3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
b'LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
2XTXA 2XT4A 4YFOA 2XT2A 3NB2A 4YDTA 3NAWA 3SY2A 4YCQA 2QYUA 4YC5A 2O6WA 5DNSA 3PSSA 2J8KA 2XTWA 2XTYA 2QZAA 3SQVA 4YEIA 3PSZA 3DU1X
chains in the Genus database with same CATH superfamily
1IHGA 3B7BA 1CZFA 3SBTB 2FULA 1O8HA 2H6HA 4HLLA 1OFMA 1QJVA 3CSTA 3SO8A 4NK6A 3OXLA 3UM0A 4N3CA 3RU0A 4XKCA 4HLEA 3LJ3A 2BKKB 1QRCA 3HXEA 3UUXA 2XTYA 1LM1A 4FLBA 5G05C 2C2LA 4Q96A 3JXIA 5A6CA 4GMLA 4FHKA 4YZ0A 4KBQA 2LXLA 1Y8MA 2J09A 3UI2A 4DJAA 4W8RA 1UN9A 5LCWJ 3LYCA 2C0MA 4HOSA 1HXIA 4U04A 1TYQG 5ENQD 2J49A 2WXMA 4R7LA 2G0YA 3ZGQA 4OAVB 3DSXA 4EQFA 3UPVA 3B7SA 1TN7A 3SFXA 1HZ4A 3N71A 2J4DA 1E96B 1ELRA 4KZCA 3NOGD 3ENEA 4GTMA 1VDYA 1KT0A 3NBNB 4F1PA 1H6KA 3GZ1A 3MCXA 2AW6A 1WXRA 3LPZA 3PDNA 1QYMA 1P5QA 2R59A 2L6BA 4XE0A 2R2LA 2BSPA 1O8DA 1A17A 3FWVA 4XOTA 3DU1X 4TUUA 1IYGA 2OVBA 3VSVA 3JQ1A 4AY6A 4G11A 3UQ3A 2I6HA 2MYOA 5A23A 1DC2A 4GPMA 3C3RA 2PM6A 4EPZA 3FU3A 3DWLG 4C48B 2O6WA 4HOQA 4I2WA 5JMND 2YUHA 3AS8A 4GA0A 4HB5A 4FJZA 5T4YA 2A5UA 4G23A 2VJIA 3JURA 1JCSA 1L1IA 3C5RA 1IA5A 3EQOA 3DEOA 2KZTB 2H6IA 1OWNA 4O6FA 2VQ2A 3LY8A 2WXGA 1KLXA 5CMYA 3HDXA 4AXHA 1K5CA 2IONA 5A7DB 2NC9A 3FUIA 5G04J 4AP2A 4IYPA 4G8LA 4J6IA 4FADA 2P9PG 4GZ6A 3LY9A 3FY3A 4BFRA 5G55A 4FU3A 5AIJA 3R7RA 3UINC 4LNGA 2RFAA 4DLOA 2LSVA 3ZRHA 3ULEG 5IY5E 3EU9A 1EDUA 3S7JA 4V3IA 3IEGA 1UW4B 4G26A 1TN8A 2NT9A 4D10C 4W8QA 2DYSE 3CHQA 2P2CP 4UWGA 1NI1A 1ZB1A 4APOA 5J90A 4YVQC 2X6FA 3Q5MA 3ABKE 3FTVA 4G1TA 2LNIA 1TN6A 4ANVA 4PMHA 3Q7FA 5FZQA 4MR0A 2GRQB 5DBKA 2I1KA 1RZ4A 3PS6A 2V5FA 1H80A 1D9SA 3TH0A 4F6RD 3SUCA 3I4GA 2H6GA 3Q4AB 2PQNA 5BV0A 1L5JA 1UOHA 1E7UA 1O1RA 4GU5A 4WNDA 4DI3A 3FTXA 2NTQA 4CCAA 3E30A 1MHQA 1JWGA 2O0WA 3D9IA 5T8IA 3TWSA 5ENTD 1FPPA 2AXZA 1RU4A 2XZTG 4CRWA 5AARA 4PH4B 3C3OA 4URRA 3Q7AA 3ZFWA 2IO3C 5EKQD 3UM2A 2WB2A 3HG0D 1H19A 3GW4A 4K5CA 2BM5A 1LD8A 2QC9A 3W9FA 4HQDA 4PUCA 3Q79A 3IBEA 2VSNA 1U2VG 1WAO1 4LNUD 4XEIG 5ENRD 2VFNA 1OCZE 5EDSA 3BQOA 3CGHA 2XEEA 5D66A 5CMWA 3QWPA 3PZ3A 2XENA 4EZKA 3CEQA 4GTTA 1WM5A 4CT4A 3B90A 2WXJA 1DBOA 3LVQE 3RAUA 4F3VA 1EF1C 1IDJA 2WXLA 4OJ5A 2IEJA 4GYWA 2BKGA 3TXMA 3Q49B 3CVNA 4FC8A 3U9WA 2JABA 2QXZA 4GMJA 1OCRE 2GROB 3QWVA 4F7AA 4UWKA 4B0ZA 1OOCA 3ONKA 3JUIA 3VTYA 2F3LA 3X2QE 1O8LA 2Z8GA 1EA0A 4YZXA 4I43A 4RVBA 4U8VD 3ASNE 1JUQA 4DK5A 3C3QA 1XGWA 4BWRA 3DXMG 1JPLA 1KZOA 5T3RA 3AG3E 2OEVA 3FFLA 3ZYKA 2LUHA 3CK8A 4B94A 2O04A 3APDA 4OZYA 2WMNA 2HM8A 2I2OA 3AK5A 3ASGA 2XPYA 4U95D 4X8QA 5E76A 4RQIA 2ILRA 2F8XK 4G24A 2P9LG 3DSSA 5EX0A 2GRPB 3EIJA 4L2YA 4J8SA 3UT8A 4GMRA 1MX6A 3DSVA 1HS6A 2KM4A 4I6EA 5EX3A 4CEMA 3B7UX 4O1OA 4U0ZA 4EW9A 1UG3A 1QZ2A 2DCPA 4JC8A 4GTRA 2VBEA 3TWUA 4YZAA 2P9IG 2L0TB 3CHRA 3TJPA 2FBNA 5HI7A 4HWVA 4Z68A 2VFQA 3GZSA 4F53A 1INZA 5LP0A 1PLUA 1N4RA 5CHEE 3GRHA 2IOUG 4F1SA 5EN5D 3FEXA 1JRGA 2YHCA 1D8EA 2AXUA 4LSZE 1TNYA 2R02A 3I3NA 3ZUVB 4BTAA 3VSUA 3V2OA 2JEKA 3AU5A 5JJ7A 3PH0C 2O1DA 3UM3A 2OV8A 1QQEA 3FUDA 2YINA 2B0RA 1ZBPA 3CSFA 3LEWA 3KEAA 3KSLA 2MRIA 3GQ7A 3PEVB 4FA6A 4XN0A 4KVOA 1RMGA 3ZVVA 2FO1E 4XQFA 2LAHA 4FP7A 4WWNA 1OFEA 4WAFA 1OUVA 4J8YA 3H09A 3SY2A 3MKRA 4E85A 4A55A 2XQ0A 2KCVA 1DVPA 5JHAA 3WG7E 2M63A 3MV2B 4XORA 2Y4TA 2V0PA 3WXXA 1NP7A 2QYUA 4C0EA 5BNWA 2YNQA 5KCMA 3B8YA 2XGOA 5FTPA 4N3BA 4OM9A 1IHBA 2VSXE 2EWEA 1K8KG 3EUVA 3UT4A 1ZU2A 2X6IA 3VLEA 4Y6CA 2PZIA 4A1SA 4DX1A 4OYSA 3BG1B 3FUMA 4DX7D 4UI9J 1BHEA 4K5BA 3VLDA 2Y0BG 1N52A 2ONDA 5M72A 4A1GA 2VTBB 4K03A 2WM9A 4J7WA 3Q78A 4UQYA 3SGHA 3HIZA 3CVWA 4YNDA 3N90A 3R7QA 3U4TA 2VTBA 3AG1E 4I84A 3LKUA 2PECA 1H2TC 1UJJA 5FWQA 1K4ZA 1VBLA 5KJMA 1Z5SC 4WNEA 3QB2A 3LDZA 1EYHA 3S7FA 3ZU7B 4JB8P 1OT8A 2KATA 2UVFA 4GZCA 4ILHB 5DNSA 4RLYA 4OJOA 3IHVA 1NA0A 1H0AA 3GZ2A 3GQ9A 3GYZA 3AS5A 4TUMA 2MOWA 2VFOA 1NL4A 1BI8B 4ZHBA 2XT4A 5LOZA 4OZZA 2HO1A 3T9KA 3CQCB 4AY5A 3QKYA 4DUIA 3QNKA 4XKVA 3TAXA 2R5SA 3L13A 3JYSA 3B4NA 2HYZA 4I9EA 1S64A 3AJIA 4ILIA 2W7ZA 2BX6A 2XC1A 4MLPA 1N0RA 1W3BA 3MGBA 3RSEG 3SNXA 3ONLA 3FH7A 3V31A 3B7RL 1JCQA 4GCOA 3RRMB 3U3WA 3LMWA 2BTDA 3E33A 3FH8A 3URZA 3QAQA 4HFGA 3SFYA 3CV0A 5C1EA 1X5BA 2WQ6A 5AMVA 2B0OE 2XGSA 5CRVA 2VFMA 1PAQA 1TNUA 3FUJA 4YEIA 1SA5A 2J8SD 4I9CA 4MRUA 4DPRA 5FT9A 3MEKA 4KVMA 4AM9A 1E90A 3LS8A 3PNTB 1G3NB 4ANWA 1HF2A 4LG6A 4J8FA 2KXPC 5EYPF 3VMVA 3TXNA 1KCCA 1WY6A 1TEZA 4J8EA 5HKPA 1A5EA 2FEZA 1O8KA 2I1JA 1Y6IA 2QZAA 3DPYA 4HI9A 3NQPA 1OGOX 3FTYA 2H6FA 3CKBA 4WWPA 2DBAA 1EPUA 2QFCA 3DRAA 3FH5A 3B95A 2CG3A 2V5QC 3D9LA 2O17A 2A5EA 2VSYA 3FP3A 2KZTA 5AQ9A 2IJGX 4RSYA 3JQ0A 3KSQA 5ENNA 5CEAA 4HRMB 1X81A 4JD2G 2A4ZA 5CERB 4NK8A 4YELA 3SZEA 1NZNA 3FUHA 4BESA 2IFUA 4YDTA 2XCCA 5CCLA 1IQUA 2C0LA 3ULYA 4AOFA 2EIKE 4XLCA 3GQAA 1FVHA 3FUEA 2OVFA 2IOLA 2R05A 2B6CA 3NOCD 3IV0A 3OXFA 4GZ3A 5KJKA 4XLAA 4J0UA 1E8ZA 3PZDA 1SVXA 4J8DA 3FEYA 3L16A 2INUA 1H6PA 3G2WA 2NT6A 1HG2A 4CDRA 3O48A 5FQ6A 2J07A 3RJVA 4WNGA 1E7VA 3CK9A 2DZNA 4DX2A 1HG5A 4MS6A 2E2EA 2YHEA 5JJTA 4DI4A 1MYOA 2WXIA 1N95A 1Z6TA 4H7XA 4TRQA 1GW6A 2DVWA 3L6AA 4XLEA 3ZEFA 1OY3D 5J08A 3NF1A 3ULQA 1OWLA 4ZFHA 2X6XA 3EQNA 2KC7A 4B8AA 5HS0A 1K8FA 3G2SA 3ZSCA 2BM6A 3PEUB 4YEJA 4GTPA 5G05J 4OJLA 1N0QA 1YMPA 3R9AB 4M3OA 1LD7A 3HXDA 2L0IA 2I9CA 3PVLA 4DLQA 4YDYA 3L9TA 5AQBA 3HXFA 4XL9A 2WXHA 4QFVA 4CDNA 2IF4A 1O5MA 4CZ2D 4HVBA 2LAIA 3Q47B 5BPPA 3EHRA 5FZSA 4XONA 3D9HA 5EYLA 3DXKG 3S7BA 4ANUA 1S63A 1KT1A 1MZCA 1OFLA 3MA5A 1IDKA 4WNFA 4IRUA 4C9BB 5CEDB 1LLWA 1O8EA 3AG2E 4L7TA 1JTAA 4N5CA 1FCHA 2F8YA 2CFZA 3JX8A 2BF0X 4YDOA 1HU3A 3ZW3A 2WXFA 2NXPA 1SA4A 1S70B 3L22A 3ABME 2ZIRA 3CLJA 3W9GA 3LYAA 1TNOA 5AAOA 4U8YD 4HNAD 2AWIA 1HO8A 3FU5A 5BT1A 4MBGA 3HYMB 4JZYA 5C1CA 4LNBA 4HOTA 2QY7A 1Z3YA 3G2VA 5DIZA 1BLXB 1BPOA 3TWTA 1K1AA 4BSZB 5B1BE 4FHJA 4I2ZA 3ZPJA 3B13A 3CVUA 4OVVA 3JCKC 3T8KA 3Q15A 2CHZA 5ENPD 2RKKA 4ME2A 3L54A 3VTXA 5CECB 3J5QB 2XPZA 3CHOA 1BD8A 4N2QA 2ZXWE 5CBNA 4KMOA 1AWCB 3DPDA 2Y69E 1MX4A 3UT7A 1ELKA 1NA3A 3UKRG 1TNBA 1K3ZD 3KRGA 2NSZA 3C98A 1O8JA 4EBAG 4QQIA 2IO2C 4XLFA 1TR4A 3UTMA 5KJLA 4BTBA 2UWJG 2ETCA 3JUEA 1KPSB 4EZJA 1O8MA 1HG8A 5H7PA 2OEWA 3D9PA 3OAWA 5ENOD 2JLBA 4GCNA 2DZOA 1LF8A 1XNFA 5E75A 3P2BA 3APCA 1FT2A 2LXMA 3S2AA 3TWRA 2IQ7A 1SZ9A 2F37A 2PM7A 3CK7A 3ZYMA 4H7YA 3TWXA 5FQ7A 2BM7A 1YA0A 3HXCA 2Y3AA 5BUZA 4N5QA 1CLWA 3FTWA 2FF4A 5C2YA 2V4HC 4YDWA 4URKA 3PETA 2BM4A 3BUAA 3QWWA 1WMRA 3FUNA 1N94A 4HRNA 4A3TA 3BH7B 3CVVA 1TYXA 2CG2A 2ETAA 4GYOA 3OXGA 3PZ1A 2AJAA 3R9MA 5FJYA 3TWWA 2AXVA 1O8IA 1TYVA 3IXEA 1E8YA 4CGVA 5LCWC 5JMCB 3NAWA 2UY1B 1O8GA 1MX2A 1PE9A 4XOPA 3ZYLA 3TG5A 1HX8A 3D9JA 3PE4A 2P58C 2P9SG 3PSSA 4NURA 3LVRE 2UY1A 4XI0A 3ML8A 1EE6A 5AQAA 4P29A 2L9BA 4GA2A 1QA2A 3ZXPA 4MKTA 2VBMA 1OFDA 3UX4A 3BG0B 3SFZA 4I1AA 3HXBA 2J08A 4JW1A 4Z03A 2NTPA 3T8MA 3FTSA 5FQ8A 4U96D 3UM1A 1NFIE 5FINA 5ANRA 2UVEA 1SQMA 3QK0A 2NSPA 2IOSA 3SF4A 2QYJA 3EHMA 4ANXA 3Q75A 4LEUA 4YC5A 3RKVA 4JL0A 3EHNA 5BXUA 4EHMA 3VLFA 2XTWA 1E8WA 2XS8A 2FI7A 1K1BA 3VSTA 4GB9A 2BEDA 4BT9A 4XX5A 2MHKA 2NYJA 4PS3A 2KBXA 4XR6A 5JA4D 5D0QD 3T9GA 2OCCE 5JHBA 2DYRE 4JVSA 3RRUA 3QJZA 4L2LA 1DCEA 3E4BA 5G04C 4UWLA 1OCOE 2PL2A 2ZU6B 2VGXB 5BV1A 1BI7B 1E8XA 3I5PA 4GAAA 4DX6D 1DBGA 3P4GA 3EJNA 4U07A 4UQXA 1MJ0A 2VGXA 1RWRA 4APFA 4L23A 4GZ5A 2CFUA 1XG2A 4JHRA 2IQCA 1OGMX 5ANLA 3DBSA 5KWDA 4HXIA 4OJ6A 3EHQA 2GRMA 1PC2A 1NHCA 1YYHA 1PXZA 3CKCA 2ZISA 5ENSD 4Q94A 2OOEA 3N6ZA 2DWZA 1TYWA 5LFAA 2PYHA 3FY4A 2XZDG 1FVFA 3LJYA 3E32A 4U49A 5EIDA 4ABNA 5FIOA 3PZ4A 4TV3A 3SYJA 4GTSA 3FUFA 4N2SA 4G8KA 2IY0C 4ACLA 3JXJA 1U3CA 3J5PA 4KH3A 4UQZA 4U0SA 5BW8C 3MJWA 4EECA 3KD7A 4NACA 4ILGA 4BX9A 4LCTA 1QRBA 1U3DA 1KZPA 2LO6A 4YZQA 4GTQA 5AENA 4RG6A 4Y6WA 3KAEA 1GQ8A 5KJNA 1SZAA 3DSWA 4XN3A 4HS2A 1ELWA 4JXTA 3CQGB 3FULA 3T5XA 3PRZA 3SHFA 3ZYQA 1LTXA 3L08A 4N39A 1DNPA 4PDXA 1QNFA 5KNGA 3FU0A 3TWQA 4XNFA 5B1AE 3D9NA 4E6HA 4I1OB 3CIAA 4TXPA 1O88A 3Q9UC 5BXOA 2LSUA 4YVOA 4TXQA 4B89A 5CRUA 1H2UA 3PUKA 3RIBA 3ZNGA 2VGEA 3MKQB 3MV3B 3Q73A 2XHEA 1Z3XA 3KEZA 3MKQA 3PREA 3UIPC 3PE3A 1N4SA 1TYUA 3ZIMA 1HE8A 2O0VA 2XPIA 3BU8A 1BU9A 1X0CA 3G2UA 3GQ8A 3P1UA 3SBSA 1TNZA 1O1TA 1OWMA 4UWFA 1KCDA 4A3VA 2EIME 3I4RB 4IULA 4G2VA 1RW2A 4TXRA 2GGFA 3HVEB 4CDMA 2WQHA 4OJPA 4IN3B 4FJYA 3LJNA 4FULA 4I1MA 3ZN3A 1OXJA 3U66A 3D3MA 1AIRA 1N54A 4OAUC 3CHMA 3HVEA 2WXOA 1B89A 3MYVA 5AJDA 3AS4A 5AYWD 2DIWA 4K0RA 1S0PA 3C72A 3FHEA 1HFAA 4WUYA 1D8DA 3T5VA 4UWHA 4XKWA 4KXKB 4MXNA 2RFMA 3CVLA 3DSUA 4GYYA 2P9UG 2P9NG 3QARA 1IB4A 4BSXA 2XRZA 3BH6B 3FTUA 2X38A 3IKOB 1TJFA 4KZ0A 2R17C 4NIKA 5B3SE 3CVPA 3F6QA 2R03A 4BEPA 4W8TA 1N9AA 2YQ8A 5EIBE 3ML3A 1YCSB 4PS8A 3UIOC 1SW6A 1JWFA 5EILA 3RK6A 2KCKA 2NSTA 2X3MA 4EBAA 3RO2A 4XZ4A 2X85A 4CYMD 1N4PA 2NTBA 2PQRA 2VJ8A 5JLVC 4AV7A 2E0IA 3AAAC 3S7DA 4U0UA 4I6JA 2WXPA 1KQ5A 3UW0A 3Q9NC 2QX3A 1HF8A 2ZGGA 3FDHA 3PSZA 1H2VC 3E37A 4B93B 1UJKA 3EU5A 4JHJA 3ASFA 1O1SA 3EIQC 5KNHD 3FU6A 4GPKA 4XI9A 1H6OA 4V02C 1N11A 3O4ZA 2EQXA 4KYOB 2X6YA 4BT8A 4Z06A 5CBOA 1DCQA 2X6KA 3ISMC 3KS2A 4K5AB 2VYIA 4BY6A 4Q69A 4AIFA 2VFPA 4U7EB 1OWOA 4XLHA 1EZGA 3AG4E 4AEZC 1JCRA 3ASDA 2X3HA 4C2LA 5FZRA 3ESLA 2INVA 3NB2A 3ZHEB 4W9RA 2AVPA 4B8CB 2XEVA 4G25A 3ZHEA 4I17A 4HOUA 4PS7A 3SI5A 2HE0A 3AU4A 2VJJA 3BEEA 1HH8A 3ML9A 4YFOA 3SZ7A 4O1PA 3RO3A 3PUJA 2Q7FA 1QQ1A 4ATGA 2XGMA 2CHWA 3V79K 2Y1LE 5HRYA 3APFA 3NZSA 4NQ0A 4AJWA 3CHPA 3PNLB 3CVQA 2EILE 4DRXE 4LERA 4BX8A 4XM3A 4UI9C 4LUNU 2VGYA 1BN8A 2WQ7A 4ATZD 3EDTB 5C1DA 1UN8A 2KCLA 2WPVA 2ETBA 4YDEA 2XCBA 2WVIA 2CHXA 1KTWA 1IKND 4DX5D 3LY7A 5ITZF 2FO7A 1Q2ZA 3MX3A 4LRZA 5ARFA 2NZMA 2GRNB 1LLZA 5LX8A 4AVZA 5D2MC 4GTVA 2F0YA 4HI8A 2V5IA 4KT6B 2VBKA 3D9OA 3CR3A 3L82A 3UMVA 2WXKA 3QOUA 3DSTA 2EINE 4UI9K 3ABLE 1O8FA 4JEHA 2J4BA 4U63A 4I6GA 1OWPA 2WXRA 3RIQA 4JEUA 3MZLB 4WWOA 3B7TA 4YCQA 2HR2A 1N4QA 2IU1A 3ASOE 3IHYA 4XKBA 2J8KA 4U8HA 5HQ8A 1IXVA 2GRLA 3WWGA 3TWVA 1QA1A 3V30A 1V54E 2X6HA 3FTZA 3CVYA 3QC1A 3ZKJA 1V55E 3SD5A 1WG0A 1OCCE 3NZUA 3ESKA 2BUGA 2WXNA 2V4LA 2XTXA 3VMWA 2Y4UA 3TGOA 4Z05A 1QCXA 3ZPPA 3D9MA 3CHSA 4JA7A 4EZLA 4GA1A 2WMOA 4C0MA 4UUCA 5G2NA 2PNNA 1IQRA 3U64A 5AQ7A 3PZ2A 2GRRB 2L6JA 2ZGDA 3LCAA 4W8SA 5CCMA 1QBQA 4L9PA 4RG9A 1AP7A 3TL5A 2J8IA 3HRAA 1WDYA 4HBDA 3RRNB 2X6JA 4CT0A 3E34A 4BERA 3CVXA 2RD0A 4M7CA 2X6WA 4O60A 2XT2A 2J9QA 1MQSA 3QDNA 3K9IA 4ACKA 2ODLA 3ZXSA 4CGWA 2GW1A 3G2TA 5KBAA 2EIJE 1DABA 4JHKA 3TG4A 4HRLA 4XMYA 3OTNA 5AN8A 3LXUX 4U4BA 1QA3A 5JJ6A 3V2XA 2VSOE 3D9KA 1TSPA 4AVXA 3UXGA 2QY1A 4L1BA 4XIFA 3SQVA 3UKUG 4GZDA 1PY1A 4GTOA 4OPWA 5FQ4A 2V8SE 4NRHB 2XS1A 1FT1A 3HHMA 5AJLA 4A63B 4HORA 4JRAC 3FUKA 4N3AA 2XRYA 2P9KG 3ASHA 4JPSA 1TJCA 2PYGA 2WXQA 4BETA 4FLHA 2XEHA 2RG8A 4JA9A 3DEPA 4OVUA 5D0OD 5ARGA 3L17A
chains in the Genus database with same CATH topology
2XTXA 2XT4A 4YFOA 2XT2A 3NB2A 4YDTA 3NAWA 3SY2A 4YCQA 2QYUA 4YC5A 2O6WA 5DNSA 3PSSA 2J8KA 2XTWA 2XTYA 2QZAA 3SQVA 4YEIA 3PSZA 3DU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTX A;  2XT4 A;  4YFO A;  2XT2 A;  3NB2 A;  4YDT A;  3NAW A;  3SY2 A;  4YCQ A;  2QYU A;  4YC5 A;  2O6W A;  5DNS A;  3PSS A;  2J8K A;  2XTW A;  2XTY A;  2QZA A;  3SQV A;  4YEI A;  3PSZ A;  3DU1 X; 
#chains in the Genus database with same CATH topology
 1IHG A;  3B7B A;  1CZF A;  3SBT B;  2FUL A;  1O8H A;  2H6H A;  4HLL A;  1OFM A;  1QJV A;  3CST A;  3SO8 A;  4NK6 A;  3OXL A;  3UM0 A;  4N3C A;  3RU0 A;  4XKC A;  4HLE A;  3LJ3 A;  2BKK B;  1QRC A;  3HXE A;  3UUX A;  2XTY A;  1LM1 A;  4FLB A;  5G05 C;  2C2L A;  4Q96 A;  3JXI A;  5A6C A;  4GML A;  4FHK A;  4YZ0 A;  4KBQ A;  2LXL A;  1Y8M A;  2J09 A;  3UI2 A;  4DJA A;  4W8R A;  1UN9 A;  5LCW J;  3LYC A;  2C0M A;  4HOS A;  1HXI A;  4U04 A;  1TYQ G;  5ENQ D;  2J49 A;  2WXM A;  4R7L A;  2G0Y A;  3ZGQ A;  4OAV B;  3DSX A;  4EQF A;  3UPV A;  3B7S A;  1TN7 A;  3SFX A;  1HZ4 A;  3N71 A;  2J4D A;  1E96 B;  1ELR A;  4KZC A;  3NOG D;  3ENE A;  4GTM A;  1VDY A;  1KT0 A;  3NBN B;  4F1P A;  1H6K A;  3GZ1 A;  3MCX A;  2AW6 A;  1WXR A;  3LPZ A;  3PDN A;  1QYM A;  1P5Q A;  2R59 A;  2L6B A;  4XE0 A;  2R2L A;  2BSP A;  1O8D A;  1A17 A;  3FWV A;  4XOT A;  3DU1 X;  4TUU A;  1IYG A;  2OVB A;  3VSV A;  3JQ1 A;  4AY6 A;  4G11 A;  3UQ3 A;  2I6H A;  2MYO A;  5A23 A;  1DC2 A;  4GPM A;  3C3R A;  2PM6 A;  4EPZ A;  3FU3 A;  3DWL G;  4C48 B;  2O6W A;  4HOQ A;  4I2W A;  5JMN D;  2YUH A;  3AS8 A;  4GA0 A;  4HB5 A;  4FJZ A;  5T4Y A;  2A5U A;  4G23 A;  2VJI A;  3JUR A;  1JCS A;  1L1I A;  3C5R A;  1IA5 A;  3EQO A;  3DEO A;  2KZT B;  2H6I A;  1OWN A;  4O6F A;  2VQ2 A;  3LY8 A;  2WXG A;  1KLX A;  5CMY A;  3HDX A;  4AXH A;  1K5C A;  2ION A;  5A7D B;  2NC9 A;  3FUI A;  5G04 J;  4AP2 A;  4IYP A;  4G8L A;  4J6I A;  4FAD A;  2P9P G;  4GZ6 A;  3LY9 A;  3FY3 A;  4BFR A;  5G55 A;  4FU3 A;  5AIJ A;  3R7R A;  3UIN C;  4LNG A;  2RFA A;  4DLO A;  2LSV A;  3ZRH A;  3ULE G;  5IY5 E;  3EU9 A;  1EDU A;  3S7J A;  4V3I A;  3IEG A;  1UW4 B;  4G26 A;  1TN8 A;  2NT9 A;  4D10 C;  4W8Q A;  2DYS E;  3CHQ A;  2P2C P;  4UWG A;  1NI1 A;  1ZB1 A;  4APO A;  5J90 A;  4YVQ C;  2X6F A;  3Q5M A;  3ABK E;  3FTV A;  4G1T A;  2LNI A;  1TN6 A;  4ANV A;  4PMH A;  3Q7F A;  5FZQ A;  4MR0 A;  2GRQ B;  5DBK A;  2I1K A;  1RZ4 A;  3PS6 A;  2V5F A;  1H80 A;  1D9S A;  3TH0 A;  4F6R D;  3SUC A;  3I4G A;  2H6G A;  3Q4A B;  2PQN A;  5BV0 A;  1L5J A;  1UOH A;  1E7U A;  1O1R A;  4GU5 A;  4WND A;  4DI3 A;  3FTX A;  2NTQ A;  4CCA A;  3E30 A;  1MHQ A;  1JWG A;  2O0W A;  3D9I A;  5T8I A;  3TWS A;  5ENT D;  1FPP A;  2AXZ A;  1RU4 A;  2XZT G;  4CRW A;  5AAR A;  4PH4 B;  3C3O A;  4URR A;  3Q7A A;  3ZFW A;  2IO3 C;  5EKQ D;  3UM2 A;  2WB2 A;  3HG0 D;  1H19 A;  3GW4 A;  4K5C A;  2BM5 A;  1LD8 A;  2QC9 A;  3W9F A;  4HQD A;  4PUC A;  3Q79 A;  3IBE A;  2VSN A;  1U2V G;  1WAO 1;  4LNU D;  4XEI G;  5ENR D;  2VFN A;  1OCZ E;  5EDS A;  3BQO A;  3CGH A;  2XEE A;  5D66 A;  5CMW A;  3QWP A;  3PZ3 A;  2XEN A;  4EZK A;  3CEQ A;  4GTT A;  1WM5 A;  4CT4 A;  3B90 A;  2WXJ A;  1DBO A;  3LVQ E;  3RAU A;  4F3V A;  1EF1 C;  1IDJ A;  2WXL A;  4OJ5 A;  2IEJ A;  4GYW A;  2BKG A;  3TXM A;  3Q49 B;  3CVN A;  4FC8 A;  3U9W A;  2JAB A;  2QXZ A;  4GMJ A;  1OCR E;  2GRO B;  3QWV A;  4F7A A;  4UWK A;  4B0Z A;  1OOC A;  3ONK A;  3JUI A;  3VTY A;  2F3L A;  3X2Q E;  1O8L A;  2Z8G A;  1EA0 A;  4YZX A;  4I43 A;  4RVB A;  4U8V D;  3ASN E;  1JUQ A;  4DK5 A;  3C3Q A;  1XGW A;  4BWR A;  3DXM G;  1JPL A;  1KZO A;  5T3R A;  3AG3 E;  2OEV A;  3FFL A;  3ZYK A;  2LUH A;  3CK8 A;  4B94 A;  2O04 A;  3APD A;  4OZY A;  2WMN A;  2HM8 A;  2I2O A;  3AK5 A;  3ASG A;  2XPY A;  4U95 D;  4X8Q A;  5E76 A;  4RQI A;  2ILR A;  2F8X K;  4G24 A;  2P9L G;  3DSS A;  5EX0 A;  2GRP B;  3EIJ A;  4L2Y A;  4J8S A;  3UT8 A;  4GMR A;  1MX6 A;  3DSV A;  1HS6 A;  2KM4 A;  4I6E A;  5EX3 A;  4CEM A;  3B7U X;  4O1O A;  4U0Z A;  4EW9 A;  1UG3 A;  1QZ2 A;  2DCP A;  4JC8 A;  4GTR A;  2VBE A;  3TWU A;  4YZA A;  2P9I G;  2L0T B;  3CHR A;  3TJP A;  2FBN A;  5HI7 A;  4HWV A;  4Z68 A;  2VFQ A;  3GZS A;  4F53 A;  1INZ A;  5LP0 A;  1PLU A;  1N4R A;  5CHE E;  3GRH A;  2IOU G;  4F1S A;  5EN5 D;  3FEX A;  1JRG A;  2YHC A;  1D8E A;  2AXU A;  4LSZ E;  1TNY A;  2R02 A;  3I3N A;  3ZUV B;  4BTA A;  3VSU A;  3V2O A;  2JEK A;  3AU5 A;  5JJ7 A;  3PH0 C;  2O1D A;  3UM3 A;  2OV8 A;  1QQE A;  3FUD A;  2YIN A;  2B0R A;  1ZBP A;  3CSF A;  3LEW A;  3KEA A;  3KSL A;  2MRI A;  3GQ7 A;  3PEV B;  4FA6 A;  4XN0 A;  4KVO A;  1RMG A;  3ZVV A;  2FO1 E;  4XQF A;  2LAH A;  4FP7 A;  4WWN A;  1OFE A;  4WAF A;  1OUV A;  4J8Y A;  3H09 A;  3SY2 A;  3MKR A;  4E85 A;  4A55 A;  2XQ0 A;  2KCV A;  1DVP A;  5JHA A;  3WG7 E;  2M63 A;  3MV2 B;  4XOR A;  2Y4T A;  2V0P A;  3WXX A;  1NP7 A;  2QYU A;  4C0E A;  5BNW A;  2YNQ A;  5KCM A;  3B8Y A;  2XGO A;  5FTP A;  4N3B A;  4OM9 A;  1IHB A;  2VSX E;  2EWE A;  1K8K G;  3EUV A;  3UT4 A;  1ZU2 A;  2X6I A;  3VLE A;  4Y6C A;  2PZI A;  4A1S A;  4DX1 A;  4OYS A;  3BG1 B;  3FUM A;  4DX7 D;  4UI9 J;  1BHE A;  4K5B A;  3VLD A;  2Y0B G;  1N52 A;  2OND A;  5M72 A;  4A1G A;  2VTB B;  4K03 A;  2WM9 A;  4J7W A;  3Q78 A;  4UQY A;  3SGH A;  3HIZ A;  3CVW A;  4YND A;  3N90 A;  3R7Q A;  3U4T A;  2VTB A;  3AG1 E;  4I84 A;  3LKU A;  2PEC A;  1H2T C;  1UJJ A;  5FWQ A;  1K4Z A;  1VBL A;  5KJM A;  1Z5S C;  4WNE A;  3QB2 A;  3LDZ A;  1EYH A;  3S7F A;  3ZU7 B;  4JB8 P;  1OT8 A;  2KAT A;  2UVF A;  4GZC A;  4ILH B;  5DNS A;  4RLY A;  4OJO A;  3IHV A;  1NA0 A;  1H0A A;  3GZ2 A;  3GQ9 A;  3GYZ A;  3AS5 A;  4TUM A;  2MOW A;  2VFO A;  1NL4 A;  1BI8 B;  4ZHB A;  2XT4 A;  5LOZ A;  4OZZ A;  2HO1 A;  3T9K A;  3CQC B;  4AY5 A;  3QKY A;  4DUI A;  3QNK A;  4XKV A;  3TAX A;  2R5S A;  3L13 A;  3JYS A;  3B4N A;  2HYZ A;  4I9E A;  1S64 A;  3AJI A;  4ILI A;  2W7Z A;  2BX6 A;  2XC1 A;  4MLP A;  1N0R A;  1W3B A;  3MGB A;  3RSE G;  3SNX A;  3ONL A;  3FH7 A;  3V31 A;  3B7R L;  1JCQ A;  4GCO A;  3RRM B;  3U3W A;  3LMW A;  2BTD A;  3E33 A;  3FH8 A;  3URZ A;  3QAQ A;  4HFG A;  3SFY A;  3CV0 A;  5C1E A;  1X5B A;  2WQ6 A;  5AMV A;  2B0O E;  2XGS A;  5CRV A;  2VFM A;  1PAQ A;  1TNU A;  3FUJ A;  4YEI A;  1SA5 A;  2J8S D;  4I9C A;  4MRU A;  4DPR A;  5FT9 A;  3MEK A;  4KVM A;  4AM9 A;  1E90 A;  3LS8 A;  3PNT B;  1G3N B;  4ANW A;  1HF2 A;  4LG6 A;  4J8F A;  2KXP C;  5EYP F;  3VMV A;  3TXN A;  1KCC A;  1WY6 A;  1TEZ A;  4J8E A;  5HKP A;  1A5E A;  2FEZ A;  1O8K A;  2I1J A;  1Y6I A;  2QZA A;  3DPY A;  4HI9 A;  3NQP A;  1OGO X;  3FTY A;  2H6F A;  3CKB A;  4WWP A;  2DBA A;  1EPU A;  2QFC A;  3DRA A;  3FH5 A;  3B95 A;  2CG3 A;  2V5Q C;  3D9L A;  2O17 A;  2A5E A;  2VSY A;  3FP3 A;  2KZT A;  5AQ9 A;  2IJG X;  4RSY A;  3JQ0 A;  3KSQ A;  5ENN A;  5CEA A;  4HRM B;  1X81 A;  4JD2 G;  2A4Z A;  5CER B;  4NK8 A;  4YEL A;  3SZE A;  1NZN A;  3FUH A;  4BES A;  2IFU A;  4YDT A;  2XCC A;  5CCL A;  1IQU A;  2C0L A;  3ULY A;  4AOF A;  2EIK E;  4XLC A;  3GQA A;  1FVH A;  3FUE A;  2OVF A;  2IOL A;  2R05 A;  2B6C A;  3NOC D;  3IV0 A;  3OXF A;  4GZ3 A;  5KJK A;  4XLA A;  4J0U A;  1E8Z A;  3PZD A;  1SVX A;  4J8D A;  3FEY A;  3L16 A;  2INU A;  1H6P A;  3G2W A;  2NT6 A;  1HG2 A;  4CDR A;  3O48 A;  5FQ6 A;  2J07 A;  3RJV A;  4WNG A;  1E7V A;  3CK9 A;  2DZN A;  4DX2 A;  1HG5 A;  4MS6 A;  2E2E A;  2YHE A;  5JJT A;  4DI4 A;  1MYO A;  2WXI A;  1N95 A;  1Z6T A;  4H7X A;  4TRQ A;  1GW6 A;  2DVW A;  3L6A A;  4XLE A;  3ZEF A;  1OY3 D;  5J08 A;  3NF1 A;  3ULQ A;  1OWL A;  4ZFH A;  2X6X A;  3EQN A;  2KC7 A;  4B8A A;  5HS0 A;  1K8F A;  3G2S A;  3ZSC A;  2BM6 A;  3PEU B;  4YEJ A;  4GTP A;  5G05 J;  4OJL A;  1N0Q A;  1YMP A;  3R9A B;  4M3O A;  1LD7 A;  3HXD A;  2L0I A;  2I9C A;  3PVL A;  4DLQ A;  4YDY A;  3L9T A;  5AQB A;  3HXF A;  4XL9 A;  2WXH A;  4QFV A;  4CDN A;  2IF4 A;  1O5M A;  4CZ2 D;  4HVB A;  2LAI A;  3Q47 B;  5BPP A;  3EHR A;  5FZS A;  4XON A;  3D9H A;  5EYL A;  3DXK G;  3S7B A;  4ANU A;  1S63 A;  1KT1 A;  1MZC A;  1OFL A;  3MA5 A;  1IDK A;  4WNF A;  4IRU A;  4C9B B;  5CED B;  1LLW A;  1O8E A;  3AG2 E;  4L7T A;  1JTA A;  4N5C A;  1FCH A;  2F8Y A;  2CFZ A;  3JX8 A;  2BF0 X;  4YDO A;  1HU3 A;  3ZW3 A;  2WXF A;  2NXP A;  1SA4 A;  1S70 B;  3L22 A;  3ABM E;  2ZIR A;  3CLJ A;  3W9G A;  3LYA A;  1TNO A;  5AAO A;  4U8Y D;  4HNA D;  2AWI A;  1HO8 A;  3FU5 A;  5BT1 A;  4MBG A;  3HYM B;  4JZY A;  5C1C A;  4LNB A;  4HOT A;  2QY7 A;  1Z3Y A;  3G2V A;  5DIZ A;  1BLX B;  1BPO A;  3TWT A;  1K1A A;  4BSZ B;  5B1B E;  4FHJ A;  4I2Z A;  3ZPJ A;  3B13 A;  3CVU A;  4OVV A;  3JCK C;  3T8K A;  3Q15 A;  2CHZ A;  5ENP D;  2RKK A;  4ME2 A;  3L54 A;  3VTX A;  5CEC B;  3J5Q B;  2XPZ A;  3CHO A;  1BD8 A;  4N2Q A;  2ZXW E;  5CBN A;  4KMO A;  1AWC B;  3DPD A;  2Y69 E;  1MX4 A;  3UT7 A;  1ELK A;  1NA3 A;  3UKR G;  1TNB A;  1K3Z D;  3KRG A;  2NSZ A;  3C98 A;  1O8J A;  4EBA G;  4QQI A;  2IO2 C;  4XLF A;  1TR4 A;  3UTM A;  5KJL A;  4BTB A;  2UWJ G;  2ETC A;  3JUE A;  1KPS B;  4EZJ A;  1O8M A;  1HG8 A;  5H7P A;  2OEW A;  3D9P A;  3OAW A;  5ENO D;  2JLB A;  4GCN A;  2DZO A;  1LF8 A;  1XNF A;  5E75 A;  3P2B A;  3APC A;  1FT2 A;  2LXM A;  3S2A A;  3TWR A;  2IQ7 A;  1SZ9 A;  2F37 A;  2PM7 A;  3CK7 A;  3ZYM A;  4H7Y A;  3TWX A;  5FQ7 A;  2BM7 A;  1YA0 A;  3HXC A;  2Y3A A;  5BUZ A;  4N5Q A;  1CLW A;  3FTW A;  2FF4 A;  5C2Y A;  2V4H C;  4YDW A;  4URK A;  3PET A;  2BM4 A;  3BUA A;  3QWW A;  1WMR A;  3FUN A;  1N94 A;  4HRN A;  4A3T A;  3BH7 B;  3CVV A;  1TYX A;  2CG2 A;  2ETA A;  4GYO A;  3OXG A;  3PZ1 A;  2AJA A;  3R9M A;  5FJY A;  3TWW A;  2AXV A;  1O8I A;  1TYV A;  3IXE A;  1E8Y A;  4CGV A;  5LCW C;  5JMC B;  3NAW A;  2UY1 B;  1O8G A;  1MX2 A;  1PE9 A;  4XOP A;  3ZYL A;  3TG5 A;  1HX8 A;  3D9J A;  3PE4 A;  2P58 C;  2P9S G;  3PSS A;  4NUR A;  3LVR E;  2UY1 A;  4XI0 A;  3ML8 A;  1EE6 A;  5AQA A;  4P29 A;  2L9B A;  4GA2 A;  1QA2 A;  3ZXP A;  4MKT A;  2VBM A;  1OFD A;  3UX4 A;  3BG0 B;  3SFZ A;  4I1A A;  3HXB A;  2J08 A;  4JW1 A;  4Z03 A;  2NTP A;  3T8M A;  3FTS A;  5FQ8 A;  4U96 D;  3UM1 A;  1NFI E;  5FIN A;  5ANR A;  2UVE A;  1SQM A;  3QK0 A;  2NSP A;  2IOS A;  3SF4 A;  2QYJ A;  3EHM A;  4ANX A;  3Q75 A;  4LEU A;  4YC5 A;  3RKV A;  4JL0 A;  3EHN A;  5BXU A;  4EHM A;  3VLF A;  2XTW A;  1E8W A;  2XS8 A;  2FI7 A;  1K1B A;  3VST A;  4GB9 A;  2BED A;  4BT9 A;  4XX5 A;  2MHK A;  2NYJ A;  4PS3 A;  2KBX A;  4XR6 A;  5JA4 D;  5D0Q D;  3T9G A;  2OCC E;  5JHB A;  2DYR E;  4JVS A;  3RRU A;  3QJZ A;  4L2L A;  1DCE A;  3E4B A;  5G04 C;  4UWL A;  1OCO E;  2PL2 A;  2ZU6 B;  2VGX B;  5BV1 A;  1BI7 B;  1E8X A;  3I5P A;  4GAA A;  4DX6 D;  1DBG A;  3P4G A;  3EJN A;  4U07 A;  4UQX A;  1MJ0 A;  2VGX A;  1RWR A;  4APF A;  4L23 A;  4GZ5 A;  2CFU A;  1XG2 A;  4JHR A;  2IQC A;  1OGM X;  5ANL A;  3DBS A;  5KWD A;  4HXI A;  4OJ6 A;  3EHQ A;  2GRM A;  1PC2 A;  1NHC A;  1YYH A;  1PXZ A;  3CKC A;  2ZIS A;  5ENS D;  4Q94 A;  2OOE A;  3N6Z A;  2DWZ A;  1TYW A;  5LFA A;  2PYH A;  3FY4 A;  2XZD G;  1FVF A;  3LJY A;  3E32 A;  4U49 A;  5EID A;  4ABN A;  5FIO A;  3PZ4 A;  4TV3 A;  3SYJ A;  4GTS A;  3FUF A;  4N2S A;  4G8K A;  2IY0 C;  4ACL A;  3JXJ A;  1U3C A;  3J5P A;  4KH3 A;  4UQZ A;  4U0S A;  5BW8 C;  3MJW A;  4EEC A;  3KD7 A;  4NAC A;  4ILG A;  4BX9 A;  4LCT A;  1QRB A;  1U3D A;  1KZP A;  2LO6 A;  4YZQ A;  4GTQ A;  5AEN A;  4RG6 A;  4Y6W A;  3KAE A;  1GQ8 A;  5KJN A;  1SZA A;  3DSW A;  4XN3 A;  4HS2 A;  1ELW A;  4JXT A;  3CQG B;  3FUL A;  3T5X A;  3PRZ A;  3SHF A;  3ZYQ A;  1LTX A;  3L08 A;  4N39 A;  1DNP A;  4PDX A;  1QNF A;  5KNG A;  3FU0 A;  3TWQ A;  4XNF A;  5B1A E;  3D9N A;  4E6H A;  4I1O B;  3CIA A;  4TXP A;  1O88 A;  3Q9U C;  5BXO A;  2LSU A;  4YVO A;  4TXQ A;  4B89 A;  5CRU A;  1H2U A;  3PUK A;  3RIB A;  3ZNG A;  2VGE A;  3MKQ B;  3MV3 B;  3Q73 A;  2XHE A;  1Z3X A;  3KEZ A;  3MKQ A;  3PRE A;  3UIP C;  3PE3 A;  1N4S A;  1TYU A;  3ZIM A;  1HE8 A;  2O0V A;  2XPI A;  3BU8 A;  1BU9 A;  1X0C A;  3G2U A;  3GQ8 A;  3P1U A;  3SBS A;  1TNZ A;  1O1T A;  1OWM A;  4UWF A;  1KCD A;  4A3V A;  2EIM E;  3I4R B;  4IUL A;  4G2V A;  1RW2 A;  4TXR A;  2GGF A;  3HVE B;  4CDM A;  2WQH A;  4OJP A;  4IN3 B;  4FJY A;  3LJN A;  4FUL A;  4I1M A;  3ZN3 A;  1OXJ A;  3U66 A;  3D3M A;  1AIR A;  1N54 A;  4OAU C;  3CHM A;  3HVE A;  2WXO A;  1B89 A;  3MYV A;  5AJD A;  3AS4 A;  5AYW D;  2DIW A;  4K0R A;  1S0P A;  3C72 A;  3FHE A;  1HFA A;  4WUY A;  1D8D A;  3T5V A;  4UWH A;  4XKW A;  4KXK B;  4MXN A;  2RFM A;  3CVL A;  3DSU A;  4GYY A;  2P9U G;  2P9N G;  3QAR A;  1IB4 A;  4BSX A;  2XRZ A;  3BH6 B;  3FTU A;  2X38 A;  3IKO B;  1TJF A;  4KZ0 A;  2R17 C;  4NIK A;  5B3S E;  3CVP A;  3F6Q A;  2R03 A;  4BEP A;  4W8T A;  1N9A A;  2YQ8 A;  5EIB E;  3ML3 A;  1YCS B;  4PS8 A;  3UIO C;  1SW6 A;  1JWF A;  5EIL A;  3RK6 A;  2KCK A;  2NST A;  2X3M A;  4EBA A;  3RO2 A;  4XZ4 A;  2X85 A;  4CYM D;  1N4P A;  2NTB A;  2PQR A;  2VJ8 A;  5JLV C;  4AV7 A;  2E0I A;  3AAA C;  3S7D A;  4U0U A;  4I6J A;  2WXP A;  1KQ5 A;  3UW0 A;  3Q9N C;  2QX3 A;  1HF8 A;  2ZGG A;  3FDH A;  3PSZ A;  1H2V C;  3E37 A;  4B93 B;  1UJK A;  3EU5 A;  4JHJ A;  3ASF A;  1O1S A;  3EIQ C;  5KNH D;  3FU6 A;  4GPK A;  4XI9 A;  1H6O A;  4V02 C;  1N11 A;  3O4Z A;  2EQX A;  4KYO B;  2X6Y A;  4BT8 A;  4Z06 A;  5CBO A;  1DCQ A;  2X6K A;  3ISM C;  3KS2 A;  4K5A B;  2VYI A;  4BY6 A;  4Q69 A;  4AIF A;  2VFP A;  4U7E B;  1OWO A;  4XLH A;  1EZG A;  3AG4 E;  4AEZ C;  1JCR A;  3ASD A;  2X3H A;  4C2L A;  5FZR A;  3ESL A;  2INV A;  3NB2 A;  3ZHE B;  4W9R A;  2AVP A;  4B8C B;  2XEV A;  4G25 A;  3ZHE A;  4I17 A;  4HOU A;  4PS7 A;  3SI5 A;  2HE0 A;  3AU4 A;  2VJJ A;  3BEE A;  1HH8 A;  3ML9 A;  4YFO A;  3SZ7 A;  4O1P A;  3RO3 A;  3PUJ A;  2Q7F A;  1QQ1 A;  4ATG A;  2XGM A;  2CHW A;  3V79 K;  2Y1L E;  5HRY A;  3APF A;  3NZS A;  4NQ0 A;  4AJW A;  3CHP A;  3PNL B;  3CVQ A;  2EIL E;  4DRX E;  4LER A;  4BX8 A;  4XM3 A;  4UI9 C;  4LUN U;  2VGY A;  1BN8 A;  2WQ7 A;  4ATZ D;  3EDT B;  5C1D A;  1UN8 A;  2KCL A;  2WPV A;  2ETB A;  4YDE A;  2XCB A;  2WVI A;  2CHX A;  1KTW A;  1IKN D;  4DX5 D;  3LY7 A;  5ITZ F;  2FO7 A;  1Q2Z A;  3MX3 A;  4LRZ A;  5ARF A;  2NZM A;  2GRN B;  1LLZ A;  5LX8 A;  4AVZ A;  5D2M C;  4GTV A;  2F0Y A;  4HI8 A;  2V5I A;  4KT6 B;  2VBK A;  3D9O A;  3CR3 A;  3L82 A;  3UMV A;  2WXK A;  3QOU A;  3DST A;  2EIN E;  4UI9 K;  3ABL E;  1O8F A;  4JEH A;  2J4B A;  4U63 A;  4I6G A;  1OWP A;  2WXR A;  3RIQ A;  4JEU A;  3MZL B;  4WWO A;  3B7T A;  4YCQ A;  2HR2 A;  1N4Q A;  2IU1 A;  3ASO E;  3IHY A;  4XKB A;  2J8K A;  4U8H A;  5HQ8 A;  1IXV A;  2GRL A;  3WWG A;  3TWV A;  1QA1 A;  3V30 A;  1V54 E;  2X6H A;  3FTZ A;  3CVY A;  3QC1 A;  3ZKJ A;  1V55 E;  3SD5 A;  1WG0 A;  1OCC E;  3NZU A;  3ESK A;  2BUG A;  2WXN A;  2V4L A;  2XTX A;  3VMW A;  2Y4U A;  3TGO A;  4Z05 A;  1QCX A;  3ZPP A;  3D9M A;  3CHS A;  4JA7 A;  4EZL A;  4GA1 A;  2WMO A;  4C0M A;  4UUC A;  5G2N A;  2PNN A;  1IQR A;  3U64 A;  5AQ7 A;  3PZ2 A;  2GRR B;  2L6J A;  2ZGD A;  3LCA A;  4W8S A;  5CCM A;  1QBQ A;  4L9P A;  4RG9 A;  1AP7 A;  3TL5 A;  2J8I A;  3HRA A;  1WDY A;  4HBD A;  3RRN B;  2X6J A;  4CT0 A;  3E34 A;  4BER A;  3CVX A;  2RD0 A;  4M7C A;  2X6W A;  4O60 A;  2XT2 A;  2J9Q A;  1MQS A;  3QDN A;  3K9I A;  4ACK A;  2ODL A;  3ZXS A;  4CGW A;  2GW1 A;  3G2T A;  5KBA A;  2EIJ E;  1DAB A;  4JHK A;  3TG4 A;  4HRL A;  4XMY A;  3OTN A;  5AN8 A;  3LXU X;  4U4B A;  1QA3 A;  5JJ6 A;  3V2X A;  2VSO E;  3D9K A;  1TSP A;  4AVX A;  3UXG A;  2QY1 A;  4L1B A;  4XIF A;  3SQV A;  3UKU G;  4GZD A;  1PY1 A;  4GTO A;  4OPW A;  5FQ4 A;  2V8S E;  4NRH B;  2XS1 A;  1FT1 A;  3HHM A;  5AJL A;  4A63 B;  4HOR A;  4JRA C;  3FUK A;  4N3A A;  2XRY A;  2P9K G;  3ASH A;  4JPS A;  1TJC A;  2PYG A;  2WXQ A;  4BET A;  4FLH A;  2XEH A;  2RG8 A;  4JA9 A;  3DEP A;  4OVU A;  5D0O D;  5ARG A;  3L17 A; 
#chains in the Genus database with same CATH homology
 2XTX A;  2XT4 A;  4YFO A;  2XT2 A;  3NB2 A;  4YDT A;  3NAW A;  3SY2 A;  4YCQ A;  2QYU A;  4YC5 A;  2O6W A;  5DNS A;  3PSS A;  2J8K A;  2XTW A;  2XTY A;  2QZA A;  3SQV A;  4YEI A;  3PSZ A;  3DU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...