4XR6A

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 230
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xr6A01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xr6A03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xr6A02
4XLAA 2NTQA 2VBEA 2PYGA 2QX3A 4NK6A 2NSTA 4W8TA 3VSVA 4YEJA 3LMWA 2O04A 4XL9A 1OGMX 3SUCA 3EQNA 4MXNA 2QY1A 4W8SA 2NT9A 4URRA 3KRGA 1KTWA 4AVZA 1O88A 1O8FA 1OGOX 3B4NA 3UW0A 1RWRA 2INVA 4Z06A 3VSUA 3ZSCA 4XLCA 4XQFA 1OOCA 4XLHA 3T9GA 4XNFA 4OJOA 4XORA 2PYHA 4W8RA 3GQ7A 4XMYA 4XKWA 4Z03A 3FY3A 1KCDA 2ODLA 2EWEA 1BN8A 1OFLA 1WMRA 1GQ8A 3GQ9A 4YZQA 3VSTA 3WWGA 1PXZA 2X6YA 1DBOA 4OJPA 4XM3A 3VMWA 4YZAA 2VBMA 1O8DA 1DBGA 1QCXA 2INUA 3VMVA 4MR0A 4C2LA 1O8JA 1CZFA 4NK8A 2PECA 2NSPA 4PMHA 1BHEA 1RMGA 2NZMA 2VJIA 4OJ5A 4EW9A 2O0WA 4OJLA 1IA5A 2X6WA 2NTPA 2Z8GA 1H80A 4OJ6A 4W8QA 3JURA 4XOPA 4XKVA 2X85A 5C1EA 2VJJA 3B90A 2BSPA 1O8MA 3B8YA 2UVFA 2X3HA 3EQOA 3GQ8A 4U4BA 4XOTA 4XR6A 1HG8A 4OZYA 1KCCA 1EE6A 1RU4A 2O1DA 3ZPPA 4YZ0A 1O8LA 1OFMA 2QXZA 1PE9A 1IB4A 2UVEA 2O0VA 3GQAA 4HWVA 2O17A 4XN0A 1O8IA 4XN3A 4YZXA 4U49A 2X6XA 1JTAA 1X0CA 4I84A 4Z05A 4XONA 1IDJA 1NHCA 1QJVA 4YELA 4OZZA 1IDKA 1AIRA 1O8EA 1O8HA 2VBKA 5C1CA 1O8KA 1K5CA 1O8GA 4XLFA 2IQ7A 2NT6A 5AMVA 4XLEA 1XG2A 1JRGA 2NTBA 3GRHA 1VBLA 1PLUA
chains in the Genus database with same CATH superfamily
4XLAA 3HDDA 2KVOA 1OB0A 1T6ZA 1GLNA 1QGAA 3W6JB 1OCOH 3NWTA 3EYYA 4W8TA 4Y13A 3I9V2 4IHYA 2GJRA 4QVAA 3PSIA 3E7LA 4IRHA 4N4OB 4IOCF 2QBYA 6PAXA 1HVXA 4B1RA 4Z4WA 3V4GA 1U5TA 1K4ZA 2BXZA 2Q1ZB 2GPJA 2QEXB 4CCMA 1VNDA 3OIPA 1YHQB 5LHGA 2DJIA 2W84A 4XLHA 1FPQA 2H1KA 3GQ7A 2IS6A 3BP8A 2X9DA 3CCRI 1GQ8A 4LITA 3EUKL 3ZUGA 2FJ1A 4C2TA 2VC1A 1IJWC 1USSA 2EPFA 2V4JC 1FT9A 1MMGA 4BXXJ 3OYBA 2XAHA 3E5XA 1N05A 5E1XA 4IHVA 2BY2A 1ZRCA 5LMZA 1B8IA 3SEQA 2IA2A 1D8JA 5BOXA 1YJNI 1WCMJ 2GWRA 1O4XA 2BHZA 5EMNA 1FOYA 2JK3A 1TWGJ 1WH7A 2VJIA 1FRQA 1TNTA 2L02A 3OY9A 2QMUA 3ZC3A 5FKMA 3BG5A 2I8DA 2X6WA 4QTRA 2GIVA 2E1CA 2QGGA 3AVWA 3DPLC 2PJPA 2BGJA 2HGCA 4XOPA 1AMOA 4LMYA 3JURA 4A3MJ 1WORA 5C1EA 2M4KA 2F48A 1WOSA 1EF4A 4ASNA 2QKLB 3BWGA 4BACA 1JI8A 3CLQA 1TT5B 1Y8RB 5D5VB 2GOXB 1FZPB 1HW5A 1PKVA 3G4SB 2P3MA 5CLSA 5K5RA 4ZDPA 3H94A 1DU6A 1C0WA 5FFXA 4ANJA 2QXZA 2NS7A 1MSFC 1NDHA 1WSVA 5GADJ 3ZOBA 1YYVA 3BCAA 1EH8A 4RCYA 4Z4YA 1SD5A 5IYPA 2M8EA 4NQWB 2YWEA 2E1RA 3PNYA 4D5FA 1VQKB 4S0HB 1R49A 1ZM2A 2GAUA 1HKTA 3CTAA 3GZNB 5DNSA 4Z05A 2E1OA 3ZMVA 4XONA 3GTJJ 4UY8I 3BH4A 2ZFWA 3E1SA 2EIMH 4V02C 5M5XJ 2XF5A 2R7XA 1YE9A 2DQRA 4BQNA 3FMSA 4ZGNB 1STZA 3CJTB 1Q9SA 2OBRA 2W4SA 2Y48A 3ASQA 1Z6RA 3OYFA 4IKFA 1SVLA 3FJOA 4UB8C 2VJ4A 1YJNB 1SMYF 1ORKA 2LREA 1VQNB 4C30A 4P5OA 1VQ9I 2PFBA 5HLGA 2V7VA 3DTKA 1VBLA 1J9ZA 3FXQA 3CPXA 2QA4B 5E1ZB 1BW6A 3UNGC 1KK0A 1IXCA 3CP2A 3WE3A 1H85A 4TSFA 2DK5A 2B7CA 2NSTA 5LRRA 4CZZA 1Z67A 5FLXZ 2Y31A 5DD4A 2LKSA 3L2CA 2XGEA 5E1WA 1YI2B 3PUBA 3DFGA 2QM3A 1KONA 2NT9A 4URRA 1K28D 2OA4A 3OWTA 3ABMH 1ETOA 3Q0UA 5HNHA 3H9NA 4RB1A 1BA5A 3HG9A 2GQQA 5KCMA 3K4NA 3T9GA 3OR2C 2Z2SB 1TQMA 3IL2A 4P9SA 1QZZA 1CF7B 1T6YA 1Q1HA 2EWEA 1XDSA 1GUUA 3CF2A 1D5YA 1KQ8A 3H3UA 3F8FA 3WU0A 1HLVA 1WVRA 2WY7Q 4XM3A 3WNCA 2XGJA 3GLXA 2CG4A 1X1CA 2X3UA 1XG1A 2ZMEA 2VQCA 4HNTA 3SYJA 3CUOA 2QDXA 1UG0A 3BTLA 4NB5A 1B9MA 1F1ZA 4RLFA 4I6ZA 3AGQA 4B4CA 4W97A 3W5HA 5GV7A 5GAHJ 4X06A 4QFMA 2XRLA 2PECA 5CJ9A 2QQAA 5CQGA 3JRHA 2YUSA 4XRMA 1JJ8C 4CCJA 4NQWA 1FX0A 2XOKA 5H59A 4PUSA 5DV5A 1E0EA 2NTPA 3BH7B 1SD6A 2X1DA 1H80A 3L09A 3BDDA 5ILSA 2XZOA 2QVOA 3DKYA 1T39A 2MG4A 1LVKA 3LSJA 2M87A 3QP6A 3B8HA 3B90A 4I2OA 5FRNA 2JJ1A 1MBHA 4TMXA 1TLHB 2F4IA 4DJAA 4HIZA 3KP4A 3F8CA 2RDPA 4OIRF 2ACJA 4Q7JB 3WG7H 4QPOA 3JRAA 2L0KA 3KYDB 4M72A 2BM6A 1Z21A 4AF6A 5A89A 4IXAA 2NYXA 1TTYA 2KPMA 4IJAA 2WYRA 2R7RA 3CO6C 1LKXA 2KRHA 3HOZJ 2RN7A 3I53A 2PQ8A 1YW7A 2ZKZA 2ZBUA 5JLXA 5BQTA 2O6WA 1PJRA 1SKYB 2XT4A 4M71A 2LNBA 1BOAA 3C3WA 4XRFA 1U2RA 3HJEA 4X0CA 2Z33A 3ZMDA 3MD2A 1EH6A 1FBUA 3BR5A 5DEQA 2DMUA 3X2QH 1Y1VJ 2Q6OA 4WQMA 5GPAA 5C3EJ 1QJVA 4E7KA 3K2ZA 3DTEA 3I4PA 2ZL6A 4HSTA 3VNUA 1T56A 1XGSA 4OZZA 4GQNA 2WY8Q 3K4BA 3M7GA 1HF0A 4HOBA 3GVJA 2IS1A 2BMWA 2XPWA 4RB3C 1O8HA 2XKPA 3VPRA 5LD2C 2DCEA 1OMIA 2DOGA 3SLNA 5LHHA 2EV0A 5F6FA 1X4OA 5LFAA 4MFEA 3UR3C 4AC0A 4RB2C 2E7WA 4C2MJ 5CDFA 1VQPB 1JHHA 3FXJA 3RKXA 3GFIA 1CF7A 5TY0A 3WHBA 2OTLB 2LLKA 2QENA 2HTJA 1W0TA 3VR6A 2DMNA 3H5RA 2LBFB 1A8PA 1EA0A 1FYMA 2HWVA 1EP2B 1KU2A 1UELB 2XAUA 3A4CA 3BTCA 2QY1A 3W5VA 3IC7A 2VB6A 1R7JA 1R6RA 1YJ9I 1OFEA 3JRDA 4KIFA 3CCVI 3DV8A 1EWYA 3B4NA 2CQKA 3PNVA 4XLCA 3VYSB 4MIMA 5EEHA 3ZPLA 3ES9A 3QRFF 5FNZA 1DP7P 4IPAA 2V9KA 4UVBA 4LB6B 1RKTA 3K0LA 1DARA 1GAQA 3BCFA 1AKHB 1K79A 4MYUA 1H9TA 4RD4A 2F3LA 3K4CA 4OJPA 2M1BA 1I27A 3R61A 3GLLA 3SDBA 3HXLA 4HAMA 2P6TA 5FA6A 2FBIA 3ZIAA 1DBGA 2DOEA 1PP7U 3Q9VA 4R1HA 2DMTA 3GFLA 1A31A 3GIRA 4HNUA 4AVPA 3IRQA 4PCQA 1MMAA 3GWZA 2Q0OA 4R71A 2R7FA 3TP0A 4ZYHA 3O2PE 4LK1F 3D5SC 2EJRA 2H27A 2AQEA 1F36A 2ELKA 4G6TB 3RPQA 1QRCA 2L2OA 1E3HA 1KQ9A 2WAFA 3F23A 2V7UA 2VFNA 5IK2A 3V8LA 1JKQC 2O0WA 1TQPA 2HYGD 5DS0A 3COAC 4DW6A 2IGOA 2E34A 2VJJA 3LMMA 3NE5B 1SD4A 1F4KA 3ONUA 4G1VA 4KKUA 4AUXA 2EZLA 2X3HA 3OS1A 2JRTA 2DPUA 3H9GA 2YWGA 3HAGA 2WC2A 5JBQA 4DNCA 2DTRA 3U1DA 3BOQA 4B47A 3FXKA 2EIJH 5BPDA 2R7ZJ 2QZ8A 5F27A 2H8WA 5KVRA 2R7DA 3QPSA 1NG6A 3CCUI 3M8FA 1E2XA 3E5QA 1E63A 3FISA 1T95A 1MRZA 1WHUA 3V7CA 4P12A 4U49A 1H42A 2GIZA 4B3XA 1JTAA 1X0CA 2KIUA 4HX8A 5H6QA 2LBFA 5HS7A 2VOOA 2UWMA 2MYSA 1S72B 1OYIA 5CKTA 1OYWA 3S3OA 3S2DJ 1QFJA 3BT9A 1G6NA 3WTTC 3LNNA 5J1RA 1FJLA 2NVQJ 3VYTB 3ABLH 3W5UA 2G7HA 1UD4A 1Q82D 2V26A 4II2A 4RGSA 2A68F 5AIPA 5ICCA 5LGNA 2QSHX 3TO9A 4RDLA 1O8GA 1X3ZB 4DBRA 4IO9F 3O8HA 1JRGA 1L3LA 2IA0A 2XAJA 4F7ZA 2KDOA 2ZSIB 4EEFG 2PYGA 1AKHA 2R7VA 1P6RA 3EDPA 4BEHA 4PC7A 2OV7A 3G71I 3G6EB 1XGMA 1EXMA 3HKZN 1MABA 2QGUA 3R60A 3I55I 2W85A 4IZZA 4HDUA 4EJTA 1MD0A 4YEJA 2I10A 1TWHJ 4ESBA 4P96A 1A04A 3VB2A 2LMDA 1P7IA 3E6MA 3P9IA 1JXSA 2E2IJ 2DO7A 2VASA 3IUOA 4G7XA 3QAHA 5AN9A 1O88A 1O8FA 2ZJPF 3KEWA 3K70D 4M2LA 2LTPA 2WA0A 1JTXA 3ONQA 1OCRH 3LFKA 1FOXA 3HB9A 1H88C 3SDGA 2B9SA 2J5OA 4A5NA 2VIXA 3FY3A 3CCUB 5FRMA 2KZGA 1BN8A 4H0EA 2WAQN 5J4YA 4KICA 2BX6A 3FXRA 1E3OC 2HPMA 3ZZUA 3E1YE 2EFNA 1F5TA 4JBAA 3T8TA 1G8XA 3CDHA 4QLCU 2W24A 3GFMA 2RKHA 4FISA 2H6BA 4Z1MA 4HA8A 3P27A 4YFOA 1GDTA 3JU4A 1QG0A 3I64A 4KYWA 2RNGA 1AHDP 3W6VA 1XTAA 5JI6A 2JT1A 4XKBA 4ESFA 2XGXA 3L2RA 1V5VA 1OCCH 5D5WB 2COMA 5J4VA 1I50J 1WTHD 1VQMI 2CU7A 1G7CA 2NOJB 3AG1H 3SY2A 2PEXA 3WODF 3S32A 1GVHA 2B7EA 1NK3P 4JX4A 3PSSA 3WGIA 1JA1A 3T56B 1B2RA 3HSEA 3S15J 1X19A 1NTCA 2OD5A 4QIWN 5IT9Z 1ITYA 3BH6B 3JAMZ 2GOMA 2CFXA 3PQJA 3KZYA 4YIIA 3DP7A 3W3CA 2GZWA 2WSSA 1V0FA 3IHUA 4IQ4A 3GTQJ 5LGTA 3J81Z 3E0JB 4PK4A 1N78A 1H8HA 4OMZA 4A0ZA 4HF1A 2XF6A 3E20A 3ZR8X 3I55B 3CUQB 3U6BA 2OAZA 3RZDJ 2BM4A 2ZJRF 1BLIA 1EE6A 2ZTGA 2STTA 1QVTA 1K6YA 5EDNA 1VQ5I 1VQLB 2Z1DA 4G7OF 4TT3A 1W87A 4PSXA 1QGZA 4XLPF 5IOYA 3WTYC 1SFOJ 1B59A 4ZZDA 3FPKA 4MTEA 5D6FA 3GBGA 1Y1WJ 2O17A 2XROA 2HS5A 4AU7A 2KLOA 4WZLA 4ACBA 4IHWA 1FNNA 3RTRA 5GV8A 4FK8A 3ZQIA 4IHTA 1PJ7A 3J81k 1P2FA 3SJPA 1SFEA 4YG2F 1IN6A 1ZLKA 1UHMA 2YX7A 1Q81D 2XNDA 3GCMA 3F21A 3JTGA 4BBRJ 2RGVA 4YAWA 2QSFX 2CWEA 1IDKA 4CYDA 4HSRA 5KAIC 1IJEA 3LAPA 4JX5A 4HV5A 2E1BA 3C2HA 1FYKA 1VQMB 4D7MA 3WQZA 3RZOJ 2WTEA 4BY1J 1EP3B 1VQ8I 2E7XA 1TC3C 4RM3A 1FMVA 2HXIA 3TBIA 2Z16A 5HS9A 2L54A 2JDIA 3I4NJ 4XLEA 1P4MA 1Z05A 1Q7YD 4BAYA 3LVBA 3CXCB 1E64A 2BXYA 2QN6A 1P92A 1G3YA 3VEPA 1UCRA 2UXNA 2NTQA 4B44A 2LKXA 1S3JA 2ZJ2A 3BR2A 3PSFA 4OOVA 5DUKA 4E4HA 3FXOA 3CUQC 4FETA 1KU7A 2R7SA 1JE8A 4GGGA 1FP1D 4RPBA 5DSZA 2JA7J 4KA4A 3GTKJ 1LDDA 2GK7A 3BZKA 1SFXA 3OYDA 4MXNA 4A3JJ 1F20A 4LG0B 1ERDA 1U9OA 1YITI 1UMQA 3RKWA 4E7SA 3IWZA 4XRSA 4XK4A 1ZARA 4WXDA 2EILH 3HOTA 4YCQA 3A02A 1H9GA 3KZIC 2HU9A 2D45A 1XX5A 2V6EA 5EEGA 3AKZA 3IP4B 3PA2A 1R1UA 2KRCA 4KDPA 2HFHA 3LSIA 1MSEC 3CC4I 1K83J 4M73A 5EJCA 3VSTA 1DBOA 3NARA 3LSPA 4RLQA 1UJ8A 2QZAA 1VLYA 2DMQA 4ZYGA 2M34A 3WTXC 2E36A 1MW7A 3CUQA 2VKEA 4GCVA 5F08A 1AWCA 2JN6A 4WXCA 4ZC3A 3B78A 4PC3A 2HOEA 1ETYA 2VE8A 5LLQA 1BL0A 3N4MA 2VPLA 3CCLI 1MJAA 1EFRA 3N90A 2MC4A 4CHUA 4NK8A 4W1UA 4F52A 1YIJB 3C2GA 4U88A 1KJZA 3OZVA 2VYQA 3BTIA 2CUFA 3DKXA 3H0DA 4P3IA 5IYWA 3QU3A 2A3SA 1RMGA 1FP2A 4UHTA 5FLXK 2QYUA 3OFNA 3V8JA 1AOYA 3QP5A 3A8KA 3NAUA 3KP5A 3VOEA 2EINH 2IGKA 1YW8A 4X1EA 5JVTA 5J8FA 1I39A 3SHFA 1EH7A 4X0GA 3FWEA 1Q86D 3B02A 3CW2A 4X7CA 1R5GA 2Z3YA 3LQ6A 3RYPA 3F22A 1BR4A 5FKLA 1SAUA 3BG3A 2NXNB 2TCTA 3QYFA 4ESJA 2WR8A 3E97A 4QUZA 4YIFA 4A0YA 5IY5H 4WK8F 2GM4A 1B4AA 1U9NA 2Y69H 2ZNYA 2RC4A 1W35A 1IRGA 4WF2A 1HCRA 4E7LA 4Q48A 1XMAA 2X48A 1X3WB 3RKYA 3OYKA 3QQAA 1DPUA 4MEXF 1BX1A 1IG7A 2L9VA 2O8XA 1E1QA 1YRNB 1EP1B 1SMTA 3GMEA 4FX4A 3ZMUA 3HM5A 1Z7UA 1R5ID 4ON0A 5DCMB 2N8GA 3ZN0A 2Y30A 2IA1A 4GYIA 1RQRA 4RS8A 1NK2P 5K1YA 3CC4B 2JMWA 2ZL5A 4N0BA 3GVKA 1YS6A 2TRTA 1J59A 3J80Z 2VFQA 2EA4A 3LSRA 2BVMA 2Y0SA 1U78A 1A36A 1D1AA 5J35A 1V54H 3FPPA 4LG0A 2PJRB 3EQLF 2P0WA 4HX4A 2LF8A 1Z7LA 4Z4ZA 2K9NA 3PETA 3CCLB 1OCZH 3MKZA 1IDZA 2M5WA 1CNEA 5LBQA 1O8KA 2Y2ZA 1PYVA 2VC0A 3PUMA 2F4NA 3AL0B 5JLVC 5DD8A 5F1JA 3WE2A 4FASD 1T6XA 5IYCJ 1HZEA 4PC1A 4I09A 3BR3A 4BDYA 1B23P 2UVFA 2D2WA 3HIFA 1ZTRA 4EQQA 3TEDA 1YLFA 4V2FA 1B9NA 4UZUA 1LPQA 3OV8A 4I7HA 4M3GA 2OF7A 2FMLA 4UUTA 3VSVA 3LSGA 3ONYA 2I5UA 1N0UA 3PENA 1HF2A 3SUCA 1IGNA 2D3NA 4FE7A 3OYHA 4GO1A 3ZQ7A 3BR6A 4X05A 3MEXA 3CD6I 3OE7A 3CC2B 2A07F 4PZJA 2ZITA 4AVZA 3L2QA 3GSIA 1O7FA 5IPAA 4HQMA 2DMPA 2GXAA 5D4SA 1SKQA 2RAEA 5L3CA 2Y9YA 3HRSA 3CCEI 4X8IA 4Z06A 4ZZLA 3AFHA 5FGMA 3U9GA 4RD0A 3WBJA 5HLHA 4XORA 1IN4A 1HDDC 1A6IA 4C9YA 3BR0A 3OJWA 1TYXA 1KU3A 1T33A 5BMZA 4UXNA 1HOMA 2JVHA 4D7NA 1YX3A 1TWFJ 4FN5A 4DYQA 1Z77A 4O3MA 2CV2A 2D1HA 4EGYA 1I6XA 5L3EA 3H35A 1X2NA 3ABKH 1JUMA 4TV7A 4UNOA 1BJKA 3G05A 5FO0A 2QLZA 5L46A 2ISYA 1O8JA 4R79A 2VBTA 4DQKA 3EUHC 1HKSA 1N07A 1P4WA 1R1VA 2WJVA 3PQKA 1NG7A 3IRRA 4ZDOA 2NSPA 3FM3A 1S4MA 2DK8A 2F2EA 2GQFA 3BG7A 3AL0C 1BHEA 5HODA 3ASNH 4AIDA 1OGIA 1X1AA 2R6HA 3CC7B 2KISA 2XB0X 2K9MA 4MFDA 3HTSB 4EW9A 2JA5J 1R58A 5F0CA 1YRNA 4OU0A 3QOEA 1YG2A 1WJDA 1PDNC 2E5NA 4A6EA 3FXUA 5DCMA 2E19A 2R93J 9ANTA 1D3YA 4KKTA 4G5GA 3G2BA 4NHJA 3SQNA 2ZB9A 2D1VA 2F5EA 2K9SA 1QVUA 1P7JA 1WFXA 3ESWB 1WU8A 1HG8A 2BM0A 3OYLA 4OZYA 1RUOA 3GW2A 1FYLA 3AVXA 1D0YA 1S9HA 2PJRA 2IT0A 3CMAI 2NS0A 3EUHA 1UD3A 2WB1A 1HW1A 3SKBA 3DLAA 3E3VA 4IHXA 1XFOA 4RDKA 3Q3SA 4WWCA 3T0YA 4J00A 3T1BA 3L2VA 2C6YA 2VLAA 1TLLA 1WRJA 1DU0A 4KITB 4YZXA 5A2QZ 2OBTA 1B72A 3LOCA 3DEEA 4KISA 3HPGA 3CCJI 2L7ZA 1S7OA 5TGTA 4ZYDA 4YFKF 3L2WA 2XAGA 1FSHA 2PG4A 5F4MA 5FL7A 1MGTA 2FMYA 1S29A 3ZMZA 3DF8A 3GO5A 1D5VA 2BY1A 4UVCA 2X1CA 2HQRA 1MH4A 3MKLA 5HXBA 1BC8C 2VKHA 3WNDA 4M9SA 1NH3A 2BBYA 2C5BA 2X6OA 5GAEJ 4KMFA 1RPWA 2IQ7A 3RPUD 2AHQA 3CMYA 4DYRA 4QHYA 3WY9A 1PLUA 4OIPF 2IBDA 2CMPA 3RDIA 2DN0A 1W7PD 5F0HA 1Z1DA 3CCRB 1V55H 1ZM9A 3ZZ0A 2K4JA 2KL4A 2JPBA 3LWFA 1I6HJ 3DXJF 5CVRA 3RCOA 2F1MA 4P1WA 3OL4A 3VYRB 4XL9A 2EIXA 2VQLA 3ZCOA 3CCQI 4UV9A 2GXGA 4GRIA 3HC7A 2XNJA 1L0OC 1KTWA 3WNBA 5E8IA 5DS9A 1XSXA 2FBKA 2W48A 4RAZA 4U7BA 5E20A 2GLOA 3BCDA 3MQ0A 3PUNA 2VFMA 1OOCA 2P7VB 3ZQHA 3KEYA 1SVMA 5AONA 1WKMA 5BS6A 4Z03A 4V19K 2LC2A 3LJYA 2DDBA 1KCDA 2ODLA 1Q1VA 5E17F 4OAZA 1WWXA 3GQ9A 3H9QA 5CVVA 2QF7A 3RY8A 2RQPA 2XAFA 3K2AA 3ASPA 3N97A 3CCJB 4D5CA 2WWYA 5ILVA 4OM9A 1ETXA 1GVDA 3HGYA 1R71A 1H0MA 2ZZEA 3P5JA 1O8DA 1SAXA 4JQFA 4A3GJ 3M8EA 4C2UA 2BY3A 2HNHA 2GREA 2INUA 5EGOB 2MBFA 4M3EA 4BY7J 2G0YA 3HOVJ 2ICWG 4ZTFA 1S8NA 3KE2A 3ZQGA 1XSDA 2V7WA 3LL7A 3VODA 5HNFA 4PMHA 1VF7A 5HKKA 3JSPA 3SJMA 2KFDA 5A88A 1YX2A 2M7AA 4FCYA 3S93A 2B5OA 4BHCA 1M1KD 1D2EA 1WOPA 3HSRA 4J0QA 4KN4X 3OEHA 1WJEA 3AK5A 1R5NA 4MGRA 2VNKA 4PSWA 4AWXB 1FOWA 1IJFA 4MO7A 1MMDA 1VHEA 3TOBA 1O8MA 2G7UA 4KJZA 2K4BA 2L7KA 3S1MJ 3EQOA 3MKWB 4Y7NJ 4XR6A 5J1YA 4LB5A 2E2JJ 1BPLA 3LA3A 4QPQA 2WJYA 2O1DA 3ZPPA 3ELKA 3HZJA 3V7RA 4GDFA 3OYEA 1ZGAA 2XSJC 4EJUA 3A0HC 1OLTA 5C44J 4MTDA 1G7RA 3FF5A 2D9RA 1RESA 1I5ZA 2F6CA 4XLNF 4HE5A 3SZPA 1ZG1A 4HF2A 2DYSH 3KZZA 2ZXIA 2FEZA 1VQ9B 2EFOA 1O3SA 1U2WA 4ZDLA 3OOPA 3R6JA 3GTOJ 1FNDA 2BVNA 2O3FA 4GYGA 4DK0A 1BR1A 1JKRC 4MYTA 1R23A 3M9AA 1CQTA 5C4XJ 4EVIA 5IT9K 1T6SA 1ZKGA 3KPHA 5E18F 2MLKA 3EUAA 4EGZA 1G4DA 1JJ2B 5HS8A 3B73A 2LR8A 2DT6A 3J81K 4Y52J 2FQ4A 1J5YA 4O5VA 1Z3YA 1UZCA 3HPHA 3J7ZI 2BGCA 2NAZA 4J19A 5M5WJ 1IHMA 3QPLA 5J8CA 1HQCA 1BM9A 4A0XA 3SFIA 3TKYA 2M7BA 3FBNB 2AS5F 2Q6LA 1RNLA 5AMVA 1QA2A 1WSRA 1GJRA 1S7AA 2NTBA 3JQPA 4AYBN 5IYRA 3LSMA 1QPIA 1OPCA 4NK6A 2BVLA 4PFOA 2FXAA 4FQGA 1X2MA 4ITVA 4QSHA 3QYEA 4IVNA 1J2XA 2E71A 4LLNA 2VBWA 3QWLA 2DA3A 1QBJA 1I18A 2DTZA 5EGOA 1JGGA 5L3FA 4OPOA 2XHKA 1IF1A 2M5SA 1D1NA 4HG2A 3VSKA 3J7YJ 4E7IA 2GA2A 3UW0A 3ZSCA 3F8BA 2HYFA 2XGDA 4OJOA 5M5YJ 2MW8A 4Z4TA 2BZTA 1BIBA 4RA2A 4M3DA 3T8RA 2CRVA 2GA1A 2OCEA 5FD6A 1U6GA 2A6HF 3OYCA 4ASUA 2LOOA 1FNCA 2ZXHA 3RQIA 3PSZA 2IJLA 2HOSA 1HBXG 2DU9A 2YR2A 4U0VA 1YTYA 3SXYA 2KIFA 4RGXA 5LEJA 3WU1B 1UHSA 4RBOA 1K4TA 2EFGA 1OYYA 3KLNA 2ZXWH 2FNPA 2JWTA 2M9HA 3QYBA 4A12A 3QFSA 3HSFA 4BL0B 1EZGA 4OIQF 3IH2A 4D1QA 2VBZA 1T8IA 3OEEA 4JOMA 1FIPA 3MKYB 4HDVA 3L2UA 2BHYA 4U9UA 2EFWA 1CGPA 3RIRA 4YFNF 4Y17A 4OJLA 3SZGA 1DUXC 5L3DA 2CK3A 1CLWA 2E2HJ 2IGNA 4RB0A 3CLOA 3GYHX 2CQ7A 3VO1A 4UB6C 3TO7A 2J5PA 2OQRA 3K4LA 5EF6A 1K7AA 5FD5A 1GR1A 4B3FX 1NB9A 4TMVA 3BCBA 2YU9J 3CMEI 5L3GA 1I3AA 3HRMA 5GTHC 2P6SA 1FBSA 1M90D 1ZGJA 5EYRA 4AF7A 1OFMA 1PE9A 2VODA 3BR1A 2D3LA 3ZMTA 3PO3J 2EIKH 2PMZN 3NEUA 4RAGA 3E6BA 3QPTA 1TWAJ 5D5XB 1IDYA 3CCMI 2NRAC 1VI0A 2ETHA 1BR2A 3FKSA 1QGPA 4UZFA 5E3LA 3VNVA 2HKOA 4UZEA 1IRXA 2IW5A 5FLMJ 3GZ5A 2DA6A 1ZRFA 1LDJA 2Z5UA 3FX3A 4BH9A 1Y0RA 2V6CA 1XMKA 4G6IA 3F6VA 3MN2A 4NDLA 2PMDA 2OBSA 2JZYA 3IAS2 1UD8A 4A3DJ 1ZK8A 2CFOA 1R5BA 2J8KA 4MLOA 2CO5A 1W9XA 4FT8A 1RI7A 4MHGA 1LFUP 2F1LA 2DFEA 1ZGWA 2VBUA 3MFKA 2ZZFA 2DYIA 1YJ9B 2IGMA 3CCVB 1ZLJA 1RIOH 1M1EB 4KIGA 4XLFA 2H6CA 5EZGA 2HVQA 2UZKA 1P4XA 2ZCWA 3GRHA 1BJAA 4P26A 2HDCA 1FRNA 2QYOA 2LK2A 2A6EF 5C4JJ 2FVGA 3ULQB 2O7OA 1A6QA 1QPMA 3N05A 1GAWA 3ZBTA 2JA2A 3LMWA 4HX7A 2Q2EB 4DNTB 1Z3XA 5HLTA 3W2IA 2VNJA 1TW2A 4IRIA 1VQ6I 1SFKA 2XZLA 2LH9A 3KP2A 1OKRA 4RLZA 2JVGA 3FKJA 3P9KA 4I0BA 1JKOC 1D0XA 3M1CA 2W82A 3SLDA 2RC6A 4X07A 4ROXA 3J80K 3K6GA 3K4MA 3BC8A 2CRGA 2K3PA 2KT0A 4LK0F 3OYIA 1SFUA 2NS8A 1AU7A 1BI2A 1LVAA 1VJSA 1IN7A 4DIQA 5THXA 4E0FA 1T98A 2V9VA 3ZQQA 3SZEA 4L9TA 1K8FA 2X6YA 4BE2A 3NRVA 1G2HA 1WZ2A 2CQQA 2JRMA 3HYIA 3TOAA 4IQJA 4BU2A 3JCUC 5J6XA 4WX9A 1O57A 2WV1A 4A3KJ 5K7FA 1XE1A 4ENJA 4C0SA 4OPVA 2M8GX 1MBJA 2VXZA 3QPHA 2K02A 2CC2A 4U0WA 2R5ZB 3MVPA 4BJ5C 2ZTNA 5D4RA 2DPDA 1XGOA 4BUPA 3W6KB 1XDUA 3LNQA 4NC7A 1UFMA 4DYCA 4L9NA 3ERED 3F3XA 1JHFA 3Q6QA 1KRHA 3P7NA 1ZR4A 3ZRGA 1PJ6A 5J3OA 3T5XA 5EZHA 1W36C 3LQEA 3AAFA 2DLLA 1TW3A 2F5DA 4IRGA 5FLVA 1J75A 2HOAA 1W0UA 3RQ4A 5F4OA 4CYCB 1G3WA 3WTVC 2Z9OA 2IPQX 4XRSG 4A2UA 4UAJA 2MABA 1QNTA 4AIKA 2PE3A 2GBYA 1W5SA 1IC8A 1RU4A 2WZPP 1BJZA 1D0ZA 3JX8A 1GO2A 4RD6A 4P2NA 1ZR2A 2WZNA 4I99C 2W57A 2OPTA 1R1TA 3F8MA 4A3FJ 1KZLA 1VQ4I 3KIOA 2QKMB 2ZZGA 3F0CA 2ELJA 5E3MA 2HKXA 2QQBA 2NVYJ 1ZG5A 3JRGA 2VZLA 1WPKA 3OS2A 2QWWA 4G6DA 4PABA 4PDKA 5GTIC 2W00A 4HV6A 2CS3A 4II3A 4HNVA 5JFRA 3G71B 2BV6A 4CICA 1Y8QB 3HEFA 1KQ5A 1V5GA 2Q2EA 5ICGA 3GVAA 3KP3A 2V1DA 4AM3A 2PBIA 1R5OA 1W4MA 4RAFA 3W2EA 3BQYA 4YEIA 1GXPA 2VUMJ 2EH3A 2VBKA 5C1CA 3FDYA 4A3CJ 3I0TA 5FFZA 5FKOA 3JQQA 4YAFA 5FB2A 1XB2A 1EV7A 2P5LC 4Z2YA 3DBLB 3QOPA 1QGYA 3HRUA 3OPOA 3RSNA 1VF9A 4OIOF 3DQVC 2CBXA 4Y15A 4I01A 4UUVA 3JW4A 2LFBA 4WZKA 3C7JA 4L18B 4M0LA 1FWZA 2R7WA 4DQLA 2EZKA 2LRDA 4LBZA 1MH3A 1TL8A 1FBQA 1WQ2A 2MFZA 3BQZA 2OQGA 3KETA 1FNMA 1FMWA 3D0SA 1N77A 4CXFA 4BYYA 2XTYA 4Z4VA 2F5FA 3K4KA 5A2QK 1NRKA 3LQRA 2W6IA 1VZ0A 3G73A 1FNBA 2R5ZA 3FMQA 2EK5A 2W25A 3F9KA 2F43A 2GJKA 3PNTA 2ZSHB 1IW7F 4RMNA 1I1GA 4XNFA 4F92B 1RZ4A 4A5MA 2O5RA 5ILUA 1K6OA 2MA3A 3DPTA 3I3LA 3SZTA 4PFPA 1VQ7I 3H0GJ 2XT2A 4W8RA 2DY1A 1Y6IA 1YOVB 4RD2A 2C77A 4CZCA 4OINF 4LBYA 4YZQA 3JRBA 1IUYA 4EJVA 3Q39A 5K5QA 4GXOA 2DETA 1QHHD 4CYCA 2VBMA 1E3ZA 3QFRA 1RRJA 4CGZA 2JQ7A 1V5EA 3VMVA 2XPUA 3V42A 3ZZTA 5E8GA 4X7DA 1QRBA 4R8HA 4BHBA 3BJ6A 1KYZA 4EH1A 3DBRB 1I7PA 5BPIA 1VQ5B 2BN4A 2QSGX 3WTWC 1LUJB 4IL6C 4OJ5A 4E70A 1WJFA 5B3SH 2EFQA 1TT0A 1POGA 3TO6A 2F4OB 2XAQA 4ENNA 3T53B 5F64A 4A3BJ 2V7XA 2YWHA 2XGCA 2LZJA 2C2WA 2VI6A 2Z8GA 3C1DA 1IXRC 4TMTA 2XV4S 5EEAA 1G3TA 5FKKA 5IYBJ 3KYLA 1RETA 3PJRA 1S5LC 1BOBA 5KSWB 1DPRA 4YC5A 2EBIA 3CCSI 3GQ8A 2A6TA 3L7WA 1WPCA 3M8JA 2OTJI 3BY6A 2WBMA 2JPCA 4G7WA 1TZLA 3NWSA 2HQNA 1J9IA 2JJ2A 3VYUB 4AD9A 1JUSA 2XSDC 2IP2A 3DEWA 1YIOA 2M45A 2L7MP 2OU2A 2X4HA 2BGIA 2AHOA 2XF7A 2EFPA 3ML6A 3D5RC 1VQ8B 3H1CA 1JT0A 4AYBA 2P8TA 2V7TA 3HL2A 2DA5A 4F3QA 2HDNB 4KIBA 3GF2A 2X6XA 2K40A 3B6CA 3PFYA 1W0JA 2PMUA 3OJXA 4OPWA 3NAWA 1YQAA 3NB2A 1QA1A 3FHZA 3A8IA 4YELA 5JLWA 2BM1A 1LLWA 2L9RA 1K78B 3UKGA 2EZIA 3QSYA 3U1KA 5B5EC 3OKXA 1HDPA 3AVUA 3ERMA 1YITB 3IAM2 2JUGA 4L5JA 1K5CA 5H5JA 1OR7C 1HSJA 4S04A 4CO8A 4EJOA 4LGWA 4CCLA 3HOSA 1FDRA 2EZHA 4NUBA 2XASA 1MNDA 3KFWX 2NVXJ 5KNLA 3C18A 1UD5A 1K73D 2KZVA 2EB7A 1R4MB 3O3KA 1SVOA 2HQ5A 2O0YA 4N9IA 2HR3A 2P4WA 3CF5F 1OGMX 4PGGA 3OYNA 1W34A 2QTZA 3CCSB 4MNUA 4W8SA 1YJWI 3A3GA 4IW3B 3JTHA 4NBSA 3P26A 4M4SA 4EV0A 1OGOX 3SEJA 4M6YA 1G59A 1X4PA 2YU3A 3VSUA 4D9JA 1QA6A 1DG1G 2M0MA 5TV2A 3WTSC 1OR7A 2VNHA 1WMRA 4NCNA 2FU4A 1JNYA 3FZVA 4ENKA 4LG3A 1K8AD 4M1KA 1HSTA 4DZPA 4HRIA 2OBPA 1TVCA 1ZH5A 1QQIA 4A3EJ 2FBHA 3PM1A 2BM5A 4YFXF 4G6QA 3AGPA 2L3DA 4C3JJ 2A05A 2ISZA 1JGSA 4CCKA 1RR7A 2AXTC 5DM7F 3CJNA 4L5EA 3N6ZA 2QEXI 1BBYA 1CZFA 2L4AA 2VXDA 1YHQI 1KQ0A 2X0LA 3FM5A 2FRHA 1KD1D 2DERA 4L8JA 4EM1A 2K7LA 3GTMJ 1BQEA 3MCAA 3OZWA 4RJLA 4Q4ZF 2NZMA 1O3TA 2IOUG 1ODDA 1QUFA 3K10A 4RGUA 1LEBA 5HZBA 4X6AJ 1YLOA 3AVVA 4YDTA 5HVQC 5IP7J 4M6XA 4Y4RA 4QVJA 4C43A 2E1MB 4N9HA 2DEUA 5HDKA 1P4AA 2X1EA 5CVUA 1XPXA 4OMYA 2X85A 2NVTJ 1R36A 4L0ZB 2R4GA 4HEA2 4J01A 2FF4A 2ZL7A 5B1AH 1VTNC 3PUFA 1P9QC 1MJBA 4XOTA 3ZPNA 3KP7A 3S14J 3D5LA 4N3GA 3D26A 3WGGA 4EJWA 3ZQCA 4F7DA 1K78A 4ZGQB 4RDUA 1ZAOA 4LBVA 2AQFA 4HYEA 4ZTJA 4TN1A 2ZNZA 2LSOA 1IB4A 1WJCA 4B4DA 4KN7X 4FWTA 1DDIA 4O6JA 1PJ5A 3M1EA 2LDUA 1QFYA 4WZEA 1K61A 2UUZA 3WBKA 3I4MJ 1ACIA 3LYCA 2CSOA 2RQQA 3OYAA 1WXRA 3VDXA 1TSPA 2VFPA 4HPQA 4RGRA 4A3IJ 2MC3A 2DIEA 4LIUA 3G4SI 2JN9A 4PJNA 3JSOA 1QZEA 1UB9A 3KCCA 2BF4A 2V4DA 2JJ7A 1WGXA 1O8EA 3Q5FA 2RREA 2EWNA 3BY1A 4WZTA 3CD6B 1IRZA 3G1LA 4HQEA 5TRDA 5BNGA 3A0BC 2X0KA 1N75A 4P9UA 2VT2A 2V5IA 4JMQA 3CCEB 4HZFA 1MBEA 1U3EM 2NT6A 1ONVA 1VQKI 4Z4UA 1ZELA 1BMFA 4YALA 2E1MC 4YRVA 3P4GA 1DGRM 1G3SA 2LKPA 3DPUA 4U7DA 3A1YA 1XQBA 2LYCA 2B7BA 2Z99A 3IWFA 3HKZA 1BC7C 2R0QC 1QVFB 5J47A 2V1UA 1QH0A 1W5CC 4M9XA 1WOOA 2NPFA 4RDJA 1HA3A 3ZXSA 2VN2A 2WAEA 5B66C 5GAGJ 3IV5A 3IKTA 3I59B 3KRGA 1VQNI 1IV8A 1Y0UA 3AVYA 2NNNA 2MD5A 1LM1A 3OIOA 2F5CA 5J1UA 3A01B 4BXUA 4XD7A 1D8TA 3KEQA 3BG6A 5F4JA 2VOPA 4HLYA 2FE3A 2HLDA 3FMRA 3A8JA 5K7ZA 1RC9A 3TGNA 2QA4I 2CYYA 2WAQA 1EA3A 4D0PA 3GVLA 3K9TA 4FE4A 2YS9A 4BBSJ 2VE9A 1APLC 3DEUA 2V9PA 3BZCA 3WWGA 4M3BA 3TDUC 3JR9A 2ZMEB 3ROUA 1OCTC 2XEXA 1R5HA 1SANA 3ABTA 4Y3OA 3PFIA 3REOA 4F93B 3L1PA 3ZMSA 1YI2I 4B48A 1QCXA 1LNWA 2D5VA 2COBA 2IEKA 1GHCA 1FSEA 1KGSA 3H9JA 5B6IA 4DNRB 2LY2A 3LA7A 2ZBVA 2HMAA 4OP7A 3OYGA 3PL8A 3BQJA 2JSPA 3K69A 3CMAB 1COWA 3DDYA 1J7KA 4BKXA 4AIHA 4MEYF 1EFTA 1IA5A 3DU5A 2VBYA 4LIVA 3QODA 2CUZA 4QV2A 2JIZA 1N25A 2LY9A 2V7FA 4C3HJ 1U8RA 4KH3A 1BIAA 2E1NA 4Y9UA 2G9WA 3PIPF 4E7ZA 1ON2A 2PMHA 4M74A 1DABA 3U2RA 1Y0YA 3O8GA 1VHOA 4B09A 4BXFA 1SM4A 3M07A 1R9TJ 2BE5F 2FOKA 4P6VF 2Z6BD 1KC8D 2PN6A 1YO5C 4WXHA 4OPSA 2DODA 2HZDA 3V7SA 1WSUA 2IXSA 4IEJA 2L01A 3HBLA 3TDZC 1RKWA 2LP0A 4PJ0C 4CA0A 4AIJA 1B6AA 4Z4SA 4HWVA 2B63J 2L4MA 1F60A 3E5UA 4L9JA 2Q6KA 4A69C 3PA1A 1J0RA 3G1OA 4ZH4F 2Y9ZA 2L7FP 5F04A 4HW0A 3MZHA 2ZMEC 1T0FC 5HOOA 3R6SA 2DQLA 3HRTA 4KT5C 3OYJA 2AO9A 4OOSA 4N4NB 4OAYA 3MHPA 1R4NB 2J8IA 2QE7A 3BZ6A 5D8KB 2FNAA 4PAAA 4CCOA 5D8LB 3ML3A 3CCQB 1KK2A 2DT7B 2BOLA 3I59A 2R7UA 4RM2A 2P81A 2UXXA 3HUGB 3I71A 3IH3A 2CGPA 2ID6A 2RNJA 4IHSA 3KL9A 3A01A 2HYJA 1FLIA 2VONA 5ERIA 3RI4A 1FOKA 1BW5A 3BROA 4PC6A 1IUFA 4XSZF 4A93J 1CQXA 2MD0A 3FK6A 3J7AY 1TYWA 2NNYA 2BY0A 2QCOA 2DXIA 2HI3A 2E60A 2H1LA 2ESHA 4HLXA 2EV6A 4RCZA 3WG9A 3BC9A 5KHDA 3HOWJ 1IO2A 5DCFA 1T0FA 1S6LA 3S3NA 2QQ9A 4WWVA 1OB5A 4G94A 5DDGA 3CRZA 3R0JA 3JAMK 4Q47A 3MZYA 1FIAA 1I1SA 4K2EA 4ZJZA 2HOTA 2KKOA 3HTUA 1S0UA 5CVIA 4NC6A 1KZHA 4KNYA 5IOZA 2IS2A 1V5FA 3EETA 4PGHA 5CVJA 1XGNA 2KMUA 2X51A 3TW7A 2VQGA 1KU9A 3DBHB 3AG4H 1LE8B 1E43A 2VNIA 3E6CC 1VQPI 1U8BA 4M9ZA 3WGHA 2OUMA 5KW9A 1MBFA 4Z6YA 2M30A 4XKWA 4ZCLA 2DA2A 2OTLI 4TMWA 5IT3A 1ETKA 3OW2B 1ETQA 2R7QA 4QWQA 3SYTA 2I1LA 3FBIB 2IVMA 4PJJA 3WYAA 4ZCIA 2DJNA 3P9CA 5E6TA 1PXZA 1N08A 4XBFA 2Q8KA 4I02A 4MQVA 4BPRA 5D5UB 3S1RJ 3WXMA 2CW5A 5ICEA 2E35A 2DCUA 2PLFA 4Z4RA 4XSXF 1DP3A 1NJID 3H3ZA 1X58A 1KQSB 2LG4A 3U6KA 3WTZA 3K1PA 3FIWA 3I5UA 2X8KA 4BQOA 2CV0A 2Q6IA 1XCVA 5J3LA 4TKOB 1UAAA 2M2EA 2XPVA 4X7FA 2HVRA 1SC7A 4HE6A 1PP8F 4M6VA 4F55A 5LEKA 2C4TA 2IRFG 4YAOA 3KEOA 3K70C 2YUHA 3A1PA 3ASTA 4MQ9F 3A3BA 2KIMA 1MMSA 3S8PA 1B1BA 2BV3A 1QO0D 1XMXA 1GV2A 3OOCA 2HDDA 5IYQA 3K1MA 1ZM4A 1O7LA 2FA5A 2O03A 1ZYRF 3OAAA 4U4BA 4Q5SF 4ZYEA 1GXQA 4JRAC 4H9GA 3O6BB 3Q9SA 5F0FA 3F8NA 2R5YB 1ZUNB 4N3NA 3I1FA 2XVCA 3HUGA 2VQHA 3V8KA 2UVEA 3VFZA 4IOAF 2O0VA 2DA4A 2DYRH 1UG2A 3SEZA 2LVSA 1V4RA 2CUEA 1TNSA 2R7OA 3H36A 4C3IJ 3NQOA 3DCFA 4I76A 1L1IA 1ZQ3P 4LD5A 4BJTA 2MLGA 1DDGA 2X53S 1YX5A 1R22A 3EYIA 5ED4A 4E6KG 1VQOI 2ZC2A 3GTGJ 4BJ6C 3S3MA 2ZZQA 1IDJA 2A5YB 1NHCA 4RPDA 4EM2A 1UD6A 4PGOA 2Y0SN 2ZBKA 3GTPJ 5LHIA 4BE0A 2BM7A 2JSCA 1TTTA 4BQQA 2HPIA 1Y0NA 1TYVA 4P9FA 3BY2A 4M53A 2VBVA 1VFCA 1OISA 3F6OA 1YS7A 4KMUX 1EJ9A 4G7HF 3W2WA 3OW7A 1LE8A 3L00A 1OGJA 2ZJQF 2GK6A 2FOWA 4LLLA 5DM6F 2K9QA 2OK7A 4CQJA 4BEHB 1W1WE 1MNMC 1BI0A 2DFIA 1F9NA 4M3FA 4OOIA 5H20A 4S05A 1A5JA 3OMYA 5HLIA 3GFJA 1S72I 1WI3A 2ME6A 3Q0WA 1Z0XA 3RJPA 3HOYJ 3T51B 3OYMA 5J40A 3BG9A 2R7TA 3PVDA 2FX0A 3R0AA 1JB9A 2CW8A 2EQRA 4YAUA 3BPXA 4ACAA 1BX0A 2KRFA 3CP8A 5FIUA 4CCNA 5FO5A 2XTXA 3W2FA 5JR3A 3S1QJ 3OS0A 3IH4A 5IP9J 4XQFA 4EMSA 1ENHA 1X1PA 1XD7A 2V7QA 4Y7CA 1WI9A 1J09A 3S2WA 2ID3A 1OFLA 2IAIA 3G6EI 1TP4A 4ABZA 5LGUA 3C2BA 1XCBA 4WCGA 2V31A 1KYWA 3KP6A 4JK1X 2DA1A 4FTHA 1VQOB 5JVGF 3VMWA 1XSVA 1QHGA 2W1OA 5GP9A 1W0KA 5HDGA 1JA0A 1JKPC 3S1NJ 2OCCH 4F91B 3I58A 2YWFA 2OZUA 1PUEE 3V76A 1X3UA 1X1DA 3CMEB 1QVGB 2R5YA 3LSHA 3ZQFA 2JUCA 1Y39A 2CQNA 3GTLJ 1MZBA 3LO8A 1FTTA 2HZTA 2VT3A 3HGGA 4FX0A 2MGQA 3W2AA 3HHGA 1LQ1A 1EFUA 2B0RA 1MJ9A 2V79A 1IAWA 1F43A 3CCMB 3A35A 1N8RD 1Z91A 1WDTA 3U2QA 4OJ6A 4W8QA 1K4SA 1ON1A 5IYDJ 3ASSA 5K7HA 2K85A 3ZP5A 4Y9RA 2QTLA 2HDWA 4OWRB 2WPDA 3RIQA 2LF7A 3CO7C 2RVCA 1XC5A 2UV1A 2CF4A 3B82A 2VFOA 2A61A 4G12A 1HA8A 1A35A 3H09A 2RV8A 1T08B 2VKDA 4CSWA 2XNCA 4L5IA 3M4OJ 2XB5A 4KKSA 1REPC 4FHTA 2WB1N 1ZREA 3H92A 2ZFUA 2HQAA 4ZCMA 1NHAA 5E3OA 1HXDA 1EFCA 1TWCJ 2HTSA 4UVAA 4XN0A 3VSLA 4XIDA 3LAJA 3GXOA 3GX4X 3Q38A 4XN3A 2XC7A 5CPRB 2XZPA 1IB0A 5TR9A 3CPWB 1LFBA 4HF0A 3Q6RA 2H94A 1LDKB 3S17J 4U0YA 1V3FA 4U87A 2E5ZA 2VJ5A 2DOAA 2OK8A 2BW3B 3WTUC 3PO2J 1I8DA 1OFDA 3I54A 1OQYA 2B0LA 1VQLI 4ENMA 3QU6A 1PUFB 1AIRA 3V7AA 2K5CA 3MMPA 4YHBA 1U0JA 1VQ6B 1CNFA 2XIGA 1ZHFA 1VLOA 1ZRDA 3FKIJ 2W7NA 3OZUA 4JX6A 1IRFA 1BN5A 2EA2A 2KJBA 2WADA 2FX3A 2J7KA 2K9LA 1XG2A 4CDGA 1Z6TA 3WU2C 1FC3A 5FJ8J 3F72A 1KK1A 2ZO4A 2QX3A 1UMKA 2ELHA 5JHFA 1GV5A 2LY1A 1T2KA 5BSYA 3DWLE 3FXMA 3OL3A 5H6RA 2HEOA 4IX7A 2XUBA 1UHWA 3SFZA 2O04A 3ASRA 1W5TA 2DDAA 2K27A 1WJ5A 4PC2A 2DAOA 3EQNA 3ZQLA 4BQAA 2Y0MA 5HDNA 1IN5A 2YX4A 4KT6A 2V1NA 3CJRB 3S2HJ 3Q3AA 4CUGA 3JREA 4ETSA 1UD2A 4E7JA 5F1RA 1RWRA 3SJZA 3B6AA 3J7AO 3TH0A 4P25A 4RD1A 2PYHA 3EPZA 3H5NA 1YFHA 2ADUA 4XMYA 1E1RA 2GJPA 2W6JA 4G1BA 2FSWA 2KP6A 2XC1A 2TDXA 3ZN1A 1FTZA 4TMZA 1QZYA 3R4KA 4YIRX 2IS4A 2XRNA 4UV8A 2ME0A 2OYNA 2PX9A 1EKEA 1LB2A 2VBXA 2R9VA 2DT5A 1MDMB 2P5KA 4P55A 1E79A 2V1XA 1E17A 4G7ZF 2BPOA 5DYMA 1MBGA 5FO1A 1H8AC 5A8AA 1DDNA 2F5VA 1D8KA 3S16J 4LBWA 2LD5A 1AIPA 2NVUB 2K3FA 4E7HA 4FXUA 4P1VA 5BSXA 3BTJA 3M3YJ 2C5HA 1QA3A 1R00A 2ZXJA 4JYKA 1KTVA 2CQXA 3R6KA 2L9NA 3MAJA 1VQ4B 2BEOA 4ZYAA 5LRSA 4P6YA 4B3GA 2K86A 1HKQA 4BGDA 5EG0B 3G3ZA 4LC0A 3HOXJ 4KFCA 2P7CB 2XKOA 4XKVA 2QQ8A 3OSFA 1BI1A 1HW2A 3ECOA 3MMYB 1ULYA 2FUG2 3LFUA 3MWMA 2DFHA 5KAFC 2VBSA 2BW3A 4H4KC 4EATA 1E3XA 2OZ6A 4G9YA 2YSRA 1KCCA 2ECCA 1WJBA 1YIJI 3E6DA 3RYRA 2QUFA 1PUFA 2C4UA 4KUMA 1O8LA 1FY7A 1DQUA 3QFCA 4BNCA 1MBKA 4UUSB 4Y33A 3ISXA 5FKNA 2JTVA 2GXBA 4BE1A 4PJMA 3CDLA 1ELOA 3CB4A 4LJZF 3IKVA 1WJAA 3JRIA 4NBQA 2DI3A 3OR1C 3OIQA 1FEXA 5E3NA 1D1CA 2CW0F 2ESNA 4BS9A 3VO2A 3BLYA 3GZ6A 5HZAA 2HXOA 5CQEA 1MIJA 1X1BA 1NB0A 2HVSA 4I84A 4DOZA 1QUEA 4NNJA 1GT0C 3ASOH 3JRFA 2JA6J 2BSAA 3ISPA 1W7PB 2YPRA 2MH2A 3KYCB 4DBQA 3I56I 3VWBA 1LFPA 3FHNA 3K1NA 4OOXA 3GUDA 3ZGKA 3H5AA 3PIOF 1JJ6C 1W2BB 2XTWA 2M3AA 1QFZA 2KIQA 4P3YA 1KA8A 3LA2A 1G7SA 5D6EA 1IXSB 4I0AA 1XN7A 2Y75A 1ETWA 2VPRA 2AXLA 4B43A 4L9VA 4DGWB 3CZ6A 1FX7A 2JA8J 1PVEA 3ABUA 4X7EA 1VQ7B 4L0YB 1QU3A 2NV4A 2VBEA 1WH5A 3JRCA 1JTYA 3SQVA 2CV1A 3QFTA 3CESA 3K7AJ 2DOFA 4RAYA 2FQ3A 3AG2H 1NBMA 1T5EA 1OHHA 2DW4A 1IV6A 1MDMA 1ZN2A 2A5WA 1SEUA 2OC6A 2P5VA 2DFFA 1JT6A 3OSGA 2FD5A 3TQNA 1H8EA 3CJQB 1KK3A 3JQRA 2CJJA 2INVA 1TBXA 2O6GE 1W36D 3BJOA 1OCPA 3H3VK 3ECHA 2KHMA 3VMFA 3CDIA 1V0EA 1E62A 1IN8A 2PIAA 5M3MJ 1T38A 3A03A 1BI3A 1QQ1A 3GEZA 5EG0A 1MNEA 1ZM3A 5IP6A 3K4JA 4DK1A 1JUPA 4YZAA 4EM0B 2NOGA 2R3SA 5DUIA 2VKVA 2W7ZA 1OJLA 1XS9A 3RKQA 3D1NI 3CC2I 1TUIA 1E3PA 2QBYB 4P22A 4LLGF 3I56B 4MR0A 4C2LA 1GVJA 2KDZA 1U5TB 3W2GA 2OTJB 3DU1X 1MMNA 1USTA 2R92J 1Z9CA 4DZJA 2EV5A 4NC8A 4BHPA 5H2FC 3A2KA 2MSYA 4UUSA 3W2HA 3G1MA 4G8XA 2G0EA 5AIQA 4A6DA 3L9FA 3AVTA 3HHHA 4AC9A 1S7EA 4HBLA 3HOUJ 1G7TA 1K9MD 2M4GA 3BJAA 4B8XA 4B3AA 2HCJB 2CUJA 3W2VA 3WHCA 1OB2A 2KQRA 4I98B 3DLLF 5KK1A 4XKCA 3CQZJ 2M0CA 3RPUA 5CYVA 5FROA 3CMMA 2BSPA 3KLOA 4A3LJ 2O61A 3U21A 3OOUA 5M3FJ 1MKMA 1Y56A 2PLYA 2STWA 1RQPA 3B8YA 4V2GA 3QE2A 1W7PA 1B8IB 2PI0A 4IF4A 4BDZA 2D74A 1RR8C 1XB4A 1QX4A 1KMHA 4YZ0A 4PJLA 5DN6A 1D1BA 3FXLA 5B1BH 3CCYA 3CC7I 2L5QA 2PMZA 1N0VC 3GQAA 4LOCA 3OP1A 1LEAA 2CNDA 2MH9A 5K5OA 1RUNA 2WV0A 1H89C 4RD3A 1B72B 3ZBUA 1O8IA 1IZ1A 3FK7A 5JHUA 5TJJA 2ECBA 5IYNA 1AA7A 2L9SA 3DKWA 2F4MB 4DQ2A 2XDVA 4GFBA 5TISC 3GQBA 2DBBA 4YXWA 2C78A 2O8KA 1LLZA 3TL4X 5L3BA 2CH0A 1TQIA 3KX2A 5GPCA 1N06A 2H8RA 3MCZA 5ICFA 1ETVA 3TP3A 1LJ9A 3BPVA 4K1XA 3DTIA 1U5TC 4JP0A 1ZG3A 2CW7A 2OJED 3Q0VA 4LFUA 5DTDA 2KJCA 3TW6A 2A69F 4CH7A 1TYUA 4XICA 5JMCB 1QRYA 1YJWB 5E79C 1O3RA 1OFCX 3LSKA 1WP6A 1O3QA 2BYVE 3MZ8A 1DGWY 3BNWA 2RC5A 3DU6A 1YW9A 2O9LA 3LQQA 1I3QJ 3LSTA 4ZV4A 4RM0A 1HC8A 3TMOA 2VL8A 1SD7A 2H09A 2DA7A 3AG3H
chains in the Genus database with same CATH topology
4XLAA 2NTQA 4B44A 2KVOA 1OB0A 3PSFA 1GLNA 3NWTA 4E4HA 3BC9A 4W8TA 5KHDA 3N05A 3I9V2 4FETA 2R7SA 2GJRA 2JA2A 3S3NA 3LMWA 3PSIA 2GK7A 2Q2EB 4DNTB 1Z3XA 4N4OB 3OYDA 4MXNA 5HLTA 1ERDA 4ZJZA 1SFKA 4E7SA 1HVXA 2LH9A 2XZLA 2JVGA 2Q1ZB 3FKJA 2IS2A 1V5FA 4CCMA 1D0XA 3M1CA 2W82A 3OIPA 3HOTA 2KMUA 1E43A 2X51A 2DJIA 2VQGA 4XLHA 2HU9A 3K6GA 3K4MA 3BC8A 2K3PA 3OYIA 2V6EA 2OUMA 3GQ7A 3AKZA 4XKWA 2IS6A 3IP4B 2KRCA 1VJSA 2R7QA 1GQ8A 4LITA 3SYTA 3EUKL 4DIQA 4E0FA 3FBIB 3LSIA 4PJJA 3ZQQA 4C2TA 3VSTA 1PXZA 2X6YA 1DBOA 4BE2A 2V4JC 1MMGA 4RLQA 3OYBA 1VLYA 4IQJA 1MW7A 4BU2A 1DP3A 2LG4A 4ZC3A 2VPLA 2VXZA 2X8KA 3SEQA 1EFRA 4BQOA 2MC4A 2CV0A 4NK8A 4BJ5C 4TKOB 4F52A 1UAAA 2ZTNA 3C2GA 4BUPA 3DKXA 3H0DA 2HVRA 4NC7A 1RMGA 2VJIA 4F55A 3OFNA 3OY9A 3K70C 3ZRGA 2I8DA 2X6WA 1W36C 2IGKA 3A3BA 3S8PA 4X0GA 3DPLC 3JURA 3RQ4A 4XOPA 3OOCA 5C1EA 2M4KA 1BR4A 2QKLB 1SAUA 4BACA 1JI8A 2MABA 3OAAA 3QYFA 4U4BA 2GOXB 1PKVA 1RU4A 2WZPP 1D0ZA 4ZDPA 3H94A 4ANJA 2QXZA 4E7LA 2VQHA 3OYKA 2UVEA 2O0VA 1KZLA 3BCAA 3SEZA 2R7OA 4NQWB 1E1QA 2QKMB 3PNYA 2ZZGA 2ELJA 4BJTA 2X53S 1YX5A 3OS2A 4E6KG 2W00A 4II3A 2CS3A 4Z05A 4BJ6C 3S3MA 2ZZQA 4XONA 3BH4A 3GVKA 1IDJA 1NHCA 3E1SA 1UD6A 2BVMA 2Y0SA 1V5GA 4BE0A 2XF5A 2R7XA 1YE9A 4BQNA 1D1AA 3FPPA 2PJRB 4BQQA 2HPIA 2P0WA 1Z7LA 2W4SA 3OYFA 3MKZA 4IKFA 2VBKA 5C1CA 3FDYA 2VJ4A 1O8KA 2LREA 1PYVA 4C30A 4P5OA 3W2WA 3OW7A 3AL0B 2GK6A 3RSNA 4FASD 1HZEA 3DQVC 4BDYA 3DTKA 4BEHB 1VBLA 2UVFA 2R7WA 2LRDA 3UNGC 3OMYA 4UZUA 3CP2A 4TSFA 2MFZA 2NSTA 3VSVA 3T51B 3LSGA 3OYMA 1FMWA 3SUCA 2R7TA 1N77A 2D3NA 3OYHA 2CW8A 3PUBA 3K4KA 3OE7A 1KONA 2NT9A 1NRKA 4URRA 1K28D 4AVZA 3L2QA 3OWTA 2W6IA 1VZ0A 3CP8A 4CCNA 5HNHA 3F9KA 2F43A 2GJKA 3OS0A 4Z06A 3PNTA 3AFHA 3HG9A 5KCMA 2ZSHB 3K4NA 4RMNA 4XQFA 3T9GA 4XNFA 3OR2C 4F92B 2Z2SB 2O5RA 4XORA 2V7QA 3DPTA 3I3LA 1J09A 4W8RA 4PFPA 4C9YA 1Y6IA 2EWEA 1OFLA 4CZCA 3CF2A 2V31A 4YZQA 2JVHA 1YX3A 2WY7Q 4XM3A 3VMWA 2CV2A 2XGJA 1QHHD 2VBMA 1X1CA 1E3ZA 1QHGA 2W1OA 2VQCA 4HNTA 1W0KA 3H35A 1UG0A 1V5EA 3G05A 3VMVA 4RLFA 3V42A 4F91B 1O8JA 4R79A 3EUHC 1X1DA 2WJVA 1NG7A 4ZDOA 2PECA 2NSPA 3LSHA 1BHEA 3BG7A 3AL0C 5CQGA 4OJ5A 1X1AA 1WJFA 1TT0A 3W2AA 2K9MA 4EW9A 4CCJA 3T53B 1FX0A 2XOKA 3A35A 4PUSA 1E0EA 2NTPA 2LZJA 2Z8GA 3QOEA 2X1DA 1H80A 1WJDA 2XZOA 4OJ6A 4W8QA 2E5NA 3DKYA 4KKTA 1LVKA 3KYLA 2HDWA 4OWRB 3G2BA 3PJRA 2WPDA 3B90A 1BOBA 5FRNA 2JJ1A 2UV1A 2F4IA 4DJAA 4HIZA 3GQ8A 1WFXA 2A6TA 1WPCA 3M8JA 1HA8A 3OYLA 1HG8A 4OZYA 4QPOA 2WBMA 2VKDA 4CSWA 1D0YA 1S9HA 2PJRA 1Z21A 4G7WA 1TZLA 4KKSA 3NWSA 1UD3A 3VYUB 2JJ2A 2WB1A 3DLAA 2ZFUA 2KPMA 2HQAA 2R7RA 2XF7A 1LKXA 3D5RC 2KRHA 4XN0A 3VSLA 4AYBA 4J00A 3L2VA 2VLAA 4XN3A 2XC7A 4F3QA 5CPRB 3HL2A 4KITB 4YZXA 1PJRA 1SKYB 2X6XA 2XZPA 3DEEA 3PFYA 4KISA 3HPGA 3L2WA 5TGTA 1W0JA 3MD2A 1LDKB 5FL7A 4U87A 2E5ZA 2VJ5A 2DOAA 1QJVA 2BW3B 4YELA 3DTEA 4E7KA 4HSTA 1I8DA 4OZZA 4GQNA 2WY8Q 2X1CA 3K4BA 3GVJA 1AIRA 2K5CA 2VKHA 2IS1A 1U0JA 3IAM2 1O8HA 2JUGA 1K5CA 5LD2C 2DCEA 2W7NA 1OR7C 5LFAA 1X4OA 2WADA 3RPUD 3UR3C 2K9LA 2IQ7A 1XG2A 3HOSA 4CCLA 5CDFA 4NUBA 1PLUA 1KCCA 1MNDA 2CMPA 2QX3A 3VR6A 5JHFA 3H5RA 2LY1A 2KL4A 2LBFB 5KNLA 1UD5A 3DWLE 3OL3A 2KZVA 2F1MA 3RCOA 4IX7A 4P1WA 3OL4A 3VYRB 2O04A 4XL9A 1OGMX 2VQLA 3ZCOA 1WJ5A 1UELB 2XAUA 3EQNA 3A4CA 3OYNA 2QY1A 4GRIA 3HC7A 2V1NA 4KT6A 2VB6A 1R6RA 4W8SA 3CJRB 3A3GA 1KTWA 4CUGA 1OGOX 3B4NA 1UD2A 4E7JA 1G59A 4U7BA 1RWRA 1X4PA 3PNVA 3BCDA 3VSUA 4XLCA 3VYSB 4D9JA 1OOCA 3KEYA 2PYHA 3EPZA 3H5NA 1E1RA 4XMYA 2LC2A 2M0MA 2V9KA 2GJPA 4Z03A 2ODLA 1KCDA 2W6JA 3BCFA 1WMRA 2KP6A 4LG3A 4OAZA 3GQ9A 3H9QA 4HRIA 3K4CA 4OJPA 2IS4A 3SDBA 3HXLA 2ZZEA 1O8DA 3ZIAA 1DBGA 4JQFA 4CCKA 4C2UA 2R9VA 2HNHA 2INUA 1E79A 4HNUA 1CZFA 1MMAA 2VXDA 4ZTFA 2F5VA 3LL7A 5HNFA 4E7HA 4FXUA 4PMHA 4L8JA 1VF7A 5HKKA 3D5SC 2NZMA 2AQEA 4G6TB 2L2OA 2WAFA 2M7AA 3K10A 5IK2A 3S93A 2L9NA 2O0WA 4ZYAA 5HVQC 4Y4RA 4B3GA 4BGDA 2E1MB 3OEHA 1WJEA 2X1EA 4XKVA 2IGOA 2X85A 4PSWA 2R4GA 2VJJA 3LMMA 1MMDA 3MMYB 4HEA2 4J01A 2FUG2 4KJZA 2L7KA 3LFUA 3NE5B 4KKUA 1O8MA 3EQOA 2X3HA 3MKWB 2BW3A 1P9QC 4H4KC 4XOTA 4XR6A 4EATA 3OS1A 1E3XA 3D5LA 1BPLA 1WJBA 3H9GA 4QPQA 3ZPNA 2WJYA 3HAGA 2O1DA 3ZPPA 2AQFA 1O8LA 3OYEA 4ZTJA 1DQUA 2XSJC 4B47A 1IB4A 1OLTA 1WJCA 4Y33A 2F6CA 4BE1A 1NG6A 4PJMA 1WJAA 2UUZA 2ZXIA 3OR1C 3OIQA 1T95A 1D1CA 4U49A 4ZDLA 4BS9A 3BLYA 2RQQA 5CQEA 3OYAA 3VDXA 1X1BA 4B3XA 1JTAA 4HPQA 2HVSA 1X0CA 4I84A 4DOZA 4DK0A 2LBFA 1BR1A 2UWMA 4NNJA 2DIEA 2MYSA 4LIUA 5CKTA 3S3OA 4PJNA 4DBQA 3EUAA 3VWBA 2V4DA 1LFPA 3FHNA 3ZGKA 3LNNA 1O8EA 3H5AA 2RREA 3VYTB 2DT6A 2M3AA 1N75A 1Z3YA 3HPHA 2V26A 4II2A 1O8GA 1UD4A 4JMQA 4B43A 2NT6A 4DBRA 2M7BA 3FBNB 4DGWB 3CZ6A 5AMVA 1JRGA 1ZELA 2NTBA 1BMFA 2E1MC 4YRVA 1QU3A 2KDOA 2ZSIB 3LSMA 1DGRM 2PYGA 3DPUA 2VBEA 2R7VA 4BEHA 3A1YA 2CV1A 4NK6A 2OV7A 2LYCA 3CESA 3HKZA 1MABA 2BVLA 4IZZA 4PFOA 4YEJA 4ITVA 3QYEA 1NBMA 1T5EA 1OHHA 3ZXSA 2WAEA 2A5WA 1I18A 3KRGA 2VASA 2OC6A 3IUOA 2M5SA 4G7XA 4HG2A 3VSKA 1O8FA 1O88A 1H8EA 3KEWA 3CJQB 3K70D 4E7IA 3UW0A 3ZSCA 2INVA 3ONQA 2WA0A 4XD7A 1W36D 3BG6A 4OJOA 2HLDA 2KHMA 2VIXA 1V0EA 3FY3A 5FRMA 3GVLA 1BN8A 2WAQA 1EA3A 2HPMA 3OYCA 1G8XA 4ASUA 2LOOA 3WWGA 1MNEA 4Z1MA 2ZXHA 3K4JA 4DK1A 4YZAA 3JU4A 4Y3OA 4F93B 2RNGA 4B48A 1QCXA 4XKBA 3L2RA 4P22A 4MR0A 4C2LA 3QYBA 1WTHD 3H9JA 4BL0B 4DNRB 2NOJB 2LY2A 1MMNA 3S32A 4D1QA 3T56B 4NC8A 3PL8A 3OYGA 4JOMA 3OEEA 3A2KA 2JSPA 3MKYB 3L2UA 1X19A 1COWA 3DDYA 2GOMA 4OJLA 1IA5A 3SZGA 3DU5A 2CK3A 3W3CA 4LIVA 2M4GA 2WSSA 3QODA 1V0FA 2CUJA 2CUZA 4IQ4A 2IGNA 3W2VA 2JIZA 2KQRA 2V7FA 3E0JB 4PK4A 4XKCA 1N78A 1H8HA 2XF6A 5FROA 3CMMA 3ZR8X 2BSPA 4E7ZA 3K4LA 3U21A 3OOUA 3B8YA 1Y56A 4B3FX 4BXFA 1BLIA 3BCBA 1EE6A 2ZTGA 4BDZA 4YZ0A 1KMHA 1K6YA 4PJLA 5DN6A 2Z6BD 1D1BA 2Z1DA 4TT3A 1OFMA 4PSXA 2HZDA 1PE9A 2D3LA 2IXSA 4CA0A 2L5QA 2PMZA 3GQAA 3GBGA 2O17A 4HWVA 4AU7A 2KLOA 1BR2A 1O8IA 3FKSA 3RTRA 1AA7A 2L9SA 1IRXA 2XDVA 3GQBA 1T0FC 5HOOA 4G6IA 4YXWA 3OYJA 4N4NB 4OAYA 3IAS2 3TL4X 2CH0A 3KX2A 1UD8A 2QE7A 2CFOA 2XNDA 4MLOA 1W9XA 4CCOA 1IDKA 3DTIA 2CW7A 4HSRA 2DT7B 4CH7A 2E1BA 2BOLA 2ZZFA 2R7UA 4RM2A 3C2HA 3HUGB 2IGMA 3LSKA 3WQZA 1WP6A 1DGWY 4XLFA 3DU6A 4RM3A 1FMVA 2HVQA 3TBIA 2Z16A 2JDIA 4XLEA 2MD0A 3TMOA 3J7AY 2VL8A 3GRHA 3OPOA 2DXIA 2E60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLA A;  2NTQ A;  2VBE A;  2PYG A;  2QX3 A;  4NK6 A;  2NST A;  4W8T A;  3VSV A;  4YEJ A;  3LMW A;  2O04 A;  4XL9 A;  1OGM X;  3SUC A;  3EQN A;  4MXN A;  2QY1 A;  4W8S A;  2NT9 A;  4URR A;  3KRG A;  1KTW A;  4AVZ A;  1O88 A;  1O8F A;  1OGO X;  3B4N A;  3UW0 A;  1RWR A;  2INV A;  4Z06 A;  3VSU A;  3ZSC A;  4XLC A;  4XQF A;  1OOC A;  4XLH A;  3T9G A;  4XNF A;  4OJO A;  4XOR A;  2PYH A;  4W8R A;  3GQ7 A;  4XMY A;  4XKW A;  4Z03 A;  3FY3 A;  1KCD A;  2ODL A;  2EWE A;  1BN8 A;  1OFL A;  1WMR A;  1GQ8 A;  3GQ9 A;  4YZQ A;  3VST A;  3WWG A;  1PXZ A;  2X6Y A;  1DBO A;  4OJP A;  4XM3 A;  3VMW A;  4YZA A;  2VBM A;  1O8D A;  1DBG A;  1QCX A;  2INU A;  3VMV A;  4MR0 A;  4C2L A;  1O8J A;  1CZF A;  4NK8 A;  2PEC A;  2NSP A;  4PMH A;  1BHE A;  1RMG A;  2NZM A;  2VJI A;  4OJ5 A;  4EW9 A;  2O0W A;  4OJL A;  1IA5 A;  2X6W A;  2NTP A;  2Z8G A;  1H80 A;  4OJ6 A;  4W8Q A;  3JUR A;  4XOP A;  4XKV A;  2X85 A;  5C1E A;  2VJJ A;  3B90 A;  2BSP A;  1O8M A;  3B8Y A;  2UVF A;  2X3H A;  3EQO A;  3GQ8 A;  4U4B A;  4XOT A;  4XR6 A;  1HG8 A;  4OZY A;  1KCC A;  1EE6 A;  1RU4 A;  2O1D A;  3ZPP A;  4YZ0 A;  1O8L A;  1OFM A;  2QXZ A;  1PE9 A;  1IB4 A;  2UVE A;  2O0V A;  3GQA A;  4HWV A;  2O17 A;  4XN0 A;  1O8I A;  4XN3 A;  4YZX A;  4U49 A;  2X6X A;  1JTA A;  1X0C A;  4I84 A;  4Z05 A;  4XON A;  1IDJ A;  1NHC A;  1QJV A;  4YEL A;  4OZZ A;  1IDK A;  1AIR A;  1O8E A;  1O8H A;  2VBK A;  5C1C A;  1O8K A;  1K5C A;  1O8G A;  4XLF A;  2IQ7 A;  2NT6 A;  5AMV A;  4XLE A;  1XG2 A;  1JRG A;  2NTB A;  3GRH A;  1VBL A;  1PLU A; 
#chains in the Genus database with same CATH topology
 4XLA A;  3HDD A;  2KVO A;  1OB0 A;  1T6Z A;  1GLN A;  1QGA A;  3W6J B;  1OCO H;  3NWT A;  3EYY A;  4W8T A;  4Y13 A;  3I9V 2;  4IHY A;  2GJR A;  4QVA A;  3PSI A;  3E7L A;  4IRH A;  4N4O B;  4IOC F;  2QBY A;  6PAX A;  1HVX A;  4B1R A;  4Z4W A;  3V4G A;  1U5T A;  1K4Z A;  2BXZ A;  2Q1Z B;  2GPJ A;  2QEX B;  4CCM A;  1VND A;  3OIP A;  1YHQ B;  5LHG A;  2DJI A;  2W84 A;  4XLH A;  1FPQ A;  2H1K A;  3GQ7 A;  2IS6 A;  3BP8 A;  2X9D A;  3CCR I;  1GQ8 A;  4LIT A;  3EUK L;  3ZUG A;  2FJ1 A;  4C2T A;  2VC1 A;  1IJW C;  1USS A;  2EPF A;  2V4J C;  1FT9 A;  1MMG A;  4BXX J;  3OYB A;  2XAH A;  3E5X A;  1N05 A;  5E1X A;  4IHV A;  2BY2 A;  1ZRC A;  5LMZ A;  1B8I A;  3SEQ A;  2IA2 A;  1D8J A;  5BOX A;  1YJN I;  1WCM J;  2GWR A;  1O4X A;  2BHZ A;  5EMN A;  1FOY A;  2JK3 A;  1TWG J;  1WH7 A;  2VJI A;  1FRQ A;  1TNT A;  2L02 A;  3OY9 A;  2QMU A;  3ZC3 A;  5FKM A;  3BG5 A;  2I8D A;  2X6W A;  4QTR A;  2GIV A;  2E1C A;  2QGG A;  3AVW A;  3DPL C;  2PJP A;  2BGJ A;  2HGC A;  4XOP A;  1AMO A;  4LMY A;  3JUR A;  4A3M J;  1WOR A;  5C1E A;  2M4K A;  2F48 A;  1WOS A;  1EF4 A;  4ASN A;  2QKL B;  3BWG A;  4BAC A;  1JI8 A;  3CLQ A;  1TT5 B;  1Y8R B;  5D5V B;  2GOX B;  1FZP B;  1HW5 A;  1PKV A;  3G4S B;  2P3M A;  5CLS A;  5K5R A;  4ZDP A;  3H94 A;  1DU6 A;  1C0W A;  5FFX A;  4ANJ A;  2QXZ A;  2NS7 A;  1MSF C;  1NDH A;  1WSV A;  5GAD J;  3ZOB A;  1YYV A;  3BCA A;  1EH8 A;  4RCY A;  4Z4Y A;  1SD5 A;  5IYP A;  2M8E A;  4NQW B;  2YWE A;  2E1R A;  3PNY A;  4D5F A;  1VQK B;  4S0H B;  1R49 A;  1ZM2 A;  2GAU A;  1HKT A;  3CTA A;  3GZN B;  5DNS A;  4Z05 A;  2E1O A;  3ZMV A;  4XON A;  3GTJ J;  4UY8 I;  3BH4 A;  2ZFW A;  3E1S A;  2EIM H;  4V02 C;  5M5X J;  2XF5 A;  2R7X A;  1YE9 A;  2DQR A;  4BQN A;  3FMS A;  4ZGN B;  1STZ A;  3CJT B;  1Q9S A;  2OBR A;  2W4S A;  2Y48 A;  3ASQ A;  1Z6R A;  3OYF A;  4IKF A;  1SVL A;  3FJO A;  4UB8 C;  2VJ4 A;  1YJN B;  1SMY F;  1ORK A;  2LRE A;  1VQN B;  4C30 A;  4P5O A;  1VQ9 I;  2PFB A;  5HLG A;  2V7V A;  3DTK A;  1VBL A;  1J9Z A;  3FXQ A;  3CPX A;  2QA4 B;  5E1Z B;  1BW6 A;  3UNG C;  1KK0 A;  1IXC A;  3CP2 A;  3WE3 A;  1H85 A;  4TSF A;  2DK5 A;  2B7C A;  2NST A;  5LRR A;  4CZZ A;  1Z67 A;  5FLX Z;  2Y31 A;  5DD4 A;  2LKS A;  3L2C A;  2XGE A;  5E1W A;  1YI2 B;  3PUB A;  3DFG A;  2QM3 A;  1KON A;  2NT9 A;  4URR A;  1K28 D;  2OA4 A;  3OWT A;  3ABM H;  1ETO A;  3Q0U A;  5HNH A;  3H9N A;  4RB1 A;  1BA5 A;  3HG9 A;  2GQQ A;  5KCM A;  3K4N A;  3T9G A;  3OR2 C;  2Z2S B;  1TQM A;  3IL2 A;  4P9S A;  1QZZ A;  1CF7 B;  1T6Y A;  1Q1H A;  2EWE A;  1XDS A;  1GUU A;  3CF2 A;  1D5Y A;  1KQ8 A;  3H3U A;  3F8F A;  3WU0 A;  1HLV A;  1WVR A;  2WY7 Q;  4XM3 A;  3WNC A;  2XGJ A;  3GLX A;  2CG4 A;  1X1C A;  2X3U A;  1XG1 A;  2ZME A;  2VQC A;  4HNT A;  3SYJ A;  3CUO A;  2QDX A;  1UG0 A;  3BTL A;  4NB5 A;  1B9M A;  1F1Z A;  4RLF A;  4I6Z A;  3AGQ A;  4B4C A;  4W97 A;  3W5H A;  5GV7 A;  5GAH J;  4X06 A;  4QFM A;  2XRL A;  2PEC A;  5CJ9 A;  2QQA A;  5CQG A;  3JRH A;  2YUS A;  4XRM A;  1JJ8 C;  4CCJ A;  4NQW A;  1FX0 A;  2XOK A;  5H59 A;  4PUS A;  5DV5 A;  1E0E A;  2NTP A;  3BH7 B;  1SD6 A;  2X1D A;  1H80 A;  3L09 A;  3BDD A;  5ILS A;  2XZO A;  2QVO A;  3DKY A;  1T39 A;  2MG4 A;  1LVK A;  3LSJ A;  2M87 A;  3QP6 A;  3B8H A;  3B90 A;  4I2O A;  5FRN A;  2JJ1 A;  1MBH A;  4TMX A;  1TLH B;  2F4I A;  4DJA A;  4HIZ A;  3KP4 A;  3F8C A;  2RDP A;  4OIR F;  2ACJ A;  4Q7J B;  3WG7 H;  4QPO A;  3JRA A;  2L0K A;  3KYD B;  4M72 A;  2BM6 A;  1Z21 A;  4AF6 A;  5A89 A;  4IXA A;  2NYX A;  1TTY A;  2KPM A;  4IJA A;  2WYR A;  2R7R A;  3CO6 C;  1LKX A;  2KRH A;  3HOZ J;  2RN7 A;  3I53 A;  2PQ8 A;  1YW7 A;  2ZKZ A;  2ZBU A;  5JLX A;  5BQT A;  2O6W A;  1PJR A;  1SKY B;  2XT4 A;  4M71 A;  2LNB A;  1BOA A;  3C3W A;  4XRF A;  1U2R A;  3HJE A;  4X0C A;  2Z33 A;  3ZMD A;  3MD2 A;  1EH6 A;  1FBU A;  3BR5 A;  5DEQ A;  2DMU A;  3X2Q H;  1Y1V J;  2Q6O A;  4WQM A;  5GPA A;  5C3E J;  1QJV A;  4E7K A;  3K2Z A;  3DTE A;  3I4P A;  2ZL6 A;  4HST A;  3VNU A;  1T56 A;  1XGS A;  4OZZ A;  4GQN A;  2WY8 Q;  3K4B A;  3M7G A;  1HF0 A;  4HOB A;  3GVJ A;  2IS1 A;  2BMW A;  2XPW A;  4RB3 C;  1O8H A;  2XKP A;  3VPR A;  5LD2 C;  2DCE A;  1OMI A;  2DOG A;  3SLN A;  5LHH A;  2EV0 A;  5F6F A;  1X4O A;  5LFA A;  4MFE A;  3UR3 C;  4AC0 A;  4RB2 C;  2E7W A;  4C2M J;  5CDF A;  1VQP B;  1JHH A;  3FXJ A;  3RKX A;  3GFI A;  1CF7 A;  5TY0 A;  3WHB A;  2OTL B;  2LLK A;  2QEN A;  2HTJ A;  1W0T A;  3VR6 A;  2DMN A;  3H5R A;  2LBF B;  1A8P A;  1EA0 A;  1FYM A;  2HWV A;  1EP2 B;  1KU2 A;  1UEL B;  2XAU A;  3A4C A;  3BTC A;  2QY1 A;  3W5V A;  3IC7 A;  2VB6 A;  1R7J A;  1R6R A;  1YJ9 I;  1OFE A;  3JRD A;  4KIF A;  3CCV I;  3DV8 A;  1EWY A;  3B4N A;  2CQK A;  3PNV A;  4XLC A;  3VYS B;  4MIM A;  5EEH A;  3ZPL A;  3ES9 A;  3QRF F;  5FNZ A;  1DP7 P;  4IPA A;  2V9K A;  4UVB A;  4LB6 B;  1RKT A;  3K0L A;  1DAR A;  1GAQ A;  3BCF A;  1AKH B;  1K79 A;  4MYU A;  1H9T A;  4RD4 A;  2F3L A;  3K4C A;  4OJP A;  2M1B A;  1I27 A;  3R61 A;  3GLL A;  3SDB A;  3HXL A;  4HAM A;  2P6T A;  5FA6 A;  2FBI A;  3ZIA A;  1DBG A;  2DOE A;  1PP7 U;  3Q9V A;  4R1H A;  2DMT A;  3GFL A;  1A31 A;  3GIR A;  4HNU A;  4AVP A;  3IRQ A;  4PCQ A;  1MMA A;  3GWZ A;  2Q0O A;  4R71 A;  2R7F A;  3TP0 A;  4ZYH A;  3O2P E;  4LK1 F;  3D5S C;  2EJR A;  2H27 A;  2AQE A;  1F36 A;  2ELK A;  4G6T B;  3RPQ A;  1QRC A;  2L2O A;  1E3H A;  1KQ9 A;  2WAF A;  3F23 A;  2V7U A;  2VFN A;  5IK2 A;  3V8L A;  1JKQ C;  2O0W A;  1TQP A;  2HYG D;  5DS0 A;  3COA C;  4DW6 A;  2IGO A;  2E34 A;  2VJJ A;  3LMM A;  3NE5 B;  1SD4 A;  1F4K A;  3ONU A;  4G1V A;  4KKU A;  4AUX A;  2EZL A;  2X3H A;  3OS1 A;  2JRT A;  2DPU A;  3H9G A;  2YWG A;  3HAG A;  2WC2 A;  5JBQ A;  4DNC A;  2DTR A;  3U1D A;  3BOQ A;  4B47 A;  3FXK A;  2EIJ H;  5BPD A;  2R7Z J;  2QZ8 A;  5F27 A;  2H8W A;  5KVR A;  2R7D A;  3QPS A;  1NG6 A;  3CCU I;  3M8F A;  1E2X A;  3E5Q A;  1E63 A;  3FIS A;  1T95 A;  1MRZ A;  1WHU A;  3V7C A;  4P12 A;  4U49 A;  1H42 A;  2GIZ A;  4B3X A;  1JTA A;  1X0C A;  2KIU A;  4HX8 A;  5H6Q A;  2LBF A;  5HS7 A;  2VOO A;  2UWM A;  2MYS A;  1S72 B;  1OYI A;  5CKT A;  1OYW A;  3S3O A;  3S2D J;  1QFJ A;  3BT9 A;  1G6N A;  3WTT C;  3LNN A;  5J1R A;  1FJL A;  2NVQ J;  3VYT B;  3ABL H;  3W5U A;  2G7H A;  1UD4 A;  1Q82 D;  2V26 A;  4II2 A;  4RGS A;  2A68 F;  5AIP A;  5ICC A;  5LGN A;  2QSH X;  3TO9 A;  4RDL A;  1O8G A;  1X3Z B;  4DBR A;  4IO9 F;  3O8H A;  1JRG A;  1L3L A;  2IA0 A;  2XAJ A;  4F7Z A;  2KDO A;  2ZSI B;  4EEF G;  2PYG A;  1AKH A;  2R7V A;  1P6R A;  3EDP A;  4BEH A;  4PC7 A;  2OV7 A;  3G71 I;  3G6E B;  1XGM A;  1EXM A;  3HKZ N;  1MAB A;  2QGU A;  3R60 A;  3I55 I;  2W85 A;  4IZZ A;  4HDU A;  4EJT A;  1MD0 A;  4YEJ A;  2I10 A;  1TWH J;  4ESB A;  4P96 A;  1A04 A;  3VB2 A;  2LMD A;  1P7I A;  3E6M A;  3P9I A;  1JXS A;  2E2I J;  2DO7 A;  2VAS A;  3IUO A;  4G7X A;  3QAH A;  5AN9 A;  1O88 A;  1O8F A;  2ZJP F;  3KEW A;  3K70 D;  4M2L A;  2LTP A;  2WA0 A;  1JTX A;  3ONQ A;  1OCR H;  3LFK A;  1FOX A;  3HB9 A;  1H88 C;  3SDG A;  2B9S A;  2J5O A;  4A5N A;  2VIX A;  3FY3 A;  3CCU B;  5FRM A;  2KZG A;  1BN8 A;  4H0E A;  2WAQ N;  5J4Y A;  4KIC A;  2BX6 A;  3FXR A;  1E3O C;  2HPM A;  3ZZU A;  3E1Y E;  2EFN A;  1F5T A;  4JBA A;  3T8T A;  1G8X A;  3CDH A;  4QLC U;  2W24 A;  3GFM A;  2RKH A;  4FIS A;  2H6B A;  4Z1M A;  4HA8 A;  3P27 A;  4YFO A;  1GDT A;  3JU4 A;  1QG0 A;  3I64 A;  4KYW A;  2RNG A;  1AHD P;  3W6V A;  1XTA A;  5JI6 A;  2JT1 A;  4XKB A;  4ESF A;  2XGX A;  3L2R A;  1V5V A;  1OCC H;  5D5W B;  2COM A;  5J4V A;  1I50 J;  1WTH D;  1VQM I;  2CU7 A;  1G7C A;  2NOJ B;  3AG1 H;  3SY2 A;  2PEX A;  3WOD F;  3S32 A;  1GVH A;  2B7E A;  1NK3 P;  4JX4 A;  3PSS A;  3WGI A;  1JA1 A;  3T56 B;  1B2R A;  3HSE A;  3S15 J;  1X19 A;  1NTC A;  2OD5 A;  4QIW N;  5IT9 Z;  1ITY A;  3BH6 B;  3JAM Z;  2GOM A;  2CFX A;  3PQJ A;  3KZY A;  4YII A;  3DP7 A;  3W3C A;  2GZW A;  2WSS A;  1V0F A;  3IHU A;  4IQ4 A;  3GTQ J;  5LGT A;  3J81 Z;  3E0J B;  4PK4 A;  1N78 A;  1H8H A;  4OMZ A;  4A0Z A;  4HF1 A;  2XF6 A;  3E20 A;  3ZR8 X;  3I55 B;  3CUQ B;  3U6B A;  2OAZ A;  3RZD J;  2BM4 A;  2ZJR F;  1BLI A;  1EE6 A;  2ZTG A;  2STT A;  1QVT A;  1K6Y A;  5EDN A;  1VQ5 I;  1VQL B;  2Z1D A;  4G7O F;  4TT3 A;  1W87 A;  4PSX A;  1QGZ A;  4XLP F;  5IOY A;  3WTY C;  1SFO J;  1B59 A;  4ZZD A;  3FPK A;  4MTE A;  5D6F A;  3GBG A;  1Y1W J;  2O17 A;  2XRO A;  2HS5 A;  4AU7 A;  2KLO A;  4WZL A;  4ACB A;  4IHW A;  1FNN A;  3RTR A;  5GV8 A;  4FK8 A;  3ZQI A;  4IHT A;  1PJ7 A;  3J81 k;  1P2F A;  3SJP A;  1SFE A;  4YG2 F;  1IN6 A;  1ZLK A;  1UHM A;  2YX7 A;  1Q81 D;  2XND A;  3GCM A;  3F21 A;  3JTG A;  4BBR J;  2RGV A;  4YAW A;  2QSF X;  2CWE A;  1IDK A;  4CYD A;  4HSR A;  5KAI C;  1IJE A;  3LAP A;  4JX5 A;  4HV5 A;  2E1B A;  3C2H A;  1FYK A;  1VQM B;  4D7M A;  3WQZ A;  3RZO J;  2WTE A;  4BY1 J;  1EP3 B;  1VQ8 I;  2E7X A;  1TC3 C;  4RM3 A;  1FMV A;  2HXI A;  3TBI A;  2Z16 A;  5HS9 A;  2L54 A;  2JDI A;  3I4N J;  4XLE A;  1P4M A;  1Z05 A;  1Q7Y D;  4BAY A;  3LVB A;  3CXC B;  1E64 A;  2BXY A;  2QN6 A;  1P92 A;  1G3Y A;  3VEP A;  1UCR A;  2UXN A;  2NTQ A;  4B44 A;  2LKX A;  1S3J A;  2ZJ2 A;  3BR2 A;  3PSF A;  4OOV A;  5DUK A;  4E4H A;  3FXO A;  3CUQ C;  4FET A;  1KU7 A;  2R7S A;  1JE8 A;  4GGG A;  1FP1 D;  4RPB A;  5DSZ A;  2JA7 J;  4KA4 A;  3GTK J;  1LDD A;  2GK7 A;  3BZK A;  1SFX A;  3OYD A;  4MXN A;  4A3J J;  1F20 A;  4LG0 B;  1ERD A;  1U9O A;  1YIT I;  1UMQ A;  3RKW A;  4E7S A;  3IWZ A;  4XRS A;  4XK4 A;  1ZAR A;  4WXD A;  2EIL H;  3HOT A;  4YCQ A;  3A02 A;  1H9G A;  3KZI C;  2HU9 A;  2D45 A;  1XX5 A;  2V6E A;  5EEG A;  3AKZ A;  3IP4 B;  3PA2 A;  1R1U A;  2KRC A;  4KDP A;  2HFH A;  3LSI A;  1MSE C;  3CC4 I;  1K83 J;  4M73 A;  5EJC A;  3VST A;  1DBO A;  3NAR A;  3LSP A;  4RLQ A;  1UJ8 A;  2QZA A;  1VLY A;  2DMQ A;  4ZYG A;  2M34 A;  3WTX C;  2E36 A;  1MW7 A;  3CUQ A;  2VKE A;  4GCV A;  5F08 A;  1AWC A;  2JN6 A;  4WXC A;  4ZC3 A;  3B78 A;  4PC3 A;  2HOE A;  1ETY A;  2VE8 A;  5LLQ A;  1BL0 A;  3N4M A;  2VPL A;  3CCL I;  1MJA A;  1EFR A;  3N90 A;  2MC4 A;  4CHU A;  4NK8 A;  4W1U A;  4F52 A;  1YIJ B;  3C2G A;  4U88 A;  1KJZ A;  3OZV A;  2VYQ A;  3BTI A;  2CUF A;  3DKX A;  3H0D A;  4P3I A;  5IYW A;  3QU3 A;  2A3S A;  1RMG A;  1FP2 A;  4UHT A;  5FLX K;  2QYU A;  3OFN A;  3V8J A;  1AOY A;  3QP5 A;  3A8K A;  3NAU A;  3KP5 A;  3VOE A;  2EIN H;  2IGK A;  1YW8 A;  4X1E A;  5JVT A;  5J8F A;  1I39 A;  3SHF A;  1EH7 A;  4X0G A;  3FWE A;  1Q86 D;  3B02 A;  3CW2 A;  4X7C A;  1R5G A;  2Z3Y A;  3LQ6 A;  3RYP A;  3F22 A;  1BR4 A;  5FKL A;  1SAU A;  3BG3 A;  2NXN B;  2TCT A;  3QYF A;  4ESJ A;  2WR8 A;  3E97 A;  4QUZ A;  4YIF A;  4A0Y A;  5IY5 H;  4WK8 F;  2GM4 A;  1B4A A;  1U9N A;  2Y69 H;  2ZNY A;  2RC4 A;  1W35 A;  1IRG A;  4WF2 A;  1HCR A;  4E7L A;  4Q48 A;  1XMA A;  2X48 A;  1X3W B;  3RKY A;  3OYK A;  3QQA A;  1DPU A;  4MEX F;  1BX1 A;  1IG7 A;  2L9V A;  2O8X A;  1E1Q A;  1YRN B;  1EP1 B;  1SMT A;  3GME A;  4FX4 A;  3ZMU A;  3HM5 A;  1Z7U A;  1R5I D;  4ON0 A;  5DCM B;  2N8G A;  3ZN0 A;  2Y30 A;  2IA1 A;  4GYI A;  1RQR A;  4RS8 A;  1NK2 P;  5K1Y A;  3CC4 B;  2JMW A;  2ZL5 A;  4N0B A;  3GVK A;  1YS6 A;  2TRT A;  1J59 A;  3J80 Z;  2VFQ A;  2EA4 A;  3LSR A;  2BVM A;  2Y0S A;  1U78 A;  1A36 A;  1D1A A;  5J35 A;  1V54 H;  3FPP A;  4LG0 A;  2PJR B;  3EQL F;  2P0W A;  4HX4 A;  2LF8 A;  1Z7L A;  4Z4Z A;  2K9N A;  3PET A;  3CCL B;  1OCZ H;  3MKZ A;  1IDZ A;  2M5W A;  1CNE A;  5LBQ A;  1O8K A;  2Y2Z A;  1PYV A;  2VC0 A;  3PUM A;  2F4N A;  3AL0 B;  5JLV C;  5DD8 A;  5F1J A;  3WE2 A;  4FAS D;  1T6X A;  5IYC J;  1HZE A;  4PC1 A;  4I09 A;  3BR3 A;  4BDY A;  1B23 P;  2UVF A;  2D2W A;  3HIF A;  1ZTR A;  4EQQ A;  3TED A;  1YLF A;  4V2F A;  1B9N A;  4UZU A;  1LPQ A;  3OV8 A;  4I7H A;  4M3G A;  2OF7 A;  2FML A;  4UUT A;  3VSV A;  3LSG A;  3ONY A;  2I5U A;  1N0U A;  3PEN A;  1HF2 A;  3SUC A;  1IGN A;  2D3N A;  4FE7 A;  3OYH A;  4GO1 A;  3ZQ7 A;  3BR6 A;  4X05 A;  3MEX A;  3CD6 I;  3OE7 A;  3CC2 B;  2A07 F;  4PZJ A;  2ZIT A;  4AVZ A;  3L2Q A;  3GSI A;  1O7F A;  5IPA A;  4HQM A;  2DMP A;  2GXA A;  5D4S A;  1SKQ A;  2RAE A;  5L3C A;  2Y9Y A;  3HRS A;  3CCE I;  4X8I A;  4Z06 A;  4ZZL A;  3AFH A;  5FGM A;  3U9G A;  4RD0 A;  3WBJ A;  5HLH A;  4XOR A;  1IN4 A;  1HDD C;  1A6I A;  4C9Y A;  3BR0 A;  3OJW A;  1TYX A;  1KU3 A;  1T33 A;  5BMZ A;  4UXN A;  1HOM A;  2JVH A;  4D7N A;  1YX3 A;  1TWF J;  4FN5 A;  4DYQ A;  1Z77 A;  4O3M A;  2CV2 A;  2D1H A;  4EGY A;  1I6X A;  5L3E A;  3H35 A;  1X2N A;  3ABK H;  1JUM A;  4TV7 A;  4UNO A;  1BJK A;  3G05 A;  5FO0 A;  2QLZ A;  5L46 A;  2ISY A;  1O8J A;  4R79 A;  2VBT A;  4DQK A;  3EUH C;  1HKS A;  1N07 A;  1P4W A;  1R1V A;  2WJV A;  3PQK A;  1NG7 A;  3IRR A;  4ZDO A;  2NSP A;  3FM3 A;  1S4M A;  2DK8 A;  2F2E A;  2GQF A;  3BG7 A;  3AL0 C;  1BHE A;  5HOD A;  3ASN H;  4AID A;  1OGI A;  1X1A A;  2R6H A;  3CC7 B;  2KIS A;  2XB0 X;  2K9M A;  4MFD A;  3HTS B;  4EW9 A;  2JA5 J;  1R58 A;  5F0C A;  1YRN A;  4OU0 A;  3QOE A;  1YG2 A;  1WJD A;  1PDN C;  2E5N A;  4A6E A;  3FXU A;  5DCM A;  2E19 A;  2R93 J;  9ANT A;  1D3Y A;  4KKT A;  4G5G A;  3G2B A;  4NHJ A;  3SQN A;  2ZB9 A;  2D1V A;  2F5E A;  2K9S A;  1QVU A;  1P7J A;  1WFX A;  3ESW B;  1WU8 A;  1HG8 A;  2BM0 A;  3OYL A;  4OZY A;  1RUO A;  3GW2 A;  1FYL A;  3AVX A;  1D0Y A;  1S9H A;  2PJR A;  2IT0 A;  3CMA I;  2NS0 A;  3EUH A;  1UD3 A;  2WB1 A;  1HW1 A;  3SKB A;  3DLA A;  3E3V A;  4IHX A;  1XFO A;  4RDK A;  3Q3S A;  4WWC A;  3T0Y A;  4J00 A;  3T1B A;  3L2V A;  2C6Y A;  2VLA A;  1TLL A;  1WRJ A;  1DU0 A;  4KIT B;  4YZX A;  5A2Q Z;  2OBT A;  1B72 A;  3LOC A;  3DEE A;  4KIS A;  3HPG A;  3CCJ I;  2L7Z A;  1S7O A;  5TGT A;  4ZYD A;  4YFK F;  3L2W A;  2XAG A;  1FSH A;  2PG4 A;  5F4M A;  5FL7 A;  1MGT A;  2FMY A;  1S29 A;  3ZMZ A;  3DF8 A;  3GO5 A;  1D5V A;  2BY1 A;  4UVC A;  2X1C A;  2HQR A;  1MH4 A;  3MKL A;  5HXB A;  1BC8 C;  2VKH A;  3WND A;  4M9S A;  1NH3 A;  2BBY A;  2C5B A;  2X6O A;  5GAE J;  4KMF A;  1RPW A;  2IQ7 A;  3RPU D;  2AHQ A;  3CMY A;  4DYR A;  4QHY A;  3WY9 A;  1PLU A;  4OIP F;  2IBD A;  2CMP A;  3RDI A;  2DN0 A;  1W7P D;  5F0H A;  1Z1D A;  3CCR B;  1V55 H;  1ZM9 A;  3ZZ0 A;  2K4J A;  2KL4 A;  2JPB A;  3LWF A;  1I6H J;  3DXJ F;  5CVR A;  3RCO A;  2F1M A;  4P1W A;  3OL4 A;  3VYR B;  4XL9 A;  2EIX A;  2VQL A;  3ZCO A;  3CCQ I;  4UV9 A;  2GXG A;  4GRI A;  3HC7 A;  2XNJ A;  1L0O C;  1KTW A;  3WNB A;  5E8I A;  5DS9 A;  1XSX A;  2FBK A;  2W48 A;  4RAZ A;  4U7B A;  5E20 A;  2GLO A;  3BCD A;  3MQ0 A;  3PUN A;  2VFM A;  1OOC A;  2P7V B;  3ZQH A;  3KEY A;  1SVM A;  5AON A;  1WKM A;  5BS6 A;  4Z03 A;  4V19 K;  2LC2 A;  3LJY A;  2DDB A;  1KCD A;  2ODL A;  1Q1V A;  5E17 F;  4OAZ A;  1WWX A;  3GQ9 A;  3H9Q A;  5CVV A;  2QF7 A;  3RY8 A;  2RQP A;  2XAF A;  3K2A A;  3ASP A;  3N97 A;  3CCJ B;  4D5C A;  2WWY A;  5ILV A;  4OM9 A;  1ETX A;  1GVD A;  3HGY A;  1R71 A;  1H0M A;  2ZZE A;  3P5J A;  1O8D A;  1SAX A;  4JQF A;  4A3G J;  3M8E A;  4C2U A;  2BY3 A;  2HNH A;  2GRE A;  2INU A;  5EGO B;  2MBF A;  4M3E A;  4BY7 J;  2G0Y A;  3HOV J;  2ICW G;  4ZTF A;  1S8N A;  3KE2 A;  3ZQG A;  1XSD A;  2V7W A;  3LL7 A;  3VOD A;  5HNF A;  4PMH A;  1VF7 A;  5HKK A;  3JSP A;  3SJM A;  2KFD A;  5A88 A;  1YX2 A;  2M7A A;  4FCY A;  3S93 A;  2B5O A;  4BHC A;  1M1K D;  1D2E A;  1WOP A;  3HSR A;  4J0Q A;  4KN4 X;  3OEH A;  1WJE A;  3AK5 A;  1R5N A;  4MGR A;  2VNK A;  4PSW A;  4AWX B;  1FOW A;  1IJF A;  4MO7 A;  1MMD A;  1VHE A;  3TOB A;  1O8M A;  2G7U A;  4KJZ A;  2K4B A;  2L7K A;  3S1M J;  3EQO A;  3MKW B;  4Y7N J;  4XR6 A;  5J1Y A;  4LB5 A;  2E2J J;  1BPL A;  3LA3 A;  4QPQ A;  2WJY A;  2O1D A;  3ZPP A;  3ELK A;  3HZJ A;  3V7R A;  4GDF A;  3OYE A;  1ZGA A;  2XSJ C;  4EJU A;  3A0H C;  1OLT A;  5C44 J;  4MTD A;  1G7R A;  3FF5 A;  2D9R A;  1RES A;  1I5Z A;  2F6C A;  4XLN F;  4HE5 A;  3SZP A;  1ZG1 A;  4HF2 A;  2DYS H;  3KZZ A;  2ZXI A;  2FEZ A;  1VQ9 B;  2EFO A;  1O3S A;  1U2W A;  4ZDL A;  3OOP A;  3R6J A;  3GTO J;  1FND A;  2BVN A;  2O3F A;  4GYG A;  4DK0 A;  1BR1 A;  1JKR C;  4MYT A;  1R23 A;  3M9A A;  1CQT A;  5C4X J;  4EVI A;  5IT9 K;  1T6S A;  1ZKG A;  3KPH A;  5E18 F;  2MLK A;  3EUA A;  4EGZ A;  1G4D A;  1JJ2 B;  5HS8 A;  3B73 A;  2LR8 A;  2DT6 A;  3J81 K;  4Y52 J;  2FQ4 A;  1J5Y A;  4O5V A;  1Z3Y A;  1UZC A;  3HPH A;  3J7Z I;  2BGC A;  2NAZ A;  4J19 A;  5M5W J;  1IHM A;  3QPL A;  5J8C A;  1HQC A;  1BM9 A;  4A0X A;  3SFI A;  3TKY A;  2M7B A;  3FBN B;  2AS5 F;  2Q6L A;  1RNL A;  5AMV A;  1QA2 A;  1WSR A;  1GJR A;  1S7A A;  2NTB A;  3JQP A;  4AYB N;  5IYR A;  3LSM A;  1QPI A;  1OPC A;  4NK6 A;  2BVL A;  4PFO A;  2FXA A;  4FQG A;  1X2M A;  4ITV A;  4QSH A;  3QYE A;  4IVN A;  1J2X A;  2E71 A;  4LLN A;  2VBW A;  3QWL A;  2DA3 A;  1QBJ A;  1I18 A;  2DTZ A;  5EGO A;  1JGG A;  5L3F A;  4OPO A;  2XHK A;  1IF1 A;  2M5S A;  1D1N A;  4HG2 A;  3VSK A;  3J7Y J;  4E7I A;  2GA2 A;  3UW0 A;  3ZSC A;  3F8B A;  2HYF A;  2XGD A;  4OJO A;  5M5Y J;  2MW8 A;  4Z4T A;  2BZT A;  1BIB A;  4RA2 A;  4M3D A;  3T8R A;  2CRV A;  2GA1 A;  2OCE A;  5FD6 A;  1U6G A;  2A6H F;  3OYC A;  4ASU A;  2LOO A;  1FNC A;  2ZXH A;  3RQI A;  3PSZ A;  2IJL A;  2HOS A;  1HBX G;  2DU9 A;  2YR2 A;  4U0V A;  1YTY A;  3SXY A;  2KIF A;  4RGX A;  5LEJ A;  3WU1 B;  1UHS A;  4RBO A;  1K4T A;  2EFG A;  1OYY A;  3KLN A;  2ZXW H;  2FNP A;  2JWT A;  2M9H A;  3QYB A;  4A12 A;  3QFS A;  3HSF A;  4BL0 B;  1EZG A;  4OIQ F;  3IH2 A;  4D1Q A;  2VBZ A;  1T8I A;  3OEE A;  4JOM A;  1FIP A;  3MKY B;  4HDV A;  3L2U A;  2BHY A;  4U9U A;  2EFW A;  1CGP A;  3RIR A;  4YFN F;  4Y17 A;  4OJL A;  3SZG A;  1DUX C;  5L3D A;  2CK3 A;  1CLW A;  2E2H J;  2IGN A;  4RB0 A;  3CLO A;  3GYH X;  2CQ7 A;  3VO1 A;  4UB6 C;  3TO7 A;  2J5P A;  2OQR A;  3K4L A;  5EF6 A;  1K7A A;  5FD5 A;  1GR1 A;  4B3F X;  1NB9 A;  4TMV A;  3BCB A;  2YU9 J;  3CME I;  5L3G A;  1I3A A;  3HRM A;  5GTH C;  2P6S A;  1FBS A;  1M90 D;  1ZGJ A;  5EYR A;  4AF7 A;  1OFM A;  1PE9 A;  2VOD A;  3BR1 A;  2D3L A;  3ZMT A;  3PO3 J;  2EIK H;  2PMZ N;  3NEU A;  4RAG A;  3E6B A;  3QPT A;  1TWA J;  5D5X B;  1IDY A;  3CCM I;  2NRA C;  1VI0 A;  2ETH A;  1BR2 A;  3FKS A;  1QGP A;  4UZF A;  5E3L A;  3VNV A;  2HKO A;  4UZE A;  1IRX A;  2IW5 A;  5FLM J;  3GZ5 A;  2DA6 A;  1ZRF A;  1LDJ A;  2Z5U A;  3FX3 A;  4BH9 A;  1Y0R A;  2V6C A;  1XMK A;  4G6I A;  3F6V A;  3MN2 A;  4NDL A;  2PMD A;  2OBS A;  2JZY A;  3IAS 2;  1UD8 A;  4A3D J;  1ZK8 A;  2CFO A;  1R5B A;  2J8K A;  4MLO A;  2CO5 A;  1W9X A;  4FT8 A;  1RI7 A;  4MHG A;  1LFU P;  2F1L A;  2DFE A;  1ZGW A;  2VBU A;  3MFK A;  2ZZF A;  2DYI A;  1YJ9 B;  2IGM A;  3CCV B;  1ZLJ A;  1RIO H;  1M1E B;  4KIG A;  4XLF A;  2H6C A;  5EZG A;  2HVQ A;  2UZK A;  1P4X A;  2ZCW A;  3GRH A;  1BJA A;  4P26 A;  2HDC A;  1FRN A;  2QYO A;  2LK2 A;  2A6E F;  5C4J J;  2FVG A;  3ULQ B;  2O7O A;  1A6Q A;  1QPM A;  3N05 A;  1GAW A;  3ZBT A;  2JA2 A;  3LMW A;  4HX7 A;  2Q2E B;  4DNT B;  1Z3X A;  5HLT A;  3W2I A;  2VNJ A;  1TW2 A;  4IRI A;  1VQ6 I;  1SFK A;  2XZL A;  2LH9 A;  3KP2 A;  1OKR A;  4RLZ A;  2JVG A;  3FKJ A;  3P9K A;  4I0B A;  1JKO C;  1D0X A;  3M1C A;  2W82 A;  3SLD A;  2RC6 A;  4X07 A;  4ROX A;  3J80 K;  3K6G A;  3K4M A;  3BC8 A;  2CRG A;  2K3P A;  2KT0 A;  4LK0 F;  3OYI A;  1SFU A;  2NS8 A;  1AU7 A;  1BI2 A;  1LVA A;  1VJS A;  1IN7 A;  4DIQ A;  5THX A;  4E0F A;  1T98 A;  2V9V A;  3ZQQ A;  3SZE A;  4L9T A;  1K8F A;  2X6Y A;  4BE2 A;  3NRV A;  1G2H A;  1WZ2 A;  2CQQ A;  2JRM A;  3HYI A;  3TOA A;  4IQJ A;  4BU2 A;  3JCU C;  5J6X A;  4WX9 A;  1O57 A;  2WV1 A;  4A3K J;  5K7F A;  1XE1 A;  4ENJ A;  4C0S A;  4OPV A;  2M8G X;  1MBJ A;  2VXZ A;  3QPH A;  2K02 A;  2CC2 A;  4U0W A;  2R5Z B;  3MVP A;  4BJ5 C;  2ZTN A;  5D4R A;  2DPD A;  1XGO A;  4BUP A;  3W6K B;  1XDU A;  3LNQ A;  4NC7 A;  1UFM A;  4DYC A;  4L9N A;  3ERE D;  3F3X A;  1JHF A;  3Q6Q A;  1KRH A;  3P7N A;  1ZR4 A;  3ZRG A;  1PJ6 A;  5J3O A;  3T5X A;  5EZH A;  1W36 C;  3LQE A;  3AAF A;  2DLL A;  1TW3 A;  2F5D A;  4IRG A;  5FLV A;  1J75 A;  2HOA A;  1W0U A;  3RQ4 A;  5F4O A;  4CYC B;  1G3W A;  3WTV C;  2Z9O A;  2IPQ X;  4XRS G;  4A2U A;  4UAJ A;  2MAB A;  1QNT A;  4AIK A;  2PE3 A;  2GBY A;  1W5S A;  1IC8 A;  1RU4 A;  2WZP P;  1BJZ A;  1D0Z A;  3JX8 A;  1GO2 A;  4RD6 A;  4P2N A;  1ZR2 A;  2WZN A;  4I99 C;  2W57 A;  2OPT A;  1R1T A;  3F8M A;  4A3F J;  1KZL A;  1VQ4 I;  3KIO A;  2QKM B;  2ZZG A;  3F0C A;  2ELJ A;  5E3M A;  2HKX A;  2QQB A;  2NVY J;  1ZG5 A;  3JRG A;  2VZL A;  1WPK A;  3OS2 A;  2QWW A;  4G6D A;  4PAB A;  4PDK A;  5GTI C;  2W00 A;  4HV6 A;  2CS3 A;  4II3 A;  4HNV A;  5JFR A;  3G71 B;  2BV6 A;  4CIC A;  1Y8Q B;  3HEF A;  1KQ5 A;  1V5G A;  2Q2E A;  5ICG A;  3GVA A;  3KP3 A;  2V1D A;  4AM3 A;  2PBI A;  1R5O A;  1W4M A;  4RAF A;  3W2E A;  3BQY A;  4YEI A;  1GXP A;  2VUM J;  2EH3 A;  2VBK A;  5C1C A;  3FDY A;  4A3C J;  3I0T A;  5FFZ A;  5FKO A;  3JQQ A;  4YAF A;  5FB2 A;  1XB2 A;  1EV7 A;  2P5L C;  4Z2Y A;  3DBL B;  3QOP A;  1QGY A;  3HRU A;  3OPO A;  3RSN A;  1VF9 A;  4OIO F;  3DQV C;  2CBX A;  4Y15 A;  4I01 A;  4UUV A;  3JW4 A;  2LFB A;  4WZK A;  3C7J A;  4L18 B;  4M0L A;  1FWZ A;  2R7W A;  4DQL A;  2EZK A;  2LRD A;  4LBZ A;  1MH3 A;  1TL8 A;  1FBQ A;  1WQ2 A;  2MFZ A;  3BQZ A;  2OQG A;  3KET A;  1FNM A;  1FMW A;  3D0S A;  1N77 A;  4CXF A;  4BYY A;  2XTY A;  4Z4V A;  2F5F A;  3K4K A;  5A2Q K;  1NRK A;  3LQR A;  2W6I A;  1VZ0 A;  3G73 A;  1FNB A;  2R5Z A;  3FMQ A;  2EK5 A;  2W25 A;  3F9K A;  2F43 A;  2GJK A;  3PNT A;  2ZSH B;  1IW7 F;  4RMN A;  1I1G A;  4XNF A;  4F92 B;  1RZ4 A;  4A5M A;  2O5R A;  5ILU A;  1K6O A;  2MA3 A;  3DPT A;  3I3L A;  3SZT A;  4PFP A;  1VQ7 I;  3H0G J;  2XT2 A;  4W8R A;  2DY1 A;  1Y6I A;  1YOV B;  4RD2 A;  2C77 A;  4CZC A;  4OIN F;  4LBY A;  4YZQ A;  3JRB A;  1IUY A;  4EJV A;  3Q39 A;  5K5Q A;  4GXO A;  2DET A;  1QHH D;  4CYC A;  2VBM A;  1E3Z A;  3QFR A;  1RRJ A;  4CGZ A;  2JQ7 A;  1V5E A;  3VMV A;  2XPU A;  3V42 A;  3ZZT A;  5E8G A;  4X7D A;  1QRB A;  4R8H A;  4BHB A;  3BJ6 A;  1KYZ A;  4EH1 A;  3DBR B;  1I7P A;  5BPI A;  1VQ5 B;  2BN4 A;  2QSG X;  3WTW C;  1LUJ B;  4IL6 C;  4OJ5 A;  4E70 A;  1WJF A;  5B3S H;  2EFQ A;  1TT0 A;  1POG A;  3TO6 A;  2F4O B;  2XAQ A;  4ENN A;  3T53 B;  5F64 A;  4A3B J;  2V7X A;  2YWH A;  2XGC A;  2LZJ A;  2C2W A;  2VI6 A;  2Z8G A;  3C1D A;  1IXR C;  4TMT A;  2XV4 S;  5EEA A;  1G3T A;  5FKK A;  5IYB J;  3KYL A;  1RET A;  3PJR A;  1S5L C;  1BOB A;  5KSW B;  1DPR A;  4YC5 A;  2EBI A;  3CCS I;  3GQ8 A;  2A6T A;  3L7W A;  1WPC A;  3M8J A;  2OTJ I;  3BY6 A;  2WBM A;  2JPC A;  4G7W A;  1TZL A;  3NWS A;  2HQN A;  1J9I A;  2JJ2 A;  3VYU B;  4AD9 A;  1JUS A;  2XSD C;  2IP2 A;  3DEW A;  1YIO A;  2M45 A;  2L7M P;  2OU2 A;  2X4H A;  2BGI A;  2AHO A;  2XF7 A;  2EFP A;  3ML6 A;  3D5R C;  1VQ8 B;  3H1C A;  1JT0 A;  4AYB A;  2P8T A;  2V7T A;  3HL2 A;  2DA5 A;  4F3Q A;  2HDN B;  4KIB A;  3GF2 A;  2X6X A;  2K40 A;  3B6C A;  3PFY A;  1W0J A;  2PMU A;  3OJX A;  4OPW A;  3NAW A;  1YQA A;  3NB2 A;  1QA1 A;  3FHZ A;  3A8I A;  4YEL A;  5JLW A;  2BM1 A;  1LLW A;  2L9R A;  1K78 B;  3UKG A;  2EZI A;  3QSY A;  3U1K A;  5B5E C;  3OKX A;  1HDP A;  3AVU A;  3ERM A;  1YIT B;  3IAM 2;  2JUG A;  4L5J A;  1K5C A;  5H5J A;  1OR7 C;  1HSJ A;  4S04 A;  4CO8 A;  4EJO A;  4LGW A;  4CCL A;  3HOS A;  1FDR A;  2EZH A;  4NUB A;  2XAS A;  1MND A;  3KFW X;  2NVX J;  5KNL A;  3C18 A;  1UD5 A;  1K73 D;  2KZV A;  2EB7 A;  1R4M B;  3O3K A;  1SVO A;  2HQ5 A;  2O0Y A;  4N9I A;  2HR3 A;  2P4W A;  3CF5 F;  1OGM X;  4PGG A;  3OYN A;  1W34 A;  2QTZ A;  3CCS B;  4MNU A;  4W8S A;  1YJW I;  3A3G A;  4IW3 B;  3JTH A;  4NBS A;  3P26 A;  4M4S A;  4EV0 A;  1OGO X;  3SEJ A;  4M6Y A;  1G59 A;  1X4P A;  2YU3 A;  3VSU A;  4D9J A;  1QA6 A;  1DG1 G;  2M0M A;  5TV2 A;  3WTS C;  1OR7 A;  2VNH A;  1WMR A;  4NCN A;  2FU4 A;  1JNY A;  3FZV A;  4ENK A;  4LG3 A;  1K8A D;  4M1K A;  1HST A;  4DZP A;  4HRI A;  2OBP A;  1TVC A;  1ZH5 A;  1QQI A;  4A3E J;  2FBH A;  3PM1 A;  2BM5 A;  4YFX F;  4G6Q A;  3AGP A;  2L3D A;  4C3J J;  2A05 A;  2ISZ A;  1JGS A;  4CCK A;  1RR7 A;  2AXT C;  5DM7 F;  3CJN A;  4L5E A;  3N6Z A;  2QEX I;  1BBY A;  1CZF A;  2L4A A;  2VXD A;  1YHQ I;  1KQ0 A;  2X0L A;  3FM5 A;  2FRH A;  1KD1 D;  2DER A;  4L8J A;  4EM1 A;  2K7L A;  3GTM J;  1BQE A;  3MCA A;  3OZW A;  4RJL A;  4Q4Z F;  2NZM A;  1O3T A;  2IOU G;  1ODD A;  1QUF A;  3K10 A;  4RGU A;  1LEB A;  5HZB A;  4X6A J;  1YLO A;  3AVV A;  4YDT A;  5HVQ C;  5IP7 J;  4M6X A;  4Y4R A;  4QVJ A;  4C43 A;  2E1M B;  4N9H A;  2DEU A;  5HDK A;  1P4A A;  2X1E A;  5CVU A;  1XPX A;  4OMY A;  2X85 A;  2NVT J;  1R36 A;  4L0Z B;  2R4G A;  4HEA 2;  4J01 A;  2FF4 A;  2ZL7 A;  5B1A H;  1VTN C;  3PUF A;  1P9Q C;  1MJB A;  4XOT A;  3ZPN A;  3KP7 A;  3S14 J;  3D5L A;  4N3G A;  3D26 A;  3WGG A;  4EJW A;  3ZQC A;  4F7D A;  1K78 A;  4ZGQ B;  4RDU A;  1ZAO A;  4LBV A;  2AQF A;  4HYE A;  4ZTJ A;  4TN1 A;  2ZNZ A;  2LSO A;  1IB4 A;  1WJC A;  4B4D A;  4KN7 X;  4FWT A;  1DDI A;  4O6J A;  1PJ5 A;  3M1E A;  2LDU A;  1QFY A;  4WZE A;  1K61 A;  2UUZ A;  3WBK A;  3I4M J;  1ACI A;  3LYC A;  2CSO A;  2RQQ A;  3OYA A;  1WXR A;  3VDX A;  1TSP A;  2VFP A;  4HPQ A;  4RGR A;  4A3I J;  2MC3 A;  2DIE A;  4LIU A;  3G4S I;  2JN9 A;  4PJN A;  3JSO A;  1QZE A;  1UB9 A;  3KCC A;  2BF4 A;  2V4D A;  2JJ7 A;  1WGX A;  1O8E A;  3Q5F A;  2RRE A;  2EWN A;  3BY1 A;  4WZT A;  3CD6 B;  1IRZ A;  3G1L A;  4HQE A;  5TRD A;  5BNG A;  3A0B C;  2X0K A;  1N75 A;  4P9U A;  2VT2 A;  2V5I A;  4JMQ A;  3CCE B;  4HZF A;  1MBE A;  1U3E M;  2NT6 A;  1ONV A;  1VQK I;  4Z4U A;  1ZEL A;  1BMF A;  4YAL A;  2E1M C;  4YRV A;  3P4G A;  1DGR M;  1G3S A;  2LKP A;  3DPU A;  4U7D A;  3A1Y A;  1XQB A;  2LYC A;  2B7B A;  2Z99 A;  3IWF A;  3HKZ A;  1BC7 C;  2R0Q C;  1QVF B;  5J47 A;  2V1U A;  1QH0 A;  1W5C C;  4M9X A;  1WOO A;  2NPF A;  4RDJ A;  1HA3 A;  3ZXS A;  2VN2 A;  2WAE A;  5B66 C;  5GAG J;  3IV5 A;  3IKT A;  3I59 B;  3KRG A;  1VQN I;  1IV8 A;  1Y0U A;  3AVY A;  2NNN A;  2MD5 A;  1LM1 A;  3OIO A;  2F5C A;  5J1U A;  3A01 B;  4BXU A;  4XD7 A;  1D8T A;  3KEQ A;  3BG6 A;  5F4J A;  2VOP A;  4HLY A;  2FE3 A;  2HLD A;  3FMR A;  3A8J A;  5K7Z A;  1RC9 A;  3TGN A;  2QA4 I;  2CYY A;  2WAQ A;  1EA3 A;  4D0P A;  3GVL A;  3K9T A;  4FE4 A;  2YS9 A;  4BBS J;  2VE9 A;  1APL C;  3DEU A;  2V9P A;  3BZC A;  3WWG A;  4M3B A;  3TDU C;  3JR9 A;  2ZME B;  3ROU A;  1OCT C;  2XEX A;  1R5H A;  1SAN A;  3ABT A;  4Y3O A;  3PFI A;  3REO A;  4F93 B;  3L1P A;  3ZMS A;  1YI2 I;  4B48 A;  1QCX A;  1LNW A;  2D5V A;  2COB A;  2IEK A;  1GHC A;  1FSE A;  1KGS A;  3H9J A;  5B6I A;  4DNR B;  2LY2 A;  3LA7 A;  2ZBV A;  2HMA A;  4OP7 A;  3OYG A;  3PL8 A;  3BQJ A;  2JSP A;  3K69 A;  3CMA B;  1COW A;  3DDY A;  1J7K A;  4BKX A;  4AIH A;  4MEY F;  1EFT A;  1IA5 A;  3DU5 A;  2VBY A;  4LIV A;  3QOD A;  2CUZ A;  4QV2 A;  2JIZ A;  1N25 A;  2LY9 A;  2V7F A;  4C3H J;  1U8R A;  4KH3 A;  1BIA A;  2E1N A;  4Y9U A;  2G9W A;  3PIP F;  4E7Z A;  1ON2 A;  2PMH A;  4M74 A;  1DAB A;  3U2R A;  1Y0Y A;  3O8G A;  1VHO A;  4B09 A;  4BXF A;  1SM4 A;  3M07 A;  1R9T J;  2BE5 F;  2FOK A;  4P6V F;  2Z6B D;  1KC8 D;  2PN6 A;  1YO5 C;  4WXH A;  4OPS A;  2DOD A;  2HZD A;  3V7S A;  1WSU A;  2IXS A;  4IEJ A;  2L01 A;  3HBL A;  3TDZ C;  1RKW A;  2LP0 A;  4PJ0 C;  4CA0 A;  4AIJ A;  1B6A A;  4Z4S A;  4HWV A;  2B63 J;  2L4M A;  1F60 A;  3E5U A;  4L9J A;  2Q6K A;  4A69 C;  3PA1 A;  1J0R A;  3G1O A;  4ZH4 F;  2Y9Z A;  2L7F P;  5F04 A;  4HW0 A;  3MZH A;  2ZME C;  1T0F C;  5HOO A;  3R6S A;  2DQL A;  3HRT A;  4KT5 C;  3OYJ A;  2AO9 A;  4OOS A;  4N4N B;  4OAY A;  3MHP A;  1R4N B;  2J8I A;  2QE7 A;  3BZ6 A;  5D8K B;  2FNA A;  4PAA A;  4CCO A;  5D8L B;  3ML3 A;  3CCQ B;  1KK2 A;  2DT7 B;  2BOL A;  3I59 A;  2R7U A;  4RM2 A;  2P81 A;  2UXX A;  3HUG B;  3I71 A;  3IH3 A;  2CGP A;  2ID6 A;  2RNJ A;  4IHS A;  3KL9 A;  3A01 A;  2HYJ A;  1FLI A;  2VON A;  5ERI A;  3RI4 A;  1FOK A;  1BW5 A;  3BRO A;  4PC6 A;  1IUF A;  4XSZ F;  4A93 J;  1CQX A;  2MD0 A;  3FK6 A;  3J7A Y;  1TYW A;  2NNY A;  2BY0 A;  2QCO A;  2DXI A;  2HI3 A;  2E60 A;  2H1L A;  2ESH A;  4HLX A;  2EV6 A;  4RCZ A;  3WG9 A;  3BC9 A;  5KHD A;  3HOW J;  1IO2 A;  5DCF A;  1T0F A;  1S6L A;  3S3N A;  2QQ9 A;  4WWV A;  1OB5 A;  4G94 A;  5DDG A;  3CRZ A;  3R0J A;  3JAM K;  4Q47 A;  3MZY A;  1FIA A;  1I1S A;  4K2E A;  4ZJZ A;  2HOT A;  2KKO A;  3HTU A;  1S0U A;  5CVI A;  4NC6 A;  1KZH A;  4KNY A;  5IOZ A;  2IS2 A;  1V5F A;  3EET A;  4PGH A;  5CVJ A;  1XGN A;  2KMU A;  2X51 A;  3TW7 A;  2VQG A;  1KU9 A;  3DBH B;  3AG4 H;  1LE8 B;  1E43 A;  2VNI A;  3E6C C;  1VQP I;  1U8B A;  4M9Z A;  3WGH A;  2OUM A;  5KW9 A;  1MBF A;  4Z6Y A;  2M30 A;  4XKW A;  4ZCL A;  2DA2 A;  2OTL I;  4TMW A;  5IT3 A;  1ETK A;  3OW2 B;  1ETQ A;  2R7Q A;  4QWQ A;  3SYT A;  2I1L A;  3FBI B;  2IVM A;  4PJJ A;  3WYA A;  4ZCI A;  2DJN A;  3P9C A;  5E6T A;  1PXZ A;  1N08 A;  4XBF A;  2Q8K A;  4I02 A;  4MQV A;  4BPR A;  5D5U B;  3S1R J;  3WXM A;  2CW5 A;  5ICE A;  2E35 A;  2DCU A;  2PLF A;  4Z4R A;  4XSX F;  1DP3 A;  1NJI D;  3H3Z A;  1X58 A;  1KQS B;  2LG4 A;  3U6K A;  3WTZ A;  3K1P A;  3FIW A;  3I5U A;  2X8K A;  4BQO A;  2CV0 A;  2Q6I A;  1XCV A;  5J3L A;  4TKO B;  1UAA A;  2M2E A;  2XPV A;  4X7F A;  2HVR A;  1SC7 A;  4HE6 A;  1PP8 F;  4M6V A;  4F55 A;  5LEK A;  2C4T A;  2IRF G;  4YAO A;  3KEO A;  3K70 C;  2YUH A;  3A1P A;  3AST A;  4MQ9 F;  3A3B A;  2KIM A;  1MMS A;  3S8P A;  1B1B A;  2BV3 A;  1QO0 D;  1XMX A;  1GV2 A;  3OOC A;  2HDD A;  5IYQ A;  3K1M A;  1ZM4 A;  1O7L A;  2FA5 A;  2O03 A;  1ZYR F;  3OAA A;  4U4B A;  4Q5S F;  4ZYE A;  1GXQ A;  4JRA C;  4H9G A;  3O6B B;  3Q9S A;  5F0F A;  3F8N A;  2R5Y B;  1ZUN B;  4N3N A;  3I1F A;  2XVC A;  3HUG A;  2VQH A;  3V8K A;  2UVE A;  3VFZ A;  4IOA F;  2O0V A;  2DA4 A;  2DYR H;  1UG2 A;  3SEZ A;  2LVS A;  1V4R A;  2CUE A;  1TNS A;  2R7O A;  3H36 A;  4C3I J;  3NQO A;  3DCF A;  4I76 A;  1L1I A;  1ZQ3 P;  4LD5 A;  4BJT A;  2MLG A;  1DDG A;  2X53 S;  1YX5 A;  1R22 A;  3EYI A;  5ED4 A;  4E6K G;  1VQO I;  2ZC2 A;  3GTG J;  4BJ6 C;  3S3M A;  2ZZQ A;  1IDJ A;  2A5Y B;  1NHC A;  4RPD A;  4EM2 A;  1UD6 A;  4PGO A;  2Y0S N;  2ZBK A;  3GTP J;  5LHI A;  4BE0 A;  2BM7 A;  2JSC A;  1TTT A;  4BQQ A;  2HPI A;  1Y0N A;  1TYV A;  4P9F A;  3BY2 A;  4M53 A;  2VBV A;  1VFC A;  1OIS A;  3F6O A;  1YS7 A;  4KMU X;  1EJ9 A;  4G7H F;  3W2W A;  3OW7 A;  1LE8 A;  3L00 A;  1OGJ A;  2ZJQ F;  2GK6 A;  2FOW A;  4LLL A;  5DM6 F;  2K9Q A;  2OK7 A;  4CQJ A;  4BEH B;  1W1W E;  1MNM C;  1BI0 A;  2DFI A;  1F9N A;  4M3F A;  4OOI A;  5H20 A;  4S05 A;  1A5J A;  3OMY A;  5HLI A;  3GFJ A;  1S72 I;  1WI3 A;  2ME6 A;  3Q0W A;  1Z0X A;  3RJP A;  3HOY J;  3T51 B;  3OYM A;  5J40 A;  3BG9 A;  2R7T A;  3PVD A;  2FX0 A;  3R0A A;  1JB9 A;  2CW8 A;  2EQR A;  4YAU A;  3BPX A;  4ACA A;  1BX0 A;  2KRF A;  3CP8 A;  5FIU A;  4CCN A;  5FO5 A;  2XTX A;  3W2F A;  5JR3 A;  3S1Q J;  3OS0 A;  3IH4 A;  5IP9 J;  4XQF A;  4EMS A;  1ENH A;  1X1P A;  1XD7 A;  2V7Q A;  4Y7C A;  1WI9 A;  1J09 A;  3S2W A;  2ID3 A;  1OFL A;  2IAI A;  3G6E I;  1TP4 A;  4ABZ A;  5LGU A;  3C2B A;  1XCB A;  4WCG A;  2V31 A;  1KYW A;  3KP6 A;  4JK1 X;  2DA1 A;  4FTH A;  1VQO B;  5JVG F;  3VMW A;  1XSV A;  1QHG A;  2W1O A;  5GP9 A;  1W0K A;  5HDG A;  1JA0 A;  1JKP C;  3S1N J;  2OCC H;  4F91 B;  3I58 A;  2YWF A;  2OZU A;  1PUE E;  3V76 A;  1X3U A;  1X1D A;  3CME B;  1QVG B;  2R5Y A;  3LSH A;  3ZQF A;  2JUC A;  1Y39 A;  2CQN A;  3GTL J;  1MZB A;  3LO8 A;  1FTT A;  2HZT A;  2VT3 A;  3HGG A;  4FX0 A;  2MGQ A;  3W2A A;  3HHG A;  1LQ1 A;  1EFU A;  2B0R A;  1MJ9 A;  2V79 A;  1IAW A;  1F43 A;  3CCM B;  3A35 A;  1N8R D;  1Z91 A;  1WDT A;  3U2Q A;  4OJ6 A;  4W8Q A;  1K4S A;  1ON1 A;  5IYD J;  3ASS A;  5K7H A;  2K85 A;  3ZP5 A;  4Y9R A;  2QTL A;  2HDW A;  4OWR B;  2WPD A;  3RIQ A;  2LF7 A;  3CO7 C;  2RVC A;  1XC5 A;  2UV1 A;  2CF4 A;  3B82 A;  2VFO A;  2A61 A;  4G12 A;  1HA8 A;  1A35 A;  3H09 A;  2RV8 A;  1T08 B;  2VKD A;  4CSW A;  2XNC A;  4L5I A;  3M4O J;  2XB5 A;  4KKS A;  1REP C;  4FHT A;  2WB1 N;  1ZRE A;  3H92 A;  2ZFU A;  2HQA A;  4ZCM A;  1NHA A;  5E3O A;  1HXD A;  1EFC A;  1TWC J;  2HTS A;  4UVA A;  4XN0 A;  3VSL A;  4XID A;  3LAJ A;  3GXO A;  3GX4 X;  3Q38 A;  4XN3 A;  2XC7 A;  5CPR B;  2XZP A;  1IB0 A;  5TR9 A;  3CPW B;  1LFB A;  4HF0 A;  3Q6R A;  2H94 A;  1LDK B;  3S17 J;  4U0Y A;  1V3F A;  4U87 A;  2E5Z A;  2VJ5 A;  2DOA A;  2OK8 A;  2BW3 B;  3WTU C;  3PO2 J;  1I8D A;  1OFD A;  3I54 A;  1OQY A;  2B0L A;  1VQL I;  4ENM A;  3QU6 A;  1PUF B;  1AIR A;  3V7A A;  2K5C A;  3MMP A;  4YHB A;  1U0J A;  1VQ6 B;  1CNF A;  2XIG A;  1ZHF A;  1VLO A;  1ZRD A;  3FKI J;  2W7N A;  3OZU A;  4JX6 A;  1IRF A;  1BN5 A;  2EA2 A;  2KJB A;  2WAD A;  2FX3 A;  2J7K A;  2K9L A;  1XG2 A;  4CDG A;  1Z6T A;  3WU2 C;  1FC3 A;  5FJ8 J;  3F72 A;  1KK1 A;  2ZO4 A;  2QX3 A;  1UMK A;  2ELH A;  5JHF A;  1GV5 A;  2LY1 A;  1T2K A;  5BSY A;  3DWL E;  3FXM A;  3OL3 A;  5H6R A;  2HEO A;  4IX7 A;  2XUB A;  1UHW A;  3SFZ A;  2O04 A;  3ASR A;  1W5T A;  2DDA A;  2K27 A;  1WJ5 A;  4PC2 A;  2DAO A;  3EQN A;  3ZQL A;  4BQA A;  2Y0M A;  5HDN A;  1IN5 A;  2YX4 A;  4KT6 A;  2V1N A;  3CJR B;  3S2H J;  3Q3A A;  4CUG A;  3JRE A;  4ETS A;  1UD2 A;  4E7J A;  5F1R A;  1RWR A;  3SJZ A;  3B6A A;  3J7A O;  3TH0 A;  4P25 A;  4RD1 A;  2PYH A;  3EPZ A;  3H5N A;  1YFH A;  2ADU A;  4XMY A;  1E1R A;  2GJP A;  2W6J A;  4G1B A;  2FSW A;  2KP6 A;  2XC1 A;  2TDX A;  3ZN1 A;  1FTZ A;  4TMZ A;  1QZY A;  3R4K A;  4YIR X;  2IS4 A;  2XRN A;  4UV8 A;  2ME0 A;  2OYN A;  2PX9 A;  1EKE A;  1LB2 A;  2VBX A;  2R9V A;  2DT5 A;  1MDM B;  2P5K A;  4P55 A;  1E79 A;  2V1X A;  1E17 A;  4G7Z F;  2BPO A;  5DYM A;  1MBG A;  5FO1 A;  1H8A C;  5A8A A;  1DDN A;  2F5V A;  1D8K A;  3S16 J;  4LBW A;  2LD5 A;  1AIP A;  2NVU B;  2K3F A;  4E7H A;  4FXU A;  4P1V A;  5BSX A;  3BTJ A;  3M3Y J;  2C5H A;  1QA3 A;  1R00 A;  2ZXJ A;  4JYK A;  1KTV A;  2CQX A;  3R6K A;  2L9N A;  3MAJ A;  1VQ4 B;  2BEO A;  4ZYA A;  5LRS A;  4P6Y A;  4B3G A;  2K86 A;  1HKQ A;  4BGD A;  5EG0 B;  3G3Z A;  4LC0 A;  3HOX J;  4KFC A;  2P7C B;  2XKO A;  4XKV A;  2QQ8 A;  3OSF A;  1BI1 A;  1HW2 A;  3ECO A;  3MMY B;  1ULY A;  2FUG 2;  3LFU A;  3MWM A;  2DFH A;  5KAF C;  2VBS A;  2BW3 A;  4H4K C;  4EAT A;  1E3X A;  2OZ6 A;  4G9Y A;  2YSR A;  1KCC A;  2ECC A;  1WJB A;  1YIJ I;  3E6D A;  3RYR A;  2QUF A;  1PUF A;  2C4U A;  4KUM A;  1O8L A;  1FY7 A;  1DQU A;  3QFC A;  4BNC A;  1MBK A;  4UUS B;  4Y33 A;  3ISX A;  5FKN A;  2JTV A;  2GXB A;  4BE1 A;  4PJM A;  3CDL A;  1ELO A;  3CB4 A;  4LJZ F;  3IKV A;  1WJA A;  3JRI A;  4NBQ A;  2DI3 A;  3OR1 C;  3OIQ A;  1FEX A;  5E3N A;  1D1C A;  2CW0 F;  2ESN A;  4BS9 A;  3VO2 A;  3BLY A;  3GZ6 A;  5HZA A;  2HXO A;  5CQE A;  1MIJ A;  1X1B A;  1NB0 A;  2HVS A;  4I84 A;  4DOZ A;  1QUE A;  4NNJ A;  1GT0 C;  3ASO H;  3JRF A;  2JA6 J;  2BSA A;  3ISP A;  1W7P B;  2YPR A;  2MH2 A;  3KYC B;  4DBQ A;  3I56 I;  3VWB A;  1LFP A;  3FHN A;  3K1N A;  4OOX A;  3GUD A;  3ZGK A;  3H5A A;  3PIO F;  1JJ6 C;  1W2B B;  2XTW A;  2M3A A;  1QFZ A;  2KIQ A;  4P3Y A;  1KA8 A;  3LA2 A;  1G7S A;  5D6E A;  1IXS B;  4I0A A;  1XN7 A;  2Y75 A;  1ETW A;  2VPR A;  2AXL A;  4B43 A;  4L9V A;  4DGW B;  3CZ6 A;  1FX7 A;  2JA8 J;  1PVE A;  3ABU A;  4X7E A;  1VQ7 B;  4L0Y B;  1QU3 A;  2NV4 A;  2VBE A;  1WH5 A;  3JRC A;  1JTY A;  3SQV A;  2CV1 A;  3QFT A;  3CES A;  3K7A J;  2DOF A;  4RAY A;  2FQ3 A;  3AG2 H;  1NBM A;  1T5E A;  1OHH A;  2DW4 A;  1IV6 A;  1MDM A;  1ZN2 A;  2A5W A;  1SEU A;  2OC6 A;  2P5V A;  2DFF A;  1JT6 A;  3OSG A;  2FD5 A;  3TQN A;  1H8E A;  3CJQ B;  1KK3 A;  3JQR A;  2CJJ A;  2INV A;  1TBX A;  2O6G E;  1W36 D;  3BJO A;  1OCP A;  3H3V K;  3ECH A;  2KHM A;  3VMF A;  3CDI A;  1V0E A;  1E62 A;  1IN8 A;  2PIA A;  5M3M J;  1T38 A;  3A03 A;  1BI3 A;  1QQ1 A;  3GEZ A;  5EG0 A;  1MNE A;  1ZM3 A;  5IP6 A;  3K4J A;  4DK1 A;  1JUP A;  4YZA A;  4EM0 B;  2NOG A;  2R3S A;  5DUI A;  2VKV A;  2W7Z A;  1OJL A;  1XS9 A;  3RKQ A;  3D1N I;  3CC2 I;  1TUI A;  1E3P A;  2QBY B;  4P22 A;  4LLG F;  3I56 B;  4MR0 A;  4C2L A;  1GVJ A;  2KDZ A;  1U5T B;  3W2G A;  2OTJ B;  3DU1 X;  1MMN A;  1UST A;  2R92 J;  1Z9C A;  4DZJ A;  2EV5 A;  4NC8 A;  4BHP A;  5H2F C;  3A2K A;  2MSY A;  4UUS A;  3W2H A;  3G1M A;  4G8X A;  2G0E A;  5AIQ A;  4A6D A;  3L9F A;  3AVT A;  3HHH A;  4AC9 A;  1S7E A;  4HBL A;  3HOU J;  1G7T A;  1K9M D;  2M4G A;  3BJA A;  4B8X A;  4B3A A;  2HCJ B;  2CUJ A;  3W2V A;  3WHC A;  1OB2 A;  2KQR A;  4I98 B;  3DLL F;  5KK1 A;  4XKC A;  3CQZ J;  2M0C A;  3RPU A;  5CYV A;  5FRO A;  3CMM A;  2BSP A;  3KLO A;  4A3L J;  2O61 A;  3U21 A;  3OOU A;  5M3F J;  1MKM A;  1Y56 A;  2PLY A;  2STW A;  1RQP A;  3B8Y A;  4V2G A;  3QE2 A;  1W7P A;  1B8I B;  2PI0 A;  4IF4 A;  4BDZ A;  2D74 A;  1RR8 C;  1XB4 A;  1QX4 A;  1KMH A;  4YZ0 A;  4PJL A;  5DN6 A;  1D1B A;  3FXL A;  5B1B H;  3CCY A;  3CC7 I;  2L5Q A;  2PMZ A;  1N0V C;  3GQA A;  4LOC A;  3OP1 A;  1LEA A;  2CND A;  2MH9 A;  5K5O A;  1RUN A;  2WV0 A;  1H89 C;  4RD3 A;  1B72 B;  3ZBU A;  1O8I A;  1IZ1 A;  3FK7 A;  5JHU A;  5TJJ A;  2ECB A;  5IYN A;  1AA7 A;  2L9S A;  3DKW A;  2F4M B;  4DQ2 A;  2XDV A;  4GFB A;  5TIS C;  3GQB A;  2DBB A;  4YXW A;  2C78 A;  2O8K A;  1LLZ A;  3TL4 X;  5L3B A;  2CH0 A;  1TQI A;  3KX2 A;  5GPC A;  1N06 A;  2H8R A;  3MCZ A;  5ICF A;  1ETV A;  3TP3 A;  1LJ9 A;  3BPV A;  4K1X A;  3DTI A;  1U5T C;  4JP0 A;  1ZG3 A;  2CW7 A;  2OJE D;  3Q0V A;  4LFU A;  5DTD A;  2KJC A;  3TW6 A;  2A69 F;  4CH7 A;  1TYU A;  4XIC A;  5JMC B;  1QRY A;  1YJW B;  5E79 C;  1O3R A;  1OFC X;  3LSK A;  1WP6 A;  1O3Q A;  2BYV E;  3MZ8 A;  1DGW Y;  3BNW A;  2RC5 A;  3DU6 A;  1YW9 A;  2O9L A;  3LQQ A;  1I3Q J;  3LST A;  4ZV4 A;  4RM0 A;  1HC8 A;  3TMO A;  2VL8 A;  1SD7 A;  2H09 A;  2DA7 A;  3AG3 H; 
#chains in the Genus database with same CATH homology
 4XLA A;  2NTQ A;  4B44 A;  2KVO A;  1OB0 A;  3PSF A;  1GLN A;  3NWT A;  4E4H A;  3BC9 A;  4W8T A;  5KHD A;  3N05 A;  3I9V 2;  4FET A;  2R7S A;  2GJR A;  2JA2 A;  3S3N A;  3LMW A;  3PSI A;  2GK7 A;  2Q2E B;  4DNT B;  1Z3X A;  4N4O B;  3OYD A;  4MXN A;  5HLT A;  1ERD A;  4ZJZ A;  1SFK A;  4E7S A;  1HVX A;  2LH9 A;  2XZL A;  2JVG A;  2Q1Z B;  3FKJ A;  2IS2 A;  1V5F A;  4CCM A;  1D0X A;  3M1C A;  2W82 A;  3OIP A;  3HOT A;  2KMU A;  1E43 A;  2X51 A;  2DJI A;  2VQG A;  4XLH A;  2HU9 A;  3K6G A;  3K4M A;  3BC8 A;  2K3P A;  3OYI A;  2V6E A;  2OUM A;  3GQ7 A;  3AKZ A;  4XKW A;  2IS6 A;  3IP4 B;  2KRC A;  1VJS A;  2R7Q A;  1GQ8 A;  4LIT A;  3SYT A;  3EUK L;  4DIQ A;  4E0F A;  3FBI B;  3LSI A;  4PJJ A;  3ZQQ A;  4C2T A;  3VST A;  1PXZ A;  2X6Y A;  1DBO A;  4BE2 A;  2V4J C;  1MMG A;  4RLQ A;  3OYB A;  1VLY A;  4IQJ A;  1MW7 A;  4BU2 A;  1DP3 A;  2LG4 A;  4ZC3 A;  2VPL A;  2VXZ A;  2X8K A;  3SEQ A;  1EFR A;  4BQO A;  2MC4 A;  2CV0 A;  4NK8 A;  4BJ5 C;  4TKO B;  4F52 A;  1UAA A;  2ZTN A;  3C2G A;  4BUP A;  3DKX A;  3H0D A;  2HVR A;  4NC7 A;  1RMG A;  2VJI A;  4F55 A;  3OFN A;  3OY9 A;  3K70 C;  3ZRG A;  2I8D A;  2X6W A;  1W36 C;  2IGK A;  3A3B A;  3S8P A;  4X0G A;  3DPL C;  3JUR A;  3RQ4 A;  4XOP A;  3OOC A;  5C1E A;  2M4K A;  1BR4 A;  2QKL B;  1SAU A;  4BAC A;  1JI8 A;  2MAB A;  3OAA A;  3QYF A;  4U4B A;  2GOX B;  1PKV A;  1RU4 A;  2WZP P;  1D0Z A;  4ZDP A;  3H94 A;  4ANJ A;  2QXZ A;  4E7L A;  2VQH A;  3OYK A;  2UVE A;  2O0V A;  1KZL A;  3BCA A;  3SEZ A;  2R7O A;  4NQW B;  1E1Q A;  2QKM B;  3PNY A;  2ZZG A;  2ELJ A;  4BJT A;  2X53 S;  1YX5 A;  3OS2 A;  4E6K G;  2W00 A;  4II3 A;  2CS3 A;  4Z05 A;  4BJ6 C;  3S3M A;  2ZZQ A;  4XON A;  3BH4 A;  3GVK A;  1IDJ A;  1NHC A;  3E1S A;  1UD6 A;  2BVM A;  2Y0S A;  1V5G A;  4BE0 A;  2XF5 A;  2R7X A;  1YE9 A;  4BQN A;  1D1A A;  3FPP A;  2PJR B;  4BQQ A;  2HPI A;  2P0W A;  1Z7L A;  2W4S A;  3OYF A;  3MKZ A;  4IKF A;  2VBK A;  5C1C A;  3FDY A;  2VJ4 A;  1O8K A;  2LRE A;  1PYV A;  4C30 A;  4P5O A;  3W2W A;  3OW7 A;  3AL0 B;  2GK6 A;  3RSN A;  4FAS D;  1HZE A;  3DQV C;  4BDY A;  3DTK A;  4BEH B;  1VBL A;  2UVF A;  2R7W A;  2LRD A;  3UNG C;  3OMY A;  4UZU A;  3CP2 A;  4TSF A;  2MFZ A;  2NST A;  3VSV A;  3T51 B;  3LSG A;  3OYM A;  1FMW A;  3SUC A;  2R7T A;  1N77 A;  2D3N A;  3OYH A;  2CW8 A;  3PUB A;  3K4K A;  3OE7 A;  1KON A;  2NT9 A;  1NRK A;  4URR A;  1K28 D;  4AVZ A;  3L2Q A;  3OWT A;  2W6I A;  1VZ0 A;  3CP8 A;  4CCN A;  5HNH A;  3F9K A;  2F43 A;  2GJK A;  3OS0 A;  4Z06 A;  3PNT A;  3AFH A;  3HG9 A;  5KCM A;  2ZSH B;  3K4N A;  4RMN A;  4XQF A;  3T9G A;  4XNF A;  3OR2 C;  4F92 B;  2Z2S B;  2O5R A;  4XOR A;  2V7Q A;  3DPT A;  3I3L A;  1J09 A;  4W8R A;  4PFP A;  4C9Y A;  1Y6I A;  2EWE A;  1OFL A;  4CZC A;  3CF2 A;  2V31 A;  4YZQ A;  2JVH A;  1YX3 A;  2WY7 Q;  4XM3 A;  3VMW A;  2CV2 A;  2XGJ A;  1QHH D;  2VBM A;  1X1C A;  1E3Z A;  1QHG A;  2W1O A;  2VQC A;  4HNT A;  1W0K A;  3H35 A;  1UG0 A;  1V5E A;  3G05 A;  3VMV A;  4RLF A;  3V42 A;  4F91 B;  1O8J A;  4R79 A;  3EUH C;  1X1D A;  2WJV A;  1NG7 A;  4ZDO A;  2PEC A;  2NSP A;  3LSH A;  1BHE A;  3BG7 A;  3AL0 C;  5CQG A;  4OJ5 A;  1X1A A;  1WJF A;  1TT0 A;  3W2A A;  2K9M A;  4EW9 A;  4CCJ A;  3T53 B;  1FX0 A;  2XOK A;  3A35 A;  4PUS A;  1E0E A;  2NTP A;  2LZJ A;  2Z8G A;  3QOE A;  2X1D A;  1H80 A;  1WJD A;  2XZO A;  4OJ6 A;  4W8Q A;  2E5N A;  3DKY A;  4KKT A;  1LVK A;  3KYL A;  2HDW A;  4OWR B;  3G2B A;  3PJR A;  2WPD A;  3B90 A;  1BOB A;  5FRN A;  2JJ1 A;  2UV1 A;  2F4I A;  4DJA A;  4HIZ A;  3GQ8 A;  1WFX A;  2A6T A;  1WPC A;  3M8J A;  1HA8 A;  3OYL A;  1HG8 A;  4OZY A;  4QPO A;  2WBM A;  2VKD A;  4CSW A;  1D0Y A;  1S9H A;  2PJR A;  1Z21 A;  4G7W A;  1TZL A;  4KKS A;  3NWS A;  1UD3 A;  3VYU B;  2JJ2 A;  2WB1 A;  3DLA A;  2ZFU A;  2KPM A;  2HQA A;  2R7R A;  2XF7 A;  1LKX A;  3D5R C;  2KRH A;  4XN0 A;  3VSL A;  4AYB A;  4J00 A;  3L2V A;  2VLA A;  4XN3 A;  2XC7 A;  4F3Q A;  5CPR B;  3HL2 A;  4KIT B;  4YZX A;  1PJR A;  1SKY B;  2X6X A;  2XZP A;  3DEE A;  3PFY A;  4KIS A;  3HPG A;  3L2W A;  5TGT A;  1W0J A;  3MD2 A;  1LDK B;  5FL7 A;  4U87 A;  2E5Z A;  2VJ5 A;  2DOA A;  1QJV A;  2BW3 B;  4YEL A;  3DTE A;  4E7K A;  4HST A;  1I8D A;  4OZZ A;  4GQN A;  2WY8 Q;  2X1C A;  3K4B A;  3GVJ A;  1AIR A;  2K5C A;  2VKH A;  2IS1 A;  1U0J A;  3IAM 2;  1O8H A;  2JUG A;  1K5C A;  5LD2 C;  2DCE A;  2W7N A;  1OR7 C;  5LFA A;  1X4O A;  2WAD A;  3RPU D;  3UR3 C;  2K9L A;  2IQ7 A;  1XG2 A;  3HOS A;  4CCL A;  5CDF A;  4NUB A;  1PLU A;  1KCC A;  1MND A;  2CMP A;  2QX3 A;  3VR6 A;  5JHF A;  3H5R A;  2LY1 A;  2KL4 A;  2LBF B;  5KNL A;  1UD5 A;  3DWL E;  3OL3 A;  2KZV A;  2F1M A;  3RCO A;  4IX7 A;  4P1W A;  3OL4 A;  3VYR B;  2O04 A;  4XL9 A;  1OGM X;  2VQL A;  3ZCO A;  1WJ5 A;  1UEL B;  2XAU A;  3EQN A;  3A4C A;  3OYN A;  2QY1 A;  4GRI A;  3HC7 A;  2V1N A;  4KT6 A;  2VB6 A;  1R6R A;  4W8S A;  3CJR B;  3A3G A;  1KTW A;  4CUG A;  1OGO X;  3B4N A;  1UD2 A;  4E7J A;  1G59 A;  4U7B A;  1RWR A;  1X4P A;  3PNV A;  3BCD A;  3VSU A;  4XLC A;  3VYS B;  4D9J A;  1OOC A;  3KEY A;  2PYH A;  3EPZ A;  3H5N A;  1E1R A;  4XMY A;  2LC2 A;  2M0M A;  2V9K A;  2GJP A;  4Z03 A;  2ODL A;  1KCD A;  2W6J A;  3BCF A;  1WMR A;  2KP6 A;  4LG3 A;  4OAZ A;  3GQ9 A;  3H9Q A;  4HRI A;  3K4C A;  4OJP A;  2IS4 A;  3SDB A;  3HXL A;  2ZZE A;  1O8D A;  3ZIA A;  1DBG A;  4JQF A;  4CCK A;  4C2U A;  2R9V A;  2HNH A;  2INU A;  1E79 A;  4HNU A;  1CZF A;  1MMA A;  2VXD A;  4ZTF A;  2F5V A;  3LL7 A;  5HNF A;  4E7H A;  4FXU A;  4PMH A;  4L8J A;  1VF7 A;  5HKK A;  3D5S C;  2NZM A;  2AQE A;  4G6T B;  2L2O A;  2WAF A;  2M7A A;  3K10 A;  5IK2 A;  3S93 A;  2L9N A;  2O0W A;  4ZYA A;  5HVQ C;  4Y4R A;  4B3G A;  4BGD A;  2E1M B;  3OEH A;  1WJE A;  2X1E A;  4XKV A;  2IGO A;  2X85 A;  4PSW A;  2R4G A;  2VJJ A;  3LMM A;  1MMD A;  3MMY B;  4HEA 2;  4J01 A;  2FUG 2;  4KJZ A;  2L7K A;  3LFU A;  3NE5 B;  4KKU A;  1O8M A;  3EQO A;  2X3H A;  3MKW B;  2BW3 A;  1P9Q C;  4H4K C;  4XOT A;  4XR6 A;  4EAT A;  3OS1 A;  1E3X A;  3D5L A;  1BPL A;  1WJB A;  3H9G A;  4QPQ A;  3ZPN A;  2WJY A;  3HAG A;  2O1D A;  3ZPP A;  2AQF A;  1O8L A;  3OYE A;  4ZTJ A;  1DQU A;  2XSJ C;  4B47 A;  1IB4 A;  1OLT A;  1WJC A;  4Y33 A;  2F6C A;  4BE1 A;  1NG6 A;  4PJM A;  1WJA A;  2UUZ A;  2ZXI A;  3OR1 C;  3OIQ A;  1T95 A;  1D1C A;  4U49 A;  4ZDL A;  4BS9 A;  3BLY A;  2RQQ A;  5CQE A;  3OYA A;  3VDX A;  1X1B A;  4B3X A;  1JTA A;  4HPQ A;  2HVS A;  1X0C A;  4I84 A;  4DOZ A;  4DK0 A;  2LBF A;  1BR1 A;  2UWM A;  4NNJ A;  2DIE A;  2MYS A;  4LIU A;  5CKT A;  3S3O A;  4PJN A;  4DBQ A;  3EUA A;  3VWB A;  2V4D A;  1LFP A;  3FHN A;  3ZGK A;  3LNN A;  1O8E A;  3H5A A;  2RRE A;  3VYT B;  2DT6 A;  2M3A A;  1N75 A;  1Z3Y A;  3HPH A;  2V26 A;  4II2 A;  1O8G A;  1UD4 A;  4JMQ A;  4B43 A;  2NT6 A;  4DBR A;  2M7B A;  3FBN B;  4DGW B;  3CZ6 A;  5AMV A;  1JRG A;  1ZEL A;  2NTB A;  1BMF A;  2E1M C;  4YRV A;  1QU3 A;  2KDO A;  2ZSI B;  3LSM A;  1DGR M;  2PYG A;  3DPU A;  2VBE A;  2R7V A;  4BEH A;  3A1Y A;  2CV1 A;  4NK6 A;  2OV7 A;  2LYC A;  3CES A;  3HKZ A;  1MAB A;  2BVL A;  4IZZ A;  4PFO A;  4YEJ A;  4ITV A;  3QYE A;  1NBM A;  1T5E A;  1OHH A;  3ZXS A;  2WAE A;  2A5W A;  1I18 A;  3KRG A;  2VAS A;  2OC6 A;  3IUO A;  2M5S A;  4G7X A;  4HG2 A;  3VSK A;  1O8F A;  1O88 A;  1H8E A;  3KEW A;  3CJQ B;  3K70 D;  4E7I A;  3UW0 A;  3ZSC A;  2INV A;  3ONQ A;  2WA0 A;  4XD7 A;  1W36 D;  3BG6 A;  4OJO A;  2HLD A;  2KHM A;  2VIX A;  1V0E A;  3FY3 A;  5FRM A;  3GVL A;  1BN8 A;  2WAQ A;  1EA3 A;  2HPM A;  3OYC A;  1G8X A;  4ASU A;  2LOO A;  3WWG A;  1MNE A;  4Z1M A;  2ZXH A;  3K4J A;  4DK1 A;  4YZA A;  3JU4 A;  4Y3O A;  4F93 B;  2RNG A;  4B48 A;  1QCX A;  4XKB A;  3L2R A;  4P22 A;  4MR0 A;  4C2L A;  3QYB A;  1WTH D;  3H9J A;  4BL0 B;  4DNR B;  2NOJ B;  2LY2 A;  1MMN A;  3S32 A;  4D1Q A;  3T56 B;  4NC8 A;  3PL8 A;  3OYG A;  4JOM A;  3OEE A;  3A2K A;  2JSP A;  3MKY B;  3L2U A;  1X19 A;  1COW A;  3DDY A;  2GOM A;  4OJL A;  1IA5 A;  3SZG A;  3DU5 A;  2CK3 A;  3W3C A;  4LIV A;  2M4G A;  2WSS A;  3QOD A;  1V0F A;  2CUJ A;  2CUZ A;  4IQ4 A;  2IGN A;  3W2V A;  2JIZ A;  2KQR A;  2V7F A;  3E0J B;  4PK4 A;  4XKC A;  1N78 A;  1H8H A;  2XF6 A;  5FRO A;  3CMM A;  3ZR8 X;  2BSP A;  4E7Z A;  3K4L A;  3U21 A;  3OOU A;  3B8Y A;  1Y56 A;  4B3F X;  4BXF A;  1BLI A;  3BCB A;  1EE6 A;  2ZTG A;  4BDZ A;  4YZ0 A;  1KMH A;  1K6Y A;  4PJL A;  5DN6 A;  2Z6B D;  1D1B A;  2Z1D A;  4TT3 A;  1OFM A;  4PSX A;  2HZD A;  1PE9 A;  2D3L A;  2IXS A;  4CA0 A;  2L5Q A;  2PMZ A;  3GQA A;  3GBG A;  2O17 A;  4HWV A;  4AU7 A;  2KLO A;  1BR2 A;  1O8I A;  3FKS A;  3RTR A;  1AA7 A;  2L9S A;  1IRX A;  2XDV A;  3GQB A;  1T0F C;  5HOO A;  4G6I A;  4YXW A;  3OYJ A;  4N4N B;  4OAY A;  3IAS 2;  3TL4 X;  2CH0 A;  3KX2 A;  1UD8 A;  2QE7 A;  2CFO A;  2XND A;  4MLO A;  1W9X A;  4CCO A;  1IDK A;  3DTI A;  2CW7 A;  4HSR A;  2DT7 B;  4CH7 A;  2E1B A;  2BOL A;  2ZZF A;  2R7U A;  4RM2 A;  3C2H A;  3HUG B;  2IGM A;  3LSK A;  3WQZ A;  1WP6 A;  1DGW Y;  4XLF A;  3DU6 A;  4RM3 A;  1FMV A;  2HVQ A;  3TBI A;  2Z16 A;  2JDI A;  4XLE A;  2MD0 A;  3TMO A;  3J7A Y;  2VL8 A;  3GRH A;  3OPO A;  2DXI A;  2E60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...