2XT2A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
AKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQWPSVKMEGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords MCBG-LIKE PROTEIN
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
total genus 78
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt2A00
4YDTA 4YFOA 2XTYA 2J8KA 2XTXA 3NB2A 3NAWA 4YEIA 2O6WA 5DNSA 3PSZA 2XT2A 2QZAA 3DU1X 2XT4A 3PSSA 2QYUA 3SY2A 4YCQA 4YC5A 2XTWA 3SQVA
chains in the Genus database with same CATH superfamily
4YDTA 4W8SA 1QRCA 1IDKA 1JTAA 2INVA 2YUHA 4OZYA 1DBOA 1JRGA 3LYCA 4U49A 3UW0A 1O8LA 2VJIA 4OJ6A 2O0WA 1TSPA 2INUA 3RIQA 1IA5A 2NZMA 2EWEA 3GQ8A 2X6WA 2VJJA 4XORA 4Z03A 2NTQA 3SUCA 3PSZA 1OFLA 2XT2A 1WMRA 2V5IA 3B4NA 3DU1X 4V02C 5AMVA 3KRGA 4XR6A 2PECA 2UVEA 4OM9A 3VSUA 2BX6A 3PSSA 2NSPA 1OGOX 4XM3A 1QJVA 2BM5A 2QYUA 1XG2A 1K5CA 4KH3A 3H09A 4YCQA 2IOUG 4XONA 3FY3A 4XLCA 2VFPA 1X0CA 2PYHA 3SYJA 1PLUA 2VFOA 4YZAA 1O8MA 3SQVA 4YEJA 3GQ7A 2X3HA 4XMYA 1OGMX 2O17A 4YFOA 4XLEA 1QQ1A 4YZ0A 3BH6B 4XQFA 4XOPA 4XN0A 3WWGA 4XOTA 3NB2A 4XL9A 4YELA 4OZZA 1BHEA 1EE6A 4JRAC 4OJOA 1LLZA 1TYWA 2VFMA 4XN3A 1O8GA 2G0YA 2IQ7A 1OFDA 2J8IA 3LJYA 4XLFA 4AVZA 2Z8GA 2XT4A 3JX8A 1OFEA 5C1EA 1O8JA 3BH7B 3GQ9A 4NK8A 1O8IA 4XKVA 4OJLA 1TYVA 4OJ5A 4XNFA 2ODLA 2UVFA 4Z06A 4YC5A 3AK5A 4XLHA 2XTWA 3PETA 1O8KA 1QRBA 3EQNA 3N6ZA 2NTPA 4MR0A 4URRA 1NHCA 1EA0A 2X6XA 2W7ZA 4U4BA 1BN8A 2X6YA 2XTYA 1DABA 2BM6A 2QX3A 1TYUA 2XTXA 2BM4A 4I84A 1LM1A 3JURA 3GRHA 4Z05A 1K4ZA 4MXNA 3VSTA 3NAWA 1O8DA 2NT6A 3ZPPA 5JLVC 1HG8A 5DNSA 1HF2A 2XC1A 4C2LA 1OOCA 3T9GA 2QZAA 4OJPA 2QY1A 1WXRA 1QA2A 1PXZA 2X85A 3N90A 4HWVA 1H80A 4W8RA 2NT9A 3SY2A 1QA3A 1RMGA 3EQOA 1CLWA 1TYXA 3SZEA 1KQ5A 4YZXA 2VBMA 2VBEA 1K8FA 3B8YA 3GQAA 1LLWA 4YZQA 1O8FA 5JMCB 1KCCA 4XKWA 1KCDA 1EZGA 1KTWA 2J8KA 1IDJA 2BM7A 3B90A 2NTBA 2O0VA 2O1DA 1DBGA 4PMHA 3TH0A 3ZSCA 4NK6A 1O88A 4EW9A 5C1CA 4YEIA 1VBLA 2O6WA 1RU4A 2B0RA 3P4GA 1QA1A 1GQ8A 1L1IA 3LMWA 3ML3A 2VFQA 4XLAA 1CZFA 1IB4A 1O8HA 2BSPA 2QXZA 4W8QA 1AIRA 3VMVA 1O8EA 1RWRA 3VMWA 2VFNA 1QCXA 2O04A 3VSVA 2NSTA 4OPWA 4W8TA 1PE9A 2F3LA 1OFMA 2PYGA 2VBKA
chains in the Genus database with same CATH topology
4YDTA 4YFOA 2XTYA 2J8KA 2XTXA 3NB2A 3NAWA 4YEIA 2O6WA 5DNSA 3PSZA 2XT2A 2QZAA 3DU1X 2XT4A 3PSSA 2QYUA 3SY2A 4YCQA 4YC5A 2XTWA 3SQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  4YFO A;  2XTY A;  2J8K A;  2XTX A;  3NB2 A;  3NAW A;  4YEI A;  2O6W A;  5DNS A;  3PSZ A;  2XT2 A;  2QZA A;  3DU1 X;  2XT4 A;  3PSS A;  2QYU A;  3SY2 A;  4YCQ A;  4YC5 A;  2XTW A;  3SQV A; 
#chains in the Genus database with same CATH topology
 4YDT A;  4W8S A;  1QRC A;  1IDK A;  1JTA A;  2INV A;  2YUH A;  4OZY A;  1DBO A;  1JRG A;  3LYC A;  4U49 A;  3UW0 A;  1O8L A;  2VJI A;  4OJ6 A;  2O0W A;  1TSP A;  2INU A;  3RIQ A;  1IA5 A;  2NZM A;  2EWE A;  3GQ8 A;  2X6W A;  2VJJ A;  4XOR A;  4Z03 A;  2NTQ A;  3SUC A;  3PSZ A;  1OFL A;  2XT2 A;  1WMR A;  2V5I A;  3B4N A;  3DU1 X;  4V02 C;  5AMV A;  3KRG A;  4XR6 A;  2PEC A;  2UVE A;  4OM9 A;  3VSU A;  2BX6 A;  3PSS A;  2NSP A;  1OGO X;  4XM3 A;  1QJV A;  2BM5 A;  2QYU A;  1XG2 A;  1K5C A;  4KH3 A;  3H09 A;  4YCQ A;  2IOU G;  4XON A;  3FY3 A;  4XLC A;  2VFP A;  1X0C A;  2PYH A;  3SYJ A;  1PLU A;  2VFO A;  4YZA A;  1O8M A;  3SQV A;  4YEJ A;  3GQ7 A;  2X3H A;  4XMY A;  1OGM X;  2O17 A;  4YFO A;  4XLE A;  1QQ1 A;  4YZ0 A;  3BH6 B;  4XQF A;  4XOP A;  4XN0 A;  3WWG A;  4XOT A;  3NB2 A;  4XL9 A;  4YEL A;  4OZZ A;  1BHE A;  1EE6 A;  4JRA C;  4OJO A;  1LLZ A;  1TYW A;  2VFM A;  4XN3 A;  1O8G A;  2G0Y A;  2IQ7 A;  1OFD A;  2J8I A;  3LJY A;  4XLF A;  4AVZ A;  2Z8G A;  2XT4 A;  3JX8 A;  1OFE A;  5C1E A;  1O8J A;  3BH7 B;  3GQ9 A;  4NK8 A;  1O8I A;  4XKV A;  4OJL A;  1TYV A;  4OJ5 A;  4XNF A;  2ODL A;  2UVF A;  4Z06 A;  4YC5 A;  3AK5 A;  4XLH A;  2XTW A;  3PET A;  1O8K A;  1QRB A;  3EQN A;  3N6Z A;  2NTP A;  4MR0 A;  4URR A;  1NHC A;  1EA0 A;  2X6X A;  2W7Z A;  4U4B A;  1BN8 A;  2X6Y A;  2XTY A;  1DAB A;  2BM6 A;  2QX3 A;  1TYU A;  2XTX A;  2BM4 A;  4I84 A;  1LM1 A;  3JUR A;  3GRH A;  4Z05 A;  1K4Z A;  4MXN A;  3VST A;  3NAW A;  1O8D A;  2NT6 A;  3ZPP A;  5JLV C;  1HG8 A;  5DNS A;  1HF2 A;  2XC1 A;  4C2L A;  1OOC A;  3T9G A;  2QZA A;  4OJP A;  2QY1 A;  1WXR A;  1QA2 A;  1PXZ A;  2X85 A;  3N90 A;  4HWV A;  1H80 A;  4W8R A;  2NT9 A;  3SY2 A;  1QA3 A;  1RMG A;  3EQO A;  1CLW A;  1TYX A;  3SZE A;  1KQ5 A;  4YZX A;  2VBM A;  2VBE A;  1K8F A;  3B8Y A;  3GQA A;  1LLW A;  4YZQ A;  1O8F A;  5JMC B;  1KCC A;  4XKW A;  1KCD A;  1EZG A;  1KTW A;  2J8K A;  1IDJ A;  2BM7 A;  3B90 A;  2NTB A;  2O0V A;  2O1D A;  1DBG A;  4PMH A;  3TH0 A;  3ZSC A;  4NK6 A;  1O88 A;  4EW9 A;  5C1C A;  4YEI A;  1VBL A;  2O6W A;  1RU4 A;  2B0R A;  3P4G A;  1QA1 A;  1GQ8 A;  1L1I A;  3LMW A;  3ML3 A;  2VFQ A;  4XLA A;  1CZF A;  1IB4 A;  1O8H A;  2BSP A;  2QXZ A;  4W8Q A;  1AIR A;  3VMV A;  1O8E A;  1RWR A;  3VMW A;  2VFN A;  1QCX A;  2O04 A;  3VSV A;  2NST A;  4OPW A;  4W8T A;  1PE9 A;  2F3L A;  1OFM A;  2PYG A;  2VBK A; 
#chains in the Genus database with same CATH homology
 4YDT A;  4YFO A;  2XTY A;  2J8K A;  2XTX A;  3NB2 A;  3NAW A;  4YEI A;  2O6W A;  5DNS A;  3PSZ A;  2XT2 A;  2QZA A;  3DU1 X;  2XT4 A;  3PSS A;  2QYU A;  3SY2 A;  4YCQ A;  4YC5 A;  2XTW A;  3SQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...