4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
b'PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
4XN0A 3B4NA 3SUCA 2NZMA 4XM3A 1CZFA 1O8GA 2NTPA 2Z8GA 4XLHA 5AMVA 4EW9A 1PLUA 3VMWA 4XQFA 2IQ7A 4XMYA 4XLFA 1HG8A 1VBLA 2VBEA 2QY1A 1GQ8A 1NHCA 1BHEA 4OJOA 4W8RA 3T9GA 4PMHA 4W8TA 2NSTA 4XL9A 2NTBA 2VJJA 4XKWA 1RU4A 4XN3A 1OFLA 2VBKA 4OZYA 2INVA 4U4BA 1IB4A 4HWVA 4YEJA 1IDKA 2QXZA 3ZPPA 4W8SA 1DBOA 4XKVA 1KTWA 1O8DA 1QCXA 2UVEA 3JURA 3VMVA 1X0CA 4XONA 4Z03A 3VSVA 1PXZA 2O17A 4XOTA 3GRHA 1O8IA 4XLAA 4OJPA 3VSTA 1DBGA 4OJ6A 4MXNA 2O04A 2UVFA 2X3HA 2VJIA 2NT6A 2NT9A 2NSPA 3GQ8A 3GQ7A 4YZQA 2ODLA 2NTQA 3B8YA 1PE9A 2EWEA 1OFMA 1JRGA 3WWGA 4XOPA 5C1EA 3GQAA 1IDJA 2BSPA 4MR0A 3B90A 4YZ0A 2PYHA 1K5CA 1OGMX 4YZAA 2INUA 3KRGA 4W8QA 2X6YA 1QJVA 3UW0A 4XORA 4Z05A 4OJLA 1RWRA 5C1CA 1AIRA 1OOCA 1O8EA 1O8LA 2O0WA 1WMRA 1XG2A 1KCDA 4URRA 4OJ5A 2VBMA 4OZZA 4XLEA 3EQNA 4NK6A 4U49A 2X6XA 1OGOX 3LMWA 1IA5A 1H80A 1KCCA 4XLCA 1O8HA 4I84A 3GQ9A 1EE6A 3VSUA 2X6WA 4XR6A 1O8JA 2O1DA 1O8MA 2PECA 4AVZA 2X85A 1BN8A 4YELA 4XNFA 4YZXA 3ZSCA 2O0VA 1JTAA 3FY3A 2QX3A 4Z06A 1O8KA 1RMGA 3EQOA 4C2LA 4NK8A 2PYGA 1O88A 1O8FA
chains in the Genus database with same CATH superfamily
2EFNA 4BUPA 3BTCA 3L2VA 1IUYA 3H0DA 2J8IA 2WAEA 2EPFA 3JRIA 5D4SA 3GO5A 3QPHA 1D0XA 1FZPB 4OINF 4D0PA 4A3CJ 3KEOA 5TV2A 1FMVA 4RJLA 1A5JA 5L3FA 1STZA 4M72A 5IOZA 4RD4A 4E0FA 3GF2A 4HSTA 4YAOA 2JA8J 4OOIA 4PK4A 4HRIA 4M9ZA 5D8LB 3JREA 1K28D 1ZR2A 2QZAA 2EIMH 1YJ9I 5JMCB 4G6DA 1I50J 2E1CA 4J19A 3W2HA 1BOAA 5GADJ 1WP6A 2EV0A 4YEJA 2DEUA 2Y2ZA 3HDDA 3NE5B 4NBSA 1BJKA 4X0GA 1Z77A 4RGRA 2WB1N 3QQAA 2BSAA 2PX9A 2DK5A 3BY2A 2R7FA 2FBKA 2H27A 4AVPA 2DQLA 1IN5A 4DGWB 2HWVA 3ZXSA 4FTHA 2JUCA 4XIDA 3ML3A 2NS7A 2GWRA 3OYFA 2IW5A 3OYBA 3R0JA 5J40A 3ZN1A 3JRGA 2ZFWA 4I01A 3ZQ7A 5JLWA 3QRFF 3CMEB 4P96A 2XDVA 1IJEA 4RAYA 3ASNH 4RLFA 3MZYA 1BI0A 3FKSA 5IP9J 2NOGA 4OU0A 2LG4A 3C2HA 2PBIA 5CQEA 3LQRA 4ENMA 1NBMA 4N3NA 3C3WA 3OOPA 4B09A 1E1QA 2BXYA 2ADUA 1X19A 3SDGA 1EF4A 4E7SA 4P3IA 2DW4A 1Y8QB 2CFXA 4QWQA 1SFUA 1OFEA 3LFUA 3OFNA 3KE2A 4XRSG 2NS8A 4UUSB 4WK8F 1VQOI 4KMFA 3ASQA 3UW0A 2X3UA 3OKXA 2R7WA 3L09A 1E0EA 1LE8A 1U2RA 3BCFA 3RJPA 4QV2A 1ZN2A 2DA6A 2FF4A 2G0EA 4JX5A 5EDNA 1VQ9I 1OCZH 1AWCA 1ZTRA 4RMNA 2Z33A 1VZ0A 1MZBA 2O0WA 2H6CA 2ZBUA 3DP7A 2BM1A 1RIOH 3BZCA 1SC7A 2DPDA 2CF4A 3BG3A 1TC3C 3GFJA 2HQNA 1DU0A 2D74A 4X7EA 2VBWA 5DCMB 1CQTA 2X51A 1QGZA 4YXWA 2KIMA 4NK6A 3U1DA 1QQIA 1JJ8C 4Y9UA 4BNCA 1V5VA 4HQMA 4D7NA 4GQNA 1N78A 5HZAA 4LB5A 3H94A 3OOCA 3TL4X 3OYHA 1Y1WJ 3IWFA 4DZPA 2VB6A 4YFKF 2PJPA 3T9GA 2IGMA 3L2UA 4OOXA 2XNDA 3PENA 2XAQA 5F1JA 2BY2A 2XPWA 1BR1A 2K9QA 1DARA 5C3EJ 4IF4A 2B7EA 3ES9A 1GO2A 2EH3A 2GJRA 1MBGA 3KZIC 3ML6A 3QAHA 4YAWA 3CJRB 1SFEA 1KQSB 4LGWA 1WJEA 4E7JA 2R0QC 3CPXA 2A05A 4Z06A 1W1WE 2DXIA 5BSXA 1JT0A 1A6QA 4UAJA 5DD4A 3KLNA 1QBJA 1UD8A 2BVNA 1Z6RA 4WWVA 3H3UA 1NB9A 1JTYA 3ZMTA 5GAEJ 3I53A 2DA1A 4HE6A 4HBLA 2BM6A 1X1PA 4LBVA 2GJKA 2H1LA 1SANA 3QOPA 2A6TA 2KISA 4U88A 2HQAA 2EINH 1ZLKA 3H9GA 1XE1A 2LDUA 3BR3A 9ANTA 4L5JA 2QKLB 2H09A 4AIDA 4LITA 5DM6F 3PQKA 4E7LA 2X0KA 3ISXA 3P27A 3GZ5A 1BOBA 2O6WA 1HW5A 5D4RA 3M8EA 1N05A 2G7HA 2WV1A 3IAM2 2CFOA 2XNCA 2M9HA 3BWGA 1VQMI 1A6IA 4HLXA 4HYEA 2D5VA 4LG0A 1VLYA 2A6HF 3UKGA 2QKMB 1ETKA 2PN6A 4IXAA 1KZLA 1Z6TA 2HGCA 1S72I 3VMVA 1RQPA 1QHHD 4AD9A 4EM0B 3DTEA 3KP7A 2B0RA 3WBKA 3ZQLA 4PFPA 2DMPA 1JKOC 1OB2A 3SFIA 1AHDP 2KPMA 4MQ9F 4HNTA 4OJPA 2IT0A 3CJNA 3K4NA 3VYRB 4ZZDA 3CD6B 4A3BJ 3LSTA 3LSIA 1T95A 1TT0A 2MW8A 3IUOA 4M2LA 3ZMSA 5FB2A 3HJEA 2Y69H 1RKWA 3W6JB 1BPLA 3QOEA 3V4GA 2QQAA 3FMRA 3E6MA 2ZNZA 5DM7F 1NK2P 2H8WA 2KQRA 3A8IA 1TSPA 4F7DA 2E19A 3GQAA 2CSOA 2OK7A 3WU0A 1Y0NA 4I2OA 3FPKA 3GZ6A 4CCNA 4I6ZA 2P6SA 2K5CA 1MBFA 1R5HA 2QN6A 3GVJA 1B59A 2R5YB 2ZITA 3ABTA 3PIPF 2PI0A 4XORA 4NCNA 4LOCA 2HTJA 4DZJA 2M30A 3P4GA 3DEEA 2EA2A 2E1RA 5GV8A 5M3MJ 5IYWA 3U6BA 4MTDA 4PC7A 2O8XA 2EQRA 4ZGQB 4OZZA 3IHUA 4DK1A 4DNRB 3QYBA 5FL7A 3VNVA 4P5OA 4LK1F 1HF0A 1HW2A 2DETA 4YG2F 1R23A 3F72A 2JT1A 2Y0MA 5JFRA 5B6IA 2YUHA 3CCVI 3E0JB 3CXCB 1KCCA 4CDGA 4ESFA 2NS0A 3TW6A 2BV6A 3QP6A 2ZSHB 3ZPLA 5IT9Z 3OAAA 2RC5A 4U9UA 1WGXA 1WJ5A 1PDNC 4Z4SA 1B23P 2VPRA 4C3IJ 1SKYB 5L3DA 1IUFA 4PGHA 2V9VA 1VQLI 2XF5A 3HEFA 4RAZA 3CC4B 4UY8I 3W5HA 4XSXF 3CCLI 2YWGA 1UD4A 2A5WA 4P26A 2EB7A 1V55H 4UHTA 2W82A 3SEQA 3VPRA 2QM3A 1UD5A 1YE9A 2TCTA 5J1YA 3OYDA 1ODDA 4AU7A 4I0AA 3H0GJ 4B47A 3BTJA 4JQFA 4ACBA 3IP4B 3S14J 5DSZA 3K4MA 5E17F 1TYWA 3E5QA 4U0YA 3SUCA 1SD5A 1IRFA 3RKQA 3ZQIA 4WXHA 4ZDLA 2NVUB 2VOPA 2QZ8A 5LHIA 3T8TA 1IW7F 2X1DA 4PJ0C 3CMEI 2ISYA 2R5ZB 1TWCJ 1TWFJ 2X1CA 3QU3A 3OYCA 2CW7A 1UMKA 4JOMA 3LMMA 4HX8A 2MABA 2B7CA 2XNJA 5AN9A 3VOEA 1GLNA 4EM1A 1J2XA 1X4PA 3UR3C 4DBQA 4UUVA 4GRIA 1OFLA 3BR1A 2XSJC 1UD6A 3HHGA 1I7PA 2DJIA 1SVOA 4GO1A 2BM5A 4B4CA 4B8XA 1BHEA 3IV5A 5B3SH 2COMA 1JKRC 4F3QA 2ZZGA 2LSOA 2RQPA 3RTRA 3OP1A 1G3WA 4LBYA 4G7ZF 2A07F 5TY0A 1PXZA 2O17A 1R71A 1FY7A 1O8IA 2BY3A 3KP5A 2XAHA 3ECHA 4HF1A 3C1DA 5FRMA 3JX8A 2OTJI 3OL3A 3PUNA 1ZG5A 2O04A 2P81A 2EFQA 2W25A 3BG7A 3M1EA 5CVRA 2GBYA 1VFCA 1LB2A 3HM5A 1FIPA 1DGRM 3TGNA 1UAAA 1DQUA 3D5SC 5HLGA 2WJVA 1VQ7B 3GQ7A 1FBQA 1W35A 3SZEA 2OA4A 2QUFA 4BQNA 2DY1A 2ZXWH 1BN5A 4EMSA 3CW2A 2ECBA 3SY2A 3OIPA 2BGJA 1QQ1A 2QWWA 1OYYA 2Q6LA 3FXKA 1WJCA 1A04A 1T98A 3JR9A 2KZGA 3RYPA 1FOWA 1VQ4I 3DKYA 1IV8A 1VQ5B 4HAMA 3B82A 2VKHA 2VFPA 4MYTA 4P25A 2W84A 1B2RA 2P3MA 1OMIA 3F0CA 2P7VB 2WV0A 4CCLA 5FRNA 1RQRA 3T8RA 4F91B 2F5DA 3J81K 4HQEA 1TW2A 5J47A 2HDWA 2E2JJ 4UUSA 4OJ5A 4MYUA 1I3QJ 2CG4A 3LSJA 4NC8A 3ZCOA 1WXRA 3SJZA 1G3TA 3R61A 1K9MD 2ZL7A 4MO7A 4QPQA 1T38A 2F2EA 5LGNA 5EG0B 1SVMA 2EK5A 2O61A 3GTMJ 4PJLA 3SZTA 1H80A 3VODA 4BXFA 1ENHA 3V8KA 4DYCA 1X1CA 2Z16A 2GAUA 3DBHB 3OMYA 3LVBA 1RPWA 1SD4A 5DCMA 5IYNA 5CQGA 4PJJA 2WPDA 3IL2A 1KQ9A 4DYRA 4B1RA 5K5OA 3WTSC 4EJTA 1IRGA 4HV5A 3MKZA 4ASUA 3DWLE 1BM9A 3MMYB 3O8HA 2DAOA 4XKBA 4M1KA 4OM9A 1N8RD 1K6OA 4D5CA 2ID3A 1HLVA 2PIAA 4A3MJ 1WH7A 2VBZA 2XZPA 4BYYA 4AUXA 3K1NA 4IEJA 1JNYA 4G6QA 3HSRA 3RIRA 1TNSA 1QZEA 5LHGA 4OPVA 3MN2A 4FXUA 2VFMA 2CQ7A 3OR2C 4XBFA 5LRRA 4Z4VA 3DF8A 3SHFA 2Z8GA 1MSEC 2E36A 1G6NA 3BR6A 2F5EA 4EW9A 2MLGA 4XK4A 1RR8C 2F4OB 2K40A 5IT9K 1YI2B 1ZELA 3K2ZA 2FJ1A 2JJ7A 3LSRA 2FX0A 1P7IA 2F4MB 1OQYA 2FXAA 3AFHA 3GZNB 4EATA 1FNMA 1GQ8A 2DIEA 3EUHC 1GAWA 3RKWA 1YITB 3CC7B 2VBKA 3FF5A 4OZYA 2GQQA 4CCJA 4HF2A 2LD5A 3ONUA 1IB4A 1IG7A 4KA4A 4EV0A 3LAPA 4Z4TA 2JA7J 1Z05A 2XRNA 3Q3SA 3HKZA 1KTWA 2XV4S 2XVCA 1N08A 2GOMA 1VQNI 3PSFA 1ONVA 1YX5A 4X7DA 3W2FA 4G1VA 1G7CA 1YW7A 3E20A 1UMQA 4XOTA 1RZ4A 2BEOA 3CCEB 3ASPA 2HVSA 2XTXA 1PP8F 4UZUA 2HOTA 4B3AA 3OJXA 1WVRA 2B9SA 1WKMA 5LEKA 1UHSA 3LSGA 3RPQA 1QPIA 3ASTA 1YIJI 1FP1D 4HLYA 4F7ZA 1QZYA 5CYVA 1IF1A 2J8KA 2XB0X 3CCMB 3CP8A 4B4DA 1EH7A 2M4GA 4AM3A 2QA4B 4CZZA 2ZJ2A 4IO9F 1ETYA 2MFZA 3EUHA 4OAYA 3AGPA 4FE4A 2X0LA 1XPXA 1U3EM 4ACAA 1BI2A 2KIFA 2ME6A 2DU9A 3ERMA 3A1PA 2HS5A 4IHYA 2O5RA 3ZGKA 3FBNB 3J81k 1HCRA 2K3PA 4GFBA 1DGWY 3N4MA 5FKKA 3FKJA 2X48A 2M2EA 3GYHX 4BKXA 2R5YA 3WE3A 1YX2A 4A3FJ 1O7LA 1VQPI 2CQKA 2V9KA 1EFTA 2CYYA 3LNQA 1MGTA 3J80K 2UXXA 1X3UA 3MKYB 1BX1A 3E6BA 3J7AY 2XAJA 3TP3A 4BXUA 2VLAA 1K4SA 2L9RA 3IRQA 3S1MJ 1A8PA 3PNVA 3PVDA 3KIOA 3M9AA 3IH2A 3P26A 2NAZA 5ICCA 2VNJA 3NWSA 1O8MA 2HXOA 3KFWX 4PSXA 4EH1A 1PVEA 4L18B 3B73A 3LFKA 3TQNA 4TMXA 1S7EA 4IQJA 1NG7A 5DNSA 1O3RA 1OISA 3MD2A 2Y30A 1N77A 2QEXI 1J9IA 2QX3A 3KEYA 1S7OA 4ZYAA 2PMZN 1T0FC 5IYQA 3CUOA 1BQEA 1H9GA 1MNMC 3SJMA 1EA3A 3R4KA 1ZUNB 1FTZA 1JHFA 1RETA 1I3AA 2YX4A 2AXTC 4ITVA 4W97A 5AMVA 2W48A 2VNIA 4MFDA 2GM4A 2O6GE 2VBEA 4E70A 3PUFA 3BTIA 1XSVA 1OR7C 1IXSB 1XB4A 2BYVE 4F92B 3KYLA 2V6EA 1QH0A 1VHEA 4NBQA 2IA2A 4UVBA 3J7YJ 4KUMA 1VQOB 3QPSA 1QRBA 2NSTA 1WPCA 3K1MA 4RDUA 3CZ6A 4V02C 1WJFA 1VQ9B 3Q38A 3BPXA 2R5ZA 1T39A 4ZYDA 1BX0A 4LFUA 1UB9A 3BT9A 4KKSA 4ABZA 3BPVA 2VODA 1DBOA 2VJ4A 3EYIA 3CCYA 3ONYA 2UWMA 1VQ5I 3KP6A 4IRIA 3HZJA 1EFCA 3G3ZA 1TL8A 3JRFA 2D3NA 3OYIA 1UZCA 1VQ8I 1T5EA 4A6EA 3A4CA 3KYDB 5KSWB 2IPQX 4J0QA 2ZFUA 1T0FA 4GYGA 2DFHA 4XLAA 1QZZA 3NAWA 4ZH4F 5KHDA 2VPLA 2LLKA 1ETOA 4RLZA 4KNYA 3ZUGA 4LG0B 4BY1J 3LQ6A 2E7XA 2P5VA 1Y0UA 5J1UA 1TYXA 2NT6A 2YUSA 2DFEA 4XLPF 1SEUA 5J3OA 3TH0A 4FCYA 1ZRDA 1TZLA 3HHHA 2IGOA 1T08B 2IA0A 2W4SA 1OR7A 3CP2A 1V5EA 1H0MA 4NQWA 1HSTA 3U1KA 1BC7C 5FKOA 4OMYA 1MRZA 3KRGA 2L9SA 3BLYA 2VBTA 5DN6A 4BPRA 1VF9A 3ABLH 5HLHA 2NVQJ 3B8HA 1BJZA 2CJJA 1QVFB 5GPCA 4Y17A 3AVWA 2XGCA 4A3EJ 2WWYA 3OYAA 2BM4A 3A2KA 2C77A 1KQ5A 3BH4A 2GZWA 5HLTA 3MHPA 1YJWI 3AK5A 2P7CB 2GJPA 4CA0A 2KIQA 2X4HA 2DOGA 2VC1A 3WHBA 1QHGA 1OGIA 4P9UA 4EQQA 1DPRA 1FNDA 2I10A 4Z2YA 3BCBA 2KVOA 4W1UA 1YI2I 4P22A 2BX6A 1RI7A 1LQ1A 3I1FA 4FHTA 1O8HA 4BHCA 1JA0A 4U7DA 2GA2A 3IKTA 1VQMB 4KITB 2P4WA 2W6IA 2VYQA 5EG0A 5EEGA 1ETQA 2O1DA 3JTHA 3H5RA 2D1HA 1RKTA 3RDIA 2PECA 4Z1MA 3VSLA 2LYCA 1S72B 4MFEA 4BE2A 3W3CA 2HQ5A 3AG1H 4BBSJ 3A8KA 4OMZA 4C0SA 1FRQA 3ZMDA 4ZTFA 4K1XA 2XPUA 3OIOA 1I18A 1UD2A 4LG3A 2JVGA 3QP5A 1JTAA 2PMZA 2L9NA 1MW7A 2LNBA 5B1BH 2YU3A 3OZWA 2A6EF 3EQOA 4C2LA 4BAYA 2JRTA 1FNNA 4EGYA 4HPQA 1B72A 2VL8A 3CCEI 1HW1A 4KN4X 4XM3A 4UUTA 5L3CA 1ZRFA 3PO3J 5EZGA 3S3MA 1YOVB 5FROA 2HYGD 2Z1DA 3BR5A 1W0UA 4X1EA 2O7OA 2BBYA 4TMWA 2QE7A 1W2BB 2PMDA 5F6FA 4DQKA 2VT3A 1Q7YD 1TLLA 2L4MA 2V7FA 2KJCA 2C4UA 3CDHA 2LMDA 1FPQA 1W4MA 2L9VA 3PO2J 4PGGA 2V4JC 5FO0A 2ZTNA 4HNUA 1K61A 2OUMA 3LO8A 2VKDA 1ZG3A 3B78A 1MJAA 1DDNA 1QFZA 1AA7A 2AO9A 2MH9A 2INVA 2IS1A 1KONA 3RIQA 1WOPA 4R79A 1H42A 4CUGA 4NC7A 3R0AA 5HODA 2FMLA 3V42A 4BU2A 3C2GA 4C9YA 1OGJA 1QRCA 3G1LA 3BDDA 2A69F 3DPLC 5CPRB 1WZ2A 1FLIA 1XGMA 5FLVA 2HYFA 3HOZJ 2IEKA 3FPPA 3PA1A 3DFGA 3CCVB 4H4KC 1WWXA 1Y0RA 3BROA 4KICA 2HEOA 3BJOA 3WG9A 1O3TA 4P6YA 2CWEA 3NRVA 4KMUX 3VSTA 4C30A 3PQJA 1RESA 1R9TJ 3S3NA 2GK6A 1PJRA 2NXNB 4ZCMA 2HOEA 2MG4A 1NRKA 1TQIA 4V19K 2LY9A 1A31A 1VQLB 3OZUA 2XRLA 4HX4A 2FSWA 3WYAA 5ILVA 3CCLB 1U9OA 2XROA 1KD1D 1W0KA 2WY8Q 4KJZA 1Z67A 3A0BC 2DTZA 3VO1A 4HOBA 5D5UB 3L2RA 2IOUG 2PYHA 1LFUP 3OYKA 3GQBA 4WCGA 4A5NA 2R92J 1CGPA 3BZKA 1OKRA 1V54H 1WFXA 3RYRA 2L54A 2GK7A 4BDZA 1XCVA 4WWCA 1XGNA 2JDIA 4S04A 4KISA 3F23A 3SYTA 2JPBA 2LP0A 3K4LA 2XZOA 1O8LA 1ZM4A 2RGVA 1B9MA 3M8JA 4A0YA 2H6BA 2J5OA 1FT9A 2R3SA 4PZJA 3CLQA 4CCMA 5H5JA 2DPUA 1TP4A 1VQ6B 3E1SA 3ZMVA 1NK3P 2XPVA 4M6XA 1FJLA 2X9DA 1G7SA 3HRMA 1YIOA 1QRYA 2EZLA 1LDJA 4ZC3A 4HE5A 3W2GA 3F8BA 2CW8A 2X1EA 3P9IA 3HGYA 4L0YB 2OQGA 3MFKA 1QFJA 5A2QK 2V7QA 1G3YA 1ZAOA 4Y4RA 1YS6A 3G1OA 3WTVC 3S1NJ 2ELJA 2KHMA 4L9NA 3GIRA 4LB6B 5F4JA 1EP1B 3JQPA 1ETXA 2ZJRF 1KK3A 1MMDA 3KX2A 5FO5A 2VKVA 2VASA 2XB5A 2QSHX 1D2EA 5F0FA 2OTJB 1IAWA 4G1BA 3A0HC 1KRHA 2RC6A 2WZNA 5IY5H 5IYRA 1HSJA 3GSIA 4E7ZA 1S3JA 1WSUA 2VFQA 2IQ7A 4AWXB 3J7AO 3OPOA 1HG8A 3GTJJ 3EPZA 3ZC3A 1NHCA 3T56B 3CF5F 2FU4A 1FOKA 1IN7A 3C2BA 5DV5A 1VQ4B 4X06A 2HZDA 5DDGA 3MAJA 5IYDJ 2Q1ZB 3FBIB 4YALA 1BJAA 2B7BA 3RKYA 2XTYA 1M1EB 4U4BA 1SFOJ 4TT3A 3SKBA 1QVTA 3N6ZA 2DODA 2YS9A 4X7FA 1H89C 2PJRB 2EBIA 4L5EA 4W8SA 4DNCA 3GFMA 1O57A 3H5AA 1R5NA 2ZXIA 2BF4A 2D2WA 4JYKA 3WU2C 4TSFA 2KRCA 2HNHA 2BOLA 1ORKA 2GIVA 1ZGJA 4JBAA 4EJOA 1USSA 2ELHA 5BPIA 1D8JA 4CXFA 4BACA 2HDCA 4QSHA 3PA2A 3GXOA 2OYNA 4FN5A 4ASNA 2V6CA 4BL0B 1N0VC 3F22A 2OF7A 1IGNA 4IOCF 4LC0A 1PYVA 4PC1A 3AG2H 2M8GX 3E6DA 2DYRH 1KU2A 4FISA 2IS6A 1GT0C 3BG5A 4MEYF 2GQFA 3OS2A 1E79A 4A0XA 2EWEA 1OFMA 1JRGA 2OTLI 4C43A 1B6AA 1W87A 4NNJA 1IDJA 1HDDC 3SYJA 4KIGA 4QLCU 5IK2A 2FE3A 1IZ1A 2B5OA 4P6VF 1OGMX 5F0CA 2DK8A 2WY7Q 3WU1B 3G4SI 2CV2A 2ZZQA 2X8KA 1M1KD 3OIQA 2WAQN 2Z2SB 3MZHA 4AF7A 2HQRA 1XQBA 3Q0VA 5FNZA 4RCZA 5C44J 3OYMA 3EETA 1R58A 3VYUB 1J0RA 4C2MJ 3V7AA 1AIRA 2XAGA 1S7AA 2IXSA 1JJ6C 2DBBA 2LR8A 4YFXF 1XG2A 2MC4A 1ZM3A 2VBMA 3S1RJ 2JK3A 1CF7B 1RUNA 3OY9A 4G5GA 3BP8A 3C7JA 1T56A 4NC6A 1PJ5A 3RKXA 1LLZA 3RQIA 4ZDOA 4OIPF 4B44A 2I8DA 3AVVA 5DS0A 2CBXA 2LF7A 1R4NB 1YRNB 1S5LC 2BM0A 3GCMA 3PFIA 2M7BA 1G59A 4N9HA 2JIZA 4L9JA 2OQRA 3ESWB 1WOOA 1YX3A 1QGPA 3WG7H 2F1MA 1BN8A 2E1OA 1VQNB 4E7KA 3DU5A 2DDAA 5ICFA 2VQCA 4PFOA 5BMZA 3FIWA 1QUEA 3N05A 5H20A 2KKOA 3V8LA 3O2PE 3SXYA 2LF8A 1GV2A 5HDKA 4II3A 2OZ6A 1B9NA 5L3BA 5HNHA 4BJ5C 1Y6IA 2RKHA 2WYRA 2CH0A 1RMGA 1X1AA 3K4BA 2VUMJ 2BMWA 1HKSA 4U0VA 2QTLA 3T1BA 1KU7A 1FRNA 1D8KA 2P6TA 4QVAA 1HOMA 4X05A 4LLGF 1ZHFA 1YIJB 3W2EA 2NZMA 5JVGF 3K10A 3G73A 2NTPA 2K9SA 2HFHA 4HA8A 4XQFA 2QBYB 4E7IA 1XDUA 3O8GA 4HG2A 4V2FA 4UB8C 3CJTB 1EH8A 2QY1A 1LDDA 1MMSA 2F6CA 3PUMA 4LK0F 2L7MP 5EF6A 4XL9A 4X6AJ 1H85A 3GEZA 3ZBTA 5BQTA 2AHOA 5D6EA 3GMEA 1RU4A 2Y9ZA 4P2NA 2XHKA 1MJ9A 4M3DA 2M87A 4N9IA 5GTHC 2V5IA 3RPUD 1F1ZA 4M3FA 3F9KA 5KNLA 2V1DA 2CU7A 2YPRA 1T8IA 4A5MA 4FWTA 4RM3A 1VQPB 4L9TA 4BY7J 2EV6A 3GVKA 3UNGC 1G4DA 2XGJA 2LKXA 3JURA 3DKWA 5DYMA 2E7WA 1D1CA 2PQ8A 4Z03A 5AONA 4YFOA 1R7JA 2E60A 4RD1A 4XD7A 1KQ0A 3JQRA 3LA3A 1OCCH 2XGEA 3K2AA 2Z9OA 4G6TB 1IN6A 3ISPA 1VQ6I 5B1AH 2OPTA 4KN7X 2YU9J 1W34A 1AKHB 3A3BA 1DBGA 3DU1X 1XMAA 3I4PA 5J4VA 2V4DA 1KTVA 3AG4H 4MXNA 3ZR8X 1GR1A 5AIQA 2ZBVA 3ASRA 2VXZA 1PUFA 4GGGA 3JSOA 1DU6A 2VBXA 4N4OB 2OBTA 3PIOF 1WU8A 4M3BA 1BA5A 3SFZA 5GAGJ 2WR8A 2AQEA 1GXQA 2QEXB 3B90A 1K5CA 1O3SA 2FQ4A 2A61A 3HKZN 4CCKA 2IP2A 2WAQA 4DK0A 4JP0A 3BG6A 2F48A 2GIZA 2W57A 5TJJA 5IP6A 5A89A 3L2CA 2V7WA 2BY1A 2Z6BD 1WJAA 4MTEA 1D1NA 2DOEA 2VJ5A 4M9SA 1O8EA 3LOCA 1CNEA 2EIJH 3MCZA 3O3KA 4ESJA 1FDRA 4RA2A 3NAUA 2HDNB 2KRFA 1DP7P 5EJCA 4NQWB 4CZCA 1K73D 2PLFA 4LD5A 1C0WA 4P3YA 4ENKA 4IHTA 4CICA 4U49A 3VDXA 2L01A 5HXBA 1IA5A 4YHBA 3TO7A 2BHYA 1DDIA 1XDSA 3FXQA 1A35A 4D5FA 4ZCIA 3A01A 3K6GA 4ZYHA 3M8FA 1FOXA 2CRVA 3CCSB 2VQHA 1F5TA 4U0WA 3OYJA 1OCOH 2JUGA 2JZYA 1YLFA 4NUBA 5GPAA 3ZPNA 1O8JA 5B5EC 1N75A 2DOAA 5B66C 2A68F 1L3LA 2DJNA 2ZJQF 1VQ8B 4YFNF 4YZXA 3SJPA 3FMSA 1EH6A 4RM2A 3SQVA 3N90A 2RV8A 3F6VA 1U5TC 2Q6KA 3S3OA 2XZLA 3FY3A 5LHHA 1PJ6A 1TWHJ 3FZVA 1S29A 1KGSA 2HZTA 2DMTA 1RR7A 4YIFA 4S05A 4QTRA 3LSPA 1Y1VJ 1RRJA 4Y7CA 3WGHA 1IN8A 2HDDA 3S32A 2E5ZA 1UCRA 3PL8A 1XSDA 2ZNYA 2RVCA 5K5RA 2JA5J 3HOUJ 1OHHA 1ETVA 4WZTA 1I39A 1WI9A 2UV1A 2MD0A 2R9VA 5H6QA 1VBLA 1UG2A 2JPCA 3R60A 2FEZA 2DOFA 1JA1A 4RGXA 2GA1A 2KMUA 1OB0A 4W8TA 2CQXA 3RPUA 4Q5SF 3FXRA 4LBZA 4EJWA 3L7WA 2R7DA 1EV7A 2CS3A 1BLIA 4WXCA 3QYEA 3HOSA 4O3MA 3ZBUA 4HEA2 1B72B 2E2HJ 4U7BA 3TEDA 5F27A 5E79C 2M0CA 2IVMA 3HOXJ 2M1BA 4FQGA 5JLXA 5KK1A 2MBFA 1O3QA 3A03A 1YJNI 2GXGA 1YJWB 3S8PA 3LYCA 1QCXA 3CDIA 1H8HA 1KMHA 2F1LA 3GVLA 5E3MA 3OEEA 4Z4UA 2HKOA 1OYIA 1LVAA 2M34A 3OSFA 3ZQCA 2K86A 3FDYA 1AMOA 1U5TA 4RD3A 1E64A 3H9NA 4X7CA 1SMTA 2P5KA 4CSWA 2ME0A 3GLLA 2C6YA 2PJRA 4PC2A 1L0OC 2FBIA 3TBIA 2K4BA 4CYDA 2EV5A 2W7NA 2JQ7A 1H8EA 2V7UA 2O9LA 2E71A 4LIVA 1YS7A 2UVFA 2CUZA 5J6XA 2NVTJ 3IWZA 3FISA 5CVVA 5TISC 1YO5C 2QF7A 2ZMEC 2XGXA 1B4AA 3GQ8A 2LY1A 4PUSA 3DPUA 3E97A 3I56I 2C5HA 4AC9A 3VYSB 1WORA 1G7RA 2DERA 1JJ2B 1O4XA 2ISZA 1ZKGA 3SEZA 3ZMUA 1J09A 1QJVA 2Z3YA 2G9WA 3U6KA 4GDFA 3CJQB 3S2DJ 5E20A 1SD6A 2BV3A 2UXNA 1RC9A 3ZZ0A 2VBVA 4IPAA 5IP7J 5HKKA 5LMZA 3CQZJ 3ZQHA 4Y13A 4WZLA 5C4JJ 4M3EA 5TGTA 2DI3A 4I7HA 3PSIA 4XSZF 4DBRA 1WH5A 4YIRX 2H8RA 1I8DA 3PFYA 4IQ4A 4IHWA 2L4AA 1ITYA 2BM7A 3CMYA 5BPDA 1E17A 2ZTGA 3GW2A 5HZBA 1TWGJ 1U6GA 4I09A 3K70D 1FP2A 2OD5A 2E34A 4KDPA 1F20A 3OS1A 1U8RA 1EP3B 3W2VA 2JMWA 2K27A 3KEWA 4A2UA 2XKOA 1X3WB 1SAUA 1CF7A 5HS8A 5HS9A 2NRAC 2LZJA 1S4MA 4EJUA 4H9GA 3QSYA 2FBHA 3ASOH 4XR6A 4BEHB 5E3NA 2ZSIB 2ZMEA 2VE8A 1G2HA 4Z4ZA 4AVZA 4YELA 1ZK8A 3PUBA 1QA2A 3CMAI 3T53B 2XUBA 2QYUA 2VNKA 1YRNA 2Q2EA 1R5ID 2A3SA 2LREA 2STTA 3HBLA 2CK3A 4E7HA 3NARA 2MH2A 2CC2A 1G3SA 2VFNA 4D9JA 4AIKA 4Y7NJ 4JMQA 3IH4A 1HBXG 2R7XA 4IJAA 3VYTB 2ZJPF 4PAAA 1APLC 1G7TA 1P6RA 2LTPA 3R6SA 1K78A 4XLHA 1Z9CA 1HC8A 4FETA 6PAXA 1XB2A 4WX9A 5L3EA 1S0UA 2V1NA 1YHQB 3VMFA 1GUUA 2K7LA 1YYVA 2CMPA 2DT5A 2DT7B 5HDGA 3WNDA 2FUG2 1GJRA 4ZYGA 3P5JA 4RD6A 3LJYA 2EIKH 3F6OA 3H92A 2DT6A 1VI0A 2ZC2A 4Z4RA 4JRAC 1P4WA 2ZO4A 2QBYA 1FNBA 2DQRA 4BXXJ 2I5UA 3ZQQA 1EZGA 3FK6A 1XGOA 1ERDA 1T2KA 4ENNA 2N8GA 4RAGA 4ON0A 3GFIA 3K70C 2QTZA 2E5NA 3OW2B 2CUFA 2DO7A 1XSXA 1ACIA 1LLWA 4BDYA 4OIQF 1JGGA 3LQEA 2K4JA 2M0MA 3TOAA 1AOYA 3L1PA 1LPQA 5C4XJ 1BIBA 4IZZA 3LA2A 2HYJA 4KT5C 4NHJA 1ZLJA 2F4IA 5DTDA 4E4HA 4B3FX 1I1SA 4RPBA 3PM1A 1EJ9A 1GXPA 2F5VA 3I58A 5D5WB 1E2XA 1V5GA 1JUSA 1IB0A 2NOJB 2Y75A 1E63A 1KYWA 2KFDA 3EUKL 2V9PA 4A3GJ 1ULYA 3OEHA 3VNUA 2NTQA 1SFKA 3CCSI 1V5FA 5KW9A 3BH6B 2L3DA 3LQQA 1AKHA 3ABMH 4MEXF 1XMXA 5J8FA 3I9V2 2R7OA 2ACJA 1HF2A 3Q9VA 5GTIC 4OPSA 5E8GA 3K7AJ 3CRZA 2LKSA 3I55I 3G6EI 2YWEA 2UUZA 3G1MA 2E1MC 5HOOA 1IO2A 3JRAA 2P5LC 4L8JA 2IGKA 4M0LA 5LD2C 2NV4A 1FTTA 2OBRA 2HLDA 2ID6A 2Q8KA 5LBQA 2DFFA 1MSFC 3A3GA 4XLEA 2D3LA 3SEJA 4Z4WA 3D5LA 3WODF 1QNTA 2WADA 4ETSA 1ZH5A 1YW9A 5ICEA 4RPDA 5FIUA 1QVGB 3EUAA 3K4JA 2JWTA 2XGDA 2EFGA 2WAFA 3VEPA 2BE5F 3CMMA 4I84A 5ICGA 3KZYA 1MNDA 2XF7A 3RZOJ 2O03A 1OPCA 5JVTA 2E1BA 2X6WA 2CO5A 1J5YA 3N97A 4TMZA 3MEXA 2DA3A 2QLZA 1WRJA 2X85A 2XSDC 4BE0A 3AL0C 1UELB 3L00A 1IDZA 4CYCB 3DBRB 5M5XJ 4N4NB 3OOUA 4TMVA 3SLDA 3CCRB 1T6ZA 4DJAA 1Q1HA 3JAMZ 1BI3A 4YAUA 2VIXA 4I02A 1KZHA 5A8AA 2DMQA 2DA2A 2VOOA 2LC2A 4I0BA 1FIAA 4F93B 4XRFA 4EGZA 1KQ8A 4E6KG 1X3ZB 2OV7A 3OZVA 4FASD 3FWEA 4RGUA 3Q0UA 5J4YA 3BQJA 2COBA 5HDNA 5D5XB 2ZXHA 3F21A 4D1QA 2JA2A 2Q6IA 2OTLB 4P1VA 1VF7A 2O3FA 1WCMJ 4JX4A 2VFOA 5LGTA 3ULQB 5JR3A 4CH7A 1I5ZA 2JSCA 3G4SB 3REOA 1IXCA 3K0LA 2KDOA 1Z3YA 2WC2A 3FXUA 4BJTA 3CCUI 3I0TA 2HMAA 1MMNA 3M3YJ 1FYKA 4UZFA 3KP3A 5FFXA 4PCQA 3DCFA 1N07A 4EM2A 4F52A 1K79A 2C4TA 3OYNA 2J5PA 3KPHA 3RQ4A 2LH9A 3U2RA 1IDKA 1OB5A 4HDVA 5J8CA 4Y52J 1DP3A 5ILUA 5EEAA 1Y39A 2EFOA 1R1TA 3I59B 3QPTA 1BC8C 4CO8A 1J9ZA 2HOAA 4A0ZA 4F55A 1FYLA 1Z91A 3I5UA 4XONA 4QUZA 2DA5A 1R5OA 3CESA 4KH3A 2VXDA 2Y0SN 1KK1A 2PG4A 4MIMA 2KIUA 3G05A 4UXNA 1X2NA 2XIGA 1Q86D 3FK7A 2W1OA 2QYOA 1MBJA 3TKYA 5E8IA 2X3HA 4RB1A 2KJBA 3Q5FA 1KU3A 3C18A 3D0SA 3ZMZA 5M5WJ 5D8KB 2IAIA 1R22A 2K9NA 3DV8A 5K7HA 4MR0A 2STWA 1OFCX 2ZXJA 4WZKA 4HIZA 4DYQA 4G9YA 3EYYA 1WSRA 2OAZA 1HZEA 4N3GA 4W8QA 4OWRB 3HSEA 4RAFA 2HCJB 3VR6A 4OPWA 4XKCA 2EFWA 2CV1A 2VZLA 4B48A 4EVIA 3O6BB 4XICA 1PUFB 1OOCA 3FKIJ 1FX7A 4G7XA 4TV7A 1UHWA 1KYZA 3M7GA 1D0YA 3Q0WA 3OYLA 2DA4A 2PLYA 2X53S 2AHQA 4ENJA 2ZZFA 3V7RA 4TMTA 3H1CA 2R7QA 3ZIAA 2ICWG 1IC8A 1MIJA 3ZZTA 1OGOX 3BQYA 1YHQI 3Q3AA 2IS4A 4RDKA 4XLCA 5FLMJ 2W6JA 2HVQA 3PSZA 1K8AD 1M90D 1XC5A 1EFRA 1R5GA 4IOAF 3VSUA 4IHXA 2MGQA 1QU3A 2QGGA 1HDPA 2XC7A 4UVCA 3D26A 1ELOA 5FJ8J 3QPLA 4Y3OA 2CGPA 1K6YA 2BVLA 3BQZA 1T33A 1W0TA 3ROUA 4QHYA 2MC3A 5A88A 3ZSCA 3FM5A 3JRBA 2FA5A 1E1RA 3FXOA 4K2EA 4BEHA 4DQLA 2O0VA 1DPUA 2QGUA 3P7NA 1LJ9A 3A01B 2I1LA 3RY8A 3U21A 3WTZA 3RI4A 1OYWA 1MABA 4EEFG 4A69C 5K1YA 4BHBA 4NK8A 3ZQGA 4XN0A 3M1CA 1WJDA 3DXJF 3ABUA 2CUJA 3HOWJ 3I71A 5L3GA 1O8GA 2DCUA 4NB5A 1U8BA 4PGOA 4BQOA 1GVHA 3VMWA 3HTUA 4XMYA 3BCDA 2MSYA 4Z4YA 2BW3B 3ZRGA 3SLNA 1MBEA 1F4KA 1VHOA 3IRRA 4ROXA 3CC2B 1X4OA 1QPMA 2KLOA 3LNNA 5E6TA 3WBJA 2YR2A 1JE8A 2HR3A 4FE7A 5K7ZA 3S15J 3FM3A 4OOVA 2L02A 2ZBKA 3WTWC 3CCQI 2M5SA 3BY1A 3JAMK 2DMNA 2PMUA 3BCAA 5GP9A 3H3VK 1ZARA 3KETA 2Q6OA 3A35A 1UD3A 2FOWA 1R1VA 2QXZA 1E3HA 4XKVA 1QG0A 1FBUA 4KIBA 1B1BA 3CLOA 1IXRC 1VQKI 4HZFA 1MD0A 1EXMA 1XX5A 3L2QA 3BH7B 2CW5A 3HUGA 4HW0A 2NNYA 1SVLA 1EP2B 1JGSA 1Q9SA 3OS0A 2Y0SA 3CCJI 1BW5A 5FD5A 4FT8A 3W6VA 3ZP5A 1ZREA 4MHGA 4GCVA 3ABKH 3AVYA 4P1WA 1TTYA 4UVAA 1XCBA 5EZHA 1RNLA 2DN0A 4IL6C 2HTSA 5JI6A 1FEXA 4M53A 3B02A 2XEXA 1FWZA 1P9QC 4AC0A 4OIOF 2OK8A 3OJWA 4RM0A 2P0WA 1PE9A 1U5TB 5CJ9A 3AAFA 2BSPA 3IAS2 3VFZA 1XFOA 2M3AA 1I6XA 5EYRA 4EJVA 2VT2A 3WE2A 3BJ6A 3K4KA 2RNGA 2KRHA 1BW6A 2MLKA 1NHAA 1A36A 3HL2A 2YWFA 4KKTA 3LWFA 4AIJA 2K02A 3CCRI 2JJ2A 2JSPA 2OCCH 2V1XA 2XC1A 2FQ3A 1COWA 4OJLA 2M45A 3KEQA 1WI3A 4TKOB 4BQAA 5GAHJ 3VSKA 4XRSA 1KCDA 3HPHA 3DEWA 1FOYA 5HVQC 1R00A 2DYSH 4A6DA 5GV7A 3DTKA 2KL4A 4R1HA 1WQ2A 5CVIA 2Z5UA 1OLTA 5DUIA 3LMWA 4M73A 4LJZF 2QVOA 3OV8A 1JT6A 3K69A 3CF2A 1FC3A 4UV8A 1YQAA 3GQ9A 3QFRA 2A5YB 2BHZA 2FOKA 1EE6A 1L1IA 1GDTA 3ECOA 1YJNB 1E3OC 4Y9RA 2VQGA 1F60A 2B63J 4XNFA 2WSSA 3ZQFA 1P4XA 3E6CC 3LL7A 4JX6A 4J01A 4DQ2A 2DTRA 1QGYA 3JU4A 2YX7A 3QFSA 2E35A 1LEAA 1O8KA 2CW0F 3A8JA 1ZG1A 3BZ6A 2WB1A 2IS2A 2XF6A 2IRFG 3HTSB 4KFCA 5CDFA 1MKMA 4CYCA 4IRGA 2ZMEB 1B8IB 2BN4A 4G94A 3B4NA 3FHNA 4P55A 3QODA 1UG0A 1OCRH 5E3OA 3WXMA 1GAQA 1QA1A 3DTIA 3B6CA 1ETWA 3G2BA 2Q2EB 1K7AA 3TDUC 1CLWA 1PLUA 3NEUA 3I56B 4PC6A 5BS6A 1SM4A 2NVXJ 3P9KA 1I1GA 3J81Z 4KYWA 2F5FA 4LLLA 3TP0A 3AVTA 1T6XA 1D1AA 3WHCA 1W9XA 3E5UA 1LNWA 3MZ8A 2VBUA 4AYBN 3JRDA 4ZYEA 3FX3A 2EZHA 5IYCJ 1R36A 4O5VA 3AVUA 1K78B 4H0EA 3U9GA 4C2UA 5F4MA 3G71B 3KL9A 3L2WA 1OJLA 3ZPPA 4DOZA 1OFDA 3PNYA 1O8DA 2BXZA 3BC8A 4I99C 3DLAA 3W2IA 2ETHA 1PUEE 3QU6A 1VTNC 4R8HA 3W2WA 1BBYA 2R7VA 2IA1A 1IRXA 5BNGA 4YEIA 2LOOA 1OCTC 5H59A 1YTYA 1SAXA 4IRHA 1BL0A 4KIFA 3I59A 3W5VA 4C3HJ 2JTVA 3Q6RA 3JRCA 1QX4A 1EWYA 2W24A 2Z99A 4YIIA 3S2WA 4XRMA 1AU7A 2VJIA 3CMAB 3HSFA 1ON2A 1GVDA 1Q1VA 1SD7A 1N06A 4X07A 1KC8D 4YZQA 3T51B 3WWGA 2NNNA 4YDTA 2L0KA 4BH9A 5LFAA 2JVHA 1EA0A 3JRHA 2GXBA 1LEBA 1W7PB 5FKLA 2AS5F 1NB0A 1MDMA 3BOQA 4Q7JB 2INUA 3WY9A 2G0YA 4M4SA 1F43A 2WA0A 2AQFA 1H8AC 3LA7A 1QVUA 2L7KA 3A1YA 3SZGA 1QA6A 4DIQA 1MMAA 1X1DA 2CQQA 2K9LA 4HNVA 1UHMA 2ZKZA 3K9TA 5C1CA 3OYEA 3WTYC 2V79A 3ONQA 3H3ZA 1JB9A 4QFMA 4ZV4A 2LBFA 2P8TA 2L2OA 3H5NA 4M6YA 2XT4A 4URRA 2PE3A 2CNDA 2K85A 2CUEA 5E1ZB 1IHMA 4AF6A 3D1NI 3V7SA 1K4TA 4ANJA 4G7HF 4QVJA 2X6XA 2BGIA 2XKPA 4P9FA 1P92A 4HF0A 4OOSA 5KAIC 3NQOA 4B3GA 3JSPA 3U2QA 5JHUA 2JN9A 1W5SA 2Q0OA 3CC2I 1V3FA 5J1RA 3MCAA 1FSEA 1JXSA 4I98B 1XS9A 4ZJZA 4HV6A 1QFYA 4PDKA 3QYFA 3AG3H 2EA4A 3PSSA 3GBGA 5CVJA 3HYIA 3WQZA 1H88C 5KCMA 1Z7LA 3GX4X 2HOSA 5E1XA 1IRZA 2JA6J 2GLOA 3I4MJ 4YAFA 2PFBA 2EFPA 2PYGA 3FMQA 3IH3A 4BHPA 1YG2A 3H36A 1J59A 2LVSA 3HPGA 3L9FA 2XASA 3QWLA 3OR1C 3R6KA 1CZFA 1S6LA 1K83J 3BR2A 2W85A 3JQQA 5FA6A 4A12A 2JN6A 1IJFA 3ZZUA 2XTWA 1I6HJ 2F4NA 3HRTA 2VI6A 1POGA 3OSGA 2HPMA 1XMKA 4IW3B 2KP6A 1SMYF 4UZEA 1MNEA 3IKVA 5FGMA 1K4ZA 4PMHA 4AYBA 3CUQB 1LDKB 3BG9A 3LSHA 4U87A 2E1MB 3H9QA 2NPFA 5IT3A 4XKWA 2ZL5A 3I55B 3G6EB 4CQJA 2LFBA 1TBXA 2L7FP 1Z7UA 4WQMA 2IBDA 2BW3A 4G8XA 1WHUA 1H9TA 1NJID 3J80Z 1WSVA 2EIXA 3R6JA 4HWVA 2ZL6A 2EJRA 4S0HB 4M9XA 2F3LA 2UVEA 3P9CA 3ASSA 3E3VA 5THXA 1Y56A 2RQQA 5LGUA 3CTAA 1U0JA 3F8CA 5HS7A 1WOSA 1DG1G 1QUFA 3EQLF 3NB2A 4ZTJA 3Q9SA 3WGGA 4FX0A 1ZM2A 3MVPA 4RB0A 2MA3A 2Y48A 2FMYA 1E3PA 1F9NA 1HVXA 1FMWA 2GOXB 4GYIA 3AL0B 1R4MB 2ZB9A 5LRSA 3QFTA 4PJMA 1Y8RB 2CV0A 2EWNA 2HU9A 3KLOA 2C2WA 4GXOA 1D8TA 1P4MA 5J35A 5ED4A 4NDLA 4Z6YA 1ZGAA 3B8YA 2QSGX 1QA3A 4A3KJ 3SQNA 2FNAA 2V31A 3SDBA 3AGQA 2L7ZA 3BTLA 4YZ0A 3KP2A 3V7CA 2QSFX 4YZAA 1HKQA 2WZPP 1O7FA 3D5RC 2DYIA 5E3LA 1V0FA 1Z0XA 2ECCA 3MQ0A 3QE2A 4RBOA 3LSMA 1QO0D 3KP4A 4RS8A 1ZM9A 2VBSA 2YWHA 1KK2A 2IJLA 1TNTA 4HSRA 4CCOA 3TW7A 3RSNA 4BBRJ 1JKQC 2NVYJ 3GTLJ 5D5VB 5L46A 4MGRA 4M6VA 3TMOA 2OZUA 1LVKA 5CVUA 2M5WA 5BOXA 2ESNA 1W7PD 3X2QH 3EQNA 3E1YE 2TRTA 4RB2C 4LLNA 1TYVA 5HNFA 5EGOB 2QENA 2K9MA 4L0ZB 2DFIA 3TDZC 4RDJA 4DNTB 3CCUB 1KA8A 3DBLB 3F3XA 4B3XA 2OBSA 2V7XA 2M7AA 2LKPA 5JBQA 1CQXA 2EZIA 2LY2A 1HA8A 1JI8A 1EFUA 2R7SA 1JHHA 4C2TA 3CD6I 3I3LA 2BGCA 3V8JA 2OU2A 3HOYJ 2NYXA 1EKEA 4V2GA 4Y15A 2WJYA 4TN1A 3DDYA 2VN2A 4BJ6C 2ESHA 3MMPA 4A3DJ 4WF2A 2C78A 1LKXA 2KT0A 5FKNA 1J7KA 4AIHA 3E7LA 4OIRF 3OW7A 2VONA 1W5CC 1BR4A 3G71I 3NWTA 2RN7A 3GLXA 3TOBA 5IYPA 1WJBA 1Z21A 2IGNA 5KAFC 1FYMA 4FK8A 3RCOA 3H09A 2X6OA 5DS9A 1LFBA 2RNJA 1KU9A 2QQ8A 2D45A 2LRDA 5DUKA 3KCCA 4II2A 1S9HA 1RUOA 2VC0A 1U2WA 1E3ZA 1IN4A 4IKFA 5FLXZ 3GTOJ 3AKZA 1R1UA 4KKUA 1IJWC 1I27A 4XLFA 1Z3XA 4HX7A 3VB2A 1U9NA 1IV6A 3VWBA 4G6IA 1B8IA 4LBWA 1K8FA 1SFXA 4OJOA 1TTTA 1P7JA 3BNWA 1D1BA 1TQMA 4ZDPA 3HOVJ 4D7MA 4IHVA 1E43A 1R6RA 1S8NA 2L5QA 2NTBA 2VJJA 1VJSA 1X1BA 2FD5A 4C3JJ 4XN3A 2M4KA 2VE9A 1V4RA 5ERIA 1AIPA 1E62A 2Y31A 3HB9A 3TO6A 1OCPA 3T0YA 5F04A 1U78A 3PJRA 2D9RA 4RCYA 1MBKA 3LAJA 3HRUA 1REPC 2W7ZA 2DLLA 4ZZLA 1FX0A 1YLOA 2FVGA 3DEUA 3WTXC 2V7VA 2OJED 1GVJA 3GTKJ 3CC4I 4N0BA 2R6HA 3OWTA 3GRHA 3CO7C 4MLOA 1ZYRF 2WTEA 3OYGA 3M4OJ 4OPOA 3W5UA 2E1NA 1LUJB 3CB4A 3HOTA 4L5IA 1W0JA 4O6JA 1VNDA 3DPTA 5DCFA 5IPAA 1W5TA 4UV9A 2YSRA 2R4GA 1Z1DA 3S1QJ 2DMUA 1USTA 2AXLA 2RAEA 3A02A 2NT9A 1JUPA 4A3JJ 3HUGB 3COAC 5BSYA 1GHCA 3DQVC 2MYSA 1ZGWA 1N0UA 3FXJA 1YJ9B 2FX3A 1LE8B 5C1EA 2HVRA 5F0HA 5JHFA 3W2AA 2F43A 3HXLA 3MKWB 1DABA 3KYCB 1D5YA 2QQ9A 3GWZA 4M71A 3H9JA 3GFLA 5K5QA 2H1KA 1MH4A 3GTPJ 2EZKA 2RC4A 2X6YA 3OE7A 2GXAA 1PP7U 1TWAJ 3SZPA 4BS9A 3GTQJ 4Z05A 2JRMA 1RWRA 1T6YA 4KT6A 2V7TA 4M74A 1W7PA 1NDHA 4JK1X 3PNTA 3HRSA 2XOKA 1BI1A 3Q39A 5LLQA 3J7ZI 4MNUA 3F8FA 1J75A 5EMNA 1UJ8A 1KJZA 3CDLA 2DA7A 4RGSA 5AIPA 3BC9A 3WTUC 3WNBA 2BVMA 3RZDJ 1V0EA 5H2FC 1R5BA 1XD7A 4IHSA 4RB3C 3CCQB 1HA3A 1TYUA 2J7KA 2GPJA 5TR9A 3HC7A 2DDBA 1FNCA 1LFPA 1XGSA 5KVRA 3CO6C 2R7RA 1Q82D 2H94A 1NG6A 1ZRCA 4ZCLA 2G7UA 1VQKB 3EDPA 3PETA 3CUQC 2BZTA 4UB6C 2HI3A 2CRGA 1VQ7I 3F8MA 1TT5B 3GUDA 2JJ1A 2V1UA 1HXDA 2FRHA 2LK2A 1WDTA 1W36D 3IC7A 2PEXA 5DD8A 2BY0A 4LMYA 4Q47A 5FD6A 2VBYA 1XTAA 3TO9A 3S17J 2O8KA 4A3LJ 3CCJB 1Q81D 4G7WA 1PKVA 2M8EA 2PMHA 1D5VA 5K7FA 4A93J 3E5XA 4CGZA 3WTTC 4P12A 1WTHD 1O8FA 5LEJA 3JTGA 1TW3A 5F64A 4PSWA 5JLVC 2QCOA 3T5XA 5F4OA 2K3FA 3DU6A 1VLOA 4P9SA 3W6KB 3QFCA 1HQCA 1T6SA 3OL4A 5EEHA 4BGDA 2Y9YA 1MMGA 4W8RA 1UFMA 1BIAA 4Q4ZF 1X2MA 1LM1A 3ZOBA 5FFZA 1KK0A 1MBHA 4Q48A 2HXIA 4HDUA 2ZZEA 3KZZA 4G12A 4A3IJ 2R7UA 3GVAA 4G7OF 4ZGNB 1JTXA 4PC3A 3ZN0A 4I76A 3I4NJ 2QDXA 1P2FA 2XT2A 3FHZA 3CUQA 5F1RA 3CPWB 4X0CA 4QPOA 2KZVA 2E2IJ 2HPIA 3ELKA 4WXDA 4RLQA 5CKTA 1WPKA 3K4CA 3M07A 5A2QZ 1X0CA 5FLXK 4M3GA 2UZKA 5DEQA 3S2HJ 2O0YA 3VSVA 1Y0YA 2B0LA 1DDGA 2RDPA 1XG1A 4RDLA 3BR0A 1MH3A 1P4AA 3DKXA 2OC6A 1MJBA 3WGIA 4PABA 5FKMA 1DUXC 3JW4A 1E3XA 1CNFA 1JKPC 4OJ6A 1G8XA 2WBMA 2MD5A 2C5BA 2FNPA 2W00A 2R7TA 3HGGA 4IVNA 5FO1A 2VNHA 3S93A 4MQVA 1W36C 1X58A 5F08A 1NH3A 3Q6QA 2NSPA 2ODLA 4YC5A 4FX4A 4QIWN 4OP7A 4XOPA 2QMUA 2VQLA 1TQPA 2RREA 1TLHB 5E18F 4R71A 2V26A 1ZR4A 2BPOA 2DCEA 3HIFA 1NTCA 1F36A 1SKQA 1QGAA 4WZEA 5D6FA 4ESBA 3S16J 4BE1A 1YITI 1BR2A 4J00A 5E1WA 4PJNA 4BQQA 5IOYA 3CC7I 4RD2A 1IDYA 1YW8A 3F8NA 2R93J 5ILSA 1XN7A 5H6RA 3H35A 4XLNF 5IYBJ 1WMRA 3AVXA 4LIUA 4OAZA 2TDXA 1FSHA 4L9VA 1R49A 2CQNA 1D0ZA 5CLSA 1MDMB 3MKLA 5HLIA 2VKEA 3FJOA 3FXMA 2KDZA 1N25A 4IX7A 2ZCWA 3I64A 1BMFA 3DLLF 5J3LA 1JUMA 2HKXA 3FXLA 3V76A 3LSKA 3WNCA 3I54A 3ERED 2QQBA 4B43A 1ZQ3P 3BJAA 2ELKA 3JCUC 2GREA 1ON1A 1HKTA 1TVCA 1YFHA 2LBFB 5EGOA 3GTGJ 3B6AA 4UNOA 3K1PA 5TRDA 1TUIA 4X8IA 3VO2A 4RD0A 2D1VA 2XAFA 3CCMI 2OCEA 3BY6A 4Y33A 1D3YA 5M5YJ 4DW6A 4YCQA 2F5CA 2XAUA 2QA4I 4YRVA 2OBPA 1PJ7A 1GV5A 3MWMA 3HG9A 4CHUA 3HAGA 5M3FJ 1FBSA 1O88A 2EILH 2R7ZJ
chains in the Genus database with same CATH topology
4BUPA 3L2VA 3H0DA 3B4NA 1EA3A 3FHNA 2WAEA 3S32A 3QODA 1UG0A 2E5ZA 3PL8A 4ITVA 3DTIA 3G2BA 1OHHA 5AMVA 1D0XA 2Q2EB 1PLUA 2UV1A 2MD0A 2R9VA 1FMVA 1VBLA 2VBEA 4E0FA 1OR7C 1BHEA 4HSTA 4F92B 3KYLA 2KMUA 2V6EA 1OB0A 1D1AA 4W8TA 3T9GA 1W9XA 4PK4A 4HRIA 1WPCA 2NSTA 2CS3A 1BLIA 3HOSA 3QYEA 1K28D 3CZ6A 4HEA2 1WJFA 4U7BA 1WP6A 4C2UA 4YEJA 3L2WA 4KKSA 3NE5B 3ZPPA 3S8PA 4DOZA 1DBOA 2VJ4A 3PNYA 4X0GA 1KMHA 1H8HA 3GVLA 3BC8A 3OEEA 1O8DA 3DLAA 2UWMA 1QCXA 2D3NA 3OYIA 3W2WA 3FDYA 4DGWB 2R7VA 1T5EA 3A4CA 3ZXSA 1IRXA 2PJRA 4CSWA 2LOOA 2ZFUA 4XLAA 3TBIA 3OYFA 3OYBA 5KHDA 2W7NA 1H8EA 2VPLA 2XDVA 4LIVA 2UVFA 2CUZA 4RLFA 2VJIA 2NT6A 3GQ8A 3FKSA 4YZQA 5CQEA 2LG4A 3C2HA 1TZLA 2LY1A 2IGOA 1NBMA 3T51B 2W4SA 4PUSA 3WWGA 3DPUA 3CP2A 5LFAA 2JVHA 1V5EA 3VYSB 1E1QA 1X19A 4E7SA 2INUA 3KRGA 3SEZA 3LFUA 2L9SA 3BLYA 1J09A 2WA0A 2AQFA 3OFNA 5DN6A 1QJVA 2L7KA 3A1YA 3SZGA 3UW0A 3CJQB 4DIQA 1MMAA 2R7WA 1E0EA 1X1DA 2K9LA 3BCFA 5C1CA 3OYAA 3A2KA 3OYEA 5HKKA 3ONQA 4RMNA 3BH4A 5HLTA 1VZ0A 2LBFA 3H5NA 2L2OA 3PSIA 5TGTA 4DBRA 1I8DA 2O0WA 4URRA 3PFYA 4IQ4A 2GJPA 4CA0A 2ZTGA 2X51A 1QHGA 4YXWA 3K70D 4NK6A 4ANJA 2X6XA 3OS1A 3BCBA 2KVOA 3W2VA 1N78A 4GQNA 4P22A 3KEWA 3H94A 3OOCA 4B3GA 1O8HA 3TL4X 3OYHA 1SAUA 2VB6A 4KITB 2IGMA 2LZJA 2W6IA 3L2UA 2XNDA 4XR6A 4BEHB 2O1DA 2ZSIB 3H5RA 2PECA 4ZJZA 4AVZA 1BR1A 4Z1MA 4YELA 3QYFA 3PUBA 2LYCA 3VSLA 3T53B 3GBGA 4BE2A 3W3CA 2GJRA 3WQZA 1I18A 2LREA 4ZTFA 2CK3A 3CJRB 5KCMA 1Z7LA 1UD2A 4LG3A 2JVGA 4E7HA 1JTAA 1WJEA 4E7JA 2PMZA 2L9NA 1MW7A 4Z06A 4D9JA 2DXIA 4JMQA 3EQOA 4C2LA 2R7XA 2PYGA 4HPQA 1UD8A 3VYTB 2VL8A 3HPGA 4XM3A 1CZFA 3OR1C 3S3MA 4XLHA 5FROA 4FETA 2Z1DA 2V1NA 2GJKA 2QE7A 2CMPA 2DT7B 2A6TA 2V7FA 2FUG2 2HPMA 2HQAA 2KP6A 1MNEA 3H9GA 4PMHA 4AYBA 2QKLB 2V4JC 1LDKB 3LSHA 2ZTNA 4U87A 2DT6A 2E1MB 4LITA 3H9QA 4HNUA 2OUMA 4E7LA 2VKDA 4XKWA 1BOBA 1AA7A 3IAM2 2BW3A 2CFOA 2INVA 3ZQQA 1KONA 2IS1A 1ERDA 4HWVA 4R79A 4CUGA 4NC7A 3V42A 4BU2A 1VLYA 3K70C 2QKMB 2E5NA 3C2GA 2UVEA 4C9YA 1KZLA 1Y56A 3VMVA 2RQQA 1QHHD 3DPLC 1U0JA 3DTEA 5CPRB 4BDYA 2M0MA 4PFPA 4ZTJA 3FPPA 4H4KC 2KPMA 4IZZA 4HNTA 4OJPA 1HVXA 4B3FX 3K4NA 1FMWA 2F4IA 4C30A 2GOXB 3VYRB 4E4HA 3VSTA 3LSIA 1T95A 1TT0A 3IUOA 3S3NA 3AL0B 1PJRA 2F5VA 2GK6A 4PJMA 2CV0A 1NRKA 1BPLA 1V5GA 2HU9A 3QOEA 2NOJB 3EUKL 3OEHA 2NTQA 3B8YA 1SFKA 1V5FA 2KQRA 1W0KA 2WY8Q 2V31A 3SDBA 4KJZA 3GQAA 3I9V2 2R7OA 4YZ0A 3L2RA 2PYHA 4CCNA 3GQBA 3OYKA 4YZAA 2WZPP 2K5CA 3D5RC 3GVJA 1V0FA 1WFXA 3LSMA 2GK7A 4XORA 4BDZA 2UUZA 2JDIA 4KISA 2E1MC 5HOOA 3SYTA 4HSRA 4L8JA 4CCOA 2IGKA 3DEEA 3K4LA 3RSNA 5LD2C 2XZOA 1O8LA 3M8JA 2HLDA 3TMOA 1LVKA 4CCMA 4OZZA 4DK1A 4DNRB 3QYBA 3E1SA 4XLEA 2D3LA 4P5OA 3A3GA 3D5LA 5FL7A 3EQNA 2WADA 5HNFA 4DNTB 2K9MA 3EUAA 3K4JA 4B3XA 3E0JB 2M7AA 2WAFA 3CMMA 4ZC3A 1KCCA 4I84A 2CW8A 1MNDA 2LY2A 2X1EA 2XF7A 1JI8A 1HA8A 2ZSHB 2R7SA 2E1BA 3OAAA 4C2TA 1WJ5A 2X6WA 3I3LA 2V7QA 4Y4RA 1SKYB 2WJYA 2X85A 3DDYA 3AL0C 4BE0A 4BJ6C 1UELB 1LKXA 2XF5A 2ELJA 2KHMA 3OW7A 4N4NB 1BR4A 3OOUA 3NWTA 1UD4A 2A5WA 4DJAA 2W82A 3SEQA 2VIXA 1WJBA 1MMDA 3KX2A 1Z21A 2IGNA 1UD5A 2LC2A 1YE9A 2VASA 4F93B 3OYDA 3RCOA 4E6KG 4AU7A 4B47A 2OV7A 4JQFA 3IP4B 3K4MA 4FASD 2LRDA 3SUCA 4II2A 1S9HA 4E7ZA 1E3ZA 2ZXHA 4ZDLA 4D1QA 2JA2A 4IKFA 3AKZA 4KKUA 2IQ7A 1VF7A 4XLFA 3OPOA 1HG8A 1Z3XA 2X1DA 3VWBA 4G6IA 3EPZA 1NHCA 3T56B 4OJOA 2X1CA 3OYCA 4CH7A 2CW7A 4JOMA 3LMMA 1D1BA 2MABA 2HZDA 4ZDPA 1E43A 2NTBA 1R6RA 2KDOA 2L5QA 1GLNA 1Z3YA 2VJJA 4BJTA 1X1BA 1X4PA 3UR3C 2Q1ZB 4XN3A 3FBIB 1MMNA 2M4KA 4GRIA 4DBQA 1OFLA 2XSJC 1UD6A 4U4BA 2DJIA 4F52A 4TT3A 3OYNA 3RQ4A 2LH9A 2PJRB 3PJRA 1IDKA 4W8SA 1DP3A 3H5AA 1VJSA 2ZXIA 4F3QA 2ZZGA 4TSFA 1FX0A 2KRCA 2HNHA 3RTRA 2BOLA 4F55A 4XONA 1PXZA 2O17A 3OWTA 3GRHA 3CESA 4MLOA 4BACA 1O8IA 2VXDA 3OYGA 3HOTA 1W0JA 3G05A 3DPTA 5FRMA 2W1OA 4BL0B 2R4GA 3OL3A 1PYVA 2O04A 3BG7A 2X3HA 2IS6A 1UAAA 2WJVA 1DGRM 1DQUA 3D5SC 3OS2A 2NT9A 3GQ7A 1E79A 3HUGB 2EWEA 3DQVC 2MYSA 4BQNA 1JRGA 1OFMA 4NNJA 3OIPA 2HVRA 1IDJA 5C1EA 5JHFA 3W2AA 2F43A 4MR0A 3HXLA 3MKWB 5IK2A 4HIZA 1OGMX 1WJCA 3H9JA 1HZEA 3OE7A 2CV2A 2WY7Q 4W8QA 2X6YA 4OWRB 2ZZQA 2X8KA 3DKYA 3VR6A 3OIQA 2Z2SB 4XKCA 4BS9A 2CV1A 2VKHA 4Z05A 4B48A 3OYMA 1RWRA 4KT6A 3VYUB 4CCLA 5FRNA 1AIRA 1OOCA 4F91B 2IXSA 3PNTA 2XOKA 2HDWA 4G7XA 2MC4A 1XG2A 3OYLA 4OJ5A 1D0YA 4NC8A 3ZCOA 2VBMA 2X53S 3OY9A 2ZZFA 4QPQA 3ZIAA 2R7QA 3BC9A 1OGOX 2BVMA 1H80A 4PJLA 1V0EA 4ZDOA 4BXFA 2IS4A 4XLCA 1X1CA 2Z16A 2I8DA 3OMYA 4B44A 2HVQA 2W6JA 3HC7A 5CQGA 1LFPA 4PJJA 1EFRA 2WPDA 3VSUA 1G59A 2M7BA 2R7RA 1QU3A 2JIZA 1NG6A 2XC7A 3MKZA 4ASUA 2F1MA 1YX3A 1BN8A 4Y3OA 1K6YA 2BVLA 3DWLE 4E7KA 3DU5A 4XKBA 3MMYB 2JJ1A 2VQCA 4PFOA 1W36D 3ZSCA 3N05A 1E1RA 4BEHA 4II3A 2O0VA 5HNHA 4BJ5C 1Y6IA 2XZPA 3U21A 1MABA 1PKVA 4G7WA 2CH0A 1RMGA 1X1AA 4NK8A 3K4BA 4FXUA 1O8FA 1WTHD 3OR2C 4XN0A 4PSWA 3M1CA 1WJDA 2NZMA 2CUJA 3K10A 1O8GA 2NTPA 2Z8GA 4EW9A 3DU6A 4BQOA 3VMWA 1ZELA 4XQFA 4XMYA 3OL4A 4BGDA 4HG2A 4E7IA 3BCDA 1MMGA 2BW3B 3ZRGA 4EATA 2QY1A 3AFHA 1GQ8A 2F6CA 4W8RA 2DIEA 3EUHC 1X4OA 2KLOA 3LNNA 4XL9A 2ZZEA 1RU4A 2R7UA 2VBKA 2M5SA 4OZYA 4CCJA 3RPUD 3BCAA 3A35A 1IB4A 3F9KA 5KNLA 1UD3A 2QXZA 4RM3A 3HKZA 4XKVA 1KTWA 4QPOA 2KZVA 3GVKA 2HPIA 3UNGC 4RLQA 5CKTA 2GOMA 2XGJA 3PSFA 3L2QA 3JURA 1YX5A 3K4CA 1X0CA 1D1CA 4Z03A 3VSVA 4XOTA 2E60A 3OS0A 2Y0SA 4XD7A 3DKXA 2OC6A 2HVSA 4UZUA 4G6TB 1E3XA 4P1WA 3A3BA 1DBGA 4OJ6A 1G8XA 2WBMA 2V4DA 2W00A 3LSGA 2R7TA 4MXNA 3ZR8X 3S93A 2VXZA 1W36C 1P9QC 2NSPA 3CP8A 2P0WA 2ODLA 2M4GA 1PE9A 4N4OB 4XOPA 2MFZA 4OAYA 2AQEA 2VQLA 2RREA 2BSPA 3B90A 3IAS2 2V26A 1K5CA 2DCEA 2M3AA 4CCKA 3K4KA 2RNGA 2KRHA 2WAQA 4KKTA 4DK0A 3HL2A 3BG6A 4BE1A 2O5RA 3ZGKA 3FBNB 2JJ2A 1BR2A 2JSPA 4BQQA 4PJNA 4J00A 2K3PA 4OJLA 1COWA 2Z6BD 1WJAA 1DGWY 4TKOB 2VJ5A 1O8EA 3FKJA 3H35A 3VSKA 1WMRA 1KCDA 3HPHA 4LIUA 4OAZA 5HVQC 4NQWB 4CZCA 2V9KA 2KL4A 3DTKA 1D0ZA 4U49A 1OLTA 3LMWA 3VDXA 1IA5A 3MKYB 4IX7A 1BMFA 3J7AY 3CF2A 3K6GA 3LSKA 2VLAA 3GQ9A 4B43A 1EE6A 2VQHA 3PNVA 3OYJA 2JUGA 4NUBA 2LBFB 3ZPNA 1O8JA 3NWSA 1O8MA 1N75A 2VQGA 2DOAA 4PSXA 4XNFA 2WSSA 4Y33A 4YZXA 2XAUA 4RM2A 3LL7A 4J01A 4YRVA 4IQJA 1NG7A 3MD2A 3JU4A 1N77A 3HG9A 3S3OA 2XZLA 3HAGA 2QX3A 3FY3A 1O8KA 3KEYA 4ZYAA 1T0FC 2WB1A 2IS2A 2XF6A 1O88A 5CDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN0 A;  3B4N A;  3SUC A;  2NZM A;  4XM3 A;  1CZF A;  1O8G A;  2NTP A;  2Z8G A;  4XLH A;  5AMV A;  4EW9 A;  1PLU A;  3VMW A;  4XQF A;  2IQ7 A;  4XMY A;  4XLF A;  1HG8 A;  1VBL A;  2VBE A;  2QY1 A;  1GQ8 A;  1NHC A;  1BHE A;  4OJO A;  4W8R A;  3T9G A;  4PMH A;  4W8T A;  2NST A;  4XL9 A;  2NTB A;  2VJJ A;  4XKW A;  1RU4 A;  4XN3 A;  1OFL A;  2VBK A;  4OZY A;  2INV A;  4U4B A;  1IB4 A;  4HWV A;  4YEJ A;  1IDK A;  2QXZ A;  3ZPP A;  4W8S A;  1DBO A;  4XKV A;  1KTW A;  1O8D A;  1QCX A;  2UVE A;  3JUR A;  3VMV A;  1X0C A;  4XON A;  4Z03 A;  3VSV A;  1PXZ A;  2O17 A;  4XOT A;  3GRH A;  1O8I A;  4XLA A;  4OJP A;  3VST A;  1DBG A;  4OJ6 A;  4MXN A;  2O04 A;  2UVF A;  2X3H A;  2VJI A;  2NT6 A;  2NT9 A;  2NSP A;  3GQ8 A;  3GQ7 A;  4YZQ A;  2ODL A;  2NTQ A;  3B8Y A;  1PE9 A;  2EWE A;  1OFM A;  1JRG A;  3WWG A;  4XOP A;  5C1E A;  3GQA A;  1IDJ A;  2BSP A;  4MR0 A;  3B90 A;  4YZ0 A;  2PYH A;  1K5C A;  1OGM X;  4YZA A;  2INU A;  3KRG A;  4W8Q A;  2X6Y A;  1QJV A;  3UW0 A;  4XOR A;  4Z05 A;  4OJL A;  1RWR A;  5C1C A;  1AIR A;  1OOC A;  1O8E A;  1O8L A;  2O0W A;  1WMR A;  1XG2 A;  1KCD A;  4URR A;  4OJ5 A;  2VBM A;  4OZZ A;  4XLE A;  3EQN A;  4NK6 A;  4U49 A;  2X6X A;  1OGO X;  3LMW A;  1IA5 A;  1H80 A;  1KCC A;  4XLC A;  1O8H A;  4I84 A;  3GQ9 A;  1EE6 A;  3VSU A;  2X6W A;  4XR6 A;  1O8J A;  2O1D A;  1O8M A;  2PEC A;  4AVZ A;  2X85 A;  1BN8 A;  4YEL A;  4XNF A;  4YZX A;  3ZSC A;  2O0V A;  1JTA A;  3FY3 A;  2QX3 A;  4Z06 A;  1O8K A;  1RMG A;  3EQO A;  4C2L A;  4NK8 A;  2PYG A;  1O88 A;  1O8F A; 
#chains in the Genus database with same CATH topology
 2EFN A;  4BUP A;  3BTC A;  3L2V A;  1IUY A;  3H0D A;  2J8I A;  2WAE A;  2EPF A;  3JRI A;  5D4S A;  3GO5 A;  3QPH A;  1D0X A;  1FZP B;  4OIN F;  4D0P A;  4A3C J;  3KEO A;  5TV2 A;  1FMV A;  4RJL A;  1A5J A;  5L3F A;  1STZ A;  4M72 A;  5IOZ A;  4RD4 A;  4E0F A;  3GF2 A;  4HST A;  4YAO A;  2JA8 J;  4OOI A;  4PK4 A;  4HRI A;  4M9Z A;  5D8L B;  3JRE A;  1K28 D;  1ZR2 A;  2QZA A;  2EIM H;  1YJ9 I;  5JMC B;  4G6D A;  1I50 J;  2E1C A;  4J19 A;  3W2H A;  1BOA A;  5GAD J;  1WP6 A;  2EV0 A;  4YEJ A;  2DEU A;  2Y2Z A;  3HDD A;  3NE5 B;  4NBS A;  1BJK A;  4X0G A;  1Z77 A;  4RGR A;  2WB1 N;  3QQA A;  2BSA A;  2PX9 A;  2DK5 A;  3BY2 A;  2R7F A;  2FBK A;  2H27 A;  4AVP A;  2DQL A;  1IN5 A;  4DGW B;  2HWV A;  3ZXS A;  4FTH A;  2JUC A;  4XID A;  3ML3 A;  2NS7 A;  2GWR A;  3OYF A;  2IW5 A;  3OYB A;  3R0J A;  5J40 A;  3ZN1 A;  3JRG A;  2ZFW A;  4I01 A;  3ZQ7 A;  5JLW A;  3QRF F;  3CME B;  4P96 A;  2XDV A;  1IJE A;  4RAY A;  3ASN H;  4RLF A;  3MZY A;  1BI0 A;  3FKS A;  5IP9 J;  2NOG A;  4OU0 A;  2LG4 A;  3C2H A;  2PBI A;  5CQE A;  3LQR A;  4ENM A;  1NBM A;  4N3N A;  3C3W A;  3OOP A;  4B09 A;  1E1Q A;  2BXY A;  2ADU A;  1X19 A;  3SDG A;  1EF4 A;  4E7S A;  4P3I A;  2DW4 A;  1Y8Q B;  2CFX A;  4QWQ A;  1SFU A;  1OFE A;  3LFU A;  3OFN A;  3KE2 A;  4XRS G;  2NS8 A;  4UUS B;  4WK8 F;  1VQO I;  4KMF A;  3ASQ A;  3UW0 A;  2X3U A;  3OKX A;  2R7W A;  3L09 A;  1E0E A;  1LE8 A;  1U2R A;  3BCF A;  3RJP A;  4QV2 A;  1ZN2 A;  2DA6 A;  2FF4 A;  2G0E A;  4JX5 A;  5EDN A;  1VQ9 I;  1OCZ H;  1AWC A;  1ZTR A;  4RMN A;  2Z33 A;  1VZ0 A;  1MZB A;  2O0W A;  2H6C A;  2ZBU A;  3DP7 A;  2BM1 A;  1RIO H;  3BZC A;  1SC7 A;  2DPD A;  2CF4 A;  3BG3 A;  1TC3 C;  3GFJ A;  2HQN A;  1DU0 A;  2D74 A;  4X7E A;  2VBW A;  5DCM B;  1CQT A;  2X51 A;  1QGZ A;  4YXW A;  2KIM A;  4NK6 A;  3U1D A;  1QQI A;  1JJ8 C;  4Y9U A;  4BNC A;  1V5V A;  4HQM A;  4D7N A;  4GQN A;  1N78 A;  5HZA A;  4LB5 A;  3H94 A;  3OOC A;  3TL4 X;  3OYH A;  1Y1W J;  3IWF A;  4DZP A;  2VB6 A;  4YFK F;  2PJP A;  3T9G A;  2IGM A;  3L2U A;  4OOX A;  2XND A;  3PEN A;  2XAQ A;  5F1J A;  2BY2 A;  2XPW A;  1BR1 A;  2K9Q A;  1DAR A;  5C3E J;  4IF4 A;  2B7E A;  3ES9 A;  1GO2 A;  2EH3 A;  2GJR A;  1MBG A;  3KZI C;  3ML6 A;  3QAH A;  4YAW A;  3CJR B;  1SFE A;  1KQS B;  4LGW A;  1WJE A;  4E7J A;  2R0Q C;  3CPX A;  2A05 A;  4Z06 A;  1W1W E;  2DXI A;  5BSX A;  1JT0 A;  1A6Q A;  4UAJ A;  5DD4 A;  3KLN A;  1QBJ A;  1UD8 A;  2BVN A;  1Z6R A;  4WWV A;  3H3U A;  1NB9 A;  1JTY A;  3ZMT A;  5GAE J;  3I53 A;  2DA1 A;  4HE6 A;  4HBL A;  2BM6 A;  1X1P A;  4LBV A;  2GJK A;  2H1L A;  1SAN A;  3QOP A;  2A6T A;  2KIS A;  4U88 A;  2HQA A;  2EIN H;  1ZLK A;  3H9G A;  1XE1 A;  2LDU A;  3BR3 A;  9ANT A;  4L5J A;  2QKL B;  2H09 A;  4AID A;  4LIT A;  5DM6 F;  3PQK A;  4E7L A;  2X0K A;  3ISX A;  3P27 A;  3GZ5 A;  1BOB A;  2O6W A;  1HW5 A;  5D4R A;  3M8E A;  1N05 A;  2G7H A;  2WV1 A;  3IAM 2;  2CFO A;  2XNC A;  2M9H A;  3BWG A;  1VQM I;  1A6I A;  4HLX A;  4HYE A;  2D5V A;  4LG0 A;  1VLY A;  2A6H F;  3UKG A;  2QKM B;  1ETK A;  2PN6 A;  4IXA A;  1KZL A;  1Z6T A;  2HGC A;  1S72 I;  3VMV A;  1RQP A;  1QHH D;  4AD9 A;  4EM0 B;  3DTE A;  3KP7 A;  2B0R A;  3WBK A;  3ZQL A;  4PFP A;  2DMP A;  1JKO C;  1OB2 A;  3SFI A;  1AHD P;  2KPM A;  4MQ9 F;  4HNT A;  4OJP A;  2IT0 A;  3CJN A;  3K4N A;  3VYR B;  4ZZD A;  3CD6 B;  4A3B J;  3LST A;  3LSI A;  1T95 A;  1TT0 A;  2MW8 A;  3IUO A;  4M2L A;  3ZMS A;  5FB2 A;  3HJE A;  2Y69 H;  1RKW A;  3W6J B;  1BPL A;  3QOE A;  3V4G A;  2QQA A;  3FMR A;  3E6M A;  2ZNZ A;  5DM7 F;  1NK2 P;  2H8W A;  2KQR A;  3A8I A;  1TSP A;  4F7D A;  2E19 A;  3GQA A;  2CSO A;  2OK7 A;  3WU0 A;  1Y0N A;  4I2O A;  3FPK A;  3GZ6 A;  4CCN A;  4I6Z A;  2P6S A;  2K5C A;  1MBF A;  1R5H A;  2QN6 A;  3GVJ A;  1B59 A;  2R5Y B;  2ZIT A;  3ABT A;  3PIP F;  2PI0 A;  4XOR A;  4NCN A;  4LOC A;  2HTJ A;  4DZJ A;  2M30 A;  3P4G A;  3DEE A;  2EA2 A;  2E1R A;  5GV8 A;  5M3M J;  5IYW A;  3U6B A;  4MTD A;  4PC7 A;  2O8X A;  2EQR A;  4ZGQ B;  4OZZ A;  3IHU A;  4DK1 A;  4DNR B;  3QYB A;  5FL7 A;  3VNV A;  4P5O A;  4LK1 F;  1HF0 A;  1HW2 A;  2DET A;  4YG2 F;  1R23 A;  3F72 A;  2JT1 A;  2Y0M A;  5JFR A;  5B6I A;  2YUH A;  3CCV I;  3E0J B;  3CXC B;  1KCC A;  4CDG A;  4ESF A;  2NS0 A;  3TW6 A;  2BV6 A;  3QP6 A;  2ZSH B;  3ZPL A;  5IT9 Z;  3OAA A;  2RC5 A;  4U9U A;  1WGX A;  1WJ5 A;  1PDN C;  4Z4S A;  1B23 P;  2VPR A;  4C3I J;  1SKY B;  5L3D A;  1IUF A;  4PGH A;  2V9V A;  1VQL I;  2XF5 A;  3HEF A;  4RAZ A;  3CC4 B;  4UY8 I;  3W5H A;  4XSX F;  3CCL I;  2YWG A;  1UD4 A;  2A5W A;  4P26 A;  2EB7 A;  1V55 H;  4UHT A;  2W82 A;  3SEQ A;  3VPR A;  2QM3 A;  1UD5 A;  1YE9 A;  2TCT A;  5J1Y A;  3OYD A;  1ODD A;  4AU7 A;  4I0A A;  3H0G J;  4B47 A;  3BTJ A;  4JQF A;  4ACB A;  3IP4 B;  3S14 J;  5DSZ A;  3K4M A;  5E17 F;  1TYW A;  3E5Q A;  4U0Y A;  3SUC A;  1SD5 A;  1IRF A;  3RKQ A;  3ZQI A;  4WXH A;  4ZDL A;  2NVU B;  2VOP A;  2QZ8 A;  5LHI A;  3T8T A;  1IW7 F;  2X1D A;  4PJ0 C;  3CME I;  2ISY A;  2R5Z B;  1TWC J;  1TWF J;  2X1C A;  3QU3 A;  3OYC A;  2CW7 A;  1UMK A;  4JOM A;  3LMM A;  4HX8 A;  2MAB A;  2B7C A;  2XNJ A;  5AN9 A;  3VOE A;  1GLN A;  4EM1 A;  1J2X A;  1X4P A;  3UR3 C;  4DBQ A;  4UUV A;  4GRI A;  1OFL A;  3BR1 A;  2XSJ C;  1UD6 A;  3HHG A;  1I7P A;  2DJI A;  1SVO A;  4GO1 A;  2BM5 A;  4B4C A;  4B8X A;  1BHE A;  3IV5 A;  5B3S H;  2COM A;  1JKR C;  4F3Q A;  2ZZG A;  2LSO A;  2RQP A;  3RTR A;  3OP1 A;  1G3W A;  4LBY A;  4G7Z F;  2A07 F;  5TY0 A;  1PXZ A;  2O17 A;  1R71 A;  1FY7 A;  1O8I A;  2BY3 A;  3KP5 A;  2XAH A;  3ECH A;  4HF1 A;  3C1D A;  5FRM A;  3JX8 A;  2OTJ I;  3OL3 A;  3PUN A;  1ZG5 A;  2O04 A;  2P81 A;  2EFQ A;  2W25 A;  3BG7 A;  3M1E A;  5CVR A;  2GBY A;  1VFC A;  1LB2 A;  3HM5 A;  1FIP A;  1DGR M;  3TGN A;  1UAA A;  1DQU A;  3D5S C;  5HLG A;  2WJV A;  1VQ7 B;  3GQ7 A;  1FBQ A;  1W35 A;  3SZE A;  2OA4 A;  2QUF A;  4BQN A;  2DY1 A;  2ZXW H;  1BN5 A;  4EMS A;  3CW2 A;  2ECB A;  3SY2 A;  3OIP A;  2BGJ A;  1QQ1 A;  2QWW A;  1OYY A;  2Q6L A;  3FXK A;  1WJC A;  1A04 A;  1T98 A;  3JR9 A;  2KZG A;  3RYP A;  1FOW A;  1VQ4 I;  3DKY A;  1IV8 A;  1VQ5 B;  4HAM A;  3B82 A;  2VKH A;  2VFP A;  4MYT A;  4P25 A;  2W84 A;  1B2R A;  2P3M A;  1OMI A;  3F0C A;  2P7V B;  2WV0 A;  4CCL A;  5FRN A;  1RQR A;  3T8R A;  4F91 B;  2F5D A;  3J81 K;  4HQE A;  1TW2 A;  5J47 A;  2HDW A;  2E2J J;  4UUS A;  4OJ5 A;  4MYU A;  1I3Q J;  2CG4 A;  3LSJ A;  4NC8 A;  3ZCO A;  1WXR A;  3SJZ A;  1G3T A;  3R61 A;  1K9M D;  2ZL7 A;  4MO7 A;  4QPQ A;  1T38 A;  2F2E A;  5LGN A;  5EG0 B;  1SVM A;  2EK5 A;  2O61 A;  3GTM J;  4PJL A;  3SZT A;  1H80 A;  3VOD A;  4BXF A;  1ENH A;  3V8K A;  4DYC A;  1X1C A;  2Z16 A;  2GAU A;  3DBH B;  3OMY A;  3LVB A;  1RPW A;  1SD4 A;  5DCM A;  5IYN A;  5CQG A;  4PJJ A;  2WPD A;  3IL2 A;  1KQ9 A;  4DYR A;  4B1R A;  5K5O A;  3WTS C;  4EJT A;  1IRG A;  4HV5 A;  3MKZ A;  4ASU A;  3DWL E;  1BM9 A;  3MMY B;  3O8H A;  2DAO A;  4XKB A;  4M1K A;  4OM9 A;  1N8R D;  1K6O A;  4D5C A;  2ID3 A;  1HLV A;  2PIA A;  4A3M J;  1WH7 A;  2VBZ A;  2XZP A;  4BYY A;  4AUX A;  3K1N A;  4IEJ A;  1JNY A;  4G6Q A;  3HSR A;  3RIR A;  1TNS A;  1QZE A;  5LHG A;  4OPV A;  3MN2 A;  4FXU A;  2VFM A;  2CQ7 A;  3OR2 C;  4XBF A;  5LRR A;  4Z4V A;  3DF8 A;  3SHF A;  2Z8G A;  1MSE C;  2E36 A;  1G6N A;  3BR6 A;  2F5E A;  4EW9 A;  2MLG A;  4XK4 A;  1RR8 C;  2F4O B;  2K40 A;  5IT9 K;  1YI2 B;  1ZEL A;  3K2Z A;  2FJ1 A;  2JJ7 A;  3LSR A;  2FX0 A;  1P7I A;  2F4M B;  1OQY A;  2FXA A;  3AFH A;  3GZN B;  4EAT A;  1FNM A;  1GQ8 A;  2DIE A;  3EUH C;  1GAW A;  3RKW A;  1YIT B;  3CC7 B;  2VBK A;  3FF5 A;  4OZY A;  2GQQ A;  4CCJ A;  4HF2 A;  2LD5 A;  3ONU A;  1IB4 A;  1IG7 A;  4KA4 A;  4EV0 A;  3LAP A;  4Z4T A;  2JA7 J;  1Z05 A;  2XRN A;  3Q3S A;  3HKZ A;  1KTW A;  2XV4 S;  2XVC A;  1N08 A;  2GOM A;  1VQN I;  3PSF A;  1ONV A;  1YX5 A;  4X7D A;  3W2F A;  4G1V A;  1G7C A;  1YW7 A;  3E20 A;  1UMQ A;  4XOT A;  1RZ4 A;  2BEO A;  3CCE B;  3ASP A;  2HVS A;  2XTX A;  1PP8 F;  4UZU A;  2HOT A;  4B3A A;  3OJX A;  1WVR A;  2B9S A;  1WKM A;  5LEK A;  1UHS A;  3LSG A;  3RPQ A;  1QPI A;  3AST A;  1YIJ I;  1FP1 D;  4HLY A;  4F7Z A;  1QZY A;  5CYV A;  1IF1 A;  2J8K A;  2XB0 X;  3CCM B;  3CP8 A;  4B4D A;  1EH7 A;  2M4G A;  4AM3 A;  2QA4 B;  4CZZ A;  2ZJ2 A;  4IO9 F;  1ETY A;  2MFZ A;  3EUH A;  4OAY A;  3AGP A;  4FE4 A;  2X0L A;  1XPX A;  1U3E M;  4ACA A;  1BI2 A;  2KIF A;  2ME6 A;  2DU9 A;  3ERM A;  3A1P A;  2HS5 A;  4IHY A;  2O5R A;  3ZGK A;  3FBN B;  3J81 k;  1HCR A;  2K3P A;  4GFB A;  1DGW Y;  3N4M A;  5FKK A;  3FKJ A;  2X48 A;  2M2E A;  3GYH X;  4BKX A;  2R5Y A;  3WE3 A;  1YX2 A;  4A3F J;  1O7L A;  1VQP I;  2CQK A;  2V9K A;  1EFT A;  2CYY A;  3LNQ A;  1MGT A;  3J80 K;  2UXX A;  1X3U A;  3MKY B;  1BX1 A;  3E6B A;  3J7A Y;  2XAJ A;  3TP3 A;  4BXU A;  2VLA A;  1K4S A;  2L9R A;  3IRQ A;  3S1M J;  1A8P A;  3PNV A;  3PVD A;  3KIO A;  3M9A A;  3IH2 A;  3P26 A;  2NAZ A;  5ICC A;  2VNJ A;  3NWS A;  1O8M A;  2HXO A;  3KFW X;  4PSX A;  4EH1 A;  1PVE A;  4L18 B;  3B73 A;  3LFK A;  3TQN A;  4TMX A;  1S7E A;  4IQJ A;  1NG7 A;  5DNS A;  1O3R A;  1OIS A;  3MD2 A;  2Y30 A;  1N77 A;  2QEX I;  1J9I A;  2QX3 A;  3KEY A;  1S7O A;  4ZYA A;  2PMZ N;  1T0F C;  5IYQ A;  3CUO A;  1BQE A;  1H9G A;  1MNM C;  3SJM A;  1EA3 A;  3R4K A;  1ZUN B;  1FTZ A;  1JHF A;  1RET A;  1I3A A;  2YX4 A;  2AXT C;  4ITV A;  4W97 A;  5AMV A;  2W48 A;  2VNI A;  4MFD A;  2GM4 A;  2O6G E;  2VBE A;  4E70 A;  3PUF A;  3BTI A;  1XSV A;  1OR7 C;  1IXS B;  1XB4 A;  2BYV E;  4F92 B;  3KYL A;  2V6E A;  1QH0 A;  1VHE A;  4NBQ A;  2IA2 A;  4UVB A;  3J7Y J;  4KUM A;  1VQO B;  3QPS A;  1QRB A;  2NST A;  1WPC A;  3K1M A;  4RDU A;  3CZ6 A;  4V02 C;  1WJF A;  1VQ9 B;  3Q38 A;  3BPX A;  2R5Z A;  1T39 A;  4ZYD A;  1BX0 A;  4LFU A;  1UB9 A;  3BT9 A;  4KKS A;  4ABZ A;  3BPV A;  2VOD A;  1DBO A;  2VJ4 A;  3EYI A;  3CCY A;  3ONY A;  2UWM A;  1VQ5 I;  3KP6 A;  4IRI A;  3HZJ A;  1EFC A;  3G3Z A;  1TL8 A;  3JRF A;  2D3N A;  3OYI A;  1UZC A;  1VQ8 I;  1T5E A;  4A6E A;  3A4C A;  3KYD B;  5KSW B;  2IPQ X;  4J0Q A;  2ZFU A;  1T0F A;  4GYG A;  2DFH A;  4XLA A;  1QZZ A;  3NAW A;  4ZH4 F;  5KHD A;  2VPL A;  2LLK A;  1ETO A;  4RLZ A;  4KNY A;  3ZUG A;  4LG0 B;  4BY1 J;  3LQ6 A;  2E7X A;  2P5V A;  1Y0U A;  5J1U A;  1TYX A;  2NT6 A;  2YUS A;  2DFE A;  4XLP F;  1SEU A;  5J3O A;  3TH0 A;  4FCY A;  1ZRD A;  1TZL A;  3HHH A;  2IGO A;  1T08 B;  2IA0 A;  2W4S A;  1OR7 A;  3CP2 A;  1V5E A;  1H0M A;  4NQW A;  1HST A;  3U1K A;  1BC7 C;  5FKO A;  4OMY A;  1MRZ A;  3KRG A;  2L9S A;  3BLY A;  2VBT A;  5DN6 A;  4BPR A;  1VF9 A;  3ABL H;  5HLH A;  2NVQ J;  3B8H A;  1BJZ A;  2CJJ A;  1QVF B;  5GPC A;  4Y17 A;  3AVW A;  2XGC A;  4A3E J;  2WWY A;  3OYA A;  2BM4 A;  3A2K A;  2C77 A;  1KQ5 A;  3BH4 A;  2GZW A;  5HLT A;  3MHP A;  1YJW I;  3AK5 A;  2P7C B;  2GJP A;  4CA0 A;  2KIQ A;  2X4H A;  2DOG A;  2VC1 A;  3WHB A;  1QHG A;  1OGI A;  4P9U A;  4EQQ A;  1DPR A;  1FND A;  2I10 A;  4Z2Y A;  3BCB A;  2KVO A;  4W1U A;  1YI2 I;  4P22 A;  2BX6 A;  1RI7 A;  1LQ1 A;  3I1F A;  4FHT A;  1O8H A;  4BHC A;  1JA0 A;  4U7D A;  2GA2 A;  3IKT A;  1VQM B;  4KIT B;  2P4W A;  2W6I A;  2VYQ A;  5EG0 A;  5EEG A;  1ETQ A;  2O1D A;  3JTH A;  3H5R A;  2D1H A;  1RKT A;  3RDI A;  2PEC A;  4Z1M A;  3VSL A;  2LYC A;  1S72 B;  4MFE A;  4BE2 A;  3W3C A;  2HQ5 A;  3AG1 H;  4BBS J;  3A8K A;  4OMZ A;  4C0S A;  1FRQ A;  3ZMD A;  4ZTF A;  4K1X A;  2XPU A;  3OIO A;  1I18 A;  1UD2 A;  4LG3 A;  2JVG A;  3QP5 A;  1JTA A;  2PMZ A;  2L9N A;  1MW7 A;  2LNB A;  5B1B H;  2YU3 A;  3OZW A;  2A6E F;  3EQO A;  4C2L A;  4BAY A;  2JRT A;  1FNN A;  4EGY A;  4HPQ A;  1B72 A;  2VL8 A;  3CCE I;  1HW1 A;  4KN4 X;  4XM3 A;  4UUT A;  5L3C A;  1ZRF A;  3PO3 J;  5EZG A;  3S3M A;  1YOV B;  5FRO A;  2HYG D;  2Z1D A;  3BR5 A;  1W0U A;  4X1E A;  2O7O A;  2BBY A;  4TMW A;  2QE7 A;  1W2B B;  2PMD A;  5F6F A;  4DQK A;  2VT3 A;  1Q7Y D;  1TLL A;  2L4M A;  2V7F A;  2KJC A;  2C4U A;  3CDH A;  2LMD A;  1FPQ A;  1W4M A;  2L9V A;  3PO2 J;  4PGG A;  2V4J C;  5FO0 A;  2ZTN A;  4HNU A;  1K61 A;  2OUM A;  3LO8 A;  2VKD A;  1ZG3 A;  3B78 A;  1MJA A;  1DDN A;  1QFZ A;  1AA7 A;  2AO9 A;  2MH9 A;  2INV A;  2IS1 A;  1KON A;  3RIQ A;  1WOP A;  4R79 A;  1H42 A;  4CUG A;  4NC7 A;  3R0A A;  5HOD A;  2FML A;  3V42 A;  4BU2 A;  3C2G A;  4C9Y A;  1OGJ A;  1QRC A;  3G1L A;  3BDD A;  2A69 F;  3DPL C;  5CPR B;  1WZ2 A;  1FLI A;  1XGM A;  5FLV A;  2HYF A;  3HOZ J;  2IEK A;  3FPP A;  3PA1 A;  3DFG A;  3CCV B;  4H4K C;  1WWX A;  1Y0R A;  3BRO A;  4KIC A;  2HEO A;  3BJO A;  3WG9 A;  1O3T A;  4P6Y A;  2CWE A;  3NRV A;  4KMU X;  3VST A;  4C30 A;  3PQJ A;  1RES A;  1R9T J;  3S3N A;  2GK6 A;  1PJR A;  2NXN B;  4ZCM A;  2HOE A;  2MG4 A;  1NRK A;  1TQI A;  4V19 K;  2LY9 A;  1A31 A;  1VQL B;  3OZU A;  2XRL A;  4HX4 A;  2FSW A;  3WYA A;  5ILV A;  3CCL B;  1U9O A;  2XRO A;  1KD1 D;  1W0K A;  2WY8 Q;  4KJZ A;  1Z67 A;  3A0B C;  2DTZ A;  3VO1 A;  4HOB A;  5D5U B;  3L2R A;  2IOU G;  2PYH A;  1LFU P;  3OYK A;  3GQB A;  4WCG A;  4A5N A;  2R92 J;  1CGP A;  3BZK A;  1OKR A;  1V54 H;  1WFX A;  3RYR A;  2L54 A;  2GK7 A;  4BDZ A;  1XCV A;  4WWC A;  1XGN A;  2JDI A;  4S04 A;  4KIS A;  3F23 A;  3SYT A;  2JPB A;  2LP0 A;  3K4L A;  2XZO A;  1O8L A;  1ZM4 A;  2RGV A;  1B9M A;  3M8J A;  4A0Y A;  2H6B A;  2J5O A;  1FT9 A;  2R3S A;  4PZJ A;  3CLQ A;  4CCM A;  5H5J A;  2DPU A;  1TP4 A;  1VQ6 B;  3E1S A;  3ZMV A;  1NK3 P;  2XPV A;  4M6X A;  1FJL A;  2X9D A;  1G7S A;  3HRM A;  1YIO A;  1QRY A;  2EZL A;  1LDJ A;  4ZC3 A;  4HE5 A;  3W2G A;  3F8B A;  2CW8 A;  2X1E A;  3P9I A;  3HGY A;  4L0Y B;  2OQG A;  3MFK A;  1QFJ A;  5A2Q K;  2V7Q A;  1G3Y A;  1ZAO A;  4Y4R A;  1YS6 A;  3G1O A;  3WTV C;  3S1N J;  2ELJ A;  2KHM A;  4L9N A;  3GIR A;  4LB6 B;  5F4J A;  1EP1 B;  3JQP A;  1ETX A;  2ZJR F;  1KK3 A;  1MMD A;  3KX2 A;  5FO5 A;  2VKV A;  2VAS A;  2XB5 A;  2QSH X;  1D2E A;  5F0F A;  2OTJ B;  1IAW A;  4G1B A;  3A0H C;  1KRH A;  2RC6 A;  2WZN A;  5IY5 H;  5IYR A;  1HSJ A;  3GSI A;  4E7Z A;  1S3J A;  1WSU A;  2VFQ A;  2IQ7 A;  4AWX B;  3J7A O;  3OPO A;  1HG8 A;  3GTJ J;  3EPZ A;  3ZC3 A;  1NHC A;  3T56 B;  3CF5 F;  2FU4 A;  1FOK A;  1IN7 A;  3C2B A;  5DV5 A;  1VQ4 B;  4X06 A;  2HZD A;  5DDG A;  3MAJ A;  5IYD J;  2Q1Z B;  3FBI B;  4YAL A;  1BJA A;  2B7B A;  3RKY A;  2XTY A;  1M1E B;  4U4B A;  1SFO J;  4TT3 A;  3SKB A;  1QVT A;  3N6Z A;  2DOD A;  2YS9 A;  4X7F A;  1H89 C;  2PJR B;  2EBI A;  4L5E A;  4W8S A;  4DNC A;  3GFM A;  1O57 A;  3H5A A;  1R5N A;  2ZXI A;  2BF4 A;  2D2W A;  4JYK A;  3WU2 C;  4TSF A;  2KRC A;  2HNH A;  2BOL A;  1ORK A;  2GIV A;  1ZGJ A;  4JBA A;  4EJO A;  1USS A;  2ELH A;  5BPI A;  1D8J A;  4CXF A;  4BAC A;  2HDC A;  4QSH A;  3PA2 A;  3GXO A;  2OYN A;  4FN5 A;  4ASN A;  2V6C A;  4BL0 B;  1N0V C;  3F22 A;  2OF7 A;  1IGN A;  4IOC F;  4LC0 A;  1PYV A;  4PC1 A;  3AG2 H;  2M8G X;  3E6D A;  2DYR H;  1KU2 A;  4FIS A;  2IS6 A;  1GT0 C;  3BG5 A;  4MEY F;  2GQF A;  3OS2 A;  1E79 A;  4A0X A;  2EWE A;  1OFM A;  1JRG A;  2OTL I;  4C43 A;  1B6A A;  1W87 A;  4NNJ A;  1IDJ A;  1HDD C;  3SYJ A;  4KIG A;  4QLC U;  5IK2 A;  2FE3 A;  1IZ1 A;  2B5O A;  4P6V F;  1OGM X;  5F0C A;  2DK8 A;  2WY7 Q;  3WU1 B;  3G4S I;  2CV2 A;  2ZZQ A;  2X8K A;  1M1K D;  3OIQ A;  2WAQ N;  2Z2S B;  3MZH A;  4AF7 A;  2HQR A;  1XQB A;  3Q0V A;  5FNZ A;  4RCZ A;  5C44 J;  3OYM A;  3EET A;  1R58 A;  3VYU B;  1J0R A;  4C2M J;  3V7A A;  1AIR A;  2XAG A;  1S7A A;  2IXS A;  1JJ6 C;  2DBB A;  2LR8 A;  4YFX F;  1XG2 A;  2MC4 A;  1ZM3 A;  2VBM A;  3S1R J;  2JK3 A;  1CF7 B;  1RUN A;  3OY9 A;  4G5G A;  3BP8 A;  3C7J A;  1T56 A;  4NC6 A;  1PJ5 A;  3RKX A;  1LLZ A;  3RQI A;  4ZDO A;  4OIP F;  4B44 A;  2I8D A;  3AVV A;  5DS0 A;  2CBX A;  2LF7 A;  1R4N B;  1YRN B;  1S5L C;  2BM0 A;  3GCM A;  3PFI A;  2M7B A;  1G59 A;  4N9H A;  2JIZ A;  4L9J A;  2OQR A;  3ESW B;  1WOO A;  1YX3 A;  1QGP A;  3WG7 H;  2F1M A;  1BN8 A;  2E1O A;  1VQN B;  4E7K A;  3DU5 A;  2DDA A;  5ICF A;  2VQC A;  4PFO A;  5BMZ A;  3FIW A;  1QUE A;  3N05 A;  5H20 A;  2KKO A;  3V8L A;  3O2P E;  3SXY A;  2LF8 A;  1GV2 A;  5HDK A;  4II3 A;  2OZ6 A;  1B9N A;  5L3B A;  5HNH A;  4BJ5 C;  1Y6I A;  2RKH A;  2WYR A;  2CH0 A;  1RMG A;  1X1A A;  3K4B A;  2VUM J;  2BMW A;  1HKS A;  4U0V A;  2QTL A;  3T1B A;  1KU7 A;  1FRN A;  1D8K A;  2P6T A;  4QVA A;  1HOM A;  4X05 A;  4LLG F;  1ZHF A;  1YIJ B;  3W2E A;  2NZM A;  5JVG F;  3K10 A;  3G73 A;  2NTP A;  2K9S A;  2HFH A;  4HA8 A;  4XQF A;  2QBY B;  4E7I A;  1XDU A;  3O8G A;  4HG2 A;  4V2F A;  4UB8 C;  3CJT B;  1EH8 A;  2QY1 A;  1LDD A;  1MMS A;  2F6C A;  3PUM A;  4LK0 F;  2L7M P;  5EF6 A;  4XL9 A;  4X6A J;  1H85 A;  3GEZ A;  3ZBT A;  5BQT A;  2AHO A;  5D6E A;  3GME A;  1RU4 A;  2Y9Z A;  4P2N A;  2XHK A;  1MJ9 A;  4M3D A;  2M87 A;  4N9I A;  5GTH C;  2V5I A;  3RPU D;  1F1Z A;  4M3F A;  3F9K A;  5KNL A;  2V1D A;  2CU7 A;  2YPR A;  1T8I A;  4A5M A;  4FWT A;  4RM3 A;  1VQP B;  4L9T A;  4BY7 J;  2EV6 A;  3GVK A;  3UNG C;  1G4D A;  2XGJ A;  2LKX A;  3JUR A;  3DKW A;  5DYM A;  2E7W A;  1D1C A;  2PQ8 A;  4Z03 A;  5AON A;  4YFO A;  1R7J A;  2E60 A;  4RD1 A;  4XD7 A;  1KQ0 A;  3JQR A;  3LA3 A;  1OCC H;  2XGE A;  3K2A A;  2Z9O A;  4G6T B;  1IN6 A;  3ISP A;  1VQ6 I;  5B1A H;  2OPT A;  4KN7 X;  2YU9 J;  1W34 A;  1AKH B;  3A3B A;  1DBG A;  3DU1 X;  1XMA A;  3I4P A;  5J4V A;  2V4D A;  1KTV A;  3AG4 H;  4MXN A;  3ZR8 X;  1GR1 A;  5AIQ A;  2ZBV A;  3ASR A;  2VXZ A;  1PUF A;  4GGG A;  3JSO A;  1DU6 A;  2VBX A;  4N4O B;  2OBT A;  3PIO F;  1WU8 A;  4M3B A;  1BA5 A;  3SFZ A;  5GAG J;  2WR8 A;  2AQE A;  1GXQ A;  2QEX B;  3B90 A;  1K5C A;  1O3S A;  2FQ4 A;  2A61 A;  3HKZ N;  4CCK A;  2IP2 A;  2WAQ A;  4DK0 A;  4JP0 A;  3BG6 A;  2F48 A;  2GIZ A;  2W57 A;  5TJJ A;  5IP6 A;  5A89 A;  3L2C A;  2V7W A;  2BY1 A;  2Z6B D;  1WJA A;  4MTE A;  1D1N A;  2DOE A;  2VJ5 A;  4M9S A;  1O8E A;  3LOC A;  1CNE A;  2EIJ H;  3MCZ A;  3O3K A;  4ESJ A;  1FDR A;  4RA2 A;  3NAU A;  2HDN B;  2KRF A;  1DP7 P;  5EJC A;  4NQW B;  4CZC A;  1K73 D;  2PLF A;  4LD5 A;  1C0W A;  4P3Y A;  4ENK A;  4IHT A;  4CIC A;  4U49 A;  3VDX A;  2L01 A;  5HXB A;  1IA5 A;  4YHB A;  3TO7 A;  2BHY A;  1DDI A;  1XDS A;  3FXQ A;  1A35 A;  4D5F A;  4ZCI A;  3A01 A;  3K6G A;  4ZYH A;  3M8F A;  1FOX A;  2CRV A;  3CCS B;  2VQH A;  1F5T A;  4U0W A;  3OYJ A;  1OCO H;  2JUG A;  2JZY A;  1YLF A;  4NUB A;  5GPA A;  3ZPN A;  1O8J A;  5B5E C;  1N75 A;  2DOA A;  5B66 C;  2A68 F;  1L3L A;  2DJN A;  2ZJQ F;  1VQ8 B;  4YFN F;  4YZX A;  3SJP A;  3FMS A;  1EH6 A;  4RM2 A;  3SQV A;  3N90 A;  2RV8 A;  3F6V A;  1U5T C;  2Q6K A;  3S3O A;  2XZL A;  3FY3 A;  5LHH A;  1PJ6 A;  1TWH J;  3FZV A;  1S29 A;  1KGS A;  2HZT A;  2DMT A;  1RR7 A;  4YIF A;  4S05 A;  4QTR A;  3LSP A;  1Y1V J;  1RRJ A;  4Y7C A;  3WGH A;  1IN8 A;  2HDD A;  3S32 A;  2E5Z A;  1UCR A;  3PL8 A;  1XSD A;  2ZNY A;  2RVC A;  5K5R A;  2JA5 J;  3HOU J;  1OHH A;  1ETV A;  4WZT A;  1I39 A;  1WI9 A;  2UV1 A;  2MD0 A;  2R9V A;  5H6Q A;  1VBL A;  1UG2 A;  2JPC A;  3R60 A;  2FEZ A;  2DOF A;  1JA1 A;  4RGX A;  2GA1 A;  2KMU A;  1OB0 A;  4W8T A;  2CQX A;  3RPU A;  4Q5S F;  3FXR A;  4LBZ A;  4EJW A;  3L7W A;  2R7D A;  1EV7 A;  2CS3 A;  1BLI A;  4WXC A;  3QYE A;  3HOS A;  4O3M A;  3ZBU A;  4HEA 2;  1B72 B;  2E2H J;  4U7B A;  3TED A;  5F27 A;  5E79 C;  2M0C A;  2IVM A;  3HOX J;  2M1B A;  4FQG A;  5JLX A;  5KK1 A;  2MBF A;  1O3Q A;  3A03 A;  1YJN I;  2GXG A;  1YJW B;  3S8P A;  3LYC A;  1QCX A;  3CDI A;  1H8H A;  1KMH A;  2F1L A;  3GVL A;  5E3M A;  3OEE A;  4Z4U A;  2HKO A;  1OYI A;  1LVA A;  2M34 A;  3OSF A;  3ZQC A;  2K86 A;  3FDY A;  1AMO A;  1U5T A;  4RD3 A;  1E64 A;  3H9N A;  4X7C A;  1SMT A;  2P5K A;  4CSW A;  2ME0 A;  3GLL A;  2C6Y A;  2PJR A;  4PC2 A;  1L0O C;  2FBI A;  3TBI A;  2K4B A;  4CYD A;  2EV5 A;  2W7N A;  2JQ7 A;  1H8E A;  2V7U A;  2O9L A;  2E71 A;  4LIV A;  1YS7 A;  2UVF A;  2CUZ A;  5J6X A;  2NVT J;  3IWZ A;  3FIS A;  5CVV A;  5TIS C;  1YO5 C;  2QF7 A;  2ZME C;  2XGX A;  1B4A A;  3GQ8 A;  2LY1 A;  4PUS A;  3DPU A;  3E97 A;  3I56 I;  2C5H A;  4AC9 A;  3VYS B;  1WOR A;  1G7R A;  2DER A;  1JJ2 B;  1O4X A;  2ISZ A;  1ZKG A;  3SEZ A;  3ZMU A;  1J09 A;  1QJV A;  2Z3Y A;  2G9W A;  3U6K A;  4GDF A;  3CJQ B;  3S2D J;  5E20 A;  1SD6 A;  2BV3 A;  2UXN A;  1RC9 A;  3ZZ0 A;  2VBV A;  4IPA A;  5IP7 J;  5HKK A;  5LMZ A;  3CQZ J;  3ZQH A;  4Y13 A;  4WZL A;  5C4J J;  4M3E A;  5TGT A;  2DI3 A;  4I7H A;  3PSI A;  4XSZ F;  4DBR A;  1WH5 A;  4YIR X;  2H8R A;  1I8D A;  3PFY A;  4IQ4 A;  4IHW A;  2L4A A;  1ITY A;  2BM7 A;  3CMY A;  5BPD A;  1E17 A;  2ZTG A;  3GW2 A;  5HZB A;  1TWG J;  1U6G A;  4I09 A;  3K70 D;  1FP2 A;  2OD5 A;  2E34 A;  4KDP A;  1F20 A;  3OS1 A;  1U8R A;  1EP3 B;  3W2V A;  2JMW A;  2K27 A;  3KEW A;  4A2U A;  2XKO A;  1X3W B;  1SAU A;  1CF7 A;  5HS8 A;  5HS9 A;  2NRA C;  2LZJ A;  1S4M A;  4EJU A;  4H9G A;  3QSY A;  2FBH A;  3ASO H;  4XR6 A;  4BEH B;  5E3N A;  2ZSI B;  2ZME A;  2VE8 A;  1G2H A;  4Z4Z A;  4AVZ A;  4YEL A;  1ZK8 A;  3PUB A;  1QA2 A;  3CMA I;  3T53 B;  2XUB A;  2QYU A;  2VNK A;  1YRN A;  2Q2E A;  1R5I D;  2A3S A;  2LRE A;  2STT A;  3HBL A;  2CK3 A;  4E7H A;  3NAR A;  2MH2 A;  2CC2 A;  1G3S A;  2VFN A;  4D9J A;  4AIK A;  4Y7N J;  4JMQ A;  3IH4 A;  1HBX G;  2R7X A;  4IJA A;  3VYT B;  2ZJP F;  4PAA A;  1APL C;  1G7T A;  1P6R A;  2LTP A;  3R6S A;  1K78 A;  4XLH A;  1Z9C A;  1HC8 A;  4FET A;  6PAX A;  1XB2 A;  4WX9 A;  5L3E A;  1S0U A;  2V1N A;  1YHQ B;  3VMF A;  1GUU A;  2K7L A;  1YYV A;  2CMP A;  2DT5 A;  2DT7 B;  5HDG A;  3WND A;  2FUG 2;  1GJR A;  4ZYG A;  3P5J A;  4RD6 A;  3LJY A;  2EIK H;  3F6O A;  3H92 A;  2DT6 A;  1VI0 A;  2ZC2 A;  4Z4R A;  4JRA C;  1P4W A;  2ZO4 A;  2QBY A;  1FNB A;  2DQR A;  4BXX J;  2I5U A;  3ZQQ A;  1EZG A;  3FK6 A;  1XGO A;  1ERD A;  1T2K A;  4ENN A;  2N8G A;  4RAG A;  4ON0 A;  3GFI A;  3K70 C;  2QTZ A;  2E5N A;  3OW2 B;  2CUF A;  2DO7 A;  1XSX A;  1ACI A;  1LLW A;  4BDY A;  4OIQ F;  1JGG A;  3LQE A;  2K4J A;  2M0M A;  3TOA A;  1AOY A;  3L1P A;  1LPQ A;  5C4X J;  1BIB A;  4IZZ A;  3LA2 A;  2HYJ A;  4KT5 C;  4NHJ A;  1ZLJ A;  2F4I A;  5DTD A;  4E4H A;  4B3F X;  1I1S A;  4RPB A;  3PM1 A;  1EJ9 A;  1GXP A;  2F5V A;  3I58 A;  5D5W B;  1E2X A;  1V5G A;  1JUS A;  1IB0 A;  2NOJ B;  2Y75 A;  1E63 A;  1KYW A;  2KFD A;  3EUK L;  2V9P A;  4A3G J;  1ULY A;  3OEH A;  3VNU A;  2NTQ A;  1SFK A;  3CCS I;  1V5F A;  5KW9 A;  3BH6 B;  2L3D A;  3LQQ A;  1AKH A;  3ABM H;  4MEX F;  1XMX A;  5J8F A;  3I9V 2;  2R7O A;  2ACJ A;  1HF2 A;  3Q9V A;  5GTI C;  4OPS A;  5E8G A;  3K7A J;  3CRZ A;  2LKS A;  3I55 I;  3G6E I;  2YWE A;  2UUZ A;  3G1M A;  2E1M C;  5HOO A;  1IO2 A;  3JRA A;  2P5L C;  4L8J A;  2IGK A;  4M0L A;  5LD2 C;  2NV4 A;  1FTT A;  2OBR A;  2HLD A;  2ID6 A;  2Q8K A;  5LBQ A;  2DFF A;  1MSF C;  3A3G A;  4XLE A;  2D3L A;  3SEJ A;  4Z4W A;  3D5L A;  3WOD F;  1QNT A;  2WAD A;  4ETS A;  1ZH5 A;  1YW9 A;  5ICE A;  4RPD A;  5FIU A;  1QVG B;  3EUA A;  3K4J A;  2JWT A;  2XGD A;  2EFG A;  2WAF A;  3VEP A;  2BE5 F;  3CMM A;  4I84 A;  5ICG A;  3KZY A;  1MND A;  2XF7 A;  3RZO J;  2O03 A;  1OPC A;  5JVT A;  2E1B A;  2X6W A;  2CO5 A;  1J5Y A;  3N97 A;  4TMZ A;  3MEX A;  2DA3 A;  2QLZ A;  1WRJ A;  2X85 A;  2XSD C;  4BE0 A;  3AL0 C;  1UEL B;  3L00 A;  1IDZ A;  4CYC B;  3DBR B;  5M5X J;  4N4N B;  3OOU A;  4TMV A;  3SLD A;  3CCR B;  1T6Z A;  4DJA A;  1Q1H A;  3JAM Z;  1BI3 A;  4YAU A;  2VIX A;  4I02 A;  1KZH A;  5A8A A;  2DMQ A;  2DA2 A;  2VOO A;  2LC2 A;  4I0B A;  1FIA A;  4F93 B;  4XRF A;  4EGZ A;  1KQ8 A;  4E6K G;  1X3Z B;  2OV7 A;  3OZV A;  4FAS D;  3FWE A;  4RGU A;  3Q0U A;  5J4Y A;  3BQJ A;  2COB A;  5HDN A;  5D5X B;  2ZXH A;  3F21 A;  4D1Q A;  2JA2 A;  2Q6I A;  2OTL B;  4P1V A;  1VF7 A;  2O3F A;  1WCM J;  4JX4 A;  2VFO A;  5LGT A;  3ULQ B;  5JR3 A;  4CH7 A;  1I5Z A;  2JSC A;  3G4S B;  3REO A;  1IXC A;  3K0L A;  2KDO A;  1Z3Y A;  2WC2 A;  3FXU A;  4BJT A;  3CCU I;  3I0T A;  2HMA A;  1MMN A;  3M3Y J;  1FYK A;  4UZF A;  3KP3 A;  5FFX A;  4PCQ A;  3DCF A;  1N07 A;  4EM2 A;  4F52 A;  1K79 A;  2C4T A;  3OYN A;  2J5P A;  3KPH A;  3RQ4 A;  2LH9 A;  3U2R A;  1IDK A;  1OB5 A;  4HDV A;  5J8C A;  4Y52 J;  1DP3 A;  5ILU A;  5EEA A;  1Y39 A;  2EFO A;  1R1T A;  3I59 B;  3QPT A;  1BC8 C;  4CO8 A;  1J9Z A;  2HOA A;  4A0Z A;  4F55 A;  1FYL A;  1Z91 A;  3I5U A;  4XON A;  4QUZ A;  2DA5 A;  1R5O A;  3CES A;  4KH3 A;  2VXD A;  2Y0S N;  1KK1 A;  2PG4 A;  4MIM A;  2KIU A;  3G05 A;  4UXN A;  1X2N A;  2XIG A;  1Q86 D;  3FK7 A;  2W1O A;  2QYO A;  1MBJ A;  3TKY A;  5E8I A;  2X3H A;  4RB1 A;  2KJB A;  3Q5F A;  1KU3 A;  3C18 A;  3D0S A;  3ZMZ A;  5M5W J;  5D8K B;  2IAI A;  1R22 A;  2K9N A;  3DV8 A;  5K7H A;  4MR0 A;  2STW A;  1OFC X;  2ZXJ A;  4WZK A;  4HIZ A;  4DYQ A;  4G9Y A;  3EYY A;  1WSR A;  2OAZ A;  1HZE A;  4N3G A;  4W8Q A;  4OWR B;  3HSE A;  4RAF A;  2HCJ B;  3VR6 A;  4OPW A;  4XKC A;  2EFW A;  2CV1 A;  2VZL A;  4B48 A;  4EVI A;  3O6B B;  4XIC A;  1PUF B;  1OOC A;  3FKI J;  1FX7 A;  4G7X A;  4TV7 A;  1UHW A;  1KYZ A;  3M7G A;  1D0Y A;  3Q0W A;  3OYL A;  2DA4 A;  2PLY A;  2X53 S;  2AHQ A;  4ENJ A;  2ZZF A;  3V7R A;  4TMT A;  3H1C A;  2R7Q A;  3ZIA A;  2ICW G;  1IC8 A;  1MIJ A;  3ZZT A;  1OGO X;  3BQY A;  1YHQ I;  3Q3A A;  2IS4 A;  4RDK A;  4XLC A;  5FLM J;  2W6J A;  2HVQ A;  3PSZ A;  1K8A D;  1M90 D;  1XC5 A;  1EFR A;  1R5G A;  4IOA F;  3VSU A;  4IHX A;  2MGQ A;  1QU3 A;  2QGG A;  1HDP A;  2XC7 A;  4UVC A;  3D26 A;  1ELO A;  5FJ8 J;  3QPL A;  4Y3O A;  2CGP A;  1K6Y A;  2BVL A;  3BQZ A;  1T33 A;  1W0T A;  3ROU A;  4QHY A;  2MC3 A;  5A88 A;  3ZSC A;  3FM5 A;  3JRB A;  2FA5 A;  1E1R A;  3FXO A;  4K2E A;  4BEH A;  4DQL A;  2O0V A;  1DPU A;  2QGU A;  3P7N A;  1LJ9 A;  3A01 B;  2I1L A;  3RY8 A;  3U21 A;  3WTZ A;  3RI4 A;  1OYW A;  1MAB A;  4EEF G;  4A69 C;  5K1Y A;  4BHB A;  4NK8 A;  3ZQG A;  4XN0 A;  3M1C A;  1WJD A;  3DXJ F;  3ABU A;  2CUJ A;  3HOW J;  3I71 A;  5L3G A;  1O8G A;  2DCU A;  4NB5 A;  1U8B A;  4PGO A;  4BQO A;  1GVH A;  3VMW A;  3HTU A;  4XMY A;  3BCD A;  2MSY A;  4Z4Y A;  2BW3 B;  3ZRG A;  3SLN A;  1MBE A;  1F4K A;  1VHO A;  3IRR A;  4ROX A;  3CC2 B;  1X4O A;  1QPM A;  2KLO A;  3LNN A;  5E6T A;  3WBJ A;  2YR2 A;  1JE8 A;  2HR3 A;  4FE7 A;  5K7Z A;  3S15 J;  3FM3 A;  4OOV A;  2L02 A;  2ZBK A;  3WTW C;  3CCQ I;  2M5S A;  3BY1 A;  3JAM K;  2DMN A;  2PMU A;  3BCA A;  5GP9 A;  3H3V K;  1ZAR A;  3KET A;  2Q6O A;  3A35 A;  1UD3 A;  2FOW A;  1R1V A;  2QXZ A;  1E3H A;  4XKV A;  1QG0 A;  1FBU A;  4KIB A;  1B1B A;  3CLO A;  1IXR C;  1VQK I;  4HZF A;  1MD0 A;  1EXM A;  1XX5 A;  3L2Q A;  3BH7 B;  2CW5 A;  3HUG A;  4HW0 A;  2NNY A;  1SVL A;  1EP2 B;  1JGS A;  1Q9S A;  3OS0 A;  2Y0S A;  3CCJ I;  1BW5 A;  5FD5 A;  4FT8 A;  3W6V A;  3ZP5 A;  1ZRE A;  4MHG A;  4GCV A;  3ABK H;  3AVY A;  4P1W A;  1TTY A;  4UVA A;  1XCB A;  5EZH A;  1RNL A;  2DN0 A;  4IL6 C;  2HTS A;  5JI6 A;  1FEX A;  4M53 A;  3B02 A;  2XEX A;  1FWZ A;  1P9Q C;  4AC0 A;  4OIO F;  2OK8 A;  3OJW A;  4RM0 A;  2P0W A;  1PE9 A;  1U5T B;  5CJ9 A;  3AAF A;  2BSP A;  3IAS 2;  3VFZ A;  1XFO A;  2M3A A;  1I6X A;  5EYR A;  4EJV A;  2VT2 A;  3WE2 A;  3BJ6 A;  3K4K A;  2RNG A;  2KRH A;  1BW6 A;  2MLK A;  1NHA A;  1A36 A;  3HL2 A;  2YWF A;  4KKT A;  3LWF A;  4AIJ A;  2K02 A;  3CCR I;  2JJ2 A;  2JSP A;  2OCC H;  2V1X A;  2XC1 A;  2FQ3 A;  1COW A;  4OJL A;  2M45 A;  3KEQ A;  1WI3 A;  4TKO B;  4BQA A;  5GAH J;  3VSK A;  4XRS A;  1KCD A;  3HPH A;  3DEW A;  1FOY A;  5HVQ C;  1R00 A;  2DYS H;  4A6D A;  5GV7 A;  3DTK A;  2KL4 A;  4R1H A;  1WQ2 A;  5CVI A;  2Z5U A;  1OLT A;  5DUI A;  3LMW A;  4M73 A;  4LJZ F;  2QVO A;  3OV8 A;  1JT6 A;  3K69 A;  3CF2 A;  1FC3 A;  4UV8 A;  1YQA A;  3GQ9 A;  3QFR A;  2A5Y B;  2BHZ A;  2FOK A;  1EE6 A;  1L1I A;  1GDT A;  3ECO A;  1YJN B;  1E3O C;  4Y9R A;  2VQG A;  1F60 A;  2B63 J;  4XNF A;  2WSS A;  3ZQF A;  1P4X A;  3E6C C;  3LL7 A;  4JX6 A;  4J01 A;  4DQ2 A;  2DTR A;  1QGY A;  3JU4 A;  2YX7 A;  3QFS A;  2E35 A;  1LEA A;  1O8K A;  2CW0 F;  3A8J A;  1ZG1 A;  3BZ6 A;  2WB1 A;  2IS2 A;  2XF6 A;  2IRF G;  3HTS B;  4KFC A;  5CDF A;  1MKM A;  4CYC A;  4IRG A;  2ZME B;  1B8I B;  2BN4 A;  4G94 A;  3B4N A;  3FHN A;  4P55 A;  3QOD A;  1UG0 A;  1OCR H;  5E3O A;  3WXM A;  1GAQ A;  1QA1 A;  3DTI A;  3B6C A;  1ETW A;  3G2B A;  2Q2E B;  1K7A A;  3TDU C;  1CLW A;  1PLU A;  3NEU A;  3I56 B;  4PC6 A;  5BS6 A;  1SM4 A;  2NVX J;  3P9K A;  1I1G A;  3J81 Z;  4KYW A;  2F5F A;  4LLL A;  3TP0 A;  3AVT A;  1T6X A;  1D1A A;  3WHC A;  1W9X A;  3E5U A;  1LNW A;  3MZ8 A;  2VBU A;  4AYB N;  3JRD A;  4ZYE A;  3FX3 A;  2EZH A;  5IYC J;  1R36 A;  4O5V A;  3AVU A;  1K78 B;  4H0E A;  3U9G A;  4C2U A;  5F4M A;  3G71 B;  3KL9 A;  3L2W A;  1OJL A;  3ZPP A;  4DOZ A;  1OFD A;  3PNY A;  1O8D A;  2BXZ A;  3BC8 A;  4I99 C;  3DLA A;  3W2I A;  2ETH A;  1PUE E;  3QU6 A;  1VTN C;  4R8H A;  3W2W A;  1BBY A;  2R7V A;  2IA1 A;  1IRX A;  5BNG A;  4YEI A;  2LOO A;  1OCT C;  5H59 A;  1YTY A;  1SAX A;  4IRH A;  1BL0 A;  4KIF A;  3I59 A;  3W5V A;  4C3H J;  2JTV A;  3Q6R A;  3JRC A;  1QX4 A;  1EWY A;  2W24 A;  2Z99 A;  4YII A;  3S2W A;  4XRM A;  1AU7 A;  2VJI A;  3CMA B;  3HSF A;  1ON2 A;  1GVD A;  1Q1V A;  1SD7 A;  1N06 A;  4X07 A;  1KC8 D;  4YZQ A;  3T51 B;  3WWG A;  2NNN A;  4YDT A;  2L0K A;  4BH9 A;  5LFA A;  2JVH A;  1EA0 A;  3JRH A;  2GXB A;  1LEB A;  1W7P B;  5FKL A;  2AS5 F;  1NB0 A;  1MDM A;  3BOQ A;  4Q7J B;  2INU A;  3WY9 A;  2G0Y A;  4M4S A;  1F43 A;  2WA0 A;  2AQF A;  1H8A C;  3LA7 A;  1QVU A;  2L7K A;  3A1Y A;  3SZG A;  1QA6 A;  4DIQ A;  1MMA A;  1X1D A;  2CQQ A;  2K9L A;  4HNV A;  1UHM A;  2ZKZ A;  3K9T A;  5C1C A;  3OYE A;  3WTY C;  2V79 A;  3ONQ A;  3H3Z A;  1JB9 A;  4QFM A;  4ZV4 A;  2LBF A;  2P8T A;  2L2O A;  3H5N A;  4M6Y A;  2XT4 A;  4URR A;  2PE3 A;  2CND A;  2K85 A;  2CUE A;  5E1Z B;  1IHM A;  4AF6 A;  3D1N I;  3V7S A;  1K4T A;  4ANJ A;  4G7H F;  4QVJ A;  2X6X A;  2BGI A;  2XKP A;  4P9F A;  1P92 A;  4HF0 A;  4OOS A;  5KAI C;  3NQO A;  4B3G A;  3JSP A;  3U2Q A;  5JHU A;  2JN9 A;  1W5S A;  2Q0O A;  3CC2 I;  1V3F A;  5J1R A;  3MCA A;  1FSE A;  1JXS A;  4I98 B;  1XS9 A;  4ZJZ A;  4HV6 A;  1QFY A;  4PDK A;  3QYF A;  3AG3 H;  2EA4 A;  3PSS A;  3GBG A;  5CVJ A;  3HYI A;  3WQZ A;  1H88 C;  5KCM A;  1Z7L A;  3GX4 X;  2HOS A;  5E1X A;  1IRZ A;  2JA6 J;  2GLO A;  3I4M J;  4YAF A;  2PFB A;  2EFP A;  2PYG A;  3FMQ A;  3IH3 A;  4BHP A;  1YG2 A;  3H36 A;  1J59 A;  2LVS A;  3HPG A;  3L9F A;  2XAS A;  3QWL A;  3OR1 C;  3R6K A;  1CZF A;  1S6L A;  1K83 J;  3BR2 A;  2W85 A;  3JQQ A;  5FA6 A;  4A12 A;  2JN6 A;  1IJF A;  3ZZU A;  2XTW A;  1I6H J;  2F4N A;  3HRT A;  2VI6 A;  1POG A;  3OSG A;  2HPM A;  1XMK A;  4IW3 B;  2KP6 A;  1SMY F;  4UZE A;  1MNE A;  3IKV A;  5FGM A;  1K4Z A;  4PMH A;  4AYB A;  3CUQ B;  1LDK B;  3BG9 A;  3LSH A;  4U87 A;  2E1M B;  3H9Q A;  2NPF A;  5IT3 A;  4XKW A;  2ZL5 A;  3I55 B;  3G6E B;  4CQJ A;  2LFB A;  1TBX A;  2L7F P;  1Z7U A;  4WQM A;  2IBD A;  2BW3 A;  4G8X A;  1WHU A;  1H9T A;  1NJI D;  3J80 Z;  1WSV A;  2EIX A;  3R6J A;  4HWV A;  2ZL6 A;  2EJR A;  4S0H B;  4M9X A;  2F3L A;  2UVE A;  3P9C A;  3ASS A;  3E3V A;  5THX A;  1Y56 A;  2RQQ A;  5LGU A;  3CTA A;  1U0J A;  3F8C A;  5HS7 A;  1WOS A;  1DG1 G;  1QUF A;  3EQL F;  3NB2 A;  4ZTJ A;  3Q9S A;  3WGG A;  4FX0 A;  1ZM2 A;  3MVP A;  4RB0 A;  2MA3 A;  2Y48 A;  2FMY A;  1E3P A;  1F9N A;  1HVX A;  1FMW A;  2GOX B;  4GYI A;  3AL0 B;  1R4M B;  2ZB9 A;  5LRS A;  3QFT A;  4PJM A;  1Y8R B;  2CV0 A;  2EWN A;  2HU9 A;  3KLO A;  2C2W A;  4GXO A;  1D8T A;  1P4M A;  5J35 A;  5ED4 A;  4NDL A;  4Z6Y A;  1ZGA A;  3B8Y A;  2QSG X;  1QA3 A;  4A3K J;  3SQN A;  2FNA A;  2V31 A;  3SDB A;  3AGQ A;  2L7Z A;  3BTL A;  4YZ0 A;  3KP2 A;  3V7C A;  2QSF X;  4YZA A;  1HKQ A;  2WZP P;  1O7F A;  3D5R C;  2DYI A;  5E3L A;  1V0F A;  1Z0X A;  2ECC A;  3MQ0 A;  3QE2 A;  4RBO A;  3LSM A;  1QO0 D;  3KP4 A;  4RS8 A;  1ZM9 A;  2VBS A;  2YWH A;  1KK2 A;  2IJL A;  1TNT A;  4HSR A;  4CCO A;  3TW7 A;  3RSN A;  4BBR J;  1JKQ C;  2NVY J;  3GTL J;  5D5V B;  5L46 A;  4MGR A;  4M6V A;  3TMO A;  2OZU A;  1LVK A;  5CVU A;  2M5W A;  5BOX A;  2ESN A;  1W7P D;  3X2Q H;  3EQN A;  3E1Y E;  2TRT A;  4RB2 C;  4LLN A;  1TYV A;  5HNF A;  5EGO B;  2QEN A;  2K9M A;  4L0Z B;  2DFI A;  3TDZ C;  4RDJ A;  4DNT B;  3CCU B;  1KA8 A;  3DBL B;  3F3X A;  4B3X A;  2OBS A;  2V7X A;  2M7A A;  2LKP A;  5JBQ A;  1CQX A;  2EZI A;  2LY2 A;  1HA8 A;  1JI8 A;  1EFU A;  2R7S A;  1JHH A;  4C2T A;  3CD6 I;  3I3L A;  2BGC A;  3V8J A;  2OU2 A;  3HOY J;  2NYX A;  1EKE A;  4V2G A;  4Y15 A;  2WJY A;  4TN1 A;  3DDY A;  2VN2 A;  4BJ6 C;  2ESH A;  3MMP A;  4A3D J;  4WF2 A;  2C78 A;  1LKX A;  2KT0 A;  5FKN A;  1J7K A;  4AIH A;  3E7L A;  4OIR F;  3OW7 A;  2VON A;  1W5C C;  1BR4 A;  3G71 I;  3NWT A;  2RN7 A;  3GLX A;  3TOB A;  5IYP A;  1WJB A;  1Z21 A;  2IGN A;  5KAF C;  1FYM A;  4FK8 A;  3RCO A;  3H09 A;  2X6O A;  5DS9 A;  1LFB A;  2RNJ A;  1KU9 A;  2QQ8 A;  2D45 A;  2LRD A;  5DUK A;  3KCC A;  4II2 A;  1S9H A;  1RUO A;  2VC0 A;  1U2W A;  1E3Z A;  1IN4 A;  4IKF A;  5FLX Z;  3GTO J;  3AKZ A;  1R1U A;  4KKU A;  1IJW C;  1I27 A;  4XLF A;  1Z3X A;  4HX7 A;  3VB2 A;  1U9N A;  1IV6 A;  3VWB A;  4G6I A;  1B8I A;  4LBW A;  1K8F A;  1SFX A;  4OJO A;  1TTT A;  1P7J A;  3BNW A;  1D1B A;  1TQM A;  4ZDP A;  3HOV J;  4D7M A;  4IHV A;  1E43 A;  1R6R A;  1S8N A;  2L5Q A;  2NTB A;  2VJJ A;  1VJS A;  1X1B A;  2FD5 A;  4C3J J;  4XN3 A;  2M4K A;  2VE9 A;  1V4R A;  5ERI A;  1AIP A;  1E62 A;  2Y31 A;  3HB9 A;  3TO6 A;  1OCP A;  3T0Y A;  5F04 A;  1U78 A;  3PJR A;  2D9R A;  4RCY A;  1MBK A;  3LAJ A;  3HRU A;  1REP C;  2W7Z A;  2DLL A;  4ZZL A;  1FX0 A;  1YLO A;  2FVG A;  3DEU A;  3WTX C;  2V7V A;  2OJE D;  1GVJ A;  3GTK J;  3CC4 I;  4N0B A;  2R6H A;  3OWT A;  3GRH A;  3CO7 C;  4MLO A;  1ZYR F;  2WTE A;  3OYG A;  3M4O J;  4OPO A;  3W5U A;  2E1N A;  1LUJ B;  3CB4 A;  3HOT A;  4L5I A;  1W0J A;  4O6J A;  1VND A;  3DPT A;  5DCF A;  5IPA A;  1W5T A;  4UV9 A;  2YSR A;  2R4G A;  1Z1D A;  3S1Q J;  2DMU A;  1UST A;  2AXL A;  2RAE A;  3A02 A;  2NT9 A;  1JUP A;  4A3J J;  3HUG B;  3COA C;  5BSY A;  1GHC A;  3DQV C;  2MYS A;  1ZGW A;  1N0U A;  3FXJ A;  1YJ9 B;  2FX3 A;  1LE8 B;  5C1E A;  2HVR A;  5F0H A;  5JHF A;  3W2A A;  2F43 A;  3HXL A;  3MKW B;  1DAB A;  3KYC B;  1D5Y A;  2QQ9 A;  3GWZ A;  4M71 A;  3H9J A;  3GFL A;  5K5Q A;  2H1K A;  1MH4 A;  3GTP J;  2EZK A;  2RC4 A;  2X6Y A;  3OE7 A;  2GXA A;  1PP7 U;  1TWA J;  3SZP A;  4BS9 A;  3GTQ J;  4Z05 A;  2JRM A;  1RWR A;  1T6Y A;  4KT6 A;  2V7T A;  4M74 A;  1W7P A;  1NDH A;  4JK1 X;  3PNT A;  3HRS A;  2XOK A;  1BI1 A;  3Q39 A;  5LLQ A;  3J7Z I;  4MNU A;  3F8F A;  1J75 A;  5EMN A;  1UJ8 A;  1KJZ A;  3CDL A;  2DA7 A;  4RGS A;  5AIP A;  3BC9 A;  3WTU C;  3WNB A;  2BVM A;  3RZD J;  1V0E A;  5H2F C;  1R5B A;  1XD7 A;  4IHS A;  4RB3 C;  3CCQ B;  1HA3 A;  1TYU A;  2J7K A;  2GPJ A;  5TR9 A;  3HC7 A;  2DDB A;  1FNC A;  1LFP A;  1XGS A;  5KVR A;  3CO6 C;  2R7R A;  1Q82 D;  2H94 A;  1NG6 A;  1ZRC A;  4ZCL A;  2G7U A;  1VQK B;  3EDP A;  3PET A;  3CUQ C;  2BZT A;  4UB6 C;  2HI3 A;  2CRG A;  1VQ7 I;  3F8M A;  1TT5 B;  3GUD A;  2JJ1 A;  2V1U A;  1HXD A;  2FRH A;  2LK2 A;  1WDT A;  1W36 D;  3IC7 A;  2PEX A;  5DD8 A;  2BY0 A;  4LMY A;  4Q47 A;  5FD6 A;  2VBY A;  1XTA A;  3TO9 A;  3S17 J;  2O8K A;  4A3L J;  3CCJ B;  1Q81 D;  4G7W A;  1PKV A;  2M8E A;  2PMH A;  1D5V A;  5K7F A;  4A93 J;  3E5X A;  4CGZ A;  3WTT C;  4P12 A;  1WTH D;  1O8F A;  5LEJ A;  3JTG A;  1TW3 A;  5F64 A;  4PSW A;  5JLV C;  2QCO A;  3T5X A;  5F4O A;  2K3F A;  3DU6 A;  1VLO A;  4P9S A;  3W6K B;  3QFC A;  1HQC A;  1T6S A;  3OL4 A;  5EEH A;  4BGD A;  2Y9Y A;  1MMG A;  4W8R A;  1UFM A;  1BIA A;  4Q4Z F;  1X2M A;  1LM1 A;  3ZOB A;  5FFZ A;  1KK0 A;  1MBH A;  4Q48 A;  2HXI A;  4HDU A;  2ZZE A;  3KZZ A;  4G12 A;  4A3I J;  2R7U A;  3GVA A;  4G7O F;  4ZGN B;  1JTX A;  4PC3 A;  3ZN0 A;  4I76 A;  3I4N J;  2QDX A;  1P2F A;  2XT2 A;  3FHZ A;  3CUQ A;  5F1R A;  3CPW B;  4X0C A;  4QPO A;  2KZV A;  2E2I J;  2HPI A;  3ELK A;  4WXD A;  4RLQ A;  5CKT A;  1WPK A;  3K4C A;  3M07 A;  5A2Q Z;  1X0C A;  5FLX K;  4M3G A;  2UZK A;  5DEQ A;  3S2H J;  2O0Y A;  3VSV A;  1Y0Y A;  2B0L A;  1DDG A;  2RDP A;  1XG1 A;  4RDL A;  3BR0 A;  1MH3 A;  1P4A A;  3DKX A;  2OC6 A;  1MJB A;  3WGI A;  4PAB A;  5FKM A;  1DUX C;  3JW4 A;  1E3X A;  1CNF A;  1JKP C;  4OJ6 A;  1G8X A;  2WBM A;  2MD5 A;  2C5B A;  2FNP A;  2W00 A;  2R7T A;  3HGG A;  4IVN A;  5FO1 A;  2VNH A;  3S93 A;  4MQV A;  1W36 C;  1X58 A;  5F08 A;  1NH3 A;  3Q6Q A;  2NSP A;  2ODL A;  4YC5 A;  4FX4 A;  4QIW N;  4OP7 A;  4XOP A;  2QMU A;  2VQL A;  1TQP A;  2RRE A;  1TLH B;  5E18 F;  4R71 A;  2V26 A;  1ZR4 A;  2BPO A;  2DCE A;  3HIF A;  1NTC A;  1F36 A;  1SKQ A;  1QGA A;  4WZE A;  5D6F A;  4ESB A;  3S16 J;  4BE1 A;  1YIT I;  1BR2 A;  4J00 A;  5E1W A;  4PJN A;  4BQQ A;  5IOY A;  3CC7 I;  4RD2 A;  1IDY A;  1YW8 A;  3F8N A;  2R93 J;  5ILS A;  1XN7 A;  5H6R A;  3H35 A;  4XLN F;  5IYB J;  1WMR A;  3AVX A;  4LIU A;  4OAZ A;  2TDX A;  1FSH A;  4L9V A;  1R49 A;  2CQN A;  1D0Z A;  5CLS A;  1MDM B;  3MKL A;  5HLI A;  2VKE A;  3FJO A;  3FXM A;  2KDZ A;  1N25 A;  4IX7 A;  2ZCW A;  3I64 A;  1BMF A;  3DLL F;  5J3L A;  1JUM A;  2HKX A;  3FXL A;  3V76 A;  3LSK A;  3WNC A;  3I54 A;  3ERE D;  2QQB A;  4B43 A;  1ZQ3 P;  3BJA A;  2ELK A;  3JCU C;  2GRE A;  1ON1 A;  1HKT A;  1TVC A;  1YFH A;  2LBF B;  5EGO A;  3GTG J;  3B6A A;  4UNO A;  3K1P A;  5TRD A;  1TUI A;  4X8I A;  3VO2 A;  4RD0 A;  2D1V A;  2XAF A;  3CCM I;  2OCE A;  3BY6 A;  4Y33 A;  1D3Y A;  5M5Y J;  4DW6 A;  4YCQ A;  2F5C A;  2XAU A;  2QA4 I;  4YRV A;  2OBP A;  1PJ7 A;  1GV5 A;  3MWM A;  3HG9 A;  4CHU A;  3HAG A;  5M3F J;  1FBS A;  1O88 A;  2EIL H;  2R7Z J; 
#chains in the Genus database with same CATH homology
 4BUP A;  3L2V A;  3H0D A;  3B4N A;  1EA3 A;  3FHN A;  2WAE A;  3S32 A;  3QOD A;  1UG0 A;  2E5Z A;  3PL8 A;  4ITV A;  3DTI A;  3G2B A;  1OHH A;  5AMV A;  1D0X A;  2Q2E B;  1PLU A;  2UV1 A;  2MD0 A;  2R9V A;  1FMV A;  1VBL A;  2VBE A;  4E0F A;  1OR7 C;  1BHE A;  4HST A;  4F92 B;  3KYL A;  2KMU A;  2V6E A;  1OB0 A;  1D1A A;  4W8T A;  3T9G A;  1W9X A;  4PK4 A;  4HRI A;  1WPC A;  2NST A;  2CS3 A;  1BLI A;  3HOS A;  3QYE A;  1K28 D;  3CZ6 A;  4HEA 2;  1WJF A;  4U7B A;  1WP6 A;  4C2U A;  4YEJ A;  3L2W A;  4KKS A;  3NE5 B;  3ZPP A;  3S8P A;  4DOZ A;  1DBO A;  2VJ4 A;  3PNY A;  4X0G A;  1KMH A;  1H8H A;  3GVL A;  3BC8 A;  3OEE A;  1O8D A;  3DLA A;  2UWM A;  1QCX A;  2D3N A;  3OYI A;  3W2W A;  3FDY A;  4DGW B;  2R7V A;  1T5E A;  3A4C A;  3ZXS A;  1IRX A;  2PJR A;  4CSW A;  2LOO A;  2ZFU A;  4XLA A;  3TBI A;  3OYF A;  3OYB A;  5KHD A;  2W7N A;  1H8E A;  2VPL A;  2XDV A;  4LIV A;  2UVF A;  2CUZ A;  4RLF A;  2VJI A;  2NT6 A;  3GQ8 A;  3FKS A;  4YZQ A;  5CQE A;  2LG4 A;  3C2H A;  1TZL A;  2LY1 A;  2IGO A;  1NBM A;  3T51 B;  2W4S A;  4PUS A;  3WWG A;  3DPU A;  3CP2 A;  5LFA A;  2JVH A;  1V5E A;  3VYS B;  1E1Q A;  1X19 A;  4E7S A;  2INU A;  3KRG A;  3SEZ A;  3LFU A;  2L9S A;  3BLY A;  1J09 A;  2WA0 A;  2AQF A;  3OFN A;  5DN6 A;  1QJV A;  2L7K A;  3A1Y A;  3SZG A;  3UW0 A;  3CJQ B;  4DIQ A;  1MMA A;  2R7W A;  1E0E A;  1X1D A;  2K9L A;  3BCF A;  5C1C A;  3OYA A;  3A2K A;  3OYE A;  5HKK A;  3ONQ A;  4RMN A;  3BH4 A;  5HLT A;  1VZ0 A;  2LBF A;  3H5N A;  2L2O A;  3PSI A;  5TGT A;  4DBR A;  1I8D A;  2O0W A;  4URR A;  3PFY A;  4IQ4 A;  2GJP A;  4CA0 A;  2ZTG A;  2X51 A;  1QHG A;  4YXW A;  3K70 D;  4NK6 A;  4ANJ A;  2X6X A;  3OS1 A;  3BCB A;  2KVO A;  3W2V A;  1N78 A;  4GQN A;  4P22 A;  3KEW A;  3H94 A;  3OOC A;  4B3G A;  1O8H A;  3TL4 X;  3OYH A;  1SAU A;  2VB6 A;  4KIT B;  2IGM A;  2LZJ A;  2W6I A;  3L2U A;  2XND A;  4XR6 A;  4BEH B;  2O1D A;  2ZSI B;  3H5R A;  2PEC A;  4ZJZ A;  4AVZ A;  1BR1 A;  4Z1M A;  4YEL A;  3QYF A;  3PUB A;  2LYC A;  3VSL A;  3T53 B;  3GBG A;  4BE2 A;  3W3C A;  2GJR A;  3WQZ A;  1I18 A;  2LRE A;  4ZTF A;  2CK3 A;  3CJR B;  5KCM A;  1Z7L A;  1UD2 A;  4LG3 A;  2JVG A;  4E7H A;  1JTA A;  1WJE A;  4E7J A;  2PMZ A;  2L9N A;  1MW7 A;  4Z06 A;  4D9J A;  2DXI A;  4JMQ A;  3EQO A;  4C2L A;  2R7X A;  2PYG A;  4HPQ A;  1UD8 A;  3VYT B;  2VL8 A;  3HPG A;  4XM3 A;  1CZF A;  3OR1 C;  3S3M A;  4XLH A;  5FRO A;  4FET A;  2Z1D A;  2V1N A;  2GJK A;  2QE7 A;  2CMP A;  2DT7 B;  2A6T A;  2V7F A;  2FUG 2;  2HPM A;  2HQA A;  2KP6 A;  1MNE A;  3H9G A;  4PMH A;  4AYB A;  2QKL B;  2V4J C;  1LDK B;  3LSH A;  2ZTN A;  4U87 A;  2DT6 A;  2E1M B;  4LIT A;  3H9Q A;  4HNU A;  2OUM A;  4E7L A;  2VKD A;  4XKW A;  1BOB A;  1AA7 A;  3IAM 2;  2BW3 A;  2CFO A;  2INV A;  3ZQQ A;  1KON A;  2IS1 A;  1ERD A;  4HWV A;  4R79 A;  4CUG A;  4NC7 A;  3V42 A;  4BU2 A;  1VLY A;  3K70 C;  2QKM B;  2E5N A;  3C2G A;  2UVE A;  4C9Y A;  1KZL A;  1Y56 A;  3VMV A;  2RQQ A;  1QHH D;  3DPL C;  1U0J A;  3DTE A;  5CPR B;  4BDY A;  2M0M A;  4PFP A;  4ZTJ A;  3FPP A;  4H4K C;  2KPM A;  4IZZ A;  4HNT A;  4OJP A;  1HVX A;  4B3F X;  3K4N A;  1FMW A;  2F4I A;  4C30 A;  2GOX B;  3VYR B;  4E4H A;  3VST A;  3LSI A;  1T95 A;  1TT0 A;  3IUO A;  3S3N A;  3AL0 B;  1PJR A;  2F5V A;  2GK6 A;  4PJM A;  2CV0 A;  1NRK A;  1BPL A;  1V5G A;  2HU9 A;  3QOE A;  2NOJ B;  3EUK L;  3OEH A;  2NTQ A;  3B8Y A;  1SFK A;  1V5F A;  2KQR A;  1W0K A;  2WY8 Q;  2V31 A;  3SDB A;  4KJZ A;  3GQA A;  3I9V 2;  2R7O A;  4YZ0 A;  3L2R A;  2PYH A;  4CCN A;  3GQB A;  3OYK A;  4YZA A;  2WZP P;  2K5C A;  3D5R C;  3GVJ A;  1V0F A;  1WFX A;  3LSM A;  2GK7 A;  4XOR A;  4BDZ A;  2UUZ A;  2JDI A;  4KIS A;  2E1M C;  5HOO A;  3SYT A;  4HSR A;  4L8J A;  4CCO A;  2IGK A;  3DEE A;  3K4L A;  3RSN A;  5LD2 C;  2XZO A;  1O8L A;  3M8J A;  2HLD A;  3TMO A;  1LVK A;  4CCM A;  4OZZ A;  4DK1 A;  4DNR B;  3QYB A;  3E1S A;  4XLE A;  2D3L A;  4P5O A;  3A3G A;  3D5L A;  5FL7 A;  3EQN A;  2WAD A;  5HNF A;  4DNT B;  2K9M A;  3EUA A;  3K4J A;  4B3X A;  3E0J B;  2M7A A;  2WAF A;  3CMM A;  4ZC3 A;  1KCC A;  4I84 A;  2CW8 A;  1MND A;  2LY2 A;  2X1E A;  2XF7 A;  1JI8 A;  1HA8 A;  2ZSH B;  2R7S A;  2E1B A;  3OAA A;  4C2T A;  1WJ5 A;  2X6W A;  3I3L A;  2V7Q A;  4Y4R A;  1SKY B;  2WJY A;  2X85 A;  3DDY A;  3AL0 C;  4BE0 A;  4BJ6 C;  1UEL B;  1LKX A;  2XF5 A;  2ELJ A;  2KHM A;  3OW7 A;  4N4N B;  1BR4 A;  3OOU A;  3NWT A;  1UD4 A;  2A5W A;  4DJA A;  2W82 A;  3SEQ A;  2VIX A;  1WJB A;  1MMD A;  3KX2 A;  1Z21 A;  2IGN A;  1UD5 A;  2LC2 A;  1YE9 A;  2VAS A;  4F93 B;  3OYD A;  3RCO A;  4E6K G;  4AU7 A;  4B47 A;  2OV7 A;  4JQF A;  3IP4 B;  3K4M A;  4FAS D;  2LRD A;  3SUC A;  4II2 A;  1S9H A;  4E7Z A;  1E3Z A;  2ZXH A;  4ZDL A;  4D1Q A;  2JA2 A;  4IKF A;  3AKZ A;  4KKU A;  2IQ7 A;  1VF7 A;  4XLF A;  3OPO A;  1HG8 A;  1Z3X A;  2X1D A;  3VWB A;  4G6I A;  3EPZ A;  1NHC A;  3T56 B;  4OJO A;  2X1C A;  3OYC A;  4CH7 A;  2CW7 A;  4JOM A;  3LMM A;  1D1B A;  2MAB A;  2HZD A;  4ZDP A;  1E43 A;  2NTB A;  1R6R A;  2KDO A;  2L5Q A;  1GLN A;  1Z3Y A;  2VJJ A;  4BJT A;  1X1B A;  1X4P A;  3UR3 C;  2Q1Z B;  4XN3 A;  3FBI B;  1MMN A;  2M4K A;  4GRI A;  4DBQ A;  1OFL A;  2XSJ C;  1UD6 A;  4U4B A;  2DJI A;  4F52 A;  4TT3 A;  3OYN A;  3RQ4 A;  2LH9 A;  2PJR B;  3PJR A;  1IDK A;  4W8S A;  1DP3 A;  3H5A A;  1VJS A;  2ZXI A;  4F3Q A;  2ZZG A;  4TSF A;  1FX0 A;  2KRC A;  2HNH A;  3RTR A;  2BOL A;  4F55 A;  4XON A;  1PXZ A;  2O17 A;  3OWT A;  3GRH A;  3CES A;  4MLO A;  4BAC A;  1O8I A;  2VXD A;  3OYG A;  3HOT A;  1W0J A;  3G05 A;  3DPT A;  5FRM A;  2W1O A;  4BL0 B;  2R4G A;  3OL3 A;  1PYV A;  2O04 A;  3BG7 A;  2X3H A;  2IS6 A;  1UAA A;  2WJV A;  1DGR M;  1DQU A;  3D5S C;  3OS2 A;  2NT9 A;  3GQ7 A;  1E79 A;  3HUG B;  2EWE A;  3DQV C;  2MYS A;  4BQN A;  1JRG A;  1OFM A;  4NNJ A;  3OIP A;  2HVR A;  1IDJ A;  5C1E A;  5JHF A;  3W2A A;  2F43 A;  4MR0 A;  3HXL A;  3MKW B;  5IK2 A;  4HIZ A;  1OGM X;  1WJC A;  3H9J A;  1HZE A;  3OE7 A;  2CV2 A;  2WY7 Q;  4W8Q A;  2X6Y A;  4OWR B;  2ZZQ A;  2X8K A;  3DKY A;  3VR6 A;  3OIQ A;  2Z2S B;  4XKC A;  4BS9 A;  2CV1 A;  2VKH A;  4Z05 A;  4B48 A;  3OYM A;  1RWR A;  4KT6 A;  3VYU B;  4CCL A;  5FRN A;  1AIR A;  1OOC A;  4F91 B;  2IXS A;  3PNT A;  2XOK A;  2HDW A;  4G7X A;  2MC4 A;  1XG2 A;  3OYL A;  4OJ5 A;  1D0Y A;  4NC8 A;  3ZCO A;  2VBM A;  2X53 S;  3OY9 A;  2ZZF A;  4QPQ A;  3ZIA A;  2R7Q A;  3BC9 A;  1OGO X;  2BVM A;  1H80 A;  4PJL A;  1V0E A;  4ZDO A;  4BXF A;  2IS4 A;  4XLC A;  1X1C A;  2Z16 A;  2I8D A;  3OMY A;  4B44 A;  2HVQ A;  2W6J A;  3HC7 A;  5CQG A;  1LFP A;  4PJJ A;  1EFR A;  2WPD A;  3VSU A;  1G59 A;  2M7B A;  2R7R A;  1QU3 A;  2JIZ A;  1NG6 A;  2XC7 A;  3MKZ A;  4ASU A;  2F1M A;  1YX3 A;  1BN8 A;  4Y3O A;  1K6Y A;  2BVL A;  3DWL E;  4E7K A;  3DU5 A;  4XKB A;  3MMY B;  2JJ1 A;  2VQC A;  4PFO A;  1W36 D;  3ZSC A;  3N05 A;  1E1R A;  4BEH A;  4II3 A;  2O0V A;  5HNH A;  4BJ5 C;  1Y6I A;  2XZP A;  3U21 A;  1MAB A;  1PKV A;  4G7W A;  2CH0 A;  1RMG A;  1X1A A;  4NK8 A;  3K4B A;  4FXU A;  1O8F A;  1WTH D;  3OR2 C;  4XN0 A;  4PSW A;  3M1C A;  1WJD A;  2NZM A;  2CUJ A;  3K10 A;  1O8G A;  2NTP A;  2Z8G A;  4EW9 A;  3DU6 A;  4BQO A;  3VMW A;  1ZEL A;  4XQF A;  4XMY A;  3OL4 A;  4BGD A;  4HG2 A;  4E7I A;  3BCD A;  1MMG A;  2BW3 B;  3ZRG A;  4EAT A;  2QY1 A;  3AFH A;  1GQ8 A;  2F6C A;  4W8R A;  2DIE A;  3EUH C;  1X4O A;  2KLO A;  3LNN A;  4XL9 A;  2ZZE A;  1RU4 A;  2R7U A;  2VBK A;  2M5S A;  4OZY A;  4CCJ A;  3RPU D;  3BCA A;  3A35 A;  1IB4 A;  3F9K A;  5KNL A;  1UD3 A;  2QXZ A;  4RM3 A;  3HKZ A;  4XKV A;  1KTW A;  4QPO A;  2KZV A;  3GVK A;  2HPI A;  3UNG C;  4RLQ A;  5CKT A;  2GOM A;  2XGJ A;  3PSF A;  3L2Q A;  3JUR A;  1YX5 A;  3K4C A;  1X0C A;  1D1C A;  4Z03 A;  3VSV A;  4XOT A;  2E60 A;  3OS0 A;  2Y0S A;  4XD7 A;  3DKX A;  2OC6 A;  2HVS A;  4UZU A;  4G6T B;  1E3X A;  4P1W A;  3A3B A;  1DBG A;  4OJ6 A;  1G8X A;  2WBM A;  2V4D A;  2W00 A;  3LSG A;  2R7T A;  4MXN A;  3ZR8 X;  3S93 A;  2VXZ A;  1W36 C;  1P9Q C;  2NSP A;  3CP8 A;  2P0W A;  2ODL A;  2M4G A;  1PE9 A;  4N4O B;  4XOP A;  2MFZ A;  4OAY A;  2AQE A;  2VQL A;  2RRE A;  2BSP A;  3B90 A;  3IAS 2;  2V26 A;  1K5C A;  2DCE A;  2M3A A;  4CCK A;  3K4K A;  2RNG A;  2KRH A;  2WAQ A;  4KKT A;  4DK0 A;  3HL2 A;  3BG6 A;  4BE1 A;  2O5R A;  3ZGK A;  3FBN B;  2JJ2 A;  1BR2 A;  2JSP A;  4BQQ A;  4PJN A;  4J00 A;  2K3P A;  4OJL A;  1COW A;  2Z6B D;  1WJA A;  1DGW Y;  4TKO B;  2VJ5 A;  1O8E A;  3FKJ A;  3H35 A;  3VSK A;  1WMR A;  1KCD A;  3HPH A;  4LIU A;  4OAZ A;  5HVQ C;  4NQW B;  4CZC A;  2V9K A;  2KL4 A;  3DTK A;  1D0Z A;  4U49 A;  1OLT A;  3LMW A;  3VDX A;  1IA5 A;  3MKY B;  4IX7 A;  1BMF A;  3J7A Y;  3CF2 A;  3K6G A;  3LSK A;  2VLA A;  3GQ9 A;  4B43 A;  1EE6 A;  2VQH A;  3PNV A;  3OYJ A;  2JUG A;  4NUB A;  2LBF B;  3ZPN A;  1O8J A;  3NWS A;  1O8M A;  1N75 A;  2VQG A;  2DOA A;  4PSX A;  4XNF A;  2WSS A;  4Y33 A;  4YZX A;  2XAU A;  4RM2 A;  3LL7 A;  4J01 A;  4YRV A;  4IQJ A;  1NG7 A;  3MD2 A;  3JU4 A;  1N77 A;  3HG9 A;  3S3O A;  2XZL A;  3HAG A;  2QX3 A;  3FY3 A;  1O8K A;  3KEY A;  4ZYA A;  1T0F C;  2WB1 A;  2IS2 A;  2XF6 A;  1O88 A;  5CDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...