A;  5D4L A;  3VHQ A;  1ZH5 A;  4QBU A;  1FRX A;  3BO4 A;  5IC4 B;  5CCM A;  1FVQ A;  4NE9 C;  4PQA A;  3ZZU A;  2DCL A;  3MCS A;  2DH8 A;  4NZ7 A;  1MMD A;  4C6A A;  2FGO A;  4DV5 F;  5A0Y B;  2CPE A;  3GSD A;  3QQC D;  4MJK A;  4EO8 A;  1L3V A;  4M5H A;  4ZPA A;  4DN0 A;  3Q8V A;  3VGT A;  1O8H A;  2YNH B;  3EE3 A;  4YP3 A;  4XN3 A;  2AKW B;  4IFY B;  2X7I A;  1EZG A;  2MKC A;  2CQG A;  3HFZ B;  4DV3 J;  1EA0 A;  5KFZ A;  3HK2 A;  3OXG A;  3DGP A;  4DV1 F;  1X7V A;  1FO1 A;  3O44 A;  5EX0 A;  4DUT A;  5KFF A;  3HM9 A;  1B3T A;  1KCD A;  1YJN S;  2EVZ A;  3I4P A;  5ETK A;  3SEO A;  3MXH P;  1H73 A;  2KFN A;  1PJ5 A;  3C6U A;  3GJR B;  2DVI A;  4IUF A;  4XPE A;  3E2E A;  2BX6 A;  1URR A;  4URS A;  5D8H B;  4U4B A;  2LXF A;  4RUA A;  3CXC R;  3J7Y U;  1KC8 T;  3OUY A;  1WEZ A;  1RT3 B;  2AJ4 A;  4URR A;  2B3T B;  2QC3 A;  3FKB A;  4FPI A;  2CQC A;  5BR8 J;  1S1X B;  5CH7 B;  5K8N A;  3RR7 A;  1HNX J;  4MIW A;  3MDF A;  1VBX A;  3RTV A;  3DU1 X;  2MHN A;  4TKT A;  3ZZZ A;  1VJQ A;  2ZKU A;  4XON A;  3ENV A;  2EEY A;  4U7U D;  4P2M A;  3QWP A;  2AU0 A;  2BQR A;  3KLE A;  4X64 F;  5D3G A;  2NCK L;  5IT9 Y;  3HSG A;  3D3C J;  1TYX A;  3E51 A;  4PKD B;  1FRL A;  3T9G A;  4JI6 F;  4DR7 F;  1HW8 A;  1Q5Y A;  1RT2 B;  3W66 A;  4DV0 F;  2B8Q A;  2OMO A;  1U2R A;  2R42 A;  1Q81 T;  4IQM A;  1OY8 A;  4ZVT B;  5HMY A;  4GKJ J;  4X4U A;  2WVD A;  1VRU B;  3B90 A;  2GIR A;  4OPW A;  2APO A;  2HG4 A;  2E5J A;  1F3F A;  1SV5 B;  1Q8I A;  3BR8 A;  3S1T A;  3PYF A;  3M8Y A;  3GPA A;  3TNV A;  5AXM A;  4GC7 A;  3K89 A;  1HYS B;  2VB6 A;  1S72 S;  4DCO B;  2LEA A;  3CCV S;  2CPX A;  2J7W A;  1SH2 A;  1UFW A;  3CCS S;  4XDD A;  4E98 A;  4JI7 J;  1LXN A;  2EK6 A;  4XK8 C;  1DZ5 A;  3D0I E;  3OFE A;  1JWW A;  1N56 A;  1PE9 A;  4HVZ A;  4F4A A;  2ZH2 A;  3OTC A;  2YWF A;  2D7S A;  3DLG A;  1B70 B;  4HLB A;  3IRW P;  4AL5 A;  3HSZ A;  4GC6 A;  1IBL F;  1FFW B;  3BQ1 A;  5MLC V;  3KJN B;  4DG1 B;  1DY3 A;  4IOA Q;  2V2Z A;  3HJF A;  3D6T B;  3JS9 A;  5BYS A;  3BSN A;  2O04 A;  2ZH5 A;  4DR4 F;  4WJB A;  4RW4 A;  1ITP A;  2HAF A;  4KGM A;  4Y2A A;  4PXD A;  1VFJ A;  4WP8 A;  5CD4 H;  1AYE A;  1IKY A;  7AT1 B;  2DNY A;  2JX2 A;  2XMV A;  4EI2 A;  3ZTS A;  1PCA A;  4M5J A;  1BN8 A;  1HHS A;  2H4Y B;  4ZLJ A;  3JYT B;  3TAQ A;  2ZJQ Q;  3VAF A;  2C3M A;  3I0S A;  4YDT A;  3MPV A;  2ERR A;  4C8K A;  4CZC A;  3RYL A;  2JEJ A;  2M9K A;  2MQL A;  4OL8 A;  4U6P A;  1FD2 A;  2G2Z A;  1N52 B;  4ZVE A;  2PD1 A;  3Q8S B;  4GRS A;  1FEE A;  3GYG A;  4B3M J;  1M5K C;  2MTL A;  2VFR A;  4PXE A;  4RLE A;  5DDP C;  3QBC A;  2DIT A;  1WEY A;  3R6G B;  4N47 A;  2ZZM A;  5GAE I;  3ET6 B;  2HEK A;  4YDD B;  2QTW A;  1Y7P A;  2A6O A;  2ZUG A;  3SDE B;  3UVJ A;  2ZJP Q;  3UW1 A;  1M5V C;  3H2V E;  2I0X A;  2PMH A;  4FYW B;  1KBR A;  2QLJ B;  1H6K X;  3PRV A;  2ZKT A;  2WAQ D;  3MR6 A;  3Q0A A;  5FJ4 A;  1ZZN A;  4PWW A;  4K4Z A;  2LFV A;  2NZM A;  3ML3 A;  1FTR A;  2C2N A;  1REG X;  4W8S A;  3QGG A;  2BE2 A;  3EZO A;  4FKX A;  5F41 A;  4BC9 A;  4CTA A;  4ENO A;  4P75 A;  3EYZ A;  1X9W A;  3W5Y A;  5DG9 A;  5LT5 A;  1SJ4 P;  1NHC A;  3LPY A;  3U1L A;  4F8R A;  5HAT A;  1S7H A;  1IKX B;  2VG6 B;  1K8A T;  1RKI A;  3PSS A;  2AJ0 A;  1HA1 A;  5J2N B;  2G0Y A;  1FD8 A;  4LFB F;  2EWH A;  1GXU A;  2HLT A;  2VU5 A;  2KO1 A;  4ZJL A;  5CQG A;  3MPU B;  2QLB B;  3IR5 B;  4FF1 A;  2IJF A;  2KB2 A;  1XMO F;  1N48 A;  2ACM A;  1OOC A;  2HSE B;  1Q5V A;  4M5N A;  2LU1 A;  2MLZ A;  4M5I A;  1X31 C;  2W8L A;  4TU8 A;  4NYP A;  5KFE A;  4B17 A;  2XI3 A;  3UDV A;  4LSN A;  4NLU A;  4CO1 A;  1WJ9 A;  3M6V A;  5RUB A;  4PUO B;  4ZCI A;  3OR1 B;  2W4D A;  3PX0 A;  3QSI A;  2KYX A;  2OSQ A;  1C0U A;  1NSK L;  1RXO B;  2K7K A;  5HK4 A;  4U7U K;  4DDF A;  1KNZ A;  2FC9 A;  1UJ4 A;  3UWT A;  2HQD A;  1IDK A;  4KGK A;  2A2C A;  6FD1 A;  1QJV A;  1OQ6 A;  3I9Z A;  5GAH U;  1Q8L A;  2IIH A;  2UU9 J;  5FLX Y;  5F9N A;  4DL4 A;  3NMR A;  1KVI A;  1N5Y B;  4G1P A;  1SC1 B;  1HR0 J;  3GR0 A;  1BQM A;  4U67 Q;  4ILL A;  2F7V A;  3FSY A;  2QZ8 A;  3CJ4 A;  4NZ0 A;  3QZ7 A;  4LF7 J;  1HF2 A;  4XO0 A;  4OYW A;  3U02 A;  3QRQ A;  4X84 A;  3W60 A;  4YB6 A;  2XYG B;  4NLP A;  3R5D A;  3AHP A;  4NML A;  5B7W A;  4EUV A;  4B3R F;  4QIG A;  4EFA C;  1ZZF A;  1PC4 A;  1HWL A;  4LF6 J;  3Q22 A;  1SKU B;  1QAY A;  4ZVR B;  1ZBT A;  2IRU A;  2J7K A;  2V34 A;  4MK9 A;  1W26 A;  4M1K A;  3M1V B;  1HBU B;  2DKO B;  3QJJ A;  3GSI A;  1RWN B;  4LFC J;  1RHQ B;  1R0B G;  1VGY A;  2J9D E;  1O8E A;  1C1C A;  5IS2 A;  3FCH A;  4QWC A;  3QT8 A;  1IR2 A;  1N32 J;  2KFZ A;  3D6H B;  2KG1 A;  1D8Y A;  1IQT A;  4BBY A;  1JXL A;  3G8Q A;  3CD0 A;  5IWA J;  4UTG A;  1KOO A;  3CCQ S;  2V9W A;  2OEM A;  1IXK A;  5DM7 Q;  1RAA B;  2VFT A;  2YKN A;  1TL3 B;  3MUM P;  1OPI A;  2XG8 A;  2JJ4 D;  1K1S A;  1T11 A;  4R8U B;  2BOP A;  1OWX A;  2HKE A;  3I31 A;  1SV5 A;  5B0A A;  2ASD A;  1AW0 A;  5DLG A;  4KH1 B;  4DR5 J;  1Y5N B;  2XY7 A;  1U0H B;  4I7F B;  1NJZ A;  1A7G E;  2QT7 A;  1CVJ A;  5DJB A;  3W61 A;  3SFG A;  4USK A;  1H3D A;  2VPW B;  3LA0 A;  3DOL B;  3JB9 k;  2MKS A;  3I0S B;  5KG6 A;  3SBM A;  3LPE A;  3MOZ A;  3KUE A;  4QIW D;  5LMN F;  4YZA A;  3JYT A;  1VQ7 S;  1XNR J;  3DRS A;  3UD3 P;  1UZH A;  2F5G A;  4LF9 F;  4DV7 F;  1OFE A;  1NK5 A;  2YKP A;  5KFB A;  5E41 A;  4QW9 A;  1N8R T;  4JOU A;  2D1C A;  4ATN A;  4C3K A;  2CZ4 A;  2Z2L A;  5HL7 Q;  1U45 A;  3RW6 A;  2CQH A;  2R7X A;  4K4Y A;  1S5Z A;  2AYE A;  1BLU A;  5LXY A;  4FYV B;  3THV A;  2XO7 A;  2B9Y A;  2FQQ B;  2IC3 B;  3NS7 B;  4C2M A;  3AT1 B;  2AYM A;  3AK5 A;  3POT A;  4KPY A;  3QJL A;  2JLF A;  4K2J A;  3DLG B;  4Z7Y A;  2XMA A;  3DRP B;  1VQS A;  2QYU A;  2HGN A;  4LIW A;  2W25 A;  4QIE A;  3ENQ A;  4ERD A;  2HPU A;  1KVJ A;  4R25 A;  2RVJ A;  3DLK A;  3B8H A;  1KQF B;  3GON A;  3T3F A;  1TL3 A;  2FPH X;  2QMX A;  2AV5 A;  4UF4 A;  2CJB A;  1SH3 A;  4ID8 A;  4QIF A;  3A12 A;  5E5N A;  1HYS A;  2CDR B;  2XI2 A;  3DLK B;  4C0O C;  3UDL A;  1CEZ A;  2IHR 1;  2VJI A;  4NA3 A;  1WD6 A;  4I67 A;  1DQ9 A;  2BQU A;  2UZA A;  2J0X A;  4DPY A;  2XLK A;  1IWA A;  3EXC X;  1S97 A;  2HVI A;  1FFG B;  2VL1 A;  4H4K A;  2P9G A;  3LOU A;  2KJV A;  2MJN A;  1NCL A;  3UN3 A;  2ACY A;  1SQF A;  3EDQ B;  1IJE B;  1KQS R;  4NXN J;  2VOD A;  1WDT A;  1NO8 A;  2E5I A;  3QAT A;  2PEH A;  3TAM B;  6FDR A;  2Y0B B;  3G8T A;  2MXY A;  1FKO B;  2ASY A;  5ETL A;  2CRL A;  5KG7 A;  2ZM6 J;  1DQA A;  2ZNZ A;  2E9Z A;  3SXL A;  3LH2 S;  2GNK A;  2V6A A;  4XKV A;  1SC3 B;  3VGU A;  1H80 A;  2J5A A;  3WX4 A;  4WFB Q;  1I94 F;  3PKM A;  2PMW A;  5M2R A;  4ZIV A;  4OYA A;  1YKW A;  4HTJ A;  2J8I A;  5GAD I;  2R8K A;  4QPT A;  1CC7 A;  3L9Z A;  2AW0 A;  2PGC A;  4PWD B;  1PG5 B;  4OLO A;  2V4R A;  2RS2 A;  1LLW A;  1KLM B;  1WWH A;  3VTI A;  5GAG I;  2UUB F;  4DR6 F;  4L72 B;  1RAC B;  4OYI A;  2XT2 A;  3IA0 A;  4ZDN A;  4PXC A;  5J1P A;  5AXN A;  1AUD A;  3J7A N;  1GMW A;  3H25 A;  4F02 A;  2O0W A;  2X3D A;  1EX8 A;  1DUR A;  3ITH A;  2I8E A;  2NSP A;  3EVO A;  1IR0 A;  3HD2 A;  1O8I A;  4XR6 A;  1FKP B;  1GTE A;  2BV3 A;  4LRA A;  2EC2 A;  1XR6 A;  4CH7 A;  4YN3 B;  3MED A;  3H5X A;  1RAO A;  1Y3K A;  3SIP B;  3PW7 A;  3RUB L;  3M32 B;  4WFX A;  2GQQ A;  1Q95 G;  2QX0 A;  4YFU A;  1JLA B;  2HFZ A;  4PG5 A;  3HKZ D;  2LQJ A;  3Q8Q B;  4RUH A;  4UOF A;  2JRS A;  4JI2 J;  2CVI A;  3D0H E;  4G65 A;  4MXN A;  4YR3 A;  3NCP A;  4LF1 A;  4NK8 A;  2HS3 A;  4OYM A;  4LMZ A;  3MM5 B;  3QLH A;  4YHH J;  1QDU B;  4DPX A;  2E5H A;  4J9V A;  5KG2 A;  2DO4 A;  4D3G A;  1IQZ A;  2CQ4 A;  3TZW A;  2RML A;  5KFM A;  3DNC A;  1LW2 B;  4N76 A;  3FFI B;  2BW2 A;  1PSD A;  5CAA A;  3AA8 A;  3VF0 B;  3D5M A;  2MLY A;  3WC2 A;  2V4J B;  3LAM A;  1UA1 A;  1WEX A;  3NAW A;  4EU0 A;  1H2U X;  2AP6 A;  2HQI A;  1JLF A;  4OJG A;  4USI A;  3GIJ A;  1R0C B;  3IBW A;  2MLX A;  1RWV B;  4PG8 A;  1ROF A;  2XLI A;  1RLC L;  1APS A;  4WTO B;  5C42 B;  3G4S S;  3HVR A;  1ZM9 A;  3O6Q A;  5C1E A;  3PJW A;  5BR8 F;  1BHN A;  1DLO A;  4TQS A;  3HHN B;  1B0T A;  1DHM A;  2EWE A;  2ZBC A;  4XMY A;  3AXM A;  3DRY A;  2FZG B;  5FII A;  5LMU F;  1M90 T;  2XS7 A;  2Q6B A;  3GZ7 A;  2GX8 A;  3T5H A;  3QT6 A;  2DHX A;  5IT0 A;  1GX5 A;  4MAK A;  3C14 B;  3MEC A;  4J5O A;  3R27 A;  2HHU A;  4N8N A;  4FN5 A;  1SIZ A;  2XEX A;  3CO0 P;  3DMJ B;  3I5B A;  1T94 A;  4NL5 A;  4ZCK A;  1CS4 B;  1BQN A;  3PR4 A;  5U47 A;  3V4I A;  4HI2 A;  4PWU A;  4GKJ F;  3OL7 A;  2KH9 A;  1NDC A;  3CJR A;  5C2C A;  1RAI B;  1XN9 A;  1T03 B;  1JKH B;  5DG7 A;  4G1Q A;  1IA5 A;  3PTW A;  4TVA B;  1JMT A;  4ECW A;  1CQN A;  4A46 A;  1NK8 A;  1KFS A;  3VZI A;  2VC0 A;  2V2K A;  1FDN A;  2N3O A;  4O4G B;  1DJ0 A;  3M6X A;  3H09 A;  2DGO A;  4RW4 B;  4HDG A;  3V6D B;  3T6B A;  1RTI A;  4FXW A;  3LYC A;  1WOS A;  3EIC A;  2YTC A;  4YC5 A;  4LFA J;  1V3Z A;  2F63 A;  2J6S A;  2OPR B;  4OX7 A;  1HQU B;  3NGR A;  5KFI A;  2XMM A;  1LW0 A;  2NT9 A;  1U0S A;  2HNY B;  1TK5 A;  1IBL J;  1MW7 A;  1RWU A;  3SQV A;  4NLV A;  1XK8 A;  4U96 A;  4ZMM A;  3RBD A;  1FDB A;  2O1D A;  1R8B A;  4LJM A;  2YNF B;  3KWM A;  5KFJ A;  4FVM A;  1XR5 A;  2HNZ A;  3HT3 A;  4QYZ K;  2CQP A;  2WOM B;  3MUV P;  1U1L A;  2B9W A;  1X8D A;  1N54 B;  3GP9 A;  1HBM A;  4HYK A;  2LA4 A;  2YX4 A;  2ZD1 B;  4TU7 A;  1FRH A;  3PW2 A;  3SI8 A;  2OFG X;  4I2Q B;  3SSR A;  3FBE A;  4DR3 J;  3CT9 A;  3G87 A;  2U2F A;  2ZFH A;  3RW7 A;  4NOH A;  2X85 A;  1SIW B;  1NPK A;  3C46 A;  4Q0B B;  1TR0 A;  3PNI A;  4NLT A;  3ADA C;  4URG A;  2F8H A;  1RT2 A;  4NLR A;  3H5U A;  3A8E A;  3CNQ P;  1JTA A;  4OZY A;  1RT1 B;  3DFE A;  2M7S A;  4N77 A;  4PPZ A;  4Y28 C;  3US5 A;  5LJ5 Y;  1WTB A;  3CUL A;  3VVT A;  2VAS A;  1X5T A;  1HNZ J;  3VAM A;  5B0E A;  2D3U A;  1KHV A;  2FZK B;  3QAU A;  1OFL A;  4QJV A;  4A8Y A;  4YZ0 A;  3R5A A;  3T1Y F;  1N6Q A;  5C5J A;  2VFP A;  1YBA A;  3B4D A;  1U25 A;  1PBA A;  2KDO A;  2HHS A;  5KT2 A;  2IFX A;  5J1E A;  1Q8B A;  1PYO B;  1YJR A;  2BXJ A;  1FRI A;  1NLK L;  2DBB A;  4NLO A;  5IM0 A;  5KT3 A;  1XMQ J;  2R3V A;  2VBW A;  1FI4 A;  2IQ7 A;  4OYZ A;  1VQ4 S;  1OSD A;  4RBV A;  3ENW A;  4RW6 B;  5I3P A;  5K8P A;  3KLE B;  4W92 B;  1LFP A;  1X0F A;  1UVL A;  1MG7 A;  2LXU A;  4WBF A;  4O0I A;  3ZFV A;  4QWD A;  3CDE A;  3ELH A;  5AE1 A;  1TFW A;  2P9C A;  3CE8 A;  1RBL A;  5KFW A;  3R3T A;  2AJ1 A;  1UKU A;  1U6F A;  5EWE A;  1LW0 B;  3TQE A;  2BKO A;  3NAI A;  2I6W A;  3MAH A;  4B9U A;  5HLF B;  4MK7 A;  2RDD A;  4RPF A;  3VWS A;  1VYA A;  2V4J A;  2J8K A;  3CC4 S;  3HO1 A;  4DL3 A;  3FMB A;  1RCO B;  1Q0N A;  2L9N A;  3CGI A;  1M5P C;  1VC0 A;  4ZP8 A;  1U1K A;  3RJM B;  1S6U A;  5B0C A;  2VJU A;  2E9R X;  3K8W A;  2JC0 A;  2HIY A;  2LQB A;  1GK8 A;  4WFZ A;  5B0F A;  1PJ6 A;  5B08 A;  4QR1 A;  5JMN A;  4DL2 A;  1U26 A;  3GFX A;  1JJH A;  2G2Y A;  4Z7C A;  5D4P A;  2VFQ A;  1IUJ A;  5CYQ B;  4CLZ A;  1KTQ A;  4WKR A;  3VR1 A;  1FXL A;  2CQD A;  2O6W A;  2VKR A;  1BY9 A;  3DMJ A;  3BGU A;  3L7U A;  4JP8 A;  5HVG A;  4FBU A;  1JLA A;  1NDK A;  1S0V A;  5L1I A;  2J0W A;  3CCE S;  3CED A;  2UXC F;  4LF7 F;  3LP0 A;  1FF2 A;  2IM1 A;  2VV5 A;  2Y3Y A;  3AD7 C;  3FGV A;  5IZH A;  2F40 A;  1WHX A;  3C6U B;  3QGH A;  3RAM A;  4M5L A;  5E0O A;  2QFI A;  4WU3 A;  3PHE A;  3K0J A;  2J9D A;  4B3R J;  2WBM A;  1IJF B;  4C0B A;  4KAI A;  4OX6 A;  5KG5 A;  3KMS A;  2VQE J;  3QPI A;  4Y6I A;  1VK8 A;  1S4F A;  2Q43 A;  3LGM A;  4LF6 F;  1CJU A;  3LUY A;  2PA8 D;  3MGJ A;  5HSP A;  3R2D J;  3PM9 A;  4RX6 A;  4LIR A;  1ZAV A;  3D3B J;  4ZVF A;  2YQ1 A;  1K9M T;  1N88 A;  2BM4 A;  3I9V 9;  1RBO B;  5D6G A;  2Z57 B;  2HVE A;  4I6A A;  1TL4 A;  3QWU A;  4ETX A;  2WK4 A;  3A8I A;  3AJ2 A;  5A0Y A;  4DQR A;  3SV4 A;  4J91 A;  5KOX A;  5T14 A;  2B5J A;  2C28 A;  5IWA F;  2AYB A;  2EBE A;  4UOG A;  2I2Y A;  4RKU C;  4IDK B;  4WK1 A;  5DLF A;  1S1T B;  1T9V A;  3IS9 B;  2ATC B;  2FHK A;  3CWJ A;  3K5N A;  1JJ2 R;  5KFR A;  2R7V A;  4IG3 A;  1R89 A;  2O01 C;  2UUW A;  4OZ0 A;  2R8G A;  3ZTQ A;  3MWB A;  3CCJ S;  4DF4 A;  1L3T A;  3QYY A;  4P73 A;  4KGV B;  5HJY A;  1UET A;  1U2C A;  4CYU A;  2M8D B;  3M2U A;  4ZP9 A;  3M32 A;  1RHR B;  5EGY A;  4KV8 B;  4WFA Q;  3KUH A;  4OZL A;  3KG1 A;  4J90 A;  1Z2L A;  2LVW A;  3IXQ A;  1JJ4 A;  4NCG B;  1RT6 A;  1FK9 B;  2WTF A;  3FBF A;  4CM2 A;  1V3R A;  3DKD A;  2QL9 B;  4DV7 J;  2BE7 D;  4DQP A;  2OTL S;  3DGV A;  3OXF A;  4O4R A;  2HBR B;  4NXM J;  2W2Q P;  3NP5 A;  1TL1 A;  1WC0 A;  1U6Z A;  2E66 A;  3DCA A;  4XKW A;  1XJW B;  4U95 A;  1TK8 A;  4DSI A;  2RIL A;  3CDB A;  2H5J B;  3FBC A;  5IM0 B;  2XGQ A;  4OYO A;  1U09 A;  1CJT B;  3R7B B;  3M30 B;  3MR3 A;  3KHL A;  2WVF A;  1KDN A;  3PYE A;  3J81 j;  2E44 A;  4KKO B;  1HWU A;  4N7T A;  5KG3 A;  4DQQ A;  3ISN D;  1LV5 A;  3C3L A;  2E1P A;  3G86 A;  3KLI B;  4B9V A;  3NNH A;  1PIE A;  1XWL A;  5CYQ A;  3UDE A;  2XC9 A;  3D2W A;  3EPG A;  1HAR A;  2NT6 A;  2AD9 A;  2GV1 A;  2W9C B;  4M5G A;  2BYC A;  2H1Y A;  2HRT A;  2MZ1 A;  2X6Y A;  2AGP A;  1S9E B;  3UCU P;  4I0W A;  1HIY A;  1F5A A;  4DFP A;  4J9L A;  2GQ2 A;  1O51 A;  2CZV C;  2P9E A;  4K4X A;  2OPS B;  5C1C A;  2UUC F;  1NSQ A;  3NL0 A;  4KGZ B;  4DSL A;  4EYH B;  1N36 J;  3HVA A;  3BYP A;  3UDC A;  4XLC A;  1YX2 A;  4ZJO A;  4A8Q A;  1NK0 A;  3CJK A;  4M5D B;  1YJT A;  3M8S A;  2UVV A;  1RWX B;  2M52 A;  2V94 A;  2V63 A;  3TUP A;  1C0T A;  5KFO A;  1O88 A;  4JI2 F;  1T02 A;  1EP4 B;  1N5V A;  1S6P A;  4LBH A;  5IOL A;  4Q8F A;  2BW7 A;  1WAC A;  4NEZ A;  3UNY A;  4G1I A;  5D4O A;  4DR1 F;  4EZ9 A;  2AX1 A;  3OHB A;  4C7Q A;  2N7C A;  1ZTW A;  4NXN F;  1HHQ A;  1BD6 A;  2D9O A;  4F3Q A;  4ICL A;  1QSL A;  2G1D A;  2CDQ A;  4K2X A;  3VGV A;  3CJS A;  5FLX U;  1KRP A;  3HJV A;  1MWY A;  2A10 A;  2AJ2 A;  3H98 A;  4F50 A;  3FDS A;  2HHP A;  4ZS6 A;  4X62 J;  4RU9 A;  2OPP A;  5A8W B;  3X3U A;  4DR2 J;  1T3O A;  4CLF A;  1ZM4 A;  3G6X A;  4P52 A;  4GKK F;  4DZ6 A;  3HD1 A;  5LSL A;  2UUB J;  1S59 A;  4KFB B;  1WKJ A;  2X3G A;  1WMR A;  3HZE A;  1RJJ A;  2OI2 A;  1EE6 A;  4KTQ A;  2GML A;  5ETQ A;  3DI6 A;  2M2B A;  5F8M A;  3N6M A;  2JHE A;  4L75 A;  3VCD A;  5ETN A;  1SQE A;  1UZD A;  1BQM B;  2QE5 A;  3AOC A;  1D9F A;  4LF8 F;  1KOH A;  3V6D A;  3SQG A;  5DDO C;  3AOD A;  4IQX A;  3M8Q B;  3JTP A;  4XTT A;  1RGV A;  3H4D A;  5CCL A;  3LWL A;  3TAP A;  2GVD A;  1GTH A;  2ZC4 A;  2XTJ P;  2VDH A;  2W7A A;  3FC9 A;  3ZZY A;  8ATC B;  1SUQ B;  4DL7 A;  2MQN A;  1U49 A;  2JEF A;  2XS5 A;  2G2O A;  4DSF A;  3NB2 A;  2HVZ A;  4NX9 A;  3NWG A;  1DTT A;  1FTC A;  2HQF A;  5DS7 A;  2PII A;  5AXL A;  3PXG a;  4YHH F;  3T1H F;  2KM8 C;  2OAU A;  1YJW S;  1FNO A;  4FXV A;  1BWE A;  1BMQ B;  2OPQ B;  4R5P B;  3BQ0 A;  1VBZ A;  1IWG A;  2EXU A;  3KKF A;  3PSZ A;  5G4D A;  2W4P A;  3EVM A;  2K8G A;  4KHM A;  3M6U A;  4I2P A;  2NR0 A;  2NPF A;  9ATC B;  3UN5 A;  2DT9 A;  4XOT A;  2VPZ B;  2Z8Q A;  2BZ2 A;  3C16 A;  3V6J A;  1L3K A;  4O44 A;  4DQI A;  1EQM A;  4X62 F;  1IKX A;  2DNK A;  2OSR A;  1YBT A;  2RF2 A;  2VG6 A;  2Y1R I;  3WIV A;  1LWC B;  3CCR S;  2KN4 A;  3HHL C;  1VQM S;  2C22 A;  4DPT A;  5E2Q A;  3A3N B;  3S8S A;  3EQO A;  2QYC A;  7FDR A;  2QFJ A;  5J2Q B;  4CLY A;  2B4O A;  1TKT A;  2A3J A;  2X6X A;  4LF4 J;  1KN6 A;  4P7V A;  4C8Z A;  1NME B;  5B09 A;  4AVZ A;  1R8H A;  2BAC A;  5D77 A;  4XN0 A;  2YNI A;  4NLD A;  2NS1 B;  2PEB A;  4Z06 A;  5A8K B;  2MZT A;  2XY5 A;  2B4P A;  3KK1 A;  1VIS A;  4B9L A;  3OHA A;  1FJ7 A;  2IMO A;  4I68 A;  3TW0 A;  2YKA A;  5DZ7 A;  1BQN B;  3UNG C;  2GO9 A;  2XMT A;  5C25 A;  5ETM A;  2DHG A;  4OYX A;  2MZR A;  4TLQ A;  4F7V A;  3NGS A;  2IJN A;  4OMF G;  2VC1 A;  4O3O A;  4Q5V A;  1J5E J;  4WE1 A;  4PG4 A;  1NXI A;  1EB0 A;  1TP7 A;  1IBC B;  1D9D A;  4JI6 J;  2MDA A;  3CJ0 A;  3DOM A;  4IH6 A;  1RAB B;  3P45 B;  3SCL E;  4Y00 A;  3M8Z A;  4OZ3 A;  3KDO A;  2B43 A;  1JB0 C;  1HD0 A;  5LOQ A;  4B9M A;  5C7P A;  1WC6 A;  5G0R A;  3PG9 A;  1D9A A;  1IR1 A;  3EDR B;  1JXE A;  3Q83 A;  4HT5 A;  4YEA A;  1TKD A;  3Q8R B;  2N3L A;  5C24 A;  1T95 A;  1Y0H A;  2NLW A;  1UEK A;  2O5D A;  5L46 A;  5F8H A;  1KVK A;  1PYT A;  2N7Y A;  5H9F J;  2FY8 A;  2FB0 A;  2IJR A;  2C2D A;  4JI7 F;  1I6J A;  2UVR A;  3G82 A;  2IVF B;  4KY3 A;  2FLP A;  3TYT A;  3FCV A;  3MI7 X;  3IWL A;  2D3O 1;  4ZA1 A;  3WZ0 A;  1WHV A;  4EYI B;  2ASJ A;  4E2F B;  2BJ7 A;  2BVZ A;  3CIZ A;  2D69 A;  2YUH A;  3LGN A;  4O44 B;  3W9H A;  3KXD A;  3W7B A;  2IAJ A;  4OV6 A;  1IDJ A;  2FY1 A;  5F3Z A;  1IKV B;  1NDP A;  3E01 A;  3M9O B;  4DR4 J;  2HWH A;  1SL0 A;  1KLN A;  4JI8 J;  2FJB B;  2F9J A;  2QL5 B;  3G6E S;  2YKO A;  4K4V A;  2RE1 A;  7FD1 A;  1TV6 A;  4PMH A;  2B4V A;  2HVH A;  4AXJ A;  1UW4 A;  1O8J A;  1RAF B;  2IBO A;  3TEG A;  1PJ7 A;  1S1U A;  3FCW A;  4ZOS A;  3TR5 A;  5DGA A;  1DTT B;  4J37 A;  2FTR A;  4LR8 A;  2LEB A;  4HKQ A;  4YME A;  1AZS A;  2KRB A;  4DOZ A;  2WSC C;  2E1C A;  4C0H A;  2XS2 A;  1OGO X;  1FKP A;  2RSQ A;  3L7P A;  5FDL B;  1ZM2 A;  4QW8 A;  4M5D A;  3CJK B;  2XO6 A;  1ZAW A;  3PCO B;  2D3Z A;  1RT7 B;  1VRU A;  4XLF A;  1V9O A;  1WG1 A;  1XR7 A;  3CVK A;  4X2B A;  2POK A;  4W90 B;  5ETP A;  4B3M F;  2LQ8 A;  4K5S A;  1O8L A;  2WSE C;  1EAY C;  3OFF A;  2EFV A;  4RR5 A;  3O8W A;  4ZP7 A;  4LRD A;  1IBK F;  2CJX B;  3MM7 A;  3T1A A;  2F3L A;  3GQ9 A;  2ZBP A;  3D7S B;  2YWK A;  2YWG A;  3IG1 B;  3IAS 9;  5CXT A;  3W8P A;  1DBG A;  2YPZ A;  5IV4 A;  5KFK A;  1JJC B;  1PBU A;  2JC1 A;  5HBM A;  3VZH A;  3W1Y C;  5I3U B;  4EGL A;  4CO5 A;  1P1T A;  3MM7 B;  4KIA A;  5LJ3 Y;  2Q66 A;  4F4Y A;  1RWO B;  4IR9 A;  1H98 A;  2AYG A;  5KFQ A;  3OUY B;  3FRY A;  2E9T A;  3BSC A;  4IO1 A;  1L3U A;  4M94 A;  4IFV B;  2ZVI A;  3NGU A;  1KFD A;  2DK2 A;  2IA6 A;  2UUA J;  1T05 B;  3K5L A;  2FHM A;  4FS1 A;  4RW7 A;  2AZ1 A;  4DS5 A;  4DSJ A;  2DJW A;  3FQL A;  1YI2 S;  1VS3 A;  1A6L A;  1AB8 A;  1DQ8 A;  2L9W A;  3I5A A;  5K14 A;  2BDP A;  4QU6 A;  2VFO A;  1RT6 B;  4NCG A;  4LFB J;  1QUV A;  2VF3 A;  2M70 A;  2QIF A;  1C1B A;  3F56 A;  1EP4 A;  1G4C A;  1S6P B;  2G4B A;  4K50 A;  2Y1L B;  2HYI B;  5L1K A;  3BF4 A;  4DF8 A;  2X1F A;  3PET A;  1S1U B;  5F0W A;  2BJ8 A;  2CPZ A;  1C4A A;  1S4E A;  2BRK A;  1E6Y B;  1AIR A;  1UWB A;  2RS8 A;  3NY0 A;  4MMO A;  4DX8 H;  5GAG U;  2DYA A;  1TKZ A;  2X3H A;  3PFE A;  1S1V A;  4Y2K A;  2OUG A;  3TVZ A;  4DLE A;  2GCF A;  1NJW A;  3CB4 A;  3H4B A;  1UEU A;  4YZQ A;  2HWI A;  2OHD A;  1TSP A;  3NOC A;  4A8S A;  1NK9 A;  3EGZ A;  4XOR A;  1U24 A;  5AJ3 J;  3VGS A;  3PW4 A;  2W9C A;  2ZBQ A;  1LLZ A;  2C3Y A;  2H5I B;  4ECY A;  2DRD A;  3VQT A;  2LDY A;  2XSF A;  1ACM B;  3OTO F;  4X66 J;  4X4S A;  4YEI A;  4OJP A;  4EK2 A;  2D9P A;  2C2E A;  4OQJ A;  2IPO B;  1Q1K A;  1O6X A;  1X0C A;  2LCW A;  3Q86 A;  2MEW A;  4KPC A;  3U1M A;  3ZTO A;  3OL8 A;  3CDU A;  1NKB A;  3JTN A;  2W9B B;  2NTP A;  3DLB A;  2HHT A;  3M6W A;  2DNZ A;  4HL9 A;  1RHU B;  4EBC A;  3V81 A;  1CJK B;  1SJF A;  1HPZ B;  3QJP A;  2CPF A;  2PI5 A;  3LP1 B;  5IQQ A;  2MKK A;  2HGM A;  2QLX A;  3U1N A;  3DOK A;  4WF9 Q;  2FVC A;  3AJD A;  1YRT A;  1QTN B;  5KG0 A;  2DIV A;  3MMA A;  5KT7 A;  2HHV A;  3W64 A;  1DTQ B;  5KFU A;  3FNN A;  3FJ2 A;  1U1R A;  1MWQ A;  2K2P A;  2QZA A;  3K17 A;  1HWK A;  2KVI A;  3G6Y A;  4K4S A;  3O1L A;  3TX8 A;  3GFY A;  2AWZ A;  3KJQ B;  3UPF A;  4DZD A;  1AZS B;  2XWX A;  3CJT A;  4C11 A;  3MMJ A;  4OI2 A;  2XGP A;  2RIJ A;  1G3O A;  5IT4 A;  3HHL D;  4IFY A;  4ZVG A;  1RYS A;  4LRC A;  1RAE B;  1TEL A;  1GT8 A;  1PLU A;  1WC4 A;  1WHY A;  4IH5 A;  2KRR A;  1OGM X;  3ZZT A;  4RNF A;  2V2Q A;  4K4T A;  1QA3 A;  2P5V A;  5KAK A;  2CJY B;  4ES2 A;  2VBE A;  4NA1 A;  3OQ2 A;  3WQP A;  5HVH A;  1FWK A;  1ULR A;  2HUR A;  3A1Y G;  4IRK A;  2I38 A;  3HP6 A;  5HP1 B;  3KLG B;  2KG0 A;  1R31 A;  2IAJ B;  2WZ1 A;  4ECU A;  3BKF A;  1TKT B;  3CUN A;  3JSR A;  2OEL A;  3CCZ A;  4Q2M A;  3PX6 A;  1NSP A;  2GGP A;  4NYO A;  3THT A;  2BQ3 A;  1XIQ A;  2GZO A;  2RF2 B;  1N34 F;  2W9A A;  1J2V A;  2BE2 B;  2DPI A;  4YY3 F;  4P2F A;  3HFK A;  1XNR F;  4ECZ A;  1WUU A;  4ZHR B;  1PIL A;  2EFP A;  4G3I A;  4USV A;  2KVQ E;  1GMU A;  4WU2 A;  2QXZ A;  3DDK A;  3GJS B;  3RU0 A;  2YKM B;  1S48 A;  2HK2 A;  4PPD A;  2G0I A;  1NJX A;  3R2C J;  1NPR A;  4QR0 A;  5I4M A;  4X4V A;  1R27 B;  1N0U A;  3MCM A;  3OJU A;  1MRO B;  1C0U B;  3IR6 B;  4QYZ J;  1OMS A;  2JZ5 A;  1RT5 A;  4A8W A;  2VOP A;  2OFH X;  2WON B;  1U4B A;  1EAR A;  1TL7 B;  2NXJ A;  4A8K A;  2RRA A;  2R7S A;  1IVZ A;  3NNC A;  2E7X A;  4LRE A;  1HG8 A;  2DO0 A;  5I3Q A;  1O8F A;  2GVD B;  3IN5 A;  4DV4 F;  3GYN A;  3NEK A;  2FDN A;  2GS8 A;  4IRC A;  3HHE A;  2MQO A;  1NJI T;  4U8V A;  3TUJ C;  1UW9 A;  4L74 A;  1MLA A;  1C4C A;  1YWX A;  4DMZ A;  1OYD A;  2KYZ A;  2H3E B;  5L39 A;  3TAR A;  4CM0 A;  3OSP A;  4P71 A;  4NRT A;  1NKE A;  2EC0 A;  4WIQ A;  1Y5L B;  3JQM A;  5A2Q U;  4OZ2 A;  3OSN A;  2ZDO A;  1EKS A;  4QWA A;  4OHY A;  1OSC A;  1MN7 A;  1RIS A;  1KQG B;  4HAC A;  4ITS A;  1KSP A;  4XAK A;  1RDR A;  4CTA B;  2WHO A;  4AL7 A;  4OM9 A;  4ZVO B;  4YOE A;  4I2Q A;  4FF2 A;  1LWX A;  1QE1 A;  2V8P A;  3QIP A;  2CWX A;  2EKY A;  3AH6 A;  3NNA A;  3PZP A;  1KR4 A;  1M1G A;  2RQM A;  1K44 A;  2B4U A;  2Q79 A;  2VBX A;  2MQ8 A;  1Q86 T;  5GVQ A;  4ELU A;  3I0R B;  3LAN A;  2HIQ A;  2M88 A;  3I5C A;  1NPP A;  1RLD A;  1WF1 A;  3L7O A;  2DH7 A;  4C97 A;  2DY9 A;  2Z4P A;  1XER A;  4AND A;  2FLO A;  2Z56 B;  5J2P A;  4LF8 J;  5HVF A;  2KI2 A;  1LWE B;  2AJF E;  2JL9 A;  2GAH C;  4LR9 A;  4O3Q A;  2X1G A;  1HWI A;  4OI4 A;  2ZOF A;  4HR2 A;  1Q8K A;  2J76 E;  2HZA A;  2RQK A;  2ZBR A;  3K5M A;  4W8R A;  1G6B A;  1ZA1 B;  2W2N P;  2YNG B;  3CD7 A;  3NLC A;  4P2S A;  2AIR B;  2B8P A;  2LLZ A;  3AD9 C;  3V2U C;  3IWN C;  2ZBI A;  2WW4 A;  1OIA A;  2IDE A;  4QIV A;  4ZK7 M;  2B6A A;  5KT6 A;  5GAD U;  4XPC A;  1ZTT A;  1SJ1 A;  2B51 A;  1FVS A;  3MCN A;  4I4B A;  5F3T A;  1F9E B;  1EET A;  1N5Q A;  4ZVQ B;  1U1N A;  2XSJ B;  2MY8 A;  4Y3C A;  2XLJ A;  1HQ2 A;  1MWZ A;  4A47 A;  3IC1 A;  4QCL A;  3TP2 A;  1O8M A;  2GAG C;  2WON A;  4B3S F;  3FZB A;  3R7N B;  5L8R C;  3ZPP A;  4KQZ A;  2ZH6 A;  2DIU A;  3P4G A;  2HND B;  2CKW A;  2UUT A;  3DYA B;  1K8F A;  3ISZ A;  3PKY A;  5JVG Q;  4K5R A;  1K5C A;  2FYX A;  3H90 A;  3S01 A;  3R1L A;  8RUC A;  1VQP S;  1PO6 A;  1TKX A;  3A3P B;  4OZZ A;  2NTB A;  1NND A;  4ZVH A;  1YZ6 A;  4ILR A;  5BYR A;  2W1B A;  4ED3 A;  1SKW A;  1FKA F;  3QRP A;  2M0G B;  4ZPD A;  4KV8 A;  3QFW A;  1HQU A;  4YB5 A;  4ZN3 A;  4RNN A;  2K3I A;  4XQF A;  3M2U B;  1RYR A;  4RW9 B;  3OVB A;  2PYG A;  2LQ5 A;  3IBF B;  3GE9 A;  2DTJ A;  2CQ0 A;  4FPR A;  3C66 A;  4KE5 A;  4M5K A;  4IYQ A;  1S0O A;  1CLF A;  4AYB D;  2E7V A;  4DR3 F;  2VA3 A;  3MCO A;  1KEK A;  1CUL B;  3GQ7 A;  1W25 A;  2X1B A;  1J5E F;  1NH7 A;  2F8E X;  3DXB A;  3HSD A;  1JLQ A;  3A8K A;  1CSJ A;  5B0G A;  4JI0 J;  4KB7 A;  1Q53 A;  1QM9 A;  3UR3 C;  3KLI A;  4HI1 A;  1B7F A;  3K5O A;  2J6T A;  3EZU A;  1WOP A;  4TY9 A;  4W8T A;  2A6M A;  2RRN A;  4KKO A;  4CLS A;  3IRX A;  1RAJ A;  2Z58 B;  2HBQ B;  4A8X A;  2R7U A;  5KG1 A;  4XDC A;  3HX9 A;  4PWD A;  1VBY A;  3FEX B;  5AE3 A;  4Z37 A;  3LTO A;  1RT3 A;  4AQY F;  3NGD A;  1GMV A;  2RHQ B;  4KO0 B;  3G6V A;  1LFW A;  2QL7 B;  3DRR A;  4OZJ A;  2W2M P;  2QA4 G;  3MMB A;  5HO4 A;  4CIO A;  4F4X A;  2J8A A;  2YKM A;  1FES A;  2G9O A;  3LAK A;  3CF5 Q;  1FK9 A;  4N56 A;  1T7P A;  2OTJ S;  3T41 A;  5CZV A;  1KLM A;  3MR7 A;  2DGU A;  4OI3 A;  3OXL A;  2BAN B;  2RH3 A;  1NEE A;  4V19 X;  2IMW P;  3BN7 A;  1S99 A;  1JLF B;  2HRU A;  1ELO A;  2AX0 A;  1WKK A;  1H2V Z;  3AOA A;  3HUL A;  3ONQ A;  2W9B A;  3KHH A;  4IO9 Q;  4AL6 A;  3HHD A;  2AGO A;  1SKS A;  1QVG R;  4B9T A;  2L41 A;  4IG3 B;  4ECT A;  1M5S A;  4DV2 F;  3HDS A;  4MFB A;  5EDW A;  1QA1 A;  3NMA A;  2ILY A;  3D66 A;  4CLL A;  3ICL A;  4C3M A;  2IRY A;  3OTE A;  2QLF B;  2PYH A;  1B0P A;  4FS2 A;  3B4N A;  3HSJ A;  3SCI E;  5LSR A;  3N28 A;  1NHK L;  2EPI A;  4CP5 A;  3OR2 B;  2FUG 9;  2VPX B;  2W2P P;  2MKI A;  3G96 A;  2EI5 A;  1TYU A;  3DU5 A;  4CCH A;  2E1R A;  3TUZ C;  1CQM A;  1CJU B;  3KLV A;  3FQK A;  1JK9 B;  5EWG A;  3LP2 B;  2YBV A;  2RHS B;  1XBW A;  1LWF B;  2XZT B;  3VSU A;  4DEZ A;  1QRC A;  1VIX A;  1DAB A;  1D3W A;  2MST A;  3VAJ A;  2VUG A;  2XZD B;  2AJQ A;  3MMB B;  3SFU A;  2ZE2 A;  2JSX A;  4CLP A;  3BS9 A;  3QZ8 A;  1X0P A;  1YSJ A;  4TY8 A;  1RTH A;  3TOQ A;  1BHE A;  3GR1 A;  3LP1 A;  2IC3 A;  3WIU A;  3KK3 B;  2BJ3 A;  1TQL A;  2O1P A;  1O8D A;  2FJE B;  1FFS B;  2R7Q A;  2XSJ A;  5EX3 A;  1F9H A;  2AQ4 A;  3C19 A;  2BSP A;  2UVE A;  1JLG A;  2RUG A;  3R6L B;  4AQY J;  1N6Q B;  2B6A B;  3IG1 A;  5A6P A;  3OTB A;  4B3O A;  1SB6 A;  4OHX A;  4Q2L A;  3GWC A;  4PAA A;  1SC4 B;  1S6Q A;  2XHC A;  4ID5 B;  4BC7 A;  4ZKA A;  3N90 A;  1WEL A;  5KFN A;  1VQ9 S;  2HFN A;  1SJQ A;  2R2T A;  2CNN B;  1ZOT A;  5IFM A;  1D8Z A;  3BGR A;  2VDI A;  2EK1 A;  4Y34 A;  1PAU B;  4X4O A;  2MQM A;  3QSY B;  1S1V B;  4WZQ A;  1RBA A;  1VR6 A;  3D1O A;  3EWG A;  2UVF A;  4HHJ A;  4B08 A;  4DX6 A;  2EFO A;  4CH1 A;  1OFD A;  3GV8 B;  3UQS A;  4KT0 C;  1LKZ A;  2YWH A;  4Y2M A;  2HW3 A;  2K1R A;  2Z2Z A;  2QA4 S;  2HMI A;  3TH0 A;  5FDL A;  1QCX A;  4RW9 A;  2LU2 A;  4R8U A;  5CYM A;  3QAE A;  2KM8 B;  4TU9 A;  1QQ1 A;  3DLH A;  4M95 A;  3PYG A;  1X4C A;  2ZD1 A;  4JI4 F;  5H9F K;  4WYL A;  4F4W A;  2C3O A;  4LVN P;  1B4S A;  3HVT A;  5AJ3 F;  4EO6 A;  4RL1 A;  3KNG A;  1NK4 A;  1X9M A;  1VMB A;  3EM1 A;  2Q6C A;  4OJO A;  2DNH A;  4X66 F;  4LQ3 A;  2XT4 A;  1HNV B;  1DBO A;  1SH0 A;  2GMJ A;  2O67 A;  2O66 A;  2RU9 A;  2KU7 A;  3DRP A;  3ETO A;  1OY9 A;  2JFD A;  3BB5 A;  3DYA A;  2HND A;  3PDN A;  4NMX A;  2DHA A;  4OYB A;  1QY7 A;  3RZA A;  2QLW A;  1N4L A;  2Y8W A;  2QA2 A;  2UXC J;  1MMN A;  1GNK A;  2OPR A;  2XC1 A;  3OFH A;  2IOU G;  1RA7 A;  2DRB A;  5T7L B;  2QG9 B;  4KR0 B;  4QWE A;  2E5L F;  2NRE A;  3BPD A;  2R7T A;  3T19 A;  2LKZ A;  4HAC B;  2YH1 A;  3D4J A;  3Q2T C;  2HZC A;  3JQK A;  2GO8 A;  1X4F A;  1VQ8 S;  2DR5 A;  4NLW A;  1P1L A;  1FWL A;  3HLU A;  3QO9 A;  2PEC A;  4BHQ A;  3RB4 A;  1ZYQ A;  2P2C B;  4V19 J;  1HI0 P;  4B9S A;  1XEZ A;  4UOH A;  4P72 A;  2VBM A;  5C24 B;  2YH0 A;  1T03 A;  3QMQ A;  2ZH9 A;  2BOA A;  4EWT A;  2BM0 A;  1CBK A;  1QD1 A;  2V5H G;  3H42 A;  2CWK A;  4RUB A;  1AFJ A;  1RHJ B;  1YZ7 A;  4Z2X A;  3GCW P;  2CAD A;  3BM7 A;  4QR2 A;  3SMZ A;  2HFS A;  5EHH A;  3GV7 B;  1UA0 A;  1SKR A;  1RMG A;  2DXF A;  5CZX A;  2CQ1 A;  3CJ3 A;  1GFW B;  1WHW A;  3H2L A;  3KJV B;  4OV1 A;  3I0R A;  4HHU A;  5JMC B;  2DGV A;  4F2R A;  4XLA A;  2WOM A;  2XMK A;  4ZPC A;  2ASL A;  4A8F A;  2QSW A;  1UVI A;  2YNF A;  3CJ5 A;  2B0R A;  1LK5 A;  5J1N A;  1FRK A;  2DGQ A;  1M1H A;  2CPH A;  2OML A;  3HHL B;  3KFW X;  4XM3 A;  2ALY B;  1T8E A;  3OBI A;  5F8N A;  3PVX A;  2MYF A;  3T5L A;  2DR6 A;  2KKH A;  1FA0 A;  1I51 B;  3AD8 C;  1GQE A;  5EN1 A;  1HBU A;  1VHF A;  2KHC A;  3N4W A;  4ZHR A;  1XNQ F;  1AFI A;  3R7S B;  1Q7Y T;  1NBE B;  4DN9 A;  2W4C A;  4PQU B;  1WI6 A;  2BM6 A;  4TYB A;  2M3D A;  3J81 U;  3I6P A;  2RAQ A;  4UY8 T;  2HBZ B;  1REV B;  3W2V B;  1U2F A;  2V4Q A;  3BYR A;  3OLA A;  5CHC B;  5E3Q A;  2PDA A;  2W7O A;  5JVH Q;  1RTJ B;  4F2S A;  1Q79 A;  1WSR A;  4ANE A;  3KLG A;  1NH8 A;  2DCU B;  1FWP A;  2OEK A;  1JKH A;  2ZVS A;  3K2Y A;  3MM5 A;  3N5B A;  3NBP A;  2QO3 A;  4LRB A;  4I6Y A;  4AXI A;  2AMC B;  5E7O B;  1MNE A;  4JB8 B;  5F9L A;  3B78 A;  5A2Q Y;  2VG7 A;  4LSL A;  4K0K J;  2XCP A;  2XNR A;  4Q45 A;  2KJW A;  3SDE A;  1XG2 A;  3TRG A;  2IDL A;  2XHW A;  2UXD F;  3LJY A;  1VRT B;  3BN4 A;  4ETZ A;  3KJV A;  2R2S A;  5DNS A;  1WDD A;  1X60 A;  1Y4Z B;  3MED B;  3OR1 A;  2PE8 A;  3PW5 A;  3I55 S;  4KHR A;  1L5U A;  2DY1 A;  3LAL A;  2NSB A;  3ITH B;  3N5F A;  3D6F B;  4G6V B;  4CNY A;  2X51 A;  5HQL A;  4OHV A;  3J7Z 5;  2GIQ A;  3M9N B;  4N5S A;  1OQ3 A;  4ZPB A;  1QAI A;  4OJ5 A;  4C8Y A;  3H5S A;  4ZIT A;  4QQB A;  5C42 A;  4HEA 9;  5K8M A;  1CJV A;  4F36 A;  4Z05 A;  3GCX P;  3GTY X;  4W98 A;  2UXB J;  1U7L A;  2IM3 A;  4DPO A;  1GXT A;  4DR1 J;  3CJ2 A;  3QO9 B;  3AXK A;  1YRX A;  2VA2 A;  3DI6 B;  1SVD A;  2BJ9 A;  4DBQ A;  1R0A B;  4DWI A;  3P5T L;  3CDW A;  4W8Q A;  2KL8 A;  3R5C A;  4PYD A;  3T9N A;  4GO7 X;  3UD5 A;  4F0H A;  1F6T A;  3CPW R;  1VOM A;  1RWK B;  3LO3 A;  4YUD A;  1S76 D;  1YGY A;  1DFD A;  2LYV A;  5DO2 A;  1BE4 A;  2VFS A;  2FC8 A;  1K47 A;  2CXE A;  4H4O A;  5KFX A;  4GKK J;  3HI9 A;  3D54 A;  3JAM Y;  3M9M B;  1PC5 A;  3D9B A;  1NZA A;  5I42 A;  2BR0 A;  3ILJ A;  1OO0 B;  4ICL B;  4USM A;  1N5S A;  2OKQ A;  3BBC A;  1F1B B;  2ZUA A;  3AFG A;  3P4U B;  5D0H A;  4F67 A;  3A13 A;  3KJF B;  3OJS A;  1RTD B;  1WG5 A;  2UP1 A;  4WKY A;  1S49 A;  2XB2 D;  3ZZP A;  3F73 A;  1FHT A;  4JV1 A;  1TK0 A;  3K58 A;  2V50 A;  2FLL A;  3F44 A;  2GJI A;  3DM2 B;  4OJ3 A;  1VCT A;  4RWW A;  4ANC A;  2XCA A;  3M8R A;  2VON A;  1DTQ A;  1XTZ A;  1EKR A;  1HNI B;  1S57 A;  2DEJ A;  3MMA B;  4CDI A;  2J7U A;  3NGK A;  4DX7 A;  2OH2 A;  3EPI A;  5DZ6 A;  2XTW A;  6AT1 B;  1UVN A;  2V0N A;  3T1H J;  2F4V F;  3J7Z T;  3M2R B;  3PRB A;  4WWS A;  3OVA A;  1V3S A;  2NTQ A;  1VK3 A;  1NJY A;  4B3S J;  4RNO A;  1BWV A;  3MPW A;  4ZCL A;  3S6E A;  2D41 A;  3PV8 A;  3I87 A;  4RWX A;  1JLG B;  4B3O B;  2NQP A;  1SBR A;  1R8P A;  4L76 A;  5KFT A;  2IBK A;  1HNW J;  3F0N A;  5HMW A;  4Q7A A;  1CJT A;  2HLU A;  2DD8 S;  3JX8 A;  2DXD A;  1YJU A;  1BUX A;  2NYI A;  3BO2 A;  4HTI A;  1HBN A;  4OJ6 A;  3BJY A;  4TY8 B;  4J9N A;  1HBO A;  3ZSC A;  5E3P A;  1NK7 A;  1X5O A;  1VBK A;  4KH0 B;  4ZVU B;  2PI4 A;  4LF4 F;  1ZET A;  3P96 A;  1EHW A;  5HRO A;  1K0V A;  3M8W A;  1CZF A;  1ZPV A;  4F4K A;  2Y8Y A;  4ZLN A;  1PKU A;  1RU1 A;  3NRB A;  3GQ8 A;  2WVC A;  4L3N A;  1PGZ A;  2CVE A;  1F3V A;  3P3D A;  4MT1 A;  3GFH A;  5L9N A;  1YTY A;  4RNH A;  1F60 B;  3RRK A;  3H5Y A;  2C3U A;  2OP5 A;  4GMK A;  1LQ9 A;  1T0T V;  1TV6 B;  2CPI A;  5D0G A;  5DQH A;  1P8G A;  1HBO B;  2C2K B;  3HT0 A;  3E3X A;  1T05 A;  4IFV A;  1HD1 A;  1RA6 A;  4F4Z A;  3BGR B;  4NRU A;  4Z03 A;  1RWR A;  1S9E A;  2GVZ A;  2WBR A;  3TI0 A;  2MKY A;  5E33 A;  3MR5 A;  4JI3 J;  4KHP J;  1KD1 T;  2GA7 A;  2J0Q D;  2CQ2 A;  1YVF A;  3LW5 C;  2HAI A;  3D68 A;  4O0N A;  4X65 J; 
#chains in the Genus database with same CATH homology
 3G2X A;  3VGU A;  3Q86 A;  4KPC A;  3ZTO A;  1LEO A;  3NGS A;  2BX6 A;  4HR2 A;  2J8I A;  3BBF A;  3LJY A;  3SYJ A;  3WX8 A;  3FKB A;  2BM5 A;  2B8P A;  3VVT A;  3FBC A;  1NSK L;  2DXE A;  5BXI A;  1KDN A;  5C7P A;  2VFP A;  1HLW A;  3ZTP A;  1CLW A;  4OJ5 A;  3EVO A;  3Q83 A;  2NCK L;  3VVU A;  4FKY A;  3N90 A;  1NLK L;  3NGT A;  4W98 A;  4F36 A;  1TYX A;  1HIY A;  1HF2 A;  1MN9 A;  3ENA A;  3P4G A;  1K8F A;  2B8Q A;  3FCV A;  1NSQ A;  4WBF A;  1QRB A;  2W7Z A;  4UOF A;  1QA3 A;  3ELH A;  1F6T A;  4OPW A;  2V5I A;  3BBB A;  1F3F A;  3DKD A;  2YUH A;  3TH0 A;  2HUR A;  3GPA A;  1W7W A;  4EK2 A;  1QQ1 A;  1BE4 A;  5IOL A;  1NDP A;  2VFN A;  3ZTR A;  1B4S A;  3B54 A;  3FBB A;  1VYA A;  1HHQ A;  5CAA A;  3EM1 A;  1NSP A;  4OJO A;  3BBC A;  2ZUA A;  4F4A A;  1XIQ A;  3R9L A;  3ETM A;  1U8W A;  3VGV A;  3FCW A;  4V02 C;  5CAB A;  4KH3 A;  2XC1 A;  2IOU G;  3SZE A;  3JS9 A;  2VFQ A;  3BH7 B;  1QA2 A;  1WXR A;  1BHN A;  4ANC A;  4DZ6 A;  1S59 A;  1WKJ A;  3MPD A;  1S57 A;  3L7U A;  1NDK A;  3ZTS A;  4UOH A;  1JXV A;  4JRA C;  2F3L A;  3Q8U A;  2CWK A;  2AZ3 A;  1NDC A;  5JLV C;  1S5Z A;  4OJL A;  3FC9 A;  3JX8 A;  2DXD A;  1NB2 A;  1BUX A;  2DXF A;  3RIQ A;  1NDL A;  3Q8Y A;  3DDI A;  3AK5 A;  1UCN A;  1WKK A;  4OJ6 A;  3NGU A;  5JMC B;  4DI6 A;  2BM7 A;  3Q89 A;  2BM4 A;  3EVW A;  2AZ1 A;  3EJM A;  2HVE A;  2B0R A;  3H09 A;  1MN7 A;  1TYW A;  2VFO A;  1XQI A;  3PRV A;  1EHW A;  3LYC A;  3EVM A;  1QA1 A;  3EIC A;  3N6Z A;  4OM9 A;  1PKU A;  1LWX A;  3BH6 B;  1B99 A;  3ML3 A;  1ZS6 A;  3NGR A;  4UOG A;  1TYV A;  3PET A;  4FKX A;  4C6A A;  4ENO A;  3PJ9 A;  2BM6 A;  1NHK L;  2VFM A;  1K44 A;  2DYA A;  4CP5 A;  3B6B A;  4S0M A;  3Q8V A;  3ZTQ A;  3VGT A;  3EE3 A;  2HVD A;  2BEF A;  1TYU A;  2G0Y A;  1NUE A;  3GP9 A;  2VU5 A;  1NCL A;  1TSP A;  1KQ5 A;  4ANE A;  1PAE X;  2DY9 A;  3VGS A;  3FBE A;  4AND A;  4DUT A;  1K4Z A;  3EMT A;  3FBF A;  4OJP A;  1QRC A;  1DAB A;  1WKL A;  4O0N A;  1NPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...