2BX6A

Crystal structure of the human retinitis pigmentosa protein 2 (rp2)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
314
structure length
311
Chain Sequence
KVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVLNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transduction protein
molecule keywords XRP2 PROTEIN
total genus 103
structure length 311
sequence length 314
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 2bx6A01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2bx6A02
2DXDA 1NLKL 2AZ1A 3BBBA 3ZTQA 3Q8VA 4ANDA 2B8PA 4WBFA 4HR2A 3FC9A 1B99A 1KQ5A 3Q89A 2DXFA 2ZUAA 4ENOA 1BE4A 2CWKA 4FKYA 1NSKL 3NGRA 1VYAA 4KPCA 2NCKL 3FBBA 3EVOA 1NDCA 3GP9A 1NSQA 1NPKA 3DKDA 4DI6A 3EVMA 1U8WA 2HVDA 3JS9A 4CP5A 4ANCA 2BEFA 1PKUA 3VGVA 1WKKA 1NDLA 1LEOA 3NGSA 2YUHA 4UOGA 2B8QA 1S57A 1W7WA 3FCVA 4W98A 1HLWA 1NHKL 3ENAA 3EVWA 3NGTA 3ETMA 3G2XA 3Q8YA 1K8FA 3VGTA 1BHNA 1UCNA 3FCWA 1HF2A 3R9LA 1ZS6A 3Q83A 3DDIA 1F3FA 4F36A 1WKLA 1MN7A 3PJ9A 1B4SA 4FKXA 3BH7B 1XQIA 3B6BA 3PRVA 4C6AA 3NGUA 3ZTOA 2DY9A 5IOLA 5C7PA 3VVTA 3B54A 1K4ZA 4ANEA 1KDNA 1WKJA 3EJMA 1NSPA 4UOFA 4V02C 3VGSA 5BXIA 3BH6B 1NB2A 3FBFA 1NDKA 3WX8A 3VGUA 2HVEA 2AZ3A 1HIYA 4UOHA 3VVUA 1BUXA 1F6TA 3EE3A 4EK2A 3BBCA 2VU5A 2HURA 1NUEA 3ZTPA 3GPAA 1EHWA 3L7UA 3Q86A 3ELHA 4F4AA 3BBFA 1XIQA 3ZTRA 5CAAA 1LWXA 3MPDA 2BX6A 1PAEX 4O0NA 4S0MA 2DXEA 1MN9A 1NDPA 3EMTA 1K44A 3Q8UA 3EM1A 4DUTA 1HHQA 2DYAA 4DZ6A 3FBEA 1S5ZA 5CABA 3FKBA 3EICA 1NCLA 3FBCA 3ZTSA 2B0RA 1JXVA 1S59A
chains in the Genus database with same CATH superfamily
4W8SA 1Q8BA 2H65B 4DG1B 2J6SA 4F3MA 1D9DA 2RSQA 2B6AB 3KRGA 1KQ5A 4PXCA 3JAMY 4DPTA 2E7VA 1RAIB 2HLUA 2NTBA 5ETMA 1PC4A 2V6AA 3UPFA 1NHVA 1IA5A 2VA3A 2CJXB 3RW7A 1YJ9S 4CT8A 3U1LA 1KSPA 2R4FA 3TYTA 1DURA 2EVZA 1REVA 2I38A 4TVAB 5IT4A 4PG5A 3EDQB 1Q0NA 3KG1A 4P74A 3MM7A 4XLHA 2EFPA 2NPIA 4ECXA 2BYCA 3FBBA 5DZ6A 5KTQA 4ZCKA 3T9ZA 3GFHA 3EYZA 4JYAF 1JXEA 1J5EF 1ZAWA 3CCLS 3AD9C 4E8UA 4YOEA 3T5KA 1REVB 2V2VA 3KFWX 2ZJPQ 2C2DA 2MGZB 5A2QU 3QGPA 3DLJA 2XY7A 3NP5A 1Q86T 3VSTA 5KFNA 3JSRA 2JJ4D 4TYAA 2W9BB 2H1YA 5ITHA 3QIPB 2XCAA 2OPRA 4LRBA 1CSJA 1LEOA 1XWLA 2V8VA 1HWUA 3IMQJ 2KO1A 4NWBA 4C48A 1VQMS 5HVFA 1ZTTA 1HNWJ 3MM5A 5FLXU 1JLEB 4QPXA 3D7SB 1HQEA 4F50A 1VQ8S 1S9EA 1QJVA 1D09B 1FKPB 1S9GB 1X7VA 2NSTA 2GHVC 2Z30B 4DQSA 1VQPS 4W90B 1JLBA 2G2OA 2VFTA 5D6GA 2DR6A 4FYWB 4WTYA 5C24B 3CJ8A 2HHHF 5DO2A 3HXMA 4CO5A 4WFAQ 3GV8B 1IWGA 3TZWA 1Z4UA 2DNQA 5G4DA 5EUHA 5B0AA 4X4RA 3KMSA 4ZJQA 4NLVA 3DDIA 2F4VJ 2EK1A 4KIAA 2K7KA 4P10A 2ZZMA 2BKPA 2J7UA 4ZP9A 1T94A 3D1OA 3D3BJ 3HMJG 1VRQC 2DGQA 4DL6A 1M5SA 4WIQA 2DGTA 2C2OB 5KFUA 3NGUA 2UUBJ 1X0CA 1D3WA 2MMYA 2MKYA 4Q7AA 4WP3A 5DGBA 3V6JA 2L41A 4XLFA 3M9OB 4KR0B 4OYOA 2YNFB 3O6QA 4J9NA 4PAAA 1LLZA 4H4MB 2IQ7A 1MW7A 3GIRA 3QZ8A 4QYZK 4MIAA 2Z2ZA 2VG5B 1K4ZA 1RT6B 1KHVA 1VQSA 1WHYA 2KRBA 4EU0A 2KHCA 5K14A 2XMAA 4OZLA 3EPGA 1D1UA 3PY8A 4NPOA 1FT8A 1HBMA 2IRUA 1UEUA 2R8IA 2RU3A 1WXRA 5KFDA 3GIKA 4C8OA 1N32J 4OX9F 3IRXB 4DHVA 4MIWA 3NB2A 2VPXB 4G1QB 1NPPA 1F60B 4USTA 3BB5A 3DOLB 3SSQA 2J9CA 1FERA 3SCIE 2UXDF 4USMA 3OSPA 3RR8A 3GRHA 1UFLA 5C42B 4PXEA 1TVRB 3V4MA 2HWIA 1U24A 2FJDB 2QA1A 2QLXA 3ZZTA 3OFFA 5K9FA 4YMEA 2AKWB 3GQAA 5AMVA 4MH8A 3IC1A 3QPIA 4PQAA 5JJBA 3D6TB 1DQ8A 6AT1B 3ADAC 4JBCA 2VZ9A 2CQ2A 2DIUA 3UR0A 2RHSB 7FD1A 4GKKF 2R7OA 1LXJA 3GFYA 3DLKA 5K8NA 3DM2A 5HP1A 4BS2A 4N8NA 1S7HA 2DHXA 4ES1A 1RT2B 2CPZA 1VGYA 1FEEA 2XZDB 3GLJA 1NJIT 3PETA 3RW6A 1OGMX 1S4FA 4IO9Q 5J2PA 4P7VA 3KHHA 3NCPA 1HQ2A 1U0SA 2ABYA 5E7OB 3CC2S 3OHBA 2IM1A 4D3GA 5GMDA 2V63A 2HHVA 4MXNA 3EICA 5AXLA 3W65A 4DV0J 4DLGA 4ID8A 1X9MA 3EGWB 3HJFA 3MR3A 3IM9A 3LPYA 4YB5A 1VBLA 2JDJA 3HJVA 3DLKB 2VUGA 3AOAA 5CQGA 1ZAVA 3VQSA 2PYHA 4QWDA 1NXIA 1OS5A 3IFEA 1RWXB 2ZH3A 1ZH5A 2AU0A 4P9SA 4O4GB 4OLPA 2X3HA 5T41A 3W5YA 5DQIA 1ZZFA 1IB4A 1KP6A 4I7FB 1F3VA 4DQRA 4JI8J 3THTA 2Q6BA 5IXUA 1IN0A 4FKYA 3QFHA 4KAIA 4U7UK 2MLYA 4Y34A 4TQSA 4H4KA 1T9WA 1YJNS 2ASYA 5FD1A 3QIDA 2G1HA 4DR6J 4W8RA 4IDKA 3OTDA 1VCTA 4PPDA 3DRYA 2XNRA 1ACMB 4CP5A 1HBUA 2HFVA 1SIWB 3C14B 1QTMA 4GC7A 1YX2A 2B4VA 1EP4B 2YKMB 3BSCA 1LWCA 4PWUA 2YNHA 3PRBA 4KH0B 1X5SA 1ZM2A 3UDEA 5KT2A 4ED5A 3W3SA 1S7IA 3KKFA 2B8QA 3CJRA 4C9DA 5ETKA 1H7XA 1BXNA 2DT9A 1UVNA 3AT1B 3GR1A 4FXVA 3D3CJ 5KFPA 1HPZA 2AYBA 3D4JA 1HG8A 1HBNB 1QUVA 7AT1B 3V6HA 4KV8A 2KKHA 3R7BB 2L9WA 3FJ2A 4Q2LA 5CYQA 1L3TA 5L9XA 4B3TJ 2HHQA 1LK7A 3NBPA 2PMHA 2IVYA 2XZWA 1NKEA 1TMJA 3GE9A 1UCNA 1BQNA 3AOBA 4ETXA 1NB7A 1F3FA 1WKLA 3DC2A 4WCEQ 1C1BA 2M8HA 3DGPB 3EZUA 4Z37A 3SZ2A 1SJFA 1BC6A 1SL0A 2NUHA 5FIIA 2ZHAA 3CDEA 1O8DA 4RR5A 2BV3A 3TOQA 4OZYA 2DY9A 4DSKA 3CULA 2XYHB 3MFHA 1HQEB 2IBOA 3LALA 3MEGB 3NMAA 1KTWA 3KK2A 4DSIA 3PFEA 1PG5B 3QSIA 4TN2A 3UN5A 2WCXA 3VVTA 1VQ5S 4DSLA 1T9XA 2UV8A 3OUYA 2V8DA 3G8SA 2FLPA 4DF4A 1IR0A 4OJPA 3TQ1A 2R8JA 1RBOB 1O8HA 4FYYB 5IQ6A 2YWGA 3MD3A 4H4KC 5KFJA 2RNEA 3LF0A 5C24A 4RNNA 2HVEA 4RBVA 2JLEA 1OPZA 1ZOTA 3DLEB 2HQ3A 1NJXA 1TKTB 4NK6A 4X4NA 2GVZA 3MM8A 4CO0A 1RHRB 3MCSA 1OJ4A 1U6BA 4LF4F 4NXMJ 4WXOA 5ETPA 4MK8A 1VQYA 2XMTA 5KOWA 4GKJJ 4B3OA 2B51A 3PW0A 1UW4A 3PW2A 3J80U 3GWCA 3CCJS 4DL5A 3VQTA 2HURA 2RD5C 2V5HG 2DKOB 2XSFA 1OY9A 4CRJA 2DVIA 1L3SA 4QIFA 2BQUA 1XN9A 4X66J 5B7WA 1UA1A 4OZ1A 2WVFA 2WZ1A 4ECYA 5ETQA 3ZTRA 5IV3A 1LWXA 2WSCC 3D1QA 2JX2A 2CVIA 4ZLJA 2ZH2A 4FXWA 4CZCA 4HH1A 2UP1A 1XNRF 4O0NA 3C16B 2HAIA 4I6WA 4PABA 4YB7A 2O04A 2ZOGA 2LEPA 2DITA 2ZJQQ 4DR7F 2N3LA 1C0TA 3GTYX 4RPFA 3D68A 4XL9A 2H5EA 2VFPA 3TR5A 1BD6A 3ZZOA 2VQFF 1GQEA 2ZBPA 3FFIA 2DGVA 1JJ2R 2M70A 3FEYB 4XPEA 3WIVA 1SH2A 2OELA 1SJ3P 3TO8A 3BGRA 2YKNA 1RT1B 2JFDA 3B82A 3CJTA 3JQJA 3QGGA 1VQ7S 2ADBA 1Y10A 2GHWA 3FGVA 4JB8B 3N90A 1PAUB 3NWRA 5DDRC 2BE9B 3R1LA 4K4UA 3ICLA 1FTCA 2P5VA 3MF5A 4RW4A 2MXYA 3OLAA 3EPIA 2FVQA 2UXBJ 1H72C 4JV2A 4HHUA 1U02A 4MYTA 5IS2A 2K06A 3GJSB 3SCJE 1LWCB 2Q79A 4NZ7A 5A6PA 5HROB 3J7YU 4PXDA 2C22A 2AGOA 4FNIA 1WOOA 2XGQA 2IVFB 3CC7S 4C8YA 4K59A 2JL9A 2X3GA 3HSGA 5EHHA 3QRQA 3OTOF 3OR2B 2J9DE 5ETRA 5L1IA 2CQPA 1FFWB 2DEJA 4CLPA 1SUQB 2RQCA 1SIZA 3VAIA 4OHXA 3CDBA 1HPZB 1HWIA 4EO8A 2OI2A 2LQJA 5I3UB 4K8RA 1NSQA 3MI7X 1CG2A 3DRXA 3BDEA 3J81Y 2YQ1A 1RYRA 3ITHB 3KLVA 1RI7A 1OFEA 3M4XA 4ELTA 2INVA 3OL9A 1LNQA 4MT1A 1BMQB 2QYUA 1RDRA 2RKIA 4XO0A 1TL3A 1QA1A 1EX8A 3KLFA 1E6VA 3T5JA 4JI4J 1T11A 1SJRA 4CQ1A 3QO9A 3ZZYA 1O8LA 2VFSA 4OJ1A 4TU7A 1TQLA 3DOKB 4RW9B 4JI1F 5C1CA 3BO3A 4LIWA 3ULHA 4IDKB 2W8LA 2XS5A 1JLCA 1CJVA 2F9DA 2YPYA 5C1EA 1R6YA 5DJBA 2PDAA 1IR2A 4EFAC 3BF4A 3DOMB 2GJFA 4WWSA 3PVXA 2GFFA 2D3UA 2AYEA 4DR5F 4K5SA 1YJRA 1HF2A 1ZS6A 3MWBA 1YGYA 1N5QA 3Q83A 4DF8A 2W2NP 3RRGA 3NNHA 1Y00A 2MZSA 4ZVRB 4HDHA 2XC1A 5HQ8A 1RT3B 5KFCA 4F4XA 2M88A 4DQIA 4NK8A 1EKRA 4QU6A 1MROB 4DR7J 1M1HA 4DL0C 2NQPA 4MKBA 3H90A 3MMAA 1YBAA 3BYRA 3SFGA 3RU0A 5HAOA 5C7PA 2V4RA 4ILLA 5LXRA 2DBBA 1TP7A 1Z2LA 1ULRA 3GYGA 1JLGB 5H1SV 2GO8A 3R5BA 2VFOA 1U6ZA 3A8IA 3A1YG 3M7VA 3M8WA 4OIXA 4LF6J 3L9ZA 4Y2MA 2JEJA 4JP8A 1QAXA 4DPXA 5K8PA 4J9SA 3TAQA 5KT4A 4ZCIA 1NK5A 1JWWA 3PYGA 2HHHJ 2WONB 4A8QA 1T9UA 1TL7B 4WFZA 2VONA 2UU9J 1Q8IA 2K1RA 3EQNA 3K57A 4GKJF 2XMWA 2GQ2A 1BQMB 3HVAA 2CQ3A 3QMQA 2KDOA 3WC2A 4XM3A 2HNZA 5BJRA 4KPYA 1RTJA 3BS9A 4DSFA 1N33J 1K0TA 1IDKA 4WTOB 2X7IA 1DARA 2KN4A 3DOKA 1VQ4S 5DS7A 2OUGA 2IBKA 2RU9A 5E2QA 3DU1X 1GMUA 3V4IA 3R1HA 2YX4A 4J9VA 1U1RA 2VG5A 2D3ZA 3DU5A 1XEZA 1JJCB 4FYDA 4LUBA 2NXUA 2JC1A 2M8DB 2N4DA 1HYSA 1F9EB 1T9VA 1IXKA 2FQQB 3N9UC 3A3PB 2NLWA 2YKAA 1U1MA 2CPIA 3DI6B 2QA2A 1F2GA 1VBXA 3MZIA 2KG0A 1X4HA 4RO0A 1KFSA 1QA3A 2XHCA 1XJWB 2F4VF 1UVIA 1NZ8A 2DJWA 2L08A 5LM7E 4X4PA 4TXSA 1U0HA 3KHRA 4B3SJ 1RAJA 2NREA 2EC2A 2IDLA 1FK9A 2D9OA 2HW3A 3CW2C 1FJGF 4HL9A 2J76E 4I56A 4KE5A 4FPRA 4P72A 4YP3A 1OGOX 2E5GA 1N36F 1M5HA 1OQ3A 2Q43A 3R7SB 2ZM6F 4WZQA 1LXNA 1YWXA 2BE2B 3C66A 1FA0A 2FJAB 2FZCB 2ZHOA 1KNZA 3KLIA 2B3TB 4PKDB 1D8ZA 4JI5F 3AJ1A 4LR7A 4WYLA 1WDTA 2QT7A 2YVSA 3PO4A 1I6JA 4MKYA 4RW7A 2Q1LA 5BYQA 2MGZA 4U96A 4U49A 4JOUA 3W9JA 3KJFB 1EIYB 2MY7A 1K1QA 2DGOA 1NSKL 1RTDB 1GX5A 1VYAA 4M5LA 3MM8B 1VLYA 2DISA 1S6QA 3O1LA 3KJVA 1S72S 1AXQA 2A0FB 3QLHA 3PX4A 3DRSA 1T05A 2E5LJ 3QAUA 4CH7A 3E01B 4W8QA 3D9BA 2LQ8A 3LP0A 5FJ4A 4Y6IA 1RT4A 3EVMA 1U8WA 2W9AA 2OPRB 3KLHB 3L7PA 4GVBA 2E1AA 3DFEA 4FF4A 1UA0A 3AFGA 2HEKA 1YITS 1RU2A 3SMZA 1L5UA 2PECA 4B3OB 4EYIB 4CTAB 3AB4B 4DN9A 3QJJA 2H4WB 3IAM9 1N8RT 2R7QA 3KYLA 2QTWA 1NHKL 2GVZB 3DDKA 2ZUGA 2JVRA 4FYVB 4U8YA 2VBKA 4A48A 5HBMA 2UUAF 2C3PA 4FBTA 4CLSA 2X6YA 3QLHB 3W5XA 5AXNA 4LF5J 4OJLA 4OZJA 3PACA 1UL3A 1S1XA 2PEHA 1U45A 4IKAA 2MB0B 3QWUA 4JI3F 1YBTA 2QX0A 3R9LA 1RWKB 2F8EX 4RKUC 2PT0A 3HSZA 1XMOF 4LF9J 1RKJA 5D4NA 2Z0GA 4C3MA 4C8NA 3EGZA 2RRNA 4CLWA 4DMZA 2V8HA 2U2FA 2W24A 4IG0A 5B0FA 5DRKA 3MEGA 1U2CA 3DLGA 4U9RA 1JRGA 1S1VB 4DG1A 2ZH8A 1O8JA 4DV6F 1FO1A 3TI0A 1CLFA 4X62F 4X4UA 4A8KA 2CPJA 5KFHA 4RZRA 3PDNA 2QFIA 2D1CA 4NI2B 3D67A 4M5IA 5DQHA 1Q8LA 2HQIA 1KN6A 1KLMB 3TJAA 3G6VA 3A13A 3ZSCA 2CPFA 4K5RA 4V02C 2X1FA 2JC0A 3CCZA 2QN6B 4Z7CA 1BQNB 1VRTA 4QZVB 5KFZA 2FJXA 1SQFA 3FQLA 2O3DA 1TYXA 1X8DA 2LA6A 3CMAS 3NBPB 3OV7A 2V9KA 3MMCA 3NS7B 4CLUA 5HQMA 2W7OA 1FFGB 4PG4A 3QQCD 4OI4A 4Y00A 4QR1A 2MKIA 1VC6A 2G0YA 4ZP6A 1JK9B 3QYYA 1S6PA 2XSJA 4CI0B 4MFBA 4DV4F 3DI6A 3MURP 1URNA 3FVYA 2J5AA 3DRPA 1BUXA 2ZVSA 3W5ZA 1WHWA 2AT1B 2H5JB 2LCWA 4O23A 6FDRA 5F8LA 1TKZB 1R27B 2J0SD 2MLZA 5LMUJ 4KHPF 2M52A 3KG4A 5D0RA 5HN0A 1VLOA 2WVBA 3T41A 3HHLC 2K3KA 4JV1A 4O4RA 2ASLA 3ENQA 3FMWA 3VV2B 4CLTA 2FTRA 4ZLNA 7FDRA 2X6WA 2HK2A 3NS5A 2W2MP 5C25B 2MZRA 2P9EA 3PIOQ 3OBIA 1NJYA 2H54B 4YY3J 2GAGC 3M1VB 4LREA 4OZ5A 3CXCR 1FDBA 1K0VA 3N5BA 2NT6A 3KHGA 3LUYA 4QW9A 3LWLA 4DL3A 1TL7A 1TKXA 1CS4B 1S79A 3L7OA 4I7FA 4LF1A 4LSNB 4C97A 2HQFA 2W9CA 1JLFA 3JQMA 4HEA9 1FX2A 2H48B 2KVQE 4L72B 2KM8B 4QWEA 1RWUA 1ZTWA 1DRZA 4DR1F 4I2PB 2HIQA 1RHJB 1R89A 3O5TB 4YR3A 3MPVA 1BWEA 1JXVA 4Q44A 1AUDA 3HD1A 4IH6A 1SKUB 3ZFVA 3R2DJ 3DM2B 1RAGB 3DN9A 4DX8H 2IFXA 1SC4B 4ANDA 5EWGA 1RWPB 5M2PA 1LK5A 1H2TZ 2Y1IA 1BWVA 2YNGB 4R8UA 4YFUA 2MTLA 2OMLA 4E98A 3OL8A 2JFKA 2C2NA 1PC5A 4F3QA 4Y0FA 3CWJA 3IWXA 2V9WA 3TUJC 2Z58B 4F0KA 2BM5A 1GMWD 1EQMA 2A1BA 2ILZA 1CJKB 3H42A 2NR0A 1RTIB 2GAHC 1BGXT 2P9GA 3D0HE 2VKZG 1NK0A 3VTIA 5D77A 4OPWA 1VOMA 3BSNA 1U48A 1I3OB 1WG5A 3EVOA 1NDCA 4I6YA 2DR7A 1LLWA 4F4YA 2F1FA 3HVTB 3L4BC 3H5XA 2DEIA 1OFLA 1PLUA 1NU4A 1YG0A 4N7TA 1H74A 2VH7A 5K14B 1RT5B 1RBAA 1B0VA 1Y4ZB 2XMKA 3ILIA 4ANCA 4DSJA 5JVHQ 2O6WA 1L3KA 4ZCLA 3V6KA 2D3OR 2MZQA 3IO1A 2E66A 3NCRA 2IIHA 2WTFA 2ZKTA 3AXKA 5I3UA 2ZD1A 2VFNA 2F9JA 4I68A 4DX6A 2DPJA 2R8KA 3JYTB 1N5YA 2HHXA 1Q1KA 4ZVGA 2XT4A 5HMZA 2ADCA 4C0HA 3BZQA 1BQXA 5A0YA 3VCDA 1Q16B 3G2XA 2Y9HA 3PSZA 3IXQA 4UQTA 4E2FB 2XC9A 2I5JB 1PJ6A 1HBMB 4Y3CA 4LIRA 2ZZNA 1LM1A 2RS2A 4PWDB 5KFVA 3UVJA 2MEWA 3VSUA 4FKXA 3FMBA 1RU1A 4OX7A 1CBKA 3BQ0A 2DHSA 3M2RB 3CNQP 3MPYA 2IHR1 2JWNA 4I67A 2DNPA 3RG6A 2Y1JA 1AZSB 3JYTA 1HNXF 1JLEA 1I1GA 2OO4A 4KKOA 2I6WA 3DLGB 3BO2A 4RBTA 1VQNS 4IH5A 1TYVA 2IRXA 5KG3A 3CCVS 2MZ1A 2O01C 3DCAA 5AT1B 3MMBA 2ZH9A 2ZKUA 4OX6A 1AB8A 3EJMA 3OLBA 5FDLB 4WKRA 1QRCA 1FE0A 2GS8A 4NLWA 1TK0A 3CIZA 4FDFA 3ZXWA 1W25A 3LP1A 5D0GA 4AFFA 2P2CB 4GMKA 1FRKA 1KD1T 4Y2KA 4QYZJ 3BKUA 1VIOA 1Y5LB 4LJMA 4NOHA 1FXLA 3C19A 5E0OA 1S9GA 3ZNJ1 3LPEA 2A18A 5DDQC 3H2VE 4ES3A 2ZEJA 4JI0J 1WWHA 4CTAA 4FVCA 3RTVA 4HYKA 2W01A 2AF6A 3IA0A 1M0SA 2DCUB 3M2UA 4YDXA 5EWFA 4ILMA 2QFJA 4OL8A 4GVBB 1NUEA 1O8GA 2B6AA 3S1TA 2N3OA 5KFLA 1GXTA 1IM6A 2YX7A 2W7AA 2B4OA 3EXYA 5L9NA 2BM1A 1O0PA 3EGVA 2U1AA 2EPIA 4Q5VA 2QSFA 3GB0A 3NMRA 1TKTA 2QG9B 2QXZA 1QE1B 2GMLA 3DLEA 3L09A 5CD4A 3OTOJ 1NO8A 4PCQA 4PWWA 3SUCA 2PYGA 3A8EA 4UUXA 2AYMA 1NDPA 3EMTA 2XEXA 4LQ9A 2H3EB 3GFZA 4NLPA 6FD1A 5HLFA 1T03B 2IJRA 4DWIA 4JI7J 2Z8QA 3P6YC 3JSMB 3H4DA 1HWLA 4XMYA 1HWKA 1RK8A 2CJBA 5FDLA 3VHQA 4DZ6A 3GQ9A 1VMBA 5T7LB 3HFKA 3GJQB 3P5BP 5I3QA 2LU1A 3TAPA 2CNOB 1FJEB 1OWXA 4NA1A 1KHWA 3DRRA 2OPQB 2J8AA 2HLTA 2VPWB 2GMJA 4ECZA 4JI4F 1EZZB 1SV5A 2O0VA 2XULA 4ZVOB 2YWKA 2HGMA 3D6HB 5A8RB 4ED2A 3G9CA 4J90A 1RT7B 5HL7Q 4B02A 4ZVTB 1TAQA 3CDAA 1YLXA 2R2TA 2YY3A 2MJUA 1N5VA 2RF2A 2HHWA 2HRYA 2C42A 3FZBA 2ZOFA 3VAKA 1NKBA 2GQCA 3MTJA 1WNEA 2C3UA 2LQ5A 4KV8B 1KQKA 4NEZA 3OL7A 1U6FA 1RCXB 2HIYA 5IV4A 3J7YI 3OJUA 4NLDA 1NMEB 5J2MA 1XTZA 3A8JA 1UKUA 4Q43A 1HNVB 1NK8A 1QSSA 1CJUA 3S8SA 2OTJS 4XLAA 1MU2A 2K3IA 2H4YB 2BEFA 4XN0A 2NT9A 2FUG9 1KLNA 3C6TB 1DJ0A 1HBUB 3C14A 4IFYA 5DGAA 3R27A 2X1BA 3D54A 2OTLS 1IBLJ 1FTRA 1HW9A 1IJEB 2XMJA 1YVFA 3PJWA 4CH0S 2XLIA 4RNHA 3G8TA 1F9HA 3KJNB 4NZ0A 1WEYA 4OX8A 1S97A 2F5GA 1R3NA 1HMVB 3IS9A 4OYBA 1PXZA 3I56S 1TSPA 4UF4A 4EW9A 4QWCA 1M90T 3Q8YA 4IUFA 1NHUA 5KG4A 1BHNA 3UFCX 2LLZA 3AHPA 1ELOA 1MWZA 4ID5B 3KK1B 3WX4A 2I8EA 3RR7A 2CQ0A 4J7CA 4OQJA 1QVFR 5IM0A 3OR1B 2XTXA 3B8HA 1P9YA 2WW4A 4Y65A 3OTEA 2GIQA 3LJYA 1F5CA 4NL5A 3W8PA 4ZITA 5EDWA 3KLEA 2YNGA 1NNDA 2MHEA 4DV5F 2O0WA 3EWGA 2XWYA 3NXZA 1XR7A 4CNYA 1TL1A 4K2JA 1RABB 2Z57B 3GIMA 2DNMA 3B78A 4OYIA 4DUZF 3RZAA 1P27B 3GG1A 1J5EJ 3UDCA 3FY3A 1S1WB 3DLLQ 3J7ZT 3M8PA 3VAMA 3CD7A 1X0FA 3K8VA 2HQGA 3KTQA 4F4WA 1OYDA 5EN1A 5AE3A 1SVDA 3MUMP 4ALZA 3I82A 3BSOA 1GNKA 2CVEA 1PILA 2YTCA 3NY0A 4X4SA 4RBUA 2XGPA 2AX0A 1Q7YT 1XMBA 2V4QA 1VBYA 1Y5IB 1SC1B 2HS0A 4WU2A 4XORA 3I0RA 4MMOA 1K8AT 2QV6A 2FJBB 2M3DA 4RW8B 3TH0A 1R0BG 1FFSB 4WP9A 2ZE2A 5A8WB 1LWFA 2EBEA 1VQ6S 1EARA 3LANA 3MXHP 1LWEA 5C2CA 1PYOB 1E6VB 4DV3F 3SI8A 3CSKA 2DHHA 4PR6A 4ECSA 4WU3A 3HD2A 1U1PA 3QRPA 1TKZA 1YKWA 4A8XA 3PR4A 4KHMA 3M8RA 1CJUB 3PSSA 2X1GA 2V8GA 5GAHU 1AZSA 1X5PA 2DK2A 2E5JA 2PIIA 3I5CA 1VIXA 4HACA 4HT5A 2V50A 1RWMB 4NRTA 5KFRA 2EEYA 2IRYA 3R5DA 4F26A 3KJQB 5LT5A 1FNXH 4Y28C 3MPUB 1FRIA 3M30A 4URSA 2J9DA 2AMCB 2CQDA 2DNRA 4P75A 1M5VC 1ZM9A 1PCAA 3QT8A 1LQ9A 4ELUA 2DGUA 4QWBA 1Z1ZA 4KH3A 3TVYA 2HHSA 4N8OA 1HI8A 2RF2B 3NLCA 2HGNA 2R7XA 1KLMA 2UUCJ 3ETOA 4M5MA 1DFDA 1RLCL 3W9IA 3PM9A 1SXLA 3MR5A 3IG1B 1RHUB 1N5YB 2XB2D 3PYFA 1OMSA 3HVWA 1DQ9A 5B08A 2K7JA 2RRBA 3RB3A 2KXFA 4F3OA 5M2UA 4RWXA 5LSLA 1F0XA 1JLAA 3NOGA 4IYQA 3JB9k 2BM0A 4K4VA 2L9NA 2OLWA 3K0JA 1J27A 1IKYA 1D9FA 3NCQA 1W2BR 2VL1A 2ZFHA 3SSSA 1VHFA 2W4PA 2B5JB 3N4WA 4KY3A 4CM0A 1ZA2B 1Q5VA 4N47A 2COLA 5K8OA 3TJ8A 3G6ES 2AQ4A 3VAHA 1VC0A 2W7ZA 2GJ2A 4NYPA 3JTOA 3QJLA 2KH9A 2VQFJ 1I5OB 1P8GA 4A47A 3D6FB 4GRSA 2OAUA 3DDNA 3HFZB 4B08A 1YIJS 2XS7A 4OX9J 3N6NA 5KFSA 4TKTA 4C8LA 4LF9F 3P3DA 4XN3A 1NPKA 3W64A 1X4CA 3M8ZA 2IJNA 1O8FA 2A2DA 3N0VA 3JS9A 3W2WB 1MMLA 1PBAA 4F0HA 3KDNA 5GAEU 2OP5A 5DDOC 1F5AA 1S4EA 2WRMA 5CCLA 5DM7Q 2UXDJ 2B0GA 3ZZZA 3O8WA 2VFRA 2R2SA 2KL8A 1JLQB 2CPEA 1IWAA 2ZITA 2FY1A 5DLFA 4XQFA 2PO4A 1O88A 4YZ0A 2CQ1A 2QGFB 4R0EA 2C3MA 3M05A 3CCQS 3MM7B 4DR4F 1S10A 1UWBB 3MM9A 5B0CA 3HT3A 2R8HA 3T9GA 1U1OA 2M7SA 2PGCA 3RAXA 2F4FA 4LFBJ 3K5PA 2JSXA 1YJTA 2VC1A 1K73T 3OFGA 4WYWA 1G2EA 4DPYA 3HSDA 2FLNA 2JNJA 5KFXA 2NZMA 3VAFA 5F8GA 1VHIA 4EYHB 1PE9A 3KK2B 2NYHA 4D3HA 2AGPA 3M8QB 4N41A 4TY9A 5A8KA 2G1DA 3LW5C 2VDIA 5E3RA 3VALA 4IRDA 2KB2A 3TP2A 4CLZA 1CVJA 3SQOP 4DV2J 5E41A 3F44A 2DY1A 2OD6A 4F4ZA 4RW6A 1U1QA 3LGNA 3LGHA 2DR8A 1M5OC 4CO4A 3CMES 1NSPA 4J37A 2W2QP 1XMQF 3P49B 1PBUA 1SPBP 4B9NA 3HF5A 1UJ6A 5J2MB 3MAAA 4W8TA 2YNIA 1U25A 4XAKA 5GADU 3TWZA 4HKQA 4LRCA 1UPMB 1CJTA 4QWAA 2FVPA 4KHPJ 2HZAA 4C0BA 5DG8A 2CJAA 2MYFA 5DZ7A 8AT1B 2GC8A 1FJGJ 3CMQA 3JURA 2IAJA 3THPA 4B3TF 4NRUA 5GADI 1RQ0A 4KTQA 1VRTB 3GU0A 3PCOB 4XDDA 3CJQA 3AA8A 2LQ9A 3FZ2A 2ZM6J 4DR2J 2HS3A 4I2QB 2RDDA 5HP1B 4ZIVA 1B70B 1RTHB 2DNOA 3BEGB 3BGLA 3ISNC 4IFVA 4P52A 9RUBA 3B4NA 2XYPB 2RQ4A 1H38A 2CJQA 2KRRA 2WSEC 1XIQA 4HTJA 4YZXA 4ZPAA 3HM9A 2KZZA 2ZNYA 1SV5B 5CAAA 3G4SS 3MPDA 1FX4A 3J81j 2ROGA 1JIHA 3FSYA 3BGOP 2NSPA 1Y7PA 4NZ6A 4U7UD 1BQMA 3SDEB 2XTWA 3SQGB 1DZ5A 2QLFB 3K5OA 3T9NA 2RQMA 3LOUA 3MM6B 3CCWA 3I55S 3CVKA 1VDHA 1ZETA 4R5PA 4ECWA 2D3O1 4IRKA 4FS2A 4L74A 2OEJA 5H9EK 2KYZA 2JHEA 1DBDA 1S5ZA 1GT8A 3H8YA 3NAIA 2FC8A 2ASDA 1F2HA 1NCLA 3FBCA 4W92B 2JEFA 5ETSA 1SC3B 3SIPB 2DXDA 4LBHA 1N33F 2HFSA 1NLKL 2CG8A 3CD5A 3C8YA 4OZZA 4NYOA 1JLQA 4QPTA 2KT2A 1G6BA 1YZ6A 4LT6A 4WBFA 4WXWA 3GQCA 4JI6F 4AE5A 3MAQA 5LMNJ 4QIGA 3T3FA 2LU2A 4F25A 2BW2A 4J9PA 3RRKA 2LECA 2NXJA 4AL7A 4PEOA 2A3JA 1FESA 1NK6A 2RVJA 1WC3A 4M1KA 1CS4A 4LSNA 3IAS9 1BY9A 3ISZA 1ROFA 2DRAA 1VQKS 4YR0A 2J7KA 3RBEA 2MLXA 4X64F 2GIFA 1H3DA 3KLGA 1AUSL 2J7WA 3MTKA 3SFUA 3H4BA 1NK4A 4M5JA 4P2FA 4B9LA 3OTCA 1JXLA 3KJVB 5HVGA 3KUHA 3UDLA 1HR0J 2BE7D 4OFZA 3W2VA 4DI6A 2ZH6A 4USWA 3IR7B 2CKWA 5IT9Y 2D7SA 1NH8A 5B0BA 2QJ3A 4FF3A 1S1UA 2J0WA 3QGIA 3WBZA 4TNOA 1YJ7A 4PG8A 2ACYA 3GQ7A 4HT7A 2YUHA 2B9EA 4UOGA 3EQOA 1VJQA 1RAAB 4HHHA 1UPPA 3LP2A 3V5RA 2PA8D 1TUVA 2FGCA 2LMIA 2QL9B 2DGSA 2VBZA 2EWHA 3H59A 3S7RA 2CUYA 4Z2XA 4B17A 4DBQA 4NXNJ 1SUQA 2JH3A 1FXDA 2CIMA 3NGTA 3R3TA 3I5AA 3UN3A 1T95A 2KHDA 1UFKA 1WTFA 5EGYA 2ZH7A 3UVJB 2B43A 1FKOA 3CIMA 4ZVQB 3WWGA 2RAQA 4F36A 3R6GB 5D3GB 5AJ3F 2B7BB 2IDEA 4WFYA 4WJBA 2V68A 2POKA 5FLXY 2VQEF 2C3YA 3AB2B 4QOTA 1FVQA 2LDIA 1QQ1A 1O51A 2BM7A 3BGRB 4J9UE 3F0NA 4P6QA 1H98A 2OPSB 4WKYA 2BJ1A 4OMFG 4EBCA 1B7FA 2J9EA 1GTHA 3B54A 3LGMA 3H25A 3LO3A 2NXNA 1HNXJ 4NXMF 2CNNB 3FFIB 3QZ7A 4DUYF 1YQHA 1O8KA 2MQMA 5IC6B 1HBOB 2XMMA 3VGSA 1LWFB 4DL7A 2JZ5A 3BN4A 3BPSP 4AQYJ 3RAQA 2J8KA 4NMXA 1HHTP 4ZJLA 3VMWA 3AXMA 4PUOB 2RRAA 3I0RB 5CZXA 1UETA 5KG0A 2EKNA 5KG1A 4WFNQ 3VAJA 4DS5A 3TRGA 3LAMA 2ZH1A 4OJ6A 4MAKA 5LMNF 1WSVA 1BHEA 2VASA 3K5MA 3OXGA 1WHVA 2RDJA 3TEGA 3ZZRA 4ELVA 1WC0A 2FD2A 2FVSA 4WP8A 3MOJB 2UXCJ 4ZPVR 2BKOA 2NXCA 2B9YA 3ZTPA 3KLHA 1FJ7A 1XNRJ 1E6YA 4OHWA 1NEEA 1V9OA 1WC5A 1UW9A 4YY3F 5F3ZA 3H40A 1WOSA 4DV7F 2BJ9A 2DNGA 4KH1B 2GHPA 4UQGA 1YTYA 2HFNA 4EEYA 1U1KA 1VK3A 3EX7B 2I2YA 2YXLA 3C46A 4F2RA 2DD8S 4I2PA 2RIJA 5L39A 1R31A 2V2KA 2VJIA 5AXKA 3TUIC 2UVEA 3Q8UA 2UU9F 2HMIB 1FHTA 2FJWA 2MSSA 3KK1A 2FJEB 2QLBB 1N6QB 3DYAA 4RW7B 2XMUA 4I84A 4DV4J 1TKXB 2CQ4A 4LVNP 4L73A 1DQAA 3EDRB 1SKSA 2Y0BB 3BKTA 4M5GA 2GGPB 2IC3A 3KOAA 4PZVA 4OYZA 3ZO7A 3ZTQA 5KFAA 2KFYA 3T1YF 1P9QC 5H9FJ 1TK8A 2OH2A 2O1PA 2V4JB 4FNHA 4DEZA 1RZMA 4HR2A 5H9EJ 2G2ZA 2Q3PA 1Q8KA 3AY0A 1C4AA 3PNIA 3P8BB 4ZK7M 4RU2A 4B3RF 4PG6A 1HNZJ 5L38A 2ZUAA 5ADZA 2EKYA 2FHJD 4DFPA 1CULB 2J0QD 3OHAA 1Q5YA 1SH3A 1WG1A 2KT3A 3G82B 2CZVC 3RJMB 1QAJA 4ED8A 3E2EA 1RHQB 1U0HB 1N0UA 1GMVA 3DXSX 3BR8A 1UVLA 2F8HA 5AJ3J 4LF7J 5CYMB 4BC9A 5CH7B 4DQQA 1M5KC 3QJPA 3SYJA 3QBCA 4GO5X 4I64A 3OPKA 3NNCA 4OHYA 4LQ3A 2YKOA 4PYDA 4Z03A 2BOAA 2YKPA 2YQ0A 2LEAA 2VQEJ 3OT9A 3H20A 4X65F 5HROA 2ZVIA 1X4DA 1F9FA 3W1YC 4ER8A 4ZVUB 1XMQJ 2W7PA 2HBYB 4LR9A 4IRCA 4DR6F 4WE1B 3OVAA 2R7TA 5C5JA 2N4CA 3C6UA 2OPPA 2QX3A 3M8QA 2HNZB 3TEHB 1PO6A 2XT2A 2C1EB 2AJ2A 4DR3J 1RT1A 1QAIA 4KQZA 4IR1A 4UW2A 1IBMF 4FYXB 1WACA 5T7LA 4ECVA 3QSYB 4PPZA 1EB0A 3AOCA 2DPIA 3K5LA 3FCWA 2UZAA 5KG6A 2IYGA 2VG6A 4DJBA 3TZYA 3IRWP 4A8MP 1FKAF 4CNZA 2IJFA 5HJYA 2ALZA 1YBUA 2R7RA 2XHWA 2VJJA 3PRVA 5DDPC 3R8YA 1JTAA 1GK8A 3TNVA 3PX6A 2RT3A 1FF2A 2JEGA 1KVIA 2PMZD 4ZPWR 3HX9A 1JLGA 2FHMA 3AJDA 2QO3A 4L3NA 4OHVA 4KSEB 2CA9A 3RRHA 1VISA 3FEZA 3I0SA 4DUZJ 2AW0A 2VD3A 4XTTA 3R2CJ 4Q2MA 3M9MB 1D8YA 2E9ZA 5G0RB 5RUBA 4YC5A 4AVZA 1YSJA 1TL5A 3ML3A 3ONQA 4C7QA 4ZHRA 2LKZA 5L1KA 4BLGA 3UW0A 1CLWA 4IOBA 4LVOP 1U8SA 4USKA 1NB2A 1O6XA 2IYIA 3E01A 3U27A 3WX8A 1VC5A 9ATCB 3TZZA 3D2WA 3RB6A 2BOPA 3DLHA 4NCBA 2XS2A 1S1TA 2ZBCA 3MEDB 4F04B 2ZOMA 2OIHA 1Q53A 1FD8A 2HKEA 2KG1A 2MZTA 3PW5A 3ILJA 2LQBA 1IBKF 5KFTA 1R7IA 1SJ4P 4BWMA 2BR0A 2CZ9A 1SJQA 2MSTA 1RHMB 1U1NA 3GSDA 3CC4S 1VBKA 3Q8QB 1RWWB 3PJXA 1NRKA 2YH1A 5E3AA 1V6HA 2M5YA 1SI9A 1T0TV 2W8KA 1LOUA 3VAGA 4KJIA 4LSZB 1RAHB 2VBMA 3ITHA 5BR8F 5IT9U 3FUYA 2OKQA 4G3IA 3KLIB 3PTWA 1P6TA 2O66A 1UWAA 4ZN1A 4QYRA 1DY3A 3RB4A 1DLOA 1FI4A 3VSVA 5J1EB 4S0MA 4IR9A 2XMVA 4P2XA 2I9SA 3T6JA 4B3MJ 1EETA 1FRHA 3M2VB 3EXCX 3HSJA 4OI6A 4CYUA 3NAHA 3M6VA 4LRAA 1HBOA 3W63A 1B3TA 5I4MA 2QL7B 4Z06A 5E3PA 4TYBA 2MKJA 4CYUB 1TL4A 4ZS6A 2HFZA 2UUTA 3MUTP 1YJVA 2OPSA 1V5IB 2CXEA 2C2MB 2X3DA 3MECA 4LSLA 4X2BA 4J5OA 4PQUB 3POTA 5THWA 3NKYA 3OL6A 1UTAA 3UO0A 5J1PA 4YR2A 4F4KA 4PQUA 2YKNB 1GXUA 3UW1A 2YWHA 1QCXA 2IY5B 3QGHA 4MKVA 2NXEA 4J9RA 2YNHB 2MKSA 1O5JA 5D0HA 3SV4A 4DV2F 1JMTA 3CJ0A 3O3LA 1LWEB 4WK3A 1HQUA 4JYAJ 3V81A 2QMWA 3NGKA 2GQQA 3K17A 4U7CA 1N56A 4RW8A 3NGRA 4LFCF 4KPCA 1DTTA 3T1HJ 3NEKA 2MQLA 4ICLB 1KKHA 2CFXA 2EK6A 2OEKA 4WIIA 2ATLA 3R5GA 3BGFA 2HQCA 1WF0A 2K1RB 3NWGA 5HO4A 3TQEA 1HHSA 3GP9A 1FD2A 3IBWA 2DHGA 3MM5B 3DKDA 1IKVA 4O3QA 2OD4A 4BC7A 3OJSA 3G96A 5LMUF 2YH0A 3V6DA 2BA9A 1L3VA 4CCHA 4FPIA 3HHLD 4NLOA 4O4GA 1QSLA 3DLBA 3D6MB 4NLQA 4J91A 2KU7A 2JRSA 4C2MA 1OIAA 2VPYB 3KK3B 1W7WA 3T1AA 1QRBA 2FLOA 4URGA 2HBRB 4OYPA 3UCZP 3TAMB 3QRRA 1NJZA 2VBEA 2J6TA 3MEDA 3W61A 3KLEB 1K9MT 4X64J 1RE1B 1TV6B 1GMWA 2HG4A 2BVZA 3OR1A 4TU9A 4H4OB 1R0AA 3H5YA 3K58A 2VKRA 2KJVA 1AFIA 1U2FA 1B4SA 1U2RA 2W2OP 4KC5A 2P8IA 5DLGA 4N76A 2O1DA 1XK8A 3BR9A 3IGVA 2QZAA 2QSWA 3K2YA 4AD6A 3BQ2A 3MEEA 3WZ0A 3TARA 4C0OC 5ETVA 3Q0AA 4B3MF 1LKZA 5IOLA 4NLRA 3UNGC 2W25A 1R8PA 4Q8FA 2MJNA 2D9PA 1G4CA 4PG7A 2HNYB 4ZP8A 4OI0A 1Q7LB 5EX3A 2BACA 4A4JA 3AH6A 3LH2S 3C6TA 5D4OA 2XQCA 4XKVA 3CDWA 3MR7A 3UE2A 2VHGA 1S6OA 3M6WA 1O8EA 3BPDA 2QL5B 1FCAA 4C11B 3GV7B 2VG6B 2WVEA 1DAXA 1TVRA 3TA1A 2Q66A 1HR0F 2HZCA 4YDDB 2XSJB 2BMBA 3UQSA 3N6ZA 4RUBA 1MG7A 3VMVA 1IBKJ 2HRTA 2X51A 3PKMA 2QY1A 2DH8A 2WVDA 3IRXA 3MMCB 3VWSA 3RBDA 4LR8A 2BRLA 4ILRA 2G0JA 3BJYA 3RB0A 3OR2A 3G82A 3I4HX 3OW2R 1TAUA 4JI8F 3OSNA 4WE1A 3H0PA 2P6TA 3GYNA 3SEOA 2E9RX 1VJWA 1N5SA 2EXUA 2ZC3A 3Q8RB 5GMKa 3SQVA 4TLQA 2FVRA 2ATCB 2YKMA 3H09A 1LFPA 3MUVP 1MLAA 1EAYC 1MWQA 4JI6J 1S76D 1O8BA 2BANA 2CWXA 4LF8J 3A3NB 4NX9A 2HNYA 5D78A 3CTRA 1NK9A 2EG1A 1PAEX 2OSRA 5I42B 1R8HA 2XBPA 1OPIA 2KI2A 4DV0F 5CXTA 2XY6A 2DXEA 1MN9A 2ASJA 2HBQB 1KONA 8ATCB 3KNGA 1O8IA 1CULA 4ZCMA 2FZGB 2DNYA 1FRMA 3CO0P 3GCXP 4H4OA 4P2SA 1R0AB 3PO5A 1TMMA 5KT6A 1IM4A 2L9DA 5HI7A 5J2QA 3FBEA 2A10A 5J1NA 1S1XB 3PW4A 1S49A 1PGZA 2PI5A 3KMQA 4KO0A 3S6EA 4K4ZA 3TX0A 2O5DA 1QE1A 1FKPA 1RHKB 3RAMA 1EHWA 1OQ6A 3HI9A 3P96A 4ZPBA 4M63A 4UTGA 3TAMA 2AZ1A 4F7VA 1YHQS 3I5BA 1U09A 3BSAA 4GKKJ 2B8PA 4USIA 3MEEB 3R5CA 3G71S 3NL0A 2BM6A 3Q89A 2DXFA 2ZWOA 4MTPA 1C2PA 4W4MA 2OFHX 5E3QA 1H7WA 4ENOA 4HDGA 5IT0A 1N6QA 2EWEA 4TY8A 2CNKB 2I1RA 3MDFA 2VB6A 2C3OA 2HSEB 3FK4A 3PR5B 2AJFE 2NCKL 2LFVA 3QT5A 1TK5A 2AD9A 4OJOA 1JKHA 1OY8A 3UDVA 2O17A 3IN5A 4AUKA 2V8PA 3UI3A 1QA2A 1SKWA 3SXLA 4O0IA 2V5IA 3KK3A 4DSEA 4ZA1A 2LYVA 4DL2A 2CQIA 1U1LA 2GA7A 3K5NA 4BDPA 4M5NA 2Y8YA 3HHKA 4JV5J 1HKAA 3OUYB 1YRXA 4OHZA 3LA0A 5AE2A 3JAMU 4PMHA 2RHQB 3ISND 1QLNA 1FDNA 2SXLA 3UWTA 1QD1A 2CDQA 1NDLA 1IR1A 1QM9A 1WJ9A 1N5TA 2K8GA 4YEAA 1S9FA 4LMZA 4B3RJ 3OTBA 5C42A 4X84A 1FRLA 1H0HB 1S12A 3I4PA 2D41A 3GYXB 4KKOB 3I9ZA 3W60A 3H5SA 4ETZA 3HK2A 2VG7B 2AWZA 5SZTA 3M2RA 4LF4J 1I94J 3HPOA 1JNZB 2NYIA 5IWAF 1SC6A 4FS1A 1X31C 2LXFA 4WPAA 5K20B 4DR1J 1SB6A 3T5HA 3AK5A 4DU7A 3V81B 1FNOA 1SH0A 4R0JA 3CJKA 3SCKE 2QEXS 1EETB 4RNFA 1RT6A 1MMNA 3IBCB 3MAHA 4Y2CA 2AJQA 1SKRA 3MOZA 4DFKA 1HBNA 3JQKA 1DLOB 4YCQA 4H4MA 3SV3A 2V67A 4UY85 4O44B 1T3OA 2ZD1B 3LP2B 2VV5A 4XLCA 4MJKA 4NE9C 4KYZA 4CLKA 4TU8A 5DNSA 4A8WA 3HHEA 5HMWA 4X62J 1J5OA 1S1UB 4F0MA 3J80Y 2GMHA 1WMRA 3HHLB 4QW8A 1EP4A 2RS8A 2D69A 2XNQA 2G13A 4OZNA 5SUHA 3RBZA 4K4SA 1LW2A 3MD1A 3K7RA 2CJKA 2AYGA 2ZE2B 1WEZA 2XWXA 1VQOS 1HI0P 2VPZB 1CPZA 3BN7A 1XC9A 4P71A 5J1EA 4QR0A 3T5LA 5IC4B 1VK8A 4B9SA 2KFNA 2FB0A 3CCTA 1KS2A 1RTIA 4A8SA 2APOA 4B9UA 3B4DA 3U02A 3GILA 4O3RA 1SBRA 3U7JA 1BN8A 3H2LA 2J8SA 2JVOA 3IR5B 3KXDA 4MKAA 2UUAJ 3MMJA 5CZVA 2LEBA 3O44A 2W9BA 3P4UB 2HVIA 8RUCA 3WIUA 4R8UB 1IUJA 4JI5J 2ZNZA 2HPUA 2FY8A 3IP0A 3E8OA 4NLXA 1UVKA 3MFIA 4JI7F 1WD6A 2ZBQA 5KFYA 4DCOB 2UV8G 4HVZA 2KXHA 4KB7A 4P2MA 2CAJA 4ERDA 4QR2A 3ZZ0A 5JVGQ 3CCES 1C0UB 2NZCA 2A6MA 2PA3A 2VBWA 4O3NA 1W26A 4AYBD 1NK7A 4XLEA 2MKHA 3EM1A 4RUHA 1IBMJ 1HWJA 4TY8B 2E5HA 4YB1P 3HFVA 5EWEA 4EI2A 2HVZA 2VDHA 3FEXB 3T19A 3FKBA 3SQGA 4F8RA 2XM3A 2CNLB 3JTNA 1VQ9S 2MY8A 1CJVB 4ZP7A 2VJVA 2E9TA 1T7PA 3EZOA 4KGXB 1ZAXA 4KGVB 1WTBA 4OI2A 3Q23A 3G8QA 4HH0A 1GTEA 4IH7A 4LF8F 2M9KA 4DLEA 1TKDA 5J2NA 2G0IA 4CO2A 4IFVB 2RJZA 2CPXA 1TL3B 1M1KT 5J2QB 2HRUA 3W8GA 2F7VA 3HP6A 1N34F 1G3OA 2GO9A 2WOMB 4KFBA 3SSRA 2EI5A 2Z2LA 3PV8A 4UY8T 3Q8SB 1EE6A 3OFEA 4MFBB 1S6UA 1WC1A 1X9WA 1AYEA 3I32A 4ZIWA 5CYMA 2BXJA 1QTNB 2KVIA 5IZHA 2UVVA 2HWHA 3DHWC 2PE8A 5KFQA 3U1NA 3LMWA 2OPPB 1XBWA 3MAAB 4B3SF 4XK8C 4FF1A 1KTVA 4NA3A 1HFEL 1RLDA 3EUNA 3CJ5A 4C11A 1V3SA 4IFYB 2KT5A 1WORA 4LFAJ 2UUBF 3JX8A 4P7TA 3KHLA 1I94F 3ZZPA 2RE1A 4RW6B 4NI2A 4KHRA 4PRFA 1QDUB 3UNYA 4RW4B 4DU8A 3HHNB 3CEDA 4RX6A 2FPHX 5A6WA 4YHHJ 4DCPB 2LVWA 2CQGA 2PI4A 2GGPA 2IC3B 1RA7A 3GJRB 3HT0A 1CQNA 4USUA 4EUVA 3K89A 5HANA 4EBEA 1Q82T 1KVKA 1CJTB 1TU0B 2RUSA 4JI2F 2B7CB 5DM6Q 1MWYA 3X3UA 2HK3A 3OD2A 5U47A 1ZYQA 4RJVA 3JXOA 2XTJP 1NZAA 4KFBB 1JJHA 4NLTA 1MN7A 3PJ9A 5DG9A 2E7WA 4YEJA 1Q4RA 1T03A 1TV6A 4QIEA 3TA0A 2UVUA 1URRA 2YKQA 1JLBB 1A7GE 2MZJA 2XLJA 1KOHA 1RJJA 1RT7A 2W4CA 1DABA 2HZVA 1S9EB 3IR6B 2CDRB 1SL1A 1RTZA 2J6UA 5HVHA 1RA6A 2CYYA 1N54B 3DRRB 3QT6A 4ZDNA 5HQLA 5KFEA 1VI7A 3CCRS 1AT1B 3QIPA 1FDDA 1KDNA 1JQGA 2MPUA 4OYAA 2INUA 1UEVA 5CHCB 3TW0A 3LYCA 3DYAB 4UOFA 5T14A 2WBRA 4USHA 4NLUA 3BH6B 2OHDA 2HMIA 2BZ2A 3A8KA 2OSQA 3FBFA 3LP0B 3PYEA 5HLFB 4AXIA 3VGUA 3A12A 1RKIA 3HULA 3V2UC 3ENWA 1H2VZ 4AQYF 2VFUA 4RNOA 1ZM3A 3W9HA 3T1HF 2VOOA 4G1PA 1DTTB 4U4BA 1RTDA 2BDPA 1F6TA 4F02A 2F3JA 4EK2A 2VJUA 2PSZA 3R5JB 2O67A 1E6YB 5MLCV 5E3CA 4NMLA 2X85A 5BYSA 1RP5A 4I4BA 4DOZA 3GQ8A 4NLSA 3PW7A 4F2SA 2DNKA 1FDAA 5F8NA 1IKWB 3BBFA 3U1MA 4F4AA 3V6DB 3AODA 5HK4A 3EGNA 1WUUA 1GFWB 5HMYA 4JI0F 1EZGA 3R97A 3UN2A 3MECB 4ATNA 2YPZA 4XR6A 4OZ2A 1R8CA 2IMWP 3MR6A 4L75A 1B0PA 5AE1A 3TZXA 1QUPA 4YEIA 3F56A 5B0GA 3ENVA 1K5CA 2AV5A 2B5JA 4NXNF 4O3SA 1HHQA 5CYJA 1LW2B 2DHAA 1QJHA 2JOQA 4MK9A 4A46A 1TR0A 3M2VA 4EMDA 5L1JA 1JJ4A 5A0YB 5CABA 3H2UB 4LRDA 1H2UX 4YHHF 4LFBF 2KFZA 1OSCA 1ITPA 1V5VA 4V1Ak 1KRPA 4N56A 2CPHA 2LXIA 5ETLA 1OY6A 4OJ3A 4DV1J 1VRUB 3CCSS 3PEHA 2EFQA 4ECTA 1X4FA 3IG1A 4WK1A 2VIHA 2C2KB 3NAWA 2W4DA 1KWMA 2CQCA 2LXUA 3UCGA 3CJKB 5D3GA 1NAQA 3FRZA 2OGUA 1MMDA 1FKOB 1WEXA 3S01A 3TUZC 1B7YB 1RTJB 1UP1A 1TTHB 4M5DB 5F8JA 2NTQA 2HVHA 4AL6A 3DMJB 1A0OB 1HL6A 4YQWA 4MYUA 1NKCA 2E1PA 1VS3A 2VG7A 1R8BA 1X4AA 3M6XA 1AROP 4RUAA 1DBGA 1RMGA 1DBOA 2BBEA 4HACB 4NEYA 2UUWA 2DRDA 2FLLA 2KTQA 5KFBA 5GVQA 1Y0HA 4ZVPB 4JUZA 4DV6J 1KC8T 2GVDA 2YWWA 3DHXA 3LQVA 5G0RA 1N52B 1H80A 4KT0C 3SCLE 4U6PA 2X1AA 3VGVA 1YJWS 4NLGA 1MSWD 2FIUA 4KGMA 1S1WA 2C28A 2VBYA 1GEHA 4G6VB 1DHMA 2Z4PA 4ZVEA 1KOOA 1F1BB 2W2PP 1I51B 2Y3YA 3M32A 1S57A 1GQ8A 4XKWA 3FCVA 3QWPA 3UR3C 3OQ2A 2R2RA 3CUNA 2PC6A 2Z2YB 1OFMA 4UOCA 5IQQA 4ECUA 2BQ3A 2ZZTA 1S0VA 2AJ1A 1IVZA 4XPCA 2QYGA 4DV1F 4Y2AA 4U67Q 3FSIA 3W62A 3KLGB 4F67A 2QMUB 2E5IA 3N28A 4TLRA 2QC3A 1HNIB 1RT3A 1RSCA 5CD4H 1Z2ZA 3HKZD 3IBFB 5F8MA 3UD3P 1YJUA 1L3UA 3RIQA 2FJVA 1C1CA 2EFGA 2MQ8A 4NCGA 5F3TA 4R5PB 4HWVA 1Y11A 1IQZA 5D8HB 3NS6A 3DOMA 2YWEA 3B6BA 2E1MC 2Y1RI 3R7NB 2FZKB 4J9KA 5K8MA 3ZPPA 3B4MA 1L1IA 1HMVA 2ACMA 3RUBL 1N48A 5DQGA 4UZBA 1HW8A 3WQPA 1IDJA 1IKXB 1VQLS 1WF2A 2J8IA 5KFKA 1RYSA 1TZ0A 1X5OA 2DNZA 2IPOB 3C6UB 4MK7A 4DR2F 1YRTA 4FZVA 3CGIA 4JV0A 1UFWA 3QO9B 4I6AA 5F9NA 1FEHA 3FCHA 4ZPDA 2XY5A 4YDTA 3FSXA 4X66F 3I87A 4I2QA 4C4WA 1JLFB 1MU2B 1B64A 4URQU 1HD0A 2V2QA 4OZ0A 1FRJA 1WDDA 4ID5A 5LOQA 2E1RA 2GX8A 3M6UA 1S99A 2G4BA 3BGUA 3PZPA 2R7SA 3TA2A 2KZMA 1WC6A 1Y9OA 2BRKA 3DOLA 4BHQA 2HFUA 4X4QA 2UXBF 2B4UA 3IS9B 3SDEA 1P1LA 2UVFA 4HLBA 3PIPQ 3M1VA 3G86A 4OV1A 5ETTA 4ANEA 1T9YA 2YNIB 1UZDA 1VR6A 4EZ6A 4DPUA 4J9MA 2KJWA 2FYXA 5CA5A 2PFFB 1HD1A 4QCLA 3D28A 2PEBA 2QMXA 1R6VA 2VU5A 4GC6A 4EWTA 2XTYA 1U26A 3HKWA 3HZEA 4DN0A 2IVMA 4K7QA 3MEKA 3L95X 1HNVA 3ILLA 1EJ7L 2FHOB 2ZDPA 3LTOA 2AJ0A 4ZPTR 2C2RA 2IAJB 4J9LA 2PD1A 5EX0A 3H7HB 1CZFA 2ODLA 4K2XA 2MHNA 4QIVA 1PJ5A 1SQEA 1PYSB 2KM8C 4OZ3A 2XO7A 4IOAQ 1Q79A 4PYAA 3W66A 4DV5J 4IG3A 5AXMA 5IWAJ 3B90A 2XZTB 2JEIA 2DNNA 5L1LA 2DYAA 4OJGA 3N6LA 3FRYA 1CEZA 4ZVFA 3BDPA 4X4TA 4OI3A 4ED7A 2B9WA 2QZ8A 5J2NB 2E7XA 3ZTSA 2V4JA 1RWNB 2DO0A 2B0RA 4RNMA 2DB1A 3D1HA 4V19J 2LDYA 2CZ4A 3D0IE 4BWJA 1TUWA 3BBBA 2VFQA 5A8KB 1AA1B 4GO7X 4DS4A 1KQSR 4DV7J 4C2LA 2OPQA 1YDLA 4IG0B 2ZH5A 4YELA 3PG9A 2BJ8A 3I9V9 1KFDA 2CPDA 5JXSA 3FC9A 4BCAA 4EGLA 5L8RC 4QIWD 2HWTA 1KEKA 2XYGB 5KFMA 4B9VA 4YFOA 2D74B 2E44A 1RWOB 1C4CA 1V3ZA 1ZBTA 2PFDA 3W2WA 4CLYA 2WK4A 4ZKAA 1WI6A 2UXCF 1MNEA 2A2CA 3JSYA 4DCJB 4CH1A 3C15B 1C0UA 4CDIA 4BBYA 3CD0A 1WI8A 1UWBA 2DH7A 2QE5A 2VBXA 4DPOA 4HTIA 5C2GA 4ZPCA 1Y3JA 5HBMB 4YB6A 5ETOA 3TUPA 1S6QB 4UT4A 3LP1B 3SY2A 4R25A 5KOXA 3HO1A 3EZ5A 2ZWPA 4ZLLA 3J7Z5 3TX8A 5H9FK 4RL1A 5HSPA 2HQDA 3CJ3A 4UZCA 4QBUA 3PRDA 1RCOB 4CWBA 1S0NA 4C8ZA 3M2UB 4ED3A 2B4PA 2GVDB 2MQQA 1ZPVA 3F41A 5B0EA 4CIOA 3NGSA 3NOCA 1GXLA 3GIJA 1NPRA 3ENAA 3GZ7A 2IM3A 3DRSB 3C3LA 4ICLA 2ZJRQ 1NSAA 3AQPA 3BKFA 3DMJA 3QNWB 3B8YA 3I31A 4L76A 1DTQB 3ETMA 4PUOA 4U8VA 1K8FA 1PSDA 3DXBA 1C1BB 3DGPA 5JLVC 3UD5A 4OV6A 4QJVA 3CJSA 1RADB 2GJIA 1HQUB 3GIIA 2I5JA 2M0GB 2OJ3A 4G1IA 4WF9Q 2UVWA 4LF7F 2KYXA 4Y2IA 3F73A 3MMBB 4Q0BA 1EQ0A 1RISA 4X65J 2L48A 2IMOA 1KBRA 5I42A 1D0EA 4ECQA 1FXRA 4XOTA 2MKCA 1UJ5A 1YZ7A 3D0GE 3AJ2A 2GW8A 4LSLB 1CQMA 4Q8EA 1APSA 3P5TL 5KG2A 4OYXA 1S0OA 3N5FA 2IM2A 3QAEA 1RT5A 3PX0A 2VC0A 1FVSA 5CCMA 2AX1A 4O3OA 2GZOA 4JI3J 2H5IB 3IWLA 1RWRA 4USJC 2GNKA 3W2VB 1FK9B 2HHTA 3ET6A 1NDKA 1QY7A 4OYMA 5D15A 3WDOA 2E5LF 1X4EA 4HHJA 4XIUA 4DFMA 5ETNA 4CO1A 4N5SA 2Z56B 2BJDA 2DR5A 2AEMA 1AW0A 2R7WA 3OXLA 4YS2A 1GAOA 2ZHBA 1CJKA 4LFCJ 3M8YA 1X4GA 1IKWA 3MR2A 4LRFA 1T02A 4M8LA 3PKYA 2DO4A 2F8MA 3VZHA 3FDSA 5DETA 4LF2A 3M9NB 1HNWF 5LXYA 3OVBA 2HHPA 2DTJA 5JUMA 1ZA1B 4P73A 5F9LA 3ELHA 2V34A 3DU6A 4XONA 2BABA 3HVTA 4OLOA 5LJ3Y 4WFBQ 1JNRB 2Y8WA 5KAKA 1HARA 2R42A 4KBIA 2QA4S 3T1YJ 2EC0A 3PFOA 3CJ2A 1T3NA 3QATA 2WSFC 2R7VA 2MQPA 5KFGA 1S1TB 2OEMA 3VF0B 3CF5Q 4H54A 2DGXA 2RH3A 5BYRA 2JLGA 1K44A 2QRRA 4OYWA 3CCMS 4B9MA 3R6LB 1ICEB 2BJEA 1BLUA 3KUEA 1ZZNA 4ZHRB 2BJ3A 3GONA 4TQRA 2FVCA 2JLFA 1KCCA 1RWVB 1LW0B 3MM6A 4K4XA 2UVRA 3CT9A 1H6KX 3DNCA 3AD7C 3I0SB 3MGJA 2VICA 4M5HA 5LJ5Y 2VA2A 1JLCB 2BM4A 2G2YA 2RMLA 2G9OA 2NTPA 2PMWA 1OFDA 2AHOB 2FGOA 4HI1A 1N36J 3Q8VA 5BR8J 1IJFB 4A8YA 4LFAF 4DR4J 4DUYJ 4MIBA 1N32F 4NA2A 2I0XA 5F0WA 2YWFA 1B99A 4XDCA 3CB4A 5F41A 5GAGU 1NH7A 3BREA 5F8IA 3G87A 3KLFB 4LBIA 2Z2MA 4CLLA 4GVLA 5KG7A 2CADA 3THVA 1FWLA 1BE4A 1M1GA 1N0VC 5GMEA 1KCDA 2F63A 3AQOA 4IG3B 2NZ4A 4JV5F 4OM9A 1S6PB 4AL5A 1JX4A 2DNHA 2IOUG 2ZDOA 4XOPA 1R0CB 1Y5NB 4K4WA 4K0KF 2GIRA 3VR1A 2HFOA 2V94A 4AXJA 4J9OA 2ERRA 1S77D 2AGQA 1G1XA 2XG8A 4M5DA 3US5A 3ET6B 3CJ4A 2CRLA 2HAFA 4RW9A 2RDIA 5MAOA 1N4LA 1P1TA 2Y0SD 4E0DA 2VFVA 2XO6A 4EO6A 4FBUA 4OJHA 2HGLA 1RTHA 2XI3A 2R3VA 4ZLPA 1PKUA 2N7CA 1TFWA 1AFJA 1O8MA 4LF6F 1WKKA 4RLEA 3HHDA 3NGDA 1SQGA 1A9NB 1FWKA 5A8RA 5D4PA 2BKNA 2CJYB 3QFWA 1D9AA 2V2ZA 5HMXA 4W98A 3SBMA 3HVRA 2QYCA 3LAKA 4YUDA 1KR4A 2QA4G 3Q2TC 2HS4A 1TFYA 3TJ9A 2CPYA 3FQKA 1FE4A 3NRBA 2ROPA 3VGTA 4C8MA 2DRBA 4FP9A 4A8OA 3J7A1 3QT7A 3AAWB 3WHIA 3Q8PB 2VOPA 5IFMA 5D0EA 3TVZA 4ED1A 4ZOSA 3JSMA 2EBGA 3GV5B 3MHYA 1IBLF 5A76A 4IO1A 2WVCA 2E29A 5JMNA 1OOCA 1IQTA 1T8EA 4ED0A 2HNDA 5M2RA 3MCNA 3MM9B 3PHEA 2PN6A 1XERA 1W2IA 4JRAC 2P9CA 1UAWA 2VF3A 3GSIA 4DDFA 3KNAA 4DX7A 3Q22A 2X6XA 3HZGA 3Q2SC 4YN3B 1KTQA 1X4BA 1Y3KA 1PYTA 1IKXA 4ZJOA 4CT9A 2ZBRA 4DPWA 4U95A 1S0MA 4USVA 2G0CA 2R8GA 3FNNA 1CC8A 1WKJA 3KG0A 5KFOA 1REGX 3R5AA 1YI2S 2AEJA 1TELA 1C1CB 3GJTB 1C0TB 4NCGB 4K50A 4ZN3A 3ZC4A 2VFMA 1HNIA 2XLKA 3CPWR 5A2QY 1G7CB 3W7BA 4JI1J 1UMJA 2CG4A 4UUWA 3X1LB 2EFNA 3C15A 2V69A 4NCAA 2WBMA 1HIYA 4UOHA 3M32B 2FC9A 2OMOA 2ALYB 2CQHA 2IA0A 4Z7YA 3RGIA 1IKYB 2B56A 4NYZA 1GH8A 1RGVA 3G6XA 1JLAB 2BSPA 2BW7A 3Q86A 4DQPA 1X0PA 3IWNC 3A3OB 3ZZUA 1U4BA 1RT4B 1IKVB 5HATA 1X5TA 1XNQJ 1KQGB 3BV8A 4X4OA 2MDAA 1VFJA 2BX6A 2KXNB 1T05B 2CQBA 3N79A 3OFHA 2ILYA 2B9XA 2C2ZB 3BO4A 3P45B 2HNDB 2CJ9A 2MKKA 1IBCB 3RYLA 1ZPWX 2WHOA 2EG2A 4L3KA 1EA0A 1NJWA 3GG0A 2P6SA 3GFXA 1A6LA 1FRXA 4OJ5A 2AIRB 3N6MA 2EFOA 3BQ1A 1J2VA 1PJ7A 1RAOA 4EBDA 2C2EA 1FJCA 4WZMA 1TUGB 4RU9A 3WC0A 2BQRA 2V0NA 1UEKA 2QLWA 2F65A 4RUCA 1VRUA 1UVMA 1OO0B 1QAYA 4C3KA 4O44A 3J81U 2OFGX 2AP6A 3D66A 1YK9A 2BE2A 3POTB 3MCMA 4A8FA 4LBPA 2ZBIA 1H73A 3T6BA 2ZH4A 1HYSB 2RB7A 1WSRA 1R43A 1RB0A 5KFWA 5B09A 4QU7A 3JTPA 4OI1A 3V4IB 4KGKA 3P4GA 1OYEA 4M95A 4PWDA 1NM2A 2W1BA 1WOPA 1YRUA 2CWKA 2XI2A 3GCWP 3IM8A 2A6OA 1N88A 4DZDA 2M2BA 4B9TA 4K0KJ 4WFXA 5LSOA 4CO3A 3M30B 4JI2J 5DG7A 3PHTA 2FHKA 5CYQB 4YZQA 3D5MA 2AJ4A 5K5MA 1GX6A 2IM0A 1VBZA 4C8KA 1AIRA 4PXBA 1T9TA 1KQFB 5KFFA 1HNZF 1XG2A 3G6YA 3E3XA 3PXGa 1R8AA 2R2UA 3GMGA 2RILA 2J0XA 2LA4A 4M94A 2F3LA 2HVDA 4L6V3 1X60A 3TANA 3AD8C 2VODA 5JMCB 1ZM4A 1K47A 3TVKA 4I69A 2EW9A 5GAGI 1XMOJ 3H98A 2E1CA 4KGZB 2EFVA 2NPFA 4DX5A 3H5UA 1WC4A 1Q81T 2NS1B 5A8WA 5LSRA 4V19X 3MCOA 3NG8A 4IQMA 1NBEB 4N77A 1RU4A 1HLWA 4ED4A 4URRA 1XR6A 1RAEB 3KDOA 1JKHB 1RBLA 2BJ7A 3BYPA 3K8WA 1MROA 3O2IA 3CDUA 3ZNUA 3EVWA 5KT3A 3BM7A 2HYIB 3N01A 4MR0A 1OSDA 1SCJB 2FDNA 4ZVHA 2QIFA 1LW0A 4C3LA 5KT7A 5IM0B 3M8SA 2DR9A 5F0UA 1UVJA 1RUSA 1RXOB 4ITSA 3J7AN 2WONA 3I96A 2XCPA 4J9QA 3CE8A 4FVMA 1K1SA 1N34J 4O3PA 3BH7B 1XQIA 3E51A 3M8PB 1TYWA 1FNMA 4CLFA 5J2PB 2R9LA 3NNAA 4X4VA 4C6AA 3JSBA 4FN5A 1JB0C 3CO9A 3ZTOA 1SJ1A 3KUGA 2LP4A 3MPWA 1M5PC 4C98A 1WG4A 2YQ3A 2DNLA 5LL6d 3CCUS 4FXDA 5GAHI 1CC7A 2MQNA 3HLUA 4DXLA 2Y1LB 3IGNA 1TL1B 3MMAB 4M5KA 5C25A 4K4TA 2Q6CA 5B0DA 4FF2A 1U49A 4KO0B 1TYUA 2DGWA 4HI2A 3UD4P 1WHXA 3I6PA 2RKIB 3VZIA 2N82B 3UCUP 2YX1A 2W9CB 2WW8A 4RWWA 4CM2A 4I1TA 4KRWA 5BXIA 1SL2A 1U7LA 2GV1A 3HDSA 4ZMMA 2GCFA 3SZEA 2FHJA 2K2PA 3DRPB 3KWMA 5F8HA 4Q45A 4G65A 2NUUG 4LF5F 1RAFB 3C2PA 4NLYA 3Q24A 2F40A 2N7YA 1EKSA 1RT2A 3PYDA 4DR5J 3A4TA 3HCXA 3ILOA 4I0WA 4DL4A 1LV5A 4XNFA 2BUNA 4ED6A 1KVJA 1WF1A 2AZ3A 3VVUA 1HA1A 3EE3A 1XNQF 2BANB 2RUGA 4DR3F 5HJXA 3BBCA 1F5BA 2L3MA 2NSCA 1UJ4A 3HHLA 5KFIA 3GPAA 3L7UA 4NASA 1B0TA 1J5OB 3AA9A 1V3RA 5I3PA 2IA6A 2DIVA 2UUCF 4IQXA 2R7UA 3CD6S 1S48A 2M4MA 1NHCA 2YNFA 1X9SA 1HI1A 2QLJB 3DGVA 5E5NA 4AT1B 1XR5A 2MQOA 1S1VA 2WB1D 1UZHA 1QVGR 5GAEI 3L3CA 3SYZA 2HBZB 4G1QA 5KG5A 1QSYA 4Z05A 2H9ZA 4Q0BB 1LFWA 2DCLA 2Z8GA 2RQKA 2HHUA 2DH9A 4YZAA 2YBVA 1RACB 4ES2A 2AEFA 2H51B 3OVSA 4ZVSB 4IOCQ 4DUTA 4DFJA 3LWMA 2ZC4A 3RBXA 2WOMA 1Q78A 2WB4A 3PEJA 5KT5A 3K59A 4EZ9A 2ROEA 3GR0A 1DTQA 1PIEA 5E33A 5L46A 1U47A 2WAQD 1FWPA 3C16A 3OXFA 1WELA 4DV3J 2NSBA 5D4LA 4ECRA 4K4YA 4QQBA 1S59A 1Q95G
chains in the Genus database with same CATH topology
2DXDA 2BM4A 1NLKL 3N90A 2VFQA 2AZ1A 3BBBA 3ZTQA 3Q8VA 4ANDA 2B8PA 4WBFA 4HR2A 3FC9A 1B99A 1KQ5A 2BM6A 2DXFA 3Q89A 2ZUAA 4ENOA 3P4GA 1BE4A 2CWKA 2BM5A 4FKYA 1NSKL 4OM9A 3NGRA 1VYAA 4KPCA 2NCKL 2W7ZA 2IOUG 4OJOA 4OPWA 3FBBA 1QA2A 3EVOA 1NDCA 3SYJA 3GP9A 2V5IA 1NSQA 1NPKA 3DKDA 4DI6A 3EVMA 1U8WA 2F3LA 2HVDA 3JS9A 4CP5A 3JX8A 4ANCA 1QA1A 1PKUA 5JMCB 2BEFA 3VGVA 1WKKA 1NDLA 1LEOA 3NGSA 2YUHA 4UOGA 2B8QA 1S57A 1W7WA 3FCVA 4W98A 1QRBA 1HLWA 2VFNA 1NHKL 3ENAA 4OJLA 3EVWA 1TSPA 3NGTA 3ETMA 3G2XA 3Q8YA 1K8FA 3VGTA 1BHNA 1UCNA 3RIQA 5JLVC 3FCWA 1HF2A 3R9LA 1ZS6A 3Q83A 3AK5A 3DDIA 1F3FA 4F36A 1WKLA 1MN7A 3PJ9A 1B4SA 4FKXA 2XC1A 3BH7B 1XQIA 3B6BA 1TYWA 3PRVA 3LJYA 4C6AA 3NGUA 3ZTOA 2DY9A 1DABA 5IOLA 2J8IA 5C7PA 1QQ1A 2BM7A 1TYVA 2VFOA 3VVTA 1TYUA 3B54A 1K4ZA 4ANEA 1KDNA 1WKJA 3EJMA 1NSPA 3LYCA 3ML3A 4V02C 4UOFA 1QRCA 4OJPA 3BH6B 3VGSA 5BXIA 1CLWA 3SZEA 1NB2A 1TYXA 1WXRA 1NDKA 2VFMA 3FBFA 3WX8A 3VGUA 3N6ZA 2HVEA 2G0YA 4OJ6A 2AZ3A 3TH0A 1HIYA 4UOHA 3VVUA 1BUXA 1F6TA 3EE3A 4EK2A 3BBCA 2VU5A 2HURA 1NUEA 3ZTPA 3H09A 1EHWA 3GPAA 3L7UA 3Q86A 3ELHA 4F4AA 3BBFA 1XIQA 3ZTRA 5CAAA 1LWXA 3MPDA 2BX6A 1PAEX 1QA3A 4O0NA 4S0MA 3PETA 2DXEA 1MN9A 1NDPA 3EMTA 1K44A 3Q8UA 3EM1A 4DUTA 2VFPA 4KH3A 1HHQA 2DYAA 4DZ6A 4OJ5A 3FBEA 1S5ZA 5CABA 3FKBA 3EICA 1S59A 1NCLA 3FBCA 3ZTSA 2B0RA 1JXVA 4JRAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXD A;  1NLK L;  2AZ1 A;  3BBB A;  3ZTQ A;  3Q8V A;  4AND A;  2B8P A;  4WBF A;  4HR2 A;  3FC9 A;  1B99 A;  1KQ5 A;  3Q89 A;  2DXF A;  2ZUA A;  4ENO A;  1BE4 A;  2CWK A;  4FKY A;  1NSK L;  3NGR A;  1VYA A;  4KPC A;  2NCK L;  3FBB A;  3EVO A;  1NDC A;  3GP9 A;  1NSQ A;  1NPK A;  3DKD A;  4DI6 A;  3EVM A;  1U8W A;  2HVD A;  3JS9 A;  4CP5 A;  4ANC A;  2BEF A;  1PKU A;  3VGV A;  1WKK A;  1NDL A;  1LEO A;  3NGS A;  2YUH A;  4UOG A;  2B8Q A;  1S57 A;  1W7W A;  3FCV A;  4W98 A;  1HLW A;  1NHK L;  3ENA A;  3EVW A;  3NGT A;  3ETM A;  3G2X A;  3Q8Y A;  1K8F A;  3VGT A;  1BHN A;  1UCN A;  3FCW A;  1HF2 A;  3R9L A;  1ZS6 A;  3Q83 A;  3DDI A;  1F3F A;  4F36 A;  1WKL A;  1MN7 A;  3PJ9 A;  1B4S A;  4FKX A;  3BH7 B;  1XQI A;  3B6B A;  3PRV A;  4C6A A;  3NGU A;  3ZTO A;  2DY9 A;  5IOL A;  5C7P A;  3VVT A;  3B54 A;  1K4Z A;  4ANE A;  1KDN A;  1WKJ A;  3EJM A;  1NSP A;  4UOF A;  4V02 C;  3VGS A;  5BXI A;  3BH6 B;  1NB2 A;  3FBF A;  1NDK A;  3WX8 A;  3VGU A;  2HVE A;  2AZ3 A;  1HIY A;  4UOH A;  3VVU A;  1BUX A;  1F6T A;  3EE3 A;  4EK2 A;  3BBC A;  2VU5 A;  2HUR A;  1NUE A;  3ZTP A;  3GPA A;  1EHW A;  3L7U A;  3Q86 A;  3ELH A;  4F4A A;  3BBF A;  1XIQ A;  3ZTR A;  5CAA A;  1LWX A;  3MPD A;  2BX6 A;  1PAE X;  4O0N A;  4S0M A;  2DXE A;  1MN9 A;  1NDP A;  3EMT A;  1K44 A;  3Q8U A;  3EM1 A;  4DUT A;  1HHQ A;  2DYA A;  4DZ6 A;  3FBE A;  1S5Z A;  5CAB A;  3FKB A;  3EIC A;  1NCL A;  3FBC A;  3ZTS A;  2B0R A;  1JXV A;  1S59 A; 
#chains in the Genus database with same CATH topology
 4W8S A;  1Q8B A;  2H65 B;  4DG1 B;  2J6S A;  4F3M A;  1D9D A;  2RSQ A;  2B6A B;  3KRG A;  1KQ5 A;  4PXC A;  3JAM Y;  4DPT A;  2E7V A;  1RAI B;  2HLU A;  2NTB A;  5ETM A;  1PC4 A;  2V6A A;  3UPF A;  1NHV A;  1IA5 A;  2VA3 A;  2CJX B;  3RW7 A;  1YJ9 S;  4CT8 A;  3U1L A;  1KSP A;  2R4F A;  3TYT A;  1DUR A;  2EVZ A;  1REV A;  2I38 A;  4TVA B;  5IT4 A;  4PG5 A;  3EDQ B;  1Q0N A;  3KG1 A;  4P74 A;  3MM7 A;  4XLH A;  2EFP A;  2NPI A;  4ECX A;  2BYC A;  3FBB A;  5DZ6 A;  5KTQ A;  4ZCK A;  3T9Z A;  3GFH A;  3EYZ A;  4JYA F;  1JXE A;  1J5E F;  1ZAW A;  3CCL S;  3AD9 C;  4E8U A;  4YOE A;  3T5K A;  1REV B;  2V2V A;  3KFW X;  2ZJP Q;  2C2D A;  2MGZ B;  5A2Q U;  3QGP A;  3DLJ A;  2XY7 A;  3NP5 A;  1Q86 T;  3VST A;  5KFN A;  3JSR A;  2JJ4 D;  4TYA A;  2W9B B;  2H1Y A;  5ITH A;  3QIP B;  2XCA A;  2OPR A;  4LRB A;  1CSJ A;  1LEO A;  1XWL A;  2V8V A;  1HWU A;  3IMQ J;  2KO1 A;  4NWB A;  4C48 A;  1VQM S;  5HVF A;  1ZTT A;  1HNW J;  3MM5 A;  5FLX U;  1JLE B;  4QPX A;  3D7S B;  1HQE A;  4F50 A;  1VQ8 S;  1S9E A;  1QJV A;  1D09 B;  1FKP B;  1S9G B;  1X7V A;  2NST A;  2GHV C;  2Z30 B;  4DQS A;  1VQP S;  4W90 B;  1JLB A;  2G2O A;  2VFT A;  5D6G A;  2DR6 A;  4FYW B;  4WTY A;  5C24 B;  3CJ8 A;  2HHH F;  5DO2 A;  3HXM A;  4CO5 A;  4WFA Q;  3GV8 B;  1IWG A;  3TZW A;  1Z4U A;  2DNQ A;  5G4D A;  5EUH A;  5B0A A;  4X4R A;  3KMS A;  4ZJQ A;  4NLV A;  3DDI A;  2F4V J;  2EK1 A;  4KIA A;  2K7K A;  4P10 A;  2ZZM A;  2BKP A;  2J7U A;  4ZP9 A;  1T94 A;  3D1O A;  3D3B J;  3HMJ G;  1VRQ C;  2DGQ A;  4DL6 A;  1M5S A;  4WIQ A;  2DGT A;  2C2O B;  5KFU A;  3NGU A;  2UUB J;  1X0C A;  1D3W A;  2MMY A;  2MKY A;  4Q7A A;  4WP3 A;  5DGB A;  3V6J A;  2L41 A;  4XLF A;  3M9O B;  4KR0 B;  4OYO A;  2YNF B;  3O6Q A;  4J9N A;  4PAA A;  1LLZ A;  4H4M B;  2IQ7 A;  1MW7 A;  3GIR A;  3QZ8 A;  4QYZ K;  4MIA A;  2Z2Z A;  2VG5 B;  1K4Z A;  1RT6 B;  1KHV A;  1VQS A;  1WHY A;  2KRB A;  4EU0 A;  2KHC A;  5K14 A;  2XMA A;  4OZL A;  3EPG A;  1D1U A;  3PY8 A;  4NPO A;  1FT8 A;  1HBM A;  2IRU A;  1UEU A;  2R8I A;  2RU3 A;  1WXR A;  5KFD A;  3GIK A;  4C8O A;  1N32 J;  4OX9 F;  3IRX B;  4DHV A;  4MIW A;  3NB2 A;  2VPX B;  4G1Q B;  1NPP A;  1F60 B;  4UST A;  3BB5 A;  3DOL B;  3SSQ A;  2J9C A;  1FER A;  3SCI E;  2UXD F;  4USM A;  3OSP A;  3RR8 A;  3GRH A;  1UFL A;  5C42 B;  4PXE A;  1TVR B;  3V4M A;  2HWI A;  1U24 A;  2FJD B;  2QA1 A;  2QLX A;  3ZZT A;  3OFF A;  5K9F A;  4YME A;  2AKW B;  3GQA A;  5AMV A;  4MH8 A;  3IC1 A;  3QPI A;  4PQA A;  5JJB A;  3D6T B;  1DQ8 A;  6AT1 B;  3ADA C;  4JBC A;  2VZ9 A;  2CQ2 A;  2DIU A;  3UR0 A;  2RHS B;  7FD1 A;  4GKK F;  2R7O A;  1LXJ A;  3GFY A;  3DLK A;  5K8N A;  3DM2 A;  5HP1 A;  4BS2 A;  4N8N A;  1S7H A;  2DHX A;  4ES1 A;  1RT2 B;  2CPZ A;  1VGY A;  1FEE A;  2XZD B;  3GLJ A;  1NJI T;  3PET A;  3RW6 A;  1OGM X;  1S4F A;  4IO9 Q;  5J2P A;  4P7V A;  3KHH A;  3NCP A;  1HQ2 A;  1U0S A;  2ABY A;  5E7O B;  3CC2 S;  3OHB A;  2IM1 A;  4D3G A;  5GMD A;  2V63 A;  2HHV A;  4MXN A;  3EIC A;  5AXL A;  3W65 A;  4DV0 J;  4DLG A;  4ID8 A;  1X9M A;  3EGW B;  3HJF A;  3MR3 A;  3IM9 A;  3LPY A;  4YB5 A;  1VBL A;  2JDJ A;  3HJV A;  3DLK B;  2VUG A;  3AOA A;  5CQG A;  1ZAV A;  3VQS A;  2PYH A;  4QWD A;  1NXI A;  1OS5 A;  3IFE A;  1RWX B;  2ZH3 A;  1ZH5 A;  2AU0 A;  4P9S A;  4O4G B;  4OLP A;  2X3H A;  5T41 A;  3W5Y A;  5DQI A;  1ZZF A;  1IB4 A;  1KP6 A;  4I7F B;  1F3V A;  4DQR A;  4JI8 J;  3THT A;  2Q6B A;  5IXU A;  1IN0 A;  4FKY A;  3QFH A;  4KAI A;  4U7U K;  2MLY A;  4Y34 A;  4TQS A;  4H4K A;  1T9W A;  1YJN S;  2ASY A;  5FD1 A;  3QID A;  2G1H A;  4DR6 J;  4W8R A;  4IDK A;  3OTD A;  1VCT A;  4PPD A;  3DRY A;  2XNR A;  1ACM B;  4CP5 A;  1HBU A;  2HFV A;  1SIW B;  3C14 B;  1QTM A;  4GC7 A;  1YX2 A;  2B4V A;  1EP4 B;  2YKM B;  3BSC A;  1LWC A;  4PWU A;  2YNH A;  3PRB A;  4KH0 B;  1X5S A;  1ZM2 A;  3UDE A;  5KT2 A;  4ED5 A;  3W3S A;  1S7I A;  3KKF A;  2B8Q A;  3CJR A;  4C9D A;  5ETK A;  1H7X A;  1BXN A;  2DT9 A;  1UVN A;  3AT1 B;  3GR1 A;  4FXV A;  3D3C J;  5KFP A;  1HPZ A;  2AYB A;  3D4J A;  1HG8 A;  1HBN B;  1QUV A;  7AT1 B;  3V6H A;  4KV8 A;  2KKH A;  3R7B B;  2L9W A;  3FJ2 A;  4Q2L A;  5CYQ A;  1L3T A;  5L9X A;  4B3T J;  2HHQ A;  1LK7 A;  3NBP A;  2PMH A;  2IVY A;  2XZW A;  1NKE A;  1TMJ A;  3GE9 A;  1UCN A;  1BQN A;  3AOB A;  4ETX A;  1NB7 A;  1F3F A;  1WKL A;  3DC2 A;  4WCE Q;  1C1B A;  2M8H A;  3DGP B;  3EZU A;  4Z37 A;  3SZ2 A;  1SJF A;  1BC6 A;  1SL0 A;  2NUH A;  5FII A;  2ZHA A;  3CDE A;  1O8D A;  4RR5 A;  2BV3 A;  3TOQ A;  4OZY A;  2DY9 A;  4DSK A;  3CUL A;  2XYH B;  3MFH A;  1HQE B;  2IBO A;  3LAL A;  3MEG B;  3NMA A;  1KTW A;  3KK2 A;  4DSI A;  3PFE A;  1PG5 B;  3QSI A;  4TN2 A;  3UN5 A;  2WCX A;  3VVT A;  1VQ5 S;  4DSL A;  1T9X A;  2UV8 A;  3OUY A;  2V8D A;  3G8S A;  2FLP A;  4DF4 A;  1IR0 A;  4OJP A;  3TQ1 A;  2R8J A;  1RBO B;  1O8H A;  4FYY B;  5IQ6 A;  2YWG A;  3MD3 A;  4H4K C;  5KFJ A;  2RNE A;  3LF0 A;  5C24 A;  4RNN A;  2HVE A;  4RBV A;  2JLE A;  1OPZ A;  1ZOT A;  3DLE B;  2HQ3 A;  1NJX A;  1TKT B;  4NK6 A;  4X4N A;  2GVZ A;  3MM8 A;  4CO0 A;  1RHR B;  3MCS A;  1OJ4 A;  1U6B A;  4LF4 F;  4NXM J;  4WXO A;  5ETP A;  4MK8 A;  1VQY A;  2XMT A;  5KOW A;  4GKJ J;  4B3O A;  2B51 A;  3PW0 A;  1UW4 A;  3PW2 A;  3J80 U;  3GWC A;  3CCJ S;  4DL5 A;  3VQT A;  2HUR A;  2RD5 C;  2V5H G;  2DKO B;  2XSF A;  1OY9 A;  4CRJ A;  2DVI A;  1L3S A;  4QIF A;  2BQU A;  1XN9 A;  4X66 J;  5B7W A;  1UA1 A;  4OZ1 A;  2WVF A;  2WZ1 A;  4ECY A;  5ETQ A;  3ZTR A;  5IV3 A;  1LWX A;  2WSC C;  3D1Q A;  2JX2 A;  2CVI A;  4ZLJ A;  2ZH2 A;  4FXW A;  4CZC A;  4HH1 A;  2UP1 A;  1XNR F;  4O0N A;  3C16 B;  2HAI A;  4I6W A;  4PAB A;  4YB7 A;  2O04 A;  2ZOG A;  2LEP A;  2DIT A;  2ZJQ Q;  4DR7 F;  2N3L A;  1C0T A;  3GTY X;  4RPF A;  3D68 A;  4XL9 A;  2H5E A;  2VFP A;  3TR5 A;  1BD6 A;  3ZZO A;  2VQF F;  1GQE A;  2ZBP A;  3FFI A;  2DGV A;  1JJ2 R;  2M70 A;  3FEY B;  4XPE A;  3WIV A;  1SH2 A;  2OEL A;  1SJ3 P;  3TO8 A;  3BGR A;  2YKN A;  1RT1 B;  2JFD A;  3B82 A;  3CJT A;  3JQJ A;  3QGG A;  1VQ7 S;  2ADB A;  1Y10 A;  2GHW A;  3FGV A;  4JB8 B;  3N90 A;  1PAU B;  3NWR A;  5DDR C;  2BE9 B;  3R1L A;  4K4U A;  3ICL A;  1FTC A;  2P5V A;  3MF5 A;  4RW4 A;  2MXY A;  3OLA A;  3EPI A;  2FVQ A;  2UXB J;  1H72 C;  4JV2 A;  4HHU A;  1U02 A;  4MYT A;  5IS2 A;  2K06 A;  3GJS B;  3SCJ E;  1LWC B;  2Q79 A;  4NZ7 A;  5A6P A;  5HRO B;  3J7Y U;  4PXD A;  2C22 A;  2AGO A;  4FNI A;  1WOO A;  2XGQ A;  2IVF B;  3CC7 S;  4C8Y A;  4K59 A;  2JL9 A;  2X3G A;  3HSG A;  5EHH A;  3QRQ A;  3OTO F;  3OR2 B;  2J9D E;  5ETR A;  5L1I A;  2CQP A;  1FFW B;  2DEJ A;  4CLP A;  1SUQ B;  2RQC A;  1SIZ A;  3VAI A;  4OHX A;  3CDB A;  1HPZ B;  1HWI A;  4EO8 A;  2OI2 A;  2LQJ A;  5I3U B;  4K8R A;  1NSQ A;  3MI7 X;  1CG2 A;  3DRX A;  3BDE A;  3J81 Y;  2YQ1 A;  1RYR A;  3ITH B;  3KLV A;  1RI7 A;  1OFE A;  3M4X A;  4ELT A;  2INV A;  3OL9 A;  1LNQ A;  4MT1 A;  1BMQ B;  2QYU A;  1RDR A;  2RKI A;  4XO0 A;  1TL3 A;  1QA1 A;  1EX8 A;  3KLF A;  1E6V A;  3T5J A;  4JI4 J;  1T11 A;  1SJR A;  4CQ1 A;  3QO9 A;  3ZZY A;  1O8L A;  2VFS A;  4OJ1 A;  4TU7 A;  1TQL A;  3DOK B;  4RW9 B;  4JI1 F;  5C1C A;  3BO3 A;  4LIW A;  3ULH A;  4IDK B;  2W8L A;  2XS5 A;  1JLC A;  1CJV A;  2F9D A;  2YPY A;  5C1E A;  1R6Y A;  5DJB A;  2PDA A;  1IR2 A;  4EFA C;  3BF4 A;  3DOM B;  2GJF A;  4WWS A;  3PVX A;  2GFF A;  2D3U A;  2AYE A;  4DR5 F;  4K5S A;  1YJR A;  1HF2 A;  1ZS6 A;  3MWB A;  1YGY A;  1N5Q A;  3Q83 A;  4DF8 A;  2W2N P;  3RRG A;  3NNH A;  1Y00 A;  2MZS A;  4ZVR B;  4HDH A;  2XC1 A;  5HQ8 A;  1RT3 B;  5KFC A;  4F4X A;  2M88 A;  4DQI A;  4NK8 A;  1EKR A;  4QU6 A;  1MRO B;  4DR7 J;  1M1H A;  4DL0 C;  2NQP A;  4MKB A;  3H90 A;  3MMA A;  1YBA A;  3BYR A;  3SFG A;  3RU0 A;  5HAO A;  5C7P A;  2V4R A;  4ILL A;  5LXR A;  2DBB A;  1TP7 A;  1Z2L A;  1ULR A;  3GYG A;  1JLG B;  5H1S V;  2GO8 A;  3R5B A;  2VFO A;  1U6Z A;  3A8I A;  3A1Y G;  3M7V A;  3M8W A;  4OIX A;  4LF6 J;  3L9Z A;  4Y2M A;  2JEJ A;  4JP8 A;  1QAX A;  4DPX A;  5K8P A;  4J9S A;  3TAQ A;  5KT4 A;  4ZCI A;  1NK5 A;  1JWW A;  3PYG A;  2HHH J;  2WON B;  4A8Q A;  1T9U A;  1TL7 B;  4WFZ A;  2VON A;  2UU9 J;  1Q8I A;  2K1R A;  3EQN A;  3K57 A;  4GKJ F;  2XMW A;  2GQ2 A;  1BQM B;  3HVA A;  2CQ3 A;  3QMQ A;  2KDO A;  3WC2 A;  4XM3 A;  2HNZ A;  5BJR A;  4KPY A;  1RTJ A;  3BS9 A;  4DSF A;  1N33 J;  1K0T A;  1IDK A;  4WTO B;  2X7I A;  1DAR A;  2KN4 A;  3DOK A;  1VQ4 S;  5DS7 A;  2OUG A;  2IBK A;  2RU9 A;  5E2Q A;  3DU1 X;  1GMU A;  3V4I A;  3R1H A;  2YX4 A;  4J9V A;  1U1R A;  2VG5 A;  2D3Z A;  3DU5 A;  1XEZ A;  1JJC B;  4FYD A;  4LUB A;  2NXU A;  2JC1 A;  2M8D B;  2N4D A;  1HYS A;  1F9E B;  1T9V A;  1IXK A;  2FQQ B;  3N9U C;  3A3P B;  2NLW A;  2YKA A;  1U1M A;  2CPI A;  3DI6 B;  2QA2 A;  1F2G A;  1VBX A;  3MZI A;  2KG0 A;  1X4H A;  4RO0 A;  1KFS A;  1QA3 A;  2XHC A;  1XJW B;  2F4V F;  1UVI A;  1NZ8 A;  2DJW A;  2L08 A;  5LM7 E;  4X4P A;  4TXS A;  1U0H A;  3KHR A;  4B3S J;  1RAJ A;  2NRE A;  2EC2 A;  2IDL A;  1FK9 A;  2D9O A;  2HW3 A;  3CW2 C;  1FJG F;  4HL9 A;  2J76 E;  4I56 A;  4KE5 A;  4FPR A;  4P72 A;  4YP3 A;  1OGO X;  2E5G A;  1N36 F;  1M5H A;  1OQ3 A;  2Q43 A;  3R7S B;  2ZM6 F;  4WZQ A;  1LXN A;  1YWX A;  2BE2 B;  3C66 A;  1FA0 A;  2FJA B;  2FZC B;  2ZHO A;  1KNZ A;  3KLI A;  2B3T B;  4PKD B;  1D8Z A;  4JI5 F;  3AJ1 A;  4LR7 A;  4WYL A;  1WDT A;  2QT7 A;  2YVS A;  3PO4 A;  1I6J A;  4MKY A;  4RW7 A;  2Q1L A;  5BYQ A;  2MGZ A;  4U96 A;  4U49 A;  4JOU A;  3W9J A;  3KJF B;  1EIY B;  2MY7 A;  1K1Q A;  2DGO A;  1NSK L;  1RTD B;  1GX5 A;  1VYA A;  4M5L A;  3MM8 B;  1VLY A;  2DIS A;  1S6Q A;  3O1L A;  3KJV A;  1S72 S;  1AXQ A;  2A0F B;  3QLH A;  3PX4 A;  3DRS A;  1T05 A;  2E5L J;  3QAU A;  4CH7 A;  3E01 B;  4W8Q A;  3D9B A;  2LQ8 A;  3LP0 A;  5FJ4 A;  4Y6I A;  1RT4 A;  3EVM A;  1U8W A;  2W9A A;  2OPR B;  3KLH B;  3L7P A;  4GVB A;  2E1A A;  3DFE A;  4FF4 A;  1UA0 A;  3AFG A;  2HEK A;  1YIT S;  1RU2 A;  3SMZ A;  1L5U A;  2PEC A;  4B3O B;  4EYI B;  4CTA B;  3AB4 B;  4DN9 A;  3QJJ A;  2H4W B;  3IAM 9;  1N8R T;  2R7Q A;  3KYL A;  2QTW A;  1NHK L;  2GVZ B;  3DDK A;  2ZUG A;  2JVR A;  4FYV B;  4U8Y A;  2VBK A;  4A48 A;  5HBM A;  2UUA F;  2C3P A;  4FBT A;  4CLS A;  2X6Y A;  3QLH B;  3W5X A;  5AXN A;  4LF5 J;  4OJL A;  4OZJ A;  3PAC A;  1UL3 A;  1S1X A;  2PEH A;  1U45 A;  4IKA A;  2MB0 B;  3QWU A;  4JI3 F;  1YBT A;  2QX0 A;  3R9L A;  1RWK B;  2F8E X;  4RKU C;  2PT0 A;  3HSZ A;  1XMO F;  4LF9 J;  1RKJ A;  5D4N A;  2Z0G A;  4C3M A;  4C8N A;  3EGZ A;  2RRN A;  4CLW A;  4DMZ A;  2V8H A;  2U2F A;  2W24 A;  4IG0 A;  5B0F A;  5DRK A;  3MEG A;  1U2C A;  3DLG A;  4U9R A;  1JRG A;  1S1V B;  4DG1 A;  2ZH8 A;  1O8J A;  4DV6 F;  1FO1 A;  3TI0 A;  1CLF A;  4X62 F;  4X4U A;  4A8K A;  2CPJ A;  5KFH A;  4RZR A;  3PDN A;  2QFI A;  2D1C A;  4NI2 B;  3D67 A;  4M5I A;  5DQH A;  1Q8L A;  2HQI A;  1KN6 A;  1KLM B;  3TJA A;  3G6V A;  3A13 A;  3ZSC A;  2CPF A;  4K5R A;  4V02 C;  2X1F A;  2JC0 A;  3CCZ A;  2QN6 B;  4Z7C A;  1BQN B;  1VRT A;  4QZV B;  5KFZ A;  2FJX A;  1SQF A;  3FQL A;  2O3D A;  1TYX A;  1X8D A;  2LA6 A;  3CMA S;  3NBP B;  3OV7 A;  2V9K A;  3MMC A;  3NS7 B;  4CLU A;  5HQM A;  2W7O A;  1FFG B;  4PG4 A;  3QQC D;  4OI4 A;  4Y00 A;  4QR1 A;  2MKI A;  1VC6 A;  2G0Y A;  4ZP6 A;  1JK9 B;  3QYY A;  1S6P A;  2XSJ A;  4CI0 B;  4MFB A;  4DV4 F;  3DI6 A;  3MUR P;  1URN A;  3FVY A;  2J5A A;  3DRP A;  1BUX A;  2ZVS A;  3W5Z A;  1WHW A;  2AT1 B;  2H5J B;  2LCW A;  4O23 A;  6FDR A;  5F8L A;  1TKZ B;  1R27 B;  2J0S D;  2MLZ A;  5LMU J;  4KHP F;  2M52 A;  3KG4 A;  5D0R A;  5HN0 A;  1VLO A;  2WVB A;  3T41 A;  3HHL C;  2K3K A;  4JV1 A;  4O4R A;  2ASL A;  3ENQ A;  3FMW A;  3VV2 B;  4CLT A;  2FTR A;  4ZLN A;  7FDR A;  2X6W A;  2HK2 A;  3NS5 A;  2W2M P;  5C25 B;  2MZR A;  2P9E A;  3PIO Q;  3OBI A;  1NJY A;  2H54 B;  4YY3 J;  2GAG C;  3M1V B;  4LRE A;  4OZ5 A;  3CXC R;  1FDB A;  1K0V A;  3N5B A;  2NT6 A;  3KHG A;  3LUY A;  4QW9 A;  3LWL A;  4DL3 A;  1TL7 A;  1TKX A;  1CS4 B;  1S79 A;  3L7O A;  4I7F A;  4LF1 A;  4LSN B;  4C97 A;  2HQF A;  2W9C A;  1JLF A;  3JQM A;  4HEA 9;  1FX2 A;  2H48 B;  2KVQ E;  4L72 B;  2KM8 B;  4QWE A;  1RWU A;  1ZTW A;  1DRZ A;  4DR1 F;  4I2P B;  2HIQ A;  1RHJ B;  1R89 A;  3O5T B;  4YR3 A;  3MPV A;  1BWE A;  1JXV A;  4Q44 A;  1AUD A;  3HD1 A;  4IH6 A;  1SKU B;  3ZFV A;  3R2D J;  3DM2 B;  1RAG B;  3DN9 A;  4DX8 H;  2IFX A;  1SC4 B;  4AND A;  5EWG A;  1RWP B;  5M2P A;  1LK5 A;  1H2T Z;  2Y1I A;  1BWV A;  2YNG B;  4R8U A;  4YFU A;  2MTL A;  2OML A;  4E98 A;  3OL8 A;  2JFK A;  2C2N A;  1PC5 A;  4F3Q A;  4Y0F A;  3CWJ A;  3IWX A;  2V9W A;  3TUJ C;  2Z58 B;  4F0K A;  2BM5 A;  1GMW D;  1EQM A;  2A1B A;  2ILZ A;  1CJK B;  3H42 A;  2NR0 A;  1RTI B;  2GAH C;  1BGX T;  2P9G A;  3D0H E;  2VKZ G;  1NK0 A;  3VTI A;  5D77 A;  4OPW A;  1VOM A;  3BSN A;  1U48 A;  1I3O B;  1WG5 A;  3EVO A;  1NDC A;  4I6Y A;  2DR7 A;  1LLW A;  4F4Y A;  2F1F A;  3HVT B;  3L4B C;  3H5X A;  2DEI A;  1OFL A;  1PLU A;  1NU4 A;  1YG0 A;  4N7T A;  1H74 A;  2VH7 A;  5K14 B;  1RT5 B;  1RBA A;  1B0V A;  1Y4Z B;  2XMK A;  3ILI A;  4ANC A;  4DSJ A;  5JVH Q;  2O6W A;  1L3K A;  4ZCL A;  3V6K A;  2D3O R;  2MZQ A;  3IO1 A;  2E66 A;  3NCR A;  2IIH A;  2WTF A;  2ZKT A;  3AXK A;  5I3U A;  2ZD1 A;  2VFN A;  2F9J A;  4I68 A;  4DX6 A;  2DPJ A;  2R8K A;  3JYT B;  1N5Y A;  2HHX A;  1Q1K A;  4ZVG A;  2XT4 A;  5HMZ A;  2ADC A;  4C0H A;  3BZQ A;  1BQX A;  5A0Y A;  3VCD A;  1Q16 B;  3G2X A;  2Y9H A;  3PSZ A;  3IXQ A;  4UQT A;  4E2F B;  2XC9 A;  2I5J B;  1PJ6 A;  1HBM B;  4Y3C A;  4LIR A;  2ZZN A;  1LM1 A;  2RS2 A;  4PWD B;  5KFV A;  3UVJ A;  2MEW A;  3VSU A;  4FKX A;  3FMB A;  1RU1 A;  4OX7 A;  1CBK A;  3BQ0 A;  2DHS A;  3M2R B;  3CNQ P;  3MPY A;  2IHR 1;  2JWN A;  4I67 A;  2DNP A;  3RG6 A;  2Y1J A;  1AZS B;  3JYT A;  1HNX F;  1JLE A;  1I1G A;  2OO4 A;  4KKO A;  2I6W A;  3DLG B;  3BO2 A;  4RBT A;  1VQN S;  4IH5 A;  1TYV A;  2IRX A;  5KG3 A;  3CCV S;  2MZ1 A;  2O01 C;  3DCA A;  5AT1 B;  3MMB A;  2ZH9 A;  2ZKU A;  4OX6 A;  1AB8 A;  3EJM A;  3OLB A;  5FDL B;  4WKR A;  1QRC A;  1FE0 A;  2GS8 A;  4NLW A;  1TK0 A;  3CIZ A;  4FDF A;  3ZXW A;  1W25 A;  3LP1 A;  5D0G A;  4AFF A;  2P2C B;  4GMK A;  1FRK A;  1KD1 T;  4Y2K A;  4QYZ J;  3BKU A;  1VIO A;  1Y5L B;  4LJM A;  4NOH A;  1FXL A;  3C19 A;  5E0O A;  1S9G A;  3ZNJ 1;  3LPE A;  2A18 A;  5DDQ C;  3H2V E;  4ES3 A;  2ZEJ A;  4JI0 J;  1WWH A;  4CTA A;  4FVC A;  3RTV A;  4HYK A;  2W01 A;  2AF6 A;  3IA0 A;  1M0S A;  2DCU B;  3M2U A;  4YDX A;  5EWF A;  4ILM A;  2QFJ A;  4OL8 A;  4GVB B;  1NUE A;  1O8G A;  2B6A A;  3S1T A;  2N3O A;  5KFL A;  1GXT A;  1IM6 A;  2YX7 A;  2W7A A;  2B4O A;  3EXY A;  5L9N A;  2BM1 A;  1O0P A;  3EGV A;  2U1A A;  2EPI A;  4Q5V A;  2QSF A;  3GB0 A;  3NMR A;  1TKT A;  2QG9 B;  2QXZ A;  1QE1 B;  2GML A;  3DLE A;  3L09 A;  5CD4 A;  3OTO J;  1NO8 A;  4PCQ A;  4PWW A;  3SUC A;  2PYG A;  3A8E A;  4UUX A;  2AYM A;  1NDP A;  3EMT A;  2XEX A;  4LQ9 A;  2H3E B;  3GFZ A;  4NLP A;  6FD1 A;  5HLF A;  1T03 B;  2IJR A;  4DWI A;  4JI7 J;  2Z8Q A;  3P6Y C;  3JSM B;  3H4D A;  1HWL A;  4XMY A;  1HWK A;  1RK8 A;  2CJB A;  5FDL A;  3VHQ A;  4DZ6 A;  3GQ9 A;  1VMB A;  5T7L B;  3HFK A;  3GJQ B;  3P5B P;  5I3Q A;  2LU1 A;  3TAP A;  2CNO B;  1FJE B;  1OWX A;  4NA1 A;  1KHW A;  3DRR A;  2OPQ B;  2J8A A;  2HLT A;  2VPW B;  2GMJ A;  4ECZ A;  4JI4 F;  1EZZ B;  1SV5 A;  2O0V A;  2XUL A;  4ZVO B;  2YWK A;  2HGM A;  3D6H B;  5A8R B;  4ED2 A;  3G9C A;  4J90 A;  1RT7 B;  5HL7 Q;  4B02 A;  4ZVT B;  1TAQ A;  3CDA A;  1YLX A;  2R2T A;  2YY3 A;  2MJU A;  1N5V A;  2RF2 A;  2HHW A;  2HRY A;  2C42 A;  3FZB A;  2ZOF A;  3VAK A;  1NKB A;  2GQC A;  3MTJ A;  1WNE A;  2C3U A;  2LQ5 A;  4KV8 B;  1KQK A;  4NEZ A;  3OL7 A;  1U6F A;  1RCX B;  2HIY A;  5IV4 A;  3J7Y I;  3OJU A;  4NLD A;  1NME B;  5J2M A;  1XTZ A;  3A8J A;  1UKU A;  4Q43 A;  1HNV B;  1NK8 A;  1QSS A;  1CJU A;  3S8S A;  2OTJ S;  4XLA A;  1MU2 A;  2K3I A;  2H4Y B;  2BEF A;  4XN0 A;  2NT9 A;  2FUG 9;  1KLN A;  3C6T B;  1DJ0 A;  1HBU B;  3C14 A;  4IFY A;  5DGA A;  3R27 A;  2X1B A;  3D54 A;  2OTL S;  1IBL J;  1FTR A;  1HW9 A;  1IJE B;  2XMJ A;  1YVF A;  3PJW A;  4CH0 S;  2XLI A;  4RNH A;  3G8T A;  1F9H A;  3KJN B;  4NZ0 A;  1WEY A;  4OX8 A;  1S97 A;  2F5G A;  1R3N A;  1HMV B;  3IS9 A;  4OYB A;  1PXZ A;  3I56 S;  1TSP A;  4UF4 A;  4EW9 A;  4QWC A;  1M90 T;  3Q8Y A;  4IUF A;  1NHU A;  5KG4 A;  1BHN A;  3UFC X;  2LLZ A;  3AHP A;  1ELO A;  1MWZ A;  4ID5 B;  3KK1 B;  3WX4 A;  2I8E A;  3RR7 A;  2CQ0 A;  4J7C A;  4OQJ A;  1QVF R;  5IM0 A;  3OR1 B;  2XTX A;  3B8H A;  1P9Y A;  2WW4 A;  4Y65 A;  3OTE A;  2GIQ A;  3LJY A;  1F5C A;  4NL5 A;  3W8P A;  4ZIT A;  5EDW A;  3KLE A;  2YNG A;  1NND A;  2MHE A;  4DV5 F;  2O0W A;  3EWG A;  2XWY A;  3NXZ A;  1XR7 A;  4CNY A;  1TL1 A;  4K2J A;  1RAB B;  2Z57 B;  3GIM A;  2DNM A;  3B78 A;  4OYI A;  4DUZ F;  3RZA A;  1P27 B;  3GG1 A;  1J5E J;  3UDC A;  3FY3 A;  1S1W B;  3DLL Q;  3J7Z T;  3M8P A;  3VAM A;  3CD7 A;  1X0F A;  3K8V A;  2HQG A;  3KTQ A;  4F4W A;  1OYD A;  5EN1 A;  5AE3 A;  1SVD A;  3MUM P;  4ALZ A;  3I82 A;  3BSO A;  1GNK A;  2CVE A;  1PIL A;  2YTC A;  3NY0 A;  4X4S A;  4RBU A;  2XGP A;  2AX0 A;  1Q7Y T;  1XMB A;  2V4Q A;  1VBY A;  1Y5I B;  1SC1 B;  2HS0 A;  4WU2 A;  4XOR A;  3I0R A;  4MMO A;  1K8A T;  2QV6 A;  2FJB B;  2M3D A;  4RW8 B;  3TH0 A;  1R0B G;  1FFS B;  4WP9 A;  2ZE2 A;  5A8W B;  1LWF A;  2EBE A;  1VQ6 S;  1EAR A;  3LAN A;  3MXH P;  1LWE A;  5C2C A;  1PYO B;  1E6V B;  4DV3 F;  3SI8 A;  3CSK A;  2DHH A;  4PR6 A;  4ECS A;  4WU3 A;  3HD2 A;  1U1P A;  3QRP A;  1TKZ A;  1YKW A;  4A8X A;  3PR4 A;  4KHM A;  3M8R A;  1CJU B;  3PSS A;  2X1G A;  2V8G A;  5GAH U;  1AZS A;  1X5P A;  2DK2 A;  2E5J A;  2PII A;  3I5C A;  1VIX A;  4HAC A;  4HT5 A;  2V50 A;  1RWM B;  4NRT A;  5KFR A;  2EEY A;  2IRY A;  3R5D A;  4F26 A;  3KJQ B;  5LT5 A;  1FNX H;  4Y28 C;  3MPU B;  1FRI A;  3M30 A;  4URS A;  2J9D A;  2AMC B;  2CQD A;  2DNR A;  4P75 A;  1M5V C;  1ZM9 A;  1PCA A;  3QT8 A;  1LQ9 A;  4ELU A;  2DGU A;  4QWB A;  1Z1Z A;  4KH3 A;  3TVY A;  2HHS A;  4N8O A;  1HI8 A;  2RF2 B;  3NLC A;  2HGN A;  2R7X A;  1KLM A;  2UUC J;  3ETO A;  4M5M A;  1DFD A;  1RLC L;  3W9I A;  3PM9 A;  1SXL A;  3MR5 A;  3IG1 B;  1RHU B;  1N5Y B;  2XB2 D;  3PYF A;  1OMS A;  3HVW A;  1DQ9 A;  5B08 A;  2K7J A;  2RRB A;  3RB3 A;  2KXF A;  4F3O A;  5M2U A;  4RWX A;  5LSL A;  1F0X A;  1JLA A;  3NOG A;  4IYQ A;  3JB9 k;  2BM0 A;  4K4V A;  2L9N A;  2OLW A;  3K0J A;  1J27 A;  1IKY A;  1D9F A;  3NCQ A;  1W2B R;  2VL1 A;  2ZFH A;  3SSS A;  1VHF A;  2W4P A;  2B5J B;  3N4W A;  4KY3 A;  4CM0 A;  1ZA2 B;  1Q5V A;  4N47 A;  2COL A;  5K8O A;  3TJ8 A;  3G6E S;  2AQ4 A;  3VAH A;  1VC0 A;  2W7Z A;  2GJ2 A;  4NYP A;  3JTO A;  3QJL A;  2KH9 A;  2VQF J;  1I5O B;  1P8G A;  4A47 A;  3D6F B;  4GRS A;  2OAU A;  3DDN A;  3HFZ B;  4B08 A;  1YIJ S;  2XS7 A;  4OX9 J;  3N6N A;  5KFS A;  4TKT A;  4C8L A;  4LF9 F;  3P3D A;  4XN3 A;  1NPK A;  3W64 A;  1X4C A;  3M8Z A;  2IJN A;  1O8F A;  2A2D A;  3N0V A;  3JS9 A;  3W2W B;  1MML A;  1PBA A;  4F0H A;  3KDN A;  5GAE U;  2OP5 A;  5DDO C;  1F5A A;  1S4E A;  2WRM A;  5CCL A;  5DM7 Q;  2UXD J;  2B0G A;  3ZZZ A;  3O8W A;  2VFR A;  2R2S A;  2KL8 A;  1JLQ B;  2CPE A;  1IWA A;  2ZIT A;  2FY1 A;  5DLF A;  4XQF A;  2PO4 A;  1O88 A;  4YZ0 A;  2CQ1 A;  2QGF B;  4R0E A;  2C3M A;  3M05 A;  3CCQ S;  3MM7 B;  4DR4 F;  1S10 A;  1UWB B;  3MM9 A;  5B0C A;  3HT3 A;  2R8H A;  3T9G A;  1U1O A;  2M7S A;  2PGC A;  3RAX A;  2F4F A;  4LFB J;  3K5P A;  2JSX A;  1YJT A;  2VC1 A;  1K73 T;  3OFG A;  4WYW A;  1G2E A;  4DPY A;  3HSD A;  2FLN A;  2JNJ A;  5KFX A;  2NZM A;  3VAF A;  5F8G A;  1VHI A;  4EYH B;  1PE9 A;  3KK2 B;  2NYH A;  4D3H A;  2AGP A;  3M8Q B;  4N41 A;  4TY9 A;  5A8K A;  2G1D A;  3LW5 C;  2VDI A;  5E3R A;  3VAL A;  4IRD A;  2KB2 A;  3TP2 A;  4CLZ A;  1CVJ A;  3SQO P;  4DV2 J;  5E41 A;  3F44 A;  2DY1 A;  2OD6 A;  4F4Z A;  4RW6 A;  1U1Q A;  3LGN A;  3LGH A;  2DR8 A;  1M5O C;  4CO4 A;  3CME S;  1NSP A;  4J37 A;  2W2Q P;  1XMQ F;  3P49 B;  1PBU A;  1SPB P;  4B9N A;  3HF5 A;  1UJ6 A;  5J2M B;  3MAA A;  4W8T A;  2YNI A;  1U25 A;  4XAK A;  5GAD U;  3TWZ A;  4HKQ A;  4LRC A;  1UPM B;  1CJT A;  4QWA A;  2FVP A;  4KHP J;  2HZA A;  4C0B A;  5DG8 A;  2CJA A;  2MYF A;  5DZ7 A;  8AT1 B;  2GC8 A;  1FJG J;  3CMQ A;  3JUR A;  2IAJ A;  3THP A;  4B3T F;  4NRU A;  5GAD I;  1RQ0 A;  4KTQ A;  1VRT B;  3GU0 A;  3PCO B;  4XDD A;  3CJQ A;  3AA8 A;  2LQ9 A;  3FZ2 A;  2ZM6 J;  4DR2 J;  2HS3 A;  4I2Q B;  2RDD A;  5HP1 B;  4ZIV A;  1B70 B;  1RTH B;  2DNO A;  3BEG B;  3BGL A;  3ISN C;  4IFV A;  4P52 A;  9RUB A;  3B4N A;  2XYP B;  2RQ4 A;  1H38 A;  2CJQ A;  2KRR A;  2WSE C;  1XIQ A;  4HTJ A;  4YZX A;  4ZPA A;  3HM9 A;  2KZZ A;  2ZNY A;  1SV5 B;  5CAA A;  3G4S S;  3MPD A;  1FX4 A;  3J81 j;  2ROG A;  1JIH A;  3FSY A;  3BGO P;  2NSP A;  1Y7P A;  4NZ6 A;  4U7U D;  1BQM A;  3SDE B;  2XTW A;  3SQG B;  1DZ5 A;  2QLF B;  3K5O A;  3T9N A;  2RQM A;  3LOU A;  3MM6 B;  3CCW A;  3I55 S;  3CVK A;  1VDH A;  1ZET A;  4R5P A;  4ECW A;  2D3O 1;  4IRK A;  4FS2 A;  4L74 A;  2OEJ A;  5H9E K;  2KYZ A;  2JHE A;  1DBD A;  1S5Z A;  1GT8 A;  3H8Y A;  3NAI A;  2FC8 A;  2ASD A;  1F2H A;  1NCL A;  3FBC A;  4W92 B;  2JEF A;  5ETS A;  1SC3 B;  3SIP B;  2DXD A;  4LBH A;  1N33 F;  2HFS A;  1NLK L;  2CG8 A;  3CD5 A;  3C8Y A;  4OZZ A;  4NYO A;  1JLQ A;  4QPT A;  2KT2 A;  1G6B A;  1YZ6 A;  4LT6 A;  4WBF A;  4WXW A;  3GQC A;  4JI6 F;  4AE5 A;  3MAQ A;  5LMN J;  4QIG A;  3T3F A;  2LU2 A;  4F25 A;  2BW2 A;  4J9P A;  3RRK A;  2LEC A;  2NXJ A;  4AL7 A;  4PEO A;  2A3J A;  1FES A;  1NK6 A;  2RVJ A;  1WC3 A;  4M1K A;  1CS4 A;  4LSN A;  3IAS 9;  1BY9 A;  3ISZ A;  1ROF A;  2DRA A;  1VQK S;  4YR0 A;  2J7K A;  3RBE A;  2MLX A;  4X64 F;  2GIF A;  1H3D A;  3KLG A;  1AUS L;  2J7W A;  3MTK A;  3SFU A;  3H4B A;  1NK4 A;  4M5J A;  4P2F A;  4B9L A;  3OTC A;  1JXL A;  3KJV B;  5HVG A;  3KUH A;  3UDL A;  1HR0 J;  2BE7 D;  4OFZ A;  3W2V A;  4DI6 A;  2ZH6 A;  4USW A;  3IR7 B;  2CKW A;  5IT9 Y;  2D7S A;  1NH8 A;  5B0B A;  2QJ3 A;  4FF3 A;  1S1U A;  2J0W A;  3QGI A;  3WBZ A;  4TNO A;  1YJ7 A;  4PG8 A;  2ACY A;  3GQ7 A;  4HT7 A;  2YUH A;  2B9E A;  4UOG A;  3EQO A;  1VJQ A;  1RAA B;  4HHH A;  1UPP A;  3LP2 A;  3V5R A;  2PA8 D;  1TUV A;  2FGC A;  2LMI A;  2QL9 B;  2DGS A;  2VBZ A;  2EWH A;  3H59 A;  3S7R A;  2CUY A;  4Z2X A;  4B17 A;  4DBQ A;  4NXN J;  1SUQ A;  2JH3 A;  1FXD A;  2CIM A;  3NGT A;  3R3T A;  3I5A A;  3UN3 A;  1T95 A;  2KHD A;  1UFK A;  1WTF A;  5EGY A;  2ZH7 A;  3UVJ B;  2B43 A;  1FKO A;  3CIM A;  4ZVQ B;  3WWG A;  2RAQ A;  4F36 A;  3R6G B;  5D3G B;  5AJ3 F;  2B7B B;  2IDE A;  4WFY A;  4WJB A;  2V68 A;  2POK A;  5FLX Y;  2VQE F;  2C3Y A;  3AB2 B;  4QOT A;  1FVQ A;  2LDI A;  1QQ1 A;  1O51 A;  2BM7 A;  3BGR B;  4J9U E;  3F0N A;  4P6Q A;  1H98 A;  2OPS B;  4WKY A;  2BJ1 A;  4OMF G;  4EBC A;  1B7F A;  2J9E A;  1GTH A;  3B54 A;  3LGM A;  3H25 A;  3LO3 A;  2NXN A;  1HNX J;  4NXM F;  2CNN B;  3FFI B;  3QZ7 A;  4DUY F;  1YQH A;  1O8K A;  2MQM A;  5IC6 B;  1HBO B;  2XMM A;  3VGS A;  1LWF B;  4DL7 A;  2JZ5 A;  3BN4 A;  3BPS P;  4AQY J;  3RAQ A;  2J8K A;  4NMX A;  1HHT P;  4ZJL A;  3VMW A;  3AXM A;  4PUO B;  2RRA A;  3I0R B;  5CZX A;  1UET A;  5KG0 A;  2EKN A;  5KG1 A;  4WFN Q;  3VAJ A;  4DS5 A;  3TRG A;  3LAM A;  2ZH1 A;  4OJ6 A;  4MAK A;  5LMN F;  1WSV A;  1BHE A;  2VAS A;  3K5M A;  3OXG A;  1WHV A;  2RDJ A;  3TEG A;  3ZZR A;  4ELV A;  1WC0 A;  2FD2 A;  2FVS A;  4WP8 A;  3MOJ B;  2UXC J;  4ZPV R;  2BKO A;  2NXC A;  2B9Y A;  3ZTP A;  3KLH A;  1FJ7 A;  1XNR J;  1E6Y A;  4OHW A;  1NEE A;  1V9O A;  1WC5 A;  1UW9 A;  4YY3 F;  5F3Z A;  3H40 A;  1WOS A;  4DV7 F;  2BJ9 A;  2DNG A;  4KH1 B;  2GHP A;  4UQG A;  1YTY A;  2HFN A;  4EEY A;  1U1K A;  1VK3 A;  3EX7 B;  2I2Y A;  2YXL A;  3C46 A;  4F2R A;  2DD8 S;  4I2P A;  2RIJ A;  5L39 A;  1R31 A;  2V2K A;  2VJI A;  5AXK A;  3TUI C;  2UVE A;  3Q8U A;  2UU9 F;  2HMI B;  1FHT A;  2FJW A;  2MSS A;  3KK1 A;  2FJE B;  2QLB B;  1N6Q B;  3DYA A;  4RW7 B;  2XMU A;  4I84 A;  4DV4 J;  1TKX B;  2CQ4 A;  4LVN P;  4L73 A;  1DQA A;  3EDR B;  1SKS A;  2Y0B B;  3BKT A;  4M5G A;  2GGP B;  2IC3 A;  3KOA A;  4PZV A;  4OYZ A;  3ZO7 A;  3ZTQ A;  5KFA A;  2KFY A;  3T1Y F;  1P9Q C;  5H9F J;  1TK8 A;  2OH2 A;  2O1P A;  2V4J B;  4FNH A;  4DEZ A;  1RZM A;  4HR2 A;  5H9E J;  2G2Z A;  2Q3P A;  1Q8K A;  3AY0 A;  1C4A A;  3PNI A;  3P8B B;  4ZK7 M;  4RU2 A;  4B3R F;  4PG6 A;  1HNZ J;  5L38 A;  2ZUA A;  5ADZ A;  2EKY A;  2FHJ D;  4DFP A;  1CUL B;  2J0Q D;  3OHA A;  1Q5Y A;  1SH3 A;  1WG1 A;  2KT3 A;  3G82 B;  2CZV C;  3RJM B;  1QAJ A;  4ED8 A;  3E2E A;  1RHQ B;  1U0H B;  1N0U A;  1GMV A;  3DXS X;  3BR8 A;  1UVL A;  2F8H A;  5AJ3 J;  4LF7 J;  5CYM B;  4BC9 A;  5CH7 B;  4DQQ A;  1M5K C;  3QJP A;  3SYJ A;  3QBC A;  4GO5 X;  4I64 A;  3OPK A;  3NNC A;  4OHY A;  4LQ3 A;  2YKO A;  4PYD A;  4Z03 A;  2BOA A;  2YKP A;  2YQ0 A;  2LEA A;  2VQE J;  3OT9 A;  3H20 A;  4X65 F;  5HRO A;  2ZVI A;  1X4D A;  1F9F A;  3W1Y C;  4ER8 A;  4ZVU B;  1XMQ J;  2W7P A;  2HBY B;  4LR9 A;  4IRC A;  4DR6 F;  4WE1 B;  3OVA A;  2R7T A;  5C5J A;  2N4C A;  3C6U A;  2OPP A;  2QX3 A;  3M8Q A;  2HNZ B;  3TEH B;  1PO6 A;  2XT2 A;  2C1E B;  2AJ2 A;  4DR3 J;  1RT1 A;  1QAI A;  4KQZ A;  4IR1 A;  4UW2 A;  1IBM F;  4FYX B;  1WAC A;  5T7L A;  4ECV A;  3QSY B;  4PPZ A;  1EB0 A;  3AOC A;  2DPI A;  3K5L A;  3FCW A;  2UZA A;  5KG6 A;  2IYG A;  2VG6 A;  4DJB A;  3TZY A;  3IRW P;  4A8M P;  1FKA F;  4CNZ A;  2IJF A;  5HJY A;  2ALZ A;  1YBU A;  2R7R A;  2XHW A;  2VJJ A;  3PRV A;  5DDP C;  3R8Y A;  1JTA A;  1GK8 A;  3TNV A;  3PX6 A;  2RT3 A;  1FF2 A;  2JEG A;  1KVI A;  2PMZ D;  4ZPW R;  3HX9 A;  1JLG A;  2FHM A;  3AJD A;  2QO3 A;  4L3N A;  4OHV A;  4KSE B;  2CA9 A;  3RRH A;  1VIS A;  3FEZ A;  3I0S A;  4DUZ J;  2AW0 A;  2VD3 A;  4XTT A;  3R2C J;  4Q2M A;  3M9M B;  1D8Y A;  2E9Z A;  5G0R B;  5RUB A;  4YC5 A;  4AVZ A;  1YSJ A;  1TL5 A;  3ML3 A;  3ONQ A;  4C7Q A;  4ZHR A;  2LKZ A;  5L1K A;  4BLG A;  3UW0 A;  1CLW A;  4IOB A;  4LVO P;  1U8S A;  4USK A;  1NB2 A;  1O6X A;  2IYI A;  3E01 A;  3U27 A;  3WX8 A;  1VC5 A;  9ATC B;  3TZZ A;  3D2W A;  3RB6 A;  2BOP A;  3DLH A;  4NCB A;  2XS2 A;  1S1T A;  2ZBC A;  3MED B;  4F04 B;  2ZOM A;  2OIH A;  1Q53 A;  1FD8 A;  2HKE A;  2KG1 A;  2MZT A;  3PW5 A;  3ILJ A;  2LQB A;  1IBK F;  5KFT A;  1R7I A;  1SJ4 P;  4BWM A;  2BR0 A;  2CZ9 A;  1SJQ A;  2MST A;  1RHM B;  1U1N A;  3GSD A;  3CC4 S;  1VBK A;  3Q8Q B;  1RWW B;  3PJX A;  1NRK A;  2YH1 A;  5E3A A;  1V6H A;  2M5Y A;  1SI9 A;  1T0T V;  2W8K A;  1LOU A;  3VAG A;  4KJI A;  4LSZ B;  1RAH B;  2VBM A;  3ITH A;  5BR8 F;  5IT9 U;  3FUY A;  2OKQ A;  4G3I A;  3KLI B;  3PTW A;  1P6T A;  2O66 A;  1UWA A;  4ZN1 A;  4QYR A;  1DY3 A;  3RB4 A;  1DLO A;  1FI4 A;  3VSV A;  5J1E B;  4S0M A;  4IR9 A;  2XMV A;  4P2X A;  2I9S A;  3T6J A;  4B3M J;  1EET A;  1FRH A;  3M2V B;  3EXC X;  3HSJ A;  4OI6 A;  4CYU A;  3NAH A;  3M6V A;  4LRA A;  1HBO A;  3W63 A;  1B3T A;  5I4M A;  2QL7 B;  4Z06 A;  5E3P A;  4TYB A;  2MKJ A;  4CYU B;  1TL4 A;  4ZS6 A;  2HFZ A;  2UUT A;  3MUT P;  1YJV A;  2OPS A;  1V5I B;  2CXE A;  2C2M B;  2X3D A;  3MEC A;  4LSL A;  4X2B A;  4J5O A;  4PQU B;  3POT A;  5THW A;  3NKY A;  3OL6 A;  1UTA A;  3UO0 A;  5J1P A;  4YR2 A;  4F4K A;  4PQU A;  2YKN B;  1GXU A;  3UW1 A;  2YWH A;  1QCX A;  2IY5 B;  3QGH A;  4MKV A;  2NXE A;  4J9R A;  2YNH B;  2MKS A;  1O5J A;  5D0H A;  3SV4 A;  4DV2 F;  1JMT A;  3CJ0 A;  3O3L A;  1LWE B;  4WK3 A;  1HQU A;  4JYA J;  3V81 A;  2QMW A;  3NGK A;  2GQQ A;  3K17 A;  4U7C A;  1N56 A;  4RW8 A;  3NGR A;  4LFC F;  4KPC A;  1DTT A;  3T1H J;  3NEK A;  2MQL A;  4ICL B;  1KKH A;  2CFX A;  2EK6 A;  2OEK A;  4WII A;  2ATL A;  3R5G A;  3BGF A;  2HQC A;  1WF0 A;  2K1R B;  3NWG A;  5HO4 A;  3TQE A;  1HHS A;  3GP9 A;  1FD2 A;  3IBW A;  2DHG A;  3MM5 B;  3DKD A;  1IKV A;  4O3Q A;  2OD4 A;  4BC7 A;  3OJS A;  3G96 A;  5LMU F;  2YH0 A;  3V6D A;  2BA9 A;  1L3V A;  4CCH A;  4FPI A;  3HHL D;  4NLO A;  4O4G A;  1QSL A;  3DLB A;  3D6M B;  4NLQ A;  4J91 A;  2KU7 A;  2JRS A;  4C2M A;  1OIA A;  2VPY B;  3KK3 B;  1W7W A;  3T1A A;  1QRB A;  2FLO A;  4URG A;  2HBR B;  4OYP A;  3UCZ P;  3TAM B;  3QRR A;  1NJZ A;  2VBE A;  2J6T A;  3MED A;  3W61 A;  3KLE B;  1K9M T;  4X64 J;  1RE1 B;  1TV6 B;  1GMW A;  2HG4 A;  2BVZ A;  3OR1 A;  4TU9 A;  4H4O B;  1R0A A;  3H5Y A;  3K58 A;  2VKR A;  2KJV A;  1AFI A;  1U2F A;  1B4S A;  1U2R A;  2W2O P;  4KC5 A;  2P8I A;  5DLG A;  4N76 A;  2O1D A;  1XK8 A;  3BR9 A;  3IGV A;  2QZA A;  2QSW A;  3K2Y A;  4AD6 A;  3BQ2 A;  3MEE A;  3WZ0 A;  3TAR A;  4C0O C;  5ETV A;  3Q0A A;  4B3M F;  1LKZ A;  5IOL A;  4NLR A;  3UNG C;  2W25 A;  1R8P A;  4Q8F A;  2MJN A;  2D9P A;  1G4C A;  4PG7 A;  2HNY B;  4ZP8 A;  4OI0 A;  1Q7L B;  5EX3 A;  2BAC A;  4A4J A;  3AH6 A;  3LH2 S;  3C6T A;  5D4O A;  2XQC A;  4XKV A;  3CDW A;  3MR7 A;  3UE2 A;  2VHG A;  1S6O A;  3M6W A;  1O8E A;  3BPD A;  2QL5 B;  1FCA A;  4C11 B;  3GV7 B;  2VG6 B;  2WVE A;  1DAX A;  1TVR A;  3TA1 A;  2Q66 A;  1HR0 F;  2HZC A;  4YDD B;  2XSJ B;  2BMB A;  3UQS A;  3N6Z A;  4RUB A;  1MG7 A;  3VMV A;  1IBK J;  2HRT A;  2X51 A;  3PKM A;  2QY1 A;  2DH8 A;  2WVD A;  3IRX A;  3MMC B;  3VWS A;  3RBD A;  4LR8 A;  2BRL A;  4ILR A;  2G0J A;  3BJY A;  3RB0 A;  3OR2 A;  3G82 A;  3I4H X;  3OW2 R;  1TAU A;  4JI8 F;  3OSN A;  4WE1 A;  3H0P A;  2P6T A;  3GYN A;  3SEO A;  2E9R X;  1VJW A;  1N5S A;  2EXU A;  2ZC3 A;  3Q8R B;  5GMK a;  3SQV A;  4TLQ A;  2FVR A;  2ATC B;  2YKM A;  3H09 A;  1LFP A;  3MUV P;  1MLA A;  1EAY C;  1MWQ A;  4JI6 J;  1S76 D;  1O8B A;  2BAN A;  2CWX A;  4LF8 J;  3A3N B;  4NX9 A;  2HNY A;  5D78 A;  3CTR A;  1NK9 A;  2EG1 A;  1PAE X;  2OSR A;  5I42 B;  1R8H A;  2XBP A;  1OPI A;  2KI2 A;  4DV0 F;  5CXT A;  2XY6 A;  2DXE A;  1MN9 A;  2ASJ A;  2HBQ B;  1KON A;  8ATC B;  3KNG A;  1O8I A;  1CUL A;  4ZCM A;  2FZG B;  2DNY A;  1FRM A;  3CO0 P;  3GCX P;  4H4O A;  4P2S A;  1R0A B;  3PO5 A;  1TMM A;  5KT6 A;  1IM4 A;  2L9D A;  5HI7 A;  5J2Q A;  3FBE A;  2A10 A;  5J1N A;  1S1X B;  3PW4 A;  1S49 A;  1PGZ A;  2PI5 A;  3KMQ A;  4KO0 A;  3S6E A;  4K4Z A;  3TX0 A;  2O5D A;  1QE1 A;  1FKP A;  1RHK B;  3RAM A;  1EHW A;  1OQ6 A;  3HI9 A;  3P96 A;  4ZPB A;  4M63 A;  4UTG A;  3TAM A;  2AZ1 A;  4F7V A;  1YHQ S;  3I5B A;  1U09 A;  3BSA A;  4GKK J;  2B8P A;  4USI A;  3MEE B;  3R5C A;  3G71 S;  3NL0 A;  2BM6 A;  3Q89 A;  2DXF A;  2ZWO A;  4MTP A;  1C2P A;  4W4M A;  2OFH X;  5E3Q A;  1H7W A;  4ENO A;  4HDG A;  5IT0 A;  1N6Q A;  2EWE A;  4TY8 A;  2CNK B;  2I1R A;  3MDF A;  2VB6 A;  2C3O A;  2HSE B;  3FK4 A;  3PR5 B;  2AJF E;  2NCK L;  2LFV A;  3QT5 A;  1TK5 A;  2AD9 A;  4OJO A;  1JKH A;  1OY8 A;  3UDV A;  2O17 A;  3IN5 A;  4AUK A;  2V8P A;  3UI3 A;  1QA2 A;  1SKW A;  3SXL A;  4O0I A;  2V5I A;  3KK3 A;  4DSE A;  4ZA1 A;  2LYV A;  4DL2 A;  2CQI A;  1U1L A;  2GA7 A;  3K5N A;  4BDP A;  4M5N A;  2Y8Y A;  3HHK A;  4JV5 J;  1HKA A;  3OUY B;  1YRX A;  4OHZ A;  3LA0 A;  5AE2 A;  3JAM U;  4PMH A;  2RHQ B;  3ISN D;  1QLN A;  1FDN A;  2SXL A;  3UWT A;  1QD1 A;  2CDQ A;  1NDL A;  1IR1 A;  1QM9 A;  1WJ9 A;  1N5T A;  2K8G A;  4YEA A;  1S9F A;  4LMZ A;  4B3R J;  3OTB A;  5C42 A;  4X84 A;  1FRL A;  1H0H B;  1S12 A;  3I4P A;  2D41 A;  3GYX B;  4KKO B;  3I9Z A;  3W60 A;  3H5S A;  4ETZ A;  3HK2 A;  2VG7 B;  2AWZ A;  5SZT A;  3M2R A;  4LF4 J;  1I94 J;  3HPO A;  1JNZ B;  2NYI A;  5IWA F;  1SC6 A;  4FS1 A;  1X31 C;  2LXF A;  4WPA A;  5K20 B;  4DR1 J;  1SB6 A;  3T5H A;  3AK5 A;  4DU7 A;  3V81 B;  1FNO A;  1SH0 A;  4R0J A;  3CJK A;  3SCK E;  2QEX S;  1EET B;  4RNF A;  1RT6 A;  1MMN A;  3IBC B;  3MAH A;  4Y2C A;  2AJQ A;  1SKR A;  3MOZ A;  4DFK A;  1HBN A;  3JQK A;  1DLO B;  4YCQ A;  4H4M A;  3SV3 A;  2V67 A;  4UY8 5;  4O44 B;  1T3O A;  2ZD1 B;  3LP2 B;  2VV5 A;  4XLC A;  4MJK A;  4NE9 C;  4KYZ A;  4CLK A;  4TU8 A;  5DNS A;  4A8W A;  3HHE A;  5HMW A;  4X62 J;  1J5O A;  1S1U B;  4F0M A;  3J80 Y;  2GMH A;  1WMR A;  3HHL B;  4QW8 A;  1EP4 A;  2RS8 A;  2D69 A;  2XNQ A;  2G13 A;  4OZN A;  5SUH A;  3RBZ A;  4K4S A;  1LW2 A;  3MD1 A;  3K7R A;  2CJK A;  2AYG A;  2ZE2 B;  1WEZ A;  2XWX A;  1VQO S;  1HI0 P;  2VPZ B;  1CPZ A;  3BN7 A;  1XC9 A;  4P71 A;  5J1E A;  4QR0 A;  3T5L A;  5IC4 B;  1VK8 A;  4B9S A;  2KFN A;  2FB0 A;  3CCT A;  1KS2 A;  1RTI A;  4A8S A;  2APO A;  4B9U A;  3B4D A;  3U02 A;  3GIL A;  4O3R A;  1SBR A;  3U7J A;  1BN8 A;  3H2L A;  2J8S A;  2JVO A;  3IR5 B;  3KXD A;  4MKA A;  2UUA J;  3MMJ A;  5CZV A;  2LEB A;  3O44 A;  2W9B A;  3P4U B;  2HVI A;  8RUC A;  3WIU A;  4R8U B;  1IUJ A;  4JI5 J;  2ZNZ A;  2HPU A;  2FY8 A;  3IP0 A;  3E8O A;  4NLX A;  1UVK A;  3MFI A;  4JI7 F;  1WD6 A;  2ZBQ A;  5KFY A;  4DCO B;  2UV8 G;  4HVZ A;  2KXH A;  4KB7 A;  4P2M A;  2CAJ A;  4ERD A;  4QR2 A;  3ZZ0 A;  5JVG Q;  3CCE S;  1C0U B;  2NZC A;  2A6M A;  2PA3 A;  2VBW A;  4O3N A;  1W26 A;  4AYB D;  1NK7 A;  4XLE A;  2MKH A;  3EM1 A;  4RUH A;  1IBM J;  1HWJ A;  4TY8 B;  2E5H A;  4YB1 P;  3HFV A;  5EWE A;  4EI2 A;  2HVZ A;  2VDH A;  3FEX B;  3T19 A;  3FKB A;  3SQG A;  4F8R A;  2XM3 A;  2CNL B;  3JTN A;  1VQ9 S;  2MY8 A;  1CJV B;  4ZP7 A;  2VJV A;  2E9T A;  1T7P A;  3EZO A;  4KGX B;  1ZAX A;  4KGV B;  1WTB A;  4OI2 A;  3Q23 A;  3G8Q A;  4HH0 A;  1GTE A;  4IH7 A;  4LF8 F;  2M9K A;  4DLE A;  1TKD A;  5J2N A;  2G0I A;  4CO2 A;  4IFV B;  2RJZ A;  2CPX A;  1TL3 B;  1M1K T;  5J2Q B;  2HRU A;  3W8G A;  2F7V A;  3HP6 A;  1N34 F;  1G3O A;  2GO9 A;  2WOM B;  4KFB A;  3SSR A;  2EI5 A;  2Z2L A;  3PV8 A;  4UY8 T;  3Q8S B;  1EE6 A;  3OFE A;  4MFB B;  1S6U A;  1WC1 A;  1X9W A;  1AYE A;  3I32 A;  4ZIW A;  5CYM A;  2BXJ A;  1QTN B;  2KVI A;  5IZH A;  2UVV A;  2HWH A;  3DHW C;  2PE8 A;  5KFQ A;  3U1N A;  3LMW A;  2OPP B;  1XBW A;  3MAA B;  4B3S F;  4XK8 C;  4FF1 A;  1KTV A;  4NA3 A;  1HFE L;  1RLD A;  3EUN A;  3CJ5 A;  4C11 A;  1V3S A;  4IFY B;  2KT5 A;  1WOR A;  4LFA J;  2UUB F;  3JX8 A;  4P7T A;  3KHL A;  1I94 F;  3ZZP A;  2RE1 A;  4RW6 B;  4NI2 A;  4KHR A;  4PRF A;  1QDU B;  3UNY A;  4RW4 B;  4DU8 A;  3HHN B;  3CED A;  4RX6 A;  2FPH X;  5A6W A;  4YHH J;  4DCP B;  2LVW A;  2CQG A;  2PI4 A;  2GGP A;  2IC3 B;  1RA7 A;  3GJR B;  3HT0 A;  1CQN A;  4USU A;  4EUV A;  3K89 A;  5HAN A;  4EBE A;  1Q82 T;  1KVK A;  1CJT B;  1TU0 B;  2RUS A;  4JI2 F;  2B7C B;  5DM6 Q;  1MWY A;  3X3U A;  2HK3 A;  3OD2 A;  5U47 A;  1ZYQ A;  4RJV A;  3JXO A;  2XTJ P;  1NZA A;  4KFB B;  1JJH A;  4NLT A;  1MN7 A;  3PJ9 A;  5DG9 A;  2E7W A;  4YEJ A;  1Q4R A;  1T03 A;  1TV6 A;  4QIE A;  3TA0 A;  2UVU A;  1URR A;  2YKQ A;  1JLB B;  1A7G E;  2MZJ A;  2XLJ A;  1KOH A;  1RJJ A;  1RT7 A;  2W4C A;  1DAB A;  2HZV A;  1S9E B;  3IR6 B;  2CDR B;  1SL1 A;  1RTZ A;  2J6U A;  5HVH A;  1RA6 A;  2CYY A;  1N54 B;  3DRR B;  3QT6 A;  4ZDN A;  5HQL A;  5KFE A;  1VI7 A;  3CCR S;  1AT1 B;  3QIP A;  1FDD A;  1KDN A;  1JQG A;  2MPU A;  4OYA A;  2INU A;  1UEV A;  5CHC B;  3TW0 A;  3LYC A;  3DYA B;  4UOF A;  5T14 A;  2WBR A;  4USH A;  4NLU A;  3BH6 B;  2OHD A;  2HMI A;  2BZ2 A;  3A8K A;  2OSQ A;  3FBF A;  3LP0 B;  3PYE A;  5HLF B;  4AXI A;  3VGU A;  3A12 A;  1RKI A;  3HUL A;  3V2U C;  3ENW A;  1H2V Z;  4AQY F;  2VFU A;  4RNO A;  1ZM3 A;  3W9H A;  3T1H F;  2VOO A;  4G1P A;  1DTT B;  4U4B A;  1RTD A;  2BDP A;  1F6T A;  4F02 A;  2F3J A;  4EK2 A;  2VJU A;  2PSZ A;  3R5J B;  2O67 A;  1E6Y B;  5MLC V;  5E3C A;  4NML A;  2X85 A;  5BYS A;  1RP5 A;  4I4B A;  4DOZ A;  3GQ8 A;  4NLS A;  3PW7 A;  4F2S A;  2DNK A;  1FDA A;  5F8N A;  1IKW B;  3BBF A;  3U1M A;  4F4A A;  3V6D B;  3AOD A;  5HK4 A;  3EGN A;  1WUU A;  1GFW B;  5HMY A;  4JI0 F;  1EZG A;  3R97 A;  3UN2 A;  3MEC B;  4ATN A;  2YPZ A;  4XR6 A;  4OZ2 A;  1R8C A;  2IMW P;  3MR6 A;  4L75 A;  1B0P A;  5AE1 A;  3TZX A;  1QUP A;  4YEI A;  3F56 A;  5B0G A;  3ENV A;  1K5C A;  2AV5 A;  2B5J A;  4NXN F;  4O3S A;  1HHQ A;  5CYJ A;  1LW2 B;  2DHA A;  1QJH A;  2JOQ A;  4MK9 A;  4A46 A;  1TR0 A;  3M2V A;  4EMD A;  5L1J A;  1JJ4 A;  5A0Y B;  5CAB A;  3H2U B;  4LRD A;  1H2U X;  4YHH F;  4LFB F;  2KFZ A;  1OSC A;  1ITP A;  1V5V A;  4V1A k;  1KRP A;  4N56 A;  2CPH A;  2LXI A;  5ETL A;  1OY6 A;  4OJ3 A;  4DV1 J;  1VRU B;  3CCS S;  3PEH A;  2EFQ A;  4ECT A;  1X4F A;  3IG1 A;  4WK1 A;  2VIH A;  2C2K B;  3NAW A;  2W4D A;  1KWM A;  2CQC A;  2LXU A;  3UCG A;  3CJK B;  5D3G A;  1NAQ A;  3FRZ A;  2OGU A;  1MMD A;  1FKO B;  1WEX A;  3S01 A;  3TUZ C;  1B7Y B;  1RTJ B;  1UP1 A;  1TTH B;  4M5D B;  5F8J A;  2NTQ A;  2HVH A;  4AL6 A;  3DMJ B;  1A0O B;  1HL6 A;  4YQW A;  4MYU A;  1NKC A;  2E1P A;  1VS3 A;  2VG7 A;  1R8B A;  1X4A A;  3M6X A;  1ARO P;  4RUA A;  1DBG A;  1RMG A;  1DBO A;  2BBE A;  4HAC B;  4NEY A;  2UUW A;  2DRD A;  2FLL A;  2KTQ A;  5KFB A;  5GVQ A;  1Y0H A;  4ZVP B;  4JUZ A;  4DV6 J;  1KC8 T;  2GVD A;  2YWW A;  3DHX A;  3LQV A;  5G0R A;  1N52 B;  1H80 A;  4KT0 C;  3SCL E;  4U6P A;  2X1A A;  3VGV A;  1YJW S;  4NLG A;  1MSW D;  2FIU A;  4KGM A;  1S1W A;  2C28 A;  2VBY A;  1GEH A;  4G6V B;  1DHM A;  2Z4P A;  4ZVE A;  1KOO A;  1F1B B;  2W2P P;  1I51 B;  2Y3Y A;  3M32 A;  1S57 A;  1GQ8 A;  4XKW A;  3FCV A;  3QWP A;  3UR3 C;  3OQ2 A;  2R2R A;  3CUN A;  2PC6 A;  2Z2Y B;  1OFM A;  4UOC A;  5IQQ A;  4ECU A;  2BQ3 A;  2ZZT A;  1S0V A;  2AJ1 A;  1IVZ A;  4XPC A;  2QYG A;  4DV1 F;  4Y2A A;  4U67 Q;  3FSI A;  3W62 A;  3KLG B;  4F67 A;  2QMU B;  2E5I A;  3N28 A;  4TLR A;  2QC3 A;  1HNI B;  1RT3 A;  1RSC A;  5CD4 H;  1Z2Z A;  3HKZ D;  3IBF B;  5F8M A;  3UD3 P;  1YJU A;  1L3U A;  3RIQ A;  2FJV A;  1C1C A;  2EFG A;  2MQ8 A;  4NCG A;  5F3T A;  4R5P B;  4HWV A;  1Y11 A;  1IQZ A;  5D8H B;  3NS6 A;  3DOM A;  2YWE A;  3B6B A;  2E1M C;  2Y1R I;  3R7N B;  2FZK B;  4J9K A;  5K8M A;  3ZPP A;  3B4M A;  1L1I A;  1HMV A;  2ACM A;  3RUB L;  1N48 A;  5DQG A;  4UZB A;  1HW8 A;  3WQP A;  1IDJ A;  1IKX B;  1VQL S;  1WF2 A;  2J8I A;  5KFK A;  1RYS A;  1TZ0 A;  1X5O A;  2DNZ A;  2IPO B;  3C6U B;  4MK7 A;  4DR2 F;  1YRT A;  4FZV A;  3CGI A;  4JV0 A;  1UFW A;  3QO9 B;  4I6A A;  5F9N A;  1FEH A;  3FCH A;  4ZPD A;  2XY5 A;  4YDT A;  3FSX A;  4X66 F;  3I87 A;  4I2Q A;  4C4W A;  1JLF B;  1MU2 B;  1B64 A;  4URQ U;  1HD0 A;  2V2Q A;  4OZ0 A;  1FRJ A;  1WDD A;  4ID5 A;  5LOQ A;  2E1R A;  2GX8 A;  3M6U A;  1S99 A;  2G4B A;  3BGU A;  3PZP A;  2R7S A;  3TA2 A;  2KZM A;  1WC6 A;  1Y9O A;  2BRK A;  3DOL A;  4BHQ A;  2HFU A;  4X4Q A;  2UXB F;  2B4U A;  3IS9 B;  3SDE A;  1P1L A;  2UVF A;  4HLB A;  3PIP Q;  3M1V A;  3G86 A;  4OV1 A;  5ETT A;  4ANE A;  1T9Y A;  2YNI B;  1UZD A;  1VR6 A;  4EZ6 A;  4DPU A;  4J9M A;  2KJW A;  2FYX A;  5CA5 A;  2PFF B;  1HD1 A;  4QCL A;  3D28 A;  2PEB A;  2QMX A;  1R6V A;  2VU5 A;  4GC6 A;  4EWT A;  2XTY A;  1U26 A;  3HKW A;  3HZE A;  4DN0 A;  2IVM A;  4K7Q A;  3MEK A;  3L95 X;  1HNV A;  3ILL A;  1EJ7 L;  2FHO B;  2ZDP A;  3LTO A;  2AJ0 A;  4ZPT R;  2C2R A;  2IAJ B;  4J9L A;  2PD1 A;  5EX0 A;  3H7H B;  1CZF A;  2ODL A;  4K2X A;  2MHN A;  4QIV A;  1PJ5 A;  1SQE A;  1PYS B;  2KM8 C;  4OZ3 A;  2XO7 A;  4IOA Q;  1Q79 A;  4PYA A;  3W66 A;  4DV5 J;  4IG3 A;  5AXM A;  5IWA J;  3B90 A;  2XZT B;  2JEI A;  2DNN A;  5L1L A;  2DYA A;  4OJG A;  3N6L A;  3FRY A;  1CEZ A;  4ZVF A;  3BDP A;  4X4T A;  4OI3 A;  4ED7 A;  2B9W A;  2QZ8 A;  5J2N B;  2E7X A;  3ZTS A;  2V4J A;  1RWN B;  2DO0 A;  2B0R A;  4RNM A;  2DB1 A;  3D1H A;  4V19 J;  2LDY A;  2CZ4 A;  3D0I E;  4BWJ A;  1TUW A;  3BBB A;  2VFQ A;  5A8K B;  1AA1 B;  4GO7 X;  4DS4 A;  1KQS R;  4DV7 J;  4C2L A;  2OPQ A;  1YDL A;  4IG0 B;  2ZH5 A;  4YEL A;  3PG9 A;  2BJ8 A;  3I9V 9;  1KFD A;  2CPD A;  5JXS A;  3FC9 A;  4BCA A;  4EGL A;  5L8R C;  4QIW D;  2HWT A;  1KEK A;  2XYG B;  5KFM A;  4B9V A;  4YFO A;  2D74 B;  2E44 A;  1RWO B;  1C4C A;  1V3Z A;  1ZBT A;  2PFD A;  3W2W A;  4CLY A;  2WK4 A;  4ZKA A;  1WI6 A;  2UXC F;  1MNE A;  2A2C A;  3JSY A;  4DCJ B;  4CH1 A;  3C15 B;  1C0U A;  4CDI A;  4BBY A;  3CD0 A;  1WI8 A;  1UWB A;  2DH7 A;  2QE5 A;  2VBX A;  4DPO A;  4HTI A;  5C2G A;  4ZPC A;  1Y3J A;  5HBM B;  4YB6 A;  5ETO A;  3TUP A;  1S6Q B;  4UT4 A;  3LP1 B;  3SY2 A;  4R25 A;  5KOX A;  3HO1 A;  3EZ5 A;  2ZWP A;  4ZLL A;  3J7Z 5;  3TX8 A;  5H9F K;  4RL1 A;  5HSP A;  2HQD A;  3CJ3 A;  4UZC A;  4QBU A;  3PRD A;  1RCO B;  4CWB A;  1S0N A;  4C8Z A;  3M2U B;  4ED3 A;  2B4P A;  2GVD B;  2MQQ A;  1ZPV A;  3F41 A;  5B0E A;  4CIO A;  3NGS A;  3NOC A;  1GXL A;  3GIJ A;  1NPR A;  3ENA A;  3GZ7 A;  2IM3 A;  3DRS B;  3C3L A;  4ICL A;  2ZJR Q;  1NSA A;  3AQP A;  3BKF A;  3DMJ A;  3QNW B;  3B8Y A;  3I31 A;  4L76 A;  1DTQ B;  3ETM A;  4PUO A;  4U8V A;  1K8F A;  1PSD A;  3DXB A;  1C1B B;  3DGP A;  5JLV C;  3UD5 A;  4OV6 A;  4QJV A;  3CJS A;  1RAD B;  2GJI A;  1HQU B;  3GII A;  2I5J A;  2M0G B;  2OJ3 A;  4G1I A;  4WF9 Q;  2UVW A;  4LF7 F;  2KYX A;  4Y2I A;  3F73 A;  3MMB B;  4Q0B A;  1EQ0 A;  1RIS A;  4X65 J;  2L48 A;  2IMO A;  1KBR A;  5I42 A;  1D0E A;  4ECQ A;  1FXR A;  4XOT A;  2MKC A;  1UJ5 A;  1YZ7 A;  3D0G E;  3AJ2 A;  2GW8 A;  4LSL B;  1CQM A;  4Q8E A;  1APS A;  3P5T L;  5KG2 A;  4OYX A;  1S0O A;  3N5F A;  2IM2 A;  3QAE A;  1RT5 A;  3PX0 A;  2VC0 A;  1FVS A;  5CCM A;  2AX1 A;  4O3O A;  2GZO A;  4JI3 J;  2H5I B;  3IWL A;  1RWR A;  4USJ C;  2GNK A;  3W2V B;  1FK9 B;  2HHT A;  3ET6 A;  1NDK A;  1QY7 A;  4OYM A;  5D15 A;  3WDO A;  2E5L F;  1X4E A;  4HHJ A;  4XIU A;  4DFM A;  5ETN A;  4CO1 A;  4N5S A;  2Z56 B;  2BJD A;  2DR5 A;  2AEM A;  1AW0 A;  2R7W A;  3OXL A;  4YS2 A;  1GAO A;  2ZHB A;  1CJK A;  4LFC J;  3M8Y A;  1X4G A;  1IKW A;  3MR2 A;  4LRF A;  1T02 A;  4M8L A;  3PKY A;  2DO4 A;  2F8M A;  3VZH A;  3FDS A;  5DET A;  4LF2 A;  3M9N B;  1HNW F;  5LXY A;  3OVB A;  2HHP A;  2DTJ A;  5JUM A;  1ZA1 B;  4P73 A;  5F9L A;  3ELH A;  2V34 A;  3DU6 A;  4XON A;  2BAB A;  3HVT A;  4OLO A;  5LJ3 Y;  4WFB Q;  1JNR B;  2Y8W A;  5KAK A;  1HAR A;  2R42 A;  4KBI A;  2QA4 S;  3T1Y J;  2EC0 A;  3PFO A;  3CJ2 A;  1T3N A;  3QAT A;  2WSF C;  2R7V A;  2MQP A;  5KFG A;  1S1T B;  2OEM A;  3VF0 B;  3CF5 Q;  4H54 A;  2DGX A;  2RH3 A;  5BYR A;  2JLG A;  1K44 A;  2QRR A;  4OYW A;  3CCM S;  4B9M A;  3R6L B;  1ICE B;  2BJE A;  1BLU A;  3KUE A;  1ZZN A;  4ZHR B;  2BJ3 A;  3GON A;  4TQR A;  2FVC A;  2JLF A;  1KCC A;  1RWV B;  1LW0 B;  3MM6 A;  4K4X A;  2UVR A;  3CT9 A;  1H6K X;  3DNC A;  3AD7 C;  3I0S B;  3MGJ A;  2VIC A;  4M5H A;  5LJ5 Y;  2VA2 A;  1JLC B;  2BM4 A;  2G2Y A;  2RML A;  2G9O A;  2NTP A;  2PMW A;  1OFD A;  2AHO B;  2FGO A;  4HI1 A;  1N36 J;  3Q8V A;  5BR8 J;  1IJF B;  4A8Y A;  4LFA F;  4DR4 J;  4DUY J;  4MIB A;  1N32 F;  4NA2 A;  2I0X A;  5F0W A;  2YWF A;  1B99 A;  4XDC A;  3CB4 A;  5F41 A;  5GAG U;  1NH7 A;  3BRE A;  5F8I A;  3G87 A;  3KLF B;  4LBI A;  2Z2M A;  4CLL A;  4GVL A;  5KG7 A;  2CAD A;  3THV A;  1FWL A;  1BE4 A;  1M1G A;  1N0V C;  5GME A;  1KCD A;  2F63 A;  3AQO A;  4IG3 B;  2NZ4 A;  4JV5 F;  4OM9 A;  1S6P B;  4AL5 A;  1JX4 A;  2DNH A;  2IOU G;  2ZDO A;  4XOP A;  1R0C B;  1Y5N B;  4K4W A;  4K0K F;  2GIR A;  3VR1 A;  2HFO A;  2V94 A;  4AXJ A;  4J9O A;  2ERR A;  1S77 D;  2AGQ A;  1G1X A;  2XG8 A;  4M5D A;  3US5 A;  3ET6 B;  3CJ4 A;  2CRL A;  2HAF A;  4RW9 A;  2RDI A;  5MAO A;  1N4L A;  1P1T A;  2Y0S D;  4E0D A;  2VFV A;  2XO6 A;  4EO6 A;  4FBU A;  4OJH A;  2HGL A;  1RTH A;  2XI3 A;  2R3V A;  4ZLP A;  1PKU A;  2N7C A;  1TFW A;  1AFJ A;  1O8M A;  4LF6 F;  1WKK A;  4RLE A;  3HHD A;  3NGD A;  1SQG A;  1A9N B;  1FWK A;  5A8R A;  5D4P A;  2BKN A;  2CJY B;  3QFW A;  1D9A A;  2V2Z A;  5HMX A;  4W98 A;  3SBM A;  3HVR A;  2QYC A;  3LAK A;  4YUD A;  1KR4 A;  2QA4 G;  3Q2T C;  2HS4 A;  1TFY A;  3TJ9 A;  2CPY A;  3FQK A;  1FE4 A;  3NRB A;  2ROP A;  3VGT A;  4C8M A;  2DRB A;  4FP9 A;  4A8O A;  3J7A 1;  3QT7 A;  3AAW B;  3WHI A;  3Q8P B;  2VOP A;  5IFM A;  5D0E A;  3TVZ A;  4ED1 A;  4ZOS A;  3JSM A;  2EBG A;  3GV5 B;  3MHY A;  1IBL F;  5A76 A;  4IO1 A;  2WVC A;  2E29 A;  5JMN A;  1OOC A;  1IQT A;  1T8E A;  4ED0 A;  2HND A;  5M2R A;  3MCN A;  3MM9 B;  3PHE A;  2PN6 A;  1XER A;  1W2I A;  4JRA C;  2P9C A;  1UAW A;  2VF3 A;  3GSI A;  4DDF A;  3KNA A;  4DX7 A;  3Q22 A;  2X6X A;  3HZG A;  3Q2S C;  4YN3 B;  1KTQ A;  1X4B A;  1Y3K A;  1PYT A;  1IKX A;  4ZJO A;  4CT9 A;  2ZBR A;  4DPW A;  4U95 A;  1S0M A;  4USV A;  2G0C A;  2R8G A;  3FNN A;  1CC8 A;  1WKJ A;  3KG0 A;  5KFO A;  1REG X;  3R5A A;  1YI2 S;  2AEJ A;  1TEL A;  1C1C B;  3GJT B;  1C0T B;  4NCG B;  4K50 A;  4ZN3 A;  3ZC4 A;  2VFM A;  1HNI A;  2XLK A;  3CPW R;  5A2Q Y;  1G7C B;  3W7B A;  4JI1 J;  1UMJ A;  2CG4 A;  4UUW A;  3X1L B;  2EFN A;  3C15 A;  2V69 A;  4NCA A;  2WBM A;  1HIY A;  4UOH A;  3M32 B;  2FC9 A;  2OMO A;  2ALY B;  2CQH A;  2IA0 A;  4Z7Y A;  3RGI A;  1IKY B;  2B56 A;  4NYZ A;  1GH8 A;  1RGV A;  3G6X A;  1JLA B;  2BSP A;  2BW7 A;  3Q86 A;  4DQP A;  1X0P A;  3IWN C;  3A3O B;  3ZZU A;  1U4B A;  1RT4 B;  1IKV B;  5HAT A;  1X5T A;  1XNQ J;  1KQG B;  3BV8 A;  4X4O A;  2MDA A;  1VFJ A;  2BX6 A;  2KXN B;  1T05 B;  2CQB A;  3N79 A;  3OFH A;  2ILY A;  2B9X A;  2C2Z B;  3BO4 A;  3P45 B;  2HND B;  2CJ9 A;  2MKK A;  1IBC B;  3RYL A;  1ZPW X;  2WHO A;  2EG2 A;  4L3K A;  1EA0 A;  1NJW A;  3GG0 A;  2P6S A;  3GFX A;  1A6L A;  1FRX A;  4OJ5 A;  2AIR B;  3N6M A;  2EFO A;  3BQ1 A;  1J2V A;  1PJ7 A;  1RAO A;  4EBD A;  2C2E A;  1FJC A;  4WZM A;  1TUG B;  4RU9 A;  3WC0 A;  2BQR A;  2V0N A;  1UEK A;  2QLW A;  2F65 A;  4RUC A;  1VRU A;  1UVM A;  1OO0 B;  1QAY A;  4C3K A;  4O44 A;  3J81 U;  2OFG X;  2AP6 A;  3D66 A;  1YK9 A;  2BE2 A;  3POT B;  3MCM A;  4A8F A;  4LBP A;  2ZBI A;  1H73 A;  3T6B A;  2ZH4 A;  1HYS B;  2RB7 A;  1WSR A;  1R43 A;  1RB0 A;  5KFW A;  5B09 A;  4QU7 A;  3JTP A;  4OI1 A;  3V4I B;  4KGK A;  3P4G A;  1OYE A;  4M95 A;  4PWD A;  1NM2 A;  2W1B A;  1WOP A;  1YRU A;  2CWK A;  2XI2 A;  3GCW P;  3IM8 A;  2A6O A;  1N88 A;  4DZD A;  2M2B A;  4B9T A;  4K0K J;  4WFX A;  5LSO A;  4CO3 A;  3M30 B;  4JI2 J;  5DG7 A;  3PHT A;  2FHK A;  5CYQ B;  4YZQ A;  3D5M A;  2AJ4 A;  5K5M A;  1GX6 A;  2IM0 A;  1VBZ A;  4C8K A;  1AIR A;  4PXB A;  1T9T A;  1KQF B;  5KFF A;  1HNZ F;  1XG2 A;  3G6Y A;  3E3X A;  3PXG a;  1R8A A;  2R2U A;  3GMG A;  2RIL A;  2J0X A;  2LA4 A;  4M94 A;  2F3L A;  2HVD A;  4L6V 3;  1X60 A;  3TAN A;  3AD8 C;  2VOD A;  5JMC B;  1ZM4 A;  1K47 A;  3TVK A;  4I69 A;  2EW9 A;  5GAG I;  1XMO J;  3H98 A;  2E1C A;  4KGZ B;  2EFV A;  2NPF A;  4DX5 A;  3H5U A;  1WC4 A;  1Q81 T;  2NS1 B;  5A8W A;  5LSR A;  4V19 X;  3MCO A;  3NG8 A;  4IQM A;  1NBE B;  4N77 A;  1RU4 A;  1HLW A;  4ED4 A;  4URR A;  1XR6 A;  1RAE B;  3KDO A;  1JKH B;  1RBL A;  2BJ7 A;  3BYP A;  3K8W A;  1MRO A;  3O2I A;  3CDU A;  3ZNU A;  3EVW A;  5KT3 A;  3BM7 A;  2HYI B;  3N01 A;  4MR0 A;  1OSD A;  1SCJ B;  2FDN A;  4ZVH A;  2QIF A;  1LW0 A;  4C3L A;  5KT7 A;  5IM0 B;  3M8S A;  2DR9 A;  5F0U A;  1UVJ A;  1RUS A;  1RXO B;  4ITS A;  3J7A N;  2WON A;  3I96 A;  2XCP A;  4J9Q A;  3CE8 A;  4FVM A;  1K1S A;  1N34 J;  4O3P A;  3BH7 B;  1XQI A;  3E51 A;  3M8P B;  1TYW A;  1FNM A;  4CLF A;  5J2P B;  2R9L A;  3NNA A;  4X4V A;  4C6A A;  3JSB A;  4FN5 A;  1JB0 C;  3CO9 A;  3ZTO A;  1SJ1 A;  3KUG A;  2LP4 A;  3MPW A;  1M5P C;  4C98 A;  1WG4 A;  2YQ3 A;  2DNL A;  5LL6 d;  3CCU S;  4FXD A;  5GAH I;  1CC7 A;  2MQN A;  3HLU A;  4DXL A;  2Y1L B;  3IGN A;  1TL1 B;  3MMA B;  4M5K A;  5C25 A;  4K4T A;  2Q6C A;  5B0D A;  4FF2 A;  1U49 A;  4KO0 B;  1TYU A;  2DGW A;  4HI2 A;  3UD4 P;  1WHX A;  3I6P A;  2RKI B;  3VZI A;  2N82 B;  3UCU P;  2YX1 A;  2W9C B;  2WW8 A;  4RWW A;  4CM2 A;  4I1T A;  4KRW A;  5BXI A;  1SL2 A;  1U7L A;  2GV1 A;  3HDS A;  4ZMM A;  2GCF A;  3SZE A;  2FHJ A;  2K2P A;  3DRP B;  3KWM A;  5F8H A;  4Q45 A;  4G65 A;  2NUU G;  4LF5 F;  1RAF B;  3C2P A;  4NLY A;  3Q24 A;  2F40 A;  2N7Y A;  1EKS A;  1RT2 A;  3PYD A;  4DR5 J;  3A4T A;  3HCX A;  3ILO A;  4I0W A;  4DL4 A;  1LV5 A;  4XNF A;  2BUN A;  4ED6 A;  1KVJ A;  1WF1 A;  2AZ3 A;  3VVU A;  1HA1 A;  3EE3 A;  1XNQ F;  2BAN B;  2RUG A;  4DR3 F;  5HJX A;  3BBC A;  1F5B A;  2L3M A;  2NSC A;  1UJ4 A;  3HHL A;  5KFI A;  3GPA A;  3L7U A;  4NAS A;  1B0T A;  1J5O B;  3AA9 A;  1V3R A;  5I3P A;  2IA6 A;  2DIV A;  2UUC F;  4IQX A;  2R7U A;  3CD6 S;  1S48 A;  2M4M A;  1NHC A;  2YNF A;  1X9S A;  1HI1 A;  2QLJ B;  3DGV A;  5E5N A;  4AT1 B;  1XR5 A;  2MQO A;  1S1V A;  2WB1 D;  1UZH A;  1QVG R;  5GAE I;  3L3C A;  3SYZ A;  2HBZ B;  4G1Q A;  5KG5 A;  1QSY A;  4Z05 A;  2H9Z A;  4Q0B B;  1LFW A;  2DCL A;  2Z8G A;  2RQK A;  2HHU A;  2DH9 A;  4YZA A;  2YBV A;  1RAC B;  4ES2 A;  2AEF A;  2H51 B;  3OVS A;  4ZVS B;  4IOC Q;  4DUT A;  4DFJ A;  3LWM A;  2ZC4 A;  3RBX A;  2WOM A;  1Q78 A;  2WB4 A;  3PEJ A;  5KT5 A;  3K59 A;  4EZ9 A;  2ROE A;  3GR0 A;  1DTQ A;  1PIE A;  5E33 A;  5L46 A;  1U47 A;  2WAQ D;  1FWP A;  3C16 A;  3OXF A;  1WEL A;  4DV3 J;  2NSB A;  5D4L A;  4ECR A;  4K4Y A;  4QQB A;  1S59 A;  1Q95 G; 
#chains in the Genus database with same CATH homology
 2DXD A;  2BM4 A;  1NLK L;  3N90 A;  2VFQ A;  2AZ1 A;  3BBB A;  3ZTQ A;  3Q8V A;  4AND A;  2B8P A;  4WBF A;  4HR2 A;  3FC9 A;  1B99 A;  1KQ5 A;  2BM6 A;  2DXF A;  3Q89 A;  2ZUA A;  4ENO A;  3P4G A;  1BE4 A;  2CWK A;  2BM5 A;  4FKY A;  1NSK L;  4OM9 A;  3NGR A;  1VYA A;  4KPC A;  2NCK L;  2W7Z A;  2IOU G;  4OJO A;  4OPW A;  3FBB A;  1QA2 A;  3EVO A;  1NDC A;  3SYJ A;  3GP9 A;  2V5I A;  1NSQ A;  1NPK A;  3DKD A;  4DI6 A;  3EVM A;  1U8W A;  2F3L A;  2HVD A;  3JS9 A;  4CP5 A;  3JX8 A;  4ANC A;  1QA1 A;  1PKU A;  5JMC B;  2BEF A;  3VGV A;  1WKK A;  1NDL A;  1LEO A;  3NGS A;  2YUH A;  4UOG A;  2B8Q A;  1S57 A;  1W7W A;  3FCV A;  4W98 A;  1QRB A;  1HLW A;  2VFN A;  1NHK L;  3ENA A;  4OJL A;  3EVW A;  1TSP A;  3NGT A;  3ETM A;  3G2X A;  3Q8Y A;  1K8F A;  3VGT A;  1BHN A;  1UCN A;  3RIQ A;  5JLV C;  3FCW A;  1HF2 A;  3R9L A;  1ZS6 A;  3Q83 A;  3AK5 A;  3DDI A;  1F3F A;  4F36 A;  1WKL A;  1MN7 A;  3PJ9 A;  1B4S A;  4FKX A;  2XC1 A;  3BH7 B;  1XQI A;  3B6B A;  1TYW A;  3PRV A;  3LJY A;  4C6A A;  3NGU A;  3ZTO A;  2DY9 A;  1DAB A;  5IOL A;  2J8I A;  5C7P A;  1QQ1 A;  2BM7 A;  1TYV A;  2VFO A;  3VVT A;  1TYU A;  3B54 A;  1K4Z A;  4ANE A;  1KDN A;  1WKJ A;  3EJM A;  1NSP A;  3LYC A;  3ML3 A;  4V02 C;  4UOF A;  1QRC A;  4OJP A;  3BH6 B;  3VGS A;  5BXI A;  1CLW A;  3SZE A;  1NB2 A;  1TYX A;  1WXR A;  1NDK A;  2VFM A;  3FBF A;  3WX8 A;  3VGU A;  3N6Z A;  2HVE A;  2G0Y A;  4OJ6 A;  2AZ3 A;  3TH0 A;  1HIY A;  4UOH A;  3VVU A;  1BUX A;  1F6T A;  3EE3 A;  4EK2 A;  3BBC A;  2VU5 A;  2HUR A;  1NUE A;  3ZTP A;  3H09 A;  1EHW A;  3GPA A;  3L7U A;  3Q86 A;  3ELH A;  4F4A A;  3BBF A;  1XIQ A;  3ZTR A;  5CAA A;  1LWX A;  3MPD A;  2BX6 A;  1PAE X;  1QA3 A;  4O0N A;  4S0M A;  3PET A;  2DXE A;  1MN9 A;  1NDP A;  3EMT A;  1K44 A;  3Q8U A;  3EM1 A;  4DUT A;  2VFP A;  4KH3 A;  1HHQ A;  2DYA A;  4DZ6 A;  4OJ5 A;  3FBE A;  1S5Z A;  5CAB A;  3FKB A;  3EIC A;  1S59 A;  1NCL A;  3FBC A;  3ZTS A;  2B0R A;  1JXV A;  4JRA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...