3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
2QYUA 2J8KA 4YCQA 4YEIA 3SY2A 4YC5A 2XTWA 2XTYA 2XT4A 2XTXA 2O6WA 4YFOA 4YDTA 3DU1X 3NB2A 3NAWA 3PSSA 2XT2A 3PSZA 3SQVA 5DNSA 2QZAA
chains in the Genus database with same CATH superfamily
3UT4A 2L9BA 3UM1A 4W9RA 1RW2A 1KTWA 2XPZA 4XLAA 1OFDA 5CMWA 2IY0C 1MZCA 2VSXE 1QBQA 2ZGDA 4XKCA 3RRMB 2NTBA 1KQ5A 4GTOA 3S7DA 4WNEA 2XZTG 1FPPA 5ENPD 5AMVA 2ETBA 1JRGA 1FT1A 1TNUA 2I2OA 4MS6A 4JVSA 4DI4A 3Q79A 1FVFA 3HXDA 3FY4A 3RK6A 2C0MA 1ELWA 4X8QA 5AARA 5AAOA 5FZSA 4GTQA 1N95A 1GQ8A 2FF4A 3EIJA 3E4BA 4Y6WA 4ZFHA 4M7CA 4EW9A 4GTSA 1TYWA 4Z05A 4GTPA 4RSYA 3T8MA 4YFOA 1RU4A 4BX8A 1DBGA 4XMYA 2AXUA 2B0OE 2VTBA 3ABME 3ZXPA 4B94A 2VFQA 3VTXA 3JUEA 1U2VG 1TYUA 3MYVA 3QB2A 4CZ2D 5CEDB 1PY1A 1BI7B 4U63A 1N4SA 3HXEA 5FQ7A 5ENOD 2XT4A 2O04A 1OXJA 4A3TA 4YZAA 3TWQA 4LCTA 3PZ3A 3LDZA 4U8YD 2ZISA 3P1UA 2V4HC 3AS4A 4N3BA 1BN8A 2XENA 4AXHA 4DK5A 1EDUA 4UWFA 4WAFA 2IQ7A 3MA5A 5ITZF 3NBNB 2VTBB 2XGMA 3FEXA 4UI9J 3R9MA 3ZHEA 1KT1A 4E6HA 3IEGA 3LY7A 4UQXA 3D3MA 2F0YA 2FO7A 1H0AA 4K0RA 4LERA 4BTAA 3TXNA 4ANVA 5LX8A 3CQGB 4XQFA 2XTXA 2I1KA 4M3OA 4CYMD 3ZIMA 4W8RA 1UJJA 4H7XA 4FADA 2WQ7A 2WPVA 1N4RA 3D9OA 3FULA 3ZHEB 2WQ6A 1TN6A 1X81A 2XHEA 4B93B 4N2SA 4IYPA 3RSEG 3LJYA 2RG8A 3FEYA 3AAAC 2L6JA 1E8ZA 4I2WA 3PNTB 4BX9A 1E8XA 4L2YA 3HXCA 1E8YA 4J8DA 5FZRA 1HX8A 2Y0BG 3NZSA 3OXGA 1TYVA 3LJ3A 4YDEA 3L9TA 4EZKA 3LXUX 1L5JA 5AIJA 3B7TA 3TWUA 3HHMA 3LS8A 3NF1A 1INZA 5EDSA 1X5BA 1KCCA 4YDOA 3TH0A 2MYOA 4N3AA 2WXJA 2VYIA 1H6OA 2DZNA 4UUCA 2MRIA 4UWKA 4XE0A 5CBNA 2EIKE 4YDYA 1HXIA 4BSZB 1JUQA 1UG3A 4KYOB 2DVWA 3E37A 4YZXA 1QYMA 4XKVA 4GYOA 3FUDA 2DZOA 3IKOB 2F3LA 2YNQA 2I9CA 1FCHA 1MJ0A 3B4NA 3CGHA 3ASHA 3TWSA 4C0EA 3CVUA 4Z03A 4PS8A 4WUYA 3RU0A 4PS7A 2LXLA 5BXUA 3FHEA 1HF2A 2R59A 4FULA 2B6CA 4DRXE 2PM7A 5EX0A 4G24A 4XOTA 3MKQA 4QFVA 2GGFA 4XI9A 1HFAA 2WXRA 3E33A 4N3CA 2JABA 4WWOA 3GW4A 3ISMC 4XZ4A 3LYAA 3PS6A 2FI7A 3O48A 3CVPA 2BEDA 1TNBA 5FWQA 3UIOC 2XCBA 2KBXA 1O8JA 2KATA 3JUIA 1TYXA 3G2UA 1HG8A 3LEWA 4GPKA 3CK7A 2LNIA 3VTYA 2IONA 2VSOE 3MKQB 5J08A 4G23A 2P9LG 4LNBA 4AIFA 4Z06A 5KNGA 3SFYA 1E7VA 3QWWA 4GCNA 1JCSA 1YMPA 2GRRB 4A1GA 4BT9A 1QA3A 1KZPA 2PYGA 3UIPC 3MX3A 2KCVA 1HO8A 5ANLA 4HI9A 1O1TA 1LM1A 1Q2ZA 4NK6A 2EIJE 2DYSE 2X38A 3CK8A 1PC2A 2KM4A 4IN3B 1OOCA 4XN0A 1OT8A 3HRAA 1N4PA 4E85A 3VLDA 4Z68A 1YCSB 3ESLA 3NZUA 5AQ9A 3NOCD 2CG3A 1O8LA 3ESKA 2NXPA 5CCMA 2R03A 2A5UA 4JA7A 4FP7A 4FHJA 2NZMA 5BPPA 1OFEA 2VFMA 1K1BA 1XG2A 3EHMA 4HOUA 4XR6A 2IQCA 4I84A 2OEVA 3DSSA 4CT4A 2X6XA 1NA0A 2NSTA 4OYSA 2PQRA 4CT0A 4UWGA 2ZGGA 5EN5D 2VGYA 4LUNU 3UUXA 4ATZD 2XRYA 4N39A 2HM8A 4A1SA 1UJKA 3FTUA 3DSXA 5G2NA 5HRYA 2CFZA 2X6IA 3L08A 3WXXA 3QKYA 4U0ZA 4DPRA 2VBKA 3RKVA 4DJAA 4DX7D 3KSQA 2JEKA 4JPSA 2VBEA 1AP7A 3AJIA 4JEUA 4RLYA 2PYHA 3QAQA 1OGOX 5KJLA 2IFUA 4ANXA 4GZ3A 5T3RA 4UQYA 2WB2A 1O8MA 1BPOA 3FUEA 3HIZA 2L0IA 4OZYA 4U49A 4OZZA 4LRZA 3TL5A 1A5EA 4KVMA 4B8CB 5EKQD 3ZEFA 3KS2A 3NAWA 4L23A 2DWZA 1TJFA 5BV0A 1RMGA 2VSYA 1QJVA 4TXQA 3PEUB 5G05J 4AY5A 1SW6A 4CRWA 2H6HA 1TEZA 3D9KA 1DVPA 5B1AE 1QA1A 2E2EA 1N54A 3SI5A 5C1CA 3DWLG 3PZ2A 4KXKB 4OVVA 5DIZA 2UVFA 4JD2G 4HI8A 4BWRA 2ETAA 2PNNA 3Q7FA 2GROB 2IU1A 1WDYA 2WXIA 3L17A 1IDKA 3SFXA 3VLFA 4N2QA 5ARFA 4B8AA 4ILHB 3ZYQA 5FINA 3ASFA 5G55A 2OVBA 5AJDA 1WY6A 3DSUA 1PLUA 4XNFA 1OWOA 4JHKA 2RFMA 5C1EA 2HYZA 2I1JA 4HRMB 4I9EA 4U0UA 1DBOA 5D2MC 1O8EA 2BX6A 1UN8A 3G2SA 4HFGA 4GMJA 1E8WA 1YA0A 4J0UA 3UTMA 2EINE 3FUHA 1SVXA 5CRUA 1H2TC 2WXPA 2P58C 1IHGA 1BU9A 3PEVB 3LKUA 1KLXA 4NK8A 3NOGD 2WXHA 1ZU2A 3Q4AB 2VSNA 3FY3A 4YVQC 3IBEA 2WMOA 4HRNA 3KEAA 2ZU6B 5LCWJ 3TWWA 4AY6A 2ZIRA 4CDRA 3FUNA 4JZYA 2BF0X 3UW0A 3JXJA 3MV2B 3PZ1A 3VMWA 1LF8A 3QC1A 1OFMA 4H7YA 4OVUA 2KCKA 2DCPA 2LO6A 3FUIA 4G1TA 3AU4A 3QARA 1G3NB 3GYZA 3V79K 1EA0A 1Z6TA 3G2WA 4GZ5A 5CCLA 5ENNA 1JWFA 4TV3A 1QZ2A 4W8TA 4FLHA 4JEHA 4QQIA 3FUMA 4ZHBA 3DPYA 4URKA 2XTYA 4UQZA 3GZ2A 3U4TA 2BM5A 4XIFA 2FBNA 1QQEA 4YDTA 1WMRA 2C2LA 2IO3C 2P9IG 2XRZA 3T9KA 4U7EB 4KZCA 3EHRA 3LVQE 2BM6A 3B90A 1CLWA 2XEEA 4XLCA 2A5EA 4ILIA 4CCAA 3SBTB 4GTVA 3S7BA 3IHVA 5LFAA 1QCXA 3ZSCA 1Z3XA 2CHWA 4HXIA 4I43A 3CVNA 1O8DA 3PNLB 5JJ7A 4U0SA 2VGEA 2KC7A 2A4ZA 2NT9A 3PSSA 4GYWA 2HR2A 2ONDA 1TNOA 3CVVA 1HH8A 4ACLA 3C3QA 2UY1A 4EZLA 2V0PA 3J5QB 2XTWA 3UXGA 5KBAA 3UX4A 1BI8B 3V2XA 1O1RA 3RO3A 5AYWD 4HBDA 1NHCA 4APFA 1HU3A 3FU0A 3B13A 1A17A 4UWHA 4ABNA 2V5QC 3ZU7B 4XX5A 4L7TA 3Q15A 4DX6D 4F1SA 4P29A 4AP2A 5D66A 4FLBA 3SZ7A 5IY5E 3ZYKA 5BUZA 4F6RD 3SD5A 2F8YA 5G04J 1E96B 1N94A 4TRQA 2UY1B 4XL9A 2VBMA 1S63A 4XLEA 3QNKA 2YINA 1UW4B 3KRGA 2Z8GA 4DI3A 1P5QA 4OPWA 2J8IA 3S2AA 1PAQA 3ASGA 3D9HA 4DLQA 1EF1C 4GCOA 4Y6CA 2INVA 2AVPA 3B95A 3PREA 3X2QE 3FH7A 4C2LA 4FA6A 1AIRA 2J07A 4JW1A 1JCQA 2P9SG 3CIAA 4HVBA 4C48B 1NL4A 1XGWA 4JB8P 4YVOA 3UKUG 5FJYA 3FH5A 3T5XA 3GZ1A 1E7UA 4GMRA 3FFLA 3AK5A 5HI7A 4XOPA 3APDA 3PZDA 2INUA 5DNSA 4D10C 3EDTB 4XI0A 4NIKA 2UWJG 4RQIA 2WXLA 3WWGA 3IXEA 5KJMA 5LP0A 2XQ0A 5AQBA 1W3BA 4YZ0A 4XEIG 4AOFA 3TG5A 3DXMG 1SZAA 3PE4A 3MV3B 3GRHA 4JHJA 3DEPA 2RD0A 4GU5A 5E76A 3LY8A 3R9AB 4JA9A 4IULA 2CHZA 5T8IA 4GTRA 3CSTA 3Q7AA 2IO2C 5JMND 1HE8A 2KXPC 3APFA 4EBAG 4B89A 3ZXSA 1U3CA 2V5FA 2O0VA 4O60A 1KPSB 2X3HA 3ABKE 4URRA 3UT8A 2QX3A 3EQNA 2QC9A 4I2ZA 2QYUA 4F3VA 1EZGA 3JCKC 4LNUD 2O17A 4XORA 3ONLA 4PDXA 1NFIE 3B7RL 4XKWA 4KMOA 3UPVA 2P9PG 4ANUA 4BFRA 2YHCA 4F53A 1MX6A 5KCMA 2XT2A 2VJ8A 2XZDG 4MBGA 4YZQA 3I4RB 5AJLA 2NSPA 2Y4TA 4B0ZA 4GTTA 3K9IA 3TWVA 5ENRD 1XNFA 5C1DA 3ULEG 4RG6A 2B0RA 1BD8A 3CHPA 1QRBA 4U4BA 2Q7FA 2R2LA 4XLFA 4N5QA 2RKKA 3Q73A 2J8SD 3MEKA 3UM0A 2L6BA 2I6HA 1H80A 4HLEA 5HS0A 4I6GA 1JPLA 2BSPA 2VJIA 2VFOA 3KSLA 1DCQA 1MYOA 4BY6A 3FDHA 3DXKG 4C0MA 3BQOA 3ZGQA 3UQ3A 2X6YA 4UI9C 3AG4E 1K4ZA 5EYLA 4J8YA 1OCCE 3EUVA 5A23A 5CBOA 3ZN3A 2DIWA 2X6FA 2X6KA 1OFLA 2BM4A 4GZ6A 4N5CA 2WXNA 3SGHA 5FQ8A 1QNFA 1TJCA 2XGOA 4KVOA 1H6PA 3P4GA 4HORA 1WAO1 2LAHA 1DCEA 4YCQA 3ZFWA 4FC8A 3RIBA 3DSTA 3TAXA 4EPZA 5CERB 2CHXA 3CVWA 3JYSA 3L22A 5JJ6A 3FU6A 1IHBA 4K5BA 1OCOE 4HOQA 4NRHB 1ZBPA 3G2TA 3BEEA 1BHEA 4RG9A 2X85A 2QZAA 4L2LA 3HXFA 1N9AA 4RVBA 2XC1A 3L82A 4PH4B 5AQAA 1K5CA 2KZTA 3UM2A 1S64A 2QYJA 3RO2A 2BKKB 1OWPA 3ML9A 2PZIA 2XEVA 2ETCA 1GW6A 3UT7A 3VSTA 4CDMA 1HG5A 3N90A 3U3WA 3RRUA 2WXQA 4OAVB 3SYJA 3BH7B 1IA5A 3D9PA 4G11A 2BTDA 2VQ2A 4O1OA 3L13A 3D9LA 4W8SA 3GQ7A 1OWMA 5EIDA 4JRAC 4BETA 3GQAA 2KZTB 5ENQD 2AWIA 4TXRA 4BT8A 3MJWA 2NC9A 3I3NA 3CVQA 4J7WA 1N11A 2DBAA 3F6QA 2G0YA 1QA2A 2LAIA 2VFPA 3WG7E 4U8HA 2EWEA 4ATGA 4XKBA 3JX8A 1KCDA 5FQ6A 4AEZC 5EILA 2OV8A 3OTNA 2NT6A 3LY9A 2HO1A 1N0QA 4YDWA 3CR3A 3P2BA 5E75A 3R7RA 3UKRG 3VLEA 1CZFA 4DUIA 2XCCA 2X6WA 2H6GA 1ELKA 3CQCB 4LNGA 1VBLA 4YEIA 2WQHA 3CKCA 1Z3YA 1TN7A 4HQDA 1YYHA 2RFAA 3V2OA 3LPZA 5FQ4A 3CVYA 4OJ5A 2Y69E 3ZRHA 2L0TB 4F7AA 4U07A 1O8GA 2WXMA 4DLOA 3HYMB 2AW6A 4A3VA 1B89A 4U04A 2XS8A 2BM7A 2XPYA 3ZW3A 1DABA 4XN3A 4WNGA 3HVEA 3CKBA 4JL0A 1OCRE 3SFZA 1O88A 3URZA 4GAAA 1TNZA 1VDYA 4LG6A 5B3SE 3E32A 2X3MA 3AS5A 3LVRE 1DNPA 3PVLA 1UOHA 4NURA 2X6JA 4GPMA 3EHNA 3S7FA 3BG1B 3DBSA 4MXNA 3E30A 2R05A 4W8QA 4EHMA 2GRQB 3HVEB 3SQVA 3FUJA 2Y4UA 3DSVA 3RAUA 3R7QA 3PE3A 1L1IA 4V02C 2DYRE 2P9NG 4BERA 4MR0A 3CHQA 4Q69A 4MRUA 1SA4A 2E0IA 4I1MA 1HF8A 1WG0A 4CGWA 3C3OA 2BKGA 3C3RA 1RWRA 1D8EA 4TUMA 4HS2A 2PL2A 3DPDA 3SY2A 4K03A 3CVXA 1V54E 2WXGA 3JQ1A 3IV0A 4OJOA 4GA1A 2QFCA 3LMWA 3CHOA 4JXTA 1IYGA 3ONKA 4KZ0A 3LJNA 3BUAA 2R5SA 1QRCA 3DSWA 4J8FA 4EZJA 3Q9NC 1IXVA 4GYYA 4GB9A 4C9BB 1WXRA 5BW8C 1H19A 4YELA 2V8SE 2MHKA 3UMVA 4K5AB 3SBSA 3ENEA 3QWPA 3ZPJA 1IB4A 3Q78A 3AG3E 3UINC 4Q96A 3C5RA 4JHRA 4G2VA 1FT2A 2J4DA 2WVIA 3N71A 2V4LA 4V3IA 2EQXA 1EPUA 2Y3AA 3V30A 2XPIA 3B7BA 2LSVA 3PZ4A 2NTQA 3OAWA 2R02A 3CVLA 4J8SA 4HRLA 1WM5A 2ODLA 1SZ9A 3KEZA 4DX5D 5HKPA 3PSZA 3MGBA 3D9JA 3CHRA 2WM9A 5JLVC 3FTWA 4GZCA 3CLJA 1K8KG 1O8FA 3RJVA 3BH6B 3T9GA 1H6KA 4OM9A 5G05C 1MX4A 2IOUG 2GW1A 1K1AA 4YNDA 5ARGA 3G2VA 3CV0A 1TN8A 3EQOA 4FU3A 2ZXWE 3TXMA 4JC8A 3VSVA 2ILRA 4PUCA 3EU9A 3QK0A 3LCAA 2KCLA 3NQPA 3U9WA 3L16A 1IQRA 3GZSA 2QY1A 2OVFA 1JCRA 2CG2A 5BT1A 2OOEA 1E90A 4G8LA 2NSZA 3MZLB 5ANRA 4DX2A 3ULYA 4ANWA 5CRVA 4A55A 5JMCB 3FTVA 5FIOA 4HLLA 2H6IA 3Q75A 4G8KA 3QDNA 1EYHA 2O0WA 3FH8A 3GQ9A 2R17C 1H2UA 2WXKA 4I1AA 4GTMA 3ABLE 1O8KA 5D0QD 4F1PA 5T4YA 2JLBA 1TNYA 3NB2A 4Q94A 2NYJA 3FTXA 5BXOA 3JXIA 5JJTA 3D9MA 3ZYLA 1LD8A 2Y1LE 1NZNA 4GA2A 1DC2A 1AWCB 5CHEE 4WNFA 2MOWA 3B7SA 5LCWC 3RIQA 1Y6IA 3AG1E 4GZDA 3CSFA 1Z5SC 5JHBA 4HOSA 5A6CA 1H2VC 3PDNA 5H7PA 4KBQA 3TWRA 4FJZA 2EIME 2EILE 3U66A 2IF4A 2AXVA 3FP3A 1K8FA 5KJNA 3SZEA 1NA3A 3SHFA 3FTYA 3EIQC 3JQ0A 5KWDA 2GRNB 3ZVVA 3CK9A 3ZYMA 2GRPB 2LUHA 3QJZA 1O5MA 4I1OB 2QY7A 3PETA 2H6FA 4L9PA 3ZPPA 3ML3A 1OUVA 2GRLA 1D8DA 1SQMA 3HXBA 1NI1A 3Q9UC 3TWXA 4NACA 5LOZA 4TXPA 5CMYA 2O6WA 2W7ZA 3TGOA 2J09A 4J8EA 4PS3A 4IRUA 4LSZE 3EJNA 4LEUA 3UI2A 4MLPA 4CGVA 1Y8MA 1O1SA 2C0LA 2VFNA 2WMNA 1TYQG 3FTSA 4ME2A 3I4GA 2OEWA 4GA0A 4AVXA 3C98A 1PXZA 3JURA 5CECB 2J9QA 4HOTA 1PE9A 3TG4A 2V5IA 4BEPA 4AJWA 4U96D 5AN8A 2IOLA 2XEHA 4G26A 5CEAA 1N4QA 1TSPA 1JWGA 4YC5A 1O8HA 3L54A 4G25A 2J08A 2FO1E 3MCXA 1OY3D 1OWNA 3CHMA 2M63A 1HZ4A 4I6EA 3UM3A 3DU1X 4CDNA 3FTZA 3EU5A 4WWPA 4KT6B 4U8VD 3ZNGA 3S7JA 4EECA 3T5VA 4OJ6A 2LXMA 3B7UX 5B1BE 3T8KA 5BV1A 3D9NA 5D0OD 1IDJA 1LLWA 1RZ4A 5G04C 3L6AA 4HNAD 2PM6A 1UN9A 4WNDA 4OAUC 1S70B 1HG2A 4WWNA 1KT0A 4CEMA 4FHKA 3V31A 5JA4D 5EX3A 2LSUA 1KZOA 4NQ0A 2PQNA 2VGXA 3O4ZA 2P9KG 4J6IA 2O1DA 3SF4A 3SO8A 2P2CP 5KNHD 4OJPA 3MKRA 3LYCA 2XGSA 4AVZA 3PH0C 3J5PA 3FUKA 1N52A 1S0PA 3ASOE 2IEJA 1X0CA 2NTPA 5M72A 2YUHA 2GRMA 3DEOA 4L1BA 4BESA 4XM3A 4AV7A 3Q47B 3HG0D 1N0RA 2J4BA 3ZUVB 1ELRA 3ASDA 3Q49B 4HB5A 4OJLA 3IHYA 3PUJA 1EE6A 4XLHA 2VGXB 3FU3A 1OCZE 2FEZA 1V55E 3VMVA 4U95D 2F37A 3FWVA 3VSUA 3ULQA 3CHSA 3GQ8A 3APCA 3FU5A 3EHQA 3KD7A 1OGMX 5EYPF 1ZB1A 4I6JA 1QQ1A 2PECA 4ACKA 4YEJA 5BNWA 3W9FA 5AENA 5J90A 4K5CA 1U3DA 4O6FA 2IJGX 4FJYA 3CEQA 3AG2E 2OCCE 5DBKA 4GMLA 3RRNB 3PRZA 3TJPA 2CFUA 2YHEA 3KAEA 1IKND 2AJAA 2P9UG 3OXLA 5A7DB 2WXOA 3H09A 1IQUA 2HE0A 5HQ8A 4XONA 4HWVA 3I5PA 5FTPA 2J49A 2IOSA 2XS1A 3W9GA 4MKTA 1TR4A 5AQ7A 5FT9A 4R7LA 3Q5MA 1BLXB 4UI9K 3QOUA 2X6HA 1LD7A 1MQSA 1JTAA 3AS8A 2QXZA 3U64A 1LLZA 4BSXA 3SNXA 4UWLA 4I9CA 3B8YA 5FZQA 3PUKA 4EBAA 4I17A 3HDXA 3QWVA 1SA5A 2WXFA 3ASNE 5KJKA 3DRAA 4DX1A 2VJJA 1HS6A 1LTXA 3C72A 3D9IA 4BTBA 5EIBE 5ENTD 4PMHA 2AXZA 4KH3A 3SUCA 4TUUA 5ENSD 1K3ZD 1O8IA 4ILGA 5C2YA 1NP7A 4O1PA 2J8KA 3FUFA 1FVHA 1D9SA 4A63B 1MX2A 4EQFA 4AM9A 2YQ8A 2BUGA 3AU5A 1OWLA 3E34A 3ML8A 3TWTA 3OXFA 3BU8A 3N6ZA 5JHAA 2FULA 3BG0B 2F8XK 3ZKJA 1MHQA 2UVEA 4APOA
chains in the Genus database with same CATH topology
2QYUA 2J8KA 4YCQA 4YEIA 3SY2A 4YC5A 2XTWA 2XTYA 2XT4A 2XTXA 2O6WA 4YFOA 4YDTA 3DU1X 3NB2A 3NAWA 3PSSA 2XT2A 3PSZA 3SQVA 5DNSA 2QZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYU A;  2J8K A;  4YCQ A;  4YEI A;  3SY2 A;  4YC5 A;  2XTW A;  2XTY A;  2XT4 A;  2XTX A;  2O6W A;  4YFO A;  4YDT A;  3DU1 X;  3NB2 A;  3NAW A;  3PSS A;  2XT2 A;  3PSZ A;  3SQV A;  5DNS A;  2QZA A; 
#chains in the Genus database with same CATH topology
 3UT4 A;  2L9B A;  3UM1 A;  4W9R A;  1RW2 A;  1KTW A;  2XPZ A;  4XLA A;  1OFD A;  5CMW A;  2IY0 C;  1MZC A;  2VSX E;  1QBQ A;  2ZGD A;  4XKC A;  3RRM B;  2NTB A;  1KQ5 A;  4GTO A;  3S7D A;  4WNE A;  2XZT G;  1FPP A;  5ENP D;  5AMV A;  2ETB A;  1JRG A;  1FT1 A;  1TNU A;  2I2O A;  4MS6 A;  4JVS A;  4DI4 A;  3Q79 A;  1FVF A;  3HXD A;  3FY4 A;  3RK6 A;  2C0M A;  1ELW A;  4X8Q A;  5AAR A;  5AAO A;  5FZS A;  4GTQ A;  1N95 A;  1GQ8 A;  2FF4 A;  3EIJ A;  3E4B A;  4Y6W A;  4ZFH A;  4M7C A;  4EW9 A;  4GTS A;  1TYW A;  4Z05 A;  4GTP A;  4RSY A;  3T8M A;  4YFO A;  1RU4 A;  4BX8 A;  1DBG A;  4XMY A;  2AXU A;  2B0O E;  2VTB A;  3ABM E;  3ZXP A;  4B94 A;  2VFQ A;  3VTX A;  3JUE A;  1U2V G;  1TYU A;  3MYV A;  3QB2 A;  4CZ2 D;  5CED B;  1PY1 A;  1BI7 B;  4U63 A;  1N4S A;  3HXE A;  5FQ7 A;  5ENO D;  2XT4 A;  2O04 A;  1OXJ A;  4A3T A;  4YZA A;  3TWQ A;  4LCT A;  3PZ3 A;  3LDZ A;  4U8Y D;  2ZIS A;  3P1U A;  2V4H C;  3AS4 A;  4N3B A;  1BN8 A;  2XEN A;  4AXH A;  4DK5 A;  1EDU A;  4UWF A;  4WAF A;  2IQ7 A;  3MA5 A;  5ITZ F;  3NBN B;  2VTB B;  2XGM A;  3FEX A;  4UI9 J;  3R9M A;  3ZHE A;  1KT1 A;  4E6H A;  3IEG A;  3LY7 A;  4UQX A;  3D3M A;  2F0Y A;  2FO7 A;  1H0A A;  4K0R A;  4LER A;  4BTA A;  3TXN A;  4ANV A;  5LX8 A;  3CQG B;  4XQF A;  2XTX A;  2I1K A;  4M3O A;  4CYM D;  3ZIM A;  4W8R A;  1UJJ A;  4H7X A;  4FAD A;  2WQ7 A;  2WPV A;  1N4R A;  3D9O A;  3FUL A;  3ZHE B;  2WQ6 A;  1TN6 A;  1X81 A;  2XHE A;  4B93 B;  4N2S A;  4IYP A;  3RSE G;  3LJY A;  2RG8 A;  3FEY A;  3AAA C;  2L6J A;  1E8Z A;  4I2W A;  3PNT B;  4BX9 A;  1E8X A;  4L2Y A;  3HXC A;  1E8Y A;  4J8D A;  5FZR A;  1HX8 A;  2Y0B G;  3NZS A;  3OXG A;  1TYV A;  3LJ3 A;  4YDE A;  3L9T A;  4EZK A;  3LXU X;  1L5J A;  5AIJ A;  3B7T A;  3TWU A;  3HHM A;  3LS8 A;  3NF1 A;  1INZ A;  5EDS A;  1X5B A;  1KCC A;  4YDO A;  3TH0 A;  2MYO A;  4N3A A;  2WXJ A;  2VYI A;  1H6O A;  2DZN A;  4UUC A;  2MRI A;  4UWK A;  4XE0 A;  5CBN A;  2EIK E;  4YDY A;  1HXI A;  4BSZ B;  1JUQ A;  1UG3 A;  4KYO B;  2DVW A;  3E37 A;  4YZX A;  1QYM A;  4XKV A;  4GYO A;  3FUD A;  2DZO A;  3IKO B;  2F3L A;  2YNQ A;  2I9C A;  1FCH A;  1MJ0 A;  3B4N A;  3CGH A;  3ASH A;  3TWS A;  4C0E A;  3CVU A;  4Z03 A;  4PS8 A;  4WUY A;  3RU0 A;  4PS7 A;  2LXL A;  5BXU A;  3FHE A;  1HF2 A;  2R59 A;  4FUL A;  2B6C A;  4DRX E;  2PM7 A;  5EX0 A;  4G24 A;  4XOT A;  3MKQ A;  4QFV A;  2GGF A;  4XI9 A;  1HFA A;  2WXR A;  3E33 A;  4N3C A;  2JAB A;  4WWO A;  3GW4 A;  3ISM C;  4XZ4 A;  3LYA A;  3PS6 A;  2FI7 A;  3O48 A;  3CVP A;  2BED A;  1TNB A;  5FWQ A;  3UIO C;  2XCB A;  2KBX A;  1O8J A;  2KAT A;  3JUI A;  1TYX A;  3G2U A;  1HG8 A;  3LEW A;  4GPK A;  3CK7 A;  2LNI A;  3VTY A;  2ION A;  2VSO E;  3MKQ B;  5J08 A;  4G23 A;  2P9L G;  4LNB A;  4AIF A;  4Z06 A;  5KNG A;  3SFY A;  1E7V A;  3QWW A;  4GCN A;  1JCS A;  1YMP A;  2GRR B;  4A1G A;  4BT9 A;  1QA3 A;  1KZP A;  2PYG A;  3UIP C;  3MX3 A;  2KCV A;  1HO8 A;  5ANL A;  4HI9 A;  1O1T A;  1LM1 A;  1Q2Z A;  4NK6 A;  2EIJ E;  2DYS E;  2X38 A;  3CK8 A;  1PC2 A;  2KM4 A;  4IN3 B;  1OOC A;  4XN0 A;  1OT8 A;  3HRA A;  1N4P A;  4E85 A;  3VLD A;  4Z68 A;  1YCS B;  3ESL A;  3NZU A;  5AQ9 A;  3NOC D;  2CG3 A;  1O8L A;  3ESK A;  2NXP A;  5CCM A;  2R03 A;  2A5U A;  4JA7 A;  4FP7 A;  4FHJ A;  2NZM A;  5BPP A;  1OFE A;  2VFM A;  1K1B A;  1XG2 A;  3EHM A;  4HOU A;  4XR6 A;  2IQC A;  4I84 A;  2OEV A;  3DSS A;  4CT4 A;  2X6X A;  1NA0 A;  2NST A;  4OYS A;  2PQR A;  4CT0 A;  4UWG A;  2ZGG A;  5EN5 D;  2VGY A;  4LUN U;  3UUX A;  4ATZ D;  2XRY A;  4N39 A;  2HM8 A;  4A1S A;  1UJK A;  3FTU A;  3DSX A;  5G2N A;  5HRY A;  2CFZ A;  2X6I A;  3L08 A;  3WXX A;  3QKY A;  4U0Z A;  4DPR A;  2VBK A;  3RKV A;  4DJA A;  4DX7 D;  3KSQ A;  2JEK A;  4JPS A;  2VBE A;  1AP7 A;  3AJI A;  4JEU A;  4RLY A;  2PYH A;  3QAQ A;  1OGO X;  5KJL A;  2IFU A;  4ANX A;  4GZ3 A;  5T3R A;  4UQY A;  2WB2 A;  1O8M A;  1BPO A;  3FUE A;  3HIZ A;  2L0I A;  4OZY A;  4U49 A;  4OZZ A;  4LRZ A;  3TL5 A;  1A5E A;  4KVM A;  4B8C B;  5EKQ D;  3ZEF A;  3KS2 A;  3NAW A;  4L23 A;  2DWZ A;  1TJF A;  5BV0 A;  1RMG A;  2VSY A;  1QJV A;  4TXQ A;  3PEU B;  5G05 J;  4AY5 A;  1SW6 A;  4CRW A;  2H6H A;  1TEZ A;  3D9K A;  1DVP A;  5B1A E;  1QA1 A;  2E2E A;  1N54 A;  3SI5 A;  5C1C A;  3DWL G;  3PZ2 A;  4KXK B;  4OVV A;  5DIZ A;  2UVF A;  4JD2 G;  4HI8 A;  4BWR A;  2ETA A;  2PNN A;  3Q7F A;  2GRO B;  2IU1 A;  1WDY A;  2WXI A;  3L17 A;  1IDK A;  3SFX A;  3VLF A;  4N2Q A;  5ARF A;  4B8A A;  4ILH B;  3ZYQ A;  5FIN A;  3ASF A;  5G55 A;  2OVB A;  5AJD A;  1WY6 A;  3DSU A;  1PLU A;  4XNF A;  1OWO A;  4JHK A;  2RFM A;  5C1E A;  2HYZ A;  2I1J A;  4HRM B;  4I9E A;  4U0U A;  1DBO A;  5D2M C;  1O8E A;  2BX6 A;  1UN8 A;  3G2S A;  4HFG A;  4GMJ A;  1E8W A;  1YA0 A;  4J0U A;  3UTM A;  2EIN E;  3FUH A;  1SVX A;  5CRU A;  1H2T C;  2WXP A;  2P58 C;  1IHG A;  1BU9 A;  3PEV B;  3LKU A;  1KLX A;  4NK8 A;  3NOG D;  2WXH A;  1ZU2 A;  3Q4A B;  2VSN A;  3FY3 A;  4YVQ C;  3IBE A;  2WMO A;  4HRN A;  3KEA A;  2ZU6 B;  5LCW J;  3TWW A;  4AY6 A;  2ZIR A;  4CDR A;  3FUN A;  4JZY A;  2BF0 X;  3UW0 A;  3JXJ A;  3MV2 B;  3PZ1 A;  3VMW A;  1LF8 A;  3QC1 A;  1OFM A;  4H7Y A;  4OVU A;  2KCK A;  2DCP A;  2LO6 A;  3FUI A;  4G1T A;  3AU4 A;  3QAR A;  1G3N B;  3GYZ A;  3V79 K;  1EA0 A;  1Z6T A;  3G2W A;  4GZ5 A;  5CCL A;  5ENN A;  1JWF A;  4TV3 A;  1QZ2 A;  4W8T A;  4FLH A;  4JEH A;  4QQI A;  3FUM A;  4ZHB A;  3DPY A;  4URK A;  2XTY A;  4UQZ A;  3GZ2 A;  3U4T A;  2BM5 A;  4XIF A;  2FBN A;  1QQE A;  4YDT A;  1WMR A;  2C2L A;  2IO3 C;  2P9I G;  2XRZ A;  3T9K A;  4U7E B;  4KZC A;  3EHR A;  3LVQ E;  2BM6 A;  3B90 A;  1CLW A;  2XEE A;  4XLC A;  2A5E A;  4ILI A;  4CCA A;  3SBT B;  4GTV A;  3S7B A;  3IHV A;  5LFA A;  1QCX A;  3ZSC A;  1Z3X A;  2CHW A;  4HXI A;  4I43 A;  3CVN A;  1O8D A;  3PNL B;  5JJ7 A;  4U0S A;  2VGE A;  2KC7 A;  2A4Z A;  2NT9 A;  3PSS A;  4GYW A;  2HR2 A;  2OND A;  1TNO A;  3CVV A;  1HH8 A;  4ACL A;  3C3Q A;  2UY1 A;  4EZL A;  2V0P A;  3J5Q B;  2XTW A;  3UXG A;  5KBA A;  3UX4 A;  1BI8 B;  3V2X A;  1O1R A;  3RO3 A;  5AYW D;  4HBD A;  1NHC A;  4APF A;  1HU3 A;  3FU0 A;  3B13 A;  1A17 A;  4UWH A;  4ABN A;  2V5Q C;  3ZU7 B;  4XX5 A;  4L7T A;  3Q15 A;  4DX6 D;  4F1S A;  4P29 A;  4AP2 A;  5D66 A;  4FLB A;  3SZ7 A;  5IY5 E;  3ZYK A;  5BUZ A;  4F6R D;  3SD5 A;  2F8Y A;  5G04 J;  1E96 B;  1N94 A;  4TRQ A;  2UY1 B;  4XL9 A;  2VBM A;  1S63 A;  4XLE A;  3QNK A;  2YIN A;  1UW4 B;  3KRG A;  2Z8G A;  4DI3 A;  1P5Q A;  4OPW A;  2J8I A;  3S2A A;  1PAQ A;  3ASG A;  3D9H A;  4DLQ A;  1EF1 C;  4GCO A;  4Y6C A;  2INV A;  2AVP A;  3B95 A;  3PRE A;  3X2Q E;  3FH7 A;  4C2L A;  4FA6 A;  1AIR A;  2J07 A;  4JW1 A;  1JCQ A;  2P9S G;  3CIA A;  4HVB A;  4C48 B;  1NL4 A;  1XGW A;  4JB8 P;  4YVO A;  3UKU G;  5FJY A;  3FH5 A;  3T5X A;  3GZ1 A;  1E7U A;  4GMR A;  3FFL A;  3AK5 A;  5HI7 A;  4XOP A;  3APD A;  3PZD A;  2INU A;  5DNS A;  4D10 C;  3EDT B;  4XI0 A;  4NIK A;  2UWJ G;  4RQI A;  2WXL A;  3WWG A;  3IXE A;  5KJM A;  5LP0 A;  2XQ0 A;  5AQB A;  1W3B A;  4YZ0 A;  4XEI G;  4AOF A;  3TG5 A;  3DXM G;  1SZA A;  3PE4 A;  3MV3 B;  3GRH A;  4JHJ A;  3DEP A;  2RD0 A;  4GU5 A;  5E76 A;  3LY8 A;  3R9A B;  4JA9 A;  4IUL A;  2CHZ A;  5T8I A;  4GTR A;  3CST A;  3Q7A A;  2IO2 C;  5JMN D;  1HE8 A;  2KXP C;  3APF A;  4EBA G;  4B89 A;  3ZXS A;  1U3C A;  2V5F A;  2O0V A;  4O60 A;  1KPS B;  2X3H A;  3ABK E;  4URR A;  3UT8 A;  2QX3 A;  3EQN A;  2QC9 A;  4I2Z A;  2QYU A;  4F3V A;  1EZG A;  3JCK C;  4LNU D;  2O17 A;  4XOR A;  3ONL A;  4PDX A;  1NFI E;  3B7R L;  4XKW A;  4KMO A;  3UPV A;  2P9P G;  4ANU A;  4BFR A;  2YHC A;  4F53 A;  1MX6 A;  5KCM A;  2XT2 A;  2VJ8 A;  2XZD G;  4MBG A;  4YZQ A;  3I4R B;  5AJL A;  2NSP A;  2Y4T A;  4B0Z A;  4GTT A;  3K9I A;  3TWV A;  5ENR D;  1XNF A;  5C1D A;  3ULE G;  4RG6 A;  2B0R A;  1BD8 A;  3CHP A;  1QRB A;  4U4B A;  2Q7F A;  2R2L A;  4XLF A;  4N5Q A;  2RKK A;  3Q73 A;  2J8S D;  3MEK A;  3UM0 A;  2L6B A;  2I6H A;  1H80 A;  4HLE A;  5HS0 A;  4I6G A;  1JPL A;  2BSP A;  2VJI A;  2VFO A;  3KSL A;  1DCQ A;  1MYO A;  4BY6 A;  3FDH A;  3DXK G;  4C0M A;  3BQO A;  3ZGQ A;  3UQ3 A;  2X6Y A;  4UI9 C;  3AG4 E;  1K4Z A;  5EYL A;  4J8Y A;  1OCC E;  3EUV A;  5A23 A;  5CBO A;  3ZN3 A;  2DIW A;  2X6F A;  2X6K A;  1OFL A;  2BM4 A;  4GZ6 A;  4N5C A;  2WXN A;  3SGH A;  5FQ8 A;  1QNF A;  1TJC A;  2XGO A;  4KVO A;  1H6P A;  3P4G A;  4HOR A;  1WAO 1;  2LAH A;  1DCE A;  4YCQ A;  3ZFW A;  4FC8 A;  3RIB A;  3DST A;  3TAX A;  4EPZ A;  5CER B;  2CHX A;  3CVW A;  3JYS A;  3L22 A;  5JJ6 A;  3FU6 A;  1IHB A;  4K5B A;  1OCO E;  4HOQ A;  4NRH B;  1ZBP A;  3G2T A;  3BEE A;  1BHE A;  4RG9 A;  2X85 A;  2QZA A;  4L2L A;  3HXF A;  1N9A A;  4RVB A;  2XC1 A;  3L82 A;  4PH4 B;  5AQA A;  1K5C A;  2KZT A;  3UM2 A;  1S64 A;  2QYJ A;  3RO2 A;  2BKK B;  1OWP A;  3ML9 A;  2PZI A;  2XEV A;  2ETC A;  1GW6 A;  3UT7 A;  3VST A;  4CDM A;  1HG5 A;  3N90 A;  3U3W A;  3RRU A;  2WXQ A;  4OAV B;  3SYJ A;  3BH7 B;  1IA5 A;  3D9P A;  4G11 A;  2BTD A;  2VQ2 A;  4O1O A;  3L13 A;  3D9L A;  4W8S A;  3GQ7 A;  1OWM A;  5EID A;  4JRA C;  4BET A;  3GQA A;  2KZT B;  5ENQ D;  2AWI A;  4TXR A;  4BT8 A;  3MJW A;  2NC9 A;  3I3N A;  3CVQ A;  4J7W A;  1N11 A;  2DBA A;  3F6Q A;  2G0Y A;  1QA2 A;  2LAI A;  2VFP A;  3WG7 E;  4U8H A;  2EWE A;  4ATG A;  4XKB A;  3JX8 A;  1KCD A;  5FQ6 A;  4AEZ C;  5EIL A;  2OV8 A;  3OTN A;  2NT6 A;  3LY9 A;  2HO1 A;  1N0Q A;  4YDW A;  3CR3 A;  3P2B A;  5E75 A;  3R7R A;  3UKR G;  3VLE A;  1CZF A;  4DUI A;  2XCC A;  2X6W A;  2H6G A;  1ELK A;  3CQC B;  4LNG A;  1VBL A;  4YEI A;  2WQH A;  3CKC A;  1Z3Y A;  1TN7 A;  4HQD A;  1YYH A;  2RFA A;  3V2O A;  3LPZ A;  5FQ4 A;  3CVY A;  4OJ5 A;  2Y69 E;  3ZRH A;  2L0T B;  4F7A A;  4U07 A;  1O8G A;  2WXM A;  4DLO A;  3HYM B;  2AW6 A;  4A3V A;  1B89 A;  4U04 A;  2XS8 A;  2BM7 A;  2XPY A;  3ZW3 A;  1DAB A;  4XN3 A;  4WNG A;  3HVE A;  3CKB A;  4JL0 A;  1OCR E;  3SFZ A;  1O88 A;  3URZ A;  4GAA A;  1TNZ A;  1VDY A;  4LG6 A;  5B3S E;  3E32 A;  2X3M A;  3AS5 A;  3LVR E;  1DNP A;  3PVL A;  1UOH A;  4NUR A;  2X6J A;  4GPM A;  3EHN A;  3S7F A;  3BG1 B;  3DBS A;  4MXN A;  3E30 A;  2R05 A;  4W8Q A;  4EHM A;  2GRQ B;  3HVE B;  3SQV A;  3FUJ A;  2Y4U A;  3DSV A;  3RAU A;  3R7Q A;  3PE3 A;  1L1I A;  4V02 C;  2DYR E;  2P9N G;  4BER A;  4MR0 A;  3CHQ A;  4Q69 A;  4MRU A;  1SA4 A;  2E0I A;  4I1M A;  1HF8 A;  1WG0 A;  4CGW A;  3C3O A;  2BKG A;  3C3R A;  1RWR A;  1D8E A;  4TUM A;  4HS2 A;  2PL2 A;  3DPD A;  3SY2 A;  4K03 A;  3CVX A;  1V54 E;  2WXG A;  3JQ1 A;  3IV0 A;  4OJO A;  4GA1 A;  2QFC A;  3LMW A;  3CHO A;  4JXT A;  1IYG A;  3ONK A;  4KZ0 A;  3LJN A;  3BUA A;  2R5S A;  1QRC A;  3DSW A;  4J8F A;  4EZJ A;  3Q9N C;  1IXV A;  4GYY A;  4GB9 A;  4C9B B;  1WXR A;  5BW8 C;  1H19 A;  4YEL A;  2V8S E;  2MHK A;  3UMV A;  4K5A B;  3SBS A;  3ENE A;  3QWP A;  3ZPJ A;  1IB4 A;  3Q78 A;  3AG3 E;  3UIN C;  4Q96 A;  3C5R A;  4JHR A;  4G2V A;  1FT2 A;  2J4D A;  2WVI A;  3N71 A;  2V4L A;  4V3I A;  2EQX A;  1EPU A;  2Y3A A;  3V30 A;  2XPI A;  3B7B A;  2LSV A;  3PZ4 A;  2NTQ A;  3OAW A;  2R02 A;  3CVL A;  4J8S A;  4HRL A;  1WM5 A;  2ODL A;  1SZ9 A;  3KEZ A;  4DX5 D;  5HKP A;  3PSZ A;  3MGB A;  3D9J A;  3CHR A;  2WM9 A;  5JLV C;  3FTW A;  4GZC A;  3CLJ A;  1K8K G;  1O8F A;  3RJV A;  3BH6 B;  3T9G A;  1H6K A;  4OM9 A;  5G05 C;  1MX4 A;  2IOU G;  2GW1 A;  1K1A A;  4YND A;  5ARG A;  3G2V A;  3CV0 A;  1TN8 A;  3EQO A;  4FU3 A;  2ZXW E;  3TXM A;  4JC8 A;  3VSV A;  2ILR A;  4PUC A;  3EU9 A;  3QK0 A;  3LCA A;  2KCL A;  3NQP A;  3U9W A;  3L16 A;  1IQR A;  3GZS A;  2QY1 A;  2OVF A;  1JCR A;  2CG2 A;  5BT1 A;  2OOE A;  1E90 A;  4G8L A;  2NSZ A;  3MZL B;  5ANR A;  4DX2 A;  3ULY A;  4ANW A;  5CRV A;  4A55 A;  5JMC B;  3FTV A;  5FIO A;  4HLL A;  2H6I A;  3Q75 A;  4G8K A;  3QDN A;  1EYH A;  2O0W A;  3FH8 A;  3GQ9 A;  2R17 C;  1H2U A;  2WXK A;  4I1A A;  4GTM A;  3ABL E;  1O8K A;  5D0Q D;  4F1P A;  5T4Y A;  2JLB A;  1TNY A;  3NB2 A;  4Q94 A;  2NYJ A;  3FTX A;  5BXO A;  3JXI A;  5JJT A;  3D9M A;  3ZYL A;  1LD8 A;  2Y1L E;  1NZN A;  4GA2 A;  1DC2 A;  1AWC B;  5CHE E;  4WNF A;  2MOW A;  3B7S A;  5LCW C;  3RIQ A;  1Y6I A;  3AG1 E;  4GZD A;  3CSF A;  1Z5S C;  5JHB A;  4HOS A;  5A6C A;  1H2V C;  3PDN A;  5H7P A;  4KBQ A;  3TWR A;  4FJZ A;  2EIM E;  2EIL E;  3U66 A;  2IF4 A;  2AXV A;  3FP3 A;  1K8F A;  5KJN A;  3SZE A;  1NA3 A;  3SHF A;  3FTY A;  3EIQ C;  3JQ0 A;  5KWD A;  2GRN B;  3ZVV A;  3CK9 A;  3ZYM A;  2GRP B;  2LUH A;  3QJZ A;  1O5M A;  4I1O B;  2QY7 A;  3PET A;  2H6F A;  4L9P A;  3ZPP A;  3ML3 A;  1OUV A;  2GRL A;  1D8D A;  1SQM A;  3HXB A;  1NI1 A;  3Q9U C;  3TWX A;  4NAC A;  5LOZ A;  4TXP A;  5CMY A;  2O6W A;  2W7Z A;  3TGO A;  2J09 A;  4J8E A;  4PS3 A;  4IRU A;  4LSZ E;  3EJN A;  4LEU A;  3UI2 A;  4MLP A;  4CGV A;  1Y8M A;  1O1S A;  2C0L A;  2VFN A;  2WMN A;  1TYQ G;  3FTS A;  4ME2 A;  3I4G A;  2OEW A;  4GA0 A;  4AVX A;  3C98 A;  1PXZ A;  3JUR A;  5CEC B;  2J9Q A;  4HOT A;  1PE9 A;  3TG4 A;  2V5I A;  4BEP A;  4AJW A;  4U96 D;  5AN8 A;  2IOL A;  2XEH A;  4G26 A;  5CEA A;  1N4Q A;  1TSP A;  1JWG A;  4YC5 A;  1O8H A;  3L54 A;  4G25 A;  2J08 A;  2FO1 E;  3MCX A;  1OY3 D;  1OWN A;  3CHM A;  2M63 A;  1HZ4 A;  4I6E A;  3UM3 A;  3DU1 X;  4CDN A;  3FTZ A;  3EU5 A;  4WWP A;  4KT6 B;  4U8V D;  3ZNG A;  3S7J A;  4EEC A;  3T5V A;  4OJ6 A;  2LXM A;  3B7U X;  5B1B E;  3T8K A;  5BV1 A;  3D9N A;  5D0O D;  1IDJ A;  1LLW A;  1RZ4 A;  5G04 C;  3L6A A;  4HNA D;  2PM6 A;  1UN9 A;  4WND A;  4OAU C;  1S70 B;  1HG2 A;  4WWN A;  1KT0 A;  4CEM A;  4FHK A;  3V31 A;  5JA4 D;  5EX3 A;  2LSU A;  1KZO A;  4NQ0 A;  2PQN A;  2VGX A;  3O4Z A;  2P9K G;  4J6I A;  2O1D A;  3SF4 A;  3SO8 A;  2P2C P;  5KNH D;  4OJP A;  3MKR A;  3LYC A;  2XGS A;  4AVZ A;  3PH0 C;  3J5P A;  3FUK A;  1N52 A;  1S0P A;  3ASO E;  2IEJ A;  1X0C A;  2NTP A;  5M72 A;  2YUH A;  2GRM A;  3DEO A;  4L1B A;  4BES A;  4XM3 A;  4AV7 A;  3Q47 B;  3HG0 D;  1N0R A;  2J4B A;  3ZUV B;  1ELR A;  3ASD A;  3Q49 B;  4HB5 A;  4OJL A;  3IHY A;  3PUJ A;  1EE6 A;  4XLH A;  2VGX B;  3FU3 A;  1OCZ E;  2FEZ A;  1V55 E;  3VMV A;  4U95 D;  2F37 A;  3FWV A;  3VSU A;  3ULQ A;  3CHS A;  3GQ8 A;  3APC A;  3FU5 A;  3EHQ A;  3KD7 A;  1OGM X;  5EYP F;  1ZB1 A;  4I6J A;  1QQ1 A;  2PEC A;  4ACK A;  4YEJ A;  5BNW A;  3W9F A;  5AEN A;  5J90 A;  4K5C A;  1U3D A;  4O6F A;  2IJG X;  4FJY A;  3CEQ A;  3AG2 E;  2OCC E;  5DBK A;  4GML A;  3RRN B;  3PRZ A;  3TJP A;  2CFU A;  2YHE A;  3KAE A;  1IKN D;  2AJA A;  2P9U G;  3OXL A;  5A7D B;  2WXO A;  3H09 A;  1IQU A;  2HE0 A;  5HQ8 A;  4XON A;  4HWV A;  3I5P A;  5FTP A;  2J49 A;  2IOS A;  2XS1 A;  3W9G A;  4MKT A;  1TR4 A;  5AQ7 A;  5FT9 A;  4R7L A;  3Q5M A;  1BLX B;  4UI9 K;  3QOU A;  2X6H A;  1LD7 A;  1MQS A;  1JTA A;  3AS8 A;  2QXZ A;  3U64 A;  1LLZ A;  4BSX A;  3SNX A;  4UWL A;  4I9C A;  3B8Y A;  5FZQ A;  3PUK A;  4EBA A;  4I17 A;  3HDX A;  3QWV A;  1SA5 A;  2WXF A;  3ASN E;  5KJK A;  3DRA A;  4DX1 A;  2VJJ A;  1HS6 A;  1LTX A;  3C72 A;  3D9I A;  4BTB A;  5EIB E;  5ENT D;  4PMH A;  2AXZ A;  4KH3 A;  3SUC A;  4TUU A;  5ENS D;  1K3Z D;  1O8I A;  4ILG A;  5C2Y A;  1NP7 A;  4O1P A;  2J8K A;  3FUF A;  1FVH A;  1D9S A;  4A63 B;  1MX2 A;  4EQF A;  4AM9 A;  2YQ8 A;  2BUG A;  3AU5 A;  1OWL A;  3E34 A;  3ML8 A;  3TWT A;  3OXF A;  3BU8 A;  3N6Z A;  5JHA A;  2FUL A;  3BG0 B;  2F8X K;  3ZKJ A;  1MHQ A;  2UVE A;  4APO A; 
#chains in the Genus database with same CATH homology
 2QYU A;  2J8K A;  4YCQ A;  4YEI A;  3SY2 A;  4YC5 A;  2XTW A;  2XTY A;  2XT4 A;  2XTX A;  2O6W A;  4YFO A;  4YDT A;  3DU1 X;  3NB2 A;  3NAW A;  3PSS A;  2XT2 A;  3PSZ A;  3SQV A;  5DNS A;  2QZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...