2IQ7A

Crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
ASCTFTDAAAAIKGKASCTSIILNGIVVPAGTTLDMTGLKSGTTVTFQGKTTFGYKEWEGPLISFSGTNININGASGHSIDCQGSRWWDSKGSNGGKTKPKFFYAHSLKSSNIKGLNVLNTPVQAFSINSATTLGVYDVIIDNSAGDSAGGHNTDAFDVGSSTGVYISGANVKNQDDCLAINSGTNITFTGGTCSGGHGLSIGSVGGRSDNTVKTVTISNSKIVNSDNGVRIKTVSGATGSVSGVTYSGITLSNIAKYGIVIEQDYENGSPTGTPTNGVPITGLTLSKITGSVASSGTNVYILCASGACSNWKWSGVSVTGGKKSTKCSNIPSGSGAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the endopolygalacturonase from the phytopathogenic fungus Colletotrichum lupini and its interaction with polygalacturonase-inhibiting proteins
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords endopolygalacturonase
total genus 123
structure length 339
sequence length 339
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2iq7A00
1IB4A 4W8RA 4XLAA 4XNFA 4Z05A 1O8EA 1OGMX 1JRGA 1OFLA 3WWGA 2EWEA 3VSTA 1NHCA 3JURA 1O8JA 2O04A 2VBEA 3T9GA 4OJOA 1HG8A 3KRGA 4OZZA 4MR0A 2VJJA 2X6YA 1EE6A 2QXZA 4OJLA 4XLFA 5C1CA 1KCCA 3SUCA 4XOTA 1OOCA 4W8QA 1WMRA 4XORA 1PE9A 1O8HA 1DBGA 3VSVA 3EQOA 2QX3A 2O0VA 1O8IA 2X3HA 2NSPA 1BN8A 4NK6A 2ODLA 3ZSCA 4PMHA 3FY3A 3B4NA 1KTWA 4YZQA 5C1EA 1BHEA 1CZFA 2NT9A 2BSPA 1GQ8A 4XOPA 4XN3A 4AVZA 4Z03A 2UVFA 1JTAA 1DBOA 2NZMA 2X6XA 3GQAA 1VBLA 1RMGA 4OJ5A 1XG2A 1O8MA 2X6WA 4XKVA 3UW0A 1PLUA 3GQ8A 2PECA 2IQ7A 1O8DA 1O8LA 3LMWA 2NSTA 1OFMA 1PXZA 1RU4A 2VBKA 4OJPA 3GRHA 3GQ9A 1O8FA 1IDJA 2O1DA 4YZAA 1X0CA 2PYHA 2Z8GA 1QCXA 1IDKA 4XM3A 4YZXA 4XLEA 4XN0A 4OJ6A 1RWRA 2NTQA 4OZYA 1O8KA 3VSUA 2NT6A 2QY1A 5AMVA 4NK8A 4YZ0A 2UVEA 4U49A 2VBMA 2O17A 4HWVA 4MXNA 3EQNA 3VMWA 2INVA 2PYGA 3GQ7A 1OGOX 1QJVA 4XL9A 1K5CA 4YELA 1O8GA 2INUA 4W8SA 2VJIA 1KCDA 1H80A 4U4BA 4W8TA 2X85A 4XR6A 4C2LA 3VMVA 4EW9A 4I84A 1IA5A 4XMYA 4XLHA 4XQFA 2NTBA 4URRA 4Z06A 4XLCA 2NTPA 3B8YA 3ZPPA 2O0WA 4YEJA 3B90A 1O88A 4XKWA 1AIRA 4XONA
chains in the Genus database with same CATH superfamily
2BM6A 1IB4A 4W8RA 4XLAA 4XNFA 4Z05A 1O8EA 1OGMX 3SZEA 1JRGA 1OFLA 1LLZA 3WWGA 2EWEA 3VSTA 5JLVC 1NHCA 3JURA 1LLWA 1O8JA 2O04A 2VBEA 1TYXA 3T9GA 4OJOA 1HG8A 3KRGA 4OZZA 2XT2A 2J8KA 4MR0A 2VJJA 2X6YA 1EE6A 2QXZA 4OJLA 4XLFA 3LYCA 1QQ1A 3AK5A 2G0YA 2YUHA 5C1CA 1KCCA 3SUCA 3ML3A 4XOTA 2VFOA 1OOCA 2XC1A 4V02C 4W8QA 3RIQA 1WMRA 4XORA 1PE9A 1O8HA 1DBGA 3VSVA 2BM5A 3EQOA 2QX3A 3PSSA 2O0VA 1O8IA 2X3HA 2NSPA 1BN8A 4NK6A 2ODLA 1TYVA 3ZSCA 3N90A 4PMHA 3FY3A 3DU1X 3NAWA 3B4NA 1KTWA 4YZQA 5C1EA 3P4GA 1BHEA 3NB2A 1CZFA 2NT9A 2BSPA 1GQ8A 2XTYA 4XOPA 1TYWA 2QZAA 4YFOA 4XN3A 2XTXA 4AVZA 4Z03A 2UVFA 1JTAA 1DABA 1DBOA 1OFDA 2NZMA 2X6XA 3GQAA 1VBLA 1RMGA 1CLWA 4OJ5A 1XG2A 2VFPA 1O8MA 2J8IA 1TYUA 1QA1A 2X6WA 4XKVA 3UW0A 1PLUA 4KH3A 5JMCB 3GQ8A 2PECA 2VFQA 2IQ7A 2F3LA 2B0RA 1O8DA 4JRAC 2XTWA 3SY2A 1O8LA 2XT4A 3LMWA 1K8FA 4YEIA 2BM4A 1LM1A 2NSTA 2W7ZA 3BH6B 1OFMA 1PXZA 1RU4A 2VBKA 4OJPA 3GRHA 3GQ9A 1O8FA 3JX8A 1TSPA 1IDJA 2O1DA 4YZAA 5DNSA 1X0CA 4OM9A 2PYHA 1EA0A 1HF2A 1QCXA 1IDKA 2QYUA 2Z8GA 4XM3A 1QA3A 2VFNA 4YZXA 4XLEA 4XN0A 4OJ6A 1RWRA 2NTQA 3N6ZA 4OZYA 3PETA 1O8KA 3VSUA 2NT6A 2QY1A 3SYJA 5AMVA 4NK8A 4YZ0A 2UVEA 4U49A 2VFMA 2VBMA 2O17A 1QA2A 4HWVA 4MXNA 3EQNA 3VMWA 2INVA 1QRBA 2O6WA 2PYGA 3GQ7A 1QRCA 4OPWA 1OGOX 1QJVA 1K4ZA 4XL9A 1WXRA 1K5CA 4YELA 1O8GA 2INUA 4W8SA 2VJIA 4YC5A 1KCDA 3H09A 1H80A 4U4BA 4W8TA 1EZGA 4YCQA 2X85A 4XR6A 4C2LA 3VMVA 4EW9A 4I84A 1IA5A 4XMYA 4XLHA 1OFEA 4XQFA 2NTBA 4URRA 4Z06A 3SQVA 4XLCA 2NTPA 2IOUG 1KQ5A 3B8YA 3ZPPA 3PSZA 2O0WA 4YEJA 2V5IA 4YDTA 3B90A 3BH7B 1O88A 4XKWA 1L1IA 2BM7A 2BX6A 1AIRA 3LJYA 3TH0A 4XONA
chains in the Genus database with same CATH topology
1IB4A 4W8RA 4XLAA 4XNFA 4Z05A 1O8EA 1OGMX 1JRGA 1OFLA 3WWGA 2EWEA 3VSTA 1NHCA 3JURA 1O8JA 2O04A 2VBEA 3T9GA 4OJOA 1HG8A 3KRGA 4OZZA 4MR0A 2VJJA 2X6YA 1EE6A 2QXZA 4OJLA 4XLFA 5C1CA 1KCCA 3SUCA 4XOTA 1OOCA 4W8QA 1WMRA 4XORA 1PE9A 1O8HA 1DBGA 3VSVA 3EQOA 2QX3A 2O0VA 1O8IA 2X3HA 2NSPA 1BN8A 4NK6A 2ODLA 3ZSCA 4PMHA 3FY3A 3B4NA 1KTWA 4YZQA 5C1EA 1BHEA 1CZFA 2NT9A 2BSPA 1GQ8A 4XOPA 4XN3A 4AVZA 4Z03A 2UVFA 1JTAA 1DBOA 2NZMA 2X6XA 3GQAA 1VBLA 1RMGA 4OJ5A 1XG2A 1O8MA 2X6WA 4XKVA 3UW0A 1PLUA 3GQ8A 2PECA 2IQ7A 1O8DA 1O8LA 3LMWA 2NSTA 1OFMA 1PXZA 1RU4A 2VBKA 4OJPA 3GRHA 3GQ9A 1O8FA 1IDJA 2O1DA 4YZAA 1X0CA 2PYHA 2Z8GA 1QCXA 1IDKA 4XM3A 4YZXA 4XLEA 4XN0A 4OJ6A 1RWRA 2NTQA 4OZYA 1O8KA 3VSUA 2NT6A 2QY1A 5AMVA 4NK8A 4YZ0A 2UVEA 4U49A 2VBMA 2O17A 4HWVA 4MXNA 3EQNA 3VMWA 2INVA 2PYGA 3GQ7A 1OGOX 1QJVA 4XL9A 1K5CA 4YELA 1O8GA 2INUA 4W8SA 2VJIA 1KCDA 1H80A 4U4BA 4W8TA 2X85A 4XR6A 4C2LA 3VMVA 4EW9A 4I84A 1IA5A 4XMYA 4XLHA 4XQFA 2NTBA 4URRA 4Z06A 4XLCA 2NTPA 3B8YA 3ZPPA 2O0WA 4YEJA 3B90A 1O88A 4XKWA 1AIRA 4XONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IB4 A;  4W8R A;  4XLA A;  4XNF A;  4Z05 A;  1O8E A;  1OGM X;  1JRG A;  1OFL A;  3WWG A;  2EWE A;  3VST A;  1NHC A;  3JUR A;  1O8J A;  2O04 A;  2VBE A;  3T9G A;  4OJO A;  1HG8 A;  3KRG A;  4OZZ A;  4MR0 A;  2VJJ A;  2X6Y A;  1EE6 A;  2QXZ A;  4OJL A;  4XLF A;  5C1C A;  1KCC A;  3SUC A;  4XOT A;  1OOC A;  4W8Q A;  1WMR A;  4XOR A;  1PE9 A;  1O8H A;  1DBG A;  3VSV A;  3EQO A;  2QX3 A;  2O0V A;  1O8I A;  2X3H A;  2NSP A;  1BN8 A;  4NK6 A;  2ODL A;  3ZSC A;  4PMH A;  3FY3 A;  3B4N A;  1KTW A;  4YZQ A;  5C1E A;  1BHE A;  1CZF A;  2NT9 A;  2BSP A;  1GQ8 A;  4XOP A;  4XN3 A;  4AVZ A;  4Z03 A;  2UVF A;  1JTA A;  1DBO A;  2NZM A;  2X6X A;  3GQA A;  1VBL A;  1RMG A;  4OJ5 A;  1XG2 A;  1O8M A;  2X6W A;  4XKV A;  3UW0 A;  1PLU A;  3GQ8 A;  2PEC A;  2IQ7 A;  1O8D A;  1O8L A;  3LMW A;  2NST A;  1OFM A;  1PXZ A;  1RU4 A;  2VBK A;  4OJP A;  3GRH A;  3GQ9 A;  1O8F A;  1IDJ A;  2O1D A;  4YZA A;  1X0C A;  2PYH A;  2Z8G A;  1QCX A;  1IDK A;  4XM3 A;  4YZX A;  4XLE A;  4XN0 A;  4OJ6 A;  1RWR A;  2NTQ A;  4OZY A;  1O8K A;  3VSU A;  2NT6 A;  2QY1 A;  5AMV A;  4NK8 A;  4YZ0 A;  2UVE A;  4U49 A;  2VBM A;  2O17 A;  4HWV A;  4MXN A;  3EQN A;  3VMW A;  2INV A;  2PYG A;  3GQ7 A;  1OGO X;  1QJV A;  4XL9 A;  1K5C A;  4YEL A;  1O8G A;  2INU A;  4W8S A;  2VJI A;  1KCD A;  1H80 A;  4U4B A;  4W8T A;  2X85 A;  4XR6 A;  4C2L A;  3VMV A;  4EW9 A;  4I84 A;  1IA5 A;  4XMY A;  4XLH A;  4XQF A;  2NTB A;  4URR A;  4Z06 A;  4XLC A;  2NTP A;  3B8Y A;  3ZPP A;  2O0W A;  4YEJ A;  3B90 A;  1O88 A;  4XKW A;  1AIR A;  4XON A; 
#chains in the Genus database with same CATH topology
 2BM6 A;  1IB4 A;  4W8R A;  4XLA A;  4XNF A;  4Z05 A;  1O8E A;  1OGM X;  3SZE A;  1JRG A;  1OFL A;  1LLZ A;  3WWG A;  2EWE A;  3VST A;  5JLV C;  1NHC A;  3JUR A;  1LLW A;  1O8J A;  2O04 A;  2VBE A;  1TYX A;  3T9G A;  4OJO A;  1HG8 A;  3KRG A;  4OZZ A;  2XT2 A;  2J8K A;  4MR0 A;  2VJJ A;  2X6Y A;  1EE6 A;  2QXZ A;  4OJL A;  4XLF A;  3LYC A;  1QQ1 A;  3AK5 A;  2G0Y A;  2YUH A;  5C1C A;  1KCC A;  3SUC A;  3ML3 A;  4XOT A;  2VFO A;  1OOC A;  2XC1 A;  4V02 C;  4W8Q A;  3RIQ A;  1WMR A;  4XOR A;  1PE9 A;  1O8H A;  1DBG A;  3VSV A;  2BM5 A;  3EQO A;  2QX3 A;  3PSS A;  2O0V A;  1O8I A;  2X3H A;  2NSP A;  1BN8 A;  4NK6 A;  2ODL A;  1TYV A;  3ZSC A;  3N90 A;  4PMH A;  3FY3 A;  3DU1 X;  3NAW A;  3B4N A;  1KTW A;  4YZQ A;  5C1E A;  3P4G A;  1BHE A;  3NB2 A;  1CZF A;  2NT9 A;  2BSP A;  1GQ8 A;  2XTY A;  4XOP A;  1TYW A;  2QZA A;  4YFO A;  4XN3 A;  2XTX A;  4AVZ A;  4Z03 A;  2UVF A;  1JTA A;  1DAB A;  1DBO A;  1OFD A;  2NZM A;  2X6X A;  3GQA A;  1VBL A;  1RMG A;  1CLW A;  4OJ5 A;  1XG2 A;  2VFP A;  1O8M A;  2J8I A;  1TYU A;  1QA1 A;  2X6W A;  4XKV A;  3UW0 A;  1PLU A;  4KH3 A;  5JMC B;  3GQ8 A;  2PEC A;  2VFQ A;  2IQ7 A;  2F3L A;  2B0R A;  1O8D A;  4JRA C;  2XTW A;  3SY2 A;  1O8L A;  2XT4 A;  3LMW A;  1K8F A;  4YEI A;  2BM4 A;  1LM1 A;  2NST A;  2W7Z A;  3BH6 B;  1OFM A;  1PXZ A;  1RU4 A;  2VBK A;  4OJP A;  3GRH A;  3GQ9 A;  1O8F A;  3JX8 A;  1TSP A;  1IDJ A;  2O1D A;  4YZA A;  5DNS A;  1X0C A;  4OM9 A;  2PYH A;  1EA0 A;  1HF2 A;  1QCX A;  1IDK A;  2QYU A;  2Z8G A;  4XM3 A;  1QA3 A;  2VFN A;  4YZX A;  4XLE A;  4XN0 A;  4OJ6 A;  1RWR A;  2NTQ A;  3N6Z A;  4OZY A;  3PET A;  1O8K A;  3VSU A;  2NT6 A;  2QY1 A;  3SYJ A;  5AMV A;  4NK8 A;  4YZ0 A;  2UVE A;  4U49 A;  2VFM A;  2VBM A;  2O17 A;  1QA2 A;  4HWV A;  4MXN A;  3EQN A;  3VMW A;  2INV A;  1QRB A;  2O6W A;  2PYG A;  3GQ7 A;  1QRC A;  4OPW A;  1OGO X;  1QJV A;  1K4Z A;  4XL9 A;  1WXR A;  1K5C A;  4YEL A;  1O8G A;  2INU A;  4W8S A;  2VJI A;  4YC5 A;  1KCD A;  3H09 A;  1H80 A;  4U4B A;  4W8T A;  1EZG A;  4YCQ A;  2X85 A;  4XR6 A;  4C2L A;  3VMV A;  4EW9 A;  4I84 A;  1IA5 A;  4XMY A;  4XLH A;  1OFE A;  4XQF A;  2NTB A;  4URR A;  4Z06 A;  3SQV A;  4XLC A;  2NTP A;  2IOU G;  1KQ5 A;  3B8Y A;  3ZPP A;  3PSZ A;  2O0W A;  4YEJ A;  2V5I A;  4YDT A;  3B90 A;  3BH7 B;  1O88 A;  4XKW A;  1L1I A;  2BM7 A;  2BX6 A;  1AIR A;  3LJY A;  3TH0 A;  4XON A; 
#chains in the Genus database with same CATH homology
 1IB4 A;  4W8R A;  4XLA A;  4XNF A;  4Z05 A;  1O8E A;  1OGM X;  1JRG A;  1OFL A;  3WWG A;  2EWE A;  3VST A;  1NHC A;  3JUR A;  1O8J A;  2O04 A;  2VBE A;  3T9G A;  4OJO A;  1HG8 A;  3KRG A;  4OZZ A;  4MR0 A;  2VJJ A;  2X6Y A;  1EE6 A;  2QXZ A;  4OJL A;  4XLF A;  5C1C A;  1KCC A;  3SUC A;  4XOT A;  1OOC A;  4W8Q A;  1WMR A;  4XOR A;  1PE9 A;  1O8H A;  1DBG A;  3VSV A;  3EQO A;  2QX3 A;  2O0V A;  1O8I A;  2X3H A;  2NSP A;  1BN8 A;  4NK6 A;  2ODL A;  3ZSC A;  4PMH A;  3FY3 A;  3B4N A;  1KTW A;  4YZQ A;  5C1E A;  1BHE A;  1CZF A;  2NT9 A;  2BSP A;  1GQ8 A;  4XOP A;  4XN3 A;  4AVZ A;  4Z03 A;  2UVF A;  1JTA A;  1DBO A;  2NZM A;  2X6X A;  3GQA A;  1VBL A;  1RMG A;  4OJ5 A;  1XG2 A;  1O8M A;  2X6W A;  4XKV A;  3UW0 A;  1PLU A;  3GQ8 A;  2PEC A;  2IQ7 A;  1O8D A;  1O8L A;  3LMW A;  2NST A;  1OFM A;  1PXZ A;  1RU4 A;  2VBK A;  4OJP A;  3GRH A;  3GQ9 A;  1O8F A;  1IDJ A;  2O1D A;  4YZA A;  1X0C A;  2PYH A;  2Z8G A;  1QCX A;  1IDK A;  4XM3 A;  4YZX A;  4XLE A;  4XN0 A;  4OJ6 A;  1RWR A;  2NTQ A;  4OZY A;  1O8K A;  3VSU A;  2NT6 A;  2QY1 A;  5AMV A;  4NK8 A;  4YZ0 A;  2UVE A;  4U49 A;  2VBM A;  2O17 A;  4HWV A;  4MXN A;  3EQN A;  3VMW A;  2INV A;  2PYG A;  3GQ7 A;  1OGO X;  1QJV A;  4XL9 A;  1K5C A;  4YEL A;  1O8G A;  2INU A;  4W8S A;  2VJI A;  1KCD A;  1H80 A;  4U4B A;  4W8T A;  2X85 A;  4XR6 A;  4C2L A;  3VMV A;  4EW9 A;  4I84 A;  1IA5 A;  4XMY A;  4XLH A;  4XQF A;  2NTB A;  4URR A;  4Z06 A;  4XLC A;  2NTP A;  3B8Y A;  3ZPP A;  2O0W A;  4YEJ A;  3B90 A;  1O88 A;  4XKW A;  1AIR A;  4XON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...