2XT2A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
AKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQWPSVKMEGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
molecule tags Cell cycle
molecule keywords MCBG-LIKE PROTEIN
total genus 78
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt2A00
4YFOA 3NAWA 3NB2A 2XTXA 2O6WA 4YC5A 3SY2A 2J8KA 2XTWA 2XT2A 2XTYA 2QZAA 4YEIA 2QYUA 4YDTA 3DU1X 3PSZA 3PSSA 3SQVA 4YCQA 2XT4A 5DNSA
chains in the Genus database with same CATH superfamily
1KTWA 1O8DA 1HF2A 1X0CA 4XKVA 4Z06A 1EZGA 1OFLA 4HWVA 1RWRA 3H09A 5JLVC 1QA2A 1TYUA 1TYWA 4XN3A 2O17A 2F3LA 4OPWA 3SYJA 2Z8GA 1JRGA 1VBLA 2NTPA 1LLZA 5DNSA 1LLWA 4XMYA 3BH7B 2INVA 2O1DA 1QJVA 1CLWA 2O0VA 4XKWA 1GQ8A 4YC5A 1IB4A 1EA0A 5C1EA 2BX6A 4W8RA 4W8TA 3B90A 2VFQA 4XOTA 1QRBA 2NTBA 2ODLA 2XT2A 4MR0A 4XONA 3B8YA 2QYUA 4YDTA 3N6ZA 2UVEA 3VSVA 3PSSA 4XN0A 4YZXA 3JURA 3VMWA 1BN8A 4YEJA 3SZEA 4XLCA 4AVZA 3B4NA 4XOPA 3AK5A 4OZZA 2VFOA 4I84A 2UVFA 2PYHA 1KQ5A 1OFMA 4EW9A 2QXZA 1OGMX 1IDKA 1O8FA 1BHEA 4XORA 2XTXA 4YZ0A 2O6WA 2VBMA 2IQ7A 3GQ9A 4NK6A 4XLAA 3SY2A 1OFEA 1O8EA 2BM4A 3VMVA 3ZSCA 1O8IA 4YELA 1O8HA 2XTWA 2NT6A 2EWEA 4OM9A 2VJJA 3LJYA 2XTYA 1OFDA 4XNFA 1OGOX 1O88A 2O04A 4OZYA 1DBOA 3GQ7A 4YCQA 1TSPA 1O8GA 2QX3A 4KH3A 3FY3A 3EQNA 4U49A 2VFNA 2VJIA 2NT9A 1H80A 2X6WA 1QA1A 1QRCA 2X85A 4YFOA 2V5IA 1EE6A 2W7ZA 1K8FA 3VSUA 4XLFA 4XM3A 1IDJA 1NHCA 3NB2A 4YZAA 2VFPA 1QA3A 4OJ6A 2NSTA 1QQ1A 2X6YA 1L1IA 4Z03A 3VSTA 4XQFA 2B0RA 1O8MA 2BM7A 2BM5A 4XLEA 1O8JA 2VBKA 3P4GA 1KCDA 3KRGA 2QZAA 2QY1A 1PXZA 2O0WA 1TYXA 3TH0A 3EQOA 3LMWA 1DABA 4MXNA 4OJOA 3DU1X 3SQVA 2X6XA 2IOUG 4URRA 4Z05A 3WWGA 2PYGA 4U4BA 2G0YA 1K5CA 1KCCA 1AIRA 3GRHA 3RIQA 2BSPA 3GQ8A 3BH6B 1PE9A 1JTAA 2YUHA 3LYCA 2PECA 2VBEA 1K4ZA 4OJPA 2VFMA 1DBGA 3UW0A 1CZFA 5JMCB 3ZPPA 4W8QA 3NAWA 1O8KA 1RMGA 2NTQA 3GQAA 4JRAC 4XR6A 3T9GA 1PLUA 4C2LA 4XLHA 1WMRA 2X3HA 2NZMA 3SUCA 1QCXA 3N90A 4YZQA 1TYVA 1IA5A 1O8LA 3JX8A 3ML3A 1WXRA 4OJLA 1OOCA 2J8KA 4PMHA 2NSPA 4V02C 2J8IA 2XC1A 1HG8A 4YEIA 3PETA 1XG2A 1RU4A 4OJ5A 3PSZA 2XT4A 2BM6A 5AMVA 4W8SA 5C1CA 2INUA 4NK8A 1LM1A 4XL9A
chains in the Genus database with same CATH topology
4YFOA 3NAWA 3NB2A 2XTXA 2O6WA 4YC5A 3SY2A 2J8KA 2XTWA 2XT2A 2XTYA 2QZAA 4YEIA 2QYUA 4YDTA 3DU1X 3PSZA 3PSSA 3SQVA 4YCQA 2XT4A 5DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFO A;  3NAW A;  3NB2 A;  2XTX A;  2O6W A;  4YC5 A;  3SY2 A;  2J8K A;  2XTW A;  2XT2 A;  2XTY A;  2QZA A;  4YEI A;  2QYU A;  4YDT A;  3DU1 X;  3PSZ A;  3PSS A;  3SQV A;  4YCQ A;  2XT4 A;  5DNS A; 
#chains in the Genus database with same CATH topology
 1KTW A;  1O8D A;  1HF2 A;  1X0C A;  4XKV A;  4Z06 A;  1EZG A;  1OFL A;  4HWV A;  1RWR A;  3H09 A;  5JLV C;  1QA2 A;  1TYU A;  1TYW A;  4XN3 A;  2O17 A;  2F3L A;  4OPW A;  3SYJ A;  2Z8G A;  1JRG A;  1VBL A;  2NTP A;  1LLZ A;  5DNS A;  1LLW A;  4XMY A;  3BH7 B;  2INV A;  2O1D A;  1QJV A;  1CLW A;  2O0V A;  4XKW A;  1GQ8 A;  4YC5 A;  1IB4 A;  1EA0 A;  5C1E A;  2BX6 A;  4W8R A;  4W8T A;  3B90 A;  2VFQ A;  4XOT A;  1QRB A;  2NTB A;  2ODL A;  2XT2 A;  4MR0 A;  4XON A;  3B8Y A;  2QYU A;  4YDT A;  3N6Z A;  2UVE A;  3VSV A;  3PSS A;  4XN0 A;  4YZX A;  3JUR A;  3VMW A;  1BN8 A;  4YEJ A;  3SZE A;  4XLC A;  4AVZ A;  3B4N A;  4XOP A;  3AK5 A;  4OZZ A;  2VFO A;  4I84 A;  2UVF A;  2PYH A;  1KQ5 A;  1OFM A;  4EW9 A;  2QXZ A;  1OGM X;  1IDK A;  1O8F A;  1BHE A;  4XOR A;  2XTX A;  4YZ0 A;  2O6W A;  2VBM A;  2IQ7 A;  3GQ9 A;  4NK6 A;  4XLA A;  3SY2 A;  1OFE A;  1O8E A;  2BM4 A;  3VMV A;  3ZSC A;  1O8I A;  4YEL A;  1O8H A;  2XTW A;  2NT6 A;  2EWE A;  4OM9 A;  2VJJ A;  3LJY A;  2XTY A;  1OFD A;  4XNF A;  1OGO X;  1O88 A;  2O04 A;  4OZY A;  1DBO A;  3GQ7 A;  4YCQ A;  1TSP A;  1O8G A;  2QX3 A;  4KH3 A;  3FY3 A;  3EQN A;  4U49 A;  2VFN A;  2VJI A;  2NT9 A;  1H80 A;  2X6W A;  1QA1 A;  1QRC A;  2X85 A;  4YFO A;  2V5I A;  1EE6 A;  2W7Z A;  1K8F A;  3VSU A;  4XLF A;  4XM3 A;  1IDJ A;  1NHC A;  3NB2 A;  4YZA A;  2VFP A;  1QA3 A;  4OJ6 A;  2NST A;  1QQ1 A;  2X6Y A;  1L1I A;  4Z03 A;  3VST A;  4XQF A;  2B0R A;  1O8M A;  2BM7 A;  2BM5 A;  4XLE A;  1O8J A;  2VBK A;  3P4G A;  1KCD A;  3KRG A;  2QZA A;  2QY1 A;  1PXZ A;  2O0W A;  1TYX A;  3TH0 A;  3EQO A;  3LMW A;  1DAB A;  4MXN A;  4OJO A;  3DU1 X;  3SQV A;  2X6X A;  2IOU G;  4URR A;  4Z05 A;  3WWG A;  2PYG A;  4U4B A;  2G0Y A;  1K5C A;  1KCC A;  1AIR A;  3GRH A;  3RIQ A;  2BSP A;  3GQ8 A;  3BH6 B;  1PE9 A;  1JTA A;  2YUH A;  3LYC A;  2PEC A;  2VBE A;  1K4Z A;  4OJP A;  2VFM A;  1DBG A;  3UW0 A;  1CZF A;  5JMC B;  3ZPP A;  4W8Q A;  3NAW A;  1O8K A;  1RMG A;  2NTQ A;  3GQA A;  4JRA C;  4XR6 A;  3T9G A;  1PLU A;  4C2L A;  4XLH A;  1WMR A;  2X3H A;  2NZM A;  3SUC A;  1QCX A;  3N90 A;  4YZQ A;  1TYV A;  1IA5 A;  1O8L A;  3JX8 A;  3ML3 A;  1WXR A;  4OJL A;  1OOC A;  2J8K A;  4PMH A;  2NSP A;  4V02 C;  2J8I A;  2XC1 A;  1HG8 A;  4YEI A;  3PET A;  1XG2 A;  1RU4 A;  4OJ5 A;  3PSZ A;  2XT4 A;  2BM6 A;  5AMV A;  4W8S A;  5C1C A;  2INU A;  4NK8 A;  1LM1 A;  4XL9 A; 
#chains in the Genus database with same CATH homology
 4YFO A;  3NAW A;  3NB2 A;  2XTX A;  2O6W A;  4YC5 A;  3SY2 A;  2J8K A;  2XTW A;  2XT2 A;  2XTY A;  2QZA A;  4YEI A;  2QYU A;  4YDT A;  3DU1 X;  3PSZ A;  3PSS A;  3SQV A;  4YCQ A;  2XT4 A;  5DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...