3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
2XT2A 4YCQA 3SY2A 2QYUA 2QZAA 3PSSA 3SQVA 2XTXA 3NAWA 2XTYA 2O6WA 5DNSA 4YEIA 2XTWA 3PSZA 2XT4A 3NB2A 4YC5A 3DU1X 4YDTA 4YFOA 2J8KA
chains in the Genus database with same CATH superfamily
3DSUA 3SFYA 4B8AA 1LD7A 3HYMB 3TWQA 1BD8A 4MBGA 3UTMA 3C3QA 4AIFA 4EZJA 4L9PA 1O8KA 2O0WA 1L1IA 3EHRA 2FO1E 3SHFA 4JA7A 3FH8A 2Y1LE 3PZDA 1PLUA 1K1AA 1O8FA 4KH3A 2LUHA 3ABME 3URZA 3MJWA 4K03A 5T8IA 4ZFHA 2AXVA 4FHJA 3WXXA 5KBAA 3DU1X 5FJYA 3UW0A 3GW4A 3ZSCA 4GPKA 4JL0A 3ULEG 3QOUA 5CBOA 1RMGA 3J5QB 1LF8A 2NZMA 5ITZF 3MEKA 3RRMB 4XLFA 4LNBA 1TNYA 4TRQA 4EBAG 1UJKA 2LXLA 4LSZE 3VMVA 3GRHA 3CHQA 2GRRB 4WNGA 1Z3YA 3UX4A 3SY2A 2AXUA 3ZPPA 4WWOA 3I3NA 3VTYA 2WMNA 4AJWA 1N4QA 2PYHA 4U63A 2P9IG 2IFUA 3FTZA 3Q49B 3Q73A 4GA2A 2BM4A 4OJ6A 3B7RL 1ELWA 1OT8A 2G0YA 5LP0A 4FA6A 4I6EA 2RD0A 4URRA 2YHEA 3Q47B 3MKQA 3S2AA 3S7FA 1O8HA 2L0IA 4J8EA 1HG8A 5JMCB 5FZRA 2J07A 1HF2A 2Y69E 3JXJA 2WXFA 5ENNA 1RU4A 2WM9A 4A63B 4LUNU 1JWFA 4Z68A 3QDNA 1TYUA 3ML3A 2DYSE 1OXJA 1MX2A 4CYMD 4GCOA 2OOEA 4OAVB 1N4SA 1L5JA 1A17A 3VMWA 3CR3A 4OZZA 2X6YA 2VBMA 2WQHA 3UT8A 1QA3A 3RK6A 3KD7A 3ZXSA 5ENTD 1DCQA 4UWGA 4WNFA 4YELA 1KTWA 4UWHA 3C98A 2RG8A 3Q7FA 4ATGA 3ZGQA 1PAQA 3LVRE 3KSLA 5EN5D 2NC9A 2L9BA 2Y4UA 5ENOD 1IB4A 4FLBA 3LEWA 4XKVA 3PUJA 1SZAA 1AIRA 4Z06A 2F37A 3B90A 2X6XA 5ARGA 4A55A 3LJNA 3JYSA 5H7PA 4E85A 2V5IA 5DIZA 2KCKA 4N5CA 4F6RD 3BU8A 1IDJA 2F0YA 4J6IA 5JMND 4HRNA 1Q2ZA 4PMHA 1O5MA 5LCWJ 1HE8A 1HS6A 3ULYA 3ZEFA 3QB2A 2NSTA 2XC1A 3VSTA 1O1RA 4BERA 4Q69A 3ZVVA 2BX6A 3UM1A 3PE3A 1ZB1A 2PNNA 2XHEA 1EE6A 3NQPA 4BSXA 3CVVA 3L54A 2EIKE 4CRWA 3BUAA 4WNEA 3LJYA 4XZ4A 1IHBA 2YQ8A 2Z8GA 3VSVA 3FFLA 4N3AA 1HFAA 3FU3A 3ZRHA 2XCBA 1HU3A 3ZU7B 4I9EA 3FUJA 5AYWD 2LAHA 1A5EA 1OY3D 1Z3XA 4YDWA 5HS0A 1QQEA 2X6JA 4XI9A 4YCQA 4UUCA 3QWVA 4JC8A 4MRUA 3NOGD 3VLDA 5KJNA 4Q94A 3U3WA 3SD5A 1YYHA 4ABNA 4N3BA 2HO1A 4EZKA 1U3CA 4JRAC 3D9PA 3IEGA 4EZLA 4GMJA 3V30A 5G04C 2IEJA 1CZFA 3C72A 5CMWA 4Q96A 5G55A 2QZAA 4UQYA 1TN6A 3EJNA 3NZSA 1WY6A 3ZIMA 3N71A 4HQDA 1FT1A 2XRYA 3N90A 3W9FA 4GYWA 4HLEA 1HXIA 3N6ZA 2L6BA 1H19A 4A3VA 4APOA 2AXZA 3U64A 4F7AA 4FADA 2PL2A 1O8IA 1SQMA 3TG4A 3CIAA 4MKTA 3AS5A 4PUCA 2HR2A 4PS8A 1XG2A 4L1BA 4I6GA 2ILRA 3AJIA 4PDXA 3BH6B 4BX8A 1K4ZA 3RKVA 3BG0B 1H2VC 3HXDA 3C3RA 4ILIA 4WUYA 2JEKA 3IXEA 4XLHA 4YDEA 4CDMA 4PS3A 4UWKA 4JHRA 1IXVA 2F3LA 4FU3A 4J7WA 1WG0A 4HFGA 3DPYA 2VJ8A 1V55E 3D9KA 4U0SA 2JLBA 3X2QE 3I4GA 3EHQA 3TXMA 4MR0A 2WQ6A 3UT7A 1JTAA 1KZOA 3AG3E 4GTVA 2BSPA 1K8KG 4APFA 1MYOA 1OFMA 1OWNA 3CK7A 3JXIA 1H2UA 3AS8A 4G25A 5LCWC 4YNDA 2GRLA 4H7YA 3CV0A 4HRLA 1EF1C 4LNGA 5ANLA 4XEIG 3CVQA 4UQXA 5KJKA 2I2OA 3FTUA 3TWUA 4HRMB 2HM8A 1RZ4A 3QNKA 3SFZA 4KVMA 3TG5A 3ZYMA 3IV0A 1E8YA 1O8GA 1OWLA 1ELKA 1FPPA 3PREA 1TSPA 2O1DA 3QWWA 2WXPA 3TWRA 5CHEE 1PY1A 1E90A 2PZIA 4U0ZA 4GA0A 2NT9A 4IRUA 2FULA 2WMOA 3FUMA 3V79K 2I1KA 4YVQC 4IYPA 1GQ8A 4O1OA 1HZ4A 1S64A 1K8FA 4A1GA 1OGMX 3ASGA 4WAFA 3Q78A 2I6HA 4U7EB 1UN9A 4ACLA 1DBOA 5EIBE 5J90A 3LYAA 5CCMA 2RFMA 3BH7B 4GZ5A 3CK9A 4I1MA 3LY7A 2J8IA 1KCCA 2V4LA 2XT4A 4W8TA 2IONA 4N2QA 2PM7A 3EU5A 3DSSA 5KWDA 5AQAA 4N3CA 5B1AE 4URKA 1W3BA 4F1PA 4CGWA 3EHMA 3UT4A 2ZISA 1PE9A 4YEIA 2EIME 1QRBA 3S7BA 1TJCA 3PNTB 4KYOB 3T5XA 4O1PA 1N9AA 3G2SA 2VSNA 4P29A 2VFNA 4G8KA 2BEDA 4V02C 5AQBA 1IKND 2IOSA 3UINC 2VFOA 3KS2A 5CEDB 3U66A 3D9JA 2WXGA 2UWJG 3LS8A 2JABA 2UY1B 2LAIA 1TN7A 2CFUA 3HXCA 3DBSA 1SZ9A 3B95A 4XNFA 3HG0D 1QQ1A 3ZPJA 4PS7A 4B89A 2AVPA 2CG3A 2PYGA 4OVUA 2INVA 1WXRA 4U8VD 1NA0A 4C0MA 1DVPA 1XGWA 4BWRA 4BTBA 3LMWA 4BETA 4XI0A 3QWPA 2IOUG 4FLHA 1O88A 1KT0A 5JJ6A 2LO6A 3LJ3A 2O17A 4BT9A 1O8EA 3PVLA 5KJLA 2X6FA 4JA9A 4DLQA 2VFQA 1HH8A 3BQOA 3PZ1A 4B93B 2X38A 1H6OA 2H6IA 2IU1A 4MXNA 4U04A 3SUCA 2XGOA 5G05J 3UI2A 3PUKA 2I9CA 4XM3A 2XTXA 3HIZA 1TR4A 1E96B 3LY9A 2WXHA 3IHVA 4I1AA 4XL9A 1N11A 3ASFA 5AJDA 4LCTA 5CCLA 4UI9K 2ODLA 4MLPA 2L0TB 3D9IA 3ZNGA 5KNGA 4I2ZA 2ZU6B 5CECB 2P9SG 5CRVA 4R7LA 3CVXA 4YZXA 2QC9A 2ZGGA 2HE0A 1QRCA 4YZAA 4G8LA 1OUVA 1QBQA 2MYOA 5FQ7A 1VDYA 2B0RA 5EDSA 1EA0A 1Y6IA 1KLXA 3JUEA 5EIDA 1WM5A 4KT6B 3MYVA 3G2WA 3T5VA 1S70B 2YNQA 3FDHA 2BF0X 1E8WA 4EQFA 1BN8A 1WDYA 3TGOA 4NQ0A 5G04J 1O8JA 1JUQA 2KZTB 2XEVA 1E7VA 4GTPA 4U8YD 5BV1A 1H0AA 1N94A 2INUA 2R03A 3V2OA 2OVFA 4XIFA 1DNPA 3B7UX 1S63A 4NIKA 1UW4B 4OJLA 4B94A 4LG6A 2J08A 1JRGA 3ENEA 3TWTA 4U07A 3FEYA 1DCEA 2VGXB 1SA4A 4DPRA 4YC5A 5EILA 1FVFA 4HOSA 5FQ8A 4L7TA 3VSUA 4JEUA 1IA5A 1TN8A 4UQZA 2C0LA 3R7QA 1H6KA 2X6HA 2FEZA 1YCSB 3OXLA 1KZPA 3CVUA 2QY1A 5LOZA 2VYIA 4XLEA 2XGMA 4ANXA 2DWZA 3CVPA 1EDUA 2CHWA 4G11A 5KJMA 4AP2A 3SBTB 3IBEA 1JCQA 1OOCA 2VFPA 3AG1E 3CHRA 2H6HA 1OWPA 2WPVA 5EX3A 4XMYA 4HI9A 4DJAA 2IJGX 1SA5A 3CSTA 1JCSA 5G05C 3KEAA 1D8EA 4YZQA 1JCRA 3PZ3A 3FU6A 3ASNE 3GYZA 1TYXA 1HO8A 3FUFA 2RFAA 4J0UA 3FY4A 3KRGA 4GZDA 2F8YA 2EQXA 3FTXA 4XOPA 2FO7A 3APFA 4HXIA 1MX4A 1MZCA 3TWVA 4XQFA 4Z03A 5BXOA 2DYRE 4DRXE 2VSOE 3U4TA 4GZ6A 5T3RA 2Q7FA 4F3VA 3Q7AA 2XRZA 1HG5A 4GCNA 2E0IA 3E33A 4A3TA 2UY1A 1X5BA 3ASDA 5D2MC 2J09A 4J8SA 1P5QA 4CEMA 3H09A 2MHKA 4K0RA 1DC2A 2AW6A 4HOQA 1TYWA 3APDA 1LM1A 1KCDA 2XPYA 3Q79A 3ML8A 3LXUX 2DZNA 2P2CP 3ESLA 2J4BA 3LDZA 3RJVA 5A23A 4YFOA 2Y3AA 2BKKB 4GPMA 3R9AB 3UKRG 2BUGA 3PS6A 4O60A 2BM7A 3OAWA 4GYYA 2P9KG 3FUEA 2KBXA 4I17A 4RSYA 4G23A 3FEXA 2WXJA 3FUHA 1LLZA 4RLYA 4KMOA 3SI5A 2WVIA 1E8ZA 4YDTA 2F8XK 4ILGA 3DSVA 2OCCE 3L13A 4YEJA 2XEEA 4CT4A 2VQ2A 2O04A 3D9NA 3BEEA 5EYPF 5AJLA 5FZQA 3MGBA 2YHCA 3CKCA 5AENA 4JVSA 2W7ZA 3EIQC 4CZ2D 3PDNA 1TEZA 3LY8A 3ZXPA 1D8DA 1HF8A 1MHQA 3RO3A 4HORA 2M63A 1N4RA 2XENA 4HS2A 4QFVA 4NK6A 5FIOA 4U96D 4BEPA 5M72A 4RG9A 2GRNB 2NXPA 3UPVA 1FVHA 3BG1B 4OJPA 4EBAA 1QYMA 3ML9A 1AP7A 5ENRD 5FT9A 2NTBA 1B89A 2IO3C 4MS6A 2R05A 1DABA 3APCA 2C2LA 3R7RA 4GTTA 2EWEA 5AQ7A 3FU5A 2BKGA 2NSPA 5LFAA 2X85A 1JWGA 3Q4AB 2DVWA 5HRYA 3RSEG 3ABLE 2OVBA 4GYOA 3MKQB 3JURA 4ANUA 2BM5A 4ZHBA 4K5BA 1K1BA 2V5QC 4AOFA 3ZHEB 2ZXWE 2UVEA 4ILHB 5A7DB 2KZTA 3L9TA 4EPZA 2WXNA 4AM9A 4EW9A 1NHCA 3L82A 1JPLA 4F1SA 1K3ZD 4H7XA 4JZYA 1IQUA 5CEAA 5JA4D 1EPUA 3D9MA 5HI7A 4GMLA 3TL5A 5BXUA 1KPSB 3MV2B 3FWVA 2BM6A 3CKBA 5KCMA 4OAUC 4I1OB 5CBNA 2OEWA 5E76A 1HG2A 3PZ2A 5DBKA 3JQ0A 3B13A 1IQRA 4UWLA 2R02A 2VGXA 2WXIA 2ETBA 2WXQA 2AJAA 2WXOA 1YA0A 3IHYA 5LX8A 5T4YA 5D0QD 2H6FA 3I5PA 3P1UA 4C2LA 2FF4A 3ESKA 2XTYA 3VLFA 1OWOA 5AIJA 3ASHA 2EINE 3ZUVB 3ZFWA 1X81A 4BT8A 3VLEA 3FH7A 5B3SE 2P58C 5JJ7A 2IQCA 3ASOE 2A5EA 4U4BA 3FTSA 3DSTA 4I9CA 3D9HA 1UG3A 2QXZA 1QNFA 3P2BA 1TNBA 3NAWA 3E4BA 4WWNA 2CHZA 4JB8P 3GQAA 3QC1A 4IULA 5G2NA 1OFDA 4JHKA 1TYQG 2P9UG 2GROB 3SFXA 2VJIA 2XPZA 2IOLA 4CT0A 1SW6A 5EKQD 4CCAA 2V8SE 3AS4A 3ZYLA 3DSWA 2X3HA 5ENQD 2FBNA 3W9GA 3QKYA 4PH4B 2NTQA 3UUXA 4YZ0A 1OCOE 3SNXA 3FUKA 2WXKA 4TXPA 2PQRA 1TJFA 4W8SA 1TNZA 1TNUA 4YDOA 4XONA 1FCHA 3CSFA 4M7CA 4TUUA 2NSZA 1Z6TA 4RVBA 1RWRA 1KT1A 1FT2A 4GMRA 4XR6A 3FUDA 2BTDA 3CGHA 4JEHA 2KM4A 3FTVA 3U9WA 3CVYA 4C48B 3EUVA 3MZLB 2DCPA 2CFZA 3T8MA 3S7JA 1OCCE 3NOCD 5E75A 5JHAA 3S7DA 3ABKE 4JHJA 4XKBA 1WAO1 2PECA 5IY5E 3JX8A 4U0UA 1HX8A 1ZBPA 3HXFA 1UJJA 3FUIA 4GZ3A 4K5CA 3DXMG 2XT2A 4GTOA 3SGHA 2QX3A 3SQVA 1N95A 2MOWA 3FY3A 4DX1A 1U2VG 3C3OA 3CK8A 3K9IA 4G24A 4B8CB 4GA1A 3EIJA 5FZSA 2WXMA 2V0PA 4BFRA 3LKUA 1BU9A 3G2TA 3OXGA 3RAUA 4UWFA 3PH0C 3CVWA 4TXRA 4OJOA 3PNLB 1NZNA 4KBQA 3GQ7A 3PEVB 3ULQA 1BPOA 3ZN3A 4KZ0A 3ZYKA 4DLOA 3L16A 5HQ8A 2VBEA 3PEUB 3KSQA 2Y0BG 4GU5A 3DPDA 3HXEA 3CHMA 2X3MA 4GTRA 3E37A 3MCXA 2V5FA 1V54E 3V31A 2QYUA 3RO2A 3SZEA 3QJZA 4D10C 1U3DA 3TXNA 5D0OD 4HOTA 2OV8A 2ETCA 3FU0A 5EYLA 3HRAA 1DBGA 2L6JA 2KC7A 3EU9A 2YINA 4LERA 3MX3A 5ENPD 5CMYA 3AAAC 1WMRA 4G1TA 3B8YA 2FI7A 3LPZA 4CDRA 5ANRA 3UQ3A 5AQ9A 3PSZA 2QY7A 3I4RB 1BLXB 2XZTG 4BY6A 4I43A 4E6HA 4XX5A 4BX9A 3LVQE 1S0PA 4G2VA 1MQSA 1PXZA 1GW6A 4DX7D 1IYGA 1LD8A 4GZCA 3Q5MA 2ETAA 4U49A 3ZHEA 4M3OA 2V4HC 3QARA 4UI9J 2NT6A 1UN8A 4ACKA 3JUIA 2P9LG 3UM0A 3KAEA 4WWPA 3WG7E 4W8RA 2J8KA 4W9RA 1OGOX 5BW8C 4OVVA 4U8HA 5D66A 4X8QA 4FJZA 1N0QA 3CVLA 1H6PA 3JCKC 4HLLA 4J8YA 4AY6A 4DK5A 2J4DA 4XKCA 2NYJA 4QQIA 3F6QA 4ME2A 1N0RA 2KCVA 2XCCA 3SF4A 3R9MA 4HVBA 2CG2A 1LTXA 3Q9UC 3PE4A 2XZDG 3MV3B 5FQ4A 4KXKB 3PZ4A 4I6JA 1QCXA 3LYCA 3Q9NC 2XS1A 4FHKA 3L17A 3FP3A 1O8MA 3IKOB 4V3IA 3Q75A 3AG2E 2XPIA 2NTPA 3SBSA 4C0EA 1LLWA 3ONKA 2X6KA 3B7BA 2ONDA 1O8DA 2X6IA 2PM6A 4KVOA 4J8DA 4IN3B 1ELRA 2YUHA 4HWVA 5B1BE 1QA1A 1PC2A 1CLWA 2LXMA 4ANVA 2RKKA 4U95D 3CLJA 2AWIA 2VSYA 2VTBB 2WXRA 5JJTA 2IY0C 1OCRE 1NP7A 3SYJA 2R59A 4GAAA 2IQ7A 1N54A 3RIBA 5ENSD 3UMVA 4FC8A 3NZUA 5ARFA 3UM2A 1BHEA 2C0MA 3CVNA 5BNWA 5CERB 3HVEB 3AG4E 1K5CA 5BUZA 4JD2G 2IO2C 3QK0A 4L2LA 4N39A 3RRNB 1NFIE 4G26A 1TNOA 4WNDA 1INZA 3WWGA 3DRAA 2R17C 5AARA 3TH0A 3KEZA 2H6GA 1BI7B 1NA3A 4DX5D 3MKRA 4F53A 3PRZA 4ANWA 3TAXA 5BT1A 3UM3A 2VJJA 3EQNA 4HNAD 3SZ7A 2A5UA 3UXGA 4UI9C 4AXHA 1O1TA 3GZ2A 2UVFA 2IF4A 4YDYA 4XOTA 4XORA 4FP7A 4I84A 5AMVA 1MX6A 3HDXA 5C1DA 2J9QA 5BV0A 3EDTB 1NI1A 3HHMA 2VGYA 3FULA 4LEUA 4XN0A 5FQ6A 5CRUA 5DNSA 4N5QA 4EECA 4FULA 3J5PA 4NACA 4GB9A 3GZSA 2XQ0A 5FINA 2DZOA 4HI8A 3FTYA 3DXKG 1YMPA 4XKWA 3ISMC 4XE0A 4K5AB 4N2SA 2DIWA 4Z05A 5J08A 2O6WA 4L23A 2EILE 4NRHB 1OFEA 2O0VA 1O1SA 2WQ7A 3CQGB 1SVXA 4HB5A 3CQCB 3E30A 5FTPA 4GTMA 3PETA 2VBKA 3Q15A 5C1EA 4Y6WA 2P9NG 3TWXA 1OFLA 3VTXA 1X0CA 1O8LA 2J8SD 3MA5A 4NK8A 4XLCA 1NL4A 3AU4A 3SO8A 2R5SA 3V2XA 2LSVA 4LNUD 3C5RA 3AK5A 2OEVA 4DI4A 3FUNA 3TJPA 3RU0A 2ZGDA 3ZKJA 3DSXA 5JHBA 5JLVC 5C2YA 3T9KA 2E2EA 1IDKA 2A4ZA 3AU5A 3D9OA 1KQ5A 3D3MA 1TYVA 4A1SA 4HOUA 1H2TC 3B7TA 4OJ5A 4XN3A 4DX6D 4KZCA 1D9SA 1IHGA 4CDNA 4BSZB 3NBNB 4RQIA 2DBAA 3EHNA 3DEPA 2CHXA 2KATA 1BI8B 2MRIA 3UKUG 3UIOC 3T9GA 4BTAA 1Z5SC 1OWMA 2P9PG 3E32A 4I2WA 3O4ZA 4JW1A 2XEHA 3DWLG 3ZW3A 4O6FA 2B6CA 2X6WA 4Y6CA 4J8FA 2I1JA 1E7UA 3L22A 3LCAA 2GRPB 3NF1A 5C1CA 2GW1A 2GGFA 3GQ8A 1N4PA 3O48A 4AVXA 3B4NA 3P4GA 2WB2A 3G2UA 5AN8A 3ZYQA 4LRZA 4B0ZA 4BESA 4AEZC 3G2VA 1G3NB 4CGVA 3JQ1A 3D9LA 1E8XA 2VFMA 4OPWA 2PQNA 1AWCB 2B0OE 2QFCA 3EQOA 3NB2A 2VSXE 3GZ1A 4C9BB 4TV3A 4AVZA 1QJVA 3CEQA 2GRMA 3RRUA 4OYSA 1XNFA 2R2LA 4NURA 3UIPC 3PSSA 1QZ2A 3QAQA 2KXPC 4DX2A 4YVOA 1MJ0A 1EYHA 1N52A 3FHEA 1VBLA 2J49A 1H80A 4JXTA 5EX0A 3L08A 4GTSA 2EIJE 1EZGA 3L6AA 4ATZD 4L2YA 2KCLA 2XGSA 5A6CA 3HXBA 4AV7A 3OXFA 5AAOA 2VTBA 2LSUA 3GQ9A 2HYZA 4W8QA 3B7SA 3FTWA 4OZYA 2XTWA 5KNHD 1OCZE 3CHSA 4HBDA 3RIQA 3CHPA 4XLAA 3TWWA 4OM9A 1Y8MA 4JPSA 4TXQA 3T8KA 3E34A 2VGEA 3OTNA 2Y4TA 5HKPA 4DUIA 3FH5A 1UOHA 2LNIA 2XS8A 4FJYA 4TUMA 5FWQA 4EHMA 4GTQA 2WXLA 3CHOA 4DI3A 2GRQB 3ONLA 2ZIRA 2QYJA 1ZU2A 5BPPA 1RW2A 4RG6A 1QA2A 4AY5A 3HVEA 3TWSA 3DEOA
chains in the Genus database with same CATH topology
2XT2A 4YCQA 3SY2A 2QYUA 2QZAA 3PSSA 3SQVA 2XTXA 3NAWA 2XTYA 2O6WA 5DNSA 4YEIA 2XTWA 3PSZA 2XT4A 3NB2A 4YC5A 3DU1X 4YDTA 4YFOA 2J8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT2 A;  4YCQ A;  3SY2 A;  2QYU A;  2QZA A;  3PSS A;  3SQV A;  2XTX A;  3NAW A;  2XTY A;  2O6W A;  5DNS A;  4YEI A;  2XTW A;  3PSZ A;  2XT4 A;  3NB2 A;  4YC5 A;  3DU1 X;  4YDT A;  4YFO A;  2J8K A; 
#chains in the Genus database with same CATH topology
 3DSU A;  3SFY A;  4B8A A;  1LD7 A;  3HYM B;  3TWQ A;  1BD8 A;  4MBG A;  3UTM A;  3C3Q A;  4AIF A;  4EZJ A;  4L9P A;  1O8K A;  2O0W A;  1L1I A;  3EHR A;  2FO1 E;  3SHF A;  4JA7 A;  3FH8 A;  2Y1L E;  3PZD A;  1PLU A;  1K1A A;  1O8F A;  4KH3 A;  2LUH A;  3ABM E;  3URZ A;  3MJW A;  4K03 A;  5T8I A;  4ZFH A;  2AXV A;  4FHJ A;  3WXX A;  5KBA A;  3DU1 X;  5FJY A;  3UW0 A;  3GW4 A;  3ZSC A;  4GPK A;  4JL0 A;  3ULE G;  3QOU A;  5CBO A;  1RMG A;  3J5Q B;  1LF8 A;  2NZM A;  5ITZ F;  3MEK A;  3RRM B;  4XLF A;  4LNB A;  1TNY A;  4TRQ A;  4EBA G;  1UJK A;  2LXL A;  4LSZ E;  3VMV A;  3GRH A;  3CHQ A;  2GRR B;  4WNG A;  1Z3Y A;  3UX4 A;  3SY2 A;  2AXU A;  3ZPP A;  4WWO A;  3I3N A;  3VTY A;  2WMN A;  4AJW A;  1N4Q A;  2PYH A;  4U63 A;  2P9I G;  2IFU A;  3FTZ A;  3Q49 B;  3Q73 A;  4GA2 A;  2BM4 A;  4OJ6 A;  3B7R L;  1ELW A;  1OT8 A;  2G0Y A;  5LP0 A;  4FA6 A;  4I6E A;  2RD0 A;  4URR A;  2YHE A;  3Q47 B;  3MKQ A;  3S2A A;  3S7F A;  1O8H A;  2L0I A;  4J8E A;  1HG8 A;  5JMC B;  5FZR A;  2J07 A;  1HF2 A;  2Y69 E;  3JXJ A;  2WXF A;  5ENN A;  1RU4 A;  2WM9 A;  4A63 B;  4LUN U;  1JWF A;  4Z68 A;  3QDN A;  1TYU A;  3ML3 A;  2DYS E;  1OXJ A;  1MX2 A;  4CYM D;  4GCO A;  2OOE A;  4OAV B;  1N4S A;  1L5J A;  1A17 A;  3VMW A;  3CR3 A;  4OZZ A;  2X6Y A;  2VBM A;  2WQH A;  3UT8 A;  1QA3 A;  3RK6 A;  3KD7 A;  3ZXS A;  5ENT D;  1DCQ A;  4UWG A;  4WNF A;  4YEL A;  1KTW A;  4UWH A;  3C98 A;  2RG8 A;  3Q7F A;  4ATG A;  3ZGQ A;  1PAQ A;  3LVR E;  3KSL A;  5EN5 D;  2NC9 A;  2L9B A;  2Y4U A;  5ENO D;  1IB4 A;  4FLB A;  3LEW A;  4XKV A;  3PUJ A;  1SZA A;  1AIR A;  4Z06 A;  2F37 A;  3B90 A;  2X6X A;  5ARG A;  4A55 A;  3LJN A;  3JYS A;  5H7P A;  4E85 A;  2V5I A;  5DIZ A;  2KCK A;  4N5C A;  4F6R D;  3BU8 A;  1IDJ A;  2F0Y A;  4J6I A;  5JMN D;  4HRN A;  1Q2Z A;  4PMH A;  1O5M A;  5LCW J;  1HE8 A;  1HS6 A;  3ULY A;  3ZEF A;  3QB2 A;  2NST A;  2XC1 A;  3VST A;  1O1R A;  4BER A;  4Q69 A;  3ZVV A;  2BX6 A;  3UM1 A;  3PE3 A;  1ZB1 A;  2PNN A;  2XHE A;  1EE6 A;  3NQP A;  4BSX A;  3CVV A;  3L54 A;  2EIK E;  4CRW A;  3BUA A;  4WNE A;  3LJY A;  4XZ4 A;  1IHB A;  2YQ8 A;  2Z8G A;  3VSV A;  3FFL A;  4N3A A;  1HFA A;  3FU3 A;  3ZRH A;  2XCB A;  1HU3 A;  3ZU7 B;  4I9E A;  3FUJ A;  5AYW D;  2LAH A;  1A5E A;  1OY3 D;  1Z3X A;  4YDW A;  5HS0 A;  1QQE A;  2X6J A;  4XI9 A;  4YCQ A;  4UUC A;  3QWV A;  4JC8 A;  4MRU A;  3NOG D;  3VLD A;  5KJN A;  4Q94 A;  3U3W A;  3SD5 A;  1YYH A;  4ABN A;  4N3B A;  2HO1 A;  4EZK A;  1U3C A;  4JRA C;  3D9P A;  3IEG A;  4EZL A;  4GMJ A;  3V30 A;  5G04 C;  2IEJ A;  1CZF A;  3C72 A;  5CMW A;  4Q96 A;  5G55 A;  2QZA A;  4UQY A;  1TN6 A;  3EJN A;  3NZS A;  1WY6 A;  3ZIM A;  3N71 A;  4HQD A;  1FT1 A;  2XRY A;  3N90 A;  3W9F A;  4GYW A;  4HLE A;  1HXI A;  3N6Z A;  2L6B A;  1H19 A;  4A3V A;  4APO A;  2AXZ A;  3U64 A;  4F7A A;  4FAD A;  2PL2 A;  1O8I A;  1SQM A;  3TG4 A;  3CIA A;  4MKT A;  3AS5 A;  4PUC A;  2HR2 A;  4PS8 A;  1XG2 A;  4L1B A;  4I6G A;  2ILR A;  3AJI A;  4PDX A;  3BH6 B;  4BX8 A;  1K4Z A;  3RKV A;  3BG0 B;  1H2V C;  3HXD A;  3C3R A;  4ILI A;  4WUY A;  2JEK A;  3IXE A;  4XLH A;  4YDE A;  4CDM A;  4PS3 A;  4UWK A;  4JHR A;  1IXV A;  2F3L A;  4FU3 A;  4J7W A;  1WG0 A;  4HFG A;  3DPY A;  2VJ8 A;  1V55 E;  3D9K A;  4U0S A;  2JLB A;  3X2Q E;  3I4G A;  3EHQ A;  3TXM A;  4MR0 A;  2WQ6 A;  3UT7 A;  1JTA A;  1KZO A;  3AG3 E;  4GTV A;  2BSP A;  1K8K G;  4APF A;  1MYO A;  1OFM A;  1OWN A;  3CK7 A;  3JXI A;  1H2U A;  3AS8 A;  4G25 A;  5LCW C;  4YND A;  2GRL A;  4H7Y A;  3CV0 A;  4HRL A;  1EF1 C;  4LNG A;  5ANL A;  4XEI G;  3CVQ A;  4UQX A;  5KJK A;  2I2O A;  3FTU A;  3TWU A;  4HRM B;  2HM8 A;  1RZ4 A;  3QNK A;  3SFZ A;  4KVM A;  3TG5 A;  3ZYM A;  3IV0 A;  1E8Y A;  1O8G A;  1OWL A;  1ELK A;  1FPP A;  3PRE A;  1TSP A;  2O1D A;  3QWW A;  2WXP A;  3TWR A;  5CHE E;  1PY1 A;  1E90 A;  2PZI A;  4U0Z A;  4GA0 A;  2NT9 A;  4IRU A;  2FUL A;  2WMO A;  3FUM A;  3V79 K;  2I1K A;  4YVQ C;  4IYP A;  1GQ8 A;  4O1O A;  1HZ4 A;  1S64 A;  1K8F A;  4A1G A;  1OGM X;  3ASG A;  4WAF A;  3Q78 A;  2I6H A;  4U7E B;  1UN9 A;  4ACL A;  1DBO A;  5EIB E;  5J90 A;  3LYA A;  5CCM A;  2RFM A;  3BH7 B;  4GZ5 A;  3CK9 A;  4I1M A;  3LY7 A;  2J8I A;  1KCC A;  2V4L A;  2XT4 A;  4W8T A;  2ION A;  4N2Q A;  2PM7 A;  3EU5 A;  3DSS A;  5KWD A;  5AQA A;  4N3C A;  5B1A E;  4URK A;  1W3B A;  4F1P A;  4CGW A;  3EHM A;  3UT4 A;  2ZIS A;  1PE9 A;  4YEI A;  2EIM E;  1QRB A;  3S7B A;  1TJC A;  3PNT B;  4KYO B;  3T5X A;  4O1P A;  1N9A A;  3G2S A;  2VSN A;  4P29 A;  2VFN A;  4G8K A;  2BED A;  4V02 C;  5AQB A;  1IKN D;  2IOS A;  3UIN C;  2VFO A;  3KS2 A;  5CED B;  3U66 A;  3D9J A;  2WXG A;  2UWJ G;  3LS8 A;  2JAB A;  2UY1 B;  2LAI A;  1TN7 A;  2CFU A;  3HXC A;  3DBS A;  1SZ9 A;  3B95 A;  4XNF A;  3HG0 D;  1QQ1 A;  3ZPJ A;  4PS7 A;  4B89 A;  2AVP A;  2CG3 A;  2PYG A;  4OVU A;  2INV A;  1WXR A;  4U8V D;  1NA0 A;  4C0M A;  1DVP A;  1XGW A;  4BWR A;  4BTB A;  3LMW A;  4BET A;  4XI0 A;  3QWP A;  2IOU G;  4FLH A;  1O88 A;  1KT0 A;  5JJ6 A;  2LO6 A;  3LJ3 A;  2O17 A;  4BT9 A;  1O8E A;  3PVL A;  5KJL A;  2X6F A;  4JA9 A;  4DLQ A;  2VFQ A;  1HH8 A;  3BQO A;  3PZ1 A;  4B93 B;  2X38 A;  1H6O A;  2H6I A;  2IU1 A;  4MXN A;  4U04 A;  3SUC A;  2XGO A;  5G05 J;  3UI2 A;  3PUK A;  2I9C A;  4XM3 A;  2XTX A;  3HIZ A;  1TR4 A;  1E96 B;  3LY9 A;  2WXH A;  3IHV A;  4I1A A;  4XL9 A;  1N11 A;  3ASF A;  5AJD A;  4LCT A;  5CCL A;  4UI9 K;  2ODL A;  4MLP A;  2L0T B;  3D9I A;  3ZNG A;  5KNG A;  4I2Z A;  2ZU6 B;  5CEC B;  2P9S G;  5CRV A;  4R7L A;  3CVX A;  4YZX A;  2QC9 A;  2ZGG A;  2HE0 A;  1QRC A;  4YZA A;  4G8L A;  1OUV A;  1QBQ A;  2MYO A;  5FQ7 A;  1VDY A;  2B0R A;  5EDS A;  1EA0 A;  1Y6I A;  1KLX A;  3JUE A;  5EID A;  1WM5 A;  4KT6 B;  3MYV A;  3G2W A;  3T5V A;  1S70 B;  2YNQ A;  3FDH A;  2BF0 X;  1E8W A;  4EQF A;  1BN8 A;  1WDY A;  3TGO A;  4NQ0 A;  5G04 J;  1O8J A;  1JUQ A;  2KZT B;  2XEV A;  1E7V A;  4GTP A;  4U8Y D;  5BV1 A;  1H0A A;  1N94 A;  2INU A;  2R03 A;  3V2O A;  2OVF A;  4XIF A;  1DNP A;  3B7U X;  1S63 A;  4NIK A;  1UW4 B;  4OJL A;  4B94 A;  4LG6 A;  2J08 A;  1JRG A;  3ENE A;  3TWT A;  4U07 A;  3FEY A;  1DCE A;  2VGX B;  1SA4 A;  4DPR A;  4YC5 A;  5EIL A;  1FVF A;  4HOS A;  5FQ8 A;  4L7T A;  3VSU A;  4JEU A;  1IA5 A;  1TN8 A;  4UQZ A;  2C0L A;  3R7Q A;  1H6K A;  2X6H A;  2FEZ A;  1YCS B;  3OXL A;  1KZP A;  3CVU A;  2QY1 A;  5LOZ A;  2VYI A;  4XLE A;  2XGM A;  4ANX A;  2DWZ A;  3CVP A;  1EDU A;  2CHW A;  4G11 A;  5KJM A;  4AP2 A;  3SBT B;  3IBE A;  1JCQ A;  1OOC A;  2VFP A;  3AG1 E;  3CHR A;  2H6H A;  1OWP A;  2WPV A;  5EX3 A;  4XMY A;  4HI9 A;  4DJA A;  2IJG X;  1SA5 A;  3CST A;  1JCS A;  5G05 C;  3KEA A;  1D8E A;  4YZQ A;  1JCR A;  3PZ3 A;  3FU6 A;  3ASN E;  3GYZ A;  1TYX A;  1HO8 A;  3FUF A;  2RFA A;  4J0U A;  3FY4 A;  3KRG A;  4GZD A;  2F8Y A;  2EQX A;  3FTX A;  4XOP A;  2FO7 A;  3APF A;  4HXI A;  1MX4 A;  1MZC A;  3TWV A;  4XQF A;  4Z03 A;  5BXO A;  2DYR E;  4DRX E;  2VSO E;  3U4T A;  4GZ6 A;  5T3R A;  2Q7F A;  4F3V A;  3Q7A A;  2XRZ A;  1HG5 A;  4GCN A;  2E0I A;  3E33 A;  4A3T A;  2UY1 A;  1X5B A;  3ASD A;  5D2M C;  2J09 A;  4J8S A;  1P5Q A;  4CEM A;  3H09 A;  2MHK A;  4K0R A;  1DC2 A;  2AW6 A;  4HOQ A;  1TYW A;  3APD A;  1LM1 A;  1KCD A;  2XPY A;  3Q79 A;  3ML8 A;  3LXU X;  2DZN A;  2P2C P;  3ESL A;  2J4B A;  3LDZ A;  3RJV A;  5A23 A;  4YFO A;  2Y3A A;  2BKK B;  4GPM A;  3R9A B;  3UKR G;  2BUG A;  3PS6 A;  4O60 A;  2BM7 A;  3OAW A;  4GYY A;  2P9K G;  3FUE A;  2KBX A;  4I17 A;  4RSY A;  4G23 A;  3FEX A;  2WXJ A;  3FUH A;  1LLZ A;  4RLY A;  4KMO A;  3SI5 A;  2WVI A;  1E8Z A;  4YDT A;  2F8X K;  4ILG A;  3DSV A;  2OCC E;  3L13 A;  4YEJ A;  2XEE A;  4CT4 A;  2VQ2 A;  2O04 A;  3D9N A;  3BEE A;  5EYP F;  5AJL A;  5FZQ A;  3MGB A;  2YHC A;  3CKC A;  5AEN A;  4JVS A;  2W7Z A;  3EIQ C;  4CZ2 D;  3PDN A;  1TEZ A;  3LY8 A;  3ZXP A;  1D8D A;  1HF8 A;  1MHQ A;  3RO3 A;  4HOR A;  2M63 A;  1N4R A;  2XEN A;  4HS2 A;  4QFV A;  4NK6 A;  5FIO A;  4U96 D;  4BEP A;  5M72 A;  4RG9 A;  2GRN B;  2NXP A;  3UPV A;  1FVH A;  3BG1 B;  4OJP A;  4EBA A;  1QYM A;  3ML9 A;  1AP7 A;  5ENR D;  5FT9 A;  2NTB A;  1B89 A;  2IO3 C;  4MS6 A;  2R05 A;  1DAB A;  3APC A;  2C2L A;  3R7R A;  4GTT A;  2EWE A;  5AQ7 A;  3FU5 A;  2BKG A;  2NSP A;  5LFA A;  2X85 A;  1JWG A;  3Q4A B;  2DVW A;  5HRY A;  3RSE G;  3ABL E;  2OVB A;  4GYO A;  3MKQ B;  3JUR A;  4ANU A;  2BM5 A;  4ZHB A;  4K5B A;  1K1B A;  2V5Q C;  4AOF A;  3ZHE B;  2ZXW E;  2UVE A;  4ILH B;  5A7D B;  2KZT A;  3L9T A;  4EPZ A;  2WXN A;  4AM9 A;  4EW9 A;  1NHC A;  3L82 A;  1JPL A;  4F1S A;  1K3Z D;  4H7X A;  4JZY A;  1IQU A;  5CEA A;  5JA4 D;  1EPU A;  3D9M A;  5HI7 A;  4GML A;  3TL5 A;  5BXU A;  1KPS B;  3MV2 B;  3FWV A;  2BM6 A;  3CKB A;  5KCM A;  4OAU C;  4I1O B;  5CBN A;  2OEW A;  5E76 A;  1HG2 A;  3PZ2 A;  5DBK A;  3JQ0 A;  3B13 A;  1IQR A;  4UWL A;  2R02 A;  2VGX A;  2WXI A;  2ETB A;  2WXQ A;  2AJA A;  2WXO A;  1YA0 A;  3IHY A;  5LX8 A;  5T4Y A;  5D0Q D;  2H6F A;  3I5P A;  3P1U A;  4C2L A;  2FF4 A;  3ESK A;  2XTY A;  3VLF A;  1OWO A;  5AIJ A;  3ASH A;  2EIN E;  3ZUV B;  3ZFW A;  1X81 A;  4BT8 A;  3VLE A;  3FH7 A;  5B3S E;  2P58 C;  5JJ7 A;  2IQC A;  3ASO E;  2A5E A;  4U4B A;  3FTS A;  3DST A;  4I9C A;  3D9H A;  1UG3 A;  2QXZ A;  1QNF A;  3P2B A;  1TNB A;  3NAW A;  3E4B A;  4WWN A;  2CHZ A;  4JB8 P;  3GQA A;  3QC1 A;  4IUL A;  5G2N A;  1OFD A;  4JHK A;  1TYQ G;  2P9U G;  2GRO B;  3SFX A;  2VJI A;  2XPZ A;  2IOL A;  4CT0 A;  1SW6 A;  5EKQ D;  4CCA A;  2V8S E;  3AS4 A;  3ZYL A;  3DSW A;  2X3H A;  5ENQ D;  2FBN A;  3W9G A;  3QKY A;  4PH4 B;  2NTQ A;  3UUX A;  4YZ0 A;  1OCO E;  3SNX A;  3FUK A;  2WXK A;  4TXP A;  2PQR A;  1TJF A;  4W8S A;  1TNZ A;  1TNU A;  4YDO A;  4XON A;  1FCH A;  3CSF A;  4M7C A;  4TUU A;  2NSZ A;  1Z6T A;  4RVB A;  1RWR A;  1KT1 A;  1FT2 A;  4GMR A;  4XR6 A;  3FUD A;  2BTD A;  3CGH A;  4JEH A;  2KM4 A;  3FTV A;  3U9W A;  3CVY A;  4C48 B;  3EUV A;  3MZL B;  2DCP A;  2CFZ A;  3T8M A;  3S7J A;  1OCC E;  3NOC D;  5E75 A;  5JHA A;  3S7D A;  3ABK E;  4JHJ A;  4XKB A;  1WAO 1;  2PEC A;  5IY5 E;  3JX8 A;  4U0U A;  1HX8 A;  1ZBP A;  3HXF A;  1UJJ A;  3FUI A;  4GZ3 A;  4K5C A;  3DXM G;  2XT2 A;  4GTO A;  3SGH A;  2QX3 A;  3SQV A;  1N95 A;  2MOW A;  3FY3 A;  4DX1 A;  1U2V G;  3C3O A;  3CK8 A;  3K9I A;  4G24 A;  4B8C B;  4GA1 A;  3EIJ A;  5FZS A;  2WXM A;  2V0P A;  4BFR A;  3LKU A;  1BU9 A;  3G2T A;  3OXG A;  3RAU A;  4UWF A;  3PH0 C;  3CVW A;  4TXR A;  4OJO A;  3PNL B;  1NZN A;  4KBQ A;  3GQ7 A;  3PEV B;  3ULQ A;  1BPO A;  3ZN3 A;  4KZ0 A;  3ZYK A;  4DLO A;  3L16 A;  5HQ8 A;  2VBE A;  3PEU B;  3KSQ A;  2Y0B G;  4GU5 A;  3DPD A;  3HXE A;  3CHM A;  2X3M A;  4GTR A;  3E37 A;  3MCX A;  2V5F A;  1V54 E;  3V31 A;  2QYU A;  3RO2 A;  3SZE A;  3QJZ A;  4D10 C;  1U3D A;  3TXN A;  5D0O D;  4HOT A;  2OV8 A;  2ETC A;  3FU0 A;  5EYL A;  3HRA A;  1DBG A;  2L6J A;  2KC7 A;  3EU9 A;  2YIN A;  4LER A;  3MX3 A;  5ENP D;  5CMY A;  3AAA C;  1WMR A;  4G1T A;  3B8Y A;  2FI7 A;  3LPZ A;  4CDR A;  5ANR A;  3UQ3 A;  5AQ9 A;  3PSZ A;  2QY7 A;  3I4R B;  1BLX B;  2XZT G;  4BY6 A;  4I43 A;  4E6H A;  4XX5 A;  4BX9 A;  3LVQ E;  1S0P A;  4G2V A;  1MQS A;  1PXZ A;  1GW6 A;  4DX7 D;  1IYG A;  1LD8 A;  4GZC A;  3Q5M A;  2ETA A;  4U49 A;  3ZHE A;  4M3O A;  2V4H C;  3QAR A;  4UI9 J;  2NT6 A;  1UN8 A;  4ACK A;  3JUI A;  2P9L G;  3UM0 A;  3KAE A;  4WWP A;  3WG7 E;  4W8R A;  2J8K A;  4W9R A;  1OGO X;  5BW8 C;  4OVV A;  4U8H A;  5D66 A;  4X8Q A;  4FJZ A;  1N0Q A;  3CVL A;  1H6P A;  3JCK C;  4HLL A;  4J8Y A;  4AY6 A;  4DK5 A;  2J4D A;  4XKC A;  2NYJ A;  4QQI A;  3F6Q A;  4ME2 A;  1N0R A;  2KCV A;  2XCC A;  3SF4 A;  3R9M A;  4HVB A;  2CG2 A;  1LTX A;  3Q9U C;  3PE4 A;  2XZD G;  3MV3 B;  5FQ4 A;  4KXK B;  3PZ4 A;  4I6J A;  1QCX A;  3LYC A;  3Q9N C;  2XS1 A;  4FHK A;  3L17 A;  3FP3 A;  1O8M A;  3IKO B;  4V3I A;  3Q75 A;  3AG2 E;  2XPI A;  2NTP A;  3SBS A;  4C0E A;  1LLW A;  3ONK A;  2X6K A;  3B7B A;  2OND A;  1O8D A;  2X6I A;  2PM6 A;  4KVO A;  4J8D A;  4IN3 B;  1ELR A;  2YUH A;  4HWV A;  5B1B E;  1QA1 A;  1PC2 A;  1CLW A;  2LXM A;  4ANV A;  2RKK A;  4U95 D;  3CLJ A;  2AWI A;  2VSY A;  2VTB B;  2WXR A;  5JJT A;  2IY0 C;  1OCR E;  1NP7 A;  3SYJ A;  2R59 A;  4GAA A;  2IQ7 A;  1N54 A;  3RIB A;  5ENS D;  3UMV A;  4FC8 A;  3NZU A;  5ARF A;  3UM2 A;  1BHE A;  2C0M A;  3CVN A;  5BNW A;  5CER B;  3HVE B;  3AG4 E;  1K5C A;  5BUZ A;  4JD2 G;  2IO2 C;  3QK0 A;  4L2L A;  4N39 A;  3RRN B;  1NFI E;  4G26 A;  1TNO A;  4WND A;  1INZ A;  3WWG A;  3DRA A;  2R17 C;  5AAR A;  3TH0 A;  3KEZ A;  2H6G A;  1BI7 B;  1NA3 A;  4DX5 D;  3MKR A;  4F53 A;  3PRZ A;  4ANW A;  3TAX A;  5BT1 A;  3UM3 A;  2VJJ A;  3EQN A;  4HNA D;  3SZ7 A;  2A5U A;  3UXG A;  4UI9 C;  4AXH A;  1O1T A;  3GZ2 A;  2UVF A;  2IF4 A;  4YDY A;  4XOT A;  4XOR A;  4FP7 A;  4I84 A;  5AMV A;  1MX6 A;  3HDX A;  5C1D A;  2J9Q A;  5BV0 A;  3EDT B;  1NI1 A;  3HHM A;  2VGY A;  3FUL A;  4LEU A;  4XN0 A;  5FQ6 A;  5CRU A;  5DNS A;  4N5Q A;  4EEC A;  4FUL A;  3J5P A;  4NAC A;  4GB9 A;  3GZS A;  2XQ0 A;  5FIN A;  2DZO A;  4HI8 A;  3FTY A;  3DXK G;  1YMP A;  4XKW A;  3ISM C;  4XE0 A;  4K5A B;  4N2S A;  2DIW A;  4Z05 A;  5J08 A;  2O6W A;  4L23 A;  2EIL E;  4NRH B;  1OFE A;  2O0V A;  1O1S A;  2WQ7 A;  3CQG B;  1SVX A;  4HB5 A;  3CQC B;  3E30 A;  5FTP A;  4GTM A;  3PET A;  2VBK A;  3Q15 A;  5C1E A;  4Y6W A;  2P9N G;  3TWX A;  1OFL A;  3VTX A;  1X0C A;  1O8L A;  2J8S D;  3MA5 A;  4NK8 A;  4XLC A;  1NL4 A;  3AU4 A;  3SO8 A;  2R5S A;  3V2X A;  2LSV A;  4LNU D;  3C5R A;  3AK5 A;  2OEV A;  4DI4 A;  3FUN A;  3TJP A;  3RU0 A;  2ZGD A;  3ZKJ A;  3DSX A;  5JHB A;  5JLV C;  5C2Y A;  3T9K A;  2E2E A;  1IDK A;  2A4Z A;  3AU5 A;  3D9O A;  1KQ5 A;  3D3M A;  1TYV A;  4A1S A;  4HOU A;  1H2T C;  3B7T A;  4OJ5 A;  4XN3 A;  4DX6 D;  4KZC A;  1D9S A;  1IHG A;  4CDN A;  4BSZ B;  3NBN B;  4RQI A;  2DBA A;  3EHN A;  3DEP A;  2CHX A;  2KAT A;  1BI8 B;  2MRI A;  3UKU G;  3UIO C;  3T9G A;  4BTA A;  1Z5S C;  1OWM A;  2P9P G;  3E32 A;  4I2W A;  3O4Z A;  4JW1 A;  2XEH A;  3DWL G;  3ZW3 A;  4O6F A;  2B6C A;  2X6W A;  4Y6C A;  4J8F A;  2I1J A;  1E7U A;  3L22 A;  3LCA A;  2GRP B;  3NF1 A;  5C1C A;  2GW1 A;  2GGF A;  3GQ8 A;  1N4P A;  3O48 A;  4AVX A;  3B4N A;  3P4G A;  2WB2 A;  3G2U A;  5AN8 A;  3ZYQ A;  4LRZ A;  4B0Z A;  4BES A;  4AEZ C;  3G2V A;  1G3N B;  4CGV A;  3JQ1 A;  3D9L A;  1E8X A;  2VFM A;  4OPW A;  2PQN A;  1AWC B;  2B0O E;  2QFC A;  3EQO A;  3NB2 A;  2VSX E;  3GZ1 A;  4C9B B;  4TV3 A;  4AVZ A;  1QJV A;  3CEQ A;  2GRM A;  3RRU A;  4OYS A;  1XNF A;  2R2L A;  4NUR A;  3UIP C;  3PSS A;  1QZ2 A;  3QAQ A;  2KXP C;  4DX2 A;  4YVO A;  1MJ0 A;  1EYH A;  1N52 A;  3FHE A;  1VBL A;  2J49 A;  1H80 A;  4JXT A;  5EX0 A;  3L08 A;  4GTS A;  2EIJ E;  1EZG A;  3L6A A;  4ATZ D;  4L2Y A;  2KCL A;  2XGS A;  5A6C A;  3HXB A;  4AV7 A;  3OXF A;  5AAO A;  2VTB A;  2LSU A;  3GQ9 A;  2HYZ A;  4W8Q A;  3B7S A;  3FTW A;  4OZY A;  2XTW A;  5KNH D;  1OCZ E;  3CHS A;  4HBD A;  3RIQ A;  3CHP A;  4XLA A;  3TWW A;  4OM9 A;  1Y8M A;  4JPS A;  4TXQ A;  3T8K A;  3E34 A;  2VGE A;  3OTN A;  2Y4T A;  5HKP A;  4DUI A;  3FH5 A;  1UOH A;  2LNI A;  2XS8 A;  4FJY A;  4TUM A;  5FWQ A;  4EHM A;  4GTQ A;  2WXL A;  3CHO A;  4DI3 A;  2GRQ B;  3ONL A;  2ZIR A;  2QYJ A;  1ZU2 A;  5BPP A;  1RW2 A;  4RG6 A;  1QA2 A;  4AY5 A;  3HVE A;  3TWS A;  3DEO A; 
#chains in the Genus database with same CATH homology
 2XT2 A;  4YCQ A;  3SY2 A;  2QYU A;  2QZA A;  3PSS A;  3SQV A;  2XTX A;  3NAW A;  2XTY A;  2O6W A;  5DNS A;  4YEI A;  2XTW A;  3PSZ A;  2XT4 A;  3NB2 A;  4YC5 A;  3DU1 X;  4YDT A;  4YFO A;  2J8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...