4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
3T9GA 3EQOA 3VSTA 2NSPA 3GQ8A 3ZPPA 4PMHA 1OFMA 4YZAA 4XOTA 1O8FA 1O8JA 2PYHA 1VBLA 2VJJA 1KTWA 3B90A 2INUA 1KCCA 4U49A 2UVEA 1O8KA 2X6XA 3LMWA 1KCDA 4OJOA 2IQ7A 4OJPA 2VJIA 1PLUA 4NK6A 2NTBA 3GRHA 4XM3A 4MR0A 2NTPA 2X6YA 1O8EA 4AVZA 1X0CA 4YELA 1OFLA 2ODLA 3B8YA 3VMWA 4XQFA 4W8QA 4W8SA 4I84A 1WMRA 3EQNA 4YZXA 1RU4A 2NTQA 2O04A 1EE6A 1HG8A 1O8MA 1RMGA 3GQ9A 4YEJA 2BSPA 1O8HA 1XG2A 3SUCA 4OZYA 1DBOA 2X85A 4HWVA 1O8IA 4XLFA 1PXZA 4XOPA 2QY1A 2NZMA 1NHCA 2O0VA 1PE9A 3FY3A 2O17A 1BN8A 5AMVA 2PECA 3B4NA 5C1CA 1OGOX 4W8TA 1O8LA 4XLEA 4XORA 1IDKA 5C1EA 2QXZA 2VBEA 2Z8GA 4XONA 4XMYA 1CZFA 4URRA 3ZSCA 4XR6A 1RWRA 4XNFA 1IDJA 4Z05A 3GQAA 1H80A 4W8RA 4XN0A 2X6WA 4OZZA 4OJ5A 4OJ6A 4EW9A 3UW0A 1O8DA 4XLAA 4NK8A 3WWGA 3KRGA 4MXNA 3VSVA 3VMVA 1IB4A 2O0WA 2NSTA 2VBKA 2X3HA 1JRGA 1IA5A 1O88A 1O8GA 4OJLA 2INVA 4XN3A 1GQ8A 2QX3A 2PYGA 1OGMX 1AIRA 2NT6A 4C2LA 1JTAA 4XLHA 1QJVA 3GQ7A 2NT9A 2O1DA 4Z06A 4YZ0A 2VBMA 2UVFA 3VSUA 1K5CA 3JURA 4XL9A 1OOCA 4Z03A 4XKWA 4XKVA 4XLCA 1BHEA 1QCXA 4U4BA 2EWEA 1DBGA 4YZQA
chains in the Genus database with same CATH superfamily
4RAYA 3HEFA 1OHHA 2UWMA 2HU9A 2CRGA 2KPMA 3KPHA 2CW0F 1JKRC 3WGHA 3V7AA 4OMZA 1UG0A 2LRDA 1MDMB 4DYQA 3CCLI 1UD5A 5M5YJ 2E1MC 5LD2C 5AN9A 2A6TA 4YFOA 3BZ6A 4YDTA 2M8EA 2Y31A 4AU7A 1DUXC 2RDPA 2IGMA 3MZHA 2VQCA 1BW5A 3ZPNA 4FE7A 1KONA 4EATA 1ZELA 2KRHA 3M07A 1HC8A 3OEEA 4BYYA 2MH2A 2R7OA 4B43A 4XLNF 1K4ZA 1PUFA 4LG0B 4FX4A 3ONYA 3Q3AA 4CHUA 3LQ6A 1V0EA 1R4NB 1FRQA 1BM9A 1G3YA 5B1BH 3OMYA 4ZJZA 2CQKA 4DBRA 4RD6A 1MMAA 2W00A 2MH9A 2B9SA 1TQIA 3E6MA 4DBQA 2C2WA 4OPOA 1QRBA 3CP8A 5F0HA 5E20A 4UY8I 1LEAA 2V1NA 3JX8A 3O3KA 2HXIA 2KJBA 1USSA 3QYFA 2WAFA 5IP6A 4XLFA 2UV1A 3BCAA 4HPQA 4ZH4F 3MKWB 2PIAA 2BHYA 2MG4A 2Z2SB 3VODA 1GAWA 1BN8A 1SFEA 2OZ6A 3F23A 4RJLA 1OISA 1ORKA 1WU8A 2L9SA 3ZMVA 1T2KA 1LLWA 2CV0A 4XLPF 1NJID 2BE5F 2QMUA 1XC5A 3CMMA 3DU6A 2QGGA 1AIPA 2JMWA 5CLSA 2CUFA 3O8GA 4F93B 1U9NA 4HZFA 2HDDA 3GLLA 5DS9A 2DA3A 1I6HJ 1UMKA 2EFQA 1PJRA 2V9VA 4F55A 2JVGA 3NWSA 5HLIA 2R4GA 5LHGA 1WFXA 3N4MA 2KIMA 3T51B 3VSLA 5A89A 1ERDA 3HTUA 2BBYA 2DERA 3MEXA 3S17J 4CQJA 1SEUA 4P5OA 4QVAA 1HDPA 5A8AA 2CH0A 1D8KA 3WTZA 3OKXA 2JK3A 4O3MA 5L3DA 1O8DA 1TP4A 2PJPA 5C4XJ 2VODA 2QF7A 4ZZLA 4LD5A 1RIOH 4GYGA 1D0ZA 3OYHA 3IAM2 5IYWA 1EH8A 1O8GA 4IW3B 4BE1A 4XICA 1XCBA 1YJ9I 1Q81D 3GO5A 3CJTB 3E5UA 1BQEA 2OU2A 3GTGJ 4DZJA 1U5TA 1YE9A 5J47A 2F48A 2R7SA 3BZCA 5L3BA 1Y0UA 2LTPA 2IS6A 3F6VA 5H2FC 1FRNA 2HDCA 1KRHA 2G0YA 1UD4A 4CGZA 5HS7A 4KISA 1IDZA 5J1RA 2WAEA 2HDNB 4GYIA 4M3FA 3BQYA 3OIPA 3PUNA 2W25A 2G7UA 2H6BA 1WOPA 4ACBA 5HODA 1E3ZA 2NVXJ 3HOZJ 3ZIAA 4D7NA 2CV1A 5J4YA 3VWBA 2A6EF 3OYIA 1XGMA 3CUQB 1KYWA 5LGNA 2PFBA 3OR1C 4V19K 1QRCA 5LGUA 1NK2P 2NSPA 3ZPPA 4G9YA 2HNHA 2F5VA 4HSTA 3WY9A 2PE3A 2Q6OA 3WQZA 2RC6A 1Z7UA 4KIGA 3HSRA 5DTDA 1J7KA 1GT0C 2A3SA 3BR5A 1I27A 2P3MA 3ZQLA 2XF5A 2VQLA 3JRGA 2OD5A 2A68F 4OINF 4IHSA 2DU9A 4TMXA 5IT9K 2M45A 3O8HA 2M4GA 5DM7F 1IN6A 1Z9CA 3QAHA 4LIVA 4CYCB 4BE0A 1PJ5A 1Z05A 4UVAA 3ZMZA 4KA4A 2UUZA 4AYBN 1RR7A 4W8QA 1SAXA 2JVHA 2EV5A 3TW6A 1T38A 4NC7A 1MBGA 1VQKB 1EE6A 1HG8A 2E1RA 1O8MA 3AG1H 2H1LA 4LG3A 1P4XA 1KQ9A 3MZYA 5TISC 3JQQA 3QFTA 1RMGA 2HCJB 2P81A 1ZUNB 4RB3C 1VQKI 3JRDA 1D3YA 2COBA 5GPAA 4XSXF 4QUZA 2OJED 2XSDC 1T33A 1PXZA 2LVSA 1X19A 5HNFA 1WQ2A 4HLXA 2R92J 4X7EA 3H5NA 4CCOA 1I18A 3IKVA 3ASQA 4RPDA 2QA4B 1D0YA 3S3OA 3R6KA 2BM0A 4LFUA 3MHPA 2AQEA 1T95A 2GZWA 2QBYA 1QX4A 1VQ6B 1Q9SA 3GQBA 4M73A 9ANTA 2DA4A 2QA4I 1WDTA 1SAUA 2V7TA 4LBVA 3CUOA 1JHFA 4AIJA 5E1ZB 2LKSA 3WGGA 1T8IA 1J9IA 2OBTA 1BI0A 3K4KA 4PAAA 2QDXA 1K4SA 4HYEA 1ZRDA 1XGSA 1IDYA 1UZCA 1IN8A 1YLFA 1T0FA 3FXQA 2EZHA 2Y0MA 2YS9A 4DNCA 1YRNA 2EWNA 2FVGA 3U6KA 1LKXA 3S1QJ 1BJKA 3M9AA 1JRGA 1WCMJ 2DXIA 1QVFB 3S3MA 1AOYA 2P5KA 3FXUA 4PUSA 3BTCA 3GTJJ 1W5TA 3HIFA 3R60A 1R4MB 4KT6A 4RLQA 1OJLA 2CMPA 3ASNH 2FD5A 2PYGA 4JRAC 3ESWB 2NT6A 2E2JJ 1ZM9A 2JA2A 4W97A 3DKYA 3BY1A 1XG1A 2J5OA 3WYAA 1VQ8B 3QU6A 2JDIA 2OBPA 2WWYA 3HM5A 4ASNA 2M3AA 5DM6F 4XL9A 4ZCMA 4P1WA 5JBQA 4CO8A 3CMAB 2QZ8A 4ZYHA 3ZXSA 3FZVA 4L9NA 3BCBA 2OCEA 1FSEA 1VQ8I 3JTGA 2VE9A 2E34A 3DP7A 1YX3A 1K73D 2DJIA 3LSJA 1SFOJ 3CCYA 3CCVI 1WRJA 3T9GA 3CMAI 4YFKF 1J9ZA 1W87A 3SQNA 3TOAA 4P22A 5LRSA 1KK0A 3TW7A 1I7PA 4OOSA 3LNNA 3A0BC 3WNBA 4YZAA 2UXNA 4Y17A 2BN4A 1O8JA 1U9OA 2BW3A 2IXSA 2CFOA 2FMYA 3VDXA 1T39A 3CQZJ 5FKKA 1WZ2A 1AA7A 3LMWA 3TOBA 5FRNA 2NOJB 3IHUA 2HTSA 2PQ8A 5IT3A 5D5XB 3N97A 2BX6A 1VZ0A 2R0QC 2WB1N 3QOEA 2V4DA 2NTBA 2E2HJ 1TC3C 5J8FA 1O7FA 2VT3A 3RQ4A 4YZXA 3G4SB 3I55B 3EQNA 1QGZA 5E3LA 5JLVC 3BG5A 1IRXA 1DG1G 2RGVA 4N9IA 1NDHA 3G4SI 4BQQA 3I55I 4J01A 3P26A 3SEQA 1JGSA 2GK6A 1E3XA 4YALA 1O8HA 4E7HA 1W7PA 1JHHA 5IP7J 1IJWC 1R5OA 3V42A 3H36A 1R5BA 3HZJA 1YS7A 4LOCA 2I1LA 1JKPC 4TT3A 2WR8A 3IH2A 1E3HA 5FLMJ 4QV2A 3SZGA 4HQEA 5F1JA 1QVGB 1UD8A 3FXLA 1G7RA 4II3A 4PFOA 4P3YA 1GLNA 2OC6A 4RM0A 2DQRA 3QWLA 2VNIA 2C6YA 3QYEA 1KZHA 1BR4A 4QVJA 4RPBA 5EF6A 3IH3A 3RZDJ 3S93A 3CRZA 3LSIA 3QPHA 5BQTA 1SKQA 3BH7B 3CMEI 3Q3SA 4OPWA 3RI4A 2VKEA 3GVKA 2VC1A 2FA5A 1B4AA 1X2MA 1MH3A 2KLOA 4AYBA 2H8RA 1ZM2A 1EH6A 2RC4A 4LB6B 5K7HA 1MRZA 5J4VA 2JUCA 4N4OB 1A6IA 4GQNA 3ZUGA 2XT4A 3BY2A 3PO3J 2LZJA 1Y39A 4L8JA 2GJRA 2WJVA 4EW9A 3T56B 1VQPB 1B1BA 2GIVA 4MTDA 1QA6A 1ACIA 1WSVA 2F5DA 2JN9A 4I0BA 4MXNA 5B66C 1IG7A 1VLYA 3RKWA 2JUGA 1NTCA 3FDYA 3MKYB 1BI3A 1HW5A 3K0LA 4D9JA 1ZGJA 1QZEA 1G7SA 4DNRB 1VQPI 1RZ4A 4U0WA 4UVBA 4E7IA 1ZLKA 2QLZA 2DT5A 2AO9A 3GX4X 1BL0A 1X1BA 3QPSA 2BHZA 2K9MA 1HSTA 3ZZ0A 1W0UA 3FIWA 3KYLA 4EH1A 1XCVA 1H8AC 3B8HA 4ZDLA 1YJNB 2AS5F 4N3GA 1Z3YA 2IEKA 2FF4A 2XB0X 2VASA 1XN7A 4MNUA 4KNYA 3GVJA 3KP7A 2LD5A 3TBIA 4XLCA 1YJNI 1UFMA 4I6ZA 3OJXA 3NRVA 3ZBUA 5HZBA 3W6KB 3LSKA 4U7DA 4BGDA 5J3LA 2KIUA 3GZNB 2K9NA 3H35A 4PJLA 4LLNA 4PMHA 2ZSIB 3CD6B 3HOYJ 3TDUC 1WPCA 1K8AD 2XV4S 2EFOA 4RAFA 4HQMA 3NAUA 2JPCA 3IRRA 5IT9Z 1LE8A 1I3QJ 3P7NA 1D1AA 2DK5A 3CCUI 2EB7A 1HA3A 3L2WA 3CD6I 5H5JA 4OJPA 1Y0NA 3CP2A 4HA8A 3K4JA 5CPRB 5D4RA 4CSWA 2LF8A 2QKMB 4UUSB 3GTOJ 2QSFX 4E7KA 1O3SA 2IS4A 2BGIA 5F4JA 5D8LB 3FKIJ 2L54A 1X0CA 2E19A 3NQOA 2X51A 1U8RA 5DV5A 3WTVC 1TL8A 1NK3P 4UNOA 1MDMA 4AF6A 1COWA 3HXLA 2F4NA 3CCQI 2ICWG 3L09A 5AIPA 3BR3A 3F9KA 3CC7B 2HVSA 4KFCA 3CCEB 4OZYA 2GA2A 5D8KB 3KLOA 2ZZFA 1O8IA 2EZIA 3CC7I 3SJZA 1FOWA 3CCEI 2WSSA 1F4KA 4LG0A 1ZG5A 2A05A 2VE8A 2KISA 2K9SA 5F0CA 1V3FA 2FNAA 5DD4A 1VHOA 1WXRA 2XVCA 5IYPA 4PGGA 3TGNA 2FEZA 3VMFA 3A4CA 5FKNA 3LSPA 2XTXA 5BOXA 3BPVA 4OIOF 3K6GA 1V54H 2HKXA 4YG2F 4KMFA 2QXZA 2FX0A 1B8IB 4BL0B 3CXCB 3EYIA 4I2OA 5IK2A 2RNJA 3V7RA 4HX7A 2E1OA 1GR1A 1WJAA 2KFDA 1QGAA 2N8GA 3K4MA 2VBVA 2XTYA 2ESHA 4MIMA 3I9V2 4HV6A 2OAZA 2KHMA 4XRSA 2M30A 1TUIA 4A3CJ 1PP7U 2I10A 4BBRJ 3HOWJ 2QEXI 3KX2A 3I4PA 3K1NA 1BOBA 3KP3A 5J1YA 1PJ6A 4OAYA 4IQJA 2VBSA 3L2UA 3QPTA 4Z2YA 2VBWA 4C2MJ 5EDNA 4CICA 3WTYC 1MKMA 1USTA 2BM1A 4UAJA 2CUJA 2GWRA 1T6ZA 2F43A 3JW4A 1APLC 5HDKA 1LEBA 1O88A 5F6FA 1RR8C 1QUFA 1K8FA 4XRMA 3G1MA 4NBSA 5FKOA 1YW7A 5AIQA 3JAMK 1H8HA 3K70C 4BEHB 1LQ1A 1LVKA 1OCTC 3PSIA 1JB9A 2NYXA 3V8KA 4C2LA 2V6CA 2DA5A 3Q5FA 1PDNC 1ZM4A 3BJAA 4L5JA 1EP1B 2VFNA 2BSAA 3GUDA 2DJNA 3FHZA 3ZQFA 3E5XA 2KDZA 1J5YA 1ZG1A 3E6DA 4TMWA 2D9RA 4G1BA 2LKPA 1FY7A 2R3SA 1OR7C 4BBSJ 4NNJA 5AONA 2J8KA 3T5XA 2A6HF 2OQRA 4IRGA 3TQNA 4OIQF 1MABA 3COAC 2EA4A 3BR2A 4BNCA 2P5VA 3ZQGA 2C5HA 1LJ9A 1XMXA 3BG9A 5K5OA 1A36A 1LFPA 5ICCA 5KSWB 2PMDA 2VBUA 3GQ8A 1MMSA 3EDPA 3AG2H 4HSRA 2KDOA 4A69C 4V2FA 5D4SA 5H6RA 1GXPA 2XAUA 2DOFA 4G7XA 4FISA 4ZTFA 1O8FA 1VBLA 3Q0WA 4FE4A 4CDGA 2LFBA 2K7LA 1BMFA 2L9NA 1S72I 1Z3XA 2BW3B 5BPDA 1JXSA 1RKWA 3R0JA 3FKSA 1MMDA 3TP3A 5HZAA 4E7SA 4Y3OA 1VQ4I 2B63J 2VFMA 2CUZA 3M7GA 1L0OC 3MAJA 1T98A 1ETWA 4L9JA 1R36A 1OKRA 4M3EA 3JTHA 1N77A 2GJKA 2BM7A 2P6SA 2LG4A 2QQBA 3CUQA 3I3LA 3J7AO 2KP6A 1JUPA 2DOEA 1N78A 4W8SA 1J09A 2IOUG 2AHQA 1CLWA 1F20A 3LMMA 5FFXA 2R7VA 1E3OC 3ES9A 4ZYEA 4BJ6C 1Y1WJ 2VUMJ 4IEJA 1NG7A 1KYZA 3RZOJ 2KVOA 3JRHA 3RKQA 2X6OA 3D0SA 2X1DA 3K10A 1DBOA 3DV8A 4EJTA 2XGDA 4KITB 4Y13A 4UZEA 1JE8A 2MC3A 4XKCA 2VZLA 4YIIA 5EEAA 3I56I 1U78A 4L0ZB 2F3LA 2GK7A 1NG6A 1EKEA 1S29A 4CYCA 4X05A 2E35A 5DS0A 4AIDA 2EZKA 3ZMUA 2BEOA 3LA2A 5J35A 1OGOX 2E7XA 3WHBA 5IYDJ 1IDKA 4P12A 2JA7J 3F6OA 3DPUA 1OB2A 3JR9A 2DFIA 5A2QK 1ZTRA 4ETSA 2W6IA 4AUXA 2ZMEC 3A03A 1E1QA 5IPAA 1S0UA 4R8HA 1TWHJ 2DFEA 3CB4A 4WZKA 3L2VA 1FJLA 1IDJA 4L9VA 2K85A 4WWCA 1NRKA 4Z4VA 3K4CA 2BM5A 2L7FP 3A2KA 3W5UA 1HF2A 1OR7A 2BVLA 2DMPA 3F8NA 3CF5F 1UHMA 1F60A 3MD2A 3TDZC 2E5NA 1MSEC 1EFTA 2BY1A 3BWGA 2KRCA 5JR3A 3ZCOA 2XNDA 2I5UA 3VMVA 3HRUA 3Q6RA 2Z3YA 1WI9A 1X4PA 3KEOA 4ZGNB 4LMYA 3NARA 5FD5A 3A8JA 2NNNA 2W1OA 1UD2A 6PAXA 1BPLA 4WQMA 1UMQA 2LREA 2K27A 5LMZA 2QGUA 1I50J 5ED4A 1HBXG 1FDRA 1Q86D 1OGMX 2V1XA 2BV3A 1J2XA 2OTLI 1ODDA 3DBRB 4EEFG 1DP3A 4LLGF 2X8KA 4RB0A 1NB9A 3H92A 3PSSA 3U6BA 3MCAA 1U2WA 2CU7A 2EK5A 3DKWA 1WKMA 3JURA 4OPSA 1QH0A 3R6JA 5IYBJ 2K4BA 2V9PA 3DBLB 3VSKA 4LK0F 3OYGA 5E1WA 3L2QA 1IV6A 4JK1X 4KKSA 5E3OA 3E20A 3BQZA 2JQ7A 1R00A 3GTKJ 3OPOA 1SVLA 2A61A 2VQHA 4TV7A 4KN7X 4UZFA 3SLNA 1TTTA 3RQIA 5DCMB 5EG0B 2VXZA 4S05A 1CF7B 5C44J 5FRMA 1UELB 2MFZA 1A5JA 4R71A 4YEIA 1FT9A 2VFOA 1C0WA 1MZBA 5DUKA 2FX3A 3KETA 1CNEA 4RA2A 2HXOA 4HX4A 3JSPA 4IHXA 3E97A 1B9NA 4ENKA 2DQLA 3OZWA 3HSEA 1G7TA 1PLUA 1DDIA 3GVAA 4C30A 2JPBA 2NVYJ 4BXXJ 3GFMA 5M5WJ 3ML3A 2WV0A 3DKXA 4EJOA 3OW2B 3AVUA 2DFFA 1OB5A 2X1CA 4PC3A 4FT8A 1S7EA 3N90A 3VYUB 4P96A 1I3AA 5E18F 4ESJA 4CA0A 3PUFA 3L00A 2EIXA 5DSZA 2EPFA 2JN6A 2DN0A 4YEJA 4A5NA 3TO7A 4GXOA 2JA5J 3K2ZA 3DEEA 3S1RJ 2Q6IA 3H09A 4WXDA 5KCMA 2GIZA 3WBJA 4HWVA 5J6XA 1DU6A 3S2WA 2BVNA 2J7KA 1R5NA 2CFXA 1S9HA 2ZITA 4G6IA 1MIJA 4B3FX 2LKXA 3FXMA 5LEKA 1X1CA 4NQWB 3FPKA 2NAZA 5EZHA 4KDPA 3ZMDA 2KZGA 1U8BA 3HUGB 2FU4A 1EXMA 2PECA 1X1PA 2DA2A 4ASUA 1UJ8A 4BUPA 1TYUA 2ZL7A 3CF2A 4ZTJA 1JTYA 4Y9RA 2OA4A 3JRIA 4WZEA 1Z91A 3LQEA 2IS2A 2DYIA 3H9QA 1MBHA 5F0FA 3LNQA 4RD3A 4LIUA 4X8IA 2TCTA 4M6XA 4TMTA 3P5JA 1FLIA 3GIRA 1DARA 3Q6QA 4Z4TA 4J0QA 1P7IA 3BQJA 3BPXA 2H09A 4OZZA 5IYCJ 4RGXA 1HW2A 3LA7A 3O6BB 1QFYA 1WORA 4Y33A 3IP4B 3VYSB 2DA7A 5C4JJ 1MSFC 3J81k 2CWEA 4BE2A 2JJ2A 4UB8C 1R23A 2QUFA 1TQMA 3JAMZ 1CQXA 2ZZEA 3UR3C 4ENNA 1RC9A 3DBHB 3HGGA 4EM1A 3A8KA 3SZEA 1B59A 4XRSG 5E8IA 2QQ9A 2Z99A 1IZ1A 1QGPA 4OOIA 4E0FA 1ETYA 1G59A 4IO9F 1X1DA 3U1KA 1D5YA 2NVTJ 3W2IA 3PUBA 3TO6A 3R6SA 2ZJRF 3MMYB 2DCEA 4RAGA 2D5VA 2M0MA 1ZR2A 4DW6A 1FC3A 3AVTA 2PJRB 1E63A 1RPWA 1MBJA 2HQAA 4AVPA 2RAEA 1BLIA 3M8FA 2V9KA 3U2RA 1BHEA 2R7WA 1YJ9B 5J8CA 5KAFC 3CO7C 4A3GJ 1ETXA 2R7QA 3F8CA 1XDUA 4ENMA 4ABZA 3HKZN 3QFSA 2VI6A 1QA2A 5HS8A 1EZGA 1MJAA 2FUG2 1ON2A 2YPRA 1L3LA 4M6YA 2PYHA 5FO5A 4MLOA 2Z1DA 4LK1F 1WPKA 4HX8A 2VJ4A 2FRHA 3ZMSA 2UVEA 3K4BA 4Y4RA 1O3TA 1HF0A 4RDKA 4BXFA 2J5PA 3FXOA 1WGXA 1MMGA 1SD4A 3FJOA 4U88A 2HPMA 3OP1A 2GOXB 4IF4A 4MR0A 2VQGA 2XRLA 3AFHA 2JT1A 3RIRA 2ZBVA 4EM2A 4EGYA 5L46A 3AG4H 2LSOA 1FNDA 1YI2B 3HOTA 1T08B 1MGTA 1IB0A 4FETA 1GVJA 1TWFJ 4X7CA 2B0RA 1E17A 3HOVJ 3HTSB 2P8TA 2M87A 3OOPA 2VN2A 1ETOA 3GF2A 1YI2I 3TKYA 2RV8A 4YIFA 2C78A 1XD7A 4I01A 1R1TA 4E7ZA 1SVOA 2HDWA 3F21A 1VF7A 1GHCA 1SVMA 3QP5A 1QZYA 2MGQA 3D26A 2L3DA 4YFXF 3ISPA 4XSZF 4Z4YA 2LK2A 1Y8QB 1G4DA 2M4KA 1R1VA 4UUSA 1TSPA 5E17F 3RPQA 3RY8A 3SDGA 3G71I 5J40A 3G73A 2A5YB 5A2QZ 3GTMJ 2VFQA 4E6KG 3W2HA 1HSJA 1RKTA 4L9TA 5LHIA 3SEJA 4NUBA 1XSXA 4XLEA 1FTZA 5F4MA 3RTRA 5CKTA 4BQNA 3ASPA 3F8BA 2DETA 3JCUC 3LVBA 1H85A 4HG2A 1AMOA 4AIHA 1XFOA 5KW9A 2OV7A 2TDXA 4ANJA 1J59A 1FYLA 3SYTA 3BLYA 3GTLJ 1QO0D 1EP2B 3NE5B 1H80A 2GXBA 2X53S 4S04A 2Y30A 4A3IJ 5KAIC 1I39A 2EH3A 2DK8A 2B7EA 2BV6A 4HV5A 3OW7A 2QM3A 3K4LA 2P7CB 1YIJB 1TT0A 1OCPA 3FWEA 4D5CA 3JU4A 1MJ9A 3S2HJ 2VNHA 1RUNA 4BPRA 2VBKA 4B09A 3CPWB 1HQCA 1SD7A 3VB2A 5FKLA 2STTA 1FNNA 1OLTA 2CF4A 3SYJA 1B8IA 3LSTA 1YIJI 4WXHA 3Q0VA 1TWGJ 1K78A 4M1KA 4HDVA 1KQ8A 3GWZA 5IYRA 3K7AJ 4KMUX 2R7ZJ 1GUUA 5CVJA 4E70A 2X4HA 4IL6C 4Q47A 2Z9OA 4A0XA 1VHEA 1KU7A 1TLLA 3ABKH 4UUTA 2LNBA 2CC2A 1UAAA 1YW9A 4UV8A 2GLOA 2BY3A 1TNTA 2ZFUA 4C3IJ 3BCDA 1OOCA 2QZAA 1VI0A 1FP1D 1LVAA 2LY2A 1ZM3A 2EINH 2GA1A 3ZN1A 3E3VA 3B6CA 3FKJA 2XNJA 4IX7A 2BY0A 2LF7A 1AU7A 4L18B 2IGKA 3BR0A 3F3XA 4M71A 1HVXA 4YC5A 2F6CA 4EJVA 3RSNA 3E1SA 4PGHA 4BEHA 2QYOA 1DDNA 2YX7A 4A0YA 2K4JA 2XEXA 5LRRA 2AHOA 4ZYAA 4PZJA 2ISYA 4U0YA 2INUA 1FNMA 3P9CA 4JX6A 2DOAA 2ZJQF 1Y1VJ 2BF4A 3PUMA 2DOGA 4PJ0C 4QLCU 1X58A 1T6YA 3SZTA 3V76A 1LDJA 1Z6TA 2EFNA 2W85A 4HE5A 3ASRA 1IF1A 4OOVA 4M74A 3W6VA 3MWMA 1R5HA 3CCVB 1H89C 4KH3A 4RAZA 4XM3A 5DCFA 1D1BA 2EQRA 2X6YA 2O03A 4KKUA 3JSOA 2MC4A 3HBLA 4XQFA 1FP2A 3HHGA 2O5RA 4IPAA 5JVGF 1YITB 4NB5A 2L7MP 4PC2A 5IYQA 3VNUA 4DK1A 5ILUA 3DXJF 3T8TA 1NHAA 3I64A 3OSFA 2Q6KA 2KMUA 2HFHA 1OYYA 1YITI 2ZMEB 2XHKA 5CYVA 1Y56A 3OYFA 4IVNA 2IAIA 1G6NA 3T0YA 4YIRX 2E7WA 2QQAA 2M9HA 1SD5A 1ZLJA 1A8PA 1RQPA 2CBXA 2M5SA 4HE6A 4FWTA 3EETA 3HKZA 1EWYA 2Y75A 3BY6A 4EMSA 2WY7Q 1IHMA 2CQNA 3DQVC 2WV1A 3KP5A 1VQ6I 5JLXA 2XRNA 3V7CA 3BTLA 5LLQA 4JQFA 2GXGA 1QQIA 4G8XA 2XGCA 1Z77A 1VQ7B 3E7LA 5FNZA 2NS8A 3FBNB 3I71A 3WTXC 4IHWA 1W4MA 4NCNA 2HYGD 2O9LA 3K69A 1VQ7I 1XX5A 3KEQA 2ELKA 2HPIA 4YAOA 2XNCA 5DNSA 1E62A 2L0KA 3U9GA 1A6QA 1B23P 1O57A 2DY1A 4M4SA 4EV0A 3TO9A 2E1BA 3CDIA 5EGOB 2X3HA 2NS0A 2QTZA 1DPRA 2QSHX 1IC8A 1JKQC 3CMEB 2IA2A 2UXXA 3FK7A 1U2RA 1OFEA 3RDIA 3C3WA 1QU3A 3WHCA 2FQ3A 2DA6A 3T53B 4BKXA 1Z0XA 5D6FA 4YZ0A 2V7XA 1PKVA 1YOVB 3C1DA 3D1NI 2QTLA 4YAFA 4YXWA 2Q2EB 4LBWA 3KL9A 1G3TA 1TTYA 2D3LA 4B1RA 2YX4A 2R6HA 4XKVA 1KC8D 5EMNA 2BXYA 2L7KA 2FSWA 2LMDA 2G7HA 2VOPA 3SQVA 2XROA 2DT6A 4P26A 5TRDA 2EIKH 1JKOC 4HOBA 2ECBA 3RYPA 2DFHA 4Z6YA 2JSPA 4X7FA 5GTHC 3OEHA 2ZXWH 2Y69H 1T5EA 3AVVA 3BR1A 3A8IA 4C3HJ 2E2IJ 1GJRA 4G7WA 1TQPA 3ERED 1BJAA 2I8DA 4DNTB 2MD5A 2WZNA 3BZKA 1J75A 2HVQA 3SY2A 1X4OA 1AKHB 2VJIA 2XUBA 2Q1ZB 1WOOA 2KKOA 2PMZN 1KK1A 1GO2A 4NK6A 3AGQA 2Q0OA 2RN7A 3RCOA 1RRJA 2B7BA 3RPUA 3CC4B 2DYSH 2V5IA 3IWZA 1OFCX 1XB4A 4Z4UA 3K9TA 2ODLA 3B8YA 2WC2A 4RGSA 2LH9A 1N0VC 1ZRFA 5DCMA 5EG0A 1CF7A 2HVRA 4IOAF 2W24A 4WZLA 3VPRA 4KKTA 4AD9A 1RESA 3KIOA 3CC4I 1RI7A 1Z67A 2IRFG 4M72A 3CCUB 3ZP5A 3HYIA 4FTHA 1JJ6C 5DD8A 2E71A 4TN1A 4IJAA 3H5AA 3CDLA 3OYBA 1OB0A 1N25A 4G6TB 2CNDA 4YCQA 2Q8KA 2OCCH 2RQPA 2XASA 3DPLC 4BQAA 2XPUA 1KU9A 3FF5A 1M1EB 2HYFA 2CQXA 1W36D 2B0LA 3A02A 5HS9A 1GV2A 1QRYA 4IQ4A 5JVTA 4ESFA 3LSRA 2W7NA 3CCQB 3B4NA 2IS1A 1K6OA 1UD6A 2CYYA 4QSHA 1M90D 1WI3A 4I02A 2R7TA 2F1MA 1O3QA 1W0TA 1N75A 3DF8A 4BQOA 2JTVA 3KFWX 2O6GE 2XPVA 5HNHA 3W2GA 2HYJA 4G94A 2JJ7A 4QFMA 3OYKA 2IT0A 1VLOA 1Q1VA 2V7UA 2X6WA 2K9LA 4ENJA 1VTNC 1TBXA 1R58A 1DPUA 1W0JA 1ZGAA 4EM0B 4NQWA 4LBYA 5CQEA 4MTEA 4G7OF 1FMVA 2VL8A 3UW0A 1FIPA 3HUGA 2V7QA 4NK8A 3VSVA 5GTIC 2VBTA 3FM5A 3WNDA 2RQQA 2V26A 3EUHC 2D1VA 1SMTA 4G6DA 3U1DA 3OAAA 4FN5A 1HXDA 2RC5A 5ICFA 2M34A 3W2VA 2E5ZA 4CH7A 4ZZDA 3VEPA 2F5CA 2D45A 4Y52J 5ERIA 2VB6A 3OFNA 1SC7A 1U3EM 3HPGA 4II2A 3QP6A 2INVA 4L0YB 2K3FA 1HW1A 2WB1A 3IL2A 3AVYA 1D8JA 3BH4A 1K78B 2IA0A 1G3WA 2QEXB 4ZGQB 2BMWA 2GPJA 3F8FA 2YU9J 3HDDA 4ITVA 4L5EA 4ZCLA 1ZG3A 4MYTA 2OPTA 3VSUA 4A3BJ 3ONQA 3WODF 4M0LA 2DODA 1N06A 5TR9A 2X0KA 1W34A 5E3MA 1D8TA 2KJCA 2L2OA 3OIOA 2XAHA 2PEXA 3G3ZA 5K7ZA 5IP9J 5GPCA 3Q9SA 4LGWA 1XQBA 2XOKA 5K5RA 1B9MA 1DBGA 4HLYA 4C3JJ 3GFJA 2R5YB 4M3DA 1B72B 3DTIA 1FNBA 3FXKA 2WYRA 2EA2A 3K1PA 1BIBA 2PX9A 3QQAA 2A69F 3VYRB 5LHHA 3MFKA 1ZH5A 2G0EA 2EJRA 1BBYA 4XOTA 2PN6A 5DDGA 2VPRA 2Z5UA 2ZO4A 3NWTA 4X0GA 3BG7A 4B48A 3DWLE 4YAWA 1IUFA 1ZARA 2AXTC 2XB5A 3ZZUA 4TMZA 3RJPA 2H27A 3SLDA 2W84A 4F3QA 4J00A 2FMLA 1DQUA 2PJRA 1EFUA 2ISZA 1S8NA 4CCLA 2FOKA 4KIFA 1TLHB 4A5MA 1K7AA 3GEZA 4H0EA 1IN4A 2JRTA 2YSRA 3JRAA 4RB1A 2V7VA 4QHYA 2HR3A 2OK7A 1H0MA 1WJDA 2OF7A 3BG6A 1F9NA 1O3RA 2DA1A 1JUMA 3H94A 1D1CA 3OS1A 3FXJA 1MNMC 1S72B 3BP8A 2XDVA 2YWHA 2XC1A 2XKOA 3D5RC 4M6VA 5FB2A 1VQ4B 4J19A 1LM1A 4M9ZA 2K9QA 1XG2A 2V7WA 3B6AA 2L5QA 3ABMH 3QYBA 3DDYA 2QY1A 2EILH 3ZGKA 1M1KD 3M1CA 1R49A 1N05A 4P25A 3EUHA 4A3DJ 4RGRA 2L7ZA 4A6DA 3PENA 5AMVA 2BM4A 4ZYGA 2EFGA 5CVUA 1XSVA 1YQAA 3TEDA 3B73A 3HGYA 3L9FA 3AVXA 2LBFB 4JX5A 4KICA 4EJWA 2BGJA 2PMZA 4S0HB 4P6YA 2VBEA 2Z8GA 4Z4RA 1LFBA 3LWFA 2DT7B 3PIPF 1Q7YD 4PABA 4UXNA 4URRA 3I56B 1Q1HA 1Z7LA 3SFIA 2Y2ZA 1OCOH 4V2GA 2GOMA 3H0GJ 4Y15A 4GFBA 1BX0A 2V7FA 3O2PE 3I1FA 1FBQA 3H3UA 4CUGA 1YO5C 3IWFA 1XPXA 4XLAA 4BACA 1LB2A 2R7XA 3WWGA 3ZQ7A 1E3PA 4C9YA 4XIDA 1BIAA 2DIEA 4RLZA 3OIQA 4Z4WA 4M9XA 1QQ1A 2KIFA 1PYVA 4WZTA 4RMNA 4BHPA 4A3FJ 1IA5A 4BJ5C 5JHUA 3U21A 2XTWA 3WG7H 2F4MB 2HQRA 2VKHA 2DLLA 3G6EB 5L3GA 2CW7A 1K6YA 3DLLF 2R5ZB 3PM1A 3OOUA 4Z06A 4WWVA 4G1VA 2MABA 3OJWA 3SFZA 3CCRB 3G6EI 2WTEA 1QPIA 1H9GA 1YFHA 4AC0A 1IJFA 3AL0B 4X07A 1DGRM 3OYNA 4Y9UA 3VR6A 2X3UA 1LDDA 1QFZA 3TH0A 3A1YA 5HDNA 2W48A 3CCRI 3ABUA 2F1LA 2HLDA 3CC2B 1QCXA 4XRFA 2EFPA 2GM4A 2K02A 3LQQA 2ZB9A 3ASTA 3EQOA 4P6VF 2LDUA 5HDGA 2VBYA 3FXRA 2OTLB 3CC2I 1QUEA 2FBIA 5FJ8J 4BAYA 3H3ZA 1BR2A 1EFCA 3IKTA 2Y48A 2M0CA 2LP0A 3A1PA 3LFUA 4CCMA 5EYRA 3B90A 2L9RA 3PIOF 4D0PA 3CJQB 3ZOBA 3WNCA 2X6XA 1WJCA 1O8KA 2OBRA 1KCDA 3FMRA 2Z6BD 1KTVA 5D5UB 2W7ZA 4KYWA 5GAHJ 3IH4A 3PSZA 5FLXZ 1IO2A 4CCJA 3OZVA 1DGWY 3KCCA 5EEHA 2JSCA 4EJUA 2NNYA 3J7ZI 2PI0A 1QGYA 1WTHD 1YHQB 2IW5A 4PSWA 5L3EA 5LEJA 5CVVA 5H59A 1I5ZA 3VO1A 4AF7A 1XTAA 5E1XA 4HEA2 3QPLA 2A07F 3RKXA 1YHQI 2VPLA 2L9VA 2QWWA 2ZZQA 4MQVA 1MH4A 5BSYA 1YW8A 4UV9A 4RB2C 4H4KC 1DU0A 1H88C 4YHBA 2O8XA 2RNGA 1TVCA 3MQ0A 2JZYA 3MKZA 4MEXF 2W6JA 1Z6RA 1NHCA 1RETA 1KMHA 3R0AA 1ZK8A 5IOYA 5TV2A 3PNTA 4GO1A 3OYAA 2C5BA 1V5EA 3ZZTA 5ILSA 3HHHA 1YX2A 1NB0A 3BOQA 5C1CA 4A0ZA 4W8TA 3SZPA 1MD0A 3HPHA 5KHDA 3P9KA 3S8PA 4DQKA 4M2LA 2K3PA 3D5LA 1P9QC 3HG9A 3SJPA 1ETKA 2ZMEA 5M3FJ 1QZZA 1K61A 1CZFA 5TY0A 4HNVA 3ZSCA 2RREA 2X1EA 4F52A 3CCJB 1LLZA 3KE2A 3ML6A 2ETHA 3SXYA 3GQAA 4FQGA 2VLAA 2FNPA 3S15J 3LJYA 2DMTA 2DYRH 4UHTA 1EA3A 2OUMA 4XN0A 4B44A 3WTTC 2ECCA 2E1CA 2BXZA 4OJ6A 4X7DA 3CCJI 1TYWA 3S2DJ 4NBQA 1T6XA 3OS2A 4RBOA 1LFUP 1QHGA 1LNWA 2HEOA 4QTRA 2E1NA 1W35A 1VQLB 4MQ9F 3PO2J 4CZCA 2EIJH 3JRBA 4C2UA 3TMOA 2V79A 1CNFA 1VQLI 2QN6A 4OPVA 2MW8A 1U5TC 1X3ZB 4PFPA 2WA0A 4UB6C 4D1QA 2XGJA 1YJWB 2P6TA 2CK3A 1JTAA 3OS0A 3DTKA 4IHVA 2EIMH 4KT5C 3MMPA 3OYEA 4X0CA 4A6EA 4A3LJ 3KZIC 1BJZA 3AVWA 1J0RA 2WY8Q 3ELKA 1YJWI 1K4TA 5ICGA 3CTAA 5EGOA 1X1AA 2XGEA 4BXUA 3F22A 1A31A 1SFKA 2DW4A 3V7SA 3B78A 2D3NA 2JIZA 2EWEA 2LY1A 4CXFA 3PNYA 4RD1A 1FOXA 5DN6A 1VQOB 3PNVA 4XK4A 5CVRA 2DEUA 2F4OB 3DEWA 2ZL5A 3MZ8A 1OFMA 3HRMA 2ZTNA 1GAQA 1REPC 4FK8A 1WJFA 4Z4ZA 3RYRA 4OP7A 1Q82D 1VQOI 1KCCA 1EA0A 2F4IA 2Q6LA 1BN5A 4BJTA 5IY5H 2XC7A 3GTPJ 5LGTA 1YX5A 1X3UA 4WF2A 2IVMA 2Q2EA 4XBFA 1UCRA 5CJ9A 3AGPA 2XIGA 5F27A 3OYMA 2YUSA 3J7YJ 2BVMA 3VMWA 3P27A 2ZKZA 2ZBKA 3AKZA 1FOYA 1ZN2A 3HRTA 1IRZA 1KQ5A 1U0JA 2NTQA 4BHBA 3KP6A 2O04A 1IN7A 2LC2A 1IV8A 2R7DA 3DU1X 2J8IA 2TRTA 4UZUA 2L02A 1ZHFA 2YWGA 2H94A 3HJEA 4JYKA 4MGRA 3IRQA 2K86A 4IRHA 1OGIA 2RVCA 2WZPP 2L4AA 4FX0A 1MNEA 5LBQA 4MYUA 2CO5A 3DLAA 3ROUA 1SANA 4M53A 1AKHA 4N3NA 4XOPA 1IGNA 2MA3A 2O0VA 2PMUA 2O17A 3IUOA 1KK2A 5L3FA 2HKOA 3C2HA 2O7OA 3M1EA 1UB9A 3DPTA 1MMNA 3RKYA 4E4HA 2NV4A 5BSXA 3WTWC 5FO1A 3L2CA 2FJ1A 3VYTB 2IP2A 4RCYA 2LY9A 3W2FA 3JREA 2ZBUA 1R7JA 2IA1A 2ZXJA 1SMYF 3CLOA 1WJ5A 3GMEA 2XT2A 2D1HA 2E36A 5FA6A 3QOPA 2BM6A 5IOZA 1QNTA 5ILVA 2B5OA 5GV8A 3IAS2 1X3WB 3LSHA 5EEGA 3U2QA 2M7AA 3LSMA 2ID3A 1FBSA 2A5WA 3G71B 1K28D 5FIUA 4OJ5A 2IPQX 2XZPA 4DK0A 4BS9A 3ULQB 3ZR8X 5GADJ 5FD6A 1CQTA 1BI1A 1T0FC 4PJMA 5K7FA 1YLOA 4HF1A 4C43A 2NS7A 1JJ8C 3I59B 1JJ2B 1BOAA 1TW2A 1FYMA 3JRCA 3HB9A 4I99C 4OAZA 1W1WE 4PSXA 3C2BA 3ZN0A 4M9SA 1BC7C 3I0TA 1P4WA 1QVTA 1AWCA 4LLLA 2O8KA 1RUOA 3PSFA 4GCVA 3E0JB 5M5XJ 1GQ8A 4BHCA 1F5TA 4OMYA 1AIRA 4IHTA 3H0DA 3AK5A 3SJMA 4RD0A 2XKPA 4XLHA 2PLFA 1F1ZA 1BA5A 3TP0A 1QA3A 3ABTA 2UVFA 4I76A 2QE7A 1KQ0A 4FXUA 3LSGA 4PC7A 3ZQHA 2MBFA 3QSYA 4RM2A 1UHSA 3DU5A 2P0WA 3FX3A 4B47A 2M8GX 5D5WB 1B2RA 2ZTGA 3DTEA 2D2WA 2HTJA 4PK4A 2HZTA 3BR6A 3BTJA 2BY2A 1WH5A 1X2NA 5HLTA 1WVRA 1JI8A 5BMZA 2NPFA 1ZQ3P 1FOKA 1SFUA 1VNDA 3WU0A 1FPQA 4AWXB 1HDDC 2EV0A 1W5SA 2IBDA 2ME6A 2NOGA 1H8EA 1OGJA 2VJJA 2L01A 2X0LA 5GAEJ 3WGIA 3FPPA 3BDDA 3KP2A 5DYMA 1W0KA 1W7PD 1KU3A 2HS5A 3JQPA 3LL7A 1HOMA 1Z21A 3R61A 5E79C 2HOTA 1K79A 3S16J 4PCQA 3PQJA 3G05A 3GVLA 3ISXA 3OSGA 2HWVA 2VJ5A 1R1UA 4BDYA 1OPCA 3LAPA 3C2GA 4MFEA 1WJEA 1H42A 2RKHA 1FWZA 2W4SA 2E60A 1SKYB 5B5EC 1FZPB 3KYDB 3BT9A 3DCFA 4EVIA 4I84A 5EZGA 2BOLA 2R5YA 1B72A 2JJ1A 4N4NB 4QWQA 1ZREA 3SKBA 3GQ9A 2GXAA 2KZVA 4PJNA 2R7FA 3GCMA 1WWXA 3A01B 1SM4A 3E6BA 2IJLA 3GFLA 1W9XA 4L5IA 5TJJA 1ZRCA 4UUVA 4C0SA 2HI3A 4BY7J 1N07A 4WK8F 3WTUC 4IRIA 2OQGA 4X06A 3ZC3A 3HSFA 3V8LA 1FNCA 2C4TA 2ESNA 1XGNA 3DFGA 1P7JA 2R7RA 1QHHD 3AL0C 3I4MJ 3FY3A 3PL8A 4DOZA 3J7AY 3B02A 1UHWA 3LQRA 3CCSB 3L7WA 4FASD 3GXOA 1D2EA 2FQ4A 4IKFA 1S4MA 2COMA 2VXDA 4XONA 4XMYA 4DZPA 3CPXA 4JMQA 2X9DA 3M3YJ 2C77A 1I6XA 3TL4X 2HOSA 1V5GA 2YU3A 3CCSI 4YFNF 1Z1DA 2O3FA 4KIBA 4Z05A 1TYXA 2FBHA 5FROA 2XGXA 4W8RA 5CDFA 4Q4ZF 1F43A 4YRVA 1ZYRF 3OYCA 3JQRA 3GFIA 3A3BA 4P55A 2PLYA 1G7CA 4DGWB 1TW3A 3I53A 4B3GA 1Y0RA 1R5GA 3RPUD 1MBFA 1OCZH 1EV7A 2WADA 3I5UA 4OOXA 3ZMTA 2ZSHB 2LBFA 2HGCA 3OV8A 3AAFA 3VFZA 1XSDA 3J80K 5GP9A 3K2AA 4Q5SF 1FBUA 2ZJPF 2YWFA 1VJSA 5BS6A 2MLGA 5B3SH 3WXMA 3T8RA 1HKQA 2H1KA 2GAUA 2VC0A 1P4MA 5HLHA 5H20A 3HAGA 2OZUA 4WXCA 1WJBA 1BX1A 3RIQA 2KQRA 3CLQA 3WE2A 2NRAC 2O1DA 3QODA 5ICEA 2DDAA 1YG2A 5F4OA 3GW2A 5B1AH 1YS6A 3MKLA 1ON1A 4V02C 4ACAA 1YYVA 4M3BA 2DMQA 2DPUA 5F08A 3G1LA 2OTJB 2XAQA 4DJAA 1LDKB 1V4RA 3MCZA 4P9FA 5KNLA 1PUFB 1KZLA 3A3GA 2JWTA 1BI2A 4JX4A 4UVCA 3WTSC 2JA8J 4YZQA 1P92A 3HC7A 3ZQQA 4W1UA 2LR8A 2V1DA 2OTJI 3SDBA 3KZZA 4A3KJ 1V5VA 5JMCB 1LUJB 4Q48A 4DQLA 3LA3A 1WP6A 2KT0A 3KLNA 2R5ZA 1MNDA 1Y8RB 4JBAA 4OM9A 2ZC2A 2MLKA 4ESBA 5DEQA 2JA6J 3Q38A 1KTWA 1H9TA 3NAWA 3QE2A 3GSIA 1QG0A 4RD4A 1E2XA 1KD1D 1TNSA 2OBSA 1D1NA 2AXLA 1FX7A 3UKGA 4E7JA 1YIOA 3FMSA 2ZL6A 4XKBA 2ZXHA 4LJZF 1ZR4A 3OOCA 4ON0A 4GGGA 3REOA 4G6QA 4PC1A 4N9HA 1NBMA 2NTPA 4YELA 4RDJA 2Y9YA 5FO0A 2ID6A 2XPWA 3OL3A 3QU3A 4I0AA 4U0VA 2R93J 5CQGA 1TYVA 2DDBA 1RU4A 3CJRB 1KK3A 4LB5A 4BDZA 1JA0A 4ZC3A 2MD0A 2QSGX 4D7MA 3F8MA 3HL2A 5D6EA 3EPZA 3OWTA 3SUCA 2F5FA 1HZEA 2VYQA 3S14J 3S3NA 1P4AA 1G3SA 3GTQJ 3EUAA 2FOWA 3FMQA 1POGA 1RNLA 5KVRA 1IN5A 4QPQA 1ELOA 1R6RA 1Y6IA 4Y7NJ 2XAFA 1QFJA 1KJZA 3EQLF 2XZOA 1MBEA 3K1MA 1DP7P 1IW7F 4NC8A 2NVQJ 2CJJA 1F36A 1KA8A 1ZGWA 4K2EA 3W5HA 4XORA 2HOAA 5FLXK 2HQ5A 2NXNB 1FTTA 4RDLA 3MVPA 3KP4A 5FKMA 4RCZA 2X48A 4U9UA 4K1XA 4WX9A 2E1MB 4RLFA 1JTXA 3K4NA 1GVHA 2QQ8A 3E5QA 1JT0A 3ABLH 1JNYA 1U5TB 2Y9ZA 5CVIA 1RWRA 3SEZA 2H8WA 3OR2C 1PUEE 1GXQA 4F92B 2XF6A 2GBYA 1K83J 2WJYA 1TWCJ 2WAQN 3WU1B 1BW6A 2HQNA 2YWEA 3PVDA 4TKOB 1D5VA 1TWAJ 4MO7A 1FX0A 2CUEA 4NDLA 3JRFA 1SD6A 3OE7A 3HOUJ 3OZUA 1IB4A 1E43A 1XMKA 4HF2A 2GREA 2W57A 5F1RA 3C18A 4GDFA 4MFDA 2QCOA 3N6ZA 4OJLA 4CZZA 4XN3A 2PBIA 1B6AA 2D74A 1WH7A 1A35A 1IUYA 1JT6A 4P1VA 3ERMA 5EJCA 3ZQCA 5E3NA 3GQ7A 3KEWA 4BY1J 2ZXIA 4O5VA 2Y0SN 3H9JA 3OYLA 1S7OA 4I7HA 1ULYA 4M3GA 3OYDA 5D5VB 3J81K 2AQFA 2H6CA 4H9GA 2XF7A 4XKWA 1BR1A 2L4MA 3AG3H 1W36C 1AHDP 1S7AA 4R1HA 2DAOA 4I09A 2FE3A 1BC8C 5HKKA 5C3EJ 1XB2A 2DPDA 2Z16A 1I1GA 4OWRB 2V4JC 3OY9A 2CW5A 2VT2A 3WG9A 3SHFA 4IZZA 3GLXA 4XD7A 1ITYA 4R79A 3C7JA 5GAGJ 4PJJA 3H1CA 1R5ID 1L1IA 3N05A 4ZDOA 2VOOA 2DTRA 3GYHX 1IXCA 2ELHA 2DMUA 2DO7A 3GZ6A 1UD3A 1WHUA 3PETA 3G2BA 2P7VB 1JA1A 2XAJA 3ZRGA 4P9UA 4U49A 3CDHA 2K5CA 1T6SA 3PA2A 2UZKA 1UG2A 2VKDA 3UNGC 1XS9A 2ZNYA 3PJRA 4PDKA 5BNGA 3Q39A 3H9GA 4RDUA 1WSUA 4DYRA 3E1YE 2F5EA 3MN2A 4AVZA 4PC6A 4I98B 3VO2A 3CUQC 1OFDA 1V55H 5LFAA 1YTYA 1VFCA 1WMRA 4B8XA 2CW8A 4NHJA 2BPOA 1OYIA 3A35A 2CSOA 2G9WA 3GZ5A 2YUHA 2QBYB 2GJPA 2CG4A 1MJBA 4FCYA 1G8XA 3K70D 3ZBTA 2BSPA 3KYCB 2EBIA 2EV6A 2X85A 4YAUA 2ADUA 2HZDA 5TGTA 4CCNA 2WBMA 1QBJA 1EF4A 1I8DA 2ACJA 4EQQA 4HNUA 4KJZA 3BCFA 4DYCA 2NZMA 4HW0A 3A0HC 1OQYA 3F72A 4HNTA 3L2RA 1O4XA 2P4WA 2R7UA 1WSRA 3QFCA 1OMIA 3CMYA 3LOCA 1FSHA 1KU2A 3W3CA 4OIPF 1T56A 3R4KA 1DDGA 2QYUA 5GV7A 4JOMA 1YRNB 1VF9A 2XSJC 2CS3A 4AM3A 1O8LA 3CCMB 1ONVA 1IXSB 1P2FA 1XDSA 2CV2A 1IRGA 5C1EA 2YR2A 3BTIA 2DI3A 1OCRH 4G5GA 3CW2A 5A88A 2CRVA 4F7ZA 4KUMA 4RGUA 3CCMI 3V4GA 3ZPLA 2ZZGA 2VNJA 5HLGA 4XNFA 3FISA 3S32A 1MW7A 4A12A 1P6RA 4IOCF 3H5RA 1S5LC 2HMAA 2ZCWA 2IGNA 3BJOA 1Y0YA 4F91B 3J80Z 4MHGA 3M4OJ 3BC9A 4B4DA 5KK1A 4BH9A 1XGOA 1VQ5B 1D0XA 2VFPA 4D5FA 4TSFA 5JHFA 2V1UA 2NSTA 2ZJ2A 2STWA 3I4NJ 4B4CA 4A3JJ 1EP3B 3PFIA 3FK6A 3HRSA 3KZYA 2VONA 5JLWA 4U87A 2ELJA 3I54A 4FHTA 1VQ5I 1EFRA 3B82A 1V5FA 2VKVA 2LOOA 2EZLA 2V6EA 2KIQA 2JRMA 3IV5A 2VBZA 4DIQA 4Z4SA 2QX3A 3ONUA 3L1PA 1HA8A 2M5WA 1QJVA 2MYSA 2NT9A 2Z33A 3W2AA 1GDTA 4GRIA 4N0BA 1N08A 2VBMA 2VBXA 4IXAA 1K5CA 4AC9A 3ASSA 1GV5A 5H6QA 3I59A 4JP0A 1FMWA 3FBIB 3LFKA 3ZQIA 4WCGA 2DCUA 1ENHA 3G1OA 4RS8A 3PQKA 4U4BA 4G7HF 1V0FA 3VSTA 5HVQC 5FL7A 1QPMA 1FYKA 2M1BA 2NVUB 3V8JA 4LC0A 2CQ7A 2QVOA 2WAQA 2XZLA 2C4UA 3GBGA 1ZAOA 2KRFA 2M2EA 3W2WA 2WPDA 2PG4A 4HIZA 5B6IA 2OK8A 3VNVA 2GQQA 2DMNA 1QVUA 4F7DA 1IXRC 4A93J 1N0UA 1NH3A 3VOEA 4Q7JB 4LBZA 4A3EJ 2MSYA 1W7PB 2M7BA 2ME0A 4RM3A 1LPQA 2CGPA 2BGCA 3BROA 3WBKA 5IYNA 1OYWA 2IQ7A 4OJOA 1PJ7A 3H9NA 2VIXA 2ZNZA 3BJ6A 1SFXA 3GRHA 5F04A 3E6CC 3W2EA 1GVDA 1KGSA 2K40A 4HAMA 1O8EA 3Q9VA 1OFLA 1STZA 2PMHA 1QA1A 5J3OA 1HKSA 5K5QA 1ETQA 3QRFF 2Y0SA 3W5VA 1EJ9A 1JUSA 4HF0A 3LYCA 2O6WA 1WOSA 5BPIA 4HBLA 1IRFA 1FEXA 2GQFA 3ECHA 3HOXJ 2ZFWA 3OL4A 5DUIA 2W82A 4X6AJ 5HOOA 1RQRA 4P3IA 4Z1MA 4C2TA 4U7BA 1U6GA 3D5SC 3P9IA 4ZDPA 2R9VA 3S1NJ 1VQNB 5J1UA 1A04A 3H3VK 4P9SA 1PE9A 1HCRA 3M8EA 2FBKA 3W6JB 3P4GA 1R71A 1R9TJ 3BC8A 5FLVA 3LO8A 3BH6B 3FM3A 1HKTA 4P2NA 3PFYA 5E6TA 2FXAA 3CESA 2XAGA 1EH7A 3T1BA 3BG3A 4B3XA 3DEUA 1VQNI 5FFZA 1S3JA 1W5CC 3IC7A 1G2HA 4B3AA 4PGOA 4ROXA 1VQMB 1PVEA 4NC6A 4CCKA 4ZCIA 1VQ9B 4A3MJ 3WU2C 5JFRA 3HOSA 4AIKA 1W2BB 3A01A 3FHNA 4Y7CA 4O6JA 5L3CA 1KQSB 1VQMI 3I58A 4XR6A 5E8GA 1VQ9I 3CO6C 1R22A 1TT5B 1ZKGA 4E7LA 4RD2A 1DABA 1PP8F 1N8RD 1HLVA 4MEYF 2B7CA 3QFRA 4KN4X 2O61A 4EGZA 1FIAA 2LYCA 1O7LA 2O0YA 3ECOA 3CZ6A 4BU2A 4CYDA 2EFWA 1JGGA 1CGPA 1E0EA 4A2UA 2DBBA 4TMVA 3Q0UA 3KRGA 5THXA 3CJNA 2VNKA 4HDUA 3M8JA 1OCCH 5FGMA 4HRIA 2V31A 4LITA 2O0WA 2LLKA 1MBKA 3NB2A 5JI6A 1S6LA 2BYVE 5F64A 3WE3A 3X2QH 1IJEA 2OYNA 4OIRF 1E64A 2QENA 1TZLA 3NEUA 2QKLB 4DQ2A 3LAJA 4ZYDA 2KL4A 1E79A 4QPOA 5HXBA 4QIWN 3J81Z 4X1EA 1IAWA 2F2EA 5K1YA 2P5LC 5M3MJ 3ASOH 1LE8B 3PA1A 3BNWA 4G7ZF 1K9MD 2BZTA 1I1SA 3S1MJ 1XE1A 1E1RA 3OYJA 4IHYA 4OU0A 1ETVA 3EYYA 2IGOA 1XMAA 2CQQA 3CCLB 2DTZA 3EUKL 3KEYA 4Z03A 4G12A 4ZV4A 2HOEA 3F0CA
chains in the Genus database with same CATH topology
1OHHA 5HLTA 2UWMA 1JI8A 2HU9A 2JSPA 1LFPA 2KPMA 3OEHA 1T5EA 3GQ8A 1UG0A 2LRDA 4HSRA 4G7XA 2KDOA 1UD5A 2E1MC 5LD2C 2XAUA 2A6TA 1O8FA 4ZTFA 4G7WA 1H8EA 1VBLA 2VJJA 4AU7A 1BMFA 2IGMA 2L9NA 3FPPA 2VQCA 1W0KA 2I8DA 1Z3XA 2BW3B 3FKSA 3ZPNA 1MMDA 3LL7A 1KONA 1Z21A 4Y3OA 4E7SA 4EATA 1ZELA 4DNTB 2HVQA 3G05A 3GVLA 1X4OA 2KRHA 2VJIA 3OEEA 2VJ5A 2CUZA 2Q1ZB 2R7OA 4BDYA 4B43A 4NK6A 3C2GA 3RCOA 1WJEA 1N77A 2GJKA 2LG4A 2W4SA 2E60A 3I3LA 2KP6A 1SKYB 1N78A 2ODLA 3B8YA 1V0EA 4W8SA 1J09A 4I84A 2BOLA 2LH9A 3OMYA 4ZJZA 2JJ1A 3LMMA 4N4NB 2HVRA 4DBRA 2R7VA 4KKTA 1MMAA 3GQ9A 2W00A 2KZVA 4BJ6C 4PJNA 1NG7A 4DBQA 2KVOA 3CP8A 1W9XA 2X1DA 2V1NA 3K10A 1DBOA 3H5AA 4KITB 3QYFA 3OYBA 2WAFA 4G6TB 1OB0A 4XLFA 2UV1A 3BCAA 4HPQA 3MKWB 4XKCA 3DPLC 2GK7A 1NG6A 2Z2SB 2R7RA 3FY3A 1QHHD 3AL0C 1BN8A 3PL8A 4DOZA 1W36D 4IQ4A 3J7AY 2L9SA 2W7NA 3B4NA 2CV0A 1OGOX 2IS1A 1UD6A 3CMMA 3DU6A 4FASD 1IDKA 3DPUA 4IKFA 2R7TA 2VXDA 2F1MA 4XONA 1N75A 4BQOA 4XMYA 2W6IA 4JMQA 4F93B 5HNHA 1E1QA 3TL4X 1V5GA 1PJRA 4F55A 2JVGA 3NWSA 3L2VA 2R4GA 3T51B 1WFXA 1IDJA 3OYKA 4Z05A 5FROA 3VSLA 1ERDA 1NRKA 5CDFA 4W8RA 2X6WA 2K9LA 3K4CA 4YRVA 3OYCA 3A2KA 4P5OA 1W0JA 3A3BA 2BVLA 5CQEA 4DGWB 1FMVA 2CH0A 2VL8A 3MD2A 4B3GA 1O8DA 3UW0A 2V7QA 2E5NA 4NK8A 3VSVA 3RPUD 2RQQA 2KRCA 2V26A 2WADA 3EUHC 3ZCOA 2XNDA 3OAAA 3VMVA 1D0ZA 3OYHA 2ZSHB 1X4PA 2LBFA 3IAM2 3W2VA 2E5ZA 4CH7A 2W1OA 1O8GA 1UD2A 2VB6A 1VJSA 4BE1A 3OFNA 1BPLA 3HPGA 2LREA 4II2A 2INVA 2WB1A 1YE9A 3BH4A 3HAGA 1OGMX 1WJBA 1DP3A 2R7SA 2X8KA 2KQRA 4ITVA 2IS6A 2O1DA 3QODA 1UD4A 4KISA 3VSUA 2WAEA 3ONQA 3JURA 3OIPA 3VSKA 2L2OA 4DJAA 3OYGA 3L2QA 1E3ZA 3ZIAA 1LDKB 5KNLA 2CV1A 4KKSA 1KZLA 3VWBA 3A3GA 2XOKA 3OYIA 1DBGA 4YZQA 3HC7A 3OPOA 2VQHA 3ZQQA 3SDBA 3OR1C 3DTIA 3VSTA 2VXZA 5FRMA 3VYRB 1WP6A 2NSPA 1UELB 2MFZA 3ZPPA 2HNHA 2F5VA 4HSTA 4XOTA 1MNDA 4X0GA 3NWTA 3BG7A 4B48A 3DWLE 3WQZA 1KTWA 4F3QA 4J00A 2PJRA 4E7JA 1DQUA 4XKBA 2ZXHA 2XF5A 2VQLA 4CCLA 3OOCA 1PLUA 4C30A 2M4GA 4LIVA 4BE0A 1NBMA 2NTPA 3DKXA 4YELA 2UUZA 4W8QA 2X1CA 3OL3A 2JVHA 5CQGA 1WJDA 1RU4A 3VYUB 3BG6A 3CJRB 4NC7A 4CA0A 3H94A 1D1CA 3OS1A 4BDZA 1EE6A 1HG8A 1O8MA 4ZC3A 1RMGA 4LG3A 2XDVA 2MD0A 3HL2A 4YEJA 3D5RC 3EPZA 3OWTA 1XG2A 3SUCA 1HZEA 3DEEA 3S3NA 3EUAA 2L5QA 5KCMA 3QYBA 3DDYA 4HWVA 1PXZA 2QY1A 1S9HA 3ZGKA 4G6IA 4B3FX 1X19A 3M1CA 4QPQA 1X1CA 1R6RA 1Y6IA 4NQWB 5HNFA 3H5NA 3HUGB 2XZOA 4CCOA 1I18A 2PECA 5AMVA 4NC8A 4ASUA 4BUPA 1D0YA 3S3OA 3CF2A 4XORA 2LBFB 4ZTJA 2AQEA 1T95A 3GQBA 2VBEA 2PMZA 2Z8GA 2E1MB 2IS2A 4RLFA 3K4NA 3H9QA 2DT7B 1SAUA 4URRA 4LIUA 1Z7LA 1RWRA 3SEZA 3OR2C 2GOMA 4F92B 2XF6A 2WJYA 2V7FA 4TKOB 3K4KA 4OZZA 4Y33A 3IP4B 3VYSB 4CUGA 1FX0A 4BE2A 4XLAA 4BACA 2R7XA 2JJ2A 3WWGA 3OE7A 4C9YA 2DIEA 1IB4A 3OIQA 1E43A 2ZZEA 1PYVA 3UR3C 4RMNA 1LKXA 1JRGA 1IA5A 2DXIA 4BJ5C 3U21A 3S3MA 4PUSA 4OJLA 4XN3A 2VKHA 4KT6A 4RLQA 2CMPA 4E0FA 2PYGA 2CW7A 1G59A 1K6YA 2NT6A 1X1DA 3PUBA 3OOUA 2JA2A 3MMYB 3GQ7A 4Z06A 2DCEA 2MABA 3DKYA 3KEWA 2ZXIA 2M0MA 3H9JA 3OYLA 2JDIA 2M3AA 3OYDA 2PJRB 4XL9A 2AQFA 4P1WA 3AL0B 1DGRM 2XF7A 2HQAA 3ZXSA 3OYNA 4XKWA 1BR1A 3VR6A 1BLIA 3BCBA 3A1YA 2V9KA 2HLDA 1W36C 1BHEA 1QCXA 2R7WA 1YX3A 5HKKA 2DJIA 2R7QA 3T9GA 2Z16A 4OWRB 3OY9A 2V4JC 3EQOA 4IZZA 4XD7A 4P22A 4R79A 4PJJA 3LNNA 2FUG2 4YZAA 1O8JA 3N05A 1BR2A 4ZDOA 2PYHA 2BW3A 2IXSA 2CFOA 4MLOA 3VDXA 2Z1DA 3LFUA 4CCMA 1UD3A 2VJ4A 3B90A 3G2BA 4U49A 3ZRGA 1AA7A 3CJQB 2UVEA 1O8KA 2X6XA 1WJCA 2K5CA 3LMWA 1KCDA 5FRNA 2NOJB 2VKDA 3K4BA 4Y4RA 2Z6BD 3UNGC 4BXFA 1VZ0A 1MMGA 4CCJA 3QOEA 1DGWY 3PJRA 3H9GA 2V4DA 2NTBA 2HPMA 4MR0A 2GOXB 4AVZA 2VQGA 3AFHA 1WTHD 4PSWA 3RQ4A 5LFAA 4YZXA 1WMRA 3EQNA 2CW8A 3HOTA 4FETA 3A35A 1IRXA 2GJPA 4HEA2 1G8XA 3K70D 2VPLA 2ZZQA 2BSPA 4BQQA 4J01A 3SEQA 1O8HA 2GK6A 1E3XA 4E7ZA 4E7HA 2HDWA 1VF7A 4H4KC 2X85A 3V42A 2HZDA 5TGTA 4CCNA 2RNGA 2WBMA 1I8DA 4HNUA 3MKZA 4KJZA 3BCFA 2W6JA 4TT3A 4HNTA 3L2RA 2NZMA 1NHCA 2R7UA 2M4KA 1KMHA 3KEYA 3SZGA 1UD8A 3W3CA 3PNTA 3OYAA 4II3A 1V5EA 4PFOA 4JOMA 1GLNA 2OC6A 4E6KG 5C1CA 2XSJC 2CS3A 4NUBA 1O8LA 3QYEA 3HPHA 1BR4A 4XLEA 5KHDA 3RTRA 5CKTA 4BQNA 3S8PA 2CV2A 5C1EA 3S93A 2K3PA 3D5LA 3LSIA 4HG2A 1P9QC 3HG9A 1CZFA 3GVKA 2OV7A 4ANJA 3ZSCA 3SYTA 2RREA 2X1EA 4F52A 2ZZGA 2KLOA 4AYBA 3BLYA 4XNFA 3GQAA 3NE5B 1H80A 2VLAA 4N4OB 2X53S 4GQNA 1EA3A 1MW7A 2OUMA 4XN0A 3S32A 4B44A 3H5RA 2LZJA 4OJ6A 4L8JA 2IGNA 2GJRA 2WJVA 3OW7A 4F91B 4EW9A 3T56B 3K4LA 3OS2A 3BC9A 1QHGA 4MXNA 1TT0A 3JU4A 1D0XA 1VLYA 5JHFA 4TSFA 2JUGA 3MKYB 3FDYA 2NSTA 2VBKA 4D9JA 4CZCA 4DNRB 1OLTA 4C2UA 3TMOA 4U87A 2ELJA 1EFRA 4E7IA 1V5FA 2LOOA 2V6EA 2QX3A 4DIQA 4PFPA 2WA0A 4D1QA 1X1BA 2XGJA 2K9MA 1JTAA 2CK3A 1HA8A 1QJVA 2MYSA 2NT9A 3KYLA 3OS0A 3DTKA 3W2AA 4GRIA 2VBMA 1UAAA 4ZDLA 3OYEA 1Z3YA 1K5CA 3BCDA 2ZFUA 1OOCA 2VASA 2WY8Q 3GVJA 3TBIA 3FBIB 1FMWA 1X1AA 2LY2A 1SFKA 4XLCA 4U4BA 1V0FA 5HVQC 2D3NA 2JIZA 5FL7A 2LY1A 3FKJA 2EWEA 3LSKA 4IX7A 2XZLA 2WAQA 4BGDA 3PNYA 2IGKA 3GBGA 1HVXA 2WPDA 5DN6A 3W2WA 3PNVA 2F6CA 4HIZA 3H35A 4PJLA 3RSNA 4PMHA 3E1SA 1OFMA 4BEHA 2ZTNA 2ZSIB 1WPCA 1WJFA 4ZYAA 1KCCA 2INUA 2F4IA 2DOAA 4BJTA 2XC7A 2M7BA 1D1AA 1YX5A 4RM3A 4OJOA 2IQ7A 3L2WA 4OJPA 3CP2A 3K4JA 5CPRB 2VIXA 4CSWA 2QKMB 3GRHA 4XM3A 3OYMA 4E7KA 2IS4A 2BVMA 1D1BA 2X6YA 1O8EA 1X0CA 1OFLA 3VMWA 4KKUA 2MC4A 4XQFA 2X51A 3AKZA 2O5RA 1U0JA 2Y0SA 2NTQA 2O04A 1COWA 2LC2A 3HXLA 4DK1A 4UZUA 3F9KA 2KMUA 2HVSA 3OYFA 3OL4A 1Y56A 2WZPP 2W82A 4OZYA 5HOOA 1MNEA 4Z1MA 4C2TA 2M5SA 3DLAA 3D5SC 4U7BA 2ZZFA 1O8IA 3HKZA 4XOPA 4ZDPA 2R9VA 2WY7Q 2WSSA 2O0VA 1PE9A 2O17A 3DQVC 3IUOA 3C2HA 3DPTA 1MMNA 3BC8A 4E4HA 4JQFA 3PFYA 3VYTB 3CESA 4B3XA 3A4CA 4W8TA 3K6GA 4CCKA 2QXZA 3FBNB 1WJ5A 3HOSA 4BL0B 5IK2A 3FHNA 1WJAA 3K4MA 4XR6A 3IAS2 2HPIA 3LSHA 4E7LA 3I9V2 2M7AA 2KHMA 3LSMA 2A5WA 1K28D 4OJ5A 2LYCA 2XZPA 4BU2A 4DK0A 3CZ6A 3KX2A 4BS9A 1E0EA 3ZR8X 1BOBA 2E1BA 4PJMA 1T0FC 4OAYA 4IQJA 3KRGA 3L2UA 3M8JA 4HRIA 2V31A 4LITA 2O0WA 2X3HA 4OAZA 2CUJA 4PSXA 2F43A 1O88A 1QU3A 1TZLA 2QKLB 3PSFA 1GQ8A 3E0JB 2KL4A 1E79A 1H8HA 3K70C 4BEHB 4QPOA 3T53B 1LVKA 1AIRA 3H0DA 3PSIA 4C2LA 4XLHA 4YZ0A 1PKVA 2UVFA 2QE7A 4FXUA 3LSGA 4YXWA 2Q2EB 4RM2A 1E1RA 3OYJA 2D3LA 3DU5A 1OR7C 2P0WA 4NNJA 2L7KA 4XKVA 4B47A 2ZTGA 2IGOA 3DTEA 4PK4A 1MABA 3EUKL 2DT6A 4Z03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9G A;  3EQO A;  3VST A;  2NSP A;  3GQ8 A;  3ZPP A;  4PMH A;  1OFM A;  4YZA A;  4XOT A;  1O8F A;  1O8J A;  2PYH A;  1VBL A;  2VJJ A;  1KTW A;  3B90 A;  2INU A;  1KCC A;  4U49 A;  2UVE A;  1O8K A;  2X6X A;  3LMW A;  1KCD A;  4OJO A;  2IQ7 A;  4OJP A;  2VJI A;  1PLU A;  4NK6 A;  2NTB A;  3GRH A;  4XM3 A;  4MR0 A;  2NTP A;  2X6Y A;  1O8E A;  4AVZ A;  1X0C A;  4YEL A;  1OFL A;  2ODL A;  3B8Y A;  3VMW A;  4XQF A;  4W8Q A;  4W8S A;  4I84 A;  1WMR A;  3EQN A;  4YZX A;  1RU4 A;  2NTQ A;  2O04 A;  1EE6 A;  1HG8 A;  1O8M A;  1RMG A;  3GQ9 A;  4YEJ A;  2BSP A;  1O8H A;  1XG2 A;  3SUC A;  4OZY A;  1DBO A;  2X85 A;  4HWV A;  1O8I A;  4XLF A;  1PXZ A;  4XOP A;  2QY1 A;  2NZM A;  1NHC A;  2O0V A;  1PE9 A;  3FY3 A;  2O17 A;  1BN8 A;  5AMV A;  2PEC A;  3B4N A;  5C1C A;  1OGO X;  4W8T A;  1O8L A;  4XLE A;  4XOR A;  1IDK A;  5C1E A;  2QXZ A;  2VBE A;  2Z8G A;  4XON A;  4XMY A;  1CZF A;  4URR A;  3ZSC A;  4XR6 A;  1RWR A;  4XNF A;  1IDJ A;  4Z05 A;  3GQA A;  1H80 A;  4W8R A;  4XN0 A;  2X6W A;  4OZZ A;  4OJ5 A;  4OJ6 A;  4EW9 A;  3UW0 A;  1O8D A;  4XLA A;  4NK8 A;  3WWG A;  3KRG A;  4MXN A;  3VSV A;  3VMV A;  1IB4 A;  2O0W A;  2NST A;  2VBK A;  2X3H A;  1JRG A;  1IA5 A;  1O88 A;  1O8G A;  4OJL A;  2INV A;  4XN3 A;  1GQ8 A;  2QX3 A;  2PYG A;  1OGM X;  1AIR A;  2NT6 A;  4C2L A;  1JTA A;  4XLH A;  1QJV A;  3GQ7 A;  2NT9 A;  2O1D A;  4Z06 A;  4YZ0 A;  2VBM A;  2UVF A;  3VSU A;  1K5C A;  3JUR A;  4XL9 A;  1OOC A;  4Z03 A;  4XKW A;  4XKV A;  4XLC A;  1BHE A;  1QCX A;  4U4B A;  2EWE A;  1DBG A;  4YZQ A; 
#chains in the Genus database with same CATH topology
 4RAY A;  3HEF A;  1OHH A;  2UWM A;  2HU9 A;  2CRG A;  2KPM A;  3KPH A;  2CW0 F;  1JKR C;  3WGH A;  3V7A A;  4OMZ A;  1UG0 A;  2LRD A;  1MDM B;  4DYQ A;  3CCL I;  1UD5 A;  5M5Y J;  2E1M C;  5LD2 C;  5AN9 A;  2A6T A;  4YFO A;  3BZ6 A;  4YDT A;  2M8E A;  2Y31 A;  4AU7 A;  1DUX C;  2RDP A;  2IGM A;  3MZH A;  2VQC A;  1BW5 A;  3ZPN A;  4FE7 A;  1KON A;  4EAT A;  1ZEL A;  2KRH A;  3M07 A;  1HC8 A;  3OEE A;  4BYY A;  2MH2 A;  2R7O A;  4B43 A;  4XLN F;  1K4Z A;  1PUF A;  4LG0 B;  4FX4 A;  3ONY A;  3Q3A A;  4CHU A;  3LQ6 A;  1V0E A;  1R4N B;  1FRQ A;  1BM9 A;  1G3Y A;  5B1B H;  3OMY A;  4ZJZ A;  2CQK A;  4DBR A;  4RD6 A;  1MMA A;  2W00 A;  2MH9 A;  2B9S A;  1TQI A;  3E6M A;  4DBQ A;  2C2W A;  4OPO A;  1QRB A;  3CP8 A;  5F0H A;  5E20 A;  4UY8 I;  1LEA A;  2V1N A;  3JX8 A;  3O3K A;  2HXI A;  2KJB A;  1USS A;  3QYF A;  2WAF A;  5IP6 A;  4XLF A;  2UV1 A;  3BCA A;  4HPQ A;  4ZH4 F;  3MKW B;  2PIA A;  2BHY A;  2MG4 A;  2Z2S B;  3VOD A;  1GAW A;  1BN8 A;  1SFE A;  2OZ6 A;  3F23 A;  4RJL A;  1OIS A;  1ORK A;  1WU8 A;  2L9S A;  3ZMV A;  1T2K A;  1LLW A;  2CV0 A;  4XLP F;  1NJI D;  2BE5 F;  2QMU A;  1XC5 A;  3CMM A;  3DU6 A;  2QGG A;  1AIP A;  2JMW A;  5CLS A;  2CUF A;  3O8G A;  4F93 B;  1U9N A;  4HZF A;  2HDD A;  3GLL A;  5DS9 A;  2DA3 A;  1I6H J;  1UMK A;  2EFQ A;  1PJR A;  2V9V A;  4F55 A;  2JVG A;  3NWS A;  5HLI A;  2R4G A;  5LHG A;  1WFX A;  3N4M A;  2KIM A;  3T51 B;  3VSL A;  5A89 A;  1ERD A;  3HTU A;  2BBY A;  2DER A;  3MEX A;  3S17 J;  4CQJ A;  1SEU A;  4P5O A;  4QVA A;  1HDP A;  5A8A A;  2CH0 A;  1D8K A;  3WTZ A;  3OKX A;  2JK3 A;  4O3M A;  5L3D A;  1O8D A;  1TP4 A;  2PJP A;  5C4X J;  2VOD A;  2QF7 A;  4ZZL A;  4LD5 A;  1RIO H;  4GYG A;  1D0Z A;  3OYH A;  3IAM 2;  5IYW A;  1EH8 A;  1O8G A;  4IW3 B;  4BE1 A;  4XIC A;  1XCB A;  1YJ9 I;  1Q81 D;  3GO5 A;  3CJT B;  3E5U A;  1BQE A;  2OU2 A;  3GTG J;  4DZJ A;  1U5T A;  1YE9 A;  5J47 A;  2F48 A;  2R7S A;  3BZC A;  5L3B A;  1Y0U A;  2LTP A;  2IS6 A;  3F6V A;  5H2F C;  1FRN A;  2HDC A;  1KRH A;  2G0Y A;  1UD4 A;  4CGZ A;  5HS7 A;  4KIS A;  1IDZ A;  5J1R A;  2WAE A;  2HDN B;  4GYI A;  4M3F A;  3BQY A;  3OIP A;  3PUN A;  2W25 A;  2G7U A;  2H6B A;  1WOP A;  4ACB A;  5HOD A;  1E3Z A;  2NVX J;  3HOZ J;  3ZIA A;  4D7N A;  2CV1 A;  5J4Y A;  3VWB A;  2A6E F;  3OYI A;  1XGM A;  3CUQ B;  1KYW A;  5LGN A;  2PFB A;  3OR1 C;  4V19 K;  1QRC A;  5LGU A;  1NK2 P;  2NSP A;  3ZPP A;  4G9Y A;  2HNH A;  2F5V A;  4HST A;  3WY9 A;  2PE3 A;  2Q6O A;  3WQZ A;  2RC6 A;  1Z7U A;  4KIG A;  3HSR A;  5DTD A;  1J7K A;  1GT0 C;  2A3S A;  3BR5 A;  1I27 A;  2P3M A;  3ZQL A;  2XF5 A;  2VQL A;  3JRG A;  2OD5 A;  2A68 F;  4OIN F;  4IHS A;  2DU9 A;  4TMX A;  5IT9 K;  2M45 A;  3O8H A;  2M4G A;  5DM7 F;  1IN6 A;  1Z9C A;  3QAH A;  4LIV A;  4CYC B;  4BE0 A;  1PJ5 A;  1Z05 A;  4UVA A;  3ZMZ A;  4KA4 A;  2UUZ A;  4AYB N;  1RR7 A;  4W8Q A;  1SAX A;  2JVH A;  2EV5 A;  3TW6 A;  1T38 A;  4NC7 A;  1MBG A;  1VQK B;  1EE6 A;  1HG8 A;  2E1R A;  1O8M A;  3AG1 H;  2H1L A;  4LG3 A;  1P4X A;  1KQ9 A;  3MZY A;  5TIS C;  3JQQ A;  3QFT A;  1RMG A;  2HCJ B;  2P81 A;  1ZUN B;  4RB3 C;  1VQK I;  3JRD A;  1D3Y A;  2COB A;  5GPA A;  4XSX F;  4QUZ A;  2OJE D;  2XSD C;  1T33 A;  1PXZ A;  2LVS A;  1X19 A;  5HNF A;  1WQ2 A;  4HLX A;  2R92 J;  4X7E A;  3H5N A;  4CCO A;  1I18 A;  3IKV A;  3ASQ A;  4RPD A;  2QA4 B;  1D0Y A;  3S3O A;  3R6K A;  2BM0 A;  4LFU A;  3MHP A;  2AQE A;  1T95 A;  2GZW A;  2QBY A;  1QX4 A;  1VQ6 B;  1Q9S A;  3GQB A;  4M73 A;  9ANT A;  2DA4 A;  2QA4 I;  1WDT A;  1SAU A;  2V7T A;  4LBV A;  3CUO A;  1JHF A;  4AIJ A;  5E1Z B;  2LKS A;  3WGG A;  1T8I A;  1J9I A;  2OBT A;  1BI0 A;  3K4K A;  4PAA A;  2QDX A;  1K4S A;  4HYE A;  1ZRD A;  1XGS A;  1IDY A;  1UZC A;  1IN8 A;  1YLF A;  1T0F A;  3FXQ A;  2EZH A;  2Y0M A;  2YS9 A;  4DNC A;  1YRN A;  2EWN A;  2FVG A;  3U6K A;  1LKX A;  3S1Q J;  1BJK A;  3M9A A;  1JRG A;  1WCM J;  2DXI A;  1QVF B;  3S3M A;  1AOY A;  2P5K A;  3FXU A;  4PUS A;  3BTC A;  3GTJ J;  1W5T A;  3HIF A;  3R60 A;  1R4M B;  4KT6 A;  4RLQ A;  1OJL A;  2CMP A;  3ASN H;  2FD5 A;  2PYG A;  4JRA C;  3ESW B;  2NT6 A;  2E2J J;  1ZM9 A;  2JA2 A;  4W97 A;  3DKY A;  3BY1 A;  1XG1 A;  2J5O A;  3WYA A;  1VQ8 B;  3QU6 A;  2JDI A;  2OBP A;  2WWY A;  3HM5 A;  4ASN A;  2M3A A;  5DM6 F;  4XL9 A;  4ZCM A;  4P1W A;  5JBQ A;  4CO8 A;  3CMA B;  2QZ8 A;  4ZYH A;  3ZXS A;  3FZV A;  4L9N A;  3BCB A;  2OCE A;  1FSE A;  1VQ8 I;  3JTG A;  2VE9 A;  2E34 A;  3DP7 A;  1YX3 A;  1K73 D;  2DJI A;  3LSJ A;  1SFO J;  3CCY A;  3CCV I;  1WRJ A;  3T9G A;  3CMA I;  4YFK F;  1J9Z A;  1W87 A;  3SQN A;  3TOA A;  4P22 A;  5LRS A;  1KK0 A;  3TW7 A;  1I7P A;  4OOS A;  3LNN A;  3A0B C;  3WNB A;  4YZA A;  2UXN A;  4Y17 A;  2BN4 A;  1O8J A;  1U9O A;  2BW3 A;  2IXS A;  2CFO A;  2FMY A;  3VDX A;  1T39 A;  3CQZ J;  5FKK A;  1WZ2 A;  1AA7 A;  3LMW A;  3TOB A;  5FRN A;  2NOJ B;  3IHU A;  2HTS A;  2PQ8 A;  5IT3 A;  5D5X B;  3N97 A;  2BX6 A;  1VZ0 A;  2R0Q C;  2WB1 N;  3QOE A;  2V4D A;  2NTB A;  2E2H J;  1TC3 C;  5J8F A;  1O7F A;  2VT3 A;  3RQ4 A;  4YZX A;  3G4S B;  3I55 B;  3EQN A;  1QGZ A;  5E3L A;  5JLV C;  3BG5 A;  1IRX A;  1DG1 G;  2RGV A;  4N9I A;  1NDH A;  3G4S I;  4BQQ A;  3I55 I;  4J01 A;  3P26 A;  3SEQ A;  1JGS A;  2GK6 A;  1E3X A;  4YAL A;  1O8H A;  4E7H A;  1W7P A;  1JHH A;  5IP7 J;  1IJW C;  1R5O A;  3V42 A;  3H36 A;  1R5B A;  3HZJ A;  1YS7 A;  4LOC A;  2I1L A;  1JKP C;  4TT3 A;  2WR8 A;  3IH2 A;  1E3H A;  5FLM J;  4QV2 A;  3SZG A;  4HQE A;  5F1J A;  1QVG B;  1UD8 A;  3FXL A;  1G7R A;  4II3 A;  4PFO A;  4P3Y A;  1GLN A;  2OC6 A;  4RM0 A;  2DQR A;  3QWL A;  2VNI A;  2C6Y A;  3QYE A;  1KZH A;  1BR4 A;  4QVJ A;  4RPB A;  5EF6 A;  3IH3 A;  3RZD J;  3S93 A;  3CRZ A;  3LSI A;  3QPH A;  5BQT A;  1SKQ A;  3BH7 B;  3CME I;  3Q3S A;  4OPW A;  3RI4 A;  2VKE A;  3GVK A;  2VC1 A;  2FA5 A;  1B4A A;  1X2M A;  1MH3 A;  2KLO A;  4AYB A;  2H8R A;  1ZM2 A;  1EH6 A;  2RC4 A;  4LB6 B;  5K7H A;  1MRZ A;  5J4V A;  2JUC A;  4N4O B;  1A6I A;  4GQN A;  3ZUG A;  2XT4 A;  3BY2 A;  3PO3 J;  2LZJ A;  1Y39 A;  4L8J A;  2GJR A;  2WJV A;  4EW9 A;  3T56 B;  1VQP B;  1B1B A;  2GIV A;  4MTD A;  1QA6 A;  1ACI A;  1WSV A;  2F5D A;  2JN9 A;  4I0B A;  4MXN A;  5B66 C;  1IG7 A;  1VLY A;  3RKW A;  2JUG A;  1NTC A;  3FDY A;  3MKY B;  1BI3 A;  1HW5 A;  3K0L A;  4D9J A;  1ZGJ A;  1QZE A;  1G7S A;  4DNR B;  1VQP I;  1RZ4 A;  4U0W A;  4UVB A;  4E7I A;  1ZLK A;  2QLZ A;  2DT5 A;  2AO9 A;  3GX4 X;  1BL0 A;  1X1B A;  3QPS A;  2BHZ A;  2K9M A;  1HST A;  3ZZ0 A;  1W0U A;  3FIW A;  3KYL A;  4EH1 A;  1XCV A;  1H8A C;  3B8H A;  4ZDL A;  1YJN B;  2AS5 F;  4N3G A;  1Z3Y A;  2IEK A;  2FF4 A;  2XB0 X;  2VAS A;  1XN7 A;  4MNU A;  4KNY A;  3GVJ A;  3KP7 A;  2LD5 A;  3TBI A;  4XLC A;  1YJN I;  1UFM A;  4I6Z A;  3OJX A;  3NRV A;  3ZBU A;  5HZB A;  3W6K B;  3LSK A;  4U7D A;  4BGD A;  5J3L A;  2KIU A;  3GZN B;  2K9N A;  3H35 A;  4PJL A;  4LLN A;  4PMH A;  2ZSI B;  3CD6 B;  3HOY J;  3TDU C;  1WPC A;  1K8A D;  2XV4 S;  2EFO A;  4RAF A;  4HQM A;  3NAU A;  2JPC A;  3IRR A;  5IT9 Z;  1LE8 A;  1I3Q J;  3P7N A;  1D1A A;  2DK5 A;  3CCU I;  2EB7 A;  1HA3 A;  3L2W A;  3CD6 I;  5H5J A;  4OJP A;  1Y0N A;  3CP2 A;  4HA8 A;  3K4J A;  5CPR B;  5D4R A;  4CSW A;  2LF8 A;  2QKM B;  4UUS B;  3GTO J;  2QSF X;  4E7K A;  1O3S A;  2IS4 A;  2BGI A;  5F4J A;  5D8L B;  3FKI J;  2L54 A;  1X0C A;  2E19 A;  3NQO A;  2X51 A;  1U8R A;  5DV5 A;  3WTV C;  1TL8 A;  1NK3 P;  4UNO A;  1MDM A;  4AF6 A;  1COW A;  3HXL A;  2F4N A;  3CCQ I;  2ICW G;  3L09 A;  5AIP A;  3BR3 A;  3F9K A;  3CC7 B;  2HVS A;  4KFC A;  3CCE B;  4OZY A;  2GA2 A;  5D8K B;  3KLO A;  2ZZF A;  1O8I A;  2EZI A;  3CC7 I;  3SJZ A;  1FOW A;  3CCE I;  2WSS A;  1F4K A;  4LG0 A;  1ZG5 A;  2A05 A;  2VE8 A;  2KIS A;  2K9S A;  5F0C A;  1V3F A;  2FNA A;  5DD4 A;  1VHO A;  1WXR A;  2XVC A;  5IYP A;  4PGG A;  3TGN A;  2FEZ A;  3VMF A;  3A4C A;  5FKN A;  3LSP A;  2XTX A;  5BOX A;  3BPV A;  4OIO F;  3K6G A;  1V54 H;  2HKX A;  4YG2 F;  4KMF A;  2QXZ A;  2FX0 A;  1B8I B;  4BL0 B;  3CXC B;  3EYI A;  4I2O A;  5IK2 A;  2RNJ A;  3V7R A;  4HX7 A;  2E1O A;  1GR1 A;  1WJA A;  2KFD A;  1QGA A;  2N8G A;  3K4M A;  2VBV A;  2XTY A;  2ESH A;  4MIM A;  3I9V 2;  4HV6 A;  2OAZ A;  2KHM A;  4XRS A;  2M30 A;  1TUI A;  4A3C J;  1PP7 U;  2I10 A;  4BBR J;  3HOW J;  2QEX I;  3KX2 A;  3I4P A;  3K1N A;  1BOB A;  3KP3 A;  5J1Y A;  1PJ6 A;  4OAY A;  4IQJ A;  2VBS A;  3L2U A;  3QPT A;  4Z2Y A;  2VBW A;  4C2M J;  5EDN A;  4CIC A;  3WTY C;  1MKM A;  1UST A;  2BM1 A;  4UAJ A;  2CUJ A;  2GWR A;  1T6Z A;  2F43 A;  3JW4 A;  1APL C;  5HDK A;  1LEB A;  1O88 A;  5F6F A;  1RR8 C;  1QUF A;  1K8F A;  4XRM A;  3G1M A;  4NBS A;  5FKO A;  1YW7 A;  5AIQ A;  3JAM K;  1H8H A;  3K70 C;  4BEH B;  1LQ1 A;  1LVK A;  1OCT C;  3PSI A;  1JB9 A;  2NYX A;  3V8K A;  4C2L A;  2V6C A;  2DA5 A;  3Q5F A;  1PDN C;  1ZM4 A;  3BJA A;  4L5J A;  1EP1 B;  2VFN A;  2BSA A;  3GUD A;  2DJN A;  3FHZ A;  3ZQF A;  3E5X A;  2KDZ A;  1J5Y A;  1ZG1 A;  3E6D A;  4TMW A;  2D9R A;  4G1B A;  2LKP A;  1FY7 A;  2R3S A;  1OR7 C;  4BBS J;  4NNJ A;  5AON A;  2J8K A;  3T5X A;  2A6H F;  2OQR A;  4IRG A;  3TQN A;  4OIQ F;  1MAB A;  3COA C;  2EA4 A;  3BR2 A;  4BNC A;  2P5V A;  3ZQG A;  2C5H A;  1LJ9 A;  1XMX A;  3BG9 A;  5K5O A;  1A36 A;  1LFP A;  5ICC A;  5KSW B;  2PMD A;  2VBU A;  3GQ8 A;  1MMS A;  3EDP A;  3AG2 H;  4HSR A;  2KDO A;  4A69 C;  4V2F A;  5D4S A;  5H6R A;  1GXP A;  2XAU A;  2DOF A;  4G7X A;  4FIS A;  4ZTF A;  1O8F A;  1VBL A;  3Q0W A;  4FE4 A;  4CDG A;  2LFB A;  2K7L A;  1BMF A;  2L9N A;  1S72 I;  1Z3X A;  2BW3 B;  5BPD A;  1JXS A;  1RKW A;  3R0J A;  3FKS A;  1MMD A;  3TP3 A;  5HZA A;  4E7S A;  4Y3O A;  1VQ4 I;  2B63 J;  2VFM A;  2CUZ A;  3M7G A;  1L0O C;  3MAJ A;  1T98 A;  1ETW A;  4L9J A;  1R36 A;  1OKR A;  4M3E A;  3JTH A;  1N77 A;  2GJK A;  2BM7 A;  2P6S A;  2LG4 A;  2QQB A;  3CUQ A;  3I3L A;  3J7A O;  2KP6 A;  1JUP A;  2DOE A;  1N78 A;  4W8S A;  1J09 A;  2IOU G;  2AHQ A;  1CLW A;  1F20 A;  3LMM A;  5FFX A;  2R7V A;  1E3O C;  3ES9 A;  4ZYE A;  4BJ6 C;  1Y1W J;  2VUM J;  4IEJ A;  1NG7 A;  1KYZ A;  3RZO J;  2KVO A;  3JRH A;  3RKQ A;  2X6O A;  3D0S A;  2X1D A;  3K10 A;  1DBO A;  3DV8 A;  4EJT A;  2XGD A;  4KIT B;  4Y13 A;  4UZE A;  1JE8 A;  2MC3 A;  4XKC A;  2VZL A;  4YII A;  5EEA A;  3I56 I;  1U78 A;  4L0Z B;  2F3L A;  2GK7 A;  1NG6 A;  1EKE A;  1S29 A;  4CYC A;  4X05 A;  2E35 A;  5DS0 A;  4AID A;  2EZK A;  3ZMU A;  2BEO A;  3LA2 A;  5J35 A;  1OGO X;  2E7X A;  3WHB A;  5IYD J;  1IDK A;  4P12 A;  2JA7 J;  3F6O A;  3DPU A;  1OB2 A;  3JR9 A;  2DFI A;  5A2Q K;  1ZTR A;  4ETS A;  2W6I A;  4AUX A;  2ZME C;  3A03 A;  1E1Q A;  5IPA A;  1S0U A;  4R8H A;  1TWH J;  2DFE A;  3CB4 A;  4WZK A;  3L2V A;  1FJL A;  1IDJ A;  4L9V A;  2K85 A;  4WWC A;  1NRK A;  4Z4V A;  3K4C A;  2BM5 A;  2L7F P;  3A2K A;  3W5U A;  1HF2 A;  1OR7 A;  2BVL A;  2DMP A;  3F8N A;  3CF5 F;  1UHM A;  1F60 A;  3MD2 A;  3TDZ C;  2E5N A;  1MSE C;  1EFT A;  2BY1 A;  3BWG A;  2KRC A;  5JR3 A;  3ZCO A;  2XND A;  2I5U A;  3VMV A;  3HRU A;  3Q6R A;  2Z3Y A;  1WI9 A;  1X4P A;  3KEO A;  4ZGN B;  4LMY A;  3NAR A;  5FD5 A;  3A8J A;  2NNN A;  2W1O A;  1UD2 A;  6PAX A;  1BPL A;  4WQM A;  1UMQ A;  2LRE A;  2K27 A;  5LMZ A;  2QGU A;  1I50 J;  5ED4 A;  1HBX G;  1FDR A;  1Q86 D;  1OGM X;  2V1X A;  2BV3 A;  1J2X A;  2OTL I;  1ODD A;  3DBR B;  4EEF G;  1DP3 A;  4LLG F;  2X8K A;  4RB0 A;  1NB9 A;  3H92 A;  3PSS A;  3U6B A;  3MCA A;  1U2W A;  2CU7 A;  2EK5 A;  3DKW A;  1WKM A;  3JUR A;  4OPS A;  1QH0 A;  3R6J A;  5IYB J;  2K4B A;  2V9P A;  3DBL B;  3VSK A;  4LK0 F;  3OYG A;  5E1W A;  3L2Q A;  1IV6 A;  4JK1 X;  4KKS A;  5E3O A;  3E20 A;  3BQZ A;  2JQ7 A;  1R00 A;  3GTK J;  3OPO A;  1SVL A;  2A61 A;  2VQH A;  4TV7 A;  4KN7 X;  4UZF A;  3SLN A;  1TTT A;  3RQI A;  5DCM B;  5EG0 B;  2VXZ A;  4S05 A;  1CF7 B;  5C44 J;  5FRM A;  1UEL B;  2MFZ A;  1A5J A;  4R71 A;  4YEI A;  1FT9 A;  2VFO A;  1C0W A;  1MZB A;  5DUK A;  2FX3 A;  3KET A;  1CNE A;  4RA2 A;  2HXO A;  4HX4 A;  3JSP A;  4IHX A;  3E97 A;  1B9N A;  4ENK A;  2DQL A;  3OZW A;  3HSE A;  1G7T A;  1PLU A;  1DDI A;  3GVA A;  4C30 A;  2JPB A;  2NVY J;  4BXX J;  3GFM A;  5M5W J;  3ML3 A;  2WV0 A;  3DKX A;  4EJO A;  3OW2 B;  3AVU A;  2DFF A;  1OB5 A;  2X1C A;  4PC3 A;  4FT8 A;  1S7E A;  3N90 A;  3VYU B;  4P96 A;  1I3A A;  5E18 F;  4ESJ A;  4CA0 A;  3PUF A;  3L00 A;  2EIX A;  5DSZ A;  2EPF A;  2JN6 A;  2DN0 A;  4YEJ A;  4A5N A;  3TO7 A;  4GXO A;  2JA5 J;  3K2Z A;  3DEE A;  3S1R J;  2Q6I A;  3H09 A;  4WXD A;  5KCM A;  2GIZ A;  3WBJ A;  4HWV A;  5J6X A;  1DU6 A;  3S2W A;  2BVN A;  2J7K A;  1R5N A;  2CFX A;  1S9H A;  2ZIT A;  4G6I A;  1MIJ A;  4B3F X;  2LKX A;  3FXM A;  5LEK A;  1X1C A;  4NQW B;  3FPK A;  2NAZ A;  5EZH A;  4KDP A;  3ZMD A;  2KZG A;  1U8B A;  3HUG B;  2FU4 A;  1EXM A;  2PEC A;  1X1P A;  2DA2 A;  4ASU A;  1UJ8 A;  4BUP A;  1TYU A;  2ZL7 A;  3CF2 A;  4ZTJ A;  1JTY A;  4Y9R A;  2OA4 A;  3JRI A;  4WZE A;  1Z91 A;  3LQE A;  2IS2 A;  2DYI A;  3H9Q A;  1MBH A;  5F0F A;  3LNQ A;  4RD3 A;  4LIU A;  4X8I A;  2TCT A;  4M6X A;  4TMT A;  3P5J A;  1FLI A;  3GIR A;  1DAR A;  3Q6Q A;  4Z4T A;  4J0Q A;  1P7I A;  3BQJ A;  3BPX A;  2H09 A;  4OZZ A;  5IYC J;  4RGX A;  1HW2 A;  3LA7 A;  3O6B B;  1QFY A;  1WOR A;  4Y33 A;  3IP4 B;  3VYS B;  2DA7 A;  5C4J J;  1MSF C;  3J81 k;  2CWE A;  4BE2 A;  2JJ2 A;  4UB8 C;  1R23 A;  2QUF A;  1TQM A;  3JAM Z;  1CQX A;  2ZZE A;  3UR3 C;  4ENN A;  1RC9 A;  3DBH B;  3HGG A;  4EM1 A;  3A8K A;  3SZE A;  1B59 A;  4XRS G;  5E8I A;  2QQ9 A;  2Z99 A;  1IZ1 A;  1QGP A;  4OOI A;  4E0F A;  1ETY A;  1G59 A;  4IO9 F;  1X1D A;  3U1K A;  1D5Y A;  2NVT J;  3W2I A;  3PUB A;  3TO6 A;  3R6S A;  2ZJR F;  3MMY B;  2DCE A;  4RAG A;  2D5V A;  2M0M A;  1ZR2 A;  4DW6 A;  1FC3 A;  3AVT A;  2PJR B;  1E63 A;  1RPW A;  1MBJ A;  2HQA A;  4AVP A;  2RAE A;  1BLI A;  3M8F A;  2V9K A;  3U2R A;  1BHE A;  2R7W A;  1YJ9 B;  5J8C A;  5KAF C;  3CO7 C;  4A3G J;  1ETX A;  2R7Q A;  3F8C A;  1XDU A;  4ENM A;  4ABZ A;  3HKZ N;  3QFS A;  2VI6 A;  1QA2 A;  5HS8 A;  1EZG A;  1MJA A;  2FUG 2;  1ON2 A;  2YPR A;  1L3L A;  4M6Y A;  2PYH A;  5FO5 A;  4MLO A;  2Z1D A;  4LK1 F;  1WPK A;  4HX8 A;  2VJ4 A;  2FRH A;  3ZMS A;  2UVE A;  3K4B A;  4Y4R A;  1O3T A;  1HF0 A;  4RDK A;  4BXF A;  2J5P A;  3FXO A;  1WGX A;  1MMG A;  1SD4 A;  3FJO A;  4U88 A;  2HPM A;  3OP1 A;  2GOX B;  4IF4 A;  4MR0 A;  2VQG A;  2XRL A;  3AFH A;  2JT1 A;  3RIR A;  2ZBV A;  4EM2 A;  4EGY A;  5L46 A;  3AG4 H;  2LSO A;  1FND A;  1YI2 B;  3HOT A;  1T08 B;  1MGT A;  1IB0 A;  4FET A;  1GVJ A;  1TWF J;  4X7C A;  2B0R A;  1E17 A;  3HOV J;  3HTS B;  2P8T A;  2M87 A;  3OOP A;  2VN2 A;  1ETO A;  3GF2 A;  1YI2 I;  3TKY A;  2RV8 A;  4YIF A;  2C78 A;  1XD7 A;  4I01 A;  1R1T A;  4E7Z A;  1SVO A;  2HDW A;  3F21 A;  1VF7 A;  1GHC A;  1SVM A;  3QP5 A;  1QZY A;  2MGQ A;  3D26 A;  2L3D A;  4YFX F;  3ISP A;  4XSZ F;  4Z4Y A;  2LK2 A;  1Y8Q B;  1G4D A;  2M4K A;  1R1V A;  4UUS A;  1TSP A;  5E17 F;  3RPQ A;  3RY8 A;  3SDG A;  3G71 I;  5J40 A;  3G73 A;  2A5Y B;  5A2Q Z;  3GTM J;  2VFQ A;  4E6K G;  3W2H A;  1HSJ A;  1RKT A;  4L9T A;  5LHI A;  3SEJ A;  4NUB A;  1XSX A;  4XLE A;  1FTZ A;  5F4M A;  3RTR A;  5CKT A;  4BQN A;  3ASP A;  3F8B A;  2DET A;  3JCU C;  3LVB A;  1H85 A;  4HG2 A;  1AMO A;  4AIH A;  1XFO A;  5KW9 A;  2OV7 A;  2TDX A;  4ANJ A;  1J59 A;  1FYL A;  3SYT A;  3BLY A;  3GTL J;  1QO0 D;  1EP2 B;  3NE5 B;  1H80 A;  2GXB A;  2X53 S;  4S04 A;  2Y30 A;  4A3I J;  5KAI C;  1I39 A;  2EH3 A;  2DK8 A;  2B7E A;  2BV6 A;  4HV5 A;  3OW7 A;  2QM3 A;  3K4L A;  2P7C B;  1YIJ B;  1TT0 A;  1OCP A;  3FWE A;  4D5C A;  3JU4 A;  1MJ9 A;  3S2H J;  2VNH A;  1RUN A;  4BPR A;  2VBK A;  4B09 A;  3CPW B;  1HQC A;  1SD7 A;  3VB2 A;  5FKL A;  2STT A;  1FNN A;  1OLT A;  2CF4 A;  3SYJ A;  1B8I A;  3LST A;  1YIJ I;  4WXH A;  3Q0V A;  1TWG J;  1K78 A;  4M1K A;  4HDV A;  1KQ8 A;  3GWZ A;  5IYR A;  3K7A J;  4KMU X;  2R7Z J;  1GUU A;  5CVJ A;  4E70 A;  2X4H A;  4IL6 C;  4Q47 A;  2Z9O A;  4A0X A;  1VHE A;  1KU7 A;  1TLL A;  3ABK H;  4UUT A;  2LNB A;  2CC2 A;  1UAA A;  1YW9 A;  4UV8 A;  2GLO A;  2BY3 A;  1TNT A;  2ZFU A;  4C3I J;  3BCD A;  1OOC A;  2QZA A;  1VI0 A;  1FP1 D;  1LVA A;  2LY2 A;  1ZM3 A;  2EIN H;  2GA1 A;  3ZN1 A;  3E3V A;  3B6C A;  3FKJ A;  2XNJ A;  4IX7 A;  2BY0 A;  2LF7 A;  1AU7 A;  4L18 B;  2IGK A;  3BR0 A;  3F3X A;  4M71 A;  1HVX A;  4YC5 A;  2F6C A;  4EJV A;  3RSN A;  3E1S A;  4PGH A;  4BEH A;  2QYO A;  1DDN A;  2YX7 A;  4A0Y A;  2K4J A;  2XEX A;  5LRR A;  2AHO A;  4ZYA A;  4PZJ A;  2ISY A;  4U0Y A;  2INU A;  1FNM A;  3P9C A;  4JX6 A;  2DOA A;  2ZJQ F;  1Y1V J;  2BF4 A;  3PUM A;  2DOG A;  4PJ0 C;  4QLC U;  1X58 A;  1T6Y A;  3SZT A;  3V76 A;  1LDJ A;  1Z6T A;  2EFN A;  2W85 A;  4HE5 A;  3ASR A;  1IF1 A;  4OOV A;  4M74 A;  3W6V A;  3MWM A;  1R5H A;  3CCV B;  1H89 C;  4KH3 A;  4RAZ A;  4XM3 A;  5DCF A;  1D1B A;  2EQR A;  2X6Y A;  2O03 A;  4KKU A;  3JSO A;  2MC4 A;  3HBL A;  4XQF A;  1FP2 A;  3HHG A;  2O5R A;  4IPA A;  5JVG F;  1YIT B;  4NB5 A;  2L7M P;  4PC2 A;  5IYQ A;  3VNU A;  4DK1 A;  5ILU A;  3DXJ F;  3T8T A;  1NHA A;  3I64 A;  3OSF A;  2Q6K A;  2KMU A;  2HFH A;  1OYY A;  1YIT I;  2ZME B;  2XHK A;  5CYV A;  1Y56 A;  3OYF A;  4IVN A;  2IAI A;  1G6N A;  3T0Y A;  4YIR X;  2E7W A;  2QQA A;  2M9H A;  1SD5 A;  1ZLJ A;  1A8P A;  1RQP A;  2CBX A;  2M5S A;  4HE6 A;  4FWT A;  3EET A;  3HKZ A;  1EWY A;  2Y75 A;  3BY6 A;  4EMS A;  2WY7 Q;  1IHM A;  2CQN A;  3DQV C;  2WV1 A;  3KP5 A;  1VQ6 I;  5JLX A;  2XRN A;  3V7C A;  3BTL A;  5LLQ A;  4JQF A;  2GXG A;  1QQI A;  4G8X A;  2XGC A;  1Z77 A;  1VQ7 B;  3E7L A;  5FNZ A;  2NS8 A;  3FBN B;  3I71 A;  3WTX C;  4IHW A;  1W4M A;  4NCN A;  2HYG D;  2O9L A;  3K69 A;  1VQ7 I;  1XX5 A;  3KEQ A;  2ELK A;  2HPI A;  4YAO A;  2XNC A;  5DNS A;  1E62 A;  2L0K A;  3U9G A;  1A6Q A;  1B23 P;  1O57 A;  2DY1 A;  4M4S A;  4EV0 A;  3TO9 A;  2E1B A;  3CDI A;  5EGO B;  2X3H A;  2NS0 A;  2QTZ A;  1DPR A;  2QSH X;  1IC8 A;  1JKQ C;  3CME B;  2IA2 A;  2UXX A;  3FK7 A;  1U2R A;  1OFE A;  3RDI A;  3C3W A;  1QU3 A;  3WHC A;  2FQ3 A;  2DA6 A;  3T53 B;  4BKX A;  1Z0X A;  5D6F A;  4YZ0 A;  2V7X A;  1PKV A;  1YOV B;  3C1D A;  3D1N I;  2QTL A;  4YAF A;  4YXW A;  2Q2E B;  4LBW A;  3KL9 A;  1G3T A;  1TTY A;  2D3L A;  4B1R A;  2YX4 A;  2R6H A;  4XKV A;  1KC8 D;  5EMN A;  2BXY A;  2L7K A;  2FSW A;  2LMD A;  2G7H A;  2VOP A;  3SQV A;  2XRO A;  2DT6 A;  4P26 A;  5TRD A;  2EIK H;  1JKO C;  4HOB A;  2ECB A;  3RYP A;  2DFH A;  4Z6Y A;  2JSP A;  4X7F A;  5GTH C;  3OEH A;  2ZXW H;  2Y69 H;  1T5E A;  3AVV A;  3BR1 A;  3A8I A;  4C3H J;  2E2I J;  1GJR A;  4G7W A;  1TQP A;  3ERE D;  1BJA A;  2I8D A;  4DNT B;  2MD5 A;  2WZN A;  3BZK A;  1J75 A;  2HVQ A;  3SY2 A;  1X4O A;  1AKH B;  2VJI A;  2XUB A;  2Q1Z B;  1WOO A;  2KKO A;  2PMZ N;  1KK1 A;  1GO2 A;  4NK6 A;  3AGQ A;  2Q0O A;  2RN7 A;  3RCO A;  1RRJ A;  2B7B A;  3RPU A;  3CC4 B;  2DYS H;  2V5I A;  3IWZ A;  1OFC X;  1XB4 A;  4Z4U A;  3K9T A;  2ODL A;  3B8Y A;  2WC2 A;  4RGS A;  2LH9 A;  1N0V C;  1ZRF A;  5DCM A;  5EG0 A;  1CF7 A;  2HVR A;  4IOA F;  2W24 A;  4WZL A;  3VPR A;  4KKT A;  4AD9 A;  1RES A;  3KIO A;  3CC4 I;  1RI7 A;  1Z67 A;  2IRF G;  4M72 A;  3CCU B;  3ZP5 A;  3HYI A;  4FTH A;  1JJ6 C;  5DD8 A;  2E71 A;  4TN1 A;  4IJA A;  3H5A A;  3CDL A;  3OYB A;  1OB0 A;  1N25 A;  4G6T B;  2CND A;  4YCQ A;  2Q8K A;  2OCC H;  2RQP A;  2XAS A;  3DPL C;  4BQA A;  2XPU A;  1KU9 A;  3FF5 A;  1M1E B;  2HYF A;  2CQX A;  1W36 D;  2B0L A;  3A02 A;  5HS9 A;  1GV2 A;  1QRY A;  4IQ4 A;  5JVT A;  4ESF A;  3LSR A;  2W7N A;  3CCQ B;  3B4N A;  2IS1 A;  1K6O A;  1UD6 A;  2CYY A;  4QSH A;  1M90 D;  1WI3 A;  4I02 A;  2R7T A;  2F1M A;  1O3Q A;  1W0T A;  1N75 A;  3DF8 A;  4BQO A;  2JTV A;  3KFW X;  2O6G E;  2XPV A;  5HNH A;  3W2G A;  2HYJ A;  4G94 A;  2JJ7 A;  4QFM A;  3OYK A;  2IT0 A;  1VLO A;  1Q1V A;  2V7U A;  2X6W A;  2K9L A;  4ENJ A;  1VTN C;  1TBX A;  1R58 A;  1DPU A;  1W0J A;  1ZGA A;  4EM0 B;  4NQW A;  4LBY A;  5CQE A;  4MTE A;  4G7O F;  1FMV A;  2VL8 A;  3UW0 A;  1FIP A;  3HUG A;  2V7Q A;  4NK8 A;  3VSV A;  5GTI C;  2VBT A;  3FM5 A;  3WND A;  2RQQ A;  2V26 A;  3EUH C;  2D1V A;  1SMT A;  4G6D A;  3U1D A;  3OAA A;  4FN5 A;  1HXD A;  2RC5 A;  5ICF A;  2M34 A;  3W2V A;  2E5Z A;  4CH7 A;  4ZZD A;  3VEP A;  2F5C A;  2D45 A;  4Y52 J;  5ERI A;  2VB6 A;  3OFN A;  1SC7 A;  1U3E M;  3HPG A;  4II2 A;  3QP6 A;  2INV A;  4L0Y B;  2K3F A;  1HW1 A;  2WB1 A;  3IL2 A;  3AVY A;  1D8J A;  3BH4 A;  1K78 B;  2IA0 A;  1G3W A;  2QEX B;  4ZGQ B;  2BMW A;  2GPJ A;  3F8F A;  2YU9 J;  3HDD A;  4ITV A;  4L5E A;  4ZCL A;  1ZG3 A;  4MYT A;  2OPT A;  3VSU A;  4A3B J;  3ONQ A;  3WOD F;  4M0L A;  2DOD A;  1N06 A;  5TR9 A;  2X0K A;  1W34 A;  5E3M A;  1D8T A;  2KJC A;  2L2O A;  3OIO A;  2XAH A;  2PEX A;  3G3Z A;  5K7Z A;  5IP9 J;  5GPC A;  3Q9S A;  4LGW A;  1XQB A;  2XOK A;  5K5R A;  1B9M A;  1DBG A;  4HLY A;  4C3J J;  3GFJ A;  2R5Y B;  4M3D A;  1B72 B;  3DTI A;  1FNB A;  3FXK A;  2WYR A;  2EA2 A;  3K1P A;  1BIB A;  2PX9 A;  3QQA A;  2A69 F;  3VYR B;  5LHH A;  3MFK A;  1ZH5 A;  2G0E A;  2EJR A;  1BBY A;  4XOT A;  2PN6 A;  5DDG A;  2VPR A;  2Z5U A;  2ZO4 A;  3NWT A;  4X0G A;  3BG7 A;  4B48 A;  3DWL E;  4YAW A;  1IUF A;  1ZAR A;  2AXT C;  2XB5 A;  3ZZU A;  4TMZ A;  3RJP A;  2H27 A;  3SLD A;  2W84 A;  4F3Q A;  4J00 A;  2FML A;  1DQU A;  2PJR A;  1EFU A;  2ISZ A;  1S8N A;  4CCL A;  2FOK A;  4KIF A;  1TLH B;  4A5M A;  1K7A A;  3GEZ A;  4H0E A;  1IN4 A;  2JRT A;  2YSR A;  3JRA A;  4RB1 A;  2V7V A;  4QHY A;  2HR3 A;  2OK7 A;  1H0M A;  1WJD A;  2OF7 A;  3BG6 A;  1F9N A;  1O3R A;  2DA1 A;  1JUM A;  3H94 A;  1D1C A;  3OS1 A;  3FXJ A;  1MNM C;  1S72 B;  3BP8 A;  2XDV A;  2YWH A;  2XC1 A;  2XKO A;  3D5R C;  4M6V A;  5FB2 A;  1VQ4 B;  4J19 A;  1LM1 A;  4M9Z A;  2K9Q A;  1XG2 A;  2V7W A;  3B6A A;  2L5Q A;  3ABM H;  3QYB A;  3DDY A;  2QY1 A;  2EIL H;  3ZGK A;  1M1K D;  3M1C A;  1R49 A;  1N05 A;  4P25 A;  3EUH A;  4A3D J;  4RGR A;  2L7Z A;  4A6D A;  3PEN A;  5AMV A;  2BM4 A;  4ZYG A;  2EFG A;  5CVU A;  1XSV A;  1YQA A;  3TED A;  3B73 A;  3HGY A;  3L9F A;  3AVX A;  2LBF B;  4JX5 A;  4KIC A;  4EJW A;  2BGJ A;  2PMZ A;  4S0H B;  4P6Y A;  2VBE A;  2Z8G A;  4Z4R A;  1LFB A;  3LWF A;  2DT7 B;  3PIP F;  1Q7Y D;  4PAB A;  4UXN A;  4URR A;  3I56 B;  1Q1H A;  1Z7L A;  3SFI A;  2Y2Z A;  1OCO H;  4V2G A;  2GOM A;  3H0G J;  4Y15 A;  4GFB A;  1BX0 A;  2V7F A;  3O2P E;  3I1F A;  1FBQ A;  3H3U A;  4CUG A;  1YO5 C;  3IWF A;  1XPX A;  4XLA A;  4BAC A;  1LB2 A;  2R7X A;  3WWG A;  3ZQ7 A;  1E3P A;  4C9Y A;  4XID A;  1BIA A;  2DIE A;  4RLZ A;  3OIQ A;  4Z4W A;  4M9X A;  1QQ1 A;  2KIF A;  1PYV A;  4WZT A;  4RMN A;  4BHP A;  4A3F J;  1IA5 A;  4BJ5 C;  5JHU A;  3U21 A;  2XTW A;  3WG7 H;  2F4M B;  2HQR A;  2VKH A;  2DLL A;  3G6E B;  5L3G A;  2CW7 A;  1K6Y A;  3DLL F;  2R5Z B;  3PM1 A;  3OOU A;  4Z06 A;  4WWV A;  4G1V A;  2MAB A;  3OJW A;  3SFZ A;  3CCR B;  3G6E I;  2WTE A;  1QPI A;  1H9G A;  1YFH A;  4AC0 A;  1IJF A;  3AL0 B;  4X07 A;  1DGR M;  3OYN A;  4Y9U A;  3VR6 A;  2X3U A;  1LDD A;  1QFZ A;  3TH0 A;  3A1Y A;  5HDN A;  2W48 A;  3CCR I;  3ABU A;  2F1L A;  2HLD A;  3CC2 B;  1QCX A;  4XRF A;  2EFP A;  2GM4 A;  2K02 A;  3LQQ A;  2ZB9 A;  3AST A;  3EQO A;  4P6V F;  2LDU A;  5HDG A;  2VBY A;  3FXR A;  2OTL B;  3CC2 I;  1QUE A;  2FBI A;  5FJ8 J;  4BAY A;  3H3Z A;  1BR2 A;  1EFC A;  3IKT A;  2Y48 A;  2M0C A;  2LP0 A;  3A1P A;  3LFU A;  4CCM A;  5EYR A;  3B90 A;  2L9R A;  3PIO F;  4D0P A;  3CJQ B;  3ZOB A;  3WNC A;  2X6X A;  1WJC A;  1O8K A;  2OBR A;  1KCD A;  3FMR A;  2Z6B D;  1KTV A;  5D5U B;  2W7Z A;  4KYW A;  5GAH J;  3IH4 A;  3PSZ A;  5FLX Z;  1IO2 A;  4CCJ A;  3OZV A;  1DGW Y;  3KCC A;  5EEH A;  2JSC A;  4EJU A;  2NNY A;  3J7Z I;  2PI0 A;  1QGY A;  1WTH D;  1YHQ B;  2IW5 A;  4PSW A;  5L3E A;  5LEJ A;  5CVV A;  5H59 A;  1I5Z A;  3VO1 A;  4AF7 A;  1XTA A;  5E1X A;  4HEA 2;  3QPL A;  2A07 F;  3RKX A;  1YHQ I;  2VPL A;  2L9V A;  2QWW A;  2ZZQ A;  4MQV A;  1MH4 A;  5BSY A;  1YW8 A;  4UV9 A;  4RB2 C;  4H4K C;  1DU0 A;  1H88 C;  4YHB A;  2O8X A;  2RNG A;  1TVC A;  3MQ0 A;  2JZY A;  3MKZ A;  4MEX F;  2W6J A;  1Z6R A;  1NHC A;  1RET A;  1KMH A;  3R0A A;  1ZK8 A;  5IOY A;  5TV2 A;  3PNT A;  4GO1 A;  3OYA A;  2C5B A;  1V5E A;  3ZZT A;  5ILS A;  3HHH A;  1YX2 A;  1NB0 A;  3BOQ A;  5C1C A;  4A0Z A;  4W8T A;  3SZP A;  1MD0 A;  3HPH A;  5KHD A;  3P9K A;  3S8P A;  4DQK A;  4M2L A;  2K3P A;  3D5L A;  1P9Q C;  3HG9 A;  3SJP A;  1ETK A;  2ZME A;  5M3F J;  1QZZ A;  1K61 A;  1CZF A;  5TY0 A;  4HNV A;  3ZSC A;  2RRE A;  2X1E A;  4F52 A;  3CCJ B;  1LLZ A;  3KE2 A;  3ML6 A;  2ETH A;  3SXY A;  3GQA A;  4FQG A;  2VLA A;  2FNP A;  3S15 J;  3LJY A;  2DMT A;  2DYR H;  4UHT A;  1EA3 A;  2OUM A;  4XN0 A;  4B44 A;  3WTT C;  2ECC A;  2E1C A;  2BXZ A;  4OJ6 A;  4X7D A;  3CCJ I;  1TYW A;  3S2D J;  4NBQ A;  1T6X A;  3OS2 A;  4RBO A;  1LFU P;  1QHG A;  1LNW A;  2HEO A;  4QTR A;  2E1N A;  1W35 A;  1VQL B;  4MQ9 F;  3PO2 J;  4CZC A;  2EIJ H;  3JRB A;  4C2U A;  3TMO A;  2V79 A;  1CNF A;  1VQL I;  2QN6 A;  4OPV A;  2MW8 A;  1U5T C;  1X3Z B;  4PFP A;  2WA0 A;  4UB6 C;  4D1Q A;  2XGJ A;  1YJW B;  2P6T A;  2CK3 A;  1JTA A;  3OS0 A;  3DTK A;  4IHV A;  2EIM H;  4KT5 C;  3MMP A;  3OYE A;  4X0C A;  4A6E A;  4A3L J;  3KZI C;  1BJZ A;  3AVW A;  1J0R A;  2WY8 Q;  3ELK A;  1YJW I;  1K4T A;  5ICG A;  3CTA A;  5EGO A;  1X1A A;  2XGE A;  4BXU A;  3F22 A;  1A31 A;  1SFK A;  2DW4 A;  3V7S A;  3B78 A;  2D3N A;  2JIZ A;  2EWE A;  2LY1 A;  4CXF A;  3PNY A;  4RD1 A;  1FOX A;  5DN6 A;  1VQO B;  3PNV A;  4XK4 A;  5CVR A;  2DEU A;  2F4O B;  3DEW A;  2ZL5 A;  3MZ8 A;  1OFM A;  3HRM A;  2ZTN A;  1GAQ A;  1REP C;  4FK8 A;  1WJF A;  4Z4Z A;  3RYR A;  4OP7 A;  1Q82 D;  1VQO I;  1KCC A;  1EA0 A;  2F4I A;  2Q6L A;  1BN5 A;  4BJT A;  5IY5 H;  2XC7 A;  3GTP J;  5LGT A;  1YX5 A;  1X3U A;  4WF2 A;  2IVM A;  2Q2E A;  4XBF A;  1UCR A;  5CJ9 A;  3AGP A;  2XIG A;  5F27 A;  3OYM A;  2YUS A;  3J7Y J;  2BVM A;  3VMW A;  3P27 A;  2ZKZ A;  2ZBK A;  3AKZ A;  1FOY A;  1ZN2 A;  3HRT A;  1IRZ A;  1KQ5 A;  1U0J A;  2NTQ A;  4BHB A;  3KP6 A;  2O04 A;  1IN7 A;  2LC2 A;  1IV8 A;  2R7D A;  3DU1 X;  2J8I A;  2TRT A;  4UZU A;  2L02 A;  1ZHF A;  2YWG A;  2H94 A;  3HJE A;  4JYK A;  4MGR A;  3IRQ A;  2K86 A;  4IRH A;  1OGI A;  2RVC A;  2WZP P;  2L4A A;  4FX0 A;  1MNE A;  5LBQ A;  4MYU A;  2CO5 A;  3DLA A;  3ROU A;  1SAN A;  4M53 A;  1AKH A;  4N3N A;  4XOP A;  1IGN A;  2MA3 A;  2O0V A;  2PMU A;  2O17 A;  3IUO A;  1KK2 A;  5L3F A;  2HKO A;  3C2H A;  2O7O A;  3M1E A;  1UB9 A;  3DPT A;  1MMN A;  3RKY A;  4E4H A;  2NV4 A;  5BSX A;  3WTW C;  5FO1 A;  3L2C A;  2FJ1 A;  3VYT B;  2IP2 A;  4RCY A;  2LY9 A;  3W2F A;  3JRE A;  2ZBU A;  1R7J A;  2IA1 A;  2ZXJ A;  1SMY F;  3CLO A;  1WJ5 A;  3GME A;  2XT2 A;  2D1H A;  2E36 A;  5FA6 A;  3QOP A;  2BM6 A;  5IOZ A;  1QNT A;  5ILV A;  2B5O A;  5GV8 A;  3IAS 2;  1X3W B;  3LSH A;  5EEG A;  3U2Q A;  2M7A A;  3LSM A;  2ID3 A;  1FBS A;  2A5W A;  3G71 B;  1K28 D;  5FIU A;  4OJ5 A;  2IPQ X;  2XZP A;  4DK0 A;  4BS9 A;  3ULQ B;  3ZR8 X;  5GAD J;  5FD6 A;  1CQT A;  1BI1 A;  1T0F C;  4PJM A;  5K7F A;  1YLO A;  4HF1 A;  4C43 A;  2NS7 A;  1JJ8 C;  3I59 B;  1JJ2 B;  1BOA A;  1TW2 A;  1FYM A;  3JRC A;  3HB9 A;  4I99 C;  4OAZ A;  1W1W E;  4PSX A;  3C2B A;  3ZN0 A;  4M9S A;  1BC7 C;  3I0T A;  1P4W A;  1QVT A;  1AWC A;  4LLL A;  2O8K A;  1RUO A;  3PSF A;  4GCV A;  3E0J B;  5M5X J;  1GQ8 A;  4BHC A;  1F5T A;  4OMY A;  1AIR A;  4IHT A;  3H0D A;  3AK5 A;  3SJM A;  4RD0 A;  2XKP A;  4XLH A;  2PLF A;  1F1Z A;  1BA5 A;  3TP0 A;  1QA3 A;  3ABT A;  2UVF A;  4I76 A;  2QE7 A;  1KQ0 A;  4FXU A;  3LSG A;  4PC7 A;  3ZQH A;  2MBF A;  3QSY A;  4RM2 A;  1UHS A;  3DU5 A;  2P0W A;  3FX3 A;  4B47 A;  2M8G X;  5D5W B;  1B2R A;  2ZTG A;  3DTE A;  2D2W A;  2HTJ A;  4PK4 A;  2HZT A;  3BR6 A;  3BTJ A;  2BY2 A;  1WH5 A;  1X2N A;  5HLT A;  1WVR A;  1JI8 A;  5BMZ A;  2NPF A;  1ZQ3 P;  1FOK A;  1SFU A;  1VND A;  3WU0 A;  1FPQ A;  4AWX B;  1HDD C;  2EV0 A;  1W5S A;  2IBD A;  2ME6 A;  2NOG A;  1H8E A;  1OGJ A;  2VJJ A;  2L01 A;  2X0L A;  5GAE J;  3WGI A;  3FPP A;  3BDD A;  3KP2 A;  5DYM A;  1W0K A;  1W7P D;  1KU3 A;  2HS5 A;  3JQP A;  3LL7 A;  1HOM A;  1Z21 A;  3R61 A;  5E79 C;  2HOT A;  1K79 A;  3S16 J;  4PCQ A;  3PQJ A;  3G05 A;  3GVL A;  3ISX A;  3OSG A;  2HWV A;  2VJ5 A;  1R1U A;  4BDY A;  1OPC A;  3LAP A;  3C2G A;  4MFE A;  1WJE A;  1H42 A;  2RKH A;  1FWZ A;  2W4S A;  2E60 A;  1SKY B;  5B5E C;  1FZP B;  3KYD B;  3BT9 A;  3DCF A;  4EVI A;  4I84 A;  5EZG A;  2BOL A;  2R5Y A;  1B72 A;  2JJ1 A;  4N4N B;  4QWQ A;  1ZRE A;  3SKB A;  3GQ9 A;  2GXA A;  2KZV A;  4PJN A;  2R7F A;  3GCM A;  1WWX A;  3A01 B;  1SM4 A;  3E6B A;  2IJL A;  3GFL A;  1W9X A;  4L5I A;  5TJJ A;  1ZRC A;  4UUV A;  4C0S A;  2HI3 A;  4BY7 J;  1N07 A;  4WK8 F;  3WTU C;  4IRI A;  2OQG A;  4X06 A;  3ZC3 A;  3HSF A;  3V8L A;  1FNC A;  2C4T A;  2ESN A;  1XGN A;  3DFG A;  1P7J A;  2R7R A;  1QHH D;  3AL0 C;  3I4M J;  3FY3 A;  3PL8 A;  4DOZ A;  3J7A Y;  3B02 A;  1UHW A;  3LQR A;  3CCS B;  3L7W A;  4FAS D;  3GXO A;  1D2E A;  2FQ4 A;  4IKF A;  1S4M A;  2COM A;  2VXD A;  4XON A;  4XMY A;  4DZP A;  3CPX A;  4JMQ A;  2X9D A;  3M3Y J;  2C77 A;  1I6X A;  3TL4 X;  2HOS A;  1V5G A;  2YU3 A;  3CCS I;  4YFN F;  1Z1D A;  2O3F A;  4KIB A;  4Z05 A;  1TYX A;  2FBH A;  5FRO A;  2XGX A;  4W8R A;  5CDF A;  4Q4Z F;  1F43 A;  4YRV A;  1ZYR F;  3OYC A;  3JQR A;  3GFI A;  3A3B A;  4P55 A;  2PLY A;  1G7C A;  4DGW B;  1TW3 A;  3I53 A;  4B3G A;  1Y0R A;  1R5G A;  3RPU D;  1MBF A;  1OCZ H;  1EV7 A;  2WAD A;  3I5U A;  4OOX A;  3ZMT A;  2ZSH B;  2LBF A;  2HGC A;  3OV8 A;  3AAF A;  3VFZ A;  1XSD A;  3J80 K;  5GP9 A;  3K2A A;  4Q5S F;  1FBU A;  2ZJP F;  2YWF A;  1VJS A;  5BS6 A;  2MLG A;  5B3S H;  3WXM A;  3T8R A;  1HKQ A;  2H1K A;  2GAU A;  2VC0 A;  1P4M A;  5HLH A;  5H20 A;  3HAG A;  2OZU A;  4WXC A;  1WJB A;  1BX1 A;  3RIQ A;  2KQR A;  3CLQ A;  3WE2 A;  2NRA C;  2O1D A;  3QOD A;  5ICE A;  2DDA A;  1YG2 A;  5F4O A;  3GW2 A;  5B1A H;  1YS6 A;  3MKL A;  1ON1 A;  4V02 C;  4ACA A;  1YYV A;  4M3B A;  2DMQ A;  2DPU A;  5F08 A;  3G1L A;  2OTJ B;  2XAQ A;  4DJA A;  1LDK B;  1V4R A;  3MCZ A;  4P9F A;  5KNL A;  1PUF B;  1KZL A;  3A3G A;  2JWT A;  1BI2 A;  4JX4 A;  4UVC A;  3WTS C;  2JA8 J;  4YZQ A;  1P92 A;  3HC7 A;  3ZQQ A;  4W1U A;  2LR8 A;  2V1D A;  2OTJ I;  3SDB A;  3KZZ A;  4A3K J;  1V5V A;  5JMC B;  1LUJ B;  4Q48 A;  4DQL A;  3LA3 A;  1WP6 A;  2KT0 A;  3KLN A;  2R5Z A;  1MND A;  1Y8R B;  4JBA A;  4OM9 A;  2ZC2 A;  2MLK A;  4ESB A;  5DEQ A;  2JA6 J;  3Q38 A;  1KTW A;  1H9T A;  3NAW A;  3QE2 A;  3GSI A;  1QG0 A;  4RD4 A;  1E2X A;  1KD1 D;  1TNS A;  2OBS A;  1D1N A;  2AXL A;  1FX7 A;  3UKG A;  4E7J A;  1YIO A;  3FMS A;  2ZL6 A;  4XKB A;  2ZXH A;  4LJZ F;  1ZR4 A;  3OOC A;  4ON0 A;  4GGG A;  3REO A;  4G6Q A;  4PC1 A;  4N9H A;  1NBM A;  2NTP A;  4YEL A;  4RDJ A;  2Y9Y A;  5FO0 A;  2ID6 A;  2XPW A;  3OL3 A;  3QU3 A;  4I0A A;  4U0V A;  2R93 J;  5CQG A;  1TYV A;  2DDB A;  1RU4 A;  3CJR B;  1KK3 A;  4LB5 A;  4BDZ A;  1JA0 A;  4ZC3 A;  2MD0 A;  2QSG X;  4D7M A;  3F8M A;  3HL2 A;  5D6E A;  3EPZ A;  3OWT A;  3SUC A;  2F5F A;  1HZE A;  2VYQ A;  3S14 J;  3S3N A;  1P4A A;  1G3S A;  3GTQ J;  3EUA A;  2FOW A;  3FMQ A;  1POG A;  1RNL A;  5KVR A;  1IN5 A;  4QPQ A;  1ELO A;  1R6R A;  1Y6I A;  4Y7N J;  2XAF A;  1QFJ A;  1KJZ A;  3EQL F;  2XZO A;  1MBE A;  3K1M A;  1DP7 P;  1IW7 F;  4NC8 A;  2NVQ J;  2CJJ A;  1F36 A;  1KA8 A;  1ZGW A;  4K2E A;  3W5H A;  4XOR A;  2HOA A;  5FLX K;  2HQ5 A;  2NXN B;  1FTT A;  4RDL A;  3MVP A;  3KP4 A;  5FKM A;  4RCZ A;  2X48 A;  4U9U A;  4K1X A;  4WX9 A;  2E1M B;  4RLF A;  1JTX A;  3K4N A;  1GVH A;  2QQ8 A;  3E5Q A;  1JT0 A;  3ABL H;  1JNY A;  1U5T B;  2Y9Z A;  5CVI A;  1RWR A;  3SEZ A;  2H8W A;  3OR2 C;  1PUE E;  1GXQ A;  4F92 B;  2XF6 A;  2GBY A;  1K83 J;  2WJY A;  1TWC J;  2WAQ N;  3WU1 B;  1BW6 A;  2HQN A;  2YWE A;  3PVD A;  4TKO B;  1D5V A;  1TWA J;  4MO7 A;  1FX0 A;  2CUE A;  4NDL A;  3JRF A;  1SD6 A;  3OE7 A;  3HOU J;  3OZU A;  1IB4 A;  1E43 A;  1XMK A;  4HF2 A;  2GRE A;  2W57 A;  5F1R A;  3C18 A;  4GDF A;  4MFD A;  2QCO A;  3N6Z A;  4OJL A;  4CZZ A;  4XN3 A;  2PBI A;  1B6A A;  2D74 A;  1WH7 A;  1A35 A;  1IUY A;  1JT6 A;  4P1V A;  3ERM A;  5EJC A;  3ZQC A;  5E3N A;  3GQ7 A;  3KEW A;  4BY1 J;  2ZXI A;  4O5V A;  2Y0S N;  3H9J A;  3OYL A;  1S7O A;  4I7H A;  1ULY A;  4M3G A;  3OYD A;  5D5V B;  3J81 K;  2AQF A;  2H6C A;  4H9G A;  2XF7 A;  4XKW A;  1BR1 A;  2L4M A;  3AG3 H;  1W36 C;  1AHD P;  1S7A A;  4R1H A;  2DAO A;  4I09 A;  2FE3 A;  1BC8 C;  5HKK A;  5C3E J;  1XB2 A;  2DPD A;  2Z16 A;  1I1G A;  4OWR B;  2V4J C;  3OY9 A;  2CW5 A;  2VT2 A;  3WG9 A;  3SHF A;  4IZZ A;  3GLX A;  4XD7 A;  1ITY A;  4R79 A;  3C7J A;  5GAG J;  4PJJ A;  3H1C A;  1R5I D;  1L1I A;  3N05 A;  4ZDO A;  2VOO A;  2DTR A;  3GYH X;  1IXC A;  2ELH A;  2DMU A;  2DO7 A;  3GZ6 A;  1UD3 A;  1WHU A;  3PET A;  3G2B A;  2P7V B;  1JA1 A;  2XAJ A;  3ZRG A;  4P9U A;  4U49 A;  3CDH A;  2K5C A;  1T6S A;  3PA2 A;  2UZK A;  1UG2 A;  2VKD A;  3UNG C;  1XS9 A;  2ZNY A;  3PJR A;  4PDK A;  5BNG A;  3Q39 A;  3H9G A;  4RDU A;  1WSU A;  4DYR A;  3E1Y E;  2F5E A;  3MN2 A;  4AVZ A;  4PC6 A;  4I98 B;  3VO2 A;  3CUQ C;  1OFD A;  1V55 H;  5LFA A;  1YTY A;  1VFC A;  1WMR A;  4B8X A;  2CW8 A;  4NHJ A;  2BPO A;  1OYI A;  3A35 A;  2CSO A;  2G9W A;  3GZ5 A;  2YUH A;  2QBY B;  2GJP A;  2CG4 A;  1MJB A;  4FCY A;  1G8X A;  3K70 D;  3ZBT A;  2BSP A;  3KYC B;  2EBI A;  2EV6 A;  2X85 A;  4YAU A;  2ADU A;  2HZD A;  5TGT A;  4CCN A;  2WBM A;  1QBJ A;  1EF4 A;  1I8D A;  2ACJ A;  4EQQ A;  4HNU A;  4KJZ A;  3BCF A;  4DYC A;  2NZM A;  4HW0 A;  3A0H C;  1OQY A;  3F72 A;  4HNT A;  3L2R A;  1O4X A;  2P4W A;  2R7U A;  1WSR A;  3QFC A;  1OMI A;  3CMY A;  3LOC A;  1FSH A;  1KU2 A;  3W3C A;  4OIP F;  1T56 A;  3R4K A;  1DDG A;  2QYU A;  5GV7 A;  4JOM A;  1YRN B;  1VF9 A;  2XSJ C;  2CS3 A;  4AM3 A;  1O8L A;  3CCM B;  1ONV A;  1IXS B;  1P2F A;  1XDS A;  2CV2 A;  1IRG A;  5C1E A;  2YR2 A;  3BTI A;  2DI3 A;  1OCR H;  4G5G A;  3CW2 A;  5A88 A;  2CRV A;  4F7Z A;  4KUM A;  4RGU A;  3CCM I;  3V4G A;  3ZPL A;  2ZZG A;  2VNJ A;  5HLG A;  4XNF A;  3FIS A;  3S32 A;  1MW7 A;  4A12 A;  1P6R A;  4IOC F;  3H5R A;  1S5L C;  2HMA A;  2ZCW A;  2IGN A;  3BJO A;  1Y0Y A;  4F91 B;  3J80 Z;  4MHG A;  3M4O J;  3BC9 A;  4B4D A;  5KK1 A;  4BH9 A;  1XGO A;  1VQ5 B;  1D0X A;  2VFP A;  4D5F A;  4TSF A;  5JHF A;  2V1U A;  2NST A;  2ZJ2 A;  2STW A;  3I4N J;  4B4C A;  4A3J J;  1EP3 B;  3PFI A;  3FK6 A;  3HRS A;  3KZY A;  2VON A;  5JLW A;  4U87 A;  2ELJ A;  3I54 A;  4FHT A;  1VQ5 I;  1EFR A;  3B82 A;  1V5F A;  2VKV A;  2LOO A;  2EZL A;  2V6E A;  2KIQ A;  2JRM A;  3IV5 A;  2VBZ A;  4DIQ A;  4Z4S A;  2QX3 A;  3ONU A;  3L1P A;  1HA8 A;  2M5W A;  1QJV A;  2MYS A;  2NT9 A;  2Z33 A;  3W2A A;  1GDT A;  4GRI A;  4N0B A;  1N08 A;  2VBM A;  2VBX A;  4IXA A;  1K5C A;  4AC9 A;  3ASS A;  1GV5 A;  5H6Q A;  3I59 A;  4JP0 A;  1FMW A;  3FBI B;  3LFK A;  3ZQI A;  4WCG A;  2DCU A;  1ENH A;  3G1O A;  4RS8 A;  3PQK A;  4U4B A;  4G7H F;  1V0F A;  3VST A;  5HVQ C;  5FL7 A;  1QPM A;  1FYK A;  2M1B A;  2NVU B;  3V8J A;  4LC0 A;  2CQ7 A;  2QVO A;  2WAQ A;  2XZL A;  2C4U A;  3GBG A;  1ZAO A;  2KRF A;  2M2E A;  3W2W A;  2WPD A;  2PG4 A;  4HIZ A;  5B6I A;  2OK8 A;  3VNV A;  2GQQ A;  2DMN A;  1QVU A;  4F7D A;  1IXR C;  4A93 J;  1N0U A;  1NH3 A;  3VOE A;  4Q7J B;  4LBZ A;  4A3E J;  2MSY A;  1W7P B;  2M7B A;  2ME0 A;  4RM3 A;  1LPQ A;  2CGP A;  2BGC A;  3BRO A;  3WBK A;  5IYN A;  1OYW A;  2IQ7 A;  4OJO A;  1PJ7 A;  3H9N A;  2VIX A;  2ZNZ A;  3BJ6 A;  1SFX A;  3GRH A;  5F04 A;  3E6C C;  3W2E A;  1GVD A;  1KGS A;  2K40 A;  4HAM A;  1O8E A;  3Q9V A;  1OFL A;  1STZ A;  2PMH A;  1QA1 A;  5J3O A;  1HKS A;  5K5Q A;  1ETQ A;  3QRF F;  2Y0S A;  3W5V A;  1EJ9 A;  1JUS A;  4HF0 A;  3LYC A;  2O6W A;  1WOS A;  5BPI A;  4HBL A;  1IRF A;  1FEX A;  2GQF A;  3ECH A;  3HOX J;  2ZFW A;  3OL4 A;  5DUI A;  2W82 A;  4X6A J;  5HOO A;  1RQR A;  4P3I A;  4Z1M A;  4C2T A;  4U7B A;  1U6G A;  3D5S C;  3P9I A;  4ZDP A;  2R9V A;  3S1N J;  1VQN B;  5J1U A;  1A04 A;  3H3V K;  4P9S A;  1PE9 A;  1HCR A;  3M8E A;  2FBK A;  3W6J B;  3P4G A;  1R71 A;  1R9T J;  3BC8 A;  5FLV A;  3LO8 A;  3BH6 B;  3FM3 A;  1HKT A;  4P2N A;  3PFY A;  5E6T A;  2FXA A;  3CES A;  2XAG A;  1EH7 A;  3T1B A;  3BG3 A;  4B3X A;  3DEU A;  1VQN I;  5FFZ A;  1S3J A;  1W5C C;  3IC7 A;  1G2H A;  4B3A A;  4PGO A;  4ROX A;  1VQM B;  1PVE A;  4NC6 A;  4CCK A;  4ZCI A;  1VQ9 B;  4A3M J;  3WU2 C;  5JFR A;  3HOS A;  4AIK A;  1W2B B;  3A01 A;  3FHN A;  4Y7C A;  4O6J A;  5L3C A;  1KQS B;  1VQM I;  3I58 A;  4XR6 A;  5E8G A;  1VQ9 I;  3CO6 C;  1R22 A;  1TT5 B;  1ZKG A;  4E7L A;  4RD2 A;  1DAB A;  1PP8 F;  1N8R D;  1HLV A;  4MEY F;  2B7C A;  3QFR A;  4KN4 X;  2O61 A;  4EGZ A;  1FIA A;  2LYC A;  1O7L A;  2O0Y A;  3ECO A;  3CZ6 A;  4BU2 A;  4CYD A;  2EFW A;  1JGG A;  1CGP A;  1E0E A;  4A2U A;  2DBB A;  4TMV A;  3Q0U A;  3KRG A;  5THX A;  3CJN A;  2VNK A;  4HDU A;  3M8J A;  1OCC H;  5FGM A;  4HRI A;  2V31 A;  4LIT A;  2O0W A;  2LLK A;  1MBK A;  3NB2 A;  5JI6 A;  1S6L A;  2BYV E;  5F64 A;  3WE3 A;  3X2Q H;  1IJE A;  2OYN A;  4OIR F;  1E64 A;  2QEN A;  1TZL A;  3NEU A;  2QKL B;  4DQ2 A;  3LAJ A;  4ZYD A;  2KL4 A;  1E79 A;  4QPO A;  5HXB A;  4QIW N;  3J81 Z;  4X1E A;  1IAW A;  2F2E A;  5K1Y A;  2P5L C;  5M3M J;  3ASO H;  1LE8 B;  3PA1 A;  3BNW A;  4G7Z F;  1K9M D;  2BZT A;  1I1S A;  3S1M J;  1XE1 A;  1E1R A;  3OYJ A;  4IHY A;  4OU0 A;  1ETV A;  3EYY A;  2IGO A;  1XMA A;  2CQQ A;  3CCL B;  2DTZ A;  3EUK L;  3KEY A;  4Z03 A;  4G12 A;  4ZV4 A;  2HOE A;  3F0C A; 
#chains in the Genus database with same CATH homology
 1OHH A;  5HLT A;  2UWM A;  1JI8 A;  2HU9 A;  2JSP A;  1LFP A;  2KPM A;  3OEH A;  1T5E A;  3GQ8 A;  1UG0 A;  2LRD A;  4HSR A;  4G7X A;  2KDO A;  1UD5 A;  2E1M C;  5LD2 C;  2XAU A;  2A6T A;  1O8F A;  4ZTF A;  4G7W A;  1H8E A;  1VBL A;  2VJJ A;  4AU7 A;  1BMF A;  2IGM A;  2L9N A;  3FPP A;  2VQC A;  1W0K A;  2I8D A;  1Z3X A;  2BW3 B;  3FKS A;  3ZPN A;  1MMD A;  3LL7 A;  1KON A;  1Z21 A;  4Y3O A;  4E7S A;  4EAT A;  1ZEL A;  4DNT B;  2HVQ A;  3G05 A;  3GVL A;  1X4O A;  2KRH A;  2VJI A;  3OEE A;  2VJ5 A;  2CUZ A;  2Q1Z B;  2R7O A;  4BDY A;  4B43 A;  4NK6 A;  3C2G A;  3RCO A;  1WJE A;  1N77 A;  2GJK A;  2LG4 A;  2W4S A;  2E60 A;  3I3L A;  2KP6 A;  1SKY B;  1N78 A;  2ODL A;  3B8Y A;  1V0E A;  4W8S A;  1J09 A;  4I84 A;  2BOL A;  2LH9 A;  3OMY A;  4ZJZ A;  2JJ1 A;  3LMM A;  4N4N B;  2HVR A;  4DBR A;  2R7V A;  4KKT A;  1MMA A;  3GQ9 A;  2W00 A;  2KZV A;  4BJ6 C;  4PJN A;  1NG7 A;  4DBQ A;  2KVO A;  3CP8 A;  1W9X A;  2X1D A;  2V1N A;  3K10 A;  1DBO A;  3H5A A;  4KIT B;  3QYF A;  3OYB A;  2WAF A;  4G6T B;  1OB0 A;  4XLF A;  2UV1 A;  3BCA A;  4HPQ A;  3MKW B;  4XKC A;  3DPL C;  2GK7 A;  1NG6 A;  2Z2S B;  2R7R A;  3FY3 A;  1QHH D;  3AL0 C;  1BN8 A;  3PL8 A;  4DOZ A;  1W36 D;  4IQ4 A;  3J7A Y;  2L9S A;  2W7N A;  3B4N A;  2CV0 A;  1OGO X;  2IS1 A;  1UD6 A;  3CMM A;  3DU6 A;  4FAS D;  1IDK A;  3DPU A;  4IKF A;  2R7T A;  2VXD A;  2F1M A;  4XON A;  1N75 A;  4BQO A;  4XMY A;  2W6I A;  4JMQ A;  4F93 B;  5HNH A;  1E1Q A;  3TL4 X;  1V5G A;  1PJR A;  4F55 A;  2JVG A;  3NWS A;  3L2V A;  2R4G A;  3T51 B;  1WFX A;  1IDJ A;  3OYK A;  4Z05 A;  5FRO A;  3VSL A;  1ERD A;  1NRK A;  5CDF A;  4W8R A;  2X6W A;  2K9L A;  3K4C A;  4YRV A;  3OYC A;  3A2K A;  4P5O A;  1W0J A;  3A3B A;  2BVL A;  5CQE A;  4DGW B;  1FMV A;  2CH0 A;  2VL8 A;  3MD2 A;  4B3G A;  1O8D A;  3UW0 A;  2V7Q A;  2E5N A;  4NK8 A;  3VSV A;  3RPU D;  2RQQ A;  2KRC A;  2V26 A;  2WAD A;  3EUH C;  3ZCO A;  2XND A;  3OAA A;  3VMV A;  1D0Z A;  3OYH A;  2ZSH B;  1X4P A;  2LBF A;  3IAM 2;  3W2V A;  2E5Z A;  4CH7 A;  2W1O A;  1O8G A;  1UD2 A;  2VB6 A;  1VJS A;  4BE1 A;  3OFN A;  1BPL A;  3HPG A;  2LRE A;  4II2 A;  2INV A;  2WB1 A;  1YE9 A;  3BH4 A;  3HAG A;  1OGM X;  1WJB A;  1DP3 A;  2R7S A;  2X8K A;  2KQR A;  4ITV A;  2IS6 A;  2O1D A;  3QOD A;  1UD4 A;  4KIS A;  3VSU A;  2WAE A;  3ONQ A;  3JUR A;  3OIP A;  3VSK A;  2L2O A;  4DJA A;  3OYG A;  3L2Q A;  1E3Z A;  3ZIA A;  1LDK B;  5KNL A;  2CV1 A;  4KKS A;  1KZL A;  3VWB A;  3A3G A;  2XOK A;  3OYI A;  1DBG A;  4YZQ A;  3HC7 A;  3OPO A;  2VQH A;  3ZQQ A;  3SDB A;  3OR1 C;  3DTI A;  3VST A;  2VXZ A;  5FRM A;  3VYR B;  1WP6 A;  2NSP A;  1UEL B;  2MFZ A;  3ZPP A;  2HNH A;  2F5V A;  4HST A;  4XOT A;  1MND A;  4X0G A;  3NWT A;  3BG7 A;  4B48 A;  3DWL E;  3WQZ A;  1KTW A;  4F3Q A;  4J00 A;  2PJR A;  4E7J A;  1DQU A;  4XKB A;  2ZXH A;  2XF5 A;  2VQL A;  4CCL A;  3OOC A;  1PLU A;  4C30 A;  2M4G A;  4LIV A;  4BE0 A;  1NBM A;  2NTP A;  3DKX A;  4YEL A;  2UUZ A;  4W8Q A;  2X1C A;  3OL3 A;  2JVH A;  5CQG A;  1WJD A;  1RU4 A;  3VYU B;  3BG6 A;  3CJR B;  4NC7 A;  4CA0 A;  3H94 A;  1D1C A;  3OS1 A;  4BDZ A;  1EE6 A;  1HG8 A;  1O8M A;  4ZC3 A;  1RMG A;  4LG3 A;  2XDV A;  2MD0 A;  3HL2 A;  4YEJ A;  3D5R C;  3EPZ A;  3OWT A;  1XG2 A;  3SUC A;  1HZE A;  3DEE A;  3S3N A;  3EUA A;  2L5Q A;  5KCM A;  3QYB A;  3DDY A;  4HWV A;  1PXZ A;  2QY1 A;  1S9H A;  3ZGK A;  4G6I A;  4B3F X;  1X19 A;  3M1C A;  4QPQ A;  1X1C A;  1R6R A;  1Y6I A;  4NQW B;  5HNF A;  3H5N A;  3HUG B;  2XZO A;  4CCO A;  1I18 A;  2PEC A;  5AMV A;  4NC8 A;  4ASU A;  4BUP A;  1D0Y A;  3S3O A;  3CF2 A;  4XOR A;  2LBF B;  4ZTJ A;  2AQE A;  1T95 A;  3GQB A;  2VBE A;  2PMZ A;  2Z8G A;  2E1M B;  2IS2 A;  4RLF A;  3K4N A;  3H9Q A;  2DT7 B;  1SAU A;  4URR A;  4LIU A;  1Z7L A;  1RWR A;  3SEZ A;  3OR2 C;  2GOM A;  4F92 B;  2XF6 A;  2WJY A;  2V7F A;  4TKO B;  3K4K A;  4OZZ A;  4Y33 A;  3IP4 B;  3VYS B;  4CUG A;  1FX0 A;  4BE2 A;  4XLA A;  4BAC A;  2R7X A;  2JJ2 A;  3WWG A;  3OE7 A;  4C9Y A;  2DIE A;  1IB4 A;  3OIQ A;  1E43 A;  2ZZE A;  1PYV A;  3UR3 C;  4RMN A;  1LKX A;  1JRG A;  1IA5 A;  2DXI A;  4BJ5 C;  3U21 A;  3S3M A;  4PUS A;  4OJL A;  4XN3 A;  2VKH A;  4KT6 A;  4RLQ A;  2CMP A;  4E0F A;  2PYG A;  2CW7 A;  1G59 A;  1K6Y A;  2NT6 A;  1X1D A;  3PUB A;  3OOU A;  2JA2 A;  3MMY B;  3GQ7 A;  4Z06 A;  2DCE A;  2MAB A;  3DKY A;  3KEW A;  2ZXI A;  2M0M A;  3H9J A;  3OYL A;  2JDI A;  2M3A A;  3OYD A;  2PJR B;  4XL9 A;  2AQF A;  4P1W A;  3AL0 B;  1DGR M;  2XF7 A;  2HQA A;  3ZXS A;  3OYN A;  4XKW A;  1BR1 A;  3VR6 A;  1BLI A;  3BCB A;  3A1Y A;  2V9K A;  2HLD A;  1W36 C;  1BHE A;  1QCX A;  2R7W A;  1YX3 A;  5HKK A;  2DJI A;  2R7Q A;  3T9G A;  2Z16 A;  4OWR B;  3OY9 A;  2V4J C;  3EQO A;  4IZZ A;  4XD7 A;  4P22 A;  4R79 A;  4PJJ A;  3LNN A;  2FUG 2;  4YZA A;  1O8J A;  3N05 A;  1BR2 A;  4ZDO A;  2PYH A;  2BW3 A;  2IXS A;  2CFO A;  4MLO A;  3VDX A;  2Z1D A;  3LFU A;  4CCM A;  1UD3 A;  2VJ4 A;  3B90 A;  3G2B A;  4U49 A;  3ZRG A;  1AA7 A;  3CJQ B;  2UVE A;  1O8K A;  2X6X A;  1WJC A;  2K5C A;  3LMW A;  1KCD A;  5FRN A;  2NOJ B;  2VKD A;  3K4B A;  4Y4R A;  2Z6B D;  3UNG C;  4BXF A;  1VZ0 A;  1MMG A;  4CCJ A;  3QOE A;  1DGW Y;  3PJR A;  3H9G A;  2V4D A;  2NTB A;  2HPM A;  4MR0 A;  2GOX B;  4AVZ A;  2VQG A;  3AFH A;  1WTH D;  4PSW A;  3RQ4 A;  5LFA A;  4YZX A;  1WMR A;  3EQN A;  2CW8 A;  3HOT A;  4FET A;  3A35 A;  1IRX A;  2GJP A;  4HEA 2;  1G8X A;  3K70 D;  2VPL A;  2ZZQ A;  2BSP A;  4BQQ A;  4J01 A;  3SEQ A;  1O8H A;  2GK6 A;  1E3X A;  4E7Z A;  4E7H A;  2HDW A;  1VF7 A;  4H4K C;  2X85 A;  3V42 A;  2HZD A;  5TGT A;  4CCN A;  2RNG A;  2WBM A;  1I8D A;  4HNU A;  3MKZ A;  4KJZ A;  3BCF A;  2W6J A;  4TT3 A;  4HNT A;  3L2R A;  2NZM A;  1NHC A;  2R7U A;  2M4K A;  1KMH A;  3KEY A;  3SZG A;  1UD8 A;  3W3C A;  3PNT A;  3OYA A;  4II3 A;  1V5E A;  4PFO A;  4JOM A;  1GLN A;  2OC6 A;  4E6K G;  5C1C A;  2XSJ C;  2CS3 A;  4NUB A;  1O8L A;  3QYE A;  3HPH A;  1BR4 A;  4XLE A;  5KHD A;  3RTR A;  5CKT A;  4BQN A;  3S8P A;  2CV2 A;  5C1E A;  3S93 A;  2K3P A;  3D5L A;  3LSI A;  4HG2 A;  1P9Q C;  3HG9 A;  1CZF A;  3GVK A;  2OV7 A;  4ANJ A;  3ZSC A;  3SYT A;  2RRE A;  2X1E A;  4F52 A;  2ZZG A;  2KLO A;  4AYB A;  3BLY A;  4XNF A;  3GQA A;  3NE5 B;  1H80 A;  2VLA A;  4N4O B;  2X53 S;  4GQN A;  1EA3 A;  1MW7 A;  2OUM A;  4XN0 A;  3S32 A;  4B44 A;  3H5R A;  2LZJ A;  4OJ6 A;  4L8J A;  2IGN A;  2GJR A;  2WJV A;  3OW7 A;  4F91 B;  4EW9 A;  3T56 B;  3K4L A;  3OS2 A;  3BC9 A;  1QHG A;  4MXN A;  1TT0 A;  3JU4 A;  1D0X A;  1VLY A;  5JHF A;  4TSF A;  2JUG A;  3MKY B;  3FDY A;  2NST A;  2VBK A;  4D9J A;  4CZC A;  4DNR B;  1OLT A;  4C2U A;  3TMO A;  4U87 A;  2ELJ A;  1EFR A;  4E7I A;  1V5F A;  2LOO A;  2V6E A;  2QX3 A;  4DIQ A;  4PFP A;  2WA0 A;  4D1Q A;  1X1B A;  2XGJ A;  2K9M A;  1JTA A;  2CK3 A;  1HA8 A;  1QJV A;  2MYS A;  2NT9 A;  3KYL A;  3OS0 A;  3DTK A;  3W2A A;  4GRI A;  2VBM A;  1UAA A;  4ZDL A;  3OYE A;  1Z3Y A;  1K5C A;  3BCD A;  2ZFU A;  1OOC A;  2VAS A;  2WY8 Q;  3GVJ A;  3TBI A;  3FBI B;  1FMW A;  1X1A A;  2LY2 A;  1SFK A;  4XLC A;  4U4B A;  1V0F A;  5HVQ C;  2D3N A;  2JIZ A;  5FL7 A;  2LY1 A;  3FKJ A;  2EWE A;  3LSK A;  4IX7 A;  2XZL A;  2WAQ A;  4BGD A;  3PNY A;  2IGK A;  3GBG A;  1HVX A;  2WPD A;  5DN6 A;  3W2W A;  3PNV A;  2F6C A;  4HIZ A;  3H35 A;  4PJL A;  3RSN A;  4PMH A;  3E1S A;  1OFM A;  4BEH A;  2ZTN A;  2ZSI B;  1WPC A;  1WJF A;  4ZYA A;  1KCC A;  2INU A;  2F4I A;  2DOA A;  4BJT A;  2XC7 A;  2M7B A;  1D1A A;  1YX5 A;  4RM3 A;  4OJO A;  2IQ7 A;  3L2W A;  4OJP A;  3CP2 A;  3K4J A;  5CPR B;  2VIX A;  4CSW A;  2QKM B;  3GRH A;  4XM3 A;  3OYM A;  4E7K A;  2IS4 A;  2BVM A;  1D1B A;  2X6Y A;  1O8E A;  1X0C A;  1OFL A;  3VMW A;  4KKU A;  2MC4 A;  4XQF A;  2X51 A;  3AKZ A;  2O5R A;  1U0J A;  2Y0S A;  2NTQ A;  2O04 A;  1COW A;  2LC2 A;  3HXL A;  4DK1 A;  4UZU A;  3F9K A;  2KMU A;  2HVS A;  3OYF A;  3OL4 A;  1Y56 A;  2WZP P;  2W82 A;  4OZY A;  5HOO A;  1MNE A;  4Z1M A;  4C2T A;  2M5S A;  3DLA A;  3D5S C;  4U7B A;  2ZZF A;  1O8I A;  3HKZ A;  4XOP A;  4ZDP A;  2R9V A;  2WY7 Q;  2WSS A;  2O0V A;  1PE9 A;  2O17 A;  3DQV C;  3IUO A;  3C2H A;  3DPT A;  1MMN A;  3BC8 A;  4E4H A;  4JQF A;  3PFY A;  3VYT B;  3CES A;  4B3X A;  3A4C A;  4W8T A;  3K6G A;  4CCK A;  2QXZ A;  3FBN B;  1WJ5 A;  3HOS A;  4BL0 B;  5IK2 A;  3FHN A;  1WJA A;  3K4M A;  4XR6 A;  3IAS 2;  2HPI A;  3LSH A;  4E7L A;  3I9V 2;  2M7A A;  2KHM A;  3LSM A;  2A5W A;  1K28 D;  4OJ5 A;  2LYC A;  2XZP A;  4BU2 A;  4DK0 A;  3CZ6 A;  3KX2 A;  4BS9 A;  1E0E A;  3ZR8 X;  1BOB A;  2E1B A;  4PJM A;  1T0F C;  4OAY A;  4IQJ A;  3KRG A;  3L2U A;  3M8J A;  4HRI A;  2V31 A;  4LIT A;  2O0W A;  2X3H A;  4OAZ A;  2CUJ A;  4PSX A;  2F43 A;  1O88 A;  1QU3 A;  1TZL A;  2QKL B;  3PSF A;  1GQ8 A;  3E0J B;  2KL4 A;  1E79 A;  1H8H A;  3K70 C;  4BEH B;  4QPO A;  3T53 B;  1LVK A;  1AIR A;  3H0D A;  3PSI A;  4C2L A;  4XLH A;  4YZ0 A;  1PKV A;  2UVF A;  2QE7 A;  4FXU A;  3LSG A;  4YXW A;  2Q2E B;  4RM2 A;  1E1R A;  3OYJ A;  2D3L A;  3DU5 A;  1OR7 C;  2P0W A;  4NNJ A;  2L7K A;  4XKV A;  4B47 A;  2ZTG A;  2IGO A;  3DTE A;  4PK4 A;  1MAB A;  3EUK L;  2DT6 A;  4Z03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...