2IQ7A

Crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
ASCTFTDAAAAIKGKASCTSIILNGIVVPAGTTLDMTGLKSGTTVTFQGKTTFGYKEWEGPLISFSGTNININGASGHSIDCQGSRWWDSKGSNGGKTKPKFFYAHSLKSSNIKGLNVLNTPVQAFSINSATTLGVYDVIIDNSAGDSAGGHNTDAFDVGSSTGVYISGANVKNQDDCLAINSGTNITFTGGTCSGGHGLSIGSVGGRSDNTVKTVTISNSKIVNSDNGVRIKTVSGATGSVSGVTYSGITLSNIAKYGIVIEQDYENGSPTGTPTNGVPITGLTLSKITGSVASSGTNVYILCASGACSNWKWSGVSVTGGKKSTKCSNIPSGSGAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the endopolygalacturonase from the phytopathogenic fungus Colletotrichum lupini and its interaction with polygalacturonase-inhibiting proteins
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords endopolygalacturonase
total genus 123
structure length 339
sequence length 339
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2iq7A00
1O8GA 2UVEA 4XONA 2X6XA 1OOCA 3FY3A 4U49A 4OJLA 1IB4A 1O8MA 3KRGA 4Z03A 2ODLA 1O8LA 1RWRA 1OGOX 3SUCA 4C2LA 4HWVA 3JURA 1O8JA 2QY1A 4XM3A 1JRGA 4XKWA 2NSTA 1RMGA 1DBOA 1QCXA 3T9GA 1X0CA 1O8KA 4OZZA 1DBGA 3B8YA 2UVFA 1NHCA 3EQOA 1HG8A 2QXZA 1RU4A 1O8DA 2NSPA 2NZMA 1O8HA 4XN0A 4Z06A 5C1CA 2NT6A 3GQ8A 1O88A 2PYGA 2X6YA 2EWEA 2INUA 1QJVA 1VBLA 4XKVA 2NTPA 2NTQA 3VSTA 1CZFA 4XMYA 3B4NA 1K5CA 2X85A 2Z8GA 3GQ7A 3WWGA 2O0WA 1XG2A 1PE9A 1O8EA 5C1EA 1IA5A 1OGMX 3GQ9A 4W8RA 4YZQA 1OFMA 1GQ8A 3GQAA 3VSUA 1IDJA 2X6WA 4W8SA 4XORA 4U4BA 3GRHA 2INVA 4YELA 4YZAA 4Z05A 2QX3A 4OJOA 4OJ5A 4AVZA 4OJ6A 4YZXA 3ZPPA 4W8QA 4PMHA 1KCCA 2VBEA 1JTAA 4OZYA 1BHEA 1BN8A 4W8TA 4XR6A 1KTWA 4I84A 2NTBA 1H80A 4XLAA 3UW0A 1PLUA 2O0VA 4MR0A 2PECA 2VJJA 1WMRA 4XLFA 4XLEA 3B90A 3LMWA 4NK8A 5AMVA 2O04A 4XLCA 1IDKA 4XOPA 2NT9A 4XLHA 4XQFA 2VJIA 3EQNA 2VBMA 4YEJA 3VMWA 2VBKA 2X3HA 2PYHA 1OFLA 4XOTA 1AIRA 4OJPA 1O8FA 1PXZA 2IQ7A 2O1DA 4NK6A 4URRA 4MXNA 3ZSCA 2BSPA 3VMVA 4XNFA 1KCDA 3VSVA 4EW9A 4XL9A 1O8IA 4YZ0A 1EE6A 4XN3A 2O17A
chains in the Genus database with same CATH superfamily
1O8GA 2UVEA 4XONA 1DABA 2X6XA 1OOCA 4YDTA 3FY3A 4U49A 4OM9A 2BM6A 3SQVA 3JX8A 2VFPA 4OJLA 1IB4A 1K4ZA 1O8MA 3KRGA 3N90A 4Z03A 2ODLA 1O8LA 1RWRA 1OGOX 3H09A 3SUCA 2XTYA 4V02C 4C2LA 4HWVA 3JURA 1O8JA 4YC5A 2QY1A 1KQ5A 4XM3A 4JRAC 1QA1A 1JRGA 4XKWA 1LM1A 1OFDA 2NSTA 3DU1X 1RMGA 1DBOA 1QCXA 3ML3A 3RIQA 1X0CA 3T9GA 3SYJA 1TYWA 1O8KA 2XT2A 4OZZA 1DBGA 1QRCA 3B8YA 2BM5A 2UVFA 1K8FA 5JMCB 1NHCA 3EQOA 3PSZA 1TYXA 1HG8A 2BM7A 2QXZA 5JLVC 1RU4A 1O8DA 1QA2A 2NSPA 1L1IA 2NZMA 1O8HA 4XN0A 4Z06A 5C1CA 2NT6A 2O6WA 2YUHA 3GQ8A 1EZGA 1O88A 2PYGA 2VFQA 3TH0A 2X6YA 2EWEA 2INUA 1QJVA 1VBLA 4XKVA 2NTPA 2QYUA 2NTQA 3VSTA 1QQ1A 3BH7B 1CZFA 4XMYA 3B4NA 1K5CA 2X85A 2Z8GA 2B0RA 2XC1A 3GQ7A 2J8KA 1XG2A 2O0WA 1PE9A 2VFNA 1O8EA 3BH6B 2W7ZA 5C1EA 1IA5A 1QA3A 5DNSA 1OGMX 3GQ9A 4W8RA 4YZQA 1OFMA 1GQ8A 3GQAA 3AK5A 3VSUA 1IDJA 2X6WA 4W8SA 4XORA 4U4BA 3GRHA 2INVA 4YELA 4YZAA 4Z05A 3N6ZA 1CLWA 3NAWA 4YCQA 2QX3A 3SZEA 4OJOA 3NB2A 1TSPA 4OJ5A 4AVZA 4OJ6A 4YZXA 3LYCA 3ZPPA 4W8QA 4PMHA 1KCCA 2XTWA 2VBEA 1JTAA 1TYUA 4OZYA 1BHEA 1BN8A 4W8TA 4XR6A 3WWGA 1KTWA 4I84A 2NTBA 1H80A 4XLAA 2XTXA 2VFMA 3UW0A 4YFOA 2V5IA 1PLUA 1EA0A 2O0VA 4MR0A 1HF2A 2PECA 2VJJA 1WMRA 4OPWA 4XLFA 2IOUG 3B90A 4XLEA 4YEIA 3LMWA 1OFEA 4NK8A 5AMVA 2O04A 4XLCA 2G0YA 1IDKA 3P4GA 1LLZA 2NT9A 1QRBA 4XLHA 4XOPA 4XQFA 2VJIA 2XT4A 3LJYA 3EQNA 2VBMA 4YEJA 3VMWA 2VBKA 1LLWA 2F3LA 2PYHA 2X3HA 2J8IA 1OFLA 2QZAA 4XN3A 4XOTA 1WXRA 1AIRA 4OJPA 1O8FA 1PXZA 2IQ7A 2O1DA 4NK6A 4URRA 4MXNA 3ZSCA 2BM4A 2BSPA 3VMVA 3SY2A 3PSSA 1TYVA 3PETA 4XNFA 2VFOA 1KCDA 4KH3A 3VSVA 4EW9A 4XL9A 1O8IA 4YZ0A 1EE6A 2BX6A 2O17A
chains in the Genus database with same CATH topology
1O8GA 2UVEA 4XONA 2X6XA 1OOCA 3FY3A 4U49A 4OJLA 1IB4A 1O8MA 3KRGA 4Z03A 2ODLA 1O8LA 1RWRA 1OGOX 3SUCA 4C2LA 4HWVA 3JURA 1O8JA 2QY1A 4XM3A 1JRGA 4XKWA 2NSTA 1RMGA 1DBOA 1QCXA 3T9GA 1X0CA 1O8KA 4OZZA 1DBGA 3B8YA 2UVFA 1NHCA 3EQOA 1HG8A 2QXZA 1RU4A 1O8DA 2NSPA 2NZMA 1O8HA 4XN0A 4Z06A 5C1CA 2NT6A 3GQ8A 1O88A 2PYGA 2X6YA 2EWEA 2INUA 1QJVA 1VBLA 4XKVA 2NTPA 2NTQA 3VSTA 1CZFA 4XMYA 3B4NA 1K5CA 2X85A 2Z8GA 3GQ7A 3WWGA 2O0WA 1XG2A 1PE9A 1O8EA 5C1EA 1IA5A 1OGMX 3GQ9A 4W8RA 4YZQA 1OFMA 1GQ8A 3GQAA 3VSUA 1IDJA 2X6WA 4W8SA 4XORA 4U4BA 3GRHA 2INVA 4YELA 4YZAA 4Z05A 2QX3A 4OJOA 4OJ5A 4AVZA 4OJ6A 4YZXA 3ZPPA 4W8QA 4PMHA 1KCCA 2VBEA 1JTAA 4OZYA 1BHEA 1BN8A 4W8TA 4XR6A 1KTWA 4I84A 2NTBA 1H80A 4XLAA 3UW0A 1PLUA 2O0VA 4MR0A 2PECA 2VJJA 1WMRA 4XLFA 4XLEA 3B90A 3LMWA 4NK8A 5AMVA 2O04A 4XLCA 1IDKA 4XOPA 2NT9A 4XLHA 4XQFA 2VJIA 3EQNA 2VBMA 4YEJA 3VMWA 2VBKA 2X3HA 2PYHA 1OFLA 4XOTA 1AIRA 4OJPA 1O8FA 1PXZA 2IQ7A 2O1DA 4NK6A 4URRA 4MXNA 3ZSCA 2BSPA 3VMVA 4XNFA 1KCDA 3VSVA 4EW9A 4XL9A 1O8IA 4YZ0A 1EE6A 4XN3A 2O17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8G A;  2UVE A;  4XON A;  2X6X A;  1OOC A;  3FY3 A;  4U49 A;  4OJL A;  1IB4 A;  1O8M A;  3KRG A;  4Z03 A;  2ODL A;  1O8L A;  1RWR A;  1OGO X;  3SUC A;  4C2L A;  4HWV A;  3JUR A;  1O8J A;  2QY1 A;  4XM3 A;  1JRG A;  4XKW A;  2NST A;  1RMG A;  1DBO A;  1QCX A;  3T9G A;  1X0C A;  1O8K A;  4OZZ A;  1DBG A;  3B8Y A;  2UVF A;  1NHC A;  3EQO A;  1HG8 A;  2QXZ A;  1RU4 A;  1O8D A;  2NSP A;  2NZM A;  1O8H A;  4XN0 A;  4Z06 A;  5C1C A;  2NT6 A;  3GQ8 A;  1O88 A;  2PYG A;  2X6Y A;  2EWE A;  2INU A;  1QJV A;  1VBL A;  4XKV A;  2NTP A;  2NTQ A;  3VST A;  1CZF A;  4XMY A;  3B4N A;  1K5C A;  2X85 A;  2Z8G A;  3GQ7 A;  3WWG A;  2O0W A;  1XG2 A;  1PE9 A;  1O8E A;  5C1E A;  1IA5 A;  1OGM X;  3GQ9 A;  4W8R A;  4YZQ A;  1OFM A;  1GQ8 A;  3GQA A;  3VSU A;  1IDJ A;  2X6W A;  4W8S A;  4XOR A;  4U4B A;  3GRH A;  2INV A;  4YEL A;  4YZA A;  4Z05 A;  2QX3 A;  4OJO A;  4OJ5 A;  4AVZ A;  4OJ6 A;  4YZX A;  3ZPP A;  4W8Q A;  4PMH A;  1KCC A;  2VBE A;  1JTA A;  4OZY A;  1BHE A;  1BN8 A;  4W8T A;  4XR6 A;  1KTW A;  4I84 A;  2NTB A;  1H80 A;  4XLA A;  3UW0 A;  1PLU A;  2O0V A;  4MR0 A;  2PEC A;  2VJJ A;  1WMR A;  4XLF A;  4XLE A;  3B90 A;  3LMW A;  4NK8 A;  5AMV A;  2O04 A;  4XLC A;  1IDK A;  4XOP A;  2NT9 A;  4XLH A;  4XQF A;  2VJI A;  3EQN A;  2VBM A;  4YEJ A;  3VMW A;  2VBK A;  2X3H A;  2PYH A;  1OFL A;  4XOT A;  1AIR A;  4OJP A;  1O8F A;  1PXZ A;  2IQ7 A;  2O1D A;  4NK6 A;  4URR A;  4MXN A;  3ZSC A;  2BSP A;  3VMV A;  4XNF A;  1KCD A;  3VSV A;  4EW9 A;  4XL9 A;  1O8I A;  4YZ0 A;  1EE6 A;  4XN3 A;  2O17 A; 
#chains in the Genus database with same CATH topology
 1O8G A;  2UVE A;  4XON A;  1DAB A;  2X6X A;  1OOC A;  4YDT A;  3FY3 A;  4U49 A;  4OM9 A;  2BM6 A;  3SQV A;  3JX8 A;  2VFP A;  4OJL A;  1IB4 A;  1K4Z A;  1O8M A;  3KRG A;  3N90 A;  4Z03 A;  2ODL A;  1O8L A;  1RWR A;  1OGO X;  3H09 A;  3SUC A;  2XTY A;  4V02 C;  4C2L A;  4HWV A;  3JUR A;  1O8J A;  4YC5 A;  2QY1 A;  1KQ5 A;  4XM3 A;  4JRA C;  1QA1 A;  1JRG A;  4XKW A;  1LM1 A;  1OFD A;  2NST A;  3DU1 X;  1RMG A;  1DBO A;  1QCX A;  3ML3 A;  3RIQ A;  1X0C A;  3T9G A;  3SYJ A;  1TYW A;  1O8K A;  2XT2 A;  4OZZ A;  1DBG A;  1QRC A;  3B8Y A;  2BM5 A;  2UVF A;  1K8F A;  5JMC B;  1NHC A;  3EQO A;  3PSZ A;  1TYX A;  1HG8 A;  2BM7 A;  2QXZ A;  5JLV C;  1RU4 A;  1O8D A;  1QA2 A;  2NSP A;  1L1I A;  2NZM A;  1O8H A;  4XN0 A;  4Z06 A;  5C1C A;  2NT6 A;  2O6W A;  2YUH A;  3GQ8 A;  1EZG A;  1O88 A;  2PYG A;  2VFQ A;  3TH0 A;  2X6Y A;  2EWE A;  2INU A;  1QJV A;  1VBL A;  4XKV A;  2NTP A;  2QYU A;  2NTQ A;  3VST A;  1QQ1 A;  3BH7 B;  1CZF A;  4XMY A;  3B4N A;  1K5C A;  2X85 A;  2Z8G A;  2B0R A;  2XC1 A;  3GQ7 A;  2J8K A;  1XG2 A;  2O0W A;  1PE9 A;  2VFN A;  1O8E A;  3BH6 B;  2W7Z A;  5C1E A;  1IA5 A;  1QA3 A;  5DNS A;  1OGM X;  3GQ9 A;  4W8R A;  4YZQ A;  1OFM A;  1GQ8 A;  3GQA A;  3AK5 A;  3VSU A;  1IDJ A;  2X6W A;  4W8S A;  4XOR A;  4U4B A;  3GRH A;  2INV A;  4YEL A;  4YZA A;  4Z05 A;  3N6Z A;  1CLW A;  3NAW A;  4YCQ A;  2QX3 A;  3SZE A;  4OJO A;  3NB2 A;  1TSP A;  4OJ5 A;  4AVZ A;  4OJ6 A;  4YZX A;  3LYC A;  3ZPP A;  4W8Q A;  4PMH A;  1KCC A;  2XTW A;  2VBE A;  1JTA A;  1TYU A;  4OZY A;  1BHE A;  1BN8 A;  4W8T A;  4XR6 A;  3WWG A;  1KTW A;  4I84 A;  2NTB A;  1H80 A;  4XLA A;  2XTX A;  2VFM A;  3UW0 A;  4YFO A;  2V5I A;  1PLU A;  1EA0 A;  2O0V A;  4MR0 A;  1HF2 A;  2PEC A;  2VJJ A;  1WMR A;  4OPW A;  4XLF A;  2IOU G;  3B90 A;  4XLE A;  4YEI A;  3LMW A;  1OFE A;  4NK8 A;  5AMV A;  2O04 A;  4XLC A;  2G0Y A;  1IDK A;  3P4G A;  1LLZ A;  2NT9 A;  1QRB A;  4XLH A;  4XOP A;  4XQF A;  2VJI A;  2XT4 A;  3LJY A;  3EQN A;  2VBM A;  4YEJ A;  3VMW A;  2VBK A;  1LLW A;  2F3L A;  2PYH A;  2X3H A;  2J8I A;  1OFL A;  2QZA A;  4XN3 A;  4XOT A;  1WXR A;  1AIR A;  4OJP A;  1O8F A;  1PXZ A;  2IQ7 A;  2O1D A;  4NK6 A;  4URR A;  4MXN A;  3ZSC A;  2BM4 A;  2BSP A;  3VMV A;  3SY2 A;  3PSS A;  1TYV A;  3PET A;  4XNF A;  2VFO A;  1KCD A;  4KH3 A;  3VSV A;  4EW9 A;  4XL9 A;  1O8I A;  4YZ0 A;  1EE6 A;  2BX6 A;  2O17 A; 
#chains in the Genus database with same CATH homology
 1O8G A;  2UVE A;  4XON A;  2X6X A;  1OOC A;  3FY3 A;  4U49 A;  4OJL A;  1IB4 A;  1O8M A;  3KRG A;  4Z03 A;  2ODL A;  1O8L A;  1RWR A;  1OGO X;  3SUC A;  4C2L A;  4HWV A;  3JUR A;  1O8J A;  2QY1 A;  4XM3 A;  1JRG A;  4XKW A;  2NST A;  1RMG A;  1DBO A;  1QCX A;  3T9G A;  1X0C A;  1O8K A;  4OZZ A;  1DBG A;  3B8Y A;  2UVF A;  1NHC A;  3EQO A;  1HG8 A;  2QXZ A;  1RU4 A;  1O8D A;  2NSP A;  2NZM A;  1O8H A;  4XN0 A;  4Z06 A;  5C1C A;  2NT6 A;  3GQ8 A;  1O88 A;  2PYG A;  2X6Y A;  2EWE A;  2INU A;  1QJV A;  1VBL A;  4XKV A;  2NTP A;  2NTQ A;  3VST A;  1CZF A;  4XMY A;  3B4N A;  1K5C A;  2X85 A;  2Z8G A;  3GQ7 A;  3WWG A;  2O0W A;  1XG2 A;  1PE9 A;  1O8E A;  5C1E A;  1IA5 A;  1OGM X;  3GQ9 A;  4W8R A;  4YZQ A;  1OFM A;  1GQ8 A;  3GQA A;  3VSU A;  1IDJ A;  2X6W A;  4W8S A;  4XOR A;  4U4B A;  3GRH A;  2INV A;  4YEL A;  4YZA A;  4Z05 A;  2QX3 A;  4OJO A;  4OJ5 A;  4AVZ A;  4OJ6 A;  4YZX A;  3ZPP A;  4W8Q A;  4PMH A;  1KCC A;  2VBE A;  1JTA A;  4OZY A;  1BHE A;  1BN8 A;  4W8T A;  4XR6 A;  1KTW A;  4I84 A;  2NTB A;  1H80 A;  4XLA A;  3UW0 A;  1PLU A;  2O0V A;  4MR0 A;  2PEC A;  2VJJ A;  1WMR A;  4XLF A;  4XLE A;  3B90 A;  3LMW A;  4NK8 A;  5AMV A;  2O04 A;  4XLC A;  1IDK A;  4XOP A;  2NT9 A;  4XLH A;  4XQF A;  2VJI A;  3EQN A;  2VBM A;  4YEJ A;  3VMW A;  2VBK A;  2X3H A;  2PYH A;  1OFL A;  4XOT A;  1AIR A;  4OJP A;  1O8F A;  1PXZ A;  2IQ7 A;  2O1D A;  4NK6 A;  4URR A;  4MXN A;  3ZSC A;  2BSP A;  3VMV A;  4XNF A;  1KCD A;  3VSV A;  4EW9 A;  4XL9 A;  1O8I A;  4YZ0 A;  1EE6 A;  4XN3 A;  2O17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...