4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
1OFLA 2X6YA 4Z05A 4OJ5A 4W8RA 4OZYA 1O88A 1CZFA 2X3HA 3EQNA 2EWEA 3B90A 3VSTA 2INVA 2X6XA 1JRGA 3WWGA 4XN3A 1BHEA 1PE9A 4NK6A 4XLEA 1OGMX 4YEJA 1O8EA 1RU4A 4NK8A 2QXZA 1IDJA 4HWVA 4U4BA 2PYGA 4PMHA 4EW9A 3SUCA 3GQ9A 4AVZA 3ZPPA 5C1CA 1IA5A 1O8DA 1OGOX 4XKWA 1DBOA 3VMWA 3VSVA 1O8JA 4U49A 2BSPA 2NT9A 4YZ0A 2O0WA 2VJIA 4Z03A 1KTWA 2X85A 4XKVA 1QJVA 3EQOA 1IB4A 2NZMA 1NHCA 2NTBA 4W8QA 4YZXA 4XR6A 1O8GA 1PXZA 1BN8A 1O8HA 4YZAA 4XM3A 1WMRA 2O1DA 2UVEA 4XL9A 3KRGA 4OZZA 4OJ6A 3GQ8A 1GQ8A 4YZQA 4XLAA 4W8TA 4XQFA 1IDKA 3VSUA 4XMYA 3GRHA 4OJPA 2IQ7A 2QY1A 2PECA 2O0VA 1KCCA 1RMGA 1EE6A 4MR0A 5C1EA 1OFMA 4YELA 1O8KA 2ODLA 1X0CA 3VMVA 3ZSCA 1DBGA 4W8SA 2VJJA 2INUA 1O8FA 1VBLA 3JURA 1OOCA 1QCXA 4OJLA 4XN0A 1HG8A 1H80A 1RWRA 4XOPA 4XOTA 1O8LA 3T9GA 4XNFA 1JTAA 3FY3A 3GQAA 4Z06A 3B8YA 2NT6A 1AIRA 2VBMA 2PYHA 3UW0A 2NSTA 3GQ7A 3B4NA 4C2LA 2NTPA 1K5CA 4MXNA 3LMWA 4XORA 4XLHA 4URRA 1O8MA 4I84A 5AMVA 2NSPA 4XONA 4XLFA 1XG2A 2UVFA 1O8IA 2X6WA 2O17A 2Z8GA 2O04A 2QX3A 1KCDA 2NTQA 4XLCA 2VBEA 1PLUA 4OJOA 2VBKA
chains in the Genus database with same CATH superfamily
3K4CA 2HDWA 1BC8C 2OV7A 2XSDC 1MBFA 4B47A 3D1NI 3F8MA 3ZBUA 3WXMA 3VYRB 3KZYA 2QKLB 3GVLA 1CF7B 2HU9A 3MKLA 1OHHA 1XCVA 3DTKA 2K9MA 3K1NA 5C3EJ 2KVOA 1NJID 1KQ8A 1D0XA 2OYNA 4RMNA 3VYSB 3R60A 4ZZLA 2QCOA 3G1MA 5J4YA 3DU1X 2X1DA 5E3MA 1OQYA 4PABA 5E20A 3HTSB 1YLFA 2MC3A 2JA2A 2E60A 1X1BA 1LVAA 1MD0A 2B7EA 2F5DA 1WH7A 3JRCA 3CMAI 2YWGA 3ASPA 1YI2I 4AVZA 3HUGB 2Z3YA 3FWEA 2Y0SN 3VSVA 4UUVA 3BR1A 1PKVA 4Z4TA 1B9NA 3DTEA 1S5LC 5HNFA 2KLOA 4A3LJ 1U2RA 2HDNB 1RPWA 1VQOB 2KISA 3WU0A 2V31A 5E1ZB 3HAGA 3QQAA 3SYTA 2Q6OA 3CCLB 1YIJI 1IN8A 4V2GA 2Z6BD 2NZMA 2OF7A 1K4SA 3W2AA 4V02C 4HZFA 1PXZA 4IPAA 4G6IA 3NB2A 4G1BA 9ANTA 3H3UA 2PE3A 1XMAA 4EATA 1QVFB 4PC3A 2XT4A 3SEZA 1NB9A 4OZZA 3K4MA 2NS0A 3OZWA 1IN7A 4PJNA 1ZREA 2DFIA 2FBKA 1XB2A 3DU6A 1MBHA 5IY5H 5K1YA 3J7AO 1U5TB 4UB8C 5KSWB 3BOQA 3GTOJ 2K27A 5CQGA 1QBJA 4E4HA 3CXCB 2DA1A 2P6SA 4AYBN 1DQUA 5IYRA 2E7XA 5DD8A 1TT0A 2JWTA 4KITB 5LFAA 3AAFA 2X1EA 3VMFA 4AIKA 1IG7A 2YS9A 2ISZA 2B0RA 1EA3A 1CGPA 1AA7A 3QOPA 1BMFA 3T1BA 2A5YB 1TW3A 2DU9A 5ED4A 5LGTA 5LGUA 4U7BA 3EQLF 1MMSA 5B1BH 3JRFA 4F3QA 3ONQA 4R79A 3P5JA 5EDNA 2C5BA 3SFIA 1WI3A 4ABZA 3A1YA 4GO1A 3W3CA 2Q1ZB 2XAUA 1D0YA 1KQ0A 4A3DJ 2R5ZA 2EZIA 3BT9A 2C77A 3E5QA 4FETA 3PNVA 4HEA2 4KIGA 2QY1A 2LFBA 5E6TA 4ZDOA 1MBJA 3LSPA 2VPRA 3HGYA 2ZXJA 2X53S 3A3BA 1ORKA 4BHBA 1VQ7I 2FOKA 3P9CA 4FTHA 2Z1DA 4CYCB 4KICA 1YJ9I 2MSYA 4KYWA 4FN5A 4MEXF 3GLXA 1Q7YD 1RIOH 3KEWA 1NH3A 1GV5A 2H1KA 1N78A 1ODDA 2VOPA 4XK4A 4PC2A 3CCVB 2NSPA 3IKTA 2BVLA 2O04A 2BM0A 4MNUA 1YI2B 2HVSA 3L2WA 3K2AA 5EEHA 2WY7Q 3CMMA 2DJNA 3DBHB 1DDIA 2LG4A 2VBKA 3IC7A 1XDUA 1IV8A 2A69F 1ETYA 2X6YA 3S3NA 1S4MA 3BQJA 4Z05A 2GPJA 4D7NA 3GF2A 1LPQA 1T6XA 5EMNA 3VR6A 4BXFA 4DQLA 2VFMA 4HNVA 1TYWA 3T8TA 1ZAOA 1LEAA 3F22A 1BQEA 3KEOA 3WHBA 1OFEA 4XN3A 2JSCA 1LE8B 2FMYA 3GSIA 4AC0A 4WZKA 1PYVA 1HW2A 2X3UA 3PO3J 2CF4A 2P6TA 1J9ZA 2PLFA 4Y4RA 1BLIA 3V8LA 1TLHB 5J3OA 5F0CA 1KGSA 2UWMA 1O8DA 5DD4A 1MDMB 2B9SA 1B8IA 2JUGA 5DSZA 3ZZ0A 3DPUA 3O2PE 1FP1D 3A8IA 2ACJA 4A3JJ 4C2MJ 2BXYA 3OSFA 4FE4A 2FOWA 3ZQFA 4DYQA 2P7VB 2GK6A 4PJLA 2XAQA 5KK1A 2G7UA 2IA2A 3E97A 2P4WA 3ISPA 3HYIA 3GTKJ 4HE5A 4DK0A 1B6AA 2BVNA 2JPBA 2V5IA 4WWCA 1VI0A 4B3XA 1V54H 1I3QJ 1GXPA 1WTHD 4WXHA 3ZN0A 4YFOA 5EG0A 1D3YA 1XGOA 3Q9SA 1U8BA 5IOZA 4O3MA 2JN9A 2G7HA 1WXRA 2KQRA 5LGNA 2HXIA 3VOEA 2WAFA 4CXFA 3QRFF 1R5GA 3CJRB 3WTYC 3GMEA 4ESJA 1RRJA 2NRAC 3ONUA 2G9WA 4UZUA 1QUFA 5EG0B 3KP5A 1Y0NA 2EV5A 4BY7J 2VZLA 1QA3A 1O4XA 3GRHA 4E7LA 1BI0A 1T95A 2HKXA 2HQRA 2OU2A 2V1XA 3ZN1A 2ZNYA 5CYVA 4KH3A 1XG1A 2G0EA 2H8WA 2CYYA 1VQ9B 1O8KA 3ABUA 1KYWA 1JTXA 2DQLA 4F7ZA 4UAJA 2R92J 2MH2A 3L00A 4KIFA 4BEHA 5IYPA 4JYKA 3JAMK 4E7KA 1E79A 3GTMJ 3LNQA 3ZGKA 1YX5A 4B4DA 3ZXSA 3K9TA 2L5QA 3FJOA 3IAM2 1ZLJA 3TDZC 3E7LA 1Z1DA 3S3OA 2FX0A 5E3OA 2ZMEC 3I71A 1EFTA 3HKZN 3T9GA 1O57A 2O9LA 1QFYA 1GT0C 2ZNZA 4MFDA 4KN4X 5DCFA 3DPLC 1YS6A 2OTLI 1BN5A 1HBXG 5HDNA 3K70C 4FT8A 5JMCB 4JX4A 3K0LA 3K70D 1V0EA 1B23P 2XB5A 1YYVA 2XUBA 3O6BB 5M5XJ 3ZUGA 5BPDA 4C3JJ 3BC8A 4V19K 2F1MA 2P5KA 2CH0A 1NB0A 1ZM9A 4OOXA 2LY9A 5JI6A 3A8JA 5F27A 4KNYA 4FX4A 1MJ9A 1U6GA 2VB6A 4XLCA 4EV0A 3M07A 3H1CA 1MMGA 2R6HA 1MIJA 2P5LC 5F6FA 1B59A 1VZ0A 4GXOA 3REOA 5H20A 1ZELA 1R1UA 1W36D 4Y52J 4JQFA 1ZLKA 2IS4A 2XOKA 3F8BA 1GXQA 2BY1A 2OBPA 5CJ9A 3ZMZA 5FA6A 4ETSA 2NYXA 1K78B 2X6XA 2BW3A 1UHWA 3J80K 2IS6A 4V2FA 1BW5A 2KZVA 5DM7F 2R7TA 3H5NA 1PJ7A 4N9HA 5B1AH 2QDXA 2L7KA 2FMLA 4WZEA 2BY0A 1PUFB 3M4OJ 2HYFA 2VYQA 1HA3A 2JUCA 3ZQQA 1PP8F 2QXZA 2YU9J 4MQ9F 3Q6RA 4QFMA 4BBSJ 4JX5A 1S72B 2JDIA 2HR3A 3E5UA 3W2FA 2MH9A 4M3FA 3RIRA 4NQWB 4BHCA 1K61A 2K4JA 3ERMA 3Q5FA 4L5EA 1HZEA 2XB0X 3OS0A 4A0ZA 2BV6A 3A01B 1R5BA 3SLDA 4CH7A 3B82A 2GAUA 3GTLJ 1N8RD 1G3TA 2QQ8A 1T5EA 2IA1A 4RB2C 3LFKA 2HZTA 2HDCA 2JMWA 4HBLA 1X3WB 2OZ6A 2NTBA 1R5ID 4OAYA 3MHPA 4TV7A 4D9JA 1G7CA 1K4ZA 3R0AA 3L2UA 1D5YA 2DMQA 1EV7A 3BY2A 3SDGA 2QUFA 4BUPA 3OS2A 2DMPA 1JUPA 1XSVA 3VEPA 3CCUI 2M7BA 1GQ8A 4IKFA 4C3IJ 1OGIA 1Y6IA 1GAQA 3VSUA 2DFEA 3KYLA 4IOCF 2LMDA 4J01A 3BTIA 1NK3P 4DJAA 3ZMVA 2JA6J 2BM1A 1VQMB 2O0VA 5D4SA 3DLAA 3MEXA 1W2BB 1X1CA 1MNMC 4MR0A 1WFXA 2W1OA 4OMYA 1FOWA 3H3ZA 2F3LA 2GOXB 2C78A 3QPTA 3CUOA 3S2DJ 3M9AA 5E8IA 5CVJA 4LBZA 1VBLA 1R71A 3E3VA 2HZDA 3IWZA 3CUQA 2UV1A 2JVHA 4TSFA 2R7DA 3CO6C 2DLLA 3IHUA 4CO8A 1JHHA 4BDYA 3KL9A 1K8FA 1HG8A 3DU5A 3M8JA 3U21A 5J4VA 3PNYA 1R1TA 2VOOA 2YWHA 1K9MD 1YJNB 1N05A 4HRIA 3JRGA 3WBKA 2E19A 4K1XA 4IHSA 1YIJB 3BLYA 5FKOA 4HF1A 4DBQA 3HXLA 2QVOA 2CO5A 1APLC 2NPFA 4DNRB 3ASOH 2CQ7A 1BI1A 3SYJA 1I8DA 1KD1D 4LLNA 3JW4A 1ZR2A 2DQRA 1T98A 4LD5A 1SM4A 1ETWA 3I54A 4CHUA 1I3AA 3HOTA 1EP3B 2VQCA 1HXDA 1V5FA 4A3BJ 1JGGA 2LREA 5D4RA 2VT2A 2NVYJ 1O3RA 4B3AA 1MSEC 3CCQI 4CCOA 3OYFA 2Y9ZA 3TW7A 3KP4A 5M3FJ 2CG4A 4M71A 1TT5B 3CMYA 1N08A 2OBRA 3SEQA 3GFIA 2EA2A 1QH0A 3EYYA 3C2BA 3HTUA 1W87A 3AK5A 3L7WA 3G3ZA 4NK6A 2KZGA 2R4GA 3S16J 2XAGA 4Y13A 2XF7A 2EFWA 4NK8A 1IV6A 1VQ8I 3I0TA 3HGGA 5D6EA 2E2IJ 4ZJZA 5FKLA 2PLYA 3S2HJ 3HZJA 5H6RA 3VFZA 2LKSA 5FB2A 2ZITA 2Z9OA 3K4BA 4C2UA 2D5VA 2BX6A 4HQMA 5IP6A 4XKWA 3WGIA 5FLXK 2F1LA 1DBOA 2V1NA 3VMWA 3H92A 1EFUA 2H1LA 3JSPA 3CW2A 4S0HB 3CCRB 2XAHA 1XSDA 2OBTA 1X3UA 2M34A 1WQ2A 1LEBA 3CCRI 2O0WA 2K9LA 1Y56A 4FHTA 5GAGJ 1X19A 1F4KA 1V4RA 4UVBA 2CV2A 3FPKA 4PDKA 2OC6A 4PFPA 3CJQB 4HNTA 3AG3H 1YJWI 3V7RA 1JI8A 3JRHA 1FSEA 1NG6A 3S2WA 2UUZA 2M0MA 1NHCA 4P1VA 4YRVA 2M3AA 3SDBA 2WPDA 2BV3A 3ASQA 4M72A 1VQNB 2MA3A 2CU7A 1QFJA 1W7PB 3SY2A 4NQWA 3PSIA 1ON1A 3BZKA 3ELKA 1SD7A 1XX5A 3H5AA 3QYFA 3CMEI 2CBXA 5C4XJ 3LNNA 4A0XA 5M3MJ 2LH9A 4OOVA 1HQCA 4F93B 3FKJA 2A6TA 2E5NA 4BKXA 2CC2A 4QPQA 1UFMA 2PECA 4I01A 1MH4A 3QU3A 2JVGA 3QP5A 2L9SA 4LIVA 1T6YA 2DFHA 5E18F 4AIDA 4QV2A 1LLZA 2WAEA 4ESFA 4WZTA 3MZHA 5FRNA 1OFCX 2FBHA 2NOJB 3FX3A 4BJTA 1AWCA 2D3LA 1TYXA 2ID3A 3A4CA 2LBFB 3LO8A 1ETVA 3G4SI 1X4PA 3DLLF 3RPUD 4KDPA 2R5YA 2CUZA 3E6MA 1CNFA 2YX4A 1A36A 5A88A 1KJZA 1RWRA 4PK4A 2MFZA 1BX0A 2K4BA 2ESHA 3LQQA 1JGSA 1KZHA 4LGWA 2OTLB 1J75A 1T6SA 2KIMA 4IX7A 3PNTA 1FIPA 5GTHC 1JXSA 1POGA 1IRGA 1ZTRA 2XTXA 4I7HA 2V9KA 3CCEI 1VLOA 2ZZFA 2C5HA 4X6AJ 2NSTA 1ENHA 3FXOA 3KE2A 4LK1F 4XRFA 3HJEA 5HODA 1YW7A 3CCMI 4LG3A 5F08A 3F8FA 3T56B 5TJJA 2BW3B 2O61A 1WDTA 3QFSA 1EA0A 2BM7A 1IF1A 1QGAA 2HQ5A 2GWRA 3CTAA 5ILVA 4OJ6A 1QA2A 2CUEA 2W57A 2BEOA 5F64A 3PVDA 4JP0A 3OYAA 3E6CC 5E1WA 5FLXZ 1PJRA 2NVXJ 2FE3A 4BHPA 1BA5A 1IW7F 3HKZA 1P4XA 4CSWA 3VSTA 1L1IA 1J59A 5DYMA 2QA4I 1OFLA 4J19A 2IS1A 3WTVC 3QFTA 2BM5A 2A3SA 2EZKA 3BZ6A 5GTIC 1CZFA 3HOWJ 5JLVC 2HI3A 2X3HA 1WHUA 3ULQB 3W5VA 3TL4X 2GLOA 3OL3A 1B2RA 3I64A 1MKMA 4RS8A 3OYLA 4HE6A 1R9TJ 2IXSA 1Y1VJ 2HLDA 4P6VF 4UZEA 5H59A 4DQKA 1N07A 1LQ1A 3P27A 4GYIA 3E1SA 2W24A 3QP6A 4UXNA 2F4OB 3LVBA 5GADJ 2KIUA 2R5ZB 3LOCA 3ZP5A 1VTNC 1EP2B 3W2EA 1N06A 4RAGA 4RGXA 1YX3A 2QQAA 5EZHA 2GQQA 2Y0MA 1J0RA 3V7SA 1ZM2A 2DOAA 1VQPI 1UD3A 3ABTA 1SFKA 2A6HF 4NUBA 4IOAF 1QGZA 2WV1A 2QTZA 1G3WA 4EM2A 3LMMA 4JOMA 1F5TA 2PMHA 1QVUA 4C43A 3CJTB 1DPUA 3Q39A 1DG1G 2GREA 4G94A 2I1LA 2EFGA 3WTXC 1G4DA 2DOGA 4E7ZA 3M1CA 1TL8A 1A31A 1SKYB 3W2HA 4HPQA 3PIOF 2WJYA 3KIOA 5FIUA 1FNMA 3EQOA 2XKOA 4RD6A 1FYKA 3CC2B 3DWLE 4KT6A 3HEFA 4LG0A 4YZXA 4XR6A 1EWYA 5J6XA 3WTZA 4KKUA 2JA5J 1TC3C 3PSSA 2HQAA 4TT3A 5TRDA 4ZCLA 3TO6A 2HVRA 4NBSA 4CYDA 1X58A 1WJCA 4XMYA 1KQSB 4BXUA 1ZG1A 2ZL5A 2EV6A 1K6YA 3GFLA 2ID6A 1ZG5A 4G12A 3KYCB 3RYRA 3GW2A 2EZHA 2ME6A 1VQ4B 3WYAA 5FRMA 4RM2A 1H42A 2FXAA 2XKPA 5J1RA 1YFHA 1TLLA 2WB1A 4E7IA 3HSEA 4M3GA 3NQOA 1IO2A 4RAZA 2X0LA 4PC7A 4B3GA 1BJZA 3P7NA 1NG7A 4Y33A 2E1MB 3FM3A 3OV8A 2V6CA 4LC0A 5D5UB 2Z16A 4I6ZA 3F6VA 5KHDA 1LFBA 3MD2A 3E0JB 1R6RA 1Y0UA 5FROA 2BSAA 5IP9J 5TY0A 2LP0A 4XOTA 1AKHB 3KEYA 2E1CA 1H9TA 3FF5A 4LK0F 4M9XA 5KCMA 5J8CA 5EF6A 3MZYA 1FLIA 3GQAA 2XVCA 4KA4A 3B8YA 2ZSIB 3T53B 2EH3A 3M1EA 1HVXA 2H6CA 4AM3A 3W2IA 1YG2A 3H94A 3GQ7A 4B48A 2HPMA 3RKYA 3ESWB 4HX8A 2OQGA 1TNSA 3RPQA 1QA1A 1USTA 1YOVB 2VQGA 2YUHA 2ICWG 3JTGA 4X06A 2MC4A 1XSXA 2L7FP 3VB2A 4PSWA 1KCDA 2V7TA 3BJAA 1JKOC 4B8XA 1X1AA 2V7XA 1BX1A 1HC8A 1KK2A 4U0WA 3GO5A 2WAQA 3KP2A 4BL0B 2P7CB 2VE9A 3JQRA 2DJIA 2D9RA 2Z5UA 1YHQB 1TYUA 5EEAA 1PP7U 2JK3A 5CVVA 2PFBA 3SFZA 3X2QH 3VYUB 2CUFA 1E62A 3GCMA 1WPKA 3CESA 3DQVC 2RQPA 4JBAA 2QQBA 1IN6A 2HTSA 4QWQA 4CUGA 2RN7A 3VNVA 2K85A 1QGYA 4C2TA 3V4GA 3AVXA 1OISA 2L9VA 3OYDA 1EZGA 4RDKA 4ZC3A 4YEJA 1O7FA 2GJPA 1VQ9I 3P9IA 3BWGA 3WG7H 2R5YB 3FDYA 3C7JA 1YJNI 4YXWA 3OYGA 4YFKF 2RV8A 4N0BA 3A35A 5AIQA 2CW5A 3KEQA 3QYEA 5HVQC 1ZYRF 4YIRX 2B0LA 2MD0A 3V76A 1O8JA 4JX6A 5BQTA 2OTJI 1MNEA 3ZQ7A 1FZPB 1WJEA 2E71A 3JSOA 3HOYJ 4ROXA 2DY1A 4GDFA 1Z91A 3ZIAA 4EVIA 5F04A 1I6XA 1UJ8A 5JBQA 4AVPA 1FDRA 4Z4UA 3B6CA 5IYWA 1Z0XA 4FX0A 2GBYA 4Q4ZF 3BG9A 3CLQA 4XRSG 1D2EA 1Z3XA 1D1AA 3DV8A 2RC5A 3PUBA 3WGGA 5KNLA 5GV8A 1VQKI 2MW8A 1WP6A 1BM9A 5HS8A 1P2FA 1C0WA 4RDLA 2WZPP 1QPMA 2H94A 4XSXF 4DBRA 3GQ8A 4BE2A 4MEYF 3T8RA 3RCOA 3BY6A 1IUFA 2KRHA 3OOPA 4G7ZF 3Q6QA 2IAIA 1M1KD 2DBBA 2R7RA 2IGKA 1K78A 3ECHA 4X05A 1TTYA 3V7CA 1WPCA 2DCUA 1GV2A 3ML3A 5EGOB 1KCCA 3OJXA 5TV2A 2NAZA 4B44A 4RJLA 4Z4YA 3G4SB 1U9NA 1MSFC 3ZSCA 1R1VA 2XRLA 3DPTA 3HSRA 4Z4VA 3EYIA 6PAXA 3GUDA 4TMZA 4MLOA 2STWA 4A6DA 2VJ5A 4NHJA 3WODF 3MVPA 3ZCOA 4H4KC 2XPWA 4XN0A 2R7UA 1H80A 2DPDA 4NC8A 2QZAA 4ACAA 4HA8A 2NNYA 4XNFA 4PSXA 4PJMA 2IPQX 1DU6A 2XT2A 1TZLA 3CLOA 3TGNA 3CCMB 1RQPA 2WTEA 4P25A 3PA2A 2L7MP 2Y69H 2GQFA 2W82A 5IOYA 5E1XA 5KW9A 4RM3A 1T6ZA 1MZBA 3FPPA 2FBIA 2JRMA 3OYKA 3F21A 1G7SA 1OGJA 1ULYA 1GJRA 1XG2A 3AL0B 2Y75A 2LLKA 2JJ2A 4BGDA 2F4NA 2QX3A 1OCPA 2WBMA 4QTRA 4RA2A 1HSTA 1P4AA 2ZFUA 2YSRA 3JCUC 4B4CA 1Y39A 1XPXA 1PDNC 4OIQF 3HC7A 3HRUA 4ZTFA 2IGOA 2FVGA 4XIDA 2HVQA 2D45A 5LHGA 3SJZA 1UHSA 2BMWA 2FF4A 2VBXA 3JRIA 2K9NA 5L3GA 3S93A 5JHFA 3I56I 2XRNA 2MBFA 2DDBA 3GFMA 4LIUA 5JLXA 2R7FA 3B90A 2OK7A 3EQNA 1RESA 1WJ5A 2HKOA 3K4LA 1QFZA 1E3HA 3BH6B 3U6KA 3ISXA 3S1QJ 1R4MB 5ICFA 3ZMSA 2VQLA 2EFNA 1FNNA 1T0FA 3VO1A 1LFPA 1HA8A 5EGOA 2VNKA 4P96A 5LBQA 2O6WA 3ZRGA 3HL2A 4RB1A 4B43A 4GYGA 4LLLA 4R8HA 2VL8A 1WKMA 4A5MA 2X8KA 2LK2A 3TEDA 4C0SA 1L3LA 3FBIB 3FXLA 5C1CA 1Z6RA 4YAOA 1OGOX 2VNIA 2OZUA 4K2EA 2ZXHA 1LB2A 4HOBA 2CQNA 5FL7A 1TYVA 4Z4WA 3OKXA 4QVAA 3P9KA 4YEIA 3TDUC 4EM0B 4KFCA 1STZA 1FC3A 1Z7LA 1H8AC 3H9GA 3MKWB 2M5WA 2X85A 2K02A 1E63A 5K7ZA 5H2FC 5BOXA 1RR8C 2CQKA 1KQ9A 1YW9A 1VJSA 1O8GA 2PIAA 2OJED 4J00A 4YZAA 3JRDA 5B5EC 1BR4A 1UCRA 5AIPA 1TWGJ 3OL4A 4XL9A 3H9NA 3CCSI 2V6EA 3ZPLA 3TP0A 1V5EA 3CC4I 3PETA 2L3DA 3DEWA 2Z2SB 2OA4A 4EGZA 3TOBA 4IQJA 3T51B 4RLZA 3KX2A 5J47A 1XD7A 2QZ8A 1OR7A 2V7FA 4M9ZA 4O5VA 4DNCA 3AGPA 4WQMA 1OLTA 3HSFA 3GZNB 1DGWY 2I8DA 3A03A 3J7YJ 2H6BA 4D7MA 4UV9A 1X2MA 2XPUA 4ZH4F 4NNJA 4YELA 1OB5A 3Q0WA 2V9PA 3ERED 4PGHA 3OOUA 1FYMA 1W1WE 1V3FA 4X0CA 4X7CA 1ZGWA 5GAHJ 3I4PA 1UG2A 2BGIA 2DA5A 1JT0A 1KMHA 3M7GA 1H88C 2BF4A 3EDPA 1XGNA 2L2OA 3JREA 1MABA 4HX7A 1ZGAA 1EF4A 3BH4A 1X1PA 1G7RA 2CWEA 4X1EA 2AQFA 5FO5A 4Z06A 1RKTA 3UKGA 2ZJPF 2HPIA 2VBMA 4ENMA 1SEUA 4P55A 3WTUC 1MJBA 2Q6LA 3CCJI 1BJAA 5LLQA 1MDMA 3K4KA 5H5JA 1NTCA 4X7FA 1I50J 2YWEA 5IP7J 5LHIA 1SANA 4U0YA 3DF8A 3R6SA 1FOXA 1EFCA 3GVAA 4KUMA 4P9UA 3AG4H 3GX4X 5EJCA 2Q6IA 1ZM4A 1P7JA 4FXUA 3A8KA 2FUG2 2VBEA 4A5NA 4G7HF 1GLNA 1WOSA 1LE8A 4N4OB 1YJWB 3DCFA 3OSGA 4XKCA 1AHDP 4BJ5C 4QPOA 4U87A 2M0CA 2BM4A 4F52A 3N97A 4LMYA 2R7ZJ 1TWAJ 2R7OA 1XN7A 2EWEA 4ZCMA 4RGSA 1B72A 5A89A 1JRGA 1R36A 2WZNA 2XTWA 2RNJA 3FXUA 3QAHA 4KJZA 1XE1A 1Z7UA 2HNHA 1WSVA 4L0YB 1EKEA 5AN9A 3JQQA 2AXLA 1MW7A 2IP2A 2EBIA 5DDGA 2GJRA 4N3NA 1RU4A 2XAJA 3HHHA 2FJ1A 1U2WA 3F8NA 1QZZA 5FD5A 3W6VA 2ZCWA 4HWVA 4A93J 3FZVA 1FNDA 4TKOB 4PMHA 4ENKA 1QUEA 1SKQA 2BXZA 3F72A 4HIZA 5LEKA 3GYHX 3DXJF 1AKHA 5DV5A 4BDZA 4CCKA 1S7AA 1K7AA 3HPGA 4JRAC 4UZFA 2NT9A 5ICGA 2AHQA 4YZ0A 1JTYA 4IZZA 1FNCA 2ME0A 4OPOA 2LBFA 4A2UA 4BE1A 2QKMB 4FISA 2Y30A 1HDDC 1VFCA 4XRMA 4ENJA 4R1HA 4XKVA 1AU7A 5HZBA 3SXYA 4XLPF 3C1DA 5KAIC 4OOSA 3KYDB 4L18B 4BACA 4MTDA 2F48A 1BN8A 2LDUA 2XDVA 2XPVA 2PBIA 4XSZF 1YIOA 4XM3A 2AS5F 4RDJA 4LJZF 4UUTA 4X8IA 3CMAB 2KPMA 4GCVA 3HOSA 4RPBA 2P8TA 1S7EA 4XQFA 2VBWA 3FM5A 3H9JA 4RD2A 1IDKA 2LNBA 3ABLH 4L9TA 1Z77A 5DM6F 4KT5C 3I4MJ 5LHHA 1V5VA 3CF2A 3N4MA 2EK5A 4B3FX 1P9QC 3DBRB 2ECCA 2ZMEA 2Z33A 3VPRA 1WVRA 1YE9A 4YHBA 1XGMA 3WGHA 3OIQA 3M3YJ 2HOAA 4S04A 1YO5C 2F4MB 2LSOA 4UB6C 3I53A 2VONA 2E36A 3BDDA 2O7OA 3S32A 1R23A 1R00A 2CFXA 2HYGD 4E70A 1BR2A 5HLHA 3HBLA 1LFUP 3FHNA 3KLNA 4UY8I 3HRMA 2W00A 4G5GA 1W5SA 2DCEA 2K7LA 1F36A 4G7OF 3QFRA 4WWVA 3LA7A 4AC9A 1TQMA 3AVVA 3WG9A 4AWXB 2ZXWH 3OYBA 3ZQCA 3IV5A 1IHMA 4A12A 2A5WA 3BR6A 2DOEA 3DEEA 1IXCA 5GP9A 4G7WA 2HCJB 1VQKB 2NTPA 4C2LA 2BPOA 2XNJA 1AOYA 4TMTA 4M9SA 5TR9A 2XF5A 1BPLA 1X2NA 2R7VA 1J2XA 1F60A 1QHGA 2E34A 1R5NA 1Q1HA 2P81A 2GXBA 1FTTA 4IRGA 3SQVA 2KJBA 1SAUA 3IKVA 2ELJA 2ZJRF 4NBQA 3WE2A 1ZRFA 2MABA 1PUEE 2DERA 2ZJQF 1N77A 2M1BA 1MJAA 3GEZA 4IJAA 3S3MA 4W8RA 2F5CA 2FNAA 5CVIA 1VNDA 2UZKA 3HOZJ 2ZTGA 3GBGA 1DU0A 1OJLA 3K2ZA 5JVGF 2XEXA 2ZFWA 2GXGA 1HKQA 4DQ2A 1LNWA 1G7TA 1Q9SA 3B8HA 4M3BA 4JMQA 1Q81D 2D1HA 3WWGA 2EIMH 2BE5F 4KN7X 1QPIA 1LJ9A 5IYNA 1WGXA 3V42A 4UHTA 2VN2A 3OR1C 3E5XA 2KDOA 2VT3A 3CUQB 1COWA 1P4WA 2L7ZA 4IQ4A 4L5IA 1DUXC 1EJ9A 4EJTA 1T56A 2HGCA 2COMA 2V79A 3WTTC 2K3FA 1J7KA 1QA6A 3HG9A 4W97A 2KJCA 4XICA 2XNCA 4TMXA 1FRNA 1S72I 2CUJA 1ZN2A 3FBNB 4UUSA 2XROA 4WCGA 4YFNF 3CB4A 5B6IA 4G7XA 5H6QA 1VQ6I 2DETA 3R0JA 5LD2C 4HV6A 3RQ4A 3OP1A 2LD5A 1Y8QB 5EEGA 1E17A 3I4NJ 1VHEA 2PEXA 2QTLA 5FKMA 5GPCA 1RC9A 4RB3C 2DMTA 4MQVA 2KMUA 2VBUA 5F0HA 1TUIA 3OY9A 1IJWC 4U88A 3KZIC 3JQPA 4P9FA 3GTQJ 3IAS2 1KK3A 2NVUB 5FLMJ 1E3PA 2KP6A 3KRGA 4Z2YA 5TGTA 2QBYB 3PUNA 5IYBJ 4OP7A 2JT1A 3F8CA 3HRSA 2ZMEB 3BR5A 1T33A 4YIIA 4I99C 3TO9A 2V1UA 3HDDA 2V7WA 4YAWA 1KC8D 2HEOA 3D26A 4P2NA 4A3KJ 3WU1B 2KIQA 1RMGA 4GRIA 3QFCA 1OFMA 5KAFC 2ODLA 2X4HA 4ZYDA 1VQMI 2ZTNA 4LB5A 4Z4ZA 1UD5A 5LEJA 1K8AD 2NOGA 3JURA 5J1YA 4KKSA 4H9GA 4L9NA 3K1MA 1E64A 5DTDA 1Q1VA 1LUJB 2EIXA 2MD5A 2M4GA 4IW3B 1BOAA 5FO1A 3RY8A 4E7JA 2JQ7A 2CFOA 3B02A 5F4MA 3HIFA 3NWSA 3F6OA 3CC7B 4E0FA 1FP2A 3K1PA 1WJAA 4MGRA 3S1NJ 2NS8A 4A3GJ 1Z21A 2Y9YA 1B4AA 3ABKH 2GJKA 1VQ7B 4EQQA 3CZ6A 3B4NA 2KRFA 1P4MA 1K5CA 3FK7A 2VKHA 1QHHD 3FHZA 4ZGNB 2Q8KA 2XGEA 1A8PA 1IRXA 3IWFA 1M90D 3DBLB 3Q3AA 1Z9CA 1VQ4I 2ZBVA 4B1RA 5GAEJ 5JHUA 3FXJA 3QU6A 2Z8GA 3GTGJ 1YX2A 3PUMA 4BQAA 2JN6A 2EINH 1ZK8A 2R93J 3DKYA 2J7KA 2RNGA 5HS9A 3H09A 1R49A 2O03A 1WJDA 1U8RA 4KMFA 1YS7A 3AG1H 2E2JJ 3GVJA 3PQJA 4AUXA 5FJ8J 1E1RA 4L5JA 3OIPA 4NB5A 1SAXA 2CS3A 1YITB 1QU3A 2OQRA 1KK1A 3W2GA 1MMNA 1K28D 4DYRA 5E17F 1TQIA 4Z1MA 1YITI 5L46A 5D6FA 3W2WA 5L3EA 3G05A 2INVA 2WSSA 2A6EF 2KHMA 2VODA 3OYEA 2XGXA 4R71A 1QVTA 1RZ4A 4EJWA 3Q38A 3RYPA 2V4JC 1VQLB 4FWTA 3V8KA 4G9YA 3CO7C 2M4KA 1Z3YA 2X51A 3BTCA 3GWZA 4W1UA 4P26A 3ZBTA 2WJVA 2KT0A 2VIXA 3BPXA 3VNUA 2XF6A 3ZPPA 2XASA 3GTPJ 5D5WB 1KZLA 4BYYA 1H89C 1F1ZA 2LY2A 3SLNA 4G1VA 1P92A 1REPC 4BEHB 2XV4S 1ETXA 2LY1A 1V55H 3G2BA 2WADA 2LZJA 2M30A 1KTWA 3LFUA 3QSYA 2LOOA 4LBYA 3UNGC 3U2RA 3SHFA 3DP7A 3OYNA 1JT6A 2IBDA 2LKXA 2O3FA 3V7AA 1KQ5A 5EYRA 5ILSA 3ABMH 2OK8A 1QQ1A 1U0JA 3TW6A 4BAYA 4E6KG 1E43A 2VBTA 2O1DA 3BG7A 4P3YA 4E7SA 5HOOA 3L1PA 2ZZGA 4M4SA 1RR7A 4AU7A 3RI4A 1H9GA 1D8JA 2VKVA 1ERDA 2I10A 5DCMB 3HRTA 4IRHA 1KU3A 1NBMA 2W84A 3ZQIA 4YG2F 1D0ZA 2QENA 1EE6A 1O3TA 1M1EB 3PSFA 4ZYHA 1B8IB 1W0JA 4HLXA 1DGRM 2BBYA 1X0CA 3WNCA 1JE8A 2VXDA 2M5SA 5E3LA 2IEKA 2IW5A 1IB0A 4ZDPA 4ZYAA 3OYCA 1OOCA 3S1RJ 3KP3A 2OAZA 5BSXA 4TMWA 4CCJA 1CF7A 2OPTA 2PMZN 1QCXA 5CVUA 1PJ5A 4M73A 3A01A 2GK7A 5D5XB 5BSYA 3SZPA 5JR3A 4WK8F 3L2CA 2FX3A 1ELOA 3GZ6A 2DDAA 4XD7A 3WNDA 1A6IA 2XZPA 3LA2A 3BROA 4I09A 3RKXA 1E3XA 4IHXA 1JTAA 3OYJA 1KU7A 1CLWA 1RETA 3BJOA 2B7CA 3CPXA 1UMQA 2NT6A 2PYHA 3UW0A 4EH1A 1I5ZA 4D5FA 1ZRDA 3OYHA 3LSMA 3Q0VA 2DT6A 3CP8A 1SFEA 2BN4A 3HM5A 3R61A 4P12A 4HYEA 3LSTA 2XC1A 3FXRA 4MO7A 4P1WA 2V7VA 5FLVA 1LDDA 2HXOA 1SC7A 1HF2A 2DA6A 4IXAA 5DUKA 2NXNB 4A6EA 4CCLA 1JJ2B 2XGJA 2FEZA 2LKPA 4XRSA 4FCYA 4EEFG 1T0FC 3CC7I 3J81k 1I27A 4M0LA 1GVHA 5J1UA 3SJMA 4RD1A 3S15J 2CRGA 1QNTA 1EFRA 1XMXA 5D8KB 1FX0A 2A05A 3BTLA 1H85A 3NARA 1WH5A 2OCEA 3BR3A 3LSIA 3CC4B 1IJEA 2BHYA 2OTJB 3LJYA 2ZSHB 2K9QA 2RGVA 2V7UA 3CCSB 4Z6YA 1G8XA 3KFWX 1WOPA 1ZRCA 1BR1A 1H0MA 1ZR4A 3L09A 2M87A 5E3NA 3OPOA 3J81K 2QF7A 1XC5A 5E8GA 2VBZA 5DCMA 4U4BA 4RLQA 2L9RA 3RDIA 1I6HJ 3PQKA 5CDFA 3ZQHA 1YW8A 2R3SA 3DDYA 1D5VA 1J9IA 3PFIA 1I1GA 4ASNA 5CQEA 3RJPA 2FQ4A 3ECOA 3K10A 4QUZA 1OCTC 4DNTB 1S8NA 3VSKA 3K4NA 3MAJA 3VODA 2R7SA 4OAZA 1Q82D 1F9NA 4GGGA 2XSJC 1DDGA 3I5UA 1OCRH 1D1CA 2YR2A 4M6XA 3G1OA 2IS2A 4P6YA 3N6ZA 2Y0SA 4PC1A 4C9YA 3J81Z 2VASA 1XFOA 3O3KA 4C30A 1N0UA 2DODA 4E7HA 3U6BA 2PG4A 1Z67A 1O8HA 1BOBA 1JJ8C 3ZMDA 3MWMA 5FGMA 5HS7A 3PIPF 4ZCIA 4HAMA 2DYSH 2L9NA 4Z4SA 3Q3SA 2PX9A 3BCBA 1IAWA 2E1BA 2LF7A 4CDGA 2HDDA 1FMVA 2R0QC 4EJVA 4Z4RA 5IT9K 2DA3A 4G6QA 4IRIA 3OW2B 1FPQA 3MCZA 5B3SH 4BE0A 2DIEA 5J8FA 1S29A 3VMVA 3BP8A 1IN4A 1BI2A 4DOZA 3MN2A 2C2WA 4RCZA 3CDLA 2IOUG 3LQRA 3JAMZ 3BCFA 1JKRC 3IH3A 1EXMA 4HF2A 3ZQGA 1LKXA 3NAUA 1R5HA 2WC2A 4LBWA 4AF7A 2VUMJ 1QVGB 5C44J 2KL4A 2C6YA 2DA7A 3PL8A 4I02A 2M2EA 1TBXA 5HLGA 5F4OA 3ZMTA 4AYBA 3HUGA 3TQNA 2AQEA 1TTTA 2JRTA 3OWTA 5F1RA 1ONVA 4IHYA 5CVRA 1D1NA 3SUCA 2ZBUA 1OB2A 1AIRA 3D5SC 1KYZA 1LDJA 2P5VA 3OYIA 3CCLI 2OBSA 4M1KA 2XTYA 3L9FA 1ZG3A 1Y8RB 3KPHA 2VXZA 3G73A 3LMWA 4XLHA 2JIZA 4BBRJ 3MQ0A 1JJ6C 2WA0A 2GA2A 4A0YA 4I84A 1I39A 3M8EA 4XLFA 2NV4A 1DPRA 4EGYA 2LVSA 1WZ2A 4CCMA 1KONA 4FQGA 3A2KA 2QEXB 2L4AA 1TQPA 3EUHA 1G3SA 2B5OA 3E6DA 5HLTA 2GZWA 4WXDA 2PMDA 3PUFA 5AMVA 1HOMA 5J3LA 1A35A 4ACBA 4ZV4A 2YPRA 1VF9A 4QLCU 4BXXJ 4OZYA 3OEEA 3BH7B 2ELKA 2L4MA 3AVTA 3P26A 2X1CA 4U0VA 1S6LA 1OFDA 1LM1A 1OKRA 2C4UA 4HX4A 4KIBA 1HW1A 3C2GA 3JTHA 2ETHA 2QSGX 2LF8A 3HOVJ 3ZPNA 2M8GX 3ZZTA 3AVUA 3EUAA 4M3EA 2XNDA 1W0KA 1O8EA 2VNJA 1R58A 2F5VA 2VBSA 2CW8A 5IPAA 1V5GA 2TRTA 1FBUA 2VC0A 2YU3A 3GTJJ 3MMPA 2UXNA 5LMZA 1T38A 2ZL7A 2OD5A 1HLVA 2BYVE 2W6JA 3GQ9A 1FT9A 3W6JB 1E0EA 2QN6A 4F91B 3OW7A 1YRNB 2BSPA 3PSZA 1SFOJ 1XQBA 1TP4A 4UUSB 3MKZA 2KKOA 4CQJA 3PJRA 1UG0A 5K5QA 2QMUA 1NRKA 1FSHA 3A02A 4N9IA 1VF7A 2VJ4A 1MBGA 1MBEA 4LFUA 2DFFA 2WYRA 1WRJA 4OMZA 3VSLA 3J7ZI 3OYMA 4UNOA 4LITA 1K73D 2K9SA 1N25A 3JRBA 4HDUA 4MYUA 2LR8A 3S1MJ 5CLSA 1CQTA 5L3BA 1XCBA 3PFYA 3TO7A 5THXA 3WY9A 2XHKA 1YLOA 1MH3A 4PJ0C 1ZUNB 3OR2C 3K69A 4YZQA 2L0KA 3RPUA 3GIRA 1SD6A 4GFBA 2K3PA 2LRDA 4RGUA 4ZGQB 1OCZH 4OJPA 4II2A 4Y3OA 3C3WA 3O8HA 4BU2A 1V0FA 3BZCA 2DT5A 2PN6A 3J80Z 2B63J 4M3DA 1W36C 4G6TB 2E1NA 5IK2A 1SVOA 3H3VK 4X7EA 4W8SA 1W34A 3D5RC 4KMUX 5TISC 2INUA 4CYCA 3DTIA 1BW6A 3BPVA 2LC2A 5HLIA 1NHAA 1TWHJ 3LWFA 1X1DA 4HNUA 4Y17A 2RKHA 3CC2I 2VPLA 1DP3A 2F6CA 1R7JA 1W5CC 3BR0A 4F92B 5DS9A 2VLAA 2VC1A 2STTA 1QG0A 3LQ6A 1XMKA 1SMYF 4G8XA 1F20A 2XGDA 1ZGJA 3F0CA 1BBYA 4Q48A 2QM3A 2IRFG 1U78A 4O6JA 2FNPA 4PGGA 3CCEB 3GFJA 3E6BA 3LSJA 4CICA 2BZTA 2K86A 4YIFA 2IT0A 3CDIA 3V8JA 2DK5A 1I1SA 1SD5A 2ADUA 3CJNA 2F4IA 1LLWA 4WX9A 4OM9A 4A3IJ 5CKTA 2I5UA 1I7PA 2DTRA 4AF6A 3A0BC 4X7DA 3FK6A 2OCCH 2R7QA 1Q86D 4URRA 2COBA 3MZ8A 4CZZA 3SZEA 1IRZA 1S3JA 2MLGA 1W9XA 1VQ6B 1I18A 2PMUA 1FOYA 1QRBA 1MGTA 1NK2P 2V26A 4YC5A 2HQNA 5DNSA 1W0UA 1USSA 5M5YJ 2NTQA 1BL0A 3R6JA 3WBJA 1UD4A 2DYIA 3I1FA 2GM4A 1PLUA 3GVKA 1OYIA 1VLYA 2O8XA 1QGPA 3WQZA 5M5WJ 1HKTA 4II3A 1JB9A 1OCCH 5HDGA 3QOEA 1OB0A 1TVCA 2V7QA 1O88A 2IA0A 4D5CA 1WSRA 2E7WA 1Y1WJ 1MMAA 5A2QZ 2HWVA 2VFNA 4PUSA 4LB6B 1T2KA 1S9HA 4D1QA 1BHEA 3ZMUA 3LAPA 1OMIA 1IN5A 1QO0D 4XLEA 1KU9A 3FIWA 2R9VA 2MG4A 2KFDA 4QHYA 1EH7A 1OGMX 2NNNA 5JFRA 4BS9A 2RAEA 1IDJA 3I58A 4L0ZB 2PYGA 3NAWA 4EW9A 1RI7A 3E20A 5HZAA 3I59A 2HOTA 3L2VA 4Y15A 4OU0A 3VYTB 4CZCA 2GXAA 4DYCA 3DFGA 1NDHA 1RQRA 2FU4A 1UD6A 3ONYA 1FBQA 5DN6A 1W5TA 1G2HA 4G6DA 1O3QA 1EP1B 4UVAA 1PUFA 4RPDA 1XB4A 1G6NA 2EJRA 2E35A 3WU2C 3LQEA 2XZLA 5A2QK 3CD6I 1FIAA 5K5OA 2VJIA 2M9HA 2UXXA 1Y0RA 3CRZA 4Z03A 2J8KA 1QRYA 4EM1A 1IXRC 3QPLA 2CNDA 1BIBA 1MBKA 2HYJA 2K40A 3IL2A 1ZHFA 3S17J 4ANJA 1GR1A 1LVKA 2C4TA 2JA7J 1IZ1A 1S0UA 5IYQA 2D2WA 3NWTA 1VQOI 2GIVA 1VQ5B 1ZARA 1DABA 3I55I 5GPAA 4LG0B 2DEUA 2TCTA 2UVEA 5C4JJ 4D0PA 1N75A 1HDPA 4XLAA 1ETQA 1DDNA 2XIGA 4RAFA 3IH2A 2X9DA 4MFEA 3MKYB 1YJ9B 3JX8A 4N4NB 4BPRA 3H0GJ 1UB9A 2D74A 1EH8A 4OPSA 1UHMA 2DAOA 3F3XA 2GOMA 1HCRA 3BCAA 1JA1A 1WU8A 1A6QA 4A3MJ 4RB0A 2CRVA 3PENA 2HS5A 2Q0OA 3IRRA 4B09A 1B72B 1RUOA 1JKQC 1F43A 1UD8A 2EIKH 3ZC3A 3TOAA 1VQNI 2EV0A 4PAAA 1W4MA 2EZLA 2H8RA 1DARA 2BGJA 5HXBA 3W5HA 2G0YA 5FNZA 3O8GA 1IXSB 3W6KB 1UD2A 1ZKGA 4P3IA 2VFOA 2NVQJ 1IC8A 1XGSA 3FISA 4M6VA 4HDVA 2FD5A 3AGQA 3JU4A 4YCQA 2QYOA 2KDZA 1A04A 2R7XA 4P5OA 2WR8A 3C18A 4A69C 2QGUA 2D3NA 3LL7A 3TMOA 2L54A 4HG2A 1JNYA 2QYUA 4FE7A 2FQ3A 4AIHA 1O3SA 1VQLI 3HOUJ 1BI3A 3OIOA 2ELHA 4MYTA 4HSTA 4MTEA 2ZL6A 1J09A 4AD9A 2CJJA 4FASD 1OYWA 1YTYA 2HTJA 3F23A 5HKKA 2MYSA 2CV0A 3L2RA 4PJJA 2QEXI 3QPHA 4PC6A 1UMKA 1N0VC 1O8IA 2Y2ZA 4U9UA 2O17A 4YDTA 3IH4A 2VI6A 3SEJA 3S8PA 3GZ5A 3S14J 4Y7CA 4NDLA 1MRZA 4RD4A 1XTAA 5FO0A 4XLNF 4OIOF 3CCYA 1QZEA 3NRVA 2ZJ2A 3Q0UA 4UVCA 3SZGA 5L3CA 5FKNA 3H5RA 4IL6C 1IJFA 1H8EA 2Y48A 3LA3A 1D8TA 4J0QA 3KZZA 1TWFJ 3CDHA 4PGOA 5D5VB 4HSRA 3AG2H 3QYBA 4EJUA 5K5RA 3QODA 3RKQA 3RSNA 4RGRA 2DXIA 1IDYA 2EILH 4DK1A 1PE9A 2RC4A 2CV1A 4OINF 3H36A 3TP3A 4RCYA 3TBIA 1JUMA 3N05A 3AVWA 4IHWA 2L01A 2Y31A 3A0HC 1K4TA 3LYCA 1W7PD 4HF0A 2IGNA 3CQZJ 3BY1A 4IF4A 4RBOA 1SMTA 4LLGF 5L3FA 4M2LA 3FXMA 3IUOA 1KU2A 3OZUA 1AIPA 3FMRA 4CCNA 5EZGA 3G6EB 3OOCA 1BC7C 2AO9A 2VBVA 3G6EI 1R4NB 5CPRB 2JJ1A 5A8AA 3KCCA 5F1JA 2DW4A 5L3DA 1IGNA 2QSHX 4IO9F 4RDUA 1FNBA 3OE7A 3UR3C 3H9QA 1G59A 1A5JA 3WTSC 2BHZA 5BMZA 2VFQA 1GAWA 1QJVA 2DT7B 3ML6A 2CSOA 3GQBA 5J35A 1IB4A 4Q47A 3JR9A 1T08B 3B73A 2DMNA 4FK8A 3C2HA 4UV8A 4P22A 1RNLA 3OJWA 3CCQB 1U5TA 3AKZA 1X3ZB 3K6GA 4A3FJ 2PJPA 1GVDA 2BM6A 2RDPA 2DMUA 1KA8A 4ZYGA 3WTWC 2ZZQA 2E1OA 4DW6A 3ASSA 2EWNA 2Z99A 2D1VA 1K6OA 4ASUA 1ETOA 2EFQA 2W4SA 2X6OA 3BQZA 3Q9VA 4A3CJ 2AXTC 3FMSA 3ZOBA 1E3OC 4BJ6C 4L8JA 2WY8Q 2VJJA 3I55B 2ZC2A 3K4JA 3M8FA 1JHFA 1FRQA 2P3MA 2W48A 1RKWA 5BS6A 2CQXA 1FYLA 1TWCJ 1YQAA 2GA1A 3WNBA 2DI3A 5J40A 2K5CA 4Y9RA 1LDKB 2ISYA 4KISA 2BY3A 4S05A 2EFOA 1GDTA 1VHOA 2W25A 4Q7JB 3CP2A 3U1KA 1ON2A 2O8KA 1ZH5A 1FBSA 3P4GA 3FMQA 1B9MA 1MNDA 3LAJA 4MHGA 2E2HJ 1W35A 3RIQA 4WXCA 2E1RA 2A61A 2FA5A 2WAQN 4XORA 2Q2EB 4XBFA 5AONA 2E1MC 3W2VA 1W7PA 3LSKA 4M53A 3CPWB 4YAFA 4XONA 3B78A 3PA1A 3BG6A 1GVJA 1RUNA 2UVFA 1U9OA 2RREA 5DUIA 1WCMJ 2CGPA 3KP6A 4YAUA 1G3YA 4ZZDA 3L2QA 2EPFA 2AHOA 2RQQA 4MIMA 2QBYA 3BTJA 4IVNA 1UZCA 2V9VA 1B1BA 2EQRA 3ASNH 2J5OA 4OJ5A 2EA4A 2ZB9A 5ILUA 3OMYA 1WJBA 2H09A 3U1DA 2BVMA 4ZTJA 3BJ6A 2TDXA 1P7IA 1J5YA 2VKEA 4BY1J 3T0YA 1FEXA 1ZM3A 4WF2A 3QE2A 2XZOA 2JPCA 4HV5A 4I76A 5F0FA 1Y0YA 3BG3A 2DYRH 1WI9A 1T39A 3B6AA 3EUKL 3ASTA 1K83J 4BQQA 2ECBA 2EB7A 2N8GA 1OCOH 3H0DA 5F4JA 3G1LA 1P6RA 1E2XA 2BGCA 3IP4B 3KP7A 4ZYEA 1R22A 2CK3A 4TN1A 2ZZEA 1YHQI 1KK0A 4PZJA 3KETA 1SFUA 2IGMA 3U9GA 3FXQA 3J7AY 5E79C 4JK1X 3BC9A 1AMOA 4U49A 4Y9UA 5B66C 3E1YE 1HW5A 5HDKA 5D8LB 4IEJA 2ZBKA 2F2EA 1T8IA 3OZVA 4P9SA 3EUHC 1WWXA 3LSRA 1HSJA 1Z6TA 2P0WA 3I9V2 1WORA 2FRHA 4I0BA 4W8QA 1XDSA 3BR2A 4DIQA 2W7ZA 4GQNA 3OFNA 4A3EJ 2M7AA 2EIJH 2IVMA 2VKDA 2XAFA 1CQXA 1WMRA 2PJRB 4BNCA 2BY2A 5FFXA 2WWYA 1SVLA 4QSHA 1UAAA 1DBGA 4W8TA 5IT3A 2LTPA 2PJRA 3IRQA 1E3ZA 4NCNA 3BNWA 4M74A 2ZKZA 2B7BA 2W85A 1U5TC 4ESBA 3QWLA 2QSFX 3MFKA 3OAAA 2EFPA 3T5XA 2X0KA 1QZYA 1GUUA 3AFHA 1D8KA 1FWZA 4HLYA 4ZDLA 2LYCA 3FKIJ 2JJ7A 3GXOA 4DZPA 2XGCA 1JKPC 4OPWA 4WZLA 3CMEB 2R7WA 3RZDJ 5IYCJ 2XC7A 4QIWN 3AL0C 1KRHA 1GHCA 4OJLA 4DGWB 4RM0A 2DN0A 3W5UA 2M45A 2VNHA 4BH9A 1K79A 1W0TA 3R4KA 1IUYA 1DP7P 1O8LA 3GLLA 1KTVA 2DA4A 2YX7A 4OIRF 2V4DA 3FY3A 4EMSA 4LOCA 5K7HA 3TH0A 3BG5A 3FXKA 3G71B 2NS7A 5BNGA 1ITYA 5ICCA 3U2QA 3I56B 3D0SA 5KVRA 1WOOA 1JUSA 2DTZA 2PQ8A 4L9VA 3BCDA 4QVJA 4U7DA 2VQHA 5JVTA 4I98B 2W7NA 1VQ5I 3CCJB 4ON0A 4PFOA 1SFXA 2X48A 3RTRA 3ASRA 1HKSA 4EJOA 4YFXF 3SZTA 1X4OA 2X6WA 3NEUA 3D5LA 3A1PA 2F5EA 1PVEA 3JRAA 2QGGA 3CUQC 1FMWA 4RAYA 2DPUA 2CW0F 2VBYA 4OJOA 5IYDJ 1QRCA 2WV0A 2J8IA 4CA0A 2KIFA 1GO2A 3BQYA 3A3GA 3DKXA 4F7DA 2GIZA 1CNEA 2DA2A 4PCQA 4H0EA 4RD0A 3KLOA 1QQIA 4LBVA 1MMDA 1ZQ3P 1E1QA 3ROUA 4I2OA 4IHTA 4AIJA 2HOEA 2IJLA 1Z05A 2RVCA 3H35A 2FSWA 4YALA 1TW2A 1BIAA 3DKWA 1PJ6A 2RC6A 5ERIA 1QX4A 1FJLA 1JA0A 1IDZA 4KKTA 3TKYA 2ZO4A 4HQEA 3LSHA 2A07F 3OEHA 2OUMA 1YRNA 1TNTA 2CMPA 2CQQA 1OYYA 1IA5A 3EETA 4X0GA 2QQ9A 3F9KA 2QE7A 5HNHA 4RD3A 3VWBA 2Q6KA 2O0YA 3PO2J 1O7LA 3CCUB 5LRRA 4BQOA 2CW7A 4TMVA 3SQNA 2VE8A 4BQNA 4L9JA 4NC7A 2JZYA 2JSPA 2WB1N 2DOFA 4ENNA 3I59B 1FX7A 2ESNA 2Q2EA 3AVYA 3QPSA 3SKBA 4OOIA 5LRSA 1WJFA 1XS9A 1S7OA 4Y7NJ 3ZZUA 3I3LA 4XKBA 4X07A 5FKKA 3MMYB 3HHGA 3EPZA 3LSGA 1R5OA 2YWFA 2JTVA 4ITVA 3G71I 3WE3A 2F5FA 2O5RA 3FKSA 1D1BA 2H27A 4Q5SF 3N90A 3R6KA 2J5PA 3CF5F 2PI0A 2QLZA 4OWRB 2PMZA 3OS1A 2IQ7A 2KRCA 3WHCA 1IRFA 1HF0A 4N3GA 1L0OC 5C1EA 2O6GE 5IT9Z 1BJKA 1OPCA 1VQ8B 5JLWA 2E5ZA 4DZJA 1ACIA 4OIPF 3NE5B 1ETKA 1H8HA 2HFHA 4F55A 2MLKA 4HW0A 1O8FA 2QA4B 3ES9A 3RZOJ 2V1DA 3ZQLA 3CCVI 2QWWA 3HPHA 2F43A 2A68F 4XOPA 3VDXA 2BOLA 2HOSA 1FTZA 3MCAA 2VFPA 5BPIA 5K7FA 1OR7C 3DEUA 1U3EM 4RLFA 4OPVA 2M8EA 1WSUA 1SVMA 5FD6A 2L02A 1VQPB 2DK8A 1EH6A 4MXNA 3VO2A 1FY7A 3COAC 2ZXIA 4CGZA 5DS0A 1O8MA 3SJPA 4C3HJ 1SD4A 2YUSA 4I0AA 3ZR8X 5ICEA 1UELB 3HOXJ 5GV7A 1TSPA 2JA8J 5DEQA 2HMAA 3CD6B 4IHVA 3K7AJ 3RQIA 3PM1A 3RKWA 1FOKA 4NC6A 2W6IA 4M6YA 2MGQA 5FFZA 2NVTJ 3HB9A 2DO7A
chains in the Genus database with same CATH topology
3WQZA 3K4CA 2HDWA 1OFLA 1N77A 4II3A 2IS1A 2OV7A 4B47A 3QOEA 3S3MA 1OB0A 2V7QA 4W8RA 3VYRB 2ZTGA 1O88A 3GBGA 1CZFA 2QKLB 3GVLA 2HU9A 2X3HA 1MMAA 1OHHA 3TL4X 3DTKA 3OL3A 2K9MA 4JMQA 3OYLA 4PUSA 2KVOA 3WWGA 1S9HA 2IXSA 1D0XA 4D1QA 4RMNA 2HLDA 3VYSB 1BHEA 4XLEA 3E1SA 3V42A 2R9VA 2X1DA 3OR1C 2KDOA 1OGMX 1COWA 2JA2A 2E60A 4BS9A 1X1BA 1IDJA 4IQ4A 2PYGA 1YX3A 4EW9A 3SUCA 4AVZA 2DOAA 1UD3A 3L2VA 1SFKA 3HUGB 3HG9A 4NUBA 3VYTB 4CZCA 1UD6A 3VSVA 2CUJA 3FBNB 5DN6A 4G7XA 3LMMA 4JOMA 1PKVA 3DTEA 5LD2C 3RQ4A 2XZLA 5HNFA 2KLOA 2V31A 3HAGA 2VJIA 4E7ZA 4Z03A 3M1CA 3SYTA 1SKYB 4HPQA 2WJYA 2KMUA 3EQOA 2Z6BD 2NZMA 4ANJA 1LVKA 3DWLE 4KT6A 3OY9A 3W2AA 4YZXA 4XR6A 3NWTA 1PXZA 4G6IA 3IAS2 4EATA 3SEZA 2UVEA 2KP6A 3K4MA 4KKUA 3KRGA 4OZZA 1N75A 5TGTA 4PJNA 2HQAA 4XLAA 4TT3A 3DU6A 2HVRA 3MKYB 1WJCA 4N4NB 4XMYA 1K6YA 5CQGA 4E4HA 2GOMA 5FRMA 4GRIA 4RM2A 1RMGA 3BCAA 1OFMA 1DQUA 2WB1A 2ODLA 4E7IA 2ZTNA 4KITB 1TT0A 5LFAA 1UD5A 1DBGA 1UD8A 4B3GA 2X1EA 1NG7A 4Y33A 3JURA 2E1MB 1EA3A 4KKSA 1AA7A 1BMFA 2Z16A 1UD2A 5KHDA 3MD2A 4U7BA 3E0JB 1R6RA 5FROA 3JU4A 4XOTA 3ONQA 2M4GA 4F3QA 4R79A 3KEYA 2R7XA 5KCMA 4E7JA 3A1YA 2CFOA 4P5OA 3W3CA 2Q1ZB 2XAUA 1D0YA 3GQAA 3B8YA 2D3NA 3LL7A 2ZSIB 3NWSA 3T53B 3TMOA 4E0FA 4HG2A 1WJAA 1HVXA 4FETA 3PNVA 4HEA2 3H94A 4B48A 3GQ7A 1Z21A 2HPMA 2GJKA 3B4NA 4ZDOA 3CZ6A 3A3BA 4HSTA 2X53S 1K5CA 1J09A 2VKHA 2Z1DA 2VQGA 1QHHD 4FASD 1IRXA 3KEWA 5HKKA 2MYSA 2CV0A 1N78A 3L2RA 2NSPA 5AMVA 4PJJA 2BVLA 2MC4A 1O8IA 2O17A 2Z8GA 2O04A 4PSWA 1KCDA 3S8PA 2HVSA 1X1AA 3DKYA 3L2WA 2RNGA 2WY7Q 3CMMA 2WAQA 1WJDA 2LG4A 2VBKA 4BL0B 3S3NA 3SZGA 2DJIA 2X6YA 1H8EA 3GVJA 4Z05A 3H5RA 1E1RA 3OIPA 4BXFA 3VR6A 3VYUB 2CS3A 1QU3A 3CESA 3DQVC 1MMNA 4HSRA 3QYBA 1K28D 4Z1MA 3G05A 3W2WA 4CUGA 3QODA 2INVA 3RSNA 2DXIA 4XN3A 2WSSA 2KHMA 4C2TA 4DK1A 1PE9A 2CV1A 3OYEA 1PYVA 3OYDA 2V4JC 3TBIA 3N05A 4ZC3A 4YEJA 2GJPA 2M4KA 1Z3YA 2X51A 4YXWA 3FDYA 3OYGA 2IGNA 2WJVA 3A35A 4Y4RA 1BLIA 2VIXA 3ZPPA 2XF6A 3QYEA 5HVQC 2UWMA 1O8DA 2MD0A 3IUOA 2JUGA 1O8JA 1KZLA 1MNEA 4CCNA 1WJEA 3DPUA 3OOCA 2LY2A 2JJ1A 5CPRB 3ZIAA 4BEHB 2GK6A 2LY1A 3OE7A 3G2BA 4PJLA 2WADA 3H9QA 3UR3C 1G59A 2LZJA 1KTWA 3LFUA 2LOOA 3UNGC 1QJVA 2DT7B 3GQBA 4DK0A 1IB4A 1Z3XA 1D1AA 3OYNA 3PUBA 5KNLA 4B3XA 1WP6A 1WTHD 2WZPP 3C2HA 1U0JA 4E6KG 4P22A 1E43A 2O1DA 3BG7A 4E7SA 5HOOA 4DBRA 2ZZGA 3GQ8A 2KQRA 4BE2A 4AU7A 2WAFA 3K6GA 3RCOA 3AKZA 2KRHA 3CJRB 1ERDA 4UZUA 2R7RA 2ZZQA 2IGKA 1WPCA 3GRHA 4E7LA 1T95A 1NBMA 4ASUA 1KCCA 2W4SA 1D0ZA 1EE6A 3PSFA 1W0JA 4B44A 1O8KA 1DGRM 1X0CA 3ZSCA 4BJ6C 4L8JA 2VXDA 2VJJA 2WY8Q 3DPTA 2M5SA 3K4JA 4ZDPA 4ZYAA 4BEHA 3OYCA 1OOCA 4E7KA 4MLOA 1E79A 2VJ5A 3ZGKA 4CCJA 1YX5A 3ZCOA 3ZXSA 4H4KC 1QCXA 2L5QA 2K5CA 3IAM2 1LDKB 2GK7A 4XN0A 2R7UA 4KISA 1H80A 3S3OA 4NC8A 4XD7A 2XZPA 3T9GA 3CP2A 4XNFA 1E3XA 4PSXA 4PJMA 1JTAA 3OYJA 2NT6A 1MNDA 1TZLA 3DPLC 2PYHA 3UW0A 3OYHA 3LSMA 2DT6A 3CP8A 2W82A 3K70C 4RM3A 4XORA 2Q2EB 3FPPA 1V0EA 3K70D 3OYKA 2E1MC 3W2VA 3LSKA 4P1WA 4XONA 1XG2A 3BC8A 3BG6A 3AL0B 2UVFA 2F1MA 2RREA 2JJ2A 4BGDA 2CH0A 2QX3A 2WBMA 2XGJA 4CCLA 2NTQA 2ZFUA 3L2QA 3HC7A 2VB6A 4XLCA 4ZTFA 2IGOA 2RQQA 1T0FC 1MMGA 2HVQA 1EFRA 1VZ0A 4OJ5A 3OMYA 1WJBA 4ZTJA 1ZELA 2BVMA 1FX0A 1W36D 4JQFA 2IS4A 2XOKA 3S93A 5JHFA 3LSIA 3EQNA 4LIUA 3B90A 2XZOA 2X6XA 1WJ5A 2ZSHB 2BW3A 3K4LA 2IS6A 1G8XA 2KZVA 2VQLA 2R7TA 3EUKL 3H5NA 1BR1A 1LFPA 3VSUA 1HA8A 2L7KA 4BQQA 3OPOA 3H0DA 3ZQQA 3IP4B 3ZRGA 3HL2A 2QXZA 4U4BA 4RLQA 4B43A 2CK3A 2ZZEA 5CDFA 2VL8A 2JDIA 2X8KA 3DDYA 3FBIB 5C1CA 3J7AY 2IGMA 4NQWB 1OGOX 2ZXHA 3BC9A 1HZEA 5CQEA 5FL7A 3OS0A 4U49A 3K10A 4CH7A 1VLYA 4DNTB 3VSKA 1Z7LA 3K4NA 2R7SA 1T5EA 4OAZA 3H9GA 3MKWB 3EUHC 2XSJC 2X85A 2P0WA 3I9V2 1D1CA 2IS2A 2NTBA 2Y0SA 4W8QA 4OAYA 4DIQA 1VJSA 4C9YA 4D9JA 2VASA 3OFNA 4GQNA 4C30A 1O8GA 4J00A 4E7HA 2M7AA 1O8HA 3L2UA 2VKDA 1WMRA 4YZAA 1BOBA 1BR4A 2PJRB 3OL4A 4XL9A 4BUPA 3OS2A 4OJ6A 2V6EA 1GQ8A 2M7BA 2L9NA 4IKFA 1UAAA 1V5EA 4W8TA 3BCBA 2E1BA 2Z2SB 1Y6IA 4IQJA 2PJRA 1E3ZA 3T51B 3KYLA 3KX2A 1FMVA 2V7FA 4J01A 1OLTA 4DJAA 2QY1A 1DGWY 2O0VA 3OAAA 3DLAA 2I8DA 1X1CA 4MR0A 1WFXA 2W1OA 4NNJA 4BE0A 4YELA 2DIEA 2GOXB 3VMVA 3AFHA 3OOUA 4ZDLA 2LYCA 4DOZA 1VBLA 3BCFA 2HZDA 1LKXA 2UV1A 2JVHA 1KMHA 4TSFA 2R7WA 2XC7A 2KL4A 2L2OA 3AL0C 4OJLA 4DGWB 1MABA 3PL8A 4BDYA 1HG8A 3DU5A 3M8JA 4AYBA 3BH4A 3U21A 2AQEA 1O8LA 3VMWA 3OWTA 3PNYA 2AQFA 2V4DA 3FY3A 4Z06A 4HRIA 1AIRA 2HPIA 3D5SC 3OYIA 2VBMA 3BLYA 3BCDA 2VXZA 4DBQA 3HXLA 2VQHA 2W7NA 3LMWA 4DNRB 4XLHA 2JIZA 3K4KA 4PFOA 2WA0A 3RTRA 1I8DA 4I84A 1DBOA 4XLFA 1X4OA 2X6WA 3D5LA 4CCMA 3HOTA 1KONA 4FXUA 3A2KA 2VQCA 1FMWA 1V5FA 2FUG2 2VBEA 2LREA 5HLTA 1GLNA 4OJOA 4N4OB 4CA0A 4XKCA 4CCOA 3OYFA 3A3GA 4BJ5C 3DKXA 4QPOA 4U87A 3OEEA 4OZYA 4CSWA 2X1CA 4F52A 3SEQA 1MMDA 2R7OA 2EWEA 1E1QA 1JRGA 3C2GA 4KJZA 3ZPNA 2HNHA 4NK6A 2R4GA 3H35A 3EUAA 2XNDA 2XF7A 1W0KA 1MW7A 2GJRA 1O8EA 1RU4A 2F5VA 4NK8A 2CW8A 1V5GA 4KKTA 4ZJZA 4HWVA 3LSHA 4TKOB 3OEHA 2OUMA 4PMHA 2CMPA 3GQ9A 2W6JA 4HIZA 3K4BA 4C2UA 1IA5A 4X0GA 4BDZA 3F9KA 4XKWA 4CCKA 5HNHA 1E0EA 2V1NA 2QE7A 3HPGA 4F91B 3VWBA 3OW7A 2BSPA 2NT9A 4YZ0A 4BQOA 2O0WA 4IZZA 2CW7A 1Y56A 2K9LA 1X19A 2LBFA 2CV2A 3MKZA 4BE1A 4BQNA 2QKMB 2OC6A 1UG0A 4NC7A 4PFPA 2JSPA 3CJQB 4HNTA 3PJRA 1NRKA 4XKVA 1JI8A 1NG6A 1VF7A 2VJ4A 2UUZA 2M0MA 1NHCA 3VSLA 4YRVA 3OYMA 1WJFA 2M3AA 4LITA 3SDBA 2WPDA 4BACA 1BN8A 2XDVA 4XM3A 3I3LA 3PFYA 4XKBA 3PSIA 3MMYB 3LSGA 3EPZA 2KPMA 3OR2C 3H5AA 3QYFA 4YZQA 3HOSA 4ITVA 3FKSA 2O5RA 4XQFA 1D1BA 3H9JA 3LNNA 1IDKA 2K3PA 2LRDA 2LH9A 4F93B 3FKJA 2A6TA 2E5NA 4OJPA 4QPQA 4II2A 4OWRB 2PMZA 4Y3OA 4BU2A 3OS1A 2KRCA 1V0FA 2IQ7A 3CF2A 2JVGA 2PECA 4B3FX 1P9QC 2L9SA 4LIVA 5C1EA 1W36C 2WAEA 4G6TB 1YE9A 2E5ZA 5IK2A 5FRNA 3OIQA 2NOJB 2D3LA 4BJTA 3D5RC 3NE5B 4W8SA 1H8HA 2INUA 3DTIA 4F55A 3A4CA 1O8FA 2LC2A 2LBFB 1X4PA 3RPUD 1X1DA 3S32A 4HNUA 2VPLA 1DP3A 2F6CA 2CUZA 3HPHA 1BR2A 4F92B 2VLAA 2F43A 1RWRA 4PK4A 2MFZA 3FHNA 4XOPA 3VDXA 2BOLA 2W00A 2DCEA 4IX7A 3PNTA 1OR7C 2V9KA 4RLFA 2ZZFA 3OYBA 2NSTA 2F4IA 2A5WA 4C2LA 3DEEA 5CKTA 2NTPA 4G7WA 4MXNA 2R7QA 2XF5A 2ZXIA 4URRA 4LG3A 1BPLA 1O8MA 3T56B 2R7VA 2BW3B 1W9XA 1I18A 3ZR8X 1UELB 1QHGA 2V26A 3OYAA 1UD4A 1PJRA 2W6IA 1SAUA 2ELJA 1PLUA 3GVKA 3HKZA 2MABA 3VSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFL A;  2X6Y A;  4Z05 A;  4OJ5 A;  4W8R A;  4OZY A;  1O88 A;  1CZF A;  2X3H A;  3EQN A;  2EWE A;  3B90 A;  3VST A;  2INV A;  2X6X A;  1JRG A;  3WWG A;  4XN3 A;  1BHE A;  1PE9 A;  4NK6 A;  4XLE A;  1OGM X;  4YEJ A;  1O8E A;  1RU4 A;  4NK8 A;  2QXZ A;  1IDJ A;  4HWV A;  4U4B A;  2PYG A;  4PMH A;  4EW9 A;  3SUC A;  3GQ9 A;  4AVZ A;  3ZPP A;  5C1C A;  1IA5 A;  1O8D A;  1OGO X;  4XKW A;  1DBO A;  3VMW A;  3VSV A;  1O8J A;  4U49 A;  2BSP A;  2NT9 A;  4YZ0 A;  2O0W A;  2VJI A;  4Z03 A;  1KTW A;  2X85 A;  4XKV A;  1QJV A;  3EQO A;  1IB4 A;  2NZM A;  1NHC A;  2NTB A;  4W8Q A;  4YZX A;  4XR6 A;  1O8G A;  1PXZ A;  1BN8 A;  1O8H A;  4YZA A;  4XM3 A;  1WMR A;  2O1D A;  2UVE A;  4XL9 A;  3KRG A;  4OZZ A;  4OJ6 A;  3GQ8 A;  1GQ8 A;  4YZQ A;  4XLA A;  4W8T A;  4XQF A;  1IDK A;  3VSU A;  4XMY A;  3GRH A;  4OJP A;  2IQ7 A;  2QY1 A;  2PEC A;  2O0V A;  1KCC A;  1RMG A;  1EE6 A;  4MR0 A;  5C1E A;  1OFM A;  4YEL A;  1O8K A;  2ODL A;  1X0C A;  3VMV A;  3ZSC A;  1DBG A;  4W8S A;  2VJJ A;  2INU A;  1O8F A;  1VBL A;  3JUR A;  1OOC A;  1QCX A;  4OJL A;  4XN0 A;  1HG8 A;  1H80 A;  1RWR A;  4XOP A;  4XOT A;  1O8L A;  3T9G A;  4XNF A;  1JTA A;  3FY3 A;  3GQA A;  4Z06 A;  3B8Y A;  2NT6 A;  1AIR A;  2VBM A;  2PYH A;  3UW0 A;  2NST A;  3GQ7 A;  3B4N A;  4C2L A;  2NTP A;  1K5C A;  4MXN A;  3LMW A;  4XOR A;  4XLH A;  4URR A;  1O8M A;  4I84 A;  5AMV A;  2NSP A;  4XON A;  4XLF A;  1XG2 A;  2UVF A;  1O8I A;  2X6W A;  2O17 A;  2Z8G A;  2O04 A;  2QX3 A;  1KCD A;  2NTQ A;  4XLC A;  2VBE A;  1PLU A;  4OJO A;  2VBK A; 
#chains in the Genus database with same CATH topology
 3K4C A;  2HDW A;  1BC8 C;  2OV7 A;  2XSD C;  1MBF A;  4B47 A;  3D1N I;  3F8M A;  3ZBU A;  3WXM A;  3VYR B;  3KZY A;  2QKL B;  3GVL A;  1CF7 B;  2HU9 A;  3MKL A;  1OHH A;  1XCV A;  3DTK A;  2K9M A;  3K1N A;  5C3E J;  2KVO A;  1NJI D;  1KQ8 A;  1D0X A;  2OYN A;  4RMN A;  3VYS B;  3R60 A;  4ZZL A;  2QCO A;  3G1M A;  5J4Y A;  3DU1 X;  2X1D A;  5E3M A;  1OQY A;  4PAB A;  5E20 A;  3HTS B;  1YLF A;  2MC3 A;  2JA2 A;  2E60 A;  1X1B A;  1LVA A;  1MD0 A;  2B7E A;  2F5D A;  1WH7 A;  3JRC A;  3CMA I;  2YWG A;  3ASP A;  1YI2 I;  4AVZ A;  3HUG B;  2Z3Y A;  3FWE A;  2Y0S N;  3VSV A;  4UUV A;  3BR1 A;  1PKV A;  4Z4T A;  1B9N A;  3DTE A;  1S5L C;  5HNF A;  2KLO A;  4A3L J;  1U2R A;  2HDN B;  1RPW A;  1VQO B;  2KIS A;  3WU0 A;  2V31 A;  5E1Z B;  3HAG A;  3QQA A;  3SYT A;  2Q6O A;  3CCL B;  1YIJ I;  1IN8 A;  4V2G A;  2Z6B D;  2NZM A;  2OF7 A;  1K4S A;  3W2A A;  4V02 C;  4HZF A;  1PXZ A;  4IPA A;  4G6I A;  3NB2 A;  4G1B A;  9ANT A;  3H3U A;  2PE3 A;  1XMA A;  4EAT A;  1QVF B;  4PC3 A;  2XT4 A;  3SEZ A;  1NB9 A;  4OZZ A;  3K4M A;  2NS0 A;  3OZW A;  1IN7 A;  4PJN A;  1ZRE A;  2DFI A;  2FBK A;  1XB2 A;  3DU6 A;  1MBH A;  5IY5 H;  5K1Y A;  3J7A O;  1U5T B;  4UB8 C;  5KSW B;  3BOQ A;  3GTO J;  2K27 A;  5CQG A;  1QBJ A;  4E4H A;  3CXC B;  2DA1 A;  2P6S A;  4AYB N;  1DQU A;  5IYR A;  2E7X A;  5DD8 A;  1TT0 A;  2JWT A;  4KIT B;  5LFA A;  3AAF A;  2X1E A;  3VMF A;  4AIK A;  1IG7 A;  2YS9 A;  2ISZ A;  2B0R A;  1EA3 A;  1CGP A;  1AA7 A;  3QOP A;  1BMF A;  3T1B A;  2A5Y B;  1TW3 A;  2DU9 A;  5ED4 A;  5LGT A;  5LGU A;  4U7B A;  3EQL F;  1MMS A;  5B1B H;  3JRF A;  4F3Q A;  3ONQ A;  4R79 A;  3P5J A;  5EDN A;  2C5B A;  3SFI A;  1WI3 A;  4ABZ A;  3A1Y A;  4GO1 A;  3W3C A;  2Q1Z B;  2XAU A;  1D0Y A;  1KQ0 A;  4A3D J;  2R5Z A;  2EZI A;  3BT9 A;  2C77 A;  3E5Q A;  4FET A;  3PNV A;  4HEA 2;  4KIG A;  2QY1 A;  2LFB A;  5E6T A;  4ZDO A;  1MBJ A;  3LSP A;  2VPR A;  3HGY A;  2ZXJ A;  2X53 S;  3A3B A;  1ORK A;  4BHB A;  1VQ7 I;  2FOK A;  3P9C A;  4FTH A;  2Z1D A;  4CYC B;  4KIC A;  1YJ9 I;  2MSY A;  4KYW A;  4FN5 A;  4MEX F;  3GLX A;  1Q7Y D;  1RIO H;  3KEW A;  1NH3 A;  1GV5 A;  2H1K A;  1N78 A;  1ODD A;  2VOP A;  4XK4 A;  4PC2 A;  3CCV B;  2NSP A;  3IKT A;  2BVL A;  2O04 A;  2BM0 A;  4MNU A;  1YI2 B;  2HVS A;  3L2W A;  3K2A A;  5EEH A;  2WY7 Q;  3CMM A;  2DJN A;  3DBH B;  1DDI A;  2LG4 A;  2VBK A;  3IC7 A;  1XDU A;  1IV8 A;  2A69 F;  1ETY A;  2X6Y A;  3S3N A;  1S4M A;  3BQJ A;  4Z05 A;  2GPJ A;  4D7N A;  3GF2 A;  1LPQ A;  1T6X A;  5EMN A;  3VR6 A;  4BXF A;  4DQL A;  2VFM A;  4HNV A;  1TYW A;  3T8T A;  1ZAO A;  1LEA A;  3F22 A;  1BQE A;  3KEO A;  3WHB A;  1OFE A;  4XN3 A;  2JSC A;  1LE8 B;  2FMY A;  3GSI A;  4AC0 A;  4WZK A;  1PYV A;  1HW2 A;  2X3U A;  3PO3 J;  2CF4 A;  2P6T A;  1J9Z A;  2PLF A;  4Y4R A;  1BLI A;  3V8L A;  1TLH B;  5J3O A;  5F0C A;  1KGS A;  2UWM A;  1O8D A;  5DD4 A;  1MDM B;  2B9S A;  1B8I A;  2JUG A;  5DSZ A;  3ZZ0 A;  3DPU A;  3O2P E;  1FP1 D;  3A8I A;  2ACJ A;  4A3J J;  4C2M J;  2BXY A;  3OSF A;  4FE4 A;  2FOW A;  3ZQF A;  4DYQ A;  2P7V B;  2GK6 A;  4PJL A;  2XAQ A;  5KK1 A;  2G7U A;  2IA2 A;  3E97 A;  2P4W A;  3ISP A;  3HYI A;  3GTK J;  4HE5 A;  4DK0 A;  1B6A A;  2BVN A;  2JPB A;  2V5I A;  4WWC A;  1VI0 A;  4B3X A;  1V54 H;  1I3Q J;  1GXP A;  1WTH D;  4WXH A;  3ZN0 A;  4YFO A;  5EG0 A;  1D3Y A;  1XGO A;  3Q9S A;  1U8B A;  5IOZ A;  4O3M A;  2JN9 A;  2G7H A;  1WXR A;  2KQR A;  5LGN A;  2HXI A;  3VOE A;  2WAF A;  4CXF A;  3QRF F;  1R5G A;  3CJR B;  3WTY C;  3GME A;  4ESJ A;  1RRJ A;  2NRA C;  3ONU A;  2G9W A;  4UZU A;  1QUF A;  5EG0 B;  3KP5 A;  1Y0N A;  2EV5 A;  4BY7 J;  2VZL A;  1QA3 A;  1O4X A;  3GRH A;  4E7L A;  1BI0 A;  1T95 A;  2HKX A;  2HQR A;  2OU2 A;  2V1X A;  3ZN1 A;  2ZNY A;  5CYV A;  4KH3 A;  1XG1 A;  2G0E A;  2H8W A;  2CYY A;  1VQ9 B;  1O8K A;  3ABU A;  1KYW A;  1JTX A;  2DQL A;  4F7Z A;  4UAJ A;  2R92 J;  2MH2 A;  3L00 A;  4KIF A;  4BEH A;  5IYP A;  4JYK A;  3JAM K;  4E7K A;  1E79 A;  3GTM J;  3LNQ A;  3ZGK A;  1YX5 A;  4B4D A;  3ZXS A;  3K9T A;  2L5Q A;  3FJO A;  3IAM 2;  1ZLJ A;  3TDZ C;  3E7L A;  1Z1D A;  3S3O A;  2FX0 A;  5E3O A;  2ZME C;  3I71 A;  1EFT A;  3HKZ N;  3T9G A;  1O57 A;  2O9L A;  1QFY A;  1GT0 C;  2ZNZ A;  4MFD A;  4KN4 X;  5DCF A;  3DPL C;  1YS6 A;  2OTL I;  1BN5 A;  1HBX G;  5HDN A;  3K70 C;  4FT8 A;  5JMC B;  4JX4 A;  3K0L A;  3K70 D;  1V0E A;  1B23 P;  2XB5 A;  1YYV A;  2XUB A;  3O6B B;  5M5X J;  3ZUG A;  5BPD A;  4C3J J;  3BC8 A;  4V19 K;  2F1M A;  2P5K A;  2CH0 A;  1NB0 A;  1ZM9 A;  4OOX A;  2LY9 A;  5JI6 A;  3A8J A;  5F27 A;  4KNY A;  4FX4 A;  1MJ9 A;  1U6G A;  2VB6 A;  4XLC A;  4EV0 A;  3M07 A;  3H1C A;  1MMG A;  2R6H A;  1MIJ A;  2P5L C;  5F6F A;  1B59 A;  1VZ0 A;  4GXO A;  3REO A;  5H20 A;  1ZEL A;  1R1U A;  1W36 D;  4Y52 J;  4JQF A;  1ZLK A;  2IS4 A;  2XOK A;  3F8B A;  1GXQ A;  2BY1 A;  2OBP A;  5CJ9 A;  3ZMZ A;  5FA6 A;  4ETS A;  2NYX A;  1K78 B;  2X6X A;  2BW3 A;  1UHW A;  3J80 K;  2IS6 A;  4V2F A;  1BW5 A;  2KZV A;  5DM7 F;  2R7T A;  3H5N A;  1PJ7 A;  4N9H A;  5B1A H;  2QDX A;  2L7K A;  2FML A;  4WZE A;  2BY0 A;  1PUF B;  3M4O J;  2HYF A;  2VYQ A;  1HA3 A;  2JUC A;  3ZQQ A;  1PP8 F;  2QXZ A;  2YU9 J;  4MQ9 F;  3Q6R A;  4QFM A;  4BBS J;  4JX5 A;  1S72 B;  2JDI A;  2HR3 A;  3E5U A;  3W2F A;  2MH9 A;  4M3F A;  3RIR A;  4NQW B;  4BHC A;  1K61 A;  2K4J A;  3ERM A;  3Q5F A;  4L5E A;  1HZE A;  2XB0 X;  3OS0 A;  4A0Z A;  2BV6 A;  3A01 B;  1R5B A;  3SLD A;  4CH7 A;  3B82 A;  2GAU A;  3GTL J;  1N8R D;  1G3T A;  2QQ8 A;  1T5E A;  2IA1 A;  4RB2 C;  3LFK A;  2HZT A;  2HDC A;  2JMW A;  4HBL A;  1X3W B;  2OZ6 A;  2NTB A;  1R5I D;  4OAY A;  3MHP A;  4TV7 A;  4D9J A;  1G7C A;  1K4Z A;  3R0A A;  3L2U A;  1D5Y A;  2DMQ A;  1EV7 A;  3BY2 A;  3SDG A;  2QUF A;  4BUP A;  3OS2 A;  2DMP A;  1JUP A;  1XSV A;  3VEP A;  3CCU I;  2M7B A;  1GQ8 A;  4IKF A;  4C3I J;  1OGI A;  1Y6I A;  1GAQ A;  3VSU A;  2DFE A;  3KYL A;  4IOC F;  2LMD A;  4J01 A;  3BTI A;  1NK3 P;  4DJA A;  3ZMV A;  2JA6 J;  2BM1 A;  1VQM B;  2O0V A;  5D4S A;  3DLA A;  3MEX A;  1W2B B;  1X1C A;  1MNM C;  4MR0 A;  1WFX A;  2W1O A;  4OMY A;  1FOW A;  3H3Z A;  2F3L A;  2GOX B;  2C78 A;  3QPT A;  3CUO A;  3S2D J;  3M9A A;  5E8I A;  5CVJ A;  4LBZ A;  1VBL A;  1R71 A;  3E3V A;  2HZD A;  3IWZ A;  3CUQ A;  2UV1 A;  2JVH A;  4TSF A;  2R7D A;  3CO6 C;  2DLL A;  3IHU A;  4CO8 A;  1JHH A;  4BDY A;  3KL9 A;  1K8F A;  1HG8 A;  3DU5 A;  3M8J A;  3U21 A;  5J4V A;  3PNY A;  1R1T A;  2VOO A;  2YWH A;  1K9M D;  1YJN B;  1N05 A;  4HRI A;  3JRG A;  3WBK A;  2E19 A;  4K1X A;  4IHS A;  1YIJ B;  3BLY A;  5FKO A;  4HF1 A;  4DBQ A;  3HXL A;  2QVO A;  2CO5 A;  1APL C;  2NPF A;  4DNR B;  3ASO H;  2CQ7 A;  1BI1 A;  3SYJ A;  1I8D A;  1KD1 D;  4LLN A;  3JW4 A;  1ZR2 A;  2DQR A;  1T98 A;  4LD5 A;  1SM4 A;  1ETW A;  3I54 A;  4CHU A;  1I3A A;  3HOT A;  1EP3 B;  2VQC A;  1HXD A;  1V5F A;  4A3B J;  1JGG A;  2LRE A;  5D4R A;  2VT2 A;  2NVY J;  1O3R A;  4B3A A;  1MSE C;  3CCQ I;  4CCO A;  3OYF A;  2Y9Z A;  3TW7 A;  3KP4 A;  5M3F J;  2CG4 A;  4M71 A;  1TT5 B;  3CMY A;  1N08 A;  2OBR A;  3SEQ A;  3GFI A;  2EA2 A;  1QH0 A;  3EYY A;  3C2B A;  3HTU A;  1W87 A;  3AK5 A;  3L7W A;  3G3Z A;  4NK6 A;  2KZG A;  2R4G A;  3S16 J;  2XAG A;  4Y13 A;  2XF7 A;  2EFW A;  4NK8 A;  1IV6 A;  1VQ8 I;  3I0T A;  3HGG A;  5D6E A;  2E2I J;  4ZJZ A;  5FKL A;  2PLY A;  3S2H J;  3HZJ A;  5H6R A;  3VFZ A;  2LKS A;  5FB2 A;  2ZIT A;  2Z9O A;  3K4B A;  4C2U A;  2D5V A;  2BX6 A;  4HQM A;  5IP6 A;  4XKW A;  3WGI A;  5FLX K;  2F1L A;  1DBO A;  2V1N A;  3VMW A;  3H92 A;  1EFU A;  2H1L A;  3JSP A;  3CW2 A;  4S0H B;  3CCR B;  2XAH A;  1XSD A;  2OBT A;  1X3U A;  2M34 A;  1WQ2 A;  1LEB A;  3CCR I;  2O0W A;  2K9L A;  1Y56 A;  4FHT A;  5GAG J;  1X19 A;  1F4K A;  1V4R A;  4UVB A;  2CV2 A;  3FPK A;  4PDK A;  2OC6 A;  4PFP A;  3CJQ B;  4HNT A;  3AG3 H;  1YJW I;  3V7R A;  1JI8 A;  3JRH A;  1FSE A;  1NG6 A;  3S2W A;  2UUZ A;  2M0M A;  1NHC A;  4P1V A;  4YRV A;  2M3A A;  3SDB A;  2WPD A;  2BV3 A;  3ASQ A;  4M72 A;  1VQN B;  2MA3 A;  2CU7 A;  1QFJ A;  1W7P B;  3SY2 A;  4NQW A;  3PSI A;  1ON1 A;  3BZK A;  3ELK A;  1SD7 A;  1XX5 A;  3H5A A;  3QYF A;  3CME I;  2CBX A;  5C4X J;  3LNN A;  4A0X A;  5M3M J;  2LH9 A;  4OOV A;  1HQC A;  4F93 B;  3FKJ A;  2A6T A;  2E5N A;  4BKX A;  2CC2 A;  4QPQ A;  1UFM A;  2PEC A;  4I01 A;  1MH4 A;  3QU3 A;  2JVG A;  3QP5 A;  2L9S A;  4LIV A;  1T6Y A;  2DFH A;  5E18 F;  4AID A;  4QV2 A;  1LLZ A;  2WAE A;  4ESF A;  4WZT A;  3MZH A;  5FRN A;  1OFC X;  2FBH A;  2NOJ B;  3FX3 A;  4BJT A;  1AWC A;  2D3L A;  1TYX A;  2ID3 A;  3A4C A;  2LBF B;  3LO8 A;  1ETV A;  3G4S I;  1X4P A;  3DLL F;  3RPU D;  4KDP A;  2R5Y A;  2CUZ A;  3E6M A;  1CNF A;  2YX4 A;  1A36 A;  5A88 A;  1KJZ A;  1RWR A;  4PK4 A;  2MFZ A;  1BX0 A;  2K4B A;  2ESH A;  3LQQ A;  1JGS A;  1KZH A;  4LGW A;  2OTL B;  1J75 A;  1T6S A;  2KIM A;  4IX7 A;  3PNT A;  1FIP A;  5GTH C;  1JXS A;  1POG A;  1IRG A;  1ZTR A;  2XTX A;  4I7H A;  2V9K A;  3CCE I;  1VLO A;  2ZZF A;  2C5H A;  4X6A J;  2NST A;  1ENH A;  3FXO A;  3KE2 A;  4LK1 F;  4XRF A;  3HJE A;  5HOD A;  1YW7 A;  3CCM I;  4LG3 A;  5F08 A;  3F8F A;  3T56 B;  5TJJ A;  2BW3 B;  2O61 A;  1WDT A;  3QFS A;  1EA0 A;  2BM7 A;  1IF1 A;  1QGA A;  2HQ5 A;  2GWR A;  3CTA A;  5ILV A;  4OJ6 A;  1QA2 A;  2CUE A;  2W57 A;  2BEO A;  5F64 A;  3PVD A;  4JP0 A;  3OYA A;  3E6C C;  5E1W A;  5FLX Z;  1PJR A;  2NVX J;  2FE3 A;  4BHP A;  1BA5 A;  1IW7 F;  3HKZ A;  1P4X A;  4CSW A;  3VST A;  1L1I A;  1J59 A;  5DYM A;  2QA4 I;  1OFL A;  4J19 A;  2IS1 A;  3WTV C;  3QFT A;  2BM5 A;  2A3S A;  2EZK A;  3BZ6 A;  5GTI C;  1CZF A;  3HOW J;  5JLV C;  2HI3 A;  2X3H A;  1WHU A;  3ULQ B;  3W5V A;  3TL4 X;  2GLO A;  3OL3 A;  1B2R A;  3I64 A;  1MKM A;  4RS8 A;  3OYL A;  4HE6 A;  1R9T J;  2IXS A;  1Y1V J;  2HLD A;  4P6V F;  4UZE A;  5H59 A;  4DQK A;  1N07 A;  1LQ1 A;  3P27 A;  4GYI A;  3E1S A;  2W24 A;  3QP6 A;  4UXN A;  2F4O B;  3LVB A;  5GAD J;  2KIU A;  2R5Z B;  3LOC A;  3ZP5 A;  1VTN C;  1EP2 B;  3W2E A;  1N06 A;  4RAG A;  4RGX A;  1YX3 A;  2QQA A;  5EZH A;  2GQQ A;  2Y0M A;  1J0R A;  3V7S A;  1ZM2 A;  2DOA A;  1VQP I;  1UD3 A;  3ABT A;  1SFK A;  2A6H F;  4NUB A;  4IOA F;  1QGZ A;  2WV1 A;  2QTZ A;  1G3W A;  4EM2 A;  3LMM A;  4JOM A;  1F5T A;  2PMH A;  1QVU A;  4C43 A;  3CJT B;  1DPU A;  3Q39 A;  1DG1 G;  2GRE A;  4G94 A;  2I1L A;  2EFG A;  3WTX C;  1G4D A;  2DOG A;  4E7Z A;  3M1C A;  1TL8 A;  1A31 A;  1SKY B;  3W2H A;  4HPQ A;  3PIO F;  2WJY A;  3KIO A;  5FIU A;  1FNM A;  3EQO A;  2XKO A;  4RD6 A;  1FYK A;  3CC2 B;  3DWL E;  4KT6 A;  3HEF A;  4LG0 A;  4YZX A;  4XR6 A;  1EWY A;  5J6X A;  3WTZ A;  4KKU A;  2JA5 J;  1TC3 C;  3PSS A;  2HQA A;  4TT3 A;  5TRD A;  4ZCL A;  3TO6 A;  2HVR A;  4NBS A;  4CYD A;  1X58 A;  1WJC A;  4XMY A;  1KQS B;  4BXU A;  1ZG1 A;  2ZL5 A;  2EV6 A;  1K6Y A;  3GFL A;  2ID6 A;  1ZG5 A;  4G12 A;  3KYC B;  3RYR A;  3GW2 A;  2EZH A;  2ME6 A;  1VQ4 B;  3WYA A;  5FRM A;  4RM2 A;  1H42 A;  2FXA A;  2XKP A;  5J1R A;  1YFH A;  1TLL A;  2WB1 A;  4E7I A;  3HSE A;  4M3G A;  3NQO A;  1IO2 A;  4RAZ A;  2X0L A;  4PC7 A;  4B3G A;  1BJZ A;  3P7N A;  1NG7 A;  4Y33 A;  2E1M B;  3FM3 A;  3OV8 A;  2V6C A;  4LC0 A;  5D5U B;  2Z16 A;  4I6Z A;  3F6V A;  5KHD A;  1LFB A;  3MD2 A;  3E0J B;  1R6R A;  1Y0U A;  5FRO A;  2BSA A;  5IP9 J;  5TY0 A;  2LP0 A;  4XOT A;  1AKH B;  3KEY A;  2E1C A;  1H9T A;  3FF5 A;  4LK0 F;  4M9X A;  5KCM A;  5J8C A;  5EF6 A;  3MZY A;  1FLI A;  3GQA A;  2XVC A;  4KA4 A;  3B8Y A;  2ZSI B;  3T53 B;  2EH3 A;  3M1E A;  1HVX A;  2H6C A;  4AM3 A;  3W2I A;  1YG2 A;  3H94 A;  3GQ7 A;  4B48 A;  2HPM A;  3RKY A;  3ESW B;  4HX8 A;  2OQG A;  1TNS A;  3RPQ A;  1QA1 A;  1UST A;  1YOV B;  2VQG A;  2YUH A;  2ICW G;  3JTG A;  4X06 A;  2MC4 A;  1XSX A;  2L7F P;  3VB2 A;  4PSW A;  1KCD A;  2V7T A;  3BJA A;  1JKO C;  4B8X A;  1X1A A;  2V7X A;  1BX1 A;  1HC8 A;  1KK2 A;  4U0W A;  3GO5 A;  2WAQ A;  3KP2 A;  4BL0 B;  2P7C B;  2VE9 A;  3JQR A;  2DJI A;  2D9R A;  2Z5U A;  1YHQ B;  1TYU A;  5EEA A;  1PP7 U;  2JK3 A;  5CVV A;  2PFB A;  3SFZ A;  3X2Q H;  3VYU B;  2CUF A;  1E62 A;  3GCM A;  1WPK A;  3CES A;  3DQV C;  2RQP A;  4JBA A;  2QQB A;  1IN6 A;  2HTS A;  4QWQ A;  4CUG A;  2RN7 A;  3VNV A;  2K85 A;  1QGY A;  4C2T A;  3V4G A;  3AVX A;  1OIS A;  2L9V A;  3OYD A;  1EZG A;  4RDK A;  4ZC3 A;  4YEJ A;  1O7F A;  2GJP A;  1VQ9 I;  3P9I A;  3BWG A;  3WG7 H;  2R5Y B;  3FDY A;  3C7J A;  1YJN I;  4YXW A;  3OYG A;  4YFK F;  2RV8 A;  4N0B A;  3A35 A;  5AIQ A;  2CW5 A;  3KEQ A;  3QYE A;  5HVQ C;  1ZYR F;  4YIR X;  2B0L A;  2MD0 A;  3V76 A;  1O8J A;  4JX6 A;  5BQT A;  2OTJ I;  1MNE A;  3ZQ7 A;  1FZP B;  1WJE A;  2E71 A;  3JSO A;  3HOY J;  4ROX A;  2DY1 A;  4GDF A;  1Z91 A;  3ZIA A;  4EVI A;  5F04 A;  1I6X A;  1UJ8 A;  5JBQ A;  4AVP A;  1FDR A;  4Z4U A;  3B6C A;  5IYW A;  1Z0X A;  4FX0 A;  2GBY A;  4Q4Z F;  3BG9 A;  3CLQ A;  4XRS G;  1D2E A;  1Z3X A;  1D1A A;  3DV8 A;  2RC5 A;  3PUB A;  3WGG A;  5KNL A;  5GV8 A;  1VQK I;  2MW8 A;  1WP6 A;  1BM9 A;  5HS8 A;  1P2F A;  1C0W A;  4RDL A;  2WZP P;  1QPM A;  2H94 A;  4XSX F;  4DBR A;  3GQ8 A;  4BE2 A;  4MEY F;  3T8R A;  3RCO A;  3BY6 A;  1IUF A;  2KRH A;  3OOP A;  4G7Z F;  3Q6Q A;  2IAI A;  1M1K D;  2DBB A;  2R7R A;  2IGK A;  1K78 A;  3ECH A;  4X05 A;  1TTY A;  3V7C A;  1WPC A;  2DCU A;  1GV2 A;  3ML3 A;  5EGO B;  1KCC A;  3OJX A;  5TV2 A;  2NAZ A;  4B44 A;  4RJL A;  4Z4Y A;  3G4S B;  1U9N A;  1MSF C;  3ZSC A;  1R1V A;  2XRL A;  3DPT A;  3HSR A;  4Z4V A;  3EYI A;  6PAX A;  3GUD A;  4TMZ A;  4MLO A;  2STW A;  4A6D A;  2VJ5 A;  4NHJ A;  3WOD F;  3MVP A;  3ZCO A;  4H4K C;  2XPW A;  4XN0 A;  2R7U A;  1H80 A;  2DPD A;  4NC8 A;  2QZA A;  4ACA A;  4HA8 A;  2NNY A;  4XNF A;  4PSX A;  4PJM A;  2IPQ X;  1DU6 A;  2XT2 A;  1TZL A;  3CLO A;  3TGN A;  3CCM B;  1RQP A;  2WTE A;  4P25 A;  3PA2 A;  2L7M P;  2Y69 H;  2GQF A;  2W82 A;  5IOY A;  5E1X A;  5KW9 A;  4RM3 A;  1T6Z A;  1MZB A;  3FPP A;  2FBI A;  2JRM A;  3OYK A;  3F21 A;  1G7S A;  1OGJ A;  1ULY A;  1GJR A;  1XG2 A;  3AL0 B;  2Y75 A;  2LLK A;  2JJ2 A;  4BGD A;  2F4N A;  2QX3 A;  1OCP A;  2WBM A;  4QTR A;  4RA2 A;  1HST A;  1P4A A;  2ZFU A;  2YSR A;  3JCU C;  4B4C A;  1Y39 A;  1XPX A;  1PDN C;  4OIQ F;  3HC7 A;  3HRU A;  4ZTF A;  2IGO A;  2FVG A;  4XID A;  2HVQ A;  2D45 A;  5LHG A;  3SJZ A;  1UHS A;  2BMW A;  2FF4 A;  2VBX A;  3JRI A;  2K9N A;  5L3G A;  3S93 A;  5JHF A;  3I56 I;  2XRN A;  2MBF A;  2DDB A;  3GFM A;  4LIU A;  5JLX A;  2R7F A;  3B90 A;  2OK7 A;  3EQN A;  1RES A;  1WJ5 A;  2HKO A;  3K4L A;  1QFZ A;  1E3H A;  3BH6 B;  3U6K A;  3ISX A;  3S1Q J;  1R4M B;  5ICF A;  3ZMS A;  2VQL A;  2EFN A;  1FNN A;  1T0F A;  3VO1 A;  1LFP A;  1HA8 A;  5EGO A;  2VNK A;  4P96 A;  5LBQ A;  2O6W A;  3ZRG A;  3HL2 A;  4RB1 A;  4B43 A;  4GYG A;  4LLL A;  4R8H A;  2VL8 A;  1WKM A;  4A5M A;  2X8K A;  2LK2 A;  3TED A;  4C0S A;  1L3L A;  3FBI B;  3FXL A;  5C1C A;  1Z6R A;  4YAO A;  1OGO X;  2VNI A;  2OZU A;  4K2E A;  2ZXH A;  1LB2 A;  4HOB A;  2CQN A;  5FL7 A;  1TYV A;  4Z4W A;  3OKX A;  4QVA A;  3P9K A;  4YEI A;  3TDU C;  4EM0 B;  4KFC A;  1STZ A;  1FC3 A;  1Z7L A;  1H8A C;  3H9G A;  3MKW B;  2M5W A;  2X85 A;  2K02 A;  1E63 A;  5K7Z A;  5H2F C;  5BOX A;  1RR8 C;  2CQK A;  1KQ9 A;  1YW9 A;  1VJS A;  1O8G A;  2PIA A;  2OJE D;  4J00 A;  4YZA A;  3JRD A;  5B5E C;  1BR4 A;  1UCR A;  5AIP A;  1TWG J;  3OL4 A;  4XL9 A;  3H9N A;  3CCS I;  2V6E A;  3ZPL A;  3TP0 A;  1V5E A;  3CC4 I;  3PET A;  2L3D A;  3DEW A;  2Z2S B;  2OA4 A;  4EGZ A;  3TOB A;  4IQJ A;  3T51 B;  4RLZ A;  3KX2 A;  5J47 A;  1XD7 A;  2QZ8 A;  1OR7 A;  2V7F A;  4M9Z A;  4O5V A;  4DNC A;  3AGP A;  4WQM A;  1OLT A;  3HSF A;  3GZN B;  1DGW Y;  2I8D A;  3A03 A;  3J7Y J;  2H6B A;  4D7M A;  4UV9 A;  1X2M A;  2XPU A;  4ZH4 F;  4NNJ A;  4YEL A;  1OB5 A;  3Q0W A;  2V9P A;  3ERE D;  4PGH A;  3OOU A;  1FYM A;  1W1W E;  1V3F A;  4X0C A;  4X7C A;  1ZGW A;  5GAH J;  3I4P A;  1UG2 A;  2BGI A;  2DA5 A;  1JT0 A;  1KMH A;  3M7G A;  1H88 C;  2BF4 A;  3EDP A;  1XGN A;  2L2O A;  3JRE A;  1MAB A;  4HX7 A;  1ZGA A;  1EF4 A;  3BH4 A;  1X1P A;  1G7R A;  2CWE A;  4X1E A;  2AQF A;  5FO5 A;  4Z06 A;  1RKT A;  3UKG A;  2ZJP F;  2HPI A;  2VBM A;  4ENM A;  1SEU A;  4P55 A;  3WTU C;  1MJB A;  2Q6L A;  3CCJ I;  1BJA A;  5LLQ A;  1MDM A;  3K4K A;  5H5J A;  1NTC A;  4X7F A;  1I50 J;  2YWE A;  5IP7 J;  5LHI A;  1SAN A;  4U0Y A;  3DF8 A;  3R6S A;  1FOX A;  1EFC A;  3GVA A;  4KUM A;  4P9U A;  3AG4 H;  3GX4 X;  5EJC A;  2Q6I A;  1ZM4 A;  1P7J A;  4FXU A;  3A8K A;  2FUG 2;  2VBE A;  4A5N A;  4G7H F;  1GLN A;  1WOS A;  1LE8 A;  4N4O B;  1YJW B;  3DCF A;  3OSG A;  4XKC A;  1AHD P;  4BJ5 C;  4QPO A;  4U87 A;  2M0C A;  2BM4 A;  4F52 A;  3N97 A;  4LMY A;  2R7Z J;  1TWA J;  2R7O A;  1XN7 A;  2EWE A;  4ZCM A;  4RGS A;  1B72 A;  5A89 A;  1JRG A;  1R36 A;  2WZN A;  2XTW A;  2RNJ A;  3FXU A;  3QAH A;  4KJZ A;  1XE1 A;  1Z7U A;  2HNH A;  1WSV A;  4L0Y B;  1EKE A;  5AN9 A;  3JQQ A;  2AXL A;  1MW7 A;  2IP2 A;  2EBI A;  5DDG A;  2GJR A;  4N3N A;  1RU4 A;  2XAJ A;  3HHH A;  2FJ1 A;  1U2W A;  3F8N A;  1QZZ A;  5FD5 A;  3W6V A;  2ZCW A;  4HWV A;  4A93 J;  3FZV A;  1FND A;  4TKO B;  4PMH A;  4ENK A;  1QUE A;  1SKQ A;  2BXZ A;  3F72 A;  4HIZ A;  5LEK A;  3GYH X;  3DXJ F;  1AKH A;  5DV5 A;  4BDZ A;  4CCK A;  1S7A A;  1K7A A;  3HPG A;  4JRA C;  4UZF A;  2NT9 A;  5ICG A;  2AHQ A;  4YZ0 A;  1JTY A;  4IZZ A;  1FNC A;  2ME0 A;  4OPO A;  2LBF A;  4A2U A;  4BE1 A;  2QKM B;  4FIS A;  2Y30 A;  1HDD C;  1VFC A;  4XRM A;  4ENJ A;  4R1H A;  4XKV A;  1AU7 A;  5HZB A;  3SXY A;  4XLP F;  3C1D A;  5KAI C;  4OOS A;  3KYD B;  4L18 B;  4BAC A;  4MTD A;  2F48 A;  1BN8 A;  2LDU A;  2XDV A;  2XPV A;  2PBI A;  4XSZ F;  1YIO A;  4XM3 A;  2AS5 F;  4RDJ A;  4LJZ F;  4UUT A;  4X8I A;  3CMA B;  2KPM A;  4GCV A;  3HOS A;  4RPB A;  2P8T A;  1S7E A;  4XQF A;  2VBW A;  3FM5 A;  3H9J A;  4RD2 A;  1IDK A;  2LNB A;  3ABL H;  4L9T A;  1Z77 A;  5DM6 F;  4KT5 C;  3I4M J;  5LHH A;  1V5V A;  3CF2 A;  3N4M A;  2EK5 A;  4B3F X;  1P9Q C;  3DBR B;  2ECC A;  2ZME A;  2Z33 A;  3VPR A;  1WVR A;  1YE9 A;  4YHB A;  1XGM A;  3WGH A;  3OIQ A;  3M3Y J;  2HOA A;  4S04 A;  1YO5 C;  2F4M B;  2LSO A;  4UB6 C;  3I53 A;  2VON A;  2E36 A;  3BDD A;  2O7O A;  3S32 A;  1R23 A;  1R00 A;  2CFX A;  2HYG D;  4E70 A;  1BR2 A;  5HLH A;  3HBL A;  1LFU P;  3FHN A;  3KLN A;  4UY8 I;  3HRM A;  2W00 A;  4G5G A;  1W5S A;  2DCE A;  2K7L A;  1F36 A;  4G7O F;  3QFR A;  4WWV A;  3LA7 A;  4AC9 A;  1TQM A;  3AVV A;  3WG9 A;  4AWX B;  2ZXW H;  3OYB A;  3ZQC A;  3IV5 A;  1IHM A;  4A12 A;  2A5W A;  3BR6 A;  2DOE A;  3DEE A;  1IXC A;  5GP9 A;  4G7W A;  2HCJ B;  1VQK B;  2NTP A;  4C2L A;  2BPO A;  2XNJ A;  1AOY A;  4TMT A;  4M9S A;  5TR9 A;  2XF5 A;  1BPL A;  1X2N A;  2R7V A;  1J2X A;  1F60 A;  1QHG A;  2E34 A;  1R5N A;  1Q1H A;  2P81 A;  2GXB A;  1FTT A;  4IRG A;  3SQV A;  2KJB A;  1SAU A;  3IKV A;  2ELJ A;  2ZJR F;  4NBQ A;  3WE2 A;  1ZRF A;  2MAB A;  1PUE E;  2DER A;  2ZJQ F;  1N77 A;  2M1B A;  1MJA A;  3GEZ A;  4IJA A;  3S3M A;  4W8R A;  2F5C A;  2FNA A;  5CVI A;  1VND A;  2UZK A;  3HOZ J;  2ZTG A;  3GBG A;  1DU0 A;  1OJL A;  3K2Z A;  5JVG F;  2XEX A;  2ZFW A;  2GXG A;  1HKQ A;  4DQ2 A;  1LNW A;  1G7T A;  1Q9S A;  3B8H A;  4M3B A;  4JMQ A;  1Q81 D;  2D1H A;  3WWG A;  2EIM H;  2BE5 F;  4KN7 X;  1QPI A;  1LJ9 A;  5IYN A;  1WGX A;  3V42 A;  4UHT A;  2VN2 A;  3OR1 C;  3E5X A;  2KDO A;  2VT3 A;  3CUQ B;  1COW A;  1P4W A;  2L7Z A;  4IQ4 A;  4L5I A;  1DUX C;  1EJ9 A;  4EJT A;  1T56 A;  2HGC A;  2COM A;  2V79 A;  3WTT C;  2K3F A;  1J7K A;  1QA6 A;  3HG9 A;  4W97 A;  2KJC A;  4XIC A;  2XNC A;  4TMX A;  1FRN A;  1S72 I;  2CUJ A;  1ZN2 A;  3FBN B;  4UUS A;  2XRO A;  4WCG A;  4YFN F;  3CB4 A;  5B6I A;  4G7X A;  5H6Q A;  1VQ6 I;  2DET A;  3R0J A;  5LD2 C;  4HV6 A;  3RQ4 A;  3OP1 A;  2LD5 A;  1Y8Q B;  5EEG A;  1E17 A;  3I4N J;  1VHE A;  2PEX A;  2QTL A;  5FKM A;  5GPC A;  1RC9 A;  4RB3 C;  2DMT A;  4MQV A;  2KMU A;  2VBU A;  5F0H A;  1TUI A;  3OY9 A;  1IJW C;  4U88 A;  3KZI C;  3JQP A;  4P9F A;  3GTQ J;  3IAS 2;  1KK3 A;  2NVU B;  5FLM J;  1E3P A;  2KP6 A;  3KRG A;  4Z2Y A;  5TGT A;  2QBY B;  3PUN A;  5IYB J;  4OP7 A;  2JT1 A;  3F8C A;  3HRS A;  2ZME B;  3BR5 A;  1T33 A;  4YII A;  4I99 C;  3TO9 A;  2V1U A;  3HDD A;  2V7W A;  4YAW A;  1KC8 D;  2HEO A;  3D26 A;  4P2N A;  4A3K J;  3WU1 B;  2KIQ A;  1RMG A;  4GRI A;  3QFC A;  1OFM A;  5KAF C;  2ODL A;  2X4H A;  4ZYD A;  1VQM I;  2ZTN A;  4LB5 A;  4Z4Z A;  1UD5 A;  5LEJ A;  1K8A D;  2NOG A;  3JUR A;  5J1Y A;  4KKS A;  4H9G A;  4L9N A;  3K1M A;  1E64 A;  5DTD A;  1Q1V A;  1LUJ B;  2EIX A;  2MD5 A;  2M4G A;  4IW3 B;  1BOA A;  5FO1 A;  3RY8 A;  4E7J A;  2JQ7 A;  2CFO A;  3B02 A;  5F4M A;  3HIF A;  3NWS A;  3F6O A;  3CC7 B;  4E0F A;  1FP2 A;  3K1P A;  1WJA A;  4MGR A;  3S1N J;  2NS8 A;  4A3G J;  1Z21 A;  2Y9Y A;  1B4A A;  3ABK H;  2GJK A;  1VQ7 B;  4EQQ A;  3CZ6 A;  3B4N A;  2KRF A;  1P4M A;  1K5C A;  3FK7 A;  2VKH A;  1QHH D;  3FHZ A;  4ZGN B;  2Q8K A;  2XGE A;  1A8P A;  1IRX A;  3IWF A;  1M90 D;  3DBL B;  3Q3A A;  1Z9C A;  1VQ4 I;  2ZBV A;  4B1R A;  5GAE J;  5JHU A;  3FXJ A;  3QU6 A;  2Z8G A;  3GTG J;  1YX2 A;  3PUM A;  4BQA A;  2JN6 A;  2EIN H;  1ZK8 A;  2R93 J;  3DKY A;  2J7K A;  2RNG A;  5HS9 A;  3H09 A;  1R49 A;  2O03 A;  1WJD A;  1U8R A;  4KMF A;  1YS7 A;  3AG1 H;  2E2J J;  3GVJ A;  3PQJ A;  4AUX A;  5FJ8 J;  1E1R A;  4L5J A;  3OIP A;  4NB5 A;  1SAX A;  2CS3 A;  1YIT B;  1QU3 A;  2OQR A;  1KK1 A;  3W2G A;  1MMN A;  1K28 D;  4DYR A;  5E17 F;  1TQI A;  4Z1M A;  1YIT I;  5L46 A;  5D6F A;  3W2W A;  5L3E A;  3G05 A;  2INV A;  2WSS A;  2A6E F;  2KHM A;  2VOD A;  3OYE A;  2XGX A;  4R71 A;  1QVT A;  1RZ4 A;  4EJW A;  3Q38 A;  3RYP A;  2V4J C;  1VQL B;  4FWT A;  3V8K A;  4G9Y A;  3CO7 C;  2M4K A;  1Z3Y A;  2X51 A;  3BTC A;  3GWZ A;  4W1U A;  4P26 A;  3ZBT A;  2WJV A;  2KT0 A;  2VIX A;  3BPX A;  3VNU A;  2XF6 A;  3ZPP A;  2XAS A;  3GTP J;  5D5W B;  1KZL A;  4BYY A;  1H89 C;  1F1Z A;  2LY2 A;  3SLN A;  4G1V A;  1P92 A;  1REP C;  4BEH B;  2XV4 S;  1ETX A;  2LY1 A;  1V55 H;  3G2B A;  2WAD A;  2LZJ A;  2M30 A;  1KTW A;  3LFU A;  3QSY A;  2LOO A;  4LBY A;  3UNG C;  3U2R A;  3SHF A;  3DP7 A;  3OYN A;  1JT6 A;  2IBD A;  2LKX A;  2O3F A;  3V7A A;  1KQ5 A;  5EYR A;  5ILS A;  3ABM H;  2OK8 A;  1QQ1 A;  1U0J A;  3TW6 A;  4BAY A;  4E6K G;  1E43 A;  2VBT A;  2O1D A;  3BG7 A;  4P3Y A;  4E7S A;  5HOO A;  3L1P A;  2ZZG A;  4M4S A;  1RR7 A;  4AU7 A;  3RI4 A;  1H9G A;  1D8J A;  2VKV A;  1ERD A;  2I10 A;  5DCM B;  3HRT A;  4IRH A;  1KU3 A;  1NBM A;  2W84 A;  3ZQI A;  4YG2 F;  1D0Z A;  2QEN A;  1EE6 A;  1O3T A;  1M1E B;  3PSF A;  4ZYH A;  1B8I B;  1W0J A;  4HLX A;  1DGR M;  2BBY A;  1X0C A;  3WNC A;  1JE8 A;  2VXD A;  2M5S A;  5E3L A;  2IEK A;  2IW5 A;  1IB0 A;  4ZDP A;  4ZYA A;  3OYC A;  1OOC A;  3S1R J;  3KP3 A;  2OAZ A;  5BSX A;  4TMW A;  4CCJ A;  1CF7 A;  2OPT A;  2PMZ N;  1QCX A;  5CVU A;  1PJ5 A;  4M73 A;  3A01 A;  2GK7 A;  5D5X B;  5BSY A;  3SZP A;  5JR3 A;  4WK8 F;  3L2C A;  2FX3 A;  1ELO A;  3GZ6 A;  2DDA A;  4XD7 A;  3WND A;  1A6I A;  2XZP A;  3LA2 A;  3BRO A;  4I09 A;  3RKX A;  1E3X A;  4IHX A;  1JTA A;  3OYJ A;  1KU7 A;  1CLW A;  1RET A;  3BJO A;  2B7C A;  3CPX A;  1UMQ A;  2NT6 A;  2PYH A;  3UW0 A;  4EH1 A;  1I5Z A;  4D5F A;  1ZRD A;  3OYH A;  3LSM A;  3Q0V A;  2DT6 A;  3CP8 A;  1SFE A;  2BN4 A;  3HM5 A;  3R61 A;  4P12 A;  4HYE A;  3LST A;  2XC1 A;  3FXR A;  4MO7 A;  4P1W A;  2V7V A;  5FLV A;  1LDD A;  2HXO A;  1SC7 A;  1HF2 A;  2DA6 A;  4IXA A;  5DUK A;  2NXN B;  4A6E A;  4CCL A;  1JJ2 B;  2XGJ A;  2FEZ A;  2LKP A;  4XRS A;  4FCY A;  4EEF G;  1T0F C;  3CC7 I;  3J81 k;  1I27 A;  4M0L A;  1GVH A;  5J1U A;  3SJM A;  4RD1 A;  3S15 J;  2CRG A;  1QNT A;  1EFR A;  1XMX A;  5D8K B;  1FX0 A;  2A05 A;  3BTL A;  1H85 A;  3NAR A;  1WH5 A;  2OCE A;  3BR3 A;  3LSI A;  3CC4 B;  1IJE A;  2BHY A;  2OTJ B;  3LJY A;  2ZSH B;  2K9Q A;  2RGV A;  2V7U A;  3CCS B;  4Z6Y A;  1G8X A;  3KFW X;  1WOP A;  1ZRC A;  1BR1 A;  1H0M A;  1ZR4 A;  3L09 A;  2M87 A;  5E3N A;  3OPO A;  3J81 K;  2QF7 A;  1XC5 A;  5E8G A;  2VBZ A;  5DCM A;  4U4B A;  4RLQ A;  2L9R A;  3RDI A;  1I6H J;  3PQK A;  5CDF A;  3ZQH A;  1YW8 A;  2R3S A;  3DDY A;  1D5V A;  1J9I A;  3PFI A;  1I1G A;  4ASN A;  5CQE A;  3RJP A;  2FQ4 A;  3ECO A;  3K10 A;  4QUZ A;  1OCT C;  4DNT B;  1S8N A;  3VSK A;  3K4N A;  3MAJ A;  3VOD A;  2R7S A;  4OAZ A;  1Q82 D;  1F9N A;  4GGG A;  2XSJ C;  1DDG A;  3I5U A;  1OCR H;  1D1C A;  2YR2 A;  4M6X A;  3G1O A;  2IS2 A;  4P6Y A;  3N6Z A;  2Y0S A;  4PC1 A;  4C9Y A;  3J81 Z;  2VAS A;  1XFO A;  3O3K A;  4C30 A;  1N0U A;  2DOD A;  4E7H A;  3U6B A;  2PG4 A;  1Z67 A;  1O8H A;  1BOB A;  1JJ8 C;  3ZMD A;  3MWM A;  5FGM A;  5HS7 A;  3PIP F;  4ZCI A;  4HAM A;  2DYS H;  2L9N A;  4Z4S A;  3Q3S A;  2PX9 A;  3BCB A;  1IAW A;  2E1B A;  2LF7 A;  4CDG A;  2HDD A;  1FMV A;  2R0Q C;  4EJV A;  4Z4R A;  5IT9 K;  2DA3 A;  4G6Q A;  4IRI A;  3OW2 B;  1FPQ A;  3MCZ A;  5B3S H;  4BE0 A;  2DIE A;  5J8F A;  1S29 A;  3VMV A;  3BP8 A;  1IN4 A;  1BI2 A;  4DOZ A;  3MN2 A;  2C2W A;  4RCZ A;  3CDL A;  2IOU G;  3LQR A;  3JAM Z;  3BCF A;  1JKR C;  3IH3 A;  1EXM A;  4HF2 A;  3ZQG A;  1LKX A;  3NAU A;  1R5H A;  2WC2 A;  4LBW A;  4AF7 A;  2VUM J;  1QVG B;  5C44 J;  2KL4 A;  2C6Y A;  2DA7 A;  3PL8 A;  4I02 A;  2M2E A;  1TBX A;  5HLG A;  5F4O A;  3ZMT A;  4AYB A;  3HUG A;  3TQN A;  2AQE A;  1TTT A;  2JRT A;  3OWT A;  5F1R A;  1ONV A;  4IHY A;  5CVR A;  1D1N A;  3SUC A;  2ZBU A;  1OB2 A;  1AIR A;  3D5S C;  1KYZ A;  1LDJ A;  2P5V A;  3OYI A;  3CCL I;  2OBS A;  4M1K A;  2XTY A;  3L9F A;  1ZG3 A;  1Y8R B;  3KPH A;  2VXZ A;  3G73 A;  3LMW A;  4XLH A;  2JIZ A;  4BBR J;  3MQ0 A;  1JJ6 C;  2WA0 A;  2GA2 A;  4A0Y A;  4I84 A;  1I39 A;  3M8E A;  4XLF A;  2NV4 A;  1DPR A;  4EGY A;  2LVS A;  1WZ2 A;  4CCM A;  1KON A;  4FQG A;  3A2K A;  2QEX B;  2L4A A;  1TQP A;  3EUH A;  1G3S A;  2B5O A;  3E6D A;  5HLT A;  2GZW A;  4WXD A;  2PMD A;  3PUF A;  5AMV A;  1HOM A;  5J3L A;  1A35 A;  4ACB A;  4ZV4 A;  2YPR A;  1VF9 A;  4QLC U;  4BXX J;  4OZY A;  3OEE A;  3BH7 B;  2ELK A;  2L4M A;  3AVT A;  3P26 A;  2X1C A;  4U0V A;  1S6L A;  1OFD A;  1LM1 A;  1OKR A;  2C4U A;  4HX4 A;  4KIB A;  1HW1 A;  3C2G A;  3JTH A;  2ETH A;  2QSG X;  2LF8 A;  3HOV J;  3ZPN A;  2M8G X;  3ZZT A;  3AVU A;  3EUA A;  4M3E A;  2XND A;  1W0K A;  1O8E A;  2VNJ A;  1R58 A;  2F5V A;  2VBS A;  2CW8 A;  5IPA A;  1V5G A;  2TRT A;  1FBU A;  2VC0 A;  2YU3 A;  3GTJ J;  3MMP A;  2UXN A;  5LMZ A;  1T38 A;  2ZL7 A;  2OD5 A;  1HLV A;  2BYV E;  2W6J A;  3GQ9 A;  1FT9 A;  3W6J B;  1E0E A;  2QN6 A;  4F91 B;  3OW7 A;  1YRN B;  2BSP A;  3PSZ A;  1SFO J;  1XQB A;  1TP4 A;  4UUS B;  3MKZ A;  2KKO A;  4CQJ A;  3PJR A;  1UG0 A;  5K5Q A;  2QMU A;  1NRK A;  1FSH A;  3A02 A;  4N9I A;  1VF7 A;  2VJ4 A;  1MBG A;  1MBE A;  4LFU A;  2DFF A;  2WYR A;  1WRJ A;  4OMZ A;  3VSL A;  3J7Z I;  3OYM A;  4UNO A;  4LIT A;  1K73 D;  2K9S A;  1N25 A;  3JRB A;  4HDU A;  4MYU A;  2LR8 A;  3S1M J;  5CLS A;  1CQT A;  5L3B A;  1XCB A;  3PFY A;  3TO7 A;  5THX A;  3WY9 A;  2XHK A;  1YLO A;  1MH3 A;  4PJ0 C;  1ZUN B;  3OR2 C;  3K69 A;  4YZQ A;  2L0K A;  3RPU A;  3GIR A;  1SD6 A;  4GFB A;  2K3P A;  2LRD A;  4RGU A;  4ZGQ B;  1OCZ H;  4OJP A;  4II2 A;  4Y3O A;  3C3W A;  3O8H A;  4BU2 A;  1V0F A;  3BZC A;  2DT5 A;  2PN6 A;  3J80 Z;  2B63 J;  4M3D A;  1W36 C;  4G6T B;  2E1N A;  5IK2 A;  1SVO A;  3H3V K;  4X7E A;  4W8S A;  1W34 A;  3D5R C;  4KMU X;  5TIS C;  2INU A;  4CYC A;  3DTI A;  1BW6 A;  3BPV A;  2LC2 A;  5HLI A;  1NHA A;  1TWH J;  3LWF A;  1X1D A;  4HNU A;  4Y17 A;  2RKH A;  3CC2 I;  2VPL A;  1DP3 A;  2F6C A;  1R7J A;  1W5C C;  3BR0 A;  4F92 B;  5DS9 A;  2VLA A;  2VC1 A;  2STT A;  1QG0 A;  3LQ6 A;  1XMK A;  1SMY F;  4G8X A;  1F20 A;  2XGD A;  1ZGJ A;  3F0C A;  1BBY A;  4Q48 A;  2QM3 A;  2IRF G;  1U78 A;  4O6J A;  2FNP A;  4PGG A;  3CCE B;  3GFJ A;  3E6B A;  3LSJ A;  4CIC A;  2BZT A;  2K86 A;  4YIF A;  2IT0 A;  3CDI A;  3V8J A;  2DK5 A;  1I1S A;  1SD5 A;  2ADU A;  3CJN A;  2F4I A;  1LLW A;  4WX9 A;  4OM9 A;  4A3I J;  5CKT A;  2I5U A;  1I7P A;  2DTR A;  4AF6 A;  3A0B C;  4X7D A;  3FK6 A;  2OCC H;  2R7Q A;  1Q86 D;  4URR A;  2COB A;  3MZ8 A;  4CZZ A;  3SZE A;  1IRZ A;  1S3J A;  2MLG A;  1W9X A;  1VQ6 B;  1I18 A;  2PMU A;  1FOY A;  1QRB A;  1MGT A;  1NK2 P;  2V26 A;  4YC5 A;  2HQN A;  5DNS A;  1W0U A;  1USS A;  5M5Y J;  2NTQ A;  1BL0 A;  3R6J A;  3WBJ A;  1UD4 A;  2DYI A;  3I1F A;  2GM4 A;  1PLU A;  3GVK A;  1OYI A;  1VLY A;  2O8X A;  1QGP A;  3WQZ A;  5M5W J;  1HKT A;  4II3 A;  1JB9 A;  1OCC H;  5HDG A;  3QOE A;  1OB0 A;  1TVC A;  2V7Q A;  1O88 A;  2IA0 A;  4D5C A;  1WSR A;  2E7W A;  1Y1W J;  1MMA A;  5A2Q Z;  2HWV A;  2VFN A;  4PUS A;  4LB6 B;  1T2K A;  1S9H A;  4D1Q A;  1BHE A;  3ZMU A;  3LAP A;  1OMI A;  1IN5 A;  1QO0 D;  4XLE A;  1KU9 A;  3FIW A;  2R9V A;  2MG4 A;  2KFD A;  4QHY A;  1EH7 A;  1OGM X;  2NNN A;  5JFR A;  4BS9 A;  2RAE A;  1IDJ A;  3I58 A;  4L0Z B;  2PYG A;  3NAW A;  4EW9 A;  1RI7 A;  3E20 A;  5HZA A;  3I59 A;  2HOT A;  3L2V A;  4Y15 A;  4OU0 A;  3VYT B;  4CZC A;  2GXA A;  4DYC A;  3DFG A;  1NDH A;  1RQR A;  2FU4 A;  1UD6 A;  3ONY A;  1FBQ A;  5DN6 A;  1W5T A;  1G2H A;  4G6D A;  1O3Q A;  1EP1 B;  4UVA A;  1PUF A;  4RPD A;  1XB4 A;  1G6N A;  2EJR A;  2E35 A;  3WU2 C;  3LQE A;  2XZL A;  5A2Q K;  3CD6 I;  1FIA A;  5K5O A;  2VJI A;  2M9H A;  2UXX A;  1Y0R A;  3CRZ A;  4Z03 A;  2J8K A;  1QRY A;  4EM1 A;  1IXR C;  3QPL A;  2CND A;  1BIB A;  1MBK A;  2HYJ A;  2K40 A;  3IL2 A;  1ZHF A;  3S17 J;  4ANJ A;  1GR1 A;  1LVK A;  2C4T A;  2JA7 J;  1IZ1 A;  1S0U A;  5IYQ A;  2D2W A;  3NWT A;  1VQO I;  2GIV A;  1VQ5 B;  1ZAR A;  1DAB A;  3I55 I;  5GPA A;  4LG0 B;  2DEU A;  2TCT A;  2UVE A;  5C4J J;  4D0P A;  1N75 A;  1HDP A;  4XLA A;  1ETQ A;  1DDN A;  2XIG A;  4RAF A;  3IH2 A;  2X9D A;  4MFE A;  3MKY B;  1YJ9 B;  3JX8 A;  4N4N B;  4BPR A;  3H0G J;  1UB9 A;  2D74 A;  1EH8 A;  4OPS A;  1UHM A;  2DAO A;  3F3X A;  2GOM A;  1HCR A;  3BCA A;  1JA1 A;  1WU8 A;  1A6Q A;  4A3M J;  4RB0 A;  2CRV A;  3PEN A;  2HS5 A;  2Q0O A;  3IRR A;  4B09 A;  1B72 B;  1RUO A;  1JKQ C;  1F43 A;  1UD8 A;  2EIK H;  3ZC3 A;  3TOA A;  1VQN I;  2EV0 A;  4PAA A;  1W4M A;  2EZL A;  2H8R A;  1DAR A;  2BGJ A;  5HXB A;  3W5H A;  2G0Y A;  5FNZ A;  3O8G A;  1IXS B;  3W6K B;  1UD2 A;  1ZKG A;  4P3I A;  2VFO A;  2NVQ J;  1IC8 A;  1XGS A;  3FIS A;  4M6V A;  4HDV A;  2FD5 A;  3AGQ A;  3JU4 A;  4YCQ A;  2QYO A;  2KDZ A;  1A04 A;  2R7X A;  4P5O A;  2WR8 A;  3C18 A;  4A69 C;  2QGU A;  2D3N A;  3LL7 A;  3TMO A;  2L54 A;  4HG2 A;  1JNY A;  2QYU A;  4FE7 A;  2FQ3 A;  4AIH A;  1O3S A;  1VQL I;  3HOU J;  1BI3 A;  3OIO A;  2ELH A;  4MYT A;  4HST A;  4MTE A;  2ZL6 A;  1J09 A;  4AD9 A;  2CJJ A;  4FAS D;  1OYW A;  1YTY A;  2HTJ A;  3F23 A;  5HKK A;  2MYS A;  2CV0 A;  3L2R A;  4PJJ A;  2QEX I;  3QPH A;  4PC6 A;  1UMK A;  1N0V C;  1O8I A;  2Y2Z A;  4U9U A;  2O17 A;  4YDT A;  3IH4 A;  2VI6 A;  3SEJ A;  3S8P A;  3GZ5 A;  3S14 J;  4Y7C A;  4NDL A;  1MRZ A;  4RD4 A;  1XTA A;  5FO0 A;  4XLN F;  4OIO F;  3CCY A;  1QZE A;  3NRV A;  2ZJ2 A;  3Q0U A;  4UVC A;  3SZG A;  5L3C A;  5FKN A;  3H5R A;  4IL6 C;  1IJF A;  1H8E A;  2Y48 A;  3LA3 A;  1D8T A;  4J0Q A;  3KZZ A;  1TWF J;  3CDH A;  4PGO A;  5D5V B;  4HSR A;  3AG2 H;  3QYB A;  4EJU A;  5K5R A;  3QOD A;  3RKQ A;  3RSN A;  4RGR A;  2DXI A;  1IDY A;  2EIL H;  4DK1 A;  1PE9 A;  2RC4 A;  2CV1 A;  4OIN F;  3H36 A;  3TP3 A;  4RCY A;  3TBI A;  1JUM A;  3N05 A;  3AVW A;  4IHW A;  2L01 A;  2Y31 A;  3A0H C;  1K4T A;  3LYC A;  1W7P D;  4HF0 A;  2IGN A;  3CQZ J;  3BY1 A;  4IF4 A;  4RBO A;  1SMT A;  4LLG F;  5L3F A;  4M2L A;  3FXM A;  3IUO A;  1KU2 A;  3OZU A;  1AIP A;  3FMR A;  4CCN A;  5EZG A;  3G6E B;  3OOC A;  1BC7 C;  2AO9 A;  2VBV A;  3G6E I;  1R4N B;  5CPR B;  2JJ1 A;  5A8A A;  3KCC A;  5F1J A;  2DW4 A;  5L3D A;  1IGN A;  2QSH X;  4IO9 F;  4RDU A;  1FNB A;  3OE7 A;  3UR3 C;  3H9Q A;  1G59 A;  1A5J A;  3WTS C;  2BHZ A;  5BMZ A;  2VFQ A;  1GAW A;  1QJV A;  2DT7 B;  3ML6 A;  2CSO A;  3GQB A;  5J35 A;  1IB4 A;  4Q47 A;  3JR9 A;  1T08 B;  3B73 A;  2DMN A;  4FK8 A;  3C2H A;  4UV8 A;  4P22 A;  1RNL A;  3OJW A;  3CCQ B;  1U5T A;  3AKZ A;  1X3Z B;  3K6G A;  4A3F J;  2PJP A;  1GVD A;  2BM6 A;  2RDP A;  2DMU A;  1KA8 A;  4ZYG A;  3WTW C;  2ZZQ A;  2E1O A;  4DW6 A;  3ASS A;  2EWN A;  2Z99 A;  2D1V A;  1K6O A;  4ASU A;  1ETO A;  2EFQ A;  2W4S A;  2X6O A;  3BQZ A;  3Q9V A;  4A3C J;  2AXT C;  3FMS A;  3ZOB A;  1E3O C;  4BJ6 C;  4L8J A;  2WY8 Q;  2VJJ A;  3I55 B;  2ZC2 A;  3K4J A;  3M8F A;  1JHF A;  1FRQ A;  2P3M A;  2W48 A;  1RKW A;  5BS6 A;  2CQX A;  1FYL A;  1TWC J;  1YQA A;  2GA1 A;  3WNB A;  2DI3 A;  5J40 A;  2K5C A;  4Y9R A;  1LDK B;  2ISY A;  4KIS A;  2BY3 A;  4S05 A;  2EFO A;  1GDT A;  1VHO A;  2W25 A;  4Q7J B;  3CP2 A;  3U1K A;  1ON2 A;  2O8K A;  1ZH5 A;  1FBS A;  3P4G A;  3FMQ A;  1B9M A;  1MND A;  3LAJ A;  4MHG A;  2E2H J;  1W35 A;  3RIQ A;  4WXC A;  2E1R A;  2A61 A;  2FA5 A;  2WAQ N;  4XOR A;  2Q2E B;  4XBF A;  5AON A;  2E1M C;  3W2V A;  1W7P A;  3LSK A;  4M53 A;  3CPW B;  4YAF A;  4XON A;  3B78 A;  3PA1 A;  3BG6 A;  1GVJ A;  1RUN A;  2UVF A;  1U9O A;  2RRE A;  5DUI A;  1WCM J;  2CGP A;  3KP6 A;  4YAU A;  1G3Y A;  4ZZD A;  3L2Q A;  2EPF A;  2AHO A;  2RQQ A;  4MIM A;  2QBY A;  3BTJ A;  4IVN A;  1UZC A;  2V9V A;  1B1B A;  2EQR A;  3ASN H;  2J5O A;  4OJ5 A;  2EA4 A;  2ZB9 A;  5ILU A;  3OMY A;  1WJB A;  2H09 A;  3U1D A;  2BVM A;  4ZTJ A;  3BJ6 A;  2TDX A;  1P7I A;  1J5Y A;  2VKE A;  4BY1 J;  3T0Y A;  1FEX A;  1ZM3 A;  4WF2 A;  3QE2 A;  2XZO A;  2JPC A;  4HV5 A;  4I76 A;  5F0F A;  1Y0Y A;  3BG3 A;  2DYR H;  1WI9 A;  1T39 A;  3B6A A;  3EUK L;  3AST A;  1K83 J;  4BQQ A;  2ECB A;  2EB7 A;  2N8G A;  1OCO H;  3H0D A;  5F4J A;  3G1L A;  1P6R A;  1E2X A;  2BGC A;  3IP4 B;  3KP7 A;  4ZYE A;  1R22 A;  2CK3 A;  4TN1 A;  2ZZE A;  1YHQ I;  1KK0 A;  4PZJ A;  3KET A;  1SFU A;  2IGM A;  3U9G A;  3FXQ A;  3J7A Y;  5E79 C;  4JK1 X;  3BC9 A;  1AMO A;  4U49 A;  4Y9U A;  5B66 C;  3E1Y E;  1HW5 A;  5HDK A;  5D8L B;  4IEJ A;  2ZBK A;  2F2E A;  1T8I A;  3OZV A;  4P9S A;  3EUH C;  1WWX A;  3LSR A;  1HSJ A;  1Z6T A;  2P0W A;  3I9V 2;  1WOR A;  2FRH A;  4I0B A;  4W8Q A;  1XDS A;  3BR2 A;  4DIQ A;  2W7Z A;  4GQN A;  3OFN A;  4A3E J;  2M7A A;  2EIJ H;  2IVM A;  2VKD A;  2XAF A;  1CQX A;  1WMR A;  2PJR B;  4BNC A;  2BY2 A;  5FFX A;  2WWY A;  1SVL A;  4QSH A;  1UAA A;  1DBG A;  4W8T A;  5IT3 A;  2LTP A;  2PJR A;  3IRQ A;  1E3Z A;  4NCN A;  3BNW A;  4M74 A;  2ZKZ A;  2B7B A;  2W85 A;  1U5T C;  4ESB A;  3QWL A;  2QSF X;  3MFK A;  3OAA A;  2EFP A;  3T5X A;  2X0K A;  1QZY A;  1GUU A;  3AFH A;  1D8K A;  1FWZ A;  4HLY A;  4ZDL A;  2LYC A;  3FKI J;  2JJ7 A;  3GXO A;  4DZP A;  2XGC A;  1JKP C;  4OPW A;  4WZL A;  3CME B;  2R7W A;  3RZD J;  5IYC J;  2XC7 A;  4QIW N;  3AL0 C;  1KRH A;  1GHC A;  4OJL A;  4DGW B;  4RM0 A;  2DN0 A;  3W5U A;  2M45 A;  2VNH A;  4BH9 A;  1K79 A;  1W0T A;  3R4K A;  1IUY A;  1DP7 P;  1O8L A;  3GLL A;  1KTV A;  2DA4 A;  2YX7 A;  4OIR F;  2V4D A;  3FY3 A;  4EMS A;  4LOC A;  5K7H A;  3TH0 A;  3BG5 A;  3FXK A;  3G71 B;  2NS7 A;  5BNG A;  1ITY A;  5ICC A;  3U2Q A;  3I56 B;  3D0S A;  5KVR A;  1WOO A;  1JUS A;  2DTZ A;  2PQ8 A;  4L9V A;  3BCD A;  4QVJ A;  4U7D A;  2VQH A;  5JVT A;  4I98 B;  2W7N A;  1VQ5 I;  3CCJ B;  4ON0 A;  4PFO A;  1SFX A;  2X48 A;  3RTR A;  3ASR A;  1HKS A;  4EJO A;  4YFX F;  3SZT A;  1X4O A;  2X6W A;  3NEU A;  3D5L A;  3A1P A;  2F5E A;  1PVE A;  3JRA A;  2QGG A;  3CUQ C;  1FMW A;  4RAY A;  2DPU A;  2CW0 F;  2VBY A;  4OJO A;  5IYD J;  1QRC A;  2WV0 A;  2J8I A;  4CA0 A;  2KIF A;  1GO2 A;  3BQY A;  3A3G A;  3DKX A;  4F7D A;  2GIZ A;  1CNE A;  2DA2 A;  4PCQ A;  4H0E A;  4RD0 A;  3KLO A;  1QQI A;  4LBV A;  1MMD A;  1ZQ3 P;  1E1Q A;  3ROU A;  4I2O A;  4IHT A;  4AIJ A;  2HOE A;  2IJL A;  1Z05 A;  2RVC A;  3H35 A;  2FSW A;  4YAL A;  1TW2 A;  1BIA A;  3DKW A;  1PJ6 A;  2RC6 A;  5ERI A;  1QX4 A;  1FJL A;  1JA0 A;  1IDZ A;  4KKT A;  3TKY A;  2ZO4 A;  4HQE A;  3LSH A;  2A07 F;  3OEH A;  2OUM A;  1YRN A;  1TNT A;  2CMP A;  2CQQ A;  1OYY A;  1IA5 A;  3EET A;  4X0G A;  2QQ9 A;  3F9K A;  2QE7 A;  5HNH A;  4RD3 A;  3VWB A;  2Q6K A;  2O0Y A;  3PO2 J;  1O7L A;  3CCU B;  5LRR A;  4BQO A;  2CW7 A;  4TMV A;  3SQN A;  2VE8 A;  4BQN A;  4L9J A;  4NC7 A;  2JZY A;  2JSP A;  2WB1 N;  2DOF A;  4ENN A;  3I59 B;  1FX7 A;  2ESN A;  2Q2E A;  3AVY A;  3QPS A;  3SKB A;  4OOI A;  5LRS A;  1WJF A;  1XS9 A;  1S7O A;  4Y7N J;  3ZZU A;  3I3L A;  4XKB A;  4X07 A;  5FKK A;  3MMY B;  3HHG A;  3EPZ A;  3LSG A;  1R5O A;  2YWF A;  2JTV A;  4ITV A;  3G71 I;  3WE3 A;  2F5F A;  2O5R A;  3FKS A;  1D1B A;  2H27 A;  4Q5S F;  3N90 A;  3R6K A;  2J5P A;  3CF5 F;  2PI0 A;  2QLZ A;  4OWR B;  2PMZ A;  3OS1 A;  2IQ7 A;  2KRC A;  3WHC A;  1IRF A;  1HF0 A;  4N3G A;  1L0O C;  5C1E A;  2O6G E;  5IT9 Z;  1BJK A;  1OPC A;  1VQ8 B;  5JLW A;  2E5Z A;  4DZJ A;  1ACI A;  4OIP F;  3NE5 B;  1ETK A;  1H8H A;  2HFH A;  4F55 A;  2MLK A;  4HW0 A;  1O8F A;  2QA4 B;  3ES9 A;  3RZO J;  2V1D A;  3ZQL A;  3CCV I;  2QWW A;  3HPH A;  2F43 A;  2A68 F;  4XOP A;  3VDX A;  2BOL A;  2HOS A;  1FTZ A;  3MCA A;  2VFP A;  5BPI A;  5K7F A;  1OR7 C;  3DEU A;  1U3E M;  4RLF A;  4OPV A;  2M8E A;  1WSU A;  1SVM A;  5FD6 A;  2L02 A;  1VQP B;  2DK8 A;  1EH6 A;  4MXN A;  3VO2 A;  1FY7 A;  3COA C;  2ZXI A;  4CGZ A;  5DS0 A;  1O8M A;  3SJP A;  4C3H J;  1SD4 A;  2YUS A;  4I0A A;  3ZR8 X;  5ICE A;  1UEL B;  3HOX J;  5GV7 A;  1TSP A;  2JA8 J;  5DEQ A;  2HMA A;  3CD6 B;  4IHV A;  3K7A J;  3RQI A;  3PM1 A;  3RKW A;  1FOK A;  4NC6 A;  2W6I A;  4M6Y A;  2MGQ A;  5FFZ A;  2NVT J;  3HB9 A;  2DO7 A; 
#chains in the Genus database with same CATH homology
 3WQZ A;  3K4C A;  2HDW A;  1OFL A;  1N77 A;  4II3 A;  2IS1 A;  2OV7 A;  4B47 A;  3QOE A;  3S3M A;  1OB0 A;  2V7Q A;  4W8R A;  3VYR B;  2ZTG A;  1O88 A;  3GBG A;  1CZF A;  2QKL B;  3GVL A;  2HU9 A;  2X3H A;  1MMA A;  1OHH A;  3TL4 X;  3DTK A;  3OL3 A;  2K9M A;  4JMQ A;  3OYL A;  4PUS A;  2KVO A;  3WWG A;  1S9H A;  2IXS A;  1D0X A;  4D1Q A;  4RMN A;  2HLD A;  3VYS B;  1BHE A;  4XLE A;  3E1S A;  3V42 A;  2R9V A;  2X1D A;  3OR1 C;  2KDO A;  1OGM X;  1COW A;  2JA2 A;  2E60 A;  4BS9 A;  1X1B A;  1IDJ A;  4IQ4 A;  2PYG A;  1YX3 A;  4EW9 A;  3SUC A;  4AVZ A;  2DOA A;  1UD3 A;  3L2V A;  1SFK A;  3HUG B;  3HG9 A;  4NUB A;  3VYT B;  4CZC A;  1UD6 A;  3VSV A;  2CUJ A;  3FBN B;  5DN6 A;  4G7X A;  3LMM A;  4JOM A;  1PKV A;  3DTE A;  5LD2 C;  3RQ4 A;  2XZL A;  5HNF A;  2KLO A;  2V31 A;  3HAG A;  2VJI A;  4E7Z A;  4Z03 A;  3M1C A;  3SYT A;  1SKY B;  4HPQ A;  2WJY A;  2KMU A;  3EQO A;  2Z6B D;  2NZM A;  4ANJ A;  1LVK A;  3DWL E;  4KT6 A;  3OY9 A;  3W2A A;  4YZX A;  4XR6 A;  3NWT A;  1PXZ A;  4G6I A;  3IAS 2;  4EAT A;  3SEZ A;  2UVE A;  2KP6 A;  3K4M A;  4KKU A;  3KRG A;  4OZZ A;  1N75 A;  5TGT A;  4PJN A;  2HQA A;  4XLA A;  4TT3 A;  3DU6 A;  2HVR A;  3MKY B;  1WJC A;  4N4N B;  4XMY A;  1K6Y A;  5CQG A;  4E4H A;  2GOM A;  5FRM A;  4GRI A;  4RM2 A;  1RMG A;  3BCA A;  1OFM A;  1DQU A;  2WB1 A;  2ODL A;  4E7I A;  2ZTN A;  4KIT B;  1TT0 A;  5LFA A;  1UD5 A;  1DBG A;  1UD8 A;  4B3G A;  2X1E A;  1NG7 A;  4Y33 A;  3JUR A;  2E1M B;  1EA3 A;  4KKS A;  1AA7 A;  1BMF A;  2Z16 A;  1UD2 A;  5KHD A;  3MD2 A;  4U7B A;  3E0J B;  1R6R A;  5FRO A;  3JU4 A;  4XOT A;  3ONQ A;  2M4G A;  4F3Q A;  4R79 A;  3KEY A;  2R7X A;  5KCM A;  4E7J A;  3A1Y A;  2CFO A;  4P5O A;  3W3C A;  2Q1Z B;  2XAU A;  1D0Y A;  3GQA A;  3B8Y A;  2D3N A;  3LL7 A;  2ZSI B;  3NWS A;  3T53 B;  3TMO A;  4E0F A;  4HG2 A;  1WJA A;  1HVX A;  4FET A;  3PNV A;  4HEA 2;  3H94 A;  4B48 A;  3GQ7 A;  1Z21 A;  2HPM A;  2GJK A;  3B4N A;  4ZDO A;  3CZ6 A;  3A3B A;  4HST A;  2X53 S;  1K5C A;  1J09 A;  2VKH A;  2Z1D A;  2VQG A;  1QHH D;  4FAS D;  1IRX A;  3KEW A;  5HKK A;  2MYS A;  2CV0 A;  1N78 A;  3L2R A;  2NSP A;  5AMV A;  4PJJ A;  2BVL A;  2MC4 A;  1O8I A;  2O17 A;  2Z8G A;  2O04 A;  4PSW A;  1KCD A;  3S8P A;  2HVS A;  1X1A A;  3DKY A;  3L2W A;  2RNG A;  2WY7 Q;  3CMM A;  2WAQ A;  1WJD A;  2LG4 A;  2VBK A;  4BL0 B;  3S3N A;  3SZG A;  2DJI A;  2X6Y A;  1H8E A;  3GVJ A;  4Z05 A;  3H5R A;  1E1R A;  3OIP A;  4BXF A;  3VR6 A;  3VYU B;  2CS3 A;  1QU3 A;  3CES A;  3DQV C;  1MMN A;  4HSR A;  3QYB A;  1K28 D;  4Z1M A;  3G05 A;  3W2W A;  4CUG A;  3QOD A;  2INV A;  3RSN A;  2DXI A;  4XN3 A;  2WSS A;  2KHM A;  4C2T A;  4DK1 A;  1PE9 A;  2CV1 A;  3OYE A;  1PYV A;  3OYD A;  2V4J C;  3TBI A;  3N05 A;  4ZC3 A;  4YEJ A;  2GJP A;  2M4K A;  1Z3Y A;  2X51 A;  4YXW A;  3FDY A;  3OYG A;  2IGN A;  2WJV A;  3A35 A;  4Y4R A;  1BLI A;  2VIX A;  3ZPP A;  2XF6 A;  3QYE A;  5HVQ C;  2UWM A;  1O8D A;  2MD0 A;  3IUO A;  2JUG A;  1O8J A;  1KZL A;  1MNE A;  4CCN A;  1WJE A;  3DPU A;  3OOC A;  2LY2 A;  2JJ1 A;  5CPR B;  3ZIA A;  4BEH B;  2GK6 A;  2LY1 A;  3OE7 A;  3G2B A;  4PJL A;  2WAD A;  3H9Q A;  3UR3 C;  1G59 A;  2LZJ A;  1KTW A;  3LFU A;  2LOO A;  3UNG C;  1QJV A;  2DT7 B;  3GQB A;  4DK0 A;  1IB4 A;  1Z3X A;  1D1A A;  3OYN A;  3PUB A;  5KNL A;  4B3X A;  1WP6 A;  1WTH D;  2WZP P;  3C2H A;  1U0J A;  4E6K G;  4P22 A;  1E43 A;  2O1D A;  3BG7 A;  4E7S A;  5HOO A;  4DBR A;  2ZZG A;  3GQ8 A;  2KQR A;  4BE2 A;  4AU7 A;  2WAF A;  3K6G A;  3RCO A;  3AKZ A;  2KRH A;  3CJR B;  1ERD A;  4UZU A;  2R7R A;  2ZZQ A;  2IGK A;  1WPC A;  3GRH A;  4E7L A;  1T95 A;  1NBM A;  4ASU A;  1KCC A;  2W4S A;  1D0Z A;  1EE6 A;  3PSF A;  1W0J A;  4B44 A;  1O8K A;  1DGR M;  1X0C A;  3ZSC A;  4BJ6 C;  4L8J A;  2VXD A;  2VJJ A;  2WY8 Q;  3DPT A;  2M5S A;  3K4J A;  4ZDP A;  4ZYA A;  4BEH A;  3OYC A;  1OOC A;  4E7K A;  4MLO A;  1E79 A;  2VJ5 A;  3ZGK A;  4CCJ A;  1YX5 A;  3ZCO A;  3ZXS A;  4H4K C;  1QCX A;  2L5Q A;  2K5C A;  3IAM 2;  1LDK B;  2GK7 A;  4XN0 A;  2R7U A;  4KIS A;  1H80 A;  3S3O A;  4NC8 A;  4XD7 A;  2XZP A;  3T9G A;  3CP2 A;  4XNF A;  1E3X A;  4PSX A;  4PJM A;  1JTA A;  3OYJ A;  2NT6 A;  1MND A;  1TZL A;  3DPL C;  2PYH A;  3UW0 A;  3OYH A;  3LSM A;  2DT6 A;  3CP8 A;  2W82 A;  3K70 C;  4RM3 A;  4XOR A;  2Q2E B;  3FPP A;  1V0E A;  3K70 D;  3OYK A;  2E1M C;  3W2V A;  3LSK A;  4P1W A;  4XON A;  1XG2 A;  3BC8 A;  3BG6 A;  3AL0 B;  2UVF A;  2F1M A;  2RRE A;  2JJ2 A;  4BGD A;  2CH0 A;  2QX3 A;  2WBM A;  2XGJ A;  4CCL A;  2NTQ A;  2ZFU A;  3L2Q A;  3HC7 A;  2VB6 A;  4XLC A;  4ZTF A;  2IGO A;  2RQQ A;  1T0F C;  1MMG A;  2HVQ A;  1EFR A;  1VZ0 A;  4OJ5 A;  3OMY A;  1WJB A;  4ZTJ A;  1ZEL A;  2BVM A;  1FX0 A;  1W36 D;  4JQF A;  2IS4 A;  2XOK A;  3S93 A;  5JHF A;  3LSI A;  3EQN A;  4LIU A;  3B90 A;  2XZO A;  2X6X A;  1WJ5 A;  2ZSH B;  2BW3 A;  3K4L A;  2IS6 A;  1G8X A;  2KZV A;  2VQL A;  2R7T A;  3EUK L;  3H5N A;  1BR1 A;  1LFP A;  3VSU A;  1HA8 A;  2L7K A;  4BQQ A;  3OPO A;  3H0D A;  3ZQQ A;  3IP4 B;  3ZRG A;  3HL2 A;  2QXZ A;  4U4B A;  4RLQ A;  4B43 A;  2CK3 A;  2ZZE A;  5CDF A;  2VL8 A;  2JDI A;  2X8K A;  3DDY A;  3FBI B;  5C1C A;  3J7A Y;  2IGM A;  4NQW B;  1OGO X;  2ZXH A;  3BC9 A;  1HZE A;  5CQE A;  5FL7 A;  3OS0 A;  4U49 A;  3K10 A;  4CH7 A;  1VLY A;  4DNT B;  3VSK A;  1Z7L A;  3K4N A;  2R7S A;  1T5E A;  4OAZ A;  3H9G A;  3MKW B;  3EUH C;  2XSJ C;  2X85 A;  2P0W A;  3I9V 2;  1D1C A;  2IS2 A;  2NTB A;  2Y0S A;  4W8Q A;  4OAY A;  4DIQ A;  1VJS A;  4C9Y A;  4D9J A;  2VAS A;  3OFN A;  4GQN A;  4C30 A;  1O8G A;  4J00 A;  4E7H A;  2M7A A;  1O8H A;  3L2U A;  2VKD A;  1WMR A;  4YZA A;  1BOB A;  1BR4 A;  2PJR B;  3OL4 A;  4XL9 A;  4BUP A;  3OS2 A;  4OJ6 A;  2V6E A;  1GQ8 A;  2M7B A;  2L9N A;  4IKF A;  1UAA A;  1V5E A;  4W8T A;  3BCB A;  2E1B A;  2Z2S B;  1Y6I A;  4IQJ A;  2PJR A;  1E3Z A;  3T51 B;  3KYL A;  3KX2 A;  1FMV A;  2V7F A;  4J01 A;  1OLT A;  4DJA A;  2QY1 A;  1DGW Y;  2O0V A;  3OAA A;  3DLA A;  2I8D A;  1X1C A;  4MR0 A;  1WFX A;  2W1O A;  4NNJ A;  4BE0 A;  4YEL A;  2DIE A;  2GOX B;  3VMV A;  3AFH A;  3OOU A;  4ZDL A;  2LYC A;  4DOZ A;  1VBL A;  3BCF A;  2HZD A;  1LKX A;  2UV1 A;  2JVH A;  1KMH A;  4TSF A;  2R7W A;  2XC7 A;  2KL4 A;  2L2O A;  3AL0 C;  4OJL A;  4DGW B;  1MAB A;  3PL8 A;  4BDY A;  1HG8 A;  3DU5 A;  3M8J A;  4AYB A;  3BH4 A;  3U21 A;  2AQE A;  1O8L A;  3VMW A;  3OWT A;  3PNY A;  2AQF A;  2V4D A;  3FY3 A;  4Z06 A;  4HRI A;  1AIR A;  2HPI A;  3D5S C;  3OYI A;  2VBM A;  3BLY A;  3BCD A;  2VXZ A;  4DBQ A;  3HXL A;  2VQH A;  2W7N A;  3LMW A;  4DNR B;  4XLH A;  2JIZ A;  3K4K A;  4PFO A;  2WA0 A;  3RTR A;  1I8D A;  4I84 A;  1DBO A;  4XLF A;  1X4O A;  2X6W A;  3D5L A;  4CCM A;  3HOT A;  1KON A;  4FXU A;  3A2K A;  2VQC A;  1FMW A;  1V5F A;  2FUG 2;  2VBE A;  2LRE A;  5HLT A;  1GLN A;  4OJO A;  4N4O B;  4CA0 A;  4XKC A;  4CCO A;  3OYF A;  3A3G A;  4BJ5 C;  3DKX A;  4QPO A;  4U87 A;  3OEE A;  4OZY A;  4CSW A;  2X1C A;  4F52 A;  3SEQ A;  1MMD A;  2R7O A;  2EWE A;  1E1Q A;  1JRG A;  3C2G A;  4KJZ A;  3ZPN A;  2HNH A;  4NK6 A;  2R4G A;  3H35 A;  3EUA A;  2XND A;  2XF7 A;  1W0K A;  1MW7 A;  2GJR A;  1O8E A;  1RU4 A;  2F5V A;  4NK8 A;  2CW8 A;  1V5G A;  4KKT A;  4ZJZ A;  4HWV A;  3LSH A;  4TKO B;  3OEH A;  2OUM A;  4PMH A;  2CMP A;  3GQ9 A;  2W6J A;  4HIZ A;  3K4B A;  4C2U A;  1IA5 A;  4X0G A;  4BDZ A;  3F9K A;  4XKW A;  4CCK A;  5HNH A;  1E0E A;  2V1N A;  2QE7 A;  3HPG A;  4F91 B;  3VWB A;  3OW7 A;  2BSP A;  2NT9 A;  4YZ0 A;  4BQO A;  2O0W A;  4IZZ A;  2CW7 A;  1Y56 A;  2K9L A;  1X19 A;  2LBF A;  2CV2 A;  3MKZ A;  4BE1 A;  4BQN A;  2QKM B;  2OC6 A;  1UG0 A;  4NC7 A;  4PFP A;  2JSP A;  3CJQ B;  4HNT A;  3PJR A;  1NRK A;  4XKV A;  1JI8 A;  1NG6 A;  1VF7 A;  2VJ4 A;  2UUZ A;  2M0M A;  1NHC A;  3VSL A;  4YRV A;  3OYM A;  1WJF A;  2M3A A;  4LIT A;  3SDB A;  2WPD A;  4BAC A;  1BN8 A;  2XDV A;  4XM3 A;  3I3L A;  3PFY A;  4XKB A;  3PSI A;  3MMY B;  3LSG A;  3EPZ A;  2KPM A;  3OR2 C;  3H5A A;  3QYF A;  4YZQ A;  3HOS A;  4ITV A;  3FKS A;  2O5R A;  4XQF A;  1D1B A;  3H9J A;  3LNN A;  1IDK A;  2K3P A;  2LRD A;  2LH9 A;  4F93 B;  3FKJ A;  2A6T A;  2E5N A;  4OJP A;  4QPQ A;  4II2 A;  4OWR B;  2PMZ A;  4Y3O A;  4BU2 A;  3OS1 A;  2KRC A;  1V0F A;  2IQ7 A;  3CF2 A;  2JVG A;  2PEC A;  4B3F X;  1P9Q C;  2L9S A;  4LIV A;  5C1E A;  1W36 C;  2WAE A;  4G6T B;  1YE9 A;  2E5Z A;  5IK2 A;  5FRN A;  3OIQ A;  2NOJ B;  2D3L A;  4BJT A;  3D5R C;  3NE5 B;  4W8S A;  1H8H A;  2INU A;  3DTI A;  4F55 A;  3A4C A;  1O8F A;  2LC2 A;  2LBF B;  1X4P A;  3RPU D;  1X1D A;  3S32 A;  4HNU A;  2VPL A;  1DP3 A;  2F6C A;  2CUZ A;  3HPH A;  1BR2 A;  4F92 B;  2VLA A;  2F43 A;  1RWR A;  4PK4 A;  2MFZ A;  3FHN A;  4XOP A;  3VDX A;  2BOL A;  2W00 A;  2DCE A;  4IX7 A;  3PNT A;  1OR7 C;  2V9K A;  4RLF A;  2ZZF A;  3OYB A;  2NST A;  2F4I A;  2A5W A;  4C2L A;  3DEE A;  5CKT A;  2NTP A;  4G7W A;  4MXN A;  2R7Q A;  2XF5 A;  2ZXI A;  4URR A;  4LG3 A;  1BPL A;  1O8M A;  3T56 B;  2R7V A;  2BW3 B;  1W9X A;  1I18 A;  3ZR8 X;  1UEL B;  1QHG A;  2V26 A;  3OYA A;  1UD4 A;  1PJR A;  2W6I A;  1SAU A;  2ELJ A;  1PLU A;  3GVK A;  3HKZ A;  2MAB A;  3VST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...