2IQ7A

Crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
339
structure length
339
Chain Sequence
b'ASCTFTDAAAAIKGKASCTSIILNGIVVPAGTTLDMTGLKSGTTVTFQGKTTFGYKEWEGPLISFSGTNININGASGHSIDCQGSRWWDSKGSNGGKTKPKFFYAHSLKSSNIKGLNVLNTPVQAFSINSATTLGVYDVIIDNSAGDSAGGHNTDAFDVGSSTGVYISGANVKNQDDCLAINSGTNITFTGGTCSGGHGLSIGSVGGRSDNTVKTVTISNSKIVNSDNGVRIKTVSGATGSVSGVTYSGITLSNIAKYGIVIEQDYENGSPTGTPTNGVPITGLTLSKITGSVASSGTNVYILCASGACSNWKWSGVSVTGGKKSTKCSNIPSGSGAAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endopolygalacturonase
publication title Crystal structure of the endopolygalacturonase from the phytopathogenic fungus Colletotrichum lupini and its interaction with polygalacturonase-inhibiting proteins
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 339
sequence length 339
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2iq7A00
3KRGA 3VSUA 1GQ8A 1IDJA 1O8HA 3T9GA 3LMWA 1K5CA 4Z06A 2IQ7A 4W8SA 4XLAA 3JURA 4OJOA 2X85A 2ODLA 3GRHA 1O88A 4XNFA 1RWRA 1KTWA 4U4BA 4XLFA 2NTQA 4OZZA 3GQ8A 4Z03A 1WMRA 3ZSCA 1IDKA 4NK6A 1IA5A 3WWGA 1RMGA 2O17A 4XKVA 4YELA 1NHCA 2PYGA 1PE9A 1XG2A 1KCCA 2INVA 3B90A 4YZQA 3VMVA 2UVEA 4W8QA 1DBGA 4OJ6A 1O8EA 1BHEA 1QJVA 4OJ5A 4W8TA 1H80A 2NTBA 4XN0A 1O8FA 5C1CA 4YZXA 4W8RA 1OFMA 4MR0A 2O1DA 2VBKA 1CZFA 4XOTA 4Z05A 1BN8A 3B8YA 1PLUA 2INUA 2NT6A 3B4NA 1PXZA 3EQOA 1KCDA 3SUCA 4XM3A 1IB4A 2X6WA 4NK8A 4URRA 4YZAA 1HG8A 4OJLA 2UVFA 3GQ9A 2BSPA 1OGMX 1X0CA 4OZYA 1AIRA 3UW0A 2NSPA 2X6XA 2X6YA 4U49A 1OGOX 1VBLA 2PECA 2NTPA 2O0WA 4XLEA 4XKWA 2NZMA 2NSTA 2QXZA 4XORA 4AVZA 2VBMA 1O8IA 2O04A 4C2LA 1O8GA 3FY3A 3GQ7A 1JTAA 2O0VA 1O8KA 4I84A 1RU4A 2PYHA 1O8DA 1O8LA 4XQFA 3VMWA 3ZPPA 4OJPA 2VBEA 1DBOA 2VJJA 4XL9A 1OOCA 1OFLA 1O8MA 3EQNA 4XONA 4XLCA 1O8JA 3VSTA 2NT9A 2QX3A 4HWVA 4XLHA 2EWEA 3GQAA 5C1EA 4MXNA 1EE6A 4PMHA 2Z8GA 1QCXA 2X3HA 4XN3A 5AMVA 4EW9A 4XR6A 4XMYA 2QY1A 4YZ0A 1JRGA 4XOPA 2VJIA 4YEJA 3VSVA
chains in the Genus database with same CATH superfamily
3KRGA 3VSUA 3P4GA 1GQ8A 1IDJA 1O8HA 1LLWA 3T9GA 1K8FA 2IOUG 3LMWA 4KH3A 1DABA 3ML3A 1K5CA 4Z06A 3DU1X 2IQ7A 4JRAC 3TH0A 3PSZA 4W8SA 4XLAA 3JURA 4OJOA 2X85A 1QQ1A 2ODLA 2XT4A 2J8IA 3GRHA 3LJYA 1CLWA 1O88A 1RWRA 1KTWA 4U4BA 4XLFA 2NTQA 4OZZA 3GQ8A 4XNFA 1WMRA 4Z03A 3ZSCA 2BM7A 1IDKA 4NK6A 1IA5A 1QA1A 1QA2A 3WWGA 3H09A 1RMGA 2O17A 2XC1A 4XKVA 4YELA 1OFEA 1LM1A 1NHCA 2PYGA 1PE9A 2VFPA 1QA3A 1XG2A 5JMCB 1EA0A 1KCCA 2INVA 2XTWA 3B90A 3LYCA 1QRBA 2B0RA 4YZQA 3VMVA 2UVEA 1TSPA 3N6ZA 4YEIA 4W8QA 1DBGA 4OJ6A 1O8EA 1BHEA 3BH7B 1QJVA 4OJ5A 4W8TA 3PETA 1H80A 2BM6A 2NTBA 2XT2A 4XN0A 3PSSA 1O8FA 5C1CA 4YZXA 4W8RA 4V02C 5DNSA 4OM9A 2O6WA 1OFMA 4MR0A 2O1DA 2VBKA 1TYUA 3AK5A 1CZFA 4XOTA 1QRCA 1TYXA 1BN8A 4Z05A 3B8YA 3JX8A 4OPWA 1PLUA 4YCQA 2INUA 2NT6A 2VFMA 3B4NA 1PXZA 3EQOA 1KCDA 2BX6A 3SUCA 2YUHA 3BH6B 4XM3A 1IB4A 1TYVA 2X6WA 2XTYA 4NK8A 4YDTA 4URRA 5JLVC 4YZAA 1HG8A 2F3LA 3NAWA 2UVFA 3NB2A 3GQ9A 4OJLA 3RIQA 2BSPA 1OGMX 3SYJA 1X0CA 2VFQA 4OZYA 1AIRA 1TYWA 3UW0A 2NSPA 2V5IA 3SZEA 2X6XA 2X6YA 4U49A 1OGOX 1VBLA 2PECA 2BM5A 2NTPA 2QZAA 2O0WA 4XLEA 4XKWA 2NZMA 2NSTA 2QXZA 4XORA 4AVZA 2VBMA 2VFNA 2VFOA 1O8IA 1K4ZA 3SQVA 2O04A 4C2LA 1O8GA 3SY2A 3FY3A 2XTXA 3GQ7A 2G0YA 1JTAA 2O0VA 1HF2A 1O8KA 4I84A 1RU4A 2PYHA 4YFOA 1EZGA 1O8DA 1O8LA 4XQFA 3VMWA 3ZPPA 3N90A 4OJPA 2VBEA 1DBOA 2VJJA 4XL9A 1OOCA 2BM4A 1OFLA 1O8MA 4YC5A 3EQNA 4XONA 4XLCA 1O8JA 3VSTA 2NT9A 2QX3A 4HWVA 4XLHA 2W7ZA 2EWEA 3GQAA 5C1EA 1L1IA 4MXNA 1EE6A 4PMHA 2Z8GA 1QCXA 2X3HA 4XN3A 5AMVA 4EW9A 1LLZA 4XR6A 1WXRA 4XMYA 2QY1A 2J8KA 4YZ0A 1OFDA 2QYUA 1JRGA 1KQ5A 4XOPA 2VJIA 4YEJA 3VSVA
chains in the Genus database with same CATH topology
3KRGA 3VSUA 1GQ8A 1IDJA 1O8HA 3T9GA 3LMWA 1K5CA 4Z06A 2IQ7A 4W8SA 4XLAA 3JURA 4OJOA 2X85A 2ODLA 3GRHA 1O88A 4XNFA 1RWRA 1KTWA 4U4BA 4XLFA 2NTQA 4OZZA 3GQ8A 4Z03A 1WMRA 3ZSCA 1IDKA 4NK6A 1IA5A 3WWGA 1RMGA 2O17A 4XKVA 4YELA 1NHCA 2PYGA 1PE9A 1XG2A 1KCCA 2INVA 3B90A 4YZQA 3VMVA 2UVEA 4W8QA 1DBGA 4OJ6A 1O8EA 1BHEA 1QJVA 4OJ5A 4W8TA 1H80A 2NTBA 4XN0A 1O8FA 5C1CA 4YZXA 4W8RA 1OFMA 4MR0A 2O1DA 2VBKA 1CZFA 4XOTA 4Z05A 1BN8A 3B8YA 1PLUA 2INUA 2NT6A 3B4NA 1PXZA 3EQOA 1KCDA 3SUCA 4XM3A 1IB4A 2X6WA 4NK8A 4URRA 4YZAA 1HG8A 4OJLA 2UVFA 3GQ9A 2BSPA 1OGMX 1X0CA 4OZYA 1AIRA 3UW0A 2NSPA 2X6XA 2X6YA 4U49A 1OGOX 1VBLA 2PECA 2NTPA 2O0WA 4XLEA 4XKWA 2NZMA 2NSTA 2QXZA 4XORA 4AVZA 2VBMA 1O8IA 2O04A 4C2LA 1O8GA 3FY3A 3GQ7A 1JTAA 2O0VA 1O8KA 4I84A 1RU4A 2PYHA 1O8DA 1O8LA 4XQFA 3VMWA 3ZPPA 4OJPA 2VBEA 1DBOA 2VJJA 4XL9A 1OOCA 1OFLA 1O8MA 3EQNA 4XONA 4XLCA 1O8JA 3VSTA 2NT9A 2QX3A 4HWVA 4XLHA 2EWEA 3GQAA 5C1EA 4MXNA 1EE6A 4PMHA 2Z8GA 1QCXA 2X3HA 4XN3A 5AMVA 4EW9A 4XR6A 4XMYA 2QY1A 4YZ0A 1JRGA 4XOPA 2VJIA 4YEJA 3VSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRG A;  3VSU A;  1GQ8 A;  1IDJ A;  1O8H A;  3T9G A;  3LMW A;  1K5C A;  4Z06 A;  2IQ7 A;  4W8S A;  4XLA A;  3JUR A;  4OJO A;  2X85 A;  2ODL A;  3GRH A;  1O88 A;  4XNF A;  1RWR A;  1KTW A;  4U4B A;  4XLF A;  2NTQ A;  4OZZ A;  3GQ8 A;  4Z03 A;  1WMR A;  3ZSC A;  1IDK A;  4NK6 A;  1IA5 A;  3WWG A;  1RMG A;  2O17 A;  4XKV A;  4YEL A;  1NHC A;  2PYG A;  1PE9 A;  1XG2 A;  1KCC A;  2INV A;  3B90 A;  4YZQ A;  3VMV A;  2UVE A;  4W8Q A;  1DBG A;  4OJ6 A;  1O8E A;  1BHE A;  1QJV A;  4OJ5 A;  4W8T A;  1H80 A;  2NTB A;  4XN0 A;  1O8F A;  5C1C A;  4YZX A;  4W8R A;  1OFM A;  4MR0 A;  2O1D A;  2VBK A;  1CZF A;  4XOT A;  4Z05 A;  1BN8 A;  3B8Y A;  1PLU A;  2INU A;  2NT6 A;  3B4N A;  1PXZ A;  3EQO A;  1KCD A;  3SUC A;  4XM3 A;  1IB4 A;  2X6W A;  4NK8 A;  4URR A;  4YZA A;  1HG8 A;  4OJL A;  2UVF A;  3GQ9 A;  2BSP A;  1OGM X;  1X0C A;  4OZY A;  1AIR A;  3UW0 A;  2NSP A;  2X6X A;  2X6Y A;  4U49 A;  1OGO X;  1VBL A;  2PEC A;  2NTP A;  2O0W A;  4XLE A;  4XKW A;  2NZM A;  2NST A;  2QXZ A;  4XOR A;  4AVZ A;  2VBM A;  1O8I A;  2O04 A;  4C2L A;  1O8G A;  3FY3 A;  3GQ7 A;  1JTA A;  2O0V A;  1O8K A;  4I84 A;  1RU4 A;  2PYH A;  1O8D A;  1O8L A;  4XQF A;  3VMW A;  3ZPP A;  4OJP A;  2VBE A;  1DBO A;  2VJJ A;  4XL9 A;  1OOC A;  1OFL A;  1O8M A;  3EQN A;  4XON A;  4XLC A;  1O8J A;  3VST A;  2NT9 A;  2QX3 A;  4HWV A;  4XLH A;  2EWE A;  3GQA A;  5C1E A;  4MXN A;  1EE6 A;  4PMH A;  2Z8G A;  1QCX A;  2X3H A;  4XN3 A;  5AMV A;  4EW9 A;  4XR6 A;  4XMY A;  2QY1 A;  4YZ0 A;  1JRG A;  4XOP A;  2VJI A;  4YEJ A;  3VSV A; 
#chains in the Genus database with same CATH topology
 3KRG A;  3VSU A;  3P4G A;  1GQ8 A;  1IDJ A;  1O8H A;  1LLW A;  3T9G A;  1K8F A;  2IOU G;  3LMW A;  4KH3 A;  1DAB A;  3ML3 A;  1K5C A;  4Z06 A;  3DU1 X;  2IQ7 A;  4JRA C;  3TH0 A;  3PSZ A;  4W8S A;  4XLA A;  3JUR A;  4OJO A;  2X85 A;  1QQ1 A;  2ODL A;  2XT4 A;  2J8I A;  3GRH A;  3LJY A;  1CLW A;  1O88 A;  1RWR A;  1KTW A;  4U4B A;  4XLF A;  2NTQ A;  4OZZ A;  3GQ8 A;  4XNF A;  1WMR A;  4Z03 A;  3ZSC A;  2BM7 A;  1IDK A;  4NK6 A;  1IA5 A;  1QA1 A;  1QA2 A;  3WWG A;  3H09 A;  1RMG A;  2O17 A;  2XC1 A;  4XKV A;  4YEL A;  1OFE A;  1LM1 A;  1NHC A;  2PYG A;  1PE9 A;  2VFP A;  1QA3 A;  1XG2 A;  5JMC B;  1EA0 A;  1KCC A;  2INV A;  2XTW A;  3B90 A;  3LYC A;  1QRB A;  2B0R A;  4YZQ A;  3VMV A;  2UVE A;  1TSP A;  3N6Z A;  4YEI A;  4W8Q A;  1DBG A;  4OJ6 A;  1O8E A;  1BHE A;  3BH7 B;  1QJV A;  4OJ5 A;  4W8T A;  3PET A;  1H80 A;  2BM6 A;  2NTB A;  2XT2 A;  4XN0 A;  3PSS A;  1O8F A;  5C1C A;  4YZX A;  4W8R A;  4V02 C;  5DNS A;  4OM9 A;  2O6W A;  1OFM A;  4MR0 A;  2O1D A;  2VBK A;  1TYU A;  3AK5 A;  1CZF A;  4XOT A;  1QRC A;  1TYX A;  1BN8 A;  4Z05 A;  3B8Y A;  3JX8 A;  4OPW A;  1PLU A;  4YCQ A;  2INU A;  2NT6 A;  2VFM A;  3B4N A;  1PXZ A;  3EQO A;  1KCD A;  2BX6 A;  3SUC A;  2YUH A;  3BH6 B;  4XM3 A;  1IB4 A;  1TYV A;  2X6W A;  2XTY A;  4NK8 A;  4YDT A;  4URR A;  5JLV C;  4YZA A;  1HG8 A;  2F3L A;  3NAW A;  2UVF A;  3NB2 A;  3GQ9 A;  4OJL A;  3RIQ A;  2BSP A;  1OGM X;  3SYJ A;  1X0C A;  2VFQ A;  4OZY A;  1AIR A;  1TYW A;  3UW0 A;  2NSP A;  2V5I A;  3SZE A;  2X6X A;  2X6Y A;  4U49 A;  1OGO X;  1VBL A;  2PEC A;  2BM5 A;  2NTP A;  2QZA A;  2O0W A;  4XLE A;  4XKW A;  2NZM A;  2NST A;  2QXZ A;  4XOR A;  4AVZ A;  2VBM A;  2VFN A;  2VFO A;  1O8I A;  1K4Z A;  3SQV A;  2O04 A;  4C2L A;  1O8G A;  3SY2 A;  3FY3 A;  2XTX A;  3GQ7 A;  2G0Y A;  1JTA A;  2O0V A;  1HF2 A;  1O8K A;  4I84 A;  1RU4 A;  2PYH A;  4YFO A;  1EZG A;  1O8D A;  1O8L A;  4XQF A;  3VMW A;  3ZPP A;  3N90 A;  4OJP A;  2VBE A;  1DBO A;  2VJJ A;  4XL9 A;  1OOC A;  2BM4 A;  1OFL A;  1O8M A;  4YC5 A;  3EQN A;  4XON A;  4XLC A;  1O8J A;  3VST A;  2NT9 A;  2QX3 A;  4HWV A;  4XLH A;  2W7Z A;  2EWE A;  3GQA A;  5C1E A;  1L1I A;  4MXN A;  1EE6 A;  4PMH A;  2Z8G A;  1QCX A;  2X3H A;  4XN3 A;  5AMV A;  4EW9 A;  1LLZ A;  4XR6 A;  1WXR A;  4XMY A;  2QY1 A;  2J8K A;  4YZ0 A;  1OFD A;  2QYU A;  1JRG A;  1KQ5 A;  4XOP A;  2VJI A;  4YEJ A;  3VSV A; 
#chains in the Genus database with same CATH homology
 3KRG A;  3VSU A;  1GQ8 A;  1IDJ A;  1O8H A;  3T9G A;  3LMW A;  1K5C A;  4Z06 A;  2IQ7 A;  4W8S A;  4XLA A;  3JUR A;  4OJO A;  2X85 A;  2ODL A;  3GRH A;  1O88 A;  4XNF A;  1RWR A;  1KTW A;  4U4B A;  4XLF A;  2NTQ A;  4OZZ A;  3GQ8 A;  4Z03 A;  1WMR A;  3ZSC A;  1IDK A;  4NK6 A;  1IA5 A;  3WWG A;  1RMG A;  2O17 A;  4XKV A;  4YEL A;  1NHC A;  2PYG A;  1PE9 A;  1XG2 A;  1KCC A;  2INV A;  3B90 A;  4YZQ A;  3VMV A;  2UVE A;  4W8Q A;  1DBG A;  4OJ6 A;  1O8E A;  1BHE A;  1QJV A;  4OJ5 A;  4W8T A;  1H80 A;  2NTB A;  4XN0 A;  1O8F A;  5C1C A;  4YZX A;  4W8R A;  1OFM A;  4MR0 A;  2O1D A;  2VBK A;  1CZF A;  4XOT A;  4Z05 A;  1BN8 A;  3B8Y A;  1PLU A;  2INU A;  2NT6 A;  3B4N A;  1PXZ A;  3EQO A;  1KCD A;  3SUC A;  4XM3 A;  1IB4 A;  2X6W A;  4NK8 A;  4URR A;  4YZA A;  1HG8 A;  4OJL A;  2UVF A;  3GQ9 A;  2BSP A;  1OGM X;  1X0C A;  4OZY A;  1AIR A;  3UW0 A;  2NSP A;  2X6X A;  2X6Y A;  4U49 A;  1OGO X;  1VBL A;  2PEC A;  2NTP A;  2O0W A;  4XLE A;  4XKW A;  2NZM A;  2NST A;  2QXZ A;  4XOR A;  4AVZ A;  2VBM A;  1O8I A;  2O04 A;  4C2L A;  1O8G A;  3FY3 A;  3GQ7 A;  1JTA A;  2O0V A;  1O8K A;  4I84 A;  1RU4 A;  2PYH A;  1O8D A;  1O8L A;  4XQF A;  3VMW A;  3ZPP A;  4OJP A;  2VBE A;  1DBO A;  2VJJ A;  4XL9 A;  1OOC A;  1OFL A;  1O8M A;  3EQN A;  4XON A;  4XLC A;  1O8J A;  3VST A;  2NT9 A;  2QX3 A;  4HWV A;  4XLH A;  2EWE A;  3GQA A;  5C1E A;  4MXN A;  1EE6 A;  4PMH A;  2Z8G A;  1QCX A;  2X3H A;  4XN3 A;  5AMV A;  4EW9 A;  4XR6 A;  4XMY A;  2QY1 A;  4YZ0 A;  1JRG A;  4XOP A;  2VJI A;  4YEJ A;  3VSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...