4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
3VSVA 4XN0A 1IDJA 2INVA 5AMVA 4YZ0A 1K5CA 4YZAA 4C2LA 1BHEA 1IDKA 4XKVA 1RMGA 4XLFA 2BSPA 3ZPPA 3SUCA 3VSUA 2PYHA 1PXZA 4XONA 4Z03A 4XORA 2UVEA 4YEJA 1O88A 2NSTA 1NHCA 1O8DA 1BN8A 1O8FA 2X6YA 2X6WA 2QX3A 4YZQA 4I84A 4XR6A 2NT9A 2O17A 3FY3A 2O0VA 2O1DA 1VBLA 2VJIA 4W8TA 4NK8A 3B4NA 4NK6A 3VMWA 2X85A 1GQ8A 4XLEA 4URRA 2Z8GA 1O8LA 1O8IA 4XOPA 1QJVA 4XM3A 2VBMA 1OFLA 4W8RA 4W8QA 1O8JA 4U49A 2NZMA 1RWRA 2NT6A 1JTAA 3T9GA 3GQ9A 3GQAA 3UW0A 4XLHA 4U4BA 1HG8A 2NSPA 2EWEA 3ZSCA 2NTPA 3GQ8A 4OJ6A 4W8SA 3KRGA 1JRGA 1O8EA 4OJLA 1O8KA 2VJJA 4XMYA 4YELA 4OJOA 4XLCA 4OZZA 2PECA 4AVZA 3GRHA 4MXNA 2INUA 2X3HA 1H80A 1O8GA 1O8MA 3B8YA 1PLUA 2QXZA 1XG2A 1IA5A 3B90A 3LMWA 4XNFA 4XKWA 1KCCA 2PYGA 1DBOA 2NTBA 2NTQA 3GQ7A 4YZXA 3WWGA 3EQNA 1WMRA 4XLAA 2UVFA 4XL9A 4EW9A 1PE9A 1IB4A 2VBEA 3VMVA 4OJPA 1KCDA 4Z05A 5C1CA 3VSTA 1DBGA 2O04A 2QY1A 4OJ5A 1KTWA 4MR0A 1EE6A 2X6XA 1OOCA 1RU4A 4XN3A 1AIRA 2IQ7A 1O8HA 5C1EA 4HWVA 4PMHA 4Z06A 1CZFA 3JURA 1QCXA 1OGOX 4OZYA 4XQFA 1OFMA 2ODLA 2O0WA 4XOTA 2VBKA 1OGMX 1X0CA 3EQOA
chains in the Genus database with same CATH superfamily
4N9IA 2K40A 3H1CA 2RC6A 3R6SA 3CP2A 5IYRA 4Z4VA 1L3LA 1A31A 2R4GA 3AFHA 1SMYF 3HM5A 4L5JA 3H9GA 3AAFA 4YFOA 3LAJA 1FJLA 4TMWA 3JCUC 1LUJB 4ENNA 1S29A 3REOA 4TKOB 2NXNB 2DCUA 2GBYA 1O3SA 1SVLA 2DU9A 3N97A 3AVYA 1K79A 1WOOA 1VQ5I 1QO0D 4E6KG 2PMUA 2ESNA 3LO8A 4ROXA 4HZFA 2XAFA 4MIMA 1GVHA 3O8HA 3DF8A 1T39A 3KP4A 2PLFA 1BI2A 4RD1A 3CCQB 4HDUA 4U87A 3A3GA 1S9HA 2LC2A 2ZC2A 4GO1A 3PVDA 2LG4A 1WJCA 3FXUA 5HXBA 3GXOA 3HOUJ 1VQNB 1EH7A 3ASOH 1W87A 1Z7UA 4F7DA 1Z9CA 1KQ8A 3M1EA 3ECHA 2ZZEA 1E2XA 2FOWA 4M3EA 4NC6A 3ML3A 3LQ6A 2VONA 4HNVA 1KYZA 3VO2A 5CDFA 2BGJA 1XCVA 1GUUA 1QFJA 3E5UA 3F21A 1XPXA 1Z0XA 4PUSA 2EZIA 4P12A 3OP1A 1QX4A 1RIOH 3A1PA 1Y39A 4W1UA 2NTPA 3SQVA 1A35A 1OFDA 3IRRA 2E2JJ 2CW7A 2F2EA 3PUBA 1T0FC 3ZMVA 1QU3A 5EDNA 1O8KA 3Q0VA 2DYSH 3OYIA 3WTWC 1YJ9I 3H35A 2W82A 2PECA 2XPWA 2DEUA 1K6YA 2HYGD 2WV1A 3FK6A 2GIVA 5DM7F 1QHGA 4M72A 4P9FA 2IS2A 4DNTB 3B90A 1IG7A 3OYKA 2LLKA 1TWCJ 3W2WA 4E7IA 1LKXA 3BY6A 5J8CA 4X8IA 2OK7A 1VQPB 2V4DA 1P92A 2NTBA 3GQ7A 2VT2A 2V9PA 2Z2SB 1VQ4B 2A3SA 4E4HA 3W3CA 2HEOA 1OQYA 4E7ZA 3ZQ7A 2L9RA 3PO3J 4ZYHA 3KZZA 3QSYA 4Z6YA 4CCLA 1Y56A 3CXCB 4OIRF 2LY9A 3G1MA 3Q9VA 3CPWB 2P6SA 4XBFA 1NG7A 2PE3A 3RSNA 1TW2A 1SD4A 1VQ8I 2JSCA 3IWZA 1YJWI 5D6FA 3J7YJ 2HOSA 5JHFA 3ZZUA 2ZXJA 4BE0A 2F4OB 5FO0A 2M30A 1SVMA 4U7BA 3HUGB 2KDZA 4KN4X 4Z4TA 1U2WA 4HG2A 3B02A 3HTUA 2JK3A 4ZYGA 1JNYA 1H8EA 1VJSA 1R5OA 1KQ0A 3I0TA 1QVUA 1JA1A 2XGXA 3CJQB 2OJED 2X9DA 2QGGA 2K3PA 1IUYA 2H09A 4C2TA 4G7OF 2EV6A 2RQQA 2DA6A 4GYIA 2OBRA 4P25A 4BBSJ 2K4JA 2M87A 2HCJB 2QQBA 5TY0A 2DFHA 3K69A 1YYVA 2FMLA 4N4OB 4TMXA 4XLFA 3FIWA 3PFYA 3C2BA 1QRCA 3WU0A 3DEUA 3S3OA 4WK8F 3ZQIA 2E1NA 4A5MA 3SDBA 5ED4A 3OE7A 4PC1A 1USSA 3LSMA 1RC9A 4EATA 4EM1A 1H9TA 2E71A 2YS9A 3SKBA 1JJ8C 2QEXB 3SLDA 1X1CA 1T6YA 4P6YA 4BAYA 2VJ5A 2HGCA 1HKSA 5C44J 2HYFA 1RR8C 1MBGA 1CQTA 4XR6A 2O6GE 4IQJA 3GWZA 1R9TJ 2L7KA 2I5UA 3HG9A 5IP6A 3GX4X 1H89C 1LE8B 3E7LA 4RJLA 1MSEC 3DTEA 1KD1D 1R23A 1MMGA 1XS9A 4D5FA 3DU5A 3TDZC 1BW5A 5L3EA 4ABZA 4QPOA 5IYPA 3V8LA 4AYBN 2QYUA 4XLEA 2K9QA 4EVIA 4M3FA 2ELJA 1T98A 4CXFA 2YWHA 3V8KA 1V54H 2GA2A 3T51B 4ZYAA 1EA3A 1A6QA 5DCMA 3DCFA 2DXIA 1FNCA 4UB8C 5HLIA 1ZK8A 1HOMA 3BJAA 5D4SA 2V5IA 1VQKB 3AKZA 2R7OA 2MC4A 4FQGA 3GQAA 4G7XA 2EFOA 4OWRB 1QHHD 4RGSA 2E1MB 4J00A 2JJ1A 4KDPA 1ON2A 2QVOA 2V9VA 5GP9A 1SFOJ 1CQXA 3MVPA 2DCEA 4LG0B 2V1UA 3W6JB 4U0WA 3ZRGA 3ZN0A 1U8RA 3BQYA 1ZM2A 4FE7A 3WHCA 1RETA 2QQ8A 3A8IA 1K9MD 3QOEA 1VQMB 1ZM9A 4NUBA 3HRSA 4OZZA 2HDWA 3MMYB 4M71A 2L3DA 1TYWA 4B4DA 3L9FA 4MXNA 4D0PA 1OMIA 1D5YA 4U88A 3TO9A 3ZPNA 1FEXA 4H9GA 4JBAA 4BJ5C 1WJDA 5K1YA 1ZRFA 3B8YA 2KHMA 1K78A 2J7KA 3I59B 2VPRA 4II2A 3LJYA 3RDIA 3VDXA 4RM3A 5ICFA 1FY7A 2FBKA 4ENMA 1R6RA 1D8KA 2FMYA 3F8MA 2OF7A 2VBZA 2E1MC 1TVCA 1WMRA 1SFEA 1WJ5A 3DP7A 2HQRA 3F6VA 3CCLI 4A3CJ 4X7EA 3CCVI 4X05A 5GTIC 2EA4A 1MMDA 3VSTA 4KKSA 2QQAA 5K7ZA 1RI7A 2NVTJ 2VI6A 1KTWA 5F27A 3CC7I 4XKCA 4JQFA 2YSRA 3OIOA 1JT0A 1CNFA 5HDKA 1PJ5A 2V1DA 4UUSB 4BE1A 1NRKA 1RU4A 1J7KA 2F43A 5B1AH 1Z1DA 4RDUA 3CC4B 5FLVA 2XTWA 2CYYA 5H6QA 3DU6A 2HPIA 3I4NJ 1HQCA 1KU3A 2ZMEB 2VC1A 2O0WA 5C4JJ 4XOTA 2VBKA 3GFIA 3FMSA 1ACIA 3IL2A 3HSRA 1EP1B 4G12A 4OAYA 2GREA 3IKVA 3TOBA 1VF9A 1FNBA 1ON1A 5FRMA 1UD3A 4AD9A 1R71A 2FVGA 1TWGJ 2Z1DA 2W1OA 3S15J 2JMWA 3WU1B 4MYUA 3VSUA 3E5XA 4XONA 1OB2A 5ICCA 3GBGA 4RDKA 2H6CA 2NV4A 4A0XA 2I1LA 1T6SA 3I58A 5CLSA 4ZTJA 4OIOF 4C30A 2XGJA 4ETSA 4FXUA 3COAC 3RKWA 2QCOA 5JVGF 4IZZA 4IRIA 2QX3A 5L46A 3CJRB 2ZKZA 1HSTA 3N90A 4I84A 2Y0SA 3K6GA 2CJJA 3RYPA 3F3XA 2RGVA 3DQVC 4LOCA 1ZG1A 1ETWA 1RNLA 2XT2A 1D0XA 1D1AA 3W2HA 2VZLA 3ZC3A 2BSAA 2RNJA 4IVNA 1QA2A 2H8RA 2DETA 5K7FA 3CJTB 5BPIA 1Y8RB 2ZTNA 4OOVA 4HA8A 4LIUA 2MG4A 4DYCA 1JTXA 5J6XA 1MBKA 2E7WA 1P4AA 2K02A 1W5TA 2GJRA 2IOUG 3RYRA 4D5CA 1B9MA 5FD6A 1W0KA 4KFCA 4B1RA 3RJPA 1A8PA 2XAJA 1MW7A 1O3TA 1EP2B 1EP3B 3OKXA 3IH3A 3B78A 1HDPA 3CCUB 4I0BA 2QMUA 4EM2A 4B43A 3L2WA 1KJZA 3BZKA 4A0YA 5DUKA 1XB4A 1YS7A 1TTYA 2A5WA 1KZLA 1USTA 1PUFA 2GXBA 1GXQA 1PDNC 1X58A 2VYQA 3CCUI 2RC4A 3DU1X 3V7SA 5CVUA 1DU0A 1O8GA 2UXXA 2DT5A 2X0LA 1W36C 2VQHA 1VQ9I 3LNNA 2VE9A 2CRVA 4M6YA 1ZN2A 3ZPLA 1FRNA 1OB5A 4HDVA 1VQ7I 3BG7A 2VXZA 2NYXA 2R7VA 5AIPA 3MKZA 2PEXA 3VYTB 1HLVA 1KC8D 2A6TA 4B3GA 2R7WA 5IYDJ 4UNOA 3ZMZA 1KCDA 1O7LA 4Z4UA 4F3QA 1YE9A 2KT0A 3S17J 3BG5A 3R4KA 4FCYA 3HPHA 4Z4RA 2CUFA 2PQ8A 1ZELA 1E1RA 1L1IA 3WGIA 4X07A 3CD6B 2IQ7A 4A5NA 2XF6A 2Q6LA 2BM5A 5LEJA 3SEJA 1Q82D 1LFPA 4D1QA 1DDGA 2XTXA 4HWVA 1IGNA 4PC2A 3LA2A 2W7NA 1VQ6B 5HDNA 4HF1A 1SAUA 1RKTA 4MTDA 1NG6A 3EUHA 2WAFA 5FKLA 4ENJA 1VQ7B 1OGMX 3KYDB 3VYSB 2JIZA 2BXZA 4MFDA 3CUQB 2B7BA 4ESBA 3WGHA 1E3OC 1DGRM 3UKGA 1VQ6I 1DARA 2VBXA 3KP5A 1VLYA 5TV2A 1LLWA 5JMCB 4Z4YA 2XC7A 4BEHB 3JRDA 1V0FA 4X06A 1YIOA 3LA3A 3OZVA 4KH3A 1RMGA 4HQEA 3P5JA 5B5EC 2BSPA 2PYHA 4Z03A 2LD5A 1KMHA 2RREA 3N6ZA 3JQQA 2Y9YA 4RB1A 1PUEE 1SFXA 3TO7A 4BXFA 2M1BA 5AN9A 3DEWA 2EK5A 2CC2A 1FOKA 2JN9A 1AIPA 3KIOA 5DCMB 1VBLA 1MBJA 2H6BA 3T1BA 1QRYA 2CH0A 3ABTA 4DW6A 5IY5H 2HOTA 2STTA 1MABA 5B1BH 5DUIA 3DPLC 2BX6A 4II3A 3ASTA 3KEQA 4WX9A 3GZNB 1OFEA 1KRHA 3I3LA 2W6IA 3ISXA 2KFDA 2GA1A 3NQOA 3A4CA 2ZL7A 2R7XA 1XQBA 2A5YB 2KRHA 4QVAA 2HKXA 1MH3A 3FMQA 4BXUA 4G6QA 1NK3P 1GAQA 2DYIA 3JRFA 3FK7A 2ADUA 1LJ9A 1Y0UA 5LEKA 1O3RA 1F60A 4W8RA 4R1HA 1FYLA 1R5ID 3OJWA 1IN5A 1ERDA 3PO2J 1U3EM 4PJLA 4V02C 5CVIA 4BJ6C 3A8JA 2QUFA 2E60A 3ABKH 2ZL5A 2AXLA 3B8HA 3HC7A 3ZN1A 2ZMEC 2V31A 4C2MJ 2VASA 3P9CA 2OV7A 3SZGA 3J7ZI 2VFNA 1UD8A 2EFWA 3H3VK 2K7LA 1IXCA 1E62A 3LSGA 2OUMA 1DP7P 1U5TB 5J1RA 2R7UA 1B2RA 2XB5A 1HA8A 2FSWA 1ZG3A 2JVHA 1Y8QB 2R7FA 1LDKB 2DK8A 1OPCA 2VUMJ 1JJ2B 3PSSA 4CHUA 4P1WA 4YEIA 4M9XA 1KGSA 3CC2I 1Y0RA 3V7CA 3DFGA 2W48A 4EV0A 3ES9A 3OZUA 4CQJA 2ZXWH 3IH2A 1QUEA 4TT3A 2IXSA 3RI4A 2H94A 2NOGA 3HJEA 2XGEA 1J0RA 5BNGA 1P4XA 1TUIA 4RA2A 3ZMUA 4OIPF 1FBSA 4EM0B 3CC2B 4M3GA 1AOYA 3HYIA 4UXNA 3U2RA 4KKUA 1SC7A 4Z05A 4RDLA 5CQGA 4LBYA 5LHGA 3T8TA 2D1HA 3BY2A 3U6KA 2L54A 3NE5B 2XPVA 4U7DA 3VO1A 4ACAA 3GUDA 1C0WA 1D8JA 1K4SA 3CMMA 4Q4ZF 1VQ5B 2DOAA 1Z6TA 3G4SB 1OCOH 4AWXB 1P7JA 1RESA 3WGGA 4IHSA 1QCXA 2MW8A 1QUFA 1X1PA 4FE4A 4QHYA 1IXSB 1U5TA 1ZUNB 5JBQA 4MHGA 3JREA 1JE8A 3KPHA 3IV5A 2W25A 3OOUA 4KKTA 1KQ9A 2PMDA 1TTTA 1X1AA 4QLCU 3QPTA 4LFUA 4DQKA 3I4PA 2L4MA 2LRDA 3MQ0A 3ZPPA 1KA8A 3AL0B 4PC3A 4NBSA 3DLAA 4Q5SF 3GMEA 2JPBA 5BOXA 2DA2A 1YS6A 1VQOB 2W84A 5F1JA 3PJRA 1NJID 3RPUA 2EFPA 2NNNA 1IO2A 4Y7NJ 2Z3YA 3P9KA 3OIQA 2JA7J 3L2QA 1ZYRF 1V3FA 2ZZFA 1BPLA 4HSRA 1YO5C 5KK1A 3LSHA 3MKYB 3HRTA 1FYKA 3K4MA 2EPFA 4AIKA 4IHYA 2O1DA 3G6EB 2LF7A 1P4WA 1QRBA 1M90D 4P96A 5LHIA 1X19A 2OZ6A 4L9JA 2GM4A 2BVNA 2A69F 4HE5A 1PJ6A 1E3PA 2NVUB 5KNLA 4G5GA 2F5FA 3D26A 1RUOA 4OOXA 2X1EA 3U21A 1O8IA 2JTVA 3TO6A 1EH8A 4BQNA 4EGYA 2O6WA 1UG0A 2EZLA 1JKQC 3PSZA 2A61A 3TW7A 1R5HA 2ZBUA 5E8GA 2QBYA 3S1NJ 2EQRA 2ZCWA 4KMFA 2E35A 2VOOA 2LKXA 2CFXA 1G2HA 2A07F 1DP3A 3H5NA 3RPUD 1ZARA 3OYAA 2OPTA 3WHBA 4DYQA 1B72B 5B3SH 3PQKA 4OJLA 1POGA 1W7PD 3TMOA 3EQLF 2KJBA 2V7XA 4RGRA 2JA6J 3ZMDA 5ILVA 3BZCA 3F8FA 1SKQA 2P3MA 3AG1H 5L3DA 1FPQA 1YJWB 4UB6C 1FOXA 2HQAA 2MABA 2L4AA 1FNNA 2WBMA 3MCZA 1FX0A 4EJUA 4LB5A 2ZBKA 4ZV4A 3WTSC 4B3FX 3C7JA 3CF2A 1OGIA 1UD5A 4WF2A 1H80A 1O8MA 1BQEA 2VFQA 5FO1A 4ITVA 2IT0A 2DFFA 2QF7A 5GPCA 1AKHB 3E6BA 4HQMA 3I53A 2GZWA 2V7UA 1V5VA 4YZXA 2GLOA 1BI1A 2DBBA 3QPLA 4HLYA 1LDJA 4KYWA 3J7AO 1MRZA 3EPZA 3OYDA 2YWEA 3WTXC 2HZTA 2L02A 3K0LA 1MKMA 3QFSA 1JXSA 1FMWA 1YW7A 1WVRA 4YG2F 3OYGA 4Y13A 2XNJA 3JAMK 3QQAA 1XCBA 3DKWA 1EE6A 4BPRA 3C18A 1MSFC 2HXOA 3G2BA 2DA4A 1BOAA 4UV8A 2J5PA 5M3FJ 4FX0A 2LP0A 3GZ5A 4EJOA 3P4GA 2HYJA 1AA7A 3L00A 2CBXA 1HW1A 3KL9A 3R6KA 2VKHA 2HQ5A 1M1EB 3GFMA 4JK1X 2O8KA 1W0UA 4A3GJ 3BTLA 3K70C 1VQ9B 3PNTA 5AONA 5GAHJ 3F72A 5TJJA 1ZGJA 3SEQA 1RQRA 2OC6A 5HS8A 1IDYA 1SFKA 3BR5A 3Q9SA 1IRZA 1BI0A 3IHUA 1GHCA 3W6KB 1K6OA 1RQPA 4Y15A 3W5HA 1DUXC 5E79C 2HNHA 3BCAA 2XEXA 2KRFA 2V1XA 1QA3A 3BLYA 1FWZA 2XB0X 2M8GX 2BW3B 3MWMA 1BHEA 3FMRA 5ICEA 3W2EA 3S2WA 1YLOA 2XGDA 5HOOA 5D8KB 2R93J 3WU2C 2K4BA 2K27A 1QZYA 2UZKA 2Z5UA 1E17A 4B48A 1D1CA 2L0KA 2Q8KA 5TR9A 4A3FJ 3CD6I 1LM1A 1BN8A 4DOZA 2FX0A 4Y33A 3S14J 1TW3A 3P27A 4EMSA 5EG0A 5F4JA 2JZYA 3CO6C 2DOGA 1DGWY 1S0UA 4XRMA 1HCRA 3HOWJ 1I1GA 1P6RA 1G7TA 3I9V2 1W9XA 5DN6A 1J59A 3J81k 1R00A 4L9VA 2KDOA 2VJIA 3M9AA 4KT6A 2E7XA 5DD8A 4F7ZA 2OYNA 3ZZ0A 3OEEA 2QENA 4ESFA 3GTJJ 2GJPA 4IHXA 2QA4B 2DA7A 3LYCA 4X7CA 1DPRA 1YI2I 2IPQX 4U0VA 2VFMA 1HDDC 4OINF 3PENA 3H5AA 1COWA 1S7OA 2KL4A 4RLZA 1JUMA 4HW0A 1FP2A 1T33A 4RM2A 2BE5F 1JTAA 2ISZA 3K2ZA 3UW0A 4QUZA 5FGMA 3EYIA 1VQMI 5FKKA 1UD6A 5EG0B 1R49A 4AUXA 1M1KD 4YCQA 1J9IA 9ANTA 2KVOA 2G0YA 1QGPA 5IP7J 3F8NA 2VJJA 3M1CA 4UHTA 1CLWA 3GLXA 3QODA 4ZTFA 4IEJA 4YFXF 2BMWA 2WA0A 4XIDA 1OB0A 3FDYA 2GK7A 4ZC3A 3VOEA 4B44A 1JKRC 2JPCA 5TGTA 2L9SA 4OMZA 4M3BA 1TNSA 1V4RA 4HX7A 1R1UA 5L3BA 2ZMEA 1A6IA 3I55I 3LSJA 2ACJA 2HPMA 3ASQA 2HQNA 2KQRA 4ZDLA 2P6TA 5DEQA 3ZZTA 1YX5A 1N08A 4CUGA 1WJBA 3JRCA 5F64A 3OW7A 4V2FA 1LVAA 1S8NA 4Y3OA 2OTLI 4UUVA 2GOMA 1E64A 2QLZA 3GCMA 2R6HA 2KIUA 4BE2A 3RKYA 3PUMA 1Z7LA 4HEA2 3GVKA 1Z05A 2F6CA 2CS3A 3M7GA 4DIQA 1WKMA 5HZAA 5EZHA 1N0VC 2VBEA 1XGMA 1YW9A 2JJ7A 4FETA 4NC8A 4UUSA 4FX4A 2EZHA 2X1DA 4BY7J 1SKYB 3VB2A 2I8DA 2JRTA 4YAOA 3A0HC 5HDGA 2QY1A 3PSIA 2C6YA 2BPOA 2XKOA 4B09A 2I10A 3S8PA 3CPXA 4XN3A 2QQ9A 2ZXIA 1HC8A 2EWNA 2BZTA 2DI3A 3BR1A 2OBPA 5C3EJ 3B6AA 3I59A 4EJVA 3LNQA 3VNUA 2VBVA 4P3YA 5F6FA 3OFNA 4MFEA 3RKXA 2FD5A 4CH7A 5M5WJ 3M8FA 1DDNA 2G7HA 3CMEB 4EGZA 3OYMA 1IN7A 1BIAA 1BJAA 4J0QA 1I18A 1TWAJ 4I76A 3Q6RA 2ZSHB 1X0CA 3RY8A 1WQ2A 4XN0A 5AMVA 2ZNYA 2HDDA 1F20A 2XDVA 3BTCA 1FMVA 3F23A 1AMOA 4OPWA 2P4WA 4YZAA 3IAS2 5J3LA 4XKVA 3TBIA 4RB3C 2X8KA 2WZPP 3SUCA 2J5OA 1EFCA 3AK5A 4X7FA 1NK2P 1BX1A 2WAQA 1F5TA 1O88A 5FLMJ 2FNPA 4RPBA 4C2UA 2A6EF 4XD7A 3K2AA 5IYBJ 1W1WE 4E7KA 1DG1G 1TT5B 3JR9A 1WDTA 2XAGA 2QGUA 3Q5FA 3HAGA 3AVXA 4DZPA 4IHWA 2COMA 2EFQA 3CMEI 2OQRA 3DDYA 4RM0A 4QIWN 4C43A 3DXJF 4I7HA 4ANJA 3HRMA 2LMDA 3IH4A 4N4NB 2QE7A 2BM7A 1D1NA 3HEFA 2FBIA 1EXMA 3TDUC 4Y17A 4Z4WA 1N78A 1YOVB 2VXDA 2BF4A 1GJRA 5FL7A 4KIBA 2W7ZA 3QE2A 2YUSA 2LKSA 3ROUA 2DN0A 3TP0A 4YALA 3L1PA 5B66C 1BX0A 4BU2A 1IHMA 4I6ZA 2A05A 1YITB 2NT6A 1ZQ3P 3CCYA 3L2UA 1G6NA 2PMHA 4C9YA 4EQQA 2WJYA 2F1LA 3W2GA 2Z16A 2JVGA 4WXHA 3EYYA 2P7CB 1BMFA 2EWEA 4WXCA 4QPQA 4JX4A 2NSPA 2V79A 1IJWC 2VL8A 1TBXA 3KYCB 5D6EA 2L01A 1N8RD 3FM3A 2V7QA 1HBXG 2OD5A 2M9HA 3VEPA 5J1YA 1PKVA 4F92B 1VQNI 4RD6A 4TV7A 2WSSA 5FA6A 5HS7A 3OZWA 3RIRA 2CUZA 2WJVA 1E1QA 1VQ4I 1X4OA 2ZXHA 2C5HA 1B23P 1HZEA 1ODDA 2R3SA 3ZQHA 4AIHA 2OBSA 2TCTA 3U1DA 3PIOF 1UFMA 3QP6A 1KQ5A 2Z6BD 5A88A 5DTDA 5JVTA 2FRHA 2LSOA 2OQGA 2WC2A 4E7SA 4PJNA 4C3HJ 4OPVA 4IHVA 2DOFA 2EB7A 3HUGA 2E5NA 3RZDJ 3GTMJ 3D5SC 3AVTA 4QV2A 1QA1A 2O04A 2DPDA 3A1YA 1OCCH 3CCEI 1YRNB 3FXJA 3QFTA 3HGGA 2VB6A 2CV0A 2OCCH 2F3LA 3H9QA 1AIRA 1SM4A 2BY3A 2Y9ZA 4KIGA 3TL4X 2ZITA 2EV0A 4WWVA 2NS0A 5D5VB 3CCEB 4HRIA 2VFPA 4J19A 4V2GA 2RV8A 3FXKA 3CO7C 1XGOA 1KK1A 1A36A 1YRNA 1QFZA 4BKXA 1QGAA 4PJ0C 2DPUA 1D2EA 1GDTA 2A6HF 4G8XA 3OYEA 3H36A 2DQLA 1T38A 1BLIA 3BY1A 2V6EA 2C4TA 5CJ9A 3LSPA 2ZBVA 5KCMA 1J9ZA 1XSVA 3GVJA 3JAMZ 3GZ6A 2Y75A 3OS0A 2B7EA 2PN6A 2LK2A 4D7NA 3IKTA 4LLNA 2LOOA 2Q6KA 4HF0A 1WPCA 1NB9A 1KONA 3DTIA 4PJJA 2E2HJ 3KEOA 1Z77A 2CFOA 5GAEJ 4CCKA 2V7WA 4Q7JB 3AVWA 3SDGA 4E70A 5FLXZ 1T2KA 2DO7A 1JKOC 2J8KA 2O0VA 2BN4A 1DQUA 4UV9A 2CW0F 4NHJA 3GF2A 3TQNA 2F1MA 4M9SA 2Y0MA 3BC8A 4KICA 2CK3A 1IRFA 3C2HA 1GQ8A 3ECOA 3RQIA 2XTYA 3FXRA 1WSRA 1XGSA 3M07A 2XAHA 3K4NA 3LAPA 2JA5J 4GDFA 3OAAA 5IYCJ 3G05A 2DA1A 4NBQA 2YX7A 2Y31A 2F4NA 3SJPA 1STZA 5IK2A 2P5KA 2V1NA 3KP7A 1XSDA 1TQPA 3T9GA 2CQXA 4P9UA 3DKYA 1JT6A 1QNTA 2IGMA 2Y2ZA 4KIFA 3DLLF 1ZGWA 5FFZA 5D8LB 1HA3A 2HMAA 3SJZA 3ZSCA 3L2RA 5FLXK 1WXRA 2AQEA 3VFZA 1W0TA 2XC1A 2EZKA 2JT1A 2KP6A 2ZJQF 3KP6A 3J7AY 2BW3A 4BS9A 3TEDA 5IOYA 4ZYEA 2R5YB 2JQ7A 3E20A 3PETA 5FB2A 2EH3A 4OJOA 2CUEA 3V7RA 1OLTA 2ZZGA 2W00A 2PFBA 2PBIA 4R79A 4AVZA 3ZUGA 2IGNA 2MD5A 3HHHA 1U5TC 2ZFUA 1G3YA 1K8AD 2MLGA 3TGNA 2CG4A 4BNCA 4HOBA 3HOSA 4UVCA 2QXZA 1LDDA 4Z4SA 4DK0A 3CCMB 4MTEA 3ZXSA 3E6CC 4X0CA 1T56A 1ZKGA 1D8TA 3WBJA 3G3ZA 3ABLH 1O7FA 2CNDA 1BR4A 4CCNA 1CNEA 5E3NA 3L2VA 3PNVA 4XLAA 4M3DA 3G1LA 2FX3A 1WJFA 5LMZA 2QKLB 1MNMC 5JLWA 5D5XB 5IT9K 4OPSA 3HSFA 1N75A 2XNDA 3DPUA 4UAJA 2YWGA 3DTKA 1P9QC 2V6CA 1WGXA 2RN7A 2HTJA 1W7PA 1WSVA 1VQOI 3WTUC 4WXDA 5GAGJ 2DDBA 2LY1A 2VE8A 2JSPA 3OYHA 2E1BA 1ZREA 4DNRB 4PC6A 5F4OA 1ZG5A 5CVRA 2XVCA 4RPDA 3FF5A 4QVJA 2M34A 4YIFA 3CCJB 5E17F 4PC7A 3N05A 2CU7A 3S1MJ 3E1SA 1JB9A 3GVLA 5H2FC 4HV6A 5K7HA 3GTLJ 1F43A 4OP7A 1BIBA 4F91B 3OSFA 5L3CA 1I8DA 1KK0A 3CCJI 4FISA 1TL8A 1W34A 2W85A 3CCLB 4I09A 2E34A 2HVQA 1KK2A 3B73A 3CCVB 2M0MA 4EJTA 2NVQJ 1ETYA 1QGZA 1IN4A 3ONQA 4R8HA 4A3BJ 3W5UA 1XX5A 4RGXA 3BJ6A 1XN7A 1XMAA 2WB1A 4HPQA 3CC7B 5F0FA 4BY1J 2R5YA 2NVYJ 4A3DJ 2YPRA 3E0JB 3HKZN 1O8DA 3R60A 3R0JA 2ME0A 3L09A 3AG3H 2LYCA 1IJEA 3CC4I 1K4TA 2JN6A 3RCOA 5CVJA 2DIEA 3DPTA 2STWA 1VFCA 1SFUA 2JDIA 3FY3A 2DLLA 4MQVA 1MIJA 4BHBA 5E3OA 1ETQA 3CQZJ 2XASA 4RAZA 5F04A 3TW6A 1JUPA 4HLXA 1U8BA 3ZCOA 1JA0A 2JJ2A 1K83J 3H9NA 1R22A 1MMNA 4YFKF 2P7VB 1H8HA 4XK4A 3JRIA 3JRAA 4OMYA 2Y48A 3K4CA 2C78A 3PUFA 2PIAA 4ZYDA 1L0OC 4M9ZA 2JA8J 1OFLA 3OOPA 3IP4B 2NZMA 2F48A 2Q1ZB 4E7JA 2QZAA 4O5VA 1WOSA 1WORA 4PFOA 3I4MJ 3OS2A 2ZJRF 1EFRA 1HG8A 2LR8A 3SZPA 2VKEA 5EYRA 2LREA 1J75A 1U78A 4P9SA 4DBQA 3SLNA 1PP8F 3ONUA 1K4ZA 1LFUP 1P2FA 4A3MJ 2RNGA 1YQAA 2DK5A 2VC0A 3LWFA 1LFBA 1G8XA 3I5UA 3OR2C 2YU9J 3G71I 3LSTA 5FO5A 1QQIA 5F0CA 2FQ3A 4HBLA 2ZFWA 2ZNZA 3MFKA 3EUHC 2O0YA 3I56I 3HOVJ 1E43A 5L3GA 3BG9A 4IHTA 4ACBA 4W97A 2L9NA 2X1CA 2UWMA 2XF7A 2M5WA 1NHAA 1E63A 2OU2A 2IRFG 1MJAA 3V8JA 1WU8A 4JMQA 1AHDP 1DBOA 5HODA 2XSDC 2HVSA 5KAFC 2XRLA 4OOSA 1QPMA 2MH9A 3EQNA 1FOWA 4P26A 2E5ZA 1ELOA 4JRAC 2CV2A 1JGSA 1MBHA 3SZTA 1AWCA 5HKKA 3DBLB 1P7IA 2EBIA 3D5LA 1UELB 1HW5A 1WFXA 5LRRA 2D9RA 1IN6A 3ESWB 4TSFA 3SYJA 3FXLA 1OYIA 2P8TA 2VJ4A 4RAYA 1BM9A 2QM3A 1N77A 1FP1D 5F1RA 4Y9RA 5KW9A 2ETHA 3OYJA 1V5GA 4XSXF 1S3JA 1WZ2A 1Q1VA 2D45A 1BN5A 2GIZA 2M5SA 3I56B 4CYCB 3F8BA 3FXQA 1DDIA 2CQNA 1XD7A 3NAUA 3WNBA 1OCTC 4BDZA 1OGOX 4XQFA 1T6ZA 1MDMA 5A89A 1YIJI 1FSHA 5GPAA 4KUMA 2GOXB 4FWTA 1HVXA 3K9TA 4RD0A 2GWRA 2LVSA 4LBVA 4G6IA 2QA4I 4Y52J 2AQFA 1R4MB 2L7MP 2E19A 3FKJA 4WZKA 1ZTRA 2VIXA 4NQWA 3WNDA 2DTZA 3Q38A 4NNJA 1BL0A 2KPMA 2ZJ2A 3HKZA 4CCMA 3BPXA 4DNCA 4IO9F 2R92J 3A03A 2R5ZB 2DMNA 3ZQGA 3QAHA 4BJTA 1B1BA 2GK6A 4U9UA 1S72B 4YZQA 3CZ6A 1BR2A 1FIAA 3FISA 3F6OA 5BSYA 4LG0A 2ZO4A 1ZGAA 3QYFA 3ZR8X 4RD3A 2VT3A 5B6IA 1R7JA 4O6JA 4RBOA 3AVUA 3OR1C 1FSEA 4A3EJ 4TMTA 3C3WA 1Q7YD 2G0EA 5J35A 4V19K 2M8EA 4P1VA 2GQQA 2Q0OA 3HZJA 4J01A 3ZGKA 2NNYA 2EIJH 3Q6QA 4CZZA 3S1RJ 4URRA 1R5NA 5HVQC 3J81Z 1RUNA 4XOPA 1W35A 2LDUA 5EZGA 1H9GA 1MD0A 3ZMSA 5HLGA 4ZGQB 3HOXJ 1GV2A 1XMKA 1QPIA 3PSFA 3HIFA 3A3BA 3JRHA 5ILSA 1BR1A 3HGYA 3QYBA 3S2HJ 2QBYB 1LE8A 4L0YB 3BZ6A 5EMNA 3ZBTA 1W4MA 2XIGA 1V55H 3OEHA 3ZMTA 2R5ZA 3BPVA 4PZJA 4I98B 3RPQA 1UD2A 3S3NA 4C0SA 2LH9A 4P6VF 2Q6IA 2YU3A 5M5YJ 3VNVA 5HS9A 1R1TA 1OISA 2FU4A 1HXDA 2WYRA 2BM4A 3LFKA 1JJ6C 2ZSIB 3WQZA 1MNDA 5M5XJ 2HFHA 4X1EA 2MSYA 4TMVA 1XC5A 4M6XA 4DYRA 1T6XA 1JTYA 4ENKA 1T95A 2CQKA 2M7AA 3RZOJ 2RC5A 3A35A 4XNFA 4HX8A 4QFMA 3VMFA 2PJPA 5JHUA 2BGIA 2E2IJ 3N4MA 3K70D 1I27A 2FJ1A 5GTHC 2XKPA 3GW2A 3O3KA 2A68F 3Q3AA 4RDJA 1QZEA 1J5YA 3LOCA 3SFIA 3U2QA 2HDCA 3WWGA 3BQJA 3T53B 3W2FA 3KCCA 4HSTA 4HAMA 2BY2A 2LZJA 4EW9A 4XRFA 1JHFA 3L2CA 1XGNA 5J4VA 3VMVA 1WCMJ 3X2QH 1IDZA 3HTSB 2F5VA 2F5CA 2PMZN 2Q2EA 3LSKA 4G9YA 3S32A 5BMZA 2GPJA 3SFZA 1CF7A 1U0JA 4MR0A 4S0HB 1IF1A 5BPDA 1FTTA 1OOCA 4AM3A 3ML6A 4CYCA 2BEOA 1MNEA 2PI0A 3BG3A 1TLHB 4P5OA 3F8CA 2DMUA 4PCQA 2XNCA 4F55A 2R7TA 1F9NA 2JWTA 3HDDA 4ZGNB 1I39A 2ECBA 4CICA 4HX4A 4XRSG 1FX7A 1I3AA 1ZRCA 2ODLA 3BWGA 2FQ4A 4WZEA 5J40A 3GIRA 3H0DA 4IW3B 4UVAA 4JX6A 1Z91A 2XV4S 5KHDA 4Y7CA 4E7LA 2BHYA 1D3YA 5ICGA 4LMYA 5EEGA 2CW5A 1YW8A 5EEHA 4RD2A 3WYAA 1LNWA 2NOJB 1I1SA 2QN6A 3R6JA 3Q39A 4YAFA 1K73D 2G9WA 2NS8A 2VPLA 2BVMA 4KA4A 4PAAA 1H0MA 3GFJA 3ZBUA 2LF8A 1I7PA 2UVEA 4WCGA 3CCQI 3KZYA 1GV5A 3QOPA 3GLLA 4KNYA 2QTLA 4ZJZA 4BH9A 4BDYA 4B3XA 1TYVA 3VR6A 2P81A 1GXPA 1ZR2A 1UHWA 3VYRB 1BC7C 4W8TA 5KVRA 1YTYA 2HDNB 2DTRA 1O3QA 4AC0A 1XSXA 3B4NA 1KZHA 1GT0C 2VFOA 5EEAA 3F0CA 4P22A 2VOPA 3OWTA 2EIKH 2VKVA 4IX7A 2PMZA 5GV7A 2Y30A 3GTKJ 3HSEA 2XUBA 3VODA 2PJRA 1AU7A 3I1FA 2HR3A 2YWFA 3K4BA 3OMYA 1Z6RA 5DYMA 2O7OA 4I02A 1OYWA 1F4KA 4H0EA 4ZCLA 5E3LA 3BJOA 3CMAI 1S4MA 2FXAA 2JUCA 4XLHA 4M1KA 2YR2A 3W2IA 2EA2A 4MQ9F 1RPWA 2COBA 2XZOA 4RLQA 3KRGA 4PJMA 2IW5A 5K5QA 1XTAA 4UUTA 1DU6A 1Y0YA 5IP9J 3K10A 4X7DA 3MKWB 4X6AJ 1G4DA 1SD6A 3TOAA 1ORKA 1X1BA 1IRXA 3ZQFA 2DFIA 3HBLA 1MMSA 2E36A 3B82A 2Z9OA 4DJAA 1TZLA 4MO7A 3HXLA 5J8FA 4GGGA 2KJCA 3BDDA 3K4JA 1FLIA 3WODF 2F5EA 3QRFF 1XMXA 2IP2A 3KX2A 2MA3A 5DDGA 2M3AA 2UVFA 2DA3A 1YX3A 2IAIA 1S6LA 1U9OA 1R4NB 2CQ7A 5BQTA 1IB4A 3WTVC 1REPC 2B0LA 3WE2A 5HLHA 1B8IB 1X2NA 2KRCA 4BEHA 5C1CA 2D2WA 2IA0A 4R71A 1RKWA 1TYUA 4AVPA 3HB9A 3OS1A 2X6XA 4H4KC 4CCOA 3BP8A 4XLPF 2X53S 2DERA 1TLLA 3WY9A 1IC8A 2O9LA 3LFUA 3I54A 4GXOA 2K85A 4ON0A 3SYTA 1K61A 3LL7A 1O8HA 5CYVA 3CLOA 2GAUA 1N25A 1ETKA 1MJBA 1E79A 4G6DA 2QSGX 1E0EA 3MN2A 1CZFA 3ZIAA 2DT6A 1EF4A 1ZHFA 2KZGA 2BHZA 3LVBA 1AKHA 3OL3A 2FF4A 4AIDA 2OK8A 3HL2A 2C4UA 3LQEA 1EZGA 1TNTA 2ESHA 4RAGA 1A5JA 4KN7X 1EA0A 4PSWA 1R5GA 2FOKA 3PL8A 1UAAA 4UZUA 3BCBA 4OU0A 3NARA 2DJNA 1YG2A 3IWFA 1IDKA 1ITYA 1B8IA 1B72A 1ZM4A 3KP2A 3E1YE 2TDXA 1X3WB 1PXZA 3K7AJ 1SVOA 4RAFA 3OYLA 2X6OA 3MD2A 4L5EA 1IZ1A 3T0YA 2CF4A 3S1QJ 2B5OA 2R7QA 2WTEA 3FKSA 1VQKI 4G7WA 2FBHA 3G73A 2MFZA 4YRVA 4LBWA 1Z3YA 4Y4RA 2R7RA 2ELKA 3EETA 3JRGA 3HOZJ 4FTHA 2EIXA 2KIFA 2QSHX 4AC9A 4AF6A 3RQ4A 1D1BA 2NT9A 1KU2A 3UNGC 4L9TA 1YJNI 1ULYA 3P7NA 4OOIA 1RR7A 2C77A 4KJZA 1P4MA 2VBSA 3F9KA 4NK6A 3I71A 1YLFA 1XDUA 1MH4A 5EGOA 3QU6A 4BGDA 2RVCA 1WHUA 1G3WA 2KIMA 1O8LA 1IV8A 1WJEA 3K4LA 1WJAA 2JRMA 3BR2A 4UVBA 4FASD 4XM3A 1E3ZA 2VBMA 1MZBA 1Q9SA 5KSWB 3H92A 1O8JA 3CDLA 3U6BA 4U49A 3GO5A 4WZLA 3FZVA 1N07A 4DZJA 3PIPF 2VNKA 3P26A 2ID6A 1KU9A 3BCDA 3CDHA 4A6DA 4IOAF 2P5VA 4LITA 3VSKA 3QFRA 1V0EA 2IGKA 2DMPA 3E5QA 5F0HA 1EFUA 3GQ8A 1XG1A 1LVKA 3K1MA 3DBHB 1JRGA 2QYOA 1O8EA 2O3FA 3CCRI 1W5CC 4XMYA 2VBTA 1WOPA 2WAQN 4G7HF 1J09A 2DDAA 4XLCA 3LQQA 3CCMI 4A3KJ 3QU3A 5D5WB 4L9NA 1IB0A 1QQ1A 4LK0F 4X0GA 3JQRA 4LC0A 2OTLB 2QDXA 2INUA 2UUZA 4G94A 4M0LA 1SEUA 1VF7A 1X1DA 1YI2B 3T8RA 3PA2A 5FIUA 1B6AA 2LKPA 3RKQA 2OBTA 2BM6A 5IYQA 3BNWA 4BACA 3H94A 2EV5A 2BBYA 1GVDA 1X2MA 3K4KA 3OIPA 1Q1HA 4PGGA 2ZZQA 2QSFX 1T08B 1WTHD 2XT4A 5E1ZB 4S05A 2IS1A 2DMQA 2R7ZJ 4I99C 4DK1A 3FXOA 3I64A 1GAWA 2PX9A 3QYEA 4ZDPA 4ZZDA 5M3MJ 4M53A 4B47A 3BTJA 1HKQA 1VZ0A 3V4GA 5JFRA 1T0FA 1MBFA 5LBQA 1TWHJ 1UMKA 2EFGA 3MMPA 1DBGA 4JYKA 5THXA 4OJ5A 4OM9A 3FBIB 3J80Z 1OGJA 1K28D 2MGQA 4DQLA 2CUJA 1NH3A 2B7CA 5IYWA 1QA6A 2M4KA 4HE6A 2CGPA 3LMMA 3S3MA 2CRGA 3BQZA 1CF7B 3UR3C 2LFBA 2Q2EB 1WRJA 3BR6A 4OZYA 1DABA 3SXYA 3KLOA 2F5DA 4PK4A 1MBEA 3PA1A 4XRSA 3FM5A 2RDPA 1TWFJ 3KE2A 5J4YA 2HS5A 2F4IA 3HHGA 4LBZA 2QWWA 4YZ0A 4E7HA 2O8XA 3OY9A 4BQAA 2K9LA 3GVAA 4C2LA 4BBRJ 4QSHA 3FX3A 1I50J 2D3NA 3A01A 1ETOA 5DSZA 4D7MA 3D1NI 1HSJA 3AVVA 5J3OA 2ZL6A 3L7WA 2LY2A 1K8FA 1I5ZA 2RKHA 4N0BA 1YFHA 3LA7A 4LB6B 2QZ8A 3CTAA 4CSWA 3EUKL 2X6WA 2IVMA 2JUGA 1IV6A 5FRNA 4PSXA 4AIJA 3QFCA 2CMPA 2DJIA 1HKTA 2E1CA 3CLQA 5E18F 4IF4A 4KISA 1VLOA 5E1XA 3TH0A 2J8IA 5IPAA 3VMWA 1XB2A 4A12A 3MZHA 5EGOB 3ELKA 4M4SA 3HRUA 2VNHA 2BV6A 2V4JC 2KISA 4PGHA 1YITI 4PDKA 1BC8C 5HLTA 3CP8A 1QJVA 3PFIA 4W8QA 4LK1F 4YHBA 3A0BC 3P9IA 1IN8A 4CA0A 5F08A 3CB4A 2PLYA 2XZPA 4GQNA 3GQ9A 2XAUA 3LQRA 4MEYF 5CQEA 1ZH5A 5K5OA 3WTTC 5J1UA 4Z4ZA 1Y0NA 2WAEA 5D5UB 2OZUA 4BYYA 2CW8A 3HOTA 1OHHA 2IBDA 2HLDA 5DCFA 2V7VA 2VBWA 2IA1A 4YIIA 2IJLA 3H09A 4RS8A 1Y1VJ 5LGTA 3CUQC 4F52A 2XAQA 1MJ9A 1OCPA 2O61A 5D4RA 4QTRA 1NBMA 1UG2A 2L7FP 3C2GA 2D1VA 2MC3A 2X3HA 3WTZA 5E8IA 3JSPA 1PLUA 2KKOA 1BI3A 2AS5F 1LPQA 1XG2A 4YDTA 3BT9A 4YAWA 2OTJB 5LGNA 3D0SA 2H1KA 1G7CA 2DMTA 1ZM3A 2PYGA 2DODA 1IXRC 3E6MA 1VNDA 1WSUA 2NTQA 5IT3A 3ZQCA 3Q0UA 4C3IJ 2UXNA 3ULQB 4UY8I 1GLNA 2IA2A 2TRTA 1ZR4A 4XL9A 3GTQJ 4MGRA 1UHMA 4RB2C 2OTJI 2VNIA 3OYBA 1FBUA 1FRQA 4ZZLA 1BA5A 1FNDA 2VNJA 2YUHA 4LG3A 2DAOA 3B6CA 1MDMB 2IS4A 2AHOA 1QVGB 2DY1A 1FZPB 1GVJA 2VQLA 1YJ9B 3VSLA 5LGUA 4DGWB 3CJNA 4XSZF 3V76A 3JTHA 2BYVE 1J2XA 3DKXA 1S5LC 2VLAA 2K9SA 2OAZA 2VBUA 4O3MA 1OCRH 2ZJPF 4P3IA 1UB9A 1SD7A 1OFMA 4EEFG 2IS6A 1VQPI 4Q48A 2W57A 4ASUA 3OOCA 2DA5A 2FE3A 4HV5A 4FHTA 5ILUA 1O4XA 2OA4A 3O2PE 3KZIC 1SAXA 1GR1A 3EQOA 4IXAA 3IAM2 3PQJA 3VSVA 1OCZH 4PFPA 4L5IA 2MBFA 4D9JA 4MEXF 2CWEA 1W2BB 2XSJC 1ZRDA 2EJRA 3J80K 5GV8A 5H20A 1PUFB 2H1LA 3JU4A 1U9NA 3GSIA 3ABMH 4RGUA 3R0AA 1I6HJ 3IRQA 4IOCF 2ME6A 4RLFA 2DQRA 4XORA 2F4MB 1OYYA 1UD4A 5CVVA 2NSTA 4MLOA 3W6VA 3MCAA 4Y9UA 4G1BA 4CO8A 4CCJA 2BVLA 1LEAA 1ETVA 2X6YA 2HZDA 2B0RA 3FBNB 3BTIA 2MH2A 4GFBA 1QZZA 1JGGA 2O17A 2HTSA 4F93B 2L9VA 4ESJA 1OR7C 5LRSA 1S7EA 2QEXI 5J47A 1UHSA 2RAEA 4RB0A 2L5QA 2X85A 1OFCX 2Q6OA 2E1OA 4PGOA 4I01A 2LNBA 4OAZA 3BG6A 1QVFB 3CF5F 4FT8A 2Z8GA 1CGPA 3ERMA 4QWQA 4ZCMA 5TRDA 3BROA 3A02A 4L0ZB 2DFEA 2HXIA 1N05A 2M2EA 4DBRA 4Q47A 3GTPJ 1ENHA 3D5RC 3GEZA 3QWLA 3BC9A 1Y6IA 4TMZA 3WXMA 4WWCA 3QPSA 4YC5A 2ZB9A 2FEZA 2V7FA 5LFAA 3W2AA 5A2QZ 2X3UA 4OJ6A 3ZQQA 2BY0A 4DQ2A 1T5EA 1Q81D 3GTOJ 2EFNA 4M74A 5DNSA 5JI6A 1TQMA 1GO2A 4MNUA 5FFXA 3SHFA 3QP5A 4A3LJ 4YELA 2CSOA 2GXAA 3M4OJ 3KETA 3MAJA 3H5RA 1B59A 1O57A 3EDPA 2ISYA 1I3QJ 2LTPA 2N8GA 2X51A 4LIVA 3ZQLA 5DS0A 5BSXA 4YFNF 5K5RA 1QGYA 2WADA 2K86A 3GYHX 1JUSA 5HZBA 3TKYA 2L7ZA 3CDIA 3T5XA 1IUFA 3K1NA 3WE3A 3JRBA 3SJMA 1ZAOA 2C5BA 1IA5A 3JTGA 1Y1WJ 1H42A 5CPRB 2NPFA 4MYTA 4YIRX 5HNHA 1XFOA 1FNMA 3AGQA 3DWLE 1G3SA 5DM6F 2UV1A 1APLC 3NB2A 3ONYA 1KTVA 4IQ4A 4N3NA 5C4XJ 2WPDA 2O03A 2BM0A 5AIQA 1G7SA 3W2VA 4AF7A 4N3GA 3FHZA 1V5FA 1NB0A 2HI3A 3DEEA 3KP3A 1SANA 2B9SA 4HNUA 2XRNA 1IAWA 4GYGA 2E1RA 2X0KA 3H3ZA 2HOAA 1BW6A 4S04A 2HVRA 4B8XA 4G7ZF 3VWBA 3RIQA 2ECCA 1UJ8A 2WV0A 2PG4A 3CMYA 3OPOA 5GADJ 5F4MA 2VQCA 1KK3A 1W36D 3OW2B 2NS7A 1E3XA 3H3UA 1Q86D 1W0JA 2EINH 2WY7Q 1W7PB 2DW4A 3KFWX 4WZTA 3E97A 1EH6A 2AO9A 3JURA 1D0YA 3O6BB 3ISPA 4UZFA 1V5EA 1U2RA 4PABA 3IC7A 4ZCIA 2HOEA 3G4SI 1B9NA 4OIQF 4BHCA 4XKBA 2AHQA 5E1WA 3Q3SA 5FROA 3MHPA 3OJXA 3NEUA 2BOLA 3FPKA 1K5CA 2V7TA 2BM1A 4A93J 3E3VA 5LLQA 2BGCA 2ELHA 1FBQA 5JLXA 4BQOA 2O5RA 3M8JA 1TC3C 5FJ8J 4CGZA 3LSIA 2EIMH 3ERED 1UMQA 2CO5A 3Q0WA 2C2WA 3CMAB 3G6EI 3V42A 1QH0A 1O8FA 1E3HA 3FXMA 2EILH 3BH6B 1OJLA 1G3TA 2LBFA 5H6RA 2CQQA 4RCYA 2CV1A 1WI3A 2MD0A 2Y69H 2FNAA 4M73A 1IJFA 4CDGA 4NK8A 1KYWA 4Z1MA 1BOBA 2P5LC 3S93A 1W5SA 1B4AA 2FA5A 1NTCA 3ZP5A 2VKDA 1QVTA 5JR3A 1PYVA 4LLGF 5E3MA 2D3LA 2W6JA 2KLOA 1EFTA 2R9VA 3NAWA 2LBFB 3OYNA 2W4SA 1R36A 2XHKA 5CKTA 2X4HA 3KLNA 4LJZF 3WTYC 4TN1A 4CYDA 3T56B 5FKMA 1VHEA 3M3YJ 3ASPA 4CZCA 3MEXA 4LD5A 1HW2A 2WWYA 4YXWA 1XDSA 4RMNA 1HF0A 4A2UA 2D5VA 4XICA 2VN2A 4A69C 2PJRB 3IUOA 2XROA 4ZDOA 1VQ8B 1VTNC 5E20A 1QFYA 3JW4A 5FKNA 5BS6A 3V7AA 3A01B 5E6TA 3HOYJ 4OPOA 4RCZA 1WPKA 4NQWB 5A8AA 3GRHA 3S16J 1ZLKA 1MGTA 1FYMA 2QKMB 1X4PA 4IL6C 5FKOA 5H5JA 1QG0A 1WP6A 4HIZA 4ASNA 3NWTA 2W24A 1FTZA 2R0QC 3WNCA 2BXYA 1FT9A 2JA2A 5FNZA 1U6GA 4IKFA 4BQQA 1IRGA 3LMWA 1A04A 4NC7A 1H88C 2GXGA 1D0ZA 1I6XA 2KMUA 3K1PA 2MYSA 1KCCA 2IEKA 3CUOA 4RD4A 4A3JJ 3OL4A 1DPUA 1K7AA 4EH1A 3TP3A 5KAIC 2RQPA 4C3JJ 4JX5A 1MMAA 5IOZA 4L18B 1PE9A 1BJKA 1FOYA 1WH7A 1HF2A 4HF2A 3S2DJ 2D74A 3KEWA 3G71B 3C1DA 2BV3A 2G7UA 3MZYA 2B63J 4M2LA 3OYCA 3AG2H 2Z99A 3WG9A 2L2OA 2XZLA 3SZEA 1YIJB 1SMTA 3BOQA 2R7SA 2OCEA 4G6TB 3WG7H 1F1ZA 4EJWA 4KITB 4U0YA 2NRAC 5C1EA 4KMUX 1Z21A 4PMHA 2HKOA 4K1XA 4Z06A 4IJAA 2H8WA 5LHHA 3H9JA 1G7RA 1YJNB 1UCRA 1WH5A 2XPUA 2M0CA 3LSRA 1QBJA 1WWXA 2VODA 1TT0A 4GRIA 2FUG2 4BL0B 2H27A 2V9KA 3H0GJ 2P0WA 1IDJA 2INVA 3MKLA 3WBKA 3NWSA 3W5VA 4HNTA 2VBYA 3ASNH 1OR7A 2M4GA 4KT5C 1VHOA 4G1VA 4IPAA 1EJ9A 4BXXJ 5DD4A 1YHQB 4YEJA 4P55A 1TQIA 2HU9A 1R5BA 3ABUA 1NHCA 4FN5A 1PP7U 2ICWG 3FWEA 1YX2A 4UZEA 3SQNA 2M45A 1IW7F 2DYRH 5L3FA 2Z33A 1K78B 4A0ZA 3O8GA 3PNYA 1YHQI 3BH4A 3PUNA 2ID3A 2VQGA 3CCRB 2MLKA 3RTRA 3ZOBA 3GQBA 4M6VA 4FK8A 1WI9A 2K9MA 2KIQA 3CCSB 3BH7B 3NRVA 1H85A 3SY2A 4XLNF 5FD5A 1S72I 5IT9Z 2ZTGA 4NCNA 4WQMA 1LB2A 1Z3XA 1LEBA 1EV7A 2X48A 5H59A 1KQSB 1TSPA 3I55B 3VPRA 3M8EA 4HYEA 1G59A 2R7DA 3QPHA 4A3IJ 1VQLB 3R61A 1PVEA 1X3ZB 3G1OA 4A6EA 4B4CA 4LGWA 1Z67A 4NDLA 4Z2YA 3BR0A 2K9NA 3FKIJ 4E0FA 1RWRA 4YAUA 1D5VA 4B3AA 4ZH4F 1ETXA 3OV8A 1F36A 2YX4A 2Y0SN 1VQLI 4U4BA 1N06A 2XGCA 4I0AA 5ERIA 4BUPA 1JHHA 1FC3A 4W8SA 1ZLJA 2HWVA 3FPPA 2K5CA 1T8IA 2NAZA 5LD2C 3KEYA 3U1KA 2XF5A 1PJ7A 1N0UA 3CCSI 3GTGJ 3JSOA 3MZ8A 2WZNA 3J81K 3A8KA 1TYXA 3PM1A 1RZ4A 5IYNA 1LLZA 4K2EA 3A2KA 2KZVA 2WY8Q 1S7AA 2BY1A 2M7BA 1JKPC 2IGOA 2NVXJ 2GJKA 2WB1N 3FJOA 3CRZA 1EKEA 1VI0A 2GQFA 1NDHA 3AGPA 3BCFA 2DT7B 2QTZA 3F22A 1FDRA 3AG4H 4XKWA 4I2OA 3GFLA 4NB5A 3KYLA 3ASRA 1SD5A 1BJZA 5EJCA 1KU7A 5A2QK 3CUQA 3HPGA 5HNFA 1H8AC 1EWYA 2AXTC 1FIPA 4AU7A 4P2NA 3JQPA 3CESA 2XOKA 1PJRA 3CW2A 4L8JA 4OJPA 5DV5A 3VYUB 1R1VA 2DOEA 4JOMA 3OSGA 4GCVA 1XE1A 1LQ1A 5EF6A 1RRJA 3SEZA 2WR8A 4IRGA 1OKRA 3ASSA 3E6DA 1ONVA 4IRHA 4N9HA 3U9GA 3DBRB 1R58A 2V26A 3EUAA 1BBYA 5JLVC 1UZCA 3OYFA 4BHPA 5DS9A 3DV8A 3JX8A 1TP4A 3FHNA 6PAXA 1X3UA 4JP0A 4AYBA 5TISC 3AL0C 1JI8A 2K3FA 4LLLA 3BR3A
chains in the Genus database with same CATH topology
1X1AA 4YZ0A 4E7HA 3OY9A 3CP2A 2HVQA 2K9LA 4C2LA 2LRDA 2M0MA 2R4GA 3AFHA 3ONQA 3AL0B 3H9GA 3ZPPA 3DLAA 2D3NA 2WB1A 4HPQA 3PJRA 4TKOB 2LY2A 3E0JB 1O8DA 4CSWA 3EUKL 3OIQA 2X6WA 5FRNA 2JUGA 2LYCA 4E6KG 3L2QA 4PSXA 3RCOA 2DIEA 2ZZFA 3DPTA 2CMPA 2DJIA 4HSRA 1BPLA 3LSHA 3MKYB 4KISA 2JDIA 3FY3A 3K4MA 2O1DA 4U87A 3A3GA 1S9HA 2LC2A 3VMWA 2JJ2A 1X19A 2LG4A 1WJCA 3ZCOA 1MMNA 2V4JC 5KNLA 1H8HA 3K4CA 2ZZEA 2X1EA 3U21A 1O8IA 4BQNA 3CP8A 5HLTA 1QJVA 1UG0A 1OFLA 5CDFA 4W8QA 3IP4B 2NZMA 2Q1ZB 4CA0A 4E7JA 2XZPA 4GQNA 4PFOA 3GQ9A 1EFRA 2XAUA 4PUSA 3OS2A 5CQEA 1HG8A 2LREA 3H5NA 3RPUD 3OYAA 1DP3A 2NTPA 2CW7A 2WAEA 3PUBA 4DBQA 1T0FC 2CW8A 3HOTA 1QU3A 1OHHA 2HLDA 2RNGA 4OJLA 1O8KA 3TMOA 3OR2C 1G8XA 3OYIA 3H35A 2W82A 2HQAA 4F52A 2PECA 2MABA 3EUHC 1K6YA 2WBMA 1E43A 3C2GA 1FX0A 1NBMA 4B3FX 3CF2A 2X3HA 2L9NA 1UD5A 1H80A 1QHGA 2X1CA 2IS2A 2UWMA 4DNTB 2XF7A 1O8MA 1PLUA 1XG2A 3B90A 3OYKA 4ITVA 3W2WA 4E7IA 1LKXA 4JMQA 2PYGA 2V4DA 1DBOA 2NTBA 2NTQA 3GQ7A 4YZXA 2HVSA 3OPOA 2Z2SB 1GLNA 4E4HA 3W3CA 3EPZA 3EQNA 2E5ZA 3OYDA 4XL9A 4E7ZA 2CV2A 3OYBA 3D5LA 4CCLA 1Y56A 1FMWA 1UELB 5HKKA 4TSFA 1WFXA 4LG3A 1NG7A 3OYGA 3RSNA 2VJ4A 1N77A 2IS4A 3OYJA 2VQLA 1EE6A 5JHFA 1V5GA 3G2BA 3VSLA 4BE0A 2M5SA 4DGWB 4U7BA 1AA7A 3HUGB 2VKHA 3DKXA 2VLAA 4HG2A 3K70C 1H8EA 3PNTA 1VJSA 3SEQA 4BDZA 4XQFA 1OFMA 1OGOX 2OC6A 3CJQB 2IS6A 1SFKA 4ASUA 3OOCA 2K3PA 2GOXB 1HVXA 4C2TA 3EQOA 2RQQA 3IAM2 3BCAA 2HNHA 4PFPA 4G6IA 3VSVA 2AQFA 4D9JA 3BLYA 3FKJA 2XSJC 2BW3B 1BHEA 2VIXA 4N4OB 4XLFA 5HOOA 3JU4A 3PFYA 4NNJA 3S3OA 4RLFA 4XORA 4B48A 1D1CA 1UD4A 2KPMA 3SDBA 3HKZA 3OE7A 2NSTA 3LSMA 4MLOA 4EATA 4CCMA 4CCJA 2BVLA 4DOZA 1BN8A 4Y33A 1X1CA 2X6YA 2GK6A 2HZDA 2VJ5A 4BJTA 4YZQA 1DGWY 3FBNB 4IQJA 3CZ6A 4XR6A 1W9XA 5DN6A 1BR2A 3I9V2 2L7KA 2O17A 3HG9A 4F93B 2KDOA 1OR7C 2VJIA 4KT6A 3DTEA 3QYFA 3ZR8X 1MMGA 2L5QA 3DU5A 3OR1C 3OEEA 2X85A 2GJPA 4QPOA 4J01A 4OAZA 3ZGKA 3BG6A 4XLEA 4URRA 2Z8GA 2ELJA 5HVQC 4XOPA 3T51B 4ZYAA 1EA3A 3H5AA 1COWA 2KL4A 2DXIA 4DBRA 3PSFA 3D5RC 3A3BA 3BC9A 1Y6IA 4RM2A 1JTAA 3AKZA 1BR1A 3QYBA 2R7OA 2MC4A 3GQAA 2V7FA 3UW0A 4G7XA 5LFAA 4OWRB 1QHHD 3W2AA 2E1MB 4J00A 1UD6A 3OEHA 4OJ6A 2JJ1A 3ZQQA 1T5EA 1UD2A 3S3NA 2KVOA 2LH9A 2DCEA 3M1CA 2VJJA 3ZRGA 4ZTFA 3QODA 4YELA 2WA0A 1OB0A 3QOEA 3FDYA 2GK7A 4NUBA 4ZC3A 2ZSIB 2HDWA 1MNDA 3MMYB 4B44A 3H5RA 3WQZA 4OZZA 5TGTA 2X51A 2L9SA 4LIVA 4MXNA 2HPMA 3ZPNA 2WADA 4BJ5C 2KQRA 1WJDA 4ZDLA 1YX5A 2KHMA 3B8YA 1IA5A 3A35A 1T95A 1WJBA 2M7AA 4CUGA 4XNFA 3OW7A 4II2A 4Y3OA 3VDXA 2GOMA 4RM3A 3K70D 5CPRB 5HNHA 1R6RA 3WWGA 2E1MC 3DWLE 4BE2A 1WMRA 3T53B 2UV1A 1WJ5A 1Z7LA 4HEA2 4HSTA 3GVKA 2F6CA 2CS3A 4DIQA 4IQ4A 2LZJA 4EW9A 2WPDA 3W2VA 2VBEA 3VMVA 1V5FA 4FETA 4NC8A 3DEEA 2X1DA 1MMDA 3VSTA 2F5VA 3LSKA 4HNUA 2I8DA 1SKYB 4KKSA 3S32A 2QY1A 3PSIA 3VWBA 1U0JA 2HVRA 1KTWA 4MR0A 4XKCA 4JQFA 1OOCA 3S8PA 4BE1A 4XN3A 2ZXIA 1MNEA 2VQCA 1NRKA 4P5OA 1W36D 2F43A 1RU4A 4F55A 2R7TA 1E3XA 1W0JA 2WY7Q 3OFNA 3DU6A 2HPIA 4CH7A 3JURA 2ODLA 1D0YA 3OYMA 2O0WA 1I18A 4XOTA 1V5EA 2VBKA 3H0DA 2ZSHB 4OAYA 1X0CA 5KHDA 4XKBA 5FROA 4E7LA 4XN0A 5AMVA 2BOLA 1K5CA 2XDVA 5FRMA 1FMVA 1UD3A 4YZAA 3IAS2 2Z1DA 4XKVA 2W1OA 2NOJB 3TBIA 4BQOA 2X8KA 2WZPP 3SUCA 3VSUA 2O5RA 3M8JA 4XONA 2VPLA 2BVMA 3GBGA 3LSIA 4ZTJA 2WAQA 2UVEA 4C30A 2XGJA 1O88A 4FXUA 3V42A 4C2UA 4XD7A 1O8FA 4IZZA 2QX3A 4E7KA 3CJRB 4ZJZA 4BDYA 2LBFA 4I84A 4B3XA 2Y0SA 3K6GA 3HAGA 2CV1A 3VR6A 3DDYA 3VYRB 2MD0A 4W8TA 4ANJA 4NK8A 3B4NA 4Z1MA 3DQVC 4N4NB 2QE7A 1BOBA 3S93A 1D0XA 4P22A 1D1AA 3OWTA 2VKDA 1N78A 4IX7A 2PMZA 1PYVA 2VXDA 2D3LA 2W6JA 5FL7A 2KLOA 2PJRA 3K4BA 3OMYA 2R9VA 2LBFB 3OYNA 2ZTNA 2W4SA 5CKTA 4LIUA 4BU2A 3T56B 2NT6A 4CZCA 3L2UA 2WJYA 4C9YA 2GJRA 4YXWA 2Z16A 4XLHA 4RMNA 2JVGA 2NSPA 1BMFA 1W0KA 2EWEA 4QPQA 1MW7A 2XZOA 4RLQA 3KRGA 4PJMA 2VL8A 2PJRB 3IUOA 4ZDOA 4B43A 3K10A 3L2WA 3MKWB 2V7QA 1PKVA 2A5WA 1X1BA 1KZLA 1IRXA 4NQWB 4F92B 3GRHA 2WSSA 2QKMB 1X4PA 2CUZA 2WJVA 1E1QA 4DJAA 1WP6A 1TZLA 1X4OA 2ZXHA 3HXLA 3NWTA 4HIZA 1O8GA 3K4JA 2JA2A 2VQHA 1W36C 1HZEA 4IKFA 4BQQA 3LNNA 3LMWA 4NC7A 1D0ZA 2KMUA 1KCCA 2MYSA 3BG7A 2VXZA 3KX2A 3OL4A 2M3AA 2R7VA 2Z6BD 3MKZA 3VYTB 2UVFA 1YX3A 2A6TA 4E7SA 4B3GA 1MMAA 4PJNA 2R7WA 1PE9A 1IB4A 2E5NA 1KCDA 2KRCA 3D5SC 4BEHA 5C1CA 4F3QA 1YE9A 3KEWA 2O04A 3A1YA 3OS1A 2X6XA 4H4KC 4CCOA 3HPHA 3OYCA 2X53S 2VB6A 1ZELA 2CV0A 2L2OA 1E1RA 3LFUA 2XZLA 3H9QA 3SYTA 1AIRA 3LL7A 2R7SA 4G6TB 3TL4X 4KITB 2XF6A 1O8HA 2IQ7A 5C1EA 4HWVA 1LFPA 1Z21A 4D1QA 4PMHA 1E79A 4Z06A 2W7NA 1E0EA 1CZFA 1SAUA 3H9JA 4HRIA 2DT6A 3ZIAA 1NG6A 3OL3A 2WAFA 1OGMX 3VYSB 3HL2A 2JIZA 1TT0A 4GRIA 2FUG2 4BL0B 2V9KA 1DGRM 2P0WA 1IDJA 2INVA 4PSWA 1VLYA 3PL8A 1UAAA 3NWSA 4UZUA 3BCBA 4BEHB 4HNTA 2XC7A 1V0FA 3OYEA 1IDKA 1BLIA 2M4GA 1RMGA 2V6EA 2BSPA 2PYHA 1PXZA 5KCMA 3GVJA 3OYLA 4Z03A 3MD2A 1KMHA 2RREA 3OS0A 2R7QA 3FKSA 4G7WA 4YEJA 2LOOA 2HU9A 1NHCA 2MFZA 4BXFA 4YRVA 1WPCA 1Z3YA 4Y4RA 1KONA 3DTIA 4PJJA 2R7RA 2CFOA 4CCKA 3RQ4A 1D1BA 2NT9A 3PNYA 3BH4A 3UNGC 2VQGA 1I8DA 2O0VA 1VBLA 1DQUA 3RTRA 3GQBA 4KJZA 2F1MA 4NK6A 2CH0A 3F9KA 2K9MA 3BC8A 2CK3A 1MABA 2ZTGA 3DPLC 3C2HA 1GQ8A 4II3A 4BGDA 1Z3XA 3I3LA 2W6IA 1O8LA 1G59A 1WJEA 3A4CA 1WJAA 3K4LA 3K4NA 2KRHA 4FASD 4XM3A 2R7XA 1E3ZA 3OAAA 2VBMA 3G05A 4W8RA 5IK2A 1O8JA 4U49A 4E0FA 1RWRA 2V1NA 1ERDA 3T9GA 3BCDA 3DKYA 2IGMA 4U4BA 4LITA 3VSKA 4PJLA 1V0EA 2IGKA 3ZSCA 4BJ6C 3GQ8A 4BUPA 3L2RA 2E60A 4W8SA 2AQEA 1LVKA 3HC7A 3FPPA 2K5CA 1JRGA 2KP6A 1O8EA 2V31A 5LD2C 3J7AY 2BW3A 2VASA 4BS9A 3KEYA 2OV7A 2XF5A 4XMYA 3SZGA 4OJOA 1J09A 2ZZGA 1OLTA 4XLCA 2W00A 1UD8A 4R79A 4AVZA 4X0GA 3LSGA 2IGNA 2OUMA 3A2KA 2KZVA 2ZFUA 2WY8Q 2UUZA 2INUA 2R7UA 2M7BA 2IGOA 1VF7A 1HA8A 2GJKA 1X1DA 2JVHA 3HOSA 2QXZA 4DK0A 3BCFA 1LDKB 2DT7B 3ZXSA 4P1WA 4XKWA 4BACA 3H94A 1BR4A 4CCNA 3K4KA 3OIPA 3KYLA 2ZZQA 3L2VA 3PNVA 4XLAA 1WTHD 1WJFA 2QKLB 2IXSA 4TT3A 3HPGA 5HNFA 2IS1A 4DK1A 4AU7A 1N75A 2XNDA 3DPUA 3QYEA 3CESA 4ZDPA 1PJRA 2XOKA 4L8JA 4OJPA 4KKUA 4Z05A 3DTKA 1P9QC 4B47A 3VYUB 1VZ0A 5CQGA 1DBGA 4JOMA 4OJ5A 3FBIB 1K28D 2LY1A 3SEZA 2JSPA 3OYHA 3NE5B 2E1BA 2CUJA 4DNRB 2M4KA 3CMMA 3LMMA 3S3MA 2V26A 3EUAA 2DOAA 3UR3C 3OYFA 2Q2EB 1QCXA 4OZYA 3N05A 3FHNA 4PK4A 3E1SA 3GVLA 4AYBA 3AL0C 1JI8A 3OOUA 4KKTA 4F91B 2F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSV A;  4XN0 A;  1IDJ A;  2INV A;  5AMV A;  4YZ0 A;  1K5C A;  4YZA A;  4C2L A;  1BHE A;  1IDK A;  4XKV A;  1RMG A;  4XLF A;  2BSP A;  3ZPP A;  3SUC A;  3VSU A;  2PYH A;  1PXZ A;  4XON A;  4Z03 A;  4XOR A;  2UVE A;  4YEJ A;  1O88 A;  2NST A;  1NHC A;  1O8D A;  1BN8 A;  1O8F A;  2X6Y A;  2X6W A;  2QX3 A;  4YZQ A;  4I84 A;  4XR6 A;  2NT9 A;  2O17 A;  3FY3 A;  2O0V A;  2O1D A;  1VBL A;  2VJI A;  4W8T A;  4NK8 A;  3B4N A;  4NK6 A;  3VMW A;  2X85 A;  1GQ8 A;  4XLE A;  4URR A;  2Z8G A;  1O8L A;  1O8I A;  4XOP A;  1QJV A;  4XM3 A;  2VBM A;  1OFL A;  4W8R A;  4W8Q A;  1O8J A;  4U49 A;  2NZM A;  1RWR A;  2NT6 A;  1JTA A;  3T9G A;  3GQ9 A;  3GQA A;  3UW0 A;  4XLH A;  4U4B A;  1HG8 A;  2NSP A;  2EWE A;  3ZSC A;  2NTP A;  3GQ8 A;  4OJ6 A;  4W8S A;  3KRG A;  1JRG A;  1O8E A;  4OJL A;  1O8K A;  2VJJ A;  4XMY A;  4YEL A;  4OJO A;  4XLC A;  4OZZ A;  2PEC A;  4AVZ A;  3GRH A;  4MXN A;  2INU A;  2X3H A;  1H80 A;  1O8G A;  1O8M A;  3B8Y A;  1PLU A;  2QXZ A;  1XG2 A;  1IA5 A;  3B90 A;  3LMW A;  4XNF A;  4XKW A;  1KCC A;  2PYG A;  1DBO A;  2NTB A;  2NTQ A;  3GQ7 A;  4YZX A;  3WWG A;  3EQN A;  1WMR A;  4XLA A;  2UVF A;  4XL9 A;  4EW9 A;  1PE9 A;  1IB4 A;  2VBE A;  3VMV A;  4OJP A;  1KCD A;  4Z05 A;  5C1C A;  3VST A;  1DBG A;  2O04 A;  2QY1 A;  4OJ5 A;  1KTW A;  4MR0 A;  1EE6 A;  2X6X A;  1OOC A;  1RU4 A;  4XN3 A;  1AIR A;  2IQ7 A;  1O8H A;  5C1E A;  4HWV A;  4PMH A;  4Z06 A;  1CZF A;  3JUR A;  1QCX A;  1OGO X;  4OZY A;  4XQF A;  1OFM A;  2ODL A;  2O0W A;  4XOT A;  2VBK A;  1OGM X;  1X0C A;  3EQO A; 
#chains in the Genus database with same CATH topology
 4N9I A;  2K40 A;  3H1C A;  2RC6 A;  3R6S A;  3CP2 A;  5IYR A;  4Z4V A;  1L3L A;  1A31 A;  2R4G A;  3AFH A;  1SMY F;  3HM5 A;  4L5J A;  3H9G A;  3AAF A;  4YFO A;  3LAJ A;  1FJL A;  4TMW A;  3JCU C;  1LUJ B;  4ENN A;  1S29 A;  3REO A;  4TKO B;  2NXN B;  2DCU A;  2GBY A;  1O3S A;  1SVL A;  2DU9 A;  3N97 A;  3AVY A;  1K79 A;  1WOO A;  1VQ5 I;  1QO0 D;  4E6K G;  2PMU A;  2ESN A;  3LO8 A;  4ROX A;  4HZF A;  2XAF A;  4MIM A;  1GVH A;  3O8H A;  3DF8 A;  1T39 A;  3KP4 A;  2PLF A;  1BI2 A;  4RD1 A;  3CCQ B;  4HDU A;  4U87 A;  3A3G A;  1S9H A;  2LC2 A;  2ZC2 A;  4GO1 A;  3PVD A;  2LG4 A;  1WJC A;  3FXU A;  5HXB A;  3GXO A;  3HOU J;  1VQN B;  1EH7 A;  3ASO H;  1W87 A;  1Z7U A;  4F7D A;  1Z9C A;  1KQ8 A;  3M1E A;  3ECH A;  2ZZE A;  1E2X A;  2FOW A;  4M3E A;  4NC6 A;  3ML3 A;  3LQ6 A;  2VON A;  4HNV A;  1KYZ A;  3VO2 A;  5CDF A;  2BGJ A;  1XCV A;  1GUU A;  1QFJ A;  3E5U A;  3F21 A;  1XPX A;  1Z0X A;  4PUS A;  2EZI A;  4P12 A;  3OP1 A;  1QX4 A;  1RIO H;  3A1P A;  1Y39 A;  4W1U A;  2NTP A;  3SQV A;  1A35 A;  1OFD A;  3IRR A;  2E2J J;  2CW7 A;  2F2E A;  3PUB A;  1T0F C;  3ZMV A;  1QU3 A;  5EDN A;  1O8K A;  3Q0V A;  2DYS H;  3OYI A;  3WTW C;  1YJ9 I;  3H35 A;  2W82 A;  2PEC A;  2XPW A;  2DEU A;  1K6Y A;  2HYG D;  2WV1 A;  3FK6 A;  2GIV A;  5DM7 F;  1QHG A;  4M72 A;  4P9F A;  2IS2 A;  4DNT B;  3B90 A;  1IG7 A;  3OYK A;  2LLK A;  1TWC J;  3W2W A;  4E7I A;  1LKX A;  3BY6 A;  5J8C A;  4X8I A;  2OK7 A;  1VQP B;  2V4D A;  1P92 A;  2NTB A;  3GQ7 A;  2VT2 A;  2V9P A;  2Z2S B;  1VQ4 B;  2A3S A;  4E4H A;  3W3C A;  2HEO A;  1OQY A;  4E7Z A;  3ZQ7 A;  2L9R A;  3PO3 J;  4ZYH A;  3KZZ A;  3QSY A;  4Z6Y A;  4CCL A;  1Y56 A;  3CXC B;  4OIR F;  2LY9 A;  3G1M A;  3Q9V A;  3CPW B;  2P6S A;  4XBF A;  1NG7 A;  2PE3 A;  3RSN A;  1TW2 A;  1SD4 A;  1VQ8 I;  2JSC A;  3IWZ A;  1YJW I;  5D6F A;  3J7Y J;  2HOS A;  5JHF A;  3ZZU A;  2ZXJ A;  4BE0 A;  2F4O B;  5FO0 A;  2M30 A;  1SVM A;  4U7B A;  3HUG B;  2KDZ A;  4KN4 X;  4Z4T A;  1U2W A;  4HG2 A;  3B02 A;  3HTU A;  2JK3 A;  4ZYG A;  1JNY A;  1H8E A;  1VJS A;  1R5O A;  1KQ0 A;  3I0T A;  1QVU A;  1JA1 A;  2XGX A;  3CJQ B;  2OJE D;  2X9D A;  2QGG A;  2K3P A;  1IUY A;  2H09 A;  4C2T A;  4G7O F;  2EV6 A;  2RQQ A;  2DA6 A;  4GYI A;  2OBR A;  4P25 A;  4BBS J;  2K4J A;  2M87 A;  2HCJ B;  2QQB A;  5TY0 A;  2DFH A;  3K69 A;  1YYV A;  2FML A;  4N4O B;  4TMX A;  4XLF A;  3FIW A;  3PFY A;  3C2B A;  1QRC A;  3WU0 A;  3DEU A;  3S3O A;  4WK8 F;  3ZQI A;  2E1N A;  4A5M A;  3SDB A;  5ED4 A;  3OE7 A;  4PC1 A;  1USS A;  3LSM A;  1RC9 A;  4EAT A;  4EM1 A;  1H9T A;  2E71 A;  2YS9 A;  3SKB A;  1JJ8 C;  2QEX B;  3SLD A;  1X1C A;  1T6Y A;  4P6Y A;  4BAY A;  2VJ5 A;  2HGC A;  1HKS A;  5C44 J;  2HYF A;  1RR8 C;  1MBG A;  1CQT A;  4XR6 A;  2O6G E;  4IQJ A;  3GWZ A;  1R9T J;  2L7K A;  2I5U A;  3HG9 A;  5IP6 A;  3GX4 X;  1H89 C;  1LE8 B;  3E7L A;  4RJL A;  1MSE C;  3DTE A;  1KD1 D;  1R23 A;  1MMG A;  1XS9 A;  4D5F A;  3DU5 A;  3TDZ C;  1BW5 A;  5L3E A;  4ABZ A;  4QPO A;  5IYP A;  3V8L A;  4AYB N;  2QYU A;  4XLE A;  2K9Q A;  4EVI A;  4M3F A;  2ELJ A;  1T98 A;  4CXF A;  2YWH A;  3V8K A;  1V54 H;  2GA2 A;  3T51 B;  4ZYA A;  1EA3 A;  1A6Q A;  5DCM A;  3DCF A;  2DXI A;  1FNC A;  4UB8 C;  5HLI A;  1ZK8 A;  1HOM A;  3BJA A;  5D4S A;  2V5I A;  1VQK B;  3AKZ A;  2R7O A;  2MC4 A;  4FQG A;  3GQA A;  4G7X A;  2EFO A;  4OWR B;  1QHH D;  4RGS A;  2E1M B;  4J00 A;  2JJ1 A;  4KDP A;  1ON2 A;  2QVO A;  2V9V A;  5GP9 A;  1SFO J;  1CQX A;  3MVP A;  2DCE A;  4LG0 B;  2V1U A;  3W6J B;  4U0W A;  3ZRG A;  3ZN0 A;  1U8R A;  3BQY A;  1ZM2 A;  4FE7 A;  3WHC A;  1RET A;  2QQ8 A;  3A8I A;  1K9M D;  3QOE A;  1VQM B;  1ZM9 A;  4NUB A;  3HRS A;  4OZZ A;  2HDW A;  3MMY B;  4M71 A;  2L3D A;  1TYW A;  4B4D A;  3L9F A;  4MXN A;  4D0P A;  1OMI A;  1D5Y A;  4U88 A;  3TO9 A;  3ZPN A;  1FEX A;  4H9G A;  4JBA A;  4BJ5 C;  1WJD A;  5K1Y A;  1ZRF A;  3B8Y A;  2KHM A;  1K78 A;  2J7K A;  3I59 B;  2VPR A;  4II2 A;  3LJY A;  3RDI A;  3VDX A;  4RM3 A;  5ICF A;  1FY7 A;  2FBK A;  4ENM A;  1R6R A;  1D8K A;  2FMY A;  3F8M A;  2OF7 A;  2VBZ A;  2E1M C;  1TVC A;  1WMR A;  1SFE A;  1WJ5 A;  3DP7 A;  2HQR A;  3F6V A;  3CCL I;  4A3C J;  4X7E A;  3CCV I;  4X05 A;  5GTI C;  2EA4 A;  1MMD A;  3VST A;  4KKS A;  2QQA A;  5K7Z A;  1RI7 A;  2NVT J;  2VI6 A;  1KTW A;  5F27 A;  3CC7 I;  4XKC A;  4JQF A;  2YSR A;  3OIO A;  1JT0 A;  1CNF A;  5HDK A;  1PJ5 A;  2V1D A;  4UUS B;  4BE1 A;  1NRK A;  1RU4 A;  1J7K A;  2F43 A;  5B1A H;  1Z1D A;  4RDU A;  3CC4 B;  5FLV A;  2XTW A;  2CYY A;  5H6Q A;  3DU6 A;  2HPI A;  3I4N J;  1HQC A;  1KU3 A;  2ZME B;  2VC1 A;  2O0W A;  5C4J J;  4XOT A;  2VBK A;  3GFI A;  3FMS A;  1ACI A;  3IL2 A;  3HSR A;  1EP1 B;  4G12 A;  4OAY A;  2GRE A;  3IKV A;  3TOB A;  1VF9 A;  1FNB A;  1ON1 A;  5FRM A;  1UD3 A;  4AD9 A;  1R71 A;  2FVG A;  1TWG J;  2Z1D A;  2W1O A;  3S15 J;  2JMW A;  3WU1 B;  4MYU A;  3VSU A;  3E5X A;  4XON A;  1OB2 A;  5ICC A;  3GBG A;  4RDK A;  2H6C A;  2NV4 A;  4A0X A;  2I1L A;  1T6S A;  3I58 A;  5CLS A;  4ZTJ A;  4OIO F;  4C30 A;  2XGJ A;  4ETS A;  4FXU A;  3COA C;  3RKW A;  2QCO A;  5JVG F;  4IZZ A;  4IRI A;  2QX3 A;  5L46 A;  3CJR B;  2ZKZ A;  1HST A;  3N90 A;  4I84 A;  2Y0S A;  3K6G A;  2CJJ A;  3RYP A;  3F3X A;  2RGV A;  3DQV C;  4LOC A;  1ZG1 A;  1ETW A;  1RNL A;  2XT2 A;  1D0X A;  1D1A A;  3W2H A;  2VZL A;  3ZC3 A;  2BSA A;  2RNJ A;  4IVN A;  1QA2 A;  2H8R A;  2DET A;  5K7F A;  3CJT B;  5BPI A;  1Y8R B;  2ZTN A;  4OOV A;  4HA8 A;  4LIU A;  2MG4 A;  4DYC A;  1JTX A;  5J6X A;  1MBK A;  2E7W A;  1P4A A;  2K02 A;  1W5T A;  2GJR A;  2IOU G;  3RYR A;  4D5C A;  1B9M A;  5FD6 A;  1W0K A;  4KFC A;  4B1R A;  3RJP A;  1A8P A;  2XAJ A;  1MW7 A;  1O3T A;  1EP2 B;  1EP3 B;  3OKX A;  3IH3 A;  3B78 A;  1HDP A;  3CCU B;  4I0B A;  2QMU A;  4EM2 A;  4B43 A;  3L2W A;  1KJZ A;  3BZK A;  4A0Y A;  5DUK A;  1XB4 A;  1YS7 A;  1TTY A;  2A5W A;  1KZL A;  1UST A;  1PUF A;  2GXB A;  1GXQ A;  1PDN C;  1X58 A;  2VYQ A;  3CCU I;  2RC4 A;  3DU1 X;  3V7S A;  5CVU A;  1DU0 A;  1O8G A;  2UXX A;  2DT5 A;  2X0L A;  1W36 C;  2VQH A;  1VQ9 I;  3LNN A;  2VE9 A;  2CRV A;  4M6Y A;  1ZN2 A;  3ZPL A;  1FRN A;  1OB5 A;  4HDV A;  1VQ7 I;  3BG7 A;  2VXZ A;  2NYX A;  2R7V A;  5AIP A;  3MKZ A;  2PEX A;  3VYT B;  1HLV A;  1KC8 D;  2A6T A;  4B3G A;  2R7W A;  5IYD J;  4UNO A;  3ZMZ A;  1KCD A;  1O7L A;  4Z4U A;  4F3Q A;  1YE9 A;  2KT0 A;  3S17 J;  3BG5 A;  3R4K A;  4FCY A;  3HPH A;  4Z4R A;  2CUF A;  2PQ8 A;  1ZEL A;  1E1R A;  1L1I A;  3WGI A;  4X07 A;  3CD6 B;  2IQ7 A;  4A5N A;  2XF6 A;  2Q6L A;  2BM5 A;  5LEJ A;  3SEJ A;  1Q82 D;  1LFP A;  4D1Q A;  1DDG A;  2XTX A;  4HWV A;  1IGN A;  4PC2 A;  3LA2 A;  2W7N A;  1VQ6 B;  5HDN A;  4HF1 A;  1SAU A;  1RKT A;  4MTD A;  1NG6 A;  3EUH A;  2WAF A;  5FKL A;  4ENJ A;  1VQ7 B;  1OGM X;  3KYD B;  3VYS B;  2JIZ A;  2BXZ A;  4MFD A;  3CUQ B;  2B7B A;  4ESB A;  3WGH A;  1E3O C;  1DGR M;  3UKG A;  1VQ6 I;  1DAR A;  2VBX A;  3KP5 A;  1VLY A;  5TV2 A;  1LLW A;  5JMC B;  4Z4Y A;  2XC7 A;  4BEH B;  3JRD A;  1V0F A;  4X06 A;  1YIO A;  3LA3 A;  3OZV A;  4KH3 A;  1RMG A;  4HQE A;  3P5J A;  5B5E C;  2BSP A;  2PYH A;  4Z03 A;  2LD5 A;  1KMH A;  2RRE A;  3N6Z A;  3JQQ A;  2Y9Y A;  4RB1 A;  1PUE E;  1SFX A;  3TO7 A;  4BXF A;  2M1B A;  5AN9 A;  3DEW A;  2EK5 A;  2CC2 A;  1FOK A;  2JN9 A;  1AIP A;  3KIO A;  5DCM B;  1VBL A;  1MBJ A;  2H6B A;  3T1B A;  1QRY A;  2CH0 A;  3ABT A;  4DW6 A;  5IY5 H;  2HOT A;  2STT A;  1MAB A;  5B1B H;  5DUI A;  3DPL C;  2BX6 A;  4II3 A;  3AST A;  3KEQ A;  4WX9 A;  3GZN B;  1OFE A;  1KRH A;  3I3L A;  2W6I A;  3ISX A;  2KFD A;  2GA1 A;  3NQO A;  3A4C A;  2ZL7 A;  2R7X A;  1XQB A;  2A5Y B;  2KRH A;  4QVA A;  2HKX A;  1MH3 A;  3FMQ A;  4BXU A;  4G6Q A;  1NK3 P;  1GAQ A;  2DYI A;  3JRF A;  3FK7 A;  2ADU A;  1LJ9 A;  1Y0U A;  5LEK A;  1O3R A;  1F60 A;  4W8R A;  4R1H A;  1FYL A;  1R5I D;  3OJW A;  1IN5 A;  1ERD A;  3PO2 J;  1U3E M;  4PJL A;  4V02 C;  5CVI A;  4BJ6 C;  3A8J A;  2QUF A;  2E60 A;  3ABK H;  2ZL5 A;  2AXL A;  3B8H A;  3HC7 A;  3ZN1 A;  2ZME C;  2V31 A;  4C2M J;  2VAS A;  3P9C A;  2OV7 A;  3SZG A;  3J7Z I;  2VFN A;  1UD8 A;  2EFW A;  3H3V K;  2K7L A;  1IXC A;  1E62 A;  3LSG A;  2OUM A;  1DP7 P;  1U5T B;  5J1R A;  2R7U A;  1B2R A;  2XB5 A;  1HA8 A;  2FSW A;  1ZG3 A;  2JVH A;  1Y8Q B;  2R7F A;  1LDK B;  2DK8 A;  1OPC A;  2VUM J;  1JJ2 B;  3PSS A;  4CHU A;  4P1W A;  4YEI A;  4M9X A;  1KGS A;  3CC2 I;  1Y0R A;  3V7C A;  3DFG A;  2W48 A;  4EV0 A;  3ES9 A;  3OZU A;  4CQJ A;  2ZXW H;  3IH2 A;  1QUE A;  4TT3 A;  2IXS A;  3RI4 A;  2H94 A;  2NOG A;  3HJE A;  2XGE A;  1J0R A;  5BNG A;  1P4X A;  1TUI A;  4RA2 A;  3ZMU A;  4OIP F;  1FBS A;  4EM0 B;  3CC2 B;  4M3G A;  1AOY A;  3HYI A;  4UXN A;  3U2R A;  4KKU A;  1SC7 A;  4Z05 A;  4RDL A;  5CQG A;  4LBY A;  5LHG A;  3T8T A;  2D1H A;  3BY2 A;  3U6K A;  2L54 A;  3NE5 B;  2XPV A;  4U7D A;  3VO1 A;  4ACA A;  3GUD A;  1C0W A;  1D8J A;  1K4S A;  3CMM A;  4Q4Z F;  1VQ5 B;  2DOA A;  1Z6T A;  3G4S B;  1OCO H;  4AWX B;  1P7J A;  1RES A;  3WGG A;  4IHS A;  1QCX A;  2MW8 A;  1QUF A;  1X1P A;  4FE4 A;  4QHY A;  1IXS B;  1U5T A;  1ZUN B;  5JBQ A;  4MHG A;  3JRE A;  1JE8 A;  3KPH A;  3IV5 A;  2W25 A;  3OOU A;  4KKT A;  1KQ9 A;  2PMD A;  1TTT A;  1X1A A;  4QLC U;  3QPT A;  4LFU A;  4DQK A;  3I4P A;  2L4M A;  2LRD A;  3MQ0 A;  3ZPP A;  1KA8 A;  3AL0 B;  4PC3 A;  4NBS A;  3DLA A;  4Q5S F;  3GME A;  2JPB A;  5BOX A;  2DA2 A;  1YS6 A;  1VQO B;  2W84 A;  5F1J A;  3PJR A;  1NJI D;  3RPU A;  2EFP A;  2NNN A;  1IO2 A;  4Y7N J;  2Z3Y A;  3P9K A;  3OIQ A;  2JA7 J;  3L2Q A;  1ZYR F;  1V3F A;  2ZZF A;  1BPL A;  4HSR A;  1YO5 C;  5KK1 A;  3LSH A;  3MKY B;  3HRT A;  1FYK A;  3K4M A;  2EPF A;  4AIK A;  4IHY A;  2O1D A;  3G6E B;  2LF7 A;  1P4W A;  1QRB A;  1M90 D;  4P96 A;  5LHI A;  1X19 A;  2OZ6 A;  4L9J A;  2GM4 A;  2BVN A;  2A69 F;  4HE5 A;  1PJ6 A;  1E3P A;  2NVU B;  5KNL A;  4G5G A;  2F5F A;  3D26 A;  1RUO A;  4OOX A;  2X1E A;  3U21 A;  1O8I A;  2JTV A;  3TO6 A;  1EH8 A;  4BQN A;  4EGY A;  2O6W A;  1UG0 A;  2EZL A;  1JKQ C;  3PSZ A;  2A61 A;  3TW7 A;  1R5H A;  2ZBU A;  5E8G A;  2QBY A;  3S1N J;  2EQR A;  2ZCW A;  4KMF A;  2E35 A;  2VOO A;  2LKX A;  2CFX A;  1G2H A;  2A07 F;  1DP3 A;  3H5N A;  3RPU D;  1ZAR A;  3OYA A;  2OPT A;  3WHB A;  4DYQ A;  1B72 B;  5B3S H;  3PQK A;  4OJL A;  1POG A;  1W7P D;  3TMO A;  3EQL F;  2KJB A;  2V7X A;  4RGR A;  2JA6 J;  3ZMD A;  5ILV A;  3BZC A;  3F8F A;  1SKQ A;  2P3M A;  3AG1 H;  5L3D A;  1FPQ A;  1YJW B;  4UB6 C;  1FOX A;  2HQA A;  2MAB A;  2L4A A;  1FNN A;  2WBM A;  3MCZ A;  1FX0 A;  4EJU A;  4LB5 A;  2ZBK A;  4ZV4 A;  3WTS C;  4B3F X;  3C7J A;  3CF2 A;  1OGI A;  1UD5 A;  4WF2 A;  1H80 A;  1O8M A;  1BQE A;  2VFQ A;  5FO1 A;  4ITV A;  2IT0 A;  2DFF A;  2QF7 A;  5GPC A;  1AKH B;  3E6B A;  4HQM A;  3I53 A;  2GZW A;  2V7U A;  1V5V A;  4YZX A;  2GLO A;  1BI1 A;  2DBB A;  3QPL A;  4HLY A;  1LDJ A;  4KYW A;  3J7A O;  1MRZ A;  3EPZ A;  3OYD A;  2YWE A;  3WTX C;  2HZT A;  2L02 A;  3K0L A;  1MKM A;  3QFS A;  1JXS A;  1FMW A;  1YW7 A;  1WVR A;  4YG2 F;  3OYG A;  4Y13 A;  2XNJ A;  3JAM K;  3QQA A;  1XCB A;  3DKW A;  1EE6 A;  4BPR A;  3C18 A;  1MSF C;  2HXO A;  3G2B A;  2DA4 A;  1BOA A;  4UV8 A;  2J5P A;  5M3F J;  4FX0 A;  2LP0 A;  3GZ5 A;  4EJO A;  3P4G A;  2HYJ A;  1AA7 A;  3L00 A;  2CBX A;  1HW1 A;  3KL9 A;  3R6K A;  2VKH A;  2HQ5 A;  1M1E B;  3GFM A;  4JK1 X;  2O8K A;  1W0U A;  4A3G J;  3BTL A;  3K70 C;  1VQ9 B;  3PNT A;  5AON A;  5GAH J;  3F72 A;  5TJJ A;  1ZGJ A;  3SEQ A;  1RQR A;  2OC6 A;  5HS8 A;  1IDY A;  1SFK A;  3BR5 A;  3Q9S A;  1IRZ A;  1BI0 A;  3IHU A;  1GHC A;  3W6K B;  1K6O A;  1RQP A;  4Y15 A;  3W5H A;  1DUX C;  5E79 C;  2HNH A;  3BCA A;  2XEX A;  2KRF A;  2V1X A;  1QA3 A;  3BLY A;  1FWZ A;  2XB0 X;  2M8G X;  2BW3 B;  3MWM A;  1BHE A;  3FMR A;  5ICE A;  3W2E A;  3S2W A;  1YLO A;  2XGD A;  5HOO A;  5D8K B;  2R93 J;  3WU2 C;  2K4B A;  2K27 A;  1QZY A;  2UZK A;  2Z5U A;  1E17 A;  4B48 A;  1D1C A;  2L0K A;  2Q8K A;  5TR9 A;  4A3F J;  3CD6 I;  1LM1 A;  1BN8 A;  4DOZ A;  2FX0 A;  4Y33 A;  3S14 J;  1TW3 A;  3P27 A;  4EMS A;  5EG0 A;  5F4J A;  2JZY A;  3CO6 C;  2DOG A;  1DGW Y;  1S0U A;  4XRM A;  1HCR A;  3HOW J;  1I1G A;  1P6R A;  1G7T A;  3I9V 2;  1W9X A;  5DN6 A;  1J59 A;  3J81 k;  1R00 A;  4L9V A;  2KDO A;  2VJI A;  3M9A A;  4KT6 A;  2E7X A;  5DD8 A;  4F7Z A;  2OYN A;  3ZZ0 A;  3OEE A;  2QEN A;  4ESF A;  3GTJ J;  2GJP A;  4IHX A;  2QA4 B;  2DA7 A;  3LYC A;  4X7C A;  1DPR A;  1YI2 I;  2IPQ X;  4U0V A;  2VFM A;  1HDD C;  4OIN F;  3PEN A;  3H5A A;  1COW A;  1S7O A;  2KL4 A;  4RLZ A;  1JUM A;  4HW0 A;  1FP2 A;  1T33 A;  4RM2 A;  2BE5 F;  1JTA A;  2ISZ A;  3K2Z A;  3UW0 A;  4QUZ A;  5FGM A;  3EYI A;  1VQM I;  5FKK A;  1UD6 A;  5EG0 B;  1R49 A;  4AUX A;  1M1K D;  4YCQ A;  1J9I A;  9ANT A;  2KVO A;  2G0Y A;  1QGP A;  5IP7 J;  3F8N A;  2VJJ A;  3M1C A;  4UHT A;  1CLW A;  3GLX A;  3QOD A;  4ZTF A;  4IEJ A;  4YFX F;  2BMW A;  2WA0 A;  4XID A;  1OB0 A;  3FDY A;  2GK7 A;  4ZC3 A;  3VOE A;  4B44 A;  1JKR C;  2JPC A;  5TGT A;  2L9S A;  4OMZ A;  4M3B A;  1TNS A;  1V4R A;  4HX7 A;  1R1U A;  5L3B A;  2ZME A;  1A6I A;  3I55 I;  3LSJ A;  2ACJ A;  2HPM A;  3ASQ A;  2HQN A;  2KQR A;  4ZDL A;  2P6T A;  5DEQ A;  3ZZT A;  1YX5 A;  1N08 A;  4CUG A;  1WJB A;  3JRC A;  5F64 A;  3OW7 A;  4V2F A;  1LVA A;  1S8N A;  4Y3O A;  2OTL I;  4UUV A;  2GOM A;  1E64 A;  2QLZ A;  3GCM A;  2R6H A;  2KIU A;  4BE2 A;  3RKY A;  3PUM A;  1Z7L A;  4HEA 2;  3GVK A;  1Z05 A;  2F6C A;  2CS3 A;  3M7G A;  4DIQ A;  1WKM A;  5HZA A;  5EZH A;  1N0V C;  2VBE A;  1XGM A;  1YW9 A;  2JJ7 A;  4FET A;  4NC8 A;  4UUS A;  4FX4 A;  2EZH A;  2X1D A;  4BY7 J;  1SKY B;  3VB2 A;  2I8D A;  2JRT A;  4YAO A;  3A0H C;  5HDG A;  2QY1 A;  3PSI A;  2C6Y A;  2BPO A;  2XKO A;  4B09 A;  2I10 A;  3S8P A;  3CPX A;  4XN3 A;  2QQ9 A;  2ZXI A;  1HC8 A;  2EWN A;  2BZT A;  2DI3 A;  3BR1 A;  2OBP A;  5C3E J;  3B6A A;  3I59 A;  4EJV A;  3LNQ A;  3VNU A;  2VBV A;  4P3Y A;  5F6F A;  3OFN A;  4MFE A;  3RKX A;  2FD5 A;  4CH7 A;  5M5W J;  3M8F A;  1DDN A;  2G7H A;  3CME B;  4EGZ A;  3OYM A;  1IN7 A;  1BIA A;  1BJA A;  4J0Q A;  1I18 A;  1TWA J;  4I76 A;  3Q6R A;  2ZSH B;  1X0C A;  3RY8 A;  1WQ2 A;  4XN0 A;  5AMV A;  2ZNY A;  2HDD A;  1F20 A;  2XDV A;  3BTC A;  1FMV A;  3F23 A;  1AMO A;  4OPW A;  2P4W A;  4YZA A;  3IAS 2;  5J3L A;  4XKV A;  3TBI A;  4RB3 C;  2X8K A;  2WZP P;  3SUC A;  2J5O A;  1EFC A;  3AK5 A;  4X7F A;  1NK2 P;  1BX1 A;  2WAQ A;  1F5T A;  1O88 A;  5FLM J;  2FNP A;  4RPB A;  4C2U A;  2A6E F;  4XD7 A;  3K2A A;  5IYB J;  1W1W E;  4E7K A;  1DG1 G;  1TT5 B;  3JR9 A;  1WDT A;  2XAG A;  2QGU A;  3Q5F A;  3HAG A;  3AVX A;  4DZP A;  4IHW A;  2COM A;  2EFQ A;  3CME I;  2OQR A;  3DDY A;  4RM0 A;  4QIW N;  4C43 A;  3DXJ F;  4I7H A;  4ANJ A;  3HRM A;  2LMD A;  3IH4 A;  4N4N B;  2QE7 A;  2BM7 A;  1D1N A;  3HEF A;  2FBI A;  1EXM A;  3TDU C;  4Y17 A;  4Z4W A;  1N78 A;  1YOV B;  2VXD A;  2BF4 A;  1GJR A;  5FL7 A;  4KIB A;  2W7Z A;  3QE2 A;  2YUS A;  2LKS A;  3ROU A;  2DN0 A;  3TP0 A;  4YAL A;  3L1P A;  5B66 C;  1BX0 A;  4BU2 A;  1IHM A;  4I6Z A;  2A05 A;  1YIT B;  2NT6 A;  1ZQ3 P;  3CCY A;  3L2U A;  1G6N A;  2PMH A;  4C9Y A;  4EQQ A;  2WJY A;  2F1L A;  3W2G A;  2Z16 A;  2JVG A;  4WXH A;  3EYY A;  2P7C B;  1BMF A;  2EWE A;  4WXC A;  4QPQ A;  4JX4 A;  2NSP A;  2V79 A;  1IJW C;  2VL8 A;  1TBX A;  3KYC B;  5D6E A;  2L01 A;  1N8R D;  3FM3 A;  2V7Q A;  1HBX G;  2OD5 A;  2M9H A;  3VEP A;  5J1Y A;  1PKV A;  4F92 B;  1VQN I;  4RD6 A;  4TV7 A;  2WSS A;  5FA6 A;  5HS7 A;  3OZW A;  3RIR A;  2CUZ A;  2WJV A;  1E1Q A;  1VQ4 I;  1X4O A;  2ZXH A;  2C5H A;  1B23 P;  1HZE A;  1ODD A;  2R3S A;  3ZQH A;  4AIH A;  2OBS A;  2TCT A;  3U1D A;  3PIO F;  1UFM A;  3QP6 A;  1KQ5 A;  2Z6B D;  5A88 A;  5DTD A;  5JVT A;  2FRH A;  2LSO A;  2OQG A;  2WC2 A;  4E7S A;  4PJN A;  4C3H J;  4OPV A;  4IHV A;  2DOF A;  2EB7 A;  3HUG A;  2E5N A;  3RZD J;  3GTM J;  3D5S C;  3AVT A;  4QV2 A;  1QA1 A;  2O04 A;  2DPD A;  3A1Y A;  1OCC H;  3CCE I;  1YRN B;  3FXJ A;  3QFT A;  3HGG A;  2VB6 A;  2CV0 A;  2OCC H;  2F3L A;  3H9Q A;  1AIR A;  1SM4 A;  2BY3 A;  2Y9Z A;  4KIG A;  3TL4 X;  2ZIT A;  2EV0 A;  4WWV A;  2NS0 A;  5D5V B;  3CCE B;  4HRI A;  2VFP A;  4J19 A;  4V2G A;  2RV8 A;  3FXK A;  3CO7 C;  1XGO A;  1KK1 A;  1A36 A;  1YRN A;  1QFZ A;  4BKX A;  1QGA A;  4PJ0 C;  2DPU A;  1D2E A;  1GDT A;  2A6H F;  4G8X A;  3OYE A;  3H36 A;  2DQL A;  1T38 A;  1BLI A;  3BY1 A;  2V6E A;  2C4T A;  5CJ9 A;  3LSP A;  2ZBV A;  5KCM A;  1J9Z A;  1XSV A;  3GVJ A;  3JAM Z;  3GZ6 A;  2Y75 A;  3OS0 A;  2B7E A;  2PN6 A;  2LK2 A;  4D7N A;  3IKT A;  4LLN A;  2LOO A;  2Q6K A;  4HF0 A;  1WPC A;  1NB9 A;  1KON A;  3DTI A;  4PJJ A;  2E2H J;  3KEO A;  1Z77 A;  2CFO A;  5GAE J;  4CCK A;  2V7W A;  4Q7J B;  3AVW A;  3SDG A;  4E70 A;  5FLX Z;  1T2K A;  2DO7 A;  1JKO C;  2J8K A;  2O0V A;  2BN4 A;  1DQU A;  4UV9 A;  2CW0 F;  4NHJ A;  3GF2 A;  3TQN A;  2F1M A;  4M9S A;  2Y0M A;  3BC8 A;  4KIC A;  2CK3 A;  1IRF A;  3C2H A;  1GQ8 A;  3ECO A;  3RQI A;  2XTY A;  3FXR A;  1WSR A;  1XGS A;  3M07 A;  2XAH A;  3K4N A;  3LAP A;  2JA5 J;  4GDF A;  3OAA A;  5IYC J;  3G05 A;  2DA1 A;  4NBQ A;  2YX7 A;  2Y31 A;  2F4N A;  3SJP A;  1STZ A;  5IK2 A;  2P5K A;  2V1N A;  3KP7 A;  1XSD A;  1TQP A;  3T9G A;  2CQX A;  4P9U A;  3DKY A;  1JT6 A;  1QNT A;  2IGM A;  2Y2Z A;  4KIF A;  3DLL F;  1ZGW A;  5FFZ A;  5D8L B;  1HA3 A;  2HMA A;  3SJZ A;  3ZSC A;  3L2R A;  5FLX K;  1WXR A;  2AQE A;  3VFZ A;  1W0T A;  2XC1 A;  2EZK A;  2JT1 A;  2KP6 A;  2ZJQ F;  3KP6 A;  3J7A Y;  2BW3 A;  4BS9 A;  3TED A;  5IOY A;  4ZYE A;  2R5Y B;  2JQ7 A;  3E20 A;  3PET A;  5FB2 A;  2EH3 A;  4OJO A;  2CUE A;  3V7R A;  1OLT A;  2ZZG A;  2W00 A;  2PFB A;  2PBI A;  4R79 A;  4AVZ A;  3ZUG A;  2IGN A;  2MD5 A;  3HHH A;  1U5T C;  2ZFU A;  1G3Y A;  1K8A D;  2MLG A;  3TGN A;  2CG4 A;  4BNC A;  4HOB A;  3HOS A;  4UVC A;  2QXZ A;  1LDD A;  4Z4S A;  4DK0 A;  3CCM B;  4MTE A;  3ZXS A;  3E6C C;  4X0C A;  1T56 A;  1ZKG A;  1D8T A;  3WBJ A;  3G3Z A;  3ABL H;  1O7F A;  2CND A;  1BR4 A;  4CCN A;  1CNE A;  5E3N A;  3L2V A;  3PNV A;  4XLA A;  4M3D A;  3G1L A;  2FX3 A;  1WJF A;  5LMZ A;  2QKL B;  1MNM C;  5JLW A;  5D5X B;  5IT9 K;  4OPS A;  3HSF A;  1N75 A;  2XND A;  3DPU A;  4UAJ A;  2YWG A;  3DTK A;  1P9Q C;  2V6C A;  1WGX A;  2RN7 A;  2HTJ A;  1W7P A;  1WSV A;  1VQO I;  3WTU C;  4WXD A;  5GAG J;  2DDB A;  2LY1 A;  2VE8 A;  2JSP A;  3OYH A;  2E1B A;  1ZRE A;  4DNR B;  4PC6 A;  5F4O A;  1ZG5 A;  5CVR A;  2XVC A;  4RPD A;  3FF5 A;  4QVJ A;  2M34 A;  4YIF A;  3CCJ B;  5E17 F;  4PC7 A;  3N05 A;  2CU7 A;  3S1M J;  3E1S A;  1JB9 A;  3GVL A;  5H2F C;  4HV6 A;  5K7H A;  3GTL J;  1F43 A;  4OP7 A;  1BIB A;  4F91 B;  3OSF A;  5L3C A;  1I8D A;  1KK0 A;  3CCJ I;  4FIS A;  1TL8 A;  1W34 A;  2W85 A;  3CCL B;  4I09 A;  2E34 A;  2HVQ A;  1KK2 A;  3B73 A;  3CCV B;  2M0M A;  4EJT A;  2NVQ J;  1ETY A;  1QGZ A;  1IN4 A;  3ONQ A;  4R8H A;  4A3B J;  3W5U A;  1XX5 A;  4RGX A;  3BJ6 A;  1XN7 A;  1XMA A;  2WB1 A;  4HPQ A;  3CC7 B;  5F0F A;  4BY1 J;  2R5Y A;  2NVY J;  4A3D J;  2YPR A;  3E0J B;  3HKZ N;  1O8D A;  3R60 A;  3R0J A;  2ME0 A;  3L09 A;  3AG3 H;  2LYC A;  1IJE A;  3CC4 I;  1K4T A;  2JN6 A;  3RCO A;  5CVJ A;  2DIE A;  3DPT A;  2STW A;  1VFC A;  1SFU A;  2JDI A;  3FY3 A;  2DLL A;  4MQV A;  1MIJ A;  4BHB A;  5E3O A;  1ETQ A;  3CQZ J;  2XAS A;  4RAZ A;  5F04 A;  3TW6 A;  1JUP A;  4HLX A;  1U8B A;  3ZCO A;  1JA0 A;  2JJ2 A;  1K83 J;  3H9N A;  1R22 A;  1MMN A;  4YFK F;  2P7V B;  1H8H A;  4XK4 A;  3JRI A;  3JRA A;  4OMY A;  2Y48 A;  3K4C A;  2C78 A;  3PUF A;  2PIA A;  4ZYD A;  1L0O C;  4M9Z A;  2JA8 J;  1OFL A;  3OOP A;  3IP4 B;  2NZM A;  2F48 A;  2Q1Z B;  4E7J A;  2QZA A;  4O5V A;  1WOS A;  1WOR A;  4PFO A;  3I4M J;  3OS2 A;  2ZJR F;  1EFR A;  1HG8 A;  2LR8 A;  3SZP A;  2VKE A;  5EYR A;  2LRE A;  1J75 A;  1U78 A;  4P9S A;  4DBQ A;  3SLN A;  1PP8 F;  3ONU A;  1K4Z A;  1LFU P;  1P2F A;  4A3M J;  2RNG A;  1YQA A;  2DK5 A;  2VC0 A;  3LWF A;  1LFB A;  1G8X A;  3I5U A;  3OR2 C;  2YU9 J;  3G71 I;  3LST A;  5FO5 A;  1QQI A;  5F0C A;  2FQ3 A;  4HBL A;  2ZFW A;  2ZNZ A;  3MFK A;  3EUH C;  2O0Y A;  3I56 I;  3HOV J;  1E43 A;  5L3G A;  3BG9 A;  4IHT A;  4ACB A;  4W97 A;  2L9N A;  2X1C A;  2UWM A;  2XF7 A;  2M5W A;  1NHA A;  1E63 A;  2OU2 A;  2IRF G;  1MJA A;  3V8J A;  1WU8 A;  4JMQ A;  1AHD P;  1DBO A;  5HOD A;  2XSD C;  2HVS A;  5KAF C;  2XRL A;  4OOS A;  1QPM A;  2MH9 A;  3EQN A;  1FOW A;  4P26 A;  2E5Z A;  1ELO A;  4JRA C;  2CV2 A;  1JGS A;  1MBH A;  3SZT A;  1AWC A;  5HKK A;  3DBL B;  1P7I A;  2EBI A;  3D5L A;  1UEL B;  1HW5 A;  1WFX A;  5LRR A;  2D9R A;  1IN6 A;  3ESW B;  4TSF A;  3SYJ A;  3FXL A;  1OYI A;  2P8T A;  2VJ4 A;  4RAY A;  1BM9 A;  2QM3 A;  1N77 A;  1FP1 D;  5F1R A;  4Y9R A;  5KW9 A;  2ETH A;  3OYJ A;  1V5G A;  4XSX F;  1S3J A;  1WZ2 A;  1Q1V A;  2D45 A;  1BN5 A;  2GIZ A;  2M5S A;  3I56 B;  4CYC B;  3F8B A;  3FXQ A;  1DDI A;  2CQN A;  1XD7 A;  3NAU A;  3WNB A;  1OCT C;  4BDZ A;  1OGO X;  4XQF A;  1T6Z A;  1MDM A;  5A89 A;  1YIJ I;  1FSH A;  5GPA A;  4KUM A;  2GOX B;  4FWT A;  1HVX A;  3K9T A;  4RD0 A;  2GWR A;  2LVS A;  4LBV A;  4G6I A;  2QA4 I;  4Y52 J;  2AQF A;  1R4M B;  2L7M P;  2E19 A;  3FKJ A;  4WZK A;  1ZTR A;  2VIX A;  4NQW A;  3WND A;  2DTZ A;  3Q38 A;  4NNJ A;  1BL0 A;  2KPM A;  2ZJ2 A;  3HKZ A;  4CCM A;  3BPX A;  4DNC A;  4IO9 F;  2R92 J;  3A03 A;  2R5Z B;  2DMN A;  3ZQG A;  3QAH A;  4BJT A;  1B1B A;  2GK6 A;  4U9U A;  1S72 B;  4YZQ A;  3CZ6 A;  1BR2 A;  1FIA A;  3FIS A;  3F6O A;  5BSY A;  4LG0 A;  2ZO4 A;  1ZGA A;  3QYF A;  3ZR8 X;  4RD3 A;  2VT3 A;  5B6I A;  1R7J A;  4O6J A;  4RBO A;  3AVU A;  3OR1 C;  1FSE A;  4A3E J;  4TMT A;  3C3W A;  1Q7Y D;  2G0E A;  5J35 A;  4V19 K;  2M8E A;  4P1V A;  2GQQ A;  2Q0O A;  3HZJ A;  4J01 A;  3ZGK A;  2NNY A;  2EIJ H;  3Q6Q A;  4CZZ A;  3S1R J;  4URR A;  1R5N A;  5HVQ C;  3J81 Z;  1RUN A;  4XOP A;  1W35 A;  2LDU A;  5EZG A;  1H9G A;  1MD0 A;  3ZMS A;  5HLG A;  4ZGQ B;  3HOX J;  1GV2 A;  1XMK A;  1QPI A;  3PSF A;  3HIF A;  3A3B A;  3JRH A;  5ILS A;  1BR1 A;  3HGY A;  3QYB A;  3S2H J;  2QBY B;  1LE8 A;  4L0Y B;  3BZ6 A;  5EMN A;  3ZBT A;  1W4M A;  2XIG A;  1V55 H;  3OEH A;  3ZMT A;  2R5Z A;  3BPV A;  4PZJ A;  4I98 B;  3RPQ A;  1UD2 A;  3S3N A;  4C0S A;  2LH9 A;  4P6V F;  2Q6I A;  2YU3 A;  5M5Y J;  3VNV A;  5HS9 A;  1R1T A;  1OIS A;  2FU4 A;  1HXD A;  2WYR A;  2BM4 A;  3LFK A;  1JJ6 C;  2ZSI B;  3WQZ A;  1MND A;  5M5X J;  2HFH A;  4X1E A;  2MSY A;  4TMV A;  1XC5 A;  4M6X A;  4DYR A;  1T6X A;  1JTY A;  4ENK A;  1T95 A;  2CQK A;  2M7A A;  3RZO J;  2RC5 A;  3A35 A;  4XNF A;  4HX8 A;  4QFM A;  3VMF A;  2PJP A;  5JHU A;  2BGI A;  2E2I J;  3N4M A;  3K70 D;  1I27 A;  2FJ1 A;  5GTH C;  2XKP A;  3GW2 A;  3O3K A;  2A68 F;  3Q3A A;  4RDJ A;  1QZE A;  1J5Y A;  3LOC A;  3SFI A;  3U2Q A;  2HDC A;  3WWG A;  3BQJ A;  3T53 B;  3W2F A;  3KCC A;  4HST A;  4HAM A;  2BY2 A;  2LZJ A;  4EW9 A;  4XRF A;  1JHF A;  3L2C A;  1XGN A;  5J4V A;  3VMV A;  1WCM J;  3X2Q H;  1IDZ A;  3HTS B;  2F5V A;  2F5C A;  2PMZ N;  2Q2E A;  3LSK A;  4G9Y A;  3S32 A;  5BMZ A;  2GPJ A;  3SFZ A;  1CF7 A;  1U0J A;  4MR0 A;  4S0H B;  1IF1 A;  5BPD A;  1FTT A;  1OOC A;  4AM3 A;  3ML6 A;  4CYC A;  2BEO A;  1MNE A;  2PI0 A;  3BG3 A;  1TLH B;  4P5O A;  3F8C A;  2DMU A;  4PCQ A;  2XNC A;  4F55 A;  2R7T A;  1F9N A;  2JWT A;  3HDD A;  4ZGN B;  1I39 A;  2ECB A;  4CIC A;  4HX4 A;  4XRS G;  1FX7 A;  1I3A A;  1ZRC A;  2ODL A;  3BWG A;  2FQ4 A;  4WZE A;  5J40 A;  3GIR A;  3H0D A;  4IW3 B;  4UVA A;  4JX6 A;  1Z91 A;  2XV4 S;  5KHD A;  4Y7C A;  4E7L A;  2BHY A;  1D3Y A;  5ICG A;  4LMY A;  5EEG A;  2CW5 A;  1YW8 A;  5EEH A;  4RD2 A;  3WYA A;  1LNW A;  2NOJ B;  1I1S A;  2QN6 A;  3R6J A;  3Q39 A;  4YAF A;  1K73 D;  2G9W A;  2NS8 A;  2VPL A;  2BVM A;  4KA4 A;  4PAA A;  1H0M A;  3GFJ A;  3ZBU A;  2LF8 A;  1I7P A;  2UVE A;  4WCG A;  3CCQ I;  3KZY A;  1GV5 A;  3QOP A;  3GLL A;  4KNY A;  2QTL A;  4ZJZ A;  4BH9 A;  4BDY A;  4B3X A;  1TYV A;  3VR6 A;  2P81 A;  1GXP A;  1ZR2 A;  1UHW A;  3VYR B;  1BC7 C;  4W8T A;  5KVR A;  1YTY A;  2HDN B;  2DTR A;  1O3Q A;  4AC0 A;  1XSX A;  3B4N A;  1KZH A;  1GT0 C;  2VFO A;  5EEA A;  3F0C A;  4P22 A;  2VOP A;  3OWT A;  2EIK H;  2VKV A;  4IX7 A;  2PMZ A;  5GV7 A;  2Y30 A;  3GTK J;  3HSE A;  2XUB A;  3VOD A;  2PJR A;  1AU7 A;  3I1F A;  2HR3 A;  2YWF A;  3K4B A;  3OMY A;  1Z6R A;  5DYM A;  2O7O A;  4I02 A;  1OYW A;  1F4K A;  4H0E A;  4ZCL A;  5E3L A;  3BJO A;  3CMA I;  1S4M A;  2FXA A;  2JUC A;  4XLH A;  4M1K A;  2YR2 A;  3W2I A;  2EA2 A;  4MQ9 F;  1RPW A;  2COB A;  2XZO A;  4RLQ A;  3KRG A;  4PJM A;  2IW5 A;  5K5Q A;  1XTA A;  4UUT A;  1DU6 A;  1Y0Y A;  5IP9 J;  3K10 A;  4X7D A;  3MKW B;  4X6A J;  1G4D A;  1SD6 A;  3TOA A;  1ORK A;  1X1B A;  1IRX A;  3ZQF A;  2DFI A;  3HBL A;  1MMS A;  2E36 A;  3B82 A;  2Z9O A;  4DJA A;  1TZL A;  4MO7 A;  3HXL A;  5J8F A;  4GGG A;  2KJC A;  3BDD A;  3K4J A;  1FLI A;  3WOD F;  2F5E A;  3QRF F;  1XMX A;  2IP2 A;  3KX2 A;  2MA3 A;  5DDG A;  2M3A A;  2UVF A;  2DA3 A;  1YX3 A;  2IAI A;  1S6L A;  1U9O A;  1R4N B;  2CQ7 A;  5BQT A;  1IB4 A;  3WTV C;  1REP C;  2B0L A;  3WE2 A;  5HLH A;  1B8I B;  1X2N A;  2KRC A;  4BEH A;  5C1C A;  2D2W A;  2IA0 A;  4R71 A;  1RKW A;  1TYU A;  4AVP A;  3HB9 A;  3OS1 A;  2X6X A;  4H4K C;  4CCO A;  3BP8 A;  4XLP F;  2X53 S;  2DER A;  1TLL A;  3WY9 A;  1IC8 A;  2O9L A;  3LFU A;  3I54 A;  4GXO A;  2K85 A;  4ON0 A;  3SYT A;  1K61 A;  3LL7 A;  1O8H A;  5CYV A;  3CLO A;  2GAU A;  1N25 A;  1ETK A;  1MJB A;  1E79 A;  4G6D A;  2QSG X;  1E0E A;  3MN2 A;  1CZF A;  3ZIA A;  2DT6 A;  1EF4 A;  1ZHF A;  2KZG A;  2BHZ A;  3LVB A;  1AKH A;  3OL3 A;  2FF4 A;  4AID A;  2OK8 A;  3HL2 A;  2C4U A;  3LQE A;  1EZG A;  1TNT A;  2ESH A;  4RAG A;  1A5J A;  4KN7 X;  1EA0 A;  4PSW A;  1R5G A;  2FOK A;  3PL8 A;  1UAA A;  4UZU A;  3BCB A;  4OU0 A;  3NAR A;  2DJN A;  1YG2 A;  3IWF A;  1IDK A;  1ITY A;  1B8I A;  1B72 A;  1ZM4 A;  3KP2 A;  3E1Y E;  2TDX A;  1X3W B;  1PXZ A;  3K7A J;  1SVO A;  4RAF A;  3OYL A;  2X6O A;  3MD2 A;  4L5E A;  1IZ1 A;  3T0Y A;  2CF4 A;  3S1Q J;  2B5O A;  2R7Q A;  2WTE A;  3FKS A;  1VQK I;  4G7W A;  2FBH A;  3G73 A;  2MFZ A;  4YRV A;  4LBW A;  1Z3Y A;  4Y4R A;  2R7R A;  2ELK A;  3EET A;  3JRG A;  3HOZ J;  4FTH A;  2EIX A;  2KIF A;  2QSH X;  4AC9 A;  4AF6 A;  3RQ4 A;  1D1B A;  2NT9 A;  1KU2 A;  3UNG C;  4L9T A;  1YJN I;  1ULY A;  3P7N A;  4OOI A;  1RR7 A;  2C77 A;  4KJZ A;  1P4M A;  2VBS A;  3F9K A;  4NK6 A;  3I71 A;  1YLF A;  1XDU A;  1MH4 A;  5EGO A;  3QU6 A;  4BGD A;  2RVC A;  1WHU A;  1G3W A;  2KIM A;  1O8L A;  1IV8 A;  1WJE A;  3K4L A;  1WJA A;  2JRM A;  3BR2 A;  4UVB A;  4FAS D;  4XM3 A;  1E3Z A;  2VBM A;  1MZB A;  1Q9S A;  5KSW B;  3H92 A;  1O8J A;  3CDL A;  3U6B A;  4U49 A;  3GO5 A;  4WZL A;  3FZV A;  1N07 A;  4DZJ A;  3PIP F;  2VNK A;  3P26 A;  2ID6 A;  1KU9 A;  3BCD A;  3CDH A;  4A6D A;  4IOA F;  2P5V A;  4LIT A;  3VSK A;  3QFR A;  1V0E A;  2IGK A;  2DMP A;  3E5Q A;  5F0H A;  1EFU A;  3GQ8 A;  1XG1 A;  1LVK A;  3K1M A;  3DBH B;  1JRG A;  2QYO A;  1O8E A;  2O3F A;  3CCR I;  1W5C C;  4XMY A;  2VBT A;  1WOP A;  2WAQ N;  4G7H F;  1J09 A;  2DDA A;  4XLC A;  3LQQ A;  3CCM I;  4A3K J;  3QU3 A;  5D5W B;  4L9N A;  1IB0 A;  1QQ1 A;  4LK0 F;  4X0G A;  3JQR A;  4LC0 A;  2OTL B;  2QDX A;  2INU A;  2UUZ A;  4G94 A;  4M0L A;  1SEU A;  1VF7 A;  1X1D A;  1YI2 B;  3T8R A;  3PA2 A;  5FIU A;  1B6A A;  2LKP A;  3RKQ A;  2OBT A;  2BM6 A;  5IYQ A;  3BNW A;  4BAC A;  3H94 A;  2EV5 A;  2BBY A;  1GVD A;  1X2M A;  3K4K A;  3OIP A;  1Q1H A;  4PGG A;  2ZZQ A;  2QSF X;  1T08 B;  1WTH D;  2XT4 A;  5E1Z B;  4S05 A;  2IS1 A;  2DMQ A;  2R7Z J;  4I99 C;  4DK1 A;  3FXO A;  3I64 A;  1GAW A;  2PX9 A;  3QYE A;  4ZDP A;  4ZZD A;  5M3M J;  4M53 A;  4B47 A;  3BTJ A;  1HKQ A;  1VZ0 A;  3V4G A;  5JFR A;  1T0F A;  1MBF A;  5LBQ A;  1TWH J;  1UMK A;  2EFG A;  3MMP A;  1DBG A;  4JYK A;  5THX A;  4OJ5 A;  4OM9 A;  3FBI B;  3J80 Z;  1OGJ A;  1K28 D;  2MGQ A;  4DQL A;  2CUJ A;  1NH3 A;  2B7C A;  5IYW A;  1QA6 A;  2M4K A;  4HE6 A;  2CGP A;  3LMM A;  3S3M A;  2CRG A;  3BQZ A;  1CF7 B;  3UR3 C;  2LFB A;  2Q2E B;  1WRJ A;  3BR6 A;  4OZY A;  1DAB A;  3SXY A;  3KLO A;  2F5D A;  4PK4 A;  1MBE A;  3PA1 A;  4XRS A;  3FM5 A;  2RDP A;  1TWF J;  3KE2 A;  5J4Y A;  2HS5 A;  2F4I A;  3HHG A;  4LBZ A;  2QWW A;  4YZ0 A;  4E7H A;  2O8X A;  3OY9 A;  4BQA A;  2K9L A;  3GVA A;  4C2L A;  4BBR J;  4QSH A;  3FX3 A;  1I50 J;  2D3N A;  3A01 A;  1ETO A;  5DSZ A;  4D7M A;  3D1N I;  1HSJ A;  3AVV A;  5J3O A;  2ZL6 A;  3L7W A;  2LY2 A;  1K8F A;  1I5Z A;  2RKH A;  4N0B A;  1YFH A;  3LA7 A;  4LB6 B;  2QZ8 A;  3CTA A;  4CSW A;  3EUK L;  2X6W A;  2IVM A;  2JUG A;  1IV6 A;  5FRN A;  4PSX A;  4AIJ A;  3QFC A;  2CMP A;  2DJI A;  1HKT A;  2E1C A;  3CLQ A;  5E18 F;  4IF4 A;  4KIS A;  1VLO A;  5E1X A;  3TH0 A;  2J8I A;  5IPA A;  3VMW A;  1XB2 A;  4A12 A;  3MZH A;  5EGO B;  3ELK A;  4M4S A;  3HRU A;  2VNH A;  2BV6 A;  2V4J C;  2KIS A;  4PGH A;  1YIT I;  4PDK A;  1BC8 C;  5HLT A;  3CP8 A;  1QJV A;  3PFI A;  4W8Q A;  4LK1 F;  4YHB A;  3A0B C;  3P9I A;  1IN8 A;  4CA0 A;  5F08 A;  3CB4 A;  2PLY A;  2XZP A;  4GQN A;  3GQ9 A;  2XAU A;  3LQR A;  4MEY F;  5CQE A;  1ZH5 A;  5K5O A;  3WTT C;  5J1U A;  4Z4Z A;  1Y0N A;  2WAE A;  5D5U B;  2OZU A;  4BYY A;  2CW8 A;  3HOT A;  1OHH A;  2IBD A;  2HLD A;  5DCF A;  2V7V A;  2VBW A;  2IA1 A;  4YII A;  2IJL A;  3H09 A;  4RS8 A;  1Y1V J;  5LGT A;  3CUQ C;  4F52 A;  2XAQ A;  1MJ9 A;  1OCP A;  2O61 A;  5D4R A;  4QTR A;  1NBM A;  1UG2 A;  2L7F P;  3C2G A;  2D1V A;  2MC3 A;  2X3H A;  3WTZ A;  5E8I A;  3JSP A;  1PLU A;  2KKO A;  1BI3 A;  2AS5 F;  1LPQ A;  1XG2 A;  4YDT A;  3BT9 A;  4YAW A;  2OTJ B;  5LGN A;  3D0S A;  2H1K A;  1G7C A;  2DMT A;  1ZM3 A;  2PYG A;  2DOD A;  1IXR C;  3E6M A;  1VND A;  1WSU A;  2NTQ A;  5IT3 A;  3ZQC A;  3Q0U A;  4C3I J;  2UXN A;  3ULQ B;  4UY8 I;  1GLN A;  2IA2 A;  2TRT A;  1ZR4 A;  4XL9 A;  3GTQ J;  4MGR A;  1UHM A;  4RB2 C;  2OTJ I;  2VNI A;  3OYB A;  1FBU A;  1FRQ A;  4ZZL A;  1BA5 A;  1FND A;  2VNJ A;  2YUH A;  4LG3 A;  2DAO A;  3B6C A;  1MDM B;  2IS4 A;  2AHO A;  1QVG B;  2DY1 A;  1FZP B;  1GVJ A;  2VQL A;  1YJ9 B;  3VSL A;  5LGU A;  4DGW B;  3CJN A;  4XSZ F;  3V76 A;  3JTH A;  2BYV E;  1J2X A;  3DKX A;  1S5L C;  2VLA A;  2K9S A;  2OAZ A;  2VBU A;  4O3M A;  1OCR H;  2ZJP F;  4P3I A;  1UB9 A;  1SD7 A;  1OFM A;  4EEF G;  2IS6 A;  1VQP I;  4Q48 A;  2W57 A;  4ASU A;  3OOC A;  2DA5 A;  2FE3 A;  4HV5 A;  4FHT A;  5ILU A;  1O4X A;  2OA4 A;  3O2P E;  3KZI C;  1SAX A;  1GR1 A;  3EQO A;  4IXA A;  3IAM 2;  3PQJ A;  3VSV A;  1OCZ H;  4PFP A;  4L5I A;  2MBF A;  4D9J A;  4MEX F;  2CWE A;  1W2B B;  2XSJ C;  1ZRD A;  2EJR A;  3J80 K;  5GV8 A;  5H20 A;  1PUF B;  2H1L A;  3JU4 A;  1U9N A;  3GSI A;  3ABM H;  4RGU A;  3R0A A;  1I6H J;  3IRQ A;  4IOC F;  2ME6 A;  4RLF A;  2DQR A;  4XOR A;  2F4M B;  1OYY A;  1UD4 A;  5CVV A;  2NST A;  4MLO A;  3W6V A;  3MCA A;  4Y9U A;  4G1B A;  4CO8 A;  4CCJ A;  2BVL A;  1LEA A;  1ETV A;  2X6Y A;  2HZD A;  2B0R A;  3FBN B;  3BTI A;  2MH2 A;  4GFB A;  1QZZ A;  1JGG A;  2O17 A;  2HTS A;  4F93 B;  2L9V A;  4ESJ A;  1OR7 C;  5LRS A;  1S7E A;  2QEX I;  5J47 A;  1UHS A;  2RAE A;  4RB0 A;  2L5Q A;  2X85 A;  1OFC X;  2Q6O A;  2E1O A;  4PGO A;  4I01 A;  2LNB A;  4OAZ A;  3BG6 A;  1QVF B;  3CF5 F;  4FT8 A;  2Z8G A;  1CGP A;  3ERM A;  4QWQ A;  4ZCM A;  5TRD A;  3BRO A;  3A02 A;  4L0Z B;  2DFE A;  2HXI A;  1N05 A;  2M2E A;  4DBR A;  4Q47 A;  3GTP J;  1ENH A;  3D5R C;  3GEZ A;  3QWL A;  3BC9 A;  1Y6I A;  4TMZ A;  3WXM A;  4WWC A;  3QPS A;  4YC5 A;  2ZB9 A;  2FEZ A;  2V7F A;  5LFA A;  3W2A A;  5A2Q Z;  2X3U A;  4OJ6 A;  3ZQQ A;  2BY0 A;  4DQ2 A;  1T5E A;  1Q81 D;  3GTO J;  2EFN A;  4M74 A;  5DNS A;  5JI6 A;  1TQM A;  1GO2 A;  4MNU A;  5FFX A;  3SHF A;  3QP5 A;  4A3L J;  4YEL A;  2CSO A;  2GXA A;  3M4O J;  3KET A;  3MAJ A;  3H5R A;  1B59 A;  1O57 A;  3EDP A;  2ISY A;  1I3Q J;  2LTP A;  2N8G A;  2X51 A;  4LIV A;  3ZQL A;  5DS0 A;  5BSX A;  4YFN F;  5K5R A;  1QGY A;  2WAD A;  2K86 A;  3GYH X;  1JUS A;  5HZB A;  3TKY A;  2L7Z A;  3CDI A;  3T5X A;  1IUF A;  3K1N A;  3WE3 A;  3JRB A;  3SJM A;  1ZAO A;  2C5B A;  1IA5 A;  3JTG A;  1Y1W J;  1H42 A;  5CPR B;  2NPF A;  4MYT A;  4YIR X;  5HNH A;  1XFO A;  1FNM A;  3AGQ A;  3DWL E;  1G3S A;  5DM6 F;  2UV1 A;  1APL C;  3NB2 A;  3ONY A;  1KTV A;  4IQ4 A;  4N3N A;  5C4X J;  2WPD A;  2O03 A;  2BM0 A;  5AIQ A;  1G7S A;  3W2V A;  4AF7 A;  4N3G A;  3FHZ A;  1V5F A;  1NB0 A;  2HI3 A;  3DEE A;  3KP3 A;  1SAN A;  2B9S A;  4HNU A;  2XRN A;  1IAW A;  4GYG A;  2E1R A;  2X0K A;  3H3Z A;  2HOA A;  1BW6 A;  4S04 A;  2HVR A;  4B8X A;  4G7Z F;  3VWB A;  3RIQ A;  2ECC A;  1UJ8 A;  2WV0 A;  2PG4 A;  3CMY A;  3OPO A;  5GAD J;  5F4M A;  2VQC A;  1KK3 A;  1W36 D;  3OW2 B;  2NS7 A;  1E3X A;  3H3U A;  1Q86 D;  1W0J A;  2EIN H;  2WY7 Q;  1W7P B;  2DW4 A;  3KFW X;  4WZT A;  3E97 A;  1EH6 A;  2AO9 A;  3JUR A;  1D0Y A;  3O6B B;  3ISP A;  4UZF A;  1V5E A;  1U2R A;  4PAB A;  3IC7 A;  4ZCI A;  2HOE A;  3G4S I;  1B9N A;  4OIQ F;  4BHC A;  4XKB A;  2AHQ A;  5E1W A;  3Q3S A;  5FRO A;  3MHP A;  3OJX A;  3NEU A;  2BOL A;  3FPK A;  1K5C A;  2V7T A;  2BM1 A;  4A93 J;  3E3V A;  5LLQ A;  2BGC A;  2ELH A;  1FBQ A;  5JLX A;  4BQO A;  2O5R A;  3M8J A;  1TC3 C;  5FJ8 J;  4CGZ A;  3LSI A;  2EIM H;  3ERE D;  1UMQ A;  2CO5 A;  3Q0W A;  2C2W A;  3CMA B;  3G6E I;  3V42 A;  1QH0 A;  1O8F A;  1E3H A;  3FXM A;  2EIL H;  3BH6 B;  1OJL A;  1G3T A;  2LBF A;  5H6R A;  2CQQ A;  4RCY A;  2CV1 A;  1WI3 A;  2MD0 A;  2Y69 H;  2FNA A;  4M73 A;  1IJF A;  4CDG A;  4NK8 A;  1KYW A;  4Z1M A;  1BOB A;  2P5L C;  3S93 A;  1W5S A;  1B4A A;  2FA5 A;  1NTC A;  3ZP5 A;  2VKD A;  1QVT A;  5JR3 A;  1PYV A;  4LLG F;  5E3M A;  2D3L A;  2W6J A;  2KLO A;  1EFT A;  2R9V A;  3NAW A;  2LBF B;  3OYN A;  2W4S A;  1R36 A;  2XHK A;  5CKT A;  2X4H A;  3KLN A;  4LJZ F;  3WTY C;  4TN1 A;  4CYD A;  3T56 B;  5FKM A;  1VHE A;  3M3Y J;  3ASP A;  4CZC A;  3MEX A;  4LD5 A;  1HW2 A;  2WWY A;  4YXW A;  1XDS A;  4RMN A;  1HF0 A;  4A2U A;  2D5V A;  4XIC A;  2VN2 A;  4A69 C;  2PJR B;  3IUO A;  2XRO A;  4ZDO A;  1VQ8 B;  1VTN C;  5E20 A;  1QFY A;  3JW4 A;  5FKN A;  5BS6 A;  3V7A A;  3A01 B;  5E6T A;  3HOY J;  4OPO A;  4RCZ A;  1WPK A;  4NQW B;  5A8A A;  3GRH A;  3S16 J;  1ZLK A;  1MGT A;  1FYM A;  2QKM B;  1X4P A;  4IL6 C;  5FKO A;  5H5J A;  1QG0 A;  1WP6 A;  4HIZ A;  4ASN A;  3NWT A;  2W24 A;  1FTZ A;  2R0Q C;  3WNC A;  2BXY A;  1FT9 A;  2JA2 A;  5FNZ A;  1U6G A;  4IKF A;  4BQQ A;  1IRG A;  3LMW A;  1A04 A;  4NC7 A;  1H88 C;  2GXG A;  1D0Z A;  1I6X A;  2KMU A;  3K1P A;  2MYS A;  1KCC A;  2IEK A;  3CUO A;  4RD4 A;  4A3J J;  3OL4 A;  1DPU A;  1K7A A;  4EH1 A;  3TP3 A;  5KAI C;  2RQP A;  4C3J J;  4JX5 A;  1MMA A;  5IOZ A;  4L18 B;  1PE9 A;  1BJK A;  1FOY A;  1WH7 A;  1HF2 A;  4HF2 A;  3S2D J;  2D74 A;  3KEW A;  3G71 B;  3C1D A;  2BV3 A;  2G7U A;  3MZY A;  2B63 J;  4M2L A;  3OYC A;  3AG2 H;  2Z99 A;  3WG9 A;  2L2O A;  2XZL A;  3SZE A;  1YIJ B;  1SMT A;  3BOQ A;  2R7S A;  2OCE A;  4G6T B;  3WG7 H;  1F1Z A;  4EJW A;  4KIT B;  4U0Y A;  2NRA C;  5C1E A;  4KMU X;  1Z21 A;  4PMH A;  2HKO A;  4K1X A;  4Z06 A;  4IJA A;  2H8W A;  5LHH A;  3H9J A;  1G7R A;  1YJN B;  1UCR A;  1WH5 A;  2XPU A;  2M0C A;  3LSR A;  1QBJ A;  1WWX A;  2VOD A;  1TT0 A;  4GRI A;  2FUG 2;  4BL0 B;  2H27 A;  2V9K A;  3H0G J;  2P0W A;  1IDJ A;  2INV A;  3MKL A;  3WBK A;  3NWS A;  3W5V A;  4HNT A;  2VBY A;  3ASN H;  1OR7 A;  2M4G A;  4KT5 C;  1VHO A;  4G1V A;  4IPA A;  1EJ9 A;  4BXX J;  5DD4 A;  1YHQ B;  4YEJ A;  4P55 A;  1TQI A;  2HU9 A;  1R5B A;  3ABU A;  1NHC A;  4FN5 A;  1PP7 U;  2ICW G;  3FWE A;  1YX2 A;  4UZE A;  3SQN A;  2M45 A;  1IW7 F;  2DYR H;  5L3F A;  2Z33 A;  1K78 B;  4A0Z A;  3O8G A;  3PNY A;  1YHQ I;  3BH4 A;  3PUN A;  2ID3 A;  2VQG A;  3CCR B;  2MLK A;  3RTR A;  3ZOB A;  3GQB A;  4M6V A;  4FK8 A;  1WI9 A;  2K9M A;  2KIQ A;  3CCS B;  3BH7 B;  3NRV A;  1H85 A;  3SY2 A;  4XLN F;  5FD5 A;  1S72 I;  5IT9 Z;  2ZTG A;  4NCN A;  4WQM A;  1LB2 A;  1Z3X A;  1LEB A;  1EV7 A;  2X48 A;  5H59 A;  1KQS B;  1TSP A;  3I55 B;  3VPR A;  3M8E A;  4HYE A;  1G59 A;  2R7D A;  3QPH A;  4A3I J;  1VQL B;  3R61 A;  1PVE A;  1X3Z B;  3G1O A;  4A6E A;  4B4C A;  4LGW A;  1Z67 A;  4NDL A;  4Z2Y A;  3BR0 A;  2K9N A;  3FKI J;  4E0F A;  1RWR A;  4YAU A;  1D5V A;  4B3A A;  4ZH4 F;  1ETX A;  3OV8 A;  1F36 A;  2YX4 A;  2Y0S N;  1VQL I;  4U4B A;  1N06 A;  2XGC A;  4I0A A;  5ERI A;  4BUP A;  1JHH A;  1FC3 A;  4W8S A;  1ZLJ A;  2HWV A;  3FPP A;  2K5C A;  1T8I A;  2NAZ A;  5LD2 C;  3KEY A;  3U1K A;  2XF5 A;  1PJ7 A;  1N0U A;  3CCS I;  3GTG J;  3JSO A;  3MZ8 A;  2WZN A;  3J81 K;  3A8K A;  1TYX A;  3PM1 A;  1RZ4 A;  5IYN A;  1LLZ A;  4K2E A;  3A2K A;  2KZV A;  2WY8 Q;  1S7A A;  2BY1 A;  2M7B A;  1JKP C;  2IGO A;  2NVX J;  2GJK A;  2WB1 N;  3FJO A;  3CRZ A;  1EKE A;  1VI0 A;  2GQF A;  1NDH A;  3AGP A;  3BCF A;  2DT7 B;  2QTZ A;  3F22 A;  1FDR A;  3AG4 H;  4XKW A;  4I2O A;  3GFL A;  4NB5 A;  3KYL A;  3ASR A;  1SD5 A;  1BJZ A;  5EJC A;  1KU7 A;  5A2Q K;  3CUQ A;  3HPG A;  5HNF A;  1H8A C;  1EWY A;  2AXT C;  1FIP A;  4AU7 A;  4P2N A;  3JQP A;  3CES A;  2XOK A;  1PJR A;  3CW2 A;  4L8J A;  4OJP A;  5DV5 A;  3VYU B;  1R1V A;  2DOE A;  4JOM A;  3OSG A;  4GCV A;  1XE1 A;  1LQ1 A;  5EF6 A;  1RRJ A;  3SEZ A;  2WR8 A;  4IRG A;  1OKR A;  3ASS A;  3E6D A;  1ONV A;  4IRH A;  4N9H A;  3U9G A;  3DBR B;  1R58 A;  2V26 A;  3EUA A;  1BBY A;  5JLV C;  1UZC A;  3OYF A;  4BHP A;  5DS9 A;  3DV8 A;  3JX8 A;  1TP4 A;  3FHN A;  6PAX A;  1X3U A;  4JP0 A;  4AYB A;  5TIS C;  3AL0 C;  1JI8 A;  2K3F A;  4LLL A;  3BR3 A; 
#chains in the Genus database with same CATH homology
 1X1A A;  4YZ0 A;  4E7H A;  3OY9 A;  3CP2 A;  2HVQ A;  2K9L A;  4C2L A;  2LRD A;  2M0M A;  2R4G A;  3AFH A;  3ONQ A;  3AL0 B;  3H9G A;  3ZPP A;  3DLA A;  2D3N A;  2WB1 A;  4HPQ A;  3PJR A;  4TKO B;  2LY2 A;  3E0J B;  1O8D A;  4CSW A;  3EUK L;  3OIQ A;  2X6W A;  5FRN A;  2JUG A;  2LYC A;  4E6K G;  3L2Q A;  4PSX A;  3RCO A;  2DIE A;  2ZZF A;  3DPT A;  2CMP A;  2DJI A;  4HSR A;  1BPL A;  3LSH A;  3MKY B;  4KIS A;  2JDI A;  3FY3 A;  3K4M A;  2O1D A;  4U87 A;  3A3G A;  1S9H A;  2LC2 A;  3VMW A;  2JJ2 A;  1X19 A;  2LG4 A;  1WJC A;  3ZCO A;  1MMN A;  2V4J C;  5KNL A;  1H8H A;  3K4C A;  2ZZE A;  2X1E A;  3U21 A;  1O8I A;  4BQN A;  3CP8 A;  5HLT A;  1QJV A;  1UG0 A;  1OFL A;  5CDF A;  4W8Q A;  3IP4 B;  2NZM A;  2Q1Z B;  4CA0 A;  4E7J A;  2XZP A;  4GQN A;  4PFO A;  3GQ9 A;  1EFR A;  2XAU A;  4PUS A;  3OS2 A;  5CQE A;  1HG8 A;  2LRE A;  3H5N A;  3RPU D;  3OYA A;  1DP3 A;  2NTP A;  2CW7 A;  2WAE A;  3PUB A;  4DBQ A;  1T0F C;  2CW8 A;  3HOT A;  1QU3 A;  1OHH A;  2HLD A;  2RNG A;  4OJL A;  1O8K A;  3TMO A;  3OR2 C;  1G8X A;  3OYI A;  3H35 A;  2W82 A;  2HQA A;  4F52 A;  2PEC A;  2MAB A;  3EUH C;  1K6Y A;  2WBM A;  1E43 A;  3C2G A;  1FX0 A;  1NBM A;  4B3F X;  3CF2 A;  2X3H A;  2L9N A;  1UD5 A;  1H80 A;  1QHG A;  2X1C A;  2IS2 A;  2UWM A;  4DNT B;  2XF7 A;  1O8M A;  1PLU A;  1XG2 A;  3B90 A;  3OYK A;  4ITV A;  3W2W A;  4E7I A;  1LKX A;  4JMQ A;  2PYG A;  2V4D A;  1DBO A;  2NTB A;  2NTQ A;  3GQ7 A;  4YZX A;  2HVS A;  3OPO A;  2Z2S B;  1GLN A;  4E4H A;  3W3C A;  3EPZ A;  3EQN A;  2E5Z A;  3OYD A;  4XL9 A;  4E7Z A;  2CV2 A;  3OYB A;  3D5L A;  4CCL A;  1Y56 A;  1FMW A;  1UEL B;  5HKK A;  4TSF A;  1WFX A;  4LG3 A;  1NG7 A;  3OYG A;  3RSN A;  2VJ4 A;  1N77 A;  2IS4 A;  3OYJ A;  2VQL A;  1EE6 A;  5JHF A;  1V5G A;  3G2B A;  3VSL A;  4BE0 A;  2M5S A;  4DGW B;  4U7B A;  1AA7 A;  3HUG B;  2VKH A;  3DKX A;  2VLA A;  4HG2 A;  3K70 C;  1H8E A;  3PNT A;  1VJS A;  3SEQ A;  4BDZ A;  4XQF A;  1OFM A;  1OGO X;  2OC6 A;  3CJQ B;  2IS6 A;  1SFK A;  4ASU A;  3OOC A;  2K3P A;  2GOX B;  1HVX A;  4C2T A;  3EQO A;  2RQQ A;  3IAM 2;  3BCA A;  2HNH A;  4PFP A;  4G6I A;  3VSV A;  2AQF A;  4D9J A;  3BLY A;  3FKJ A;  2XSJ C;  2BW3 B;  1BHE A;  2VIX A;  4N4O B;  4XLF A;  5HOO A;  3JU4 A;  3PFY A;  4NNJ A;  3S3O A;  4RLF A;  4XOR A;  4B48 A;  1D1C A;  1UD4 A;  2KPM A;  3SDB A;  3HKZ A;  3OE7 A;  2NST A;  3LSM A;  4MLO A;  4EAT A;  4CCM A;  4CCJ A;  2BVL A;  4DOZ A;  1BN8 A;  4Y33 A;  1X1C A;  2X6Y A;  2GK6 A;  2HZD A;  2VJ5 A;  4BJT A;  4YZQ A;  1DGW Y;  3FBN B;  4IQJ A;  3CZ6 A;  4XR6 A;  1W9X A;  5DN6 A;  1BR2 A;  3I9V 2;  2L7K A;  2O17 A;  3HG9 A;  4F93 B;  2KDO A;  1OR7 C;  2VJI A;  4KT6 A;  3DTE A;  3QYF A;  3ZR8 X;  1MMG A;  2L5Q A;  3DU5 A;  3OR1 C;  3OEE A;  2X85 A;  2GJP A;  4QPO A;  4J01 A;  4OAZ A;  3ZGK A;  3BG6 A;  4XLE A;  4URR A;  2Z8G A;  2ELJ A;  5HVQ C;  4XOP A;  3T51 B;  4ZYA A;  1EA3 A;  3H5A A;  1COW A;  2KL4 A;  2DXI A;  4DBR A;  3PSF A;  3D5R C;  3A3B A;  3BC9 A;  1Y6I A;  4RM2 A;  1JTA A;  3AKZ A;  1BR1 A;  3QYB A;  2R7O A;  2MC4 A;  3GQA A;  2V7F A;  3UW0 A;  4G7X A;  5LFA A;  4OWR B;  1QHH D;  3W2A A;  2E1M B;  4J00 A;  1UD6 A;  3OEH A;  4OJ6 A;  2JJ1 A;  3ZQQ A;  1T5E A;  1UD2 A;  3S3N A;  2KVO A;  2LH9 A;  2DCE A;  3M1C A;  2VJJ A;  3ZRG A;  4ZTF A;  3QOD A;  4YEL A;  2WA0 A;  1OB0 A;  3QOE A;  3FDY A;  2GK7 A;  4NUB A;  4ZC3 A;  2ZSI B;  2HDW A;  1MND A;  3MMY B;  4B44 A;  3H5R A;  3WQZ A;  4OZZ A;  5TGT A;  2X51 A;  2L9S A;  4LIV A;  4MXN A;  2HPM A;  3ZPN A;  2WAD A;  4BJ5 C;  2KQR A;  1WJD A;  4ZDL A;  1YX5 A;  2KHM A;  3B8Y A;  1IA5 A;  3A35 A;  1T95 A;  1WJB A;  2M7A A;  4CUG A;  4XNF A;  3OW7 A;  4II2 A;  4Y3O A;  3VDX A;  2GOM A;  4RM3 A;  3K70 D;  5CPR B;  5HNH A;  1R6R A;  3WWG A;  2E1M C;  3DWL E;  4BE2 A;  1WMR A;  3T53 B;  2UV1 A;  1WJ5 A;  1Z7L A;  4HEA 2;  4HST A;  3GVK A;  2F6C A;  2CS3 A;  4DIQ A;  4IQ4 A;  2LZJ A;  4EW9 A;  2WPD A;  3W2V A;  2VBE A;  3VMV A;  1V5F A;  4FET A;  4NC8 A;  3DEE A;  2X1D A;  1MMD A;  3VST A;  2F5V A;  3LSK A;  4HNU A;  2I8D A;  1SKY B;  4KKS A;  3S32 A;  2QY1 A;  3PSI A;  3VWB A;  1U0J A;  2HVR A;  1KTW A;  4MR0 A;  4XKC A;  4JQF A;  1OOC A;  3S8P A;  4BE1 A;  4XN3 A;  2ZXI A;  1MNE A;  2VQC A;  1NRK A;  4P5O A;  1W36 D;  2F43 A;  1RU4 A;  4F55 A;  2R7T A;  1E3X A;  1W0J A;  2WY7 Q;  3OFN A;  3DU6 A;  2HPI A;  4CH7 A;  3JUR A;  2ODL A;  1D0Y A;  3OYM A;  2O0W A;  1I18 A;  4XOT A;  1V5E A;  2VBK A;  3H0D A;  2ZSH B;  4OAY A;  1X0C A;  5KHD A;  4XKB A;  5FRO A;  4E7L A;  4XN0 A;  5AMV A;  2BOL A;  1K5C A;  2XDV A;  5FRM A;  1FMV A;  1UD3 A;  4YZA A;  3IAS 2;  2Z1D A;  4XKV A;  2W1O A;  2NOJ B;  3TBI A;  4BQO A;  2X8K A;  2WZP P;  3SUC A;  3VSU A;  2O5R A;  3M8J A;  4XON A;  2VPL A;  2BVM A;  3GBG A;  3LSI A;  4ZTJ A;  2WAQ A;  2UVE A;  4C30 A;  2XGJ A;  1O88 A;  4FXU A;  3V42 A;  4C2U A;  4XD7 A;  1O8F A;  4IZZ A;  2QX3 A;  4E7K A;  3CJR B;  4ZJZ A;  4BDY A;  2LBF A;  4I84 A;  4B3X A;  2Y0S A;  3K6G A;  3HAG A;  2CV1 A;  3VR6 A;  3DDY A;  3VYR B;  2MD0 A;  4W8T A;  4ANJ A;  4NK8 A;  3B4N A;  4Z1M A;  3DQV C;  4N4N B;  2QE7 A;  1BOB A;  3S93 A;  1D0X A;  4P22 A;  1D1A A;  3OWT A;  2VKD A;  1N78 A;  4IX7 A;  2PMZ A;  1PYV A;  2VXD A;  2D3L A;  2W6J A;  5FL7 A;  2KLO A;  2PJR A;  3K4B A;  3OMY A;  2R9V A;  2LBF B;  3OYN A;  2ZTN A;  2W4S A;  5CKT A;  4LIU A;  4BU2 A;  3T56 B;  2NT6 A;  4CZC A;  3L2U A;  2WJY A;  4C9Y A;  2GJR A;  4YXW A;  2Z16 A;  4XLH A;  4RMN A;  2JVG A;  2NSP A;  1BMF A;  1W0K A;  2EWE A;  4QPQ A;  1MW7 A;  2XZO A;  4RLQ A;  3KRG A;  4PJM A;  2VL8 A;  2PJR B;  3IUO A;  4ZDO A;  4B43 A;  3K10 A;  3L2W A;  3MKW B;  2V7Q A;  1PKV A;  2A5W A;  1X1B A;  1KZL A;  1IRX A;  4NQW B;  4F92 B;  3GRH A;  2WSS A;  2QKM B;  1X4P A;  2CUZ A;  2WJV A;  1E1Q A;  4DJA A;  1WP6 A;  1TZL A;  1X4O A;  2ZXH A;  3HXL A;  3NWT A;  4HIZ A;  1O8G A;  3K4J A;  2JA2 A;  2VQH A;  1W36 C;  1HZE A;  4IKF A;  4BQQ A;  3LNN A;  3LMW A;  4NC7 A;  1D0Z A;  2KMU A;  1KCC A;  2MYS A;  3BG7 A;  2VXZ A;  3KX2 A;  3OL4 A;  2M3A A;  2R7V A;  2Z6B D;  3MKZ A;  3VYT B;  2UVF A;  1YX3 A;  2A6T A;  4E7S A;  4B3G A;  1MMA A;  4PJN A;  2R7W A;  1PE9 A;  1IB4 A;  2E5N A;  1KCD A;  2KRC A;  3D5S C;  4BEH A;  5C1C A;  4F3Q A;  1YE9 A;  3KEW A;  2O04 A;  3A1Y A;  3OS1 A;  2X6X A;  4H4K C;  4CCO A;  3HPH A;  3OYC A;  2X53 S;  2VB6 A;  1ZEL A;  2CV0 A;  2L2O A;  1E1R A;  3LFU A;  2XZL A;  3H9Q A;  3SYT A;  1AIR A;  3LL7 A;  2R7S A;  4G6T B;  3TL4 X;  4KIT B;  2XF6 A;  1O8H A;  2IQ7 A;  5C1E A;  4HWV A;  1LFP A;  1Z21 A;  4D1Q A;  4PMH A;  1E79 A;  4Z06 A;  2W7N A;  1E0E A;  1CZF A;  1SAU A;  3H9J A;  4HRI A;  2DT6 A;  3ZIA A;  1NG6 A;  3OL3 A;  2WAF A;  1OGM X;  3VYS B;  3HL2 A;  2JIZ A;  1TT0 A;  4GRI A;  2FUG 2;  4BL0 B;  2V9K A;  1DGR M;  2P0W A;  1IDJ A;  2INV A;  4PSW A;  1VLY A;  3PL8 A;  1UAA A;  3NWS A;  4UZU A;  3BCB A;  4BEH B;  4HNT A;  2XC7 A;  1V0F A;  3OYE A;  1IDK A;  1BLI A;  2M4G A;  1RMG A;  2V6E A;  2BSP A;  2PYH A;  1PXZ A;  5KCM A;  3GVJ A;  3OYL A;  4Z03 A;  3MD2 A;  1KMH A;  2RRE A;  3OS0 A;  2R7Q A;  3FKS A;  4G7W A;  4YEJ A;  2LOO A;  2HU9 A;  1NHC A;  2MFZ A;  4BXF A;  4YRV A;  1WPC A;  1Z3Y A;  4Y4R A;  1KON A;  3DTI A;  4PJJ A;  2R7R A;  2CFO A;  4CCK A;  3RQ4 A;  1D1B A;  2NT9 A;  3PNY A;  3BH4 A;  3UNG C;  2VQG A;  1I8D A;  2O0V A;  1VBL A;  1DQU A;  3RTR A;  3GQB A;  4KJZ A;  2F1M A;  4NK6 A;  2CH0 A;  3F9K A;  2K9M A;  3BC8 A;  2CK3 A;  1MAB A;  2ZTG A;  3DPL C;  3C2H A;  1GQ8 A;  4II3 A;  4BGD A;  1Z3X A;  3I3L A;  2W6I A;  1O8L A;  1G59 A;  1WJE A;  3A4C A;  1WJA A;  3K4L A;  3K4N A;  2KRH A;  4FAS D;  4XM3 A;  2R7X A;  1E3Z A;  3OAA A;  2VBM A;  3G05 A;  4W8R A;  5IK2 A;  1O8J A;  4U49 A;  4E0F A;  1RWR A;  2V1N A;  1ERD A;  3T9G A;  3BCD A;  3DKY A;  2IGM A;  4U4B A;  4LIT A;  3VSK A;  4PJL A;  1V0E A;  2IGK A;  3ZSC A;  4BJ6 C;  3GQ8 A;  4BUP A;  3L2R A;  2E60 A;  4W8S A;  2AQE A;  1LVK A;  3HC7 A;  3FPP A;  2K5C A;  1JRG A;  2KP6 A;  1O8E A;  2V31 A;  5LD2 C;  3J7A Y;  2BW3 A;  2VAS A;  4BS9 A;  3KEY A;  2OV7 A;  2XF5 A;  4XMY A;  3SZG A;  4OJO A;  1J09 A;  2ZZG A;  1OLT A;  4XLC A;  2W00 A;  1UD8 A;  4R79 A;  4AVZ A;  4X0G A;  3LSG A;  2IGN A;  2OUM A;  3A2K A;  2KZV A;  2ZFU A;  2WY8 Q;  2UUZ A;  2INU A;  2R7U A;  2M7B A;  2IGO A;  1VF7 A;  1HA8 A;  2GJK A;  1X1D A;  2JVH A;  3HOS A;  2QXZ A;  4DK0 A;  3BCF A;  1LDK B;  2DT7 B;  3ZXS A;  4P1W A;  4XKW A;  4BAC A;  3H94 A;  1BR4 A;  4CCN A;  3K4K A;  3OIP A;  3KYL A;  2ZZQ A;  3L2V A;  3PNV A;  4XLA A;  1WTH D;  1WJF A;  2QKL B;  2IXS A;  4TT3 A;  3HPG A;  5HNF A;  2IS1 A;  4DK1 A;  4AU7 A;  1N75 A;  2XND A;  3DPU A;  3QYE A;  3CES A;  4ZDP A;  1PJR A;  2XOK A;  4L8J A;  4OJP A;  4KKU A;  4Z05 A;  3DTK A;  1P9Q C;  4B47 A;  3VYU B;  1VZ0 A;  5CQG A;  1DBG A;  4JOM A;  4OJ5 A;  3FBI B;  1K28 D;  2LY1 A;  3SEZ A;  2JSP A;  3OYH A;  3NE5 B;  2E1B A;  2CUJ A;  4DNR B;  2M4K A;  3CMM A;  3LMM A;  3S3M A;  2V26 A;  3EUA A;  2DOA A;  3UR3 C;  3OYF A;  2Q2E B;  1QCX A;  4OZY A;  3N05 A;  3FHN A;  4PK4 A;  3E1S A;  3GVL A;  4AYB A;  3AL0 C;  1JI8 A;  3OOU A;  4KKT A;  4F91 B;  2F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...