4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
2X6YA 4XORA 2O17A 2NTPA 3KRGA 4W8TA 1KTWA 2QX3A 1O8HA 5AMVA 1RMGA 4OZZA 4XLCA 2INVA 2X3HA 4XLHA 1H80A 2UVFA 3T9GA 4XQFA 4OJOA 4EW9A 2UVEA 3ZSCA 1JRGA 3EQNA 4XMYA 1IDKA 4OJPA 2QXZA 4XN0A 2BSPA 2NZMA 3WWGA 1O8MA 2X85A 4W8QA 2X6WA 4OJ6A 3VSVA 5C1CA 1O8GA 4OZYA 4NK8A 4XOTA 1VBLA 4XKVA 2IQ7A 1O8DA 2X6XA 1AIRA 1O88A 1O8FA 1PLUA 2INUA 1JTAA 1KCDA 2NSPA 2PYHA 4W8RA 2NTQA 1K5CA 1CZFA 1QCXA 1WMRA 1O8KA 4YZAA 1O8JA 2O04A 4XONA 2O0WA 4XKWA 4W8SA 4U49A 4XM3A 4OJLA 3GQ7A 2NT6A 4YEJA 2EWEA 1EE6A 1KCCA 1RWRA 1OOCA 3VSTA 4XOPA 1IA5A 2NT9A 2NTBA 4XN3A 2ODLA 2QY1A 1OGOX 4Z06A 3GQAA 1OGMX 4AVZA 4U4BA 4XLFA 1PE9A 1NHCA 1OFLA 4Z03A 1BHEA 2VJIA 3UW0A 4YZXA 1O8IA 2VBMA 2O1DA 3EQOA 2VBEA 3SUCA 4MXNA 3ZPPA 2VJJA 3VMVA 4PMHA 4XR6A 3GQ8A 1DBGA 4C2LA 1RU4A 4YZ0A 2PYGA 4XLAA 3B4NA 1DBOA 1IB4A 1O8EA 4XL9A 1OFMA 2NSTA 4HWVA 1PXZA 4YZQA 1BN8A 4XLEA 4URRA 3LMWA 4OJ5A 1XG2A 4MR0A 1O8LA 4I84A 3JURA 2Z8GA 1QJVA 5C1EA 3GRHA 2PECA 2VBKA 3FY3A 3GQ9A 3B90A 4XNFA 4NK6A 4Z05A 2O0VA 3VMWA 1HG8A 3B8YA 4YELA 1IDJA 1X0CA 1GQ8A 3VSUA
chains in the Genus database with same CATH superfamily
2KIMA 2ZL5A 2G7UA 2YUSA 1CQTA 3I3LA 3QOPA 1IF1A 4U9UA 3ZZTA 3CCEI 3KRGA 3N05A 3ABTA 1ZKGA 1OR7C 2OC6A 2KISA 1X19A 2OUMA 3T5XA 1GV2A 3MWMA 1HZEA 3I1FA 3B6CA 4BGDA 4DYCA 5D4RA 3BLYA 5FIUA 3SZPA 4WXCA 4BQNA 2E1OA 4KDPA 4NHJA 3JQQA 1UJ8A 2VBXA 1BW6A 3MKWB 3VO1A 4C2TA 2JTVA 2VBYA 2LRDA 4JX4A 5DYMA 5IP9J 1LLWA 1NDHA 2HU9A 4V02C 2QDXA 1ETOA 3N90A 3BCAA 3M9AA 2A69F 2CG4A 4EEFG 2PJRA 3WGIA 1Y0NA 3LA2A 5FJ8J 3ZP5A 2IGOA 5FKKA 1LLZA 2ZBKA 3WXMA 4W1UA 5FLMJ 3CCRI 5E8IA 1WJEA 2XB5A 1J7KA 2JWTA 3EQLF 2BEOA 4O3MA 2DFHA 4S05A 2K3PA 2P4WA 1AIRA 3TO6A 1B9MA 3HOVJ 1RKWA 4CA0A 1A31A 3I71A 2EILH 1PP7U 1UD3A 3BNWA 1QGAA 3W5UA 1XFOA 3GTLJ 2XUBA 5HNHA 3I54A 2R7UA 3AVYA 2JN6A 2ECBA 3QWLA 2DMTA 1SMTA 2PLYA 5AN9A 2UUZA 1QA2A 2HQNA 3DPTA 1O7FA 3ABLH 2YU9J 4HF1A 4XSXF 2FX3A 3WBJA 1MDMB 1F60A 3O3KA 1X1AA 2B7BA 3H35A 2JK3A 3VODA 2ZSHB 4BE2A 3PSSA 4DBQA 3WG7H 3FMQA 2M1BA 1JKPC 1W5SA 2CQNA 4U4BA 4GYGA 5IT9Z 4PDKA 3UNGC 1WDTA 4CDGA 1VQ4I 1WI9A 2P7CB 2LNBA 3CC2I 4KKSA 1IDYA 4CYCA 2E2IJ 3G2BA 5A2QK 3CUQA 4Q48A 3JRIA 1MJAA 4TMVA 2IXSA 1MD0A 4A3EJ 2VC0A 2X6OA 2VBEA 2VI6A 2IPQX 2LY1A 6PAXA 1FC3A 4DK0A 1B4AA 3PQJA 2OU2A 1PUEE 1MABA 5IP7J 4GQNA 3V8JA 2XOKA 4BHPA 3QP5A 5JFRA 2R0QC 3AL0C 2V31A 1TVCA 4P55A 2JUCA 2VOOA 4GCVA 4C2MJ 3F8MA 3CCLB 1O3TA 3CCMB 2VNJA 3PM1A 1NTCA 2VFMA 3SJMA 4IHVA 4LBZA 3RPQA 5E3LA 3I56I 2FD5A 4BHBA 3DFGA 5DV5A 1N8RD 4AYBN 4G7OF 2CQ7A 1R23A 4RPBA 1K6OA 2OF7A 4QIWN 3HOXJ 4KISA 1Y8QB 3A35A 2OTLB 4ZTFA 1TT5B 3FDYA 1MSFC 4Z05A 3U6BA 1POGA 3VMWA 5KHDA 3QFTA 1FOWA 2LR8A 2RNGA 3CDIA 2VQCA 4KIFA 2NS8A 1OCZH 3VSUA 3CCQB 2ZFUA 3GLXA 4HV6A 3ECOA 1E79A 3EUAA 4EJOA 3DP7A 3TO7A 3QAHA 2AS5F 2CV2A 3IH2A 5AMVA 2BN4A 2M7BA 4MQ9F 3CP8A 4KUMA 4YXWA 4C3HJ 1X2NA 3ZUGA 5J1YA 2YX4A 3KFWX 3MKZA 4ZTJA 3LOCA 1W0JA 3NAWA 3G4SB 2MD5A 4PABA 3GO5A 2M34A 4XQFA 2MC3A 1HSTA 2EK5A 1F36A 2DTZA 2CS3A 3LSRA 5FRNA 1I5ZA 5HKKA 1FMVA 3L2CA 4I02A 1X3UA 1VQPB 3PVDA 2QA4B 3K70C 3WWGA 1YW8A 4P5OA 4ZDLA 5DUKA 2P5VA 2DY1A 4A3JJ 2B63J 3BG9A 2O0YA 2RC5A 3MZ8A 4RM3A 3JRGA 2CJJA 4YC5A 2HR3A 2W6IA 2MFZA 5IOYA 4RD4A 2V1UA 2XAGA 3CMAI 2CRGA 2GOMA 2HZTA 2LLKA 4ZH4F 1BR4A 5CVRA 2R5ZB 1IB0A 2QCOA 4KIGA 4R1HA 2LBFA 2Q1ZB 1ZRCA 4P9UA 2HXOA 3I4NJ 3B73A 1S29A 3RKWA 2L02A 2VN2A 4HAMA 3K4JA 3IKTA 3CW2A 3M8FA 3I55B 3C2BA 4E7KA 2O04A 3FF5A 3Q5FA 2ZMEC 4PZJA 1EXMA 1VNDA 4MIMA 2F48A 3JTHA 4RAYA 4RLFA 2DFFA 2IS6A 1XDUA 2KIFA 2XAUA 3G1LA 4MQVA 2B7CA 4WZLA 1XB4A 1OB2A 3L2RA 1S72I 3SLDA 4LD5A 3U6KA 3CCEB 4XN3A 5LEKA 2EV5A 3QYFA 2XF7A 1V0EA 4OAYA 2GM4A 3ZQFA 2DT7B 4A93J 1N05A 4RJLA 1OGOX 5HOOA 2VFOA 2JVHA 2VT2A 1RRJA 3KEOA 1XMXA 2H8RA 1CGPA 2W82A 3CCJI 4LBWA 2WC2A 3AVTA 5LMZA 1BHEA 4BY7J 5GAGJ 1H0MA 1BN5A 1HCRA 2DMNA 4ESFA 1QFYA 3AG4H 3K7AJ 4D0PA 5E8GA 1ENHA 3RKYA 3HXLA 1IRXA 2DA2A 2IEKA 1W36C 5F4JA 5KSWB 4I0BA 2L9SA 3VFZA 3WTSC 3JCUC 3B4NA 1IXCA 1BIAA 1W1WE 1IN4A 2DLLA 1U8RA 4A3LJ 1W7PA 4LG3A 1ZAOA 4GRIA 1AU7A 2ME0A 1OGJA 4F92B 1R5NA 3ISXA 2W7ZA 4HWVA 1R5ID 5LRRA 4XIDA 1IW7F 2QWWA 3TBIA 1R1UA 4URRA 3FXRA 4IZZA 2D2WA 2AQEA 4B3GA 2CQQA 3OWTA 5HXBA 2K5CA 4YIRX 1ZH5A 3V4GA 1AIPA 1SD7A 2YSRA 5E18F 5E1WA 3WQZA 1QJVA 4MYTA 1K78A 2FF4A 1IXSB 3O8GA 3JRAA 2PECA 1XSXA 2EQRA 4XNFA 2V1NA 2ZC2A 4PJJA 4W97A 2E34A 3OOPA 2XNJA 5M5XJ 2L5QA 2X48A 2AXTC 3AVUA 4RLQA 3H36A 3B8YA 1W4MA 3S1NJ 2X4HA 2PIAA 1D8TA 4DGWB 2IOUG 4C43A 1ZLKA 3O2PE 3GLLA 2C2WA 2BM0A 3E1SA 4PJMA 3J7AY 4M1KA 1P9QC 3IAS2 2DERA 4Y52J 3QFCA 2E1BA 2FU4A 5FA6A 4Q4ZF 2P5LC 1YJNI 4LBYA 3J81Z 1T6ZA 1R1TA 5JHFA 3D0SA 4IHXA 5F27A 4XBFA 2KVOA 4FISA 1V55H 3S1QJ 4WZTA 3ASNH 5CQGA 1H8AC 9ANTA 3FBIB 4P2NA 1O3SA 2E1CA 1Z21A 1MNEA 1DQUA 2ELHA 5K7HA 1SD4A 1CLWA 1MMDA 2EJRA 4XKVA 3CCSI 2I5UA 1RI7A 4BYYA 2VBVA 1TQPA 1ZN2A 2JJ7A 4YFOA 5JI6A 4OM9A 4PSXA 5DDGA 2WA0A 1GDTA 2NTQA 1TYUA 3FK7A 2VKHA 1G59A 5DCFA 4OPSA 1UMKA 3KP5A 5CYVA 3F8BA 1U8BA 4JBAA 4B3FX 4HF0A 3MAJA 3ML6A 3RSNA 2VE9A 3X2QH 1JHFA 2DEUA 1OFDA 1BA5A 2D3LA 2ESNA 3VSTA 1RR8C 5HNFA 1QA3A 2EIKH 3ONUA 1N07A 1J09A 1J75A 3CPXA 2F2EA 4MEXF 4Y7NJ 3HG9A 1O7LA 1SAUA 4XLFA 3OY9A 2DOFA 1WPKA 5LRSA 3BH7B 3RIQA 1MNDA 4R71A 2M2EA 3OYNA 1E3HA 3OR1C 2UXNA 3MFKA 1CNFA 1AOYA 1VQ6I 3HPHA 1XMAA 3BR1A 2XB0X 1OGIA 1T38A 2W84A 4HX4A 2XKOA 3SUCA 2GZWA 2PFBA 3CDHA 1TYVA 1T0FA 2MH2A 1E64A 3F3XA 4BDYA 4TMTA 2GK7A 3M3YJ 1KZHA 5CVIA 1ZGJA 3VYSB 4A12A 1TYXA 3ZIAA 4H0EA 2PYGA 3ONYA 5ILUA 2ZTGA 2Z99A 3CLOA 4HQMA 2GJKA 1G4DA 5FO1A 3ERED 3DEWA 2H1KA 2K9LA 4E7JA 1QA6A 2XHKA 1HKSA 1QVGB 1PXZA 5CLSA 4UZEA 3C2GA 2HTJA 1PUFB 3KE2A 4ANJA 5GP9A 1ELOA 4OJ5A 5L3FA 2GIVA 3VEPA 2KDZA 1O8LA 4IL6C 3MMPA 4GO1A 1T6YA 2HFHA 1YE9A 5F4OA 3GVKA 1JKRC 2M9HA 1G3SA 2A05A 5FROA 3NEUA 4DJAA 2GXGA 1Y0RA 4WWCA 4I7HA 3R0JA 4A0YA 2C78A 1Q9SA 3BC8A 4G7ZF 3ZMZA 1OFCX 2VZLA 2ZBUA 1VQOB 1VQMB 2P81A 1LDJA 2E19A 2WB1A 2LKSA 4Z1MA 1UMQA 4U0VA 1A6QA 1VQ5B 4JX5A 2LY9A 1TNSA 3FXQA 4IX7A 3GTOJ 1JJ2B 2FBKA 1G8XA 1OQYA 5KAIC 2L7ZA 2XTYA 4UXNA 1O3RA 4Z4YA 2M45A 4A2UA 2DA5A 1APLC 2FBIA 2K27A 1K4TA 3IC7A 2VQHA 2YR2A 1G7RA 2INVA 2HOTA 3EETA 3BH4A 3KZIC 2A07F 2ZXJA 3WTYC 1NH3A 3TKYA 4L0ZB 4BE0A 3GUDA 3KZYA 4RCZA 4PJLA 2ZMEB 2Q6OA 3S1MJ 5C3EJ 3CMEI 3VOEA 5GV8A 2CRVA 2EBIA 2QXZA 3B6AA 3I58A 4E7SA 2BGJA 2FVGA 3A8KA 2X9DA 1YS6A 3ONQA 2NZMA 1FX0A 4B8XA 4GGGA 4BBSJ 1D1NA 2BM5A 1SVMA 1ETQA 3E5UA 4HLYA 2DTRA 2V1DA 1K8AD 4G8XA 1O8FA 3KEYA 1MNMC 1KCDA 2W4SA 3OS0A 2R7RA 2JIZA 4Q7JB 2K9MA 2PYHA 3WHCA 3A1YA 4UV9A 2WV1A 2L2OA 2DQRA 5K7FA 4ZYAA 2IW5A 1YO5C 1T56A 1YHQI 1O8KA 2OZUA 1JKQC 5A89A 3E6CC 1O8JA 3FM3A 2LSOA 3QFSA 4RCYA 2V26A 2V5IA 4YEJA 2CUEA 1PKVA 3BTJA 5LBQA 2PMDA 2V4DA 2EIMH 3E20A 2XZLA 1J0RA 1MKMA 3LVBA 2R7VA 2YX7A 1TW2A 5HDKA 4ZYHA 3Q0UA 5LHHA 2NVXJ 1BPLA 5JR3A 2V7QA 5HODA 5EZGA 2KKOA 1J5YA 1EP1B 1OFLA 3WTUC 2KMUA 1QG0A 2X8KA 3MVPA 1WFXA 4D5CA 4Z4VA 4YZXA 4OOIA 3ZMDA 3LO8A 2KPMA 4LLNA 4A3KJ 3EQOA 2MH9A 4PGHA 1OYYA 2VKDA 1L0OC 1IUFA 2QTZA 1D3YA 2CV0A 1HW1A 3ECHA 4C9YA 3E6BA 1L3LA 2MG4A 1ACIA 1VQ9B 2L9NA 5E3OA 4C2LA 4OOXA 1A04A 4BXUA 3OYMA 2XT4A 3KP6A 2JMWA 1ZREA 2XTXA 4DIQA 3H94A 1K78B 2D9RA 3NRVA 5IYDJ 1BM9A 1HLVA 1EP3B 5EJCA 1YYVA 2LDUA 1O57A 5GV7A 2R6HA 1R22A 4C2UA 5FFZA 1ZG3A 5IY5H 1TP4A 1TWFJ 2WY7Q 4ZZDA 2Y31A 1MMSA 5IYQA 3CMAB 1S0UA 2P8TA 2E5ZA 2GJRA 5D5UB 3DV8A 4TSFA 3GQ9A 2RN7A 2AHQA 2RAEA 1ETKA 4NK6A 2EPFA 1IUYA 2EV6A 1TBXA 5FFXA 3F22A 2FOWA 3ZQCA 4PAAA 2IA2A 1D8KA 2CC2A 2XIGA 4WF2A 3KIOA 3C3WA 4Y7CA 1F9NA 3I5UA 3E6MA 3RIRA 4ENKA 3W6VA 1E3OC 4PC7A 2O17A 3H9JA 3FHZA 4U0YA 2ETHA 2JUGA 2L4AA 3W2HA 4QLCU 1HW2A 2GQFA 1TWGJ 3QOEA 4A3CJ 1W87A 2LFBA 5K5QA 4QV2A 2YPRA 2QKLB 3AVXA 3KZZA 5D6EA 3LAPA 2CGPA 1ZG1A 1QGZA 4HG2A 3DU6A 1GUUA 2LKXA 2DPDA 3PUBA 2BXZA 2WTEA 2QGUA 4LOCA 4EM2A 2BGIA 2W7NA 1BI1A 3FMSA 3QU3A 4FE7A 2F5FA 4OJPA 3SQVA 4RD3A 4RM2A 1HA3A 2R7QA 1E17A 1WJ5A 5GPAA 2KIUA 2OTLI 4ROXA 2KJBA 3JW4A 5ERIA 2L54A 3I9V2 5B6IA 3WTZA 2XT2A 5KW9A 1K61A 1I18A 2L4MA 2IAIA 2MW8A 2JZYA 4LITA 1O88A 1X1CA 3J7ZI 3VPRA 2IA0A 5EG0B 2LD5A 4PFOA 3R4KA 3HSEA 1O4XA 1W34A 2DA1A 4RDKA 5IYBJ 3K2ZA 5LGTA 4N3NA 1VQLB 4HLXA 1GXPA 3OYIA 3ZZ0A 4L18B 1O3QA 2HDDA 4BACA 2CBXA 2O0WA 2XGCA 3PUMA 4B3XA 4O6JA 1OHHA 3MD2A 3OZUA 1KTVA 3CC4I 4NC6A 4KKUA 2Y9YA 3HHGA 1WJCA 3E6DA 3S15J 3PUNA 1K83J 3HOUJ 4D9JA 1D0YA 3ESWB 3JQRA 1D1BA 3OKXA 2L01A 1UB9A 4CYDA 2E35A 1HSJA 4EJWA 3SJZA 2QEXI 3HSFA 5DS9A 2GWRA 5B3SH 2D3NA 4ZCIA 2MC4A 5DM7F 1B72B 2MSYA 1J2XA 4WZKA 1N25A 2DI3A 4HNUA 3VMVA 4PMHA 1DUXC 4PCQA 4P26A 2QSFX 2NYXA 3S1RJ 1MJBA 2CSOA 3GZ5A 4J0QA 3SZGA 4C3JJ 1N08A 4X06A 1RU4A 3EUHA 2E2JJ 1HOMA 1QFZA 2BM1A 1IB4A 2ME6A 1WJFA 4NB5A 2CO5A 2DN0A 1XE1A 1TWCJ 1OCTC 4YAWA 3T56B 2ZXHA 4RDLA 2EZLA 4YFKF 2E1NA 2KRFA 4WZEA 1T95A 5D5XB 3QRFF 2VL8A 3A4CA 3CCVI 2VYQA 2Z8GA 3OYDA 4KMUX 2CH0A 1DDNA 2KJCA 3GW2A 3GRHA 4FXUA 4X05A 2LOOA 3AVWA 4LIUA 5TISC 5IYWA 2OV7A 1MJ9A 1ZELA 2HS5A 5HLHA 3PIPF 1FBSA 3CJTB 3CLQA 1SC7A 4X7FA 3IV5A 3HAGA 5JVGF 3A8JA 2M4KA 1FNMA 1EFTA 1BQEA 1TNTA 2K85A 5BS6A 4D7NA 4BE1A 3PUFA 1BC8C 2QN6A 4RAGA 4ZDOA 2VC1A 4RGXA 5HS9A 3SQNA 2EFPA 4HX8A 2OJED 3H3UA 2FE3A 4PGOA 2JA6J 4KNYA 1W5CC 4WX9A 2P6TA 1N78A 2XSJC 1JA0A 1V5GA 5GAEJ 3BDDA 2VODA 3BPVA 1KRHA 1NG7A 2M5SA 2XNDA 1K7AA 2CUFA 3HTSB 1IN6A 2WWYA 3G71B 2EFGA 1K9MD 1FNCA 3DQVC 4A3GJ 4P96A 4QFMA 3CMYA 1VQ9I 2M0MA 1ETYA 2HYFA 2WB1N 1IRGA 4N4OB 2CUZA 5ICCA 2A6TA 1I3AA 3N6ZA 1WJAA 3L2UA 1GJRA 3HRMA 3U1DA 2IBDA 2L0KA 3ZBTA 2XTWA 4K1XA 2F5VA 3IUOA 5IYNA 3H0DA 4P3IA 2L7MP 1I1SA 2FXAA 3B8HA 5F08A 1KU3A 1Y0UA 1NB9A 5E6TA 4I0AA 2R5YB 4QPOA 1U5TC 3I59A 2NAZA 2J5OA 1XSVA 2MBFA 1UHSA 2WBMA 4IF4A 2XROA 2W57A 1LPQA 4LC0A 4BS9A 4W8SA 2K4BA 2VBTA 3I53A 5H5JA 2JRMA 1D1CA 1RWRA 2OBRA 4G6QA 3GXOA 3I56B 2PMUA 2O6GE 1IA5A 3PNTA 2NT9A 3QPTA 2OAZA 2EIXA 2XGJA 3NB2A 2RREA 1QX4A 3A3GA 4RM0A 3E7LA 3BR2A 1NBMA 4XKCA 2Q2EA 3WY9A 1KQ5A 1SFKA 1W5TA 2QQ9A 1R71A 3HRUA 1YJWB 1VQKB 2B7EA 2A68F 1HKTA 1E3ZA 2W25A 1HBXG 2LTPA 1ZK8A 3WNDA 2O1DA 3ZMSA 4XRMA 4QHYA 2OA4A 4A5MA 4WK8F 2RC4A 1WH7A 4X7EA 4HX7A 5L3EA 1XCVA 1VQ8I 2PJRB 4G7XA 4R79A 1DGRM 3E5QA 3GEZA 4PGGA 3S16J 4BEHB 1UAAA 1BMFA 4B3AA 4IHWA 2C4TA 2OBPA 2F3LA 1BBYA 1UZCA 2DT6A 3CXCB 3FXKA 4P1VA 2NOGA 3Q9VA 4XLEA 3GCMA 4M9ZA 1IG7A 1VQKI 1USSA 5FB2A 1W0KA 1YIJI 5TV2A 1N75A 4HYEA 5GPCA 4M0LA 3UKGA 1S7OA 1YLFA 1SFUA 3GTQJ 1WGXA 1SM4A 5C1EA 2R93J 2NV4A 3FWEA 4Q5SF 3K1NA 1QZZA 1FX7A 3PFYA 5E3MA 1KK1A 5H20A 4YIFA 2O9LA 3K4BA 4IRGA 2OCEA 2XAQA 2ESHA 3REOA 5F0HA 4ABZA 4RDUA 4ENNA 4M74A 2IJLA 3TOAA 1CF7B 5TRDA 3ML3A 4XORA 4CH7A 5B1BH 3WTVC 3A02A 4IOCF 3QSYA 3MKLA 1UFMA 2LC2A 1I8DA 4IHSA 1DPRA 2VASA 1VF9A 1I39A 4HQEA 4OZZA 1STZA 1VF7A 1WOOA 2O6WA 2EFQA 3OPOA 1ZM9A 3BQYA 1KQ8A 4L9NA 5H6RA 2E7WA 3SZTA 4QWQA 5EEAA 3J81k 1U5TA 4FWTA 1WSRA 2TDXA 3BY1A 3K4NA 4AIJA 1QVTA 3O8HA 2L3DA 3GTGJ 4YAFA 3GWZA 2COBA 4B48A 4F7ZA 2HVSA 3CCJB 3GSIA 3F8NA 3OYCA 3H9NA 3HGGA 4ENJA 4P12A 5DN6A 1CNEA 2VJ4A 4B43A 1MH4A 1P4XA 1VLOA 4K2EA 3KL9A 2QZAA 4E4HA 5EGOA 2R7FA 2INUA 3L00A 5AIQA 2F5DA 1XDSA 3BY6A 5DS0A 1Z1DA 4OAZA 4Y13A 5EEGA 2HEOA 3WHBA 2BV3A 2D1HA 3LSIA 2ZZEA 2L9VA 1E43A 2XSDC 3U2QA 3CPWB 3ZPNA 3NQOA 5EEHA 2DCEA 2ZB9A 2HWVA 3M8EA 3DXJF 1OCPA 2EWEA 1TW3A 4WXHA 3T51B 4HDVA 1XX5A 1VQNI 3KEWA 1HF0A 1XPXA 2FRHA 4B4DA 4RS8A 4Y33A 2IVMA 3GTJJ 4A69C 3CCMI 5GTIC 2XPVA 5GAHJ 2JDIA 4HNVA 1UD4A 4X0CA 1KYWA 1LJ9A 4M3FA 1NJID 1OGMX 1PE9A 3DPLC 1X4PA 4BY1J 4LIVA 3KLNA 2XPWA 1J59A 2VJIA 1XCBA 2QQ8A 4HA8A 1SD6A 3UW0A 3VYTB 1QHHD 2ZO4A 1GVJA 3A01B 1IJWC 3L9FA 4IVNA 4EJVA 3J7YJ 2JJ2A 1HC8A 5A8AA 2WAEA 2DA7A 4GDFA 2QSGX 2JN9A 4V2FA 4J00A 1N0UA 3K70D 3BP8A 4IRIA 1ETXA 1EH6A 4YAOA 3JX8A 3BTLA 2DOEA 3MKYB 3TW7A 2IS2A 3PA2A 1S9HA 4EMSA 2K3FA 2WZPP 1WSVA 4G7HF 2DMPA 1SD5A 5KVRA 3TP3A 2IGNA 1G7SA 3CC7B 5JVTA 2ZJ2A 4TMWA 1FTTA 4OIPF 3JAMK 1JUSA 1V54H 2DXIA 2L9RA 4G6TB 2BY1A 3WGGA 3LSMA 3CO6C 4ZGQB 2QKMB 2VJ5A 3H9GA 3TH0A 2BV6A 4DOZA 3HDDA 1ONVA 3M7GA 3BQZA 1K28D 3ZQQA 2Q6IA 1E3XA 1EP2B 2ZBVA 5LD2C 2X1CA 3FK6A 1U2RA 3OJXA 3W2EA 1Z7UA 3BG3A 3FY3A 1EJ9A 2RKHA 2Z6BD 3AG3H 2A3SA 1EV7A 1I50J 4OWRB 2JA8J 2JSPA 3GZ6A 5BSXA 3ZR8X 3HIFA 1QGPA 1VZ0A 2X6YA 3DU5A 4UVBA 3U21A 4V2GA 5LHGA 3HJEA 3RKQA 1VHOA 4HF2A 1DDIA 4U87A 4M9SA 4OMYA 2WZNA 2ICWG 5JHUA 2JJ1A 2X3HA 3OV8A 1YS7A 5K5OA 1AA7A 5FD5A 4UUSA 3RI4A 1TT0A 3R6SA 3WNCA 1HDPA 3BJOA 2Y48A 3TQNA 1M1EB 3S2WA 1I6XA 3MCZA 4CUGA 3L2QA 2UVEA 4EW9A 5DD8A 4CCNA 1FOYA 4XMYA 3Q0VA 5J8CA 4A6EA 3KP4A 1LFPA 4LK1F 5FKOA 3NARA 5BMZA 2ZNYA 4QPQA 4L9TA 3HOSA 1FZPB 4F7DA 3BZCA 3Q3AA 2BOLA 1YOVB 5IPAA 2GXBA 1RZ4A 2PE3A 4FX4A 3PSZA 1W2BB 5IT9K 4QVAA 4BAYA 4I76A 1LQ1A 2PMHA 5IYPA 3G6EB 1ZM4A 3A0HC 1XS9A 1O8DA 2MLKA 2P0WA 4LK0F 3LQ6A 3CD6I 3W2VA 3SFZA 2ZCWA 2L7FP 1HA8A 1W35A 3F72A 4M2LA 3D5LA 4A5NA 2XRLA 2BXYA 3HUGB 3J80Z 4J01A 3L2WA 1JNYA 3HOTA 1JT6A 1ULYA 3OYHA 1UCRA 1UHMA 4KMFA 4BPRA 4ZYDA 3Q6RA 1KD1D 4RA2A 1ETVA 2X3UA 1U9OA 4EH1A 2EV0A 3H3ZA 3R61A 2LMDA 1R6RA 2B9SA 3H92A 4P6YA 4TKOB 4KT6A 5IT3A 3AAFA 4Q47A 4B4CA 1LVKA 3ZQIA 4AVZA 1IN5A 3OE7A 1RR7A 2DO7A 2XAHA 3DKXA 2ZNZA 2H1LA 5D8LB 3JQPA 5D5WB 1XGSA 3SDGA 1H8EA 1MZBA 2NVYJ 2JA7J 4MNUA 4RGUA 3RYRA 3CB4A 2OBSA 3J81K 1LFUP 2M30A 3SYTA 1IV6A 2VFPA 1JXSA 1FRQA 1B1BA 2R3SA 4XSZF 1XGOA 4XR6A 3GQ8A 4KYWA 1DBGA 4PJNA 2LVSA 1R9TJ 3W5HA 1IN8A 1TZLA 4DNRB 1I27A 4RD2A 2ZXWH 2E1MB 2YWEA 1EFUA 4OIRF 2QA4I 1Y0YA 4PC6A 5HZAA 1QRCA 3CQZJ 4M71A 2UZKA 1DP7P 4YZQA 4P1WA 2DIEA 1S5LC 2Z16A 4CO8A 1S4MA 2RC6A 3L1PA 3KEQA 4TV7A 4MR0A 1S7AA 1IGNA 2BSAA 3ULQB 4CCKA 1PYVA 3MEXA 2DFEA 2ZJQF 1ZGAA 5DCMB 3ASRA 4MTDA 1DARA 4N9IA 1UD5A 1S7EA 3IP4B 2Z9OA 2VONA 4ZGNB 3R0AA 2DCUA 3LWFA 2CWEA 2OPTA 1VLYA 3SFIA 1EZGA 4G9YA 4AM3A 1IDJA 2LP0A 2AHOA 3Q3SA 3SDBA 1FJLA 2RV8A 4C0SA 4DNCA 1U5TB 1QZYA 3SLNA 3F6VA 1JTXA 2NVQJ 1ZR4A 2EFOA 2BHYA 1T8IA 4XLHA 2FBHA 4QUZA 4Z4WA 1KQ9A 5HS7A 2LF8A 4A3IJ 1XG1A 3S2HJ 4HE5A 3CC4B 2UVFA 5LLQA 2C6YA 2W85A 3HKZN 3OMYA 4EJTA 2DOGA 5HZBA 1B6AA 5BQTA 1O8MA 2KZVA 4I6ZA 1REPC 2HYGD 3N97A 4HZFA 1RNLA 2PMZN 3OL3A 2GOXB 3CF5F 4Y17A 4I01A 4N9HA 3SJPA 1V4RA 2COMA 1Z77A 3D5RC 1NHAA 2A6EF 3BG6A 4H4KC 3OYGA 1F43A 3KPHA 2V7XA 2Y75A 2DW4A 4OINF 4AIDA 2NVTJ 2E36A 1SANA 2Y30A 2GA2A 3M1EA 1UG2A 4ZZLA 3ABKH 1N06A 3OAAA 1JHHA 1GLNA 5FLXK 1OMIA 2QEXB 2VB6A 1QZEA 3GTPJ 1E62A 1CZFA 4L5IA 2F5CA 3RZDJ 2R9VA 3EUKL 2QZ8A 1WPCA 3BT9A 3GBGA 2XGEA 1WP6A 3IWZA 1JGSA 4BJTA 1YI2I 1QFJA 3B82A 3FJOA 3FPKA 3MCAA 2QTLA 2F6CA 3CF2A 4DK1A 1TQIA 1SVLA 3P27A 2O8XA 2RGVA 1BC7C 4AIHA 1VQMI 2WJVA 1TTYA 4CQJA 3CJNA 4OOVA 2LZJA 1LFBA 3ZPLA 1U0JA 1F5TA 4KITB 1IXRC 3RYPA 3OYJA 2XF5A 4QVJA 3GQAA 5K5RA 3CUQB 1TL8A 1R5HA 3WG9A 2VBWA 1HDDC 3AG1H 2WPDA 3TMOA 1YIOA 3AG2H 1BLIA 1R36A 5KAFC 4M3DA 3A2KA 1VHEA 2EZIA 1OB5A 4RB2C 2VQLA 4KA4A 2W1OA 3FXMA 3A03A 3GMEA 2A61A 4OU0A 1QA1A 1WRJA 2ZMEA 5J35A 2ELJA 3HPGA 2BBYA 3LSKA 3ERMA 3MMYB 4EGYA 3F8CA 1RQRA 3HRTA 3TDUC 2K86A 4II3A 3K4MA 4B44A 3QPHA 1QVFB 3F9KA 1DP3A 5D4SA 3G6EI 2M8GX 4WWVA 3ES9A 3T53B 2HOAA 2VKVA 2P7VB 1WOSA 2LREA 4PFPA 3TEDA 2B0LA 4ACAA 2D1VA 4CZCA 1XC5A 1BN8A 4XRFA 1Q1HA 2DK8A 2FOKA 4EM1A 4D7MA 2J8KA 1T6SA 1ON2A 3IWFA 2F4NA 2O8KA 3JURA 1MBJA 1U9NA 3GF2A 1E0EA 1DU6A 5CPRB 3OW7A 3CD6B 2WV0A 4JX6A 1UD8A 1Z3YA 3KP2A 3P7NA 4A6DA 2E60A 1ZTRA 2V4JC 2V7TA 4ACBA 1P4AA 5FLXZ 1VI0A 2MA3A 1BI2A 2CFOA 2VT3A 3JSPA 2HVRA 1WCMJ 4HNTA 3WYAA 4Z6YA 4U7DA 5K1YA 3LL7A 3RDIA 2D5VA 4X1EA 2G9WA 2Z33A 4M72A 3K1PA 1BL0A 1SAXA 1S72B 4PUSA 2V1XA 4G6IA 3IRRA 2RNJA 4NC7A 4P9FA 2IT0A 1WU8A 1ZARA 1E3PA 1D0XA 2JSCA 4IPAA 4W8TA 1G3TA 3V8LA 4HE6A 2BY0A 1FWZA 4BDZA 2NNYA 4NC8A 3BR6A 2ACJA 1TYWA 3H9QA 3EYYA 4ESBA 3F21A 3T9GA 3FXJA 4CCJA 1JUMA 3G73A 4LFUA 2RDPA 2F43A 4RD6A 3BC9A 3BZ6A 4BQOA 1RIOH 5J6XA 1QQIA 2A6HF 3LJYA 3OS2A 3EQNA 3BG7A 3M07A 1GVDA 4XN0A 3O6BB 1U3EM 4TMXA 3PQKA 4OJ6A 4W8QA 5IP6A 1Y56A 2QBYA 2QQAA 2F1LA 3GVJA 2LY2A 5FD6A 2BY3A 4XOTA 2R5ZA 3W2IA 1IAWA 4II2A 3OYAA 2YWFA 3S2DJ 1ZYRF 3CC7I 1FEXA 4JP0A 1F4KA 4XLPF 1AKHA 2V7UA 5BSYA 4DNTB 2EINH 5KNLA 1BJKA 1WTHD 2M3AA 2O03A 2R4GA 1OYIA 4IRHA 3LAJA 4YHBA 4OPWA 4YCQA 4EM0B 1VQ8B 2RQPA 2FUG2 1TSPA 2M5WA 4HIZA 4XONA 2FJ1A 3CMEB 2D45A 4CCMA 2C77A 4NBQA 3OYEA 2VBUA 4IJAA 4I98B 2XC7A 1WXRA 4JOMA 2AQFA 1VQOI 3SYJA 1WHUA 2HNHA 1Q86D 4FQGA 3LSPA 2BVNA 1D1AA 4YFNF 2BZTA 3BJ6A 3BOQA 3NWTA 3BZKA 1DU0A 1SKYB 2ADUA 2FSWA 4Z2YA 2R7TA 3GFJA 1OLTA 1SMYF 5CKTA 2DMQA 3LSGA 3Q9SA 1H85A 1X1DA 3EPZA 2HQ5A 2KT0A 3S8PA 5HLIA 1UG0A 4OIQF 3MQ0A 3P9CA 5DSZA 4BJ6C 1ZGWA 1R1VA 3T8TA 1XTAA 2YU3A 4UUVA 2BMWA 5FKMA 2CNDA 1ZRFA 3BCFA 3OL4A 3GTMJ 2CW5A 1VQPI 4OIOF 2HTSA 1KU9A 1A36A 4XICA 1DBOA 3S14J 2QSHX 1R58A 3SKBA 1P2FA 4JYKA 2LK2A 3E5XA 1LE8B 1FNDA 1OFMA 2WADA 2BYVE 3R60A 1EH8A 2Y0SA 4FETA 4NQWA 3ASPA 1H88C 3VNUA 1MBKA 3WODF 3G3ZA 2Y69H 2K4JA 5H6QA 1YRNA 1XG2A 4Z4RA 1WZ2A 1MBHA 5CVVA 3A8IA 3OEEA 1OYWA 2MLGA 2G7HA 2I1LA 2EFWA 1VQ4B 5H59A 1NG6A 5AONA 4BJ5C 1JI8A 3V7RA 3E97A 3FKSA 3ROUA 1KK0A 2FQ4A 2PN6A 1FSEA 3IH3A 5FKLA 2XEXA 2OTJB 2QGGA 3OZWA 1YG2A 2W24A 2WR8A 3ZQLA 3HOYJ 3SXYA 3BROA 3DDYA 3S93A 3QU6A 4A0XA 4XK4A 3HL2A 1EF4A 4OPVA 3ZQGA 1PJ6A 3RPUA 5ILVA 4X7DA 2VQGA 1LM1A 4YG2F 3JR9A 2AO9A 4WXDA 1IN7A 3FXLA 2CW8A 3K0LA 2XGXA 5DUIA 2V7WA 4C3IJ 5E1XA 2HPMA 2H27A 3BH6B 1OB0A 5FLVA 2V7VA 1M1KD 4RBOA 2VLAA 2VBSA 2F4OB 2B0RA 1LEAA 4LJZF 4IHTA 5C4XJ 3E0JB 1IC8A 1IDKA 2WJYA 4S04A 3W2FA 3CCVB 2BSPA 2OTJI 5DM6F 3C18A 4MFDA 1FTZA 2V7FA 5L3DA 3TW6A 3PIOF 3FHNA 3RZOJ 2E7XA 1O8GA 4OZYA 3KYDB 2HDNB 4UV8A 5EYRA 4EQQA 1V3FA 1WKMA 3L09A 1DDGA 4FN5A 2P5KA 4I2OA 2IS1A 4YEIA 4AUXA 2KP6A 3OOCA 1ZG5A 2R7OA 4ITVA 4DZJA 2HDWA 4E6KG 2G0YA 1JTAA 5AIPA 4E7LA 1CF7A 2NSPA 3OYBA 1JUPA 3KLOA 3OOUA 2XZOA 1ZR2A 3K4LA 3H09A 4PK4A 5CJ9A 1EWYA 2XNCA 1YIJB 1WMRA 3T8RA 4OMZA 3ASQA 4UVCA 3GFIA 1EFRA 1R5BA 1QQ1A 2Q0OA 3H5RA 4N4NB 4LG0B 3OIPA 3GQ7A 3FKJA 3QPSA 3IRQA 1FYLA 2HKXA 3BTCA 5FKNA 4E7ZA 3DKYA 4KN7X 2E5NA 4CGZA 1JTYA 5F1RA 3NWSA 1E63A 3LSTA 3DEEA 2NRAC 1QNTA 1MBEA 3OYLA 4F55A 2ZTNA 2L7KA 3LA3A 4N0BA 2R7ZJ 2Z5UA 2ZFWA 3FX3A 5FO5A 3HBLA 1ETWA 1KMHA 4LBVA 3GIRA 4NNJA 4GFBA 3BR5A 5J47A 4FTHA 3TO9A 1AHDP 4ASUA 4JQFA 1YX5A 2XRNA 1ZLJA 1D5VA 1O8IA 2OK8A 5DTDA 3LFKA 1K79A 1QPIA 1OR7A 3COAC 4CZZA 1TWHJ 2V6CA 3FM5A 2GIZA 2IP2A 3Q0WA 3OYKA 1JE8A 4P3YA 2K40A 2VPRA 2CU7A 4FASD 3VSLA 4A3DJ 1T33A 1RESA 1W0TA 3RY8A 1P7JA 2CUJA 3SHFA 5J3OA 1X2MA 1F20A 3EUHC 3M1CA 1D0ZA 4PJ0C 3P9IA 4UZFA 2CYYA 3LSHA 4CSWA 3VO2A 1G3WA 1QPMA 3OS1A 1HF2A 1XN7A 3QP6A 3JAMZ 1GVHA 5ILSA 3P26A 1GAQA 2QYOA 1UELB 2JA2A 2R7WA 2ZKZA 1Y1WJ 4U7BA 1PUFA 2ZITA 1N77A 5HS8A 4DBRA 4BQAA 2GQQA 2RQQA 3EYIA 1T08B 2BM6A 3WU0A 2OYNA 3V7CA 1T98A 2DFIA 2H6BA 5J3LA 2E2HJ 2ISZA 4IQJA 4X07A 1HG8A 2VFQA 2OCCH 1MDMA 1QH0A 4DQ2A 2D74A 1Z05A 1X0CA 1KGSA 1ORKA 3U2RA 1B8IB 1WJDA 2FA5A 3AGQA 3CCUB 4E7HA 5M5YJ 3WTXC 1DPUA 2ID6A 4HBLA 2Q2EB 4M9XA 1M90D 3L7WA 1FP2A 2PG4A 1BJAA 1NK3P 4DQKA 1QRYA 2QBYB 1Z6TA 4CYCB 3R6KA 3PENA 2OZ6A 4L0YB 5FL7A 1KQ0A 1RC9A 2FEZA 1TLLA 2OQGA 5LFAA 4X6AJ 4UHTA 1E1QA 1JRGA 2Y0MA 4CCOA 3VR6A 4RGSA 3F6OA 2LYCA 3Q6QA 4BXXJ 3GFLA 4KJZA 2BHZA 4L5JA 1KA8A 2E1RA 4AU7A 5J4VA 1RUNA 3SZEA 3DF8A 2C5HA 4PSWA 2Y9ZA 5BOXA 2XASA 3BJAA 1WI3A 3L2VA 1FDRA 2NOJB 4IHYA 3DWLE 1PLUA 1U78A 4X0GA 2IS4A 1MW7A 2ID3A 3PSFA 2B5OA 3W2GA 1HXDA 3KX2A 3P4GA 3BCBA 1SVOA 1EKEA 3PO3J 4X8IA 1VQ7B 5J8FA 1OPCA 3OIOA 4LGWA 5KCMA 1WJBA 1YW7A 2FMLA 4I99C 3ZQ7A 4UUSB 1H9TA 3IAM2 4HPQA 5K7ZA 1BR2A 2HKOA 3FZVA 1TWAJ 5E20A 4YALA 3ZRGA 3JRFA 3PFIA 5KK1A 1UD2A 2OK7A 3K4KA 2Z1DA 4HOBA 1LNWA 3VDXA 3BR0A 2KFDA 5EF6A 5L46A 4P22A 3DCFA 3RTRA 3QODA 2BGCA 2XAJA 2TRTA 2HI3A 2DMUA 5F0FA 4ZYEA 2DA6A 2EFNA 3CJQB 1W0UA 1A5JA 3VSKA 1Y39A 4NDLA 4BKXA 1E2XA 3QYEA 1Y6IA 1V5FA 1V5VA 1VJSA 3I64A 3SEZA 3MZHA 1X1PA 2GREA 4RD1A 1K4SA 1F1ZA 4M73A 1D8JA 4IOAF 3S17J 2Q8KA 3G1MA 4DYQA 2NS7A 2ELKA 4ZJZA 1YRNB 1Y8RB 4WQMA 3VNVA 1S3JA 2VNHA 3LA7A 3W6JB 2HMAA 3GZNB 1FLIA 3E3VA 1GAWA 1MMNA 2BPOA 2XVCA 4M3EA 1FP1D 1OCOH 2H94A 3J7AO 2ZZFA 1EA0A 3PA1A 2BY2A 4YIIA 3U9GA 4FK8A 4I09A 5B5EC 3CCSB 3DBLB 1Z67A 4MHGA 3CJRB 2V9VA 3LMWA 1GXQA 1U2WA 4L9JA 1UHWA 1FNBA 2CMPA 1Q7YD 3G05A 1XQBA 1ZQ3P 4J19A 4EVIA 4UUTA 3PSIA 3F8FA 1R4NB 3V7SA 1N0VC 4TT3A 1DABA 4CICA 2V9PA 2X51A 1I3QJ 1X58A 2DDBA 3HHHA 1OJLA 5D6FA 5J1RA 2IRFG 3P9KA 3DU1X 4E70A 2R7XA 1GQ8A 3LNNA 3NAUA 1IRFA 4P9SA 1A6IA 2W48A 3CC2B 3DTEA 2DA3A 4ETSA 1WSUA 1KONA 3BG5A 2CQKA 5IYRA 4JMQA 1O8HA 3DPUA 3K1MA 5M3MJ 4GYIA 4XLCA 1GO2A 1BX0A 1B9NA 4EGZA 3V42A 1Z9CA 2TCTA 4R8HA 1IZ1A 3DKWA 2WY8Q 3ABMH 4A0ZA 4AIKA 4FCYA 3S3OA 1PP8F 1PJ7A 1H80A 3AFHA 4RAFA 4IKFA 3HGYA 4PC3A 4YDTA 2IA1A 3BPXA 2VUMJ 1IHMA 3CZ6A 4MLOA 4LB6B 1X3ZB 3H1CA 1G7TA 4AD9A 5C1CA 2X6WA 4Y4RA 3OYFA 1GV5A 4ZDPA 1ERDA 5CVJA 1V5EA 3CP2A 5B66C 2QF7A 2I8DA 1XGMA 4MYUA 2EWNA 2PI0A 3P5JA 2G0EA 2IQ7A 1FIAA 2PX9A 4ZYGA 4Z4SA 5JMCB 1NB0A 2VXDA 2X53S 3BY2A 2M0CA 3K69A 4W8RA 2UXXA 2EA2A 4WCGA 3ZBUA 3KETA 1TUIA 1KU2A 3IH4A 2EH3A 1SFOJ 5F1JA 4U49A 2ZL7A 1G7CA 2X1DA 4MGRA 4B1RA 4B09A 3JRDA 1QBJA 4TMZA 4OJLA 3T1BA 3OZVA 4XLNF 4FE4A 5GADJ 1BIBA 2FQ3A 1VFCA 1T2KA 4CXFA 2VNKA 1BJZA 5CDFA 2K9NA 2NTBA 3V76A 3MHPA 2QY1A 3JRCA 1H89C 1YW9A 2CFXA 2CF4A 5A88A 1NHCA 2Q6LA 1B72A 2XPUA 2QM3A 3ZN0A 3LMMA 4DZPA 3CCQI 1JKOC 4P6VF 3FBNB 1X4OA 2DJIA 3DBHB 3J80K 4AC0A 2YWHA 3WE2A 3WU1B 1BW5A 1KJZA 3TL4X 1NRKA 3VYUB 3HTUA 2HOEA 2VJJA 3FXOA 4IXAA 2GXAA 1JA1A 3CUOA 2DK5A 5LHIA 4AF7A 5HVQC 4Y3OA 1JB9A 2BW3A 4HSRA 3HOWJ 3V7AA 1ODDA 1HW5A 1ON1A 4OPOA 3CTAA 3IKVA 3TOBA 3S32A 4XL9A 1O8EA 1OCCH 4M4SA 4B47A 3VWBA 3SY2A 3D1NI 3WBKA 2KDOA 2VIXA 4BUPA 2P6SA 1EE6A 2XKPA 4UVAA 5J1UA 2IGMA 3RCOA 3UR3C 1V0FA 2ZZQA 3QFRA 4Z4ZA 4ZV4A 4RB3C 5DEQA 1KK3A 1VTNC 4MFEA 3QPLA 3G1OA 3QYBA 3CMMA 1TC3C 3C1DA 2UV1A 4IO9F 3NE5B 4NBSA 2JPBA 3DLLF 4OP7A 3FKIJ 4RD0A 2VBKA 2K9SA 4KT5C 4A3BJ 3DEUA 2K7LA 2WAQA 4E7IA 1FT9A 2Y2ZA 3IHUA 1H42A 2ECCA 1RETA 1P6RA 1XGNA 4YELA 5H2FC 3HZJA 5L3GA 5C44J 1ZUNB 5ICEA 1K8FA 3SEJA 2DA4A 2M8EA 3OJWA 3LQQA 1A8PA 2X0KA 4TN1A 3H0GJ 2KZGA 3JRBA 3QE2A 1R4MB 2NTPA 1MIJA 1FYMA 1USTA 1YLOA 1KTWA 5FO0A 5ICGA 2O5RA 5DD4A 2JA5J 5FRMA 4L8JA 1PVEA 3ZCOA 4KIBA 1QRBA 5EMNA 1EA3A 5TGTA 1W36D 4F91B 1BOBA 2XGDA 2ZJRF 3W5VA 3VYRB 3QQAA 2GBYA 3CESA 3M8JA 4BH9A 1BR1A 3AGPA 2X85A 3OR2C 2LKPA 1R5OA 3PETA 1MRZA 4QTRA 1H8HA 1SFXA 3N4MA 4NK8A 1MGTA 1PJ5A 1IJEA 2EZHA 3H5NA 3RQIA 4XRSG 1Z0XA 3W6KB 2Q6KA 4AYBA 3ZZUA 1X1BA 2X6XA 2UWMA 4Y15A 1JT0A 2HVQA 4CCLA 3CCLI 4UZUA 2KL4A 1IV8A 1COWA 3Q38A 1QGYA 3HKZA 2DT5A 4YFXF 1AMOA 4P25A 3GVAA 1R00A 1QCXA 2ZL6A 5F4MA 4YZAA 3HM5A 2O3FA 1IO2A 4JK1X 2VPLA 1P92A 3BR3A 4MEYF 4F3QA 2HPIA 4KH3A 3ZOBA 2R5YA 1W7PB 5EZHA 1IRZA 1T5EA 4G7WA 5F64A 4KN4X 1MSEC 3I59B 3GQBA 4YRVA 2F5EA 2M87A 4XOPA 3ZGKA 4BNCA 2R7SA 2FNAA 4S0HB 1LKXA 5IYCJ 3W2AA 1J9ZA 1KQSB 2EB7A 5M5WJ 5M3FJ 1OISA 2QUFA 5J40A 1YTYA 1XD7A 3CRZA 4UAJA 2MYSA 1RKTA 5J4YA 2QENA 2HQRA 2NXNB 2CV1A 4Z03A 5E79C 4NCNA 5ED4A 4QSHA 4AF6A 2BVMA 4BXFA 1AKHB 1DG1G 1R49A 2VBMA 3I4PA 3WE3A 3JTGA 3JU4A 5IOZA 2BF4A 2BE5F 5F0CA 2QYUA 4BEHA 1FRNA 2MD0A 2DJNA 4ESJA 1LVAA 4G6DA 2WYRA 1A35A 2STWA 2WAQN 3DBRB 3K4CA 3LNQA 3H5AA 1B23P 2DDAA 2ISYA 2XDVA 3OIQA 5HDNA 4F52A 3WTWC 1YHQB 1Z91A 3ASTA 3HYIA 2OD5A 2KRHA 2OBTA 2GAUA 1PJRA 1SFEA 3BTIA 2DBBA 2MGQA 3KYCB 1KYZA 4EJUA 1FOKA 3HOZJ 1KZLA 2XZPA 3KP3A 4ENMA 1YI2B 2KRCA 2DODA 1BI3A 2CK3A 3K6GA 5CVUA 1OFEA 3CO7C 2VOPA 5TY0A 2OQRA 2HCJB 2HLDA 2NNNA 4L9VA 2X1EA 1BOAA 4RB1A 2KHMA 2JT1A 1ZM2A 4KFCA 3RQ4A 3OEHA 4N3GA 1FBUA 4G5GA 3I4MJ 1FBQA 1I7PA 3MZYA 2BM4A 5E3NA 1FIPA 2PQ8A 5F04A 5LGUA 1YITB 4U0WA 5THXA 2K02A 2QX3A 4KICA 3RKXA 1T39A 1Q1VA 1BX1A 3AL0B 1RMGA 4FT8A 2RVCA 2QE7A 1RQPA 2DQLA 3ASSA 1YJ9B 2DETA 2GPJA 1I6HJ 3LQEA 3AVVA 1ZRDA 1QHGA 1LUJB 3A0BC 1SEUA 4U88A 2PEXA 5HDGA 3WGHA 3JSOA 3LYCA 2PMZA 3OFNA 3HSRA 1AWCA 2ZJPF 5JLXA 1TQMA 4XRSA 3GVLA 2KIQA 3LFUA 1RUOA 2PLFA 3D5SC 5LEJA 3A1PA 2GK6A 4G1BA 4IEJA 5EGOB 3IL2A 1MMGA 2EA4A 4Y9RA 5L3BA 2NVUB 2JVGA 3ZMVA 1MBGA 2WAFA 1LDDA 1JGGA 2DU9A 4UNOA 3PO2J 2FX0A 1WVRA 3K9TA 1K5CA 5FGMA 3W3CA 1DGWY 4Z4TA 5A2QZ 2XV4S 1G3YA 4XKBA 2ZXIA 2M4GA 4ON0A 2V79A 3HC7A 4EATA 1SKQA 3JRHA 1YJNB 4G94A 2VNIA 3FXUA 5B1AH 2DYIA 3FPPA 2NT6A 1H9GA 2BM7A 3BWGA 2E71A 4XD7A 1QUFA 3V8KA 3FIWA 1G6NA 4AVPA 2VKEA 4BBRJ 2QQBA 4C30A 1S8NA 1OCRH 2VBZA 4HRIA 1TTTA 1HVXA 4F93B 5TR9A 1VQ5I 5BPIA 5IK2A 1YITI 3I0TA 1GR1A 3A01A 4BL0B 2BW3B 2XC1A 3RPUD 2CW7A 4RB0A 3GX4X 2E1MC 3Q39A 3CUQC 1U6GA 2JPCA 1FYKA 1X3WB 1YQAA 3BCDA 2HQAA 3I55I 3G71I 3OP1A 1K73D 4DYRA 1Y1VJ 4PC1A 3ZPPA 5F6FA 1WQ2A 4MTEA 4HEA2 1P7IA 4BHCA 1PDNC 2HOSA 2YUHA 3ZMTA 2DYRH 3DTIA 1FNNA 1YFHA 3ABUA 4ZC3A 2C4UA 3TDZC 2FMYA 1QVUA 4RMNA 1I1GA 5HLTA 1NK2P 2GLOA 3CCRB 2W00A 4CHUA 4IW3B 2PJPA 1G2HA 4AWXB 1IJFA 1FMWA 1S6LA 1FY7A 2DOAA 5BNGA 4LB5A 4ZCLA 3S3NA 1B59A 4MO7A 5EG0A 1KK2A 2YWGA 1Q81D 1GT0C 3WU2C 4DQLA 1FOXA 1T0FC 2BVLA 2DAOA 1BI0A 5E17F 1EH7A 2NPFA 2EZKA 1KU7A 1JJ8C 2QVOA 3C2HA 1Z7LA 2M7AA 2V9KA 2X0LA 2QMUA 2W6JA 4A3FJ 2WSSA 2YS9A 1TLHB 3K10A 3ELKA 5DNSA 2EIJH 1Z3XA 2HGCA 2DPUA 2Y0SN 1L1IA 2IGKA 2VE8A 2HYJA 3VB2A 2BX6A 1KCCA 5D8KB 4LMYA 4UB8C 3TP0A 1XMKA 2J7KA 3LQRA 2GJPA 2V6EA 1UD6A 1WH5A 1VQ7I 4AC9A 1KC8D 2VFNA 3ISPA 1LEBA 3DLAA 3CDLA 2P3MA 3T0YA 3WNBA 1XB2A 2NS0A 2KLOA 5C4JJ 1VQ6B 3D26A 3KCCA 5JLVC 2CW0F 2R92J 2K9QA 3ZN1A 4OJOA 3GFMA 3M4OJ 4H9GA 2I10A 2C5BA 3ZSCA 4LLGF 1D2EA 5BPDA 3AK5A 1LDKB 3OSFA 2GA1A 3VSVA 4X7CA 4L5EA 4BQQA 2AXLA 2R7DA 3R6JA 4M3GA 5EDNA 1WOPA 1W7PD 1YX3A 3CCYA 4GXOA 1YJWI 1R5GA 1ZM3A 4ZCMA 4UY8I 4RAZA 1LE8A 3OW2B 1VBLA 4YAUA 2HXIA 4NQWB 1EFCA 1B8IA 2HZDA 2HDCA 4Z4UA 3A3BA 3PNVA 2Z2SB 4BU2A 3SEQA 1P4MA 1MBFA 1T6XA 3H3VK 2ZZGA 4OOSA 1MMAA 4FX0A 4O5VA 4D5FA 3ZXSA 3ZC3A 3F23A 2H8WA 1Q82D 2J8IA 3FMRA 2KQRA 2FNPA 4XKWA 2QLZA 2Z3YA 5ICFA 4XM3A 2H09A 3G4SI 3HUGA 4IQ4A 3HB9A 3B02A 2LBFB 2STTA 2CQXA 5GTHC 2JQ7A 3CCUI 3WTTC 1IDZA 1E1RA 4RPDA 1OOCA 3KP7A 4D1QA 3BQJA 3ASOH 1YJ9I 1XSDA 2JRTA 2ODLA 3DTKA 4V19K 4Z06A 4HDUA 2ZSIB 1QO0D 1W9XA 4HV5A 2J5PA 3HEFA 4M6VA 2O7OA 3ZMUA 1Z6RA 4RDJA 3GTKJ 1LB2A 2A5YB 4M53A 3HRSA 3F0CA 3VMFA 3K2AA 1FSHA 5FNZA 4M6YA 4ASNA 5LGNA 1K6YA 5JBQA 2LH9A 4MXNA 4DW6A 4FHTA 4G12A 1RPWA 1YX2A 5TJJA 2PBIA 2DYSH 4EV0A 1OKRA 1P4WA 5CQEA 3TGNA 4YZ0A 1D5YA 4XLAA 3MN2A 2O61A 2A5WA 1HKQA 3PL8A 4M3BA 3W2WA 1JJ6C 1QU3A 5E1ZB 1ITYA 1QUEA 5HLGA 2LG4A 4G1VA 3LSJA 5L3CA 3OSGA 1HQCA 5D5VB 3B78A 1J9IA 2NSTA 4JRAC 1B2RA 1MH3A 1WORA 1VQLI 4RLZA 5JLWA 4HW0A 2XF6A 1VQNB 3FISA 4UB6C 1ZHFA 5DCMA 2N8GA 3S3MA 3ZQHA 3B90A 1C0WA 2XAFA 2MABA 4NUBA 4I84A 2F1MA 4M6XA 3U1KA 3PJRA 1CQXA 3PNYA 4RGRA 3AKZA 4E0FA 2VXZA 2F4MB 4HSTA 3E1YE 4KKTA 2LF7A 2F4IA 4A3MJ 4LG0A 3KYLA 2O0VA 3RJPA 1FPQA 3C7JA 3GYHX 4Y9UA 2H6CA 1WWXA 3EDPA 4LLLA 1R7JA 1GHCA 4PC2A 3JREA 1K4ZA
chains in the Genus database with same CATH topology
3I3LA 2O17A 3DTEA 3N05A 3H9JA 3KRGA 1KONA 1OR7C 2OC6A 2JUGA 1X19A 2OUMA 4JMQA 1HZEA 1O8HA 3DPUA 3QOEA 4XLCA 4BGDA 4XLHA 3V42A 2QKLB 3S3OA 3BLYA 2WY8Q 1H80A 4BQNA 2UVFA 3AFHA 4IKFA 4HG2A 3DU6A 3MKWB 4C2TA 2LRDA 3PUBA 3CZ6A 4MLOA 2HU9A 3OMYA 4OJPA 3BCAA 2W7NA 1O8MA 5C1CA 2X6WA 2KZVA 4Y4RA 4RM2A 3OYFA 2R7QA 4ZDPA 1WJ5A 2PJRA 1V5EA 2IGOA 3OL3A 2GOXB 1ERDA 3CP2A 2I8DA 3I9V2 4H4KC 3D5RC 1WJEA 3BG6A 3OYGA 2IQ7A 1I18A 2K3PA 1AIRA 4LITA 3OAAA 1O88A 1X1CA 1GLNA 4CA0A 2X53S 2VXDA 4PFOA 4W8RA 2VB6A 1UD3A 1CZFA 2R9VA 3EUKL 1WPCA 5HNHA 3OYIA 3GBGA 2R7UA 4BACA 1WP6A 2O0WA 2UUZA 4B3XA 4BJTA 3DPTA 1OHHA 4U49A 3MD2A 4OJLA 2X1DA 2F6CA 3CF2A 4DK1A 4KKUA 1X1AA 2WJVA 5CDFA 3H35A 1WJCA 2LZJA 2ZSHB 4BE2A 1U0JA 4DBQA 2NTBA 4D9JA 1D0YA 2QY1A 4KITB 1D1BA 3OYJA 3GQAA 2XF5A 4U4BA 3UNGC 1NHCA 3LMMA 4KKSA 3FBNB 1X4OA 2DJIA 3TMOA 3G2BA 2WPDA 1BLIA 2D3NA 3A2KA 2MC4A 2IXSA 2VQLA 2W1OA 3TL4X 2VBEA 1NRKA 2LY1A 3VYUB 2ELJA 4HNUA 4DK0A 2VJJA 3HPGA 1MABA 4GQNA 3VMVA 4PMHA 3MMYB 3LSKA 2XOKA 5HVQC 4Y3OA 3AL0C 2BW3A 2V31A 1RU4A 4II3A 3K4MA 4HSRA 3SZGA 4B44A 3F9KA 1DP3A 1IB4A 3S32A 1WJFA 4XL9A 1O8EA 3T53B 2LREA 4PFPA 3T56B 4B47A 3VWBA 2ZXHA 4CZCA 1BN8A 2KDOA 2VIXA 4BUPA 3UR3C 1V0FA 2IGMA 3RCOA 1T95A 2ZZQA 2VL8A 3A4CA 3JURA 2Z8GA 3OYDA 3QYBA 1E0EA 2CH0A 3CMMA 3NE5B 2UV1A 5CPRB 3OW7A 4KISA 3GRHA 3A35A 4FXUA 2VBKA 1UD8A 1Z3YA 2LOOA 4LIUA 4ZTFA 3B90A 2OV7A 2E60A 1ZELA 2V4JC 3FDYA 4Z05A 2CFOA 2WAQA 4E7IA 2HVRA 4HNTA 3HAGA 5KHDA 3VMWA 2M4KA 3LL7A 2RNGA 2VQCA 4YELA 4PUSA 4G6IA 4NC7A 4BE1A 3VSUA 2ZFUA 1D0XA 1E79A 2NTPA 3EUAA 4ZDOA 4W8TA 1KTWA 2CV2A 2O5RA 5FRMA 4L8JA 5AMVA 3ZCOA 2M7BA 3CP8A 4YXWA 4BDZA 3MKZA 4ZTJA 1W0JA 4NC8A 1EA3A 5TGTA 3H9QA 1W36D 2XSJC 4XQFA 4F91B 1N78A 1V5GA 4CCJA 3T9GA 1BOBA 2CS3A 2F43A 5FRNA 5HKKA 3BC9A 1FMVA 1NG7A 4BQOA 2M5SA 3VYRB 2XNDA 3OS2A 3EQNA 3BG7A 3CESA 3M8JA 4XN0A 1BR1A 3K70C 3WWGA 2X85A 3OR2C 4OJ6A 4W8QA 3DQVC 4P5OA 4ZDLA 1Y56A 1H8HA 3GVJA 4NK8A 2LY2A 4XOTA 4RM3A 2M0MA 4II2A 3H5NA 2MFZA 3OYAA 2W6IA 4N4OB 4AYBA 2CUZA 1X1BA 2A6TA 2GOMA 2X6XA 1WJAA 3L2UA 1BR4A 4DNTB 2UWMA 5KNLA 2LBFA 2Q1ZB 2F5VA 2HVQA 3IUOA 4CCLA 4UZUA 2KL4A 3H0DA 2M3AA 2R4GA 1COWA 1WTHD 3HKZA 1QCXA 3K4JA 2FUG2 4QPOA 4YZAA 2WBMA 4E7KA 2VPLA 4XONA 4F3QA 4HIZA 2O04A 2HPIA 4BS9A 4CCMA 4G7WA 1T5EA 4W8SA 3OYEA 3GQBA 1D1CA 2XC7A 1RWRA 4JOMA 4RLFA 2AQFA 2IS6A 4YRVA 4XOPA 2HNHA 2XAUA 3ZGKA 2R7SA 3W2AA 3PNTA 1LKXA 3L2RA 2NT9A 2XGJA 1IA5A 4XN3A 1D1AA 2RREA 3QYFA 2XF7A 1V0EA 4OAYA 3A3GA 2DT7B 3NWTA 1SKYB 1NBMA 1OGOX 5HOOA 2MYSA 2JVHA 4XKCA 2R7TA 1SFKA 1OLTA 2W82A 5CKTA 2CV1A 4Z03A 3LSGA 1BHEA 1X1DA 3EPZA 3S8PA 2BVMA 1E3ZA 4BXFA 1UG0A 2VBMA 2O1DA 4BJ6C 3JU4A 3HXLA 1IRXA 1W36C 3BCFA 4BEHA 2MD0A 3OL4A 2L9SA 2PJRB 4G7XA 4R79A 3B4NA 1DBOA 1DGRM 4BEHB 1UAAA 1BMFA 4LG3A 3K4CA 4GRIA 3H5AA 4F92B 1OFMA 4HWVA 2DT6A 2WADA 3TBIA 2Y0SA 4FETA 4XLEA 3OIQA 2XDVA 4URRA 4IZZA 4F52A 2AQEA 4B3GA 1XG2A 1W0KA 3OWTA 1N75A 2KRHA 1PJRA 2K5CA 2XZPA 3OEEA 1KZLA 1QJVA 3WQZA 5C1EA 2PECA 2KRCA 1NG6A 4XNFA 4BJ5C 2V1NA 3K6GA 4PJJA 1JI8A 3PFYA 2CK3A 3FKSA 2L5QA 4RLQA 2HLDA 2X1EA 3B8YA 3K4BA 2KHMA 3RQ4A 3OEHA 3DDYA 3S93A 4DGWB 3HL2A 4XORA 4CH7A 3E1SA 4PJMA 2VQGA 2QX3A 3J7AY 1P9QC 2LC2A 1I8DA 3IAS2 3AL0B 1RMGA 2VASA 2QE7A 2E1BA 4OZZA 2CW8A 1VF7A 1QHGA 2HPMA 3OPOA 1OB0A 5JHFA 2VLAA 2KVOA 2PMZA 3E0JB 3OFNA 1IDKA 5CQGA 2WJYA 3K4NA 2BSPA 3FBIB 2V7FA 4B48A 1Z21A 2HVSA 3FHNA 1O8GA 1MNEA 1DQUA 4OZYA 3GVLA 3LFUA 3D5SC 3OYCA 1MMDA 2GK6A 4XKVA 1MMGA 2IS1A 5DN6A 2VJ4A 4B43A 2KP6A 3OOCA 2R7OA 4ITVA 2HDWA 4E6KG 4E4HA 2JVGA 4PSXA 1JTAA 2WA0A 2WAFA 4E7LA 2INUA 3OYBA 2NSPA 2XZOA 3OOUA 2NTQA 3K4LA 4OAZA 4PK4A 2VKHA 3W3CA 1G59A 1WMRA 1K5CA 1DGWY 4B3FX 2ZZEA 3LSIA 1EFRA 4XKBA 2ZXIA 1E43A 3H5RA 3RSNA 2M4GA 4N4NB 4EATA 3HC7A 3ZPNA 2DCEA 3OIPA 3GQ7A 2NT6A 3FKJA 2D3LA 3FPPA 2EWEA 3VSTA 3T51B 4E7ZA 4XD7A 5HNFA 3DKYA 2E5NA 3KEWA 4Y33A 4C30A 1J09A 3NWSA 3DEEA 2JDIA 1UD4A 3OYLA 4HRIA 1OGMX 3HG9A 1SAUA 4F93B 4XLFA 4F55A 3OY9A 1HVXA 2L7KA 3DPLC 1X4PA 2ZTNA 5IK2A 1MNDA 1PE9A 3OYNA 4LIVA 3OR1C 1KMHA 4BL0B 2BW3B 4NNJA 3RPUD 2VJIA 2CW7A 4ASUA 2E1MC 4JQFA 3UW0A 1YX5A 3HPHA 1QHHD 3VYTB 1O8IA 3BCDA 2HQAA 2JJ2A 2WAEA 3SUCA 4J00A 3OYKA 3K70D 3ZPPA 4HEA2 4FASD 3VSLA 4BDYA 3MKYB 2IS2A 2GK7A 1S9HA 2CUJA 3VYSB 3DTIA 2WZPP 3ZIAA 2PYGA 3EUHC 3M1CA 1D0ZA 2ZTGA 4CSWA 3LSHA 2IGNA 4ZC3A 2GJKA 3OS1A 4RMNA 5HLTA 2K9LA 2DXIA 4E7JA 4G6TB 1PXZA 2W00A 3LSMA 2QKMB 2VJ5A 3H9GA 3C2GA 4DOZA 1FMWA 4ANJA 2DOAA 4OJ5A 1UELB 3S3NA 2JA2A 1O8LA 1K28D 3ZQQA 2R7WA 1YE9A 3GVKA 1E3XA 1T0FC 4U7BA 5LD2C 5FROA 2X1CA 4DJAA 2BVLA 1N77A 4DBRA 3FY3A 2RQQA 3BC8A 2Z6BD 2M7AA 1Z7LA 3C2HA 2V9KA 4IQJA 2W6JA 2WSSA 1HG8A 2WB1A 3K10A 4OWRB 4Z1MA 1X0CA 1Z3XA 2JSPA 3ZR8X 2IGKA 1WJDA 1VZ0A 1KCCA 2X6YA 3DU5A 4IX7A 3U21A 4E7HA 1G8XA 2Q2EB 2GJPA 4U87A 2V6EA 1UD6A 2VQHA 2INVA 2X3HA 2JJ1A 3DLAA 3BH4A 1AA7A 1TT0A 2KLOA 5FL7A 4OJOA 4BE0A 4CUGA 3L2QA 4EW9A 4PJLA 5LFAA 2UVEA 4CCNA 3ZSCA 1E1QA 1JRGA 4XMYA 4CCOA 3VR6A 2QXZA 1LDKB 4E7SA 1LFPA 2NZMA 2LYCA 3ONQA 3VSVA 4QPQA 1FX0A 3HOSA 4BQQA 4KJZA 2BOLA 4AU7A 1YX3A 4PSWA 1VBLA 3L2VA 4NQWB 1O8DA 2P0WA 2NOJB 2HZDA 1O8FA 3KEYA 1PLUA 3DWLE 1KCDA 3W2VA 2W4SA 3OS0A 3PNVA 2R7RA 2JIZA 2Z2SB 4BU2A 2K9MA 1MW7A 3SEQA 4X0GA 3PSFA 3A1YA 2IS4A 1HA8A 2L2OA 2PYHA 3KX2A 4ZYAA 2ZZGA 3D5LA 1MMAA 3BCBA 1O8KA 3HUGB 3ZXSA 4J01A 1O8JA 3L2WA 5KCMA 2KQRA 1WJBA 3HOTA 4XKWA 3OYHA 4XM3A 3IAM2 4HPQA 2V26A 4YEJA 1PKVA 1BR2A 4IQ4A 2LBFB 2V4DA 2XZLA 1EE6A 1OOCA 1E1RA 3ZRGA 2R7VA 4D1QA 1UD2A 3K4KA 1R6RA 2Z1DA 2ODLA 3DTKA 4TKOB 3VDXA 4KT6A 1BPLA 4Z06A 2ZSIB 4P22A 2V7QA 1LVKA 4AVZA 1W9XA 3RTRA 3QODA 3OE7A 3DKXA 1OFLA 3CJQB 2KMUA 3VSKA 2X8KA 1H8EA 1WFXA 4YZXA 3A3BA 2KPMA 3QYEA 1Y6IA 1V5FA 1VJSA 3EQOA 1K6YA 3SEZA 3SYTA 2LH9A 4MXNA 2VKDA 2CV0A 4XR6A 3GQ8A 1DBGA 4C9YA 4PJNA 4ZJZA 4C2LA 2L9NA 5CQEA 4YZ0A 1TZLA 4DNRB 4XLAA 3OYMA 2A5WA 3PL8A 3W2WA 1MMNA 2E1MB 1QU3A 4DIQA 3H94A 2LG4A 2ZZFA 2NSTA 4YZQA 4P1WA 2DIEA 2Z16A 2XF6A 4C2UA 3CJRB 3LMWA 3S3MA 4MR0A 2MABA 4NUBA 4I84A 2WY7Q 4CCKA 2F1MA 1PYVA 3PJRA 2CMPA 3PNYA 3AKZA 3G05A 2VXZA 4E0FA 2E5ZA 4HSTA 2GJRA 4KKTA 4TSFA 3GQ9A 2F4IA 3PSIA 1UD5A 4TT3A 3IP4B 3KYLA 4NK6A 2X51A 2O0VA 1VLYA 1IDJA 2R7XA 1GQ8A 3LNNA 3SDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6Y A;  4XOR A;  2O17 A;  2NTP A;  3KRG A;  4W8T A;  1KTW A;  2QX3 A;  1O8H A;  5AMV A;  1RMG A;  4OZZ A;  4XLC A;  2INV A;  2X3H A;  4XLH A;  1H80 A;  2UVF A;  3T9G A;  4XQF A;  4OJO A;  4EW9 A;  2UVE A;  3ZSC A;  1JRG A;  3EQN A;  4XMY A;  1IDK A;  4OJP A;  2QXZ A;  4XN0 A;  2BSP A;  2NZM A;  3WWG A;  1O8M A;  2X85 A;  4W8Q A;  2X6W A;  4OJ6 A;  3VSV A;  5C1C A;  1O8G A;  4OZY A;  4NK8 A;  4XOT A;  1VBL A;  4XKV A;  2IQ7 A;  1O8D A;  2X6X A;  1AIR A;  1O88 A;  1O8F A;  1PLU A;  2INU A;  1JTA A;  1KCD A;  2NSP A;  2PYH A;  4W8R A;  2NTQ A;  1K5C A;  1CZF A;  1QCX A;  1WMR A;  1O8K A;  4YZA A;  1O8J A;  2O04 A;  4XON A;  2O0W A;  4XKW A;  4W8S A;  4U49 A;  4XM3 A;  4OJL A;  3GQ7 A;  2NT6 A;  4YEJ A;  2EWE A;  1EE6 A;  1KCC A;  1RWR A;  1OOC A;  3VST A;  4XOP A;  1IA5 A;  2NT9 A;  2NTB A;  4XN3 A;  2ODL A;  2QY1 A;  1OGO X;  4Z06 A;  3GQA A;  1OGM X;  4AVZ A;  4U4B A;  4XLF A;  1PE9 A;  1NHC A;  1OFL A;  4Z03 A;  1BHE A;  2VJI A;  3UW0 A;  4YZX A;  1O8I A;  2VBM A;  2O1D A;  3EQO A;  2VBE A;  3SUC A;  4MXN A;  3ZPP A;  2VJJ A;  3VMV A;  4PMH A;  4XR6 A;  3GQ8 A;  1DBG A;  4C2L A;  1RU4 A;  4YZ0 A;  2PYG A;  4XLA A;  3B4N A;  1DBO A;  1IB4 A;  1O8E A;  4XL9 A;  1OFM A;  2NST A;  4HWV A;  1PXZ A;  4YZQ A;  1BN8 A;  4XLE A;  4URR A;  3LMW A;  4OJ5 A;  1XG2 A;  4MR0 A;  1O8L A;  4I84 A;  3JUR A;  2Z8G A;  1QJV A;  5C1E A;  3GRH A;  2PEC A;  2VBK A;  3FY3 A;  3GQ9 A;  3B90 A;  4XNF A;  4NK6 A;  4Z05 A;  2O0V A;  3VMW A;  1HG8 A;  3B8Y A;  4YEL A;  1IDJ A;  1X0C A;  1GQ8 A;  3VSU A; 
#chains in the Genus database with same CATH topology
 2KIM A;  2ZL5 A;  2G7U A;  2YUS A;  1CQT A;  3I3L A;  3QOP A;  1IF1 A;  4U9U A;  3ZZT A;  3CCE I;  3KRG A;  3N05 A;  3ABT A;  1ZKG A;  1OR7 C;  2OC6 A;  2KIS A;  1X19 A;  2OUM A;  3T5X A;  1GV2 A;  3MWM A;  1HZE A;  3I1F A;  3B6C A;  4BGD A;  4DYC A;  5D4R A;  3BLY A;  5FIU A;  3SZP A;  4WXC A;  4BQN A;  2E1O A;  4KDP A;  4NHJ A;  3JQQ A;  1UJ8 A;  2VBX A;  1BW6 A;  3MKW B;  3VO1 A;  4C2T A;  2JTV A;  2VBY A;  2LRD A;  4JX4 A;  5DYM A;  5IP9 J;  1LLW A;  1NDH A;  2HU9 A;  4V02 C;  2QDX A;  1ETO A;  3N90 A;  3BCA A;  3M9A A;  2A69 F;  2CG4 A;  4EEF G;  2PJR A;  3WGI A;  1Y0N A;  3LA2 A;  5FJ8 J;  3ZP5 A;  2IGO A;  5FKK A;  1LLZ A;  2ZBK A;  3WXM A;  4W1U A;  5FLM J;  3CCR I;  5E8I A;  1WJE A;  2XB5 A;  1J7K A;  2JWT A;  3EQL F;  2BEO A;  4O3M A;  2DFH A;  4S05 A;  2K3P A;  2P4W A;  1AIR A;  3TO6 A;  1B9M A;  3HOV J;  1RKW A;  4CA0 A;  1A31 A;  3I71 A;  2EIL H;  1PP7 U;  1UD3 A;  3BNW A;  1QGA A;  3W5U A;  1XFO A;  3GTL J;  2XUB A;  5HNH A;  3I54 A;  2R7U A;  3AVY A;  2JN6 A;  2ECB A;  3QWL A;  2DMT A;  1SMT A;  2PLY A;  5AN9 A;  2UUZ A;  1QA2 A;  2HQN A;  3DPT A;  1O7F A;  3ABL H;  2YU9 J;  4HF1 A;  4XSX F;  2FX3 A;  3WBJ A;  1MDM B;  1F60 A;  3O3K A;  1X1A A;  2B7B A;  3H35 A;  2JK3 A;  3VOD A;  2ZSH B;  4BE2 A;  3PSS A;  4DBQ A;  3WG7 H;  3FMQ A;  2M1B A;  1JKP C;  1W5S A;  2CQN A;  4U4B A;  4GYG A;  5IT9 Z;  4PDK A;  3UNG C;  1WDT A;  4CDG A;  1VQ4 I;  1WI9 A;  2P7C B;  2LNB A;  3CC2 I;  4KKS A;  1IDY A;  4CYC A;  2E2I J;  3G2B A;  5A2Q K;  3CUQ A;  4Q48 A;  3JRI A;  1MJA A;  4TMV A;  2IXS A;  1MD0 A;  4A3E J;  2VC0 A;  2X6O A;  2VBE A;  2VI6 A;  2IPQ X;  2LY1 A;  6PAX A;  1FC3 A;  4DK0 A;  1B4A A;  3PQJ A;  2OU2 A;  1PUE E;  1MAB A;  5IP7 J;  4GQN A;  3V8J A;  2XOK A;  4BHP A;  3QP5 A;  5JFR A;  2R0Q C;  3AL0 C;  2V31 A;  1TVC A;  4P55 A;  2JUC A;  2VOO A;  4GCV A;  4C2M J;  3F8M A;  3CCL B;  1O3T A;  3CCM B;  2VNJ A;  3PM1 A;  1NTC A;  2VFM A;  3SJM A;  4IHV A;  4LBZ A;  3RPQ A;  5E3L A;  3I56 I;  2FD5 A;  4BHB A;  3DFG A;  5DV5 A;  1N8R D;  4AYB N;  4G7O F;  2CQ7 A;  1R23 A;  4RPB A;  1K6O A;  2OF7 A;  4QIW N;  3HOX J;  4KIS A;  1Y8Q B;  3A35 A;  2OTL B;  4ZTF A;  1TT5 B;  3FDY A;  1MSF C;  4Z05 A;  3U6B A;  1POG A;  3VMW A;  5KHD A;  3QFT A;  1FOW A;  2LR8 A;  2RNG A;  3CDI A;  2VQC A;  4KIF A;  2NS8 A;  1OCZ H;  3VSU A;  3CCQ B;  2ZFU A;  3GLX A;  4HV6 A;  3ECO A;  1E79 A;  3EUA A;  4EJO A;  3DP7 A;  3TO7 A;  3QAH A;  2AS5 F;  2CV2 A;  3IH2 A;  5AMV A;  2BN4 A;  2M7B A;  4MQ9 F;  3CP8 A;  4KUM A;  4YXW A;  4C3H J;  1X2N A;  3ZUG A;  5J1Y A;  2YX4 A;  3KFW X;  3MKZ A;  4ZTJ A;  3LOC A;  1W0J A;  3NAW A;  3G4S B;  2MD5 A;  4PAB A;  3GO5 A;  2M34 A;  4XQF A;  2MC3 A;  1HST A;  2EK5 A;  1F36 A;  2DTZ A;  2CS3 A;  3LSR A;  5FRN A;  1I5Z A;  5HKK A;  1FMV A;  3L2C A;  4I02 A;  1X3U A;  1VQP B;  3PVD A;  2QA4 B;  3K70 C;  3WWG A;  1YW8 A;  4P5O A;  4ZDL A;  5DUK A;  2P5V A;  2DY1 A;  4A3J J;  2B63 J;  3BG9 A;  2O0Y A;  2RC5 A;  3MZ8 A;  4RM3 A;  3JRG A;  2CJJ A;  4YC5 A;  2HR3 A;  2W6I A;  2MFZ A;  5IOY A;  4RD4 A;  2V1U A;  2XAG A;  3CMA I;  2CRG A;  2GOM A;  2HZT A;  2LLK A;  4ZH4 F;  1BR4 A;  5CVR A;  2R5Z B;  1IB0 A;  2QCO A;  4KIG A;  4R1H A;  2LBF A;  2Q1Z B;  1ZRC A;  4P9U A;  2HXO A;  3I4N J;  3B73 A;  1S29 A;  3RKW A;  2L02 A;  2VN2 A;  4HAM A;  3K4J A;  3IKT A;  3CW2 A;  3M8F A;  3I55 B;  3C2B A;  4E7K A;  2O04 A;  3FF5 A;  3Q5F A;  2ZME C;  4PZJ A;  1EXM A;  1VND A;  4MIM A;  2F48 A;  3JTH A;  4RAY A;  4RLF A;  2DFF A;  2IS6 A;  1XDU A;  2KIF A;  2XAU A;  3G1L A;  4MQV A;  2B7C A;  4WZL A;  1XB4 A;  1OB2 A;  3L2R A;  1S72 I;  3SLD A;  4LD5 A;  3U6K A;  3CCE B;  4XN3 A;  5LEK A;  2EV5 A;  3QYF A;  2XF7 A;  1V0E A;  4OAY A;  2GM4 A;  3ZQF A;  2DT7 B;  4A93 J;  1N05 A;  4RJL A;  1OGO X;  5HOO A;  2VFO A;  2JVH A;  2VT2 A;  1RRJ A;  3KEO A;  1XMX A;  2H8R A;  1CGP A;  2W82 A;  3CCJ I;  4LBW A;  2WC2 A;  3AVT A;  5LMZ A;  1BHE A;  4BY7 J;  5GAG J;  1H0M A;  1BN5 A;  1HCR A;  2DMN A;  4ESF A;  1QFY A;  3AG4 H;  3K7A J;  4D0P A;  5E8G A;  1ENH A;  3RKY A;  3HXL A;  1IRX A;  2DA2 A;  2IEK A;  1W36 C;  5F4J A;  5KSW B;  4I0B A;  2L9S A;  3VFZ A;  3WTS C;  3JCU C;  3B4N A;  1IXC A;  1BIA A;  1W1W E;  1IN4 A;  2DLL A;  1U8R A;  4A3L J;  1W7P A;  4LG3 A;  1ZAO A;  4GRI A;  1AU7 A;  2ME0 A;  1OGJ A;  4F92 B;  1R5N A;  3ISX A;  2W7Z A;  4HWV A;  1R5I D;  5LRR A;  4XID A;  1IW7 F;  2QWW A;  3TBI A;  1R1U A;  4URR A;  3FXR A;  4IZZ A;  2D2W A;  2AQE A;  4B3G A;  2CQQ A;  3OWT A;  5HXB A;  2K5C A;  4YIR X;  1ZH5 A;  3V4G A;  1AIP A;  1SD7 A;  2YSR A;  5E18 F;  5E1W A;  3WQZ A;  1QJV A;  4MYT A;  1K78 A;  2FF4 A;  1IXS B;  3O8G A;  3JRA A;  2PEC A;  1XSX A;  2EQR A;  4XNF A;  2V1N A;  2ZC2 A;  4PJJ A;  4W97 A;  2E34 A;  3OOP A;  2XNJ A;  5M5X J;  2L5Q A;  2X48 A;  2AXT C;  3AVU A;  4RLQ A;  3H36 A;  3B8Y A;  1W4M A;  3S1N J;  2X4H A;  2PIA A;  1D8T A;  4DGW B;  2IOU G;  4C43 A;  1ZLK A;  3O2P E;  3GLL A;  2C2W A;  2BM0 A;  3E1S A;  4PJM A;  3J7A Y;  4M1K A;  1P9Q C;  3IAS 2;  2DER A;  4Y52 J;  3QFC A;  2E1B A;  2FU4 A;  5FA6 A;  4Q4Z F;  2P5L C;  1YJN I;  4LBY A;  3J81 Z;  1T6Z A;  1R1T A;  5JHF A;  3D0S A;  4IHX A;  5F27 A;  4XBF A;  2KVO A;  4FIS A;  1V55 H;  3S1Q J;  4WZT A;  3ASN H;  5CQG A;  1H8A C;  9ANT A;  3FBI B;  4P2N A;  1O3S A;  2E1C A;  1Z21 A;  1MNE A;  1DQU A;  2ELH A;  5K7H A;  1SD4 A;  1CLW A;  1MMD A;  2EJR A;  4XKV A;  3CCS I;  2I5U A;  1RI7 A;  4BYY A;  2VBV A;  1TQP A;  1ZN2 A;  2JJ7 A;  4YFO A;  5JI6 A;  4OM9 A;  4PSX A;  5DDG A;  2WA0 A;  1GDT A;  2NTQ A;  1TYU A;  3FK7 A;  2VKH A;  1G59 A;  5DCF A;  4OPS A;  1UMK A;  3KP5 A;  5CYV A;  3F8B A;  1U8B A;  4JBA A;  4B3F X;  4HF0 A;  3MAJ A;  3ML6 A;  3RSN A;  2VE9 A;  3X2Q H;  1JHF A;  2DEU A;  1OFD A;  1BA5 A;  2D3L A;  2ESN A;  3VST A;  1RR8 C;  5HNF A;  1QA3 A;  2EIK H;  3ONU A;  1N07 A;  1J09 A;  1J75 A;  3CPX A;  2F2E A;  4MEX F;  4Y7N J;  3HG9 A;  1O7L A;  1SAU A;  4XLF A;  3OY9 A;  2DOF A;  1WPK A;  5LRS A;  3BH7 B;  3RIQ A;  1MND A;  4R71 A;  2M2E A;  3OYN A;  1E3H A;  3OR1 C;  2UXN A;  3MFK A;  1CNF A;  1AOY A;  1VQ6 I;  3HPH A;  1XMA A;  3BR1 A;  2XB0 X;  1OGI A;  1T38 A;  2W84 A;  4HX4 A;  2XKO A;  3SUC A;  2GZW A;  2PFB A;  3CDH A;  1TYV A;  1T0F A;  2MH2 A;  1E64 A;  3F3X A;  4BDY A;  4TMT A;  2GK7 A;  3M3Y J;  1KZH A;  5CVI A;  1ZGJ A;  3VYS B;  4A12 A;  1TYX A;  3ZIA A;  4H0E A;  2PYG A;  3ONY A;  5ILU A;  2ZTG A;  2Z99 A;  3CLO A;  4HQM A;  2GJK A;  1G4D A;  5FO1 A;  3ERE D;  3DEW A;  2H1K A;  2K9L A;  4E7J A;  1QA6 A;  2XHK A;  1HKS A;  1QVG B;  1PXZ A;  5CLS A;  4UZE A;  3C2G A;  2HTJ A;  1PUF B;  3KE2 A;  4ANJ A;  5GP9 A;  1ELO A;  4OJ5 A;  5L3F A;  2GIV A;  3VEP A;  2KDZ A;  1O8L A;  4IL6 C;  3MMP A;  4GO1 A;  1T6Y A;  2HFH A;  1YE9 A;  5F4O A;  3GVK A;  1JKR C;  2M9H A;  1G3S A;  2A05 A;  5FRO A;  3NEU A;  4DJA A;  2GXG A;  1Y0R A;  4WWC A;  4I7H A;  3R0J A;  4A0Y A;  2C78 A;  1Q9S A;  3BC8 A;  4G7Z F;  3ZMZ A;  1OFC X;  2VZL A;  2ZBU A;  1VQO B;  1VQM B;  2P81 A;  1LDJ A;  2E19 A;  2WB1 A;  2LKS A;  4Z1M A;  1UMQ A;  4U0V A;  1A6Q A;  1VQ5 B;  4JX5 A;  2LY9 A;  1TNS A;  3FXQ A;  4IX7 A;  3GTO J;  1JJ2 B;  2FBK A;  1G8X A;  1OQY A;  5KAI C;  2L7Z A;  2XTY A;  4UXN A;  1O3R A;  4Z4Y A;  2M45 A;  4A2U A;  2DA5 A;  1APL C;  2FBI A;  2K27 A;  1K4T A;  3IC7 A;  2VQH A;  2YR2 A;  1G7R A;  2INV A;  2HOT A;  3EET A;  3BH4 A;  3KZI C;  2A07 F;  2ZXJ A;  3WTY C;  1NH3 A;  3TKY A;  4L0Z B;  4BE0 A;  3GUD A;  3KZY A;  4RCZ A;  4PJL A;  2ZME B;  2Q6O A;  3S1M J;  5C3E J;  3CME I;  3VOE A;  5GV8 A;  2CRV A;  2EBI A;  2QXZ A;  3B6A A;  3I58 A;  4E7S A;  2BGJ A;  2FVG A;  3A8K A;  2X9D A;  1YS6 A;  3ONQ A;  2NZM A;  1FX0 A;  4B8X A;  4GGG A;  4BBS J;  1D1N A;  2BM5 A;  1SVM A;  1ETQ A;  3E5U A;  4HLY A;  2DTR A;  2V1D A;  1K8A D;  4G8X A;  1O8F A;  3KEY A;  1MNM C;  1KCD A;  2W4S A;  3OS0 A;  2R7R A;  2JIZ A;  4Q7J B;  2K9M A;  2PYH A;  3WHC A;  3A1Y A;  4UV9 A;  2WV1 A;  2L2O A;  2DQR A;  5K7F A;  4ZYA A;  2IW5 A;  1YO5 C;  1T56 A;  1YHQ I;  1O8K A;  2OZU A;  1JKQ C;  5A89 A;  3E6C C;  1O8J A;  3FM3 A;  2LSO A;  3QFS A;  4RCY A;  2V26 A;  2V5I A;  4YEJ A;  2CUE A;  1PKV A;  3BTJ A;  5LBQ A;  2PMD A;  2V4D A;  2EIM H;  3E20 A;  2XZL A;  1J0R A;  1MKM A;  3LVB A;  2R7V A;  2YX7 A;  1TW2 A;  5HDK A;  4ZYH A;  3Q0U A;  5LHH A;  2NVX J;  1BPL A;  5JR3 A;  2V7Q A;  5HOD A;  5EZG A;  2KKO A;  1J5Y A;  1EP1 B;  1OFL A;  3WTU C;  2KMU A;  1QG0 A;  2X8K A;  3MVP A;  1WFX A;  4D5C A;  4Z4V A;  4YZX A;  4OOI A;  3ZMD A;  3LO8 A;  2KPM A;  4LLN A;  4A3K J;  3EQO A;  2MH9 A;  4PGH A;  1OYY A;  2VKD A;  1L0O C;  1IUF A;  2QTZ A;  1D3Y A;  2CV0 A;  1HW1 A;  3ECH A;  4C9Y A;  3E6B A;  1L3L A;  2MG4 A;  1ACI A;  1VQ9 B;  2L9N A;  5E3O A;  4C2L A;  4OOX A;  1A04 A;  4BXU A;  3OYM A;  2XT4 A;  3KP6 A;  2JMW A;  1ZRE A;  2XTX A;  4DIQ A;  3H94 A;  1K78 B;  2D9R A;  3NRV A;  5IYD J;  1BM9 A;  1HLV A;  1EP3 B;  5EJC A;  1YYV A;  2LDU A;  1O57 A;  5GV7 A;  2R6H A;  1R22 A;  4C2U A;  5FFZ A;  1ZG3 A;  5IY5 H;  1TP4 A;  1TWF J;  2WY7 Q;  4ZZD A;  2Y31 A;  1MMS A;  5IYQ A;  3CMA B;  1S0U A;  2P8T A;  2E5Z A;  2GJR A;  5D5U B;  3DV8 A;  4TSF A;  3GQ9 A;  2RN7 A;  2AHQ A;  2RAE A;  1ETK A;  4NK6 A;  2EPF A;  1IUY A;  2EV6 A;  1TBX A;  5FFX A;  3F22 A;  2FOW A;  3ZQC A;  4PAA A;  2IA2 A;  1D8K A;  2CC2 A;  2XIG A;  4WF2 A;  3KIO A;  3C3W A;  4Y7C A;  1F9N A;  3I5U A;  3E6M A;  3RIR A;  4ENK A;  3W6V A;  1E3O C;  4PC7 A;  2O17 A;  3H9J A;  3FHZ A;  4U0Y A;  2ETH A;  2JUG A;  2L4A A;  3W2H A;  4QLC U;  1HW2 A;  2GQF A;  1TWG J;  3QOE A;  4A3C J;  1W87 A;  2LFB A;  5K5Q A;  4QV2 A;  2YPR A;  2QKL B;  3AVX A;  3KZZ A;  5D6E A;  3LAP A;  2CGP A;  1ZG1 A;  1QGZ A;  4HG2 A;  3DU6 A;  1GUU A;  2LKX A;  2DPD A;  3PUB A;  2BXZ A;  2WTE A;  2QGU A;  4LOC A;  4EM2 A;  2BGI A;  2W7N A;  1BI1 A;  3FMS A;  3QU3 A;  4FE7 A;  2F5F A;  4OJP A;  3SQV A;  4RD3 A;  4RM2 A;  1HA3 A;  2R7Q A;  1E17 A;  1WJ5 A;  5GPA A;  2KIU A;  2OTL I;  4ROX A;  2KJB A;  3JW4 A;  5ERI A;  2L54 A;  3I9V 2;  5B6I A;  3WTZ A;  2XT2 A;  5KW9 A;  1K61 A;  1I18 A;  2L4M A;  2IAI A;  2MW8 A;  2JZY A;  4LIT A;  1O88 A;  1X1C A;  3J7Z I;  3VPR A;  2IA0 A;  5EG0 B;  2LD5 A;  4PFO A;  3R4K A;  3HSE A;  1O4X A;  1W34 A;  2DA1 A;  4RDK A;  5IYB J;  3K2Z A;  5LGT A;  4N3N A;  1VQL B;  4HLX A;  1GXP A;  3OYI A;  3ZZ0 A;  4L18 B;  1O3Q A;  2HDD A;  4BAC A;  2CBX A;  2O0W A;  2XGC A;  3PUM A;  4B3X A;  4O6J A;  1OHH A;  3MD2 A;  3OZU A;  1KTV A;  3CC4 I;  4NC6 A;  4KKU A;  2Y9Y A;  3HHG A;  1WJC A;  3E6D A;  3S15 J;  3PUN A;  1K83 J;  3HOU J;  4D9J A;  1D0Y A;  3ESW B;  3JQR A;  1D1B A;  3OKX A;  2L01 A;  1UB9 A;  4CYD A;  2E35 A;  1HSJ A;  4EJW A;  3SJZ A;  2QEX I;  3HSF A;  5DS9 A;  2GWR A;  5B3S H;  2D3N A;  4ZCI A;  2MC4 A;  5DM7 F;  1B72 B;  2MSY A;  1J2X A;  4WZK A;  1N25 A;  2DI3 A;  4HNU A;  3VMV A;  4PMH A;  1DUX C;  4PCQ A;  4P26 A;  2QSF X;  2NYX A;  3S1R J;  1MJB A;  2CSO A;  3GZ5 A;  4J0Q A;  3SZG A;  4C3J J;  1N08 A;  4X06 A;  1RU4 A;  3EUH A;  2E2J J;  1HOM A;  1QFZ A;  2BM1 A;  1IB4 A;  2ME6 A;  1WJF A;  4NB5 A;  2CO5 A;  2DN0 A;  1XE1 A;  1TWC J;  1OCT C;  4YAW A;  3T56 B;  2ZXH A;  4RDL A;  2EZL A;  4YFK F;  2E1N A;  2KRF A;  4WZE A;  1T95 A;  5D5X B;  3QRF F;  2VL8 A;  3A4C A;  3CCV I;  2VYQ A;  2Z8G A;  3OYD A;  4KMU X;  2CH0 A;  1DDN A;  2KJC A;  3GW2 A;  3GRH A;  4FXU A;  4X05 A;  2LOO A;  3AVW A;  4LIU A;  5TIS C;  5IYW A;  2OV7 A;  1MJ9 A;  1ZEL A;  2HS5 A;  5HLH A;  3PIP F;  1FBS A;  3CJT B;  3CLQ A;  1SC7 A;  4X7F A;  3IV5 A;  3HAG A;  5JVG F;  3A8J A;  2M4K A;  1FNM A;  1EFT A;  1BQE A;  1TNT A;  2K85 A;  5BS6 A;  4D7N A;  4BE1 A;  3PUF A;  1BC8 C;  2QN6 A;  4RAG A;  4ZDO A;  2VC1 A;  4RGX A;  5HS9 A;  3SQN A;  2EFP A;  4HX8 A;  2OJE D;  3H3U A;  2FE3 A;  4PGO A;  2JA6 J;  4KNY A;  1W5C C;  4WX9 A;  2P6T A;  1N78 A;  2XSJ C;  1JA0 A;  1V5G A;  5GAE J;  3BDD A;  2VOD A;  3BPV A;  1KRH A;  1NG7 A;  2M5S A;  2XND A;  1K7A A;  2CUF A;  3HTS B;  1IN6 A;  2WWY A;  3G71 B;  2EFG A;  1K9M D;  1FNC A;  3DQV C;  4A3G J;  4P96 A;  4QFM A;  3CMY A;  1VQ9 I;  2M0M A;  1ETY A;  2HYF A;  2WB1 N;  1IRG A;  4N4O B;  2CUZ A;  5ICC A;  2A6T A;  1I3A A;  3N6Z A;  1WJA A;  3L2U A;  1GJR A;  3HRM A;  3U1D A;  2IBD A;  2L0K A;  3ZBT A;  2XTW A;  4K1X A;  2F5V A;  3IUO A;  5IYN A;  3H0D A;  4P3I A;  2L7M P;  1I1S A;  2FXA A;  3B8H A;  5F08 A;  1KU3 A;  1Y0U A;  1NB9 A;  5E6T A;  4I0A A;  2R5Y B;  4QPO A;  1U5T C;  3I59 A;  2NAZ A;  2J5O A;  1XSV A;  2MBF A;  1UHS A;  2WBM A;  4IF4 A;  2XRO A;  2W57 A;  1LPQ A;  4LC0 A;  4BS9 A;  4W8S A;  2K4B A;  2VBT A;  3I53 A;  5H5J A;  2JRM A;  1D1C A;  1RWR A;  2OBR A;  4G6Q A;  3GXO A;  3I56 B;  2PMU A;  2O6G E;  1IA5 A;  3PNT A;  2NT9 A;  3QPT A;  2OAZ A;  2EIX A;  2XGJ A;  3NB2 A;  2RRE A;  1QX4 A;  3A3G A;  4RM0 A;  3E7L A;  3BR2 A;  1NBM A;  4XKC A;  2Q2E A;  3WY9 A;  1KQ5 A;  1SFK A;  1W5T A;  2QQ9 A;  1R71 A;  3HRU A;  1YJW B;  1VQK B;  2B7E A;  2A68 F;  1HKT A;  1E3Z A;  2W25 A;  1HBX G;  2LTP A;  1ZK8 A;  3WND A;  2O1D A;  3ZMS A;  4XRM A;  4QHY A;  2OA4 A;  4A5M A;  4WK8 F;  2RC4 A;  1WH7 A;  4X7E A;  4HX7 A;  5L3E A;  1XCV A;  1VQ8 I;  2PJR B;  4G7X A;  4R79 A;  1DGR M;  3E5Q A;  3GEZ A;  4PGG A;  3S16 J;  4BEH B;  1UAA A;  1BMF A;  4B3A A;  4IHW A;  2C4T A;  2OBP A;  2F3L A;  1BBY A;  1UZC A;  2DT6 A;  3CXC B;  3FXK A;  4P1V A;  2NOG A;  3Q9V A;  4XLE A;  3GCM A;  4M9Z A;  1IG7 A;  1VQK I;  1USS A;  5FB2 A;  1W0K A;  1YIJ I;  5TV2 A;  1N75 A;  4HYE A;  5GPC A;  4M0L A;  3UKG A;  1S7O A;  1YLF A;  1SFU A;  3GTQ J;  1WGX A;  1SM4 A;  5C1E A;  2R93 J;  2NV4 A;  3FWE A;  4Q5S F;  3K1N A;  1QZZ A;  1FX7 A;  3PFY A;  5E3M A;  1KK1 A;  5H20 A;  4YIF A;  2O9L A;  3K4B A;  4IRG A;  2OCE A;  2XAQ A;  2ESH A;  3REO A;  5F0H A;  4ABZ A;  4RDU A;  4ENN A;  4M74 A;  2IJL A;  3TOA A;  1CF7 B;  5TRD A;  3ML3 A;  4XOR A;  4CH7 A;  5B1B H;  3WTV C;  3A02 A;  4IOC F;  3QSY A;  3MKL A;  1UFM A;  2LC2 A;  1I8D A;  4IHS A;  1DPR A;  2VAS A;  1VF9 A;  1I39 A;  4HQE A;  4OZZ A;  1STZ A;  1VF7 A;  1WOO A;  2O6W A;  2EFQ A;  3OPO A;  1ZM9 A;  3BQY A;  1KQ8 A;  4L9N A;  5H6R A;  2E7W A;  3SZT A;  4QWQ A;  5EEA A;  3J81 k;  1U5T A;  4FWT A;  1WSR A;  2TDX A;  3BY1 A;  3K4N A;  4AIJ A;  1QVT A;  3O8H A;  2L3D A;  3GTG J;  4YAF A;  3GWZ A;  2COB A;  4B48 A;  4F7Z A;  2HVS A;  3CCJ B;  3GSI A;  3F8N A;  3OYC A;  3H9N A;  3HGG A;  4ENJ A;  4P12 A;  5DN6 A;  1CNE A;  2VJ4 A;  4B43 A;  1MH4 A;  1P4X A;  1VLO A;  4K2E A;  3KL9 A;  2QZA A;  4E4H A;  5EGO A;  2R7F A;  2INU A;  3L00 A;  5AIQ A;  2F5D A;  1XDS A;  3BY6 A;  5DS0 A;  1Z1D A;  4OAZ A;  4Y13 A;  5EEG A;  2HEO A;  3WHB A;  2BV3 A;  2D1H A;  3LSI A;  2ZZE A;  2L9V A;  1E43 A;  2XSD C;  3U2Q A;  3CPW B;  3ZPN A;  3NQO A;  5EEH A;  2DCE A;  2ZB9 A;  2HWV A;  3M8E A;  3DXJ F;  1OCP A;  2EWE A;  1TW3 A;  4WXH A;  3T51 B;  4HDV A;  1XX5 A;  1VQN I;  3KEW A;  1HF0 A;  1XPX A;  2FRH A;  4B4D A;  4RS8 A;  4Y33 A;  2IVM A;  3GTJ J;  4A69 C;  3CCM I;  5GTI C;  2XPV A;  5GAH J;  2JDI A;  4HNV A;  1UD4 A;  4X0C A;  1KYW A;  1LJ9 A;  4M3F A;  1NJI D;  1OGM X;  1PE9 A;  3DPL C;  1X4P A;  4BY1 J;  4LIV A;  3KLN A;  2XPW A;  1J59 A;  2VJI A;  1XCB A;  2QQ8 A;  4HA8 A;  1SD6 A;  3UW0 A;  3VYT B;  1QHH D;  2ZO4 A;  1GVJ A;  3A01 B;  1IJW C;  3L9F A;  4IVN A;  4EJV A;  3J7Y J;  2JJ2 A;  1HC8 A;  5A8A A;  2WAE A;  2DA7 A;  4GDF A;  2QSG X;  2JN9 A;  4V2F A;  4J00 A;  1N0U A;  3K70 D;  3BP8 A;  4IRI A;  1ETX A;  1EH6 A;  4YAO A;  3JX8 A;  3BTL A;  2DOE A;  3MKY B;  3TW7 A;  2IS2 A;  3PA2 A;  1S9H A;  4EMS A;  2K3F A;  2WZP P;  1WSV A;  4G7H F;  2DMP A;  1SD5 A;  5KVR A;  3TP3 A;  2IGN A;  1G7S A;  3CC7 B;  5JVT A;  2ZJ2 A;  4TMW A;  1FTT A;  4OIP F;  3JAM K;  1JUS A;  1V54 H;  2DXI A;  2L9R A;  4G6T B;  2BY1 A;  3WGG A;  3LSM A;  3CO6 C;  4ZGQ B;  2QKM B;  2VJ5 A;  3H9G A;  3TH0 A;  2BV6 A;  4DOZ A;  3HDD A;  1ONV A;  3M7G A;  3BQZ A;  1K28 D;  3ZQQ A;  2Q6I A;  1E3X A;  1EP2 B;  2ZBV A;  5LD2 C;  2X1C A;  3FK6 A;  1U2R A;  3OJX A;  3W2E A;  1Z7U A;  3BG3 A;  3FY3 A;  1EJ9 A;  2RKH A;  2Z6B D;  3AG3 H;  2A3S A;  1EV7 A;  1I50 J;  4OWR B;  2JA8 J;  2JSP A;  3GZ6 A;  5BSX A;  3ZR8 X;  3HIF A;  1QGP A;  1VZ0 A;  2X6Y A;  3DU5 A;  4UVB A;  3U21 A;  4V2G A;  5LHG A;  3HJE A;  3RKQ A;  1VHO A;  4HF2 A;  1DDI A;  4U87 A;  4M9S A;  4OMY A;  2WZN A;  2ICW G;  5JHU A;  2JJ1 A;  2X3H A;  3OV8 A;  1YS7 A;  5K5O A;  1AA7 A;  5FD5 A;  4UUS A;  3RI4 A;  1TT0 A;  3R6S A;  3WNC A;  1HDP A;  3BJO A;  2Y48 A;  3TQN A;  1M1E B;  3S2W A;  1I6X A;  3MCZ A;  4CUG A;  3L2Q A;  2UVE A;  4EW9 A;  5DD8 A;  4CCN A;  1FOY A;  4XMY A;  3Q0V A;  5J8C A;  4A6E A;  3KP4 A;  1LFP A;  4LK1 F;  5FKO A;  3NAR A;  5BMZ A;  2ZNY A;  4QPQ A;  4L9T A;  3HOS A;  1FZP B;  4F7D A;  3BZC A;  3Q3A A;  2BOL A;  1YOV B;  5IPA A;  2GXB A;  1RZ4 A;  2PE3 A;  4FX4 A;  3PSZ A;  1W2B B;  5IT9 K;  4QVA A;  4BAY A;  4I76 A;  1LQ1 A;  2PMH A;  5IYP A;  3G6E B;  1ZM4 A;  3A0H C;  1XS9 A;  1O8D A;  2MLK A;  2P0W A;  4LK0 F;  3LQ6 A;  3CD6 I;  3W2V A;  3SFZ A;  2ZCW A;  2L7F P;  1HA8 A;  1W35 A;  3F72 A;  4M2L A;  3D5L A;  4A5N A;  2XRL A;  2BXY A;  3HUG B;  3J80 Z;  4J01 A;  3L2W A;  1JNY A;  3HOT A;  1JT6 A;  1ULY A;  3OYH A;  1UCR A;  1UHM A;  4KMF A;  4BPR A;  4ZYD A;  3Q6R A;  1KD1 D;  4RA2 A;  1ETV A;  2X3U A;  1U9O A;  4EH1 A;  2EV0 A;  3H3Z A;  3R61 A;  2LMD A;  1R6R A;  2B9S A;  3H92 A;  4P6Y A;  4TKO B;  4KT6 A;  5IT3 A;  3AAF A;  4Q47 A;  4B4C A;  1LVK A;  3ZQI A;  4AVZ A;  1IN5 A;  3OE7 A;  1RR7 A;  2DO7 A;  2XAH A;  3DKX A;  2ZNZ A;  2H1L A;  5D8L B;  3JQP A;  5D5W B;  1XGS A;  3SDG A;  1H8E A;  1MZB A;  2NVY J;  2JA7 J;  4MNU A;  4RGU A;  3RYR A;  3CB4 A;  2OBS A;  3J81 K;  1LFU P;  2M30 A;  3SYT A;  1IV6 A;  2VFP A;  1JXS A;  1FRQ A;  1B1B A;  2R3S A;  4XSZ F;  1XGO A;  4XR6 A;  3GQ8 A;  4KYW A;  1DBG A;  4PJN A;  2LVS A;  1R9T J;  3W5H A;  1IN8 A;  1TZL A;  4DNR B;  1I27 A;  4RD2 A;  2ZXW H;  2E1M B;  2YWE A;  1EFU A;  4OIR F;  2QA4 I;  1Y0Y A;  4PC6 A;  5HZA A;  1QRC A;  3CQZ J;  4M71 A;  2UZK A;  1DP7 P;  4YZQ A;  4P1W A;  2DIE A;  1S5L C;  2Z16 A;  4CO8 A;  1S4M A;  2RC6 A;  3L1P A;  3KEQ A;  4TV7 A;  4MR0 A;  1S7A A;  1IGN A;  2BSA A;  3ULQ B;  4CCK A;  1PYV A;  3MEX A;  2DFE A;  2ZJQ F;  1ZGA A;  5DCM B;  3ASR A;  4MTD A;  1DAR A;  4N9I A;  1UD5 A;  1S7E A;  3IP4 B;  2Z9O A;  2VON A;  4ZGN B;  3R0A A;  2DCU A;  3LWF A;  2CWE A;  2OPT A;  1VLY A;  3SFI A;  1EZG A;  4G9Y A;  4AM3 A;  1IDJ A;  2LP0 A;  2AHO A;  3Q3S A;  3SDB A;  1FJL A;  2RV8 A;  4C0S A;  4DNC A;  1U5T B;  1QZY A;  3SLN A;  3F6V A;  1JTX A;  2NVQ J;  1ZR4 A;  2EFO A;  2BHY A;  1T8I A;  4XLH A;  2FBH A;  4QUZ A;  4Z4W A;  1KQ9 A;  5HS7 A;  2LF8 A;  4A3I J;  1XG1 A;  3S2H J;  4HE5 A;  3CC4 B;  2UVF A;  5LLQ A;  2C6Y A;  2W85 A;  3HKZ N;  3OMY A;  4EJT A;  2DOG A;  5HZB A;  1B6A A;  5BQT A;  1O8M A;  2KZV A;  4I6Z A;  1REP C;  2HYG D;  3N97 A;  4HZF A;  1RNL A;  2PMZ N;  3OL3 A;  2GOX B;  3CF5 F;  4Y17 A;  4I01 A;  4N9H A;  3SJP A;  1V4R A;  2COM A;  1Z77 A;  3D5R C;  1NHA A;  2A6E F;  3BG6 A;  4H4K C;  3OYG A;  1F43 A;  3KPH A;  2V7X A;  2Y75 A;  2DW4 A;  4OIN F;  4AID A;  2NVT J;  2E36 A;  1SAN A;  2Y30 A;  2GA2 A;  3M1E A;  1UG2 A;  4ZZL A;  3ABK H;  1N06 A;  3OAA A;  1JHH A;  1GLN A;  5FLX K;  1OMI A;  2QEX B;  2VB6 A;  1QZE A;  3GTP J;  1E62 A;  1CZF A;  4L5I A;  2F5C A;  3RZD J;  2R9V A;  3EUK L;  2QZ8 A;  1WPC A;  3BT9 A;  3GBG A;  2XGE A;  1WP6 A;  3IWZ A;  1JGS A;  4BJT A;  1YI2 I;  1QFJ A;  3B82 A;  3FJO A;  3FPK A;  3MCA A;  2QTL A;  2F6C A;  3CF2 A;  4DK1 A;  1TQI A;  1SVL A;  3P27 A;  2O8X A;  2RGV A;  1BC7 C;  4AIH A;  1VQM I;  2WJV A;  1TTY A;  4CQJ A;  3CJN A;  4OOV A;  2LZJ A;  1LFB A;  3ZPL A;  1U0J A;  1F5T A;  4KIT B;  1IXR C;  3RYP A;  3OYJ A;  2XF5 A;  4QVJ A;  3GQA A;  5K5R A;  3CUQ B;  1TL8 A;  1R5H A;  3WG9 A;  2VBW A;  1HDD C;  3AG1 H;  2WPD A;  3TMO A;  1YIO A;  3AG2 H;  1BLI A;  1R36 A;  5KAF C;  4M3D A;  3A2K A;  1VHE A;  2EZI A;  1OB5 A;  4RB2 C;  2VQL A;  4KA4 A;  2W1O A;  3FXM A;  3A03 A;  3GME A;  2A61 A;  4OU0 A;  1QA1 A;  1WRJ A;  2ZME A;  5J35 A;  2ELJ A;  3HPG A;  2BBY A;  3LSK A;  3ERM A;  3MMY B;  4EGY A;  3F8C A;  1RQR A;  3HRT A;  3TDU C;  2K86 A;  4II3 A;  3K4M A;  4B44 A;  3QPH A;  1QVF B;  3F9K A;  1DP3 A;  5D4S A;  3G6E I;  2M8G X;  4WWV A;  3ES9 A;  3T53 B;  2HOA A;  2VKV A;  2P7V B;  1WOS A;  2LRE A;  4PFP A;  3TED A;  2B0L A;  4ACA A;  2D1V A;  4CZC A;  1XC5 A;  1BN8 A;  4XRF A;  1Q1H A;  2DK8 A;  2FOK A;  4EM1 A;  4D7M A;  2J8K A;  1T6S A;  1ON2 A;  3IWF A;  2F4N A;  2O8K A;  3JUR A;  1MBJ A;  1U9N A;  3GF2 A;  1E0E A;  1DU6 A;  5CPR B;  3OW7 A;  3CD6 B;  2WV0 A;  4JX6 A;  1UD8 A;  1Z3Y A;  3KP2 A;  3P7N A;  4A6D A;  2E60 A;  1ZTR A;  2V4J C;  2V7T A;  4ACB A;  1P4A A;  5FLX Z;  1VI0 A;  2MA3 A;  1BI2 A;  2CFO A;  2VT3 A;  3JSP A;  2HVR A;  1WCM J;  4HNT A;  3WYA A;  4Z6Y A;  4U7D A;  5K1Y A;  3LL7 A;  3RDI A;  2D5V A;  4X1E A;  2G9W A;  2Z33 A;  4M72 A;  3K1P A;  1BL0 A;  1SAX A;  1S72 B;  4PUS A;  2V1X A;  4G6I A;  3IRR A;  2RNJ A;  4NC7 A;  4P9F A;  2IT0 A;  1WU8 A;  1ZAR A;  1E3P A;  1D0X A;  2JSC A;  4IPA A;  4W8T A;  1G3T A;  3V8L A;  4HE6 A;  2BY0 A;  1FWZ A;  4BDZ A;  2NNY A;  4NC8 A;  3BR6 A;  2ACJ A;  1TYW A;  3H9Q A;  3EYY A;  4ESB A;  3F21 A;  3T9G A;  3FXJ A;  4CCJ A;  1JUM A;  3G73 A;  4LFU A;  2RDP A;  2F43 A;  4RD6 A;  3BC9 A;  3BZ6 A;  4BQO A;  1RIO H;  5J6X A;  1QQI A;  2A6H F;  3LJY A;  3OS2 A;  3EQN A;  3BG7 A;  3M07 A;  1GVD A;  4XN0 A;  3O6B B;  1U3E M;  4TMX A;  3PQK A;  4OJ6 A;  4W8Q A;  5IP6 A;  1Y56 A;  2QBY A;  2QQA A;  2F1L A;  3GVJ A;  2LY2 A;  5FD6 A;  2BY3 A;  4XOT A;  2R5Z A;  3W2I A;  1IAW A;  4II2 A;  3OYA A;  2YWF A;  3S2D J;  1ZYR F;  3CC7 I;  1FEX A;  4JP0 A;  1F4K A;  4XLP F;  1AKH A;  2V7U A;  5BSY A;  4DNT B;  2EIN H;  5KNL A;  1BJK A;  1WTH D;  2M3A A;  2O03 A;  2R4G A;  1OYI A;  4IRH A;  3LAJ A;  4YHB A;  4OPW A;  4YCQ A;  4EM0 B;  1VQ8 B;  2RQP A;  2FUG 2;  1TSP A;  2M5W A;  4HIZ A;  4XON A;  2FJ1 A;  3CME B;  2D45 A;  4CCM A;  2C77 A;  4NBQ A;  3OYE A;  2VBU A;  4IJA A;  4I98 B;  2XC7 A;  1WXR A;  4JOM A;  2AQF A;  1VQO I;  3SYJ A;  1WHU A;  2HNH A;  1Q86 D;  4FQG A;  3LSP A;  2BVN A;  1D1A A;  4YFN F;  2BZT A;  3BJ6 A;  3BOQ A;  3NWT A;  3BZK A;  1DU0 A;  1SKY B;  2ADU A;  2FSW A;  4Z2Y A;  2R7T A;  3GFJ A;  1OLT A;  1SMY F;  5CKT A;  2DMQ A;  3LSG A;  3Q9S A;  1H85 A;  1X1D A;  3EPZ A;  2HQ5 A;  2KT0 A;  3S8P A;  5HLI A;  1UG0 A;  4OIQ F;  3MQ0 A;  3P9C A;  5DSZ A;  4BJ6 C;  1ZGW A;  1R1V A;  3T8T A;  1XTA A;  2YU3 A;  4UUV A;  2BMW A;  5FKM A;  2CND A;  1ZRF A;  3BCF A;  3OL4 A;  3GTM J;  2CW5 A;  1VQP I;  4OIO F;  2HTS A;  1KU9 A;  1A36 A;  4XIC A;  1DBO A;  3S14 J;  2QSH X;  1R58 A;  3SKB A;  1P2F A;  4JYK A;  2LK2 A;  3E5X A;  1LE8 B;  1FND A;  1OFM A;  2WAD A;  2BYV E;  3R60 A;  1EH8 A;  2Y0S A;  4FET A;  4NQW A;  3ASP A;  1H88 C;  3VNU A;  1MBK A;  3WOD F;  3G3Z A;  2Y69 H;  2K4J A;  5H6Q A;  1YRN A;  1XG2 A;  4Z4R A;  1WZ2 A;  1MBH A;  5CVV A;  3A8I A;  3OEE A;  1OYW A;  2MLG A;  2G7H A;  2I1L A;  2EFW A;  1VQ4 B;  5H59 A;  1NG6 A;  5AON A;  4BJ5 C;  1JI8 A;  3V7R A;  3E97 A;  3FKS A;  3ROU A;  1KK0 A;  2FQ4 A;  2PN6 A;  1FSE A;  3IH3 A;  5FKL A;  2XEX A;  2OTJ B;  2QGG A;  3OZW A;  1YG2 A;  2W24 A;  2WR8 A;  3ZQL A;  3HOY J;  3SXY A;  3BRO A;  3DDY A;  3S93 A;  3QU6 A;  4A0X A;  4XK4 A;  3HL2 A;  1EF4 A;  4OPV A;  3ZQG A;  1PJ6 A;  3RPU A;  5ILV A;  4X7D A;  2VQG A;  1LM1 A;  4YG2 F;  3JR9 A;  2AO9 A;  4WXD A;  1IN7 A;  3FXL A;  2CW8 A;  3K0L A;  2XGX A;  5DUI A;  2V7W A;  4C3I J;  5E1X A;  2HPM A;  2H27 A;  3BH6 B;  1OB0 A;  5FLV A;  2V7V A;  1M1K D;  4RBO A;  2VLA A;  2VBS A;  2F4O B;  2B0R A;  1LEA A;  4LJZ F;  4IHT A;  5C4X J;  3E0J B;  1IC8 A;  1IDK A;  2WJY A;  4S04 A;  3W2F A;  3CCV B;  2BSP A;  2OTJ I;  5DM6 F;  3C18 A;  4MFD A;  1FTZ A;  2V7F A;  5L3D A;  3TW6 A;  3PIO F;  3FHN A;  3RZO J;  2E7X A;  1O8G A;  4OZY A;  3KYD B;  2HDN B;  4UV8 A;  5EYR A;  4EQQ A;  1V3F A;  1WKM A;  3L09 A;  1DDG A;  4FN5 A;  2P5K A;  4I2O A;  2IS1 A;  4YEI A;  4AUX A;  2KP6 A;  3OOC A;  1ZG5 A;  2R7O A;  4ITV A;  4DZJ A;  2HDW A;  4E6K G;  2G0Y A;  1JTA A;  5AIP A;  4E7L A;  1CF7 A;  2NSP A;  3OYB A;  1JUP A;  3KLO A;  3OOU A;  2XZO A;  1ZR2 A;  3K4L A;  3H09 A;  4PK4 A;  5CJ9 A;  1EWY A;  2XNC A;  1YIJ B;  1WMR A;  3T8R A;  4OMZ A;  3ASQ A;  4UVC A;  3GFI A;  1EFR A;  1R5B A;  1QQ1 A;  2Q0O A;  3H5R A;  4N4N B;  4LG0 B;  3OIP A;  3GQ7 A;  3FKJ A;  3QPS A;  3IRQ A;  1FYL A;  2HKX A;  3BTC A;  5FKN A;  4E7Z A;  3DKY A;  4KN7 X;  2E5N A;  4CGZ A;  1JTY A;  5F1R A;  3NWS A;  1E63 A;  3LST A;  3DEE A;  2NRA C;  1QNT A;  1MBE A;  3OYL A;  4F55 A;  2ZTN A;  2L7K A;  3LA3 A;  4N0B A;  2R7Z J;  2Z5U A;  2ZFW A;  3FX3 A;  5FO5 A;  3HBL A;  1ETW A;  1KMH A;  4LBV A;  3GIR A;  4NNJ A;  4GFB A;  3BR5 A;  5J47 A;  4FTH A;  3TO9 A;  1AHD P;  4ASU A;  4JQF A;  1YX5 A;  2XRN A;  1ZLJ A;  1D5V A;  1O8I A;  2OK8 A;  5DTD A;  3LFK A;  1K79 A;  1QPI A;  1OR7 A;  3COA C;  4CZZ A;  1TWH J;  2V6C A;  3FM5 A;  2GIZ A;  2IP2 A;  3Q0W A;  3OYK A;  1JE8 A;  4P3Y A;  2K40 A;  2VPR A;  2CU7 A;  4FAS D;  3VSL A;  4A3D J;  1T33 A;  1RES A;  1W0T A;  3RY8 A;  1P7J A;  2CUJ A;  3SHF A;  5J3O A;  1X2M A;  1F20 A;  3EUH C;  3M1C A;  1D0Z A;  4PJ0 C;  3P9I A;  4UZF A;  2CYY A;  3LSH A;  4CSW A;  3VO2 A;  1G3W A;  1QPM A;  3OS1 A;  1HF2 A;  1XN7 A;  3QP6 A;  3JAM Z;  1GVH A;  5ILS A;  3P26 A;  1GAQ A;  2QYO A;  1UEL B;  2JA2 A;  2R7W A;  2ZKZ A;  1Y1W J;  4U7B A;  1PUF A;  2ZIT A;  1N77 A;  5HS8 A;  4DBR A;  4BQA A;  2GQQ A;  2RQQ A;  3EYI A;  1T08 B;  2BM6 A;  3WU0 A;  2OYN A;  3V7C A;  1T98 A;  2DFI A;  2H6B A;  5J3L A;  2E2H J;  2ISZ A;  4IQJ A;  4X07 A;  1HG8 A;  2VFQ A;  2OCC H;  1MDM A;  1QH0 A;  4DQ2 A;  2D74 A;  1Z05 A;  1X0C A;  1KGS A;  1ORK A;  3U2R A;  1B8I B;  1WJD A;  2FA5 A;  3AGQ A;  3CCU B;  4E7H A;  5M5Y J;  3WTX C;  1DPU A;  2ID6 A;  4HBL A;  2Q2E B;  4M9X A;  1M90 D;  3L7W A;  1FP2 A;  2PG4 A;  1BJA A;  1NK3 P;  4DQK A;  1QRY A;  2QBY B;  1Z6T A;  4CYC B;  3R6K A;  3PEN A;  2OZ6 A;  4L0Y B;  5FL7 A;  1KQ0 A;  1RC9 A;  2FEZ A;  1TLL A;  2OQG A;  5LFA A;  4X6A J;  4UHT A;  1E1Q A;  1JRG A;  2Y0M A;  4CCO A;  3VR6 A;  4RGS A;  3F6O A;  2LYC A;  3Q6Q A;  4BXX J;  3GFL A;  4KJZ A;  2BHZ A;  4L5J A;  1KA8 A;  2E1R A;  4AU7 A;  5J4V A;  1RUN A;  3SZE A;  3DF8 A;  2C5H A;  4PSW A;  2Y9Z A;  5BOX A;  2XAS A;  3BJA A;  1WI3 A;  3L2V A;  1FDR A;  2NOJ B;  4IHY A;  3DWL E;  1PLU A;  1U78 A;  4X0G A;  2IS4 A;  1MW7 A;  2ID3 A;  3PSF A;  2B5O A;  3W2G A;  1HXD A;  3KX2 A;  3P4G A;  3BCB A;  1SVO A;  1EKE A;  3PO3 J;  4X8I A;  1VQ7 B;  5J8F A;  1OPC A;  3OIO A;  4LGW A;  5KCM A;  1WJB A;  1YW7 A;  2FML A;  4I99 C;  3ZQ7 A;  4UUS B;  1H9T A;  3IAM 2;  4HPQ A;  5K7Z A;  1BR2 A;  2HKO A;  3FZV A;  1TWA J;  5E20 A;  4YAL A;  3ZRG A;  3JRF A;  3PFI A;  5KK1 A;  1UD2 A;  2OK7 A;  3K4K A;  2Z1D A;  4HOB A;  1LNW A;  3VDX A;  3BR0 A;  2KFD A;  5EF6 A;  5L46 A;  4P22 A;  3DCF A;  3RTR A;  3QOD A;  2BGC A;  2XAJ A;  2TRT A;  2HI3 A;  2DMU A;  5F0F A;  4ZYE A;  2DA6 A;  2EFN A;  3CJQ B;  1W0U A;  1A5J A;  3VSK A;  1Y39 A;  4NDL A;  4BKX A;  1E2X A;  3QYE A;  1Y6I A;  1V5F A;  1V5V A;  1VJS A;  3I64 A;  3SEZ A;  3MZH A;  1X1P A;  2GRE A;  4RD1 A;  1K4S A;  1F1Z A;  4M73 A;  1D8J A;  4IOA F;  3S17 J;  2Q8K A;  3G1M A;  4DYQ A;  2NS7 A;  2ELK A;  4ZJZ A;  1YRN B;  1Y8R B;  4WQM A;  3VNV A;  1S3J A;  2VNH A;  3LA7 A;  3W6J B;  2HMA A;  3GZN B;  1FLI A;  3E3V A;  1GAW A;  1MMN A;  2BPO A;  2XVC A;  4M3E A;  1FP1 D;  1OCO H;  2H94 A;  3J7A O;  2ZZF A;  1EA0 A;  3PA1 A;  2BY2 A;  4YII A;  3U9G A;  4FK8 A;  4I09 A;  5B5E C;  3CCS B;  3DBL B;  1Z67 A;  4MHG A;  3CJR B;  2V9V A;  3LMW A;  1GXQ A;  1U2W A;  4L9J A;  1UHW A;  1FNB A;  2CMP A;  1Q7Y D;  3G05 A;  1XQB A;  1ZQ3 P;  4J19 A;  4EVI A;  4UUT A;  3PSI A;  3F8F A;  1R4N B;  3V7S A;  1N0V C;  4TT3 A;  1DAB A;  4CIC A;  2V9P A;  2X51 A;  1I3Q J;  1X58 A;  2DDB A;  3HHH A;  1OJL A;  5D6F A;  5J1R A;  2IRF G;  3P9K A;  3DU1 X;  4E70 A;  2R7X A;  1GQ8 A;  3LNN A;  3NAU A;  1IRF A;  4P9S A;  1A6I A;  2W48 A;  3CC2 B;  3DTE A;  2DA3 A;  4ETS A;  1WSU A;  1KON A;  3BG5 A;  2CQK A;  5IYR A;  4JMQ A;  1O8H A;  3DPU A;  3K1M A;  5M3M J;  4GYI A;  4XLC A;  1GO2 A;  1BX0 A;  1B9N A;  4EGZ A;  3V42 A;  1Z9C A;  2TCT A;  4R8H A;  1IZ1 A;  3DKW A;  2WY8 Q;  3ABM H;  4A0Z A;  4AIK A;  4FCY A;  3S3O A;  1PP8 F;  1PJ7 A;  1H80 A;  3AFH A;  4RAF A;  4IKF A;  3HGY A;  4PC3 A;  4YDT A;  2IA1 A;  3BPX A;  2VUM J;  1IHM A;  3CZ6 A;  4MLO A;  4LB6 B;  1X3Z B;  3H1C A;  1G7T A;  4AD9 A;  5C1C A;  2X6W A;  4Y4R A;  3OYF A;  1GV5 A;  4ZDP A;  1ERD A;  5CVJ A;  1V5E A;  3CP2 A;  5B66 C;  2QF7 A;  2I8D A;  1XGM A;  4MYU A;  2EWN A;  2PI0 A;  3P5J A;  2G0E A;  2IQ7 A;  1FIA A;  2PX9 A;  4ZYG A;  4Z4S A;  5JMC B;  1NB0 A;  2VXD A;  2X53 S;  3BY2 A;  2M0C A;  3K69 A;  4W8R A;  2UXX A;  2EA2 A;  4WCG A;  3ZBU A;  3KET A;  1TUI A;  1KU2 A;  3IH4 A;  2EH3 A;  1SFO J;  5F1J A;  4U49 A;  2ZL7 A;  1G7C A;  2X1D A;  4MGR A;  4B1R A;  4B09 A;  3JRD A;  1QBJ A;  4TMZ A;  4OJL A;  3T1B A;  3OZV A;  4XLN F;  4FE4 A;  5GAD J;  1BIB A;  2FQ3 A;  1VFC A;  1T2K A;  4CXF A;  2VNK A;  1BJZ A;  5CDF A;  2K9N A;  2NTB A;  3V76 A;  3MHP A;  2QY1 A;  3JRC A;  1H89 C;  1YW9 A;  2CFX A;  2CF4 A;  5A88 A;  1NHC A;  2Q6L A;  1B72 A;  2XPU A;  2QM3 A;  3ZN0 A;  3LMM A;  4DZP A;  3CCQ I;  1JKO C;  4P6V F;  3FBN B;  1X4O A;  2DJI A;  3DBH B;  3J80 K;  4AC0 A;  2YWH A;  3WE2 A;  3WU1 B;  1BW5 A;  1KJZ A;  3TL4 X;  1NRK A;  3VYU B;  3HTU A;  2HOE A;  2VJJ A;  3FXO A;  4IXA A;  2GXA A;  1JA1 A;  3CUO A;  2DK5 A;  5LHI A;  4AF7 A;  5HVQ C;  4Y3O A;  1JB9 A;  2BW3 A;  4HSR A;  3HOW J;  3V7A A;  1ODD A;  1HW5 A;  1ON1 A;  4OPO A;  3CTA A;  3IKV A;  3TOB A;  3S32 A;  4XL9 A;  1O8E A;  1OCC H;  4M4S A;  4B47 A;  3VWB A;  3SY2 A;  3D1N I;  3WBK A;  2KDO A;  2VIX A;  4BUP A;  2P6S A;  1EE6 A;  2XKP A;  4UVA A;  5J1U A;  2IGM A;  3RCO A;  3UR3 C;  1V0F A;  2ZZQ A;  3QFR A;  4Z4Z A;  4ZV4 A;  4RB3 C;  5DEQ A;  1KK3 A;  1VTN C;  4MFE A;  3QPL A;  3G1O A;  3QYB A;  3CMM A;  1TC3 C;  3C1D A;  2UV1 A;  4IO9 F;  3NE5 B;  4NBS A;  2JPB A;  3DLL F;  4OP7 A;  3FKI J;  4RD0 A;  2VBK A;  2K9S A;  4KT5 C;  4A3B J;  3DEU A;  2K7L A;  2WAQ A;  4E7I A;  1FT9 A;  2Y2Z A;  3IHU A;  1H42 A;  2ECC A;  1RET A;  1P6R A;  1XGN A;  4YEL A;  5H2F C;  3HZJ A;  5L3G A;  5C44 J;  1ZUN B;  5ICE A;  1K8F A;  3SEJ A;  2DA4 A;  2M8E A;  3OJW A;  3LQQ A;  1A8P A;  2X0K A;  4TN1 A;  3H0G J;  2KZG A;  3JRB A;  3QE2 A;  1R4M B;  2NTP A;  1MIJ A;  1FYM A;  1UST A;  1YLO A;  1KTW A;  5FO0 A;  5ICG A;  2O5R A;  5DD4 A;  2JA5 J;  5FRM A;  4L8J A;  1PVE A;  3ZCO A;  4KIB A;  1QRB A;  5EMN A;  1EA3 A;  5TGT A;  1W36 D;  4F91 B;  1BOB A;  2XGD A;  2ZJR F;  3W5V A;  3VYR B;  3QQA A;  2GBY A;  3CES A;  3M8J A;  4BH9 A;  1BR1 A;  3AGP A;  2X85 A;  3OR2 C;  2LKP A;  1R5O A;  3PET A;  1MRZ A;  4QTR A;  1H8H A;  1SFX A;  3N4M A;  4NK8 A;  1MGT A;  1PJ5 A;  1IJE A;  2EZH A;  3H5N A;  3RQI A;  4XRS G;  1Z0X A;  3W6K B;  2Q6K A;  4AYB A;  3ZZU A;  1X1B A;  2X6X A;  2UWM A;  4Y15 A;  1JT0 A;  2HVQ A;  4CCL A;  3CCL I;  4UZU A;  2KL4 A;  1IV8 A;  1COW A;  3Q38 A;  1QGY A;  3HKZ A;  2DT5 A;  4YFX F;  1AMO A;  4P25 A;  3GVA A;  1R00 A;  1QCX A;  2ZL6 A;  5F4M A;  4YZA A;  3HM5 A;  2O3F A;  1IO2 A;  4JK1 X;  2VPL A;  1P92 A;  3BR3 A;  4MEY F;  4F3Q A;  2HPI A;  4KH3 A;  3ZOB A;  2R5Y A;  1W7P B;  5EZH A;  1IRZ A;  1T5E A;  4G7W A;  5F64 A;  4KN4 X;  1MSE C;  3I59 B;  3GQB A;  4YRV A;  2F5E A;  2M87 A;  4XOP A;  3ZGK A;  4BNC A;  2R7S A;  2FNA A;  4S0H B;  1LKX A;  5IYC J;  3W2A A;  1J9Z A;  1KQS B;  2EB7 A;  5M5W J;  5M3F J;  1OIS A;  2QUF A;  5J40 A;  1YTY A;  1XD7 A;  3CRZ A;  4UAJ A;  2MYS A;  1RKT A;  5J4Y A;  2QEN A;  2HQR A;  2NXN B;  2CV1 A;  4Z03 A;  5E79 C;  4NCN A;  5ED4 A;  4QSH A;  4AF6 A;  2BVM A;  4BXF A;  1AKH B;  1DG1 G;  1R49 A;  2VBM A;  3I4P A;  3WE3 A;  3JTG A;  3JU4 A;  5IOZ A;  2BF4 A;  2BE5 F;  5F0C A;  2QYU A;  4BEH A;  1FRN A;  2MD0 A;  2DJN A;  4ESJ A;  1LVA A;  4G6D A;  2WYR A;  1A35 A;  2STW A;  2WAQ N;  3DBR B;  3K4C A;  3LNQ A;  3H5A A;  1B23 P;  2DDA A;  2ISY A;  2XDV A;  3OIQ A;  5HDN A;  4F52 A;  3WTW C;  1YHQ B;  1Z91 A;  3AST A;  3HYI A;  2OD5 A;  2KRH A;  2OBT A;  2GAU A;  1PJR A;  1SFE A;  3BTI A;  2DBB A;  2MGQ A;  3KYC B;  1KYZ A;  4EJU A;  1FOK A;  3HOZ J;  1KZL A;  2XZP A;  3KP3 A;  4ENM A;  1YI2 B;  2KRC A;  2DOD A;  1BI3 A;  2CK3 A;  3K6G A;  5CVU A;  1OFE A;  3CO7 C;  2VOP A;  5TY0 A;  2OQR A;  2HCJ B;  2HLD A;  2NNN A;  4L9V A;  2X1E A;  1BOA A;  4RB1 A;  2KHM A;  2JT1 A;  1ZM2 A;  4KFC A;  3RQ4 A;  3OEH A;  4N3G A;  1FBU A;  4G5G A;  3I4M J;  1FBQ A;  1I7P A;  3MZY A;  2BM4 A;  5E3N A;  1FIP A;  2PQ8 A;  5F04 A;  5LGU A;  1YIT B;  4U0W A;  5THX A;  2K02 A;  2QX3 A;  4KIC A;  3RKX A;  1T39 A;  1Q1V A;  1BX1 A;  3AL0 B;  1RMG A;  4FT8 A;  2RVC A;  2QE7 A;  1RQP A;  2DQL A;  3ASS A;  1YJ9 B;  2DET A;  2GPJ A;  1I6H J;  3LQE A;  3AVV A;  1ZRD A;  1QHG A;  1LUJ B;  3A0B C;  1SEU A;  4U88 A;  2PEX A;  5HDG A;  3WGH A;  3JSO A;  3LYC A;  2PMZ A;  3OFN A;  3HSR A;  1AWC A;  2ZJP F;  5JLX A;  1TQM A;  4XRS A;  3GVL A;  2KIQ A;  3LFU A;  1RUO A;  2PLF A;  3D5S C;  5LEJ A;  3A1P A;  2GK6 A;  4G1B A;  4IEJ A;  5EGO B;  3IL2 A;  1MMG A;  2EA4 A;  4Y9R A;  5L3B A;  2NVU B;  2JVG A;  3ZMV A;  1MBG A;  2WAF A;  1LDD A;  1JGG A;  2DU9 A;  4UNO A;  3PO2 J;  2FX0 A;  1WVR A;  3K9T A;  1K5C A;  5FGM A;  3W3C A;  1DGW Y;  4Z4T A;  5A2Q Z;  2XV4 S;  1G3Y A;  4XKB A;  2ZXI A;  2M4G A;  4ON0 A;  2V79 A;  3HC7 A;  4EAT A;  1SKQ A;  3JRH A;  1YJN B;  4G94 A;  2VNI A;  3FXU A;  5B1A H;  2DYI A;  3FPP A;  2NT6 A;  1H9G A;  2BM7 A;  3BWG A;  2E71 A;  4XD7 A;  1QUF A;  3V8K A;  3FIW A;  1G6N A;  4AVP A;  2VKE A;  4BBR J;  2QQB A;  4C30 A;  1S8N A;  1OCR H;  2VBZ A;  4HRI A;  1TTT A;  1HVX A;  4F93 B;  5TR9 A;  1VQ5 I;  5BPI A;  5IK2 A;  1YIT I;  3I0T A;  1GR1 A;  3A01 A;  4BL0 B;  2BW3 B;  2XC1 A;  3RPU D;  2CW7 A;  4RB0 A;  3GX4 X;  2E1M C;  3Q39 A;  3CUQ C;  1U6G A;  2JPC A;  1FYK A;  1X3W B;  1YQA A;  3BCD A;  2HQA A;  3I55 I;  3G71 I;  3OP1 A;  1K73 D;  4DYR A;  1Y1V J;  4PC1 A;  3ZPP A;  5F6F A;  1WQ2 A;  4MTE A;  4HEA 2;  1P7I A;  4BHC A;  1PDN C;  2HOS A;  2YUH A;  3ZMT A;  2DYR H;  3DTI A;  1FNN A;  1YFH A;  3ABU A;  4ZC3 A;  2C4U A;  3TDZ C;  2FMY A;  1QVU A;  4RMN A;  1I1G A;  5HLT A;  1NK2 P;  2GLO A;  3CCR B;  2W00 A;  4CHU A;  4IW3 B;  2PJP A;  1G2H A;  4AWX B;  1IJF A;  1FMW A;  1S6L A;  1FY7 A;  2DOA A;  5BNG A;  4LB5 A;  4ZCL A;  3S3N A;  1B59 A;  4MO7 A;  5EG0 A;  1KK2 A;  2YWG A;  1Q81 D;  1GT0 C;  3WU2 C;  4DQL A;  1FOX A;  1T0F C;  2BVL A;  2DAO A;  1BI0 A;  5E17 F;  1EH7 A;  2NPF A;  2EZK A;  1KU7 A;  1JJ8 C;  2QVO A;  3C2H A;  1Z7L A;  2M7A A;  2V9K A;  2X0L A;  2QMU A;  2W6J A;  4A3F J;  2WSS A;  2YS9 A;  1TLH B;  3K10 A;  3ELK A;  5DNS A;  2EIJ H;  1Z3X A;  2HGC A;  2DPU A;  2Y0S N;  1L1I A;  2IGK A;  2VE8 A;  2HYJ A;  3VB2 A;  2BX6 A;  1KCC A;  5D8K B;  4LMY A;  4UB8 C;  3TP0 A;  1XMK A;  2J7K A;  3LQR A;  2GJP A;  2V6E A;  1UD6 A;  1WH5 A;  1VQ7 I;  4AC9 A;  1KC8 D;  2VFN A;  3ISP A;  1LEB A;  3DLA A;  3CDL A;  2P3M A;  3T0Y A;  3WNB A;  1XB2 A;  2NS0 A;  2KLO A;  5C4J J;  1VQ6 B;  3D26 A;  3KCC A;  5JLV C;  2CW0 F;  2R92 J;  2K9Q A;  3ZN1 A;  4OJO A;  3GFM A;  3M4O J;  4H9G A;  2I10 A;  2C5B A;  3ZSC A;  4LLG F;  1D2E A;  5BPD A;  3AK5 A;  1LDK B;  3OSF A;  2GA1 A;  3VSV A;  4X7C A;  4L5E A;  4BQQ A;  2AXL A;  2R7D A;  3R6J A;  4M3G A;  5EDN A;  1WOP A;  1W7P D;  1YX3 A;  3CCY A;  4GXO A;  1YJW I;  1R5G A;  1ZM3 A;  4ZCM A;  4UY8 I;  4RAZ A;  1LE8 A;  3OW2 B;  1VBL A;  4YAU A;  2HXI A;  4NQW B;  1EFC A;  1B8I A;  2HZD A;  2HDC A;  4Z4U A;  3A3B A;  3PNV A;  2Z2S B;  4BU2 A;  3SEQ A;  1P4M A;  1MBF A;  1T6X A;  3H3V K;  2ZZG A;  4OOS A;  1MMA A;  4FX0 A;  4O5V A;  4D5F A;  3ZXS A;  3ZC3 A;  3F23 A;  2H8W A;  1Q82 D;  2J8I A;  3FMR A;  2KQR A;  2FNP A;  4XKW A;  2QLZ A;  2Z3Y A;  5ICF A;  4XM3 A;  2H09 A;  3G4S I;  3HUG A;  4IQ4 A;  3HB9 A;  3B02 A;  2LBF B;  2STT A;  2CQX A;  5GTH C;  2JQ7 A;  3CCU I;  3WTT C;  1IDZ A;  1E1R A;  4RPD A;  1OOC A;  3KP7 A;  4D1Q A;  3BQJ A;  3ASO H;  1YJ9 I;  1XSD A;  2JRT A;  2ODL A;  3DTK A;  4V19 K;  4Z06 A;  4HDU A;  2ZSI B;  1QO0 D;  1W9X A;  4HV5 A;  2J5P A;  3HEF A;  4M6V A;  2O7O A;  3ZMU A;  1Z6R A;  4RDJ A;  3GTK J;  1LB2 A;  2A5Y B;  4M53 A;  3HRS A;  3F0C A;  3VMF A;  3K2A A;  1FSH A;  5FNZ A;  4M6Y A;  4ASN A;  5LGN A;  1K6Y A;  5JBQ A;  2LH9 A;  4MXN A;  4DW6 A;  4FHT A;  4G12 A;  1RPW A;  1YX2 A;  5TJJ A;  2PBI A;  2DYS H;  4EV0 A;  1OKR A;  1P4W A;  5CQE A;  3TGN A;  4YZ0 A;  1D5Y A;  4XLA A;  3MN2 A;  2O61 A;  2A5W A;  1HKQ A;  3PL8 A;  4M3B A;  3W2W A;  1JJ6 C;  1QU3 A;  5E1Z B;  1ITY A;  1QUE A;  5HLG A;  2LG4 A;  4G1V A;  3LSJ A;  5L3C A;  3OSG A;  1HQC A;  5D5V B;  3B78 A;  1J9I A;  2NST A;  4JRA C;  1B2R A;  1MH3 A;  1WOR A;  1VQL I;  4RLZ A;  5JLW A;  4HW0 A;  2XF6 A;  1VQN B;  3FIS A;  4UB6 C;  1ZHF A;  5DCM A;  2N8G A;  3S3M A;  3ZQH A;  3B90 A;  1C0W A;  2XAF A;  2MAB A;  4NUB A;  4I84 A;  2F1M A;  4M6X A;  3U1K A;  3PJR A;  1CQX A;  3PNY A;  4RGR A;  3AKZ A;  4E0F A;  2VXZ A;  2F4M B;  4HST A;  3E1Y E;  4KKT A;  2LF7 A;  2F4I A;  4A3M J;  4LG0 A;  3KYL A;  2O0V A;  3RJP A;  1FPQ A;  3C7J A;  3GYH X;  4Y9U A;  2H6C A;  1WWX A;  3EDP A;  4LLL A;  1R7J A;  1GHC A;  4PC2 A;  3JRE A;  1K4Z A; 
#chains in the Genus database with same CATH homology
 3I3L A;  2O17 A;  3DTE A;  3N05 A;  3H9J A;  3KRG A;  1KON A;  1OR7 C;  2OC6 A;  2JUG A;  1X19 A;  2OUM A;  4JMQ A;  1HZE A;  1O8H A;  3DPU A;  3QOE A;  4XLC A;  4BGD A;  4XLH A;  3V42 A;  2QKL B;  3S3O A;  3BLY A;  2WY8 Q;  1H80 A;  4BQN A;  2UVF A;  3AFH A;  4IKF A;  4HG2 A;  3DU6 A;  3MKW B;  4C2T A;  2LRD A;  3PUB A;  3CZ6 A;  4MLO A;  2HU9 A;  3OMY A;  4OJP A;  3BCA A;  2W7N A;  1O8M A;  5C1C A;  2X6W A;  2KZV A;  4Y4R A;  4RM2 A;  3OYF A;  2R7Q A;  4ZDP A;  1WJ5 A;  2PJR A;  1V5E A;  2IGO A;  3OL3 A;  2GOX B;  1ERD A;  3CP2 A;  2I8D A;  3I9V 2;  4H4K C;  3D5R C;  1WJE A;  3BG6 A;  3OYG A;  2IQ7 A;  1I18 A;  2K3P A;  1AIR A;  4LIT A;  3OAA A;  1O88 A;  1X1C A;  1GLN A;  4CA0 A;  2X53 S;  2VXD A;  4PFO A;  4W8R A;  2VB6 A;  1UD3 A;  1CZF A;  2R9V A;  3EUK L;  1WPC A;  5HNH A;  3OYI A;  3GBG A;  2R7U A;  4BAC A;  1WP6 A;  2O0W A;  2UUZ A;  4B3X A;  4BJT A;  3DPT A;  1OHH A;  4U49 A;  3MD2 A;  4OJL A;  2X1D A;  2F6C A;  3CF2 A;  4DK1 A;  4KKU A;  1X1A A;  2WJV A;  5CDF A;  3H35 A;  1WJC A;  2LZJ A;  2ZSH B;  4BE2 A;  1U0J A;  4DBQ A;  2NTB A;  4D9J A;  1D0Y A;  2QY1 A;  4KIT B;  1D1B A;  3OYJ A;  3GQA A;  2XF5 A;  4U4B A;  3UNG C;  1NHC A;  3LMM A;  4KKS A;  3FBN B;  1X4O A;  2DJI A;  3TMO A;  3G2B A;  2WPD A;  1BLI A;  2D3N A;  3A2K A;  2MC4 A;  2IXS A;  2VQL A;  2W1O A;  3TL4 X;  2VBE A;  1NRK A;  2LY1 A;  3VYU B;  2ELJ A;  4HNU A;  4DK0 A;  2VJJ A;  3HPG A;  1MAB A;  4GQN A;  3VMV A;  4PMH A;  3MMY B;  3LSK A;  2XOK A;  5HVQ C;  4Y3O A;  3AL0 C;  2BW3 A;  2V31 A;  1RU4 A;  4II3 A;  3K4M A;  4HSR A;  3SZG A;  4B44 A;  3F9K A;  1DP3 A;  1IB4 A;  3S32 A;  1WJF A;  4XL9 A;  1O8E A;  3T53 B;  2LRE A;  4PFP A;  3T56 B;  4B47 A;  3VWB A;  2ZXH A;  4CZC A;  1BN8 A;  2KDO A;  2VIX A;  4BUP A;  3UR3 C;  1V0F A;  2IGM A;  3RCO A;  1T95 A;  2ZZQ A;  2VL8 A;  3A4C A;  3JUR A;  2Z8G A;  3OYD A;  3QYB A;  1E0E A;  2CH0 A;  3CMM A;  3NE5 B;  2UV1 A;  5CPR B;  3OW7 A;  4KIS A;  3GRH A;  3A35 A;  4FXU A;  2VBK A;  1UD8 A;  1Z3Y A;  2LOO A;  4LIU A;  4ZTF A;  3B90 A;  2OV7 A;  2E60 A;  1ZEL A;  2V4J C;  3FDY A;  4Z05 A;  2CFO A;  2WAQ A;  4E7I A;  2HVR A;  4HNT A;  3HAG A;  5KHD A;  3VMW A;  2M4K A;  3LL7 A;  2RNG A;  2VQC A;  4YEL A;  4PUS A;  4G6I A;  4NC7 A;  4BE1 A;  3VSU A;  2ZFU A;  1D0X A;  1E79 A;  2NTP A;  3EUA A;  4ZDO A;  4W8T A;  1KTW A;  2CV2 A;  2O5R A;  5FRM A;  4L8J A;  5AMV A;  3ZCO A;  2M7B A;  3CP8 A;  4YXW A;  4BDZ A;  3MKZ A;  4ZTJ A;  1W0J A;  4NC8 A;  1EA3 A;  5TGT A;  3H9Q A;  1W36 D;  2XSJ C;  4XQF A;  4F91 B;  1N78 A;  1V5G A;  4CCJ A;  3T9G A;  1BOB A;  2CS3 A;  2F43 A;  5FRN A;  5HKK A;  3BC9 A;  1FMV A;  1NG7 A;  4BQO A;  2M5S A;  3VYR B;  2XND A;  3OS2 A;  3EQN A;  3BG7 A;  3CES A;  3M8J A;  4XN0 A;  1BR1 A;  3K70 C;  3WWG A;  2X85 A;  3OR2 C;  4OJ6 A;  4W8Q A;  3DQV C;  4P5O A;  4ZDL A;  1Y56 A;  1H8H A;  3GVJ A;  4NK8 A;  2LY2 A;  4XOT A;  4RM3 A;  2M0M A;  4II2 A;  3H5N A;  2MFZ A;  3OYA A;  2W6I A;  4N4O B;  4AYB A;  2CUZ A;  1X1B A;  2A6T A;  2GOM A;  2X6X A;  1WJA A;  3L2U A;  1BR4 A;  4DNT B;  2UWM A;  5KNL A;  2LBF A;  2Q1Z B;  2F5V A;  2HVQ A;  3IUO A;  4CCL A;  4UZU A;  2KL4 A;  3H0D A;  2M3A A;  2R4G A;  1COW A;  1WTH D;  3HKZ A;  1QCX A;  3K4J A;  2FUG 2;  4QPO A;  4YZA A;  2WBM A;  4E7K A;  2VPL A;  4XON A;  4F3Q A;  4HIZ A;  2O04 A;  2HPI A;  4BS9 A;  4CCM A;  4G7W A;  1T5E A;  4W8S A;  3OYE A;  3GQB A;  1D1C A;  2XC7 A;  1RWR A;  4JOM A;  4RLF A;  2AQF A;  2IS6 A;  4YRV A;  4XOP A;  2HNH A;  2XAU A;  3ZGK A;  2R7S A;  3W2A A;  3PNT A;  1LKX A;  3L2R A;  2NT9 A;  2XGJ A;  1IA5 A;  4XN3 A;  1D1A A;  2RRE A;  3QYF A;  2XF7 A;  1V0E A;  4OAY A;  3A3G A;  2DT7 B;  3NWT A;  1SKY B;  1NBM A;  1OGO X;  5HOO A;  2MYS A;  2JVH A;  4XKC A;  2R7T A;  1SFK A;  1OLT A;  2W82 A;  5CKT A;  2CV1 A;  4Z03 A;  3LSG A;  1BHE A;  1X1D A;  3EPZ A;  3S8P A;  2BVM A;  1E3Z A;  4BXF A;  1UG0 A;  2VBM A;  2O1D A;  4BJ6 C;  3JU4 A;  3HXL A;  1IRX A;  1W36 C;  3BCF A;  4BEH A;  2MD0 A;  3OL4 A;  2L9S A;  2PJR B;  4G7X A;  4R79 A;  3B4N A;  1DBO A;  1DGR M;  4BEH B;  1UAA A;  1BMF A;  4LG3 A;  3K4C A;  4GRI A;  3H5A A;  4F92 B;  1OFM A;  4HWV A;  2DT6 A;  2WAD A;  3TBI A;  2Y0S A;  4FET A;  4XLE A;  3OIQ A;  2XDV A;  4URR A;  4IZZ A;  4F52 A;  2AQE A;  4B3G A;  1XG2 A;  1W0K A;  3OWT A;  1N75 A;  2KRH A;  1PJR A;  2K5C A;  2XZP A;  3OEE A;  1KZL A;  1QJV A;  3WQZ A;  5C1E A;  2PEC A;  2KRC A;  1NG6 A;  4XNF A;  4BJ5 C;  2V1N A;  3K6G A;  4PJJ A;  1JI8 A;  3PFY A;  2CK3 A;  3FKS A;  2L5Q A;  4RLQ A;  2HLD A;  2X1E A;  3B8Y A;  3K4B A;  2KHM A;  3RQ4 A;  3OEH A;  3DDY A;  3S93 A;  4DGW B;  3HL2 A;  4XOR A;  4CH7 A;  3E1S A;  4PJM A;  2VQG A;  2QX3 A;  3J7A Y;  1P9Q C;  2LC2 A;  1I8D A;  3IAS 2;  3AL0 B;  1RMG A;  2VAS A;  2QE7 A;  2E1B A;  4OZZ A;  2CW8 A;  1VF7 A;  1QHG A;  2HPM A;  3OPO A;  1OB0 A;  5JHF A;  2VLA A;  2KVO A;  2PMZ A;  3E0J B;  3OFN A;  1IDK A;  5CQG A;  2WJY A;  3K4N A;  2BSP A;  3FBI B;  2V7F A;  4B48 A;  1Z21 A;  2HVS A;  3FHN A;  1O8G A;  1MNE A;  1DQU A;  4OZY A;  3GVL A;  3LFU A;  3D5S C;  3OYC A;  1MMD A;  2GK6 A;  4XKV A;  1MMG A;  2IS1 A;  5DN6 A;  2VJ4 A;  4B43 A;  2KP6 A;  3OOC A;  2R7O A;  4ITV A;  2HDW A;  4E6K G;  4E4H A;  2JVG A;  4PSX A;  1JTA A;  2WA0 A;  2WAF A;  4E7L A;  2INU A;  3OYB A;  2NSP A;  2XZO A;  3OOU A;  2NTQ A;  3K4L A;  4OAZ A;  4PK4 A;  2VKH A;  3W3C A;  1G59 A;  1WMR A;  1K5C A;  1DGW Y;  4B3F X;  2ZZE A;  3LSI A;  1EFR A;  4XKB A;  2ZXI A;  1E43 A;  3H5R A;  3RSN A;  2M4G A;  4N4N B;  4EAT A;  3HC7 A;  3ZPN A;  2DCE A;  3OIP A;  3GQ7 A;  2NT6 A;  3FKJ A;  2D3L A;  3FPP A;  2EWE A;  3VST A;  3T51 B;  4E7Z A;  4XD7 A;  5HNF A;  3DKY A;  2E5N A;  3KEW A;  4Y33 A;  4C30 A;  1J09 A;  3NWS A;  3DEE A;  2JDI A;  1UD4 A;  3OYL A;  4HRI A;  1OGM X;  3HG9 A;  1SAU A;  4F93 B;  4XLF A;  4F55 A;  3OY9 A;  1HVX A;  2L7K A;  3DPL C;  1X4P A;  2ZTN A;  5IK2 A;  1MND A;  1PE9 A;  3OYN A;  4LIV A;  3OR1 C;  1KMH A;  4BL0 B;  2BW3 B;  4NNJ A;  3RPU D;  2VJI A;  2CW7 A;  4ASU A;  2E1M C;  4JQF A;  3UW0 A;  1YX5 A;  3HPH A;  1QHH D;  3VYT B;  1O8I A;  3BCD A;  2HQA A;  2JJ2 A;  2WAE A;  3SUC A;  4J00 A;  3OYK A;  3K70 D;  3ZPP A;  4HEA 2;  4FAS D;  3VSL A;  4BDY A;  3MKY B;  2IS2 A;  2GK7 A;  1S9H A;  2CUJ A;  3VYS B;  3DTI A;  2WZP P;  3ZIA A;  2PYG A;  3EUH C;  3M1C A;  1D0Z A;  2ZTG A;  4CSW A;  3LSH A;  2IGN A;  4ZC3 A;  2GJK A;  3OS1 A;  4RMN A;  5HLT A;  2K9L A;  2DXI A;  4E7J A;  4G6T B;  1PXZ A;  2W00 A;  3LSM A;  2QKM B;  2VJ5 A;  3H9G A;  3C2G A;  4DOZ A;  1FMW A;  4ANJ A;  2DOA A;  4OJ5 A;  1UEL B;  3S3N A;  2JA2 A;  1O8L A;  1K28 D;  3ZQQ A;  2R7W A;  1YE9 A;  3GVK A;  1E3X A;  1T0F C;  4U7B A;  5LD2 C;  5FRO A;  2X1C A;  4DJA A;  2BVL A;  1N77 A;  4DBR A;  3FY3 A;  2RQQ A;  3BC8 A;  2Z6B D;  2M7A A;  1Z7L A;  3C2H A;  2V9K A;  4IQJ A;  2W6J A;  2WSS A;  1HG8 A;  2WB1 A;  3K10 A;  4OWR B;  4Z1M A;  1X0C A;  1Z3X A;  2JSP A;  3ZR8 X;  2IGK A;  1WJD A;  1VZ0 A;  1KCC A;  2X6Y A;  3DU5 A;  4IX7 A;  3U21 A;  4E7H A;  1G8X A;  2Q2E B;  2GJP A;  4U87 A;  2V6E A;  1UD6 A;  2VQH A;  2INV A;  2X3H A;  2JJ1 A;  3DLA A;  3BH4 A;  1AA7 A;  1TT0 A;  2KLO A;  5FL7 A;  4OJO A;  4BE0 A;  4CUG A;  3L2Q A;  4EW9 A;  4PJL A;  5LFA A;  2UVE A;  4CCN A;  3ZSC A;  1E1Q A;  1JRG A;  4XMY A;  4CCO A;  3VR6 A;  2QXZ A;  1LDK B;  4E7S A;  1LFP A;  2NZM A;  2LYC A;  3ONQ A;  3VSV A;  4QPQ A;  1FX0 A;  3HOS A;  4BQQ A;  4KJZ A;  2BOL A;  4AU7 A;  1YX3 A;  4PSW A;  1VBL A;  3L2V A;  4NQW B;  1O8D A;  2P0W A;  2NOJ B;  2HZD A;  1O8F A;  3KEY A;  1PLU A;  3DWL E;  1KCD A;  3W2V A;  2W4S A;  3OS0 A;  3PNV A;  2R7R A;  2JIZ A;  2Z2S B;  4BU2 A;  2K9M A;  1MW7 A;  3SEQ A;  4X0G A;  3PSF A;  3A1Y A;  2IS4 A;  1HA8 A;  2L2O A;  2PYH A;  3KX2 A;  4ZYA A;  2ZZG A;  3D5L A;  1MMA A;  3BCB A;  1O8K A;  3HUG B;  3ZXS A;  4J01 A;  1O8J A;  3L2W A;  5KCM A;  2KQR A;  1WJB A;  3HOT A;  4XKW A;  3OYH A;  4XM3 A;  3IAM 2;  4HPQ A;  2V26 A;  4YEJ A;  1PKV A;  1BR2 A;  4IQ4 A;  2LBF B;  2V4D A;  2XZL A;  1EE6 A;  1OOC A;  1E1R A;  3ZRG A;  2R7V A;  4D1Q A;  1UD2 A;  3K4K A;  1R6R A;  2Z1D A;  2ODL A;  3DTK A;  4TKO B;  3VDX A;  4KT6 A;  1BPL A;  4Z06 A;  2ZSI B;  4P22 A;  2V7Q A;  1LVK A;  4AVZ A;  1W9X A;  3RTR A;  3QOD A;  3OE7 A;  3DKX A;  1OFL A;  3CJQ B;  2KMU A;  3VSK A;  2X8K A;  1H8E A;  1WFX A;  4YZX A;  3A3B A;  2KPM A;  3QYE A;  1Y6I A;  1V5F A;  1VJS A;  3EQO A;  1K6Y A;  3SEZ A;  3SYT A;  2LH9 A;  4MXN A;  2VKD A;  2CV0 A;  4XR6 A;  3GQ8 A;  1DBG A;  4C9Y A;  4PJN A;  4ZJZ A;  4C2L A;  2L9N A;  5CQE A;  4YZ0 A;  1TZL A;  4DNR B;  4XLA A;  3OYM A;  2A5W A;  3PL8 A;  3W2W A;  1MMN A;  2E1M B;  1QU3 A;  4DIQ A;  3H94 A;  2LG4 A;  2ZZF A;  2NST A;  4YZQ A;  4P1W A;  2DIE A;  2Z16 A;  2XF6 A;  4C2U A;  3CJR B;  3LMW A;  3S3M A;  4MR0 A;  2MAB A;  4NUB A;  4I84 A;  2WY7 Q;  4CCK A;  2F1M A;  1PYV A;  3PJR A;  2CMP A;  3PNY A;  3AKZ A;  3G05 A;  2VXZ A;  4E0F A;  2E5Z A;  4HST A;  2GJR A;  4KKT A;  4TSF A;  3GQ9 A;  2F4I A;  3PSI A;  1UD5 A;  4TT3 A;  3IP4 B;  3KYL A;  4NK6 A;  2X51 A;  2O0V A;  1VLY A;  1IDJ A;  2R7X A;  1GQ8 A;  3LNN A;  3SDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...