4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
2NTBA 4EW9A 1BN8A 2VJIA 4YZAA 1O8LA 1H80A 3UW0A 5C1CA 4OJLA 2QY1A 3ZSCA 1IDKA 3GQ7A 2O17A 2O0WA 4W8QA 2UVFA 4OZZA 1AIRA 1RMGA 1RWRA 4NK8A 3B90A 1IB4A 2NT9A 4I84A 3SUCA 2VJJA 4OZYA 1IDJA 3FY3A 4XLEA 3GQAA 4XLCA 4PMHA 3GQ9A 1IA5A 2VBMA 1CZFA 1QCXA 3B4NA 1O8IA 4XONA 1O8MA 2NSTA 1GQ8A 2X6XA 2O0VA 2Z8GA 1DBGA 1DBOA 4U49A 1KCCA 1BHEA 3T9GA 5AMVA 4XQFA 4HWVA 4OJOA 1O8FA 2NTQA 2IQ7A 1O8HA 1JRGA 4Z06A 2BSPA 1O8JA 4XL9A 2UVEA 4W8TA 3VMVA 4YELA 4XORA 2EWEA 2QXZA 2VBKA 1OOCA 2NSPA 3B8YA 4XLHA 3VMWA 1OGOX 4XR6A 2VBEA 1RU4A 2QX3A 4YZ0A 4AVZA 1XG2A 1O8KA 2X3HA 3WWGA 1O88A 2NT6A 4XNFA 4OJ5A 2X85A 4MXNA 3JURA 4NK6A 2ODLA 1O8EA 4XLFA 3EQOA 2NTPA 1O8GA 4OJ6A 1WMRA 4XOTA 3VSTA 4W8RA 1OFLA 1JTAA 1EE6A 2NZMA 4Z03A 4XLAA 1O8DA 2INUA 1QJVA 4W8SA 1OGMX 2INVA 3EQNA 4XKWA 5C1EA 1OFMA 2PYGA 3ZPPA 1X0CA 2O1DA 4URRA 4YZXA 3KRGA 4U4BA 1HG8A 4XN0A 4YZQA 4XKVA 4MR0A 2PYHA 3GQ8A 4XM3A 4YEJA 1VBLA 1KTWA 3LMWA 4C2LA 1PE9A 1NHCA 1K5CA 4XMYA 2X6YA 3GRHA 2O04A 4OJPA 4Z05A 2X6WA 4XN3A 2PECA 1PLUA 4XOPA 3VSUA 1KCDA 1PXZA 3VSVA
chains in the Genus database with same CATH superfamily
4LC0A 1G6NA 2OYNA 2K9SA 4BYYA 6PAXA 2OD5A 2CH0A 3GMEA 2WB1N 5JLWA 5F4MA 1PUEE 2QA4I 3LFUA 2V31A 3K4JA 3CB4A 1MGTA 1TWCJ 3CMEI 2CW5A 3QFTA 1U5TB 3CC2B 1IDKA 2KISA 5CPRB 3K7AJ 4D7MA 4QTRA 4X1EA 3VR6A 2R7FA 3B78A 1AIRA 2W85A 1P4AA 2E60A 1UB9A 2F5CA 2WPDA 3PVDA 2XZPA 5CVIA 5EJCA 1HF2A 1YOVB 4IHXA 3JQRA 2FUG2 4FETA 4LIVA 4UY8I 4QLCU 3ERED 2H09A 2LF7A 4OMYA 3E6BA 1G7CA 4PJNA 1VQOI 4E70A 4IRHA 3G71I 1QA3A 4BU2A 1FSEA 3CD6B 2V7UA 2QMUA 1SFUA 1GV2A 3QYEA 3BR3A 1IXCA 5H20A 1IHMA 5CVUA 1WJEA 2GA2A 2Z16A 4D5CA 1ACIA 2MGQA 2JJ2A 2KRCA 5KCMA 1FX0A 3K70D 2PLFA 1DU6A 5AMVA 4V2GA 2MH2A 3KPHA 3REOA 1OR7C 3BTCA 3B6CA 2ESHA 2I5UA 3Q5FA 3G6EI 2DOAA 2QSHX 3T56B 4ETSA 2LP0A 4KMFA 1BIBA 4M74A 2F4OB 5JFRA 4HDUA 2QYOA 3M4OJ 4NBSA 1IF1A 4A3GJ 3IH3A 4AIHA 2NS7A 4PJMA 1PYVA 1XCBA 3JX8A 2PX9A 1T2KA 2YWFA 1Z1DA 2DFIA 1UMKA 4HZFA 5K7ZA 2RQQA 1J59A 1P7JA 1FYKA 4IQJA 1GJRA 2BF4A 3OZUA 2JVGA 1FNBA 3WBJA 3M8JA 4RB0A 4ACBA 5EGOB 3T53B 2BY0A 2E2HJ 2CSOA 2XGDA 1FNMA 4OOSA 5FO1A 4ZTFA 1YTYA 4NCNA 1YYVA 3I56B 2XAHA 5E18F 2D3LA 2KMUA 1QNTA 2YU9J 4KJZA 4C43A 1FOKA 1XGNA 4Z2YA 4ZZLA 1WSUA 1QZZA 2BGIA 3SLDA 4E7IA 5HZBA 4YFOA 4W8SA 4DNTB 1IXSB 1C0WA 1EFCA 1S4MA 1VJSA 4RAYA 5LGUA 3JAMZ 1A35A 2DN0A 4UUTA 4I6ZA 5DTDA 5KAIC 3CJQB 5HNHA 1TYWA 4D0PA 4G1VA 2W4SA 2OZ6A 1ELOA 4G1BA 4IHTA 4Y9RA 2DA2A 3W2HA 4EATA 1GV5A 4BNCA 1LDDA 1PJ5A 2VFOA 3KIOA 4MFEA 2V5IA 2HYJA 4M6VA 1EFRA 4MYTA 4B1RA 1QZYA 3LSJA 4FHTA 3ZUGA 1KJZA 3GRHA 2QDXA 3FIWA 2FOKA 3O3KA 3LA7A 1N0VC 2HTJA 3BQYA 5IYWA 4JOMA 3F8BA 4YAWA 4PZJA 1ZHFA 5LFAA 1XE1A 2VT3A 3RQIA 2HVQA 2P6TA 2F3LA 2VB6A 1YX3A 2EILH 4EMSA 2GA1A 3OS1A 4EGZA 4PFOA 2Y0SN 3HTSB 2Y0MA 2HKOA 3E7LA 1LUJB 5E20A 1L3LA 1DQUA 2VFMA 3F72A 3HOTA 2XOKA 3GQ7A 4HEA2 3ZMZA 4F92B 3QRFF 4RM3A 1NB9A 5DS9A 2M4GA 4EM2A 2Y2ZA 2BVNA 4P2NA 3LSTA 5C4JJ 2DYSH 4C9YA 2EPFA 1V5GA 1I3QJ 1OYWA 3G6EB 3PO3J 2CF4A 1K73D 1MMGA 4K1XA 2ELHA 2EZHA 4ENNA 4QSHA 1VQ4B 2BHYA 1VLYA 5CQGA 1CZFA 2L4MA 2RC5A 4CCJA 2W00A 4OWRB 4JMQA 1G3SA 3MN2A 2DMUA 1DBOA 4AF6A 1L0OC 3DLAA 2VBVA 1WZ2A 4RJLA 1NBMA 4LIUA 4B47A 1YE9A 4HPQA 5D8KB 5J8FA 1WJCA 1NG6A 3OYFA 2YWEA 3FKJA 4LG3A 2R5YB 1IRXA 3PENA 3GVLA 2B7CA 4I7HA 3VEPA 4MIMA 3T5XA 5L3CA 1WTHD 1VZ0A 2CS3A 1WH7A 5EYRA 1RUOA 5ICFA 1LQ1A 1MSFC 3G1MA 1JKOC 1JI8A 2QZAA 3HBLA 2OCEA 4BHCA 2BMWA 2HS5A 4PFPA 2IJLA 1KTVA 3TOAA 2O6GE 3A0HC 2H8WA 2MLKA 3BG5A 3MQ0A 5LBQA 4RGSA 3LSGA 2LKSA 5L46A 5BMZA 3F8NA 1SFXA 3SQVA 4XICA 5GV7A 2XTXA 4Q48A 4M3FA 2KZVA 3PFYA 4W1UA 4XKCA 2QEXI 3BZKA 1I6XA 1DDGA 2FD5A 2VFPA 3CO7C 1XB2A 3ZZTA 3HHHA 5TRDA 3HDDA 1BX0A 3Q9VA 3BCFA 2XPVA 4I99C 3RPUD 4UB6C 1UG2A 4I0BA 2DCUA 2DIEA 3BY2A 2VKHA 3WTWC 1KQ0A 3S1RJ 2DXIA 4M1KA 5KK1A 2V7VA 3WTVC 1JA1A 2EZIA 3DXJF 1O4XA 1RPWA 3A02A 4RB1A 1QVFB 3AG4H 3BC8A 4E7SA 1YHQB 1V55H 1BW5A 2G7HA 1U2RA 3NB2A 1HW5A 4RGRA 2AXTC 4CYCA 2LYCA 3OL4A 2D2WA 3WTSC 2R5ZB 3FMRA 5HODA 1U3EM 4UXNA 1H88C 5IYQA 1K78B 4BS9A 2E1OA 2ZCWA 1ERDA 5D5VB 1FP1D 2A3SA 5IT3A 2M5WA 3HB9A 1EA0A 1KYWA 4UUVA 1VQ9B 3L09A 2D5VA 2TRTA 2PJRA 2MLGA 4GYIA 3QU3A 2V7XA 2XB0X 2PECA 2VT2A 3W2VA 5FO5A 3G4SI 3BWGA 3I59B 4RD3A 4QFMA 1T98A 3GTPJ 4UHTA 3J7ZI 3C3WA 3I55I 3W6JB 3WGHA 2HOAA 1AU7A 2DFEA 5M5WJ 4LLGF 4AU7A 1U6GA 2BVMA 4BXUA 4AD9A 3K10A 3LSPA 2L7MP 3OZVA 3OYEA 4TV7A 4E4HA 1YIJI 3AVTA 1TYUA 2VPRA 1IB4A 2EINH 3BQZA 1I50J 3JAMK 1R1UA 2VBWA 1DDIA 5D5XB 1I1SA 3BR5A 1LM1A 1IA5A 2MFZA 2RDPA 4A0ZA 3OYKA 1PUFA 3NQOA 4AYBN 1YJ9I 1YQAA 5E17F 1NK2P 4B3XA 4BDYA 1SKQA 1W5TA 2DERA 2JUGA 2IT0A 2MG4A 1FT9A 1E63A 2HI3A 2P8TA 2DW4A 3VO1A 3K4KA 1O8FA 2K86A 1MKMA 9ANTA 2VBTA 3HYIA 2ZBVA 4BH9A 2YR2A 2RV8A 3JRGA 2C2WA 2BSPA 4Z06A 3FK7A 1TP4A 3DCFA 4C3HJ 2STWA 3ZOBA 3RZOJ 1QUFA 4GQNA 4RDJA 2O8KA 3JQQA 3H5AA 4XORA 1YIJB 3SEQA 1QO0D 2HPIA 2AHOA 2VLAA 3OS2A 2WSSA 4JBAA 4RS8A 2J5PA 3VMWA 4D1QA 3JTGA 3U6BA 4U9UA 2E7WA 3LSKA 3M9AA 5J35A 4O5VA 2R0QC 4GRIA 2XEXA 3ZMDA 4MHGA 2DT5A 4Y3OA 1EFTA 2H8RA 4Y33A 2R7RA 1W35A 2CYYA 1MIJA 4M71A 4AM3A 5HNFA 2V9VA 3QFSA 3T51B 3RJPA 1AIPA 2K5CA 2COBA 2KLOA 1F1ZA 5J1RA 2OTJI 2RC6A 3AVVA 1N25A 3CCYA 2JA6J 1OGJA 3JURA 2ZNYA 1ETVA 4KH3A 1ON2A 5A2QZ 2WA0A 3CJRB 4DYCA 4P9SA 1N0UA 2WBMA 2W84A 5J3OA 3RKWA 1GO2A 1EE6A 3NARA 4I2OA 1SM4A 1QFZA 4WZEA 3PA1A 3IRRA 3UNGC 1GR1A 2F43A 3FXMA 1OISA 1KZHA 1KYZA 4LK0F 5DM6F 2VNIA 2FE3A 4HX4A 4R71A 1S7OA 2FNAA 3F21A 4X06A 4EJOA 2V26A 3TO7A 2XSJC 1WH5A 3Q6QA 3MFKA 3GIRA 4RGXA 5EEHA 3AAFA 4L9TA 2PI0A 4XRSG 2RC4A 1X4PA 3FXQA 2C77A 2KJBA 4A2UA 5K5OA 1N07A 4MEYF 5IYCJ 3GFLA 2KRFA 1TNTA 1IN8A 2BGJA 2WYRA 4BXFA 4EJWA 1NG7A 4HQMA 4L5IA 2W6JA 2CWEA 5B66C 4R1HA 3WE3A 1JB9A 5IT9K 5DUKA 4E7ZA 3FF5A 2E35A 4QIWN 3OWTA 2AS5F 4CCLA 1T0FC 5GAEJ 3D5LA 1VHOA 4IL6C 2LFBA 3H5RA 5F64A 3DTIA 1WGXA 5E3OA 1GVHA 3FISA 4DNRB 3PSFA 1WFXA 3SZTA 1UCRA 4AUXA 1FZPB 1Y1VJ 1L1IA 4EJTA 1VQ7B 2GXBA 4L0YB 3C2HA 4J00A 1MNEA 1T56A 3PUNA 3FKIJ 2O17A 2ELJA 1WORA 3B6AA 2UZKA 1W36D 4A3JJ 2IP2A 1MBGA 2DEUA 3M3YJ 3LO8A 4ENJA 3ZQQA 3OYJA 2BX6A 2Q2EA 2E71A 3E6MA 3MZ8A 1F43A 2PE3A 3SFIA 2V79A 3FMSA 3HKZA 1FOWA 4HE5A 4HLYA 3FY3A 4XLCA 3A4CA 4IPAA 1XMXA 4DZJA 3BLYA 5E79C 5HVQC 5F4JA 3AVXA 3IKVA 5LLQA 2E36A 5CJ9A 3HGGA 4YFKF 1SAXA 1JXSA 5EDNA 1FJLA 2O0VA 1HKQA 1VQMI 4N0BA 4U7DA 1D3YA 5BSXA 1V5EA 1YW7A 3ZMUA 4HWVA 4OJOA 1G3TA 3RCOA 3BJAA 1BJZA 3KLNA 1VQKI 3CXCB 5K5QA 2F1LA 1GUUA 5DSZA 2E1CA 2O61A 4KIGA 2ZJ2A 3ABTA 4P3IA 2GBYA 2XRNA 2QXZA 4KIFA 1VQLI 1B1BA 3CRZA 3ZC3A 3CDLA 5D5UB 4KN4X 2VL8A 1RU4A 3CMYA 3ABMH 1RKWA 4ZGQB 5ILSA 1MJAA 1S7AA 3OS0A 1UHSA 4HX7A 5FKOA 1ZH5A 5E1ZB 2BY1A 1QUEA 1BR2A 2X3HA 2FA5A 1MZBA 2K02A 2OBPA 3RYRA 4B48A 2LY9A 2M34A 3K69A 4BQOA 4BXXJ 1G59A 3ECOA 1SVMA 1F60A 5J6XA 2XDVA 1CF7A 3ZQFA 2LKPA 3SJMA 2GK6A 3CW2A 1OFLA 2XV4S 2HEOA 2KHMA 4QPOA 5DCMA 2OJED 4UVAA 1X19A 4BJ6C 4L9VA 4OOVA 3ES9A 2BW3A 2LK2A 2F5DA 1CQXA 1QJVA 2JIZA 4ENKA 3CCJI 1Q86D 1BI0A 2BV6A 2BOLA 4ZDOA 4X05A 2ZNZA 5LHHA 2HOEA 2X4HA 3ABLH 5FLXZ 5L3FA 2GOMA 4HDVA 5GPAA 4A6EA 2ZB9A 5F0CA 2IGKA 1OCOH 3EUHA 3GLLA 4FQGA 4XN0A 3OFNA 1BIAA 4PGHA 1ZLKA 2NVUB 1K83J 1E62A 2VBXA 1Y0YA 1ETOA 2GREA 1A8PA 2HYFA 5DCMB 1OB5A 1R5HA 3I4NJ 1BOBA 3LQEA 5FD6A 2IGNA 3R0JA 1YJ9B 3AVWA 3AL0B 3BDDA 4OPSA 1X58A 1JKQC 1OFEA 2G9WA 1K79A 4P3YA 3VSVA 2Q6OA 3ZQHA 2DDBA 3J80Z 3ZRGA 2QTZA 3E6CC 3QFCA 4ACAA 2HWVA 3Q9SA 1WCMJ 4FT8A 4BJ5C 5M5YJ 1EA3A 3HIFA 3P9CA 1D0ZA 1ON1A 2A61A 4G8XA 4M6YA 1S0UA 3V7CA 4GYGA 2L5QA 2B7EA 1VQMB 5JLVC 4UVCA 1X1PA 3CC4I 2BE5F 2Q2EB 1TT5B 1MJBA 1KA8A 3H5NA 1PUFB 1I5ZA 4OAZA 1WVRA 2VJ5A 3CESA 3C2GA 4OP7A 4Y9UA 2NT9A 2WJVA 3A8KA 1BQEA 3LSMA 3PSSA 4Y4RA 2ZZFA 3L2WA 1KU9A 2E1RA 1CGPA 1RR7A 3CP8A 3CUOA 2K9NA 3KCCA 1ZELA 1J2XA 4GO1A 4BHPA 2CJJA 4GXOA 4UNOA 2DA3A 2NPFA 2Y9ZA 1WPCA 3BQJA 4IOAF 4L5JA 4CUGA 2P81A 1TQIA 1ZN2A 4ZYHA 1YLOA 5CVJA 1BHEA 3OYNA 4TMVA 2QKLB 4IEJA 3AGQA 2XIGA 3RTRA 1MRZA 1IO2A 4MLOA 3L2RA 3BH4A 3FJOA 2ISYA 4B4CA 3IAM2 4WXCA 2Q8KA 3RPQA 2Y0SA 5ICCA 2UVEA 1J9ZA 4HYEA 1J5YA 2C6YA 2V1DA 3GVKA 1W0JA 1VQNB 1GDTA 3RQ4A 1DP3A 1G7RA 5AN9A 4WF2A 1V4RA 3H9NA 3WTUC 1R00A 2DU9A 2BY2A 2DOEA 2BXZA 2ZXJA 5FKLA 5H59A 1OGOX 4E7KA 4G7WA 5KNLA 1X1DA 2PJRB 3IH2A 1APLC 3U9GA 1JGSA 1N77A 1FMWA 2LOOA 2QZ8A 2X85A 4D7NA 2ME0A 4PDKA 3TGNA 3E5QA 1I8DA 1RR8C 3B82A 1QH0A 1QA6A 1R5ID 3ZMTA 2UUZA 4FK8A 5LRRA 4X7FA 4I01A 1HC8A 4A3LJ 3FKSA 3BG7A 3ONYA 1WXRA 3D1NI 3C7JA 4I09A 3K4NA 1VQPI 4X8IA 1OJLA 2WY8Q 4XKBA 4RDLA 1HLVA 2A6EF 2QYUA 1LE8A 3KX2A 1UD4A 3PL8A 4KKSA 4PC6A 3FWEA 3HOYJ 3EETA 2IAIA 3ML6A 1FBUA 3GVAA 4LLLA 5C4XJ 1CNFA 4PAAA 3VMFA 4YZXA 2E1NA 4U4BA 2E5ZA 2E1MB 2JJ7A 1Z9CA 1PKVA 1R6RA 3DBHB 5HZAA 5IYBJ 2GQFA 2JZYA 2L01A 4V02C 4XKVA 1JT6A 2IOUG 3J7AO 2Q1ZB 1OMIA 2LVSA 1D0XA 5JLXA 4EJVA 3H9GA 4DIQA 2P4WA 2R7SA 4DYQA 1YS7A 1HA3A 4RDUA 3OYMA 1E1RA 1T95A 1TL8A 2LDUA 4L8JA 5LD2C 2R7XA 4C3IJ 2WAQN 1ZLJA 5M5XJ 4UUSB 1W5SA 1X4OA 1IJWC 4DBRA 4JX6A 1EWYA 1PLUA 5EF6A 2ZBKA 4HW0A 3QPLA 4DQ2A 3VSUA 1JGGA 2HZDA 4EQQA 2QQ9A 2NOGA 4ZZDA 1DG1G 1NTCA 2CUFA 2ZTNA 4NDLA 3SEZA 2XAGA 1K8AD 3RKYA 1KK2A 1JUSA 5HDKA 1R9TJ 1SVOA 2BN4A 2PBIA 3LNQA 4BHBA 4AVPA 1BR1A 3NWTA 1FC3A 5IOZA 1U5TA 2LD5A 4X07A 4A3DJ 4YFXF 2R93J 2V7QA 5JVGF 5D8LB 4HOBA 2A07F 1XS9A 1N8RD 5DN6A 3OEHA 4BE1A 4I84A 2VJJA 3KYDB 2BEOA 3AVYA 1IDJA 3HGYA 3F8FA 1OHHA 2IS2A 4E6KG 2IPQX 2E19A 5IPAA 3CCEI 2WAEA 1BJKA 3HL2A 5GPCA 1XC5A 4F91B 3AL0C 3WY9A 2Z8GA 4S05A 3I0TA 3VNUA 2QGGA 3WU0A 2BYVE 3GEZA 4U87A 4ZC3A 3ZQCA 3FXLA 3PIPF 1VQOB 2XTWA 1UHWA 2X53S 4OM9A 4ZDPA 2M0MA 5E6TA 2AQFA 1M1EB 2L7ZA 3A3GA 2VKVA 2L9NA 5FLXK 2PJPA 3SJZA 1DU0A 1A31A 2DJIA 3I59A 2EQRA 4TMZA 4LD5A 3E6DA 1VF7A 1BC8C 3O2PE 3CCSB 5L3DA 1D1CA 5HDNA 2VBKA 3HTUA 2R5YA 1FOXA 4C30A 3K4LA 5ILVA 2N8GA 4BE0A 5F08A 1BL0A 3RI4A 1SVLA 1K6OA 1BOAA 2CQNA 1P4WA 2P0WA 2JPBA 2V4JC 1FNNA 4HSTA 3OW2B 2Y48A 3HOXJ 2C5HA 1MH3A 3K1NA 4AYBA 4EGYA 2CBXA 3QSYA 1TTYA 1YRNB 1J9IA 2VNJA 2BM5A 2CQ7A 2L9VA 2XAJA 1SFOJ 2K27A 2X1EA 3LNNA 3ONQA 2HYGD 1H9GA 1Q1HA 3MKLA 2IS1A 2O5RA 2KIFA 2QKMB 5J1UA 2JQ7A 4HNTA 4L5EA 2ZMEC 4RLQA 2Y30A 1BM9A 2XSDC 3H9QA 3QPHA 2E2JJ 4CSWA 3GUDA 1EP1B 3CMAI 3I55B 5F0FA 4ZYDA 2RQPA 1T0FA 2QE7A 4R79A 5D6EA 1QRYA 2JN6A 1I1GA 2VXDA 2MABA 5ICEA 3ZPPA 3WNDA 2M1BA 1FIAA 2O1DA 2JN9A 4MQVA 3P4GA 1LJ9A 3JREA 4U7BA 2H94A 5BOXA 5J8CA 2PMHA 5FB2A 1U9OA 3MEXA 4Q4ZF 4TMWA 2E1MC 1HQCA 4HV5A 4UUSA 3EDPA 2VE8A 5CLSA 2OBTA 5F4OA 3OSGA 3M8FA 1SMTA 2X1DA 3BR0A 1LEBA 1ZG1A 3CD6I 4Z4ZA 2XHKA 4QV2A 1WSRA 4ITVA 4CICA 4Z05A 2P7CB 4XN3A 3S2HJ 3LSHA 3OIQA 3EPZA 1GT0C 4MTDA 3BG6A 5F1RA 1T6YA 3MHPA 2L7FP 4M72A 4GGGA 1T5EA 3ZBUA 2VJIA 5CYVA 2NNNA 2JK3A 5FD5A 2QQBA 4MYUA 2RN7A 1LEAA 4IHYA 2QY1A 2PIAA 1MBFA 5JMCB 3L7WA 3ESWB 3FM3A 3OP1A 1FY7A 3NE5B 4FE7A 5EZHA 1R1TA 3CUQA 3DLLF 1W34A 4YIFA 1E1QA 2VQHA 1RMGA 5IYPA 1ZRCA 2ZO4A 2F5FA 1HA8A 3QYFA 3S1QJ 1Z7UA 4ASUA 4NHJA 2MD5A 3E20A 2XRLA 3BTJA 3PUBA 3AKZA 2CQXA 1D1NA 2VFQA 1EH8A 1E79A 1Z05A 1FLIA 2VBMA 3M1CA 4DK0A 4LB5A 3K4MA 4OPWA 2V7FA 1LPQA 5H6RA 3E3VA 5DCFA 2KDOA 2WZPP 2MW8A 2CRVA 4KKTA 2HQ5A 3MZHA 1I18A 4U49A 3R6KA 3T8TA 3DBLB 3S3MA 1Q9SA 2XB5A 3CUQB 5THXA 3ISPA 4NUBA 2F48A 4N4OB 4BKXA 1B72A 5EEAA 1O8HA 2FBIA 1LKXA 3SZPA 1TW3A 1B6AA 4ZDLA 3SHFA 4F7ZA 2MYSA 3QP5A 2FSWA 3GFJA 3CCUB 3TMOA 2KKOA 2DO7A 2C5BA 2P7VB 4TT3A 3PNVA 3ERMA 4MTEA 2ETHA 1OCPA 5GV8A 4YZ0A 1MNDA 3T8RA 1YI2B 3GZ5A 2WWYA 2BM1A 4E7HA 1BLIA 2VONA 1ZG5A 1O3QA 1MDMA 3OKXA 1TNSA 2DK5A 3W2WA 3LSRA 4CZZA 3ZP5A 3Q0UA 1YJWB 5F0HA 1G3WA 4B09A 1QBJA 3DEEA 3HOSA 4HQEA 1MJ9A 2EWNA 4BEHB 1WJ5A 2K85A 3A8IA 3TDZC 2HDWA 3PA2A 4NK6A 4II3A 5IYDJ 2NTPA 3EQOA 4OJ6A 1FBQA 3GZNB 3PO2J 5DM7F 3QQAA 2HVRA 3FXKA 2IBDA 4OIRF 4ANJA 3ASRA 3VSTA 1JHHA 4MNUA 2GM4A 2BHZA 1FMVA 2JA5J 1BPLA 3IC7A 2V1XA 3LOCA 1G7TA 4N9IA 4N9HA 1YO5C 5FL7A 4Z03A 2K9LA 1FWZA 4D5FA 4DOZA 3H92A 3CCLB 3ZGKA 5BPDA 1Y8QB 3TL4X 2QF7A 1WJDA 2BZTA 2OCCH 4EH1A 1RETA 4MEXF 1Z6TA 3TP0A 2A6TA 5B5EC 3R61A 3DU1X 4RA2A 4URRA 1WI3A 2ZBUA 1R36A 3LWFA 4FTHA 3CCJB 3O8HA 3JR9A 2VC1A 3LA2A 4XK4A 2H6BA 3OIOA 1HF0A 2XC1A 2DQRA 1FTZA 5DYMA 4DJAA 4Y7CA 3JRFA 1VBLA 2AQEA 2K9QA 3FHNA 1TLHB 2X6YA 3IKTA 2X6WA 3LSIA 5TJJA 5DD4A 1HSJA 2A5YB 5D4SA 3CC7I 1WOPA 3L2QA 3CJNA 3KP6A 4G94A 3KETA 1F4KA 1QZEA 2RAEA 3LMMA 3M8EA 3ZCOA 4Z4YA 1WQ2A 3L1PA 1TTTA 1S5LC 3OYLA 2NS8A 2JRTA 3GYHX 1K7AA 1POGA 1PP8F 1OCTC 1XD7A 4BY7J 3CCRB 1DGRM 1JHFA 2R92J 3UR3C 1RI7A 2PG4A 1GXQA 1USTA 1XGSA 2BW3B 4HF0A 4XLPF 1PDNC 3WU2C 3CCSI 1YIOA 4UZFA 4W8QA 2O0YA 4FX4A 1RQRA 3IP4B 1JJ8C 3W2GA 1EH7A 5AONA 2ZL7A 4BE2A 3OSFA 5IK2A 4DGWB 2XZLA 1A04A 1UZCA 4IQ4A 4JQFA 1IN4A 4RBOA 2EA2A 1FP2A 2IA2A 2ZL5A 2QTLA 1IUFA 3FXOA 2W7ZA 1NHAA 3ECHA 3H3ZA 3HOVJ 3V7RA 1U78A 3S1MJ 2FMYA 3DEWA 5E8GA 4X7DA 2R4GA 4W97A 4MFDA 5CQEA 5HLIA 4BACA 1EJ9A 1BBYA 1S72B 2V9PA 2EV6A 1R1VA 4XQFA 2VBZA 4RAZA 4F52A 1ZM9A 4YAOA 2YU3A 4C2TA 1GVJA 1OFDA 2Z3YA 4LBWA 2Z5UA 1JRGA 4CA0A 4Z6YA 2VC0A 2IW5A 1W7PD 1VQ8I 2Z9OA 4C0SA 4LJZF 3SFZA 3OOUA 2X1CA 4GCVA 2VUMJ 1MH4A 3KFWX 1JUMA 1O7LA 2CUEA 2LH9A 1DPUA 1RQPA 1WOOA 4QHYA 1IRGA 3N90A 4G6QA 3OYBA 1T6ZA 2UV1A 1R4MB 4HBLA 4A93J 3J81k 5LGNA 3ZBTA 4JK1X 4P55A 1N75A 4KIBA 1Z77A 1ZG3A 4IF4A 1QPIA 5F1JA 2CV2A 2R7ZJ 2GIVA 4YIRX 1GAQA 2E1BA 2FQ4A 2VASA 1K4ZA 4NNJA 2KIQA 5BQTA 3RSNA 4FN5A 5AIQA 3DFGA 1KC8D 4HRIA 1O8GA 2K9MA 4NC6A 3DU6A 3I64A 1YJWI 1DABA 2KIUA 2VBUA 1VQ9I 3F22A 3HC7A 1IJEA 3R6JA 4BBRJ 3JTHA 2M2EA 3BG3A 3WGIA 1ZQ3P 1EH6A 2LRDA 5FJ8J 2FBHA 4Z1MA 2O6WA 5IOYA 2ZKZA 2NVQJ 4RD0A 1Z6RA 2HOSA 1JA0A 3R0AA 5BS6A 3OZWA 4N4NB 2XKOA 1KQ8A 2HLDA 3LQQA 2WAFA 1H8EA 3QWLA 3GCMA 2LZJA 1GLNA 1R22A 1MD0A 3J81Z 2CV1A 3OYDA 1H8HA 4BBSJ 2FVGA 1F9NA 4WK8F 4EM0B 3GQAA 3W2IA 2QQAA 3B8HA 1ZREA 3SZEA 4FE4A 4PJJA 1OYIA 4RDKA 4B3GA 1IGNA 4D9JA 1COWA 3HRMA 3KP4A 2Q6LA 2WR8A 4XM3A 5EG0B 1Q7YD 1B59A 3GQ8A 3VYUB 3WE2A 1KTWA 1PE9A 3FPPA 3S17J 4OAYA 2STTA 4LLNA 1LLZA 1G3YA 2GOXB 4AIKA 4RPBA 3A03A 4YFNF 2K4JA 3GVJA 1VQ6B 1DPRA 1QVGB 3SXYA 1BN8A 2RREA 1I3AA 4YC5A 1QGPA 1SD7A 4QVAA 1CLWA 2HNHA 1O57A 3QPTA 1PP7U 4YZAA 1IV8A 1KQSB 3E1SA 2AHQA 5C1CA 2V1NA 2WAQA 1XDSA 3V42A 5IY5H 4A3MJ 2DPUA 4BY1J 2R5ZA 4GDFA 2VPLA 2FX3A 5J4VA 2TDXA 4G7OF 4TMTA 1RKTA 4P5OA 1T08B 2R3SA 3KEOA 4G7ZF 2F4IA 2W48A 3UKGA 2UVFA 2BVLA 3H9JA 4NK8A 2NXNB 1B9MA 3GTKJ 2W82A 3QU6A 3VOEA 4PUSA 1ZR4A 3OYIA 3SUCA 2YX4A 1IG7A 1LVKA 4RAFA 2E5NA 2EB7A 3S15J 1ORKA 3B4NA 2A5WA 1ZAOA 2Y75A 2DT6A 2LREA 2FJ1A 2XF7A 3WG9A 1KMHA 4P26A 1GQ8A 1AOYA 3WODF 1DBGA 3SY2A 4YCQA 4LK1F 1TUIA 1S7EA 3WBKA 3H0GJ 3WYAA 2CFOA 3W5HA 4DK1A 4PSWA 2M8GX 5TGTA 4EVIA 1DDNA 1E0EA 2R7QA 1Q82D 1R5OA 5GAGJ 2DPDA 3GXOA 1QVUA 2DA6A 1Z91A 2OC6A 4O3MA 1AWCA 3V7SA 4W8TA 3J7AY 2GJKA 3AGPA 2QQ8A 2QWWA 1LFUP 1G4DA 2WV0A 2QENA 1SFKA 4HF2A 3GTQJ 1U9NA 3PQJA 2KT0A 2ICWG 2KIMA 2KJCA 3CMAB 4BDZA 3O6BB 4HX8A 2P5VA 1WJBA 2D45A 1W2BB 3DEUA 5J40A 1ZGJA 2R9VA 4DZPA 2IGOA 2IGMA 3CZ6A 3KLOA 4Z4RA 2JSCA 4V19K 2JDIA 1Y0NA 2Z33A 1Z0XA 2ZXWH 2PQ8A 3DF8A 3CF2A 3JU4A 1QU3A 1HDDC 1XQBA 4G12A 1B8IB 2LY1A 2W25A 1XTAA 3C2BA 5BNGA 4BJTA 2JA2A 1CNEA 2LY2A 4ZCLA 2XNCA 1E17A 2CW8A 2CU7A 4WWVA 1OKRA 1TC3C 2X48A 3R4KA 3LVBA 3HJEA 2M0CA 2EZKA 4HSRA 2F5VA 4NBQA 4A3FJ 2ZTGA 5E8IA 1JKPC 4XRSA 1NJID 2L9RA 4EV0A 2OTLB 1LVAA 2RGVA 3Q3SA 2DLLA 2CG4A 3FPKA 2XGJA 4HIZA 1W5CC 3BT9A 3H94A 3ASQA 3GQBA 2WTEA 1RRJA 1H9TA 2XPWA 4P6YA 3A01A 2MD0A 3CLOA 1ZYRF 3BNWA 1W7PA 1VQPB 3GO5A 3E1YE 4ZV4A 2PYHA 1Y0UA 1EKEA 3T1BA 3LMWA 2LG4A 1W36C 3ROUA 3KEQA 1P92A 1HCRA 2Y69H 3PIOF 3ISXA 2JTVA 2ELKA 4ZCIA 2ME6A 4UAJA 2C4TA 3OYAA 5EMNA 4Z4UA 2VFNA 1QGZA 4YEIA 3TW6A 1B23P 2NTBA 2R7OA 4EW9A 3JSPA 4P1VA 1ZKGA 3DWLE 1Y6IA 4A3IJ 3MVPA 3QOPA 2XGEA 2LF8A 1V3FA 3K0LA 1U8BA 3MKZA 1JTYA 4QVJA 1P6RA 5C44J 1WWXA 2LR8A 4Q47A 4A6DA 3PUFA 4YIIA 3DKYA 1T8IA 3QE2A 3V76A 4U0WA 1WI9A 4KITB 1SEUA 4N3GA 1VF9A 2O8XA 1M1KD 2HZTA 4PJLA 3FMQA 3BH6B 4OZYA 1N78A 3J80K 3ZQ7A 3HRTA 2AO9A 3KYLA 1XSDA 2QM3A 2UXXA 4G9YA 1KQ5A 3GTLJ 3TH0A 1XX5A 1JKRC 1O8IA 3SDBA 4XONA 2F4NA 4XD7A 1O8MA 2NSTA 1Z3YA 4M73A 2EFWA 3EYIA 1PJ6A 5KVRA 3BY6A 4BL0B 4JX5A 3OJXA 3HRUA 2CW7A 1R49A 1IAWA 1BR4A 5KW9A 3HPHA 3EUKL 5E1XA 1OB0A 2WB1A 2GXGA 1STZA 3K2ZA 1UD8A 4PABA 3LFKA 1J7KA 4EEFG 4IZZA 3BPVA 1IZ1A 4OIOF 4NQWB 2ZSHB 3WG7H 1DP7P 3SQNA 4CYDA 4C2MJ 2KZGA 4LBZA 2LNBA 2LKXA 2QBYB 3RPUA 3W6VA 4YAUA 2XTYA 2DMQA 3TP3A 3JRBA 3OR2C 1BC7C 1MMAA 1Z3XA 1XCVA 2DOFA 4XR6A 3S93A 3GF2A 2H6CA 3LAJA 1H0MA 1W9XA 2V4DA 4CGZA 1W0KA 4M2LA 1IDYA 2Z2SB 1YW8A 4R8HA 1D5YA 3OAAA 2L54A 3GWZA 4HV6A 3BOQA 4I76A 2KRHA 2M3AA 2XVCA 2EH3A 3HPGA 1K6YA 1P4XA 1QQIA 1XB4A 3KP3A 5CVVA 2B0RA 5EG0A 2CQQA 4P1WA 4M9SA 3SZGA 1WMRA 2W24A 1K61A 3LA3A 4XOTA 2D1VA 2IVMA 1ITYA 3GBGA 3F8MA 3QP6A 3H3UA 2QSGX 1OGIA 3CCVB 3VYSB 2HOTA 5H2FC 1KRHA 1BI3A 5J4YA 1UHMA 3OV8A 4ABZA 3ZMVA 3MKYB 4RPDA 5E1WA 4P9UA 1RNLA 3BZCA 5DUIA 4L18B 3IL2A 1V5VA 1WP6A 4IX7A 4M9XA 3HOWJ 1BI2A 1DUXC 1USSA 2X9DA 1EP2B 2K4BA 2KQRA 2VBYA 2YUSA 2DODA 1CF7B 2WY7Q 1Z21A 2WADA 2I8DA 3CCRI 2W7NA 1HDPA 4B44A 2OBRA 3I56I 2M8EA 2H1LA 3M7GA 1SD5A 4E7JA 1MDMB 2DBBA 3HXLA 2O04A 1UJ8A 4YALA 1T6SA 3KE2A 4XOPA 4OMZA 4A0YA 1GHCA 2OTLI 4IHSA 1YITB 3MMYB 4L9NA 2XAQA 4RGUA 4XLNF 2DMPA 2HKXA 2GAUA 4RLZA 1ZTRA 2M7AA 1H80A 2V6CA 4YXWA 2J8IA 2EBIA 4PCQA 3LAPA 3CC4B 3MD2A 1TBXA 3LQ6A 2P3MA 2ZSIB 4PC7A 2QCOA 3NAUA 1WPKA 1ZGAA 2CQKA 4XBFA 2FMLA 5IP6A 4LB6B 2YWGA 4IJAA 1FRNA 2MA3A 3JW4A 2EA4A 2EZLA 3K4CA 4AC0A 5FRNA 2PMZN 2ZFUA 3ABKH 3TOBA 3H35A 3FBIB 4KICA 1ETXA 1IRZA 3GLXA 2OQGA 2D9RA 4LBVA 2OQRA 5IP7J 4M4SA 3HUGA 5E3NA 4PMHA 3CCLI 4I02A 2HXOA 2XROA 2GZWA 1Y39A 1JE8A 2ECBA 1D8TA 1KGSA 3S1NJ 1KQ9A 3V8KA 3U6KA 1QVTA 3ZPLA 3C1DA 3BC9A 4BQAA 5ICGA 1NH3A 1MBHA 1A36A 1E3XA 2NTQA 2FXAA 2XGCA 3BCBA 4M3DA 4EM1A 2IQ7A 4AIDA 1P9QC 1H42A 4A3CJ 3F3XA 1K9MD 4EJUA 2QBYA 2A6HF 3QAHA 2NYXA 2Z1DA 3M07A 4G6TB 1ZGWA 2J5OA 3PNYA 1QG0A 2NVXJ 2IS6A 3Q38A 3I3LA 3WHCA 2H27A 1W1WE 4M53A 2FOWA 2B0LA 5GTIC 1QX4A 3WTYC 1I7PA 2HGCA 1ENHA 2DAOA 3HEFA 3S3OA 4A0XA 1R23A 2QA4B 4OINF 1R71A 1O3TA 2NT6A 3K9TA 3DPTA 1ETYA 3KP5A 4UV8A 2HDDA 1LDJA 1TVCA 5B1AH 4DNCA 2O3FA 2QUFA 2YWHA 2HQNA 2V6EA 1NB0A 5LGTA 4UZUA 5HKKA 1F20A 2VBSA 4MQ9F 1I6HJ 4WXHA 2F6CA 1XMKA 3GTGJ 1JT0A 5KAFC 3BR6A 2CO5A 1HXDA 5B6IA 3NEUA 5JHUA 3FHZA 3KZZA 4A3KJ 1U0JA 2Y31A 1S3JA 4ESJA 1OGMX 3G2BA 5LHGA 1V0FA 2KFDA 5A88A 1VQ6I 2JRMA 4LFUA 2IS4A 2DTZA 4HG2A 2CK3A 4ZCMA 3CJTB 4KA4A 1OFMA 4KMUX 5HOOA 4Y15A 4P25A 2LC2A 2FNPA 4RMNA 2HVSA 4BQQA 2DCEA 3MWMA 5K7HA 3ZQLA 4TKOB 3TQNA 5FA6A 3FXJA 2CW0F 3I71A 3SYTA 2XNDA 2VOPA 2RNGA 4AC9A 2OU2A 2EV0A 1FNDA 2K40A 3VPRA 1PVEA 2I10A 1VTNC 4KNYA 5JI6A 4PJ0C 4WX9A 1QGAA 3ASNH 4L9JA 3PJRA 3AG2H 3AG3H 5TISC 4DBQA 1ZM4A 4P6VF 3PQKA 4KDPA 4KT6A 1PXZA 2CMPA 1ZRDA 3K4BA 1U8RA 3KP2A 2BSAA 1OB2A 4HNVA 3KL9A 3BR1A 2PMZA 3I53A 3WTZA 5JBQA 3ZSCA 2HTSA 4HNUA 5B1BH 2HR3A 5ED4A 2BM7A 1XMAA 2R7TA 5IT9Z 1WJFA 2L0KA 3RKXA 4KFCA 3DV8A 1VQ5B 3D0SA 4XIDA 4IVNA 1QA1A 2EFOA 1D5VA 4ROXA 2CGPA 5GADJ 3CDHA 1VHEA 1OCRH 4A69C 1V54H 2ZJPF 5CVRA 1FEXA 4F7DA 1Q1VA 2OZUA 4G7XA 1LLWA 3GQ9A 3HOUJ 3F6VA 2XASA 4V2FA 3I5UA 4G5GA 3AK5A 3MZYA 2X6XA 2OK7A 3S32A 1UD2A 2GJRA 1O3RA 4K2EA 3DP7A 3L2UA 1X1BA 1LDKB 1P2FA 3S14J 2BGCA 4CCOA 2WZNA 1X2NA 3IAS2 3T9GA 4ZH4F 1JJ6C 3I4MJ 2OTJB 2EIKH 2NOJB 3J81K 1N05A 3PUMA 3DQVC 1QRBA 3COAC 3H36A 1XPXA 2OF7A 1J0RA 4RD4A 2W57A 2FX0A 3VSLA 4WZTA 1B2RA 1E3ZA 1OOCA 4OIPF 3B8YA 3ZN1A 2D74A 4KISA 2QX3A 2HDNB 3AVUA 1KK0A 2VQLA 3O8GA 2FBKA 1D1AA 2HU9A 4LITA 5HDGA 2IRFG 4IHWA 1WDTA 4AWXB 2QN6A 2X8KA 2BM6A 2G7UA 3DDYA 3OE7A 4DQLA 2PMDA 2DETA 1VFCA 2L3DA 1FX7A 1WJAA 2ADUA 3D26A 2DA4A 1PJ7A 2UXNA 3E0JB 1KD1D 5FIUA 1R7JA 3VB2A 1YW9A 5HXBA 1IV6A 4PC2A 1XSVA 1X3UA 3N97A 1T39A 3P5JA 4KUMA 1MMDA 3VYRB 5H6QA 2QGUA 5FGMA 5L3GA 3KP7A 3CQZJ 4XSXF 3RYPA 1H8AC 4L0ZB 4WZKA 3BTLA 3HSRA 3OEEA 2TCTA 1IN6A 2CNDA 1IW7F 2XZOA 1O3SA 3WTTC 3I54A 4LMYA 4ESBA 1HW1A 3EQNA 2VIXA 5FNZA 1YHQI 3I58A 1FYMA 3WNCA 3QOEA 5DS0A 3WTXC 4LBYA 1A6IA 1KU3A 4IOCF 1HKTA 4PGOA 1UMQA 2ID3A 3CF5F 5F04A 4UZEA 3M1EA 2DQLA 3ZPNA 2M4KA 4CCKA 1BN5A 2YPRA 3ASTA 4PC3A 4RM2A 4YEJA 2P5LC 3BCAA 3IH4A 1XGMA 1U5TC 3JRDA 4C2LA 1UELB 2E34A 2HQAA 4XMYA 1OCCH 1N08A 3GZ6A 2WC2A 2OBSA 1EFUA 1MABA 1ETKA 2OV7A 1KCDA 2XF5A 3G1OA 3IUOA 3Q6RA 4ZGNB 1M90D 1ETQA 5K1YA 2DOGA 3TO9A 1MNMC 3A3BA 3S2WA 4RAGA 1E2XA 2M5SA 3E97A 2VKDA 3S2DJ 1O8LA 1NDHA 3W2EA 3DPLC 2XC7A 1YI2I 3A0BC 2A68F 4E0FA 2YX7A 3ZQIA 5LEKA 4P9FA 2ESNA 3CCQI 2G0EA 1HBXG 2O0WA 4CXFA 5TR9A 2X0KA 3CCUI 3ZMSA 3OIPA 3N4MA 3VO2A 1EZGA 3ZZUA 2VJ4A 3JQPA 3B90A 4JRAC 1MMNA 5M3MJ 1A6QA 4LG0B 3WQZA 3J7YJ 5KHDA 4HLXA 4LGWA 4WWCA 2Q6IA 1A5JA 1AA7A 1XFOA 3BR2A 1MW7A 3IRQA 2ZZQA 2D1HA 1F36A 3L00A 4A3BJ 4UVBA 1TWHJ 3FDYA 2MC4A 4NB5A 1TQMA 4M6XA 1Y1WJ 1W87A 1LNWA 2ZXIA 3VDXA 1X3WB 4O6JA 5TY0A 3R6SA 2ID6A 1B4AA 2JPCA 2X51A 2XT4A 4G6DA 2IA1A 3W5VA 3PM1A 4WXDA 1VQ8B 2NNYA 1PJRA 4Y52J 1SMYF 1YS6A 2DFFA 4A12A 5JR3A 2HPMA 4B43A 4OPOA 1TT0A 3P7NA 2XAUA 1HZEA 2L4AA 4XL9A 5IYNA 2LBFB 1O8JA 3OJWA 4G6IA 3H0DA 2NS0A 3IV5A 4TN1A 2IEKA 3W2AA 2EWEA 2M9HA 4IW3B 3I1FA 2QVOA 4Y17A 4CH7A 4NC7A 4ZJZA 4YRVA 3LYCA 2VBEA 2OPTA 3CC2I 2GWRA 3CMEB 4HE6A 2ACJA 1X2MA 1IXRC 3H09A 3FBNB 1O8KA 5JVTA 4C3JJ 3ZIAA 4I98B 3DKWA 2CC2A 2RVCA 2F2EA 5CKTA 3JRHA 4XNFA 5D4RA 1RC9A 3MCZA 2VN2A 2MSYA 1KK3A 1O8EA 2JSPA 1QA2A 3DBRB 2JMWA 1HOMA 2LBFA 2FRHA 3PSZA 2CUZA 1ETWA 4ZYEA 3ZR8X 1FBSA 3WU1B 1OLTA 2NZMA 3PSIA 4XLAA 5DDGA 5FO0A 4H0EA 3BJ6A 3ZZ0A 2ZZEA 4F3QA 2EFQA 3SKBA 2XT2A 3GTJJ 5ILUA 1MBEA 2INVA 4CO8A 5J3LA 3D5SC 3GX4X 5C1EA 2YS9A 4J0QA 1UD5A 2DT7B 3E5UA 2P5KA 2M45A 3KRGA 3CDIA 1P7IA 2LSOA 2DYIA 2ZMEA 4CZCA 2HQRA 5HLGA 1YLFA 3WXMA 3CPWB 4RD1A 3BG9A 5EZGA 2GJPA 3CCQB 2NVYJ 3LL7A 2X3UA 4MR0A 3PETA 2B63J 1FRQA 2F4MB 3CUQC 4HAMA 1JJ2B 2ZJRF 1FDRA 3QYBA 3OW7A 1S9HA 3A01B 1EF4A 1WU8A 3WNBA 1XDUA 5B3SH 3F6OA 3FZVA 2H1KA 1TSPA 1UFMA 4AF7A 3K6GA 5L3BA 2VQCA 3AG1H 2B9SA 1MMSA 2B7BA 1FTTA 3F9KA 2I1LA 2R7WA 3QPSA 2DYRH 3BTIA 3RY8A 3HOZJ 4NC8A 1I27A 2GLOA 1TYXA 2LLKA 2ZL6A 1KZLA 1SD4A 1KK1A 1IC8A 2ZXHA 2HCJB 4JYKA 4C2UA 1LFPA 2J8KA 3OOPA 1VI0A 5C3EJ 2HMAA 2EFGA 1MBJA 4OZZA 1RWRA 1TYVA 3A8JA 2K3PA 2DFHA 2E7XA 1TLLA 4FXUA 1V5FA 1EXMA 4HA8A 3BJOA 5EGOA 2K7LA 3B02A 3W5UA 4BQNA 4P22A 3OYHA 3EUHC 3FX3A 1RUNA 4KN7X 3Q39A 1SANA 4ON0A 2ECCA 2K3FA 2MC3A 3HSFA 4J01A 1AKHA 2XNJA 4M3GA 4Z4VA 1J09A 3EQLF 2JA8J 1E43A 2DA1A 1HW2A 3EUAA 3OYCA 1OPCA 1UAAA 4RB3C 1KCCA 1WRJA 1S29A 5FRMA 2AXLA 1VQLB 4B3FX 2WV1A 4F55A 2F1MA 1I39A 5H5JA 3G1LA 5IP9J 1T6XA 4YAFA 1TW2A 2HXIA 2KDZA 1D8JA 1DGWY 3VMVA 1S6LA 2HFHA 4U0YA 4FWTA 3HM5A 5TV2A 4LOCA 1SC7A 2XKPA 1RIOH 3G73A 1ULYA 2V9KA 4QPQA 4GFBA 1TZLA 2Y9YA 3PFIA 2B5OA 3JCUC 1YX2A 2BM0A 2VNKA 2DTRA 4XLHA 2RKHA 2BXYA 3P9KA 2OA4A 2Z6BD 2DA7A 1O7FA 1G8XA 4AVZA 3T0YA 3WWGA 3FXRA 4XRMA 4RCZA 2EV5A 2BY3A 2R7DA 1IN7A 3DPUA 2XUBA 3W6KB 4MXNA 5GP9A 1R5NA 2ODLA 4B8XA 2XF6A 4XLFA 4A3EJ 1FPQA 2V7WA 1EP3B 3NAWA 1X1AA 2KP6A 1DARA 1W4MA 1MSEC 1FNCA 2EK5A 5L3EA 1MBKA 4ZYGA 3R60A 3BP8A 2GXAA 3CCVI 2V1UA 2VODA 5FKNA 2LTPA 3OY9A 3VFZA 1K78A 2FF4A 1UD6A 2QLZA 1K8FA 2OK8A 1H89C 2ZITA 4XRFA 3RDIA 3GW2A 2R7VA 2VKEA 3ASPA 2BM4A 3TW7A 2Z99A 3Q0VA 1GXPA 4F93B 4G7HF 1VQKB 5FFXA 1D2EA 2VZLA 1QRCA 1QHGA 1AMOA 3OL3A 1YRNA 2ISZA 5F6FA 2GQQA 2L9SA 2PMUA 3HKZN 3OMYA 1VQ7I 3SDGA 3GTOJ 3TBIA 2DY1A 4P12A 3X2QH 5CDFA 1Z67A 4KYWA 3TDUC 4QUZA 4WZLA 2W6IA 4FX0A 1K5CA 3F23A 3K1MA 4DQKA 3U2QA 2M30A 3G71B 2J7KA 5E3LA 3ZN0A 3JSOA 1GAWA 2BBYA 2BPOA 3P27A 1IUYA 3HAGA 2FEZA 5F27A 1T38A 1FYLA 4Y7NJ 3HHGA 3KYCB 1IDZA 4M9ZA 3G3ZA 4Z4SA 2IXSA 3ONUA 3WHBA 1QPMA 2DMNA 2Q0OA 5HLTA 2C78A 2PLYA 4OJLA 1Y8RB 4B3AA 1B9NA 2PEXA 1B72B 3D5RC 3ULQB 1BMFA 1RZ4A 4HF1A 2BV3A 3BCDA 3HRSA 2VNHA 3P26A 3B73A 1OR7A 2F5EA 1OFCX 2JVHA 4M3EA 4CDGA 4X6AJ 1LB2A 2JT1A 1F5TA 2DJNA 4TSFA 5FKKA 1VQ4I 4PSXA 3SJPA 3S8PA 3K70C 1WSVA 3GFMA 2HDCA 1N06A 4OPVA 4XLEA 1AKHB 1T33A 4II2A 4U0VA 2EIXA 1K4TA 2DI3A 1RESA 1X1CA 3ASOH 1S72I 2CRGA 4Q7JB 3RZDJ 1FIPA 1HKSA 5DD8A 2FQ3A 3FXUA 3CPXA 2VI6A 2ZC2A 4N3NA 1E3HA 4H4KC 1ZK8A 3AFHA 5LHIA 4JX4A 1IN5A 4YHBA 2W1OA 5HLHA 3L2CA 4J19A 2KVOA 1BI1A 1Q81D 4H9GA 1QFYA 2V7TA 2R6HA 2CUJA 3C18A 4YELA 4Z4TA 2KL4A 5IYRA 4TMXA 4BAYA 1NHCA 2JWTA 4JP0A 2VYQA 3KZIC 3U1KA 5FLVA 3U21A 3GTMJ 2M7BA 3CMMA 3EYYA 3FM5A 1K4SA 2C4UA 1XG2A 2KPMA 1LFBA 3CO6C 4ENMA 3LJYA 3DTEA 4IRIA 3MKWB 2VOOA 1G2HA 1LE8B 1BX1A 3BY1A 1H85A 1ZR2A 2EIMH 3BPXA 4X0CA 1XGOA 2XAFA 3A2KA 4X7CA 1D8KA 1IRFA 1UD3A 2MBFA 1ZARA 4KT5C 3U2RA 1HVXA 3KEWA 3L2VA 1YJNI 3P9IA 4FISA 5K5RA 3K2AA 3V4GA 3ML3A 1SFEA 3VODA 3MMPA 4CCNA 1JTAA 1CQTA 1W7PB 4RD6A 3A1PA 3DTKA 2X0LA 3OR1C 1WOSA 2JJ1A 4KKUA 1O8DA 2INUA 3I4PA 1OQYA 1VLOA 1R58A 2A69F 2ZMEB 4P96A 5DV5A 5FFZA 5HS7A 1KONA 2YSRA 5J1YA 4LG0A 1YITI 1ZRFA 3HG9A 3G4SB 4UB8C 2VQGA 3IWFA 1FOYA 1BJAA 1X0CA 4OU0A 1W0TA 2L02A 5D5WB 3NRVA 1YFHA 1JNYA 1B8IA 5LMZA 2L7KA 1YG2A 2EFNA 5HS8A 5GAHJ 1SKYB 3BROA 1TWAJ 3OPOA 3N6ZA 3SEJA 5HS9A 2D3NA 4YDTA 1REPC 4Q5SF 3U1DA 3CCEB 2ZJQF 1WKMA 2GK7A 1E3OC 2CV0A 2WJYA 4U88A 4ASNA 2DK8A 3VNVA 5BSYA 2DMTA 3BZ6A 1Y0RA 5M3FJ 1YX5A 2OAZA 3CC7B 3DKXA 3OOCA 4UV9A 4S04A 4PK4A 2UWMA 2A05A 4CCMA 2GPJA 4OIQF 2Q6KA 3TO6A 4ZYAA 3JRCA 3GFIA 4ESFA 5A2QK 3UW0A 3KEYA 4WQMA 5GTHC 4RB2C 1P4MA 1ZM3A 4B4DA 2QSFX 5LEJA 3A35A 1GVDA 1D1BA 1X3ZB 5ERIA 1ZM2A 3G05A 3BH7B 3FK6A 1QFJA 3DU5A 2L2OA 4RM0A 3E5XA 4M3BA 1W0UA 4A5NA 4NQWA 4BPRA 3H1CA 4A5MA 3Q3AA 2ZFWA 4PC1A 3V8JA 1QCXA 1Z7LA 4DYRA 3JRAA 3F0CA 4X7EA 3RIQA 2G0YA 1D0YA 3HUGB 2OUMA 3IWZA 4BEHA 3V8LA 5AIPA 1TWFJ 5E3MA 4MGRA 1K28D 3CLQA 3KZYA 3Q0WA 2E2IJ 5JHFA 1U2WA 5A8AA 4I0AA 3VSKA 3L9FA 3W2FA 3LQRA 4X0GA 4M0LA 1R5BA 2JA7J 3CP2A 3HSEA 3WGGA 2NRAC 3OYGA 1IJFA 2EJRA 3IHUA 4FASD 1VQ5I 1V0EA 1XSXA 3ZQGA 3VWBA 4RCYA 5KSWB 4IO9F 2NSPA 5DNSA 4IRGA 2VE9A 2NV4A 1TWGJ 2O9LA 3MAJA 1S8NA 3S3NA 4OOXA 1XG1A 1WHUA 2PFBA 3ABUA 2COMA 2GIZA 2RNJA 2VXZA 4MO7A 4RLFA 5FKMA 3N05A 2DA5A 1O88A 5FROA 4DW6A 3CCMB 1YJNB 1ODDA 2NAZA 4XSZF 4Z4WA 1OYYA 2M87A 1BW6A 4OJ5A 1KU2A 1E3PA 5EEGA 4S0HB 3CCMI 5A89A 2O03A 1NRKA 1QHHD 3MCAA 2QEXB 3HZJA 3A1YA 3QODA 2P6SA 4W8RA 2YUHA 2CFXA 4ZTJA 5D6FA 4E7LA 4PGGA 1FSHA 1VNDA 3ASSA 2XGXA 4QWQA 4BGDA 2MH9A 1J75A 4YG2F 1OCZH 3ELKA 3NWSA 2EIJH 4CHUA 5K7FA 1ONVA 5LRSA 2FU4A 1Y56A 2O7OA 3V7AA 3TEDA 3ZXSA 1QGYA 1XN7A 4XKWA 2EFPA 3S16J 3GSIA 3RKQA 1R5GA 2PYGA 4IKFA 4CQJA 3W3CA 4AIJA 1TQPA 2JUCA 1E64A 1HSTA 3K1PA 1HG8A 2ZZGA 3CTAA 4YZQA 3VYTB 1EV7A 1ZUNB 1BA5A 2PN6A 4OOIA 3SLNA 2XPUA 2DDAA 4IHVA 1SAUA 1KU7A 3JRIA 2R7UA 4Y13A 3TKYA 5FLMJ 4FCYA 1NK3P 2NVTJ 1G7SA 4IXAA 1IB0A 3QFRA 4WCGA 1SD6A 4CYCB 1UG0A 4OJPA 3F8CA 1R4NB 5DEQA 5J47A 1JTXA 1VQNI 1QQ1A 3PNTA 2LMDA 3RIRA 1JUPA 2IA0A 4BUPA 1AHDP 2X6OA 4RD2A 3H3VK 3I9V2 3SYJA 5BPIA
chains in the Genus database with same CATH topology
3A3BA 3ZRGA 1BN8A 2RREA 2CH0A 2M5SA 2HNHA 4BJ5C 2VKDA 4YZAA 1EA3A 1O8LA 3E1SA 3LFUA 1D0ZA 3DPLC 2XC7A 2V1NA 2WAQA 3K4JA 3V42A 2VPLA 2V31A 4E0FA 2L5QA 1IDKA 5CPRB 2O0WA 4P5OA 2Q2EB 2F4IA 3VR6A 2UVFA 1AIRA 2BVLA 3OIPA 2E60A 3H5NA 2WPDA 4OAZA 2VJ4A 3H9JA 2VJ5A 2XZPA 3CESA 1MMNA 3C2GA 2W82A 3WQZA 2NT9A 4PUSA 2WJVA 3OYIA 3LSMA 5KHDA 4Y4RA 3SUCA 2ZZFA 3L2WA 1LVKA 1AA7A 2FUG2 3CP8A 4FETA 4LIVA 2E5NA 1MW7A 1ZELA 4PJNA 2ZZQA 3B4NA 2A5WA 4BU2A 2DT6A 1WPCA 2LREA 2XF7A 1KMHA 1GQ8A 3QYEA 3FDYA 2MC4A 4CUGA 1DBGA 1WJEA 2ZXIA 2Z16A 3VDXA 2CFOA 2X51A 2KRCA 3OYNA 4PSWA 5KCMA 3K70D 5TGTA 1E0EA 1FX0A 2JJ2A 2QKLB 2R7QA 5AMVA 3RTRA 1OR7C 1PJRA 2HPMA 4MLOA 3L2RA 3BH4A 4B43A 1TT0A 2OC6A 3IAM2 2DOAA 2XAUA 2Y0SA 4XL9A 1HZEA 2LBFB 3J7AY 2GJKA 3T56B 1O8JA 2UVEA 4W8TA 3GVKA 4G6IA 1W0JA 3H0DA 3RQ4A 1DP3A 2EWEA 3W2AA 1SFKA 4PJMA 1PYVA 4CH7A 4BDZA 4NC7A 4ZJZA 4YRVA 1WJBA 1OGOX 2VBEA 4E7KA 2RQQA 3FBNB 5KNLA 2R9VA 4G7WA 2IGOA 2IGMA 3CZ6A 1X1DA 2PJRB 4IQJA 3ZIAA 1O8KA 2JDIA 2JVGA 5CKTA 1N77A 1FMWA 2LOOA 3M8JA 4XNFA 3CF2A 2X85A 3JU4A 1QU3A 1I8DA 3T53B 1O8EA 2JSPA 2LY1A 2LBFA 4BJTA 2JA2A 4ZTFA 2LY2A 2UUZA 2CUZA 2D3LA 2KMUA 2CW8A 4KJZA 3ZR8X 3FKSA 3BG7A 1OLTA 2NZMA 3K4NA 3PSIA 4XLAA 4HSRA 2F5VA 2WY8Q 4XKBA 2ZTGA 4F3QA 2ZZEA 4E7IA 3B90A 4W8SA 4DNTB 2INVA 3D5SC 1VJSA 3KX2A 1UD4A 3PL8A 4KKSA 5C1EA 2XGJA 1UD5A 2DT7B 4HIZA 3H94A 5HNHA 3CJQB 4YZXA 3KRGA 4U4BA 2E5ZA 2E1MB 2W4SA 1PKVA 3GQBA 1R6RA 2MD0A 4XKVA 4EATA 4CZCA 2Q1ZB 4MR0A 1D0XA 1EFRA 2GJPA 3LL7A 3H9GA 4DIQA 2R7SA 2PYHA 3OYMA 1E1RA 3LMWA 1T95A 2LG4A 1W36C 3QYBA 5LD2C 2R7XA 3OW7A 1S9HA 3GRHA 1X4OA 4DBRA 1PLUA 3VSUA 3OYAA 4JOMA 3K6GA 2VQCA 2NTBA 2HZDA 2R7OA 4EW9A 5LFAA 3DWLE 3F9KA 2ZTNA 1Y6IA 2R7WA 2HVQA 3SEZA 2VB6A 1YX3A 4NC8A 3MKZA 3OS1A 4PFOA 1KZLA 1DQUA 2XOKA 2ZXHA 3HOTA 3GQ7A 3DKYA 4C2UA 4HEA2 1BR1A 1LFPA 4F92B 3NWTA 4RM3A 4OZZA 2V7QA 2M4GA 4KITB 1RWRA 2K3PA 5DN6A 3OEHA 4BE1A 4PJLA 4C9YA 4FXUA 4I84A 1V5GA 1V5FA 2VJJA 4OZYA 1N78A 1IDJA 4BQNA 4P22A 3OYHA 1MMGA 3KYLA 3EUHC 1OHHA 2IS2A 4E6KG 1VLYA 5CQGA 1CZFA 1O8IA 4J01A 2WAEA 3SDBA 4XONA 4XD7A 1O8MA 2NSTA 3HL2A 1Z3YA 4CCJA 1J09A 2W00A 4OWRB 4BL0B 4F91B 3AL0C 1E43A 4JMQA 2Z8GA 1DBOA 3EUAA 3OYCA 1UAAA 2CW7A 3DLAA 4U87A 4ZC3A 1KCCA 1NBMA 1BR4A 5FRMA 3HPHA 4LIUA 4B47A 4F55A 3EUKL 2F1MA 1YE9A 4HPQA 2M0MA 4ZDPA 1WJCA 1NG6A 2AQFA 2WB1A 1OB0A 3A3GA 2L9NA 1UD8A 3OYFA 3FKJA 4LG3A 4IZZA 1IRXA 2DJIA 3GVLA 4NQWB 2ZSHB 1DGWY 3VMVA 1WTHD 1VZ0A 2CS3A 2V9KA 4QPQA 1D1CA 1TZLA 2VBKA 1JI8A 4XLHA 3OR2C 4PFPA 1MMAA 4C30A 1Z3XA 3K4LA 4XR6A 3S93A 1W9XA 2V4DA 4BE0A 2Z6BD 4AVZA 1G8XA 1W0KA 2Z2SB 2P0WA 3WWGA 3LSGA 2V4JC 3OAAA 4HSTA 2KRHA 2M3AA 4AYBA 3HPGA 3DPUA 1K6YA 4MXNA 2KZVA 3PFYA 4B3FX 4XKCA 2ODLA 2XF6A 4XLFA 4P1WA 2X1EA 3SZGA 3LNNA 1WMRA 1X1AA 2KP6A 3ONQA 4XOTA 2IS1A 2O5RA 2QKMB 3BCFA 3GBGA 4HNTA 3RPUD 4RLQA 2DIEA 3VYSB 3OY9A 3H9QA 4CSWA 2VKHA 1UD6A 2DXIA 3MKYB 2QE7A 4R79A 2VXDA 2R7VA 3BC8A 4E7SA 2MABA 1WP6A 4IX7A 3ZPPA 2O1DA 4F93B 2KQRA 4U7BA 1QHGA 2LYCA 3OL4A 3OL3A 2WY7Q 1Z21A 2WADA 2I8DA 2L9SA 2W7NA 2E1MC 3OMYA 4BS9A 1ERDA 3TBIA 5CDFA 4DK1A 4B44A 2X1DA 2W6IA 1K5CA 4E7JA 3HXLA 2O04A 4ITVA 2PJRA 4Z05A 4XN3A 2PECA 4XOPA 3LSHA 3OIQA 3W2VA 3HAGA 3EPZA 3MMYB 3BG6A 1T5EA 2IXSA 2VJIA 5C1CA 2M7AA 1H80A 5HLTA 4YXWA 4OJLA 2QY1A 3MD2A 4AU7A 1BMFA 4L8JA 3D5RC 3BCDA 2ZSIB 2BVMA 3NE5B 3K10A 2JVHA 3OYEA 1E1QA 2VQHA 4TSFA 4E4HA 1RMGA 4PSXA 3S8PA 3QYFA 3K70C 1HA8A 1IB4A 4ASUA 3K4CA 5FRNA 2ZFUA 3H35A 3FBIB 3PUBA 3AKZA 4XLEA 3GQAA 1E79A 4PMHA 1IA5A 4II2A 2VBMA 2MFZA 1X1CA 3M1CA 3OYKA 4DK0A 3K4MA 2V7FA 4B3XA 4BDYA 2JUGA 2KDOA 2WZPP 4H4KC 1I18A 4KKTA 4U49A 3AFHA 3BC9A 3S3MA 2W1OA 3K4KA 1O8FA 1E3XA 2NTQA 4NUBA 3BCBA 4N4OB 2IQ7A 2KVOA 1P9QC 1O8HA 1LKXA 2BSPA 4Z06A 2CUJA 4YELA 4ZDLA 4G6TB 2KL4A 2MYSA 2Z1DA 4GQNA 3PNYA 3H5AA 4XORA 3TMOA 2IS6A 3I3LA 3SEQA 2HPIA 2VLAA 3OS2A 2WSSA 4TT3A 3PNVA 3U21A 2M7BA 3VMWA 3CMMA 4D1QA 4YZ0A 1MNDA 3LSKA 1XG2A 4GRIA 2KPMA 4E7HA 3S3OA 1BLIA 3DTEA 4Y3OA 3MKWB 4Y33A 2R7RA 2NT6A 3W2WA 3DPTA 5HNFA 3T51B 3DEEA 2K5CA 2KLOA 3HOSA 3A2KA 3JURA 4BEHB 1WJ5A 4NK6A 2HDWA 1UD3A 4II3A 1HVXA 3EQOA 2NTPA 2V6EA 3KEWA 4OJ6A 2WA0A 3CJRB 3L2VA 2HVRA 4ANJA 3VSTA 2WBMA 4UZUA 5HKKA 1JTAA 1FMVA 2F6CA 4CCNA 1BPLA 5FL7A 1EE6A 3UNGC 4Z03A 2K9LA 3DTKA 4DOZA 2F43A 3OR1C 2JJ1A 4KKUA 1U0JA 1O8DA 3ZGKA 2INUA 3TL4X 1OGMX 3G2BA 1V0FA 1WJDA 1KONA 2V26A 3HG9A 2IS4A 1OFMA 2VQGA 4HG2A 2XSJC 2CK3A 2A6TA 1X0CA 5HOOA 4URRA 2LC2A 4RMNA 2HVSA 4BQQA 2DCEA 4TKOB 1X4PA 2L7KA 1SKYB 2X53S 3SYTA 2XNDA 3OPOA 4DJAA 2D3NA 2RNGA 4BXFA 1VBLA 1NG7A 2W6JA 2AQEA 2GK7A 1VF7A 1NHCA 2CV0A 3FHNA 2WJYA 2X6YA 4E7ZA 3PJRA 2X6WA 3LSIA 3OWTA 4CCLA 1T0FC 3D5LA 1YX5A 4DBQA 3L2QA 3DKXA 3OOCA 4KT6A 1PXZA 3H5RA 2CMPA 2UWMA 3DTIA 3LMMA 4PK4A 3ZCOA 3K4BA 4CCMA 3OYLA 4DNRB 3PSFA 1WFXA 4ZYAA 2PMZA 3UW0A 3KEYA 4NK8A 3ZSCA 4HNUA 1DGRM 3C2HA 4J00A 1MNEA 3UR3C 2O17A 3A35A 2ELJA 2R7TA 1D1BA 1WJFA 2BW3B 1W36D 3G05A 4W8QA 3IP4B 3DU5A 3ZQQA 3OYJA 2L2OA 4BE2A 5IK2A 4DGWB 2XZLA 3HKZA 4JQFA 4IQ4A 3FY3A 4XLCA 3A4CA 3GQ9A 4G7XA 3BLYA 5HVQC 1QCXA 1Z7LA 1D0YA 3HUGB 2OUMA 2X6XA 4BEHA 2O0VA 3S32A 1UD2A 2GJRA 2R4GA 1V5EA 1K28D 5CQEA 3L2UA 1X1BA 5JHFA 1LDKB 4BACA 3VSKA 4CCOA 3IAS2 3T9GA 4XQFA 4HWVA 4OJOA 4F52A 4X0GA 3RCOA 4C2TA 2NOJB 3CP2A 1JRGA 3DQVC 3OYGA 4CA0A 4FASD 3VSLA 3OOUA 3VWBA 1V0EA 2X1CA 2QXZA 1E3ZA 1OOCA 2LH9A 2NSPA 3B8YA 3S3NA 2VL8A 3OYBA 2UV1A 1RU4A 4KISA 2QX3A 3OS0A 2VQLA 2VXZA 4RLFA 2HU9A 1D1AA 4LITA 1N75A 3N05A 1BR2A 2X3HA 2X8KA 5FROA 4B48A 1O88A 3DDYA 2CV2A 2E1BA 3OE7A 2VASA 4OJ5A 4NNJA 4BQOA 3RSNA 1G59A 1WJAA 1NRKA 1QHHD 3E0JB 4HRIA 3A1YA 3QODA 1O8GA 2K9MA 2XDVA 3DU6A 3HC7A 4W8RA 1MMDA 3VYRB 4ZTJA 2GK6A 1OFLA 4E7LA 2KHMA 4QPOA 2LRDA 4BGDA 1X19A 4Z1MA 4BJ6C 3OEEA 2BW3A 3NWSA 1QJVA 2JIZA 2XZOA 1Y56A 4N4NB 1BHEA 2BOLA 3ZXSA 4ZDOA 2HLDA 3EQNA 2VIXA 4XKWA 2WAFA 1H8EA 2LZJA 1GLNA 2GOMA 4IKFA 3QOEA 2PYGA 3W3CA 2CV1A 3OYDA 1H8HA 2IGKA 1HG8A 2ZZGA 4XN0A 3OFNA 3ZPNA 4YZQA 3VYTB 2M4KA 4PJJA 4CCKA 4B3GA 1COWA 4D9JA 3GQ8A 4RM2A 4XM3A 4YEJA 1SAUA 2R7UA 3VYUB 3BCAA 1KTWA 4C2LA 1PE9A 1UELB 2HQAA 4XMYA 1BOBA 3FPPA 1UG0A 2IGNA 4OJPA 4OAYA 3AL0B 1MABA 2GOXB 3PNTA 2OV7A 4BUPA 1KCDA 2XF5A 3IUOA 3GVJA 3I9V2 3VSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTB A;  4EW9 A;  1BN8 A;  2VJI A;  4YZA A;  1O8L A;  1H80 A;  3UW0 A;  5C1C A;  4OJL A;  2QY1 A;  3ZSC A;  1IDK A;  3GQ7 A;  2O17 A;  2O0W A;  4W8Q A;  2UVF A;  4OZZ A;  1AIR A;  1RMG A;  1RWR A;  4NK8 A;  3B90 A;  1IB4 A;  2NT9 A;  4I84 A;  3SUC A;  2VJJ A;  4OZY A;  1IDJ A;  3FY3 A;  4XLE A;  3GQA A;  4XLC A;  4PMH A;  3GQ9 A;  1IA5 A;  2VBM A;  1CZF A;  1QCX A;  3B4N A;  1O8I A;  4XON A;  1O8M A;  2NST A;  1GQ8 A;  2X6X A;  2O0V A;  2Z8G A;  1DBG A;  1DBO A;  4U49 A;  1KCC A;  1BHE A;  3T9G A;  5AMV A;  4XQF A;  4HWV A;  4OJO A;  1O8F A;  2NTQ A;  2IQ7 A;  1O8H A;  1JRG A;  4Z06 A;  2BSP A;  1O8J A;  4XL9 A;  2UVE A;  4W8T A;  3VMV A;  4YEL A;  4XOR A;  2EWE A;  2QXZ A;  2VBK A;  1OOC A;  2NSP A;  3B8Y A;  4XLH A;  3VMW A;  1OGO X;  4XR6 A;  2VBE A;  1RU4 A;  2QX3 A;  4YZ0 A;  4AVZ A;  1XG2 A;  1O8K A;  2X3H A;  3WWG A;  1O88 A;  2NT6 A;  4XNF A;  4OJ5 A;  2X85 A;  4MXN A;  3JUR A;  4NK6 A;  2ODL A;  1O8E A;  4XLF A;  3EQO A;  2NTP A;  1O8G A;  4OJ6 A;  1WMR A;  4XOT A;  3VST A;  4W8R A;  1OFL A;  1JTA A;  1EE6 A;  2NZM A;  4Z03 A;  4XLA A;  1O8D A;  2INU A;  1QJV A;  4W8S A;  1OGM X;  2INV A;  3EQN A;  4XKW A;  5C1E A;  1OFM A;  2PYG A;  3ZPP A;  1X0C A;  2O1D A;  4URR A;  4YZX A;  3KRG A;  4U4B A;  1HG8 A;  4XN0 A;  4YZQ A;  4XKV A;  4MR0 A;  2PYH A;  3GQ8 A;  4XM3 A;  4YEJ A;  1VBL A;  1KTW A;  3LMW A;  4C2L A;  1PE9 A;  1NHC A;  1K5C A;  4XMY A;  2X6Y A;  3GRH A;  2O04 A;  4OJP A;  4Z05 A;  2X6W A;  4XN3 A;  2PEC A;  1PLU A;  4XOP A;  3VSU A;  1KCD A;  1PXZ A;  3VSV A; 
#chains in the Genus database with same CATH topology
 4LC0 A;  1G6N A;  2OYN A;  2K9S A;  4BYY A;  6PAX A;  2OD5 A;  2CH0 A;  3GME A;  2WB1 N;  5JLW A;  5F4M A;  1PUE E;  2QA4 I;  3LFU A;  2V31 A;  3K4J A;  3CB4 A;  1MGT A;  1TWC J;  3CME I;  2CW5 A;  3QFT A;  1U5T B;  3CC2 B;  1IDK A;  2KIS A;  5CPR B;  3K7A J;  4D7M A;  4QTR A;  4X1E A;  3VR6 A;  2R7F A;  3B78 A;  1AIR A;  2W85 A;  1P4A A;  2E60 A;  1UB9 A;  2F5C A;  2WPD A;  3PVD A;  2XZP A;  5CVI A;  5EJC A;  1HF2 A;  1YOV B;  4IHX A;  3JQR A;  2FUG 2;  4FET A;  4LIV A;  4UY8 I;  4QLC U;  3ERE D;  2H09 A;  2LF7 A;  4OMY A;  3E6B A;  1G7C A;  4PJN A;  1VQO I;  4E70 A;  4IRH A;  3G71 I;  1QA3 A;  4BU2 A;  1FSE A;  3CD6 B;  2V7U A;  2QMU A;  1SFU A;  1GV2 A;  3QYE A;  3BR3 A;  1IXC A;  5H20 A;  1IHM A;  5CVU A;  1WJE A;  2GA2 A;  2Z16 A;  4D5C A;  1ACI A;  2MGQ A;  2JJ2 A;  2KRC A;  5KCM A;  1FX0 A;  3K70 D;  2PLF A;  1DU6 A;  5AMV A;  4V2G A;  2MH2 A;  3KPH A;  3REO A;  1OR7 C;  3BTC A;  3B6C A;  2ESH A;  2I5U A;  3Q5F A;  3G6E I;  2DOA A;  2QSH X;  3T56 B;  4ETS A;  2LP0 A;  4KMF A;  1BIB A;  4M74 A;  2F4O B;  5JFR A;  4HDU A;  2QYO A;  3M4O J;  4NBS A;  1IF1 A;  4A3G J;  3IH3 A;  4AIH A;  2NS7 A;  4PJM A;  1PYV A;  1XCB A;  3JX8 A;  2PX9 A;  1T2K A;  2YWF A;  1Z1D A;  2DFI A;  1UMK A;  4HZF A;  5K7Z A;  2RQQ A;  1J59 A;  1P7J A;  1FYK A;  4IQJ A;  1GJR A;  2BF4 A;  3OZU A;  2JVG A;  1FNB A;  3WBJ A;  3M8J A;  4RB0 A;  4ACB A;  5EGO B;  3T53 B;  2BY0 A;  2E2H J;  2CSO A;  2XGD A;  1FNM A;  4OOS A;  5FO1 A;  4ZTF A;  1YTY A;  4NCN A;  1YYV A;  3I56 B;  2XAH A;  5E18 F;  2D3L A;  2KMU A;  1QNT A;  2YU9 J;  4KJZ A;  4C43 A;  1FOK A;  1XGN A;  4Z2Y A;  4ZZL A;  1WSU A;  1QZZ A;  2BGI A;  3SLD A;  4E7I A;  5HZB A;  4YFO A;  4W8S A;  4DNT B;  1IXS B;  1C0W A;  1EFC A;  1S4M A;  1VJS A;  4RAY A;  5LGU A;  3JAM Z;  1A35 A;  2DN0 A;  4UUT A;  4I6Z A;  5DTD A;  5KAI C;  3CJQ B;  5HNH A;  1TYW A;  4D0P A;  4G1V A;  2W4S A;  2OZ6 A;  1ELO A;  4G1B A;  4IHT A;  4Y9R A;  2DA2 A;  3W2H A;  4EAT A;  1GV5 A;  4BNC A;  1LDD A;  1PJ5 A;  2VFO A;  3KIO A;  4MFE A;  2V5I A;  2HYJ A;  4M6V A;  1EFR A;  4MYT A;  4B1R A;  1QZY A;  3LSJ A;  4FHT A;  3ZUG A;  1KJZ A;  3GRH A;  2QDX A;  3FIW A;  2FOK A;  3O3K A;  3LA7 A;  1N0V C;  2HTJ A;  3BQY A;  5IYW A;  4JOM A;  3F8B A;  4YAW A;  4PZJ A;  1ZHF A;  5LFA A;  1XE1 A;  2VT3 A;  3RQI A;  2HVQ A;  2P6T A;  2F3L A;  2VB6 A;  1YX3 A;  2EIL H;  4EMS A;  2GA1 A;  3OS1 A;  4EGZ A;  4PFO A;  2Y0S N;  3HTS B;  2Y0M A;  2HKO A;  3E7L A;  1LUJ B;  5E20 A;  1L3L A;  1DQU A;  2VFM A;  3F72 A;  3HOT A;  2XOK A;  3GQ7 A;  4HEA 2;  3ZMZ A;  4F92 B;  3QRF F;  4RM3 A;  1NB9 A;  5DS9 A;  2M4G A;  4EM2 A;  2Y2Z A;  2BVN A;  4P2N A;  3LST A;  5C4J J;  2DYS H;  4C9Y A;  2EPF A;  1V5G A;  1I3Q J;  1OYW A;  3G6E B;  3PO3 J;  2CF4 A;  1K73 D;  1MMG A;  4K1X A;  2ELH A;  2EZH A;  4ENN A;  4QSH A;  1VQ4 B;  2BHY A;  1VLY A;  5CQG A;  1CZF A;  2L4M A;  2RC5 A;  4CCJ A;  2W00 A;  4OWR B;  4JMQ A;  1G3S A;  3MN2 A;  2DMU A;  1DBO A;  4AF6 A;  1L0O C;  3DLA A;  2VBV A;  1WZ2 A;  4RJL A;  1NBM A;  4LIU A;  4B47 A;  1YE9 A;  4HPQ A;  5D8K B;  5J8F A;  1WJC A;  1NG6 A;  3OYF A;  2YWE A;  3FKJ A;  4LG3 A;  2R5Y B;  1IRX A;  3PEN A;  3GVL A;  2B7C A;  4I7H A;  3VEP A;  4MIM A;  3T5X A;  5L3C A;  1WTH D;  1VZ0 A;  2CS3 A;  1WH7 A;  5EYR A;  1RUO A;  5ICF A;  1LQ1 A;  1MSF C;  3G1M A;  1JKO C;  1JI8 A;  2QZA A;  3HBL A;  2OCE A;  4BHC A;  2BMW A;  2HS5 A;  4PFP A;  2IJL A;  1KTV A;  3TOA A;  2O6G E;  3A0H C;  2H8W A;  2MLK A;  3BG5 A;  3MQ0 A;  5LBQ A;  4RGS A;  3LSG A;  2LKS A;  5L46 A;  5BMZ A;  3F8N A;  1SFX A;  3SQV A;  4XIC A;  5GV7 A;  2XTX A;  4Q48 A;  4M3F A;  2KZV A;  3PFY A;  4W1U A;  4XKC A;  2QEX I;  3BZK A;  1I6X A;  1DDG A;  2FD5 A;  2VFP A;  3CO7 C;  1XB2 A;  3ZZT A;  3HHH A;  5TRD A;  3HDD A;  1BX0 A;  3Q9V A;  3BCF A;  2XPV A;  4I99 C;  3RPU D;  4UB6 C;  1UG2 A;  4I0B A;  2DCU A;  2DIE A;  3BY2 A;  2VKH A;  3WTW C;  1KQ0 A;  3S1R J;  2DXI A;  4M1K A;  5KK1 A;  2V7V A;  3WTV C;  1JA1 A;  2EZI A;  3DXJ F;  1O4X A;  1RPW A;  3A02 A;  4RB1 A;  1QVF B;  3AG4 H;  3BC8 A;  4E7S A;  1YHQ B;  1V55 H;  1BW5 A;  2G7H A;  1U2R A;  3NB2 A;  1HW5 A;  4RGR A;  2AXT C;  4CYC A;  2LYC A;  3OL4 A;  2D2W A;  3WTS C;  2R5Z B;  3FMR A;  5HOD A;  1U3E M;  4UXN A;  1H88 C;  5IYQ A;  1K78 B;  4BS9 A;  2E1O A;  2ZCW A;  1ERD A;  5D5V B;  1FP1 D;  2A3S A;  5IT3 A;  2M5W A;  3HB9 A;  1EA0 A;  1KYW A;  4UUV A;  1VQ9 B;  3L09 A;  2D5V A;  2TRT A;  2PJR A;  2MLG A;  4GYI A;  3QU3 A;  2V7X A;  2XB0 X;  2PEC A;  2VT2 A;  3W2V A;  5FO5 A;  3G4S I;  3BWG A;  3I59 B;  4RD3 A;  4QFM A;  1T98 A;  3GTP J;  4UHT A;  3J7Z I;  3C3W A;  3I55 I;  3W6J B;  3WGH A;  2HOA A;  1AU7 A;  2DFE A;  5M5W J;  4LLG F;  4AU7 A;  1U6G A;  2BVM A;  4BXU A;  4AD9 A;  3K10 A;  3LSP A;  2L7M P;  3OZV A;  3OYE A;  4TV7 A;  4E4H A;  1YIJ I;  3AVT A;  1TYU A;  2VPR A;  1IB4 A;  2EIN H;  3BQZ A;  1I50 J;  3JAM K;  1R1U A;  2VBW A;  1DDI A;  5D5X B;  1I1S A;  3BR5 A;  1LM1 A;  1IA5 A;  2MFZ A;  2RDP A;  4A0Z A;  3OYK A;  1PUF A;  3NQO A;  4AYB N;  1YJ9 I;  1YQA A;  5E17 F;  1NK2 P;  4B3X A;  4BDY A;  1SKQ A;  1W5T A;  2DER A;  2JUG A;  2IT0 A;  2MG4 A;  1FT9 A;  1E63 A;  2HI3 A;  2P8T A;  2DW4 A;  3VO1 A;  3K4K A;  1O8F A;  2K86 A;  1MKM A;  9ANT A;  2VBT A;  3HYI A;  2ZBV A;  4BH9 A;  2YR2 A;  2RV8 A;  3JRG A;  2C2W A;  2BSP A;  4Z06 A;  3FK7 A;  1TP4 A;  3DCF A;  4C3H J;  2STW A;  3ZOB A;  3RZO J;  1QUF A;  4GQN A;  4RDJ A;  2O8K A;  3JQQ A;  3H5A A;  4XOR A;  1YIJ B;  3SEQ A;  1QO0 D;  2HPI A;  2AHO A;  2VLA A;  3OS2 A;  2WSS A;  4JBA A;  4RS8 A;  2J5P A;  3VMW A;  4D1Q A;  3JTG A;  3U6B A;  4U9U A;  2E7W A;  3LSK A;  3M9A A;  5J35 A;  4O5V A;  2R0Q C;  4GRI A;  2XEX A;  3ZMD A;  4MHG A;  2DT5 A;  4Y3O A;  1EFT A;  2H8R A;  4Y33 A;  2R7R A;  1W35 A;  2CYY A;  1MIJ A;  4M71 A;  4AM3 A;  5HNF A;  2V9V A;  3QFS A;  3T51 B;  3RJP A;  1AIP A;  2K5C A;  2COB A;  2KLO A;  1F1Z A;  5J1R A;  2OTJ I;  2RC6 A;  3AVV A;  1N25 A;  3CCY A;  2JA6 J;  1OGJ A;  3JUR A;  2ZNY A;  1ETV A;  4KH3 A;  1ON2 A;  5A2Q Z;  2WA0 A;  3CJR B;  4DYC A;  4P9S A;  1N0U A;  2WBM A;  2W84 A;  5J3O A;  3RKW A;  1GO2 A;  1EE6 A;  3NAR A;  4I2O A;  1SM4 A;  1QFZ A;  4WZE A;  3PA1 A;  3IRR A;  3UNG C;  1GR1 A;  2F43 A;  3FXM A;  1OIS A;  1KZH A;  1KYZ A;  4LK0 F;  5DM6 F;  2VNI A;  2FE3 A;  4HX4 A;  4R71 A;  1S7O A;  2FNA A;  3F21 A;  4X06 A;  4EJO A;  2V26 A;  3TO7 A;  2XSJ C;  1WH5 A;  3Q6Q A;  3MFK A;  3GIR A;  4RGX A;  5EEH A;  3AAF A;  4L9T A;  2PI0 A;  4XRS G;  2RC4 A;  1X4P A;  3FXQ A;  2C77 A;  2KJB A;  4A2U A;  5K5O A;  1N07 A;  4MEY F;  5IYC J;  3GFL A;  2KRF A;  1TNT A;  1IN8 A;  2BGJ A;  2WYR A;  4BXF A;  4EJW A;  1NG7 A;  4HQM A;  4L5I A;  2W6J A;  2CWE A;  5B66 C;  4R1H A;  3WE3 A;  1JB9 A;  5IT9 K;  5DUK A;  4E7Z A;  3FF5 A;  2E35 A;  4QIW N;  3OWT A;  2AS5 F;  4CCL A;  1T0F C;  5GAE J;  3D5L A;  1VHO A;  4IL6 C;  2LFB A;  3H5R A;  5F64 A;  3DTI A;  1WGX A;  5E3O A;  1GVH A;  3FIS A;  4DNR B;  3PSF A;  1WFX A;  3SZT A;  1UCR A;  4AUX A;  1FZP B;  1Y1V J;  1L1I A;  4EJT A;  1VQ7 B;  2GXB A;  4L0Y B;  3C2H A;  4J00 A;  1MNE A;  1T56 A;  3PUN A;  3FKI J;  2O17 A;  2ELJ A;  1WOR A;  3B6A A;  2UZK A;  1W36 D;  4A3J J;  2IP2 A;  1MBG A;  2DEU A;  3M3Y J;  3LO8 A;  4ENJ A;  3ZQQ A;  3OYJ A;  2BX6 A;  2Q2E A;  2E71 A;  3E6M A;  3MZ8 A;  1F43 A;  2PE3 A;  3SFI A;  2V79 A;  3FMS A;  3HKZ A;  1FOW A;  4HE5 A;  4HLY A;  3FY3 A;  4XLC A;  3A4C A;  4IPA A;  1XMX A;  4DZJ A;  3BLY A;  5E79 C;  5HVQ C;  5F4J A;  3AVX A;  3IKV A;  5LLQ A;  2E36 A;  5CJ9 A;  3HGG A;  4YFK F;  1SAX A;  1JXS A;  5EDN A;  1FJL A;  2O0V A;  1HKQ A;  1VQM I;  4N0B A;  4U7D A;  1D3Y A;  5BSX A;  1V5E A;  1YW7 A;  3ZMU A;  4HWV A;  4OJO A;  1G3T A;  3RCO A;  3BJA A;  1BJZ A;  3KLN A;  1VQK I;  3CXC B;  5K5Q A;  2F1L A;  1GUU A;  5DSZ A;  2E1C A;  2O61 A;  4KIG A;  2ZJ2 A;  3ABT A;  4P3I A;  2GBY A;  2XRN A;  2QXZ A;  4KIF A;  1VQL I;  1B1B A;  3CRZ A;  3ZC3 A;  3CDL A;  5D5U B;  4KN4 X;  2VL8 A;  1RU4 A;  3CMY A;  3ABM H;  1RKW A;  4ZGQ B;  5ILS A;  1MJA A;  1S7A A;  3OS0 A;  1UHS A;  4HX7 A;  5FKO A;  1ZH5 A;  5E1Z B;  2BY1 A;  1QUE A;  1BR2 A;  2X3H A;  2FA5 A;  1MZB A;  2K02 A;  2OBP A;  3RYR A;  4B48 A;  2LY9 A;  2M34 A;  3K69 A;  4BQO A;  4BXX J;  1G59 A;  3ECO A;  1SVM A;  1F60 A;  5J6X A;  2XDV A;  1CF7 A;  3ZQF A;  2LKP A;  3SJM A;  2GK6 A;  3CW2 A;  1OFL A;  2XV4 S;  2HEO A;  2KHM A;  4QPO A;  5DCM A;  2OJE D;  4UVA A;  1X19 A;  4BJ6 C;  4L9V A;  4OOV A;  3ES9 A;  2BW3 A;  2LK2 A;  2F5D A;  1CQX A;  1QJV A;  2JIZ A;  4ENK A;  3CCJ I;  1Q86 D;  1BI0 A;  2BV6 A;  2BOL A;  4ZDO A;  4X05 A;  2ZNZ A;  5LHH A;  2HOE A;  2X4H A;  3ABL H;  5FLX Z;  5L3F A;  2GOM A;  4HDV A;  5GPA A;  4A6E A;  2ZB9 A;  5F0C A;  2IGK A;  1OCO H;  3EUH A;  3GLL A;  4FQG A;  4XN0 A;  3OFN A;  1BIA A;  4PGH A;  1ZLK A;  2NVU B;  1K83 J;  1E62 A;  2VBX A;  1Y0Y A;  1ETO A;  2GRE A;  1A8P A;  2HYF A;  5DCM B;  1OB5 A;  1R5H A;  3I4N J;  1BOB A;  3LQE A;  5FD6 A;  2IGN A;  3R0J A;  1YJ9 B;  3AVW A;  3AL0 B;  3BDD A;  4OPS A;  1X58 A;  1JKQ C;  1OFE A;  2G9W A;  1K79 A;  4P3Y A;  3VSV A;  2Q6O A;  3ZQH A;  2DDB A;  3J80 Z;  3ZRG A;  2QTZ A;  3E6C C;  3QFC A;  4ACA A;  2HWV A;  3Q9S A;  1WCM J;  4FT8 A;  4BJ5 C;  5M5Y J;  1EA3 A;  3HIF A;  3P9C A;  1D0Z A;  1ON1 A;  2A61 A;  4G8X A;  4M6Y A;  1S0U A;  3V7C A;  4GYG A;  2L5Q A;  2B7E A;  1VQM B;  5JLV C;  4UVC A;  1X1P A;  3CC4 I;  2BE5 F;  2Q2E B;  1TT5 B;  1MJB A;  1KA8 A;  3H5N A;  1PUF B;  1I5Z A;  4OAZ A;  1WVR A;  2VJ5 A;  3CES A;  3C2G A;  4OP7 A;  4Y9U A;  2NT9 A;  2WJV A;  3A8K A;  1BQE A;  3LSM A;  3PSS A;  4Y4R A;  2ZZF A;  3L2W A;  1KU9 A;  2E1R A;  1CGP A;  1RR7 A;  3CP8 A;  3CUO A;  2K9N A;  3KCC A;  1ZEL A;  1J2X A;  4GO1 A;  4BHP A;  2CJJ A;  4GXO A;  4UNO A;  2DA3 A;  2NPF A;  2Y9Z A;  1WPC A;  3BQJ A;  4IOA F;  4L5J A;  4CUG A;  2P81 A;  1TQI A;  1ZN2 A;  4ZYH A;  1YLO A;  5CVJ A;  1BHE A;  3OYN A;  4TMV A;  2QKL B;  4IEJ A;  3AGQ A;  2XIG A;  3RTR A;  1MRZ A;  1IO2 A;  4MLO A;  3L2R A;  3BH4 A;  3FJO A;  2ISY A;  4B4C A;  3IAM 2;  4WXC A;  2Q8K A;  3RPQ A;  2Y0S A;  5ICC A;  2UVE A;  1J9Z A;  4HYE A;  1J5Y A;  2C6Y A;  2V1D A;  3GVK A;  1W0J A;  1VQN B;  1GDT A;  3RQ4 A;  1DP3 A;  1G7R A;  5AN9 A;  4WF2 A;  1V4R A;  3H9N A;  3WTU C;  1R00 A;  2DU9 A;  2BY2 A;  2DOE A;  2BXZ A;  2ZXJ A;  5FKL A;  5H59 A;  1OGO X;  4E7K A;  4G7W A;  5KNL A;  1X1D A;  2PJR B;  3IH2 A;  1APL C;  3U9G A;  1JGS A;  1N77 A;  1FMW A;  2LOO A;  2QZ8 A;  2X85 A;  4D7N A;  2ME0 A;  4PDK A;  3TGN A;  3E5Q A;  1I8D A;  1RR8 C;  3B82 A;  1QH0 A;  1QA6 A;  1R5I D;  3ZMT A;  2UUZ A;  4FK8 A;  5LRR A;  4X7F A;  4I01 A;  1HC8 A;  4A3L J;  3FKS A;  3BG7 A;  3ONY A;  1WXR A;  3D1N I;  3C7J A;  4I09 A;  3K4N A;  1VQP I;  4X8I A;  1OJL A;  2WY8 Q;  4XKB A;  4RDL A;  1HLV A;  2A6E F;  2QYU A;  1LE8 A;  3KX2 A;  1UD4 A;  3PL8 A;  4KKS A;  4PC6 A;  3FWE A;  3HOY J;  3EET A;  2IAI A;  3ML6 A;  1FBU A;  3GVA A;  4LLL A;  5C4X J;  1CNF A;  4PAA A;  3VMF A;  4YZX A;  2E1N A;  4U4B A;  2E5Z A;  2E1M B;  2JJ7 A;  1Z9C A;  1PKV A;  1R6R A;  3DBH B;  5HZA A;  5IYB J;  2GQF A;  2JZY A;  2L01 A;  4V02 C;  4XKV A;  1JT6 A;  2IOU G;  3J7A O;  2Q1Z B;  1OMI A;  2LVS A;  1D0X A;  5JLX A;  4EJV A;  3H9G A;  4DIQ A;  2P4W A;  2R7S A;  4DYQ A;  1YS7 A;  1HA3 A;  4RDU A;  3OYM A;  1E1R A;  1T95 A;  1TL8 A;  2LDU A;  4L8J A;  5LD2 C;  2R7X A;  4C3I J;  2WAQ N;  1ZLJ A;  5M5X J;  4UUS B;  1W5S A;  1X4O A;  1IJW C;  4DBR A;  4JX6 A;  1EWY A;  1PLU A;  5EF6 A;  2ZBK A;  4HW0 A;  3QPL A;  4DQ2 A;  3VSU A;  1JGG A;  2HZD A;  4EQQ A;  2QQ9 A;  2NOG A;  4ZZD A;  1DG1 G;  1NTC A;  2CUF A;  2ZTN A;  4NDL A;  3SEZ A;  2XAG A;  1K8A D;  3RKY A;  1KK2 A;  1JUS A;  5HDK A;  1R9T J;  1SVO A;  2BN4 A;  2PBI A;  3LNQ A;  4BHB A;  4AVP A;  1BR1 A;  3NWT A;  1FC3 A;  5IOZ A;  1U5T A;  2LD5 A;  4X07 A;  4A3D J;  4YFX F;  2R93 J;  2V7Q A;  5JVG F;  5D8L B;  4HOB A;  2A07 F;  1XS9 A;  1N8R D;  5DN6 A;  3OEH A;  4BE1 A;  4I84 A;  2VJJ A;  3KYD B;  2BEO A;  3AVY A;  1IDJ A;  3HGY A;  3F8F A;  1OHH A;  2IS2 A;  4E6K G;  2IPQ X;  2E19 A;  5IPA A;  3CCE I;  2WAE A;  1BJK A;  3HL2 A;  5GPC A;  1XC5 A;  4F91 B;  3AL0 C;  3WY9 A;  2Z8G A;  4S05 A;  3I0T A;  3VNU A;  2QGG A;  3WU0 A;  2BYV E;  3GEZ A;  4U87 A;  4ZC3 A;  3ZQC A;  3FXL A;  3PIP F;  1VQO B;  2XTW A;  1UHW A;  2X53 S;  4OM9 A;  4ZDP A;  2M0M A;  5E6T A;  2AQF A;  1M1E B;  2L7Z A;  3A3G A;  2VKV A;  2L9N A;  5FLX K;  2PJP A;  3SJZ A;  1DU0 A;  1A31 A;  2DJI A;  3I59 A;  2EQR A;  4TMZ A;  4LD5 A;  3E6D A;  1VF7 A;  1BC8 C;  3O2P E;  3CCS B;  5L3D A;  1D1C A;  5HDN A;  2VBK A;  3HTU A;  2R5Y A;  1FOX A;  4C30 A;  3K4L A;  5ILV A;  2N8G A;  4BE0 A;  5F08 A;  1BL0 A;  3RI4 A;  1SVL A;  1K6O A;  1BOA A;  2CQN A;  1P4W A;  2P0W A;  2JPB A;  2V4J C;  1FNN A;  4HST A;  3OW2 B;  2Y48 A;  3HOX J;  2C5H A;  1MH3 A;  3K1N A;  4AYB A;  4EGY A;  2CBX A;  3QSY A;  1TTY A;  1YRN B;  1J9I A;  2VNJ A;  2BM5 A;  2CQ7 A;  2L9V A;  2XAJ A;  1SFO J;  2K27 A;  2X1E A;  3LNN A;  3ONQ A;  2HYG D;  1H9G A;  1Q1H A;  3MKL A;  2IS1 A;  2O5R A;  2KIF A;  2QKM B;  5J1U A;  2JQ7 A;  4HNT A;  4L5E A;  2ZME C;  4RLQ A;  2Y30 A;  1BM9 A;  2XSD C;  3H9Q A;  3QPH A;  2E2J J;  4CSW A;  3GUD A;  1EP1 B;  3CMA I;  3I55 B;  5F0F A;  4ZYD A;  2RQP A;  1T0F A;  2QE7 A;  4R79 A;  5D6E A;  1QRY A;  2JN6 A;  1I1G A;  2VXD A;  2MAB A;  5ICE A;  3ZPP A;  3WND A;  2M1B A;  1FIA A;  2O1D A;  2JN9 A;  4MQV A;  3P4G A;  1LJ9 A;  3JRE A;  4U7B A;  2H94 A;  5BOX A;  5J8C A;  2PMH A;  5FB2 A;  1U9O A;  3MEX A;  4Q4Z F;  4TMW A;  2E1M C;  1HQC A;  4HV5 A;  4UUS A;  3EDP A;  2VE8 A;  5CLS A;  2OBT A;  5F4O A;  3OSG A;  3M8F A;  1SMT A;  2X1D A;  3BR0 A;  1LEB A;  1ZG1 A;  3CD6 I;  4Z4Z A;  2XHK A;  4QV2 A;  1WSR A;  4ITV A;  4CIC A;  4Z05 A;  2P7C B;  4XN3 A;  3S2H J;  3LSH A;  3OIQ A;  3EPZ A;  1GT0 C;  4MTD A;  3BG6 A;  5F1R A;  1T6Y A;  3MHP A;  2L7F P;  4M72 A;  4GGG A;  1T5E A;  3ZBU A;  2VJI A;  5CYV A;  2NNN A;  2JK3 A;  5FD5 A;  2QQB A;  4MYU A;  2RN7 A;  1LEA A;  4IHY A;  2QY1 A;  2PIA A;  1MBF A;  5JMC B;  3L7W A;  3ESW B;  3FM3 A;  3OP1 A;  1FY7 A;  3NE5 B;  4FE7 A;  5EZH A;  1R1T A;  3CUQ A;  3DLL F;  1W34 A;  4YIF A;  1E1Q A;  2VQH A;  1RMG A;  5IYP A;  1ZRC A;  2ZO4 A;  2F5F A;  1HA8 A;  3QYF A;  3S1Q J;  1Z7U A;  4ASU A;  4NHJ A;  2MD5 A;  3E20 A;  2XRL A;  3BTJ A;  3PUB A;  3AKZ A;  2CQX A;  1D1N A;  2VFQ A;  1EH8 A;  1E79 A;  1Z05 A;  1FLI A;  2VBM A;  3M1C A;  4DK0 A;  4LB5 A;  3K4M A;  4OPW A;  2V7F A;  1LPQ A;  5H6R A;  3E3V A;  5DCF A;  2KDO A;  2WZP P;  2MW8 A;  2CRV A;  4KKT A;  2HQ5 A;  3MZH A;  1I18 A;  4U49 A;  3R6K A;  3T8T A;  3DBL B;  3S3M A;  1Q9S A;  2XB5 A;  3CUQ B;  5THX A;  3ISP A;  4NUB A;  2F48 A;  4N4O B;  4BKX A;  1B72 A;  5EEA A;  1O8H A;  2FBI A;  1LKX A;  3SZP A;  1TW3 A;  1B6A A;  4ZDL A;  3SHF A;  4F7Z A;  2MYS A;  3QP5 A;  2FSW A;  3GFJ A;  3CCU B;  3TMO A;  2KKO A;  2DO7 A;  2C5B A;  2P7V B;  4TT3 A;  3PNV A;  3ERM A;  4MTE A;  2ETH A;  1OCP A;  5GV8 A;  4YZ0 A;  1MND A;  3T8R A;  1YI2 B;  3GZ5 A;  2WWY A;  2BM1 A;  4E7H A;  1BLI A;  2VON A;  1ZG5 A;  1O3Q A;  1MDM A;  3OKX A;  1TNS A;  2DK5 A;  3W2W A;  3LSR A;  4CZZ A;  3ZP5 A;  3Q0U A;  1YJW B;  5F0H A;  1G3W A;  4B09 A;  1QBJ A;  3DEE A;  3HOS A;  4HQE A;  1MJ9 A;  2EWN A;  4BEH B;  1WJ5 A;  2K85 A;  3A8I A;  3TDZ C;  2HDW A;  3PA2 A;  4NK6 A;  4II3 A;  5IYD J;  2NTP A;  3EQO A;  4OJ6 A;  1FBQ A;  3GZN B;  3PO2 J;  5DM7 F;  3QQA A;  2HVR A;  3FXK A;  2IBD A;  4OIR F;  4ANJ A;  3ASR A;  3VST A;  1JHH A;  4MNU A;  2GM4 A;  2BHZ A;  1FMV A;  2JA5 J;  1BPL A;  3IC7 A;  2V1X A;  3LOC A;  1G7T A;  4N9I A;  4N9H A;  1YO5 C;  5FL7 A;  4Z03 A;  2K9L A;  1FWZ A;  4D5F A;  4DOZ A;  3H92 A;  3CCL B;  3ZGK A;  5BPD A;  1Y8Q B;  3TL4 X;  2QF7 A;  1WJD A;  2BZT A;  2OCC H;  4EH1 A;  1RET A;  4MEX F;  1Z6T A;  3TP0 A;  2A6T A;  5B5E C;  3R61 A;  3DU1 X;  4RA2 A;  4URR A;  1WI3 A;  2ZBU A;  1R36 A;  3LWF A;  4FTH A;  3CCJ B;  3O8H A;  3JR9 A;  2VC1 A;  3LA2 A;  4XK4 A;  2H6B A;  3OIO A;  1HF0 A;  2XC1 A;  2DQR A;  1FTZ A;  5DYM A;  4DJA A;  4Y7C A;  3JRF A;  1VBL A;  2AQE A;  2K9Q A;  3FHN A;  1TLH B;  2X6Y A;  3IKT A;  2X6W A;  3LSI A;  5TJJ A;  5DD4 A;  1HSJ A;  2A5Y B;  5D4S A;  3CC7 I;  1WOP A;  3L2Q A;  3CJN A;  3KP6 A;  4G94 A;  3KET A;  1F4K A;  1QZE A;  2RAE A;  3LMM A;  3M8E A;  3ZCO A;  4Z4Y A;  1WQ2 A;  3L1P A;  1TTT A;  1S5L C;  3OYL A;  2NS8 A;  2JRT A;  3GYH X;  1K7A A;  1POG A;  1PP8 F;  1OCT C;  1XD7 A;  4BY7 J;  3CCR B;  1DGR M;  1JHF A;  2R92 J;  3UR3 C;  1RI7 A;  2PG4 A;  1GXQ A;  1UST A;  1XGS A;  2BW3 B;  4HF0 A;  4XLP F;  1PDN C;  3WU2 C;  3CCS I;  1YIO A;  4UZF A;  4W8Q A;  2O0Y A;  4FX4 A;  1RQR A;  3IP4 B;  1JJ8 C;  3W2G A;  1EH7 A;  5AON A;  2ZL7 A;  4BE2 A;  3OSF A;  5IK2 A;  4DGW B;  2XZL A;  1A04 A;  1UZC A;  4IQ4 A;  4JQF A;  1IN4 A;  4RBO A;  2EA2 A;  1FP2 A;  2IA2 A;  2ZL5 A;  2QTL A;  1IUF A;  3FXO A;  2W7Z A;  1NHA A;  3ECH A;  3H3Z A;  3HOV J;  3V7R A;  1U78 A;  3S1M J;  2FMY A;  3DEW A;  5E8G A;  4X7D A;  2R4G A;  4W97 A;  4MFD A;  5CQE A;  5HLI A;  4BAC A;  1EJ9 A;  1BBY A;  1S72 B;  2V9P A;  2EV6 A;  1R1V A;  4XQF A;  2VBZ A;  4RAZ A;  4F52 A;  1ZM9 A;  4YAO A;  2YU3 A;  4C2T A;  1GVJ A;  1OFD A;  2Z3Y A;  4LBW A;  2Z5U A;  1JRG A;  4CA0 A;  4Z6Y A;  2VC0 A;  2IW5 A;  1W7P D;  1VQ8 I;  2Z9O A;  4C0S A;  4LJZ F;  3SFZ A;  3OOU A;  2X1C A;  4GCV A;  2VUM J;  1MH4 A;  3KFW X;  1JUM A;  1O7L A;  2CUE A;  2LH9 A;  1DPU A;  1RQP A;  1WOO A;  4QHY A;  1IRG A;  3N90 A;  4G6Q A;  3OYB A;  1T6Z A;  2UV1 A;  1R4M B;  4HBL A;  4A93 J;  3J81 k;  5LGN A;  3ZBT A;  4JK1 X;  4P55 A;  1N75 A;  4KIB A;  1Z77 A;  1ZG3 A;  4IF4 A;  1QPI A;  5F1J A;  2CV2 A;  2R7Z J;  2GIV A;  4YIR X;  1GAQ A;  2E1B A;  2FQ4 A;  2VAS A;  1K4Z A;  4NNJ A;  2KIQ A;  5BQT A;  3RSN A;  4FN5 A;  5AIQ A;  3DFG A;  1KC8 D;  4HRI A;  1O8G A;  2K9M A;  4NC6 A;  3DU6 A;  3I64 A;  1YJW I;  1DAB A;  2KIU A;  2VBU A;  1VQ9 I;  3F22 A;  3HC7 A;  1IJE A;  3R6J A;  4BBR J;  3JTH A;  2M2E A;  3BG3 A;  3WGI A;  1ZQ3 P;  1EH6 A;  2LRD A;  5FJ8 J;  2FBH A;  4Z1M A;  2O6W A;  5IOY A;  2ZKZ A;  2NVQ J;  4RD0 A;  1Z6R A;  2HOS A;  1JA0 A;  3R0A A;  5BS6 A;  3OZW A;  4N4N B;  2XKO A;  1KQ8 A;  2HLD A;  3LQQ A;  2WAF A;  1H8E A;  3QWL A;  3GCM A;  2LZJ A;  1GLN A;  1R22 A;  1MD0 A;  3J81 Z;  2CV1 A;  3OYD A;  1H8H A;  4BBS J;  2FVG A;  1F9N A;  4WK8 F;  4EM0 B;  3GQA A;  3W2I A;  2QQA A;  3B8H A;  1ZRE A;  3SZE A;  4FE4 A;  4PJJ A;  1OYI A;  4RDK A;  4B3G A;  1IGN A;  4D9J A;  1COW A;  3HRM A;  3KP4 A;  2Q6L A;  2WR8 A;  4XM3 A;  5EG0 B;  1Q7Y D;  1B59 A;  3GQ8 A;  3VYU B;  3WE2 A;  1KTW A;  1PE9 A;  3FPP A;  3S17 J;  4OAY A;  2STT A;  4LLN A;  1LLZ A;  1G3Y A;  2GOX B;  4AIK A;  4RPB A;  3A03 A;  4YFN F;  2K4J A;  3GVJ A;  1VQ6 B;  1DPR A;  1QVG B;  3SXY A;  1BN8 A;  2RRE A;  1I3A A;  4YC5 A;  1QGP A;  1SD7 A;  4QVA A;  1CLW A;  2HNH A;  1O57 A;  3QPT A;  1PP7 U;  4YZA A;  1IV8 A;  1KQS B;  3E1S A;  2AHQ A;  5C1C A;  2V1N A;  2WAQ A;  1XDS A;  3V42 A;  5IY5 H;  4A3M J;  2DPU A;  4BY1 J;  2R5Z A;  4GDF A;  2VPL A;  2FX3 A;  5J4V A;  2TDX A;  4G7O F;  4TMT A;  1RKT A;  4P5O A;  1T08 B;  2R3S A;  3KEO A;  4G7Z F;  2F4I A;  2W48 A;  3UKG A;  2UVF A;  2BVL A;  3H9J A;  4NK8 A;  2NXN B;  1B9M A;  3GTK J;  2W82 A;  3QU6 A;  3VOE A;  4PUS A;  1ZR4 A;  3OYI A;  3SUC A;  2YX4 A;  1IG7 A;  1LVK A;  4RAF A;  2E5N A;  2EB7 A;  3S15 J;  1ORK A;  3B4N A;  2A5W A;  1ZAO A;  2Y75 A;  2DT6 A;  2LRE A;  2FJ1 A;  2XF7 A;  3WG9 A;  1KMH A;  4P26 A;  1GQ8 A;  1AOY A;  3WOD F;  1DBG A;  3SY2 A;  4YCQ A;  4LK1 F;  1TUI A;  1S7E A;  3WBK A;  3H0G J;  3WYA A;  2CFO A;  3W5H A;  4DK1 A;  4PSW A;  2M8G X;  5TGT A;  4EVI A;  1DDN A;  1E0E A;  2R7Q A;  1Q82 D;  1R5O A;  5GAG J;  2DPD A;  3GXO A;  1QVU A;  2DA6 A;  1Z91 A;  2OC6 A;  4O3M A;  1AWC A;  3V7S A;  4W8T A;  3J7A Y;  2GJK A;  3AGP A;  2QQ8 A;  2QWW A;  1LFU P;  1G4D A;  2WV0 A;  2QEN A;  1SFK A;  4HF2 A;  3GTQ J;  1U9N A;  3PQJ A;  2KT0 A;  2ICW G;  2KIM A;  2KJC A;  3CMA B;  4BDZ A;  3O6B B;  4HX8 A;  2P5V A;  1WJB A;  2D45 A;  1W2B B;  3DEU A;  5J40 A;  1ZGJ A;  2R9V A;  4DZP A;  2IGO A;  2IGM A;  3CZ6 A;  3KLO A;  4Z4R A;  2JSC A;  4V19 K;  2JDI A;  1Y0N A;  2Z33 A;  1Z0X A;  2ZXW H;  2PQ8 A;  3DF8 A;  3CF2 A;  3JU4 A;  1QU3 A;  1HDD C;  1XQB A;  4G12 A;  1B8I B;  2LY1 A;  2W25 A;  1XTA A;  3C2B A;  5BNG A;  4BJT A;  2JA2 A;  1CNE A;  2LY2 A;  4ZCL A;  2XNC A;  1E17 A;  2CW8 A;  2CU7 A;  4WWV A;  1OKR A;  1TC3 C;  2X48 A;  3R4K A;  3LVB A;  3HJE A;  2M0C A;  2EZK A;  4HSR A;  2F5V A;  4NBQ A;  4A3F J;  2ZTG A;  5E8I A;  1JKP C;  4XRS A;  1NJI D;  2L9R A;  4EV0 A;  2OTL B;  1LVA A;  2RGV A;  3Q3S A;  2DLL A;  2CG4 A;  3FPK A;  2XGJ A;  4HIZ A;  1W5C C;  3BT9 A;  3H94 A;  3ASQ A;  3GQB A;  2WTE A;  1RRJ A;  1H9T A;  2XPW A;  4P6Y A;  3A01 A;  2MD0 A;  3CLO A;  1ZYR F;  3BNW A;  1W7P A;  1VQP B;  3GO5 A;  3E1Y E;  4ZV4 A;  2PYH A;  1Y0U A;  1EKE A;  3T1B A;  3LMW A;  2LG4 A;  1W36 C;  3ROU A;  3KEQ A;  1P92 A;  1HCR A;  2Y69 H;  3PIO F;  3ISX A;  2JTV A;  2ELK A;  4ZCI A;  2ME6 A;  4UAJ A;  2C4T A;  3OYA A;  5EMN A;  4Z4U A;  2VFN A;  1QGZ A;  4YEI A;  3TW6 A;  1B23 P;  2NTB A;  2R7O A;  4EW9 A;  3JSP A;  4P1V A;  1ZKG A;  3DWL E;  1Y6I A;  4A3I J;  3MVP A;  3QOP A;  2XGE A;  2LF8 A;  1V3F A;  3K0L A;  1U8B A;  3MKZ A;  1JTY A;  4QVJ A;  1P6R A;  5C44 J;  1WWX A;  2LR8 A;  4Q47 A;  4A6D A;  3PUF A;  4YII A;  3DKY A;  1T8I A;  3QE2 A;  3V76 A;  4U0W A;  1WI9 A;  4KIT B;  1SEU A;  4N3G A;  1VF9 A;  2O8X A;  1M1K D;  2HZT A;  4PJL A;  3FMQ A;  3BH6 B;  4OZY A;  1N78 A;  3J80 K;  3ZQ7 A;  3HRT A;  2AO9 A;  3KYL A;  1XSD A;  2QM3 A;  2UXX A;  4G9Y A;  1KQ5 A;  3GTL J;  3TH0 A;  1XX5 A;  1JKR C;  1O8I A;  3SDB A;  4XON A;  2F4N A;  4XD7 A;  1O8M A;  2NST A;  1Z3Y A;  4M73 A;  2EFW A;  3EYI A;  1PJ6 A;  5KVR A;  3BY6 A;  4BL0 B;  4JX5 A;  3OJX A;  3HRU A;  2CW7 A;  1R49 A;  1IAW A;  1BR4 A;  5KW9 A;  3HPH A;  3EUK L;  5E1X A;  1OB0 A;  2WB1 A;  2GXG A;  1STZ A;  3K2Z A;  1UD8 A;  4PAB A;  3LFK A;  1J7K A;  4EEF G;  4IZZ A;  3BPV A;  1IZ1 A;  4OIO F;  4NQW B;  2ZSH B;  3WG7 H;  1DP7 P;  3SQN A;  4CYD A;  4C2M J;  2KZG A;  4LBZ A;  2LNB A;  2LKX A;  2QBY B;  3RPU A;  3W6V A;  4YAU A;  2XTY A;  2DMQ A;  3TP3 A;  3JRB A;  3OR2 C;  1BC7 C;  1MMA A;  1Z3X A;  1XCV A;  2DOF A;  4XR6 A;  3S93 A;  3GF2 A;  2H6C A;  3LAJ A;  1H0M A;  1W9X A;  2V4D A;  4CGZ A;  1W0K A;  4M2L A;  1IDY A;  2Z2S B;  1YW8 A;  4R8H A;  1D5Y A;  3OAA A;  2L54 A;  3GWZ A;  4HV6 A;  3BOQ A;  4I76 A;  2KRH A;  2M3A A;  2XVC A;  2EH3 A;  3HPG A;  1K6Y A;  1P4X A;  1QQI A;  1XB4 A;  3KP3 A;  5CVV A;  2B0R A;  5EG0 A;  2CQQ A;  4P1W A;  4M9S A;  3SZG A;  1WMR A;  2W24 A;  1K61 A;  3LA3 A;  4XOT A;  2D1V A;  2IVM A;  1ITY A;  3GBG A;  3F8M A;  3QP6 A;  3H3U A;  2QSG X;  1OGI A;  3CCV B;  3VYS B;  2HOT A;  5H2F C;  1KRH A;  1BI3 A;  5J4Y A;  1UHM A;  3OV8 A;  4ABZ A;  3ZMV A;  3MKY B;  4RPD A;  5E1W A;  4P9U A;  1RNL A;  3BZC A;  5DUI A;  4L18 B;  3IL2 A;  1V5V A;  1WP6 A;  4IX7 A;  4M9X A;  3HOW J;  1BI2 A;  1DUX C;  1USS A;  2X9D A;  1EP2 B;  2K4B A;  2KQR A;  2VBY A;  2YUS A;  2DOD A;  1CF7 B;  2WY7 Q;  1Z21 A;  2WAD A;  2I8D A;  3CCR I;  2W7N A;  1HDP A;  4B44 A;  2OBR A;  3I56 I;  2M8E A;  2H1L A;  3M7G A;  1SD5 A;  4E7J A;  1MDM B;  2DBB A;  3HXL A;  2O04 A;  1UJ8 A;  4YAL A;  1T6S A;  3KE2 A;  4XOP A;  4OMZ A;  4A0Y A;  1GHC A;  2OTL I;  4IHS A;  1YIT B;  3MMY B;  4L9N A;  2XAQ A;  4RGU A;  4XLN F;  2DMP A;  2HKX A;  2GAU A;  4RLZ A;  1ZTR A;  2M7A A;  1H80 A;  2V6C A;  4YXW A;  2J8I A;  2EBI A;  4PCQ A;  3LAP A;  3CC4 B;  3MD2 A;  1TBX A;  3LQ6 A;  2P3M A;  2ZSI B;  4PC7 A;  2QCO A;  3NAU A;  1WPK A;  1ZGA A;  2CQK A;  4XBF A;  2FML A;  5IP6 A;  4LB6 B;  2YWG A;  4IJA A;  1FRN A;  2MA3 A;  3JW4 A;  2EA4 A;  2EZL A;  3K4C A;  4AC0 A;  5FRN A;  2PMZ N;  2ZFU A;  3ABK H;  3TOB A;  3H35 A;  3FBI B;  4KIC A;  1ETX A;  1IRZ A;  3GLX A;  2OQG A;  2D9R A;  4LBV A;  2OQR A;  5IP7 J;  4M4S A;  3HUG A;  5E3N A;  4PMH A;  3CCL I;  4I02 A;  2HXO A;  2XRO A;  2GZW A;  1Y39 A;  1JE8 A;  2ECB A;  1D8T A;  1KGS A;  3S1N J;  1KQ9 A;  3V8K A;  3U6K A;  1QVT A;  3ZPL A;  3C1D A;  3BC9 A;  4BQA A;  5ICG A;  1NH3 A;  1MBH A;  1A36 A;  1E3X A;  2NTQ A;  2FXA A;  2XGC A;  3BCB A;  4M3D A;  4EM1 A;  2IQ7 A;  4AID A;  1P9Q C;  1H42 A;  4A3C J;  3F3X A;  1K9M D;  4EJU A;  2QBY A;  2A6H F;  3QAH A;  2NYX A;  2Z1D A;  3M07 A;  4G6T B;  1ZGW A;  2J5O A;  3PNY A;  1QG0 A;  2NVX J;  2IS6 A;  3Q38 A;  3I3L A;  3WHC A;  2H27 A;  1W1W E;  4M53 A;  2FOW A;  2B0L A;  5GTI C;  1QX4 A;  3WTY C;  1I7P A;  2HGC A;  1ENH A;  2DAO A;  3HEF A;  3S3O A;  4A0X A;  1R23 A;  2QA4 B;  4OIN F;  1R71 A;  1O3T A;  2NT6 A;  3K9T A;  3DPT A;  1ETY A;  3KP5 A;  4UV8 A;  2HDD A;  1LDJ A;  1TVC A;  5B1A H;  4DNC A;  2O3F A;  2QUF A;  2YWH A;  2HQN A;  2V6E A;  1NB0 A;  5LGT A;  4UZU A;  5HKK A;  1F20 A;  2VBS A;  4MQ9 F;  1I6H J;  4WXH A;  2F6C A;  1XMK A;  3GTG J;  1JT0 A;  5KAF C;  3BR6 A;  2CO5 A;  1HXD A;  5B6I A;  3NEU A;  5JHU A;  3FHZ A;  3KZZ A;  4A3K J;  1U0J A;  2Y31 A;  1S3J A;  4ESJ A;  1OGM X;  3G2B A;  5LHG A;  1V0F A;  2KFD A;  5A88 A;  1VQ6 I;  2JRM A;  4LFU A;  2IS4 A;  2DTZ A;  4HG2 A;  2CK3 A;  4ZCM A;  3CJT B;  4KA4 A;  1OFM A;  4KMU X;  5HOO A;  4Y15 A;  4P25 A;  2LC2 A;  2FNP A;  4RMN A;  2HVS A;  4BQQ A;  2DCE A;  3MWM A;  5K7H A;  3ZQL A;  4TKO B;  3TQN A;  5FA6 A;  3FXJ A;  2CW0 F;  3I71 A;  3SYT A;  2XND A;  2VOP A;  2RNG A;  4AC9 A;  2OU2 A;  2EV0 A;  1FND A;  2K40 A;  3VPR A;  1PVE A;  2I10 A;  1VTN C;  4KNY A;  5JI6 A;  4PJ0 C;  4WX9 A;  1QGA A;  3ASN H;  4L9J A;  3PJR A;  3AG2 H;  3AG3 H;  5TIS C;  4DBQ A;  1ZM4 A;  4P6V F;  3PQK A;  4KDP A;  4KT6 A;  1PXZ A;  2CMP A;  1ZRD A;  3K4B A;  1U8R A;  3KP2 A;  2BSA A;  1OB2 A;  4HNV A;  3KL9 A;  3BR1 A;  2PMZ A;  3I53 A;  3WTZ A;  5JBQ A;  3ZSC A;  2HTS A;  4HNU A;  5B1B H;  2HR3 A;  5ED4 A;  2BM7 A;  1XMA A;  2R7T A;  5IT9 Z;  1WJF A;  2L0K A;  3RKX A;  4KFC A;  3DV8 A;  1VQ5 B;  3D0S A;  4XID A;  4IVN A;  1QA1 A;  2EFO A;  1D5V A;  4ROX A;  2CGP A;  5GAD J;  3CDH A;  1VHE A;  1OCR H;  4A69 C;  1V54 H;  2ZJP F;  5CVR A;  1FEX A;  4F7D A;  1Q1V A;  2OZU A;  4G7X A;  1LLW A;  3GQ9 A;  3HOU J;  3F6V A;  2XAS A;  4V2F A;  3I5U A;  4G5G A;  3AK5 A;  3MZY A;  2X6X A;  2OK7 A;  3S32 A;  1UD2 A;  2GJR A;  1O3R A;  4K2E A;  3DP7 A;  3L2U A;  1X1B A;  1LDK B;  1P2F A;  3S14 J;  2BGC A;  4CCO A;  2WZN A;  1X2N A;  3IAS 2;  3T9G A;  4ZH4 F;  1JJ6 C;  3I4M J;  2OTJ B;  2EIK H;  2NOJ B;  3J81 K;  1N05 A;  3PUM A;  3DQV C;  1QRB A;  3COA C;  3H36 A;  1XPX A;  2OF7 A;  1J0R A;  4RD4 A;  2W57 A;  2FX0 A;  3VSL A;  4WZT A;  1B2R A;  1E3Z A;  1OOC A;  4OIP F;  3B8Y A;  3ZN1 A;  2D74 A;  4KIS A;  2QX3 A;  2HDN B;  3AVU A;  1KK0 A;  2VQL A;  3O8G A;  2FBK A;  1D1A A;  2HU9 A;  4LIT A;  5HDG A;  2IRF G;  4IHW A;  1WDT A;  4AWX B;  2QN6 A;  2X8K A;  2BM6 A;  2G7U A;  3DDY A;  3OE7 A;  4DQL A;  2PMD A;  2DET A;  1VFC A;  2L3D A;  1FX7 A;  1WJA A;  2ADU A;  3D26 A;  2DA4 A;  1PJ7 A;  2UXN A;  3E0J B;  1KD1 D;  5FIU A;  1R7J A;  3VB2 A;  1YW9 A;  5HXB A;  1IV6 A;  4PC2 A;  1XSV A;  1X3U A;  3N97 A;  1T39 A;  3P5J A;  4KUM A;  1MMD A;  3VYR B;  5H6Q A;  2QGU A;  5FGM A;  5L3G A;  3KP7 A;  3CQZ J;  4XSX F;  3RYP A;  1H8A C;  4L0Z B;  4WZK A;  3BTL A;  3HSR A;  3OEE A;  2TCT A;  1IN6 A;  2CND A;  1IW7 F;  2XZO A;  1O3S A;  3WTT C;  3I54 A;  4LMY A;  4ESB A;  1HW1 A;  3EQN A;  2VIX A;  5FNZ A;  1YHQ I;  3I58 A;  1FYM A;  3WNC A;  3QOE A;  5DS0 A;  3WTX C;  4LBY A;  1A6I A;  1KU3 A;  4IOC F;  1HKT A;  4PGO A;  1UMQ A;  2ID3 A;  3CF5 F;  5F04 A;  4UZE A;  3M1E A;  2DQL A;  3ZPN A;  2M4K A;  4CCK A;  1BN5 A;  2YPR A;  3AST A;  4PC3 A;  4RM2 A;  4YEJ A;  2P5L C;  3BCA A;  3IH4 A;  1XGM A;  1U5T C;  3JRD A;  4C2L A;  1UEL B;  2E34 A;  2HQA A;  4XMY A;  1OCC H;  1N08 A;  3GZ6 A;  2WC2 A;  2OBS A;  1EFU A;  1MAB A;  1ETK A;  2OV7 A;  1KCD A;  2XF5 A;  3G1O A;  3IUO A;  3Q6R A;  4ZGN B;  1M90 D;  1ETQ A;  5K1Y A;  2DOG A;  3TO9 A;  1MNM C;  3A3B A;  3S2W A;  4RAG A;  1E2X A;  2M5S A;  3E97 A;  2VKD A;  3S2D J;  1O8L A;  1NDH A;  3W2E A;  3DPL C;  2XC7 A;  1YI2 I;  3A0B C;  2A68 F;  4E0F A;  2YX7 A;  3ZQI A;  5LEK A;  4P9F A;  2ESN A;  3CCQ I;  2G0E A;  1HBX G;  2O0W A;  4CXF A;  5TR9 A;  2X0K A;  3CCU I;  3ZMS A;  3OIP A;  3N4M A;  3VO2 A;  1EZG A;  3ZZU A;  2VJ4 A;  3JQP A;  3B90 A;  4JRA C;  1MMN A;  5M3M J;  1A6Q A;  4LG0 B;  3WQZ A;  3J7Y J;  5KHD A;  4HLX A;  4LGW A;  4WWC A;  2Q6I A;  1A5J A;  1AA7 A;  1XFO A;  3BR2 A;  1MW7 A;  3IRQ A;  2ZZQ A;  2D1H A;  1F36 A;  3L00 A;  4A3B J;  4UVB A;  1TWH J;  3FDY A;  2MC4 A;  4NB5 A;  1TQM A;  4M6X A;  1Y1W J;  1W87 A;  1LNW A;  2ZXI A;  3VDX A;  1X3W B;  4O6J A;  5TY0 A;  3R6S A;  2ID6 A;  1B4A A;  2JPC A;  2X51 A;  2XT4 A;  4G6D A;  2IA1 A;  3W5V A;  3PM1 A;  4WXD A;  1VQ8 B;  2NNY A;  1PJR A;  4Y52 J;  1SMY F;  1YS6 A;  2DFF A;  4A12 A;  5JR3 A;  2HPM A;  4B43 A;  4OPO A;  1TT0 A;  3P7N A;  2XAU A;  1HZE A;  2L4A A;  4XL9 A;  5IYN A;  2LBF B;  1O8J A;  3OJW A;  4G6I A;  3H0D A;  2NS0 A;  3IV5 A;  4TN1 A;  2IEK A;  3W2A A;  2EWE A;  2M9H A;  4IW3 B;  3I1F A;  2QVO A;  4Y17 A;  4CH7 A;  4NC7 A;  4ZJZ A;  4YRV A;  3LYC A;  2VBE A;  2OPT A;  3CC2 I;  2GWR A;  3CME B;  4HE6 A;  2ACJ A;  1X2M A;  1IXR C;  3H09 A;  3FBN B;  1O8K A;  5JVT A;  4C3J J;  3ZIA A;  4I98 B;  3DKW A;  2CC2 A;  2RVC A;  2F2E A;  5CKT A;  3JRH A;  4XNF A;  5D4R A;  1RC9 A;  3MCZ A;  2VN2 A;  2MSY A;  1KK3 A;  1O8E A;  2JSP A;  1QA2 A;  3DBR B;  2JMW A;  1HOM A;  2LBF A;  2FRH A;  3PSZ A;  2CUZ A;  1ETW A;  4ZYE A;  3ZR8 X;  1FBS A;  3WU1 B;  1OLT A;  2NZM A;  3PSI A;  4XLA A;  5DDG A;  5FO0 A;  4H0E A;  3BJ6 A;  3ZZ0 A;  2ZZE A;  4F3Q A;  2EFQ A;  3SKB A;  2XT2 A;  3GTJ J;  5ILU A;  1MBE A;  2INV A;  4CO8 A;  5J3L A;  3D5S C;  3GX4 X;  5C1E A;  2YS9 A;  4J0Q A;  1UD5 A;  2DT7 B;  3E5U A;  2P5K A;  2M45 A;  3KRG A;  3CDI A;  1P7I A;  2LSO A;  2DYI A;  2ZME A;  4CZC A;  2HQR A;  5HLG A;  1YLF A;  3WXM A;  3CPW B;  4RD1 A;  3BG9 A;  5EZG A;  2GJP A;  3CCQ B;  2NVY J;  3LL7 A;  2X3U A;  4MR0 A;  3PET A;  2B63 J;  1FRQ A;  2F4M B;  3CUQ C;  4HAM A;  1JJ2 B;  2ZJR F;  1FDR A;  3QYB A;  3OW7 A;  1S9H A;  3A01 B;  1EF4 A;  1WU8 A;  3WNB A;  1XDU A;  5B3S H;  3F6O A;  3FZV A;  2H1K A;  1TSP A;  1UFM A;  4AF7 A;  3K6G A;  5L3B A;  2VQC A;  3AG1 H;  2B9S A;  1MMS A;  2B7B A;  1FTT A;  3F9K A;  2I1L A;  2R7W A;  3QPS A;  2DYR H;  3BTI A;  3RY8 A;  3HOZ J;  4NC8 A;  1I27 A;  2GLO A;  1TYX A;  2LLK A;  2ZL6 A;  1KZL A;  1SD4 A;  1KK1 A;  1IC8 A;  2ZXH A;  2HCJ B;  4JYK A;  4C2U A;  1LFP A;  2J8K A;  3OOP A;  1VI0 A;  5C3E J;  2HMA A;  2EFG A;  1MBJ A;  4OZZ A;  1RWR A;  1TYV A;  3A8J A;  2K3P A;  2DFH A;  2E7X A;  1TLL A;  4FXU A;  1V5F A;  1EXM A;  4HA8 A;  3BJO A;  5EGO A;  2K7L A;  3B02 A;  3W5U A;  4BQN A;  4P22 A;  3OYH A;  3EUH C;  3FX3 A;  1RUN A;  4KN7 X;  3Q39 A;  1SAN A;  4ON0 A;  2ECC A;  2K3F A;  2MC3 A;  3HSF A;  4J01 A;  1AKH A;  2XNJ A;  4M3G A;  4Z4V A;  1J09 A;  3EQL F;  2JA8 J;  1E43 A;  2DA1 A;  1HW2 A;  3EUA A;  3OYC A;  1OPC A;  1UAA A;  4RB3 C;  1KCC A;  1WRJ A;  1S29 A;  5FRM A;  2AXL A;  1VQL B;  4B3F X;  2WV1 A;  4F55 A;  2F1M A;  1I39 A;  5H5J A;  3G1L A;  5IP9 J;  1T6X A;  4YAF A;  1TW2 A;  2HXI A;  2KDZ A;  1D8J A;  1DGW Y;  3VMV A;  1S6L A;  2HFH A;  4U0Y A;  4FWT A;  3HM5 A;  5TV2 A;  4LOC A;  1SC7 A;  2XKP A;  1RIO H;  3G73 A;  1ULY A;  2V9K A;  4QPQ A;  4GFB A;  1TZL A;  2Y9Y A;  3PFI A;  2B5O A;  3JCU C;  1YX2 A;  2BM0 A;  2VNK A;  2DTR A;  4XLH A;  2RKH A;  2BXY A;  3P9K A;  2OA4 A;  2Z6B D;  2DA7 A;  1O7F A;  1G8X A;  4AVZ A;  3T0Y A;  3WWG A;  3FXR A;  4XRM A;  4RCZ A;  2EV5 A;  2BY3 A;  2R7D A;  1IN7 A;  3DPU A;  2XUB A;  3W6K B;  4MXN A;  5GP9 A;  1R5N A;  2ODL A;  4B8X A;  2XF6 A;  4XLF A;  4A3E J;  1FPQ A;  2V7W A;  1EP3 B;  3NAW A;  1X1A A;  2KP6 A;  1DAR A;  1W4M A;  1MSE C;  1FNC A;  2EK5 A;  5L3E A;  1MBK A;  4ZYG A;  3R60 A;  3BP8 A;  2GXA A;  3CCV I;  2V1U A;  2VOD A;  5FKN A;  2LTP A;  3OY9 A;  3VFZ A;  1K78 A;  2FF4 A;  1UD6 A;  2QLZ A;  1K8F A;  2OK8 A;  1H89 C;  2ZIT A;  4XRF A;  3RDI A;  3GW2 A;  2R7V A;  2VKE A;  3ASP A;  2BM4 A;  3TW7 A;  2Z99 A;  3Q0V A;  1GXP A;  4F93 B;  4G7H F;  1VQK B;  5FFX A;  1D2E A;  2VZL A;  1QRC A;  1QHG A;  1AMO A;  3OL3 A;  1YRN A;  2ISZ A;  5F6F A;  2GQQ A;  2L9S A;  2PMU A;  3HKZ N;  3OMY A;  1VQ7 I;  3SDG A;  3GTO J;  3TBI A;  2DY1 A;  4P12 A;  3X2Q H;  5CDF A;  1Z67 A;  4KYW A;  3TDU C;  4QUZ A;  4WZL A;  2W6I A;  4FX0 A;  1K5C A;  3F23 A;  3K1M A;  4DQK A;  3U2Q A;  2M30 A;  3G71 B;  2J7K A;  5E3L A;  3ZN0 A;  3JSO A;  1GAW A;  2BBY A;  2BPO A;  3P27 A;  1IUY A;  3HAG A;  2FEZ A;  5F27 A;  1T38 A;  1FYL A;  4Y7N J;  3HHG A;  3KYC B;  1IDZ A;  4M9Z A;  3G3Z A;  4Z4S A;  2IXS A;  3ONU A;  3WHB A;  1QPM A;  2DMN A;  2Q0O A;  5HLT A;  2C78 A;  2PLY A;  4OJL A;  1Y8R B;  4B3A A;  1B9N A;  2PEX A;  1B72 B;  3D5R C;  3ULQ B;  1BMF A;  1RZ4 A;  4HF1 A;  2BV3 A;  3BCD A;  3HRS A;  2VNH A;  3P26 A;  3B73 A;  1OR7 A;  2F5E A;  1OFC X;  2JVH A;  4M3E A;  4CDG A;  4X6A J;  1LB2 A;  2JT1 A;  1F5T A;  2DJN A;  4TSF A;  5FKK A;  1VQ4 I;  4PSX A;  3SJP A;  3S8P A;  3K70 C;  1WSV A;  3GFM A;  2HDC A;  1N06 A;  4OPV A;  4XLE A;  1AKH B;  1T33 A;  4II2 A;  4U0V A;  2EIX A;  1K4T A;  2DI3 A;  1RES A;  1X1C A;  3ASO H;  1S72 I;  2CRG A;  4Q7J B;  3RZD J;  1FIP A;  1HKS A;  5DD8 A;  2FQ3 A;  3FXU A;  3CPX A;  2VI6 A;  2ZC2 A;  4N3N A;  1E3H A;  4H4K C;  1ZK8 A;  3AFH A;  5LHI A;  4JX4 A;  1IN5 A;  4YHB A;  2W1O A;  5HLH A;  3L2C A;  4J19 A;  2KVO A;  1BI1 A;  1Q81 D;  4H9G A;  1QFY A;  2V7T A;  2R6H A;  2CUJ A;  3C18 A;  4YEL A;  4Z4T A;  2KL4 A;  5IYR A;  4TMX A;  4BAY A;  1NHC A;  2JWT A;  4JP0 A;  2VYQ A;  3KZI C;  3U1K A;  5FLV A;  3U21 A;  3GTM J;  2M7B A;  3CMM A;  3EYY A;  3FM5 A;  1K4S A;  2C4U A;  1XG2 A;  2KPM A;  1LFB A;  3CO6 C;  4ENM A;  3LJY A;  3DTE A;  4IRI A;  3MKW B;  2VOO A;  1G2H A;  1LE8 B;  1BX1 A;  3BY1 A;  1H85 A;  1ZR2 A;  2EIM H;  3BPX A;  4X0C A;  1XGO A;  2XAF A;  3A2K A;  4X7C A;  1D8K A;  1IRF A;  1UD3 A;  2MBF A;  1ZAR A;  4KT5 C;  3U2R A;  1HVX A;  3KEW A;  3L2V A;  1YJN I;  3P9I A;  4FIS A;  5K5R A;  3K2A A;  3V4G A;  3ML3 A;  1SFE A;  3VOD A;  3MMP A;  4CCN A;  1JTA A;  1CQT A;  1W7P B;  4RD6 A;  3A1P A;  3DTK A;  2X0L A;  3OR1 C;  1WOS A;  2JJ1 A;  4KKU A;  1O8D A;  2INU A;  3I4P A;  1OQY A;  1VLO A;  1R58 A;  2A69 F;  2ZME B;  4P96 A;  5DV5 A;  5FFZ A;  5HS7 A;  1KON A;  2YSR A;  5J1Y A;  4LG0 A;  1YIT I;  1ZRF A;  3HG9 A;  3G4S B;  4UB8 C;  2VQG A;  3IWF A;  1FOY A;  1BJA A;  1X0C A;  4OU0 A;  1W0T A;  2L02 A;  5D5W B;  3NRV A;  1YFH A;  1JNY A;  1B8I A;  5LMZ A;  2L7K A;  1YG2 A;  2EFN A;  5HS8 A;  5GAH J;  1SKY B;  3BRO A;  1TWA J;  3OPO A;  3N6Z A;  3SEJ A;  5HS9 A;  2D3N A;  4YDT A;  1REP C;  4Q5S F;  3U1D A;  3CCE B;  2ZJQ F;  1WKM A;  2GK7 A;  1E3O C;  2CV0 A;  2WJY A;  4U88 A;  4ASN A;  2DK8 A;  3VNV A;  5BSY A;  2DMT A;  3BZ6 A;  1Y0R A;  5M3F J;  1YX5 A;  2OAZ A;  3CC7 B;  3DKX A;  3OOC A;  4UV9 A;  4S04 A;  4PK4 A;  2UWM A;  2A05 A;  4CCM A;  2GPJ A;  4OIQ F;  2Q6K A;  3TO6 A;  4ZYA A;  3JRC A;  3GFI A;  4ESF A;  5A2Q K;  3UW0 A;  3KEY A;  4WQM A;  5GTH C;  4RB2 C;  1P4M A;  1ZM3 A;  4B4D A;  2QSF X;  5LEJ A;  3A35 A;  1GVD A;  1D1B A;  1X3Z B;  5ERI A;  1ZM2 A;  3G05 A;  3BH7 B;  3FK6 A;  1QFJ A;  3DU5 A;  2L2O A;  4RM0 A;  3E5X A;  4M3B A;  1W0U A;  4A5N A;  4NQW A;  4BPR A;  3H1C A;  4A5M A;  3Q3A A;  2ZFW A;  4PC1 A;  3V8J A;  1QCX A;  1Z7L A;  4DYR A;  3JRA A;  3F0C A;  4X7E A;  3RIQ A;  2G0Y A;  1D0Y A;  3HUG B;  2OUM A;  3IWZ A;  4BEH A;  3V8L A;  5AIP A;  1TWF J;  5E3M A;  4MGR A;  1K28 D;  3CLQ A;  3KZY A;  3Q0W A;  2E2I J;  5JHF A;  1U2W A;  5A8A A;  4I0A A;  3VSK A;  3L9F A;  3W2F A;  3LQR A;  4X0G A;  4M0L A;  1R5B A;  2JA7 J;  3CP2 A;  3HSE A;  3WGG A;  2NRA C;  3OYG A;  1IJF A;  2EJR A;  3IHU A;  4FAS D;  1VQ5 I;  1V0E A;  1XSX A;  3ZQG A;  3VWB A;  4RCY A;  5KSW B;  4IO9 F;  2NSP A;  5DNS A;  4IRG A;  2VE9 A;  2NV4 A;  1TWG J;  2O9L A;  3MAJ A;  1S8N A;  3S3N A;  4OOX A;  1XG1 A;  1WHU A;  2PFB A;  3ABU A;  2COM A;  2GIZ A;  2RNJ A;  2VXZ A;  4MO7 A;  4RLF A;  5FKM A;  3N05 A;  2DA5 A;  1O88 A;  5FRO A;  4DW6 A;  3CCM B;  1YJN B;  1ODD A;  2NAZ A;  4XSZ F;  4Z4W A;  1OYY A;  2M87 A;  1BW6 A;  4OJ5 A;  1KU2 A;  1E3P A;  5EEG A;  4S0H B;  3CCM I;  5A89 A;  2O03 A;  1NRK A;  1QHH D;  3MCA A;  2QEX B;  3HZJ A;  3A1Y A;  3QOD A;  2P6S A;  4W8R A;  2YUH A;  2CFX A;  4ZTJ A;  5D6F A;  4E7L A;  4PGG A;  1FSH A;  1VND A;  3ASS A;  2XGX A;  4QWQ A;  4BGD A;  2MH9 A;  1J75 A;  4YG2 F;  1OCZ H;  3ELK A;  3NWS A;  2EIJ H;  4CHU A;  5K7F A;  1ONV A;  5LRS A;  2FU4 A;  1Y56 A;  2O7O A;  3V7A A;  3TED A;  3ZXS A;  1QGY A;  1XN7 A;  4XKW A;  2EFP A;  3S16 J;  3GSI A;  3RKQ A;  1R5G A;  2PYG A;  4IKF A;  4CQJ A;  3W3C A;  4AIJ A;  1TQP A;  2JUC A;  1E64 A;  1HST A;  3K1P A;  1HG8 A;  2ZZG A;  3CTA A;  4YZQ A;  3VYT B;  1EV7 A;  1ZUN B;  1BA5 A;  2PN6 A;  4OOI A;  3SLN A;  2XPU A;  2DDA A;  4IHV A;  1SAU A;  1KU7 A;  3JRI A;  2R7U A;  4Y13 A;  3TKY A;  5FLM J;  4FCY A;  1NK3 P;  2NVT J;  1G7S A;  4IXA A;  1IB0 A;  3QFR A;  4WCG A;  1SD6 A;  4CYC B;  1UG0 A;  4OJP A;  3F8C A;  1R4N B;  5DEQ A;  5J47 A;  1JTX A;  1VQN I;  1QQ1 A;  3PNT A;  2LMD A;  3RIR A;  1JUP A;  2IA0 A;  4BUP A;  1AHD P;  2X6O A;  4RD2 A;  3H3V K;  3I9V 2;  3SYJ A;  5BPI A; 
#chains in the Genus database with same CATH homology
 3A3B A;  3ZRG A;  1BN8 A;  2RRE A;  2CH0 A;  2M5S A;  2HNH A;  4BJ5 C;  2VKD A;  4YZA A;  1EA3 A;  1O8L A;  3E1S A;  3LFU A;  1D0Z A;  3DPL C;  2XC7 A;  2V1N A;  2WAQ A;  3K4J A;  3V42 A;  2VPL A;  2V31 A;  4E0F A;  2L5Q A;  1IDK A;  5CPR B;  2O0W A;  4P5O A;  2Q2E B;  2F4I A;  3VR6 A;  2UVF A;  1AIR A;  2BVL A;  3OIP A;  2E60 A;  3H5N A;  2WPD A;  4OAZ A;  2VJ4 A;  3H9J A;  2VJ5 A;  2XZP A;  3CES A;  1MMN A;  3C2G A;  2W82 A;  3WQZ A;  2NT9 A;  4PUS A;  2WJV A;  3OYI A;  3LSM A;  5KHD A;  4Y4R A;  3SUC A;  2ZZF A;  3L2W A;  1LVK A;  1AA7 A;  2FUG 2;  3CP8 A;  4FET A;  4LIV A;  2E5N A;  1MW7 A;  1ZEL A;  4PJN A;  2ZZQ A;  3B4N A;  2A5W A;  4BU2 A;  2DT6 A;  1WPC A;  2LRE A;  2XF7 A;  1KMH A;  1GQ8 A;  3QYE A;  3FDY A;  2MC4 A;  4CUG A;  1DBG A;  1WJE A;  2ZXI A;  2Z16 A;  3VDX A;  2CFO A;  2X51 A;  2KRC A;  3OYN A;  4PSW A;  5KCM A;  3K70 D;  5TGT A;  1E0E A;  1FX0 A;  2JJ2 A;  2QKL B;  2R7Q A;  5AMV A;  3RTR A;  1OR7 C;  1PJR A;  2HPM A;  4MLO A;  3L2R A;  3BH4 A;  4B43 A;  1TT0 A;  2OC6 A;  3IAM 2;  2DOA A;  2XAU A;  2Y0S A;  4XL9 A;  1HZE A;  2LBF B;  3J7A Y;  2GJK A;  3T56 B;  1O8J A;  2UVE A;  4W8T A;  3GVK A;  4G6I A;  1W0J A;  3H0D A;  3RQ4 A;  1DP3 A;  2EWE A;  3W2A A;  1SFK A;  4PJM A;  1PYV A;  4CH7 A;  4BDZ A;  4NC7 A;  4ZJZ A;  4YRV A;  1WJB A;  1OGO X;  2VBE A;  4E7K A;  2RQQ A;  3FBN B;  5KNL A;  2R9V A;  4G7W A;  2IGO A;  2IGM A;  3CZ6 A;  1X1D A;  2PJR B;  4IQJ A;  3ZIA A;  1O8K A;  2JDI A;  2JVG A;  5CKT A;  1N77 A;  1FMW A;  2LOO A;  3M8J A;  4XNF A;  3CF2 A;  2X85 A;  3JU4 A;  1QU3 A;  1I8D A;  3T53 B;  1O8E A;  2JSP A;  2LY1 A;  2LBF A;  4BJT A;  2JA2 A;  4ZTF A;  2LY2 A;  2UUZ A;  2CUZ A;  2D3L A;  2KMU A;  2CW8 A;  4KJZ A;  3ZR8 X;  3FKS A;  3BG7 A;  1OLT A;  2NZM A;  3K4N A;  3PSI A;  4XLA A;  4HSR A;  2F5V A;  2WY8 Q;  4XKB A;  2ZTG A;  4F3Q A;  2ZZE A;  4E7I A;  3B90 A;  4W8S A;  4DNT B;  2INV A;  3D5S C;  1VJS A;  3KX2 A;  1UD4 A;  3PL8 A;  4KKS A;  5C1E A;  2XGJ A;  1UD5 A;  2DT7 B;  4HIZ A;  3H94 A;  5HNH A;  3CJQ B;  4YZX A;  3KRG A;  4U4B A;  2E5Z A;  2E1M B;  2W4S A;  1PKV A;  3GQB A;  1R6R A;  2MD0 A;  4XKV A;  4EAT A;  4CZC A;  2Q1Z B;  4MR0 A;  1D0X A;  1EFR A;  2GJP A;  3LL7 A;  3H9G A;  4DIQ A;  2R7S A;  2PYH A;  3OYM A;  1E1R A;  3LMW A;  1T95 A;  2LG4 A;  1W36 C;  3QYB A;  5LD2 C;  2R7X A;  3OW7 A;  1S9H A;  3GRH A;  1X4O A;  4DBR A;  1PLU A;  3VSU A;  3OYA A;  4JOM A;  3K6G A;  2VQC A;  2NTB A;  2HZD A;  2R7O A;  4EW9 A;  5LFA A;  3DWL E;  3F9K A;  2ZTN A;  1Y6I A;  2R7W A;  2HVQ A;  3SEZ A;  2VB6 A;  1YX3 A;  4NC8 A;  3MKZ A;  3OS1 A;  4PFO A;  1KZL A;  1DQU A;  2XOK A;  2ZXH A;  3HOT A;  3GQ7 A;  3DKY A;  4C2U A;  4HEA 2;  1BR1 A;  1LFP A;  4F92 B;  3NWT A;  4RM3 A;  4OZZ A;  2V7Q A;  2M4G A;  4KIT B;  1RWR A;  2K3P A;  5DN6 A;  3OEH A;  4BE1 A;  4PJL A;  4C9Y A;  4FXU A;  4I84 A;  1V5G A;  1V5F A;  2VJJ A;  4OZY A;  1N78 A;  1IDJ A;  4BQN A;  4P22 A;  3OYH A;  1MMG A;  3KYL A;  3EUH C;  1OHH A;  2IS2 A;  4E6K G;  1VLY A;  5CQG A;  1CZF A;  1O8I A;  4J01 A;  2WAE A;  3SDB A;  4XON A;  4XD7 A;  1O8M A;  2NST A;  3HL2 A;  1Z3Y A;  4CCJ A;  1J09 A;  2W00 A;  4OWR B;  4BL0 B;  4F91 B;  3AL0 C;  1E43 A;  4JMQ A;  2Z8G A;  1DBO A;  3EUA A;  3OYC A;  1UAA A;  2CW7 A;  3DLA A;  4U87 A;  4ZC3 A;  1KCC A;  1NBM A;  1BR4 A;  5FRM A;  3HPH A;  4LIU A;  4B47 A;  4F55 A;  3EUK L;  2F1M A;  1YE9 A;  4HPQ A;  2M0M A;  4ZDP A;  1WJC A;  1NG6 A;  2AQF A;  2WB1 A;  1OB0 A;  3A3G A;  2L9N A;  1UD8 A;  3OYF A;  3FKJ A;  4LG3 A;  4IZZ A;  1IRX A;  2DJI A;  3GVL A;  4NQW B;  2ZSH B;  1DGW Y;  3VMV A;  1WTH D;  1VZ0 A;  2CS3 A;  2V9K A;  4QPQ A;  1D1C A;  1TZL A;  2VBK A;  1JI8 A;  4XLH A;  3OR2 C;  4PFP A;  1MMA A;  4C30 A;  1Z3X A;  3K4L A;  4XR6 A;  3S93 A;  1W9X A;  2V4D A;  4BE0 A;  2Z6B D;  4AVZ A;  1G8X A;  1W0K A;  2Z2S B;  2P0W A;  3WWG A;  3LSG A;  2V4J C;  3OAA A;  4HST A;  2KRH A;  2M3A A;  4AYB A;  3HPG A;  3DPU A;  1K6Y A;  4MXN A;  2KZV A;  3PFY A;  4B3F X;  4XKC A;  2ODL A;  2XF6 A;  4XLF A;  4P1W A;  2X1E A;  3SZG A;  3LNN A;  1WMR A;  1X1A A;  2KP6 A;  3ONQ A;  4XOT A;  2IS1 A;  2O5R A;  2QKM B;  3BCF A;  3GBG A;  4HNT A;  3RPU D;  4RLQ A;  2DIE A;  3VYS B;  3OY9 A;  3H9Q A;  4CSW A;  2VKH A;  1UD6 A;  2DXI A;  3MKY B;  2QE7 A;  4R79 A;  2VXD A;  2R7V A;  3BC8 A;  4E7S A;  2MAB A;  1WP6 A;  4IX7 A;  3ZPP A;  2O1D A;  4F93 B;  2KQR A;  4U7B A;  1QHG A;  2LYC A;  3OL4 A;  3OL3 A;  2WY7 Q;  1Z21 A;  2WAD A;  2I8D A;  2L9S A;  2W7N A;  2E1M C;  3OMY A;  4BS9 A;  1ERD A;  3TBI A;  5CDF A;  4DK1 A;  4B44 A;  2X1D A;  2W6I A;  1K5C A;  4E7J A;  3HXL A;  2O04 A;  4ITV A;  2PJR A;  4Z05 A;  4XN3 A;  2PEC A;  4XOP A;  3LSH A;  3OIQ A;  3W2V A;  3HAG A;  3EPZ A;  3MMY B;  3BG6 A;  1T5E A;  2IXS A;  2VJI A;  5C1C A;  2M7A A;  1H80 A;  5HLT A;  4YXW A;  4OJL A;  2QY1 A;  3MD2 A;  4AU7 A;  1BMF A;  4L8J A;  3D5R C;  3BCD A;  2ZSI B;  2BVM A;  3NE5 B;  3K10 A;  2JVH A;  3OYE A;  1E1Q A;  2VQH A;  4TSF A;  4E4H A;  1RMG A;  4PSX A;  3S8P A;  3QYF A;  3K70 C;  1HA8 A;  1IB4 A;  4ASU A;  3K4C A;  5FRN A;  2ZFU A;  3H35 A;  3FBI B;  3PUB A;  3AKZ A;  4XLE A;  3GQA A;  1E79 A;  4PMH A;  1IA5 A;  4II2 A;  2VBM A;  2MFZ A;  1X1C A;  3M1C A;  3OYK A;  4DK0 A;  3K4M A;  2V7F A;  4B3X A;  4BDY A;  2JUG A;  2KDO A;  2WZP P;  4H4K C;  1I18 A;  4KKT A;  4U49 A;  3AFH A;  3BC9 A;  3S3M A;  2W1O A;  3K4K A;  1O8F A;  1E3X A;  2NTQ A;  4NUB A;  3BCB A;  4N4O B;  2IQ7 A;  2KVO A;  1P9Q C;  1O8H A;  1LKX A;  2BSP A;  4Z06 A;  2CUJ A;  4YEL A;  4ZDL A;  4G6T B;  2KL4 A;  2MYS A;  2Z1D A;  4GQN A;  3PNY A;  3H5A A;  4XOR A;  3TMO A;  2IS6 A;  3I3L A;  3SEQ A;  2HPI A;  2VLA A;  3OS2 A;  2WSS A;  4TT3 A;  3PNV A;  3U21 A;  2M7B A;  3VMW A;  3CMM A;  4D1Q A;  4YZ0 A;  1MND A;  3LSK A;  1XG2 A;  4GRI A;  2KPM A;  4E7H A;  3S3O A;  1BLI A;  3DTE A;  4Y3O A;  3MKW B;  4Y33 A;  2R7R A;  2NT6 A;  3W2W A;  3DPT A;  5HNF A;  3T51 B;  3DEE A;  2K5C A;  2KLO A;  3HOS A;  3A2K A;  3JUR A;  4BEH B;  1WJ5 A;  4NK6 A;  2HDW A;  1UD3 A;  4II3 A;  1HVX A;  3EQO A;  2NTP A;  2V6E A;  3KEW A;  4OJ6 A;  2WA0 A;  3CJR B;  3L2V A;  2HVR A;  4ANJ A;  3VST A;  2WBM A;  4UZU A;  5HKK A;  1JTA A;  1FMV A;  2F6C A;  4CCN A;  1BPL A;  5FL7 A;  1EE6 A;  3UNG C;  4Z03 A;  2K9L A;  3DTK A;  4DOZ A;  2F43 A;  3OR1 C;  2JJ1 A;  4KKU A;  1U0J A;  1O8D A;  3ZGK A;  2INU A;  3TL4 X;  1OGM X;  3G2B A;  1V0F A;  1WJD A;  1KON A;  2V26 A;  3HG9 A;  2IS4 A;  1OFM A;  2VQG A;  4HG2 A;  2XSJ C;  2CK3 A;  2A6T A;  1X0C A;  5HOO A;  4URR A;  2LC2 A;  4RMN A;  2HVS A;  4BQQ A;  2DCE A;  4TKO B;  1X4P A;  2L7K A;  1SKY B;  2X53 S;  3SYT A;  2XND A;  3OPO A;  4DJA A;  2D3N A;  2RNG A;  4BXF A;  1VBL A;  1NG7 A;  2W6J A;  2AQE A;  2GK7 A;  1VF7 A;  1NHC A;  2CV0 A;  3FHN A;  2WJY A;  2X6Y A;  4E7Z A;  3PJR A;  2X6W A;  3LSI A;  3OWT A;  4CCL A;  1T0F C;  3D5L A;  1YX5 A;  4DBQ A;  3L2Q A;  3DKX A;  3OOC A;  4KT6 A;  1PXZ A;  3H5R A;  2CMP A;  2UWM A;  3DTI A;  3LMM A;  4PK4 A;  3ZCO A;  3K4B A;  4CCM A;  3OYL A;  4DNR B;  3PSF A;  1WFX A;  4ZYA A;  2PMZ A;  3UW0 A;  3KEY A;  4NK8 A;  3ZSC A;  4HNU A;  1DGR M;  3C2H A;  4J00 A;  1MNE A;  3UR3 C;  2O17 A;  3A35 A;  2ELJ A;  2R7T A;  1D1B A;  1WJF A;  2BW3 B;  1W36 D;  3G05 A;  4W8Q A;  3IP4 B;  3DU5 A;  3ZQQ A;  3OYJ A;  2L2O A;  4BE2 A;  5IK2 A;  4DGW B;  2XZL A;  3HKZ A;  4JQF A;  4IQ4 A;  3FY3 A;  4XLC A;  3A4C A;  3GQ9 A;  4G7X A;  3BLY A;  5HVQ C;  1QCX A;  1Z7L A;  1D0Y A;  3HUG B;  2OUM A;  2X6X A;  4BEH A;  2O0V A;  3S32 A;  1UD2 A;  2GJR A;  2R4G A;  1V5E A;  1K28 D;  5CQE A;  3L2U A;  1X1B A;  5JHF A;  1LDK B;  4BAC A;  3VSK A;  4CCO A;  3IAS 2;  3T9G A;  4XQF A;  4HWV A;  4OJO A;  4F52 A;  4X0G A;  3RCO A;  4C2T A;  2NOJ B;  3CP2 A;  1JRG A;  3DQV C;  3OYG A;  4CA0 A;  4FAS D;  3VSL A;  3OOU A;  3VWB A;  1V0E A;  2X1C A;  2QXZ A;  1E3Z A;  1OOC A;  2LH9 A;  2NSP A;  3B8Y A;  3S3N A;  2VL8 A;  3OYB A;  2UV1 A;  1RU4 A;  4KIS A;  2QX3 A;  3OS0 A;  2VQL A;  2VXZ A;  4RLF A;  2HU9 A;  1D1A A;  4LIT A;  1N75 A;  3N05 A;  1BR2 A;  2X3H A;  2X8K A;  5FRO A;  4B48 A;  1O88 A;  3DDY A;  2CV2 A;  2E1B A;  3OE7 A;  2VAS A;  4OJ5 A;  4NNJ A;  4BQO A;  3RSN A;  1G59 A;  1WJA A;  1NRK A;  1QHH D;  3E0J B;  4HRI A;  3A1Y A;  3QOD A;  1O8G A;  2K9M A;  2XDV A;  3DU6 A;  3HC7 A;  4W8R A;  1MMD A;  3VYR B;  4ZTJ A;  2GK6 A;  1OFL A;  4E7L A;  2KHM A;  4QPO A;  2LRD A;  4BGD A;  1X19 A;  4Z1M A;  4BJ6 C;  3OEE A;  2BW3 A;  3NWS A;  1QJV A;  2JIZ A;  2XZO A;  1Y56 A;  4N4N B;  1BHE A;  2BOL A;  3ZXS A;  4ZDO A;  2HLD A;  3EQN A;  2VIX A;  4XKW A;  2WAF A;  1H8E A;  2LZJ A;  1GLN A;  2GOM A;  4IKF A;  3QOE A;  2PYG A;  3W3C A;  2CV1 A;  3OYD A;  1H8H A;  2IGK A;  1HG8 A;  2ZZG A;  4XN0 A;  3OFN A;  3ZPN A;  4YZQ A;  3VYT B;  2M4K A;  4PJJ A;  4CCK A;  4B3G A;  1COW A;  4D9J A;  3GQ8 A;  4RM2 A;  4XM3 A;  4YEJ A;  1SAU A;  2R7U A;  3VYU B;  3BCA A;  1KTW A;  4C2L A;  1PE9 A;  1UEL B;  2HQA A;  4XMY A;  1BOB A;  3FPP A;  1UG0 A;  2IGN A;  4OJP A;  4OAY A;  3AL0 B;  1MAB A;  2GOX B;  3PNT A;  2OV7 A;  4BUP A;  1KCD A;  2XF5 A;  3IUO A;  3GVJ A;  3I9V 2;  3VSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...