2IQ7A

Crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
ASCTFTDAAAAIKGKASCTSIILNGIVVPAGTTLDMTGLKSGTTVTFQGKTTFGYKEWEGPLISFSGTNININGASGHSIDCQGSRWWDSKGSNGGKTKPKFFYAHSLKSSNIKGLNVLNTPVQAFSINSATTLGVYDVIIDNSAGDSAGGHNTDAFDVGSSTGVYISGANVKNQDDCLAINSGTNITFTGGTCSGGHGLSIGSVGGRSDNTVKTVTISNSKIVNSDNGVRIKTVSGATGSVSGVTYSGITLSNIAKYGIVIEQDYENGSPTGTPTNGVPITGLTLSKITGSVASSGTNVYILCASGACSNWKWSGVSVTGGKKSTKCSNIPSGSGAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endopolygalacturonase
publication title Crystal structure of the endopolygalacturonase from the phytopathogenic fungus Colletotrichum lupini and its interaction with polygalacturonase-inhibiting proteins
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 339
sequence length 339
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2iq7A00
1QCXA 2X6WA 4YELA 3EQNA 2O0WA 4NK6A 4XLCA 4OZZA 4Z03A 4OJPA 1XG2A 4XORA 4U49A 3SUCA 1AIRA 2X6YA 1OFMA 3GRHA 4XKVA 4YZQA 4OZYA 2O17A 3VSVA 1CZFA 2UVEA 5AMVA 4XN3A 2X3HA 3FY3A 1O8GA 2X85A 2QXZA 3EQOA 1IB4A 5C1EA 4MXNA 3ZSCA 2VBEA 1JTAA 2EWEA 2BSPA 3LMWA 4Z06A 1RU4A 4URRA 1K5CA 3VSUA 3GQ9A 4W8QA 2PYHA 1DBOA 1QJVA 2NTBA 2NSPA 1OOCA 1VBLA 2ODLA 3KRGA 3ZPPA 2VJIA 1OGMX 4YZXA 4XONA 4AVZA 2NSTA 1KTWA 2IQ7A 4W8TA 1OGOX 2NTPA 1OFLA 4W8RA 4EW9A 1X0CA 1PLUA 2O1DA 2O04A 4NK8A 4XLFA 2INUA 2PYGA 1EE6A 1PE9A 3GQAA 1O8IA 4YZ0A 4XOTA 2NZMA 4HWVA 4XLAA 3JURA 4I84A 3VSTA 1O88A 1NHCA 2Z8GA 5C1CA 4XQFA 4MR0A 2NT9A 1O8EA 1DBGA 4XNFA 1KCDA 1RMGA 4PMHA 1JRGA 1H80A 4XLEA 3VMVA 1IDJA 4XMYA 4YEJA 3GQ8A 1PXZA 3B8YA 2QY1A 4C2LA 3GQ7A 4XLHA 1O8FA 2X6XA 1BHEA 3B4NA 2PECA 1RWRA 4Z05A 4U4BA 2VJJA 4XN0A 2QX3A 1O8HA 2INVA 4XL9A 4OJOA 1WMRA 4YZAA 1IA5A 2VBMA 3WWGA 4OJLA 2NTQA 1HG8A 2NT6A 4OJ6A 3UW0A 1O8MA 1BN8A 4XKWA 4W8SA 1IDKA 1O8KA 3B90A 4XOPA 4XR6A 1O8DA 1O8LA 2O0VA 3VMWA 1O8JA 2UVFA 1GQ8A 3T9GA 2VBKA 4OJ5A 4XM3A 1KCCA
chains in the Genus database with same CATH superfamily
1QCXA 2X6WA 3PSSA 4YELA 1QRCA 3EQNA 3ML3A 2O0WA 4NK6A 4KH3A 4XLCA 4OZZA 4Z03A 4OJPA 1XG2A 1TYVA 4U49A 4XORA 3SUCA 1AIRA 2X6YA 1QA2A 1OFMA 4YDTA 3GRHA 3PSZA 1L1IA 5DNSA 4XKVA 3SQVA 2O6WA 4YZQA 4OZYA 2O17A 3VSVA 1CZFA 2BM4A 3SZEA 2UVEA 5AMVA 4XN3A 2X3HA 3FY3A 1O8GA 2X85A 2QXZA 3EQOA 1IB4A 5C1EA 1QA3A 4MXNA 3DU1X 2YUHA 2BM5A 3NB2A 3ZSCA 2VBEA 1JTAA 2VFPA 2EWEA 3LYCA 3RIQA 2BSPA 3LMWA 4Z06A 1RU4A 4URRA 1K5CA 3JX8A 3VSUA 3GQ9A 4W8QA 2PYHA 1DBOA 1QJVA 2NTBA 2NSPA 1OOCA 1LM1A 2J8IA 3BH6B 1VBLA 2ODLA 2J8KA 2BM6A 1TYXA 1TYUA 2VFNA 3KRGA 3SY2A 3ZPPA 3P4GA 2VJIA 1OGMX 4YZXA 4XONA 4AVZA 2NSTA 1KTWA 2IQ7A 4W8TA 1OGOX 2NTPA 1OFLA 4W8RA 2B0RA 1EA0A 4EW9A 4OPWA 1X0CA 1PLUA 2QZAA 1QRBA 1TYWA 2O1DA 2O04A 1QQ1A 4NK8A 4XLFA 2INUA 2PYGA 1EE6A 2QYUA 1PE9A 3GQAA 1O8IA 1EZGA 4XOTA 2VFMA 2NZMA 4YZ0A 4HWVA 4V02C 4XLAA 4OM9A 1K4ZA 3JURA 4I84A 3VSTA 1O88A 2V5IA 2VFOA 1OFDA 1NHCA 1HF2A 2Z8GA 3LJYA 4YC5A 5C1CA 4XQFA 4MR0A 2NT9A 3TH0A 3AK5A 1O8EA 1DBGA 4XNFA 2XT4A 4JRAC 1KCDA 1RMGA 4PMHA 1JRGA 1H80A 4XLEA 2VFQA 3VMVA 1IDJA 4XMYA 2W7ZA 4YEJA 3GQ8A 1PXZA 3B8YA 3NAWA 2QY1A 4C2LA 1K8FA 3GQ7A 2IOUG 4XLHA 1O8FA 2X6XA 1BHEA 1LLZA 3B4NA 2XTXA 2PECA 3SYJA 1LLWA 1RWRA 4Z05A 4YCQA 3H09A 4U4BA 2VJJA 3N6ZA 4XN0A 1QA1A 2QX3A 1O8HA 2INVA 4XL9A 3PETA 5JLVC 5JMCB 4OJOA 1WMRA 4YZAA 2F3LA 1IA5A 2VBMA 3WWGA 4OJLA 2NTQA 1HG8A 2NT6A 4OJ6A 3UW0A 1O8MA 1BN8A 1CLWA 4W8SA 4XKWA 3N90A 1OFEA 1IDKA 1O8KA 4YFOA 3BH7B 1DABA 3B90A 4XOPA 1KQ5A 1TSPA 2BX6A 4XR6A 1O8DA 2XTYA 1O8LA 2G0YA 2O0VA 3VMWA 1O8JA 2UVFA 2XT2A 1GQ8A 2BM7A 2XTWA 2VBKA 3T9GA 4YEIA 2XC1A 4OJ5A 1WXRA 4XM3A 1KCCA
chains in the Genus database with same CATH topology
1QCXA 2X6WA 4YELA 3EQNA 2O0WA 4NK6A 4XLCA 4OZZA 4Z03A 4OJPA 1XG2A 4XORA 4U49A 3SUCA 1AIRA 2X6YA 1OFMA 3GRHA 4XKVA 4YZQA 4OZYA 2O17A 3VSVA 1CZFA 2UVEA 5AMVA 4XN3A 2X3HA 3FY3A 1O8GA 2X85A 2QXZA 3EQOA 1IB4A 5C1EA 4MXNA 3ZSCA 2VBEA 1JTAA 2EWEA 2BSPA 3LMWA 4Z06A 1RU4A 4URRA 1K5CA 3VSUA 3GQ9A 4W8QA 2PYHA 1DBOA 1QJVA 2NTBA 2NSPA 1OOCA 1VBLA 2ODLA 3KRGA 3ZPPA 2VJIA 1OGMX 4YZXA 4XONA 4AVZA 2NSTA 1KTWA 2IQ7A 4W8TA 1OGOX 2NTPA 1OFLA 4W8RA 4EW9A 1X0CA 1PLUA 2O1DA 2O04A 4NK8A 4XLFA 2INUA 2PYGA 1EE6A 1PE9A 3GQAA 1O8IA 4YZ0A 4XOTA 2NZMA 4HWVA 4XLAA 3JURA 4I84A 3VSTA 1O88A 1NHCA 2Z8GA 5C1CA 4XQFA 4MR0A 2NT9A 1O8EA 1DBGA 4XNFA 1KCDA 1RMGA 4PMHA 1JRGA 1H80A 4XLEA 3VMVA 1IDJA 4XMYA 4YEJA 3GQ8A 1PXZA 3B8YA 2QY1A 4C2LA 3GQ7A 4XLHA 1O8FA 2X6XA 1BHEA 3B4NA 2PECA 1RWRA 4Z05A 4U4BA 2VJJA 4XN0A 2QX3A 1O8HA 2INVA 4XL9A 4OJOA 1WMRA 4YZAA 1IA5A 2VBMA 3WWGA 4OJLA 2NTQA 1HG8A 2NT6A 4OJ6A 3UW0A 1O8MA 1BN8A 4XKWA 4W8SA 1IDKA 1O8KA 3B90A 4XOPA 4XR6A 1O8DA 1O8LA 2O0VA 3VMWA 1O8JA 2UVFA 1GQ8A 3T9GA 2VBKA 4OJ5A 4XM3A 1KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCX A;  2X6W A;  4YEL A;  3EQN A;  2O0W A;  4NK6 A;  4XLC A;  4OZZ A;  4Z03 A;  4OJP A;  1XG2 A;  4XOR A;  4U49 A;  3SUC A;  1AIR A;  2X6Y A;  1OFM A;  3GRH A;  4XKV A;  4YZQ A;  4OZY A;  2O17 A;  3VSV A;  1CZF A;  2UVE A;  5AMV A;  4XN3 A;  2X3H A;  3FY3 A;  1O8G A;  2X85 A;  2QXZ A;  3EQO A;  1IB4 A;  5C1E A;  4MXN A;  3ZSC A;  2VBE A;  1JTA A;  2EWE A;  2BSP A;  3LMW A;  4Z06 A;  1RU4 A;  4URR A;  1K5C A;  3VSU A;  3GQ9 A;  4W8Q A;  2PYH A;  1DBO A;  1QJV A;  2NTB A;  2NSP A;  1OOC A;  1VBL A;  2ODL A;  3KRG A;  3ZPP A;  2VJI A;  1OGM X;  4YZX A;  4XON A;  4AVZ A;  2NST A;  1KTW A;  2IQ7 A;  4W8T A;  1OGO X;  2NTP A;  1OFL A;  4W8R A;  4EW9 A;  1X0C A;  1PLU A;  2O1D A;  2O04 A;  4NK8 A;  4XLF A;  2INU A;  2PYG A;  1EE6 A;  1PE9 A;  3GQA A;  1O8I A;  4YZ0 A;  4XOT A;  2NZM A;  4HWV A;  4XLA A;  3JUR A;  4I84 A;  3VST A;  1O88 A;  1NHC A;  2Z8G A;  5C1C A;  4XQF A;  4MR0 A;  2NT9 A;  1O8E A;  1DBG A;  4XNF A;  1KCD A;  1RMG A;  4PMH A;  1JRG A;  1H80 A;  4XLE A;  3VMV A;  1IDJ A;  4XMY A;  4YEJ A;  3GQ8 A;  1PXZ A;  3B8Y A;  2QY1 A;  4C2L A;  3GQ7 A;  4XLH A;  1O8F A;  2X6X A;  1BHE A;  3B4N A;  2PEC A;  1RWR A;  4Z05 A;  4U4B A;  2VJJ A;  4XN0 A;  2QX3 A;  1O8H A;  2INV A;  4XL9 A;  4OJO A;  1WMR A;  4YZA A;  1IA5 A;  2VBM A;  3WWG A;  4OJL A;  2NTQ A;  1HG8 A;  2NT6 A;  4OJ6 A;  3UW0 A;  1O8M A;  1BN8 A;  4XKW A;  4W8S A;  1IDK A;  1O8K A;  3B90 A;  4XOP A;  4XR6 A;  1O8D A;  1O8L A;  2O0V A;  3VMW A;  1O8J A;  2UVF A;  1GQ8 A;  3T9G A;  2VBK A;  4OJ5 A;  4XM3 A;  1KCC A; 
#chains in the Genus database with same CATH topology
 1QCX A;  2X6W A;  3PSS A;  4YEL A;  1QRC A;  3EQN A;  3ML3 A;  2O0W A;  4NK6 A;  4KH3 A;  4XLC A;  4OZZ A;  4Z03 A;  4OJP A;  1XG2 A;  1TYV A;  4U49 A;  4XOR A;  3SUC A;  1AIR A;  2X6Y A;  1QA2 A;  1OFM A;  4YDT A;  3GRH A;  3PSZ A;  1L1I A;  5DNS A;  4XKV A;  3SQV A;  2O6W A;  4YZQ A;  4OZY A;  2O17 A;  3VSV A;  1CZF A;  2BM4 A;  3SZE A;  2UVE A;  5AMV A;  4XN3 A;  2X3H A;  3FY3 A;  1O8G A;  2X85 A;  2QXZ A;  3EQO A;  1IB4 A;  5C1E A;  1QA3 A;  4MXN A;  3DU1 X;  2YUH A;  2BM5 A;  3NB2 A;  3ZSC A;  2VBE A;  1JTA A;  2VFP A;  2EWE A;  3LYC A;  3RIQ A;  2BSP A;  3LMW A;  4Z06 A;  1RU4 A;  4URR A;  1K5C A;  3JX8 A;  3VSU A;  3GQ9 A;  4W8Q A;  2PYH A;  1DBO A;  1QJV A;  2NTB A;  2NSP A;  1OOC A;  1LM1 A;  2J8I A;  3BH6 B;  1VBL A;  2ODL A;  2J8K A;  2BM6 A;  1TYX A;  1TYU A;  2VFN A;  3KRG A;  3SY2 A;  3ZPP A;  3P4G A;  2VJI A;  1OGM X;  4YZX A;  4XON A;  4AVZ A;  2NST A;  1KTW A;  2IQ7 A;  4W8T A;  1OGO X;  2NTP A;  1OFL A;  4W8R A;  2B0R A;  1EA0 A;  4EW9 A;  4OPW A;  1X0C A;  1PLU A;  2QZA A;  1QRB A;  1TYW A;  2O1D A;  2O04 A;  1QQ1 A;  4NK8 A;  4XLF A;  2INU A;  2PYG A;  1EE6 A;  2QYU A;  1PE9 A;  3GQA A;  1O8I A;  1EZG A;  4XOT A;  2VFM A;  2NZM A;  4YZ0 A;  4HWV A;  4V02 C;  4XLA A;  4OM9 A;  1K4Z A;  3JUR A;  4I84 A;  3VST A;  1O88 A;  2V5I A;  2VFO A;  1OFD A;  1NHC A;  1HF2 A;  2Z8G A;  3LJY A;  4YC5 A;  5C1C A;  4XQF A;  4MR0 A;  2NT9 A;  3TH0 A;  3AK5 A;  1O8E A;  1DBG A;  4XNF A;  2XT4 A;  4JRA C;  1KCD A;  1RMG A;  4PMH A;  1JRG A;  1H80 A;  4XLE A;  2VFQ A;  3VMV A;  1IDJ A;  4XMY A;  2W7Z A;  4YEJ A;  3GQ8 A;  1PXZ A;  3B8Y A;  3NAW A;  2QY1 A;  4C2L A;  1K8F A;  3GQ7 A;  2IOU G;  4XLH A;  1O8F A;  2X6X A;  1BHE A;  1LLZ A;  3B4N A;  2XTX A;  2PEC A;  3SYJ A;  1LLW A;  1RWR A;  4Z05 A;  4YCQ A;  3H09 A;  4U4B A;  2VJJ A;  3N6Z A;  4XN0 A;  1QA1 A;  2QX3 A;  1O8H A;  2INV A;  4XL9 A;  3PET A;  5JLV C;  5JMC B;  4OJO A;  1WMR A;  4YZA A;  2F3L A;  1IA5 A;  2VBM A;  3WWG A;  4OJL A;  2NTQ A;  1HG8 A;  2NT6 A;  4OJ6 A;  3UW0 A;  1O8M A;  1BN8 A;  1CLW A;  4W8S A;  4XKW A;  3N90 A;  1OFE A;  1IDK A;  1O8K A;  4YFO A;  3BH7 B;  1DAB A;  3B90 A;  4XOP A;  1KQ5 A;  1TSP A;  2BX6 A;  4XR6 A;  1O8D A;  2XTY A;  1O8L A;  2G0Y A;  2O0V A;  3VMW A;  1O8J A;  2UVF A;  2XT2 A;  1GQ8 A;  2BM7 A;  2XTW A;  2VBK A;  3T9G A;  4YEI A;  2XC1 A;  4OJ5 A;  1WXR A;  4XM3 A;  1KCC A; 
#chains in the Genus database with same CATH homology
 1QCX A;  2X6W A;  4YEL A;  3EQN A;  2O0W A;  4NK6 A;  4XLC A;  4OZZ A;  4Z03 A;  4OJP A;  1XG2 A;  4XOR A;  4U49 A;  3SUC A;  1AIR A;  2X6Y A;  1OFM A;  3GRH A;  4XKV A;  4YZQ A;  4OZY A;  2O17 A;  3VSV A;  1CZF A;  2UVE A;  5AMV A;  4XN3 A;  2X3H A;  3FY3 A;  1O8G A;  2X85 A;  2QXZ A;  3EQO A;  1IB4 A;  5C1E A;  4MXN A;  3ZSC A;  2VBE A;  1JTA A;  2EWE A;  2BSP A;  3LMW A;  4Z06 A;  1RU4 A;  4URR A;  1K5C A;  3VSU A;  3GQ9 A;  4W8Q A;  2PYH A;  1DBO A;  1QJV A;  2NTB A;  2NSP A;  1OOC A;  1VBL A;  2ODL A;  3KRG A;  3ZPP A;  2VJI A;  1OGM X;  4YZX A;  4XON A;  4AVZ A;  2NST A;  1KTW A;  2IQ7 A;  4W8T A;  1OGO X;  2NTP A;  1OFL A;  4W8R A;  4EW9 A;  1X0C A;  1PLU A;  2O1D A;  2O04 A;  4NK8 A;  4XLF A;  2INU A;  2PYG A;  1EE6 A;  1PE9 A;  3GQA A;  1O8I A;  4YZ0 A;  4XOT A;  2NZM A;  4HWV A;  4XLA A;  3JUR A;  4I84 A;  3VST A;  1O88 A;  1NHC A;  2Z8G A;  5C1C A;  4XQF A;  4MR0 A;  2NT9 A;  1O8E A;  1DBG A;  4XNF A;  1KCD A;  1RMG A;  4PMH A;  1JRG A;  1H80 A;  4XLE A;  3VMV A;  1IDJ A;  4XMY A;  4YEJ A;  3GQ8 A;  1PXZ A;  3B8Y A;  2QY1 A;  4C2L A;  3GQ7 A;  4XLH A;  1O8F A;  2X6X A;  1BHE A;  3B4N A;  2PEC A;  1RWR A;  4Z05 A;  4U4B A;  2VJJ A;  4XN0 A;  2QX3 A;  1O8H A;  2INV A;  4XL9 A;  4OJO A;  1WMR A;  4YZA A;  1IA5 A;  2VBM A;  3WWG A;  4OJL A;  2NTQ A;  1HG8 A;  2NT6 A;  4OJ6 A;  3UW0 A;  1O8M A;  1BN8 A;  4XKW A;  4W8S A;  1IDK A;  1O8K A;  3B90 A;  4XOP A;  4XR6 A;  1O8D A;  1O8L A;  2O0V A;  3VMW A;  1O8J A;  2UVF A;  1GQ8 A;  3T9G A;  2VBK A;  4OJ5 A;  4XM3 A;  1KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...