4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
4XKWA 2O1DA 1O8HA 3VMVA 1BN8A 1DBOA 2NT6A 2NT9A 4U4BA 3VSVA 2PYGA 1O8KA 2Z8GA 4XN3A 4W8RA 2NTPA 2PECA 4W8QA 3GQ9A 4HWVA 4XLCA 1O8DA 1PE9A 2UVEA 3B4NA 3B90A 1AIRA 1JTAA 4XM3A 4YELA 4YEJA 1O8MA 1XG2A 1NHCA 4XMYA 1QJVA 4MXNA 3ZPPA 2VJJA 5C1EA 3T9GA 4OJPA 1RMGA 1DBGA 1VBLA 3JURA 1WMRA 1IB4A 3GQ8A 4PMHA 1O8JA 1O8FA 3ZSCA 2NSPA 4YZXA 1IDJA 2PYHA 3KRGA 2INVA 4EW9A 1RWRA 1PXZA 2X6XA 3B8YA 2VJIA 1QCXA 4OJ5A 4XOTA 1RU4A 4OJ6A 1GQ8A 4OZYA 1IDKA 1KCCA 3WWGA 2NZMA 2BSPA 4I84A 4Z05A 2QXZA 4YZ0A 4XLEA 4C2LA 2O0WA 4XR6A 4OZZA 4W8TA 3VMWA 4Z03A 3EQNA 1KCDA 2NSTA 4MR0A 1OOCA 2QY1A 3FY3A 4YZQA 2IQ7A 2ODLA 1IA5A 3SUCA 1H80A 1OGOX 4XL9A 1OFLA 1BHEA 2QX3A 1OFMA 4NK6A 1O8GA 4XN0A 3EQOA 1O8LA 4OJOA 2O0VA 1O8IA 4XOPA 4XLAA 1OGMX 4W8SA 2NTBA 4XORA 2O04A 2X6YA 4URRA 4YZAA 2VBMA 3GQ7A 3LMWA 1CZFA 1HG8A 2X3HA 5AMVA 2X85A 3VSUA 4U49A 3VSTA 3UW0A 2UVFA 2O17A 1JRGA 1PLUA 4OJLA 2NTQA 1K5CA 1EE6A 2VBKA 4XONA 1O88A 1KTWA 4XNFA 2X6WA 1O8EA 4XQFA 3GRHA 4AVZA 4XLHA 4Z06A 4XKVA 2EWEA 2INUA 2VBEA 5C1CA 4XLFA 3GQAA 1X0CA 4NK8A
chains in the Genus database with same CATH superfamily
1DGWY 3VO1A 2E7WA 3V42A 1OJLA 5HS7A 2K40A 5A2QZ 2ME6A 2BVNA 1W0UA 2EFQA 1K4TA 4KFCA 1DBOA 2QA4I 2W7ZA 3VSVA 5LBQA 2Z8GA 1E3PA 3KP5A 4X06A 4EATA 4EV0A 1VQKB 4W8QA 2VUMJ 2IBDA 5C4JJ 1WVRA 3CUOA 2WC2A 3PNTA 3PJRA 2H1KA 1JI8A 3H9GA 3OL4A 2A6EF 3GXOA 1MABA 2K4BA 1XQBA 1D1CA 4Z4UA 5L3EA 3NAWA 3T5XA 2RC6A 2EFNA 4NC6A 2E1CA 1Z91A 1N25A 2LKPA 4B44A 3QOPA 1IB4A 5HLIA 4Y15A 1QG0A 3D5LA 4DJAA 5M3MJ 2LOOA 4YAUA 3J80Z 3ASQA 2WY7Q 2C6YA 3OMYA 5D5UB 1ZUNB 4OU0A 2OUMA 2F5CA 1MJ9A 2E36A 4M9SA 1IXCA 1RRJA 2EIJH 3OYAA 3B6AA 5DSZA 4ZGNB 4EW9A 2K9SA 4D1QA 2DU9A 5JFRA 1EA0A 4OJ6A 2FNAA 2ZXJA 2JRMA 3HXLA 4HV6A 3VFZA 2BY0A 3VYTB 4OOIA 4TMVA 4ZDLA 4B4DA 3K1NA 1YQAA 3KP7A 3H35A 3E97A 2KDOA 1TWCJ 2BY1A 4IRIA 5FD5A 3VMWA 3ZMTA 1D2EA 3SZGA 1U2WA 4EJUA 3BTIA 3TL4X 3DPLC 3IKVA 5FD6A 2QY1A 4MFEA 3QODA 3GSIA 1HA8A 2G7UA 3Q39A 1OMIA 3OOCA 1NH3A 1JTAA 4KH3A 1OFMA 3B8HA 3B82A 1JKQC 3PA1A 5F6FA 1YJNI 2E2IJ 1KU9A 4IOAF 3A2KA 1G3YA 4NCNA 1Z9CA 1GT0C 1G7RA 3K2ZA 4XLAA 1KGSA 4U7BA 3JTHA 4JOMA 2NTBA 2DYSH 4YIIA 4RJLA 2Y48A 4PJ0C 3OYMA 5M5YJ 4A3IJ 1XS9A 3F6VA 2CSOA 3MQ0A 4ZYAA 1KU3A 5E1ZB 1OKRA 3T51B 1OCPA 3CCMI 4QPQA 1QX4A 2R3SA 5EYRA 1TQMA 3LFUA 3DCFA 3FWEA 4IJAA 1WCMJ 1VQ6I 3AL0C 3FPKA 5LGTA 3E0JB 1Y1WJ 3HTSB 1IJEA 1B9MA 2FQ3A 3EUAA 4IW3B 1RC9A 3FISA 4XRSG 1U5TA 3FHNA 4XNFA 4ZDPA 3CCSI 2PJRB 1IDJA 3LJYA 4NNJA 1NDHA 2JJ1A 1C0WA 4BHCA 2V7QA 1UHMA 5L46A 3WGGA 1IDYA 4B1RA 1ON2A 2L5QA 3F23A 3U2RA 3V8LA 3QFSA 1IV6A 1O3RA 2B7EA 3PVDA 2MW8A 3J81Z 3DU5A 2O1DA 4DOZA 3CCQB 4I02A 2B63J 3VMVA 4N9IA 4A3FJ 3ZR8X 3K7AJ 3A03A 2C77A 3I58A 2PBIA 1TTYA 4EJWA 4PZJA 4YCQA 1FC3A 3VR6A 1SFKA 5E3LA 2NVXJ 2DO7A 2ZJQF 2LF7A 2ZSIB 1N0UA 4M1KA 4BQOA 3U1KA 2XROA 3S1MJ 4HSRA 1HVXA 3P26A 4CXFA 1MGTA 1NB9A 2XZLA 1QJVA 2XAQA 2V4JC 2PMDA 2EINH 3HC7A 2EQRA 2VQHA 1U9NA 1JTXA 2QWWA 2OBSA 4DZPA 2J5OA 4HQMA 3OPOA 2HVSA 2BM0A 1IB0A 1OCZH 2HGCA 1P9QC 3A3GA 3QE2A 2VB6A 2RAEA 2DCEA 2EFPA 3P7NA 2OCCH 1ZK8A 2JSCA 1Y0UA 1IRXA 5LLQA 2CMPA 2V1DA 2H1LA 4V2GA 3I54A 5J35A 3S1NJ 3L1PA 4LBVA 3I4NJ 2WB1A 3ZC3A 1XSVA 2RQQA 4UV8A 1GQ8A 2CUZA 4HF1A 1BX0A 2LZJA 2DT6A 3H5RA 1FBQA 3ZBTA 1W7PD 3LA2A 2Z2SB 4ESFA 4A5MA 4M3GA 4C2LA 2LP0A 4DNRB 1U3EM 3EQLF 3HRTA 1BJAA 3V8KA 2CFOA 3WBKA 4BACA 1QZYA 4NBQA 1W0TA 3A1PA 1RQPA 4QFMA 1OOCA 2XF6A 3HOTA 1X3ZB 5C4XJ 3L2CA 1TT5B 1PJ6A 1H8AC 2D9RA 1T33A 1VQMB 5F1RA 4AF6A 2HI3A 2DQLA 1J9IA 1Z6TA 5LMZA 2XGDA 3HBLA 1DP7P 2XAUA 3JRHA 3RKYA 2JUGA 1W35A 4DK0A 1EJ9A 4ANJA 1G2HA 4P1VA 1K73D 4U0WA 2IP2A 2O0VA 3G1LA 2L02A 1NG7A 4HX4A 3CCRI 3A8KA 1V54H 1ZKGA 3BCBA 3SFZA 1KYWA 2R7SA 1IJFA 4URRA 2DMUA 1S6LA 3HOWJ 1ZM2A 2ZITA 3CJQB 1O57A 1U5TB 2PJRA 1ZQ3P 1NTCA 2O61A 5LHGA 3V4GA 4WF2A 2R93J 4RD0A 1HKQA 4A3LJ 3SKBA 4HPQA 3F0CA 5EF6A 1IN7A 2BPOA 1U5TC 5CQEA 4F7DA 4QWQA 1W87A 2Q6IA 1K5CA 4ZZDA 1QA3A 3NB2A 3LNQA 2YX4A 1OCCH 2I10A 1O8EA 2E1MB 4Q4ZF 2M7AA 1X58A 3OIQA 3ZPLA 2BMWA 1VZ0A 1JHHA 3CC7I 3OR2C 2EILH 1WSRA 1WXRA 1G8XA 5JLXA 3W2EA 3HYIA 3G6EI 5GV8A 1OFDA 2AS5F 2K27A 4HX7A 1Y0RA 3U21A 3ERMA 4HRIA 3HRSA 5ILVA 1BN8A 3MFKA 1FOXA 1RKWA 3FXQA 2P8TA 3V7RA 5JMCB 2PYGA 2OYNA 2R7ZJ 1MBFA 4HWVA 3BTJA 1GHCA 2UVEA 3P9KA 3GWZA 4XM3A 1O8MA 4RDUA 3G3ZA 3RZDJ 1VF9A 3SEJA 2GZWA 5FLXZ 2ZL7A 2OQGA 2NNYA 3T0YA 2BM5A 2HXOA 1BA5A 3CP2A 5FKNA 2LY1A 5FRNA 4AYBN 4CYDA 1SMTA 1H9TA 3C7JA 3I4PA 5IYBJ 1I39A 3ZQGA 1X3UA 2BBYA 2PG4A 3RTRA 2KIUA 1P7IA 1DQUA 5AONA 4ENMA 4LLLA 1HC8A 1LVAA 3SQNA 5F27A 4CH7A 1I6HJ 2ZBVA 4WX9A 3CJTB 2HYFA 3SLDA 2MG4A 4X7DA 3CD6B 1WJBA 1J7KA 3OL3A 2DA5A 5CVUA 3S3MA 3MZ8A 4X1EA 3OZWA 2VJ4A 1XN7A 2NNNA 2BHZA 2OV7A 5DD4A 2WADA 3O8HA 5AN9A 2G9WA 2VBZA 1PP7U 1WOOA 4WXDA 3SYTA 4F3QA 1EH8A 1SVMA 1XPXA 5IYPA 1O7LA 1D1NA 4X8IA 3JREA 3L7WA 1TVCA 3SLNA 4OZZA 2I1LA 4B3AA 3SDGA 5H6RA 2DJIA 3OR1C 1Q7YD 3KYDB 4Q48A 3OS0A 3OYGA 2VXZA 1W9XA 3GVKA 2F6CA 3FM3A 4P22A 1OCTC 2CW0F 2P81A 3K6GA 1WI9A 4BQAA 2VT3A 1E3OC 4G7HF 3QOEA 1S8NA 4HDUA 3K4LA 4TKOB 2VODA 1K83J 1VQNI 3OS2A 5H59A 3H9JA 2HDCA 4X0CA 1ZREA 3CDIA 1FYMA 3G4SB 2KZVA 3ECHA 3F9KA 5TR9A 1R5ID 2LLKA 2R6HA 3GFLA 1O3SA 1VQ8B 2HOAA 3RQ4A 3GCMA 4XORA 2CV1A 2HFHA 2MSYA 5EEHA 3CCQI 2CV2A 3M3YJ 2RV8A 5M5WJ 4FE4A 2KZGA 3MEXA 3VSUA 4RDJA 1YW8A 4H4KC 3CCEB 3GEZA 2VPLA 4TV7A 4ZCIA 3LO8A 1L3LA 1FY7A 1PJRA 4XSXF 2FSWA 4FHTA 2GXAA 3OIPA 4RAGA 3E6DA 4IEJA 1W5TA 2DA4A 1VQ4I 1O7FA 3GTLJ 4XONA 3L2RA 1EZGA 2KIMA 1IXSB 1H89C 3F8FA 4XQFA 1YITI 1YOVB 4AVZA 3WYAA 4Y7CA 1QUEA 5TGTA 2XVCA 1XGNA 2R0QC 1JKPC 2E1RA 3CCRB 4IXAA 4JX4A 5E3OA 2XZOA 3WQZA 3ZMZA 3CMMA 4M72A 1YG2A 1N78A 2IS4A 1FBSA 3LSRA 4XKWA 1MMSA 2KRFA 1SD7A 4HIZA 2CU7A 4R8HA 3I1FA 1R6RA 3TDZC 3JU4A 2VONA 1MDMB 3CRZA 5IK2A 1V3FA 3E1SA 2BZTA 4A5NA 3BCDA 3WTVC 1OB5A 3C1DA 2L9SA 1RUOA 5CKTA 2DBBA 2L0KA 2NS7A 4UB8C 2QEXB 3CCUB 3CF2A 2ZL5A 2K7LA 1LDKB 4RAZA 4DQKA 3WODF 4OPOA 2CW7A 1ENHA 2Z16A 2Z99A 3H9NA 1XGOA 3DF8A 2O5RA 2H8WA 2HZTA 4RS8A 4QUZA 1W5CC 3JURA 3JSPA 2ETHA 3F22A 2GJRA 4OWRB 2MFZA 2LKSA 2XPWA 2HYJA 2CQNA 3BG6A 4IOCF 4UUTA 4KMUX 1HSJA 2DAOA 3HHHA 5HODA 5DN6A 2TDXA 3SJPA 4A6EA 4RGXA 5C3EJ 1PVEA 2FD5A 1UD5A 3FHZA 4HV5A 3DPTA 2X6XA 4GCVA 1PXZA 2ZNYA 2KPMA 5AIQA 1TWGJ 3K1PA 3REOA 4W97A 3AG3H 3HUGB 4MEYF 3BY1A 1X1CA 3SYJA 2K3FA 2BOLA 2DA6A 3KFWX 2HQNA 3F3XA 3HAGA 2B0RA 1DUXC 1J2XA 3LNNA 3OZVA 4C30A 2AO9A 4BQQA 4MR0A 1JA1A 4A93J 2WJYA 2EBIA 1FP1D 2DQRA 2Z1DA 1MSFC 3RPUD 3M4OJ 1TW3A 2L9VA 3N97A 1I7PA 2RC5A 1R5BA 2QX3A 2Z33A 3H5NA 2EA2A 3Q3SA 4A3KJ 3CCLB 5B5EC 1AOYA 3U6KA 1B2RA 5L3GA 1R7JA 3OOPA 2W6IA 3S1RJ 2CW8A 2O04A 1KQ8A 2XTXA 2K9QA 3BNWA 3RKXA 5IT3A 2CRVA 1JJ2B 5IOZA 1FNBA 2RN7A 3GVAA 3HEFA 3JTGA 3HDDA 2Q8KA 3ABMH 3UW0A 3BTLA 1S3JA 3W5HA 1TUIA 1S72B 3PFIA 5FKOA 2M30A 5LEKA 2ZFUA 5CVIA 3FXRA 4DBQA 1GV2A 1LDJA 2ELKA 2YS9A 1I1SA 4UY8I 3N6ZA 3Q38A 1XGMA 2PLYA 4RLZA 1QRBA 3U9GA 2WSSA 2AHQA 4HSTA 3CCMB 2PX9A 2DXIA 3MKWB 1HKTA 3HIFA 2VBEA 2X6WA 2O6GE 5KW9A 3WE2A 3OZUA 3P4GA 4NBSA 3FXMA 4L0ZB 1D5VA 2INUA 3MZYA 5HS8A 9ANTA 3CJRB 2CQ7A 1TYXA 1KK3A 1YRNB 4OINF 5E3MA 3H1CA 3VNVA 2VFQA 2ZZGA 3ZN1A 1JHFA 3MKZA 3BY2A 4ASUA 4P9FA 3VYRB 2LBFA 2NT9A 4LB5A 2O3FA 3LQ6A 2YPRA 1A5JA 2JN9A 3WU1B 4PFOA 2EZKA 2DA2A 2X1CA 5J3OA 2QGUA 4EGZA 1W0JA 2CS3A 3BH4A 2EIMH 2VE9A 3TBIA 2BXYA 2OTLI 5A88A 3J7YJ 3BJOA 1YS6A 3NAUA 1VQLI 3ONYA 2KT0A 2W1OA 3JRIA 1W1WE 2PMZN 1EFTA 2C5HA 2XTYA 3BWGA 4N3GA 1HDPA 2L7MP 4GDFA 2LFBA 5DNSA 3W5VA 4QPOA 1BC8C 3QFTA 2VFPA 4ZCMA 1UELB 4I7HA 1AHDP 3BPVA 1K6YA 2A5YB 1F1ZA 1T08B 3NQOA 4RMNA 3HOUJ 5JR3A 4L9NA 3GLLA 1BI1A 2EV5A 2XAJA 3IWFA 3LQRA 5TRDA 4P26A 4G7WA 1V5EA 1R1UA 3LOCA 2IVMA 3GFJA 1BR1A 1YO5C 2ADUA 2XF7A 3GUDA 2HDWA 5ICCA 3KP6A 1NB0A 1X1DA 2R7VA 3Q6QA 1RU4A 2V5IA 4A3GJ 1WRJA 5F4OA 1IDKA 4HEA2 1QGZA 4PC6A 4OPWA 2GIVA 2JUCA 2L4MA 3S2HJ 2R7OA 1ETQA 5JLWA 5K5RA 3WNDA 3M8FA 2BSPA 3PA2A 4I84A 2DOFA 3PSZA 1YHQI 5BPDA 2CK3A 5HLTA 1D0ZA 2DODA 2F5FA 4D7MA 4DIQA 1VQOI 4P6VF 3BR2A 5HDKA 5IOYA 5CQGA 3OJXA 1WOPA 1K6OA 1WH5A 4PDKA 2LVSA 1XC5A 2IS6A 1R5HA 1YE9A 4RGRA 4M3EA 1GVDA 4NHJA 2JA5J 2R9VA 3FF5A 5FLMJ 2X8KA 2BGCA 2XGCA 3CP8A 3BCFA 4C3IJ 1JA0A 2Y69H 5D8KB 4KMFA 2G0YA 1UB9A 1BIBA 2M7BA 2Q2EA 4A3CJ 1Y0YA 5F4JA 3NARA 1M1KD 1QQIA 2Z3YA 2HWVA 4WZEA 3W6VA 2F48A 1HCRA 3BR1A 4XN0A 1V5VA 1LLWA 1T98A 4LIVA 4BYYA 3CMYA 3BJAA 1IN6A 3RSNA 1LE8A 1UJ8A 2DMTA 3TO7A 1R4MB 1S5LC 3I59B 3I0TA 3VSLA 1E1RA 1I8DA 3JQRA 3ZQCA 3IH3A 5D4RA 2J8IA 3H0DA 2NOGA 3DV8A 1HW1A 2VBMA 3L2WA 2ECBA 2ZL6A 4Z4ZA 2A6HF 4EEFG 4JK1X 3R6JA 5CPRB 2ZFWA 4QTRA 4OP7A 1BOBA 4FISA 5FO5A 4IVNA 3FJOA 2BV6A 1JTYA 4MNUA 5JLVC 1MJBA 2Q1ZB 4BJ6C 1EE6A 4I01A 2QSGX 2DPDA 2WAQA 2VFOA 2EPFA 3SDBA 2KIQA 3ZN0A 2ZCWA 1T6ZA 2UXNA 2FE3A 1IUFA 3ML6A 2JVGA 3MAJA 1FJLA 1WTHD 2D3NA 3UKGA 1SD6A 4A3DJ 2MABA 4YEIA 3BT9A 3AVXA 4RLFA 2X6OA 1OFEA 1QH0A 3GQAA 1QPMA 4P55A 2GOXB 5FKLA 2XNDA 4WXHA 3LA3A 4CGZA 2LY2A 2M87A 3GTOJ 2XASA 1ETYA 3K4JA 2JPBA 4NDLA 2NT6A 4KN4X 1WPKA 3VNUA 3MWMA 5JHFA 3AGPA 1Y0NA 2QM3A 1K8FA 2CQKA 2XAHA 1QRCA 4E70A 3H36A 5IYNA 1ZGJA 2OJED 4DNTB 3VODA 2JT1A 1EH6A 2RDPA 2M5WA 2CFXA 2QZ8A 1U6GA 2LRDA 1FBUA 4M9XA 4A0ZA 1SEUA 2JVHA 4U7DA 4UNOA 1QZEA 2VJJA 1OGJA 3GLXA 4ZV4A 4P25A 4J19A 4II2A 3IRRA 1G7CA 2FF4A 1B72B 2L9RA 3K2AA 1LEBA 4PC1A 2YU9J 5IYWA 5A8AA 1YYVA 3QQAA 1ZM9A 3JSOA 2C4TA 2ZXHA 4QVJA 2KKOA 2W84A 3GTJJ 2PMHA 1WKMA 5IT9K 1L1IA 1QCXA 2IS2A 2EH3A 1WPCA 4NC8A 3N90A 2GREA 4CA0A 2DI3A 2PI0A 5F08A 1W36C 4EM0B 1R1VA 1U2RA 4OAYA 1WWXA 1M1EB 4G94A 4IQ4A 4R79A 4LLNA 4TMTA 5L3FA 4X7FA 2OTLB 1U0JA 1JXSA 3I3LA 2R5ZB 2OZUA 1IHMA 2QTZA 4KKUA 3KP4A 5B66C 3CO6C 3H92A 3R61A 2IEKA 2IPQX 3ZQ7A 4ZTJA 1X3WB 2FOWA 2VC1A 3Q9VA 2E71A 1DARA 2JIZA 4S05A 1XMXA 2HQAA 2DFHA 1IA5A 1SM4A 1JE8A 5F0HA 5EGOA 4RDKA 1PUFB 1FP2A 2PMZA 1T56A 2VBUA 4A3MJ 4IPAA 1MH4A 2H94A 1QNTA 4OIPF 1YI2B 1VQPB 4E7SA 2HOEA 3D1NI 2V26A 2ELJA 1MNEA 5TISC 5IYDJ 4RCYA 3E7LA 3K9TA 2DTRA 4X6AJ 1IC8A 2DK5A 5D8LB 1ETKA 3J7ZI 3JQPA 4MHGA 2K85A 3GX4X 4GFBA 3ROUA 4XRSA 2BM1A 5IYRA 1YW9A 1SC7A 4RD1A 3PUNA 2OAZA 1OLTA 2XPUA 1JJ8C 2ID6A 2VN2A 4B43A 1EP3B 1WSUA 2ZZFA 1S7OA 4FQGA 1RETA 4PJMA 4MO7A 5FIUA 2FJ1A 3FMSA 1A6QA 3M7GA 1TC3C 4MGRA 3W3CA 4BQNA 1FX7A 2HXIA 3T8RA 4MLOA 2EFWA 5E79C 4M73A 1IXRC 2JMWA 2ZMEB 5LRSA 3AAFA 5E20A 5M3FJ 2MGQA 3N05A 3PIOF 1DDGA 2VBKA 2VBWA 2IGKA 3KP2A 5J6XA 4BHBA 4BXFA 3CCJI 4E7KA 2VNJA 4C2MJ 3E20A 3FDYA 4MYTA 2BVMA 3LSMA 4PSWA 2GJKA 4MYUA 1YX5A 1MBEA 1DU0A 4RDLA 2DLLA 2ZC2A 1R23A 2L54A 3F6OA 2XT4A 4D0PA 3FXJA 1B8IA 2NXNB 4N9HA 3GTPJ 4M6XA 3OW2B 2IOUG 3CMEI 2E19A 4RPBA 1MBKA 1JGGA 4V19K 2EJRA 1BMFA 4XN3A 1V5GA 4A0XA 2NTPA 1VQLB 4Y52J 2C4UA 4WK8F 1WOSA 4M0LA 3IC7A 1QVGB 2HQ5A 1T0FC 4LIUA 2OBTA 3B4NA 2ZNZA 3OE7A 4I76A 2KVOA 1W36D 1VQ5B 1DABA 2EA4A 3BCAA 3DPUA 2ZJ2A 3SJMA 1N08A 4KDPA 2DETA 2Q0OA 1B23P 1BX1A 1ETWA 1F4KA 2BM7A 2QENA 4JQFA 4HLYA 3R4KA 4AIHA 3KLNA 3TO6A 4B4CA 4C2TA 4ZZLA 1XG1A 2GIZA 4PK4A 4ENKA 2L3DA 1EKEA 2QQBA 3RPUA 3OEHA 3GQ8A 1FTZA 3BDDA 3CZ6A 1O8JA 3LQQA 4LFUA 1G6NA 1O4XA 3RCOA 2M8GX 1DGRM 4Y13A 2E5NA 2NS8A 4PJLA 1ZR4A 3FBIB 2L2OA 4FX4A 3RIQA 1RWRA 2Q6LA 1QA1A 2WA0A 5BOXA 5IT9Z 2X53S 1G7SA 3A8JA 3A3BA 2Y9YA 3K70D 3W2IA 3S16J 3O2PE 1Y6IA 3WWGA 3LFKA 1REPC 1H9GA 3JAMZ 2LSOA 1VF7A 1P92A 1UD8A 3HGGA 2NVYJ 4PC2A 4CCLA 4EMSA 1VQMI 4NQWA 4ENJA 1TNTA 2B0LA 1U8RA 4P3YA 3TKYA 3K69A 2BV3A 1KQ0A 5FJ8J 1Z1DA 1KCDA 5FKKA 3AFHA 1H8EA 1UD3A 4A12A 2VKEA 2BM4A 1YX2A 3CXCB 1WQ2A 2JN6A 4RB2C 3C2HA 5EJCA 4CCOA 1X1AA 4XL9A 1XSDA 3JRCA 3HOZJ 4LMYA 1OPCA 2STWA 3FK7A 1Y56A 2NRAC 2QSHX 2KISA 3G73A 3C2GA 1QHGA 4KIFA 4KISA 4A0YA 4OIRF 1UD6A 2PEXA 3JCUC 5LGNA 1WJEA 1Z3XA 2DTZA 4LK0F 4IKFA 4HF0A 4XOPA 1O8IA 3C3WA 2CF4A 2XIGA 3CPXA 3QP5A 1OISA 4LITA 2R7DA 3AK5A 5HNHA 5HOOA 4HYEA 4YFXF 2LTPA 2XGXA 5K7FA 5E8GA 3LSPA 1JKOC 1X4PA 1PKVA 2GXGA 2E1BA 3U1DA 1IN5A 3GZ5A 2EV0A 3MMYB 3PNVA 5J1UA 3PUMA 5DCMA 2W4SA 3FM5A 5DDGA 3ZMSA 3OYHA 1VTNC 5LRRA 1XCBA 3CW2A 4WZTA 3M9AA 2QQ8A 3QYFA 2P4WA 2OTJB 2DOEA 4QSHA 5EG0B 4CYCB 2VOPA 1F60A 4LD5A 1T39A 2XAGA 4BJTA 1A6IA 1GXPA 4LBYA 4RM2A 3OS1A 1H0MA 4HW0A 4BBRJ 1ZRDA 2V6EA 2EIKH 4WWVA 3PENA 4CZCA 2UWMA 1JJ6C 1JGSA 1QVTA 4TT3A 1TWFJ 4JX5A 1VNDA 3TW7A 2BF4A 2QDXA 3LSTA 3C18A 4BL0B 3V76A 3D5SC 3EYYA 1FMWA 4ZYHA 2WTEA 1VQPI 1YI2I 4HAMA 4RM3A 2PECA 2LYCA 3U6BA 1W2BB 3L00A 3O8GA 1VQ7I 2LF8A 1N75A 2A3SA 4HX8A 4YELA 5FFXA 4A3BJ 1MH3A 2FBHA 2W00A 5DTDA 4AD9A 2QYOA 3GMEA 2HYGD 1W4MA 1XG2A 4BKXA 3KX2A 4XMYA 2HTSA 4UUVA 4BAYA 2P5VA 3Q9SA 3W6KB 4DZJA 2R7TA 2E1NA 4L9JA 3FX3A 4X05A 4G6QA 1KU2A 1VBLA 3HZJA 1BW6A 2GBYA 3MD2A 4Y7NJ 1P4XA 2OC6A 1Z6RA 3ZOBA 2J8KA 4F92B 3OW7A 3J80K 2KRCA 1QFJA 1K28D 3QAHA 2WR8A 2LK2A 5JI6A 2XGEA 1X4OA 4AIJA 1BOAA 2VFMA 1U78A 5KHDA 4J01A 2C5BA 1B59A 1E3ZA 2XEXA 1HQCA 3ZZTA 3FKJA 4S04A 1BI2A 1OCOH 3LA7A 4I09A 5DYMA 2BX6A 5H2FC 3B8YA 3BC9A 3CLQA 3SZPA 4BH9A 1KJZA 4YAFA 4PGGA 2BY3A 3A4CA 3CESA 3TW6A 1ZLKA 3E5UA 2L7ZA 2IT0A 2VJ5A 3ULQB 1E63A 1KK2A 3ONUA 4P3IA 3W2GA 1PJ7A 1UHSA 3AVVA 3IP4B 1JKRC 1VQ5I 2QXZA 3RIRA 3TEDA 2X0KA 4LBWA 3CC2B 2QLZA 5TJJA 4MTEA 2I5UA 2V9PA 5DUKA 4M6VA 1NG6A 4BJ5C 3IRQA 4UB6C 1YS7A 3K4MA 3LMMA 4W8TA 4EM1A 2J7KA 3CCLI 3CTAA 1W5SA 1VQ8I 5J3LA 4Y9RA 1BI0A 1PYVA 4L9TA 2IQ7A 3TOAA 1ACIA 3PM1A 3OP1A 4M2LA 1OGOX 3ABKH 2LKXA 4RCZA 3AVUA 4IHWA 3ZQHA 5BMZA 2QCOA 3CUQA 1ZARA 2MC3A 3IL2A 5F0CA 2EWNA 1FIPA 1LLZA 1Z67A 5B1AH 4JBAA 4G5GA 1EF4A 2BW3A 2R5YB 2HDNB 2XZPA 4OAZA 1XDSA 5LEJA 2D3LA 5KVRA 5J1RA 3H5AA 2FA5A 3G1MA 3TDUC 3GBGA 2ACJA 4AC9A 1CQTA 2ZTNA 5AMVA 4BE1A 2C2WA 4A3EJ 3HOSA 1K78A 4YFOA 2DMNA 2V7UA 1JRGA 1V5FA 2YWGA 3ASTA 1Z0XA 4BY1J 3HSEA 3ASPA 1ZG1A 2OBPA 3TP3A 2IXSA 2WAFA 2X9DA 3HOYJ 2F1LA 1BL0A 3CDLA 1WJCA 2GQFA 2Z6BD 1KQ9A 3RI4A 2VQLA 4B47A 3DU1X 3TQNA 1MW7A 2V6CA 2YU3A 3OYEA 1P6RA 4IHSA 1X19A 3WU2C 4BUPA 2ZJPF 2EWEA 1K9MD 1F43A 2OF7A 3OYFA 3CCVB 1OB0A 1X1BA 3M8EA 3CCUI 2XB0X 1TYVA 2KRHA 2QGGA 4IHVA 3G1OA 2CQQA 3PSIA 4LB6B 3W2AA 4OPVA 3R6SA 3W6JB 4QVAA 3PSFA 2F5DA 3OYNA 4FK8A 2QQ9A 2E35A 4Z4VA 2GQQA 3G71B 2G0EA 3ISXA 3L9FA 5L3CA 4Y3OA 2FOKA 5E1XA 1ZG3A 3KZYA 3EPZA 4MEXF 4Z4SA 1I50J 1D1AA 4RBOA 1GVHA 1R36A 3Q3AA 1POGA 3ASNH 2GXBA 3GQBA 5D5WB 3ZQFA 2HU9A 2QUFA 1QA6A 3T9GA 2TCTA 2Y2ZA 2LY9A 1MD0A 2VE8A 3G4SI 3DTEA 4O6JA 1ZN2A 3KETA 1ON1A 3S2DJ 1QGPA 2DDAA 1CF7A 2WYRA 3WY9A 5KSWB 1R5NA 1BQEA 3R0AA 5THXA 3HM5A 4PMHA 5KCMA 1T8IA 3S1QJ 4YIFA 1HBXG 2Y30A 2IA2A 4FX0A 2FU4A 2CW5A 4D5CA 4YRVA 1BJKA 3P27A 4TMWA 4I0BA 4YALA 1VI0A 2PMUA 2VBYA 1SKQA 2NV4A 3KLOA 1J59A 1E64A 3JR9A 2VL8A 4OIOF 4BS9A 1D1BA 1QFZA 1ODDA 1N05A 3DBLB 1I27A 1F20A 1KK0A 2A05A 2JDIA 2K9MA 3I55B 3WTUC 4MFDA 1EFRA 3RY8A 2IGOA 2JA2A 4XR6A 4GQNA 3R6KA 2R7WA 4ZJZA 4A69C 4GO1A 1QFYA 4HQEA 2L4AA 2NYXA 3GFMA 4Z4TA 1EP2B 2W7NA 5KNLA 3JRFA 3RKWA 3P9CA 2BGJA 1P4AA 2O8XA 5FLXK 4D9JA 3H94A 1D8JA 4UUSA 1Q82D 2XV4S 1N8RD 4ETSA 2CQXA 1R9TJ 2QA4B 1BHEA 1FT9A 1OYWA 2DFIA 3OYIA 1J9ZA 1TSPA 1IN8A 1DPRA 1UAAA 5FO0A 4N4NB 4XSZF 1O8GA 2GOMA 5LHIA 2KJCA 4BEHB 1R22A 2XRNA 3PQKA 1GAWA 1MJAA 3CCSB 2EZIA 4R1HA 3JRBA 4L5IA 1TL8A 1OGMX 1G4DA 5KAIC 3ZIAA 1LQ1A 4RAYA 1FTTA 1EXMA 4RM0A 3KZIC 4YZAA 2CG4A 3ABLH 2X3HA 1W34A 4U49A 1VQOB 3CC4B 3T1BA 3J81K 3ZRGA 3HOXJ 4I6ZA 4X7CA 2YUHA 3KP3A 5GADJ 1W7PA 2O7OA 5DS9A 4Z4WA 5ICEA 5FL7A 4YHBA 3WTZA 1S72I 2NOJB 3BR6A 3HRMA 1UD4A 2JJ2A 3FK6A 4KJZA 4Y4RA 3DDYA 4P9SA 2VKVA 2AQEA 3IAM2 2D1VA 5K7ZA 2FX3A 1LVKA 3RPQA 1FSEA 3ASOH 1YFHA 3KZZA 4MIMA 4ZH4F 5C1CA 1I18A 1R58A 2QBYB 2DYRH 2RC4A 1Z3YA 3SHFA 2STTA 3IKTA 2O8KA 2OCEA 1FOKA 1R00A 4K1XA 4A2UA 5IP7J 2DN0A 1S0UA 1E79A 4B48A 1LB2A 3KCCA 2XB5A 2P6SA 4LGWA 4PJNA 4LG0A 2IGNA 2OQRA 4ZC3A 1R5OA 1CNFA 1YLFA 1PE9A 3E5XA 3B90A 3A01A 1SKYB 2Q6KA 3AVWA 3Q0WA 1AKHB 3BR3A 1UHWA 5KK1A 3K4BA 2FMYA 3CQZJ 1VQKI 3PO3J 3GIRA 4IRHA 4MQVA 4IHYA 1OYYA 3M1EA 2HOTA 3DXJF 4OJPA 2XC1A 2IRFG 2NPFA 2LNBA 3L2UA 4L9VA 4M71A 3V8JA 4ZTFA 1N0VC 1K8AD 1OR7C 5ERIA 2H6CA 3A1YA 3M8JA 2YSRA 3CCVI 2F3LA 1OR7A 4TSFA 2BEOA 2RNJA 4F55A 1QQ1A 3J7AO 3BP8A 4PABA 4I98B 2M3AA 2EK5A 4LK1F 1PJ5A 2QYUA 1ETVA 4U88A 4E7HA 2R7QA 3S3OA 2NZMA 3WU0A 1OHHA 3VB2A 5AIPA 3CPWB 3A02A 3CLOA 3R60A 2QF7A 4UVAA 1NBMA 1HLVA 3CO7C 3D26A 3LAJA 5HZAA 1RESA 3PO2J 1QZZA 4RB0A 3MHPA 4LC0A 2HQRA 3DEEA 3CMAB 4AU7A 3MN2A 4QLCU 1AKHA 4C43A 4UVBA 1HSTA 3A01B 4JMQA 2ZXWH 4YZQA 1S4MA 1KU7A 4LG0B 2ELHA 4L5JA 3S15J 1ZGWA 3ASSA 1H80A 2L9NA 3N4MA 1ITYA 2H09A 2RREA 2KL4A 5CDFA 1IN4A 4NK6A 2EFOA 3MCAA 3HRUA 2VASA 2Y75A 2XKOA 3RYPA 2QBYA 3I9V2 1BJZA 5E6TA 3BQYA 2H8RA 3SXYA 4HLXA 4D5FA 2ZZQA 2A61A 1A36A 2M4GA 4Q7JB 2KQRA 4II3A 2GK6A 3A35A 4EJVA 1MBGA 1LKXA 3BY6A 1E62A 4OOVA 4FWTA 4PUSA 3I56B 1VQ4B 4C3JJ 2UVFA 1TYWA 2D74A 4RAFA 1W7PB 2A69F 1ORKA 1XMKA 2XKPA 1FNNA 5DM7F 2W24A 2COMA 2XAFA 3DKYA 1P4WA 1YJ9I 1R4NB 2MA3A 3WG7H 1ZRFA 3OYJA 1HW5A 3WNBA 2VBSA 3K4KA 5CLSA 1O3QA 4BPRA 1GJRA 1KC8D 3GRHA 4V02C 1FOYA 3B73A 4XRMA 3QYEA 2RNGA 2JQ7A 1KQSB 4C0SA 3HSFA 4RD6A 2F5VA 4HNTA 2B5OA 1R49A 1BI3A 1X0CA 4S0HB 4BEHA 2BVLA 1EWYA 2XGJA 4YAOA 3T53B 1RUNA 2HEOA 2F4OB 2ZB9A 2E2HJ 3OIOA 1K79A 1O8HA 4XLNF 1FOWA 3K70C 4IO9F 5DUIA 1SAXA 2DIEA 2VC0A 2M0CA 4UUSB 4FETA 4WQMA 4PSXA 1RI7A 1Z7LA 1SFXA 3C2BA 1IDZA 5BPIA 3WTSC 4XKCA 4G9YA 1VHEA 3BZKA 3V7CA 3E3VA 3LSIA 1MIJA 1NRKA 2P0WA 3LSHA 3SZTA 1KZLA 1ZGAA 2IJLA 3NWTA 1RMGA 5GAGJ 3ISPA 2R7RA 3BTCA 1WMRA 4P96A 3QSYA 1IO2A 1I5ZA 1GV5A 5J8FA 2ESHA 4G7ZF 1FDRA 2O0YA 3ESWB 5ED4A 2WPDA 2A6TA 2XOKA 5EZGA 3CD6I 4FXUA 3H3UA 4Y9UA 2E34A 3B78A 2W57A 2MLKA 1FPQA 1K61A 4ACAA 3OAAA 3CMEB 1UD2A 4KN7X 1P2FA 4X0GA 4G1VA 4OJ5A 3FIWA 2PLFA 2JPCA 2NAZA 3AKZA 3P9IA 4PJJA 2M9HA 1EFCA 2B7CA 2DJNA 2JRTA 2K02A 3MKYB 3V7SA 1VJSA 1CF7B 2Y0SA 4JX6A 2E1MC 4GGGA 2OK7A 4ESJA 3SEQA 3S32A 1UMQA 2BN4A 5IY5H 2E60A 2HTJA 1E0EA 1WJDA 2OD5A 1ZH5A 2M4KA 4XRFA 1TT0A 4HNUA 3QU3A 3ES9A 3ZMDA 1PUEE 2MD0A 3ERED 2VBTA 2XRLA 4IF4A 1ONVA 3OYLA 1VHOA 1XDUA 2UV1A 4WWCA 1TQIA 3R0JA 1LUJB 2EV6A 5F04A 3H9QA 2Y0SN 5L3BA 4CCKA 1O8LA 4OJOA 3TOBA 3BLYA 2EFGA 3Q5FA 2QMUA 3ML3A 2VKHA 2BHYA 1TZLA 4XD7A 4E6KG 1Z05A 4Y33A 5F1JA 3QPSA 3SEZA 1T2KA 1IW7F 4P2NA 3KEOA 5BS6A 3GQ7A 1CZFA 1KTVA 3CCJB 1HG8A 3OEEA 2YR2A 4M53A 2HVQA 3K10A 1WI3A 2KIFA 3BG7A 3E1YE 4B3FX 4M9ZA 2JWTA 4EQQA 1F9NA 2V31A 1EP1B 1AMOA 2HKOA 2CBXA 1H42A 1WORA 3WTXC 1WJFA 4CDGA 1J75A 5J4YA 3KYLA 2HMAA 2ZO4A 3ABUA 1O3TA 4YAWA 4UXNA 1K78B 2X0LA 5H5JA 3IH2A 2F2EA 2NVUB 4IX7A 5DV5A 2DPUA 2DMPA 3HKZA 4YC5A 4XKVA 1EFUA 2VNIA 2ZTGA 3JQQA 3SQVA 1XGSA 2HPMA 3U2QA 2DT5A 3HJEA 5DEQA 5DS0A 3QYBA 3S3NA 2R5YA 3EYIA 2FX0A 2BW3B 2BSAA 3WG9A 1WHUA 4F93B 1YIJI 3OYDA 5LD2C 1TQPA 2NS0A 2X4HA 3BPXA 5D4SA 2M34A 3LVBA 4ON0A 2CYYA 1SMYF 3CUQB 2RKHA 4XICA 1CGPA 1HF2A 3COAC 4EVIA 1SANA 3OYBA 3EDPA 4W8RA 4HA8A 3RJPA 5J40A 2K4JA 2CNDA 5H6QA 2WBMA 2K9LA 4N4OB 2LD5A 5J47A 3S8PA 2WAQN 2V1NA 3DLLF 1IV8A 3IAS2 4CZZA 2VOOA 2RQPA 1N77A 1DBGA 1JUSA 1IRGA 1E2XA 2DOAA 2ZKZA 1LEAA 3ZXSA 4BE0A 4HOBA 3WNCA 4GRIA 3BG3A 3OYKA 4U87A 3DU6A 2CH0A 2UUZA 3AG1H 2XSDC 2F43A 4F52A 4IZZA 3G2BA 5M5XJ 1QGAA 1BM9A 4UVCA 3E5QA 3PIPF 1D8KA 3AG4H 3S2WA 2MH2A 2XNJA 4Z2YA 1HZEA 3I64A 1G3WA 3P5JA 2F4NA 4FCYA 3OJWA 1MBHA 2W25A 5LGUA 1WH7A 1N06A 3TP0A 2V1UA 4DQ2A 3ABTA 2B9SA 2JZYA 4AYBA 2H6BA 3W2VA 4YFNF 5EZHA 1V0EA 4OPSA 1GXQA 2G7HA 3SZEA 2RGVA 3JAMK 4BNCA 1TLLA 1XMAA 2DDBA 3O6BB 2MD5A 1FNCA 2X1DA 2XDVA 1ZELA 2I8DA 2OZ6A 5HLGA 4TMZA 2MC4A 2HKXA 4RB1A 4Z05A 5BNGA 1BPLA 4IRGA 1JUPA 3DBHB 1HXDA 4G6IA 2DW4A 3WE3A 4ZYGA 3MKLA 3HGYA 5GTHC 1SFEA 4J00A 2VNHA 5FO1A 5F0FA 3FXLA 5B6IA 2ZZEA 4W1UA 5BSYA 5IP9J 1VQ6B 2DERA 3BJ6A 3IH4A 4G6TB 4ENNA 4N3NA 1QVFB 3TGNA 1OGIA 1UMKA 1M90D 5FROA 1BR2A 1SD5A 2VT2A 3KEQA 4MQ9F 4IHTA 4BHPA 1Q1VA 1WJAA 2PE3A 1S29A 2XPVA 4O5VA 1STZA 2LH9A 1AIPA 1VLYA 4E0FA 2WZNA 2UXXA 3BZCA 2KMUA 2HNHA 2HDDA 1Q86D 2GM4A 4NUBA 1QBJA 3FKSA 1ERDA 1XFOA 4IL6C 3NE5B 4M3BA 1UG2A 2LREA 1VLOA 4TMXA 4JP0A 3PETA 2TRTA 3LMWA 4FE7A 2X85A 2DFFA 4CYCA 5EG0A 1MZBA 4CCMA 4FTHA 2PN6A 3Q6RA 3H0GJ 1QUFA 2B7BA 5B1BH 4OJLA 3F8MA 4JRAC 1J5YA 2ESNA 5DCMB 2GK7A 5IP6A 2ZJRF 3CB4A 4AUXA 4ACBA 1I6XA 4B8XA 2IGMA 4E7LA 2FRHA 3GTGJ 3CC4I 3BQZA 2QN6A 3K4NA 2CUFA 2N8GA 3QPHA 2XNCA 1TYUA 2K3PA 5CVJA 2IW5A 2VFNA 4Z06A 4XIDA 5J4VA 5HNFA 1R1TA 3GFIA 3KPHA 3AG2H 3LSGA 3EUHC 4XLFA 5JVGF 5IPAA 2CUEA 1VQ7B 4KKSA 1MMNA 3F8NA 3VYUB 5JHUA 4AIDA 5K1YA 4ZCLA 2CWEA 1WGXA 4PGOA 2FNPA 4WZKA 2QKMB 3GO5A 5K7HA 4UV9A 2WZPP 4G12A 4CUGA 2JA7J 4R71A 4AC0A 1H88C 2M1BA 3B02A 1AWCA 1AA7A 1Y39A 4U9UA 2KDZA 3NEUA 4CQJA 1X1PA 4KIGA 1XE1A 2L7KA 5B3SH 4YEJA 1ETXA 1X2MA 1NHCA 1Y8QB 2E5ZA 3DWLE 5K5OA 3ZZUA 4UZUA 2OTJI 2P5KA 5EDNA 4NQWB 1CNEA 1QA2A 1YHQB 2QVOA 4L18B 2DCUA 4H0EA 4E4HA 1FMVA 1QHHD 1ZG5A 3CCYA 4XKBA 3DBRB 3DEWA 5GPCA 1YIOA 2YWFA 3GVJA 1ZTRA 3CC2I 1T5EA 2QTLA 1X2NA 2D1HA 4PC7A 5LFAA 3A0HC 1KQ5A 3WXMA 4OZYA 4RD3A 6PAXA 4BY7J 3X2QH 3DLAA 1ULYA 1HKSA 4Q47A 2DK8A 2CC2A 3IUOA 4YZ0A 1QGYA 3OFNA 4ZYEA 3LYCA 3FKIJ 2O0WA 3OV8A 2P6TA 4DNCA 2XTWA 1T95A 1HF0A 4P12A 4A6DA 1RIOH 3D0SA 3CUQC 5E1WA 2LR8A 3A8IA 4U0YA 1HOMA 4IHXA 1UG0A 2KJBA 1IGNA 1VQNB 3EQNA 1E1QA 2NSTA 1Q81D 3FY3A 1KRHA 2ODLA 3SUCA 4M3FA 3GTMJ 4HG2A 5D6FA 5IYQA 2KP6A 4HF2A 3HB9A 1SD4A 1IUYA 1ZM4A 1T0FA 4NB5A 1J09A 2V7FA 2VQCA 3F8CA 1B8IB 3DQVC 1T6SA 3JW4A 1VFCA 3ZP5A 3NWSA 2Y9ZA 4F91B 4YXWA 1SVOA 4DW6A 1IJWC 1T6XA 4G7OF 3VO2A 4LOCA 5TV2A 3VOEA 1GUUA 1YJWB 1QRYA 1A8PA 1W0KA 3I5UA 2BY2A 3KE2A 3M07A 1V0FA 1FRQA 5H20A 3GZ6A 2AHOA 2WWYA 4KKTA 3MCZA 2V9KA 4RGSA 3QP6A 2VLAA 3EUHA 3VSTA 2AXLA 3HSRA 3JRGA 2FVGA 4AVPA 2D45A 2ISZA 4ROXA 2O6WA 1GR1A 2ZMEA 3HL2A 2C78A 2GPJA 4QV2A 1SVLA 2HVRA 3AGQA 1LFPA 3VEPA 2YWHA 4EJOA 3GTKJ 3J7AY 3BOQA 3G71I 1RR7A 5J1YA 2JA8J 1LNWA 3ASRA 4FN5A 1G59A 2F4MB 1SFUA 2IA0A 2M8EA 1ZLJA 5ICFA 1RQRA 4RD4A 1G3SA 5GAHJ 4LBZA 3S14J 2DMQA 2Z9OA 2GA1A 3V7AA 3DKXA 3SFIA 1YJ9B 2IS1A 4PFPA 4NK8A 1MKMA 3QRFF 3WGIA 5HKKA 1S7AA 3BROA 1MMDA 4AWXB 1NK2P 3GZNB 3W2WA 3L2VA 1Q9SA 1PDNC 5J8CA 2V7XA 2X51A 4JYKA 3ZQQA 3OYCA 1QPIA 4X7EA 3DTIA 2XT2A 5D5VB 1IZ1A 1GLNA 3ECOA 1O8KA 2KFDA 3FXUA 3PSSA 3WTWC 3IV5A 3MZHA 3L09A 1PUFA 5HDGA 1U9OA 2ID3A 1TP4A 2RVCA 5IYCJ 2VBXA 3PL8A 5EGOB 1PP8F 4RB3C 3OSFA 1K7AA 4PCQA 3HTUA 1NK3P 1JNYA 4DK1A 3G6EB 3PNYA 3LQEA 4OM9A 3W5UA 1BLIA 1E17A 1RKTA 3Q0VA 3O3KA 2ICWG 3DKWA 1FIAA 2FMLA 4MXNA 3ZPPA 3TMOA 2W82A 5A2QK 4WCGA 4ZDOA 4KT6A 2R5ZA 1KD1D 2XHKA 5A89A 1MMGA 4C2UA 2HR3A 1FSHA 1LDDA 3I53A 1P4MA 5HXBA 3JRAA 2V4DA 4E7JA 4F7ZA 1IG7A 4BXXJ 3TO9A 4O3MA 2O9LA 3BZ6A 4Q5SF 3ZSCA 2M2EA 2VKDA 1ZM3A 4OOXA 3LSJA 1YLOA 2ZMEC 2FBIA 4RD2A 5HVQC 1MBJA 1A35A 1T6YA 3VSKA 3SJZA 4I99C 3VDXA 2BYVE 1KZHA 1WSVA 1WZ2A 2K5CA 1EH7A 3S93A 1D0XA 3ZCOA 3ZZ0A 2DYIA 2QZAA 1FWZA 1B72A 2GJPA 4Z4RA 1V55H 2EZLA 1YITB 3TH0A 2AXTC 3ZMUA 3HHGA 1QU3A 4QIWN 4WZLA 1GDTA 2QSFX 2IA1A 1FX0A 4HE6A 1KA8A 1IRFA 3GYHX 2QQAA 4KITB 4BBSJ 4CHUA 3GW2A 5HLHA 2HCJB 4YDTA 3QFRA 4X07A 4IQJA 1WP6A 5FRMA 2R4GA 3H09A 1MNDA 3HKZN 2KHMA 2WV1A 4P1WA 2QE7A 3AVYA 1RPWA 3F8BA 3EQOA 2HZDA 2XF5A 2GA2A 1E3HA 1BC7C 2X3UA 5F4MA 2CUJA 1FLIA 1OYIA 1RR8C 3W2FA 4W8SA 1TLHB 5HS9A 1Z7UA 1P7JA 2X6YA 2DY1A 1KYZA 3FXOA 1BIAA 5CVVA 1I1GA 5EMNA 4WXCA 1DPUA 2DA7A 5GTIC 4E7IA 2EZHA 4I0AA 3KL9A 2O17A 2WV0A 3A0BC 3BC8A 4G8XA 4LJZF 3UR3C 4ESBA 2QEXI 1R71A 1E3XA 3ONQA 2NTQA 3GF2A 3HOVJ 1JT6A 2ISYA 2A68F 4G6DA 5ILUA 5BSXA 2W48A 5D5XB 3CCEI 1FEXA 4D7NA 1FYLA 3K0LA 1TW2A 2CGPA 2E1OA 2JK3A 3BR0A 2PQ8A 3DFGA 2DA1A 3HPHA 3LL7A 3PFYA 4KT5C 1LPQA 4BU2A 1WU8A 3RQIA 1WJ5A 3KEYA 2FQ4A 3MVPA 3VWBA 4ZYDA 1IF1A 2DT7B 1BW5A 1DG1G 1HA3A 1HW2A 2V79A 3I59A 3H3ZA 1KMHA 4OMZA 2Y31A 1Z21A 4BGDA 1LE8B 3HPGA 1GVJA 5FA6A 3WTYC 2Q2EB 1FNDA 3ZUGA 2WY8Q 1F5TA 4BDYA 1XSXA 4KICA 3EUKL 4XBFA 2QKLB 2GLOA 5ILSA 1O8DA 2ME0A 3WGHA 1JB9A 1AIRA 1H8HA 5ICGA 4HZFA 3T8TA 2COBA 3EETA 2H27A 1TWHJ 2OK8A 1OQYA 4BDZA 4L5EA 3F72A 3H3VK 2FBKA 3BR5A 5GPAA 2DOGA 5FLVA 3J81k 4YG2F 1WDTA 2R7FA 4EJTA 1H85A 3QFCA 3QPLA 5FFZA 3FZVA 2Y0MA 1IRZA 1NHAA 2IAIA 3LSKA 1G3TA 3VMFA 1U8BA 4P5OA 2GAUA 4Z4YA 4PGHA 4ASNA 3CMAI 1O8FA 4EGYA 1TBXA 1D0YA 4M4SA 3LWFA 3M1CA 4DGWB 2ZXIA 4DYRA 3AL0B 4Z1MA 1XCVA 2X1EA 4DYCA 2PYHA 2ZBKA 2INVA 2VBVA 2F5EA 3CJNA 3K4CA 4P9UA 3KYCB 2LC2A 2VNKA 3E6MA 4AIKA 1YW7A 2D2WA 4A3JJ 1KCCA 1ZAOA 5FB2A 1B6AA 4GYIA 1UZCA 4GYGA 3I71A 2DEUA 3GVLA 2OA4A 1CLWA 1VQ9I 4OOSA 1Z77A 2MLGA 5FGMA 4C3HJ 2MBFA 4TN1A 4FT8A 3MMPA 2WAEA 4HNVA 1GO2A 1EV7A 3RKQA 3BG5A 1BR4A 1LFBA 4XLPF 3I56I 2HLDA 1AU7A 2ZSHB 1UCRA 5HDNA 3FMQA 3GTQJ 3KEWA 1XX5A 5EEAA 2Q6OA 2HOSA 5TY0A 4PC3A 3NRVA 2F1MA 4QHYA 2LBFB 4XK4A 2L01A 4U0VA 4BE2A 4AF7A 1T38A 1B4AA 4NC7A 2OU2A 3IWZA 1YRNA 3AVTA 1ETOA 3WTTC 4ABZA 3I4MJ 2WJVA 3B6CA 1LJ9A 4M74A 3WBJA 4AM3A 4UZEA 1A31A 1OCRH 4DBRA 3JX8A 4RA2A 1BN5A 2BXZA 2LG4A 2XSJC 2X48A 3DP7A 2P3MA 2M5SA 5DD8A 3HG9A 1BBYA 3OOUA 1CQXA 3ZBUA 1SFOJ 1Y1VJ 5E8IA 3PUBA 1J0RA 4HBLA 4K2EA 2DA3A 3WHBA 4KYWA 4UHTA 2V7VA 4RLQA 1PLUA 1G7TA 4B3XA 4LG3A 3OWTA 4M3DA 2LMDA 3ZMVA 2ECCA 2BM6A 2XC7A 2E2JJ 2OBRA 1DDIA 2A07F 1COWA 1XTAA 3CDHA 2W6JA 3LAPA 5HZBA 2V7TA 2K86A 5DCFA 2VXDA 3SY2A 4ZGQB 4DYQA 3WHCA 2NVTJ 1I3AA 4XLHA 4YFKF 1FYKA 4MTDA 1DU6A 1WFXA 1DDNA 2GWRA 2BE5F 2YUSA 4L8JA 4P6YA 5GV7A 3PQJA 1D8TA 4N0BA 3CF5F 1TWAJ 1MSEC 1D5YA 1EA3A 2A5WA 2AQFA 2CJJA 1ZR2A 1XB2A 5GAEJ 3OSGA 3ZQIA 4OMYA 3BQJA 2VYQA 1YJWI 5E17F 3RZOJ 3FXKA 4U4BA 4G1BA 4CCNA 1V4RA 4B3GA 1USTA 1Y8RB 3F21A 2D5VA 2VQGA 4CSWA 3GQ9A 5K5QA 1Q1HA 5JVTA 3DEUA 2DFEA 4XLCA 5L3DA 2BGIA 4BXUA 5C44J 4C9YA 3ZQLA 4ITVA 2WB1N 2Z5UA 4L0YB 5E3NA 1OFCX 2MH9A 2OPTA 2VI6A 2VIXA 1MMAA 4Y17A 4HE5A 4KA4A 3T56B 5C1EA 2YWEA 1ZYRF 2O03A 5EEGA 2FEZA 2R92J 2W85A 2XUBA 1D3YA 2CO5A 3QU6A 1L0OC 3FPPA 4UAJA 3UNGC 3VPRA 2P7VB 1RZ4A 3OY9A 2R7XA 3HUGA 2L7FP 1E43A 3E6CC 1FZPB 2V9VA 4GXOA 2NSPA 2MYSA 1DP3A 3BG9A 4EH1A 1OB2A 4YZXA 2PFBA 1KK1A 4E7ZA 3ZGKA 4V2FA 3I55I 1YX3A 2UZKA 1FNMA 4B09A 2VJIA 5FNZA 3KRGA 4XOTA 1IAWA 2KLOA 1R5GA 1GAQA 4G7XA 3RDIA 1UFMA 2EIXA 1FRNA 3KIOA 1B1BA 3BH7B 1YJNB 1QO0D 4UZFA 1MNMC 3BH6B 4H9GA 5KAFC 1KONA 4XLEA 4M6YA 1LM1A 3QPTA 3S17J 1YIJB 4DQLA 2JJ7A 2PJPA 5GP9A 4FASD 1APLC 5BQTA 4CICA 4KUMA 5F64A 4Z03A 3ZPNA 1LFUP 1HDDC 3DTKA 1K4ZA 4RGUA 2K9NA 1QVUA 4I2OA 4OIQF 1B9NA 5CVRA 3Q0UA 3W2HA 5FKMA 3L2QA 4KNYA 4RPDA 2F4IA 4YIRX 2YX7A 2FUG2 1XD7A 1OFLA 1MDMA 4EM2A 3CC7B 4CO8A 2PIAA 2VPRA 2P7CB 2CRGA 3IHUA 5JBQA 2FXAA 2VZLA 3VYSB 2JTVA 1I3QJ 2R7UA 5CYVA 1K4SA 1S9HA 1JT0A 1ELOA 4HDVA 4LLGF 3ELKA 1ZRCA 2V1XA 3G05A 2P5LC 2J5PA 1VQ9B 1ZHFA 1YTYA 2JSPA 4PAAA 1N07A 1RNLA 2LDUA 3FMRA 2JA6J 2V7WA 1XB4A 5DM6F 2HPIA 3FBNB 2CV0A 3OKXA 2M0MA 1JUMA 4J0QA 3QWLA 5CJ9A 3E6BA 1S7EA 1NJID 2HS5A 1TNSA 2E7XA 2M45A 2NVQJ 1O88A 1F36A 1KTWA 3D5RC 2ZBUA 1SAUA 3K1MA 5D6EA 1TTTA 4CCJA 3PUFA 5LHHA 4KIBA 1A04A 5E18F 2EB7A 1USSA 1MRZA 4Z6YA 3JRDA 3RYRA
chains in the Genus database with same CATH topology
1DGWY 3V42A 2ZZGA 3MKZA 4ASUA 2KRHA 2QKMB 3PSIA 3W2AA 2WZPP 3VYRB 4CUGA 2LBFA 1DBOA 3PSFA 2NT9A 3VSVA 3OYNA 2Z8GA 4EATA 1AA7A 4PFOA 4W8QA 3PJRA 2X1CA 3PNTA 1W0JA 2CS3A 3H9GA 3OL4A 4Y3OA 1JI8A 3BH4A 1MABA 3TBIA 2L7KA 3EPZA 1D1CA 4YEJA 1D1AA 1NHCA 2W1OA 2E5ZA 3GQBA 3DWLE 2HU9A 3T9GA 4UZUA 4NQWB 3DTEA 4B44A 4E4HA 1FMVA 1QHHD 1IB4A 4QPOA 1UELB 3D5LA 4DJAA 2LOOA 4XKBA 4PMHA 5KCMA 1K6YA 2WY7Q 3OMYA 3GVJA 2OUMA 4RMNA 1T5EA 4YRVA 3OYAA 4G7WA 1V5EA 4EW9A 1BR1A 4D1QA 2XF7A 2HDWA 5LFAA 1X1DA 2R7VA 1RU4A 4OJ6A 2VL8A 4BS9A 4OZYA 1IDKA 4HEA2 3HXLA 1D1BA 3DLAA 2R7OA 3VYTB 4ZDLA 2BSPA 3IUOA 4I84A 2JDIA 2K9MA 3H35A 4YZ0A 2KDOA 1EFRA 3OFNA 2CK3A 2IGOA 2JA2A 5HLTA 1D0ZA 2O0WA 4XR6A 4GQNA 4DIQA 1T95A 2R7WA 4ZJZA 3VMWA 5CQGA 3SZGA 3EQNA 1UG0A 2IS6A 1E1QA 2NSTA 1YE9A 3DPLC 3TL4X 5KNLA 2W7NA 2QY1A 3FY3A 3QODA 2ODLA 3SUCA 4HG2A 2R9VA 2X8KA 3BCFA 3CP8A 4D9JA 2KP6A 1HA8A 3H94A 3OOCA 1BHEA 2M7BA 3OYIA 1OFMA 1UAAA 1J09A 2V7FA 2VQCA 4N4NB 2GOMA 3DQVC 4XN0A 1O8GA 3A2KA 4LIVA 4BEHB 3NWSA 3RSNA 4F91B 4YXWA 3VSLA 1I8DA 4XLAA 1E1RA 1OGMX 4U7BA 2NTBA 4JOMA 1W0KA 3OYMA 3H0DA 1V0FA 3ZIAA 4YZAA 2VBMA 4ZYAA 3L2WA 4KKTA 2X3HA 2V9KA 2VLAA 3T51B 4U49A 3VSTA 4QPQA 3ZRGA 5CPRB 3HL2A 1BOBA 3LFUA 2HVRA 1LFPA 3AL0C 5FL7A 3E0JB 3J7AY 2Q1ZB 4BJ6C 1EE6A 2NOJB 2WAQA 3EUAA 1UD4A 1G59A 4Y4RA 4KJZA 2JJ2A 3SDBA 3DDYA 2PJRB 3FHNA 4XNFA 2AQEA 4ZDPA 3IAM2 4NNJA 2JJ1A 2JVGA 1WTHD 1LVKA 2D3NA 2V7QA 2MABA 5C1CA 1I18A 4RLFA 3GQAA 2L5QA 3DKXA 2IS1A 2GOXB 4PFPA 4NK8A 5HKKA 1Z3YA 2XNDA 1MMDA 3DU5A 3L2VA 2LY2A 3W2WA 2O1DA 4DOZA 3VMVA 3K4JA 3ZR8X 2X51A 3ZQQA 3OYCA 2NT6A 3DTIA 1GLNA 5JHFA 1O8KA 1E79A 4B48A 3VR6A 1SFKA 4PJNA 3PL8A 2IGNA 1PE9A 4ZC3A 3B90A 4DK1A 1SKYB 4DNTB 2ZSIB 3PNYA 1BLIA 4BQOA 4HSRA 1HVXA 2LRDA 2XZLA 3K4BA 1QJVA 4MXNA 3ZPPA 3TMOA 2JVHA 2W82A 2VJJA 4OJPA 2V4JC 4KT6A 4ZDOA 4II2A 3HC7A 1MMGA 3L2UA 4C2UA 1OB0A 2VQHA 4ZTFA 3OPOA 2HVSA 2V4DA 4E7JA 1P9QC 1OR7C 3A3GA 3A1YA 3ZSCA 3M8JA 2VKDA 2VB6A 2DCEA 2ZXHA 4TSFA 1IRXA 2CMPA 4F55A 5HVQC 1QCXA 3VSKA 2IS2A 1WPCA 4NC8A 3VDXA 2WB1A 2K5CA 2M3AA 2RQQA 4CA0A 2CUZA 3S93A 1W36C 1GQ8A 4OAYA 1D0XA 3ZCOA 4E7HA 2R7QA 4R79A 2LZJA 3S3OA 4IQ4A 2NZMA 1OHHA 3H5RA 2DT6A 2GJPA 1U0JA 2Z2SB 4C2LA 1QU3A 3I3LA 4DNRB 1NBMA 4KKUA 1FX0A 4ZTJA 3DEEA 4AU7A 2CFOA 4BACA 2JIZA 4JMQA 2HQAA 4KITB 1OOCA 4YZQA 2XF6A 1IA5A 3HOTA 4IQJA 1WP6A 5FRMA 2R4GA 1K28D 2L9NA 1H80A 2PMZA 1MNDA 2KHMA 4P1WA 2QE7A 4E7SA 2RREA 2KL4A 5CDFA 2V26A 2ELJA 1MNEA 3EQOA 4NK6A 2XAUA 2HZDA 2JUGA 2VASA 2XF5A 4DK0A 4ANJA 2CUJA 2O0VA 3I9V2 1NG7A 4W8SA 2ZZQA 3BCBA 2R7SA 2X6YA 4URRA 1OLTA 3CJQB 4B43A 2PJRA 2M4GA 2KQRA 4II3A 2GK6A 3A35A 2ZZFA 1LKXA 4E7IA 4PJMA 4PUSA 4HPQA 2UVFA 2O17A 3BC8A 3UR3C 3W3CA 4BQNA 1E3XA 3ONQA 2NTQA 4MLOA 5CQEA 1K5CA 3DKYA 3N05A 2VBKA 3PFYA 1O8EA 3OYJA 2E1MB 3HPHA 3LL7A 2IGKA 3K4KA 4BXFA 4BU2A 4E7KA 2M7AA 3GRHA 3OIQA 1WJ5A 3KEYA 1VZ0A 3QYEA 2RNGA 3FDYA 3OR2C 3VWBA 2BVMA 1G8XA 2DT7B 3LSMA 4PSWA 2F5VA 4HNTA 1KMHA 2GJKA 1YX5A 1X0CA 1Z21A 4BEHA 2BVLA 4BGDA 3U21A 4HRIA 2XGJA 1O8HA 3T53B 3HPGA 1BN8A 2Q2EB 3K70C 2PYGA 2WY8Q 1BMFA 4BDYA 4XN3A 2DIEA 1V5GA 2NTPA 3EUKL 4FETA 4PSXA 1Z7LA 2QKLB 4HWVA 1T0FC 4LIUA 1O8DA 2UVEA 3B4NA 3OE7A 1AIRA 2KVOA 4XM3A 1W36D 1H8HA 1JTAA 4XKCA 3BCAA 3DPUA 1O8MA 4BDZA 3LSIA 1NRKA 2P0WA 3LSHA 1KZLA 4JQFA 3CP2A 3NWTA 2LY1A 5FRNA 1RMGA 4C2TA 4PK4A 2R7RA 1WMRA 3LSKA 2WPDA 4P5OA 3RTRA 3OEHA 3GQ8A 1O8JA 3CZ6A 1O8FA 2A6TA 2XOKA 1DQUA 4FXUA 3RCOA 1D0YA 4CH7A 1DGRM 2E5NA 3M1CA 4DGWB 2ZXIA 4PJLA 3FBIB 2L2OA 2X1EA 3AL0B 3OAAA 4Z1MA 2PYHA 2INVA 1UD2A 4X0GA 1RWRA 2WA0A 3K4CA 4OJ5A 2X53S 1WJBA 3A3BA 3AKZA 3K70D 3OL3A 2LC2A 4PJJA 3S3MA 1Y6IA 1KCCA 3WWGA 3MKYB 2VJ4A 1VJSA 1VF7A 2OV7A 2Y0SA 1UD8A 2WADA 3GVLA 2E1MC 4CCLA 3SYTA 4F3QA 3SEQA 3S32A 4OZZA 2E60A 1E0EA 2DJIA 3OR1C 2WAEA 1WJDA 1KCDA 2M4KA 4HNUA 1TT0A 3OS0A 3OYGA 2VXZA 1W9XA 3GVKA 2F6CA 1BR4A 4P22A 3AFHA 1H8EA 1UD3A 2MD0A 3K6GA 2HLDA 3OYLA 2ZSHB 3KEWA 3C2HA 4CCOA 1X1AA 2UV1A 3QOEA 4XL9A 3K4LA 2F1MA 4TKOB 1Y56A 2LBFB 3OS2A 3H9QA 3C2GA 1QHGA 3H9JA 4BE2A 1O8LA 4KISA 4CCKA 4OJOA 2KZVA 1UD6A 3F9KA 3BLYA 4NC7A 1Z3XA 1WJEA 4IKFA 2VKHA 4XOPA 1TZLA 4XD7A 1O8IA 2WJVA 4E6KG 3RQ4A 4XORA 4Y33A 2CV1A 2CV2A 4LITA 4DBRA 3SEZA 5HNHA 5HOOA 3GQ7A 2LG4A 1PKVA 2XSJC 1CZFA 3OEEA 1HG8A 1X4PA 2M5SA 3HG9A 2HVQA 3K10A 3OOUA 3BG7A 2E1BA 4B3FX 4H4KC 3VSUA 3PUBA 2VPLA 2V31A 3PNVA 3MMYB 4RLQA 1PLUA 4B3XA 4LG3A 1PJRA 3OWTA 2W4SA 1WJFA 3OYHA 3OIPA 2XC7A 3KYLA 3QYFA 1COWA 2W6JA 4IX7A 4XONA 2VXDA 3L2RA 4XQFA 3HKZA 4AVZA 4BJTA 4XLHA 5TGTA 4XKVA 1WFXA 2ZTGA 2XZOA 2HPMA 4L8JA 4RM2A 3OS1A 3WQZA 2V6EA 3QYBA 3CMMA 3S3NA 1N78A 2BW3B 2IS4A 4CZCA 4F93B 1EA3A 2A5WA 2AQFA 4XKWA 3OYDA 5LD2C 2UWMA 4TT3A 4HIZA 1R6RA 4BL0B 4U4BA 3D5SC 3JU4A 4CCNA 1FMWA 3OYBA 5IK2A 4B3GA 3E1SA 4W8RA 4RM3A 3BCDA 2PECA 2VQGA 2LYCA 4CSWA 3GQ9A 4XLCA 2L9SA 1N75A 2WBMA 2K9LA 5CKTA 4YELA 4C9YA 4ITVA 2W00A 1XG2A 3CF2A 4N4OB 3KX2A 4XMYA 2VIXA 1LDKB 1MMAA 3S8PA 2V1NA 3T56B 2R7TA 5C1EA 2CW7A 3IAS2 2Z16A 1N77A 2O5RA 1DBGA 1VBLA 3MD2A 3JURA 2DOAA 3ZXSA 4BE0A 2GJRA 2OC6A 3FPPA 4OWRB 2MFZA 4F92B 3UNGC 3OW7A 4GRIA 3OYKA 2F43A 2KRCA 2UUZA 2CH0A 3BG6A 3DU6A 4U87A 3OY9A 2R7XA 1E43A 4F52A 4IZZA 1X4OA 3G2BA 2MYSA 1DP3A 2NSPA 5KHDA 4J01A 4YZXA 1IDJA 5DN6A 1HZEA 1E3ZA 3FKJA 4E7ZA 3ZGKA 1UD5A 3KRGA 1YX3A 3DPTA 2X6XA 1PXZA 2VJIA 3B8YA 2KPMA 4XOTA 3BC9A 4AYBA 2KLOA 3W2VA 4G7XA 3CESA 3A4CA 1V0EA 3HUGB 2VJ5A 2X1DA 2XDVA 1X1CA 1ZELA 2I8DA 3IP4B 2MC4A 2QXZA 4Z05A 1KONA 4XLEA 2BOLA 1BPLA 3HAGA 4G6IA 4FASD 4W8TA 1NG6A 4BJ5C 4J00A 3K4MA 3LMMA 2ZZEA 4Z03A 3ZPNA 3LNNA 3DTKA 4C30A 4BQQA 4MR0A 2WJYA 4G6TB 2IQ7A 1PYVA 3L2QA 2Z1DA 2F4IA 3RPUD 1OGOX 5FROA 1BR2A 2FUG2 1OFLA 2QX3A 1WJAA 3H5NA 2LH9A 1VLYA 4E0FA 3VYSB 2KMUA 2HNHA 2BW3A 2R7UA 1S9HA 2W6IA 4NUBA 4OAZA 2XZPA 2CW8A 1ERDA 3FKSA 2D3LA 2O04A 3H5AA 3NE5B 3G05A 3GBGA 2LREA 2ZTNA 3LMWA 5AMVA 2JSPA 4BE1A 2X85A 3HOSA 4CCMA 3UW0A 1JRGA 1V5FA 4OJLA 2HPIA 2ZFUA 3FBNB 4DBQA 2CV0A 2GK7A 2M0MA 2IXSA 2WAFA 2IGMA 4E7LA 4HSTA 2WSSA 1WJCA 2DXIA 3MKWB 2Z6BD 3K4NA 1KTWA 1O88A 2VQLA 2X6WA 4B47A 1MW7A 3OYEA 2K3PA 3D5RC 1X19A 1SAUA 4Z06A 4CCJA 4BUPA 5HNFA 2EWEA 2INUA 2VBEA 3LSGA 4XLFA 3CJRB 3EUHC 3OYFA 4KKSA 1MMNA 3VYUB 1X1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKW A;  2O1D A;  1O8H A;  3VMV A;  1BN8 A;  1DBO A;  2NT6 A;  2NT9 A;  4U4B A;  3VSV A;  2PYG A;  1O8K A;  2Z8G A;  4XN3 A;  4W8R A;  2NTP A;  2PEC A;  4W8Q A;  3GQ9 A;  4HWV A;  4XLC A;  1O8D A;  1PE9 A;  2UVE A;  3B4N A;  3B90 A;  1AIR A;  1JTA A;  4XM3 A;  4YEL A;  4YEJ A;  1O8M A;  1XG2 A;  1NHC A;  4XMY A;  1QJV A;  4MXN A;  3ZPP A;  2VJJ A;  5C1E A;  3T9G A;  4OJP A;  1RMG A;  1DBG A;  1VBL A;  3JUR A;  1WMR A;  1IB4 A;  3GQ8 A;  4PMH A;  1O8J A;  1O8F A;  3ZSC A;  2NSP A;  4YZX A;  1IDJ A;  2PYH A;  3KRG A;  2INV A;  4EW9 A;  1RWR A;  1PXZ A;  2X6X A;  3B8Y A;  2VJI A;  1QCX A;  4OJ5 A;  4XOT A;  1RU4 A;  4OJ6 A;  1GQ8 A;  4OZY A;  1IDK A;  1KCC A;  3WWG A;  2NZM A;  2BSP A;  4I84 A;  4Z05 A;  2QXZ A;  4YZ0 A;  4XLE A;  4C2L A;  2O0W A;  4XR6 A;  4OZZ A;  4W8T A;  3VMW A;  4Z03 A;  3EQN A;  1KCD A;  2NST A;  4MR0 A;  1OOC A;  2QY1 A;  3FY3 A;  4YZQ A;  2IQ7 A;  2ODL A;  1IA5 A;  3SUC A;  1H80 A;  1OGO X;  4XL9 A;  1OFL A;  1BHE A;  2QX3 A;  1OFM A;  4NK6 A;  1O8G A;  4XN0 A;  3EQO A;  1O8L A;  4OJO A;  2O0V A;  1O8I A;  4XOP A;  4XLA A;  1OGM X;  4W8S A;  2NTB A;  4XOR A;  2O04 A;  2X6Y A;  4URR A;  4YZA A;  2VBM A;  3GQ7 A;  3LMW A;  1CZF A;  1HG8 A;  2X3H A;  5AMV A;  2X85 A;  3VSU A;  4U49 A;  3VST A;  3UW0 A;  2UVF A;  2O17 A;  1JRG A;  1PLU A;  4OJL A;  2NTQ A;  1K5C A;  1EE6 A;  2VBK A;  4XON A;  1O88 A;  1KTW A;  4XNF A;  2X6W A;  1O8E A;  4XQF A;  3GRH A;  4AVZ A;  4XLH A;  4Z06 A;  4XKV A;  2EWE A;  2INU A;  2VBE A;  5C1C A;  4XLF A;  3GQA A;  1X0C A;  4NK8 A; 
#chains in the Genus database with same CATH topology
 1DGW Y;  3VO1 A;  2E7W A;  3V42 A;  1OJL A;  5HS7 A;  2K40 A;  5A2Q Z;  2ME6 A;  2BVN A;  1W0U A;  2EFQ A;  1K4T A;  4KFC A;  1DBO A;  2QA4 I;  2W7Z A;  3VSV A;  5LBQ A;  2Z8G A;  1E3P A;  3KP5 A;  4X06 A;  4EAT A;  4EV0 A;  1VQK B;  4W8Q A;  2VUM J;  2IBD A;  5C4J J;  1WVR A;  3CUO A;  2WC2 A;  3PNT A;  3PJR A;  2H1K A;  1JI8 A;  3H9G A;  3OL4 A;  2A6E F;  3GXO A;  1MAB A;  2K4B A;  1XQB A;  1D1C A;  4Z4U A;  5L3E A;  3NAW A;  3T5X A;  2RC6 A;  2EFN A;  4NC6 A;  2E1C A;  1Z91 A;  1N25 A;  2LKP A;  4B44 A;  3QOP A;  1IB4 A;  5HLI A;  4Y15 A;  1QG0 A;  3D5L A;  4DJA A;  5M3M J;  2LOO A;  4YAU A;  3J80 Z;  3ASQ A;  2WY7 Q;  2C6Y A;  3OMY A;  5D5U B;  1ZUN B;  4OU0 A;  2OUM A;  2F5C A;  1MJ9 A;  2E36 A;  4M9S A;  1IXC A;  1RRJ A;  2EIJ H;  3OYA A;  3B6A A;  5DSZ A;  4ZGN B;  4EW9 A;  2K9S A;  4D1Q A;  2DU9 A;  5JFR A;  1EA0 A;  4OJ6 A;  2FNA A;  2ZXJ A;  2JRM A;  3HXL A;  4HV6 A;  3VFZ A;  2BY0 A;  3VYT B;  4OOI A;  4TMV A;  4ZDL A;  4B4D A;  3K1N A;  1YQA A;  3KP7 A;  3H35 A;  3E97 A;  2KDO A;  1TWC J;  2BY1 A;  4IRI A;  5FD5 A;  3VMW A;  3ZMT A;  1D2E A;  3SZG A;  1U2W A;  4EJU A;  3BTI A;  3TL4 X;  3DPL C;  3IKV A;  5FD6 A;  2QY1 A;  4MFE A;  3QOD A;  3GSI A;  1HA8 A;  2G7U A;  3Q39 A;  1OMI A;  3OOC A;  1NH3 A;  1JTA A;  4KH3 A;  1OFM A;  3B8H A;  3B82 A;  1JKQ C;  3PA1 A;  5F6F A;  1YJN I;  2E2I J;  1KU9 A;  4IOA F;  3A2K A;  1G3Y A;  4NCN A;  1Z9C A;  1GT0 C;  1G7R A;  3K2Z A;  4XLA A;  1KGS A;  4U7B A;  3JTH A;  4JOM A;  2NTB A;  2DYS H;  4YII A;  4RJL A;  2Y48 A;  4PJ0 C;  3OYM A;  5M5Y J;  4A3I J;  1XS9 A;  3F6V A;  2CSO A;  3MQ0 A;  4ZYA A;  1KU3 A;  5E1Z B;  1OKR A;  3T51 B;  1OCP A;  3CCM I;  4QPQ A;  1QX4 A;  2R3S A;  5EYR A;  1TQM A;  3LFU A;  3DCF A;  3FWE A;  4IJA A;  1WCM J;  1VQ6 I;  3AL0 C;  3FPK A;  5LGT A;  3E0J B;  1Y1W J;  3HTS B;  1IJE A;  1B9M A;  2FQ3 A;  3EUA A;  4IW3 B;  1RC9 A;  3FIS A;  4XRS G;  1U5T A;  3FHN A;  4XNF A;  4ZDP A;  3CCS I;  2PJR B;  1IDJ A;  3LJY A;  4NNJ A;  1NDH A;  2JJ1 A;  1C0W A;  4BHC A;  2V7Q A;  1UHM A;  5L46 A;  3WGG A;  1IDY A;  4B1R A;  1ON2 A;  2L5Q A;  3F23 A;  3U2R A;  3V8L A;  3QFS A;  1IV6 A;  1O3R A;  2B7E A;  3PVD A;  2MW8 A;  3J81 Z;  3DU5 A;  2O1D A;  4DOZ A;  3CCQ B;  4I02 A;  2B63 J;  3VMV A;  4N9I A;  4A3F J;  3ZR8 X;  3K7A J;  3A03 A;  2C77 A;  3I58 A;  2PBI A;  1TTY A;  4EJW A;  4PZJ A;  4YCQ A;  1FC3 A;  3VR6 A;  1SFK A;  5E3L A;  2NVX J;  2DO7 A;  2ZJQ F;  2LF7 A;  2ZSI B;  1N0U A;  4M1K A;  4BQO A;  3U1K A;  2XRO A;  3S1M J;  4HSR A;  1HVX A;  3P26 A;  4CXF A;  1MGT A;  1NB9 A;  2XZL A;  1QJV A;  2XAQ A;  2V4J C;  2PMD A;  2EIN H;  3HC7 A;  2EQR A;  2VQH A;  1U9N A;  1JTX A;  2QWW A;  2OBS A;  4DZP A;  2J5O A;  4HQM A;  3OPO A;  2HVS A;  2BM0 A;  1IB0 A;  1OCZ H;  2HGC A;  1P9Q C;  3A3G A;  3QE2 A;  2VB6 A;  2RAE A;  2DCE A;  2EFP A;  3P7N A;  2OCC H;  1ZK8 A;  2JSC A;  1Y0U A;  1IRX A;  5LLQ A;  2CMP A;  2V1D A;  2H1L A;  4V2G A;  3I54 A;  5J35 A;  3S1N J;  3L1P A;  4LBV A;  3I4N J;  2WB1 A;  3ZC3 A;  1XSV A;  2RQQ A;  4UV8 A;  1GQ8 A;  2CUZ A;  4HF1 A;  1BX0 A;  2LZJ A;  2DT6 A;  3H5R A;  1FBQ A;  3ZBT A;  1W7P D;  3LA2 A;  2Z2S B;  4ESF A;  4A5M A;  4M3G A;  4C2L A;  2LP0 A;  4DNR B;  1U3E M;  3EQL F;  3HRT A;  1BJA A;  3V8K A;  2CFO A;  3WBK A;  4BAC A;  1QZY A;  4NBQ A;  1W0T A;  3A1P A;  1RQP A;  4QFM A;  1OOC A;  2XF6 A;  3HOT A;  1X3Z B;  5C4X J;  3L2C A;  1TT5 B;  1PJ6 A;  1H8A C;  2D9R A;  1T33 A;  1VQM B;  5F1R A;  4AF6 A;  2HI3 A;  2DQL A;  1J9I A;  1Z6T A;  5LMZ A;  2XGD A;  3HBL A;  1DP7 P;  2XAU A;  3JRH A;  3RKY A;  2JUG A;  1W35 A;  4DK0 A;  1EJ9 A;  4ANJ A;  1G2H A;  4P1V A;  1K73 D;  4U0W A;  2IP2 A;  2O0V A;  3G1L A;  2L02 A;  1NG7 A;  4HX4 A;  3CCR I;  3A8K A;  1V54 H;  1ZKG A;  3BCB A;  3SFZ A;  1KYW A;  2R7S A;  1IJF A;  4URR A;  2DMU A;  1S6L A;  3HOW J;  1ZM2 A;  2ZIT A;  3CJQ B;  1O57 A;  1U5T B;  2PJR A;  1ZQ3 P;  1NTC A;  2O61 A;  5LHG A;  3V4G A;  4WF2 A;  2R93 J;  4RD0 A;  1HKQ A;  4A3L J;  3SKB A;  4HPQ A;  3F0C A;  5EF6 A;  1IN7 A;  2BPO A;  1U5T C;  5CQE A;  4F7D A;  4QWQ A;  1W87 A;  2Q6I A;  1K5C A;  4ZZD A;  1QA3 A;  3NB2 A;  3LNQ A;  2YX4 A;  1OCC H;  2I10 A;  1O8E A;  2E1M B;  4Q4Z F;  2M7A A;  1X58 A;  3OIQ A;  3ZPL A;  2BMW A;  1VZ0 A;  1JHH A;  3CC7 I;  3OR2 C;  2EIL H;  1WSR A;  1WXR A;  1G8X A;  5JLX A;  3W2E A;  3HYI A;  3G6E I;  5GV8 A;  1OFD A;  2AS5 F;  2K27 A;  4HX7 A;  1Y0R A;  3U21 A;  3ERM A;  4HRI A;  3HRS A;  5ILV A;  1BN8 A;  3MFK A;  1FOX A;  1RKW A;  3FXQ A;  2P8T A;  3V7R A;  5JMC B;  2PYG A;  2OYN A;  2R7Z J;  1MBF A;  4HWV A;  3BTJ A;  1GHC A;  2UVE A;  3P9K A;  3GWZ A;  4XM3 A;  1O8M A;  4RDU A;  3G3Z A;  3RZD J;  1VF9 A;  3SEJ A;  2GZW A;  5FLX Z;  2ZL7 A;  2OQG A;  2NNY A;  3T0Y A;  2BM5 A;  2HXO A;  1BA5 A;  3CP2 A;  5FKN A;  2LY1 A;  5FRN A;  4AYB N;  4CYD A;  1SMT A;  1H9T A;  3C7J A;  3I4P A;  5IYB J;  1I39 A;  3ZQG A;  1X3U A;  2BBY A;  2PG4 A;  3RTR A;  2KIU A;  1P7I A;  1DQU A;  5AON A;  4ENM A;  4LLL A;  1HC8 A;  1LVA A;  3SQN A;  5F27 A;  4CH7 A;  1I6H J;  2ZBV A;  4WX9 A;  3CJT B;  2HYF A;  3SLD A;  2MG4 A;  4X7D A;  3CD6 B;  1WJB A;  1J7K A;  3OL3 A;  2DA5 A;  5CVU A;  3S3M A;  3MZ8 A;  4X1E A;  3OZW A;  2VJ4 A;  1XN7 A;  2NNN A;  2BHZ A;  2OV7 A;  5DD4 A;  2WAD A;  3O8H A;  5AN9 A;  2G9W A;  2VBZ A;  1PP7 U;  1WOO A;  4WXD A;  3SYT A;  4F3Q A;  1EH8 A;  1SVM A;  1XPX A;  5IYP A;  1O7L A;  1D1N A;  4X8I A;  3JRE A;  3L7W A;  1TVC A;  3SLN A;  4OZZ A;  2I1L A;  4B3A A;  3SDG A;  5H6R A;  2DJI A;  3OR1 C;  1Q7Y D;  3KYD B;  4Q48 A;  3OS0 A;  3OYG A;  2VXZ A;  1W9X A;  3GVK A;  2F6C A;  3FM3 A;  4P22 A;  1OCT C;  2CW0 F;  2P81 A;  3K6G A;  1WI9 A;  4BQA A;  2VT3 A;  1E3O C;  4G7H F;  3QOE A;  1S8N A;  4HDU A;  3K4L A;  4TKO B;  2VOD A;  1K83 J;  1VQN I;  3OS2 A;  5H59 A;  3H9J A;  2HDC A;  4X0C A;  1ZRE A;  3CDI A;  1FYM A;  3G4S B;  2KZV A;  3ECH A;  3F9K A;  5TR9 A;  1R5I D;  2LLK A;  2R6H A;  3GFL A;  1O3S A;  1VQ8 B;  2HOA A;  3RQ4 A;  3GCM A;  4XOR A;  2CV1 A;  2HFH A;  2MSY A;  5EEH A;  3CCQ I;  2CV2 A;  3M3Y J;  2RV8 A;  5M5W J;  4FE4 A;  2KZG A;  3MEX A;  3VSU A;  4RDJ A;  1YW8 A;  4H4K C;  3CCE B;  3GEZ A;  2VPL A;  4TV7 A;  4ZCI A;  3LO8 A;  1L3L A;  1FY7 A;  1PJR A;  4XSX F;  2FSW A;  4FHT A;  2GXA A;  3OIP A;  4RAG A;  3E6D A;  4IEJ A;  1W5T A;  2DA4 A;  1VQ4 I;  1O7F A;  3GTL J;  4XON A;  3L2R A;  1EZG A;  2KIM A;  1IXS B;  1H89 C;  3F8F A;  4XQF A;  1YIT I;  1YOV B;  4AVZ A;  3WYA A;  4Y7C A;  1QUE A;  5TGT A;  2XVC A;  1XGN A;  2R0Q C;  1JKP C;  2E1R A;  3CCR B;  4IXA A;  4JX4 A;  5E3O A;  2XZO A;  3WQZ A;  3ZMZ A;  3CMM A;  4M72 A;  1YG2 A;  1N78 A;  2IS4 A;  1FBS A;  3LSR A;  4XKW A;  1MMS A;  2KRF A;  1SD7 A;  4HIZ A;  2CU7 A;  4R8H A;  3I1F A;  1R6R A;  3TDZ C;  3JU4 A;  2VON A;  1MDM B;  3CRZ A;  5IK2 A;  1V3F A;  3E1S A;  2BZT A;  4A5N A;  3BCD A;  3WTV C;  1OB5 A;  3C1D A;  2L9S A;  1RUO A;  5CKT A;  2DBB A;  2L0K A;  2NS7 A;  4UB8 C;  2QEX B;  3CCU B;  3CF2 A;  2ZL5 A;  2K7L A;  1LDK B;  4RAZ A;  4DQK A;  3WOD F;  4OPO A;  2CW7 A;  1ENH A;  2Z16 A;  2Z99 A;  3H9N A;  1XGO A;  3DF8 A;  2O5R A;  2H8W A;  2HZT A;  4RS8 A;  4QUZ A;  1W5C C;  3JUR A;  3JSP A;  2ETH A;  3F22 A;  2GJR A;  4OWR B;  2MFZ A;  2LKS A;  2XPW A;  2HYJ A;  2CQN A;  3BG6 A;  4IOC F;  4UUT A;  4KMU X;  1HSJ A;  2DAO A;  3HHH A;  5HOD A;  5DN6 A;  2TDX A;  3SJP A;  4A6E A;  4RGX A;  5C3E J;  1PVE A;  2FD5 A;  1UD5 A;  3FHZ A;  4HV5 A;  3DPT A;  2X6X A;  4GCV A;  1PXZ A;  2ZNY A;  2KPM A;  5AIQ A;  1TWG J;  3K1P A;  3REO A;  4W97 A;  3AG3 H;  3HUG B;  4MEY F;  3BY1 A;  1X1C A;  3SYJ A;  2K3F A;  2BOL A;  2DA6 A;  3KFW X;  2HQN A;  3F3X A;  3HAG A;  2B0R A;  1DUX C;  1J2X A;  3LNN A;  3OZV A;  4C30 A;  2AO9 A;  4BQQ A;  4MR0 A;  1JA1 A;  4A93 J;  2WJY A;  2EBI A;  1FP1 D;  2DQR A;  2Z1D A;  1MSF C;  3RPU D;  3M4O J;  1TW3 A;  2L9V A;  3N97 A;  1I7P A;  2RC5 A;  1R5B A;  2QX3 A;  2Z33 A;  3H5N A;  2EA2 A;  3Q3S A;  4A3K J;  3CCL B;  5B5E C;  1AOY A;  3U6K A;  1B2R A;  5L3G A;  1R7J A;  3OOP A;  2W6I A;  3S1R J;  2CW8 A;  2O04 A;  1KQ8 A;  2XTX A;  2K9Q A;  3BNW A;  3RKX A;  5IT3 A;  2CRV A;  1JJ2 B;  5IOZ A;  1FNB A;  2RN7 A;  3GVA A;  3HEF A;  3JTG A;  3HDD A;  2Q8K A;  3ABM H;  3UW0 A;  3BTL A;  1S3J A;  3W5H A;  1TUI A;  1S72 B;  3PFI A;  5FKO A;  2M30 A;  5LEK A;  2ZFU A;  5CVI A;  3FXR A;  4DBQ A;  1GV2 A;  1LDJ A;  2ELK A;  2YS9 A;  1I1S A;  4UY8 I;  3N6Z A;  3Q38 A;  1XGM A;  2PLY A;  4RLZ A;  1QRB A;  3U9G A;  2WSS A;  2AHQ A;  4HST A;  3CCM B;  2PX9 A;  2DXI A;  3MKW B;  1HKT A;  3HIF A;  2VBE A;  2X6W A;  2O6G E;  5KW9 A;  3WE2 A;  3OZU A;  3P4G A;  4NBS A;  3FXM A;  4L0Z B;  1D5V A;  2INU A;  3MZY A;  5HS8 A;  9ANT A;  3CJR B;  2CQ7 A;  1TYX A;  1KK3 A;  1YRN B;  4OIN F;  5E3M A;  3H1C A;  3VNV A;  2VFQ A;  2ZZG A;  3ZN1 A;  1JHF A;  3MKZ A;  3BY2 A;  4ASU A;  4P9F A;  3VYR B;  2LBF A;  2NT9 A;  4LB5 A;  2O3F A;  3LQ6 A;  2YPR A;  1A5J A;  2JN9 A;  3WU1 B;  4PFO A;  2EZK A;  2DA2 A;  2X1C A;  5J3O A;  2QGU A;  4EGZ A;  1W0J A;  2CS3 A;  3BH4 A;  2EIM H;  2VE9 A;  3TBI A;  2BXY A;  2OTL I;  5A88 A;  3J7Y J;  3BJO A;  1YS6 A;  3NAU A;  1VQL I;  3ONY A;  2KT0 A;  2W1O A;  3JRI A;  1W1W E;  2PMZ N;  1EFT A;  2C5H A;  2XTY A;  3BWG A;  4N3G A;  1HDP A;  2L7M P;  4GDF A;  2LFB A;  5DNS A;  3W5V A;  4QPO A;  1BC8 C;  3QFT A;  2VFP A;  4ZCM A;  1UEL B;  4I7H A;  1AHD P;  3BPV A;  1K6Y A;  2A5Y B;  1F1Z A;  1T08 B;  3NQO A;  4RMN A;  3HOU J;  5JR3 A;  4L9N A;  3GLL A;  1BI1 A;  2EV5 A;  2XAJ A;  3IWF A;  3LQR A;  5TRD A;  4P26 A;  4G7W A;  1V5E A;  1R1U A;  3LOC A;  2IVM A;  3GFJ A;  1BR1 A;  1YO5 C;  2ADU A;  2XF7 A;  3GUD A;  2HDW A;  5ICC A;  3KP6 A;  1NB0 A;  1X1D A;  2R7V A;  3Q6Q A;  1RU4 A;  2V5I A;  4A3G J;  1WRJ A;  5F4O A;  1IDK A;  4HEA 2;  1QGZ A;  4PC6 A;  4OPW A;  2GIV A;  2JUC A;  2L4M A;  3S2H J;  2R7O A;  1ETQ A;  5JLW A;  5K5R A;  3WND A;  3M8F A;  2BSP A;  3PA2 A;  4I84 A;  2DOF A;  3PSZ A;  1YHQ I;  5BPD A;  2CK3 A;  5HLT A;  1D0Z A;  2DOD A;  2F5F A;  4D7M A;  4DIQ A;  1VQO I;  4P6V F;  3BR2 A;  5HDK A;  5IOY A;  5CQG A;  3OJX A;  1WOP A;  1K6O A;  1WH5 A;  4PDK A;  2LVS A;  1XC5 A;  2IS6 A;  1R5H A;  1YE9 A;  4RGR A;  4M3E A;  1GVD A;  4NHJ A;  2JA5 J;  2R9V A;  3FF5 A;  5FLM J;  2X8K A;  2BGC A;  2XGC A;  3CP8 A;  3BCF A;  4C3I J;  1JA0 A;  2Y69 H;  5D8K B;  4KMF A;  2G0Y A;  1UB9 A;  1BIB A;  2M7B A;  2Q2E A;  4A3C J;  1Y0Y A;  5F4J A;  3NAR A;  1M1K D;  1QQI A;  2Z3Y A;  2HWV A;  4WZE A;  3W6V A;  2F48 A;  1HCR A;  3BR1 A;  4XN0 A;  1V5V A;  1LLW A;  1T98 A;  4LIV A;  4BYY A;  3CMY A;  3BJA A;  1IN6 A;  3RSN A;  1LE8 A;  1UJ8 A;  2DMT A;  3TO7 A;  1R4M B;  1S5L C;  3I59 B;  3I0T A;  3VSL A;  1E1R A;  1I8D A;  3JQR A;  3ZQC A;  3IH3 A;  5D4R A;  2J8I A;  3H0D A;  2NOG A;  3DV8 A;  1HW1 A;  2VBM A;  3L2W A;  2ECB A;  2ZL6 A;  4Z4Z A;  2A6H F;  4EEF G;  4JK1 X;  3R6J A;  5CPR B;  2ZFW A;  4QTR A;  4OP7 A;  1BOB A;  4FIS A;  5FO5 A;  4IVN A;  3FJO A;  2BV6 A;  1JTY A;  4MNU A;  5JLV C;  1MJB A;  2Q1Z B;  4BJ6 C;  1EE6 A;  4I01 A;  2QSG X;  2DPD A;  2WAQ A;  2VFO A;  2EPF A;  3SDB A;  2KIQ A;  3ZN0 A;  2ZCW A;  1T6Z A;  2UXN A;  2FE3 A;  1IUF A;  3ML6 A;  2JVG A;  3MAJ A;  1FJL A;  1WTH D;  2D3N A;  3UKG A;  1SD6 A;  4A3D J;  2MAB A;  4YEI A;  3BT9 A;  3AVX A;  4RLF A;  2X6O A;  1OFE A;  1QH0 A;  3GQA A;  1QPM A;  4P55 A;  2GOX B;  5FKL A;  2XND A;  4WXH A;  3LA3 A;  4CGZ A;  2LY2 A;  2M87 A;  3GTO J;  2XAS A;  1ETY A;  3K4J A;  2JPB A;  4NDL A;  2NT6 A;  4KN4 X;  1WPK A;  3VNU A;  3MWM A;  5JHF A;  3AGP A;  1Y0N A;  2QM3 A;  1K8F A;  2CQK A;  2XAH A;  1QRC A;  4E70 A;  3H36 A;  5IYN A;  1ZGJ A;  2OJE D;  4DNT B;  3VOD A;  2JT1 A;  1EH6 A;  2RDP A;  2M5W A;  2CFX A;  2QZ8 A;  1U6G A;  2LRD A;  1FBU A;  4M9X A;  4A0Z A;  1SEU A;  2JVH A;  4U7D A;  4UNO A;  1QZE A;  2VJJ A;  1OGJ A;  3GLX A;  4ZV4 A;  4P25 A;  4J19 A;  4II2 A;  3IRR A;  1G7C A;  2FF4 A;  1B72 B;  2L9R A;  3K2A A;  1LEB A;  4PC1 A;  2YU9 J;  5IYW A;  5A8A A;  1YYV A;  3QQA A;  1ZM9 A;  3JSO A;  2C4T A;  2ZXH A;  4QVJ A;  2KKO A;  2W84 A;  3GTJ J;  2PMH A;  1WKM A;  5IT9 K;  1L1I A;  1QCX A;  2IS2 A;  2EH3 A;  1WPC A;  4NC8 A;  3N90 A;  2GRE A;  4CA0 A;  2DI3 A;  2PI0 A;  5F08 A;  1W36 C;  4EM0 B;  1R1V A;  1U2R A;  4OAY A;  1WWX A;  1M1E B;  4G94 A;  4IQ4 A;  4R79 A;  4LLN A;  4TMT A;  5L3F A;  4X7F A;  2OTL B;  1U0J A;  1JXS A;  3I3L A;  2R5Z B;  2OZU A;  1IHM A;  2QTZ A;  4KKU A;  3KP4 A;  5B66 C;  3CO6 C;  3H92 A;  3R61 A;  2IEK A;  2IPQ X;  3ZQ7 A;  4ZTJ A;  1X3W B;  2FOW A;  2VC1 A;  3Q9V A;  2E71 A;  1DAR A;  2JIZ A;  4S05 A;  1XMX A;  2HQA A;  2DFH A;  1IA5 A;  1SM4 A;  1JE8 A;  5F0H A;  5EGO A;  4RDK A;  1PUF B;  1FP2 A;  2PMZ A;  1T56 A;  2VBU A;  4A3M J;  4IPA A;  1MH4 A;  2H94 A;  1QNT A;  4OIP F;  1YI2 B;  1VQP B;  4E7S A;  2HOE A;  3D1N I;  2V26 A;  2ELJ A;  1MNE A;  5TIS C;  5IYD J;  4RCY A;  3E7L A;  3K9T A;  2DTR A;  4X6A J;  1IC8 A;  2DK5 A;  5D8L B;  1ETK A;  3J7Z I;  3JQP A;  4MHG A;  2K85 A;  3GX4 X;  4GFB A;  3ROU A;  4XRS A;  2BM1 A;  5IYR A;  1YW9 A;  1SC7 A;  4RD1 A;  3PUN A;  2OAZ A;  1OLT A;  2XPU A;  1JJ8 C;  2ID6 A;  2VN2 A;  4B43 A;  1EP3 B;  1WSU A;  2ZZF A;  1S7O A;  4FQG A;  1RET A;  4PJM A;  4MO7 A;  5FIU A;  2FJ1 A;  3FMS A;  1A6Q A;  3M7G A;  1TC3 C;  4MGR A;  3W3C A;  4BQN A;  1FX7 A;  2HXI A;  3T8R A;  4MLO A;  2EFW A;  5E79 C;  4M73 A;  1IXR C;  2JMW A;  2ZME B;  5LRS A;  3AAF A;  5E20 A;  5M3F J;  2MGQ A;  3N05 A;  3PIO F;  1DDG A;  2VBK A;  2VBW A;  2IGK A;  3KP2 A;  5J6X A;  4BHB A;  4BXF A;  3CCJ I;  4E7K A;  2VNJ A;  4C2M J;  3E20 A;  3FDY A;  4MYT A;  2BVM A;  3LSM A;  4PSW A;  2GJK A;  4MYU A;  1YX5 A;  1MBE A;  1DU0 A;  4RDL A;  2DLL A;  2ZC2 A;  1R23 A;  2L54 A;  3F6O A;  2XT4 A;  4D0P A;  3FXJ A;  1B8I A;  2NXN B;  4N9H A;  3GTP J;  4M6X A;  3OW2 B;  2IOU G;  3CME I;  2E19 A;  4RPB A;  1MBK A;  1JGG A;  4V19 K;  2EJR A;  1BMF A;  4XN3 A;  1V5G A;  4A0X A;  2NTP A;  1VQL B;  4Y52 J;  2C4U A;  4WK8 F;  1WOS A;  4M0L A;  3IC7 A;  1QVG B;  2HQ5 A;  1T0F C;  4LIU A;  2OBT A;  3B4N A;  2ZNZ A;  3OE7 A;  4I76 A;  2KVO A;  1W36 D;  1VQ5 B;  1DAB A;  2EA4 A;  3BCA A;  3DPU A;  2ZJ2 A;  3SJM A;  1N08 A;  4KDP A;  2DET A;  2Q0O A;  1B23 P;  1BX1 A;  1ETW A;  1F4K A;  2BM7 A;  2QEN A;  4JQF A;  4HLY A;  3R4K A;  4AIH A;  3KLN A;  3TO6 A;  4B4C A;  4C2T A;  4ZZL A;  1XG1 A;  2GIZ A;  4PK4 A;  4ENK A;  2L3D A;  1EKE A;  2QQB A;  3RPU A;  3OEH A;  3GQ8 A;  1FTZ A;  3BDD A;  3CZ6 A;  1O8J A;  3LQQ A;  4LFU A;  1G6N A;  1O4X A;  3RCO A;  2M8G X;  1DGR M;  4Y13 A;  2E5N A;  2NS8 A;  4PJL A;  1ZR4 A;  3FBI B;  2L2O A;  4FX4 A;  3RIQ A;  1RWR A;  2Q6L A;  1QA1 A;  2WA0 A;  5BOX A;  5IT9 Z;  2X53 S;  1G7S A;  3A8J A;  3A3B A;  2Y9Y A;  3K70 D;  3W2I A;  3S16 J;  3O2P E;  1Y6I A;  3WWG A;  3LFK A;  1REP C;  1H9G A;  3JAM Z;  2LSO A;  1VF7 A;  1P92 A;  1UD8 A;  3HGG A;  2NVY J;  4PC2 A;  4CCL A;  4EMS A;  1VQM I;  4NQW A;  4ENJ A;  1TNT A;  2B0L A;  1U8R A;  4P3Y A;  3TKY A;  3K69 A;  2BV3 A;  1KQ0 A;  5FJ8 J;  1Z1D A;  1KCD A;  5FKK A;  3AFH A;  1H8E A;  1UD3 A;  4A12 A;  2VKE A;  2BM4 A;  1YX2 A;  3CXC B;  1WQ2 A;  2JN6 A;  4RB2 C;  3C2H A;  5EJC A;  4CCO A;  1X1A A;  4XL9 A;  1XSD A;  3JRC A;  3HOZ J;  4LMY A;  1OPC A;  2STW A;  3FK7 A;  1Y56 A;  2NRA C;  2QSH X;  2KIS A;  3G73 A;  3C2G A;  1QHG A;  4KIF A;  4KIS A;  4A0Y A;  4OIR F;  1UD6 A;  2PEX A;  3JCU C;  5LGN A;  1WJE A;  1Z3X A;  2DTZ A;  4LK0 F;  4IKF A;  4HF0 A;  4XOP A;  1O8I A;  3C3W A;  2CF4 A;  2XIG A;  3CPX A;  3QP5 A;  1OIS A;  4LIT A;  2R7D A;  3AK5 A;  5HNH A;  5HOO A;  4HYE A;  4YFX F;  2LTP A;  2XGX A;  5K7F A;  5E8G A;  3LSP A;  1JKO C;  1X4P A;  1PKV A;  2GXG A;  2E1B A;  3U1D A;  1IN5 A;  3GZ5 A;  2EV0 A;  3MMY B;  3PNV A;  5J1U A;  3PUM A;  5DCM A;  2W4S A;  3FM5 A;  5DDG A;  3ZMS A;  3OYH A;  1VTN C;  5LRR A;  1XCB A;  3CW2 A;  4WZT A;  3M9A A;  2QQ8 A;  3QYF A;  2P4W A;  2OTJ B;  2DOE A;  4QSH A;  5EG0 B;  4CYC B;  2VOP A;  1F60 A;  4LD5 A;  1T39 A;  2XAG A;  4BJT A;  1A6I A;  1GXP A;  4LBY A;  4RM2 A;  3OS1 A;  1H0M A;  4HW0 A;  4BBR J;  1ZRD A;  2V6E A;  2EIK H;  4WWV A;  3PEN A;  4CZC A;  2UWM A;  1JJ6 C;  1JGS A;  1QVT A;  4TT3 A;  1TWF J;  4JX5 A;  1VND A;  3TW7 A;  2BF4 A;  2QDX A;  3LST A;  3C18 A;  4BL0 B;  3V76 A;  3D5S C;  3EYY A;  1FMW A;  4ZYH A;  2WTE A;  1VQP I;  1YI2 I;  4HAM A;  4RM3 A;  2PEC A;  2LYC A;  3U6B A;  1W2B B;  3L00 A;  3O8G A;  1VQ7 I;  2LF8 A;  1N75 A;  2A3S A;  4HX8 A;  4YEL A;  5FFX A;  4A3B J;  1MH3 A;  2FBH A;  2W00 A;  5DTD A;  4AD9 A;  2QYO A;  3GME A;  2HYG D;  1W4M A;  1XG2 A;  4BKX A;  3KX2 A;  4XMY A;  2HTS A;  4UUV A;  4BAY A;  2P5V A;  3Q9S A;  3W6K B;  4DZJ A;  2R7T A;  2E1N A;  4L9J A;  3FX3 A;  4X05 A;  4G6Q A;  1KU2 A;  1VBL A;  3HZJ A;  1BW6 A;  2GBY A;  3MD2 A;  4Y7N J;  1P4X A;  2OC6 A;  1Z6R A;  3ZOB A;  2J8K A;  4F92 B;  3OW7 A;  3J80 K;  2KRC A;  1QFJ A;  1K28 D;  3QAH A;  2WR8 A;  2LK2 A;  5JI6 A;  2XGE A;  1X4O A;  4AIJ A;  1BOA A;  2VFM A;  1U78 A;  5KHD A;  4J01 A;  2C5B A;  1B59 A;  1E3Z A;  2XEX A;  1HQC A;  3ZZT A;  3FKJ A;  4S04 A;  1BI2 A;  1OCO H;  3LA7 A;  4I09 A;  5DYM A;  2BX6 A;  5H2F C;  3B8Y A;  3BC9 A;  3CLQ A;  3SZP A;  4BH9 A;  1KJZ A;  4YAF A;  4PGG A;  2BY3 A;  3A4C A;  3CES A;  3TW6 A;  1ZLK A;  3E5U A;  2L7Z A;  2IT0 A;  2VJ5 A;  3ULQ B;  1E63 A;  1KK2 A;  3ONU A;  4P3I A;  3W2G A;  1PJ7 A;  1UHS A;  3AVV A;  3IP4 B;  1JKR C;  1VQ5 I;  2QXZ A;  3RIR A;  3TED A;  2X0K A;  4LBW A;  3CC2 B;  2QLZ A;  5TJJ A;  4MTE A;  2I5U A;  2V9P A;  5DUK A;  4M6V A;  1NG6 A;  4BJ5 C;  3IRQ A;  4UB6 C;  1YS7 A;  3K4M A;  3LMM A;  4W8T A;  4EM1 A;  2J7K A;  3CCL I;  3CTA A;  1W5S A;  1VQ8 I;  5J3L A;  4Y9R A;  1BI0 A;  1PYV A;  4L9T A;  2IQ7 A;  3TOA A;  1ACI A;  3PM1 A;  3OP1 A;  4M2L A;  1OGO X;  3ABK H;  2LKX A;  4RCZ A;  3AVU A;  4IHW A;  3ZQH A;  5BMZ A;  2QCO A;  3CUQ A;  1ZAR A;  2MC3 A;  3IL2 A;  5F0C A;  2EWN A;  1FIP A;  1LLZ A;  1Z67 A;  5B1A H;  4JBA A;  4G5G A;  1EF4 A;  2BW3 A;  2R5Y B;  2HDN B;  2XZP A;  4OAZ A;  1XDS A;  5LEJ A;  2D3L A;  5KVR A;  5J1R A;  3H5A A;  2FA5 A;  3G1M A;  3TDU C;  3GBG A;  2ACJ A;  4AC9 A;  1CQT A;  2ZTN A;  5AMV A;  4BE1 A;  2C2W A;  4A3E J;  3HOS A;  1K78 A;  4YFO A;  2DMN A;  2V7U A;  1JRG A;  1V5F A;  2YWG A;  3AST A;  1Z0X A;  4BY1 J;  3HSE A;  3ASP A;  1ZG1 A;  2OBP A;  3TP3 A;  2IXS A;  2WAF A;  2X9D A;  3HOY J;  2F1L A;  1BL0 A;  3CDL A;  1WJC A;  2GQF A;  2Z6B D;  1KQ9 A;  3RI4 A;  2VQL A;  4B47 A;  3DU1 X;  3TQN A;  1MW7 A;  2V6C A;  2YU3 A;  3OYE A;  1P6R A;  4IHS A;  1X19 A;  3WU2 C;  4BUP A;  2ZJP F;  2EWE A;  1K9M D;  1F43 A;  2OF7 A;  3OYF A;  3CCV B;  1OB0 A;  1X1B A;  3M8E A;  3CCU I;  2XB0 X;  1TYV A;  2KRH A;  2QGG A;  4IHV A;  3G1O A;  2CQQ A;  3PSI A;  4LB6 B;  3W2A A;  4OPV A;  3R6S A;  3W6J B;  4QVA A;  3PSF A;  2F5D A;  3OYN A;  4FK8 A;  2QQ9 A;  2E35 A;  4Z4V A;  2GQQ A;  3G71 B;  2G0E A;  3ISX A;  3L9F A;  5L3C A;  4Y3O A;  2FOK A;  5E1X A;  1ZG3 A;  3KZY A;  3EPZ A;  4MEX F;  4Z4S A;  1I50 J;  1D1A A;  4RBO A;  1GVH A;  1R36 A;  3Q3A A;  1POG A;  3ASN H;  2GXB A;  3GQB A;  5D5W B;  3ZQF A;  2HU9 A;  2QUF A;  1QA6 A;  3T9G A;  2TCT A;  2Y2Z A;  2LY9 A;  1MD0 A;  2VE8 A;  3G4S I;  3DTE A;  4O6J A;  1ZN2 A;  3KET A;  1ON1 A;  3S2D J;  1QGP A;  2DDA A;  1CF7 A;  2WYR A;  3WY9 A;  5KSW B;  1R5N A;  1BQE A;  3R0A A;  5THX A;  3HM5 A;  4PMH A;  5KCM A;  1T8I A;  3S1Q J;  4YIF A;  1HBX G;  2Y30 A;  2IA2 A;  4FX0 A;  2FU4 A;  2CW5 A;  4D5C A;  4YRV A;  1BJK A;  3P27 A;  4TMW A;  4I0B A;  4YAL A;  1VI0 A;  2PMU A;  2VBY A;  1SKQ A;  2NV4 A;  3KLO A;  1J59 A;  1E64 A;  3JR9 A;  2VL8 A;  4OIO F;  4BS9 A;  1D1B A;  1QFZ A;  1ODD A;  1N05 A;  3DBL B;  1I27 A;  1F20 A;  1KK0 A;  2A05 A;  2JDI A;  2K9M A;  3I55 B;  3WTU C;  4MFD A;  1EFR A;  3RY8 A;  2IGO A;  2JA2 A;  4XR6 A;  4GQN A;  3R6K A;  2R7W A;  4ZJZ A;  4A69 C;  4GO1 A;  1QFY A;  4HQE A;  2L4A A;  2NYX A;  3GFM A;  4Z4T A;  1EP2 B;  2W7N A;  5KNL A;  3JRF A;  3RKW A;  3P9C A;  2BGJ A;  1P4A A;  2O8X A;  5FLX K;  4D9J A;  3H94 A;  1D8J A;  4UUS A;  1Q82 D;  2XV4 S;  1N8R D;  4ETS A;  2CQX A;  1R9T J;  2QA4 B;  1BHE A;  1FT9 A;  1OYW A;  2DFI A;  3OYI A;  1J9Z A;  1TSP A;  1IN8 A;  1DPR A;  1UAA A;  5FO0 A;  4N4N B;  4XSZ F;  1O8G A;  2GOM A;  5LHI A;  2KJC A;  4BEH B;  1R22 A;  2XRN A;  3PQK A;  1GAW A;  1MJA A;  3CCS B;  2EZI A;  4R1H A;  3JRB A;  4L5I A;  1TL8 A;  1OGM X;  1G4D A;  5KAI C;  3ZIA A;  1LQ1 A;  4RAY A;  1FTT A;  1EXM A;  4RM0 A;  3KZI C;  4YZA A;  2CG4 A;  3ABL H;  2X3H A;  1W34 A;  4U49 A;  1VQO B;  3CC4 B;  3T1B A;  3J81 K;  3ZRG A;  3HOX J;  4I6Z A;  4X7C A;  2YUH A;  3KP3 A;  5GAD J;  1W7P A;  2O7O A;  5DS9 A;  4Z4W A;  5ICE A;  5FL7 A;  4YHB A;  3WTZ A;  1S72 I;  2NOJ B;  3BR6 A;  3HRM A;  1UD4 A;  2JJ2 A;  3FK6 A;  4KJZ A;  4Y4R A;  3DDY A;  4P9S A;  2VKV A;  2AQE A;  3IAM 2;  2D1V A;  5K7Z A;  2FX3 A;  1LVK A;  3RPQ A;  1FSE A;  3ASO H;  1YFH A;  3KZZ A;  4MIM A;  4ZH4 F;  5C1C A;  1I18 A;  1R58 A;  2QBY B;  2DYR H;  2RC4 A;  1Z3Y A;  3SHF A;  2STT A;  3IKT A;  2O8K A;  2OCE A;  1FOK A;  1R00 A;  4K1X A;  4A2U A;  5IP7 J;  2DN0 A;  1S0U A;  1E79 A;  4B48 A;  1LB2 A;  3KCC A;  2XB5 A;  2P6S A;  4LGW A;  4PJN A;  4LG0 A;  2IGN A;  2OQR A;  4ZC3 A;  1R5O A;  1CNF A;  1YLF A;  1PE9 A;  3E5X A;  3B90 A;  3A01 A;  1SKY B;  2Q6K A;  3AVW A;  3Q0W A;  1AKH B;  3BR3 A;  1UHW A;  5KK1 A;  3K4B A;  2FMY A;  3CQZ J;  1VQK I;  3PO3 J;  3GIR A;  4IRH A;  4MQV A;  4IHY A;  1OYY A;  3M1E A;  2HOT A;  3DXJ F;  4OJP A;  2XC1 A;  2IRF G;  2NPF A;  2LNB A;  3L2U A;  4L9V A;  4M71 A;  3V8J A;  4ZTF A;  1N0V C;  1K8A D;  1OR7 C;  5ERI A;  2H6C A;  3A1Y A;  3M8J A;  2YSR A;  3CCV I;  2F3L A;  1OR7 A;  4TSF A;  2BEO A;  2RNJ A;  4F55 A;  1QQ1 A;  3J7A O;  3BP8 A;  4PAB A;  4I98 B;  2M3A A;  2EK5 A;  4LK1 F;  1PJ5 A;  2QYU A;  1ETV A;  4U88 A;  4E7H A;  2R7Q A;  3S3O A;  2NZM A;  3WU0 A;  1OHH A;  3VB2 A;  5AIP A;  3CPW B;  3A02 A;  3CLO A;  3R60 A;  2QF7 A;  4UVA A;  1NBM A;  1HLV A;  3CO7 C;  3D26 A;  3LAJ A;  5HZA A;  1RES A;  3PO2 J;  1QZZ A;  4RB0 A;  3MHP A;  4LC0 A;  2HQR A;  3DEE A;  3CMA B;  4AU7 A;  3MN2 A;  4QLC U;  1AKH A;  4C43 A;  4UVB A;  1HST A;  3A01 B;  4JMQ A;  2ZXW H;  4YZQ A;  1S4M A;  1KU7 A;  4LG0 B;  2ELH A;  4L5J A;  3S15 J;  1ZGW A;  3ASS A;  1H80 A;  2L9N A;  3N4M A;  1ITY A;  2H09 A;  2RRE A;  2KL4 A;  5CDF A;  1IN4 A;  4NK6 A;  2EFO A;  3MCA A;  3HRU A;  2VAS A;  2Y75 A;  2XKO A;  3RYP A;  2QBY A;  3I9V 2;  1BJZ A;  5E6T A;  3BQY A;  2H8R A;  3SXY A;  4HLX A;  4D5F A;  2ZZQ A;  2A61 A;  1A36 A;  2M4G A;  4Q7J B;  2KQR A;  4II3 A;  2GK6 A;  3A35 A;  4EJV A;  1MBG A;  1LKX A;  3BY6 A;  1E62 A;  4OOV A;  4FWT A;  4PUS A;  3I56 B;  1VQ4 B;  4C3J J;  2UVF A;  1TYW A;  2D74 A;  4RAF A;  1W7P B;  2A69 F;  1ORK A;  1XMK A;  2XKP A;  1FNN A;  5DM7 F;  2W24 A;  2COM A;  2XAF A;  3DKY A;  1P4W A;  1YJ9 I;  1R4N B;  2MA3 A;  3WG7 H;  1ZRF A;  3OYJ A;  1HW5 A;  3WNB A;  2VBS A;  3K4K A;  5CLS A;  1O3Q A;  4BPR A;  1GJR A;  1KC8 D;  3GRH A;  4V02 C;  1FOY A;  3B73 A;  4XRM A;  3QYE A;  2RNG A;  2JQ7 A;  1KQS B;  4C0S A;  3HSF A;  4RD6 A;  2F5V A;  4HNT A;  2B5O A;  1R49 A;  1BI3 A;  1X0C A;  4S0H B;  4BEH A;  2BVL A;  1EWY A;  2XGJ A;  4YAO A;  3T53 B;  1RUN A;  2HEO A;  2F4O B;  2ZB9 A;  2E2H J;  3OIO A;  1K79 A;  1O8H A;  4XLN F;  1FOW A;  3K70 C;  4IO9 F;  5DUI A;  1SAX A;  2DIE A;  2VC0 A;  2M0C A;  4UUS B;  4FET A;  4WQM A;  4PSX A;  1RI7 A;  1Z7L A;  1SFX A;  3C2B A;  1IDZ A;  5BPI A;  3WTS C;  4XKC A;  4G9Y A;  1VHE A;  3BZK A;  3V7C A;  3E3V A;  3LSI A;  1MIJ A;  1NRK A;  2P0W A;  3LSH A;  3SZT A;  1KZL A;  1ZGA A;  2IJL A;  3NWT A;  1RMG A;  5GAG J;  3ISP A;  2R7R A;  3BTC A;  1WMR A;  4P96 A;  3QSY A;  1IO2 A;  1I5Z A;  1GV5 A;  5J8F A;  2ESH A;  4G7Z F;  1FDR A;  2O0Y A;  3ESW B;  5ED4 A;  2WPD A;  2A6T A;  2XOK A;  5EZG A;  3CD6 I;  4FXU A;  3H3U A;  4Y9U A;  2E34 A;  3B78 A;  2W57 A;  2MLK A;  1FPQ A;  1K61 A;  4ACA A;  3OAA A;  3CME B;  1UD2 A;  4KN7 X;  1P2F A;  4X0G A;  4G1V A;  4OJ5 A;  3FIW A;  2PLF A;  2JPC A;  2NAZ A;  3AKZ A;  3P9I A;  4PJJ A;  2M9H A;  1EFC A;  2B7C A;  2DJN A;  2JRT A;  2K02 A;  3MKY B;  3V7S A;  1VJS A;  1CF7 B;  2Y0S A;  4JX6 A;  2E1M C;  4GGG A;  2OK7 A;  4ESJ A;  3SEQ A;  3S32 A;  1UMQ A;  2BN4 A;  5IY5 H;  2E60 A;  2HTJ A;  1E0E A;  1WJD A;  2OD5 A;  1ZH5 A;  2M4K A;  4XRF A;  1TT0 A;  4HNU A;  3QU3 A;  3ES9 A;  3ZMD A;  1PUE E;  2MD0 A;  3ERE D;  2VBT A;  2XRL A;  4IF4 A;  1ONV A;  3OYL A;  1VHO A;  1XDU A;  2UV1 A;  4WWC A;  1TQI A;  3R0J A;  1LUJ B;  2EV6 A;  5F04 A;  3H9Q A;  2Y0S N;  5L3B A;  4CCK A;  1O8L A;  4OJO A;  3TOB A;  3BLY A;  2EFG A;  3Q5F A;  2QMU A;  3ML3 A;  2VKH A;  2BHY A;  1TZL A;  4XD7 A;  4E6K G;  1Z05 A;  4Y33 A;  5F1J A;  3QPS A;  3SEZ A;  1T2K A;  1IW7 F;  4P2N A;  3KEO A;  5BS6 A;  3GQ7 A;  1CZF A;  1KTV A;  3CCJ B;  1HG8 A;  3OEE A;  2YR2 A;  4M53 A;  2HVQ A;  3K10 A;  1WI3 A;  2KIF A;  3BG7 A;  3E1Y E;  4B3F X;  4M9Z A;  2JWT A;  4EQQ A;  1F9N A;  2V31 A;  1EP1 B;  1AMO A;  2HKO A;  2CBX A;  1H42 A;  1WOR A;  3WTX C;  1WJF A;  4CDG A;  1J75 A;  5J4Y A;  3KYL A;  2HMA A;  2ZO4 A;  3ABU A;  1O3T A;  4YAW A;  4UXN A;  1K78 B;  2X0L A;  5H5J A;  3IH2 A;  2F2E A;  2NVU B;  4IX7 A;  5DV5 A;  2DPU A;  2DMP A;  3HKZ A;  4YC5 A;  4XKV A;  1EFU A;  2VNI A;  2ZTG A;  3JQQ A;  3SQV A;  1XGS A;  2HPM A;  3U2Q A;  2DT5 A;  3HJE A;  5DEQ A;  5DS0 A;  3QYB A;  3S3N A;  2R5Y A;  3EYI A;  2FX0 A;  2BW3 B;  2BSA A;  3WG9 A;  1WHU A;  4F93 B;  1YIJ I;  3OYD A;  5LD2 C;  1TQP A;  2NS0 A;  2X4H A;  3BPX A;  5D4S A;  2M34 A;  3LVB A;  4ON0 A;  2CYY A;  1SMY F;  3CUQ B;  2RKH A;  4XIC A;  1CGP A;  1HF2 A;  3COA C;  4EVI A;  1SAN A;  3OYB A;  3EDP A;  4W8R A;  4HA8 A;  3RJP A;  5J40 A;  2K4J A;  2CND A;  5H6Q A;  2WBM A;  2K9L A;  4N4O B;  2LD5 A;  5J47 A;  3S8P A;  2WAQ N;  2V1N A;  3DLL F;  1IV8 A;  3IAS 2;  4CZZ A;  2VOO A;  2RQP A;  1N77 A;  1DBG A;  1JUS A;  1IRG A;  1E2X A;  2DOA A;  2ZKZ A;  1LEA A;  3ZXS A;  4BE0 A;  4HOB A;  3WNC A;  4GRI A;  3BG3 A;  3OYK A;  4U87 A;  3DU6 A;  2CH0 A;  2UUZ A;  3AG1 H;  2XSD C;  2F43 A;  4F52 A;  4IZZ A;  3G2B A;  5M5X J;  1QGA A;  1BM9 A;  4UVC A;  3E5Q A;  3PIP F;  1D8K A;  3AG4 H;  3S2W A;  2MH2 A;  2XNJ A;  4Z2Y A;  1HZE A;  3I64 A;  1G3W A;  3P5J A;  2F4N A;  4FCY A;  3OJW A;  1MBH A;  2W25 A;  5LGU A;  1WH7 A;  1N06 A;  3TP0 A;  2V1U A;  4DQ2 A;  3ABT A;  2B9S A;  2JZY A;  4AYB A;  2H6B A;  3W2V A;  4YFN F;  5EZH A;  1V0E A;  4OPS A;  1GXQ A;  2G7H A;  3SZE A;  2RGV A;  3JAM K;  4BNC A;  1TLL A;  1XMA A;  2DDB A;  3O6B B;  2MD5 A;  1FNC A;  2X1D A;  2XDV A;  1ZEL A;  2I8D A;  2OZ6 A;  5HLG A;  4TMZ A;  2MC4 A;  2HKX A;  4RB1 A;  4Z05 A;  5BNG A;  1BPL A;  4IRG A;  1JUP A;  3DBH B;  1HXD A;  4G6I A;  2DW4 A;  3WE3 A;  4ZYG A;  3MKL A;  3HGY A;  5GTH C;  1SFE A;  4J00 A;  2VNH A;  5FO1 A;  5F0F A;  3FXL A;  5B6I A;  2ZZE A;  4W1U A;  5BSY A;  5IP9 J;  1VQ6 B;  2DER A;  3BJ6 A;  3IH4 A;  4G6T B;  4ENN A;  4N3N A;  1QVF B;  3TGN A;  1OGI A;  1UMK A;  1M90 D;  5FRO A;  1BR2 A;  1SD5 A;  2VT2 A;  3KEQ A;  4MQ9 F;  4IHT A;  4BHP A;  1Q1V A;  1WJA A;  2PE3 A;  1S29 A;  2XPV A;  4O5V A;  1STZ A;  2LH9 A;  1AIP A;  1VLY A;  4E0F A;  2WZN A;  2UXX A;  3BZC A;  2KMU A;  2HNH A;  2HDD A;  1Q86 D;  2GM4 A;  4NUB A;  1QBJ A;  3FKS A;  1ERD A;  1XFO A;  4IL6 C;  3NE5 B;  4M3B A;  1UG2 A;  2LRE A;  1VLO A;  4TMX A;  4JP0 A;  3PET A;  2TRT A;  3LMW A;  4FE7 A;  2X85 A;  2DFF A;  4CYC A;  5EG0 A;  1MZB A;  4CCM A;  4FTH A;  2PN6 A;  3Q6R A;  3H0G J;  1QUF A;  2B7B A;  5B1B H;  4OJL A;  3F8M A;  4JRA C;  1J5Y A;  2ESN A;  5DCM B;  2GK7 A;  5IP6 A;  2ZJR F;  3CB4 A;  4AUX A;  4ACB A;  1I6X A;  4B8X A;  2IGM A;  4E7L A;  2FRH A;  3GTG J;  3CC4 I;  3BQZ A;  2QN6 A;  3K4N A;  2CUF A;  2N8G A;  3QPH A;  2XNC A;  1TYU A;  2K3P A;  5CVJ A;  2IW5 A;  2VFN A;  4Z06 A;  4XID A;  5J4V A;  5HNF A;  1R1T A;  3GFI A;  3KPH A;  3AG2 H;  3LSG A;  3EUH C;  4XLF A;  5JVG F;  5IPA A;  2CUE A;  1VQ7 B;  4KKS A;  1MMN A;  3F8N A;  3VYU B;  5JHU A;  4AID A;  5K1Y A;  4ZCL A;  2CWE A;  1WGX A;  4PGO A;  2FNP A;  4WZK A;  2QKM B;  3GO5 A;  5K7H A;  4UV9 A;  2WZP P;  4G12 A;  4CUG A;  2JA7 J;  4R71 A;  4AC0 A;  1H88 C;  2M1B A;  3B02 A;  1AWC A;  1AA7 A;  1Y39 A;  4U9U A;  2KDZ A;  3NEU A;  4CQJ A;  1X1P A;  4KIG A;  1XE1 A;  2L7K A;  5B3S H;  4YEJ A;  1ETX A;  1X2M A;  1NHC A;  1Y8Q B;  2E5Z A;  3DWL E;  5K5O A;  3ZZU A;  4UZU A;  2OTJ I;  2P5K A;  5EDN A;  4NQW B;  1CNE A;  1QA2 A;  1YHQ B;  2QVO A;  4L18 B;  2DCU A;  4H0E A;  4E4H A;  1FMV A;  1QHH D;  1ZG5 A;  3CCY A;  4XKB A;  3DBR B;  3DEW A;  5GPC A;  1YIO A;  2YWF A;  3GVJ A;  1ZTR A;  3CC2 I;  1T5E A;  2QTL A;  1X2N A;  2D1H A;  4PC7 A;  5LFA A;  3A0H C;  1KQ5 A;  3WXM A;  4OZY A;  4RD3 A;  6PAX A;  4BY7 J;  3X2Q H;  3DLA A;  1ULY A;  1HKS A;  4Q47 A;  2DK8 A;  2CC2 A;  3IUO A;  4YZ0 A;  1QGY A;  3OFN A;  4ZYE A;  3LYC A;  3FKI J;  2O0W A;  3OV8 A;  2P6T A;  4DNC A;  2XTW A;  1T95 A;  1HF0 A;  4P12 A;  4A6D A;  1RIO H;  3D0S A;  3CUQ C;  5E1W A;  2LR8 A;  3A8I A;  4U0Y A;  1HOM A;  4IHX A;  1UG0 A;  2KJB A;  1IGN A;  1VQN B;  3EQN A;  1E1Q A;  2NST A;  1Q81 D;  3FY3 A;  1KRH A;  2ODL A;  3SUC A;  4M3F A;  3GTM J;  4HG2 A;  5D6F A;  5IYQ A;  2KP6 A;  4HF2 A;  3HB9 A;  1SD4 A;  1IUY A;  1ZM4 A;  1T0F A;  4NB5 A;  1J09 A;  2V7F A;  2VQC A;  3F8C A;  1B8I B;  3DQV C;  1T6S A;  3JW4 A;  1VFC A;  3ZP5 A;  3NWS A;  2Y9Z A;  4F91 B;  4YXW A;  1SVO A;  4DW6 A;  1IJW C;  1T6X A;  4G7O F;  3VO2 A;  4LOC A;  5TV2 A;  3VOE A;  1GUU A;  1YJW B;  1QRY A;  1A8P A;  1W0K A;  3I5U A;  2BY2 A;  3KE2 A;  3M07 A;  1V0F A;  1FRQ A;  5H20 A;  3GZ6 A;  2AHO A;  2WWY A;  4KKT A;  3MCZ A;  2V9K A;  4RGS A;  3QP6 A;  2VLA A;  3EUH A;  3VST A;  2AXL A;  3HSR A;  3JRG A;  2FVG A;  4AVP A;  2D45 A;  2ISZ A;  4ROX A;  2O6W A;  1GR1 A;  2ZME A;  3HL2 A;  2C78 A;  2GPJ A;  4QV2 A;  1SVL A;  2HVR A;  3AGQ A;  1LFP A;  3VEP A;  2YWH A;  4EJO A;  3GTK J;  3J7A Y;  3BOQ A;  3G71 I;  1RR7 A;  5J1Y A;  2JA8 J;  1LNW A;  3ASR A;  4FN5 A;  1G59 A;  2F4M B;  1SFU A;  2IA0 A;  2M8E A;  1ZLJ A;  5ICF A;  1RQR A;  4RD4 A;  1G3S A;  5GAH J;  4LBZ A;  3S14 J;  2DMQ A;  2Z9O A;  2GA1 A;  3V7A A;  3DKX A;  3SFI A;  1YJ9 B;  2IS1 A;  4PFP A;  4NK8 A;  1MKM A;  3QRF F;  3WGI A;  5HKK A;  1S7A A;  3BRO A;  1MMD A;  4AWX B;  1NK2 P;  3GZN B;  3W2W A;  3L2V A;  1Q9S A;  1PDN C;  5J8C A;  2V7X A;  2X51 A;  4JYK A;  3ZQQ A;  3OYC A;  1QPI A;  4X7E A;  3DTI A;  2XT2 A;  5D5V B;  1IZ1 A;  1GLN A;  3ECO A;  1O8K A;  2KFD A;  3FXU A;  3PSS A;  3WTW C;  3IV5 A;  3MZH A;  3L09 A;  1PUF A;  5HDG A;  1U9O A;  2ID3 A;  1TP4 A;  2RVC A;  5IYC J;  2VBX A;  3PL8 A;  5EGO B;  1PP8 F;  4RB3 C;  3OSF A;  1K7A A;  4PCQ A;  3HTU A;  1NK3 P;  1JNY A;  4DK1 A;  3G6E B;  3PNY A;  3LQE A;  4OM9 A;  3W5U A;  1BLI A;  1E17 A;  1RKT A;  3Q0V A;  3O3K A;  2ICW G;  3DKW A;  1FIA A;  2FML A;  4MXN A;  3ZPP A;  3TMO A;  2W82 A;  5A2Q K;  4WCG A;  4ZDO A;  4KT6 A;  2R5Z A;  1KD1 D;  2XHK A;  5A89 A;  1MMG A;  4C2U A;  2HR3 A;  1FSH A;  1LDD A;  3I53 A;  1P4M A;  5HXB A;  3JRA A;  2V4D A;  4E7J A;  4F7Z A;  1IG7 A;  4BXX J;  3TO9 A;  4O3M A;  2O9L A;  3BZ6 A;  4Q5S F;  3ZSC A;  2M2E A;  2VKD A;  1ZM3 A;  4OOX A;  3LSJ A;  1YLO A;  2ZME C;  2FBI A;  4RD2 A;  5HVQ C;  1MBJ A;  1A35 A;  1T6Y A;  3VSK A;  3SJZ A;  4I99 C;  3VDX A;  2BYV E;  1KZH A;  1WSV A;  1WZ2 A;  2K5C A;  1EH7 A;  3S93 A;  1D0X A;  3ZCO A;  3ZZ0 A;  2DYI A;  2QZA A;  1FWZ A;  1B72 A;  2GJP A;  4Z4R A;  1V55 H;  2EZL A;  1YIT B;  3TH0 A;  2AXT C;  3ZMU A;  3HHG A;  1QU3 A;  4QIW N;  4WZL A;  1GDT A;  2QSF X;  2IA1 A;  1FX0 A;  4HE6 A;  1KA8 A;  1IRF A;  3GYH X;  2QQA A;  4KIT B;  4BBS J;  4CHU A;  3GW2 A;  5HLH A;  2HCJ B;  4YDT A;  3QFR A;  4X07 A;  4IQJ A;  1WP6 A;  5FRM A;  2R4G A;  3H09 A;  1MND A;  3HKZ N;  2KHM A;  2WV1 A;  4P1W A;  2QE7 A;  3AVY A;  1RPW A;  3F8B A;  3EQO A;  2HZD A;  2XF5 A;  2GA2 A;  1E3H A;  1BC7 C;  2X3U A;  5F4M A;  2CUJ A;  1FLI A;  1OYI A;  1RR8 C;  3W2F A;  4W8S A;  1TLH B;  5HS9 A;  1Z7U A;  1P7J A;  2X6Y A;  2DY1 A;  1KYZ A;  3FXO A;  1BIA A;  5CVV A;  1I1G A;  5EMN A;  4WXC A;  1DPU A;  2DA7 A;  5GTI C;  4E7I A;  2EZH A;  4I0A A;  3KL9 A;  2O17 A;  2WV0 A;  3A0B C;  3BC8 A;  4G8X A;  4LJZ F;  3UR3 C;  4ESB A;  2QEX I;  1R71 A;  1E3X A;  3ONQ A;  2NTQ A;  3GF2 A;  3HOV J;  1JT6 A;  2ISY A;  2A68 F;  4G6D A;  5ILU A;  5BSX A;  2W48 A;  5D5X B;  3CCE I;  1FEX A;  4D7N A;  1FYL A;  3K0L A;  1TW2 A;  2CGP A;  2E1O A;  2JK3 A;  3BR0 A;  2PQ8 A;  3DFG A;  2DA1 A;  3HPH A;  3LL7 A;  3PFY A;  4KT5 C;  1LPQ A;  4BU2 A;  1WU8 A;  3RQI A;  1WJ5 A;  3KEY A;  2FQ4 A;  3MVP A;  3VWB A;  4ZYD A;  1IF1 A;  2DT7 B;  1BW5 A;  1DG1 G;  1HA3 A;  1HW2 A;  2V79 A;  3I59 A;  3H3Z A;  1KMH A;  4OMZ A;  2Y31 A;  1Z21 A;  4BGD A;  1LE8 B;  3HPG A;  1GVJ A;  5FA6 A;  3WTY C;  2Q2E B;  1FND A;  3ZUG A;  2WY8 Q;  1F5T A;  4BDY A;  1XSX A;  4KIC A;  3EUK L;  4XBF A;  2QKL B;  2GLO A;  5ILS A;  1O8D A;  2ME0 A;  3WGH A;  1JB9 A;  1AIR A;  1H8H A;  5ICG A;  4HZF A;  3T8T A;  2COB A;  3EET A;  2H27 A;  1TWH J;  2OK8 A;  1OQY A;  4BDZ A;  4L5E A;  3F72 A;  3H3V K;  2FBK A;  3BR5 A;  5GPA A;  2DOG A;  5FLV A;  3J81 k;  4YG2 F;  1WDT A;  2R7F A;  4EJT A;  1H85 A;  3QFC A;  3QPL A;  5FFZ A;  3FZV A;  2Y0M A;  1IRZ A;  1NHA A;  2IAI A;  3LSK A;  1G3T A;  3VMF A;  1U8B A;  4P5O A;  2GAU A;  4Z4Y A;  4PGH A;  4ASN A;  3CMA I;  1O8F A;  4EGY A;  1TBX A;  1D0Y A;  4M4S A;  3LWF A;  3M1C A;  4DGW B;  2ZXI A;  4DYR A;  3AL0 B;  4Z1M A;  1XCV A;  2X1E A;  4DYC A;  2PYH A;  2ZBK A;  2INV A;  2VBV A;  2F5E A;  3CJN A;  3K4C A;  4P9U A;  3KYC B;  2LC2 A;  2VNK A;  3E6M A;  4AIK A;  1YW7 A;  2D2W A;  4A3J J;  1KCC A;  1ZAO A;  5FB2 A;  1B6A A;  4GYI A;  1UZC A;  4GYG A;  3I71 A;  2DEU A;  3GVL A;  2OA4 A;  1CLW A;  1VQ9 I;  4OOS A;  1Z77 A;  2MLG A;  5FGM A;  4C3H J;  2MBF A;  4TN1 A;  4FT8 A;  3MMP A;  2WAE A;  4HNV A;  1GO2 A;  1EV7 A;  3RKQ A;  3BG5 A;  1BR4 A;  1LFB A;  4XLP F;  3I56 I;  2HLD A;  1AU7 A;  2ZSH B;  1UCR A;  5HDN A;  3FMQ A;  3GTQ J;  3KEW A;  1XX5 A;  5EEA A;  2Q6O A;  2HOS A;  5TY0 A;  4PC3 A;  3NRV A;  2F1M A;  4QHY A;  2LBF B;  4XK4 A;  2L01 A;  4U0V A;  4BE2 A;  4AF7 A;  1T38 A;  1B4A A;  4NC7 A;  2OU2 A;  3IWZ A;  1YRN A;  3AVT A;  1ETO A;  3WTT C;  4ABZ A;  3I4M J;  2WJV A;  3B6C A;  1LJ9 A;  4M74 A;  3WBJ A;  4AM3 A;  4UZE A;  1A31 A;  1OCR H;  4DBR A;  3JX8 A;  4RA2 A;  1BN5 A;  2BXZ A;  2LG4 A;  2XSJ C;  2X48 A;  3DP7 A;  2P3M A;  2M5S A;  5DD8 A;  3HG9 A;  1BBY A;  3OOU A;  1CQX A;  3ZBU A;  1SFO J;  1Y1V J;  5E8I A;  3PUB A;  1J0R A;  4HBL A;  4K2E A;  2DA3 A;  3WHB A;  4KYW A;  4UHT A;  2V7V A;  4RLQ A;  1PLU A;  1G7T A;  4B3X A;  4LG3 A;  3OWT A;  4M3D A;  2LMD A;  3ZMV A;  2ECC A;  2BM6 A;  2XC7 A;  2E2J J;  2OBR A;  1DDI A;  2A07 F;  1COW A;  1XTA A;  3CDH A;  2W6J A;  3LAP A;  5HZB A;  2V7T A;  2K86 A;  5DCF A;  2VXD A;  3SY2 A;  4ZGQ B;  4DYQ A;  3WHC A;  2NVT J;  1I3A A;  4XLH A;  4YFK F;  1FYK A;  4MTD A;  1DU6 A;  1WFX A;  1DDN A;  2GWR A;  2BE5 F;  2YUS A;  4L8J A;  4P6Y A;  5GV7 A;  3PQJ A;  1D8T A;  4N0B A;  3CF5 F;  1TWA J;  1MSE C;  1D5Y A;  1EA3 A;  2A5W A;  2AQF A;  2CJJ A;  1ZR2 A;  1XB2 A;  5GAE J;  3OSG A;  3ZQI A;  4OMY A;  3BQJ A;  2VYQ A;  1YJW I;  5E17 F;  3RZO J;  3FXK A;  4U4B A;  4G1B A;  4CCN A;  1V4R A;  4B3G A;  1UST A;  1Y8R B;  3F21 A;  2D5V A;  2VQG A;  4CSW A;  3GQ9 A;  5K5Q A;  1Q1H A;  5JVT A;  3DEU A;  2DFE A;  4XLC A;  5L3D A;  2BGI A;  4BXU A;  5C44 J;  4C9Y A;  3ZQL A;  4ITV A;  2WB1 N;  2Z5U A;  4L0Y B;  5E3N A;  1OFC X;  2MH9 A;  2OPT A;  2VI6 A;  2VIX A;  1MMA A;  4Y17 A;  4HE5 A;  4KA4 A;  3T56 B;  5C1E A;  2YWE A;  1ZYR F;  2O03 A;  5EEG A;  2FEZ A;  2R92 J;  2W85 A;  2XUB A;  1D3Y A;  2CO5 A;  3QU6 A;  1L0O C;  3FPP A;  4UAJ A;  3UNG C;  3VPR A;  2P7V B;  1RZ4 A;  3OY9 A;  2R7X A;  3HUG A;  2L7F P;  1E43 A;  3E6C C;  1FZP B;  2V9V A;  4GXO A;  2NSP A;  2MYS A;  1DP3 A;  3BG9 A;  4EH1 A;  1OB2 A;  4YZX A;  2PFB A;  1KK1 A;  4E7Z A;  3ZGK A;  4V2F A;  3I55 I;  1YX3 A;  2UZK A;  1FNM A;  4B09 A;  2VJI A;  5FNZ A;  3KRG A;  4XOT A;  1IAW A;  2KLO A;  1R5G A;  1GAQ A;  4G7X A;  3RDI A;  1UFM A;  2EIX A;  1FRN A;  3KIO A;  1B1B A;  3BH7 B;  1YJN B;  1QO0 D;  4UZF A;  1MNM C;  3BH6 B;  4H9G A;  5KAF C;  1KON A;  4XLE A;  4M6Y A;  1LM1 A;  3QPT A;  3S17 J;  1YIJ B;  4DQL A;  2JJ7 A;  2PJP A;  5GP9 A;  4FAS D;  1APL C;  5BQT A;  4CIC A;  4KUM A;  5F64 A;  4Z03 A;  3ZPN A;  1LFU P;  1HDD C;  3DTK A;  1K4Z A;  4RGU A;  2K9N A;  1QVU A;  4I2O A;  4OIQ F;  1B9N A;  5CVR A;  3Q0U A;  3W2H A;  5FKM A;  3L2Q A;  4KNY A;  4RPD A;  2F4I A;  4YIR X;  2YX7 A;  2FUG 2;  1XD7 A;  1OFL A;  1MDM A;  4EM2 A;  3CC7 B;  4CO8 A;  2PIA A;  2VPR A;  2P7C B;  2CRG A;  3IHU A;  5JBQ A;  2FXA A;  2VZL A;  3VYS B;  2JTV A;  1I3Q J;  2R7U A;  5CYV A;  1K4S A;  1S9H A;  1JT0 A;  1ELO A;  4HDV A;  4LLG F;  3ELK A;  1ZRC A;  2V1X A;  3G05 A;  2P5L C;  2J5P A;  1VQ9 B;  1ZHF A;  1YTY A;  2JSP A;  4PAA A;  1N07 A;  1RNL A;  2LDU A;  3FMR A;  2JA6 J;  2V7W A;  1XB4 A;  5DM6 F;  2HPI A;  3FBN B;  2CV0 A;  3OKX A;  2M0M A;  1JUM A;  4J0Q A;  3QWL A;  5CJ9 A;  3E6B A;  1S7E A;  1NJI D;  2HS5 A;  1TNS A;  2E7X A;  2M45 A;  2NVQ J;  1O88 A;  1F36 A;  1KTW A;  3D5R C;  2ZBU A;  1SAU A;  3K1M A;  5D6E A;  1TTT A;  4CCJ A;  3PUF A;  5LHH A;  4KIB A;  1A04 A;  5E18 F;  2EB7 A;  1USS A;  1MRZ A;  4Z6Y A;  3JRD A;  3RYR A; 
#chains in the Genus database with same CATH homology
 1DGW Y;  3V42 A;  2ZZG A;  3MKZ A;  4ASU A;  2KRH A;  2QKM B;  3PSI A;  3W2A A;  2WZP P;  3VYR B;  4CUG A;  2LBF A;  1DBO A;  3PSF A;  2NT9 A;  3VSV A;  3OYN A;  2Z8G A;  4EAT A;  1AA7 A;  4PFO A;  4W8Q A;  3PJR A;  2X1C A;  3PNT A;  1W0J A;  2CS3 A;  3H9G A;  3OL4 A;  4Y3O A;  1JI8 A;  3BH4 A;  1MAB A;  3TBI A;  2L7K A;  3EPZ A;  1D1C A;  4YEJ A;  1D1A A;  1NHC A;  2W1O A;  2E5Z A;  3GQB A;  3DWL E;  2HU9 A;  3T9G A;  4UZU A;  4NQW B;  3DTE A;  4B44 A;  4E4H A;  1FMV A;  1QHH D;  1IB4 A;  4QPO A;  1UEL B;  3D5L A;  4DJA A;  2LOO A;  4XKB A;  4PMH A;  5KCM A;  1K6Y A;  2WY7 Q;  3OMY A;  3GVJ A;  2OUM A;  4RMN A;  1T5E A;  4YRV A;  3OYA A;  4G7W A;  1V5E A;  4EW9 A;  1BR1 A;  4D1Q A;  2XF7 A;  2HDW A;  5LFA A;  1X1D A;  2R7V A;  1RU4 A;  4OJ6 A;  2VL8 A;  4BS9 A;  4OZY A;  1IDK A;  4HEA 2;  3HXL A;  1D1B A;  3DLA A;  2R7O A;  3VYT B;  4ZDL A;  2BSP A;  3IUO A;  4I84 A;  2JDI A;  2K9M A;  3H35 A;  4YZ0 A;  2KDO A;  1EFR A;  3OFN A;  2CK3 A;  2IGO A;  2JA2 A;  5HLT A;  1D0Z A;  2O0W A;  4XR6 A;  4GQN A;  4DIQ A;  1T95 A;  2R7W A;  4ZJZ A;  3VMW A;  5CQG A;  3SZG A;  3EQN A;  1UG0 A;  2IS6 A;  1E1Q A;  2NST A;  1YE9 A;  3DPL C;  3TL4 X;  5KNL A;  2W7N A;  2QY1 A;  3FY3 A;  3QOD A;  2ODL A;  3SUC A;  4HG2 A;  2R9V A;  2X8K A;  3BCF A;  3CP8 A;  4D9J A;  2KP6 A;  1HA8 A;  3H94 A;  3OOC A;  1BHE A;  2M7B A;  3OYI A;  1OFM A;  1UAA A;  1J09 A;  2V7F A;  2VQC A;  4N4N B;  2GOM A;  3DQV C;  4XN0 A;  1O8G A;  3A2K A;  4LIV A;  4BEH B;  3NWS A;  3RSN A;  4F91 B;  4YXW A;  3VSL A;  1I8D A;  4XLA A;  1E1R A;  1OGM X;  4U7B A;  2NTB A;  4JOM A;  1W0K A;  3OYM A;  3H0D A;  1V0F A;  3ZIA A;  4YZA A;  2VBM A;  4ZYA A;  3L2W A;  4KKT A;  2X3H A;  2V9K A;  2VLA A;  3T51 B;  4U49 A;  3VST A;  4QPQ A;  3ZRG A;  5CPR B;  3HL2 A;  1BOB A;  3LFU A;  2HVR A;  1LFP A;  3AL0 C;  5FL7 A;  3E0J B;  3J7A Y;  2Q1Z B;  4BJ6 C;  1EE6 A;  2NOJ B;  2WAQ A;  3EUA A;  1UD4 A;  1G59 A;  4Y4R A;  4KJZ A;  2JJ2 A;  3SDB A;  3DDY A;  2PJR B;  3FHN A;  4XNF A;  2AQE A;  4ZDP A;  3IAM 2;  4NNJ A;  2JJ1 A;  2JVG A;  1WTH D;  1LVK A;  2D3N A;  2V7Q A;  2MAB A;  5C1C A;  1I18 A;  4RLF A;  3GQA A;  2L5Q A;  3DKX A;  2IS1 A;  2GOX B;  4PFP A;  4NK8 A;  5HKK A;  1Z3Y A;  2XND A;  1MMD A;  3DU5 A;  3L2V A;  2LY2 A;  3W2W A;  2O1D A;  4DOZ A;  3VMV A;  3K4J A;  3ZR8 X;  2X51 A;  3ZQQ A;  3OYC A;  2NT6 A;  3DTI A;  1GLN A;  5JHF A;  1O8K A;  1E79 A;  4B48 A;  3VR6 A;  1SFK A;  4PJN A;  3PL8 A;  2IGN A;  1PE9 A;  4ZC3 A;  3B90 A;  4DK1 A;  1SKY B;  4DNT B;  2ZSI B;  3PNY A;  1BLI A;  4BQO A;  4HSR A;  1HVX A;  2LRD A;  2XZL A;  3K4B A;  1QJV A;  4MXN A;  3ZPP A;  3TMO A;  2JVH A;  2W82 A;  2VJJ A;  4OJP A;  2V4J C;  4KT6 A;  4ZDO A;  4II2 A;  3HC7 A;  1MMG A;  3L2U A;  4C2U A;  1OB0 A;  2VQH A;  4ZTF A;  3OPO A;  2HVS A;  2V4D A;  4E7J A;  1P9Q C;  1OR7 C;  3A3G A;  3A1Y A;  3ZSC A;  3M8J A;  2VKD A;  2VB6 A;  2DCE A;  2ZXH A;  4TSF A;  1IRX A;  2CMP A;  4F55 A;  5HVQ C;  1QCX A;  3VSK A;  2IS2 A;  1WPC A;  4NC8 A;  3VDX A;  2WB1 A;  2K5C A;  2M3A A;  2RQQ A;  4CA0 A;  2CUZ A;  3S93 A;  1W36 C;  1GQ8 A;  4OAY A;  1D0X A;  3ZCO A;  4E7H A;  2R7Q A;  4R79 A;  2LZJ A;  3S3O A;  4IQ4 A;  2NZM A;  1OHH A;  3H5R A;  2DT6 A;  2GJP A;  1U0J A;  2Z2S B;  4C2L A;  1QU3 A;  3I3L A;  4DNR B;  1NBM A;  4KKU A;  1FX0 A;  4ZTJ A;  3DEE A;  4AU7 A;  2CFO A;  4BAC A;  2JIZ A;  4JMQ A;  2HQA A;  4KIT B;  1OOC A;  4YZQ A;  2XF6 A;  1IA5 A;  3HOT A;  4IQJ A;  1WP6 A;  5FRM A;  2R4G A;  1K28 D;  2L9N A;  1H80 A;  2PMZ A;  1MND A;  2KHM A;  4P1W A;  2QE7 A;  4E7S A;  2RRE A;  2KL4 A;  5CDF A;  2V26 A;  2ELJ A;  1MNE A;  3EQO A;  4NK6 A;  2XAU A;  2HZD A;  2JUG A;  2VAS A;  2XF5 A;  4DK0 A;  4ANJ A;  2CUJ A;  2O0V A;  3I9V 2;  1NG7 A;  4W8S A;  2ZZQ A;  3BCB A;  2R7S A;  2X6Y A;  4URR A;  1OLT A;  3CJQ B;  4B43 A;  2PJR A;  2M4G A;  2KQR A;  4II3 A;  2GK6 A;  3A35 A;  2ZZF A;  1LKX A;  4E7I A;  4PJM A;  4PUS A;  4HPQ A;  2UVF A;  2O17 A;  3BC8 A;  3UR3 C;  3W3C A;  4BQN A;  1E3X A;  3ONQ A;  2NTQ A;  4MLO A;  5CQE A;  1K5C A;  3DKY A;  3N05 A;  2VBK A;  3PFY A;  1O8E A;  3OYJ A;  2E1M B;  3HPH A;  3LL7 A;  2IGK A;  3K4K A;  4BXF A;  4BU2 A;  4E7K A;  2M7A A;  3GRH A;  3OIQ A;  1WJ5 A;  3KEY A;  1VZ0 A;  3QYE A;  2RNG A;  3FDY A;  3OR2 C;  3VWB A;  2BVM A;  1G8X A;  2DT7 B;  3LSM A;  4PSW A;  2F5V A;  4HNT A;  1KMH A;  2GJK A;  1YX5 A;  1X0C A;  1Z21 A;  4BEH A;  2BVL A;  4BGD A;  3U21 A;  4HRI A;  2XGJ A;  1O8H A;  3T53 B;  3HPG A;  1BN8 A;  2Q2E B;  3K70 C;  2PYG A;  2WY8 Q;  1BMF A;  4BDY A;  4XN3 A;  2DIE A;  1V5G A;  2NTP A;  3EUK L;  4FET A;  4PSX A;  1Z7L A;  2QKL B;  4HWV A;  1T0F C;  4LIU A;  1O8D A;  2UVE A;  3B4N A;  3OE7 A;  1AIR A;  2KVO A;  4XM3 A;  1W36 D;  1H8H A;  1JTA A;  4XKC A;  3BCA A;  3DPU A;  1O8M A;  4BDZ A;  3LSI A;  1NRK A;  2P0W A;  3LSH A;  1KZL A;  4JQF A;  3CP2 A;  3NWT A;  2LY1 A;  5FRN A;  1RMG A;  4C2T A;  4PK4 A;  2R7R A;  1WMR A;  3LSK A;  2WPD A;  4P5O A;  3RTR A;  3OEH A;  3GQ8 A;  1O8J A;  3CZ6 A;  1O8F A;  2A6T A;  2XOK A;  1DQU A;  4FXU A;  3RCO A;  1D0Y A;  4CH7 A;  1DGR M;  2E5N A;  3M1C A;  4DGW B;  2ZXI A;  4PJL A;  3FBI B;  2L2O A;  2X1E A;  3AL0 B;  3OAA A;  4Z1M A;  2PYH A;  2INV A;  1UD2 A;  4X0G A;  1RWR A;  2WA0 A;  3K4C A;  4OJ5 A;  2X53 S;  1WJB A;  3A3B A;  3AKZ A;  3K70 D;  3OL3 A;  2LC2 A;  4PJJ A;  3S3M A;  1Y6I A;  1KCC A;  3WWG A;  3MKY B;  2VJ4 A;  1VJS A;  1VF7 A;  2OV7 A;  2Y0S A;  1UD8 A;  2WAD A;  3GVL A;  2E1M C;  4CCL A;  3SYT A;  4F3Q A;  3SEQ A;  3S32 A;  4OZZ A;  2E60 A;  1E0E A;  2DJI A;  3OR1 C;  2WAE A;  1WJD A;  1KCD A;  2M4K A;  4HNU A;  1TT0 A;  3OS0 A;  3OYG A;  2VXZ A;  1W9X A;  3GVK A;  2F6C A;  1BR4 A;  4P22 A;  3AFH A;  1H8E A;  1UD3 A;  2MD0 A;  3K6G A;  2HLD A;  3OYL A;  2ZSH B;  3KEW A;  3C2H A;  4CCO A;  1X1A A;  2UV1 A;  3QOE A;  4XL9 A;  3K4L A;  2F1M A;  4TKO B;  1Y56 A;  2LBF B;  3OS2 A;  3H9Q A;  3C2G A;  1QHG A;  3H9J A;  4BE2 A;  1O8L A;  4KIS A;  4CCK A;  4OJO A;  2KZV A;  1UD6 A;  3F9K A;  3BLY A;  4NC7 A;  1Z3X A;  1WJE A;  4IKF A;  2VKH A;  4XOP A;  1TZL A;  4XD7 A;  1O8I A;  2WJV A;  4E6K G;  3RQ4 A;  4XOR A;  4Y33 A;  2CV1 A;  2CV2 A;  4LIT A;  4DBR A;  3SEZ A;  5HNH A;  5HOO A;  3GQ7 A;  2LG4 A;  1PKV A;  2XSJ C;  1CZF A;  3OEE A;  1HG8 A;  1X4P A;  2M5S A;  3HG9 A;  2HVQ A;  3K10 A;  3OOU A;  3BG7 A;  2E1B A;  4B3F X;  4H4K C;  3VSU A;  3PUB A;  2VPL A;  2V31 A;  3PNV A;  3MMY B;  4RLQ A;  1PLU A;  4B3X A;  4LG3 A;  1PJR A;  3OWT A;  2W4S A;  1WJF A;  3OYH A;  3OIP A;  2XC7 A;  3KYL A;  3QYF A;  1COW A;  2W6J A;  4IX7 A;  4XON A;  2VXD A;  3L2R A;  4XQF A;  3HKZ A;  4AVZ A;  4BJT A;  4XLH A;  5TGT A;  4XKV A;  1WFX A;  2ZTG A;  2XZO A;  2HPM A;  4L8J A;  4RM2 A;  3OS1 A;  3WQZ A;  2V6E A;  3QYB A;  3CMM A;  3S3N A;  1N78 A;  2BW3 B;  2IS4 A;  4CZC A;  4F93 B;  1EA3 A;  2A5W A;  2AQF A;  4XKW A;  3OYD A;  5LD2 C;  2UWM A;  4TT3 A;  4HIZ A;  1R6R A;  4BL0 B;  4U4B A;  3D5S C;  3JU4 A;  4CCN A;  1FMW A;  3OYB A;  5IK2 A;  4B3G A;  3E1S A;  4W8R A;  4RM3 A;  3BCD A;  2PEC A;  2VQG A;  2LYC A;  4CSW A;  3GQ9 A;  4XLC A;  2L9S A;  1N75 A;  2WBM A;  2K9L A;  5CKT A;  4YEL A;  4C9Y A;  4ITV A;  2W00 A;  1XG2 A;  3CF2 A;  4N4O B;  3KX2 A;  4XMY A;  2VIX A;  1LDK B;  1MMA A;  3S8P A;  2V1N A;  3T56 B;  2R7T A;  5C1E A;  2CW7 A;  3IAS 2;  2Z16 A;  1N77 A;  2O5R A;  1DBG A;  1VBL A;  3MD2 A;  3JUR A;  2DOA A;  3ZXS A;  4BE0 A;  2GJR A;  2OC6 A;  3FPP A;  4OWR B;  2MFZ A;  4F92 B;  3UNG C;  3OW7 A;  4GRI A;  3OYK A;  2F43 A;  2KRC A;  2UUZ A;  2CH0 A;  3BG6 A;  3DU6 A;  4U87 A;  3OY9 A;  2R7X A;  1E43 A;  4F52 A;  4IZZ A;  1X4O A;  3G2B A;  2MYS A;  1DP3 A;  2NSP A;  5KHD A;  4J01 A;  4YZX A;  1IDJ A;  5DN6 A;  1HZE A;  1E3Z A;  3FKJ A;  4E7Z A;  3ZGK A;  1UD5 A;  3KRG A;  1YX3 A;  3DPT A;  2X6X A;  1PXZ A;  2VJI A;  3B8Y A;  2KPM A;  4XOT A;  3BC9 A;  4AYB A;  2KLO A;  3W2V A;  4G7X A;  3CES A;  3A4C A;  1V0E A;  3HUG B;  2VJ5 A;  2X1D A;  2XDV A;  1X1C A;  1ZEL A;  2I8D A;  3IP4 B;  2MC4 A;  2QXZ A;  4Z05 A;  1KON A;  4XLE A;  2BOL A;  1BPL A;  3HAG A;  4G6I A;  4FAS D;  4W8T A;  1NG6 A;  4BJ5 C;  4J00 A;  3K4M A;  3LMM A;  2ZZE A;  4Z03 A;  3ZPN A;  3LNN A;  3DTK A;  4C30 A;  4BQQ A;  4MR0 A;  2WJY A;  4G6T B;  2IQ7 A;  1PYV A;  3L2Q A;  2Z1D A;  2F4I A;  3RPU D;  1OGO X;  5FRO A;  1BR2 A;  2FUG 2;  1OFL A;  2QX3 A;  1WJA A;  3H5N A;  2LH9 A;  1VLY A;  4E0F A;  3VYS B;  2KMU A;  2HNH A;  2BW3 A;  2R7U A;  1S9H A;  2W6I A;  4NUB A;  4OAZ A;  2XZP A;  2CW8 A;  1ERD A;  3FKS A;  2D3L A;  2O04 A;  3H5A A;  3NE5 B;  3G05 A;  3GBG A;  2LRE A;  2ZTN A;  3LMW A;  5AMV A;  2JSP A;  4BE1 A;  2X85 A;  3HOS A;  4CCM A;  3UW0 A;  1JRG A;  1V5F A;  4OJL A;  2HPI A;  2ZFU A;  3FBN B;  4DBQ A;  2CV0 A;  2GK7 A;  2M0M A;  2IXS A;  2WAF A;  2IGM A;  4E7L A;  4HST A;  2WSS A;  1WJC A;  2DXI A;  3MKW B;  2Z6B D;  3K4N A;  1KTW A;  1O88 A;  2VQL A;  2X6W A;  4B47 A;  1MW7 A;  3OYE A;  2K3P A;  3D5R C;  1X19 A;  1SAU A;  4Z06 A;  4CCJ A;  4BUP A;  5HNF A;  2EWE A;  2INU A;  2VBE A;  3LSG A;  4XLF A;  3CJR B;  3EUH C;  3OYF A;  4KKS A;  1MMN A;  3VYU B;  1X1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...