4XLFA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
599
structure length
599
Chain Sequence
PDQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 230
structure length 599
sequence length 599
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xlfA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xlfA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xlfA02
1IDJA 4XKWA 2NTBA 4W8TA 1AIRA 3SUCA 1O8JA 4XR6A 2QX3A 1NHCA 4XLHA 2VBKA 1PXZA 3GQ7A 1H80A 1O8FA 1IA5A 1JRGA 1CZFA 4XOTA 3VSUA 4XN3A 2UVFA 4YZXA 4XN0A 4C2LA 3VMWA 3EQNA 1BHEA 4W8SA 5C1EA 4YZ0A 1PLUA 4OJ6A 4Z06A 1O8KA 4YEJA 3GQAA 1GQ8A 4OZZA 3KRGA 2X6XA 4AVZA 3FY3A 4XL9A 4XKVA 1O8MA 1JTAA 3UW0A 3VMVA 4Z05A 1DBGA 1VBLA 2EWEA 1WMRA 4HWVA 1KCCA 3B8YA 2PECA 2NT6A 2O0WA 2BSPA 4OJPA 4MR0A 3GQ8A 1OOCA 1O8IA 4EW9A 2NZMA 2VBMA 4XONA 4XLFA 3WWGA 4XLEA 2UVEA 4XLAA 5C1CA 2IQ7A 1OFMA 1XG2A 4OZYA 2QY1A 4Z03A 4MXNA 4XMYA 3LMWA 2PYHA 2PYGA 2INUA 2NSPA 3GRHA 2NTPA 3ZSCA 5AMVA 1KCDA 4URRA 1RMGA 2VJJA 1IB4A 4XQFA 4XLCA 2INVA 1IDKA 1QCXA 3VSTA 4XNFA 2QXZA 4XOPA 4I84A 2NTQA 2VBEA 4U49A 1EE6A 4W8QA 4YELA 1O8GA 1OFLA 2NSTA 2X3HA 1HG8A 3JURA 2O17A 4W8RA 1O8DA 4YZAA 3ZPPA 1RWRA 4OJLA 4YZQA 2X6YA 1O88A 3B4NA 3EQOA 1OGMX 3B90A 4NK6A 2X6WA 1O8LA 2O0VA 4XM3A 2O1DA 2Z8GA 4XORA 1KTWA 3T9GA 1PE9A 1OGOX 2O04A 1BN8A 2VJIA 2NT9A 3GQ9A 4PMHA 4OJOA 3VSVA 4NK8A 4OJ5A 1RU4A 2ODLA 1K5CA 1DBOA 1O8EA 1QJVA 1O8HA 1X0CA 2X85A 4U4BA
chains in the Genus database with same CATH superfamily
3LNQA 4RAYA 2KIMA 4G7OF 2O7OA 4E7JA 4BHCA 2KZGA 2KHMA 1FNNA 2XT2A 2E1OA 1FNBA 3FIWA 1W0JA 4XLHA 2J8KA 2I8DA 4B3FX 1X2MA 4P6YA 4JBAA 4GFBA 3GQ7A 1YLFA 4BY7J 5A8AA 4NUBA 1FOWA 2E60A 3G1OA 5LHGA 1JA1A 2ZNYA 3IAM2 1UD3A 3IV5A 4J01A 4QPOA 1A31A 5FKLA 2R5YB 1BHEA 3GFLA 5TJJA 2K4JA 3U2QA 1OCOH 4BEHB 1QA3A 2UXXA 3LA7A 2Q8KA 2B0RA 2IGNA 1ETYA 4LK1F 4XKVA 2DMNA 4L5IA 2CW8A 2VI6A 4RS8A 3CF5F 2GPJA 1W4MA 1Z3XA 1OFEA 1R5HA 4CCLA 3DV8A 4E7IA 2VUMJ 3W2FA 3VNVA 3ZZUA 1D8JA 3F72A 1N77A 3A1PA 4X7EA 1X2NA 2VE9A 1SD4A 4D0PA 2Z99A 4UV9A 2FBKA 3R60A 4RPBA 3MCAA 1IO2A 1HQCA 2XPWA 3WODF 1HW2A 3RQ4A 1UG0A 2O0WA 1JB9A 3F6OA 3U6BA 2XNDA 1H88C 2A6TA 3BH4A 1TW2A 2NS0A 3CCSI 1ELOA 1KQSB 4YFOA 4D1QA 1FJLA 4ZCIA 3W2WA 3J7ZI 2M45A 4CCNA 4DQKA 3CO7C 3E3VA 4G12A 3WG7H 3I4NJ 3PVDA 3VO2A 5GPCA 2L4MA 4OPSA 5LRRA 2IQ7A 1YI2I 5DSZA 2BVNA 4OINF 3WTSC 1X1PA 2HQRA 1I6HJ 1X3WB 1FOYA 1BQEA 2GIVA 1YIJI 2PQ8A 2HMAA 2XC1A 2D74A 3MEXA 3ZR8X 4BQNA 4Z4VA 4RMNA 2HPMA 3ERED 1T6ZA 3CMYA 1YJ9I 5GTHC 1Z6RA 1RMGA 5GAHJ 4Y7NJ 4UAJA 4XQFA 1BOBA 2DMQA 3BR0A 4R8HA 2DFEA 2VBUA 3PM1A 2ID3A 1B2RA 4XOPA 1JA0A 2C2WA 2HKOA 3LSHA 3CD6I 1VF7A 1CNFA 3RPQA 4I6ZA 2FU4A 4E7HA 4NHJA 4X6AJ 1UD2A 3KLNA 2F4MB 3AGPA 2DOEA 3PUFA 4YEIA 2WA0A 4M3BA 1BJZA 1JTXA 3FBIB 1B8IB 4Y52J 1ZQ3P 1OYIA 2CH0A 4OMZA 5A2QZ 1KJZA 4RBOA 3VYRB 2JSPA 2M0CA 4F93B 4MHGA 4I02A 3CCSB 3I4PA 3TO9A 3Q5FA 3B4NA 1OGMX 3MCZA 4G94A 2EZHA 4Z4SA 2K27A 2A05A 3Q39A 4ACAA 1WPCA 4NC8A 2MBFA 4G7XA 1J9ZA 3GBGA 1KK0A 1DP3A 3WTXC 1YJNI 3AFHA 1YIJB 3KP4A 1ZG3A 1G7RA 4O3MA 2ODLA 4LITA 1R49A 1EFRA 3PO2J 1BOAA 4NCNA 2PMDA 2E35A 1YJ9B 1Q9SA 3NRVA 1LE8A 4X7DA 3ISXA 2JUGA 5EEGA 1J2XA 1HKTA 4RGRA 1YTYA 1SFKA 4Z4WA 4QWQA 4B3AA 1TYUA 2CYYA 3CD6B 2R4GA 1E64A 3PUNA 1GVDA 2KRHA 1IA5A 4EQQA 1FYMA 4HW0A 1B4AA 3ZMTA 3T8TA 4OIOF 1UD8A 3ASNH 3CLQA 2DA4A 2H27A 1U2WA 3CDHA 1PVEA 3PNTA 4W8SA 2JPBA 2CNDA 3A4CA 3M1CA 1ZGAA 3OYMA 2KDOA 3QFRA 5CPRB 4ZV4A 4WWVA 3TKYA 2LTPA 1WJAA 2ZMEB 3PQKA 3OYKA 1JE8A 3ASPA 3LL7A 4IW3B 2KPMA 4HZFA 3JRCA 4Y9RA 1EH6A 2M8EA 3H36A 1QO0D 3DEWA 3AVXA 2ZO4A 1K8AD 3GVLA 4BE2A 1VI0A 1FT9A 3W2AA 3PA1A 2CO5A 4IX7A 1YJNB 3R6SA 5E6TA 2L01A 3EDPA 4H0EA 1DDNA 2ZJRF 3OP1A 1X1DA 2CQXA 2H1LA 1ENHA 2IXSA 2WPDA 1YFHA 3W5UA 1OMIA 2QQBA 2EIXA 2IAIA 2B5OA 4CUGA 2ECCA 3BCBA 3DPUA 1ZELA 4CCMA 3BOQA 3BT9A 2Q6OA 4A3FJ 1W5TA 5CDFA 3GLLA 1T95A 1MMNA 3LSRA 1FMVA 4HQMA 4HF1A 1XGMA 1VQNI 2O3FA 5M5WJ 3E20A 5IYBJ 3Q38A 3G05A 2Y0SA 3BJ6A 4AWXB 4MEXF 1RKTA 3OSGA 1V5VA 2YPRA 3L2CA 2VNKA 4EJVA 5F27A 2LYCA 3N4MA 3KEOA 1IRXA 1MMAA 2ESHA 2Z33A 1OGIA 4RAFA 3ULQB 4URRA 4BU2A 3GTMJ 4UV8A 1H42A 2M34A 1Q1VA 4PZJA 4HIZA 5IYPA 3G2BA 4E4HA 2A5YB 3FM5A 1XMAA 2WV0A 5FFZA 3AL0B 1EE6A 3I9V2 3OL4A 4LK0F 1OFLA 1E17A 1DPRA 1KZLA 5BS6A 4U0WA 1T08B 1BLIA 1DGWY 2BE5F 4ETSA 4NDLA 3JAMZ 4L9JA 2XHKA 1S29A 1OLTA 2LKXA 3Q6QA 3W2GA 3GSIA 3O8HA 1SFXA 3TOBA 1LVKA 2F5EA 4OPWA 2Y0SN 2Z2SB 4Z4YA 1H85A 4WX9A 3G1MA 3P4GA 4P6VF 2FNAA 2KIUA 4WWCA 4RA2A 1IXSB 1G8XA 4FN5A 1Q81D 1TWCJ 4LMYA 3WG9A 4BHPA 5IY5H 1U78A 4ENKA 3M3YJ 1G7SA 2B7BA 1NJID 1S9HA 3EUAA 4NC6A 2W24A 5DD8A 4OJ5A 2Y75A 1JJ6C 3DCFA 1BC7C 2NVQJ 2JVHA 2RAEA 2P4WA 3ZQLA 1YS7A 4IHTA 1O8HA 3FBNB 4U4BA 4Z2YA 3KX2A 1D5VA 2YWFA 1KYZA 3JTHA 4W8TA 2DN0A 1O8JA 4M9ZA 1LQ1A 3ONQA 2XTXA 4IRGA 1ZRDA 4FASD 3JREA 1A8PA 3HL2A 3KFWX 3WTTC 3Q0WA 3R0JA 1ODDA 2HOEA 4RM2A 1S5LC 2KVOA 4A93J 4DK0A 2KIQA 1HC8A 2FA5A 3BLYA 4AC0A 3EPZA 2OTJI 3OR1C 3HOZJ 1XPXA 1MNMC 4RD0A 4KA4A 3AVWA 3DF8A 4HNVA 5F0CA 5IT9Z 2XTWA 2N8GA 4B44A 1SVLA 3R4KA 4PGHA 4RGUA 1FSHA 2BY0A 5H59A 3OEEA 1W0KA 2VQGA 2OZUA 3SDBA 1FMWA 2WSSA 2BM6A 3TGNA 3LFUA 4YCQA 1P92A 2OV7A 1WMRA 2QA4I 3B8YA 2VLAA 1FC3A 1E2XA 1XX5A 2XAQA 3HTUA 4IPAA 3ZQHA 1LE8B 1K83J 1SEUA 1MSFC 1BPLA 5D8KB 1ZYRF 3V76A 4ZGQB 4MR0A 2CUJA 3RKXA 2LP0A 2V7UA 4MO7A 2K02A 2MH2A 2P6SA 1CGPA 1ETKA 1PJ5A 2ZBUA 4M71A 3RPUD 4FE7A 2D3NA 1ETQA 1OR7C 2IJLA 2MGQA 1DG1G 3LVBA 3FXRA 2XGEA 1T2KA 1UZCA 2K3FA 3ABTA 1QUEA 4V02C 4IQJA 1XG2A 2HXIA 5FLVA 3H9JA 3O3KA 2K9MA 3SEQA 4DQ2A 1N25A 5BMZA 1VQ6B 3S3NA 1D3YA 1OYWA 3SZGA 3H5AA 2DIEA 3OYCA 2OTJB 2IS6A 1JKQC 1GVHA 2C4UA 3A3BA 4FCYA 3ML3A 3S8PA 1SFUA 2BM1A 3K4JA 3DLLF 4XLCA 2W6IA 4IL6C 2BGIA 2GJPA 5EGOA 4P25A 1ETOA 3CCRB 3BTLA 4I98B 2YUSA 3QYEA 1UFMA 4J19A 2BZTA 2E2IJ 4CDGA 5FRNA 4P1VA 2DQLA 1Z3YA 2ISZA 2A3SA 2QENA 1ZUNB 2NSTA 2X3HA 1R36A 2VPRA 1X3UA 1L0OC 2EB7A 2NOJB 2CGPA 4W8RA 4G7HF 1QZEA 3RKYA 1IRGA 1NHAA 2R3SA 1J9IA 3DEUA 1LLWA 3BY6A 4BXFA 3CJQB 2W84A 2VODA 4N4OB 3T56B 2JUCA 3JRBA 4ZYAA 1ZM9A 3LA2A 3S93A 4ASUA 5JR3A 2OBRA 4HYEA 2IBDA 1Y1WJ 4A0XA 1TP4A 1UD4A 4D7NA 2DMTA 3KETA 2R7UA 3ASRA 1ETVA 5D6FA 1WZ2A 1EH8A 2D45A 3A2KA 4M3DA 2EA2A 3OYBA 3HB9A 2VXZA 1W0UA 3PSSA 4P9FA 4XRSG 4RAZA 1QVGB 2QVOA 2EIKH 5E20A 2QQ9A 2EPFA 2DTRA 4K2EA 3TO7A 4G1VA 3TP0A 3CF2A 2PYHA 1H89C 1PDNC 2O6GE 3SZEA 2HWVA 4X05A 2L7FP 2AXTC 5EZHA 1IN7A 5EZGA 1HF0A 5FKMA 2L9NA 2QEXI 4JQFA 4KT5C 2XAFA 3CPWB 2M1BA 2VBVA 4KNYA 2A5WA 1IAWA 1N07A 5HKKA 1ZAOA 3CC4I 4KH3A 4FT8A 5M5YJ 2M4GA 3G73A 4LBWA 4PC6A 2VOOA 4OJ6A 1S7OA 3CPXA 2VFQA 1V3FA 3S2HJ 2R7QA 1MABA 1Y1VJ 3M8JA 2UZKA 3O2PE 5GP9A 2QCOA 2QBYB 5CVIA 4PC1A 4RPDA 4PCQA 2ICWG 3V7SA 1HKQA 1IUFA 3A8IA 2BXYA 3S2WA 1ZGJA 1DBGA 1OPCA 1BA5A 2M3AA 3C1DA 1IF1A 1W7PA 2ZXIA 2V1UA 1YX3A 3CZ6A 1EWYA 1R5BA 3L2WA 3ZZTA 1SMYF 1FYLA 5J8FA 2CV2A 1ZREA 1ZARA 3E0JB 1O3TA 3QFCA 3FXUA 2FBHA 1VQKI 1EF4A 3H1CA 2RREA 1ZM3A 1QHGA 2LSOA 2OC6A 3FX3A 4U87A 5D5XB 3WE2A 3CUQA 1TQMA 2M8GX 1IV6A 3BTIA 4P26A 2QEXB 4GXOA 4YDTA 2VKDA 1QUFA 3HAGA 1TLLA 3SZTA 4Y13A 3RZDJ 3BG3A 1SAXA 1QGYA 2NPFA 2D2WA 2OBPA 4EJWA 1ZH5A 4LBVA 2KIFA 2MC3A 5DS0A 3CC4B 1BJAA 3RI4A 5GAEJ 1IUYA 4LIVA 2XNJA 4PABA 1PKVA 4JX6A 3BDDA 1WSUA 4L0ZB 3HRUA 1GXPA 3LQRA 2V7WA 3AVVA 1P6RA 4IQ4A 1Y6IA 4HBLA 3JR9A 1HBXG 4IVNA 2Y31A 5F1JA 1EXMA 3FKSA 2ZTNA 4A3JJ 1DU6A 2CUZA 1NK2P 2JQ7A 2CF4A 1D0YA 2EV6A 1O8GA 3ZN0A 3OOUA 1TT5B 2XASA 3GUDA 4DGWB 2O17A 1HSJA 1UG2A 5HZAA 1GHCA 2DA5A 2GXGA 4KICA 3OSFA 1FOXA 3V7AA 3MWMA 3N05A 3BG9A 3OYDA 3F6VA 1F60A 1WDTA 3RKWA 1VQKB 1T98A 2PG4A 2VT2A 3BPXA 4Z6YA 1QA2A 3HRMA 1S3JA 3OOCA 1KRHA 2KDZA 1OFDA 3BG5A 1HVXA 2A6EF 3H3ZA 3IRRA 3ZMZA 4FXUA 4Y15A 4P3IA 1ONVA 4LJZF 1VQ4I 2BV6A 3NAUA 1PYVA 3V42A 1X3ZB 3MZ8A 3VYSB 1NG7A 2JWTA 2ZBKA 2LF8A 4XRFA 1LDKB 1RU4A 2DA7A 1O57A 3FKIJ 3QQAA 4HSRA 2XPVA 5EGOB 1T39A 4II2A 4IHSA 2V31A 3K2AA 1OFMA 2Y2ZA 2CQNA 1G2HA 1IB4A 4RCZA 1ON1A 3DLAA 2ZMEC 4G6DA 1GT0C 1R00A 1GJRA 2E34A 3B6CA 3CC7I 2YWGA 4PGOA 3SJMA 4I2OA 4BYYA 3OY9A 1PXZA 5E18F 1DQUA 1OFCX 1F43A 3BQJA 1B23P 4HF0A 3HKZN 5FRMA 1AHDP 2BPOA 4A6EA 4XN0A 3T0YA 1OB0A 3DEEA 2K85A 4Z4RA 2ME6A 4WZLA 4DYQA 5DYMA 1PLUA 4QPQA 5L3DA 2XRNA 4L18B 2P81A 4M0LA 5HLTA 2JZYA 4Q47A 2K40A 4OP7A 1GDTA 3OYJA 3I3LA 3GLXA 1O8MA 1BM9A 2PMZA 4MYUA 2HOTA 1FLIA 1JJ8C 3KYDB 3GTOJ 4TKOB 4JK1X 1TTTA 2COMA 3H3UA 3H9GA 2ZKZA 2VB6A 1SD6A 2ZZGA 5B66C 3FK7A 2Y9YA 3HZJA 1R1UA 4X07A 1VQ4B 4FX0A 5ICCA 5A2QK 1JXSA 3ECOA 4L8JA 5IP7J 1P4XA 1HSTA 4II3A 3JQQA 3LAJA 3MMPA 4TMTA 4HWVA 1K7AA 3MMYB 4B09A 2JRMA 1RRJA 5LEKA 1PUEE 4HG2A 3DDYA 1H9TA 1BW5A 2QTLA 4M6VA 1XS9A 2LRDA 3D0SA 4BY1J 1IDYA 3F8MA 3OW7A 2DPUA 1G3TA 3Q6RA 3DTIA 1R1TA 1ZHFA 3D5SC 4PC7A 3L2VA 2VBXA 3CC7B 2M87A 3AL0C 4QV2A 2UVEA 1XSDA 4ZCLA 5H5JA 1FIPA 2LZJA 2L02A 3H0DA 4XMYA 2PMZN 1D2EA 2HLDA 4IHXA 4PJNA 1B72A 4PFOA 3EYIA 3TQNA 4MQ9F 3PETA 2IGOA 2I1LA 1QPMA 4ZDLA 2F3LA 3P9CA 3HOSA 3RSNA 2IP2A 5IP6A 4RD3A 2VONA 3E97A 3WTUC 2BVMA 2GAUA 1W7PB 3VSTA 1F9NA 2QXZA 3ASQA 3KYLA 1XSVA 3MHPA 4B8XA 3HGGA 1RPWA 3HXLA 3L09A 5ICGA 1FRQA 5JMCB 4UVAA 1HW5A 1JT0A 3JURA 5IYWA 1XDSA 4D5FA 1GUUA 1SC7A 1B6AA 1GV2A 2ETHA 4GCVA 4WQMA 3LYCA 4UZUA 3N6ZA 3CUQB 4M1KA 4R79A 1HDDC 4XD7A 4PJ0C 1X58A 3K4MA 5J4YA 2QE7A 1ZLKA 3U2RA 2V7XA 3NWSA 4IO9F 1MBHA 5KVRA 4MTEA 1ZK8A 4ZYHA 2ESNA 2O0YA 3W6KB 3S32A 1BJKA 1WGXA 3MVPA 3VSKA 3GTLJ 4OIQF 1X1BA 3I54A 1KK1A 1PE9A 5K7HA 2V6EA 2M7BA 3GFJA 4F91B 4XRMA 4PSXA 2F4IA 3VSVA 2KFDA 4UZFA 5DUIA 4L5JA 2E5ZA 3FM3A 5HLIA 2HPIA 5FIUA 3KP5A 1CQTA 3GTJJ 4IRHA 1VQOI 2HU9A 1H9GA 3FXMA 3GW2A 4R71A 2BM5A 2QQAA 3SY2A 2HVRA 4A0ZA 4C2MJ 2XTYA 3VPRA 4A3EJ 3AG4H 2MLGA 1LEBA 1HA8A 2GQFA 1YG2A 2HEOA 2XB5A 3OPOA 2M5WA 2E2JJ 3OE7A 4M6XA 1BBYA 2HZDA 3HOYJ 1W0TA 2VC0A 3A8JA 1AWCA 2VBYA 3CW2A 1ZM2A 3H9NA 1MMGA 1TT0A 2LREA 2Z3YA 3H92A 4AIDA 3JRIA 3L2QA 2ZZQA 2FUG2 3KP2A 1UCRA 4UZEA 1VHEA 1O8KA 3W6VA 4W1UA 3PUBA 2DTZA 3QPSA 1XE1A 4OZZA 2IA0A 1W1WE 3TW6A 2V4DA 2CW7A 3FKJA 1GVJA 4HV6A 4A0YA 1QZYA 5EDNA 1I18A 1K61A 5FJ8J 3ZC3A 3WHCA 1LFBA 1S8NA 3JAMK 1TWGJ 2X48A 3ERMA 2L3DA 3P7NA 4BHBA 4M9XA 4BBSJ 2TCTA 4D9JA 1E3ZA 4F7DA 2WAQA 2V1DA 4UHTA 5HODA 1TVCA 2ISYA 1B59A 4OWRB 3VDXA 4LLNA 2P0WA 1HZEA 3WGHA 3HPGA 1OOCA 1RR8C 1VQOB 3T5XA 1KQ8A 2R7WA 4XLFA 3DU6A 2Z9OA 2DT5A 3LOCA 5KW9A 5E3NA 5E8GA 1R5OA 2HR3A 1VQ7I 1U3EM 2F5FA 2KISA 2CV0A 4X06A 3JRFA 2DYIA 2QY1A 4CZZA 1P7JA 4A3BJ 3L9FA 5DCFA 4BQOA 2V7TA 1Q82D 1W9XA 4ZC3A 3IRQA 3OIPA 3J81k 2QLZA 2DOFA 4LG3A 5LEJA 1RUOA 1T6XA 3PUMA 3GMEA 4EM1A 4XSXF 4CYCA 5CQGA 3H0GJ 1KK3A 1V0EA 1WJFA 5B6IA 1O3RA 4BXUA 2WBMA 1QNTA 2WAQN 1N06A 3AVYA 3HJEA 3EUHA 4F55A 4RDLA 3MD2A 3S1RJ 4I84A 2I5UA 4BS9A 2VBEA 2UXNA 2E7WA 4YIFA 1TWAJ 1MJBA 1ZR4A 2QTZA 1DARA 5C3EJ 1MIJA 5FNZA 3FZVA 4XLPF 3GXOA 3PENA 4NC7A 5FA6A 3QYBA 1LDDA 3UKGA 1T0FA 3ZPPA 5ICFA 1X19A 2RQPA 4G8XA 5IT9K 1HF2A 2DCEA 2BSAA 2C5HA 3OZWA 1TYWA 3U9GA 5J1UA 1JUMA 1BR2A 1RKWA 3BJOA 4I99C 2F4NA 2ZC2A 2QDXA 1EFTA 4B4DA 2GREA 4N9HA 2EFPA 3FXJA 1EJ9A 3PO3J 4NK6A 4XSZF 1VQ7B 3PSZA 1B72B 2VPLA 2W82A 3M8EA 4ZTFA 2BEOA 3AG2H 4P9UA 2VE8A 4S04A 4KIGA 2VJIA 1JTYA 3J80Z 2OBSA 1FSEA 1Z67A 4XKCA 2W25A 4MNUA 2F1MA 1K9MD 3DPLC 3KYCB 3CCUI 1OHHA 4I7HA 3GVJA 2MW8A 2CFXA 4RM0A 4Z06A 2VYQA 3HBLA 2CRVA 4Y33A 2PMUA 3HSRA 1EA0A 1SD5A 3AAFA 5HS8A 1TC3C 3TDUC 1LVAA 3WHBA 4FTHA 3CP8A 3ABUA 2DEUA 4YC5A 4B1RA 5FO5A 3JRDA 2CU7A 2VASA 3RCOA 3SJPA 1LB2A 4J0QA 5E79C 4E6KG 3ABKH 5DTDA 2K5CA 1MRZA 3KL9A 4M72A 2YU3A 3K9TA 1E3HA 4EM2A 3ES9A 2GK7A 2E2HJ 3A01A 2GLOA 5IPAA 1VHOA 3GQAA 4HSTA 3QPLA 3FY3A 3I64A 1BC8C 4ZDOA 2DMPA 3HYIA 1MBJA 2PJPA 4MFDA 3SQNA 2GK6A 2DMUA 1N78A 2HOAA 2K9LA 4YG2F 3FWEA 1WKMA 2LDUA 2HTJA 3Q9SA 2C5BA 2JN9A 1NTCA 4ROXA 4ANJA 3CCUB 4ZJZA 2QYUA 4DBRA 1OB2A 3BR5A 4U88A 3WU0A 5C4XJ 4LG0A 1MGTA 2NNNA 1NB9A 1O3QA 1JHHA 1I3AA 1SKYB 4M6YA 2NXNB 3H09A 2L4AA 3IWZA 4A3DJ 2K9SA 3IH4A 4WF2A 1S72I 1EP1B 2DFFA 4DZJA 3OJWA 3HTSB 1TLHB 3BJAA 2JJ1A 1B1BA 3OYGA 3BCDA 2B0LA 2DDAA 3H3VK 4ACBA 3J81K 1QGZA 2XIGA 2R92J 4C43A 3KEQA 4JRAC 5KCMA 1AKHB 2F6CA 3CB4A 2VKVA 4LFUA 1KK2A 4CCKA 4RB1A 1R5NA 4Q4ZF 1SMTA 4OMYA 2ELJA 2BGCA 2KQRA 5EJCA 2OF7A 1I50J 3P9IA 2OD5A 1Z0XA 2LKSA 2XOKA 4AIHA 2VKHA 2WC2A 3MKYB 2IRFG 5KSWB 2QUFA 3IHUA 2FXAA 2ZZEA 1FNCA 1S6LA 5BPDA 4P1WA 2HDDA 2HTSA 3JRGA 1QQ1A 2DT6A 2PJRA 1MJAA 4DW6A 3K1NA 4ITVA 3R0AA 5AIQA 1WTHD 3G4SB 3E5QA 4ENJA 4QUZA 3QOPA 2ZL5A 1KU3A 2TDXA 2EWNA 2QKLB 1I3QJ 4IF4A 4KITB 5CVUA 3HOWJ 2GOXB 1Z05A 2H94A 2STTA 3WBKA 4IOCF 1RWRA 2MABA 4E7LA 2QN6A 3QWLA 2WAFA 4E7SA 3FMQA 3L00A 1MMDA 1WP6A 4C3HJ 2LC2A 3LSTA 1PJ6A 3WYAA 1JI8A 3P26A 1S72B 2ZJ2A 1W5SA 3HHHA 5B5EC 1G3WA 1ULYA 3EQLF 1EA3A 1R5ID 1VF9A 5D4RA 3PIPF 2NV4A 2O9LA 1EV7A 2R0QC 4YAFA 1OCPA 4CYCB 1IRFA 1BN5A 3E6MA 3R6KA 4TMWA 4KIFA 5FLXZ 2L9VA 4EJTA 3JRHA 3BP8A 2VBZA 1XN7A 2VQLA 1DBOA 4M3FA 4UB8C 1SVOA 1D8KA 1YYVA 1QJVA 1DP7P 1S0UA 3SDGA 3D26A 4HLXA 2NTBA 3ESWB 1YW7A 3GQBA 3SUCA 1JNYA 2GXBA 4PSWA 2B9SA 2KP6A 1IN4A 1KONA 5DM6F 3LQQA 4M74A 1YITI 1Z91A 3D1NI 4KFCA 1I7PA 2IGMA 2JTVA 5LHHA 1CZFA 1JJ2B 2XAHA 4P22A 3WBJA 3I55B 1STZA 3S1MJ 1A04A 1T6YA 3S3OA 3A02A 3HSFA 4FHTA 3ZQCA 2QBYA 3EQNA 4IJAA 3NE5B 2W85A 2EFGA 2R6HA 1XTAA 1LPQA 3N97A 4CA0A 1IC8A 1K4TA 1A6QA 1BIAA 3DWLE 4M2LA 3FHNA 3SEJA 3W5VA 2OYNA 1I5ZA 1USTA 3A03A 3K4LA 3M7GA 4FK8A 2EIMH 2NOGA 4BE0A 5KNLA 4P5OA 4BQAA 2CBXA 3CRZA 3FDYA 2CFOA 1KCCA 1WHUA 1TQIA 3LSJA 4PGGA 4KDPA 2NT6A 2DAOA 1TSPA 2YSRA 5IYRA 2FNPA 2STWA 1VQ6I 2LY9A 3OYHA 1QFZA 3FPPA 3BC8A 4DIQA 1YO5C 5L3CA 3SLNA 4Q48A 4CCOA 2ZITA 2GOMA 2D3LA 1YITB 4Z4TA 3CCRI 3A01B 2XT4A 2WJYA 3WNDA 3LMWA 3ISPA 1WI3A 2CUFA 1WI9A 2LMDA 2MYSA 4UUTA 4AUXA 4UUVA 3ZMDA 3SFZA 3CUQC 3ZMVA 1IN8A 2YR2A 3ASSA 3K1MA 1ZR2A 4CH7A 2V9PA 5L3BA 1DUXC 2H8WA 5E1ZB 3TH0A 2BBYA 2LG4A 3C2GA 3KIOA 2DXIA 4EGYA 3HDDA 1WRJA 2G0EA 1WH5A 1TUIA 2M30A 2NTQA 2XZOA 3DKYA 4LG0B 3DKXA 2E1MB 3I5UA 5J6XA 2V9VA 2QGUA 3W2HA 1WOSA 3BY1A 2W7NA 4E0FA 4QLCU 2H6BA 2HVSA 4RD2A 5K5RA 3P9KA 5TRDA 1V0FA 4A5NA 3W5HA 1QA1A 1J0RA 4HE5A 2X9DA 4ZYDA 5J1RA 4EEFG 1CNEA 2ZNZA 2BVLA 4WXCA 3IUOA 2FOWA 5HXBA 1VQ8I 4L9TA 2DW4A 1E3XA 4PK4A 3JTGA 3SYJA 4B43A 3NEUA 3PNVA 1KTWA 2Z16A 3BH6B 1RZ4A 1MKMA 4EM0B 1BIBA 3COAC 2YUHA 1LFPA 5E3MA 2NS8A 2VQHA 3B73A 1P4MA 1QGAA 4OM9A 2H6CA 2NNYA 2UV1A 4U7BA 2PI0A 4W97A 1G4DA 2PJRB 5FO0A 2EV0A 3PIOF 4RD1A 3ZXSA 2Q6LA 4QHYA 4UVBA 4BJ6C 5F1RA 2IGKA 1K78B 1BX1A 2RNGA 1SFOJ 4I01A 5DV5A 4BL0B 5B1BH 1E79A 5FD5A 2X8KA 1ON2A 3GX4X 2DK8A 2BY2A 4Y9UA 3WU1B 3LA3A 5HVQC 4JYKA 2P7CB 3ZPNA 3A3GA 4BDYA 2F4OB 4E7KA 1K8FA 5IYCJ 4H9GA 2FD5A 2RKHA 3OYEA 1YHQB 4YZ0A 3F8CA 3M1EA 4KUMA 1YLOA 2Y9ZA 1Y0UA 3TBIA 3V8LA 1KQ5A 3ZMUA 1ITYA 4RD6A 5LBQA 3CCLB 2H8RA 2O5RA 3KCCA 3F0CA 1QH0A 3ZMSA 2WZPP 5HDGA 2DETA 2GZWA 2L7MP 1VQ8B 1JTAA 2MLKA 2EINH 5LGNA 3DBLB 5J1YA 5AN9A 3LJYA 3HRTA 4QTRA 1BR1A 1Z21A 2ZFWA 4DK1A 1O3SA 3ZQQA 1FNMA 4FETA 5KAIC 3RTRA 5HLHA 1FZPB 1VLOA 3QE2A 2BM0A 3U21A 2RN7A 2AO9A 4P96A 4HE6A 1GV5A 2OJED 4HAMA 2VOPA 2IEKA 3NQOA 1EKEA 2KMUA 3VEPA 3OYLA 3PFYA 4Y4RA 1F36A 1U5TA 2B7EA 3ZN1A 1APLC 1WORA 1FBQA 3WWGA 4AD9A 5B3SH 3S1NJ 4A6DA 2AHOA 2L2OA 2LY2A 1JUSA 2ZZFA 1BMFA 2XZPA 2K9QA 5DUKA 3RZOJ 1AOYA 1DDIA 3ZGKA 1L1IA 2CJJA 4OAZA 3QRFF 4A3GJ 2Q0OA 2CQQA 2F5VA 2CWEA 1YX2A 3D5RC 1IJFA 2NSPA 2NTPA 9ANTA 2BHYA 3QYFA 1A36A 2XUBA 1BR4A 1VNDA 3HOVJ 2HYJA 4E7ZA 4FISA 4KISA 2XNCA 3L2RA 3K70C 3KZZA 2K7LA 2M4KA 2WJVA 3AVUA 1VFCA 2VN2A 3CCVB 1TZLA 1I39A 3WGGA 1WU8A 2VC1A 2XC7A 5TISC 1E62A 3GTKJ 2ME0A 4LGWA 5CJ9A 2BM7A 5DN6A 2X6OA 4ASNA 2IA1A 4U0YA 2VBSA 2BXZA 3C2HA 2HDNB 5DNSA 4N0BA 3PNYA 4BUPA 1XGSA 5JFRA 3RYPA 1VJSA 4N3GA 3RIRA 2LOOA 3N90A 3F9KA 4Y17A 1OJLA 1S7EA 4ESBA 4LLLA 3I0TA 4XORA 1DU0A 5EEHA 4F52A 2VJ4A 2YS9A 1BN8A 3GTGJ 3DKWA 4MIMA 4G6TB 3GZ6A 1XFOA 2A68F 3A8KA 4PMHA 1PJRA 2O8KA 2KLOA 2OA4A 5HNFA 4OJOA 2RC4A 3G71B 3OIOA 1TW3A 2M0MA 2FVGA 2J7KA 2ZL7A 2M7AA 4C30A 1XCBA 2MA3A 4DQLA 1QGPA 1H8EA 2Q1ZB 4AM3A 4XKWA 4QSHA 1Z1DA 2UWMA 1HDPA 5KK1A 1FX0A 3X2QH 1GO2A 1M90D 1WOOA 2K9NA 1XMXA 2FOKA 2VZLA 3ZQ7A 4BJ5C 3HKZA 4Z1MA 2ZJPF 1C0WA 3OR2C 1SKQA 2XGCA 5J47A 6PAXA 2PIAA 4PC3A 2DFHA 1I8DA 5BOXA 3S15J 3C2BA 2QSGX 4YHBA 2W48A 1FIAA 5JI6A 1IJWC 3VMWA 1LUJB 2CC2A 2NVYJ 3ABMH 3QODA 3ROUA 5FROA 2GM4A 3CCQI 4F92B 2VJ5A 3CXCB 3I56I 1T38A 2HI3A 1AA7A 5IYNA 2JK3A 3GWZA 3CTAA 2LK2A 5M3MJ 1MSEC 2QQ8A 4AIKA 4HRIA 3O6BB 1T8IA 1QQIA 4Z05A 2IS4A 3NB2A 1XG1A 3OEHA 3S14J 4CYDA 2WZNA 3BPVA 4QVAA 4DOZA 3ABLH 3HPHA 4J00A 4BQQA 4RDUA 4A3MJ 1UD6A 4HX8A 1MMSA 1VLYA 5KHDA 1D1BA 2VBMA 3K4CA 1L3LA 4KJZA 1UMQA 5L3EA 3HC7A 3WNBA 1T56A 2RVCA 3SYTA 1WJ5A 1E1QA 1IRZA 1ZGWA 2A69F 5K1YA 3H5NA 4RAGA 4ENNA 4OZYA 2G9WA 3K4NA 4HA8A 2KRCA 5IYDJ 2K4BA 4UUSA 1VTNC 3E6BA 3C3WA 3IKVA 5HS7A 2R7XA 3OYFA 1ERDA 3IP4B 2OZ6A 3K4KA 4BXXJ 2PMHA 1MH3A 3ZZ0A 4QFMA 3VMFA 1OGJA 3CCQB 1LDJA 5C4JJ 3ML6A 3I56B 2D1VA 2A61A 3DU1X 2MC4A 3VYUB 1RQPA 1MZBA 4X8IA 2LR8A 1IDKA 2R7ZJ 3KPHA 2P7VB 3DBRB 3HHGA 2BV3A 2NVTJ 3MKZA 4W8QA 3CC2I 4CO8A 2DO7A 3M8FA 2DOGA 4NQWA 1USSA 2MFZA 4MEYF 1PP8F 2CMPA 3K1PA 1U5TB 5BQTA 1I6XA 3EUHC 2XVCA 3K10A 2V1NA 2XROA 4ZZDA 4EJOA 4PJLA 4OJLA 1T6SA 1D8TA 3DP7A 2LKPA 2LLKA 1QA6A 1RETA 5HZBA 1R71A 4P12A 3PL8A 3SFIA 3CCEI 3CDIA 2FX3A 4X7FA 4KMFA 4HV5A 2CS3A 3V7CA 4HLYA 1T0FC 4N3NA 2EA4A 4ZTJA 2KT0A 1VQ5I 3BR6A 3FK6A 3GVAA 1CQXA 5HS9A 1YX5A 1R22A 5K5QA 5FB2A 4CQJA 1Z77A 2V7QA 3RKQA 3GQ9A 5E3LA 1A5JA 2GBYA 3P5JA 2WR8A 1QZZA 1S7AA 2DPDA 3M4OJ 2X0KA 4C3IJ 4L0YB 3VOEA 4BE1A 1VQ9B 3L2UA 3U1KA 2ZXJA 4V2FA 3OS2A 3TW7A 3BY2A 1Y56A 2QYOA 2LBFA 3KP6A 3OL3A 4HQEA 2G7HA 1NK3P 4YAUA 4AF6A 4EH1A 2QX3A 5GV8A 1NHCA 3OJXA 1X4PA 5HDKA 1O8FA 1U9NA 2GXAA 4TN1A 3CC2B 4KMUX 3KE2A 3IH2A 4XOTA 4BNCA 2Z6BD 3BG6A 3JSPA 4U9UA 5F4OA 1VBLA 3HRSA 5ILSA 4YIRX 1M1EB 4LIUA 3VYTB 4TSFA 1VQLB 1OISA 5FO1A 4O6JA 1RNLA 3QP5A 4PUSA 4Z4UA 2JJ7A 3KRGA 3BR2A 1KQ9A 3MKLA 4C0SA 4XL9A 3WTZA 3FXKA 1EH7A 2H1KA 3JW4A 2XAJA 3CCEB 2XF6A 1WFXA 4BACA 3VMVA 4P55A 2R7TA 3BWGA 1VQ5B 3JRAA 5IOYA 1JGGA 1OCZH 1YS6A 3ZQIA 5DDGA 2KKOA 2COBA 3ASOH 4KYWA 3E1SA 2VT3A 1H8HA 4FQGA 1FP2A 4JOMA 1XB4A 5E17F 2PEXA 1N0VC 5LFAA 2HDWA 1BL0A 1O8IA 4EW9A 1LKXA 3G6EB 4Y3OA 5D4SA 2DBBA 1AKHA 4QIWN 1W87A 4RLFA 2BYVE 3C7JA 4GO1A 4U0VA 3A0BC 5FLXK 3TL4X 2E1MC 4A3LJ 2LF7A 2RC6A 4A69C 3WNCA 1HW1A 3ZBTA 2M2EA 3OV8A 4M3GA 5GV7A 3IWFA 2WWYA 1OQYA 1Y39A 4WZTA 2INUA 4D5CA 5TV2A 2FX0A 3PSIA 1IV8A 4HX7A 3CDLA 2DY1A 1UELB 3EUKL 3RPUA 3BTJA 2CSOA 2DOAA 1V4RA 4Z4ZA 2P5LC 1PUFA 3WQZA 2HFHA 1MW7A 4A3IJ 5H20A 3V8JA 2BN4A 2EH3A 4U49A 2PLYA 5J40A 3KEYA 5CVVA 4RLZA 1KZHA 4A5MA 3ZUGA 2X3UA 2EBIA 2HS5A 4BPRA 2M9HA 4XICA 4EMSA 2VNIA 3QAHA 3IAS2 1J09A 3OS1A 1JKOC 5E3OA 1KMHA 3GIRA 3JU4A 1FDRA 3G3ZA 1FEXA 5F0HA 4UY8I 2FSWA 2DLLA 4C2UA 1Y8QB 2XAUA 4RB3C 1R4NB 1MJ9A 1Q1HA 1F20A 3BQZA 3J7YJ 1QVUA 1NB0A 1X1AA 4CICA 2HOSA 2XRLA 4UUSB 1GXQA 5TR9A 2VFOA 1R5GA 2BW3A 3A35A 4N4NB 1K28D 2OCCH 4IRIA 4EGZA 1OGOX 2O04A 1ZG5A 3JX8A 2OAZA 3T1BA 2OTLI 1YW8A 1YOVB 3K7AJ 3QOEA 3ASTA 3OWTA 1BW6A 4G7ZF 4X7CA 3LMMA 1J59A 3BR3A 2PFBA 2X85A 4BAYA 1FOKA 1OCRH 4XIDA 4X0GA 1RI7A 2RGVA 2KZVA 1ZKGA 1D1CA 3VR6A 2NVXJ 5LHIA 1DABA 4NQWB 1E63A 1SFEA 5CYVA 1MBKA 2EFWA 5EF6A 5F04A 4BBRJ 1EZGA 4G7WA 2AHQA 5FLMJ 4PDKA 2Y48A 2C77A 4XN3A 4I0BA 1N05A 1FWZA 3RJPA 4KIBA 3GVKA 1W7PD 3F8FA 1IJEA 2GA2A 5C1EA 3S16J 3OW2B 3I58A 3HIFA 3LWFA 3W6JB 3PFIA 2QMUA 2VL8A 4YEJA 2E1NA 5M5XJ 2JDIA 2FMYA 5E1XA 1WOPA 3E1YE 4DNTB 3IH3A 3GFIA 2V4JC 2HCJB 2EIJH 4Y7CA 1KGSA 5C44J 4L9NA 1KU9A 2DT7B 3HUGA 2M5SA 4RDJA 2CW5A 3T51B 1KD1D 2DJNA 2EQRA 2V79A 4E70A 4OPVA 5A88A 4ZDPA 2OTLB 4NNJA 3U1DA 1O4XA 2CQKA 1D0ZA 3LO8A 3LSKA 4CXFA 3E7LA 2LBFB 2OBTA 3P27A 1E0EA 5GPAA 4OJPA 4TT3A 5F6FA 4NBSA 4B4CA 3GQ8A 3QU6A 1COWA 1LNWA 5H2FC 2F2EA 4XONA 3F21A 3J7AO 4MLOA 2E1RA 1OYYA 2UUZA 2QGGA 5ICEA 4I0AA 4UXNA 1FYKA 2CUEA 4CGZA 2FJ1A 4N9IA 2DA2A 4TMZA 4IKFA 5F4JA 1QPIA 3E5XA 4YFNF 2EV5A 5JLWA 3ONYA 5EMNA 3OYAA 1EFCA 2PYGA 2JN6A 5TGTA 3LSPA 3G4SI 4K1XA 2R7SA 2EILH 4LB6B 1W36C 1ZG1A 1Z7LA 1VQMI 2FE3A 2J8IA 2L0KA 1WJBA 5JLXA 3ZOBA 5HNHA 3W2VA 1U8BA 2OK7A 3WTVC 1YI2B 1KA8A 1WJEA 2INVA 3TP3A 2QKMB 1G7TA 1QCXA 3HEFA 4XNFA 2YX7A 3BCFA 1WWXA 2DK5A 4B47A 4RGSA 1EP2B 3BZCA 2YU9J 2TRTA 2R5ZA 2QZAA 1O8DA 4ZYEA 2R7VA 3OIQA 1K4SA 1UAAA 4YZAA 5J8CA 2WTEA 4IOAF 2BMWA 1R9TJ 1MNEA 1AU7A 4YZQA 3ZCOA 4F3QA 3K0LA 3L7WA 3I59A 1J7KA 3PA2A 4OIRF 2PBIA 5GADJ 1HA3A 3BH7B 1QHHD 4C2TA 5CKTA 1O8LA 4DZPA 4HEA2 2ZJQF 2BY1A 3OOPA 1V5GA 2IA2A 2O1DA 4OOSA 2V9KA 3CCJI 3ZRGA 3CMEI 1A35A 1ACIA 1FX7A 2LY1A 3PSFA 3VODA 1QX4A 2W6JA 1UJ8A 2Y30A 1K73D 5LGTA 5ERIA 4KN7X 3FPKA 4WK8F 1P7IA 3PQJA 1PUFB 1JHFA 4PAAA 3WY9A 4ZYGA 1O7FA 2AQEA 1K78A 3DU5A 5THXA 3RY8A 3MQ0A 3KEWA 3OZUA 1WQ2A 1VQMB 3I55I 1X0CA 1WSRA 4RD4A 1IDJA 3JQPA 2E5NA 3DBHB 1QU3A 4ZH4F 3ONUA 2MSYA 2IW5A 3MZYA 5LLQA 4IHVA 1D0XA 4AYBA 2CQ7A 4B48A 2IS2A 2OK8A 1K6OA 5K7ZA 1EFUA 2VNJA 1WJDA 1HCRA 1H80A 3AG3H 1JRGA 1IGNA 5LGUA 3KZIC 2RV8A 5FFXA 3LQ6A 3CJTB 1V55H 3TMOA 4I09A 3DPTA 4LBZA 4YAWA 2NVUB 2NAZA 2VXDA 3G1LA 1FNDA 1GQ8A 2XKOA 2BW3B 2X6XA 3JCUC 4YXWA 2F48A 4M73A 1GLNA 5D8LB 1IDZA 5IYQA 5IOZA 3QU3A 1LFUP 2ZB9A 1BI0A 5D5VB 5LD2C 3HGYA 2O6WA 3CCJB 3DFGA 4EATA 3HOUJ 2HQAA 2JVGA 1DGRM 4RCYA 4WZKA 3CMEB 3GCMA 2BGJA 3FMSA 4AYBN 2V6CA 1CF7A 3K70D 2WB1A 1FP1D 4X1EA 4P3YA 4AIJA 2DCUA 2BSPA 2R7OA 5HOOA 5D5WB 3I1FA 1OKRA 2NZMA 5JLVC 4BH9A 4P2NA 3U6KA 1UMKA 2VFPA 1QVFB 5LRSA 2XGDA 3WU2C 3O8GA 3Q9VA 4XLEA 3B6AA 2HQ5A 3AG1H 5FGMA 3E6CC 3ZIAA 4XLAA 3FHZA 4IHWA 4OPOA 3Q0UA 4C3JJ 2XGXA 3KLOA 3BCAA 1U8RA 4P9SA 4M9SA 2ECBA 2DI3A 1ZN2A 4PFPA 1MDMA 2XGJA 2FMLA 2ZTGA 1QFYA 2E1BA 1U5TC 2IPQX 2Q2EA 5DCMA 3MZHA 2K3PA 2Q6IA 4KKTA 1WCMJ 1M1KD 4O5VA 4TV7A 3RDIA 5K7FA 1GAWA 3ZQFA 2DODA 2I10A 2ELKA 3TOAA 5GTIC 3HUGB 1G7CA 2WB1N 1UHMA 1P4AA 3VWBA 1E43A 2EK5A 5CVRA 4S05A 2AS5F 1VQNB 2X1CA 1GAQA 2FEZA 2L9RA 3GYHX 1POGA 4HPQA 2P5VA 4XKBA 5BSXA 2OPTA 3S2DJ 1LEAA 2DYRH 4YELA 3CLOA 5J3LA 1G3YA 3BNWA 2VBWA 2JA7J 1ZRCA 2GIZA 3GF2A 1ZM4A 1V54H 1IG7A 2JIZA 2FQ4A 2J5OA 3MAJA 2DA6A 1AIPA 1R58A 2HQNA 4IHYA 2KRFA 2XDVA 4OU0A 2BM4A 2W1OA 3GZ5A 2OQGA 1BI1A 2CG4A 2MD5A 3B90A 5LMZA 1QRBA 1Y0RA 4R1HA 2JMWA 2E1CA 2JRTA 1E1RA 3FXOA 2KJBA 4DBQA 4XRSA 2DA1A 3WE3A 3B8HA 4LB5A 4G5GA 4RB0A 4AU7A 2XZLA 5FL7A 2X53S 1A6IA 4FX4A 2DFIA 2Y0MA 3LFKA 1K5CA 4ESJA 1RESA 3QFTA 2ZBVA 2RDPA 3QSYA 4G6IA 1AMOA 2VKEA 1QVTA 4ZZLA 4WZEA 1QRCA 2XV4S 3PJRA 3NWTA 2O03A 1YHQI 5JHUA 4XR6A 4JP0A 1JT6A 3OMYA 2G7UA 1TWFJ 2E36A 2JSCA 3QPTA 4RM3A 2R5ZB 1IXCA 3QP6A 3CCLI 3BROA 4LBYA 4OAYA 5JHFA 2JA6J 1MBEA 2EZLA 4FE4A 3VSLA 3I59B 1W2BB 4C2LA 2WAEA 3TEDA 4LOCA 4JX4A 2PE3A 1EP3B 3DTKA 2DYSH 2R93J 2AQFA 3WTYC 4HDUA 1O7LA 3H94A 4EJUA 2HKXA 2CW0F 4LLGF 4G1BA 4DJAA 2H09A 4F7ZA 4XLNF 3UW0A 3R6JA 1SANA 1J75A 2XKPA 4V2GA 2F5DA 3JQRA 3OKXA 2AXLA 2ZCWA 3K6GA 1QBJA 1UB9A 2R7DA 5J35A 3RYRA 4B3GA 3MN2A 4G6QA 1I1GA 5L3FA 3S3MA 3F23A 2CV1A 2PECA 1V5FA 2X1EA 4IEJA 1H8AC 2ZXWH 3L1PA 1S4MA 4Q5SF 4DNCA 5FD6A 2ZL6A 3OYIA 4RGXA 1JKPC 1N0UA 1KU7A 1ZRFA 2BF4A 1WPKA 2D5VA 1IN6A 2V7VA 2WYRA 2QA4B 1BI3A 1T33A 1QRYA 2A6HF 3NARA 4G9YA 5H6RA 3LNNA 5C1CA 3BQYA 3IL2A 2IS1A 3A0HC 3IC7A 4TMVA 4AF7A 4MXNA 1LJ9A 1JKRC 2W4SA 1BI2A 2F43A 2HVQA 2IVMA 3CCVI 2FRHA 3FISA 2PX9A 5H6QA 2V5IA 2W7ZA 2VFMA 1TNSA 4WXDA 1ZLJA 2XB0X 4FWTA 4M53A 3WTWC 4YIIA 2IOUG 3BZ6A 2ADUA 4CCJA 2C6YA 1WH7A 3V8KA 4OIPF 2PLFA 1YIOA 4ABZA 3B82A 1TTYA 4WXHA 3AKZA 3SLDA 2DERA 4DYRA 2QSHX 2Q6KA 1NDHA 3LQEA 5J3OA 3J81Z 2ID6A 1JUPA 5BNGA 1CF7B 3CMAI 2JJ2A 3NAWA 2RQQA 5F4MA 1Q86D 3ELKA 4RB2C 1HG8A 1HOMA 3BTCA 3F8BA 5K5OA 3CUOA 3WGIA 5FKNA 3BG7A 2P8TA 5FKOA 3FJOA 3W2IA 2EJRA 2NRAC 1TYXA 4BGDA 4GQNA 5AIPA 4CHUA 3GTQJ 1XQBA 3IKTA 4M3EA 3G71I 4HNTA 4TMXA 3EQOA 1NG6A 2RNJA 1RQRA 1HLVA 1FRNA 1Y0NA 1MDMB 3HSEA 2CK3A 2YWEA 2DA3A 1N8RD 2O0VA 2Z8GA 1XMKA 2Q2EB 5DCMB 3RQIA 4EV0A 4WCGA 3T9GA 3SHFA 1FY7A 3HG9A 1UHSA 1G6NA 2LFBA 1RUNA 4XK4A 1NH3A 4DNRB 5ILVA 2NYXA 4NK8A 3S1QJ 1N75A 1X4OA 5DS9A 1Y0YA 4HOBA 4CSWA 4AC9A 2GWRA 4QVJA 2HYFA 3CESA 2QZ8A 2E71A 2FF4A 2MG4A 5GAGJ 1MD0A 2ELHA 1IXRC 5CQEA 3K4BA 2LD5A 2DDBA 2X0LA 1YRNA 3H35A 1B9MA 2EFOA 5J4VA 3OFNA 2VBKA 2B7CA 3CMAB 3GZNB 4I76A 2YX4A 4BKXA 1WSVA 1SVMA 1I1SA 2P6TA 3ECHA 1J5YA 2UVFA 4YZXA 3WXMA 2PN6A 3B78A 2ZSIB 2V7FA 3SJZA 3H9QA 4HDVA 3SEZA 1U0JA 2XAGA 3GO5A 4GGGA 5CVJA 3FXLA 3CJNA 1FTTA 4AVZA 3BC9A 2X51A 5A89A 3OZVA 4ZGNB 4DYCA 1G3SA 1IB0A 5D5UB 5EG0A 4ENMA 1OB5A 4RJLA 1PP7U 1UHWA 3F3XA 1OR7A 5JVGF 2P5KA 1QFJA 3OAAA 3UR3C 4KKUA 1P2FA 1F5TA 1W35A 3REOA 5IT3A 1U2RA 1R1VA 1ETWA 4PJMA 2L5QA 1I27A 4GYIA 1Q7YD 1XDUA 4PC2A 1D5YA 2DJIA 2F5CA 3ZPLA 1DDGA 5TY0A 1LLZA 2GQQA 2OU2A 1NRKA 1K6YA 2BY3A 1TYVA 2R7FA 2EZKA 4GDFA 2LNBA 1GR1A 2BHZA 3S17J 5E8IA 1KQ0A 4CZCA 1Z7UA 1XB2A 4AVPA 1VZ0A 1UD5A 1FBSA 4MQVA 1IW7F 2W57A 5EEAA 2ACJA 4HNUA 4S0HB 5FKKA 2ZFUA 3FXQA 5EYRA 3F8NA 4YFXF 3ZSCA 2QM3A 4UB6C 3DQVC 1MBGA 1KCDA 2CRGA 4YRVA 5IK2A 2VQCA 1CLWA 1KYWA 5JVTA 1FTZA 4KT6A 1X1CA 3H5RA 2KJCA 4Q7JB 3CMMA 2MH9A 2D9RA 2GJKA 1TWHJ 1MNDA 2VFNA 5BSYA 1RR7A 3F22A 4LC0A 1G59A 3M07A 1R6RA 5L46A 2HNHA 3V7RA 4IZZA 1R4MB 1WXRA 5AONA 2OUMA 3KP3A 3J80K 3AGQA 1VQPI 2P3MA 2MD0A 4BDZA 3D5LA 1BX0A 2NS7A 3BR1A 2X6YA 3LSGA 2YWHA 1FPQA 3DXJF 1NBMA 2K86A 2R5YA 3GTPJ 2Y69H 1O88A 1VQ9I 4A12A 2DU9A 2V26A 2X6WA 3DTEA 2JA8J 1OCCH 1R7JA 4KN4X 4LD5A 1YE9A 3A1YA 4XM3A 4BEHA 3HOXJ 4JX5A 4NB5A 4YFKF 1PJ7A 3W2EA 4UNOA 3HM5A 2OQRA 4OOVA 1F1ZA 1TL8A 3OS0A 3VO1A 4HX4A 3MFKA 1P9QC 1YQAA 2HXOA 3EYYA 4MGRA 5HDNA 2XSJC 4XBFA 3T8RA 2LH9A 2FBIA 3CCMI 1O8EA 3AK5A 3R61A 3TO6A 2HDCA 1WJCA 1MBFA 5F0FA 1U9OA 1U6GA 4ON0A 3QFSA 1AIRA 4C9YA 3VNUA 2VBTA 1TQPA 2F1LA 1VQLI 1K4ZA 2VNHA 3FMRA 5F64A 1W5CC 5JBQA 1ZTRA 2IT0A 2JA2A 1HKSA 2ZXHA 1D1NA 1XGNA 2W00A 1D1AA 2OCEA 2E7XA 3UNGC 3VFZA 4EVIA 5IP9J 1F4KA 3T53B 3VSUA 3K69A 2BOLA 3ZP5A 2LVSA 2J5PA 1SM4A 1VQPB 1Y8RB 4JMQA 4U7DA 2L7ZA 1RIOH 3CQZJ 3OYNA 4D7MA 2JPCA 2O61A 1KC8D 1HXDA 4L9VA 2V1XA 2RC5A 4RLQA 1TNTA 2G0YA 1SAUA 3E5UA 1H0MA 3QPHA 3CJRB 1KU2A 4X0CA 3BZKA 1FBUA 5DEQA 5BPIA 3G6EI 1W36D 4ESFA 3SXYA 1XGOA 3I4MJ 2GJRA 2XF7A 4MYTA 3FF5A 2XPUA 2EWEA 3TDZC 3RIQA 5D6EA 3CO6C 3LSIA 1E3OC 1MH4A 1Z6TA 1XC5A 5CLSA 3CCMB 1YRNB 1E3PA 3LAPA 1P4WA 2E19A 2JT1A 1B8IA 4ZCMA 1XCVA 4H4KC 2C78A 2L9SA 4YAOA 1IZ1A 1IHMA 1T5EA 2EZIA 2X1DA 3I53A 1Z9CA 2XSDC 5F08A 3E6DA 5DM7F 2EFNA 3I71A 3KZYA 3SKBA 4Z03A 4KKSA 2DQRA 1YJWI 4GRIA 5KAFC 2C4TA 4OOXA 5M3FJ 5E1WA 3V4GA 2A07F 3GRHA 4V19K 1REPC 1DPUA 1XSXA 2QWWA 2WY7Q 1V5EA 4MFEA 4MTDA 1SD7A 5EG0B 1KTVA 2BX6A 5AMVA 3C18A 2JA5J 2L54A 2VJJA 3K2ZA 3AVTA 2XF5A 3MKWB 4BJTA 3GFMA 1R23A 5DD4A 4B3XA 5HLGA 3Q3AA 3LSMA 4HF2A 3Q0VA 3J7AY 3VB2A 2EFQA 4NBQA 4A2UA 2B63J 5L3GA 1XD7A 1W34A 1QG0A 2XEXA 1K79A 4UVCA 1WVRA 1ETXA 4GYGA 2WV1A 4PJJA 2HYGD 1N08A 3B02A 2WY8Q 4YALA 2QF7A 4L5EA 3ZBUA 2HGCA 2KL4A 4A3CJ 2GA1A 3KP7A 5B1AH 2ZSHB 3SQVA 1IN5A 2HZTA 2Z5UA 2QSFX 2WADA 2Z1DA 3EETA 3M9AA 3ZQGA 1RC9A 2O8XA 3Q3SA 2D1HA 2X4HA 4OOIA 2VIXA 3SZPA 3JSOA 3W3CA 1TBXA 2FQ3A 2ZMEA 1JGSA 1LM1A 2NT9A 2R9VA 1B9NA 1YW9A 3CCYA 1YJWB 4IXAA 1OCTC 5ILUA 1ORKA 5ED4A 4A3KJ 4RDKA 2L7KA 3CP2A 3GEZA 4M4SA 3HOTA 2R7RA
chains in the Genus database with same CATH topology
1IDJA 3ZXSA 2E5NA 3DLAA 1QU3A 4BJ6C 2IGKA 4E7JA 2KHMA 1W0JA 2RNGA 4XLHA 4BL0B 1D0XA 2I8DA 4AYBA 1E79A 3OY9A 4B48A 2X8KA 1DQUA 2IS2A 4B3FX 1PXZA 3GQ7A 1WJDA 5FRMA 1H80A 1JRGA 5HVQC 4NUBA 3ZPNA 2E60A 3A3GA 4BDYA 1UD3A 3TMOA 3IAM2 4XN0A 4E7KA 1OB0A 3DEEA 4J01A 4QPOA 3DPTA 1BHEA 3OYEA 4YZ0A 1PLUA 4QPQA 2VXDA 3TBIA 4BEHB 1GQ8A 5HLTA 2BW3B 2X6XA 2IGNA 3OYJA 3I3LA 4YXWA 1GLNA 2O5RA 2WZPP 4XKVA 1O8MA 2CW8A 2PMZA 1JTAA 5LD2C 1Z3XA 4TKOB 4EATA 2HQAA 2JVGA 1DGRM 3H9GA 4CCLA 1BR1A 1Z21A 2VB6A 4E7IA 2ZZGA 1VBLA 4DK1A 3ZQQA 1N77A 4FETA 3RTRA 4L8JA 4II3A 4HWVA 3K70D 2WB1A 3U21A 3MMYB 3RQ4A 1UG0A 2O0WA 4HG2A 3DDYA 2BSPA 2R7OA 5HOOA 2XNDA 2KMUA 3OYLA 2A6TA 3PFYA 4Y4RA 3BH4A 2NZMA 2LRDA 4D1QA 3W2WA 3OW7A 4CCNA 3WWGA 4XLEA 3DTIA 3D5SC 3L2VA 3ZIAA 3AL0C 2L2OA 4XLAA 2UVEA 2LY2A 2ZZFA 2IQ7A 1BMFA 2XZPA 3BCAA 2LZJA 3H0DA 2HLDA 4XMYA 4PFPA 2XGJA 3ZGKA 4PJNA 4OAZA 4PFOA 2ZTGA 2E1BA 2K3PA 2F5VA 4KKTA 2NSPA 3D5RC 2NTPA 3ZR8X 4BQNA 2IGOA 4RMNA 3QYFA 2HPMA 3HUGB 1BR4A 4ZDLA 4E7ZA 3VWBA 4KISA 3HOSA 4XQFA 1BOBA 3RSNA 3L2RA 1E43A 3K70C 2BVMA 2M4KA 2X1CA 3VSTA 2QXZA 2WJVA 4XOPA 4HPQA 4XKBA 3KYLA 3LSHA 1VF7A 1TZLA 3HXLA 4YELA 2XC7A 4E7HA 1UD2A 2WA0A 5DN6A 3JURA 3FBIB 2JIZA 4UZUA 2CH0A 3C2HA 3VYRB 4R79A 3PNYA 2JSPA 4BUPA 4F93B 2QE7A 3K4MA 4XD7A 1VJSA 3NWSA 2XDVA 3B4NA 2W1OA 1OGMX 2LOOA 3B90A 3F9KA 3S32A 3VSKA 1WPCA 4XORA 4NC8A 1E1RA 4F52A 1X1BA 2VJ4A 4DBQA 2XZLA 1BN8A 1PE9A 4AU7A 2V6EA 2M7BA 3GBGA 4G6TB 4F91B 4G7XA 2X53S 1DP3A 4PSXA 5FL7A 3AFHA 2F4IA 1PJRA 4PMHA 2KLOA 4OJOA 5HNFA 3VSVA 2ODLA 1K5CA 2E5ZA 2M0MA 4LITA 1EFRA 2M7AA 2HPIA 4C30A 4G6IA 1H8EA 2Q1ZB 2HU9A 3PJRA 4XKWA 2UWMA 3NWTA 2JUGA 2HVRA 4XR6A 1FX0A 1HA8A 3OPOA 3OMYA 4RM3A 1SFKA 3OE7A 2R4GA 4BJ5C 2HZDA 3HKZA 4Z1MA 2KRHA 4OAYA 3OR2C 1IA5A 5JHFA 1UD8A 1I8DA 3VSLA 1MMGA 1TT0A 2LREA 4C2LA 2WAEA 3L2QA 3VMWA 3PNTA 4W8SA 2ZZQA 2FUG2 3A4CA 3M1CA 3QODA 5FROA 1O8KA 3DTKA 4F92B 2AQFA 2VJ5A 2KDOA 3OYMA 3PUBA 5CPRB 4OZZA 3H94A 1AA7A 4DJAA 2CW7A 1WJAA 3FKJA 3OYKA 2V4DA 3LL7A 1I18A 2KPMA 3UW0A 4HRIA 4Z05A 2IS4A 3K6GA 3GVLA 4BE2A 3OEHA 3W2AA 4B3GA 4IX7A 4DOZA 3S3MA 2CV1A 2PECA 3HPHA 4J00A 4D9JA 1E3ZA 4BQQA 1V5FA 2WAQA 2X1EA 1UD6A 1VLYA 1X1DA 4OWRB 5KHDA 3VDXA 1D1BA 2P0WA 1HZEA 1OOCA 3HPGA 2VBMA 2IXSA 3K4CA 2WPDA 2R7WA 4KJZA 4XLFA 3OYIA 3DU6A 3HC7A 3SYTA 1WJ5A 4CUGA 1E1QA 3BCBA 3DPUA 1ZELA 4CCMA 2CV0A 5C1CA 3H5NA 1OFMA 3LNNA 5CDFA 1T95A 1MMNA 4OZYA 1FMVA 2IS1A 2QY1A 3K4NA 4MXNA 2KRCA 4BQOA 2W4SA 2F43A 3G05A 2HVQA 2Y0SA 1W9XA 4ZC3A 2R7XA 3OIPA 3OYFA 3IP4B 3K4KA 4LG3A 1ERDA 2LYCA 1RMGA 1IRXA 1MMAA 5CQGA 1V0EA 4CCJA 4URRA 1WJFA 1IB4A 4BU2A 2MC4A 2WBMA 3VYUB 3AKZA 4F55A 1IDKA 3MD2A 4HIZA 3G2BA 4E4HA 4I84A 4BS9A 3AL0B 2VBEA 1EE6A 3MKZA 3I9V2 3OL4A 2JJ2A 2RQQA 4W8QA 1OFLA 1HG8A 1KZLA 1BLIA 1DGWY 4NC7A 2MFZA 3QYBA 2CMPA 3BG7A 3ZPPA 1OLTA 1X19A 3EUHC 3K10A 2V1NA 4BGDA 4GQNA 4PJLA 2DCEA 4OJLA 1LVKA 2Z2SB 1BR2A 4HNTA 3EQOA 1NG6A 4NK6A 3PL8A 2CK3A 2O0VA 2VPLA 2W82A 2CS3A 2Z8GA 4ZTFA 1T0FC 2Q2EB 4ZTJA 1G8XA 3T9GA 1YX5A 2VJIA 3HG9A 4XKCA 2F1MA 2V7QA 3GQ9A 3DPLC 1OHHA 4DNRB 1S9HA 3EUAA 4NK8A 4OJ5A 1N75A 1X4OA 4CSWA 4BE1A 3GVJA 3L2UA 2JVHA 3CESA 1O8HA 3OS2A 3FBNB 4U4BA 4Z06A 3KX2A 1Y56A 4W8TA 4Y33A 2LBFA 3OL3A 5CQEA 3K4BA 1O8JA 3ONQA 2QX3A 4FASD 1NHCA 3H35A 3OFNA 3HL2A 2VBKA 1X4PA 3CP8A 4RM2A 1O8FA 3RCOA 2VASA 2KVOA 4XOTA 2Z6BD 3BG6A 2UVFA 4YZXA 4E6KG 4DK0A 2ZSIB 2V7FA 2K5CA 3BLYA 3H9QA 4LIUA 3VYTB 3EPZA 3SEZA 2GK7A 1U0JA 3OR1C 4TSFA 3GQAA 4HSTA 4PUSA 3KRGA 4AVZA 3BC9A 2X51A 4B44A 3FY3A 4XL9A 4ZDOA 2GK6A 3OEEA 2XF6A 1N78A 1WFXA 4BACA 1W0KA 2K9LA 3VMVA 2VQGA 2R7TA 3SDBA 1FMWA 2WSSA 3LFUA 2OV7A 1WMRA 4ANJA 4ZJZA 2VLAA 3B8YA 3OAAA 3UR3C 3E1SA 4DBRA 1H8HA 4KKUA 1BPLA 4PJMA 4JOMA 2L5QA 4MR0A 2CUJA 5LFAA 2HDWA 2DJIA 1SKYB 1O8IA 4EW9A 1LKXA 4Y3OA 1NRKA 1K6YA 3RPUD 2D3NA 1OR7C 4RLFA 3OYGA 2JJ1A 3BCDA 4CZCA 4IQJA 1XG2A 3TL4X 2E1MC 5KCMA 1VZ0A 3H9JA 2K9MA 3SEQA 1UD5A 2F6CA 4CCKA 3S3NA 4HNUA 3SZGA 3H5AA 2ELJA 2DIEA 2ZFUA 2INUA 2KQRA 3OYCA 3PSIA 2IS6A 3ZSCA 3A3BA 1UELB 3DQVC 3EUKL 2XOKA 1KCDA 2VKHA 4YRVA 2DOAA 2VQCA 3S8PA 3MKYB 5IK2A 3K4JA 2W6IA 4KT6A 1X1CA 3H5RA 4XLCA 2GJPA 3WQZA 3CMMA 2ZZEA 4P1WA 1MW7A 2DT6A 3QYEA 2PJRA 2GJKA 5FRNA 1WTHD 1MNDA 4ITVA 1Z3YA 4U49A 1G59A 3KEYA 2NSTA 2X3HA 1R6RA 2HNHA 4IZZA 2NOJB 2OUMA 4W8RA 2QKLB 4KITB 3IAS2 1J09A 3OS1A 1KMHA 3JU4A 2GOXB 1RWRA 2MD0A 2MABA 4BDZA 4E7LA 3D5LA 4C2UA 4BXFA 2WAFA 2XAUA 3CJQB 2X6YA 3LSGA 4N4OB 1MMDA 4E7SA 1WP6A 3T56B 1NBMA 2LC2A 4ZYAA 1O88A 1X1AA 1JI8A 3S93A 4ASUA 2V26A 2X6WA 3DTEA 4XM3A 1YE9A 3A1YA 4BEHA 2BW3A 1UD4A 3A35A 4N4NB 1EA3A 1K28D 2R7UA 2O04A 1OGOX 3A2KA 3OS0A 3OYBA 2VXZA 3QOEA 1P9QC 3OWTA 2XSJC 2VQLA 1DBOA 2LH9A 1O8EA 3LMMA 1QJVA 2PYHA 3CF2A 1WJCA 2X85A 4X0GA 2NTBA 3GQBA 1AIRA 4C9YA 2KZVA 3SUCA 1D1CA 3VR6A 4NQWB 4PSWA 2L9NA 4JQFA 2KP6A 1KONA 2JA2A 2ZXHA 4G7WA 2IGMA 2W00A 1D1AA 3UNGC 1CZFA 2A5WA 3T53B 4P22A 3VSUA 4XN3A 5HKKA 3S3OA 2BOLA 3EQNA 3GVKA 4JMQA 2M4GA 5C1EA 3NE5B 4OJ6A 3OYNA 2VL8A 2R7QA 4YEJA 1MABA 3M8JA 2JDIA 4RLQA 4CA0A 4DNTB 1SAUA 2V4JC 3DWLE 3CJRB 3FHNA 2DT7B 2M5SA 3T51B 3K4LA 1W36D 4BE0A 5KNLA 4P5OA 2GJRA 1DBGA 3FDYA 2XF7A 2M3AA 2ZXIA 2CFOA 2EWEA 1YX3A 3CZ6A 4ZDPA 1KCCA 3L2WA 4NNJA 1D0ZA 3LSIA 3LSKA 2CV2A 2NT6A 2LBFB 3E0JB 1E0EA 4OJPA 4TT3A 3GQ8A 1COWA 2RREA 1QHGA 2OC6A 4XONA 4H4KC 3BC8A 2L9SA 3OYHA 3FPPA 4MLOA 4DIQA 1T5EA 4U87A 2UUZA 2X1DA 4CCOA 2GOMA 2VKDA 3HAGA 2D3LA 4IKFA 4Z03A 3LMWA 2WJYA 4KKSA 3OYAA 4GRIA 2MYSA 5TGTA 2PYGA 2R7SA 4LIVA 3GRHA 1W36C 1PKVA 1Z7LA 2WY7Q 1V5EA 5AMVA 4CH7A 5HNHA 1WJBA 3W2VA 2VJJA 4IQ4A 2LG4A 2XF5A 1Y6IA 3C2GA 1WJEA 3MKWB 2DXIA 4BJTA 2INVA 2QKMB 1QCXA 4XNFA 4B3XA 2ZTNA 3FKSA 3LSMA 2CUZA 3J7AY 3BCFA 2NTQA 1D0YA 4B47A 3DKYA 2XZOA 3DKXA 1O8GA 2E1MB 3OOUA 4DGWB 2O17A 1O8DA 2W7NA 4E0FA 2R7VA 3OIQA 1UAAA 4YZAA 2HVSA 1V0FA 4PJJA 1MNEA 3N05A 3OYDA 4YZQA 3ZCOA 4F3QA 2WY8Q 2KL4A 3OOCA 2BVLA 3IUOA 1HVXA 1QHHD 2ZSHB 4C2TA 5CKTA 1O8LA 4HEA2 2WADA 2Z1DA 1E3XA 1V5GA 4PK4A 2O1DA 2V9KA 4B43A 3PNVA 3ZRGA 4FXUA 2VIXA 1KTWA 2LY1A 3PSFA 2Z16A 3W3CA 2NT9A 2W6JA 1PYVA 3V42A 2R9VA 3VYSB 1NG7A 1LFPA 1LDKB 1RU4A 2AQEA 2VQHA 3DU5A 4HSRA 2L7KA 2V31A 2UV1A 3CP2A 4II2A 4U7BA 3KEWA 1X0CA 2PJRB 3HOTA 2R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  4XKW A;  2NTB A;  4W8T A;  1AIR A;  3SUC A;  1O8J A;  4XR6 A;  2QX3 A;  1NHC A;  4XLH A;  2VBK A;  1PXZ A;  3GQ7 A;  1H80 A;  1O8F A;  1IA5 A;  1JRG A;  1CZF A;  4XOT A;  3VSU A;  4XN3 A;  2UVF A;  4YZX A;  4XN0 A;  4C2L A;  3VMW A;  3EQN A;  1BHE A;  4W8S A;  5C1E A;  4YZ0 A;  1PLU A;  4OJ6 A;  4Z06 A;  1O8K A;  4YEJ A;  3GQA A;  1GQ8 A;  4OZZ A;  3KRG A;  2X6X A;  4AVZ A;  3FY3 A;  4XL9 A;  4XKV A;  1O8M A;  1JTA A;  3UW0 A;  3VMV A;  4Z05 A;  1DBG A;  1VBL A;  2EWE A;  1WMR A;  4HWV A;  1KCC A;  3B8Y A;  2PEC A;  2NT6 A;  2O0W A;  2BSP A;  4OJP A;  4MR0 A;  3GQ8 A;  1OOC A;  1O8I A;  4EW9 A;  2NZM A;  2VBM A;  4XON A;  4XLF A;  3WWG A;  4XLE A;  2UVE A;  4XLA A;  5C1C A;  2IQ7 A;  1OFM A;  1XG2 A;  4OZY A;  2QY1 A;  4Z03 A;  4MXN A;  4XMY A;  3LMW A;  2PYH A;  2PYG A;  2INU A;  2NSP A;  3GRH A;  2NTP A;  3ZSC A;  5AMV A;  1KCD A;  4URR A;  1RMG A;  2VJJ A;  1IB4 A;  4XQF A;  4XLC A;  2INV A;  1IDK A;  1QCX A;  3VST A;  4XNF A;  2QXZ A;  4XOP A;  4I84 A;  2NTQ A;  2VBE A;  4U49 A;  1EE6 A;  4W8Q A;  4YEL A;  1O8G A;  1OFL A;  2NST A;  2X3H A;  1HG8 A;  3JUR A;  2O17 A;  4W8R A;  1O8D A;  4YZA A;  3ZPP A;  1RWR A;  4OJL A;  4YZQ A;  2X6Y A;  1O88 A;  3B4N A;  3EQO A;  1OGM X;  3B90 A;  4NK6 A;  2X6W A;  1O8L A;  2O0V A;  4XM3 A;  2O1D A;  2Z8G A;  4XOR A;  1KTW A;  3T9G A;  1PE9 A;  1OGO X;  2O04 A;  1BN8 A;  2VJI A;  2NT9 A;  3GQ9 A;  4PMH A;  4OJO A;  3VSV A;  4NK8 A;  4OJ5 A;  1RU4 A;  2ODL A;  1K5C A;  1DBO A;  1O8E A;  1QJV A;  1O8H A;  1X0C A;  2X85 A;  4U4B A; 
#chains in the Genus database with same CATH topology
 3LNQ A;  4RAY A;  2KIM A;  4G7O F;  2O7O A;  4E7J A;  4BHC A;  2KZG A;  2KHM A;  1FNN A;  2XT2 A;  2E1O A;  1FNB A;  3FIW A;  1W0J A;  4XLH A;  2J8K A;  2I8D A;  4B3F X;  1X2M A;  4P6Y A;  4JBA A;  4GFB A;  3GQ7 A;  1YLF A;  4BY7 J;  5A8A A;  4NUB A;  1FOW A;  2E60 A;  3G1O A;  5LHG A;  1JA1 A;  2ZNY A;  3IAM 2;  1UD3 A;  3IV5 A;  4J01 A;  4QPO A;  1A31 A;  5FKL A;  2R5Y B;  1BHE A;  3GFL A;  5TJJ A;  2K4J A;  3U2Q A;  1OCO H;  4BEH B;  1QA3 A;  2UXX A;  3LA7 A;  2Q8K A;  2B0R A;  2IGN A;  1ETY A;  4LK1 F;  4XKV A;  2DMN A;  4L5I A;  2CW8 A;  2VI6 A;  4RS8 A;  3CF5 F;  2GPJ A;  1W4M A;  1Z3X A;  1OFE A;  1R5H A;  4CCL A;  3DV8 A;  4E7I A;  2VUM J;  3W2F A;  3VNV A;  3ZZU A;  1D8J A;  3F72 A;  1N77 A;  3A1P A;  4X7E A;  1X2N A;  2VE9 A;  1SD4 A;  4D0P A;  2Z99 A;  4UV9 A;  2FBK A;  3R60 A;  4RPB A;  3MCA A;  1IO2 A;  1HQC A;  2XPW A;  3WOD F;  1HW2 A;  3RQ4 A;  1UG0 A;  2O0W A;  1JB9 A;  3F6O A;  3U6B A;  2XND A;  1H88 C;  2A6T A;  3BH4 A;  1TW2 A;  2NS0 A;  3CCS I;  1ELO A;  1KQS B;  4YFO A;  4D1Q A;  1FJL A;  4ZCI A;  3W2W A;  3J7Z I;  2M45 A;  4CCN A;  4DQK A;  3CO7 C;  3E3V A;  4G12 A;  3WG7 H;  3I4N J;  3PVD A;  3VO2 A;  5GPC A;  2L4M A;  4OPS A;  5LRR A;  2IQ7 A;  1YI2 I;  5DSZ A;  2BVN A;  4OIN F;  3WTS C;  1X1P A;  2HQR A;  1I6H J;  1X3W B;  1FOY A;  1BQE A;  2GIV A;  1YIJ I;  2PQ8 A;  2HMA A;  2XC1 A;  2D74 A;  3MEX A;  3ZR8 X;  4BQN A;  4Z4V A;  4RMN A;  2HPM A;  3ERE D;  1T6Z A;  3CMY A;  1YJ9 I;  5GTH C;  1Z6R A;  1RMG A;  5GAH J;  4Y7N J;  4UAJ A;  4XQF A;  1BOB A;  2DMQ A;  3BR0 A;  4R8H A;  2DFE A;  2VBU A;  3PM1 A;  2ID3 A;  1B2R A;  4XOP A;  1JA0 A;  2C2W A;  2HKO A;  3LSH A;  3CD6 I;  1VF7 A;  1CNF A;  3RPQ A;  4I6Z A;  2FU4 A;  4E7H A;  4NHJ A;  4X6A J;  1UD2 A;  3KLN A;  2F4M B;  3AGP A;  2DOE A;  3PUF A;  4YEI A;  2WA0 A;  4M3B A;  1BJZ A;  1JTX A;  3FBI B;  1B8I B;  4Y52 J;  1ZQ3 P;  1OYI A;  2CH0 A;  4OMZ A;  5A2Q Z;  1KJZ A;  4RBO A;  3VYR B;  2JSP A;  2M0C A;  4F93 B;  4MHG A;  4I02 A;  3CCS B;  3I4P A;  3TO9 A;  3Q5F A;  3B4N A;  1OGM X;  3MCZ A;  4G94 A;  2EZH A;  4Z4S A;  2K27 A;  2A05 A;  3Q39 A;  4ACA A;  1WPC A;  4NC8 A;  2MBF A;  4G7X A;  1J9Z A;  3GBG A;  1KK0 A;  1DP3 A;  3WTX C;  1YJN I;  3AFH A;  1YIJ B;  3KP4 A;  1ZG3 A;  1G7R A;  4O3M A;  2ODL A;  4LIT A;  1R49 A;  1EFR A;  3PO2 J;  1BOA A;  4NCN A;  2PMD A;  2E35 A;  1YJ9 B;  1Q9S A;  3NRV A;  1LE8 A;  4X7D A;  3ISX A;  2JUG A;  5EEG A;  1J2X A;  1HKT A;  4RGR A;  1YTY A;  1SFK A;  4Z4W A;  4QWQ A;  4B3A A;  1TYU A;  2CYY A;  3CD6 B;  2R4G A;  1E64 A;  3PUN A;  1GVD A;  2KRH A;  1IA5 A;  4EQQ A;  1FYM A;  4HW0 A;  1B4A A;  3ZMT A;  3T8T A;  4OIO F;  1UD8 A;  3ASN H;  3CLQ A;  2DA4 A;  2H27 A;  1U2W A;  3CDH A;  1PVE A;  3PNT A;  4W8S A;  2JPB A;  2CND A;  3A4C A;  3M1C A;  1ZGA A;  3OYM A;  2KDO A;  3QFR A;  5CPR B;  4ZV4 A;  4WWV A;  3TKY A;  2LTP A;  1WJA A;  2ZME B;  3PQK A;  3OYK A;  1JE8 A;  3ASP A;  3LL7 A;  4IW3 B;  2KPM A;  4HZF A;  3JRC A;  4Y9R A;  1EH6 A;  2M8E A;  3H36 A;  1QO0 D;  3DEW A;  3AVX A;  2ZO4 A;  1K8A D;  3GVL A;  4BE2 A;  1VI0 A;  1FT9 A;  3W2A A;  3PA1 A;  2CO5 A;  4IX7 A;  1YJN B;  3R6S A;  5E6T A;  2L01 A;  3EDP A;  4H0E A;  1DDN A;  2ZJR F;  3OP1 A;  1X1D A;  2CQX A;  2H1L A;  1ENH A;  2IXS A;  2WPD A;  1YFH A;  3W5U A;  1OMI A;  2QQB A;  2EIX A;  2IAI A;  2B5O A;  4CUG A;  2ECC A;  3BCB A;  3DPU A;  1ZEL A;  4CCM A;  3BOQ A;  3BT9 A;  2Q6O A;  4A3F J;  1W5T A;  5CDF A;  3GLL A;  1T95 A;  1MMN A;  3LSR A;  1FMV A;  4HQM A;  4HF1 A;  1XGM A;  1VQN I;  2O3F A;  5M5W J;  3E20 A;  5IYB J;  3Q38 A;  3G05 A;  2Y0S A;  3BJ6 A;  4AWX B;  4MEX F;  1RKT A;  3OSG A;  1V5V A;  2YPR A;  3L2C A;  2VNK A;  4EJV A;  5F27 A;  2LYC A;  3N4M A;  3KEO A;  1IRX A;  1MMA A;  2ESH A;  2Z33 A;  1OGI A;  4RAF A;  3ULQ B;  4URR A;  4BU2 A;  3GTM J;  4UV8 A;  1H42 A;  2M34 A;  1Q1V A;  4PZJ A;  4HIZ A;  5IYP A;  3G2B A;  4E4H A;  2A5Y B;  3FM5 A;  1XMA A;  2WV0 A;  5FFZ A;  3AL0 B;  1EE6 A;  3I9V 2;  3OL4 A;  4LK0 F;  1OFL A;  1E17 A;  1DPR A;  1KZL A;  5BS6 A;  4U0W A;  1T08 B;  1BLI A;  1DGW Y;  2BE5 F;  4ETS A;  4NDL A;  3JAM Z;  4L9J A;  2XHK A;  1S29 A;  1OLT A;  2LKX A;  3Q6Q A;  3W2G A;  3GSI A;  3O8H A;  1SFX A;  3TOB A;  1LVK A;  2F5E A;  4OPW A;  2Y0S N;  2Z2S B;  4Z4Y A;  1H85 A;  4WX9 A;  3G1M A;  3P4G A;  4P6V F;  2FNA A;  2KIU A;  4WWC A;  4RA2 A;  1IXS B;  1G8X A;  4FN5 A;  1Q81 D;  1TWC J;  4LMY A;  3WG9 A;  4BHP A;  5IY5 H;  1U78 A;  4ENK A;  3M3Y J;  1G7S A;  2B7B A;  1NJI D;  1S9H A;  3EUA A;  4NC6 A;  2W24 A;  5DD8 A;  4OJ5 A;  2Y75 A;  1JJ6 C;  3DCF A;  1BC7 C;  2NVQ J;  2JVH A;  2RAE A;  2P4W A;  3ZQL A;  1YS7 A;  4IHT A;  1O8H A;  3FBN B;  4U4B A;  4Z2Y A;  3KX2 A;  1D5V A;  2YWF A;  1KYZ A;  3JTH A;  4W8T A;  2DN0 A;  1O8J A;  4M9Z A;  1LQ1 A;  3ONQ A;  2XTX A;  4IRG A;  1ZRD A;  4FAS D;  3JRE A;  1A8P A;  3HL2 A;  3KFW X;  3WTT C;  3Q0W A;  3R0J A;  1ODD A;  2HOE A;  4RM2 A;  1S5L C;  2KVO A;  4A93 J;  4DK0 A;  2KIQ A;  1HC8 A;  2FA5 A;  3BLY A;  4AC0 A;  3EPZ A;  2OTJ I;  3OR1 C;  3HOZ J;  1XPX A;  1MNM C;  4RD0 A;  4KA4 A;  3AVW A;  3DF8 A;  4HNV A;  5F0C A;  5IT9 Z;  2XTW A;  2N8G A;  4B44 A;  1SVL A;  3R4K A;  4PGH A;  4RGU A;  1FSH A;  2BY0 A;  5H59 A;  3OEE A;  1W0K A;  2VQG A;  2OZU A;  3SDB A;  1FMW A;  2WSS A;  2BM6 A;  3TGN A;  3LFU A;  4YCQ A;  1P92 A;  2OV7 A;  1WMR A;  2QA4 I;  3B8Y A;  2VLA A;  1FC3 A;  1E2X A;  1XX5 A;  2XAQ A;  3HTU A;  4IPA A;  3ZQH A;  1LE8 B;  1K83 J;  1SEU A;  1MSF C;  1BPL A;  5D8K B;  1ZYR F;  3V76 A;  4ZGQ B;  4MR0 A;  2CUJ A;  3RKX A;  2LP0 A;  2V7U A;  4MO7 A;  2K02 A;  2MH2 A;  2P6S A;  1CGP A;  1ETK A;  1PJ5 A;  2ZBU A;  4M71 A;  3RPU D;  4FE7 A;  2D3N A;  1ETQ A;  1OR7 C;  2IJL A;  2MGQ A;  1DG1 G;  3LVB A;  3FXR A;  2XGE A;  1T2K A;  1UZC A;  2K3F A;  3ABT A;  1QUE A;  4V02 C;  4IQJ A;  1XG2 A;  2HXI A;  5FLV A;  3H9J A;  3O3K A;  2K9M A;  3SEQ A;  4DQ2 A;  1N25 A;  5BMZ A;  1VQ6 B;  3S3N A;  1D3Y A;  1OYW A;  3SZG A;  3H5A A;  2DIE A;  3OYC A;  2OTJ B;  2IS6 A;  1JKQ C;  1GVH A;  2C4U A;  3A3B A;  4FCY A;  3ML3 A;  3S8P A;  1SFU A;  2BM1 A;  3K4J A;  3DLL F;  4XLC A;  2W6I A;  4IL6 C;  2BGI A;  2GJP A;  5EGO A;  4P25 A;  1ETO A;  3CCR B;  3BTL A;  4I98 B;  2YUS A;  3QYE A;  1UFM A;  4J19 A;  2BZT A;  2E2I J;  4CDG A;  5FRN A;  4P1V A;  2DQL A;  1Z3Y A;  2ISZ A;  2A3S A;  2QEN A;  1ZUN B;  2NST A;  2X3H A;  1R36 A;  2VPR A;  1X3U A;  1L0O C;  2EB7 A;  2NOJ B;  2CGP A;  4W8R A;  4G7H F;  1QZE A;  3RKY A;  1IRG A;  1NHA A;  2R3S A;  1J9I A;  3DEU A;  1LLW A;  3BY6 A;  4BXF A;  3CJQ B;  2W84 A;  2VOD A;  4N4O B;  3T56 B;  2JUC A;  3JRB A;  4ZYA A;  1ZM9 A;  3LA2 A;  3S93 A;  4ASU A;  5JR3 A;  2OBR A;  4HYE A;  2IBD A;  1Y1W J;  4A0X A;  1TP4 A;  1UD4 A;  4D7N A;  2DMT A;  3KET A;  2R7U A;  3ASR A;  1ETV A;  5D6F A;  1WZ2 A;  1EH8 A;  2D45 A;  3A2K A;  4M3D A;  2EA2 A;  3OYB A;  3HB9 A;  2VXZ A;  1W0U A;  3PSS A;  4P9F A;  4XRS G;  4RAZ A;  1QVG B;  2QVO A;  2EIK H;  5E20 A;  2QQ9 A;  2EPF A;  2DTR A;  4K2E A;  3TO7 A;  4G1V A;  3TP0 A;  3CF2 A;  2PYH A;  1H89 C;  1PDN C;  2O6G E;  3SZE A;  2HWV A;  4X05 A;  2L7F P;  2AXT C;  5EZH A;  1IN7 A;  5EZG A;  1HF0 A;  5FKM A;  2L9N A;  2QEX I;  4JQF A;  4KT5 C;  2XAF A;  3CPW B;  2M1B A;  2VBV A;  4KNY A;  2A5W A;  1IAW A;  1N07 A;  5HKK A;  1ZAO A;  3CC4 I;  4KH3 A;  4FT8 A;  5M5Y J;  2M4G A;  3G73 A;  4LBW A;  4PC6 A;  2VOO A;  4OJ6 A;  1S7O A;  3CPX A;  2VFQ A;  1V3F A;  3S2H J;  2R7Q A;  1MAB A;  1Y1V J;  3M8J A;  2UZK A;  3O2P E;  5GP9 A;  2QCO A;  2QBY B;  5CVI A;  4PC1 A;  4RPD A;  4PCQ A;  2ICW G;  3V7S A;  1HKQ A;  1IUF A;  3A8I A;  2BXY A;  3S2W A;  1ZGJ A;  1DBG A;  1OPC A;  1BA5 A;  2M3A A;  3C1D A;  1IF1 A;  1W7P A;  2ZXI A;  2V1U A;  1YX3 A;  3CZ6 A;  1EWY A;  1R5B A;  3L2W A;  3ZZT A;  1SMY F;  1FYL A;  5J8F A;  2CV2 A;  1ZRE A;  1ZAR A;  3E0J B;  1O3T A;  3QFC A;  3FXU A;  2FBH A;  1VQK I;  1EF4 A;  3H1C A;  2RRE A;  1ZM3 A;  1QHG A;  2LSO A;  2OC6 A;  3FX3 A;  4U87 A;  5D5X B;  3WE2 A;  3CUQ A;  1TQM A;  2M8G X;  1IV6 A;  3BTI A;  4P26 A;  2QEX B;  4GXO A;  4YDT A;  2VKD A;  1QUF A;  3HAG A;  1TLL A;  3SZT A;  4Y13 A;  3RZD J;  3BG3 A;  1SAX A;  1QGY A;  2NPF A;  2D2W A;  2OBP A;  4EJW A;  1ZH5 A;  4LBV A;  2KIF A;  2MC3 A;  5DS0 A;  3CC4 B;  1BJA A;  3RI4 A;  5GAE J;  1IUY A;  4LIV A;  2XNJ A;  4PAB A;  1PKV A;  4JX6 A;  3BDD A;  1WSU A;  4L0Z B;  3HRU A;  1GXP A;  3LQR A;  2V7W A;  3AVV A;  1P6R A;  4IQ4 A;  1Y6I A;  4HBL A;  3JR9 A;  1HBX G;  4IVN A;  2Y31 A;  5F1J A;  1EXM A;  3FKS A;  2ZTN A;  4A3J J;  1DU6 A;  2CUZ A;  1NK2 P;  2JQ7 A;  2CF4 A;  1D0Y A;  2EV6 A;  1O8G A;  3ZN0 A;  3OOU A;  1TT5 B;  2XAS A;  3GUD A;  4DGW B;  2O17 A;  1HSJ A;  1UG2 A;  5HZA A;  1GHC A;  2DA5 A;  2GXG A;  4KIC A;  3OSF A;  1FOX A;  3V7A A;  3MWM A;  3N05 A;  3BG9 A;  3OYD A;  3F6V A;  1F60 A;  1WDT A;  3RKW A;  1VQK B;  1T98 A;  2PG4 A;  2VT2 A;  3BPX A;  4Z6Y A;  1QA2 A;  3HRM A;  1S3J A;  3OOC A;  1KRH A;  2KDZ A;  1OFD A;  3BG5 A;  1HVX A;  2A6E F;  3H3Z A;  3IRR A;  3ZMZ A;  4FXU A;  4Y15 A;  4P3I A;  1ONV A;  4LJZ F;  1VQ4 I;  2BV6 A;  3NAU A;  1PYV A;  3V42 A;  1X3Z B;  3MZ8 A;  3VYS B;  1NG7 A;  2JWT A;  2ZBK A;  2LF8 A;  4XRF A;  1LDK B;  1RU4 A;  2DA7 A;  1O57 A;  3FKI J;  3QQA A;  4HSR A;  2XPV A;  5EGO B;  1T39 A;  4II2 A;  4IHS A;  2V31 A;  3K2A A;  1OFM A;  2Y2Z A;  2CQN A;  1G2H A;  1IB4 A;  4RCZ A;  1ON1 A;  3DLA A;  2ZME C;  4G6D A;  1GT0 C;  1R00 A;  1GJR A;  2E34 A;  3B6C A;  3CC7 I;  2YWG A;  4PGO A;  3SJM A;  4I2O A;  4BYY A;  3OY9 A;  1PXZ A;  5E18 F;  1DQU A;  1OFC X;  1F43 A;  3BQJ A;  1B23 P;  4HF0 A;  3HKZ N;  5FRM A;  1AHD P;  2BPO A;  4A6E A;  4XN0 A;  3T0Y A;  1OB0 A;  3DEE A;  2K85 A;  4Z4R A;  2ME6 A;  4WZL A;  4DYQ A;  5DYM A;  1PLU A;  4QPQ A;  5L3D A;  2XRN A;  4L18 B;  2P81 A;  4M0L A;  5HLT A;  2JZY A;  4Q47 A;  2K40 A;  4OP7 A;  1GDT A;  3OYJ A;  3I3L A;  3GLX A;  1O8M A;  1BM9 A;  2PMZ A;  4MYU A;  2HOT A;  1FLI A;  1JJ8 C;  3KYD B;  3GTO J;  4TKO B;  4JK1 X;  1TTT A;  2COM A;  3H3U A;  3H9G A;  2ZKZ A;  2VB6 A;  1SD6 A;  2ZZG A;  5B66 C;  3FK7 A;  2Y9Y A;  3HZJ A;  1R1U A;  4X07 A;  1VQ4 B;  4FX0 A;  5ICC A;  5A2Q K;  1JXS A;  3ECO A;  4L8J A;  5IP7 J;  1P4X A;  1HST A;  4II3 A;  3JQQ A;  3LAJ A;  3MMP A;  4TMT A;  4HWV A;  1K7A A;  3MMY B;  4B09 A;  2JRM A;  1RRJ A;  5LEK A;  1PUE E;  4HG2 A;  3DDY A;  1H9T A;  1BW5 A;  2QTL A;  4M6V A;  1XS9 A;  2LRD A;  3D0S A;  4BY1 J;  1IDY A;  3F8M A;  3OW7 A;  2DPU A;  1G3T A;  3Q6R A;  3DTI A;  1R1T A;  1ZHF A;  3D5S C;  4PC7 A;  3L2V A;  2VBX A;  3CC7 B;  2M87 A;  3AL0 C;  4QV2 A;  2UVE A;  1XSD A;  4ZCL A;  5H5J A;  1FIP A;  2LZJ A;  2L02 A;  3H0D A;  4XMY A;  2PMZ N;  1D2E A;  2HLD A;  4IHX A;  4PJN A;  1B72 A;  4PFO A;  3EYI A;  3TQN A;  4MQ9 F;  3PET A;  2IGO A;  2I1L A;  1QPM A;  4ZDL A;  2F3L A;  3P9C A;  3HOS A;  3RSN A;  2IP2 A;  5IP6 A;  4RD3 A;  2VON A;  3E97 A;  3WTU C;  2BVM A;  2GAU A;  1W7P B;  3VST A;  1F9N A;  2QXZ A;  3ASQ A;  3KYL A;  1XSV A;  3MHP A;  4B8X A;  3HGG A;  1RPW A;  3HXL A;  3L09 A;  5ICG A;  1FRQ A;  5JMC B;  4UVA A;  1HW5 A;  1JT0 A;  3JUR A;  5IYW A;  1XDS A;  4D5F A;  1GUU A;  1SC7 A;  1B6A A;  1GV2 A;  2ETH A;  4GCV A;  4WQM A;  3LYC A;  4UZU A;  3N6Z A;  3CUQ B;  4M1K A;  4R79 A;  1HDD C;  4XD7 A;  4PJ0 C;  1X58 A;  3K4M A;  5J4Y A;  2QE7 A;  1ZLK A;  3U2R A;  2V7X A;  3NWS A;  4IO9 F;  1MBH A;  5KVR A;  4MTE A;  1ZK8 A;  4ZYH A;  2ESN A;  2O0Y A;  3W6K B;  3S32 A;  1BJK A;  1WGX A;  3MVP A;  3VSK A;  3GTL J;  4OIQ F;  1X1B A;  3I54 A;  1KK1 A;  1PE9 A;  5K7H A;  2V6E A;  2M7B A;  3GFJ A;  4F91 B;  4XRM A;  4PSX A;  2F4I A;  3VSV A;  2KFD A;  4UZF A;  5DUI A;  4L5J A;  2E5Z A;  3FM3 A;  5HLI A;  2HPI A;  5FIU A;  3KP5 A;  1CQT A;  3GTJ J;  4IRH A;  1VQO I;  2HU9 A;  1H9G A;  3FXM A;  3GW2 A;  4R71 A;  2BM5 A;  2QQA A;  3SY2 A;  2HVR A;  4A0Z A;  4C2M J;  2XTY A;  3VPR A;  4A3E J;  3AG4 H;  2MLG A;  1LEB A;  1HA8 A;  2GQF A;  1YG2 A;  2HEO A;  2XB5 A;  3OPO A;  2M5W A;  2E2J J;  3OE7 A;  4M6X A;  1BBY A;  2HZD A;  3HOY J;  1W0T A;  2VC0 A;  3A8J A;  1AWC A;  2VBY A;  3CW2 A;  1ZM2 A;  3H9N A;  1MMG A;  1TT0 A;  2LRE A;  2Z3Y A;  3H92 A;  4AID A;  3JRI A;  3L2Q A;  2ZZQ A;  2FUG 2;  3KP2 A;  1UCR A;  4UZE A;  1VHE A;  1O8K A;  3W6V A;  4W1U A;  3PUB A;  2DTZ A;  3QPS A;  1XE1 A;  4OZZ A;  2IA0 A;  1W1W E;  3TW6 A;  2V4D A;  2CW7 A;  3FKJ A;  1GVJ A;  4HV6 A;  4A0Y A;  1QZY A;  5EDN A;  1I18 A;  1K61 A;  5FJ8 J;  3ZC3 A;  3WHC A;  1LFB A;  1S8N A;  3JAM K;  1TWG J;  2X48 A;  3ERM A;  2L3D A;  3P7N A;  4BHB A;  4M9X A;  4BBS J;  2TCT A;  4D9J A;  1E3Z A;  4F7D A;  2WAQ A;  2V1D A;  4UHT A;  5HOD A;  1TVC A;  2ISY A;  1B59 A;  4OWR B;  3VDX A;  4LLN A;  2P0W A;  1HZE A;  3WGH A;  3HPG A;  1OOC A;  1RR8 C;  1VQO B;  3T5X A;  1KQ8 A;  2R7W A;  4XLF A;  3DU6 A;  2Z9O A;  2DT5 A;  3LOC A;  5KW9 A;  5E3N A;  5E8G A;  1R5O A;  2HR3 A;  1VQ7 I;  1U3E M;  2F5F A;  2KIS A;  2CV0 A;  4X06 A;  3JRF A;  2DYI A;  2QY1 A;  4CZZ A;  1P7J A;  4A3B J;  3L9F A;  5DCF A;  4BQO A;  2V7T A;  1Q82 D;  1W9X A;  4ZC3 A;  3IRQ A;  3OIP A;  3J81 k;  2QLZ A;  2DOF A;  4LG3 A;  5LEJ A;  1RUO A;  1T6X A;  3PUM A;  3GME A;  4EM1 A;  4XSX F;  4CYC A;  5CQG A;  3H0G J;  1KK3 A;  1V0E A;  1WJF A;  5B6I A;  1O3R A;  4BXU A;  2WBM A;  1QNT A;  2WAQ N;  1N06 A;  3AVY A;  3HJE A;  3EUH A;  4F55 A;  4RDL A;  3MD2 A;  3S1R J;  4I84 A;  2I5U A;  4BS9 A;  2VBE A;  2UXN A;  2E7W A;  4YIF A;  1TWA J;  1MJB A;  1ZR4 A;  2QTZ A;  1DAR A;  5C3E J;  1MIJ A;  5FNZ A;  3FZV A;  4XLP F;  3GXO A;  3PEN A;  4NC7 A;  5FA6 A;  3QYB A;  1LDD A;  3UKG A;  1T0F A;  3ZPP A;  5ICF A;  1X19 A;  2RQP A;  4G8X A;  5IT9 K;  1HF2 A;  2DCE A;  2BSA A;  2C5H A;  3OZW A;  1TYW A;  3U9G A;  5J1U A;  1JUM A;  1BR2 A;  1RKW A;  3BJO A;  4I99 C;  2F4N A;  2ZC2 A;  2QDX A;  1EFT A;  4B4D A;  2GRE A;  4N9H A;  2EFP A;  3FXJ A;  1EJ9 A;  3PO3 J;  4NK6 A;  4XSZ F;  1VQ7 B;  3PSZ A;  1B72 B;  2VPL A;  2W82 A;  3M8E A;  4ZTF A;  2BEO A;  3AG2 H;  4P9U A;  2VE8 A;  4S04 A;  4KIG A;  2VJI A;  1JTY A;  3J80 Z;  2OBS A;  1FSE A;  1Z67 A;  4XKC A;  2W25 A;  4MNU A;  2F1M A;  1K9M D;  3DPL C;  3KYC B;  3CCU I;  1OHH A;  4I7H A;  3GVJ A;  2MW8 A;  2CFX A;  4RM0 A;  4Z06 A;  2VYQ A;  3HBL A;  2CRV A;  4Y33 A;  2PMU A;  3HSR A;  1EA0 A;  1SD5 A;  3AAF A;  5HS8 A;  1TC3 C;  3TDU C;  1LVA A;  3WHB A;  4FTH A;  3CP8 A;  3ABU A;  2DEU A;  4YC5 A;  4B1R A;  5FO5 A;  3JRD A;  2CU7 A;  2VAS A;  3RCO A;  3SJP A;  1LB2 A;  4J0Q A;  5E79 C;  4E6K G;  3ABK H;  5DTD A;  2K5C A;  1MRZ A;  3KL9 A;  4M72 A;  2YU3 A;  3K9T A;  1E3H A;  4EM2 A;  3ES9 A;  2GK7 A;  2E2H J;  3A01 A;  2GLO A;  5IPA A;  1VHO A;  3GQA A;  4HST A;  3QPL A;  3FY3 A;  3I64 A;  1BC8 C;  4ZDO A;  2DMP A;  3HYI A;  1MBJ A;  2PJP A;  4MFD A;  3SQN A;  2GK6 A;  2DMU A;  1N78 A;  2HOA A;  2K9L A;  4YG2 F;  3FWE A;  1WKM A;  2LDU A;  2HTJ A;  3Q9S A;  2C5B A;  2JN9 A;  1NTC A;  4ROX A;  4ANJ A;  3CCU B;  4ZJZ A;  2QYU A;  4DBR A;  1OB2 A;  3BR5 A;  4U88 A;  3WU0 A;  5C4X J;  4LG0 A;  1MGT A;  2NNN A;  1NB9 A;  1O3Q A;  1JHH A;  1I3A A;  1SKY B;  4M6Y A;  2NXN B;  3H09 A;  2L4A A;  3IWZ A;  4A3D J;  2K9S A;  3IH4 A;  4WF2 A;  1S72 I;  1EP1 B;  2DFF A;  4DZJ A;  3OJW A;  3HTS B;  1TLH B;  3BJA A;  2JJ1 A;  1B1B A;  3OYG A;  3BCD A;  2B0L A;  2DDA A;  3H3V K;  4ACB A;  3J81 K;  1QGZ A;  2XIG A;  2R92 J;  4C43 A;  3KEQ A;  4JRA C;  5KCM A;  1AKH B;  2F6C A;  3CB4 A;  2VKV A;  4LFU A;  1KK2 A;  4CCK A;  4RB1 A;  1R5N A;  4Q4Z F;  1SMT A;  4OMY A;  2ELJ A;  2BGC A;  2KQR A;  5EJC A;  2OF7 A;  1I50 J;  3P9I A;  2OD5 A;  1Z0X A;  2LKS A;  2XOK A;  4AIH A;  2VKH A;  2WC2 A;  3MKY B;  2IRF G;  5KSW B;  2QUF A;  3IHU A;  2FXA A;  2ZZE A;  1FNC A;  1S6L A;  5BPD A;  4P1W A;  2HDD A;  2HTS A;  3JRG A;  1QQ1 A;  2DT6 A;  2PJR A;  1MJA A;  4DW6 A;  3K1N A;  4ITV A;  3R0A A;  5AIQ A;  1WTH D;  3G4S B;  3E5Q A;  4ENJ A;  4QUZ A;  3QOP A;  2ZL5 A;  1KU3 A;  2TDX A;  2EWN A;  2QKL B;  1I3Q J;  4IF4 A;  4KIT B;  5CVU A;  3HOW J;  2GOX B;  1Z05 A;  2H94 A;  2STT A;  3WBK A;  4IOC F;  1RWR A;  2MAB A;  4E7L A;  2QN6 A;  3QWL A;  2WAF A;  4E7S A;  3FMQ A;  3L00 A;  1MMD A;  1WP6 A;  4C3H J;  2LC2 A;  3LST A;  1PJ6 A;  3WYA A;  1JI8 A;  3P26 A;  1S72 B;  2ZJ2 A;  1W5S A;  3HHH A;  5B5E C;  1G3W A;  1ULY A;  3EQL F;  1EA3 A;  1R5I D;  1VF9 A;  5D4R A;  3PIP F;  2NV4 A;  2O9L A;  1EV7 A;  2R0Q C;  4YAF A;  1OCP A;  4CYC B;  1IRF A;  1BN5 A;  3E6M A;  3R6K A;  4TMW A;  4KIF A;  5FLX Z;  2L9V A;  4EJT A;  3JRH A;  3BP8 A;  2VBZ A;  1XN7 A;  2VQL A;  1DBO A;  4M3F A;  4UB8 C;  1SVO A;  1D8K A;  1YYV A;  1QJV A;  1DP7 P;  1S0U A;  3SDG A;  3D26 A;  4HLX A;  2NTB A;  3ESW B;  1YW7 A;  3GQB A;  3SUC A;  1JNY A;  2GXB A;  4PSW A;  2B9S A;  2KP6 A;  1IN4 A;  1KON A;  5DM6 F;  3LQQ A;  4M74 A;  1YIT I;  1Z91 A;  3D1N I;  4KFC A;  1I7P A;  2IGM A;  2JTV A;  5LHH A;  1CZF A;  1JJ2 B;  2XAH A;  4P22 A;  3WBJ A;  3I55 B;  1STZ A;  3S1M J;  1A04 A;  1T6Y A;  3S3O A;  3A02 A;  3HSF A;  4FHT A;  3ZQC A;  2QBY A;  3EQN A;  4IJA A;  3NE5 B;  2W85 A;  2EFG A;  2R6H A;  1XTA A;  1LPQ A;  3N97 A;  4CA0 A;  1IC8 A;  1K4T A;  1A6Q A;  1BIA A;  3DWL E;  4M2L A;  3FHN A;  3SEJ A;  3W5V A;  2OYN A;  1I5Z A;  1UST A;  3A03 A;  3K4L A;  3M7G A;  4FK8 A;  2EIM H;  2NOG A;  4BE0 A;  5KNL A;  4P5O A;  4BQA A;  2CBX A;  3CRZ A;  3FDY A;  2CFO A;  1KCC A;  1WHU A;  1TQI A;  3LSJ A;  4PGG A;  4KDP A;  2NT6 A;  2DAO A;  1TSP A;  2YSR A;  5IYR A;  2FNP A;  2STW A;  1VQ6 I;  2LY9 A;  3OYH A;  1QFZ A;  3FPP A;  3BC8 A;  4DIQ A;  1YO5 C;  5L3C A;  3SLN A;  4Q48 A;  4CCO A;  2ZIT A;  2GOM A;  2D3L A;  1YIT B;  4Z4T A;  3CCR I;  3A01 B;  2XT4 A;  2WJY A;  3WND A;  3LMW A;  3ISP A;  1WI3 A;  2CUF A;  1WI9 A;  2LMD A;  2MYS A;  4UUT A;  4AUX A;  4UUV A;  3ZMD A;  3SFZ A;  3CUQ C;  3ZMV A;  1IN8 A;  2YR2 A;  3ASS A;  3K1M A;  1ZR2 A;  4CH7 A;  2V9P A;  5L3B A;  1DUX C;  2H8W A;  5E1Z B;  3TH0 A;  2BBY A;  2LG4 A;  3C2G A;  3KIO A;  2DXI A;  4EGY A;  3HDD A;  1WRJ A;  2G0E A;  1WH5 A;  1TUI A;  2M30 A;  2NTQ A;  2XZO A;  3DKY A;  4LG0 B;  3DKX A;  2E1M B;  3I5U A;  5J6X A;  2V9V A;  2QGU A;  3W2H A;  1WOS A;  3BY1 A;  2W7N A;  4E0F A;  4QLC U;  2H6B A;  2HVS A;  4RD2 A;  5K5R A;  3P9K A;  5TRD A;  1V0F A;  4A5N A;  3W5H A;  1QA1 A;  1J0R A;  4HE5 A;  2X9D A;  4ZYD A;  5J1R A;  4EEF G;  1CNE A;  2ZNZ A;  2BVL A;  4WXC A;  3IUO A;  2FOW A;  5HXB A;  1VQ8 I;  4L9T A;  2DW4 A;  1E3X A;  4PK4 A;  3JTG A;  3SYJ A;  4B43 A;  3NEU A;  3PNV A;  1KTW A;  2Z16 A;  3BH6 B;  1RZ4 A;  1MKM A;  4EM0 B;  1BIB A;  3COA C;  2YUH A;  1LFP A;  5E3M A;  2NS8 A;  2VQH A;  3B73 A;  1P4M A;  1QGA A;  4OM9 A;  2H6C A;  2NNY A;  2UV1 A;  4U7B A;  2PI0 A;  4W97 A;  1G4D A;  2PJR B;  5FO0 A;  2EV0 A;  3PIO F;  4RD1 A;  3ZXS A;  2Q6L A;  4QHY A;  4UVB A;  4BJ6 C;  5F1R A;  2IGK A;  1K78 B;  1BX1 A;  2RNG A;  1SFO J;  4I01 A;  5DV5 A;  4BL0 B;  5B1B H;  1E79 A;  5FD5 A;  2X8K A;  1ON2 A;  3GX4 X;  2DK8 A;  2BY2 A;  4Y9U A;  3WU1 B;  3LA3 A;  5HVQ C;  4JYK A;  2P7C B;  3ZPN A;  3A3G A;  4BDY A;  2F4O B;  4E7K A;  1K8F A;  5IYC J;  4H9G A;  2FD5 A;  2RKH A;  3OYE A;  1YHQ B;  4YZ0 A;  3F8C A;  3M1E A;  4KUM A;  1YLO A;  2Y9Z A;  1Y0U A;  3TBI A;  3V8L A;  1KQ5 A;  3ZMU A;  1ITY A;  4RD6 A;  5LBQ A;  3CCL B;  2H8R A;  2O5R A;  3KCC A;  3F0C A;  1QH0 A;  3ZMS A;  2WZP P;  5HDG A;  2DET A;  2GZW A;  2L7M P;  1VQ8 B;  1JTA A;  2MLK A;  2EIN H;  5LGN A;  3DBL B;  5J1Y A;  5AN9 A;  3LJY A;  3HRT A;  4QTR A;  1BR1 A;  1Z21 A;  2ZFW A;  4DK1 A;  1O3S A;  3ZQQ A;  1FNM A;  4FET A;  5KAI C;  3RTR A;  5HLH A;  1FZP B;  1VLO A;  3QE2 A;  2BM0 A;  3U21 A;  2RN7 A;  2AO9 A;  4P96 A;  4HE6 A;  1GV5 A;  2OJE D;  4HAM A;  2VOP A;  2IEK A;  3NQO A;  1EKE A;  2KMU A;  3VEP A;  3OYL A;  3PFY A;  4Y4R A;  1F36 A;  1U5T A;  2B7E A;  3ZN1 A;  1APL C;  1WOR A;  1FBQ A;  3WWG A;  4AD9 A;  5B3S H;  3S1N J;  4A6D A;  2AHO A;  2L2O A;  2LY2 A;  1JUS A;  2ZZF A;  1BMF A;  2XZP A;  2K9Q A;  5DUK A;  3RZO J;  1AOY A;  1DDI A;  3ZGK A;  1L1I A;  2CJJ A;  4OAZ A;  3QRF F;  4A3G J;  2Q0O A;  2CQQ A;  2F5V A;  2CWE A;  1YX2 A;  3D5R C;  1IJF A;  2NSP A;  2NTP A;  9ANT A;  2BHY A;  3QYF A;  1A36 A;  2XUB A;  1BR4 A;  1VND A;  3HOV J;  2HYJ A;  4E7Z A;  4FIS A;  4KIS A;  2XNC A;  3L2R A;  3K70 C;  3KZZ A;  2K7L A;  2M4K A;  2WJV A;  3AVU A;  1VFC A;  2VN2 A;  3CCV B;  1TZL A;  1I39 A;  3WGG A;  1WU8 A;  2VC1 A;  2XC7 A;  5TIS C;  1E62 A;  3GTK J;  2ME0 A;  4LGW A;  5CJ9 A;  2BM7 A;  5DN6 A;  2X6O A;  4ASN A;  2IA1 A;  4U0Y A;  2VBS A;  2BXZ A;  3C2H A;  2HDN B;  5DNS A;  4N0B A;  3PNY A;  4BUP A;  1XGS A;  5JFR A;  3RYP A;  1VJS A;  4N3G A;  3RIR A;  2LOO A;  3N90 A;  3F9K A;  4Y17 A;  1OJL A;  1S7E A;  4ESB A;  4LLL A;  3I0T A;  4XOR A;  1DU0 A;  5EEH A;  4F52 A;  2VJ4 A;  2YS9 A;  1BN8 A;  3GTG J;  3DKW A;  4MIM A;  4G6T B;  3GZ6 A;  1XFO A;  2A68 F;  3A8K A;  4PMH A;  1PJR A;  2O8K A;  2KLO A;  2OA4 A;  5HNF A;  4OJO A;  2RC4 A;  3G71 B;  3OIO A;  1TW3 A;  2M0M A;  2FVG A;  2J7K A;  2ZL7 A;  2M7A A;  4C30 A;  1XCB A;  2MA3 A;  4DQL A;  1QGP A;  1H8E A;  2Q1Z B;  4AM3 A;  4XKW A;  4QSH A;  1Z1D A;  2UWM A;  1HDP A;  5KK1 A;  1FX0 A;  3X2Q H;  1GO2 A;  1M90 D;  1WOO A;  2K9N A;  1XMX A;  2FOK A;  2VZL A;  3ZQ7 A;  4BJ5 C;  3HKZ A;  4Z1M A;  2ZJP F;  1C0W A;  3OR2 C;  1SKQ A;  2XGC A;  5J47 A;  6PAX A;  2PIA A;  4PC3 A;  2DFH A;  1I8D A;  5BOX A;  3S15 J;  3C2B A;  2QSG X;  4YHB A;  2W48 A;  1FIA A;  5JI6 A;  1IJW C;  3VMW A;  1LUJ B;  2CC2 A;  2NVY J;  3ABM H;  3QOD A;  3ROU A;  5FRO A;  2GM4 A;  3CCQ I;  4F92 B;  2VJ5 A;  3CXC B;  3I56 I;  1T38 A;  2HI3 A;  1AA7 A;  5IYN A;  2JK3 A;  3GWZ A;  3CTA A;  2LK2 A;  5M3M J;  1MSE C;  2QQ8 A;  4AIK A;  4HRI A;  3O6B B;  1T8I A;  1QQI A;  4Z05 A;  2IS4 A;  3NB2 A;  1XG1 A;  3OEH A;  3S14 J;  4CYD A;  2WZN A;  3BPV A;  4QVA A;  4DOZ A;  3ABL H;  3HPH A;  4J00 A;  4BQQ A;  4RDU A;  4A3M J;  1UD6 A;  4HX8 A;  1MMS A;  1VLY A;  5KHD A;  1D1B A;  2VBM A;  3K4C A;  1L3L A;  4KJZ A;  1UMQ A;  5L3E A;  3HC7 A;  3WNB A;  1T56 A;  2RVC A;  3SYT A;  1WJ5 A;  1E1Q A;  1IRZ A;  1ZGW A;  2A69 F;  5K1Y A;  3H5N A;  4RAG A;  4ENN A;  4OZY A;  2G9W A;  3K4N A;  4HA8 A;  2KRC A;  5IYD J;  2K4B A;  4UUS A;  1VTN C;  3E6B A;  3C3W A;  3IKV A;  5HS7 A;  2R7X A;  3OYF A;  1ERD A;  3IP4 B;  2OZ6 A;  3K4K A;  4BXX J;  2PMH A;  1MH3 A;  3ZZ0 A;  4QFM A;  3VMF A;  1OGJ A;  3CCQ B;  1LDJ A;  5C4J J;  3ML6 A;  3I56 B;  2D1V A;  2A61 A;  3DU1 X;  2MC4 A;  3VYU B;  1RQP A;  1MZB A;  4X8I A;  2LR8 A;  1IDK A;  2R7Z J;  3KPH A;  2P7V B;  3DBR B;  3HHG A;  2BV3 A;  2NVT J;  3MKZ A;  4W8Q A;  3CC2 I;  4CO8 A;  2DO7 A;  3M8F A;  2DOG A;  4NQW A;  1USS A;  2MFZ A;  4MEY F;  1PP8 F;  2CMP A;  3K1P A;  1U5T B;  5BQT A;  1I6X A;  3EUH C;  2XVC A;  3K10 A;  2V1N A;  2XRO A;  4ZZD A;  4EJO A;  4PJL A;  4OJL A;  1T6S A;  1D8T A;  3DP7 A;  2LKP A;  2LLK A;  1QA6 A;  1RET A;  5HZB A;  1R71 A;  4P12 A;  3PL8 A;  3SFI A;  3CCE I;  3CDI A;  2FX3 A;  4X7F A;  4KMF A;  4HV5 A;  2CS3 A;  3V7C A;  4HLY A;  1T0F C;  4N3N A;  2EA4 A;  4ZTJ A;  2KT0 A;  1VQ5 I;  3BR6 A;  3FK6 A;  3GVA A;  1CQX A;  5HS9 A;  1YX5 A;  1R22 A;  5K5Q A;  5FB2 A;  4CQJ A;  1Z77 A;  2V7Q A;  3RKQ A;  3GQ9 A;  5E3L A;  1A5J A;  2GBY A;  3P5J A;  2WR8 A;  1QZZ A;  1S7A A;  2DPD A;  3M4O J;  2X0K A;  4C3I J;  4L0Y B;  3VOE A;  4BE1 A;  1VQ9 B;  3L2U A;  3U1K A;  2ZXJ A;  4V2F A;  3OS2 A;  3TW7 A;  3BY2 A;  1Y56 A;  2QYO A;  2LBF A;  3KP6 A;  3OL3 A;  4HQE A;  2G7H A;  1NK3 P;  4YAU A;  4AF6 A;  4EH1 A;  2QX3 A;  5GV8 A;  1NHC A;  3OJX A;  1X4P A;  5HDK A;  1O8F A;  1U9N A;  2GXA A;  4TN1 A;  3CC2 B;  4KMU X;  3KE2 A;  3IH2 A;  4XOT A;  4BNC A;  2Z6B D;  3BG6 A;  3JSP A;  4U9U A;  5F4O A;  1VBL A;  3HRS A;  5ILS A;  4YIR X;  1M1E B;  4LIU A;  3VYT B;  4TSF A;  1VQL B;  1OIS A;  5FO1 A;  4O6J A;  1RNL A;  3QP5 A;  4PUS A;  4Z4U A;  2JJ7 A;  3KRG A;  3BR2 A;  1KQ9 A;  3MKL A;  4C0S A;  4XL9 A;  3WTZ A;  3FXK A;  1EH7 A;  2H1K A;  3JW4 A;  2XAJ A;  3CCE B;  2XF6 A;  1WFX A;  4BAC A;  3VMV A;  4P55 A;  2R7T A;  3BWG A;  1VQ5 B;  3JRA A;  5IOY A;  1JGG A;  1OCZ H;  1YS6 A;  3ZQI A;  5DDG A;  2KKO A;  2COB A;  3ASO H;  4KYW A;  3E1S A;  2VT3 A;  1H8H A;  4FQG A;  1FP2 A;  4JOM A;  1XB4 A;  5E17 F;  2PEX A;  1N0V C;  5LFA A;  2HDW A;  1BL0 A;  1O8I A;  4EW9 A;  1LKX A;  3G6E B;  4Y3O A;  5D4S A;  2DBB A;  1AKH A;  4QIW N;  1W87 A;  4RLF A;  2BYV E;  3C7J A;  4GO1 A;  4U0V A;  3A0B C;  5FLX K;  3TL4 X;  2E1M C;  4A3L J;  2LF7 A;  2RC6 A;  4A69 C;  3WNC A;  1HW1 A;  3ZBT A;  2M2E A;  3OV8 A;  4M3G A;  5GV7 A;  3IWF A;  2WWY A;  1OQY A;  1Y39 A;  4WZT A;  2INU A;  4D5C A;  5TV2 A;  2FX0 A;  3PSI A;  1IV8 A;  4HX7 A;  3CDL A;  2DY1 A;  1UEL B;  3EUK L;  3RPU A;  3BTJ A;  2CSO A;  2DOA A;  1V4R A;  4Z4Z A;  2P5L C;  1PUF A;  3WQZ A;  2HFH A;  1MW7 A;  4A3I J;  5H20 A;  3V8J A;  2BN4 A;  2EH3 A;  4U49 A;  2PLY A;  5J40 A;  3KEY A;  5CVV A;  4RLZ A;  1KZH A;  4A5M A;  3ZUG A;  2X3U A;  2EBI A;  2HS5 A;  4BPR A;  2M9H A;  4XIC A;  4EMS A;  2VNI A;  3QAH A;  3IAS 2;  1J09 A;  3OS1 A;  1JKO C;  5E3O A;  1KMH A;  3GIR A;  3JU4 A;  1FDR A;  3G3Z A;  1FEX A;  5F0H A;  4UY8 I;  2FSW A;  2DLL A;  4C2U A;  1Y8Q B;  2XAU A;  4RB3 C;  1R4N B;  1MJ9 A;  1Q1H A;  1F20 A;  3BQZ A;  3J7Y J;  1QVU A;  1NB0 A;  1X1A A;  4CIC A;  2HOS A;  2XRL A;  4UUS B;  1GXQ A;  5TR9 A;  2VFO A;  1R5G A;  2BW3 A;  3A35 A;  4N4N B;  1K28 D;  2OCC H;  4IRI A;  4EGZ A;  1OGO X;  2O04 A;  1ZG5 A;  3JX8 A;  2OAZ A;  3T1B A;  2OTL I;  1YW8 A;  1YOV B;  3K7A J;  3QOE A;  3AST A;  3OWT A;  1BW6 A;  4G7Z F;  4X7C A;  3LMM A;  1J59 A;  3BR3 A;  2PFB A;  2X85 A;  4BAY A;  1FOK A;  1OCR H;  4XID A;  4X0G A;  1RI7 A;  2RGV A;  2KZV A;  1ZKG A;  1D1C A;  3VR6 A;  2NVX J;  5LHI A;  1DAB A;  4NQW B;  1E63 A;  1SFE A;  5CYV A;  1MBK A;  2EFW A;  5EF6 A;  5F04 A;  4BBR J;  1EZG A;  4G7W A;  2AHQ A;  5FLM J;  4PDK A;  2Y48 A;  2C77 A;  4XN3 A;  4I0B A;  1N05 A;  1FWZ A;  3RJP A;  4KIB A;  3GVK A;  1W7P D;  3F8F A;  1IJE A;  2GA2 A;  5C1E A;  3S16 J;  3OW2 B;  3I58 A;  3HIF A;  3LWF A;  3W6J B;  3PFI A;  2QMU A;  2VL8 A;  4YEJ A;  2E1N A;  5M5X J;  2JDI A;  2FMY A;  5E1X A;  1WOP A;  3E1Y E;  4DNT B;  3IH3 A;  3GFI A;  2V4J C;  2HCJ B;  2EIJ H;  4Y7C A;  1KGS A;  5C44 J;  4L9N A;  1KU9 A;  2DT7 B;  3HUG A;  2M5S A;  4RDJ A;  2CW5 A;  3T51 B;  1KD1 D;  2DJN A;  2EQR A;  2V79 A;  4E70 A;  4OPV A;  5A88 A;  4ZDP A;  2OTL B;  4NNJ A;  3U1D A;  1O4X A;  2CQK A;  1D0Z A;  3LO8 A;  3LSK A;  4CXF A;  3E7L A;  2LBF B;  2OBT A;  3P27 A;  1E0E A;  5GPA A;  4OJP A;  4TT3 A;  5F6F A;  4NBS A;  4B4C A;  3GQ8 A;  3QU6 A;  1COW A;  1LNW A;  5H2F C;  2F2E A;  4XON A;  3F21 A;  3J7A O;  4MLO A;  2E1R A;  1OYY A;  2UUZ A;  2QGG A;  5ICE A;  4I0A A;  4UXN A;  1FYK A;  2CUE A;  4CGZ A;  2FJ1 A;  4N9I A;  2DA2 A;  4TMZ A;  4IKF A;  5F4J A;  1QPI A;  3E5X A;  4YFN F;  2EV5 A;  5JLW A;  3ONY A;  5EMN A;  3OYA A;  1EFC A;  2PYG A;  2JN6 A;  5TGT A;  3LSP A;  3G4S I;  4K1X A;  2R7S A;  2EIL H;  4LB6 B;  1W36 C;  1ZG1 A;  1Z7L A;  1VQM I;  2FE3 A;  2J8I A;  2L0K A;  1WJB A;  5JLX A;  3ZOB A;  5HNH A;  3W2V A;  1U8B A;  2OK7 A;  3WTV C;  1YI2 B;  1KA8 A;  1WJE A;  2INV A;  3TP3 A;  2QKM B;  1G7T A;  1QCX A;  3HEF A;  4XNF A;  2YX7 A;  3BCF A;  1WWX A;  2DK5 A;  4B47 A;  4RGS A;  1EP2 B;  3BZC A;  2YU9 J;  2TRT A;  2R5Z A;  2QZA A;  1O8D A;  4ZYE A;  2R7V A;  3OIQ A;  1K4S A;  1UAA A;  4YZA A;  5J8C A;  2WTE A;  4IOA F;  2BMW A;  1R9T J;  1MNE A;  1AU7 A;  4YZQ A;  3ZCO A;  4F3Q A;  3K0L A;  3L7W A;  3I59 A;  1J7K A;  3PA2 A;  4OIR F;  2PBI A;  5GAD J;  1HA3 A;  3BH7 B;  1QHH D;  4C2T A;  5CKT A;  1O8L A;  4DZP A;  4HEA 2;  2ZJQ F;  2BY1 A;  3OOP A;  1V5G A;  2IA2 A;  2O1D A;  4OOS A;  2V9K A;  3CCJ I;  3ZRG A;  3CME I;  1A35 A;  1ACI A;  1FX7 A;  2LY1 A;  3PSF A;  3VOD A;  1QX4 A;  2W6J A;  1UJ8 A;  2Y30 A;  1K73 D;  5LGT A;  5ERI A;  4KN7 X;  3FPK A;  4WK8 F;  1P7I A;  3PQJ A;  1PUF B;  1JHF A;  4PAA A;  3WY9 A;  4ZYG A;  1O7F A;  2AQE A;  1K78 A;  3DU5 A;  5THX A;  3RY8 A;  3MQ0 A;  3KEW A;  3OZU A;  1WQ2 A;  1VQM B;  3I55 I;  1X0C A;  1WSR A;  4RD4 A;  1IDJ A;  3JQP A;  2E5N A;  3DBH B;  1QU3 A;  4ZH4 F;  3ONU A;  2MSY A;  2IW5 A;  3MZY A;  5LLQ A;  4IHV A;  1D0X A;  4AYB A;  2CQ7 A;  4B48 A;  2IS2 A;  2OK8 A;  1K6O A;  5K7Z A;  1EFU A;  2VNJ A;  1WJD A;  1HCR A;  1H80 A;  3AG3 H;  1JRG A;  1IGN A;  5LGU A;  3KZI C;  2RV8 A;  5FFX A;  3LQ6 A;  3CJT B;  1V55 H;  3TMO A;  4I09 A;  3DPT A;  4LBZ A;  4YAW A;  2NVU B;  2NAZ A;  2VXD A;  3G1L A;  1FND A;  1GQ8 A;  2XKO A;  2BW3 B;  2X6X A;  3JCU C;  4YXW A;  2F48 A;  4M73 A;  1GLN A;  5D8L B;  1IDZ A;  5IYQ A;  5IOZ A;  3QU3 A;  1LFU P;  2ZB9 A;  1BI0 A;  5D5V B;  5LD2 C;  3HGY A;  2O6W A;  3CCJ B;  3DFG A;  4EAT A;  3HOU J;  2HQA A;  2JVG A;  1DGR M;  4RCY A;  4WZK A;  3CME B;  3GCM A;  2BGJ A;  3FMS A;  4AYB N;  2V6C A;  1CF7 A;  3K70 D;  2WB1 A;  1FP1 D;  4X1E A;  4P3Y A;  4AIJ A;  2DCU A;  2BSP A;  2R7O A;  5HOO A;  5D5W B;  3I1F A;  1OKR A;  2NZM A;  5JLV C;  4BH9 A;  4P2N A;  3U6K A;  1UMK A;  2VFP A;  1QVF B;  5LRS A;  2XGD A;  3WU2 C;  3O8G A;  3Q9V A;  4XLE A;  3B6A A;  2HQ5 A;  3AG1 H;  5FGM A;  3E6C C;  3ZIA A;  4XLA A;  3FHZ A;  4IHW A;  4OPO A;  3Q0U A;  4C3J J;  2XGX A;  3KLO A;  3BCA A;  1U8R A;  4P9S A;  4M9S A;  2ECB A;  2DI3 A;  1ZN2 A;  4PFP A;  1MDM A;  2XGJ A;  2FML A;  2ZTG A;  1QFY A;  2E1B A;  1U5T C;  2IPQ X;  2Q2E A;  5DCM A;  3MZH A;  2K3P A;  2Q6I A;  4KKT A;  1WCM J;  1M1K D;  4O5V A;  4TV7 A;  3RDI A;  5K7F A;  1GAW A;  3ZQF A;  2DOD A;  2I10 A;  2ELK A;  3TOA A;  5GTI C;  3HUG B;  1G7C A;  2WB1 N;  1UHM A;  1P4A A;  3VWB A;  1E43 A;  2EK5 A;  5CVR A;  4S05 A;  2AS5 F;  1VQN B;  2X1C A;  1GAQ A;  2FEZ A;  2L9R A;  3GYH X;  1POG A;  4HPQ A;  2P5V A;  4XKB A;  5BSX A;  2OPT A;  3S2D J;  1LEA A;  2DYR H;  4YEL A;  3CLO A;  5J3L A;  1G3Y A;  3BNW A;  2VBW A;  2JA7 J;  1ZRC A;  2GIZ A;  3GF2 A;  1ZM4 A;  1V54 H;  1IG7 A;  2JIZ A;  2FQ4 A;  2J5O A;  3MAJ A;  2DA6 A;  1AIP A;  1R58 A;  2HQN A;  4IHY A;  2KRF A;  2XDV A;  4OU0 A;  2BM4 A;  2W1O A;  3GZ5 A;  2OQG A;  1BI1 A;  2CG4 A;  2MD5 A;  3B90 A;  5LMZ A;  1QRB A;  1Y0R A;  4R1H A;  2JMW A;  2E1C A;  2JRT A;  1E1R A;  3FXO A;  2KJB A;  4DBQ A;  4XRS A;  2DA1 A;  3WE3 A;  3B8H A;  4LB5 A;  4G5G A;  4RB0 A;  4AU7 A;  2XZL A;  5FL7 A;  2X53 S;  1A6I A;  4FX4 A;  2DFI A;  2Y0M A;  3LFK A;  1K5C A;  4ESJ A;  1RES A;  3QFT A;  2ZBV A;  2RDP A;  3QSY A;  4G6I A;  1AMO A;  2VKE A;  1QVT A;  4ZZL A;  4WZE A;  1QRC A;  2XV4 S;  3PJR A;  3NWT A;  2O03 A;  1YHQ I;  5JHU A;  4XR6 A;  4JP0 A;  1JT6 A;  3OMY A;  2G7U A;  1TWF J;  2E36 A;  2JSC A;  3QPT A;  4RM3 A;  2R5Z B;  1IXC A;  3QP6 A;  3CCL I;  3BRO A;  4LBY A;  4OAY A;  5JHF A;  2JA6 J;  1MBE A;  2EZL A;  4FE4 A;  3VSL A;  3I59 B;  1W2B B;  4C2L A;  2WAE A;  3TED A;  4LOC A;  4JX4 A;  2PE3 A;  1EP3 B;  3DTK A;  2DYS H;  2R93 J;  2AQF A;  3WTY C;  4HDU A;  1O7L A;  3H94 A;  4EJU A;  2HKX A;  2CW0 F;  4LLG F;  4G1B A;  4DJA A;  2H09 A;  4F7Z A;  4XLN F;  3UW0 A;  3R6J A;  1SAN A;  1J75 A;  2XKP A;  4V2G A;  2F5D A;  3JQR A;  3OKX A;  2AXL A;  2ZCW A;  3K6G A;  1QBJ A;  1UB9 A;  2R7D A;  5J35 A;  3RYR A;  4B3G A;  3MN2 A;  4G6Q A;  1I1G A;  5L3F A;  3S3M A;  3F23 A;  2CV1 A;  2PEC A;  1V5F A;  2X1E A;  4IEJ A;  1H8A C;  2ZXW H;  3L1P A;  1S4M A;  4Q5S F;  4DNC A;  5FD6 A;  2ZL6 A;  3OYI A;  4RGX A;  1JKP C;  1N0U A;  1KU7 A;  1ZRF A;  2BF4 A;  1WPK A;  2D5V A;  1IN6 A;  2V7V A;  2WYR A;  2QA4 B;  1BI3 A;  1T33 A;  1QRY A;  2A6H F;  3NAR A;  4G9Y A;  5H6R A;  3LNN A;  5C1C A;  3BQY A;  3IL2 A;  2IS1 A;  3A0H C;  3IC7 A;  4TMV A;  4AF7 A;  4MXN A;  1LJ9 A;  1JKR C;  2W4S A;  1BI2 A;  2F43 A;  2HVQ A;  2IVM A;  3CCV I;  2FRH A;  3FIS A;  2PX9 A;  5H6Q A;  2V5I A;  2W7Z A;  2VFM A;  1TNS A;  4WXD A;  1ZLJ A;  2XB0 X;  4FWT A;  4M53 A;  3WTW C;  4YII A;  2IOU G;  3BZ6 A;  2ADU A;  4CCJ A;  2C6Y A;  1WH7 A;  3V8K A;  4OIP F;  2PLF A;  1YIO A;  4ABZ A;  3B82 A;  1TTY A;  4WXH A;  3AKZ A;  3SLD A;  2DER A;  4DYR A;  2QSH X;  2Q6K A;  1NDH A;  3LQE A;  5J3O A;  3J81 Z;  2ID6 A;  1JUP A;  5BNG A;  1CF7 B;  3CMA I;  2JJ2 A;  3NAW A;  2RQQ A;  5F4M A;  1Q86 D;  3ELK A;  4RB2 C;  1HG8 A;  1HOM A;  3BTC A;  3F8B A;  5K5O A;  3CUO A;  3WGI A;  5FKN A;  3BG7 A;  2P8T A;  5FKO A;  3FJO A;  3W2I A;  2EJR A;  2NRA C;  1TYX A;  4BGD A;  4GQN A;  5AIP A;  4CHU A;  3GTQ J;  1XQB A;  3IKT A;  4M3E A;  3G71 I;  4HNT A;  4TMX A;  3EQO A;  1NG6 A;  2RNJ A;  1RQR A;  1HLV A;  1FRN A;  1Y0N A;  1MDM B;  3HSE A;  2CK3 A;  2YWE A;  2DA3 A;  1N8R D;  2O0V A;  2Z8G A;  1XMK A;  2Q2E B;  5DCM B;  3RQI A;  4EV0 A;  4WCG A;  3T9G A;  3SHF A;  1FY7 A;  3HG9 A;  1UHS A;  1G6N A;  2LFB A;  1RUN A;  4XK4 A;  1NH3 A;  4DNR B;  5ILV A;  2NYX A;  4NK8 A;  3S1Q J;  1N75 A;  1X4O A;  5DS9 A;  1Y0Y A;  4HOB A;  4CSW A;  4AC9 A;  2GWR A;  4QVJ A;  2HYF A;  3CES A;  2QZ8 A;  2E71 A;  2FF4 A;  2MG4 A;  5GAG J;  1MD0 A;  2ELH A;  1IXR C;  5CQE A;  3K4B A;  2LD5 A;  2DDB A;  2X0L A;  1YRN A;  3H35 A;  1B9M A;  2EFO A;  5J4V A;  3OFN A;  2VBK A;  2B7C A;  3CMA B;  3GZN B;  4I76 A;  2YX4 A;  4BKX A;  1WSV A;  1SVM A;  1I1S A;  2P6T A;  3ECH A;  1J5Y A;  2UVF A;  4YZX A;  3WXM A;  2PN6 A;  3B78 A;  2ZSI B;  2V7F A;  3SJZ A;  3H9Q A;  4HDV A;  3SEZ A;  1U0J A;  2XAG A;  3GO5 A;  4GGG A;  5CVJ A;  3FXL A;  3CJN A;  1FTT A;  4AVZ A;  3BC9 A;  2X51 A;  5A89 A;  3OZV A;  4ZGN B;  4DYC A;  1G3S A;  1IB0 A;  5D5U B;  5EG0 A;  4ENM A;  1OB5 A;  4RJL A;  1PP7 U;  1UHW A;  3F3X A;  1OR7 A;  5JVG F;  2P5K A;  1QFJ A;  3OAA A;  3UR3 C;  4KKU A;  1P2F A;  1F5T A;  1W35 A;  3REO A;  5IT3 A;  1U2R A;  1R1V A;  1ETW A;  4PJM A;  2L5Q A;  1I27 A;  4GYI A;  1Q7Y D;  1XDU A;  4PC2 A;  1D5Y A;  2DJI A;  2F5C A;  3ZPL A;  1DDG A;  5TY0 A;  1LLZ A;  2GQQ A;  2OU2 A;  1NRK A;  1K6Y A;  2BY3 A;  1TYV A;  2R7F A;  2EZK A;  4GDF A;  2LNB A;  1GR1 A;  2BHZ A;  3S17 J;  5E8I A;  1KQ0 A;  4CZC A;  1Z7U A;  1XB2 A;  4AVP A;  1VZ0 A;  1UD5 A;  1FBS A;  4MQV A;  1IW7 F;  2W57 A;  5EEA A;  2ACJ A;  4HNU A;  4S0H B;  5FKK A;  2ZFU A;  3FXQ A;  5EYR A;  3F8N A;  4YFX F;  3ZSC A;  2QM3 A;  4UB6 C;  3DQV C;  1MBG A;  1KCD A;  2CRG A;  4YRV A;  5IK2 A;  2VQC A;  1CLW A;  1KYW A;  5JVT A;  1FTZ A;  4KT6 A;  1X1C A;  3H5R A;  2KJC A;  4Q7J B;  3CMM A;  2MH9 A;  2D9R A;  2GJK A;  1TWH J;  1MND A;  2VFN A;  5BSY A;  1RR7 A;  3F22 A;  4LC0 A;  1G59 A;  3M07 A;  1R6R A;  5L46 A;  2HNH A;  3V7R A;  4IZZ A;  1R4M B;  1WXR A;  5AON A;  2OUM A;  3KP3 A;  3J80 K;  3AGQ A;  1VQP I;  2P3M A;  2MD0 A;  4BDZ A;  3D5L A;  1BX0 A;  2NS7 A;  3BR1 A;  2X6Y A;  3LSG A;  2YWH A;  1FPQ A;  3DXJ F;  1NBM A;  2K86 A;  2R5Y A;  3GTP J;  2Y69 H;  1O88 A;  1VQ9 I;  4A12 A;  2DU9 A;  2V26 A;  2X6W A;  3DTE A;  2JA8 J;  1OCC H;  1R7J A;  4KN4 X;  4LD5 A;  1YE9 A;  3A1Y A;  4XM3 A;  4BEH A;  3HOX J;  4JX5 A;  4NB5 A;  4YFK F;  1PJ7 A;  3W2E A;  4UNO A;  3HM5 A;  2OQR A;  4OOV A;  1F1Z A;  1TL8 A;  3OS0 A;  3VO1 A;  4HX4 A;  3MFK A;  1P9Q C;  1YQA A;  2HXO A;  3EYY A;  4MGR A;  5HDN A;  2XSJ C;  4XBF A;  3T8R A;  2LH9 A;  2FBI A;  3CCM I;  1O8E A;  3AK5 A;  3R61 A;  3TO6 A;  2HDC A;  1WJC A;  1MBF A;  5F0F A;  1U9O A;  1U6G A;  4ON0 A;  3QFS A;  1AIR A;  4C9Y A;  3VNU A;  2VBT A;  1TQP A;  2F1L A;  1VQL I;  1K4Z A;  2VNH A;  3FMR A;  5F64 A;  1W5C C;  5JBQ A;  1ZTR A;  2IT0 A;  2JA2 A;  1HKS A;  2ZXH A;  1D1N A;  1XGN A;  2W00 A;  1D1A A;  2OCE A;  2E7X A;  3UNG C;  3VFZ A;  4EVI A;  5IP9 J;  1F4K A;  3T53 B;  3VSU A;  3K69 A;  2BOL A;  3ZP5 A;  2LVS A;  2J5P A;  1SM4 A;  1VQP B;  1Y8R B;  4JMQ A;  4U7D A;  2L7Z A;  1RIO H;  3CQZ J;  3OYN A;  4D7M A;  2JPC A;  2O61 A;  1KC8 D;  1HXD A;  4L9V A;  2V1X A;  2RC5 A;  4RLQ A;  1TNT A;  2G0Y A;  1SAU A;  3E5U A;  1H0M A;  3QPH A;  3CJR B;  1KU2 A;  4X0C A;  3BZK A;  1FBU A;  5DEQ A;  5BPI A;  3G6E I;  1W36 D;  4ESF A;  3SXY A;  1XGO A;  3I4M J;  2GJR A;  2XF7 A;  4MYT A;  3FF5 A;  2XPU A;  2EWE A;  3TDZ C;  3RIQ A;  5D6E A;  3CO6 C;  3LSI A;  1E3O C;  1MH4 A;  1Z6T A;  1XC5 A;  5CLS A;  3CCM B;  1YRN B;  1E3P A;  3LAP A;  1P4W A;  2E19 A;  2JT1 A;  1B8I A;  4ZCM A;  1XCV A;  4H4K C;  2C78 A;  2L9S A;  4YAO A;  1IZ1 A;  1IHM A;  1T5E A;  2EZI A;  2X1D A;  3I53 A;  1Z9C A;  2XSD C;  5F08 A;  3E6D A;  5DM7 F;  2EFN A;  3I71 A;  3KZY A;  3SKB A;  4Z03 A;  4KKS A;  2DQR A;  1YJW I;  4GRI A;  5KAF C;  2C4T A;  4OOX A;  5M3F J;  5E1W A;  3V4G A;  2A07 F;  3GRH A;  4V19 K;  1REP C;  1DPU A;  1XSX A;  2QWW A;  2WY7 Q;  1V5E A;  4MFE A;  4MTD A;  1SD7 A;  5EG0 B;  1KTV A;  2BX6 A;  5AMV A;  3C18 A;  2JA5 J;  2L54 A;  2VJJ A;  3K2Z A;  3AVT A;  2XF5 A;  3MKW B;  4BJT A;  3GFM A;  1R23 A;  5DD4 A;  4B3X A;  5HLG A;  3Q3A A;  3LSM A;  4HF2 A;  3Q0V A;  3J7A Y;  3VB2 A;  2EFQ A;  4NBQ A;  4A2U A;  2B63 J;  5L3G A;  1XD7 A;  1W34 A;  1QG0 A;  2XEX A;  1K79 A;  4UVC A;  1WVR A;  1ETX A;  4GYG A;  2WV1 A;  4PJJ A;  2HYG D;  1N08 A;  3B02 A;  2WY8 Q;  4YAL A;  2QF7 A;  4L5E A;  3ZBU A;  2HGC A;  2KL4 A;  4A3C J;  2GA1 A;  3KP7 A;  5B1A H;  2ZSH B;  3SQV A;  1IN5 A;  2HZT A;  2Z5U A;  2QSF X;  2WAD A;  2Z1D A;  3EET A;  3M9A A;  3ZQG A;  1RC9 A;  2O8X A;  3Q3S A;  2D1H A;  2X4H A;  4OOI A;  2VIX A;  3SZP A;  3JSO A;  3W3C A;  1TBX A;  2FQ3 A;  2ZME A;  1JGS A;  1LM1 A;  2NT9 A;  2R9V A;  1B9N A;  1YW9 A;  3CCY A;  1YJW B;  4IXA A;  1OCT C;  5ILU A;  1ORK A;  5ED4 A;  4A3K J;  4RDK A;  2L7K A;  3CP2 A;  3GEZ A;  4M4S A;  3HOT A;  2R7R A; 
#chains in the Genus database with same CATH homology
 1IDJ A;  3ZXS A;  2E5N A;  3DLA A;  1QU3 A;  4BJ6 C;  2IGK A;  4E7J A;  2KHM A;  1W0J A;  2RNG A;  4XLH A;  4BL0 B;  1D0X A;  2I8D A;  4AYB A;  1E79 A;  3OY9 A;  4B48 A;  2X8K A;  1DQU A;  2IS2 A;  4B3F X;  1PXZ A;  3GQ7 A;  1WJD A;  5FRM A;  1H80 A;  1JRG A;  5HVQ C;  4NUB A;  3ZPN A;  2E60 A;  3A3G A;  4BDY A;  1UD3 A;  3TMO A;  3IAM 2;  4XN0 A;  4E7K A;  1OB0 A;  3DEE A;  4J01 A;  4QPO A;  3DPT A;  1BHE A;  3OYE A;  4YZ0 A;  1PLU A;  4QPQ A;  2VXD A;  3TBI A;  4BEH B;  1GQ8 A;  5HLT A;  2BW3 B;  2X6X A;  2IGN A;  3OYJ A;  3I3L A;  4YXW A;  1GLN A;  2O5R A;  2WZP P;  4XKV A;  1O8M A;  2CW8 A;  2PMZ A;  1JTA A;  5LD2 C;  1Z3X A;  4TKO B;  4EAT A;  2HQA A;  2JVG A;  1DGR M;  3H9G A;  4CCL A;  1BR1 A;  1Z21 A;  2VB6 A;  4E7I A;  2ZZG A;  1VBL A;  4DK1 A;  3ZQQ A;  1N77 A;  4FET A;  3RTR A;  4L8J A;  4II3 A;  4HWV A;  3K70 D;  2WB1 A;  3U21 A;  3MMY B;  3RQ4 A;  1UG0 A;  2O0W A;  4HG2 A;  3DDY A;  2BSP A;  2R7O A;  5HOO A;  2XND A;  2KMU A;  3OYL A;  2A6T A;  3PFY A;  4Y4R A;  3BH4 A;  2NZM A;  2LRD A;  4D1Q A;  3W2W A;  3OW7 A;  4CCN A;  3WWG A;  4XLE A;  3DTI A;  3D5S C;  3L2V A;  3ZIA A;  3AL0 C;  2L2O A;  4XLA A;  2UVE A;  2LY2 A;  2ZZF A;  2IQ7 A;  1BMF A;  2XZP A;  3BCA A;  2LZJ A;  3H0D A;  2HLD A;  4XMY A;  4PFP A;  2XGJ A;  3ZGK A;  4PJN A;  4OAZ A;  4PFO A;  2ZTG A;  2E1B A;  2K3P A;  2F5V A;  4KKT A;  2NSP A;  3D5R C;  2NTP A;  3ZR8 X;  4BQN A;  2IGO A;  4RMN A;  3QYF A;  2HPM A;  3HUG B;  1BR4 A;  4ZDL A;  4E7Z A;  3VWB A;  4KIS A;  3HOS A;  4XQF A;  1BOB A;  3RSN A;  3L2R A;  1E43 A;  3K70 C;  2BVM A;  2M4K A;  2X1C A;  3VST A;  2QXZ A;  2WJV A;  4XOP A;  4HPQ A;  4XKB A;  3KYL A;  3LSH A;  1VF7 A;  1TZL A;  3HXL A;  4YEL A;  2XC7 A;  4E7H A;  1UD2 A;  2WA0 A;  5DN6 A;  3JUR A;  3FBI B;  2JIZ A;  4UZU A;  2CH0 A;  3C2H A;  3VYR B;  4R79 A;  3PNY A;  2JSP A;  4BUP A;  4F93 B;  2QE7 A;  3K4M A;  4XD7 A;  1VJS A;  3NWS A;  2XDV A;  3B4N A;  2W1O A;  1OGM X;  2LOO A;  3B90 A;  3F9K A;  3S32 A;  3VSK A;  1WPC A;  4XOR A;  4NC8 A;  1E1R A;  4F52 A;  1X1B A;  2VJ4 A;  4DBQ A;  2XZL A;  1BN8 A;  1PE9 A;  4AU7 A;  2V6E A;  2M7B A;  3GBG A;  4G6T B;  4F91 B;  4G7X A;  2X53 S;  1DP3 A;  4PSX A;  5FL7 A;  3AFH A;  2F4I A;  1PJR A;  4PMH A;  2KLO A;  4OJO A;  5HNF A;  3VSV A;  2ODL A;  1K5C A;  2E5Z A;  2M0M A;  4LIT A;  1EFR A;  2M7A A;  2HPI A;  4C30 A;  4G6I A;  1H8E A;  2Q1Z B;  2HU9 A;  3PJR A;  4XKW A;  2UWM A;  3NWT A;  2JUG A;  2HVR A;  4XR6 A;  1FX0 A;  1HA8 A;  3OPO A;  3OMY A;  4RM3 A;  1SFK A;  3OE7 A;  2R4G A;  4BJ5 C;  2HZD A;  3HKZ A;  4Z1M A;  2KRH A;  4OAY A;  3OR2 C;  1IA5 A;  5JHF A;  1UD8 A;  1I8D A;  3VSL A;  1MMG A;  1TT0 A;  2LRE A;  4C2L A;  2WAE A;  3L2Q A;  3VMW A;  3PNT A;  4W8S A;  2ZZQ A;  2FUG 2;  3A4C A;  3M1C A;  3QOD A;  5FRO A;  1O8K A;  3DTK A;  4F92 B;  2AQF A;  2VJ5 A;  2KDO A;  3OYM A;  3PUB A;  5CPR B;  4OZZ A;  3H94 A;  1AA7 A;  4DJA A;  2CW7 A;  1WJA A;  3FKJ A;  3OYK A;  2V4D A;  3LL7 A;  1I18 A;  2KPM A;  3UW0 A;  4HRI A;  4Z05 A;  2IS4 A;  3K6G A;  3GVL A;  4BE2 A;  3OEH A;  3W2A A;  4B3G A;  4IX7 A;  4DOZ A;  3S3M A;  2CV1 A;  2PEC A;  3HPH A;  4J00 A;  4D9J A;  1E3Z A;  4BQQ A;  1V5F A;  2WAQ A;  2X1E A;  1UD6 A;  1VLY A;  1X1D A;  4OWR B;  5KHD A;  3VDX A;  1D1B A;  2P0W A;  1HZE A;  1OOC A;  3HPG A;  2VBM A;  2IXS A;  3K4C A;  2WPD A;  2R7W A;  4KJZ A;  4XLF A;  3OYI A;  3DU6 A;  3HC7 A;  3SYT A;  1WJ5 A;  4CUG A;  1E1Q A;  3BCB A;  3DPU A;  1ZEL A;  4CCM A;  2CV0 A;  5C1C A;  3H5N A;  1OFM A;  3LNN A;  5CDF A;  1T95 A;  1MMN A;  4OZY A;  1FMV A;  2IS1 A;  2QY1 A;  3K4N A;  4MXN A;  2KRC A;  4BQO A;  2W4S A;  2F43 A;  3G05 A;  2HVQ A;  2Y0S A;  1W9X A;  4ZC3 A;  2R7X A;  3OIP A;  3OYF A;  3IP4 B;  3K4K A;  4LG3 A;  1ERD A;  2LYC A;  1RMG A;  1IRX A;  1MMA A;  5CQG A;  1V0E A;  4CCJ A;  4URR A;  1WJF A;  1IB4 A;  4BU2 A;  2MC4 A;  2WBM A;  3VYU B;  3AKZ A;  4F55 A;  1IDK A;  3MD2 A;  4HIZ A;  3G2B A;  4E4H A;  4I84 A;  4BS9 A;  3AL0 B;  2VBE A;  1EE6 A;  3MKZ A;  3I9V 2;  3OL4 A;  2JJ2 A;  2RQQ A;  4W8Q A;  1OFL A;  1HG8 A;  1KZL A;  1BLI A;  1DGW Y;  4NC7 A;  2MFZ A;  3QYB A;  2CMP A;  3BG7 A;  3ZPP A;  1OLT A;  1X19 A;  3EUH C;  3K10 A;  2V1N A;  4BGD A;  4GQN A;  4PJL A;  2DCE A;  4OJL A;  1LVK A;  2Z2S B;  1BR2 A;  4HNT A;  3EQO A;  1NG6 A;  4NK6 A;  3PL8 A;  2CK3 A;  2O0V A;  2VPL A;  2W82 A;  2CS3 A;  2Z8G A;  4ZTF A;  1T0F C;  2Q2E B;  4ZTJ A;  1G8X A;  3T9G A;  1YX5 A;  2VJI A;  3HG9 A;  4XKC A;  2F1M A;  2V7Q A;  3GQ9 A;  3DPL C;  1OHH A;  4DNR B;  1S9H A;  3EUA A;  4NK8 A;  4OJ5 A;  1N75 A;  1X4O A;  4CSW A;  4BE1 A;  3GVJ A;  3L2U A;  2JVH A;  3CES A;  1O8H A;  3OS2 A;  3FBN B;  4U4B A;  4Z06 A;  3KX2 A;  1Y56 A;  4W8T A;  4Y33 A;  2LBF A;  3OL3 A;  5CQE A;  3K4B A;  1O8J A;  3ONQ A;  2QX3 A;  4FAS D;  1NHC A;  3H35 A;  3OFN A;  3HL2 A;  2VBK A;  1X4P A;  3CP8 A;  4RM2 A;  1O8F A;  3RCO A;  2VAS A;  2KVO A;  4XOT A;  2Z6B D;  3BG6 A;  2UVF A;  4YZX A;  4E6K G;  4DK0 A;  2ZSI B;  2V7F A;  2K5C A;  3BLY A;  3H9Q A;  4LIU A;  3VYT B;  3EPZ A;  3SEZ A;  2GK7 A;  1U0J A;  3OR1 C;  4TSF A;  3GQA A;  4HST A;  4PUS A;  3KRG A;  4AVZ A;  3BC9 A;  2X51 A;  4B44 A;  3FY3 A;  4XL9 A;  4ZDO A;  2GK6 A;  3OEE A;  2XF6 A;  1N78 A;  1WFX A;  4BAC A;  1W0K A;  2K9L A;  3VMV A;  2VQG A;  2R7T A;  3SDB A;  1FMW A;  2WSS A;  3LFU A;  2OV7 A;  1WMR A;  4ANJ A;  4ZJZ A;  2VLA A;  3B8Y A;  3OAA A;  3UR3 C;  3E1S A;  4DBR A;  1H8H A;  4KKU A;  1BPL A;  4PJM A;  4JOM A;  2L5Q A;  4MR0 A;  2CUJ A;  5LFA A;  2HDW A;  2DJI A;  1SKY B;  1O8I A;  4EW9 A;  1LKX A;  4Y3O A;  1NRK A;  1K6Y A;  3RPU D;  2D3N A;  1OR7 C;  4RLF A;  3OYG A;  2JJ1 A;  3BCD A;  4CZC A;  4IQJ A;  1XG2 A;  3TL4 X;  2E1M C;  5KCM A;  1VZ0 A;  3H9J A;  2K9M A;  3SEQ A;  1UD5 A;  2F6C A;  4CCK A;  3S3N A;  4HNU A;  3SZG A;  3H5A A;  2ELJ A;  2DIE A;  2ZFU A;  2INU A;  2KQR A;  3OYC A;  3PSI A;  2IS6 A;  3ZSC A;  3A3B A;  1UEL B;  3DQV C;  3EUK L;  2XOK A;  1KCD A;  2VKH A;  4YRV A;  2DOA A;  2VQC A;  3S8P A;  3MKY B;  5IK2 A;  3K4J A;  2W6I A;  4KT6 A;  1X1C A;  3H5R A;  4XLC A;  2GJP A;  3WQZ A;  3CMM A;  2ZZE A;  4P1W A;  1MW7 A;  2DT6 A;  3QYE A;  2PJR A;  2GJK A;  5FRN A;  1WTH D;  1MND A;  4ITV A;  1Z3Y A;  4U49 A;  1G59 A;  3KEY A;  2NST A;  2X3H A;  1R6R A;  2HNH A;  4IZZ A;  2NOJ B;  2OUM A;  4W8R A;  2QKL B;  4KIT B;  3IAS 2;  1J09 A;  3OS1 A;  1KMH A;  3JU4 A;  2GOX B;  1RWR A;  2MD0 A;  2MAB A;  4BDZ A;  4E7L A;  3D5L A;  4C2U A;  4BXF A;  2WAF A;  2XAU A;  3CJQ B;  2X6Y A;  3LSG A;  4N4O B;  1MMD A;  4E7S A;  1WP6 A;  3T56 B;  1NBM A;  2LC2 A;  4ZYA A;  1O88 A;  1X1A A;  1JI8 A;  3S93 A;  4ASU A;  2V26 A;  2X6W A;  3DTE A;  4XM3 A;  1YE9 A;  3A1Y A;  4BEH A;  2BW3 A;  1UD4 A;  3A35 A;  4N4N B;  1EA3 A;  1K28 D;  2R7U A;  2O04 A;  1OGO X;  3A2K A;  3OS0 A;  3OYB A;  2VXZ A;  3QOE A;  1P9Q C;  3OWT A;  2XSJ C;  2VQL A;  1DBO A;  2LH9 A;  1O8E A;  3LMM A;  1QJV A;  2PYH A;  3CF2 A;  1WJC A;  2X85 A;  4X0G A;  2NTB A;  3GQB A;  1AIR A;  4C9Y A;  2KZV A;  3SUC A;  1D1C A;  3VR6 A;  4NQW B;  4PSW A;  2L9N A;  4JQF A;  2KP6 A;  1KON A;  2JA2 A;  2ZXH A;  4G7W A;  2IGM A;  2W00 A;  1D1A A;  3UNG C;  1CZF A;  2A5W A;  3T53 B;  4P22 A;  3VSU A;  4XN3 A;  5HKK A;  3S3O A;  2BOL A;  3EQN A;  3GVK A;  4JMQ A;  2M4G A;  5C1E A;  3NE5 B;  4OJ6 A;  3OYN A;  2VL8 A;  2R7Q A;  4YEJ A;  1MAB A;  3M8J A;  2JDI A;  4RLQ A;  4CA0 A;  4DNT B;  1SAU A;  2V4J C;  3DWL E;  3CJR B;  3FHN A;  2DT7 B;  2M5S A;  3T51 B;  3K4L A;  1W36 D;  4BE0 A;  5KNL A;  4P5O A;  2GJR A;  1DBG A;  3FDY A;  2XF7 A;  2M3A A;  2ZXI A;  2CFO A;  2EWE A;  1YX3 A;  3CZ6 A;  4ZDP A;  1KCC A;  3L2W A;  4NNJ A;  1D0Z A;  3LSI A;  3LSK A;  2CV2 A;  2NT6 A;  2LBF B;  3E0J B;  1E0E A;  4OJP A;  4TT3 A;  3GQ8 A;  1COW A;  2RRE A;  1QHG A;  2OC6 A;  4XON A;  4H4K C;  3BC8 A;  2L9S A;  3OYH A;  3FPP A;  4MLO A;  4DIQ A;  1T5E A;  4U87 A;  2UUZ A;  2X1D A;  4CCO A;  2GOM A;  2VKD A;  3HAG A;  2D3L A;  4IKF A;  4Z03 A;  3LMW A;  2WJY A;  4KKS A;  3OYA A;  4GRI A;  2MYS A;  5TGT A;  2PYG A;  2R7S A;  4LIV A;  3GRH A;  1W36 C;  1PKV A;  1Z7L A;  2WY7 Q;  1V5E A;  5AMV A;  4CH7 A;  5HNH A;  1WJB A;  3W2V A;  2VJJ A;  4IQ4 A;  2LG4 A;  2XF5 A;  1Y6I A;  3C2G A;  1WJE A;  3MKW B;  2DXI A;  4BJT A;  2INV A;  2QKM B;  1QCX A;  4XNF A;  4B3X A;  2ZTN A;  3FKS A;  3LSM A;  2CUZ A;  3J7A Y;  3BCF A;  2NTQ A;  1D0Y A;  4B47 A;  3DKY A;  2XZO A;  3DKX A;  1O8G A;  2E1M B;  3OOU A;  4DGW B;  2O17 A;  1O8D A;  2W7N A;  4E0F A;  2R7V A;  3OIQ A;  1UAA A;  4YZA A;  2HVS A;  1V0F A;  4PJJ A;  1MNE A;  3N05 A;  3OYD A;  4YZQ A;  3ZCO A;  4F3Q A;  2WY8 Q;  2KL4 A;  3OOC A;  2BVL A;  3IUO A;  1HVX A;  1QHH D;  2ZSH B;  4C2T A;  5CKT A;  1O8L A;  4HEA 2;  2WAD A;  2Z1D A;  1E3X A;  1V5G A;  4PK4 A;  2O1D A;  2V9K A;  4B43 A;  3PNV A;  3ZRG A;  4FXU A;  2VIX A;  1KTW A;  2LY1 A;  3PSF A;  2Z16 A;  3W3C A;  2NT9 A;  2W6J A;  1PYV A;  3V42 A;  2R9V A;  3VYS B;  1NG7 A;  1LFP A;  1LDK B;  1RU4 A;  2AQE A;  2VQH A;  3DU5 A;  4HSR A;  2L7K A;  2V31 A;  2UV1 A;  3CP2 A;  4II2 A;  4U7B A;  3KEW A;  1X0C A;  2PJR B;  3HOT A;  2R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...