4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
4AVZA 4XKWA 2PYHA 3LMWA 4OJ6A 2X6WA 1RWRA 3VSTA 4U4BA 3VSVA 1OFLA 4XQFA 5C1EA 1JRGA 2VJJA 3VMVA 4OJLA 4URRA 1OGOX 2NSPA 1O8KA 2NTPA 4Z06A 1X0CA 2UVEA 1BHEA 2O17A 1O8GA 2VBKA 4OZZA 1GQ8A 1EE6A 4U49A 2NZMA 2O0VA 1O8HA 1QJVA 4NK8A 2O04A 5AMVA 4W8QA 1PLUA 3B90A 2O0WA 1BN8A 2QY1A 4W8TA 1KTWA 4OJPA 1KCCA 4XOPA 4XMYA 2ODLA 1RMGA 3B8YA 4YELA 4EW9A 1IDKA 3GRHA 1IA5A 1O8MA 4Z03A 4XNFA 4XLHA 2PECA 3VMWA 3KRGA 3ZSCA 1KCDA 3T9GA 4HWVA 1JTAA 1O8JA 3EQOA 2X3HA 5C1CA 4OZYA 4YZAA 4Z05A 4I84A 2NTBA 1OFMA 4PMHA 2INVA 1QCXA 2UVFA 3FY3A 1O8EA 2QX3A 3GQ9A 4C2LA 1XG2A 1DBOA 3GQ8A 3EQNA 2INUA 3GQAA 1DBGA 4XONA 1HG8A 2VJIA 4XKVA 2X85A 4YZ0A 4OJ5A 1NHCA 4XOTA 1OGMX 1IB4A 2NT9A 4W8SA 2X6XA 2Z8GA 4MR0A 1O8LA 3B4NA 2PYGA 3UW0A 4YZXA 4XR6A 1H80A 1O88A 1OOCA 2EWEA 2O1DA 3GQ7A 1AIRA 4NK6A 1RU4A 4XM3A 2X6YA 4XLFA 4XN3A 2NT6A 4XLAA 4XL9A 1O8FA 2VBEA 2NTQA 4MXNA 4XLCA 4YEJA 2IQ7A 2NSTA 1O8IA 2VBMA 1IDJA 4OJOA 4XN0A 3JURA 4W8RA 4YZQA 1CZFA 1PXZA 1VBLA 2BSPA 1PE9A 1O8DA 1K5CA 3VSUA 3SUCA 4XORA 3WWGA 4XLEA 3ZPPA 1WMRA 2QXZA
chains in the Genus database with same CATH superfamily
4AVZA 1GVHA 1T08B 4XKWA 4AVPA 2GPJA 5BSYA 4YC5A 4G6TB 3EDPA 4YALA 3AVVA 3JREA 4L8JA 1T6YA 3U1KA 2EILH 2CSOA 3ZZTA 4FN5A 1W7PD 4UVCA 4J0QA 1LDDA 2E1RA 1W5TA 4WXHA 5DS0A 3U1DA 2CW8A 2XAFA 2CMPA 1MBJA 4XSXF 1FMWA 3CO6C 2DOEA 3BG3A 3WU0A 3GTQJ 4Z06A 3KP3A 3PQJA 2HDDA 3ERED 1Y6IA 1YX2A 4Y13A 3H9NA 1FBUA 1HCRA 4N3GA 3KPHA 4KN7X 4RD2A 4B8XA 3PJRA 2PJRA 4A3DJ 1BM9A 1P6RA 5JI6A 2JA8J 3E5QA 3HDDA 2MC3A 4R1HA 4RPBA 1UD8A 3ABMH 4JRAC 4BU2A 3N4MA 5F6FA 2DO7A 4PSXA 2HOSA 2QLZA 2JTVA 2HVQA 3S2HJ 1QX4A 3M8EA 3AL0B 2Q6IA 4HNUA 1LDJA 4RB2C 3BG6A 3PSFA 2Q0OA 5FKOA 1GXPA 4PSWA 4XNFA 3I4MJ 3FXKA 4YAUA 2CU7A 5LRRA 2OBSA 4IZZA 1LE8B 2XASA 2DMQA 4B47A 5E8GA 5JBQA 3B82A 3DDYA 1EFTA 2QSGX 3KX2A 4I84A 4AM3A 1QFYA 2INVA 2MLKA 2VNJA 4UAJA 2NOGA 3AAFA 2DK8A 4BE1A 2Y48A 3GIRA 4C2LA 5FO1A 5IP9J 4C43A 1K8AD 3SJPA 1ONVA 1N77A 2R9VA 4LLLA 4M1KA 4QHYA 2OCCH 2ZO4A 4CYDA 4PJLA 5K5QA 4G7OF 2EPFA 3MD2A 2HPIA 1RQPA 1ZHFA 2O3FA 4RM3A 2L7ZA 3BPVA 3IV5A 2OK8A 1PUFB 1O8LA 4RAFA 3B4NA 5D5VB 2K4JA 5KAFC 1D2EA 3ABTA 4YZXA 2LREA 2MABA 2BGIA 2CJJA 4KYWA 5FNZA 3FK7A 2STTA 3OEHA 3B78A 2O7OA 4XM3A 1G7TA 3CJNA 4RB3C 4A3MJ 3G71I 4QWQA 2C6YA 1Y56A 2VKVA 2CW5A 1VQPI 2A68F 2AXLA 3T53B 2X0KA 1RC9A 3O8GA 5D5UB 3WTUC 1W36C 1C0WA 4BYYA 2WJVA 3F9KA 1Q82D 3ESWB 1TTTA 3OSFA 3H3VK 3OEEA 2JN9A 2M1BA 5AIPA 4BEHB 5F27A 2LY9A 3CJQB 5IYRA 2CQNA 4Z4VA 3FXRA 5GTIC 1IDJA 2VBMA 3FHZA 1Z91A 3K1MA 1L0OC 2H6BA 5FB2A 4E7KA 3ASTA 4JX5A 1OFDA 3NAUA 1M1KD 2JIZA 3H9JA 1SFXA 4B44A 2VBSA 2XF7A 5LMZA 2XVCA 3L09A 4OIRF 4DYCA 1WMRA 3K0LA 3J7ZI 1E3XA 2G0YA 2XGDA 2HKOA 1RWRA 3HXLA 5JFRA 1PDNC 2K02A 2JMWA 3GCMA 2WZNA 2FOKA 4PUSA 4G7HF 3V8JA 1BJZA 1A36A 1OB2A 4XRMA 4HDVA 3I59A 3G71B 2LFBA 2Y69H 1VQPB 4H4KC 4HV5A 3S2DJ 3B02A 3HTUA 1GDTA 1QBJA 2VQHA 2P81A 3DU6A 4NQWB 2UVEA 1BHEA 3MQ0A 2X4HA 2GJRA 1NB0A 2VBKA 3PUFA 1A04A 4BHPA 1P92A 1WI9A 3W2FA 2NZMA 1VNDA 2DOFA 3N97A 2QBYA 2JJ2A 3ZZUA 2O0VA 1STZA 4ZZDA 3GTLJ 2PN6A 2LH9A 3PUNA 3FM3A 2A3SA 2BVNA 1ETQA 4RMNA 2XNCA 1ZAOA 3HB9A 2XSJC 4ON0A 3ES9A 1MJAA 4W8TA 1P4WA 2J8KA 2GOXB 3DEWA 1WSVA 3KP2A 5C3EJ 1UZCA 4MQ9F 1NBMA 3I55I 3W5HA 3SFIA 3WHBA 1S29A 4BJTA 1APLC 4M53A 1G3TA 3AKZA 3A0HC 4HF2A 3PL8A 1O8MA 5FD6A 3D5LA 3V7RA 4DOZA 1IW7F 3ZUGA 2JUGA 2LG4A 3IH3A 3R0AA 2JJ1A 1ON2A 3AGQA 2B7BA 2W85A 2VE9A 1PP7U 2E5ZA 2R7TA 2EA2A 3QAHA 1OQYA 3K2AA 3ASRA 2FMLA 2D1HA 1MBFA 2GM4A 2G9WA 4X7EA 2WAFA 5TV2A 2QX3A 4RAZA 3RKXA 1TYXA 1CQTA 1W5CC 5E3MA 5H20A 1QRYA 2B0RA 1MABA 2XZLA 2EFQA 4QVJA 2W57A 2ZB9A 2E5NA 3FMRA 5IYQA 2QQ9A 5ICEA 2ZZEA 4L5JA 2DT6A 3L9FA 1GAWA 4CCNA 3G2BA 3I4NJ 2QEXI 2BSAA 3I55B 1IN8A 5B6IA 1YQAA 1JTYA 4TSFA 1BOBA 3CRZA 3MKLA 2WADA 2E71A 3FX3A 1DGWY 1XD7A 5K5OA 3JRGA 1SMYF 5BS6A 2FX0A 3ZN0A 3ASNH 2YU9J 2ZZFA 4CO8A 2QTLA 1F60A 4S0HB 3G4SI 1S72I 2M45A 1S5LC 3TO6A 1FX0A 3BQYA 1IUFA 3VDXA 3OYAA 1B8IA 4EM1A 3DKWA 1J7KA 3B8HA 2F6CA 3OYMA 3ZQQA 4J19A 3VMFA 2V1NA 1WXRA 2HQRA 3QYEA 1BW6A 1KD1D 3FKIJ 1YW7A 5BPDA 2DERA 1X2NA 5FIUA 1WPKA 1TZLA 1HKQA 4EV0A 2DA1A 1MBGA 2KJBA 2MC4A 1KU7A 3K4KA 3LMWA 5E6TA 2UUZA 2IS4A 1FSHA 1W9XA 1JE8A 4EJVA 3SHFA 4EH1A 2QEXB 5J1UA 2H94A 4CCMA 3VSVA 1HF0A 3BT9A 4BQAA 4CSWA 2IGNA 5DSZA 3PENA 2K7LA 1J9ZA 4IRIA 1I3AA 1OGOX 1U2RA 2L0KA 5EF6A 4IHYA 4F93B 3ZMZA 3L1PA 3AL0C 4C9YA 1ETYA 3ECHA 3SLNA 3MEXA 4I0BA 3GX4X 2CW0F 3CCSI 3G4SB 1S72B 2DPDA 2R7VA 4RA2A 1PLUA 3F6OA 1N0VC 3B90A 1HLVA 1T95A 2HEOA 3NQOA 1FDRA 2IA0A 1TP4A 1KQ0A 1LVKA 1JKQC 2DA5A 3HUGB 4AWXB 4KDPA 4IHWA 4IHSA 1Z6RA 4U7BA 2WAQA 2DYIA 2KFDA 4DYQA 1LUJB 1GVDA 2LP0A 3VR6A 1B9MA 2OUMA 1FRQA 2JZYA 1HZEA 1KCDA 3MZYA 1TW3A 3TDZC 4V02C 2P0WA 1NTCA 4XSZF 2NNYA 3ZC3A 1E1QA 1MD0A 3GZ5A 1FYKA 1UAAA 4QPQA 4D1QA 1EFCA 4Z05A 3PA2A 2E1MB 3GUDA 4FHTA 2DODA 1MNMC 2XGJA 1VQKI 1G3SA 3FF5A 4P6YA 2FE3A 3D5RC 2BYVE 3GZ6A 1E17A 1OLTA 1DPUA 1GV5A 5H59A 4FISA 3GQ8A 3H09A 3W6JB 3CCSB 5M5WJ 2EBIA 3CQZJ 4XONA 4KMFA 3ZPLA 4G1BA 1KA8A 5HDNA 4HF1A 3Q9VA 2AO9A 2ZC2A 2R7UA 1XFOA 2PE3A 2OQRA 3I1FA 5DD8A 1QU3A 2VODA 1VLYA 1YJ9I 1IJEA 3AG3H 4IX7A 1Q81D 1UMKA 2YX4A 1RKTA 4RM0A 3J80K 4L9VA 1X58A 5BOXA 3ABLH 2DFIA 4A3CJ 1S8NA 4ZDOA 2Q2EB 1MNDA 2KL4A 2BBYA 1OCRH 1WPCA 2V7QA 4I2OA 3M3YJ 2VFOA 2Z6BD 2VXZA 1O8FA 1R4NB 2K9QA 3H5RA 3OS0A 4MXNA 3WHCA 1IXRC 3K1PA 3D1NI 1SANA 2Z33A 2IPQX 1E0EA 1VQKB 3CJRB 1OR7C 2DY1A 4YEIA 4PC7A 3J7AO 2DFHA 4ENKA 1BI2A 1R7JA 3BQJA 3P27A 2RNGA 3WTWC 4I09A 4WQMA 3HJEA 5GV7A 1IXCA 1RETA 2BM6A 3LNQA 2JPBA 3OZWA 1YJ9B 2DOGA 4LD5A 2JA6J 2C2WA 1FBQA 4BJ5C 5LD2C 2PMHA 1EZGA 3W5UA 4A3BJ 4FT8A 2H8WA 2ECCA 2W24A 1Z05A 5FGMA 4M9XA 5JMCB 4K2EA 3VMVA 5HDKA 2KZGA 2V26A 1P2FA 2X3HA 4OPWA 4XKCA 1E63A 3KP6A 3DXJF 2F5VA 3I0TA 4A0ZA 3AVWA 4YFNF 5ILSA 2O6WA 1P7IA 1X0CA 2FEZA 4PJNA 3QFTA 1UB9A 2P3MA 3KEOA 4KT5C 4U49A 2JA5J 3BP8A 4ZYGA 2BV6A 3R6KA 4D5FA 1LFPA 3HC7A 2ZMEB 1FIAA 4QPOA 3LSGA 3RSNA 1QO0D 2BVLA 4Q48A 3OYKA 1KYWA 1LLZA 4UV8A 2B63J 5DYMA 2WAQN 1R71A 5FLMJ 1EP3B 5FLXK 2D3NA 2RREA 3BTJA 2QA4I 1WFXA 1LE8A 1BN8A 2QE7A 1FZPB 5DCFA 2L9RA 5ERIA 4YIIA 2LBFB 4BL0B 2HFHA 5HDGA 2LZJA 2L5QA 3SFZA 3UKGA 3JX8A 2ODLA 1RMGA 4GFBA 4YELA 4EW9A 3BZ6A 2KIQA 1K78A 1XSXA 3ERMA 3HOSA 2PECA 1WDTA 2BW3A 2P4WA 4RGXA 2ZJQF 2DA2A 2BGJA 2BM4A 1BR2A 3OR1C 3PO3J 3WNBA 4UV9A 1L3LA 1TYWA 4Y9UA 2F1MA 1JTAA 3ASOH 1O8JA 2QQBA 2FU4A 2P5KA 2RVCA 1SM4A 1MKMA 1VQ6B 4IOAF 3ONUA 2NOJB 3CUQA 4Z4YA 1TBXA 3MMYB 3SQNA 2A61A 4DW6A 5J47A 4AIJA 1PUFA 3GQ9A 2QGUA 1DARA 4EM0B 4UB6C 4WF2A 1OPCA 2DFEA 4OWRB 1FNBA 2ZXHA 1VF9A 3F6VA 4YZ0A 4PK4A 3RZDJ 2DCEA 3BC9A 1OFCX 4G6DA 2W1OA 4ZYAA 2LDUA 1ZR4A 4EMSA 4ESJA 2QA4B 5F0HA 2FQ3A 2Z16A 3Q0WA 5E17F 3MWMA 1JUSA 1YX5A 3P5JA 1WORA 4MGRA 4XR6A 1JB9A 1ZG3A 1TYVA 2R5ZB 3S15J 2VPRA 1IXSB 5J1YA 1KMHA 1GLNA 3DTKA 5FD5A 2EIXA 4XK4A 1T33A 2O6GE 1BR1A 3LA2A 5J8FA 1O57A 3H5NA 1ZG1A 3VWBA 1IRZA 1ZH5A 1Z77A 1P9QC 1T6XA 4OPSA 3OL4A 5KAIC 3DKYA 2BN4A 1P7JA 3VSLA 3PUMA 2GBYA 3HPGA 2XPWA 3TGNA 2NSTA 2R3SA 4QFMA 1OB0A 4M73A 1X19A 2VIXA 2V7VA 1RUNA 1IZ1A 1REPC 4E7IA 4W8RA 3S1QJ 3EUAA 1OR7A 3PVDA 5IK2A 2Y75A 1J2XA 1IUYA 2IXSA 4BQNA 2TRTA 3L2UA 1T8IA 2ECBA 2VC0A 3EUHA 3FHNA 3F8CA 2QXZA 2DQRA 5TY0A 2QN6A 2HI3A 1D0YA 5J40A 4DQLA 4YDTA 4BPRA 3RPUA 5GAHJ 3VNVA 3U2RA 1LM1A 3W6VA 1VQOI 2HR3A 1KK3A 2NS7A 4IW3B 3CCUI 5C1EA 1IF1A 2B7EA 1SD4A 2VT2A 1JRGA 3BG7A 1ZM3A 2OU2A 4KKTA 5BMZA 5A8AA 2QQAA 3M1EA 5E1ZB 3KCCA 4BXUA 1HW2A 1E2XA 1N0UA 4OU0A 1TWGJ 4BH9A 2CRGA 4N4NB 4ZGQB 1AKHB 1XDSA 3DU1X 4ZV4A 2FRHA 2DPUA 3I3LA 4ASNA 5FKKA 1QJVA 1G6NA 2VXDA 1W0UA 3PO2J 1E3OC 5IYNA 2M8EA 2GK6A 1I1SA 2XAUA 2O0WA 3H35A 5F1JA 3HOTA 2E1MC 3F8NA 4GCVA 1N08A 3LNNA 3K70C 1LFUP 3KIOA 4IRGA 2DJIA 2VJ5A 3L2VA 3OW7A 4DNRB 1E64A 4XMYA 1EA0A 4XRSG 2EJRA 2ZBKA 3DBLB 1K6YA 5DTDA 3W2WA 4CCJA 1J9IA 1QHHD 1R9TJ 2FVGA 3HSEA 3H5AA 1T0FC 3CCUB 2WAEA 2EIKH 2BXYA 3LWFA 3K4BA 3ZBTA 4WZLA 2HTSA 4HEA2 1FOWA 2P8TA 2ZKZA 2I10A 3BJOA 1LPQA 1HOMA 1N07A 3CP8A 1GAQA 2EV6A 3IRRA 1WJDA 3VYTB 4ZDLA 3E6CC 2BMWA 2UVFA 3CCMI 2VONA 1QZYA 3NAWA 3RIRA 2QMUA 2EV5A 1XG2A 3P4GA 4A3EJ 1SFKA 4NNJA 4IQ4A 2ID3A 1DDIA 3ZMDA 5A89A 3GQAA 4M71A 3FMQA 2A6EF 3BCFA 2VJIA 4M4SA 1R1UA 2EZKA 3HRSA 4XOTA 1Z1DA 3I54A 2IGKA 5LLQA 4BDZA 4Y52J 4PZJA 3RPUD 2YWFA 5CPRB 1S7OA 2HS5A 4FCYA 1CF7A 3VPRA 4O3MA 2OV7A 3ZMVA 2XAHA 4MFEA 3OSGA 2ZL5A 2IS2A 1H80A 4D7MA 4G6IA 4BY7J 1K6OA 1FBSA 3JSOA 3OV8A 3L7WA 2K40A 3DCFA 3FDYA 4OMYA 1WTHD 2W7ZA 2NT6A 3L2CA 1QA1A 3GLXA 1P4MA 5B66C 5L3CA 4KKUA 3LSRA 1YE9A 5KCMA 1U3EM 2QQ8A 4M6XA 3ABKH 3W2IA 3ISXA 3HIFA 2IQ7A 4W97A 1QVGB 3OY9A 5IOZA 1O8IA 5LFAA 5HKKA 4Z4WA 3CCMB 2FBHA 4MNUA 5K5RA 1XN7A 2HPMA 3SDGA 1ORKA 3JRCA 1MNEA 4O6JA 1P4AA 4PABA 1VBLA 3CCQI 1QQIA 2YSRA 4BAYA 1OKRA 4IRHA 6PAXA 2WV0A 1R1VA 3BCAA 3VYUB 2OYNA 4HSTA 2ZITA 3A3GA 4MTEA 3OAAA 3LMMA 2M0MA 1T2KA 1S7EA 5H2FC 4RBOA 2NVQJ 1YW9A 4BS9A 1OCCH 3CCYA 3I58A 1R00A 3QPHA 4LB5A 2BOLA 2ZMEC 1B1BA 3MFKA 1MMNA 5HS8A 3RYRA 2TDXA 4ZJZA 2O9LA 1W4MA 1MSEC 3QWLA 3OYHA 2XTYA 3M4OJ 3ZQCA 2HWVA 2ZTGA 3CCJI 4HNTA 4OM9A 2HQAA 5J4VA 2VBWA 1VTNC 2DMPA 3AG4H 3BR0A 5EGOA 4OZZA 5JLWA 1DABA 2Y9ZA 1UCRA 2EA4A 1CLWA 2M30A 3HUGA 2QGGA 1BJAA 4A3FJ 1QVFB 4PJ0C 3AVUA 1IAWA 3V7SA 5ED4A 3W2VA 2LY2A 2KDOA 1N75A 5IP7J 3CCQB 2HVSA 1KK1A 2F5FA 2F4MB 3K4JA 3QOPA 1WJCA 5HZBA 3QU3A 4HIZA 4D0PA 5ILUA 3LSTA 1KTWA 4EGZA 1FEXA 2BXZA 1OYYA 2P5VA 3IAS2 2EFWA 1ZRDA 4BXXJ 1G7RA 1Z3XA 1IA5A 2OD5A 2VFMA 3WG9A 3DF8A 3EUKL 2A5YB 3TL4X 1UJ8A 3ZMUA 4ENMA 1YRNB 2IRFG 3GTOJ 2D2WA 4UUSA 4K1XA 1F5TA 2JN6A 4E6KG 3CPXA 5E1XA 4IVNA 2CGPA 2Y30A 1LFBA 4ASUA 3QQAA 1BIAA 3CCJB 5KW9A 1OFMA 3OR2C 1LQ1A 4JYKA 1KQSB 3RKWA 1WSUA 2M87A 2V5IA 2GIZA 3HOWJ 1V5GA 1CGPA 4C3IJ 3OJWA 2VBZA 3NE5B 3KYDB 3L2RA 1J59A 1Z21A 3PIPF 4HF0A 2WJYA 3ZXSA 1NHCA 4LK1F 3WG7H 3Q3SA 2EFOA 5J8CA 2K27A 4XLPF 4QTRA 1IRGA 1SFEA 5KHDA 4A3GJ 1USSA 4X7DA 1EP1B 3RTRA 3ZMTA 3GTKJ 1QFZA 3UNGC 3VSKA 4BQQA 5LEKA 3VOEA 3UW0A 1EFRA 2XAJA 4RD3A 1R5GA 2P7CB 2EWEA 1FY7A 4ITVA 2R7RA 3TKYA 4IKFA 2WZPP 1K4SA 1GO2A 3G3ZA 1QGAA 1ZLJA 5EG0B 4X0CA 5C44J 2AQFA 2XAQA 4M3FA 3R0JA 2ELHA 3E1YE 3U2QA 1ETOA 4FTHA 2VKDA 2OC6A 5ILVA 3BH6B 3VEPA 2LTPA 1KJZA 2W7NA 2ADUA 1EP2B 2DYSH 1LVAA 3LOCA 3D0SA 2VQCA 4II2A 2QDXA 2CRVA 1O7LA 2J5PA 4UB8C 2Y0SA 3BH7B 4ACAA 5CVVA 1H0MA 2R4GA 1EFUA 3PNVA 3GW2A 4XLEA 2CF4A 1ACIA 1ITYA 3FM5A 1D5YA 3SEJA 1O8KA 3H1CA 4BE2A 2F5EA 2KRCA 1O3TA 5GAGJ 4FE4A 3FXMA 1BOAA 2XAGA 1E62A 1I6HJ 3BC8A 4LBVA 4L0ZB 3I5UA 1D1BA 4ACBA 2YS9A 3U9GA 3AFHA 4ZYHA 1Q7YD 2A05A 1W35A 5B1AH 4DNCA 3KYCB 1LNWA 1QZEA 1V5FA 4MEYF 1QG0A 1U5TA 2LF8A 4XLNF 1FNNA 2HYJA 3HSRA 1OHHA 1ZGAA 5L3DA 2I1LA 3R61A 2CO5A 2BHZA 1WJFA 1FJLA 3GTGJ 3ASSA 3WGHA 1CQXA 4Q5SF 4P1VA 1FLIA 2QWWA 1TC3C 2WTEA 2LBFA 4S05A 2H8RA 4LG0B 1GQ8A 3ASQA 2NS0A 3BTCA 3SZPA 1AHDP 3JR9A 2E2IJ 3WNDA 4I7HA 1O8HA 2AHQA 1U9OA 1FNCA 4L5EA 9ANTA 1ZM9A 3IRQA 2L01A 1HA3A 4I98B 3LSHA 1ZM4A 3ZOBA 3HTSB 3HSFA 1Y0RA 4EVIA 2DN0A 1UD2A 5JVTA 2JDIA 4H0EA 1IRXA 1A6IA 5HS9A 4L9NA 3V8KA 3WBKA 3KP7A 5CVIA 2V1DA 3KYLA 1UFMA 2QVOA 1QUFA 1BPLA 3GRHA 1Y8RB 1FWZA 3OFNA 1IJWC 4Q7JB 4JX4A 1O3SA 5IT9Z 1IHMA 4P96A 2BY3A 3GBGA 2DFFA 4WXCA 2OAZA 4FE7A 1R5BA 1T6SA 3EQOA 2L7MP 3HOXJ 4AIHA 4B3XA 3HBLA 4P9SA 5F4MA 4OZYA 4HSRA 3B73A 4A3IJ 1DP7P 3ZRGA 4KIBA 1TW2A 2EIMH 3HM5A 3DLAA 1B59A 3IH2A 1BX0A 2CUJA 2Z3YA 2K3PA 2OJED 1DU0A 3CMEI 2VNHA 1HSTA 1UG2A 2YWGA 4RB1A 4L18B 1KTVA 3SZGA 2GXBA 1EF4A 4FWTA 3OYLA 1HVXA 3IC7A 4L9TA 2X6XA 1Z7UA 4FQGA 2V4JC 1JJ6C 3GFIA 3BJ6A 3JRIA 4U0VA 3O6BB 1EWYA 2D74A 5F04A 3V76A 1O88A 2DYRH 3G1OA 2PI0A 3GQ7A 2M2EA 4LG3A 4W1UA 1SKYB 4NBQA 5IYDJ 4CYCA 2X6YA 5E18F 2Q8KA 2RV8A 1ZGWA 3P7NA 4KN4X 2HDNB 1V5VA 2NTQA 2DI3A 2Y0SN 3K4CA 4CCOA 3MN2A 3RQIA 3MCAA 2F5CA 2OBPA 1E3ZA 1JA0A 1ETXA 3ZMSA 1DU6A 3RJPA 3E0JB 1WKMA 2X53S 4LBYA 5BQTA 3CMEB 2F3LA 3MZ8A 2DA6A 2QYUA 3FPPA 1BA5A 1W5SA 2BSPA 2PLYA 1PE9A 1MDMB 4DBRA 2PJPA 2O03A 1FRNA 4C2TA 3WWGA 1KGSA 1FNMA 3WTSC 4RB0A 4PFPA 4X0GA 4ENNA 3LSIA 5JHFA 3OP1A 3U6BA 2PYHA 3BR5A 2X6WA 3K2ZA 1QH0A 1YITI 5FO5A 1OGJA 1BLIA 3E1SA 3V8LA 2GLOA 1OFLA 3LQRA 2DT5A 3PSIA 4DIQA 1JJ8C 1AKHA 4HYEA 1VZ0A 4RS8A 4XQFA 2ISZA 4G7WA 2DEUA 5DCMB 5D4RA 4PJMA 1VI0A 3QFRA 4MLOA 2FUG2 3OYBA 2NSPA 1G3WA 2FMYA 1SMTA 5J35A 3F23A 1JGGA 2L02A 2QKLB 4F55A 1MMGA 2VKEA 1N25A 2NXNB 4CZZA 1F9NA 5DNSA 1OYIA 1DDGA 1EE6A 3C1DA 3A01A 2L7FP 4YHBA 3K7AJ 5GP9A 2V31A 4ZYEA 2KDZA 4KMUX 2CS3A 4OPOA 2XNDA 3H3UA 1K4TA 1MMDA 2MLGA 1IV6A 3DPTA 4KUMA 1Y1WJ 2NV4A 3JQPA 1QA6A 3SEZA 3Q3AA 3I56I 1WOSA 1MMAA 3CMYA 2HDWA 3RY8A 1W7PB 4HA8A 2YPRA 5CLSA 3AGPA 4PC2A 2ELJA 4NC6A 1YITB 3NRVA 2BGCA 3QPLA 2D45A 4LLNA 1IB0A 3P26A 1OB5A 2PEXA 2QM3A 4P9UA 3PM1A 3KRGA 4BKXA 1D0XA 4HQEA 4YAFA 1TWCJ 4U88A 2GWRA 2ZNYA 4DJAA 2XOKA 3D26A 3T8RA 4KIGA 2Z9OA 4TKOB 1MBHA 4YG2F 3CXCB 1XTAA 1GV2A 3RIQA 3A3BA 1WOPA 2ICWG 2E35A 4TV7A 2RC5A 3CMMA 1VHOA 2BHYA 1QNTA 4TN1A 2M7BA 2V9KA 4P2NA 4J01A 5DS9A 2CQ7A 4F3QA 3F22A 3VNUA 1XPXA 3H94A 1YG2A 2BY0A 3BZCA 4R8HA 2WC2A 1CNEA 1R4MB 3Q6RA 3QYFA 3ZBUA 3E5XA 4PGGA 1WGXA 1QVUA 3I56B 3T1BA 1T98A 3FXLA 1W36D 1RR8C 4E4HA 3LSJA 3JRFA 4DK0A 2R5YA 1RU4A 3LSKA 5LBQA 2DTZA 2HNHA 2OBRA 2QKMB 2PX9A 4BNCA 1V3FA 3GQBA 5GADJ 3HZJA 3T51B 1QFJA 5J4YA 3R6SA 5IYPA 4FX4A 1HW1A 2DJNA 2XIGA 3F8MA 4ZYDA 2BVMA 2R92J 3AVTA 3I64A 5F64A 5LRSA 2R7WA 3JTHA 1FIPA 4YCQA 4ZC3A 1AOYA 1MH3A 5K7ZA 3H9GA 2K5CA 2R7FA 2UXNA 4QIWN 3CB4A 4OJOA 4XN0A 2K85A 4YIRX 4X1EA 2NAZA 3OYEA 1KQ9A 1XB2A 5F1RA 2DAOA 3ELKA 3WY9A 1XGMA 4EJWA 3AK5A 5JHUA 3E5UA 3QPSA 1R36A 2XHKA 3ZPPA 3A2KA 2VYQA 3TOBA 4Z4ZA 1RNLA 2GK7A 3CCLI 2B0LA 4ZCIA 3C2HA 1WCMJ 2X1CA 1OCPA 3S3MA 3OIQA 4BBSJ 3VSTA 3SJZA 5CVRA 2K9LA 4IOCF 1U0JA 5DN6A 4J00A 2VBXA 5E20A 4MYUA 1QQ1A 3FXQA 3M8FA 5TJJA 3MCZA 4GRIA 5TISC 1X3UA 1D3YA 3CC2I 2RGVA 2ZXJA 2PJRB 3MKWB 2J8IA 3V7CA 5M5XJ 1GJRA 2NTPA 4OAZA 5M3MJ 3LSMA 4PGHA 1E43A 4HNVA 1EJ9A 4UUVA 1D8JA 3HRMA 2V79A 2XKOA 3MVPA 3BG9A 4PCQA 1ZARA 3FKJA 4XRFA 3HOYJ 1E3HA 1Z7LA 4RDJA 1KK2A 2IA1A 3CD6I 5L3FA 4NUBA 1PJ7A 1R5NA 2K3FA 4PC1A 1I3QJ 2FOWA 2GA1A 4XKBA 2HYFA 1G7SA 3DTIA 3IWFA 3BCDA 4AIKA 4CGZA 1NG7A 2M5WA 4Z4UA 1WP6A 1GUUA 3CCLB 3U6KA 5HNFA 2MD0A 1IDZA 3T5XA 1X1PA 2ZJ2A 1IDKA 3BWGA 3FXJA 2ZFUA 2H27A 3IAM2 1UHWA 4XRSA 3R60A 1VQ6I 1Y39A 3W3CA 3VMWA 1VLOA 4A93J 1NB9A 3CCVI 2BM5A 4LLGF 1HF2A 5THXA 1F1ZA 3CC2B 1XSDA 3OMYA 4HX4A 2M0CA 4ZTJA 4RLQA 4WZKA 1XX5A 4A5MA 2VQLA 2WPDA 2KLOA 2COMA 2O8XA 2QZAA 3O3KA 4CA0A 3CD6B 3B6CA 1JNYA 2QTZA 1I18A 4U0WA 1QRBA 3LA7A 2F2EA 4YAOA 3PSSA 1TQMA 2K86A 1TLLA 1Z0XA 3BR6A 5IP6A 3EYIA 3DFGA 2E1CA 3G1MA 2PG4A 3W6KB 3GO5A 2X8KA 1H85A 4Y7CA 4Z4RA 2BM0A 2VFNA 4PAAA 4B3GA 2ACJA 5GPAA 2PYGA 4IHTA 1ELOA 1G8XA 1SKQA 1H9GA 4IO9F 5JLXA 5M5YJ 3SJMA 1F20A 4B4DA 2O1DA 1K8FA 1TVCA 3CMAI 2D1VA 4AD9A 2ETHA 1K28D 1BC8C 2EWNA 1XCVA 3DTEA 3FJOA 4HBLA 3QFSA 4P22A 4DNTB 2Z99A 1D1CA 1I27A 2KZVA 2KPMA 3G73A 1H42A 3WYAA 4XL9A 2MW8A 3CCVB 2RNJA 2M7AA 3GLLA 4UHTA 3HKZA 2X51A 1H8HA 3RDIA 3BROA 2F48A 1B2RA 1O7FA 4CCLA 2M4KA 3FISA 5DD4A 4KISA 4X05A 1IN5A 2GXGA 3SY2A 1YX3A 2M4GA 3OYCA 1Q1HA 1A31A 1RR7A 4IHVA 3PETA 4YZQA 4A69C 2KVOA 3GVLA 1EXMA 1G4DA 2Y0MA 3OS2A 2GAUA 4F7DA 1I50J 2F4OB 3S8PA 3SUCA 2DIEA 4HV6A 3I59B 4A12A 4ZDPA 5CJ9A 1XQBA 2XNJA 4JBAA 5ICFA 4BEHA 2E1OA 2G7HA 2V7WA 2CC2A 5HOOA 1U8RA 3OKXA 2HKXA 2MH9A 1G7CA 2YUSA 5J1RA 4NBSA 4WCGA 4UZFA 4HQMA 1R1TA 3RCOA 3CMAB 1K79A 4HDUA 1ZKGA 4EQQA 4OOVA 2CWEA 2XGCA 2HYGD 2DQLA 3TO9A 3ZQHA 5FFZA 4A0YA 3MMPA 4MYTA 2WWYA 1PP8F 2M34A 4ZGNB 2Z5UA 4I02A 3X2QH 4G5GA 3KP4A 1V5EA 1X1AA 4WWCA 4Q4ZF 3OS1A 2XV4S 4GYIA 5KK1A 2R7SA 2PIAA 3K69A 3CDIA 1SFUA 3KEWA 3PA1A 4M9ZA 2CFOA 1W0JA 5FFXA 1O3QA 1TSPA 1OCTC 3GTMJ 1KU9A 1A5JA 3HPHA 4XBFA 3OZVA 3BR2A 4RDUA 2E2JJ 1QRCA 2JVHA 1X1CA 2EV0A 2ME0A 3WBJA 3CCRI 3H3ZA 4NQWA 4I0AA 2F43A 1J5YA 1IDYA 5E3NA 3KZZA 2ZJRF 4BHCA 5BNGA 4ZH4F 5K1YA 1ZR2A 2V6CA 4XOPA 3S3NA 3CC4I 2VJ4A 1MSFC 5TGTA 1D5VA 4M0LA 2JJ7A 3HOVJ 4RCYA 4TT3A 1PJ6A 4P3IA 1MJ9A 2J5OA 5EDNA 1YTYA 3M1CA 3HGYA 1AA7A 5TR9A 3LSPA 4HWVA 1ZRFA 2IW5A 1N06A 5CVUA 3LVBA 1R5ID 2NTBA 4CHUA 2IGOA 4OOSA 2V1UA 3E20A 5HLGA 1U6GA 2YUHA 1XGNA 3AVYA 1SD7A 1FT9A 1XGSA 3CLOA 3G1LA 1DBOA 1XSVA 1JXSA 2VNKA 2OTJI 4WZEA 3PFYA 1D1NA 5LEJA 2R7XA 1G2HA 1IV8A 2K9SA 2MFZA 1FSEA 4KICA 5JR3A 2I8DA 3OYIA 4KNYA 4PFOA 3ZR8X 1IB4A 3CCRB 3S93A 1JGSA 2IVMA 1VQ4I 3A0BC 1JKOC 2IA2A 3PSZA 2LNBA 1R6RA 1Z9CA 5B1BH 4PJJA 1T5EA 4OP7A 5D5WB 4YFOA 1DG1G 2VBTA 1I39A 3HKZN 3PQKA 3ZIAA 3CC4B 2QCOA 2VT3A 2Q6OA 4NK6A 5DUKA 1WRJA 3V7AA 1KYZA 5F08A 5F0CA 1QUEA 4EM2A 3GZNB 1F43A 3NARA 2HQNA 4DQ2A 1XMXA 3P9CA 1B8IB 3J81k 2C5BA 2VB6A 3A1PA 2UXXA 3W2HA 1NG6A 4C2UA 3I9V2 3OYFA 2BV3A 3OL3A 2VZLA 2L54A 1J0RA 3T56B 2XZOA 4R71A 2W25A 2VLAA 1LKXA 1BC7C 1FNDA 4G7XA 2OTJB 5IY5H 1PXZA 2LKPA 2LSOA 1AWCA 2NVXJ 1ZREA 3TBIA 4EEFG 1DUXC 2XC7A 1YI2I 1VQ4B 2ESHA 1BIBA 4E7LA 2ZXIA 3OOPA 4QV2A 3G6EB 4OJ6A 1XCBA 3JU4A 3CESA 1HW5A 3CLQA 4G12A 3CCEI 5CQGA 4RCZA 4LC0A 2JA2A 4X6AJ 1UD5A 1IG7A 1V0EA 1JTXA 5H6QA 1JUMA 4OMZA 1UG0A 3RYPA 1K83J 4LBZA 2DA7A 2V7TA 5IT9K 2IT0A 2BZTA 2X1DA 3RKYA 1YFHA 1FMVA 4I6ZA 1VQ8I 3C18A 4CXFA 5FA6A 3MHPA 4MQVA 2XF6A 3LYCA 2ZL6A 1F36A 1ENHA 2RQPA 2V9PA 2JRTA 2BEOA 2BE5F 5A2QZ 4ANJA 5FROA 1PJRA 2O04A 1ZTRA 4NDLA 4NC7A 2W4SA 4B09A 3O2PE 4LB6B 3I53A 1D0ZA 5D8LB 4QVAA 1VQLI 3MAJA 4G9YA 5KSWB 1QZZA 4F52A 2ZFWA 3TOAA 2MBFA 1VQ9I 1LDKB 5E3OA 1YI2B 3HYIA 4C30A 1MRZA 3BR1A 1QGPA 2PFBA 1W0TA 3CW2A 3CCEB 5ICGA 4U7DA 1E79A 3T0YA 1FTZA 2ZL7A 5C4XJ 5D4SA 4TMZA 4I99C 2FJ1A 5LGUA 2EZIA 4N0BA 1K73D 5EZGA 1YYVA 1OCZH 2V9VA 3WTXC 1A6QA 3JW4A 2L9NA 2WB1A 1YS6A 2QF7A 2VPLA 3A8KA 2KRHA 2XB5A 2DU9A 5L3BA 2C77A 4UZUA 3LQEA 5C1CA 5GPCA 4HE6A 4EJUA 4DGWB 3ABUA 5DDGA 4IL6C 1VQ8B 2UWMA 3H36A 4OOXA 1D8TA 3DV8A 2E1BA 4PC3A 2VFQA 2MH2A 4GO1A 2O0YA 5J6XA 1FOKA 1PKVA 3FXOA 1QGZA 4Z4SA 1ULYA 3GVJA 3Q39A 3WGIA 3ZQLA 2X85A 4E70A 3GYHX 4GGGA 3M8JA 5E79C 1R23A 4E7HA 3QSYA 3BNWA 4W8SA 1VQLB 2NRAC 1KONA 1A35A 2EINH 2FBIA 4LFUA 3K4MA 2Z8GA 1B72B 1Z67A 2ESNA 2VQGA 3C3WA 3IH4A 2KP6A 5AN9A 1VQ9B 1U2WA 4ETSA 1TWHJ 1BMFA 3ML6A 3U21A 4CICA 2XRNA 2JSPA 3SQVA 1RUOA 5GV8A 2CQXA 1EKEA 2FX3A 1POGA 2E2HJ 2N8GA 2E7WA 2GQQA 2FA5A 3NWTA 1T0FA 1QPIA 1FTTA 4XN3A 4M6YA 4BUPA 3NWSA 2V7XA 4U0YA 2VBEA 2LR8A 2ME6A 2DDAA 4EGYA 3KZIC 1R58A 2K4BA 2Y31A 2HOAA 2V1XA 4TMWA 2LLKA 3AVXA 2VC1A 1TNTA 2XTXA 3A8JA 1H8AC 4UNOA 1WJ5A 2FNAA 4A2UA 4V2FA 2HOTA 2Q2EA 2GA2A 3J7YJ 1IC8A 3J81Z 1J75A 4I76A 2H1LA 2ID6A 4E0FA 2E1NA 2DBBA 1TNSA 2F4IA 4OINF 5K7HA 2IBDA 3A4CA 4NCNA 3ZN1A 4TMTA 2L9VA 3BOQA 3LFKA 1E3PA 2CYYA 3QP6A 2XSDC 4HX8A 4BDYA 3O8HA 1VJSA 5FKLA 3SZEA 1QPMA 3BTIA 3HRTA 1FP1D 3JSPA 1BN5A 2GJPA 1Y1VJ 5FLVA 2MSYA 1YLFA 3DP7A 2H6CA 5EEGA 4U87A 4QLCU 2OTLI 4MR0A 2OZUA 1R5HA 1ZYRF 4B3AA 1TYUA 2FNPA 2XZPA 4DYRA 2JA7J 1JKPC 2VL8A 2MYSA 2VJJA 4CZCA 2HU9A 1Z3YA 4M72A 2EQRA 1U78A 1SVOA 2VOOA 2P5LC 5L3GA 4RJLA 3VYSB 3JRBA 4GYGA 2VE8A 2O17A 2UZKA 1RKWA 4TMVA 2R6HA 2GXAA 3KLNA 4N3NA 1V0FA 1YIJI 3KZYA 2KMUA 5EEHA 1N05A 2WR8A 3SXYA 5FRNA 4BXFA 2KISA 2X9DA 1IN7A 3VO2A 3K70D 4DBQA 1BBYA 2VUMJ 2ZTNA 3PNYA 3CF5F 3H0DA 2XT4A 5DEQA 1K78B 1L1IA 2PBIA 2BY2A 2MGQA 4HZFA 2CUZA 3DPUA 3MZHA 2BW3B 2RQQA 2VOPA 1K9MD 1TT5B 4JQFA 3ZQGA 5HODA 4A3KJ 3K4NA 1I6XA 2WB1N 5LHIA 5E8IA 3CUQB 4N9IA 2EK5A 2ZMEA 3OPOA 3BQZA 5EJCA 3Q38A 2K9MA 1K61A 4WXDA 1BX1A 2OTLB 2YX7A 4CQJA 1W2BB 1Y0YA 3F72A 2CV1A 1H89C 3DKXA 2AS5F 4C3JJ 4L0YB 1EV7A 3ASPA 4RAYA 3ROUA 4Z6YA 4UY8I 1H8EA 4WK8F 1QVTA 5B5EC 1KU2A 4RD1A 3S3OA 1IJFA 3FPKA 4KKSA 4C0SA 2OA4A 3WODF 3CZ6A 1MJBA 5D6EA 3QU6A 1JKRC 1YIJB 1Y0NA 5IOYA 1IRFA 2BX6A 1KZHA 1DBGA 1HG8A 3K6GA 3KLOA 3S1MJ 4F7ZA 1VHEA 4Z2YA 1TL8A 2KIFA 1H88C 5FO0A 1E1RA 4E7JA 4S04A 3CC7I 1M90D 2LOOA 4WZTA 1X1BA 3WTYC 1BI1A 3ULQB 1CNFA 2JUCA 2LY1A 2OBTA 1JHFA 2AXTC 2W6JA 3M9AA 1NH3A 3EQLF 3OOUA 5DM7F 2HXIA 1AIRA 2EZHA 3OYGA 2FF4A 3JQRA 2GREA 2IS6A 4XLFA 3P9KA 3QP5A 3Q0VA 3WGGA 3DQVC 4FXUA 1V55H 2OZ6A 4HG2A 4M6VA 1EA3A 1S7AA 2V6EA 5HXBA 1UHSA 3H92A 2R7ZJ 2JSCA 4HPQA 1VFCA 2HVRA 2R5ZA 3CJTB 2ZCWA 2PMZA 4I01A 5IPAA 4X06A 2Q6KA 1I5ZA 2KT0A 2VBYA 3IHUA 2OQGA 4ABZA 3TDUC 2E34A 2IEKA 2JK3A 3ONYA 3R6JA 1YO5C 1GT0C 1RPWA 5IYBJ 3WTZA 3E97A 2PMDA 3DBHB 3F8BA 2YU3A 4BHBA 4ESBA 3OYDA 2E19A 1VQMI 1XS9A 1RQRA 5F4JA 3VSUA 2E7XA 2WSSA 1NJID 4EATA 5GAEJ 1SD5A 1KU3A 5EZHA 1YS7A 3DWLE 3OZUA 3GMEA 2OPTA 3BY6A 5DV5A 1PUEE 2YWHA 3CC7B 3GFJA 4RAGA 1OGIA 3TQNA 5BPIA 2P6SA 3FK6A 3REOA 3OE7A 4X7CA 5M3FJ 3GSIA 1QHGA 2CV0A 4YAWA 2A5WA 1HKTA 3GVAA 1XC5A 3F21A 4A3JJ 4URRA 5A88A 3A02A 4A0XA 4KFCA 5TRDA 3W2EA 4P55A 4LK0F 2XC1A 1P4XA 2E60A 2UV1A 3ONQA 2LKSA 5E3LA 3G05A 3OW2B 3WNCA 2EFGA 2CFXA 2DA3A 3HGGA 3BTLA 1R5OA 3CPWB 4RGRA 2M5SA 2CH0A 1VF7A 2HCJB 2OK7A 4CH7A 4W8QA 3GFMA 2A69F 3GWZA 1VQMB 1YJNI 2IJLA 3E6BA 1ETWA 2CNDA 2XGEA 4IXAA 5CYVA 2ZZQA 4P25A 1B6AA 4BJ6C 3J7AY 1T56A 2WY8Q 3EETA 3Q6QA 4M2LA 1XG1A 4P12A 2V4DA 3FZVA 1X3WB 3PNTA 1VQ7I 3CUOA 2GOMA 2HTJA 1MIJA 5AONA 4XLHA 1R49A 2L3DA 3DBRB 1ZM2A 4LIUA 4FASD 4OPVA 2CBXA 4QUZA 2L2OA 2OF7A 1YLOA 4KJZA 4PGOA 2YR2A 1X2MA 4ESFA 3AG2H 3IWZA 1XDUA 1DP3A 4P26A 1CF7B 3CTAA 2LF7A 3TP0A 3WE3A 3BZKA 2Y9YA 3VODA 2INUA 1ON1A 2ZBVA 1OJLA 4G7ZF 2LVSA 3WTVC 4XKVA 5D8KB 3PUBA 5K7FA 4RPDA 2XGXA 1AMOA 1ZN2A 2ZXWH 4UVBA 2XROA 3HG9A 2WYRA 2A07F 1B4AA 3ISPA 4D5CA 4X7FA 1YJNB 4XICA 2X0LA 2F1LA 3TP3A 1UELB 3MKYB 3FIWA 4ZCLA 3JAMK 5DUIA 4AF7A 1VQ7B 4OJPA 4HX7A 2RKHA 1LB2A 4B1RA 2H1KA 1PYVA 2PMZN 1HSJA 3JRHA 3RKQA 2HMAA 4MHGA 5HLTA 4M3DA 1WH5A 4EJTA 5LHHA 2BM1A 2LD5A 1U8BA 2R7OA 2W84A 3WE2A 3A03A 2QZ8A 1RI7A 1RRJA 2OCEA 1F4KA 2FQ4A 3W5VA 4NC8A 1GVJA 2KRFA 3H0GJ 4PDKA 2LMDA 4UXNA 3S17J 1T39A 3TW7A 5L3EA 1O4XA 2PMUA 2Z2SB 4CDGA 3SZTA 3RI4A 2YWEA 1SC7A 2CG4A 1KQ5A 2W82A 1S0UA 1TWAJ 3SLDA 1O8DA 2VNIA 4BE0A 3AG1H 3BG5A 3HOZJ 2FSWA 4CUGA 3BCBA 3ZQIA 1RESA 3KL9A 2WY7Q 1V54H 3ZP5A 1UMQA 5HNHA 1JA1A 1J09A 4P5OA 2JT1A 2WV1A 4UVAA 5EGOB 3OJXA 4U4BA 3R4KA 2KHMA 3OOCA 1IN4A 2HGCA 3SDBA 4MO7A 4E7SA 3L00A 4F92B 3GFLA 5HS7A 2ISYA 4AUXA 2KQRA 2K9NA 4UUTA 2RN7A 3LFUA 4HOBA 1FYLA 3SYTA 3RZOJ 4P1WA 4YFXF 3CUQC 2Q6LA 3CDHA 1I1GA 1O3RA 3DU5A 3HHGA 3HEFA 3LQQA 4O5VA 3OIPA 3CF2A 3S1NJ 1U9NA 2VFPA 2QYOA 3LAPA 1ZQ3P 3GVKA 3LJYA 5BSXA 4NHJA 3GF2A 4L9JA 2LK2A 2NPFA 1XB4A 4P6VF 4UUSB 1WJBA 4M3EA 4ENJA 3E6DA 4L5IA 4XIDA 2NS8A 3HAGA 3WXMA 3ML3A 3C2BA 3MKZA 3OWTA 1FOXA 4AC9A 1KCCA 2XB0X 1H9TA 4RD0A 1QA2A 5FL7A 1X4PA 1MGTA 1S9HA 4PC6A 4HLXA 4LJZF 2W6IA 3V4GA 2XUBA 5DM6F 1KZLA 1XE1A 1K4ZA 2EB7A 1WHUA 3JRDA 4BACA 1ZUNB 1ZK8A 2V7UA 3GTJJ 2D5VA 1ETVA 2A6TA 2XPUA 3BLYA 3IL2A 3SKBA 4JX6A 3ZZ0A 1FPQA 1KQ8A 4IQJA 2CW7A 2JRMA 5CKTA 5FKNA 3E3VA 1JT6A 2R0QC 2GIVA 1B72A 2KKOA 1K7AA 3EPZA 4YFKF 1HA8A 2ELKA 1YRNA 5LGTA 1GHCA 3EQNA 5KVRA 2EIJH 3KE2A 3ZPNA 2L4AA 4RGUA 1I7PA 3V42A 3DEUA 2V7FA 3LO8A 4OJ5A 3S16J 4BGDA 3LL7A 2C4TA 4FK8A 2RC6A 3M07A 2MD5A 3M7GA 2BM7A 1BR4A 3EUHC 4FETA 2DK5A 3F8FA 3BJAA 4LGWA 2IS1A 4GQNA 1IN6A 3NB2A 2O5RA 4RDLA 4V2GA 3VB2A 4B43A 2XRLA 3CO7C 1Q9SA 3K1NA 4P3YA 3KEQA 1ZG5A 2XPVA 1BI3A 1MZBA 4XLAA 3T8TA 4M74A 1AU7A 4D9JA 1FOYA 2P6TA 1TQPA 4MIMA 1XMKA 4HLYA 4LMYA 3A35A 1LEBA 2QUFA 3HL2A 1YHQI 1HDPA 2ZBUA 4WWVA 1IGNA 1XGOA 5AIQA 4Z1MA 4F91B 1N8RD 2X3UA 5EG0A 3VO1A 2WA0A 2XDVA 3EYYA 3RQ4A 3WU2C 2JVGA 2DMTA 1HC8A 1XMAA 3N90A 4II3A 4Y33A 5E1WA 5A2QK 1ZGJA 2B7CA 5LHGA 3WQZA 4NB5A 3FKSA 3K9TA 4MEXF 4Y17A 3I71A 1KC8D 2I5UA 5FKMA 1U5TB 3JTGA 4C2MJ 2R7QA 1QA3A 4P9FA 4IF4A 2C4UA 1TUIA 2KIMA 3S1RJ 2F5DA 4X8IA 1WH7A 4G1VA 4RD4A 4EJOA 2FXAA 2JPCA 2X48A 4JK1X 4LITA 5CQEA 3FBNB 3ZCOA 1WZ2A 1NDHA 2AQEA 2XTWA 4CCKA 4HAMA 4M3GA 2XT2A 2DA4A 2ZNZA 4B48A 3LAJA 4M9SA 2HLDA 1Q86D 3COAC 3FBIB 2DLLA 4ZZLA 2EZLA 1O8GA 1YHQB 3QYBA 2KIUA 4AC0A 1SFOJ 2CV2A 3QFCA 2KJCA 5J3LA 3IKVA 4OOIA 3JAMZ 2EH3A 2ZSIB 3KEYA 3WTTC 5AMVA 3OYJA 2ZZGA 1COWA 2HXOA 4DZPA 4RGSA 2L4MA 2GJKA 2PQ8A 4KH3A 1G3YA 2CQQA 2DOAA 3JQQA 4FX0A 2C5HA 2DW4A 1S4MA 3GXOA 4LG0A 4R79A 4Y15A 4N9HA 1MW7A 1TT0A 2G0EA 1ZLKA 2W48A 2QBYB 1JHHA 1VQNI 1WOOA 5IT3A 3B8YA 1I8DA 4YRVA 5C4JJ 1X4OA 5J3OA 3N05A 1UHMA 2NVYJ 2MG4A 4Y3OA 3F3XA 1FX7A 3TW6A 2TCTA 1WSRA 3W2AA 3N6ZA 2NVUB 1LLWA 4LIVA 3GEZA 4WX9A 4KT6A 2PLFA 5FJ8J 4GXOA 1SAUA 3D5SC 2XF5A 3PIOF 1BL0A 1W0KA 3BR3A 2AHOA 4YZAA 2ZSHB 2DMUA 1YW8A 4YXWA 4PMHA 1SVLA 1QCXA 4RLFA 4JOMA 3S32A 2BF4A 1LEAA 1D8KA 2HZTA 2Z1DA 4X07A 4HRIA 1DGRM 3BH4A 3QODA 2B5OA 2M8GX 4H9GA 1HBXG 3VYRB 3WU1B 4CYCB 3E7LA 3FMSA 3J81K 1UD3A 1OGMX 3VFZA 3W2GA 4IJAA 2Y2ZA 4AYBA 3S2WA 1YJWI 1JT0A 2L9SA 5F4OA 1NK2P 4KIFA 3A1YA 1OISA 4TMXA 5HVQC 4V19K 1KK0A 3UR3C 1SVMA 2HQ5A 4IHXA 1VQNB 1OOCA 4A3LJ 4IPAA 4XD7A 2RDPA 2O61A 1MMSA 1OYWA 2NVTJ 2H09A 1TQIA 2O8KA 1S6LA 1X1DA 2LKXA 2XEXA 2MA3A 4JP0A 4N4OB 1UD4A 1QGYA 1HQCA 2DDBA 1YIOA 3ZGKA 5ICCA 1WVRA 1ZELA 2X1EA 3L2WA 4LOCA 3TEDA 2GZWA 1MBKA 1S3JA 4XLCA 1OCOH 3OYNA 4A6DA 3IKTA 1W87A 4YEJA 2C78A 1JUPA 2G7UA 2HZDA 2QENA 2X6OA 5IYCJ 3DLLF 2DMNA 3OIOA 4MFDA 1GXQA 4ZTFA 4GDFA 1AIPA 2DETA 1WJAA 3PFIA 1Y0UA 2LYCA 4A6EA 2DT7B 1GR1A 4Y7NJ 2F4NA 2EFNA 4HE5A 3G6EI 4DQKA 3TH0A 4BBRJ 3BPXA 3JRAA 3BY1A 2IGMA 4XORA 4JMQA 5CVJA 4ROXA 3J80Z 1ERDA 3HRUA 3CDLA 1Y8QB 1YJWB 2XKPA 4AF6A 1K5CA 2IOUG 4Q47A 2DCUA 2A6HF 2M3AA 1DPRA 2IAIA 2L7KA 1LJ9A 2NNNA 1USTA 3P9IA 2B9SA 2D9RA 4D7NA 3A8IA 5LGNA 4IEJA 5F0FA 3A01B 1MDMA 3KFWX 3E6MA 4LBWA 4B4CA 2R93J 1SD6A 3KP5A 3K10A 2BY1A 4RLZA 4OJLA 4DZJA 3LQ6A 2RC4A 2RAEA 3FXUA 1M1EB 1VQOB 5HLIA 1W1WE 1X3ZB 1PJ5A 1JJ2B 1BW5A 2VN2A 4Y4RA 2CQKA 3JCUC 4YIFA 1VQ5I 1EH6A 4OIPF 3ZQFA 3BDDA 2HDCA 4U9UA 1KRHA 2Q1ZB 5DCMA 4NK8A 3L2QA 1HKSA 3TO7A 3FWEA 2CK3A 2JWTA 4E7ZA 5CDFA 3K4LA 3Q0UA 2LRDA 2M9HA 2WBMA 1FYMA 1D1AA 5HZAA 1OMIA 2QY1A 1WJEA 4HW0A 1DDNA 1V4RA 5L46A 2DTRA 1BQEA 3LA3A 5EEAA 1BJKA 5KNLA 2ZJPF 2FBKA 4RDKA 1OFEA 1JI8A 2CUEA 2W00A 4MTDA 3GTPJ 3DEEA 4Z03A 3IP4B 5EYRA 1ETKA 2COBA 2D3LA 1A8PA 2LC2A 1HDDC 3C7JA 3NEUA 2VKHA 4AIDA 4UZEA 3Q5FA 3ZSCA 3CP2A 5H6RA 3T9GA 2HOEA 3SYJA 1TWFJ 4AU7A 3F0CA 1WI3A 3DPLC 2VBUA 5GTHC 1Z6TA 1W7PA 2J7KA 3ECOA 1HXDA 1ZRCA 5IYWA 1TTYA 2STWA 4AYBN 2GQFA 1O8EA 3FY3A 2CUFA 3QPTA 3TMOA 1VQ5B 3BY2A 1FP2A 5FLXZ 3KETA 2R5YB 2DXIA 1B23P 1NRKA 1YOVB 5JVGF 4B3FX 1N78A 2NT9A 3HOUJ 4OIQF 1IO2A 1PVEA 4OAYA 5D6FA 4C3HJ 1MBEA 3Q9SA 3H9QA 4DK1A 4M3BA 1TLHB 4OIOF 1ODDA 5B3SH 4ZCMA 1DQUA 1T6ZA 4G94A 3HHHA 3QOEA 1WWXA 3RPQA 5H5JA 3QRFF 4BQOA 2QSFX 1R22A 2VBVA 4KA4A 1B9NA 1SAXA 4RM2A 2E36A 3ZQ7A 1SEUA 1W34A 1EH8A 1FC3A 2EFPA 4QSHA 2P7VB 4A5NA 3S14J 3SEQA 4RD6A 4Z4TA 1U5TC 1WU8A 1RIOH 1RZ4A 3I4PA 1NHAA 2VASA 2FD5A 1NK3P 3B6AA 4G8XA 4BY1J 2NYXA 2QSHX 3IUOA 2VI6A 3JURA 4G6QA 2BPOA 2IP2A 3C2GA 5D5XB 1MH4A 2JQ7A 5HLHA 1CZFA 1T38A 3QE2A 5JLVC 1BI0A 1G59A 5FRMA 1Q1VA 2R7DA 1UD6A 4Y9RA 5EMNA 4KITB 1EH7A 1WQ2A
chains in the Genus database with same CATH topology
3DWLE 4AVZA 2GK7A 4XKWA 1D0YA 3C2HA 2X1CA 3S3MA 4G6TB 3OIQA 3VSTA 4L8JA 3OE7A 2K9LA 1U0JA 5DN6A 4J00A 1QHGA 2CV0A 2A5WA 5C1EA 1JRGA 4GRIA 3BG7A 4URRA 4KKTA 2PJRB 3MKWB 2CW8A 2CMPA 1FMWA 2NTPA 4OAZA 4Z06A 3LSMA 1E43A 2E60A 1Y6IA 4N4NB 2UV1A 3ONQA 3G05A 3FKJA 1Z7LA 3I3LA 4NUBA 1QJVA 2M5SA 2CH0A 1VF7A 2VXDA 3PJRA 4CH7A 4W8QA 2PJRA 4XKBA 2GK6A 2O0WA 2XAUA 3DTIA 3H35A 3BCDA 3HOTA 1UD8A 2ZZQA 2E1MC 4BU2A 1NG7A 4BJ6C 3LNNA 3J7AY 1WP6A 4PSXA 3K70C 2WY8Q 2DJIA 2VJ5A 3L2VA 5HNFA 3OW7A 2HVQA 2MD0A 4XMYA 2V4DA 4DNRB 3PNTA 3AL0B 1IDKA 2GOMA 2ZFUA 4HNUA 3BG6A 3PSFA 3IAM2 1K6YA 3W2AA 4PSWA 4XNFA 4XLHA 3W2WA 4CCJA 1QHHD 3W3CA 3VMWA 3H5AA 1T0FC 4LIUA 4IZZA 2WAEA 4FASD 4B47A 2L2OA 3K4BA 4KJZA 3DDYA 4HEA2 3KX2A 4I84A 3OMYA 4ZTJA 3CP8A 2INVA 4RLQA 1WJDA 3VYTB 4ZDLA 1DP3A 2UVFA 4BE1A 2VQLA 4C2LA 2WPDA 2KLOA 1XG2A 1SFKA 4NNJA 4IQ4A 1N77A 2INUA 4CA0A 3GQAA 2R9VA 1I18A 3BCFA 2VJIA 4PJLA 4XKVA 3PUBA 4XOTA 3MD2A 3HG9A 2HPIA 2IGKA 4BDZA 4RM3A 3RPUD 5CPRB 2X8KA 1O8LA 3B4NA 4B3GA 1UELB 3MKYB 2PYGA 1G8XA 2OV7A 4YZXA 2LREA 2MABA 2IS2A 1H80A 2O1DA 4G6IA 3OEHA 1K28D 4P22A 3DTEA 4XM3A 1PYVA 4DNTB 3FDYA 1D1CA 1WTHD 2KZVA 2KPMA 2NT6A 4XL9A 1Y56A 5HLTA 3T53B 2M7AA 2R7OA 1W36C 4KKUA 1YE9A 5KCMA 2WJVA 3F9KA 3HKZA 2X51A 1H8HA 3OEEA 4NC8A 2IQ7A 3OY9A 4CCLA 4BEHB 2M4KA 1O8IA 5LFAA 4KISA 5HKKA 3CJQB 1YX3A 2M4GA 2Z2SB 2VBMA 2HPMA 3OYCA 1IDJA 1MNEA 4E7KA 4YZQA 2KVOA 3GVLA 1VBLA 2W82A 3OS2A 2JIZA 1O8DA 3SUCA 3BCAA 3S8PA 4BE0A 3VYUB 2DIEA 3H9JA 4HSTA 4B44A 3A3GA 4ZDPA 4CUGA 3BCBA 2XF7A 4BEHA 1WMRA 3OAAA 3LMMA 2M0MA 2WY7Q 5HOOA 1E3XA 5HNHA 1RWRA 3HXLA 4BS9A 1J09A 4P5OA 2BOLA 4U4BA 4PUSA 3RCOA 2KHMA 3OOCA 1MMNA 3SDBA 4ZJZA 4E7SA 4F92B 3OYHA 4H4KC 2ZTGA 1V5EA 1X1AA 4HNTA 2KQRA 2HQAA 3OS1A 3LFUA 2VQHA 3DU6A 3SYTA 4NQWB 2R7SA 2UVEA 4P1WA 1BHEA 5C1CA 3KEWA 2GJRA 2VBKA 4OZZA 3DU5A 2CFOA 1W0JA 2NZMA 3OIPA 3CF2A 2JJ2A 3HPHA 2O0VA 3GVKA 3W2VA 2JVHA 2LH9A 1X1CA 2KDOA 2LY2A 1N75A 2HVSA 4RMNA 1WJBA 3K4JA 1WJCA 4HIZA 2XSJC 4W8TA 2F43A 2GOXB 3HAGA 1KTWA 3MKZA 1NBMA 3OWTA 1KCCA 4XOPA 4BJTA 3S3NA 2VJ4A 3IAS2 5TGTA 3AKZA 1Z3XA 5FL7A 1X4PA 3PL8A 1IA5A 4TT3A 1S9HA 1O8MA 2W6IA 3EUKL 3TL4X 1KZLA 3D5LA 3M1CA 4DOZA 1AA7A 2JUGA 4E6KG 2LG4A 4BACA 2JJ1A 4HWVA 2A6TA 3BLYA 4ASUA 2NTBA 1OFMA 2IGOA 2E5ZA 3OR2C 2CW7A 5CKTA 4IQJA 2R7TA 2QX3A 2WAFA 3EPZA 1HA8A 1DBOA 1V5GA 3EQNA 3PFYA 3NE5B 3ZPNA 3L2RA 2R7XA 2MFZA 1Z21A 3V42A 1MABA 2WJYA 2V7FA 3ZXSA 2I8DA 3OYIA 2XZLA 4PFOA 3ZR8X 4BGDA 4OJ5A 3LL7A 1IB4A 1NHCA 3S93A 5KHDA 1BR4A 2E5NA 3EUHC 1R6RA 4FETA 3RTRA 4PJJA 3UNGC 3VSKA 4BQQA 2IS1A 1T5EA 2ZZEA 4GQNA 3UW0A 2DT6A 2O5RA 1EFRA 4CCNA 3G2BA 4B43A 3ZIAA 2EWEA 4ITVA 2R7RA 4IKFA 2WZPP 4NK6A 4TSFA 1BOBA 2AQFA 2WADA 4XLAA 1DGWY 4D9JA 2VKDA 2VB6A 2OC6A 3A35A 1NG6A 2W7NA 4C2UA 3I9V2 3OYFA 3OL3A 2ZZFA 3T56B 2XZOA 3HL2A 2VLAA 4Z1MA 1LKXA 2VQCA 4F91B 4II2A 2WA0A 2XDVA 3RQ4A 2Y0SA 1FX0A 4G7XA 2JVGA 3VDXA 1PXZA 3OYAA 4II3A 4Y33A 2F6CA 2R4GA 3OYMA 3PNVA 3ZQQA 2V1NA 4XLEA 3WQZA 3QYEA 3TBIA 3FKSA 2XC7A 1O8KA 1TZLA 4BE2A 2ZXIA 4E7LA 2MC4A 2KRCA 2R7QA 3K4KA 3LMWA 4OJ6A 3JU4A 3CESA 2UUZA 2IS4A 1W9XA 5CQGA 2JA2A 3K70D 3BC8A 1UD5A 4CCMA 1V0EA 3VSVA 1D1BA 1UG0A 4CSWA 2IGNA 3AFHA 4LITA 3FBNB 5CQEA 3ZCOA 2AQEA 4CCKA 2X1DA 1OGOX 1V5FA 1FMVA 4B48A 1OHHA 2HLDA 1WJFA 3FBIB 4F93B 1O8GA 2XF6A 1GQ8A 2LBFA 4C9YA 3QYBA 3AL0C 2CV2A 1O8HA 4ANJA 5FROA 1PJRA 2O04A 2ZSIB 3KEYA 4NC7A 2R7VA 5AMVA 3OYJA 2ZZGA 2W4SA 1COWA 2VBEA 1PLUA 1D0ZA 2GJKA 3LSHA 3B90A 1T95A 4F52A 2DOAA 1UD2A 2JDIA 1IRXA 1LDKB 1LVKA 4R79A 4C30A 3HUGB 1MW7A 1TT0A 4OJPA 3KYLA 3B8YA 4U7BA 2WAQA 1BPLA 1E1QA 1I8DA 4YRVA 3GRHA 1X4OA 1E79A 3OFNA 3N05A 3VR6A 2OUMA 4Y3OA 1HZEA 1KCDA 3GBGA 2P0WA 4LIVA 3EQOA 2L9NA 2WB1A 1UAAA 4KT6A 4B3XA 4QPQA 2KRHA 1SAUA 3D5SC 2XF5A 4HSRA 4D1QA 1W0KA 4UZUA 4OZYA 4YZAA 2ZSHB 2E1MB 3ZRGA 4DGWB 4YXWA 4PMHA 1QCXA 4RLFA 4JOMA 3S32A 2UWMA 2XGJA 2E1BA 3D5RC 3DLAA 2CUJA 2Z1DA 2K3PA 1OLTA 3GQ8A 4HRIA 1PKVA 3GVJA 1DGRM 3BH4A 3QODA 4XONA 3SZGA 2X85A 3VYRB 3OYLA 3M8JA 4E7HA 2R7UA 1HVXA 1UD3A 1OGMX 4W8SA 2VPLA 1QU3A 2X6XA 4AYBA 1KONA 1VLYA 2Z8GA 2V4JC 4MR0A 3K4MA 2L9SA 2VQGA 4IX7A 2KP6A 3A1YA 1BMFA 5HVQC 3U21A 3UR3C 2JSPA 1O88A 1OOCA 3GQ7A 4XD7A 1SKYB 4LG3A 3NWTA 4ZDOA 1X1DA 2Q2EB 2X6YA 1MNDA 4N4OB 2KL4A 4XN3A 4BUPA 1UD4A 3NWSA 1WPCA 2V7QA 2Z6BD 2VXZA 3ZGKA 3L2WA 1O8FA 3H5RA 1ZELA 2X1EA 2NTQA 3K4CA 3OS0A 4MXNA 3OYNA 4XLCA 4CCOA 4YEJA 2HZDA 1E0EA 1E3ZA 4ZTFA 3CJRB 1WJAA 1OR7C 1WJ5A 3E0JB 2X53S 2LYCA 2DT7B 3FPPA 4E0FA 2BSPA 1PE9A 2F4IA 3A4CA 2RNGA 4DBRA 4C2TA 2IGMA 4XORA 4BDYA 1VJSA 4JMQA 3WWGA 4Z05A 1ERDA 4PFPA 4X0GA 2GJPA 1K5CA 3LSIA 5JHFA 4BJ5C 5LD2C 2PYHA 2X6WA 2M3AA 2L7KA 1BLIA 4U87A 3E1SA 1OFLA 4DIQA 3PSIA 4G7WA 2XZPA 1VZ0A 4XQFA 2VL8A 2MYSA 2VJJA 4CZCA 2HU9A 3K10A 1Z3YA 4PJMA 2V26A 4OJLA 3VMVA 4MLOA 2FUG2 3OYBA 4XKCA 2X3HA 2NSPA 2F5VA 3VYSB 1X0CA 2QKLB 4F55A 4PJNA 1MMGA 4Y4RA 2O17A 1EE6A 1V0FA 4U49A 2KMUA 5FRNA 4BXFA 1LFPA 3HC7A 2V31A 4QPOA 4DBQA 3LSGA 3RSNA 2Q1ZB 2BVLA 3PNYA 3OYKA 3L2QA 3H0DA 2ZTNA 2CS3A 4NK8A 2CK3A 2CUZA 3DPUA 4E7ZA 2XNDA 2BW3B 2RQQA 1MMDA 2LRDA 3K4LA 5CDFA 2WBMA 2D3NA 2RREA 1BN8A 4JQFA 1WFXA 1D1AA 3DPTA 2QE7A 2QY1A 1WJEA 4BL0B 2LBFB 3SEZA 3K4NA 2LZJA 1MMAA 2L5QA 2HDWA 5KNLA 2ODLA 1JI8A 1RMGA 3OPOA 4YELA 2W00A 4EW9A 2ELJA 2K9MA 3DEEA 4Z03A 3IP4B 2PECA 3HOSA 2D3LA 2BW3A 2LC2A 3KRGA 3ZSCA 1BR2A 1D0XA 2VKHA 3OR1C 2CV1A 3CP2A 3DKXA 3T9GA 2F1MA 1JTAA 1O8JA 4DJAA 4AU7A 1H8EA 2XOKA 3DPLC 4TKOB 2NOJB 3S3OA 3MMYB 3A3BA 4KKSA 3FY3A 1O8EA 3GQ9A 3CMMA 3CZ6A 3TMOA 4OWRB 2M7BA 1DBGA 2V9KA 2ZXHA 1HG8A 3K6GA 4J01A 4YZ0A 2DXIA 4PK4A 1NRKA 2DCEA 3BC9A 4B3FX 4F3QA 2W1OA 4ZYAA 1N78A 2NT9A 3H94A 1E1RA 4OAYA 4E7JA 2Z16A 3QYFA 2LOOA 3H9QA 4DK1A 1X1BA 1YX5A 2LY1A 2W6JA 4XR6A 1W36D 1DQUA 4E4HA 1KMHA 3OOUA 1AIRA 1GLNA 4DK0A 3OYGA 3QOEA 1RU4A 3DTKA 2IS6A 3LSKA 4XLFA 2HNHA 3T51B 2QKMB 3GQBA 4BQOA 3DQVC 4FXUA 4HG2A 1BR1A 3H5NA 3VWBA 1EA3A 1P9QC 4RM2A 2BVMA 3OL4A 2V6EA 3DKYA 2R7WA 3VSLA 3SEQA 4HPQA 3HPGA 2HVRA 4ZC3A 2NSTA 2PMZA 3H9GA 2VASA 1OB0A 2K5CA 1X19A 2VIXA 3IUOA 4OJOA 4XN0A 4E7IA 3JURA 4W8RA 3C2GA 3OYEA 3EUAA 5IK2A 1CZFA 3OYDA 3VSUA 2IXSA 1G59A 5FRMA 4BQNA 1UD6A 3L2UA 2WSSA 3FHNA 4EATA 3ZPPA 4KITB 3A2KA 2QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVZ A;  4XKW A;  2PYH A;  3LMW A;  4OJ6 A;  2X6W A;  1RWR A;  3VST A;  4U4B A;  3VSV A;  1OFL A;  4XQF A;  5C1E A;  1JRG A;  2VJJ A;  3VMV A;  4OJL A;  4URR A;  1OGO X;  2NSP A;  1O8K A;  2NTP A;  4Z06 A;  1X0C A;  2UVE A;  1BHE A;  2O17 A;  1O8G A;  2VBK A;  4OZZ A;  1GQ8 A;  1EE6 A;  4U49 A;  2NZM A;  2O0V A;  1O8H A;  1QJV A;  4NK8 A;  2O04 A;  5AMV A;  4W8Q A;  1PLU A;  3B90 A;  2O0W A;  1BN8 A;  2QY1 A;  4W8T A;  1KTW A;  4OJP A;  1KCC A;  4XOP A;  4XMY A;  2ODL A;  1RMG A;  3B8Y A;  4YEL A;  4EW9 A;  1IDK A;  3GRH A;  1IA5 A;  1O8M A;  4Z03 A;  4XNF A;  4XLH A;  2PEC A;  3VMW A;  3KRG A;  3ZSC A;  1KCD A;  3T9G A;  4HWV A;  1JTA A;  1O8J A;  3EQO A;  2X3H A;  5C1C A;  4OZY A;  4YZA A;  4Z05 A;  4I84 A;  2NTB A;  1OFM A;  4PMH A;  2INV A;  1QCX A;  2UVF A;  3FY3 A;  1O8E A;  2QX3 A;  3GQ9 A;  4C2L A;  1XG2 A;  1DBO A;  3GQ8 A;  3EQN A;  2INU A;  3GQA A;  1DBG A;  4XON A;  1HG8 A;  2VJI A;  4XKV A;  2X85 A;  4YZ0 A;  4OJ5 A;  1NHC A;  4XOT A;  1OGM X;  1IB4 A;  2NT9 A;  4W8S A;  2X6X A;  2Z8G A;  4MR0 A;  1O8L A;  3B4N A;  2PYG A;  3UW0 A;  4YZX A;  4XR6 A;  1H80 A;  1O88 A;  1OOC A;  2EWE A;  2O1D A;  3GQ7 A;  1AIR A;  4NK6 A;  1RU4 A;  4XM3 A;  2X6Y A;  4XLF A;  4XN3 A;  2NT6 A;  4XLA A;  4XL9 A;  1O8F A;  2VBE A;  2NTQ A;  4MXN A;  4XLC A;  4YEJ A;  2IQ7 A;  2NST A;  1O8I A;  2VBM A;  1IDJ A;  4OJO A;  4XN0 A;  3JUR A;  4W8R A;  4YZQ A;  1CZF A;  1PXZ A;  1VBL A;  2BSP A;  1PE9 A;  1O8D A;  1K5C A;  3VSU A;  3SUC A;  4XOR A;  3WWG A;  4XLE A;  3ZPP A;  1WMR A;  2QXZ A; 
#chains in the Genus database with same CATH topology
 4AVZ A;  1GVH A;  1T08 B;  4XKW A;  4AVP A;  2GPJ A;  5BSY A;  4YC5 A;  4G6T B;  3EDP A;  4YAL A;  3AVV A;  3JRE A;  4L8J A;  1T6Y A;  3U1K A;  2EIL H;  2CSO A;  3ZZT A;  4FN5 A;  1W7P D;  4UVC A;  4J0Q A;  1LDD A;  2E1R A;  1W5T A;  4WXH A;  5DS0 A;  3U1D A;  2CW8 A;  2XAF A;  2CMP A;  1MBJ A;  4XSX F;  1FMW A;  3CO6 C;  2DOE A;  3BG3 A;  3WU0 A;  3GTQ J;  4Z06 A;  3KP3 A;  3PQJ A;  2HDD A;  3ERE D;  1Y6I A;  1YX2 A;  4Y13 A;  3H9N A;  1FBU A;  1HCR A;  4N3G A;  3KPH A;  4KN7 X;  4RD2 A;  4B8X A;  3PJR A;  2PJR A;  4A3D J;  1BM9 A;  1P6R A;  5JI6 A;  2JA8 J;  3E5Q A;  3HDD A;  2MC3 A;  4R1H A;  4RPB A;  1UD8 A;  3ABM H;  4JRA C;  4BU2 A;  3N4M A;  5F6F A;  2DO7 A;  4PSX A;  2HOS A;  2QLZ A;  2JTV A;  2HVQ A;  3S2H J;  1QX4 A;  3M8E A;  3AL0 B;  2Q6I A;  4HNU A;  1LDJ A;  4RB2 C;  3BG6 A;  3PSF A;  2Q0O A;  5FKO A;  1GXP A;  4PSW A;  4XNF A;  3I4M J;  3FXK A;  4YAU A;  2CU7 A;  5LRR A;  2OBS A;  4IZZ A;  1LE8 B;  2XAS A;  2DMQ A;  4B47 A;  5E8G A;  5JBQ A;  3B82 A;  3DDY A;  1EFT A;  2QSG X;  3KX2 A;  4I84 A;  4AM3 A;  1QFY A;  2INV A;  2MLK A;  2VNJ A;  4UAJ A;  2NOG A;  3AAF A;  2DK8 A;  4BE1 A;  2Y48 A;  3GIR A;  4C2L A;  5FO1 A;  5IP9 J;  4C43 A;  1K8A D;  3SJP A;  1ONV A;  1N77 A;  2R9V A;  4LLL A;  4M1K A;  4QHY A;  2OCC H;  2ZO4 A;  4CYD A;  4PJL A;  5K5Q A;  4G7O F;  2EPF A;  3MD2 A;  2HPI A;  1RQP A;  1ZHF A;  2O3F A;  4RM3 A;  2L7Z A;  3BPV A;  3IV5 A;  2OK8 A;  1PUF B;  1O8L A;  4RAF A;  3B4N A;  5D5V B;  2K4J A;  5KAF C;  1D2E A;  3ABT A;  4YZX A;  2LRE A;  2MAB A;  2BGI A;  2CJJ A;  4KYW A;  5FNZ A;  3FK7 A;  2STT A;  3OEH A;  3B78 A;  2O7O A;  4XM3 A;  1G7T A;  3CJN A;  4RB3 C;  4A3M J;  3G71 I;  4QWQ A;  2C6Y A;  1Y56 A;  2VKV A;  2CW5 A;  1VQP I;  2A68 F;  2AXL A;  3T53 B;  2X0K A;  1RC9 A;  3O8G A;  5D5U B;  3WTU C;  1W36 C;  1C0W A;  4BYY A;  2WJV A;  3F9K A;  1Q82 D;  3ESW B;  1TTT A;  3OSF A;  3H3V K;  3OEE A;  2JN9 A;  2M1B A;  5AIP A;  4BEH B;  5F27 A;  2LY9 A;  3CJQ B;  5IYR A;  2CQN A;  4Z4V A;  3FXR A;  5GTI C;  1IDJ A;  2VBM A;  3FHZ A;  1Z91 A;  3K1M A;  1L0O C;  2H6B A;  5FB2 A;  4E7K A;  3AST A;  4JX5 A;  1OFD A;  3NAU A;  1M1K D;  2JIZ A;  3H9J A;  1SFX A;  4B44 A;  2VBS A;  2XF7 A;  5LMZ A;  2XVC A;  3L09 A;  4OIR F;  4DYC A;  1WMR A;  3K0L A;  3J7Z I;  1E3X A;  2G0Y A;  2XGD A;  2HKO A;  1RWR A;  3HXL A;  5JFR A;  1PDN C;  2K02 A;  2JMW A;  3GCM A;  2WZN A;  2FOK A;  4PUS A;  4G7H F;  3V8J A;  1BJZ A;  1A36 A;  1OB2 A;  4XRM A;  4HDV A;  3I59 A;  3G71 B;  2LFB A;  2Y69 H;  1VQP B;  4H4K C;  4HV5 A;  3S2D J;  3B02 A;  3HTU A;  1GDT A;  1QBJ A;  2VQH A;  2P81 A;  3DU6 A;  4NQW B;  2UVE A;  1BHE A;  3MQ0 A;  2X4H A;  2GJR A;  1NB0 A;  2VBK A;  3PUF A;  1A04 A;  4BHP A;  1P92 A;  1WI9 A;  3W2F A;  2NZM A;  1VND A;  2DOF A;  3N97 A;  2QBY A;  2JJ2 A;  3ZZU A;  2O0V A;  1STZ A;  4ZZD A;  3GTL J;  2PN6 A;  2LH9 A;  3PUN A;  3FM3 A;  2A3S A;  2BVN A;  1ETQ A;  4RMN A;  2XNC A;  1ZAO A;  3HB9 A;  2XSJ C;  4ON0 A;  3ES9 A;  1MJA A;  4W8T A;  1P4W A;  2J8K A;  2GOX B;  3DEW A;  1WSV A;  3KP2 A;  5C3E J;  1UZC A;  4MQ9 F;  1NBM A;  3I55 I;  3W5H A;  3SFI A;  3WHB A;  1S29 A;  4BJT A;  1APL C;  4M53 A;  1G3T A;  3AKZ A;  3A0H C;  4HF2 A;  3PL8 A;  1O8M A;  5FD6 A;  3D5L A;  3V7R A;  4DOZ A;  1IW7 F;  3ZUG A;  2JUG A;  2LG4 A;  3IH3 A;  3R0A A;  2JJ1 A;  1ON2 A;  3AGQ A;  2B7B A;  2W85 A;  2VE9 A;  1PP7 U;  2E5Z A;  2R7T A;  2EA2 A;  3QAH A;  1OQY A;  3K2A A;  3ASR A;  2FML A;  2D1H A;  1MBF A;  2GM4 A;  2G9W A;  4X7E A;  2WAF A;  5TV2 A;  2QX3 A;  4RAZ A;  3RKX A;  1TYX A;  1CQT A;  1W5C C;  5E3M A;  5H20 A;  1QRY A;  2B0R A;  1MAB A;  2XZL A;  2EFQ A;  4QVJ A;  2W57 A;  2ZB9 A;  2E5N A;  3FMR A;  5IYQ A;  2QQ9 A;  5ICE A;  2ZZE A;  4L5J A;  2DT6 A;  3L9F A;  1GAW A;  4CCN A;  3G2B A;  3I4N J;  2QEX I;  2BSA A;  3I55 B;  1IN8 A;  5B6I A;  1YQA A;  1JTY A;  4TSF A;  1BOB A;  3CRZ A;  3MKL A;  2WAD A;  2E71 A;  3FX3 A;  1DGW Y;  1XD7 A;  5K5O A;  3JRG A;  1SMY F;  5BS6 A;  2FX0 A;  3ZN0 A;  3ASN H;  2YU9 J;  2ZZF A;  4CO8 A;  2QTL A;  1F60 A;  4S0H B;  3G4S I;  1S72 I;  2M45 A;  1S5L C;  3TO6 A;  1FX0 A;  3BQY A;  1IUF A;  3VDX A;  3OYA A;  1B8I A;  4EM1 A;  3DKW A;  1J7K A;  3B8H A;  2F6C A;  3OYM A;  3ZQQ A;  4J19 A;  3VMF A;  2V1N A;  1WXR A;  2HQR A;  3QYE A;  1BW6 A;  1KD1 D;  3FKI J;  1YW7 A;  5BPD A;  2DER A;  1X2N A;  5FIU A;  1WPK A;  1TZL A;  1HKQ A;  4EV0 A;  2DA1 A;  1MBG A;  2KJB A;  2MC4 A;  1KU7 A;  3K4K A;  3LMW A;  5E6T A;  2UUZ A;  2IS4 A;  1FSH A;  1W9X A;  1JE8 A;  4EJV A;  3SHF A;  4EH1 A;  2QEX B;  5J1U A;  2H94 A;  4CCM A;  3VSV A;  1HF0 A;  3BT9 A;  4BQA A;  4CSW A;  2IGN A;  5DSZ A;  3PEN A;  2K7L A;  1J9Z A;  4IRI A;  1I3A A;  1OGO X;  1U2R A;  2L0K A;  5EF6 A;  4IHY A;  4F93 B;  3ZMZ A;  3L1P A;  3AL0 C;  4C9Y A;  1ETY A;  3ECH A;  3SLN A;  3MEX A;  4I0B A;  3GX4 X;  2CW0 F;  3CCS I;  3G4S B;  1S72 B;  2DPD A;  2R7V A;  4RA2 A;  1PLU A;  3F6O A;  1N0V C;  3B90 A;  1HLV A;  1T95 A;  2HEO A;  3NQO A;  1FDR A;  2IA0 A;  1TP4 A;  1KQ0 A;  1LVK A;  1JKQ C;  2DA5 A;  3HUG B;  4AWX B;  4KDP A;  4IHW A;  4IHS A;  1Z6R A;  4U7B A;  2WAQ A;  2DYI A;  2KFD A;  4DYQ A;  1LUJ B;  1GVD A;  2LP0 A;  3VR6 A;  1B9M A;  2OUM A;  1FRQ A;  2JZY A;  1HZE A;  1KCD A;  3MZY A;  1TW3 A;  3TDZ C;  4V02 C;  2P0W A;  1NTC A;  4XSZ F;  2NNY A;  3ZC3 A;  1E1Q A;  1MD0 A;  3GZ5 A;  1FYK A;  1UAA A;  4QPQ A;  4D1Q A;  1EFC A;  4Z05 A;  3PA2 A;  2E1M B;  3GUD A;  4FHT A;  2DOD A;  1MNM C;  2XGJ A;  1VQK I;  1G3S A;  3FF5 A;  4P6Y A;  2FE3 A;  3D5R C;  2BYV E;  3GZ6 A;  1E17 A;  1OLT A;  1DPU A;  1GV5 A;  5H59 A;  4FIS A;  3GQ8 A;  3H09 A;  3W6J B;  3CCS B;  5M5W J;  2EBI A;  3CQZ J;  4XON A;  4KMF A;  3ZPL A;  4G1B A;  1KA8 A;  5HDN A;  4HF1 A;  3Q9V A;  2AO9 A;  2ZC2 A;  2R7U A;  1XFO A;  2PE3 A;  2OQR A;  3I1F A;  5DD8 A;  1QU3 A;  2VOD A;  1VLY A;  1YJ9 I;  1IJE A;  3AG3 H;  4IX7 A;  1Q81 D;  1UMK A;  2YX4 A;  1RKT A;  4RM0 A;  3J80 K;  4L9V A;  1X58 A;  5BOX A;  3ABL H;  2DFI A;  4A3C J;  1S8N A;  4ZDO A;  2Q2E B;  1MND A;  2KL4 A;  2BBY A;  1OCR H;  1WPC A;  2V7Q A;  4I2O A;  3M3Y J;  2VFO A;  2Z6B D;  2VXZ A;  1O8F A;  1R4N B;  2K9Q A;  3H5R A;  3OS0 A;  4MXN A;  3WHC A;  1IXR C;  3K1P A;  3D1N I;  1SAN A;  2Z33 A;  2IPQ X;  1E0E A;  1VQK B;  3CJR B;  1OR7 C;  2DY1 A;  4YEI A;  4PC7 A;  3J7A O;  2DFH A;  4ENK A;  1BI2 A;  1R7J A;  3BQJ A;  3P27 A;  2RNG A;  3WTW C;  4I09 A;  4WQM A;  3HJE A;  5GV7 A;  1IXC A;  1RET A;  2BM6 A;  3LNQ A;  2JPB A;  3OZW A;  1YJ9 B;  2DOG A;  4LD5 A;  2JA6 J;  2C2W A;  1FBQ A;  4BJ5 C;  5LD2 C;  2PMH A;  1EZG A;  3W5U A;  4A3B J;  4FT8 A;  2H8W A;  2ECC A;  2W24 A;  1Z05 A;  5FGM A;  4M9X A;  5JMC B;  4K2E A;  3VMV A;  5HDK A;  2KZG A;  2V26 A;  1P2F A;  2X3H A;  4OPW A;  4XKC A;  1E63 A;  3KP6 A;  3DXJ F;  2F5V A;  3I0T A;  4A0Z A;  3AVW A;  4YFN F;  5ILS A;  2O6W A;  1P7I A;  1X0C A;  2FEZ A;  4PJN A;  3QFT A;  1UB9 A;  2P3M A;  3KEO A;  4KT5 C;  4U49 A;  2JA5 J;  3BP8 A;  4ZYG A;  2BV6 A;  3R6K A;  4D5F A;  1LFP A;  3HC7 A;  2ZME B;  1FIA A;  4QPO A;  3LSG A;  3RSN A;  1QO0 D;  2BVL A;  4Q48 A;  3OYK A;  1KYW A;  1LLZ A;  4UV8 A;  2B63 J;  5DYM A;  2WAQ N;  1R71 A;  5FLM J;  1EP3 B;  5FLX K;  2D3N A;  2RRE A;  3BTJ A;  2QA4 I;  1WFX A;  1LE8 A;  1BN8 A;  2QE7 A;  1FZP B;  5DCF A;  2L9R A;  5ERI A;  4YII A;  2LBF B;  4BL0 B;  2HFH A;  5HDG A;  2LZJ A;  2L5Q A;  3SFZ A;  3UKG A;  3JX8 A;  2ODL A;  1RMG A;  4GFB A;  4YEL A;  4EW9 A;  3BZ6 A;  2KIQ A;  1K78 A;  1XSX A;  3ERM A;  3HOS A;  2PEC A;  1WDT A;  2BW3 A;  2P4W A;  4RGX A;  2ZJQ F;  2DA2 A;  2BGJ A;  2BM4 A;  1BR2 A;  3OR1 C;  3PO3 J;  3WNB A;  4UV9 A;  1L3L A;  1TYW A;  4Y9U A;  2F1M A;  1JTA A;  3ASO H;  1O8J A;  2QQB A;  2FU4 A;  2P5K A;  2RVC A;  1SM4 A;  1MKM A;  1VQ6 B;  4IOA F;  3ONU A;  2NOJ B;  3CUQ A;  4Z4Y A;  1TBX A;  3MMY B;  3SQN A;  2A61 A;  4DW6 A;  5J47 A;  4AIJ A;  1PUF A;  3GQ9 A;  2QGU A;  1DAR A;  4EM0 B;  4UB6 C;  4WF2 A;  1OPC A;  2DFE A;  4OWR B;  1FNB A;  2ZXH A;  1VF9 A;  3F6V A;  4YZ0 A;  4PK4 A;  3RZD J;  2DCE A;  3BC9 A;  1OFC X;  4G6D A;  2W1O A;  4ZYA A;  2LDU A;  1ZR4 A;  4EMS A;  4ESJ A;  2QA4 B;  5F0H A;  2FQ3 A;  2Z16 A;  3Q0W A;  5E17 F;  3MWM A;  1JUS A;  1YX5 A;  3P5J A;  1WOR A;  4MGR A;  4XR6 A;  1JB9 A;  1ZG3 A;  1TYV A;  2R5Z B;  3S15 J;  2VPR A;  1IXS B;  5J1Y A;  1KMH A;  1GLN A;  3DTK A;  5FD5 A;  2EIX A;  4XK4 A;  1T33 A;  2O6G E;  1BR1 A;  3LA2 A;  5J8F A;  1O57 A;  3H5N A;  1ZG1 A;  3VWB A;  1IRZ A;  1ZH5 A;  1Z77 A;  1P9Q C;  1T6X A;  4OPS A;  3OL4 A;  5KAI C;  3DKY A;  2BN4 A;  1P7J A;  3VSL A;  3PUM A;  2GBY A;  3HPG A;  2XPW A;  3TGN A;  2NST A;  2R3S A;  4QFM A;  1OB0 A;  4M73 A;  1X19 A;  2VIX A;  2V7V A;  1RUN A;  1IZ1 A;  1REP C;  4E7I A;  4W8R A;  3S1Q J;  3EUA A;  1OR7 A;  3PVD A;  5IK2 A;  2Y75 A;  1J2X A;  1IUY A;  2IXS A;  4BQN A;  2TRT A;  3L2U A;  1T8I A;  2ECB A;  2VC0 A;  3EUH A;  3FHN A;  3F8C A;  2QXZ A;  2DQR A;  5TY0 A;  2QN6 A;  2HI3 A;  1D0Y A;  5J40 A;  4DQL A;  4YDT A;  4BPR A;  3RPU A;  5GAH J;  3VNV A;  3U2R A;  1LM1 A;  3W6V A;  1VQO I;  2HR3 A;  1KK3 A;  2NS7 A;  4IW3 B;  3CCU I;  5C1E A;  1IF1 A;  2B7E A;  1SD4 A;  2VT2 A;  1JRG A;  3BG7 A;  1ZM3 A;  2OU2 A;  4KKT A;  5BMZ A;  5A8A A;  2QQA A;  3M1E A;  5E1Z B;  3KCC A;  4BXU A;  1HW2 A;  1E2X A;  1N0U A;  4OU0 A;  1TWG J;  4BH9 A;  2CRG A;  4N4N B;  4ZGQ B;  1AKH B;  1XDS A;  3DU1 X;  4ZV4 A;  2FRH A;  2DPU A;  3I3L A;  4ASN A;  5FKK A;  1QJV A;  1G6N A;  2VXD A;  1W0U A;  3PO2 J;  1E3O C;  5IYN A;  2M8E A;  2GK6 A;  1I1S A;  2XAU A;  2O0W A;  3H35 A;  5F1J A;  3HOT A;  2E1M C;  3F8N A;  4GCV A;  1N08 A;  3LNN A;  3K70 C;  1LFU P;  3KIO A;  4IRG A;  2DJI A;  2VJ5 A;  3L2V A;  3OW7 A;  4DNR B;  1E64 A;  4XMY A;  1EA0 A;  4XRS G;  2EJR A;  2ZBK A;  3DBL B;  1K6Y A;  5DTD A;  3W2W A;  4CCJ A;  1J9I A;  1QHH D;  1R9T J;  2FVG A;  3HSE A;  3H5A A;  1T0F C;  3CCU B;  2WAE A;  2EIK H;  2BXY A;  3LWF A;  3K4B A;  3ZBT A;  4WZL A;  2HTS A;  4HEA 2;  1FOW A;  2P8T A;  2ZKZ A;  2I10 A;  3BJO A;  1LPQ A;  1HOM A;  1N07 A;  3CP8 A;  1GAQ A;  2EV6 A;  3IRR A;  1WJD A;  3VYT B;  4ZDL A;  3E6C C;  2BMW A;  2UVF A;  3CCM I;  2VON A;  1QZY A;  3NAW A;  3RIR A;  2QMU A;  2EV5 A;  1XG2 A;  3P4G A;  4A3E J;  1SFK A;  4NNJ A;  4IQ4 A;  2ID3 A;  1DDI A;  3ZMD A;  5A89 A;  3GQA A;  4M71 A;  3FMQ A;  2A6E F;  3BCF A;  2VJI A;  4M4S A;  1R1U A;  2EZK A;  3HRS A;  4XOT A;  1Z1D A;  3I54 A;  2IGK A;  5LLQ A;  4BDZ A;  4Y52 J;  4PZJ A;  3RPU D;  2YWF A;  5CPR B;  1S7O A;  2HS5 A;  4FCY A;  1CF7 A;  3VPR A;  4O3M A;  2OV7 A;  3ZMV A;  2XAH A;  4MFE A;  3OSG A;  2ZL5 A;  2IS2 A;  1H80 A;  4D7M A;  4G6I A;  4BY7 J;  1K6O A;  1FBS A;  3JSO A;  3OV8 A;  3L7W A;  2K40 A;  3DCF A;  3FDY A;  4OMY A;  1WTH D;  2W7Z A;  2NT6 A;  3L2C A;  1QA1 A;  3GLX A;  1P4M A;  5B66 C;  5L3C A;  4KKU A;  3LSR A;  1YE9 A;  5KCM A;  1U3E M;  2QQ8 A;  4M6X A;  3ABK H;  3W2I A;  3ISX A;  3HIF A;  2IQ7 A;  4W97 A;  1QVG B;  3OY9 A;  5IOZ A;  1O8I A;  5LFA A;  5HKK A;  4Z4W A;  3CCM B;  2FBH A;  4MNU A;  5K5R A;  1XN7 A;  2HPM A;  3SDG A;  1ORK A;  3JRC A;  1MNE A;  4O6J A;  1P4A A;  4PAB A;  1VBL A;  3CCQ I;  1QQI A;  2YSR A;  4BAY A;  1OKR A;  4IRH A;  6PAX A;  2WV0 A;  1R1V A;  3BCA A;  3VYU B;  2OYN A;  4HST A;  2ZIT A;  3A3G A;  4MTE A;  3OAA A;  3LMM A;  2M0M A;  1T2K A;  1S7E A;  5H2F C;  4RBO A;  2NVQ J;  1YW9 A;  4BS9 A;  1OCC H;  3CCY A;  3I58 A;  1R00 A;  3QPH A;  4LB5 A;  2BOL A;  2ZME C;  1B1B A;  3MFK A;  1MMN A;  5HS8 A;  3RYR A;  2TDX A;  4ZJZ A;  2O9L A;  1W4M A;  1MSE C;  3QWL A;  3OYH A;  2XTY A;  3M4O J;  3ZQC A;  2HWV A;  2ZTG A;  3CCJ I;  4HNT A;  4OM9 A;  2HQA A;  5J4V A;  2VBW A;  1VTN C;  2DMP A;  3AG4 H;  3BR0 A;  5EGO A;  4OZZ A;  5JLW A;  1DAB A;  2Y9Z A;  1UCR A;  2EA4 A;  1CLW A;  2M30 A;  3HUG A;  2QGG A;  1BJA A;  4A3F J;  1QVF B;  4PJ0 C;  3AVU A;  1IAW A;  3V7S A;  5ED4 A;  3W2V A;  2LY2 A;  2KDO A;  1N75 A;  5IP7 J;  3CCQ B;  2HVS A;  1KK1 A;  2F5F A;  2F4M B;  3K4J A;  3QOP A;  1WJC A;  5HZB A;  3QU3 A;  4HIZ A;  4D0P A;  5ILU A;  3LST A;  1KTW A;  4EGZ A;  1FEX A;  2BXZ A;  1OYY A;  2P5V A;  3IAS 2;  2EFW A;  1ZRD A;  4BXX J;  1G7R A;  1Z3X A;  1IA5 A;  2OD5 A;  2VFM A;  3WG9 A;  3DF8 A;  3EUK L;  2A5Y B;  3TL4 X;  1UJ8 A;  3ZMU A;  4ENM A;  1YRN B;  2IRF G;  3GTO J;  2D2W A;  4UUS A;  4K1X A;  1F5T A;  2JN6 A;  4E6K G;  3CPX A;  5E1X A;  4IVN A;  2CGP A;  2Y30 A;  1LFB A;  4ASU A;  3QQA A;  1BIA A;  3CCJ B;  5KW9 A;  1OFM A;  3OR2 C;  1LQ1 A;  4JYK A;  1KQS B;  3RKW A;  1WSU A;  2M87 A;  2V5I A;  2GIZ A;  3HOW J;  1V5G A;  1CGP A;  4C3I J;  3OJW A;  2VBZ A;  3NE5 B;  3KYD B;  3L2R A;  1J59 A;  1Z21 A;  3PIP F;  4HF0 A;  2WJY A;  3ZXS A;  1NHC A;  4LK1 F;  3WG7 H;  3Q3S A;  2EFO A;  5J8C A;  2K27 A;  4XLP F;  4QTR A;  1IRG A;  1SFE A;  5KHD A;  4A3G J;  1USS A;  4X7D A;  1EP1 B;  3RTR A;  3ZMT A;  3GTK J;  1QFZ A;  3UNG C;  3VSK A;  4BQQ A;  5LEK A;  3VOE A;  3UW0 A;  1EFR A;  2XAJ A;  4RD3 A;  1R5G A;  2P7C B;  2EWE A;  1FY7 A;  4ITV A;  2R7R A;  3TKY A;  4IKF A;  2WZP P;  1K4S A;  1GO2 A;  3G3Z A;  1QGA A;  1ZLJ A;  5EG0 B;  4X0C A;  5C44 J;  2AQF A;  2XAQ A;  4M3F A;  3R0J A;  2ELH A;  3E1Y E;  3U2Q A;  1ETO A;  4FTH A;  2VKD A;  2OC6 A;  5ILV A;  3BH6 B;  3VEP A;  2LTP A;  1KJZ A;  2W7N A;  2ADU A;  1EP2 B;  2DYS H;  1LVA A;  3LOC A;  3D0S A;  2VQC A;  4II2 A;  2QDX A;  2CRV A;  1O7L A;  2J5P A;  4UB8 C;  2Y0S A;  3BH7 B;  4ACA A;  5CVV A;  1H0M A;  2R4G A;  1EFU A;  3PNV A;  3GW2 A;  4XLE A;  2CF4 A;  1ACI A;  1ITY A;  3FM5 A;  1D5Y A;  3SEJ A;  1O8K A;  3H1C A;  4BE2 A;  2F5E A;  2KRC A;  1O3T A;  5GAG J;  4FE4 A;  3FXM A;  1BOA A;  2XAG A;  1E62 A;  1I6H J;  3BC8 A;  4LBV A;  4L0Z B;  3I5U A;  1D1B A;  4ACB A;  2YS9 A;  3U9G A;  3AFH A;  4ZYH A;  1Q7Y D;  2A05 A;  1W35 A;  5B1A H;  4DNC A;  3KYC B;  1LNW A;  1QZE A;  1V5F A;  4MEY F;  1QG0 A;  1U5T A;  2LF8 A;  4XLN F;  1FNN A;  2HYJ A;  3HSR A;  1OHH A;  1ZGA A;  5L3D A;  2I1L A;  3R61 A;  2CO5 A;  2BHZ A;  1WJF A;  1FJL A;  3GTG J;  3ASS A;  3WGH A;  1CQX A;  4Q5S F;  4P1V A;  1FLI A;  2QWW A;  1TC3 C;  2WTE A;  2LBF A;  4S05 A;  2H8R A;  4LG0 B;  1GQ8 A;  3ASQ A;  2NS0 A;  3BTC A;  3SZP A;  1AHD P;  3JR9 A;  2E2I J;  3WND A;  4I7H A;  1O8H A;  2AHQ A;  1U9O A;  1FNC A;  4L5E A;  9ANT A;  1ZM9 A;  3IRQ A;  2L01 A;  1HA3 A;  4I98 B;  3LSH A;  1ZM4 A;  3ZOB A;  3HTS B;  3HSF A;  1Y0R A;  4EVI A;  2DN0 A;  1UD2 A;  5JVT A;  2JDI A;  4H0E A;  1IRX A;  1A6I A;  5HS9 A;  4L9N A;  3V8K A;  3WBK A;  3KP7 A;  5CVI A;  2V1D A;  3KYL A;  1UFM A;  2QVO A;  1QUF A;  1BPL A;  3GRH A;  1Y8R B;  1FWZ A;  3OFN A;  1IJW C;  4Q7J B;  4JX4 A;  1O3S A;  5IT9 Z;  1IHM A;  4P96 A;  2BY3 A;  3GBG A;  2DFF A;  4WXC A;  2OAZ A;  4FE7 A;  1R5B A;  1T6S A;  3EQO A;  2L7M P;  3HOX J;  4AIH A;  4B3X A;  3HBL A;  4P9S A;  5F4M A;  4OZY A;  4HSR A;  3B73 A;  4A3I J;  1DP7 P;  3ZRG A;  4KIB A;  1TW2 A;  2EIM H;  3HM5 A;  3DLA A;  1B59 A;  3IH2 A;  1BX0 A;  2CUJ A;  2Z3Y A;  2K3P A;  2OJE D;  1DU0 A;  3CME I;  2VNH A;  1HST A;  1UG2 A;  2YWG A;  4RB1 A;  4L18 B;  1KTV A;  3SZG A;  2GXB A;  1EF4 A;  4FWT A;  3OYL A;  1HVX A;  3IC7 A;  4L9T A;  2X6X A;  1Z7U A;  4FQG A;  2V4J C;  1JJ6 C;  3GFI A;  3BJ6 A;  3JRI A;  4U0V A;  3O6B B;  1EWY A;  2D74 A;  5F04 A;  3V76 A;  1O88 A;  2DYR H;  3G1O A;  2PI0 A;  3GQ7 A;  2M2E A;  4LG3 A;  4W1U A;  1SKY B;  4NBQ A;  5IYD J;  4CYC A;  2X6Y A;  5E18 F;  2Q8K A;  2RV8 A;  1ZGW A;  3P7N A;  4KN4 X;  2HDN B;  1V5V A;  2NTQ A;  2DI3 A;  2Y0S N;  3K4C A;  4CCO A;  3MN2 A;  3RQI A;  3MCA A;  2F5C A;  2OBP A;  1E3Z A;  1JA0 A;  1ETX A;  3ZMS A;  1DU6 A;  3RJP A;  3E0J B;  1WKM A;  2X53 S;  4LBY A;  5BQT A;  3CME B;  2F3L A;  3MZ8 A;  2DA6 A;  2QYU A;  3FPP A;  1BA5 A;  1W5S A;  2BSP A;  2PLY A;  1PE9 A;  1MDM B;  4DBR A;  2PJP A;  2O03 A;  1FRN A;  4C2T A;  3WWG A;  1KGS A;  1FNM A;  3WTS C;  4RB0 A;  4PFP A;  4X0G A;  4ENN A;  3LSI A;  5JHF A;  3OP1 A;  3U6B A;  2PYH A;  3BR5 A;  2X6W A;  3K2Z A;  1QH0 A;  1YIT I;  5FO5 A;  1OGJ A;  1BLI A;  3E1S A;  3V8L A;  2GLO A;  1OFL A;  3LQR A;  2DT5 A;  3PSI A;  4DIQ A;  1JJ8 C;  1AKH A;  4HYE A;  1VZ0 A;  4RS8 A;  4XQF A;  2ISZ A;  4G7W A;  2DEU A;  5DCM B;  5D4R A;  4PJM A;  1VI0 A;  3QFR A;  4MLO A;  2FUG 2;  3OYB A;  2NSP A;  1G3W A;  2FMY A;  1SMT A;  5J35 A;  3F23 A;  1JGG A;  2L02 A;  2QKL B;  4F55 A;  1MMG A;  2VKE A;  1N25 A;  2NXN B;  4CZZ A;  1F9N A;  5DNS A;  1OYI A;  1DDG A;  1EE6 A;  3C1D A;  3A01 A;  2L7F P;  4YHB A;  3K7A J;  5GP9 A;  2V31 A;  4ZYE A;  2KDZ A;  4KMU X;  2CS3 A;  4OPO A;  2XND A;  3H3U A;  1K4T A;  1MMD A;  2MLG A;  1IV6 A;  3DPT A;  4KUM A;  1Y1W J;  2NV4 A;  3JQP A;  1QA6 A;  3SEZ A;  3Q3A A;  3I56 I;  1WOS A;  1MMA A;  3CMY A;  2HDW A;  3RY8 A;  1W7P B;  4HA8 A;  2YPR A;  5CLS A;  3AGP A;  4PC2 A;  2ELJ A;  4NC6 A;  1YIT B;  3NRV A;  2BGC A;  3QPL A;  2D45 A;  4LLN A;  1IB0 A;  3P26 A;  1OB5 A;  2PEX A;  2QM3 A;  4P9U A;  3PM1 A;  3KRG A;  4BKX A;  1D0X A;  4HQE A;  4YAF A;  1TWC J;  4U88 A;  2GWR A;  2ZNY A;  4DJA A;  2XOK A;  3D26 A;  3T8R A;  4KIG A;  2Z9O A;  4TKO B;  1MBH A;  4YG2 F;  3CXC B;  1XTA A;  1GV2 A;  3RIQ A;  3A3B A;  1WOP A;  2ICW G;  2E35 A;  4TV7 A;  2RC5 A;  3CMM A;  1VHO A;  2BHY A;  1QNT A;  4TN1 A;  2M7B A;  2V9K A;  4P2N A;  4J01 A;  5DS9 A;  2CQ7 A;  4F3Q A;  3F22 A;  3VNU A;  1XPX A;  3H94 A;  1YG2 A;  2BY0 A;  3BZC A;  4R8H A;  2WC2 A;  1CNE A;  1R4M B;  3Q6R A;  3QYF A;  3ZBU A;  3E5X A;  4PGG A;  1WGX A;  1QVU A;  3I56 B;  3T1B A;  1T98 A;  3FXL A;  1W36 D;  1RR8 C;  4E4H A;  3LSJ A;  3JRF A;  4DK0 A;  2R5Y A;  1RU4 A;  3LSK A;  5LBQ A;  2DTZ A;  2HNH A;  2OBR A;  2QKM B;  2PX9 A;  4BNC A;  1V3F A;  3GQB A;  5GAD J;  3HZJ A;  3T51 B;  1QFJ A;  5J4Y A;  3R6S A;  5IYP A;  4FX4 A;  1HW1 A;  2DJN A;  2XIG A;  3F8M A;  4ZYD A;  2BVM A;  2R92 J;  3AVT A;  3I64 A;  5F64 A;  5LRS A;  2R7W A;  3JTH A;  1FIP A;  4YCQ A;  4ZC3 A;  1AOY A;  1MH3 A;  5K7Z A;  3H9G A;  2K5C A;  2R7F A;  2UXN A;  4QIW N;  3CB4 A;  4OJO A;  4XN0 A;  2K85 A;  4YIR X;  4X1E A;  2NAZ A;  3OYE A;  1KQ9 A;  1XB2 A;  5F1R A;  2DAO A;  3ELK A;  3WY9 A;  1XGM A;  4EJW A;  3AK5 A;  5JHU A;  3E5U A;  3QPS A;  1R36 A;  2XHK A;  3ZPP A;  3A2K A;  2VYQ A;  3TOB A;  4Z4Z A;  1RNL A;  2GK7 A;  3CCL I;  2B0L A;  4ZCI A;  3C2H A;  1WCM J;  2X1C A;  1OCP A;  3S3M A;  3OIQ A;  4BBS J;  3VST A;  3SJZ A;  5CVR A;  2K9L A;  4IOC F;  1U0J A;  5DN6 A;  4J00 A;  2VBX A;  5E20 A;  4MYU A;  1QQ1 A;  3FXQ A;  3M8F A;  5TJJ A;  3MCZ A;  4GRI A;  5TIS C;  1X3U A;  1D3Y A;  3CC2 I;  2RGV A;  2ZXJ A;  2PJR B;  3MKW B;  2J8I A;  3V7C A;  5M5X J;  1GJR A;  2NTP A;  4OAZ A;  5M3M J;  3LSM A;  4PGH A;  1E43 A;  4HNV A;  1EJ9 A;  4UUV A;  1D8J A;  3HRM A;  2V79 A;  2XKO A;  3MVP A;  3BG9 A;  4PCQ A;  1ZAR A;  3FKJ A;  4XRF A;  3HOY J;  1E3H A;  1Z7L A;  4RDJ A;  1KK2 A;  2IA1 A;  3CD6 I;  5L3F A;  4NUB A;  1PJ7 A;  1R5N A;  2K3F A;  4PC1 A;  1I3Q J;  2FOW A;  2GA1 A;  4XKB A;  2HYF A;  1G7S A;  3DTI A;  3IWF A;  3BCD A;  4AIK A;  4CGZ A;  1NG7 A;  2M5W A;  4Z4U A;  1WP6 A;  1GUU A;  3CCL B;  3U6K A;  5HNF A;  2MD0 A;  1IDZ A;  3T5X A;  1X1P A;  2ZJ2 A;  1IDK A;  3BWG A;  3FXJ A;  2ZFU A;  2H27 A;  3IAM 2;  1UHW A;  4XRS A;  3R60 A;  1VQ6 I;  1Y39 A;  3W3C A;  3VMW A;  1VLO A;  4A93 J;  1NB9 A;  3CCV I;  2BM5 A;  4LLG F;  1HF2 A;  5THX A;  1F1Z A;  3CC2 B;  1XSD A;  3OMY A;  4HX4 A;  2M0C A;  4ZTJ A;  4RLQ A;  4WZK A;  1XX5 A;  4A5M A;  2VQL A;  2WPD A;  2KLO A;  2COM A;  2O8X A;  2QZA A;  3O3K A;  4CA0 A;  3CD6 B;  3B6C A;  1JNY A;  2QTZ A;  1I18 A;  4U0W A;  1QRB A;  3LA7 A;  2F2E A;  4YAO A;  3PSS A;  1TQM A;  2K86 A;  1TLL A;  1Z0X A;  3BR6 A;  5IP6 A;  3EYI A;  3DFG A;  2E1C A;  3G1M A;  2PG4 A;  3W6K B;  3GO5 A;  2X8K A;  1H85 A;  4Y7C A;  4Z4R A;  2BM0 A;  2VFN A;  4PAA A;  4B3G A;  2ACJ A;  5GPA A;  2PYG A;  4IHT A;  1ELO A;  1G8X A;  1SKQ A;  1H9G A;  4IO9 F;  5JLX A;  5M5Y J;  3SJM A;  1F20 A;  4B4D A;  2O1D A;  1K8F A;  1TVC A;  3CMA I;  2D1V A;  4AD9 A;  2ETH A;  1K28 D;  1BC8 C;  2EWN A;  1XCV A;  3DTE A;  3FJO A;  4HBL A;  3QFS A;  4P22 A;  4DNT B;  2Z99 A;  1D1C A;  1I27 A;  2KZV A;  2KPM A;  3G73 A;  1H42 A;  3WYA A;  4XL9 A;  2MW8 A;  3CCV B;  2RNJ A;  2M7A A;  3GLL A;  4UHT A;  3HKZ A;  2X51 A;  1H8H A;  3RDI A;  3BRO A;  2F48 A;  1B2R A;  1O7F A;  4CCL A;  2M4K A;  3FIS A;  5DD4 A;  4KIS A;  4X05 A;  1IN5 A;  2GXG A;  3SY2 A;  1YX3 A;  2M4G A;  3OYC A;  1Q1H A;  1A31 A;  1RR7 A;  4IHV A;  3PET A;  4YZQ A;  4A69 C;  2KVO A;  3GVL A;  1EXM A;  1G4D A;  2Y0M A;  3OS2 A;  2GAU A;  4F7D A;  1I50 J;  2F4O B;  3S8P A;  3SUC A;  2DIE A;  4HV6 A;  3I59 B;  4A12 A;  4ZDP A;  5CJ9 A;  1XQB A;  2XNJ A;  4JBA A;  5ICF A;  4BEH A;  2E1O A;  2G7H A;  2V7W A;  2CC2 A;  5HOO A;  1U8R A;  3OKX A;  2HKX A;  2MH9 A;  1G7C A;  2YUS A;  5J1R A;  4NBS A;  4WCG A;  4UZF A;  4HQM A;  1R1T A;  3RCO A;  3CMA B;  1K79 A;  4HDU A;  1ZKG A;  4EQQ A;  4OOV A;  2CWE A;  2XGC A;  2HYG D;  2DQL A;  3TO9 A;  3ZQH A;  5FFZ A;  4A0Y A;  3MMP A;  4MYT A;  2WWY A;  1PP8 F;  2M34 A;  4ZGN B;  2Z5U A;  4I02 A;  3X2Q H;  4G5G A;  3KP4 A;  1V5E A;  1X1A A;  4WWC A;  4Q4Z F;  3OS1 A;  2XV4 S;  4GYI A;  5KK1 A;  2R7S A;  2PIA A;  3K69 A;  3CDI A;  1SFU A;  3KEW A;  3PA1 A;  4M9Z A;  2CFO A;  1W0J A;  5FFX A;  1O3Q A;  1TSP A;  1OCT C;  3GTM J;  1KU9 A;  1A5J A;  3HPH A;  4XBF A;  3OZV A;  3BR2 A;  4RDU A;  2E2J J;  1QRC A;  2JVH A;  1X1C A;  2EV0 A;  2ME0 A;  3WBJ A;  3CCR I;  3H3Z A;  4NQW A;  4I0A A;  2F43 A;  1J5Y A;  1IDY A;  5E3N A;  3KZZ A;  2ZJR F;  4BHC A;  5BNG A;  4ZH4 F;  5K1Y A;  1ZR2 A;  2V6C A;  4XOP A;  3S3N A;  3CC4 I;  2VJ4 A;  1MSF C;  5TGT A;  1D5V A;  4M0L A;  2JJ7 A;  3HOV J;  4RCY A;  4TT3 A;  1PJ6 A;  4P3I A;  1MJ9 A;  2J5O A;  5EDN A;  1YTY A;  3M1C A;  3HGY A;  1AA7 A;  5TR9 A;  3LSP A;  4HWV A;  1ZRF A;  2IW5 A;  1N06 A;  5CVU A;  3LVB A;  1R5I D;  2NTB A;  4CHU A;  2IGO A;  4OOS A;  2V1U A;  3E20 A;  5HLG A;  1U6G A;  2YUH A;  1XGN A;  3AVY A;  1SD7 A;  1FT9 A;  1XGS A;  3CLO A;  3G1L A;  1DBO A;  1XSV A;  1JXS A;  2VNK A;  2OTJ I;  4WZE A;  3PFY A;  1D1N A;  5LEJ A;  2R7X A;  1G2H A;  1IV8 A;  2K9S A;  2MFZ A;  1FSE A;  4KIC A;  5JR3 A;  2I8D A;  3OYI A;  4KNY A;  4PFO A;  3ZR8 X;  1IB4 A;  3CCR B;  3S93 A;  1JGS A;  2IVM A;  1VQ4 I;  3A0B C;  1JKO C;  2IA2 A;  3PSZ A;  2LNB A;  1R6R A;  1Z9C A;  5B1B H;  4PJJ A;  1T5E A;  4OP7 A;  5D5W B;  4YFO A;  1DG1 G;  2VBT A;  1I39 A;  3HKZ N;  3PQK A;  3ZIA A;  3CC4 B;  2QCO A;  2VT3 A;  2Q6O A;  4NK6 A;  5DUK A;  1WRJ A;  3V7A A;  1KYZ A;  5F08 A;  5F0C A;  1QUE A;  4EM2 A;  3GZN B;  1F43 A;  3NAR A;  2HQN A;  4DQ2 A;  1XMX A;  3P9C A;  1B8I B;  3J81 k;  2C5B A;  2VB6 A;  3A1P A;  2UXX A;  3W2H A;  1NG6 A;  4C2U A;  3I9V 2;  3OYF A;  2BV3 A;  3OL3 A;  2VZL A;  2L54 A;  1J0R A;  3T56 B;  2XZO A;  4R71 A;  2W25 A;  2VLA A;  1LKX A;  1BC7 C;  1FND A;  4G7X A;  2OTJ B;  5IY5 H;  1PXZ A;  2LKP A;  2LSO A;  1AWC A;  2NVX J;  1ZRE A;  3TBI A;  4EEF G;  1DUX C;  2XC7 A;  1YI2 I;  1VQ4 B;  2ESH A;  1BIB A;  4E7L A;  2ZXI A;  3OOP A;  4QV2 A;  3G6E B;  4OJ6 A;  1XCB A;  3JU4 A;  3CES A;  1HW5 A;  3CLQ A;  4G12 A;  3CCE I;  5CQG A;  4RCZ A;  4LC0 A;  2JA2 A;  4X6A J;  1UD5 A;  1IG7 A;  1V0E A;  1JTX A;  5H6Q A;  1JUM A;  4OMZ A;  1UG0 A;  3RYP A;  1K83 J;  4LBZ A;  2DA7 A;  2V7T A;  5IT9 K;  2IT0 A;  2BZT A;  2X1D A;  3RKY A;  1YFH A;  1FMV A;  4I6Z A;  1VQ8 I;  3C18 A;  4CXF A;  5FA6 A;  3MHP A;  4MQV A;  2XF6 A;  3LYC A;  2ZL6 A;  1F36 A;  1ENH A;  2RQP A;  2V9P A;  2JRT A;  2BEO A;  2BE5 F;  5A2Q Z;  4ANJ A;  5FRO A;  1PJR A;  2O04 A;  1ZTR A;  4NDL A;  4NC7 A;  2W4S A;  4B09 A;  3O2P E;  4LB6 B;  3I53 A;  1D0Z A;  5D8L B;  4QVA A;  1VQL I;  3MAJ A;  4G9Y A;  5KSW B;  1QZZ A;  4F52 A;  2ZFW A;  3TOA A;  2MBF A;  1VQ9 I;  1LDK B;  5E3O A;  1YI2 B;  3HYI A;  4C30 A;  1MRZ A;  3BR1 A;  1QGP A;  2PFB A;  1W0T A;  3CW2 A;  3CCE B;  5ICG A;  4U7D A;  1E79 A;  3T0Y A;  1FTZ A;  2ZL7 A;  5C4X J;  5D4S A;  4TMZ A;  4I99 C;  2FJ1 A;  5LGU A;  2EZI A;  4N0B A;  1K73 D;  5EZG A;  1YYV A;  1OCZ H;  2V9V A;  3WTX C;  1A6Q A;  3JW4 A;  2L9N A;  2WB1 A;  1YS6 A;  2QF7 A;  2VPL A;  3A8K A;  2KRH A;  2XB5 A;  2DU9 A;  5L3B A;  2C77 A;  4UZU A;  3LQE A;  5C1C A;  5GPC A;  4HE6 A;  4EJU A;  4DGW B;  3ABU A;  5DDG A;  4IL6 C;  1VQ8 B;  2UWM A;  3H36 A;  4OOX A;  1D8T A;  3DV8 A;  2E1B A;  4PC3 A;  2VFQ A;  2MH2 A;  4GO1 A;  2O0Y A;  5J6X A;  1FOK A;  1PKV A;  3FXO A;  1QGZ A;  4Z4S A;  1ULY A;  3GVJ A;  3Q39 A;  3WGI A;  3ZQL A;  2X85 A;  4E70 A;  3GYH X;  4GGG A;  3M8J A;  5E79 C;  1R23 A;  4E7H A;  3QSY A;  3BNW A;  4W8S A;  1VQL B;  2NRA C;  1KON A;  1A35 A;  2EIN H;  2FBI A;  4LFU A;  3K4M A;  2Z8G A;  1B72 B;  1Z67 A;  2ESN A;  2VQG A;  3C3W A;  3IH4 A;  2KP6 A;  5AN9 A;  1VQ9 B;  1U2W A;  4ETS A;  1TWH J;  1BMF A;  3ML6 A;  3U21 A;  4CIC A;  2XRN A;  2JSP A;  3SQV A;  1RUO A;  5GV8 A;  2CQX A;  1EKE A;  2FX3 A;  1POG A;  2E2H J;  2N8G A;  2E7W A;  2GQQ A;  2FA5 A;  3NWT A;  1T0F A;  1QPI A;  1FTT A;  4XN3 A;  4M6Y A;  4BUP A;  3NWS A;  2V7X A;  4U0Y A;  2VBE A;  2LR8 A;  2ME6 A;  2DDA A;  4EGY A;  3KZI C;  1R58 A;  2K4B A;  2Y31 A;  2HOA A;  2V1X A;  4TMW A;  2LLK A;  3AVX A;  2VC1 A;  1TNT A;  2XTX A;  3A8J A;  1H8A C;  4UNO A;  1WJ5 A;  2FNA A;  4A2U A;  4V2F A;  2HOT A;  2Q2E A;  2GA2 A;  3J7Y J;  1IC8 A;  3J81 Z;  1J75 A;  4I76 A;  2H1L A;  2ID6 A;  4E0F A;  2E1N A;  2DBB A;  1TNS A;  2F4I A;  4OIN F;  5K7H A;  2IBD A;  3A4C A;  4NCN A;  3ZN1 A;  4TMT A;  2L9V A;  3BOQ A;  3LFK A;  1E3P A;  2CYY A;  3QP6 A;  2XSD C;  4HX8 A;  4BDY A;  3O8H A;  1VJS A;  5FKL A;  3SZE A;  1QPM A;  3BTI A;  3HRT A;  1FP1 D;  3JSP A;  1BN5 A;  2GJP A;  1Y1V J;  5FLV A;  2MSY A;  1YLF A;  3DP7 A;  2H6C A;  5EEG A;  4U87 A;  4QLC U;  2OTL I;  4MR0 A;  2OZU A;  1R5H A;  1ZYR F;  4B3A A;  1TYU A;  2FNP A;  2XZP A;  4DYR A;  2JA7 J;  1JKP C;  2VL8 A;  2MYS A;  2VJJ A;  4CZC A;  2HU9 A;  1Z3Y A;  4M72 A;  2EQR A;  1U78 A;  1SVO A;  2VOO A;  2P5L C;  5L3G A;  4RJL A;  3VYS B;  3JRB A;  4GYG A;  2VE8 A;  2O17 A;  2UZK A;  1RKW A;  4TMV A;  2R6H A;  2GXA A;  3KLN A;  4N3N A;  1V0F A;  1YIJ I;  3KZY A;  2KMU A;  5EEH A;  1N05 A;  2WR8 A;  3SXY A;  5FRN A;  4BXF A;  2KIS A;  2X9D A;  1IN7 A;  3VO2 A;  3K70 D;  4DBQ A;  1BBY A;  2VUM J;  2ZTN A;  3PNY A;  3CF5 F;  3H0D A;  2XT4 A;  5DEQ A;  1K78 B;  1L1I A;  2PBI A;  2BY2 A;  2MGQ A;  4HZF A;  2CUZ A;  3DPU A;  3MZH A;  2BW3 B;  2RQQ A;  2VOP A;  1K9M D;  1TT5 B;  4JQF A;  3ZQG A;  5HOD A;  4A3K J;  3K4N A;  1I6X A;  2WB1 N;  5LHI A;  5E8I A;  3CUQ B;  4N9I A;  2EK5 A;  2ZME A;  3OPO A;  3BQZ A;  5EJC A;  3Q38 A;  2K9M A;  1K61 A;  4WXD A;  1BX1 A;  2OTL B;  2YX7 A;  4CQJ A;  1W2B B;  1Y0Y A;  3F72 A;  2CV1 A;  1H89 C;  3DKX A;  2AS5 F;  4C3J J;  4L0Y B;  1EV7 A;  3ASP A;  4RAY A;  3ROU A;  4Z6Y A;  4UY8 I;  1H8E A;  4WK8 F;  1QVT A;  5B5E C;  1KU2 A;  4RD1 A;  3S3O A;  1IJF A;  3FPK A;  4KKS A;  4C0S A;  2OA4 A;  3WOD F;  3CZ6 A;  1MJB A;  5D6E A;  3QU6 A;  1JKR C;  1YIJ B;  1Y0N A;  5IOY A;  1IRF A;  2BX6 A;  1KZH A;  1DBG A;  1HG8 A;  3K6G A;  3KLO A;  3S1M J;  4F7Z A;  1VHE A;  4Z2Y A;  1TL8 A;  2KIF A;  1H88 C;  5FO0 A;  1E1R A;  4E7J A;  4S04 A;  3CC7 I;  1M90 D;  2LOO A;  4WZT A;  1X1B A;  3WTY C;  1BI1 A;  3ULQ B;  1CNF A;  2JUC A;  2LY1 A;  2OBT A;  1JHF A;  2AXT C;  2W6J A;  3M9A A;  1NH3 A;  3EQL F;  3OOU A;  5DM7 F;  2HXI A;  1AIR A;  2EZH A;  3OYG A;  2FF4 A;  3JQR A;  2GRE A;  2IS6 A;  4XLF A;  3P9K A;  3QP5 A;  3Q0V A;  3WGG A;  3DQV C;  4FXU A;  1V55 H;  2OZ6 A;  4HG2 A;  4M6V A;  1EA3 A;  1S7A A;  2V6E A;  5HXB A;  1UHS A;  3H92 A;  2R7Z J;  2JSC A;  4HPQ A;  1VFC A;  2HVR A;  2R5Z A;  3CJT B;  2ZCW A;  2PMZ A;  4I01 A;  5IPA A;  4X06 A;  2Q6K A;  1I5Z A;  2KT0 A;  2VBY A;  3IHU A;  2OQG A;  4ABZ A;  3TDU C;  2E34 A;  2IEK A;  2JK3 A;  3ONY A;  3R6J A;  1YO5 C;  1GT0 C;  1RPW A;  5IYB J;  3WTZ A;  3E97 A;  2PMD A;  3DBH B;  3F8B A;  2YU3 A;  4BHB A;  4ESB A;  3OYD A;  2E19 A;  1VQM I;  1XS9 A;  1RQR A;  5F4J A;  3VSU A;  2E7X A;  2WSS A;  1NJI D;  4EAT A;  5GAE J;  1SD5 A;  1KU3 A;  5EZH A;  1YS7 A;  3DWL E;  3OZU A;  3GME A;  2OPT A;  3BY6 A;  5DV5 A;  1PUE E;  2YWH A;  3CC7 B;  3GFJ A;  4RAG A;  1OGI A;  3TQN A;  5BPI A;  2P6S A;  3FK6 A;  3REO A;  3OE7 A;  4X7C A;  5M3F J;  3GSI A;  1QHG A;  2CV0 A;  4YAW A;  2A5W A;  1HKT A;  3GVA A;  1XC5 A;  3F21 A;  4A3J J;  4URR A;  5A88 A;  3A02 A;  4A0X A;  4KFC A;  5TRD A;  3W2E A;  4P55 A;  4LK0 F;  2XC1 A;  1P4X A;  2E60 A;  2UV1 A;  3ONQ A;  2LKS A;  5E3L A;  3G05 A;  3OW2 B;  3WNC A;  2EFG A;  2CFX A;  2DA3 A;  3HGG A;  3BTL A;  1R5O A;  3CPW B;  4RGR A;  2M5S A;  2CH0 A;  1VF7 A;  2HCJ B;  2OK7 A;  4CH7 A;  4W8Q A;  3GFM A;  2A69 F;  3GWZ A;  1VQM B;  1YJN I;  2IJL A;  3E6B A;  1ETW A;  2CND A;  2XGE A;  4IXA A;  5CYV A;  2ZZQ A;  4P25 A;  1B6A A;  4BJ6 C;  3J7A Y;  1T56 A;  2WY8 Q;  3EET A;  3Q6Q A;  4M2L A;  1XG1 A;  4P12 A;  2V4D A;  3FZV A;  1X3W B;  3PNT A;  1VQ7 I;  3CUO A;  2GOM A;  2HTJ A;  1MIJ A;  5AON A;  4XLH A;  1R49 A;  2L3D A;  3DBR B;  1ZM2 A;  4LIU A;  4FAS D;  4OPV A;  2CBX A;  4QUZ A;  2L2O A;  2OF7 A;  1YLO A;  4KJZ A;  4PGO A;  2YR2 A;  1X2M A;  4ESF A;  3AG2 H;  3IWZ A;  1XDU A;  1DP3 A;  4P26 A;  1CF7 B;  3CTA A;  2LF7 A;  3TP0 A;  3WE3 A;  3BZK A;  2Y9Y A;  3VOD A;  2INU A;  1ON1 A;  2ZBV A;  1OJL A;  4G7Z F;  2LVS A;  3WTV C;  4XKV A;  5D8K B;  3PUB A;  5K7F A;  4RPD A;  2XGX A;  1AMO A;  1ZN2 A;  2ZXW H;  4UVB A;  2XRO A;  3HG9 A;  2WYR A;  2A07 F;  1B4A A;  3ISP A;  4D5C A;  4X7F A;  1YJN B;  4XIC A;  2X0L A;  2F1L A;  3TP3 A;  1UEL B;  3MKY B;  3FIW A;  4ZCL A;  3JAM K;  5DUI A;  4AF7 A;  1VQ7 B;  4OJP A;  4HX7 A;  2RKH A;  1LB2 A;  4B1R A;  2H1K A;  1PYV A;  2PMZ N;  1HSJ A;  3JRH A;  3RKQ A;  2HMA A;  4MHG A;  5HLT A;  4M3D A;  1WH5 A;  4EJT A;  5LHH A;  2BM1 A;  2LD5 A;  1U8B A;  2R7O A;  2W84 A;  3WE2 A;  3A03 A;  2QZ8 A;  1RI7 A;  1RRJ A;  2OCE A;  1F4K A;  2FQ4 A;  3W5V A;  4NC8 A;  1GVJ A;  2KRF A;  3H0G J;  4PDK A;  2LMD A;  4UXN A;  3S17 J;  1T39 A;  3TW7 A;  5L3E A;  1O4X A;  2PMU A;  2Z2S B;  4CDG A;  3SZT A;  3RI4 A;  2YWE A;  1SC7 A;  2CG4 A;  1KQ5 A;  2W82 A;  1S0U A;  1TWA J;  3SLD A;  1O8D A;  2VNI A;  4BE0 A;  3AG1 H;  3BG5 A;  3HOZ J;  2FSW A;  4CUG A;  3BCB A;  3ZQI A;  1RES A;  3KL9 A;  2WY7 Q;  1V54 H;  3ZP5 A;  1UMQ A;  5HNH A;  1JA1 A;  1J09 A;  4P5O A;  2JT1 A;  2WV1 A;  4UVA A;  5EGO B;  3OJX A;  4U4B A;  3R4K A;  2KHM A;  3OOC A;  1IN4 A;  2HGC A;  3SDB A;  4MO7 A;  4E7S A;  3L00 A;  4F92 B;  3GFL A;  5HS7 A;  2ISY A;  4AUX A;  2KQR A;  2K9N A;  4UUT A;  2RN7 A;  3LFU A;  4HOB A;  1FYL A;  3SYT A;  3RZO J;  4P1W A;  4YFX F;  3CUQ C;  2Q6L A;  3CDH A;  1I1G A;  1O3R A;  3DU5 A;  3HHG A;  3HEF A;  3LQQ A;  4O5V A;  3OIP A;  3CF2 A;  3S1N J;  1U9N A;  2VFP A;  2QYO A;  3LAP A;  1ZQ3 P;  3GVK A;  3LJY A;  5BSX A;  4NHJ A;  3GF2 A;  4L9J A;  2LK2 A;  2NPF A;  1XB4 A;  4P6V F;  4UUS B;  1WJB A;  4M3E A;  4ENJ A;  3E6D A;  4L5I A;  4XID A;  2NS8 A;  3HAG A;  3WXM A;  3ML3 A;  3C2B A;  3MKZ A;  3OWT A;  1FOX A;  4AC9 A;  1KCC A;  2XB0 X;  1H9T A;  4RD0 A;  1QA2 A;  5FL7 A;  1X4P A;  1MGT A;  1S9H A;  4PC6 A;  4HLX A;  4LJZ F;  2W6I A;  3V4G A;  2XUB A;  5DM6 F;  1KZL A;  1XE1 A;  1K4Z A;  2EB7 A;  1WHU A;  3JRD A;  4BAC A;  1ZUN B;  1ZK8 A;  2V7U A;  3GTJ J;  2D5V A;  1ETV A;  2A6T A;  2XPU A;  3BLY A;  3IL2 A;  3SKB A;  4JX6 A;  3ZZ0 A;  1FPQ A;  1KQ8 A;  4IQJ A;  2CW7 A;  2JRM A;  5CKT A;  5FKN A;  3E3V A;  1JT6 A;  2R0Q C;  2GIV A;  1B72 A;  2KKO A;  1K7A A;  3EPZ A;  4YFK F;  1HA8 A;  2ELK A;  1YRN A;  5LGT A;  1GHC A;  3EQN A;  5KVR A;  2EIJ H;  3KE2 A;  3ZPN A;  2L4A A;  4RGU A;  1I7P A;  3V42 A;  3DEU A;  2V7F A;  3LO8 A;  4OJ5 A;  3S16 J;  4BGD A;  3LL7 A;  2C4T A;  4FK8 A;  2RC6 A;  3M07 A;  2MD5 A;  3M7G A;  2BM7 A;  1BR4 A;  3EUH C;  4FET A;  2DK5 A;  3F8F A;  3BJA A;  4LGW A;  2IS1 A;  4GQN A;  1IN6 A;  3NB2 A;  2O5R A;  4RDL A;  4V2G A;  3VB2 A;  4B43 A;  2XRL A;  3CO7 C;  1Q9S A;  3K1N A;  4P3Y A;  3KEQ A;  1ZG5 A;  2XPV A;  1BI3 A;  1MZB A;  4XLA A;  3T8T A;  4M74 A;  1AU7 A;  4D9J A;  1FOY A;  2P6T A;  1TQP A;  4MIM A;  1XMK A;  4HLY A;  4LMY A;  3A35 A;  1LEB A;  2QUF A;  3HL2 A;  1YHQ I;  1HDP A;  2ZBU A;  4WWV A;  1IGN A;  1XGO A;  5AIQ A;  4Z1M A;  4F91 B;  1N8R D;  2X3U A;  5EG0 A;  3VO1 A;  2WA0 A;  2XDV A;  3EYY A;  3RQ4 A;  3WU2 C;  2JVG A;  2DMT A;  1HC8 A;  1XMA A;  3N90 A;  4II3 A;  4Y33 A;  5E1W A;  5A2Q K;  1ZGJ A;  2B7C A;  5LHG A;  3WQZ A;  4NB5 A;  3FKS A;  3K9T A;  4MEX F;  4Y17 A;  3I71 A;  1KC8 D;  2I5U A;  5FKM A;  1U5T B;  3JTG A;  4C2M J;  2R7Q A;  1QA3 A;  4P9F A;  4IF4 A;  2C4U A;  1TUI A;  2KIM A;  3S1R J;  2F5D A;  4X8I A;  1WH7 A;  4G1V A;  4RD4 A;  4EJO A;  2FXA A;  2JPC A;  2X48 A;  4JK1 X;  4LIT A;  5CQE A;  3FBN B;  3ZCO A;  1WZ2 A;  1NDH A;  2AQE A;  2XTW A;  4CCK A;  4HAM A;  4M3G A;  2XT2 A;  2DA4 A;  2ZNZ A;  4B48 A;  3LAJ A;  4M9S A;  2HLD A;  1Q86 D;  3COA C;  3FBI B;  2DLL A;  4ZZL A;  2EZL A;  1O8G A;  1YHQ B;  3QYB A;  2KIU A;  4AC0 A;  1SFO J;  2CV2 A;  3QFC A;  2KJC A;  5J3L A;  3IKV A;  4OOI A;  3JAM Z;  2EH3 A;  2ZSI B;  3KEY A;  3WTT C;  5AMV A;  3OYJ A;  2ZZG A;  1COW A;  2HXO A;  4DZP A;  4RGS A;  2L4M A;  2GJK A;  2PQ8 A;  4KH3 A;  1G3Y A;  2CQQ A;  2DOA A;  3JQQ A;  4FX0 A;  2C5H A;  2DW4 A;  1S4M A;  3GXO A;  4LG0 A;  4R79 A;  4Y15 A;  4N9H A;  1MW7 A;  1TT0 A;  2G0E A;  1ZLK A;  2W48 A;  2QBY B;  1JHH A;  1VQN I;  1WOO A;  5IT3 A;  3B8Y A;  1I8D A;  4YRV A;  5C4J J;  1X4O A;  5J3O A;  3N05 A;  1UHM A;  2NVY J;  2MG4 A;  4Y3O A;  3F3X A;  1FX7 A;  3TW6 A;  2TCT A;  1WSR A;  3W2A A;  3N6Z A;  2NVU B;  1LLW A;  4LIV A;  3GEZ A;  4WX9 A;  4KT6 A;  2PLF A;  5FJ8 J;  4GXO A;  1SAU A;  3D5S C;  2XF5 A;  3PIO F;  1BL0 A;  1W0K A;  3BR3 A;  2AHO A;  4YZA A;  2ZSH B;  2DMU A;  1YW8 A;  4YXW A;  4PMH A;  1SVL A;  1QCX A;  4RLF A;  4JOM A;  3S32 A;  2BF4 A;  1LEA A;  1D8K A;  2HZT A;  2Z1D A;  4X07 A;  4HRI A;  1DGR M;  3BH4 A;  3QOD A;  2B5O A;  2M8G X;  4H9G A;  1HBX G;  3VYR B;  3WU1 B;  4CYC B;  3E7L A;  3FMS A;  3J81 K;  1UD3 A;  1OGM X;  3VFZ A;  3W2G A;  4IJA A;  2Y2Z A;  4AYB A;  3S2W A;  1YJW I;  1JT0 A;  2L9S A;  5F4O A;  1NK2 P;  4KIF A;  3A1Y A;  1OIS A;  4TMX A;  5HVQ C;  4V19 K;  1KK0 A;  3UR3 C;  1SVM A;  2HQ5 A;  4IHX A;  1VQN B;  1OOC A;  4A3L J;  4IPA A;  4XD7 A;  2RDP A;  2O61 A;  1MMS A;  1OYW A;  2NVT J;  2H09 A;  1TQI A;  2O8K A;  1S6L A;  1X1D A;  2LKX A;  2XEX A;  2MA3 A;  4JP0 A;  4N4O B;  1UD4 A;  1QGY A;  1HQC A;  2DDB A;  1YIO A;  3ZGK A;  5ICC A;  1WVR A;  1ZEL A;  2X1E A;  3L2W A;  4LOC A;  3TED A;  2GZW A;  1MBK A;  1S3J A;  4XLC A;  1OCO H;  3OYN A;  4A6D A;  3IKT A;  1W87 A;  4YEJ A;  2C78 A;  1JUP A;  2G7U A;  2HZD A;  2QEN A;  2X6O A;  5IYC J;  3DLL F;  2DMN A;  3OIO A;  4MFD A;  1GXQ A;  4ZTF A;  4GDF A;  1AIP A;  2DET A;  1WJA A;  3PFI A;  1Y0U A;  2LYC A;  4A6E A;  2DT7 B;  1GR1 A;  4Y7N J;  2F4N A;  2EFN A;  4HE5 A;  3G6E I;  4DQK A;  3TH0 A;  4BBR J;  3BPX A;  3JRA A;  3BY1 A;  2IGM A;  4XOR A;  4JMQ A;  5CVJ A;  4ROX A;  3J80 Z;  1ERD A;  3HRU A;  3CDL A;  1Y8Q B;  1YJW B;  2XKP A;  4AF6 A;  1K5C A;  2IOU G;  4Q47 A;  2DCU A;  2A6H F;  2M3A A;  1DPR A;  2IAI A;  2L7K A;  1LJ9 A;  2NNN A;  1UST A;  3P9I A;  2B9S A;  2D9R A;  4D7N A;  3A8I A;  5LGN A;  4IEJ A;  5F0F A;  3A01 B;  1MDM A;  3KFW X;  3E6M A;  4LBW A;  4B4C A;  2R93 J;  1SD6 A;  3KP5 A;  3K10 A;  2BY1 A;  4RLZ A;  4OJL A;  4DZJ A;  3LQ6 A;  2RC4 A;  2RAE A;  3FXU A;  1M1E B;  1VQO B;  5HLI A;  1W1W E;  1X3Z B;  1PJ5 A;  1JJ2 B;  1BW5 A;  2VN2 A;  4Y4R A;  2CQK A;  3JCU C;  4YIF A;  1VQ5 I;  1EH6 A;  4OIP F;  3ZQF A;  3BDD A;  2HDC A;  4U9U A;  1KRH A;  2Q1Z B;  5DCM A;  4NK8 A;  3L2Q A;  1HKS A;  3TO7 A;  3FWE A;  2CK3 A;  2JWT A;  4E7Z A;  5CDF A;  3K4L A;  3Q0U A;  2LRD A;  2M9H A;  2WBM A;  1FYM A;  1D1A A;  5HZA A;  1OMI A;  2QY1 A;  1WJE A;  4HW0 A;  1DDN A;  1V4R A;  5L46 A;  2DTR A;  1BQE A;  3LA3 A;  5EEA A;  1BJK A;  5KNL A;  2ZJP F;  2FBK A;  4RDK A;  1OFE A;  1JI8 A;  2CUE A;  2W00 A;  4MTD A;  3GTP J;  3DEE A;  4Z03 A;  3IP4 B;  5EYR A;  1ETK A;  2COB A;  2D3L A;  1A8P A;  2LC2 A;  1HDD C;  3C7J A;  3NEU A;  2VKH A;  4AID A;  4UZE A;  3Q5F A;  3ZSC A;  3CP2 A;  5H6R A;  3T9G A;  2HOE A;  3SYJ A;  1TWF J;  4AU7 A;  3F0C A;  1WI3 A;  3DPL C;  2VBU A;  5GTH C;  1Z6T A;  1W7P A;  2J7K A;  3ECO A;  1HXD A;  1ZRC A;  5IYW A;  1TTY A;  2STW A;  4AYB N;  2GQF A;  1O8E A;  3FY3 A;  2CUF A;  3QPT A;  3TMO A;  1VQ5 B;  3BY2 A;  1FP2 A;  5FLX Z;  3KET A;  2R5Y B;  2DXI A;  1B23 P;  1NRK A;  1YOV B;  5JVG F;  4B3F X;  1N78 A;  2NT9 A;  3HOU J;  4OIQ F;  1IO2 A;  1PVE A;  4OAY A;  5D6F A;  4C3H J;  1MBE A;  3Q9S A;  3H9Q A;  4DK1 A;  4M3B A;  1TLH B;  4OIO F;  1ODD A;  5B3S H;  4ZCM A;  1DQU A;  1T6Z A;  4G94 A;  3HHH A;  3QOE A;  1WWX A;  3RPQ A;  5H5J A;  3QRF F;  4BQO A;  2QSF X;  1R22 A;  2VBV A;  4KA4 A;  1B9N A;  1SAX A;  4RM2 A;  2E36 A;  3ZQ7 A;  1SEU A;  1W34 A;  1EH8 A;  1FC3 A;  2EFP A;  4QSH A;  2P7V B;  4A5N A;  3S14 J;  3SEQ A;  4RD6 A;  4Z4T A;  1U5T C;  1WU8 A;  1RIO H;  1RZ4 A;  3I4P A;  1NHA A;  2VAS A;  2FD5 A;  1NK3 P;  3B6A A;  4G8X A;  4BY1 J;  2NYX A;  2QSH X;  3IUO A;  2VI6 A;  3JUR A;  4G6Q A;  2BPO A;  2IP2 A;  3C2G A;  5D5X B;  1MH4 A;  2JQ7 A;  5HLH A;  1CZF A;  1T38 A;  3QE2 A;  5JLV C;  1BI0 A;  1G59 A;  5FRM A;  1Q1V A;  2R7D A;  1UD6 A;  4Y9R A;  5EMN A;  4KIT B;  1EH7 A;  1WQ2 A; 
#chains in the Genus database with same CATH homology
 3DWL E;  4AVZ A;  2GK7 A;  4XKW A;  1D0Y A;  3C2H A;  2X1C A;  3S3M A;  4G6T B;  3OIQ A;  3VST A;  4L8J A;  3OE7 A;  2K9L A;  1U0J A;  5DN6 A;  4J00 A;  1QHG A;  2CV0 A;  2A5W A;  5C1E A;  1JRG A;  4GRI A;  3BG7 A;  4URR A;  4KKT A;  2PJR B;  3MKW B;  2CW8 A;  2CMP A;  1FMW A;  2NTP A;  4OAZ A;  4Z06 A;  3LSM A;  1E43 A;  2E60 A;  1Y6I A;  4N4N B;  2UV1 A;  3ONQ A;  3G05 A;  3FKJ A;  1Z7L A;  3I3L A;  4NUB A;  1QJV A;  2M5S A;  2CH0 A;  1VF7 A;  2VXD A;  3PJR A;  4CH7 A;  4W8Q A;  2PJR A;  4XKB A;  2GK6 A;  2O0W A;  2XAU A;  3DTI A;  3H35 A;  3BCD A;  3HOT A;  1UD8 A;  2ZZQ A;  2E1M C;  4BU2 A;  1NG7 A;  4BJ6 C;  3LNN A;  3J7A Y;  1WP6 A;  4PSX A;  3K70 C;  2WY8 Q;  2DJI A;  2VJ5 A;  3L2V A;  5HNF A;  3OW7 A;  2HVQ A;  2MD0 A;  4XMY A;  2V4D A;  4DNR B;  3PNT A;  3AL0 B;  1IDK A;  2GOM A;  2ZFU A;  4HNU A;  3BG6 A;  3PSF A;  3IAM 2;  1K6Y A;  3W2A A;  4PSW A;  4XNF A;  4XLH A;  3W2W A;  4CCJ A;  1QHH D;  3W3C A;  3VMW A;  3H5A A;  1T0F C;  4LIU A;  4IZZ A;  2WAE A;  4FAS D;  4B47 A;  2L2O A;  3K4B A;  4KJZ A;  3DDY A;  4HEA 2;  3KX2 A;  4I84 A;  3OMY A;  4ZTJ A;  3CP8 A;  2INV A;  4RLQ A;  1WJD A;  3VYT B;  4ZDL A;  1DP3 A;  2UVF A;  4BE1 A;  2VQL A;  4C2L A;  2WPD A;  2KLO A;  1XG2 A;  1SFK A;  4NNJ A;  4IQ4 A;  1N77 A;  2INU A;  4CA0 A;  3GQA A;  2R9V A;  1I18 A;  3BCF A;  2VJI A;  4PJL A;  4XKV A;  3PUB A;  4XOT A;  3MD2 A;  3HG9 A;  2HPI A;  2IGK A;  4BDZ A;  4RM3 A;  3RPU D;  5CPR B;  2X8K A;  1O8L A;  3B4N A;  4B3G A;  1UEL B;  3MKY B;  2PYG A;  1G8X A;  2OV7 A;  4YZX A;  2LRE A;  2MAB A;  2IS2 A;  1H80 A;  2O1D A;  4G6I A;  3OEH A;  1K28 D;  4P22 A;  3DTE A;  4XM3 A;  1PYV A;  4DNT B;  3FDY A;  1D1C A;  1WTH D;  2KZV A;  2KPM A;  2NT6 A;  4XL9 A;  1Y56 A;  5HLT A;  3T53 B;  2M7A A;  2R7O A;  1W36 C;  4KKU A;  1YE9 A;  5KCM A;  2WJV A;  3F9K A;  3HKZ A;  2X51 A;  1H8H A;  3OEE A;  4NC8 A;  2IQ7 A;  3OY9 A;  4CCL A;  4BEH B;  2M4K A;  1O8I A;  5LFA A;  4KIS A;  5HKK A;  3CJQ B;  1YX3 A;  2M4G A;  2Z2S B;  2VBM A;  2HPM A;  3OYC A;  1IDJ A;  1MNE A;  4E7K A;  4YZQ A;  2KVO A;  3GVL A;  1VBL A;  2W82 A;  3OS2 A;  2JIZ A;  1O8D A;  3SUC A;  3BCA A;  3S8P A;  4BE0 A;  3VYU B;  2DIE A;  3H9J A;  4HST A;  4B44 A;  3A3G A;  4ZDP A;  4CUG A;  3BCB A;  2XF7 A;  4BEH A;  1WMR A;  3OAA A;  3LMM A;  2M0M A;  2WY7 Q;  5HOO A;  1E3X A;  5HNH A;  1RWR A;  3HXL A;  4BS9 A;  1J09 A;  4P5O A;  2BOL A;  4U4B A;  4PUS A;  3RCO A;  2KHM A;  3OOC A;  1MMN A;  3SDB A;  4ZJZ A;  4E7S A;  4F92 B;  3OYH A;  4H4K C;  2ZTG A;  1V5E A;  1X1A A;  4HNT A;  2KQR A;  2HQA A;  3OS1 A;  3LFU A;  2VQH A;  3DU6 A;  3SYT A;  4NQW B;  2R7S A;  2UVE A;  4P1W A;  1BHE A;  5C1C A;  3KEW A;  2GJR A;  2VBK A;  4OZZ A;  3DU5 A;  2CFO A;  1W0J A;  2NZM A;  3OIP A;  3CF2 A;  2JJ2 A;  3HPH A;  2O0V A;  3GVK A;  3W2V A;  2JVH A;  2LH9 A;  1X1C A;  2KDO A;  2LY2 A;  1N75 A;  2HVS A;  4RMN A;  1WJB A;  3K4J A;  1WJC A;  4HIZ A;  2XSJ C;  4W8T A;  2F43 A;  2GOX B;  3HAG A;  1KTW A;  3MKZ A;  1NBM A;  3OWT A;  1KCC A;  4XOP A;  4BJT A;  3S3N A;  2VJ4 A;  3IAS 2;  5TGT A;  3AKZ A;  1Z3X A;  5FL7 A;  1X4P A;  3PL8 A;  1IA5 A;  4TT3 A;  1S9H A;  1O8M A;  2W6I A;  3EUK L;  3TL4 X;  1KZL A;  3D5L A;  3M1C A;  4DOZ A;  1AA7 A;  2JUG A;  4E6K G;  2LG4 A;  4BAC A;  2JJ1 A;  4HWV A;  2A6T A;  3BLY A;  4ASU A;  2NTB A;  1OFM A;  2IGO A;  2E5Z A;  3OR2 C;  2CW7 A;  5CKT A;  4IQJ A;  2R7T A;  2QX3 A;  2WAF A;  3EPZ A;  1HA8 A;  1DBO A;  1V5G A;  3EQN A;  3PFY A;  3NE5 B;  3ZPN A;  3L2R A;  2R7X A;  2MFZ A;  1Z21 A;  3V42 A;  1MAB A;  2WJY A;  2V7F A;  3ZXS A;  2I8D A;  3OYI A;  2XZL A;  4PFO A;  3ZR8 X;  4BGD A;  4OJ5 A;  3LL7 A;  1IB4 A;  1NHC A;  3S93 A;  5KHD A;  1BR4 A;  2E5N A;  3EUH C;  1R6R A;  4FET A;  3RTR A;  4PJJ A;  3UNG C;  3VSK A;  4BQQ A;  2IS1 A;  1T5E A;  2ZZE A;  4GQN A;  3UW0 A;  2DT6 A;  2O5R A;  1EFR A;  4CCN A;  3G2B A;  4B43 A;  3ZIA A;  2EWE A;  4ITV A;  2R7R A;  4IKF A;  2WZP P;  4NK6 A;  4TSF A;  1BOB A;  2AQF A;  2WAD A;  4XLA A;  1DGW Y;  4D9J A;  2VKD A;  2VB6 A;  2OC6 A;  3A35 A;  1NG6 A;  2W7N A;  4C2U A;  3I9V 2;  3OYF A;  3OL3 A;  2ZZF A;  3T56 B;  2XZO A;  3HL2 A;  2VLA A;  4Z1M A;  1LKX A;  2VQC A;  4F91 B;  4II2 A;  2WA0 A;  2XDV A;  3RQ4 A;  2Y0S A;  1FX0 A;  4G7X A;  2JVG A;  3VDX A;  1PXZ A;  3OYA A;  4II3 A;  4Y33 A;  2F6C A;  2R4G A;  3OYM A;  3PNV A;  3ZQQ A;  2V1N A;  4XLE A;  3WQZ A;  3QYE A;  3TBI A;  3FKS A;  2XC7 A;  1O8K A;  1TZL A;  4BE2 A;  2ZXI A;  4E7L A;  2MC4 A;  2KRC A;  2R7Q A;  3K4K A;  3LMW A;  4OJ6 A;  3JU4 A;  3CES A;  2UUZ A;  2IS4 A;  1W9X A;  5CQG A;  2JA2 A;  3K70 D;  3BC8 A;  1UD5 A;  4CCM A;  1V0E A;  3VSV A;  1D1B A;  1UG0 A;  4CSW A;  2IGN A;  3AFH A;  4LIT A;  3FBN B;  5CQE A;  3ZCO A;  2AQE A;  4CCK A;  2X1D A;  1OGO X;  1V5F A;  1FMV A;  4B48 A;  1OHH A;  2HLD A;  1WJF A;  3FBI B;  4F93 B;  1O8G A;  2XF6 A;  1GQ8 A;  2LBF A;  4C9Y A;  3QYB A;  3AL0 C;  2CV2 A;  1O8H A;  4ANJ A;  5FRO A;  1PJR A;  2O04 A;  2ZSI B;  3KEY A;  4NC7 A;  2R7V A;  5AMV A;  3OYJ A;  2ZZG A;  2W4S A;  1COW A;  2VBE A;  1PLU A;  1D0Z A;  2GJK A;  3LSH A;  3B90 A;  1T95 A;  4F52 A;  2DOA A;  1UD2 A;  2JDI A;  1IRX A;  1LDK B;  1LVK A;  4R79 A;  4C30 A;  3HUG B;  1MW7 A;  1TT0 A;  4OJP A;  3KYL A;  3B8Y A;  4U7B A;  2WAQ A;  1BPL A;  1E1Q A;  1I8D A;  4YRV A;  3GRH A;  1X4O A;  1E79 A;  3OFN A;  3N05 A;  3VR6 A;  2OUM A;  4Y3O A;  1HZE A;  1KCD A;  3GBG A;  2P0W A;  4LIV A;  3EQO A;  2L9N A;  2WB1 A;  1UAA A;  4KT6 A;  4B3X A;  4QPQ A;  2KRH A;  1SAU A;  3D5S C;  2XF5 A;  4HSR A;  4D1Q A;  1W0K A;  4UZU A;  4OZY A;  4YZA A;  2ZSH B;  2E1M B;  3ZRG A;  4DGW B;  4YXW A;  4PMH A;  1QCX A;  4RLF A;  4JOM A;  3S32 A;  2UWM A;  2XGJ A;  2E1B A;  3D5R C;  3DLA A;  2CUJ A;  2Z1D A;  2K3P A;  1OLT A;  3GQ8 A;  4HRI A;  1PKV A;  3GVJ A;  1DGR M;  3BH4 A;  3QOD A;  4XON A;  3SZG A;  2X85 A;  3VYR B;  3OYL A;  3M8J A;  4E7H A;  2R7U A;  1HVX A;  1UD3 A;  1OGM X;  4W8S A;  2VPL A;  1QU3 A;  2X6X A;  4AYB A;  1KON A;  1VLY A;  2Z8G A;  2V4J C;  4MR0 A;  3K4M A;  2L9S A;  2VQG A;  4IX7 A;  2KP6 A;  3A1Y A;  1BMF A;  5HVQ C;  3U21 A;  3UR3 C;  2JSP A;  1O88 A;  1OOC A;  3GQ7 A;  4XD7 A;  1SKY B;  4LG3 A;  3NWT A;  4ZDO A;  1X1D A;  2Q2E B;  2X6Y A;  1MND A;  4N4O B;  2KL4 A;  4XN3 A;  4BUP A;  1UD4 A;  3NWS A;  1WPC A;  2V7Q A;  2Z6B D;  2VXZ A;  3ZGK A;  3L2W A;  1O8F A;  3H5R A;  1ZEL A;  2X1E A;  2NTQ A;  3K4C A;  3OS0 A;  4MXN A;  3OYN A;  4XLC A;  4CCO A;  4YEJ A;  2HZD A;  1E0E A;  1E3Z A;  4ZTF A;  3CJR B;  1WJA A;  1OR7 C;  1WJ5 A;  3E0J B;  2X53 S;  2LYC A;  2DT7 B;  3FPP A;  4E0F A;  2BSP A;  1PE9 A;  2F4I A;  3A4C A;  2RNG A;  4DBR A;  4C2T A;  2IGM A;  4XOR A;  4BDY A;  1VJS A;  4JMQ A;  3WWG A;  4Z05 A;  1ERD A;  4PFP A;  4X0G A;  2GJP A;  1K5C A;  3LSI A;  5JHF A;  4BJ5 C;  5LD2 C;  2PYH A;  2X6W A;  2M3A A;  2L7K A;  1BLI A;  4U87 A;  3E1S A;  1OFL A;  4DIQ A;  3PSI A;  4G7W A;  2XZP A;  1VZ0 A;  4XQF A;  2VL8 A;  2MYS A;  2VJJ A;  4CZC A;  2HU9 A;  3K10 A;  1Z3Y A;  4PJM A;  2V26 A;  4OJL A;  3VMV A;  4MLO A;  2FUG 2;  3OYB A;  4XKC A;  2X3H A;  2NSP A;  2F5V A;  3VYS B;  1X0C A;  2QKL B;  4F55 A;  4PJN A;  1MMG A;  4Y4R A;  2O17 A;  1EE6 A;  1V0F A;  4U49 A;  2KMU A;  5FRN A;  4BXF A;  1LFP A;  3HC7 A;  2V31 A;  4QPO A;  4DBQ A;  3LSG A;  3RSN A;  2Q1Z B;  2BVL A;  3PNY A;  3OYK A;  3L2Q A;  3H0D A;  2ZTN A;  2CS3 A;  4NK8 A;  2CK3 A;  2CUZ A;  3DPU A;  4E7Z A;  2XND A;  2BW3 B;  2RQQ A;  1MMD A;  2LRD A;  3K4L A;  5CDF A;  2WBM A;  2D3N A;  2RRE A;  1BN8 A;  4JQF A;  1WFX A;  1D1A A;  3DPT A;  2QE7 A;  2QY1 A;  1WJE A;  4BL0 B;  2LBF B;  3SEZ A;  3K4N A;  2LZJ A;  1MMA A;  2L5Q A;  2HDW A;  5KNL A;  2ODL A;  1JI8 A;  1RMG A;  3OPO A;  4YEL A;  2W00 A;  4EW9 A;  2ELJ A;  2K9M A;  3DEE A;  4Z03 A;  3IP4 B;  2PEC A;  3HOS A;  2D3L A;  2BW3 A;  2LC2 A;  3KRG A;  3ZSC A;  1BR2 A;  1D0X A;  2VKH A;  3OR1 C;  2CV1 A;  3CP2 A;  3DKX A;  3T9G A;  2F1M A;  1JTA A;  1O8J A;  4DJA A;  4AU7 A;  1H8E A;  2XOK A;  3DPL C;  4TKO B;  2NOJ B;  3S3O A;  3MMY B;  3A3B A;  4KKS A;  3FY3 A;  1O8E A;  3GQ9 A;  3CMM A;  3CZ6 A;  3TMO A;  4OWR B;  2M7B A;  1DBG A;  2V9K A;  2ZXH A;  1HG8 A;  3K6G A;  4J01 A;  4YZ0 A;  2DXI A;  4PK4 A;  1NRK A;  2DCE A;  3BC9 A;  4B3F X;  4F3Q A;  2W1O A;  4ZYA A;  1N78 A;  2NT9 A;  3H94 A;  1E1R A;  4OAY A;  4E7J A;  2Z16 A;  3QYF A;  2LOO A;  3H9Q A;  4DK1 A;  1X1B A;  1YX5 A;  2LY1 A;  2W6J A;  4XR6 A;  1W36 D;  1DQU A;  4E4H A;  1KMH A;  3OOU A;  1AIR A;  1GLN A;  4DK0 A;  3OYG A;  3QOE A;  1RU4 A;  3DTK A;  2IS6 A;  3LSK A;  4XLF A;  2HNH A;  3T51 B;  2QKM B;  3GQB A;  4BQO A;  3DQV C;  4FXU A;  4HG2 A;  1BR1 A;  3H5N A;  3VWB A;  1EA3 A;  1P9Q C;  4RM2 A;  2BVM A;  3OL4 A;  2V6E A;  3DKY A;  2R7W A;  3VSL A;  3SEQ A;  4HPQ A;  3HPG A;  2HVR A;  4ZC3 A;  2NST A;  2PMZ A;  3H9G A;  2VAS A;  1OB0 A;  2K5C A;  1X19 A;  2VIX A;  3IUO A;  4OJO A;  4XN0 A;  4E7I A;  3JUR A;  4W8R A;  3C2G A;  3OYE A;  3EUA A;  5IK2 A;  1CZF A;  3OYD A;  3VSU A;  2IXS A;  1G59 A;  5FRM A;  4BQN A;  1UD6 A;  3L2U A;  2WSS A;  3FHN A;  4EAT A;  3ZPP A;  4KIT B;  3A2K A;  2QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...