4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
2X6WA 3SUCA 4XLCA 4XORA 2UVEA 5AMVA 2PECA 1H80A 4W8RA 1XG2A 1OGMX 1PLUA 1JRGA 5C1CA 1O8JA 4HWVA 4C2LA 4OJ5A 1K5CA 4XLAA 1QJVA 2VBEA 1RWRA 3EQNA 2Z8GA 4XOPA 4XONA 4W8TA 5C1EA 2X85A 4XN0A 1DBOA 1KTWA 4XM3A 1PXZA 1O8EA 2O17A 2IQ7A 2PYGA 2O04A 4OJ6A 4PMHA 1GQ8A 1NHCA 1AIRA 1IDJA 2O0WA 3GQ7A 3WWGA 4XKWA 4U49A 3VMVA 1O8IA 4YZXA 3B90A 1KCCA 1O8HA 2INUA 4EW9A 3B4NA 4W8SA 1OOCA 2X3HA 4XR6A 1PE9A 2NSPA 3GQ9A 4MR0A 2X6XA 2NTBA 1CZFA 4XMYA 3GQAA 4XL9A 4Z03A 4XLHA 1HG8A 2NT9A 2NZMA 4W8QA 2NTQA 4OZZA 1VBLA 2O1DA 4YEJA 1IA5A 4Z06A 3JURA 3ZSCA 4XKVA 4U4BA 3B8YA 1BHEA 4XLEA 1O8KA 4YELA 4OJLA 4MXNA 3ZPPA 4OJPA 1O88A 1O8FA 2QXZA 3VSTA 2INVA 2X6YA 3LMWA 4XN3A 1QCXA 1IB4A 2QX3A 2NT6A 2PYHA 1EE6A 2VJIA 4XNFA 1JTAA 2VBKA 1OFLA 3UW0A 1O8LA 3EQOA 4YZ0A 3VSUA 4XLFA 2NTPA 4AVZA 4YZAA 1IDKA 3T9GA 1BN8A 1RU4A 4Z05A 2O0VA 2UVFA 4XQFA 3FY3A 3GQ8A 3VMWA 2VBMA 1WMRA 2ODLA 4I84A 2BSPA 4OZYA 3VSVA 1X0CA 4OJOA 2NSTA 1O8MA 4NK8A 1KCDA 2QY1A 4XOTA 1O8GA 2VJJA 1DBGA 3GRHA 1O8DA 2EWEA 4NK6A 1OFMA 4URRA 4YZQA 1RMGA 1OGOX 3KRGA
chains in the Genus database with same CATH superfamily
4GCVA 3D0SA 2O5RA 4FHTA 1WKMA 2UVEA 5J8CA 2VQGA 2VXZA 3IV5A 1R5GA 3VMFA 1PLUA 2OJED 1Y39A 1RUOA 3TDUC 5IYRA 5CVIA 3HSFA 3T0YA 3NEUA 1YOVB 2KIMA 4C2LA 1OPCA 4RDUA 2XAGA 1P92A 5HDNA 1BL0A 1V0EA 1J9ZA 1VLOA 2DCUA 3RTRA 1RQPA 1NJID 3KP7A 2QQ8A 1BR4A 2EZHA 3B02A 4A3EJ 4Q48A 4P2NA 2V7FA 5DCFA 1RQRA 2HZDA 2R5ZA 5IYWA 3EUKL 1ZELA 3T8RA 1FRQA 1TTTA 3OYMA 3T1BA 1QGPA 2CW7A 3KZIC 3TEDA 2E2IJ 1KYZA 3CCYA 2M7AA 1OGIA 1TTYA 1P4MA 1O8IA 3OYFA 4HBLA 4EJVA 5CDFA 3AVVA 1KCCA 5CJ9A 2GWRA 2L9NA 4RCZA 2HVQA 2IPQX 4OU0A 2BV3A 1Y8QB 2HOTA 1QA6A 1FMVA 2KPMA 2OQGA 3GTLJ 3TP3A 3ZMDA 3R0JA 5K5OA 4B09A 4HNVA 3MN2A 2V1UA 1X3UA 2JVGA 3G05A 4XRSA 2ZMEA 4R1HA 4PAAA 1MSEC 2NAZA 1TWGJ 2Z9OA 2DERA 4OPWA 2MC3A 4L9NA 3PENA 1MBHA 2V26A 5IYPA 1T6ZA 4CO8A 2NNYA 3T56B 4M53A 1GVJA 4YEJA 3GTPJ 3FX3A 4U0WA 5IT3A 2Y48A 1YHQB 4UUVA 2Q2EA 4F91B 4JQFA 2XPWA 4S04A 1ERDA 4NC6A 4WK8F 1WJAA 3PL8A 3OYBA 3UKGA 3H92A 1R6RA 2PLYA 3VYRB 3ZQFA 1JA1A 2NOJB 4IJAA 4BHBA 3BTCA 2H8RA 3AVWA 2WAEA 1O8FA 3TDZC 1MDMA 4OJPA 4CA0A 4PGGA 4AUXA 2KJCA 2VZLA 3JRBA 4FISA 3B73A 3X2QH 3EYIA 2XNDA 2XF6A 2VQLA 1FTTA 2LY1A 4G94A 1BI1A 2BVMA 2H6BA 4FT8A 5DYMA 1TT0A 1WCMJ 3OAAA 2I8DA 2OUMA 3RQIA 4EQQA 3KZYA 4RB2C 5AN9A 1QQ1A 5LRRA 5LGTA 5JLVC 1OCOH 1UZCA 1T56A 1IDKA 3PNYA 1VI0A 2HPIA 1W7PB 3PSSA 3LA7A 2CQKA 1VQPI 2ZKZA 2XPVA 4AIHA 3I71A 5AIQA 1RIOH 2HCJB 2VBXA 3LO8A 1ENHA 4PFOA 2XGEA 1ODDA 4MFDA 4OWRB 4E7HA 1ZLKA 2VJ5A 1QGYA 3OEHA 4DNCA 1X0CA 3VB2A 1PUEE 4GDFA 3GF2A 3AGQA 4BQQA 4EH1A 3KETA 3NQOA 2LLKA 2MG4A 2L5QA 3OFNA 1D0ZA 2MD5A 1P7JA 5B5EC 4FTHA 3OWTA 5GP9A 5JHUA 4YALA 4AC0A 1YIOA 2STTA 3KEYA 5HLGA 3MKWB 4PCQA 3PIOF 3FXQA 3WBJA 2FBKA 5J1RA 4UUSB 2VBTA 3JR9A 4XORA 1VF7A 1GV2A 3GVKA 2DA3A 1W7PD 3I59A 4R79A 4BUPA 2PEXA 1OYWA 5FLVA 1JUSA 3FF5A 3OYKA 4EGYA 2P81A 5EYRA 2IP2A 3MHPA 3HHGA 3ASOH 4A12A 3E97A 1XFOA 4G6IA 1YYVA 2ZXIA 3KL9A 2BX6A 1JT6A 1OYIA 1MNMC 2QTLA 2ZTNA 4XONA 4HAMA 1KTWA 2D1HA 1BR2A 2XAQA 2CFOA 2IQ7A 2O04A 1HDDC 1L0OC 3CLOA 3TKYA 1Q81D 1GXPA 1ZREA 1OYYA 4LIVA 4BY1J 4C2UA 2E19A 4J01A 3JAMZ 1TUIA 2OZUA 4U49A 2XNCA 4A2UA 1JI8A 2DFIA 4HW0A 1S72B 5LHHA 1FBQA 5LHGA 1FOYA 1B23P 2YU3A 3WTXC 2QMUA 1KC8D 1RC9A 2OK7A 2NSTA 2X4HA 1VQLI 2XT2A 1T5EA 4HV5A 1WFXA 1YW7A 4MEYF 1R36A 4Z4TA 3Q6RA 1AMOA 4AWXB 4PJ0C 2VKVA 2NTBA 1RETA 4X1EA 2XVCA 1K6YA 5L3CA 2V7VA 2EFWA 2XB5A 1N0UA 1QVFB 1TWFJ 4I98B 4PGHA 3ZZ0A 5DCMA 2H27A 5FKNA 3GQAA 1XB4A 2R7DA 3F8BA 1ZARA 1V0FA 2H1LA 3L2VA 3ECHA 1ZH5A 1ZN2A 3CUOA 1VTNC 3I1FA 4IQ4A 3A03A 2IXSA 2NT9A 1Z3YA 3A8JA 2A61A 2CMPA 2A5WA 5E20A 4IZZA 3FKSA 4OZZA 5FLXK 3A4CA 2EK5A 4IF4A 1OJLA 1R5ID 4XKVA 2PMDA 1YJ9I 1QFYA 4XLEA 3I4MJ 2DOEA 3GFLA 4RLZA 2MSYA 1FWZA 3HZJA 3K4BA 4M9XA 1SKYB 3E20A 1VQKI 1N05A 2TCTA 3ZQGA 1O88A 1QU3A 4IW3B 4HOBA 1TL8A 3HRMA 2GA2A 1RR8C 2QX3A 2H09A 2HOEA 2DFEA 4QVJA 3G2BA 3FM5A 5FKKA 4BJTA 2DU9A 2NVYJ 3HKZA 1PJRA 3ERED 4MYTA 3HXLA 5EEAA 2ISZA 2E1BA 3CCSI 1FC3A 5L3GA 1XN7A 3A1PA 1FOKA 2NTPA 2AQFA 3B8HA 2F4OB 3G1MA 3IC7A 2Z3YA 1DDIA 2W4SA 2HI3A 3DWLE 2PJRB 1BN8A 3QOPA 4X8IA 5KCMA 3FKJA 1YW8A 4O3MA 4ACBA 2UVFA 3F8CA 1APLC 1Z05A 3CO7C 4MO7A 3PO3J 4KKTA 3NRVA 4OP7A 2PG4A 3VR6A 2XOKA 2EA2A 3WTYC 3FXLA 2OTLI 3VSVA 4KMFA 1IXSB 1B59A 1U5TA 2M8GX 1OR7A 1KK0A 4D7MA 2AS5F 4DJAA 3HPGA 4E7LA 1XDSA 4ZDPA 1KJZA 4NBSA 2W00A 1K9MD 1EZGA 2MD0A 3RPQA 5F0CA 1LNWA 3C2BA 5B1AH 2BZTA 2ZZFA 3NE5B 1I50J 1G6NA 3F8FA 4WXHA 2DXIA 2WBMA 2BM4A 3BQJA 3ABMH 5EG0B 1JKPC 1BC8C 1I27A 1V5GA 4Y7NJ 1IHMA 3PETA 4ZH4F 3M3YJ 3OEEA 1VQ6I 3WU2C 4AVPA 3GZ6A 4NQWB 5CYVA 3TW6A 3PM1A 4E7ZA 2R7VA 2ZC2A 3RKXA 2ZNZA 2XV4S 1K4SA 3F8MA 5M5WJ 2XZLA 3C3WA 4DYQA 1RI7A 2QYUA 3IAS2 1K5CA 1ETKA 4NBQA 3SHFA 3SYTA 5CVJA 5JVTA 3CPXA 5LMZA 3BJAA 2EFGA 4BE2A 1PXZA 1QZZA 3BZCA 1YIJB 3LAPA 1WJDA 2CJJA 2JPCA 1IDJA 1QA1A 3VFZA 3C2GA 4ESBA 4LGWA 4EEFG 2BSAA 3OKXA 2JSCA 4GQNA 1LDKB 3QFTA 2G0EA 3OS1A 4RLFA 1WJ5A 2IS2A 1AU7A 1WSRA 2HKXA 3K0LA 1WP6A 3VODA 1MBKA 1T2KA 1MRZA 3HL2A 4IHVA 2Z6BD 2DYRH 3EUAA 2F2EA 4HV6A 3WE2A 2WSSA 5F6FA 2ZXHA 5L46A 4OINF 4F93B 3ZQLA 4A3LJ 1KQ0A 2Y0SA 4RAZA 4BBSJ 1MNDA 3KLNA 4YIIA 2KQRA 4QPQA 1TW2A 4C2TA 4KJZA 4UVBA 4ZYEA 1Z1DA 4D5FA 2F5CA 4X6AJ 3GLLA 2OA4A 5DS0A 2BHZA 2JA2A 3ZQQA 4RLQA 2VNHA 2CC2A 1MBGA 4WZLA 2EV6A 3ZQCA 2UV1A 4F55A 5GTHC 4LLNA 4DQLA 1VQNI 1EH7A 3E3VA 2HYFA 2IJLA 2NVTJ 2XAHA 1XD7A 3J7YJ 3KEWA 1ON2A 4PC2A 5J40A 2UUZA 3TO6A 3E5UA 4LBYA 4Y9RA 2TDXA 3IL2A 2LBFA 2LFBA 1G4DA 4HQEA 5DM7F 1AWCA 4XNFA 3CO6C 2ESNA 3GZNB 1I3QJ 1W4MA 3IWFA 4M9ZA 1ZGAA 4DOZA 3JQRA 5J47A 4H0EA 2VN2A 4KNYA 5H5JA 1SMTA 3QPLA 1S9HA 2DJNA 2EIKH 1XCVA 1VQMB 3P7NA 3J7AO 5JFRA 3RZOJ 3ASSA 1TQPA 1EXMA 2WR8A 2JZYA 4HQMA 4KITB 4M6XA 1AKHA 1A5JA 2V31A 4N3GA 1FRNA 1V4RA 4RD2A 4C3HJ 3A01A 2L4MA 2DA7A 3F6VA 1EF4A 2PIAA 1QFZA 3Q0VA 1T08B 3SZTA 3ZRGA 1O8MA 3S2WA 1ETQA 1FNDA 1T0FC 2CQXA 2CS3A 3CCLI 5EGOB 2FEZA 3WODF 1CQTA 5K7HA 5HZBA 1QRBA 1WJFA 2JUGA 2RVCA 2K4JA 4BXUA 3OY9A 2A07F 2XTXA 5LEJA 4HZFA 4B48A 3ISXA 4RAGA 1VQ9I 4XLCA 1KU3A 4EM2A 3G1LA 2LY9A 3DKWA 3OMYA 5DD4A 3FHZA 4W8RA 1QX4A 2Y9YA 2V7UA 4ZCIA 3HUGA 2EQRA 1O8JA 1ETVA 4S0HB 4Y13A 1GHCA 3WY9A 1OKRA 2JA6J 3GWZA 1QJVA 2DMPA 2IA0A 3CDHA 3L2CA 1SC7A 1K79A 2GXAA 3EQNA 4QV2A 1R5HA 3FIWA 2Z8GA 2DA5A 4TT3A 3ABTA 3N6ZA 1ONVA 4KICA 1FBSA 2HVSA 1D1CA 1DU0A 3BR5A 5CPRB 1TQMA 2RKHA 4OOVA 2P7CB 2L9SA 2GAUA 3CW2A 1E2XA 5L3BA 4BHCA 2GXBA 2E34A 3C7JA 1O7LA 2Y0MA 5F1RA 2IVMA 3JRIA 5KNLA 3BTLA 1FOXA 5J6XA 3DTEA 2C5HA 2KDOA 3GTKJ 3OYLA 4CHUA 1IJEA 4M9SA 1E3HA 2A6HF 1YITI 4P26A 3CC4B 2ISYA 3LA2A 3KP5A 3S14J 2F4MB 2ZJRF 2DTZA 5A2QK 3BC8A 4CYCB 1S6LA 3HAGA 5F4OA 4N0BA 3LAJA 1JNYA 2DW4A 2L7KA 2JN6A 3H09A 1PVEA 1SFOJ 2MC4A 2I1LA 2RQPA 1H9GA 1TBXA 2K85A 3H0GJ 2WY7Q 3LSKA 1MH4A 4EVIA 2QTZA 2O1DA 2DMNA 4Z06A 2QYOA 1E1RA 2QWWA 4U4BA 2K5CA 2PFBA 2AO9A 3L09A 4RAYA 3FBNB 4MXNA 2M0CA 1QVGB 3LSTA 3PA2A 4IHYA 2EFNA 3CCMB 3WTVC 3ABUA 4GGGA 4X0GA 3CCQB 4P9FA 2OTJI 2Q1ZB 2WAFA 4Y17A 5K7ZA 2E1CA 3RY8A 4MTEA 1OB2A 1QHHD 2GOXB 2VOOA 1X3WB 1H8EA 4EGZA 1MBFA 4R71A 4HG2A 1QPMA 4WCGA 5HLIA 1RUNA 4CZCA 2D3NA 2E7XA 4QIWN 1U78A 4A0XA 2L7FP 4YZAA 4PK4A 3P9IA 1LEAA 2VJ4A 3KYCB 3TQNA 1YX5A 1FP2A 1FY7A 2ZNYA 4L9JA 2FD5A 3BR2A 1R00A 1IJFA 1EP3B 2Q6IA 3LSJA 1WMRA 1IO2A 1D8KA 2FQ3A 5IPAA 3RI4A 2K40A 2RC6A 1KQ8A 5E3MA 4ZZDA 3QOEA 3EETA 4UB8C 2HDDA 1B6AA 4BXFA 3G71B 5C4JJ 4U9UA 4B3FX 2E35A 2QBYB 2V9VA 1IN7A 2CU7A 4P25A 1ZGJA 2EZIA 2XAJA 2OPTA 1OFMA 4M0LA 3RCOA 4LITA 1LEBA 3OZVA 4N4OB 4M6YA 1T6XA 4QHYA 1Z0XA 2COBA 1JJ6C 3WTUC 2L4AA 2PI0A 1KK2A 1XG2A 3ZCOA 4E4HA 1IXCA 5CQGA 1YO5C 4Z4YA 1JRGA 1WJCA 1VQ7I 4Z6YA 1PJ5A 2XTYA 2ZCWA 3BR3A 1LVAA 2XAFA 3AL0B 3QYBA 4FXUA 2E7WA 3OL4A 1CF7A 3S3MA 3S3NA 1SAUA 1ULYA 4Z2YA 1E17A 3WHBA 2YUHA 4W8TA 3BCFA 3AVYA 4MQ9F 1X1DA 2CV1A 1VQOI 4DK0A 3A3BA 4B3AA 3L1PA 1YFHA 2L7ZA 3SJMA 2BF4A 4HEA2 3L2WA 4OOIA 3HG9A 2R7TA 3LQEA 5J4VA 2KRFA 1HLVA 4BHPA 4PC6A 3R60A 5ILSA 3CCVI 4JX6A 4CYDA 1ZG5A 1G7TA 1P9QC 3JAMK 3QU6A 3ASNH 3FZVA 3OIPA 1NB0A 3ZN1A 4EMSA 3S1NJ 3SEQA 2VASA 2RNGA 2OYNA 3R6KA 1ETWA 2E2JJ 2O61A 2R93J 1QRYA 1QGAA 4WZEA 2R7RA 2VBYA 3K4NA 3LWFA 2ZZEA 1HG8A 2QENA 4ETSA 4ZYHA 4YEIA 3RSNA 4V02C 2HKOA 3SLDA 1FSEA 1BPLA 3ZSCA 1WRJA 2BGCA 4NCNA 1SD5A 4HYEA 4EATA 5IP9J 3CCJI 4ESJA 1P7IA 3GEZA 2FX3A 2DJIA 1NTCA 3MZHA 2QKMB 2DK5A 2VPRA 2RC4A 4LLGF 2MH9A 4KISA 1F1ZA 3P27A 5EEHA 2IGKA 2OQRA 2DPDA 2V9KA 2R0QC 4BE0A 4MNUA 3GBGA 3KFWX 1GXQA 2JA8J 3I55B 2JK3A 3W2IA 4HDUA 1BJAA 2ZL7A 1N75A 2LVSA 2VFMA 5FGMA 1TT5B 3DEUA 4GO1A 1BC7C 2HXOA 2F5DA 2BYVE 5E3NA 3VSUA 2DK8A 3HYIA 1B72A 2FX0A 2O6WA 2JJ1A 1L3LA 1MMSA 5E1XA 2IAIA 3EDPA 3L9FA 1NB9A 2X3UA 4LMYA 3KP4A 2IOUG 3KYLA 1GAQA 1GVHA 2B0LA 2J8IA 2BSPA 4OZYA 1HSJA 1ZG3A 3K1PA 4M71A 2XKPA 1MD0A 2KZGA 3DF8A 5D5VB 2CO5A 5FFZA 1YRNA 3SJZA 1QGZA 1O3QA 3D5RC 1FNMA 2BPOA 3IKTA 1ZGWA 4OMZA 4IHWA 2DODA 2P4WA 2VQCA 3K69A 4CICA 3I9V2 1HKTA 2E5NA 1KYWA 5JBQA 1NHAA 5CKTA 1PKVA 4BDZA 3D26A 3OS0A 1T8IA 2PECA 3FK7A 2X6OA 2YPRA 3H9GA 2CNDA 4E7KA 2DT7B 1H42A 1HKQA 2OZ6A 2Z16A 2ZJ2A 4K2EA 3N97A 3SEJA 4HWVA 4J19A 2W48A 3ZQIA 3LSMA 2EZLA 3F8NA 4BEHA 3WU0A 4ZDOA 1WWXA 2LKSA 3UR3C 2ESHA 1YHQI 1R5NA 2NYXA 4R8HA 5C1EA 3EUHA 2EPFA 2D2WA 3FBIB 3LSGA 4RB3C 1DDNA 2V4DA 4RAFA 1TLLA 3E5XA 2IBDA 5FJ8J 4ACAA 4CCNA 3RKWA 1DPUA 1FP1D 1RKWA 2EV5A 2LYCA 3OR2C 2Z2SB 3L00A 5H2FC 1SMYF 1EP1B 2INUA 2WPDA 3IWZA 1JKQC 4MHGA 4B1RA 4FQGA 4A3JJ 1COWA 4YDTA 5TGTA 1BMFA 5J1UA 1WJBA 4Y3OA 4CQJA 3WNCA 3M4OJ 2NSPA 3GQ9A 5J8FA 2ELHA 2X6XA 2DA1A 2L9VA 4A3DJ 3JQPA 5LHIA 3OW2B 2DA2A 1HA8A 2P3MA 2DQRA 1QVUA 2KMUA 5KAFC 3BJ6A 2AXLA 2WB1A 4XL9A 2L01A 4JMQA 1VQ4B 2KDZA 2DCEA 3BPXA 1ZKGA 4N4NB 3COAC 3E7LA 3ABLH 2FVGA 1R1UA 4KFCA 2CGPA 1F4KA 2CV0A 1UD3A 1D5VA 2M45A 2VKDA 3OJWA 3DEEA 5GAEJ 3TOAA 5M3MJ 1VHEA 4S05A 2P0WA 4OIQF 5IK2A 2V6EA 3W3CA 2INVA 2VQHA 2XT4A 1QZYA 3GTQJ 1SVMA 4YCQA 2PYHA 3V76A 3K4CA 4LBVA 2KJBA 4N9IA 2A68F 2OC6A 4X0CA 3WNDA 1POGA 2A05A 2EFQA 1JKRC 4RD6A 1A6QA 1MBEA 3VYTB 2BM5A 1U2RA 1XS9A 1HCRA 4RPBA 1K61A 1XTAA 3DBRB 3CMAB 1XE1A 3MAJA 2VE8A 5GPAA 3CLQA 4IEJA 3AKZA 1JGGA 3T5XA 2YUSA 3P26A 2DA4A 3BDDA 3L2RA 3BROA 3OSFA 4U88A 1IC8A 1XB2A 3L2UA 1BW6A 1YW9A 5HZAA 3A8IA 2ODLA 2LTPA 3A0BC 4L5EA 2L0KA 2LG4A 1PUFA 1N08A 1O3RA 2MLGA 1S72I 2DA6A 5KSWB 3BZ6A 4M4SA 3ZQHA 2EWEA 4KN7X 3KCCA 2WY8Q 3QFRA 4C43A 2EJRA 4LG0A 1P4WA 3DEWA 3VDXA 2F5FA 4MQVA 2F48A 1WPCA 1E3ZA 1JUPA 1EA3A 4II2A 5F08A 5HDGA 2JRMA 3MCAA 1R5BA 4G7ZF 2B0RA 5C1CA 2KZVA 4BQAA 2F3LA 2FBIA 1ON1A 3HHHA 1EWYA 2KKOA 1E3PA 3VYUB 2D74A 4HPQA 5DUIA 3M8FA 1OGJA 1MIJA 4FASD 3OR1C 1D5YA 4L0ZB 2FOKA 1OCZH 2E1NA 3GFJA 3CC2B 5FKMA 4TMVA 1MKMA 1VF9A 1W5CC 1J2XA 1JB9A 3N90A 1Z6RA 2K9MA 3OIOA 4AU7A 4V19K 3QE2A 1Y0NA 4ZGNB 2DFFA 2K86A 2BGJA 2NPFA 2L7MP 2QQAA 5E1ZB 1J59A 2L02A 5IYDJ 4PJNA 1E63A 4XK4A 4DQKA 1Q1VA 3BG9A 3I4NJ 4IHTA 1LE8B 4KKUA 4WWVA 1R7JA 5D5WB 2A5YB 2VT2A 2E36A 3HSRA 4JBAA 4Z4VA 4QLCU 1BR1A 1Y0RA 1QZEA 5JLWA 3PIPF 2KLOA 1CZFA 1CNFA 2P5VA 4TV7A 1EFCA 3GCMA 1B8IA 1BX1A 3A1YA 1B9NA 1ELOA 2EA4A 2HLDA 2BY1A 4ROXA 3HOXJ 2NVXJ 3PSZA 1SFUA 2OBSA 4Z4RA 1JTYA 4PJJA 4XLHA 3CQZJ 2KFDA 3VO1A 5J3LA 3SJPA 1K78A 4ESFA 4HLYA 2V1NA 3GW2A 3H9NA 2GREA 5BQTA 3ISPA 3QQAA 2HYJA 1V3FA 2GZWA 2D1VA 3I56B 3CC7B 2A6EF 2XDVA 4AD9A 1ZM2A 4RGSA 2DQLA 4PJMA 5FROA 5JHFA 2ID6A 3AG2H 3ZPPA 1QQIA 2UXNA 1G3TA 3M8JA 5DD8A 4QVAA 3S2DJ 2QXZA 3LL7A 3HOSA 2QLZA 3FMSA 4A3KJ 1UMQA 2EZKA 4I0BA 3Q38A 2K9SA 1EE6A 1P4XA 3G3ZA 4LOCA 1A35A 2NRAC 1WTHD 1JTAA 3QPHA 4L5JA 3CJNA 4FE4A 4BQNA 2KISA 2LZJA 3ZZTA 2DDAA 1HBXG 3QAHA 5K1YA 1HVXA 5EEGA 1LUJB 1JA0A 1U9NA 1ZYRF 1WH5A 1OFCX 5DN6A 1UHMA 3PUFA 5FL7A 1KQSB 3I5UA 4Z05A 3BCDA 4I7HA 4N9HA 1FJLA 2XRNA 1BN5A 1YIJI 2CF4A 1DP7P 1SVLA 1N77A 2BBYA 2X1EA 4QPOA 1GVDA 2L2OA 3MCZA 5JLXA 3V7SA 4XD7A 3WHCA 3O8GA 3AK5A 2QVOA 3BR0A 4ENKA 2KHMA 1MNEA 1DGWY 1P2FA 3GTJJ 1TVCA 2HNHA 2VONA 4DW6A 3ASTA 4M3EA 3GYHX 1U8RA 4AC9A 1X3ZB 4XOTA 4P3YA 4X06A 2GQQA 1VFCA 3DBLB 1DQUA 2VNKA 2NVUB 2R7QA 2RGVA 3ECOA 3V7CA 3CP2A 1A04A 3O3KA 1F36A 3U6KA 2K9LA 3OL3A 5IT9Z 4P55A 1GV5A 3SDGA 3ERMA 4BQOA 3K10A 1Y0UA 1W35A 1OGMX 4LD5A 3LSHA 1UAAA 2FOWA 4M3GA 4CCMA 5LGUA 1GO2A 1I7PA 2WADA 4OJ5A 4HF1A 1MJ9A 4XLAA 1FX7A 2ECCA 2DAOA 2FE3A 3SXYA 2LD5A 3FJOA 4RD3A 3QSYA 2DMUA 3VO2A 3J7AY 2X85A 3DXJF 3DFGA 4XN0A 1KZLA 2O17A 5KK1A 4FK8A 4B4CA 4TMTA 1FDRA 2ZBUA 2XAUA 2VKEA 2V6CA 4NC7A 5DTDA 4P9UA 1SFXA 3V8JA 1MZBA 1UMKA 3GQ7A 4HX4A 4G1BA 1G7RA 1G3WA 4P6VF 1ZR4A 4YIFA 4BL0B 4KUMA 1J5YA 3PSIA 2JTVA 3Q39A 3PJRA 4YZXA 2VUMJ 1FIPA 3OYNA 3LOCA 2IS6A 1KMHA 2WWYA 3B6CA 4L18B 4AM3A 1IRXA 3WG9A 2WB1N 3OIQA 1XG1A 4C2MJ 1N78A 1LJ9A 1Z9CA 1IN4A 2DOAA 5B3SH 3GZ5A 2DMTA 2M9HA 1VQMI 1QBJA 2YU9J 2E1RA 2PLFA 3CD6I 2AHOA 3QP5A 4I99C 1FEXA 4W8QA 2CQQA 3HM5A 2F4IA 1A36A 3DLLF 3SKBA 1XC5A 2NZMA 3CUQB 2O3FA 3WQZA 1BM9A 1KONA 3CPWB 2LRDA 3DKXA 1XX5A 1CQXA 1PYVA 3VWBA 4OM9A 4D5CA 2X0KA 1ZK8A 4ZYAA 2C6YA 2IGMA 1XSDA 2X53S 4F3QA 3HBLA 2XGDA 4E7JA 1Y1WJ 4XRFA 3Q0WA 4XBFA 3NAUA 1JGSA 2W85A 2BHYA 2M5WA 3SDBA 1IAWA 2HEOA 1YI2B 1IN5A 4IRGA 2HPMA 3BQYA 3JU4A 1K8AD 3G4SB 2X6YA 5LBQA 1YJ9B 3QPTA 1S8NA 5EF6A 5F4MA 4G6QA 3SFZA 4M73A 2JUCA 2OU2A 4EJWA 2QSHX 3EYYA 4HDVA 2ZITA 3K1MA 1FMWA 2CW0F 3MZ8A 1QRCA 2M30A 3RYRA 1J09A 5CLSA 3EQOA 2LREA 2W24A 5FFXA 2O6GE 2OBRA 1X1BA 2QA4B 1E79A 2XC1A 1LQ1A 4MFEA 2F4NA 2DTRA 5LGNA 1LFBA 2BY0A 4ASUA 3LNNA 2W1OA 2XEXA 1D1AA 1I1SA 4DZPA 2FNAA 1R9TJ 4TN1A 4Y7CA 3DKYA 3DTIA 5CVUA 3RDIA 3KYDB 1IDZA 3VMWA 1E1QA 3I54A 2VBMA 4GFBA 2VNIA 1SANA 4M74A 3CCSB 1M1EB 2OBTA 3F21A 1J7KA 2JA5J 3OE7A 2VPLA 3W2WA 4DGWB 1UJ8A 3VNUA 2MBFA 3GLXA 1IRZA 3JRAA 2R3SA 4O5VA 5GV7A 1ORKA 1T95A 2JT1A 2VI6A 3AGPA 1MH3A 3H36A 2JJ7A 3HJEA 4CH7A 1BI2A 4RD0A 3OSGA 3LSIA 1IXRC 1JTXA 1XCBA 4HRIA 3IAM2 1O7FA 1UD4A 4YZQA 2OCEA 4G12A 1IUFA 2E1MB 1YQAA 4PSWA 5M5YJ 2X6WA 3SUCA 5E3OA 4CSWA 1H8AC 3CUQC 2XGJA 3FMRA 3LA3A 2O8XA 1V5FA 2OCCH 1WDTA 2V7TA 1ZTRA 2R5YB 2GM4A 4HIZA 4L5IA 1T6SA 3WGGA 2V1DA 1TLHB 2W84A 5IYCJ 1JUMA 3I3LA 1D0YA 4ENMA 1IF1A 2QEXB 1H8HA 2ZJPF 3CCMI 2YWFA 4RCYA 4Z1MA 1KGSA 3JTHA 3CTAA 5C44J 4FX4A 4OPVA 4E0FA 3CCQI 2DOFA 3SEZA 4HE6A 2GOMA 4QUZA 4BEHB 4HSRA 3S93A 2C4TA 2V4JC 3H5AA 1PJ6A 2F6CA 3KIOA 1EH8A 3IP4B 4HNUA 1D2EA 2B63J 2BW3B 1G7CA 2WZNA 3EPZA 3FISA 1Q82D 1WI3A 5J4YA 5BSXA 3AG4H 4OOSA 4ZCLA 4NHJA 1EKEA 4F7ZA 5TV2A 4F7DA 2WC2A 2HDNB 5K5QA 1S5LC 4XMYA 1K4TA 1AOYA 3DCFA 1IRFA 4XSZF 3REOA 2XHKA 4UV8A 1N0VC 4RGXA 1LB2A 2C5BA 4U0VA 5KW9A 1STZA 2EIMH 3TO9A 3CDIA 3QU3A 1IA5A 1IW7F 1U6GA 4GYGA 1DARA 1IG7A 5D6EA 2HQRA 1X2MA 4GRIA 3QP6A 3OYAA 3G71I 4X7FA 2G9WA 2B7EA 5TY0A 2HTJA 1WZ2A 3H3ZA 1S7OA 2GA1A 1XPXA 4UNOA 2E1MC 4UUSA 2LDUA 2Q8KA 5BMZA 4N3NA 4B44A 2C77A 2VBSA 2R5ZB 2VFOA 4RGRA 4JOMA 3HGYA 1MW7A 2I10A 1FZPB 3CCEB 4C3JJ 2UZKA 3BR6A 3HOYJ 1PJ7A 3QWLA 3DPTA 3ZMUA 5FD5A 1FX0A 2ADUA 3SQVA 5L3FA 3CESA 3JTGA 1G8XA 4CUGA 4G6TB 3K2AA 5FO0A 1HSTA 3WGHA 4PJLA 5ICEA 3W6KB 2XPUA 4LFUA 4XQFA 3F23A 4WZKA 2EFPA 3OYDA 2ZMEB 4XRMA 1J75A 1EA0A 2LMDA 3ML3A 2ZJQF 2VBVA 1MJBA 4O6JA 4CXFA 4D1QA 3FM3A 3CMYA 3GFIA 4BACA 3G6EB 4I76A 3BNWA 2X0LA 1NRKA 4G1VA 4W1UA 2R7FA 1W36D 4BBRJ 2MA3A 1W0JA 5B1BH 3GRHA 2E71A 1USSA 4HF2A 1HXDA 2Q2EB 1G3SA 1ZRDA 3ES9A 1N8RD 2ZXJA 3BR1A 1ZM9A 3PNTA 3ZMZA 1OGOX 3OV8A 1Y1VJ 3ZQ7A 3KRGA 5BSYA 4CDGA 5AIPA 2LKXA 3FXKA 3QODA 2YWEA 3PFYA 1MDMB 2D9RA 1QA3A 1SVOA 3W2FA 1NG6A 3H1CA 4IRIA 3BP8A 3U1KA 1DUXC 2Q6KA 2LR8A 5F0FA 3FMQA 4PZJA 3HGGA 2Y2ZA 1VQ8B 1OMIA 2JA7J 2J8KA 1XSXA 1R22A 2JMWA 5IYQA 2YWHA 3H5RA 3OZWA 4OJ6A 1Q9SA 3CMEB 1GQ8A 1DPRA 2WV1A 1NHCA 4ZYGA 2O0WA 4DNRB 3WWGA 4CGZA 4Y33A 4C9YA 3JX8A 2K27A 1YX2A 1UELB 1W36C 2VFPA 1EH6A 3OYGA 1F43A 3I55I 3ZMVA 3M1CA 1GDTA 1I18A 2TRTA 4OIRF 2NNNA 4DNTB 3L2QA 2LKPA 1XGNA 5HS9A 1KK3A 1CGPA 2PJRA 4OIPF 4IVNA 3Q9VA 2HTSA 2D5VA 3KX2A 3HRSA 3DDYA 2ZMEC 5HS8A 1O3SA 1QNTA 1R58A 1R4MB 3E5QA 4KMUX 4WF2A 2W7ZA 4U7BA 2GQFA 2BY2A 5HDKA 4K1XA 1MMNA 1YE9A 1KQ5A 3I59B 1G3YA 3OYCA 4YG2F 2R4GA 2HVRA 1KZHA 3LQRA 1O8KA 3BG6A 3BCBA 2E5ZA 4DYCA 5LRSA 3MKYB 5HOOA 1BA5A 1MJAA 5EG0A 1QG0A 2HQAA 1ETOA 3FXOA 4UUTA 3KEOA 1WGXA 3F0CA 3FXUA 4NQWA 1QFJA 1SD6A 3C2HA 2VBWA 4BXXJ 3LYCA 2Y31A 1QCXA 3WBKA 5GV8A 4X05A 4XLNF 3SQNA 2BXZA 5JR3A 2HQNA 3JRGA 3ZIAA 1W0KA 3GIRA 2BVLA 3RPUA 2X1CA 4I2OA 4DYRA 3Q9SA 5KVRA 4Z4UA 5BOXA 1OCRH 3SLNA 4YZ0A 4BH9A 2XSDC 2PMZN 3ZGKA 1Z6TA 2M34A 2ZB9A 1BOBA 1FYKA 4KIBA 1AHDP 3S2HJ 1WU8A 1Q7YD 1TZLA 1GJRA 5H59A 2IA2A 3FPPA 2OF7A 3GTMJ 2Z1DA 4ZCMA 1U3EM 2B9SA 2ETHA 5AONA 2XIGA 3ZMTA 5J35A 2EBIA 2JN9A 4ABZA 2RC5A 5TRDA 4HE5A 3PQJA 5DCMB 4G7OF 2V79A 3HPHA 3R4KA 5HNFA 1HQCA 4RM0A 3T51B 3OYEA 2E2HJ 1RR7A 3O6BB 4OJOA 2OD5A 2O8KA 1T0FA 4NUBA 1HA3A 5F1JA 1KCDA 3RKYA 4NC8A 5ICFA 1DBGA 1VQ5B 4E7IA 4M72A 4RDKA 3IRQA 2XB0X 3C18A 2YX7A 4P96A 4RGUA 1U8BA 1BJKA 3ULQB 1H9TA 3T9GA 5DNSA 2XKOA 3TBIA 4IOAF 3ROUA 2MGQA 2X48A 5E3LA 2E60A 1F5TA 1K83J 2FSWA 1VQ4I 4LJZF 1T39A 2R92J 2EIXA 1H80A 3BY6A 3Q3AA 4PC3A 3GUDA 5IT9K 2IA1A 2FRHA 1Z91A 3A0HC 4L9TA 4FCYA 1ZG1A 5TR9A 4KH3A 5LEKA 3LSPA 4P9SA 1WSVA 1RWRA 4PGOA 1X19A 3HC7A 3PUNA 2IEKA 1O4XA 1EP2B 2DDBA 1G7SA 1K28D 2PYGA 2W57A 3LQ6A 4PMHA 4WWCA 3TO7A 3IUOA 4AIDA 2KRHA 3W5UA 4YFXF 3AFHA 1SEUA 3CF5F 2DT5A 5JVGF 1IB0A 5BNGA 5BS6A 2QQBA 2JJ2A 2HMAA 2M5SA 4C0SA 3F9KA 3B90A 1PDNC 1V5EA 4DK1A 2HDWA 4RJLA 2X9DA 1VQOB 5JMCB 3A35A 2LK2A 3GVAA 1A31A 1Y0YA 3IH2A 2H6CA 2RAEA 2JQ7A 4X7EA 3R0AA 2DYIA 2R9VA 2K4BA 1U5TB 3SZEA 3F22A 2GJKA 4F52A 2FXAA 2VC1A 1FNCA 3CMAI 3K2ZA 1C0WA 4EJTA 1K73D 1IN6A 2F1LA 3ASQA 4TMZA 3ZUGA 2WAQN 2CRVA 2ZSHB 3FK6A 4UZEA 1XSVA 2QCOA 4L0YB 3W2GA 2LP0A 3QFSA 2XNJA 3ZXSA 2QSFX 2J5PA 2B7CA 1RESA 2NOGA 4X07A 4FE7A 5EGOA 2PE3A 4ZV4A 2M87A 5IYNA 1YG2A 2Y75A 3HB9A 3FKIJ 4ON0A 4MYUA 4B4DA 1D1NA 1ACIA 1BX0A 4IOCF 3BOQA 3ZN0A 4P1VA 4YELA 3HTSB 2YR2A 2JWTA 3ONYA 3TH0A 2M0MA 3OW7A 1TWAJ 2K3FA 3WTTC 3TL4X 1FOWA 1RKTA 3QYEA 5D4SA 3HOUJ 1YLOA 1MSFC 4P3IA 3E6CC 2BM0A 2Z5UA 4UVAA 4ZDLA 2QGGA 1F9NA 2ZTGA 5CVVA 3CCJB 3R6SA 5ILVA 5L3DA 2ZZQA 3IKVA 3J80Z 5EMNA 3BJOA 5FNZA 1S4MA 4H4KC 2WYRA 2HOSA 1NBMA 4TMXA 3CCUB 2MH2A 2VODA 1JJ2B 1OFLA 2NXNB 3EQLF 4H9GA 4PC1A 2DI3A 5FIUA 1O8LA 5F0HA 1VNDA 1I5ZA 5JI6A 2A69F 3JREA 3GFMA 3ONQA 1R71A 1FSHA 3CC2I 2Q6LA 4ENNA 3DPUA 1GLNA 1Q1HA 3BG3A 4XIDA 2XRLA 3LSRA 4JP0A 1BLIA 5IP7J 1R5OA 1SD7A 5LFAA 4KN4X 2DEUA 2ZL5A 2QF7A 1SFEA 1TNSA 4IHSA 4Y52J 3N05A 4M6VA 4RM2A 1XMAA 4A3MJ 2V7QA 3RIQA 2C4UA 4P22A 1X58A 3OYJA 2XASA 4ZGQB 3DV8A 4OOXA 4DBRA 1N25A 1KK1A 3JRCA 3WGIA 1KTVA 1SKQA 3J81Z 1J0RA 1G59A 2P5KA 4RB1A 1U5TC 2HFHA 2R7SA 3BC9A 1JE8A 2QQ9A 5H6RA 1OR7C 3UNGC 4DZJA 4W97A 5ICCA 1O8GA 3U1DA 2KVOA 2QZAA 4Y15A 4AYBA 2EH3A 4CYCA 1B9MA 2L9RA 4URRA 3HIFA 5FO1A 1KU7A 2I5UA 3E1SA 2M7BA 1P6RA 3HRUA 3S16J 1X1AA 4Z4ZA 3P9KA 3IH3A 4J00A 2GJRA 1D8JA 4YXWA 5A2QZ 3K6GA 2V1XA 2YS9A 1YJWB 3BTIA 1DGRM 2LNBA 1IV8A 2LBFB 4A3CJ 4FN5A 4M3BA 3CCRB 5FD6A 3A02A 4A5MA 3O2PE 1MGTA 2BEOA 3CMMA 2GLOA 2D3LA 2DLLA 5A88A 3I53A 3I56I 2MFZA 1B1BA 1UFMA 3CC7I 2BVNA 2DPUA 2Q6OA 2FF4A 1NK3P 1UG2A 4NDLA 1YJNB 3BH7B 1USTA 3V7AA 1M1KD 2VFNA 3GSIA 2CH0A 4UVCA 4UY8I 1I39A 4BNCA 3M1EA 6PAXA 3RJPA 1LM1A 3JSPA 2K9NA 4FX0A 1JT0A 4AIKA 2IW5A 5KHDA 4BJ6C 4U0YA 1AKHB 4BPRA 1UD5A 3A01B 3B4NA 1DU6A 4M2LA 2VBUA 1UD2A 4U87A 2BV6A 4MTDA 1DG1G 2Y30A 1OCPA 3LNQA 1I3AA 1CLWA 2XTWA 1BQEA 4QWQA 1REPC 1DDGA 3KP2A 3BH6B 4IXAA 2NS0A 4UAJA 3JQQA 1FNBA 4LB6B 1LKXA 2GPJA 1VJSA 1MMGA 2GIZA 3OYHA 4Z03A 4XLPF 4MGRA 1EFUA 1IZ1A 1XGOA 2QBYA 3ZPLA 2GJPA 4Q7JB 1KA8A 3JRFA 2QZ8A 3HUGB 2W7NA 4ZTJA 4X7DA 2XROA 1BHEA 1A6IA 2X51A 4HF0A 1W0UA 4JRAC 5D4RA 2B5OA 5GADJ 4Z4SA 4PUSA 3MFKA 3Q5FA 2ZXWH 2DYSH 1ZAOA 2L3DA 4ZC3A 3DQVC 3A2KA 1BI3A 2CV2A 3W2EA 3VSTA 2CW5A 2J7KA 2BOLA 1GT0C 2GBYA 3LMWA 3SFIA 1WORA 3MZYA 4EJOA 5H20A 5TISC 4B8XA 1OLTA 3F72A 2EILH 1WHUA 4QTRA 3GTOJ 1R23A 5EJCA 5DS9A 2DT6A 2XF7A 4HLXA 2KRCA 1K7AA 1UD8A 5J3OA 4XLFA 1JHHA 2Z33A 4A3FJ 1WOOA 1VLYA 3D1NI 1RU4A 5E8IA 2JIZA 1QPIA 1IRGA 3ASPA 3SY2A 3GQ8A 4V2GA 3G73A 4Z4WA 2WTEA 3H3UA 5M5XJ 1PP7U 2UXXA 4G7WA 2WV0A 1ZHFA 3KEQA 2EINH 4CZZA 5HODA 2NVQJ 4PDKA 2EWNA 2ME0A 3NWSA 2VE9A 3K1NA 1HDPA 1LDDA 4G5GA 5ED4A 4MEXF 2QY1A 1O57A 4PFPA 2RN7A 2PJPA 4BE1A 3D5SC 4Q47A 1T33A 3Q3SA 4RDJA 2Y69H 1RMGA 2KIFA 3CZ6A 2VLAA 3A3GA 3DP7A 4A93J 4I6ZA 3ZC3A 3RIRA 3LFKA 5M3FJ 1GUUA 4M1KA 1UG0A 1T98A 3WXMA 4RDLA 4IL6C 4C30A 4MIMA 1MBJA 3I4PA 3JW4A 5F64A 2HQ5A 3ESWB 2KP6A 4LIUA 3G1OA 1W2BB 1O8EA 3V4GA 1D1BA 4Q5SF 5FB2A 4P1WA 2NS7A 5HXBA 2GK6A 2COMA 2HGCA 4WQMA 1W5SA 1JJ8C 4LBZA 1VQPB 3MVPA 2H1KA 2O03A 1X4OA 2E1OA 3DTKA 1YI2I 1JXSA 5B66C 4XKWA 3HOZJ 1HW5A 1VZ0A 1WJEA 3OZUA 3AVUA 4U7DA 3GQBA 1H88C 3G4SI 9ANTA 3WTSC 1Z7UA 2XC7A 1G2HA 2D45A 4OPOA 4WX9A 3U2QA 1O8HA 1R49A 5HLHA 4W8SA 2UWMA 3KP6A 1OOCA 2K02A 1HKSA 4BU2A 4XR6A 5IY5H 1QVTA 4YAWA 5A89A 2Y9ZA 1MABA 4CCLA 2QA4I 3ZP5A 1QO0D 4E70A 3SYJA 5F4JA 4TSFA 3I58A 2O7OA 2ELJA 2LSOA 2M4KA 2VXDA 3C1DA 4PSXA 4BKXA 4EM1A 3H0DA 1NDHA 3LQQA 3VSKA 3VSLA 1LFUP 4V2FA 3WTWC 5HKKA 2NTQA 2KL4A 1VBLA 3M07A 4UXNA 2R7WA 3W2AA 2DETA 1EJ9A 2ICWG 1AIPA 2IGNA 2A6TA 1FIAA 4G9YA 2CG4A 3DU1X 2IS4A 4YC5A 2OV7A 1CF7B 2P8TA 4DBQA 3TP0A 1QUEA 1V55H 1E43A 1KD1D 3NARA 3FXMA 1PP8F 1Z67A 1I6XA 1SFKA 4RS8A 5FKLA 3S3OA 3ZOBA 2X8KA 4XKCA 1LLZA 2GXGA 2C78A 4P5OA 3K4JA 4BYYA 2CYYA 3V42A 2QUFA 4A5NA 2VOPA 1A8PA 3BZKA 2R7ZJ 4IX7A 4RD4A 1OB5A 1YX3A 1VQLB 1I6HJ 4QFMA 1YTYA 3I64A 4I02A 1IUYA 4ZYDA 4BGDA 1TQIA 4AVZA 1F60A 2HOAA 2DFHA 1K6OA 1ETYA 3CJRB 5TJJA 3U2RA 3GX4X 5D8LB 3W5HA 2DOGA 4RD1A 2QEXI 3H3VK 3PO2J 4X7CA 4AF7A 1DABA 5HVQC 1H85A 3QFCA 2FUG2 3HRTA 1H0MA 4AYBN 3M7GA 4Q4ZF 3TW7A 1V54H 2CQ7A 1ITYA 4NK6A 3MWMA 3OOUA 4BAYA 5K7FA 2M4GA 2HDCA 2LY2A 3PQKA 2BM1A 2W25A 4YHBA 1WH7A 4GYIA 1VQKB 3LMMA 3HDDA 5D8KB 2CUFA 5FLMJ 1F20A 2CBXA 1PE9A 2WJYA 3IRRA 2FNPA 2K3PA 1FTZA 1Z3XA 3KE2A 5DV5A 1XGSA 2WZPP 1FNNA 2HR3A 2YWGA 2BGIA 3A8KA 3JRHA 2PMZA 1ZM4A 4RPDA 3GTGJ 2ECBA 4I09A 3M9AA 3HEFA 3RPUD 2GK7A 3VEPA 3AVXA 2IRFG 5BPIA 4IO9F 2OK8A 1DBOA 3QYFA 4XM3A 4DIQA 4XKBA 1WPKA 4CCJA 2ELKA 2XGXA 3B6AA 1B72B 4YRVA 1EFTA 5C4XJ 1WOPA 3ONUA 1ZRCA 3S32A 2RQQA 2EFOA 4HX8A 4C3IJ 1HOMA 3Q6QA 3ABKH 2FMYA 2OTLB 1TSPA 3T53B 3CCEI 2DBBA 2LC2A 3CXCB 1V5VA 2RREA 3QRFF 4A0ZA 2H94A 3V7RA 1LPQA 4LLLA 5DSZA 3ZMSA 5ICGA 3W2VA 2V7WA 2DN0A 1YRNB 4MR0A 2PBIA 2W6IA 2ZZGA 1TNTA 2VL8A 3U9GA 4LG3A 1E3XA 5IOZA 3E1YE 2NV4A 2ZBVA 3GO5A 2FU4A 4YIRX 4XICA 1HZEA 3BLYA 5EZHA 5AMVA 2M1BA 1VQ6B 4WXDA 3SZGA 2DY1A 1TYWA 4KKSA 1OCCH 2JRTA 3PSFA 5THXA 2R7OA 1BI0A 4F92B 4LC0A 2AHQA 4JYKA 1ZR2A 1FYMA 2F5VA 4JX4A 1T6YA 3RYPA 1SD4A 3JURA 3M8EA 3HOVJ 3JCUC 2DO7A 5E8GA 3CD6B 3G6EI 1H89C 3OS2A 2QGUA 1ZUNB 1RNLA 1Y6IA 3BG5A 1BW5A 4ENJA 1QA2A 1YLFA 1LLWA 1E64A 4YFNF 1W34A 2CK3A 3S1QJ 3CRZA 2FBHA 2WJVA 3AG3H 1W7PA 2LF8A 1K8FA 2J5OA 5HS7A 4XN3A 1OFDA 5DM6F 1SAXA 2VBZA 4UV9A 2Z99A 2VJIA 1T38A 1J9IA 1S0UA 2HU9A 2NS8A 4GXOA 1OB0A 3HOWJ 3IHUA 5GAHJ 2STWA 1MMDA 3RQ4A 2IT0A 4OPSA 3NB2A 2QDXA 3FDYA 1OHHA 5EDNA 3OPOA 1NK2P 1TWCJ 2WAQA 3J80K 2HYGD 4II3A 2VB6A 4QSHA 1VQ8I 1N06A 5A8AA 3K7AJ 1I1GA 2CUEA 1KRHA 2XF5A 4YAUA 2O0VA 3FY3A 2L54A 2XGCA 1HW2A 3CMEI 3E6MA 4NB5A 4RB0A 4D9JA 4KT5C 4G6DA 1LE8A 4TMWA 3ZBUA 1FYLA 3PUMA 3K4KA 3ZZUA 3VYSB 2V5IA 4A0YA 1RRJA 1CNEA 5FA6A 4LB5A 4ANJA 5IOYA 3K9TA 5FRNA 3S15J 1B2RA 4UZUA 1BJZA 1VQNB 3TGNA 3NAWA 2QKLB 5CQEA 1FT9A 4WZTA 5C3EJ 2P6TA 3J81K 3I0TA 1XMKA 2W6JA 3BCAA 4A69C 5HLTA 2KIQA 3K70D 1U0JA 2H8WA 3CP8A 2KIUA 1RZ4A 2ZO4A 1W0TA 4LK1F 1TWHJ 3WU1B 1O3TA 2P6SA 1ZQ3P 1WQ2A 1Z77A 1K4ZA 1HC8A 1RPWA 3FXJA 3LVBA 3VNVA 2VC0A 2BMWA 3MEXA 3WG7H 1S3JA 4YAFA 1XDUA 1U2WA 2CFXA 3FXRA 4KDPA 2VBEA 2FQ4A 2BY3A 3TMOA 2B7BA 1LVKA 2P7VB 3H5NA 5DUKA 1WSUA 2FJ1A 2HWVA 3EUHC 4RMNA 2M8EA 4I01A 3KLOA 4BDYA 5L3EA 2OBPA 3WYAA 4D0PA 3OOPA 4XSXF 2QSGX 2VYQA 1W9XA 5GPCA 3GMEA 3H9JA 3S8PA 3B78A 3CB4A 5E6TA 3VMVA 1W87A 1GR1A 2R7UA 3S1RJ 5DEQA 1IJWC 2XSJC 4FETA 3FWEA 3H9QA 3GXOA 5D6FA 2DMQA 3MMYB 3W2HA 4HA8A 2EIJH 2BM6A 4EW9A 3H35A 2KT0A 1R1VA 2ME6A 3P9CA 2A3SA 4ZZLA 4ZTFA 3CCLB 1D3YA 2Q0OA 1LFPA 2ZFUA 3K70C 4IPAA 1PUFB 2X3HA 2HS5A 1KQ9A 3HKZN 3ELKA 1Y8RB 2CUZA 3ZR8X 1B4AA 3S1MJ 1M90D 1W1WE 3V8KA 1FLIA 3U6BA 1VQ9B 4AIJA 1XMXA 1HW1A 5FLXZ 1HF2A 2BN4A 1BIAA 1QH0A 4LG0B 3MKZA 2YSRA 4IKFA 1LDJA 1Q86D 4AF6A 3PNVA 3CJTB 4MLOA 4RBOA 3WNBA 1KU9A 1D8TA 3FHNA 3CF2A 2PMHA 3TOBA 3FPKA 1QHGA 4TKOB 2XZOA 2VFQA 2LH9A 2ZSIB 2MYSA 2R6HA 4JX5A 1L1IA 4B47A 3P5JA 3D5LA 3E0JB 2XZPA 2CSOA 3B8YA 2VT3A 2G7HA 3BG7A 1JKOC 4PABA 4XRSG 1TYVA 2N8GA 4KYWA 5LLQA 1Z21A 1VQ5I 2ZBKA 5ILUA 1E62A 4A3IJ 1ZM3A 1R1TA 3T8TA 2JDIA 1TW3A 4A3BJ 3W6JB 4D7NA 5IYBJ 1EV7A 3AAFA 1IGNA 1WOSA 1IB4A 2NT6A 1WVRA 2F43A 3K4LA 2QM3A 1Y56A 2VBKA 4Y4RA 5FKOA 3UW0A 1BIBA 1BOAA 3P4GA 1YITB 2O0YA 4Y9UA 3PUBA 2IS1A 3OP1A 2JPBA 4B3GA 2MW8A 4BY7J 4G8XA 1E3OC 5B6IA 3LJYA 4LBWA 4G7HF 1E0EA 1ZRFA 2ZFWA 1X1PA 1MMAA 3BY1A 4UHTA 5F27A 1B8IB 3Q0UA 3BQZA 3B82A 3DU5A 2YX4A 3E6BA 4I84A 4E7SA 4G7XA 3IH4A 1R4NB 5F04A 3PA1A 4B3XA 4EM0B 1TYXA 3S17J 3O8HA 4NK8A 1K78B 3BTJA 5KAIC 3K4MA 1TC3C 2VJJA 3CJQB 4HX7A 3W5VA 1NG7A 2CWEA 1O8DA 1AA7A 1UCRA 3H94A 1ZLJA 5ERIA 1X1CA 2V7XA 4ASNA 2EB7A 2CRGA 3JSOA 2OTJB 5E79C 4EV0A 5EZGA 2Y0SN 3CUQA 3KPHA 4A6EA 2FA5A 1WI9A 4UB6C 1P4AA 1OQYA 4WXCA 1WXRA 5D5UB 1S7AA 5E1WA 5E17F 2M3AA 3MQ0A 2QN6A 4XOPA 3J7ZI 4A3GJ 3F6OA 3KZZA 3VPRA 2R7XA 1DP3A 3DBHB 2BXYA 3DLAA 2ACJA 2K9QA 5HNHA 2C2WA 1UD6A 3HOTA 5GAGJ 1AIRA 3R6JA 4L9VA 3JRDA 4RA2A 3VOEA 5LD2C 1UHWA 2O9LA 3GVJA 3KP3A 1X4PA 4L8JA 1FPQA 2G0YA 1TP4A 2ZL6A 1YS7A 2LOOA 4IQJA 4J0QA 2VIXA 2PQ8A 3PFIA 2V9PA 4HNTA 3BPVA 3CCUI 3MKLA 1OISA 3AG1H 4IHXA 5FRMA 3PVDA 2M2EA 3J81k 3L7WA 3OYIA 3ASRA 2FMLA 2XUBA 2QE7A 3LFUA 2F5EA 1NH3A 3AL0C 2BE5F 1N07A 3HSEA 2G7UA 2CUJA 3HTUA 2CW8A 2HXIA 1VQ7B 3NWTA 4NNJA 1TYUA 4ITVA 3GVLA 2PMUA 2DIEA 2RNJA 4M3FA 3MMPA 4P12A 4B43A 2PN6A 1FBUA 3WE3A 3ML6A 5BPDA 3AVTA 5DDGA 4EJUA 3CC4I 3SZPA 4ZJZA 1XQBA 4OJLA 2GIVA 2JSPA 2VKHA 5GTIC 1W5TA 1U9OA 2EV0A 1EFRA 3W6VA 2K7LA 4RM3A 4CCKA 4OMYA 1D0XA 3R61A 2BM7A 3QPSA 4KT6A 1VHOA 4LK0F 3RKQA 3N4MA 4CCOA 3BY2A 4PC7A 1S29A 3WTZA 2MLKA 3CCVB 3BH4A 3OOCA 4BS9A 2R5YA 4DQ2A 2ID3A 1S7EA 1IV6A 2AQEA 1YJWI 1OCTC 1X2NA 2VNJA 4OAYA 1UHSA 3CDLA 2JVHA 2W82A 4KIFA 5E18F 1XGMA 5IP6A 3CCRI 1OFEA 4HSTA 3RZDJ 2CQNA 3E6DA 2X1DA 2AXTC 5D5XB 1IN8A 4M3DA 1I8DA 4FWTA 1SM4A 3DPLC 4JK1X 4YAOA 4YFOA 1YS6A 3OJXA 1YJNI 4P6YA 1Z7LA 1ETXA 4BJ5C 2OAZA 3U21A 4UZFA 1GAWA 2BW3A 3ZBTA 4OIOF 2WA0A 3BT9A 4IRHA 2P5LC 2PX9A 1JHFA 2LF7A 4KIGA 3V8LA 1HF0A 2IGOA 3DU6A 4E6KG 1BBYA 2RDPA 3MD2A 4A6DA 2F1MA 3F3XA 4I0AA 4OAZA 5J1YA 5FO5A 4KA4A 4YFKF 1IDYA 1UB9A 3BWGA 5H6QA 2HZTA 2RV8A 5CVRA 1QUFA 3ZPNA 1KU2A 5K5RA 2MABA
chains in the Genus database with same CATH topology
2X6WA 3SUCA 2VLAA 2O5RA 3A3GA 2UVEA 2VQGA 4CSWA 2VXZA 1XG2A 3ZCOA 4E4HA 5CQGA 1PLUA 1JRGA 1WJCA 2XGJA 1UG0A 1V5FA 4C2LA 3AL0B 3QYBA 4C30A 4FXUA 3OL4A 1V0EA 4HIZA 3S3MA 3RTRA 1SAUA 3S3NA 4W8TA 3BCFA 1BR4A 2KP6A 4LIUA 1X1DA 2CV1A 1O8EA 2V7FA 1D1BA 3I3LA 1D0YA 2HZDA 4P1WA 3A3BA 3EUKL 4DK0A 2GK6A 1ZELA 1H8HA 3OYMA 1X4OA 3DTKA 4HEA2 2CW7A 4XKWA 4Z1MA 1VZ0A 1WJEA 3L2WA 3HG9A 2R7TA 3GQBA 4E0FA 2M7AA 2XC7A 1O8IA 3OYFA 1KCCA 5CDFA 1O8HA 3SEZA 2GOMA 2L9NA 4BEHB 2HVQA 4HSRA 3S93A 2V4JC 3H5AA 1P9QC 2F6CA 2UWMA 3IP4B 4HNUA 4BU2A 4XR6A 1FMVA 2KPMA 3OIPA 2BW3B 3EPZA 1MABA 4CCLA 4TSFA 3SEQA 3G05A 2JVGA 2VASA 2ELJA 2RNGA 2M4KA 2VXDA 4XMYA 4PSXA 3H0DA 2R7RA 3K4NA 3VSKA 3VSLA 2ZZEA 1HG8A 2V26A 3T56B 5HKKA 3RSNA 2KL4A 1VBLA 4YEJA 2NTQA 1IA5A 2R7WA 3W2AA 1BPLA 3ZSCA 4F91B 4JQFA 2IGNA 4GRIA 4EATA 2A6TA 3OYAA 1ERDA 2IS4A 1WJAA 3PL8A 2DJIA 3OYBA 2OV7A 2QKMB 4DBQA 2E1MC 1R6RA 3VYRB 2NOJB 4KISA 1E43A 4B44A 4OJPA 1O8FA 2WAEA 2IGKA 1SFKA 2V9KA 4CA0A 4BE0A 3S3OA 2X8KA 3GBGA 4XKCA 4JOMA 1MW7A 4P5OA 3K4JA 2XF6A 2VQLA 2XNDA 3V42A 2LY1A 1N75A 2BVMA 1TT0A 4PSWA 4IX7A 2I8DA 1YX3A 2OUMA 3OAAA 3DPTA 1FX0A 3VSUA 4BGDA 4AVZA 3CESA 1G8XA 4CUGA 4G6TB 1IDKA 2JJ1A 3PNYA 3CJRB 4PJLA 2HPIA 4XQFA 3OYDA 3KYLA 4PFOA 5HVQC 4E7HA 2FUG2 4OWRB 3OEHA 2BSPA 2VJ5A 4OZYA 4D1QA 1X0CA 4BACA 4BQQA 3OOUA 1NRKA 1W36D 2L5QA 2M4GA 3D5RC 1D0ZA 1W0JA 3GRHA 2LY2A 3OWTA 2Q2EB 2VQCA 3LMMA 3I9V2 3KEYA 3MKWB 3PNTA 1PE9A 1OGOX 2E5NA 3KRGA 5CKTA 1PKVA 2WJYA 4BDZA 3OS0A 4XORA 1VF7A 2K3PA 3QODA 1Z3XA 2PECA 3PFYA 3GVKA 3H9GA 2WZPP 4R79A 4BUPA 4E7KA 2DT7B 1NG6A 3OYKA 2PMZA 2Z16A 4G6IA 4HWVA 2ZXIA 3LSMA 4BEHA 4ZDOA 3UR3C 3RPUD 2GK7A 2ZTNA 4XONA 5C1EA 1DBOA 1KTWA 1BR2A 3QYFA 2CFOA 4XM3A 4DIQA 4XKBA 3H5RA 3FBIB 2IQ7A 2O04A 3LSGA 4CCJA 4OJ6A 1GQ8A 2V4DA 1NHCA 2O0WA 4YRVA 4LIVA 4C2UA 4DNRB 3WWGA 4J01A 4Y33A 4C9YA 4CCNA 4U49A 1UELB 3S32A 2RQQA 1W36C 1JI8A 3OYGA 2LYCA 3OR2C 2Z2SB 3T53B 2INUA 3M1CA 2LC2A 2WPDA 2RREA 1I18A 4DNTB 4W8SA 3L2QA 1COWA 1T5EA 1WFXA 5TGTA 1BMFA 2PJRA 1WJBA 4Y3OA 3W2VA 1OOCA 2NSPA 3GQ9A 4MR0A 2X6XA 2W6IA 2ZZGA 2NTBA 2VL8A 4LG3A 1K6YA 3KX2A 1E3XA 3DDYA 1HA8A 1HZEA 3GQAA 3BLYA 2KMUA 1V0FA 2WB1A 4XL9A 3L2VA 3SZGA 4JMQA 2DCEA 4KKSA 3PSFA 4IQ4A 2IXSA 4N4NB 4U7BA 2NT9A 1Z3YA 2R7OA 4F92B 2CMPA 2A5WA 2F5VA 4IZZA 3FKSA 4OZZA 1MMNA 1YE9A 3A4CA 3JURA 2CV0A 4XKVA 3OYCA 2HVRA 2R4GA 1UD3A 4XLEA 3OS2A 2VKDA 1O8KA 3BG6A 3BCBA 2E5ZA 1Y6IA 3DEEA 3K4BA 1SKYB 3MKYB 5HOOA 2HQAA 2CK3A 2P0WA 1O88A 1QU3A 2WJVA 5IK2A 2V6EA 3W3CA 2INVA 3C2HA 2VQHA 4XN3A 1QCXA 2QX3A 2PYHA 2VJIA 3K4CA 3G2BA 2HU9A 2OC6A 4BJTA 3ZIAA 1W0KA 2BVLA 3HKZA 1PJRA 1OB0A 3HXLA 2X1CA 3VYTB 1MMDA 3RQ4A 2E1BA 4YZ0A 2NTPA 2AQFA 3FDYA 3ZGKA 1OHHA 3OPOA 1BOBA 2WAQA 4II3A 2VB6A 1TZLA 2W4SA 3DWLE 2PJRB 3FPPA 1BN8A 2Z1DA 2XF5A 3AKZA 5KCMA 3FKJA 2O0VA 2UVFA 3FY3A 4D9JA 3L2RA 4KKTA 3K4KA 3L2UA 3VYSB 2XOKA 3HPHA 3VR6A 2ODLA 5HNFA 3T51B 3OYEA 3VSVA 2LG4A 4ANJA 4OJOA 4NUBA 5FRNA 1KCDA 4UZUA 4DJAA 3HPGA 4NC8A 4E7LA 1DBGA 4ZDPA 2W00A 2QKLB 5CQEA 2MD0A 4E7IA 2EWEA 2WY8Q 3OFNA 3NE5B 2ZZFA 2W6JA 3VDXA 3T9GA 2DXIA 2WBMA 3BCAA 5HLTA 3TBIA 3K70D 1U0JA 1E3ZA 3CP8A 1WPCA 5AMVA 1V5GA 2E60A 1EA3A 4II2A 3OEEA 1H80A 4NQWB 5C1CA 2KZVA 4E7ZA 2R7VA 3VYUB 4HPQA 2XZLA 1K5CA 4FASD 3IAS2 3OR1C 2VBEA 3SYTA 1RWRA 1X19A 3TMOA 1LVKA 3H5NA 3HC7A 4BE2A 2PYGA 1K28D 1PXZA 4RMNA 3EUHC 2K9MA 4AU7A 4BDYA 4PMHA 3IUOA 1WJDA 2KRHA 1IDJA 1W9XA 3C2GA 3AFHA 3H9JA 3S8PA 4PJNA 2JJ2A 2M5SA 3VMVA 4GQNA 2R7UA 1LDKB 3F9KA 2XSJC 4FETA 3B90A 3H9QA 1V5EA 3OS1A 2HDWA 1WJ5A 4RLFA 2IS2A 1WP6A 3MMYB 4KKUA 3A35A 4DK1A 4EW9A 3H35A 3HL2A 2Z6BD 4ZTFA 2X3HA 2ZFUA 1LFPA 3EUAA 3K70C 2R9VA 2WSSA 1BR1A 2GJKA 2ZXHA 4F93B 4F52A 2CUZA 3ZR8X 2KLOA 2Y0SA 1CZFA 1MNDA 2KQRA 4QPQA 3A1YA 2HLDA 2ZSHB 3MKZA 4IKFA 4C2TA 3PNVA 4KJZA 4MLOA 4PJJA 4XLHA 3ZXSA 3FHNA 3CF2A 4TKOB 2JA2A 3ZQQA 1QHGA 4RLQA 2XZOA 2LH9A 2V1NA 2MYSA 2ZSIB 4B47A 2XZPA 3D5LA 3E0JB 3B8YA 2UV1A 4F55A 4YELA 3BG7A 2XDVA 2M0MA 1Z21A 3KEWA 3OW7A 5FROA 3TL4X 4PJMA 5JHFA 3ZPPA 2UUZA 3QYEA 3M8JA 2QXZA 2JDIA 3LL7A 3HOSA 4ZDLA 1IB4A 2LBFA 2F43A 2NT6A 2ZTGA 3K4LA 1EE6A 2ZZQA 4XNFA 1JTAA 1Y56A 1WTHD 2VBKA 4Y4RA 4H4KC 1NBMA 1OFLA 4BQNA 2LZJA 3UW0A 4DOZA 1O8LA 1HVXA 3ONQA 3PUBA 2IS1A 1S9HA 5DN6A 5FL7A 3DPUA 1GLNA 1BLIA 4B3GA 4Z05A 3BCDA 5LFAA 1E0EA 4KITB 2V31A 1MMAA 3N05A 2X1EA 4RM2A 4QPOA 2L2OA 1N77A 2V7QA 4XD7A 4P22A 3DU5A 3OYJA 4I84A 4E7SA 4DBRA 2KHMA 3ZRGA 4G7XA 1MNEA 1DGWY 4B3XA 1G59A 3BC9A 2HNHA 1O8MA 2NSTA 4NK8A 1T0FC 2R7SA 1OR7C 2CS3A 3UNGC 4XOTA 1O8GA 3K4MA 2VJJA 1WJFA 3CJQB 1DQUA 2JUGA 2KVOA 1NG7A 1O8DA 4AYBA 1AA7A 2R7QA 3H94A 3CP2A 1X1CA 3OY9A 4URRA 4B48A 3E1SA 2K9LA 3OL3A 2M7BA 4XLCA 1X1AA 4BQOA 4J00A 3OMYA 4W8RA 3K10A 2GJRA 1OGMX 3LSHA 4YXWA 1UAAA 3K6GA 1O8JA 1DGRM 4CCMA 2LBFB 2WADA 4OJ5A 4XLAA 1QJVA 2M3AA 3EQNA 2Z8GA 3CMMA 4XOPA 2D3LA 3J7AY 2X85A 4XN0A 1KZLA 2MFZA 2O17A 4TT3A 2R7XA 1DP3A 2XAUA 3DLAA 5HNHA 1D1CA 4NC7A 2HVSA 1UD6A 5CPRB 3HOTA 1AIRA 3GQ7A 2CH0A 5LD2C 2L9SA 4BL0B 3PSIA 3GVJA 1X4PA 4L8JA 3PJRA 4YZXA 5KHDA 4BJ6C 1UD5A 2LOOA 4IQJA 2VIXA 3B4NA 5KNLA 3OYNA 4HNTA 2IS6A 1KMHA 3DTEA 1UD2A 2KDOA 4U87A 3OYLA 1IRXA 5FRMA 3OIQA 1N78A 3OYIA 2DOAA 2QE7A 3LFUA 3AL0C 3BC8A 3HAGA 1LKXA 2L7KA 1VJSA 1MMGA 2CUJA 3OYHA 2CW8A 4Z03A 3NWTA 2F4IA 4NNJA 4ITVA 3GVLA 2MC4A 2NZMA 4W8QA 3WQZA 2DIEA 2WY7Q 1KONA 3LSKA 2GJPA 2LRDA 3DKXA 2MABA 4B43A 1PYVA 3VWBA 2O1DA 1E1RA 4Z06A 4ZTJA 3HUGB 2W7NA 4ZYAA 4U4BA 2IGMA 2K5CA 2X53S 1BHEA 4F3QA 2X51A 4ZJZA 4OJLA 3FBNB 4E7JA 4MXNA 2JSPA 2VKHA 4PUSA 3SDBA 4ZC3A 1EFRA 3DQVC 3A2KA 4RM3A 4CCKA 1D0XA 2CV2A 3VSTA 4KT6A 2HPMA 2BOLA 4X0GA 3JU4A 2X6YA 3LMWA 2Q1ZB 2WAFA 4CCOA 1QHHD 2GOXB 3BH4A 3OOCA 4BS9A 1H8EA 1OLTA 1FMWA 2AQEA 4HG2A 4OAYA 1J09A 2DT6A 2JVHA 2KRCA 2W82A 2LREA 2XF7A 4CZCA 2D3NA 1UD8A 4HSTA 1X1BA 3EQOA 4XLFA 1E79A 2X1DA 1I8DA 4YZAA 4PK4A 4ASUA 3LNNA 2W1OA 1VLYA 1D1AA 2VJ4A 1RU4A 2JIZA 3DPLC 1YX5A 3DKYA 3DTIA 3GQ8A 3VMWA 1E1QA 2VBMA 3OE7A 1Z7LA 4G7WA 4BJ5C 2VPLA 3W2WA 4DGWB 1WMRA 3U21A 3QOEA 2BW3A 1T95A 3NWSA 2WA0A 4CH7A 4BXFA 4B3FX 3LSIA 2F1MA 2IGOA 3DU6A 4E6KG 2QY1A 3MD2A 4HRIA 3IAM2 4PFPA 4OAZA 4NK6A 4BE1A 1OFMA 3D5SC 1UD4A 3RCOA 4LITA 4YZQA 4N4OB 3ZPNA 1RMGA 2E1MB 3CZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6W A;  3SUC A;  4XLC A;  4XOR A;  2UVE A;  5AMV A;  2PEC A;  1H80 A;  4W8R A;  1XG2 A;  1OGM X;  1PLU A;  1JRG A;  5C1C A;  1O8J A;  4HWV A;  4C2L A;  4OJ5 A;  1K5C A;  4XLA A;  1QJV A;  2VBE A;  1RWR A;  3EQN A;  2Z8G A;  4XOP A;  4XON A;  4W8T A;  5C1E A;  2X85 A;  4XN0 A;  1DBO A;  1KTW A;  4XM3 A;  1PXZ A;  1O8E A;  2O17 A;  2IQ7 A;  2PYG A;  2O04 A;  4OJ6 A;  4PMH A;  1GQ8 A;  1NHC A;  1AIR A;  1IDJ A;  2O0W A;  3GQ7 A;  3WWG A;  4XKW A;  4U49 A;  3VMV A;  1O8I A;  4YZX A;  3B90 A;  1KCC A;  1O8H A;  2INU A;  4EW9 A;  3B4N A;  4W8S A;  1OOC A;  2X3H A;  4XR6 A;  1PE9 A;  2NSP A;  3GQ9 A;  4MR0 A;  2X6X A;  2NTB A;  1CZF A;  4XMY A;  3GQA A;  4XL9 A;  4Z03 A;  4XLH A;  1HG8 A;  2NT9 A;  2NZM A;  4W8Q A;  2NTQ A;  4OZZ A;  1VBL A;  2O1D A;  4YEJ A;  1IA5 A;  4Z06 A;  3JUR A;  3ZSC A;  4XKV A;  4U4B A;  3B8Y A;  1BHE A;  4XLE A;  1O8K A;  4YEL A;  4OJL A;  4MXN A;  3ZPP A;  4OJP A;  1O88 A;  1O8F A;  2QXZ A;  3VST A;  2INV A;  2X6Y A;  3LMW A;  4XN3 A;  1QCX A;  1IB4 A;  2QX3 A;  2NT6 A;  2PYH A;  1EE6 A;  2VJI A;  4XNF A;  1JTA A;  2VBK A;  1OFL A;  3UW0 A;  1O8L A;  3EQO A;  4YZ0 A;  3VSU A;  4XLF A;  2NTP A;  4AVZ A;  4YZA A;  1IDK A;  3T9G A;  1BN8 A;  1RU4 A;  4Z05 A;  2O0V A;  2UVF A;  4XQF A;  3FY3 A;  3GQ8 A;  3VMW A;  2VBM A;  1WMR A;  2ODL A;  4I84 A;  2BSP A;  4OZY A;  3VSV A;  1X0C A;  4OJO A;  2NST A;  1O8M A;  4NK8 A;  1KCD A;  2QY1 A;  4XOT A;  1O8G A;  2VJJ A;  1DBG A;  3GRH A;  1O8D A;  2EWE A;  4NK6 A;  1OFM A;  4URR A;  4YZQ A;  1RMG A;  1OGO X;  3KRG A; 
#chains in the Genus database with same CATH topology
 4GCV A;  3D0S A;  2O5R A;  4FHT A;  1WKM A;  2UVE A;  5J8C A;  2VQG A;  2VXZ A;  3IV5 A;  1R5G A;  3VMF A;  1PLU A;  2OJE D;  1Y39 A;  1RUO A;  3TDU C;  5IYR A;  5CVI A;  3HSF A;  3T0Y A;  3NEU A;  1YOV B;  2KIM A;  4C2L A;  1OPC A;  4RDU A;  2XAG A;  1P92 A;  5HDN A;  1BL0 A;  1V0E A;  1J9Z A;  1VLO A;  2DCU A;  3RTR A;  1RQP A;  1NJI D;  3KP7 A;  2QQ8 A;  1BR4 A;  2EZH A;  3B02 A;  4A3E J;  4Q48 A;  4P2N A;  2V7F A;  5DCF A;  1RQR A;  2HZD A;  2R5Z A;  5IYW A;  3EUK L;  1ZEL A;  3T8R A;  1FRQ A;  1TTT A;  3OYM A;  3T1B A;  1QGP A;  2CW7 A;  3KZI C;  3TED A;  2E2I J;  1KYZ A;  3CCY A;  2M7A A;  1OGI A;  1TTY A;  1P4M A;  1O8I A;  3OYF A;  4HBL A;  4EJV A;  5CDF A;  3AVV A;  1KCC A;  5CJ9 A;  2GWR A;  2L9N A;  4RCZ A;  2HVQ A;  2IPQ X;  4OU0 A;  2BV3 A;  1Y8Q B;  2HOT A;  1QA6 A;  1FMV A;  2KPM A;  2OQG A;  3GTL J;  3TP3 A;  3ZMD A;  3R0J A;  5K5O A;  4B09 A;  4HNV A;  3MN2 A;  2V1U A;  1X3U A;  2JVG A;  3G05 A;  4XRS A;  2ZME A;  4R1H A;  4PAA A;  1MSE C;  2NAZ A;  1TWG J;  2Z9O A;  2DER A;  4OPW A;  2MC3 A;  4L9N A;  3PEN A;  1MBH A;  2V26 A;  5IYP A;  1T6Z A;  4CO8 A;  2NNY A;  3T56 B;  4M53 A;  1GVJ A;  4YEJ A;  3GTP J;  3FX3 A;  4U0W A;  5IT3 A;  2Y48 A;  1YHQ B;  4UUV A;  2Q2E A;  4F91 B;  4JQF A;  2XPW A;  4S04 A;  1ERD A;  4NC6 A;  4WK8 F;  1WJA A;  3PL8 A;  3OYB A;  3UKG A;  3H92 A;  1R6R A;  2PLY A;  3VYR B;  3ZQF A;  1JA1 A;  2NOJ B;  4IJA A;  4BHB A;  3BTC A;  2H8R A;  3AVW A;  2WAE A;  1O8F A;  3TDZ C;  1MDM A;  4OJP A;  4CA0 A;  4PGG A;  4AUX A;  2KJC A;  2VZL A;  3JRB A;  4FIS A;  3B73 A;  3X2Q H;  3EYI A;  2XND A;  2XF6 A;  2VQL A;  1FTT A;  2LY1 A;  4G94 A;  1BI1 A;  2BVM A;  2H6B A;  4FT8 A;  5DYM A;  1TT0 A;  1WCM J;  3OAA A;  2I8D A;  2OUM A;  3RQI A;  4EQQ A;  3KZY A;  4RB2 C;  5AN9 A;  1QQ1 A;  5LRR A;  5LGT A;  5JLV C;  1OCO H;  1UZC A;  1T56 A;  1IDK A;  3PNY A;  1VI0 A;  2HPI A;  1W7P B;  3PSS A;  3LA7 A;  2CQK A;  1VQP I;  2ZKZ A;  2XPV A;  4AIH A;  3I71 A;  5AIQ A;  1RIO H;  2HCJ B;  2VBX A;  3LO8 A;  1ENH A;  4PFO A;  2XGE A;  1ODD A;  4MFD A;  4OWR B;  4E7H A;  1ZLK A;  2VJ5 A;  1QGY A;  3OEH A;  4DNC A;  1X0C A;  3VB2 A;  1PUE E;  4GDF A;  3GF2 A;  3AGQ A;  4BQQ A;  4EH1 A;  3KET A;  3NQO A;  2LLK A;  2MG4 A;  2L5Q A;  3OFN A;  1D0Z A;  2MD5 A;  1P7J A;  5B5E C;  4FTH A;  3OWT A;  5GP9 A;  5JHU A;  4YAL A;  4AC0 A;  1YIO A;  2STT A;  3KEY A;  5HLG A;  3MKW B;  4PCQ A;  3PIO F;  3FXQ A;  3WBJ A;  2FBK A;  5J1R A;  4UUS B;  2VBT A;  3JR9 A;  4XOR A;  1VF7 A;  1GV2 A;  3GVK A;  2DA3 A;  1W7P D;  3I59 A;  4R79 A;  4BUP A;  2PEX A;  1OYW A;  5FLV A;  1JUS A;  3FF5 A;  3OYK A;  4EGY A;  2P81 A;  5EYR A;  2IP2 A;  3MHP A;  3HHG A;  3ASO H;  4A12 A;  3E97 A;  1XFO A;  4G6I A;  1YYV A;  2ZXI A;  3KL9 A;  2BX6 A;  1JT6 A;  1OYI A;  1MNM C;  2QTL A;  2ZTN A;  4XON A;  4HAM A;  1KTW A;  2D1H A;  1BR2 A;  2XAQ A;  2CFO A;  2IQ7 A;  2O04 A;  1HDD C;  1L0O C;  3CLO A;  3TKY A;  1Q81 D;  1GXP A;  1ZRE A;  1OYY A;  4LIV A;  4BY1 J;  4C2U A;  2E19 A;  4J01 A;  3JAM Z;  1TUI A;  2OZU A;  4U49 A;  2XNC A;  4A2U A;  1JI8 A;  2DFI A;  4HW0 A;  1S72 B;  5LHH A;  1FBQ A;  5LHG A;  1FOY A;  1B23 P;  2YU3 A;  3WTX C;  2QMU A;  1KC8 D;  1RC9 A;  2OK7 A;  2NST A;  2X4H A;  1VQL I;  2XT2 A;  1T5E A;  4HV5 A;  1WFX A;  1YW7 A;  4MEY F;  1R36 A;  4Z4T A;  3Q6R A;  1AMO A;  4AWX B;  4PJ0 C;  2VKV A;  2NTB A;  1RET A;  4X1E A;  2XVC A;  1K6Y A;  5L3C A;  2V7V A;  2EFW A;  2XB5 A;  1N0U A;  1QVF B;  1TWF J;  4I98 B;  4PGH A;  3ZZ0 A;  5DCM A;  2H27 A;  5FKN A;  3GQA A;  1XB4 A;  2R7D A;  3F8B A;  1ZAR A;  1V0F A;  2H1L A;  3L2V A;  3ECH A;  1ZH5 A;  1ZN2 A;  3CUO A;  1VTN C;  3I1F A;  4IQ4 A;  3A03 A;  2IXS A;  2NT9 A;  1Z3Y A;  3A8J A;  2A61 A;  2CMP A;  2A5W A;  5E20 A;  4IZZ A;  3FKS A;  4OZZ A;  5FLX K;  3A4C A;  2EK5 A;  4IF4 A;  1OJL A;  1R5I D;  4XKV A;  2PMD A;  1YJ9 I;  1QFY A;  4XLE A;  3I4M J;  2DOE A;  3GFL A;  4RLZ A;  2MSY A;  1FWZ A;  3HZJ A;  3K4B A;  4M9X A;  1SKY B;  3E20 A;  1VQK I;  1N05 A;  2TCT A;  3ZQG A;  1O88 A;  1QU3 A;  4IW3 B;  4HOB A;  1TL8 A;  3HRM A;  2GA2 A;  1RR8 C;  2QX3 A;  2H09 A;  2HOE A;  2DFE A;  4QVJ A;  3G2B A;  3FM5 A;  5FKK A;  4BJT A;  2DU9 A;  2NVY J;  3HKZ A;  1PJR A;  3ERE D;  4MYT A;  3HXL A;  5EEA A;  2ISZ A;  2E1B A;  3CCS I;  1FC3 A;  5L3G A;  1XN7 A;  3A1P A;  1FOK A;  2NTP A;  2AQF A;  3B8H A;  2F4O B;  3G1M A;  3IC7 A;  2Z3Y A;  1DDI A;  2W4S A;  2HI3 A;  3DWL E;  2PJR B;  1BN8 A;  3QOP A;  4X8I A;  5KCM A;  3FKJ A;  1YW8 A;  4O3M A;  4ACB A;  2UVF A;  3F8C A;  1APL C;  1Z05 A;  3CO7 C;  4MO7 A;  3PO3 J;  4KKT A;  3NRV A;  4OP7 A;  2PG4 A;  3VR6 A;  2XOK A;  2EA2 A;  3WTY C;  3FXL A;  2OTL I;  3VSV A;  4KMF A;  1IXS B;  1B59 A;  1U5T A;  2M8G X;  1OR7 A;  1KK0 A;  4D7M A;  2AS5 F;  4DJA A;  3HPG A;  4E7L A;  1XDS A;  4ZDP A;  1KJZ A;  4NBS A;  2W00 A;  1K9M D;  1EZG A;  2MD0 A;  3RPQ A;  5F0C A;  1LNW A;  3C2B A;  5B1A H;  2BZT A;  2ZZF A;  3NE5 B;  1I50 J;  1G6N A;  3F8F A;  4WXH A;  2DXI A;  2WBM A;  2BM4 A;  3BQJ A;  3ABM H;  5EG0 B;  1JKP C;  1BC8 C;  1I27 A;  1V5G A;  4Y7N J;  1IHM A;  3PET A;  4ZH4 F;  3M3Y J;  3OEE A;  1VQ6 I;  3WU2 C;  4AVP A;  3GZ6 A;  4NQW B;  5CYV A;  3TW6 A;  3PM1 A;  4E7Z A;  2R7V A;  2ZC2 A;  3RKX A;  2ZNZ A;  2XV4 S;  1K4S A;  3F8M A;  5M5W J;  2XZL A;  3C3W A;  4DYQ A;  1RI7 A;  2QYU A;  3IAS 2;  1K5C A;  1ETK A;  4NBQ A;  3SHF A;  3SYT A;  5CVJ A;  5JVT A;  3CPX A;  5LMZ A;  3BJA A;  2EFG A;  4BE2 A;  1PXZ A;  1QZZ A;  3BZC A;  1YIJ B;  3LAP A;  1WJD A;  2CJJ A;  2JPC A;  1IDJ A;  1QA1 A;  3VFZ A;  3C2G A;  4ESB A;  4LGW A;  4EEF G;  2BSA A;  3OKX A;  2JSC A;  4GQN A;  1LDK B;  3QFT A;  2G0E A;  3OS1 A;  4RLF A;  1WJ5 A;  2IS2 A;  1AU7 A;  1WSR A;  2HKX A;  3K0L A;  1WP6 A;  3VOD A;  1MBK A;  1T2K A;  1MRZ A;  3HL2 A;  4IHV A;  2Z6B D;  2DYR H;  3EUA A;  2F2E A;  4HV6 A;  3WE2 A;  2WSS A;  5F6F A;  2ZXH A;  5L46 A;  4OIN F;  4F93 B;  3ZQL A;  4A3L J;  1KQ0 A;  2Y0S A;  4RAZ A;  4BBS J;  1MND A;  3KLN A;  4YII A;  2KQR A;  4QPQ A;  1TW2 A;  4C2T A;  4KJZ A;  4UVB A;  4ZYE A;  1Z1D A;  4D5F A;  2F5C A;  4X6A J;  3GLL A;  2OA4 A;  5DS0 A;  2BHZ A;  2JA2 A;  3ZQQ A;  4RLQ A;  2VNH A;  2CC2 A;  1MBG A;  4WZL A;  2EV6 A;  3ZQC A;  2UV1 A;  4F55 A;  5GTH C;  4LLN A;  4DQL A;  1VQN I;  1EH7 A;  3E3V A;  2HYF A;  2IJL A;  2NVT J;  2XAH A;  1XD7 A;  3J7Y J;  3KEW A;  1ON2 A;  4PC2 A;  5J40 A;  2UUZ A;  3TO6 A;  3E5U A;  4LBY A;  4Y9R A;  2TDX A;  3IL2 A;  2LBF A;  2LFB A;  1G4D A;  4HQE A;  5DM7 F;  1AWC A;  4XNF A;  3CO6 C;  2ESN A;  3GZN B;  1I3Q J;  1W4M A;  3IWF A;  4M9Z A;  1ZGA A;  4DOZ A;  3JQR A;  5J47 A;  4H0E A;  2VN2 A;  4KNY A;  5H5J A;  1SMT A;  3QPL A;  1S9H A;  2DJN A;  2EIK H;  1XCV A;  1VQM B;  3P7N A;  3J7A O;  5JFR A;  3RZO J;  3ASS A;  1TQP A;  1EXM A;  2WR8 A;  2JZY A;  4HQM A;  4KIT B;  4M6X A;  1AKH A;  1A5J A;  2V31 A;  4N3G A;  1FRN A;  1V4R A;  4RD2 A;  4C3H J;  3A01 A;  2L4M A;  2DA7 A;  3F6V A;  1EF4 A;  2PIA A;  1QFZ A;  3Q0V A;  1T08 B;  3SZT A;  3ZRG A;  1O8M A;  3S2W A;  1ETQ A;  1FND A;  1T0F C;  2CQX A;  2CS3 A;  3CCL I;  5EGO B;  2FEZ A;  3WOD F;  1CQT A;  5K7H A;  5HZB A;  1QRB A;  1WJF A;  2JUG A;  2RVC A;  2K4J A;  4BXU A;  3OY9 A;  2A07 F;  2XTX A;  5LEJ A;  4HZF A;  4B48 A;  3ISX A;  4RAG A;  1VQ9 I;  4XLC A;  1KU3 A;  4EM2 A;  3G1L A;  2LY9 A;  3DKW A;  3OMY A;  5DD4 A;  3FHZ A;  4W8R A;  1QX4 A;  2Y9Y A;  2V7U A;  4ZCI A;  3HUG A;  2EQR A;  1O8J A;  1ETV A;  4S0H B;  4Y13 A;  1GHC A;  3WY9 A;  1OKR A;  2JA6 J;  3GWZ A;  1QJV A;  2DMP A;  2IA0 A;  3CDH A;  3L2C A;  1SC7 A;  1K79 A;  2GXA A;  3EQN A;  4QV2 A;  1R5H A;  3FIW A;  2Z8G A;  2DA5 A;  4TT3 A;  3ABT A;  3N6Z A;  1ONV A;  4KIC A;  1FBS A;  2HVS A;  1D1C A;  1DU0 A;  3BR5 A;  5CPR B;  1TQM A;  2RKH A;  4OOV A;  2P7C B;  2L9S A;  2GAU A;  3CW2 A;  1E2X A;  5L3B A;  4BHC A;  2GXB A;  2E34 A;  3C7J A;  1O7L A;  2Y0M A;  5F1R A;  2IVM A;  3JRI A;  5KNL A;  3BTL A;  1FOX A;  5J6X A;  3DTE A;  2C5H A;  2KDO A;  3GTK J;  3OYL A;  4CHU A;  1IJE A;  4M9S A;  1E3H A;  2A6H F;  1YIT I;  4P26 A;  3CC4 B;  2ISY A;  3LA2 A;  3KP5 A;  3S14 J;  2F4M B;  2ZJR F;  2DTZ A;  5A2Q K;  3BC8 A;  4CYC B;  1S6L A;  3HAG A;  5F4O A;  4N0B A;  3LAJ A;  1JNY A;  2DW4 A;  2L7K A;  2JN6 A;  3H09 A;  1PVE A;  1SFO J;  2MC4 A;  2I1L A;  2RQP A;  1H9G A;  1TBX A;  2K85 A;  3H0G J;  2WY7 Q;  3LSK A;  1MH4 A;  4EVI A;  2QTZ A;  2O1D A;  2DMN A;  4Z06 A;  2QYO A;  1E1R A;  2QWW A;  4U4B A;  2K5C A;  2PFB A;  2AO9 A;  3L09 A;  4RAY A;  3FBN B;  4MXN A;  2M0C A;  1QVG B;  3LST A;  3PA2 A;  4IHY A;  2EFN A;  3CCM B;  3WTV C;  3ABU A;  4GGG A;  4X0G A;  3CCQ B;  4P9F A;  2OTJ I;  2Q1Z B;  2WAF A;  4Y17 A;  5K7Z A;  2E1C A;  3RY8 A;  4MTE A;  1OB2 A;  1QHH D;  2GOX B;  2VOO A;  1X3W B;  1H8E A;  4EGZ A;  1MBF A;  4R71 A;  4HG2 A;  1QPM A;  4WCG A;  5HLI A;  1RUN A;  4CZC A;  2D3N A;  2E7X A;  4QIW N;  1U78 A;  4A0X A;  2L7F P;  4YZA A;  4PK4 A;  3P9I A;  1LEA A;  2VJ4 A;  3KYC B;  3TQN A;  1YX5 A;  1FP2 A;  1FY7 A;  2ZNY A;  4L9J A;  2FD5 A;  3BR2 A;  1R00 A;  1IJF A;  1EP3 B;  2Q6I A;  3LSJ A;  1WMR A;  1IO2 A;  1D8K A;  2FQ3 A;  5IPA A;  3RI4 A;  2K40 A;  2RC6 A;  1KQ8 A;  5E3M A;  4ZZD A;  3QOE A;  3EET A;  4UB8 C;  2HDD A;  1B6A A;  4BXF A;  3G71 B;  5C4J J;  4U9U A;  4B3F X;  2E35 A;  2QBY B;  2V9V A;  1IN7 A;  2CU7 A;  4P25 A;  1ZGJ A;  2EZI A;  2XAJ A;  2OPT A;  1OFM A;  4M0L A;  3RCO A;  4LIT A;  1LEB A;  3OZV A;  4N4O B;  4M6Y A;  1T6X A;  4QHY A;  1Z0X A;  2COB A;  1JJ6 C;  3WTU C;  2L4A A;  2PI0 A;  1KK2 A;  1XG2 A;  3ZCO A;  4E4H A;  1IXC A;  5CQG A;  1YO5 C;  4Z4Y A;  1JRG A;  1WJC A;  1VQ7 I;  4Z6Y A;  1PJ5 A;  2XTY A;  2ZCW A;  3BR3 A;  1LVA A;  2XAF A;  3AL0 B;  3QYB A;  4FXU A;  2E7W A;  3OL4 A;  1CF7 A;  3S3M A;  3S3N A;  1SAU A;  1ULY A;  4Z2Y A;  1E17 A;  3WHB A;  2YUH A;  4W8T A;  3BCF A;  3AVY A;  4MQ9 F;  1X1D A;  2CV1 A;  1VQO I;  4DK0 A;  3A3B A;  4B3A A;  3L1P A;  1YFH A;  2L7Z A;  3SJM A;  2BF4 A;  4HEA 2;  3L2W A;  4OOI A;  3HG9 A;  2R7T A;  3LQE A;  5J4V A;  2KRF A;  1HLV A;  4BHP A;  4PC6 A;  3R60 A;  5ILS A;  3CCV I;  4JX6 A;  4CYD A;  1ZG5 A;  1G7T A;  1P9Q C;  3JAM K;  3QU6 A;  3ASN H;  3FZV A;  3OIP A;  1NB0 A;  3ZN1 A;  4EMS A;  3S1N J;  3SEQ A;  2VAS A;  2RNG A;  2OYN A;  3R6K A;  1ETW A;  2E2J J;  2O61 A;  2R93 J;  1QRY A;  1QGA A;  4WZE A;  2R7R A;  2VBY A;  3K4N A;  3LWF A;  2ZZE A;  1HG8 A;  2QEN A;  4ETS A;  4ZYH A;  4YEI A;  3RSN A;  4V02 C;  2HKO A;  3SLD A;  1FSE A;  1BPL A;  3ZSC A;  1WRJ A;  2BGC A;  4NCN A;  1SD5 A;  4HYE A;  4EAT A;  5IP9 J;  3CCJ I;  4ESJ A;  1P7I A;  3GEZ A;  2FX3 A;  2DJI A;  1NTC A;  3MZH A;  2QKM B;  2DK5 A;  2VPR A;  2RC4 A;  4LLG F;  2MH9 A;  4KIS A;  1F1Z A;  3P27 A;  5EEH A;  2IGK A;  2OQR A;  2DPD A;  2V9K A;  2R0Q C;  4BE0 A;  4MNU A;  3GBG A;  3KFW X;  1GXQ A;  2JA8 J;  3I55 B;  2JK3 A;  3W2I A;  4HDU A;  1BJA A;  2ZL7 A;  1N75 A;  2LVS A;  2VFM A;  5FGM A;  1TT5 B;  3DEU A;  4GO1 A;  1BC7 C;  2HXO A;  2F5D A;  2BYV E;  5E3N A;  3VSU A;  2DK8 A;  3HYI A;  1B72 A;  2FX0 A;  2O6W A;  2JJ1 A;  1L3L A;  1MMS A;  5E1X A;  2IAI A;  3EDP A;  3L9F A;  1NB9 A;  2X3U A;  4LMY A;  3KP4 A;  2IOU G;  3KYL A;  1GAQ A;  1GVH A;  2B0L A;  2J8I A;  2BSP A;  4OZY A;  1HSJ A;  1ZG3 A;  3K1P A;  4M71 A;  2XKP A;  1MD0 A;  2KZG A;  3DF8 A;  5D5V B;  2CO5 A;  5FFZ A;  1YRN A;  3SJZ A;  1QGZ A;  1O3Q A;  3D5R C;  1FNM A;  2BPO A;  3IKT A;  1ZGW A;  4OMZ A;  4IHW A;  2DOD A;  2P4W A;  2VQC A;  3K69 A;  4CIC A;  3I9V 2;  1HKT A;  2E5N A;  1KYW A;  5JBQ A;  1NHA A;  5CKT A;  1PKV A;  4BDZ A;  3D26 A;  3OS0 A;  1T8I A;  2PEC A;  3FK7 A;  2X6O A;  2YPR A;  3H9G A;  2CND A;  4E7K A;  2DT7 B;  1H42 A;  1HKQ A;  2OZ6 A;  2Z16 A;  2ZJ2 A;  4K2E A;  3N97 A;  3SEJ A;  4HWV A;  4J19 A;  2W48 A;  3ZQI A;  3LSM A;  2EZL A;  3F8N A;  4BEH A;  3WU0 A;  4ZDO A;  1WWX A;  2LKS A;  3UR3 C;  2ESH A;  1YHQ I;  1R5N A;  2NYX A;  4R8H A;  5C1E A;  3EUH A;  2EPF A;  2D2W A;  3FBI B;  3LSG A;  4RB3 C;  1DDN A;  2V4D A;  4RAF A;  1TLL A;  3E5X A;  2IBD A;  5FJ8 J;  4ACA A;  4CCN A;  3RKW A;  1DPU A;  1FP1 D;  1RKW A;  2EV5 A;  2LYC A;  3OR2 C;  2Z2S B;  3L00 A;  5H2F C;  1SMY F;  1EP1 B;  2INU A;  2WPD A;  3IWZ A;  1JKQ C;  4MHG A;  4B1R A;  4FQG A;  4A3J J;  1COW A;  4YDT A;  5TGT A;  1BMF A;  5J1U A;  1WJB A;  4Y3O A;  4CQJ A;  3WNC A;  3M4O J;  2NSP A;  3GQ9 A;  5J8F A;  2ELH A;  2X6X A;  2DA1 A;  2L9V A;  4A3D J;  3JQP A;  5LHI A;  3OW2 B;  2DA2 A;  1HA8 A;  2P3M A;  2DQR A;  1QVU A;  2KMU A;  5KAF C;  3BJ6 A;  2AXL A;  2WB1 A;  4XL9 A;  2L01 A;  4JMQ A;  1VQ4 B;  2KDZ A;  2DCE A;  3BPX A;  1ZKG A;  4N4N B;  3COA C;  3E7L A;  3ABL H;  2FVG A;  1R1U A;  4KFC A;  2CGP A;  1F4K A;  2CV0 A;  1UD3 A;  1D5V A;  2M45 A;  2VKD A;  3OJW A;  3DEE A;  5GAE J;  3TOA A;  5M3M J;  1VHE A;  4S05 A;  2P0W A;  4OIQ F;  5IK2 A;  2V6E A;  3W3C A;  2INV A;  2VQH A;  2XT4 A;  1QZY A;  3GTQ J;  1SVM A;  4YCQ A;  2PYH A;  3V76 A;  3K4C A;  4LBV A;  2KJB A;  4N9I A;  2A68 F;  2OC6 A;  4X0C A;  3WND A;  1POG A;  2A05 A;  2EFQ A;  1JKR C;  4RD6 A;  1A6Q A;  1MBE A;  3VYT B;  2BM5 A;  1U2R A;  1XS9 A;  1HCR A;  4RPB A;  1K61 A;  1XTA A;  3DBR B;  3CMA B;  1XE1 A;  3MAJ A;  2VE8 A;  5GPA A;  3CLQ A;  4IEJ A;  3AKZ A;  1JGG A;  3T5X A;  2YUS A;  3P26 A;  2DA4 A;  3BDD A;  3L2R A;  3BRO A;  3OSF A;  4U88 A;  1IC8 A;  1XB2 A;  3L2U A;  1BW6 A;  1YW9 A;  5HZA A;  3A8I A;  2ODL A;  2LTP A;  3A0B C;  4L5E A;  2L0K A;  2LG4 A;  1PUF A;  1N08 A;  1O3R A;  2MLG A;  1S72 I;  2DA6 A;  5KSW B;  3BZ6 A;  4M4S A;  3ZQH A;  2EWE A;  4KN7 X;  3KCC A;  2WY8 Q;  3QFR A;  4C43 A;  2EJR A;  4LG0 A;  1P4W A;  3DEW A;  3VDX A;  2F5F A;  4MQV A;  2F48 A;  1WPC A;  1E3Z A;  1JUP A;  1EA3 A;  4II2 A;  5F08 A;  5HDG A;  2JRM A;  3MCA A;  1R5B A;  4G7Z F;  2B0R A;  5C1C A;  2KZV A;  4BQA A;  2F3L A;  2FBI A;  1ON1 A;  3HHH A;  1EWY A;  2KKO A;  1E3P A;  3VYU B;  2D74 A;  4HPQ A;  5DUI A;  3M8F A;  1OGJ A;  1MIJ A;  4FAS D;  3OR1 C;  1D5Y A;  4L0Z B;  2FOK A;  1OCZ H;  2E1N A;  3GFJ A;  3CC2 B;  5FKM A;  4TMV A;  1MKM A;  1VF9 A;  1W5C C;  1J2X A;  1JB9 A;  3N90 A;  1Z6R A;  2K9M A;  3OIO A;  4AU7 A;  4V19 K;  3QE2 A;  1Y0N A;  4ZGN B;  2DFF A;  2K86 A;  2BGJ A;  2NPF A;  2L7M P;  2QQA A;  5E1Z B;  1J59 A;  2L02 A;  5IYD J;  4PJN A;  1E63 A;  4XK4 A;  4DQK A;  1Q1V A;  3BG9 A;  3I4N J;  4IHT A;  1LE8 B;  4KKU A;  4WWV A;  1R7J A;  5D5W B;  2A5Y B;  2VT2 A;  2E36 A;  3HSR A;  4JBA A;  4Z4V A;  4QLC U;  1BR1 A;  1Y0R A;  1QZE A;  5JLW A;  3PIP F;  2KLO A;  1CZF A;  1CNF A;  2P5V A;  4TV7 A;  1EFC A;  3GCM A;  1B8I A;  1BX1 A;  3A1Y A;  1B9N A;  1ELO A;  2EA4 A;  2HLD A;  2BY1 A;  4ROX A;  3HOX J;  2NVX J;  3PSZ A;  1SFU A;  2OBS A;  4Z4R A;  1JTY A;  4PJJ A;  4XLH A;  3CQZ J;  2KFD A;  3VO1 A;  5J3L A;  3SJP A;  1K78 A;  4ESF A;  4HLY A;  2V1N A;  3GW2 A;  3H9N A;  2GRE A;  5BQT A;  3ISP A;  3QQA A;  2HYJ A;  1V3F A;  2GZW A;  2D1V A;  3I56 B;  3CC7 B;  2A6E F;  2XDV A;  4AD9 A;  1ZM2 A;  4RGS A;  2DQL A;  4PJM A;  5FRO A;  5JHF A;  2ID6 A;  3AG2 H;  3ZPP A;  1QQI A;  2UXN A;  1G3T A;  3M8J A;  5DD8 A;  4QVA A;  3S2D J;  2QXZ A;  3LL7 A;  3HOS A;  2QLZ A;  3FMS A;  4A3K J;  1UMQ A;  2EZK A;  4I0B A;  3Q38 A;  2K9S A;  1EE6 A;  1P4X A;  3G3Z A;  4LOC A;  1A35 A;  2NRA C;  1WTH D;  1JTA A;  3QPH A;  4L5J A;  3CJN A;  4FE4 A;  4BQN A;  2KIS A;  2LZJ A;  3ZZT A;  2DDA A;  1HBX G;  3QAH A;  5K1Y A;  1HVX A;  5EEG A;  1LUJ B;  1JA0 A;  1U9N A;  1ZYR F;  1WH5 A;  1OFC X;  5DN6 A;  1UHM A;  3PUF A;  5FL7 A;  1KQS B;  3I5U A;  4Z05 A;  3BCD A;  4I7H A;  4N9H A;  1FJL A;  2XRN A;  1BN5 A;  1YIJ I;  2CF4 A;  1DP7 P;  1SVL A;  1N77 A;  2BBY A;  2X1E A;  4QPO A;  1GVD A;  2L2O A;  3MCZ A;  5JLX A;  3V7S A;  4XD7 A;  3WHC A;  3O8G A;  3AK5 A;  2QVO A;  3BR0 A;  4ENK A;  2KHM A;  1MNE A;  1DGW Y;  1P2F A;  3GTJ J;  1TVC A;  2HNH A;  2VON A;  4DW6 A;  3AST A;  4M3E A;  3GYH X;  1U8R A;  4AC9 A;  1X3Z B;  4XOT A;  4P3Y A;  4X06 A;  2GQQ A;  1VFC A;  3DBL B;  1DQU A;  2VNK A;  2NVU B;  2R7Q A;  2RGV A;  3ECO A;  3V7C A;  3CP2 A;  1A04 A;  3O3K A;  1F36 A;  3U6K A;  2K9L A;  3OL3 A;  5IT9 Z;  4P55 A;  1GV5 A;  3SDG A;  3ERM A;  4BQO A;  3K10 A;  1Y0U A;  1W35 A;  1OGM X;  4LD5 A;  3LSH A;  1UAA A;  2FOW A;  4M3G A;  4CCM A;  5LGU A;  1GO2 A;  1I7P A;  2WAD A;  4OJ5 A;  4HF1 A;  1MJ9 A;  4XLA A;  1FX7 A;  2ECC A;  2DAO A;  2FE3 A;  3SXY A;  2LD5 A;  3FJO A;  4RD3 A;  3QSY A;  2DMU A;  3VO2 A;  3J7A Y;  2X85 A;  3DXJ F;  3DFG A;  4XN0 A;  1KZL A;  2O17 A;  5KK1 A;  4FK8 A;  4B4C A;  4TMT A;  1FDR A;  2ZBU A;  2XAU A;  2VKE A;  2V6C A;  4NC7 A;  5DTD A;  4P9U A;  1SFX A;  3V8J A;  1MZB A;  1UMK A;  3GQ7 A;  4HX4 A;  4G1B A;  1G7R A;  1G3W A;  4P6V F;  1ZR4 A;  4YIF A;  4BL0 B;  4KUM A;  1J5Y A;  3PSI A;  2JTV A;  3Q39 A;  3PJR A;  4YZX A;  2VUM J;  1FIP A;  3OYN A;  3LOC A;  2IS6 A;  1KMH A;  2WWY A;  3B6C A;  4L18 B;  4AM3 A;  1IRX A;  3WG9 A;  2WB1 N;  3OIQ A;  1XG1 A;  4C2M J;  1N78 A;  1LJ9 A;  1Z9C A;  1IN4 A;  2DOA A;  5B3S H;  3GZ5 A;  2DMT A;  2M9H A;  1VQM I;  1QBJ A;  2YU9 J;  2E1R A;  2PLF A;  3CD6 I;  2AHO A;  3QP5 A;  4I99 C;  1FEX A;  4W8Q A;  2CQQ A;  3HM5 A;  2F4I A;  1A36 A;  3DLL F;  3SKB A;  1XC5 A;  2NZM A;  3CUQ B;  2O3F A;  3WQZ A;  1BM9 A;  1KON A;  3CPW B;  2LRD A;  3DKX A;  1XX5 A;  1CQX A;  1PYV A;  3VWB A;  4OM9 A;  4D5C A;  2X0K A;  1ZK8 A;  4ZYA A;  2C6Y A;  2IGM A;  1XSD A;  2X53 S;  4F3Q A;  3HBL A;  2XGD A;  4E7J A;  1Y1W J;  4XRF A;  3Q0W A;  4XBF A;  3NAU A;  1JGS A;  2W85 A;  2BHY A;  2M5W A;  3SDB A;  1IAW A;  2HEO A;  1YI2 B;  1IN5 A;  4IRG A;  2HPM A;  3BQY A;  3JU4 A;  1K8A D;  3G4S B;  2X6Y A;  5LBQ A;  1YJ9 B;  3QPT A;  1S8N A;  5EF6 A;  5F4M A;  4G6Q A;  3SFZ A;  4M73 A;  2JUC A;  2OU2 A;  4EJW A;  2QSH X;  3EYY A;  4HDV A;  2ZIT A;  3K1M A;  1FMW A;  2CW0 F;  3MZ8 A;  1QRC A;  2M30 A;  3RYR A;  1J09 A;  5CLS A;  3EQO A;  2LRE A;  2W24 A;  5FFX A;  2O6G E;  2OBR A;  1X1B A;  2QA4 B;  1E79 A;  2XC1 A;  1LQ1 A;  4MFE A;  2F4N A;  2DTR A;  5LGN A;  1LFB A;  2BY0 A;  4ASU A;  3LNN A;  2W1O A;  2XEX A;  1D1A A;  1I1S A;  4DZP A;  2FNA A;  1R9T J;  4TN1 A;  4Y7C A;  3DKY A;  3DTI A;  5CVU A;  3RDI A;  3KYD B;  1IDZ A;  3VMW A;  1E1Q A;  3I54 A;  2VBM A;  4GFB A;  2VNI A;  1SAN A;  4M74 A;  3CCS B;  1M1E B;  2OBT A;  3F21 A;  1J7K A;  2JA5 J;  3OE7 A;  2VPL A;  3W2W A;  4DGW B;  1UJ8 A;  3VNU A;  2MBF A;  3GLX A;  1IRZ A;  3JRA A;  2R3S A;  4O5V A;  5GV7 A;  1ORK A;  1T95 A;  2JT1 A;  2VI6 A;  3AGP A;  1MH3 A;  3H36 A;  2JJ7 A;  3HJE A;  4CH7 A;  1BI2 A;  4RD0 A;  3OSG A;  3LSI A;  1IXR C;  1JTX A;  1XCB A;  4HRI A;  3IAM 2;  1O7F A;  1UD4 A;  4YZQ A;  2OCE A;  4G12 A;  1IUF A;  2E1M B;  1YQA A;  4PSW A;  5M5Y J;  2X6W A;  3SUC A;  5E3O A;  4CSW A;  1H8A C;  3CUQ C;  2XGJ A;  3FMR A;  3LA3 A;  2O8X A;  1V5F A;  2OCC H;  1WDT A;  2V7T A;  1ZTR A;  2R5Y B;  2GM4 A;  4HIZ A;  4L5I A;  1T6S A;  3WGG A;  2V1D A;  1TLH B;  2W84 A;  5IYC J;  1JUM A;  3I3L A;  1D0Y A;  4ENM A;  1IF1 A;  2QEX B;  1H8H A;  2ZJP F;  3CCM I;  2YWF A;  4RCY A;  4Z1M A;  1KGS A;  3JTH A;  3CTA A;  5C44 J;  4FX4 A;  4OPV A;  4E0F A;  3CCQ I;  2DOF A;  3SEZ A;  4HE6 A;  2GOM A;  4QUZ A;  4BEH B;  4HSR A;  3S93 A;  2C4T A;  2V4J C;  3H5A A;  1PJ6 A;  2F6C A;  3KIO A;  1EH8 A;  3IP4 B;  4HNU A;  1D2E A;  2B63 J;  2BW3 B;  1G7C A;  2WZN A;  3EPZ A;  3FIS A;  1Q82 D;  1WI3 A;  5J4Y A;  5BSX A;  3AG4 H;  4OOS A;  4ZCL A;  4NHJ A;  1EKE A;  4F7Z A;  5TV2 A;  4F7D A;  2WC2 A;  2HDN B;  5K5Q A;  1S5L C;  4XMY A;  1K4T A;  1AOY A;  3DCF A;  1IRF A;  4XSZ F;  3REO A;  2XHK A;  4UV8 A;  1N0V C;  4RGX A;  1LB2 A;  2C5B A;  4U0V A;  5KW9 A;  1STZ A;  2EIM H;  3TO9 A;  3CDI A;  3QU3 A;  1IA5 A;  1IW7 F;  1U6G A;  4GYG A;  1DAR A;  1IG7 A;  5D6E A;  2HQR A;  1X2M A;  4GRI A;  3QP6 A;  3OYA A;  3G71 I;  4X7F A;  2G9W A;  2B7E A;  5TY0 A;  2HTJ A;  1WZ2 A;  3H3Z A;  1S7O A;  2GA1 A;  1XPX A;  4UNO A;  2E1M C;  4UUS A;  2LDU A;  2Q8K A;  5BMZ A;  4N3N A;  4B44 A;  2C77 A;  2VBS A;  2R5Z B;  2VFO A;  4RGR A;  4JOM A;  3HGY A;  1MW7 A;  2I10 A;  1FZP B;  3CCE B;  4C3J J;  2UZK A;  3BR6 A;  3HOY J;  1PJ7 A;  3QWL A;  3DPT A;  3ZMU A;  5FD5 A;  1FX0 A;  2ADU A;  3SQV A;  5L3F A;  3CES A;  3JTG A;  1G8X A;  4CUG A;  4G6T B;  3K2A A;  5FO0 A;  1HST A;  3WGH A;  4PJL A;  5ICE A;  3W6K B;  2XPU A;  4LFU A;  4XQF A;  3F23 A;  4WZK A;  2EFP A;  3OYD A;  2ZME B;  4XRM A;  1J75 A;  1EA0 A;  2LMD A;  3ML3 A;  2ZJQ F;  2VBV A;  1MJB A;  4O6J A;  4CXF A;  4D1Q A;  3FM3 A;  3CMY A;  3GFI A;  4BAC A;  3G6E B;  4I76 A;  3BNW A;  2X0L A;  1NRK A;  4G1V A;  4W1U A;  2R7F A;  1W36 D;  4BBR J;  2MA3 A;  1W0J A;  5B1B H;  3GRH A;  2E71 A;  1USS A;  4HF2 A;  1HXD A;  2Q2E B;  1G3S A;  1ZRD A;  3ES9 A;  1N8R D;  2ZXJ A;  3BR1 A;  1ZM9 A;  3PNT A;  3ZMZ A;  1OGO X;  3OV8 A;  1Y1V J;  3ZQ7 A;  3KRG A;  5BSY A;  4CDG A;  5AIP A;  2LKX A;  3FXK A;  3QOD A;  2YWE A;  3PFY A;  1MDM B;  2D9R A;  1QA3 A;  1SVO A;  3W2F A;  1NG6 A;  3H1C A;  4IRI A;  3BP8 A;  3U1K A;  1DUX C;  2Q6K A;  2LR8 A;  5F0F A;  3FMQ A;  4PZJ A;  3HGG A;  2Y2Z A;  1VQ8 B;  1OMI A;  2JA7 J;  2J8K A;  1XSX A;  1R22 A;  2JMW A;  5IYQ A;  2YWH A;  3H5R A;  3OZW A;  4OJ6 A;  1Q9S A;  3CME B;  1GQ8 A;  1DPR A;  2WV1 A;  1NHC A;  4ZYG A;  2O0W A;  4DNR B;  3WWG A;  4CGZ A;  4Y33 A;  4C9Y A;  3JX8 A;  2K27 A;  1YX2 A;  1UEL B;  1W36 C;  2VFP A;  1EH6 A;  3OYG A;  1F43 A;  3I55 I;  3ZMV A;  3M1C A;  1GDT A;  1I18 A;  2TRT A;  4OIR F;  2NNN A;  4DNT B;  3L2Q A;  2LKP A;  1XGN A;  5HS9 A;  1KK3 A;  1CGP A;  2PJR A;  4OIP F;  4IVN A;  3Q9V A;  2HTS A;  2D5V A;  3KX2 A;  3HRS A;  3DDY A;  2ZME C;  5HS8 A;  1O3S A;  1QNT A;  1R58 A;  1R4M B;  3E5Q A;  4KMU X;  4WF2 A;  2W7Z A;  4U7B A;  2GQF A;  2BY2 A;  5HDK A;  4K1X A;  1MMN A;  1YE9 A;  1KQ5 A;  3I59 B;  1G3Y A;  3OYC A;  4YG2 F;  2R4G A;  2HVR A;  1KZH A;  3LQR A;  1O8K A;  3BG6 A;  3BCB A;  2E5Z A;  4DYC A;  5LRS A;  3MKY B;  5HOO A;  1BA5 A;  1MJA A;  5EG0 A;  1QG0 A;  2HQA A;  1ETO A;  3FXO A;  4UUT A;  3KEO A;  1WGX A;  3F0C A;  3FXU A;  4NQW A;  1QFJ A;  1SD6 A;  3C2H A;  2VBW A;  4BXX J;  3LYC A;  2Y31 A;  1QCX A;  3WBK A;  5GV8 A;  4X05 A;  4XLN F;  3SQN A;  2BXZ A;  5JR3 A;  2HQN A;  3JRG A;  3ZIA A;  1W0K A;  3GIR A;  2BVL A;  3RPU A;  2X1C A;  4I2O A;  4DYR A;  3Q9S A;  5KVR A;  4Z4U A;  5BOX A;  1OCR H;  3SLN A;  4YZ0 A;  4BH9 A;  2XSD C;  2PMZ N;  3ZGK A;  1Z6T A;  2M34 A;  2ZB9 A;  1BOB A;  1FYK A;  4KIB A;  1AHD P;  3S2H J;  1WU8 A;  1Q7Y D;  1TZL A;  1GJR A;  5H59 A;  2IA2 A;  3FPP A;  2OF7 A;  3GTM J;  2Z1D A;  4ZCM A;  1U3E M;  2B9S A;  2ETH A;  5AON A;  2XIG A;  3ZMT A;  5J35 A;  2EBI A;  2JN9 A;  4ABZ A;  2RC5 A;  5TRD A;  4HE5 A;  3PQJ A;  5DCM B;  4G7O F;  2V79 A;  3HPH A;  3R4K A;  5HNF A;  1HQC A;  4RM0 A;  3T51 B;  3OYE A;  2E2H J;  1RR7 A;  3O6B B;  4OJO A;  2OD5 A;  2O8K A;  1T0F A;  4NUB A;  1HA3 A;  5F1J A;  1KCD A;  3RKY A;  4NC8 A;  5ICF A;  1DBG A;  1VQ5 B;  4E7I A;  4M72 A;  4RDK A;  3IRQ A;  2XB0 X;  3C18 A;  2YX7 A;  4P96 A;  4RGU A;  1U8B A;  1BJK A;  3ULQ B;  1H9T A;  3T9G A;  5DNS A;  2XKO A;  3TBI A;  4IOA F;  3ROU A;  2MGQ A;  2X48 A;  5E3L A;  2E60 A;  1F5T A;  1K83 J;  2FSW A;  1VQ4 I;  4LJZ F;  1T39 A;  2R92 J;  2EIX A;  1H80 A;  3BY6 A;  3Q3A A;  4PC3 A;  3GUD A;  5IT9 K;  2IA1 A;  2FRH A;  1Z91 A;  3A0H C;  4L9T A;  4FCY A;  1ZG1 A;  5TR9 A;  4KH3 A;  5LEK A;  3LSP A;  4P9S A;  1WSV A;  1RWR A;  4PGO A;  1X19 A;  3HC7 A;  3PUN A;  2IEK A;  1O4X A;  1EP2 B;  2DDB A;  1G7S A;  1K28 D;  2PYG A;  2W57 A;  3LQ6 A;  4PMH A;  4WWC A;  3TO7 A;  3IUO A;  4AID A;  2KRH A;  3W5U A;  4YFX F;  3AFH A;  1SEU A;  3CF5 F;  2DT5 A;  5JVG F;  1IB0 A;  5BNG A;  5BS6 A;  2QQB A;  2JJ2 A;  2HMA A;  2M5S A;  4C0S A;  3F9K A;  3B90 A;  1PDN C;  1V5E A;  4DK1 A;  2HDW A;  4RJL A;  2X9D A;  1VQO B;  5JMC B;  3A35 A;  2LK2 A;  3GVA A;  1A31 A;  1Y0Y A;  3IH2 A;  2H6C A;  2RAE A;  2JQ7 A;  4X7E A;  3R0A A;  2DYI A;  2R9V A;  2K4B A;  1U5T B;  3SZE A;  3F22 A;  2GJK A;  4F52 A;  2FXA A;  2VC1 A;  1FNC A;  3CMA I;  3K2Z A;  1C0W A;  4EJT A;  1K73 D;  1IN6 A;  2F1L A;  3ASQ A;  4TMZ A;  3ZUG A;  2WAQ N;  2CRV A;  2ZSH B;  3FK6 A;  4UZE A;  1XSV A;  2QCO A;  4L0Y B;  3W2G A;  2LP0 A;  3QFS A;  2XNJ A;  3ZXS A;  2QSF X;  2J5P A;  2B7C A;  1RES A;  2NOG A;  4X07 A;  4FE7 A;  5EGO A;  2PE3 A;  4ZV4 A;  2M87 A;  5IYN A;  1YG2 A;  2Y75 A;  3HB9 A;  3FKI J;  4ON0 A;  4MYU A;  4B4D A;  1D1N A;  1ACI A;  1BX0 A;  4IOC F;  3BOQ A;  3ZN0 A;  4P1V A;  4YEL A;  3HTS B;  2YR2 A;  2JWT A;  3ONY A;  3TH0 A;  2M0M A;  3OW7 A;  1TWA J;  2K3F A;  3WTT C;  3TL4 X;  1FOW A;  1RKT A;  3QYE A;  5D4S A;  3HOU J;  1YLO A;  1MSF C;  4P3I A;  3E6C C;  2BM0 A;  2Z5U A;  4UVA A;  4ZDL A;  2QGG A;  1F9N A;  2ZTG A;  5CVV A;  3CCJ B;  3R6S A;  5ILV A;  5L3D A;  2ZZQ A;  3IKV A;  3J80 Z;  5EMN A;  3BJO A;  5FNZ A;  1S4M A;  4H4K C;  2WYR A;  2HOS A;  1NBM A;  4TMX A;  3CCU B;  2MH2 A;  2VOD A;  1JJ2 B;  1OFL A;  2NXN B;  3EQL F;  4H9G A;  4PC1 A;  2DI3 A;  5FIU A;  1O8L A;  5F0H A;  1VND A;  1I5Z A;  5JI6 A;  2A69 F;  3JRE A;  3GFM A;  3ONQ A;  1R71 A;  1FSH A;  3CC2 I;  2Q6L A;  4ENN A;  3DPU A;  1GLN A;  1Q1H A;  3BG3 A;  4XID A;  2XRL A;  3LSR A;  4JP0 A;  1BLI A;  5IP7 J;  1R5O A;  1SD7 A;  5LFA A;  4KN4 X;  2DEU A;  2ZL5 A;  2QF7 A;  1SFE A;  1TNS A;  4IHS A;  4Y52 J;  3N05 A;  4M6V A;  4RM2 A;  1XMA A;  4A3M J;  2V7Q A;  3RIQ A;  2C4U A;  4P22 A;  1X58 A;  3OYJ A;  2XAS A;  4ZGQ B;  3DV8 A;  4OOX A;  4DBR A;  1N25 A;  1KK1 A;  3JRC A;  3WGI A;  1KTV A;  1SKQ A;  3J81 Z;  1J0R A;  1G59 A;  2P5K A;  4RB1 A;  1U5T C;  2HFH A;  2R7S A;  3BC9 A;  1JE8 A;  2QQ9 A;  5H6R A;  1OR7 C;  3UNG C;  4DZJ A;  4W97 A;  5ICC A;  1O8G A;  3U1D A;  2KVO A;  2QZA A;  4Y15 A;  4AYB A;  2EH3 A;  4CYC A;  1B9M A;  2L9R A;  4URR A;  3HIF A;  5FO1 A;  1KU7 A;  2I5U A;  3E1S A;  2M7B A;  1P6R A;  3HRU A;  3S16 J;  1X1A A;  4Z4Z A;  3P9K A;  3IH3 A;  4J00 A;  2GJR A;  1D8J A;  4YXW A;  5A2Q Z;  3K6G A;  2V1X A;  2YS9 A;  1YJW B;  3BTI A;  1DGR M;  2LNB A;  1IV8 A;  2LBF B;  4A3C J;  4FN5 A;  4M3B A;  3CCR B;  5FD6 A;  3A02 A;  4A5M A;  3O2P E;  1MGT A;  2BEO A;  3CMM A;  2GLO A;  2D3L A;  2DLL A;  5A88 A;  3I53 A;  3I56 I;  2MFZ A;  1B1B A;  1UFM A;  3CC7 I;  2BVN A;  2DPU A;  2Q6O A;  2FF4 A;  1NK3 P;  1UG2 A;  4NDL A;  1YJN B;  3BH7 B;  1UST A;  3V7A A;  1M1K D;  2VFN A;  3GSI A;  2CH0 A;  4UVC A;  4UY8 I;  1I39 A;  4BNC A;  3M1E A;  6PAX A;  3RJP A;  1LM1 A;  3JSP A;  2K9N A;  4FX0 A;  1JT0 A;  4AIK A;  2IW5 A;  5KHD A;  4BJ6 C;  4U0Y A;  1AKH B;  4BPR A;  1UD5 A;  3A01 B;  3B4N A;  1DU6 A;  4M2L A;  2VBU A;  1UD2 A;  4U87 A;  2BV6 A;  4MTD A;  1DG1 G;  2Y30 A;  1OCP A;  3LNQ A;  1I3A A;  1CLW A;  2XTW A;  1BQE A;  4QWQ A;  1REP C;  1DDG A;  3KP2 A;  3BH6 B;  4IXA A;  2NS0 A;  4UAJ A;  3JQQ A;  1FNB A;  4LB6 B;  1LKX A;  2GPJ A;  1VJS A;  1MMG A;  2GIZ A;  3OYH A;  4Z03 A;  4XLP F;  4MGR A;  1EFU A;  1IZ1 A;  1XGO A;  2QBY A;  3ZPL A;  2GJP A;  4Q7J B;  1KA8 A;  3JRF A;  2QZ8 A;  3HUG B;  2W7N A;  4ZTJ A;  4X7D A;  2XRO A;  1BHE A;  1A6I A;  2X51 A;  4HF0 A;  1W0U A;  4JRA C;  5D4R A;  2B5O A;  5GAD J;  4Z4S A;  4PUS A;  3MFK A;  3Q5F A;  2ZXW H;  2DYS H;  1ZAO A;  2L3D A;  4ZC3 A;  3DQV C;  3A2K A;  1BI3 A;  2CV2 A;  3W2E A;  3VST A;  2CW5 A;  2J7K A;  2BOL A;  1GT0 C;  2GBY A;  3LMW A;  3SFI A;  1WOR A;  3MZY A;  4EJO A;  5H20 A;  5TIS C;  4B8X A;  1OLT A;  3F72 A;  2EIL H;  1WHU A;  4QTR A;  3GTO J;  1R23 A;  5EJC A;  5DS9 A;  2DT6 A;  2XF7 A;  4HLX A;  2KRC A;  1K7A A;  1UD8 A;  5J3O A;  4XLF A;  1JHH A;  2Z33 A;  4A3F J;  1WOO A;  1VLY A;  3D1N I;  1RU4 A;  5E8I A;  2JIZ A;  1QPI A;  1IRG A;  3ASP A;  3SY2 A;  3GQ8 A;  4V2G A;  3G73 A;  4Z4W A;  2WTE A;  3H3U A;  5M5X J;  1PP7 U;  2UXX A;  4G7W A;  2WV0 A;  1ZHF A;  3KEQ A;  2EIN H;  4CZZ A;  5HOD A;  2NVQ J;  4PDK A;  2EWN A;  2ME0 A;  3NWS A;  2VE9 A;  3K1N A;  1HDP A;  1LDD A;  4G5G A;  5ED4 A;  4MEX F;  2QY1 A;  1O57 A;  4PFP A;  2RN7 A;  2PJP A;  4BE1 A;  3D5S C;  4Q47 A;  1T33 A;  3Q3S A;  4RDJ A;  2Y69 H;  1RMG A;  2KIF A;  3CZ6 A;  2VLA A;  3A3G A;  3DP7 A;  4A93 J;  4I6Z A;  3ZC3 A;  3RIR A;  3LFK A;  5M3F J;  1GUU A;  4M1K A;  1UG0 A;  1T98 A;  3WXM A;  4RDL A;  4IL6 C;  4C30 A;  4MIM A;  1MBJ A;  3I4P A;  3JW4 A;  5F64 A;  2HQ5 A;  3ESW B;  2KP6 A;  4LIU A;  3G1O A;  1W2B B;  1O8E A;  3V4G A;  1D1B A;  4Q5S F;  5FB2 A;  4P1W A;  2NS7 A;  5HXB A;  2GK6 A;  2COM A;  2HGC A;  4WQM A;  1W5S A;  1JJ8 C;  4LBZ A;  1VQP B;  3MVP A;  2H1K A;  2O03 A;  1X4O A;  2E1O A;  3DTK A;  1YI2 I;  1JXS A;  5B66 C;  4XKW A;  3HOZ J;  1HW5 A;  1VZ0 A;  1WJE A;  3OZU A;  3AVU A;  4U7D A;  3GQB A;  1H88 C;  3G4S I;  9ANT A;  3WTS C;  1Z7U A;  2XC7 A;  1G2H A;  2D45 A;  4OPO A;  4WX9 A;  3U2Q A;  1O8H A;  1R49 A;  5HLH A;  4W8S A;  2UWM A;  3KP6 A;  1OOC A;  2K02 A;  1HKS A;  4BU2 A;  4XR6 A;  5IY5 H;  1QVT A;  4YAW A;  5A89 A;  2Y9Z A;  1MAB A;  4CCL A;  2QA4 I;  3ZP5 A;  1QO0 D;  4E70 A;  3SYJ A;  5F4J A;  4TSF A;  3I58 A;  2O7O A;  2ELJ A;  2LSO A;  2M4K A;  2VXD A;  3C1D A;  4PSX A;  4BKX A;  4EM1 A;  3H0D A;  1NDH A;  3LQQ A;  3VSK A;  3VSL A;  1LFU P;  4V2F A;  3WTW C;  5HKK A;  2NTQ A;  2KL4 A;  1VBL A;  3M07 A;  4UXN A;  2R7W A;  3W2A A;  2DET A;  1EJ9 A;  2ICW G;  1AIP A;  2IGN A;  2A6T A;  1FIA A;  4G9Y A;  2CG4 A;  3DU1 X;  2IS4 A;  4YC5 A;  2OV7 A;  1CF7 B;  2P8T A;  4DBQ A;  3TP0 A;  1QUE A;  1V55 H;  1E43 A;  1KD1 D;  3NAR A;  3FXM A;  1PP8 F;  1Z67 A;  1I6X A;  1SFK A;  4RS8 A;  5FKL A;  3S3O A;  3ZOB A;  2X8K A;  4XKC A;  1LLZ A;  2GXG A;  2C78 A;  4P5O A;  3K4J A;  4BYY A;  2CYY A;  3V42 A;  2QUF A;  4A5N A;  2VOP A;  1A8P A;  3BZK A;  2R7Z J;  4IX7 A;  4RD4 A;  1OB5 A;  1YX3 A;  1VQL B;  1I6H J;  4QFM A;  1YTY A;  3I64 A;  4I02 A;  1IUY A;  4ZYD A;  4BGD A;  1TQI A;  4AVZ A;  1F60 A;  2HOA A;  2DFH A;  1K6O A;  1ETY A;  3CJR B;  5TJJ A;  3U2R A;  3GX4 X;  5D8L B;  3W5H A;  2DOG A;  4RD1 A;  2QEX I;  3H3V K;  3PO2 J;  4X7C A;  4AF7 A;  1DAB A;  5HVQ C;  1H85 A;  3QFC A;  2FUG 2;  3HRT A;  1H0M A;  4AYB N;  3M7G A;  4Q4Z F;  3TW7 A;  1V54 H;  2CQ7 A;  1ITY A;  4NK6 A;  3MWM A;  3OOU A;  4BAY A;  5K7F A;  2M4G A;  2HDC A;  2LY2 A;  3PQK A;  2BM1 A;  2W25 A;  4YHB A;  1WH7 A;  4GYI A;  1VQK B;  3LMM A;  3HDD A;  5D8K B;  2CUF A;  5FLM J;  1F20 A;  2CBX A;  1PE9 A;  2WJY A;  3IRR A;  2FNP A;  2K3P A;  1FTZ A;  1Z3X A;  3KE2 A;  5DV5 A;  1XGS A;  2WZP P;  1FNN A;  2HR3 A;  2YWG A;  2BGI A;  3A8K A;  3JRH A;  2PMZ A;  1ZM4 A;  4RPD A;  3GTG J;  2ECB A;  4I09 A;  3M9A A;  3HEF A;  3RPU D;  2GK7 A;  3VEP A;  3AVX A;  2IRF G;  5BPI A;  4IO9 F;  2OK8 A;  1DBO A;  3QYF A;  4XM3 A;  4DIQ A;  4XKB A;  1WPK A;  4CCJ A;  2ELK A;  2XGX A;  3B6A A;  1B72 B;  4YRV A;  1EFT A;  5C4X J;  1WOP A;  3ONU A;  1ZRC A;  3S32 A;  2RQQ A;  2EFO A;  4HX8 A;  4C3I J;  1HOM A;  3Q6Q A;  3ABK H;  2FMY A;  2OTL B;  1TSP A;  3T53 B;  3CCE I;  2DBB A;  2LC2 A;  3CXC B;  1V5V A;  2RRE A;  3QRF F;  4A0Z A;  2H94 A;  3V7R A;  1LPQ A;  4LLL A;  5DSZ A;  3ZMS A;  5ICG A;  3W2V A;  2V7W A;  2DN0 A;  1YRN B;  4MR0 A;  2PBI A;  2W6I A;  2ZZG A;  1TNT A;  2VL8 A;  3U9G A;  4LG3 A;  1E3X A;  5IOZ A;  3E1Y E;  2NV4 A;  2ZBV A;  3GO5 A;  2FU4 A;  4YIR X;  4XIC A;  1HZE A;  3BLY A;  5EZH A;  5AMV A;  2M1B A;  1VQ6 B;  4WXD A;  3SZG A;  2DY1 A;  1TYW A;  4KKS A;  1OCC H;  2JRT A;  3PSF A;  5THX A;  2R7O A;  1BI0 A;  4F92 B;  4LC0 A;  2AHQ A;  4JYK A;  1ZR2 A;  1FYM A;  2F5V A;  4JX4 A;  1T6Y A;  3RYP A;  1SD4 A;  3JUR A;  3M8E A;  3HOV J;  3JCU C;  2DO7 A;  5E8G A;  3CD6 B;  3G6E I;  1H89 C;  3OS2 A;  2QGU A;  1ZUN B;  1RNL A;  1Y6I A;  3BG5 A;  1BW5 A;  4ENJ A;  1QA2 A;  1YLF A;  1LLW A;  1E64 A;  4YFN F;  1W34 A;  2CK3 A;  3S1Q J;  3CRZ A;  2FBH A;  2WJV A;  3AG3 H;  1W7P A;  2LF8 A;  1K8F A;  2J5O A;  5HS7 A;  4XN3 A;  1OFD A;  5DM6 F;  1SAX A;  2VBZ A;  4UV9 A;  2Z99 A;  2VJI A;  1T38 A;  1J9I A;  1S0U A;  2HU9 A;  2NS8 A;  4GXO A;  1OB0 A;  3HOW J;  3IHU A;  5GAH J;  2STW A;  1MMD A;  3RQ4 A;  2IT0 A;  4OPS A;  3NB2 A;  2QDX A;  3FDY A;  1OHH A;  5EDN A;  3OPO A;  1NK2 P;  1TWC J;  2WAQ A;  3J80 K;  2HYG D;  4II3 A;  2VB6 A;  4QSH A;  1VQ8 I;  1N06 A;  5A8A A;  3K7A J;  1I1G A;  2CUE A;  1KRH A;  2XF5 A;  4YAU A;  2O0V A;  3FY3 A;  2L54 A;  2XGC A;  1HW2 A;  3CME I;  3E6M A;  4NB5 A;  4RB0 A;  4D9J A;  4KT5 C;  4G6D A;  1LE8 A;  4TMW A;  3ZBU A;  1FYL A;  3PUM A;  3K4K A;  3ZZU A;  3VYS B;  2V5I A;  4A0Y A;  1RRJ A;  1CNE A;  5FA6 A;  4LB5 A;  4ANJ A;  5IOY A;  3K9T A;  5FRN A;  3S15 J;  1B2R A;  4UZU A;  1BJZ A;  1VQN B;  3TGN A;  3NAW A;  2QKL B;  5CQE A;  1FT9 A;  4WZT A;  5C3E J;  2P6T A;  3J81 K;  3I0T A;  1XMK A;  2W6J A;  3BCA A;  4A69 C;  5HLT A;  2KIQ A;  3K70 D;  1U0J A;  2H8W A;  3CP8 A;  2KIU A;  1RZ4 A;  2ZO4 A;  1W0T A;  4LK1 F;  1TWH J;  3WU1 B;  1O3T A;  2P6S A;  1ZQ3 P;  1WQ2 A;  1Z77 A;  1K4Z A;  1HC8 A;  1RPW A;  3FXJ A;  3LVB A;  3VNV A;  2VC0 A;  2BMW A;  3MEX A;  3WG7 H;  1S3J A;  4YAF A;  1XDU A;  1U2W A;  2CFX A;  3FXR A;  4KDP A;  2VBE A;  2FQ4 A;  2BY3 A;  3TMO A;  2B7B A;  1LVK A;  2P7V B;  3H5N A;  5DUK A;  1WSU A;  2FJ1 A;  2HWV A;  3EUH C;  4RMN A;  2M8E A;  4I01 A;  3KLO A;  4BDY A;  5L3E A;  2OBP A;  3WYA A;  4D0P A;  3OOP A;  4XSX F;  2QSG X;  2VYQ A;  1W9X A;  5GPC A;  3GME A;  3H9J A;  3S8P A;  3B78 A;  3CB4 A;  5E6T A;  3VMV A;  1W87 A;  1GR1 A;  2R7U A;  3S1R J;  5DEQ A;  1IJW C;  2XSJ C;  4FET A;  3FWE A;  3H9Q A;  3GXO A;  5D6F A;  2DMQ A;  3MMY B;  3W2H A;  4HA8 A;  2EIJ H;  2BM6 A;  4EW9 A;  3H35 A;  2KT0 A;  1R1V A;  2ME6 A;  3P9C A;  2A3S A;  4ZZL A;  4ZTF A;  3CCL B;  1D3Y A;  2Q0O A;  1LFP A;  2ZFU A;  3K70 C;  4IPA A;  1PUF B;  2X3H A;  2HS5 A;  1KQ9 A;  3HKZ N;  3ELK A;  1Y8R B;  2CUZ A;  3ZR8 X;  1B4A A;  3S1M J;  1M90 D;  1W1W E;  3V8K A;  1FLI A;  3U6B A;  1VQ9 B;  4AIJ A;  1XMX A;  1HW1 A;  5FLX Z;  1HF2 A;  2BN4 A;  1BIA A;  1QH0 A;  4LG0 B;  3MKZ A;  2YSR A;  4IKF A;  1LDJ A;  1Q86 D;  4AF6 A;  3PNV A;  3CJT B;  4MLO A;  4RBO A;  3WNB A;  1KU9 A;  1D8T A;  3FHN A;  3CF2 A;  2PMH A;  3TOB A;  3FPK A;  1QHG A;  4TKO B;  2XZO A;  2VFQ A;  2LH9 A;  2ZSI B;  2MYS A;  2R6H A;  4JX5 A;  1L1I A;  4B47 A;  3P5J A;  3D5L A;  3E0J B;  2XZP A;  2CSO A;  3B8Y A;  2VT3 A;  2G7H A;  3BG7 A;  1JKO C;  4PAB A;  4XRS G;  1TYV A;  2N8G A;  4KYW A;  5LLQ A;  1Z21 A;  1VQ5 I;  2ZBK A;  5ILU A;  1E62 A;  4A3I J;  1ZM3 A;  1R1T A;  3T8T A;  2JDI A;  1TW3 A;  4A3B J;  3W6J B;  4D7N A;  5IYB J;  1EV7 A;  3AAF A;  1IGN A;  1WOS A;  1IB4 A;  2NT6 A;  1WVR A;  2F43 A;  3K4L A;  2QM3 A;  1Y56 A;  2VBK A;  4Y4R A;  5FKO A;  3UW0 A;  1BIB A;  1BOA A;  3P4G A;  1YIT B;  2O0Y A;  4Y9U A;  3PUB A;  2IS1 A;  3OP1 A;  2JPB A;  4B3G A;  2MW8 A;  4BY7 J;  4G8X A;  1E3O C;  5B6I A;  3LJY A;  4LBW A;  4G7H F;  1E0E A;  1ZRF A;  2ZFW A;  1X1P A;  1MMA A;  3BY1 A;  4UHT A;  5F27 A;  1B8I B;  3Q0U A;  3BQZ A;  3B82 A;  3DU5 A;  2YX4 A;  3E6B A;  4I84 A;  4E7S A;  4G7X A;  3IH4 A;  1R4N B;  5F04 A;  3PA1 A;  4B3X A;  4EM0 B;  1TYX A;  3S17 J;  3O8H A;  4NK8 A;  1K78 B;  3BTJ A;  5KAI C;  3K4M A;  1TC3 C;  2VJJ A;  3CJQ B;  4HX7 A;  3W5V A;  1NG7 A;  2CWE A;  1O8D A;  1AA7 A;  1UCR A;  3H94 A;  1ZLJ A;  5ERI A;  1X1C A;  2V7X A;  4ASN A;  2EB7 A;  2CRG A;  3JSO A;  2OTJ B;  5E79 C;  4EV0 A;  5EZG A;  2Y0S N;  3CUQ A;  3KPH A;  4A6E A;  2FA5 A;  1WI9 A;  4UB6 C;  1P4A A;  1OQY A;  4WXC A;  1WXR A;  5D5U B;  1S7A A;  5E1W A;  5E17 F;  2M3A A;  3MQ0 A;  2QN6 A;  4XOP A;  3J7Z I;  4A3G J;  3F6O A;  3KZZ A;  3VPR A;  2R7X A;  1DP3 A;  3DBH B;  2BXY A;  3DLA A;  2ACJ A;  2K9Q A;  5HNH A;  2C2W A;  1UD6 A;  3HOT A;  5GAG J;  1AIR A;  3R6J A;  4L9V A;  3JRD A;  4RA2 A;  3VOE A;  5LD2 C;  1UHW A;  2O9L A;  3GVJ A;  3KP3 A;  1X4P A;  4L8J A;  1FPQ A;  2G0Y A;  1TP4 A;  2ZL6 A;  1YS7 A;  2LOO A;  4IQJ A;  4J0Q A;  2VIX A;  2PQ8 A;  3PFI A;  2V9P A;  4HNT A;  3BPV A;  3CCU I;  3MKL A;  1OIS A;  3AG1 H;  4IHX A;  5FRM A;  3PVD A;  2M2E A;  3J81 k;  3L7W A;  3OYI A;  3ASR A;  2FML A;  2XUB A;  2QE7 A;  3LFU A;  2F5E A;  1NH3 A;  3AL0 C;  2BE5 F;  1N07 A;  3HSE A;  2G7U A;  2CUJ A;  3HTU A;  2CW8 A;  2HXI A;  1VQ7 B;  3NWT A;  4NNJ A;  1TYU A;  4ITV A;  3GVL A;  2PMU A;  2DIE A;  2RNJ A;  4M3F A;  3MMP A;  4P12 A;  4B43 A;  2PN6 A;  1FBU A;  3WE3 A;  3ML6 A;  5BPD A;  3AVT A;  5DDG A;  4EJU A;  3CC4 I;  3SZP A;  4ZJZ A;  1XQB A;  4OJL A;  2GIV A;  2JSP A;  2VKH A;  5GTI C;  1W5T A;  1U9O A;  2EV0 A;  1EFR A;  3W6V A;  2K7L A;  4RM3 A;  4CCK A;  4OMY A;  1D0X A;  3R61 A;  2BM7 A;  3QPS A;  4KT6 A;  1VHO A;  4LK0 F;  3RKQ A;  3N4M A;  4CCO A;  3BY2 A;  4PC7 A;  1S29 A;  3WTZ A;  2MLK A;  3CCV B;  3BH4 A;  3OOC A;  4BS9 A;  2R5Y A;  4DQ2 A;  2ID3 A;  1S7E A;  1IV6 A;  2AQE A;  1YJW I;  1OCT C;  1X2N A;  2VNJ A;  4OAY A;  1UHS A;  3CDL A;  2JVH A;  2W82 A;  4KIF A;  5E18 F;  1XGM A;  5IP6 A;  3CCR I;  1OFE A;  4HST A;  3RZD J;  2CQN A;  3E6D A;  2X1D A;  2AXT C;  5D5X B;  1IN8 A;  4M3D A;  1I8D A;  4FWT A;  1SM4 A;  3DPL C;  4JK1 X;  4YAO A;  4YFO A;  1YS6 A;  3OJX A;  1YJN I;  4P6Y A;  1Z7L A;  1ETX A;  4BJ5 C;  2OAZ A;  3U21 A;  4UZF A;  1GAW A;  2BW3 A;  3ZBT A;  4OIO F;  2WA0 A;  3BT9 A;  4IRH A;  2P5L C;  2PX9 A;  1JHF A;  2LF7 A;  4KIG A;  3V8L A;  1HF0 A;  2IGO A;  3DU6 A;  4E6K G;  1BBY A;  2RDP A;  3MD2 A;  4A6D A;  2F1M A;  3F3X A;  4I0A A;  4OAZ A;  5J1Y A;  5FO5 A;  4KA4 A;  4YFK F;  1IDY A;  1UB9 A;  3BWG A;  5H6Q A;  2HZT A;  2RV8 A;  5CVR A;  1QUF A;  3ZPN A;  1KU2 A;  5K5R A;  2MAB A; 
#chains in the Genus database with same CATH homology
 2X6W A;  3SUC A;  2VLA A;  2O5R A;  3A3G A;  2UVE A;  2VQG A;  4CSW A;  2VXZ A;  1XG2 A;  3ZCO A;  4E4H A;  5CQG A;  1PLU A;  1JRG A;  1WJC A;  2XGJ A;  1UG0 A;  1V5F A;  4C2L A;  3AL0 B;  3QYB A;  4C30 A;  4FXU A;  3OL4 A;  1V0E A;  4HIZ A;  3S3M A;  3RTR A;  1SAU A;  3S3N A;  4W8T A;  3BCF A;  1BR4 A;  2KP6 A;  4LIU A;  1X1D A;  2CV1 A;  1O8E A;  2V7F A;  1D1B A;  3I3L A;  1D0Y A;  2HZD A;  4P1W A;  3A3B A;  3EUK L;  4DK0 A;  2GK6 A;  1ZEL A;  1H8H A;  3OYM A;  1X4O A;  3DTK A;  4HEA 2;  2CW7 A;  4XKW A;  4Z1M A;  1VZ0 A;  1WJE A;  3L2W A;  3HG9 A;  2R7T A;  3GQB A;  4E0F A;  2M7A A;  2XC7 A;  1O8I A;  3OYF A;  1KCC A;  5CDF A;  1O8H A;  3SEZ A;  2GOM A;  2L9N A;  4BEH B;  2HVQ A;  4HSR A;  3S93 A;  2V4J C;  3H5A A;  1P9Q C;  2F6C A;  2UWM A;  3IP4 B;  4HNU A;  4BU2 A;  4XR6 A;  1FMV A;  2KPM A;  3OIP A;  2BW3 B;  3EPZ A;  1MAB A;  4CCL A;  4TSF A;  3SEQ A;  3G05 A;  2JVG A;  2VAS A;  2ELJ A;  2RNG A;  2M4K A;  2VXD A;  4XMY A;  4PSX A;  3H0D A;  2R7R A;  3K4N A;  3VSK A;  3VSL A;  2ZZE A;  1HG8 A;  2V26 A;  3T56 B;  5HKK A;  3RSN A;  2KL4 A;  1VBL A;  4YEJ A;  2NTQ A;  1IA5 A;  2R7W A;  3W2A A;  1BPL A;  3ZSC A;  4F91 B;  4JQF A;  2IGN A;  4GRI A;  4EAT A;  2A6T A;  3OYA A;  1ERD A;  2IS4 A;  1WJA A;  3PL8 A;  2DJI A;  3OYB A;  2OV7 A;  2QKM B;  4DBQ A;  2E1M C;  1R6R A;  3VYR B;  2NOJ B;  4KIS A;  1E43 A;  4B44 A;  4OJP A;  1O8F A;  2WAE A;  2IGK A;  1SFK A;  2V9K A;  4CA0 A;  4BE0 A;  3S3O A;  2X8K A;  3GBG A;  4XKC A;  4JOM A;  1MW7 A;  4P5O A;  3K4J A;  2XF6 A;  2VQL A;  2XND A;  3V42 A;  2LY1 A;  1N75 A;  2BVM A;  1TT0 A;  4PSW A;  4IX7 A;  2I8D A;  1YX3 A;  2OUM A;  3OAA A;  3DPT A;  1FX0 A;  3VSU A;  4BGD A;  4AVZ A;  3CES A;  1G8X A;  4CUG A;  4G6T B;  1IDK A;  2JJ1 A;  3PNY A;  3CJR B;  4PJL A;  2HPI A;  4XQF A;  3OYD A;  3KYL A;  4PFO A;  5HVQ C;  4E7H A;  2FUG 2;  4OWR B;  3OEH A;  2BSP A;  2VJ5 A;  4OZY A;  4D1Q A;  1X0C A;  4BAC A;  4BQQ A;  3OOU A;  1NRK A;  1W36 D;  2L5Q A;  2M4G A;  3D5R C;  1D0Z A;  1W0J A;  3GRH A;  2LY2 A;  3OWT A;  2Q2E B;  2VQC A;  3LMM A;  3I9V 2;  3KEY A;  3MKW B;  3PNT A;  1PE9 A;  1OGO X;  2E5N A;  3KRG A;  5CKT A;  1PKV A;  2WJY A;  4BDZ A;  3OS0 A;  4XOR A;  1VF7 A;  2K3P A;  3QOD A;  1Z3X A;  2PEC A;  3PFY A;  3GVK A;  3H9G A;  2WZP P;  4R79 A;  4BUP A;  4E7K A;  2DT7 B;  1NG6 A;  3OYK A;  2PMZ A;  2Z16 A;  4G6I A;  4HWV A;  2ZXI A;  3LSM A;  4BEH A;  4ZDO A;  3UR3 C;  3RPU D;  2GK7 A;  2ZTN A;  4XON A;  5C1E A;  1DBO A;  1KTW A;  1BR2 A;  3QYF A;  2CFO A;  4XM3 A;  4DIQ A;  4XKB A;  3H5R A;  3FBI B;  2IQ7 A;  2O04 A;  3LSG A;  4CCJ A;  4OJ6 A;  1GQ8 A;  2V4D A;  1NHC A;  2O0W A;  4YRV A;  4LIV A;  4C2U A;  4DNR B;  3WWG A;  4J01 A;  4Y33 A;  4C9Y A;  4CCN A;  4U49 A;  1UEL B;  3S32 A;  2RQQ A;  1W36 C;  1JI8 A;  3OYG A;  2LYC A;  3OR2 C;  2Z2S B;  3T53 B;  2INU A;  3M1C A;  2LC2 A;  2WPD A;  2RRE A;  1I18 A;  4DNT B;  4W8S A;  3L2Q A;  1COW A;  1T5E A;  1WFX A;  5TGT A;  1BMF A;  2PJR A;  1WJB A;  4Y3O A;  3W2V A;  1OOC A;  2NSP A;  3GQ9 A;  4MR0 A;  2X6X A;  2W6I A;  2ZZG A;  2NTB A;  2VL8 A;  4LG3 A;  1K6Y A;  3KX2 A;  1E3X A;  3DDY A;  1HA8 A;  1HZE A;  3GQA A;  3BLY A;  2KMU A;  1V0F A;  2WB1 A;  4XL9 A;  3L2V A;  3SZG A;  4JMQ A;  2DCE A;  4KKS A;  3PSF A;  4IQ4 A;  2IXS A;  4N4N B;  4U7B A;  2NT9 A;  1Z3Y A;  2R7O A;  4F92 B;  2CMP A;  2A5W A;  2F5V A;  4IZZ A;  3FKS A;  4OZZ A;  1MMN A;  1YE9 A;  3A4C A;  3JUR A;  2CV0 A;  4XKV A;  3OYC A;  2HVR A;  2R4G A;  1UD3 A;  4XLE A;  3OS2 A;  2VKD A;  1O8K A;  3BG6 A;  3BCB A;  2E5Z A;  1Y6I A;  3DEE A;  3K4B A;  1SKY B;  3MKY B;  5HOO A;  2HQA A;  2CK3 A;  2P0W A;  1O88 A;  1QU3 A;  2WJV A;  5IK2 A;  2V6E A;  3W3C A;  2INV A;  3C2H A;  2VQH A;  4XN3 A;  1QCX A;  2QX3 A;  2PYH A;  2VJI A;  3K4C A;  3G2B A;  2HU9 A;  2OC6 A;  4BJT A;  3ZIA A;  1W0K A;  2BVL A;  3HKZ A;  1PJR A;  1OB0 A;  3HXL A;  2X1C A;  3VYT B;  1MMD A;  3RQ4 A;  2E1B A;  4YZ0 A;  2NTP A;  2AQF A;  3FDY A;  3ZGK A;  1OHH A;  3OPO A;  1BOB A;  2WAQ A;  4II3 A;  2VB6 A;  1TZL A;  2W4S A;  3DWL E;  2PJR B;  3FPP A;  1BN8 A;  2Z1D A;  2XF5 A;  3AKZ A;  5KCM A;  3FKJ A;  2O0V A;  2UVF A;  3FY3 A;  4D9J A;  3L2R A;  4KKT A;  3K4K A;  3L2U A;  3VYS B;  2XOK A;  3HPH A;  3VR6 A;  2ODL A;  5HNF A;  3T51 B;  3OYE A;  3VSV A;  2LG4 A;  4ANJ A;  4OJO A;  4NUB A;  5FRN A;  1KCD A;  4UZU A;  4DJA A;  3HPG A;  4NC8 A;  4E7L A;  1DBG A;  4ZDP A;  2W00 A;  2QKL B;  5CQE A;  2MD0 A;  4E7I A;  2EWE A;  2WY8 Q;  3OFN A;  3NE5 B;  2ZZF A;  2W6J A;  3VDX A;  3T9G A;  2DXI A;  2WBM A;  3BCA A;  5HLT A;  3TBI A;  3K70 D;  1U0J A;  1E3Z A;  3CP8 A;  1WPC A;  5AMV A;  1V5G A;  2E60 A;  1EA3 A;  4II2 A;  3OEE A;  1H80 A;  4NQW B;  5C1C A;  2KZV A;  4E7Z A;  2R7V A;  3VYU B;  4HPQ A;  2XZL A;  1K5C A;  4FAS D;  3IAS 2;  3OR1 C;  2VBE A;  3SYT A;  1RWR A;  1X19 A;  3TMO A;  1LVK A;  3H5N A;  3HC7 A;  4BE2 A;  2PYG A;  1K28 D;  1PXZ A;  4RMN A;  3EUH C;  2K9M A;  4AU7 A;  4BDY A;  4PMH A;  3IUO A;  1WJD A;  2KRH A;  1IDJ A;  1W9X A;  3C2G A;  3AFH A;  3H9J A;  3S8P A;  4PJN A;  2JJ2 A;  2M5S A;  3VMV A;  4GQN A;  2R7U A;  1LDK B;  3F9K A;  2XSJ C;  4FET A;  3B90 A;  3H9Q A;  1V5E A;  3OS1 A;  2HDW A;  1WJ5 A;  4RLF A;  2IS2 A;  1WP6 A;  3MMY B;  4KKU A;  3A35 A;  4DK1 A;  4EW9 A;  3H35 A;  3HL2 A;  2Z6B D;  4ZTF A;  2X3H A;  2ZFU A;  1LFP A;  3EUA A;  3K70 C;  2R9V A;  2WSS A;  1BR1 A;  2GJK A;  2ZXH A;  4F93 B;  4F52 A;  2CUZ A;  3ZR8 X;  2KLO A;  2Y0S A;  1CZF A;  1MND A;  2KQR A;  4QPQ A;  3A1Y A;  2HLD A;  2ZSH B;  3MKZ A;  4IKF A;  4C2T A;  3PNV A;  4KJZ A;  4MLO A;  4PJJ A;  4XLH A;  3ZXS A;  3FHN A;  3CF2 A;  4TKO B;  2JA2 A;  3ZQQ A;  1QHG A;  4RLQ A;  2XZO A;  2LH9 A;  2V1N A;  2MYS A;  2ZSI B;  4B47 A;  2XZP A;  3D5L A;  3E0J B;  3B8Y A;  2UV1 A;  4F55 A;  4YEL A;  3BG7 A;  2XDV A;  2M0M A;  1Z21 A;  3KEW A;  3OW7 A;  5FRO A;  3TL4 X;  4PJM A;  5JHF A;  3ZPP A;  2UUZ A;  3QYE A;  3M8J A;  2QXZ A;  2JDI A;  3LL7 A;  3HOS A;  4ZDL A;  1IB4 A;  2LBF A;  2F43 A;  2NT6 A;  2ZTG A;  3K4L A;  1EE6 A;  2ZZQ A;  4XNF A;  1JTA A;  1Y56 A;  1WTH D;  2VBK A;  4Y4R A;  4H4K C;  1NBM A;  1OFL A;  4BQN A;  2LZJ A;  3UW0 A;  4DOZ A;  1O8L A;  1HVX A;  3ONQ A;  3PUB A;  2IS1 A;  1S9H A;  5DN6 A;  5FL7 A;  3DPU A;  1GLN A;  1BLI A;  4B3G A;  4Z05 A;  3BCD A;  5LFA A;  1E0E A;  4KIT B;  2V31 A;  1MMA A;  3N05 A;  2X1E A;  4RM2 A;  4QPO A;  2L2O A;  1N77 A;  2V7Q A;  4XD7 A;  4P22 A;  3DU5 A;  3OYJ A;  4I84 A;  4E7S A;  4DBR A;  2KHM A;  3ZRG A;  4G7X A;  1MNE A;  1DGW Y;  4B3X A;  1G59 A;  3BC9 A;  2HNH A;  1O8M A;  2NST A;  4NK8 A;  1T0F C;  2R7S A;  1OR7 C;  2CS3 A;  3UNG C;  4XOT A;  1O8G A;  3K4M A;  2VJJ A;  1WJF A;  3CJQ B;  1DQU A;  2JUG A;  2KVO A;  1NG7 A;  1O8D A;  4AYB A;  1AA7 A;  2R7Q A;  3H94 A;  3CP2 A;  1X1C A;  3OY9 A;  4URR A;  4B48 A;  3E1S A;  2K9L A;  3OL3 A;  2M7B A;  4XLC A;  1X1A A;  4BQO A;  4J00 A;  3OMY A;  4W8R A;  3K10 A;  2GJR A;  1OGM X;  3LSH A;  4YXW A;  1UAA A;  3K6G A;  1O8J A;  1DGR M;  4CCM A;  2LBF B;  2WAD A;  4OJ5 A;  4XLA A;  1QJV A;  2M3A A;  3EQN A;  2Z8G A;  3CMM A;  4XOP A;  2D3L A;  3J7A Y;  2X85 A;  4XN0 A;  1KZL A;  2MFZ A;  2O17 A;  4TT3 A;  2R7X A;  1DP3 A;  2XAU A;  3DLA A;  5HNH A;  1D1C A;  4NC7 A;  2HVS A;  1UD6 A;  5CPR B;  3HOT A;  1AIR A;  3GQ7 A;  2CH0 A;  5LD2 C;  2L9S A;  4BL0 B;  3PSI A;  3GVJ A;  1X4P A;  4L8J A;  3PJR A;  4YZX A;  5KHD A;  4BJ6 C;  1UD5 A;  2LOO A;  4IQJ A;  2VIX A;  3B4N A;  5KNL A;  3OYN A;  4HNT A;  2IS6 A;  1KMH A;  3DTE A;  1UD2 A;  2KDO A;  4U87 A;  3OYL A;  1IRX A;  5FRM A;  3OIQ A;  1N78 A;  3OYI A;  2DOA A;  2QE7 A;  3LFU A;  3AL0 C;  3BC8 A;  3HAG A;  1LKX A;  2L7K A;  1VJS A;  1MMG A;  2CUJ A;  3OYH A;  2CW8 A;  4Z03 A;  3NWT A;  2F4I A;  4NNJ A;  4ITV A;  3GVL A;  2MC4 A;  2NZM A;  4W8Q A;  3WQZ A;  2DIE A;  2WY7 Q;  1KON A;  3LSK A;  2GJP A;  2LRD A;  3DKX A;  2MAB A;  4B43 A;  1PYV A;  3VWB A;  2O1D A;  1E1R A;  4Z06 A;  4ZTJ A;  3HUG B;  2W7N A;  4ZYA A;  4U4B A;  2IGM A;  2K5C A;  2X53 S;  1BHE A;  4F3Q A;  2X51 A;  4ZJZ A;  4OJL A;  3FBN B;  4E7J A;  4MXN A;  2JSP A;  2VKH A;  4PUS A;  3SDB A;  4ZC3 A;  1EFR A;  3DQV C;  3A2K A;  4RM3 A;  4CCK A;  1D0X A;  2CV2 A;  3VST A;  4KT6 A;  2HPM A;  2BOL A;  4X0G A;  3JU4 A;  2X6Y A;  3LMW A;  2Q1Z B;  2WAF A;  4CCO A;  1QHH D;  2GOX B;  3BH4 A;  3OOC A;  4BS9 A;  1H8E A;  1OLT A;  1FMW A;  2AQE A;  4HG2 A;  4OAY A;  1J09 A;  2DT6 A;  2JVH A;  2KRC A;  2W82 A;  2LRE A;  2XF7 A;  4CZC A;  2D3N A;  1UD8 A;  4HST A;  1X1B A;  3EQO A;  4XLF A;  1E79 A;  2X1D A;  1I8D A;  4YZA A;  4PK4 A;  4ASU A;  3LNN A;  2W1O A;  1VLY A;  1D1A A;  2VJ4 A;  1RU4 A;  2JIZ A;  3DPL C;  1YX5 A;  3DKY A;  3DTI A;  3GQ8 A;  3VMW A;  1E1Q A;  2VBM A;  3OE7 A;  1Z7L A;  4G7W A;  4BJ5 C;  2VPL A;  3W2W A;  4DGW B;  1WMR A;  3U21 A;  3QOE A;  2BW3 A;  1T95 A;  3NWS A;  2WA0 A;  4CH7 A;  4BXF A;  4B3F X;  3LSI A;  2F1M A;  2IGO A;  3DU6 A;  4E6K G;  2QY1 A;  3MD2 A;  4HRI A;  3IAM 2;  4PFP A;  4OAZ A;  4NK6 A;  4BE1 A;  1OFM A;  3D5S C;  1UD4 A;  3RCO A;  4LIT A;  4YZQ A;  4N4O B;  3ZPN A;  1RMG A;  2E1M B;  3CZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...