4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
4YZAA 1H80A 1JTAA 2QY1A 3GQ7A 4URRA 1AIRA 5AMVA 3VSVA 1O8MA 2VBEA 4XORA 3VMVA 2VBKA 2IQ7A 1IB4A 1O8JA 4OJ5A 5C1EA 1DBOA 2NT6A 1QJVA 1EE6A 4OJ6A 4XL9A 4NK8A 4YZQA 1O8LA 2INUA 4W8TA 1O88A 1K5CA 2INVA 3SUCA 4XOTA 2O04A 3B8YA 4I84A 4PMHA 2NZMA 1O8HA 4OJPA 1IDKA 4XLFA 3WWGA 4XKVA 3GRHA 2NTBA 4XLHA 3GQ9A 1IA5A 4XR6A 3B90A 4U49A 1OFLA 4YEJA 4XKWA 3VMWA 2Z8GA 2QXZA 4XQFA 4XNFA 2NSPA 5C1CA 1PLUA 4EW9A 1KCDA 1KTWA 4OJOA 4W8SA 1DBGA 4W8RA 1XG2A 3FY3A 2X6YA 2O1DA 1O8GA 3GQAA 4MXNA 1OGOX 3KRGA 1JRGA 2NSTA 2O0VA 4XN3A 4W8QA 2X85A 2BSPA 4XLAA 4OJLA 1NHCA 4C2LA 4OZYA 4XLEA 2X6WA 1O8EA 3GQ8A 4XM3A 4HWVA 4NK6A 4YELA 1RU4A 4XLCA 1O8DA 1WMRA 4XMYA 4U4BA 2VJJA 1OGMX 1O8FA 4YZXA 1O8KA 2UVFA 1OOCA 1X0CA 4YZ0A 3T9GA 1QCXA 2EWEA 4OZZA 2ODLA 1GQ8A 1OFMA 4XN0A 1VBLA 4Z06A 3JURA 3ZPPA 4Z05A 2NTQA 1BN8A 2UVEA 2PECA 2QX3A 1CZFA 2O0WA 3LMWA 1PE9A 4MR0A 3ZSCA 1HG8A 3EQOA 2PYGA 2NTPA 3B4NA 2VJIA 2NT9A 2VBMA 1IDJA 1O8IA 2X6XA 3UW0A 4Z03A 3VSTA 4XONA 1RWRA 1BHEA 2X3HA 1KCCA 2O17A 3EQNA 4XOPA 2PYHA 1RMGA 3VSUA 1PXZA 4AVZA
chains in the Genus database with same CATH superfamily
2XF6A 2DQLA 4GYGA 5E20A 2BM0A 1HKTA 1J9ZA 2YU3A 3RQIA 3OL4A 3O2PE 2HDDA 3RIQA 4EGZA 2D1VA 1O8MA 3E97A 5AN9A 2QYOA 3JR9A 3HTUA 1XGNA 2LKSA 3P9CA 4BUPA 2X0KA 3ZQ7A 4ESFA 3DFGA 2V79A 2MA3A 1R1VA 1PDNC 1YW9A 3QPTA 3BCFA 4ACBA 4XL9A 3ERMA 2FX3A 3I0TA 4HV5A 3TDZC 4E7IA 2CFOA 2H94A 1LDDA 1FBUA 2OBPA 3PFIA 1ZR2A 1MNEA 5HNFA 1VQKI 4G94A 4ZYDA 2R7ZJ 2P7VB 3CCMB 4FQGA 2AHQA 1YIJI 2TCTA 2M3AA 2XAJA 3WWGA 4Z4SA 1NJID 1HCRA 2WV1A 4FK8A 4OIOF 4YFOA 2VC0A 2P8TA 4NCNA 3ZQFA 3I64A 2CF4A 3RKWA 2QTZA 2RV8A 1ACIA 5LLQA 5TRDA 3BR0A 4DNRB 3BQZA 4LK0F 1S72B 4FT8A 3F8NA 1YG2A 2WA0A 3W6JB 4KIGA 5EMNA 3SZPA 3J80Z 4FCYA 3B78A 3IP4B 4CCOA 2KJBA 4NC8A 2X6YA 2P3MA 4AIKA 1ZYRF 1BLIA 2WZPP 1A36A 3BCAA 4V2FA 1U2WA 3CCYA 1J75A 2VUMJ 3OP1A 4E7LA 1IXSB 3M3YJ 1HVXA 1TQMA 3Q6QA 2ESHA 1EFRA 1A8PA 4TMTA 1D3YA 1QBJA 1EP1B 1T6ZA 3FXOA 2M7BA 1W36C 2FSWA 4IW3B 3K4JA 2F4NA 3V7SA 3LSRA 1MJAA 4TV7A 5FKKA 1B2RA 3FXJA 5CVUA 3K4BA 1HKQA 4PGGA 3KP3A 1T95A 4D7MA 5M5YJ 2ZFWA 5K1YA 3QFTA 1O8KA 3MKYB 1W1WE 2M2EA 2V26A 1VQ5B 1EH6A 1HSTA 3N4MA 2VNJA 1CF7A 3G6EI 1P4MA 3WTTC 4WXDA 3ERED 4HDUA 1USTA 1GQ8A 1JUMA 2MABA 4RD1A 1WWXA 2DT7B 3GF2A 1Y0UA 1QRCA 1HW1A 1PUFA 4RB2C 4CHUA 4HSRA 2QKMB 3BZKA 2NVXJ 4O3MA 3LNNA 2ZMEB 4YAUA 2LF8A 1P4XA 3NAUA 3LJYA 2E1MB 3FMSA 1QHGA 2F2EA 3LSIA 2R5YB 2YX7A 2ACJA 4A0XA 1NH3A 3MFKA 1ODDA 1RUOA 2BM5A 4JRAC 1SVLA 2D9RA 2E71A 2X6XA 3E5UA 2GOMA 3M8EA 5ICGA 4RBOA 5HS7A 1VQPI 4HF2A 1N05A 1VQ9B 4MLOA 2P0WA 1S5LC 3OZWA 3HSFA 1IRXA 3AG4H 2NVQJ 3AGQA 3T5XA 4C43A 3BY1A 5H59A 1YJNB 1WJAA 2HDWA 2W24A 3LA7A 1OCTC 1VQOI 2QSFX 3CC4B 1XS9A 1R9TJ 1WKMA 4L5EA 1DARA 1N77A 3T8RA 2FA5A 4ZDLA 2M30A 4RGRA 2XSDC 1MJ9A 3ZN1A 2YR2A 1G3YA 2L5QA 3D1NI 1P9QC 1P6RA 3A0BC 3QPLA 3CC7I 1DU6A 1OHHA 3QU3A 4Y4RA 1RR8C 1OGIA 4D9JA 2V1NA 4XORA 4JX6A 2VBKA 1WI9A 2QZAA 4J19A 4RGXA 3K6GA 2VFMA 3WG7H 4M3EA 3G1MA 1V4RA 1KQSB 3W3CA 4CA0A 1U9NA 1Q81D 5IT3A 3VB2A 1WTHD 2M4GA 2JN6A 3U1DA 1YYVA 4CYCB 2NTBA 3CDLA 3BC8A 2IA1A 4G5GA 2W85A 2XPUA 5BNGA 3LL7A 4G6DA 4Y7NJ 3G4SB 3PNTA 3VMWA 2OA4A 2R5ZB 2TDXA 4YXWA 2Z8GA 1C0WA 2D3NA 2VLAA 4ZJZA 2I1LA 3CZ6A 4ZGQB 2H27A 2W1OA 2VBYA 3FK6A 3MKZA 1WSUA 4K2EA 1LJ9A 2V7TA 5HZBA 3Q6RA 2J5PA 3H5AA 4NUBA 5ERIA 3RTRA 4CSWA 4RPDA 4LG3A 2VBZA 3M1CA 1K7AA 3KRGA 1WRJA 3ZQGA 3S2WA 2V7WA 2H1KA 2KHMA 3RPUD 1SFUA 4PJ0C 1MH3A 2BW3B 3DKXA 2Y0SN 3GW2A 1SVMA 1BR4A 2M1BA 4EJTA 1WPKA 3CP2A 4U0VA 2B9SA 4AC9A 3L7WA 1P7JA 2R9VA 2WSSA 1O8EA 4BQNA 1BI0A 1BQEA 3AGPA 2CUJA 2M8EA 4JX4A 2X53S 3VO1A 1FWZA 4XK4A 3OV8A 3CMYA 2HTJA 3SZGA 4N9IA 1WDTA 3AVVA 2CUZA 3RKXA 2LVSA 4I98B 1FTZA 1VQPB 1IUFA 2O8KA 2L2OA 2Y0SA 3QSYA 3BOQA 5DYMA 4HF1A 4P9SA 2VN2A 3LO8A 4XN0A 4X8IA 2R93J 2J8IA 4ASUA 3CD6I 1I7PA 2CMPA 3CTAA 2M5WA 2L7FP 2R6HA 3QAHA 4HAMA 4NC6A 1W0KA 2BF4A 4G7WA 2V5IA 2PYGA 4CCMA 1S4MA 3CXCB 3EQOA 2O0YA 3BCBA 5BPIA 2R7TA 2VJIA 2DMUA 4NHJA 3NWTA 2IXSA 5CVIA 3I58A 3OYNA 3HRUA 1BX0A 4HDVA 5FKMA 4ABZA 4MTDA 4U7DA 1IW7F 1GVJA 4A3KJ 2KRHA 3QU6A 5TY0A 2DK8A 2LP0A 3C2BA 1UD4A 5KSWB 2JUCA 3WE3A 1FEXA 2O03A 5EGOB 2JZYA 1MRZA 4A5MA 2FMYA 4AVPA 5IP6A 1REPC 1PXZA 2AO9A 3P7NA 3ZP5A 2GM4A 3AK5A 2JSPA 2CV0A 1WFXA 1QZZA 3NEUA 1IG7A 5HLGA 3TQNA 3IAS2 1K4ZA 4KH3A 3JU4A 3FPKA 4Y3OA 3ABUA 4A2UA 2ZJPF 5L3GA 2E1BA 4LJZF 3BT9A 4OPOA 1MMGA 2W84A 3KPHA 4K1XA 3VMVA 2PJRA 1S7EA 2LK2A 2IGKA 1WGXA 2JK3A 1B72B 3LQEA 5J8CA 1WP6A 3JRDA 1MGTA 5LHGA 3G73A 4BS9A 4KMFA 2ZSIB 5ILSA 2R7WA 3CESA 3EYYA 3W2IA 1GXPA 3DLAA 4D1QA 4XKBA 4EV0A 3VFZA 5F4JA 3BH6B 4X0CA 3BG7A 3IWFA 3ZMZA 4YFXF 1JXSA 4XKVA 4AYBN 1ZELA 2OZ6A 4AIJA 4WWVA 1QA1A 2C78A 2X1EA 1ETKA 4M6VA 2ZMEC 5LGUA 4XRSA 2E1MC 2VFQA 3CB4A 2GWRA 2XKOA 1Z77A 4ROXA 1W0UA 5TR9A 4PC2A 5FO1A 1SVOA 1HSJA 1EKEA 4PJMA 4ON0A 4FASD 1N25A 2KDOA 5ICFA 4A0ZA 1APLC 2FF4A 4MEYF 4EM1A 1LVAA 3LSGA 3LSPA 4A3IJ 2E2JJ 2CK3A 3ASQA 3CRZA 5FJ8J 2EWNA 3A8IA 1NHAA 2BHYA 5GAEJ 1ONVA 1FNDA 2A61A 4RM2A 2X3UA 2BEOA 4OOSA 4AYBA 5JLWA 4QTRA 1OGOX 1COWA 4QVAA 1X3ZB 3FM3A 3SDBA 3HPHA 3I4NJ 3S3NA 1A5JA 5HDKA 4G6IA 1QRBA 2NSTA 1T0FC 2MFZA 2HVQA 1HKSA 2DCUA 4N4OB 4EM0B 5TJJA 4BEHA 4L5IA 2L4AA 4O5VA 4M74A 1RI7A 5GTIC 4OAZA 2E7WA 1BOAA 1R6RA 2V9VA 2GIZA 2KIUA 3H5NA 4IZZA 1OB0A 4NK6A 2FBIA 5EG0B 2ZZFA 1TL8A 4C9YA 4X7CA 2D1HA 1U9OA 1ZRFA 4BL0B 4WXCA 1BA5A 3U6BA 2FVGA 1OISA 4UV8A 4BQAA 4CH7A 4YZXA 3C7JA 4OIPF 1MH4A 4RD0A 4CCJA 5B6IA 2O6WA 4W8QA 2GJPA 2QCOA 3OYCA 1IN8A 3QFSA 1LVKA 1WJBA 2VL8A 1EJ9A 2EIXA 3NB2A 3VOEA 4RPBA 3VYRB 2ZL7A 2LY2A 3V8LA 4B44A 1AKHB 2Q1ZB 1POGA 2FD5A 1OLTA 1VQ4I 3VWBA 1BN8A 2LY9A 3S17J 3A03A 3GFLA 5A89A 2O0WA 3U6KA 2JA7J 2VQLA 1UAAA 1HG8A 1LDJA 3I56I 5F64A 3WNDA 2MH9A 4E7SA 2NRAC 2YU9J 1ZHFA 4NQWA 5KK1A 1OMIA 1CGPA 2X9DA 2VB6A 3IKVA 2B0LA 2LLKA 2XZOA 1I5ZA 2GJKA 1Q1HA 2LG4A 4D5CA 1YOVB 4Y15A 3FKJA 4CO8A 2IS4A 1JKRC 3V7AA 1B6AA 1QO0D 3GMEA 2VPLA 1KCCA 2WBMA 1U8RA 3SQNA 1BI1A 3S3MA 2JRTA 3PSIA 5DSZA 2EV6A 3KEQA 4G9YA 4LLNA 2PYHA 3Q0VA 3CUOA 4I01A 2ME6A 2Q6LA 1RMGA 3KP6A 4ESJA 1YFHA 1T5EA 5THXA 1AIRA 1JTAA 5DNSA 1FYLA 1FIAA 3H3ZA 4BBRJ 2IOUG 1Z6TA 3DU6A 3JCUC 1X3UA 4H9GA 3LWFA 1QGPA 3OYGA 2XAUA 2GIVA 1UD3A 1JB9A 1WHUA 3SYTA 2BVMA 3WQZA 3QRFF 1QHHD 2PMDA 3A0HC 3I9V2 5HDGA 1ZRCA 4IHYA 4Y52J 1N0UA 5E3OA 3BY2A 3CW2A 1B59A 3SFIA 4DYRA 4A3EJ 4RMNA 2VQHA 2HKOA 2PG4A 1K6OA 3SY2A 4W8TA 1H8AC 2QLZA 1XTAA 3DCFA 2CO5A 2PBIA 2DO7A 3H3VK 1PJ7A 4G7ZF 3OYHA 1A35A 4EATA 3JRAA 3W5HA 4MFEA 4XLFA 1T6XA 3OYFA 2XEXA 2ZL5A 2KIQA 1ERDA 5DM6F 3WY9A 2IJLA 2HS5A 2OK8A 3R60A 4UUSA 5DM7F 5K7ZA 2R3SA 3COAC 1KGSA 4X07A 2QXZA 4XQFA 1GLNA 2ZSHB 4QIWN 3JAMK 1X58A 4G7HF 4PCQA 1SFXA 5DUKA 4A3DJ 1OR7C 1EP2B 4P3YA 2R7DA 5L3BA 3I71A 2Y69H 1BOBA 4M53A 4RCYA 4TMXA 1XE1A 2XPWA 1VQ7I 3A02A 1X1CA 4BPRA 3PUBA 3SKBA 2MD0A 4BGDA 2BVLA 1KU9A 1R1TA 3ZZTA 3CUQB 1W4MA 4F92B 5F27A 1FNBA 4ASNA 2ZNYA 1VQ4B 5M5XJ 4HNUA 3BJAA 3A01B 3SHFA 3GQ8A 2KJCA 3GXOA 4L9JA 4HWVA 2ZBKA 2LKPA 3AG1H 3TOAA 3FXRA 2KZGA 4FISA 5FRMA 3CCJI 1WMRA 3F9KA 1E62A 1WCMJ 1GAQA 1WJFA 2W82A 2WZNA 2ZXHA 2DU9A 4EJUA 1J09A 3WTVC 3EUHC 4YZ0A 5F4MA 5M3MJ 2HOSA 5FD6A 1MBJA 1E0EA 4EQQA 2IT0A 2VOOA 2NS8A 1CNFA 2GOXB 3K1PA 1FBSA 3KYDB 5KCMA 1F9NA 4ZV4A 5IYQA 1F1ZA 2LKXA 2D3LA 2RVCA 3H3UA 3BNWA 1Q82D 4C2UA 2EK5A 1U78A 3BCDA 3S15J 1CZFA 2V1UA 2HPIA 1Z67A 1S9HA 3F6OA 3HUGB 3JRHA 5IT9K 2L3DA 3I3LA 1MBFA 2Z99A 3DBLB 4M4SA 2MYSA 5JHFA 4Q47A 2BMWA 3LSMA 4Z03A 4IJAA 1K78B 3C2GA 2DFEA 2M7AA 3I4PA 2OU2A 4X0GA 2VOPA 1KK2A 4Z6YA 2R7QA 5A2QZ 3M1EA 2CGPA 2P5VA 1DPUA 2A3SA 1RESA 1FYMA 2ZXJA 2XZLA 4MFDA 1DPRA 1E1RA 1UD6A 5LFAA 3U2QA 3CPWB 1YO5C 3D0SA 4KMUX 2KLOA 3R61A 5EEHA 3SZTA 2A68F 5IYRA 1R22A 2WADA 5J1YA 2HXOA 3CCRB 1VQ6B 1GT0C 2QSGX 1RKWA 3ML6A 5C1EA 1OYWA 5JMCB 2DTRA 2ZMEA 1PKVA 2DI3A 3BR1A 3FX3A 4UUVA 1YRNB 1Y0RA 2HPMA 3ZBUA 3ZPNA 5TISC 1IZ1A 4G7XA 1TWGJ 2R5YA 1H88C 2O04A 3ASSA 4UZEA 3BG6A 3P4GA 2P6SA 2ZKZA 2QZ8A 5BSXA 1IDYA 5ICCA 1SFOJ 3HC7A 2M9HA 1IN4A 3IUOA 1B4AA 4ZC3A 4RB1A 1K73D 3B90A 3JAMZ 2LF7A 3EUAA 2QWWA 1YLOA 2VPRA 4ENNA 3O8GA 3I5UA 3MAJA 1LUJB 4JK1X 1J2XA 2WY8Q 4YCQA 1JKPC 3F21A 3Q3AA 4X7EA 2Z33A 1ELOA 2NNNA 3FXMA 1JT0A 4BDYA 1BI2A 5FNZA 2OBTA 4BEHB 1G4DA 4QV2A 4F3QA 1LNWA 2R7SA 3SXYA 2B7BA 1EFTA 2P5KA 1JRGA 1E3XA 3UNGC 3WTSC 5JLXA 4IHVA 1DABA 3OR2C 1W7PD 3FXKA 4JX5A 5LEJA 1X3WB 4N4NB 1QH0A 1TWFJ 2BM7A 3B02A 2WAFA 3TEDA 3G3ZA 1HW5A 5H2FC 4XIDA 4J0QA 2B7EA 4HQMA 9ANTA 3Q0WA 1GVDA 2OPTA 5KHDA 2PI0A 1FSHA 3E6CC 1UHMA 4CYCA 2K85A 2P4WA 2ZC2A 3AAFA 1MNDA 3LYCA 3N6ZA 4WXHA 4ACAA 2HQNA 2NV4A 1V5GA 3DP7A 2MLGA 2R7UA 4KIBA 4QSHA 2R5ZA 3BDDA 2XGEA 5IYCJ 3J7YJ 1MBGA 2ODLA 2CQXA 1SD6A 1Z05A 4Z06A 3ASRA 4ZDOA 2W25A 1QPMA 2CW8A 2XIGA 2KIMA 4N3GA 3SJZA 4GFBA 4PGOA 2QENA 4I76A 2ZB9A 3JRFA 4RM0A 1ITYA 1AMOA 3FHZA 4P9UA 3HOXJ 2QX3A 2LDUA 2OYNA 4V02C 2DJIA 3A1YA 2YWHA 4PFPA 3QODA 3MN2A 2NT9A 1GO2A 3L2CA 2BW3A 3TMOA 4RAGA 2KPMA 2OCCH 4PFOA 4JOMA 3DU1X 1GV2A 5IOYA 1RR7A 1XCBA 2LRDA 3Q9SA 3V42A 3H0DA 1IO2A 1ZRDA 2E1CA 2CUFA 2HI3A 1F5TA 4XRMA 2WWYA 4XOPA 1NRKA 3ISPA 2ZZEA 4FN5A 1ZGWA 4AVZA 2LTPA 3CUQC 2QY1A 2ME0A 3GFIA 1F4KA 1PUEE 2ZL6A 2XTYA 2JTVA 3BJ6A 1SKYB 4KT6A 3K70C 5LMZA 3OL3A 5C3EJ 2K27A 2DY1A 1TT5B 1LEAA 3MWMA 3F0CA 3TO6A 1QVUA 1W2BB 3W2WA 2CV1A 1Q86D 3VDXA 3MZHA 2VT2A 4DZPA 2HMAA 2RC5A 4M9SA 3OAAA 3HKZN 3I1FA 1KJZA 1OCZH 4UAJA 2GXAA 3AVTA 5K5OA 2UWMA 3LFKA 2EFPA 3H1CA 1LPQA 5E6TA 2UUZA 2B0RA 2L02A 1AIPA 2C2WA 2ZNZA 4ITVA 1V5EA 3HSEA 1Y1WJ 2INVA 2JMWA 3HBLA 1G7TA 4RDJA 4HZFA 5IYPA 2A5WA 4R1HA 2BGJA 1OR7A 1QQ1A 1IDKA 3NAWA 2Y48A 4A3BJ 2YS9A 5H6QA 1FYKA 1J7KA 2EZLA 4JYKA 4B48A 1DDNA 5LRSA 1N06A 4PC1A 3HKZA 2V7FA 3KETA 5IY5H 3ZMUA 2KP6A 1IDZA 2K4JA 1MZBA 2RNJA 2NVTJ 4LK1F 4E7KA 1VF7A 4QLCU 2GK7A 3W2FA 1M1KD 3CCQI 4XKCA 5EGOA 1LEBA 2NSPA 5HLIA 3R6JA 1OFCX 5HVQC 2ECCA 2C6YA 2MW8A 4CCNA 3T8TA 2K5CA 2QYUA 1X19A 3QQAA 1O7FA 3OOCA 4L9VA 5E1XA 2DLLA 4MYUA 1IRZA 1LLZA 4AC0A 4HF0A 4HLXA 4CDGA 4RM3A 1H42A 3WGGA 1B72A 2E1NA 2C4TA 5L3EA 1A04A 3Q38A 3OSFA 1W0TA 2C4UA 4MIMA 2OK7A 3EUHA 2O3FA 3BC9A 5HXBA 1R23A 4QPOA 1UG2A 1NK2P 3HOUJ 4BNCA 1UMKA 3AVYA 2NPFA 3GFMA 3DQVC 4GQNA 2P6TA 4YIFA 3DPTA 3HL2A 2CFXA 4NBQA 3H94A 4W1UA 2CNDA 2K86A 1VQ8B 3PUMA 4CQJA 1ENHA 3BR2A 3WNBA 1B9NA 3T53B 1SAXA 3K4CA 1RETA 3CC2I 2F5DA 4DYQA 1OQYA 3A3BA 2ZZQA 1N78A 1SC7A 3ASPA 3FMRA 3V7RA 1QA3A 5GPCA 2VJ4A 2LBFB 3IV5A 4RD3A 1LDKB 5B66C 4OOIA 1G7SA 4M72A 2W6JA 1BM9A 2QA4B 3VSKA 2DTZA 4JMQA 4IKFA 2L9NA 3HRTA 1STZA 1OGJA 2A6TA 1H8EA 2F1LA 1IDJA 4RCZA 1CQXA 4M2LA 2AHOA 3QYBA 4OIRF 3RCOA 2PE3A 2DYIA 1FC3A 4EVIA 5EG0A 4I2OA 4RLZA 1W5TA 3K0LA 2HQRA 3PNYA 2DQRA 2OTLI 3D26A 4OPWA 3ZBTA 3K4LA 3U2RA 3F8MA 1TWAJ 1MABA 5HS9A 5AMVA 4AWXB 3HRMA 1D8JA 2BY2A 4X05A 1ZM9A 1TZLA 4PJNA 1HDPA 2W48A 4X7FA 1XFOA 1AKHA 4A5NA 1D1CA 3RYRA 1FSEA 5K7FA 2QQAA 3N05A 4BY1J 1WOOA 2F5FA 2WAEA 3PQKA 4Z2YA 4ZYHA 3CCQB 1BI3A 2JUGA 1QJVA 3ZCOA 2KISA 3TGNA 3E5XA 2INUA 3GZ6A 2FEZA 4ENKA 1W9XA 5GPAA 2XROA 4Y9UA 4CZZA 1V0EA 2BOLA 3DBRB 1VQKB 2BE5F 2E34A 3GRHA 2XNCA 3Q39A 1YS6A 3TH0A 1NK3P 1TQPA 3HAGA 1YIJB 4ZCLA 2JJ1A 1X4PA 3VO2A 4XR6A 1WU8A 1FP1D 2XV4S 3DDYA 1ULYA 1TTYA 2BBYA 2EZHA 1KQ0A 2KRFA 1HDDC 3UKGA 1K83J 2Q8KA 2V4DA 1JJ2B 1WJCA 3CJQB 1QG0A 1E79A 1ZH5A 1UD8A 2D74A 3E6BA 4B8XA 3GWZA 2IVMA 5HOOA 1T39A 1K9MD 3FJOA 2IGNA 2BXZA 3ABTA 1L0OC 2YWEA 1EE6A 4P1VA 1SFEA 2HCJB 1G3TA 2DT6A 2XF7A 3FISA 2OV7A 5M3FJ 1P2FA 4IHTA 1QGYA 2D45A 1IJWC 3LSTA 4I02A 3T0YA 2FNAA 3OOUA 4E70A 2DETA 4OJLA 1A6QA 2JJ7A 3ASNH 3GTGJ 3CO6C 1EFCA 1KONA 2FX0A 3R0JA 5EZHA 4C2MJ 3PIPF 2STWA 4OZYA 3GVAA 5AONA 3HG9A 2VC1A 2WYRA 3KP7A 4YELA 2EJRA 3BR6A 2M0MA 2DOGA 4E6KG 5LGTA 4XLCA 4DK0A 3RZDJ 4PDKA 3ZMDA 2Y9ZA 2FRHA 1YIOA 2VJJA 1O8FA 3BZ6A 2E2HJ 4OOXA 3S1MJ 1JUPA 2A6HF 4UXNA 2L7KA 1BN5A 4L5JA 3PUFA 2FUG2 2DA2A 2FJ1A 2DFFA 2OF7A 1ZREA 6PAXA 3GTMJ 2L7ZA 1W35A 4EJWA 3VMFA 2VT3A 1FOYA 3FMQA 1ETVA 5D4RA 4B3GA 3ZPPA 4Z05A 5GP9A 3G6EB 3PSZA 3V8JA 1I8DA 2A5YB 3KZYA 3OYEA 1ON1A 2X1DA 5IK2A 5FKLA 1L1IA 4YG2F 3JTGA 1H0MA 1RZ4A 1JKQC 1HF0A 1FZPB 1K79A 3LFUA 2X51A 5AIQA 3SEZA 1S29A 4A6EA 3CCUI 3CUQA 4R8HA 2EFWA 1VLYA 4I0AA 4M71A 2HDCA 3EDPA 1X2NA 4X7DA 3A01A 2GA1A 2RQPA 4I09A 2DJNA 3OYBA 1RWRA 3F3XA 4YC5A 2VKVA 1BMFA 4L9TA 2HTSA 5ED4A 4FE7A 3R4KA 2ZBVA 1L3LA 2DN0A 1X2MA 3L2QA 1YX3A 3VSUA 1T98A 3KYCB 1R71A 2OQRA 2DPUA 1QU3A 1FMWA 1H80A 1Y39A 3F22A 1VQOB 1ETWA 3VODA 3L2VA 3FXQA 2D5VA 2P7CB 2W00A 3FWEA 2DA3A 1ZLJA 1BJZA 3J7AY 2GQQA 3WU0A 1O3SA 1N07A 4P6VF 3ZUGA 3CC7B 2L01A 1XDSA 4S05A 2ZXWH 1Z3XA 1GXQA 2K7LA 5IYDJ 5EF6A 2HU9A 2ELJA 3I59B 1D5YA 3JQQA 2HOAA 3OZUA 1IRFA 4PUSA 2VNHA 2K9MA 2RKHA 3HUGA 3SUCA 2NZMA 1O8HA 4MQ9F 1FX7A 4A69C 1O3TA 4OJPA 3U21A 3V4GA 5FO0A 1KK0A 4F52A 1K78A 2K3PA 1EH8A 3DEWA 3ZQQA 4LLLA 2CV2A 3DV8A 5D6EA 2ELHA 5K7HA 4ENMA 5FKOA 1OB5A 4XKWA 4DW6A 5JR3A 3D5RC 4DGWB 1EZGA 3ABKH 1K8FA 2NNYA 4XBFA 1PLUA 2LY1A 3K1NA 2JJ2A 1UFMA 5DUIA 2B63J 3PFYA 4PGHA 1DBGA 4YEIA 2BY0A 4Q7JB 5B1BH 2F6CA 1R5HA 3GVJA 2HOEA 3FY3A 2PMUA 1JTXA 2X0LA 1R5OA 1LKXA 2ELKA 2VKEA 2YUHA 1PYVA 1FIPA 4XN3A 2JPBA 3W2EA 2ZTNA 4PAAA 1E63A 5CQGA 1HA8A 4JP0A 1YRNA 5E3NA 4FXUA 3BG5A 2ZJQF 2R7RA 1VHEA 4B47A 1VF9A 3FDYA 5D5WB 1N75A 1O3RA 2XHKA 4WF2A 4V2GA 4FWTA 1OKRA 3VEPA 3CCUB 3C1DA 4ENJA 1N08A 3B82A 4C3JJ 4BE0A 2V6EA 2YX4A 3W6VA 5JLVC 4TT3A 1WJDA 4DIQA 4OZZA 1FY7A 2NVUB 1JNYA 5HS8A 2O61A 3HPGA 3CCEI 2VBTA 2H8WA 1GAWA 2EZKA 4OPVA 3HOTA 4YAOA 1E3ZA 4PZJA 3S8PA 4L0YB 3SFZA 2G9WA 2UVEA 2GLOA 4KDPA 3WYAA 1PE9A 1RKTA 3K9TA 1M90D 3CD6B 1D1BA 4P25A 4LLGF 2F48A 3WTUC 4XSXF 3CCLI 3MCZA 4HW0A 3ISXA 5HKKA 4QHYA 4DBRA 1WORA 3E20A 1D0YA 2JA5J 2AS5F 2DYRH 4A3LJ 1SEUA 1QZEA 1UHWA 2A69F 3HZJA 3QP6A 3KLOA 1Y6IA 5LEKA 2DERA 3AVXA 3CJTB 4N0BA 1MNMC 2BX6A 3OKXA 3L9FA 4TSFA 1O88A 4RDKA 3A35A 2XTXA 2BHZA 2QM3A 1RUNA 4M3BA 2W4SA 3W5UA 1MIJA 4PJLA 1JA1A 3OEEA 3ABMH 2BM1A 3QWLA 4LMYA 3ES9A 3WBJA 2K3FA 1XN7A 1KD1D 3ECOA 4MQVA 4A3FJ 1G6NA 1W34A 2WTEA 3E7LA 4ZYAA 1HLVA 2HR3A 1Z21A 2I5UA 1DP7P 2F5EA 1BW6A 2OTJI 2JA6J 1DBOA 5CKTA 5DCFA 2EFNA 3CMAI 1BX1A 5KNLA 2VQCA 5E18F 1MMDA 1UELB 2PJPA 2HLDA 2JWTA 1HBXG 3GUDA 2ICWG 1W0JA 5IOZA 2JDIA 1ZKGA 5K5QA 4EM2A 4M3DA 1U5TB 2V6CA 1YW8A 4ETSA 5A2QK 1IA5A 3ROUA 3O8HA 4I99C 2FBKA 2XAGA 4RD4A 1SM4A 3A1PA 1OFLA 4YEJA 2V1DA 4IQJA 3W2VA 3FM5A 2W6IA 1FNMA 1JI8A 1V3FA 2STTA 5F4OA 4LGWA 2HYJA 4E7ZA 1NDHA 4TMVA 3ZMSA 3RIRA 1TWCJ 5GADJ 1KCDA 1D2EA 4PC6A 2F5VA 4W8SA 3VPRA 3LQQA 2HVRA 3LQ6A 4P22A 2X1CA 1WSRA 1OCCH 2M87A 4W8RA 4OMYA 3C18A 5HZAA 4P5OA 1B8IB 5DD8A 4DYCA 2DEUA 2V7UA 2DT5A 3FBNB 2DA6A 2EINH 2ZO4A 3OIOA 2DYSH 1XGSA 2XUBA 3NWSA 3LQRA 1Z6RA 1QUFA 2L7MP 2IA0A 2PIAA 3EUKL 4ZZLA 2QQ9A 4P3IA 3CPXA 2XVCA 2IEKA 1TSPA 2IRFG 1UD5A 1Z3YA 3BG9A 4L8JA 1VQLI 3CDIA 2UZKA 2XF5A 2WB1N 3IWZA 5AIPA 2ZCWA 2YUSA 1QPIA 3EYIA 1QVTA 1BIBA 3TW7A 2PQ8A 3OYKA 5FGMA 1Z0XA 4KUMA 4W97A 4IO9F 5B5EC 3JRBA 4U88A 3M4OJ 1MBKA 1WXRA 4LBVA 3RI4A 1IB0A 2GK6A 3PSSA 4GRIA 2ID6A 4G1VA 1X1PA 5L3CA 1HF2A 1KQ9A 2O8XA 2WB1A 4HIZA 2EA2A 1TLHB 3CP8A 2XRLA 4QWQA 5DTDA 2CU7A 2Q2EA 4ZTFA 3TW6A 1SMYF 2CJJA 1VI0A 1Y56A 3TO7A 3L2UA 2NVYJ 4BDZA 2JT1A 4U7BA 3I56B 3GTJJ 3CMEI 1YJ9I 4G8XA 4WCGA 2OTJB 4LB6B 3OYIA 1ZG1A 3ONUA 3HYIA 4YFKF 1G3SA 1Y0YA 2LNBA 1R5GA 3OS1A 2BYVE 4P2NA 4CGZA 5DV5A 4F55A 2W7ZA 3BWGA 4JBAA 4IX7A 4AUXA 2ECBA 2B5OA 4ZH4F 1Y0NA 2DFIA 4IXAA 4P1WA 3F8BA 5E79C 1K6YA 4BHCA 2VJ5A 1D1AA 4IHSA 2H6BA 3RSNA 2EIJH 2V4JC 1F20A 4WZLA 4WZEA 5GAHJ 4IQ4A 2LBFA 5EDNA 1WH5A 1Z1DA 4HPQA 4DJAA 3BH7B 4MNUA 1IXRC 1OB2A 4B3AA 2VZLA 4S04A 1TYXA 2MSYA 2M8GX 2QE7A 2IGMA 3KYLA 2COBA 4WX9A 2OBSA 3B8YA 4I84A 1J59A 1D8KA 2NS7A 2R4GA 3CCSI 5J47A 3PIOF 3CF2A 3AL0B 2DMTA 3ELKA 1QFYA 3W2GA 2IS6A 2R7VA 4DK1A 1IF1A 1TT0A 1XG1A 1OCOH 2B7CA 5CLSA 3ZR8X 1R4MB 3F6VA 1XSVA 2ESNA 1DUXC 4PSXA 5FKNA 2Z6BD 3BQJA 1DQUA 1AOYA 1R58A 2XRNA 3HOYJ 4OOVA 4MYTA 4BU2A 1VQLB 4M3FA 5B3SH 4B1RA 3DTIA 3CJNA 2EV0A 1W7PB 2PMHA 4KA4A 1QFJA 1LM1A 2DOFA 2QBYB 1E3PA 2NYXA 1TYVA 1U2RA 3ZQCA 2XAFA 2VE9A 3NE5B 5E1WA 1V5VA 2GA2A 2KFDA 3F8FA 3H36A 3H92A 5L3DA 4C3IJ 4D5FA 4E4HA 1K4SA 1K28D 5LHIA 2QN6A 3OZVA 4BE2A 2CRGA 4NB5A 1VQ7B 2ZJRF 4AD9A 4G6TB 4IRIA 1WOSA 2Q6KA 1NHCA 2GAUA 4A3GJ 1SD7A 4QVJA 1DG1G 3IH4A 2RDPA 1RQRA 5JI6A 1TBXA 1YITI 1JHHA 1VTNC 2XC1A 3CCVI 3SYJA 1OGMX 3OPOA 2E35A 3CCJB 3A2KA 1HQCA 5B1AH 1QA6A 1MMNA 3EETA 2LZJA 3CMEB 3AVWA 1MBEA 1A6IA 1GJRA 3K2ZA 4ZDPA 4G12A 2K40A 4KITB 3MVPA 4A3JJ 2COMA 3DLLF 5FFZA 2HFHA 3LOCA 5FLXZ 2UXXA 3RPUA 1MBHA 4ANJA 4Y13A 2IS2A 1VQMI 3SLNA 2Y75A 1U5TC 4KIFA 4OU0A 3S1QJ 1D8TA 1EP3B 3T56B 1U8BA 4MR0A 1OPCA 3W6KB 3HOSA 2ETHA 2JSCA 4XLPF 4F93B 1E64A 5KVRA 2ZBUA 3BR5A 4DZJA 5JFRA 1B23P 2XPVA 2NOJB 4DQ2A 1IV6A 4MGRA 1TLLA 2J8KA 1P7IA 2CQ7A 2AXLA 2EQRA 1SD5A 1NBMA 2CSOA 2EFQA 1JJ6C 1QX4A 1JA0A 3FIWA 4HSTA 3TKYA 2R0QC 2AQEA 1QVGB 3ZOBA 3PJRA 1EH7A 4ZTJA 2X6OA 2KRCA 2G0EA 3IH2A 1ORKA 2MC4A 4IL6C 1JUSA 5E3LA 1T2KA 1X1DA 3RZOJ 3VSVA 3LA3A 5ILUA 1FNNA 1ZGJA 3S32A 2DMNA 3DEUA 1T33A 2LSOA 5J35A 2WAQN 2C77A 2IPQX 4H0EA 2BZTA 2IP2A 2BGIA 1VFCA 1LE8A 1T56A 1IV8A 1G7CA 5E8GA 1YI2I 5LGNA 3TBIA 1W36D 3HIFA 5E1ZB 2NS0A 1JHFA 3RPQA 1ETOA 1P92A 1E2XA 4OAYA 1IGNA 1O3QA 1O57A 4V19K 2FE3A 1S7OA 2EA4A 5CVJA 3OY9A 2KL4A 5IYBJ 3MMPA 4Q4ZF 2NAZA 5D5XB 5BMZA 1FOKA 5H5JA 2K9LA 1KMHA 1S8NA 2XKPA 3ONYA 2WAQA 2YPRA 5IP7J 2H09A 3GTPJ 1WQ2A 1USSA 4Z4WA 4XRFA 3KEOA 2MG4A 4IEJA 4IVNA 4IOCF 2VONA 2Y30A 4MHGA 4B09A 1AA7A 4HOBA 3PM1A 4OJOA 2F1MA 4TKOB 2E7XA 2DBBA 2PMZN 3O3KA 3CCVB 3FHNA 1HA3A 2V1XA 2OQGA 1DDIA 4RDLA 2M34A 3ZGKA 4MTEA 1O8GA 4X06A 3H9GA 2L9RA 3BR3A 1IRGA 5C4XJ 3RKYA 2DXIA 3Q0UA 3I59A 5JVTA 3K1MA 4R79A 2W7NA 1T8IA 1XB2A 3WXMA 3LAPA 2CW7A 2LOOA 2PLYA 2G7HA 4BJTA 1FPQA 2ID3A 4HV6A 4I0BA 3QP5A 2GXBA 4J01A 4LIVA 5J3OA 3KP5A 2DOAA 2PMZA 3OW2B 1XD7A 1K8AD 2HGCA 4M9ZA 4CYDA 2M4KA 4FX0A 4RB3C 4QPQA 1IJEA 4KFCA 2QGGA 3W5VA 1KTVA 5FL7A 1KZLA 4KKUA 1SAUA 3CF5F 2DA5A 2E1RA 3SEQA 3ZRGA 3I54A 4EMSA 2XOKA 2XZPA 3VNVA 2Q2EB 1OFMA 4LG0B 1QQIA 5DEQA 1VQNI 4AF6A 2R7OA 2NOGA 4AIDA 3AL0C 3BY6A 4XRSG 2VYQA 1ETYA 3HOVJ 3EPZA 3FBIB 4BYYA 3IHUA 2BXYA 1AWCA 2VXZA 4AU7A 1H85A 3IRQA 3ZSCA 1BJAA 1H9GA 2CG4A 2X4HA 2JRMA 3KP2A 1VQ9I 4OWRB 3KEYA 2R7XA 2EH3A 2LD5A 2YWGA 4OPSA 2HWVA 4F91B 1VZ0A 2BY3A 5F6FA 3UW0A 4UUTA 1YS7A 2MGQA 4BJ6C 1YJNI 4IHXA 1W87A 5CPRB 2DA1A 3CC4I 1YI2B 1UD2A 3I55I 2NXNB 4X1EA 2GZWA 3HJEA 3Q9VA 1BC7C 4AF7A 1HZEA 3K69A 1FJLA 1NB9A 2O17A 4I6ZA 3BPXA 1NB0A 3ZC3A 3KP4A 4PK4A 1GDTA 1FTTA 4PJJA 3NRVA 4Z4TA 3GQ7A 4M73A 2BM6A 2IAIA 1XSXA 2L4MA 3KZIC 2JN9A 3WHCA 3OW7A 5D5VB 3JRCA 1DP3A 4UZFA 2ZXIA 3FF5A 1E3OC 1O7LA 2HDNB 3PVDA 3FKSA 3BJOA 2Z16A 1MSFC 4FE4A 4OJ5A 4Q48A 2HOTA 3ZMVA 1X1AA 3DXJF 2FNPA 2J7KA 2HKXA 1DGWY 1EV7A 4OP7A 4CICA 5F0HA 3HEFA 4ZCIA 3G1OA 2EILH 2Z3YA 3G4SI 2XNDA 3CLOA 3HHHA 5JHUA 5L3FA 4Y9RA 2Q6IA 3Q5FA 5FIUA 3JQPA 4YHBA 2QSHX 3HGGA 1R5BA 4YIRX 4RLQA 1QFZA 4F7ZA 3GTLJ 3QOPA 5J1UA 2QDXA 3DF8A 5TV2A 1QZYA 5A8AA 4Z4ZA 4RJLA 2VFNA 1UCRA 4BACA 1XMXA 4HNVA 3A4CA 4PC3A 2MD5A 4PSWA 2QVOA 3MHPA 4AIHA 1KQ5A 2BM4A 5J4YA 3F8CA 2LC2A 2TRTA 2CS3A 5E3MA 1LFPA 4HYEA 1XGOA 2O1DA 3K10A 1ZM3A 2CYYA 4MO7A 2H8RA 3TO9A 3SJMA 1YTYA 4BAYA 1HC8A 4DQLA 2BSPA 1K61A 4P12A 3PO2J 2OZUA 3E6DA 1VQNB 3WU1B 4MEXF 2F4OB 3KLNA 2FOKA 3LMMA 2DODA 2Y0MA 3M8FA 2DA7A 5BOXA 4N9HA 1KU2A 4HX4A 3P9KA 3HB9A 4HQEA 2HZTA 4LBYA 2XB5A 1U5TA 3MMYB 5LHHA 4A93J 4C0SA 1KQ8A 1YX2A 3SJPA 3SQVA 4II2A 1V5FA 2LR8A 3E3VA 3JW4A 3OYMA 1TYUA 4B43A 2DFHA 1FOWA 3KX2A 4CXFA 2WC2A 2XTWA 4AM3A 3I55B 2OCEA 1E3HA 1VBLA 3H9JA 4U0YA 5IP9J 2XNJA 3CC2B 1MDMB 2NTQA 1ETXA 3OMYA 3S93A 1Z7UA 4WQMA 1B8IA 4LBZA 3KFWX 4Y33A 1I50J 2PEXA 1EXMA 3JX8A 3F72A 3M8JA 1S6LA 3ZXSA 1LFBA 2PN6A 3B4NA 3GFJA 4HX8A 2DK5A 4Z4UA 1O8IA 3J81K 2KZVA 1NG7A 4U0WA 2MLKA 2VQGA 2VODA 1FX0A 5BSYA 2V7XA 2IBDA 3HTSB 1IC8A 3E0JB 2JA2A 1XSDA 1QUEA 1BHEA 2DMQA 1TC3C 1SMTA 3DU5A 3OE7A 3I4MJ 1MKMA 3CO7C 4BE1A 2VNKA 3HOZJ 4KT5C 1CLWA 3PETA 4KN7X 3GLXA 3I53A 5DCMB 5IYNA 4EGYA 3OR1C 4M6XA 1T6SA 4UVAA 1LE8B 2IS1A 2OTLB 5ILVA 3TDUC 1D0XA 4YIIA 2VI6A 3H5RA 3ZQHA 4M1KA 5J4VA 2F43A 2VBEA 3N97A 2X48A 5CYVA 3RKQA 2HVSA 2KQRA 5EEGA 2XAQA 5FROA 3E1YE 2GPJA 1Z7LA 4XD7A 5EJCA 1J0RA 3CMMA 3HRSA 3AKZA 3T51B 4NK8A 3WTWC 3G1LA 1A31A 1QRYA 1H8HA 3C3WA 2PFBA 1QGAA 2I10A 5ICEA 2RGVA 2QEXI 3BTJA 1DU0A 2WPDA 4PMHA 1TW2A 2MH2A 2V9KA 2ZJ2A 3G71I 3GTOJ 3K4KA 4UHTA 1B1BA 4O6JA 2Z1DA 3MQ0A 3L00A 4HA8A 4LITA 2XDVA 3MZYA 1YJWI 1B9MA 1BR2A 4A12A 3J7AO 4BKXA 3A8JA 4OM9A 1GUUA 1T08B 3K4MA 3R6SA 3KIOA 4BHBA 3FKIJ 1S7AA 1ZUNB 1EA0A 2ZITA 4TMZA 3CJRB 3HSRA 1XG2A 5DS0A 4YDTA 3GQAA 2HQAA 5TGTA 4HRIA 1G8XA 1PP8F 4OIQF 3WTZA 1I1GA 4GXOA 2ISYA 2O5RA 3ZPLA 2RN7A 1Y1VJ 3OIQA 2EIKH 1TVCA 1LLWA 4X6AJ 4OINF 1FOXA 1G2HA 2QMUA 1IHMA 4RA2A 2X6WA 3WHBA 5FRNA 4XLNF 3RJPA 5EZGA 3KCCA 1FMVA 2JVGA 1AU7A 3C2HA 4A3MJ 1VHOA 2DMPA 2VFOA 4UV9A 2BVNA 1O8DA 1S0UA 2E5ZA 3SLDA 1I6XA 1IUYA 1ZLKA 4P26A 3GTKJ 4U87A 1GHCA 4RGUA 4PC7A 2XT2A 1V55H 3K2AA 2I8DA 3R0AA 4U4BA 3VYSB 2UVFA 1WJ5A 2E36A 2DDBA 3WU2C 2K9SA 3B6AA 1F60A 1V0FA 1X0CA 3U1KA 2LH9A 4BQOA 2EWEA 4LD5A 3DTKA 4I7HA 2RC4A 3IC7A 3S3OA 2ADUA 2QKLB 3MD2A 1GR1A 1FT9A 2XGCA 3GEZA 1KA8A 1W7PA 2EBIA 3N90A 4J00A 2VE8A 3WTYC 2QBYA 1J9IA 2BY1A 4UB8C 1EF4A 2FU4A 2HNHA 1G7RA 3REOA 2DIEA 1JTYA 3KL9A 2A05A 3J81Z 2CH0A 4CCKA 4FX4A 4B3XA 1FDRA 3M07A 4TMWA 4C30A 4Z4YA 2G0YA 1OCPA 5F0FA 3WE2A 2C5BA 1MMSA 2CW0F 2F4MB 5D8KB 5HDNA 1OYYA 4NNJA 4UVCA 1R1UA 2KKOA 3M9AA 4EJOA 2GREA 4YAFA 3L1PA 1JGSA 2G7UA 1H9TA 1VNDA 1JE8A 3PSFA 4U9UA 3P27A 5GTHC 1WPCA 3E1SA 2QQ8A 5JBQA 2QEXB 1ZTRA 3BTCA 3PUNA 5FD5A 2J5OA 4A3CJ 3B8HA 4URRA 3G71B 2M45A 3GVKA 2IA2A 4IF4A 1TWHJ 4M9XA 5J3LA 4G7OF 2VNIA 1LB2A 2F4IA 2JVHA 4OMZA 3V8KA 3MZ8A 4H4KC 3LNQA 5H20A 3VSLA 1PJ5A 1YJWB 1MMAA 2O7OA 1NTCA 3AG3H 3ASOH 1BJKA 4G6QA 2V31A 4KN4X 1P4AA 5F04A 2CQNA 2NT6A 4RS8A 3OEHA 1I6HJ 2DW4A 4HNTA 1E43A 1R00A 2HYGD 5CVVA 2BSAA 3TL4X 4KICA 1FBQA 4BH9A 3DKWA 5IYWA 3DKYA 3BLYA 1M1EB 2CC2A 4DQKA 3OSGA 2VFPA 3TP0A 4N3NA 4XLHA 1KK1A 4F7DA 4R71A 1X4OA 3BROA 5FLMJ 1UHSA 3B6CA 3E5QA 2LREA 1YHQI 3P26A 4U49A 3ZN0A 1RQPA 1Z9CA 2D2WA 3PNVA 2PLFA 1YLFA 2UV1A 1CF7B 5C1CA 1ZAOA 3MKLA 3OYDA 1KTWA 1IAWA 3K7AJ 3QPHA 2ZTGA 2FXAA 3WTXC 2P81A 2R7FA 1PUFB 2Z9OA 1Q7YD 3IL2A 5LBQA 1EWYA 4QFMA 3KZZA 1UZCA 2EB7A 1YE9A 2E1OA 4WK8F 3ZQLA 1R5NA 4MXNA 2KMUA 3F23A 2O0VA 1SANA 2E2IJ 3VYTB 1ZN2A 4ZGNB 1SD4A 1JGGA 2X85A 3J7ZI 2VBVA 4UZUA 4CCLA 4C2LA 2W57A 4HBLA 4BXUA 4FETA 2R92J 1XGMA 1XQBA 3SEJA 4EEFG 2P5LC 3AG2H 4DOZA 5F1JA 2YWFA 1I27A 3L2WA 2BPOA 2VBXA 3VNUA 3UR3C 1SKQA 1MJBA 3AVUA 3KE2A 2K02A 1CQTA 3ABLH 1XCVA 4NDLA 2OAZA 3Q3SA 1OCRH 2VBUA 3QYFA 4DNCA 1R5ID 3OJXA 2O9LA 3T9GA 1FP2A 1UG0A 3DBHB 2CW5A 1R36A 3OIPA 1KU3A 4Z4VA 2CRVA 1FNCA 1WJEA 3BH4A 1I1SA 1RNLA 1GV5A 2WY7Q 1E1QA 2OBRA 5DN6A 1QA2A 3JURA 3S2DJ 3WBKA 5C44J 3NARA 2XT4A 3GX4X 2L0KA 4HE5A 2PECA 3CCEB 1D5VA 2BGCA 4KKSA 2XB0X 2XASA 2HXIA 1P4WA 3LSJA 4IPAA 4BHPA 1Q1VA 5M5WJ 5HLTA 2XGJA 1EFUA 3VSTA 2FOWA 3CCLB 1QGZA 1XX5A 1ZQ3P 1N8RD 3PA1A 2OUMA 3DPLC 4L9NA 1BBYA 3JSOA 4HE6A 1QNTA 4HG2A 5CDFA 1D1NA 2K4BA 4B4CA 5E8IA 2WV0A 2UXNA 4IRGA 1TW3A 3HGYA 3RYPA 3L2RA 2M5SA 5HNHA 5KW9A 2EZIA 1GVHA 2Q6OA 1I39A 3IAM2 3FPPA 2RNGA 1KRHA 2O6GE 2HEOA 3GZ5A 5F08A 4ZZDA 4BJ5C 1VQ6I 1VLOA 3CCRI 2Y31A 2QQBA 4BBSJ 2VASA 3TOBA 5FLXK 2EFGA 2L54A 4BQQA 4RD6A 4S0HB 3G05A 2WJYA 4LG0A 5GV8A 1PJRA 1KU7A 1YHQB 1JT6A 3DPUA 5KAIC 4NC7A 2GXGA 3K4NA 3WNCA 3OWTA 2RC6A 1UB9A 3QPSA 2CBXA 4DNTB 4OJ6A 1XDUA 5A88A 2F5CA 5D8LB 2BN4A 3HXLA 1ZGAA 2F3LA 3LA2A 3OJWA 2GBYA 3CMAB 1TNTA 1ZK8A 2VIXA 5J6XA 4IOAF 3H09A 2GQFA 3BTLA 1RC9A 1Y8QB 4RAZA 2BV3A 4FTHA 1TQIA 1XPXA 4M0LA 3GYHX 3GQ9A 3V76A 3E6MA 3H35A 5E17F 3DEEA 2AQFA 2FQ3A 3FK7A 4GCVA 4UNOA 3B73A 3KEWA 1TUIA 3LSHA 3FZVA 3D5SC 1WSVA 3JRIA 5LD2C 4P9FA 2N8GA 4GYIA 2V9PA 4XNFA 3X2QH 1I3AA 2V7VA 2OJED 5FO5A 4EW9A 2A6EF 5F1RA 4WWCA 2K9NA 3VYUB 1KYZA 3OYLA 4Z4RA 5D5UB 5K5RA 3A3GA 1WI3A 1XMAA 3P9IA 4KKTA 4C3HJ 1Q9SA 1F43A 4RAYA 3JQRA 3OOPA 3S14J 2IW5A 2DPDA 2L9VA 3W2AA 3OS2A 2VBSA 2M0CA 4CUGA 3OYAA 4XLAA 1RRJA 1MSEC 2A07F 4LB5A 3PO3J 1XB4A 3H9NA 1R7JA 1HXDA 1ZARA 2YSRA 3BP8A 1W5SA 4XLEA 2V7QA 3JREA 4HEA2 4L0ZB 5C4JJ 1T6YA 4G1BA 4E7JA 4XM3A 4ESBA 4QUZA 3OS0A 2HYFA 1U6GA 4ZCMA 2CUEA 2PX9A 5GV7A 3ONQA 5IPAA 1IXCA 4YAWA 1K4TA 3HHGA 1BPLA 4YFNF 2XC7A 1TYWA 4II3A 2ZFUA 5FLVA 3K70D 2XSJC 1KK3A 2C5HA 1YX5A 3ZZUA 3A8KA 1FRNA 1QCXA 2E60A 3PQJA 1V54H 4B4DA 3PL8A 3LVBA 4XICA 1IN5A 4Y17A 5HLHA 2JQ7A 1AHDP 1QVFB 1Z91A 1WZ2A 1J5YA 5BPDA 2PJRB 1MD0A 3AFHA 2X8KA 4A6DA 1E17A 3R6KA 4LIUA 2IGOA 1YW7A 2LYCA 3ZQIA 3FXUA 4D0PA 2CWEA 1D0ZA 1ETQA 3WGIA 2DDAA 2Z2SB 4GGGA 1X1BA 3BG3A 1ZG3A 3GVLA 2HZDA 2KVOA 1WH7A 2XGXA 2EIMH 3QOEA 2VBMA 2MC3A 2LFBA 3CLQA 4EJVA 3RDIA 3JTHA 1SFKA 2KIFA 3BTIA 3MEXA 3V7CA 3IH3A 1PJ6A 2GJRA 3GTQJ 4PABA 4EH1A 2EFOA 4XSZF 2H1LA 5D4SA 5LRRA 3IRRA 3GQBA 2Y2ZA 3HDDA 1YJ9B 4ZYGA 4LBWA 4NBSA 4C2TA 2DCEA 1FRQA 2Z5UA 3RY8A 3RQ4A 3GBGA 3WGHA 5FA6A 2HQ5A 1G3WA 1O4XA 1BL0A 4YZAA 1UMQA 4KISA 5FFXA 2VKHA 1H89C 4B3FX 1N0VC 1W5CC 3HOWJ 1T0FA 1VJSA 3IKTA 5CVRA 2QF7A 5D6FA 3U9GA 4RAFA 4BXXJ 1NG6A 2IQ7A 1MDMA 2XAHA 1F36A 1IB4A 1O8JA 3JRGA 3W2HA 4P55A 5J1RA 3EQLF 3GO5A 3GLLA 4LFUA 1MW7A 1BR1A 3ZMTA 2CQQA 1DGRM 3GSIA 4YZQA 3O6BB 1O8LA 3GCMA 4RB0A 1OJLA 5J40A 4CZCA 5J8FA 2L9SA 3ESWB 2KDZA 1K5CA 4XOTA 1U0JA 2JIZA 3QFCA 1PVEA 2EPFA 2BV6A 4A0YA 3MCAA 4DBQA 4E7HA 4YRVA 4FHTA 3T1BA 1HOMA 3SDGA 1IJFA 1ON2A 2E19A 4P96A 2VXDA 5GAGJ 5DS9A 2FBHA 3VR6A 3CCSB 3BZCA 2DA4A 1TNSA 1RIOH 2JA8J 5L46A 1PP7U 3J81k 1R4NB 4Y7CA 4RD2A 3JSPA 2OD5A 5EYRA 5BS6A 2JPCA 4TN1A 3HM5A 1RPWA 5DCMA 1IN7A 4WZTA 3CDHA 4KYWA 4ZYEA 2RQQA 2KT0A 5KAFC 3CCMI 3DWLE 4RLFA 5HODA 1Y8RB 1UJ8A 4WZKA 1U3EM 1FLIA 2FMLA 4LC0A 3J80K 2ISZA 1OFDA 2XGDA 3NQOA 1IN6A 1CNEA 1TTTA 3QYEA 4KJZA 4UY8I 4NQWB 1ZG5A 1JJ8C 4GO1A 4JQFA 1YQAA 3WODF 1JKOC 4P6YA 3M7GA 1XMKA 2AXTC 5IT9Z 1S72I 3MKWB 3QE2A 5DD4A 3S16J 3G2BA 4GDFA 1ZM2A 4UB6C 2WR8A 3LSKA 3ASTA 2RREA 4HX7A 3D5LA 4RGSA 4LOCA 3ZIAA 5F0CA 2QGUA 1VQ8I 1RU4A 1KYWA 3S1RJ 4IRHA 1G59A 4XMYA 2ZZGA 3H0GJ 4IHWA 1YITB 3WG9A 2Y9YA 1S3JA 3PENA 2CQKA 5DDGA 4UVBA 3TP3A 5FB2A 1T38A 2VBWA 3PA2A 3GIRA 3QFRA 1OOCA 2VKDA 3ML3A 1EA3A 1HW2A 1XC5A 2E5NA 3ECHA 1LQ1A 3LAJA 4Z1MA 1WVRA 1ZM4A 2Q0OA 5CQEA 1BW5A 1I3QJ 2RAEA 3P5JA 4KNYA 1TP4A 2QA4I 1R49A 3GZNB 2LMDA 4M6YA 5EEAA 4E0FA 3LMWA 2MBFA 2WJVA 1OYIA 1VQMB 2QUFA 2DAOA 3OYJA 3S2HJ 3OFNA 1I18A 3H9QA 2OC6A 3L09A 4BY7J 2QTLA 4HLYA 2NTPA 1BIAA 2K9QA 2DOEA 5JVGF 1LFUP 5CJ9A 5H6RA 1VQ5I 4M3GA 4BXFA 4RDUA 4YALA 3BPVA 2FQ4A 1BC8C 3DTEA 4XONA 4UUSB 2X3HA 3FXLA 3S1NJ 1ZR4A 4Q5SF 1DDGA 5BQTA 3EQNA 1KC8D 3CQZJ 3BQYA 3ULQB 4L18B 3SZEA 1KZHA 1WOPA 2H6CA 4D7NA 3ZZ0A 2EV5A 1OFEA
chains in the Genus database with same CATH topology
2XF6A 3A35A 2XZLA 1E1RA 2W4SA 3OR1C 5LFAA 4PJLA 2IS1A 1UD6A 3OEEA 3OL4A 1D0XA 2KLOA 3H5RA 1O8MA 2VBEA 2F43A 4ZYAA 4BUPA 2WADA 1Z21A 2HVSA 2KQRA 5C1EA 5FROA 1DBOA 5CKTA 3BCFA 1Z7LA 4XD7A 4XL9A 3AKZA 3CMMA 5KNLA 1PKVA 3T51B 4NK8A 1H8HA 4E7IA 2VQCA 1MMDA 1UELB 2CFOA 2HPMA 2HLDA 3ZPNA 1MNEA 5HNFA 4G7XA 2O04A 4PMHA 2WPDA 3BG6A 2V9KA 1W0JA 2M3AA 3WWGA 3K4KA 2JDIA 2Z1DA 4LITA 2XDVA 3HC7A 1IA5A 4ZC3A 3IUOA 1BR2A 3B90A 3EUAA 1OFLA 4YEJA 4IQJA 4DNRB 3W2VA 2W6IA 1JI8A 3K4MA 2WY8Q 4E7ZA 2WA0A 1KCDA 2F5VA 4W8SA 4BDYA 2HVRA 4P22A 2X1CA 4W8RA 3CJRB 3IP4B 4BEHB 4CCOA 1XG2A 4P5OA 4NC8A 4F3QA 2X6YA 2R7SA 3GQAA 2HQAA 1BLIA 5TGTA 4HRIA 3FBNB 2WZPP 1G8XA 1JRGA 1E3XA 3UNGC 3BCAA 2O5RA 3NWSA 4E7LA 3OR2C 1HVXA 3OIQA 4N4NB 3EUKL 1EFRA 2WAFA 2X6WA 5FRNA 2M7BA 1W36C 5KHDA 3K4JA 1FMVA 2JVGA 3C2HA 1UD5A 1Z3YA 4L8JA 1O8DA 2XF5A 2E5ZA 3K4BA 1MNDA 4U87A 4U4BA 2I8DA 1T95A 3OYKA 3VYSB 1O8KA 1WJ5A 2UVFA 3MKYB 1X0CA 1V5GA 1V0FA 2V26A 2R7UA 2LH9A 4BQOA 2EWEA 3DTKA 3S3OA 2ODLA 1GQ8A 2QKLB 2MABA 3MD2A 4Z06A 4ZDOA 2DT7B 2CW8A 2GK6A 4GRIA 4HSRA 2QKMB 4J00A 3LNNA 2QX3A 2WB1A 2E1MB 2HNHA 3CP8A 4HIZA 2DIEA 2DJIA 3A1YA 4ZTFA 2CH0A 1QHGA 3LSIA 4CCKA 4PFPA 4B3XA 1Y56A 3QODA 3L2UA 4C30A 4BDZA 2NT9A 4U7BA 2BW3A 3TMOA 2X6XA 2KPMA 2GOMA 4PFOA 4MLOA 2P0WA 4JOMA 4NNJA 3OYIA 2LRDA 3V42A 3H0DA 1IRXA 3PSFA 1WJAA 3OS1A 4XOPA 1NRKA 2HDWA 4F55A 1WPCA 2ZZEA 3E1SA 4IX7A 1N77A 4AVZA 4ZDLA 2QY1A 4URRA 3GVKA 4P1WA 1SKYB 4KT6A 3K70C 2L5QA 1K6YA 3OL3A 2F4IA 2JVHA 1P9QC 2VJ5A 4H4KC 1D1AA 3VSLA 3RSNA 1OHHA 4Y4RA 3W2WA 2CV1A 4D9JA 2V4JC 3VDXA 2V1NA 3OAAA 4XORA 1MMAA 4IQ4A 2LBFA 2VBKA 2V31A 4HPQA 4DJAA 3K6GA 2UWMA 3OEHA 2NT6A 1E43A 4HNTA 2UUZA 4ITVA 1V5EA 2IGMA 3W3CA 3KYLA 2QE7A 3TL4X 2INVA 3B8YA 4I84A 4CA0A 2A5WA 2R4GA 3BLYA 3DKYA 1WTHD 2M4GA 1IDKA 3CF2A 2NTBA 4XLHA 3AL0B 3BC8A 2IS6A 2R7VA 4DK1A 4B48A 1TT0A 1X4OA 3LL7A 3HKZA 2V7FA 2KP6A 2LREA 3PNTA 4U49A 3ZR8X 3VMWA 4E7KA 1VF7A 4YXWA 3PNVA 2GK7A 4PSXA 2Z8GA 2D3NA 4XKCA 1DQUA 2Z6BD 2UV1A 4ZJZA 2VLAA 3CZ6A 2NSPA 5C1CA 2W1OA 3OYDA 4BU2A 5HVQC 1KTWA 4CCNA 2ZTGA 3MKZA 3DTIA 2K5CA 1X19A 3H5AA 4NUBA 3RTRA 3OOCA 4CSWA 4LG3A 1YE9A 3M1CA 3NE5B 4MXNA 3KRGA 2KMUA 2O0VA 3OPOA 3VYTB 4W8QA 4RM3A 2KHMA 4E4HA 2X85A 3RPUD 1K28D 4BE2A 2BW3B 3DKXA 4G6TB 4CCLA 4UZUA 1BR4A 1NHCA 3CP2A 4C2LA 4FETA 3BC9A 4QPOA 2R9VA 2WSSA 1O8EA 4BQNA 4DOZA 3L2WA 2CUJA 4GQNA 3DQVC 3HL2A 3DPTA 3UR3C 2X53S 3SZGA 3H94A 1OGMX 2CUZA 3A2KA 3QYFA 3T9GA 2LZJA 1MMNA 1UG0A 3T53B 3K4CA 3OIPA 2L2OA 2Y0SA 4ZDPA 3A3BA 1WJEA 2ZZQA 1N78A 3BH4A 4KITB 2WY7Q 1E1QA 4XN0A 5DN6A 2VJ4A 2LBFB 3JURA 4ANJA 2IS2A 4ASUA 1LDKB 2CMPA 2PECA 4MR0A 3T56B 4KKSA 3HOSA 2W6JA 4G7WA 4F93B 1W0KA 3EQOA 2PYGA 4CCMA 3VSKA 3BCBA 4JMQA 2NOJB 2L9NA 4IKFA 2R7TA 2VJIA 2A6TA 1H8EA 3NWTA 1IDJA 5HLTA 1NBMA 2XGJA 3VSTA 2IXSA 4HSTA 3QYBA 3OYNA 2AQEA 3RCOA 5CDFA 2KRHA 2OUMA 3DPLC 4HG2A 3PJRA 1UD4A 4ZTJA 3PNYA 3L2RA 2M5SA 5HNHA 2KRCA 1PXZA 3K4LA 2MC4A 3IAM2 3FPPA 2JSPA 2RNGA 1WFXA 2CV0A 1MABA 3IAS2 4BJ5C 5AMVA 1X1DA 3VSVA 2VASA 3JU4A 4Y3OA 3S32A 2E1BA 1TZLA 4BQQA 4PJNA 3G05A 2WJYA 1PJRA 1MMGA 1D1CA 3DPUA 3VMVA 4NC7A 2PJRA 3K4NA 3N05A 3OWTA 2WAEA 2IGKA 1WP6A 4DNTB 2JUGA 1QJVA 4OJ6A 3ZCOA 3TBIA 1W36D 4BS9A 2ZSIB 2R7WA 3CESA 2INUA 3HXLA 3DLAA 4OAYA 2VIXA 4D1QA 4XKBA 1W9XA 3BG7A 3OY9A 1V0EA 2BOLA 2KL4A 4XKVA 3GRHA 3GQ9A 3HAGA 2K9LA 1ZELA 1KMHA 2JJ1A 1X4PA 3H35A 2WAQA 2X1EA 3DEEA 2AQFA 4XR6A 3DDYA 3KEWA 3LSHA 2E1MC 2V4DA 3D5SC 5LD2C 1WJCA 3CJQB 4XNFA 1E79A 1UD8A 5HOOA 4FASD 1AA7A 4PJMA 4EW9A 2KDOA 4OJOA 2F1MA 2CK3A 4TKOB 3LSGA 2IGNA 3VYUB 3OYLA 3FHNA 4RM2A 3ZGKA 3A3GA 2XF7A 2DT6A 4AYBA 4KKTA 3H9GA 2OV7A 1COWA 1O8GA 3SDBA 1OGOX 3HPHA 3S3NA 4G6IA 2NSTA 1T0FC 2MFZA 3OS2A 2HVQA 3W2AA 3OOUA 4CUGA 4XLAA 3OYAA 4N4OB 2DXIA 4OJLA 4BEHA 2W7NA 4R79A 1KONA 4OZYA 4XLEA 2CW7A 2LOOA 3HG9A 2V7QA 4OAZA 1R6RA 3H5NA 4HEA2 4BJTA 4IZZA 1OB0A 4E7JA 4XM3A 4J01A 4LIVA 4YELA 2ZZFA 3OS0A 2DOAA 2PMZA 4C9YA 4NK6A 2M0MA 4E6KG 4XLCA 4DK0A 3ONQA 4BL0B 1BPLA 2M4KA 2XC7A 4II3A 2VJJA 2ZFUA 4CH7A 3K70D 2XSJC 4QPQA 1O8FA 4YZXA 1YX5A 2L7KA 4CCJA 5FL7A 2GJPA 1KZLA 4KKUA 1SAUA 3OYCA 2FUG2 1LVKA 1QCXA 3SEQA 1WJBA 2E60A 2VL8A 3ZRGA 3PL8A 2XOKA 3VYRB 2XZPA 2LY2A 2Q2EB 1OFMA 4B44A 4B3GA 2Q1ZB 1OLTA 3ZPPA 3VWBA 4Z05A 2PJRB 2R7OA 3AL0C 1BN8A 3AFHA 2X8KA 1I8DA 4LIUA 2IGOA 3EPZA 3FBIB 3OYEA 2LYCA 2O0WA 2X1DA 5IK2A 2VXZA 4AU7A 1D0ZA 2VQLA 1UAAA 1HG8A 3ZSCA 4E7SA 2Z2SB 4OWRB 1X1BA 3KEYA 2X51A 3LFUA 3SEZA 2R7XA 3GVLA 2HZDA 2KVOA 2VB6A 4F91B 1VZ0A 3QOEA 2VBMA 1VLYA 3UW0A 2XZOA 4BJ6C 2GJKA 1SFKA 2LG4A 2GJRA 3OYBA 5CPRB 1RWRA 3FKJA 2IS4A 1BMFA 3GQBA 1UD2A 1KCCA 2VPLA 2WBMA 3S3MA 4C2TA 1HZEA 2O17A 2DCEA 3PSIA 2PYHA 3RQ4A 3GBGA 1YX3A 3L2QA 4PK4A 1RMGA 3VSUA 4PJJA 4YZAA 1QU3A 1T5EA 4KISA 1FMWA 1H80A 1AIRA 1JTAA 3GQ7A 3OW7A 2VKHA 3L2VA 3DU6A 1DP3A 4B3FX 2W00A 2ZXIA 1VJSA 3OYGA 2XAUA 1UD3A 3FKSA 3SYTA 3J7AY 2BVMA 3WQZA 1NG6A 1QHHD 2Z16A 2IQ7A 1IB4A 3I9V2 1O8JA 4OJ5A 1Z3XA 1EE6A 1MW7A 1BR1A 1X1AA 2ELJA 2HU9A 1DGRM 2VQHA 4RMNA 1O8LA 4YZQA 1DGWY 4CZCA 4PUSA 4W8TA 1K5CA 2L9SA 2K9MA 3SUCA 4XOTA 1U0JA 2JIZA 3OYHA 2NZMA 1O8HA 4DBQA 4E7HA 4EATA 4YRVA 4OJPA 2XNDA 4XLFA 3U21A 3OYFA 4F52A 1ERDA 2K3PA 2VXDA 3VR6A 3ZQQA 2CV2A 4RLQA 4XKWA 3D5RC 4DGWB 2QXZA 4XQFA 1GLNA 2ZSHB 4BACA 1PLUA 2LY1A 1OR7C 3A4CA 2JJ2A 4PSWA 3PFYA 1DBGA 2F6CA 2RQQA 1BOBA 2LC2A 2CS3A 3DWLE 4RLFA 1LFPA 3GVJA 3FY3A 2O1DA 1LKXA 3K10A 1X1CA 1PYVA 3PUBA 3QYEA 4KJZA 4XN3A 2MD0A 4BGDA 2BVLA 4NQWB 2BSPA 2ZTNA 4F92B 4JQFA 5CQGA 1HA8A 4HNUA 4FXUA 3MKWB 3GQ8A 3LMMA 2R7RA 3G2BA 4B47A 4HWVA 3LSKA 3FDYA 2RREA 3ZIAA 3D5LA 5FRMA 1RU4A 1N75A 1WMRA 3F9KA 1G59A 1WJFA 2W82A 4XMYA 3MMYB 2ZZGA 2ZXHA 1OOCA 1J09A 3EUHC 1V5FA 4II2A 4BE0A 3OYMA 2V6EA 4YZ0A 2VKDA 4B43A 4TT3A 1EA3A 1WJDA 2E5NA 3KX2A 4DIQA 1E0EA 4OZZA 2GOXB 4Z1MA 5KCMA 3H9JA 3HPGA 1VBLA 5CQEA 2D3LA 2NTQA 3S93A 3OMYA 3HOTA 1E3ZA 3S8PA 4C2UA 2UVEA 3BCDA 1CZFA 4E0FA 3LMWA 4Y33A 1PE9A 2WJVA 2HPIA 1S9HA 1D1BA 3M8JA 3OYJA 3ZXSA 3HUGB 3OFNA 1I18A 3H9QA 2OC6A 3I3LA 2NTPA 3B4NA 1O8IA 2MYSA 5JHFA 2KZVA 1NG7A 3LSMA 5HKKA 4Z03A 2VQGA 4BXFA 3C2GA 1FX0A 4DBRA 2M7AA 3DTEA 1D0YA 4XONA 1BHEA 3E0JB 2JA2A 4X0GA 2X3HA 1Y6IA 2R7QA 3DU5A 3EQNA 3OE7A 4BE1A 4TSFA 1O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZA A;  1H80 A;  1JTA A;  2QY1 A;  3GQ7 A;  4URR A;  1AIR A;  5AMV A;  3VSV A;  1O8M A;  2VBE A;  4XOR A;  3VMV A;  2VBK A;  2IQ7 A;  1IB4 A;  1O8J A;  4OJ5 A;  5C1E A;  1DBO A;  2NT6 A;  1QJV A;  1EE6 A;  4OJ6 A;  4XL9 A;  4NK8 A;  4YZQ A;  1O8L A;  2INU A;  4W8T A;  1O88 A;  1K5C A;  2INV A;  3SUC A;  4XOT A;  2O04 A;  3B8Y A;  4I84 A;  4PMH A;  2NZM A;  1O8H A;  4OJP A;  1IDK A;  4XLF A;  3WWG A;  4XKV A;  3GRH A;  2NTB A;  4XLH A;  3GQ9 A;  1IA5 A;  4XR6 A;  3B90 A;  4U49 A;  1OFL A;  4YEJ A;  4XKW A;  3VMW A;  2Z8G A;  2QXZ A;  4XQF A;  4XNF A;  2NSP A;  5C1C A;  1PLU A;  4EW9 A;  1KCD A;  1KTW A;  4OJO A;  4W8S A;  1DBG A;  4W8R A;  1XG2 A;  3FY3 A;  2X6Y A;  2O1D A;  1O8G A;  3GQA A;  4MXN A;  1OGO X;  3KRG A;  1JRG A;  2NST A;  2O0V A;  4XN3 A;  4W8Q A;  2X85 A;  2BSP A;  4XLA A;  4OJL A;  1NHC A;  4C2L A;  4OZY A;  4XLE A;  2X6W A;  1O8E A;  3GQ8 A;  4XM3 A;  4HWV A;  4NK6 A;  4YEL A;  1RU4 A;  4XLC A;  1O8D A;  1WMR A;  4XMY A;  4U4B A;  2VJJ A;  1OGM X;  1O8F A;  4YZX A;  1O8K A;  2UVF A;  1OOC A;  1X0C A;  4YZ0 A;  3T9G A;  1QCX A;  2EWE A;  4OZZ A;  2ODL A;  1GQ8 A;  1OFM A;  4XN0 A;  1VBL A;  4Z06 A;  3JUR A;  3ZPP A;  4Z05 A;  2NTQ A;  1BN8 A;  2UVE A;  2PEC A;  2QX3 A;  1CZF A;  2O0W A;  3LMW A;  1PE9 A;  4MR0 A;  3ZSC A;  1HG8 A;  3EQO A;  2PYG A;  2NTP A;  3B4N A;  2VJI A;  2NT9 A;  2VBM A;  1IDJ A;  1O8I A;  2X6X A;  3UW0 A;  4Z03 A;  3VST A;  4XON A;  1RWR A;  1BHE A;  2X3H A;  1KCC A;  2O17 A;  3EQN A;  4XOP A;  2PYH A;  1RMG A;  3VSU A;  1PXZ A;  4AVZ A; 
#chains in the Genus database with same CATH topology
 2XF6 A;  2DQL A;  4GYG A;  5E20 A;  2BM0 A;  1HKT A;  1J9Z A;  2YU3 A;  3RQI A;  3OL4 A;  3O2P E;  2HDD A;  3RIQ A;  4EGZ A;  2D1V A;  1O8M A;  3E97 A;  5AN9 A;  2QYO A;  3JR9 A;  3HTU A;  1XGN A;  2LKS A;  3P9C A;  4BUP A;  2X0K A;  3ZQ7 A;  4ESF A;  3DFG A;  2V79 A;  2MA3 A;  1R1V A;  1PDN C;  1YW9 A;  3QPT A;  3BCF A;  4ACB A;  4XL9 A;  3ERM A;  2FX3 A;  3I0T A;  4HV5 A;  3TDZ C;  4E7I A;  2CFO A;  2H94 A;  1LDD A;  1FBU A;  2OBP A;  3PFI A;  1ZR2 A;  1MNE A;  5HNF A;  1VQK I;  4G94 A;  4ZYD A;  2R7Z J;  2P7V B;  3CCM B;  4FQG A;  2AHQ A;  1YIJ I;  2TCT A;  2M3A A;  2XAJ A;  3WWG A;  4Z4S A;  1NJI D;  1HCR A;  2WV1 A;  4FK8 A;  4OIO F;  4YFO A;  2VC0 A;  2P8T A;  4NCN A;  3ZQF A;  3I64 A;  2CF4 A;  3RKW A;  2QTZ A;  2RV8 A;  1ACI A;  5LLQ A;  5TRD A;  3BR0 A;  4DNR B;  3BQZ A;  4LK0 F;  1S72 B;  4FT8 A;  3F8N A;  1YG2 A;  2WA0 A;  3W6J B;  4KIG A;  5EMN A;  3SZP A;  3J80 Z;  4FCY A;  3B78 A;  3IP4 B;  4CCO A;  2KJB A;  4NC8 A;  2X6Y A;  2P3M A;  4AIK A;  1ZYR F;  1BLI A;  2WZP P;  1A36 A;  3BCA A;  4V2F A;  1U2W A;  3CCY A;  1J75 A;  2VUM J;  3OP1 A;  4E7L A;  1IXS B;  3M3Y J;  1HVX A;  1TQM A;  3Q6Q A;  2ESH A;  1EFR A;  1A8P A;  4TMT A;  1D3Y A;  1QBJ A;  1EP1 B;  1T6Z A;  3FXO A;  2M7B A;  1W36 C;  2FSW A;  4IW3 B;  3K4J A;  2F4N A;  3V7S A;  3LSR A;  1MJA A;  4TV7 A;  5FKK A;  1B2R A;  3FXJ A;  5CVU A;  3K4B A;  1HKQ A;  4PGG A;  3KP3 A;  1T95 A;  4D7M A;  5M5Y J;  2ZFW A;  5K1Y A;  3QFT A;  1O8K A;  3MKY B;  1W1W E;  2M2E A;  2V26 A;  1VQ5 B;  1EH6 A;  1HST A;  3N4M A;  2VNJ A;  1CF7 A;  3G6E I;  1P4M A;  3WTT C;  4WXD A;  3ERE D;  4HDU A;  1UST A;  1GQ8 A;  1JUM A;  2MAB A;  4RD1 A;  1WWX A;  2DT7 B;  3GF2 A;  1Y0U A;  1QRC A;  1HW1 A;  1PUF A;  4RB2 C;  4CHU A;  4HSR A;  2QKM B;  3BZK A;  2NVX J;  4O3M A;  3LNN A;  2ZME B;  4YAU A;  2LF8 A;  1P4X A;  3NAU A;  3LJY A;  2E1M B;  3FMS A;  1QHG A;  2F2E A;  3LSI A;  2R5Y B;  2YX7 A;  2ACJ A;  4A0X A;  1NH3 A;  3MFK A;  1ODD A;  1RUO A;  2BM5 A;  4JRA C;  1SVL A;  2D9R A;  2E71 A;  2X6X A;  3E5U A;  2GOM A;  3M8E A;  5ICG A;  4RBO A;  5HS7 A;  1VQP I;  4HF2 A;  1N05 A;  1VQ9 B;  4MLO A;  2P0W A;  1S5L C;  3OZW A;  3HSF A;  1IRX A;  3AG4 H;  2NVQ J;  3AGQ A;  3T5X A;  4C43 A;  3BY1 A;  5H59 A;  1YJN B;  1WJA A;  2HDW A;  2W24 A;  3LA7 A;  1OCT C;  1VQO I;  2QSF X;  3CC4 B;  1XS9 A;  1R9T J;  1WKM A;  4L5E A;  1DAR A;  1N77 A;  3T8R A;  2FA5 A;  4ZDL A;  2M30 A;  4RGR A;  2XSD C;  1MJ9 A;  3ZN1 A;  2YR2 A;  1G3Y A;  2L5Q A;  3D1N I;  1P9Q C;  1P6R A;  3A0B C;  3QPL A;  3CC7 I;  1DU6 A;  1OHH A;  3QU3 A;  4Y4R A;  1RR8 C;  1OGI A;  4D9J A;  2V1N A;  4XOR A;  4JX6 A;  2VBK A;  1WI9 A;  2QZA A;  4J19 A;  4RGX A;  3K6G A;  2VFM A;  3WG7 H;  4M3E A;  3G1M A;  1V4R A;  1KQS B;  3W3C A;  4CA0 A;  1U9N A;  1Q81 D;  5IT3 A;  3VB2 A;  1WTH D;  2M4G A;  2JN6 A;  3U1D A;  1YYV A;  4CYC B;  2NTB A;  3CDL A;  3BC8 A;  2IA1 A;  4G5G A;  2W85 A;  2XPU A;  5BNG A;  3LL7 A;  4G6D A;  4Y7N J;  3G4S B;  3PNT A;  3VMW A;  2OA4 A;  2R5Z B;  2TDX A;  4YXW A;  2Z8G A;  1C0W A;  2D3N A;  2VLA A;  4ZJZ A;  2I1L A;  3CZ6 A;  4ZGQ B;  2H27 A;  2W1O A;  2VBY A;  3FK6 A;  3MKZ A;  1WSU A;  4K2E A;  1LJ9 A;  2V7T A;  5HZB A;  3Q6R A;  2J5P A;  3H5A A;  4NUB A;  5ERI A;  3RTR A;  4CSW A;  4RPD A;  4LG3 A;  2VBZ A;  3M1C A;  1K7A A;  3KRG A;  1WRJ A;  3ZQG A;  3S2W A;  2V7W A;  2H1K A;  2KHM A;  3RPU D;  1SFU A;  4PJ0 C;  1MH3 A;  2BW3 B;  3DKX A;  2Y0S N;  3GW2 A;  1SVM A;  1BR4 A;  2M1B A;  4EJT A;  1WPK A;  3CP2 A;  4U0V A;  2B9S A;  4AC9 A;  3L7W A;  1P7J A;  2R9V A;  2WSS A;  1O8E A;  4BQN A;  1BI0 A;  1BQE A;  3AGP A;  2CUJ A;  2M8E A;  4JX4 A;  2X53 S;  3VO1 A;  1FWZ A;  4XK4 A;  3OV8 A;  3CMY A;  2HTJ A;  3SZG A;  4N9I A;  1WDT A;  3AVV A;  2CUZ A;  3RKX A;  2LVS A;  4I98 B;  1FTZ A;  1VQP B;  1IUF A;  2O8K A;  2L2O A;  2Y0S A;  3QSY A;  3BOQ A;  5DYM A;  4HF1 A;  4P9S A;  2VN2 A;  3LO8 A;  4XN0 A;  4X8I A;  2R93 J;  2J8I A;  4ASU A;  3CD6 I;  1I7P A;  2CMP A;  3CTA A;  2M5W A;  2L7F P;  2R6H A;  3QAH A;  4HAM A;  4NC6 A;  1W0K A;  2BF4 A;  4G7W A;  2V5I A;  2PYG A;  4CCM A;  1S4M A;  3CXC B;  3EQO A;  2O0Y A;  3BCB A;  5BPI A;  2R7T A;  2VJI A;  2DMU A;  4NHJ A;  3NWT A;  2IXS A;  5CVI A;  3I58 A;  3OYN A;  3HRU A;  1BX0 A;  4HDV A;  5FKM A;  4ABZ A;  4MTD A;  4U7D A;  1IW7 F;  1GVJ A;  4A3K J;  2KRH A;  3QU6 A;  5TY0 A;  2DK8 A;  2LP0 A;  3C2B A;  1UD4 A;  5KSW B;  2JUC A;  3WE3 A;  1FEX A;  2O03 A;  5EGO B;  2JZY A;  1MRZ A;  4A5M A;  2FMY A;  4AVP A;  5IP6 A;  1REP C;  1PXZ A;  2AO9 A;  3P7N A;  3ZP5 A;  2GM4 A;  3AK5 A;  2JSP A;  2CV0 A;  1WFX A;  1QZZ A;  3NEU A;  1IG7 A;  5HLG A;  3TQN A;  3IAS 2;  1K4Z A;  4KH3 A;  3JU4 A;  3FPK A;  4Y3O A;  3ABU A;  4A2U A;  2ZJP F;  5L3G A;  2E1B A;  4LJZ F;  3BT9 A;  4OPO A;  1MMG A;  2W84 A;  3KPH A;  4K1X A;  3VMV A;  2PJR A;  1S7E A;  2LK2 A;  2IGK A;  1WGX A;  2JK3 A;  1B72 B;  3LQE A;  5J8C A;  1WP6 A;  3JRD A;  1MGT A;  5LHG A;  3G73 A;  4BS9 A;  4KMF A;  2ZSI B;  5ILS A;  2R7W A;  3CES A;  3EYY A;  3W2I A;  1GXP A;  3DLA A;  4D1Q A;  4XKB A;  4EV0 A;  3VFZ A;  5F4J A;  3BH6 B;  4X0C A;  3BG7 A;  3IWF A;  3ZMZ A;  4YFX F;  1JXS A;  4XKV A;  4AYB N;  1ZEL A;  2OZ6 A;  4AIJ A;  4WWV A;  1QA1 A;  2C78 A;  2X1E A;  1ETK A;  4M6V A;  2ZME C;  5LGU A;  4XRS A;  2E1M C;  2VFQ A;  3CB4 A;  2GWR A;  2XKO A;  1Z77 A;  4ROX A;  1W0U A;  5TR9 A;  4PC2 A;  5FO1 A;  1SVO A;  1HSJ A;  1EKE A;  4PJM A;  4ON0 A;  4FAS D;  1N25 A;  2KDO A;  5ICF A;  4A0Z A;  1APL C;  2FF4 A;  4MEY F;  4EM1 A;  1LVA A;  3LSG A;  3LSP A;  4A3I J;  2E2J J;  2CK3 A;  3ASQ A;  3CRZ A;  5FJ8 J;  2EWN A;  3A8I A;  1NHA A;  2BHY A;  5GAE J;  1ONV A;  1FND A;  2A61 A;  4RM2 A;  2X3U A;  2BEO A;  4OOS A;  4AYB A;  5JLW A;  4QTR A;  1OGO X;  1COW A;  4QVA A;  1X3Z B;  3FM3 A;  3SDB A;  3HPH A;  3I4N J;  3S3N A;  1A5J A;  5HDK A;  4G6I A;  1QRB A;  2NST A;  1T0F C;  2MFZ A;  2HVQ A;  1HKS A;  2DCU A;  4N4O B;  4EM0 B;  5TJJ A;  4BEH A;  4L5I A;  2L4A A;  4O5V A;  4M74 A;  1RI7 A;  5GTI C;  4OAZ A;  2E7W A;  1BOA A;  1R6R A;  2V9V A;  2GIZ A;  2KIU A;  3H5N A;  4IZZ A;  1OB0 A;  4NK6 A;  2FBI A;  5EG0 B;  2ZZF A;  1TL8 A;  4C9Y A;  4X7C A;  2D1H A;  1U9O A;  1ZRF A;  4BL0 B;  4WXC A;  1BA5 A;  3U6B A;  2FVG A;  1OIS A;  4UV8 A;  4BQA A;  4CH7 A;  4YZX A;  3C7J A;  4OIP F;  1MH4 A;  4RD0 A;  4CCJ A;  5B6I A;  2O6W A;  4W8Q A;  2GJP A;  2QCO A;  3OYC A;  1IN8 A;  3QFS A;  1LVK A;  1WJB A;  2VL8 A;  1EJ9 A;  2EIX A;  3NB2 A;  3VOE A;  4RPB A;  3VYR B;  2ZL7 A;  2LY2 A;  3V8L A;  4B44 A;  1AKH B;  2Q1Z B;  1POG A;  2FD5 A;  1OLT A;  1VQ4 I;  3VWB A;  1BN8 A;  2LY9 A;  3S17 J;  3A03 A;  3GFL A;  5A89 A;  2O0W A;  3U6K A;  2JA7 J;  2VQL A;  1UAA A;  1HG8 A;  1LDJ A;  3I56 I;  5F64 A;  3WND A;  2MH9 A;  4E7S A;  2NRA C;  2YU9 J;  1ZHF A;  4NQW A;  5KK1 A;  1OMI A;  1CGP A;  2X9D A;  2VB6 A;  3IKV A;  2B0L A;  2LLK A;  2XZO A;  1I5Z A;  2GJK A;  1Q1H A;  2LG4 A;  4D5C A;  1YOV B;  4Y15 A;  3FKJ A;  4CO8 A;  2IS4 A;  1JKR C;  3V7A A;  1B6A A;  1QO0 D;  3GME A;  2VPL A;  1KCC A;  2WBM A;  1U8R A;  3SQN A;  1BI1 A;  3S3M A;  2JRT A;  3PSI A;  5DSZ A;  2EV6 A;  3KEQ A;  4G9Y A;  4LLN A;  2PYH A;  3Q0V A;  3CUO A;  4I01 A;  2ME6 A;  2Q6L A;  1RMG A;  3KP6 A;  4ESJ A;  1YFH A;  1T5E A;  5THX A;  1AIR A;  1JTA A;  5DNS A;  1FYL A;  1FIA A;  3H3Z A;  4BBR J;  2IOU G;  1Z6T A;  3DU6 A;  3JCU C;  1X3U A;  4H9G A;  3LWF A;  1QGP A;  3OYG A;  2XAU A;  2GIV A;  1UD3 A;  1JB9 A;  1WHU A;  3SYT A;  2BVM A;  3WQZ A;  3QRF F;  1QHH D;  2PMD A;  3A0H C;  3I9V 2;  5HDG A;  1ZRC A;  4IHY A;  4Y52 J;  1N0U A;  5E3O A;  3BY2 A;  3CW2 A;  1B59 A;  3SFI A;  4DYR A;  4A3E J;  4RMN A;  2VQH A;  2HKO A;  2PG4 A;  1K6O A;  3SY2 A;  4W8T A;  1H8A C;  2QLZ A;  1XTA A;  3DCF A;  2CO5 A;  2PBI A;  2DO7 A;  3H3V K;  1PJ7 A;  4G7Z F;  3OYH A;  1A35 A;  4EAT A;  3JRA A;  3W5H A;  4MFE A;  4XLF A;  1T6X A;  3OYF A;  2XEX A;  2ZL5 A;  2KIQ A;  1ERD A;  5DM6 F;  3WY9 A;  2IJL A;  2HS5 A;  2OK8 A;  3R60 A;  4UUS A;  5DM7 F;  5K7Z A;  2R3S A;  3COA C;  1KGS A;  4X07 A;  2QXZ A;  4XQF A;  1GLN A;  2ZSH B;  4QIW N;  3JAM K;  1X58 A;  4G7H F;  4PCQ A;  1SFX A;  5DUK A;  4A3D J;  1OR7 C;  1EP2 B;  4P3Y A;  2R7D A;  5L3B A;  3I71 A;  2Y69 H;  1BOB A;  4M53 A;  4RCY A;  4TMX A;  1XE1 A;  2XPW A;  1VQ7 I;  3A02 A;  1X1C A;  4BPR A;  3PUB A;  3SKB A;  2MD0 A;  4BGD A;  2BVL A;  1KU9 A;  1R1T A;  3ZZT A;  3CUQ B;  1W4M A;  4F92 B;  5F27 A;  1FNB A;  4ASN A;  2ZNY A;  1VQ4 B;  5M5X J;  4HNU A;  3BJA A;  3A01 B;  3SHF A;  3GQ8 A;  2KJC A;  3GXO A;  4L9J A;  4HWV A;  2ZBK A;  2LKP A;  3AG1 H;  3TOA A;  3FXR A;  2KZG A;  4FIS A;  5FRM A;  3CCJ I;  1WMR A;  3F9K A;  1E62 A;  1WCM J;  1GAQ A;  1WJF A;  2W82 A;  2WZN A;  2ZXH A;  2DU9 A;  4EJU A;  1J09 A;  3WTV C;  3EUH C;  4YZ0 A;  5F4M A;  5M3M J;  2HOS A;  5FD6 A;  1MBJ A;  1E0E A;  4EQQ A;  2IT0 A;  2VOO A;  2NS8 A;  1CNF A;  2GOX B;  3K1P A;  1FBS A;  3KYD B;  5KCM A;  1F9N A;  4ZV4 A;  5IYQ A;  1F1Z A;  2LKX A;  2D3L A;  2RVC A;  3H3U A;  3BNW A;  1Q82 D;  4C2U A;  2EK5 A;  1U78 A;  3BCD A;  3S15 J;  1CZF A;  2V1U A;  2HPI A;  1Z67 A;  1S9H A;  3F6O A;  3HUG B;  3JRH A;  5IT9 K;  2L3D A;  3I3L A;  1MBF A;  2Z99 A;  3DBL B;  4M4S A;  2MYS A;  5JHF A;  4Q47 A;  2BMW A;  3LSM A;  4Z03 A;  4IJA A;  1K78 B;  3C2G A;  2DFE A;  2M7A A;  3I4P A;  2OU2 A;  4X0G A;  2VOP A;  1KK2 A;  4Z6Y A;  2R7Q A;  5A2Q Z;  3M1E A;  2CGP A;  2P5V A;  1DPU A;  2A3S A;  1RES A;  1FYM A;  2ZXJ A;  2XZL A;  4MFD A;  1DPR A;  1E1R A;  1UD6 A;  5LFA A;  3U2Q A;  3CPW B;  1YO5 C;  3D0S A;  4KMU X;  2KLO A;  3R61 A;  5EEH A;  3SZT A;  2A68 F;  5IYR A;  1R22 A;  2WAD A;  5J1Y A;  2HXO A;  3CCR B;  1VQ6 B;  1GT0 C;  2QSG X;  1RKW A;  3ML6 A;  5C1E A;  1OYW A;  5JMC B;  2DTR A;  2ZME A;  1PKV A;  2DI3 A;  3BR1 A;  3FX3 A;  4UUV A;  1YRN B;  1Y0R A;  2HPM A;  3ZBU A;  3ZPN A;  5TIS C;  1IZ1 A;  4G7X A;  1TWG J;  2R5Y A;  1H88 C;  2O04 A;  3ASS A;  4UZE A;  3BG6 A;  3P4G A;  2P6S A;  2ZKZ A;  2QZ8 A;  5BSX A;  1IDY A;  5ICC A;  1SFO J;  3HC7 A;  2M9H A;  1IN4 A;  3IUO A;  1B4A A;  4ZC3 A;  4RB1 A;  1K73 D;  3B90 A;  3JAM Z;  2LF7 A;  3EUA A;  2QWW A;  1YLO A;  2VPR A;  4ENN A;  3O8G A;  3I5U A;  3MAJ A;  1LUJ B;  4JK1 X;  1J2X A;  2WY8 Q;  4YCQ A;  1JKP C;  3F21 A;  3Q3A A;  4X7E A;  2Z33 A;  1ELO A;  2NNN A;  3FXM A;  1JT0 A;  4BDY A;  1BI2 A;  5FNZ A;  2OBT A;  4BEH B;  1G4D A;  4QV2 A;  4F3Q A;  1LNW A;  2R7S A;  3SXY A;  2B7B A;  1EFT A;  2P5K A;  1JRG A;  1E3X A;  3UNG C;  3WTS C;  5JLX A;  4IHV A;  1DAB A;  3OR2 C;  1W7P D;  3FXK A;  4JX5 A;  5LEJ A;  1X3W B;  4N4N B;  1QH0 A;  1TWF J;  2BM7 A;  3B02 A;  2WAF A;  3TED A;  3G3Z A;  1HW5 A;  5H2F C;  4XID A;  4J0Q A;  2B7E A;  4HQM A;  9ANT A;  3Q0W A;  1GVD A;  2OPT A;  5KHD A;  2PI0 A;  1FSH A;  3E6C C;  1UHM A;  4CYC A;  2K85 A;  2P4W A;  2ZC2 A;  3AAF A;  1MND A;  3LYC A;  3N6Z A;  4WXH A;  4ACA A;  2HQN A;  2NV4 A;  1V5G A;  3DP7 A;  2MLG A;  2R7U A;  4KIB A;  4QSH A;  2R5Z A;  3BDD A;  2XGE A;  5IYC J;  3J7Y J;  1MBG A;  2ODL A;  2CQX A;  1SD6 A;  1Z05 A;  4Z06 A;  3ASR A;  4ZDO A;  2W25 A;  1QPM A;  2CW8 A;  2XIG A;  2KIM A;  4N3G A;  3SJZ A;  4GFB A;  4PGO A;  2QEN A;  4I76 A;  2ZB9 A;  3JRF A;  4RM0 A;  1ITY A;  1AMO A;  3FHZ A;  4P9U A;  3HOX J;  2QX3 A;  2LDU A;  2OYN A;  4V02 C;  2DJI A;  3A1Y A;  2YWH A;  4PFP A;  3QOD A;  3MN2 A;  2NT9 A;  1GO2 A;  3L2C A;  2BW3 A;  3TMO A;  4RAG A;  2KPM A;  2OCC H;  4PFO A;  4JOM A;  3DU1 X;  1GV2 A;  5IOY A;  1RR7 A;  1XCB A;  2LRD A;  3Q9S A;  3V42 A;  3H0D A;  1IO2 A;  1ZRD A;  2E1C A;  2CUF A;  2HI3 A;  1F5T A;  4XRM A;  2WWY A;  4XOP A;  1NRK A;  3ISP A;  2ZZE A;  4FN5 A;  1ZGW A;  4AVZ A;  2LTP A;  3CUQ C;  2QY1 A;  2ME0 A;  3GFI A;  1F4K A;  1PUE E;  2ZL6 A;  2XTY A;  2JTV A;  3BJ6 A;  1SKY B;  4KT6 A;  3K70 C;  5LMZ A;  3OL3 A;  5C3E J;  2K27 A;  2DY1 A;  1TT5 B;  1LEA A;  3MWM A;  3F0C A;  3TO6 A;  1QVU A;  1W2B B;  3W2W A;  2CV1 A;  1Q86 D;  3VDX A;  3MZH A;  2VT2 A;  4DZP A;  2HMA A;  2RC5 A;  4M9S A;  3OAA A;  3HKZ N;  3I1F A;  1KJZ A;  1OCZ H;  4UAJ A;  2GXA A;  3AVT A;  5K5O A;  2UWM A;  3LFK A;  2EFP A;  3H1C A;  1LPQ A;  5E6T A;  2UUZ A;  2B0R A;  2L02 A;  1AIP A;  2C2W A;  2ZNZ A;  4ITV A;  1V5E A;  3HSE A;  1Y1W J;  2INV A;  2JMW A;  3HBL A;  1G7T A;  4RDJ A;  4HZF A;  5IYP A;  2A5W A;  4R1H A;  2BGJ A;  1OR7 A;  1QQ1 A;  1IDK A;  3NAW A;  2Y48 A;  4A3B J;  2YS9 A;  5H6Q A;  1FYK A;  1J7K A;  2EZL A;  4JYK A;  4B48 A;  1DDN A;  5LRS A;  1N06 A;  4PC1 A;  3HKZ A;  2V7F A;  3KET A;  5IY5 H;  3ZMU A;  2KP6 A;  1IDZ A;  2K4J A;  1MZB A;  2RNJ A;  2NVT J;  4LK1 F;  4E7K A;  1VF7 A;  4QLC U;  2GK7 A;  3W2F A;  1M1K D;  3CCQ I;  4XKC A;  5EGO A;  1LEB A;  2NSP A;  5HLI A;  3R6J A;  1OFC X;  5HVQ C;  2ECC A;  2C6Y A;  2MW8 A;  4CCN A;  3T8T A;  2K5C A;  2QYU A;  1X19 A;  3QQA A;  1O7F A;  3OOC A;  4L9V A;  5E1X A;  2DLL A;  4MYU A;  1IRZ A;  1LLZ A;  4AC0 A;  4HF0 A;  4HLX A;  4CDG A;  4RM3 A;  1H42 A;  3WGG A;  1B72 A;  2E1N A;  2C4T A;  5L3E A;  1A04 A;  3Q38 A;  3OSF A;  1W0T A;  2C4U A;  4MIM A;  2OK7 A;  3EUH A;  2O3F A;  3BC9 A;  5HXB A;  1R23 A;  4QPO A;  1UG2 A;  1NK2 P;  3HOU J;  4BNC A;  1UMK A;  3AVY A;  2NPF A;  3GFM A;  3DQV C;  4GQN A;  2P6T A;  4YIF A;  3DPT A;  3HL2 A;  2CFX A;  4NBQ A;  3H94 A;  4W1U A;  2CND A;  2K86 A;  1VQ8 B;  3PUM A;  4CQJ A;  1ENH A;  3BR2 A;  3WNB A;  1B9N A;  3T53 B;  1SAX A;  3K4C A;  1RET A;  3CC2 I;  2F5D A;  4DYQ A;  1OQY A;  3A3B A;  2ZZQ A;  1N78 A;  1SC7 A;  3ASP A;  3FMR A;  3V7R A;  1QA3 A;  5GPC A;  2VJ4 A;  2LBF B;  3IV5 A;  4RD3 A;  1LDK B;  5B66 C;  4OOI A;  1G7S A;  4M72 A;  2W6J A;  1BM9 A;  2QA4 B;  3VSK A;  2DTZ A;  4JMQ A;  4IKF A;  2L9N A;  3HRT A;  1STZ A;  1OGJ A;  2A6T A;  1H8E A;  2F1L A;  1IDJ A;  4RCZ A;  1CQX A;  4M2L A;  2AHO A;  3QYB A;  4OIR F;  3RCO A;  2PE3 A;  2DYI A;  1FC3 A;  4EVI A;  5EG0 A;  4I2O A;  4RLZ A;  1W5T A;  3K0L A;  2HQR A;  3PNY A;  2DQR A;  2OTL I;  3D26 A;  4OPW A;  3ZBT A;  3K4L A;  3U2R A;  3F8M A;  1TWA J;  1MAB A;  5HS9 A;  5AMV A;  4AWX B;  3HRM A;  1D8J A;  2BY2 A;  4X05 A;  1ZM9 A;  1TZL A;  4PJN A;  1HDP A;  2W48 A;  4X7F A;  1XFO A;  1AKH A;  4A5N A;  1D1C A;  3RYR A;  1FSE A;  5K7F A;  2QQA A;  3N05 A;  4BY1 J;  1WOO A;  2F5F A;  2WAE A;  3PQK A;  4Z2Y A;  4ZYH A;  3CCQ B;  1BI3 A;  2JUG A;  1QJV A;  3ZCO A;  2KIS A;  3TGN A;  3E5X A;  2INU A;  3GZ6 A;  2FEZ A;  4ENK A;  1W9X A;  5GPA A;  2XRO A;  4Y9U A;  4CZZ A;  1V0E A;  2BOL A;  3DBR B;  1VQK B;  2BE5 F;  2E34 A;  3GRH A;  2XNC A;  3Q39 A;  1YS6 A;  3TH0 A;  1NK3 P;  1TQP A;  3HAG A;  1YIJ B;  4ZCL A;  2JJ1 A;  1X4P A;  3VO2 A;  4XR6 A;  1WU8 A;  1FP1 D;  2XV4 S;  3DDY A;  1ULY A;  1TTY A;  2BBY A;  2EZH A;  1KQ0 A;  2KRF A;  1HDD C;  3UKG A;  1K83 J;  2Q8K A;  2V4D A;  1JJ2 B;  1WJC A;  3CJQ B;  1QG0 A;  1E79 A;  1ZH5 A;  1UD8 A;  2D74 A;  3E6B A;  4B8X A;  3GWZ A;  2IVM A;  5HOO A;  1T39 A;  1K9M D;  3FJO A;  2IGN A;  2BXZ A;  3ABT A;  1L0O C;  2YWE A;  1EE6 A;  4P1V A;  1SFE A;  2HCJ B;  1G3T A;  2DT6 A;  2XF7 A;  3FIS A;  2OV7 A;  5M3F J;  1P2F A;  4IHT A;  1QGY A;  2D45 A;  1IJW C;  3LST A;  4I02 A;  3T0Y A;  2FNA A;  3OOU A;  4E70 A;  2DET A;  4OJL A;  1A6Q A;  2JJ7 A;  3ASN H;  3GTG J;  3CO6 C;  1EFC A;  1KON A;  2FX0 A;  3R0J A;  5EZH A;  4C2M J;  3PIP F;  2STW A;  4OZY A;  3GVA A;  5AON A;  3HG9 A;  2VC1 A;  2WYR A;  3KP7 A;  4YEL A;  2EJR A;  3BR6 A;  2M0M A;  2DOG A;  4E6K G;  5LGT A;  4XLC A;  4DK0 A;  3RZD J;  4PDK A;  3ZMD A;  2Y9Z A;  2FRH A;  1YIO A;  2VJJ A;  1O8F A;  3BZ6 A;  2E2H J;  4OOX A;  3S1M J;  1JUP A;  2A6H F;  4UXN A;  2L7K A;  1BN5 A;  4L5J A;  3PUF A;  2FUG 2;  2DA2 A;  2FJ1 A;  2DFF A;  2OF7 A;  1ZRE A;  6PAX A;  3GTM J;  2L7Z A;  1W35 A;  4EJW A;  3VMF A;  2VT3 A;  1FOY A;  3FMQ A;  1ETV A;  5D4R A;  4B3G A;  3ZPP A;  4Z05 A;  5GP9 A;  3G6E B;  3PSZ A;  3V8J A;  1I8D A;  2A5Y B;  3KZY A;  3OYE A;  1ON1 A;  2X1D A;  5IK2 A;  5FKL A;  1L1I A;  4YG2 F;  3JTG A;  1H0M A;  1RZ4 A;  1JKQ C;  1HF0 A;  1FZP B;  1K79 A;  3LFU A;  2X51 A;  5AIQ A;  3SEZ A;  1S29 A;  4A6E A;  3CCU I;  3CUQ A;  4R8H A;  2EFW A;  1VLY A;  4I0A A;  4M71 A;  2HDC A;  3EDP A;  1X2N A;  4X7D A;  3A01 A;  2GA1 A;  2RQP A;  4I09 A;  2DJN A;  3OYB A;  1RWR A;  3F3X A;  4YC5 A;  2VKV A;  1BMF A;  4L9T A;  2HTS A;  5ED4 A;  4FE7 A;  3R4K A;  2ZBV A;  1L3L A;  2DN0 A;  1X2M A;  3L2Q A;  1YX3 A;  3VSU A;  1T98 A;  3KYC B;  1R71 A;  2OQR A;  2DPU A;  1QU3 A;  1FMW A;  1H80 A;  1Y39 A;  3F22 A;  1VQO B;  1ETW A;  3VOD A;  3L2V A;  3FXQ A;  2D5V A;  2P7C B;  2W00 A;  3FWE A;  2DA3 A;  1ZLJ A;  1BJZ A;  3J7A Y;  2GQQ A;  3WU0 A;  1O3S A;  1N07 A;  4P6V F;  3ZUG A;  3CC7 B;  2L01 A;  1XDS A;  4S05 A;  2ZXW H;  1Z3X A;  1GXQ A;  2K7L A;  5IYD J;  5EF6 A;  2HU9 A;  2ELJ A;  3I59 B;  1D5Y A;  3JQQ A;  2HOA A;  3OZU A;  1IRF A;  4PUS A;  2VNH A;  2K9M A;  2RKH A;  3HUG A;  3SUC A;  2NZM A;  1O8H A;  4MQ9 F;  1FX7 A;  4A69 C;  1O3T A;  4OJP A;  3U21 A;  3V4G A;  5FO0 A;  1KK0 A;  4F52 A;  1K78 A;  2K3P A;  1EH8 A;  3DEW A;  3ZQQ A;  4LLL A;  2CV2 A;  3DV8 A;  5D6E A;  2ELH A;  5K7H A;  4ENM A;  5FKO A;  1OB5 A;  4XKW A;  4DW6 A;  5JR3 A;  3D5R C;  4DGW B;  1EZG A;  3ABK H;  1K8F A;  2NNY A;  4XBF A;  1PLU A;  2LY1 A;  3K1N A;  2JJ2 A;  1UFM A;  5DUI A;  2B63 J;  3PFY A;  4PGH A;  1DBG A;  4YEI A;  2BY0 A;  4Q7J B;  5B1B H;  2F6C A;  1R5H A;  3GVJ A;  2HOE A;  3FY3 A;  2PMU A;  1JTX A;  2X0L A;  1R5O A;  1LKX A;  2ELK A;  2VKE A;  2YUH A;  1PYV A;  1FIP A;  4XN3 A;  2JPB A;  3W2E A;  2ZTN A;  4PAA A;  1E63 A;  5CQG A;  1HA8 A;  4JP0 A;  1YRN A;  5E3N A;  4FXU A;  3BG5 A;  2ZJQ F;  2R7R A;  1VHE A;  4B47 A;  1VF9 A;  3FDY A;  5D5W B;  1N75 A;  1O3R A;  2XHK A;  4WF2 A;  4V2G A;  4FWT A;  1OKR A;  3VEP A;  3CCU B;  3C1D A;  4ENJ A;  1N08 A;  3B82 A;  4C3J J;  4BE0 A;  2V6E A;  2YX4 A;  3W6V A;  5JLV C;  4TT3 A;  1WJD A;  4DIQ A;  4OZZ A;  1FY7 A;  2NVU B;  1JNY A;  5HS8 A;  2O61 A;  3HPG A;  3CCE I;  2VBT A;  2H8W A;  1GAW A;  2EZK A;  4OPV A;  3HOT A;  4YAO A;  1E3Z A;  4PZJ A;  3S8P A;  4L0Y B;  3SFZ A;  2G9W A;  2UVE A;  2GLO A;  4KDP A;  3WYA A;  1PE9 A;  1RKT A;  3K9T A;  1M90 D;  3CD6 B;  1D1B A;  4P25 A;  4LLG F;  2F48 A;  3WTU C;  4XSX F;  3CCL I;  3MCZ A;  4HW0 A;  3ISX A;  5HKK A;  4QHY A;  4DBR A;  1WOR A;  3E20 A;  1D0Y A;  2JA5 J;  2AS5 F;  2DYR H;  4A3L J;  1SEU A;  1QZE A;  1UHW A;  2A69 F;  3HZJ A;  3QP6 A;  3KLO A;  1Y6I A;  5LEK A;  2DER A;  3AVX A;  3CJT B;  4N0B A;  1MNM C;  2BX6 A;  3OKX A;  3L9F A;  4TSF A;  1O88 A;  4RDK A;  3A35 A;  2XTX A;  2BHZ A;  2QM3 A;  1RUN A;  4M3B A;  2W4S A;  3W5U A;  1MIJ A;  4PJL A;  1JA1 A;  3OEE A;  3ABM H;  2BM1 A;  3QWL A;  4LMY A;  3ES9 A;  3WBJ A;  2K3F A;  1XN7 A;  1KD1 D;  3ECO A;  4MQV A;  4A3F J;  1G6N A;  1W34 A;  2WTE A;  3E7L A;  4ZYA A;  1HLV A;  2HR3 A;  1Z21 A;  2I5U A;  1DP7 P;  2F5E A;  1BW6 A;  2OTJ I;  2JA6 J;  1DBO A;  5CKT A;  5DCF A;  2EFN A;  3CMA I;  1BX1 A;  5KNL A;  2VQC A;  5E18 F;  1MMD A;  1UEL B;  2PJP A;  2HLD A;  2JWT A;  1HBX G;  3GUD A;  2ICW G;  1W0J A;  5IOZ A;  2JDI A;  1ZKG A;  5K5Q A;  4EM2 A;  4M3D A;  1U5T B;  2V6C A;  1YW8 A;  4ETS A;  5A2Q K;  1IA5 A;  3ROU A;  3O8H A;  4I99 C;  2FBK A;  2XAG A;  4RD4 A;  1SM4 A;  3A1P A;  1OFL A;  4YEJ A;  2V1D A;  4IQJ A;  3W2V A;  3FM5 A;  2W6I A;  1FNM A;  1JI8 A;  1V3F A;  2STT A;  5F4O A;  4LGW A;  2HYJ A;  4E7Z A;  1NDH A;  4TMV A;  3ZMS A;  3RIR A;  1TWC J;  5GAD J;  1KCD A;  1D2E A;  4PC6 A;  2F5V A;  4W8S A;  3VPR A;  3LQQ A;  2HVR A;  3LQ6 A;  4P22 A;  2X1C A;  1WSR A;  1OCC H;  2M87 A;  4W8R A;  4OMY A;  3C18 A;  5HZA A;  4P5O A;  1B8I B;  5DD8 A;  4DYC A;  2DEU A;  2V7U A;  2DT5 A;  3FBN B;  2DA6 A;  2EIN H;  2ZO4 A;  3OIO A;  2DYS H;  1XGS A;  2XUB A;  3NWS A;  3LQR A;  1Z6R A;  1QUF A;  2L7M P;  2IA0 A;  2PIA A;  3EUK L;  4ZZL A;  2QQ9 A;  4P3I A;  3CPX A;  2XVC A;  2IEK A;  1TSP A;  2IRF G;  1UD5 A;  1Z3Y A;  3BG9 A;  4L8J A;  1VQL I;  3CDI A;  2UZK A;  2XF5 A;  2WB1 N;  3IWZ A;  5AIP A;  2ZCW A;  2YUS A;  1QPI A;  3EYI A;  1QVT A;  1BIB A;  3TW7 A;  2PQ8 A;  3OYK A;  5FGM A;  1Z0X A;  4KUM A;  4W97 A;  4IO9 F;  5B5E C;  3JRB A;  4U88 A;  3M4O J;  1MBK A;  1WXR A;  4LBV A;  3RI4 A;  1IB0 A;  2GK6 A;  3PSS A;  4GRI A;  2ID6 A;  4G1V A;  1X1P A;  5L3C A;  1HF2 A;  1KQ9 A;  2O8X A;  2WB1 A;  4HIZ A;  2EA2 A;  1TLH B;  3CP8 A;  2XRL A;  4QWQ A;  5DTD A;  2CU7 A;  2Q2E A;  4ZTF A;  3TW6 A;  1SMY F;  2CJJ A;  1VI0 A;  1Y56 A;  3TO7 A;  3L2U A;  2NVY J;  4BDZ A;  2JT1 A;  4U7B A;  3I56 B;  3GTJ J;  3CME I;  1YJ9 I;  4G8X A;  4WCG A;  2OTJ B;  4LB6 B;  3OYI A;  1ZG1 A;  3ONU A;  3HYI A;  4YFK F;  1G3S A;  1Y0Y A;  2LNB A;  1R5G A;  3OS1 A;  2BYV E;  4P2N A;  4CGZ A;  5DV5 A;  4F55 A;  2W7Z A;  3BWG A;  4JBA A;  4IX7 A;  4AUX A;  2ECB A;  2B5O A;  4ZH4 F;  1Y0N A;  2DFI A;  4IXA A;  4P1W A;  3F8B A;  5E79 C;  1K6Y A;  4BHC A;  2VJ5 A;  1D1A A;  4IHS A;  2H6B A;  3RSN A;  2EIJ H;  2V4J C;  1F20 A;  4WZL A;  4WZE A;  5GAH J;  4IQ4 A;  2LBF A;  5EDN A;  1WH5 A;  1Z1D A;  4HPQ A;  4DJA A;  3BH7 B;  4MNU A;  1IXR C;  1OB2 A;  4B3A A;  2VZL A;  4S04 A;  1TYX A;  2MSY A;  2M8G X;  2QE7 A;  2IGM A;  3KYL A;  2COB A;  4WX9 A;  2OBS A;  3B8Y A;  4I84 A;  1J59 A;  1D8K A;  2NS7 A;  2R4G A;  3CCS I;  5J47 A;  3PIO F;  3CF2 A;  3AL0 B;  2DMT A;  3ELK A;  1QFY A;  3W2G A;  2IS6 A;  2R7V A;  4DK1 A;  1IF1 A;  1TT0 A;  1XG1 A;  1OCO H;  2B7C A;  5CLS A;  3ZR8 X;  1R4M B;  3F6V A;  1XSV A;  2ESN A;  1DUX C;  4PSX A;  5FKN A;  2Z6B D;  3BQJ A;  1DQU A;  1AOY A;  1R58 A;  2XRN A;  3HOY J;  4OOV A;  4MYT A;  4BU2 A;  1VQL B;  4M3F A;  5B3S H;  4B1R A;  3DTI A;  3CJN A;  2EV0 A;  1W7P B;  2PMH A;  4KA4 A;  1QFJ A;  1LM1 A;  2DOF A;  2QBY B;  1E3P A;  2NYX A;  1TYV A;  1U2R A;  3ZQC A;  2XAF A;  2VE9 A;  3NE5 B;  5E1W A;  1V5V A;  2GA2 A;  2KFD A;  3F8F A;  3H36 A;  3H92 A;  5L3D A;  4C3I J;  4D5F A;  4E4H A;  1K4S A;  1K28 D;  5LHI A;  2QN6 A;  3OZV A;  4BE2 A;  2CRG A;  4NB5 A;  1VQ7 B;  2ZJR F;  4AD9 A;  4G6T B;  4IRI A;  1WOS A;  2Q6K A;  1NHC A;  2GAU A;  4A3G J;  1SD7 A;  4QVJ A;  1DG1 G;  3IH4 A;  2RDP A;  1RQR A;  5JI6 A;  1TBX A;  1YIT I;  1JHH A;  1VTN C;  2XC1 A;  3CCV I;  3SYJ A;  1OGM X;  3OPO A;  2E35 A;  3CCJ B;  3A2K A;  1HQC A;  5B1A H;  1QA6 A;  1MMN A;  3EET A;  2LZJ A;  3CME B;  3AVW A;  1MBE A;  1A6I A;  1GJR A;  3K2Z A;  4ZDP A;  4G12 A;  2K40 A;  4KIT B;  3MVP A;  4A3J J;  2COM A;  3DLL F;  5FFZ A;  2HFH A;  3LOC A;  5FLX Z;  2UXX A;  3RPU A;  1MBH A;  4ANJ A;  4Y13 A;  2IS2 A;  1VQM I;  3SLN A;  2Y75 A;  1U5T C;  4KIF A;  4OU0 A;  3S1Q J;  1D8T A;  1EP3 B;  3T56 B;  1U8B A;  4MR0 A;  1OPC A;  3W6K B;  3HOS A;  2ETH A;  2JSC A;  4XLP F;  4F93 B;  1E64 A;  5KVR A;  2ZBU A;  3BR5 A;  4DZJ A;  5JFR A;  1B23 P;  2XPV A;  2NOJ B;  4DQ2 A;  1IV6 A;  4MGR A;  1TLL A;  2J8K A;  1P7I A;  2CQ7 A;  2AXL A;  2EQR A;  1SD5 A;  1NBM A;  2CSO A;  2EFQ A;  1JJ6 C;  1QX4 A;  1JA0 A;  3FIW A;  4HST A;  3TKY A;  2R0Q C;  2AQE A;  1QVG B;  3ZOB A;  3PJR A;  1EH7 A;  4ZTJ A;  2X6O A;  2KRC A;  2G0E A;  3IH2 A;  1ORK A;  2MC4 A;  4IL6 C;  1JUS A;  5E3L A;  1T2K A;  1X1D A;  3RZO J;  3VSV A;  3LA3 A;  5ILU A;  1FNN A;  1ZGJ A;  3S32 A;  2DMN A;  3DEU A;  1T33 A;  2LSO A;  5J35 A;  2WAQ N;  2C77 A;  2IPQ X;  4H0E A;  2BZT A;  2IP2 A;  2BGI A;  1VFC A;  1LE8 A;  1T56 A;  1IV8 A;  1G7C A;  5E8G A;  1YI2 I;  5LGN A;  3TBI A;  1W36 D;  3HIF A;  5E1Z B;  2NS0 A;  1JHF A;  3RPQ A;  1ETO A;  1P92 A;  1E2X A;  4OAY A;  1IGN A;  1O3Q A;  1O57 A;  4V19 K;  2FE3 A;  1S7O A;  2EA4 A;  5CVJ A;  3OY9 A;  2KL4 A;  5IYB J;  3MMP A;  4Q4Z F;  2NAZ A;  5D5X B;  5BMZ A;  1FOK A;  5H5J A;  2K9L A;  1KMH A;  1S8N A;  2XKP A;  3ONY A;  2WAQ A;  2YPR A;  5IP7 J;  2H09 A;  3GTP J;  1WQ2 A;  1USS A;  4Z4W A;  4XRF A;  3KEO A;  2MG4 A;  4IEJ A;  4IVN A;  4IOC F;  2VON A;  2Y30 A;  4MHG A;  4B09 A;  1AA7 A;  4HOB A;  3PM1 A;  4OJO A;  2F1M A;  4TKO B;  2E7X A;  2DBB A;  2PMZ N;  3O3K A;  3CCV B;  3FHN A;  1HA3 A;  2V1X A;  2OQG A;  1DDI A;  4RDL A;  2M34 A;  3ZGK A;  4MTE A;  1O8G A;  4X06 A;  3H9G A;  2L9R A;  3BR3 A;  1IRG A;  5C4X J;  3RKY A;  2DXI A;  3Q0U A;  3I59 A;  5JVT A;  3K1M A;  4R79 A;  2W7N A;  1T8I A;  1XB2 A;  3WXM A;  3LAP A;  2CW7 A;  2LOO A;  2PLY A;  2G7H A;  4BJT A;  1FPQ A;  2ID3 A;  4HV6 A;  4I0B A;  3QP5 A;  2GXB A;  4J01 A;  4LIV A;  5J3O A;  3KP5 A;  2DOA A;  2PMZ A;  3OW2 B;  1XD7 A;  1K8A D;  2HGC A;  4M9Z A;  4CYD A;  2M4K A;  4FX0 A;  4RB3 C;  4QPQ A;  1IJE A;  4KFC A;  2QGG A;  3W5V A;  1KTV A;  5FL7 A;  1KZL A;  4KKU A;  1SAU A;  3CF5 F;  2DA5 A;  2E1R A;  3SEQ A;  3ZRG A;  3I54 A;  4EMS A;  2XOK A;  2XZP A;  3VNV A;  2Q2E B;  1OFM A;  4LG0 B;  1QQI A;  5DEQ A;  1VQN I;  4AF6 A;  2R7O A;  2NOG A;  4AID A;  3AL0 C;  3BY6 A;  4XRS G;  2VYQ A;  1ETY A;  3HOV J;  3EPZ A;  3FBI B;  4BYY A;  3IHU A;  2BXY A;  1AWC A;  2VXZ A;  4AU7 A;  1H85 A;  3IRQ A;  3ZSC A;  1BJA A;  1H9G A;  2CG4 A;  2X4H A;  2JRM A;  3KP2 A;  1VQ9 I;  4OWR B;  3KEY A;  2R7X A;  2EH3 A;  2LD5 A;  2YWG A;  4OPS A;  2HWV A;  4F91 B;  1VZ0 A;  2BY3 A;  5F6F A;  3UW0 A;  4UUT A;  1YS7 A;  2MGQ A;  4BJ6 C;  1YJN I;  4IHX A;  1W87 A;  5CPR B;  2DA1 A;  3CC4 I;  1YI2 B;  1UD2 A;  3I55 I;  2NXN B;  4X1E A;  2GZW A;  3HJE A;  3Q9V A;  1BC7 C;  4AF7 A;  1HZE A;  3K69 A;  1FJL A;  1NB9 A;  2O17 A;  4I6Z A;  3BPX A;  1NB0 A;  3ZC3 A;  3KP4 A;  4PK4 A;  1GDT A;  1FTT A;  4PJJ A;  3NRV A;  4Z4T A;  3GQ7 A;  4M73 A;  2BM6 A;  2IAI A;  1XSX A;  2L4M A;  3KZI C;  2JN9 A;  3WHC A;  3OW7 A;  5D5V B;  3JRC A;  1DP3 A;  4UZF A;  2ZXI A;  3FF5 A;  1E3O C;  1O7L A;  2HDN B;  3PVD A;  3FKS A;  3BJO A;  2Z16 A;  1MSF C;  4FE4 A;  4OJ5 A;  4Q48 A;  2HOT A;  3ZMV A;  1X1A A;  3DXJ F;  2FNP A;  2J7K A;  2HKX A;  1DGW Y;  1EV7 A;  4OP7 A;  4CIC A;  5F0H A;  3HEF A;  4ZCI A;  3G1O A;  2EIL H;  2Z3Y A;  3G4S I;  2XND A;  3CLO A;  3HHH A;  5JHU A;  5L3F A;  4Y9R A;  2Q6I A;  3Q5F A;  5FIU A;  3JQP A;  4YHB A;  2QSH X;  3HGG A;  1R5B A;  4YIR X;  4RLQ A;  1QFZ A;  4F7Z A;  3GTL J;  3QOP A;  5J1U A;  2QDX A;  3DF8 A;  5TV2 A;  1QZY A;  5A8A A;  4Z4Z A;  4RJL A;  2VFN A;  1UCR A;  4BAC A;  1XMX A;  4HNV A;  3A4C A;  4PC3 A;  2MD5 A;  4PSW A;  2QVO A;  3MHP A;  4AIH A;  1KQ5 A;  2BM4 A;  5J4Y A;  3F8C A;  2LC2 A;  2TRT A;  2CS3 A;  5E3M A;  1LFP A;  4HYE A;  1XGO A;  2O1D A;  3K10 A;  1ZM3 A;  2CYY A;  4MO7 A;  2H8R A;  3TO9 A;  3SJM A;  1YTY A;  4BAY A;  1HC8 A;  4DQL A;  2BSP A;  1K61 A;  4P12 A;  3PO2 J;  2OZU A;  3E6D A;  1VQN B;  3WU1 B;  4MEX F;  2F4O B;  3KLN A;  2FOK A;  3LMM A;  2DOD A;  2Y0M A;  3M8F A;  2DA7 A;  5BOX A;  4N9H A;  1KU2 A;  4HX4 A;  3P9K A;  3HB9 A;  4HQE A;  2HZT A;  4LBY A;  2XB5 A;  1U5T A;  3MMY B;  5LHH A;  4A93 J;  4C0S A;  1KQ8 A;  1YX2 A;  3SJP A;  3SQV A;  4II2 A;  1V5F A;  2LR8 A;  3E3V A;  3JW4 A;  3OYM A;  1TYU A;  4B43 A;  2DFH A;  1FOW A;  3KX2 A;  4CXF A;  2WC2 A;  2XTW A;  4AM3 A;  3I55 B;  2OCE A;  1E3H A;  1VBL A;  3H9J A;  4U0Y A;  5IP9 J;  2XNJ A;  3CC2 B;  1MDM B;  2NTQ A;  1ETX A;  3OMY A;  3S93 A;  1Z7U A;  4WQM A;  1B8I A;  4LBZ A;  3KFW X;  4Y33 A;  1I50 J;  2PEX A;  1EXM A;  3JX8 A;  3F72 A;  3M8J A;  1S6L A;  3ZXS A;  1LFB A;  2PN6 A;  3B4N A;  3GFJ A;  4HX8 A;  2DK5 A;  4Z4U A;  1O8I A;  3J81 K;  2KZV A;  1NG7 A;  4U0W A;  2MLK A;  2VQG A;  2VOD A;  1FX0 A;  5BSY A;  2V7X A;  2IBD A;  3HTS B;  1IC8 A;  3E0J B;  2JA2 A;  1XSD A;  1QUE A;  1BHE A;  2DMQ A;  1TC3 C;  1SMT A;  3DU5 A;  3OE7 A;  3I4M J;  1MKM A;  3CO7 C;  4BE1 A;  2VNK A;  3HOZ J;  4KT5 C;  1CLW A;  3PET A;  4KN7 X;  3GLX A;  3I53 A;  5DCM B;  5IYN A;  4EGY A;  3OR1 C;  4M6X A;  1T6S A;  4UVA A;  1LE8 B;  2IS1 A;  2OTL B;  5ILV A;  3TDU C;  1D0X A;  4YII A;  2VI6 A;  3H5R A;  3ZQH A;  4M1K A;  5J4V A;  2F43 A;  2VBE A;  3N97 A;  2X48 A;  5CYV A;  3RKQ A;  2HVS A;  2KQR A;  5EEG A;  2XAQ A;  5FRO A;  3E1Y E;  2GPJ A;  1Z7L A;  4XD7 A;  5EJC A;  1J0R A;  3CMM A;  3HRS A;  3AKZ A;  3T51 B;  4NK8 A;  3WTW C;  3G1L A;  1A31 A;  1QRY A;  1H8H A;  3C3W A;  2PFB A;  1QGA A;  2I10 A;  5ICE A;  2RGV A;  2QEX I;  3BTJ A;  1DU0 A;  2WPD A;  4PMH A;  1TW2 A;  2MH2 A;  2V9K A;  2ZJ2 A;  3G71 I;  3GTO J;  3K4K A;  4UHT A;  1B1B A;  4O6J A;  2Z1D A;  3MQ0 A;  3L00 A;  4HA8 A;  4LIT A;  2XDV A;  3MZY A;  1YJW I;  1B9M A;  1BR2 A;  4A12 A;  3J7A O;  4BKX A;  3A8J A;  4OM9 A;  1GUU A;  1T08 B;  3K4M A;  3R6S A;  3KIO A;  4BHB A;  3FKI J;  1S7A A;  1ZUN B;  1EA0 A;  2ZIT A;  4TMZ A;  3CJR B;  3HSR A;  1XG2 A;  5DS0 A;  4YDT A;  3GQA A;  2HQA A;  5TGT A;  4HRI A;  1G8X A;  1PP8 F;  4OIQ F;  3WTZ A;  1I1G A;  4GXO A;  2ISY A;  2O5R A;  3ZPL A;  2RN7 A;  1Y1V J;  3OIQ A;  2EIK H;  1TVC A;  1LLW A;  4X6A J;  4OIN F;  1FOX A;  1G2H A;  2QMU A;  1IHM A;  4RA2 A;  2X6W A;  3WHB A;  5FRN A;  4XLN F;  3RJP A;  5EZG A;  3KCC A;  1FMV A;  2JVG A;  1AU7 A;  3C2H A;  4A3M J;  1VHO A;  2DMP A;  2VFO A;  4UV9 A;  2BVN A;  1O8D A;  1S0U A;  2E5Z A;  3SLD A;  1I6X A;  1IUY A;  1ZLK A;  4P26 A;  3GTK J;  4U87 A;  1GHC A;  4RGU A;  4PC7 A;  2XT2 A;  1V55 H;  3K2A A;  2I8D A;  3R0A A;  4U4B A;  3VYS B;  2UVF A;  1WJ5 A;  2E36 A;  2DDB A;  3WU2 C;  2K9S A;  3B6A A;  1F60 A;  1V0F A;  1X0C A;  3U1K A;  2LH9 A;  4BQO A;  2EWE A;  4LD5 A;  3DTK A;  4I7H A;  2RC4 A;  3IC7 A;  3S3O A;  2ADU A;  2QKL B;  3MD2 A;  1GR1 A;  1FT9 A;  2XGC A;  3GEZ A;  1KA8 A;  1W7P A;  2EBI A;  3N90 A;  4J00 A;  2VE8 A;  3WTY C;  2QBY A;  1J9I A;  2BY1 A;  4UB8 C;  1EF4 A;  2FU4 A;  2HNH A;  1G7R A;  3REO A;  2DIE A;  1JTY A;  3KL9 A;  2A05 A;  3J81 Z;  2CH0 A;  4CCK A;  4FX4 A;  4B3X A;  1FDR A;  3M07 A;  4TMW A;  4C30 A;  4Z4Y A;  2G0Y A;  1OCP A;  5F0F A;  3WE2 A;  2C5B A;  1MMS A;  2CW0 F;  2F4M B;  5D8K B;  5HDN A;  1OYY A;  4NNJ A;  4UVC A;  1R1U A;  2KKO A;  3M9A A;  4EJO A;  2GRE A;  4YAF A;  3L1P A;  1JGS A;  2G7U A;  1H9T A;  1VND A;  1JE8 A;  3PSF A;  4U9U A;  3P27 A;  5GTH C;  1WPC A;  3E1S A;  2QQ8 A;  5JBQ A;  2QEX B;  1ZTR A;  3BTC A;  3PUN A;  5FD5 A;  2J5O A;  4A3C J;  3B8H A;  4URR A;  3G71 B;  2M45 A;  3GVK A;  2IA2 A;  4IF4 A;  1TWH J;  4M9X A;  5J3L A;  4G7O F;  2VNI A;  1LB2 A;  2F4I A;  2JVH A;  4OMZ A;  3V8K A;  3MZ8 A;  4H4K C;  3LNQ A;  5H20 A;  3VSL A;  1PJ5 A;  1YJW B;  1MMA A;  2O7O A;  1NTC A;  3AG3 H;  3ASO H;  1BJK A;  4G6Q A;  2V31 A;  4KN4 X;  1P4A A;  5F04 A;  2CQN A;  2NT6 A;  4RS8 A;  3OEH A;  1I6H J;  2DW4 A;  4HNT A;  1E43 A;  1R00 A;  2HYG D;  5CVV A;  2BSA A;  3TL4 X;  4KIC A;  1FBQ A;  4BH9 A;  3DKW A;  5IYW A;  3DKY A;  3BLY A;  1M1E B;  2CC2 A;  4DQK A;  3OSG A;  2VFP A;  3TP0 A;  4N3N A;  4XLH A;  1KK1 A;  4F7D A;  4R71 A;  1X4O A;  3BRO A;  5FLM J;  1UHS A;  3B6C A;  3E5Q A;  2LRE A;  1YHQ I;  3P26 A;  4U49 A;  3ZN0 A;  1RQP A;  1Z9C A;  2D2W A;  3PNV A;  2PLF A;  1YLF A;  2UV1 A;  1CF7 B;  5C1C A;  1ZAO A;  3MKL A;  3OYD A;  1KTW A;  1IAW A;  3K7A J;  3QPH A;  2ZTG A;  2FXA A;  3WTX C;  2P81 A;  2R7F A;  1PUF B;  2Z9O A;  1Q7Y D;  3IL2 A;  5LBQ A;  1EWY A;  4QFM A;  3KZZ A;  1UZC A;  2EB7 A;  1YE9 A;  2E1O A;  4WK8 F;  3ZQL A;  1R5N A;  4MXN A;  2KMU A;  3F23 A;  2O0V A;  1SAN A;  2E2I J;  3VYT B;  1ZN2 A;  4ZGN B;  1SD4 A;  1JGG A;  2X85 A;  3J7Z I;  2VBV A;  4UZU A;  4CCL A;  4C2L A;  2W57 A;  4HBL A;  4BXU A;  4FET A;  2R92 J;  1XGM A;  1XQB A;  3SEJ A;  4EEF G;  2P5L C;  3AG2 H;  4DOZ A;  5F1J A;  2YWF A;  1I27 A;  3L2W A;  2BPO A;  2VBX A;  3VNU A;  3UR3 C;  1SKQ A;  1MJB A;  3AVU A;  3KE2 A;  2K02 A;  1CQT A;  3ABL H;  1XCV A;  4NDL A;  2OAZ A;  3Q3S A;  1OCR H;  2VBU A;  3QYF A;  4DNC A;  1R5I D;  3OJX A;  2O9L A;  3T9G A;  1FP2 A;  1UG0 A;  3DBH B;  2CW5 A;  1R36 A;  3OIP A;  1KU3 A;  4Z4V A;  2CRV A;  1FNC A;  1WJE A;  3BH4 A;  1I1S A;  1RNL A;  1GV5 A;  2WY7 Q;  1E1Q A;  2OBR A;  5DN6 A;  1QA2 A;  3JUR A;  3S2D J;  3WBK A;  5C44 J;  3NAR A;  2XT4 A;  3GX4 X;  2L0K A;  4HE5 A;  2PEC A;  3CCE B;  1D5V A;  2BGC A;  4KKS A;  2XB0 X;  2XAS A;  2HXI A;  1P4W A;  3LSJ A;  4IPA A;  4BHP A;  1Q1V A;  5M5W J;  5HLT A;  2XGJ A;  1EFU A;  3VST A;  2FOW A;  3CCL B;  1QGZ A;  1XX5 A;  1ZQ3 P;  1N8R D;  3PA1 A;  2OUM A;  3DPL C;  4L9N A;  1BBY A;  3JSO A;  4HE6 A;  1QNT A;  4HG2 A;  5CDF A;  1D1N A;  2K4B A;  4B4C A;  5E8I A;  2WV0 A;  2UXN A;  4IRG A;  1TW3 A;  3HGY A;  3RYP A;  3L2R A;  2M5S A;  5HNH A;  5KW9 A;  2EZI A;  1GVH A;  2Q6O A;  1I39 A;  3IAM 2;  3FPP A;  2RNG A;  1KRH A;  2O6G E;  2HEO A;  3GZ5 A;  5F08 A;  4ZZD A;  4BJ5 C;  1VQ6 I;  1VLO A;  3CCR I;  2Y31 A;  2QQB A;  4BBS J;  2VAS A;  3TOB A;  5FLX K;  2EFG A;  2L54 A;  4BQQ A;  4RD6 A;  4S0H B;  3G05 A;  2WJY A;  4LG0 A;  5GV8 A;  1PJR A;  1KU7 A;  1YHQ B;  1JT6 A;  3DPU A;  5KAI C;  4NC7 A;  2GXG A;  3K4N A;  3WNC A;  3OWT A;  2RC6 A;  1UB9 A;  3QPS A;  2CBX A;  4DNT B;  4OJ6 A;  1XDU A;  5A88 A;  2F5C A;  5D8L B;  2BN4 A;  3HXL A;  1ZGA A;  2F3L A;  3LA2 A;  3OJW A;  2GBY A;  3CMA B;  1TNT A;  1ZK8 A;  2VIX A;  5J6X A;  4IOA F;  3H09 A;  2GQF A;  3BTL A;  1RC9 A;  1Y8Q B;  4RAZ A;  2BV3 A;  4FTH A;  1TQI A;  1XPX A;  4M0L A;  3GYH X;  3GQ9 A;  3V76 A;  3E6M A;  3H35 A;  5E17 F;  3DEE A;  2AQF A;  2FQ3 A;  3FK7 A;  4GCV A;  4UNO A;  3B73 A;  3KEW A;  1TUI A;  3LSH A;  3FZV A;  3D5S C;  1WSV A;  3JRI A;  5LD2 C;  4P9F A;  2N8G A;  4GYI A;  2V9P A;  4XNF A;  3X2Q H;  1I3A A;  2V7V A;  2OJE D;  5FO5 A;  4EW9 A;  2A6E F;  5F1R A;  4WWC A;  2K9N A;  3VYU B;  1KYZ A;  3OYL A;  4Z4R A;  5D5U B;  5K5R A;  3A3G A;  1WI3 A;  1XMA A;  3P9I A;  4KKT A;  4C3H J;  1Q9S A;  1F43 A;  4RAY A;  3JQR A;  3OOP A;  3S14 J;  2IW5 A;  2DPD A;  2L9V A;  3W2A A;  3OS2 A;  2VBS A;  2M0C A;  4CUG A;  3OYA A;  4XLA A;  1RRJ A;  1MSE C;  2A07 F;  4LB5 A;  3PO3 J;  1XB4 A;  3H9N A;  1R7J A;  1HXD A;  1ZAR A;  2YSR A;  3BP8 A;  1W5S A;  4XLE A;  2V7Q A;  3JRE A;  4HEA 2;  4L0Z B;  5C4J J;  1T6Y A;  4G1B A;  4E7J A;  4XM3 A;  4ESB A;  4QUZ A;  3OS0 A;  2HYF A;  1U6G A;  4ZCM A;  2CUE A;  2PX9 A;  5GV7 A;  3ONQ A;  5IPA A;  1IXC A;  4YAW A;  1K4T A;  3HHG A;  1BPL A;  4YFN F;  2XC7 A;  1TYW A;  4II3 A;  2ZFU A;  5FLV A;  3K70 D;  2XSJ C;  1KK3 A;  2C5H A;  1YX5 A;  3ZZU A;  3A8K A;  1FRN A;  1QCX A;  2E60 A;  3PQJ A;  1V54 H;  4B4D A;  3PL8 A;  3LVB A;  4XIC A;  1IN5 A;  4Y17 A;  5HLH A;  2JQ7 A;  1AHD P;  1QVF B;  1Z91 A;  1WZ2 A;  1J5Y A;  5BPD A;  2PJR B;  1MD0 A;  3AFH A;  2X8K A;  4A6D A;  1E17 A;  3R6K A;  4LIU A;  2IGO A;  1YW7 A;  2LYC A;  3ZQI A;  3FXU A;  4D0P A;  2CWE A;  1D0Z A;  1ETQ A;  3WGI A;  2DDA A;  2Z2S B;  4GGG A;  1X1B A;  3BG3 A;  1ZG3 A;  3GVL A;  2HZD A;  2KVO A;  1WH7 A;  2XGX A;  2EIM H;  3QOE A;  2VBM A;  2MC3 A;  2LFB A;  3CLQ A;  4EJV A;  3RDI A;  3JTH A;  1SFK A;  2KIF A;  3BTI A;  3MEX A;  3V7C A;  3IH3 A;  1PJ6 A;  2GJR A;  3GTQ J;  4PAB A;  4EH1 A;  2EFO A;  4XSZ F;  2H1L A;  5D4S A;  5LRR A;  3IRR A;  3GQB A;  2Y2Z A;  3HDD A;  1YJ9 B;  4ZYG A;  4LBW A;  4NBS A;  4C2T A;  2DCE A;  1FRQ A;  2Z5U A;  3RY8 A;  3RQ4 A;  3GBG A;  3WGH A;  5FA6 A;  2HQ5 A;  1G3W A;  1O4X A;  1BL0 A;  4YZA A;  1UMQ A;  4KIS A;  5FFX A;  2VKH A;  1H89 C;  4B3F X;  1N0V C;  1W5C C;  3HOW J;  1T0F A;  1VJS A;  3IKT A;  5CVR A;  2QF7 A;  5D6F A;  3U9G A;  4RAF A;  4BXX J;  1NG6 A;  2IQ7 A;  1MDM A;  2XAH A;  1F36 A;  1IB4 A;  1O8J A;  3JRG A;  3W2H A;  4P55 A;  5J1R A;  3EQL F;  3GO5 A;  3GLL A;  4LFU A;  1MW7 A;  1BR1 A;  3ZMT A;  2CQQ A;  1DGR M;  3GSI A;  4YZQ A;  3O6B B;  1O8L A;  3GCM A;  4RB0 A;  1OJL A;  5J40 A;  4CZC A;  5J8F A;  2L9S A;  3ESW B;  2KDZ A;  1K5C A;  4XOT A;  1U0J A;  2JIZ A;  3QFC A;  1PVE A;  2EPF A;  2BV6 A;  4A0Y A;  3MCA A;  4DBQ A;  4E7H A;  4YRV A;  4FHT A;  3T1B A;  1HOM A;  3SDG A;  1IJF A;  1ON2 A;  2E19 A;  4P96 A;  2VXD A;  5GAG J;  5DS9 A;  2FBH A;  3VR6 A;  3CCS B;  3BZC A;  2DA4 A;  1TNS A;  1RIO H;  2JA8 J;  5L46 A;  1PP7 U;  3J81 k;  1R4N B;  4Y7C A;  4RD2 A;  3JSP A;  2OD5 A;  5EYR A;  5BS6 A;  2JPC A;  4TN1 A;  3HM5 A;  1RPW A;  5DCM A;  1IN7 A;  4WZT A;  3CDH A;  4KYW A;  4ZYE A;  2RQQ A;  2KT0 A;  5KAF C;  3CCM I;  3DWL E;  4RLF A;  5HOD A;  1Y8R B;  1UJ8 A;  4WZK A;  1U3E M;  1FLI A;  2FML A;  4LC0 A;  3J80 K;  2ISZ A;  1OFD A;  2XGD A;  3NQO A;  1IN6 A;  1CNE A;  1TTT A;  3QYE A;  4KJZ A;  4UY8 I;  4NQW B;  1ZG5 A;  1JJ8 C;  4GO1 A;  4JQF A;  1YQA A;  3WOD F;  1JKO C;  4P6Y A;  3M7G A;  1XMK A;  2AXT C;  5IT9 Z;  1S72 I;  3MKW B;  3QE2 A;  5DD4 A;  3S16 J;  3G2B A;  4GDF A;  1ZM2 A;  4UB6 C;  2WR8 A;  3LSK A;  3AST A;  2RRE A;  4HX7 A;  3D5L A;  4RGS A;  4LOC A;  3ZIA A;  5F0C A;  2QGU A;  1VQ8 I;  1RU4 A;  1KYW A;  3S1R J;  4IRH A;  1G59 A;  4XMY A;  2ZZG A;  3H0G J;  4IHW A;  1YIT B;  3WG9 A;  2Y9Y A;  1S3J A;  3PEN A;  2CQK A;  5DDG A;  4UVB A;  3TP3 A;  5FB2 A;  1T38 A;  2VBW A;  3PA2 A;  3GIR A;  3QFR A;  1OOC A;  2VKD A;  3ML3 A;  1EA3 A;  1HW2 A;  1XC5 A;  2E5N A;  3ECH A;  1LQ1 A;  3LAJ A;  4Z1M A;  1WVR A;  1ZM4 A;  2Q0O A;  5CQE A;  1BW5 A;  1I3Q J;  2RAE A;  3P5J A;  4KNY A;  1TP4 A;  2QA4 I;  1R49 A;  3GZN B;  2LMD A;  4M6Y A;  5EEA A;  4E0F A;  3LMW A;  2MBF A;  2WJV A;  1OYI A;  1VQM B;  2QUF A;  2DAO A;  3OYJ A;  3S2H J;  3OFN A;  1I18 A;  3H9Q A;  2OC6 A;  3L09 A;  4BY7 J;  2QTL A;  4HLY A;  2NTP A;  1BIA A;  2K9Q A;  2DOE A;  5JVG F;  1LFU P;  5CJ9 A;  5H6R A;  1VQ5 I;  4M3G A;  4BXF A;  4RDU A;  4YAL A;  3BPV A;  2FQ4 A;  1BC8 C;  3DTE A;  4XON A;  4UUS B;  2X3H A;  3FXL A;  3S1N J;  1ZR4 A;  4Q5S F;  1DDG A;  5BQT A;  3EQN A;  1KC8 D;  3CQZ J;  3BQY A;  3ULQ B;  4L18 B;  3SZE A;  1KZH A;  1WOP A;  2H6C A;  4D7N A;  3ZZ0 A;  2EV5 A;  1OFE A; 
#chains in the Genus database with same CATH homology
 2XF6 A;  3A35 A;  2XZL A;  1E1R A;  2W4S A;  3OR1 C;  5LFA A;  4PJL A;  2IS1 A;  1UD6 A;  3OEE A;  3OL4 A;  1D0X A;  2KLO A;  3H5R A;  1O8M A;  2VBE A;  2F43 A;  4ZYA A;  4BUP A;  2WAD A;  1Z21 A;  2HVS A;  2KQR A;  5C1E A;  5FRO A;  1DBO A;  5CKT A;  3BCF A;  1Z7L A;  4XD7 A;  4XL9 A;  3AKZ A;  3CMM A;  5KNL A;  1PKV A;  3T51 B;  4NK8 A;  1H8H A;  4E7I A;  2VQC A;  1MMD A;  1UEL B;  2CFO A;  2HPM A;  2HLD A;  3ZPN A;  1MNE A;  5HNF A;  4G7X A;  2O04 A;  4PMH A;  2WPD A;  3BG6 A;  2V9K A;  1W0J A;  2M3A A;  3WWG A;  3K4K A;  2JDI A;  2Z1D A;  4LIT A;  2XDV A;  3HC7 A;  1IA5 A;  4ZC3 A;  3IUO A;  1BR2 A;  3B90 A;  3EUA A;  1OFL A;  4YEJ A;  4IQJ A;  4DNR B;  3W2V A;  2W6I A;  1JI8 A;  3K4M A;  2WY8 Q;  4E7Z A;  2WA0 A;  1KCD A;  2F5V A;  4W8S A;  4BDY A;  2HVR A;  4P22 A;  2X1C A;  4W8R A;  3CJR B;  3IP4 B;  4BEH B;  4CCO A;  1XG2 A;  4P5O A;  4NC8 A;  4F3Q A;  2X6Y A;  2R7S A;  3GQA A;  2HQA A;  1BLI A;  5TGT A;  4HRI A;  3FBN B;  2WZP P;  1G8X A;  1JRG A;  1E3X A;  3UNG C;  3BCA A;  2O5R A;  3NWS A;  4E7L A;  3OR2 C;  1HVX A;  3OIQ A;  4N4N B;  3EUK L;  1EFR A;  2WAF A;  2X6W A;  5FRN A;  2M7B A;  1W36 C;  5KHD A;  3K4J A;  1FMV A;  2JVG A;  3C2H A;  1UD5 A;  1Z3Y A;  4L8J A;  1O8D A;  2XF5 A;  2E5Z A;  3K4B A;  1MND A;  4U87 A;  4U4B A;  2I8D A;  1T95 A;  3OYK A;  3VYS B;  1O8K A;  1WJ5 A;  2UVF A;  3MKY B;  1X0C A;  1V5G A;  1V0F A;  2V26 A;  2R7U A;  2LH9 A;  4BQO A;  2EWE A;  3DTK A;  3S3O A;  2ODL A;  1GQ8 A;  2QKL B;  2MAB A;  3MD2 A;  4Z06 A;  4ZDO A;  2DT7 B;  2CW8 A;  2GK6 A;  4GRI A;  4HSR A;  2QKM B;  4J00 A;  3LNN A;  2QX3 A;  2WB1 A;  2E1M B;  2HNH A;  3CP8 A;  4HIZ A;  2DIE A;  2DJI A;  3A1Y A;  4ZTF A;  2CH0 A;  1QHG A;  3LSI A;  4CCK A;  4PFP A;  4B3X A;  1Y56 A;  3QOD A;  3L2U A;  4C30 A;  4BDZ A;  2NT9 A;  4U7B A;  2BW3 A;  3TMO A;  2X6X A;  2KPM A;  2GOM A;  4PFO A;  4MLO A;  2P0W A;  4JOM A;  4NNJ A;  3OYI A;  2LRD A;  3V42 A;  3H0D A;  1IRX A;  3PSF A;  1WJA A;  3OS1 A;  4XOP A;  1NRK A;  2HDW A;  4F55 A;  1WPC A;  2ZZE A;  3E1S A;  4IX7 A;  1N77 A;  4AVZ A;  4ZDL A;  2QY1 A;  4URR A;  3GVK A;  4P1W A;  1SKY B;  4KT6 A;  3K70 C;  2L5Q A;  1K6Y A;  3OL3 A;  2F4I A;  2JVH A;  1P9Q C;  2VJ5 A;  4H4K C;  1D1A A;  3VSL A;  3RSN A;  1OHH A;  4Y4R A;  3W2W A;  2CV1 A;  4D9J A;  2V4J C;  3VDX A;  2V1N A;  3OAA A;  4XOR A;  1MMA A;  4IQ4 A;  2LBF A;  2VBK A;  2V31 A;  4HPQ A;  4DJA A;  3K6G A;  2UWM A;  3OEH A;  2NT6 A;  1E43 A;  4HNT A;  2UUZ A;  4ITV A;  1V5E A;  2IGM A;  3W3C A;  3KYL A;  2QE7 A;  3TL4 X;  2INV A;  3B8Y A;  4I84 A;  4CA0 A;  2A5W A;  2R4G A;  3BLY A;  3DKY A;  1WTH D;  2M4G A;  1IDK A;  3CF2 A;  2NTB A;  4XLH A;  3AL0 B;  3BC8 A;  2IS6 A;  2R7V A;  4DK1 A;  4B48 A;  1TT0 A;  1X4O A;  3LL7 A;  3HKZ A;  2V7F A;  2KP6 A;  2LRE A;  3PNT A;  4U49 A;  3ZR8 X;  3VMW A;  4E7K A;  1VF7 A;  4YXW A;  3PNV A;  2GK7 A;  4PSX A;  2Z8G A;  2D3N A;  4XKC A;  1DQU A;  2Z6B D;  2UV1 A;  4ZJZ A;  2VLA A;  3CZ6 A;  2NSP A;  5C1C A;  2W1O A;  3OYD A;  4BU2 A;  5HVQ C;  1KTW A;  4CCN A;  2ZTG A;  3MKZ A;  3DTI A;  2K5C A;  1X19 A;  3H5A A;  4NUB A;  3RTR A;  3OOC A;  4CSW A;  4LG3 A;  1YE9 A;  3M1C A;  3NE5 B;  4MXN A;  3KRG A;  2KMU A;  2O0V A;  3OPO A;  3VYT B;  4W8Q A;  4RM3 A;  2KHM A;  4E4H A;  2X85 A;  3RPU D;  1K28 D;  4BE2 A;  2BW3 B;  3DKX A;  4G6T B;  4CCL A;  4UZU A;  1BR4 A;  1NHC A;  3CP2 A;  4C2L A;  4FET A;  3BC9 A;  4QPO A;  2R9V A;  2WSS A;  1O8E A;  4BQN A;  4DOZ A;  3L2W A;  2CUJ A;  4GQN A;  3DQV C;  3HL2 A;  3DPT A;  3UR3 C;  2X53 S;  3SZG A;  3H94 A;  1OGM X;  2CUZ A;  3A2K A;  3QYF A;  3T9G A;  2LZJ A;  1MMN A;  1UG0 A;  3T53 B;  3K4C A;  3OIP A;  2L2O A;  2Y0S A;  4ZDP A;  3A3B A;  1WJE A;  2ZZQ A;  1N78 A;  3BH4 A;  4KIT B;  2WY7 Q;  1E1Q A;  4XN0 A;  5DN6 A;  2VJ4 A;  2LBF B;  3JUR A;  4ANJ A;  2IS2 A;  4ASU A;  1LDK B;  2CMP A;  2PEC A;  4MR0 A;  3T56 B;  4KKS A;  3HOS A;  2W6J A;  4G7W A;  4F93 B;  1W0K A;  3EQO A;  2PYG A;  4CCM A;  3VSK A;  3BCB A;  4JMQ A;  2NOJ B;  2L9N A;  4IKF A;  2R7T A;  2VJI A;  2A6T A;  1H8E A;  3NWT A;  1IDJ A;  5HLT A;  1NBM A;  2XGJ A;  3VST A;  2IXS A;  4HST A;  3QYB A;  3OYN A;  2AQE A;  3RCO A;  5CDF A;  2KRH A;  2OUM A;  3DPL C;  4HG2 A;  3PJR A;  1UD4 A;  4ZTJ A;  3PNY A;  3L2R A;  2M5S A;  5HNH A;  2KRC A;  1PXZ A;  3K4L A;  2MC4 A;  3IAM 2;  3FPP A;  2JSP A;  2RNG A;  1WFX A;  2CV0 A;  1MAB A;  3IAS 2;  4BJ5 C;  5AMV A;  1X1D A;  3VSV A;  2VAS A;  3JU4 A;  4Y3O A;  3S32 A;  2E1B A;  1TZL A;  4BQQ A;  4PJN A;  3G05 A;  2WJY A;  1PJR A;  1MMG A;  1D1C A;  3DPU A;  3VMV A;  4NC7 A;  2PJR A;  3K4N A;  3N05 A;  3OWT A;  2WAE A;  2IGK A;  1WP6 A;  4DNT B;  2JUG A;  1QJV A;  4OJ6 A;  3ZCO A;  3TBI A;  1W36 D;  4BS9 A;  2ZSI B;  2R7W A;  3CES A;  2INU A;  3HXL A;  3DLA A;  4OAY A;  2VIX A;  4D1Q A;  4XKB A;  1W9X A;  3BG7 A;  3OY9 A;  1V0E A;  2BOL A;  2KL4 A;  4XKV A;  3GRH A;  3GQ9 A;  3HAG A;  2K9L A;  1ZEL A;  1KMH A;  2JJ1 A;  1X4P A;  3H35 A;  2WAQ A;  2X1E A;  3DEE A;  2AQF A;  4XR6 A;  3DDY A;  3KEW A;  3LSH A;  2E1M C;  2V4D A;  3D5S C;  5LD2 C;  1WJC A;  3CJQ B;  4XNF A;  1E79 A;  1UD8 A;  5HOO A;  4FAS D;  1AA7 A;  4PJM A;  4EW9 A;  2KDO A;  4OJO A;  2F1M A;  2CK3 A;  4TKO B;  3LSG A;  2IGN A;  3VYU B;  3OYL A;  3FHN A;  4RM2 A;  3ZGK A;  3A3G A;  2XF7 A;  2DT6 A;  4AYB A;  4KKT A;  3H9G A;  2OV7 A;  1COW A;  1O8G A;  3SDB A;  1OGO X;  3HPH A;  3S3N A;  4G6I A;  2NST A;  1T0F C;  2MFZ A;  3OS2 A;  2HVQ A;  3W2A A;  3OOU A;  4CUG A;  4XLA A;  3OYA A;  4N4O B;  2DXI A;  4OJL A;  4BEH A;  2W7N A;  4R79 A;  1KON A;  4OZY A;  4XLE A;  2CW7 A;  2LOO A;  3HG9 A;  2V7Q A;  4OAZ A;  1R6R A;  3H5N A;  4HEA 2;  4BJT A;  4IZZ A;  1OB0 A;  4E7J A;  4XM3 A;  4J01 A;  4LIV A;  4YEL A;  2ZZF A;  3OS0 A;  2DOA A;  2PMZ A;  4C9Y A;  4NK6 A;  2M0M A;  4E6K G;  4XLC A;  4DK0 A;  3ONQ A;  4BL0 B;  1BPL A;  2M4K A;  2XC7 A;  4II3 A;  2VJJ A;  2ZFU A;  4CH7 A;  3K70 D;  2XSJ C;  4QPQ A;  1O8F A;  4YZX A;  1YX5 A;  2L7K A;  4CCJ A;  5FL7 A;  2GJP A;  1KZL A;  4KKU A;  1SAU A;  3OYC A;  2FUG 2;  1LVK A;  1QCX A;  3SEQ A;  1WJB A;  2E60 A;  2VL8 A;  3ZRG A;  3PL8 A;  2XOK A;  3VYR B;  2XZP A;  2LY2 A;  2Q2E B;  1OFM A;  4B44 A;  4B3G A;  2Q1Z B;  1OLT A;  3ZPP A;  3VWB A;  4Z05 A;  2PJR B;  2R7O A;  3AL0 C;  1BN8 A;  3AFH A;  2X8K A;  1I8D A;  4LIU A;  2IGO A;  3EPZ A;  3FBI B;  3OYE A;  2LYC A;  2O0W A;  2X1D A;  5IK2 A;  2VXZ A;  4AU7 A;  1D0Z A;  2VQL A;  1UAA A;  1HG8 A;  3ZSC A;  4E7S A;  2Z2S B;  4OWR B;  1X1B A;  3KEY A;  2X51 A;  3LFU A;  3SEZ A;  2R7X A;  3GVL A;  2HZD A;  2KVO A;  2VB6 A;  4F91 B;  1VZ0 A;  3QOE A;  2VBM A;  1VLY A;  3UW0 A;  2XZO A;  4BJ6 C;  2GJK A;  1SFK A;  2LG4 A;  2GJR A;  3OYB A;  5CPR B;  1RWR A;  3FKJ A;  2IS4 A;  1BMF A;  3GQB A;  1UD2 A;  1KCC A;  2VPL A;  2WBM A;  3S3M A;  4C2T A;  1HZE A;  2O17 A;  2DCE A;  3PSI A;  2PYH A;  3RQ4 A;  3GBG A;  1YX3 A;  3L2Q A;  4PK4 A;  1RMG A;  3VSU A;  4PJJ A;  4YZA A;  1QU3 A;  1T5E A;  4KIS A;  1FMW A;  1H80 A;  1AIR A;  1JTA A;  3GQ7 A;  3OW7 A;  2VKH A;  3L2V A;  3DU6 A;  1DP3 A;  4B3F X;  2W00 A;  2ZXI A;  1VJS A;  3OYG A;  2XAU A;  1UD3 A;  3FKS A;  3SYT A;  3J7A Y;  2BVM A;  3WQZ A;  1NG6 A;  1QHH D;  2Z16 A;  2IQ7 A;  1IB4 A;  3I9V 2;  1O8J A;  4OJ5 A;  1Z3X A;  1EE6 A;  1MW7 A;  1BR1 A;  1X1A A;  2ELJ A;  2HU9 A;  1DGR M;  2VQH A;  4RMN A;  1O8L A;  4YZQ A;  1DGW Y;  4CZC A;  4PUS A;  4W8T A;  1K5C A;  2L9S A;  2K9M A;  3SUC A;  4XOT A;  1U0J A;  2JIZ A;  3OYH A;  2NZM A;  1O8H A;  4DBQ A;  4E7H A;  4EAT A;  4YRV A;  4OJP A;  2XND A;  4XLF A;  3U21 A;  3OYF A;  4F52 A;  1ERD A;  2K3P A;  2VXD A;  3VR6 A;  3ZQQ A;  2CV2 A;  4RLQ A;  4XKW A;  3D5R C;  4DGW B;  2QXZ A;  4XQF A;  1GLN A;  2ZSH B;  4BAC A;  1PLU A;  2LY1 A;  1OR7 C;  3A4C A;  2JJ2 A;  4PSW A;  3PFY A;  1DBG A;  2F6C A;  2RQQ A;  1BOB A;  2LC2 A;  2CS3 A;  3DWL E;  4RLF A;  1LFP A;  3GVJ A;  3FY3 A;  2O1D A;  1LKX A;  3K10 A;  1X1C A;  1PYV A;  3PUB A;  3QYE A;  4KJZ A;  4XN3 A;  2MD0 A;  4BGD A;  2BVL A;  4NQW B;  2BSP A;  2ZTN A;  4F92 B;  4JQF A;  5CQG A;  1HA8 A;  4HNU A;  4FXU A;  3MKW B;  3GQ8 A;  3LMM A;  2R7R A;  3G2B A;  4B47 A;  4HWV A;  3LSK A;  3FDY A;  2RRE A;  3ZIA A;  3D5L A;  5FRM A;  1RU4 A;  1N75 A;  1WMR A;  3F9K A;  1G59 A;  1WJF A;  2W82 A;  4XMY A;  3MMY B;  2ZZG A;  2ZXH A;  1OOC A;  1J09 A;  3EUH C;  1V5F A;  4II2 A;  4BE0 A;  3OYM A;  2V6E A;  4YZ0 A;  2VKD A;  4B43 A;  4TT3 A;  1EA3 A;  1WJD A;  2E5N A;  3KX2 A;  4DIQ A;  1E0E A;  4OZZ A;  2GOX B;  4Z1M A;  5KCM A;  3H9J A;  3HPG A;  1VBL A;  5CQE A;  2D3L A;  2NTQ A;  3S93 A;  3OMY A;  3HOT A;  1E3Z A;  3S8P A;  4C2U A;  2UVE A;  3BCD A;  1CZF A;  4E0F A;  3LMW A;  4Y33 A;  1PE9 A;  2WJV A;  2HPI A;  1S9H A;  1D1B A;  3M8J A;  3OYJ A;  3ZXS A;  3HUG B;  3OFN A;  1I18 A;  3H9Q A;  2OC6 A;  3I3L A;  2NTP A;  3B4N A;  1O8I A;  2MYS A;  5JHF A;  2KZV A;  1NG7 A;  3LSM A;  5HKK A;  4Z03 A;  2VQG A;  4BXF A;  3C2G A;  1FX0 A;  4DBR A;  2M7A A;  3DTE A;  1D0Y A;  4XON A;  1BHE A;  3E0J B;  2JA2 A;  4X0G A;  2X3H A;  1Y6I A;  2R7Q A;  3DU5 A;  3EQN A;  3OE7 A;  4BE1 A;  4TSF A;  1O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...