3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
3PSZA 3SY2A 4YEIA 2QYUA 3SQVA 4YDTA 2XT4A 2J8KA 2XT2A 3NAWA 2XTYA 2XTXA 3PSSA 3DU1X 4YC5A 2QZAA 5DNSA 3NB2A 2O6WA 2XTWA 4YFOA 4YCQA
chains in the Genus database with same CATH superfamily
2F37A 3D9JA 4JEUA 3CK8A 3SD5A 1UW4B 3ZW3A 4JRAC 3TXMA 1EYHA 4F3VA 3TG5A 2RD0A 3CK9A 2VJIA 3UT8A 1KCCA 2X3MA 1OWNA 2E0IA 4LEUA 3O4ZA 4A63B 1V55E 2VJ8A 5ENPD 2VYIA 1ZB1A 5FINA 4HORA 1K8FA 4W8QA 5DBKA 1JTAA 1HE8A 1YYHA 2NT9A 5T8IA 1ZU2A 2V5QC 5HKPA 3LY8A 3MYVA 4GTVA 1G3NB 2YHEA 2NSPA 4I6EA 3DRAA 2WXOA 3FY4A 1IKND 4YZXA 5CCMA 5IY5E 3PZ1A 2IO3C 4IYPA 4HB5A 3L6AA 3NQPA 2DZNA 2L6BA 4XKBA 4HQDA 3ZIMA 4N5CA 4IRUA 1BI7B 2PM6A 3KRGA 3PETA 5LX8A 3E4BA 5FZQA 3BUAA 4HWVA 2W7ZA 3ABKE 4XI0A 2CG3A 1QQEA 3EDTB 4M3OA 3EJNA 3RK6A 5E75A 1BPOA 5G2NA 3SGHA 5A23A 1A5EA 1KZOA 4AOFA 1S0PA 4CT4A 2CHWA 1TNBA 3UIPC 4L2YA 1JRGA 3D9IA 4LUNU 5CMYA 3RO3A 3SI5A 3HIZA 1EF1C 3CVXA 2PQNA 3PSZA 4DJAA 3SY2A 2ZIRA 2FEZA 2OEWA 4LG6A 3N71A 4XLAA 1PC2A 4GYOA 2V4HC 4O1OA 5KJKA 1LF8A 5BV0A 4UWKA 4C0MA 3FUKA 3DBSA 3EUVA 3PUJA 4I1OB 3TWWA 3AS5A 5AYWD 2E2EA 3SNXA 1OXJA 1MX6A 2Y69E 5EIDA 1MX4A 1X0CA 2CHZA 4QFVA 1RMGA 2X3HA 4BSXA 3EHQA 1OY3D 1O1SA 5KNGA 2VTBA 2G0YA 3HXFA 3OTNA 1SVXA 1HS6A 4N5QA 4OPWA 1WDYA 2XT2A 1K3ZD 4NURA 4XNFA 1AP7A 3IKOB 4JL0A 4NIKA 3QWVA 3ZYKA 2HO1A 3HVEB 1FVFA 2V5FA 2QY1A 3T9KA 4OVUA 4K5BA 5AARA 4EECA 2XTWA 1RZ4A 4CCAA 3U4TA 4U0ZA 4GTOA 3FTVA 3UTMA 5EYPF 3FH5A 4H7YA 2IOLA 3AK5A 3T8MA 5FWQA 5H7PA 3FH7A 4BT9A 3QC1A 3T5VA 3S7BA 4OJOA 2WQHA 3J5PA 1S64A 4HOSA 3NBNB 3RSEG 3FY3A 1LD8A 2Y0BG 2YHCA 3LDZA 1BU9A 3ONKA 2JABA 1O1TA 5DNSA 5EX3A 2X6XA 3EHRA 1XG2A 4C9BB 4HRMB 1HX8A 4C48B 2O0VA 4OVVA 3T5XA 3ULQA 5JHAA 4TXRA 1NA3A 4YZAA 2XGOA 3OXLA 2I1KA 4EZKA 3ZNGA 3AG1E 2H6IA 4GYWA 2OOEA 3CVUA 4RVBA 3ASDA 3L54A 2KZTB 3LYAA 5ENRD 3EQOA 3CHMA 2ODLA 3RRUA 4FHKA 2XPIA 4MBGA 4AIFA 2WXNA 4GA0A 3UMVA 3ZKJA 2XC1A 1N0QA 3QARA 2ZU6B 4XE0A 4UI9J 3UM2A 2L0IA 3HXDA 1MQSA 4GU5A 4TRQA 3VLDA 4UQXA 5T3RA 1IA5A 3V2OA 5ENQD 4CT0A 3AG2E 1OFMA 2WXFA 3PZ3A 5CRVA 1JCRA 4Z05A 3URZA 2ZXWE 3Q5MA 2XENA 4APOA 3DSVA 1P5QA 2QYJA 1TYWA 1OCCE 1WMRA 3F6QA 1MX2A 3CSFA 2F8YA 1U3CA 2X6FA 3NOCD 4IN3B 4KVMA 4XX5A 3DU1X 3G2TA 4XKVA 4WWNA 3EU5A 5JJTA 4N2QA 4RG6A 4RG9A 2FO1E 1QYMA 4LNBA 3VTYA 4Y6CA 1HFAA 3QJZA 4URKA 2RFAA 3HRAA 3QOUA 1A17A 1H0AA 2ONDA 4U0UA 3FH8A 3AJIA 3KEAA 1H6PA 4XL9A 1QRBA 3I4RB 2CHXA 3Q15A 3ML3A 3E32A 4TXQA 4ILHB 4EZJA 2PNNA 4ANWA 3V2XA 2DCPA 4MLPA 4JZYA 1RU4A 3D9KA 4MKTA 4XLFA 4N3BA 4YELA 5G05C 4LNUD 3ASFA 3Q7FA 3B7BA 3DSTA 4WWPA 2R03A 1XGWA 2UWJG 4HFGA 3U64A 4JXTA 2P9KG 5KJNA 3TWTA 2AWIA 2YINA 5JJ6A 3CVQA 4GYYA 4G1TA 4ME2A 4DLQA 3LEWA 4W9RA 3PEUB 4CYMD 3T9GA 1L5JA 4GCOA 4UWGA 4XZ4A 1IDJA 1D8DA 5ARGA 2WXKA 3E37A 4GZ5A 4PUCA 2VGXA 5BPPA 2LXLA 3CHPA 3DSSA 3ZYLA 3TWVA 3WXXA 1MZCA 3GZ1A 2INVA 3G2UA 1N0RA 1FVHA 2P58C 2X6KA 4UWFA 3ASOE 4Q96A 5A6CA 3UM3A 1NP7A 2XS1A 3GW4A 1PXZA 4HXIA 1K1AA 4KH3A 3HDXA 5BUZA 2EIJE 1HG8A 4JVSA 5C2YA 3VSVA 1CLWA 1N4SA 2X6WA 5JMCB 3I4GA 1HH8A 3PNLB 3ESKA 2INUA 4LRZA 4GB9A 1OCOE 1IYGA 4A55A 3IHYA 4GTPA 2LNIA 2BKGA 4XN0A 2VBMA 1QZ2A 3V30A 1OCZE 3PH0C 3BG0B 1IQUA 2VFNA 4I6GA 2Y3AA 5LP0A 1NA0A 3D9MA 4TV3A 3PREA 4JB8P 3Q49B 3UQ3A 1N54A 1NL4A 3KEZA 2GRQB 1O8GA 1SZ9A 4OM9A 4YEIA 1D9SA 1L1IA 2A5UA 4LSZE 4F53A 3VSUA 3RJVA 4R7LA 3TL5A 2J9QA 1GW6A 2RG8A 2I9CA 4LNGA 2WB2A 4GTQA 4GZDA 3QNKA 3APFA 3Q9NC 1S63A 3ZEFA 5CEDB 3PZDA 4UQZA 4CEMA 4EPZA 4AY5A 5EN5D 1HO8A 4XLCA 4E6HA 4AP2A 2IFUA 2BEDA 3SFYA 4N39A 3C3OA 3CVNA 1TN6A 3HXEA 1HF2A 5AN8A 4L9PA 4JHKA 2IOUG 1LLWA 3ISMC 1OWLA 2XS8A 2DVWA 1INZA 5EX0A 5AIJA 4I84A 3UUXA 5T4YA 3FEYA 3C98A 1OFDA 2F3LA 3ML9A 5AJLA 4E85A 4CRWA 1RWRA 5HI7A 3EIJA 4BFRA 1EE6A 3L82A 2VJJA 4XOTA 4MR0A 3CEQA 4NRHB 3JXIA 2UY1A 4ZHBA 3UKRG 4N2SA 1ZBPA 2GRMA 4PH4B 1JWGA 2WMNA 5KCMA 5ENTD 1QJVA 2X6IA 4U8HA 3PNTB 4BTBA 2XCBA 4A1GA 1KZPA 1YMPA 1IHGA 3B4NA 5LCWC 4Z68A 1TJCA 2WM9A 4GA2A 1TSPA 3FUEA 5FZRA 1TNOA 4W8SA 3TG4A 2KCLA 2NT6A 2QXZA 4XOPA 5CHEE 2LUHA 3TWUA 4ANUA 2OCCE 2WXPA 3UM0A 3X2QE 2H6FA 3GZSA 3SZEA 3L16A 4ATZD 3FU6A 3TGOA 2Y4UA 1NI1A 4U0SA 4XORA 1OWPA 5FTPA 5J90A 1Y8MA 3GZ2A 4AVXA 4FC8A 4AM9A 4HOTA 1OFEA 2FULA 5C1EA 3S2AA 2J09A 2NSZA 2J08A 1H80A 1B89A 1E96B 2GRLA 4HBDA 3LCAA 4HVBA 3RRNB 3S7FA 2PQRA 1O8MA 3LVQE 3IBEA 1OWMA 4C2LA 3JXJA 4Q94A 3CVPA 4K5CA 4W8RA 2IJGX 4GMJA 2VTBB 3ASHA 3KSQA 4FP7A 1E90A 3SUCA 2DIWA 4GTMA 4DUIA 2I6HA 2FO7A 4OJPA 3QK0A 3MEKA 1FT1A 4GZ6A 3B8YA 2J4BA 3ZHEA 4DK5A 1FPPA 3NF1A 4OJ5A 1BD8A 3LPZA 3EU9A 5G05J 4WAFA 3SBSA 4B93B 3FUNA 2EQXA 3ZXSA 3DXKG 4I2ZA 3MX3A 5CERB 2BSPA 2PYHA 5D0QD 1E7UA 1OT8A 3MA5A 2LSVA 4ILIA 3ZVVA 1DBOA 4WNGA 1EZGA 1PY1A 2QC9A 2XEVA 1N94A 4MRUA 4MS6A 1OFLA 1TN7A 3AG3E 1SZAA 2PECA 3APCA 4BSZB 1O8KA 1SQMA 4ACKA 2J8KA 1UJKA 4XQFA 3ABLE 3FEXA 2B0OE 2WXHA 1EDUA 2WVIA 2DZOA 2MOWA 2ZGDA 2WXQA 1O8EA 1WG0A 1TN8A 1K4ZA 3MKQB 2LXMA 2LSUA 2PL2A 4U95D 4U96D 4B8AA 3BG1B 3TXNA 1TEZA 3GQ7A 3KAEA 2BM4A 3VSTA 2X6HA 2J4DA 3C72A 3CVLA 1TYXA 5B1AE 2WQ6A 4BERA 3HG0D 2WXJA 2FI7A 2JEKA 2ETBA 3HVEA 2XEHA 3QAQA 3LMWA 4YDTA 2GGFA 2WMOA 3I5PA 4O60A 3OXGA 4AV7A 4HI9A 3QWPA 3LYCA 3AS4A 1HU3A 5KJLA 1K5CA 3VTXA 3CGHA 3B7TA 2VSNA 3DPDA 4Z06A 2VFQA 4F1SA 4I9EA 4EQFA 3IEGA 4XM3A 4BT8A 2EWEA 2FBNA 1QA2A 4EW9A 4J8FA 3E34A 2QX3A 4WNEA 3FUMA 2OVFA 1PE9A 3SFXA 4ACLA 1N4RA 4GA1A 2WXRA 1NFIE 4FADA 2OV8A 2XZDG 4NQ0A 1HXIA 1O8LA 3RRMB 4B8CB 4U49A 4JA9A 3L13A 2AXUA 3UIOC 1TR4A 2IU1A 5JJ7A 4JHJA 2Q7FA 3ZGQA 2GRNB 2EIKE 2O17A 5AMVA 4CDRA 5CBOA 5BV1A 4GPKA 2VBEA 3LJNA 3VLEA 1OGMX 4YVOA 1KT0A 2KCKA 2P9IG 4ANXA 2X6JA 2AXZA 5DIZA 3CQGB 2YNQA 3Q79A 2I2OA 3FTYA 3RKVA 3D9OA 4H7XA 3VLFA 4G11A 2I1JA 3Q78A 3D3MA 3PZ4A 3PEVB 3I3NA 1ELKA 4W8TA 2P9UG 2HYZA 5JHBA 4WWOA 3V79K 1AWCB 3CHQA 3ABME 3QB2A 3NAWA 3FWVA 3C3QA 3UXGA 1U2VG 2B6CA 5JLVC 4FA6A 3LY9A 4J8YA 2IOSA 1IQRA 2NSTA 2WPVA 3TH0A 4HRNA 3JYSA 1U3DA 4YDYA 1Y6IA 2C0MA 3GQ8A 5C1CA 4KZ0A 4U7EB 4GMLA 1HG2A 3TWXA 2VGXB 5KJMA 5B3SE 3FUDA 2GRRB 2GROB 3EHMA 1H2UA 4J8SA 4CDMA 1DBGA 2A5EA 3Q47B 4G2VA 5HQ8A 1PLUA 1K8KG 4EBAA 3CV0A 2O6WA 4XR6A 2FF4A 4B0ZA 2XGMA 3DEOA 4DX1A 3SQVA 1FT2A 2ZISA 1E8YA 4DRXE 2H6HA 3CK7A 4DI4A 3TAXA 3MV3B 4UWLA 3H09A 4P29A 4APFA 4GZ3A 2VFPA 1DABA 3MJWA 2OEVA 3EHNA 4GCNA 3CKBA 3UKUG 3R9AB 3FTSA 3HXBA 4F7AA 1E7VA 4PDXA 1KT1A 1UN8A 4F1PA 2NC9A 3B90A 3ZPJA 3QDNA 5KWDA 4WNDA 1XNFA 3BH6B 4L1BA 4U8YD 4TXPA 1E8WA 3CIAA 5M72A 4YFOA 1DNPA 3UI2A 4URRA 3TWQA 2MHKA 3FU3A 1O8JA 3PVLA 5AENA 1JWFA 4YZQA 3ZUVB 4V3IA 4XIFA 3G2SA 2JLBA 4M7CA 2KCVA 2DYRE 2UVFA 3RIQA 3AG4E 2H6GA 3LJYA 2PM7A 3R9MA 4A3TA 3FP3A 1N11A 5JA4D 4A1SA 3J5QB 2EIME 3IV0A 3ASNE 5FT9A 4AVZA 2KBXA 1TYUA 1OCRE 2VSOE 4HS2A 3NOGD 4KMOA 2BTDA 1V54E 1BHEA 3CR3A 4B94A 1OOCA 3FULA 2VSXE 2CG2A 3JUIA 1E8XA 1AIRA 4GMRA 4KVOA 5AQBA 3P2BA 3ZN3A 3EQNA 3VMWA 5G04C 2CFUA 1BLXB 4A3VA 3CHSA 3L22A 2V0PA 5A7DB 4J7WA 3P1UA 4Y6WA 4YNDA 3FTZA 3CVYA 1JCSA 2QYUA 5EILA 1JPLA 1H2TC 3RAUA 3PUKA 3W9FA 3WWGA 2KM4A 1QA3A 3S7JA 2R02A 2C2LA 4GAAA 3AS8A 3B7UX 3ZU7B 4OZZA 4BX8A 1HZ4A 3D9NA 1N4QA 3LJ3A 1SA5A 4YVQC 1JCQA 3ZFWA 5AQ7A 1ELWA 2AW6A 5CMWA 4I6JA 3CQCB 2NTPA 3PE3A 3ASGA 2IY0C 1TNUA 2VGYA 4K0RA 4CGWA 3JX8A 4C0EA 3AAAC 2XEEA 2J49A 2L0TB 4CGVA 2BM6A 3WG7E 2VFOA 1DC2A 3CVVA 1H6KA 2O04A 4AJWA 3FDHA 2X85A 3EIQC 4KXKB 4ILGA 2GRPB 3JCKC 1LD7A 3GQ9A 2DYSE 4BEPA 2XQ0A 1TYVA 3FU5A 3BQOA 2MYOA 3JQ1A 4ZFHA 1IDKA 3P4GA 3CSTA 2ETCA 4WUYA 2AVPA 2NYJA 3Q9UC 4YDOA 3ZHEB 2PZIA 2X38A 2QY7A 1O5MA 3MKRA 3FUJA 4OAUC 3LY7A 4AY6A 2IQCA 3PRZA 2V5IA 4G24A 2BUGA 4FU3A 2WXGA 3FU0A 3RO2A 4U04A 4I2WA 3FUIA 3PZ2A 4ABNA 2WXLA 1H6OA 3LVRE 2UVEA 5BNWA 1WM5A 3QWWA 3O48A 1UJJA 2BM7A 3JUEA 4GTSA 4HI8A 4NK8A 2R05A 4PMHA 1PAQA 1D8EA 2LO6A 5FQ7A 4G23A 4F6RD 2KC7A 3FHEA 1KCDA 1BN8A 3V31A 4O6FA 1O8DA 2A4ZA 1QBQA 2L9BA 4JEHA 5CRUA 2HR2A 4HRLA 3U3WA 3LKUA 4XLEA 4GTTA 3OAWA 4OZYA 1DVPA 3D9HA 1JUQA 4YCQA 4HLLA 5B1BE 5HS0A 2XRZA 2MRIA 4PS7A 3T8KA 3AU5A 2HM8A 1OGOX 2B0RA 5FZSA 2P9NG 2NTQA 5ENSD 1FCHA 3UX4A 5LOZA 2P9LG 2F8XK 1X5BA 4RSYA 3SHFA 2Y1LE 2QFCA 3E30A 3CHOA 2KXPC 5FJYA 3HXCA 1Z3YA 5FQ4A 4FHJA 2Y4TA 4L7TA 3N6ZA 3SBTB 3UPVA 4G25A 1IB4A 4U8VD 4G8KA 4JHRA 2P2CP 1N9AA 2C0LA 4J6IA 2WQ7A 2BF0X 2XZTG 4DLOA 4AEZC 3MGBA 5AQAA 4XI9A 3Q73A 4J8EA 4FULA 2LAHA 2R2LA 3L08A 1N95A 4G26A 3DSXA 5KNHD 4DX6D 3UM1A 1LLZA 5HRYA 4MXNA 4DX7D 3UT7A 2XTYA 1IXVA 3ZPPA 1HF8A 1UOHA 4J0UA 1QRCA 4FLBA 3ZYQA 5EIBE 3E33A 2J8SD 4XN3A 4I1MA 4PS8A 3CHRA 3FTWA 3N90A 1QNFA 3L9TA 5CBNA 3FUFA 1WAO1 4HOQA 3G2WA 5JMND 3SYJA 3S7DA 1S70B 4K03A 2VSYA 3TWRA 5ENOD 4FJZA 3B95A 4KBQA 3IHVA 1YA0A 4HNAD 5FQ8A 4O1PA 4U07A 4BESA 3FTXA 5BXOA 4YEJA 3TWSA 2R59A 4U4BA 4PS3A 4XMYA 5D2MC 4X8QA 5J08A 3R7QA 2XTXA 5G04J 3MZLB 1O8IA 3ULEG 4EBAG 3ENEA 3B7RL 3MKQA 2J07A 2KATA 4XKCA 4I43A 3UW0A 4LERA 2DWZA 3NZSA 3W9GA 3K9IA 5ITZF 1N52A 3HHMA 4K5AB 2AXVA 2V8SE 5E76A 5BXUA 2IEJA 5KBAA 2BX6A 2PYGA 2O1DA 1H19A 1KPSB 2XHEA 2VBKA 3VMVA 3FUHA 1TNZA 3KS2A 4XLHA 3C5RA 3CVWA 1OWOA 1UN9A 2VGEA 4UI9K 3CKCA 3QKYA 5AQ9A 4UWHA 3Q4AB 2XPYA 1Z3XA 4OYSA 4NK6A 3FTUA 3B13A 3ONLA 2O0WA 1TYQG 4XONA 2KZTA 3MV2B 5D0OD 3AU4A 1RW2A 3PDNA 5BT1A 1KTWA 3D9PA 3NZUA 1QQ1A 1K1BA 2M63A 2XCCA 3IXEA 4I1AA 4BX9A 4DPRA 3MCXA 4FLHA 5ANLA 3HYMB 3ULYA 2YQ8A 2YUHA 3ZRHA 2OVBA 2ILRA 1O8HA 1UG3A 2ZGGA 2F0YA 2P9PG 4JW1A 2IF4A 3PS6A 4ATGA 1O1RA 1QA1A 1WXRA 2EILE 2CFZA 2BM5A 4RQIA 3Q7AA 5LCWJ 2V4LA 5ENNA 3LXUX 4D10C 4BETA 1GQ8A 4OAVB 1CZFA 4DI3A 4EZLA 4TUUA 1VBLA 1N4PA 2XPZA 4JD2G 2BKKB 1Z5SC 1DCQA 4AXHA 5EYLA 2R5SA 1KQ5A 1SA4A 4BY6A 1IHBA 2NZMA 4BWRA 2ETAA 2RFMA 1NZNA 5CCLA 1VDYA 2IO2C 2LAIA 4HLEA 2L6JA 3SO8A 5FIOA 1QCXA 3TJPA 1KLXA 4OJ6A 1Q2ZA 3LS8A 1LTXA 4KYOB 4L2LA 3SZ7A 5FQ6A 4BTAA 4CZ2D 4CDNA 3D9LA 1DCEA 5AAOA 3APDA 3SF4A 3GRHA 1EPUA 1TJFA 1ELRA 4KZCA 1O88A 2HE0A 4UUCA 4Z03A 4JA7A 3ZSCA 3ML8A 4EHMA 4YC5A 2QZAA 1MHQA 2VQ2A 3KSLA 5CECB 3RIBA 1O8FA 5G55A 4ANVA 2R17C 3U66A 2Z8GA 3GQAA 4NACA 3U9WA 4JPSA 3FFLA 1MJ0A 3UT4A 1WY6A 1H2VC 4GTRA 3GYZA 3NB2A 5ARFA 3JQ0A 4UQYA 4QQIA 2DBAA 4JC8A 1W3BA 3SFZA 3DPYA 1YCSB 4LCTA 1Z6TA 4U63A 3ZXPA 4XEIG 3C3RA 3PSSA 4V02C 1LM1A 4KT6B 3ESLA 2AJAA 5D66A 4RLYA 4B89A 3BH7B 1E8ZA 2X6YA 1MYOA 3ZYMA 2XT4A 5AJDA 2VFMA 4I9CA 4J8DA 5CEAA 3UINC 4IULA 5EDSA 3R7RA 1HG5A 4N3CA 3L17A 4DX2A 4GZCA 4YZ0A 3DWLG 4I17A 2GW1A 2J8IA 4G8LA 5BW8C 3DXMG 4XKWA 2EINE 4L23A 1SW6A 5EKQD 4TUMA 3BEEA 1OUVA 3G2VA 5C1DA 1BI8B 3DSWA 3CLJA 4OJLA 2IQ7A 3DEPA 4GPMA 2WXIA 2XGSA 2XRYA 2NTBA 5LFAA 3OXFA 2WXMA 3DSUA 2NXPA 4N3AA 2RKKA 1NHCA 4YDWA 2UY1B 4DX5D 3B7SA 1X81A 3JURA 4Q69A 3PE4A 3Q75A 4FJYA 4HOUA 1TNYA 3BU8A 3RU0A 5ANRA 1EA0A 3KD7A 4YDEA 2P9SG 4UI9C 2IONA 4WNFA
chains in the Genus database with same CATH topology
3PSZA 3SY2A 4YEIA 2QYUA 3SQVA 4YDTA 2XT4A 2J8KA 2XT2A 3NAWA 2XTYA 2XTXA 3PSSA 3DU1X 4YC5A 2QZAA 5DNSA 3NB2A 2O6WA 2XTWA 4YFOA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSZ A;  3SY2 A;  4YEI A;  2QYU A;  3SQV A;  4YDT A;  2XT4 A;  2J8K A;  2XT2 A;  3NAW A;  2XTY A;  2XTX A;  3PSS A;  3DU1 X;  4YC5 A;  2QZA A;  5DNS A;  3NB2 A;  2O6W A;  2XTW A;  4YFO A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 2F37 A;  3D9J A;  4JEU A;  3CK8 A;  3SD5 A;  1UW4 B;  3ZW3 A;  4JRA C;  3TXM A;  1EYH A;  4F3V A;  3TG5 A;  2RD0 A;  3CK9 A;  2VJI A;  3UT8 A;  1KCC A;  2X3M A;  1OWN A;  2E0I A;  4LEU A;  3O4Z A;  4A63 B;  1V55 E;  2VJ8 A;  5ENP D;  2VYI A;  1ZB1 A;  5FIN A;  4HOR A;  1K8F A;  4W8Q A;  5DBK A;  1JTA A;  1HE8 A;  1YYH A;  2NT9 A;  5T8I A;  1ZU2 A;  2V5Q C;  5HKP A;  3LY8 A;  3MYV A;  4GTV A;  1G3N B;  2YHE A;  2NSP A;  4I6E A;  3DRA A;  2WXO A;  3FY4 A;  1IKN D;  4YZX A;  5CCM A;  5IY5 E;  3PZ1 A;  2IO3 C;  4IYP A;  4HB5 A;  3L6A A;  3NQP A;  2DZN A;  2L6B A;  4XKB A;  4HQD A;  3ZIM A;  4N5C A;  4IRU A;  1BI7 B;  2PM6 A;  3KRG A;  3PET A;  5LX8 A;  3E4B A;  5FZQ A;  3BUA A;  4HWV A;  2W7Z A;  3ABK E;  4XI0 A;  2CG3 A;  1QQE A;  3EDT B;  4M3O A;  3EJN A;  3RK6 A;  5E75 A;  1BPO A;  5G2N A;  3SGH A;  5A23 A;  1A5E A;  1KZO A;  4AOF A;  1S0P A;  4CT4 A;  2CHW A;  1TNB A;  3UIP C;  4L2Y A;  1JRG A;  3D9I A;  4LUN U;  5CMY A;  3RO3 A;  3SI5 A;  3HIZ A;  1EF1 C;  3CVX A;  2PQN A;  3PSZ A;  4DJA A;  3SY2 A;  2ZIR A;  2FEZ A;  2OEW A;  4LG6 A;  3N71 A;  4XLA A;  1PC2 A;  4GYO A;  2V4H C;  4O1O A;  5KJK A;  1LF8 A;  5BV0 A;  4UWK A;  4C0M A;  3FUK A;  3DBS A;  3EUV A;  3PUJ A;  4I1O B;  3TWW A;  3AS5 A;  5AYW D;  2E2E A;  3SNX A;  1OXJ A;  1MX6 A;  2Y69 E;  5EID A;  1MX4 A;  1X0C A;  2CHZ A;  4QFV A;  1RMG A;  2X3H A;  4BSX A;  3EHQ A;  1OY3 D;  1O1S A;  5KNG A;  2VTB A;  2G0Y A;  3HXF A;  3OTN A;  1SVX A;  1HS6 A;  4N5Q A;  4OPW A;  1WDY A;  2XT2 A;  1K3Z D;  4NUR A;  4XNF A;  1AP7 A;  3IKO B;  4JL0 A;  4NIK A;  3QWV A;  3ZYK A;  2HO1 A;  3HVE B;  1FVF A;  2V5F A;  2QY1 A;  3T9K A;  4OVU A;  4K5B A;  5AAR A;  4EEC A;  2XTW A;  1RZ4 A;  4CCA A;  3U4T A;  4U0Z A;  4GTO A;  3FTV A;  3UTM A;  5EYP F;  3FH5 A;  4H7Y A;  2IOL A;  3AK5 A;  3T8M A;  5FWQ A;  5H7P A;  3FH7 A;  4BT9 A;  3QC1 A;  3T5V A;  3S7B A;  4OJO A;  2WQH A;  3J5P A;  1S64 A;  4HOS A;  3NBN B;  3RSE G;  3FY3 A;  1LD8 A;  2Y0B G;  2YHC A;  3LDZ A;  1BU9 A;  3ONK A;  2JAB A;  1O1T A;  5DNS A;  5EX3 A;  2X6X A;  3EHR A;  1XG2 A;  4C9B B;  4HRM B;  1HX8 A;  4C48 B;  2O0V A;  4OVV A;  3T5X A;  3ULQ A;  5JHA A;  4TXR A;  1NA3 A;  4YZA A;  2XGO A;  3OXL A;  2I1K A;  4EZK A;  3ZNG A;  3AG1 E;  2H6I A;  4GYW A;  2OOE A;  3CVU A;  4RVB A;  3ASD A;  3L54 A;  2KZT B;  3LYA A;  5ENR D;  3EQO A;  3CHM A;  2ODL A;  3RRU A;  4FHK A;  2XPI A;  4MBG A;  4AIF A;  2WXN A;  4GA0 A;  3UMV A;  3ZKJ A;  2XC1 A;  1N0Q A;  3QAR A;  2ZU6 B;  4XE0 A;  4UI9 J;  3UM2 A;  2L0I A;  3HXD A;  1MQS A;  4GU5 A;  4TRQ A;  3VLD A;  4UQX A;  5T3R A;  1IA5 A;  3V2O A;  5ENQ D;  4CT0 A;  3AG2 E;  1OFM A;  2WXF A;  3PZ3 A;  5CRV A;  1JCR A;  4Z05 A;  3URZ A;  2ZXW E;  3Q5M A;  2XEN A;  4APO A;  3DSV A;  1P5Q A;  2QYJ A;  1TYW A;  1OCC E;  1WMR A;  3F6Q A;  1MX2 A;  3CSF A;  2F8Y A;  1U3C A;  2X6F A;  3NOC D;  4IN3 B;  4KVM A;  4XX5 A;  3DU1 X;  3G2T A;  4XKV A;  4WWN A;  3EU5 A;  5JJT A;  4N2Q A;  4RG6 A;  4RG9 A;  2FO1 E;  1QYM A;  4LNB A;  3VTY A;  4Y6C A;  1HFA A;  3QJZ A;  4URK A;  2RFA A;  3HRA A;  3QOU A;  1A17 A;  1H0A A;  2OND A;  4U0U A;  3FH8 A;  3AJI A;  3KEA A;  1H6P A;  4XL9 A;  1QRB A;  3I4R B;  2CHX A;  3Q15 A;  3ML3 A;  3E32 A;  4TXQ A;  4ILH B;  4EZJ A;  2PNN A;  4ANW A;  3V2X A;  2DCP A;  4MLP A;  4JZY A;  1RU4 A;  3D9K A;  4MKT A;  4XLF A;  4N3B A;  4YEL A;  5G05 C;  4LNU D;  3ASF A;  3Q7F A;  3B7B A;  3DST A;  4WWP A;  2R03 A;  1XGW A;  2UWJ G;  4HFG A;  3U64 A;  4JXT A;  2P9K G;  5KJN A;  3TWT A;  2AWI A;  2YIN A;  5JJ6 A;  3CVQ A;  4GYY A;  4G1T A;  4ME2 A;  4DLQ A;  3LEW A;  4W9R A;  3PEU B;  4CYM D;  3T9G A;  1L5J A;  4GCO A;  4UWG A;  4XZ4 A;  1IDJ A;  1D8D A;  5ARG A;  2WXK A;  3E37 A;  4GZ5 A;  4PUC A;  2VGX A;  5BPP A;  2LXL A;  3CHP A;  3DSS A;  3ZYL A;  3TWV A;  3WXX A;  1MZC A;  3GZ1 A;  2INV A;  3G2U A;  1N0R A;  1FVH A;  2P58 C;  2X6K A;  4UWF A;  3ASO E;  4Q96 A;  5A6C A;  3UM3 A;  1NP7 A;  2XS1 A;  3GW4 A;  1PXZ A;  4HXI A;  1K1A A;  4KH3 A;  3HDX A;  5BUZ A;  2EIJ E;  1HG8 A;  4JVS A;  5C2Y A;  3VSV A;  1CLW A;  1N4S A;  2X6W A;  5JMC B;  3I4G A;  1HH8 A;  3PNL B;  3ESK A;  2INU A;  4LRZ A;  4GB9 A;  1OCO E;  1IYG A;  4A55 A;  3IHY A;  4GTP A;  2LNI A;  2BKG A;  4XN0 A;  2VBM A;  1QZ2 A;  3V30 A;  1OCZ E;  3PH0 C;  3BG0 B;  1IQU A;  2VFN A;  4I6G A;  2Y3A A;  5LP0 A;  1NA0 A;  3D9M A;  4TV3 A;  3PRE A;  4JB8 P;  3Q49 B;  3UQ3 A;  1N54 A;  1NL4 A;  3KEZ A;  2GRQ B;  1O8G A;  1SZ9 A;  4OM9 A;  4YEI A;  1D9S A;  1L1I A;  2A5U A;  4LSZ E;  4F53 A;  3VSU A;  3RJV A;  4R7L A;  3TL5 A;  2J9Q A;  1GW6 A;  2RG8 A;  2I9C A;  4LNG A;  2WB2 A;  4GTQ A;  4GZD A;  3QNK A;  3APF A;  3Q9N C;  1S63 A;  3ZEF A;  5CED B;  3PZD A;  4UQZ A;  4CEM A;  4EPZ A;  4AY5 A;  5EN5 D;  1HO8 A;  4XLC A;  4E6H A;  4AP2 A;  2IFU A;  2BED A;  3SFY A;  4N39 A;  3C3O A;  3CVN A;  1TN6 A;  3HXE A;  1HF2 A;  5AN8 A;  4L9P A;  4JHK A;  2IOU G;  1LLW A;  3ISM C;  1OWL A;  2XS8 A;  2DVW A;  1INZ A;  5EX0 A;  5AIJ A;  4I84 A;  3UUX A;  5T4Y A;  3FEY A;  3C98 A;  1OFD A;  2F3L A;  3ML9 A;  5AJL A;  4E85 A;  4CRW A;  1RWR A;  5HI7 A;  3EIJ A;  4BFR A;  1EE6 A;  3L82 A;  2VJJ A;  4XOT A;  4MR0 A;  3CEQ A;  4NRH B;  3JXI A;  2UY1 A;  4ZHB A;  3UKR G;  4N2S A;  1ZBP A;  2GRM A;  4PH4 B;  1JWG A;  2WMN A;  5KCM A;  5ENT D;  1QJV A;  2X6I A;  4U8H A;  3PNT B;  4BTB A;  2XCB A;  4A1G A;  1KZP A;  1YMP A;  1IHG A;  3B4N A;  5LCW C;  4Z68 A;  1TJC A;  2WM9 A;  4GA2 A;  1TSP A;  3FUE A;  5FZR A;  1TNO A;  4W8S A;  3TG4 A;  2KCL A;  2NT6 A;  2QXZ A;  4XOP A;  5CHE E;  2LUH A;  3TWU A;  4ANU A;  2OCC E;  2WXP A;  3UM0 A;  3X2Q E;  2H6F A;  3GZS A;  3SZE A;  3L16 A;  4ATZ D;  3FU6 A;  3TGO A;  2Y4U A;  1NI1 A;  4U0S A;  4XOR A;  1OWP A;  5FTP A;  5J90 A;  1Y8M A;  3GZ2 A;  4AVX A;  4FC8 A;  4AM9 A;  4HOT A;  1OFE A;  2FUL A;  5C1E A;  3S2A A;  2J09 A;  2NSZ A;  2J08 A;  1H80 A;  1B89 A;  1E96 B;  2GRL A;  4HBD A;  3LCA A;  4HVB A;  3RRN B;  3S7F A;  2PQR A;  1O8M A;  3LVQ E;  3IBE A;  1OWM A;  4C2L A;  3JXJ A;  4Q94 A;  3CVP A;  4K5C A;  4W8R A;  2IJG X;  4GMJ A;  2VTB B;  3ASH A;  3KSQ A;  4FP7 A;  1E90 A;  3SUC A;  2DIW A;  4GTM A;  4DUI A;  2I6H A;  2FO7 A;  4OJP A;  3QK0 A;  3MEK A;  1FT1 A;  4GZ6 A;  3B8Y A;  2J4B A;  3ZHE A;  4DK5 A;  1FPP A;  3NF1 A;  4OJ5 A;  1BD8 A;  3LPZ A;  3EU9 A;  5G05 J;  4WAF A;  3SBS A;  4B93 B;  3FUN A;  2EQX A;  3ZXS A;  3DXK G;  4I2Z A;  3MX3 A;  5CER B;  2BSP A;  2PYH A;  5D0Q D;  1E7U A;  1OT8 A;  3MA5 A;  2LSV A;  4ILI A;  3ZVV A;  1DBO A;  4WNG A;  1EZG A;  1PY1 A;  2QC9 A;  2XEV A;  1N94 A;  4MRU A;  4MS6 A;  1OFL A;  1TN7 A;  3AG3 E;  1SZA A;  2PEC A;  3APC A;  4BSZ B;  1O8K A;  1SQM A;  4ACK A;  2J8K A;  1UJK A;  4XQF A;  3ABL E;  3FEX A;  2B0O E;  2WXH A;  1EDU A;  2WVI A;  2DZO A;  2MOW A;  2ZGD A;  2WXQ A;  1O8E A;  1WG0 A;  1TN8 A;  1K4Z A;  3MKQ B;  2LXM A;  2LSU A;  2PL2 A;  4U95 D;  4U96 D;  4B8A A;  3BG1 B;  3TXN A;  1TEZ A;  3GQ7 A;  3KAE A;  2BM4 A;  3VST A;  2X6H A;  2J4D A;  3C72 A;  3CVL A;  1TYX A;  5B1A E;  2WQ6 A;  4BER A;  3HG0 D;  2WXJ A;  2FI7 A;  2JEK A;  2ETB A;  3HVE A;  2XEH A;  3QAQ A;  3LMW A;  4YDT A;  2GGF A;  2WMO A;  3I5P A;  4O60 A;  3OXG A;  4AV7 A;  4HI9 A;  3QWP A;  3LYC A;  3AS4 A;  1HU3 A;  5KJL A;  1K5C A;  3VTX A;  3CGH A;  3B7T A;  2VSN A;  3DPD A;  4Z06 A;  2VFQ A;  4F1S A;  4I9E A;  4EQF A;  3IEG A;  4XM3 A;  4BT8 A;  2EWE A;  2FBN A;  1QA2 A;  4EW9 A;  4J8F A;  3E34 A;  2QX3 A;  4WNE A;  3FUM A;  2OVF A;  1PE9 A;  3SFX A;  4ACL A;  1N4R A;  4GA1 A;  2WXR A;  1NFI E;  4FAD A;  2OV8 A;  2XZD G;  4NQ0 A;  1HXI A;  1O8L A;  3RRM B;  4B8C B;  4U49 A;  4JA9 A;  3L13 A;  2AXU A;  3UIO C;  1TR4 A;  2IU1 A;  5JJ7 A;  4JHJ A;  2Q7F A;  3ZGQ A;  2GRN B;  2EIK E;  2O17 A;  5AMV A;  4CDR A;  5CBO A;  5BV1 A;  4GPK A;  2VBE A;  3LJN A;  3VLE A;  1OGM X;  4YVO A;  1KT0 A;  2KCK A;  2P9I G;  4ANX A;  2X6J A;  2AXZ A;  5DIZ A;  3CQG B;  2YNQ A;  3Q79 A;  2I2O A;  3FTY A;  3RKV A;  3D9O A;  4H7X A;  3VLF A;  4G11 A;  2I1J A;  3Q78 A;  3D3M A;  3PZ4 A;  3PEV B;  3I3N A;  1ELK A;  4W8T A;  2P9U G;  2HYZ A;  5JHB A;  4WWO A;  3V79 K;  1AWC B;  3CHQ A;  3ABM E;  3QB2 A;  3NAW A;  3FWV A;  3C3Q A;  3UXG A;  1U2V G;  2B6C A;  5JLV C;  4FA6 A;  3LY9 A;  4J8Y A;  2IOS A;  1IQR A;  2NST A;  2WPV A;  3TH0 A;  4HRN A;  3JYS A;  1U3D A;  4YDY A;  1Y6I A;  2C0M A;  3GQ8 A;  5C1C A;  4KZ0 A;  4U7E B;  4GML A;  1HG2 A;  3TWX A;  2VGX B;  5KJM A;  5B3S E;  3FUD A;  2GRR B;  2GRO B;  3EHM A;  1H2U A;  4J8S A;  4CDM A;  1DBG A;  2A5E A;  3Q47 B;  4G2V A;  5HQ8 A;  1PLU A;  1K8K G;  4EBA A;  3CV0 A;  2O6W A;  4XR6 A;  2FF4 A;  4B0Z A;  2XGM A;  3DEO A;  4DX1 A;  3SQV A;  1FT2 A;  2ZIS A;  1E8Y A;  4DRX E;  2H6H A;  3CK7 A;  4DI4 A;  3TAX A;  3MV3 B;  4UWL A;  3H09 A;  4P29 A;  4APF A;  4GZ3 A;  2VFP A;  1DAB A;  3MJW A;  2OEV A;  3EHN A;  4GCN A;  3CKB A;  3UKU G;  3R9A B;  3FTS A;  3HXB A;  4F7A A;  1E7V A;  4PDX A;  1KT1 A;  1UN8 A;  4F1P A;  2NC9 A;  3B90 A;  3ZPJ A;  3QDN A;  5KWD A;  4WND A;  1XNF A;  3BH6 B;  4L1B A;  4U8Y D;  4TXP A;  1E8W A;  3CIA A;  5M72 A;  4YFO A;  1DNP A;  3UI2 A;  4URR A;  3TWQ A;  2MHK A;  3FU3 A;  1O8J A;  3PVL A;  5AEN A;  1JWF A;  4YZQ A;  3ZUV B;  4V3I A;  4XIF A;  3G2S A;  2JLB A;  4M7C A;  2KCV A;  2DYR E;  2UVF A;  3RIQ A;  3AG4 E;  2H6G A;  3LJY A;  2PM7 A;  3R9M A;  4A3T A;  3FP3 A;  1N11 A;  5JA4 D;  4A1S A;  3J5Q B;  2EIM E;  3IV0 A;  3ASN E;  5FT9 A;  4AVZ A;  2KBX A;  1TYU A;  1OCR E;  2VSO E;  4HS2 A;  3NOG D;  4KMO A;  2BTD A;  1V54 E;  1BHE A;  3CR3 A;  4B94 A;  1OOC A;  3FUL A;  2VSX E;  2CG2 A;  3JUI A;  1E8X A;  1AIR A;  4GMR A;  4KVO A;  5AQB A;  3P2B A;  3ZN3 A;  3EQN A;  3VMW A;  5G04 C;  2CFU A;  1BLX B;  4A3V A;  3CHS A;  3L22 A;  2V0P A;  5A7D B;  4J7W A;  3P1U A;  4Y6W A;  4YND A;  3FTZ A;  3CVY A;  1JCS A;  2QYU A;  5EIL A;  1JPL A;  1H2T C;  3RAU A;  3PUK A;  3W9F A;  3WWG A;  2KM4 A;  1QA3 A;  3S7J A;  2R02 A;  2C2L A;  4GAA A;  3AS8 A;  3B7U X;  3ZU7 B;  4OZZ A;  4BX8 A;  1HZ4 A;  3D9N A;  1N4Q A;  3LJ3 A;  1SA5 A;  4YVQ C;  1JCQ A;  3ZFW A;  5AQ7 A;  1ELW A;  2AW6 A;  5CMW A;  4I6J A;  3CQC B;  2NTP A;  3PE3 A;  3ASG A;  2IY0 C;  1TNU A;  2VGY A;  4K0R A;  4CGW A;  3JX8 A;  4C0E A;  3AAA C;  2XEE A;  2J49 A;  2L0T B;  4CGV A;  2BM6 A;  3WG7 E;  2VFO A;  1DC2 A;  3CVV A;  1H6K A;  2O04 A;  4AJW A;  3FDH A;  2X85 A;  3EIQ C;  4KXK B;  4ILG A;  2GRP B;  3JCK C;  1LD7 A;  3GQ9 A;  2DYS E;  4BEP A;  2XQ0 A;  1TYV A;  3FU5 A;  3BQO A;  2MYO A;  3JQ1 A;  4ZFH A;  1IDK A;  3P4G A;  3CST A;  2ETC A;  4WUY A;  2AVP A;  2NYJ A;  3Q9U C;  4YDO A;  3ZHE B;  2PZI A;  2X38 A;  2QY7 A;  1O5M A;  3MKR A;  3FUJ A;  4OAU C;  3LY7 A;  4AY6 A;  2IQC A;  3PRZ A;  2V5I A;  4G24 A;  2BUG A;  4FU3 A;  2WXG A;  3FU0 A;  3RO2 A;  4U04 A;  4I2W A;  3FUI A;  3PZ2 A;  4ABN A;  2WXL A;  1H6O A;  3LVR E;  2UVE A;  5BNW A;  1WM5 A;  3QWW A;  3O48 A;  1UJJ A;  2BM7 A;  3JUE A;  4GTS A;  4HI8 A;  4NK8 A;  2R05 A;  4PMH A;  1PAQ A;  1D8E A;  2LO6 A;  5FQ7 A;  4G23 A;  4F6R D;  2KC7 A;  3FHE A;  1KCD A;  1BN8 A;  3V31 A;  4O6F A;  1O8D A;  2A4Z A;  1QBQ A;  2L9B A;  4JEH A;  5CRU A;  2HR2 A;  4HRL A;  3U3W A;  3LKU A;  4XLE A;  4GTT A;  3OAW A;  4OZY A;  1DVP A;  3D9H A;  1JUQ A;  4YCQ A;  4HLL A;  5B1B E;  5HS0 A;  2XRZ A;  2MRI A;  4PS7 A;  3T8K A;  3AU5 A;  2HM8 A;  1OGO X;  2B0R A;  5FZS A;  2P9N G;  2NTQ A;  5ENS D;  1FCH A;  3UX4 A;  5LOZ A;  2P9L G;  2F8X K;  1X5B A;  4RSY A;  3SHF A;  2Y1L E;  2QFC A;  3E30 A;  3CHO A;  2KXP C;  5FJY A;  3HXC A;  1Z3Y A;  5FQ4 A;  4FHJ A;  2Y4T A;  4L7T A;  3N6Z A;  3SBT B;  3UPV A;  4G25 A;  1IB4 A;  4U8V D;  4G8K A;  4JHR A;  2P2C P;  1N9A A;  2C0L A;  4J6I A;  2WQ7 A;  2BF0 X;  2XZT G;  4DLO A;  4AEZ C;  3MGB A;  5AQA A;  4XI9 A;  3Q73 A;  4J8E A;  4FUL A;  2LAH A;  2R2L A;  3L08 A;  1N95 A;  4G26 A;  3DSX A;  5KNH D;  4DX6 D;  3UM1 A;  1LLZ A;  5HRY A;  4MXN A;  4DX7 D;  3UT7 A;  2XTY A;  1IXV A;  3ZPP A;  1HF8 A;  1UOH A;  4J0U A;  1QRC A;  4FLB A;  3ZYQ A;  5EIB E;  3E33 A;  2J8S D;  4XN3 A;  4I1M A;  4PS8 A;  3CHR A;  3FTW A;  3N90 A;  1QNF A;  3L9T A;  5CBN A;  3FUF A;  1WAO 1;  4HOQ A;  3G2W A;  5JMN D;  3SYJ A;  3S7D A;  1S70 B;  4K03 A;  2VSY A;  3TWR A;  5ENO D;  4FJZ A;  3B95 A;  4KBQ A;  3IHV A;  1YA0 A;  4HNA D;  5FQ8 A;  4O1P A;  4U07 A;  4BES A;  3FTX A;  5BXO A;  4YEJ A;  3TWS A;  2R59 A;  4U4B A;  4PS3 A;  4XMY A;  5D2M C;  4X8Q A;  5J08 A;  3R7Q A;  2XTX A;  5G04 J;  3MZL B;  1O8I A;  3ULE G;  4EBA G;  3ENE A;  3B7R L;  3MKQ A;  2J07 A;  2KAT A;  4XKC A;  4I43 A;  3UW0 A;  4LER A;  2DWZ A;  3NZS A;  3W9G A;  3K9I A;  5ITZ F;  1N52 A;  3HHM A;  4K5A B;  2AXV A;  2V8S E;  5E76 A;  5BXU A;  2IEJ A;  5KBA A;  2BX6 A;  2PYG A;  2O1D A;  1H19 A;  1KPS B;  2XHE A;  2VBK A;  3VMV A;  3FUH A;  1TNZ A;  3KS2 A;  4XLH A;  3C5R A;  3CVW A;  1OWO A;  1UN9 A;  2VGE A;  4UI9 K;  3CKC A;  3QKY A;  5AQ9 A;  4UWH A;  3Q4A B;  2XPY A;  1Z3X A;  4OYS A;  4NK6 A;  3FTU A;  3B13 A;  3ONL A;  2O0W A;  1TYQ G;  4XON A;  2KZT A;  3MV2 B;  5D0O D;  3AU4 A;  1RW2 A;  3PDN A;  5BT1 A;  1KTW A;  3D9P A;  3NZU A;  1QQ1 A;  1K1B A;  2M63 A;  2XCC A;  3IXE A;  4I1A A;  4BX9 A;  4DPR A;  3MCX A;  4FLH A;  5ANL A;  3HYM B;  3ULY A;  2YQ8 A;  2YUH A;  3ZRH A;  2OVB A;  2ILR A;  1O8H A;  1UG3 A;  2ZGG A;  2F0Y A;  2P9P G;  4JW1 A;  2IF4 A;  3PS6 A;  4ATG A;  1O1R A;  1QA1 A;  1WXR A;  2EIL E;  2CFZ A;  2BM5 A;  4RQI A;  3Q7A A;  5LCW J;  2V4L A;  5ENN A;  3LXU X;  4D10 C;  4BET A;  1GQ8 A;  4OAV B;  1CZF A;  4DI3 A;  4EZL A;  4TUU A;  1VBL A;  1N4P A;  2XPZ A;  4JD2 G;  2BKK B;  1Z5S C;  1DCQ A;  4AXH A;  5EYL A;  2R5S A;  1KQ5 A;  1SA4 A;  4BY6 A;  1IHB A;  2NZM A;  4BWR A;  2ETA A;  2RFM A;  1NZN A;  5CCL A;  1VDY A;  2IO2 C;  2LAI A;  4HLE A;  2L6J A;  3SO8 A;  5FIO A;  1QCX A;  3TJP A;  1KLX A;  4OJ6 A;  1Q2Z A;  3LS8 A;  1LTX A;  4KYO B;  4L2L A;  3SZ7 A;  5FQ6 A;  4BTA A;  4CZ2 D;  4CDN A;  3D9L A;  1DCE A;  5AAO A;  3APD A;  3SF4 A;  3GRH A;  1EPU A;  1TJF A;  1ELR A;  4KZC A;  1O88 A;  2HE0 A;  4UUC A;  4Z03 A;  4JA7 A;  3ZSC A;  3ML8 A;  4EHM A;  4YC5 A;  2QZA A;  1MHQ A;  2VQ2 A;  3KSL A;  5CEC B;  3RIB A;  1O8F A;  5G55 A;  4ANV A;  2R17 C;  3U66 A;  2Z8G A;  3GQA A;  4NAC A;  3U9W A;  4JPS A;  3FFL A;  1MJ0 A;  3UT4 A;  1WY6 A;  1H2V C;  4GTR A;  3GYZ A;  3NB2 A;  5ARF A;  3JQ0 A;  4UQY A;  4QQI A;  2DBA A;  4JC8 A;  1W3B A;  3SFZ A;  3DPY A;  1YCS B;  4LCT A;  1Z6T A;  4U63 A;  3ZXP A;  4XEI G;  3C3R A;  3PSS A;  4V02 C;  1LM1 A;  4KT6 B;  3ESL A;  2AJA A;  5D66 A;  4RLY A;  4B89 A;  3BH7 B;  1E8Z A;  2X6Y A;  1MYO A;  3ZYM A;  2XT4 A;  5AJD A;  2VFM A;  4I9C A;  4J8D A;  5CEA A;  3UIN C;  4IUL A;  5EDS A;  3R7R A;  1HG5 A;  4N3C A;  3L17 A;  4DX2 A;  4GZC A;  4YZ0 A;  3DWL G;  4I17 A;  2GW1 A;  2J8I A;  4G8L A;  5BW8 C;  3DXM G;  4XKW A;  2EIN E;  4L23 A;  1SW6 A;  5EKQ D;  4TUM A;  3BEE A;  1OUV A;  3G2V A;  5C1D A;  1BI8 B;  3DSW A;  3CLJ A;  4OJL A;  2IQ7 A;  3DEP A;  4GPM A;  2WXI A;  2XGS A;  2XRY A;  2NTB A;  5LFA A;  3OXF A;  2WXM A;  3DSU A;  2NXP A;  4N3A A;  2RKK A;  1NHC A;  4YDW A;  2UY1 B;  4DX5 D;  3B7S A;  1X81 A;  3JUR A;  4Q69 A;  3PE4 A;  3Q75 A;  4FJY A;  4HOU A;  1TNY A;  3BU8 A;  3RU0 A;  5ANR A;  1EA0 A;  3KD7 A;  4YDE A;  2P9S G;  4UI9 C;  2ION A;  4WNF A; 
#chains in the Genus database with same CATH homology
 3PSZ A;  3SY2 A;  4YEI A;  2QYU A;  3SQV A;  4YDT A;  2XT4 A;  2J8K A;  2XT2 A;  3NAW A;  2XTY A;  2XTX A;  3PSS A;  3DU1 X;  4YC5 A;  2QZA A;  5DNS A;  3NB2 A;  2O6W A;  2XTW A;  4YFO A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...