3NAWA

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
607
structure length
607
Chain Sequence
LSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords secreted effector protein
total genus 222
structure length 607
sequence length 607
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nawA04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nawA02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nawA01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nawA03
3SY2A 2XTXA 2QZAA 2XTWA 2J8KA 4YEIA 4YFOA 3NB2A 3PSZA 4YCQA 2XT2A 2O6WA 2XT4A 4YDTA 3DU1X 3SQVA 2XTYA 5DNSA 2QYUA 3PSSA 3NAWA 4YC5A
chains in the Genus database with same CATH superfamily
4L7TA 4KVMA 4GA2A 1QA1A 2EIKE 5EILA 1TNZA 5KNGA 4E85A 1KTWA 2IONA 1D8EA 3SNXA 1FT1A 4GTTA 4YEJA 3QWVA 2KCVA 5FIOA 4YDWA 3NAWA 2ETBA 3D9IA 3ZIMA 1HZ4A 4K5BA 3PS6A 2OCCE 4BSZB 4OVVA 4BT9A 4I1AA 2VBMA 1KCCA 3JQ0A 2RD0A 2F8XK 2XZDG 4UI9K 4OVUA 2RKKA 5E76A 4LNBA 4EBAA 2VBEA 3FH5A 3NOCD 2EIME 3CSTA 1O8HA 5JLVC 4GMJA 4Q69A 4ACKA 3RK6A 3LYCA 1EZGA 2NTPA 4XOPA 3R7RA 4DX1A 3B7TA 3HG0D 2X6XA 4NIKA 4XLEA 3UPVA 4CT0A 3KEAA 2WQHA 2O1DA 1HS6A 2JLBA 1DC2A 1YA0A 3L13A 1E8YA 4HOUA 3DBSA 2R5SA 3PE4A 4WNDA 3PEUB 3CKCA 4ILGA 4I6GA 3UUXA 4EQFA 1WG0A 4LUNU 4K5AB 3VLDA 3PH0C 3TAXA 4H7YA 1QQ1A 3EHNA 4ATGA 1N95A 2P2CP 4G8LA 2O0WA 5AQBA 5B1BE 4FLHA 2PZIA 4ANWA 3EJNA 4JRAC 4CZ2D 4JC8A 3PZ2A 2A5UA 4EBAG 4GTMA 1SZ9A 3DEOA 3SUCA 2UWJG 3HHMA 3NQPA 4GMRA 4EZKA 2CG3A 3ZW3A 5CEAA 4I6EA 3VSTA 3CVXA 5ARFA 4KT6B 4BERA 3KRGA 2CFUA 4DLOA 3PSZA 2I1KA 2WXGA 4FHJA 3MX3A 5DBKA 2Y1LE 3ML3A 3SF4A 1H80A 5H7PA 3UINC 3QNKA 3MKQA 3GW4A 1E8ZA 3QK0A 3AG3E 4U0UA 3DWLG 1DABA 1H2VC 1IQUA 3CHRA 3S7DA 3CK9A 1QA2A 2IF4A 2Y0BG 2Y3AA 4OAVB 3CGHA 1H6PA 2XEVA 4YDTA 4N3BA 1O88A 5JA4D 2JEKA 5LFAA 3EHRA 2I6HA 2NC9A 2VJ8A 4RSYA 1UN8A 3FTZA 3FTXA 4OM9A 1TYQG 4ME2A 2CFZA 2VFNA 2BX6A 2DIWA 2XS1A 2QC9A 3L9TA 3JYSA 2J9QA 1N94A 1BN8A 1NI1A 2VGYA 5ENOD 4HXIA 1U3DA 1LLWA 2PM7A 3OXGA 2LXMA 4Z05A 4XI9A 4A55A 1OFMA 2VQ2A 3UX4A 2YINA 3FTYA 4QQIA 1CLWA 4K0RA 1ELKA 4YCQA 4XMYA 3U66A 1IXVA 3QDNA 2PNNA 2V4LA 4CGWA 3ZYQA 3D9LA 5EIDA 3AU4A 3B7BA 1O1TA 4GA1A 1V54E 5AQAA 1X81A 4U96D 3JXJA 4FJYA 2VGXB 5CBNA 3H09A 2ONDA 3ASOE 3OXLA 4WNGA 1TN7A 4O1PA 3FUDA 4RQIA 2QFCA 4EPZA 1NFIE 1QA3A 3FHEA 2FO7A 2QXZA 2KATA 4YVQC 3PUJA 1TYVA 4JEUA 2XPYA 2GRMA 4RVBA 2IO2C 3RRUA 3LY7A 5CEDB 4BFRA 3E30A 1TEZA 3FUKA 3D3MA 3RKVA 1O8FA 3CK7A 5AMVA 4NACA 2HM8A 3ZGQA 2O04A 4I9CA 4XOTA 2PM6A 4Z68A 3AAAC 2V5FA 3CVQA 2P9IG 4UI9J 1OUVA 4OJPA 1MX2A 4XLFA 1N0RA 3CEQA 1SQMA 2KC7A 3EUVA 4XONA 2LO6A 3L22A 1UJJA 1KT1A 1L1IA 4RG6A 4HBDA 4FU3A 4GA0A 4IYPA 4UWGA 1IB4A 3PZ4A 4HFGA 3J5PA 1PLUA 4V02C 4PS3A 3ASFA 5ENNA 3DXKG 3FU0A 1QCXA 3VMVA 1FVHA 1LD8A 5BT1A 5BPPA 3IXEA 4YFOA 3O4ZA 2DYSE 3RRMB 4IRUA 3VLEA 1N54A 1Z6TA 3V79K 3AS4A 1QRCA 1LTXA 3IEGA 3LYAA 3CVYA 1TYWA 4AV7A 2XEEA 5G05C 3MV3B 4CDMA 4WUYA 2OV8A 2L6JA 3B7SA 3EIJA 3EQOA 1IDKA 5C2YA 3MCXA 2F8YA 3FUMA 3UTMA 1GQ8A 3SD5A 2DYRE 2AXZA 4OJOA 3UT4A 2J8KA 1S63A 4GTOA 2X38A 5EN5D 2NSTA 2V5IA 3L08A 1BHEA 3B8YA 1PAQA 3T5VA 2ILRA 3FU3A 2VGXA 2XEHA 1INZA 1TNYA 3QJZA 5HI7A 3RIBA 4U8YD 4DUIA 3SGHA 2QY1A 2IO3C 4B8CB 3IKOB 2KCLA 4XLHA 4AM9A 4DX6D 4DJAA 3GZ2A 3RSEG 3U9WA 2B0OE 2FF4A 3EU9A 3HYMB 3GZSA 4Z03A 1OWOA 2MRIA 4WNEA 4FULA 4BETA 2R03A 1RW2A 3SQVA 3TWTA 4KZ0A 1JTAA 1A17A 2R02A 1K3ZD 4W8TA 3ENEA 1IA5A 2OVBA 4BTAA 1H2TC 1MQSA 5JMND 4I2ZA 3UM2A 2PQNA 4L2LA 2LXLA 3JUIA 2V5QC 4FP7A 2IOUG 3OTNA 3KSQA 2XHEA 4GTVA 2XPZA 5C1EA 1IDJA 1VBLA 5AAOA 4PDXA 3CSFA 4A1SA 3NZUA 4X8QA 1JCRA 1K1BA 2XT4A 1EA0A 2GRNB 3RO3A 3U3WA 1MHQA 2EWEA 2VFOA 3GQAA 3ISMC 3WXXA 2VGEA 1ZBPA 5EX3A 3KAEA 3ONKA 4ZHBA 4N5QA 2KZTA 2WXRA 4M7CA 3G2SA 4U8HA 3LKUA 3ZNGA 3V30A 2J08A 4GTRA 1WMRA 4EZLA 2EINE 4KH3A 1E90A 1X5BA 3ASHA 4ANXA 3DRAA 5KJKA 1RWRA 3ULQA 1WXRA 2GRQB 2ETAA 5KJMA 1ELWA 3IBEA 3SZ7A 3BU8A 3CVVA 3MV2B 3FUEA 1N4RA 4CCAA 4AY6A 3C98A 4HRLA 2VJJA 1HH8A 4JD2G 2YHEA 4GTPA 3CK8A 1D8DA 4YDEA 1X0CA 5AQ7A 2XGSA 3AU5A 1TYXA 3T9KA 1LD7A 2VTBB 2PYHA 1WAO1 3UM0A 2BEDA 2C0LA 1BD8A 1Y8MA 3ABME 3SFXA 4MRUA 3Q49B 2WQ6A 1KZPA 4OZYA 3GQ8A 4U8VD 3EHQA 4HVBA 3P1UA 4F1PA 2IOSA 3GZ1A 4DI3A 3FTVA 4BEPA 2L6BA 1Z3XA 3CHSA 5AIJA 2NSPA 4NQ0A 1OOCA 2J8SD 5FTPA 2H6GA 1SZAA 3KSLA 1OCCE 4YZAA 2X6HA 3V2OA 5HKPA 3PNTB 3EDTB 2DZOA 3CVPA 4U63A 4DX2A 4I9EA 3MYVA 4GYOA 3K9IA 5AQ9A 3G2VA 1IYGA 2DVWA 3DSVA 2RFAA 4J6IA 3ZVVA 1OXJA 4HOQA 4G2VA 3MKQB 3QWPA 3Q47B 4O6FA 4JB8P 3X2QE 1N52A 4I1MA 1UN9A 4JHKA 4JZYA 5CRUA 1D9SA 2PL2A 4N2QA 2BM4A 4A3TA 4Q94A 3V2XA 3FY4A 5FZSA 1BI8B 4TUMA 1E96B 1TNUA 4EZJA 5ENTD 3LVRE 3ASGA 3ZYLA 4EHMA 3MKRA 4PUCA 4GB9A 3QAQA 3DSSA 3I5PA 3PVLA 3FP3A 1WM5A 4HWVA 5CERB 4FLBA 2EIJE 3UQ3A 1N9AA 1EE6A 3PE3A 4UQZA 4XKWA 4JVSA 1SA5A 5AARA 3VTYA 1SW6A 4ACLA 5IY5E 2YNQA 3SBTB 3ZYMA 3T5XA 1AIRA 3F6QA 5J90A 3FU5A 3GQ9A 5G55A 3ZHEA 1KT0A 2H6FA 4HB5A 2I2OA 4XEIG 4JL0A 4TV3A 2NYJA 2X85A 2Q7FA 3IV0A 3UIOC 3FUHA 1OFEA 3RJVA 2OVFA 3KEZA 2INVA 5JJ7A 3MJWA 5KJNA 3UW0A 4APOA 4NRHB 3GRHA 3IHVA 4J0UA 3FTSA 3TXMA 3LY8A 1OWNA 5JMCB 3B7UX 4JW1A 2WXFA 1QNFA 2WPVA 3DSXA 3U4TA 2XT2A 3Q7AA 1RZ4A 3ASDA 2PYGA 1U2VG 1N4QA 2XTYA 3EU5A 2FEZA 2HO1A 3BEEA 2X3MA 2LAIA 4XIFA 4XI0A 2J49A 2DWZA 4L9PA 3CVWA 5KBAA 3SFYA 3JCKC 4K03A 5G04J 3ZSCA 5DIZA 1PY1A 4XNFA 2XGOA 1E7UA 4MR0A 4GU5A 3FDHA 3L17A 2M63A 4UWLA 4ZFHA 2R2LA 4B0ZA 1KLXA 2RFMA 3CHOA 2AXUA 3PDNA 5CCMA 3L54A 3ZXSA 3C72A 4YEIA 2I9CA 4GZ6A 1FCHA 3CQGB 3AG4E 4I43A 5CBOA 5JHBA 3W9GA 1H2UA 4GZ3A 4G26A 5FQ8A 5JJTA 1O8GA 3AS5A 1U3CA 1OWMA 4WWNA 4XKVA 3CHQA 3UKRG 5BV0A 1N4PA 3Q9UC 4DPRA 1OFDA 4I84A 2WXKA 4KZCA 2J4DA 4AJWA 1TSPA 4EW9A 2GROB 3L6AA 5EKQD 3RRNB 3ML9A 5CECB 2C2LA 4XKBA 4N3CA 1H19A 4YZXA 2VBKA 1YCSB 2XRYA 3UM3A 1TN8A 5EYLA 4LRZA 3I4RB 3TWUA 4XLCA 4U49A 4MBGA 4OJ5A 2QZAA 3FEYA 3JUEA 3AJIA 3ZXPA 2IFUA 2NSZA 3JURA 1K8KG 2P9LG 1OCRE 2E0IA 2L0TB 3GYZA 1N11A 2EQXA 3SI5A 4RLYA 3TGOA 3Q15A 4XKCA 4AIFA 3EIQC 3Q78A 3D9NA 3FTUA 3QOUA 1QJVA 3PZDA 3SFZA 4WWPA 3RO2A 1HG8A 5D0OD 3S2AA 5D2MC 4ANUA 4UWKA 2WXMA 3QWWA 1UOHA 4KMOA 4CDNA 5KCMA 4FHKA 1UW4B 4UWFA 5BUZA 2BSPA 5FQ6A 3W9FA 5FZQA 4L1BA 4CEMA 3V31A 4MLPA 2NT6A 2BM6A 5ENRD 2P58C 2L9BA 1OFLA 4JA9A 1BU9A 3PETA 2WXPA 3KS2A 4OAUC 4KBQA 4BX8A 5LCWC 4TRQA 5CCLA 2BM7A 3B95A 4CT4A 3B13A 3IHYA 3QC1A 1E8WA 3B90A 3FWVA 3ONLA 3RIQA 2Y4TA 3LPZA 3TH0A 2NXPA 4MKTA 5A6CA 2P9KG 1K8FA 5CRVA 2VSNA 1XNFA 3OXFA 1YMPA 4J8SA 1EPUA 3L16A 1G3NB 4MS6A 3UIPC 2VSOE 4FA6A 1NZNA 1O5MA 3LCAA 2H6IA 2J4BA 5CMWA 2WB2A 3DSWA 4XE0A 3ZPJA 2BF0X 3R7QA 2DZNA 2QYUA 4LERA 2XZTG 3D9MA 3TWVA 4AEZC 5KWDA 3LJNA 2WXHA 3AK5A 1ELRA 1DCQA 1HXIA 2X6WA 4C0MA 5J08A 1JRGA 1EF1C 1Y6IA 5FQ7A 4OJLA 1HE8A 3I3NA 1NHCA 2X3HA 4XN0A 3MGBA 2ZIRA 4XLAA 3AG2E 2KM4A 3VSVA 3LJYA 3NOGD 1FT2A 2R59A 4YZ0A 3CHPA 2V8SE 2WVIA 3TWWA 4ATZD 5C1CA 3SO8A 4D10C 3ABLE 3D9OA 4UWHA 4OZZA 2CHXA 3EHMA 1QRBA 2WMOA 5DNSA 1O8KA 4ILHB 5B1AE 1V55E 4AVXA 3FUNA 3FTWA 3ZRHA 3UM1A 3ABKE 1WDYA 2IEJA 5HQ8A 3BH6B 1O8MA 1MX6A 3Q79A 1N4SA 4APFA 4GCOA 2KZTB 2MHKA 3BH7B 4A1GA 3HXEA 2X6KA 4GZ5A 1LLZA 4G1TA 4URRA 2VTBA 2J09A 3D9HA 1TNBA 4N39A 4AXHA 4XN3A 4XX5A 4I17A 3N90A 5LP0A 4XQFA 2FULA 5CHEE 3UKUG 1HO8A 4FJZA 5BW8C 2HYZA 2ZGDA 1IQRA 3VTXA 3HVEA 4WWOA 3FU6A 5T4YA 1E8XA 3LEWA 2WQ7A 1JWGA 2XENA 4XORA 4OYSA 2LSUA 3FH8A 3SHFA 5LOZA 2P9PG 1VDYA 3APFA 2BTDA 4L2YA 2Y4UA 5HS0A 2RG8A 3CVNA 3QARA 3SBSA 1AP7A 1AWCB 2XQ0A 4GTSA 4GZCA 4I2WA 2B6CA 1K4ZA 4DRXE 5CMYA 4TXQA 5AJLA 3UXGA 4XM3A 2GRPB 5ANRA 4YELA 2VFQA 3WWGA 3HXBA 2WXLA 3HIZA 1HU3A 3NB2A 3P2BA 2MYOA 2MOWA 4AY5A 1OCOE 3ESLA 4HOTA 4F7AA 2V0PA 4J7WA 3DSTA 3S7BA 1BPOA 2AXVA 2AVPA 3R9MA 4BESA 3BQOA 3E37A 4YNDA 4NURA 3ZU7B 3Q73A 2Z8GA 4GPKA 2XTWA 4G11A 1S70B 3S7JA 3P4GA 2PECA 4HQDA 2LAHA 1P5QA 1O8IA 1NP7A 2BKGA 3UT7A 3TJPA 1O8JA 4U0SA 2GGFA 1XG2A 2ZU6B 3TL5A 1O8DA 4G23A 1S0PA 4IULA 3R9AB 1MYOA 4HI9A 5FWQA 4F3VA 4KYOB 4J8DA 2FI7A 4E6HA 5A23A 2IQ7A 2KBXA 3HXFA 4QFVA 4FADA 4C2LA 4PS7A 2NTBA 5AJDA 1H0AA 3LXUX 5EX0A 4Y6CA 3DPDA 5JHAA 2H6HA 3ZN3A 1JCSA 4GZDA 4UQXA 2NTQA 1EDUA 3C5RA 1TJFA 2XGMA 2R17C 1B89A 4U95D 1O8EA 3NF1A 4LNGA 5FZRA 2FBNA 4W9RA 3PZ3A 1QZ2A 4HRMB 4O1OA 5ARGA 4AP2A 1GW6A 2ZXWE 4HOSA 4L23A 2HR2A 4C9BB 1TR4A 1HF2A 3U64A 2NT9A 2YHCA 3T9GA 1O1RA 1RU4A 2GW1A 1O1SA 2OEWA 3D9PA 3E4BA 3CIAA 3CQCB 4NK8A 1QYMA 4P29A 3TWQA 1NL4A 3ESKA 4LSZE 5ENPD 3BUAA 4NK6A 4JXTA 1O8LA 2ETCA 4UQYA 4GCNA 2AJAA 4HI8A 2NZMA 4W8SA 3ZEFA 3DXMG 4EECA 1OWPA 2XCBA 3LJ3A 4OPWA 3MZLB 4U07A 4YZQA 2IU1A 1Q2ZA 3UI2A 3ULEG 3NBNB 2QY7A 2INUA 3TG4A 3KD7A 4HNAD 1HG2A 5BXOA 1MZCA 2E2EA 2LSVA 2O6WA 5C1DA 4PMHA 1ZB1A 4JHJA 4MXNA 5EYPF 2IOLA 3HXDA 4DX7D 1DBGA 3PZ1A 4G24A 4GMLA 3APCA 3TXNA 3JX8A 2P9NG 2DBAA 5AENA 1SA4A 3CLJA 3WG7E 2YQ8A 5A7DB 4F1SA 3B4NA 3ZPPA 1IHGA 4PS8A 3GQ7A 4HRNA 4DX5D 4W8RA 1QBQA 3LMWA 2G0YA 2WXNA 1IKND 4N2SA 2IJGX 4GAAA 3I4GA 4N5CA 3Q9NC 2YUHA 5E75A 4CGVA 4KVOA 5KNHD 2F0YA 3JQ1A 5FT9A 1OCZE 1TNOA 2LUHA 4TXPA 1UG3A 3PREA 5B3SE 2F37A 3E34A 1HX8A 1OGOX 2QX3A 1S64A 1PE9A 2X6FA 1CZFA 3HRAA 5FJYA 2EILE 3VSUA 3FUJA 1LF8A 4M3OA 4C48B 4F6RD 4GTQA 4AVZA 2BUGA 1PC2A 1Z5SC 4B94A 2LNIA 3PUKA 3Q5MA 4FC8A 4XR6A 2KCKA 3MA5A 4U0ZA 3HVEB 1N0QA 3CKBA 1EYHA 4DI4A 2ZISA 2CHZA 4GYYA 1TYUA 3S7FA 3DU1X 1L5JA 3C3OA 5D66A 5AYWD 3LS8A 4B89A 4HS2A 2KXPC 2F3LA 3FUFA 1JWFA 4O60A 3OAWA 5EDSA 4B8AA 1UJKA 3ZKJA 3VMWA 4BX9A 4BY6A 2XRZA 4TUUA 4JPSA 2WXOA 3AS8A 3Q7FA 3PNLB 4KXKB 4XL9A 5ITZF 4CYMD 1MJ0A 2I1JA 4G25A 1BI7B 3ML8A 4WAFA 3URZA 4TXRA 1H6OA 1KZOA 1BLXB 4CRWA 2X6JA 3TWXA 3FUIA 2UVFA 3D9KA 1RMGA 3T8KA 2R05A 2QYJA 1TN6A 3G2WA 3AG1E 4UUCA 5KJLA 2OEVA 3FULA 2BM5A 3NZSA 2WXIA 3QKYA 3LVQE 5LX8A 3CVLA 1E7VA 3LDZA 4U7EB 3CVUA 4G8KA 2WMNA 4ILIA 2L0IA 1HF8A 1OGMX 4B93B 1WY6A 4J8FA 1KPSB 2CG2A 2XTXA 2XS8A 4URKA 2UY1A 5FQ4A 3D9JA 5ENQD 3FH7A 3CHMA 4BWRA 5LCWJ 3EQNA 1JPLA 3RU0A 3FEXA 1OY3D 3Q75A 5JJ6A 2A4ZA 4Q96A 4YDOA 1HG5A 3FY3A 4RG9A 4Y6WA 5G05J 4DK5A 3N71A 4N3AA 4XZ4A 2HE0A 1YYHA 2WXQA 3MEKA 3QB2A 4J8EA 2VSXE 4JA7A 4OJ6A 4YDYA 2VJIA 3BG1B 2VFPA 2CHWA 1OWLA 4LG6A 2P9UG 4ANVA 4H7XA 2W7ZA 5EIBE 2AW6A 4BT8A 3C3RA 1HFAA 1DVPA 2WM9A 2B0RA 2J8IA 3UT8A 4J8YA 4LCTA 2ODLA 4Z06A 4LEUA 4YC5A 2XCCA 1K1AA 4HLLA 1KQ5A 4WNFA 4AOFA 2VSYA 5G2NA 4R7LA 2AWIA 3N6ZA 2X6IA 2J07A 1K5CA 2XC1A 2O17A 1W3BA 4BSXA 3BG0B 1H6KA 3UMVA 2BKKB 4LNUD 3ZYKA 2UY1B 4BTBA 4U4BA 4ABNA 2A5EA 3DSUA 4CDRA 2ZGGA 2GRRB 1FVFA 3JXIA 1Z3YA 4YVOA 4HORA 4GPMA 5T8IA 4I6JA 2DCPA 2O0VA 1PXZA 1NA0A 1KCDA 4I1OB 5FINA 4U04A 1OT8A 1ZU2A 3C3QA 2XPIA 4PH4B 3FFLA 5ENSD 4F53A 5AN8A 3ZHEB 3SZEA 2Y69E 5M72A 3Q4AB 5T3RA 2WXJA 2P9SG 3ULYA 3PEVB 5D0QD 3TWRA 1TJCA 5BXUA 4HLEA 2X6YA 4V3IA 4W8QA 1NA3A 5HRYA 3CV0A 2PQRA 3TG5A 3G2TA 1DNPA 3HXCA 2UVEA 4GYWA 3PRZA 3ZUVB 3G2UA 3LY9A 3E32A 3SYJA 2GRLA 2OOEA 4A3VA 1SVXA 2JABA 1IHBA 1DCEA 4A63B 3E33A 4C0EA 1JUQA 2VFMA 2FO1E 3HDXA 4DLQA 2C0MA 5G04C 2IY0C 1XGWA 2IQCA 1A5EA 2VYIA 1JCQA 3B7RL 4JEHA 3O48A 1DBOA 1LM1A 4JHRA 3PSSA 2V4HC 3DPYA 4IN3B 3SY2A 1QQEA 3RAUA 3J5QB 3DEPA 3VLFA 5BV1A 5BNWA 3L82A 3CR3A 3TWSA 3ZFWA 3ASNE 4K5CA 1MX4A 3APDA 5ANLA 4UI9C 1FPPA 3T8MA
chains in the Genus database with same CATH topology
3SY2A 2XTXA 2QZAA 2XTWA 2J8KA 4YEIA 4YFOA 3NB2A 3PSZA 4YCQA 2XT2A 2O6WA 2XT4A 4YDTA 3DU1X 3SQVA 2XTYA 5DNSA 2QYUA 3PSSA 3NAWA 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  2XTX A;  2QZA A;  2XTW A;  2J8K A;  4YEI A;  4YFO A;  3NB2 A;  3PSZ A;  4YCQ A;  2XT2 A;  2O6W A;  2XT4 A;  4YDT A;  3DU1 X;  3SQV A;  2XTY A;  5DNS A;  2QYU A;  3PSS A;  3NAW A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 4L7T A;  4KVM A;  4GA2 A;  1QA1 A;  2EIK E;  5EIL A;  1TNZ A;  5KNG A;  4E85 A;  1KTW A;  2ION A;  1D8E A;  3SNX A;  1FT1 A;  4GTT A;  4YEJ A;  3QWV A;  2KCV A;  5FIO A;  4YDW A;  3NAW A;  2ETB A;  3D9I A;  3ZIM A;  1HZ4 A;  4K5B A;  3PS6 A;  2OCC E;  4BSZ B;  4OVV A;  4BT9 A;  4I1A A;  2VBM A;  1KCC A;  3JQ0 A;  2RD0 A;  2F8X K;  2XZD G;  4UI9 K;  4OVU A;  2RKK A;  5E76 A;  4LNB A;  4EBA A;  2VBE A;  3FH5 A;  3NOC D;  2EIM E;  3CST A;  1O8H A;  5JLV C;  4GMJ A;  4Q69 A;  4ACK A;  3RK6 A;  3LYC A;  1EZG A;  2NTP A;  4XOP A;  3R7R A;  4DX1 A;  3B7T A;  3HG0 D;  2X6X A;  4NIK A;  4XLE A;  3UPV A;  4CT0 A;  3KEA A;  2WQH A;  2O1D A;  1HS6 A;  2JLB A;  1DC2 A;  1YA0 A;  3L13 A;  1E8Y A;  4HOU A;  3DBS A;  2R5S A;  3PE4 A;  4WND A;  3PEU B;  3CKC A;  4ILG A;  4I6G A;  3UUX A;  4EQF A;  1WG0 A;  4LUN U;  4K5A B;  3VLD A;  3PH0 C;  3TAX A;  4H7Y A;  1QQ1 A;  3EHN A;  4ATG A;  1N95 A;  2P2C P;  4G8L A;  2O0W A;  5AQB A;  5B1B E;  4FLH A;  2PZI A;  4ANW A;  3EJN A;  4JRA C;  4CZ2 D;  4JC8 A;  3PZ2 A;  2A5U A;  4EBA G;  4GTM A;  1SZ9 A;  3DEO A;  3SUC A;  2UWJ G;  3HHM A;  3NQP A;  4GMR A;  4EZK A;  2CG3 A;  3ZW3 A;  5CEA A;  4I6E A;  3VST A;  3CVX A;  5ARF A;  4KT6 B;  4BER A;  3KRG A;  2CFU A;  4DLO A;  3PSZ A;  2I1K A;  2WXG A;  4FHJ A;  3MX3 A;  5DBK A;  2Y1L E;  3ML3 A;  3SF4 A;  1H80 A;  5H7P A;  3UIN C;  3QNK A;  3MKQ A;  3GW4 A;  1E8Z A;  3QK0 A;  3AG3 E;  4U0U A;  3DWL G;  1DAB A;  1H2V C;  1IQU A;  3CHR A;  3S7D A;  3CK9 A;  1QA2 A;  2IF4 A;  2Y0B G;  2Y3A A;  4OAV B;  3CGH A;  1H6P A;  2XEV A;  4YDT A;  4N3B A;  1O88 A;  5JA4 D;  2JEK A;  5LFA A;  3EHR A;  2I6H A;  2NC9 A;  2VJ8 A;  4RSY A;  1UN8 A;  3FTZ A;  3FTX A;  4OM9 A;  1TYQ G;  4ME2 A;  2CFZ A;  2VFN A;  2BX6 A;  2DIW A;  2XS1 A;  2QC9 A;  3L9T A;  3JYS A;  2J9Q A;  1N94 A;  1BN8 A;  1NI1 A;  2VGY A;  5ENO D;  4HXI A;  1U3D A;  1LLW A;  2PM7 A;  3OXG A;  2LXM A;  4Z05 A;  4XI9 A;  4A55 A;  1OFM A;  2VQ2 A;  3UX4 A;  2YIN A;  3FTY A;  4QQI A;  1CLW A;  4K0R A;  1ELK A;  4YCQ A;  4XMY A;  3U66 A;  1IXV A;  3QDN A;  2PNN A;  2V4L A;  4CGW A;  3ZYQ A;  3D9L A;  5EID A;  3AU4 A;  3B7B A;  1O1T A;  4GA1 A;  1V54 E;  5AQA A;  1X81 A;  4U96 D;  3JXJ A;  4FJY A;  2VGX B;  5CBN A;  3H09 A;  2OND A;  3ASO E;  3OXL A;  4WNG A;  1TN7 A;  4O1P A;  3FUD A;  4RQI A;  2QFC A;  4EPZ A;  1NFI E;  1QA3 A;  3FHE A;  2FO7 A;  2QXZ A;  2KAT A;  4YVQ C;  3PUJ A;  1TYV A;  4JEU A;  2XPY A;  2GRM A;  4RVB A;  2IO2 C;  3RRU A;  3LY7 A;  5CED B;  4BFR A;  3E30 A;  1TEZ A;  3FUK A;  3D3M A;  3RKV A;  1O8F A;  3CK7 A;  5AMV A;  4NAC A;  2HM8 A;  3ZGQ A;  2O04 A;  4I9C A;  4XOT A;  2PM6 A;  4Z68 A;  3AAA C;  2V5F A;  3CVQ A;  2P9I G;  4UI9 J;  1OUV A;  4OJP A;  1MX2 A;  4XLF A;  1N0R A;  3CEQ A;  1SQM A;  2KC7 A;  3EUV A;  4XON A;  2LO6 A;  3L22 A;  1UJJ A;  1KT1 A;  1L1I A;  4RG6 A;  4HBD A;  4FU3 A;  4GA0 A;  4IYP A;  4UWG A;  1IB4 A;  3PZ4 A;  4HFG A;  3J5P A;  1PLU A;  4V02 C;  4PS3 A;  3ASF A;  5ENN A;  3DXK G;  3FU0 A;  1QCX A;  3VMV A;  1FVH A;  1LD8 A;  5BT1 A;  5BPP A;  3IXE A;  4YFO A;  3O4Z A;  2DYS E;  3RRM B;  4IRU A;  3VLE A;  1N54 A;  1Z6T A;  3V79 K;  3AS4 A;  1QRC A;  1LTX A;  3IEG A;  3LYA A;  3CVY A;  1TYW A;  4AV7 A;  2XEE A;  5G05 C;  3MV3 B;  4CDM A;  4WUY A;  2OV8 A;  2L6J A;  3B7S A;  3EIJ A;  3EQO A;  1IDK A;  5C2Y A;  3MCX A;  2F8Y A;  3FUM A;  3UTM A;  1GQ8 A;  3SD5 A;  2DYR E;  2AXZ A;  4OJO A;  3UT4 A;  2J8K A;  1S63 A;  4GTO A;  2X38 A;  5EN5 D;  2NST A;  2V5I A;  3L08 A;  1BHE A;  3B8Y A;  1PAQ A;  3T5V A;  2ILR A;  3FU3 A;  2VGX A;  2XEH A;  1INZ A;  1TNY A;  3QJZ A;  5HI7 A;  3RIB A;  4U8Y D;  4DUI A;  3SGH A;  2QY1 A;  2IO3 C;  4B8C B;  3IKO B;  2KCL A;  4XLH A;  4AM9 A;  4DX6 D;  4DJA A;  3GZ2 A;  3RSE G;  3U9W A;  2B0O E;  2FF4 A;  3EU9 A;  3HYM B;  3GZS A;  4Z03 A;  1OWO A;  2MRI A;  4WNE A;  4FUL A;  4BET A;  2R03 A;  1RW2 A;  3SQV A;  3TWT A;  4KZ0 A;  1JTA A;  1A17 A;  2R02 A;  1K3Z D;  4W8T A;  3ENE A;  1IA5 A;  2OVB A;  4BTA A;  1H2T C;  1MQS A;  5JMN D;  4I2Z A;  3UM2 A;  2PQN A;  4L2L A;  2LXL A;  3JUI A;  2V5Q C;  4FP7 A;  2IOU G;  3OTN A;  3KSQ A;  2XHE A;  4GTV A;  2XPZ A;  5C1E A;  1IDJ A;  1VBL A;  5AAO A;  4PDX A;  3CSF A;  4A1S A;  3NZU A;  4X8Q A;  1JCR A;  1K1B A;  2XT4 A;  1EA0 A;  2GRN B;  3RO3 A;  3U3W A;  1MHQ A;  2EWE A;  2VFO A;  3GQA A;  3ISM C;  3WXX A;  2VGE A;  1ZBP A;  5EX3 A;  3KAE A;  3ONK A;  4ZHB A;  4N5Q A;  2KZT A;  2WXR A;  4M7C A;  3G2S A;  4U8H A;  3LKU A;  3ZNG A;  3V30 A;  2J08 A;  4GTR A;  1WMR A;  4EZL A;  2EIN E;  4KH3 A;  1E90 A;  1X5B A;  3ASH A;  4ANX A;  3DRA A;  5KJK A;  1RWR A;  3ULQ A;  1WXR A;  2GRQ B;  2ETA A;  5KJM A;  1ELW A;  3IBE A;  3SZ7 A;  3BU8 A;  3CVV A;  3MV2 B;  3FUE A;  1N4R A;  4CCA A;  4AY6 A;  3C98 A;  4HRL A;  2VJJ A;  1HH8 A;  4JD2 G;  2YHE A;  4GTP A;  3CK8 A;  1D8D A;  4YDE A;  1X0C A;  5AQ7 A;  2XGS A;  3AU5 A;  1TYX A;  3T9K A;  1LD7 A;  2VTB B;  2PYH A;  1WAO 1;  3UM0 A;  2BED A;  2C0L A;  1BD8 A;  1Y8M A;  3ABM E;  3SFX A;  4MRU A;  3Q49 B;  2WQ6 A;  1KZP A;  4OZY A;  3GQ8 A;  4U8V D;  3EHQ A;  4HVB A;  3P1U A;  4F1P A;  2IOS A;  3GZ1 A;  4DI3 A;  3FTV A;  4BEP A;  2L6B A;  1Z3X A;  3CHS A;  5AIJ A;  2NSP A;  4NQ0 A;  1OOC A;  2J8S D;  5FTP A;  2H6G A;  1SZA A;  3KSL A;  1OCC E;  4YZA A;  2X6H A;  3V2O A;  5HKP A;  3PNT B;  3EDT B;  2DZO A;  3CVP A;  4U63 A;  4DX2 A;  4I9E A;  3MYV A;  4GYO A;  3K9I A;  5AQ9 A;  3G2V A;  1IYG A;  2DVW A;  3DSV A;  2RFA A;  4J6I A;  3ZVV A;  1OXJ A;  4HOQ A;  4G2V A;  3MKQ B;  3QWP A;  3Q47 B;  4O6F A;  4JB8 P;  3X2Q E;  1N52 A;  4I1M A;  1UN9 A;  4JHK A;  4JZY A;  5CRU A;  1D9S A;  2PL2 A;  4N2Q A;  2BM4 A;  4A3T A;  4Q94 A;  3V2X A;  3FY4 A;  5FZS A;  1BI8 B;  4TUM A;  1E96 B;  1TNU A;  4EZJ A;  5ENT D;  3LVR E;  3ASG A;  3ZYL A;  4EHM A;  3MKR A;  4PUC A;  4GB9 A;  3QAQ A;  3DSS A;  3I5P A;  3PVL A;  3FP3 A;  1WM5 A;  4HWV A;  5CER B;  4FLB A;  2EIJ E;  3UQ3 A;  1N9A A;  1EE6 A;  3PE3 A;  4UQZ A;  4XKW A;  4JVS A;  1SA5 A;  5AAR A;  3VTY A;  1SW6 A;  4ACL A;  5IY5 E;  2YNQ A;  3SBT B;  3ZYM A;  3T5X A;  1AIR A;  3F6Q A;  5J90 A;  3FU5 A;  3GQ9 A;  5G55 A;  3ZHE A;  1KT0 A;  2H6F A;  4HB5 A;  2I2O A;  4XEI G;  4JL0 A;  4TV3 A;  2NYJ A;  2X85 A;  2Q7F A;  3IV0 A;  3UIO C;  3FUH A;  1OFE A;  3RJV A;  2OVF A;  3KEZ A;  2INV A;  5JJ7 A;  3MJW A;  5KJN A;  3UW0 A;  4APO A;  4NRH B;  3GRH A;  3IHV A;  4J0U A;  3FTS A;  3TXM A;  3LY8 A;  1OWN A;  5JMC B;  3B7U X;  4JW1 A;  2WXF A;  1QNF A;  2WPV A;  3DSX A;  3U4T A;  2XT2 A;  3Q7A A;  1RZ4 A;  3ASD A;  2PYG A;  1U2V G;  1N4Q A;  2XTY A;  3EU5 A;  2FEZ A;  2HO1 A;  3BEE A;  2X3M A;  2LAI A;  4XIF A;  4XI0 A;  2J49 A;  2DWZ A;  4L9P A;  3CVW A;  5KBA A;  3SFY A;  3JCK C;  4K03 A;  5G04 J;  3ZSC A;  5DIZ A;  1PY1 A;  4XNF A;  2XGO A;  1E7U A;  4MR0 A;  4GU5 A;  3FDH A;  3L17 A;  2M63 A;  4UWL A;  4ZFH A;  2R2L A;  4B0Z A;  1KLX A;  2RFM A;  3CHO A;  2AXU A;  3PDN A;  5CCM A;  3L54 A;  3ZXS A;  3C72 A;  4YEI A;  2I9C A;  4GZ6 A;  1FCH A;  3CQG B;  3AG4 E;  4I43 A;  5CBO A;  5JHB A;  3W9G A;  1H2U A;  4GZ3 A;  4G26 A;  5FQ8 A;  5JJT A;  1O8G A;  3AS5 A;  1U3C A;  1OWM A;  4WWN A;  4XKV A;  3CHQ A;  3UKR G;  5BV0 A;  1N4P A;  3Q9U C;  4DPR A;  1OFD A;  4I84 A;  2WXK A;  4KZC A;  2J4D A;  4AJW A;  1TSP A;  4EW9 A;  2GRO B;  3L6A A;  5EKQ D;  3RRN B;  3ML9 A;  5CEC B;  2C2L A;  4XKB A;  4N3C A;  1H19 A;  4YZX A;  2VBK A;  1YCS B;  2XRY A;  3UM3 A;  1TN8 A;  5EYL A;  4LRZ A;  3I4R B;  3TWU A;  4XLC A;  4U49 A;  4MBG A;  4OJ5 A;  2QZA A;  3FEY A;  3JUE A;  3AJI A;  3ZXP A;  2IFU A;  2NSZ A;  3JUR A;  1K8K G;  2P9L G;  1OCR E;  2E0I A;  2L0T B;  3GYZ A;  1N11 A;  2EQX A;  3SI5 A;  4RLY A;  3TGO A;  3Q15 A;  4XKC A;  4AIF A;  3EIQ C;  3Q78 A;  3D9N A;  3FTU A;  3QOU A;  1QJV A;  3PZD A;  3SFZ A;  4WWP A;  3RO2 A;  1HG8 A;  5D0O D;  3S2A A;  5D2M C;  4ANU A;  4UWK A;  2WXM A;  3QWW A;  1UOH A;  4KMO A;  4CDN A;  5KCM A;  4FHK A;  1UW4 B;  4UWF A;  5BUZ A;  2BSP A;  5FQ6 A;  3W9F A;  5FZQ A;  4L1B A;  4CEM A;  3V31 A;  4MLP A;  2NT6 A;  2BM6 A;  5ENR D;  2P58 C;  2L9B A;  1OFL A;  4JA9 A;  1BU9 A;  3PET A;  2WXP A;  3KS2 A;  4OAU C;  4KBQ A;  4BX8 A;  5LCW C;  4TRQ A;  5CCL A;  2BM7 A;  3B95 A;  4CT4 A;  3B13 A;  3IHY A;  3QC1 A;  1E8W A;  3B90 A;  3FWV A;  3ONL A;  3RIQ A;  2Y4T A;  3LPZ A;  3TH0 A;  2NXP A;  4MKT A;  5A6C A;  2P9K G;  1K8F A;  5CRV A;  2VSN A;  1XNF A;  3OXF A;  1YMP A;  4J8S A;  1EPU A;  3L16 A;  1G3N B;  4MS6 A;  3UIP C;  2VSO E;  4FA6 A;  1NZN A;  1O5M A;  3LCA A;  2H6I A;  2J4B A;  5CMW A;  2WB2 A;  3DSW A;  4XE0 A;  3ZPJ A;  2BF0 X;  3R7Q A;  2DZN A;  2QYU A;  4LER A;  2XZT G;  3D9M A;  3TWV A;  4AEZ C;  5KWD A;  3LJN A;  2WXH A;  3AK5 A;  1ELR A;  1DCQ A;  1HXI A;  2X6W A;  4C0M A;  5J08 A;  1JRG A;  1EF1 C;  1Y6I A;  5FQ7 A;  4OJL A;  1HE8 A;  3I3N A;  1NHC A;  2X3H A;  4XN0 A;  3MGB A;  2ZIR A;  4XLA A;  3AG2 E;  2KM4 A;  3VSV A;  3LJY A;  3NOG D;  1FT2 A;  2R59 A;  4YZ0 A;  3CHP A;  2V8S E;  2WVI A;  3TWW A;  4ATZ D;  5C1C A;  3SO8 A;  4D10 C;  3ABL E;  3D9O A;  4UWH A;  4OZZ A;  2CHX A;  3EHM A;  1QRB A;  2WMO A;  5DNS A;  1O8K A;  4ILH B;  5B1A E;  1V55 E;  4AVX A;  3FUN A;  3FTW A;  3ZRH A;  3UM1 A;  3ABK E;  1WDY A;  2IEJ A;  5HQ8 A;  3BH6 B;  1O8M A;  1MX6 A;  3Q79 A;  1N4S A;  4APF A;  4GCO A;  2KZT B;  2MHK A;  3BH7 B;  4A1G A;  3HXE A;  2X6K A;  4GZ5 A;  1LLZ A;  4G1T A;  4URR A;  2VTB A;  2J09 A;  3D9H A;  1TNB A;  4N39 A;  4AXH A;  4XN3 A;  4XX5 A;  4I17 A;  3N90 A;  5LP0 A;  4XQF A;  2FUL A;  5CHE E;  3UKU G;  1HO8 A;  4FJZ A;  5BW8 C;  2HYZ A;  2ZGD A;  1IQR A;  3VTX A;  3HVE A;  4WWO A;  3FU6 A;  5T4Y A;  1E8X A;  3LEW A;  2WQ7 A;  1JWG A;  2XEN A;  4XOR A;  4OYS A;  2LSU A;  3FH8 A;  3SHF A;  5LOZ A;  2P9P G;  1VDY A;  3APF A;  2BTD A;  4L2Y A;  2Y4U A;  5HS0 A;  2RG8 A;  3CVN A;  3QAR A;  3SBS A;  1AP7 A;  1AWC B;  2XQ0 A;  4GTS A;  4GZC A;  4I2W A;  2B6C A;  1K4Z A;  4DRX E;  5CMY A;  4TXQ A;  5AJL A;  3UXG A;  4XM3 A;  2GRP B;  5ANR A;  4YEL A;  2VFQ A;  3WWG A;  3HXB A;  2WXL A;  3HIZ A;  1HU3 A;  3NB2 A;  3P2B A;  2MYO A;  2MOW A;  4AY5 A;  1OCO E;  3ESL A;  4HOT A;  4F7A A;  2V0P A;  4J7W A;  3DST A;  3S7B A;  1BPO A;  2AXV A;  2AVP A;  3R9M A;  4BES A;  3BQO A;  3E37 A;  4YND A;  4NUR A;  3ZU7 B;  3Q73 A;  2Z8G A;  4GPK A;  2XTW A;  4G11 A;  1S70 B;  3S7J A;  3P4G A;  2PEC A;  4HQD A;  2LAH A;  1P5Q A;  1O8I A;  1NP7 A;  2BKG A;  3UT7 A;  3TJP A;  1O8J A;  4U0S A;  2GGF A;  1XG2 A;  2ZU6 B;  3TL5 A;  1O8D A;  4G23 A;  1S0P A;  4IUL A;  3R9A B;  1MYO A;  4HI9 A;  5FWQ A;  4F3V A;  4KYO B;  4J8D A;  2FI7 A;  4E6H A;  5A23 A;  2IQ7 A;  2KBX A;  3HXF A;  4QFV A;  4FAD A;  4C2L A;  4PS7 A;  2NTB A;  5AJD A;  1H0A A;  3LXU X;  5EX0 A;  4Y6C A;  3DPD A;  5JHA A;  2H6H A;  3ZN3 A;  1JCS A;  4GZD A;  4UQX A;  2NTQ A;  1EDU A;  3C5R A;  1TJF A;  2XGM A;  2R17 C;  1B89 A;  4U95 D;  1O8E A;  3NF1 A;  4LNG A;  5FZR A;  2FBN A;  4W9R A;  3PZ3 A;  1QZ2 A;  4HRM B;  4O1O A;  5ARG A;  4AP2 A;  1GW6 A;  2ZXW E;  4HOS A;  4L23 A;  2HR2 A;  4C9B B;  1TR4 A;  1HF2 A;  3U64 A;  2NT9 A;  2YHC A;  3T9G A;  1O1R A;  1RU4 A;  2GW1 A;  1O1S A;  2OEW A;  3D9P A;  3E4B A;  3CIA A;  3CQC B;  4NK8 A;  1QYM A;  4P29 A;  3TWQ A;  1NL4 A;  3ESK A;  4LSZ E;  5ENP D;  3BUA A;  4NK6 A;  4JXT A;  1O8L A;  2ETC A;  4UQY A;  4GCN A;  2AJA A;  4HI8 A;  2NZM A;  4W8S A;  3ZEF A;  3DXM G;  4EEC A;  1OWP A;  2XCB A;  3LJ3 A;  4OPW A;  3MZL B;  4U07 A;  4YZQ A;  2IU1 A;  1Q2Z A;  3UI2 A;  3ULE G;  3NBN B;  2QY7 A;  2INU A;  3TG4 A;  3KD7 A;  4HNA D;  1HG2 A;  5BXO A;  1MZC A;  2E2E A;  2LSV A;  2O6W A;  5C1D A;  4PMH A;  1ZB1 A;  4JHJ A;  4MXN A;  5EYP F;  2IOL A;  3HXD A;  4DX7 D;  1DBG A;  3PZ1 A;  4G24 A;  4GML A;  3APC A;  3TXN A;  3JX8 A;  2P9N G;  2DBA A;  5AEN A;  1SA4 A;  3CLJ A;  3WG7 E;  2YQ8 A;  5A7D B;  4F1S A;  3B4N A;  3ZPP A;  1IHG A;  4PS8 A;  3GQ7 A;  4HRN A;  4DX5 D;  4W8R A;  1QBQ A;  3LMW A;  2G0Y A;  2WXN A;  1IKN D;  4N2S A;  2IJG X;  4GAA A;  3I4G A;  4N5C A;  3Q9N C;  2YUH A;  5E75 A;  4CGV A;  4KVO A;  5KNH D;  2F0Y A;  3JQ1 A;  5FT9 A;  1OCZ E;  1TNO A;  2LUH A;  4TXP A;  1UG3 A;  3PRE A;  5B3S E;  2F37 A;  3E34 A;  1HX8 A;  1OGO X;  2QX3 A;  1S64 A;  1PE9 A;  2X6F A;  1CZF A;  3HRA A;  5FJY A;  2EIL E;  3VSU A;  3FUJ A;  1LF8 A;  4M3O A;  4C48 B;  4F6R D;  4GTQ A;  4AVZ A;  2BUG A;  1PC2 A;  1Z5S C;  4B94 A;  2LNI A;  3PUK A;  3Q5M A;  4FC8 A;  4XR6 A;  2KCK A;  3MA5 A;  4U0Z A;  3HVE B;  1N0Q A;  3CKB A;  1EYH A;  4DI4 A;  2ZIS A;  2CHZ A;  4GYY A;  1TYU A;  3S7F A;  3DU1 X;  1L5J A;  3C3O A;  5D66 A;  5AYW D;  3LS8 A;  4B89 A;  4HS2 A;  2KXP C;  2F3L A;  3FUF A;  1JWF A;  4O60 A;  3OAW A;  5EDS A;  4B8A A;  1UJK A;  3ZKJ A;  3VMW A;  4BX9 A;  4BY6 A;  2XRZ A;  4TUU A;  4JPS A;  2WXO A;  3AS8 A;  3Q7F A;  3PNL B;  4KXK B;  4XL9 A;  5ITZ F;  4CYM D;  1MJ0 A;  2I1J A;  4G25 A;  1BI7 B;  3ML8 A;  4WAF A;  3URZ A;  4TXR A;  1H6O A;  1KZO A;  1BLX B;  4CRW A;  2X6J A;  3TWX A;  3FUI A;  2UVF A;  3D9K A;  1RMG A;  3T8K A;  2R05 A;  2QYJ A;  1TN6 A;  3G2W A;  3AG1 E;  4UUC A;  5KJL A;  2OEV A;  3FUL A;  2BM5 A;  3NZS A;  2WXI A;  3QKY A;  3LVQ E;  5LX8 A;  3CVL A;  1E7V A;  3LDZ A;  4U7E B;  3CVU A;  4G8K A;  2WMN A;  4ILI A;  2L0I A;  1HF8 A;  1OGM X;  4B93 B;  1WY6 A;  4J8F A;  1KPS B;  2CG2 A;  2XTX A;  2XS8 A;  4URK A;  2UY1 A;  5FQ4 A;  3D9J A;  5ENQ D;  3FH7 A;  3CHM A;  4BWR A;  5LCW J;  3EQN A;  1JPL A;  3RU0 A;  3FEX A;  1OY3 D;  3Q75 A;  5JJ6 A;  2A4Z A;  4Q96 A;  4YDO A;  1HG5 A;  3FY3 A;  4RG9 A;  4Y6W A;  5G05 J;  4DK5 A;  3N71 A;  4N3A A;  4XZ4 A;  2HE0 A;  1YYH A;  2WXQ A;  3MEK A;  3QB2 A;  4J8E A;  2VSX E;  4JA7 A;  4OJ6 A;  4YDY A;  2VJI A;  3BG1 B;  2VFP A;  2CHW A;  1OWL A;  4LG6 A;  2P9U G;  4ANV A;  4H7X A;  2W7Z A;  5EIB E;  2AW6 A;  4BT8 A;  3C3R A;  1HFA A;  1DVP A;  2WM9 A;  2B0R A;  2J8I A;  3UT8 A;  4J8Y A;  4LCT A;  2ODL A;  4Z06 A;  4LEU A;  4YC5 A;  2XCC A;  1K1A A;  4HLL A;  1KQ5 A;  4WNF A;  4AOF A;  2VSY A;  5G2N A;  4R7L A;  2AWI A;  3N6Z A;  2X6I A;  2J07 A;  1K5C A;  2XC1 A;  2O17 A;  1W3B A;  4BSX A;  3BG0 B;  1H6K A;  3UMV A;  2BKK B;  4LNU D;  3ZYK A;  2UY1 B;  4BTB A;  4U4B A;  4ABN A;  2A5E A;  3DSU A;  4CDR A;  2ZGG A;  2GRR B;  1FVF A;  3JXI A;  1Z3Y A;  4YVO A;  4HOR A;  4GPM A;  5T8I A;  4I6J A;  2DCP A;  2O0V A;  1PXZ A;  1NA0 A;  1KCD A;  4I1O B;  5FIN A;  4U04 A;  1OT8 A;  1ZU2 A;  3C3Q A;  2XPI A;  4PH4 B;  3FFL A;  5ENS D;  4F53 A;  5AN8 A;  3ZHE B;  3SZE A;  2Y69 E;  5M72 A;  3Q4A B;  5T3R A;  2WXJ A;  2P9S G;  3ULY A;  3PEV B;  5D0Q D;  3TWR A;  1TJC A;  5BXU A;  4HLE A;  2X6Y A;  4V3I A;  4W8Q A;  1NA3 A;  5HRY A;  3CV0 A;  2PQR A;  3TG5 A;  3G2T A;  1DNP A;  3HXC A;  2UVE A;  4GYW A;  3PRZ A;  3ZUV B;  3G2U A;  3LY9 A;  3E32 A;  3SYJ A;  2GRL A;  2OOE A;  4A3V A;  1SVX A;  2JAB A;  1IHB A;  1DCE A;  4A63 B;  3E33 A;  4C0E A;  1JUQ A;  2VFM A;  2FO1 E;  3HDX A;  4DLQ A;  2C0M A;  5G04 C;  2IY0 C;  1XGW A;  2IQC A;  1A5E A;  2VYI A;  1JCQ A;  3B7R L;  4JEH A;  3O48 A;  1DBO A;  1LM1 A;  4JHR A;  3PSS A;  2V4H C;  3DPY A;  4IN3 B;  3SY2 A;  1QQE A;  3RAU A;  3J5Q B;  3DEP A;  3VLF A;  5BV1 A;  5BNW A;  3L82 A;  3CR3 A;  3TWS A;  3ZFW A;  3ASN E;  4K5C A;  1MX4 A;  3APD A;  5ANL A;  4UI9 C;  1FPP A;  3T8M A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  2XTX A;  2QZA A;  2XTW A;  2J8K A;  4YEI A;  4YFO A;  3NB2 A;  3PSZ A;  4YCQ A;  2XT2 A;  2O6W A;  2XT4 A;  4YDT A;  3DU1 X;  3SQV A;  2XTY A;  5DNS A;  2QYU A;  3PSS A;  3NAW A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...