4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
2NTPA 4NK8A 4Z06A 2PYHA 4XONA 3VSTA 2INUA 1IDKA 1RU4A 4OJ6A 3ZPPA 2VBKA 2NSTA 4I84A 3B8YA 2INVA 3VMWA 4EW9A 4U49A 4XL9A 2NT9A 2VBMA 1RMGA 2NTBA 1IA5A 3B4NA 4MXNA 2PYGA 4XMYA 1DBGA 4XLHA 1O8FA 1HG8A 1JTAA 4XOTA 1IDJA 1O88A 2QXZA 1O8JA 1EE6A 4NK6A 2X6YA 3T9GA 1PE9A 2VJJA 4YZQA 2O04A 2O17A 2IQ7A 1O8GA 4XN3A 1O8IA 2O0WA 3B90A 3SUCA 4YEJA 4XM3A 4U4BA 1OOCA 1IB4A 2X85A 4XLFA 4XNFA 4XKWA 1O8HA 1OFLA 1OGOX 1RWRA 2Z8GA 4HWVA 4OJPA 1VBLA 4OJOA 1KCDA 2NSPA 2VBEA 1O8KA 2NZMA 4W8TA 1BHEA 1O8DA 3EQNA 4YZ0A 1O8EA 3VMVA 3GQ8A 1WMRA 4W8RA 3VSUA 4AVZA 4XN0A 4YZAA 2VJIA 4YELA 2QX3A 2X6XA 1KCCA 1OGMX 1KTWA 1X0CA 1NHCA 1CZFA 4Z05A 1K5CA 1AIRA 4OJ5A 1GQ8A 4XKVA 2X3HA 4URRA 2ODLA 3GQ7A 2O1DA 2NT6A 3EQOA 3GQAA 1BN8A 2UVEA 1JRGA 1PXZA 5AMVA 1DBOA 1QCXA 5C1CA 3GQ9A 4W8SA 3ZSCA 3LMWA 4XLEA 4OZYA 4XLCA 3WWGA 4OZZA 4XR6A 4MR0A 4XOPA 4XQFA 2PECA 2BSPA 2EWEA 2NTQA 4W8QA 3GRHA 1OFMA 3FY3A 1QJVA 1H80A 5C1EA 3JURA 2O0VA 4Z03A 1O8LA 2QY1A 3UW0A 1PLUA 4YZXA 3VSVA 2UVFA 4OJLA 4XLAA 3KRGA 4PMHA 4C2LA 4XORA 1O8MA 1XG2A 2X6WA
chains in the Genus database with same CATH superfamily
3V42A 2M34A 4ZYAA 4B3AA 2O9LA 1MMSA 1HDPA 3OEHA 1V0EA 4HE6A 2QTLA 2MABA 1WZ2A 4EW9A 4ZCLA 4DBRA 2A6TA 2HQNA 4AC0A 5DD4A 2IT0A 1KYZA 2CWEA 1D5VA 1D8TA 3OW2B 4A3JJ 3TO7A 4RDLA 3JQQA 1VQ4B 4QPQA 1VQKB 4KT5C 3H1CA 1XQBA 1L1IA 3W2IA 5GTIC 3AKZA 5ERIA 4NQWB 2ESHA 4V2GA 3S14J 4RBOA 3A35A 1HG8A 3B78A 4NC7A 2W4SA 2Q1ZB 2KIQA 2QCOA 3KE2A 4C3HJ 2HLDA 1TL8A 4G7XA 3LA7A 5B66C 1YIJI 3T56B 2M0MA 3TBIA 5F0FA 1VQKI 2ZBUA 5FROA 2V1XA 1O3SA 5J35A 3ZZ0A 4CCLA 4P22A 4QSHA 1VNDA 2ZJPF 2CS3A 3CF5F 4YZQA 4KT6A 1Z05A 2VKDA 1QA3A 3DBLB 2NNYA 3HOXJ 3I3LA 1G59A 2DA3A 2CQNA 3E0JB 1K73D 3DEWA 3MCAA 1QVGB 2F4IA 3HUGA 4FETA 1X4PA 1HSTA 4TSFA 2K86A 2CUEA 1SVLA 3SZPA 2CH0A 2I10A 3OR1C 5C4XJ 3SJZA 3MCZA 2GZWA 1IHMA 4Z4TA 3ABTA 1Z9CA 2HCJB 4IPAA 4P9UA 3TEDA 4LG3A 4FX4A 1E3PA 2HVQA 4G94A 3EUAA 1YJWI 2DFHA 1G7CA 4Z1MA 3NARA 4ZC3A 1LPQA 3WGIA 2GREA 2A61A 3E5QA 1FYKA 2E35A 3ZN0A 4ASNA 2R0QC 1N77A 4LB5A 1WTHD 2MD0A 3AL0C 3Q9VA 2M45A 3OYEA 4GDFA 1PJRA 1EKEA 3H94A 4PGHA 4CXFA 1N8RD 4G6TB 2QX3A 3DBHB 1Z1DA 4AM3A 2HYFA 3D5LA 2LLKA 1F4KA 2V9PA 2E2IJ 1DU6A 5HXBA 3V8JA 5DN6A 3HJEA 3CJQB 3VDXA 2O1DA 5FRMA 5IYRA 1BN8A 4LITA 5L3EA 2DA1A 3GUDA 2R92J 3J7AY 1E17A 5C4JJ 1KQ8A 4L0ZB 4M72A 4BE2A 3DWLE 2HYJA 5EGOA 2BW3A 2LOOA 3LMWA 2DXIA 4S04A 3EETA 2DFEA 1QGZA 4B3GA 1S9HA 4QTRA 2VBTA 2W7ZA 3ML3A 2W6JA 4F92B 3FZVA 1HW1A 2R7DA 4U0WA 3Q5FA 5GPCA 4Z03A 3DF8A 4U7DA 4BAYA 4XIDA 5JVTA 4MYTA 1UHSA 1F9NA 3AG1H 1QVUA 3JCUC 5HDGA 5JFRA 5M3MJ 4ZCIA 2J8IA 1YLFA 1W2BB 1TWHJ 4Z4SA 4E7SA 3G4SI 1JE8A 2PMZA 4OOIA 4A3EJ 1JTXA 4XLAA 4GYGA 3M1CA 5HLIA 3W2VA 4HNVA 3ZMTA 1IN4A 1I5ZA 2E1MC 1E79A 3K4NA 1BLIA 1M1EB 1X19A 1TTTA 2QQ9A 3E1SA 3CCSI 1AHDP 3FK6A 1WORA 3CZ6A 2DERA 3E6MA 4MFDA 3J81k 2DYSH 2DCEA 1EV7A 5JLVC 2VBKA 1TWAJ 1K4ZA 2HOEA 4YFKF 3PA1A 3HTSB 2OC6A 3ASNH 5IYPA 1UD6A 3LSJA 2KIFA 4U49A 2LNBA 5D4SA 3SYJA 4BL0B 4UUSB 4A3LJ 4P9FA 4EJUA 3FMQA 5HZAA 3VO2A 3FBNB 4QVAA 5HNHA 2FOWA 2ZFWA 3TQNA 1U8BA 1ZM4A 1UD4A 2ESNA 2GOMA 2QXZA 3SJPA 2X51A 1QRCA 2W25A 5J4YA 1FIAA 1SFXA 1QRYA 2PEXA 2XAGA 3ONQA 3PUFA 4NB5A 2MC4A 4HAMA 2M8EA 4PJMA 4NHJA 1O3QA 1NK3P 5ILVA 4QVJA 2FBKA 1B4AA 4M6YA 3LSHA 5L3FA 4BNCA 2QBYA 1R49A 2L54A 4NC6A 5LEJA 2KMUA 1B1BA 4GQNA 4EJWA 3JRCA 2HKXA 1CQXA 4I6ZA 2IBDA 5GV7A 3BY6A 3M8FA 1MMGA 2M4KA 2E5NA 3NQOA 3GTJJ 3F8FA 4OPOA 1IN7A 3JTGA 1SD5A 3BG9A 1ZM3A 5J40A 3KP7A 2FVGA 3ZMVA 4WX9A 3GVKA 3J7AO 1QRBA 3OKXA 2ZJ2A 2CBXA 3OOCA 2M4GA 1P9QC 3BTIA 2XF7A 3RYPA 1VQLI 2JA8J 2F5CA 2RREA 4Q47A 1Z21A 2QYOA 4XRSG 5HLTA 1XSDA 2HYGD 1H9GA 1X3UA 4NDLA 1ORKA 2VYQA 1CZFA 1K5CA 1BI3A 3V8LA 1AIRA 4OJ5A 2ICWG 2HTSA 4J19A 4K2EA 1RR7A 2NT6A 3QPSA 2UXNA 1K78B 1B9NA 4BXXJ 1GVDA 1L0OC 1ZRCA 3AVWA 5KAFC 1UAAA 3TDUC 1MMDA 4KITB 1EF4A 1IXSB 4A93J 1LM1A 1VQPB 5F4MA 3IC7A 2QA4B 1BR4A 1XG1A 2VPLA 4B09A 2XT4A 2B0LA 2MLGA 2Z1DA 3IRRA 2F3LA 3PSZA 2C6YA 3MZHA 1K6OA 2E1CA 2M2EA 5JLXA 4RLQA 3CCQB 2L01A 4UUVA 4OOSA 2CRVA 1BOBA 4UXNA 4HLYA 2NS7A 3EUKL 3CCVI 4BHPA 4IW3B 3RTRA 5DUIA 4LOCA 2O3FA 4BJ5C 2QWWA 4PK4A 3KRGA 3GTGJ 5IYDJ 5IYQA 2FF4A 4N4OB 3VNUA 5FLXK 1JKPC 3SXYA 1KU9A 1WU8A 3Q3AA 2NTPA 3VFZA 2D3LA 3VSTA 1XX5A 4XSZF 3ZMSA 1KMHA 1ETYA 4II2A 3ONYA 4HIZA 2YWHA 4KICA 2NYXA 3CC2I 4M9ZA 2J5OA 2I1LA 2Z16A 2VBWA 2NT9A 1H8AC 3A02A 3GFJA 3HB9A 4BDZA 3GTPJ 2XNCA 2NTBA 1BW5A 4C43A 5D5XB 3Q0UA 2JRMA 4NQWA 1XCBA 2ZSIB 1FWZA 2IGMA 3OYJA 2DMUA 1VQOI 2XAQA 5K5OA 2DMPA 4XOTA 5LHHA 1Q7YD 1FMVA 2FXAA 1W36C 4RD1A 4UZUA 1P7JA 2OBSA 3BCDA 2E7WA 1X3WB 2F5VA 3GBGA 4HRIA 2LK2A 1VQOB 3IH4A 4IRHA 4TMZA 5FJ8J 5CLSA 3OYCA 3ELKA 4FTHA 1K8AD 2DODA 2OD5A 2WTEA 3U21A 1GDTA 1OQYA 5EGOB 1JI8A 3HOTA 1ZGAA 5EJCA 1EFCA 1HKQA 4BU2A 3AG3H 3SHFA 1N75A 4DYCA 5FL7A 4KYWA 1G7RA 4P25A 2Z8GA 3A01B 5GPAA 4F55A 5AIQA 4B47A 4A3GJ 1VBLA 3BCBA 3VYRB 3BROA 2GIZA 1J5YA 1QPIA 2VBEA 4OMYA 4W8TA 3PM1A 4CCNA 2P0WA 2HOSA 1PJ6A 3AL0B 3IRQA 4JQFA 5FD6A 2NS8A 3T8TA 3GXOA 2M9HA 1MGTA 4AVZA 4OOVA 5K7ZA 2OQRA 4QWQA 3CCQI 1JUSA 1LLZA 1DARA 1Q86D 5TJJA 1IUFA 1QGYA 3WQZA 3HOWJ 3GMEA 4RAFA 4RA2A 2V7WA 1EJ9A 2MW8A 5H2FC 2WY8Q 5E8IA 1ZELA 4BEHB 3GYHX 3WTYC 2E36A 2X53S 4LG0A 4L9JA 4BXUA 3QU6A 6PAXA 4HYEA 2D3NA 3O2PE 2VBXA 2CGPA 2X4HA 2O8KA 4G6DA 4BE0A 4KUMA 5IYWA 3SZTA 4TKOB 3ZR8X 4DQ2A 1PP8F 3C7JA 4HPQA 1YIOA 4ETSA 3F22A 4KNYA 4I02A 1FNDA 4I09A 4PC1A 1UFMA 2HOAA 3TKYA 4HSTA 1NG7A 2XASA 4MTEA 3OSFA 1DDGA 4P1WA 1R23A 5CQGA 2B63J 3LO8A 3MHPA 4B4DA 4UZEA 4DGWB 3D26A 4Y13A 1XB4A 1IRZA 4A0XA 1TTYA 2K3FA 3M9AA 2K85A 1W4MA 2N8GA 5BPDA 5CDFA 3I71A 1S72B 3S3MA 1T33A 3HPHA 2A5WA 1WJEA 5J47A 2BXYA 2XNJA 1QO0D 4EATA 3DCFA 1FOWA 4M73A 4G1BA 1BW6A 3VMFA 3ASPA 2JPCA 2KRCA 3L1PA 3CCMI 2DA4A 2QEXI 2BE5F 5BNGA 1RKWA 4HF1A 4ZYHA 4YDTA 1IZ1A 2DOAA 5EYRA 2ELKA 4KN7X 4RD2A 3ESWB 1DABA 3CJRB 3SQVA 2PYHA 1W7PD 5DS0A 2GXGA 2BHZA 1JUPA 3DEEA 2A3SA 1D1AA 3PSIA 4D7NA 1JUMA 3VMWA 5GAHJ 4XL9A 2VUMJ 3H9NA 1VQ8I 4E7HA 4BY7J 3IUOA 4IEJA 3UNGC 4CO8A 1H42A 5JVGF 1K79A 3OYHA 1F20A 2OCEA 2X3UA 1T5EA 1KGSA 1B23P 3QYBA 2K9NA 2DT7B 4Q4ZF 2KIMA 2FSWA 3CO7C 3QYEA 2VE9A 1W0KA 5TRDA 1FNBA 3OPOA 2R93J 3WHBA 1HOMA 1R1VA 5IYNA 1YX5A 3KP2A 4D0PA 3VYUB 2M5WA 2DYIA 3EPZA 2V4JC 1AMOA 2Q2EB 1U2RA 3A0HC 1Y0YA 4PC7A 5JMCB 2BM7A 1QA1A 2OBPA 4NK6A 2Y75A 1GVHA 2V31A 4UVAA 1M1KD 3SLNA 1MJBA 3X2QH 4M9XA 1ITYA 1T0FA 2WB1A 3CCUI 1OGIA 3GQBA 1UMQA 2CG4A 3S2WA 1Z0XA 2CYYA 1T6SA 3WG7H 4QPOA 3AG2H 1E3HA 2EQRA 2PMUA 1OFDA 2JA7J 3CCJI 4L18B 2AS5F 4G5GA 3U2QA 3ERED 1U5TA 2C4TA 1BHEA 3K7AJ 3T5XA 3FXLA 2M7AA 4I98B 1LQ1A 1CQTA 2C5BA 3FHNA 2VL8A 2DOGA 1B9MA 3LQRA 2WR8A 3KP5A 1YLOA 4BGDA 5KK1A 1U5TC 1YS7A 2M7BA 3K2AA 4RAYA 4QIWN 2XF6A 3F8CA 4LJZF 2JJ1A 3ZC3A 4Z4ZA 3HOSA 1WQ2A 1KD1D 1G7SA 2VXDA 1CLWA 3F8BA 1ETWA 3D5RC 3H5NA 4GXOA 1RPWA 2M87A 1DP7P 3DP7A 2XGXA 2DMQA 4X7EA 1P4AA 3JREA 2H09A 1OCZH 1G4DA 2R7QA 1A8PA 1Q1HA 3N05A 1J7KA 3TH0A 1PXZA 3BH7B 3BZ6A 1KZLA 1I3QJ 4FXUA 3CW2A 2NAZA 2L9RA 1OYIA 2QA4I 1VQ9B 1QCXA 3AVUA 2WADA 1W0UA 2GA2A 2K9MA 3JAMZ 1HVXA 1QUFA 1A5JA 2FMLA 3L9FA 1MJ9A 5CVIA 3HTUA 2XOKA 4MR0A 3KP4A 1AA7A 1SKYB 3I59B 4D9JA 2VBZA 4DOZA 3CC7B 1MKMA 3REOA 2EWEA 2X9DA 1OCRH 4XLPF 1E3OC 3VSLA 3ZQCA 3O6BB 3V76A 2XZLA 4XRFA 5FLVA 3SYTA 4PJJA 1IRGA 5K1YA 3D1NI 1HLVA 2VT3A 1TQIA 2ISZA 2EBIA 4U7BA 4LC0A 1HXDA 3A3GA 2Y48A 5E17F 3CCEI 4FCYA 2K4JA 3ZUGA 3W2WA 5J3OA 2O03A 1EP3B 2BX6A 4P26A 1FRQA 1BIBA 2YU9J 3BTLA 4XORA 2VFNA 4KDPA 4MEXF 4DQKA 2XTXA 2JJ7A 2HNHA 2P81A 2LYCA 3WU0A 1VQMB 3HHGA 5HS8A 3K4CA 4FISA 4PJ0C 3CCLI 3Q3SA 3JRHA 3HRUA 3RKYA 4ROXA 2ZKZA 2ACJA 4LLLA 5FIUA 4F93B 3ZQQA 1ON2A 4AIKA 1BPLA 1R58A 2BGCA 2ZJRF 4LGWA 2ID3A 3B4NA 1BX0A 3A1PA 2R3SA 4E7LA 4LLNA 3KLOA 4C2UA 2PYGA 3LVBA 1H9TA 3S8PA 5E6TA 2M5SA 1BBYA 1P6RA 4PC6A 3H09A 3CF2A 2PJRB 2GAUA 2LG4A 2VKVA 4P2NA 3R4KA 4BUPA 2EFQA 1KONA 4XICA 2XB5A 2C78A 4X06A 1YRNA 2JUCA 1JHHA 1F60A 4IVNA 2BSAA 4OP7A 2Z99A 2BV3A 5DNSA 2ZXWH 4B8XA 2EV6A 2JVGA 3JRFA 3OAAA 1GLNA 4ON0A 3G2BA 2BVMA 4HF0A 1W36D 1Y1VJ 4ACBA 3SEZA 3MWMA 5DCMA 2MG4A 4XM3A 1OYYA 2FMYA 3TO9A 3CLQA 1GHCA 1ZHFA 5JHFA 1UB9A 1MBGA 5GAEJ 1FYMA 1KK1A 1VQ7B 4OJOA 4EM0B 3F3XA 3I4MJ 5FKMA 1CF7A 2H6CA 1HW2A 3KPHA 1NTCA 3UKGA 3EQNA 4E0FA 2WA0A 4HZFA 1MBHA 3VMVA 2AHOA 2XAJA 1HZEA 1WMRA 3GTKJ 4M3GA 5F6FA 2XKOA 4A3MJ 3OR2C 4UB6C 3WGHA 4W97A 1EWYA 4ZDPA 3TOBA 4Q48A 2LY9A 2K02A 4DNRB 3FDYA 5E3LA 1N25A 4MFEA 1FDRA 5L3BA 1FX7A 2KJCA 1EA0A 4E7KA 4ENKA 2QENA 1HA3A 3J7YJ 3QSYA 4TN1A 2VFPA 2WY7Q 2CFOA 1L3LA 3CMEI 1X2MA 5EMNA 1KC8D 4EVIA 3HOZJ 2UXXA 3COAC 2ZBVA 3GQAA 1R5OA 3I56I 2V6EA 4MTDA 1LFUP 3RPQA 3SEJA 1MDMB 3GTMJ 2C4UA 3WTTC 2Y0SA 3GTLJ 3WNDA 3BR5A 2EIJH 4BY1J 4UVBA 1LLWA 1MRZA 1YIJB 2KRFA 4CCMA 3A8JA 2FX0A 2DFFA 3CMYA 1BJKA 2CQQA 2E1OA 1NG6A 1KQSB 4Y7NJ 2YR2A 2BM1A 1MW7A 2ZNZA 1MBKA 5LBQA 2R7TA 2KDZA 2A68F 3QOPA 3K4MA 2JN9A 3IWFA 4ZZLA 5E3NA 2XSDC 2CO5A 4TT3A 4DQLA 5A2QK 3GVAA 4A6DA 3OP1A 4IHSA 3JQRA 4YG2F 1D1CA 5F1JA 1I18A 4I2OA 3G6EI 3BTCA 2A07F 2FD5A 2QE7A 5BOXA 3LOCA 4RB2C 2KPMA 3BTJA 4LFUA 3NAUA 1YJWB 4I99C 3DTKA 2DO7A 2IXSA 1U8RA 3PA2A 5LGTA 4L9NA 5F27A 3MKYB 1RU4A 1ZARA 4CYDA 4DJAA 2F43A 1YO5C 2EFNA 2Y30A 2OF7A 2FU4A 4JYKA 2HVRA 2CRGA 5EZHA 3B8YA 1XN7A 2OPTA 3ERMA 1WRJA 1TT0A 1VQ7I 4HEA2 4X6AJ 4RAGA 1RMGA 4P5OA 1Y39A 1ZTRA 4WZTA 1S72I 1W87A 2JA2A 3W5VA 4KIBA 4MGRA 4XMYA 2EV0A 4DBQA 3V7AA 1LVKA 4XLHA 1I50J 1LJ9A 3FXRA 4PFPA 3GEZA 4RGXA 3LQQA 3I53A 3GVLA 2YS9A 4C2MJ 5HLGA 2L4AA 3H92A 3RYRA 2HPIA 1HF0A 2G0EA 2DMTA 5J1RA 2Y9YA 1FP2A 1ZLKA 4KISA 2L3DA 2KJBA 1SVMA 2OTLB 3M07A 2HU9A 2XAFA 2LMDA 1OCTC 4EV0A 2O0WA 1QVFB 3VYTB 3SUCA 3LA2A 2DDAA 2L4MA 3K1PA 3OEEA 1IB4A 4MQVA 2X85A 5B1BH 3WHCA 4HBLA 4XBFA 4R1HA 1ONVA 4L5IA 2LTPA 4A3FJ 1FOKA 3I59A 4PGGA 1RWRA 3BCFA 4A12A 2P7VB 2IGKA 2LY1A 1YHQI 4PCQA 3CXCB 1ZKGA 3KCCA 2MBFA 3M7GA 1FLIA 4CGZA 1FY7A 2CU7A 5BPIA 2D1VA 1XB2A 4EH1A 1H88C 4JK1X 4JX6A 1KA8A 3RQ4A 5H6QA 1UHWA 3U6BA 3GFIA 2NRAC 3KEYA 1OB5A 2X6XA 1TSPA 1MJAA 2OU2A 1OGMX 4NBSA 3RCOA 1T6YA 2Q6OA 4D7MA 4Z4RA 2EFWA 3AVXA 2TRTA 1KQ5A 1R9TJ 2Q6IA 2GK6A 4TMXA 3MKWB 2HTJA 2J8KA 1GQ8A 1O3TA 2C2WA 2C77A 5GADJ 2ZMEC 2ZZFA 1X1DA 1VQ9I 2CC2A 2WZPP 5LEKA 5HNFA 5H5JA 4JOMA 2DOEA 3H9QA 4PC2A 1QHGA 1HF2A 3BC8A 2BM4A 1S3JA 4KIFA 1BOAA 2E19A 5A89A 2G9WA 2CUFA 4F3QA 3ZQFA 5K5QA 2Q6KA 1M90D 1OR7A 5HDKA 4W8QA 2P5VA 4KN4X 3GRHA 1ZK8A 3PIOF 1E0EA 2IEKA 1RESA 4HNUA 3MVPA 5FO5A 4BJTA 4F52A 2IS6A 2QMUA 4KKTA 3BH6B 2ZZGA 1KU2A 1X1BA 4HV6A 2WAQA 3BG7A 3DBRB 3HPGA 5CJ9A 3VYSB 4IHWA 2D9RA 2JN6A 1YW9A 2GXBA 3T51B 2HI3A 4ZGNB 4RAZA 1TP4A 4QFMA 4IQ4A 1RR8C 4P6YA 4LMYA 2DDBA 1Y0UA 2ETHA 4RGSA 2ME6A 4Z6YA 3KEQA 3JTHA 1ZG5A 2GPJA 3K9TA 2O6WA 3OZVA 1XMKA 1A35A 2NVTJ 3R6KA 4O3MA 1SC7A 3DFGA 2IS1A 2EK5A 2F4MB 5CYVA 1ZLJA 4IF4A 2PJPA 3GSIA 4N3NA 2L9VA 1LE8B 2VKEA 1A04A 1CGPA 2OYNA 1TVCA 3WNBA 3BR3A 1ZG3A 1MD0A 3KYDB 4ZYGA 1QHHD 1S8NA 2FQ3A 3ZQIA 4A0ZA 1E1QA 3B8HA 2CNDA 2YUSA 3C3WA 1CNFA 5J6XA 1T08B 3ASSA 1LE8A 3WNCA 1JTAA 2ZXJA 5LD2C 2K9SA 1S7AA 1WXRA 2XSJC 1PDNC 4M3EA 3FHZA 1JA1A 2G0YA 2FA5A 2K27A 3W5UA 1ODDA 1ZG1A 3S15J 1OCOH 2XC7A 4ZYEA 3JSPA 1WFXA 3CESA 3TMOA 1OLTA 1MBEA 3OYAA 1BR2A 4XN3A 1A36A 1VZ0A 1QVTA 4C2TA 3H3VK 4M3FA 3LSPA 4M1KA 2YWFA 4Y52J 2VODA 1YE9A 3ZPNA 1X3ZB 2VIXA 3O8GA 4XLFA 1NK2P 2IS2A 1O8HA 3BR0A 2PMDA 4EJTA 3Q0WA 1MSEC 5F64A 4OU0A 2VQGA 3OYNA 4U9UA 5BSYA 5FKLA 3K4LA 2VT2A 5DEQA 2DPUA 1O8EA 3K70C 5ICFA 3AG4H 3CUQC 2XF5A 1LEBA 3E5XA 3PQKA 3VNVA 3VSUA 1LDKB 1YFHA 2KT0A 3W5HA 2R5ZB 3KL9A 5FA6A 4AYBN 1PJ7A 4L0YB 2VQLA 2VBYA 2XNDA 4Y15A 3JU4A 2MH9A 3ROUA 2O61A 1P92A 2P5KA 5TR9A 1KCCA 5LFAA 4DIQA 2WAQN 2Z2SB 1I6HJ 3QODA 2F5DA 1WSRA 1IF1A 1E64A 4RDUA 4OAZA 2QUFA 1IRXA 4GYIA 4YAFA 3GQ7A 1MBFA 1B8IA 1OJLA 2K7LA 1FOYA 1IUYA 4CHUA 3PO3J 3N97A 2VZLA 3G3ZA 4QHYA 5F4JA 3JSOA 4PDKA 5LGNA 4AVPA 2H94A 1N05A 1EH8A 1V55H 3WGGA 1VQPI 1B8IB 3A1YA 3C2BA 5BQTA 4AC9A 1K61A 2P8TA 5EDNA 2J5PA 3WWGA 2NOJB 1XPXA 2HS5A 3I58A 1FP1D 2KZGA 3MMYB 3HRTA 3U2RA 5IOYA 2L7ZA 2BSPA 2PECA 3QFTA 4IX7A 3S16J 1QX4A 2PQ8A 2XRLA 3E5UA 3HUGB 1FYLA 3ZQ7A 2X0LA 1E3ZA 1ZREA 4D5CA 2VASA 2ELJA 2DOFA 5F0CA 3GZ6A 3W2AA 2VBUA 1D8KA 2ZJQF 2V9VA 1KRHA 5B3SH 2RNGA 1E1RA 4L9VA 2ZCWA 5JHUA 2D2WA 4N4NB 3TGNA 1F5TA 2EINH 4IQJA 5CVRA 2Y0MA 4C2LA 2QQBA 3SQNA 5TGTA 3BG6A 3PUBA 2LP0A 5J1YA 4ZTFA 3QE2A 5FRNA 5M5WJ 3CDIA 3LMMA 5THXA 2INUA 3L2QA 2LKXA 3HRMA 2BGIA 2W48A 1FEXA 2ID6A 4I84A 5C3EJ 4H0EA 3K4BA 4CH7A 1SKQA 2CFXA 2H6BA 3CDHA 2F2EA 5E1XA 1DPRA 3WTSC 5A88A 1VQ5B 2CQ7A 2W24A 1E63A 4RD4A 3BR1A 1X1PA 3S93A 1SFOJ 4XSXF 4QLCU 5ICGA 3L2UA 2KKOA 2L7KA 3FKIJ 2E1NA 3CO6C 4II3A 4P1VA 4RD3A 3PIPF 4BBRJ 2CW0F 5KCMA 2EB7A 5BS6A 4G6IA 2XGCA 3TP0A 4A5NA 1S4MA 5TV2A 2BBYA 2DLLA 1WP6A 2V7QA 5BSXA 2PFBA 1EE6A 1R5GA 2UUZA 2A5YB 2ZB9A 3H9JA 2P4WA 3O3KA 1OPCA 2E71A 3DXJF 1T39A 2IQ7A 2WJYA 4Z4YA 2XPWA 3ZMZA 4HF2A 1RRJA 3K69A 3PQJA 2CJJA 2XEXA 3SZGA 2FJ1A 1LNWA 4U4BA 1YTYA 3I9V2 3Q38A 1KU7A 2YWGA 3FWEA 4OOXA 4YIIA 4ZDLA 1J09A 5KAIC 2NSPA 1IJEA 2KZVA 4IRGA 1O8KA 3LSGA 1DDIA 4YZ0A 3PNTA 5DM6F 1JXSA 1FNNA 3ZIAA 5E3MA 4B44A 1UJ8A 3LWFA 3OL3A 3RKXA 2F6CA 3OOUA 2P6SA 2BY1A 2QZ8A 3ZP5A 3DPUA 2OTLI 1YX3A 3HBLA 3CP2A 5D4RA 3ABKH 3LSMA 2ZTGA 1BC8C 3EUHC 2OJED 4MEYF 1YITI 3QAHA 2R5ZA 2DBBA 1Y0NA 3IH2A 5KHDA 3T0YA 1MNEA 1T56A 4IKFA 2DY1A 3RKWA 3OYFA 2WV1A 4KFCA 3WXMA 3K6GA 3OOPA 2VNKA 2W84A 4MHGA 1OR7C 2V26A 3C2HA 5JLWA 3KEWA 3CPXA 5F1RA 1NB9A 3LAPA 4XLCA 1F36A 3CUOA 4J0QA 4GCVA 4ABZA 3BPVA 2W7NA 3OYBA 3NEUA 4RS8A 1GV5A 3QRFF 2QN6A 3FKJA 1O3RA 3LFUA 1H80A 1ETVA 4RJLA 2JUGA 1MMNA 4BBSJ 4L5EA 2A69F 1OYWA 2BN4A 1FTZA 1LDJA 5CVJA 1G8XA 5J3LA 3Q6RA 1KJZA 2CSOA 1DDNA 1V4RA 2XVCA 2DQLA 2DAOA 2EFPA 1DGWY 1ENHA 1YQAA 3S1RJ 4HDUA 3CCLB 4WQMA 4B1RA 2WB1N 1YG2A 1JJ6C 1QFYA 4MQ9F 2K9QA 1TNSA 1AWCA 3J81Z 5LRRA 3AAFA 4N9HA 1IXRC 1U9OA 2OZUA 3ZZTA 4R79A 3WBKA 2HWVA 3L09A 3TP3A 5IYCJ 2R9VA 3F6VA 1IRFA 2GQQA 3G4SB 3S1NJ 1GT0C 1XDSA 1YJ9I 3Q9SA 3IP4B 1BM9A 1GAQA 4JRAC 1JTYA 1WH5A 3BLYA 1XS9A 3RZOJ 4CICA 1FSHA 2GJPA 4EJOA 2CV1A 3ZBUA 3I55B 1HKTA 3CCUB 5HOOA 3WYAA 2V5IA 1Y8QB 1QNTA 2W82A 3GO5A 4RCYA 3GCMA 1XGSA 5EEAA 3K2ZA 2VBSA 1GUUA 3KP3A 1IV6A 5F0HA 1XFOA 3HHHA 2R7RA 2BM0A 5JBQA 4RB3C 1G3SA 2E5ZA 3C2GA 1S0UA 5DS9A 2M8GX 3ECHA 1F1ZA 2DMNA 3Q39A 3T53B 2VJJA 3WY9A 1C0WA 1DGRM 4A3IJ 2KFDA 2KDOA 2YX7A 4OAYA 1WI3A 1ZYRF 4BYYA 3DLLF 3E6CC 4I7HA 1B72B 3PUNA 1F43A 1EH6A 1Z7UA 2L02A 2R7UA 1SD7A 2RC5A 3WE2A 4B48A 4LBZA 2VQHA 4D1QA 2QZAA 3HC7A 2E1MB 3BQJA 3K0LA 3B6CA 1HSJA 2VB6A 3EYYA 1EP2B 2ZC2A 1RKTA 1D0YA 1P4MA 4TMWA 1BA5A 3OIOA 1U9NA 2PBIA 2ZZQA 1JB9A 3HDDA 4L9TA 3HG9A 5IP9J 1HC8A 3V8KA 2LFBA 4J00A 1BL0A 1KK0A 2XRNA 3BJ6A 1DP3A 1KK3A 2LREA 2R7SA 3DQVC 4LD5A 1YOVB 4XN0A 2VJIA 1W34A 4YZAA 2VNIA 1WOSA 1BC7C 2JDIA 3OFNA 3FMSA 5C44J 3GLXA 4Y17A 2YPRA 4C30A 3S1QJ 3BG3A 1U2WA 2UV1A 5IYBJ 4Y3OA 1V3FA 1IN8A 2R4GA 2HQ5A 2JVHA 2PE3A 5HKKA 1WGXA 2V1NA 3EYIA 1VQNI 4PABA 1CNEA 5DDGA 2X48A 1BI0A 3DTEA 4M71A 2IP2A 1K78A 2J7KA 4OPSA 1MDMA 5LGUA 4D5FA 1ZRFA 1ETXA 1O7LA 4BJ6C 1LFPA 4LK1F 1Q82D 5E18F 1VLYA 1RIOH 3B02A 1BN5A 3RQIA 4KA4A 1BJZA 1B6AA 4XLEA 1VQNB 2EIMH 2FQ4A 2XKPA 1UG0A 3P7NA 4ESBA 2GIVA 1D5YA 1UD5A 3AFHA 4EJVA 1FC3A 2ZXIA 1TYXA 1YJ9B 2GBYA 3BCAA 4GGGA 4RM2A 4TMTA 1LKXA 1K6YA 3G71B 4M2LA 3JW4A 1OFMA 3ZOBA 1EFTA 2QSFX 2RN7A 3ZRGA 4ESJA 1OB2A 1TWGJ 4LBYA 3RPUD 2WPDA 5L3DA 2BZTA 3HSEA 5H20A 2VNHA 1YI2B 3FXQA 4ZJZA 2GLOA 1MZBA 1TBXA 2CV0A 2Q0OA 2NPFA 4OINF 2FBIA 4AU7A 4RB1A 4WXDA 4U88A 3SZEA 2B7CA 4X1EA 5F4OA 4YFXF 4XONA 2EPFA 1V5FA 5E8GA 4Z06A 1QGAA 4OJ6A 3SLDA 2NSTA 4FE4A 4UVCA 3GZNB 4A3CJ 2JQ7A 3CC7I 2PI0A 3E97A 3I54A 2ADUA 4PJLA 4Y7CA 1IA5A 3F0CA 4CZCA 5JR3A 1I1SA 1NHAA 3L7WA 1RI7A 4MXNA 2GJRA 5FGMA 2JRTA 3LSRA 2QLZA 3LSKA 5L3CA 2PJRA 4HG2A 4RGUA 3M4OJ 2XC1A 2DU9A 2W85A 2KQRA 1O88A 1WJCA 3BY1A 5FKKA 1BX1A 3DU5A 2CK3A 3QPHA 2ZXHA 4HQMA 5KNLA 4HLXA 3WU2C 2JIZA 2OCCH 1J2XA 1VTNC 2B0RA 1UD3A 2FBHA 1I7PA 1RQRA 3H0GJ 2BYVE 3TOAA 3I4PA 3H5RA 3HL2A 1JT0A 4ASUA 1OMIA 1GAWA 2OK8A 2QQAA 3QQAA 4M6VA 2QKLB 3CUQA 1ZH5A 4XKWA 2A05A 1OFLA 1YYVA 4FT8A 4HWVA 5A8AA 2BY3A 5ILSA 1U78A 3W2HA 1I6XA 1QH0A 4UZFA 2KL4A 3K10A 2QYUA 4U87A 4Z2YA 3F8NA 1A31A 2EA2A 1HCRA 3VWBA 4WZKA 3ECOA 3OL4A 2BF4A 4Q7JB 4C9YA 3G6EB 2JK3A 2P5LC 3P26A 4RD0A 1H8EA 2EA4A 4X8IA 3TO6A 3E6DA 3J81K 2OBTA 1T2KA 2DJNA 1Z7LA 5KVRA 2YX4A 3CCYA 1J9ZA 4A6EA 2MA3A 4JMQA 4BDYA 1KTWA 2X6OA 4HOBA 2NVYJ 4IOCF 4YHBA 1LVAA 3R6JA 2K3PA 3WE3A 3W6KB 4Z05A 1WJ5A 4LBWA 2LR8A 4HV5A 1NDHA 3MFKA 1IB0A 2GJKA 5F04A 4DNCA 4DYRA 3CQZJ 1TW3A 3C1DA 2NS0A 1PVEA 4AYBA 4HQEA 3G1OA 4N0BA 2XDVA 2H27A 1PYVA 4RM3A 9ANTA 1S7OA 2VQCA 2ZTNA 4X7FA 4HX8A 5C1CA 1FMWA 1QZEA 3PUMA 3RY8A 3MKLA 3K70D 3OJWA 3HIFA 4XR6A 4YRVA 4A3BJ 3RIQA 5KW9A 3PO2J 3BPXA 2OQGA 4CYCB 1VQ6B 2RNJA 3JRDA 3IHUA 2X1DA 3ZN1A 3SKBA 4AF7A 1XC5A 3CJNA 3ISPA 2QSHX 3FM3A 1ZGJA 2V7TA 4ESFA 1ZQ3P 1G3YA 4IJAA 5BMZA 3LYCA 1O4XA 2C5HA 2BVLA 1USTA 5LMZA 1DG1G 1JA0A 1PLUA 3FIWA 1X1AA 4UV8A 4N9IA 4DZJA 4MNUA 4A3DJ 5H6RA 2B7EA 2LF7A 4BHBA 1ZRDA 1CF7B 3FF5A 3FXOA 4CDGA 4ITVA 2LH9A 3DKYA 1ERDA 1WPKA 1QFZA 3Q0VA 4A0YA 3CJTB 4Q5SF 4NK8A 2R5YA 1J0RA 2DYRH 1FT9A 5DCFA 4J01A 1WJAA 1JT6A 2KLOA 4RDJA 2QTZA 3QFRA 3NAWA 4UB8C 2VJ5A 2XPUA 4UUTA 3S3OA 2AXLA 2E60A 4O5VA 5HDNA 2MYSA 2WBMA 4X0GA 2L2OA 1NB0A 2V79A 3OIPA 4YFNF 4C0SA 2STWA 1V5GA 1DPUA 3IKVA 1YRNB 2F4NA 3MZYA 4KKUA 2R7VA 1Z67A 3A0BC 2CW5A 3HGYA 2TCTA 1VFCA 3FPPA 3ZCOA 3E6BA 1R5NA 2B9SA 4JP0A 3ZXSA 1WSUA 3I1FA 2HXOA 1W0TA 3S3NA 1H0MA 1K83J 1TYUA 3BG5A 3V4GA 4BKXA 3HEFA 3WG9A 2COBA 5EF6A 4G1VA 2PIAA 4WCGA 1WHUA 1Y1WJ 3HZJA 1RNLA 2ELHA 3B90A 2HFHA 1PUFB 3GX4X 1YW8A 1VJSA 1AKHB 2V7VA 1UCRA 1WOPA 3QFSA 2F4OB 3OSGA 1VHEA 2XAUA 3HXLA 4LB6B 1G3WA 2VLAA 1VHOA 1MMAA 2JMWA 4V2FA 1WJDA 3CD6B 2L9SA 3MAJA 4LBVA 2OUMA 4F91B 5LRSA 3P27A 2EZHA 1T95A 1GO2A 4CQJA 2V7FA 4A2UA 3DTIA 3PFYA 1TWFJ 2WYRA 2RKHA 3HOVJ 3P4GA 4FX0A 4DK0A 3ABUA 1YJNB 2UZKA 1D1BA 3G1LA 3OY9A 4PGOA 1O7FA 3PETA 2BHYA 4ANJA 3AVYA 4JX5A 5FD5A 2CF4A 2R5YB 2GXAA 4Z4UA 3OZUA 5AIPA 1H8HA 3JQPA 1BI2A 2XPVA 2DI3A 3PNVA 3QPLA 1IJWC 2Z9OA 1LDDA 2VFQA 2RQQA 5A2QZ 2HZDA 3EQOA 2EFOA 2MFZA 3PFIA 3LJYA 3OYIA 1QBJA 1I27A 3MEXA 1B72A 3MZ8A 3O8HA 2F1MA 3SDBA 4IHYA 1P2FA 5AN9A 3ZSCA 3GFMA 1WOOA 4DK1A 3CMEB 2VC0A 4OZYA 4B4CA 1GXQA 3AVVA 2IS4A 1XSXA 4XOPA 2MD5A 4NNJA 1MH3A 4CYCA 2CUZA 3M1EA 1JJ2B 2IRFG 4I76A 2BW3B 4Y9UA 2BGJA 5J8CA 1A6IA 2MLKA 5C1EA 3OV8A 5HODA 3KFWX 5ILUA 4P3YA 1O8LA 1DUXC 2Q2EA 5FKNA 4BHCA 3BT9A 1PUEE 5FNZA 2QY1A 4ENNA 2KISA 2BOLA 1D8JA 1NBMA 3FPKA 2OV7A 2W57A 3HKZN 5HLHA 2UVFA 3SEQA 1TQPA 1QFJA 3JX8A 3FKSA 2XTWA 1V54H 2DTRA 5IT9K 2HKOA 5LHGA 1BR1A 3WTZA 1XG2A 2O6GE 3TW6A 1UZCA 2NOGA 4BEHA 4X7DA 4F7DA 1KQ0A 3VB2A 1ZGWA 4BQNA 2EFGA 3ZPPA 1LEAA 2VOPA 2EIXA 1SVOA 1N08A 2DEUA 1ZAOA 3L2VA 1SD6A 2KHMA 5B5EC 3G71I 3CCRI 3CPWB 4HNTA 1K9MD 3WTUC 5DTDA 3V7SA 4CZZA 2LKPA 2ZL7A 5IP7J 4N3GA 2BVNA 1JGSA 4GO1A 2LC2A 3GTQJ 3ABLH 2FNPA 3RZDJ 3OYDA 1XMAA 5E1WA 1IJFA 4R71A 4KJZA 1J9IA 4YC5A 3LNNA 3J80K 2E2HJ 4X07A 5J1UA 5D6FA 2IA1A 3I0TA 3GWZA 1Z6TA 3BR6A 3OW7A 3OWTA 4GFBA 1U6GA 3S17J 1IDJA 4TMVA 3BJAA 2NVUB 4Z4WA 3KIOA 4ENJA 1D1NA 5K5RA 1R71A 1GR1A 1NJID 3FBIB 5FB2A 3FXJA 2IW5A 1MBJA 4IHTA 1G6NA 2EH3A 4GRIA 3A8IA 1FNMA 4WF2A 1RUOA 2LBFA 1O8GA 5TISC 5GAGJ 3R61A 4G7ZF 1SEUA 1I8DA 2DPDA 3N4MA 4WZEA 2D45A 2CQKA 3CMMA 4AUXA 4P9SA 1X1CA 3EUHA 1JHFA 4WXCA 1IDYA 4LIUA 2W6IA 2JSPA 2E7XA 1U5TB 1FSEA 3CCRB 2DTZA 1HQCA 2XGDA 1JGGA 3S2HJ 3AK5A 2LDUA 3BZKA 1IG7A 2RQPA 2F48A 2BY0A 4LIVA 1EZGA 2OAZA 3D5SC 5AONA 2XT2A 2DJIA 2EILH 3H5AA 1NHCA 2GM4A 3A03A 4M3DA 4EGZA 2IVMA 1FBUA 2X3HA 2NNNA 5LHIA 1T0FC 1QA6A 4MIMA 1OGJA 4G9YA 3G73A 1W5SA 1TYVA 4UV9A 2VE8A 4PUSA 2ZFUA 3G05A 1QA2A 1KQ9A 4RCZA 3SFZA 2W00A 2V7XA 4W8SA 2Y2ZA 5D8LB 4XRSA 1XE1A 3R6SA 5H59A 4LLGF 1XGOA 1Y56A 3HKZA 1POGA 2JSCA 2DIEA 1XCVA 2PMZN 2VOOA 2VC1A 3CC4B 3BDDA 4O6JA 1YITB 2JJ2A 2D5VA 3DKXA 4EQQA 1DU0A 4YXWA 3D0SA 4OIQF 1G2HA 4CA0A 1XGMA 1IGNA 1IO2A 1FJLA 4JBAA 4PSWA 3HSFA 2O5RA 3P5JA 1V0FA 3LL7A 5DM7F 1ETKA 4S0HB 1HDDC 3FXKA 1QGPA 4AD9A 4E4HA 3VR6A 3BQYA 2JTVA 3FISA 1TW2A 2O8XA 3HM5A 4P55A 4ZYDA 4OJLA 1ACIA 5CKTA 2QGGA 4AWXB 3LAJA 2QM3A 1ZR2A 1J75A 3W3CA 4AIHA 4KMFA 2LKSA 4XK4A 1MIJA 2BV6A 1X58A 4I0BA 4IZZA 1TC3C 1IDKA 4H9GA 4M4SA 2QSGX 5FO0A 3SY2A 3U9GA 1T98A 2Y9ZA 4I0AA 1MSFC 4IOAF 3P9IA 2VBMA 4BPRA 1R1TA 1OKRA 1SFUA 3BWGA 1U0JA 4E7JA 1A6QA 1ZM9A 2GK7A 1Q9SA 3LSTA 2GOXB 3GF2A 2ZNYA 3J7ZI 2FE3A 3PL8A 3ZZUA 3MQ0A 3VPRA 1IXCA 4BS9A 3DLAA 5FFXA 2BMWA 4ZGQB 1ULYA 2AHQA 1KYWA 5CVUA 1UMKA 4LG0B 4A69C 4DYQA 3WTWC 1JKRC 2EV5A 3GLLA 1R5HA 2HMAA 2GWRA 2A6EF 3DPTA 4BH9A 3VODA 2X8KA 4WXHA 3P9CA 3DU1X 1FIPA 2XV4S 2X6YA 3K4KA 1XMXA 1P4WA 3S2DJ 1Z91A 2TDXA 3IAS2 1I1GA 2WSSA 4YAUA 2WAEA 3WU1B 4RLZA 4EMSA 3IKTA 4RM0A 1IN5A 2NVQJ 1X2NA 4IXAA 2DA5A 4YEJA 1YW7A 2FX3A 4HE5A 1QZZA 1OFCX 3IAM2 4XLNF 3T1BA 1VLOA 2QEXB 1G7TA 2R7OA 3K1MA 3OS1A 2O0YA 1VQ5I 2UWMA 3B73A 4G12A 2DK5A 3M8JA 3WBJA 5E3OA 4YIRX 4HA8A 1W5CC 3ASOH 5J4VA 2NVXJ 2QDXA 2LRDA 1YJNI 3S1MJ 5HS9A 4BACA 4YAWA 3LA3A 3DV8A 2G7UA 4EGYA 2LZJA 1R7JA 3CCSB 1XDUA 1LFBA 2HDCA 2HXIA 1QG0A 1BI1A 3W2FA 2M30A 1TYWA 3CCJB 5GV8A 1ELOA 1RETA 1W5TA 4I01A 3QOEA 4B3XA 3IL2A 3L2RA 5IT9Z 2B5OA 3BH4A 1RUNA 5DYMA 1Y0RA 2EZKA 4EM2A 4OM9A 3R60A 4URRA 3BOQA 3RIRA 1W0JA 2ZL5A 5E79C 2IJLA 1J59A 4PJNA 1JRGA 2VFMA 2ZO4A 2O7OA 2RC4A 1MH4A 2ZMEA 2WZNA 3QFCA 3BJOA 4HX4A 2XAHA 2ZITA 2M1BA 2PMHA 3V7CA 2IPQX 4OZZA 1K7AA 3CC2B 2WAFA 3ML6A 1WVRA 2FNAA 1QUEA 3ONUA 2ZMEB 3F6OA 2XROA 1QPMA 3W6VA 5KSWB 3PSFA 1K8FA 1PJ5A 4ZDOA 3OJXA 2XZOA 4NCNA 1IV8A 1VF7A 3JURA 2O0VA 3BQZA 1D2EA 1FNCA 1E3XA 1Z3XA 2LD5A 4CCJA 2H8WA 2YU3A 1B59A 4CCOA 1ETOA 2WV0A 2M0CA 2WJVA 1SAXA 1K28D 5M5YJ 2CQXA 2EZLA 1TZLA 3RJPA 1V5VA 1RC9A 4BXFA 2X6WA 4RD6A 3NWTA 4CSWA 4ZZDA 3E20A 4UY8I 4Y9RA 1IAWA 1WWXA 2X1CA 4L5JA 2HDDA 3CCEB 3A2KA 2DQRA 2PN6A 3CLOA 1WDTA 5HVQC 3OE7A 2DA6A 4X05A 3CCVB 3KYCB 1ON1A 2V9KA 2JWTA 4HDVA 4A5MA 3RKQA 3DKWA 2LVSA 4ZV4A 4P96A 1TLLA 2K9LA 2EZIA 3JRGA 2L9NA 2OA4A 1SMTA 3CTAA 4G7HF 1QQ1A 3H3ZA 2H1LA 3BC9A 3H35A 3KZIC 3HSRA 3NB2A 4RGRA 2VXZA 1GXPA 1STZA 5GP9A 1YX2A 3NE5B 2VBVA 3QYFA 2HQRA 1UG2A 2H1KA 1EH7A 1XD7A 4M6XA 2IGNA 2ME0A 5D5UB 3RI4A 1R5BA 2XZPA 2LSOA 3TW7A 2Z33A 3Q6QA 4G7WA 4EM1A 1JKOC 1PUFA 2Z3YA 4RPBA 3MMPA 3PNYA 2Z5UA 1SAUA 2K40A 3RPUA 2G7HA 4YCQA 1PE9A 3CDLA 2L7FP 1TUIA 2X0KA 5ICCA 4M9SA 1IN6A 4B43A 1ZM2A 5EEHA 3F8MA 3QP5A 1O8IA 4E7ZA 2Z6BD 4QUZA 3M3YJ 3T8RA 3JRIA 3F23A 1OOCA 4E7IA 1R4NB 4HW0A 3JRAA 5LLQA 1S5LC 1R36A 1NH3A 1H89C 2R7FA 5K7FA 5TY0A 4OPWA 1YI2I 3SFIA 3ZBTA 5CVVA 1TQMA 5D5WB 1R5ID 3CUQB 2KIUA 2PLYA 3I64A 4IHVA 3ISXA 4W8RA 2D1HA 2HPMA 4WWVA 3GW2A 2EIKH 2E1RA 3VEPA 3H36A 4G8XA 5L46A 3CB4A 2QF7A 1QZYA 1E43A 4FWTA 2IGOA 4DW6A 4WZLA 2HEOA 1X0CA 2EJRA 5IY5H 4W1UA 2IAIA 1X4OA 4FK8A 4AF6A 3SDGA 3B6AA 1W7PA 3FJOA 4RMNA 1DQUA 2E1BA 4XKVA 1OB0A 3GTOJ 4ZCMA 3VOEA 2W1OA 4OIOF 1BMFA 3CP8A 3KETA 3L00A 4PFOA 2B7BA 4UHTA 4JX4A 1OFEA 2UVEA 2KP6A 2V4DA 4P3IA 3L2CA 4MYUA 1OCCH 4PC3A 1W1WE 2HZTA 3LQEA 4BQOA 1OCPA 4DNTB 3LNQA 3PJRA 2DK8A 3IH3A 1ETQA 1MNMC 3K4JA 2ECBA 2HDWA 2LY2A 1TLHB 1XSVA 3C18A 5HZBA 1COWA 3OYMA 3PSSA 4YIFA 3OIQA 1VQ8B 2NTQA 1IDZA 3MN2A 2HGCA 3M8EA 1IW7F 3OYGA 2FEZA 1QJVA 4ENMA 1FZPB 1SFKA 2CUJA 2LBFB 3R0AA 2QBYB 1P7IA 3JAMK 2LF8A 5DCMB 2NV4A 4YZXA 1AKHA 3OS0A 2V1DA 3MD2A 3BNWA 1EA3A 4KH3A 3BP8A 4OWRB 1BIAA 1UHMA 2F5EA 5J8FA 1Z6RA 2CW8A 1E62A 4PSXA 1O8MA 3NWSA 1S6LA 4PZJA 5M5XJ 1W35A 4M0LA 2HDNB 3R0JA 1ZN2A 3KLNA 2RVCA 1VQ6I 2DT5A 3A01A 3CC4I 3P9KA 2BM6A 2INVA 1GVJA 2HQAA 3SJMA 1JKQC 2JA6J 3AGQA 3B82A 4BE1A 2RC6A 4NC8A 4TV7A 1HA8A 1R6RA 1YS6A 2MGQA 3ABMH 4KMUX 2JZYA 5E20A 1AU7A 5F08A 1WJFA 1WPCA 3OS2A 2YUHA 3S32A 4FN5A 3LSIA 3GZ5A 3FX3A 2GQFA 4P6VF 4KIGA 1SFEA 1DBGA 4LK0F 3QP6A 2KRHA 2HR3A 5K7HA 3PENA 1I39A 1TWCJ 4XD7A 1O8FA 2BM5A 1T6ZA 2RDPA 3KP6A 3HGGA 1GJRA 3I4NJ 2V7UA 1USSA 3I55I 4V02C 1Z77A 1O8JA 4Y4RA 1GV2A 5EG0A 2NXNB 2JPBA 2D74A 3FXMA 2JA5J 3DPLC 2R7WA 4YEIA 1ZR4A 2L0KA 4M74A 2O04A 3KX2A 1R4MB 2BXZA 2VPRA 3FXUA 2VKHA 1KZHA 3KEOA 2PX9A 2CV2A 3EDPA 5FKOA 4ACAA 5CQEA 5GTHC 3ES9A 2Y69H 4Y33A 2WWYA 4YFOA 3ZQHA 5IP6A 1OGOX 1B2RA 3ZQGA 1XGNA 3AGPA 5B1AH 2XB0X 3HAGA 3VO1A 2IA2A 3CRZA 5JI6A 2XTYA 4NBQA 3ZGKA 3N6ZA 5DV5A 4P12A 3GQ8A 1HBXG 1K4TA 4EEFG 2DETA 1UELB 5D6EA 3TL4X 1AIPA 2QKMB 1TNTA 3ULQB 5IPAA 2OTJI 1TT5B 2BY2A 3J80Z 3KZYA 4OIPF 1FPQA 2FRHA 3NRVA 4UUSA 4F7ZA 2BPOA 1D3YA 3E7LA 5DD8A 1Y8RB 3ZMUA 5FFZA 3AVTA 2DA7A 2ODLA 3MKZA 1E2XA 3L2WA 1I3AA 5E1ZB 1QQIA 4H4KC 5DUKA 3V7RA 5CPRB 1DBOA 2RV8A 1EFRA 1W7PB 1VF9A 2JT1A 1FX0A 2QVOA 3GQ9A 4IO9F 2AQEA 2ZSHB 4IHXA 2K5CA 5EEGA 2DA2A 1N06A 4Z4VA 2ZL6A 3IV5A 4M3BA 2XGJA 4S05A 3A8KA 2DN0A 4C3IJ 1AOYA 1RZ4A 2MH2A 3OYLA 1WKMA 2YWEA 5EG0B 3F21A 1P4XA 4R8HA 5IOZA 3H0DA 1WI9A 2FOKA 4MO7A 3ASQA 1K4SA 3BY2A 3FY3A 2ISYA 1SM4A 3FMRA 3FM5A 1VQLB 2Y31A 3W6JB 4RB0A 1YHQB 4MLOA 2F5FA 4G6QA 3ZPLA 3HOUJ 1MABA 3QWLA 1G3TA 1Q1VA 2MC3A 3U1KA 4WWCA 2XHKA 2FUG2 3UW0A 1FBQA 4UAJA 4IRIA 2OTJB 2RAEA 2VONA 4FQGA 1N0UA 3U6KA 4FE7A 2CMPA 3EQLF 4E70A 1XTAA 4CCKA 3A4CA 4PMHA 2YSRA 3E3VA 2R7XA 1KK2A 1BJAA 1JJ8C 2E2JJ 3DEUA 3PVDA 3ASRA 4ZH4F 1VQMI 2KVOA 4G7OF 4FHTA 3CCMB 1Z3YA 1H85A 3KZZA 3GFLA 4XKBA 1LUJB 1PKVA 1D0XA 5HS7A 2E34A 1WH7A 3ZQLA 2H8RA 5D8KB 2K4BA 2Q8KA 1Q81D 2V1UA 1R1UA 2MSYA 2WC2A 3WTVC 2STTA 1PP7U 3BZCA 2AQFA 4UNOA 1FBSA 1SMYF 3K1NA 4OPVA 5FLMJ 2DW4A 1EFUA 2EWNA 2ZZEA 4QV2A 5DSZA 2GA1A 2ZBKA 5D5VB 4PAAA 1BQEA 2XGEA 3IWZA 3I5UA 4A3KJ 5IK2A 1LB2A 1HW5A 4M53A 3W2GA 3GIRA 3BR2A 4YAOA 3F9KA 4BQQA 3DDYA 3FK7A 2IOUG 2R6HA 3OYKA 4U0VA 1UD2A 3F72A 3T9GA 2IA0A 2XIGA 4WK8F 1KU3A 2O17A 4CUGA 3HOYJ 2OK7A 1KTVA 4AIDA 3TDZC 1R22A 3A3BA 1N07A 1IC8A 2Y0SN 3OMYA 1SANA 4X7CA 3GVJA 3WTXC 3H3UA 1D0ZA 2X1EA 3DU6A 4RPDA 4RDKA 4XNFA 3HRSA 3KYLA 2QGUA 5FO1A 3W2EA 4OJPA 1KCDA 4OMZA 3CD6I 3LFKA 4ZTJA 3CMAI 1T8IA 2NZMA 4IL6C 1QU3A 1O8DA 1O57A 1Y6IA 2P3MA 2I5UA 2VI6A 1ZUNB 4E6KG 2VFOA 2V6CA 2R7ZJ 3LQ6A 2P7CB 1N0VC 1APLC 3JRBA 2CW7A 2ECCA 2L7MP 4U0YA 3CMAB 4K1XA 3G1MA 3RSNA 1OISA 1SD4A 2XUBA 2VN2A 4HSRA 4YELA 2VJ4A 4XKCA 1FOXA 5ICEA 4YALA 4XRMA 1FTTA 1V5EA 2PG4A 1MNDA 4L8JA 2M3AA 1FRNA 3I56B 4X0CA 1UD8A 3H9GA 3VSKA 1T6XA 5AMVA 1WSVA 2I8DA 4V19K 4C3JJ 3QU3A 5EZGA 2VNJA 5ED4A 5FLXZ 4HX7A 4NUBA 1JNYA 4FASD 3RDIA 1VQ4I 1T38A 2A6HF 2HOTA 1NRKA 5B6IA 2OZ6A 4XQFA 1HKSA 1W9XA 4OIRF 4AIJA 1EP1B 3WODF 2DCUA 2OBRA 3UR3C 1R00A 4BQAA 3OZWA 3HYIA 1S29A 2RGVA 2F1LA 1VI0A 1OHHA 4KKSA 4DZPA 5IT3A 1WJBA 2DFIA 2AO9A 2QQ8A 3E1YE 2HVSA 1RQPA 3VSVA 1N78A 1EXMA 2P6TA 3U1DA 3ZMDA 1U3EM 4B3FX 3N90A 2COMA 3JR9A 5L3GA 2AXTC 3QPTA 2DT6A 2BEOA 2L5QA 2PLFA 2Q6LA 1WCMJ 3ASTA 1REPC 4RLFA 1S7EA 5M3FJ
chains in the Genus database with same CATH topology
2LYCA 3W3CA 3V42A 4ZYAA 3K4CA 4IZZA 3OEHA 1IDKA 1V0EA 4R79A 2MABA 2R9VA 4EW9A 4DBRA 2A6TA 4F93B 3ZQQA 1BPLA 2VBMA 3IP4B 3BLYA 3B4NA 1U0JA 4E7JA 2GJPA 4E7LA 2CV1A 4QPQA 4C2UA 2GK7A 2GOXB 2PYGA 3S8PA 5HOOA 2M5SA 3PL8A 3AKZA 4NQWB 2W82A 3CF2A 4BS9A 3DLAA 1HG8A 3A35A 2PJRB 2LG4A 4NC7A 2W4SA 2Q1ZB 2HLDA 4BUPA 1KONA 4G7XA 3T56B 2M0MA 3TBIA 3DPTA 2X8KA 2R7RA 5FROA 3C2GA 2E5ZA 4CCLA 4P22A 2X6YA 2CS3A 3K4KA 3T53B 2VJJA 3IAS2 4KT6A 4YZQA 1DGRM 2JVGA 2VKDA 2WSSA 2KDOA 1GLNA 2WAEA 4OAYA 3OAAA 3G2BA 3I3LA 1G59A 2BVMA 1W36D 3SEZA 4YEJA 3E0JB 2R7UA 4B48A 4XM3A 3IAM2 2F4IA 4FETA 1X4PA 2VQHA 2R7OA 4D1QA 3OS1A 4TSFA 3HC7A 5JHFA 2UWMA 2E1MB 4OJOA 3M8JA 2CH0A 2VB6A 1D0YA 3OR1C 2ZZQA 3EQNA 2LRDA 2WA0A 4E0FA 3HG9A 4LG3A 2HVQA 4Z1MA 1HZEA 3EUAA 1WMRA 3VMVA 4BACA 4ZC3A 4J00A 2LZJA 3OR2C 1DP3A 1N77A 2LREA 4ZDPA 2R7SA 3DQVC 2MD0A 4XN0A 3AL0C 2VJIA 3OYEA 4DNRB 4YZAA 1PJRA 2QX3A 3FDYA 3H94A 4G6TB 2JDIA 3L2RA 3QOEA 4B3XA 3D5LA 3OFNA 3BH4A 4C30A 4E7KA 2UV1A 4Y3OA 5DN6A 2R4GA 2JVHA 2WY7Q 3CJQB 3VDXA 2CFOA 5HKKA 2O1DA 1W0JA 4URRA 2V1NA 5FRMA 3GQAA 1BN8A 4LITA 2V6EA 3DTEA 3J7AY 1JRGA 4PJNA 2Y0SA 4BE2A 3DWLE 4BJ6C 1LFPA 1VLYA 2BW3A 2LOOA 4XLEA 3LMWA 2DXIA 4CCMA 1UD5A 1UG0A 4OZZA 3AFHA 2ZXIA 4B3GA 2WAFA 1S9HA 3BCAA 4RM2A 2W6JA 1LKXA 1NG6A 4F92B 1K6YA 1OFMA 1MW7A 3PSFA 4ZDOA 2XZOA 1VF7A 3JURA 2R7TA 2O0VA 4Z03A 3ZRGA 1E3XA 1Z3XA 3K4MA 4CCJA 4TT3A 3RPUD 4CCOA 2WPDA 2WJVA 4E7SA 1K28D 4ZJZA 2PMZA 1D1CA 4XLAA 1I18A 2CV0A 3M1CA 3W2VA 4AU7A 1E79A 1TZLA 2E1MC 2QE7A 3K4NA 1BLIA 2KPMA 2X6WA 4BXFA 1X19A 3NWTA 4CSWA 3E1SA 3DTKA 4Z06A 2IXSA 4XONA 1V5FA 3CZ6A 3MKYB 2X1CA 1RU4A 4OJ6A 2DCEA 4DJAA 2F43A 2VBKA 2NSTA 3A2KA 3B8YA 2OC6A 2HVRA 1UD6A 5HVQC 4U49A 3OE7A 1TT0A 4HEA2 2V9KA 1RMGA 4P5OA 4PJLA 4BL0B 1IA5A 4CZCA 2K9LA 2JA2A 4MXNA 2L9NA 2GJRA 4XMYA 4DBQA 3LSKA 1LVKA 4XLHA 3FBNB 2PJRA 3BC9A 3H35A 4PFPA 5HNHA 4HG2A 2VXZA 3GVLA 3NE5B 3QYFA 2KQRA 1UD4A 1WTHD 1O88A 2XZPA 2IGNA 1WJCA 2GOMA 2QXZA 2HPIA 2X51A 4G7WA 3DU5A 2CK3A 2ZXHA 3ONQA 5KNLA 3PNYA 4KISA 2MC4A 1SAUA 4PJMA 2JIZA 1PE9A 1UD3A 2HU9A 3LSHA 4B43A 3H5RA 3HL2A 1O8IA 2O0WA 4E7ZA 3VYTB 2KMUA 4ASUA 4GQNA 3SUCA 2Z6BD 2QKLB 3OEEA 1OOCA 1IB4A 4E7IA 2X85A 4HWVA 1MMGA 2M4KA 2E5NA 4XKWA 1OFLA 1RWRA 3BCFA 2KL4A 2IGKA 3K10A 2LY1A 4U87A 3VWBA 3OL4A 3GVKA 4C9YA 4W8RA 3OOCA 2M4GA 1P9QC 2HPMA 1H8EA 2XF7A 3RQ4A 1Z7LA 2RREA 1E43A 1Z21A 2IGOA 3KEYA 2X6XA 4JMQA 4BDYA 5HLTA 1KTWA 1OGMX 1X0CA 3RCOA 1X4OA 2K3PA 1CZFA 4Z05A 2GK6A 1K5CA 3MKWB 1WJ5A 4RMNA 1DQUA 2E1BA 1AIRA 1GQ8A 4XKVA 4OJ5A 1OB0A 2GJKA 2W1OA 1BMFA 3CP8A 2NT6A 4PFOA 2ZZFA 1X1DA 2UVEA 2WZPP 2KP6A 4AYBA 1UAAA 5HNFA 2V4DA 4JOMA 1MMDA 2XDVA 4DNTB 1PYVA 4RM3A 4BQOA 3H9QA 2VQCA 1QHGA 4KITB 2ZTNA 5C1CA 3PJRA 3BC8A 1FMWA 3K4JA 2HDWA 1BR4A 2LY2A 3K70D 4YRVA 4XR6A 4F3QA 2VPLA 1COWA 3OYMA 2Z1DA 3OIQA 2NTQA 4W8QA 3GRHA 1E0EA 2X1DA 3OYGA 1QJVA 4HNUA 4RLQA 4BJTA 4F52A 1SFKA 2CUJA 2LBFB 2IS6A 4KKTA 1BOBA 2ZZGA 2BVLA 3EUKL 1X1BA 1PLUA 4YZXA 1X1AA 3OS0A 2WAQA 3BG7A 3HPGA 3MD2A 3RTRA 3VYSB 1EA3A 4BJ5C 4OWRB 3KRGA 4PK4A 3T51B 2CW8A 4PSXA 1O8MA 4IQ4A 3NWSA 2LH9A 4ITVA 4N4OB 3DKYA 1ERDA 2NTPA 4NK8A 2D3LA 3VSTA 1KMHA 4II2A 4HIZA 4J01A 1WJAA 2KLOA 2IS1A 2INVA 2Z16A 2VJ5A 2HQAA 3S3OA 2NT9A 4BE1A 4BDZA 2E60A 2MYSA 2NTBA 2WBMA 4NC8A 1HA8A 4X0GA 1R6RA 2L2OA 3OIPA 1WJFA 1WPCA 1V5GA 3OS2A 3S32A 1QHHD 3LSIA 2R7VA 4KKUA 1E1QA 1DBGA 2ZSIB 2IGMA 2KRHA 3OYJA 4XD7A 1O8FA 3FPPA 3ZCOA 1JTAA 4XOTA 5LD2C 1FMVA 2XSJC 1W36C 3ZXSA 4UZUA 1O8JA 4Y4RA 3BCDA 3S3NA 3GBGA 4HRIA 2F5VA 3DPLC 2R7WA 2XC7A 2O04A 3KX2A 3OYCA 1WFXA 3CESA 3TMOA 1OLTA 3OYAA 2VKHA 1BR2A 4XN3A 3U21A 1VZ0A 2CV2A 4C2TA 3B90A 1JI8A 5CQEA 3HOTA 1VJSA 4Y33A 1YE9A 4BU2A 3ZPNA 2VIXA 5FL7A 1N75A 3HXLA 2XAUA 4XLFA 2IS2A 2VLAA 1O8HA 1OGOX 2Z8GA 4F55A 1MMAA 4B47A 3HAGA 1WJDA 1VBLA 2L9SA 3BCBA 3VYRB 2VBEA 2OUMA 2VQGA 4F91B 3OYNA 4W8TA 4CCNA 3K4LA 1T95A 3ZGKA 2P0WA 1O8EA 2V7FA 3AL0B 3GQ8A 3DTIA 3K70C 3PFYA 4JQFA 2XF5A 3VSUA 1UELB 1LDKB 4DK0A 1D1BA 4AVZA 3OY9A 3TL4X 2QKMB 2XNDA 2VQLA 4ANJA 3JU4A 3WQZA 1KCCA 5LFAA 4DIQA 2Z2SB 1H8HA 3QODA 3PNVA 2WY8Q 4OAZA 1IRXA 1ZELA 2RQQA 2ODLA 3GQ7A 4BEHB 3MKZA 2HZDA 3EQOA 3L2WA 2MFZA 2X53S 4H4KC 3OYIA 5CPRB 2D3NA 1DBOA 1EFRA 2F1MA 1FX0A 3SDBA 4BE0A 3GQ9A 4TKOB 3ZR8X 2AQEA 2ZSHB 3A1YA 2K5CA 4DK1A 4HPQA 4OZYA 3ZSCA 3WWGA 2IS4A 2XGJA 2NOJB 4XOPA 4HSTA 1NG7A 3MMYB 4NNJA 3OYLA 2BSPA 2PECA 4P1WA 5CQGA 2CUZA 3H0DA 4IX7A 4DGWB 2BW3B 3FY3A 5C1EA 3HUGB 1E3ZA 5CDFA 1O8LA 2VASA 2ELJA 3W2AA 4MLOA 3S3MA 1MABA 2QY1A 3HPHA 3UW0A 2A5WA 2BOLA 1WJEA 2RNGA 2FUG2 1E1RA 1NBMA 2OV7A 4EATA 2UVFA 3SEQA 2KRCA 2CMPA 4N4NB 4IQJA 3FKSA 4CCKA 3A4CA 4PMHA 4C2LA 2R7XA 5TGTA 1BR1A 3BG6A 3PUBA 2DOAA 1XG2A 4BEHA 4ZTFA 3CJRB 5FRNA 2KVOA 2PYHA 1Z3YA 3LMMA 2INUA 3L2QA 4BQNA 3ZPPA 3DEEA 1D1AA 3PSIA 4XKBA 4I84A 3L2VA 1PKVA 1D0XA 2KHMA 3VMWA 3K4BA 4XL9A 4CH7A 4HNTA 4E7HA 3IUOA 3UNGC 3OYHA 2LC2A 1T5EA 3QYBA 3S93A 3OYDA 2AQFA 2DT7B 4KJZA 3L2UA 3LNNA 2L7KA 3QYEA 4II3A 1W0KA 3OPOA 2ZZEA 5KCMA 3OW7A 1YX5A 4G6IA 3OWTA 3VYUB 5IK2A 1IDJA 3EPZA 1WP6A 2V4JC 2Q2EB 2V7QA 3F9KA 4BQQA 1EE6A 3DDYA 4NK6A 3FBIB 2UUZA 3OYKA 2V31A 1UD2A 3H9JA 4GRIA 3T9GA 2O17A 4CUGA 2IQ7A 2WB1A 2WJYA 3GQBA 2LBFA 1O8GA 3A3BA 1I8DA 3OMYA 3SZGA 3GVJA 1D0ZA 4QPOA 4U4BA 3DU6A 2X1EA 3CMMA 1X1CA 3I9V2 4XNFA 3KYLA 4OJPA 1KCDA 4ZDLA 1J09A 4LIUA 2W6IA 2JSPA 2NSPA 2KZVA 4ZTJA 1O8KA 2NZMA 3LSGA 1BHEA 1QU3A 1O8DA 1Y6IA 4YZ0A 3PNTA 4E6KG 3ZIAA 2M7AA 4B44A 3FHNA 2VL8A 2CW7A 4BGDA 3OL3A 2F6CA 3OOUA 4LIVA 2M7BA 3RSNA 3DPUA 4HSRA 4YELA 1YX3A 3D5SC 3CP2A 2DJIA 2VJ4A 3LSMA 2JJ1A 2XF6A 2ZTGA 3EUHC 3HOSA 3H5AA 1NHCA 4XKCA 2VXDA 3D5RC 3H5NA 1V5EA 5KHDA 4IKFA 1MNEA 2X3HA 3OYFA 1MNDA 3K6GA 1T0FC 2R7QA 4L8JA 3N05A 2M3AA 1UD8A 1OR7C 3H9GA 3VSKA 1PXZA 5AMVA 2I8DA 1KZLA 4FXUA 4PUSA 2V26A 1QCXA 3C2HA 2ZFUA 3G05A 2WADA 2K9MA 3KEWA 2W00A 4W8SA 1HVXA 4NUBA 4XLCA 4FASD 1NRKA 1Y56A 3HKZA 2XOKA 4MR0A 1AA7A 4XQFA 1SKYB 1W9XA 4D9JA 2DIEA 4DOZA 2EWEA 2W7NA 3OYBA 3UR3C 2JJ2A 3FKJA 3DKXA 3LFUA 3VSLA 2XZLA 4YXWA 1H80A 3SYTA 4PJJA 2JUGA 4CA0A 1MMNA 1OHHA 4PSWA 4KKSA 2O5RA 1WJBA 1V0FA 4U7BA 3LL7A 1G8XA 3A3GA 2HVSA 3VR6A 4E4HA 3VSVA 1N78A 3W2WA 4B3FX 4OJLA 1DGWY 2DT6A 5CKTA 2L5QA 4XORA 4RLFA 2HNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTP A;  4NK8 A;  4Z06 A;  2PYH A;  4XON A;  3VST A;  2INU A;  1IDK A;  1RU4 A;  4OJ6 A;  3ZPP A;  2VBK A;  2NST A;  4I84 A;  3B8Y A;  2INV A;  3VMW A;  4EW9 A;  4U49 A;  4XL9 A;  2NT9 A;  2VBM A;  1RMG A;  2NTB A;  1IA5 A;  3B4N A;  4MXN A;  2PYG A;  4XMY A;  1DBG A;  4XLH A;  1O8F A;  1HG8 A;  1JTA A;  4XOT A;  1IDJ A;  1O88 A;  2QXZ A;  1O8J A;  1EE6 A;  4NK6 A;  2X6Y A;  3T9G A;  1PE9 A;  2VJJ A;  4YZQ A;  2O04 A;  2O17 A;  2IQ7 A;  1O8G A;  4XN3 A;  1O8I A;  2O0W A;  3B90 A;  3SUC A;  4YEJ A;  4XM3 A;  4U4B A;  1OOC A;  1IB4 A;  2X85 A;  4XLF A;  4XNF A;  4XKW A;  1O8H A;  1OFL A;  1OGO X;  1RWR A;  2Z8G A;  4HWV A;  4OJP A;  1VBL A;  4OJO A;  1KCD A;  2NSP A;  2VBE A;  1O8K A;  2NZM A;  4W8T A;  1BHE A;  1O8D A;  3EQN A;  4YZ0 A;  1O8E A;  3VMV A;  3GQ8 A;  1WMR A;  4W8R A;  3VSU A;  4AVZ A;  4XN0 A;  4YZA A;  2VJI A;  4YEL A;  2QX3 A;  2X6X A;  1KCC A;  1OGM X;  1KTW A;  1X0C A;  1NHC A;  1CZF A;  4Z05 A;  1K5C A;  1AIR A;  4OJ5 A;  1GQ8 A;  4XKV A;  2X3H A;  4URR A;  2ODL A;  3GQ7 A;  2O1D A;  2NT6 A;  3EQO A;  3GQA A;  1BN8 A;  2UVE A;  1JRG A;  1PXZ A;  5AMV A;  1DBO A;  1QCX A;  5C1C A;  3GQ9 A;  4W8S A;  3ZSC A;  3LMW A;  4XLE A;  4OZY A;  4XLC A;  3WWG A;  4OZZ A;  4XR6 A;  4MR0 A;  4XOP A;  4XQF A;  2PEC A;  2BSP A;  2EWE A;  2NTQ A;  4W8Q A;  3GRH A;  1OFM A;  3FY3 A;  1QJV A;  1H80 A;  5C1E A;  3JUR A;  2O0V A;  4Z03 A;  1O8L A;  2QY1 A;  3UW0 A;  1PLU A;  4YZX A;  3VSV A;  2UVF A;  4OJL A;  4XLA A;  3KRG A;  4PMH A;  4C2L A;  4XOR A;  1O8M A;  1XG2 A;  2X6W A; 
#chains in the Genus database with same CATH topology
 3V42 A;  2M34 A;  4ZYA A;  4B3A A;  2O9L A;  1MMS A;  1HDP A;  3OEH A;  1V0E A;  4HE6 A;  2QTL A;  2MAB A;  1WZ2 A;  4EW9 A;  4ZCL A;  4DBR A;  2A6T A;  2HQN A;  4AC0 A;  5DD4 A;  2IT0 A;  1KYZ A;  2CWE A;  1D5V A;  1D8T A;  3OW2 B;  4A3J J;  3TO7 A;  4RDL A;  3JQQ A;  1VQ4 B;  4QPQ A;  1VQK B;  4KT5 C;  3H1C A;  1XQB A;  1L1I A;  3W2I A;  5GTI C;  3AKZ A;  5ERI A;  4NQW B;  2ESH A;  4V2G A;  3S14 J;  4RBO A;  3A35 A;  1HG8 A;  3B78 A;  4NC7 A;  2W4S A;  2Q1Z B;  2KIQ A;  2QCO A;  3KE2 A;  4C3H J;  2HLD A;  1TL8 A;  4G7X A;  3LA7 A;  5B66 C;  1YIJ I;  3T56 B;  2M0M A;  3TBI A;  5F0F A;  1VQK I;  2ZBU A;  5FRO A;  2V1X A;  1O3S A;  5J35 A;  3ZZ0 A;  4CCL A;  4P22 A;  4QSH A;  1VND A;  2ZJP F;  2CS3 A;  3CF5 F;  4YZQ A;  4KT6 A;  1Z05 A;  2VKD A;  1QA3 A;  3DBL B;  2NNY A;  3HOX J;  3I3L A;  1G59 A;  2DA3 A;  2CQN A;  3E0J B;  1K73 D;  3DEW A;  3MCA A;  1QVG B;  2F4I A;  3HUG A;  4FET A;  1X4P A;  1HST A;  4TSF A;  2K86 A;  2CUE A;  1SVL A;  3SZP A;  2CH0 A;  2I10 A;  3OR1 C;  5C4X J;  3SJZ A;  3MCZ A;  2GZW A;  1IHM A;  4Z4T A;  3ABT A;  1Z9C A;  2HCJ B;  4IPA A;  4P9U A;  3TED A;  4LG3 A;  4FX4 A;  1E3P A;  2HVQ A;  4G94 A;  3EUA A;  1YJW I;  2DFH A;  1G7C A;  4Z1M A;  3NAR A;  4ZC3 A;  1LPQ A;  3WGI A;  2GRE A;  2A61 A;  3E5Q A;  1FYK A;  2E35 A;  3ZN0 A;  4ASN A;  2R0Q C;  1N77 A;  4LB5 A;  1WTH D;  2MD0 A;  3AL0 C;  3Q9V A;  2M45 A;  3OYE A;  4GDF A;  1PJR A;  1EKE A;  3H94 A;  4PGH A;  4CXF A;  1N8R D;  4G6T B;  2QX3 A;  3DBH B;  1Z1D A;  4AM3 A;  2HYF A;  3D5L A;  2LLK A;  1F4K A;  2V9P A;  2E2I J;  1DU6 A;  5HXB A;  3V8J A;  5DN6 A;  3HJE A;  3CJQ B;  3VDX A;  2O1D A;  5FRM A;  5IYR A;  1BN8 A;  4LIT A;  5L3E A;  2DA1 A;  3GUD A;  2R92 J;  3J7A Y;  1E17 A;  5C4J J;  1KQ8 A;  4L0Z B;  4M72 A;  4BE2 A;  3DWL E;  2HYJ A;  5EGO A;  2BW3 A;  2LOO A;  3LMW A;  2DXI A;  4S04 A;  3EET A;  2DFE A;  1QGZ A;  4B3G A;  1S9H A;  4QTR A;  2VBT A;  2W7Z A;  3ML3 A;  2W6J A;  4F92 B;  3FZV A;  1HW1 A;  2R7D A;  4U0W A;  3Q5F A;  5GPC A;  4Z03 A;  3DF8 A;  4U7D A;  4BAY A;  4XID A;  5JVT A;  4MYT A;  1UHS A;  1F9N A;  3AG1 H;  1QVU A;  3JCU C;  5HDG A;  5JFR A;  5M3M J;  4ZCI A;  2J8I A;  1YLF A;  1W2B B;  1TWH J;  4Z4S A;  4E7S A;  3G4S I;  1JE8 A;  2PMZ A;  4OOI A;  4A3E J;  1JTX A;  4XLA A;  4GYG A;  3M1C A;  5HLI A;  3W2V A;  4HNV A;  3ZMT A;  1IN4 A;  1I5Z A;  2E1M C;  1E79 A;  3K4N A;  1BLI A;  1M1E B;  1X19 A;  1TTT A;  2QQ9 A;  3E1S A;  3CCS I;  1AHD P;  3FK6 A;  1WOR A;  3CZ6 A;  2DER A;  3E6M A;  4MFD A;  3J81 k;  2DYS H;  2DCE A;  1EV7 A;  5JLV C;  2VBK A;  1TWA J;  1K4Z A;  2HOE A;  4YFK F;  3PA1 A;  3HTS B;  2OC6 A;  3ASN H;  5IYP A;  1UD6 A;  3LSJ A;  2KIF A;  4U49 A;  2LNB A;  5D4S A;  3SYJ A;  4BL0 B;  4UUS B;  4A3L J;  4P9F A;  4EJU A;  3FMQ A;  5HZA A;  3VO2 A;  3FBN B;  4QVA A;  5HNH A;  2FOW A;  2ZFW A;  3TQN A;  1U8B A;  1ZM4 A;  1UD4 A;  2ESN A;  2GOM A;  2QXZ A;  3SJP A;  2X51 A;  1QRC A;  2W25 A;  5J4Y A;  1FIA A;  1SFX A;  1QRY A;  2PEX A;  2XAG A;  3ONQ A;  3PUF A;  4NB5 A;  2MC4 A;  4HAM A;  2M8E A;  4PJM A;  4NHJ A;  1O3Q A;  1NK3 P;  5ILV A;  4QVJ A;  2FBK A;  1B4A A;  4M6Y A;  3LSH A;  5L3F A;  4BNC A;  2QBY A;  1R49 A;  2L54 A;  4NC6 A;  5LEJ A;  2KMU A;  1B1B A;  4GQN A;  4EJW A;  3JRC A;  2HKX A;  1CQX A;  4I6Z A;  2IBD A;  5GV7 A;  3BY6 A;  3M8F A;  1MMG A;  2M4K A;  2E5N A;  3NQO A;  3GTJ J;  3F8F A;  4OPO A;  1IN7 A;  3JTG A;  1SD5 A;  3BG9 A;  1ZM3 A;  5J40 A;  3KP7 A;  2FVG A;  3ZMV A;  4WX9 A;  3GVK A;  3J7A O;  1QRB A;  3OKX A;  2ZJ2 A;  2CBX A;  3OOC A;  2M4G A;  1P9Q C;  3BTI A;  2XF7 A;  3RYP A;  1VQL I;  2JA8 J;  2F5C A;  2RRE A;  4Q47 A;  1Z21 A;  2QYO A;  4XRS G;  5HLT A;  1XSD A;  2HYG D;  1H9G A;  1X3U A;  4NDL A;  1ORK A;  2VYQ A;  1CZF A;  1K5C A;  1BI3 A;  3V8L A;  1AIR A;  4OJ5 A;  2ICW G;  2HTS A;  4J19 A;  4K2E A;  1RR7 A;  2NT6 A;  3QPS A;  2UXN A;  1K78 B;  1B9N A;  4BXX J;  1GVD A;  1L0O C;  1ZRC A;  3AVW A;  5KAF C;  1UAA A;  3TDU C;  1MMD A;  4KIT B;  1EF4 A;  1IXS B;  4A93 J;  1LM1 A;  1VQP B;  5F4M A;  3IC7 A;  2QA4 B;  1BR4 A;  1XG1 A;  2VPL A;  4B09 A;  2XT4 A;  2B0L A;  2MLG A;  2Z1D A;  3IRR A;  2F3L A;  3PSZ A;  2C6Y A;  3MZH A;  1K6O A;  2E1C A;  2M2E A;  5JLX A;  4RLQ A;  3CCQ B;  2L01 A;  4UUV A;  4OOS A;  2CRV A;  1BOB A;  4UXN A;  4HLY A;  2NS7 A;  3EUK L;  3CCV I;  4BHP A;  4IW3 B;  3RTR A;  5DUI A;  4LOC A;  2O3F A;  4BJ5 C;  2QWW A;  4PK4 A;  3KRG A;  3GTG J;  5IYD J;  5IYQ A;  2FF4 A;  4N4O B;  3VNU A;  5FLX K;  1JKP C;  3SXY A;  1KU9 A;  1WU8 A;  3Q3A A;  2NTP A;  3VFZ A;  2D3L A;  3VST A;  1XX5 A;  4XSZ F;  3ZMS A;  1KMH A;  1ETY A;  4II2 A;  3ONY A;  4HIZ A;  2YWH A;  4KIC A;  2NYX A;  3CC2 I;  4M9Z A;  2J5O A;  2I1L A;  2Z16 A;  2VBW A;  2NT9 A;  1H8A C;  3A02 A;  3GFJ A;  3HB9 A;  4BDZ A;  3GTP J;  2XNC A;  2NTB A;  1BW5 A;  4C43 A;  5D5X B;  3Q0U A;  2JRM A;  4NQW A;  1XCB A;  2ZSI B;  1FWZ A;  2IGM A;  3OYJ A;  2DMU A;  1VQO I;  2XAQ A;  5K5O A;  2DMP A;  4XOT A;  5LHH A;  1Q7Y D;  1FMV A;  2FXA A;  1W36 C;  4RD1 A;  4UZU A;  1P7J A;  2OBS A;  3BCD A;  2E7W A;  1X3W B;  2F5V A;  3GBG A;  4HRI A;  2LK2 A;  1VQO B;  3IH4 A;  4IRH A;  4TMZ A;  5FJ8 J;  5CLS A;  3OYC A;  3ELK A;  4FTH A;  1K8A D;  2DOD A;  2OD5 A;  2WTE A;  3U21 A;  1GDT A;  1OQY A;  5EGO B;  1JI8 A;  3HOT A;  1ZGA A;  5EJC A;  1EFC A;  1HKQ A;  4BU2 A;  3AG3 H;  3SHF A;  1N75 A;  4DYC A;  5FL7 A;  4KYW A;  1G7R A;  4P25 A;  2Z8G A;  3A01 B;  5GPA A;  4F55 A;  5AIQ A;  4B47 A;  4A3G J;  1VBL A;  3BCB A;  3VYR B;  3BRO A;  2GIZ A;  1J5Y A;  1QPI A;  2VBE A;  4OMY A;  4W8T A;  3PM1 A;  4CCN A;  2P0W A;  2HOS A;  1PJ6 A;  3AL0 B;  3IRQ A;  4JQF A;  5FD6 A;  2NS8 A;  3T8T A;  3GXO A;  2M9H A;  1MGT A;  4AVZ A;  4OOV A;  5K7Z A;  2OQR A;  4QWQ A;  3CCQ I;  1JUS A;  1LLZ A;  1DAR A;  1Q86 D;  5TJJ A;  1IUF A;  1QGY A;  3WQZ A;  3HOW J;  3GME A;  4RAF A;  4RA2 A;  2V7W A;  1EJ9 A;  2MW8 A;  5H2F C;  2WY8 Q;  5E8I A;  1ZEL A;  4BEH B;  3GYH X;  3WTY C;  2E36 A;  2X53 S;  4LG0 A;  4L9J A;  4BXU A;  3QU6 A;  6PAX A;  4HYE A;  2D3N A;  3O2P E;  2VBX A;  2CGP A;  2X4H A;  2O8K A;  4G6D A;  4BE0 A;  4KUM A;  5IYW A;  3SZT A;  4TKO B;  3ZR8 X;  4DQ2 A;  1PP8 F;  3C7J A;  4HPQ A;  1YIO A;  4ETS A;  3F22 A;  4KNY A;  4I02 A;  1FND A;  4I09 A;  4PC1 A;  1UFM A;  2HOA A;  3TKY A;  4HST A;  1NG7 A;  2XAS A;  4MTE A;  3OSF A;  1DDG A;  4P1W A;  1R23 A;  5CQG A;  2B63 J;  3LO8 A;  3MHP A;  4B4D A;  4UZE A;  4DGW B;  3D26 A;  4Y13 A;  1XB4 A;  1IRZ A;  4A0X A;  1TTY A;  2K3F A;  3M9A A;  2K85 A;  1W4M A;  2N8G A;  5BPD A;  5CDF A;  3I71 A;  1S72 B;  3S3M A;  1T33 A;  3HPH A;  2A5W A;  1WJE A;  5J47 A;  2BXY A;  2XNJ A;  1QO0 D;  4EAT A;  3DCF A;  1FOW A;  4M73 A;  4G1B A;  1BW6 A;  3VMF A;  3ASP A;  2JPC A;  2KRC A;  3L1P A;  3CCM I;  2DA4 A;  2QEX I;  2BE5 F;  5BNG A;  1RKW A;  4HF1 A;  4ZYH A;  4YDT A;  1IZ1 A;  2DOA A;  5EYR A;  2ELK A;  4KN7 X;  4RD2 A;  3ESW B;  1DAB A;  3CJR B;  3SQV A;  2PYH A;  1W7P D;  5DS0 A;  2GXG A;  2BHZ A;  1JUP A;  3DEE A;  2A3S A;  1D1A A;  3PSI A;  4D7N A;  1JUM A;  3VMW A;  5GAH J;  4XL9 A;  2VUM J;  3H9N A;  1VQ8 I;  4E7H A;  4BY7 J;  3IUO A;  4IEJ A;  3UNG C;  4CO8 A;  1H42 A;  5JVG F;  1K79 A;  3OYH A;  1F20 A;  2OCE A;  2X3U A;  1T5E A;  1KGS A;  1B23 P;  3QYB A;  2K9N A;  2DT7 B;  4Q4Z F;  2KIM A;  2FSW A;  3CO7 C;  3QYE A;  2VE9 A;  1W0K A;  5TRD A;  1FNB A;  3OPO A;  2R93 J;  3WHB A;  1HOM A;  1R1V A;  5IYN A;  1YX5 A;  3KP2 A;  4D0P A;  3VYU B;  2M5W A;  2DYI A;  3EPZ A;  2V4J C;  1AMO A;  2Q2E B;  1U2R A;  3A0H C;  1Y0Y A;  4PC7 A;  5JMC B;  2BM7 A;  1QA1 A;  2OBP A;  4NK6 A;  2Y75 A;  1GVH A;  2V31 A;  4UVA A;  1M1K D;  3SLN A;  1MJB A;  3X2Q H;  4M9X A;  1ITY A;  1T0F A;  2WB1 A;  3CCU I;  1OGI A;  3GQB A;  1UMQ A;  2CG4 A;  3S2W A;  1Z0X A;  2CYY A;  1T6S A;  3WG7 H;  4QPO A;  3AG2 H;  1E3H A;  2EQR A;  2PMU A;  1OFD A;  2JA7 J;  3CCJ I;  4L18 B;  2AS5 F;  4G5G A;  3U2Q A;  3ERE D;  1U5T A;  2C4T A;  1BHE A;  3K7A J;  3T5X A;  3FXL A;  2M7A A;  4I98 B;  1LQ1 A;  1CQT A;  2C5B A;  3FHN A;  2VL8 A;  2DOG A;  1B9M A;  3LQR A;  2WR8 A;  3KP5 A;  1YLO A;  4BGD A;  5KK1 A;  1U5T C;  1YS7 A;  2M7B A;  3K2A A;  4RAY A;  4QIW N;  2XF6 A;  3F8C A;  4LJZ F;  2JJ1 A;  3ZC3 A;  4Z4Z A;  3HOS A;  1WQ2 A;  1KD1 D;  1G7S A;  2VXD A;  1CLW A;  3F8B A;  1ETW A;  3D5R C;  3H5N A;  4GXO A;  1RPW A;  2M87 A;  1DP7 P;  3DP7 A;  2XGX A;  2DMQ A;  4X7E A;  1P4A A;  3JRE A;  2H09 A;  1OCZ H;  1G4D A;  2R7Q A;  1A8P A;  1Q1H A;  3N05 A;  1J7K A;  3TH0 A;  1PXZ A;  3BH7 B;  3BZ6 A;  1KZL A;  1I3Q J;  4FXU A;  3CW2 A;  2NAZ A;  2L9R A;  1OYI A;  2QA4 I;  1VQ9 B;  1QCX A;  3AVU A;  2WAD A;  1W0U A;  2GA2 A;  2K9M A;  3JAM Z;  1HVX A;  1QUF A;  1A5J A;  2FML A;  3L9F A;  1MJ9 A;  5CVI A;  3HTU A;  2XOK A;  4MR0 A;  3KP4 A;  1AA7 A;  1SKY B;  3I59 B;  4D9J A;  2VBZ A;  4DOZ A;  3CC7 B;  1MKM A;  3REO A;  2EWE A;  2X9D A;  1OCR H;  4XLP F;  1E3O C;  3VSL A;  3ZQC A;  3O6B B;  3V76 A;  2XZL A;  4XRF A;  5FLV A;  3SYT A;  4PJJ A;  1IRG A;  5K1Y A;  3D1N I;  1HLV A;  2VT3 A;  1TQI A;  2ISZ A;  2EBI A;  4U7B A;  4LC0 A;  1HXD A;  3A3G A;  2Y48 A;  5E17 F;  3CCE I;  4FCY A;  2K4J A;  3ZUG A;  3W2W A;  5J3O A;  2O03 A;  1EP3 B;  2BX6 A;  4P26 A;  1FRQ A;  1BIB A;  2YU9 J;  3BTL A;  4XOR A;  2VFN A;  4KDP A;  4MEX F;  4DQK A;  2XTX A;  2JJ7 A;  2HNH A;  2P81 A;  2LYC A;  3WU0 A;  1VQM B;  3HHG A;  5HS8 A;  3K4C A;  4FIS A;  4PJ0 C;  3CCL I;  3Q3S A;  3JRH A;  3HRU A;  3RKY A;  4ROX A;  2ZKZ A;  2ACJ A;  4LLL A;  5FIU A;  4F93 B;  3ZQQ A;  1ON2 A;  4AIK A;  1BPL A;  1R58 A;  2BGC A;  2ZJR F;  4LGW A;  2ID3 A;  3B4N A;  1BX0 A;  3A1P A;  2R3S A;  4E7L A;  4LLN A;  3KLO A;  4C2U A;  2PYG A;  3LVB A;  1H9T A;  3S8P A;  5E6T A;  2M5S A;  1BBY A;  1P6R A;  4PC6 A;  3H09 A;  3CF2 A;  2PJR B;  2GAU A;  2LG4 A;  2VKV A;  4P2N A;  3R4K A;  4BUP A;  2EFQ A;  1KON A;  4XIC A;  2XB5 A;  2C78 A;  4X06 A;  1YRN A;  2JUC A;  1JHH A;  1F60 A;  4IVN A;  2BSA A;  4OP7 A;  2Z99 A;  2BV3 A;  5DNS A;  2ZXW H;  4B8X A;  2EV6 A;  2JVG A;  3JRF A;  3OAA A;  1GLN A;  4ON0 A;  3G2B A;  2BVM A;  4HF0 A;  1W36 D;  1Y1V J;  4ACB A;  3SEZ A;  3MWM A;  5DCM A;  2MG4 A;  4XM3 A;  1OYY A;  2FMY A;  3TO9 A;  3CLQ A;  1GHC A;  1ZHF A;  5JHF A;  1UB9 A;  1MBG A;  5GAE J;  1FYM A;  1KK1 A;  1VQ7 B;  4OJO A;  4EM0 B;  3F3X A;  3I4M J;  5FKM A;  1CF7 A;  2H6C A;  1HW2 A;  3KPH A;  1NTC A;  3UKG A;  3EQN A;  4E0F A;  2WA0 A;  4HZF A;  1MBH A;  3VMV A;  2AHO A;  2XAJ A;  1HZE A;  1WMR A;  3GTK J;  4M3G A;  5F6F A;  2XKO A;  4A3M J;  3OR2 C;  4UB6 C;  3WGH A;  4W97 A;  1EWY A;  4ZDP A;  3TOB A;  4Q48 A;  2LY9 A;  2K02 A;  4DNR B;  3FDY A;  5E3L A;  1N25 A;  4MFE A;  1FDR A;  5L3B A;  1FX7 A;  2KJC A;  1EA0 A;  4E7K A;  4ENK A;  2QEN A;  1HA3 A;  3J7Y J;  3QSY A;  4TN1 A;  2VFP A;  2WY7 Q;  2CFO A;  1L3L A;  3CME I;  1X2M A;  5EMN A;  1KC8 D;  4EVI A;  3HOZ J;  2UXX A;  3COA C;  2ZBV A;  3GQA A;  1R5O A;  3I56 I;  2V6E A;  4MTD A;  1LFU P;  3RPQ A;  3SEJ A;  1MDM B;  3GTM J;  2C4U A;  3WTT C;  2Y0S A;  3GTL J;  3WND A;  3BR5 A;  2EIJ H;  4BY1 J;  4UVB A;  1LLW A;  1MRZ A;  1YIJ B;  2KRF A;  4CCM A;  3A8J A;  2FX0 A;  2DFF A;  3CMY A;  1BJK A;  2CQQ A;  2E1O A;  1NG6 A;  1KQS B;  4Y7N J;  2YR2 A;  2BM1 A;  1MW7 A;  2ZNZ A;  1MBK A;  5LBQ A;  2R7T A;  2KDZ A;  2A68 F;  3QOP A;  3K4M A;  2JN9 A;  3IWF A;  4ZZL A;  5E3N A;  2XSD C;  2CO5 A;  4TT3 A;  4DQL A;  5A2Q K;  3GVA A;  4A6D A;  3OP1 A;  4IHS A;  3JQR A;  4YG2 F;  1D1C A;  5F1J A;  1I18 A;  4I2O A;  3G6E I;  3BTC A;  2A07 F;  2FD5 A;  2QE7 A;  5BOX A;  3LOC A;  4RB2 C;  2KPM A;  3BTJ A;  4LFU A;  3NAU A;  1YJW B;  4I99 C;  3DTK A;  2DO7 A;  2IXS A;  1U8R A;  3PA2 A;  5LGT A;  4L9N A;  5F27 A;  3MKY B;  1RU4 A;  1ZAR A;  4CYD A;  4DJA A;  2F43 A;  1YO5 C;  2EFN A;  2Y30 A;  2OF7 A;  2FU4 A;  4JYK A;  2HVR A;  2CRG A;  5EZH A;  3B8Y A;  1XN7 A;  2OPT A;  3ERM A;  1WRJ A;  1TT0 A;  1VQ7 I;  4HEA 2;  4X6A J;  4RAG A;  1RMG A;  4P5O A;  1Y39 A;  1ZTR A;  4WZT A;  1S72 I;  1W87 A;  2JA2 A;  3W5V A;  4KIB A;  4MGR A;  4XMY A;  2EV0 A;  4DBQ A;  3V7A A;  1LVK A;  4XLH A;  1I50 J;  1LJ9 A;  3FXR A;  4PFP A;  3GEZ A;  4RGX A;  3LQQ A;  3I53 A;  3GVL A;  2YS9 A;  4C2M J;  5HLG A;  2L4A A;  3H92 A;  3RYR A;  2HPI A;  1HF0 A;  2G0E A;  2DMT A;  5J1R A;  2Y9Y A;  1FP2 A;  1ZLK A;  4KIS A;  2L3D A;  2KJB A;  1SVM A;  2OTL B;  3M07 A;  2HU9 A;  2XAF A;  2LMD A;  1OCT C;  4EV0 A;  2O0W A;  1QVF B;  3VYT B;  3SUC A;  3LA2 A;  2DDA A;  2L4M A;  3K1P A;  3OEE A;  1IB4 A;  4MQV A;  2X85 A;  5B1B H;  3WHC A;  4HBL A;  4XBF A;  4R1H A;  1ONV A;  4L5I A;  2LTP A;  4A3F J;  1FOK A;  3I59 A;  4PGG A;  1RWR A;  3BCF A;  4A12 A;  2P7V B;  2IGK A;  2LY1 A;  1YHQ I;  4PCQ A;  3CXC B;  1ZKG A;  3KCC A;  2MBF A;  3M7G A;  1FLI A;  4CGZ A;  1FY7 A;  2CU7 A;  5BPI A;  2D1V A;  1XB2 A;  4EH1 A;  1H88 C;  4JK1 X;  4JX6 A;  1KA8 A;  3RQ4 A;  5H6Q A;  1UHW A;  3U6B A;  3GFI A;  2NRA C;  3KEY A;  1OB5 A;  2X6X A;  1TSP A;  1MJA A;  2OU2 A;  1OGM X;  4NBS A;  3RCO A;  1T6Y A;  2Q6O A;  4D7M A;  4Z4R A;  2EFW A;  3AVX A;  2TRT A;  1KQ5 A;  1R9T J;  2Q6I A;  2GK6 A;  4TMX A;  3MKW B;  2HTJ A;  2J8K A;  1GQ8 A;  1O3T A;  2C2W A;  2C77 A;  5GAD J;  2ZME C;  2ZZF A;  1X1D A;  1VQ9 I;  2CC2 A;  2WZP P;  5LEK A;  5HNF A;  5H5J A;  4JOM A;  2DOE A;  3H9Q A;  4PC2 A;  1QHG A;  1HF2 A;  3BC8 A;  2BM4 A;  1S3J A;  4KIF A;  1BOA A;  2E19 A;  5A89 A;  2G9W A;  2CUF A;  4F3Q A;  3ZQF A;  5K5Q A;  2Q6K A;  1M90 D;  1OR7 A;  5HDK A;  4W8Q A;  2P5V A;  4KN4 X;  3GRH A;  1ZK8 A;  3PIO F;  1E0E A;  2IEK A;  1RES A;  4HNU A;  3MVP A;  5FO5 A;  4BJT A;  4F52 A;  2IS6 A;  2QMU A;  4KKT A;  3BH6 B;  2ZZG A;  1KU2 A;  1X1B A;  4HV6 A;  2WAQ A;  3BG7 A;  3DBR B;  3HPG A;  5CJ9 A;  3VYS B;  4IHW A;  2D9R A;  2JN6 A;  1YW9 A;  2GXB A;  3T51 B;  2HI3 A;  4ZGN B;  4RAZ A;  1TP4 A;  4QFM A;  4IQ4 A;  1RR8 C;  4P6Y A;  4LMY A;  2DDB A;  1Y0U A;  2ETH A;  4RGS A;  2ME6 A;  4Z6Y A;  3KEQ A;  3JTH A;  1ZG5 A;  2GPJ A;  3K9T A;  2O6W A;  3OZV A;  1XMK A;  1A35 A;  2NVT J;  3R6K A;  4O3M A;  1SC7 A;  3DFG A;  2IS1 A;  2EK5 A;  2F4M B;  5CYV A;  1ZLJ A;  4IF4 A;  2PJP A;  3GSI A;  4N3N A;  2L9V A;  1LE8 B;  2VKE A;  1A04 A;  1CGP A;  2OYN A;  1TVC A;  3WNB A;  3BR3 A;  1ZG3 A;  1MD0 A;  3KYD B;  4ZYG A;  1QHH D;  1S8N A;  2FQ3 A;  3ZQI A;  4A0Z A;  1E1Q A;  3B8H A;  2CND A;  2YUS A;  3C3W A;  1CNF A;  5J6X A;  1T08 B;  3ASS A;  1LE8 A;  3WNC A;  1JTA A;  2ZXJ A;  5LD2 C;  2K9S A;  1S7A A;  1WXR A;  2XSJ C;  1PDN C;  4M3E A;  3FHZ A;  1JA1 A;  2G0Y A;  2FA5 A;  2K27 A;  3W5U A;  1ODD A;  1ZG1 A;  3S15 J;  1OCO H;  2XC7 A;  4ZYE A;  3JSP A;  1WFX A;  3CES A;  3TMO A;  1OLT A;  1MBE A;  3OYA A;  1BR2 A;  4XN3 A;  1A36 A;  1VZ0 A;  1QVT A;  4C2T A;  3H3V K;  4M3F A;  3LSP A;  4M1K A;  2YWF A;  4Y52 J;  2VOD A;  1YE9 A;  3ZPN A;  1X3Z B;  2VIX A;  3O8G A;  4XLF A;  1NK2 P;  2IS2 A;  1O8H A;  3BR0 A;  2PMD A;  4EJT A;  3Q0W A;  1MSE C;  5F64 A;  4OU0 A;  2VQG A;  3OYN A;  4U9U A;  5BSY A;  5FKL A;  3K4L A;  2VT2 A;  5DEQ A;  2DPU A;  1O8E A;  3K70 C;  5ICF A;  3AG4 H;  3CUQ C;  2XF5 A;  1LEB A;  3E5X A;  3PQK A;  3VNV A;  3VSU A;  1LDK B;  1YFH A;  2KT0 A;  3W5H A;  2R5Z B;  3KL9 A;  5FA6 A;  4AYB N;  1PJ7 A;  4L0Y B;  2VQL A;  2VBY A;  2XND A;  4Y15 A;  3JU4 A;  2MH9 A;  3ROU A;  2O61 A;  1P92 A;  2P5K A;  5TR9 A;  1KCC A;  5LFA A;  4DIQ A;  2WAQ N;  2Z2S B;  1I6H J;  3QOD A;  2F5D A;  1WSR A;  1IF1 A;  1E64 A;  4RDU A;  4OAZ A;  2QUF A;  1IRX A;  4GYI A;  4YAF A;  3GQ7 A;  1MBF A;  1B8I A;  1OJL A;  2K7L A;  1FOY A;  1IUY A;  4CHU A;  3PO3 J;  3N97 A;  2VZL A;  3G3Z A;  4QHY A;  5F4J A;  3JSO A;  4PDK A;  5LGN A;  4AVP A;  2H94 A;  1N05 A;  1EH8 A;  1V55 H;  3WGG A;  1VQP I;  1B8I B;  3A1Y A;  3C2B A;  5BQT A;  4AC9 A;  1K61 A;  2P8T A;  5EDN A;  2J5P A;  3WWG A;  2NOJ B;  1XPX A;  2HS5 A;  3I58 A;  1FP1 D;  2KZG A;  3MMY B;  3HRT A;  3U2R A;  5IOY A;  2L7Z A;  2BSP A;  2PEC A;  3QFT A;  4IX7 A;  3S16 J;  1QX4 A;  2PQ8 A;  2XRL A;  3E5U A;  3HUG B;  1FYL A;  3ZQ7 A;  2X0L A;  1E3Z A;  1ZRE A;  4D5C A;  2VAS A;  2ELJ A;  2DOF A;  5F0C A;  3GZ6 A;  3W2A A;  2VBU A;  1D8K A;  2ZJQ F;  2V9V A;  1KRH A;  5B3S H;  2RNG A;  1E1R A;  4L9V A;  2ZCW A;  5JHU A;  2D2W A;  4N4N B;  3TGN A;  1F5T A;  2EIN H;  4IQJ A;  5CVR A;  2Y0M A;  4C2L A;  2QQB A;  3SQN A;  5TGT A;  3BG6 A;  3PUB A;  2LP0 A;  5J1Y A;  4ZTF A;  3QE2 A;  5FRN A;  5M5W J;  3CDI A;  3LMM A;  5THX A;  2INU A;  3L2Q A;  2LKX A;  3HRM A;  2BGI A;  2W48 A;  1FEX A;  2ID6 A;  4I84 A;  5C3E J;  4H0E A;  3K4B A;  4CH7 A;  1SKQ A;  2CFX A;  2H6B A;  3CDH A;  2F2E A;  5E1X A;  1DPR A;  3WTS C;  5A88 A;  1VQ5 B;  2CQ7 A;  2W24 A;  1E63 A;  4RD4 A;  3BR1 A;  1X1P A;  3S93 A;  1SFO J;  4XSX F;  4QLC U;  5ICG A;  3L2U A;  2KKO A;  2L7K A;  3FKI J;  2E1N A;  3CO6 C;  4II3 A;  4P1V A;  4RD3 A;  3PIP F;  4BBR J;  2CW0 F;  5KCM A;  2EB7 A;  5BS6 A;  4G6I A;  2XGC A;  3TP0 A;  4A5N A;  1S4M A;  5TV2 A;  2BBY A;  2DLL A;  1WP6 A;  2V7Q A;  5BSX A;  2PFB A;  1EE6 A;  1R5G A;  2UUZ A;  2A5Y B;  2ZB9 A;  3H9J A;  2P4W A;  3O3K A;  1OPC A;  2E71 A;  3DXJ F;  1T39 A;  2IQ7 A;  2WJY A;  4Z4Y A;  2XPW A;  3ZMZ A;  4HF2 A;  1RRJ A;  3K69 A;  3PQJ A;  2CJJ A;  2XEX A;  3SZG A;  2FJ1 A;  1LNW A;  4U4B A;  1YTY A;  3I9V 2;  3Q38 A;  1KU7 A;  2YWG A;  3FWE A;  4OOX A;  4YII A;  4ZDL A;  1J09 A;  5KAI C;  2NSP A;  1IJE A;  2KZV A;  4IRG A;  1O8K A;  3LSG A;  1DDI A;  4YZ0 A;  3PNT A;  5DM6 F;  1JXS A;  1FNN A;  3ZIA A;  5E3M A;  4B44 A;  1UJ8 A;  3LWF A;  3OL3 A;  3RKX A;  2F6C A;  3OOU A;  2P6S A;  2BY1 A;  2QZ8 A;  3ZP5 A;  3DPU A;  2OTL I;  1YX3 A;  3HBL A;  3CP2 A;  5D4R A;  3ABK H;  3LSM A;  2ZTG A;  1BC8 C;  3EUH C;  2OJE D;  4MEY F;  1YIT I;  3QAH A;  2R5Z A;  2DBB A;  1Y0N A;  3IH2 A;  5KHD A;  3T0Y A;  1MNE A;  1T56 A;  4IKF A;  2DY1 A;  3RKW A;  3OYF A;  2WV1 A;  4KFC A;  3WXM A;  3K6G A;  3OOP A;  2VNK A;  2W84 A;  4MHG A;  1OR7 C;  2V26 A;  3C2H A;  5JLW A;  3KEW A;  3CPX A;  5F1R A;  1NB9 A;  3LAP A;  4XLC A;  1F36 A;  3CUO A;  4J0Q A;  4GCV A;  4ABZ A;  3BPV A;  2W7N A;  3OYB A;  3NEU A;  4RS8 A;  1GV5 A;  3QRF F;  2QN6 A;  3FKJ A;  1O3R A;  3LFU A;  1H80 A;  1ETV A;  4RJL A;  2JUG A;  1MMN A;  4BBS J;  4L5E A;  2A69 F;  1OYW A;  2BN4 A;  1FTZ A;  1LDJ A;  5CVJ A;  1G8X A;  5J3L A;  3Q6R A;  1KJZ A;  2CSO A;  1DDN A;  1V4R A;  2XVC A;  2DQL A;  2DAO A;  2EFP A;  1DGW Y;  1ENH A;  1YQA A;  3S1R J;  4HDU A;  3CCL B;  4WQM A;  4B1R A;  2WB1 N;  1YG2 A;  1JJ6 C;  1QFY A;  4MQ9 F;  2K9Q A;  1TNS A;  1AWC A;  3J81 Z;  5LRR A;  3AAF A;  4N9H A;  1IXR C;  1U9O A;  2OZU A;  3ZZT A;  4R79 A;  3WBK A;  2HWV A;  3L09 A;  3TP3 A;  5IYC J;  2R9V A;  3F6V A;  1IRF A;  2GQQ A;  3G4S B;  3S1N J;  1GT0 C;  1XDS A;  1YJ9 I;  3Q9S A;  3IP4 B;  1BM9 A;  1GAQ A;  4JRA C;  1JTY A;  1WH5 A;  3BLY A;  1XS9 A;  3RZO J;  4CIC A;  1FSH A;  2GJP A;  4EJO A;  2CV1 A;  3ZBU A;  3I55 B;  1HKT A;  3CCU B;  5HOO A;  3WYA A;  2V5I A;  1Y8Q B;  1QNT A;  2W82 A;  3GO5 A;  4RCY A;  3GCM A;  1XGS A;  5EEA A;  3K2Z A;  2VBS A;  1GUU A;  3KP3 A;  1IV6 A;  5F0H A;  1XFO A;  3HHH A;  2R7R A;  2BM0 A;  5JBQ A;  4RB3 C;  1G3S A;  2E5Z A;  3C2G A;  1S0U A;  5DS9 A;  2M8G X;  3ECH A;  1F1Z A;  2DMN A;  3Q39 A;  3T53 B;  2VJJ A;  3WY9 A;  1C0W A;  1DGR M;  4A3I J;  2KFD A;  2KDO A;  2YX7 A;  4OAY A;  1WI3 A;  1ZYR F;  4BYY A;  3DLL F;  3E6C C;  4I7H A;  1B72 B;  3PUN A;  1F43 A;  1EH6 A;  1Z7U A;  2L02 A;  2R7U A;  1SD7 A;  2RC5 A;  3WE2 A;  4B48 A;  4LBZ A;  2VQH A;  4D1Q A;  2QZA A;  3HC7 A;  2E1M B;  3BQJ A;  3K0L A;  3B6C A;  1HSJ A;  2VB6 A;  3EYY A;  1EP2 B;  2ZC2 A;  1RKT A;  1D0Y A;  1P4M A;  4TMW A;  1BA5 A;  3OIO A;  1U9N A;  2PBI A;  2ZZQ A;  1JB9 A;  3HDD A;  4L9T A;  3HG9 A;  5IP9 J;  1HC8 A;  3V8K A;  2LFB A;  4J00 A;  1BL0 A;  1KK0 A;  2XRN A;  3BJ6 A;  1DP3 A;  1KK3 A;  2LRE A;  2R7S A;  3DQV C;  4LD5 A;  1YOV B;  4XN0 A;  2VJI A;  1W34 A;  4YZA A;  2VNI A;  1WOS A;  1BC7 C;  2JDI A;  3OFN A;  3FMS A;  5C44 J;  3GLX A;  4Y17 A;  2YPR A;  4C30 A;  3S1Q J;  3BG3 A;  1U2W A;  2UV1 A;  5IYB J;  4Y3O A;  1V3F A;  1IN8 A;  2R4G A;  2HQ5 A;  2JVH A;  2PE3 A;  5HKK A;  1WGX A;  2V1N A;  3EYI A;  1VQN I;  4PAB A;  1CNE A;  5DDG A;  2X48 A;  1BI0 A;  3DTE A;  4M71 A;  2IP2 A;  1K78 A;  2J7K A;  4OPS A;  1MDM A;  5LGU A;  4D5F A;  1ZRF A;  1ETX A;  1O7L A;  4BJ6 C;  1LFP A;  4LK1 F;  1Q82 D;  5E18 F;  1VLY A;  1RIO H;  3B02 A;  1BN5 A;  3RQI A;  4KA4 A;  1BJZ A;  1B6A A;  4XLE A;  1VQN B;  2EIM H;  2FQ4 A;  2XKP A;  1UG0 A;  3P7N A;  4ESB A;  2GIV A;  1D5Y A;  1UD5 A;  3AFH A;  4EJV A;  1FC3 A;  2ZXI A;  1TYX A;  1YJ9 B;  2GBY A;  3BCA A;  4GGG A;  4RM2 A;  4TMT A;  1LKX A;  1K6Y A;  3G71 B;  4M2L A;  3JW4 A;  1OFM A;  3ZOB A;  1EFT A;  2QSF X;  2RN7 A;  3ZRG A;  4ESJ A;  1OB2 A;  1TWG J;  4LBY A;  3RPU D;  2WPD A;  5L3D A;  2BZT A;  3HSE A;  5H20 A;  2VNH A;  1YI2 B;  3FXQ A;  4ZJZ A;  2GLO A;  1MZB A;  1TBX A;  2CV0 A;  2Q0O A;  2NPF A;  4OIN F;  2FBI A;  4AU7 A;  4RB1 A;  4WXD A;  4U88 A;  3SZE A;  2B7C A;  4X1E A;  5F4O A;  4YFX F;  4XON A;  2EPF A;  1V5F A;  5E8G A;  4Z06 A;  1QGA A;  4OJ6 A;  3SLD A;  2NST A;  4FE4 A;  4UVC A;  3GZN B;  4A3C J;  2JQ7 A;  3CC7 I;  2PI0 A;  3E97 A;  3I54 A;  2ADU A;  4PJL A;  4Y7C A;  1IA5 A;  3F0C A;  4CZC A;  5JR3 A;  1I1S A;  1NHA A;  3L7W A;  1RI7 A;  4MXN A;  2GJR A;  5FGM A;  2JRT A;  3LSR A;  2QLZ A;  3LSK A;  5L3C A;  2PJR A;  4HG2 A;  4RGU A;  3M4O J;  2XC1 A;  2DU9 A;  2W85 A;  2KQR A;  1O88 A;  1WJC A;  3BY1 A;  5FKK A;  1BX1 A;  3DU5 A;  2CK3 A;  3QPH A;  2ZXH A;  4HQM A;  5KNL A;  4HLX A;  3WU2 C;  2JIZ A;  2OCC H;  1J2X A;  1VTN C;  2B0R A;  1UD3 A;  2FBH A;  1I7P A;  1RQR A;  3H0G J;  2BYV E;  3TOA A;  3I4P A;  3H5R A;  3HL2 A;  1JT0 A;  4ASU A;  1OMI A;  1GAW A;  2OK8 A;  2QQA A;  3QQA A;  4M6V A;  2QKL B;  3CUQ A;  1ZH5 A;  4XKW A;  2A05 A;  1OFL A;  1YYV A;  4FT8 A;  4HWV A;  5A8A A;  2BY3 A;  5ILS A;  1U78 A;  3W2H A;  1I6X A;  1QH0 A;  4UZF A;  2KL4 A;  3K10 A;  2QYU A;  4U87 A;  4Z2Y A;  3F8N A;  1A31 A;  2EA2 A;  1HCR A;  3VWB A;  4WZK A;  3ECO A;  3OL4 A;  2BF4 A;  4Q7J B;  4C9Y A;  3G6E B;  2JK3 A;  2P5L C;  3P26 A;  4RD0 A;  1H8E A;  2EA4 A;  4X8I A;  3TO6 A;  3E6D A;  3J81 K;  2OBT A;  1T2K A;  2DJN A;  1Z7L A;  5KVR A;  2YX4 A;  3CCY A;  1J9Z A;  4A6E A;  2MA3 A;  4JMQ A;  4BDY A;  1KTW A;  2X6O A;  4HOB A;  2NVY J;  4IOC F;  4YHB A;  1LVA A;  3R6J A;  2K3P A;  3WE3 A;  3W6K B;  4Z05 A;  1WJ5 A;  4LBW A;  2LR8 A;  4HV5 A;  1NDH A;  3MFK A;  1IB0 A;  2GJK A;  5F04 A;  4DNC A;  4DYR A;  3CQZ J;  1TW3 A;  3C1D A;  2NS0 A;  1PVE A;  4AYB A;  4HQE A;  3G1O A;  4N0B A;  2XDV A;  2H27 A;  1PYV A;  4RM3 A;  9ANT A;  1S7O A;  2VQC A;  2ZTN A;  4X7F A;  4HX8 A;  5C1C A;  1FMW A;  1QZE A;  3PUM A;  3RY8 A;  3MKL A;  3K70 D;  3OJW A;  3HIF A;  4XR6 A;  4YRV A;  4A3B J;  3RIQ A;  5KW9 A;  3PO2 J;  3BPX A;  2OQG A;  4CYC B;  1VQ6 B;  2RNJ A;  3JRD A;  3IHU A;  2X1D A;  3ZN1 A;  3SKB A;  4AF7 A;  1XC5 A;  3CJN A;  3ISP A;  2QSH X;  3FM3 A;  1ZGJ A;  2V7T A;  4ESF A;  1ZQ3 P;  1G3Y A;  4IJA A;  5BMZ A;  3LYC A;  1O4X A;  2C5H A;  2BVL A;  1UST A;  5LMZ A;  1DG1 G;  1JA0 A;  1PLU A;  3FIW A;  1X1A A;  4UV8 A;  4N9I A;  4DZJ A;  4MNU A;  4A3D J;  5H6R A;  2B7E A;  2LF7 A;  4BHB A;  1ZRD A;  1CF7 B;  3FF5 A;  3FXO A;  4CDG A;  4ITV A;  2LH9 A;  3DKY A;  1ERD A;  1WPK A;  1QFZ A;  3Q0V A;  4A0Y A;  3CJT B;  4Q5S F;  4NK8 A;  2R5Y A;  1J0R A;  2DYR H;  1FT9 A;  5DCF A;  4J01 A;  1WJA A;  1JT6 A;  2KLO A;  4RDJ A;  2QTZ A;  3QFR A;  3NAW A;  4UB8 C;  2VJ5 A;  2XPU A;  4UUT A;  3S3O A;  2AXL A;  2E60 A;  4O5V A;  5HDN A;  2MYS A;  2WBM A;  4X0G A;  2L2O A;  1NB0 A;  2V79 A;  3OIP A;  4YFN F;  4C0S A;  2STW A;  1V5G A;  1DPU A;  3IKV A;  1YRN B;  2F4N A;  3MZY A;  4KKU A;  2R7V A;  1Z67 A;  3A0B C;  2CW5 A;  3HGY A;  2TCT A;  1VFC A;  3FPP A;  3ZCO A;  3E6B A;  1R5N A;  2B9S A;  4JP0 A;  3ZXS A;  1WSU A;  3I1F A;  2HXO A;  1W0T A;  3S3N A;  1H0M A;  1K83 J;  1TYU A;  3BG5 A;  3V4G A;  4BKX A;  3HEF A;  3WG9 A;  2COB A;  5EF6 A;  4G1V A;  2PIA A;  4WCG A;  1WHU A;  1Y1W J;  3HZJ A;  1RNL A;  2ELH A;  3B90 A;  2HFH A;  1PUF B;  3GX4 X;  1YW8 A;  1VJS A;  1AKH B;  2V7V A;  1UCR A;  1WOP A;  3QFS A;  2F4O B;  3OSG A;  1VHE A;  2XAU A;  3HXL A;  4LB6 B;  1G3W A;  2VLA A;  1VHO A;  1MMA A;  2JMW A;  4V2F A;  1WJD A;  3CD6 B;  2L9S A;  3MAJ A;  4LBV A;  2OUM A;  4F91 B;  5LRS A;  3P27 A;  2EZH A;  1T95 A;  1GO2 A;  4CQJ A;  2V7F A;  4A2U A;  3DTI A;  3PFY A;  1TWF J;  2WYR A;  2RKH A;  3HOV J;  3P4G A;  4FX0 A;  4DK0 A;  3ABU A;  1YJN B;  2UZK A;  1D1B A;  3G1L A;  3OY9 A;  4PGO A;  1O7F A;  3PET A;  2BHY A;  4ANJ A;  3AVY A;  4JX5 A;  5FD5 A;  2CF4 A;  2R5Y B;  2GXA A;  4Z4U A;  3OZU A;  5AIP A;  1H8H A;  3JQP A;  1BI2 A;  2XPV A;  2DI3 A;  3PNV A;  3QPL A;  1IJW C;  2Z9O A;  1LDD A;  2VFQ A;  2RQQ A;  5A2Q Z;  2HZD A;  3EQO A;  2EFO A;  2MFZ A;  3PFI A;  3LJY A;  3OYI A;  1QBJ A;  1I27 A;  3MEX A;  1B72 A;  3MZ8 A;  3O8H A;  2F1M A;  3SDB A;  4IHY A;  1P2F A;  5AN9 A;  3ZSC A;  3GFM A;  1WOO A;  4DK1 A;  3CME B;  2VC0 A;  4OZY A;  4B4C A;  1GXQ A;  3AVV A;  2IS4 A;  1XSX A;  4XOP A;  2MD5 A;  4NNJ A;  1MH3 A;  4CYC A;  2CUZ A;  3M1E A;  1JJ2 B;  2IRF G;  4I76 A;  2BW3 B;  4Y9U A;  2BGJ A;  5J8C A;  1A6I A;  2MLK A;  5C1E A;  3OV8 A;  5HOD A;  3KFW X;  5ILU A;  4P3Y A;  1O8L A;  1DUX C;  2Q2E A;  5FKN A;  4BHC A;  3BT9 A;  1PUE E;  5FNZ A;  2QY1 A;  4ENN A;  2KIS A;  2BOL A;  1D8J A;  1NBM A;  3FPK A;  2OV7 A;  2W57 A;  3HKZ N;  5HLH A;  2UVF A;  3SEQ A;  1TQP A;  1QFJ A;  3JX8 A;  3FKS A;  2XTW A;  1V54 H;  2DTR A;  5IT9 K;  2HKO A;  5LHG A;  1BR1 A;  3WTZ A;  1XG2 A;  2O6G E;  3TW6 A;  1UZC A;  2NOG A;  4BEH A;  4X7D A;  4F7D A;  1KQ0 A;  3VB2 A;  1ZGW A;  4BQN A;  2EFG A;  3ZPP A;  1LEA A;  2VOP A;  2EIX A;  1SVO A;  1N08 A;  2DEU A;  1ZAO A;  3L2V A;  1SD6 A;  2KHM A;  5B5E C;  3G71 I;  3CCR I;  3CPW B;  4HNT A;  1K9M D;  3WTU C;  5DTD A;  3V7S A;  4CZZ A;  2LKP A;  2ZL7 A;  5IP7 J;  4N3G A;  2BVN A;  1JGS A;  4GO1 A;  2LC2 A;  3GTQ J;  3ABL H;  2FNP A;  3RZD J;  3OYD A;  1XMA A;  5E1W A;  1IJF A;  4R71 A;  4KJZ A;  1J9I A;  4YC5 A;  3LNN A;  3J80 K;  2E2H J;  4X07 A;  5J1U A;  5D6F A;  2IA1 A;  3I0T A;  3GWZ A;  1Z6T A;  3BR6 A;  3OW7 A;  3OWT A;  4GFB A;  1U6G A;  3S17 J;  1IDJ A;  4TMV A;  3BJA A;  2NVU B;  4Z4W A;  3KIO A;  4ENJ A;  1D1N A;  5K5R A;  1R71 A;  1GR1 A;  1NJI D;  3FBI B;  5FB2 A;  3FXJ A;  2IW5 A;  1MBJ A;  4IHT A;  1G6N A;  2EH3 A;  4GRI A;  3A8I A;  1FNM A;  4WF2 A;  1RUO A;  2LBF A;  1O8G A;  5TIS C;  5GAG J;  3R61 A;  4G7Z F;  1SEU A;  1I8D A;  2DPD A;  3N4M A;  4WZE A;  2D45 A;  2CQK A;  3CMM A;  4AUX A;  4P9S A;  1X1C A;  3EUH A;  1JHF A;  4WXC A;  1IDY A;  4LIU A;  2W6I A;  2JSP A;  2E7X A;  1U5T B;  1FSE A;  3CCR B;  2DTZ A;  1HQC A;  2XGD A;  1JGG A;  3S2H J;  3AK5 A;  2LDU A;  3BZK A;  1IG7 A;  2RQP A;  2F48 A;  2BY0 A;  4LIV A;  1EZG A;  2OAZ A;  3D5S C;  5AON A;  2XT2 A;  2DJI A;  2EIL H;  3H5A A;  1NHC A;  2GM4 A;  3A03 A;  4M3D A;  4EGZ A;  2IVM A;  1FBU A;  2X3H A;  2NNN A;  5LHI A;  1T0F C;  1QA6 A;  4MIM A;  1OGJ A;  4G9Y A;  3G73 A;  1W5S A;  1TYV A;  4UV9 A;  2VE8 A;  4PUS A;  2ZFU A;  3G05 A;  1QA2 A;  1KQ9 A;  4RCZ A;  3SFZ A;  2W00 A;  2V7X A;  4W8S A;  2Y2Z A;  5D8L B;  4XRS A;  1XE1 A;  3R6S A;  5H59 A;  4LLG F;  1XGO A;  1Y56 A;  3HKZ A;  1POG A;  2JSC A;  2DIE A;  1XCV A;  2PMZ N;  2VOO A;  2VC1 A;  3CC4 B;  3BDD A;  4O6J A;  1YIT B;  2JJ2 A;  2D5V A;  3DKX A;  4EQQ A;  1DU0 A;  4YXW A;  3D0S A;  4OIQ F;  1G2H A;  4CA0 A;  1XGM A;  1IGN A;  1IO2 A;  1FJL A;  4JBA A;  4PSW A;  3HSF A;  2O5R A;  3P5J A;  1V0F A;  3LL7 A;  5DM7 F;  1ETK A;  4S0H B;  1HDD C;  3FXK A;  1QGP A;  4AD9 A;  4E4H A;  3VR6 A;  3BQY A;  2JTV A;  3FIS A;  1TW2 A;  2O8X A;  3HM5 A;  4P55 A;  4ZYD A;  4OJL A;  1ACI A;  5CKT A;  2QGG A;  4AWX B;  3LAJ A;  2QM3 A;  1ZR2 A;  1J75 A;  3W3C A;  4AIH A;  4KMF A;  2LKS A;  4XK4 A;  1MIJ A;  2BV6 A;  1X58 A;  4I0B A;  4IZZ A;  1TC3 C;  1IDK A;  4H9G A;  4M4S A;  2QSG X;  5FO0 A;  3SY2 A;  3U9G A;  1T98 A;  2Y9Z A;  4I0A A;  1MSF C;  4IOA F;  3P9I A;  2VBM A;  4BPR A;  1R1T A;  1OKR A;  1SFU A;  3BWG A;  1U0J A;  4E7J A;  1A6Q A;  1ZM9 A;  2GK7 A;  1Q9S A;  3LST A;  2GOX B;  3GF2 A;  2ZNY A;  3J7Z I;  2FE3 A;  3PL8 A;  3ZZU A;  3MQ0 A;  3VPR A;  1IXC A;  4BS9 A;  3DLA A;  5FFX A;  2BMW A;  4ZGQ B;  1ULY A;  2AHQ A;  1KYW A;  5CVU A;  1UMK A;  4LG0 B;  4A69 C;  4DYQ A;  3WTW C;  1JKR C;  2EV5 A;  3GLL A;  1R5H A;  2HMA A;  2GWR A;  2A6E F;  3DPT A;  4BH9 A;  3VOD A;  2X8K A;  4WXH A;  3P9C A;  3DU1 X;  1FIP A;  2XV4 S;  2X6Y A;  3K4K A;  1XMX A;  1P4W A;  3S2D J;  1Z91 A;  2TDX A;  3IAS 2;  1I1G A;  2WSS A;  4YAU A;  2WAE A;  3WU1 B;  4RLZ A;  4EMS A;  3IKT A;  4RM0 A;  1IN5 A;  2NVQ J;  1X2N A;  4IXA A;  2DA5 A;  4YEJ A;  1YW7 A;  2FX3 A;  4HE5 A;  1QZZ A;  1OFC X;  3IAM 2;  4XLN F;  3T1B A;  1VLO A;  2QEX B;  1G7T A;  2R7O A;  3K1M A;  3OS1 A;  2O0Y A;  1VQ5 I;  2UWM A;  3B73 A;  4G12 A;  2DK5 A;  3M8J A;  3WBJ A;  5E3O A;  4YIR X;  4HA8 A;  1W5C C;  3ASO H;  5J4V A;  2NVX J;  2QDX A;  2LRD A;  1YJN I;  3S1M J;  5HS9 A;  4BAC A;  4YAW A;  3LA3 A;  3DV8 A;  2G7U A;  4EGY A;  2LZJ A;  1R7J A;  3CCS B;  1XDU A;  1LFB A;  2HDC A;  2HXI A;  1QG0 A;  1BI1 A;  3W2F A;  2M30 A;  1TYW A;  3CCJ B;  5GV8 A;  1ELO A;  1RET A;  1W5T A;  4I01 A;  3QOE A;  4B3X A;  3IL2 A;  3L2R A;  5IT9 Z;  2B5O A;  3BH4 A;  1RUN A;  5DYM A;  1Y0R A;  2EZK A;  4EM2 A;  4OM9 A;  3R60 A;  4URR A;  3BOQ A;  3RIR A;  1W0J A;  2ZL5 A;  5E79 C;  2IJL A;  1J59 A;  4PJN A;  1JRG A;  2VFM A;  2ZO4 A;  2O7O A;  2RC4 A;  1MH4 A;  2ZME A;  2WZN A;  3QFC A;  3BJO A;  4HX4 A;  2XAH A;  2ZIT A;  2M1B A;  2PMH A;  3V7C A;  2IPQ X;  4OZZ A;  1K7A A;  3CC2 B;  2WAF A;  3ML6 A;  1WVR A;  2FNA A;  1QUE A;  3ONU A;  2ZME B;  3F6O A;  2XRO A;  1QPM A;  3W6V A;  5KSW B;  3PSF A;  1K8F A;  1PJ5 A;  4ZDO A;  3OJX A;  2XZO A;  4NCN A;  1IV8 A;  1VF7 A;  3JUR A;  2O0V A;  3BQZ A;  1D2E A;  1FNC A;  1E3X A;  1Z3X A;  2LD5 A;  4CCJ A;  2H8W A;  2YU3 A;  1B59 A;  4CCO A;  1ETO A;  2WV0 A;  2M0C A;  2WJV A;  1SAX A;  1K28 D;  5M5Y J;  2CQX A;  2EZL A;  1TZL A;  3RJP A;  1V5V A;  1RC9 A;  4BXF A;  2X6W A;  4RD6 A;  3NWT A;  4CSW A;  4ZZD A;  3E20 A;  4UY8 I;  4Y9R A;  1IAW A;  1WWX A;  2X1C A;  4L5J A;  2HDD A;  3CCE B;  3A2K A;  2DQR A;  2PN6 A;  3CLO A;  1WDT A;  5HVQ C;  3OE7 A;  2DA6 A;  4X05 A;  3CCV B;  3KYC B;  1ON1 A;  2V9K A;  2JWT A;  4HDV A;  4A5M A;  3RKQ A;  3DKW A;  2LVS A;  4ZV4 A;  4P96 A;  1TLL A;  2K9L A;  2EZI A;  3JRG A;  2L9N A;  2OA4 A;  1SMT A;  3CTA A;  4G7H F;  1QQ1 A;  3H3Z A;  2H1L A;  3BC9 A;  3H35 A;  3KZI C;  3HSR A;  3NB2 A;  4RGR A;  2VXZ A;  1GXP A;  1STZ A;  5GP9 A;  1YX2 A;  3NE5 B;  2VBV A;  3QYF A;  2HQR A;  1UG2 A;  2H1K A;  1EH7 A;  1XD7 A;  4M6X A;  2IGN A;  2ME0 A;  5D5U B;  3RI4 A;  1R5B A;  2XZP A;  2LSO A;  3TW7 A;  2Z33 A;  3Q6Q A;  4G7W A;  4EM1 A;  1JKO C;  1PUF A;  2Z3Y A;  4RPB A;  3MMP A;  3PNY A;  2Z5U A;  1SAU A;  2K40 A;  3RPU A;  2G7H A;  4YCQ A;  1PE9 A;  3CDL A;  2L7F P;  1TUI A;  2X0K A;  5ICC A;  4M9S A;  1IN6 A;  4B43 A;  1ZM2 A;  5EEH A;  3F8M A;  3QP5 A;  1O8I A;  4E7Z A;  2Z6B D;  4QUZ A;  3M3Y J;  3T8R A;  3JRI A;  3F23 A;  1OOC A;  4E7I A;  1R4N B;  4HW0 A;  3JRA A;  5LLQ A;  1S5L C;  1R36 A;  1NH3 A;  1H89 C;  2R7F A;  5K7F A;  5TY0 A;  4OPW A;  1YI2 I;  3SFI A;  3ZBT A;  5CVV A;  1TQM A;  5D5W B;  1R5I D;  3CUQ B;  2KIU A;  2PLY A;  3I64 A;  4IHV A;  3ISX A;  4W8R A;  2D1H A;  2HPM A;  4WWV A;  3GW2 A;  2EIK H;  2E1R A;  3VEP A;  3H36 A;  4G8X A;  5L46 A;  3CB4 A;  2QF7 A;  1QZY A;  1E43 A;  4FWT A;  2IGO A;  4DW6 A;  4WZL A;  2HEO A;  1X0C A;  2EJR A;  5IY5 H;  4W1U A;  2IAI A;  1X4O A;  4FK8 A;  4AF6 A;  3SDG A;  3B6A A;  1W7P A;  3FJO A;  4RMN A;  1DQU A;  2E1B A;  4XKV A;  1OB0 A;  3GTO J;  4ZCM A;  3VOE A;  2W1O A;  4OIO F;  1BMF A;  3CP8 A;  3KET A;  3L00 A;  4PFO A;  2B7B A;  4UHT A;  4JX4 A;  1OFE A;  2UVE A;  2KP6 A;  2V4D A;  4P3I A;  3L2C A;  4MYU A;  1OCC H;  4PC3 A;  1W1W E;  2HZT A;  3LQE A;  4BQO A;  1OCP A;  4DNT B;  3LNQ A;  3PJR A;  2DK8 A;  3IH3 A;  1ETQ A;  1MNM C;  3K4J A;  2ECB A;  2HDW A;  2LY2 A;  1TLH B;  1XSV A;  3C18 A;  5HZB A;  1COW A;  3OYM A;  3PSS A;  4YIF A;  3OIQ A;  1VQ8 B;  2NTQ A;  1IDZ A;  3MN2 A;  2HGC A;  3M8E A;  1IW7 F;  3OYG A;  2FEZ A;  1QJV A;  4ENM A;  1FZP B;  1SFK A;  2CUJ A;  2LBF B;  3R0A A;  2QBY B;  1P7I A;  3JAM K;  2LF8 A;  5DCM B;  2NV4 A;  4YZX A;  1AKH A;  3OS0 A;  2V1D A;  3MD2 A;  3BNW A;  1EA3 A;  4KH3 A;  3BP8 A;  4OWR B;  1BIA A;  1UHM A;  2F5E A;  5J8F A;  1Z6R A;  2CW8 A;  1E62 A;  4PSX A;  1O8M A;  3NWS A;  1S6L A;  4PZJ A;  5M5X J;  1W35 A;  4M0L A;  2HDN B;  3R0J A;  1ZN2 A;  3KLN A;  2RVC A;  1VQ6 I;  2DT5 A;  3A01 A;  3CC4 I;  3P9K A;  2BM6 A;  2INV A;  1GVJ A;  2HQA A;  3SJM A;  1JKQ C;  2JA6 J;  3AGQ A;  3B82 A;  4BE1 A;  2RC6 A;  4NC8 A;  4TV7 A;  1HA8 A;  1R6R A;  1YS6 A;  2MGQ A;  3ABM H;  4KMU X;  2JZY A;  5E20 A;  1AU7 A;  5F08 A;  1WJF A;  1WPC A;  3OS2 A;  2YUH A;  3S32 A;  4FN5 A;  3LSI A;  3GZ5 A;  3FX3 A;  2GQF A;  4P6V F;  4KIG A;  1SFE A;  1DBG A;  4LK0 F;  3QP6 A;  2KRH A;  2HR3 A;  5K7H A;  3PEN A;  1I39 A;  1TWC J;  4XD7 A;  1O8F A;  2BM5 A;  1T6Z A;  2RDP A;  3KP6 A;  3HGG A;  1GJR A;  3I4N J;  2V7U A;  1USS A;  3I55 I;  4V02 C;  1Z77 A;  1O8J A;  4Y4R A;  1GV2 A;  5EG0 A;  2NXN B;  2JPB A;  2D74 A;  3FXM A;  2JA5 J;  3DPL C;  2R7W A;  4YEI A;  1ZR4 A;  2L0K A;  4M74 A;  2O04 A;  3KX2 A;  1R4M B;  2BXZ A;  2VPR A;  3FXU A;  2VKH A;  1KZH A;  3KEO A;  2PX9 A;  2CV2 A;  3EDP A;  5FKO A;  4ACA A;  5CQE A;  5GTH C;  3ES9 A;  2Y69 H;  4Y33 A;  2WWY A;  4YFO A;  3ZQH A;  5IP6 A;  1OGO X;  1B2R A;  3ZQG A;  1XGN A;  3AGP A;  5B1A H;  2XB0 X;  3HAG A;  3VO1 A;  2IA2 A;  3CRZ A;  5JI6 A;  2XTY A;  4NBQ A;  3ZGK A;  3N6Z A;  5DV5 A;  4P12 A;  3GQ8 A;  1HBX G;  1K4T A;  4EEF G;  2DET A;  1UEL B;  5D6E A;  3TL4 X;  1AIP A;  2QKM B;  1TNT A;  3ULQ B;  5IPA A;  2OTJ I;  1TT5 B;  2BY2 A;  3J80 Z;  3KZY A;  4OIP F;  1FPQ A;  2FRH A;  3NRV A;  4UUS A;  4F7Z A;  2BPO A;  1D3Y A;  3E7L A;  5DD8 A;  1Y8R B;  3ZMU A;  5FFZ A;  3AVT A;  2DA7 A;  2ODL A;  3MKZ A;  1E2X A;  3L2W A;  1I3A A;  5E1Z B;  1QQI A;  4H4K C;  5DUK A;  3V7R A;  5CPR B;  1DBO A;  2RV8 A;  1EFR A;  1W7P B;  1VF9 A;  2JT1 A;  1FX0 A;  2QVO A;  3GQ9 A;  4IO9 F;  2AQE A;  2ZSH B;  4IHX A;  2K5C A;  5EEG A;  2DA2 A;  1N06 A;  4Z4V A;  2ZL6 A;  3IV5 A;  4M3B A;  2XGJ A;  4S05 A;  3A8K A;  2DN0 A;  4C3I J;  1AOY A;  1RZ4 A;  2MH2 A;  3OYL A;  1WKM A;  2YWE A;  5EG0 B;  3F21 A;  1P4X A;  4R8H A;  5IOZ A;  3H0D A;  1WI9 A;  2FOK A;  4MO7 A;  3ASQ A;  1K4S A;  3BY2 A;  3FY3 A;  2ISY A;  1SM4 A;  3FMR A;  3FM5 A;  1VQL B;  2Y31 A;  3W6J B;  4RB0 A;  1YHQ B;  4MLO A;  2F5F A;  4G6Q A;  3ZPL A;  3HOU J;  1MAB A;  3QWL A;  1G3T A;  1Q1V A;  2MC3 A;  3U1K A;  4WWC A;  2XHK A;  2FUG 2;  3UW0 A;  1FBQ A;  4UAJ A;  4IRI A;  2OTJ B;  2RAE A;  2VON A;  4FQG A;  1N0U A;  3U6K A;  4FE7 A;  2CMP A;  3EQL F;  4E70 A;  1XTA A;  4CCK A;  3A4C A;  4PMH A;  2YSR A;  3E3V A;  2R7X A;  1KK2 A;  1BJA A;  1JJ8 C;  2E2J J;  3DEU A;  3PVD A;  3ASR A;  4ZH4 F;  1VQM I;  2KVO A;  4G7O F;  4FHT A;  3CCM B;  1Z3Y A;  1H85 A;  3KZZ A;  3GFL A;  4XKB A;  1LUJ B;  1PKV A;  1D0X A;  5HS7 A;  2E34 A;  1WH7 A;  3ZQL A;  2H8R A;  5D8K B;  2K4B A;  2Q8K A;  1Q81 D;  2V1U A;  1R1U A;  2MSY A;  2WC2 A;  3WTV C;  2STT A;  1PP7 U;  3BZC A;  2AQF A;  4UNO A;  1FBS A;  1SMY F;  3K1N A;  4OPV A;  5FLM J;  2DW4 A;  1EFU A;  2EWN A;  2ZZE A;  4QV2 A;  5DSZ A;  2GA1 A;  2ZBK A;  5D5V B;  4PAA A;  1BQE A;  2XGE A;  3IWZ A;  3I5U A;  4A3K J;  5IK2 A;  1LB2 A;  1HW5 A;  4M53 A;  3W2G A;  3GIR A;  3BR2 A;  4YAO A;  3F9K A;  4BQQ A;  3DDY A;  3FK7 A;  2IOU G;  2R6H A;  3OYK A;  4U0V A;  1UD2 A;  3F72 A;  3T9G A;  2IA0 A;  2XIG A;  4WK8 F;  1KU3 A;  2O17 A;  4CUG A;  3HOY J;  2OK7 A;  1KTV A;  4AID A;  3TDZ C;  1R22 A;  3A3B A;  1N07 A;  1IC8 A;  2Y0S N;  3OMY A;  1SAN A;  4X7C A;  3GVJ A;  3WTX C;  3H3U A;  1D0Z A;  2X1E A;  3DU6 A;  4RPD A;  4RDK A;  4XNF A;  3HRS A;  3KYL A;  2QGU A;  5FO1 A;  3W2E A;  4OJP A;  1KCD A;  4OMZ A;  3CD6 I;  3LFK A;  4ZTJ A;  3CMA I;  1T8I A;  2NZM A;  4IL6 C;  1QU3 A;  1O8D A;  1O57 A;  1Y6I A;  2P3M A;  2I5U A;  2VI6 A;  1ZUN B;  4E6K G;  2VFO A;  2V6C A;  2R7Z J;  3LQ6 A;  2P7C B;  1N0V C;  1APL C;  3JRB A;  2CW7 A;  2ECC A;  2L7M P;  4U0Y A;  3CMA B;  4K1X A;  3G1M A;  3RSN A;  1OIS A;  1SD4 A;  2XUB A;  2VN2 A;  4HSR A;  4YEL A;  2VJ4 A;  4XKC A;  1FOX A;  5ICE A;  4YAL A;  4XRM A;  1FTT A;  1V5E A;  2PG4 A;  1MND A;  4L8J A;  2M3A A;  1FRN A;  3I56 B;  4X0C A;  1UD8 A;  3H9G A;  3VSK A;  1T6X A;  5AMV A;  1WSV A;  2I8D A;  4V19 K;  4C3J J;  3QU3 A;  5EZG A;  2VNJ A;  5ED4 A;  5FLX Z;  4HX7 A;  4NUB A;  1JNY A;  4FAS D;  3RDI A;  1VQ4 I;  1T38 A;  2A6H F;  2HOT A;  1NRK A;  5B6I A;  2OZ6 A;  4XQF A;  1HKS A;  1W9X A;  4OIR F;  4AIJ A;  1EP1 B;  3WOD F;  2DCU A;  2OBR A;  3UR3 C;  1R00 A;  4BQA A;  3OZW A;  3HYI A;  1S29 A;  2RGV A;  2F1L A;  1VI0 A;  1OHH A;  4KKS A;  4DZP A;  5IT3 A;  1WJB A;  2DFI A;  2AO9 A;  2QQ8 A;  3E1Y E;  2HVS A;  1RQP A;  3VSV A;  1N78 A;  1EXM A;  2P6T A;  3U1D A;  3ZMD A;  1U3E M;  4B3F X;  3N90 A;  2COM A;  3JR9 A;  5L3G A;  2AXT C;  3QPT A;  2DT6 A;  2BEO A;  2L5Q A;  2PLF A;  2Q6L A;  1WCM J;  3AST A;  1REP C;  4RLF A;  1S7E A;  5M3F J; 
#chains in the Genus database with same CATH homology
 2LYC A;  3W3C A;  3V42 A;  4ZYA A;  3K4C A;  4IZZ A;  3OEH A;  1IDK A;  1V0E A;  4R79 A;  2MAB A;  2R9V A;  4EW9 A;  4DBR A;  2A6T A;  4F93 B;  3ZQQ A;  1BPL A;  2VBM A;  3IP4 B;  3BLY A;  3B4N A;  1U0J A;  4E7J A;  2GJP A;  4E7L A;  2CV1 A;  4QPQ A;  4C2U A;  2GK7 A;  2GOX B;  2PYG A;  3S8P A;  5HOO A;  2M5S A;  3PL8 A;  3AKZ A;  4NQW B;  2W82 A;  3CF2 A;  4BS9 A;  3DLA A;  1HG8 A;  3A35 A;  2PJR B;  2LG4 A;  4NC7 A;  2W4S A;  2Q1Z B;  2HLD A;  4BUP A;  1KON A;  4G7X A;  3T56 B;  2M0M A;  3TBI A;  3DPT A;  2X8K A;  2R7R A;  5FRO A;  3C2G A;  2E5Z A;  4CCL A;  4P22 A;  2X6Y A;  2CS3 A;  3K4K A;  3T53 B;  2VJJ A;  3IAS 2;  4KT6 A;  4YZQ A;  1DGR M;  2JVG A;  2VKD A;  2WSS A;  2KDO A;  1GLN A;  2WAE A;  4OAY A;  3OAA A;  3G2B A;  3I3L A;  1G59 A;  2BVM A;  1W36 D;  3SEZ A;  4YEJ A;  3E0J B;  2R7U A;  4B48 A;  4XM3 A;  3IAM 2;  2F4I A;  4FET A;  1X4P A;  2VQH A;  2R7O A;  4D1Q A;  3OS1 A;  4TSF A;  3HC7 A;  5JHF A;  2UWM A;  2E1M B;  4OJO A;  3M8J A;  2CH0 A;  2VB6 A;  1D0Y A;  3OR1 C;  2ZZQ A;  3EQN A;  2LRD A;  2WA0 A;  4E0F A;  3HG9 A;  4LG3 A;  2HVQ A;  4Z1M A;  1HZE A;  3EUA A;  1WMR A;  3VMV A;  4BAC A;  4ZC3 A;  4J00 A;  2LZJ A;  3OR2 C;  1DP3 A;  1N77 A;  2LRE A;  4ZDP A;  2R7S A;  3DQV C;  2MD0 A;  4XN0 A;  3AL0 C;  2VJI A;  3OYE A;  4DNR B;  4YZA A;  1PJR A;  2QX3 A;  3FDY A;  3H94 A;  4G6T B;  2JDI A;  3L2R A;  3QOE A;  4B3X A;  3D5L A;  3OFN A;  3BH4 A;  4C30 A;  4E7K A;  2UV1 A;  4Y3O A;  5DN6 A;  2R4G A;  2JVH A;  2WY7 Q;  3CJQ B;  3VDX A;  2CFO A;  5HKK A;  2O1D A;  1W0J A;  4URR A;  2V1N A;  5FRM A;  3GQA A;  1BN8 A;  4LIT A;  2V6E A;  3DTE A;  3J7A Y;  1JRG A;  4PJN A;  2Y0S A;  4BE2 A;  3DWL E;  4BJ6 C;  1LFP A;  1VLY A;  2BW3 A;  2LOO A;  4XLE A;  3LMW A;  2DXI A;  4CCM A;  1UD5 A;  1UG0 A;  4OZZ A;  3AFH A;  2ZXI A;  4B3G A;  2WAF A;  1S9H A;  3BCA A;  4RM2 A;  2W6J A;  1LKX A;  1NG6 A;  4F92 B;  1K6Y A;  1OFM A;  1MW7 A;  3PSF A;  4ZDO A;  2XZO A;  1VF7 A;  3JUR A;  2R7T A;  2O0V A;  4Z03 A;  3ZRG A;  1E3X A;  1Z3X A;  3K4M A;  4CCJ A;  4TT3 A;  3RPU D;  4CCO A;  2WPD A;  2WJV A;  4E7S A;  1K28 D;  4ZJZ A;  2PMZ A;  1D1C A;  4XLA A;  1I18 A;  2CV0 A;  3M1C A;  3W2V A;  4AU7 A;  1E79 A;  1TZL A;  2E1M C;  2QE7 A;  3K4N A;  1BLI A;  2KPM A;  2X6W A;  4BXF A;  1X19 A;  3NWT A;  4CSW A;  3E1S A;  3DTK A;  4Z06 A;  2IXS A;  4XON A;  1V5F A;  3CZ6 A;  3MKY B;  2X1C A;  1RU4 A;  4OJ6 A;  2DCE A;  4DJA A;  2F43 A;  2VBK A;  2NST A;  3A2K A;  3B8Y A;  2OC6 A;  2HVR A;  1UD6 A;  5HVQ C;  4U49 A;  3OE7 A;  1TT0 A;  4HEA 2;  2V9K A;  1RMG A;  4P5O A;  4PJL A;  4BL0 B;  1IA5 A;  4CZC A;  2K9L A;  2JA2 A;  4MXN A;  2L9N A;  2GJR A;  4XMY A;  4DBQ A;  3LSK A;  1LVK A;  4XLH A;  3FBN B;  2PJR A;  3BC9 A;  3H35 A;  4PFP A;  5HNH A;  4HG2 A;  2VXZ A;  3GVL A;  3NE5 B;  3QYF A;  2KQR A;  1UD4 A;  1WTH D;  1O88 A;  2XZP A;  2IGN A;  1WJC A;  2GOM A;  2QXZ A;  2HPI A;  2X51 A;  4G7W A;  3DU5 A;  2CK3 A;  2ZXH A;  3ONQ A;  5KNL A;  3PNY A;  4KIS A;  2MC4 A;  1SAU A;  4PJM A;  2JIZ A;  1PE9 A;  1UD3 A;  2HU9 A;  3LSH A;  4B43 A;  3H5R A;  3HL2 A;  1O8I A;  2O0W A;  4E7Z A;  3VYT B;  2KMU A;  4ASU A;  4GQN A;  3SUC A;  2Z6B D;  2QKL B;  3OEE A;  1OOC A;  1IB4 A;  4E7I A;  2X85 A;  4HWV A;  1MMG A;  2M4K A;  2E5N A;  4XKW A;  1OFL A;  1RWR A;  3BCF A;  2KL4 A;  2IGK A;  3K10 A;  2LY1 A;  4U87 A;  3VWB A;  3OL4 A;  3GVK A;  4C9Y A;  4W8R A;  3OOC A;  2M4G A;  1P9Q C;  2HPM A;  1H8E A;  2XF7 A;  3RQ4 A;  1Z7L A;  2RRE A;  1E43 A;  1Z21 A;  2IGO A;  3KEY A;  2X6X A;  4JMQ A;  4BDY A;  5HLT A;  1KTW A;  1OGM X;  1X0C A;  3RCO A;  1X4O A;  2K3P A;  1CZF A;  4Z05 A;  2GK6 A;  1K5C A;  3MKW B;  1WJ5 A;  4RMN A;  1DQU A;  2E1B A;  1AIR A;  1GQ8 A;  4XKV A;  4OJ5 A;  1OB0 A;  2GJK A;  2W1O A;  1BMF A;  3CP8 A;  2NT6 A;  4PFO A;  2ZZF A;  1X1D A;  2UVE A;  2WZP P;  2KP6 A;  4AYB A;  1UAA A;  5HNF A;  2V4D A;  4JOM A;  1MMD A;  2XDV A;  4DNT B;  1PYV A;  4RM3 A;  4BQO A;  3H9Q A;  2VQC A;  1QHG A;  4KIT B;  2ZTN A;  5C1C A;  3PJR A;  3BC8 A;  1FMW A;  3K4J A;  2HDW A;  1BR4 A;  2LY2 A;  3K70 D;  4YRV A;  4XR6 A;  4F3Q A;  2VPL A;  1COW A;  3OYM A;  2Z1D A;  3OIQ A;  2NTQ A;  4W8Q A;  3GRH A;  1E0E A;  2X1D A;  3OYG A;  1QJV A;  4HNU A;  4RLQ A;  4BJT A;  4F52 A;  1SFK A;  2CUJ A;  2LBF B;  2IS6 A;  4KKT A;  1BOB A;  2ZZG A;  2BVL A;  3EUK L;  1X1B A;  1PLU A;  4YZX A;  1X1A A;  3OS0 A;  2WAQ A;  3BG7 A;  3HPG A;  3MD2 A;  3RTR A;  3VYS B;  1EA3 A;  4BJ5 C;  4OWR B;  3KRG A;  4PK4 A;  3T51 B;  2CW8 A;  4PSX A;  1O8M A;  4IQ4 A;  3NWS A;  2LH9 A;  4ITV A;  4N4O B;  3DKY A;  1ERD A;  2NTP A;  4NK8 A;  2D3L A;  3VST A;  1KMH A;  4II2 A;  4HIZ A;  4J01 A;  1WJA A;  2KLO A;  2IS1 A;  2INV A;  2Z16 A;  2VJ5 A;  2HQA A;  3S3O A;  2NT9 A;  4BE1 A;  4BDZ A;  2E60 A;  2MYS A;  2NTB A;  2WBM A;  4NC8 A;  1HA8 A;  4X0G A;  1R6R A;  2L2O A;  3OIP A;  1WJF A;  1WPC A;  1V5G A;  3OS2 A;  3S32 A;  1QHH D;  3LSI A;  2R7V A;  4KKU A;  1E1Q A;  1DBG A;  2ZSI B;  2IGM A;  2KRH A;  3OYJ A;  4XD7 A;  1O8F A;  3FPP A;  3ZCO A;  1JTA A;  4XOT A;  5LD2 C;  1FMV A;  2XSJ C;  1W36 C;  3ZXS A;  4UZU A;  1O8J A;  4Y4R A;  3BCD A;  3S3N A;  3GBG A;  4HRI A;  2F5V A;  3DPL C;  2R7W A;  2XC7 A;  2O04 A;  3KX2 A;  3OYC A;  1WFX A;  3CES A;  3TMO A;  1OLT A;  3OYA A;  2VKH A;  1BR2 A;  4XN3 A;  3U21 A;  1VZ0 A;  2CV2 A;  4C2T A;  3B90 A;  1JI8 A;  5CQE A;  3HOT A;  1VJS A;  4Y33 A;  1YE9 A;  4BU2 A;  3ZPN A;  2VIX A;  5FL7 A;  1N75 A;  3HXL A;  2XAU A;  4XLF A;  2IS2 A;  2VLA A;  1O8H A;  1OGO X;  2Z8G A;  4F55 A;  1MMA A;  4B47 A;  3HAG A;  1WJD A;  1VBL A;  2L9S A;  3BCB A;  3VYR B;  2VBE A;  2OUM A;  2VQG A;  4F91 B;  3OYN A;  4W8T A;  4CCN A;  3K4L A;  1T95 A;  3ZGK A;  2P0W A;  1O8E A;  2V7F A;  3AL0 B;  3GQ8 A;  3DTI A;  3K70 C;  3PFY A;  4JQF A;  2XF5 A;  3VSU A;  1UEL B;  1LDK B;  4DK0 A;  1D1B A;  4AVZ A;  3OY9 A;  3TL4 X;  2QKM B;  2XND A;  2VQL A;  4ANJ A;  3JU4 A;  3WQZ A;  1KCC A;  5LFA A;  4DIQ A;  2Z2S B;  1H8H A;  3QOD A;  3PNV A;  2WY8 Q;  4OAZ A;  1IRX A;  1ZEL A;  2RQQ A;  2ODL A;  3GQ7 A;  4BEH B;  3MKZ A;  2HZD A;  3EQO A;  3L2W A;  2MFZ A;  2X53 S;  4H4K C;  3OYI A;  5CPR B;  2D3N A;  1DBO A;  1EFR A;  2F1M A;  1FX0 A;  3SDB A;  4BE0 A;  3GQ9 A;  4TKO B;  3ZR8 X;  2AQE A;  2ZSH B;  3A1Y A;  2K5C A;  4DK1 A;  4HPQ A;  4OZY A;  3ZSC A;  3WWG A;  2IS4 A;  2XGJ A;  2NOJ B;  4XOP A;  4HST A;  1NG7 A;  3MMY B;  4NNJ A;  3OYL A;  2BSP A;  2PEC A;  4P1W A;  5CQG A;  2CUZ A;  3H0D A;  4IX7 A;  4DGW B;  2BW3 B;  3FY3 A;  5C1E A;  3HUG B;  1E3Z A;  5CDF A;  1O8L A;  2VAS A;  2ELJ A;  3W2A A;  4MLO A;  3S3M A;  1MAB A;  2QY1 A;  3HPH A;  3UW0 A;  2A5W A;  2BOL A;  1WJE A;  2RNG A;  2FUG 2;  1E1R A;  1NBM A;  2OV7 A;  4EAT A;  2UVF A;  3SEQ A;  2KRC A;  2CMP A;  4N4N B;  4IQJ A;  3FKS A;  4CCK A;  3A4C A;  4PMH A;  4C2L A;  2R7X A;  5TGT A;  1BR1 A;  3BG6 A;  3PUB A;  2DOA A;  1XG2 A;  4BEH A;  4ZTF A;  3CJR B;  5FRN A;  2KVO A;  2PYH A;  1Z3Y A;  3LMM A;  2INU A;  3L2Q A;  4BQN A;  3ZPP A;  3DEE A;  1D1A A;  3PSI A;  4XKB A;  4I84 A;  3L2V A;  1PKV A;  1D0X A;  2KHM A;  3VMW A;  3K4B A;  4XL9 A;  4CH7 A;  4HNT A;  4E7H A;  3IUO A;  3UNG C;  3OYH A;  2LC2 A;  1T5E A;  3QYB A;  3S93 A;  3OYD A;  2AQF A;  2DT7 B;  4KJZ A;  3L2U A;  3LNN A;  2L7K A;  3QYE A;  4II3 A;  1W0K A;  3OPO A;  2ZZE A;  5KCM A;  3OW7 A;  1YX5 A;  4G6I A;  3OWT A;  3VYU B;  5IK2 A;  1IDJ A;  3EPZ A;  1WP6 A;  2V4J C;  2Q2E B;  2V7Q A;  3F9K A;  4BQQ A;  1EE6 A;  3DDY A;  4NK6 A;  3FBI B;  2UUZ A;  3OYK A;  2V31 A;  1UD2 A;  3H9J A;  4GRI A;  3T9G A;  2O17 A;  4CUG A;  2IQ7 A;  2WB1 A;  2WJY A;  3GQB A;  2LBF A;  1O8G A;  3A3B A;  1I8D A;  3OMY A;  3SZG A;  3GVJ A;  1D0Z A;  4QPO A;  4U4B A;  3DU6 A;  2X1E A;  3CMM A;  1X1C A;  3I9V 2;  4XNF A;  3KYL A;  4OJP A;  1KCD A;  4ZDL A;  1J09 A;  4LIU A;  2W6I A;  2JSP A;  2NSP A;  2KZV A;  4ZTJ A;  1O8K A;  2NZM A;  3LSG A;  1BHE A;  1QU3 A;  1O8D A;  1Y6I A;  4YZ0 A;  3PNT A;  4E6K G;  3ZIA A;  2M7A A;  4B44 A;  3FHN A;  2VL8 A;  2CW7 A;  4BGD A;  3OL3 A;  2F6C A;  3OOU A;  4LIV A;  2M7B A;  3RSN A;  3DPU A;  4HSR A;  4YEL A;  1YX3 A;  3D5S C;  3CP2 A;  2DJI A;  2VJ4 A;  3LSM A;  2JJ1 A;  2XF6 A;  2ZTG A;  3EUH C;  3HOS A;  3H5A A;  1NHC A;  4XKC A;  2VXD A;  3D5R C;  3H5N A;  1V5E A;  5KHD A;  4IKF A;  1MNE A;  2X3H A;  3OYF A;  1MND A;  3K6G A;  1T0F C;  2R7Q A;  4L8J A;  3N05 A;  2M3A A;  1UD8 A;  1OR7 C;  3H9G A;  3VSK A;  1PXZ A;  5AMV A;  2I8D A;  1KZL A;  4FXU A;  4PUS A;  2V26 A;  1QCX A;  3C2H A;  2ZFU A;  3G05 A;  2WAD A;  2K9M A;  3KEW A;  2W00 A;  4W8S A;  1HVX A;  4NUB A;  4XLC A;  4FAS D;  1NRK A;  1Y56 A;  3HKZ A;  2XOK A;  4MR0 A;  1AA7 A;  4XQF A;  1SKY B;  1W9X A;  4D9J A;  2DIE A;  4DOZ A;  2EWE A;  2W7N A;  3OYB A;  3UR3 C;  2JJ2 A;  3FKJ A;  3DKX A;  3LFU A;  3VSL A;  2XZL A;  4YXW A;  1H80 A;  3SYT A;  4PJJ A;  2JUG A;  4CA0 A;  1MMN A;  1OHH A;  4PSW A;  4KKS A;  2O5R A;  1WJB A;  1V0F A;  4U7B A;  3LL7 A;  1G8X A;  3A3G A;  2HVS A;  3VR6 A;  4E4H A;  3VSV A;  1N78 A;  3W2W A;  4B3F X;  4OJL A;  1DGW Y;  2DT6 A;  5CKT A;  2L5Q A;  4XOR A;  4RLF A;  2HNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...