4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
1KCCA 2X6YA 1IDKA 1XG2A 4OZZA 4U4BA 4Z06A 4XMYA 3GQ7A 4OJOA 4Z03A 5C1CA 2UVEA 4XLHA 1X0CA 4XLAA 1O8FA 2EWEA 3LMWA 3ZPPA 4XORA 4W8QA 3VSTA 4EW9A 2PYGA 3WWGA 1HG8A 2INVA 2X6WA 2O1DA 4URRA 4YZAA 4YZXA 1IA5A 4HWVA 4XL9A 3B4NA 4W8RA 1RMGA 1IB4A 3FY3A 1KCDA 4U49A 4OJPA 4XLEA 4PMHA 1VBLA 1QJVA 4XQFA 1O8HA 3B90A 2NTQA 4OJ5A 4MXNA 3SUCA 3T9GA 4YEJA 2VBMA 5AMVA 2VJJA 2VBKA 1OFLA 1RU4A 4W8SA 4MR0A 1NHCA 1BN8A 4C2LA 2QX3A 2O17A 4NK8A 4OZYA 4XKVA 2O04A 4XN0A 2NSPA 1OFMA 1OGMX 2BSPA 1PLUA 1GQ8A 2PECA 3B8YA 1JRGA 1O8KA 2QXZA 2ODLA 2X3HA 1O8IA 1RWRA 3GQAA 5C1EA 1JTAA 4XKWA 2INUA 2NTBA 1K5CA 1O8EA 3JURA 1DBGA 2X85A 4YELA 3GRHA 3KRGA 1O8JA 3UW0A 1KTWA 1O8LA 2PYHA 4XOTA 4OJ6A 2NT9A 4YZ0A 2UVFA 1O88A 3VSVA 1DBOA 1AIRA 4XN3A 2NZMA 1H80A 2NSTA 1WMRA 4XONA 4XLFA 1CZFA 3GQ8A 3ZSCA 2Z8GA 3GQ9A 2NTPA 2VBEA 1O8MA 1O8GA 4I84A 4XLCA 4OJLA 4XM3A 4XR6A 1EE6A 2NT6A 4NK6A 4XOPA 2IQ7A 1OOCA 1IDJA 3VMWA 2QY1A 1O8DA 2O0WA 1OGOX 4XNFA 1PXZA 3EQNA 1QCXA 3EQOA 3VSUA 1BHEA 4YZQA 2X6XA 1PE9A 3VMVA 2O0VA 4AVZA 2VJIA 4Z05A 4W8TA
chains in the Genus database with same CATH superfamily
3TGNA 1BJZA 1TVCA 1JA0A 1Z6TA 3CMAB 2PG4A 3WU0A 2V31A 2Y0SA 4F55A 5M5YJ 4P5OA 4EJWA 3FXQA 1XE1A 5GAHJ 4TMTA 2M0MA 2W24A 1TZLA 1IO2A 3NWTA 3P26A 1QZYA 2FU4A 2DYSH 2MYSA 3S1RJ 1LEAA 3LMWA 1XGNA 1B6AA 3VR6A 5HKKA 4NQWB 2QYOA 3SKBA 5HS8A 5FROA 3S1QJ 3CLOA 2PLYA 3FXRA 3HAGA 4ROXA 3W2GA 1SD5A 2ID3A 1I50J 2QA4I 2R5YB 1VBLA 4UY8I 1QJVA 1W7PD 3BLYA 2LYCA 2NRAC 1IRZA 1IN4A 3OYDA 2COBA 4C30A 3V8JA 4RCZA 5AMVA 2BM7A 2X3UA 1UG0A 2ZL6A 1UFMA 1V5GA 1YS6A 2ESNA 2L01A 3CCEB 4Y7NJ 3RQIA 1Q86D 1QO0D 1U0JA 3I59B 2HDWA 4M3EA 2ZMEA 1BA5A 4RM3A 2JIZA 1I5ZA 1IV6A 2D5VA 4FE7A 4RLZA 2FNAA 2FOWA 3HXLA 1Q1HA 4D7NA 2M7BA 1SAXA 4RLFA 4XSZF 4CCLA 4BJTA 5A88A 1SC7A 5GP9A 3ASNH 3MAJA 1DG1G 2K5CA 3WGGA 2CYYA 5IYCJ 5D5VB 1JJ6C 4A6EA 2VE9A 3CMEI 2XF5A 3TBIA 3J7YJ 2M30A 1LB2A 1SFOJ 3BR0A 2E5NA 2YWGA 4M2LA 1ZGWA 3U6KA 3MEXA 4B48A 3KRGA 2KVOA 1N06A 2ETHA 3L09A 4JBAA 2E1CA 3DEEA 2PJPA 3L2RA 2XGEA 2VKHA 3ZMUA 4FN5A 2VFNA 3VSVA 2FVGA 1FJLA 1DBOA 4A69C 3V8LA 4IXAA 1XSDA 3WTXC 2LRDA 2HPIA 2R92J 3W2VA 4OPWA 1MNEA 5DUKA 3CCYA 1K78B 3GVAA 2VXDA 1NH3A 4KISA 3ZGKA 4IHYA 5JI6A 3RKXA 1WDTA 3MKLA 3VO2A 4WX9A 1ZARA 3HDDA 2W1OA 2UWMA 1DARA 1QZZA 5LGTA 4RD3A 3F9KA 4BJ5C 2DPDA 2P3MA 1I3AA 1X1BA 2NT6A 2H1LA 4UB6C 4XOPA 1DDNA 4LIVA 3V8KA 5E3MA 2BXYA 4HIZA 1TNTA 3H0GJ 3K1NA 2C6YA 3SJPA 3VMWA 3WU1B 2M87A 2PJRB 2B5OA 5ICEA 4X0GA 4LGWA 2PQ8A 4PSWA 4RB1A 1HCRA 4IKFA 1ZR4A 2O0WA 3DQVC 2BXZA 4PUSA 2MLGA 1IJWC 3LSKA 1PDNC 1ZUNB 3GVKA 1K8AD 1QCXA 3TQNA 3OIPA 3RZDJ 4HG2A 3A1YA 3H3VK 5IYWA 2KJBA 1EH6A 2A68F 2O5RA 2EB7A 2VJ5A 2Y2ZA 4I99C 4JYKA 4YIRX 4UUVA 4A3DJ 1E63A 5KNLA 5A2QK 4V19K 3I54A 2X51A 3LA3A 2C5HA 3CF2A 4CZCA 4YEIA 1D8KA 2ELKA 2VBWA 2W25A 5IK2A 1BX0A 4U4BA 2FA5A 3OW7A 1OCZH 4Z4SA 2OZ6A 1V4RA 3IUOA 2ISYA 4CCOA 2Q6OA 2M0CA 5GV8A 3GQ7A 3EUKL 4KYWA 4Z03A 2LNBA 2XPVA 3ERED 4XLAA 4IO9F 4ENKA 1XCBA 2L5QA 1G3YA 4AYBN 3LVBA 1IXCA 2V9KA 1YFHA 1WOOA 4N3GA 2L02A 1HG8A 2DBBA 4MNUA 2LTPA 1UMKA 4YHBA 1W36D 2HR3A 3OYIA 3B4NA 2L7KA 2R7ZJ 4X6AJ 3NE5B 3Q6QA 4M53A 1KCDA 2FE3A 3RKWA 1BR2A 3GLXA 4CGZA 1NB9A 2P6TA 4OP7A 1WSVA 3PSIA 3GTKJ 2ODLA 4I02A 2HI3A 1FTTA 4P3YA 2XC1A 5BQTA 2Q6IA 4N0BA 4MGRA 2G9WA 1CF7B 5HDGA 1XGSA 5CVIA 3QOEA 2VBKA 2WR8A 2CW8A 4NDLA 5L3FA 3ZMTA 4M6YA 2IRFG 1G4DA 1BIBA 1YW7A 1T6YA 3DBRB 4Z4WA 2F4MB 5E3NA 1IDZA 2W57A 4MR0A 5B6IA 4AU7A 3A3BA 2ZXWH 1D5VA 3RCOA 4E0FA 3TOBA 2HOTA 1VQ7B 3KL9A 2LOOA 3Q3SA 1NBMA 2B0RA 4XRSA 3K70D 4AF6A 3HGGA 4O3MA 2J8IA 4M3BA 3AGPA 3BQZA 1ZGAA 1EF4A 1W1WE 4CCKA 2QQAA 2BN4A 2XASA 2BHYA 4X05A 1IC8A 2DFFA 5E8IA 2VQCA 2M9HA 4WXHA 2INUA 3DLAA 4NB5A 2X85A 4DNRB 3JQRA 2R7QA 3I4MJ 3CCLB 2EIKH 1YQAA 3W2WA 2DAOA 3A0HC 1R5ID 2L9NA 5D6FA 1AU7A 4A0XA 2EZLA 3FBNB 5CPRB 1WMRA 2B63J 3IL2A 3OYFA 4PC2A 5HODA 3LSIA 3GQ9A 4A5NA 3WBKA 3FPPA 3UNGC 1VHOA 3Q9SA 1IAWA 2OJED 2Y9YA 4MLOA 4OINF 3VB2A 3D1NI 3F21A 5J35A 5HLHA 4OJLA 1ETWA 3P4GA 2V7FA 4RGSA 4HBLA 3F0CA 1QA3A 1KQ0A 3HOZJ 3AG2H 3FWEA 3QU3A 3IP4B 2QGGA 3W2HA 5BPIA 2EV5A 1KONA 2JA2A 1GXPA 2EPFA 5J1YA 3U6BA 2DA1A 3CJQB 4HPQA 1R5BA 2BYVE 1Q9SA 4YXWA 1UCRA 4ZGNB 3AL0C 3EQOA 5HZBA 2PBIA 3GVJA 3QP5A 5JLVC 3TL4X 2JZYA 1K73D 1WZ2A 3DKYA 1WU8A 3GFMA 1KZHA 1BJKA 3LSGA 3AVYA 2ZTGA 3OY9A 2V4DA 3CCLI 2CV1A 4HSTA 2WADA 3DTKA 1YI2I 1TUIA 5J1UA 2CQQA 2I8DA 2M2EA 2JA6J 1RETA 4G7XA 1K5CA 2RNJA 1YITI 1GXQA 1YRNB 4Q48A 5J8CA 3S3NA 5CQGA 3JAMZ 2IS6A 3OR2C 4BEHB 3D5RC 2BGJA 4LBYA 3GEZA 1O8FA 1Z0XA 2CQNA 1EFUA 4B4DA 3L7WA 4EW9A 1LFUP 1EWYA 2V7WA 1VQKI 4TMVA 2PMHA 3ZN1A 2X6WA 3BR5A 1YITB 3ROUA 2JA8J 4BE2A 2R7WA 2FEZA 2RAEA 3DF8A 1VQ7I 4PJJA 4E70A 2X1CA 4AIJA 1BC7C 3WTYC 2F5VA 2F43A 4ESJA 2EIMH 3OIOA 4HNVA 5FJ8J 1IGNA 1CNFA 3FXUA 5FKLA 4N4NB 4HF1A 1S8NA 4JP0A 2DOGA 4MXNA 4P12A 4B1RA 3JCUC 5B1AH 2PMDA 2VJJA 5JVGF 2WTEA 5J47A 1O7FA 2W48A 3FDYA 1MNDA 1XGOA 2ZC2A 5A89A 4O5VA 4OIPF 3OL4A 3VYUB 2ZKZA 4PK4A 3W2FA 1GT0C 3PENA 1N08A 2FUG2 2O17A 2BM5A 3S1NJ 2QN6A 1VQ8B 1T2KA 4A3EJ 4P9UA 1XGMA 4AIDA 1TC3C 1N78A 3OWTA 4NC7A 3A2KA 2IVMA 1UZCA 1OCOH 5FKKA 1MNMC 3LSHA 4YALA 2O03A 3F22A 3I53A 1JA1A 2DODA 1VQ9B 2X3HA 3ZQGA 2ZJQF 2IS1A 2GJRA 1IN8A 3GYHX 2EILH 2J5PA 2RGVA 2XPWA 4XBFA 1REPC 2L4AA 3A03A 2QVOA 1LVAA 4TMWA 2GAUA 2K27A 2L7FP 1NRKA 4ETSA 2PJRA 2KQRA 5M3MJ 3FM5A 2OQGA 4V2GA 2XSJC 3S3OA 1TL8A 1Y39A 3MZYA 4OIQF 1OB5A 4X7CA 1SVLA 1WI3A 3DPUA 3KIOA 4DYRA 4B4CA 1RI7A 1SD4A 1K4SA 2H1KA 4ZYHA 2OUMA 4ZJZA 2ME6A 2KP6A 4PGGA 4XRSG 1BJAA 2ZL7A 2OA4A 4LBWA 2QF7A 4DQLA 4MEYF 3V42A 4KT5C 3LNQA 1M90D 1HBXG 1WVRA 3WTTC 4GGGA 5BOXA 1WQ2A 4BBSJ 2RREA 1IXSB 1GAWA 1I6HJ 3CCQB 4XR6A 4A2UA 2ZXJA 4UHTA 1H88C 1E43A 1RRJA 1WWXA 1ZM9A 4YAOA 3K0LA 3RTRA 3Q5FA 3I56I 3PSSA 4YDTA 3HOTA 3FF5A 1FOWA 5EYRA 1A04A 4PJLA 2IP2A 4F91B 1IJFA 1KJZA 1W5SA 5J3OA 4B3AA 4Y33A 2EZHA 2ZBVA 2JWTA 3TDZC 1CQXA 5IP6A 2DMPA 5GV7A 2XAQA 2D3LA 1J09A 1PE9A 2TCTA 2UUZA 1H89C 4M0LA 2HXIA 4ZZDA 4L0ZB 5CVJA 1VLYA 2LF7A 4A12A 1LDDA 2VJIA 2X1EA 1AKHA 1PUFA 2OYNA 3CCQI 1KCCA 4ZCMA 2XGJA 4P1WA 1IDKA 3U2QA 4QWQA 4X7FA 1MABA 1JTXA 2LFBA 2CW5A 3W2IA 2D1VA 4HSRA 4U88A 4MYTA 3F8FA 2XDVA 5IT3A 5GTHC 5JLXA 2AO9A 1GLNA 1O3RA 2VNKA 4RAFA 3BROA 4U87A 5IP9J 3VODA 1B9NA 2KKOA 3SY2A 4E7KA 3GWZA 3HJEA 2I5UA 4W8RA 1FRNA 1FNNA 2JA5J 3NARA 5JHUA 2JVGA 4LG0B 2LLKA 2CRGA 2EFWA 1O8HA 2A3SA 4OJ5A 3RIQA 1RZ4A 1FOYA 2IGMA 4HDUA 1DDIA 3HC7A 3ZBUA 5AN9A 3UR3C 1W0TA 3S16J 2XTXA 4ZYGA 3H9GA 1B72A 2ZZEA 2XAJA 3OS2A 1GAQA 1QPIA 3NEUA 3VEPA 3OIQA 1AMOA 3I3LA 2GQFA 2DTZA 3S32A 2OQRA 4HZFA 3HUGB 5ICCA 3OE7A 5EMNA 5F4OA 1SEUA 1BR4A 1DGWY 1QQIA 3K9TA 4BH9A 5A2QZ 2O04A 2VQGA 4Y4RA 1V5VA 1L1IA 4G6QA 3BOQA 1I3QJ 3BPVA 5HNHA 1PLUA 3ABMH 2PECA 1N25A 5ED4A 3H36A 3ZQQA 3K4LA 2E1MB 3QYBA 1EFTA 2KJCA 2Q2EA 2DT7B 2GBYA 3R6SA 1X58A 5J4YA 2GPJA 4S05A 4RD4A 5FL7A 3FZVA 1FOXA 1P4XA 4LK0F 3VPRA 2NTBA 3S3MA 3EYIA 5BSYA 1SAUA 5J4VA 2XT2A 1KTWA 1YHQI 4BDZA 2X4HA 2W84A 4P9SA 1K61A 4TMXA 1VJSA 3QU6A 3BY6A 1MD0A 4OOIA 2CQKA 4QLCU 1FNMA 2C4UA 2HU9A 3B82A 4NQWA 2BE5F 2K3FA 2EINH 2EFQA 2NTPA 4G7WA 4CUGA 2VBSA 4C0SA 1PJ5A 3G71I 2XPUA 3BDDA 1HOMA 1FYKA 3SYJA 5LEKA 2E2HJ 2NS8A 3EDPA 3NB2A 3J7AO 2PIAA 1TP4A 1QGYA 2HKOA 1J0RA 2UZKA 1GVDA 3V7CA 3E5UA 3GTPJ 2VNHA 3ERMA 1DU0A 2XIGA 2UVFA 3BTJA 3L1PA 2YWEA 3BC8A 3QPLA 2C4TA 2QY1A 1USTA 3KP3A 1HSTA 4M71A 3ZOBA 3CTAA 3CCEI 2ZJRF 2D45A 2CH0A 3I55I 3R61A 5DYMA 2V5IA 2C78A 3K70C 1H9TA 1A31A 3DLLF 4R71A 1FT9A 2ZFWA 2QZAA 5DCMA 1E3PA 2E1NA 2R7VA 2VC1A 3ZQIA 2EFPA 2LC2A 1VF7A 2QA4B 3W3CA 3HPGA 2WA0A 3ECHA 5K5OA 3LQEA 5HS7A 2DFHA 2X6YA 3HOUJ 2XZOA 2NVUB 3TKYA 2E1MC 4OZZA 3BY2A 1CLWA 4Z06A 3T5XA 3JQPA 1Z3YA 2PMUA 3BG7A 4H4KC 4B3GA 1OHHA 1E79A 2MABA 4X7DA 1X3ZB 1IV8A 4OMZA 2BY3A 2P5VA 5JHFA 1HDDC 2KIFA 1OPCA 1X3UA 3Q0VA 1OCPA 1VNDA 3LYCA 2H27A 4B43A 1XN7A 1YX2A 2RV8A 3B02A 3HSRA 1QU3A 3CCVI 4TSFA 2QTZA 2E35A 1CF7A 2GOXB 4XQFA 1AWCA 3DU1X 1FNBA 3ZR8X 1TYUA 4DIQA 3FHNA 4ESFA 2M8EA 2STWA 1J5YA 4I2OA 2PEXA 3SXYA 1QA2A 3DU5A 3ABKH 1IG7A 5FKOA 1OFLA 4HX8A 3QP6A 2A61A 3CJNA 2JRTA 2QTLA 1NTCA 5ILVA 1BM9A 2XGCA 2RVCA 2E60A 4EJTA 1V3FA 2MLKA 2YUSA 1ZR2A 2Q6KA 4Z4TA 1NHCA 1GVJA 4EGZA 3O8HA 2EWNA 2J5OA 1FRQA 2QYUA 4EM0B 1ETKA 4DYCA 3OYCA 1TNSA 3CCJI 2GXBA 1RR7A 2CG4A 3PQKA 1GQ8A 1FMWA 2GOMA 4LMYA 2K4BA 2VYQA 5LGUA 1WGXA 3QFCA 3DPTA 2UXNA 2F6CA 4HQMA 2IW5A 3P9IA 2ZJPF 5EG0B 1DGRM 4BHPA 3SEQA 4LFUA 2MA3A 2QM3A 4G8XA 3PVDA 4G9YA 3ZRGA 2ZFUA 1P92A 2OBRA 2PFBA 3DV8A 3E6CC 2HVSA 5HLGA 4B44A 2JN6A 4PC3A 3LL7A 2IGKA 3O6BB 4XN3A 3KEYA 3CCRI 4NNJA 5DNSA 5EZHA 3CDHA 3E5XA 2EH3A 3ASTA 3AVTA 1VQPB 1O57A 3CCSB 3ZSCA 5CDFA 2W6JA 5LBQA 3LAJA 2CV2A 1D0ZA 3K4KA 1W5CC 5CVVA 5BPDA 1YS7A 3LA7A 1QVGB 1XMXA 4A3JJ 3PSZA 3RY8A 3PETA 3OV8A 3IKVA 3RIRA 2DA4A 1W9XA 2AQFA 3C3WA 2E1BA 3ONYA 1NG7A 4TN1A 2C77A 4CYCB 3BH7B 1YW9A 5B3SH 1XQBA 3LFKA 1EH7A 2JDIA 1OOCA 5DD4A 4OU0A 4B09A 2HVRA 4HRIA 1F60A 3L2UA 1F4KA 2YWFA 4D5CA 4CCMA 1PXZA 4M3FA 2BGCA 1WJCA 4BYYA 2JJ2A 3JRCA 4KIGA 3JRBA 3M8FA 4YZQA 2MC3A 1HA8A 1T56A 2BVLA 2VQHA 5IPAA 4D1QA 5LLQA 1G3WA 2HTSA 2DT5A 3QQAA 4M9SA 1TT0A 1B2RA 3ASRA 2GA2A 1F43A 1W0UA 2FXAA 4EV0A 5IT9Z 3M1EA 4AM3A 2VLAA 1R22A 1ZG5A 3FKJA 3K69A 1P9QC 5AIPA 1F5TA 1G3TA 1RKWA 1ETVA 1JT6A 2O7OA 3ELKA 4R79A 2F5FA 1B72B 3PUNA 3HIFA 1K4TA 1COWA 4HNUA 1VQOI 3GFIA 3PM1A 2XHKA 3D0SA 4XLHA 3R6KA 1F9NA 2X6OA 2DDBA 4KKTA 3G05A 3ZPLA 1HC8A 5EEHA 1KMHA 3KCCA 3H94A 3ZZTA 2LKXA 3PUBA 1SFUA 3Q3AA 1PJ7A 2O1DA 3U1KA 4URRA 4NC8A 4HV6A 4XRMA 4A3FJ 5IYNA 2WC2A 5F1JA 2C5BA 1IDYA 2TDXA 2X48A 3BTIA 4WCGA 1HQCA 2H8WA 3I9V2 5FO5A 1FBQA 4ZDOA 4BGDA 2LF8A 1EP2B 3LAPA 4V2FA 3FIWA 5KK1A 3IRRA 3T9GA 1GUUA 2HZDA 5CQEA 2XF7A 1RNLA 1VZ0A 2BW3A 1RQRA 4C3IJ 3LSMA 1VFCA 1R5OA 2LG4A 1TWCJ 1OMIA 4K1XA 4IRHA 1JGSA 2XKPA 1I18A 1BN8A 3L00A 4D0PA 2EJRA 3SYTA 5D5WB 3PSFA 2DU9A 3JRAA 2DETA 2A05A 3PNTA 1HSJA 2WYRA 4ZDLA 4CZZA 2BSPA 3BJ6A 3P5JA 3JRDA 2QXZA 5E6TA 3B6AA 1J7KA 4RGXA 3JRGA 2EFOA 3C7JA 2KIMA 1KQ8A 1YJWB 1RWRA 1Z91A 3F72A 4OOXA 1BBYA 1BW5A 2YR2A 2IEKA 3KEQA 3L2WA 4J19A 1TLLA 1WOSA 4Y9RA 5IYDJ 2ZZFA 1ZRFA 4HF0A 4EGYA 1SVMA 1XSXA 3N05A 5GAEJ 1T0FA 3A01A 3BCFA 1K6YA 2RQPA 2Y0SN 1O8JA 3GRHA 2QLZA 1A8PA 4U7DA 4BQAA 1XB4A 1BOAA 1M1KD 5DCFA 3SQVA 1HXDA 4XKCA 5KAFC 5IYPA 1OJLA 1N05A 2NZMA 2E2IJ 3VYRB 2DCEA 2PMZN 2KZGA 3ML6A 4KA4A 1BL0A 3MHPA 3CC2B 3LNNA 2X8KA 5FO0A 2DOFA 4ZYDA 2ZCWA 1TWFJ 4EJVA 4L9NA 2FX3A 4DQKA 1B9MA 1SMTA 3CUOA 4PFPA 3I4NJ 4Z4UA 1VQ9I 1ETXA 2P81A 4XLNF 1O8MA 4IOCF 4HOBA 3SFIA 3CUQA 2NYXA 2QBYB 3CLQA 3HBLA 4PJ0C 3G4SB 2QKLB 4BHCA 1UG2A 3H3ZA 1YJNI 4U0WA 3P27A 2BM0A 2LZJA 1YIJB 1NK3P 1IDJA 3ESWB 4V02C 1XMAA 1X1CA 5E3LA 1HF0A 5FA6A 2RNGA 2Y30A 3TO7A 5H59A 4ACBA 1ERDA 4FHTA 2NXNB 4PJNA 5DUIA 3LSPA 3VSUA 4P6VF 1LDJA 3OKXA 3QWLA 4G5GA 2O0VA 2TRTA 3IRQA 3L2CA 4WZTA 2CBXA 1Y8RB 1K8FA 3VDXA 1JTYA 2FNPA 3L2VA 4J00A 2EIXA 3OAAA 4MO7A 3H9QA 3HZJA 1ZLKA 4QHYA 5ILSA 4HLXA 1SFXA 3HL2A 4M3GA 3F6OA 5FRNA 4XICA 3E6DA 1AHDP 1ZYRF 4OJOA 3PFIA 2F4IA 3MMPA 3DBHB 3IH2A 2FSWA 3I64A 1H8HA 3F8BA 2LMDA 1N77A 4LK1F 3N90A 4FASD 3GZ6A 1D3YA 5E18F 1OFCX 5IOZA 3N6ZA 1UD3A 2ZB9A 3GXOA 2F5CA 3PJRA 1RMGA 1XSVA 5C3EJ 4DNCA 2CU7A 3ZQFA 4OJPA 1GV2A 1MMDA 2NAZA 2CS3A 2VL8A 5F6FA 1Z1DA 3QSYA 3NAWA 3E6BA 1SANA 2MH9A 1JGGA 3KZZA 2ACJA 4RA2A 1EZGA 2M45A 4QV2A 1E3OC 1UMQA 2NV4A 3ZBTA 3DPLC 4C2UA 4X7EA 1OCRH 5IYQA 1RESA 4NK8A 4IEJA 2QCOA 2LD5A 2HLDA 3MKYB 2H8RA 5DN6A 4XKVA 1R9TJ 1QUEA 3GIRA 1ON1A 2BBYA 4I09A 1JHHA 3VFZA 2DYIA 4UXNA 2QENA 1W0JA 3HHHA 3WGHA 3T53B 1JRGA 1DP7P 4P3IA 4E6KG 1UD4A 4J0QA 3ZMSA 1WPKA 3ONQA 2EV6A 4FE4A 2A6HF 4M74A 4U0YA 2BPOA 3GQAA 5C1EA 1S7AA 1T6XA 3WY9A 2EK5A 4DNTB 4JMQA 4UUTA 3CDLA 2R5ZA 2OD5A 2EFNA 1O8EA 2V7VA 2BZTA 4YELA 2VC0A 3BR1A 5H6RA 1S3JA 5HDKA 1KQ5A 1R5GA 1VQ4B 1E17A 1O88A 3BY1A 5BSXA 1R71A 4EJOA 4AIHA 2Z99A 1ZGJA 2HXOA 2Q1ZB 2QQ8A 2R9VA 5F27A 2NOGA 2E19A 2G0YA 5KHDA 2A5YB 5D4RA 1IF1A 4XRFA 4RMNA 2VBEA 2YWHA 2CUFA 4BXFA 3ECOA 4LG0A 1QFYA 1IUFA 2DA3A 5E1XA 1P7JA 3A35A 3AG4H 3AVUA 4AC9A 1FC3A 1S29A 3K2AA 2P7VB 3HSFA 1NG6A 2L9VA 4A6DA 4MQVA 3H0DA 2GIVA 5F04A 1MRZA 1QVFB 4IHSA 4PGOA 1T39A 1OKRA 3QOPA 1VI0A 4QIWN 2KDZA 4W1UA 2DDAA 2Z3YA 4HNTA 4YC5A 2D2WA 2IS4A 2VN2A 4YIFA 1Y0RA 1KU2A 5L3DA 4WZKA 2NNNA 2A07F 4K2EA 4IW3B 4TT3A 1WJFA 1VQMB 4DBRA 4BXUA 2V1UA 1K28D 3CD6I 2JT1A 1OFEA 4EM1A 3GFLA 2FBHA 2QGUA 1Z21A 5TISC 4A3GJ 2V9VA 3I71A 4RDLA 3U9GA 3JAMK 3TW7A 5M3FJ 3M8EA 2VBTA 3A8KA 1ZAOA 5B1BH 3CB4A 3GF2A 2OC6A 2B7CA 4G6IA 3FXKA 2MC4A 4XIDA 3W6VA 2LREA 4A3BJ 5FLXK 1EA3A 4XORA 4W8QA 3WWGA 4YZXA 1VQ6I 4HX7A 1IW7F 1YX3A 4KN7X 1XX5A 2BV3A 1W5TA 1OYYA 1WKMA 3TOAA 4FK8A 3DFGA 3HKZA 1VHEA 3ABLH 3GTMJ 1XMKA 1UD5A 3NWSA 2VBVA 2CGPA 1WH5A 2OU2A 4IPAA 4RDJA 3ZMZA 4Z1MA 1DDGA 2L3DA 3CO6C 3ZQLA 2NTQA 3JW4A 4IHWA 4ZV4A 4YEJA 1MIJA 4PC7A 3CP2A 4CH7A 5FLVA 5E1WA 1S5LC 2RC6A 4EMSA 2K9NA 1MDMA 1YIJI 4RAYA 3BPXA 3IV5A 2LKPA 5DM7F 2L7MP 2XGDA 4CA0A 2JTVA 2YU3A 3IH4A 4C3JJ 1T5EA 1MBHA 4EM2A 4IX7A 3D26A 5D8KB 4C2LA 2XSDC 2CUZA 1I7PA 2IOUG 2BY0A 3VO1A 3K10A 2QQBA 5M5WJ 2VBYA 5JLWA 5HLTA 2M5WA 3BJOA 4ZZLA 4E7JA 2XAUA 4BKXA 2YX7A 1T8IA 3SLNA 3IAM2 3ZCOA 2XV4S 4G6DA 4FCYA 1S9HA 2IA2A 1RIOH 4F7DA 4RDUA 1K6OA 1PVEA 2L9SA 4RB0A 2JRMA 3FKIJ 3JREA 1VQLB 1SFKA 2BOLA 2IGNA 2ZSIB 1IB0A 4UNOA 4Y52J 3GTJJ 1A35A 5LEJA 1MMGA 2QSGX 1SMYF 2PE3A 4P9FA 3F8MA 4NUBA 1W87A 1WOPA 3PNVA 2QQ9A 3HGYA 5D6EA 4YFXF 1IN7A 3RPUA 3FXMA 4XLFA 3W6KB 2RC4A 1V0FA 4PZJA 5FLXZ 3T1BA 2JJ1A 5H5JA 2IPQX 2DQLA 3SHFA 3WNDA 4UZUA 3OP1A 2EZIA 2Z5UA 1XD7A 1ETYA 3TEDA 5EGOB 1MGTA 2M7AA 1MJAA 1FSEA 4RGUA 5L3CA 1YLFA 2OCEA 1MH3A 3F8CA 4PC6A 1U5TA 2NPFA 1JHFA 4N4OB 3HTUA 1UHWA 1LE8B 3K4MA 4YAFA 4IRIA 3TMOA 4ENMA 1VQNI 3MN2A 2L7ZA 2P5KA 2CUEA 2CSOA 4RAZA 3RSNA 3S14J 4LBZA 3CC4B 2WY8Q 2VNIA 2KT0A 2V7QA 4H0EA 3PUMA 4OPVA 3KP4A 3X2QH 4U7BA 2DERA 1WTHD 1Q7YD 3NQOA 4M3DA 3EPZA 3BQJA 4YAWA 2GZWA 2DYRH 1X1AA 1Y0UA 2Q2EB 5HS9A 3L2QA 1QX4A 2CRVA 1LUJB 2XAHA 3QE2A 3BZ6A 3AG1H 2Q8KA 1NDHA 4CSWA 1IN6A 3VSLA 1LEBA 1A5JA 3R4KA 3S17J 4QFMA 1XCVA 4HA8A 1H0MA 3ZMDA 1ACIA 2B7BA 2V1NA 5F64A 4IL6C 2F4OB 4HE6A 2IBDA 2GXAA 3ASPA 3GLLA 2HOEA 3RI4A 5KSWB 3HRUA 1KK0A 4C2MJ 4ZYEA 2UVEA 4I76A 3FXJA 4HW0A 2V6EA 5GPCA 1QH0A 4RB2C 2XNJA 3JTGA 5FFXA 1FPQA 1CQTA 3VSTA 2Y69H 2GJKA 1O7LA 4IRGA 1DU6A 4KIBA 4YFKF 3ZC3A 3K4JA 1Z9CA 4L9TA 1BLIA 1ENHA 1TYXA 1R23A 1WHUA 4MYUA 1BPLA 2AXLA 1KYZA 4NHJA 4OOVA 2WV0A 3WE3A 5LFAA 3J81k 5B5EC 2JPCA 2WAQA 3PUFA 2MH2A 2VASA 3SUCA 1OFDA 4G94A 2MSYA 4UUSB 2GM4A 1AOYA 4WF2A 3F6VA 2EA2A 3M9AA 1DABA 4RGRA 1R1UA 2W6IA 2WSSA 2FQ4A 4UZFA 2OTJI 1WSUA 3LSTA 2VPRA 4UV9A 1FBSA 2BM4A 1N0UA 4W8SA 3JRHA 3QPTA 2F1LA 4AC0A 3N4MA 2HPMA 3HOVJ 5ICFA 5EZGA 3OEEA 2JSCA 2BY1A 3KLOA 3FPKA 3A4CA 2Y75A 2NNYA 1V55H 5DSZA 2RKHA 1YO5C 2E1OA 2O9LA 1T98A 3RPQA 2R93J 1TQIA 1EFCA 4N3NA 1S72B 3WTSC 1XC5A 1O8KA 2VT2A 3EQLF 4DGWB 1IJEA 1G3SA 1W34A 2ECBA 3CPXA 2ME0A 4WXCA 2W85A 1O8IA 1Y0NA 4XK4A 1A6QA 2LY9A 5M5XJ 1ORKA 1O4XA 2Z9OA 2A5WA 2AQEA 3COAC 5B66C 1WFXA 2EV0A 4XLPF 1K79A 1TT5B 2K9LA 4MTDA 1FWZA 1W36C 3UW0A 2O8KA 4BQOA 1QRCA 3QFRA 3KPHA 1EA0A 1FDRA 2HKXA 2GWRA 1Y8QB 1HW2A 2FD5A 1VQMI 1H80A 5TGTA 4MFEA 3AAFA 2NVQJ 1KU9A 3R0JA 2JN9A 2Q6LA 4TV7A 1IZ1A 2XVCA 1EKEA 4GRIA 1ULYA 1ETQA 4KKSA 1MMNA 3G1OA 4C2TA 2X0KA 4I84A 2A6TA 3MKWB 2LR8A 3CW2A 4OAYA 3E1SA 4OMYA 1T6ZA 2DIEA 4ON0A 4YAUA 1EE6A 3O8GA 4ZYAA 4RD1A 3A01B 4BY1J 5LMZA 3SZGA 1Q82D 1RKTA 3CC7I 1ZM3A 2CWEA 3HRSA 2KHMA 3J80K 2DMQA 3QRFF 3TH0A 4UAJA 3A8IA 1U9OA 3C1DA 4FISA 1A36A 1MSEC 1I1GA 3H5NA 2RQQA 2F4NA 3JR9A 1B4AA 2KL4A 4X1EA 3CXCB 2ESHA 2DXIA 2RDPA 2LKSA 1XFOA 2DOEA 3ABUA 1WRJA 2O61A 1EJ9A 1LLWA 3LWFA 1N0VC 1BOBA 1V54H 1SFEA 2JPBA 5FLMJ 3FK7A 1F1ZA 1W7PB 2V6CA 5KCMA 1G7CA 3R0AA 4W8TA 1OR7A 1YIOA 3FXLA 4A3CJ 1VQ5I 3MWMA 1UHMA 1K7AA 1OCTC 2HMAA 3SEZA 4L5JA 3E5QA 2VOPA 3I58A 5E8GA 4LB6B 3KZYA 2K86A 3BZCA 1F20A 2NVXJ 5C1CA 2DOAA 5HVQC 4P25A 2HYFA 1U8RA 4I6ZA 3K1MA 4MIMA 1Z7UA 2K02A 3WHBA 4HLYA 2PYGA 3MVPA 1QRYA 4PJMA 1OB2A 2OPTA 3SQNA 1BMFA 3VWBA 1TYVA 1S7OA 3Q6RA 2E5ZA 2HQAA 1XB2A 4PMHA 4ACAA 3U21A 3B78A 2Z16A 4ESBA 3OPOA 2R3SA 6PAXA 2VPLA 1J9IA 3PA1A 1G7TA 3FKSA 1POGA 1QA1A 3FJOA 1BN5A 4G1BA 2ZITA 3CUQB 3REOA 3ABTA 4LG3A 2B7EA 1NHAA 5HDNA 3S2HJ 1LQ1A 2X53S 3HB9A 2QE7A 5FD5A 1JB9A 4A3IJ 4AVPA 3AVWA 2HCJB 2E36A 1ETOA 3HEFA 5LRRA 5EEAA 2N8GA 3PFYA 2O8XA 1G6NA 3TP0A 2NOJB 5EF6A 1WH7A 2CC2A 1TQMA 3AGQA 2ZZGA 1RUOA 1ZG3A 4Y7CA 3H5AA 2HQRA 3H9JA 5J40A 3LQRA 2XUBA 4BS9A 1B1BA 1Y6IA 2W7ZA 2XTWA 3M1CA 2BV6A 1N75A 2EBIA 4RLQA 2D74A 3CCUI 3ZQHA 3U1DA 3BG9A 5JFRA 2Z33A 4KICA 2NS0A 2QSFX 1DBGA 1DPRA 2XB0X 4BDYA 3OOUA 1ZHFA 5GPAA 3ZMVA 2NT9A 3NRVA 2KLOA 3WNBA 3EUAA 3P9KA 1TTYA 3VSKA 2M3AA 3E3VA 5L46A 2PX9A 3KLNA 1UD6A 4PCQA 3CMYA 3DTIA 4E7LA 4CXFA 4RB3C 2OTLI 4OZYA 1CZFA 1WCMJ 2YU9J 1E62A 2XOKA 3FHZA 1U5TC 2UXXA 1WSRA 1BQEA 1W2BB 2BW3B 2O6GE 5F0FA 4N9IA 1D1AA 4I01A 1UB9A 2ADUA 4MFDA 2CJJA 3CQZJ 4CYCA 1HLVA 5LRSA 5C4JJ 3MCAA 2QWWA 4G7HF 4OIOF 3A02A 2KZVA 2DJNA 1X19A 2ELHA 2FRHA 2VFOA 2Z1DA 1Y56A 2ZNYA 3PIOF 1R58A 2WV1A 2ZBUA 1BHEA 2VIXA 5C4XJ 4RS8A 4MTEA 1RPWA 3LA2A 3OYLA 4KDPA 1ZELA 3TDUC 4XSXF 1U6GA 3PNYA 3CJRB 2VODA 2DN0A 3SJZA 3JTHA 1PJ6A 4HEA2 2ZTNA 2DEUA 3A8JA 3SJMA 5E79C 5IP7J 3SZTA 2Y31A 2R5ZB 5H20A 4QPOA 4LITA 2Y48A 4DK1A 5D5XB 1SM4A 5BMZA 2PMZA 4A5MA 3DCFA 1WXRA 2R7DA 1OYWA 5DD8A 4OIRF 3KZIC 5H6QA 4DZJA 3ZPPA 3LQQA 2VKVA 1D0XA 2CW0F 1LM1A 4OPSA 1LVKA 1YW8A 3WTWC 4HWVA 3LSJA 4JOMA 3HOWJ 2O3FA 4ZC3A 2BY2A 1D2EA 5AIQA 1VQLI 4F93B 4LLNA 2EFGA 2VFQA 5ICGA 1CNEA 3K2ZA 3KYCB 1ZKGA 3B90A 5AONA 3J7ZI 4KITB 2IJLA 2X9DA 3QYEA 2GREA 4ENJA 2OK7A 2VBMA 3ASSA 1Z67A 2V1XA 1H42A 3FK6A 3G1MA 1JUPA 1TYWA 4R8HA 1D0YA 1CGPA 1J75A 5LHHA 3B8HA 1JKPC 4I98B 1WJAA 3RYRA 4LJZF 4S04A 1SD6A 1YLOA 1K78A 1E3ZA 2R4GA 4IHTA 2OV7A 4RDKA 2M8GX 2MBFA 3HHGA 3TO9A 1OB0A 4CCNA 4G7ZF 4AUXA 3HTSB 4E7IA 3MD2A 3IKTA 4A0ZA 2W00A 1Y1VJ 2XGXA 4UV8A 3P9CA 4S0HB 2STTA 4Z4ZA 1KZLA 4LD5A 3LSRA 4Z4VA 3JURA 1I27A 4HQEA 2GJPA 3FMRA 4RM2A 1YTYA 2KRHA 1R5NA 4XOTA 4BU2A 2E34A 3K1PA 3WQZA 3NAUA 3ASOH 4GXOA 3H09A 1AIRA 3GUDA 1WI9A 5BS6A 3RDIA 1FYMA 1AA7A 2ZJ2A 5L3EA 5IY5H 1ZG1A 4ASUA 1Z05A 1AIPA 2WB1A 5TV2A 5EEGA 3S8PA 1QBJA 4G6TB 4IF4A 2VBXA 2F5DA 4U0VA 4Q7JB 5DS0A 1JUSA 2Z6BD 3MZ8A 1VQ8I 2VFPA 4P22A 1MKMA 9ANTA 1EV7A 1JKOC 3J80Z 1MZBA 2BVMA 2ICWG 2JUCA 3I0TA 4A3KJ 1Z6RA 5HLIA 5E3OA 1QHHD 3Q0WA 3OYKA 3LQ6A 4NK6A 3MFKA 1ZH5A 3W5UA 2GXGA 2R7UA 4QPQA 1XS9A 2HQNA 3H1CA 2QDXA 1O8DA 4IJAA 1O3SA 4P1VA 1T33A 1OGOX 1STZA 1U8BA 4D7MA 4BQQA 1ODDA 3BTLA 1WJEA 5TJJA 3OSFA 2R7OA 3H3UA 3KETA 1HKTA 2BHZA 4F7ZA 3W5HA 1O3TA 1KRHA 4Z2YA 1V5EA 4Z05A 1NK2P 1P2FA 4P6YA 3G6EB 1XG2A 1ZLJA 2X1DA 2VBZA 2WZNA 3CESA 1Z7LA 3LMMA 1FOKA 4TKOB 3S2DJ 2O0YA 1HVXA 4QUZA 1E64A 1EXMA 3KEOA 2XEXA 3N97A 4E4HA 4IHVA 1PKVA 1OCCH 1USSA 2JK3A 3MMYB 1ON2A 5DEQA 3VYTB 3KYLA 1S72I 3LO8A 2GIZA 3AKZA 1TWHJ 3F8NA 1WJDA 2HQ5A 2DFEA 2IA0A 2XT4A 2RN7A 3OYHA 3V4GA 2V9PA 3CP8A 4U49A 3CZ6A 5FB2A 4RD2A 4DOZA 3T56B 1QVTA 2CUJA 3GZ5A 3ISPA 5LHIA 1VF9A 4ABZA 2DI3A 3RKQA 4ZDPA 2ZZQA 3WTUC 1K4ZA 1T6SA 1HW1A 1LNWA 5EDNA 2E2JJ 3KX2A 4KMUX 4C43A 2LVSA 3IHUA 2K9MA 1BW6A 3DWLE 2Y0MA 3RYPA 5GADJ 4X8IA 1TWGJ 1BI0A 2MW8A 3E7LA 3ULQB 2J7KA 3WNCA 3B73A 2XROA 1D8JA 2JQ7A 2CNDA 4XN0A 3BR6A 3ZQCA 5GTIC 2K9SA 3ES9A 2D3NA 5IYBJ 3C18A 1L0OC 5F1RA 1ZM2A 4RD6A 4Y9UA 3K7AJ 1Q81D 1D1CA 1LLZA 3IWFA 2OZUA 3O2PE 1N8RD 4LBVA 4PC1A 1TW2A 1X1PA 2XNDA 1KU3A 1E2XA 1SKYB 1DQUA 3DP7A 3FX3A 2LK2A 2MFZA 3MQ0A 4XKWA 4BQNA 4KH3A 3J81Z 4DW6A 4MEXF 1KQSB 5LGNA 3HSEA 3BNWA 1O8LA 5BNGA 4AYBA 1ITYA 1P4MA 3BCDA 2MD5A 2DQRA 1W4MA 3QODA 4YFNF 3HKZN 5FNZA 3G1LA 4Q47A 3AK5A 1RR8C 2DTRA 3ASQA 3CO7C 4M73A 1P7IA 3TP3A 3M4OJ 1T95A 2DA6A 1Z77A 2DT6A 3CCMB 1YG2A 3E6MA 2Z2SB 1R5HA 2IA1A 2IT0A 2VFMA 2OBTA 1QZEA 3M07A 4M1KA 1FIAA 1YRNA 3I1FA 3CUQC 5K1YA 1OGIA 1DP3A 1J59A 1BI1A 2GK6A 1WPCA 1R1TA 1GO2A 1EFRA 1YX5A 4ITVA 1IRGA 2BM1A 1D5YA 3G71B 2VONA 2HYGD 3EQNA 4QSHA 2OK8A 1HW5A 2I10A 2F5EA 3VMFA 1XDUA 2NS7A 2B0LA 2L4MA 3OSGA 5CJ9A 5CKTA 4Q5SF 3SDBA 1IUYA 3OW2B 4KMFA 4J01A 4AVZA 3E20A 3DXJF 5A8AA 2CK3A 1YJ9I 1FNDA 1BC8C 4L0YB 2F1MA 4GYIA 2VJ4A 3H9NA 3FXOA 2MD0A 1U9NA 4ZH4F 2CW7A 3QAHA 2WAEA 3WTZA 4XMYA 1ONVA 4WK8F 2QBYA 3PO3J 2DK8A 2HDNB 3OOCA 1HF2A 4O6JA 3OYNA 1HKSA 3CC2I 2W4SA 1U78A 1QVUA 1JI8A 3GQBA 4Y3OA 3BCBA 3BT9A 1U3EM 1X0CA 1RUNA 2KIQA 1QGZA 1OYIA 4R1HA 2V7UA 4XKBA 2INVA 3C2HA 4FQGA 3JQQA 3WTVC 1U2RA 4ZCLA 1A6IA 1LPQA 4RPDA 2XB5A 4LB5A 3GZNB 1D1NA 4WXDA 4L9VA 2NVTJ 1QFZA 2V26A 2VT3A 2R7FA 2LBFB 3BG3A 5HZAA 3CCUB 1SVOA 1YJ9B 1IN5A 2WJVA 1YJWI 2ZSHB 1ZK8A 1B8IA 4PDKA 4PGHA 1GR1A 4TMZA 3OJWA 4YFOA 2XRNA 3RZOJ 5F4MA 1RU4A 5CYVA 5GAGJ 1R00A 4UVAA 3CC4I 2QUFA 3JSPA 3HOYJ 1NJID 2L54A 1H8EA 3SDGA 3G3ZA 2WB1N 1HKQA 1OISA 1S0UA 3DBLB 3R60A 3OYGA 2OBSA 2WJYA 5DDGA 4HV5A 4EVIA 2B9SA 2YX4A 1LDKB 3S2WA 2H09A 1PP8F 1X2MA 4B3FX 2HVQA 5TY0A 3BZKA 3FMSA 3CCMI 1LFBA 2L2OA 3DEUA 2EA4A 3DKWA 1LJ9A 3KFWX 5EJCA 3WG9A 3J81K 4CHUA 3Q38A 3R6JA 4F92B 3W2EA 5TR9A 4P55A 4BE1A 1UELB 2H94A 2O6WA 2WWYA 4HE5A 3H35A 1YE9A 1LFPA 3K4BA 4HF2A 1SKQA 2FBIA 4HX4A 5JR3A 1FY7A 1QG0A 4IZZA 2D9RA 5HNFA 4P2NA 2HOSA 1G8XA 4BY7J 2AHOA 2PYHA 4OJ6A 4YZ0A 2R0QC 1X3WB 5J8FA 1MSFC 1TTTA 2ZL5A 3GFJA 4EH1A 3DDYA 2NSTA 3EYYA 2IXSA 2IS2A 1DPUA 2KISA 2ZBKA 4ANJA 1UD8A 2BM6A 5D4SA 1FLIA 3GMEA 4KJZA 4KT6A 2NVYJ 3GVLA 5CVRA 2V7TA 2E71A 1R4NB 1X4OA 3BCAA 5DTDA 2WAQN 1PUFB 2OF7A 4B3XA 4NC6A 4D5FA 1JT0A 4PSXA 1NB0A 4OPOA 1VQ5B 2R6HA 3OJXA 4F52A 4QVAA 2V4JC 2XF6A 4XM3A 2BVNA 1GJRA 2A6EF 4XD7A 5EGOA 3WBJA 4CQJA 3CF5F 3OS1A 2KRFA 1V5FA 1MH4A 4IQ4A 5KVRA 1U5TB 2V79A 5F0CA 2RC5A 2CFOA 2IAIA 3QFSA 3LFUA 4G7OF 4WQMA 3BH4A 2F3LA 3GTOJ 5F4JA 3RKYA 3W5VA 1X4PA 3AVXA 1QA6A 4XNFA 4RD0A 5THXA 1Q1VA 5TRDA 1XDSA 1R1VA 2J8KA 3K4NA 2G7UA 2OAZA 2PI0A 1FEXA 3ZZ0A 3CDIA 3SEJA 3EETA 2YSRA 3KP2A 4IHXA 3F3XA 1P4WA 3EUHC 1PUEE 2K7LA 1JXSA 1E1QA 4BE0A 2MG4A 4PFOA 3V7RA 2R5YA 4G1VA 1D8TA 3PA2A 4BEHA 1H85A 2LP0A 2AHQA 2VE8A 3CCSI 1FIPA 1EP1B 4OM9A 1VQPI 2FMYA 3OYAA 3K6GA 5FRMA 2BMWA 3ISXA 1GVHA 3I59A 3CMAI 4P26A 2EWEA 3T8TA 4M4SA 2DJIA 4BNCA 2PN6A 4YZAA 1APLC 1IA5A 3GW2A 3ZIAA 2HZTA 1FBUA 2DO7A 3G6EI 2CMPA 4A3MJ 1QUFA 4M9ZA 1VLOA 3GSIA 1IB4A 4AWXB 4LC0A 2V1DA 4HDVA 4ZTJA 2DPUA 4YCQA 3OYJA 3HYIA 3HOSA 4LLGF 1QHGA 3Q39A 1BIAA 3D5LA 3KEWA 1R36A 1GHCA 2PLFA 4UUSA 3GCMA 3VYSB 3CCJB 4DQ2A 2OBPA 1ZQ3P 1EP3B 5LD2C 2QKMB 2CFXA 3JSOA 3I5UA 1KD1D 1PYVA 4LIUA 2WZPP 2ZMEB 2HYJA 5IYRA 1MJBA 2DFIA 4ZGQB 3BR3A 3OZVA 1OFMA 1TWAJ 2WY7Q 5F0HA 3OR1C 2VNJA 1WORA 3OZWA 3B8YA 2JVHA 2KPMA 3AVVA 3PIPF 3PQJA 1HZEA 1SD7A 3G2BA 3EUHA 2W82A 3BR2A 4JX5A 1ZREA 3JRIA 1KTVA 2VQLA 2WPDA 5FIUA 3J7AY 2DY1A 3CMMA 3H5RA 4M72A 5FO1A 4A93J 3FM3A 1T38A 2ZNZA 5DS9A 4Z4RA 2CV0A 3S1MJ 2DLLA 2K4JA 2L9RA 3FBIB 1MDMB 2H6CA 2OCCH 1VQ4I 1FNCA 5K7FA 4I0BA 1X2NA 1Z3XA 4JRAC 1KGSA 4EJUA 5FFZA 2GK7A 3Q0UA 5DCMB 1OLTA 1FP1D 1FSHA 2HWVA 1ELOA 2HOAA 1KK2A 3T8RA 2XZPA 4U9UA 1ZN2A 1B23P 2Z8GA 2K3PA 2VZLA 4X07A 3RJPA 2Y9ZA 3TW6A 2P5LC 4XLCA 1W7PA 3A0BC 4EEFG 1G7RA 3ZUGA 4FX4A 2YS9A 1JNYA 2G7HA 1YYVA 2GLOA 2F2EA 4UVBA 4F3QA 2ISZA 1MW7A 3ZN0A 2IQ7A 2ZO4A 2M4KA 1HDPA 2KRCA 2D1HA 2H6BA 2QMUA 2ECCA 4E7SA 3I55B 2JSPA 4II3A 3W2AA 1KU7A 2GA1A 3S15J 4Q4ZF 2FOKA 4BBRJ 4AF7A 2LY1A 4HAMA 1GDTA 2CF4A 3BQYA 1WJ5A 3WE2A 2HDCA 1VQNB 3LJYA 4MQ9F 4IQJA 2XTYA 1X1DA 3E0JB 5D8LB 4RJLA 4OOSA 3KP5A 2ZMEC 3ONUA 3IWZA 3LOCA 4BXXJ 2K40A 4RBOA 2R7XA 2YUHA 2DA5A 3P7NA 4NCNA 2XZLA 1ZM4A 3O3KA 1KYWA 4WWCA 5JBQA 2AS5F 4L5EA 4PABA 4FETA 5J6XA 5D5UB 4A3LJ 1JKRC 2XAGA 1OR7C 3BJAA 3L9FA 2P7CB 2GQQA 2KDOA 3GX4X 4C9YA 5J1RA 3WGIA 1B59A 4DBQA 2FF4A 4RPBA 3ZZUA 1LE8A 3GTQJ 3E97A 3JU4A 3DTEA 3PO2J 1FP2A 2VXZA 2DMTA 3BWGA 3OL3A 4WWVA 5JVTA 3M3YJ 5H2FC 2FBKA 1UJ8A 1YHQB 3FISA 2QZ8A 1MMAA 4FT8A 3HRTA 4XL9A 4Y13A 2KFDA 4UZEA 2CO5A 3I4PA 4RAGA 1QPMA 4KFCA 1UD2A 1ZTRA 5IOYA 3FY3A 1BX1A 3CPWB 4XLEA 5KAIC 4UVCA 3IAS2 3IH3A 2BX6A 3W6JB 1GV5A 1JUMA 3T0YA 4IOAF 2KMUA 3WHCA 4YG2F 1JKQC 1G2HA 5FKNA 2UV1A 2HFHA 3HOXJ 1P6RA 1K83J 2LY2A 1JJ2B 3QYFA 5K5QA 2DMNA 5L3GA 4CDGA 2HTJA 4JK1X 2HDDA 3I56B 1MMSA 3WG7H 3AL0B 4ZCIA 4N9HA 2R7SA 1KK1A 2XKOA 2BGIA 3BG5A 3C2BA 3V7SA 4Z6YA 3BC9A 1I8DA 1E3HA 4GO1A 1G59A 4DK0A 3KP6A 1E0EA 1H8AC 1O3QA 2NSPA 3HG9A 1OGMX 4NBSA 5K7HA 3DU6A 4DYQA 3GBGA 3A3GA 4DZPA 1QFJA 4L5IA 4FTHA 1IRFA 3WU2C 4P96A 5LHGA 1JTAA 2XAFA 1VQOB 2COMA 1AKHB 2WBMA 2OTLB 2M1BA 2M4GA 3OYEA 4E7ZA 2G0EA 2DA2A 4YIIA 4UB8C 3K4CA 2DCUA 4D9JA 1VQ6B 4FX0A 1I6XA 1WP6A 3SZPA 4X06A 3BTCA 3RPUD 3GTLJ 4PAAA 1S4MA 2DK5A 2KIUA 3PL8A 4Y15A 4BAYA 1G7SA 3V76A 4XONA 2EIJH 3RQ4A 3MZHA 1FYLA 4IVNA 3GQ8A 2R7TA 2HGCA 1MBGA 1T0FC 2VB6A 1QGAA 1OQYA 1RQPA 2WAFA 4I7HA 1O8GA 1FX0A 1VTNC 3HM5A 3WXMA 3DEWA 3CJTB 1XPXA 5K5RA 2JMWA 3B6CA 4L18B 4FXUA 2P0WA 3V7AA 3CD6B 1Y0YA 4GQNA 1EH8A 4GCVA 2YPRA 3OMYA 2CQ7A 2BF4A 5HXBA 2LH9A 3UKGA 1H9GA 1MBKA 4Y17A 3TO6A 2VUMJ 2Q0OA 4ENNA 1K9MD 1IHMA 4B47A 2L0KA 1JJ8C 5CVUA 2XNCA 3OYBA 1BI3A 3HUGA 2X0LA 1E3XA 2QSHX 5IT9K 2VKDA 2XC7A 5KW9A 1C0WA 3VMVA 2FQ3A 3MCZA 4BACA 4NBQA 3OFNA 4W97A 4Z4YA 3CCRB 2F48A 3M7GA 4X0CA 3QPSA 4HYEA 5FGMA 2DW4A 3JX8A 3ZPNA 5E17F 3SZEA 1VQKB 1PJRA 4LOCA 2XRLA 1UHSA 1J9ZA 4E7HA 4DJAA 1IRXA 3SFZA 4KUMA 3Q9VA 3VOEA 4KN4X 3QPHA 3HPHA 2BSAA 4CICA 1MBJA 4I0AA 3D5SC 1QRBA 1T08B 3DKXA 2P4WA 1FMVA 3E1YE 3CMEB 4M6VA 1KK3A 2JJ7A 4BL0B 1V0EA 2VBUA 3GO5A 1HA3A 4JQFA 2P6SA 3G73A 5DM6F 4QVJA 1TW3A 1WJBA 1LKXA 4GYGA 3OEHA 2BEOA 1OGJA 3GTGJ 5CLSA 4KIFA 4BPRA 5C44J 1B8IB 2E1RA 4M9XA 3KP7A 3ZP5A 3VNVA 2DMUA 2E7XA 2I1LA 1FZPB 2LSOA 4II2A 2VOOA 3ZQ7A 2HNHA 1TLHB 3CRZA 3IC7A 5E20A 3AFHA 2FX0A 4OAZA 2JA7J 1TSPA 2ID6A 1F36A 4A0YA 1S7EA 1BI2A 4BJ6C 1PP7U 1FX7A 1YOVB 5FD6A 5ILUA 4EATA 4QTRA 1I1SA 2LDUA 2QX3A 3CC7B 4FWTA 3ML3A 1W0KA 4JX4A 2R7RA 3QFTA 3WYAA 5J3LA 5HOOA 4AD9A 3AG3H 4KKUA 1QQ1A 4L9JA 4B8XA 1ZRDA 3JRFA 2AXTC 2DA7A 2LBFA 4RCYA 1IXRC 4EQQA 4BUPA 1FTZA 1Y1WJ 3ZXSA 2HEOA 4CCJA 2V7XA 3T51B 2W7NA 1MBFA 2M34A 3BG6A 4RM0A 2ZXHA 4GDFA 3WODF 4YRVA 1R7JA 4OWRB 4KNYA 5FKMA 1KQ9A 3HRMA 1S6LA 3S93A 3U2RA 4C3HJ 1JE8A 1ZRCA 4WZLA 4WZEA 1TBXA 1R6RA 4H9GA 3OZUA 4CYDA 4M6XA 2IGOA 2P8TA 1UAAA 4L8JA 2EZKA 1I39A 2MGQA 2M5SA 1MBEA 4ASNA 2QEXB 2HS5A 1D1BA 1QNTA 5E1ZB 1KC8D 1P4AA 1W35A 1J2XA 5K7ZA 2ZXIA 2C2WA 3BH6B 3KYDB 1YI2B 4AIKA 2JUGA 3FMQA 1R4MB 5EG0A 2E7WA 1QGPA 1BR1A 3C2GA 1R49A 2K9QA 3M8JA 3OOPA 5DV5A 3A1PA 5ERIA 1N07A 2CQXA 2FJ1A 4G12A 5F08A 4JX6A 1DUXC 3KE2A 3BP8A 1RC9A 2ELJA 2EQRA 1MJ9A 3OS0A 3MKZA 1U2WA 1XTAA 4CO8A 1L3LA 2OTJB 2A69F 1M1EB 2VI6A 3VNUA 4GFBA 3F23A 2QEXI 2X6XA 1E1RA 2FMLA 3SLDA 1TQPA 5JMCB 4LLLA 1XG1A 5L3BA 4ZTFA 1YJNB 1KA8A 2K85A 4BHBA 4MHGA 3G4SI 2VKEA 3OYMA 3CCVB 3H92A
chains in the Genus database with same CATH topology
2MD0A 2X6YA 2CW7A 2XZOA 2V31A 2WAEA 2E1MC 4OZZA 4Z06A 4XMYA 2V1NA 2Y0SA 4F55A 1Z3YA 4P5OA 3BG7A 4H4KC 3OOCA 4B3GA 2M0MA 1OHHA 3OYNA 1JI8A 2MABA 2W4SA 1E79A 2UVEA 1TZLA 4Y3OA 3BCBA 3NWTA 2V6EA 3GQBA 5JHFA 1X0CA 2MYSA 3LMWA 3VR6A 5HKKA 4NQWB 3VSTA 2GJKA 4XKBA 2INVA 3C2HA 4B43A 3K4JA 5FROA 1BLIA 3HAGA 1BPLA 1QU3A 4TSFA 2V26A 2LBFB 1VBLA 5LFAA 2GOXB 4XQFA 1QJVA 3BLYA 2LYCA 3ZR8X 2WJVA 2WAQA 3FHNA 4DIQA 2VASA 3OYDA 4C30A 2ZSHB 3SUCA 5AMVA 1UG0A 3DU5A 1V5GA 1OFLA 1RU4A 2W6IA 2WSSA 1U0JA 2HDWA 4RM3A 1H8EA 2JIZA 2E60A 4W8SA 1NHCA 2HPMA 3HXLA 3OEEA 2WJYA 3A4CA 3OYGA 2M7BA 3OYCA 4RLFA 4CCLA 1LDKB 4BJTA 1GQ8A 1FMWA 4B3FX 1O8KA 2HVQA 2K5CA 4DGWB 2L2OA 2GOMA 2ODLA 1O8IA 2XF5A 4F92B 3DPTA 2F6CA 3TBIA 4BE1A 1UELB 1DGRM 3H35A 3SEQA 1YE9A 1LFPA 2E5NA 3K4BA 2A5WA 2AQEA 1K5CA 1WFXA 4B48A 3ZRGA 2K9LA 2ZFUA 4IZZA 5HNFA 1W36C 2KVOA 3KRGA 3UW0A 2HVSA 4BQOA 1G8XA 3DEEA 4B44A 3L2RA 2PYHA 4OJ6A 2VKHA 4YZ0A 3LL7A 2IGKA 3VSVA 1DBOA 4XN3A 3KEYA 3DDYA 5TGTA 1H80A 2NSTA 4NNJA 2LRDA 2IXSA 2HPIA 2IS2A 4ANJA 3W2VA 1UD8A 1MNEA 4KJZA 4KT6A 4GRIA 3ZSCA 2VXDA 5CDFA 4KISA 2W6JA 3ZGKA 2CV2A 3GVLA 1D0ZA 3K4KA 4KKSA 1X4OA 3BCAA 1MMNA 4B3XA 4C2TA 4I84A 4PSXA 2A6TA 3MKWB 4F52A 2W1OA 2V4JC 2XF6A 3E1SA 4OAYA 4XM3A 2UWMA 1W9XA 2AQFA 2DIEA 2E1BA 1EE6A 3F9KA 1NG7A 4BJ5C 4ZYAA 4XD7A 1X1BA 2NT6A 4XOPA 3SZGA 4LIVA 3OS1A 1V5FA 2JDIA 1OOCA 4IQ4A 2KHMA 4HIZA 3VMWA 2CFOA 3LFUA 2HVRA 4HRIA 3BH4A 3L2UA 2PJRB 4X0GA 1X4PA 4PSWA 4CCMA 4IKFA 2O0WA 4XNFA 3DQVC 4PUSA 3H5NA 3GVKA 1PXZA 1WJCA 2RQQA 3LSKA 2JJ2A 1QCXA 2KL4A 4YZQA 3OIPA 2DXIA 4HG2A 2BVLA 2VQHA 3K4NA 3A1YA 1HA8A 4D1QA 2VJ5A 2O5RA 1TT0A 1BOBA 5KNLA 2X51A 3EUHC 4W8TA 3CF2A 5KCMA 4CZCA 4BE0A 1E1QA 4PFOA 2VLAA 3FKJA 1P9QC 5IK2A 4U4BA 3SEZA 3OW7A 3IUOA 4BEHA 4CCOA 4R79A 3GQ7A 3EUKL 4HNUA 1COWA 4Z03A 5C1CA 2DOAA 3K6GA 3OYAA 4XLHA 5HVQC 5FRMA 4XLAA 2L5QA 4KKTA 3G05A 2EWEA 1KMHA 3H94A 2V9KA 2DJIA 3PUBA 2PYGA 1HG8A 2O1DA 4PJMA 4URRA 4NC8A 4YZAA 1BMFA 1IA5A 1W36D 3VWBA 3ZIAA 3OYIA 3B4NA 2L7KA 3NE5B 1IB4A 2CMPA 1KCDA 2E5ZA 1BR2A 2HQAA 3I9V2 4PMHA 3U21A 4ZTJA 3PSIA 4BGDA 2Z16A 4ZDOA 3OYJA 3OPOA 2VPLA 3HOSA 3T9GA 1QHGA 3FKSA 3QOEA 3D5LA 3KEWA 2VBKA 2HZDA 4LG3A 5CQEA 2X53S 2CW8A 2XF7A 1VZ0A 2BW3A 2QE7A 3VYSB 3LSMA 5LD2C 2LG4A 2QKMB 1PYVA 4LIUA 4AU7A 2WZPP 3A3BA 1I18A 3PFYA 1BN8A 3RCOA 4E0FA 2NOJB 3SYTA 2LOOA 1OFMA 3PSFA 1NBMA 2WY7Q 2BSPA 3OR1C 3PNTA 4ZDLA 2ZZGA 3B8YA 2JVHA 2KPMA 2QXZA 3K70D 1HZEA 3H5AA 3G2BA 2W82A 3H9JA 4BS9A 1Y6IA 2VQLA 2WPDA 1RWRA 3M1CA 4CCKA 1N75A 4RLQA 3J7AY 3L2WA 3CMMA 3H5RA 2VQCA 2ZZFA 2INUA 3N05A 3BCFA 3DLAA 1DBGA 2X85A 1K6YA 2CV0A 4DNRB 1O8JA 3GRHA 3FBIB 4BDYA 3OOUA 2R7QA 2NT9A 2UVFA 2KLOA 3EUAA 4XKCA 3VSKA 3W2WA 2M3AA 2NZMA 1Z3XA 3VYRB 2DCEA 2L9NA 1UD6A 3DTIA 4E7LA 3FBNB 5CPRB 1WMRA 2GK7A 2XZPA 1OLTA 2X8KA 3LNNA 3OYFA 1CZFA 3LSIA 2Z8GA 3GQ9A 2K3PA 2XOKA 3FPPA 4PFPA 3UNGC 1O8MA 4MLOA 4XLCA 4OJLA 2V7FA 2BW3B 2QKLB 1D1AA 4F3QA 1MW7A 2IQ7A 3IP4B 2LZJA 2M4KA 2KRCA 1IDJA 1KONA 2JA2A 4E7SA 1X1CA 2JSPA 4II3A 2RNGA 3W2AA 2KZVA 3CJQB 4HPQA 1X19A 1ERDA 2Z1DA 1Y56A 4YXWA 2LY1A 3AL0C 3EQOA 1WJ5A 4PJNA 3GVJA 3VSUA 3TL4X 1BHEA 2VIXA 4IQJA 4MR0A 1X1DA 3E0JB 2O0VA 3OYLA 1ZELA 3DKYA 3PNYA 3CJRB 2R7XA 3LSGA 2ZTGA 2XZLA 3OY9A 2V4DA 2CV1A 4HSTA 4FETA 2WADA 3DTKA 3VDXA 3L2VA 4HEA2 4J00A 2ZTNA 3OAAA 3H9QA 2I8DA 4G7XA 1OR7C 3HL2A 2KDOA 4C9YA 5FRNA 4OJOA 4DBQA 5CQGA 2F4IA 3S3NA 2IS6A 4QPOA 4LITA 3OR2C 4BEHB 3D5RC 3JU4A 4DK1A 1H8HA 2PMZA 3DTEA 1N77A 1O8FA 3ZPPA 2VXZA 4EW9A 3OL3A 4FASD 1D0XA 2X6WA 1LVKA 1UD3A 4HWVA 1MMAA 4XL9A 2R7WA 4BE2A 3PJRA 4JOMA 1RMGA 4PJJA 1UD2A 3FY3A 2X1CA 4ZC3A 4OJPA 4XLEA 2F5VA 4F93B 3IAS2 1MMDA 2F43A 2CS3A 2VL8A 3B90A 4N4NB 2KMUA 4KITB 4MXNA 3QYEA 2VBMA 2UV1A 2VJJA 2LY2A 3QYFA 3FDYA 1MNDA 1D0YA 3AL0B 2R7SA 3OL4A 3VYUB 4PK4A 3DPLC 4C2UA 3BC9A 1WJAA 2FUG2 1I8DA 2HLDA 2O17A 4NK8A 1G59A 3MKYB 5DN6A 1E0EA 4XKVA 4DK0A 4OZYA 2NSPA 1N78A 3HG9A 3OWTA 1E3ZA 1OGMX 2R4GA 3DU6A 2OV7A 3GBGA 4NC7A 3A2KA 1W0JA 3T53B 1JRGA 3A3GA 3LSHA 4E6KG 1OB0A 1UD4A 2X3HA 4CCNA 3ONQA 2IS1A 3GQAA 5C1EA 2GJRA 4E7IA 1JTAA 3MD2A 2W00A 4JMQA 4DNTB 2WBMA 1KZLA 2M4GA 1O8EA 3JURA 3OYEA 4YELA 2GJPA 4E7ZA 4RM2A 1NRKA 2KRHA 3K4CA 2PJRA 4XOTA 4BU2A 2KQRA 4D9JA 1WP6A 3S3OA 2XSJC 3WQZA 3RPUD 1O88A 1AIRA 3DPUA 1AA7A 4ASUA 3PL8A 2Q1ZB 2R9VA 2WB1A 4XONA 3S8PA 2OUMA 4ZJZA 3RQ4A 2KP6A 3GQ8A 2R7TA 5KHDA 4G6TB 2VB6A 1T0FC 3V42A 2WAFA 4RMNA 2VBEA 1O8GA 1FX0A 2Z6BD 2RREA 4BXFA 4FXUA 4XR6A 4P22A 2P0WA 1E43A 2BVMA 3A35A 4GQNA 3OYKA 4NK6A 1QHHD 3RTRA 2F1MA 3OMYA 3HOTA 2LH9A 1NG6A 4F91B 4PJLA 4QPQA 3H0DA 2R7UA 1O8DA 4Y33A 4B47A 1OGOX 4HNTA 3OYBA 1E3XA 4BQQA 2D3LA 2IS4A 2VKDA 1J09A 2XC7A 1PE9A 2UUZA 3VMVA 1WJEA 4BACA 3OFNA 2R7OA 1VLYA 1WJFA 4TT3A 4DBRA 2VJIA 1K28D 1V5EA 2X1EA 3ZPNA 4Z05A 1PJRA 1Z21A 1KCCA 4E7HA 4DJAA 4P1WA 2XGJA 1IRXA 1IDKA 1XG2A 2X1DA 1MABA 3HPHA 4HSRA 3CESA 1Z7LA 2OC6A 3D5SC 3LMMA 4G6IA 3DKXA 4TKOB 2XDVA 1FMVA 1HVXA 2MC4A 2LREA 4BL0B 1V0EA 1GLNA 1EA3A 4XORA 4W8QA 4U87A 4E4HA 1PKVA 3WWGA 4YZXA 3VYTB 3MMYB 4JQFA 1YX3A 3KYLA 4E7KA 3AKZA 1WJBA 1LKXA 4W8RA 3OEHA 1WJDA 3HKZA 3OYHA 2JVGA 4U49A 3CP8A 3CZ6A 1UD5A 3NWSA 4DOZA 4Z1MA 3T56B 2CUJA 1O8HA 2NTQA 4OJ5A 2IGMA 4II2A 4ZDPA 4YEJA 2ZZQA 2HNHA 3CP2A 3HC7A 4CH7A 3UR3C 3AFHA 3KX2A 3H9GA 4OAZA 2ZZEA 3OS2A 4BJ6C 3OIQA 2K9MA 4CA0A 3DWLE 3I3LA 1T5EA 3S32A 4IX7A 4EATA 3HUGB 3OE7A 4C2LA 2QX3A 1W0KA 1BR4A 2CUZA 1DGWY 4XN0A 2R7RA 2O04A 2VQGA 4Y4RA 2D3NA 5HOOA 4KKUA 1PLUA 5HNHA 3K10A 3OYMA 2PECA 1D1CA 3ZQQA 2LBFA 5HLTA 4E7JA 3K4LA 2E1MB 2XAUA 4BUPA 3QYBA 3IAM2 3ZCOA 3ZXSA 2DT7B 1S9HA 2XNDA 4CCJA 1SKYB 2W7NA 5FL7A 3T51B 2L9SA 1DQUA 2MFZA 4XKWA 4BQNA 3BG6A 1SFKA 2ZXHA 2BOLA 2IGNA 2NTBA 4YRVA 2ZSIB 4OWRB 3S3MA 1SAUA 1MMGA 3S93A 1KTWA 1O8LA 4AYBA 4BDZA 3BCDA 1R6RA 4NUBA 2IGOA 1UAAA 4L8JA 3PNVA 3QODA 1VJSA 2M5SA 4XLFA 1D1BA 2HU9A 1V0FA 2JJ1A 2NTPA 4G7WA 4CUGA 4UZUA 2ZXIA 1T95A 2DT6A 2JUGA 2Z2SB 2M7AA 1BR1A 3C2GA 3M8JA 4N4OB 1DP3A 3K4MA 2GK6A 1WPCA 3TMOA 3BC8A 1EFRA 1YX5A 4ITVA 2QY1A 2ELJA 3RSNA 3OS0A 3MKZA 2WY8Q 3EQNA 2CH0A 2V7QA 4U7BA 1WTHD 3K70C 5CKTA 2X6XA 3EPZA 3SDBA 1E1RA 1X1AA 4AVZA 2Q2EB 3L2QA 4J01A 4ZTFA 2R7VA 2CK3A 2LC2A 1VF7A 3W3CA 3HPGA 2WA0A 4CSWA 3VSLA 2VJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCC A;  2X6Y A;  1IDK A;  1XG2 A;  4OZZ A;  4U4B A;  4Z06 A;  4XMY A;  3GQ7 A;  4OJO A;  4Z03 A;  5C1C A;  2UVE A;  4XLH A;  1X0C A;  4XLA A;  1O8F A;  2EWE A;  3LMW A;  3ZPP A;  4XOR A;  4W8Q A;  3VST A;  4EW9 A;  2PYG A;  3WWG A;  1HG8 A;  2INV A;  2X6W A;  2O1D A;  4URR A;  4YZA A;  4YZX A;  1IA5 A;  4HWV A;  4XL9 A;  3B4N A;  4W8R A;  1RMG A;  1IB4 A;  3FY3 A;  1KCD A;  4U49 A;  4OJP A;  4XLE A;  4PMH A;  1VBL A;  1QJV A;  4XQF A;  1O8H A;  3B90 A;  2NTQ A;  4OJ5 A;  4MXN A;  3SUC A;  3T9G A;  4YEJ A;  2VBM A;  5AMV A;  2VJJ A;  2VBK A;  1OFL A;  1RU4 A;  4W8S A;  4MR0 A;  1NHC A;  1BN8 A;  4C2L A;  2QX3 A;  2O17 A;  4NK8 A;  4OZY A;  4XKV A;  2O04 A;  4XN0 A;  2NSP A;  1OFM A;  1OGM X;  2BSP A;  1PLU A;  1GQ8 A;  2PEC A;  3B8Y A;  1JRG A;  1O8K A;  2QXZ A;  2ODL A;  2X3H A;  1O8I A;  1RWR A;  3GQA A;  5C1E A;  1JTA A;  4XKW A;  2INU A;  2NTB A;  1K5C A;  1O8E A;  3JUR A;  1DBG A;  2X85 A;  4YEL A;  3GRH A;  3KRG A;  1O8J A;  3UW0 A;  1KTW A;  1O8L A;  2PYH A;  4XOT A;  4OJ6 A;  2NT9 A;  4YZ0 A;  2UVF A;  1O88 A;  3VSV A;  1DBO A;  1AIR A;  4XN3 A;  2NZM A;  1H80 A;  2NST A;  1WMR A;  4XON A;  4XLF A;  1CZF A;  3GQ8 A;  3ZSC A;  2Z8G A;  3GQ9 A;  2NTP A;  2VBE A;  1O8M A;  1O8G A;  4I84 A;  4XLC A;  4OJL A;  4XM3 A;  4XR6 A;  1EE6 A;  2NT6 A;  4NK6 A;  4XOP A;  2IQ7 A;  1OOC A;  1IDJ A;  3VMW A;  2QY1 A;  1O8D A;  2O0W A;  1OGO X;  4XNF A;  1PXZ A;  3EQN A;  1QCX A;  3EQO A;  3VSU A;  1BHE A;  4YZQ A;  2X6X A;  1PE9 A;  3VMV A;  2O0V A;  4AVZ A;  2VJI A;  4Z05 A;  4W8T A; 
#chains in the Genus database with same CATH topology
 3TGN A;  1BJZ A;  1TVC A;  1JA0 A;  1Z6T A;  3CMA B;  2PG4 A;  3WU0 A;  2V31 A;  2Y0S A;  4F55 A;  5M5Y J;  4P5O A;  4EJW A;  3FXQ A;  1XE1 A;  5GAH J;  4TMT A;  2M0M A;  2W24 A;  1TZL A;  1IO2 A;  3NWT A;  3P26 A;  1QZY A;  2FU4 A;  2DYS H;  2MYS A;  3S1R J;  1LEA A;  3LMW A;  1XGN A;  1B6A A;  3VR6 A;  5HKK A;  4NQW B;  2QYO A;  3SKB A;  5HS8 A;  5FRO A;  3S1Q J;  3CLO A;  2PLY A;  3FXR A;  3HAG A;  4ROX A;  3W2G A;  1SD5 A;  2ID3 A;  1I50 J;  2QA4 I;  2R5Y B;  1VBL A;  4UY8 I;  1QJV A;  1W7P D;  3BLY A;  2LYC A;  2NRA C;  1IRZ A;  1IN4 A;  3OYD A;  2COB A;  4C30 A;  3V8J A;  4RCZ A;  5AMV A;  2BM7 A;  2X3U A;  1UG0 A;  2ZL6 A;  1UFM A;  1V5G A;  1YS6 A;  2ESN A;  2L01 A;  3CCE B;  4Y7N J;  3RQI A;  1Q86 D;  1QO0 D;  1U0J A;  3I59 B;  2HDW A;  4M3E A;  2ZME A;  1BA5 A;  4RM3 A;  2JIZ A;  1I5Z A;  1IV6 A;  2D5V A;  4FE7 A;  4RLZ A;  2FNA A;  2FOW A;  3HXL A;  1Q1H A;  4D7N A;  2M7B A;  1SAX A;  4RLF A;  4XSZ F;  4CCL A;  4BJT A;  5A88 A;  1SC7 A;  5GP9 A;  3ASN H;  3MAJ A;  1DG1 G;  2K5C A;  3WGG A;  2CYY A;  5IYC J;  5D5V B;  1JJ6 C;  4A6E A;  2VE9 A;  3CME I;  2XF5 A;  3TBI A;  3J7Y J;  2M30 A;  1LB2 A;  1SFO J;  3BR0 A;  2E5N A;  2YWG A;  4M2L A;  1ZGW A;  3U6K A;  3MEX A;  4B48 A;  3KRG A;  2KVO A;  1N06 A;  2ETH A;  3L09 A;  4JBA A;  2E1C A;  3DEE A;  2PJP A;  3L2R A;  2XGE A;  2VKH A;  3ZMU A;  4FN5 A;  2VFN A;  3VSV A;  2FVG A;  1FJL A;  1DBO A;  4A69 C;  3V8L A;  4IXA A;  1XSD A;  3WTX C;  2LRD A;  2HPI A;  2R92 J;  3W2V A;  4OPW A;  1MNE A;  5DUK A;  3CCY A;  1K78 B;  3GVA A;  2VXD A;  1NH3 A;  4KIS A;  3ZGK A;  4IHY A;  5JI6 A;  3RKX A;  1WDT A;  3MKL A;  3VO2 A;  4WX9 A;  1ZAR A;  3HDD A;  2W1O A;  2UWM A;  1DAR A;  1QZZ A;  5LGT A;  4RD3 A;  3F9K A;  4BJ5 C;  2DPD A;  2P3M A;  1I3A A;  1X1B A;  2NT6 A;  2H1L A;  4UB6 C;  4XOP A;  1DDN A;  4LIV A;  3V8K A;  5E3M A;  2BXY A;  4HIZ A;  1TNT A;  3H0G J;  3K1N A;  2C6Y A;  3SJP A;  3VMW A;  3WU1 B;  2M87 A;  2PJR B;  2B5O A;  5ICE A;  4X0G A;  4LGW A;  2PQ8 A;  4PSW A;  4RB1 A;  1HCR A;  4IKF A;  1ZR4 A;  2O0W A;  3DQV C;  2BXZ A;  4PUS A;  2MLG A;  1IJW C;  3LSK A;  1PDN C;  1ZUN B;  3GVK A;  1K8A D;  1QCX A;  3TQN A;  3OIP A;  3RZD J;  4HG2 A;  3A1Y A;  3H3V K;  5IYW A;  2KJB A;  1EH6 A;  2A68 F;  2O5R A;  2EB7 A;  2VJ5 A;  2Y2Z A;  4I99 C;  4JYK A;  4YIR X;  4UUV A;  4A3D J;  1E63 A;  5KNL A;  5A2Q K;  4V19 K;  3I54 A;  2X51 A;  3LA3 A;  2C5H A;  3CF2 A;  4CZC A;  4YEI A;  1D8K A;  2ELK A;  2VBW A;  2W25 A;  5IK2 A;  1BX0 A;  4U4B A;  2FA5 A;  3OW7 A;  1OCZ H;  4Z4S A;  2OZ6 A;  1V4R A;  3IUO A;  2ISY A;  4CCO A;  2Q6O A;  2M0C A;  5GV8 A;  3GQ7 A;  3EUK L;  4KYW A;  4Z03 A;  2LNB A;  2XPV A;  3ERE D;  4XLA A;  4IO9 F;  4ENK A;  1XCB A;  2L5Q A;  1G3Y A;  4AYB N;  3LVB A;  1IXC A;  2V9K A;  1YFH A;  1WOO A;  4N3G A;  2L02 A;  1HG8 A;  2DBB A;  4MNU A;  2LTP A;  1UMK A;  4YHB A;  1W36 D;  2HR3 A;  3OYI A;  3B4N A;  2L7K A;  2R7Z J;  4X6A J;  3NE5 B;  3Q6Q A;  4M53 A;  1KCD A;  2FE3 A;  3RKW A;  1BR2 A;  3GLX A;  4CGZ A;  1NB9 A;  2P6T A;  4OP7 A;  1WSV A;  3PSI A;  3GTK J;  2ODL A;  4I02 A;  2HI3 A;  1FTT A;  4P3Y A;  2XC1 A;  5BQT A;  2Q6I A;  4N0B A;  4MGR A;  2G9W A;  1CF7 B;  5HDG A;  1XGS A;  5CVI A;  3QOE A;  2VBK A;  2WR8 A;  2CW8 A;  4NDL A;  5L3F A;  3ZMT A;  4M6Y A;  2IRF G;  1G4D A;  1BIB A;  1YW7 A;  1T6Y A;  3DBR B;  4Z4W A;  2F4M B;  5E3N A;  1IDZ A;  2W57 A;  4MR0 A;  5B6I A;  4AU7 A;  3A3B A;  2ZXW H;  1D5V A;  3RCO A;  4E0F A;  3TOB A;  2HOT A;  1VQ7 B;  3KL9 A;  2LOO A;  3Q3S A;  1NBM A;  2B0R A;  4XRS A;  3K70 D;  4AF6 A;  3HGG A;  4O3M A;  2J8I A;  4M3B A;  3AGP A;  3BQZ A;  1ZGA A;  1EF4 A;  1W1W E;  4CCK A;  2QQA A;  2BN4 A;  2XAS A;  2BHY A;  4X05 A;  1IC8 A;  2DFF A;  5E8I A;  2VQC A;  2M9H A;  4WXH A;  2INU A;  3DLA A;  4NB5 A;  2X85 A;  4DNR B;  3JQR A;  2R7Q A;  3I4M J;  3CCL B;  2EIK H;  1YQA A;  3W2W A;  2DAO A;  3A0H C;  1R5I D;  2L9N A;  5D6F A;  1AU7 A;  4A0X A;  2EZL A;  3FBN B;  5CPR B;  1WMR A;  2B63 J;  3IL2 A;  3OYF A;  4PC2 A;  5HOD A;  3LSI A;  3GQ9 A;  4A5N A;  3WBK A;  3FPP A;  3UNG C;  1VHO A;  3Q9S A;  1IAW A;  2OJE D;  2Y9Y A;  4MLO A;  4OIN F;  3VB2 A;  3D1N I;  3F21 A;  5J35 A;  5HLH A;  4OJL A;  1ETW A;  3P4G A;  2V7F A;  4RGS A;  4HBL A;  3F0C A;  1QA3 A;  1KQ0 A;  3HOZ J;  3AG2 H;  3FWE A;  3QU3 A;  3IP4 B;  2QGG A;  3W2H A;  5BPI A;  2EV5 A;  1KON A;  2JA2 A;  1GXP A;  2EPF A;  5J1Y A;  3U6B A;  2DA1 A;  3CJQ B;  4HPQ A;  1R5B A;  2BYV E;  1Q9S A;  4YXW A;  1UCR A;  4ZGN B;  3AL0 C;  3EQO A;  5HZB A;  2PBI A;  3GVJ A;  3QP5 A;  5JLV C;  3TL4 X;  2JZY A;  1K73 D;  1WZ2 A;  3DKY A;  1WU8 A;  3GFM A;  1KZH A;  1BJK A;  3LSG A;  3AVY A;  2ZTG A;  3OY9 A;  2V4D A;  3CCL I;  2CV1 A;  4HST A;  2WAD A;  3DTK A;  1YI2 I;  1TUI A;  5J1U A;  2CQQ A;  2I8D A;  2M2E A;  2JA6 J;  1RET A;  4G7X A;  1K5C A;  2RNJ A;  1YIT I;  1GXQ A;  1YRN B;  4Q48 A;  5J8C A;  3S3N A;  5CQG A;  3JAM Z;  2IS6 A;  3OR2 C;  4BEH B;  3D5R C;  2BGJ A;  4LBY A;  3GEZ A;  1O8F A;  1Z0X A;  2CQN A;  1EFU A;  4B4D A;  3L7W A;  4EW9 A;  1LFU P;  1EWY A;  2V7W A;  1VQK I;  4TMV A;  2PMH A;  3ZN1 A;  2X6W A;  3BR5 A;  1YIT B;  3ROU A;  2JA8 J;  4BE2 A;  2R7W A;  2FEZ A;  2RAE A;  3DF8 A;  1VQ7 I;  4PJJ A;  4E70 A;  2X1C A;  4AIJ A;  1BC7 C;  3WTY C;  2F5V A;  2F43 A;  4ESJ A;  2EIM H;  3OIO A;  4HNV A;  5FJ8 J;  1IGN A;  1CNF A;  3FXU A;  5FKL A;  4N4N B;  4HF1 A;  1S8N A;  4JP0 A;  2DOG A;  4MXN A;  4P12 A;  4B1R A;  3JCU C;  5B1A H;  2PMD A;  2VJJ A;  5JVG F;  2WTE A;  5J47 A;  1O7F A;  2W48 A;  3FDY A;  1MND A;  1XGO A;  2ZC2 A;  5A89 A;  4O5V A;  4OIP F;  3OL4 A;  3VYU B;  2ZKZ A;  4PK4 A;  3W2F A;  1GT0 C;  3PEN A;  1N08 A;  2FUG 2;  2O17 A;  2BM5 A;  3S1N J;  2QN6 A;  1VQ8 B;  1T2K A;  4A3E J;  4P9U A;  1XGM A;  4AID A;  1TC3 C;  1N78 A;  3OWT A;  4NC7 A;  3A2K A;  2IVM A;  1UZC A;  1OCO H;  5FKK A;  1MNM C;  3LSH A;  4YAL A;  2O03 A;  3F22 A;  3I53 A;  1JA1 A;  2DOD A;  1VQ9 B;  2X3H A;  3ZQG A;  2ZJQ F;  2IS1 A;  2GJR A;  1IN8 A;  3GYH X;  2EIL H;  2J5P A;  2RGV A;  2XPW A;  4XBF A;  1REP C;  2L4A A;  3A03 A;  2QVO A;  1LVA A;  4TMW A;  2GAU A;  2K27 A;  2L7F P;  1NRK A;  4ETS A;  2PJR A;  2KQR A;  5M3M J;  3FM5 A;  2OQG A;  4V2G A;  2XSJ C;  3S3O A;  1TL8 A;  1Y39 A;  3MZY A;  4OIQ F;  1OB5 A;  4X7C A;  1SVL A;  1WI3 A;  3DPU A;  3KIO A;  4DYR A;  4B4C A;  1RI7 A;  1SD4 A;  1K4S A;  2H1K A;  4ZYH A;  2OUM A;  4ZJZ A;  2ME6 A;  2KP6 A;  4PGG A;  4XRS G;  1BJA A;  2ZL7 A;  2OA4 A;  4LBW A;  2QF7 A;  4DQL A;  4MEY F;  3V42 A;  4KT5 C;  3LNQ A;  1M90 D;  1HBX G;  1WVR A;  3WTT C;  4GGG A;  5BOX A;  1WQ2 A;  4BBS J;  2RRE A;  1IXS B;  1GAW A;  1I6H J;  3CCQ B;  4XR6 A;  4A2U A;  2ZXJ A;  4UHT A;  1H88 C;  1E43 A;  1RRJ A;  1WWX A;  1ZM9 A;  4YAO A;  3K0L A;  3RTR A;  3Q5F A;  3I56 I;  3PSS A;  4YDT A;  3HOT A;  3FF5 A;  1FOW A;  5EYR A;  1A04 A;  4PJL A;  2IP2 A;  4F91 B;  1IJF A;  1KJZ A;  1W5S A;  5J3O A;  4B3A A;  4Y33 A;  2EZH A;  2ZBV A;  2JWT A;  3TDZ C;  1CQX A;  5IP6 A;  2DMP A;  5GV7 A;  2XAQ A;  2D3L A;  1J09 A;  1PE9 A;  2TCT A;  2UUZ A;  1H89 C;  4M0L A;  2HXI A;  4ZZD A;  4L0Z B;  5CVJ A;  1VLY A;  2LF7 A;  4A12 A;  1LDD A;  2VJI A;  2X1E A;  1AKH A;  1PUF A;  2OYN A;  3CCQ I;  1KCC A;  4ZCM A;  2XGJ A;  4P1W A;  1IDK A;  3U2Q A;  4QWQ A;  4X7F A;  1MAB A;  1JTX A;  2LFB A;  2CW5 A;  3W2I A;  2D1V A;  4HSR A;  4U88 A;  4MYT A;  3F8F A;  2XDV A;  5IT3 A;  5GTH C;  5JLX A;  2AO9 A;  1GLN A;  1O3R A;  2VNK A;  4RAF A;  3BRO A;  4U87 A;  5IP9 J;  3VOD A;  1B9N A;  2KKO A;  3SY2 A;  4E7K A;  3GWZ A;  3HJE A;  2I5U A;  4W8R A;  1FRN A;  1FNN A;  2JA5 J;  3NAR A;  5JHU A;  2JVG A;  4LG0 B;  2LLK A;  2CRG A;  2EFW A;  1O8H A;  2A3S A;  4OJ5 A;  3RIQ A;  1RZ4 A;  1FOY A;  2IGM A;  4HDU A;  1DDI A;  3HC7 A;  3ZBU A;  5AN9 A;  3UR3 C;  1W0T A;  3S16 J;  2XTX A;  4ZYG A;  3H9G A;  1B72 A;  2ZZE A;  2XAJ A;  3OS2 A;  1GAQ A;  1QPI A;  3NEU A;  3VEP A;  3OIQ A;  1AMO A;  3I3L A;  2GQF A;  2DTZ A;  3S32 A;  2OQR A;  4HZF A;  3HUG B;  5ICC A;  3OE7 A;  5EMN A;  5F4O A;  1SEU A;  1BR4 A;  1DGW Y;  1QQI A;  3K9T A;  4BH9 A;  5A2Q Z;  2O04 A;  2VQG A;  4Y4R A;  1V5V A;  1L1I A;  4G6Q A;  3BOQ A;  1I3Q J;  3BPV A;  5HNH A;  1PLU A;  3ABM H;  2PEC A;  1N25 A;  5ED4 A;  3H36 A;  3ZQQ A;  3K4L A;  2E1M B;  3QYB A;  1EFT A;  2KJC A;  2Q2E A;  2DT7 B;  2GBY A;  3R6S A;  1X58 A;  5J4Y A;  2GPJ A;  4S05 A;  4RD4 A;  5FL7 A;  3FZV A;  1FOX A;  1P4X A;  4LK0 F;  3VPR A;  2NTB A;  3S3M A;  3EYI A;  5BSY A;  1SAU A;  5J4V A;  2XT2 A;  1KTW A;  1YHQ I;  4BDZ A;  2X4H A;  2W84 A;  4P9S A;  1K61 A;  4TMX A;  1VJS A;  3QU6 A;  3BY6 A;  1MD0 A;  4OOI A;  2CQK A;  4QLC U;  1FNM A;  2C4U A;  2HU9 A;  3B82 A;  4NQW A;  2BE5 F;  2K3F A;  2EIN H;  2EFQ A;  2NTP A;  4G7W A;  4CUG A;  2VBS A;  4C0S A;  1PJ5 A;  3G71 I;  2XPU A;  3BDD A;  1HOM A;  1FYK A;  3SYJ A;  5LEK A;  2E2H J;  2NS8 A;  3EDP A;  3NB2 A;  3J7A O;  2PIA A;  1TP4 A;  1QGY A;  2HKO A;  1J0R A;  2UZK A;  1GVD A;  3V7C A;  3E5U A;  3GTP J;  2VNH A;  3ERM A;  1DU0 A;  2XIG A;  2UVF A;  3BTJ A;  3L1P A;  2YWE A;  3BC8 A;  3QPL A;  2C4T A;  2QY1 A;  1UST A;  3KP3 A;  1HST A;  4M71 A;  3ZOB A;  3CTA A;  3CCE I;  2ZJR F;  2D45 A;  2CH0 A;  3I55 I;  3R61 A;  5DYM A;  2V5I A;  2C78 A;  3K70 C;  1H9T A;  1A31 A;  3DLL F;  4R71 A;  1FT9 A;  2ZFW A;  2QZA A;  5DCM A;  1E3P A;  2E1N A;  2R7V A;  2VC1 A;  3ZQI A;  2EFP A;  2LC2 A;  1VF7 A;  2QA4 B;  3W3C A;  3HPG A;  2WA0 A;  3ECH A;  5K5O A;  3LQE A;  5HS7 A;  2DFH A;  2X6Y A;  3HOU J;  2XZO A;  2NVU B;  3TKY A;  2E1M C;  4OZZ A;  3BY2 A;  1CLW A;  4Z06 A;  3T5X A;  3JQP A;  1Z3Y A;  2PMU A;  3BG7 A;  4H4K C;  4B3G A;  1OHH A;  1E79 A;  2MAB A;  4X7D A;  1X3Z B;  1IV8 A;  4OMZ A;  2BY3 A;  2P5V A;  5JHF A;  1HDD C;  2KIF A;  1OPC A;  1X3U A;  3Q0V A;  1OCP A;  1VND A;  3LYC A;  2H27 A;  4B43 A;  1XN7 A;  1YX2 A;  2RV8 A;  3B02 A;  3HSR A;  1QU3 A;  3CCV I;  4TSF A;  2QTZ A;  2E35 A;  1CF7 A;  2GOX B;  4XQF A;  1AWC A;  3DU1 X;  1FNB A;  3ZR8 X;  1TYU A;  4DIQ A;  3FHN A;  4ESF A;  2M8E A;  2STW A;  1J5Y A;  4I2O A;  2PEX A;  3SXY A;  1QA2 A;  3DU5 A;  3ABK H;  1IG7 A;  5FKO A;  1OFL A;  4HX8 A;  3QP6 A;  2A61 A;  3CJN A;  2JRT A;  2QTL A;  1NTC A;  5ILV A;  1BM9 A;  2XGC A;  2RVC A;  2E60 A;  4EJT A;  1V3F A;  2MLK A;  2YUS A;  1ZR2 A;  2Q6K A;  4Z4T A;  1NHC A;  1GVJ A;  4EGZ A;  3O8H A;  2EWN A;  2J5O A;  1FRQ A;  2QYU A;  4EM0 B;  1ETK A;  4DYC A;  3OYC A;  1TNS A;  3CCJ I;  2GXB A;  1RR7 A;  2CG4 A;  3PQK A;  1GQ8 A;  1FMW A;  2GOM A;  4LMY A;  2K4B A;  2VYQ A;  5LGU A;  1WGX A;  3QFC A;  3DPT A;  2UXN A;  2F6C A;  4HQM A;  2IW5 A;  3P9I A;  2ZJP F;  5EG0 B;  1DGR M;  4BHP A;  3SEQ A;  4LFU A;  2MA3 A;  2QM3 A;  4G8X A;  3PVD A;  4G9Y A;  3ZRG A;  2ZFU A;  1P92 A;  2OBR A;  2PFB A;  3DV8 A;  3E6C C;  2HVS A;  5HLG A;  4B44 A;  2JN6 A;  4PC3 A;  3LL7 A;  2IGK A;  3O6B B;  4XN3 A;  3KEY A;  3CCR I;  4NNJ A;  5DNS A;  5EZH A;  3CDH A;  3E5X A;  2EH3 A;  3AST A;  3AVT A;  1VQP B;  1O57 A;  3CCS B;  3ZSC A;  5CDF A;  2W6J A;  5LBQ A;  3LAJ A;  2CV2 A;  1D0Z A;  3K4K A;  1W5C C;  5CVV A;  5BPD A;  1YS7 A;  3LA7 A;  1QVG B;  1XMX A;  4A3J J;  3PSZ A;  3RY8 A;  3PET A;  3OV8 A;  3IKV A;  3RIR A;  2DA4 A;  1W9X A;  2AQF A;  3C3W A;  2E1B A;  3ONY A;  1NG7 A;  4TN1 A;  2C77 A;  4CYC B;  3BH7 B;  1YW9 A;  5B3S H;  1XQB A;  3LFK A;  1EH7 A;  2JDI A;  1OOC A;  5DD4 A;  4OU0 A;  4B09 A;  2HVR A;  4HRI A;  1F60 A;  3L2U A;  1F4K A;  2YWF A;  4D5C A;  4CCM A;  1PXZ A;  4M3F A;  2BGC A;  1WJC A;  4BYY A;  2JJ2 A;  3JRC A;  4KIG A;  3JRB A;  3M8F A;  4YZQ A;  2MC3 A;  1HA8 A;  1T56 A;  2BVL A;  2VQH A;  5IPA A;  4D1Q A;  5LLQ A;  1G3W A;  2HTS A;  2DT5 A;  3QQA A;  4M9S A;  1TT0 A;  1B2R A;  3ASR A;  2GA2 A;  1F43 A;  1W0U A;  2FXA A;  4EV0 A;  5IT9 Z;  3M1E A;  4AM3 A;  2VLA A;  1R22 A;  1ZG5 A;  3FKJ A;  3K69 A;  1P9Q C;  5AIP A;  1F5T A;  1G3T A;  1RKW A;  1ETV A;  1JT6 A;  2O7O A;  3ELK A;  4R79 A;  2F5F A;  1B72 B;  3PUN A;  3HIF A;  1K4T A;  1COW A;  4HNU A;  1VQO I;  3GFI A;  3PM1 A;  2XHK A;  3D0S A;  4XLH A;  3R6K A;  1F9N A;  2X6O A;  2DDB A;  4KKT A;  3G05 A;  3ZPL A;  1HC8 A;  5EEH A;  1KMH A;  3KCC A;  3H94 A;  3ZZT A;  2LKX A;  3PUB A;  1SFU A;  3Q3A A;  1PJ7 A;  2O1D A;  3U1K A;  4URR A;  4NC8 A;  4HV6 A;  4XRM A;  4A3F J;  5IYN A;  2WC2 A;  5F1J A;  2C5B A;  1IDY A;  2TDX A;  2X48 A;  3BTI A;  4WCG A;  1HQC A;  2H8W A;  3I9V 2;  5FO5 A;  1FBQ A;  4ZDO A;  4BGD A;  2LF8 A;  1EP2 B;  3LAP A;  4V2F A;  3FIW A;  5KK1 A;  3IRR A;  3T9G A;  1GUU A;  2HZD A;  5CQE A;  2XF7 A;  1RNL A;  1VZ0 A;  2BW3 A;  1RQR A;  4C3I J;  3LSM A;  1VFC A;  1R5O A;  2LG4 A;  1TWC J;  1OMI A;  4K1X A;  4IRH A;  1JGS A;  2XKP A;  1I18 A;  1BN8 A;  3L00 A;  4D0P A;  2EJR A;  3SYT A;  5D5W B;  3PSF A;  2DU9 A;  3JRA A;  2DET A;  2A05 A;  3PNT A;  1HSJ A;  2WYR A;  4ZDL A;  4CZZ A;  2BSP A;  3BJ6 A;  3P5J A;  3JRD A;  2QXZ A;  5E6T A;  3B6A A;  1J7K A;  4RGX A;  3JRG A;  2EFO A;  3C7J A;  2KIM A;  1KQ8 A;  1YJW B;  1RWR A;  1Z91 A;  3F72 A;  4OOX A;  1BBY A;  1BW5 A;  2YR2 A;  2IEK A;  3KEQ A;  3L2W A;  4J19 A;  1TLL A;  1WOS A;  4Y9R A;  5IYD J;  2ZZF A;  1ZRF A;  4HF0 A;  4EGY A;  1SVM A;  1XSX A;  3N05 A;  5GAE J;  1T0F A;  3A01 A;  3BCF A;  1K6Y A;  2RQP A;  2Y0S N;  1O8J A;  3GRH A;  2QLZ A;  1A8P A;  4U7D A;  4BQA A;  1XB4 A;  1BOA A;  1M1K D;  5DCF A;  3SQV A;  1HXD A;  4XKC A;  5KAF C;  5IYP A;  1OJL A;  1N05 A;  2NZM A;  2E2I J;  3VYR B;  2DCE A;  2PMZ N;  2KZG A;  3ML6 A;  4KA4 A;  1BL0 A;  3MHP A;  3CC2 B;  3LNN A;  2X8K A;  5FO0 A;  2DOF A;  4ZYD A;  2ZCW A;  1TWF J;  4EJV A;  4L9N A;  2FX3 A;  4DQK A;  1B9M A;  1SMT A;  3CUO A;  4PFP A;  3I4N J;  4Z4U A;  1VQ9 I;  1ETX A;  2P81 A;  4XLN F;  1O8M A;  4IOC F;  4HOB A;  3SFI A;  3CUQ A;  2NYX A;  2QBY B;  3CLQ A;  3HBL A;  4PJ0 C;  3G4S B;  2QKL B;  4BHC A;  1UG2 A;  3H3Z A;  1YJN I;  4U0W A;  3P27 A;  2BM0 A;  2LZJ A;  1YIJ B;  1NK3 P;  1IDJ A;  3ESW B;  4V02 C;  1XMA A;  1X1C A;  5E3L A;  1HF0 A;  5FA6 A;  2RNG A;  2Y30 A;  3TO7 A;  5H59 A;  4ACB A;  1ERD A;  4FHT A;  2NXN B;  4PJN A;  5DUI A;  3LSP A;  3VSU A;  4P6V F;  1LDJ A;  3OKX A;  3QWL A;  4G5G A;  2O0V A;  2TRT A;  3IRQ A;  3L2C A;  4WZT A;  2CBX A;  1Y8R B;  1K8F A;  3VDX A;  1JTY A;  2FNP A;  3L2V A;  4J00 A;  2EIX A;  3OAA A;  4MO7 A;  3H9Q A;  3HZJ A;  1ZLK A;  4QHY A;  5ILS A;  4HLX A;  1SFX A;  3HL2 A;  4M3G A;  3F6O A;  5FRN A;  4XIC A;  3E6D A;  1AHD P;  1ZYR F;  4OJO A;  3PFI A;  2F4I A;  3MMP A;  3DBH B;  3IH2 A;  2FSW A;  3I64 A;  1H8H A;  3F8B A;  2LMD A;  1N77 A;  4LK1 F;  3N90 A;  4FAS D;  3GZ6 A;  1D3Y A;  5E18 F;  1OFC X;  5IOZ A;  3N6Z A;  1UD3 A;  2ZB9 A;  3GXO A;  2F5C A;  3PJR A;  1RMG A;  1XSV A;  5C3E J;  4DNC A;  2CU7 A;  3ZQF A;  4OJP A;  1GV2 A;  1MMD A;  2NAZ A;  2CS3 A;  2VL8 A;  5F6F A;  1Z1D A;  3QSY A;  3NAW A;  3E6B A;  1SAN A;  2MH9 A;  1JGG A;  3KZZ A;  2ACJ A;  4RA2 A;  1EZG A;  2M45 A;  4QV2 A;  1E3O C;  1UMQ A;  2NV4 A;  3ZBT A;  3DPL C;  4C2U A;  4X7E A;  1OCR H;  5IYQ A;  1RES A;  4NK8 A;  4IEJ A;  2QCO A;  2LD5 A;  2HLD A;  3MKY B;  2H8R A;  5DN6 A;  4XKV A;  1R9T J;  1QUE A;  3GIR A;  1ON1 A;  2BBY A;  4I09 A;  1JHH A;  3VFZ A;  2DYI A;  4UXN A;  2QEN A;  1W0J A;  3HHH A;  3WGH A;  3T53 B;  1JRG A;  1DP7 P;  4P3I A;  4E6K G;  1UD4 A;  4J0Q A;  3ZMS A;  1WPK A;  3ONQ A;  2EV6 A;  4FE4 A;  2A6H F;  4M74 A;  4U0Y A;  2BPO A;  3GQA A;  5C1E A;  1S7A A;  1T6X A;  3WY9 A;  2EK5 A;  4DNT B;  4JMQ A;  4UUT A;  3CDL A;  2R5Z A;  2OD5 A;  2EFN A;  1O8E A;  2V7V A;  2BZT A;  4YEL A;  2VC0 A;  3BR1 A;  5H6R A;  1S3J A;  5HDK A;  1KQ5 A;  1R5G A;  1VQ4 B;  1E17 A;  1O88 A;  3BY1 A;  5BSX A;  1R71 A;  4EJO A;  4AIH A;  2Z99 A;  1ZGJ A;  2HXO A;  2Q1Z B;  2QQ8 A;  2R9V A;  5F27 A;  2NOG A;  2E19 A;  2G0Y A;  5KHD A;  2A5Y B;  5D4R A;  1IF1 A;  4XRF A;  4RMN A;  2VBE A;  2YWH A;  2CUF A;  4BXF A;  3ECO A;  4LG0 A;  1QFY A;  1IUF A;  2DA3 A;  5E1X A;  1P7J A;  3A35 A;  3AG4 H;  3AVU A;  4AC9 A;  1FC3 A;  1S29 A;  3K2A A;  2P7V B;  3HSF A;  1NG6 A;  2L9V A;  4A6D A;  4MQV A;  3H0D A;  2GIV A;  5F04 A;  1MRZ A;  1QVF B;  4IHS A;  4PGO A;  1T39 A;  1OKR A;  3QOP A;  1VI0 A;  4QIW N;  2KDZ A;  4W1U A;  2DDA A;  2Z3Y A;  4HNT A;  4YC5 A;  2D2W A;  2IS4 A;  2VN2 A;  4YIF A;  1Y0R A;  1KU2 A;  5L3D A;  4WZK A;  2NNN A;  2A07 F;  4K2E A;  4IW3 B;  4TT3 A;  1WJF A;  1VQM B;  4DBR A;  4BXU A;  2V1U A;  1K28 D;  3CD6 I;  2JT1 A;  1OFE A;  4EM1 A;  3GFL A;  2FBH A;  2QGU A;  1Z21 A;  5TIS C;  4A3G J;  2V9V A;  3I71 A;  4RDL A;  3U9G A;  3JAM K;  3TW7 A;  5M3F J;  3M8E A;  2VBT A;  3A8K A;  1ZAO A;  5B1B H;  3CB4 A;  3GF2 A;  2OC6 A;  2B7C A;  4G6I A;  3FXK A;  2MC4 A;  4XID A;  3W6V A;  2LRE A;  4A3B J;  5FLX K;  1EA3 A;  4XOR A;  4W8Q A;  3WWG A;  4YZX A;  1VQ6 I;  4HX7 A;  1IW7 F;  1YX3 A;  4KN7 X;  1XX5 A;  2BV3 A;  1W5T A;  1OYY A;  1WKM A;  3TOA A;  4FK8 A;  3DFG A;  3HKZ A;  1VHE A;  3ABL H;  3GTM J;  1XMK A;  1UD5 A;  3NWS A;  2VBV A;  2CGP A;  1WH5 A;  2OU2 A;  4IPA A;  4RDJ A;  3ZMZ A;  4Z1M A;  1DDG A;  2L3D A;  3CO6 C;  3ZQL A;  2NTQ A;  3JW4 A;  4IHW A;  4ZV4 A;  4YEJ A;  1MIJ A;  4PC7 A;  3CP2 A;  4CH7 A;  5FLV A;  5E1W A;  1S5L C;  2RC6 A;  4EMS A;  2K9N A;  1MDM A;  1YIJ I;  4RAY A;  3BPX A;  3IV5 A;  2LKP A;  5DM7 F;  2L7M P;  2XGD A;  4CA0 A;  2JTV A;  2YU3 A;  3IH4 A;  4C3J J;  1T5E A;  1MBH A;  4EM2 A;  4IX7 A;  3D26 A;  5D8K B;  4C2L A;  2XSD C;  2CUZ A;  1I7P A;  2IOU G;  2BY0 A;  3VO1 A;  3K10 A;  2QQB A;  5M5W J;  2VBY A;  5JLW A;  5HLT A;  2M5W A;  3BJO A;  4ZZL A;  4E7J A;  2XAU A;  4BKX A;  2YX7 A;  1T8I A;  3SLN A;  3IAM 2;  3ZCO A;  2XV4 S;  4G6D A;  4FCY A;  1S9H A;  2IA2 A;  1RIO H;  4F7D A;  4RDU A;  1K6O A;  1PVE A;  2L9S A;  4RB0 A;  2JRM A;  3FKI J;  3JRE A;  1VQL B;  1SFK A;  2BOL A;  2IGN A;  2ZSI B;  1IB0 A;  4UNO A;  4Y52 J;  3GTJ J;  1A35 A;  5LEJ A;  1MMG A;  2QSG X;  1SMY F;  2PE3 A;  4P9F A;  3F8M A;  4NUB A;  1W87 A;  1WOP A;  3PNV A;  2QQ9 A;  3HGY A;  5D6E A;  4YFX F;  1IN7 A;  3RPU A;  3FXM A;  4XLF A;  3W6K B;  2RC4 A;  1V0F A;  4PZJ A;  5FLX Z;  3T1B A;  2JJ1 A;  5H5J A;  2IPQ X;  2DQL A;  3SHF A;  3WND A;  4UZU A;  3OP1 A;  2EZI A;  2Z5U A;  1XD7 A;  1ETY A;  3TED A;  5EGO B;  1MGT A;  2M7A A;  1MJA A;  1FSE A;  4RGU A;  5L3C A;  1YLF A;  2OCE A;  1MH3 A;  3F8C A;  4PC6 A;  1U5T A;  2NPF A;  1JHF A;  4N4O B;  3HTU A;  1UHW A;  1LE8 B;  3K4M A;  4YAF A;  4IRI A;  3TMO A;  4ENM A;  1VQN I;  3MN2 A;  2L7Z A;  2P5K A;  2CUE A;  2CSO A;  4RAZ A;  3RSN A;  3S14 J;  4LBZ A;  3CC4 B;  2WY8 Q;  2VNI A;  2KT0 A;  2V7Q A;  4H0E A;  3PUM A;  4OPV A;  3KP4 A;  3X2Q H;  4U7B A;  2DER A;  1WTH D;  1Q7Y D;  3NQO A;  4M3D A;  3EPZ A;  3BQJ A;  4YAW A;  2GZW A;  2DYR H;  1X1A A;  1Y0U A;  2Q2E B;  5HS9 A;  3L2Q A;  1QX4 A;  2CRV A;  1LUJ B;  2XAH A;  3QE2 A;  3BZ6 A;  3AG1 H;  2Q8K A;  1NDH A;  4CSW A;  1IN6 A;  3VSL A;  1LEB A;  1A5J A;  3R4K A;  3S17 J;  4QFM A;  1XCV A;  4HA8 A;  1H0M A;  3ZMD A;  1ACI A;  2B7B A;  2V1N A;  5F64 A;  4IL6 C;  2F4O B;  4HE6 A;  2IBD A;  2GXA A;  3ASP A;  3GLL A;  2HOE A;  3RI4 A;  5KSW B;  3HRU A;  1KK0 A;  4C2M J;  4ZYE A;  2UVE A;  4I76 A;  3FXJ A;  4HW0 A;  2V6E A;  5GPC A;  1QH0 A;  4RB2 C;  2XNJ A;  3JTG A;  5FFX A;  1FPQ A;  1CQT A;  3VST A;  2Y69 H;  2GJK A;  1O7L A;  4IRG A;  1DU6 A;  4KIB A;  4YFK F;  3ZC3 A;  3K4J A;  1Z9C A;  4L9T A;  1BLI A;  1ENH A;  1TYX A;  1R23 A;  1WHU A;  4MYU A;  1BPL A;  2AXL A;  1KYZ A;  4NHJ A;  4OOV A;  2WV0 A;  3WE3 A;  5LFA A;  3J81 k;  5B5E C;  2JPC A;  2WAQ A;  3PUF A;  2MH2 A;  2VAS A;  3SUC A;  1OFD A;  4G94 A;  2MSY A;  4UUS B;  2GM4 A;  1AOY A;  4WF2 A;  3F6V A;  2EA2 A;  3M9A A;  1DAB A;  4RGR A;  1R1U A;  2W6I A;  2WSS A;  2FQ4 A;  4UZF A;  2OTJ I;  1WSU A;  3LST A;  2VPR A;  4UV9 A;  1FBS A;  2BM4 A;  1N0U A;  4W8S A;  3JRH A;  3QPT A;  2F1L A;  4AC0 A;  3N4M A;  2HPM A;  3HOV J;  5ICF A;  5EZG A;  3OEE A;  2JSC A;  2BY1 A;  3KLO A;  3FPK A;  3A4C A;  2Y75 A;  2NNY A;  1V55 H;  5DSZ A;  2RKH A;  1YO5 C;  2E1O A;  2O9L A;  1T98 A;  3RPQ A;  2R93 J;  1TQI A;  1EFC A;  4N3N A;  1S72 B;  3WTS C;  1XC5 A;  1O8K A;  2VT2 A;  3EQL F;  4DGW B;  1IJE A;  1G3S A;  1W34 A;  2ECB A;  3CPX A;  2ME0 A;  4WXC A;  2W85 A;  1O8I A;  1Y0N A;  4XK4 A;  1A6Q A;  2LY9 A;  5M5X J;  1ORK A;  1O4X A;  2Z9O A;  2A5W A;  2AQE A;  3COA C;  5B66 C;  1WFX A;  2EV0 A;  4XLP F;  1K79 A;  1TT5 B;  2K9L A;  4MTD A;  1FWZ A;  1W36 C;  3UW0 A;  2O8K A;  4BQO A;  1QRC A;  3QFR A;  3KPH A;  1EA0 A;  1FDR A;  2HKX A;  2GWR A;  1Y8Q B;  1HW2 A;  2FD5 A;  1VQM I;  1H80 A;  5TGT A;  4MFE A;  3AAF A;  2NVQ J;  1KU9 A;  3R0J A;  2JN9 A;  2Q6L A;  4TV7 A;  1IZ1 A;  2XVC A;  1EKE A;  4GRI A;  1ULY A;  1ETQ A;  4KKS A;  1MMN A;  3G1O A;  4C2T A;  2X0K A;  4I84 A;  2A6T A;  3MKW B;  2LR8 A;  3CW2 A;  4OAY A;  3E1S A;  4OMY A;  1T6Z A;  2DIE A;  4ON0 A;  4YAU A;  1EE6 A;  3O8G A;  4ZYA A;  4RD1 A;  3A01 B;  4BY1 J;  5LMZ A;  3SZG A;  1Q82 D;  1RKT A;  3CC7 I;  1ZM3 A;  2CWE A;  3HRS A;  2KHM A;  3J80 K;  2DMQ A;  3QRF F;  3TH0 A;  4UAJ A;  3A8I A;  1U9O A;  3C1D A;  4FIS A;  1A36 A;  1MSE C;  1I1G A;  3H5N A;  2RQQ A;  2F4N A;  3JR9 A;  1B4A A;  2KL4 A;  4X1E A;  3CXC B;  2ESH A;  2DXI A;  2RDP A;  2LKS A;  1XFO A;  2DOE A;  3ABU A;  1WRJ A;  2O61 A;  1EJ9 A;  1LLW A;  3LWF A;  1N0V C;  1BOB A;  1V54 H;  1SFE A;  2JPB A;  5FLM J;  3FK7 A;  1F1Z A;  1W7P B;  2V6C A;  5KCM A;  1G7C A;  3R0A A;  4W8T A;  1OR7 A;  1YIO A;  3FXL A;  4A3C J;  1VQ5 I;  3MWM A;  1UHM A;  1K7A A;  1OCT C;  2HMA A;  3SEZ A;  4L5J A;  3E5Q A;  2VOP A;  3I58 A;  5E8G A;  4LB6 B;  3KZY A;  2K86 A;  3BZC A;  1F20 A;  2NVX J;  5C1C A;  2DOA A;  5HVQ C;  4P25 A;  2HYF A;  1U8R A;  4I6Z A;  3K1M A;  4MIM A;  1Z7U A;  2K02 A;  3WHB A;  4HLY A;  2PYG A;  3MVP A;  1QRY A;  4PJM A;  1OB2 A;  2OPT A;  3SQN A;  1BMF A;  3VWB A;  1TYV A;  1S7O A;  3Q6R A;  2E5Z A;  2HQA A;  1XB2 A;  4PMH A;  4ACA A;  3U21 A;  3B78 A;  2Z16 A;  4ESB A;  3OPO A;  2R3S A;  6PAX A;  2VPL A;  1J9I A;  3PA1 A;  1G7T A;  3FKS A;  1POG A;  1QA1 A;  3FJO A;  1BN5 A;  4G1B A;  2ZIT A;  3CUQ B;  3REO A;  3ABT A;  4LG3 A;  2B7E A;  1NHA A;  5HDN A;  3S2H J;  1LQ1 A;  2X53 S;  3HB9 A;  2QE7 A;  5FD5 A;  1JB9 A;  4A3I J;  4AVP A;  3AVW A;  2HCJ B;  2E36 A;  1ETO A;  3HEF A;  5LRR A;  5EEA A;  2N8G A;  3PFY A;  2O8X A;  1G6N A;  3TP0 A;  2NOJ B;  5EF6 A;  1WH7 A;  2CC2 A;  1TQM A;  3AGQ A;  2ZZG A;  1RUO A;  1ZG3 A;  4Y7C A;  3H5A A;  2HQR A;  3H9J A;  5J40 A;  3LQR A;  2XUB A;  4BS9 A;  1B1B A;  1Y6I A;  2W7Z A;  2XTW A;  3M1C A;  2BV6 A;  1N75 A;  2EBI A;  4RLQ A;  2D74 A;  3CCU I;  3ZQH A;  3U1D A;  3BG9 A;  5JFR A;  2Z33 A;  4KIC A;  2NS0 A;  2QSF X;  1DBG A;  1DPR A;  2XB0 X;  4BDY A;  3OOU A;  1ZHF A;  5GPA A;  3ZMV A;  2NT9 A;  3NRV A;  2KLO A;  3WNB A;  3EUA A;  3P9K A;  1TTY A;  3VSK A;  2M3A A;  3E3V A;  5L46 A;  2PX9 A;  3KLN A;  1UD6 A;  4PCQ A;  3CMY A;  3DTI A;  4E7L A;  4CXF A;  4RB3 C;  2OTL I;  4OZY A;  1CZF A;  1WCM J;  2YU9 J;  1E62 A;  2XOK A;  3FHZ A;  1U5T C;  2UXX A;  1WSR A;  1BQE A;  1W2B B;  2BW3 B;  2O6G E;  5F0F A;  4N9I A;  1D1A A;  4I01 A;  1UB9 A;  2ADU A;  4MFD A;  2CJJ A;  3CQZ J;  4CYC A;  1HLV A;  5LRS A;  5C4J J;  3MCA A;  2QWW A;  4G7H F;  4OIO F;  3A02 A;  2KZV A;  2DJN A;  1X19 A;  2ELH A;  2FRH A;  2VFO A;  2Z1D A;  1Y56 A;  2ZNY A;  3PIO F;  1R58 A;  2WV1 A;  2ZBU A;  1BHE A;  2VIX A;  5C4X J;  4RS8 A;  4MTE A;  1RPW A;  3LA2 A;  3OYL A;  4KDP A;  1ZEL A;  3TDU C;  4XSX F;  1U6G A;  3PNY A;  3CJR B;  2VOD A;  2DN0 A;  3SJZ A;  3JTH A;  1PJ6 A;  4HEA 2;  2ZTN A;  2DEU A;  3A8J A;  3SJM A;  5E79 C;  5IP7 J;  3SZT A;  2Y31 A;  2R5Z B;  5H20 A;  4QPO A;  4LIT A;  2Y48 A;  4DK1 A;  5D5X B;  1SM4 A;  5BMZ A;  2PMZ A;  4A5M A;  3DCF A;  1WXR A;  2R7D A;  1OYW A;  5DD8 A;  4OIR F;  3KZI C;  5H6Q A;  4DZJ A;  3ZPP A;  3LQQ A;  2VKV A;  1D0X A;  2CW0 F;  1LM1 A;  4OPS A;  1LVK A;  1YW8 A;  3WTW C;  4HWV A;  3LSJ A;  4JOM A;  3HOW J;  2O3F A;  4ZC3 A;  2BY2 A;  1D2E A;  5AIQ A;  1VQL I;  4F93 B;  4LLN A;  2EFG A;  2VFQ A;  5ICG A;  1CNE A;  3K2Z A;  3KYC B;  1ZKG A;  3B90 A;  5AON A;  3J7Z I;  4KIT B;  2IJL A;  2X9D A;  3QYE A;  2GRE A;  4ENJ A;  2OK7 A;  2VBM A;  3ASS A;  1Z67 A;  2V1X A;  1H42 A;  3FK6 A;  3G1M A;  1JUP A;  1TYW A;  4R8H A;  1D0Y A;  1CGP A;  1J75 A;  5LHH A;  3B8H A;  1JKP C;  4I98 B;  1WJA A;  3RYR A;  4LJZ F;  4S04 A;  1SD6 A;  1YLO A;  1K78 A;  1E3Z A;  2R4G A;  4IHT A;  2OV7 A;  4RDK A;  2M8G X;  2MBF A;  3HHG A;  3TO9 A;  1OB0 A;  4CCN A;  4G7Z F;  4AUX A;  3HTS B;  4E7I A;  3MD2 A;  3IKT A;  4A0Z A;  2W00 A;  1Y1V J;  2XGX A;  4UV8 A;  3P9C A;  4S0H B;  2STT A;  4Z4Z A;  1KZL A;  4LD5 A;  3LSR A;  4Z4V A;  3JUR A;  1I27 A;  4HQE A;  2GJP A;  3FMR A;  4RM2 A;  1YTY A;  2KRH A;  1R5N A;  4XOT A;  4BU2 A;  2E34 A;  3K1P A;  3WQZ A;  3NAU A;  3ASO H;  4GXO A;  3H09 A;  1AIR A;  3GUD A;  1WI9 A;  5BS6 A;  3RDI A;  1FYM A;  1AA7 A;  2ZJ2 A;  5L3E A;  5IY5 H;  1ZG1 A;  4ASU A;  1Z05 A;  1AIP A;  2WB1 A;  5TV2 A;  5EEG A;  3S8P A;  1QBJ A;  4G6T B;  4IF4 A;  2VBX A;  2F5D A;  4U0V A;  4Q7J B;  5DS0 A;  1JUS A;  2Z6B D;  3MZ8 A;  1VQ8 I;  2VFP A;  4P22 A;  1MKM A;  9ANT A;  1EV7 A;  1JKO C;  3J80 Z;  1MZB A;  2BVM A;  2ICW G;  2JUC A;  3I0T A;  4A3K J;  1Z6R A;  5HLI A;  5E3O A;  1QHH D;  3Q0W A;  3OYK A;  3LQ6 A;  4NK6 A;  3MFK A;  1ZH5 A;  3W5U A;  2GXG A;  2R7U A;  4QPQ A;  1XS9 A;  2HQN A;  3H1C A;  2QDX A;  1O8D A;  4IJA A;  1O3S A;  4P1V A;  1T33 A;  1OGO X;  1STZ A;  1U8B A;  4D7M A;  4BQQ A;  1ODD A;  3BTL A;  1WJE A;  5TJJ A;  3OSF A;  2R7O A;  3H3U A;  3KET A;  1HKT A;  2BHZ A;  4F7Z A;  3W5H A;  1O3T A;  1KRH A;  4Z2Y A;  1V5E A;  4Z05 A;  1NK2 P;  1P2F A;  4P6Y A;  3G6E B;  1XG2 A;  1ZLJ A;  2X1D A;  2VBZ A;  2WZN A;  3CES A;  1Z7L A;  3LMM A;  1FOK A;  4TKO B;  3S2D J;  2O0Y A;  1HVX A;  4QUZ A;  1E64 A;  1EXM A;  3KEO A;  2XEX A;  3N97 A;  4E4H A;  4IHV A;  1PKV A;  1OCC H;  1USS A;  2JK3 A;  3MMY B;  1ON2 A;  5DEQ A;  3VYT B;  3KYL A;  1S72 I;  3LO8 A;  2GIZ A;  3AKZ A;  1TWH J;  3F8N A;  1WJD A;  2HQ5 A;  2DFE A;  2IA0 A;  2XT4 A;  2RN7 A;  3OYH A;  3V4G A;  2V9P A;  3CP8 A;  4U49 A;  3CZ6 A;  5FB2 A;  4RD2 A;  4DOZ A;  3T56 B;  1QVT A;  2CUJ A;  3GZ5 A;  3ISP A;  5LHI A;  1VF9 A;  4ABZ A;  2DI3 A;  3RKQ A;  4ZDP A;  2ZZQ A;  3WTU C;  1K4Z A;  1T6S A;  1HW1 A;  1LNW A;  5EDN A;  2E2J J;  3KX2 A;  4KMU X;  4C43 A;  2LVS A;  3IHU A;  2K9M A;  1BW6 A;  3DWL E;  2Y0M A;  3RYP A;  5GAD J;  4X8I A;  1TWG J;  1BI0 A;  2MW8 A;  3E7L A;  3ULQ B;  2J7K A;  3WNC A;  3B73 A;  2XRO A;  1D8J A;  2JQ7 A;  2CND A;  4XN0 A;  3BR6 A;  3ZQC A;  5GTI C;  2K9S A;  3ES9 A;  2D3N A;  5IYB J;  3C18 A;  1L0O C;  5F1R A;  1ZM2 A;  4RD6 A;  4Y9U A;  3K7A J;  1Q81 D;  1D1C A;  1LLZ A;  3IWF A;  2OZU A;  3O2P E;  1N8R D;  4LBV A;  4PC1 A;  1TW2 A;  1X1P A;  2XND A;  1KU3 A;  1E2X A;  1SKY B;  1DQU A;  3DP7 A;  3FX3 A;  2LK2 A;  2MFZ A;  3MQ0 A;  4XKW A;  4BQN A;  4KH3 A;  3J81 Z;  4DW6 A;  4MEX F;  1KQS B;  5LGN A;  3HSE A;  3BNW A;  1O8L A;  5BNG A;  4AYB A;  1ITY A;  1P4M A;  3BCD A;  2MD5 A;  2DQR A;  1W4M A;  3QOD A;  4YFN F;  3HKZ N;  5FNZ A;  3G1L A;  4Q47 A;  3AK5 A;  1RR8 C;  2DTR A;  3ASQ A;  3CO7 C;  4M73 A;  1P7I A;  3TP3 A;  3M4O J;  1T95 A;  2DA6 A;  1Z77 A;  2DT6 A;  3CCM B;  1YG2 A;  3E6M A;  2Z2S B;  1R5H A;  2IA1 A;  2IT0 A;  2VFM A;  2OBT A;  1QZE A;  3M07 A;  4M1K A;  1FIA A;  1YRN A;  3I1F A;  3CUQ C;  5K1Y A;  1OGI A;  1DP3 A;  1J59 A;  1BI1 A;  2GK6 A;  1WPC A;  1R1T A;  1GO2 A;  1EFR A;  1YX5 A;  4ITV A;  1IRG A;  2BM1 A;  1D5Y A;  3G71 B;  2VON A;  2HYG D;  3EQN A;  4QSH A;  2OK8 A;  1HW5 A;  2I10 A;  2F5E A;  3VMF A;  1XDU A;  2NS7 A;  2B0L A;  2L4M A;  3OSG A;  5CJ9 A;  5CKT A;  4Q5S F;  3SDB A;  1IUY A;  3OW2 B;  4KMF A;  4J01 A;  4AVZ A;  3E20 A;  3DXJ F;  5A8A A;  2CK3 A;  1YJ9 I;  1FND A;  1BC8 C;  4L0Y B;  2F1M A;  4GYI A;  2VJ4 A;  3H9N A;  3FXO A;  2MD0 A;  1U9N A;  4ZH4 F;  2CW7 A;  3QAH A;  2WAE A;  3WTZ A;  4XMY A;  1ONV A;  4WK8 F;  2QBY A;  3PO3 J;  2DK8 A;  2HDN B;  3OOC A;  1HF2 A;  4O6J A;  3OYN A;  1HKS A;  3CC2 I;  2W4S A;  1U78 A;  1QVU A;  1JI8 A;  3GQB A;  4Y3O A;  3BCB A;  3BT9 A;  1U3E M;  1X0C A;  1RUN A;  2KIQ A;  1QGZ A;  1OYI A;  4R1H A;  2V7U A;  4XKB A;  2INV A;  3C2H A;  4FQG A;  3JQQ A;  3WTV C;  1U2R A;  4ZCL A;  1A6I A;  1LPQ A;  4RPD A;  2XB5 A;  4LB5 A;  3GZN B;  1D1N A;  4WXD A;  4L9V A;  2NVT J;  1QFZ A;  2V26 A;  2VT3 A;  2R7F A;  2LBF B;  3BG3 A;  5HZA A;  3CCU B;  1SVO A;  1YJ9 B;  1IN5 A;  2WJV A;  1YJW I;  2ZSH B;  1ZK8 A;  1B8I A;  4PDK A;  4PGH A;  1GR1 A;  4TMZ A;  3OJW A;  4YFO A;  2XRN A;  3RZO J;  5F4M A;  1RU4 A;  5CYV A;  5GAG J;  1R00 A;  4UVA A;  3CC4 I;  2QUF A;  3JSP A;  3HOY J;  1NJI D;  2L54 A;  1H8E A;  3SDG A;  3G3Z A;  2WB1 N;  1HKQ A;  1OIS A;  1S0U A;  3DBL B;  3R60 A;  3OYG A;  2OBS A;  2WJY A;  5DDG A;  4HV5 A;  4EVI A;  2B9S A;  2YX4 A;  1LDK B;  3S2W A;  2H09 A;  1PP8 F;  1X2M A;  4B3F X;  2HVQ A;  5TY0 A;  3BZK A;  3FMS A;  3CCM I;  1LFB A;  2L2O A;  3DEU A;  2EA4 A;  3DKW A;  1LJ9 A;  3KFW X;  5EJC A;  3WG9 A;  3J81 K;  4CHU A;  3Q38 A;  3R6J A;  4F92 B;  3W2E A;  5TR9 A;  4P55 A;  4BE1 A;  1UEL B;  2H94 A;  2O6W A;  2WWY A;  4HE5 A;  3H35 A;  1YE9 A;  1LFP A;  3K4B A;  4HF2 A;  1SKQ A;  2FBI A;  4HX4 A;  5JR3 A;  1FY7 A;  1QG0 A;  4IZZ A;  2D9R A;  5HNF A;  4P2N A;  2HOS A;  1G8X A;  4BY7 J;  2AHO A;  2PYH A;  4OJ6 A;  4YZ0 A;  2R0Q C;  1X3W B;  5J8F A;  1MSF C;  1TTT A;  2ZL5 A;  3GFJ A;  4EH1 A;  3DDY A;  2NST A;  3EYY A;  2IXS A;  2IS2 A;  1DPU A;  2KIS A;  2ZBK A;  4ANJ A;  1UD8 A;  2BM6 A;  5D4S A;  1FLI A;  3GME A;  4KJZ A;  4KT6 A;  2NVY J;  3GVL A;  5CVR A;  2V7T A;  2E71 A;  1R4N B;  1X4O A;  3BCA A;  5DTD A;  2WAQ N;  1PUF B;  2OF7 A;  4B3X A;  4NC6 A;  4D5F A;  1JT0 A;  4PSX A;  1NB0 A;  4OPO A;  1VQ5 B;  2R6H A;  3OJX A;  4F52 A;  4QVA A;  2V4J C;  2XF6 A;  4XM3 A;  2BVN A;  1GJR A;  2A6E F;  4XD7 A;  5EGO A;  3WBJ A;  4CQJ A;  3CF5 F;  3OS1 A;  2KRF A;  1V5F A;  1MH4 A;  4IQ4 A;  5KVR A;  1U5T B;  2V79 A;  5F0C A;  2RC5 A;  2CFO A;  2IAI A;  3QFS A;  3LFU A;  4G7O F;  4WQM A;  3BH4 A;  2F3L A;  3GTO J;  5F4J A;  3RKY A;  3W5V A;  1X4P A;  3AVX A;  1QA6 A;  4XNF A;  4RD0 A;  5THX A;  1Q1V A;  5TRD A;  1XDS A;  1R1V A;  2J8K A;  3K4N A;  2G7U A;  2OAZ A;  2PI0 A;  1FEX A;  3ZZ0 A;  3CDI A;  3SEJ A;  3EET A;  2YSR A;  3KP2 A;  4IHX A;  3F3X A;  1P4W A;  3EUH C;  1PUE E;  2K7L A;  1JXS A;  1E1Q A;  4BE0 A;  2MG4 A;  4PFO A;  3V7R A;  2R5Y A;  4G1V A;  1D8T A;  3PA2 A;  4BEH A;  1H85 A;  2LP0 A;  2AHQ A;  2VE8 A;  3CCS I;  1FIP A;  1EP1 B;  4OM9 A;  1VQP I;  2FMY A;  3OYA A;  3K6G A;  5FRM A;  2BMW A;  3ISX A;  1GVH A;  3I59 A;  3CMA I;  4P26 A;  2EWE A;  3T8T A;  4M4S A;  2DJI A;  4BNC A;  2PN6 A;  4YZA A;  1APL C;  1IA5 A;  3GW2 A;  3ZIA A;  2HZT A;  1FBU A;  2DO7 A;  3G6E I;  2CMP A;  4A3M J;  1QUF A;  4M9Z A;  1VLO A;  3GSI A;  1IB4 A;  4AWX B;  4LC0 A;  2V1D A;  4HDV A;  4ZTJ A;  2DPU A;  4YCQ A;  3OYJ A;  3HYI A;  3HOS A;  4LLG F;  1QHG A;  3Q39 A;  1BIA A;  3D5L A;  3KEW A;  1R36 A;  1GHC A;  2PLF A;  4UUS A;  3GCM A;  3VYS B;  3CCJ B;  4DQ2 A;  2OBP A;  1ZQ3 P;  1EP3 B;  5LD2 C;  2QKM B;  2CFX A;  3JSO A;  3I5U A;  1KD1 D;  1PYV A;  4LIU A;  2WZP P;  2ZME B;  2HYJ A;  5IYR A;  1MJB A;  2DFI A;  4ZGQ B;  3BR3 A;  3OZV A;  1OFM A;  1TWA J;  2WY7 Q;  5F0H A;  3OR1 C;  2VNJ A;  1WOR A;  3OZW A;  3B8Y A;  2JVH A;  2KPM A;  3AVV A;  3PIP F;  3PQJ A;  1HZE A;  1SD7 A;  3G2B A;  3EUH A;  2W82 A;  3BR2 A;  4JX5 A;  1ZRE A;  3JRI A;  1KTV A;  2VQL A;  2WPD A;  5FIU A;  3J7A Y;  2DY1 A;  3CMM A;  3H5R A;  4M72 A;  5FO1 A;  4A93 J;  3FM3 A;  1T38 A;  2ZNZ A;  5DS9 A;  4Z4R A;  2CV0 A;  3S1M J;  2DLL A;  2K4J A;  2L9R A;  3FBI B;  1MDM B;  2H6C A;  2OCC H;  1VQ4 I;  1FNC A;  5K7F A;  4I0B A;  1X2N A;  1Z3X A;  4JRA C;  1KGS A;  4EJU A;  5FFZ A;  2GK7 A;  3Q0U A;  5DCM B;  1OLT A;  1FP1 D;  1FSH A;  2HWV A;  1ELO A;  2HOA A;  1KK2 A;  3T8R A;  2XZP A;  4U9U A;  1ZN2 A;  1B23 P;  2Z8G A;  2K3P A;  2VZL A;  4X07 A;  3RJP A;  2Y9Z A;  3TW6 A;  2P5L C;  4XLC A;  1W7P A;  3A0B C;  4EEF G;  1G7R A;  3ZUG A;  4FX4 A;  2YS9 A;  1JNY A;  2G7H A;  1YYV A;  2GLO A;  2F2E A;  4UVB A;  4F3Q A;  2ISZ A;  1MW7 A;  3ZN0 A;  2IQ7 A;  2ZO4 A;  2M4K A;  1HDP A;  2KRC A;  2D1H A;  2H6B A;  2QMU A;  2ECC A;  4E7S A;  3I55 B;  2JSP A;  4II3 A;  3W2A A;  1KU7 A;  2GA1 A;  3S15 J;  4Q4Z F;  2FOK A;  4BBR J;  4AF7 A;  2LY1 A;  4HAM A;  1GDT A;  2CF4 A;  3BQY A;  1WJ5 A;  3WE2 A;  2HDC A;  1VQN B;  3LJY A;  4MQ9 F;  4IQJ A;  2XTY A;  1X1D A;  3E0J B;  5D8L B;  4RJL A;  4OOS A;  3KP5 A;  2ZME C;  3ONU A;  3IWZ A;  3LOC A;  4BXX J;  2K40 A;  4RBO A;  2R7X A;  2YUH A;  2DA5 A;  3P7N A;  4NCN A;  2XZL A;  1ZM4 A;  3O3K A;  1KYW A;  4WWC A;  5JBQ A;  2AS5 F;  4L5E A;  4PAB A;  4FET A;  5J6X A;  5D5U B;  4A3L J;  1JKR C;  2XAG A;  1OR7 C;  3BJA A;  3L9F A;  2P7C B;  2GQQ A;  2KDO A;  3GX4 X;  4C9Y A;  5J1R A;  3WGI A;  1B59 A;  4DBQ A;  2FF4 A;  4RPB A;  3ZZU A;  1LE8 A;  3GTQ J;  3E97 A;  3JU4 A;  3DTE A;  3PO2 J;  1FP2 A;  2VXZ A;  2DMT A;  3BWG A;  3OL3 A;  4WWV A;  5JVT A;  3M3Y J;  5H2F C;  2FBK A;  1UJ8 A;  1YHQ B;  3FIS A;  2QZ8 A;  1MMA A;  4FT8 A;  3HRT A;  4XL9 A;  4Y13 A;  2KFD A;  4UZE A;  2CO5 A;  3I4P A;  4RAG A;  1QPM A;  4KFC A;  1UD2 A;  1ZTR A;  5IOY A;  3FY3 A;  1BX1 A;  3CPW B;  4XLE A;  5KAI C;  4UVC A;  3IAS 2;  3IH3 A;  2BX6 A;  3W6J B;  1GV5 A;  1JUM A;  3T0Y A;  4IOA F;  2KMU A;  3WHC A;  4YG2 F;  1JKQ C;  1G2H A;  5FKN A;  2UV1 A;  2HFH A;  3HOX J;  1P6R A;  1K83 J;  2LY2 A;  1JJ2 B;  3QYF A;  5K5Q A;  2DMN A;  5L3G A;  4CDG A;  2HTJ A;  4JK1 X;  2HDD A;  3I56 B;  1MMS A;  3WG7 H;  3AL0 B;  4ZCI A;  4N9H A;  2R7S A;  1KK1 A;  2XKO A;  2BGI A;  3BG5 A;  3C2B A;  3V7S A;  4Z6Y A;  3BC9 A;  1I8D A;  1E3H A;  4GO1 A;  1G59 A;  4DK0 A;  3KP6 A;  1E0E A;  1H8A C;  1O3Q A;  2NSP A;  3HG9 A;  1OGM X;  4NBS A;  5K7H A;  3DU6 A;  4DYQ A;  3GBG A;  3A3G A;  4DZP A;  1QFJ A;  4L5I A;  4FTH A;  1IRF A;  3WU2 C;  4P96 A;  5LHG A;  1JTA A;  2XAF A;  1VQO B;  2COM A;  1AKH B;  2WBM A;  2OTL B;  2M1B A;  2M4G A;  3OYE A;  4E7Z A;  2G0E A;  2DA2 A;  4YII A;  4UB8 C;  3K4C A;  2DCU A;  4D9J A;  1VQ6 B;  4FX0 A;  1I6X A;  1WP6 A;  3SZP A;  4X06 A;  3BTC A;  3RPU D;  3GTL J;  4PAA A;  1S4M A;  2DK5 A;  2KIU A;  3PL8 A;  4Y15 A;  4BAY A;  1G7S A;  3V76 A;  4XON A;  2EIJ H;  3RQ4 A;  3MZH A;  1FYL A;  4IVN A;  3GQ8 A;  2R7T A;  2HGC A;  1MBG A;  1T0F C;  2VB6 A;  1QGA A;  1OQY A;  1RQP A;  2WAF A;  4I7H A;  1O8G A;  1FX0 A;  1VTN C;  3HM5 A;  3WXM A;  3DEW A;  3CJT B;  1XPX A;  5K5R A;  2JMW A;  3B6C A;  4L18 B;  4FXU A;  2P0W A;  3V7A A;  3CD6 B;  1Y0Y A;  4GQN A;  1EH8 A;  4GCV A;  2YPR A;  3OMY A;  2CQ7 A;  2BF4 A;  5HXB A;  2LH9 A;  3UKG A;  1H9G A;  1MBK A;  4Y17 A;  3TO6 A;  2VUM J;  2Q0O A;  4ENN A;  1K9M D;  1IHM A;  4B47 A;  2L0K A;  1JJ8 C;  5CVU A;  2XNC A;  3OYB A;  1BI3 A;  3HUG A;  2X0L A;  1E3X A;  2QSH X;  5IT9 K;  2VKD A;  2XC7 A;  5KW9 A;  1C0W A;  3VMV A;  2FQ3 A;  3MCZ A;  4BAC A;  4NBQ A;  3OFN A;  4W97 A;  4Z4Y A;  3CCR B;  2F48 A;  3M7G A;  4X0C A;  3QPS A;  4HYE A;  5FGM A;  2DW4 A;  3JX8 A;  3ZPN A;  5E17 F;  3SZE A;  1VQK B;  1PJR A;  4LOC A;  2XRL A;  1UHS A;  1J9Z A;  4E7H A;  4DJA A;  1IRX A;  3SFZ A;  4KUM A;  3Q9V A;  3VOE A;  4KN4 X;  3QPH A;  3HPH A;  2BSA A;  4CIC A;  1MBJ A;  4I0A A;  3D5S C;  1QRB A;  1T08 B;  3DKX A;  2P4W A;  1FMV A;  3E1Y E;  3CME B;  4M6V A;  1KK3 A;  2JJ7 A;  4BL0 B;  1V0E A;  2VBU A;  3GO5 A;  1HA3 A;  4JQF A;  2P6S A;  3G73 A;  5DM6 F;  4QVJ A;  1TW3 A;  1WJB A;  1LKX A;  4GYG A;  3OEH A;  2BEO A;  1OGJ A;  3GTG J;  5CLS A;  4KIF A;  4BPR A;  5C44 J;  1B8I B;  2E1R A;  4M9X A;  3KP7 A;  3ZP5 A;  3VNV A;  2DMU A;  2E7X A;  2I1L A;  1FZP B;  2LSO A;  4II2 A;  2VOO A;  3ZQ7 A;  2HNH A;  1TLH B;  3CRZ A;  3IC7 A;  5E20 A;  3AFH A;  2FX0 A;  4OAZ A;  2JA7 J;  1TSP A;  2ID6 A;  1F36 A;  4A0Y A;  1S7E A;  1BI2 A;  4BJ6 C;  1PP7 U;  1FX7 A;  1YOV B;  5FD6 A;  5ILU A;  4EAT A;  4QTR A;  1I1S A;  2LDU A;  2QX3 A;  3CC7 B;  4FWT A;  3ML3 A;  1W0K A;  4JX4 A;  2R7R A;  3QFT A;  3WYA A;  5J3L A;  5HOO A;  4AD9 A;  3AG3 H;  4KKU A;  1QQ1 A;  4L9J A;  4B8X A;  1ZRD A;  3JRF A;  2AXT C;  2DA7 A;  2LBF A;  4RCY A;  1IXR C;  4EQQ A;  4BUP A;  1FTZ A;  1Y1W J;  3ZXS A;  2HEO A;  4CCJ A;  2V7X A;  3T51 B;  2W7N A;  1MBF A;  2M34 A;  3BG6 A;  4RM0 A;  2ZXH A;  4GDF A;  3WOD F;  4YRV A;  1R7J A;  4OWR B;  4KNY A;  5FKM A;  1KQ9 A;  3HRM A;  1S6L A;  3S93 A;  3U2R A;  4C3H J;  1JE8 A;  1ZRC A;  4WZL A;  4WZE A;  1TBX A;  1R6R A;  4H9G A;  3OZU A;  4CYD A;  4M6X A;  2IGO A;  2P8T A;  1UAA A;  4L8J A;  2EZK A;  1I39 A;  2MGQ A;  2M5S A;  1MBE A;  4ASN A;  2QEX B;  2HS5 A;  1D1B A;  1QNT A;  5E1Z B;  1KC8 D;  1P4A A;  1W35 A;  1J2X A;  5K7Z A;  2ZXI A;  2C2W A;  3BH6 B;  3KYD B;  1YI2 B;  4AIK A;  2JUG A;  3FMQ A;  1R4M B;  5EG0 A;  2E7W A;  1QGP A;  1BR1 A;  3C2G A;  1R49 A;  2K9Q A;  3M8J A;  3OOP A;  5DV5 A;  3A1P A;  5ERI A;  1N07 A;  2CQX A;  2FJ1 A;  4G12 A;  5F08 A;  4JX6 A;  1DUX C;  3KE2 A;  3BP8 A;  1RC9 A;  2ELJ A;  2EQR A;  1MJ9 A;  3OS0 A;  3MKZ A;  1U2W A;  1XTA A;  4CO8 A;  1L3L A;  2OTJ B;  2A69 F;  1M1E B;  2VI6 A;  3VNU A;  4GFB A;  3F23 A;  2QEX I;  2X6X A;  1E1R A;  2FML A;  3SLD A;  1TQP A;  5JMC B;  4LLL A;  1XG1 A;  5L3B A;  4ZTF A;  1YJN B;  1KA8 A;  2K85 A;  4BHB A;  4MHG A;  3G4S I;  2VKE A;  3OYM A;  3CCV B;  3H92 A; 
#chains in the Genus database with same CATH homology
 2MD0 A;  2X6Y A;  2CW7 A;  2XZO A;  2V31 A;  2WAE A;  2E1M C;  4OZZ A;  4Z06 A;  4XMY A;  2V1N A;  2Y0S A;  4F55 A;  1Z3Y A;  4P5O A;  3BG7 A;  4H4K C;  3OOC A;  4B3G A;  2M0M A;  1OHH A;  3OYN A;  1JI8 A;  2MAB A;  2W4S A;  1E79 A;  2UVE A;  1TZL A;  4Y3O A;  3BCB A;  3NWT A;  2V6E A;  3GQB A;  5JHF A;  1X0C A;  2MYS A;  3LMW A;  3VR6 A;  5HKK A;  4NQW B;  3VST A;  2GJK A;  4XKB A;  2INV A;  3C2H A;  4B43 A;  3K4J A;  5FRO A;  1BLI A;  3HAG A;  1BPL A;  1QU3 A;  4TSF A;  2V26 A;  2LBF B;  1VBL A;  5LFA A;  2GOX B;  4XQF A;  1QJV A;  3BLY A;  2LYC A;  3ZR8 X;  2WJV A;  2WAQ A;  3FHN A;  4DIQ A;  2VAS A;  3OYD A;  4C30 A;  2ZSH B;  3SUC A;  5AMV A;  1UG0 A;  3DU5 A;  1V5G A;  1OFL A;  1RU4 A;  2W6I A;  2WSS A;  1U0J A;  2HDW A;  4RM3 A;  1H8E A;  2JIZ A;  2E60 A;  4W8S A;  1NHC A;  2HPM A;  3HXL A;  3OEE A;  2WJY A;  3A4C A;  3OYG A;  2M7B A;  3OYC A;  4RLF A;  4CCL A;  1LDK B;  4BJT A;  1GQ8 A;  1FMW A;  4B3F X;  1O8K A;  2HVQ A;  2K5C A;  4DGW B;  2L2O A;  2GOM A;  2ODL A;  1O8I A;  2XF5 A;  4F92 B;  3DPT A;  2F6C A;  3TBI A;  4BE1 A;  1UEL B;  1DGR M;  3H35 A;  3SEQ A;  1YE9 A;  1LFP A;  2E5N A;  3K4B A;  2A5W A;  2AQE A;  1K5C A;  1WFX A;  4B48 A;  3ZRG A;  2K9L A;  2ZFU A;  4IZZ A;  5HNF A;  1W36 C;  2KVO A;  3KRG A;  3UW0 A;  2HVS A;  4BQO A;  1G8X A;  3DEE A;  4B44 A;  3L2R A;  2PYH A;  4OJ6 A;  2VKH A;  4YZ0 A;  3LL7 A;  2IGK A;  3VSV A;  1DBO A;  4XN3 A;  3KEY A;  3DDY A;  5TGT A;  1H80 A;  2NST A;  4NNJ A;  2LRD A;  2IXS A;  2HPI A;  2IS2 A;  4ANJ A;  3W2V A;  1UD8 A;  1MNE A;  4KJZ A;  4KT6 A;  4GRI A;  3ZSC A;  2VXD A;  5CDF A;  4KIS A;  2W6J A;  3ZGK A;  2CV2 A;  3GVL A;  1D0Z A;  3K4K A;  4KKS A;  1X4O A;  3BCA A;  1MMN A;  4B3X A;  4C2T A;  4I84 A;  4PSX A;  2A6T A;  3MKW B;  4F52 A;  2W1O A;  2V4J C;  2XF6 A;  3E1S A;  4OAY A;  4XM3 A;  2UWM A;  1W9X A;  2AQF A;  2DIE A;  2E1B A;  1EE6 A;  3F9K A;  1NG7 A;  4BJ5 C;  4ZYA A;  4XD7 A;  1X1B A;  2NT6 A;  4XOP A;  3SZG A;  4LIV A;  3OS1 A;  1V5F A;  2JDI A;  1OOC A;  4IQ4 A;  2KHM A;  4HIZ A;  3VMW A;  2CFO A;  3LFU A;  2HVR A;  4HRI A;  3BH4 A;  3L2U A;  2PJR B;  4X0G A;  1X4P A;  4PSW A;  4CCM A;  4IKF A;  2O0W A;  4XNF A;  3DQV C;  4PUS A;  3H5N A;  3GVK A;  1PXZ A;  1WJC A;  2RQQ A;  3LSK A;  2JJ2 A;  1QCX A;  2KL4 A;  4YZQ A;  3OIP A;  2DXI A;  4HG2 A;  2BVL A;  2VQH A;  3K4N A;  3A1Y A;  1HA8 A;  4D1Q A;  2VJ5 A;  2O5R A;  1TT0 A;  1BOB A;  5KNL A;  2X51 A;  3EUH C;  4W8T A;  3CF2 A;  5KCM A;  4CZC A;  4BE0 A;  1E1Q A;  4PFO A;  2VLA A;  3FKJ A;  1P9Q C;  5IK2 A;  4U4B A;  3SEZ A;  3OW7 A;  3IUO A;  4BEH A;  4CCO A;  4R79 A;  3GQ7 A;  3EUK L;  4HNU A;  1COW A;  4Z03 A;  5C1C A;  2DOA A;  3K6G A;  3OYA A;  4XLH A;  5HVQ C;  5FRM A;  4XLA A;  2L5Q A;  4KKT A;  3G05 A;  2EWE A;  1KMH A;  3H94 A;  2V9K A;  2DJI A;  3PUB A;  2PYG A;  1HG8 A;  2O1D A;  4PJM A;  4URR A;  4NC8 A;  4YZA A;  1BMF A;  1IA5 A;  1W36 D;  3VWB A;  3ZIA A;  3OYI A;  3B4N A;  2L7K A;  3NE5 B;  1IB4 A;  2CMP A;  1KCD A;  2E5Z A;  1BR2 A;  2HQA A;  3I9V 2;  4PMH A;  3U21 A;  4ZTJ A;  3PSI A;  4BGD A;  2Z16 A;  4ZDO A;  3OYJ A;  3OPO A;  2VPL A;  3HOS A;  3T9G A;  1QHG A;  3FKS A;  3QOE A;  3D5L A;  3KEW A;  2VBK A;  2HZD A;  4LG3 A;  5CQE A;  2X53 S;  2CW8 A;  2XF7 A;  1VZ0 A;  2BW3 A;  2QE7 A;  3VYS B;  3LSM A;  5LD2 C;  2LG4 A;  2QKM B;  1PYV A;  4LIU A;  4AU7 A;  2WZP P;  3A3B A;  1I18 A;  3PFY A;  1BN8 A;  3RCO A;  4E0F A;  2NOJ B;  3SYT A;  2LOO A;  1OFM A;  3PSF A;  1NBM A;  2WY7 Q;  2BSP A;  3OR1 C;  3PNT A;  4ZDL A;  2ZZG A;  3B8Y A;  2JVH A;  2KPM A;  2QXZ A;  3K70 D;  1HZE A;  3H5A A;  3G2B A;  2W82 A;  3H9J A;  4BS9 A;  1Y6I A;  2VQL A;  2WPD A;  1RWR A;  3M1C A;  4CCK A;  1N75 A;  4RLQ A;  3J7A Y;  3L2W A;  3CMM A;  3H5R A;  2VQC A;  2ZZF A;  2INU A;  3N05 A;  3BCF A;  3DLA A;  1DBG A;  2X85 A;  1K6Y A;  2CV0 A;  4DNR B;  1O8J A;  3GRH A;  3FBI B;  4BDY A;  3OOU A;  2R7Q A;  2NT9 A;  2UVF A;  2KLO A;  3EUA A;  4XKC A;  3VSK A;  3W2W A;  2M3A A;  2NZM A;  1Z3X A;  3VYR B;  2DCE A;  2L9N A;  1UD6 A;  3DTI A;  4E7L A;  3FBN B;  5CPR B;  1WMR A;  2GK7 A;  2XZP A;  1OLT A;  2X8K A;  3LNN A;  3OYF A;  1CZF A;  3LSI A;  2Z8G A;  3GQ9 A;  2K3P A;  2XOK A;  3FPP A;  4PFP A;  3UNG C;  1O8M A;  4MLO A;  4XLC A;  4OJL A;  2V7F A;  2BW3 B;  2QKL B;  1D1A A;  4F3Q A;  1MW7 A;  2IQ7 A;  3IP4 B;  2LZJ A;  2M4K A;  2KRC A;  1IDJ A;  1KON A;  2JA2 A;  4E7S A;  1X1C A;  2JSP A;  4II3 A;  2RNG A;  3W2A A;  2KZV A;  3CJQ B;  4HPQ A;  1X19 A;  1ERD A;  2Z1D A;  1Y56 A;  4YXW A;  2LY1 A;  3AL0 C;  3EQO A;  1WJ5 A;  4PJN A;  3GVJ A;  3VSU A;  3TL4 X;  1BHE A;  2VIX A;  4IQJ A;  4MR0 A;  1X1D A;  3E0J B;  2O0V A;  3OYL A;  1ZEL A;  3DKY A;  3PNY A;  3CJR B;  2R7X A;  3LSG A;  2ZTG A;  2XZL A;  3OY9 A;  2V4D A;  2CV1 A;  4HST A;  4FET A;  2WAD A;  3DTK A;  3VDX A;  3L2V A;  4HEA 2;  4J00 A;  2ZTN A;  3OAA A;  3H9Q A;  2I8D A;  4G7X A;  1OR7 C;  3HL2 A;  2KDO A;  4C9Y A;  5FRN A;  4OJO A;  4DBQ A;  5CQG A;  2F4I A;  3S3N A;  2IS6 A;  4QPO A;  4LIT A;  3OR2 C;  4BEH B;  3D5R C;  3JU4 A;  4DK1 A;  1H8H A;  2PMZ A;  3DTE A;  1N77 A;  1O8F A;  3ZPP A;  2VXZ A;  4EW9 A;  3OL3 A;  4FAS D;  1D0X A;  2X6W A;  1LVK A;  1UD3 A;  4HWV A;  1MMA A;  4XL9 A;  2R7W A;  4BE2 A;  3PJR A;  4JOM A;  1RMG A;  4PJJ A;  1UD2 A;  3FY3 A;  2X1C A;  4ZC3 A;  4OJP A;  4XLE A;  2F5V A;  4F93 B;  3IAS 2;  1MMD A;  2F43 A;  2CS3 A;  2VL8 A;  3B90 A;  4N4N B;  2KMU A;  4KIT B;  4MXN A;  3QYE A;  2VBM A;  2UV1 A;  2VJJ A;  2LY2 A;  3QYF A;  3FDY A;  1MND A;  1D0Y A;  3AL0 B;  2R7S A;  3OL4 A;  3VYU B;  4PK4 A;  3DPL C;  4C2U A;  3BC9 A;  1WJA A;  2FUG 2;  1I8D A;  2HLD A;  2O17 A;  4NK8 A;  1G59 A;  3MKY B;  5DN6 A;  1E0E A;  4XKV A;  4DK0 A;  4OZY A;  2NSP A;  1N78 A;  3HG9 A;  3OWT A;  1E3Z A;  1OGM X;  2R4G A;  3DU6 A;  2OV7 A;  3GBG A;  4NC7 A;  3A2K A;  1W0J A;  3T53 B;  1JRG A;  3A3G A;  3LSH A;  4E6K G;  1OB0 A;  1UD4 A;  2X3H A;  4CCN A;  3ONQ A;  2IS1 A;  3GQA A;  5C1E A;  2GJR A;  4E7I A;  1JTA A;  3MD2 A;  2W00 A;  4JMQ A;  4DNT B;  2WBM A;  1KZL A;  2M4G A;  1O8E A;  3JUR A;  3OYE A;  4YEL A;  2GJP A;  4E7Z A;  4RM2 A;  1NRK A;  2KRH A;  3K4C A;  2PJR A;  4XOT A;  4BU2 A;  2KQR A;  4D9J A;  1WP6 A;  3S3O A;  2XSJ C;  3WQZ A;  3RPU D;  1O88 A;  1AIR A;  3DPU A;  1AA7 A;  4ASU A;  3PL8 A;  2Q1Z B;  2R9V A;  2WB1 A;  4XON A;  3S8P A;  2OUM A;  4ZJZ A;  3RQ4 A;  2KP6 A;  3GQ8 A;  2R7T A;  5KHD A;  4G6T B;  2VB6 A;  1T0F C;  3V42 A;  2WAF A;  4RMN A;  2VBE A;  1O8G A;  1FX0 A;  2Z6B D;  2RRE A;  4BXF A;  4FXU A;  4XR6 A;  4P22 A;  2P0W A;  1E43 A;  2BVM A;  3A35 A;  4GQN A;  3OYK A;  4NK6 A;  1QHH D;  3RTR A;  2F1M A;  3OMY A;  3HOT A;  2LH9 A;  1NG6 A;  4F91 B;  4PJL A;  4QPQ A;  3H0D A;  2R7U A;  1O8D A;  4Y33 A;  4B47 A;  1OGO X;  4HNT A;  3OYB A;  1E3X A;  4BQQ A;  2D3L A;  2IS4 A;  2VKD A;  1J09 A;  2XC7 A;  1PE9 A;  2UUZ A;  3VMV A;  1WJE A;  4BAC A;  3OFN A;  2R7O A;  1VLY A;  1WJF A;  4TT3 A;  4DBR A;  2VJI A;  1K28 D;  1V5E A;  2X1E A;  3ZPN A;  4Z05 A;  1PJR A;  1Z21 A;  1KCC A;  4E7H A;  4DJA A;  4P1W A;  2XGJ A;  1IRX A;  1IDK A;  1XG2 A;  2X1D A;  1MAB A;  3HPH A;  4HSR A;  3CES A;  1Z7L A;  2OC6 A;  3D5S C;  3LMM A;  4G6I A;  3DKX A;  4TKO B;  2XDV A;  1FMV A;  1HVX A;  2MC4 A;  2LRE A;  4BL0 B;  1V0E A;  1GLN A;  1EA3 A;  4XOR A;  4W8Q A;  4U87 A;  4E4H A;  1PKV A;  3WWG A;  4YZX A;  3VYT B;  3MMY B;  4JQF A;  1YX3 A;  3KYL A;  4E7K A;  3AKZ A;  1WJB A;  1LKX A;  4W8R A;  3OEH A;  1WJD A;  3HKZ A;  3OYH A;  2JVG A;  4U49 A;  3CP8 A;  3CZ6 A;  1UD5 A;  3NWS A;  4DOZ A;  4Z1M A;  3T56 B;  2CUJ A;  1O8H A;  2NTQ A;  4OJ5 A;  2IGM A;  4II2 A;  4ZDP A;  4YEJ A;  2ZZQ A;  2HNH A;  3CP2 A;  3HC7 A;  4CH7 A;  3UR3 C;  3AFH A;  3KX2 A;  3H9G A;  4OAZ A;  2ZZE A;  3OS2 A;  4BJ6 C;  3OIQ A;  2K9M A;  4CA0 A;  3DWL E;  3I3L A;  1T5E A;  3S32 A;  4IX7 A;  4EAT A;  3HUG B;  3OE7 A;  4C2L A;  2QX3 A;  1W0K A;  1BR4 A;  2CUZ A;  1DGW Y;  4XN0 A;  2R7R A;  2O04 A;  2VQG A;  4Y4R A;  2D3N A;  5HOO A;  4KKU A;  1PLU A;  5HNH A;  3K10 A;  3OYM A;  2PEC A;  1D1C A;  3ZQQ A;  2LBF A;  5HLT A;  4E7J A;  3K4L A;  2E1M B;  2XAU A;  4BUP A;  3QYB A;  3IAM 2;  3ZCO A;  3ZXS A;  2DT7 B;  1S9H A;  2XND A;  4CCJ A;  1SKY B;  2W7N A;  5FL7 A;  3T51 B;  2L9S A;  1DQU A;  2MFZ A;  4XKW A;  4BQN A;  3BG6 A;  1SFK A;  2ZXH A;  2BOL A;  2IGN A;  2NTB A;  4YRV A;  2ZSI B;  4OWR B;  3S3M A;  1SAU A;  1MMG A;  3S93 A;  1KTW A;  1O8L A;  4AYB A;  4BDZ A;  3BCD A;  1R6R A;  4NUB A;  2IGO A;  1UAA A;  4L8J A;  3PNV A;  3QOD A;  1VJS A;  2M5S A;  4XLF A;  1D1B A;  2HU9 A;  1V0F A;  2JJ1 A;  2NTP A;  4G7W A;  4CUG A;  4UZU A;  2ZXI A;  1T95 A;  2DT6 A;  2JUG A;  2Z2S B;  2M7A A;  1BR1 A;  3C2G A;  3M8J A;  4N4O B;  1DP3 A;  3K4M A;  2GK6 A;  1WPC A;  3TMO A;  3BC8 A;  1EFR A;  1YX5 A;  4ITV A;  2QY1 A;  2ELJ A;  3RSN A;  3OS0 A;  3MKZ A;  2WY8 Q;  3EQN A;  2CH0 A;  2V7Q A;  4U7B A;  1WTH D;  3K70 C;  5CKT A;  2X6X A;  3EPZ A;  3SDB A;  1E1R A;  1X1A A;  4AVZ A;  2Q2E B;  3L2Q A;  4J01 A;  4ZTF A;  2R7V A;  2CK3 A;  2LC2 A;  1VF7 A;  3W3C A;  3HPG A;  2WA0 A;  4CSW A;  3VSL A;  2VJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...