4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
3GRHA 2X3HA 1O8KA 3B4NA 4XKVA 4Z03A 4XOPA 1OOCA 4XMYA 4EW9A 1KTWA 1EE6A 5AMVA 4XORA 4OZYA 1O8GA 4XLFA 3ZSCA 2INVA 2O04A 1IA5A 1DBGA 4W8RA 4XR6A 4XONA 4YZ0A 1O88A 2NZMA 1OGMX 2NT9A 2UVFA 3FY3A 1K5CA 1RWRA 4YEJA 2O0VA 2IQ7A 2X6WA 3VMVA 5C1EA 3SUCA 1AIRA 4XLHA 2O0WA 3GQ8A 3VSVA 2UVEA 2O1DA 2VBKA 2PYHA 2X6XA 2O17A 4YZAA 4YZXA 4XL9A 4NK6A 4XQFA 1BHEA 4W8TA 4NK8A 4XN3A 4U49A 2VJIA 1O8DA 3GQAA 2X6YA 3T9GA 4C2LA 1QCXA 4W8QA 4OZZA 4PMHA 1HG8A 1IDKA 4URRA 1BN8A 1RU4A 1X0CA 1OFMA 2QX3A 3B8YA 4I84A 4OJPA 1O8IA 3UW0A 3WWGA 1O8FA 2BSPA 3ZPPA 2NSPA 2PECA 4U4BA 4XKWA 2VBEA 3EQOA 3GQ7A 2NTPA 1KCDA 4XLEA 1O8HA 1O8LA 2PYGA 5C1CA 1IDJA 4XLCA 4OJ5A 4W8SA 1O8EA 3VSTA 2INUA 1IB4A 1NHCA 1H80A 2VJJA 4XM3A 4XOTA 2VBMA 2QXZA 1PE9A 1O8JA 4Z06A 3VMWA 1KCCA 1CZFA 1VBLA 1XG2A 4YELA 2EWEA 1JTAA 2Z8GA 3LMWA 1QJVA 1RMGA 2ODLA 4Z05A 2NSTA 3GQ9A 4AVZA 4YZQA 2QY1A 1OFLA 4MXNA 3EQNA 1PLUA 4OJOA 4OJLA 2NTBA 4HWVA 2NTQA 4XLAA 4XN0A 1JRGA 4MR0A 1OGOX 3KRGA 3VSUA 4XNFA 1DBOA 1PXZA 3B90A 4OJ6A 3JURA 1WMRA 1O8MA 2X85A 2NT6A 1GQ8A
chains in the Genus database with same CATH superfamily
1SD4A 5CVIA 3MVPA 2LMDA 2Q8KA 3JR9A 5F4JA 1KQ8A 1YLOA 3MFKA 2E1CA 3HOYJ 4E70A 3SQNA 3BG9A 1TVCA 1WJDA 4PJLA 3H92A 1LLZA 2DPDA 2WBMA 4M9XA 3OYNA 4RB0A 2DA6A 4PGOA 3ZSCA 3BR3A 4EJTA 1D0ZA 4BKXA 2Z6BD 3OS0A 2HS5A 1MNMC 3CCLB 1FOYA 2QTZA 2W7ZA 1AA7A 3QP5A 3R61A 2Z33A 3HGYA 2HQRA 1VQ4B 3CCEI 2C6YA 2FOKA 4YEJA 1R71A 1OFDA 1SFEA 1FWZA 3VYRB 1I1SA 1R1VA 2EINH 4KKUA 2P5LC 1EA3A 4MEXF 3VMVA 1PP8F 5CPRB 4N4OB 4A3JJ 2FRHA 5FKKA 2FQ4A 2VOOA 3P27A 4M4SA 2M5WA 5IYWA 2XF7A 1SFOJ 1ENHA 3CRZA 4HNTA 2Z9OA 2BBYA 3FXJA 4KITB 3FXMA 5CVRA 3C3WA 2UWMA 3EUAA 5CVVA 1YW7A 3QPSA 2VQLA 4LMYA 2VFNA 1IUFA 2M0MA 3PUNA 1YITI 1HLVA 1TTYA 2XPUA 3GCMA 5FL7A 1HSTA 4DIQA 2ELHA 3VPRA 4X1EA 1OKRA 3FBIB 3C1DA 4IXAA 2QZ8A 2GK6A 3WQZA 2IOUG 2DK5A 1RETA 3K69A 2PMUA 2KFDA 4F55A 3K4CA 2RV8A 2OTJI 3ZZTA 1WU8A 4NUBA 2V7FA 2DFHA 3I59A 3K4JA 3R0JA 2A5YB 2H1LA 3BT9A 4F52A 1O8FA 3CLOA 2XB0X 5IT9K 4LK0F 3BCDA 4AIHA 4PCQA 1GDTA 3EQOA 3FDYA 4XLEA 4CDGA 4ZYGA 1B72B 2EZIA 3OS2A 1ITYA 3T0YA 1Y0YA 2IBDA 4GO1A 2AXTC 2GIVA 2JZYA 3BR0A 3L9FA 1G7TA 3H35A 3M9AA 4BJTA 1E17A 1C0WA 1B2RA 4X0CA 4Z4TA 1YJWB 1NG7A 4Y52J 3DU1X 1R58A 1FP2A 2X0LA 1N05A 4EM2A 1H80A 3K1PA 2ACJA 4XOTA 3GVKA 3BH6B 1MBFA 4IRGA 1CNEA 2JN6A 5EGOA 2IGKA 2GIZA 5ED4A 3CCUB 3RZDJ 3OYJA 3BDDA 1VQ6I 1ERDA 2AHOA 2ZL6A 3NE5B 1ZREA 1ZM2A 1IJEA 3SZEA 2EA4A 3K2AA 1RESA 3AVVA 4Z4RA 2BM5A 4YZQA 5FD5A 1K9MD 2KJBA 3EQNA 3G3ZA 3W5VA 4BAYA 2HU9A 1EFCA 3PQKA 1RQPA 3GUDA 2R4GA 1N78A 2NNNA 5DD4A 5JHUA 4UUTA 4ENMA 3MAJA 2ZL5A 3HG9A 3HOWJ 3EUHA 4LLLA 1DBOA 1WOOA 3W5UA 2FX0A 2CQNA 1QPMA 3E97A 5H5JA 3RJPA 1O8MA 1MNDA 3A01A 2FF4A 3PNVA 4IF4A 5CVJA 1WXRA 3VYTB 3L09A 3T8RA 2L7FP 3IHUA 4G6IA 1WRJA 5TR9A 1Y8RB 5IYNA 4XMYA 4D1QA 4MNUA 2HKXA 3F72A 2XZLA 1FRNA 2PEXA 4HAMA 1BJZA 1B1BA 2ESHA 3KETA 2MA3A 3U2RA 3IKTA 2GOMA 2DQLA 2ZXHA 2CUZA 1TT5B 4LG0A 4KMFA 4RM0A 1ZKGA 4PZJA 1MSEC 1PKVA 2OQGA 2R7VA 3BR6A 3ELKA 4EM1A 4AIJA 1CQTA 2IRFG 4IHSA 1AOYA 4GQNA 4OPOA 1IRXA 2RC4A 3ZN0A 3VWBA 2W48A 3GZ5A 5K1YA 2RVCA 4ZTFA 3PVDA 1ORKA 1UD8A 2V9KA 3P9IA 1YW8A 4E7SA 5FKOA 4OOSA 4XLNF 2E19A 5AONA 1ZLJA 2ZFWA 5C4JJ 2F43A 4X7FA 3E6DA 1PJ6A 1XC5A 1SD6A 2R3SA 5LBQA 1JKPC 2JA2A 1TBXA 1SD5A 2QSGX 1E1RA 5K5QA 4BH9A 1MDMB 1OB2A 3ZQCA 1HSJA 2FVGA 1X3WB 1ZM9A 4PC6A 4NHJA 1JKOC 2PFBA 4FE7A 5GPCA 3RKQA 3FPKA 4HV6A 1ZARA 3I5UA 1H8AC 2EPFA 1EV7A 4RPDA 1BN5A 1N75A 3KEYA 2RDPA 3BZCA 1YX5A 3V4GA 1QHGA 5FLXK 5J1UA 2VC1A 1JUMA 5E79C 3KP3A 1BW5A 2W00A 3H5AA 1XGNA 3FWEA 3RZOJ 3KP5A 1HXDA 1LUJB 4CA0A 3JSOA 4OWRB 2JRMA 2HR3A 1SFXA 2JSPA 2O5RA 4Y4RA 2LD5A 2D3NA 2HOEA 4ON0A 1MBHA 3QU6A 3GIRA 1QA1A 3WY9A 3MMYB 1WVRA 5L3EA 2XGDA 2CFXA 2CG4A 4I98B 4WXCA 3JQRA 4L9NA 4BE2A 3EYYA 1KZLA 2BX6A 5DCFA 1IC8A 4OIOF 1BQEA 1QZZA 3H36A 5BOXA 2E1RA 1RNLA 4LK1F 2XGJA 2XAQA 2EZHA 3E5UA 3HTUA 1PUFB 3WODF 4ZV4A 2RREA 2LH9A 3HB9A 3OYEA 1W1WE 4MO7A 3BTJA 4BQQA 1HW2A 1DDGA 1WSRA 4P3IA 2E71A 3FXLA 1BW6A 2Z8GA 4A3EJ 2O7OA 5CLSA 2JPBA 1POGA 1FBSA 3CXCB 2XRLA 1V5EA 2OAZA 1JJ6C 3DEEA 1SKYB 2G7UA 4DYRA 2EH3A 2P8TA 3OW2B 4B3AA 2NTBA 3A02A 3I4PA 2P7VB 2CSOA 4B43A 4A3DJ 1ZM4A 1IO2A 1FT9A 3KYCB 4EMSA 3N90A 3MZ8A 1MMSA 1GV2A 2A5WA 4CCJA 4UB6C 2BY3A 3GTLJ 1U6GA 5KW9A 3J81k 1PXZA 1O3QA 2W25A 2I1LA 4O3MA 1DABA 1FX7A 3WYAA 3OYBA 1D5YA 4PGHA 1HA3A 5F1RA 4ENNA 2UXXA 2CF4A 3A8KA 3ZCOA 1VLYA 2X85A 1VQ9I 2PMZA 1VQKI 4ITVA 1IDZA 3WNCA 2BYVE 3E5XA 4A0ZA 3WTSC 1Z7UA 3QRFF 4Q48A 4RLFA 3ERED 2CQ7A 3QP6A 3O6BB 4FCYA 2PIAA 2YWFA 3NB2A 4YALA 3WTXC 2X9DA 4PC2A 5FKLA 4EATA 5E1ZB 4XLFA 1LEBA 2QYUA 2PE3A 1Z7LA 2GAUA 3OYIA 4XR6A 2FD5A 2JTVA 2BY2A 2DMQA 3LSJA 4M6YA 3S16J 3BY1A 2COMA 3E6MA 1D1AA 2UVFA 3J81K 1R23A 4P1VA 2K3PA 3PSIA 3E5QA 2Z16A 3JTHA 5K5OA 3I58A 2TCTA 3H9QA 5BNGA 1WZ2A 5GV8A 3CMAB 3GW2A 1IRGA 1WI9A 3VB2A 3FXUA 2A6HF 2GBYA 3Q38A 4IZZA 2QE7A 3V42A 1YRNB 2ZZGA 2VXDA 3LMMA 4RD4A 1T08B 3ABLH 3HRUA 1N77A 1FYMA 3K10A 2VBXA 3HDDA 1Z77A 3KZYA 3G73A 3V7SA 2KIFA 2VKDA 2E7XA 2C5BA 2JRTA 3KZZA 2ZXWH 4W8QA 3TW7A 2XKPA 3WG9A 3MD2A 3DBRB 3IL2A 4PSXA 1I8DA 1D5VA 1IZ1A 3C7JA 4FE4A 1BN8A 1R5BA 1GV5A 1A36A 1Z3YA 2KRFA 2B0RA 4JP0A 1KQ0A 3BH7B 4PC7A 3BJOA 3PA2A 2Y9ZA 2PYGA 3U1KA 4AC0A 1N08A 3AFHA 2FSWA 3HRSA 2DFFA 4ZH4F 4FETA 4A12A 4XSZF 2B7BA 1JT6A 1LNWA 1T8IA 3BQYA 2V6EA 1R49A 2DETA 4BJ6C 5ILUA 5M5YJ 5FO5A 2F48A 2JVGA 4RLZA 2CJJA 2DDBA 2KP6A 2DBBA 1GUUA 3E6BA 5LHIA 3ZC3A 3RIQA 1H9TA 2PMHA 1IB0A 1XG2A 4YELA 3TO6A 1D8KA 3GF2A 4BQNA 3LAJA 3FK6A 2BGJA 5J8CA 1UG2A 2NVUB 3OOCA 1AKHA 2DO7A 5EZHA 4DOZA 2ID3A 3WGHA 2WPDA 1VLOA 2OBPA 1OCZH 1ZRCA 3Q6QA 4OJLA 2AQEA 4PFOA 1UAAA 4HF0A 2L9SA 5E18F 4AYBA 4WWVA 4AYBN 1XMKA 1NK2P 2HVQA 4B4CA 3G71B 4TMZA 3PO2J 2XAGA 4E7ZA 2F3LA 1VZ0A 1IN5A 3CC7I 1PJ7A 2QN6A 1TW2A 2QVOA 3B90A 2Y30A 1VQLB 4B1RA 2ISZA 3CCYA 2RQPA 1W0UA 4JOMA 3S3MA 3TOAA 1TQPA 3LFKA 2QF7A 2OCCH 1WQ2A 3FPPA 1D1NA 4GCVA 3CMEI 2ZZEA 1Y6IA 4Z4SA 3LA7A 2A6TA 4G6QA 1RR8C 2Z2SB 4K1XA 2R9VA 1OLTA 1UHSA 3C2GA 4YIIA 1ZG5A 3LQ6A 2NS7A 4QHYA 1S0UA 4S0HB 1VI0A 1W35A 4N3NA 4BEHA 2DOAA 1DGRM 4C2MJ 5DM6F 1MGTA 5C4XJ 2JN9A 4BXUA 3J81Z 3FKJA 4N9HA 4F91B 3LSHA 4EH1A 2E36A 3SKBA 3WE3A 1ZG1A 3LJYA 4L9VA 4GYIA 4BY1J 4C3JJ 3ONUA 1FC3A 1BR1A 1STZA 3ZOBA 3KL9A 3MCAA 1KONA 1VQ4I 5F64A 5KSWB 4YEIA 3H3ZA 1I1GA 1ONVA 1DBGA 1W36C 4HF2A 3ML3A 1IJWC 4Z4WA 4L0ZB 3TDZC 2HXOA 1X1BA 2LKSA 3GFMA 1MMDA 3M4OJ 3HJEA 2ZBVA 2GQQA 4QLCU 1S7OA 1QVUA 5FIUA 2LKXA 3I1FA 2EIMH 2DI3A 1I7PA 1WOSA 2K40A 4M9SA 3T1BA 1VHOA 3IKVA 1EH6A 5E3LA 2ZJ2A 3B73A 2CRVA 4YAWA 4OAZA 3QYBA 4XQFA 2V7WA 1M1KD 1W0TA 1EKEA 4KDPA 1DP3A 2VJIA 4RMNA 1S7EA 3HL2A 1F36A 3LNNA 3A01B 4E0FA 1MNEA 3UNGC 2UZKA 1ZRDA 1VTNC 1A6IA 3RYRA 4RD1A 1X2MA 2ZSHB 4Y9UA 1JKQC 4C43A 1P4WA 1S5LC 2E1MB 2ZL7A 2NRAC 1DDNA 2BOLA 4UUSB 1CF7A 4GDFA 4P12A 4EJVA 1W0JA 2OBTA 4OJPA 3KYDB 4R8HA 4EQQA 4PABA 3T5XA 2VIXA 4UXNA 3DWLE 2E1NA 2GM4A 2WWYA 3J7AO 2VQCA 1B23P 3HIFA 1JTYA 3PETA 3L2WA 2QSHX 3HTSB 4I02A 1HCRA 1IAWA 1MZBA 4XLCA 4QVJA 1QRYA 5FFXA 2DFIA 4FQGA 1G59A 1OYIA 2DT6A 2LOOA 4F3QA 3AVWA 2OZ6A 1XFOA 1BOBA 3ZMTA 2WYRA 3GTGJ 5DDGA 2OTJB 3BJAA 4AUXA 4LLNA 1UJ8A 2QBYA 4X06A 3BLYA 3MWMA 2ZXIA 1IF1A 2QXZA 1KCCA 4H0EA 3LVBA 5TY0A 5J4YA 5EMNA 2H6CA 1JTAA 3VYSB 2VNJA 2PBIA 4RGRA 1WP6A 1HC8A 1G2HA 4QVAA 3GQ9A 3C18A 1NDHA 4LBWA 4ZGNB 1WI3A 4M9ZA 3H9JA 2QY1A 4HLYA 1HQCA 5D6EA 1Y0RA 3PUBA 2R5YB 5FLVA 2CC2A 4A5MA 1YI2B 4YDTA 3H3UA 3FHZA 3ZBUA 5DUIA 3MKYB 2EZKA 3L2CA 4OOIA 2F1MA 4LB6B 1OGOX 1KD1D 5BQTA 4XNFA 4ZDOA 2CNDA 1KRHA 1OPCA 1U9NA 1W5TA 3DTKA 1I6HJ 2VFPA 3F8MA 4OJ6A 2MC4A 4JYKA 4X7CA 5L3CA 2P3MA 1XDSA 3LQQA 3BG6A 4KMUX 4LOCA 3R60A 1OCCH 3DBHB 3JW4A 4XSXF 4ZDLA 4BJ5C 1Y39A 1VQ7I 3I4NJ 3S8PA 2IS2A 3KIOA 3KEQA 4EW9A 3BC8A 3ZQIA 3W5HA 3PENA 1J9ZA 1L3LA 2N8GA 2L4MA 3KFWX 4XRFA 2YU3A 1K78A 1T39A 3IAM2 2XAFA 3T56B 3GZ6A 2LR8A 4MLOA 2ICWG 1MH4A 1U8RA 3RSNA 5FD6A 1YITB 2CW0F 3CDLA 4Y17A 1X19A 1OGMX 3M07A 4RCYA 5J3LA 3EUHC 2CK3A 2XAHA 4YG2F 3L2UA 2QWWA 1XSXA 2J8IA 4X7EA 3CCRI 3BJ6A 2M8EA 3HEFA 4G9YA 1KMHA 2EILH 2O0WA 3GQ8A 4MIMA 3VSVA 2OUMA 1FYLA 2XTYA 1XCVA 1R4MB 1ETVA 2ME0A 4FX0A 3FKSA 1EA0A 2RQQA 1T5EA 1MMNA 5TJJA 1U5TC 4EGZA 3TEDA 4RD2A 2L9RA 2VBYA 1XB2A 3SHFA 1K28D 4OOVA 3AVYA 1IV8A 1FY7A 3VSLA 2W6IA 2IPQX 2FXAA 1K6OA 1KTVA 3ERMA 1K4SA 1EFTA 2X3UA 2ZITA 2EWNA 4FTHA 1FIPA 4G1VA 1FRQA 3S2HJ 5HLTA 4PMHA 3CCVB 1RU4A 1BR2A 4BU2A 2JT1A 3SZTA 2RGVA 5ICCA 1O8IA 1FYKA 2MD0A 3D5LA 3LSKA 1Y1WJ 1WHUA 1T6SA 2Y2ZA 3KZIC 3JRDA 1D1BA 3GQ7A 2KRCA 4DZPA 2FX3A 2FOWA 5JR3A 1Z67A 3R0AA 4DJAA 4Q47A 1E0EA 4CH7A 4NC7A 2OBRA 3D26A 1TWHJ 1B6AA 1K83J 4G12A 2M7BA 1QU3A 3PJRA 2BXZA 1D0YA 4IHVA 2Z99A 5L46A 4W1UA 3ZMVA 3KPHA 5E3MA 2Z1DA 2HOSA 2E1OA 2OYNA 5KHDA 4BHCA 1IB4A 4G94A 2A69F 1PVEA 4OMZA 1TP4A 3R6KA 4KT6A 1QA3A 4M2LA 2VBMA 1Y0UA 2OK8A 4Z06A 1G3WA 1X1PA 3FISA 4YCQA 3PNTA 2DA7A 2DA4A 5E3OA 1NHAA 2VUMJ 5DEQA 3HOVJ 2OC6A 2BM4A 1WJBA 3KP4A 1T38A 5A89A 1P7IA 1Z21A 2E60A 1R1TA 3QODA 4C3HJ 4U7BA 3KP2A 3PSSA 5FNZA 5B66C 3D5SC 2FBHA 1QVGB 1H9GA 1XD7A 4U88A 4WQMA 1QGZA 2VKEA 2I10A 5D4SA 1F5TA 2BVMA 5KAFC 4V2FA 2QGGA 1SM4A 1R1UA 1FMVA 2YWHA 2F2EA 3K9TA 3FMRA 2MC3A 2FNAA 5HZBA 1G6NA 3FBNB 4WWCA 3PIOF 2VBUA 3FJOA 1G4DA 3QFRA 4JQFA 4OPWA 1QGPA 2R7TA 4CZZA 4AIDA 4PJ0C 5JI6A 3O8GA 3BCFA 1VQ5B 1WCMJ 5IY5H 1J09A 2VBWA 2DCUA 3OZVA 1WJCA 2IGMA 1XCBA 2RKHA 1YG2A 4U0VA 3WU2C 2NVTJ 1WJAA 1O8KA 2J8KA 2JA8J 3DU5A 3ZMZA 1OYWA 3J80Z 3OMYA 1OOCA 2BM0A 3VDXA 1A31A 3ASPA 3R4KA 4WK8F 5HXBA 1MBEA 1P6RA 4P9UA 3OAAA 4V2GA 5FA6A 2WY7Q 3MEXA 3CP8A 5BSXA 3PUMA 3BTLA 5A88A 4B3GA 1TC3C 2X1EA 4B8XA 1HKQA 2INVA 2OF7A 3G6EI 3OSGA 1HDPA 4XONA 2WADA 2DJIA 3QPLA 4RGSA 2ZNZA 5BS6A 4E7IA 1KK0A 3I55B 4E7KA 2MH2A 3VR6A 1JHHA 3R6SA 4A6DA 3ULQB 3GVAA 1I5ZA 3G4SI 4JRAC 2X48A 4RM2A 1OB5A 4QUZA 1FBQA 2F5VA 1AKHB 4PUSA 2WTEA 3BZKA 1FLIA 3FM3A 4JX6A 1Z0XA 3OEEA 2Q6IA 2Y0SN 2H8RA 4DQLA 1BC8C 4Z4ZA 2HVRA 4L9TA 1ODDA 4XIDA 2HQ5A 1DG1G 3B6CA 3NQOA 1OR7C 4HA8A 4YZXA 5EG0A 3HPHA 4W8TA 2MYSA 4MTDA 3PIPF 1Q81D 4NK8A 5E8GA 4U49A 3REOA 2J5PA 3FHNA 2R7RA 1G7RA 3ZR8X 1J2XA 1KU9A 1YIJI 4OZZA 3H0GJ 3SJZA 2CQQA 2YWEA 5GV7A 3CCEB 1FNNA 3ZXSA 5M5WJ 3AVTA 2LK2A 2ZTNA 2ZJQF 4TMWA 4GGGA 4EJOA 5GAEJ 1SFKA 4BACA 5IK2A 1G3SA 2OA4A 5F04A 1BBYA 4HE5A 3PL8A 2G9WA 5LGTA 4KFCA 3HXLA 4BEHB 2DFEA 2DMPA 2IS1A 2CW8A 2GXBA 3E1YE 2HYFA 5HS9A 4HLXA 1VQPI 3CC4I 4C2UA 1GAWA 3A8IA 3BZ6A 1TWGJ 2VB6A 3VSTA 2DW4A 1X58A 3S32A 1LB2A 1WJ5A 1X1CA 3RI4A 4EJWA 3A3BA 4ZCIA 4FK8A 2XPVA 3GXOA 5IYQA 1X1AA 1QGYA 4ZYDA 2K9SA 4M71A 5HDGA 2HDCA 1Q7YD 2VBSA 1Y0NA 1ETYA 3J7YJ 1KJZA 3W6VA 2Q6LA 2DJNA 1T33A 2EA2A 2ELKA 3LOCA 4Y15A 2CYYA 4HDUA 4A93J 4TMTA 3U6KA 4RM3A 1TQMA 3ABUA 3RKWA 2EIJH 2LBFA 5BMZA 1D2EA 1HZEA 1XPXA 2NTQA 1QX4A 1F60A 4ZJZA 1QRBA 1BM9A 3LWFA 3V8KA 2V5IA 4DYCA 1ZELA 1MBGA 3LA3A 3Q9VA 5F27A 3Q6RA 3OYHA 5JBQA 3DKWA 1JGGA 1J0RA 2UXNA 4RB1A 3A2KA 4CZCA 3JRIA 1FIAA 3GO5A 2FU4A 1BIBA 1PUFA 2DN0A 2DTZA 4UV8A 4BXXJ 1E62A 3KEWA 3B4NA 2QQBA 1BMFA 2H09A 1JT0A 3SJPA 2OK7A 1Q9SA 1OJLA 3P5JA 1RKTA 3KCCA 3EQLF 3S1NJ 4HNUA 2W6JA 5LMZA 2M7AA 2P4WA 4G7HF 3CF5F 1UMQA 3KLNA 4D9JA 4OIQF 2HPIA 3B8HA 4V02C 1ON2A 5FB2A 4IEJA 3FX3A 4U7DA 4M3EA 5LRSA 1OFCX 2LY9A 2QBYB 3VNVA 4KICA 3OP1A 1YHQB 1RWRA 4YFXF 3BC9A 3GYHX 4F93B 3AL0B 3RYPA 2Q1ZB 4QWQA 2BPOA 2E2HJ 2EZLA 5HS7A 1WGXA 5TRDA 1RKWA 3PA1A 5AN9A 2RAEA 3O2PE 3P9CA 4YAFA 1WPKA 4HE6A 2KJCA 2XAJA 4FASD 2X4HA 2B0LA 4YFKF 2YX7A 3DTIA 5ILSA 4XKCA 5M5XJ 1LJ9A 4RB3C 1G7SA 5HLHA 1O8DA 1CNFA 1WOPA 5JVTA 3MCZA 1U2RA 2VOPA 4RDJA 3ABKH 3BCBA 4ZYHA 3WTWC 5LD2C 2FEZA 1WSUA 4ZZDA 4TMVA 2W84A 3KLOA 1VQKB 1EFRA 4AVPA 5LGUA 4IKFA 2CFOA 3N6ZA 4I84A 2OZUA 3B6AA 3K1NA 1G3YA 4A0YA 2TDXA 5CKTA 5CQEA 3CESA 4XKWA 4O5VA 1XTAA 3OY9A 3K4BA 4LITA 4HDVA 1I27A 3CCJB 3ZPNA 3BTCA 2V1NA 3ZMDA 3JQPA 1XMAA 4G6TB 2LF7A 1OCPA 4W8SA 1LFPA 4BY7J 4IX7A 2C77A 2A68F 1VF9A 4RDKA 3GVLA 1MABA 1DPUA 3B02A 2UUZA 2VASA 1AU7A 3VYUB 4L5IA 3TP0A 1OCTC 3BQJA 3H09A 4IOAF 4I99C 4L18B 2NVQJ 4ESJA 1KQ5A 4KIFA 3BOQA 3W2GA 3KE2A 4ACBA 5HKKA 1HA8A 4A3CJ 4EGYA 2GA2A 4UNOA 1R5NA 4C9YA 4TKOB 5IOZA 2VYQA 4QTRA 4RB2C 2XDVA 3DPTA 2IA0A 2ETHA 2STTA 5B1AH 2IA1A 1XDUA 3RQIA 4RDUA 2HEOA 3D0SA 3SZPA 3CB4A 1LFUP 4RGUA 1L0OC 4RAYA 2EV5A 1IDYA 1R7JA 5EGOB 1MDMA 4UZEA 1QUEA 1UD2A 4Q7JB 4AIKA 4Y7NJ 3IH2A 3X2QH 1ELOA 3NEUA 1NBMA 4L9JA 3W2IA 3H3VK 2W7NA 1DU6A 4P9SA 3KRGA 1TLLA 4RCZA 3HBLA 3ZGKA 2V7XA 2HWVA 4M0LA 2ZJPF 1TQIA 1YIJB 4M3DA 4G7ZF 3OR2C 2QA4B 3HAGA 2H1KA 1JB9A 4EM0B 2VQGA 3FIWA 4J0QA 2DMTA 2KKOA 2LP0A 1WDTA 3FXKA 4DNTB 1W5SA 2JJ1A 1AWCA 3IRQA 2VODA 1QQ1A 2HNHA 1IN6A 1EE6A 3OIPA 2NNYA 1SVLA 4XORA 4P3YA 1E3XA 2LY1A 5JFRA 4KKTA 4NCNA 1W34A 5F0HA 1RUOA 4WXHA 2CUJA 2L9NA 2WJVA 3I53A 3Q0VA 2O9LA 3CW2A 2EFPA 3SEJA 4G7WA 3CD6B 3BR5A 2VKHA 4Y9RA 4AC9A 1J59A 4CCOA 2DTRA 3CLQA 2W24A 1ZH5A 3CZ6A 2QM3A 4YC5A 3K7AJ 2P5KA 2VONA 4WZLA 2R92J 4NBQA 4D7MA 3MKZA 2VT3A 3ZMUA 1VHEA 3NAWA 4WZEA 3ZRGA 1GVJA 1R00A 2W82A 2XVCA 5CVUA 3ABTA 4NB5A 2RC5A 3K1MA 5E1WA 3V7AA 4XD7A 2IXSA 2L3DA 1HKSA 2DYIA 3CJTB 2Q2EA 4XL9A 2ZFUA 4NDLA 3FXRA 3Q0UA 2XASA 1BHEA 5JLXA 4OIPF 2KZGA 4JX5A 4C3IJ 4I09A 4IRHA 2VJ5A 1H89C 2DOEA 1RUNA 4OIRF 2Y0MA 2R7DA 3JCUC 3M8JA 1Y1VJ 5F0FA 2VNHA 3GEZA 1RIOH 3ES9A 1QA6A 4C2LA 2E1MC 2WAEA 2VI6A 2R5ZA 5FRMA 3JRGA 5E20A 1SMYF 1FMWA 4I01A 4FX4A 3ZZUA 4Z4UA 2ZB9A 2LG4A 4HV5A 1X0CA 3B8YA 2QX3A 3UW0A 1JGSA 1MBJA 2PI0A 4IO9F 3AG4H 3GBGA 1ZRFA 3BY2A 2BSPA 3S14J 2VBEA 3LQRA 2FJ1A 3I54A 3ZP5A 4MQVA 4NQWA 2KVOA 4BBSJ 2M8GX 1K4ZA 1MIJA 3UR3C 4LC0A 3CO6C 2PMDA 2CMPA 4QFMA 4ASUA 3BCAA 3HOUJ 2JMWA 2X51A 2V1UA 2BF4A 4M53A 2NV4A 1SANA 2DYRH 2IVMA 3F0CA 3JREA 2PJRB 2HTJA 3CCVI 3S17J 1P2FA 2L02A 1FDRA 3SEZA 3AG2H 1FNCA 1K8FA 2K5CA 2K7LA 4IL6C 5DN6A 3CJRB 4TSFA 4QPQA 1ETOA 2IW5A 2VLAA 2D9RA 2ODLA 4PC3A 4Q5SF 3BROA 4AVZA 4PGGA 2QEXI 1MKMA 1OFEA 1UD5A 1QZEA 5FKNA 1EXMA 2Q6KA 2H8WA 5FROA 3JRBA 3AGQA 1HKTA 3QYEA 4DBRA 2P0WA 1MJAA 1V55H 3CMYA 4I76A 4HIZA 2QKLB 5J35A 1KQ9A 4U9UA 2DA2A 2ZKZA 4BE0A 3HHGA 1VQMI 3OJXA 4P26A 3OL3A 4UVCA 3ZPLA 1WMRA 2VBVA 2HPMA 2NT6A 1MMGA 4RPBA 4Y33A 1FSEA 5ICGA 3OEHA 1HF0A 1JE8A 1LDJA 4HW0A 3F3XA 5M3MJ 4XKVA 3I9V2 2HCJB 2NS8A 2EFGA 2GOXB 1E3PA 2MLKA 2V1DA 4H4KC 1UCRA 2QENA 1ZG3A 4RD6A 3WHCA 4HF1A 1KU7A 2ZC2A 3OL4A 4Y7CA 4XBFA 2ZJRF 1GJRA 1YS6A 2PG4A 3HOXJ 1SEUA 2NYXA 3VO2A 2FE3A 1ETXA 2V6CA 4WXDA 3MHPA 4YFOA 4E7LA 5DUKA 3L2VA 1ZGAA 5L3BA 3FF5A 2ZO4A 4Y13A 5H2FC 3BNWA 2OJED 2QSFX 2R93J 2HI3A 1BC7C 3UKGA 2PQ8A 1XGMA 2VBZA 1BL0A 2E2IJ 2HOTA 3SUCA 1I50J 3DXJF 3PNYA 4XRSG 4ZZLA 2YU9J 2JA5J 1OHHA 3TDUC 3GFIA 5F08A 2W85A 1FZPB 2DT5A 2Z5UA 1TLHB 1A6QA 2PYHA 5KCMA 4ZGQB 3MN2A 2PJRA 4A3GJ 3MKLA 4A69C 3W2EA 1QNTA 1PYVA 1S7AA 3P4GA 3I55I 4NK6A 2M9HA 4ETSA 1QFJA 2DXIA 4BGDA 3ZQQA 5HLGA 2BGCA 4I0AA 1O4XA 1E2XA 2WR8A 2FMLA 1V0FA 1EZGA 3ZUGA 3NWSA 2GXAA 1TTTA 2QKMB 2P5VA 4ZCLA 1YRNA 1VQPB 4FXUA 5LFAA 4HYEA 4M3GA 4ROXA 3E7LA 1V5VA 2E1BA 2QDXA 2XNDA 2DDAA 2XAUA 3GTOJ 1HG8A 1OMIA 2XGXA 1H0MA 1J9IA 3OZWA 2LFBA 2NPFA 2EV0A 2O6GE 2CUFA 1UD4A 3HZJA 2R0QC 3ZPPA 2DQRA 5DTDA 5IT3A 4HPQA 2A07F 2JA6J 2VXZA 3I3LA 3HHHA 3S15J 3OE7A 4FWTA 2RN7A 2VT2A 3BQZA 4BNCA 2Q6OA 1ZK8A 1EP3B 1IDJA 1JHFA 2QQ9A 4NC6A 1QPIA 5K7HA 3QOPA 3RTRA 3HRMA 1CGPA 1RZ4A 1P92A 1JXSA 3TH0A 3FKIJ 2E35A 4HRIA 1VQNI 2MABA 5TISC 1JUPA 3TP3A 1N0UA 2VJJA 2K9NA 4ZTJA 3I0TA 2JUCA 4YRVA 2YUHA 4S04A 4AF6A 1VQ5I 1R5GA 2FNPA 3F8CA 3U21A 5J4VA 2STWA 4Z05A 2DK8A 3OYKA 2R7FA 1K79A 1N06A 4PSWA 4G8XA 2HYJA 3GX4X 4J19A 4G1BA 5FO0A 4W97A 3CCRB 3CC4B 1BX0A 4YIRX 3DPUA 2OBSA 1UD3A 5IP6A 4AF7A 3V7RA 3GVJA 4X7DA 3C2BA 1Z6TA 2J7KA 5LLQA 3U1DA 1QVTA 5TGTA 2KDOA 2XEXA 1W7PB 4RBOA 2HZDA 2DA5A 4HX7A 5GAGJ 1N07A 1BI2A 4C30A 5D5XB 2OTLI 2BM7A 4IJAA 4Y3OA 2X8KA 2EFWA 2BMWA 1OB0A 4LD5A 1IN7A 4UV9A 1NRKA 1QG0A 1IRFA 2OQRA 2K4JA 3NRVA 5FFZA 1E3OC 1AHDP 2B7CA 2IGNA 2C4TA 1Q86D 1QO0D 5GTIC 1GLNA 4M3FA 1X4PA 4RD3A 1WKMA 4XOPA 2IS4A 1LVKA 2FQ3A 5BPDA 2EJRA 3GTPJ 4LBZA 4GXOA 2M4GA 2K4BA 3JX8A 4KKSA 3K2ZA 2DCEA 3HYIA 1GAQA 2M45A 1O3SA 1UHWA 2EB7A 4A0XA 2COBA 3OKXA 2IGOA 2NS0A 5CYVA 4UY8I 2EBIA 3CQZJ 1DGWY 3IV5A 4WX9A 2DMUA 4W8RA 2YPRA 2JUGA 2L54A 3N05A 3HUGA 3OYGA 1V4RA 1NB9A 3DEWA 4OPSA 1NTCA 3LSPA 3H94A 1WH7A 3WU1B 4XRSA 1TSPA 2QTLA 4N0BA 3CUQA 1MRZA 2P81A 4QIWN 3DBLB 1R9TJ 4DW6A 1F1ZA 5FLXZ 5DD8A 3LSGA 2Y31A 3CMAI 2WV1A 1IHMA 2QEXB 4MFDA 1WFXA 3QSYA 2HGCA 4CCNA 1WSVA 1XN7A 4DQ2A 2OCEA 4O6JA 2C4UA 1P4XA 2C2WA 2M30A 2PJPA 5HZAA 1Z6RA 1Q1HA 1TNTA 1TWAJ 1VFCA 1APLC 4HOBA 2BM6A 1OR7A 2F4MB 4EJUA 1KK1A 2O8KA 5BSYA 1IXCA 3HKZN 4R1HA 1EF4A 4PAAA 3GQAA 4F7ZA 2K9QA 3QFSA 1VQ9B 2WAFA 3DU6A 4QPOA 3RPUA 1F4KA 5L3GA 5LEJA 5D5UB 1BJKA 5AIPA 3AL0C 2JDIA 2DAOA 2ZNYA 2HDDA 1Q82D 3SEQA 5FLMJ 4BDYA 2R7QA 1YW9A 2WZNA 3OYCA 4U4BA 3QU3A 4JX4A 4KYWA 3DCFA 3JRCA 4IQ4A 2X6OA 5F4OA 2V4JC 3A4CA 5C1CA 3CCJI 3OYLA 3A1YA 1CLWA 5HLIA 3V8LA 4MFEA 4OJ5A 1A8PA 3GLXA 2HTSA 2XT2A 2LRDA 4HG2A 1X3UA 1U2WA 2D5VA 1QH0A 4AD9A 3CUOA 1SAXA 2INUA 3N97A 3CDHA 2NVXJ 2O03A 1YJ9I 2GA1A 1GT0C 3GTQJ 1B4AA 2D1HA 2EWEA 4P1WA 1WJFA 3BG5A 2ZMEA 1V5GA 1W9XA 1RMGA 3RIRA 2W57A 3FZVA 5D5VB 2Q0OA 4HSTA 1I18A 3L2RA 2D1VA 2KL4A 3WE2A 3SY2A 1YJNB 1KGSA 5HNHA 2VFQA 5IYDJ 3HUGB 3LSTA 3WU0A 4DYQA 1RPWA 3ZQ7A 1OISA 3G71I 1K7AA 1E3HA 1GR1A 1MJBA 4RLQA 2CGPA 3QE2A 2ISYA 2D2WA 4S05A 3H9GA 3WBKA 2XF5A 3RKYA 4A3KJ 2MGQA 1T98A 3NWTA 4KJZA 4CICA 4D0PA 3BG7A 3LSRA 3OPOA 4AU7A 2R5YA 5F0CA 4J00A 2O61A 3RY8A 2R7XA 5J1RA 3QAHA 3GQBA 3WBJA 2LC2A 1J5YA 4B44A 2WY8Q 1H85A 2YR2A 5E8IA 4E7HA 4F7DA 1USSA 5C44J 5D4RA 3TL4X 2H94A 4C2TA 1KZHA 3CPWB 1KTWA 2ME6A 2MD5A 1JKRC 1Z05A 3WTVC 1WORA 1U5TA 3MKWB 5IP7J 2O0YA 1W2BB 2BHZA 5J8FA 1L1IA 3PSZA 4A3BJ 1A35A 1IA5A 5H59A 1YFHA 2DY1A 2BY1A 4YZ0A 3ISPA 5B3SH 3FMQA 2LKPA 1I39A 5IPAA 4C0SA 3LQEA 3FY3A 1K5CA 3F6VA 2XTXA 2M5SA 1ZAOA 2JQ7A 5HDKA 2VPRA 2ELJA 3NARA 5EEAA 1Z1DA 4A5NA 3R6JA 2BHYA 2X6WA 3G2BA 1GVDA 1D8TA 4PJNA 1I3QJ 5KVRA 3LO8A 5F6FA 4LB5A 1EFUA 1UMKA 4OU0A 5DS9A 4R79A 1T0FA 2O1DA 2LSOA 3BH4A 2JIZA 4ENKA 1Z3XA 2E2JJ 4ZC3A 5DNSA 2R7OA 4ZYAA 4DNRB 4M73A 4M72A 4A3LJ 5JLWA 3VO1A 1KYZA 3JRHA 4XLPF 2HYGD 1YQAA 1K73D 1TZLA 1W0KA 3CDIA 3G6EB 2ZMEB 3KX2A 1G3TA 1Q1VA 1QA2A 1EH7A 1W7PD 1X3ZB 3PSFA 3VSKA 5JVGF 2L7ZA 4RJLA 1BI1A 1LDDA 2MBFA 2V26A 4LG3A 3PUFA 1OGIA 2LZJA 4KIBA 1TW3A 1ETWA 3GWZA 2G0EA 1ZUNB 4D7NA 3EPZA 2PN6A 4HQMA 3VOEA 2W1OA 3F6OA 1REPC 3KP7A 2Y0SA 2ZZQA 2F5EA 4CCMA 2XNCA 3ISXA 5THXA 3SDGA 3ZQGA 2F5FA 4ANJA 5DM7F 2Y75A 3D5RC 3LAPA 1KYWA 3VMFA 1HW1A 1UFMA 2DMNA 2I5UA 1RI7A 3IWFA 3HOTA 2QQ8A 4AM3A 2EV6A 2XSJC 4D5FA 2AXLA 3I64A 1YIOA 3CC2B 3SLDA 4HZFA 1D0XA 2CW5A 1V3FA 4CCLA 4KH3A 5LEKA 1F9NA 3MMPA 3SDBA 3DP7A 3P9KA 1OQYA 1QJVA 5J6XA 3HRTA 4MYTA 2NSTA 4ZCMA 1MJ9A 2KPMA 3SFIA 4E4HA 1X2NA 3OW7A 3IUOA 3A3GA 4UB8C 2V1XA 3L2QA 2QQAA 3I4MJ 1CQXA 2LDUA 4G7OF 2F1LA 1IJFA 4WF2A 3DKXA 2DOFA 1T6ZA 1YO5C 4KISA 4MEYF 1YHQI 4IHWA 1TYVA 2ZTGA 5J47A 5M3FJ 3NAUA 3OYFA 1QQIA 1XSVA 5E17F 1E1QA 2V7QA 1WTHD 2MLGA 3DKYA 1ZR2A 5KNLA 1XE1A 4KUMA 1FOXA 1LKXA 1ULYA 3RQ4A 2EQRA 3G1LA 3WG7H 3GRHA 3F8BA 2QLZA 2YWGA 3I59B 2NVYJ 1XS9A 1OYYA 4KN4X 2DA3A 2M1BA 4II2A 1VNDA 1BIAA 5E6TA 2CQKA 1V0EA 3F9KA 5HS8A 1U9OA 2XUBA 1UHMA 4P2NA 4DQKA 5AMVA 2R7WA 1YX3A 4ZDPA 5C3EJ 3C2HA 4WCGA 4OZYA 4M74A 1X4OA 2TRTA 2RNJA 1S72I 4UUVA 3SQVA 3E1SA 1MH3A 2R7SA 1QVFB 1QHHD 5EZGA 5EEGA 2NZMA 3JU4A 1R5OA 2YUSA 9ANTA 4CYDA 4G7XA 1SVMA 4U0YA 4GYGA 5C1EA 2HQAA 3CJQB 4BBRJ 1B9NA 2OV7A 3ECHA 4CCKA 2MW8A 4UVAA 4CO8A 1KQSB 4A6EA 1JUSA 1SFUA 1UD6A 2MG4A 3DEUA 3K0LA 1KA8A 2NAZA 2VFOA 2GQFA 3AGPA 1QFYA 3HOZJ 4I0BA 3A8JA 3MQ0A 2M34A 4NC8A 4B4DA 4OAYA 2ZXJA 1BI3A 2ECBA 2GJRA 3G05A 2DIEA 4CYCB 3K70D 4OOXA 4YFNF 2L01A 1RQRA 3CCUI 4IHTA 5EG0B 3OYMA 1J75A 1FTTA 1F20A 1UZCA 3SJMA 1S29A 1HVXA 1FNDA 4JMQA 3WWGA 1I3AA 1Z91A 3P26A 2CWEA 3F22A 4YAUA 2NSPA 1Y8QB 2V9PA 3BWGA 2GLOA 4QV2A 2CW7A 3O3KA 1WPCA 3HGGA 1O8LA 1O8HA 5ILVA 1FOWA 2VKVA 1O57A 4M3BA 2DT7B 3RPUD 4LG0B 3GTJJ 4LIVA 3CCSB 4HBLA 2WC2A 1IXSB 4QSHA 3VFZA 5IOYA 4XK4A 1U78A 4XKBA 1QRCA 2FMYA 3E0JB 4TN1A 1EWYA 3QWLA 3COAC 1V54H 4ENJA 4BQOA 4BXFA 2O3FA 1R5ID 4UZFA 3L7WA 3EYIA 5EYRA 1TT0A 2BVNA 3VEPA 3QPTA 4UHTA 1N8RD 4X05A 1COWA 4BHBA 2RNGA 1XSDA 3BR1A 1YX2A 1BPLA 4G5GA 3T51B 1R4NB 3PFYA 3G1MA 4HX4A 2M4KA 1F43A 1E64A 2EIXA 2WB1N 2K86A 5AIQA 5CDFA 1BOAA 1SD7A 2L9VA 5JMCB 3AVXA 1YS7A 4NNJA 3CPXA 3OJWA 2BE5F 1QBJA 5L3DA 4FN5A 1O3RA 1GXPA 3W2HA 2LNBA 1GQ8A 5IYCJ 1LQ1A 1SAUA 2JWTA 1I6XA 4U0WA 2JA7J 2MH9A 1ZGWA 4DK1A 3P7NA 4HSRA 2X3HA 1TNSA 5EEHA 4CGZA 2B7EA 1ACIA 1QUFA 3BTIA 5HDNA 2OU2A 4CUGA 3DLAA 2DERA 4P6YA 4Q4ZF 1PJ5A 1UELB 3WTYC 3J7AY 2UV1A 3I71A 1MD0A 3T53B 2CS3A 2KIMA 2HDNB 1KK3A 4TT3A 2XC1A 2QCOA 4X6AJ 4BYYA 4N3GA 2BSAA 1RRJA 3ASQA 4MHGA 4LFUA 3LSMA 2AQFA 3IAS2 2VNIA 3TKYA 3OYAA 1PP7U 2HMAA 3W2VA 4CHUA 1WWXA 1S3JA 5FGMA 3JAMK 5A2QK 1DU0A 1BR4A 1IW7F 1ETQA 2FUG2 2ID6A 1H8HA 4YAOA 2KIQA 4MQ9F 2BM1A 3SYJA 4J01A 3LNQA 2EK5A 2IQ7A 2XT4A 2HDWA 1ZQ3P 1R5HA 1ETKA 1HF2A 2DU9A 2XGCA 3WGGA 1XGSA 3AG3H 3DF8A 2VC0A 2VBKA 4LBVA 2ZCWA 3KYLA 4L5JA 4LIUA 5H6QA 2PLFA 3AAFA 2O17A 4YZAA 2IJLA 3OOUA 4MGRA 3M8FA 4D5CA 2AHQA 5FKMA 3U9GA 3JSPA 2GJPA 3PO3J 3E3VA 2MSYA 1M90D 5KAIC 1B59A 1O7FA 1WH5A 2LY2A 4B3FX 4PDKA 1ZM3A 3TQNA 5TV2A 3T9GA 2PMZN 2GK7A 4ASNA 3U2QA 2A6EF 4FT8A 2K02A 3W2AA 1DQUA 1OFMA 1MW7A 2CUEA 5E3NA 4L0YB 3ASRA 4BPRA 3ML6A 3IWZA 2NOJB 2XF6A 1OCRH 2WB1A 2VL8A 5ICFA 3SLNA 3GTMJ 4I6ZA 2XRNA 2WAQN 3S2DJ 2BN4A 3Q39A 3VNUA 3OOPA 1J7KA 1W7PA 1HDDC 1W87A 2CH0A 2RC6A 5DV5A 1YJNI 5EDNA 1U8BA 2V9VA 1LDKB 1NK3P 2B63J 1BA5A 2ZBKA 2L4AA 2Y9YA 1NHCA 1IN8A 2KRHA 4PJJA 4XM3A 2Z3YA 2A05A 3VODA 1FTZA 3BR2A 5DSZA 2BVLA 1S9HA 3F8NA 1U3EM 4Z6YA 3OWTA 2R7ZJ 1JJ8C 1KK2A 2X0KA 3B78A 3SXYA 3V76A 3SYTA 3A0BC 3WNBA 1LEAA 5J1YA 4IHXA 3FM5A 4RA2A 1OFLA 1JA1A 2QGUA 2F4NA 4OJOA 4UVBA 2HFHA 3GMEA 3WTUC 5EF6A 4BHPA 3AK5A 3F23A 2QMUA 1PJRA 5IT9Z 1BI0A 5E1XA 1VJSA 1JTXA 1XGOA 2HZTA 2KHMA 2CBXA 3TO9A 4Z4VA 1K4TA 2WA0A 3CCSI 3A35A 1B8IB 4IW3B 1LPQA 3CCQB 1K8AD 1VQ6B 5JHFA 2R5ZB 1YE9A 3WGIA 3M8EA 3JRAA 1G7CA 5IYRA 3ZIAA 2CRGA 2PX9A 4A3MJ 3QPHA 1E79A 3GSIA 4R71A 1JJ2B 4BQAA 4IHYA 5ERIA 1EJ9A 2H27A 1N25A 3QQAA 2GZWA 3TO7A 5K7FA 4UAJA 2KMUA 1E63A 4PK4A 1EH8A 3IRRA 3IH3A 1BLIA 3ECOA 3JAMZ 5A2QZ 1D1CA 2XOKA 2W4SA 2ZSIB 3HSRA 3CMMA 5CJ9A 2GWRA 4E7JA 1HW5A 2LBFB 3CCLI 3I56B 2BV6A 1ZN2A 3CUQC 2NT9A 1LFBA 2G7HA 3F8FA 3W2FA 3JRFA 3RCOA 2CO5A 2QYOA 3J80K 1IN4A 4LGWA 4N9IA 2BY0A 2M2EA 3SFZA 1ON1A 2CU7A 3DLLF 2HVSA 2QZAA 3CF2A 4XICA 3DV8A 4KA4A 1TYWA 1TWFJ 2EIKH 4CYCA 4P55A 1V5FA 3WHBA 2XHKA 1DARA 5KK1A 3M3YJ 4B3XA 2GPJA 3B82A 5J3OA 2LREA 4UUSA 1CF7B 1VQMB 1HBXG 4RDLA 4XN3A 1LVAA 1NJID 2C5HA 3IH4A 3GFJA 3ZMSA 3A0HC 3AG1H 1YOVB 3DQVC 3ZQLA 1SVOA 3LL7A 1NH3A 1QFZA 3A1PA 4LLGF 5DCMB 5D8KB 1IRZA 1BX1A 2D3LA 1IDKA 3FXOA 4URRA 3CC2I 2V7TA 2DA1A 3GLLA 4A3IJ 5EJCA 2FBKA 3S1RJ 3CUQB 2D45A 1TUIA 1H42A 3EETA 1ZGJA 1JNYA 3DDYA 1H88C 2IEKA 2NTPA 1K6YA 3HC7A 4PC1A 1YLFA 2KT0A 1K61A 3CTAA 1VQOB 3M1EA 5IYPA 3QFTA 1FSHA 2XNJA 3D1NI 2I8DA 1OCOH 1X1DA 3ZBTA 2JPCA 1FNBA 1R22A 2YX4A 1T56A 2XROA 4NBSA 5DS0A 3ASOH 2BW3A 2XGEA 4KT5C 2P6TA 2ZMEC 2HOAA 1PUEE 4OM9A 1ZTRA 1PE9A 2Y48A 2KDZA 1NB0A 2VZLA 3VMWA 2P6SA 1D8JA 2XB5A 1VBLA 3K4KA 3O8HA 2PLYA 2ZBUA 1KU2A 2LYCA 5HODA 4OP7A 5L3FA 5HNFA 2CQXA 1GXQA 3OYDA 3CP2A 3OFNA 1PLUA 2XTWA 2BXYA 4MXNA 4FISA 3ONYA 2VN2A 2FBIA 5GP9A 4HWVA 2F5DA 4U87A 4EEFG 4XLAA 1OGJA 3V8JA 2LVSA 1JA0A 3K70C 2H6BA 1FP1D 1O3TA 2BGIA 3E20A 1JRGA 3RPQA 1DDIA 2V79A 2E34A 3K4NA 3QYFA 3K6GA 4M1KA 1S72B 1P4AA 3AVUA 1AMOA 2LF8A 3E6CC 2XPWA 3KP6A 2KQRA 1P9QC 3ZQFA 1G8XA 3S1QJ 4Z1MA 2XZOA 1SMTA 4P5OA 2JJ7A 5K5RA 3W2WA 1FOKA 4PFPA 2DYSH 3FXQA 1MBKA 4MTEA 4DK0A 4CXFA 2NXNB 3HM5A 5HOOA 4WZKA 1LE8B 1A04A 3TBIA 3W6JB 3CCMI 1KC8D 5JLVC 2VFMA 3LSIA 1A5JA 2ECCA 2WZPP 1O8GA 4LJZF 3T8TA 1XX5A 1TWCJ 3M7GA 5GPAA 3PQJA 2IAIA 5LHHA 2O04A 4GFBA 3WTTC 5DCMA 1NG6A 4DZJA 4ZYEA 4WZTA 1T6YA 1S4MA 1S6LA 3Q5FA 4OMYA 1UG0A 2XSDC 1D3YA 4JBAA 1LM1A 5IYBJ 3AKZA 2V7VA 2HKOA 3A03A 1T0FC 1R6RA 1TL8A 2XKOA 2FA5A 2L5QA 1IV6A 1AIRA 4XLHA 3L1PA 1DPRA 2L2OA 4YHBA 3DPLC 1SC7A 3BPVA 1IG7A 2DODA 2M87A 3OIQA 4OPVA 2X1DA 4HEA2 4X8IA 2K3FA 1IXRC 1QZYA 3TGNA 4RS8A 2EFQA 3N4MA 1HOMA 4DNCA 2MFZA 1U5TB 5LHGA 4ESBA 4DGWB 4JK1X 4N4NB 5D8LB 1R36A 1M1EB 3DTEA 3OV8A 2VE8A 2X6YA 2XC7A 3ASSA 4CQJA 2WAQA 5B6IA 2V31A 4A2UA 3CCQI 3W6KB 3CMEB 2B9SA 5F4MA 4ACAA 3S2WA 3WTZA 4Z4YA 1FBUA 4P96A 3MZHA 3ESWB 3GTKJ 3WXMA 1RC9A 2G0YA 1ZR4A 4L8JA 2PECA 3EUKL 4HQEA 1FPQA 1VQ8I 2ESNA 4I7HA 4BUPA 2V4DA 5H20A 1K78B 3RKXA 2F5CA 1N0VC 2OPTA 3LFUA 3ASNH 1W5CC 4XRMA 1T95A 3M1CA 4PJMA 2VE9A 1FEXA 1GHCA 2EFOA 5DYMA 2NOGA 4ABZA 3I56I 3H0DA 2IS6A 3CJNA 3ZQHA 3CD6I 4GRIA 2GREA 2J5OA 5B5EC 1P4MA 2Q2EB 2XV4S 2L0KA 1T6XA 2D74A 3LA2A 1TYUA 1XG1A 4RAFA 1CZFA 4RAGA 4LBYA 4YXWA 2R7UA 3BY6A 5GTHC 5FJ8J 3HPGA 4EV0A 2F6CA 4L5EA 2VBTA 1S8NA 3KEOA 1VF7A 2B5OA 5IP9J 3DFGA 4IPAA 1GO2A 3CO7C 4KN7X 1B8IA 1W36D 2ZZFA 2KISA 3TOBA 1EP2B 2HXIA 3Q9SA 1Z9CA 4BL0B 3J7ZI 1MSFC 1LLWA 3SZGA 2CV1A 2AO9A 2DLLA 4NQWB 2P7CB 3JQQA 3QFCA 3VSUA 2OD5A 4IRIA 2VNKA 3IP4B 3OR1C 3JURA 2WV0A 4M6XA 3CC7B 1T2KA 2F4IA 2BZTA 2QUFA 3Q3AA 3OS1A 2K27A 2F4OB 3BG3A 4KNYA 2X1CA 3HKZA 2E7WA 3ONQA 2O8XA 4II3A 1KU3A 3RDIA 2JK3A 2CV0A 3LYCA 3S3OA 4P22A 4Z03A 3ASTA 4IVNA 5J40A 4Z2YA 2GXGA 1FJLA 3HSFA 1P7JA 1TYXA 3U6BA 2KZVA 2CV2A 2L7KA 5FRNA 1MMAA 5HVQC 4P6VF 4CSWA 3PFIA 2VQHA 5K7ZA 1VQLI 3OSFA 2DPUA 1XB4A 6PAXA 1O88A 2LTPA 2A61A 3IC7A 4F92B 2BV3A 2IA2A 1IUYA 2L7MP 1USTA 1WJEA 3S3NA 2HQNA 4P25A 4HX8A 2A3SA 4UZUA 1RR7A 1UB9A 2YS9A 3ABMH 3FMSA 3F21A 4V19K 2O0VA 5GADJ 2V7UA 4X07A 2EFNA 1PDNC 2LLKA 4BE1A 3QOEA 4P9FA 3JTGA 2IT0A 5A8AA 4A3FJ 4TMXA 2UVEA 5LGNA 2IP2A 3H9NA 2X6XA 2KLOA 2C78A 3OIOA 3TMOA 3V7CA 5BPIA 1O7LA 1ZHFA 4KIGA 1ZLKA 1JI8A 3CCMB 2Y69H 2DEUA 3H1CA 3Q3SA 4RAZA 5F1JA 3G1OA 5FO1A 2XIGA 2JVHA 3H5RA 3W3CA 4K2EA 1EP1B 3K4MA 2DOGA 1VQ7B 1W4MA 1QCXA 4IQJA 2XZPA 1B9MA 2VJ4A 2QA4I 1DUXC 1FX0A 1GVHA 4E6KG 2YSRA 3K4LA 2AS5F 5D5WB 2GJKA 4DBQA 4BS9A 5H6RA 3ROUA 4AWXB 4G6DA 1KCDA 2BW3B 3WNDA 2VPLA 3BP8A 3H5NA 2BEOA 2M0CA 3GZNB 2JSCA 4H9GA 2KIUA 1FNMA 2R6HA 2JJ2A 1O8EA 4OINF 1H8EA 1BJAA 3S93A 2X53S 2E5ZA 3BPXA 3EDPA 1VQNB 2K85A 4B09A 3PM1A 2K9LA 3GFLA 2O6WA 4RGXA 4MYUA 4HNVA 1O8JA 5CQGA 3S1MJ 2WJYA 3LMWA 3OZUA 1SKQA 1YJ9B 4IOCF 5LRRA 3ZZ0A 4EVIA 3HOSA 1XQBA 4M6VA 4I2OA 1YYVA 3Q0WA 1QGAA 1XMXA 3TW6A 3L00A 5GAHJ 2K9MA 4YIFA 4B48A 4B47A 5D6FA 5B1BH 1IGNA 2HLDA 1VQOI 1AIPA 5ICEA 1YTYA 3HSEA 4ESFA 4XN0A 4X0GA 1U0JA 1YI2I 1E3ZA 1VQ8B 3FK7A 4MR0A 4TV7A 1B72A 2WSSA 2E5NA 1E43A 3ZN1A 2ADUA 1YJWI 2OTLB 4FHTA 1ZYRF 1Y56A 2M3AA 3MZYA 1LE8A 3G4SB 1DP7P 4RD0A 4BDZA
chains in the Genus database with same CATH topology
3BG6A 1SAUA 4BJ5C 3OEHA 4ZDLA 4DK1A 4HSRA 2X3HA 3S8PA 2IS2A 4XKVA 3I9V2 4CUGA 3DLAA 4EW9A 2GOXB 3BC8A 4H4KC 1UELB 3J7AY 2UV1A 3T53B 1WJDA 2CS3A 4PJLA 3OL4A 4TT3A 2WBMA 3IAM2 3OYNA 3T56B 4MLOA 3ZSCA 1D0ZA 3RSNA 2Z6BD 3OS0A 3LSMA 2AQFA 3IAS2 3OYAA 1AA7A 1X19A 4E7LA 1OGMX 3W2VA 3EUHC 2CK3A 3L2VA 1BR4A 2FUG2 3L2UA 4YEJA 1E3XA 1H8HA 3VYRB 4KKUA 4J01A 2IQ7A 1EA3A 2HDWA 3SUCA 3VMVA 3PNYA 5CPRB 4N4OB 1KMHA 1OHHA 2O0WA 3GQ8A 3VSVA 2OUMA 2XF7A 2VBKA 3FKSA 2PYHA 5KCMA 3KYLA 2RQQA 4HNTA 2PJRA 1T5EA 1MMNA 4KITB 4LIUA 2O17A 1PYVA 2UWMA 3EUAA 4YZAA 4NK6A 2VQLA 3OOUA 2M0MA 2DXIA 4BGDA 3ZQQA 1K28D 2GJPA 1V0FA 2W6IA 3VSLA 3NWSA 5FL7A 2QKMB 4DIQA 3T9GA 2LY2A 4FXUA 3FBIB 5LFAA 4B3FX 3WQZA 2GK6A 2GK7A 5HLTA 4F55A 2E1BA 2XNDA 2XAUA 3K4CA 1HG8A 4PMHA 3W2AA 1RU4A 1DQUA 1BR2A 4NUBA 4BU2A 1MW7A 2V7FA 3K4JA 1OFMA 1O8IA 1O8FA 4F52A 2MD0A 3D5LA 2NOJB 3LSKA 1UD4A 3ZPPA 2XF6A 3BCDA 1D1BA 4HPQA 2WB1A 2KRCA 2VL8A 2VXZA 3FDYA 3I3LA 4XLEA 4DJAA 3OE7A 3OS2A 1E0EA 4CH7A 1IDJA 4NC7A 2CH0A 2M7BA 3PJRA 1QU3A 1D0YA 3RTRA 2Z1DA 3H35A 4BJTA 5KHDA 1LDKB 1NG7A 4HRIA 2MABA 1IB4A 1NHCA 1H80A 2VJJA 2KRHA 4PJJA 4XM3A 4KT6A 4ZTJA 4XOTA 4YRVA 3GVKA 2VBMA 4Z06A 2BVLA 1S9HA 2IGKA 3OWTA 3OYJA 3PNTA 1ERDA 3SYTA 3U21A 2OC6A 3NE5B 4Z05A 1WJBA 1Z21A 3OYKA 2E60A 2PECA 3QODA 4U7BA 4YZQA 4PSWA 1OFLA 3EQNA 3D5SC 4OJOA 2HU9A 3DPUA 1UD3A 2BVMA 2R4GA 3GVJA 1PJRA 1N78A 1VJSA 1FMVA 5TGTA 2KDOA 3HG9A 2KHMA 2HZDA 3FBNB 1DBOA 4C30A 2WA0A 4JQFA 3A35A 1O8MA 2R7TA 1MNDA 4Y3OA 3PNVA 2X8KA 3BCFA 1OB0A 5JHFA 1NRKA 1J09A 3VYTB 1WJCA 2IGMA 1YE9A 2IGNA 3ZIAA 1O8KA 1WJAA 4G6IA 1GLNA 3DU5A 1X4PA 1E79A 4XOPA 3OMYA 4XMYA 1LVKA 4D1QA 2IS4A 1OOCA 3VDXA 2M4GA 2XZLA 4KKSA 2DCEA 3OAAA 2WY7Q 3CP8A 4W8RA 2KMUA 2IGOA 4PK4A 4B3GA 2X1EA 2GOMA 2ZXHA 1DGWY 2CUZA 1BLIA 2INVA 1D1CA 2XOKA 2W4SA 2JUGA 2ZSIB 3CMMA 3N05A 4E7JA 2R7VA 2LBFB 3OYGA 4XONA 1PKVA 2WADA 2DJIA 4E7IA 4GQNA 1IRXA 2NT9A 4E7KA 3VWBA 3VR6A 3H94A 3RCOA 4ZTFA 4RM2A 1UD8A 2V9KA 4E7SA 2F5VA 2F43A 4PUSA 2HVSA 3LSGA 3OEEA 3CF2A 2JA2A 1WFXA 1E1RA 4CCNA 2HVRA 1V5FA 1OR7C 4B3XA 4YZXA 2LREA 3HPHA 3EQOA 4W8TA 1N75A 2MYSA 3KEYA 4NK8A 4XN3A 4U49A 1YX5A 3FHNA 2R7RA 1QHGA 3ZR8X 3GQAA 3DQVC 3LL7A 4OZZA 2WAFA 2W00A 3DU6A 3H5AA 4QPOA 1IDKA 2D3LA 4URRA 3ZXSA 3AL0C 2JDIA 4CA0A 4OWRB 2ZTNA 2O5RA 2JSPA 4Y4RA 1SFKA 3SEQA 4BACA 4BDYA 2D3NA 5IK2A 2R7QA 4U4BA 3OYCA 3DDYA 3MMYB 2NTPA 3PL8A 4IQ4A 3HXLA 4BEHB 2V4JC 3A4CA 1K6YA 3HC7A 5C1CA 3OYLA 3A1YA 2IS1A 2CW8A 4OJ5A 4BE2A 1KZLA 2LRDA 4HG2A 2I8DA 4C2UA 1X1DA 2VB6A 2XGJA 3VSTA 3S32A 2INUA 1WJ5A 1X1CA 2BW3A 3A3BA 1X1AA 2RREA 2LH9A 3OYEA 1PE9A 4BQQA 3VMWA 1VBLA 2EWEA 3K4KA 4P1WA 2Z8GA 1WJFA 1V5GA 1W9XA 2LYCA 1RMGA 1V5EA 3DEEA 4HSTA 1I18A 5HNFA 1SKYB 4MXNA 3OYDA 3CP2A 2KL4A 3L2RA 3OFNA 1PLUA 4RM3A 5HNHA 2LBFA 3HUGB 2NTBA 4HWVA 1HZEA 1GQ8A 4U87A 4B43A 2NTQA 4XLAA 4RLQA 3K70C 3H9GA 4ZJZA 2XF5A 1JRGA 2A5WA 4CCJA 1ZELA 3NWTA 4KJZA 1PXZA 3K4NA 3BG7A 3QYFA 3OYHA 3OPOA 4AU7A 3OYBA 3K6GA 3A2KA 4J00A 3ZCOA 4CZCA 2R7XA 2X85A 1VLYA 2PMZA 4ITVA 4Z1MA 2KQRA 1P9QC 3GQBA 1G8XA 2XZOA 2LC2A 4P5OA 4B44A 2WY8Q 3W2WA 3KEWA 4E7HA 3B4NA 4PFPA 1BMFA 3GQ7A 4RLFA 4DK0A 3TL4X 5HOOA 4C2TA 1KTWA 3TBIA 4HNUA 2W6JA 2M7AA 3LSIA 2WZPP 3MKWB 1O8GA 4EATA 4D9JA 2HPIA 4XLFA 1IA5A 2O04A 1Z7LA 1NG6A 3OYIA 4XR6A 4YZ0A 1UG0A 3FY3A 1D1AA 2UVFA 1K5CA 2M5SA 1RWRA 2K3PA 3BC9A 3PSIA 4F93B 3AL0B 3AKZA 2Z16A 2ELJA 1T0FC 3H9QA 1R6RA 2X6WA 3G2BA 2Q1ZB 4PJNA 2L5QA 1AIRA 4XLHA 2L2OA 4R79A 2O1DA 3DPLC 3BH4A 3OIQA 4IZZA 2X1DA 2JIZA 1Z3XA 4HEA2 3V42A 2QE7A 4ZC3A 2ZZGA 2R7OA 2VXDA 3LMMA 4ZYAA 4DNRB 4FASD 1N77A 3K10A 3DTIA 2MFZA 4XKCA 1TZLA 4DGWB 1W0KA 4N4NB 1O8DA 3KX2A 3DTEA 2VKDA 2X6YA 3BCBA 2XC7A 2WAQA 4W8QA 2V31A 3PSFA 3VSKA 5LD2C 4LG3A 2LZJA 2V26A 3MD2A 1I8DA 4PSXA 1BN8A 1EFRA 4IKFA 2CFOA 4I84A 3EPZA 1Z3YA 2W1OA 5CKTA 3CESA 4XKWA 2Y0SA 3EUKL 5CQEA 3OY9A 2ZZQA 4L8JA 3K4BA 4BUPA 4LITA 4CCMA 2V4DA 2PYGA 3ZPNA 3LFUA 2V1NA 3AFHA 3D5RC 4ANJA 1T95A 3M1CA 4G6TB 4PJMA 4W8SA 1LFPA 4IX7A 4FETA 3GVLA 1MABA 2UUZA 3HOTA 2VASA 3VYUB 3H0DA 2XSJC 2V6EA 2IS6A 4GRIA 4BJ6C 2Q2EB 2JVGA 1D0XA 2KP6A 4CCLA 5HKKA 1HA8A 1CZFA 3SDBA 4TKOB 4YELA 4YXWA 4C9YA 1XG2A 4BQNA 2R7UA 1QJVA 3OOCA 3HPGA 2F6CA 2XDVA 3DPTA 2NSTA 2KPMA 4DOZA 2WPDA 4E4HA 1VF7A 3OW7A 3IUOA 3A3GA 3L2QA 2AQEA 4PFOA 1UAAA 4OJLA 2L9SA 4AYBA 1UD2A 1W36D 2ZZFA 2HVQA 3DKXA 4KISA 1NBMA 4E7ZA 4BL0B 1VZ0A 3SZGA 2W7NA 2CV1A 2ZTGA 3KRGA 4NQWB 3VSUA 3B90A 3OYFA 3IP4B 3ZGKA 3OR1C 1E1QA 3JURA 2V7QA 1WTHD 3DKYA 4JOMA 2F4IA 3S3MA 5KNLA 3OS1A 1LKXA 3OR2C 3RQ4A 3HAGA 3GRHA 3FPPA 2VQGA 2X1CA 1Y6IA 3HKZA 2ZZEA 3ONQA 4II3A 2CV0A 4Z03A 4DNTB 2A6TA 3S3OA 4P22A 4II2A 2JJ1A 2HNHA 1EE6A 2Z2SB 3OIPA 2R9VA 1OLTA 3C2GA 3F9KA 1V0EA 5AMVA 4XORA 2KZVA 1YX3A 2LY1A 4ZDPA 2R7WA 2L7KA 3C2HA 2CV2A 4BEHA 5FRNA 2DOAA 1DGRM 1MMAA 4KKTA 1X4OA 4OZYA 5HVQC 2CUJA 2L9NA 4CSWA 2WJVA 2VQHA 3FKJA 4F91B 3LSHA 3E1SA 4G7WA 2R7SA 1O88A 1QHHD 2VKHA 4F92B 2NZMA 1BR1A 4CCOA 1WJEA 3S3NA 1KONA 3JU4A 3CZ6A 1DBGA 1W36C 4G7XA 4UZUA 2O0VA 5C1EA 2HQAA 3CJQB 3MKZA 4BE1A 3QOEA 1X1BA 1MMDA 2OV7A 3ZRGA 2W82A 4CCKA 2UVEA 1UD6A 4XD7A 2X6XA 2KLOA 2IXSA 3TMOA 4XL9A 2ZFUA 4OAZA 3QYBA 4XQFA 1BHEA 1JI8A 4NC8A 4OAYA 1DP3A 2VJ5A 2VJIA 4RMNA 2DIEA 2GJRA 3G05A 3HL2A 3K70D 2JVHA 3M8JA 3H5RA 1MNEA 3W3CA 3UNGC 3K4MA 3LNNA 4E0FA 4C2LA 1QCXA 2E1MC 2WAEA 5FRMA 2ZSHB 4IQJA 1FMWA 2VJ4A 2XZPA 2E1MB 3OYMA 1FX0A 2BOLA 4E6KG 2LG4A 3K4LA 2GJKA 1HVXA 4DBQA 1W0JA 4JMQA 4BS9A 1X0CA 2QX3A 3B8YA 4OJPA 3UW0A 3WWGA 2VIXA 3DWLE 3GBGA 2BSPA 2NSPA 2VBEA 1KCDA 2KVOA 2CW7A 2BW3B 2VQCA 1WPCA 2VPLA 1O8LA 1O8HA 3UR3C 3L2WA 3H5NA 2CMPA 4ASUA 4XLCA 3BCAA 3RPUD 2DT7B 1G59A 2X51A 4LIVA 2JJ2A 1O8EA 2DT6A 1H8EA 2LOOA 3S93A 4F3QA 2X53S 2E5ZA 4XKBA 2PJRB 1BOBA 3E0JB 2K9LA 3BLYA 4BQOA 2ZXIA 3SEZA 4BXFA 1O8JA 2QXZA 1KCCA 5CQGA 2WJYA 3LMWA 1TT0A 3VYSB 1JTAA 2K5CA 5DN6A 3CJRB 4TSFA 4QPQA 1WP6A 2VLAA 2ODLA 1COWA 3HOSA 3GQ9A 4AVZA 2RNGA 3H9JA 2QY1A 1UD5A 2K9MA 4B48A 1BPLA 4B47A 3T51B 3PFYA 2M4KA 3PUBA 2HLDA 5FROA 3QYEA 4DBRA 2P0WA 3MKYB 4XN0A 4HIZA 4X0GA 1U0JA 2QKLB 1E3ZA 5CDFA 2F1MA 4MR0A 1OGOX 2WSSA 4NNJA 2E5NA 4XNFA 4ZDOA 1E43A 4BE0A 4OJ6A 3DTKA 1WMRA 3OL3A 2MC4A 1Y56A 2M3AA 2HPMA 2NT6A 1MMGA 4BDZA 4Y33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRH A;  2X3H A;  1O8K A;  3B4N A;  4XKV A;  4Z03 A;  4XOP A;  1OOC A;  4XMY A;  4EW9 A;  1KTW A;  1EE6 A;  5AMV A;  4XOR A;  4OZY A;  1O8G A;  4XLF A;  3ZSC A;  2INV A;  2O04 A;  1IA5 A;  1DBG A;  4W8R A;  4XR6 A;  4XON A;  4YZ0 A;  1O88 A;  2NZM A;  1OGM X;  2NT9 A;  2UVF A;  3FY3 A;  1K5C A;  1RWR A;  4YEJ A;  2O0V A;  2IQ7 A;  2X6W A;  3VMV A;  5C1E A;  3SUC A;  1AIR A;  4XLH A;  2O0W A;  3GQ8 A;  3VSV A;  2UVE A;  2O1D A;  2VBK A;  2PYH A;  2X6X A;  2O17 A;  4YZA A;  4YZX A;  4XL9 A;  4NK6 A;  4XQF A;  1BHE A;  4W8T A;  4NK8 A;  4XN3 A;  4U49 A;  2VJI A;  1O8D A;  3GQA A;  2X6Y A;  3T9G A;  4C2L A;  1QCX A;  4W8Q A;  4OZZ A;  4PMH A;  1HG8 A;  1IDK A;  4URR A;  1BN8 A;  1RU4 A;  1X0C A;  1OFM A;  2QX3 A;  3B8Y A;  4I84 A;  4OJP A;  1O8I A;  3UW0 A;  3WWG A;  1O8F A;  2BSP A;  3ZPP A;  2NSP A;  2PEC A;  4U4B A;  4XKW A;  2VBE A;  3EQO A;  3GQ7 A;  2NTP A;  1KCD A;  4XLE A;  1O8H A;  1O8L A;  2PYG A;  5C1C A;  1IDJ A;  4XLC A;  4OJ5 A;  4W8S A;  1O8E A;  3VST A;  2INU A;  1IB4 A;  1NHC A;  1H80 A;  2VJJ A;  4XM3 A;  4XOT A;  2VBM A;  2QXZ A;  1PE9 A;  1O8J A;  4Z06 A;  3VMW A;  1KCC A;  1CZF A;  1VBL A;  1XG2 A;  4YEL A;  2EWE A;  1JTA A;  2Z8G A;  3LMW A;  1QJV A;  1RMG A;  2ODL A;  4Z05 A;  2NST A;  3GQ9 A;  4AVZ A;  4YZQ A;  2QY1 A;  1OFL A;  4MXN A;  3EQN A;  1PLU A;  4OJO A;  4OJL A;  2NTB A;  4HWV A;  2NTQ A;  4XLA A;  4XN0 A;  1JRG A;  4MR0 A;  1OGO X;  3KRG A;  3VSU A;  4XNF A;  1DBO A;  1PXZ A;  3B90 A;  4OJ6 A;  3JUR A;  1WMR A;  1O8M A;  2X85 A;  2NT6 A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 1SD4 A;  5CVI A;  3MVP A;  2LMD A;  2Q8K A;  3JR9 A;  5F4J A;  1KQ8 A;  1YLO A;  3MFK A;  2E1C A;  3HOY J;  4E70 A;  3SQN A;  3BG9 A;  1TVC A;  1WJD A;  4PJL A;  3H92 A;  1LLZ A;  2DPD A;  2WBM A;  4M9X A;  3OYN A;  4RB0 A;  2DA6 A;  4PGO A;  3ZSC A;  3BR3 A;  4EJT A;  1D0Z A;  4BKX A;  2Z6B D;  3OS0 A;  2HS5 A;  1MNM C;  3CCL B;  1FOY A;  2QTZ A;  2W7Z A;  1AA7 A;  3QP5 A;  3R61 A;  2Z33 A;  3HGY A;  2HQR A;  1VQ4 B;  3CCE I;  2C6Y A;  2FOK A;  4YEJ A;  1R71 A;  1OFD A;  1SFE A;  1FWZ A;  3VYR B;  1I1S A;  1R1V A;  2EIN H;  4KKU A;  2P5L C;  1EA3 A;  4MEX F;  3VMV A;  1PP8 F;  5CPR B;  4N4O B;  4A3J J;  2FRH A;  5FKK A;  2FQ4 A;  2VOO A;  3P27 A;  4M4S A;  2M5W A;  5IYW A;  2XF7 A;  1SFO J;  1ENH A;  3CRZ A;  4HNT A;  2Z9O A;  2BBY A;  3FXJ A;  4KIT B;  3FXM A;  5CVR A;  3C3W A;  2UWM A;  3EUA A;  5CVV A;  1YW7 A;  3QPS A;  2VQL A;  4LMY A;  2VFN A;  1IUF A;  2M0M A;  3PUN A;  1YIT I;  1HLV A;  1TTY A;  2XPU A;  3GCM A;  5FL7 A;  1HST A;  4DIQ A;  2ELH A;  3VPR A;  4X1E A;  1OKR A;  3FBI B;  3C1D A;  4IXA A;  2QZ8 A;  2GK6 A;  3WQZ A;  2IOU G;  2DK5 A;  1RET A;  3K69 A;  2PMU A;  2KFD A;  4F55 A;  3K4C A;  2RV8 A;  2OTJ I;  3ZZT A;  1WU8 A;  4NUB A;  2V7F A;  2DFH A;  3I59 A;  3K4J A;  3R0J A;  2A5Y B;  2H1L A;  3BT9 A;  4F52 A;  1O8F A;  3CLO A;  2XB0 X;  5IT9 K;  4LK0 F;  3BCD A;  4AIH A;  4PCQ A;  1GDT A;  3EQO A;  3FDY A;  4XLE A;  4CDG A;  4ZYG A;  1B72 B;  2EZI A;  3OS2 A;  1ITY A;  3T0Y A;  1Y0Y A;  2IBD A;  4GO1 A;  2AXT C;  2GIV A;  2JZY A;  3BR0 A;  3L9F A;  1G7T A;  3H35 A;  3M9A A;  4BJT A;  1E17 A;  1C0W A;  1B2R A;  4X0C A;  4Z4T A;  1YJW B;  1NG7 A;  4Y52 J;  3DU1 X;  1R58 A;  1FP2 A;  2X0L A;  1N05 A;  4EM2 A;  1H80 A;  3K1P A;  2ACJ A;  4XOT A;  3GVK A;  3BH6 B;  1MBF A;  4IRG A;  1CNE A;  2JN6 A;  5EGO A;  2IGK A;  2GIZ A;  5ED4 A;  3CCU B;  3RZD J;  3OYJ A;  3BDD A;  1VQ6 I;  1ERD A;  2AHO A;  2ZL6 A;  3NE5 B;  1ZRE A;  1ZM2 A;  1IJE A;  3SZE A;  2EA4 A;  3K2A A;  1RES A;  3AVV A;  4Z4R A;  2BM5 A;  4YZQ A;  5FD5 A;  1K9M D;  2KJB A;  3EQN A;  3G3Z A;  3W5V A;  4BAY A;  2HU9 A;  1EFC A;  3PQK A;  1RQP A;  3GUD A;  2R4G A;  1N78 A;  2NNN A;  5DD4 A;  5JHU A;  4UUT A;  4ENM A;  3MAJ A;  2ZL5 A;  3HG9 A;  3HOW J;  3EUH A;  4LLL A;  1DBO A;  1WOO A;  3W5U A;  2FX0 A;  2CQN A;  1QPM A;  3E97 A;  5H5J A;  3RJP A;  1O8M A;  1MND A;  3A01 A;  2FF4 A;  3PNV A;  4IF4 A;  5CVJ A;  1WXR A;  3VYT B;  3L09 A;  3T8R A;  2L7F P;  3IHU A;  4G6I A;  1WRJ A;  5TR9 A;  1Y8R B;  5IYN A;  4XMY A;  4D1Q A;  4MNU A;  2HKX A;  3F72 A;  2XZL A;  1FRN A;  2PEX A;  4HAM A;  1BJZ A;  1B1B A;  2ESH A;  3KET A;  2MA3 A;  3U2R A;  3IKT A;  2GOM A;  2DQL A;  2ZXH A;  2CUZ A;  1TT5 B;  4LG0 A;  4KMF A;  4RM0 A;  1ZKG A;  4PZJ A;  1MSE C;  1PKV A;  2OQG A;  2R7V A;  3BR6 A;  3ELK A;  4EM1 A;  4AIJ A;  1CQT A;  2IRF G;  4IHS A;  1AOY A;  4GQN A;  4OPO A;  1IRX A;  2RC4 A;  3ZN0 A;  3VWB A;  2W48 A;  3GZ5 A;  5K1Y A;  2RVC A;  4ZTF A;  3PVD A;  1ORK A;  1UD8 A;  2V9K A;  3P9I A;  1YW8 A;  4E7S A;  5FKO A;  4OOS A;  4XLN F;  2E19 A;  5AON A;  1ZLJ A;  2ZFW A;  5C4J J;  2F43 A;  4X7F A;  3E6D A;  1PJ6 A;  1XC5 A;  1SD6 A;  2R3S A;  5LBQ A;  1JKP C;  2JA2 A;  1TBX A;  1SD5 A;  2QSG X;  1E1R A;  5K5Q A;  4BH9 A;  1MDM B;  1OB2 A;  3ZQC A;  1HSJ A;  2FVG A;  1X3W B;  1ZM9 A;  4PC6 A;  4NHJ A;  1JKO C;  2PFB A;  4FE7 A;  5GPC A;  3RKQ A;  3FPK A;  4HV6 A;  1ZAR A;  3I5U A;  1H8A C;  2EPF A;  1EV7 A;  4RPD A;  1BN5 A;  1N75 A;  3KEY A;  2RDP A;  3BZC A;  1YX5 A;  3V4G A;  1QHG A;  5FLX K;  5J1U A;  2VC1 A;  1JUM A;  5E79 C;  3KP3 A;  1BW5 A;  2W00 A;  3H5A A;  1XGN A;  3FWE A;  3RZO J;  3KP5 A;  1HXD A;  1LUJ B;  4CA0 A;  3JSO A;  4OWR B;  2JRM A;  2HR3 A;  1SFX A;  2JSP A;  2O5R A;  4Y4R A;  2LD5 A;  2D3N A;  2HOE A;  4ON0 A;  1MBH A;  3QU6 A;  3GIR A;  1QA1 A;  3WY9 A;  3MMY B;  1WVR A;  5L3E A;  2XGD A;  2CFX A;  2CG4 A;  4I98 B;  4WXC A;  3JQR A;  4L9N A;  4BE2 A;  3EYY A;  1KZL A;  2BX6 A;  5DCF A;  1IC8 A;  4OIO F;  1BQE A;  1QZZ A;  3H36 A;  5BOX A;  2E1R A;  1RNL A;  4LK1 F;  2XGJ A;  2XAQ A;  2EZH A;  3E5U A;  3HTU A;  1PUF B;  3WOD F;  4ZV4 A;  2RRE A;  2LH9 A;  3HB9 A;  3OYE A;  1W1W E;  4MO7 A;  3BTJ A;  4BQQ A;  1HW2 A;  1DDG A;  1WSR A;  4P3I A;  2E71 A;  3FXL A;  1BW6 A;  2Z8G A;  4A3E J;  2O7O A;  5CLS A;  2JPB A;  1POG A;  1FBS A;  3CXC B;  2XRL A;  1V5E A;  2OAZ A;  1JJ6 C;  3DEE A;  1SKY B;  2G7U A;  4DYR A;  2EH3 A;  2P8T A;  3OW2 B;  4B3A A;  2NTB A;  3A02 A;  3I4P A;  2P7V B;  2CSO A;  4B43 A;  4A3D J;  1ZM4 A;  1IO2 A;  1FT9 A;  3KYC B;  4EMS A;  3N90 A;  3MZ8 A;  1MMS A;  1GV2 A;  2A5W A;  4CCJ A;  4UB6 C;  2BY3 A;  3GTL J;  1U6G A;  5KW9 A;  3J81 k;  1PXZ A;  1O3Q A;  2W25 A;  2I1L A;  4O3M A;  1DAB A;  1FX7 A;  3WYA A;  3OYB A;  1D5Y A;  4PGH A;  1HA3 A;  5F1R A;  4ENN A;  2UXX A;  2CF4 A;  3A8K A;  3ZCO A;  1VLY A;  2X85 A;  1VQ9 I;  2PMZ A;  1VQK I;  4ITV A;  1IDZ A;  3WNC A;  2BYV E;  3E5X A;  4A0Z A;  3WTS C;  1Z7U A;  3QRF F;  4Q48 A;  4RLF A;  3ERE D;  2CQ7 A;  3QP6 A;  3O6B B;  4FCY A;  2PIA A;  2YWF A;  3NB2 A;  4YAL A;  3WTX C;  2X9D A;  4PC2 A;  5FKL A;  4EAT A;  5E1Z B;  4XLF A;  1LEB A;  2QYU A;  2PE3 A;  1Z7L A;  2GAU A;  3OYI A;  4XR6 A;  2FD5 A;  2JTV A;  2BY2 A;  2DMQ A;  3LSJ A;  4M6Y A;  3S16 J;  3BY1 A;  2COM A;  3E6M A;  1D1A A;  2UVF A;  3J81 K;  1R23 A;  4P1V A;  2K3P A;  3PSI A;  3E5Q A;  2Z16 A;  3JTH A;  5K5O A;  3I58 A;  2TCT A;  3H9Q A;  5BNG A;  1WZ2 A;  5GV8 A;  3CMA B;  3GW2 A;  1IRG A;  1WI9 A;  3VB2 A;  3FXU A;  2A6H F;  2GBY A;  3Q38 A;  4IZZ A;  2QE7 A;  3V42 A;  1YRN B;  2ZZG A;  2VXD A;  3LMM A;  4RD4 A;  1T08 B;  3ABL H;  3HRU A;  1N77 A;  1FYM A;  3K10 A;  2VBX A;  3HDD A;  1Z77 A;  3KZY A;  3G73 A;  3V7S A;  2KIF A;  2VKD A;  2E7X A;  2C5B A;  2JRT A;  3KZZ A;  2ZXW H;  4W8Q A;  3TW7 A;  2XKP A;  3WG9 A;  3MD2 A;  3DBR B;  3IL2 A;  4PSX A;  1I8D A;  1D5V A;  1IZ1 A;  3C7J A;  4FE4 A;  1BN8 A;  1R5B A;  1GV5 A;  1A36 A;  1Z3Y A;  2KRF A;  2B0R A;  4JP0 A;  1KQ0 A;  3BH7 B;  4PC7 A;  3BJO A;  3PA2 A;  2Y9Z A;  2PYG A;  3U1K A;  4AC0 A;  1N08 A;  3AFH A;  2FSW A;  3HRS A;  2DFF A;  4ZH4 F;  4FET A;  4A12 A;  4XSZ F;  2B7B A;  1JT6 A;  1LNW A;  1T8I A;  3BQY A;  2V6E A;  1R49 A;  2DET A;  4BJ6 C;  5ILU A;  5M5Y J;  5FO5 A;  2F48 A;  2JVG A;  4RLZ A;  2CJJ A;  2DDB A;  2KP6 A;  2DBB A;  1GUU A;  3E6B A;  5LHI A;  3ZC3 A;  3RIQ A;  1H9T A;  2PMH A;  1IB0 A;  1XG2 A;  4YEL A;  3TO6 A;  1D8K A;  3GF2 A;  4BQN A;  3LAJ A;  3FK6 A;  2BGJ A;  5J8C A;  1UG2 A;  2NVU B;  3OOC A;  1AKH A;  2DO7 A;  5EZH A;  4DOZ A;  2ID3 A;  3WGH A;  2WPD A;  1VLO A;  2OBP A;  1OCZ H;  1ZRC A;  3Q6Q A;  4OJL A;  2AQE A;  4PFO A;  1UAA A;  4HF0 A;  2L9S A;  5E18 F;  4AYB A;  4WWV A;  4AYB N;  1XMK A;  1NK2 P;  2HVQ A;  4B4C A;  3G71 B;  4TMZ A;  3PO2 J;  2XAG A;  4E7Z A;  2F3L A;  1VZ0 A;  1IN5 A;  3CC7 I;  1PJ7 A;  2QN6 A;  1TW2 A;  2QVO A;  3B90 A;  2Y30 A;  1VQL B;  4B1R A;  2ISZ A;  3CCY A;  2RQP A;  1W0U A;  4JOM A;  3S3M A;  3TOA A;  1TQP A;  3LFK A;  2QF7 A;  2OCC H;  1WQ2 A;  3FPP A;  1D1N A;  4GCV A;  3CME I;  2ZZE A;  1Y6I A;  4Z4S A;  3LA7 A;  2A6T A;  4G6Q A;  1RR8 C;  2Z2S B;  4K1X A;  2R9V A;  1OLT A;  1UHS A;  3C2G A;  4YII A;  1ZG5 A;  3LQ6 A;  2NS7 A;  4QHY A;  1S0U A;  4S0H B;  1VI0 A;  1W35 A;  4N3N A;  4BEH A;  2DOA A;  1DGR M;  4C2M J;  5DM6 F;  1MGT A;  5C4X J;  2JN9 A;  4BXU A;  3J81 Z;  3FKJ A;  4N9H A;  4F91 B;  3LSH A;  4EH1 A;  2E36 A;  3SKB A;  3WE3 A;  1ZG1 A;  3LJY A;  4L9V A;  4GYI A;  4BY1 J;  4C3J J;  3ONU A;  1FC3 A;  1BR1 A;  1STZ A;  3ZOB A;  3KL9 A;  3MCA A;  1KON A;  1VQ4 I;  5F64 A;  5KSW B;  4YEI A;  3H3Z A;  1I1G A;  1ONV A;  1DBG A;  1W36 C;  4HF2 A;  3ML3 A;  1IJW C;  4Z4W A;  4L0Z B;  3TDZ C;  2HXO A;  1X1B A;  2LKS A;  3GFM A;  1MMD A;  3M4O J;  3HJE A;  2ZBV A;  2GQQ A;  4QLC U;  1S7O A;  1QVU A;  5FIU A;  2LKX A;  3I1F A;  2EIM H;  2DI3 A;  1I7P A;  1WOS A;  2K40 A;  4M9S A;  3T1B A;  1VHO A;  3IKV A;  1EH6 A;  5E3L A;  2ZJ2 A;  3B73 A;  2CRV A;  4YAW A;  4OAZ A;  3QYB A;  4XQF A;  2V7W A;  1M1K D;  1W0T A;  1EKE A;  4KDP A;  1DP3 A;  2VJI A;  4RMN A;  1S7E A;  3HL2 A;  1F36 A;  3LNN A;  3A01 B;  4E0F A;  1MNE A;  3UNG C;  2UZK A;  1ZRD A;  1VTN C;  1A6I A;  3RYR A;  4RD1 A;  1X2M A;  2ZSH B;  4Y9U A;  1JKQ C;  4C43 A;  1P4W A;  1S5L C;  2E1M B;  2ZL7 A;  2NRA C;  1DDN A;  2BOL A;  4UUS B;  1CF7 A;  4GDF A;  4P12 A;  4EJV A;  1W0J A;  2OBT A;  4OJP A;  3KYD B;  4R8H A;  4EQQ A;  4PAB A;  3T5X A;  2VIX A;  4UXN A;  3DWL E;  2E1N A;  2GM4 A;  2WWY A;  3J7A O;  2VQC A;  1B23 P;  3HIF A;  1JTY A;  3PET A;  3L2W A;  2QSH X;  3HTS B;  4I02 A;  1HCR A;  1IAW A;  1MZB A;  4XLC A;  4QVJ A;  1QRY A;  5FFX A;  2DFI A;  4FQG A;  1G59 A;  1OYI A;  2DT6 A;  2LOO A;  4F3Q A;  3AVW A;  2OZ6 A;  1XFO A;  1BOB A;  3ZMT A;  2WYR A;  3GTG J;  5DDG A;  2OTJ B;  3BJA A;  4AUX A;  4LLN A;  1UJ8 A;  2QBY A;  4X06 A;  3BLY A;  3MWM A;  2ZXI A;  1IF1 A;  2QXZ A;  1KCC A;  4H0E A;  3LVB A;  5TY0 A;  5J4Y A;  5EMN A;  2H6C A;  1JTA A;  3VYS B;  2VNJ A;  2PBI A;  4RGR A;  1WP6 A;  1HC8 A;  1G2H A;  4QVA A;  3GQ9 A;  3C18 A;  1NDH A;  4LBW A;  4ZGN B;  1WI3 A;  4M9Z A;  3H9J A;  2QY1 A;  4HLY A;  1HQC A;  5D6E A;  1Y0R A;  3PUB A;  2R5Y B;  5FLV A;  2CC2 A;  4A5M A;  1YI2 B;  4YDT A;  3H3U A;  3FHZ A;  3ZBU A;  5DUI A;  3MKY B;  2EZK A;  3L2C A;  4OOI A;  2F1M A;  4LB6 B;  1OGO X;  1KD1 D;  5BQT A;  4XNF A;  4ZDO A;  2CND A;  1KRH A;  1OPC A;  1U9N A;  1W5T A;  3DTK A;  1I6H J;  2VFP A;  3F8M A;  4OJ6 A;  2MC4 A;  4JYK A;  4X7C A;  5L3C A;  2P3M A;  1XDS A;  3LQQ A;  3BG6 A;  4KMU X;  4LOC A;  3R60 A;  1OCC H;  3DBH B;  3JW4 A;  4XSX F;  4ZDL A;  4BJ5 C;  1Y39 A;  1VQ7 I;  3I4N J;  3S8P A;  2IS2 A;  3KIO A;  3KEQ A;  4EW9 A;  3BC8 A;  3ZQI A;  3W5H A;  3PEN A;  1J9Z A;  1L3L A;  2N8G A;  2L4M A;  3KFW X;  4XRF A;  2YU3 A;  1K78 A;  1T39 A;  3IAM 2;  2XAF A;  3T56 B;  3GZ6 A;  2LR8 A;  4MLO A;  2ICW G;  1MH4 A;  1U8R A;  3RSN A;  5FD6 A;  1YIT B;  2CW0 F;  3CDL A;  4Y17 A;  1X19 A;  1OGM X;  3M07 A;  4RCY A;  5J3L A;  3EUH C;  2CK3 A;  2XAH A;  4YG2 F;  3L2U A;  2QWW A;  1XSX A;  2J8I A;  4X7E A;  3CCR I;  3BJ6 A;  2M8E A;  3HEF A;  4G9Y A;  1KMH A;  2EIL H;  2O0W A;  3GQ8 A;  4MIM A;  3VSV A;  2OUM A;  1FYL A;  2XTY A;  1XCV A;  1R4M B;  1ETV A;  2ME0 A;  4FX0 A;  3FKS A;  1EA0 A;  2RQQ A;  1T5E A;  1MMN A;  5TJJ A;  1U5T C;  4EGZ A;  3TED A;  4RD2 A;  2L9R A;  2VBY A;  1XB2 A;  3SHF A;  1K28 D;  4OOV A;  3AVY A;  1IV8 A;  1FY7 A;  3VSL A;  2W6I A;  2IPQ X;  2FXA A;  1K6O A;  1KTV A;  3ERM A;  1K4S A;  1EFT A;  2X3U A;  2ZIT A;  2EWN A;  4FTH A;  1FIP A;  4G1V A;  1FRQ A;  3S2H J;  5HLT A;  4PMH A;  3CCV B;  1RU4 A;  1BR2 A;  4BU2 A;  2JT1 A;  3SZT A;  2RGV A;  5ICC A;  1O8I A;  1FYK A;  2MD0 A;  3D5L A;  3LSK A;  1Y1W J;  1WHU A;  1T6S A;  2Y2Z A;  3KZI C;  3JRD A;  1D1B A;  3GQ7 A;  2KRC A;  4DZP A;  2FX3 A;  2FOW A;  5JR3 A;  1Z67 A;  3R0A A;  4DJA A;  4Q47 A;  1E0E A;  4CH7 A;  4NC7 A;  2OBR A;  3D26 A;  1TWH J;  1B6A A;  1K83 J;  4G12 A;  2M7B A;  1QU3 A;  3PJR A;  2BXZ A;  1D0Y A;  4IHV A;  2Z99 A;  5L46 A;  4W1U A;  3ZMV A;  3KPH A;  5E3M A;  2Z1D A;  2HOS A;  2E1O A;  2OYN A;  5KHD A;  4BHC A;  1IB4 A;  4G94 A;  2A69 F;  1PVE A;  4OMZ A;  1TP4 A;  3R6K A;  4KT6 A;  1QA3 A;  4M2L A;  2VBM A;  1Y0U A;  2OK8 A;  4Z06 A;  1G3W A;  1X1P A;  3FIS A;  4YCQ A;  3PNT A;  2DA7 A;  2DA4 A;  5E3O A;  1NHA A;  2VUM J;  5DEQ A;  3HOV J;  2OC6 A;  2BM4 A;  1WJB A;  3KP4 A;  1T38 A;  5A89 A;  1P7I A;  1Z21 A;  2E60 A;  1R1T A;  3QOD A;  4C3H J;  4U7B A;  3KP2 A;  3PSS A;  5FNZ A;  5B66 C;  3D5S C;  2FBH A;  1QVG B;  1H9G A;  1XD7 A;  4U88 A;  4WQM A;  1QGZ A;  2VKE A;  2I10 A;  5D4S A;  1F5T A;  2BVM A;  5KAF C;  4V2F A;  2QGG A;  1SM4 A;  1R1U A;  1FMV A;  2YWH A;  2F2E A;  3K9T A;  3FMR A;  2MC3 A;  2FNA A;  5HZB A;  1G6N A;  3FBN B;  4WWC A;  3PIO F;  2VBU A;  3FJO A;  1G4D A;  3QFR A;  4JQF A;  4OPW A;  1QGP A;  2R7T A;  4CZZ A;  4AID A;  4PJ0 C;  5JI6 A;  3O8G A;  3BCF A;  1VQ5 B;  1WCM J;  5IY5 H;  1J09 A;  2VBW A;  2DCU A;  3OZV A;  1WJC A;  2IGM A;  1XCB A;  2RKH A;  1YG2 A;  4U0V A;  3WU2 C;  2NVT J;  1WJA A;  1O8K A;  2J8K A;  2JA8 J;  3DU5 A;  3ZMZ A;  1OYW A;  3J80 Z;  3OMY A;  1OOC A;  2BM0 A;  3VDX A;  1A31 A;  3ASP A;  3R4K A;  4WK8 F;  5HXB A;  1MBE A;  1P6R A;  4P9U A;  3OAA A;  4V2G A;  5FA6 A;  2WY7 Q;  3MEX A;  3CP8 A;  5BSX A;  3PUM A;  3BTL A;  5A88 A;  4B3G A;  1TC3 C;  2X1E A;  4B8X A;  1HKQ A;  2INV A;  2OF7 A;  3G6E I;  3OSG A;  1HDP A;  4XON A;  2WAD A;  2DJI A;  3QPL A;  4RGS A;  2ZNZ A;  5BS6 A;  4E7I A;  1KK0 A;  3I55 B;  4E7K A;  2MH2 A;  3VR6 A;  1JHH A;  3R6S A;  4A6D A;  3ULQ B;  3GVA A;  1I5Z A;  3G4S I;  4JRA C;  2X48 A;  4RM2 A;  1OB5 A;  4QUZ A;  1FBQ A;  2F5V A;  1AKH B;  4PUS A;  2WTE A;  3BZK A;  1FLI A;  3FM3 A;  4JX6 A;  1Z0X A;  3OEE A;  2Q6I A;  2Y0S N;  2H8R A;  4DQL A;  1BC8 C;  4Z4Z A;  2HVR A;  4L9T A;  1ODD A;  4XID A;  2HQ5 A;  1DG1 G;  3B6C A;  3NQO A;  1OR7 C;  4HA8 A;  4YZX A;  5EG0 A;  3HPH A;  4W8T A;  2MYS A;  4MTD A;  3PIP F;  1Q81 D;  4NK8 A;  5E8G A;  4U49 A;  3REO A;  2J5P A;  3FHN A;  2R7R A;  1G7R A;  3ZR8 X;  1J2X A;  1KU9 A;  1YIJ I;  4OZZ A;  3H0G J;  3SJZ A;  2CQQ A;  2YWE A;  5GV7 A;  3CCE B;  1FNN A;  3ZXS A;  5M5W J;  3AVT A;  2LK2 A;  2ZTN A;  2ZJQ F;  4TMW A;  4GGG A;  4EJO A;  5GAE J;  1SFK A;  4BAC A;  5IK2 A;  1G3S A;  2OA4 A;  5F04 A;  1BBY A;  4HE5 A;  3PL8 A;  2G9W A;  5LGT A;  4KFC A;  3HXL A;  4BEH B;  2DFE A;  2DMP A;  2IS1 A;  2CW8 A;  2GXB A;  3E1Y E;  2HYF A;  5HS9 A;  4HLX A;  1VQP I;  3CC4 I;  4C2U A;  1GAW A;  3A8I A;  3BZ6 A;  1TWG J;  2VB6 A;  3VST A;  2DW4 A;  1X58 A;  3S32 A;  1LB2 A;  1WJ5 A;  1X1C A;  3RI4 A;  4EJW A;  3A3B A;  4ZCI A;  4FK8 A;  2XPV A;  3GXO A;  5IYQ A;  1X1A A;  1QGY A;  4ZYD A;  2K9S A;  4M71 A;  5HDG A;  2HDC A;  1Q7Y D;  2VBS A;  1Y0N A;  1ETY A;  3J7Y J;  1KJZ A;  3W6V A;  2Q6L A;  2DJN A;  1T33 A;  2EA2 A;  2ELK A;  3LOC A;  4Y15 A;  2CYY A;  4HDU A;  4A93 J;  4TMT A;  3U6K A;  4RM3 A;  1TQM A;  3ABU A;  3RKW A;  2EIJ H;  2LBF A;  5BMZ A;  1D2E A;  1HZE A;  1XPX A;  2NTQ A;  1QX4 A;  1F60 A;  4ZJZ A;  1QRB A;  1BM9 A;  3LWF A;  3V8K A;  2V5I A;  4DYC A;  1ZEL A;  1MBG A;  3LA3 A;  3Q9V A;  5F27 A;  3Q6R A;  3OYH A;  5JBQ A;  3DKW A;  1JGG A;  1J0R A;  2UXN A;  4RB1 A;  3A2K A;  4CZC A;  3JRI A;  1FIA A;  3GO5 A;  2FU4 A;  1BIB A;  1PUF A;  2DN0 A;  2DTZ A;  4UV8 A;  4BXX J;  1E62 A;  3KEW A;  3B4N A;  2QQB A;  1BMF A;  2H09 A;  1JT0 A;  3SJP A;  2OK7 A;  1Q9S A;  1OJL A;  3P5J A;  1RKT A;  3KCC A;  3EQL F;  3S1N J;  4HNU A;  2W6J A;  5LMZ A;  2M7A A;  2P4W A;  4G7H F;  3CF5 F;  1UMQ A;  3KLN A;  4D9J A;  4OIQ F;  2HPI A;  3B8H A;  4V02 C;  1ON2 A;  5FB2 A;  4IEJ A;  3FX3 A;  4U7D A;  4M3E A;  5LRS A;  1OFC X;  2LY9 A;  2QBY B;  3VNV A;  4KIC A;  3OP1 A;  1YHQ B;  1RWR A;  4YFX F;  3BC9 A;  3GYH X;  4F93 B;  3AL0 B;  3RYP A;  2Q1Z B;  4QWQ A;  2BPO A;  2E2H J;  2EZL A;  5HS7 A;  1WGX A;  5TRD A;  1RKW A;  3PA1 A;  5AN9 A;  2RAE A;  3O2P E;  3P9C A;  4YAF A;  1WPK A;  4HE6 A;  2KJC A;  2XAJ A;  4FAS D;  2X4H A;  2B0L A;  4YFK F;  2YX7 A;  3DTI A;  5ILS A;  4XKC A;  5M5X J;  1LJ9 A;  4RB3 C;  1G7S A;  5HLH A;  1O8D A;  1CNF A;  1WOP A;  5JVT A;  3MCZ A;  1U2R A;  2VOP A;  4RDJ A;  3ABK H;  3BCB A;  4ZYH A;  3WTW C;  5LD2 C;  2FEZ A;  1WSU A;  4ZZD A;  4TMV A;  2W84 A;  3KLO A;  1VQK B;  1EFR A;  4AVP A;  5LGU A;  4IKF A;  2CFO A;  3N6Z A;  4I84 A;  2OZU A;  3B6A A;  3K1N A;  1G3Y A;  4A0Y A;  2TDX A;  5CKT A;  5CQE A;  3CES A;  4XKW A;  4O5V A;  1XTA A;  3OY9 A;  3K4B A;  4LIT A;  4HDV A;  1I27 A;  3CCJ B;  3ZPN A;  3BTC A;  2V1N A;  3ZMD A;  3JQP A;  1XMA A;  4G6T B;  2LF7 A;  1OCP A;  4W8S A;  1LFP A;  4BY7 J;  4IX7 A;  2C77 A;  2A68 F;  1VF9 A;  4RDK A;  3GVL A;  1MAB A;  1DPU A;  3B02 A;  2UUZ A;  2VAS A;  1AU7 A;  3VYU B;  4L5I A;  3TP0 A;  1OCT C;  3BQJ A;  3H09 A;  4IOA F;  4I99 C;  4L18 B;  2NVQ J;  4ESJ A;  1KQ5 A;  4KIF A;  3BOQ A;  3W2G A;  3KE2 A;  4ACB A;  5HKK A;  1HA8 A;  4A3C J;  4EGY A;  2GA2 A;  4UNO A;  1R5N A;  4C9Y A;  4TKO B;  5IOZ A;  2VYQ A;  4QTR A;  4RB2 C;  2XDV A;  3DPT A;  2IA0 A;  2ETH A;  2STT A;  5B1A H;  2IA1 A;  1XDU A;  3RQI A;  4RDU A;  2HEO A;  3D0S A;  3SZP A;  3CB4 A;  1LFU P;  4RGU A;  1L0O C;  4RAY A;  2EV5 A;  1IDY A;  1R7J A;  5EGO B;  1MDM A;  4UZE A;  1QUE A;  1UD2 A;  4Q7J B;  4AIK A;  4Y7N J;  3IH2 A;  3X2Q H;  1ELO A;  3NEU A;  1NBM A;  4L9J A;  3W2I A;  3H3V K;  2W7N A;  1DU6 A;  4P9S A;  3KRG A;  1TLL A;  4RCZ A;  3HBL A;  3ZGK A;  2V7X A;  2HWV A;  4M0L A;  2ZJP F;  1TQI A;  1YIJ B;  4M3D A;  4G7Z F;  3OR2 C;  2QA4 B;  3HAG A;  2H1K A;  1JB9 A;  4EM0 B;  2VQG A;  3FIW A;  4J0Q A;  2DMT A;  2KKO A;  2LP0 A;  1WDT A;  3FXK A;  4DNT B;  1W5S A;  2JJ1 A;  1AWC A;  3IRQ A;  2VOD A;  1QQ1 A;  2HNH A;  1IN6 A;  1EE6 A;  3OIP A;  2NNY A;  1SVL A;  4XOR A;  4P3Y A;  1E3X A;  2LY1 A;  5JFR A;  4KKT A;  4NCN A;  1W34 A;  5F0H A;  1RUO A;  4WXH A;  2CUJ A;  2L9N A;  2WJV A;  3I53 A;  3Q0V A;  2O9L A;  3CW2 A;  2EFP A;  3SEJ A;  4G7W A;  3CD6 B;  3BR5 A;  2VKH A;  4Y9R A;  4AC9 A;  1J59 A;  4CCO A;  2DTR A;  3CLQ A;  2W24 A;  1ZH5 A;  3CZ6 A;  2QM3 A;  4YC5 A;  3K7A J;  2P5K A;  2VON A;  4WZL A;  2R92 J;  4NBQ A;  4D7M A;  3MKZ A;  2VT3 A;  3ZMU A;  1VHE A;  3NAW A;  4WZE A;  3ZRG A;  1GVJ A;  1R00 A;  2W82 A;  2XVC A;  5CVU A;  3ABT A;  4NB5 A;  2RC5 A;  3K1M A;  5E1W A;  3V7A A;  4XD7 A;  2IXS A;  2L3D A;  1HKS A;  2DYI A;  3CJT B;  2Q2E A;  4XL9 A;  2ZFU A;  4NDL A;  3FXR A;  3Q0U A;  2XAS A;  1BHE A;  5JLX A;  4OIP F;  2KZG A;  4JX5 A;  4C3I J;  4I09 A;  4IRH A;  2VJ5 A;  1H89 C;  2DOE A;  1RUN A;  4OIR F;  2Y0M A;  2R7D A;  3JCU C;  3M8J A;  1Y1V J;  5F0F A;  2VNH A;  3GEZ A;  1RIO H;  3ES9 A;  1QA6 A;  4C2L A;  2E1M C;  2WAE A;  2VI6 A;  2R5Z A;  5FRM A;  3JRG A;  5E20 A;  1SMY F;  1FMW A;  4I01 A;  4FX4 A;  3ZZU A;  4Z4U A;  2ZB9 A;  2LG4 A;  4HV5 A;  1X0C A;  3B8Y A;  2QX3 A;  3UW0 A;  1JGS A;  1MBJ A;  2PI0 A;  4IO9 F;  3AG4 H;  3GBG A;  1ZRF A;  3BY2 A;  2BSP A;  3S14 J;  2VBE A;  3LQR A;  2FJ1 A;  3I54 A;  3ZP5 A;  4MQV A;  4NQW A;  2KVO A;  4BBS J;  2M8G X;  1K4Z A;  1MIJ A;  3UR3 C;  4LC0 A;  3CO6 C;  2PMD A;  2CMP A;  4QFM A;  4ASU A;  3BCA A;  3HOU J;  2JMW A;  2X51 A;  2V1U A;  2BF4 A;  4M53 A;  2NV4 A;  1SAN A;  2DYR H;  2IVM A;  3F0C A;  3JRE A;  2PJR B;  2HTJ A;  3CCV I;  3S17 J;  1P2F A;  2L02 A;  1FDR A;  3SEZ A;  3AG2 H;  1FNC A;  1K8F A;  2K5C A;  2K7L A;  4IL6 C;  5DN6 A;  3CJR B;  4TSF A;  4QPQ A;  1ETO A;  2IW5 A;  2VLA A;  2D9R A;  2ODL A;  4PC3 A;  4Q5S F;  3BRO A;  4AVZ A;  4PGG A;  2QEX I;  1MKM A;  1OFE A;  1UD5 A;  1QZE A;  5FKN A;  1EXM A;  2Q6K A;  2H8W A;  5FRO A;  3JRB A;  3AGQ A;  1HKT A;  3QYE A;  4DBR A;  2P0W A;  1MJA A;  1V55 H;  3CMY A;  4I76 A;  4HIZ A;  2QKL B;  5J35 A;  1KQ9 A;  4U9U A;  2DA2 A;  2ZKZ A;  4BE0 A;  3HHG A;  1VQM I;  3OJX A;  4P26 A;  3OL3 A;  4UVC A;  3ZPL A;  1WMR A;  2VBV A;  2HPM A;  2NT6 A;  1MMG A;  4RPB A;  4Y33 A;  1FSE A;  5ICG A;  3OEH A;  1HF0 A;  1JE8 A;  1LDJ A;  4HW0 A;  3F3X A;  5M3M J;  4XKV A;  3I9V 2;  2HCJ B;  2NS8 A;  2EFG A;  2GOX B;  1E3P A;  2MLK A;  2V1D A;  4H4K C;  1UCR A;  2QEN A;  1ZG3 A;  4RD6 A;  3WHC A;  4HF1 A;  1KU7 A;  2ZC2 A;  3OL4 A;  4Y7C A;  4XBF A;  2ZJR F;  1GJR A;  1YS6 A;  2PG4 A;  3HOX J;  1SEU A;  2NYX A;  3VO2 A;  2FE3 A;  1ETX A;  2V6C A;  4WXD A;  3MHP A;  4YFO A;  4E7L A;  5DUK A;  3L2V A;  1ZGA A;  5L3B A;  3FF5 A;  2ZO4 A;  4Y13 A;  5H2F C;  3BNW A;  2OJE D;  2QSF X;  2R93 J;  2HI3 A;  1BC7 C;  3UKG A;  2PQ8 A;  1XGM A;  2VBZ A;  1BL0 A;  2E2I J;  2HOT A;  3SUC A;  1I50 J;  3DXJ F;  3PNY A;  4XRS G;  4ZZL A;  2YU9 J;  2JA5 J;  1OHH A;  3TDU C;  3GFI A;  5F08 A;  2W85 A;  1FZP B;  2DT5 A;  2Z5U A;  1TLH B;  1A6Q A;  2PYH A;  5KCM A;  4ZGQ B;  3MN2 A;  2PJR A;  4A3G J;  3MKL A;  4A69 C;  3W2E A;  1QNT A;  1PYV A;  1S7A A;  3P4G A;  3I55 I;  4NK6 A;  2M9H A;  4ETS A;  1QFJ A;  2DXI A;  4BGD A;  3ZQQ A;  5HLG A;  2BGC A;  4I0A A;  1O4X A;  1E2X A;  2WR8 A;  2FML A;  1V0F A;  1EZG A;  3ZUG A;  3NWS A;  2GXA A;  1TTT A;  2QKM B;  2P5V A;  4ZCL A;  1YRN A;  1VQP B;  4FXU A;  5LFA A;  4HYE A;  4M3G A;  4ROX A;  3E7L A;  1V5V A;  2E1B A;  2QDX A;  2XND A;  2DDA A;  2XAU A;  3GTO J;  1HG8 A;  1OMI A;  2XGX A;  1H0M A;  1J9I A;  3OZW A;  2LFB A;  2NPF A;  2EV0 A;  2O6G E;  2CUF A;  1UD4 A;  3HZJ A;  2R0Q C;  3ZPP A;  2DQR A;  5DTD A;  5IT3 A;  4HPQ A;  2A07 F;  2JA6 J;  2VXZ A;  3I3L A;  3HHH A;  3S15 J;  3OE7 A;  4FWT A;  2RN7 A;  2VT2 A;  3BQZ A;  4BNC A;  2Q6O A;  1ZK8 A;  1EP3 B;  1IDJ A;  1JHF A;  2QQ9 A;  4NC6 A;  1QPI A;  5K7H A;  3QOP A;  3RTR A;  3HRM A;  1CGP A;  1RZ4 A;  1P92 A;  1JXS A;  3TH0 A;  3FKI J;  2E35 A;  4HRI A;  1VQN I;  2MAB A;  5TIS C;  1JUP A;  3TP3 A;  1N0U A;  2VJJ A;  2K9N A;  4ZTJ A;  3I0T A;  2JUC A;  4YRV A;  2YUH A;  4S04 A;  4AF6 A;  1VQ5 I;  1R5G A;  2FNP A;  3F8C A;  3U21 A;  5J4V A;  2STW A;  4Z05 A;  2DK8 A;  3OYK A;  2R7F A;  1K79 A;  1N06 A;  4PSW A;  4G8X A;  2HYJ A;  3GX4 X;  4J19 A;  4G1B A;  5FO0 A;  4W97 A;  3CCR B;  3CC4 B;  1BX0 A;  4YIR X;  3DPU A;  2OBS A;  1UD3 A;  5IP6 A;  4AF7 A;  3V7R A;  3GVJ A;  4X7D A;  3C2B A;  1Z6T A;  2J7K A;  5LLQ A;  3U1D A;  1QVT A;  5TGT A;  2KDO A;  2XEX A;  1W7P B;  4RBO A;  2HZD A;  2DA5 A;  4HX7 A;  5GAG J;  1N07 A;  1BI2 A;  4C30 A;  5D5X B;  2OTL I;  2BM7 A;  4IJA A;  4Y3O A;  2X8K A;  2EFW A;  2BMW A;  1OB0 A;  4LD5 A;  1IN7 A;  4UV9 A;  1NRK A;  1QG0 A;  1IRF A;  2OQR A;  2K4J A;  3NRV A;  5FFZ A;  1E3O C;  1AHD P;  2B7C A;  2IGN A;  2C4T A;  1Q86 D;  1QO0 D;  5GTI C;  1GLN A;  4M3F A;  1X4P A;  4RD3 A;  1WKM A;  4XOP A;  2IS4 A;  1LVK A;  2FQ3 A;  5BPD A;  2EJR A;  3GTP J;  4LBZ A;  4GXO A;  2M4G A;  2K4B A;  3JX8 A;  4KKS A;  3K2Z A;  2DCE A;  3HYI A;  1GAQ A;  2M45 A;  1O3S A;  1UHW A;  2EB7 A;  4A0X A;  2COB A;  3OKX A;  2IGO A;  2NS0 A;  5CYV A;  4UY8 I;  2EBI A;  3CQZ J;  1DGW Y;  3IV5 A;  4WX9 A;  2DMU A;  4W8R A;  2YPR A;  2JUG A;  2L54 A;  3N05 A;  3HUG A;  3OYG A;  1V4R A;  1NB9 A;  3DEW A;  4OPS A;  1NTC A;  3LSP A;  3H94 A;  1WH7 A;  3WU1 B;  4XRS A;  1TSP A;  2QTL A;  4N0B A;  3CUQ A;  1MRZ A;  2P81 A;  4QIW N;  3DBL B;  1R9T J;  4DW6 A;  1F1Z A;  5FLX Z;  5DD8 A;  3LSG A;  2Y31 A;  3CMA I;  2WV1 A;  1IHM A;  2QEX B;  4MFD A;  1WFX A;  3QSY A;  2HGC A;  4CCN A;  1WSV A;  1XN7 A;  4DQ2 A;  2OCE A;  4O6J A;  2C4U A;  1P4X A;  2C2W A;  2M30 A;  2PJP A;  5HZA A;  1Z6R A;  1Q1H A;  1TNT A;  1TWA J;  1VFC A;  1APL C;  4HOB A;  2BM6 A;  1OR7 A;  2F4M B;  4EJU A;  1KK1 A;  2O8K A;  5BSY A;  1IXC A;  3HKZ N;  4R1H A;  1EF4 A;  4PAA A;  3GQA A;  4F7Z A;  2K9Q A;  3QFS A;  1VQ9 B;  2WAF A;  3DU6 A;  4QPO A;  3RPU A;  1F4K A;  5L3G A;  5LEJ A;  5D5U B;  1BJK A;  5AIP A;  3AL0 C;  2JDI A;  2DAO A;  2ZNY A;  2HDD A;  1Q82 D;  3SEQ A;  5FLM J;  4BDY A;  2R7Q A;  1YW9 A;  2WZN A;  3OYC A;  4U4B A;  3QU3 A;  4JX4 A;  4KYW A;  3DCF A;  3JRC A;  4IQ4 A;  2X6O A;  5F4O A;  2V4J C;  3A4C A;  5C1C A;  3CCJ I;  3OYL A;  3A1Y A;  1CLW A;  5HLI A;  3V8L A;  4MFE A;  4OJ5 A;  1A8P A;  3GLX A;  2HTS A;  2XT2 A;  2LRD A;  4HG2 A;  1X3U A;  1U2W A;  2D5V A;  1QH0 A;  4AD9 A;  3CUO A;  1SAX A;  2INU A;  3N97 A;  3CDH A;  2NVX J;  2O03 A;  1YJ9 I;  2GA1 A;  1GT0 C;  3GTQ J;  1B4A A;  2D1H A;  2EWE A;  4P1W A;  1WJF A;  3BG5 A;  2ZME A;  1V5G A;  1W9X A;  1RMG A;  3RIR A;  2W57 A;  3FZV A;  5D5V B;  2Q0O A;  4HST A;  1I18 A;  3L2R A;  2D1V A;  2KL4 A;  3WE2 A;  3SY2 A;  1YJN B;  1KGS A;  5HNH A;  2VFQ A;  5IYD J;  3HUG B;  3LST A;  3WU0 A;  4DYQ A;  1RPW A;  3ZQ7 A;  1OIS A;  3G71 I;  1K7A A;  1E3H A;  1GR1 A;  1MJB A;  4RLQ A;  2CGP A;  3QE2 A;  2ISY A;  2D2W A;  4S05 A;  3H9G A;  3WBK A;  2XF5 A;  3RKY A;  4A3K J;  2MGQ A;  1T98 A;  3NWT A;  4KJZ A;  4CIC A;  4D0P A;  3BG7 A;  3LSR A;  3OPO A;  4AU7 A;  2R5Y A;  5F0C A;  4J00 A;  2O61 A;  3RY8 A;  2R7X A;  5J1R A;  3QAH A;  3GQB A;  3WBJ A;  2LC2 A;  1J5Y A;  4B44 A;  2WY8 Q;  1H85 A;  2YR2 A;  5E8I A;  4E7H A;  4F7D A;  1USS A;  5C44 J;  5D4R A;  3TL4 X;  2H94 A;  4C2T A;  1KZH A;  3CPW B;  1KTW A;  2ME6 A;  2MD5 A;  1JKR C;  1Z05 A;  3WTV C;  1WOR A;  1U5T A;  3MKW B;  5IP7 J;  2O0Y A;  1W2B B;  2BHZ A;  5J8F A;  1L1I A;  3PSZ A;  4A3B J;  1A35 A;  1IA5 A;  5H59 A;  1YFH A;  2DY1 A;  2BY1 A;  4YZ0 A;  3ISP A;  5B3S H;  3FMQ A;  2LKP A;  1I39 A;  5IPA A;  4C0S A;  3LQE A;  3FY3 A;  1K5C A;  3F6V A;  2XTX A;  2M5S A;  1ZAO A;  2JQ7 A;  5HDK A;  2VPR A;  2ELJ A;  3NAR A;  5EEA A;  1Z1D A;  4A5N A;  3R6J A;  2BHY A;  2X6W A;  3G2B A;  1GVD A;  1D8T A;  4PJN A;  1I3Q J;  5KVR A;  3LO8 A;  5F6F A;  4LB5 A;  1EFU A;  1UMK A;  4OU0 A;  5DS9 A;  4R79 A;  1T0F A;  2O1D A;  2LSO A;  3BH4 A;  2JIZ A;  4ENK A;  1Z3X A;  2E2J J;  4ZC3 A;  5DNS A;  2R7O A;  4ZYA A;  4DNR B;  4M73 A;  4M72 A;  4A3L J;  5JLW A;  3VO1 A;  1KYZ A;  3JRH A;  4XLP F;  2HYG D;  1YQA A;  1K73 D;  1TZL A;  1W0K A;  3CDI A;  3G6E B;  2ZME B;  3KX2 A;  1G3T A;  1Q1V A;  1QA2 A;  1EH7 A;  1W7P D;  1X3Z B;  3PSF A;  3VSK A;  5JVG F;  2L7Z A;  4RJL A;  1BI1 A;  1LDD A;  2MBF A;  2V26 A;  4LG3 A;  3PUF A;  1OGI A;  2LZJ A;  4KIB A;  1TW3 A;  1ETW A;  3GWZ A;  2G0E A;  1ZUN B;  4D7N A;  3EPZ A;  2PN6 A;  4HQM A;  3VOE A;  2W1O A;  3F6O A;  1REP C;  3KP7 A;  2Y0S A;  2ZZQ A;  2F5E A;  4CCM A;  2XNC A;  3ISX A;  5THX A;  3SDG A;  3ZQG A;  2F5F A;  4ANJ A;  5DM7 F;  2Y75 A;  3D5R C;  3LAP A;  1KYW A;  3VMF A;  1HW1 A;  1UFM A;  2DMN A;  2I5U A;  1RI7 A;  3IWF A;  3HOT A;  2QQ8 A;  4AM3 A;  2EV6 A;  2XSJ C;  4D5F A;  2AXL A;  3I64 A;  1YIO A;  3CC2 B;  3SLD A;  4HZF A;  1D0X A;  2CW5 A;  1V3F A;  4CCL A;  4KH3 A;  5LEK A;  1F9N A;  3MMP A;  3SDB A;  3DP7 A;  3P9K A;  1OQY A;  1QJV A;  5J6X A;  3HRT A;  4MYT A;  2NST A;  4ZCM A;  1MJ9 A;  2KPM A;  3SFI A;  4E4H A;  1X2N A;  3OW7 A;  3IUO A;  3A3G A;  4UB8 C;  2V1X A;  3L2Q A;  2QQA A;  3I4M J;  1CQX A;  2LDU A;  4G7O F;  2F1L A;  1IJF A;  4WF2 A;  3DKX A;  2DOF A;  1T6Z A;  1YO5 C;  4KIS A;  4MEY F;  1YHQ I;  4IHW A;  1TYV A;  2ZTG A;  5J47 A;  5M3F J;  3NAU A;  3OYF A;  1QQI A;  1XSV A;  5E17 F;  1E1Q A;  2V7Q A;  1WTH D;  2MLG A;  3DKY A;  1ZR2 A;  5KNL A;  1XE1 A;  4KUM A;  1FOX A;  1LKX A;  1ULY A;  3RQ4 A;  2EQR A;  3G1L A;  3WG7 H;  3GRH A;  3F8B A;  2QLZ A;  2YWG A;  3I59 B;  2NVY J;  1XS9 A;  1OYY A;  4KN4 X;  2DA3 A;  2M1B A;  4II2 A;  1VND A;  1BIA A;  5E6T A;  2CQK A;  1V0E A;  3F9K A;  5HS8 A;  1U9O A;  2XUB A;  1UHM A;  4P2N A;  4DQK A;  5AMV A;  2R7W A;  1YX3 A;  4ZDP A;  5C3E J;  3C2H A;  4WCG A;  4OZY A;  4M74 A;  1X4O A;  2TRT A;  2RNJ A;  1S72 I;  4UUV A;  3SQV A;  3E1S A;  1MH3 A;  2R7S A;  1QVF B;  1QHH D;  5EZG A;  5EEG A;  2NZM A;  3JU4 A;  1R5O A;  2YUS A;  9ANT A;  4CYD A;  4G7X A;  1SVM A;  4U0Y A;  4GYG A;  5C1E A;  2HQA A;  3CJQ B;  4BBR J;  1B9N A;  2OV7 A;  3ECH A;  4CCK A;  2MW8 A;  4UVA A;  4CO8 A;  1KQS B;  4A6E A;  1JUS A;  1SFU A;  1UD6 A;  2MG4 A;  3DEU A;  3K0L A;  1KA8 A;  2NAZ A;  2VFO A;  2GQF A;  3AGP A;  1QFY A;  3HOZ J;  4I0B A;  3A8J A;  3MQ0 A;  2M34 A;  4NC8 A;  4B4D A;  4OAY A;  2ZXJ A;  1BI3 A;  2ECB A;  2GJR A;  3G05 A;  2DIE A;  4CYC B;  3K70 D;  4OOX A;  4YFN F;  2L01 A;  1RQR A;  3CCU I;  4IHT A;  5EG0 B;  3OYM A;  1J75 A;  1FTT A;  1F20 A;  1UZC A;  3SJM A;  1S29 A;  1HVX A;  1FND A;  4JMQ A;  3WWG A;  1I3A A;  1Z91 A;  3P26 A;  2CWE A;  3F22 A;  4YAU A;  2NSP A;  1Y8Q B;  2V9P A;  3BWG A;  2GLO A;  4QV2 A;  2CW7 A;  3O3K A;  1WPC A;  3HGG A;  1O8L A;  1O8H A;  5ILV A;  1FOW A;  2VKV A;  1O57 A;  4M3B A;  2DT7 B;  3RPU D;  4LG0 B;  3GTJ J;  4LIV A;  3CCS B;  4HBL A;  2WC2 A;  1IXS B;  4QSH A;  3VFZ A;  5IOY A;  4XK4 A;  1U78 A;  4XKB A;  1QRC A;  2FMY A;  3E0J B;  4TN1 A;  1EWY A;  3QWL A;  3COA C;  1V54 H;  4ENJ A;  4BQO A;  4BXF A;  2O3F A;  1R5I D;  4UZF A;  3L7W A;  3EYI A;  5EYR A;  1TT0 A;  2BVN A;  3VEP A;  3QPT A;  4UHT A;  1N8R D;  4X05 A;  1COW A;  4BHB A;  2RNG A;  1XSD A;  3BR1 A;  1YX2 A;  1BPL A;  4G5G A;  3T51 B;  1R4N B;  3PFY A;  3G1M A;  4HX4 A;  2M4K A;  1F43 A;  1E64 A;  2EIX A;  2WB1 N;  2K86 A;  5AIQ A;  5CDF A;  1BOA A;  1SD7 A;  2L9V A;  5JMC B;  3AVX A;  1YS7 A;  4NNJ A;  3CPX A;  3OJW A;  2BE5 F;  1QBJ A;  5L3D A;  4FN5 A;  1O3R A;  1GXP A;  3W2H A;  2LNB A;  1GQ8 A;  5IYC J;  1LQ1 A;  1SAU A;  2JWT A;  1I6X A;  4U0W A;  2JA7 J;  2MH9 A;  1ZGW A;  4DK1 A;  3P7N A;  4HSR A;  2X3H A;  1TNS A;  5EEH A;  4CGZ A;  2B7E A;  1ACI A;  1QUF A;  3BTI A;  5HDN A;  2OU2 A;  4CUG A;  3DLA A;  2DER A;  4P6Y A;  4Q4Z F;  1PJ5 A;  1UEL B;  3WTY C;  3J7A Y;  2UV1 A;  3I71 A;  1MD0 A;  3T53 B;  2CS3 A;  2KIM A;  2HDN B;  1KK3 A;  4TT3 A;  2XC1 A;  2QCO A;  4X6A J;  4BYY A;  4N3G A;  2BSA A;  1RRJ A;  3ASQ A;  4MHG A;  4LFU A;  3LSM A;  2AQF A;  3IAS 2;  2VNI A;  3TKY A;  3OYA A;  1PP7 U;  2HMA A;  3W2V A;  4CHU A;  1WWX A;  1S3J A;  5FGM A;  3JAM K;  5A2Q K;  1DU0 A;  1BR4 A;  1IW7 F;  1ETQ A;  2FUG 2;  2ID6 A;  1H8H A;  4YAO A;  2KIQ A;  4MQ9 F;  2BM1 A;  3SYJ A;  4J01 A;  3LNQ A;  2EK5 A;  2IQ7 A;  2XT4 A;  2HDW A;  1ZQ3 P;  1R5H A;  1ETK A;  1HF2 A;  2DU9 A;  2XGC A;  3WGG A;  1XGS A;  3AG3 H;  3DF8 A;  2VC0 A;  2VBK A;  4LBV A;  2ZCW A;  3KYL A;  4L5J A;  4LIU A;  5H6Q A;  2PLF A;  3AAF A;  2O17 A;  4YZA A;  2IJL A;  3OOU A;  4MGR A;  3M8F A;  4D5C A;  2AHQ A;  5FKM A;  3U9G A;  3JSP A;  2GJP A;  3PO3 J;  3E3V A;  2MSY A;  1M90 D;  5KAI C;  1B59 A;  1O7F A;  1WH5 A;  2LY2 A;  4B3F X;  4PDK A;  1ZM3 A;  3TQN A;  5TV2 A;  3T9G A;  2PMZ N;  2GK7 A;  4ASN A;  3U2Q A;  2A6E F;  4FT8 A;  2K02 A;  3W2A A;  1DQU A;  1OFM A;  1MW7 A;  2CUE A;  5E3N A;  4L0Y B;  3ASR A;  4BPR A;  3ML6 A;  3IWZ A;  2NOJ B;  2XF6 A;  1OCR H;  2WB1 A;  2VL8 A;  5ICF A;  3SLN A;  3GTM J;  4I6Z A;  2XRN A;  2WAQ N;  3S2D J;  2BN4 A;  3Q39 A;  3VNU A;  3OOP A;  1J7K A;  1W7P A;  1HDD C;  1W87 A;  2CH0 A;  2RC6 A;  5DV5 A;  1YJN I;  5EDN A;  1U8B A;  2V9V A;  1LDK B;  1NK3 P;  2B63 J;  1BA5 A;  2ZBK A;  2L4A A;  2Y9Y A;  1NHC A;  1IN8 A;  2KRH A;  4PJJ A;  4XM3 A;  2Z3Y A;  2A05 A;  3VOD A;  1FTZ A;  3BR2 A;  5DSZ A;  2BVL A;  1S9H A;  3F8N A;  1U3E M;  4Z6Y A;  3OWT A;  2R7Z J;  1JJ8 C;  1KK2 A;  2X0K A;  3B78 A;  3SXY A;  3V76 A;  3SYT A;  3A0B C;  3WNB A;  1LEA A;  5J1Y A;  4IHX A;  3FM5 A;  4RA2 A;  1OFL A;  1JA1 A;  2QGU A;  2F4N A;  4OJO A;  4UVB A;  2HFH A;  3GME A;  3WTU C;  5EF6 A;  4BHP A;  3AK5 A;  3F23 A;  2QMU A;  1PJR A;  5IT9 Z;  1BI0 A;  5E1X A;  1VJS A;  1JTX A;  1XGO A;  2HZT A;  2KHM A;  2CBX A;  3TO9 A;  4Z4V A;  1K4T A;  2WA0 A;  3CCS I;  3A35 A;  1B8I B;  4IW3 B;  1LPQ A;  3CCQ B;  1K8A D;  1VQ6 B;  5JHF A;  2R5Z B;  1YE9 A;  3WGI A;  3M8E A;  3JRA A;  1G7C A;  5IYR A;  3ZIA A;  2CRG A;  2PX9 A;  4A3M J;  3QPH A;  1E79 A;  3GSI A;  4R71 A;  1JJ2 B;  4BQA A;  4IHY A;  5ERI A;  1EJ9 A;  2H27 A;  1N25 A;  3QQA A;  2GZW A;  3TO7 A;  5K7F A;  4UAJ A;  2KMU A;  1E63 A;  4PK4 A;  1EH8 A;  3IRR A;  3IH3 A;  1BLI A;  3ECO A;  3JAM Z;  5A2Q Z;  1D1C A;  2XOK A;  2W4S A;  2ZSI B;  3HSR A;  3CMM A;  5CJ9 A;  2GWR A;  4E7J A;  1HW5 A;  2LBF B;  3CCL I;  3I56 B;  2BV6 A;  1ZN2 A;  3CUQ C;  2NT9 A;  1LFB A;  2G7H A;  3F8F A;  3W2F A;  3JRF A;  3RCO A;  2CO5 A;  2QYO A;  3J80 K;  1IN4 A;  4LGW A;  4N9I A;  2BY0 A;  2M2E A;  3SFZ A;  1ON1 A;  2CU7 A;  3DLL F;  2HVS A;  2QZA A;  3CF2 A;  4XIC A;  3DV8 A;  4KA4 A;  1TYW A;  1TWF J;  2EIK H;  4CYC A;  4P55 A;  1V5F A;  3WHB A;  2XHK A;  1DAR A;  5KK1 A;  3M3Y J;  4B3X A;  2GPJ A;  3B82 A;  5J3O A;  2LRE A;  4UUS A;  1CF7 B;  1VQM B;  1HBX G;  4RDL A;  4XN3 A;  1LVA A;  1NJI D;  2C5H A;  3IH4 A;  3GFJ A;  3ZMS A;  3A0H C;  3AG1 H;  1YOV B;  3DQV C;  3ZQL A;  1SVO A;  3LL7 A;  1NH3 A;  1QFZ A;  3A1P A;  4LLG F;  5DCM B;  5D8K B;  1IRZ A;  1BX1 A;  2D3L A;  1IDK A;  3FXO A;  4URR A;  3CC2 I;  2V7T A;  2DA1 A;  3GLL A;  4A3I J;  5EJC A;  2FBK A;  3S1R J;  3CUQ B;  2D45 A;  1TUI A;  1H42 A;  3EET A;  1ZGJ A;  1JNY A;  3DDY A;  1H88 C;  2IEK A;  2NTP A;  1K6Y A;  3HC7 A;  4PC1 A;  1YLF A;  2KT0 A;  1K61 A;  3CTA A;  1VQO B;  3M1E A;  5IYP A;  3QFT A;  1FSH A;  2XNJ A;  3D1N I;  2I8D A;  1OCO H;  1X1D A;  3ZBT A;  2JPC A;  1FNB A;  1R22 A;  2YX4 A;  1T56 A;  2XRO A;  4NBS A;  5DS0 A;  3ASO H;  2BW3 A;  2XGE A;  4KT5 C;  2P6T A;  2ZME C;  2HOA A;  1PUE E;  4OM9 A;  1ZTR A;  1PE9 A;  2Y48 A;  2KDZ A;  1NB0 A;  2VZL A;  3VMW A;  2P6S A;  1D8J A;  2XB5 A;  1VBL A;  3K4K A;  3O8H A;  2PLY A;  2ZBU A;  1KU2 A;  2LYC A;  5HOD A;  4OP7 A;  5L3F A;  5HNF A;  2CQX A;  1GXQ A;  3OYD A;  3CP2 A;  3OFN A;  1PLU A;  2XTW A;  2BXY A;  4MXN A;  4FIS A;  3ONY A;  2VN2 A;  2FBI A;  5GP9 A;  4HWV A;  2F5D A;  4U87 A;  4EEF G;  4XLA A;  1OGJ A;  3V8J A;  2LVS A;  1JA0 A;  3K70 C;  2H6B A;  1FP1 D;  1O3T A;  2BGI A;  3E20 A;  1JRG A;  3RPQ A;  1DDI A;  2V79 A;  2E34 A;  3K4N A;  3QYF A;  3K6G A;  4M1K A;  1S72 B;  1P4A A;  3AVU A;  1AMO A;  2LF8 A;  3E6C C;  2XPW A;  3KP6 A;  2KQR A;  1P9Q C;  3ZQF A;  1G8X A;  3S1Q J;  4Z1M A;  2XZO A;  1SMT A;  4P5O A;  2JJ7 A;  5K5R A;  3W2W A;  1FOK A;  4PFP A;  2DYS H;  3FXQ A;  1MBK A;  4MTE A;  4DK0 A;  4CXF A;  2NXN B;  3HM5 A;  5HOO A;  4WZK A;  1LE8 B;  1A04 A;  3TBI A;  3W6J B;  3CCM I;  1KC8 D;  5JLV C;  2VFM A;  3LSI A;  1A5J A;  2ECC A;  2WZP P;  1O8G A;  4LJZ F;  3T8T A;  1XX5 A;  1TWC J;  3M7G A;  5GPA A;  3PQJ A;  2IAI A;  5LHH A;  2O04 A;  4GFB A;  3WTT C;  5DCM A;  1NG6 A;  4DZJ A;  4ZYE A;  4WZT A;  1T6Y A;  1S4M A;  1S6L A;  3Q5F A;  4OMY A;  1UG0 A;  2XSD C;  1D3Y A;  4JBA A;  1LM1 A;  5IYB J;  3AKZ A;  2V7V A;  2HKO A;  3A03 A;  1T0F C;  1R6R A;  1TL8 A;  2XKO A;  2FA5 A;  2L5Q A;  1IV6 A;  1AIR A;  4XLH A;  3L1P A;  1DPR A;  2L2O A;  4YHB A;  3DPL C;  1SC7 A;  3BPV A;  1IG7 A;  2DOD A;  2M87 A;  3OIQ A;  4OPV A;  2X1D A;  4HEA 2;  4X8I A;  2K3F A;  1IXR C;  1QZY A;  3TGN A;  4RS8 A;  2EFQ A;  3N4M A;  1HOM A;  4DNC A;  2MFZ A;  1U5T B;  5LHG A;  4ESB A;  4DGW B;  4JK1 X;  4N4N B;  5D8L B;  1R36 A;  1M1E B;  3DTE A;  3OV8 A;  2VE8 A;  2X6Y A;  2XC7 A;  3ASS A;  4CQJ A;  2WAQ A;  5B6I A;  2V31 A;  4A2U A;  3CCQ I;  3W6K B;  3CME B;  2B9S A;  5F4M A;  4ACA A;  3S2W A;  3WTZ A;  4Z4Y A;  1FBU A;  4P96 A;  3MZH A;  3ESW B;  3GTK J;  3WXM A;  1RC9 A;  2G0Y A;  1ZR4 A;  4L8J A;  2PEC A;  3EUK L;  4HQE A;  1FPQ A;  1VQ8 I;  2ESN A;  4I7H A;  4BUP A;  2V4D A;  5H20 A;  1K78 B;  3RKX A;  2F5C A;  1N0V C;  2OPT A;  3LFU A;  3ASN H;  1W5C C;  4XRM A;  1T95 A;  3M1C A;  4PJM A;  2VE9 A;  1FEX A;  1GHC A;  2EFO A;  5DYM A;  2NOG A;  4ABZ A;  3I56 I;  3H0D A;  2IS6 A;  3CJN A;  3ZQH A;  3CD6 I;  4GRI A;  2GRE A;  2J5O A;  5B5E C;  1P4M A;  2Q2E B;  2XV4 S;  2L0K A;  1T6X A;  2D74 A;  3LA2 A;  1TYU A;  1XG1 A;  4RAF A;  1CZF A;  4RAG A;  4LBY A;  4YXW A;  2R7U A;  3BY6 A;  5GTH C;  5FJ8 J;  3HPG A;  4EV0 A;  2F6C A;  4L5E A;  2VBT A;  1S8N A;  3KEO A;  1VF7 A;  2B5O A;  5IP9 J;  3DFG A;  4IPA A;  1GO2 A;  3CO7 C;  4KN7 X;  1B8I A;  1W36 D;  2ZZF A;  2KIS A;  3TOB A;  1EP2 B;  2HXI A;  3Q9S A;  1Z9C A;  4BL0 B;  3J7Z I;  1MSF C;  1LLW A;  3SZG A;  2CV1 A;  2AO9 A;  2DLL A;  4NQW B;  2P7C B;  3JQQ A;  3QFC A;  3VSU A;  2OD5 A;  4IRI A;  2VNK A;  3IP4 B;  3OR1 C;  3JUR A;  2WV0 A;  4M6X A;  3CC7 B;  1T2K A;  2F4I A;  2BZT A;  2QUF A;  3Q3A A;  3OS1 A;  2K27 A;  2F4O B;  3BG3 A;  4KNY A;  2X1C A;  3HKZ A;  2E7W A;  3ONQ A;  2O8X A;  4II3 A;  1KU3 A;  3RDI A;  2JK3 A;  2CV0 A;  3LYC A;  3S3O A;  4P22 A;  4Z03 A;  3AST A;  4IVN A;  5J40 A;  4Z2Y A;  2GXG A;  1FJL A;  3HSF A;  1P7J A;  1TYX A;  3U6B A;  2KZV A;  2CV2 A;  2L7K A;  5FRN A;  1MMA A;  5HVQ C;  4P6V F;  4CSW A;  3PFI A;  2VQH A;  5K7Z A;  1VQL I;  3OSF A;  2DPU A;  1XB4 A;  6PAX A;  1O88 A;  2LTP A;  2A61 A;  3IC7 A;  4F92 B;  2BV3 A;  2IA2 A;  1IUY A;  2L7M P;  1UST A;  1WJE A;  3S3N A;  2HQN A;  4P25 A;  4HX8 A;  2A3S A;  4UZU A;  1RR7 A;  1UB9 A;  2YS9 A;  3ABM H;  3FMS A;  3F21 A;  4V19 K;  2O0V A;  5GAD J;  2V7U A;  4X07 A;  2EFN A;  1PDN C;  2LLK A;  4BE1 A;  3QOE A;  4P9F A;  3JTG A;  2IT0 A;  5A8A A;  4A3F J;  4TMX A;  2UVE A;  5LGN A;  2IP2 A;  3H9N A;  2X6X A;  2KLO A;  2C78 A;  3OIO A;  3TMO A;  3V7C A;  5BPI A;  1O7L A;  1ZHF A;  4KIG A;  1ZLK A;  1JI8 A;  3CCM B;  2Y69 H;  2DEU A;  3H1C A;  3Q3S A;  4RAZ A;  5F1J A;  3G1O A;  5FO1 A;  2XIG A;  2JVH A;  3H5R A;  3W3C A;  4K2E A;  1EP1 B;  3K4M A;  2DOG A;  1VQ7 B;  1W4M A;  1QCX A;  4IQJ A;  2XZP A;  1B9M A;  2VJ4 A;  2QA4 I;  1DUX C;  1FX0 A;  1GVH A;  4E6K G;  2YSR A;  3K4L A;  2AS5 F;  5D5W B;  2GJK A;  4DBQ A;  4BS9 A;  5H6R A;  3ROU A;  4AWX B;  4G6D A;  1KCD A;  2BW3 B;  3WND A;  2VPL A;  3BP8 A;  3H5N A;  2BEO A;  2M0C A;  3GZN B;  2JSC A;  4H9G A;  2KIU A;  1FNM A;  2R6H A;  2JJ2 A;  1O8E A;  4OIN F;  1H8E A;  1BJA A;  3S93 A;  2X53 S;  2E5Z A;  3BPX A;  3EDP A;  1VQN B;  2K85 A;  4B09 A;  3PM1 A;  2K9L A;  3GFL A;  2O6W A;  4RGX A;  4MYU A;  4HNV A;  1O8J A;  5CQG A;  3S1M J;  2WJY A;  3LMW A;  3OZU A;  1SKQ A;  1YJ9 B;  4IOC F;  5LRR A;  3ZZ0 A;  4EVI A;  3HOS A;  1XQB A;  4M6V A;  4I2O A;  1YYV A;  3Q0W A;  1QGA A;  1XMX A;  3TW6 A;  3L00 A;  5GAH J;  2K9M A;  4YIF A;  4B48 A;  4B47 A;  5D6F A;  5B1B H;  1IGN A;  2HLD A;  1VQO I;  1AIP A;  5ICE A;  1YTY A;  3HSE A;  4ESF A;  4XN0 A;  4X0G A;  1U0J A;  1YI2 I;  1E3Z A;  1VQ8 B;  3FK7 A;  4MR0 A;  4TV7 A;  1B72 A;  2WSS A;  2E5N A;  1E43 A;  3ZN1 A;  2ADU A;  1YJW I;  2OTL B;  4FHT A;  1ZYR F;  1Y56 A;  2M3A A;  3MZY A;  1LE8 A;  3G4S B;  1DP7 P;  4RD0 A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 3BG6 A;  1SAU A;  4BJ5 C;  3OEH A;  4ZDL A;  4DK1 A;  4HSR A;  2X3H A;  3S8P A;  2IS2 A;  4XKV A;  3I9V 2;  4CUG A;  3DLA A;  4EW9 A;  2GOX B;  3BC8 A;  4H4K C;  1UEL B;  3J7A Y;  2UV1 A;  3T53 B;  1WJD A;  2CS3 A;  4PJL A;  3OL4 A;  4TT3 A;  2WBM A;  3IAM 2;  3OYN A;  3T56 B;  4MLO A;  3ZSC A;  1D0Z A;  3RSN A;  2Z6B D;  3OS0 A;  3LSM A;  2AQF A;  3IAS 2;  3OYA A;  1AA7 A;  1X19 A;  4E7L A;  1OGM X;  3W2V A;  3EUH C;  2CK3 A;  3L2V A;  1BR4 A;  2FUG 2;  3L2U A;  4YEJ A;  1E3X A;  1H8H A;  3VYR B;  4KKU A;  4J01 A;  2IQ7 A;  1EA3 A;  2HDW A;  3SUC A;  3VMV A;  3PNY A;  5CPR B;  4N4O B;  1KMH A;  1OHH A;  2O0W A;  3GQ8 A;  3VSV A;  2OUM A;  2XF7 A;  2VBK A;  3FKS A;  2PYH A;  5KCM A;  3KYL A;  2RQQ A;  4HNT A;  2PJR A;  1T5E A;  1MMN A;  4KIT B;  4LIU A;  2O17 A;  1PYV A;  2UWM A;  3EUA A;  4YZA A;  4NK6 A;  2VQL A;  3OOU A;  2M0M A;  2DXI A;  4BGD A;  3ZQQ A;  1K28 D;  2GJP A;  1V0F A;  2W6I A;  3VSL A;  3NWS A;  5FL7 A;  2QKM B;  4DIQ A;  3T9G A;  2LY2 A;  4FXU A;  3FBI B;  5LFA A;  4B3F X;  3WQZ A;  2GK6 A;  2GK7 A;  5HLT A;  4F55 A;  2E1B A;  2XND A;  2XAU A;  3K4C A;  1HG8 A;  4PMH A;  3W2A A;  1RU4 A;  1DQU A;  1BR2 A;  4NUB A;  4BU2 A;  1MW7 A;  2V7F A;  3K4J A;  1OFM A;  1O8I A;  1O8F A;  4F52 A;  2MD0 A;  3D5L A;  2NOJ B;  3LSK A;  1UD4 A;  3ZPP A;  2XF6 A;  3BCD A;  1D1B A;  4HPQ A;  2WB1 A;  2KRC A;  2VL8 A;  2VXZ A;  3FDY A;  3I3L A;  4XLE A;  4DJA A;  3OE7 A;  3OS2 A;  1E0E A;  4CH7 A;  1IDJ A;  4NC7 A;  2CH0 A;  2M7B A;  3PJR A;  1QU3 A;  1D0Y A;  3RTR A;  2Z1D A;  3H35 A;  4BJT A;  5KHD A;  1LDK B;  1NG7 A;  4HRI A;  2MAB A;  1IB4 A;  1NHC A;  1H80 A;  2VJJ A;  2KRH A;  4PJJ A;  4XM3 A;  4KT6 A;  4ZTJ A;  4XOT A;  4YRV A;  3GVK A;  2VBM A;  4Z06 A;  2BVL A;  1S9H A;  2IGK A;  3OWT A;  3OYJ A;  3PNT A;  1ERD A;  3SYT A;  3U21 A;  2OC6 A;  3NE5 B;  4Z05 A;  1WJB A;  1Z21 A;  3OYK A;  2E60 A;  2PEC A;  3QOD A;  4U7B A;  4YZQ A;  4PSW A;  1OFL A;  3EQN A;  3D5S C;  4OJO A;  2HU9 A;  3DPU A;  1UD3 A;  2BVM A;  2R4G A;  3GVJ A;  1PJR A;  1N78 A;  1VJS A;  1FMV A;  5TGT A;  2KDO A;  3HG9 A;  2KHM A;  2HZD A;  3FBN B;  1DBO A;  4C30 A;  2WA0 A;  4JQF A;  3A35 A;  1O8M A;  2R7T A;  1MND A;  4Y3O A;  3PNV A;  2X8K A;  3BCF A;  1OB0 A;  5JHF A;  1NRK A;  1J09 A;  3VYT B;  1WJC A;  2IGM A;  1YE9 A;  2IGN A;  3ZIA A;  1O8K A;  1WJA A;  4G6I A;  1GLN A;  3DU5 A;  1X4P A;  1E79 A;  4XOP A;  3OMY A;  4XMY A;  1LVK A;  4D1Q A;  2IS4 A;  1OOC A;  3VDX A;  2M4G A;  2XZL A;  4KKS A;  2DCE A;  3OAA A;  2WY7 Q;  3CP8 A;  4W8R A;  2KMU A;  2IGO A;  4PK4 A;  4B3G A;  2X1E A;  2GOM A;  2ZXH A;  1DGW Y;  2CUZ A;  1BLI A;  2INV A;  1D1C A;  2XOK A;  2W4S A;  2JUG A;  2ZSI B;  3CMM A;  3N05 A;  4E7J A;  2R7V A;  2LBF B;  3OYG A;  4XON A;  1PKV A;  2WAD A;  2DJI A;  4E7I A;  4GQN A;  1IRX A;  2NT9 A;  4E7K A;  3VWB A;  3VR6 A;  3H94 A;  3RCO A;  4ZTF A;  4RM2 A;  1UD8 A;  2V9K A;  4E7S A;  2F5V A;  2F43 A;  4PUS A;  2HVS A;  3LSG A;  3OEE A;  3CF2 A;  2JA2 A;  1WFX A;  1E1R A;  4CCN A;  2HVR A;  1V5F A;  1OR7 C;  4B3X A;  4YZX A;  2LRE A;  3HPH A;  3EQO A;  4W8T A;  1N75 A;  2MYS A;  3KEY A;  4NK8 A;  4XN3 A;  4U49 A;  1YX5 A;  3FHN A;  2R7R A;  1QHG A;  3ZR8 X;  3GQA A;  3DQV C;  3LL7 A;  4OZZ A;  2WAF A;  2W00 A;  3DU6 A;  3H5A A;  4QPO A;  1IDK A;  2D3L A;  4URR A;  3ZXS A;  3AL0 C;  2JDI A;  4CA0 A;  4OWR B;  2ZTN A;  2O5R A;  2JSP A;  4Y4R A;  1SFK A;  3SEQ A;  4BAC A;  4BDY A;  2D3N A;  5IK2 A;  2R7Q A;  4U4B A;  3OYC A;  3DDY A;  3MMY B;  2NTP A;  3PL8 A;  4IQ4 A;  3HXL A;  4BEH B;  2V4J C;  3A4C A;  1K6Y A;  3HC7 A;  5C1C A;  3OYL A;  3A1Y A;  2IS1 A;  2CW8 A;  4OJ5 A;  4BE2 A;  1KZL A;  2LRD A;  4HG2 A;  2I8D A;  4C2U A;  1X1D A;  2VB6 A;  2XGJ A;  3VST A;  3S32 A;  2INU A;  1WJ5 A;  1X1C A;  2BW3 A;  3A3B A;  1X1A A;  2RRE A;  2LH9 A;  3OYE A;  1PE9 A;  4BQQ A;  3VMW A;  1VBL A;  2EWE A;  3K4K A;  4P1W A;  2Z8G A;  1WJF A;  1V5G A;  1W9X A;  2LYC A;  1RMG A;  1V5E A;  3DEE A;  4HST A;  1I18 A;  5HNF A;  1SKY B;  4MXN A;  3OYD A;  3CP2 A;  2KL4 A;  3L2R A;  3OFN A;  1PLU A;  4RM3 A;  5HNH A;  2LBF A;  3HUG B;  2NTB A;  4HWV A;  1HZE A;  1GQ8 A;  4U87 A;  4B43 A;  2NTQ A;  4XLA A;  4RLQ A;  3K70 C;  3H9G A;  4ZJZ A;  2XF5 A;  1JRG A;  2A5W A;  4CCJ A;  1ZEL A;  3NWT A;  4KJZ A;  1PXZ A;  3K4N A;  3BG7 A;  3QYF A;  3OYH A;  3OPO A;  4AU7 A;  3OYB A;  3K6G A;  3A2K A;  4J00 A;  3ZCO A;  4CZC A;  2R7X A;  2X85 A;  1VLY A;  2PMZ A;  4ITV A;  4Z1M A;  2KQR A;  1P9Q C;  3GQB A;  1G8X A;  2XZO A;  2LC2 A;  4P5O A;  4B44 A;  2WY8 Q;  3W2W A;  3KEW A;  4E7H A;  3B4N A;  4PFP A;  1BMF A;  3GQ7 A;  4RLF A;  4DK0 A;  3TL4 X;  5HOO A;  4C2T A;  1KTW A;  3TBI A;  4HNU A;  2W6J A;  2M7A A;  3LSI A;  2WZP P;  3MKW B;  1O8G A;  4EAT A;  4D9J A;  2HPI A;  4XLF A;  1IA5 A;  2O04 A;  1Z7L A;  1NG6 A;  3OYI A;  4XR6 A;  4YZ0 A;  1UG0 A;  3FY3 A;  1D1A A;  2UVF A;  1K5C A;  2M5S A;  1RWR A;  2K3P A;  3BC9 A;  3PSI A;  4F93 B;  3AL0 B;  3AKZ A;  2Z16 A;  2ELJ A;  1T0F C;  3H9Q A;  1R6R A;  2X6W A;  3G2B A;  2Q1Z B;  4PJN A;  2L5Q A;  1AIR A;  4XLH A;  2L2O A;  4R79 A;  2O1D A;  3DPL C;  3BH4 A;  3OIQ A;  4IZZ A;  2X1D A;  2JIZ A;  1Z3X A;  4HEA 2;  3V42 A;  2QE7 A;  4ZC3 A;  2ZZG A;  2R7O A;  2VXD A;  3LMM A;  4ZYA A;  4DNR B;  4FAS D;  1N77 A;  3K10 A;  3DTI A;  2MFZ A;  4XKC A;  1TZL A;  4DGW B;  1W0K A;  4N4N B;  1O8D A;  3KX2 A;  3DTE A;  2VKD A;  2X6Y A;  3BCB A;  2XC7 A;  2WAQ A;  4W8Q A;  2V31 A;  3PSF A;  3VSK A;  5LD2 C;  4LG3 A;  2LZJ A;  2V26 A;  3MD2 A;  1I8D A;  4PSX A;  1BN8 A;  1EFR A;  4IKF A;  2CFO A;  4I84 A;  3EPZ A;  1Z3Y A;  2W1O A;  5CKT A;  3CES A;  4XKW A;  2Y0S A;  3EUK L;  5CQE A;  3OY9 A;  2ZZQ A;  4L8J A;  3K4B A;  4BUP A;  4LIT A;  4CCM A;  2V4D A;  2PYG A;  3ZPN A;  3LFU A;  2V1N A;  3AFH A;  3D5R C;  4ANJ A;  1T95 A;  3M1C A;  4G6T B;  4PJM A;  4W8S A;  1LFP A;  4IX7 A;  4FET A;  3GVL A;  1MAB A;  2UUZ A;  3HOT A;  2VAS A;  3VYU B;  3H0D A;  2XSJ C;  2V6E A;  2IS6 A;  4GRI A;  4BJ6 C;  2Q2E B;  2JVG A;  1D0X A;  2KP6 A;  4CCL A;  5HKK A;  1HA8 A;  1CZF A;  3SDB A;  4TKO B;  4YEL A;  4YXW A;  4C9Y A;  1XG2 A;  4BQN A;  2R7U A;  1QJV A;  3OOC A;  3HPG A;  2F6C A;  2XDV A;  3DPT A;  2NST A;  2KPM A;  4DOZ A;  2WPD A;  4E4H A;  1VF7 A;  3OW7 A;  3IUO A;  3A3G A;  3L2Q A;  2AQE A;  4PFO A;  1UAA A;  4OJL A;  2L9S A;  4AYB A;  1UD2 A;  1W36 D;  2ZZF A;  2HVQ A;  3DKX A;  4KIS A;  1NBM A;  4E7Z A;  4BL0 B;  1VZ0 A;  3SZG A;  2W7N A;  2CV1 A;  2ZTG A;  3KRG A;  4NQW B;  3VSU A;  3B90 A;  3OYF A;  3IP4 B;  3ZGK A;  3OR1 C;  1E1Q A;  3JUR A;  2V7Q A;  1WTH D;  3DKY A;  4JOM A;  2F4I A;  3S3M A;  5KNL A;  3OS1 A;  1LKX A;  3OR2 C;  3RQ4 A;  3HAG A;  3GRH A;  3FPP A;  2VQG A;  2X1C A;  1Y6I A;  3HKZ A;  2ZZE A;  3ONQ A;  4II3 A;  2CV0 A;  4Z03 A;  4DNT B;  2A6T A;  3S3O A;  4P22 A;  4II2 A;  2JJ1 A;  2HNH A;  1EE6 A;  2Z2S B;  3OIP A;  2R9V A;  1OLT A;  3C2G A;  3F9K A;  1V0E A;  5AMV A;  4XOR A;  2KZV A;  1YX3 A;  2LY1 A;  4ZDP A;  2R7W A;  2L7K A;  3C2H A;  2CV2 A;  4BEH A;  5FRN A;  2DOA A;  1DGR M;  1MMA A;  4KKT A;  1X4O A;  4OZY A;  5HVQ C;  2CUJ A;  2L9N A;  4CSW A;  2WJV A;  2VQH A;  3FKJ A;  4F91 B;  3LSH A;  3E1S A;  4G7W A;  2R7S A;  1O88 A;  1QHH D;  2VKH A;  4F92 B;  2NZM A;  1BR1 A;  4CCO A;  1WJE A;  3S3N A;  1KON A;  3JU4 A;  3CZ6 A;  1DBG A;  1W36 C;  4G7X A;  4UZU A;  2O0V A;  5C1E A;  2HQA A;  3CJQ B;  3MKZ A;  4BE1 A;  3QOE A;  1X1B A;  1MMD A;  2OV7 A;  3ZRG A;  2W82 A;  4CCK A;  2UVE A;  1UD6 A;  4XD7 A;  2X6X A;  2KLO A;  2IXS A;  3TMO A;  4XL9 A;  2ZFU A;  4OAZ A;  3QYB A;  4XQF A;  1BHE A;  1JI8 A;  4NC8 A;  4OAY A;  1DP3 A;  2VJ5 A;  2VJI A;  4RMN A;  2DIE A;  2GJR A;  3G05 A;  3HL2 A;  3K70 D;  2JVH A;  3M8J A;  3H5R A;  1MNE A;  3W3C A;  3UNG C;  3K4M A;  3LNN A;  4E0F A;  4C2L A;  1QCX A;  2E1M C;  2WAE A;  5FRM A;  2ZSH B;  4IQJ A;  1FMW A;  2VJ4 A;  2XZP A;  2E1M B;  3OYM A;  1FX0 A;  2BOL A;  4E6K G;  2LG4 A;  3K4L A;  2GJK A;  1HVX A;  4DBQ A;  1W0J A;  4JMQ A;  4BS9 A;  1X0C A;  2QX3 A;  3B8Y A;  4OJP A;  3UW0 A;  3WWG A;  2VIX A;  3DWL E;  3GBG A;  2BSP A;  2NSP A;  2VBE A;  1KCD A;  2KVO A;  2CW7 A;  2BW3 B;  2VQC A;  1WPC A;  2VPL A;  1O8L A;  1O8H A;  3UR3 C;  3L2W A;  3H5N A;  2CMP A;  4ASU A;  4XLC A;  3BCA A;  3RPU D;  2DT7 B;  1G59 A;  2X51 A;  4LIV A;  2JJ2 A;  1O8E A;  2DT6 A;  1H8E A;  2LOO A;  3S93 A;  4F3Q A;  2X53 S;  2E5Z A;  4XKB A;  2PJR B;  1BOB A;  3E0J B;  2K9L A;  3BLY A;  4BQO A;  2ZXI A;  3SEZ A;  4BXF A;  1O8J A;  2QXZ A;  1KCC A;  5CQG A;  2WJY A;  3LMW A;  1TT0 A;  3VYS B;  1JTA A;  2K5C A;  5DN6 A;  3CJR B;  4TSF A;  4QPQ A;  1WP6 A;  2VLA A;  2ODL A;  1COW A;  3HOS A;  3GQ9 A;  4AVZ A;  2RNG A;  3H9J A;  2QY1 A;  1UD5 A;  2K9M A;  4B48 A;  1BPL A;  4B47 A;  3T51 B;  3PFY A;  2M4K A;  3PUB A;  2HLD A;  5FRO A;  3QYE A;  4DBR A;  2P0W A;  3MKY B;  4XN0 A;  4HIZ A;  4X0G A;  1U0J A;  2QKL B;  1E3Z A;  5CDF A;  2F1M A;  4MR0 A;  1OGO X;  2WSS A;  4NNJ A;  2E5N A;  4XNF A;  4ZDO A;  1E43 A;  4BE0 A;  4OJ6 A;  3DTK A;  1WMR A;  3OL3 A;  2MC4 A;  1Y56 A;  2M3A A;  2HPM A;  2NT6 A;  1MMG A;  4BDZ A;  4Y33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...