2XT2A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
197
structure length
197
Chain Sequence
AKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQWPSVKMEGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCBG-LIKE PROTEIN
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
molecule tags Cell cycle
total genus 78
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt2A00
2XTYA 4YDTA 4YC5A 2XT4A 3DU1X 4YFOA 5DNSA 3NAWA 2XTWA 3NB2A 2QYUA 2XT2A 3PSZA 2QZAA 2J8KA 3SQVA 2O6WA 3SY2A 4YCQA 3PSSA 2XTXA 4YEIA
chains in the Genus database with same CATH superfamily
4YDTA 3SZEA 2VFQA 4XM3A 2X6YA 1IDKA 2NSTA 3KRGA 1RMGA 2PYHA 3DU1X 1EZGA 3N6ZA 3H09A 1QRBA 1RU4A 4KH3A 1DBOA 3LYCA 4Z06A 3GQ9A 2VFNA 2UVFA 4XR6A 2QYUA 1HF2A 1TYWA 3JURA 1K8FA 1L1IA 1O8JA 1OFEA 2X6WA 2Z8GA 3B4NA 3GQAA 2PECA 3UW0A 2INVA 1TSPA 2O6WA 4YEJA 1QA2A 2QXZA 2VBKA 2BX6A 4YELA 1OOCA 2QY1A 4Z03A 4HWVA 4OJ6A 2NSPA 1O8FA 2UVEA 4XN3A 3AK5A 1PXZA 1IA5A 1NHCA 2NTPA 2IOUG 2W7ZA 2NZMA 3EQNA 4XN0A 5C1EA 3B8YA 3BH7B 4YFOA 3ZSCA 4YZXA 4YZQA 5DNSA 4XORA 1TYUA 3NAWA 1WXRA 1QQ1A 1PLUA 2VFPA 4OJPA 3N90A 4OJLA 3SYJA 1AIRA 1EE6A 2XT2A 4XNFA 4U49A 4OM9A 3TH0A 3BH6B 1O8HA 1KTWA 2J8KA 2F3LA 1O8MA 2X3HA 4MXNA 1X0CA 2G0YA 4OZZA 1O8KA 1O8GA 3SY2A 2O0VA 1GQ8A 4XLEA 2X6XA 4OJ5A 1DABA 1KCCA 2BM7A 4W8RA 2VJJA 3VSTA 2EWEA 1QCXA 4XKWA 4C2LA 1LM1A 5C1CA 2VFOA 2INUA 3RIQA 2XTYA 3VSVA 2IQ7A 4YC5A 1OGMX 1KQ5A 1TYXA 1LLWA 4I84A 2QX3A 4YZ0A 2VBEA 2XT4A 4XOTA 4YZAA 1HG8A 1O88A 1H80A 1QRCA 3VSUA 1K4ZA 4XKVA 2V5IA 4W8TA 4XQFA 4V02C 2NT6A 2YUHA 3B90A 4XMYA 4XLCA 1KCDA 1IDJA 2XTWA 4OPWA 1CZFA 3NB2A 1LLZA 4OZYA 4MR0A 1VBLA 3GQ8A 3PSZA 1QJVA 1BHEA 3ML3A 2NT9A 2BM5A 2O0WA 1O8LA 4PMHA 4Z05A 2J8IA 3EQOA 3P4GA 3SQVA 1O8DA 1JRGA 1O8IA 1XG2A 3PSSA 1JTAA 2XTXA 5JMCB 3SUCA 2PYGA 4W8SA 1IB4A 4NK8A 4XL9A 3LMWA 3WWGA 2BSPA 4JRAC 3JX8A 3VMVA 4XLHA 2O04A 3GRHA 2X85A 4OJOA 3ZPPA 2BM6A 4U4BA 1RWRA 2VJIA 5AMVA 5JLVC 2VFMA 3T9GA 2XC1A 1BN8A 1CLWA 1K5CA 4XOPA 3FY3A 2BM4A 4NK6A 2NTBA 1WMRA 3GQ7A 1OGOX 2NTQA 2QZAA 2B0RA 4URRA 4XLAA 1OFLA 1OFDA 2O1DA 4EW9A 1QA3A 3VMWA 4YCQA 3PETA 4W8QA 1DBGA 1PE9A 1EA0A 1O8EA 1TYVA 2ODLA 4AVZA 4YEIA 3LJYA 4XLFA 4XONA 1QA1A 2O17A 2VBMA 1OFMA
chains in the Genus database with same CATH topology
2XTYA 4YDTA 4YC5A 2XT4A 3DU1X 4YFOA 5DNSA 3NAWA 2XTWA 3NB2A 2QYUA 2XT2A 3PSZA 2QZAA 2J8KA 3SQVA 2O6WA 3SY2A 4YCQA 3PSSA 2XTXA 4YEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTY A;  4YDT A;  4YC5 A;  2XT4 A;  3DU1 X;  4YFO A;  5DNS A;  3NAW A;  2XTW A;  3NB2 A;  2QYU A;  2XT2 A;  3PSZ A;  2QZA A;  2J8K A;  3SQV A;  2O6W A;  3SY2 A;  4YCQ A;  3PSS A;  2XTX A;  4YEI A; 
#chains in the Genus database with same CATH topology
 4YDT A;  3SZE A;  2VFQ A;  4XM3 A;  2X6Y A;  1IDK A;  2NST A;  3KRG A;  1RMG A;  2PYH A;  3DU1 X;  1EZG A;  3N6Z A;  3H09 A;  1QRB A;  1RU4 A;  4KH3 A;  1DBO A;  3LYC A;  4Z06 A;  3GQ9 A;  2VFN A;  2UVF A;  4XR6 A;  2QYU A;  1HF2 A;  1TYW A;  3JUR A;  1K8F A;  1L1I A;  1O8J A;  1OFE A;  2X6W A;  2Z8G A;  3B4N A;  3GQA A;  2PEC A;  3UW0 A;  2INV A;  1TSP A;  2O6W A;  4YEJ A;  1QA2 A;  2QXZ A;  2VBK A;  2BX6 A;  4YEL A;  1OOC A;  2QY1 A;  4Z03 A;  4HWV A;  4OJ6 A;  2NSP A;  1O8F A;  2UVE A;  4XN3 A;  3AK5 A;  1PXZ A;  1IA5 A;  1NHC A;  2NTP A;  2IOU G;  2W7Z A;  2NZM A;  3EQN A;  4XN0 A;  5C1E A;  3B8Y A;  3BH7 B;  4YFO A;  3ZSC A;  4YZX A;  4YZQ A;  5DNS A;  4XOR A;  1TYU A;  3NAW A;  1WXR A;  1QQ1 A;  1PLU A;  2VFP A;  4OJP A;  3N90 A;  4OJL A;  3SYJ A;  1AIR A;  1EE6 A;  2XT2 A;  4XNF A;  4U49 A;  4OM9 A;  3TH0 A;  3BH6 B;  1O8H A;  1KTW A;  2J8K A;  2F3L A;  1O8M A;  2X3H A;  4MXN A;  1X0C A;  2G0Y A;  4OZZ A;  1O8K A;  1O8G A;  3SY2 A;  2O0V A;  1GQ8 A;  4XLE A;  2X6X A;  4OJ5 A;  1DAB A;  1KCC A;  2BM7 A;  4W8R A;  2VJJ A;  3VST A;  2EWE A;  1QCX A;  4XKW A;  4C2L A;  1LM1 A;  5C1C A;  2VFO A;  2INU A;  3RIQ A;  2XTY A;  3VSV A;  2IQ7 A;  4YC5 A;  1OGM X;  1KQ5 A;  1TYX A;  1LLW A;  4I84 A;  2QX3 A;  4YZ0 A;  2VBE A;  2XT4 A;  4XOT A;  4YZA A;  1HG8 A;  1O88 A;  1H80 A;  1QRC A;  3VSU A;  1K4Z A;  4XKV A;  2V5I A;  4W8T A;  4XQF A;  4V02 C;  2NT6 A;  2YUH A;  3B90 A;  4XMY A;  4XLC A;  1KCD A;  1IDJ A;  2XTW A;  4OPW A;  1CZF A;  3NB2 A;  1LLZ A;  4OZY A;  4MR0 A;  1VBL A;  3GQ8 A;  3PSZ A;  1QJV A;  1BHE A;  3ML3 A;  2NT9 A;  2BM5 A;  2O0W A;  1O8L A;  4PMH A;  4Z05 A;  2J8I A;  3EQO A;  3P4G A;  3SQV A;  1O8D A;  1JRG A;  1O8I A;  1XG2 A;  3PSS A;  1JTA A;  2XTX A;  5JMC B;  3SUC A;  2PYG A;  4W8S A;  1IB4 A;  4NK8 A;  4XL9 A;  3LMW A;  3WWG A;  2BSP A;  4JRA C;  3JX8 A;  3VMV A;  4XLH A;  2O04 A;  3GRH A;  2X85 A;  4OJO A;  3ZPP A;  2BM6 A;  4U4B A;  1RWR A;  2VJI A;  5AMV A;  5JLV C;  2VFM A;  3T9G A;  2XC1 A;  1BN8 A;  1CLW A;  1K5C A;  4XOP A;  3FY3 A;  2BM4 A;  4NK6 A;  2NTB A;  1WMR A;  3GQ7 A;  1OGO X;  2NTQ A;  2QZA A;  2B0R A;  4URR A;  4XLA A;  1OFL A;  1OFD A;  2O1D A;  4EW9 A;  1QA3 A;  3VMW A;  4YCQ A;  3PET A;  4W8Q A;  1DBG A;  1PE9 A;  1EA0 A;  1O8E A;  1TYV A;  2ODL A;  4AVZ A;  4YEI A;  3LJY A;  4XLF A;  4XON A;  1QA1 A;  2O17 A;  2VBM A;  1OFM A; 
#chains in the Genus database with same CATH homology
 2XTY A;  4YDT A;  4YC5 A;  2XT4 A;  3DU1 X;  4YFO A;  5DNS A;  3NAW A;  2XTW A;  3NB2 A;  2QYU A;  2XT2 A;  3PSZ A;  2QZA A;  2J8K A;  3SQV A;  2O6W A;  3SY2 A;  4YCQ A;  3PSS A;  2XTX A;  4YEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...