3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords secreted effector protein
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
2XTWA 4YDTA 2XT2A 2QZAA 3NAWA 4YCQA 3PSSA 2XTXA 4YEIA 3NB2A 3PSZA 4YC5A 2XTYA 2XT4A 3SQVA 2QYUA 3SY2A 2O6WA 4YFOA 5DNSA 2J8KA 3DU1X
chains in the Genus database with same CATH superfamily
2C0MA 1VDYA 3DSXA 3B8YA 2Z8GA 4IULA 2IO2C 4XONA 3VMWA 2GGFA 2LXLA 3MX3A 2LNIA 1U3CA 1NFIE 4M7CA 2QXZA 4CRWA 3UKRG 1O8HA 3NZSA 4YFOA 2VGXA 3PRZA 1INZA 1EZGA 4C0EA 3DWLG 3ABLE 3FH7A 5C1DA 1TSPA 1DBOA 4JEHA 4U7EB 5FWQA 2VSYA 3UINC 2XCCA 2CHZA 4GA0A 4V02C 4JXTA 2GRPB 2VJJA 3U9WA 1SW6A 2PM7A 4NIKA 3ABME 3ZYMA 1KT0A 2V5QC 3IBEA 3SD5A 4OVVA 3DRAA 3GRHA 1H2UA 2WMNA 4CT4A 2EIME 5JJ7A 1O8KA 4WWNA 3ULYA 4XZ4A 3WXXA 3ZYKA 1N0RA 4ABNA 4XN3A 3FTYA 3PNTB 2GRQB 4UI9C 4LNGA 3P4GA 1TNBA 3I3NA 3FUIA 4DUIA 1DCQA 2DBAA 2VTBB 1YCSB 3CVQA 1UW4B 3PSSA 4XKWA 2DYSE 1VBLA 3IHYA 2KZTB 4Q94A 3EQOA 3AG2E 1OCCE 3ML3A 1HG2A 2FBNA 3Q49B 5D66A 3HXCA 1PXZA 5JMND 1JRGA 3VSTA 2XTXA 5ENPD 1HF8A 1UG3A 3RAUA 3D9JA 1DABA 3E32A 3JXJA 1FVHA 2PYHA 3MCXA 4K0RA 3R9AB 4YZQA 1JCQA 3IHVA 4DX7D 4RLYA 1NP7A 4ILIA 1NZNA 2UVFA 2KCVA 3OXLA 4I6EA 4G25A 3IV0A 2WXHA 5C1EA 4F3VA 2BM7A 2WXFA 2H6IA 5HKPA 3AK5A 4LRZA 4JD2G 3U4TA 2IY0C 5AQAA 1H80A 3ASNE 5FIOA 4AVXA 4KZ0A 4BWRA 2ZXWE 3CK9A 1OFLA 1DNPA 2VBEA 4NK6A 4XL9A 2B6CA 5KBAA 2CG3A 1SZ9A 2BTDA 4OM9A 3K9IA 1WG0A 3SYJA 1HU3A 4YDYA 3O48A 3B7UX 5KJNA 1PLUA 4GCOA 3NOCD 1BU9A 1WMRA 4WNEA 4FJZA 2O1DA 4N5QA 3Q4AB 1KZPA 2P9PG 3JXIA 3FY4A 2QC9A 1PE9A 2XZDG 4UQYA 4PS8A 2UWJG 2VTBA 1Z3XA 3FUNA 4FC8A 4AXHA 1TYQG 3NZUA 2VGXB 3T8KA 3KD7A 2HR2A 2WXQA 2QYJA 2Y69E 1MJ0A 1EDUA 3OXGA 2VSXE 3MV3B 1ELKA 5AJDA 4RG9A 2YNQA 4Q96A 1SZAA 1S70B 2WQ7A 3TXMA 4BETA 3SFXA 2O6WA 3ML8A 1JPLA 3O4ZA 2NSZA 5J08A 2WB2A 4HI9A 1V54E 3TG5A 5CBOA 1H6OA 3Q9NC 3QWPA 1E8ZA 3L13A 1AP7A 3CHSA 3FU3A 4JHKA 1KZOA 3VTYA 2WMOA 2KM4A 4W9RA 3D9HA 4ZFHA 3CLJA 4YZAA 1K1BA 3KEAA 1D8DA 3KEZA 3RKVA 5KJKA 4R7LA 3ESKA 3P1UA 3FTVA 4YVQC 2J4BA 1DBGA 3ABKE 4UWHA 2NZMA 1YA0A 3JQ0A 3UT7A 3CHRA 1OCRE 5G55A 4GTOA 4U49A 4GCNA 2IOLA 3Q78A 2DZOA 4J8DA 2LAIA 4JHJA 5AN8A 3JURA 1P5QA 2R17C 2ZU6B 1N95A 4KMOA 5H7PA 2NSTA 4G23A 4EBAG 4TXRA 4BX9A 5FJYA 5AQ9A 4MLPA 3KS2A 1HG5A 4DI4A 5HQ8A 2L0TB 1DVPA 2E0IA 4IN3B 3B7SA 3CV0A 4U63A 2UY1A 4HLEA 4HORA 3LY9A 4YDWA 4X8QA 4URKA 1PAQA 3TL5A 4OJ6A 3MEKA 1CLWA 1TN7A 3HHMA 2DWZA 2WXPA 4MRUA 2H6GA 4GTVA 2RFMA 2VBKA 2X6YA 1E8WA 1E7UA 1GQ8A 3LPZA 4XOPA 4Z03A 4XKCA 5CHEE 1N11A 4G2VA 1OOCA 2V4HC 2VFOA 1KT1A 1D8EA 4L2YA 5AAOA 2Y1LE 3EU9A 3ZPPA 4KT6B 4I2WA 2XGOA 4I84A 5G04J 4FU3A 4RG6A 4F7AA 1MX4A 4J6IA 4E6HA 1N52A 2KZTA 2LSVA 2X6KA 2J8SD 4UWKA 2NTPA 1N4QA 4EPZA 2J4DA 4Z06A 1TJFA 2EWEA 3MKRA 5AQ7A 3EU5A 3PEUB 1IDJA 4M3OA 1JTAA 3TWQA 2VGYA 3CVLA 1TR4A 3SFYA 1EPUA 2ZIRA 5EYPF 4AY6A 5BUZA 3UMVA 2J9QA 3DSSA 4L2LA 3TG4A 4DLOA 3CK8A 4A1SA 3U66A 3P2BA 2ETCA 2HM8A 4LEUA 5LCWC 2P9LG 3UM3A 2FI7A 3ZYQA 4FJYA 3HXDA 4ANVA 2QYUA 4N3AA 3Q5MA 3KAEA 4O6FA 2UY1B 2ETBA 2XQ0A 3SGHA 4BSZB 1O8IA 2CFZA 2XPYA 4Z05A 3E30A 4A3TA 1WY6A 2BSPA 4DPRA 3SZEA 2F0YA 2PQRA 1JWGA 2EQXA 1DCEA 2R2LA 5CRVA 3S2AA 4XR6A 3BEEA 4CCAA 4DRXE 1QQ1A 3S7DA 4IRUA 4I9CA 2H6HA 4TV3A 4OJ5A 4BSXA 2BM6A 2VFMA 1O8LA 2EINE 3UIOC 1G3NB 3CHOA 4JRAC 1OGOX 5FINA 3T8MA 4ATGA 3EIJA 3SUCA 3I4RB 2XT4A 3MKQB 4WNDA 4GZ3A 3GZ1A 3LJNA 1HE8A 2BM5A 1HXIA 1JCRA 3CHPA 1NL4A 3FU0A 4EBAA 4Z68A 4BFRA 3WWGA 1KPSB 4H7YA 3PH0C 3SO8A 2L6BA 4KVMA 3ASOE 1LD7A 2NTBA 4PMHA 2WPVA 4XQFA 2NC9A 4GTMA 3RRUA 3CHMA 3FUFA 1HH8A 3ENEA 4CT0A 4HWVA 5G04C 3L9TA 4OAVB 3TGOA 3C5RA 4G26A 1OY3D 4G11A 1MHQA 4OJOA 3CSFA 3ZUVB 5CECB 4YZXA 3FULA 3HDXA 2IO3C 3BU8A 1O1SA 3CVYA 3LXUX 4L23A 3TXNA 2IOSA 1A5EA 2INVA 1OFMA 3LJ3A 3Q9UC 2F8XK 4HXIA 3DSUA 5ENNA 4YDOA 2HE0A 4HRMB 2GRMA 5EYLA 3SF4A 1E7VA 3RIBA 5JMCB 4WUYA 2VSNA 3BH6B 2XEVA 1TYUA 3ULQA 2XS8A 1N9AA 3LY8A 1IDKA 3B7RL 1BLXB 4KVOA 3BUAA 3CVVA 2LUHA 2ILRA 1ZU2A 2H6FA 4U0UA 2WXJA 1L5JA 3TWSA 3FTWA 3HXFA 3ONKA 4XEIG 3B13A 3FFLA 2WXMA 2LSUA 4GA1A 4U8YD 2PM6A 3PNLB 5ANLA 5B1AE 5LP0A 3DU1X 5AMVA 5FQ4A 4I6JA 3TJPA 4I43A 2W7ZA 3PUJA 1OWNA 1QBQA 4YZ0A 1O1TA 1TNUA 5BV0A 3Q75A 3QWWA 3V30A 3TWRA 4U8VD 4HOTA 3RK6A 1Y6IA 2XRZA 2X3HA 3N90A 2OCCE 4MXNA 2P9SG 1LLWA 4WWOA 5AJLA 4BY6A 3LY7A 3L82A 3FU6A 3EQNA 1MYOA 2YINA 2YUHA 1TJCA 4ILGA 2BM4A 2XEEA 1UOHA 1MZCA 2WXRA 3EUVA 3URZA 4CGVA 1IKND 4UWLA 1QRCA 2HYZA 1O8JA 1FPPA 2L9BA 5EDSA 5AYWD 1O5MA 3LS8A 3Q47B 1WM5A 5A23A 2M63A 5KNHD 3ZXSA 4EZKA 3Q7AA 5EX0A 3ZPJA 1EA0A 4U0ZA 1AIRA 3VSUA 3EHNA 3KRGA 4CEMA 2VFPA 3NBNB 4XI0A 5C2YA 3RSEG 3FUKA 2GW1A 2L6JA 4I2ZA 3T5XA 3IEGA 1UJKA 1Z3YA 1XNFA 2NSPA 2IJGX 4GTQA 1SQMA 5KJMA 3DSWA 2XTWA 2HO1A 3C3RA 4U4BA 1SA4A 4GZCA 4GYYA 2WXLA 4K5BA 3ZXPA 4XLFA 2CHWA 2I6HA 5E76A 3PETA 3U3WA 1QJVA 4MR0A 3TAXA 5LOZA 4ILHB 4HRNA 4DX1A 2LAHA 3ZHEA 5BNWA 2PL2A 5ENRD 5CMWA 1ELWA 4O1OA 3Q7FA 4W8QA 1KTWA 2VYIA 4LUNU 1TYWA 2FF4A 1S64A 2V5FA 5EILA 1N4PA 2PYGA 2IOUG 2GROB 2NT6A 1MQSA 1RMGA 3CQGB 1QA2A 4C48B 2P9KG 1Z6TA 3RRNB 2KCLA 2LXMA 3MA5A 1DC2A 3FUMA 4XKVA 3UM2A 3D9PA 2G0YA 1K5CA 1HX8A 4L7TA 3D9KA 3R7QA 3L16A 4NRHB 3UT8A 4NK8A 4U8HA 5KWDA 2JEKA 3AS5A 2OEWA 1BN8A 3PZ1A 1N0QA 4UUCA 4YVOA 2PNNA 3ISMC 2GRRB 4PH4B 1H2VC 3ULEG 2JABA 1IHGA 4L1BA 4JVSA 5CEAA 3QB2A 3LVQE 2IF4A 3C98A 4JA7A 2CFUA 5HS0A 1RW2A 4TXPA 3SY2A 3NF1A 4AY5A 4BESA 2AXVA 3RU0A 2O0WA 3PZ3A 3AG4E 2XGSA 5G05J 2A5EA 1HG8A 3FDHA 3SZ7A 1MX2A 3N6ZA 4K5CA 4BERA 5CERB 3AAAC 4NACA 3UM1A 4BEPA 5IY5E 2EIKE 3D3MA 5KNGA 1W3BA 3V79K 1WDYA 2VJ8A 3CK7A 4CDMA 4OAUC 4HOQA 4AEZC 5KCMA 4XN0A 4J8YA 3QDNA 1PC2A 1BPOA 1HO8A 3RO2A 4HBDA 2WXKA 4WWPA 3ZIMA 4EW9A 3FTUA 4NQ0A 1E8YA 5LFAA 3EHQA 4DK5A 5AENA 3AJIA 3CVWA 1WXRA 1XGWA 2I2OA 2AW6A 1TEZA 3FH8A 3OAWA 2XZTG 3L6AA 1H6PA 3HYMB 3AS4A 1E96B 3DXMG 3FTSA 1LLZA 2PZIA 2XGMA 4WNGA 4W8SA 1QCXA 4DX2A 1QYMA 4KXKB 4GZ6A 3J5QB 3QOUA 2BX6A 1KQ5A 2KBXA 4GMLA 2ZGGA 4ANXA 3D9IA 2QY1A 4UQZA 2NXPA 3V2OA 2I1KA 2VFQA 4P29A 1CZFA 3TH0A 2A5UA 3VLFA 3U64A 3NB2A 3V2XA 1FT1A 4C9BB 1ZBPA 5EX3A 4U0SA 4WNFA 2XPIA 2OVFA 3ZN3A 4B94A 2BUGA 2Y4TA 5B3SE 2F8YA 1S63A 1OWPA 4HQDA 4N2QA 1NA0A 4W8RA 2EILE 1OXJA 3OXFA 4F1SA 3LYCA 3FU5A 3L54A 4JW1A 3CSTA 1N54A 1IQRA 3R7RA 3T9KA 3QNKA 4B8CB 1RU4A 4B93B 2IONA 3FP3A 3TWWA 1BI7B 4YDEA 2DCPA 1O8DA 1ZB1A 3ONLA 3CR3A 3GQ7A 5JHBA 3VLDA 1LF8A 5D0OD 4JL0A 3UPVA 1EE6A 2VFNA 2UVEA 4BTAA 2ETAA 2A4ZA 3G2VA 1O1RA 4K03A 4XLAA 3ML9A 4Q69A 3QARA 3JUIA 5ENSD 1QRBA 1V55E 1HS6A 3E33A 1Z5SC 3PE3A 4O1PA 2F37A 2X6XA 4OJPA 3B4NA 2I1JA 4J7WA 2KXPC 3QWVA 2V4LA 2OV8A 2AXUA 1OCZE 4I1MA 3PEVB 2XEHA 5E75A 3ASFA 3BH7B 3PZ4A 5FTPA 3VSVA 4UWGA 2NYJA 3FUEA 2XENA 2WQ6A 2J09A 3SBTB 2WXNA 3FUHA 2WVIA 2NTQA 2XC1A 4CZ2D 2DVWA 1IQUA 1X81A 2X6IA 4H7XA 2X3MA 3C3OA 4HOSA 2VQ2A 3SQVA 4ACKA 4BT9A 5JJTA 4GTSA 1O8GA 2J8KA 4PS7A 2WXOA 4OZYA 3QC1A 1BD8A 4I1OB 3WG7E 2J08A 4JC8A 4PDXA 1D9SA 2FEZA 4I17A 3FEYA 4HOUA 3CKCA 3ESLA 1OWMA 4N3CA 3B95A 4C2LA 5D0QD 2KCKA 1TN8A 5D2MC 4NURA 1IB4A 1RZ4A 1TYXA 2ONDA 5G2NA 5DBKA 3UUXA 4HB5A 3Q73A 5EN5D 4MBGA 1JUQA 3MGBA 2O0VA 2GRLA 4GA2A 4U96D 2O17A 2FO7A 4A63B 5ANRA 4QFVA 1N4RA 2AJAA 3PZDA 3FTZA 3RO3A 3S7JA 4F6RD 2IQCA 3ZRHA 4ME2A 3SHFA 1TNYA 4AVZA 3LMWA 5FQ6A 2X6JA 3ZU7B 4J0UA 5B1BE 3ZFWA 3ASHA 5KJLA 5A7DB 2AVPA 4TXQA 5BPPA 3SBSA 4DX6D 1E90A 5BT1A 4I1AA 3NQPA 4GTPA 4ZHBA 4GB9A 2R5SA 5BW8C 3DEPA 1OFDA 4XLEA 4I6GA 3V31A 3EJNA 4GZDA 3CHQA 2X6FA 5JJ6A 5JA4D 4F1PA 1SVXA 1H19A 4F53A 4YELA 2O04A 1H6KA 2X38A 1JCSA 2RKKA 2QZAA 1QA3A 3ASDA 3FUDA 1TNZA 2Q7FA 3UXGA 5DIZA 3W9GA 5ENOD 3CVNA 4A1GA 5EIDA 4AM9A 1QZ2A 5FT9A 4IYPA 1X5BA 3N71A 4OYSA 3UT4A 2OOEA 5JHAA 1K4ZA 3HVEB 2PQNA 1OFEA 1NA3A 2AWIA 3B7TA 2V5IA 3MV2B 3ZEFA 5BXUA 4E85A 2X6HA 3ZVVA 1HF2A 1H2TC 4G1TA 2DIWA 4HI8A 4DLQA 3RIQA 4FHJA 4MS6A 3MZLB 4QQIA 2BKGA 1OWLA 3D9OA 4AOFA 4C0MA 1X0CA 3ZSCA 4JZYA 5FQ8A 2INUA 4LSZE 3G2TA 3I5PA 1MX6A 3DSTA 2X85A 3FUJA 4PS3A 1FVFA 1NI1A 2J49A 2P9NG 1IYGA 3E37A 1L1IA 3HRAA 2B0OE 3LVRE 3LDZA 3T9GA 4XLCA 3CGHA 4N39A 4N3BA 1KCCA 1O8MA 3CVPA 3G2SA 3TWXA 3PZ2A 4TRQA 2BKKB 2X6WA 3W9FA 2EIJE 2PECA 5AQBA 1AWCB 1ELRA 2MYOA 3J5PA 3GYZA 5ARFA 1UJJA 3B90A 4U95D 3CKBA 3PUKA 3EHMA 3EHRA 4GZ5A 1OGMX 1TYVA 1H0AA 4HFGA 1OWOA 2J8IA 3Q15A 2OEVA 3S7FA 3E4BA 4N2SA 4U07A 3AG1E 2R59A 3GQ8A 4D10C 5HRYA 4YEIA 4I9EA 1OCOE 1Y8MA 1IXVA 1Q2ZA 1UN8A 3MJWA 3FHEA 4RSYA 3QK0A 3LYAA 1OUVA 4EHMA 4K5AB 5CRUA 4FA6A 4W8TA 1QNFA 1S0PA 1OT8A 3TWUA 4PUCA 3NOGD 1N94A 4OZZA 5CMYA 4FLHA 4JHRA 4A55A 2AXZA 1K8KG 5T8IA 3QAQA 2QX3A 4KYOB 3DPDA 5G05C 4L9PA 5LCWJ 4J8EA 2XPZA 5AIJA 4YCQA 2MRIA 1IA5A 4KZCA 3D9LA 4YC5A 3GQAA 2MHKA 1JWFA 3VLEA 4WAFA 3RJVA 1A17A 3GW4A 3TWVA 4BTBA 2R03A 3HVEA 5ARGA 5FQ7A 1RWRA 4EZLA 3UTMA 3AS8A 3UQ3A 4LNBA 2XCBA 3UIPC 5HI7A 4BT8A 3C72A 1K8FA 2QY7A 3DXKG 5M72A 2XHEA 2CHXA 4GU5A 3HG0D 4YNDA 3AU5A 1YYHA 3EDTB 1K3ZD 2YQ8A 3BG0B 3RRMB 4URRA 3FWVA 3VTXA 4XMYA 4APFA 3PS6A 4CYMD 3L17A 4J8SA 2ZISA 2P58C 4YDTA 3GQ9A 1B89A 1XG2A 3IXEA 3LJYA 1QQEA 3PREA 4GYWA 2B0RA 2C2LA 4G8KA 3SI5A 5EIBE 2XS1A 2DYRE 4AJWA 2R05A 3FY3A 3CIAA 2VSOE 4RQIA 2RG8A 3JQ1A 3GZSA 1U3DA 2WXIA 2VBMA 5BV1A 3ZW3A 1LTXA 4XM3A 3LKUA 2DZNA 4Y6CA 2KC7A 4ATZD 3PVLA 5JLVC 2RD0A 4JB8P 3PE4A 2Y4UA 2WM9A 4OPWA 5FZSA 4UWFA 2ZGDA 3FEXA 2FULA 4CGWA 5T4YA 4XIFA 3L08A 1EF1C 3CVXA 3R9MA 3BQOA 4OVUA 2KATA 4JEUA 5A6CA 2CG2A 2I9CA 5FZQA 5LX8A 2VGEA 4UI9K 4UQXA 4GTRA 3JYSA 4XI9A 5DNSA 4OJLA 3DSVA 3FH5A 3MKQA 4B89A 2ODLA 5C1CA 4LG6A 4JA9A 3JX8A 3G2WA 4CDNA 4LERA 1HFAA 2OVBA 3ASGA 5BXOA 2IU1A 4FP7A 1GW6A 3AG3E 3H09A 3D9MA 3S7BA 3VMVA 3ZKJA 3FTXA 3I4GA 2YHCA 5ENQD 4HVBA 3BG1B 4DX5D 4HS2A 1EYHA 4ANUA 2RFAA 3APFA 2FO1E 4JPSA 2Y3AA 5CCMA 3CVUA 3E34A 4GMRA 3JUEA 5ITZF 1HZ4A 3ZHEB 5CCLA 4GMJA 5ENTD 4B0ZA 2C0LA 4BX8A 3DEOA 4ANWA 2E2EA 5EKQD 4XORA 3MYVA 4LCTA 2GRNB 2WXGA 3X2QE 4U04A 4KBQA 2IEJA 4B8AA 4DJAA 3QKYA 4FHKA 4V3IA 1YMPA 3KSLA 1N4SA 3PSZA 4J8FA 3CQCB 4XE0A 4UI9J 3ZYLA 4TUMA 4TUUA 2XRYA 2V8SE 2F3LA 3G2UA 5AARA 1K1AA 1LM1A 4RVBA 1FT2A 4HNAD 4GPMA 3D9NA 4FADA 3SNXA 3T5VA 4G24A 1IHBA 1TN6A 3DBSA 3JCKC 4AIFA 3CEQA 3DPYA 4G8LA 4O60A 3OTNA 4XX5A 4KH3A 4AV7A 4EZJA 4A3VA 4EQFA 4HLLA 3EIQC 2MOWA 2WQHA 2XT2A 4APOA 2P9UG 3UX4A 4GPKA 2NT9A 4GAAA 1KLXA 3C3QA 3PDNA 2V0PA 5CEDB 5J90A 3LEWA 2P9IG 4XOTA 1UN9A 1SA5A 3UI2A 1QA1A 3HXEA 3QJZA 4FULA 3ZNGA 2LO6A 2JLBA 4Y6WA 3B7BA 4N5CA 5FZRA 1NHCA 3LCAA 2IFUA 2L0IA 2P2CP 3HXBA 1BHEA 2QFCA 2YHEA 3F6QA 3L22A 1O88A 5T3RA 3APCA 4FLBA 5CBNA 1LD8A 4ACLA 2Y0BG 4EECA 1E8XA 4GTTA 2J07A 3Q79A 1O8EA 4YEJA 2R02A 4CDRA 1FCHA 3AU4A 3HIZA 4LNUD 1BI8B 2VJIA 4HRLA 1PY1A 2XTYA 3IKOB 3APDA 4XLHA 3TWTA 1O8FA 1KCDA 1U2VG 4GYOA 1TNOA 2IQ7A 3UW0A 3ZGQA 1WAO1 4DI3A 3GZ2A 3NAWA 3UM0A 4XNFA 4XKBA 3KSQA 4AP2A 2BEDA 3UKUG 3SFZA 2BF0X 4MKTA
chains in the Genus database with same CATH topology
2XTWA 4YDTA 2XT2A 2QZAA 3NAWA 4YCQA 3PSSA 2XTXA 4YEIA 3NB2A 3PSZA 4YC5A 2XTYA 2XT4A 3SQVA 2QYUA 3SY2A 2O6WA 4YFOA 5DNSA 2J8KA 3DU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTW A;  4YDT A;  2XT2 A;  2QZA A;  3NAW A;  4YCQ A;  3PSS A;  2XTX A;  4YEI A;  3NB2 A;  3PSZ A;  4YC5 A;  2XTY A;  2XT4 A;  3SQV A;  2QYU A;  3SY2 A;  2O6W A;  4YFO A;  5DNS A;  2J8K A;  3DU1 X; 
#chains in the Genus database with same CATH topology
 2C0M A;  1VDY A;  3DSX A;  3B8Y A;  2Z8G A;  4IUL A;  2IO2 C;  4XON A;  3VMW A;  2GGF A;  2LXL A;  3MX3 A;  2LNI A;  1U3C A;  1NFI E;  4M7C A;  2QXZ A;  4CRW A;  3UKR G;  1O8H A;  3NZS A;  4YFO A;  2VGX A;  3PRZ A;  1INZ A;  1EZG A;  4C0E A;  3DWL G;  3ABL E;  3FH7 A;  5C1D A;  1TSP A;  1DBO A;  4JEH A;  4U7E B;  5FWQ A;  2VSY A;  3UIN C;  2XCC A;  2CHZ A;  4GA0 A;  4V02 C;  4JXT A;  2GRP B;  2VJJ A;  3U9W A;  1SW6 A;  2PM7 A;  4NIK A;  3ABM E;  3ZYM A;  1KT0 A;  2V5Q C;  3IBE A;  3SD5 A;  4OVV A;  3DRA A;  3GRH A;  1H2U A;  2WMN A;  4CT4 A;  2EIM E;  5JJ7 A;  1O8K A;  4WWN A;  3ULY A;  4XZ4 A;  3WXX A;  3ZYK A;  1N0R A;  4ABN A;  4XN3 A;  3FTY A;  3PNT B;  2GRQ B;  4UI9 C;  4LNG A;  3P4G A;  1TNB A;  3I3N A;  3FUI A;  4DUI A;  1DCQ A;  2DBA A;  2VTB B;  1YCS B;  3CVQ A;  1UW4 B;  3PSS A;  4XKW A;  2DYS E;  1VBL A;  3IHY A;  2KZT B;  4Q94 A;  3EQO A;  3AG2 E;  1OCC E;  3ML3 A;  1HG2 A;  2FBN A;  3Q49 B;  5D66 A;  3HXC A;  1PXZ A;  5JMN D;  1JRG A;  3VST A;  2XTX A;  5ENP D;  1HF8 A;  1UG3 A;  3RAU A;  3D9J A;  1DAB A;  3E32 A;  3JXJ A;  1FVH A;  2PYH A;  3MCX A;  4K0R A;  3R9A B;  4YZQ A;  1JCQ A;  3IHV A;  4DX7 D;  4RLY A;  1NP7 A;  4ILI A;  1NZN A;  2UVF A;  2KCV A;  3OXL A;  4I6E A;  4G25 A;  3IV0 A;  2WXH A;  5C1E A;  4F3V A;  2BM7 A;  2WXF A;  2H6I A;  5HKP A;  3AK5 A;  4LRZ A;  4JD2 G;  3U4T A;  2IY0 C;  5AQA A;  1H80 A;  3ASN E;  5FIO A;  4AVX A;  4KZ0 A;  4BWR A;  2ZXW E;  3CK9 A;  1OFL A;  1DNP A;  2VBE A;  4NK6 A;  4XL9 A;  2B6C A;  5KBA A;  2CG3 A;  1SZ9 A;  2BTD A;  4OM9 A;  3K9I A;  1WG0 A;  3SYJ A;  1HU3 A;  4YDY A;  3O48 A;  3B7U X;  5KJN A;  1PLU A;  4GCO A;  3NOC D;  1BU9 A;  1WMR A;  4WNE A;  4FJZ A;  2O1D A;  4N5Q A;  3Q4A B;  1KZP A;  2P9P G;  3JXI A;  3FY4 A;  2QC9 A;  1PE9 A;  2XZD G;  4UQY A;  4PS8 A;  2UWJ G;  2VTB A;  1Z3X A;  3FUN A;  4FC8 A;  4AXH A;  1TYQ G;  3NZU A;  2VGX B;  3T8K A;  3KD7 A;  2HR2 A;  2WXQ A;  2QYJ A;  2Y69 E;  1MJ0 A;  1EDU A;  3OXG A;  2VSX E;  3MV3 B;  1ELK A;  5AJD A;  4RG9 A;  2YNQ A;  4Q96 A;  1SZA A;  1S70 B;  2WQ7 A;  3TXM A;  4BET A;  3SFX A;  2O6W A;  3ML8 A;  1JPL A;  3O4Z A;  2NSZ A;  5J08 A;  2WB2 A;  4HI9 A;  1V54 E;  3TG5 A;  5CBO A;  1H6O A;  3Q9N C;  3QWP A;  1E8Z A;  3L13 A;  1AP7 A;  3CHS A;  3FU3 A;  4JHK A;  1KZO A;  3VTY A;  2WMO A;  2KM4 A;  4W9R A;  3D9H A;  4ZFH A;  3CLJ A;  4YZA A;  1K1B A;  3KEA A;  1D8D A;  3KEZ A;  3RKV A;  5KJK A;  4R7L A;  3ESK A;  3P1U A;  3FTV A;  4YVQ C;  2J4B A;  1DBG A;  3ABK E;  4UWH A;  2NZM A;  1YA0 A;  3JQ0 A;  3UT7 A;  3CHR A;  1OCR E;  5G55 A;  4GTO A;  4U49 A;  4GCN A;  2IOL A;  3Q78 A;  2DZO A;  4J8D A;  2LAI A;  4JHJ A;  5AN8 A;  3JUR A;  1P5Q A;  2R17 C;  2ZU6 B;  1N95 A;  4KMO A;  5H7P A;  2NST A;  4G23 A;  4EBA G;  4TXR A;  4BX9 A;  5FJY A;  5AQ9 A;  4MLP A;  3KS2 A;  1HG5 A;  4DI4 A;  5HQ8 A;  2L0T B;  1DVP A;  2E0I A;  4IN3 B;  3B7S A;  3CV0 A;  4U63 A;  2UY1 A;  4HLE A;  4HOR A;  3LY9 A;  4YDW A;  4X8Q A;  4URK A;  1PAQ A;  3TL5 A;  4OJ6 A;  3MEK A;  1CLW A;  1TN7 A;  3HHM A;  2DWZ A;  2WXP A;  4MRU A;  2H6G A;  4GTV A;  2RFM A;  2VBK A;  2X6Y A;  1E8W A;  1E7U A;  1GQ8 A;  3LPZ A;  4XOP A;  4Z03 A;  4XKC A;  5CHE E;  1N11 A;  4G2V A;  1OOC A;  2V4H C;  2VFO A;  1KT1 A;  1D8E A;  4L2Y A;  5AAO A;  2Y1L E;  3EU9 A;  3ZPP A;  4KT6 B;  4I2W A;  2XGO A;  4I84 A;  5G04 J;  4FU3 A;  4RG6 A;  4F7A A;  1MX4 A;  4J6I A;  4E6H A;  1N52 A;  2KZT A;  2LSV A;  2X6K A;  2J8S D;  4UWK A;  2NTP A;  1N4Q A;  4EPZ A;  2J4D A;  4Z06 A;  1TJF A;  2EWE A;  3MKR A;  5AQ7 A;  3EU5 A;  3PEU B;  1IDJ A;  4M3O A;  1JTA A;  3TWQ A;  2VGY A;  3CVL A;  1TR4 A;  3SFY A;  1EPU A;  2ZIR A;  5EYP F;  4AY6 A;  5BUZ A;  3UMV A;  2J9Q A;  3DSS A;  4L2L A;  3TG4 A;  4DLO A;  3CK8 A;  4A1S A;  3U66 A;  3P2B A;  2ETC A;  2HM8 A;  4LEU A;  5LCW C;  2P9L G;  3UM3 A;  2FI7 A;  3ZYQ A;  4FJY A;  3HXD A;  4ANV A;  2QYU A;  4N3A A;  3Q5M A;  3KAE A;  4O6F A;  2UY1 B;  2ETB A;  2XQ0 A;  3SGH A;  4BSZ B;  1O8I A;  2CFZ A;  2XPY A;  4Z05 A;  3E30 A;  4A3T A;  1WY6 A;  2BSP A;  4DPR A;  3SZE A;  2F0Y A;  2PQR A;  1JWG A;  2EQX A;  1DCE A;  2R2L A;  5CRV A;  3S2A A;  4XR6 A;  3BEE A;  4CCA A;  4DRX E;  1QQ1 A;  3S7D A;  4IRU A;  4I9C A;  2H6H A;  4TV3 A;  4OJ5 A;  4BSX A;  2BM6 A;  2VFM A;  1O8L A;  2EIN E;  3UIO C;  1G3N B;  3CHO A;  4JRA C;  1OGO X;  5FIN A;  3T8M A;  4ATG A;  3EIJ A;  3SUC A;  3I4R B;  2XT4 A;  3MKQ B;  4WND A;  4GZ3 A;  3GZ1 A;  3LJN A;  1HE8 A;  2BM5 A;  1HXI A;  1JCR A;  3CHP A;  1NL4 A;  3FU0 A;  4EBA A;  4Z68 A;  4BFR A;  3WWG A;  1KPS B;  4H7Y A;  3PH0 C;  3SO8 A;  2L6B A;  4KVM A;  3ASO E;  1LD7 A;  2NTB A;  4PMH A;  2WPV A;  4XQF A;  2NC9 A;  4GTM A;  3RRU A;  3CHM A;  3FUF A;  1HH8 A;  3ENE A;  4CT0 A;  4HWV A;  5G04 C;  3L9T A;  4OAV B;  3TGO A;  3C5R A;  4G26 A;  1OY3 D;  4G11 A;  1MHQ A;  4OJO A;  3CSF A;  3ZUV B;  5CEC B;  4YZX A;  3FUL A;  3HDX A;  2IO3 C;  3BU8 A;  1O1S A;  3CVY A;  3LXU X;  4L23 A;  3TXN A;  2IOS A;  1A5E A;  2INV A;  1OFM A;  3LJ3 A;  3Q9U C;  2F8X K;  4HXI A;  3DSU A;  5ENN A;  4YDO A;  2HE0 A;  4HRM B;  2GRM A;  5EYL A;  3SF4 A;  1E7V A;  3RIB A;  5JMC B;  4WUY A;  2VSN A;  3BH6 B;  2XEV A;  1TYU A;  3ULQ A;  2XS8 A;  1N9A A;  3LY8 A;  1IDK A;  3B7R L;  1BLX B;  4KVO A;  3BUA A;  3CVV A;  2LUH A;  2ILR A;  1ZU2 A;  2H6F A;  4U0U A;  2WXJ A;  1L5J A;  3TWS A;  3FTW A;  3HXF A;  3ONK A;  4XEI G;  3B13 A;  3FFL A;  2WXM A;  2LSU A;  4GA1 A;  4U8Y D;  2PM6 A;  3PNL B;  5ANL A;  5B1A E;  5LP0 A;  3DU1 X;  5AMV A;  5FQ4 A;  4I6J A;  3TJP A;  4I43 A;  2W7Z A;  3PUJ A;  1OWN A;  1QBQ A;  4YZ0 A;  1O1T A;  1TNU A;  5BV0 A;  3Q75 A;  3QWW A;  3V30 A;  3TWR A;  4U8V D;  4HOT A;  3RK6 A;  1Y6I A;  2XRZ A;  2X3H A;  3N90 A;  2OCC E;  4MXN A;  2P9S G;  1LLW A;  4WWO A;  5AJL A;  4BY6 A;  3LY7 A;  3L82 A;  3FU6 A;  3EQN A;  1MYO A;  2YIN A;  2YUH A;  1TJC A;  4ILG A;  2BM4 A;  2XEE A;  1UOH A;  1MZC A;  2WXR A;  3EUV A;  3URZ A;  4CGV A;  1IKN D;  4UWL A;  1QRC A;  2HYZ A;  1O8J A;  1FPP A;  2L9B A;  5EDS A;  5AYW D;  1O5M A;  3LS8 A;  3Q47 B;  1WM5 A;  5A23 A;  2M63 A;  5KNH D;  3ZXS A;  4EZK A;  3Q7A A;  5EX0 A;  3ZPJ A;  1EA0 A;  4U0Z A;  1AIR A;  3VSU A;  3EHN A;  3KRG A;  4CEM A;  2VFP A;  3NBN B;  4XI0 A;  5C2Y A;  3RSE G;  3FUK A;  2GW1 A;  2L6J A;  4I2Z A;  3T5X A;  3IEG A;  1UJK A;  1Z3Y A;  1XNF A;  2NSP A;  2IJG X;  4GTQ A;  1SQM A;  5KJM A;  3DSW A;  2XTW A;  2HO1 A;  3C3R A;  4U4B A;  1SA4 A;  4GZC A;  4GYY A;  2WXL A;  4K5B A;  3ZXP A;  4XLF A;  2CHW A;  2I6H A;  5E76 A;  3PET A;  3U3W A;  1QJV A;  4MR0 A;  3TAX A;  5LOZ A;  4ILH B;  4HRN A;  4DX1 A;  2LAH A;  3ZHE A;  5BNW A;  2PL2 A;  5ENR D;  5CMW A;  1ELW A;  4O1O A;  3Q7F A;  4W8Q A;  1KTW A;  2VYI A;  4LUN U;  1TYW A;  2FF4 A;  1S64 A;  2V5F A;  5EIL A;  1N4P A;  2PYG A;  2IOU G;  2GRO B;  2NT6 A;  1MQS A;  1RMG A;  3CQG B;  1QA2 A;  4C48 B;  2P9K G;  1Z6T A;  3RRN B;  2KCL A;  2LXM A;  3MA5 A;  1DC2 A;  3FUM A;  4XKV A;  3UM2 A;  3D9P A;  2G0Y A;  1K5C A;  1HX8 A;  4L7T A;  3D9K A;  3R7Q A;  3L16 A;  4NRH B;  3UT8 A;  4NK8 A;  4U8H A;  5KWD A;  2JEK A;  3AS5 A;  2OEW A;  1BN8 A;  3PZ1 A;  1N0Q A;  4UUC A;  4YVO A;  2PNN A;  3ISM C;  2GRR B;  4PH4 B;  1H2V C;  3ULE G;  2JAB A;  1IHG A;  4L1B A;  4JVS A;  5CEA A;  3QB2 A;  3LVQ E;  2IF4 A;  3C98 A;  4JA7 A;  2CFU A;  5HS0 A;  1RW2 A;  4TXP A;  3SY2 A;  3NF1 A;  4AY5 A;  4BES A;  2AXV A;  3RU0 A;  2O0W A;  3PZ3 A;  3AG4 E;  2XGS A;  5G05 J;  2A5E A;  1HG8 A;  3FDH A;  3SZ7 A;  1MX2 A;  3N6Z A;  4K5C A;  4BER A;  5CER B;  3AAA C;  4NAC A;  3UM1 A;  4BEP A;  5IY5 E;  2EIK E;  3D3M A;  5KNG A;  1W3B A;  3V79 K;  1WDY A;  2VJ8 A;  3CK7 A;  4CDM A;  4OAU C;  4HOQ A;  4AEZ C;  5KCM A;  4XN0 A;  4J8Y A;  3QDN A;  1PC2 A;  1BPO A;  1HO8 A;  3RO2 A;  4HBD A;  2WXK A;  4WWP A;  3ZIM A;  4EW9 A;  3FTU A;  4NQ0 A;  1E8Y A;  5LFA A;  3EHQ A;  4DK5 A;  5AEN A;  3AJI A;  3CVW A;  1WXR A;  1XGW A;  2I2O A;  2AW6 A;  1TEZ A;  3FH8 A;  3OAW A;  2XZT G;  3L6A A;  1H6P A;  3HYM B;  3AS4 A;  1E96 B;  3DXM G;  3FTS A;  1LLZ A;  2PZI A;  2XGM A;  4WNG A;  4W8S A;  1QCX A;  4DX2 A;  1QYM A;  4KXK B;  4GZ6 A;  3J5Q B;  3QOU A;  2BX6 A;  1KQ5 A;  2KBX A;  4GML A;  2ZGG A;  4ANX A;  3D9I A;  2QY1 A;  4UQZ A;  2NXP A;  3V2O A;  2I1K A;  2VFQ A;  4P29 A;  1CZF A;  3TH0 A;  2A5U A;  3VLF A;  3U64 A;  3NB2 A;  3V2X A;  1FT1 A;  4C9B B;  1ZBP A;  5EX3 A;  4U0S A;  4WNF A;  2XPI A;  2OVF A;  3ZN3 A;  4B94 A;  2BUG A;  2Y4T A;  5B3S E;  2F8Y A;  1S63 A;  1OWP A;  4HQD A;  4N2Q A;  1NA0 A;  4W8R A;  2EIL E;  1OXJ A;  3OXF A;  4F1S A;  3LYC A;  3FU5 A;  3L54 A;  4JW1 A;  3CST A;  1N54 A;  1IQR A;  3R7R A;  3T9K A;  3QNK A;  4B8C B;  1RU4 A;  4B93 B;  2ION A;  3FP3 A;  3TWW A;  1BI7 B;  4YDE A;  2DCP A;  1O8D A;  1ZB1 A;  3ONL A;  3CR3 A;  3GQ7 A;  5JHB A;  3VLD A;  1LF8 A;  5D0O D;  4JL0 A;  3UPV A;  1EE6 A;  2VFN A;  2UVE A;  4BTA A;  2ETA A;  2A4Z A;  3G2V A;  1O1R A;  4K03 A;  4XLA A;  3ML9 A;  4Q69 A;  3QAR A;  3JUI A;  5ENS D;  1QRB A;  1V55 E;  1HS6 A;  3E33 A;  1Z5S C;  3PE3 A;  4O1P A;  2F37 A;  2X6X A;  4OJP A;  3B4N A;  2I1J A;  4J7W A;  2KXP C;  3QWV A;  2V4L A;  2OV8 A;  2AXU A;  1OCZ E;  4I1M A;  3PEV B;  2XEH A;  5E75 A;  3ASF A;  3BH7 B;  3PZ4 A;  5FTP A;  3VSV A;  4UWG A;  2NYJ A;  3FUE A;  2XEN A;  2WQ6 A;  2J09 A;  3SBT B;  2WXN A;  3FUH A;  2WVI A;  2NTQ A;  2XC1 A;  4CZ2 D;  2DVW A;  1IQU A;  1X81 A;  2X6I A;  4H7X A;  2X3M A;  3C3O A;  4HOS A;  2VQ2 A;  3SQV A;  4ACK A;  4BT9 A;  5JJT A;  4GTS A;  1O8G A;  2J8K A;  4PS7 A;  2WXO A;  4OZY A;  3QC1 A;  1BD8 A;  4I1O B;  3WG7 E;  2J08 A;  4JC8 A;  4PDX A;  1D9S A;  2FEZ A;  4I17 A;  3FEY A;  4HOU A;  3CKC A;  3ESL A;  1OWM A;  4N3C A;  3B95 A;  4C2L A;  5D0Q D;  2KCK A;  1TN8 A;  5D2M C;  4NUR A;  1IB4 A;  1RZ4 A;  1TYX A;  2OND A;  5G2N A;  5DBK A;  3UUX A;  4HB5 A;  3Q73 A;  5EN5 D;  4MBG A;  1JUQ A;  3MGB A;  2O0V A;  2GRL A;  4GA2 A;  4U96 D;  2O17 A;  2FO7 A;  4A63 B;  5ANR A;  4QFV A;  1N4R A;  2AJA A;  3PZD A;  3FTZ A;  3RO3 A;  3S7J A;  4F6R D;  2IQC A;  3ZRH A;  4ME2 A;  3SHF A;  1TNY A;  4AVZ A;  3LMW A;  5FQ6 A;  2X6J A;  3ZU7 B;  4J0U A;  5B1B E;  3ZFW A;  3ASH A;  5KJL A;  5A7D B;  2AVP A;  4TXQ A;  5BPP A;  3SBS A;  4DX6 D;  1E90 A;  5BT1 A;  4I1A A;  3NQP A;  4GTP A;  4ZHB A;  4GB9 A;  2R5S A;  5BW8 C;  3DEP A;  1OFD A;  4XLE A;  4I6G A;  3V31 A;  3EJN A;  4GZD A;  3CHQ A;  2X6F A;  5JJ6 A;  5JA4 D;  4F1P A;  1SVX A;  1H19 A;  4F53 A;  4YEL A;  2O04 A;  1H6K A;  2X38 A;  1JCS A;  2RKK A;  2QZA A;  1QA3 A;  3ASD A;  3FUD A;  1TNZ A;  2Q7F A;  3UXG A;  5DIZ A;  3W9G A;  5ENO D;  3CVN A;  4A1G A;  5EID A;  4AM9 A;  1QZ2 A;  5FT9 A;  4IYP A;  1X5B A;  3N71 A;  4OYS A;  3UT4 A;  2OOE A;  5JHA A;  1K4Z A;  3HVE B;  2PQN A;  1OFE A;  1NA3 A;  2AWI A;  3B7T A;  2V5I A;  3MV2 B;  3ZEF A;  5BXU A;  4E85 A;  2X6H A;  3ZVV A;  1HF2 A;  1H2T C;  4G1T A;  2DIW A;  4HI8 A;  4DLQ A;  3RIQ A;  4FHJ A;  4MS6 A;  3MZL B;  4QQI A;  2BKG A;  1OWL A;  3D9O A;  4AOF A;  4C0M A;  1X0C A;  3ZSC A;  4JZY A;  5FQ8 A;  2INU A;  4LSZ E;  3G2T A;  3I5P A;  1MX6 A;  3DST A;  2X85 A;  3FUJ A;  4PS3 A;  1FVF A;  1NI1 A;  2J49 A;  2P9N G;  1IYG A;  3E37 A;  1L1I A;  3HRA A;  2B0O E;  3LVR E;  3LDZ A;  3T9G A;  4XLC A;  3CGH A;  4N39 A;  4N3B A;  1KCC A;  1O8M A;  3CVP A;  3G2S A;  3TWX A;  3PZ2 A;  4TRQ A;  2BKK B;  2X6W A;  3W9F A;  2EIJ E;  2PEC A;  5AQB A;  1AWC B;  1ELR A;  2MYO A;  3J5P A;  3GYZ A;  5ARF A;  1UJJ A;  3B90 A;  4U95 D;  3CKB A;  3PUK A;  3EHM A;  3EHR A;  4GZ5 A;  1OGM X;  1TYV A;  1H0A A;  4HFG A;  1OWO A;  2J8I A;  3Q15 A;  2OEV A;  3S7F A;  3E4B A;  4N2S A;  4U07 A;  3AG1 E;  2R59 A;  3GQ8 A;  4D10 C;  5HRY A;  4YEI A;  4I9E A;  1OCO E;  1Y8M A;  1IXV A;  1Q2Z A;  1UN8 A;  3MJW A;  3FHE A;  4RSY A;  3QK0 A;  3LYA A;  1OUV A;  4EHM A;  4K5A B;  5CRU A;  4FA6 A;  4W8T A;  1QNF A;  1S0P A;  1OT8 A;  3TWU A;  4PUC A;  3NOG D;  1N94 A;  4OZZ A;  5CMY A;  4FLH A;  4JHR A;  4A55 A;  2AXZ A;  1K8K G;  5T8I A;  3QAQ A;  2QX3 A;  4KYO B;  3DPD A;  5G05 C;  4L9P A;  5LCW J;  4J8E A;  2XPZ A;  5AIJ A;  4YCQ A;  2MRI A;  1IA5 A;  4KZC A;  3D9L A;  4YC5 A;  3GQA A;  2MHK A;  1JWF A;  3VLE A;  4WAF A;  3RJV A;  1A17 A;  3GW4 A;  3TWV A;  4BTB A;  2R03 A;  3HVE A;  5ARG A;  5FQ7 A;  1RWR A;  4EZL A;  3UTM A;  3AS8 A;  3UQ3 A;  4LNB A;  2XCB A;  3UIP C;  5HI7 A;  4BT8 A;  3C72 A;  1K8F A;  2QY7 A;  3DXK G;  5M72 A;  2XHE A;  2CHX A;  4GU5 A;  3HG0 D;  4YND A;  3AU5 A;  1YYH A;  3EDT B;  1K3Z D;  2YQ8 A;  3BG0 B;  3RRM B;  4URR A;  3FWV A;  3VTX A;  4XMY A;  4APF A;  3PS6 A;  4CYM D;  3L17 A;  4J8S A;  2ZIS A;  2P58 C;  4YDT A;  3GQ9 A;  1B89 A;  1XG2 A;  3IXE A;  3LJY A;  1QQE A;  3PRE A;  4GYW A;  2B0R A;  2C2L A;  4G8K A;  3SI5 A;  5EIB E;  2XS1 A;  2DYR E;  4AJW A;  2R05 A;  3FY3 A;  3CIA A;  2VSO E;  4RQI A;  2RG8 A;  3JQ1 A;  3GZS A;  1U3D A;  2WXI A;  2VBM A;  5BV1 A;  3ZW3 A;  1LTX A;  4XM3 A;  3LKU A;  2DZN A;  4Y6C A;  2KC7 A;  4ATZ D;  3PVL A;  5JLV C;  2RD0 A;  4JB8 P;  3PE4 A;  2Y4U A;  2WM9 A;  4OPW A;  5FZS A;  4UWF A;  2ZGD A;  3FEX A;  2FUL A;  4CGW A;  5T4Y A;  4XIF A;  3L08 A;  1EF1 C;  3CVX A;  3R9M A;  3BQO A;  4OVU A;  2KAT A;  4JEU A;  5A6C A;  2CG2 A;  2I9C A;  5FZQ A;  5LX8 A;  2VGE A;  4UI9 K;  4UQX A;  4GTR A;  3JYS A;  4XI9 A;  5DNS A;  4OJL A;  3DSV A;  3FH5 A;  3MKQ A;  4B89 A;  2ODL A;  5C1C A;  4LG6 A;  4JA9 A;  3JX8 A;  3G2W A;  4CDN A;  4LER A;  1HFA A;  2OVB A;  3ASG A;  5BXO A;  2IU1 A;  4FP7 A;  1GW6 A;  3AG3 E;  3H09 A;  3D9M A;  3S7B A;  3VMV A;  3ZKJ A;  3FTX A;  3I4G A;  2YHC A;  5ENQ D;  4HVB A;  3BG1 B;  4DX5 D;  4HS2 A;  1EYH A;  4ANU A;  2RFA A;  3APF A;  2FO1 E;  4JPS A;  2Y3A A;  5CCM A;  3CVU A;  3E34 A;  4GMR A;  3JUE A;  5ITZ F;  1HZ4 A;  3ZHE B;  5CCL A;  4GMJ A;  5ENT D;  4B0Z A;  2C0L A;  4BX8 A;  3DEO A;  4ANW A;  2E2E A;  5EKQ D;  4XOR A;  3MYV A;  4LCT A;  2GRN B;  2WXG A;  3X2Q E;  4U04 A;  4KBQ A;  2IEJ A;  4B8A A;  4DJA A;  3QKY A;  4FHK A;  4V3I A;  1YMP A;  3KSL A;  1N4S A;  3PSZ A;  4J8F A;  3CQC B;  4XE0 A;  4UI9 J;  3ZYL A;  4TUM A;  4TUU A;  2XRY A;  2V8S E;  2F3L A;  3G2U A;  5AAR A;  1K1A A;  1LM1 A;  4RVB A;  1FT2 A;  4HNA D;  4GPM A;  3D9N A;  4FAD A;  3SNX A;  3T5V A;  4G24 A;  1IHB A;  1TN6 A;  3DBS A;  3JCK C;  4AIF A;  3CEQ A;  3DPY A;  4G8L A;  4O60 A;  3OTN A;  4XX5 A;  4KH3 A;  4AV7 A;  4EZJ A;  4A3V A;  4EQF A;  4HLL A;  3EIQ C;  2MOW A;  2WQH A;  2XT2 A;  4APO A;  2P9U G;  3UX4 A;  4GPK A;  2NT9 A;  4GAA A;  1KLX A;  3C3Q A;  3PDN A;  2V0P A;  5CED B;  5J90 A;  3LEW A;  2P9I G;  4XOT A;  1UN9 A;  1SA5 A;  3UI2 A;  1QA1 A;  3HXE A;  3QJZ A;  4FUL A;  3ZNG A;  2LO6 A;  2JLB A;  4Y6W A;  3B7B A;  4N5C A;  5FZR A;  1NHC A;  3LCA A;  2IFU A;  2L0I A;  2P2C P;  3HXB A;  1BHE A;  2QFC A;  2YHE A;  3F6Q A;  3L22 A;  1O88 A;  5T3R A;  3APC A;  4FLB A;  5CBN A;  1LD8 A;  4ACL A;  2Y0B G;  4EEC A;  1E8X A;  4GTT A;  2J07 A;  3Q79 A;  1O8E A;  4YEJ A;  2R02 A;  4CDR A;  1FCH A;  3AU4 A;  3HIZ A;  4LNU D;  1BI8 B;  2VJI A;  4HRL A;  1PY1 A;  2XTY A;  3IKO B;  3APD A;  4XLH A;  3TWT A;  1O8F A;  1KCD A;  1U2V G;  4GYO A;  1TNO A;  2IQ7 A;  3UW0 A;  3ZGQ A;  1WAO 1;  4DI3 A;  3GZ2 A;  3NAW A;  3UM0 A;  4XNF A;  4XKB A;  3KSQ A;  4AP2 A;  2BED A;  3UKU G;  3SFZ A;  2BF0 X;  4MKT A; 
#chains in the Genus database with same CATH homology
 2XTW A;  4YDT A;  2XT2 A;  2QZA A;  3NAW A;  4YCQ A;  3PSS A;  2XTX A;  4YEI A;  3NB2 A;  3PSZ A;  4YC5 A;  2XTY A;  2XT4 A;  3SQV A;  2QYU A;  3SY2 A;  2O6W A;  4YFO A;  5DNS A;  2J8K A;  3DU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...