2IQ7A

Crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
ASCTFTDAAAAIKGKASCTSIILNGIVVPAGTTLDMTGLKSGTTVTFQGKTTFGYKEWEGPLISFSGTNININGASGHSIDCQGSRWWDSKGSNGGKTKPKFFYAHSLKSSNIKGLNVLNTPVQAFSINSATTLGVYDVIIDNSAGDSAGGHNTDAFDVGSSTGVYISGANVKNQDDCLAINSGTNITFTGGTCSGGHGLSIGSVGGRSDNTVKTVTISNSKIVNSDNGVRIKTVSGATGSVSGVTYSGITLSNIAKYGIVIEQDYENGSPTGTPTNGVPITGLTLSKITGSVASSGTNVYILCASGACSNWKWSGVSVTGGKKSTKCSNIPSGSGAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords endopolygalacturonase
publication title Crystal structure of the endopolygalacturonase from the phytopathogenic fungus Colletotrichum lupini and its interaction with polygalacturonase-inhibiting proteins
pubmed doi rcsb
total genus 123
structure length 339
sequence length 339
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2iq7A00
4XORA 2PYGA 1GQ8A 2NSPA 3FY3A 3ZPPA 1IDKA 1O8FA 4EW9A 1K5CA 3VSTA 2ODLA 2VJJA 2VBKA 4XOTA 3SUCA 1O8KA 4YELA 2O1DA 3KRGA 2UVFA 4YZQA 2NTPA 2NTBA 1CZFA 1OGMX 1IA5A 4XONA 3EQOA 2VBEA 2INVA 4XN3A 4XL9A 1PXZA 1O8GA 1X0CA 4XLFA 4XLCA 2NTQA 2O0WA 4XKVA 4XMYA 1O8JA 1RU4A 5C1EA 1KCDA 1JRGA 1O8HA 4OZYA 2X6XA 2QXZA 2QY1A 4YZAA 1PLUA 3B90A 4W8QA 1NHCA 3VSUA 1DBOA 3VMVA 1AIRA 1JTAA 4U49A 4W8SA 1KTWA 1OFLA 2O04A 4XQFA 1DBGA 5AMVA 1OOCA 2NT9A 2EWEA 3B4NA 3GQ8A 2X3HA 4NK8A 2NT6A 3GQAA 1IDJA 4OJ6A 2IQ7A 4NK6A 2O17A 3WWGA 3JURA 4XKWA 4W8RA 3UW0A 2INUA 4AVZA 1PE9A 2O0VA 4U4BA 4XR6A 1O88A 2NZMA 3EQNA 3GQ7A 1VBLA 3GRHA 3ZSCA 1QCXA 4OJPA 3GQ9A 4MXNA 1XG2A 2UVEA 5C1CA 2X85A 4URRA 3VMWA 4HWVA 1O8MA 4YZ0A 4OJOA 1RMGA 4C2LA 1H80A 3VSVA 1RWRA 1WMRA 1O8EA 1HG8A 1EE6A 4OJLA 3B8YA 1IB4A 4OZZA 1O8IA 2PYHA 4OJ5A 2VBMA 4Z06A 1OGOX 1OFMA 4XOPA 4W8TA 2NSTA 3LMWA 4XLAA 4YEJA 4Z05A 2PECA 4XLEA 1BHEA 4MR0A 2X6WA 1QJVA 4I84A 3T9GA 4XM3A 1O8DA 1BN8A 2QX3A 4XN0A 4YZXA 4PMHA 2X6YA 1KCCA 4XNFA 2BSPA 4Z03A 2VJIA 2Z8GA 4XLHA 1O8LA
chains in the Genus database with same CATH superfamily
4XORA 2QZAA 2PYGA 1GQ8A 2NSPA 1LM1A 3FY3A 2BM7A 3ZPPA 1IDKA 1O8FA 1QQ1A 4EW9A 1K5CA 2B0RA 3VSTA 2ODLA 4OM9A 1L1IA 1WXRA 2VJJA 2VBKA 2XC1A 4XOTA 2VFQA 2VFPA 3SUCA 2BM6A 1O8KA 2J8IA 1QA2A 4YELA 2O1DA 3KRGA 2UVFA 1OFEA 4YZQA 2NTPA 3SZEA 1QA3A 2NTBA 4YC5A 1CZFA 1O8LA 1OGMX 1LLZA 1IA5A 3NB2A 1TYWA 4XONA 3EQOA 2VBEA 2INVA 2BM5A 4XN3A 4XL9A 2XT4A 3BH7B 2BX6A 1PXZA 1O8GA 1X0CA 4XLFA 4XLCA 3P4GA 2NTQA 2O0WA 2V5IA 4XKVA 4XMYA 1O8JA 1RU4A 3SY2A 5C1EA 1KCDA 1JRGA 1O8HA 4OZYA 2X6XA 2QXZA 3SQVA 2QY1A 4YZAA 1TYXA 4YCQA 1PLUA 2VFNA 1OFDA 3B90A 2W7ZA 4W8QA 5JLVC 1NHCA 3VSUA 1DBOA 3VMVA 1AIRA 3DU1X 1JTAA 4U49A 4W8SA 1KTWA 1KQ5A 1OFLA 2O04A 2VJIA 4XQFA 1DBGA 5AMVA 1CLWA 1OOCA 2EWEA 2NT9A 3B4NA 3GQ8A 2X3HA 4NK8A 1QA1A 2NT6A 3GQAA 1IDJA 2XT2A 3SYJA 4OJ6A 2IQ7A 2QYUA 4NK6A 2VFOA 2O17A 3WWGA 1K8FA 3JURA 4XKWA 3PSZA 4W8RA 3UW0A 2INUA 4AVZA 1PE9A 2O0VA 4XLHA 3BH6B 3PSSA 2BM4A 3JX8A 4U4BA 4YFOA 2XTWA 1LLWA 4XR6A 1O88A 2NZMA 3EQNA 3GQ7A 1VBLA 3GRHA 3ZSCA 3AK5A 3H09A 1QCXA 4OJPA 3GQ9A 4MXNA 1XG2A 2UVEA 3LJYA 4KH3A 2X85A 2YUHA 3ML3A 4URRA 5C1CA 1DABA 1HF2A 3VMWA 1TYUA 4HWVA 1EA0A 1O8MA 3LYCA 3N90A 2F3LA 4YZ0A 4OPWA 3PETA 4OJOA 1RMGA 4C2LA 1H80A 3VSVA 1RWRA 2XTXA 1O8EA 1WMRA 1HG8A 1EE6A 4YDTA 4YEIA 4OJLA 3B8YA 1IB4A 4OZZA 1O8IA 2PYHA 4OJ5A 4Z06A 1OGOX 1OFMA 2IOUG 2VFMA 4W8TA 4XOPA 2NSTA 3LMWA 4XLAA 4YEJA 4Z05A 2PECA 3NAWA 5DNSA 3RIQA 4XLEA 1BHEA 4MR0A 2X6WA 2XTYA 3N6ZA 1QRCA 1QJVA 4I84A 3T9GA 4XM3A 1O8DA 4JRAC 1BN8A 1TSPA 2QX3A 4V02C 4XN0A 4YZXA 3TH0A 1EZGA 4PMHA 2G0YA 2X6YA 1KCCA 4XNFA 2BSPA 2O6WA 5JMCB 4Z03A 2VBMA 2Z8GA 2J8KA 1K4ZA 1QRBA 1TYVA
chains in the Genus database with same CATH topology
4XORA 2PYGA 1GQ8A 2NSPA 3FY3A 3ZPPA 1IDKA 1O8FA 4EW9A 1K5CA 3VSTA 2ODLA 2VJJA 2VBKA 4XOTA 3SUCA 1O8KA 4YELA 2O1DA 3KRGA 2UVFA 4YZQA 2NTPA 2NTBA 1CZFA 1OGMX 1IA5A 4XONA 3EQOA 2VBEA 2INVA 4XN3A 4XL9A 1PXZA 1O8GA 1X0CA 4XLFA 4XLCA 2NTQA 2O0WA 4XKVA 4XMYA 1O8JA 1RU4A 5C1EA 1KCDA 1JRGA 1O8HA 4OZYA 2X6XA 2QXZA 2QY1A 4YZAA 1PLUA 3B90A 4W8QA 1NHCA 3VSUA 1DBOA 3VMVA 1AIRA 1JTAA 4U49A 4W8SA 1KTWA 1OFLA 2O04A 4XQFA 1DBGA 5AMVA 1OOCA 2NT9A 2EWEA 3B4NA 3GQ8A 2X3HA 4NK8A 2NT6A 3GQAA 1IDJA 4OJ6A 2IQ7A 4NK6A 2O17A 3WWGA 3JURA 4XKWA 4W8RA 3UW0A 2INUA 4AVZA 1PE9A 2O0VA 4U4BA 4XR6A 1O88A 2NZMA 3EQNA 3GQ7A 1VBLA 3GRHA 3ZSCA 1QCXA 4OJPA 3GQ9A 4MXNA 1XG2A 2UVEA 5C1CA 2X85A 4URRA 3VMWA 4HWVA 1O8MA 4YZ0A 4OJOA 1RMGA 4C2LA 1H80A 3VSVA 1RWRA 1WMRA 1O8EA 1HG8A 1EE6A 4OJLA 3B8YA 1IB4A 4OZZA 1O8IA 2PYHA 4OJ5A 2VBMA 4Z06A 1OGOX 1OFMA 4XOPA 4W8TA 2NSTA 3LMWA 4XLAA 4YEJA 4Z05A 2PECA 4XLEA 1BHEA 4MR0A 2X6WA 1QJVA 4I84A 3T9GA 4XM3A 1O8DA 1BN8A 2QX3A 4XN0A 4YZXA 4PMHA 2X6YA 1KCCA 4XNFA 2BSPA 4Z03A 2VJIA 2Z8GA 4XLHA 1O8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOR A;  2PYG A;  1GQ8 A;  2NSP A;  3FY3 A;  3ZPP A;  1IDK A;  1O8F A;  4EW9 A;  1K5C A;  3VST A;  2ODL A;  2VJJ A;  2VBK A;  4XOT A;  3SUC A;  1O8K A;  4YEL A;  2O1D A;  3KRG A;  2UVF A;  4YZQ A;  2NTP A;  2NTB A;  1CZF A;  1OGM X;  1IA5 A;  4XON A;  3EQO A;  2VBE A;  2INV A;  4XN3 A;  4XL9 A;  1PXZ A;  1O8G A;  1X0C A;  4XLF A;  4XLC A;  2NTQ A;  2O0W A;  4XKV A;  4XMY A;  1O8J A;  1RU4 A;  5C1E A;  1KCD A;  1JRG A;  1O8H A;  4OZY A;  2X6X A;  2QXZ A;  2QY1 A;  4YZA A;  1PLU A;  3B90 A;  4W8Q A;  1NHC A;  3VSU A;  1DBO A;  3VMV A;  1AIR A;  1JTA A;  4U49 A;  4W8S A;  1KTW A;  1OFL A;  2O04 A;  4XQF A;  1DBG A;  5AMV A;  1OOC A;  2NT9 A;  2EWE A;  3B4N A;  3GQ8 A;  2X3H A;  4NK8 A;  2NT6 A;  3GQA A;  1IDJ A;  4OJ6 A;  2IQ7 A;  4NK6 A;  2O17 A;  3WWG A;  3JUR A;  4XKW A;  4W8R A;  3UW0 A;  2INU A;  4AVZ A;  1PE9 A;  2O0V A;  4U4B A;  4XR6 A;  1O88 A;  2NZM A;  3EQN A;  3GQ7 A;  1VBL A;  3GRH A;  3ZSC A;  1QCX A;  4OJP A;  3GQ9 A;  4MXN A;  1XG2 A;  2UVE A;  5C1C A;  2X85 A;  4URR A;  3VMW A;  4HWV A;  1O8M A;  4YZ0 A;  4OJO A;  1RMG A;  4C2L A;  1H80 A;  3VSV A;  1RWR A;  1WMR A;  1O8E A;  1HG8 A;  1EE6 A;  4OJL A;  3B8Y A;  1IB4 A;  4OZZ A;  1O8I A;  2PYH A;  4OJ5 A;  2VBM A;  4Z06 A;  1OGO X;  1OFM A;  4XOP A;  4W8T A;  2NST A;  3LMW A;  4XLA A;  4YEJ A;  4Z05 A;  2PEC A;  4XLE A;  1BHE A;  4MR0 A;  2X6W A;  1QJV A;  4I84 A;  3T9G A;  4XM3 A;  1O8D A;  1BN8 A;  2QX3 A;  4XN0 A;  4YZX A;  4PMH A;  2X6Y A;  1KCC A;  4XNF A;  2BSP A;  4Z03 A;  2VJI A;  2Z8G A;  4XLH A;  1O8L A; 
#chains in the Genus database with same CATH topology
 4XOR A;  2QZA A;  2PYG A;  1GQ8 A;  2NSP A;  1LM1 A;  3FY3 A;  2BM7 A;  3ZPP A;  1IDK A;  1O8F A;  1QQ1 A;  4EW9 A;  1K5C A;  2B0R A;  3VST A;  2ODL A;  4OM9 A;  1L1I A;  1WXR A;  2VJJ A;  2VBK A;  2XC1 A;  4XOT A;  2VFQ A;  2VFP A;  3SUC A;  2BM6 A;  1O8K A;  2J8I A;  1QA2 A;  4YEL A;  2O1D A;  3KRG A;  2UVF A;  1OFE A;  4YZQ A;  2NTP A;  3SZE A;  1QA3 A;  2NTB A;  4YC5 A;  1CZF A;  1O8L A;  1OGM X;  1LLZ A;  1IA5 A;  3NB2 A;  1TYW A;  4XON A;  3EQO A;  2VBE A;  2INV A;  2BM5 A;  4XN3 A;  4XL9 A;  2XT4 A;  3BH7 B;  2BX6 A;  1PXZ A;  1O8G A;  1X0C A;  4XLF A;  4XLC A;  3P4G A;  2NTQ A;  2O0W A;  2V5I A;  4XKV A;  4XMY A;  1O8J A;  1RU4 A;  3SY2 A;  5C1E A;  1KCD A;  1JRG A;  1O8H A;  4OZY A;  2X6X A;  2QXZ A;  3SQV A;  2QY1 A;  4YZA A;  1TYX A;  4YCQ A;  1PLU A;  2VFN A;  1OFD A;  3B90 A;  2W7Z A;  4W8Q A;  5JLV C;  1NHC A;  3VSU A;  1DBO A;  3VMV A;  1AIR A;  3DU1 X;  1JTA A;  4U49 A;  4W8S A;  1KTW A;  1KQ5 A;  1OFL A;  2O04 A;  2VJI A;  4XQF A;  1DBG A;  5AMV A;  1CLW A;  1OOC A;  2EWE A;  2NT9 A;  3B4N A;  3GQ8 A;  2X3H A;  4NK8 A;  1QA1 A;  2NT6 A;  3GQA A;  1IDJ A;  2XT2 A;  3SYJ A;  4OJ6 A;  2IQ7 A;  2QYU A;  4NK6 A;  2VFO A;  2O17 A;  3WWG A;  1K8F A;  3JUR A;  4XKW A;  3PSZ A;  4W8R A;  3UW0 A;  2INU A;  4AVZ A;  1PE9 A;  2O0V A;  4XLH A;  3BH6 B;  3PSS A;  2BM4 A;  3JX8 A;  4U4B A;  4YFO A;  2XTW A;  1LLW A;  4XR6 A;  1O88 A;  2NZM A;  3EQN A;  3GQ7 A;  1VBL A;  3GRH A;  3ZSC A;  3AK5 A;  3H09 A;  1QCX A;  4OJP A;  3GQ9 A;  4MXN A;  1XG2 A;  2UVE A;  3LJY A;  4KH3 A;  2X85 A;  2YUH A;  3ML3 A;  4URR A;  5C1C A;  1DAB A;  1HF2 A;  3VMW A;  1TYU A;  4HWV A;  1EA0 A;  1O8M A;  3LYC A;  3N90 A;  2F3L A;  4YZ0 A;  4OPW A;  3PET A;  4OJO A;  1RMG A;  4C2L A;  1H80 A;  3VSV A;  1RWR A;  2XTX A;  1O8E A;  1WMR A;  1HG8 A;  1EE6 A;  4YDT A;  4YEI A;  4OJL A;  3B8Y A;  1IB4 A;  4OZZ A;  1O8I A;  2PYH A;  4OJ5 A;  4Z06 A;  1OGO X;  1OFM A;  2IOU G;  2VFM A;  4W8T A;  4XOP A;  2NST A;  3LMW A;  4XLA A;  4YEJ A;  4Z05 A;  2PEC A;  3NAW A;  5DNS A;  3RIQ A;  4XLE A;  1BHE A;  4MR0 A;  2X6W A;  2XTY A;  3N6Z A;  1QRC A;  1QJV A;  4I84 A;  3T9G A;  4XM3 A;  1O8D A;  4JRA C;  1BN8 A;  1TSP A;  2QX3 A;  4V02 C;  4XN0 A;  4YZX A;  3TH0 A;  1EZG A;  4PMH A;  2G0Y A;  2X6Y A;  1KCC A;  4XNF A;  2BSP A;  2O6W A;  5JMC B;  4Z03 A;  2VBM A;  2Z8G A;  2J8K A;  1K4Z A;  1QRB A;  1TYV A; 
#chains in the Genus database with same CATH homology
 4XOR A;  2PYG A;  1GQ8 A;  2NSP A;  3FY3 A;  3ZPP A;  1IDK A;  1O8F A;  4EW9 A;  1K5C A;  3VST A;  2ODL A;  2VJJ A;  2VBK A;  4XOT A;  3SUC A;  1O8K A;  4YEL A;  2O1D A;  3KRG A;  2UVF A;  4YZQ A;  2NTP A;  2NTB A;  1CZF A;  1OGM X;  1IA5 A;  4XON A;  3EQO A;  2VBE A;  2INV A;  4XN3 A;  4XL9 A;  1PXZ A;  1O8G A;  1X0C A;  4XLF A;  4XLC A;  2NTQ A;  2O0W A;  4XKV A;  4XMY A;  1O8J A;  1RU4 A;  5C1E A;  1KCD A;  1JRG A;  1O8H A;  4OZY A;  2X6X A;  2QXZ A;  2QY1 A;  4YZA A;  1PLU A;  3B90 A;  4W8Q A;  1NHC A;  3VSU A;  1DBO A;  3VMV A;  1AIR A;  1JTA A;  4U49 A;  4W8S A;  1KTW A;  1OFL A;  2O04 A;  4XQF A;  1DBG A;  5AMV A;  1OOC A;  2NT9 A;  2EWE A;  3B4N A;  3GQ8 A;  2X3H A;  4NK8 A;  2NT6 A;  3GQA A;  1IDJ A;  4OJ6 A;  2IQ7 A;  4NK6 A;  2O17 A;  3WWG A;  3JUR A;  4XKW A;  4W8R A;  3UW0 A;  2INU A;  4AVZ A;  1PE9 A;  2O0V A;  4U4B A;  4XR6 A;  1O88 A;  2NZM A;  3EQN A;  3GQ7 A;  1VBL A;  3GRH A;  3ZSC A;  1QCX A;  4OJP A;  3GQ9 A;  4MXN A;  1XG2 A;  2UVE A;  5C1C A;  2X85 A;  4URR A;  3VMW A;  4HWV A;  1O8M A;  4YZ0 A;  4OJO A;  1RMG A;  4C2L A;  1H80 A;  3VSV A;  1RWR A;  1WMR A;  1O8E A;  1HG8 A;  1EE6 A;  4OJL A;  3B8Y A;  1IB4 A;  4OZZ A;  1O8I A;  2PYH A;  4OJ5 A;  2VBM A;  4Z06 A;  1OGO X;  1OFM A;  4XOP A;  4W8T A;  2NST A;  3LMW A;  4XLA A;  4YEJ A;  4Z05 A;  2PEC A;  4XLE A;  1BHE A;  4MR0 A;  2X6W A;  1QJV A;  4I84 A;  3T9G A;  4XM3 A;  1O8D A;  1BN8 A;  2QX3 A;  4XN0 A;  4YZX A;  4PMH A;  2X6Y A;  1KCC A;  4XNF A;  2BSP A;  4Z03 A;  2VJI A;  2Z8G A;  4XLH A;  1O8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...