4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
5C1EA 2VBKA 1X0CA 2QY1A 2VJIA 2X3HA 2UVFA 1QCXA 1KCCA 1OGOX 4YZ0A 2VJJA 4Z06A 3VMVA 3T9GA 3B8YA 3EQOA 2X6WA 1OOCA 2UVEA 3GQ8A 4OZZA 3WWGA 5C1CA 4W8TA 4XL9A 1CZFA 2NZMA 2ODLA 4PMHA 3B4NA 4XKVA 1EE6A 1IB4A 1O88A 2X6YA 1NHCA 3GQ9A 4XNFA 3JURA 2EWEA 3UW0A 3VSTA 4OJ6A 2PYHA 4XN3A 4XN0A 3GQAA 4YZXA 4XKWA 3SUCA 3LMWA 1PLUA 1VBLA 4YEJA 1AIRA 4W8SA 2QXZA 1HG8A 1IDJA 4XMYA 1WMRA 1OFMA 1PXZA 1DBGA 1H80A 2NTPA 4XOTA 4OZYA 4I84A 4AVZA 4NK8A 4C2LA 4XQFA 1O8LA 4MXNA 1IA5A 4YELA 4W8QA 1O8IA 4XM3A 4XLHA 4Z05A 1BN8A 4OJOA 1RMGA 4XOPA 2NTQA 1KTWA 1RU4A 4OJLA 4XLEA 4XORA 2BSPA 4OJPA 2INUA 2Z8GA 3ZSCA 2NT9A 3EQNA 3KRGA 2O0WA 4XONA 2O17A 4Z03A 4XR6A 2O0VA 4XLAA 2VBEA 2QX3A 3GRHA 2NT6A 3FY3A 3B90A 1O8FA 1OFLA 1GQ8A 1O8MA 1DBOA 4MR0A 4W8RA 1OGMX 2X85A 4OJ5A 2O04A 2VBMA 1O8DA 4YZAA 2X6XA 1O8EA 3VSVA 1QJVA 2PYGA 1KCDA 3GQ7A 1RWRA 1O8JA 1O8HA 2NSPA 1JTAA 2PECA 4HWVA 4U4BA 5AMVA 3VMWA 1JRGA 4XLFA 1BHEA 2NSTA 4URRA 4NK6A 3VSUA 1O8GA 4EW9A 3ZPPA 2O1DA 1XG2A 4YZQA 4U49A 2IQ7A 1PE9A 1K5CA 1O8KA 2INVA 1IDKA 2NTBA 4XLCA
chains in the Genus database with same CATH superfamily
3VYSB 5JR3A 5DCFA 1MBFA 3LNQA 4QFMA 4B3FX 4E7KA 3Q0VA 2VOOA 1E1QA 2F5FA 1VQPB 4Z4TA 3WQZA 2CUZA 2E19A 3B8YA 4S0HB 3HXLA 5B66C 5A8AA 1MBHA 3OMYA 3OW7A 4RD0A 3E1YE 2R7WA 5DUIA 1J5YA 2ZZFA 1LKXA 3WNCA 4GDFA 3DF8A 1SKYB 2VIXA 1VFCA 3K70C 2ODLA 2A6EF 4OINF 3RKWA 3Q38A 3WY9A 3B4NA 1IB4A 1YS7A 1U8BA 3J7YJ 3TDUC 3I5UA 5E3LA 3IC7A 1M1KD 2XTYA 1I5ZA 1D8TA 4IPAA 3VPRA 1LVAA 4ENKA 1UB9A 1O57A 3FXQA 4IJAA 3VSTA 2GQFA 3RKXA 3WGIA 1E0EA 1WJDA 1TL8A 1XCBA 4W8SA 1P4AA 3S3OA 4DNRB 2BOLA 4Z4VA 1WFXA 4QIWN 1HKSA 2DCEA 4KMUX 4L5EA 4Q47A 1VQKB 3ONYA 2JVHA 1IXSB 1PP8F 2NAZA 1JT6A 2Y0SN 1K79A 2DETA 1Y0YA 1WH5A 1G7TA 2XAGA 1WU8A 1LNWA 3LSMA 1XS9A 1IB0A 3V4GA 4KITB 1RESA 1GVDA 3D5RC 4BEHA 2VQCA 5FROA 2Q8KA 3SEQA 3LSKA 1BOAA 3B02A 1B1BA 4A3DJ 1TVCA 2NTQA 1FOWA 3DTIA 4DQ2A 4QHYA 3GLLA 4OJLA 1RPWA 3WNDA 5DCMA 3HRUA 2VC1A 4YIIA 4UB8C 4ZZLA 2OPTA 4QPOA 1QFZA 1DP3A 3S3NA 3VSLA 1QRCA 3A4CA 2LBFA 1YRNA 5IYNA 1BJAA 2VBZA 4DIQA 5DEQA 3ECOA 2F5DA 1FBUA 3RKYA 2E34A 4OMZA 1S4MA 2PX9A 1R00A 2OBSA 1CF7A 1HZEA 5ICGA 2NVYJ 3L2RA 2KIFA 3DU1X 2Q6LA 4DK1A 2DPUA 1XCVA 1O8FA 4RAZA 2WZNA 1VQ5B 3TP3A 4BAYA 4WCGA 2NVXJ 1VQ6B 3EYIA 3OYIA 3REOA 1XGMA 3HB9A 4JX6A 1W36C 3K4BA 2P8TA 3CRZA 2RC4A 1ORKA 3CUQC 1VF9A 3KP2A 1T39A 3W5HA 2XZLA 5HZBA 3M1CA 2DTRA 1RUOA 2IRFG 4NHJA 1W0UA 3OPOA 1RWRA 4JQFA 5DM7F 2XASA 4BQAA 1WPCA 4KIFA 2MYSA 4WZKA 3VMWA 1DGRM 3ZBTA 1YIJI 2LREA 3GFJA 3CMYA 3CMMA 3HRSA 2B7EA 1SFUA 4C2TA 3Q3AA 2MFZA 2FOWA 3LA3A 4H0EA 5EGOA 3AFHA 3E1SA 3QYEA 3F72A 5GV7A 2MG4A 2X53S 2VBWA 2OA4A 3M8JA 4B4CA 4IEJA 1G7CA 2HZTA 5J3OA 2NTBA 3FXKA 5H59A 1G8XA 2E5NA 2GA2A 2DA5A 4ZYDA 3TOAA 1V5EA 3G1LA 5FD5A 3MAJA 3W6JB 1S7EA 1WZ2A 2IXSA 3DV8A 1QCXA 4MQ9F 2R7XA 3HRTA 4AIHA 5KHDA 4BXFA 4YCQA 3CCQI 1TZLA 4G94A 2L7MP 4DBRA 3ZMSA 3SQNA 2H09A 5M5YJ 2FEZA 2DIEA 3DKYA 2L02A 4V19K 1D5YA 1OISA 4OZZA 4RM2A 2V79A 3CC7I 1AWCA 4CHUA 1SFXA 3WBJA 3SZGA 5EMNA 1RZ4A 3MKYB 4HA8A 2JTVA 3IH3A 1QFYA 4PC2A 2RDPA 4MIMA 5J4YA 2F2EA 1QBJA 1S5LC 4BBSJ 3TGNA 1K6OA 1V54H 3KPHA 2M5SA 3LQQA 1ENHA 3JRDA 2DMQA 2JWTA 1HKTA 4KN4X 4LD5A 1PLUA 1VBLA 1D1BA 2ESNA 2EFPA 4YEJA 2HVRA 2D1HA 3HGGA 1GLNA 1Z6TA 1R71A 1U2RA 2LC2A 4AD9A 2BX6A 2HCJB 2VQGA 3HZJA 4P9UA 2M0CA 1YTYA 4E7ZA 2K4JA 4ITVA 3V7CA 3VFZA 4ESFA 4XQFA 5C4XJ 4PC1A 3SLDA 3W5VA 1P4XA 5IK2A 3OW2B 1KYWA 3GZ5A 2DLLA 2PFBA 5HDNA 4HQMA 1MMNA 2H6CA 4MEYF 3FPPA 2FOKA 2XKOA 5F4OA 1JHFA 3T8RA 2M0MA 3S1RJ 2DAOA 1E17A 2R9VA 2XKPA 2HDWA 2LY9A 4TN1A 3SEJA 1ULYA 4A5NA 2XVCA 2P7VB 1TLLA 2HDNB 4RD2A 2BSPA 1OCTC 3WHBA 2R7RA 2D3LA 5B3SH 1Z91A 1EFCA 3S15J 3H94A 1YG2A 2XPVA 2KMUA 2E7XA 1ODDA 3DBHB 1R5GA 1VQLB 3IHUA 2KKOA 3OAAA 3FMSA 3TL4X 1YX3A 4IOCF 4CZZA 1MJBA 3QFCA 4A3BJ 2DJIA 2JJ2A 3ASPA 1P92A 4UZFA 2DOFA 2CFXA 4LB5A 1E64A 1NK2P 2WAFA 1IN6A 3BH6B 3WTYC 4AIKA 4E7JA 1K8AD 2E36A 1O3TA 1DPUA 3QYBA 4TMXA 1CLWA 2CQQA 3M07A 3F23A 2CRVA 4YIRX 4FTHA 2CQKA 2V7FA 5K5RA 4I2OA 2VOPA 2MBFA 1B8IB 1MW7A 1XC5A 2Q6KA 4KKUA 4UV8A 4U0VA 2J8KA 3RYRA 1YO5C 1QX4A 4IOAF 3RYPA 1OCOH 2XPUA 5AMVA 3PNTA 3WTXC 3CC4B 4P55A 1NRKA 1VTNC 5J1RA 5DD4A 3OYFA 3LSGA 2F48A 2LD5A 2BW3A 2EH3A 2FMLA 3OOPA 1MBGA 4GQNA 1HOMA 4Q4ZF 3MFKA 1LEBA 2XAHA 2MLKA 3WTSC 3JTGA 1UD4A 2M87A 3PETA 1HA3A 1GO2A 1QG0A 2FVGA 4AF7A 2P5LC 1QQIA 3ZRGA 3OS2A 1B23P 2EILH 4B47A 3OYDA 4KJZA 2GK6A 2VBKA 2QY1A 2YPRA 2WAQA 4B1RA 4G7WA 3QOEA 2QEXI 1KK2A 3FXMA 1A8PA 2WB1N 2M34A 4A3EJ 2RKHA 1QA2A 3D5SC 1G2HA 2FU4A 4PJNA 2E7WA 1Q7YD 1FX7A 1MBEA 3E6BA 3J81k 2V1NA 3WTVC 2ZL5A 3GVKA 3PSIA 4Z4YA 3ABTA 3LL7A 1EJ9A 2OZUA 1UHSA 3V8LA 4F91B 1S72B 3DKWA 3ABUA 2N8GA 4RCZA 3QU3A 1ZRFA 1EA3A 2AXTC 1W2BB 5D6EA 3GVAA 3UW0A 2NV4A 3F3XA 2LK2A 3DEWA 2AO9A 4PJJA 2BZTA 1K78A 3ZIAA 4XN0A 2DA2A 2CV2A 5J40A 1D1NA 5HNHA 3JRFA 2EFGA 4ACBA 4IRHA 2IA0A 2QGUA 5GAGJ 3D5LA 4OPWA 3QOPA 1OFMA 3W2IA 4FETA 3T0YA 4BQNA 3FPKA 2RC6A 3R6SA 2JUGA 1R7JA 5JVGF 2QZAA 1H0MA 1H89C 1OCZH 3MD2A 1VQNB 1YLOA 3JTHA 4MXNA 1N25A 5LFAA 1MMDA 2XGEA 3OIOA 1H9TA 3HOYJ 4M74A 3CJNA 3OYMA 1H8EA 4WZEA 1KD1D 2BM5A 1DDNA 5EG0B 2UWMA 3PA1A 3H92A 3OEHA 1SD6A 3BDDA 4KICA 4II2A 2A3SA 3SEZA 5BOXA 3IWFA 4GYIA 2UZKA 3JQRA 2AHOA 1TYXA 4PC6A 5AN9A 3BPVA 2P5VA 4M3GA 4D7MA 2Q6IA 1QVFB 4Z03A 1JJ8C 1GV2A 2WYRA 1S8NA 1FYKA 1IN4A 2OQGA 4I09A 4XLAA 3CCMI 1V4RA 3RJPA 5CDFA 1I18A 2DMPA 1VQ7I 3WODF 2X6OA 2NT6A 4A0YA 1HW1A 1E3PA 3K70D 5LGTA 1DUXC 2QTZA 2WADA 2O8KA 1D2EA 4EATA 4YAUA 1HXDA 2JVGA 2HU9A 2QKMB 4LC0A 1VQ9B 1W5CC 4ASUA 4EJUA 5D8LB 1VLYA 1K4SA 3ZQ7A 4W1UA 3CDLA 1T0FA 2OCCH 4U0WA 2EIXA 2B0LA 2DT6A 3HOWJ 2DOGA 1F43A 2R7TA 2K5CA 3PUFA 1FRNA 1O8JA 3BOQA 3I71A 2VQHA 1ZLJA 4N9IA 2O5RA 2MC3A 4B44A 4IHWA 4XLFA 1HKQA 3WTTC 5J4VA 1TW3A 3CUQB 3ZMTA 1HDDC 4NK6A 4KFCA 1YX5A 4IZZA 2HPMA 3W6VA 1O7FA 2ZJRF 4DK0A 5IPAA 5IYQA 2EIMH 1U0JA 1USTA 3R60A 2IS2A 3CMEI 5L3FA 5FLVA 3CW2A 4M9SA 5EEAA 4BKXA 2PI0A 2INVA 4G12A 4OWRB 4FISA 2L9RA 1YX2A 3A01A 5C1EA 3VYTB 3OY9A 3BH4A 2GQQA 1W7PB 3BR6A 3E97A 3HSRA 2P81A 3KEWA 2OD5A 2DO7A 3P27A 3BLYA 2VNJA 2HXIA 2DA6A 3LNNA 4M2LA 1CQTA 3OP1A 1K61A 1QHHD 1BR1A 2GLOA 2BM4A 3T5XA 4XK4A 1KQ5A 2EZKA 1ACIA 1O88A 5HLIA 1FJLA 1XPXA 1Z6RA 2G0YA 1IW7F 3DPLC 2EWEA 2F1LA 2A5YB 1FSEA 1R49A 4XN3A 3FBIB 5GV8A 2WY8Q 2V4DA 1WSVA 2RN7A 4IXAA 2BXZA 4N9HA 4RPDA 1IDJA 4HNUA 2D3NA 3MHPA 2M45A 1ZGJA 2M8EA 2F5EA 1G3SA 1T8IA 1ZM3A 1NB9A 4X7DA 3OYBA 3BROA 3HPHA 4LMYA 2STTA 3HDDA 1FX0A 2K3PA 1H80A 3TP0A 5ICFA 4LK0F 4EMSA 1C0WA 1FDRA 1QPIA 2QBYA 1QGPA 4KNYA 3JU4A 3V8JA 1DABA 3L2CA 5DDGA 1X3WB 4TV7A 5EYRA 4IHVA 1FP1D 1B9MA 3C18A 4XLHA 4Z05A 3ZQLA 1YJNB 2FUG2 4CH7A 3HHGA 2PBIA 4GCVA 2Y0SA 1YHQI 2ZNYA 1ZG3A 1KTWA 4L18B 5CVJA 3CCUI 3O3KA 1XTAA 4ON0A 3U2RA 1ZLKA 2IS1A 2VBYA 4EVIA 4XD7A 2Z8GA 2LTPA 2MSYA 3DPUA 2W6JA 3BJOA 2BY0A 3CCRI 3H3UA 1MABA 1FZPB 2STWA 4Z4SA 1BJZA 1PVEA 3K10A 4V2GA 3MKLA 3BPXA 2MC4A 1X3ZB 4Y52J 4NC8A 1UFMA 2EFOA 4RLFA 4A5MA 3PENA 1LM1A 1A6IA 3Q0WA 1B72A 3BCBA 1GV5A 2K27A 5CLSA 4XLNF 3WG9A 2XGJA 4KIBA 1X58A 4IHTA 1PJ6A 1DBOA 2P4WA 3T51B 1AA7A 3T1BA 4I6ZA 2F4OB 2M2EA 3EDPA 1JKRC 4A3KJ 4ZTJA 4YZAA 1XMAA 2O6GE 1R6RA 4Y3OA 4KUMA 3ABMH 3CCSB 3K2ZA 2W00A 2WBMA 3E5XA 4S05A 1W0JA 4RD3A 3KP5A 1WOSA 4LB6B 3QFRA 5IY5H 2HR3A 2L5QA 3HOTA 2BN4A 2JN6A 4URRA 2J5OA 3E0JB 2PG4A 2L9VA 2Q1ZB 5D8KB 5C3EJ 1RUNA 2OCEA 2V1UA 3GSIA 1JGSA 4FK8A 3ZZUA 4EW9A 3PUMA 3PM1A 2E71A 2KIUA 2LF7A 2WWYA 2PJPA 1FNNA 3CB4A 1MD0A 4ESBA 3KETA 1SFOJ 1GDTA 3OFNA 2W57A 1IRFA 3IKVA 2Y9ZA 5E3NA 2OYNA 3S2DJ 1QFJA 5FGMA 4LIVA 2BSAA 3NWSA 2DJNA 4RBOA 1UELB 5TGTA 1K28D 4UUTA 4F93B 1OGIA 3PSSA 1BW5A 2BMWA 4CXFA 3OSFA 1XD7A 4AUXA 1I7PA 3PSZA 1WXRA 1ZGWA 5EZGA 3NARA 1REPC 4Z06A 2HNHA 4GRIA 2V26A 3UKGA 2B7BA 1U6GA 1OOCA 4QLCU 2BVLA 2CRGA 1T6SA 5HS7A 2CW8A 1X1PA 1ETOA 2GAUA 3GXOA 3GTQJ 2BHYA 5JBQA 1MNEA 2BEOA 2LH9A 4ZC3A 3ROUA 4S04A 1CZFA 2NZMA 4I02A 3VDXA 1XE1A 3R4KA 4UUSA 2E1OA 5CJ9A 1KQ9A 3MQ0A 4RMNA 2W24A 2R7DA 5IYRA 1A31A 2ECCA 1H8HA 1NHAA 4MO7A 2L3DA 5EEHA 1ZH5A 1IXRC 2QSFX 4C3HJ 2CNDA 1S29A 1R4MB 1XB4A 2KIMA 3BJ6A 3FBNB 5C44J 1ZKGA 1JKOC 2GJPA 2P6SA 2JIZA 4RGSA 4A3IJ 2LKPA 1PXZA 1R5ID 3LYCA 3K6GA 3CDHA 3F8CA 5K7HA 3IUOA 1T6XA 3CJRB 2OTJI 2CQXA 2V6EA 3IH4A 4RB0A 1U3EM 1FOYA 2LKSA 3N90A 3TO6A 5D5XB 1TYVA 4W8QA 3GEZA 3H35A 3PA2A 1WCMJ 2K7LA 2VE9A 4RD6A 2FBHA 2FJ1A 4Y7CA 3DWLE 3S1MJ 1F4KA 5CQEA 2E1BA 3CD6B 1VQOB 2V1XA 2XGDA 4ANJA 1QVTA 3CESA 1WOPA 1Y39A 3ZZTA 4NUBA 4HE6A 2INUA 3S2HJ 1FLIA 3PO3J 4UAJA 3M4OJ 3HEFA 4RB1A 1E1RA 2QYUA 3JRIA 3DLLF 4A3MJ 4B43A 4J0QA 1XQBA 2WZPP 1PYVA 5AIQA 2E2JJ 4DW6A 4EM0B 3GTMJ 1KYZA 2BY1A 2OF7A 5LMZA 3ZUGA 3U9GA 2HDDA 4IHYA 3JQQA 3FY3A 2VPLA 2C5HA 2X1EA 3ABLH 3G3ZA 2RGVA 4B48A 5HLGA 4RB2C 5HS9A 4NQWA 3ZMDA 4F55A 4R79A 1X1CA 2FNAA 3DTEA 4IVNA 4XRSA 3LFKA 2XTWA 2IT0A 3SHFA 1E43A 1G59A 3DBRB 5FRMA 3F9KA 3HL2A 4ZDOA 2BBYA 4FX0A 1JTAA 3E6CC 4BPRA 2EIJH 1MH4A 1RKTA 3QPHA 4UZUA 3QQAA 1TNTA 5BMZA 2X4HA 1TWFJ 3QYFA 2XUBA 2XPWA 4MGRA 1K4ZA 1KK1A 1J9ZA 2L01A 4P26A 2QQAA 2DFIA 1LUJB 1NG6A 3A0BC 1R5OA 4PSXA 5J6XA 2Q2EA 4U7DA 4O6JA 3OOCA 2VT2A 5E8IA 2R92J 1RQRA 3E7LA 5FO1A 3C1DA 5BSXA 1Z7UA 3AGQA 4YFNF 1IUFA 5EJCA 1ZR4A 3VMFA 2EWNA 2JRMA 3CCEB 1QUEA 1XSVA 5HOOA 4UV9A 3BT9A 1MJ9A 3O8GA 2ZFUA 3TQNA 9ANTA 2Y75A 1WDTA 2HPIA 3TW6A 1SKQA 2EZHA 2VFOA 5E3MA 2UVEA 3FDYA 3J7AY 2VASA 5FD6A 2HGCA 4HE5A 3KCCA 5EZHA 2K9MA 3AG4H 2CW7A 4M3FA 4PMHA 1YE9A 4N4NB 2Z2SB 3GTJJ 4CQJA 2W1OA 1BW6A 5BS6A 1YITI 2PIAA 1BI1A 1ZTRA 4W97A 4XNFA 3G4SI 3KEQA 5LBQA 1Y0RA 1X4PA 4MEXF 3ISPA 4OM9A 2EFWA 4U0YA 5FKMA 4BU2A 3RQIA 5DN6A 2CS3A 4XKWA 4Y9UA 2KDOA 4WXDA 2QXZA 2VBVA 1F1ZA 2LP0A 2K9SA 2QENA 3OIQA 3E6MA 4BDZA 3MEXA 1AIPA 3KL9A 3AVTA 2PMUA 4YFKF 1ZK8A 3QPTA 5FFXA 5KAIC 5F0CA 3OEEA 3D0SA 2RREA 4IQ4A 3LSIA 4AU7A 2WSSA 2K85A 4ZH4F 3COAC 4C2UA 1O8IA 5KK1A 1MSEC 2QM3A 4OJOA 2K02A 1TUIA 1Y0UA 5J1YA 1IDZA 1WSUA 2VB6A 4F3QA 3BP8A 4TMTA 2VT3A 1ZN2A 3FZVA 3CO7C 3S1NJ 2IP2A 2GOXB 3ASTA 2IGNA 1X1DA 2O3FA 3C3WA 5F27A 3W5UA 4OJPA 3MZYA 3ZSCA 4N3NA 2QE7A 3T53B 3B82A 4XKCA 4NNJA 4XSXF 1GHCA 4XONA 4XSZF 3CPXA 2O8XA 1Z7LA 3BY2A 2M3AA 4RAGA 1Z05A 3I59A 1JXSA 1ETVA 2B0RA 2UV1A 1MZBA 1BI3A 2AXLA 4B09A 4EM1A 3LSRA 1ZRDA 3I1FA 4KDPA 2VBXA 3FXOA 3A8IA 4A0ZA 1R5BA 4M71A 1OFLA 3PQJA 4K1XA 3OWTA 2TDXA 3H5AA 1DDGA 4U9UA 2JA2A 5AIPA 3A3GA 1YIOA 4OJ5A 3LQEA 4ENMA 1YI2I 1H85A 4Z4RA 4E70A 3OE7A 3G1MA 4LG0A 5CKTA 1IN8A 5FLXK 1QJVA 2BM6A 2OBRA 3K4JA 1HBXG 2DERA 3T8TA 4BGDA 4LBWA 1WRJA 1YLFA 1UD2A 4DZJA 4FXUA 5KW9A 4XIDA 2XB0X 1XSXA 1Z3XA 3SJPA 3CCLI 1JKQC 1MRZA 1WJBA 2W6IA 3VR6A 2O1DA 1IRXA 1SD5A 1ZARA 2EV0A 3KZYA 3ZOBA 2JSPA 3LSTA 1YIJB 3LSPA 4CYCB 2PJRB 2KDZA 1A04A 1BMFA 1VQMI 3ERED 1RQPA 3MCAA 1KA8A 1ZQ3P 3PUBA 1X2MA 2ZO4A 3SLNA 3TEDA 4QTRA 3OYEA 5LRSA 4X7CA 1EF4A 2R3SA 2CFOA 3P9IA 3ES9A 4RLZA 3BQZA 2JA7J 3QE2A 4NC7A 3K1NA 4CCLA 3GZ6A 4YXWA 3GX4X 2JZYA 4Y7NJ 1FC3A 3JRHA 4DNCA 1K4TA 1WP6A 1N0VC 2VNKA 4NCNA 2QF7A 4H9GA 4HX8A 3RPQA 3SDGA 3WGHA 1PJ5A 1R5NA 3HKZN 1SEUA 2MLGA 1KQSB 2BY2A 3WWGA 1SANA 3CCQB 1J2XA 3PNVA 2KHMA 2R5ZB 3S14J 4PGOA 2JK3A 4AF6A 1D5VA 3ISXA 4C3JJ 3RZDJ 5M3MJ 1XB2A 3VYRB 3CC7B 1BN5A 5E20A 1ETWA 2GK7A 4P3YA 3Q3SA 4ZYGA 3SY2A 1EH6A 4HV5A 2KT0A 2ZXHA 1SD7A 4HDUA 1UHWA 2CYYA 3RSNA 1R1UA 1CQXA 3F21A 3A1PA 3OJXA 1TQIA 3KYCB 2NTPA 4NK8A 2EA4A 2ETHA 4E7HA 1O8LA 1QRYA 2NYXA 2F4NA 1D1CA 1ON2A 2IGOA 5F64A 1EZGA 5D5UB 3PL8A 2R7OA 3GFLA 2HEOA 2GXAA 1HF0A 5FKKA 4IRIA 1LE8B 1OYIA 5EG0A 3AVVA 5F04A 1OCRH 2JRTA 3G71I 2RNGA 3AL0C 2J8IA 2MH2A 3H3VK 3ZMUA 2I10A 1V3FA 2XF6A 1PDNC 4DZPA 1JJ6C 1TBXA 1QHGA 4ZTFA 4MFEA 4KIGA 1QU3A 4DQLA 3EQNA 2YWGA 1FSHA 1SFEA 1EXMA 1Z0XA 2ECBA 3FKSA 2V9KA 1AKHB 5E1ZB 3UR3C 2VYQA 4KKTA 3H0GJ 3SFIA 4HRIA 4DNTB 1FNCA 2VODA 4BUPA 4U88A 4BQQA 4C43A 4MR0A 3KP6A 2HOTA 2ICWG 2BM7A 3Q9VA 4L9VA 2ZMEA 3RTRA 4CSWA 5E1WA 3L2VA 1O8DA 2VE8A 2L4MA 2Y69H 4IHSA 2CK3A 1F36A 1R9TJ 1QZZA 3HOVJ 2X6XA 3AG1H 3OYJA 4L5JA 4A3CJ 3SJMA 1KCDA 3QP6A 2HQNA 3WYAA 5H5JA 4CCMA 2CG4A 5E17F 1OFCX 2NXNB 2Z16A 5GAEJ 1G7RA 3BQYA 2DMTA 2ELJA 1IV6A 4UY8I 3TW7A 3NB2A 4RAYA 5F0FA 2DFEA 2CUFA 1QVGB 1E63A 4YZQA 5FFZA 1Y56A 5FNZA 4G6QA 2ZJQF 2F4MB 2EBIA 4CA0A 5L3BA 5GTIC 3K9TA 1IDKA 1Y0NA 3G73A 3WTZA 1OR7A 4FQGA 2RNJA 2AS5F 2VZLA 3JX8A 2XAUA 2GJRA 3CQZJ 1M1EB 2K40A 2OU2A 1X19A 2QCOA 2ZJ2A 2Y31A 6PAXA 1MDMA 5IT9K 5HKKA 4BY7J 2MW8A 2QSHX 4FN5A 3P4GA 1ETXA 2VJJA 3Q0UA 3ONUA 1P6RA 2WA0A 4MFDA 2K86A 5F4JA 3QFSA 2ZC2A 4U7BA 1QA6A 3FK7A 1ETYA 1UG2A 1EP2B 1JTXA 3ASOH 2NS0A 3KLNA 1FBSA 4DOZA 3BR1A 2HWVA 2VC0A 3AG2H 1QA1A 1RC9A 1IGNA 2GREA 3HHHA 5DV5A 3V7RA 2ELKA 2CSOA 2OBPA 3EETA 3A8KA 3W2GA 3JRCA 5J8FA 4HW0A 2BV6A 3HJEA 4AYBA 1WORA 5DS0A 4Y17A 5FO0A 3OSGA 1OMIA 3QU6A 4A93J 5DCMB 2L9NA 1OGJA 2VNIA 1HG8A 2OV7A 1S7OA 3ERMA 3I56I 1YRNB 2LBFB 1OCCH 1FIAA 2HOSA 3UNGC 1Q81D 1PKVA 5THXA 2QKLB 3LVBA 2JUCA 1CF7B 2AHQA 2L4AA 2YX4A 4HIZA 3OJWA 3W2AA 3DCFA 4PJLA 1PP7U 1T0FC 2QVOA 1O3SA 1FNMA 3LSHA 1KQ8A 2GIZA 3O2PE 4GGGA 5JVTA 1A5JA 1BN8A 3FIWA 1IN5A 3HGYA 2XZPA 2FE3A 1CNFA 4P12A 3F6OA 4BE2A 5LD2C 1WH7A 4A12A 5FJ8J 2M8GX 1MMSA 4L9TA 1LLWA 1V0EA 2A68F 2Y30A 5J3LA 3GFIA 1NB0A 1B59A 2NT9A 1IDYA 1NH3A 1VQ4I 1ETQA 4X8IA 2O0VA 3JCUC 3OR1C 4NBQA 4HQEA 3MMPA 1T2KA 1U5TA 2XAQA 1TYWA 2IGKA 3H9GA 4HG2A 5K1YA 4AIDA 1EFUA 2E5ZA 2A6HF 3CCJB 5EGOB 4D1QA 3B90A 4B3AA 2XZOA 2WAEA 1ZR2A 1W9XA 3CCMB 2YU3A 2EZIA 1U2WA 1VQ7B 2CUJA 2Q0OA 4A6DA 2CV0A 2H6BA 3H9JA 1HSTA 1GVHA 2X48A 1P9QC 4OPVA 4ABZA 3BC8A 5IP6A 2QQBA 3M8FA 4Y4RA 3RI4A 2XIGA 2DQRA 1UMQA 2V6CA 3WE3A 4D7NA 3H9NA 5KNLA 2V5IA 2EFQA 2PMZN 2M30A 3RDIA 4RCYA 1FNBA 1S72I 5E6TA 5B5EC 1JRGA 2IW5A 2VXDA 3H9QA 3WU2C 1W5TA 3HSEA 2G0EA 2OTLI 2KFDA 3VSUA 2A05A 4GO1A 4L9NA 4M3EA 4JX4A 4RAFA 3PQKA 4F92B 2CWEA 3NWTA 4KYWA 4X05A 1XG2A 4RDKA 4MQVA 1PE9A 3LO8A 2XC1A 3L9FA 3QPLA 1ZM9A 3VEPA 1PUFA 2BE5F 2VJ5A 1MNDA 4UUVA 4OOSA 3LJYA 4BJ5C 4C2MJ 3TDZC 3F8FA 2DW4A 1TSPA 4WK8F 3JRBA 2R4GA 1ETKA 1S9HA 3KZIC 2X3UA 4BJ6C 1I27A 5B6IA 3CMEB 5D4SA 2XC7A 3KEOA 2UVFA 1XFOA 1OFDA 1KCCA 1XMKA 2ZTGA 2R7QA 3T9GA 3S16J 1DQUA 1JA0A 4X06A 5E8GA 5ILSA 3KP3A 3J80K 2A69F 1QGYA 3A0HC 1K8FA 2MH9A 4AM3A 5JHUA 2XDVA 3A3BA 2RAEA 5C1CA 1RETA 3P5JA 2ID3A 3ZQCA 2Y2ZA 2GWRA 1N77A 4KT6A 1VQ8B 1EE6A 1D1AA 2ZZGA 2JPBA 3F8MA 3I4NJ 4TMZA 3GQ9A 4QSHA 2DOAA 4LK1F 2VUMJ 1Y1VJ 3PNYA 4BXUA 4BE1A 2K9NA 1JUSA 3ONQA 1JKPC 3FX3A 1J75A 4RJLA 1BM9A 2CGPA 2GA1A 3R6JA 1IAWA 1TWHJ 1TTYA 2DPDA 2CBXA 4RGUA 3ZXSA 1LFPA 5M5WJ 1QGAA 3GCMA 1O3QA 1PJRA 2FD5A 3N97A 1MIJA 2Z99A 2JA8J 2JT1A 2XGCA 5K5OA 1AHDP 5A2QZ 3B78A 1KGSA 4MTDA 4OZYA 1BI0A 4E4HA 4OMYA 4M0LA 1NG7A 4PAAA 1I50J 3SZEA 2LR8A 3KFWX 4YELA 2L7ZA 1TLHB 2R7FA 4P1WA 2TCTA 2LF8A 4ETSA 3HYIA 2GPJA 3MN2A 4Y33A 1EFTA 1E3ZA 2QA4I 1IRGA 5DSZA 4C0SA 3W2VA 1W36D 2F1MA 1YJWI 5JLXA 3CF2A 2W48A 2ZB9A 2HVQA 2BM1A 3V7SA 3LWFA 1FTZA 1B9NA 2E35A 4HYEA 2QMUA 5IYCJ 1YHQB 4CYDA 4YFXF 2V7XA 1EP1B 1KU2A 2ZBKA 4ESJA 1T38A 2CF4A 4QV2A 3CCUB 4A69C 1XDSA 3AL0B 2FX0A 1GJRA 4BHPA 5JLVC 2BW3B 1QZEA 5GPAA 3PVDA 5HS8A 2XNCA 3ZZ0A 3CCRB 1KZHA 4TKOB 2O7OA 1E2XA 4JYKA 5JLWA 4LG3A 4MTEA 3R0AA 1GT0C 5IYPA 1W7PD 4LBZA 1OPCA 4FE7A 3HUGA 2V7UA 1CNEA 2V7WA 1ZAOA 4BY1J 3KZZA 1R1TA 3SKBA 2XT2A 3EUKL 4LBVA 1FP2A 1W35A 3HSFA 5F1RA 1T08B 3JSPA 2KJBA 4RS8A 2EIKH 2M1BA 2VL8A 1N78A 5E79C 4JP0A 4P6YA 3QWLA 2ZFWA 3L7WA 4HF1A 3J7AO 2NSTA 1MH3A 1ITYA 1XDUA 1YS6A 2BHZA 4M3DA 2XRLA 3FWEA 4F52A 3CCVI 1ZELA 3WTUC 3ECHA 3LQRA 1E3OC 2YWHA 3HAGA 4KT5C 1QVUA 4AC0A 2ZZEA 2DMNA 3OYGA 4PC3A 2EINH 4BE0A 3ASSA 1LFBA 1JB9A 3BZKA 1K83J 5EF6A 1GAQA 5LEKA 3K4LA 4A3FJ 4G5GA 4IO9F 2WV0A 3Q6QA 1HDPA 1T33A 2XAFA 5FLXZ 3G6EI 5TJJA 1K78B 4OOXA 2FSWA 1ONVA 1IJFA 4RDJA 2O6WA 1HQCA 2CMPA 3A1YA 1OGOX 1OB0A 3QODA 3IRRA 3VMVA 4YHBA 1I1SA 1ZYRF 3IL2A 4EGYA 3U6KA 4P25A 1HW2A 2XROA 3GYHX 2JN9A 4Z2YA 4FX4A 2MD5A 2DA1A 3BZ6A 1LB2A 2FRHA 2CC2A 4A2UA 3AVUA 1OYYA 4XL9A 3AKZA 1KJZA 2YX7A 2M4GA 4F7ZA 3HOUJ 4ZDPA 2NNNA 2OZ6A 4R1HA 4ZYEA 4XICA 4R71A 1G3WA 2HXOA 5K7FA 3L2QA 4D5FA 3HC7A 4B8XA 1NDHA 2XSJC 5ILUA 5FA6A 3P26A 3GQAA 4NDLA 3MVPA 3ML3A 5FL7A 4P9FA 3S1QJ 2VFNA 2X51A 5M3FJ 4NC6A 2RV8A 2BGCA 3DQVC 1UD3A 5LEJA 1JGGA 1W87A 2JDIA 1QZYA 3MWMA 1XMXA 3CMAI 5IYDJ 4EJVA 1HCRA 4IF4A 1IV8A 2V7QA 5IOYA 2VBTA 1JJ2B 2DEUA 2RQQA 1VZ0A 3Q5FA 2GBYA 1U9NA 3V42A 1G4DA 2GJKA 2C4UA 4WXHA 2XOKA 2XB5A 1H88C 3M1EA 3FXLA 1IJWC 1TW2A 2BF4A 2DXIA 1QA3A 2OTJB 5IYWA 1FWZA 2HI3A 3BR0A 2E1CA 1BX1A 1O7LA 3FK6A 1U8RA 2CJJA 1IRZA 4P5OA 4UVAA 4ZJZA 3L1PA 3GTKJ 1QQ1A 1LVKA 4CUGA 5JHFA 5GADJ 4DQKA 5C4JJ 2CH0A 3ABKH 2Y0MA 2XSDC 1ZRCA 4ZCMA 2XT4A 4EQQA 2XTXA 5ICCA 2V7TA 1E79A 2M9HA 4GYGA 2VONA 1TYUA 3ZMZA 4I98B 4JMQA 2ZXJA 4M73A 2ME6A 2VBEA 3LA2A 4K2EA 1KU3A 5D6FA 2ZBVA 1TWAJ 5F6FA 2ID6A 2WAQN 3KE2A 2UXXA 2VBSA 1FMVA 2BYVE 1ZG5A 4TT3A 1GXPA 4YFOA 2BVNA 3I58A 2KRCA 2XRNA 1E3XA 2NOJB 3VO2A 1TP4A 3BR2A 1I3QJ 1ON1A 1PUEE 3ML6A 4L0ZB 3OKXA 4LBYA 3GIRA 3R0JA 4BL0B 1X2NA 5EEGA 4UVBA 3U1DA 1VNDA 2ZXWH 4LFUA 2E2HJ 2PECA 4DYQA 2ME0A 2D9RA 2FXAA 3LAJA 5HDKA 5HLTA 2F5VA 2WC2A 3SZTA 1P7JA 3I0TA 3KYDB 4C30A 2PJRA 4GXOA 2A5WA 4I01A 5GTHC 3K4NA 1A36A 3I64A 2OK7A 2HOAA 1D0YA 3H5NA 4Z4ZA 3DKXA 2JMWA 5DD8A 3BTIA 4FT8A 1J59A 2JPCA 4G1VA 4G6TB 2ZXIA 3R61A 1BI2A 1X0CA 4G6DA 2LYCA 3FF5A 1LPQA 3FXRA 2K4BA 3RKQA 2KLOA 4YZ0A 3BZCA 4HV6A 3QPSA 2XEXA 4ZGQB 3DPTA 3LA7A 4I0AA 2MD0A 3CP2A 3EUHA 4KMFA 1P4WA 3HTSB 4OIOF 1R5HA 2EV6A 4AIJA 1WVRA 5A88A 2HTJA 3KP4A 2NOGA 4WF2A 1YJ9I 3GQ8A 3FHNA 3NE5B 3WU1B 1WJFA 2W4SA 2QBYB 4Q48A 3OS1A 1BIAA 3ZC3A 3E5UA 3M8EA 2EV5A 1UCRA 1ZREA 4IKFA 4L8JA 1NHCA 2K9LA 2A07F 3G2BA 4CCKA 3JURA 1ZM4A 2PLFA 4ROXA 1OQYA 2LVSA 3IKTA 4J00A 4RDUA 2R7UA 4CDGA 1MMAA 2VFPA 2DK5A 3DLAA 4OJ6A 1DU0A 1Q1VA 5IT9Z 4D9JA 1WHUA 3OOUA 3Q9SA 1YITB 3G4SB 1HC8A 2I5UA 4OIPF 5KSWB 2NS7A 1ZHFA 1J9IA 4RPBA 1WMRA 1Y8RB 1LFUP 1J09A 2NRAC 4G7XA 5M5XJ 3PSFA 1JE8A 3H5RA 3LSJA 1K9MD 4L9JA 3HPGA 3MMYB 2EZLA 1T56A 4BHBA 3FM5A 3EYYA 2ZSHB 4JBAA 3GLXA 3WG7H 1B72B 1FTTA 3Q6RA 3NRVA 1UJ8A 5A2QK 4PSWA 2WB1A 1D8JA 2O9LA 4JOMA 1FBQA 4BNCA 1GVJA 2PE3A 1P2FA 3A35A 3BC9A 2LMDA 1N07A 1HLVA 4II3A 1YYVA 3OYLA 4AVPA 2X8KA 1ZUNB 2HYFA 4XLEA 5L3DA 3DU6A 5LHHA 1WKMA 1SMTA 2CW0F 1N08A 4QVAA 2KRHA 1KZLA 2LKXA 4YEIA 2DYIA 1WGXA 2LSOA 4D0PA 1NTCA 2LG4A 4LIUA 2V31A 3BCDA 3FXUA 1SD4A 2OQRA 2P0WA 3DEEA 3I55I 4F7DA 1WQ2A 3W2HA 2BV3A 5D4RA 2OK8A 3S8PA 1SFKA 4W8RA 3K0LA 1SAXA 3OL3A 2V1DA 5CQGA 5DM6F 1MSFC 2E1RA 5DTDA 1X3UA 2DYRH 4OU0A 5IOZA 1WTHD 2I8DA 3ELKA 2X1DA 5ED4A 3CC2I 4HSTA 3BQJA 2ZKZA 3X2QH 1YI2B 4M9XA 5H6QA 4M1KA 3V7AA 2R5YB 1BHEA 2KZVA 2VPRA 1LLZA 2M5WA 2MA3A 3J81Z 2CQNA 3S17J 2WV1A 3OYNA 2D2WA 3BG3A 4HAMA 4MYTA 4U49A 2IQ7A 2F43A 2PMZA 5BPIA 1IG7A 4UUSB 3GQBA 3K4CA 3D1NI 2D45A 4WZLA 1V5FA 3S2WA 3CCLB 1DGWY 1J0RA 3IV5A 4M3BA 1VQPI 2EB7A 1F5TA 2DY1A 2HQ5A 2WJYA 2NS8A 3ZP5A 3RZOJ 1TTTA 2L54A 2A61A 1B8IA 3PIPF 2B7CA 1VQMB 3HOXJ 3I53A 3KX2A 2YWEA 3CXCB 2HDCA 3ZQIA 2B63J 2IS4A 2Y48A 2M7AA 3IRQA 2O61A 4Y13A 3HRMA 2FQ4A 3TKYA 4FCYA 3LAPA 1BIBA 4PDKA 1FOKA 4N3GA 4W8TA 5E1XA 5GAHJ 1SVOA 4ZV4A 1VI0A 4HLYA 4B3XA 1T6YA 3CZ6A 1WJAA 1RKWA 4YIFA 4CCNA 4HF0A 1SAUA 1KRHA 4RD4A 2IA2A 1BA5A 4Z4UA 5K7ZA 2CU7A 1BR4A 1DU6A 4EGZA 2BXYA 2DYSH 2ISZA 3O6BB 2XNJA 2F3LA 1K7AA 4NB5A 3IH2A 1YW9A 2IVMA 2HFHA 4A6EA 2KP6A 5B1AH 1VQKI 4HOBA 2LNBA 2QQ8A 4UVCA 2GXGA 1EH8A 4XMYA 5FKNA 4XLPF 1FMWA 5IP7J 3J80Z 2JA5J 4WQMA 4YAWA 3F6VA 2IBDA 1IO2A 2Y9YA 3BY6A 1G3TA 4MHGA 5LGUA 2IOUG 1XGOA 3I9V2 4E7IA 1BPLA 1POGA 3ZQQA 3ZPNA 2ZMEC 2JA6J 1WPKA 3VB2A 3EQLF 5CVVA 3KP7A 1I8DA 1IA5A 3JAMK 4ENJA 4XM3A 4DGWB 1T98A 4RD1A 4IRGA 2W25A 4HBLA 3T56B 2C78A 4I76A 4O3MA 5FRNA 4NQWB 5HODA 1IJEA 1N75A 4B3GA 1S3JA 2ACJA 1UD5A 3VOEA 4ZZDA 1RU4A 5IP9J 4BDYA 3AGPA 4FASD 4XORA 5H2FC 4PUSA 3VYUB 1FT9A 4G9YA 4P9SA 2WR8A 3G05A 3CJQB 1BL0A 3OZWA 3GMEA 4P22A 5TR9A 1W1WE 3B73A 2X1CA 2O0WA 1S6LA 3BG7A 4PJ0C 3G71B 4G7ZF 4A3GJ 1VQ5I 1SVMA 2K9QA 1VQ6I 4YALA 2C6YA 3RIQA 4PK4A 2RC5A 3MKWB 4JRAC 1OR7C 3SQVA 5D5VB 2M4KA 1EH7A 4TMWA 3CF5F 1QO0D 3VSKA 2BVMA 1UD8A 1GR1A 3OR2C 4LLGF 5HDGA 1O8MA 1DDIA 1J7KA 3ZCOA 2Q2EB 2HYJA 2O0YA 1OGMX 4XRMA 4Z6YA 3L2UA 2H1KA 1F9NA 2ZJPF 2B9SA 2X0KA 3KYLA 2G7HA 1QH0A 3CLQA 4PFPA 1MBJA 4OIRF 3OYCA 4X7EA 4PC7A 3A03A 2WTEA 4MLOA 1FPQA 3S93A 1TQPA 2HZDA 1DPRA 3HG9A 2FQ3A 4HX4A 1Q1HA 5GPCA 2NSPA 1USSA 3TOBA 3RPUD 3U6BA 2LFBA 5LRRA 1OB2A 1OFEA 1MKMA 4LJZF 3IP4B 2VI6A 1L1IA 2DTZA 4HNVA 4ZCIA 3K69A 3OZUA 4FHTA 4KA4A 3GTPJ 3FKJA 2PMDA 4I7HA 3WNBA 3AG3H 1TNSA 5CVUA 5ILVA 2R7VA 4ZYAA 3CCYA 4E6KG 1LJ9A 4X0GA 3WTWC 1WI9A 3QRFF 4UZEA 3HM5A 5J35A 4Z1MA 1Q82D 2C4TA 2J7KA 2X3HA 2FBIA 1D3YA 4HZFA 3S3MA 3FHZA 4C9YA 3BH7B 4RGXA 3FKIJ 1N06A 1U78A 1XSDA 5CVRA 4IW3B 4PCQA 2I1LA 2DMUA 3CUQA 3ZN1A 2H8WA 4BXXJ 4YDTA 3SYTA 1BC7C 1SVLA 4KKSA 2QZ8A 3OYAA 3A02A 1B4AA 3DFGA 5F4MA 2VQLA 1COWA 4Y15A 2D5VA 1HA8A 4O5VA 5FB2A 3N05A 5IYBJ 4M4SA 1RIOH 4CCOA 4JX5A 5J47A 1H42A 2PYHA 4PJMA 4HDVA 4ZDLA 3K2AA 4EV0A 3JRGA 1R23A 1U5TC 1W7PA 2B5OA 5J1UA 4E7LA 1R4NB 1Y8QB 1A6QA 2H27A 4GFBA 1FIPA 2IAIA 5B1BH 4AC9A 4PGHA 3I59B 1FYMA 3L2WA 2QEXB 4RLQA 3QAHA 3I56B 2EJRA 2NVUB 3CPWB 4BYYA 2HMAA 1RI7A 2Z5UA 2HLDA 3ASRA 2COMA 2LY2A 1TC3C 4ZYHA 3CLOA 4LOCA 3TO7A 4BEHB 1BOBA 4TSFA 2DDBA 3ASNH 1WJCA 2OC6A 3CDIA 5LGNA 1RMGA 3TO9A 2RQPA 1WI3A 3BG5A 1RR8C 1STZA 3CJTB 4PABA 1VQLI 4LG0B 2YUSA 2E1NA 2ELHA 2H94A 1BX0A 2IPQX 3OYHA 1W0KA 3NAWA 3HTUA 4HPQA 4UHTA 1B2RA 5JMCB 1I6XA 3E3VA 2ZL6A 3MZHA 2HKOA 1NJID 3U2QA 2Z1DA 2DT5A 5CPRB 4RDLA 4LITA 1DP7P 2QSGX 3GRHA 2DA4A 3BCAA 5JI6A 1VQ4B 3J7ZI 3JQPA 5FIUA 1TT5B 4KN7X 1HVXA 3BR5A 3RIRA 2A6TA 1EWYA 2EPFA 2XF5A 4QPQA 4LLNA 4P3IA 1E3HA 3IAM2 2VBMA 5BSYA 3CO6C 4PZJA 3H3ZA 2UUZA 1IF1A 3CC4I 2QTLA 4ACAA 4X1EA 1N05A 4M6VA 3DU5A 3FMRA 2ZITA 3P9KA 2JJ7A 3K1MA 4HWVA 1F60A 2GXBA 3OL4A 4L0YB 2GZWA 3BG9A 3GWZA 3OIPA 1VJSA 5GP9A 2DFHA 4EM2A 1O8GA 3V76A 4G8XA 3KLOA 4Q7JB 3ZQHA 3OS0A 4BQOA 2JQ7A 4P6VF 1X1AA 2COBA 2AQEA 1K5CA 3MZ8A 5KCMA 2Z6BD 1EV7A 2FMYA 3J81K 3E5QA 5LHGA 2OTLB 2VBUA 1RNLA 5H20A 2ZTNA 2LDUA 1O8KA 2YUHA 1YOVB 5AONA 2YR2A 4M6YA 1SMYF 4A3LJ 2JSCA 3TBIA 1IZ1A 1JUPA 3BR3A 4FWTA 2DU9A 2VJIA 3VNUA 2P3MA 2R93J 2W85A 1Y1WJ 1WJ5A 4OOIA 1DG1G 2OBTA 1UMKA 1KU7A 1OLTA 2QLZA 1CGPA 3AK5A 2OJED 5A89A 3HIFA 3ESWB 4U87A 4IHXA 2C5BA 3DDYA 3I54A 3RQ4A 2RVCA 2F6CA 3W3CA 2ZBUA 1T95A 3HOZJ 2YWFA 4XKVA 2ZL7A 1LEAA 3C2BA 3L00A 2KVOA 1W5SA 2ADUA 2VKDA 4BJTA 4DYRA 5TRDA 4EJWA 3HOSA 3OV8A 1G3YA 1BLIA 2KL4A 3MKZA 3GF2A 1DARA 4CO8A 4OOVA 1H9GA 3FXJA 4A0XA 4YZXA 3SUCA 3K7AJ 2NVTJ 2FNPA 5HNFA 4DYCA 3BJAA 3QFTA 1A35A 4G7HF 1VQNI 3M7GA 5F08A 3CCJI 4WWCA 3GUDA 2LZJA 4UNOA 1P4MA 3K1PA 5BNGA 1DBGA 4M72A 4I84A 1JA1A 4EEFG 2QYOA 5HXBA 1BJKA 5IT3A 4C2LA 2NNYA 1R58A 5DYMA 1ERDA 2ZNZA 1D8KA 3AVXA 4I0BA 2HQAA 2DN0A 3CP8A 2DBBA 1JNYA 2X9DA 1H8AC 1W4MA 4X6AJ 1UAAA 2ZMEB 3DP7A 2DOEA 1F20A 5L3EA 2P6TA 3DTKA 2DCUA 1UD6A 4DJAA 4X0CA 3C2GA 1NK3P 3GTLJ 1L3LA 1QPMA 2HQRA 4QWQA 1JT0A 2QA4B 1YJWB 1WJEA 4P2NA 2BGIA 2VFQA 4XR6A 2E1MC 2D74A 4M9ZA 2CW5A 1VQ9I 3IAS2 4J19A 1OHHA 4XBFA 2GM4A 2GOMA 2ZZQA 2R6HA 4YAOA 1W0TA 2X0LA 4IQJA 2ESHA 4QUZA 2V9PA 1N8RD 2R0QC 3N6ZA 1FOXA 2X85A 3VO1A 3V8KA 2DK8A 2LOOA 3TH0A 4OAZA 1LDDA 1I1GA 5EDNA 4X07A 2P5KA 1U9OA 2H8RA 1RRJA 1O8EA 5DUKA 2EA2A 1MDMB 3GTOJ 3O8HA 5E3OA 2L9SA 3GW2A 2DDAA 4PGGA 1O8HA 5L3CA 4CGZA 3LFUA 2IGMA 2HOEA 4L5IA 3SZPA 1SC7A 1VQ8I 1AOYA 5F0HA 3OZVA 2BPOA 4HF2A 4G1BA 3L09A 1M90D 2F4IA 1YFHA 4XRFA 1O3RA 4YC5A 2XNDA 1D0XA 4G6IA 4A3JJ 1TWGJ 2KISA 4AWXB 3FISA 3AAFA 3LMMA 3JW4A 3CCVB 3PFIA 2EK5A 3ZN0A 3SDBA 4UB6C 1FRQA 3WXMA 4M6XA 1ZG1A 1TQMA 3CTAA 4OAYA 5J8CA 4YG2F 2Z33A 5BPDA 1I6HJ 1IUYA 1VF7A 2Q6OA 2NVQJ 4YAFA 2PLYA 3G6EB 2MABA 3EQOA 1WOOA 3I3LA 2X6WA 1YQAA 4OP7A 1AMOA 3K4KA 3VODA 4HEA2 1HSJA 2DODA 4YRVA 1KK3A 2IS6A 2VJ4A 1KMHA 3CUOA 3PO2J 1IN7A 1JTYA 2X6YA 1R1VA 2DA7A 4J01A 3FM3A 1EP3B 1HW5A 2M7BA 1TT0A 5FKLA 5HLHA 1N0UA 1JHHA 4M53A 1OYWA 4RM3A 1BBYA 3GBGA 1Z1DA 4LGWA 3LMWA 3SJZA 5H6RA 1EKEA 1ZGAA 4HLXA 1AIRA 2WPDA 2K3FA 1V55H 2QQ9A 4EJOA 2QGGA 1OCPA 4E7SA 2R7SA 3MCZA 4N0BA 1T5EA 4BBRJ 2VNHA 3BY1A 3C2HA 1YJNI 1VHOA 4V02C 1U5TB 3N4MA 1JI8A 2DT7B 1XN7A 2G9WA 4RB3C 3GZNB 1FYLA 3CMAB 1QRBA 4IX7A 3H1CA 1MNMC 1NBMA 1T6ZA 3HBLA 2FF4A 2O03A 3HKZA 1QNTA 4KISA 4G7OF 3WHCA 2VN2A 4XOPA 5F1JA 1ZM2A 2FX3A 3P7NA 1RR7A 4WZTA 3DEUA 5LLQA 3ZQFA 2E2IJ 4Y9RA 5TY0A 2Z9OA 1Z21A 5FO5A 3IWZA 1FEXA 3BCFA 3WE2A 1KC8D 1QGZA 2O17A 3B6CA 3F8NA 4MYUA 5TV2A 3I4MJ 1APLC 1MBKA 1S0UA 2L2OA 2QX3A 1GUUA 3JAMZ 1FNDA 3ULQB 1QUFA 2L7KA 1X1BA 1KK0A 1UZCA 2C77A 1BR2A 3NEUA 4DBQA 2QUFA 1K6YA 1PUFB 5HVQC 3EPZA 1OJLA 3BG6A 1V5GA 3CCSI 2ISYA 5E18F 4BACA 2YSRA 1VLOA 3EUHC 3AVWA 1IXCA 2NPFA 3PUNA 1HF2A 3RY8A 2WY7Q 3PIOF 3VSVA 5L3GA 2LLKA 1LDJA 2XHKA 2YU9J 3W2EA 3GQ7A 5JFRA 1KTVA 3M9AA 4WXCA 2R5YA 2AQFA 2VKHA 3GVJA 3KIOA 4EH1A 4HSRA 3PJRA 3ZPLA 2WJVA 4P1VA 4EJTA 2PQ8A 4AYBN 4WX9A 3H36A 3F22A 1AU7A 2ZSIB 3P9CA 1TWCJ 4TMVA 2C2WA 4BH9A 2HVSA 4PFOA 1YW7A 2OAZA 1UG0A 3JR9A 2P7CB 1JUMA 1GAWA 2L7FP 3NQOA 5BQTA 4CCJA 3A2KA 3ZMVA 3BTLA 5D5WB 5FLMJ 4QVJA 3ZGKA 3ASQA 5ERIA 4MNUA 1KU9A 3A01B 4OPOA 3PFYA 3Q39A 2R7ZJ 5K5QA 2DFFA 3GVLA 3WBKA 3ZR8X 3QSYA 2BGJA 3GTGJ 4Q5SF 5LHIA 2VKEA 4XRSG 1XG1A 2CQ7A 3BTCA 3LOCA 1OB5A 3H0DA 1IC8A 2FBKA 4WWVA 4NBSA 3WU0A 1Z9CA 3SYJA 1Z77A 1D0ZA 4CYCA 4P96A 1YJ9B 2DQLA 3I4PA 3M3YJ 2KIQA 5HZAA 2KQRA 1EA0A 5TISC 1Q86D 3ZQGA 3EUAA 5DS9A 1V5VA 4LLLA 5FKOA 4E0FA 3S32A 2E60A 1R22A 2IJLA 2DI3A 1FY7A 4N4OB 3F8BA 1MGTA 1MMGA 3OYKA 1ELOA 3W2WA 2HKXA 4I99C 4XOTA 3WGGA 1SM4A 3FJOA 4AVZA 2PN6A 4D5CA 2HS5A 3VWBA 3JREA 2EQRA 2V9VA 2XGXA 2DA3A 2QWWA 1I39A 2W84A 3KEYA 4RGRA 4UXNA 4CICA 3K4MA 2CUEA 2R5ZA 1Z67A 3G1OA 2KZGA 3RPUA 3DXJF 1VQOI 4OIQF 2F5CA 3CD6I 2HYGD 2XF7A 4OPSA 3A8JA 2VFMA 2VXZA 5ICEA 4XKBA 4V2FA 4ENNA 1LQ1A 3U21A 3HUGB 2V4JC 3FMQA 3E20A 1MJAA 2BM0A 3B8HA 1P7IA 2ZCWA 2MGQA 3NAUA 3C7JA 4HNTA 2QDXA 2PMHA 1I3AA 2LRDA 2W7NA 1E62A 4ZGNB 4IL6C 3AVYA 3KRGA 3VNVA 1G6NA 2JJ1A 3U1KA 1XGNA 1Y6IA 1IHMA 1O4XA 2TRTA 1B6AA 1LDKB 3B6AA 1W34A 4C3IJ 2YS9A 3BNWA 2GIVA 1VHEA 2W7ZA 4FE4A 2EFNA 4H4KC 4KH3A 2CV1A 4R8HA 2KPMA 1GQ8A 1KQ0A 1X4OA 2KRFA 1BQEA 1Q9SA 2L0KA 3BTJA 2E1MB 3ZBUA 1GXQA 2PEXA 2IEKA 5L46A 3H09A 2IA1A 3JSOA 2HTSA 1LE8A 3I55B 2O04A 4B4DA 2V7VA 3BWGA 2KJCA 5KAFC 3DBLB 5CYVA 2PYGA 3TMOA 3SXYA 2VLAA 2J5PA 3SFZA 2CO5A 3JRAA 1KONA 3W6KB 4CZCA 3E6DA 3GFMA 4U4BA 2Z3YA 5DNSA 5CVIA 1WWXA 1G7SA 4ASNA 2BY3A 4HX7A 5KVRA 4X7FA 1R36A 1XX5A 2D1VA 4JK1X 1EFRA 3R6KA 2XAJA 1PJ7A 2XV4S 1AKHA 3CC2B 1UHMA 3ZPPA 1XGSA 2FA5A 4Z4WA 2UXNA 3RCOA 1WSRA 3LQ6A 4ZCLA 2QN6A 1YW8A 1BC8C 1OKRA 3F0CA 1K73D 3QP5A 2LY1A 3GO5A 2VKVA 3CCEI 4RM0A 3W2FA 2G7UA 4BHCA 2H1LA 2OUMA 1L0OC 1S7AA 4RA2A 4BS9A 1Z3YA 4XLCA 3D26A 1V0FA 2W82A
chains in the Genus database with same CATH topology
3VYSB 2R4GA 4Z1MA 1S9HA 4B3FX 2X3HA 4BJ6C 3S3MA 2XC7A 4E7KA 1E1QA 2UVFA 4C9YA 1KCCA 2ZTGA 3WQZA 4Z06A 2CUZA 2HNHA 2R7QA 1DQUA 3B8YA 3T9GA 3HXLA 4GRIA 2V26A 3OMYA 3OW7A 1OOCA 2R7WA 2BVLA 2ZZFA 2CW8A 1LKXA 2XDVA 3SYTA 3A3BA 5C1CA 4KKSA 1MNEA 4ZC3A 2LH9A 2VIXA 3OYAA 1SKYB 1CZFA 3K70C 4KT6A 3VDXA 1N77A 2NZMA 2ODLA 1EE6A 3B4NA 1IB4A 1D1AA 2ZZGA 2VQLA 1COWA 4RMNA 3GQ9A 2DOAA 1HA8A 3N05A 3PNYA 4BE1A 4CCOA 3VSTA 1H8HA 3ONQA 2PYHA 4PJMA 4ZDLA 1E0EA 1WJDA 3FBNB 4W8SA 4E7LA 3S3OA 2JIZA 4DNRB 3ZXSA 1LFPA 1PJRA 2BOLA 1PXZA 1WFXA 3K6GA 2DCEA 3IUOA 4OZYA 3CJRB 2JVHA 3L2WA 2V6EA 4E4HA 4RLQA 1NG7A 4YELA 4W8QA 3LSMA 2HLDA 3H35A 4P1WA 2LY2A 4KITB 3D5RC 4BEHA 2VQCA 4BEHB 1BOBA 3DWLE 4Y33A 3SEQA 1WJCA 2OC6A 5FROA 1E3ZA 4TSFA 3LSKA 1RMGA 2NTQA 3W2VA 5CQEA 1W36D 2E1BA 2F1MA 3DTIA 3CF2A 4ANJA 4OJLA 3CESA 2HVQA 4NUBA 4QPOA 2INUA 1DP3A 3S3NA 3VSLA 3OYHA 3A4CA 2LBFA 1E1RA 4HPQA 1W0KA 4DIQA 4B43A 2WZPP 1PYVA 3AL0B 2BW3B 2Z1DA 5CPRB 4LITA 1HZEA 3GRHA 3L2RA 3FY3A 4TKOB 3BCAA 2VPLA 4DK1A 2X1EA 1O8FA 4LG3A 1HVXA 2A6TA 4B48A 3OYIA 2XF5A 4QPQA 4F55A 4R79A 1X1CA 3DTEA 1W36C 3IAM2 2VBMA 3K4BA 2UUZA 2XZLA 3EUKL 3M1CA 1E43A 1G59A 3DU5A 5FRMA 3F9KA 3HL2A 1N78A 2VL8A 4JQFA 4ZDOA 3OPOA 1RWRA 1JTAA 1WPCA 4HWVA 2MYSA 3VMWA 1DGRM 3OL4A 4UZUA 3OIPA 2LREA 1VJSA 2NSTA 1O8GA 3CMMA 3QYFA 4C2TA 4F52A 1ZELA 2MFZA 3OS0A 4BQOA 3HAGA 1X1AA 2ZZEA 1NG6A 2AQEA 3OYGA 4PSXA 1K5CA 3AFHA 5KCMA 3E1SA 3QYEA 4BE0A 2Z6BD 3OOCA 1O8KA 2ZTNA 2X53S 3M8JA 3K4LA 2NTBA 1G8XA 2E5NA 3TBIA 1V5EA 2VJIA 1QCXA 2IXSA 1WJ5A 2CMPA 3A1YA 5HOOA 1OB0A 3QODA 5KHDA 2R7XA 1OGOX 4BXFA 2ZFUA 3VMVA 1TZLA 1OLTA 4DBRA 2HPIA 2UVEA 2DIEA 3DKYA 3FDYA 3J7AY 2VASA 4OZZA 4U87A 4RM2A 3DDYA 3RQ4A 4XL9A 2F6CA 3W3CA 3SZGA 2K9MA 1T95A 3AKZA 2CW7A 2M4GA 4PMHA 1YE9A 4XKVA 3MKYB 4N4NB 2Z2SB 4ZDPA 2W1OA 2KVOA 2VKDA 4XNFA 4BJTA 3HOSA 3L2QA 1X4PA 3HC7A 1BLIA 2KL4A 2M5SA 3MKZA 2XSJC 5DN6A 4BU2A 3GQAA 4YZXA 2CS3A 4XKWA 5FL7A 3SUCA 2X51A 1PLUA 1D1BA 1VBLA 5HNFA 4YEJA 2KDOA 1UD3A 2HVRA 2QXZA 3DQVC 1GLNA 2JDIA 2LC2A 3OIQA 4BDZA 2VQGA 4E7ZA 2LZJA 1DBGA 4I84A 2V7QA 4ITVA 4C2LA 2RQQA 1VZ0A 4XQFA 3OEEA 1ERDA 2RREA 4IQ4A 3LSIA 3V42A 4AU7A 2HQAA 2GJKA 2WSSA 3CP8A 2XOKA 5IK2A 4C2UA 1O8IA 1MMNA 2DXIA 3FPPA 4OJOA 2M0MA 4P5OA 1UAAA 4ZJZA 2VB6A 2HDWA 2R9VA 4F3QA 3DTKA 1LVKA 4CUGA 5JHFA 1UD6A 4DJAA 2GOXB 3C2GA 2IGNA 1X1DA 2BSPA 2CH0A 2R7RA 4OJPA 2D3LA 3ZSCA 2QE7A 3H94A 3T53B 2KMUA 4NNJA 4XKCA 1E79A 1WJEA 4XONA 4XR6A 3OAAA 1Z7LA 2E1MC 2M3AA 3TL4X 4JMQA 2UV1A 1YX3A 2VBEA 3IAS2 1OHHA 2DJIA 2JJ2A 2GOMA 2ZZQA 2WAFA 4IQJA 1OFLA 1FMVA 4E7JA 3OWTA 4TT3A 3H5AA 2JA2A 2KRCA 2X85A 3A3GA 3QYBA 1E3XA 4OJ5A 2LOOA 4OAZA 2NOJB 2V7FA 1O8EA 3OE7A 1MW7A 4KKUA 5CKTA 1QJVA 4BL0B 2L9SA 1O8HA 2PECA 3K4JA 5AMVA 3LFUA 2IGMA 3PNTA 4BGDA 1NRKA 3OYFA 1UD2A 4FXUA 3LSGA 1Z3XA 2BW3A 2F4IA 5HLTA 2F5VA 1WJBA 2W6IA 2XNDA 4GQNA 1IRXA 4C30A 3VR6A 2O1DA 1D0XA 2PJRA 2JSPA 4G6IA 2A5WA 2PJRB 1BMFA 3K4NA 1UD4A 3LMMA 1D0YA 3PUBA 3H5NA 3DKXA 3ZRGA 3OS2A 3OYEA 3SDBA 4B47A 3OYDA 4KJZA 2CFOA 4G6TB 2ZXIA 2GK6A 2VBKA 1X0CA 2QY1A 2LYCA 2WAQA 4NC7A 4CCLA 4OAYA 4G7WA 3QOEA 4YXWA 2KLOA 1WP6A 4YZ0A 1VF7A 3DPTA 2MD0A 2MABA 3CP2A 3EQOA 3D5SC 3I3LA 2X6WA 4PJNA 3K4KA 4HEA2 3GQ8A 3FHNA 3NE5B 4YRVA 2V1NA 3GVKA 3WWGA 2IS6A 1WJFA 2VJ4A 2W4SA 3PSIA 3OS1A 1KMHA 3PNVA 2KHMA 3LL7A 4F91B 4IKFA 2X6YA 4L8JA 1NHCA 2K9LA 1EA3A 4J01A 3G2BA 4CCKA 3JURA 3VYRB 3UW0A 4J00A 2R7UA 1MMAA 2M7BA 3DLAA 1TT0A 2GK7A 4OJ6A 4PJJA 4RM3A 4D9JA 3ZIAA 4XN0A 3OOUA 2ZXHA 3GBGA 2CV2A 3LMWA 5HNHA 1AIRA 3RSNA 2WPDA 1WMRA 3D5LA 1J09A 1OFMA 4G7XA 4E7SA 2R7SA 3PSFA 4FETA 4BQNA 3H5RA 1T5EA 2NTPA 2JUGA 3C2HA 3HPGA 3MMYB 4NK8A 4E7HA 2ZSHB 1O8LA 1JI8A 2DT7B 3MD2A 4MXNA 1D1CA 2IGOA 4PSWA 5LFAA 1MMDA 2WB1A 4IX7A 1NBMA 3PL8A 4JOMA 2R7OA 3A35A 3BC9A 3HKZA 4KISA 1H8EA 3OYMA 4XOPA 4II3A 3OYLA 2UWMA 2RNGA 3AL0C 2X8KA 4II2A 3OEHA 4XLEA 3SEZA 3DU6A 1Z21A 3BCFA 2XF6A 1QU3A 3EQNA 1QHGA 2KRHA 4ZTFA 1KZLA 2O17A 4Z03A 3BCDA 2LG4A 4LIUA 2V31A 3FKSA 2V9KA 2L2OA 4XLAA 3UR3C 2QX3A 5CDFA 2P0WA 4KKTA 1I18A 3DEEA 4HRIA 2NT6A 2L7KA 1X1BA 3K70D 4DNTB 4BUPA 1BR2A 2WADA 4BQQA 4EATA 4DBQA 1K6YA 1SFKA 3S8PA 3EPZA 2JVGA 2HU9A 2QKMB 3BG6A 1V5GA 5HVQC 4MR0A 4W8RA 3OL3A 5CQGA 4BACA 4ASUA 3RTRA 3EUHC 4CSWA 3L2VA 1VLYA 1O8DA 2CK3A 1WTHD 2WY7Q 2X6XA 2I8DA 3VSVA 2DT6A 3OYJA 2X1DA 1KCDA 2R7TA 2K5CA 4HSTA 3GQ7A 1O8JA 4CCMA 2VQHA 2AQFA 2O5RA 2VKHA 4B44A 2Z16A 4XLFA 3GVJA 4HSRA 1BHEA 2KZVA 3PJRA 2WJVA 4NK6A 2ELJA 1YX5A 4IZZA 2HPMA 3OYNA 2ZSIB 4DK0A 4U49A 2IQ7A 2F43A 1Y56A 2PMZA 4YZQA 3GQBA 1U0JA 2IS2A 2HVSA 4PFOA 3K4CA 1UG0A 1V5FA 4CA0A 1DGWY 2INVA 1IDKA 4OWRB 4CCJA 3A2KA 2WJYA 2XAUA 2GJRA 5C1EA 3ZGKA 2GJPA 1X19A 3VYTB 3OY9A 3BH4A 5HKKA 3PFYA 3KX2A 2VJJA 3GVLA 3ZR8X 2WA0A 2IS4A 3KEWA 3BLYA 4U7BA 2M7AA 3LNNA 1QHHD 1BR1A 4DOZA 3H0DA 4W8TA 4B3XA 3CZ6A 1WJAA 4CCNA 1O88A 1D0ZA 1SAUA 1BR4A 3DPLC 2EWEA 2KQRA 4AYBA 4XN3A 3FBIB 3EUAA 4E0FA 2WY8Q 3S32A 2E60A 2V4DA 2L9NA 2KP6A 1HG8A 1IDJA 2OV7A 4XMYA 4HNUA 2D3NA 4N4OB 1FMWA 2LBFB 1MMGA 3OYKA 3UNGC 3W2WA 1PKVA 3OYBA 3HPHA 1FX0A 4XOTA 1H80A 2K3PA 2QKLB 3I9V2 4E7IA 1BPLA 4AVZA 3ZPNA 3ZQQA 3VWBA 4HIZA 3JU4A 3W2AA 3KEYA 4PJLA 1I8DA 1T0FC 1IA5A 3K4MA 3LSHA 4XM3A 4DGWB 4XLHA 4Z05A 2XF7A 3T56B 1BN8A 2VXZA 2FUG2 4CH7A 5FRNA 4XKBA 4NQWB 3U21A 3HUGB 2V4JC 1N75A 2Y0SA 2XZPA 4B3GA 1UD5A 1KTWA 1RU4A 4HNTA 4BDYA 4BE2A 5LD2C 4FASD 4XORA 2IS1A 4PUSA 3VYUB 1V0EA 2LRDA 4XD7A 2Z8GA 3DPUA 2W7NA 2W6JA 3G05A 2NT9A 3CJQB 3KRGA 2JJ1A 4P22A 1Y6IA 1MABA 2X1CA 2O0WA 3BG7A 3K10A 2MC4A 2O0VA 3OR1C 1LDKB 4NC8A 4RLFA 4PK4A 3MKWB 1OR7C 2IGKA 2M4KA 3H9GA 3BCBA 4HG2A 3VSKA 2E5ZA 2BVMA 3B90A 4H4KC 4D1QA 1UD8A 2CV1A 3OR2C 2KPMA 2XGJA 1GQ8A 1O8MA 3ZCOA 1X4OA 2Q2EB 2XZOA 2WAEA 1W9XA 1DBOA 3T51B 1AA7A 2E1MB 1OGMX 3L2UA 2CUJA 2O04A 2CV0A 3H9JA 3KYLA 4ZTJA 4YZAA 1P9QC 3BC8A 4PFPA 1R6RA 4Y3OA 4Y4RA 3OYCA 2PYGA 3TMOA 2VLAA 4MLOA 3S93A 2HZDA 1KONA 2WBMA 2W00A 3HG9A 4CZCA 5KNLA 1W0JA 2NSPA 4U4BA 3RPUD 1JRGA 2L5QA 3HOTA 2VXDA 4URRA 3H9QA 1EFRA 3E0JB 2Q1ZB 3VSUA 4EW9A 3IP4B 3ZPPA 4F92B 3RCOA 3NWTA 1XG2A 1PE9A 3OFNA 3FKJA 2LY1A 2R7VA 2VJ5A 1MNDA 4LIVA 3NWSA 4ZYAA 1UELB 5TGTA 4BJ5C 2OUMA 4BS9A 4E6KG 4X0GA 1K28D 4F93B 1Z3YA 4XLCA 1V0FA 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1E A;  2VBK A;  1X0C A;  2QY1 A;  2VJI A;  2X3H A;  2UVF A;  1QCX A;  1KCC A;  1OGO X;  4YZ0 A;  2VJJ A;  4Z06 A;  3VMV A;  3T9G A;  3B8Y A;  3EQO A;  2X6W A;  1OOC A;  2UVE A;  3GQ8 A;  4OZZ A;  3WWG A;  5C1C A;  4W8T A;  4XL9 A;  1CZF A;  2NZM A;  2ODL A;  4PMH A;  3B4N A;  4XKV A;  1EE6 A;  1IB4 A;  1O88 A;  2X6Y A;  1NHC A;  3GQ9 A;  4XNF A;  3JUR A;  2EWE A;  3UW0 A;  3VST A;  4OJ6 A;  2PYH A;  4XN3 A;  4XN0 A;  3GQA A;  4YZX A;  4XKW A;  3SUC A;  3LMW A;  1PLU A;  1VBL A;  4YEJ A;  1AIR A;  4W8S A;  2QXZ A;  1HG8 A;  1IDJ A;  4XMY A;  1WMR A;  1OFM A;  1PXZ A;  1DBG A;  1H80 A;  2NTP A;  4XOT A;  4OZY A;  4I84 A;  4AVZ A;  4NK8 A;  4C2L A;  4XQF A;  1O8L A;  4MXN A;  1IA5 A;  4YEL A;  4W8Q A;  1O8I A;  4XM3 A;  4XLH A;  4Z05 A;  1BN8 A;  4OJO A;  1RMG A;  4XOP A;  2NTQ A;  1KTW A;  1RU4 A;  4OJL A;  4XLE A;  4XOR A;  2BSP A;  4OJP A;  2INU A;  2Z8G A;  3ZSC A;  2NT9 A;  3EQN A;  3KRG A;  2O0W A;  4XON A;  2O17 A;  4Z03 A;  4XR6 A;  2O0V A;  4XLA A;  2VBE A;  2QX3 A;  3GRH A;  2NT6 A;  3FY3 A;  3B90 A;  1O8F A;  1OFL A;  1GQ8 A;  1O8M A;  1DBO A;  4MR0 A;  4W8R A;  1OGM X;  2X85 A;  4OJ5 A;  2O04 A;  2VBM A;  1O8D A;  4YZA A;  2X6X A;  1O8E A;  3VSV A;  1QJV A;  2PYG A;  1KCD A;  3GQ7 A;  1RWR A;  1O8J A;  1O8H A;  2NSP A;  1JTA A;  2PEC A;  4HWV A;  4U4B A;  5AMV A;  3VMW A;  1JRG A;  4XLF A;  1BHE A;  2NST A;  4URR A;  4NK6 A;  3VSU A;  1O8G A;  4EW9 A;  3ZPP A;  2O1D A;  1XG2 A;  4YZQ A;  4U49 A;  2IQ7 A;  1PE9 A;  1K5C A;  1O8K A;  2INV A;  1IDK A;  2NTB A;  4XLC A; 
#chains in the Genus database with same CATH topology
 3VYS B;  5JR3 A;  5DCF A;  1MBF A;  3LNQ A;  4QFM A;  4B3F X;  4E7K A;  3Q0V A;  2VOO A;  1E1Q A;  2F5F A;  1VQP B;  4Z4T A;  3WQZ A;  2CUZ A;  2E19 A;  3B8Y A;  4S0H B;  3HXL A;  5B66 C;  5A8A A;  1MBH A;  3OMY A;  3OW7 A;  4RD0 A;  3E1Y E;  2R7W A;  5DUI A;  1J5Y A;  2ZZF A;  1LKX A;  3WNC A;  4GDF A;  3DF8 A;  1SKY B;  2VIX A;  1VFC A;  3K70 C;  2ODL A;  2A6E F;  4OIN F;  3RKW A;  3Q38 A;  3WY9 A;  3B4N A;  1IB4 A;  1YS7 A;  1U8B A;  3J7Y J;  3TDU C;  3I5U A;  5E3L A;  3IC7 A;  1M1K D;  2XTY A;  1I5Z A;  1D8T A;  4IPA A;  3VPR A;  1LVA A;  4ENK A;  1UB9 A;  1O57 A;  3FXQ A;  4IJA A;  3VST A;  2GQF A;  3RKX A;  3WGI A;  1E0E A;  1WJD A;  1TL8 A;  1XCB A;  4W8S A;  1P4A A;  3S3O A;  4DNR B;  2BOL A;  4Z4V A;  1WFX A;  4QIW N;  1HKS A;  2DCE A;  4KMU X;  4L5E A;  4Q47 A;  1VQK B;  3ONY A;  2JVH A;  1IXS B;  1PP8 F;  2NAZ A;  1JT6 A;  2Y0S N;  1K79 A;  2DET A;  1Y0Y A;  1WH5 A;  1G7T A;  2XAG A;  1WU8 A;  1LNW A;  3LSM A;  1XS9 A;  1IB0 A;  3V4G A;  4KIT B;  1RES A;  1GVD A;  3D5R C;  4BEH A;  2VQC A;  5FRO A;  2Q8K A;  3SEQ A;  3LSK A;  1BOA A;  3B02 A;  1B1B A;  4A3D J;  1TVC A;  2NTQ A;  1FOW A;  3DTI A;  4DQ2 A;  4QHY A;  3GLL A;  4OJL A;  1RPW A;  3WND A;  5DCM A;  3HRU A;  2VC1 A;  4YII A;  4UB8 C;  4ZZL A;  2OPT A;  4QPO A;  1QFZ A;  1DP3 A;  3S3N A;  3VSL A;  1QRC A;  3A4C A;  2LBF A;  1YRN A;  5IYN A;  1BJA A;  2VBZ A;  4DIQ A;  5DEQ A;  3ECO A;  2F5D A;  1FBU A;  3RKY A;  2E34 A;  4OMZ A;  1S4M A;  2PX9 A;  1R00 A;  2OBS A;  1CF7 A;  1HZE A;  5ICG A;  2NVY J;  3L2R A;  2KIF A;  3DU1 X;  2Q6L A;  4DK1 A;  2DPU A;  1XCV A;  1O8F A;  4RAZ A;  2WZN A;  1VQ5 B;  3TP3 A;  4BAY A;  4WCG A;  2NVX J;  1VQ6 B;  3EYI A;  3OYI A;  3REO A;  1XGM A;  3HB9 A;  4JX6 A;  1W36 C;  3K4B A;  2P8T A;  3CRZ A;  2RC4 A;  1ORK A;  3CUQ C;  1VF9 A;  3KP2 A;  1T39 A;  3W5H A;  2XZL A;  5HZB A;  3M1C A;  2DTR A;  1RUO A;  2IRF G;  4NHJ A;  1W0U A;  3OPO A;  1RWR A;  4JQF A;  5DM7 F;  2XAS A;  4BQA A;  1WPC A;  4KIF A;  2MYS A;  4WZK A;  3VMW A;  1DGR M;  3ZBT A;  1YIJ I;  2LRE A;  3GFJ A;  3CMY A;  3CMM A;  3HRS A;  2B7E A;  1SFU A;  4C2T A;  3Q3A A;  2MFZ A;  2FOW A;  3LA3 A;  4H0E A;  5EGO A;  3AFH A;  3E1S A;  3QYE A;  3F72 A;  5GV7 A;  2MG4 A;  2X53 S;  2VBW A;  2OA4 A;  3M8J A;  4B4C A;  4IEJ A;  1G7C A;  2HZT A;  5J3O A;  2NTB A;  3FXK A;  5H59 A;  1G8X A;  2E5N A;  2GA2 A;  2DA5 A;  4ZYD A;  3TOA A;  1V5E A;  3G1L A;  5FD5 A;  3MAJ A;  3W6J B;  1S7E A;  1WZ2 A;  2IXS A;  3DV8 A;  1QCX A;  4MQ9 F;  2R7X A;  3HRT A;  4AIH A;  5KHD A;  4BXF A;  4YCQ A;  3CCQ I;  1TZL A;  4G94 A;  2L7M P;  4DBR A;  3ZMS A;  3SQN A;  2H09 A;  5M5Y J;  2FEZ A;  2DIE A;  3DKY A;  2L02 A;  4V19 K;  1D5Y A;  1OIS A;  4OZZ A;  4RM2 A;  2V79 A;  3CC7 I;  1AWC A;  4CHU A;  1SFX A;  3WBJ A;  3SZG A;  5EMN A;  1RZ4 A;  3MKY B;  4HA8 A;  2JTV A;  3IH3 A;  1QFY A;  4PC2 A;  2RDP A;  4MIM A;  5J4Y A;  2F2E A;  1QBJ A;  1S5L C;  4BBS J;  3TGN A;  1K6O A;  1V54 H;  3KPH A;  2M5S A;  3LQQ A;  1ENH A;  3JRD A;  2DMQ A;  2JWT A;  1HKT A;  4KN4 X;  4LD5 A;  1PLU A;  1VBL A;  1D1B A;  2ESN A;  2EFP A;  4YEJ A;  2HVR A;  2D1H A;  3HGG A;  1GLN A;  1Z6T A;  1R71 A;  1U2R A;  2LC2 A;  4AD9 A;  2BX6 A;  2HCJ B;  2VQG A;  3HZJ A;  4P9U A;  2M0C A;  1YTY A;  4E7Z A;  2K4J A;  4ITV A;  3V7C A;  3VFZ A;  4ESF A;  4XQF A;  5C4X J;  4PC1 A;  3SLD A;  3W5V A;  1P4X A;  5IK2 A;  3OW2 B;  1KYW A;  3GZ5 A;  2DLL A;  2PFB A;  5HDN A;  4HQM A;  1MMN A;  2H6C A;  4MEY F;  3FPP A;  2FOK A;  2XKO A;  5F4O A;  1JHF A;  3T8R A;  2M0M A;  3S1R J;  2DAO A;  1E17 A;  2R9V A;  2XKP A;  2HDW A;  2LY9 A;  4TN1 A;  3SEJ A;  1ULY A;  4A5N A;  2XVC A;  2P7V B;  1TLL A;  2HDN B;  4RD2 A;  2BSP A;  1OCT C;  3WHB A;  2R7R A;  2D3L A;  5B3S H;  1Z91 A;  1EFC A;  3S15 J;  3H94 A;  1YG2 A;  2XPV A;  2KMU A;  2E7X A;  1ODD A;  3DBH B;  1R5G A;  1VQL B;  3IHU A;  2KKO A;  3OAA A;  3FMS A;  3TL4 X;  1YX3 A;  4IOC F;  4CZZ A;  1MJB A;  3QFC A;  4A3B J;  2DJI A;  2JJ2 A;  3ASP A;  1P92 A;  4UZF A;  2DOF A;  2CFX A;  4LB5 A;  1E64 A;  1NK2 P;  2WAF A;  1IN6 A;  3BH6 B;  3WTY C;  4AIK A;  4E7J A;  1K8A D;  2E36 A;  1O3T A;  1DPU A;  3QYB A;  4TMX A;  1CLW A;  2CQQ A;  3M07 A;  3F23 A;  2CRV A;  4YIR X;  4FTH A;  2CQK A;  2V7F A;  5K5R A;  4I2O A;  2VOP A;  2MBF A;  1B8I B;  1MW7 A;  1XC5 A;  2Q6K A;  4KKU A;  4UV8 A;  4U0V A;  2J8K A;  3RYR A;  1YO5 C;  1QX4 A;  4IOA F;  3RYP A;  1OCO H;  2XPU A;  5AMV A;  3PNT A;  3WTX C;  3CC4 B;  4P55 A;  1NRK A;  1VTN C;  5J1R A;  5DD4 A;  3OYF A;  3LSG A;  2F48 A;  2LD5 A;  2BW3 A;  2EH3 A;  2FML A;  3OOP A;  1MBG A;  4GQN A;  1HOM A;  4Q4Z F;  3MFK A;  1LEB A;  2XAH A;  2MLK A;  3WTS C;  3JTG A;  1UD4 A;  2M87 A;  3PET A;  1HA3 A;  1GO2 A;  1QG0 A;  2FVG A;  4AF7 A;  2P5L C;  1QQI A;  3ZRG A;  3OS2 A;  1B23 P;  2EIL H;  4B47 A;  3OYD A;  4KJZ A;  2GK6 A;  2VBK A;  2QY1 A;  2YPR A;  2WAQ A;  4B1R A;  4G7W A;  3QOE A;  2QEX I;  1KK2 A;  3FXM A;  1A8P A;  2WB1 N;  2M34 A;  4A3E J;  2RKH A;  1QA2 A;  3D5S C;  1G2H A;  2FU4 A;  4PJN A;  2E7W A;  1Q7Y D;  1FX7 A;  1MBE A;  3E6B A;  3J81 k;  2V1N A;  3WTV C;  2ZL5 A;  3GVK A;  3PSI A;  4Z4Y A;  3ABT A;  3LL7 A;  1EJ9 A;  2OZU A;  1UHS A;  3V8L A;  4F91 B;  1S72 B;  3DKW A;  3ABU A;  2N8G A;  4RCZ A;  3QU3 A;  1ZRF A;  1EA3 A;  2AXT C;  1W2B B;  5D6E A;  3GVA A;  3UW0 A;  2NV4 A;  3F3X A;  2LK2 A;  3DEW A;  2AO9 A;  4PJJ A;  2BZT A;  1K78 A;  3ZIA A;  4XN0 A;  2DA2 A;  2CV2 A;  5J40 A;  1D1N A;  5HNH A;  3JRF A;  2EFG A;  4ACB A;  4IRH A;  2IA0 A;  2QGU A;  5GAG J;  3D5L A;  4OPW A;  3QOP A;  1OFM A;  3W2I A;  4FET A;  3T0Y A;  4BQN A;  3FPK A;  2RC6 A;  3R6S A;  2JUG A;  1R7J A;  5JVG F;  2QZA A;  1H0M A;  1H89 C;  1OCZ H;  3MD2 A;  1VQN B;  1YLO A;  3JTH A;  4MXN A;  1N25 A;  5LFA A;  1MMD A;  2XGE A;  3OIO A;  1H9T A;  3HOY J;  4M74 A;  3CJN A;  3OYM A;  1H8E A;  4WZE A;  1KD1 D;  2BM5 A;  1DDN A;  5EG0 B;  2UWM A;  3PA1 A;  3H92 A;  3OEH A;  1SD6 A;  3BDD A;  4KIC A;  4II2 A;  2A3S A;  3SEZ A;  5BOX A;  3IWF A;  4GYI A;  2UZK A;  3JQR A;  2AHO A;  1TYX A;  4PC6 A;  5AN9 A;  3BPV A;  2P5V A;  4M3G A;  4D7M A;  2Q6I A;  1QVF B;  4Z03 A;  1JJ8 C;  1GV2 A;  2WYR A;  1S8N A;  1FYK A;  1IN4 A;  2OQG A;  4I09 A;  4XLA A;  3CCM I;  1V4R A;  3RJP A;  5CDF A;  1I18 A;  2DMP A;  1VQ7 I;  3WOD F;  2X6O A;  2NT6 A;  4A0Y A;  1HW1 A;  1E3P A;  3K70 D;  5LGT A;  1DUX C;  2QTZ A;  2WAD A;  2O8K A;  1D2E A;  4EAT A;  4YAU A;  1HXD A;  2JVG A;  2HU9 A;  2QKM B;  4LC0 A;  1VQ9 B;  1W5C C;  4ASU A;  4EJU A;  5D8L B;  1VLY A;  1K4S A;  3ZQ7 A;  4W1U A;  3CDL A;  1T0F A;  2OCC H;  4U0W A;  2EIX A;  2B0L A;  2DT6 A;  3HOW J;  2DOG A;  1F43 A;  2R7T A;  2K5C A;  3PUF A;  1FRN A;  1O8J A;  3BOQ A;  3I71 A;  2VQH A;  1ZLJ A;  4N9I A;  2O5R A;  2MC3 A;  4B44 A;  4IHW A;  4XLF A;  1HKQ A;  3WTT C;  5J4V A;  1TW3 A;  3CUQ B;  3ZMT A;  1HDD C;  4NK6 A;  4KFC A;  1YX5 A;  4IZZ A;  2HPM A;  3W6V A;  1O7F A;  2ZJR F;  4DK0 A;  5IPA A;  5IYQ A;  2EIM H;  1U0J A;  1UST A;  3R60 A;  2IS2 A;  3CME I;  5L3F A;  5FLV A;  3CW2 A;  4M9S A;  5EEA A;  4BKX A;  2PI0 A;  2INV A;  4G12 A;  4OWR B;  4FIS A;  2L9R A;  1YX2 A;  3A01 A;  5C1E A;  3VYT B;  3OY9 A;  3BH4 A;  2GQQ A;  1W7P B;  3BR6 A;  3E97 A;  3HSR A;  2P81 A;  3KEW A;  2OD5 A;  2DO7 A;  3P27 A;  3BLY A;  2VNJ A;  2HXI A;  2DA6 A;  3LNN A;  4M2L A;  1CQT A;  3OP1 A;  1K61 A;  1QHH D;  1BR1 A;  2GLO A;  2BM4 A;  3T5X A;  4XK4 A;  1KQ5 A;  2EZK A;  1ACI A;  1O88 A;  5HLI A;  1FJL A;  1XPX A;  1Z6R A;  2G0Y A;  1IW7 F;  3DPL C;  2EWE A;  2F1L A;  2A5Y B;  1FSE A;  1R49 A;  4XN3 A;  3FBI B;  5GV8 A;  2WY8 Q;  2V4D A;  1WSV A;  2RN7 A;  4IXA A;  2BXZ A;  4N9H A;  4RPD A;  1IDJ A;  4HNU A;  2D3N A;  3MHP A;  2M45 A;  1ZGJ A;  2M8E A;  2F5E A;  1G3S A;  1T8I A;  1ZM3 A;  1NB9 A;  4X7D A;  3OYB A;  3BRO A;  3HPH A;  4LMY A;  2STT A;  3HDD A;  1FX0 A;  2K3P A;  1H80 A;  3TP0 A;  5ICF A;  4LK0 F;  4EMS A;  1C0W A;  1FDR A;  1QPI A;  2QBY A;  1QGP A;  4KNY A;  3JU4 A;  3V8J A;  1DAB A;  3L2C A;  5DDG A;  1X3W B;  4TV7 A;  5EYR A;  4IHV A;  1FP1 D;  1B9M A;  3C18 A;  4XLH A;  4Z05 A;  3ZQL A;  1YJN B;  2FUG 2;  4CH7 A;  3HHG A;  2PBI A;  4GCV A;  2Y0S A;  1YHQ I;  2ZNY A;  1ZG3 A;  1KTW A;  4L18 B;  5CVJ A;  3CCU I;  3O3K A;  1XTA A;  4ON0 A;  3U2R A;  1ZLK A;  2IS1 A;  2VBY A;  4EVI A;  4XD7 A;  2Z8G A;  2LTP A;  2MSY A;  3DPU A;  2W6J A;  3BJO A;  2BY0 A;  3CCR I;  3H3U A;  1MAB A;  1FZP B;  2STW A;  4Z4S A;  1BJZ A;  1PVE A;  3K10 A;  4V2G A;  3MKL A;  3BPX A;  2MC4 A;  1X3Z B;  4Y52 J;  4NC8 A;  1UFM A;  2EFO A;  4RLF A;  4A5M A;  3PEN A;  1LM1 A;  1A6I A;  3Q0W A;  1B72 A;  3BCB A;  1GV5 A;  2K27 A;  5CLS A;  4XLN F;  3WG9 A;  2XGJ A;  4KIB A;  1X58 A;  4IHT A;  1PJ6 A;  1DBO A;  2P4W A;  3T51 B;  1AA7 A;  3T1B A;  4I6Z A;  2F4O B;  2M2E A;  3EDP A;  1JKR C;  4A3K J;  4ZTJ A;  4YZA A;  1XMA A;  2O6G E;  1R6R A;  4Y3O A;  4KUM A;  3ABM H;  3CCS B;  3K2Z A;  2W00 A;  2WBM A;  3E5X A;  4S05 A;  1W0J A;  4RD3 A;  3KP5 A;  1WOS A;  4LB6 B;  3QFR A;  5IY5 H;  2HR3 A;  2L5Q A;  3HOT A;  2BN4 A;  2JN6 A;  4URR A;  2J5O A;  3E0J B;  2PG4 A;  2L9V A;  2Q1Z B;  5D8K B;  5C3E J;  1RUN A;  2OCE A;  2V1U A;  3GSI A;  1JGS A;  4FK8 A;  3ZZU A;  4EW9 A;  3PUM A;  3PM1 A;  2E71 A;  2KIU A;  2LF7 A;  2WWY A;  2PJP A;  1FNN A;  3CB4 A;  1MD0 A;  4ESB A;  3KET A;  1SFO J;  1GDT A;  3OFN A;  2W57 A;  1IRF A;  3IKV A;  2Y9Z A;  5E3N A;  2OYN A;  3S2D J;  1QFJ A;  5FGM A;  4LIV A;  2BSA A;  3NWS A;  2DJN A;  4RBO A;  1UEL B;  5TGT A;  1K28 D;  4UUT A;  4F93 B;  1OGI A;  3PSS A;  1BW5 A;  2BMW A;  4CXF A;  3OSF A;  1XD7 A;  4AUX A;  1I7P A;  3PSZ A;  1WXR A;  1ZGW A;  5EZG A;  3NAR A;  1REP C;  4Z06 A;  2HNH A;  4GRI A;  2V26 A;  3UKG A;  2B7B A;  1U6G A;  1OOC A;  4QLC U;  2BVL A;  2CRG A;  1T6S A;  5HS7 A;  2CW8 A;  1X1P A;  1ETO A;  2GAU A;  3GXO A;  3GTQ J;  2BHY A;  5JBQ A;  1MNE A;  2BEO A;  2LH9 A;  4ZC3 A;  3ROU A;  4S04 A;  1CZF A;  2NZM A;  4I02 A;  3VDX A;  1XE1 A;  3R4K A;  4UUS A;  2E1O A;  5CJ9 A;  1KQ9 A;  3MQ0 A;  4RMN A;  2W24 A;  2R7D A;  5IYR A;  1A31 A;  2ECC A;  1H8H A;  1NHA A;  4MO7 A;  2L3D A;  5EEH A;  1ZH5 A;  1IXR C;  2QSF X;  4C3H J;  2CND A;  1S29 A;  1R4M B;  1XB4 A;  2KIM A;  3BJ6 A;  3FBN B;  5C44 J;  1ZKG A;  1JKO C;  2GJP A;  2P6S A;  2JIZ A;  4RGS A;  4A3I J;  2LKP A;  1PXZ A;  1R5I D;  3LYC A;  3K6G A;  3CDH A;  3F8C A;  5K7H A;  3IUO A;  1T6X A;  3CJR B;  2OTJ I;  2CQX A;  2V6E A;  3IH4 A;  4RB0 A;  1U3E M;  1FOY A;  2LKS A;  3N90 A;  3TO6 A;  5D5X B;  1TYV A;  4W8Q A;  3GEZ A;  3H35 A;  3PA2 A;  1WCM J;  2K7L A;  2VE9 A;  4RD6 A;  2FBH A;  2FJ1 A;  4Y7C A;  3DWL E;  3S1M J;  1F4K A;  5CQE A;  2E1B A;  3CD6 B;  1VQO B;  2V1X A;  2XGD A;  4ANJ A;  1QVT A;  3CES A;  1WOP A;  1Y39 A;  3ZZT A;  4NUB A;  4HE6 A;  2INU A;  3S2H J;  1FLI A;  3PO3 J;  4UAJ A;  3M4O J;  3HEF A;  4RB1 A;  1E1R A;  2QYU A;  3JRI A;  3DLL F;  4A3M J;  4B43 A;  4J0Q A;  1XQB A;  2WZP P;  1PYV A;  5AIQ A;  2E2J J;  4DW6 A;  4EM0 B;  3GTM J;  1KYZ A;  2BY1 A;  2OF7 A;  5LMZ A;  3ZUG A;  3U9G A;  2HDD A;  4IHY A;  3JQQ A;  3FY3 A;  2VPL A;  2C5H A;  2X1E A;  3ABL H;  3G3Z A;  2RGV A;  4B48 A;  5HLG A;  4RB2 C;  5HS9 A;  4NQW A;  3ZMD A;  4F55 A;  4R79 A;  1X1C A;  2FNA A;  3DTE A;  4IVN A;  4XRS A;  3LFK A;  2XTW A;  2IT0 A;  3SHF A;  1E43 A;  1G59 A;  3DBR B;  5FRM A;  3F9K A;  3HL2 A;  4ZDO A;  2BBY A;  4FX0 A;  1JTA A;  3E6C C;  4BPR A;  2EIJ H;  1MH4 A;  1RKT A;  3QPH A;  4UZU A;  3QQA A;  1TNT A;  5BMZ A;  2X4H A;  1TWF J;  3QYF A;  2XUB A;  2XPW A;  4MGR A;  1K4Z A;  1KK1 A;  1J9Z A;  2L01 A;  4P26 A;  2QQA A;  2DFI A;  1LUJ B;  1NG6 A;  3A0B C;  1R5O A;  4PSX A;  5J6X A;  2Q2E A;  4U7D A;  4O6J A;  3OOC A;  2VT2 A;  5E8I A;  2R92 J;  1RQR A;  3E7L A;  5FO1 A;  3C1D A;  5BSX A;  1Z7U A;  3AGQ A;  4YFN F;  1IUF A;  5EJC A;  1ZR4 A;  3VMF A;  2EWN A;  2JRM A;  3CCE B;  1QUE A;  1XSV A;  5HOO A;  4UV9 A;  3BT9 A;  1MJ9 A;  3O8G A;  2ZFU A;  3TQN A;  9ANT A;  2Y75 A;  1WDT A;  2HPI A;  3TW6 A;  1SKQ A;  2EZH A;  2VFO A;  5E3M A;  2UVE A;  3FDY A;  3J7A Y;  2VAS A;  5FD6 A;  2HGC A;  4HE5 A;  3KCC A;  5EZH A;  2K9M A;  3AG4 H;  2CW7 A;  4M3F A;  4PMH A;  1YE9 A;  4N4N B;  2Z2S B;  3GTJ J;  4CQJ A;  2W1O A;  1BW6 A;  5BS6 A;  1YIT I;  2PIA A;  1BI1 A;  1ZTR A;  4W97 A;  4XNF A;  3G4S I;  3KEQ A;  5LBQ A;  1Y0R A;  1X4P A;  4MEX F;  3ISP A;  4OM9 A;  2EFW A;  4U0Y A;  5FKM A;  4BU2 A;  3RQI A;  5DN6 A;  2CS3 A;  4XKW A;  4Y9U A;  2KDO A;  4WXD A;  2QXZ A;  2VBV A;  1F1Z A;  2LP0 A;  2K9S A;  2QEN A;  3OIQ A;  3E6M A;  4BDZ A;  3MEX A;  1AIP A;  3KL9 A;  3AVT A;  2PMU A;  4YFK F;  1ZK8 A;  3QPT A;  5FFX A;  5KAI C;  5F0C A;  3OEE A;  3D0S A;  2RRE A;  4IQ4 A;  3LSI A;  4AU7 A;  2WSS A;  2K85 A;  4ZH4 F;  3COA C;  4C2U A;  1O8I A;  5KK1 A;  1MSE C;  2QM3 A;  4OJO A;  2K02 A;  1TUI A;  1Y0U A;  5J1Y A;  1IDZ A;  1WSU A;  2VB6 A;  4F3Q A;  3BP8 A;  4TMT A;  2VT3 A;  1ZN2 A;  3FZV A;  3CO7 C;  3S1N J;  2IP2 A;  2GOX B;  3AST A;  2IGN A;  1X1D A;  2O3F A;  3C3W A;  5F27 A;  3W5U A;  4OJP A;  3MZY A;  3ZSC A;  4N3N A;  2QE7 A;  3T53 B;  3B82 A;  4XKC A;  4NNJ A;  4XSX F;  1GHC A;  4XON A;  4XSZ F;  3CPX A;  2O8X A;  1Z7L A;  3BY2 A;  2M3A A;  4RAG A;  1Z05 A;  3I59 A;  1JXS A;  1ETV A;  2B0R A;  2UV1 A;  1MZB A;  1BI3 A;  2AXL A;  4B09 A;  4EM1 A;  3LSR A;  1ZRD A;  3I1F A;  4KDP A;  2VBX A;  3FXO A;  3A8I A;  4A0Z A;  1R5B A;  4M71 A;  1OFL A;  3PQJ A;  4K1X A;  3OWT A;  2TDX A;  3H5A A;  1DDG A;  4U9U A;  2JA2 A;  5AIP A;  3A3G A;  1YIO A;  4OJ5 A;  3LQE A;  4ENM A;  1YI2 I;  1H85 A;  4Z4R A;  4E70 A;  3OE7 A;  3G1M A;  4LG0 A;  5CKT A;  1IN8 A;  5FLX K;  1QJV A;  2BM6 A;  2OBR A;  3K4J A;  1HBX G;  2DER A;  3T8T A;  4BGD A;  4LBW A;  1WRJ A;  1YLF A;  1UD2 A;  4DZJ A;  4FXU A;  5KW9 A;  4XID A;  2XB0 X;  1XSX A;  1Z3X A;  3SJP A;  3CCL I;  1JKQ C;  1MRZ A;  1WJB A;  2W6I A;  3VR6 A;  2O1D A;  1IRX A;  1SD5 A;  1ZAR A;  2EV0 A;  3KZY A;  3ZOB A;  2JSP A;  3LST A;  1YIJ B;  3LSP A;  4CYC B;  2PJR B;  2KDZ A;  1A04 A;  1BMF A;  1VQM I;  3ERE D;  1RQP A;  3MCA A;  1KA8 A;  1ZQ3 P;  3PUB A;  1X2M A;  2ZO4 A;  3SLN A;  3TED A;  4QTR A;  3OYE A;  5LRS A;  4X7C A;  1EF4 A;  2R3S A;  2CFO A;  3P9I A;  3ES9 A;  4RLZ A;  3BQZ A;  2JA7 J;  3QE2 A;  4NC7 A;  3K1N A;  4CCL A;  3GZ6 A;  4YXW A;  3GX4 X;  2JZY A;  4Y7N J;  1FC3 A;  3JRH A;  4DNC A;  1K4T A;  1WP6 A;  1N0V C;  2VNK A;  4NCN A;  2QF7 A;  4H9G A;  4HX8 A;  3RPQ A;  3SDG A;  3WGH A;  1PJ5 A;  1R5N A;  3HKZ N;  1SEU A;  2MLG A;  1KQS B;  2BY2 A;  3WWG A;  1SAN A;  3CCQ B;  1J2X A;  3PNV A;  2KHM A;  2R5Z B;  3S14 J;  4PGO A;  2JK3 A;  4AF6 A;  1D5V A;  3ISX A;  4C3J J;  3RZD J;  5M3M J;  1XB2 A;  3VYR B;  3CC7 B;  1BN5 A;  5E20 A;  1ETW A;  2GK7 A;  4P3Y A;  3Q3S A;  4ZYG A;  3SY2 A;  1EH6 A;  4HV5 A;  2KT0 A;  2ZXH A;  1SD7 A;  4HDU A;  1UHW A;  2CYY A;  3RSN A;  1R1U A;  1CQX A;  3F21 A;  3A1P A;  3OJX A;  1TQI A;  3KYC B;  2NTP A;  4NK8 A;  2EA4 A;  2ETH A;  4E7H A;  1O8L A;  1QRY A;  2NYX A;  2F4N A;  1D1C A;  1ON2 A;  2IGO A;  5F64 A;  1EZG A;  5D5U B;  3PL8 A;  2R7O A;  3GFL A;  2HEO A;  2GXA A;  1HF0 A;  5FKK A;  4IRI A;  1LE8 B;  1OYI A;  5EG0 A;  3AVV A;  5F04 A;  1OCR H;  2JRT A;  3G71 I;  2RNG A;  3AL0 C;  2J8I A;  2MH2 A;  3H3V K;  3ZMU A;  2I10 A;  1V3F A;  2XF6 A;  1PDN C;  4DZP A;  1JJ6 C;  1TBX A;  1QHG A;  4ZTF A;  4MFE A;  4KIG A;  1QU3 A;  4DQL A;  3EQN A;  2YWG A;  1FSH A;  1SFE A;  1EXM A;  1Z0X A;  2ECB A;  3FKS A;  2V9K A;  1AKH B;  5E1Z B;  3UR3 C;  2VYQ A;  4KKT A;  3H0G J;  3SFI A;  4HRI A;  4DNT B;  1FNC A;  2VOD A;  4BUP A;  4U88 A;  4BQQ A;  4C43 A;  4MR0 A;  3KP6 A;  2HOT A;  2ICW G;  2BM7 A;  3Q9V A;  4L9V A;  2ZME A;  3RTR A;  4CSW A;  5E1W A;  3L2V A;  1O8D A;  2VE8 A;  2L4M A;  2Y69 H;  4IHS A;  2CK3 A;  1F36 A;  1R9T J;  1QZZ A;  3HOV J;  2X6X A;  3AG1 H;  3OYJ A;  4L5J A;  4A3C J;  3SJM A;  1KCD A;  3QP6 A;  2HQN A;  3WYA A;  5H5J A;  4CCM A;  2CG4 A;  5E17 F;  1OFC X;  2NXN B;  2Z16 A;  5GAE J;  1G7R A;  3BQY A;  2DMT A;  2ELJ A;  1IV6 A;  4UY8 I;  3TW7 A;  3NB2 A;  4RAY A;  5F0F A;  2DFE A;  2CUF A;  1QVG B;  1E63 A;  4YZQ A;  5FFZ A;  1Y56 A;  5FNZ A;  4G6Q A;  2ZJQ F;  2F4M B;  2EBI A;  4CA0 A;  5L3B A;  5GTI C;  3K9T A;  1IDK A;  1Y0N A;  3G73 A;  3WTZ A;  1OR7 A;  4FQG A;  2RNJ A;  2AS5 F;  2VZL A;  3JX8 A;  2XAU A;  2GJR A;  3CQZ J;  1M1E B;  2K40 A;  2OU2 A;  1X19 A;  2QCO A;  2ZJ2 A;  2Y31 A;  6PAX A;  1MDM A;  5IT9 K;  5HKK A;  4BY7 J;  2MW8 A;  2QSH X;  4FN5 A;  3P4G A;  1ETX A;  2VJJ A;  3Q0U A;  3ONU A;  1P6R A;  2WA0 A;  4MFD A;  2K86 A;  5F4J A;  3QFS A;  2ZC2 A;  4U7B A;  1QA6 A;  3FK7 A;  1ETY A;  1UG2 A;  1EP2 B;  1JTX A;  3ASO H;  2NS0 A;  3KLN A;  1FBS A;  4DOZ A;  3BR1 A;  2HWV A;  2VC0 A;  3AG2 H;  1QA1 A;  1RC9 A;  1IGN A;  2GRE A;  3HHH A;  5DV5 A;  3V7R A;  2ELK A;  2CSO A;  2OBP A;  3EET A;  3A8K A;  3W2G A;  3JRC A;  5J8F A;  4HW0 A;  2BV6 A;  3HJE A;  4AYB A;  1WOR A;  5DS0 A;  4Y17 A;  5FO0 A;  3OSG A;  1OMI A;  3QU6 A;  4A93 J;  5DCM B;  2L9N A;  1OGJ A;  2VNI A;  1HG8 A;  2OV7 A;  1S7O A;  3ERM A;  3I56 I;  1YRN B;  2LBF B;  1OCC H;  1FIA A;  2HOS A;  3UNG C;  1Q81 D;  1PKV A;  5THX A;  2QKL B;  3LVB A;  2JUC A;  1CF7 B;  2AHQ A;  2L4A A;  2YX4 A;  4HIZ A;  3OJW A;  3W2A A;  3DCF A;  4PJL A;  1PP7 U;  1T0F C;  2QVO A;  1O3S A;  1FNM A;  3LSH A;  1KQ8 A;  2GIZ A;  3O2P E;  4GGG A;  5JVT A;  1A5J A;  1BN8 A;  3FIW A;  1IN5 A;  3HGY A;  2XZP A;  2FE3 A;  1CNF A;  4P12 A;  3F6O A;  4BE2 A;  5LD2 C;  1WH7 A;  4A12 A;  5FJ8 J;  2M8G X;  1MMS A;  4L9T A;  1LLW A;  1V0E A;  2A68 F;  2Y30 A;  5J3L A;  3GFI A;  1NB0 A;  1B59 A;  2NT9 A;  1IDY A;  1NH3 A;  1VQ4 I;  1ETQ A;  4X8I A;  2O0V A;  3JCU C;  3OR1 C;  4NBQ A;  4HQE A;  3MMP A;  1T2K A;  1U5T A;  2XAQ A;  1TYW A;  2IGK A;  3H9G A;  4HG2 A;  5K1Y A;  4AID A;  1EFU A;  2E5Z A;  2A6H F;  3CCJ B;  5EGO B;  4D1Q A;  3B90 A;  4B3A A;  2XZO A;  2WAE A;  1ZR2 A;  1W9X A;  3CCM B;  2YU3 A;  2EZI A;  1U2W A;  1VQ7 B;  2CUJ A;  2Q0O A;  4A6D A;  2CV0 A;  2H6B A;  3H9J A;  1HST A;  1GVH A;  2X48 A;  1P9Q C;  4OPV A;  4ABZ A;  3BC8 A;  5IP6 A;  2QQB A;  3M8F A;  4Y4R A;  3RI4 A;  2XIG A;  2DQR A;  1UMQ A;  2V6C A;  3WE3 A;  4D7N A;  3H9N A;  5KNL A;  2V5I A;  2EFQ A;  2PMZ N;  2M30 A;  3RDI A;  4RCY A;  1FNB A;  1S72 I;  5E6T A;  5B5E C;  1JRG A;  2IW5 A;  2VXD A;  3H9Q A;  3WU2 C;  1W5T A;  3HSE A;  2G0E A;  2OTL I;  2KFD A;  3VSU A;  2A05 A;  4GO1 A;  4L9N A;  4M3E A;  4JX4 A;  4RAF A;  3PQK A;  4F92 B;  2CWE A;  3NWT A;  4KYW A;  4X05 A;  1XG2 A;  4RDK A;  4MQV A;  1PE9 A;  3LO8 A;  2XC1 A;  3L9F A;  3QPL A;  1ZM9 A;  3VEP A;  1PUF A;  2BE5 F;  2VJ5 A;  1MND A;  4UUV A;  4OOS A;  3LJY A;  4BJ5 C;  4C2M J;  3TDZ C;  3F8F A;  2DW4 A;  1TSP A;  4WK8 F;  3JRB A;  2R4G A;  1ETK A;  1S9H A;  3KZI C;  2X3U A;  4BJ6 C;  1I27 A;  5B6I A;  3CME B;  5D4S A;  2XC7 A;  3KEO A;  2UVF A;  1XFO A;  1OFD A;  1KCC A;  1XMK A;  2ZTG A;  2R7Q A;  3T9G A;  3S16 J;  1DQU A;  1JA0 A;  4X06 A;  5E8G A;  5ILS A;  3KP3 A;  3J80 K;  2A69 F;  1QGY A;  3A0H C;  1K8F A;  2MH9 A;  4AM3 A;  5JHU A;  2XDV A;  3A3B A;  2RAE A;  5C1C A;  1RET A;  3P5J A;  2ID3 A;  3ZQC A;  2Y2Z A;  2GWR A;  1N77 A;  4KT6 A;  1VQ8 B;  1EE6 A;  1D1A A;  2ZZG A;  2JPB A;  3F8M A;  3I4N J;  4TMZ A;  3GQ9 A;  4QSH A;  2DOA A;  4LK1 F;  2VUM J;  1Y1V J;  3PNY A;  4BXU A;  4BE1 A;  2K9N A;  1JUS A;  3ONQ A;  1JKP C;  3FX3 A;  1J75 A;  4RJL A;  1BM9 A;  2CGP A;  2GA1 A;  3R6J A;  1IAW A;  1TWH J;  1TTY A;  2DPD A;  2CBX A;  4RGU A;  3ZXS A;  1LFP A;  5M5W J;  1QGA A;  3GCM A;  1O3Q A;  1PJR A;  2FD5 A;  3N97 A;  1MIJ A;  2Z99 A;  2JA8 J;  2JT1 A;  2XGC A;  5K5O A;  1AHD P;  5A2Q Z;  3B78 A;  1KGS A;  4MTD A;  4OZY A;  1BI0 A;  4E4H A;  4OMY A;  4M0L A;  1NG7 A;  4PAA A;  1I50 J;  3SZE A;  2LR8 A;  3KFW X;  4YEL A;  2L7Z A;  1TLH B;  2R7F A;  4P1W A;  2TCT A;  2LF8 A;  4ETS A;  3HYI A;  2GPJ A;  3MN2 A;  4Y33 A;  1EFT A;  1E3Z A;  2QA4 I;  1IRG A;  5DSZ A;  4C0S A;  3W2V A;  1W36 D;  2F1M A;  1YJW I;  5JLX A;  3CF2 A;  2W48 A;  2ZB9 A;  2HVQ A;  2BM1 A;  3V7S A;  3LWF A;  1FTZ A;  1B9N A;  2E35 A;  4HYE A;  2QMU A;  5IYC J;  1YHQ B;  4CYD A;  4YFX F;  2V7X A;  1EP1 B;  1KU2 A;  2ZBK A;  4ESJ A;  1T38 A;  2CF4 A;  4QV2 A;  3CCU B;  4A69 C;  1XDS A;  3AL0 B;  2FX0 A;  1GJR A;  4BHP A;  5JLV C;  2BW3 B;  1QZE A;  5GPA A;  3PVD A;  5HS8 A;  2XNC A;  3ZZ0 A;  3CCR B;  1KZH A;  4TKO B;  2O7O A;  1E2X A;  4JYK A;  5JLW A;  4LG3 A;  4MTE A;  3R0A A;  1GT0 C;  5IYP A;  1W7P D;  4LBZ A;  1OPC A;  4FE7 A;  3HUG A;  2V7U A;  1CNE A;  2V7W A;  1ZAO A;  4BY1 J;  3KZZ A;  1R1T A;  3SKB A;  2XT2 A;  3EUK L;  4LBV A;  1FP2 A;  1W35 A;  3HSF A;  5F1R A;  1T08 B;  3JSP A;  2KJB A;  4RS8 A;  2EIK H;  2M1B A;  2VL8 A;  1N78 A;  5E79 C;  4JP0 A;  4P6Y A;  3QWL A;  2ZFW A;  3L7W A;  4HF1 A;  3J7A O;  2NST A;  1MH3 A;  1ITY A;  1XDU A;  1YS6 A;  2BHZ A;  4M3D A;  2XRL A;  3FWE A;  4F52 A;  3CCV I;  1ZEL A;  3WTU C;  3ECH A;  3LQR A;  1E3O C;  2YWH A;  3HAG A;  4KT5 C;  1QVU A;  4AC0 A;  2ZZE A;  2DMN A;  3OYG A;  4PC3 A;  2EIN H;  4BE0 A;  3ASS A;  1LFB A;  1JB9 A;  3BZK A;  1K83 J;  5EF6 A;  1GAQ A;  5LEK A;  3K4L A;  4A3F J;  4G5G A;  4IO9 F;  2WV0 A;  3Q6Q A;  1HDP A;  1T33 A;  2XAF A;  5FLX Z;  3G6E I;  5TJJ A;  1K78 B;  4OOX A;  2FSW A;  1ONV A;  1IJF A;  4RDJ A;  2O6W A;  1HQC A;  2CMP A;  3A1Y A;  1OGO X;  1OB0 A;  3QOD A;  3IRR A;  3VMV A;  4YHB A;  1I1S A;  1ZYR F;  3IL2 A;  4EGY A;  3U6K A;  4P25 A;  1HW2 A;  2XRO A;  3GYH X;  2JN9 A;  4Z2Y A;  4FX4 A;  2MD5 A;  2DA1 A;  3BZ6 A;  1LB2 A;  2FRH A;  2CC2 A;  4A2U A;  3AVU A;  1OYY A;  4XL9 A;  3AKZ A;  1KJZ A;  2YX7 A;  2M4G A;  4F7Z A;  3HOU J;  4ZDP A;  2NNN A;  2OZ6 A;  4R1H A;  4ZYE A;  4XIC A;  4R71 A;  1G3W A;  2HXO A;  5K7F A;  3L2Q A;  4D5F A;  3HC7 A;  4B8X A;  1NDH A;  2XSJ C;  5ILU A;  5FA6 A;  3P26 A;  3GQA A;  4NDL A;  3MVP A;  3ML3 A;  5FL7 A;  4P9F A;  3S1Q J;  2VFN A;  2X51 A;  5M3F J;  4NC6 A;  2RV8 A;  2BGC A;  3DQV C;  1UD3 A;  5LEJ A;  1JGG A;  1W87 A;  2JDI A;  1QZY A;  3MWM A;  1XMX A;  3CMA I;  5IYD J;  4EJV A;  1HCR A;  4IF4 A;  1IV8 A;  2V7Q A;  5IOY A;  2VBT A;  1JJ2 B;  2DEU A;  2RQQ A;  1VZ0 A;  3Q5F A;  2GBY A;  1U9N A;  3V42 A;  1G4D A;  2GJK A;  2C4U A;  4WXH A;  2XOK A;  2XB5 A;  1H88 C;  3M1E A;  3FXL A;  1IJW C;  1TW2 A;  2BF4 A;  2DXI A;  1QA3 A;  2OTJ B;  5IYW A;  1FWZ A;  2HI3 A;  3BR0 A;  2E1C A;  1BX1 A;  1O7L A;  3FK6 A;  1U8R A;  2CJJ A;  1IRZ A;  4P5O A;  4UVA A;  4ZJZ A;  3L1P A;  3GTK J;  1QQ1 A;  1LVK A;  4CUG A;  5JHF A;  5GAD J;  4DQK A;  5C4J J;  2CH0 A;  3ABK H;  2Y0M A;  2XSD C;  1ZRC A;  4ZCM A;  2XT4 A;  4EQQ A;  2XTX A;  5ICC A;  2V7T A;  1E79 A;  2M9H A;  4GYG A;  2VON A;  1TYU A;  3ZMZ A;  4I98 B;  4JMQ A;  2ZXJ A;  4M73 A;  2ME6 A;  2VBE A;  3LA2 A;  4K2E A;  1KU3 A;  5D6F A;  2ZBV A;  1TWA J;  5F6F A;  2ID6 A;  2WAQ N;  3KE2 A;  2UXX A;  2VBS A;  1FMV A;  2BYV E;  1ZG5 A;  4TT3 A;  1GXP A;  4YFO A;  2BVN A;  3I58 A;  2KRC A;  2XRN A;  1E3X A;  2NOJ B;  3VO2 A;  1TP4 A;  3BR2 A;  1I3Q J;  1ON1 A;  1PUE E;  3ML6 A;  4L0Z B;  3OKX A;  4LBY A;  3GIR A;  3R0J A;  4BL0 B;  1X2N A;  5EEG A;  4UVB A;  3U1D A;  1VND A;  2ZXW H;  4LFU A;  2E2H J;  2PEC A;  4DYQ A;  2ME0 A;  2D9R A;  2FXA A;  3LAJ A;  5HDK A;  5HLT A;  2F5V A;  2WC2 A;  3SZT A;  1P7J A;  3I0T A;  3KYD B;  4C30 A;  2PJR A;  4GXO A;  2A5W A;  4I01 A;  5GTH C;  3K4N A;  1A36 A;  3I64 A;  2OK7 A;  2HOA A;  1D0Y A;  3H5N A;  4Z4Z A;  3DKX A;  2JMW A;  5DD8 A;  3BTI A;  4FT8 A;  1J59 A;  2JPC A;  4G1V A;  4G6T B;  2ZXI A;  3R61 A;  1BI2 A;  1X0C A;  4G6D A;  2LYC A;  3FF5 A;  1LPQ A;  3FXR A;  2K4B A;  3RKQ A;  2KLO A;  4YZ0 A;  3BZC A;  4HV6 A;  3QPS A;  2XEX A;  4ZGQ B;  3DPT A;  3LA7 A;  4I0A A;  2MD0 A;  3CP2 A;  3EUH A;  4KMF A;  1P4W A;  3HTS B;  4OIO F;  1R5H A;  2EV6 A;  4AIJ A;  1WVR A;  5A88 A;  2HTJ A;  3KP4 A;  2NOG A;  4WF2 A;  1YJ9 I;  3GQ8 A;  3FHN A;  3NE5 B;  3WU1 B;  1WJF A;  2W4S A;  2QBY B;  4Q48 A;  3OS1 A;  1BIA A;  3ZC3 A;  3E5U A;  3M8E A;  2EV5 A;  1UCR A;  1ZRE A;  4IKF A;  4L8J A;  1NHC A;  2K9L A;  2A07 F;  3G2B A;  4CCK A;  3JUR A;  1ZM4 A;  2PLF A;  4ROX A;  1OQY A;  2LVS A;  3IKT A;  4J00 A;  4RDU A;  2R7U A;  4CDG A;  1MMA A;  2VFP A;  2DK5 A;  3DLA A;  4OJ6 A;  1DU0 A;  1Q1V A;  5IT9 Z;  4D9J A;  1WHU A;  3OOU A;  3Q9S A;  1YIT B;  3G4S B;  1HC8 A;  2I5U A;  4OIP F;  5KSW B;  2NS7 A;  1ZHF A;  1J9I A;  4RPB A;  1WMR A;  1Y8R B;  1LFU P;  1J09 A;  2NRA C;  4G7X A;  5M5X J;  3PSF A;  1JE8 A;  3H5R A;  3LSJ A;  1K9M D;  4L9J A;  3HPG A;  3MMY B;  2EZL A;  1T56 A;  4BHB A;  3FM5 A;  3EYY A;  2ZSH B;  4JBA A;  3GLX A;  3WG7 H;  1B72 B;  1FTT A;  3Q6R A;  3NRV A;  1UJ8 A;  5A2Q K;  4PSW A;  2WB1 A;  1D8J A;  2O9L A;  4JOM A;  1FBQ A;  4BNC A;  1GVJ A;  2PE3 A;  1P2F A;  3A35 A;  3BC9 A;  2LMD A;  1N07 A;  1HLV A;  4II3 A;  1YYV A;  3OYL A;  4AVP A;  2X8K A;  1ZUN B;  2HYF A;  4XLE A;  5L3D A;  3DU6 A;  5LHH A;  1WKM A;  1SMT A;  2CW0 F;  1N08 A;  4QVA A;  2KRH A;  1KZL A;  2LKX A;  4YEI A;  2DYI A;  1WGX A;  2LSO A;  4D0P A;  1NTC A;  2LG4 A;  4LIU A;  2V31 A;  3BCD A;  3FXU A;  1SD4 A;  2OQR A;  2P0W A;  3DEE A;  3I55 I;  4F7D A;  1WQ2 A;  3W2H A;  2BV3 A;  5D4R A;  2OK8 A;  3S8P A;  1SFK A;  4W8R A;  3K0L A;  1SAX A;  3OL3 A;  2V1D A;  5CQG A;  5DM6 F;  1MSF C;  2E1R A;  5DTD A;  1X3U A;  2DYR H;  4OU0 A;  5IOZ A;  1WTH D;  2I8D A;  3ELK A;  2X1D A;  5ED4 A;  3CC2 I;  4HST A;  3BQJ A;  2ZKZ A;  3X2Q H;  1YI2 B;  4M9X A;  5H6Q A;  4M1K A;  3V7A A;  2R5Y B;  1BHE A;  2KZV A;  2VPR A;  1LLZ A;  2M5W A;  2MA3 A;  3J81 Z;  2CQN A;  3S17 J;  2WV1 A;  3OYN A;  2D2W A;  3BG3 A;  4HAM A;  4MYT A;  4U49 A;  2IQ7 A;  2F43 A;  2PMZ A;  5BPI A;  1IG7 A;  4UUS B;  3GQB A;  3K4C A;  3D1N I;  2D45 A;  4WZL A;  1V5F A;  3S2W A;  3CCL B;  1DGW Y;  1J0R A;  3IV5 A;  4M3B A;  1VQP I;  2EB7 A;  1F5T A;  2DY1 A;  2HQ5 A;  2WJY A;  2NS8 A;  3ZP5 A;  3RZO J;  1TTT A;  2L54 A;  2A61 A;  1B8I A;  3PIP F;  2B7C A;  1VQM B;  3HOX J;  3I53 A;  3KX2 A;  2YWE A;  3CXC B;  2HDC A;  3ZQI A;  2B63 J;  2IS4 A;  2Y48 A;  2M7A A;  3IRQ A;  2O61 A;  4Y13 A;  3HRM A;  2FQ4 A;  3TKY A;  4FCY A;  3LAP A;  1BIB A;  4PDK A;  1FOK A;  4N3G A;  4W8T A;  5E1X A;  5GAH J;  1SVO A;  4ZV4 A;  1VI0 A;  4HLY A;  4B3X A;  1T6Y A;  3CZ6 A;  1WJA A;  1RKW A;  4YIF A;  4CCN A;  4HF0 A;  1SAU A;  1KRH A;  4RD4 A;  2IA2 A;  1BA5 A;  4Z4U A;  5K7Z A;  2CU7 A;  1BR4 A;  1DU6 A;  4EGZ A;  2BXY A;  2DYS H;  2ISZ A;  3O6B B;  2XNJ A;  2F3L A;  1K7A A;  4NB5 A;  3IH2 A;  1YW9 A;  2IVM A;  2HFH A;  4A6E A;  2KP6 A;  5B1A H;  1VQK I;  4HOB A;  2LNB A;  2QQ8 A;  4UVC A;  2GXG A;  1EH8 A;  4XMY A;  5FKN A;  4XLP F;  1FMW A;  5IP7 J;  3J80 Z;  2JA5 J;  4WQM A;  4YAW A;  3F6V A;  2IBD A;  1IO2 A;  2Y9Y A;  3BY6 A;  1G3T A;  4MHG A;  5LGU A;  2IOU G;  1XGO A;  3I9V 2;  4E7I A;  1BPL A;  1POG A;  3ZQQ A;  3ZPN A;  2ZME C;  2JA6 J;  1WPK A;  3VB2 A;  3EQL F;  5CVV A;  3KP7 A;  1I8D A;  1IA5 A;  3JAM K;  4ENJ A;  4XM3 A;  4DGW B;  1T98 A;  4RD1 A;  4IRG A;  2W25 A;  4HBL A;  3T56 B;  2C78 A;  4I76 A;  4O3M A;  5FRN A;  4NQW B;  5HOD A;  1IJE A;  1N75 A;  4B3G A;  1S3J A;  2ACJ A;  1UD5 A;  3VOE A;  4ZZD A;  1RU4 A;  5IP9 J;  4BDY A;  3AGP A;  4FAS D;  4XOR A;  5H2F C;  4PUS A;  3VYU B;  1FT9 A;  4G9Y A;  4P9S A;  2WR8 A;  3G05 A;  3CJQ B;  1BL0 A;  3OZW A;  3GME A;  4P22 A;  5TR9 A;  1W1W E;  3B73 A;  2X1C A;  2O0W A;  1S6L A;  3BG7 A;  4PJ0 C;  3G71 B;  4G7Z F;  4A3G J;  1VQ5 I;  1SVM A;  2K9Q A;  1VQ6 I;  4YAL A;  2C6Y A;  3RIQ A;  4PK4 A;  2RC5 A;  3MKW B;  4JRA C;  1OR7 C;  3SQV A;  5D5V B;  2M4K A;  1EH7 A;  4TMW A;  3CF5 F;  1QO0 D;  3VSK A;  2BVM A;  1UD8 A;  1GR1 A;  3OR2 C;  4LLG F;  5HDG A;  1O8M A;  1DDI A;  1J7K A;  3ZCO A;  2Q2E B;  2HYJ A;  2O0Y A;  1OGM X;  4XRM A;  4Z6Y A;  3L2U A;  2H1K A;  1F9N A;  2ZJP F;  2B9S A;  2X0K A;  3KYL A;  2G7H A;  1QH0 A;  3CLQ A;  4PFP A;  1MBJ A;  4OIR F;  3OYC A;  4X7E A;  4PC7 A;  3A03 A;  2WTE A;  4MLO A;  1FPQ A;  3S93 A;  1TQP A;  2HZD A;  1DPR A;  3HG9 A;  2FQ3 A;  4HX4 A;  1Q1H A;  5GPC A;  2NSP A;  1USS A;  3TOB A;  3RPU D;  3U6B A;  2LFB A;  5LRR A;  1OB2 A;  1OFE A;  1MKM A;  4LJZ F;  3IP4 B;  2VI6 A;  1L1I A;  2DTZ A;  4HNV A;  4ZCI A;  3K69 A;  3OZU A;  4FHT A;  4KA4 A;  3GTP J;  3FKJ A;  2PMD A;  4I7H A;  3WNB A;  3AG3 H;  1TNS A;  5CVU A;  5ILV A;  2R7V A;  4ZYA A;  3CCY A;  4E6K G;  1LJ9 A;  4X0G A;  3WTW C;  1WI9 A;  3QRF F;  4UZE A;  3HM5 A;  5J35 A;  4Z1M A;  1Q82 D;  2C4T A;  2J7K A;  2X3H A;  2FBI A;  1D3Y A;  4HZF A;  3S3M A;  3FHZ A;  4C9Y A;  3BH7 B;  4RGX A;  3FKI J;  1N06 A;  1U78 A;  1XSD A;  5CVR A;  4IW3 B;  4PCQ A;  2I1L A;  2DMU A;  3CUQ A;  3ZN1 A;  2H8W A;  4BXX J;  4YDT A;  3SYT A;  1BC7 C;  1SVL A;  4KKS A;  2QZ8 A;  3OYA A;  3A02 A;  1B4A A;  3DFG A;  5F4M A;  2VQL A;  1COW A;  4Y15 A;  2D5V A;  1HA8 A;  4O5V A;  5FB2 A;  3N05 A;  5IYB J;  4M4S A;  1RIO H;  4CCO A;  4JX5 A;  5J47 A;  1H42 A;  2PYH A;  4PJM A;  4HDV A;  4ZDL A;  3K2A A;  4EV0 A;  3JRG A;  1R23 A;  1U5T C;  1W7P A;  2B5O A;  5J1U A;  4E7L A;  1R4N B;  1Y8Q B;  1A6Q A;  2H27 A;  4GFB A;  1FIP A;  2IAI A;  5B1B H;  4AC9 A;  4PGH A;  3I59 B;  1FYM A;  3L2W A;  2QEX B;  4RLQ A;  3QAH A;  3I56 B;  2EJR A;  2NVU B;  3CPW B;  4BYY A;  2HMA A;  1RI7 A;  2Z5U A;  2HLD A;  3ASR A;  2COM A;  2LY2 A;  1TC3 C;  4ZYH A;  3CLO A;  4LOC A;  3TO7 A;  4BEH B;  1BOB A;  4TSF A;  2DDB A;  3ASN H;  1WJC A;  2OC6 A;  3CDI A;  5LGN A;  1RMG A;  3TO9 A;  2RQP A;  1WI3 A;  3BG5 A;  1RR8 C;  1STZ A;  3CJT B;  4PAB A;  1VQL I;  4LG0 B;  2YUS A;  2E1N A;  2ELH A;  2H94 A;  1BX0 A;  2IPQ X;  3OYH A;  1W0K A;  3NAW A;  3HTU A;  4HPQ A;  4UHT A;  1B2R A;  5JMC B;  1I6X A;  3E3V A;  2ZL6 A;  3MZH A;  2HKO A;  1NJI D;  3U2Q A;  2Z1D A;  2DT5 A;  5CPR B;  4RDL A;  4LIT A;  1DP7 P;  2QSG X;  3GRH A;  2DA4 A;  3BCA A;  5JI6 A;  1VQ4 B;  3J7Z I;  3JQP A;  5FIU A;  1TT5 B;  4KN7 X;  1HVX A;  3BR5 A;  3RIR A;  2A6T A;  1EWY A;  2EPF A;  2XF5 A;  4QPQ A;  4LLN A;  4P3I A;  1E3H A;  3IAM 2;  2VBM A;  5BSY A;  3CO6 C;  4PZJ A;  3H3Z A;  2UUZ A;  1IF1 A;  3CC4 I;  2QTL A;  4ACA A;  4X1E A;  1N05 A;  4M6V A;  3DU5 A;  3FMR A;  2ZIT A;  3P9K A;  2JJ7 A;  3K1M A;  4HWV A;  1F60 A;  2GXB A;  3OL4 A;  4L0Y B;  2GZW A;  3BG9 A;  3GWZ A;  3OIP A;  1VJS A;  5GP9 A;  2DFH A;  4EM2 A;  1O8G A;  3V76 A;  4G8X A;  3KLO A;  4Q7J B;  3ZQH A;  3OS0 A;  4BQO A;  2JQ7 A;  4P6V F;  1X1A A;  2COB A;  2AQE A;  1K5C A;  3MZ8 A;  5KCM A;  2Z6B D;  1EV7 A;  2FMY A;  3J81 K;  3E5Q A;  5LHG A;  2OTL B;  2VBU A;  1RNL A;  5H20 A;  2ZTN A;  2LDU A;  1O8K A;  2YUH A;  1YOV B;  5AON A;  2YR2 A;  4M6Y A;  1SMY F;  4A3L J;  2JSC A;  3TBI A;  1IZ1 A;  1JUP A;  3BR3 A;  4FWT A;  2DU9 A;  2VJI A;  3VNU A;  2P3M A;  2R93 J;  2W85 A;  1Y1W J;  1WJ5 A;  4OOI A;  1DG1 G;  2OBT A;  1UMK A;  1KU7 A;  1OLT A;  2QLZ A;  1CGP A;  3AK5 A;  2OJE D;  5A89 A;  3HIF A;  3ESW B;  4U87 A;  4IHX A;  2C5B A;  3DDY A;  3I54 A;  3RQ4 A;  2RVC A;  2F6C A;  3W3C A;  2ZBU A;  1T95 A;  3HOZ J;  2YWF A;  4XKV A;  2ZL7 A;  1LEA A;  3C2B A;  3L00 A;  2KVO A;  1W5S A;  2ADU A;  2VKD A;  4BJT A;  4DYR A;  5TRD A;  4EJW A;  3HOS A;  3OV8 A;  1G3Y A;  1BLI A;  2KL4 A;  3MKZ A;  3GF2 A;  1DAR A;  4CO8 A;  4OOV A;  1H9G A;  3FXJ A;  4A0X A;  4YZX A;  3SUC A;  3K7A J;  2NVT J;  2FNP A;  5HNF A;  4DYC A;  3BJA A;  3QFT A;  1A35 A;  4G7H F;  1VQN I;  3M7G A;  5F08 A;  3CCJ I;  4WWC A;  3GUD A;  2LZJ A;  4UNO A;  1P4M A;  3K1P A;  5BNG A;  1DBG A;  4M72 A;  4I84 A;  1JA1 A;  4EEF G;  2QYO A;  5HXB A;  1BJK A;  5IT3 A;  4C2L A;  2NNY A;  1R58 A;  5DYM A;  1ERD A;  2ZNZ A;  1D8K A;  3AVX A;  4I0B A;  2HQA A;  2DN0 A;  3CP8 A;  2DBB A;  1JNY A;  2X9D A;  1H8A C;  1W4M A;  4X6A J;  1UAA A;  2ZME B;  3DP7 A;  2DOE A;  1F20 A;  5L3E A;  2P6T A;  3DTK A;  2DCU A;  1UD6 A;  4DJA A;  4X0C A;  3C2G A;  1NK3 P;  3GTL J;  1L3L A;  1QPM A;  2HQR A;  4QWQ A;  1JT0 A;  2QA4 B;  1YJW B;  1WJE A;  4P2N A;  2BGI A;  2VFQ A;  4XR6 A;  2E1M C;  2D74 A;  4M9Z A;  2CW5 A;  1VQ9 I;  3IAS 2;  4J19 A;  1OHH A;  4XBF A;  2GM4 A;  2GOM A;  2ZZQ A;  2R6H A;  4YAO A;  1W0T A;  2X0L A;  4IQJ A;  2ESH A;  4QUZ A;  2V9P A;  1N8R D;  2R0Q C;  3N6Z A;  1FOX A;  2X85 A;  3VO1 A;  3V8K A;  2DK8 A;  2LOO A;  3TH0 A;  4OAZ A;  1LDD A;  1I1G A;  5EDN A;  4X07 A;  2P5K A;  1U9O A;  2H8R A;  1RRJ A;  1O8E A;  5DUK A;  2EA2 A;  1MDM B;  3GTO J;  3O8H A;  5E3O A;  2L9S A;  3GW2 A;  2DDA A;  4PGG A;  1O8H A;  5L3C A;  4CGZ A;  3LFU A;  2IGM A;  2HOE A;  4L5I A;  3SZP A;  1SC7 A;  1VQ8 I;  1AOY A;  5F0H A;  3OZV A;  2BPO A;  4HF2 A;  4G1B A;  3L09 A;  1M90 D;  2F4I A;  1YFH A;  4XRF A;  1O3R A;  4YC5 A;  2XND A;  1D0X A;  4G6I A;  4A3J J;  1TWG J;  2KIS A;  4AWX B;  3FIS A;  3AAF A;  3LMM A;  3JW4 A;  3CCV B;  3PFI A;  2EK5 A;  3ZN0 A;  3SDB A;  4UB6 C;  1FRQ A;  3WXM A;  4M6X A;  1ZG1 A;  1TQM A;  3CTA A;  4OAY A;  5J8C A;  4YG2 F;  2Z33 A;  5BPD A;  1I6H J;  1IUY A;  1VF7 A;  2Q6O A;  2NVQ J;  4YAF A;  2PLY A;  3G6E B;  2MAB A;  3EQO A;  1WOO A;  3I3L A;  2X6W A;  1YQA A;  4OP7 A;  1AMO A;  3K4K A;  3VOD A;  4HEA 2;  1HSJ A;  2DOD A;  4YRV A;  1KK3 A;  2IS6 A;  2VJ4 A;  1KMH A;  3CUO A;  3PO2 J;  1IN7 A;  1JTY A;  2X6Y A;  1R1V A;  2DA7 A;  4J01 A;  3FM3 A;  1EP3 B;  1HW5 A;  2M7B A;  1TT0 A;  5FKL A;  5HLH A;  1N0U A;  1JHH A;  4M53 A;  1OYW A;  4RM3 A;  1BBY A;  3GBG A;  1Z1D A;  4LGW A;  3LMW A;  3SJZ A;  5H6R A;  1EKE A;  1ZGA A;  4HLX A;  1AIR A;  2WPD A;  2K3F A;  1V55 H;  2QQ9 A;  4EJO A;  2QGG A;  1OCP A;  4E7S A;  2R7S A;  3MCZ A;  4N0B A;  1T5E A;  4BBR J;  2VNH A;  3BY1 A;  3C2H A;  1YJN I;  1VHO A;  4V02 C;  1U5T B;  3N4M A;  1JI8 A;  2DT7 B;  1XN7 A;  2G9W A;  4RB3 C;  3GZN B;  1FYL A;  3CMA B;  1QRB A;  4IX7 A;  3H1C A;  1MNM C;  1NBM A;  1T6Z A;  3HBL A;  2FF4 A;  2O03 A;  3HKZ A;  1QNT A;  4KIS A;  4G7O F;  3WHC A;  2VN2 A;  4XOP A;  5F1J A;  1ZM2 A;  2FX3 A;  3P7N A;  1RR7 A;  4WZT A;  3DEU A;  5LLQ A;  3ZQF A;  2E2I J;  4Y9R A;  5TY0 A;  2Z9O A;  1Z21 A;  5FO5 A;  3IWZ A;  1FEX A;  3BCF A;  3WE2 A;  1KC8 D;  1QGZ A;  2O17 A;  3B6C A;  3F8N A;  4MYU A;  5TV2 A;  3I4M J;  1APL C;  1MBK A;  1S0U A;  2L2O A;  2QX3 A;  1GUU A;  3JAM Z;  1FND A;  3ULQ B;  1QUF A;  2L7K A;  1X1B A;  1KK0 A;  1UZC A;  2C77 A;  1BR2 A;  3NEU A;  4DBQ A;  2QUF A;  1K6Y A;  1PUF B;  5HVQ C;  3EPZ A;  1OJL A;  3BG6 A;  1V5G A;  3CCS I;  2ISY A;  5E18 F;  4BAC A;  2YSR A;  1VLO A;  3EUH C;  3AVW A;  1IXC A;  2NPF A;  3PUN A;  1HF2 A;  3RY8 A;  2WY7 Q;  3PIO F;  3VSV A;  5L3G A;  2LLK A;  1LDJ A;  2XHK A;  2YU9 J;  3W2E A;  3GQ7 A;  5JFR A;  1KTV A;  3M9A A;  4WXC A;  2R5Y A;  2AQF A;  2VKH A;  3GVJ A;  3KIO A;  4EH1 A;  4HSR A;  3PJR A;  3ZPL A;  2WJV A;  4P1V A;  4EJT A;  2PQ8 A;  4AYB N;  4WX9 A;  3H36 A;  3F22 A;  1AU7 A;  2ZSI B;  3P9C A;  1TWC J;  4TMV A;  2C2W A;  4BH9 A;  2HVS A;  4PFO A;  1YW7 A;  2OAZ A;  1UG0 A;  3JR9 A;  2P7C B;  1JUM A;  1GAW A;  2L7F P;  3NQO A;  5BQT A;  4CCJ A;  3A2K A;  3ZMV A;  3BTL A;  5D5W B;  5FLM J;  4QVJ A;  3ZGK A;  3ASQ A;  5ERI A;  4MNU A;  1KU9 A;  3A01 B;  4OPO A;  3PFY A;  3Q39 A;  2R7Z J;  5K5Q A;  2DFF A;  3GVL A;  3WBK A;  3ZR8 X;  3QSY A;  2BGJ A;  3GTG J;  4Q5S F;  5LHI A;  2VKE A;  4XRS G;  1XG1 A;  2CQ7 A;  3BTC A;  3LOC A;  1OB5 A;  3H0D A;  1IC8 A;  2FBK A;  4WWV A;  4NBS A;  3WU0 A;  1Z9C A;  3SYJ A;  1Z77 A;  1D0Z A;  4CYC A;  4P96 A;  1YJ9 B;  2DQL A;  3I4P A;  3M3Y J;  2KIQ A;  5HZA A;  2KQR A;  1EA0 A;  5TIS C;  1Q86 D;  3ZQG A;  3EUA A;  5DS9 A;  1V5V A;  4LLL A;  5FKO A;  4E0F A;  3S32 A;  2E60 A;  1R22 A;  2IJL A;  2DI3 A;  1FY7 A;  4N4O B;  3F8B A;  1MGT A;  1MMG A;  3OYK A;  1ELO A;  3W2W A;  2HKX A;  4I99 C;  4XOT A;  3WGG A;  1SM4 A;  3FJO A;  4AVZ A;  2PN6 A;  4D5C A;  2HS5 A;  3VWB A;  3JRE A;  2EQR A;  2V9V A;  2XGX A;  2DA3 A;  2QWW A;  1I39 A;  2W84 A;  3KEY A;  4RGR A;  4UXN A;  4CIC A;  3K4M A;  2CUE A;  2R5Z A;  1Z67 A;  3G1O A;  2KZG A;  3RPU A;  3DXJ F;  1VQO I;  4OIQ F;  2F5C A;  3CD6 I;  2HYG D;  2XF7 A;  4OPS A;  3A8J A;  2VFM A;  2VXZ A;  5ICE A;  4XKB A;  4V2F A;  4ENN A;  1LQ1 A;  3U21 A;  3HUG B;  2V4J C;  3FMQ A;  3E20 A;  1MJA A;  2BM0 A;  3B8H A;  1P7I A;  2ZCW A;  2MGQ A;  3NAU A;  3C7J A;  4HNT A;  2QDX A;  2PMH A;  1I3A A;  2LRD A;  2W7N A;  1E62 A;  4ZGN B;  4IL6 C;  3AVY A;  3KRG A;  3VNV A;  1G6N A;  2JJ1 A;  3U1K A;  1XGN A;  1Y6I A;  1IHM A;  1O4X A;  2TRT A;  1B6A A;  1LDK B;  3B6A A;  1W34 A;  4C3I J;  2YS9 A;  3BNW A;  2GIV A;  1VHE A;  2W7Z A;  4FE4 A;  2EFN A;  4H4K C;  4KH3 A;  2CV1 A;  4R8H A;  2KPM A;  1GQ8 A;  1KQ0 A;  1X4O A;  2KRF A;  1BQE A;  1Q9S A;  2L0K A;  3BTJ A;  2E1M B;  3ZBU A;  1GXQ A;  2PEX A;  2IEK A;  5L46 A;  3H09 A;  2IA1 A;  3JSO A;  2HTS A;  1LE8 A;  3I55 B;  2O04 A;  4B4D A;  2V7V A;  3BWG A;  2KJC A;  5KAF C;  3DBL B;  5CYV A;  2PYG A;  3TMO A;  3SXY A;  2VLA A;  2J5P A;  3SFZ A;  2CO5 A;  3JRA A;  1KON A;  3W6K B;  4CZC A;  3E6D A;  3GFM A;  4U4B A;  2Z3Y A;  5DNS A;  5CVI A;  1WWX A;  1G7S A;  4ASN A;  2BY3 A;  4HX7 A;  5KVR A;  4X7F A;  1R36 A;  1XX5 A;  2D1V A;  4JK1 X;  1EFR A;  3R6K A;  2XAJ A;  1PJ7 A;  2XV4 S;  1AKH A;  3CC2 B;  1UHM A;  3ZPP A;  1XGS A;  2FA5 A;  4Z4W A;  2UXN A;  3RCO A;  1WSR A;  3LQ6 A;  4ZCL A;  2QN6 A;  1YW8 A;  1BC8 C;  1OKR A;  3F0C A;  1K73 D;  3QP5 A;  2LY1 A;  3GO5 A;  2VKV A;  3CCE I;  4RM0 A;  3W2F A;  2G7U A;  4BHC A;  2H1L A;  2OUM A;  1L0O C;  1S7A A;  4RA2 A;  4BS9 A;  1Z3Y A;  4XLC A;  3D26 A;  1V0F A;  2W82 A; 
#chains in the Genus database with same CATH homology
 3VYS B;  2R4G A;  4Z1M A;  1S9H A;  4B3F X;  2X3H A;  4BJ6 C;  3S3M A;  2XC7 A;  4E7K A;  1E1Q A;  2UVF A;  4C9Y A;  1KCC A;  2ZTG A;  3WQZ A;  4Z06 A;  2CUZ A;  2HNH A;  2R7Q A;  1DQU A;  3B8Y A;  3T9G A;  3HXL A;  4GRI A;  2V26 A;  3OMY A;  3OW7 A;  1OOC A;  2R7W A;  2BVL A;  2ZZF A;  2CW8 A;  1LKX A;  2XDV A;  3SYT A;  3A3B A;  5C1C A;  4KKS A;  1MNE A;  4ZC3 A;  2LH9 A;  2VIX A;  3OYA A;  1SKY B;  1CZF A;  3K70 C;  4KT6 A;  3VDX A;  1N77 A;  2NZM A;  2ODL A;  1EE6 A;  3B4N A;  1IB4 A;  1D1A A;  2ZZG A;  2VQL A;  1COW A;  4RMN A;  3GQ9 A;  2DOA A;  1HA8 A;  3N05 A;  3PNY A;  4BE1 A;  4CCO A;  3VST A;  1H8H A;  3ONQ A;  2PYH A;  4PJM A;  4ZDL A;  1E0E A;  1WJD A;  3FBN B;  4W8S A;  4E7L A;  3S3O A;  2JIZ A;  4DNR B;  3ZXS A;  1LFP A;  1PJR A;  2BOL A;  1PXZ A;  1WFX A;  3K6G A;  2DCE A;  3IUO A;  4OZY A;  3CJR B;  2JVH A;  3L2W A;  2V6E A;  4E4H A;  4RLQ A;  1NG7 A;  4YEL A;  4W8Q A;  3LSM A;  2HLD A;  3H35 A;  4P1W A;  2LY2 A;  4KIT B;  3D5R C;  4BEH A;  2VQC A;  4BEH B;  1BOB A;  3DWL E;  4Y33 A;  3SEQ A;  1WJC A;  2OC6 A;  5FRO A;  1E3Z A;  4TSF A;  3LSK A;  1RMG A;  2NTQ A;  3W2V A;  5CQE A;  1W36 D;  2E1B A;  2F1M A;  3DTI A;  3CF2 A;  4ANJ A;  4OJL A;  3CES A;  2HVQ A;  4NUB A;  4QPO A;  2INU A;  1DP3 A;  3S3N A;  3VSL A;  3OYH A;  3A4C A;  2LBF A;  1E1R A;  4HPQ A;  1W0K A;  4DIQ A;  4B43 A;  2WZP P;  1PYV A;  3AL0 B;  2BW3 B;  2Z1D A;  5CPR B;  4LIT A;  1HZE A;  3GRH A;  3L2R A;  3FY3 A;  4TKO B;  3BCA A;  2VPL A;  4DK1 A;  2X1E A;  1O8F A;  4LG3 A;  1HVX A;  2A6T A;  4B48 A;  3OYI A;  2XF5 A;  4QPQ A;  4F55 A;  4R79 A;  1X1C A;  3DTE A;  1W36 C;  3IAM 2;  2VBM A;  3K4B A;  2UUZ A;  2XZL A;  3EUK L;  3M1C A;  1E43 A;  1G59 A;  3DU5 A;  5FRM A;  3F9K A;  3HL2 A;  1N78 A;  2VL8 A;  4JQF A;  4ZDO A;  3OPO A;  1RWR A;  1JTA A;  1WPC A;  4HWV A;  2MYS A;  3VMW A;  1DGR M;  3OL4 A;  4UZU A;  3OIP A;  2LRE A;  1VJS A;  2NST A;  1O8G A;  3CMM A;  3QYF A;  4C2T A;  4F52 A;  1ZEL A;  2MFZ A;  3OS0 A;  4BQO A;  3HAG A;  1X1A A;  2ZZE A;  1NG6 A;  2AQE A;  3OYG A;  4PSX A;  1K5C A;  3AFH A;  5KCM A;  3E1S A;  3QYE A;  4BE0 A;  2Z6B D;  3OOC A;  1O8K A;  2ZTN A;  2X53 S;  3M8J A;  3K4L A;  2NTB A;  1G8X A;  2E5N A;  3TBI A;  1V5E A;  2VJI A;  1QCX A;  2IXS A;  1WJ5 A;  2CMP A;  3A1Y A;  5HOO A;  1OB0 A;  3QOD A;  5KHD A;  2R7X A;  1OGO X;  4BXF A;  2ZFU A;  3VMV A;  1TZL A;  1OLT A;  4DBR A;  2HPI A;  2UVE A;  2DIE A;  3DKY A;  3FDY A;  3J7A Y;  2VAS A;  4OZZ A;  4U87 A;  4RM2 A;  3DDY A;  3RQ4 A;  4XL9 A;  2F6C A;  3W3C A;  3SZG A;  2K9M A;  1T95 A;  3AKZ A;  2CW7 A;  2M4G A;  4PMH A;  1YE9 A;  4XKV A;  3MKY B;  4N4N B;  2Z2S B;  4ZDP A;  2W1O A;  2KVO A;  2VKD A;  4XNF A;  4BJT A;  3HOS A;  3L2Q A;  1X4P A;  3HC7 A;  1BLI A;  2KL4 A;  2M5S A;  3MKZ A;  2XSJ C;  5DN6 A;  4BU2 A;  3GQA A;  4YZX A;  2CS3 A;  4XKW A;  5FL7 A;  3SUC A;  2X51 A;  1PLU A;  1D1B A;  1VBL A;  5HNF A;  4YEJ A;  2KDO A;  1UD3 A;  2HVR A;  2QXZ A;  3DQV C;  1GLN A;  2JDI A;  2LC2 A;  3OIQ A;  4BDZ A;  2VQG A;  4E7Z A;  2LZJ A;  1DBG A;  4I84 A;  2V7Q A;  4ITV A;  4C2L A;  2RQQ A;  1VZ0 A;  4XQF A;  3OEE A;  1ERD A;  2RRE A;  4IQ4 A;  3LSI A;  3V42 A;  4AU7 A;  2HQA A;  2GJK A;  2WSS A;  3CP8 A;  2XOK A;  5IK2 A;  4C2U A;  1O8I A;  1MMN A;  2DXI A;  3FPP A;  4OJO A;  2M0M A;  4P5O A;  1UAA A;  4ZJZ A;  2VB6 A;  2HDW A;  2R9V A;  4F3Q A;  3DTK A;  1LVK A;  4CUG A;  5JHF A;  1UD6 A;  4DJA A;  2GOX B;  3C2G A;  2IGN A;  1X1D A;  2BSP A;  2CH0 A;  2R7R A;  4OJP A;  2D3L A;  3ZSC A;  2QE7 A;  3H94 A;  3T53 B;  2KMU A;  4NNJ A;  4XKC A;  1E79 A;  1WJE A;  4XON A;  4XR6 A;  3OAA A;  1Z7L A;  2E1M C;  2M3A A;  3TL4 X;  4JMQ A;  2UV1 A;  1YX3 A;  2VBE A;  3IAS 2;  1OHH A;  2DJI A;  2JJ2 A;  2GOM A;  2ZZQ A;  2WAF A;  4IQJ A;  1OFL A;  1FMV A;  4E7J A;  3OWT A;  4TT3 A;  3H5A A;  2JA2 A;  2KRC A;  2X85 A;  3A3G A;  3QYB A;  1E3X A;  4OJ5 A;  2LOO A;  4OAZ A;  2NOJ B;  2V7F A;  1O8E A;  3OE7 A;  1MW7 A;  4KKU A;  5CKT A;  1QJV A;  4BL0 B;  2L9S A;  1O8H A;  2PEC A;  3K4J A;  5AMV A;  3LFU A;  2IGM A;  3PNT A;  4BGD A;  1NRK A;  3OYF A;  1UD2 A;  4FXU A;  3LSG A;  1Z3X A;  2BW3 A;  2F4I A;  5HLT A;  2F5V A;  1WJB A;  2W6I A;  2XND A;  4GQN A;  1IRX A;  4C30 A;  3VR6 A;  2O1D A;  1D0X A;  2PJR A;  2JSP A;  4G6I A;  2A5W A;  2PJR B;  1BMF A;  3K4N A;  1UD4 A;  3LMM A;  1D0Y A;  3PUB A;  3H5N A;  3DKX A;  3ZRG A;  3OS2 A;  3OYE A;  3SDB A;  4B47 A;  3OYD A;  4KJZ A;  2CFO A;  4G6T B;  2ZXI A;  2GK6 A;  2VBK A;  1X0C A;  2QY1 A;  2LYC A;  2WAQ A;  4NC7 A;  4CCL A;  4OAY A;  4G7W A;  3QOE A;  4YXW A;  2KLO A;  1WP6 A;  4YZ0 A;  1VF7 A;  3DPT A;  2MD0 A;  2MAB A;  3CP2 A;  3EQO A;  3D5S C;  3I3L A;  2X6W A;  4PJN A;  3K4K A;  4HEA 2;  3GQ8 A;  3FHN A;  3NE5 B;  4YRV A;  2V1N A;  3GVK A;  3WWG A;  2IS6 A;  1WJF A;  2VJ4 A;  2W4S A;  3PSI A;  3OS1 A;  1KMH A;  3PNV A;  2KHM A;  3LL7 A;  4F91 B;  4IKF A;  2X6Y A;  4L8J A;  1NHC A;  2K9L A;  1EA3 A;  4J01 A;  3G2B A;  4CCK A;  3JUR A;  3VYR B;  3UW0 A;  4J00 A;  2R7U A;  1MMA A;  2M7B A;  3DLA A;  1TT0 A;  2GK7 A;  4OJ6 A;  4PJJ A;  4RM3 A;  4D9J A;  3ZIA A;  4XN0 A;  3OOU A;  2ZXH A;  3GBG A;  2CV2 A;  3LMW A;  5HNH A;  1AIR A;  3RSN A;  2WPD A;  1WMR A;  3D5L A;  1J09 A;  1OFM A;  4G7X A;  4E7S A;  2R7S A;  3PSF A;  4FET A;  4BQN A;  3H5R A;  1T5E A;  2NTP A;  2JUG A;  3C2H A;  3HPG A;  3MMY B;  4NK8 A;  4E7H A;  2ZSH B;  1O8L A;  1JI8 A;  2DT7 B;  3MD2 A;  4MXN A;  1D1C A;  2IGO A;  4PSW A;  5LFA A;  1MMD A;  2WB1 A;  4IX7 A;  1NBM A;  3PL8 A;  4JOM A;  2R7O A;  3A35 A;  3BC9 A;  3HKZ A;  4KIS A;  1H8E A;  3OYM A;  4XOP A;  4II3 A;  3OYL A;  2UWM A;  2RNG A;  3AL0 C;  2X8K A;  4II2 A;  3OEH A;  4XLE A;  3SEZ A;  3DU6 A;  1Z21 A;  3BCF A;  2XF6 A;  1QU3 A;  3EQN A;  1QHG A;  2KRH A;  4ZTF A;  1KZL A;  2O17 A;  4Z03 A;  3BCD A;  2LG4 A;  4LIU A;  2V31 A;  3FKS A;  2V9K A;  2L2O A;  4XLA A;  3UR3 C;  2QX3 A;  5CDF A;  2P0W A;  4KKT A;  1I18 A;  3DEE A;  4HRI A;  2NT6 A;  2L7K A;  1X1B A;  3K70 D;  4DNT B;  4BUP A;  1BR2 A;  2WAD A;  4BQQ A;  4EAT A;  4DBQ A;  1K6Y A;  1SFK A;  3S8P A;  3EPZ A;  2JVG A;  2HU9 A;  2QKM B;  3BG6 A;  1V5G A;  5HVQ C;  4MR0 A;  4W8R A;  3OL3 A;  5CQG A;  4BAC A;  4ASU A;  3RTR A;  3EUH C;  4CSW A;  3L2V A;  1VLY A;  1O8D A;  2CK3 A;  1WTH D;  2WY7 Q;  2X6X A;  2I8D A;  3VSV A;  2DT6 A;  3OYJ A;  2X1D A;  1KCD A;  2R7T A;  2K5C A;  4HST A;  3GQ7 A;  1O8J A;  4CCM A;  2VQH A;  2AQF A;  2O5R A;  2VKH A;  4B44 A;  2Z16 A;  4XLF A;  3GVJ A;  4HSR A;  1BHE A;  2KZV A;  3PJR A;  2WJV A;  4NK6 A;  2ELJ A;  1YX5 A;  4IZZ A;  2HPM A;  3OYN A;  2ZSI B;  4DK0 A;  4U49 A;  2IQ7 A;  2F43 A;  1Y56 A;  2PMZ A;  4YZQ A;  3GQB A;  1U0J A;  2IS2 A;  2HVS A;  4PFO A;  3K4C A;  1UG0 A;  1V5F A;  4CA0 A;  1DGW Y;  2INV A;  1IDK A;  4OWR B;  4CCJ A;  3A2K A;  2WJY A;  2XAU A;  2GJR A;  5C1E A;  3ZGK A;  2GJP A;  1X19 A;  3VYT B;  3OY9 A;  3BH4 A;  5HKK A;  3PFY A;  3KX2 A;  2VJJ A;  3GVL A;  3ZR8 X;  2WA0 A;  2IS4 A;  3KEW A;  3BLY A;  4U7B A;  2M7A A;  3LNN A;  1QHH D;  1BR1 A;  4DOZ A;  3H0D A;  4W8T A;  4B3X A;  3CZ6 A;  1WJA A;  4CCN A;  1O88 A;  1D0Z A;  1SAU A;  1BR4 A;  3DPL C;  2EWE A;  2KQR A;  4AYB A;  4XN3 A;  3FBI B;  3EUA A;  4E0F A;  2WY8 Q;  3S32 A;  2E60 A;  2V4D A;  2L9N A;  2KP6 A;  1HG8 A;  1IDJ A;  2OV7 A;  4XMY A;  4HNU A;  2D3N A;  4N4O B;  1FMW A;  2LBF B;  1MMG A;  3OYK A;  3UNG C;  3W2W A;  1PKV A;  3OYB A;  3HPH A;  1FX0 A;  4XOT A;  1H80 A;  2K3P A;  2QKL B;  3I9V 2;  4E7I A;  1BPL A;  4AVZ A;  3ZPN A;  3ZQQ A;  3VWB A;  4HIZ A;  3JU4 A;  3W2A A;  3KEY A;  4PJL A;  1I8D A;  1T0F C;  1IA5 A;  3K4M A;  3LSH A;  4XM3 A;  4DGW B;  4XLH A;  4Z05 A;  2XF7 A;  3T56 B;  1BN8 A;  2VXZ A;  2FUG 2;  4CH7 A;  5FRN A;  4XKB A;  4NQW B;  3U21 A;  3HUG B;  2V4J C;  1N75 A;  2Y0S A;  2XZP A;  4B3G A;  1UD5 A;  1KTW A;  1RU4 A;  4HNT A;  4BDY A;  4BE2 A;  5LD2 C;  4FAS D;  4XOR A;  2IS1 A;  4PUS A;  3VYU B;  1V0E A;  2LRD A;  4XD7 A;  2Z8G A;  3DPU A;  2W7N A;  2W6J A;  3G05 A;  2NT9 A;  3CJQ B;  3KRG A;  2JJ1 A;  4P22 A;  1Y6I A;  1MAB A;  2X1C A;  2O0W A;  3BG7 A;  3K10 A;  2MC4 A;  2O0V A;  3OR1 C;  1LDK B;  4NC8 A;  4RLF A;  4PK4 A;  3MKW B;  1OR7 C;  2IGK A;  2M4K A;  3H9G A;  3BCB A;  4HG2 A;  3VSK A;  2E5Z A;  2BVM A;  3B90 A;  4H4K C;  4D1Q A;  1UD8 A;  2CV1 A;  3OR2 C;  2KPM A;  2XGJ A;  1GQ8 A;  1O8M A;  3ZCO A;  1X4O A;  2Q2E B;  2XZO A;  2WAE A;  1W9X A;  1DBO A;  3T51 B;  1AA7 A;  2E1M B;  1OGM X;  3L2U A;  2CUJ A;  2O04 A;  2CV0 A;  3H9J A;  3KYL A;  4ZTJ A;  4YZA A;  1P9Q C;  3BC8 A;  4PFP A;  1R6R A;  4Y3O A;  4Y4R A;  3OYC A;  2PYG A;  3TMO A;  2VLA A;  4MLO A;  3S93 A;  2HZD A;  1KON A;  2WBM A;  2W00 A;  3HG9 A;  4CZC A;  5KNL A;  1W0J A;  2NSP A;  4U4B A;  3RPU D;  1JRG A;  2L5Q A;  3HOT A;  2VXD A;  4URR A;  3H9Q A;  1EFR A;  3E0J B;  2Q1Z B;  3VSU A;  4EW9 A;  3IP4 B;  3ZPP A;  4F92 B;  3RCO A;  3NWT A;  1XG2 A;  1PE9 A;  3OFN A;  3FKJ A;  2LY1 A;  2R7V A;  2VJ5 A;  1MND A;  4LIV A;  3NWS A;  4ZYA A;  1UEL B;  5TGT A;  4BJ5 C;  2OUM A;  4BS9 A;  4E6K G;  4X0G A;  1K28 D;  4F93 B;  1Z3Y A;  4XLC A;  1V0F A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...