4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
2ODLA 1JRGA 2UVEA 4W8QA 1OGMX 1KCCA 4EW9A 2QX3A 4XLAA 1OGOX 1XG2A 4XN3A 1PE9A 3EQOA 2O1DA 3LMWA 2X3HA 4XQFA 3GQ8A 2BSPA 2NTQA 2X6XA 2VBEA 2O0VA 1O8FA 5C1EA 3GQAA 4OZZA 4OZYA 4NK8A 3VSTA 4XKVA 3WWGA 3VMWA 3B90A 4AVZA 2VJJA 4YZAA 1O8EA 1JTAA 2X6WA 3B8YA 4XLFA 2INVA 4YZQA 1PXZA 2VBMA 1OOCA 4YZ0A 1IA5A 1H80A 4XLEA 1AIRA 3UW0A 3ZPPA 1DBOA 2NTPA 1CZFA 1O8LA 2NZMA 1K5CA 1KCDA 2VBKA 1O88A 1RU4A 2INUA 3GQ9A 3SUCA 4I84A 4MR0A 2IQ7A 3KRGA 4C2LA 4OJOA 1GQ8A 4Z06A 1VBLA 5AMVA 2X6YA 4XL9A 4OJLA 3T9GA 3VSUA 4Z03A 1X0CA 2NSTA 2O0WA 4XM3A 2EWEA 1OFLA 1O8KA 1PLUA 4U4BA 3GQ7A 2VJIA 4XLCA 4OJ6A 3ZSCA 4XORA 2NT6A 4YELA 1KTWA 1QJVA 2NT9A 2Z8GA 4Z05A 4OJ5A 2X85A 4XNFA 4XN0A 3VSVA 2QXZA 2PECA 4XR6A 2O17A 4W8SA 3EQNA 1O8MA 1QCXA 2PYHA 5C1CA 1O8JA 2QY1A 4XMYA 1IB4A 4NK6A 1DBGA 4OJPA 4YZXA 4XOPA 1BHEA 1IDKA 4XLHA 2UVFA 4PMHA 4W8RA 3B4NA 3GRHA 1HG8A 1O8IA 2NSPA 1NHCA 3VMVA 4XOTA 4XONA 1WMRA 2PYGA 4URRA 1EE6A 1OFMA 4W8TA 1O8HA 1BN8A 4XKWA 1RWRA 4MXNA 1IDJA 4U49A 4YEJA 1RMGA 1O8GA 2O04A 3JURA 3FY3A 4HWVA 1O8DA 2NTBA
chains in the Genus database with same CATH superfamily
2ODLA 2BM5A 3SJZA 1EFCA 2VASA 4KYWA 4BACA 4W97A 4EW9A 1W35A 1FWZA 1Z0XA 4GFBA 4RD2A 2QQ9A 2O1DA 5IPAA 2Y30A 1MMDA 2B9SA 2F4OB 4M72A 3C2HA 1VF7A 2C6YA 3RQIA 1IN6A 3VDXA 1Z3XA 2M4GA 2CUJA 3CCMI 4HEA2 4EGZA 3MZHA 3KP6A 1WZ2A 1SAXA 1XSVA 2YWGA 1O8FA 2M87A 3V76A 4WWVA 1MBJA 1SANA 2A07F 3GFMA 3HTSB 2HMAA 2KL4A 3WWGA 1V54H 4LITA 3V8JA 3A1PA 3CQZJ 3ZN1A 2HOTA 2CC2A 5L3CA 5EF6A 4HSRA 4LBZA 3B8YA 2DOEA 2CK3A 1L0OC 2FUG2 3LMMA 4IOAF 4KKUA 4TKOB 2LRDA 1F1ZA 3FK7A 3REOA 1QG0A 3ZPPA 1FRNA 1ZR4A 2ZZQA 3IH4A 2BM7A 1U6GA 3G1LA 3GYHX 1QGZA 3MFKA 2VFMA 4BBSJ 2KVOA 4MYTA 1OB2A 2YX7A 3BQYA 2IQ7A 4C2LA 2UXNA 5HS9A 4CCLA 2LKPA 2NPFA 1IXRC 4OAYA 4BL0B 1A31A 2KQRA 3ZP5A 4DJAA 2P7CB 2BBYA 4KUMA 3BROA 1BM9A 3DP7A 4RLQA 4ETSA 4P6YA 3VFZA 3I58A 2PJRA 2R93J 1QH0A 2WADA 1TSPA 1PJRA 4RGRA 1OYWA 3MKZA 3GVKA 1T95A 3JRGA 1L1IA 3CC2I 3HB9A 4LC0A 1W2BB 3SXYA 1ZLKA 2NS8A 2V7FA 2BYVE 1NG7A 1OCRH 4IRIA 1Y1VJ 4L0YB 3ROUA 2C2WA 4WCGA 3CCUB 4F55A 4OP7A 4ACAA 2XGEA 3CCRB 1KTWA 2OJED 3JTHA 3WTUC 4U7DA 3BR1A 1WJFA 3I54A 5JHUA 2B0RA 2E1CA 5H2FC 2KP6A 4KNYA 4RPDA 1R5GA 5F0CA 3RZDJ 1WGXA 1K6OA 4PAAA 3S17J 1LVKA 1MNEA 4DZPA 3F8BA 4YFOA 5M3FJ 1IJFA 1PUFB 3FXOA 2NVUB 4PGHA 2FBKA 4F3QA 2OBSA 4K2EA 1IB4A 1IN7A 5KCMA 2Q8KA 2PMHA 4NNJA 3ASNH 3CDIA 2B7CA 2V4DA 2K9MA 2HZTA 2K4BA 2MBFA 3GZ5A 4A0ZA 2UVFA 1JT6A 3K9TA 2EZHA 4Q47A 1MBFA 1YW9A 1W0KA 4I01A 5FLXZ 4IOCF 3PSFA 2HEOA 5FO0A 4XKWA 1HQCA 3F72A 2COMA 4EVIA 2STWA 3AVWA 1IDJA 2G9WA 2XHKA 4U87A 4UVCA 2XAGA 4Y3OA 3ASSA 1RMGA 3LNNA 1GVDA 3L9FA 1F36A 3B6CA 4O6JA 4AIKA 5H6QA 2MA3A 2D1VA 5EZGA 2MH2A 3IRQA 5KAFC 2D45A 4IZZA 1I50J 2W84A 3OL4A 3BH4A 3DTEA 3VYSB 2LY1A 4GRIA 4XLAA 4BJTA 2CQQA 1B8IA 1VQ9B 1N0VC 3CCEB 3CD6I 1XQBA 2X6XA 3OFNA 3GZ6A 3DLLF 3DPUA 1S8NA 1E2XA 2LTPA 1YS7A 1IJEA 2ECCA 2DEUA 1XB4A 1AU7A 3TQNA 4EV0A 2O0VA 4A3CJ 4IPAA 3HG9A 2EWNA 3GF2A 5FGMA 1R5BA 4OZZA 3ZQCA 2LK2A 2YU3A 4M71A 1VFCA 2QEXI 5F1JA 4R8HA 1S72B 1TWFJ 1JNYA 1QHGA 1T08B 1HW1A 2HXOA 2M30A 2VQLA 3H9JA 4GYGA 2Q2EA 3J81K 2JMWA 3UKGA 4XLFA 2E5NA 2EFPA 3HHHA 1WU8A 2VBMA 4X7EA 2EFWA 2X51A 5FFXA 3QPTA 2DQLA 4L5EA 1ON2A 4CUGA 5GAHJ 3Q3AA 1K5CA 2FOWA 2DCEA 3I55I 4YXWA 4YAFA 2KFDA 1OYIA 1O7FA 4XICA 1XGSA 3FF5A 3O6BB 5CYVA 4OOVA 3IRRA 3COAC 3CC7B 4A3KJ 2JN6A 3A01B 3T53B 2L01A 4HF0A 5CVUA 5K1YA 1P4WA 4JRAC 4UV9A 2Q2EB 1SMYF 4U4BA 3S3NA 4E7ZA 4X0CA 2OYNA 3W2FA 4RM0A 4XLCA 2YS9A 2CUEA 3S1RJ 1ZM2A 1W9XA 4YAOA 3LSIA 2NYXA 3NRVA 1B1BA 4GYIA 2QF7A 2VPRA 4ON0A 1IRZA 3CW2A 4ENKA 3T51B 3OIQA 2GK6A 4WZKA 1TWHJ 4ESFA 1Z6TA 4OINF 2PI0A 2VOOA 4KKTA 2QVOA 4OPVA 4MEXF 3HYIA 2VFOA 1G3WA 2R4GA 2PECA 2IBDA 2FMYA 3RKYA 3LL7A 3TDUC 3N05A 1LDDA 4LG3A 1O3RA 1ZQ3P 1WSVA 2A68F 2W1OA 1OKRA 5KAIC 4NK6A 3SZGA 1DBGA 2E36A 1Y0YA 4FISA 3LOCA 2DETA 4ITVA 3LQEA 1A04A 4ESJA 1P7IA 3W6KB 4XLHA 4M6XA 1TC3C 4BGDA 3B4NA 3DPTA 3LA7A 2EJRA 2JZYA 1ZG1A 3HGGA 3AG4H 4NCNA 2IRFG 3L1PA 1A6IA 3LQQA 5ICEA 1FTZA 1OCCH 2BW3B 3EUHC 1GLNA 1H42A 1ETVA 2QWWA 3H94A 1Q81D 3SYTA 1BN8A 1XB2A 2K9NA 2EIKH 4PJ0C 3I4MJ 2WAFA 3CDHA 2QKLB 1WI3A 1T2KA 4IHVA 2R5ZA 1YRNB 2GPJA 4R1HA 2JUCA 2WA0A 2L7FP 2P3MA 3KP3A 3S3OA 2ZTGA 5J6XA 4OMZA 3IV5A 1Q82D 1E3HA 4L5IA 2RAEA 3U2QA 1JGGA 1IXSB 3CJTB 4LLGF 2R7SA 2NV4A 2DOAA 1I27A 2JVHA 1G7TA 2E1RA 5ILVA 1Z91A 4B3AA 4HQEA 1ELOA 1FNNA 5B1BH 1AMOA 2BEOA 1WH7A 2CFOA 3PO2J 4X1EA 5LEKA 3N4MA 2IOUG 1U9NA 4E70A 5JVGF 1TVCA 2BSPA 1V3FA 1S3JA 1UMQA 1G7CA 2DCUA 2HOEA 3LFUA 3LYCA 1MSEC 1U8BA 3MKYB 3C18A 4M6YA 4BXUA 5DUKA 2PFBA 1QVFB 3FIWA 4XKVA 1DPUA 1ZLJA 1KU2A 5FO5A 4OOIA 3GFLA 3EUHA 1I3AA 4E7LA 1JTAA 4MEYF 5B5EC 2L4MA 4FX0A 1XCVA 3JRIA 2V5IA 3TO6A 4Q4ZF 2IA0A 3G1MA 3PM1A 1SFOJ 1POGA 3R6SA 4YZ0A 1J09A 2HTSA 4J00A 5CJ9A 2B0LA 2ETHA 3PNYA 3OOPA 1J0RA 2CUFA 5F6FA 3H0DA 5FKOA 1P4MA 1RU4A 2GA1A 1IN4A 2GOMA 2IAIA 4ZDLA 4ABZA 3OS1A 4IVNA 1Y1WJ 1WOOA 4JP0A 2LC2A 4PC6A 4I84A 4R71A 3KRGA 2QDXA 2CYYA 3H35A 1WJBA 3PQJA 1ITYA 2IW5A 4I6ZA 1JA0A 2Y9ZA 2XTXA 3DLAA 1Y0RA 2IA1A 2A6TA 2R7ZJ 3R60A 1SEUA 1E1RA 2EIXA 2L7MP 2WB1N 4QFMA 3W2HA 4I7HA 4J0QA 3T8RA 1AWCA 3KLNA 5GP9A 4MFEA 2R7XA 2OV7A 1OFLA 4ZCLA 5IYRA 4I09A 1JA1A 5DN6A 2JA7J 5A2QZ 2VFNA 3DU1X 1QQIA 5D6EA 3OSFA 5GV8A 1HVXA 1RRJA 4A5MA 3JQQA 1RKWA 5EMNA 4TN1A 2E1MB 3NEUA 3CP8A 1WVRA 5F08A 1H85A 1D1NA 2Y2ZA 2PMDA 3PA1A 3AGQA 1USTA 3EDPA 2K85A 3HL2A 3RIQA 1G3SA 3FHNA 4RAFA 5KW9A 3BWGA 3M9AA 2L7ZA 2ZZFA 1TT0A 3ZMSA 3CDLA 1J5YA 1AIPA 1JB9A 1TBXA 4A3GJ 4Y7CA 1REPC 1WJDA 2B7BA 3HAGA 3MMYB 4GO1A 1LE8A 1VQ4I 4Y52J 2ID3A 4NB5A 3D26A 2RREA 1K61A 5JFRA 2X4HA 3K2AA 4KIBA 3QYEA 1DG1G 1N0UA 3OAAA 4PGOA 2KIFA 4LOCA 1HA3A 1KQ0A 2FEZA 4RAZA 1T38A 3S2DJ 4KMUX 3GIRA 3BTIA 2P7VB 2FX0A 3TOBA 3WG7H 2V7TA 1EE6A 1XGNA 3W2WA 4NQWA 1A6QA 3H1CA 3CCMB 2MG4A 4Y17A 1SFUA 3S16J 3D0SA 2PLFA 3FBIB 3OIPA 1FYKA 1X3WB 4DIQA 3ABKH 4OOXA 1FOWA 2GAUA 4P1WA 4A3LJ 3K4CA 3KEYA 3CUQA 1D8JA 3DKXA 4U9UA 3WNBA 1G7SA 2UVEA 3KE2A 3KZYA 2ZXIA 2VN2A 3R0AA 1FTTA 2R92J 1D1CA 4KJZA 3VMFA 5L3EA 2BF4A 2GQFA 2L4AA 3RY8A 2D3LA 4O3MA 1YO5C 4J19A 2DU9A 1YFHA 4MHGA 1ZGJA 1LEBA 1XS9A 2R7QA 3TW7A 1YJWI 2ZFWA 4XBFA 1ZH5A 1FOKA 3BZ6A 5ERIA 1X58A 3TO9A 1OR7C 4U0WA 3AGPA 2HS5A 5TR9A 1VQ7B 4Z4SA 3CPWB 3IH2A 4LG0A 4M3GA 3FPKA 1K9MD 4P3IA 4L8JA 4KT5C 1DUXC 4IHTA 3SEQA 2LBFA 4MTEA 5BS6A 3Q5FA 3AFHA 2OCCH 3FISA 3LFKA 4UVAA 3MKWB 1N06A 2EV6A 2M1BA 4C2MJ 1IAWA 2OA4A 1QU3A 2OTJB 1G3TA 1P7JA 2AXTC 1JJ8C 2X6OA 2VKEA 2KRHA 4CGZA 4KDPA 1WFXA 1X3ZB 5F04A 1VHOA 1FX7A 1NRKA 5TRDA 2EIMH 4HW0A 4G7WA 3SZTA 3AG1H 1H8HA 3RIRA 2H27A 2CS3A 3KLOA 4FQGA 1ZUNB 2JJ2A 2ZNZA 4W1UA 4B48A 1MRZA 2JRMA 2L02A 1JUSA 3FXLA 2ZSHB 1LFPA 4FE7A 4DBRA 3IC7A 3KZZA 3JRAA 2Z99A 2M7BA 2WPDA 3ZQQA 1OISA 5HDGA 4E7KA 1UD2A 2XNJA 4DK0A 5IYNA 2OBPA 3I9V2 2R7FA 4OJ6A 4RDKA 3HRUA 2VBWA 1PUEE 3Q0VA 4I98B 4E0FA 1STZA 4CCNA 2IT0A 4QPQA 2DLLA 4UNOA 1X1PA 4DQLA 1BX1A 2WJVA 4R79A 3JX8A 3I4NJ 2NT9A 4M9SA 1ZRDA 1SMTA 3ZMVA 2QN6A 5IYBJ 2W25A 3F23A 3K4KA 1AKHB 2GXBA 5CLSA 3CO6C 2XF7A 2Y9YA 4QIWN 1B72A 5IT9Z 1TQIA 1XX5A 2V7UA 2QLZA 4NC7A 3U21A 4RD4A 4AF6A 2VBSA 1G4DA 5EEAA 1WDTA 4B09A 1RIOH 1YI2B 1BC7C 4Z4YA 2IJLA 4ZCMA 5LBQA 4RD0A 1BI0A 1D3YA 1QZYA 3ZMZA 4LGWA 1U9OA 1B23P 1EV7A 3LSGA 2DYSH 3OJWA 3Q0UA 5J35A 3T56B 4OJPA 1YX5A 1TP4A 2ZB9A 3PFIA 3WU0A 4G7XA 3SLDA 5GADJ 5KSWB 4RDLA 1NK2P 4PMHA 2KIUA 3QAHA 4BHBA 2OAZA 2A05A 3RPUA 4BE2A 3Q9SA 1LQ1A 3BTJA 1ORKA 2P8TA 4OMYA 1DABA 4XOTA 3IAS2 2JQ7A 3BR2A 1XGOA 5HOOA 3CC7I 1ODDA 4I02A 3A3BA 4FASD 4MXNA 3LSKA 5LRSA 1YYVA 2DT7B 2DYIA 2ZCWA 1VQOI 4TMVA 3M7GA 5B6IA 1FX0A 3H9GA 3ECHA 4EJOA 4GQNA 2VBYA 1UG2A 3MQ0A 5B66C 2NTBA 4P22A 5HVQC 1WOSA 1B2RA 4OPSA 4Z4TA 5DCFA 3KZIC 4RCZA 4IF4A 5JR3A 3CJQB 3CMYA 2ID6A 1B6AA 1TWGJ 4P96A 1UD3A 4GDFA 2HKXA 2EB7A 4ENMA 3BCFA 1OGOX 1XG2A 2R7OA 1A36A 2R7TA 3RI4A 2FXAA 4Z4ZA 5BNGA 1HC8A 4PC3A 2BXZA 1E79A 1R1TA 4ZZDA 2DDAA 2QQ8A 2LG4A 3M8FA 2C77A 5TY0A 3K7AJ 2M9HA 2KKOA 3KP4A 1N07A 5CVVA 5DD8A 2RNGA 5IT9K 4CCMA 3F21A 3W5HA 2HKOA 3HOSA 4OIOF 3SEZA 1UB9A 3VSKA 2B7EA 1JGSA 4G6IA 3TOAA 3DEUA 3IWZA 1I1SA 3E5QA 1HA8A 3PUBA 2LH9A 4L9JA 1WXRA 5D6FA 4BY1J 3K2ZA 3QFCA 2NTPA 1XGMA 4DGWB 1O8LA 1KONA 2VBTA 1KCDA 4TMWA 1S7EA 2HCJB 3OW7A 2BV3A 2HQNA 2L5QA 3P4GA 3C7JA 1E3XA 2VIXA 4CICA 3X2QH 1MJAA 5IOZA 5LHIA 1CNFA 3PUMA 1XPXA 3BP8A 5A89A 5JLVC 4BY7J 2AQFA 4A5NA 1BR2A 1LJ9A 2E5ZA 4XRMA 1I5ZA 4DQ2A 3JRHA 2F4NA 5HZAA 3V8LA 5HZBA 3BOQA 1UAAA 3G05A 1FT9A 3DQVC 1JKPC 2EFGA 4OIQF 3U2RA 3MAJA 3LQ6A 4OPOA 1MJ9A 2F5CA 1H89C 1R58A 3F8FA 1GUUA 2OQGA 1D2EA 2DOGA 2XAUA 4CCKA 1JXSA 2DA7A 1HF0A 2IS4A 3RKXA 4XD7A 3H09A 4G1BA 2VE8A 3BR3A 4X07A 5D5XB 1TNSA 1IRGA 4PJJA 3MKLA 1F60A 5FB2A 3QPSA 3ASQA 5AN9A 2CF4A 2QM3A 3AK5A 1R4MB 4X7FA 2XKPA 4W8SA 2FX3A 5DYMA 3EQNA 4E7JA 1ZREA 4N4OB 2FQ4A 4CCJA 2R6HA 1BC8C 1YJNB 4CYCB 3K1PA 1IDZA 5HNFA 1U5TC 4RMNA 5D8LB 3AVVA 1ETXA 1FBQA 3SJPA 1I8DA 2PG4A 1SKQA 4OU0A 2DY1A 2WY8Q 3ZXSA 5C3EJ 4HF1A 1QPIA 3PNVA 3CC4I 1K8FA 4M9ZA 3SZPA 2MGQA 2KZGA 3Q6QA 1A8PA 2VKDA 1IDYA 2XGDA 1R36A 3FXJA 3K10A 2QBYB 1KZLA 1OFMA 1QQ1A 4W8TA 5JHFA 1IF1A 2HDDA 4HPQA 2CFXA 2BX6A 1Y0UA 2M5WA 1Y56A 4AIJA 5GTHC 2LOOA 2UV1A 3CMAI 1H88C 1FJLA 1QX4A 3KFWX 1ETYA 4MNUA 1WP6A 5FLXK 2J8IA 4UVBA 3L2WA 5L3BA 2BGJA 2X3HA 3GBGA 3ZGKA 2DJIA 2CU7A 2VBUA 2M4KA 3OZUA 1CNEA 3V4GA 3J81k 1YW8A 2YSRA 3TO7A 3I0TA 3VYTB 2CBXA 4QVJA 1PE9A 3LMWA 1RETA 3OYNA 3H3ZA 2V31A 3SHFA 1ZG3A 5CVRA 9ANTA 5CDFA 2RGVA 2LYCA 5HS7A 1DDNA 1ZM3A 4P6VF 2BOLA 1EA3A 3TP0A 3ML6A 4MFDA 3AL0C 3OJXA 1PP8F 2EINH 2WAQA 3EPZA 3FM5A 4BAYA 4BDYA 1TTTA 1XDUA 2E7XA 2PEXA 3F6VA 4A3MJ 1YX2A 2P6SA 3G6EB 3BG3A 1VQOB 3G71I 3G71B 1WORA 2CNDA 4FHTA 1EH8A 2V1XA 1ZG5A 1VTNC 2MLKA 3QQAA 4RD1A 2GIZA 5CVJA 2XGXA 3KYLA 1Y39A 3GQ9A 3BR5A 1R5NA 4LBWA 4C9YA 3OZWA 4MR0A 2IPQX 4A93J 1J59A 2NAZA 3D5LA 2RV8A 1Y8RB 4G6QA 2OUMA 2HPMA 3SFIA 4DBQA 3WG9A 1JJ2B 3TL4X 1QFJA 2XT4A 3M07A 2ZJQF 2QTLA 3QFSA 2YX4A 3T0YA 1USSA 3M4OJ 2R7VA 3PVDA 5CQGA 2HGCA 2MLGA 4TMXA 5LGNA 3ASRA 1MBKA 1B9MA 3OYJA 2GJPA 5DSZA 3HRSA 1ETQA 5CPRB 1T8IA 5LMZA 2XRLA 3FWEA 4D0PA 4B3GA 4X0GA 3J7AY 5FL7A 1DGRM 1SKYB 1W7PA 5LGUA 1OFEA 2QMUA 4FTHA 4KISA 1DU6A 2X85A 3RDIA 3BDDA 5E1XA 2WYRA 2Z2SB 2BHZA 4XR6A 3E6BA 1AA7A 1HKSA 1MD0A 2DA2A 4H4KC 4YDTA 2XZPA 1PVEA 3H5AA 4G9YA 4HX7A 1QGYA 1OLTA 3CUQC 5LEJA 3L2VA 2E35A 1Y0NA 2K9QA 3KCCA 1CF7A 3JAMZ 4IXAA 1MBGA 3I71A 4AM3A 2BY0A 1GXQA 3EETA 4PFOA 1SFXA 5EDNA 1BQEA 2NVYJ 3CB4A 2XV4S 3CPXA 1KYZA 1T0FC 4TMTA 1O8IA 2VONA 5DEQA 1WMRA 4URRA 4BJ5C 1BA5A 1MBHA 2AXLA 2K5CA 3BLYA 3FZVA 1SM4A 1O8HA 2XTWA 3HOTA 3DTKA 1IG7A 3BG6A 2ZC2A 2FQ3A 4RM2A 2HI3A 2L9RA 2RQPA 2DPUA 2OTJI 4ZGQB 2EA4A 2L2OA 2J7KA 3B02A 1T39A 2W85A 4BDZA 2Y69H 4EJUA 1RZ4A 2VBZA 2XSDC 1O3SA 2QSGX 1FRQA 4UAJA 1VQ5B 1WH5A 1UCRA 5DM6F 3E5XA 2F6CA 4WZEA 4E4HA 4YFNF 2ACJA 2JPCA 3OOCA 5H59A 2DFFA 1Y6IA 1ZGAA 2BGCA 2Q6OA 1LLZA 2O8XA 3NARA 1J9IA 3AVXA 2IA2A 1FMVA 4LBVA 1AOYA 5HXBA 5C4JJ 1TW3A 3FXUA 4XRSA 2V6CA 3I56B 2DN0A 4LMYA 2DI3A 2GREA 1MH3A 4ZYAA 3FXMA 3LNQA 5FIUA 4NK8A 1WPKA 1BR1A 3O2PE 4LK1F 3F0CA 3RKWA 3U1KA 2XPVA 4RM3A 3JU4A 1IJWC 3VMWA 3HC7A 2QENA 2VJJA 4M3BA 1V5GA 5CVIA 4AVZA 2HVSA 1IRFA 3CCUI 4DQKA 1VLYA 3A2KA 5IK2A 4OM9A 4UUVA 3OE7A 3PSSA 2QYUA 4P1VA 3G3ZA 2W00A 5HDKA 1EFRA 1NB0A 3HDDA 1OGJA 3B82A 1K7AA 3GVJA 3FXRA 2VQGA 4D9JA 1WJCA 4V02C 4OWRB 4LFUA 3DEEA 3ZQFA 2EIJH 1K6YA 3K4NA 4BHCA 2QTZA 1W5CC 4WX9A 4XRFA 1UJ8A 1QRYA 3CF5F 2L3DA 3V8KA 1FNBA 2ZKZA 3UNGC 1VQLI 5E18F 1FBUA 5IYQA 1EF4A 1VQPB 3N6ZA 2V7XA 2EWEA 2DMUA 4UV8A 3CRZA 1O8KA 2D1HA 2V4JC 2JSCA 4M74A 4UB6C 5K5OA 3WU1B 1KJZA 1TLLA 4BXFA 4KA4A 3H92A 3AG2H 4YFKF 2R7WA 5JBQA 1D1AA 1Q86D 1I6XA 1OB0A 2CRGA 4JX6A 3IP4B 2JSPA 2NT6A 2BV6A 1SD6A 1BJKA 5HKKA 3ZZTA 1HDDC 2ZBKA 2FVGA 1PP7U 2XAQA 2C5BA 2W82A 4YEIA 2EK5A 3E97A 5THXA 3RCOA 3OYAA 2NOJB 2YU9J 3P26A 2IXSA 1YTYA 3CLOA 5K7HA 1LFUP 1EZGA 4F92B 3I1FA 3V7SA 5E20A 2JUGA 2A6HF 2VPLA 4GXOA 1HKQA 4X06A 4CYCA 3KL9A 1YOVB 5E79C 3J7YJ 1XE1A 2HTJA 1O3TA 3GTKJ 2HFHA 1D5VA 2CG4A 1BOAA 2HVQA 5LLQA 3LO8A 1LDJA 2MSYA 4XOPA 3S3MA 2ZBVA 2DODA 1IHMA 1NJID 3IHUA 2LSOA 3CJNA 1T6SA 1FNMA 3VYRB 4IQJA 1RQPA 4QHYA 1Z67A 3DBHB 4C43A 3GXOA 1TYWA 2DYRH 3G4SI 4II3A 5K7ZA 2OBTA 2XRNA 1OCPA 1LDKB 1WJEA 3GWZA 1RWRA 3BC9A 4L0ZB 4A3DJ 3CCJI 4HSTA 1W0TA 2DTZA 3DEWA 1SVOA 2STTA 5HLHA 1X3UA 4EJTA 3IWFA 5BSXA 1UD5A 3JURA 2V1DA 1ZGWA 1YIOA 4P9UA 4KITB 3V7CA 2COBA 4DNCA 1K4SA 3I5UA 1LE8B 2Q0OA 3D1NI 3N97A 3SY2A 4Q7JB 4EH1A 5EG0B 1QZZA 2W57A 5ICFA 1DP3A 3ASTA 4V2GA 4Y7NJ 4YALA 2H1LA 3KEWA 5F1RA 5K5RA 2KT0A 1CGPA 3GW2A 5F0HA 3PA2A 2ZJ2A 2XAJA 2VJ5A 4IHYA 2CQ7A 2DOFA 2R0QC 2XVCA 5D5UB 2VC1A 1VQ8B 2E1NA 4P12A 2L54A 1KMHA 3LSPA 2AO9A 1MSFC 3SEJA 2E71A 4KN7X 4YFXF 1W87A 5E3OA 1OJLA 1T6XA 3GLLA 4HQMA 4YZAA 5E8IA 5HLTA 4TT3A 4AIDA 1KU7A 2X6WA 4P9SA 2RC4A 2AQEA 2ME0A 4E6KG 1MBEA 1IZ1A 1OOCA 4G12A 1X19A 1V5VA 2XASA 3CC4B 1VQNI 1I6HJ 2DAOA 1QFZA 4JBAA 1P4AA 1R22A 2KIQA 5BPDA 1BLIA 5AIQA 1O88A 2HOAA 2IEKA 2Z1DA 2MFZA 4KICA 1J75A 2G0EA 3HEFA 1YJ9B 3PIPF 4OJOA 1YJNI 1YE9A 4D1QA 3MWMA 2QSHX 4PJMA 3LSHA 3W5UA 5E3MA 1G6NA 4M0LA 1K4ZA 2KLOA 1RKTA 5AMVA 4HX8A 1WQ2A 2CMPA 3ABUA 2FF4A 3EUAA 2JJ7A 4XM3A 3JRCA 2HLDA 3HRTA 5ICGA 3LWFA 4UZFA 4AU7A 4ROXA 2L9VA 1TL8A 3NB2A 2V79A 5BMZA 2XGJA 3ZQ7A 3ZZ0A 1I18A 4PFPA 4KFCA 4L9TA 1FC3A 3OY9A 2M2EA 3LQRA 1YQAA 2E1OA 3W2VA 3CMMA 1RC9A 1W7PB 1DDGA 4TSFA 1HXDA 4EJVA 2F4MB 3DCFA 1KQ5A 4PJLA 4A3IJ 3Q38A 4YIFA 2HYJA 1T98A 1YITB 4A12A 1VQLB 1H8AC 2J5OA 5FKLA 3GTQJ 1QPMA 1ZKGA 5J4VA 3JRDA 5HLIA 3ONUA 4D7NA 2DMPA 2O17A 2G7UA 1QVTA 2NOGA 2YR2A 1IXCA 4U88A 3K1NA 3JTGA 3SQVA 3BJAA 1HDPA 3KP5A 4G6TB 1NB9A 1UELB 2UXXA 5FKNA 1R71A 4PSWA 4Z4UA 3PUFA 1DQUA 3CXCB 3QP5A 4WF2A 1WOPA 5DS9A 1R6RA 2L7KA 4ZGNB 3HZJA 3VOEA 3F8MA 2VUMJ 1G2HA 1KK3A 3GFJA 2X0KA 3BCDA 3JR9A 3V7AA 1OHHA 4FXUA 4UZEA 2RKHA 1ONVA 2PMZA 3R0JA 3CCYA 2JA6J 3B73A 5JMCB 1NHCA 1WJAA 4L9NA 4XONA 4X05A 3RPUD 4ACBA 3O8GA 4N3NA 3GTJJ 1QA2A 2Z3YA 2GQQA 1LPQA 2J5PA 1U2RA 4WZTA 4WZLA 3HUGB 4IHWA 4KIGA 5E1WA 2VKVA 1GJRA 1NDHA 2G0YA 1RNLA 4UB8C 3A35A 1O8GA 4LB6B 3G4SB 3FM3A 2BVMA 3CCLI 4UHTA 2JA5J 1RESA 2LKSA 5J1RA 5LGTA 2DERA 5ILUA 1EFTA 4Z1MA 1KCCA 4LIUA 5DDGA 2M0MA 2V6EA 5BPIA 4ZZLA 2X9DA 4XN3A 3I4PA 3E1YE 3RKQA 3OPOA 4PC1A 4CQJA 2VOPA 1HOMA 2HYFA 1TLHB 4L5JA 2VBEA 1D8KA 5EJCA 3DV8A 4PK4A 1A5JA 6PAXA 2WWYA 2CW5A 2F2EA 1R00A 2EFNA 3QFRA 3ZOBA 3H5NA 1GR1A 2JPBA 1VZ0A 3OR1C 4ESBA 1EH7A 4UXNA 2ZJRF 2AS5F 1EP1B 3W2GA 3L2RA 2BMWA 5DNSA 4E7IA 1T6YA 2F5DA 3U6BA 3FMQA 4IEJA 3KP2A 1ULYA 5HODA 2NNYA 1BJAA 5EZHA 3JQPA 3SKBA 2INVA 2ZO4A 2Y0SN 3W2IA 4ASUA 1X4PA 5LFAA 3VO2A 2WV1A 4YRVA 1W4MA 2BSAA 3H5RA 3BH7B 4CSWA 2MD5A 2NZMA 2BY3A 2PQ8A 3Q6RA 2BY1A 3GUDA 3NWSA 4CO8A 1R9TJ 1QVGB 3SUCA 2GXAA 4BU2A 3DDYA 1T5EA 1M1EB 3DTIA 1Z9CA 1W0UA 2RVCA 3JRBA 1QHHD 5J8CA 4ZCIA 4HBLA 4EM0B 3BCBA 2O6WA 3CLQA 1TQMA 2O61A 3A03A 2WAQN 2RDPA 3PSIA 1S29A 5C44J 5IY5H 1DPRA 2WC2A 3LA3A 2HOSA 4G5GA 1S9HA 4HNVA 2WV0A 2O9LA 1WI9A 4RGUA 2MYSA 2FBIA 3T8TA 1KGSA 3A02A 3OEHA 1VQ8I 2VT2A 2X1EA 2IS6A 4MTDA 1HBXG 4YELA 2OK7A 4P2NA 3CCSB 2H1KA 2O0YA 1E3PA 4K1XA 1NHAA 2EZLA 2PMZN 1EXMA 4XNFA 2QZAA 2HZDA 1W7PD 2VC0A 3WHCA 1NG6A 4WXCA 1K8AD 1TT5B 2EILH 1B59A 5TISC 1F4KA 3WTVC 1QCXA 2R5YB 2C5HA 5KHDA 4YIRX 4M53A 2VQCA 2XZLA 1IUYA 2QY1A 1BIBA 5IP7J 3K6GA 2V7VA 4BEHA 3NAUA 1OFCX 4YZXA 1RI7A 4EATA 1RQRA 2W4SA 1BHEA 3MCAA 1IDKA 2UWMA 1S6LA 1ETKA 3RPQA 1FLIA 2QCOA 1UFMA 3MZ8A 4XIDA 3W2EA 3OYBA 3ZQLA 2HQAA 4H9GA 2PYGA 1S7OA 4E7HA 1WJ5A 2X1DA 2FNAA 3E0JB 3K69A 5H20A 4QVAA 2QA4B 3M3YJ 1R23A 4I99C 1YS6A 3FJOA 2IS1A 2V9VA 1QBJA 4YAWA 3FMSA 4FT8A 3ZRGA 1EFUA 1JTXA 2ELKA 4CCOA 4XLNF 2HVRA 2V1UA 1O8DA 1QA1A 5D5VB 3AKZA 1BOBA 2DMTA 3CZ6A 3I53A 3PENA 4Z4RA 3ASOH 3OYFA 2TDXA 3MCZA 4LIVA 2OTLI 3G2BA 3KX2A 1CLWA 2LLKA 2FE3A 2TCTA 1U2WA 1PJ5A 1G3YA 5GTIC 4HA8A 3VNVA 2Z33A 2WJYA 2Z9OA 2NTQA 3EUKL 2PJPA 1R1UA 3QOEA 2E2HJ 3FKJA 4U0VA 2CSOA 5FRMA 1QA3A 3SQNA 1BI3A 3F8CA 3S1NJ 2XSJC 4Q48A 3TP3A 4N9HA 3AAFA 2OK8A 4OZYA 1X4OA 2XKOA 1XSXA 1MMSA 1CQXA 3HPGA 3ZMTA 5C4XJ 4ENJA 2NS0A 2Z5UA 4CHUA 4G1VA 4PC7A 4YCQA 5BOXA 2R5ZB 2M7AA 3I64A 3JCUC 2JJ1A 1GO2A 3VB2A 1KQSB 1LFBA 2VODA 2X48A 3WE2A 4IHSA 1MW7A 3TBIA 3MMPA 3WE3A 2LVSA 4M2LA 2LMDA 1H80A 3UW0A 3A1YA 5M5YJ 4A3BJ 1NK3P 2A5YB 3CCVB 2LNBA 4A2UA 2KMUA 3P27A 4LLLA 1QVUA 1BI1A 2INUA 1WSRA 4IW3B 1OB5A 2RC6A 1BJZA 3DBLB 4BNCA 4Z06A 3Q39A 2DMNA 2GIVA 1D5YA 2BVLA 3OYGA 4G7ZF 3ZPNA 2E19A 1Q1VA 2ISZA 4N3GA 3FDYA 1XMAA 5GAGJ 1H0MA 3M1EA 4FE4A 5FO1A 1PUFA 2O0WA 4M6VA 5J8FA 4HLYA 3Q3SA 1K78A 4B3FX 3ZPLA 1KQ9A 4BHPA 5F0FA 4HG2A 3IL2A 3GQ7A 2CUZA 1FIAA 2Z6BD 1K28D 3BNWA 4MYUA 2NS7A 5K7FA 1WPCA 2XF5A 2BVNA 1F5TA 3K0LA 2GA2A 4DYCA 1A35A 1QRBA 4YC5A 2DO7A 2WY7Q 3ELKA 3ZC3A 3E6CC 1R1VA 2DJNA 1B72B 2AHOA 3FX3A 4PUSA 1N77A 2O7OA 5IP9J 2K86A 5EGOA 3FXQA 2A5WA 4JOMA 4L9VA 1JKOC 3HOZJ 2VNIA 1SAUA 3J80Z 4XKBA 2X1CA 2DIEA 3EYYA 2OZUA 2M8GX 2Y0MA 1JJ6C 2PYHA 1XN7A 1PKVA 5E3NA 3BTLA 2CJJA 1ZR2A 3S32A 1K73D 4P9FA 5TJJA 2OTLB 3L09A 4D5FA 3WTYC 1W5SA 1HF2A 2FRHA 4HE5A 3KEOA 1I39A 3OS2A 5JLWA 2QKMB 2DXIA 4AWXB 2BM4A 2ZTNA 3WTZA 4RBOA 2NSPA 5JI6A 4XK4A 2XZOA 1Q7YD 1TYVA 3BPVA 4CH7A 2LDUA 3LSJA 4YAUA 4P26A 2J8KA 2Z16A 3ZCOA 5EEHA 1OCOH 1KK1A 5F64A 3VEPA 1BW6A 2IVMA 4Z6YA 3DWLE 2XUBA 3QFTA 5DCMB 2X53S 2O04A 3WU2C 2DFIA 3F6OA 2I5UA 2CW7A 4BBRJ 4RB3C 2GJRA 3BZCA 3HKZN 3LVBA 5IOYA 2LREA 4O5VA 2BM0A 3BTCA 5B3SH 2DA4A 4ASNA 1E62A 2LY9A 3BZKA 2K9SA 1SVMA 3CUQB 2C78A 2L0KA 4CZZA 4BYYA 1FPQA 1KA8A 1FEXA 2VNHA 4Z2YA 2M3AA 3PJRA 2GZWA 2XGCA 1Z6RA 3IKTA 1SFKA 5E3LA 3ABMH 3K1MA 3OYHA 1M1KD 2HNHA 1GXPA 1KK2A 3OW2B 2E60A 3ERMA 3HSRA 3JSPA 4HLXA 1KC8D 2ZBUA 3QP6A 4M3FA 2JDIA 1JHFA 1LKXA 3H0GJ 5L3GA 1ZYRF 4JMQA 3CCJB 2PMUA 1R4NB 2WB1A 1E63A 3W5VA 1V55H 1O4XA 4IKFA 2K7LA 2OD5A 3P9CA 4MIMA 4NC8A 2KHMA 5CQEA 2VBKA 4F93B 2DA3A 2QQBA 4C3IJ 2KISA 3L2CA 2AHQA 4AVPA 3GQBA 3W6VA 3KEQA 1QA6A 2FBHA 3IKVA 2EH3A 3I3LA 5DCMA 3TW6A 3RTRA 3MZYA 1QGPA 1ZHFA 2VKHA 3KIOA 4LK0F 5ED4A 2OPTA 2ZMEA 3QPLA 3QU3A 2MC3A 3ES9A 1VQ6I 1FMWA 3HGYA 4Y9UA 2M8EA 1U78A 4G6DA 4RCYA 4B4DA 4B43A 2H09A 2LY2A 1QRCA 4ZH4F 2NVTJ 3H3VK 2VJIA 3HOXJ 1YHQB 1UD4A 2HDCA 4AD9A 2WBMA 3VO1A 3AVTA 3B78A 3ZBTA 1X1AA 3BG9A 4S0HB 4Q5SF 2EFOA 1TNTA 1FY7A 4JX4A 5DM7F 1VLOA 2HQ5A 2H8WA 2XB0X 3BCAA 5JVTA 4DOZA 1WRJA 2K3PA 5A2QK 3R6KA 3CMEB 1S5LC 2MH9A 2H94A 4BQQA 2QBYA 2F1LA 3U6KA 3RYPA 2BY2A 1U3EM 1EWYA 2DW4A 3HXLA 4C3JJ 4RB1A 4JQFA 3HBLA 2VFPA 1O8JA 2GXGA 1LM1A 2IS2A 3ASPA 2O5RA 4FCYA 2FJ1A 2DQRA 2DK5A 1W36C 3AVYA 3D5SC 3E1SA 2N8GA 4A3FJ 1U8RA 3CF2A 1OCZH 1YHQI 4A0XA 3HPHA 2HPIA 3WNCA 1GDTA 2F5FA 2XF6A 1N8RD 3MEXA 3ZN0A 2IGNA 1LUJB 1V4RA 2MC4A 1XCBA 3WTTC 1KU3A 4B4CA 1K83J 2VLAA 4IHXA 2ISYA 3OMYA 3CUOA 4PCQA 1R5OA 1W5TA 2QSFX 5M5WJ 4RS8A 1OCTC 1E3ZA 3ISPA 2Y75A 5GPAA 2H6CA 1VQKI 4QTRA 4CDGA 4YEJA 1G8XA 3ECOA 3ZQIA 5L3DA 4XLPF 3CCQI 1HLVA 1R49A 3R6JA 3OKXA 3BQJA 3JREA 1YITI 4HWVA 1P92A 5DS0A 1SD7A 1RR8C 2V9PA 5K5QA 4OAZA 3LAPA 3PO3J 3ZMDA 1N08A 1SD5A 2QX3A 3FBNB 1Z05A 4AC0A 1VQPI 5CKTA 4PZJA 3F9KA 1T0FA 1P9QC 3HKZA 5FKMA 3GQ8A 3VPRA 3S15J 4CXFA 2ADUA 2VL8A 2E1MC 3G1OA 3HM5A 3WTWC 3VODA 1JKRC 1VQNB 3QU6A 2P0WA 5C1EA 3MN2A 3FKIJ 4XSXF 1WTHD 1IN5A 1NBMA 1GVJA 2QEXB 2HQRA 2XROA 2CV0A 3P9KA 4Y15A 1YJ9I 3GO5A 4P25A 2JWTA 1O8EA 2ZXHA 2OU2A 1RPWA 2P4WA 2XDVA 4A6DA 4XLEA 3HHGA 4M3DA 1V0FA 1DBOA 1Z1DA 2HU9A 2K3FA 2ZL6A 1TUIA 3ZIAA 1MNMC 1CZFA 1KU9A 2I1LA 1SD4A 3QYBA 3I55B 2FU4A 2ZNYA 2Q6KA 4C0SA 4OPWA 2NXNB 2QQAA 1U0JA 2ZXJA 2DA1A 5EYRA 3LSTA 1JUPA 4BQOA 3S8PA 5DV5A 2VBVA 1R7JA 3ZQGA 3QPHA 3HOWJ 3AL0B 2BZTA 1K79A 4GCVA 2H6BA 2A6EF 2DT6A 3OWTA 4ZYDA 3S1QJ 4HRIA 2VNJA 4CYDA 4WK8F 1S72I 1H9TA 4Z4VA 2HDNB 2FSWA 3VNUA 1JUMA 2A3SA 1GHCA 3ZSCA 3TH0A 2LF7A 2H8RA 1TZLA 3QODA 2W6IA 2DFEA 1P4XA 5F4JA 5FJ8J 3OYKA 2PX9A 4AYBA 2CQXA 2Z8GA 2P5KA 4Z05A 1K78B 1UHSA 1JI8A 4EM1A 4FK8A 4AIHA 4XN0A 3P7NA 3VSVA 3Q9VA 5D8KB 3H9QA 4G7OF 3KPHA 4HYEA 2D2WA 2JVGA 1I1GA 2F5VA 1MJBA 4RB2C 4ZYGA 2HYGD 1F9NA 2VE9A 3OOUA 4RB0A 3VSLA 1QUEA 3OSGA 1N05A 1FOXA 2LZJA 3JAMK 2HXIA 1FZPB 4QV2A 4M1KA 2NNNA 2FD5A 1MNDA 4KN4X 2ICWG 2XEXA 1VQ6B 2WZPP 1UD8A 3SDGA 1UHMA 2F4IA 4G94A 1X1BA 4DNTB 2Y0SA 3CCSI 4HF2A 2A69F 1W36D 5BSYA 2V26A 1HW2A 4RDUA 4HV5A 1EH6A 3CJRB 3PQKA 1E3OC 3GTPJ 3VMVA 2DFHA 1WKMA 4I76A 4F91B 5LHHA 4ZC3A 3CMEI 2E2IJ 5E17F 4MQVA 2UZKA 3OR2C 2PIAA 2EV5A 3ZR8X 4U49A 2KDOA 1O57A 3DKYA 1VQ7I 2ELHA 4HZFA 3CO7C 1DP7P 2CGPA 1PJ7A 4LBYA 3A8KA 4V19K 2XAFA 3AG3H 1X2NA 4FX4A 3O3KA 2ZXWH 5EGOB 1PJ6A 5J47A 4TV7A 4NBQA 1L3LA 1UZCA 2CV1A 1MABA 2VT3A 3R4KA 2R9VA 4BPRA 1ERDA 2WTEA 2X0LA 4P5OA 3GMEA 5LHGA 2VXZA 3EQOA 1S0UA 4XQFA 3GEZA 4DNRB 1IO2A 3TKYA 5E8GA 1JE8A 4I0AA 1LB2A 3ERED 3OYIA 2RQQA 1W0JA 2R7RA 3DU5A 2MW8A 1HSJA 2XAHA 3L2UA 2O8KA 2KZVA 2YWEA 1B8IB 3LA2A 1PDNC 3L2QA 3J7ZI 1HW5A 5AONA 5A8AA 3GTLJ 2MD0A 4PJNA 1IW7F 5J4YA 4RGSA 4JK1X 1GV5A 1BN5A 3PSZA 4B1RA 1XSDA 2OC6A 2EV0A 3KYDB 4AUXA 1JKQC 2FA5A 1AIRA 5D4RA 3I56I 1BMFA 4KH3A 2ZZGA 3CMAB 2RNJA 4M3EA 1JHHA 2K27A 3C2BA 4QLCU 5GV7A 3ULQB 1FYMA 3VR6A 5FLVA 1QO0D 2R5YA 4YHBA 1MMGA 4ZYEA 2PLYA 2FMLA 1DGWY 5JLXA 3E7LA 1D0XA 3M1CA 1IGNA 4WQMA 2ZSIB 3U1DA 2VBXA 2O03A 4BEHB 2GBYA 3T1BA 1VBLA 3KP7A 3WY9A 3BT9A 2F48A 3FPPA 4KMFA 1Y8QB 1E43A 1N78A 3IUOA 4Z03A 2F3LA 5TGTA 2D9RA 3C2GA 1AHDP 4RD3A 4C30A 2KPMA 5M3MJ 5AIPA 4UUSA 3K4BA 1ZELA 3KYCB 4A3EJ 4NQWB 4BQNA 2JIZA 2ESNA 3M8EA 1AKHA 2ZL7A 4A69C 5BQTA 4KKSA 2VB6A 2EZIA 1ETOA 1X1DA 2I8DA 3GTMJ 3QYFA 3P5JA 3WBKA 3LSRA 4DYQA 4Z4WA 4OJ5A 1OQYA 4B8XA 1LLWA 3F8NA 1RUOA 2DA6A 2QXZA 2WSSA 3ML3A 3CTAA 2DPDA 1IN8A 3WODF 1S4MA 3S1MJ 4U0YA 1PYVA 1K4TA 1XFOA 1O8MA 2P5VA 2P5LC 5C1CA 3ZUGA 1YX3A 2QA4I 3PL8A 2W6JA 1MDMA 4ENNA 5J40A 3JW4A 3A0HC 3OZVA 1HSTA 1OPCA 1XTAA 1HKTA 3AVUA 4EQQA 5LD2C 4BKXA 2VNKA 2ESHA 3OV8A 2W48A 3N90A 1B4AA 5F4OA 1KK0A 4W8RA 2LBFB 3WTXC 1YG2A 1ACIA 2OF7A 1QFYA 1N75A 3RQ4A 1FBSA 3MVPA 1CF7B 2OBRA 2K02A 1XG1A 1JT0A 3SFZA 2JT1A 5GPCA 4A3JJ 1EJ9A 1YW7A 3BR6A 3W2AA 2JA2A 4KT6A 4CA0A 4ZDOA 2HR3A 1LEAA 4F7ZA 1ZRFA 2QE7A 3D5RC 3QOPA 3H36A 1P2FA 5F4MA 5IT3A 1BPLA 3JRFA 2VI6A 3EQLF 4B47A 3CESA 3ZBUA 5FRNA 1H8EA 3GCMA 1ENHA 3E6DA 3RJPA 1JRGA 2CH0A 1VQMI 5KK1A 1OGMX 5LRRA 4FWTA 5J3LA 3CCRI 1TW2A 3BY6A 1FP1D 1E64A 2C4TA 3W6JB 2IGMA 2QGGA 1GAQA 3BC8A 4ZJZA 3TDZC 5B1AH 5HS8A 4OIPF 1M90D 3OEEA 2XPWA 4LLNA 1T56A 2YUSA 2XC7A 1MDMB 3U9GA 3S14J 1ETWA 2I10A 3J81Z 4AF7A 4NC6A 1QUFA 4NUBA 3S93A 1F43A 2ME6A 2ZZEA 1OR7A 3BPXA 3PNTA 3OP1A 3GQAA 1EP3B 2A61A 3ZMUA 3QWLA 1FP2A 4OOSA 5TV2A 2XOKA 4X7DA 4TMZA 2KJBA 2G7HA 3ZQHA 4N9IA 4LG0B 4IRGA 4JX5A 5L3FA 1IA5A 2GOXB 1J9ZA 1KD1D 5HNHA 2R7UA 5F27A 3NWTA 3E5UA 3CCLB 2YPRA 2OQRA 3S2HJ 4YG2F 2X3UA 4NHJA 1XC5A 3OYMA 4RD6A 2X6YA 1JTYA 4XL9A 3RSNA 3T9GA 3RZOJ 1Z77A 2NVXJ 1XD7A 3B8HA 1EA0A 3WGHA 5KVRA 4ZTJA 2Q6LA 3IH3A 2QZ8A 3A3GA 3G73A 1O7LA 3DXJF 4DW6A 2GM4A 5FNZA 5FD5A 3OYLA 1D1BA 2M45A 4XORA 2F43A 1YI2I 2CO5A 4B44A 3M8JA 3HOVJ 1GV2A 3I59A 3H3UA 1W1WE 4M73A 4RDJA 3HJEA 3DKWA 1LNWA 2OZ6A 2XNDA 2CW0F 4QSHA 1KTVA 3K4LA 1XDSA 4NDLA 4RLFA 5A88A 1DARA 1BIAA 1WHUA 3F22A 4ANJA 4EMSA 1VJSA 2ZITA 2LFBA 3A8IA 3VWBA 1KYWA 1UHWA 2V7QA 1ON1A 3BJOA 2O6GE 3WYAA 4A6EA 2XPUA 2CQNA 4BE1A 1N25A 2GWRA 4I2OA 5EEGA 2K9LA 1UMKA 3P9IA 5J1YA 2DT5A 3HIFA 4PSXA 1G59A 3FK6A 4JYKA 3LSMA 1FSHA 2OCEA 1COWA 3HOUJ 2BW3A 4MLOA 1ZM4A 1HG8A 3L00A 2WAEA 2ZMEB 4RAGA 3ABTA 5HDNA 1QGAA 1D8TA 4UY8I 5J3OA 3HUGA 4II2A 3S2WA 5KNLA 2ZL5A 4HX4A 1VNDA 2HWVA 4ZDPA 3MD2A 2BM1A 1D0YA 3MHPA 1IRXA 2KIMA 3E3VA 3WTSC 4QPOA 1F20A 2K40A 2K4JA 4X8IA 4LJZF 3FY3A 4S05A 3E6MA 4RJLA 2BN4A 3I59B 1GVHA 4N0BA 3OYEA 3WQZA 4HV6A 3ABLH 2QGUA 3QRFF 1DDIA 1U5TA 3VYUB 1YIJI 3WNDA 5IP6A 1EP2B 4NBSA 4ZV4A 1VHEA 3JQRA 3FMRA 4N4NB 2PJRB 3PIOF 4C2UA 3GVLA 1BX0A 3ONYA 2V1NA 1DU0A 2V9KA 5FA6A 2O3FA 4M9XA 4I0BA 3OS0A 2M0CA 2FNPA 3ISXA 2DMQA 5FD6A 2W7NA 2KRFA 5H6RA 4EM2A 4PGGA 1BW5A 2C4UA 3H9NA 2BM6A 3FXKA 2CQKA 4UZUA 2EBIA 2XC1A 4BJ6C 1VQMB 3B90A 4XSZF 1APLC 2Y48A 1G7RA 2FOKA 1V5EA 2VZLA 3PFYA 4BXXJ 2EPFA 3QE2A 5DD4A 1ZK8A 3O8HA 4S04A 5J1UA 1YRNA 3CCQB 2WR8A 3GZNB 4LB5A 3SLNA 4Y9RA 1ZTRA 4X7CA 3CC2B 2R7DA 5FROA 4G8XA 2YUHA 1V5FA 4RPBA 1EKEA 4RAYA 3K70D 1OGIA 3GVAA 2LR8A 3SZEA 4H0EA 2IGKA 1BR4A 1WCMJ 3BY2A 3OIOA 2EZKA 2VJ4A 4OJLA 3VSUA 1IB0A 1R5ID 1X0CA 1S7AA 2NSTA 1CQTA 3SJMA 5H5JA 2CW8A 1TYXA 2IGOA 1YLFA 2PBIA 2DDBA 3NQOA 4C2TA 4X6AJ 3NAWA 3R61A 5DTDA 3BQZA 3C3WA 4RLZA 2XT2A 1RR7A 2JTVA 3DBRB 4IX7A 4HNUA 2B5OA 2DBBA 2TRTA 3ESWB 4RGXA 2BGIA 4YIIA 5FKKA 4Y33A 2V7WA 2M34A 1ZM9A 4BE0A 3BG7A 1QJVA 4B3XA 3HSEA 4HE6A 3B6AA 4P3YA 2JA8J 4ZYHA 3BR0A 1HCRA 2W24A 1Z3YA 4MQ9F 4IJAA 3CD6B 3RYRA 4D7MA 4KIFA 4UUSB 1FIPA 4Y4RA 4BQAA 4MO7A 1XMXA 1TWAJ 2EA2A 2LD5A 2D74A 3GX4X 3LAJA 3NE5B 1HZEA 3GTGJ 3TEDA 2DA5A 4BH9A 2E2JJ 4XMYA 4HOBA 4DK1A 1Q1HA 2D5VA 1IV8A 3F3XA 2BPOA 3ZZUA 2VFQA 4HIZA 4IRHA 2L9SA 1BBYA 4PC2A 1GAWA 4FN5A 3BG5A 4RA2A 4XKCA 2P6TA 1FOYA 1MZBA 2ELJA 2LP0A 2MABA 5FFZA 1W34A 2GK7A 2JK3A 1LVAA 2PN6A 4XRSG 3HRMA 2ZJPF 1SVLA 1X2MA 2KJCA 1SC7A 5EG0A 2W7ZA 3C1DA 4U7BA 4WWCA 5FLMJ 4P55A 1TQPA 3WHBA 1VI0A 1VQ9I 3WGGA 3L7WA 2VYQA 2ZFUA 4IL6C 2E7WA 2E34A 1T6ZA 2NVQJ 4E7SA 1O3QA 3A4CA 1QNTA 4EEFG 3DFGA 4W8QA 3ONQA 1SFEA 3IAM2 1BL0A 1MH4A 4A0YA 5D4SA 4EJWA 1T33A 1IUFA 1J2XA 1UD6A 2E1BA 4L18B 1MGTA 3J80K 1FSEA 3DU6A 3OYDA 4HAMA 3G6EI 1ZAOA 2ECBA 4AYBN 2LKXA 1OFDA 4BS9A 1VF9A 3W3CA 3A0BC 5HLGA 3K4JA 1ZN2A 2R3SA 2ZMEC 4CZCA 1OMIA 3HSFA 3DPLC 2VXDA 3WBJA 3VSTA 2PE3A 3TMOA 4Y13A 1I7PA 2GJKA 3SYJA 2QUFA 1B9NA 4F52A 3DF8A 5ICCA 1RUNA 1V0EA 2Y31A 1KRHA 3GLXA 1C0WA 2JRTA 3GTOJ 4YZQA 3UR3C 3WGIA 1PXZA 3E20A 4BUPA 1X1CA 3A8JA 1TTYA 1E17A 5IYWA 3GFIA 1MKMA 3CP2A 5M5XJ 1Z7LA 4C3HJ 3CCVI 2XTYA 5E6TA 3TGNA 2KRCA 2VQHA 1OYYA 5IYCJ 2XIGA 5DUIA 1NTCA 3V7RA 4J01A 2CV2A 5IYPA 2YWHA 3LJYA 4ZTFA 2UUZA 1ZRCA 4MGRA 1GQ8A 4V2FA 1BI2A 5ILSA 1Q9SA 2KDZA 4QUZA 1WSUA 3K70C 4IO9F 2P81A 2BHYA 4IQ4A 1PLUA 1QZEA 1Z7UA 4LD5A 4G7HF 1FNDA 4GGGA 3V42A 4F7DA 4PDKA 1E0EA 2RC5A 5IYDJ 1VQKB 1VQ4B 3EYIA 2XNCA 1FYLA 2B63J 4DYRA 4WXHA 2WZNA 3PUNA 1MMAA 3A01A 1ZARA 1YIJB 2JN9A 1E1QA 2Q6IA 3BH6B 1YJWB 2EQRA 1GT0C 2BE5F 2YWFA 2X8KA 1TWCJ 2XB5A 2LF8A 3GSIA 3QSYA 4FETA 1R5HA 1UG0A 2DK8A 5E1ZB 1IC8A 3SDBA 1XMKA 2GLOA 4AC9A 3BJ6A 4UUTA 4HNTA 3KETA 5L46A 4D5CA 1MMNA 2HDWA 4HDUA 1D0ZA 3FHZA 3PETA 2L9NA 1J7KA 2Q1ZB 3OL3A 2CRVA 4OIRF 2IP2A 1P6RA 2BXYA 3J7AO 1YLOA 1Z21A 1FNCA 3WXMA 3FKSA 4EGYA 3GRHA 1MIJA 3CCEI 4HDVA 1TYUA 4DZJA 3T5XA 3OYCA 3HTUA 3HOYJ 1I3QJ 2NRAC 1U5TB 5GAEJ 5D5WB 1FDRA 4WXDA 2F1MA 2D3NA 3K4MA 1NH3A 2QYOA 2DTRA 2M5SA 2RN7A 4QWQA 1KQ8A 1H9GA 1IV6A 3JSOA 4M4SA 1VQ5I 2F5EA 3BY1A 4PABA 2EFQA 3Q0WA 1KZHA 2CWEA 1WWXA
chains in the Genus database with same CATH topology
2ODLA 2CV1A 1MABA 2VASA 3CJQB 4Z1MA 1KCCA 4LIUA 4BACA 2R9VA 2V6EA 2M0MA 1UD3A 4EW9A 1ERDA 3BCFA 4P5OA 1OGOX 1XG2A 4XN3A 2VXZA 3OPOA 2R7OA 2R7TA 2O1DA 3EQOA 1MMDA 2X3HA 4XQFA 4DNRB 3C2HA 1E79A 1VF7A 2VBEA 2LG4A 4PK4A 1Z3XA 2M4GA 2CUJA 3VDXA 4HEA2 2RQQA 3OYIA 2R7RA 3DU5A 3L2UA 1W0JA 1O8FA 2KZVA 2RNGA 3L2QA 4CCMA 2KL4A 3H5NA 3WWGA 1VZ0A 2MD0A 3OR1C 4LITA 3HOSA 3L2RA 4PJNA 3SEZA 3VSKA 4G6IA 4E7IA 4HSRA 3B8YA 1HA8A 2INVA 2OC6A 3PUBA 2LH9A 2CK3A 2FUG2 3LMMA 4TKOB 4KKUA 2LRDA 4ASUA 1X4PA 5LFAA 1BMFA 1AIRA 3ZPPA 2ZZQA 4YRVA 2ZZGA 3H5RA 2NTPA 4DGWB 4CSWA 1O8LA 2NZMA 1KONA 1KCDA 2KVOA 3NWSA 3VR6A 3SUCA 3OW7A 1MMGA 2IQ7A 4BU2A 3DDYA 1DGWY 2L5QA 4C2LA 1D0XA 3M1CA 4CCLA 1T5EA 3DTIA 2ZSIB 1E3XA 2VIXA 4OAYA 4BEHB 1QHHD 4BL0B 1VBLA 2KQRA 4DJAA 3FPPA 1E43A 1N78A 3IUOA 4RLQA 4Z03A 2AQFA 5TGTA 2PJRA 3BCBA 2WADA 1BR2A 3C2GA 2E5ZA 1PJRA 3MKZA 3GVKA 1T95A 3PSIA 4C30A 2KPMA 1UAAA 3G05A 3DQVC 2V7FA 3K4BA 1S9HA 1ZELA 1NG7A 4NQWB 4BQNA 2JIZA 2MYSA 3OEHA 2X1EA 2IS6A 4F55A 4KKSA 2VB6A 2I8DA 1X1DA 4YELA 2XAUA 3QYFA 1KTWA 4CCKA 4OJ5A 2IS4A 4XD7A 1WJFA 4XNFA 2KP6A 2HZDA 2QXZA 1NG6A 2WSSA 4PJJA 1LVKA 1MNEA 4W8SA 1PYVA 3EQNA 4E7JA 1O8MA 1QCXA 4N4OB 5KHDA 5C1CA 4CCJA 2VQCA 1YX3A 4F3QA 2XZLA 2QY1A 1IB4A 5KCMA 3PL8A 3K6GA 4NNJA 2W6JA 4BEHA 5HNFA 4RMNA 2V4DA 4YZXA 4EATA 2K9MA 2W4SA 1BHEA 1IDKA 1I8DA 2UWMA 5LD2C 2UVFA 2WY8Q 4W8RA 3ZXSA 2LBFB 3PNVA 1N75A 3RQ4A 1W0KA 3OYBA 2HQAA 2PYGA 2VKDA 1OFMA 3PSFA 4E7HA 1KZLA 3K10A 3W2AA 4W8TA 1WJ5A 2X1DA 3E0JB 5JHFA 4XKWA 2JA2A 4HPQA 4KT6A 4CA0A 4ZDOA 1Y56A 4U87A 2IS1A 1IDJA 2LOOA 2UV1A 4Y3OA 3D5RC 2QE7A 1RMGA 3ZRGA 3LNNA 4CCOA 1BPLA 1WP6A 3L2WA 2HVRA 4B47A 3GBGA 3CESA 2DJIA 3ZGKA 5FRNA 3AKZA 1H8EA 1O8DA 1BOBA 3CZ6A 4IZZA 2M4KA 3OYFA 1JRGA 3OL4A 4LIVA 2CH0A 1OGMX 3G2BA 3KX2A 3BH4A 3DTEA 3VYSB 2LY1A 4GRIA 2IGMA 4XLAA 3BC8A 3VYTB 4BJTA 1PE9A 4ZJZA 3LMWA 3OEEA 2WJYA 2XC7A 3EUKL 2X6XA 2NTQA 3QOEA 3OYNA 2V31A 3OFNA 3DPUA 3FKJA 5FRMA 5CDFA 2XSJC 4NUBA 3S93A 2LYCA 2ZZEA 2O0VA 3HG9A 3PNTA 3GQAA 4OZZA 4OZYA 1X4OA 3HPGA 2XOKA 2BOLA 1EA3A 1QHGA 2M7AA 2JJ1A 2VQLA 3H9JA 3AL0C 2WAQA 3EPZA 4BDYA 4XLFA 2E5NA 1MW7A 3TBIA 2VBMA 1IA5A 1H80A 3UW0A 2GOXB 3A1YA 2X51A 4CUGA 2KMUA 5HNHA 2R7UA 1K5CA 3KYLA 2INUA 3NWTA 2DCEA 4YXWA 3GQ9A 4C9YA 4MR0A 4Z06A 2BVLA 3D5LA 3OYGA 2OUMA 3OYMA 2HPMA 3ZPNA 4DBQA 2X6YA 4XL9A 3RSNA 3TL4X 3T9GA 3FDYA 3T53B 2O0WA 4B3FX 2Q2EB 4U4BA 4ZTJA 3S3NA 4E7ZA 3GQ7A 4HG2A 2CUZA 2R7VA 3A3GA 4XLCA 5CQGA 1K28D 2Z6BD 3OYLA 1W9XA 1D1BA 3LSIA 4XORA 3OYJA 1WPCA 2F43A 2GJPA 5CPRB 4B44A 2XF5A 3M8JA 3T51B 3OIQA 2GK6A 4B3GA 4X0GA 3J7AY 5FL7A 1DGRM 2WY7Q 4KKTA 1SKYB 2XNDA 4PUSA 1N77A 4KISA 3K4LA 2X85A 2A5WA 4JOMA 2R4GA 4RLFA 2PECA 2Z2SB 1SAUA 4XR6A 4XKBA 1AA7A 2X1CA 3LL7A 4ANJA 3N05A 4H4KC 1VJSA 2DIEA 4LG3A 3H5AA 2XZPA 3VWBA 2W1OA 2V7QA 1OLTA 1PKVA 2PYHA 3S32A 4NK6A 3SZGA 3L2VA 4BE1A 1DBGA 4ITVA 2K9LA 4PSXA 4XLHA 3OS2A 1G59A 4PFOA 3LSMA 2QKMB 2DXIA 1COWA 4BGDA 2BW3A 4MLOA 3DPTA 2ZTNA 3B4NA 1T0FC 1HG8A 2XZOA 1O8IA 2NSPA 2WAEA 4URRA 1WMRA 2BW3B 3EUHC 1GLNA 4BJ5C 4CH7A 2K5CA 3BLYA 4II2A 5KNLA 3H94A 3SYTA 1BN8A 1O8HA 3HOTA 2Z16A 3DTKA 3ZCOA 3BG6A 3MD2A 4ZDPA 1D0YA 4RM2A 1IRXA 2WAFA 2QKLB 3DWLE 4QPOA 2L2OA 2X53S 2O04A 2WA0A 4BDZA 2CW7A 2GJRA 3FY3A 3S3OA 2ZTGA 3OYEA 3WQZA 2F6CA 2LREA 4E4HA 2R7SA 2DOAA 2JVHA 3VYUB 3OOCA 1Y6IA 2CFOA 4N4NB 1FMVA 2PJRB 4C2UA 3GVLA 2BSPA 2V1NA 2V9KA 3LFUA 3OS0A 2W7NA 3MKYB 4ZYAA 2M3AA 3PJRA 4NK8A 1BR1A 1SFKA 3OYHA 4XKVA 4UZUA 2HNHA 4RM3A 3JU4A 4BJ6C 3VMWA 2E60A 3HC7A 3B90A 2VJJA 4AVZA 1V5GA 2JDIA 4E7LA 1JTAA 1V5EA 1LKXA 1VLYA 3A2KA 3PFYA 5IK2A 4JMQA 4YZ0A 2WB1A 3OE7A 1J09A 4J00A 4IKFA 3PNYA 2W00A 4NC8A 1EFRA 3GVJA 2KHMA 5CQEA 3H0DA 2VBKA 4F93B 2VQGA 2GOMA 5FROA 1WJCA 4ZDLA 4D9JA 4OWRB 3OS1A 3DEEA 3GQBA 4I84A 1K6YA 1V5FA 2LC2A 3K4NA 3KRGA 3K70D 3I3LA 3H35A 1WJBA 3RTRA 2HVSA 2VKHA 2IGKA 3DLAA 1BR4A 2A6TA 4OJLA 2VJ4A 1E1RA 1FMWA 3VSUA 1X0CA 3UNGC 2NSTA 2CW8A 2EWEA 4B43A 2IGOA 2R7XA 1OFLA 2OV7A 1O8KA 2LY2A 2V4JC 4C2TA 5DN6A 2VJIA 4BXFA 1UD4A 4IX7A 2R7WA 1D1AA 2WBMA 4HNUA 1HVXA 1OB0A 3IP4B 2JSPA 2NT6A 1X1AA 4Y33A 2E1MB 5HKKA 3CP8A 2W82A 4BE0A 3BG7A 1QJVA 4B3XA 3BCAA 4DOZA 3RCOA 3OYAA 2NOJB 2K3PA 3HL2A 1Z3YA 2IXSA 4BQQA 3FHNA 4Y4RA 4F92B 2ZZFA 1TT0A 2JUGA 3HXLA 2VPLA 3NE5B 1HZEA 4JQFA 1O8JA 4XMYA 2IS2A 1WJDA 2O5RA 4DK1A 2HVQA 3HAGA 3MMYB 1W36C 4HIZA 4XOPA 3D5SC 3E1SA 2L9SA 3CF2A 3S3MA 2RREA 3HPHA 2HPIA 4XKCA 2XF6A 3VYRB 4IQJA 3QYEA 2ELJA 2MABA 2GK7A 2IGNA 3OAAA 2MC4A 2VLAA 3OMYA 4II3A 1EE6A 3W2WA 1LDKB 1E3ZA 1WJEA 4U7BA 1RWRA 3BC9A 4YEJA 1G8XA 3FBIB 3OIPA 4HSTA 4DIQA 1UD5A 3JURA 2ZFUA 4P1WA 4HWVA 3K4CA 4KITB 3KEYA 4E7SA 3A4CA 3DKXA 4OAZA 2UVEA 3ONQA 4W8QA 3IAM2 1DP3A 2ZXIA 2QX3A 3KEWA 1D1CA 3FBNB 4KJZA 1UD6A 2E1BA 5CKTA 2D3LA 3F9KA 1P9QC 3HKZA 3GQ8A 3DU6A 2VJ5A 3OYDA 2VL8A 2E1MC 2R7QA 4BS9A 2P0WA 3W3CA 3K4JA 5C1EA 4CZCA 1KMHA 3DPLC 1OR7C 2VXDA 1WTHD 1NBMA 3VSTA 2CV0A 3TMOA 2GJKA 4F52A 4YZAA 1V0EA 4L8JA 5HLTA 3SEQA 2LBFA 4TT3A 2ZXHA 1O8EA 2X6WA 2AQEA 3AFHA 3UR3C 4E6KG 3MKWB 1PXZA 4YZQA 1OOCA 4BUPA 1X1CA 1X19A 2XDVA 1RU4A 4XLEA 1QU3A 1V0FA 1DBOA 2HU9A 3CP2A 3ZIAA 1Z7LA 2KRHA 1CZFA 1BLIA 2KRCA 2VQHA 1O88A 2Z1DA 1WFXA 3QYBA 4J01A 2MFZA 2CV2A 4ZTFA 2UUZA 1NRKA 4OJOA 4G7WA 1YE9A 4D1QA 1GQ8A 1U0JA 1H8HA 4PJMA 3LSHA 2CS3A 4BQOA 5AMVA 2KLOA 4B48A 2JJ2A 3K70C 2CMPA 3EUAA 3AL0B 4XM3A 2ZSHB 1LFPA 2HLDA 4DBRA 3OWTA 2DT6A 4IQ4A 4AU7A 2M7BA 1PLUA 4HRIA 2WPDA 3ZQQA 2XGJA 3V42A 4E7KA 1UD2A 4DK0A 1E0EA 1I18A 3I9V2 4PFPA 4OJ6A 3OY9A 3ZSCA 4E0FA 1TZLA 3QODA 3W2VA 3CMMA 4CCNA 4QPQA 4TSFA 2W6IA 1MMAA 2WJVA 3OYKA 4R79A 4PJLA 1E1QA 2NT9A 4AYBA 2Z8GA 4Z05A 1JI8A 2X8KA 3K4KA 4XN0A 2XF7A 3VSVA 4FETA 3H9QA 1UG0A 4NC7A 3U21A 2JVGA 2O17A 3SDBA 2F5VA 4HNTA 3OOUA 4G6TB 1MMNA 1UELB 2HDWA 3VSLA 4PSWA 2LZJA 1D0ZA 1DQUA 3LSGA 3T56B 2L9NA 1MNDA 4OJPA 1YX5A 1R6RA 2L7KA 4G7XA 2Q1ZB 3OL3A 2WZPP 1UD8A 2F4IA 4PMHA 3BCDA 1X1BA 1Z21A 4DNTB 2Y0SA 4BE2A 1OHHA 4FXUA 3FKSA 3GRHA 1W36D 2PMZA 2V26A 1NHCA 3CJRB 3VMVA 1WJAA 4XOTA 3IAS2 4XONA 3RPUD 3OYCA 5HOOA 4F91B 4ZC3A 2F1MA 3A3BA 2D3NA 3K4MA 4FASD 4MXNA 3LSKA 2DT7B 2M5SA 3OR2C 3HUGB 4U49A 2KDOA 3DKYA 3A35A 1O8GA 1FX0A 3H9GA 2BVMA 4GQNA 3S8PA 3ZR8X 2NTBA 4P22A 5HVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODL A;  1JRG A;  2UVE A;  4W8Q A;  1OGM X;  1KCC A;  4EW9 A;  2QX3 A;  4XLA A;  1OGO X;  1XG2 A;  4XN3 A;  1PE9 A;  3EQO A;  2O1D A;  3LMW A;  2X3H A;  4XQF A;  3GQ8 A;  2BSP A;  2NTQ A;  2X6X A;  2VBE A;  2O0V A;  1O8F A;  5C1E A;  3GQA A;  4OZZ A;  4OZY A;  4NK8 A;  3VST A;  4XKV A;  3WWG A;  3VMW A;  3B90 A;  4AVZ A;  2VJJ A;  4YZA A;  1O8E A;  1JTA A;  2X6W A;  3B8Y A;  4XLF A;  2INV A;  4YZQ A;  1PXZ A;  2VBM A;  1OOC A;  4YZ0 A;  1IA5 A;  1H80 A;  4XLE A;  1AIR A;  3UW0 A;  3ZPP A;  1DBO A;  2NTP A;  1CZF A;  1O8L A;  2NZM A;  1K5C A;  1KCD A;  2VBK A;  1O88 A;  1RU4 A;  2INU A;  3GQ9 A;  3SUC A;  4I84 A;  4MR0 A;  2IQ7 A;  3KRG A;  4C2L A;  4OJO A;  1GQ8 A;  4Z06 A;  1VBL A;  5AMV A;  2X6Y A;  4XL9 A;  4OJL A;  3T9G A;  3VSU A;  4Z03 A;  1X0C A;  2NST A;  2O0W A;  4XM3 A;  2EWE A;  1OFL A;  1O8K A;  1PLU A;  4U4B A;  3GQ7 A;  2VJI A;  4XLC A;  4OJ6 A;  3ZSC A;  4XOR A;  2NT6 A;  4YEL A;  1KTW A;  1QJV A;  2NT9 A;  2Z8G A;  4Z05 A;  4OJ5 A;  2X85 A;  4XNF A;  4XN0 A;  3VSV A;  2QXZ A;  2PEC A;  4XR6 A;  2O17 A;  4W8S A;  3EQN A;  1O8M A;  1QCX A;  2PYH A;  5C1C A;  1O8J A;  2QY1 A;  4XMY A;  1IB4 A;  4NK6 A;  1DBG A;  4OJP A;  4YZX A;  4XOP A;  1BHE A;  1IDK A;  4XLH A;  2UVF A;  4PMH A;  4W8R A;  3B4N A;  3GRH A;  1HG8 A;  1O8I A;  2NSP A;  1NHC A;  3VMV A;  4XOT A;  4XON A;  1WMR A;  2PYG A;  4URR A;  1EE6 A;  1OFM A;  4W8T A;  1O8H A;  1BN8 A;  4XKW A;  1RWR A;  4MXN A;  1IDJ A;  4U49 A;  4YEJ A;  1RMG A;  1O8G A;  2O04 A;  3JUR A;  3FY3 A;  4HWV A;  1O8D A;  2NTB A; 
#chains in the Genus database with same CATH topology
 2ODL A;  2BM5 A;  3SJZ A;  1EFC A;  2VAS A;  4KYW A;  4BAC A;  4W97 A;  4EW9 A;  1W35 A;  1FWZ A;  1Z0X A;  4GFB A;  4RD2 A;  2QQ9 A;  2O1D A;  5IPA A;  2Y30 A;  1MMD A;  2B9S A;  2F4O B;  4M72 A;  3C2H A;  1VF7 A;  2C6Y A;  3RQI A;  1IN6 A;  3VDX A;  1Z3X A;  2M4G A;  2CUJ A;  3CCM I;  4HEA 2;  4EGZ A;  3MZH A;  3KP6 A;  1WZ2 A;  1SAX A;  1XSV A;  2YWG A;  1O8F A;  2M87 A;  3V76 A;  4WWV A;  1MBJ A;  1SAN A;  2A07 F;  3GFM A;  3HTS B;  2HMA A;  2KL4 A;  3WWG A;  1V54 H;  4LIT A;  3V8J A;  3A1P A;  3CQZ J;  3ZN1 A;  2HOT A;  2CC2 A;  5L3C A;  5EF6 A;  4HSR A;  4LBZ A;  3B8Y A;  2DOE A;  2CK3 A;  1L0O C;  2FUG 2;  3LMM A;  4IOA F;  4KKU A;  4TKO B;  2LRD A;  1F1Z A;  3FK7 A;  3REO A;  1QG0 A;  3ZPP A;  1FRN A;  1ZR4 A;  2ZZQ A;  3IH4 A;  2BM7 A;  1U6G A;  3G1L A;  3GYH X;  1QGZ A;  3MFK A;  2VFM A;  4BBS J;  2KVO A;  4MYT A;  1OB2 A;  2YX7 A;  3BQY A;  2IQ7 A;  4C2L A;  2UXN A;  5HS9 A;  4CCL A;  2LKP A;  2NPF A;  1IXR C;  4OAY A;  4BL0 B;  1A31 A;  2KQR A;  3ZP5 A;  4DJA A;  2P7C B;  2BBY A;  4KUM A;  3BRO A;  1BM9 A;  3DP7 A;  4RLQ A;  4ETS A;  4P6Y A;  3VFZ A;  3I58 A;  2PJR A;  2R93 J;  1QH0 A;  2WAD A;  1TSP A;  1PJR A;  4RGR A;  1OYW A;  3MKZ A;  3GVK A;  1T95 A;  3JRG A;  1L1I A;  3CC2 I;  3HB9 A;  4LC0 A;  1W2B B;  3SXY A;  1ZLK A;  2NS8 A;  2V7F A;  2BYV E;  1NG7 A;  1OCR H;  4IRI A;  1Y1V J;  4L0Y B;  3ROU A;  2C2W A;  4WCG A;  3CCU B;  4F55 A;  4OP7 A;  4ACA A;  2XGE A;  3CCR B;  1KTW A;  2OJE D;  3JTH A;  3WTU C;  4U7D A;  3BR1 A;  1WJF A;  3I54 A;  5JHU A;  2B0R A;  2E1C A;  5H2F C;  2KP6 A;  4KNY A;  4RPD A;  1R5G A;  5F0C A;  3RZD J;  1WGX A;  1K6O A;  4PAA A;  3S17 J;  1LVK A;  1MNE A;  4DZP A;  3F8B A;  4YFO A;  5M3F J;  1IJF A;  1PUF B;  3FXO A;  2NVU B;  4PGH A;  2FBK A;  4F3Q A;  2OBS A;  4K2E A;  1IB4 A;  1IN7 A;  5KCM A;  2Q8K A;  2PMH A;  4NNJ A;  3ASN H;  3CDI A;  2B7C A;  2V4D A;  2K9M A;  2HZT A;  2K4B A;  2MBF A;  3GZ5 A;  4A0Z A;  2UVF A;  1JT6 A;  3K9T A;  2EZH A;  4Q47 A;  1MBF A;  1YW9 A;  1W0K A;  4I01 A;  5FLX Z;  4IOC F;  3PSF A;  2HEO A;  5FO0 A;  4XKW A;  1HQC A;  3F72 A;  2COM A;  4EVI A;  2STW A;  3AVW A;  1IDJ A;  2G9W A;  2XHK A;  4U87 A;  4UVC A;  2XAG A;  4Y3O A;  3ASS A;  1RMG A;  3LNN A;  1GVD A;  3L9F A;  1F36 A;  3B6C A;  4O6J A;  4AIK A;  5H6Q A;  2MA3 A;  2D1V A;  5EZG A;  2MH2 A;  3IRQ A;  5KAF C;  2D45 A;  4IZZ A;  1I50 J;  2W84 A;  3OL4 A;  3BH4 A;  3DTE A;  3VYS B;  2LY1 A;  4GRI A;  4XLA A;  4BJT A;  2CQQ A;  1B8I A;  1VQ9 B;  1N0V C;  3CCE B;  3CD6 I;  1XQB A;  2X6X A;  3OFN A;  3GZ6 A;  3DLL F;  3DPU A;  1S8N A;  1E2X A;  2LTP A;  1YS7 A;  1IJE A;  2ECC A;  2DEU A;  1XB4 A;  1AU7 A;  3TQN A;  4EV0 A;  2O0V A;  4A3C J;  4IPA A;  3HG9 A;  2EWN A;  3GF2 A;  5FGM A;  1R5B A;  4OZZ A;  3ZQC A;  2LK2 A;  2YU3 A;  4M71 A;  1VFC A;  2QEX I;  5F1J A;  4R8H A;  1S72 B;  1TWF J;  1JNY A;  1QHG A;  1T08 B;  1HW1 A;  2HXO A;  2M30 A;  2VQL A;  3H9J A;  4GYG A;  2Q2E A;  3J81 K;  2JMW A;  3UKG A;  4XLF A;  2E5N A;  2EFP A;  3HHH A;  1WU8 A;  2VBM A;  4X7E A;  2EFW A;  2X51 A;  5FFX A;  3QPT A;  2DQL A;  4L5E A;  1ON2 A;  4CUG A;  5GAH J;  3Q3A A;  1K5C A;  2FOW A;  2DCE A;  3I55 I;  4YXW A;  4YAF A;  2KFD A;  1OYI A;  1O7F A;  4XIC A;  1XGS A;  3FF5 A;  3O6B B;  5CYV A;  4OOV A;  3IRR A;  3COA C;  3CC7 B;  4A3K J;  2JN6 A;  3A01 B;  3T53 B;  2L01 A;  4HF0 A;  5CVU A;  5K1Y A;  1P4W A;  4JRA C;  4UV9 A;  2Q2E B;  1SMY F;  4U4B A;  3S3N A;  4E7Z A;  4X0C A;  2OYN A;  3W2F A;  4RM0 A;  4XLC A;  2YS9 A;  2CUE A;  3S1R J;  1ZM2 A;  1W9X A;  4YAO A;  3LSI A;  2NYX A;  3NRV A;  1B1B A;  4GYI A;  2QF7 A;  2VPR A;  4ON0 A;  1IRZ A;  3CW2 A;  4ENK A;  3T51 B;  3OIQ A;  2GK6 A;  4WZK A;  1TWH J;  4ESF A;  1Z6T A;  4OIN F;  2PI0 A;  2VOO A;  4KKT A;  2QVO A;  4OPV A;  4MEX F;  3HYI A;  2VFO A;  1G3W A;  2R4G A;  2PEC A;  2IBD A;  2FMY A;  3RKY A;  3LL7 A;  3TDU C;  3N05 A;  1LDD A;  4LG3 A;  1O3R A;  1ZQ3 P;  1WSV A;  2A68 F;  2W1O A;  1OKR A;  5KAI C;  4NK6 A;  3SZG A;  1DBG A;  2E36 A;  1Y0Y A;  4FIS A;  3LOC A;  2DET A;  4ITV A;  3LQE A;  1A04 A;  4ESJ A;  1P7I A;  3W6K B;  4XLH A;  4M6X A;  1TC3 C;  4BGD A;  3B4N A;  3DPT A;  3LA7 A;  2EJR A;  2JZY A;  1ZG1 A;  3HGG A;  3AG4 H;  4NCN A;  2IRF G;  3L1P A;  1A6I A;  3LQQ A;  5ICE A;  1FTZ A;  1OCC H;  2BW3 B;  3EUH C;  1GLN A;  1H42 A;  1ETV A;  2QWW A;  3H94 A;  1Q81 D;  3SYT A;  1BN8 A;  1XB2 A;  2K9N A;  2EIK H;  4PJ0 C;  3I4M J;  2WAF A;  3CDH A;  2QKL B;  1WI3 A;  1T2K A;  4IHV A;  2R5Z A;  1YRN B;  2GPJ A;  4R1H A;  2JUC A;  2WA0 A;  2L7F P;  2P3M A;  3KP3 A;  3S3O A;  2ZTG A;  5J6X A;  4OMZ A;  3IV5 A;  1Q82 D;  1E3H A;  4L5I A;  2RAE A;  3U2Q A;  1JGG A;  1IXS B;  3CJT B;  4LLG F;  2R7S A;  2NV4 A;  2DOA A;  1I27 A;  2JVH A;  1G7T A;  2E1R A;  5ILV A;  1Z91 A;  4B3A A;  4HQE A;  1ELO A;  1FNN A;  5B1B H;  1AMO A;  2BEO A;  1WH7 A;  2CFO A;  3PO2 J;  4X1E A;  5LEK A;  3N4M A;  2IOU G;  1U9N A;  4E70 A;  5JVG F;  1TVC A;  2BSP A;  1V3F A;  1S3J A;  1UMQ A;  1G7C A;  2DCU A;  2HOE A;  3LFU A;  3LYC A;  1MSE C;  1U8B A;  3MKY B;  3C18 A;  4M6Y A;  4BXU A;  5DUK A;  2PFB A;  1QVF B;  3FIW A;  4XKV A;  1DPU A;  1ZLJ A;  1KU2 A;  5FO5 A;  4OOI A;  3GFL A;  3EUH A;  1I3A A;  4E7L A;  1JTA A;  4MEY F;  5B5E C;  2L4M A;  4FX0 A;  1XCV A;  3JRI A;  2V5I A;  3TO6 A;  4Q4Z F;  2IA0 A;  3G1M A;  3PM1 A;  1SFO J;  1POG A;  3R6S A;  4YZ0 A;  1J09 A;  2HTS A;  4J00 A;  5CJ9 A;  2B0L A;  2ETH A;  3PNY A;  3OOP A;  1J0R A;  2CUF A;  5F6F A;  3H0D A;  5FKO A;  1P4M A;  1RU4 A;  2GA1 A;  1IN4 A;  2GOM A;  2IAI A;  4ZDL A;  4ABZ A;  3OS1 A;  4IVN A;  1Y1W J;  1WOO A;  4JP0 A;  2LC2 A;  4PC6 A;  4I84 A;  4R71 A;  3KRG A;  2QDX A;  2CYY A;  3H35 A;  1WJB A;  3PQJ A;  1ITY A;  2IW5 A;  4I6Z A;  1JA0 A;  2Y9Z A;  2XTX A;  3DLA A;  1Y0R A;  2IA1 A;  2A6T A;  2R7Z J;  3R60 A;  1SEU A;  1E1R A;  2EIX A;  2L7M P;  2WB1 N;  4QFM A;  3W2H A;  4I7H A;  4J0Q A;  3T8R A;  1AWC A;  3KLN A;  5GP9 A;  4MFE A;  2R7X A;  2OV7 A;  1OFL A;  4ZCL A;  5IYR A;  4I09 A;  1JA1 A;  5DN6 A;  2JA7 J;  5A2Q Z;  2VFN A;  3DU1 X;  1QQI A;  5D6E A;  3OSF A;  5GV8 A;  1HVX A;  1RRJ A;  4A5M A;  3JQQ A;  1RKW A;  5EMN A;  4TN1 A;  2E1M B;  3NEU A;  3CP8 A;  1WVR A;  5F08 A;  1H85 A;  1D1N A;  2Y2Z A;  2PMD A;  3PA1 A;  3AGQ A;  1UST A;  3EDP A;  2K85 A;  3HL2 A;  3RIQ A;  1G3S A;  3FHN A;  4RAF A;  5KW9 A;  3BWG A;  3M9A A;  2L7Z A;  2ZZF A;  1TT0 A;  3ZMS A;  3CDL A;  1J5Y A;  1AIP A;  1JB9 A;  1TBX A;  4A3G J;  4Y7C A;  1REP C;  1WJD A;  2B7B A;  3HAG A;  3MMY B;  4GO1 A;  1LE8 A;  1VQ4 I;  4Y52 J;  2ID3 A;  4NB5 A;  3D26 A;  2RRE A;  1K61 A;  5JFR A;  2X4H A;  3K2A A;  4KIB A;  3QYE A;  1DG1 G;  1N0U A;  3OAA A;  4PGO A;  2KIF A;  4LOC A;  1HA3 A;  1KQ0 A;  2FEZ A;  4RAZ A;  1T38 A;  3S2D J;  4KMU X;  3GIR A;  3BTI A;  2P7V B;  2FX0 A;  3TOB A;  3WG7 H;  2V7T A;  1EE6 A;  1XGN A;  3W2W A;  4NQW A;  1A6Q A;  3H1C A;  3CCM B;  2MG4 A;  4Y17 A;  1SFU A;  3S16 J;  3D0S A;  2PLF A;  3FBI B;  3OIP A;  1FYK A;  1X3W B;  4DIQ A;  3ABK H;  4OOX A;  1FOW A;  2GAU A;  4P1W A;  4A3L J;  3K4C A;  3KEY A;  3CUQ A;  1D8J A;  3DKX A;  4U9U A;  3WNB A;  1G7S A;  2UVE A;  3KE2 A;  3KZY A;  2ZXI A;  2VN2 A;  3R0A A;  1FTT A;  2R92 J;  1D1C A;  4KJZ A;  3VMF A;  5L3E A;  2BF4 A;  2GQF A;  2L4A A;  3RY8 A;  2D3L A;  4O3M A;  1YO5 C;  4J19 A;  2DU9 A;  1YFH A;  4MHG A;  1ZGJ A;  1LEB A;  1XS9 A;  2R7Q A;  3TW7 A;  1YJW I;  2ZFW A;  4XBF A;  1ZH5 A;  1FOK A;  3BZ6 A;  5ERI A;  1X58 A;  3TO9 A;  1OR7 C;  4U0W A;  3AGP A;  2HS5 A;  5TR9 A;  1VQ7 B;  4Z4S A;  3CPW B;  3IH2 A;  4LG0 A;  4M3G A;  3FPK A;  1K9M D;  4P3I A;  4L8J A;  4KT5 C;  1DUX C;  4IHT A;  3SEQ A;  2LBF A;  4MTE A;  5BS6 A;  3Q5F A;  3AFH A;  2OCC H;  3FIS A;  3LFK A;  4UVA A;  3MKW B;  1N06 A;  2EV6 A;  2M1B A;  4C2M J;  1IAW A;  2OA4 A;  1QU3 A;  2OTJ B;  1G3T A;  1P7J A;  2AXT C;  1JJ8 C;  2X6O A;  2VKE A;  2KRH A;  4CGZ A;  4KDP A;  1WFX A;  1X3Z B;  5F04 A;  1VHO A;  1FX7 A;  1NRK A;  5TRD A;  2EIM H;  4HW0 A;  4G7W A;  3SZT A;  3AG1 H;  1H8H A;  3RIR A;  2H27 A;  2CS3 A;  3KLO A;  4FQG A;  1ZUN B;  2JJ2 A;  2ZNZ A;  4W1U A;  4B48 A;  1MRZ A;  2JRM A;  2L02 A;  1JUS A;  3FXL A;  2ZSH B;  1LFP A;  4FE7 A;  4DBR A;  3IC7 A;  3KZZ A;  3JRA A;  2Z99 A;  2M7B A;  2WPD A;  3ZQQ A;  1OIS A;  5HDG A;  4E7K A;  1UD2 A;  2XNJ A;  4DK0 A;  5IYN A;  2OBP A;  3I9V 2;  2R7F A;  4OJ6 A;  4RDK A;  3HRU A;  2VBW A;  1PUE E;  3Q0V A;  4I98 B;  4E0F A;  1STZ A;  4CCN A;  2IT0 A;  4QPQ A;  2DLL A;  4UNO A;  1X1P A;  4DQL A;  1BX1 A;  2WJV A;  4R79 A;  3JX8 A;  3I4N J;  2NT9 A;  4M9S A;  1ZRD A;  1SMT A;  3ZMV A;  2QN6 A;  5IYB J;  2W25 A;  3F23 A;  3K4K A;  1AKH B;  2GXB A;  5CLS A;  3CO6 C;  2XF7 A;  2Y9Y A;  4QIW N;  1B72 A;  5IT9 Z;  1TQI A;  1XX5 A;  2V7U A;  2QLZ A;  4NC7 A;  3U21 A;  4RD4 A;  4AF6 A;  2VBS A;  1G4D A;  5EEA A;  1WDT A;  4B09 A;  1RIO H;  1YI2 B;  1BC7 C;  4Z4Y A;  2IJL A;  4ZCM A;  5LBQ A;  4RD0 A;  1BI0 A;  1D3Y A;  1QZY A;  3ZMZ A;  4LGW A;  1U9O A;  1B23 P;  1EV7 A;  3LSG A;  2DYS H;  3OJW A;  3Q0U A;  5J35 A;  3T56 B;  4OJP A;  1YX5 A;  1TP4 A;  2ZB9 A;  3PFI A;  3WU0 A;  4G7X A;  3SLD A;  5GAD J;  5KSW B;  4RDL A;  1NK2 P;  4PMH A;  2KIU A;  3QAH A;  4BHB A;  2OAZ A;  2A05 A;  3RPU A;  4BE2 A;  3Q9S A;  1LQ1 A;  3BTJ A;  1ORK A;  2P8T A;  4OMY A;  1DAB A;  4XOT A;  3IAS 2;  2JQ7 A;  3BR2 A;  1XGO A;  5HOO A;  3CC7 I;  1ODD A;  4I02 A;  3A3B A;  4FAS D;  4MXN A;  3LSK A;  5LRS A;  1YYV A;  2DT7 B;  2DYI A;  2ZCW A;  1VQO I;  4TMV A;  3M7G A;  5B6I A;  1FX0 A;  3H9G A;  3ECH A;  4EJO A;  4GQN A;  2VBY A;  1UG2 A;  3MQ0 A;  5B66 C;  2NTB A;  4P22 A;  5HVQ C;  1WOS A;  1B2R A;  4OPS A;  4Z4T A;  5DCF A;  3KZI C;  4RCZ A;  4IF4 A;  5JR3 A;  3CJQ B;  3CMY A;  2ID6 A;  1B6A A;  1TWG J;  4P96 A;  1UD3 A;  4GDF A;  2HKX A;  2EB7 A;  4ENM A;  3BCF A;  1OGO X;  1XG2 A;  2R7O A;  1A36 A;  2R7T A;  3RI4 A;  2FXA A;  4Z4Z A;  5BNG A;  1HC8 A;  4PC3 A;  2BXZ A;  1E79 A;  1R1T A;  4ZZD A;  2DDA A;  2QQ8 A;  2LG4 A;  3M8F A;  2C77 A;  5TY0 A;  3K7A J;  2M9H A;  2KKO A;  3KP4 A;  1N07 A;  5CVV A;  5DD8 A;  2RNG A;  5IT9 K;  4CCM A;  3F21 A;  3W5H A;  2HKO A;  3HOS A;  4OIO F;  3SEZ A;  1UB9 A;  3VSK A;  2B7E A;  1JGS A;  4G6I A;  3TOA A;  3DEU A;  3IWZ A;  1I1S A;  3E5Q A;  1HA8 A;  3PUB A;  2LH9 A;  4L9J A;  1WXR A;  5D6F A;  4BY1 J;  3K2Z A;  3QFC A;  2NTP A;  1XGM A;  4DGW B;  1O8L A;  1KON A;  2VBT A;  1KCD A;  4TMW A;  1S7E A;  2HCJ B;  3OW7 A;  2BV3 A;  2HQN A;  2L5Q A;  3P4G A;  3C7J A;  1E3X A;  2VIX A;  4CIC A;  3X2Q H;  1MJA A;  5IOZ A;  5LHI A;  1CNF A;  3PUM A;  1XPX A;  3BP8 A;  5A89 A;  5JLV C;  4BY7 J;  2AQF A;  4A5N A;  1BR2 A;  1LJ9 A;  2E5Z A;  4XRM A;  1I5Z A;  4DQ2 A;  3JRH A;  2F4N A;  5HZA A;  3V8L A;  5HZB A;  3BOQ A;  1UAA A;  3G05 A;  1FT9 A;  3DQV C;  1JKP C;  2EFG A;  4OIQ F;  3U2R A;  3MAJ A;  3LQ6 A;  4OPO A;  1MJ9 A;  2F5C A;  1H89 C;  1R58 A;  3F8F A;  1GUU A;  2OQG A;  1D2E A;  2DOG A;  2XAU A;  4CCK A;  1JXS A;  2DA7 A;  1HF0 A;  2IS4 A;  3RKX A;  4XD7 A;  3H09 A;  4G1B A;  2VE8 A;  3BR3 A;  4X07 A;  5D5X B;  1TNS A;  1IRG A;  4PJJ A;  3MKL A;  1F60 A;  5FB2 A;  3QPS A;  3ASQ A;  5AN9 A;  2CF4 A;  2QM3 A;  3AK5 A;  1R4M B;  4X7F A;  2XKP A;  4W8S A;  2FX3 A;  5DYM A;  3EQN A;  4E7J A;  1ZRE A;  4N4O B;  2FQ4 A;  4CCJ A;  2R6H A;  1BC8 C;  1YJN B;  4CYC B;  3K1P A;  1IDZ A;  5HNF A;  1U5T C;  4RMN A;  5D8L B;  3AVV A;  1ETX A;  1FBQ A;  3SJP A;  1I8D A;  2PG4 A;  1SKQ A;  4OU0 A;  2DY1 A;  2WY8 Q;  3ZXS A;  5C3E J;  4HF1 A;  1QPI A;  3PNV A;  3CC4 I;  1K8F A;  4M9Z A;  3SZP A;  2MGQ A;  2KZG A;  3Q6Q A;  1A8P A;  2VKD A;  1IDY A;  2XGD A;  1R36 A;  3FXJ A;  3K10 A;  2QBY B;  1KZL A;  1OFM A;  1QQ1 A;  4W8T A;  5JHF A;  1IF1 A;  2HDD A;  4HPQ A;  2CFX A;  2BX6 A;  1Y0U A;  2M5W A;  1Y56 A;  4AIJ A;  5GTH C;  2LOO A;  2UV1 A;  3CMA I;  1H88 C;  1FJL A;  1QX4 A;  3KFW X;  1ETY A;  4MNU A;  1WP6 A;  5FLX K;  2J8I A;  4UVB A;  3L2W A;  5L3B A;  2BGJ A;  2X3H A;  3GBG A;  3ZGK A;  2DJI A;  2CU7 A;  2VBU A;  2M4K A;  3OZU A;  1CNE A;  3V4G A;  3J81 k;  1YW8 A;  2YSR A;  3TO7 A;  3I0T A;  3VYT B;  2CBX A;  4QVJ A;  1PE9 A;  3LMW A;  1RET A;  3OYN A;  3H3Z A;  2V31 A;  3SHF A;  1ZG3 A;  5CVR A;  9ANT A;  5CDF A;  2RGV A;  2LYC A;  5HS7 A;  1DDN A;  1ZM3 A;  4P6V F;  2BOL A;  1EA3 A;  3TP0 A;  3ML6 A;  4MFD A;  3AL0 C;  3OJX A;  1PP8 F;  2EIN H;  2WAQ A;  3EPZ A;  3FM5 A;  4BAY A;  4BDY A;  1TTT A;  1XDU A;  2E7X A;  2PEX A;  3F6V A;  4A3M J;  1YX2 A;  2P6S A;  3G6E B;  3BG3 A;  1VQO B;  3G71 I;  3G71 B;  1WOR A;  2CND A;  4FHT A;  1EH8 A;  2V1X A;  1ZG5 A;  1VTN C;  2MLK A;  3QQA A;  4RD1 A;  2GIZ A;  5CVJ A;  2XGX A;  3KYL A;  1Y39 A;  3GQ9 A;  3BR5 A;  1R5N A;  4LBW A;  4C9Y A;  3OZW A;  4MR0 A;  2IPQ X;  4A93 J;  1J59 A;  2NAZ A;  3D5L A;  2RV8 A;  1Y8R B;  4G6Q A;  2OUM A;  2HPM A;  3SFI A;  4DBQ A;  3WG9 A;  1JJ2 B;  3TL4 X;  1QFJ A;  2XT4 A;  3M07 A;  2ZJQ F;  2QTL A;  3QFS A;  2YX4 A;  3T0Y A;  1USS A;  3M4O J;  2R7V A;  3PVD A;  5CQG A;  2HGC A;  2MLG A;  4TMX A;  5LGN A;  3ASR A;  1MBK A;  1B9M A;  3OYJ A;  2GJP A;  5DSZ A;  3HRS A;  1ETQ A;  5CPR B;  1T8I A;  5LMZ A;  2XRL A;  3FWE A;  4D0P A;  4B3G A;  4X0G A;  3J7A Y;  5FL7 A;  1DGR M;  1SKY B;  1W7P A;  5LGU A;  1OFE A;  2QMU A;  4FTH A;  4KIS A;  1DU6 A;  2X85 A;  3RDI A;  3BDD A;  5E1X A;  2WYR A;  2Z2S B;  2BHZ A;  4XR6 A;  3E6B A;  1AA7 A;  1HKS A;  1MD0 A;  2DA2 A;  4H4K C;  4YDT A;  2XZP A;  1PVE A;  3H5A A;  4G9Y A;  4HX7 A;  1QGY A;  1OLT A;  3CUQ C;  5LEJ A;  3L2V A;  2E35 A;  1Y0N A;  2K9Q A;  3KCC A;  1CF7 A;  3JAM Z;  4IXA A;  1MBG A;  3I71 A;  4AM3 A;  2BY0 A;  1GXQ A;  3EET A;  4PFO A;  1SFX A;  5EDN A;  1BQE A;  2NVY J;  3CB4 A;  2XV4 S;  3CPX A;  1KYZ A;  1T0F C;  4TMT A;  1O8I A;  2VON A;  5DEQ A;  1WMR A;  4URR A;  4BJ5 C;  1BA5 A;  1MBH A;  2AXL A;  2K5C A;  3BLY A;  3FZV A;  1SM4 A;  1O8H A;  2XTW A;  3HOT A;  3DTK A;  1IG7 A;  3BG6 A;  2ZC2 A;  2FQ3 A;  4RM2 A;  2HI3 A;  2L9R A;  2RQP A;  2DPU A;  2OTJ I;  4ZGQ B;  2EA4 A;  2L2O A;  2J7K A;  3B02 A;  1T39 A;  2W85 A;  4BDZ A;  2Y69 H;  4EJU A;  1RZ4 A;  2VBZ A;  2XSD C;  1O3S A;  2QSG X;  1FRQ A;  4UAJ A;  1VQ5 B;  1WH5 A;  1UCR A;  5DM6 F;  3E5X A;  2F6C A;  4WZE A;  4E4H A;  4YFN F;  2ACJ A;  2JPC A;  3OOC A;  5H59 A;  2DFF A;  1Y6I A;  1ZGA A;  2BGC A;  2Q6O A;  1LLZ A;  2O8X A;  3NAR A;  1J9I A;  3AVX A;  2IA2 A;  1FMV A;  4LBV A;  1AOY A;  5HXB A;  5C4J J;  1TW3 A;  3FXU A;  4XRS A;  2V6C A;  3I56 B;  2DN0 A;  4LMY A;  2DI3 A;  2GRE A;  1MH3 A;  4ZYA A;  3FXM A;  3LNQ A;  5FIU A;  4NK8 A;  1WPK A;  1BR1 A;  3O2P E;  4LK1 F;  3F0C A;  3RKW A;  3U1K A;  2XPV A;  4RM3 A;  3JU4 A;  1IJW C;  3VMW A;  3HC7 A;  2QEN A;  2VJJ A;  4M3B A;  1V5G A;  5CVI A;  4AVZ A;  2HVS A;  1IRF A;  3CCU I;  4DQK A;  1VLY A;  3A2K A;  5IK2 A;  4OM9 A;  4UUV A;  3OE7 A;  3PSS A;  2QYU A;  4P1V A;  3G3Z A;  2W00 A;  5HDK A;  1EFR A;  1NB0 A;  3HDD A;  1OGJ A;  3B82 A;  1K7A A;  3GVJ A;  3FXR A;  2VQG A;  4D9J A;  1WJC A;  4V02 C;  4OWR B;  4LFU A;  3DEE A;  3ZQF A;  2EIJ H;  1K6Y A;  3K4N A;  4BHC A;  2QTZ A;  1W5C C;  4WX9 A;  4XRF A;  1UJ8 A;  1QRY A;  3CF5 F;  2L3D A;  3V8K A;  1FNB A;  2ZKZ A;  3UNG C;  1VQL I;  5E18 F;  1FBU A;  5IYQ A;  1EF4 A;  1VQP B;  3N6Z A;  2V7X A;  2EWE A;  2DMU A;  4UV8 A;  3CRZ A;  1O8K A;  2D1H A;  2V4J C;  2JSC A;  4M74 A;  4UB6 C;  5K5O A;  3WU1 B;  1KJZ A;  1TLL A;  4BXF A;  4KA4 A;  3H92 A;  3AG2 H;  4YFK F;  2R7W A;  5JBQ A;  1D1A A;  1Q86 D;  1I6X A;  1OB0 A;  2CRG A;  4JX6 A;  3IP4 B;  2JSP A;  2NT6 A;  2BV6 A;  1SD6 A;  1BJK A;  5HKK A;  3ZZT A;  1HDD C;  2ZBK A;  2FVG A;  1PP7 U;  2XAQ A;  2C5B A;  2W82 A;  4YEI A;  2EK5 A;  3E97 A;  5THX A;  3RCO A;  3OYA A;  2NOJ B;  2YU9 J;  3P26 A;  2IXS A;  1YTY A;  3CLO A;  5K7H A;  1LFU P;  1EZG A;  4F92 B;  3I1F A;  3V7S A;  5E20 A;  2JUG A;  2A6H F;  2VPL A;  4GXO A;  1HKQ A;  4X06 A;  4CYC A;  3KL9 A;  1YOV B;  5E79 C;  3J7Y J;  1XE1 A;  2HTJ A;  1O3T A;  3GTK J;  2HFH A;  1D5V A;  2CG4 A;  1BOA A;  2HVQ A;  5LLQ A;  3LO8 A;  1LDJ A;  2MSY A;  4XOP A;  3S3M A;  2ZBV A;  2DOD A;  1IHM A;  1NJI D;  3IHU A;  2LSO A;  3CJN A;  1T6S A;  1FNM A;  3VYR B;  4IQJ A;  1RQP A;  4QHY A;  1Z67 A;  3DBH B;  4C43 A;  3GXO A;  1TYW A;  2DYR H;  3G4S I;  4II3 A;  5K7Z A;  2OBT A;  2XRN A;  1OCP A;  1LDK B;  1WJE A;  3GWZ A;  1RWR A;  3BC9 A;  4L0Z B;  4A3D J;  3CCJ I;  4HST A;  1W0T A;  2DTZ A;  3DEW A;  1SVO A;  2STT A;  5HLH A;  1X3U A;  4EJT A;  3IWF A;  5BSX A;  1UD5 A;  3JUR A;  2V1D A;  1ZGW A;  1YIO A;  4P9U A;  4KIT B;  3V7C A;  2COB A;  4DNC A;  1K4S A;  3I5U A;  1LE8 B;  2Q0O A;  3D1N I;  3N97 A;  3SY2 A;  4Q7J B;  4EH1 A;  5EG0 B;  1QZZ A;  2W57 A;  5ICF A;  1DP3 A;  3AST A;  4V2G A;  4Y7N J;  4YAL A;  2H1L A;  3KEW A;  5F1R A;  5K5R A;  2KT0 A;  1CGP A;  3GW2 A;  5F0H A;  3PA2 A;  2ZJ2 A;  2XAJ A;  2VJ5 A;  4IHY A;  2CQ7 A;  2DOF A;  2R0Q C;  2XVC A;  5D5U B;  2VC1 A;  1VQ8 B;  2E1N A;  4P12 A;  2L54 A;  1KMH A;  3LSP A;  2AO9 A;  1MSF C;  3SEJ A;  2E71 A;  4KN7 X;  4YFX F;  1W87 A;  5E3O A;  1OJL A;  1T6X A;  3GLL A;  4HQM A;  4YZA A;  5E8I A;  5HLT A;  4TT3 A;  4AID A;  1KU7 A;  2X6W A;  4P9S A;  2RC4 A;  2AQE A;  2ME0 A;  4E6K G;  1MBE A;  1IZ1 A;  1OOC A;  4G12 A;  1X19 A;  1V5V A;  2XAS A;  3CC4 B;  1VQN I;  1I6H J;  2DAO A;  1QFZ A;  4JBA A;  1P4A A;  1R22 A;  2KIQ A;  5BPD A;  1BLI A;  5AIQ A;  1O88 A;  2HOA A;  2IEK A;  2Z1D A;  2MFZ A;  4KIC A;  1J75 A;  2G0E A;  3HEF A;  1YJ9 B;  3PIP F;  4OJO A;  1YJN I;  1YE9 A;  4D1Q A;  3MWM A;  2QSH X;  4PJM A;  3LSH A;  3W5U A;  5E3M A;  1G6N A;  4M0L A;  1K4Z A;  2KLO A;  1RKT A;  5AMV A;  4HX8 A;  1WQ2 A;  2CMP A;  3ABU A;  2FF4 A;  3EUA A;  2JJ7 A;  4XM3 A;  3JRC A;  2HLD A;  3HRT A;  5ICG A;  3LWF A;  4UZF A;  4AU7 A;  4ROX A;  2L9V A;  1TL8 A;  3NB2 A;  2V79 A;  5BMZ A;  2XGJ A;  3ZQ7 A;  3ZZ0 A;  1I18 A;  4PFP A;  4KFC A;  4L9T A;  1FC3 A;  3OY9 A;  2M2E A;  3LQR A;  1YQA A;  2E1O A;  3W2V A;  3CMM A;  1RC9 A;  1W7P B;  1DDG A;  4TSF A;  1HXD A;  4EJV A;  2F4M B;  3DCF A;  1KQ5 A;  4PJL A;  4A3I J;  3Q38 A;  4YIF A;  2HYJ A;  1T98 A;  1YIT B;  4A12 A;  1VQL B;  1H8A C;  2J5O A;  5FKL A;  3GTQ J;  1QPM A;  1ZKG A;  5J4V A;  3JRD A;  5HLI A;  3ONU A;  4D7N A;  2DMP A;  2O17 A;  2G7U A;  1QVT A;  2NOG A;  2YR2 A;  1IXC A;  4U88 A;  3K1N A;  3JTG A;  3SQV A;  3BJA A;  1HDP A;  3KP5 A;  4G6T B;  1NB9 A;  1UEL B;  2UXX A;  5FKN A;  1R71 A;  4PSW A;  4Z4U A;  3PUF A;  1DQU A;  3CXC B;  3QP5 A;  4WF2 A;  1WOP A;  5DS9 A;  1R6R A;  2L7K A;  4ZGN B;  3HZJ A;  3VOE A;  3F8M A;  2VUM J;  1G2H A;  1KK3 A;  3GFJ A;  2X0K A;  3BCD A;  3JR9 A;  3V7A A;  1OHH A;  4FXU A;  4UZE A;  2RKH A;  1ONV A;  2PMZ A;  3R0J A;  3CCY A;  2JA6 J;  3B73 A;  5JMC B;  1NHC A;  1WJA A;  4L9N A;  4XON A;  4X05 A;  3RPU D;  4ACB A;  3O8G A;  4N3N A;  3GTJ J;  1QA2 A;  2Z3Y A;  2GQQ A;  1LPQ A;  2J5P A;  1U2R A;  4WZT A;  4WZL A;  3HUG B;  4IHW A;  4KIG A;  5E1W A;  2VKV A;  1GJR A;  1NDH A;  2G0Y A;  1RNL A;  4UB8 C;  3A35 A;  1O8G A;  4LB6 B;  3G4S B;  3FM3 A;  2BVM A;  3CCL I;  4UHT A;  2JA5 J;  1RES A;  2LKS A;  5J1R A;  5LGT A;  2DER A;  5ILU A;  1EFT A;  4Z1M A;  1KCC A;  4LIU A;  5DDG A;  2M0M A;  2V6E A;  5BPI A;  4ZZL A;  2X9D A;  4XN3 A;  3I4P A;  3E1Y E;  3RKQ A;  3OPO A;  4PC1 A;  4CQJ A;  2VOP A;  1HOM A;  2HYF A;  1TLH B;  4L5J A;  2VBE A;  1D8K A;  5EJC A;  3DV8 A;  4PK4 A;  1A5J A;  6PAX A;  2WWY A;  2CW5 A;  2F2E A;  1R00 A;  2EFN A;  3QFR A;  3ZOB A;  3H5N A;  1GR1 A;  2JPB A;  1VZ0 A;  3OR1 C;  4ESB A;  1EH7 A;  4UXN A;  2ZJR F;  2AS5 F;  1EP1 B;  3W2G A;  3L2R A;  2BMW A;  5DNS A;  4E7I A;  1T6Y A;  2F5D A;  3U6B A;  3FMQ A;  4IEJ A;  3KP2 A;  1ULY A;  5HOD A;  2NNY A;  1BJA A;  5EZH A;  3JQP A;  3SKB A;  2INV A;  2ZO4 A;  2Y0S N;  3W2I A;  4ASU A;  1X4P A;  5LFA A;  3VO2 A;  2WV1 A;  4YRV A;  1W4M A;  2BSA A;  3H5R A;  3BH7 B;  4CSW A;  2MD5 A;  2NZM A;  2BY3 A;  2PQ8 A;  3Q6R A;  2BY1 A;  3GUD A;  3NWS A;  4CO8 A;  1R9T J;  1QVG B;  3SUC A;  2GXA A;  4BU2 A;  3DDY A;  1T5E A;  1M1E B;  3DTI A;  1Z9C A;  1W0U A;  2RVC A;  3JRB A;  1QHH D;  5J8C A;  4ZCI A;  4HBL A;  4EM0 B;  3BCB A;  2O6W A;  3CLQ A;  1TQM A;  2O61 A;  3A03 A;  2WAQ N;  2RDP A;  3PSI A;  1S29 A;  5C44 J;  5IY5 H;  1DPR A;  2WC2 A;  3LA3 A;  2HOS A;  4G5G A;  1S9H A;  4HNV A;  2WV0 A;  2O9L A;  1WI9 A;  4RGU A;  2MYS A;  2FBI A;  3T8T A;  1KGS A;  3A02 A;  3OEH A;  1VQ8 I;  2VT2 A;  2X1E A;  2IS6 A;  4MTD A;  1HBX G;  4YEL A;  2OK7 A;  4P2N A;  3CCS B;  2H1K A;  2O0Y A;  1E3P A;  4K1X A;  1NHA A;  2EZL A;  2PMZ N;  1EXM A;  4XNF A;  2QZA A;  2HZD A;  1W7P D;  2VC0 A;  3WHC A;  1NG6 A;  4WXC A;  1K8A D;  1TT5 B;  2EIL H;  1B59 A;  5TIS C;  1F4K A;  3WTV C;  1QCX A;  2R5Y B;  2C5H A;  5KHD A;  4YIR X;  4M53 A;  2VQC A;  2XZL A;  1IUY A;  2QY1 A;  1BIB A;  5IP7 J;  3K6G A;  2V7V A;  4BEH A;  3NAU A;  1OFC X;  4YZX A;  1RI7 A;  4EAT A;  1RQR A;  2W4S A;  1BHE A;  3MCA A;  1IDK A;  2UWM A;  1S6L A;  1ETK A;  3RPQ A;  1FLI A;  2QCO A;  1UFM A;  3MZ8 A;  4XID A;  3W2E A;  3OYB A;  3ZQL A;  2HQA A;  4H9G A;  2PYG A;  1S7O A;  4E7H A;  1WJ5 A;  2X1D A;  2FNA A;  3E0J B;  3K69 A;  5H20 A;  4QVA A;  2QA4 B;  3M3Y J;  1R23 A;  4I99 C;  1YS6 A;  3FJO A;  2IS1 A;  2V9V A;  1QBJ A;  4YAW A;  3FMS A;  4FT8 A;  3ZRG A;  1EFU A;  1JTX A;  2ELK A;  4CCO A;  4XLN F;  2HVR A;  2V1U A;  1O8D A;  1QA1 A;  5D5V B;  3AKZ A;  1BOB A;  2DMT A;  3CZ6 A;  3I53 A;  3PEN A;  4Z4R A;  3ASO H;  3OYF A;  2TDX A;  3MCZ A;  4LIV A;  2OTL I;  3G2B A;  3KX2 A;  1CLW A;  2LLK A;  2FE3 A;  2TCT A;  1U2W A;  1PJ5 A;  1G3Y A;  5GTI C;  4HA8 A;  3VNV A;  2Z33 A;  2WJY A;  2Z9O A;  2NTQ A;  3EUK L;  2PJP A;  1R1U A;  3QOE A;  2E2H J;  3FKJ A;  4U0V A;  2CSO A;  5FRM A;  1QA3 A;  3SQN A;  1BI3 A;  3F8C A;  3S1N J;  2XSJ C;  4Q48 A;  3TP3 A;  4N9H A;  3AAF A;  2OK8 A;  4OZY A;  1X4O A;  2XKO A;  1XSX A;  1MMS A;  1CQX A;  3HPG A;  3ZMT A;  5C4X J;  4ENJ A;  2NS0 A;  2Z5U A;  4CHU A;  4G1V A;  4PC7 A;  4YCQ A;  5BOX A;  2R5Z B;  2M7A A;  3I64 A;  3JCU C;  2JJ1 A;  1GO2 A;  3VB2 A;  1KQS B;  1LFB A;  2VOD A;  2X48 A;  3WE2 A;  4IHS A;  1MW7 A;  3TBI A;  3MMP A;  3WE3 A;  2LVS A;  4M2L A;  2LMD A;  1H80 A;  3UW0 A;  3A1Y A;  5M5Y J;  4A3B J;  1NK3 P;  2A5Y B;  3CCV B;  2LNB A;  4A2U A;  2KMU A;  3P27 A;  4LLL A;  1QVU A;  1BI1 A;  2INU A;  1WSR A;  4IW3 B;  1OB5 A;  2RC6 A;  1BJZ A;  3DBL B;  4BNC A;  4Z06 A;  3Q39 A;  2DMN A;  2GIV A;  1D5Y A;  2BVL A;  3OYG A;  4G7Z F;  3ZPN A;  2E19 A;  1Q1V A;  2ISZ A;  4N3G A;  3FDY A;  1XMA A;  5GAG J;  1H0M A;  3M1E A;  4FE4 A;  5FO1 A;  1PUF A;  2O0W A;  4M6V A;  5J8F A;  4HLY A;  3Q3S A;  1K78 A;  4B3F X;  3ZPL A;  1KQ9 A;  4BHP A;  5F0F A;  4HG2 A;  3IL2 A;  3GQ7 A;  2CUZ A;  1FIA A;  2Z6B D;  1K28 D;  3BNW A;  4MYU A;  2NS7 A;  5K7F A;  1WPC A;  2XF5 A;  2BVN A;  1F5T A;  3K0L A;  2GA2 A;  4DYC A;  1A35 A;  1QRB A;  4YC5 A;  2DO7 A;  2WY7 Q;  3ELK A;  3ZC3 A;  3E6C C;  1R1V A;  2DJN A;  1B72 B;  2AHO A;  3FX3 A;  4PUS A;  1N77 A;  2O7O A;  5IP9 J;  2K86 A;  5EGO A;  3FXQ A;  2A5W A;  4JOM A;  4L9V A;  1JKO C;  3HOZ J;  2VNI A;  1SAU A;  3J80 Z;  4XKB A;  2X1C A;  2DIE A;  3EYY A;  2OZU A;  2M8G X;  2Y0M A;  1JJ6 C;  2PYH A;  1XN7 A;  1PKV A;  5E3N A;  3BTL A;  2CJJ A;  1ZR2 A;  3S32 A;  1K73 D;  4P9F A;  5TJJ A;  2OTL B;  3L09 A;  4D5F A;  3WTY C;  1W5S A;  1HF2 A;  2FRH A;  4HE5 A;  3KEO A;  1I39 A;  3OS2 A;  5JLW A;  2QKM B;  2DXI A;  4AWX B;  2BM4 A;  2ZTN A;  3WTZ A;  4RBO A;  2NSP A;  5JI6 A;  4XK4 A;  2XZO A;  1Q7Y D;  1TYV A;  3BPV A;  4CH7 A;  2LDU A;  3LSJ A;  4YAU A;  4P26 A;  2J8K A;  2Z16 A;  3ZCO A;  5EEH A;  1OCO H;  1KK1 A;  5F64 A;  3VEP A;  1BW6 A;  2IVM A;  4Z6Y A;  3DWL E;  2XUB A;  3QFT A;  5DCM B;  2X53 S;  2O04 A;  3WU2 C;  2DFI A;  3F6O A;  2I5U A;  2CW7 A;  4BBR J;  4RB3 C;  2GJR A;  3BZC A;  3HKZ N;  3LVB A;  5IOY A;  2LRE A;  4O5V A;  2BM0 A;  3BTC A;  5B3S H;  2DA4 A;  4ASN A;  1E62 A;  2LY9 A;  3BZK A;  2K9S A;  1SVM A;  3CUQ B;  2C78 A;  2L0K A;  4CZZ A;  4BYY A;  1FPQ A;  1KA8 A;  1FEX A;  2VNH A;  4Z2Y A;  2M3A A;  3PJR A;  2GZW A;  2XGC A;  1Z6R A;  3IKT A;  1SFK A;  5E3L A;  3ABM H;  3K1M A;  3OYH A;  1M1K D;  2HNH A;  1GXP A;  1KK2 A;  3OW2 B;  2E60 A;  3ERM A;  3HSR A;  3JSP A;  4HLX A;  1KC8 D;  2ZBU A;  3QP6 A;  4M3F A;  2JDI A;  1JHF A;  1LKX A;  3H0G J;  5L3G A;  1ZYR F;  4JMQ A;  3CCJ B;  2PMU A;  1R4N B;  2WB1 A;  1E63 A;  3W5V A;  1V55 H;  1O4X A;  4IKF A;  2K7L A;  2OD5 A;  3P9C A;  4MIM A;  4NC8 A;  2KHM A;  5CQE A;  2VBK A;  4F93 B;  2DA3 A;  2QQB A;  4C3I J;  2KIS A;  3L2C A;  2AHQ A;  4AVP A;  3GQB A;  3W6V A;  3KEQ A;  1QA6 A;  2FBH A;  3IKV A;  2EH3 A;  3I3L A;  5DCM A;  3TW6 A;  3RTR A;  3MZY A;  1QGP A;  1ZHF A;  2VKH A;  3KIO A;  4LK0 F;  5ED4 A;  2OPT A;  2ZME A;  3QPL A;  3QU3 A;  2MC3 A;  3ES9 A;  1VQ6 I;  1FMW A;  3HGY A;  4Y9U A;  2M8E A;  1U78 A;  4G6D A;  4RCY A;  4B4D A;  4B43 A;  2H09 A;  2LY2 A;  1QRC A;  4ZH4 F;  2NVT J;  3H3V K;  2VJI A;  3HOX J;  1YHQ B;  1UD4 A;  2HDC A;  4AD9 A;  2WBM A;  3VO1 A;  3AVT A;  3B78 A;  3ZBT A;  1X1A A;  3BG9 A;  4S0H B;  4Q5S F;  2EFO A;  1TNT A;  1FY7 A;  4JX4 A;  5DM7 F;  1VLO A;  2HQ5 A;  2H8W A;  2XB0 X;  3BCA A;  5JVT A;  4DOZ A;  1WRJ A;  2K3P A;  5A2Q K;  3R6K A;  3CME B;  1S5L C;  2MH9 A;  2H94 A;  4BQQ A;  2QBY A;  2F1L A;  3U6K A;  3RYP A;  2BY2 A;  1U3E M;  1EWY A;  2DW4 A;  3HXL A;  4C3J J;  4RB1 A;  4JQF A;  3HBL A;  2VFP A;  1O8J A;  2GXG A;  1LM1 A;  2IS2 A;  3ASP A;  2O5R A;  4FCY A;  2FJ1 A;  2DQR A;  2DK5 A;  1W36 C;  3AVY A;  3D5S C;  3E1S A;  2N8G A;  4A3F J;  1U8R A;  3CF2 A;  1OCZ H;  1YHQ I;  4A0X A;  3HPH A;  2HPI A;  3WNC A;  1GDT A;  2F5F A;  2XF6 A;  1N8R D;  3MEX A;  3ZN0 A;  2IGN A;  1LUJ B;  1V4R A;  2MC4 A;  1XCB A;  3WTT C;  1KU3 A;  4B4C A;  1K83 J;  2VLA A;  4IHX A;  2ISY A;  3OMY A;  3CUO A;  4PCQ A;  1R5O A;  1W5T A;  2QSF X;  5M5W J;  4RS8 A;  1OCT C;  1E3Z A;  3ISP A;  2Y75 A;  5GPA A;  2H6C A;  1VQK I;  4QTR A;  4CDG A;  4YEJ A;  1G8X A;  3ECO A;  3ZQI A;  5L3D A;  4XLP F;  3CCQ I;  1HLV A;  1R49 A;  3R6J A;  3OKX A;  3BQJ A;  3JRE A;  1YIT I;  4HWV A;  1P92 A;  5DS0 A;  1SD7 A;  1RR8 C;  2V9P A;  5K5Q A;  4OAZ A;  3LAP A;  3PO3 J;  3ZMD A;  1N08 A;  1SD5 A;  2QX3 A;  3FBN B;  1Z05 A;  4AC0 A;  1VQP I;  5CKT A;  4PZJ A;  3F9K A;  1T0F A;  1P9Q C;  3HKZ A;  5FKM A;  3GQ8 A;  3VPR A;  3S15 J;  4CXF A;  2ADU A;  2VL8 A;  2E1M C;  3G1O A;  3HM5 A;  3WTW C;  3VOD A;  1JKR C;  1VQN B;  3QU6 A;  2P0W A;  5C1E A;  3MN2 A;  3FKI J;  4XSX F;  1WTH D;  1IN5 A;  1NBM A;  1GVJ A;  2QEX B;  2HQR A;  2XRO A;  2CV0 A;  3P9K A;  4Y15 A;  1YJ9 I;  3GO5 A;  4P25 A;  2JWT A;  1O8E A;  2ZXH A;  2OU2 A;  1RPW A;  2P4W A;  2XDV A;  4A6D A;  4XLE A;  3HHG A;  4M3D A;  1V0F A;  1DBO A;  1Z1D A;  2HU9 A;  2K3F A;  2ZL6 A;  1TUI A;  3ZIA A;  1MNM C;  1CZF A;  1KU9 A;  2I1L A;  1SD4 A;  3QYB A;  3I55 B;  2FU4 A;  2ZNY A;  2Q6K A;  4C0S A;  4OPW A;  2NXN B;  2QQA A;  1U0J A;  2ZXJ A;  2DA1 A;  5EYR A;  3LST A;  1JUP A;  4BQO A;  3S8P A;  5DV5 A;  2VBV A;  1R7J A;  3ZQG A;  3QPH A;  3HOW J;  3AL0 B;  2BZT A;  1K79 A;  4GCV A;  2H6B A;  2A6E F;  2DT6 A;  3OWT A;  4ZYD A;  3S1Q J;  4HRI A;  2VNJ A;  4CYD A;  4WK8 F;  1S72 I;  1H9T A;  4Z4V A;  2HDN B;  2FSW A;  3VNU A;  1JUM A;  2A3S A;  1GHC A;  3ZSC A;  3TH0 A;  2LF7 A;  2H8R A;  1TZL A;  3QOD A;  2W6I A;  2DFE A;  1P4X A;  5F4J A;  5FJ8 J;  3OYK A;  2PX9 A;  4AYB A;  2CQX A;  2Z8G A;  2P5K A;  4Z05 A;  1K78 B;  1UHS A;  1JI8 A;  4EM1 A;  4FK8 A;  4AIH A;  4XN0 A;  3P7N A;  3VSV A;  3Q9V A;  5D8K B;  3H9Q A;  4G7O F;  3KPH A;  4HYE A;  2D2W A;  2JVG A;  1I1G A;  2F5V A;  1MJB A;  4RB2 C;  4ZYG A;  2HYG D;  1F9N A;  2VE9 A;  3OOU A;  4RB0 A;  3VSL A;  1QUE A;  3OSG A;  1N05 A;  1FOX A;  2LZJ A;  3JAM K;  2HXI A;  1FZP B;  4QV2 A;  4M1K A;  2NNN A;  2FD5 A;  1MND A;  4KN4 X;  2ICW G;  2XEX A;  1VQ6 B;  2WZP P;  1UD8 A;  3SDG A;  1UHM A;  2F4I A;  4G94 A;  1X1B A;  4DNT B;  2Y0S A;  3CCS I;  4HF2 A;  2A69 F;  1W36 D;  5BSY A;  2V26 A;  1HW2 A;  4RDU A;  4HV5 A;  1EH6 A;  3CJR B;  3PQK A;  1E3O C;  3GTP J;  3VMV A;  2DFH A;  1WKM A;  4I76 A;  4F91 B;  5LHH A;  4ZC3 A;  3CME I;  2E2I J;  5E17 F;  4MQV A;  2UZK A;  3OR2 C;  2PIA A;  2EV5 A;  3ZR8 X;  4U49 A;  2KDO A;  1O57 A;  3DKY A;  1VQ7 I;  2ELH A;  4HZF A;  3CO7 C;  1DP7 P;  2CGP A;  1PJ7 A;  4LBY A;  3A8K A;  4V19 K;  2XAF A;  3AG3 H;  1X2N A;  4FX4 A;  3O3K A;  2ZXW H;  5EGO B;  1PJ6 A;  5J47 A;  4TV7 A;  4NBQ A;  1L3L A;  1UZC A;  2CV1 A;  1MAB A;  2VT3 A;  3R4K A;  2R9V A;  4BPR A;  1ERD A;  2WTE A;  2X0L A;  4P5O A;  3GME A;  5LHG A;  2VXZ A;  3EQO A;  1S0U A;  4XQF A;  3GEZ A;  4DNR B;  1IO2 A;  3TKY A;  5E8G A;  1JE8 A;  4I0A A;  1LB2 A;  3ERE D;  3OYI A;  2RQQ A;  1W0J A;  2R7R A;  3DU5 A;  2MW8 A;  1HSJ A;  2XAH A;  3L2U A;  2O8K A;  2KZV A;  2YWE A;  1B8I B;  3LA2 A;  1PDN C;  3L2Q A;  3J7Z I;  1HW5 A;  5AON A;  5A8A A;  3GTL J;  2MD0 A;  4PJN A;  1IW7 F;  5J4Y A;  4RGS A;  4JK1 X;  1GV5 A;  1BN5 A;  3PSZ A;  4B1R A;  1XSD A;  2OC6 A;  2EV0 A;  3KYD B;  4AUX A;  1JKQ C;  2FA5 A;  1AIR A;  5D4R A;  3I56 I;  1BMF A;  4KH3 A;  2ZZG A;  3CMA B;  2RNJ A;  4M3E A;  1JHH A;  2K27 A;  3C2B A;  4QLC U;  5GV7 A;  3ULQ B;  1FYM A;  3VR6 A;  5FLV A;  1QO0 D;  2R5Y A;  4YHB A;  1MMG A;  4ZYE A;  2PLY A;  2FML A;  1DGW Y;  5JLX A;  3E7L A;  1D0X A;  3M1C A;  1IGN A;  4WQM A;  2ZSI B;  3U1D A;  2VBX A;  2O03 A;  4BEH B;  2GBY A;  3T1B A;  1VBL A;  3KP7 A;  3WY9 A;  3BT9 A;  2F48 A;  3FPP A;  4KMF A;  1Y8Q B;  1E43 A;  1N78 A;  3IUO A;  4Z03 A;  2F3L A;  5TGT A;  2D9R A;  3C2G A;  1AHD P;  4RD3 A;  4C30 A;  2KPM A;  5M3M J;  5AIP A;  4UUS A;  3K4B A;  1ZEL A;  3KYC B;  4A3E J;  4NQW B;  4BQN A;  2JIZ A;  2ESN A;  3M8E A;  1AKH A;  2ZL7 A;  4A69 C;  5BQT A;  4KKS A;  2VB6 A;  2EZI A;  1ETO A;  1X1D A;  2I8D A;  3GTM J;  3QYF A;  3P5J A;  3WBK A;  3LSR A;  4DYQ A;  4Z4W A;  4OJ5 A;  1OQY A;  4B8X A;  1LLW A;  3F8N A;  1RUO A;  2DA6 A;  2QXZ A;  2WSS A;  3ML3 A;  3CTA A;  2DPD A;  1IN8 A;  3WOD F;  1S4M A;  3S1M J;  4U0Y A;  1PYV A;  1K4T A;  1XFO A;  1O8M A;  2P5V A;  2P5L C;  5C1C A;  3ZUG A;  1YX3 A;  2QA4 I;  3PL8 A;  2W6J A;  1MDM A;  4ENN A;  5J40 A;  3JW4 A;  3A0H C;  3OZV A;  1HST A;  1OPC A;  1XTA A;  1HKT A;  3AVU A;  4EQQ A;  5LD2 C;  4BKX A;  2VNK A;  2ESH A;  3OV8 A;  2W48 A;  3N90 A;  1B4A A;  5F4O A;  1KK0 A;  4W8R A;  2LBF B;  3WTX C;  1YG2 A;  1ACI A;  2OF7 A;  1QFY A;  1N75 A;  3RQ4 A;  1FBS A;  3MVP A;  1CF7 B;  2OBR A;  2K02 A;  1XG1 A;  1JT0 A;  3SFZ A;  2JT1 A;  5GPC A;  4A3J J;  1EJ9 A;  1YW7 A;  3BR6 A;  3W2A A;  2JA2 A;  4KT6 A;  4CA0 A;  4ZDO A;  2HR3 A;  1LEA A;  4F7Z A;  1ZRF A;  2QE7 A;  3D5R C;  3QOP A;  3H36 A;  1P2F A;  5F4M A;  5IT3 A;  1BPL A;  3JRF A;  2VI6 A;  3EQL F;  4B47 A;  3CES A;  3ZBU A;  5FRN A;  1H8E A;  3GCM A;  1ENH A;  3E6D A;  3RJP A;  1JRG A;  2CH0 A;  1VQM I;  5KK1 A;  1OGM X;  5LRR A;  4FWT A;  5J3L A;  3CCR I;  1TW2 A;  3BY6 A;  1FP1 D;  1E64 A;  2C4T A;  3W6J B;  2IGM A;  2QGG A;  1GAQ A;  3BC8 A;  4ZJZ A;  3TDZ C;  5B1A H;  5HS8 A;  4OIP F;  1M90 D;  3OEE A;  2XPW A;  4LLN A;  1T56 A;  2YUS A;  2XC7 A;  1MDM B;  3U9G A;  3S14 J;  1ETW A;  2I10 A;  3J81 Z;  4AF7 A;  4NC6 A;  1QUF A;  4NUB A;  3S93 A;  1F43 A;  2ME6 A;  2ZZE A;  1OR7 A;  3BPX A;  3PNT A;  3OP1 A;  3GQA A;  1EP3 B;  2A61 A;  3ZMU A;  3QWL A;  1FP2 A;  4OOS A;  5TV2 A;  2XOK A;  4X7D A;  4TMZ A;  2KJB A;  2G7H A;  3ZQH A;  4N9I A;  4LG0 B;  4IRG A;  4JX5 A;  5L3F A;  1IA5 A;  2GOX B;  1J9Z A;  1KD1 D;  5HNH A;  2R7U A;  5F27 A;  3NWT A;  3E5U A;  3CCL B;  2YPR A;  2OQR A;  3S2H J;  4YG2 F;  2X3U A;  4NHJ A;  1XC5 A;  3OYM A;  4RD6 A;  2X6Y A;  1JTY A;  4XL9 A;  3RSN A;  3T9G A;  3RZO J;  1Z77 A;  2NVX J;  1XD7 A;  3B8H A;  1EA0 A;  3WGH A;  5KVR A;  4ZTJ A;  2Q6L A;  3IH3 A;  2QZ8 A;  3A3G A;  3G73 A;  1O7L A;  3DXJ F;  4DW6 A;  2GM4 A;  5FNZ A;  5FD5 A;  3OYL A;  1D1B A;  2M45 A;  4XOR A;  2F43 A;  1YI2 I;  2CO5 A;  4B44 A;  3M8J A;  3HOV J;  1GV2 A;  3I59 A;  3H3U A;  1W1W E;  4M73 A;  4RDJ A;  3HJE A;  3DKW A;  1LNW A;  2OZ6 A;  2XND A;  2CW0 F;  4QSH A;  1KTV A;  3K4L A;  1XDS A;  4NDL A;  4RLF A;  5A88 A;  1DAR A;  1BIA A;  1WHU A;  3F22 A;  4ANJ A;  4EMS A;  1VJS A;  2ZIT A;  2LFB A;  3A8I A;  3VWB A;  1KYW A;  1UHW A;  2V7Q A;  1ON1 A;  3BJO A;  2O6G E;  3WYA A;  4A6E A;  2XPU A;  2CQN A;  4BE1 A;  1N25 A;  2GWR A;  4I2O A;  5EEG A;  2K9L A;  1UMK A;  3P9I A;  5J1Y A;  2DT5 A;  3HIF A;  4PSX A;  1G59 A;  3FK6 A;  4JYK A;  3LSM A;  1FSH A;  2OCE A;  1COW A;  3HOU J;  2BW3 A;  4MLO A;  1ZM4 A;  1HG8 A;  3L00 A;  2WAE A;  2ZME B;  4RAG A;  3ABT A;  5HDN A;  1QGA A;  1D8T A;  4UY8 I;  5J3O A;  3HUG A;  4II2 A;  3S2W A;  5KNL A;  2ZL5 A;  4HX4 A;  1VND A;  2HWV A;  4ZDP A;  3MD2 A;  2BM1 A;  1D0Y A;  3MHP A;  1IRX A;  2KIM A;  3E3V A;  3WTS C;  4QPO A;  1F20 A;  2K40 A;  2K4J A;  4X8I A;  4LJZ F;  3FY3 A;  4S05 A;  3E6M A;  4RJL A;  2BN4 A;  3I59 B;  1GVH A;  4N0B A;  3OYE A;  3WQZ A;  4HV6 A;  3ABL H;  2QGU A;  3QRF F;  1DDI A;  1U5T A;  3VYU B;  1YIJ I;  3WND A;  5IP6 A;  1EP2 B;  4NBS A;  4ZV4 A;  1VHE A;  3JQR A;  3FMR A;  4N4N B;  2PJR B;  3PIO F;  4C2U A;  3GVL A;  1BX0 A;  3ONY A;  2V1N A;  1DU0 A;  2V9K A;  5FA6 A;  2O3F A;  4M9X A;  4I0B A;  3OS0 A;  2M0C A;  2FNP A;  3ISX A;  2DMQ A;  5FD6 A;  2W7N A;  2KRF A;  5H6R A;  4EM2 A;  4PGG A;  1BW5 A;  2C4U A;  3H9N A;  2BM6 A;  3FXK A;  2CQK A;  4UZU A;  2EBI A;  2XC1 A;  4BJ6 C;  1VQM B;  3B90 A;  4XSZ F;  1APL C;  2Y48 A;  1G7R A;  2FOK A;  1V5E A;  2VZL A;  3PFY A;  4BXX J;  2EPF A;  3QE2 A;  5DD4 A;  1ZK8 A;  3O8H A;  4S04 A;  5J1U A;  1YRN A;  3CCQ B;  2WR8 A;  3GZN B;  4LB5 A;  3SLN A;  4Y9R A;  1ZTR A;  4X7C A;  3CC2 B;  2R7D A;  5FRO A;  4G8X A;  2YUH A;  1V5F A;  4RPB A;  1EKE A;  4RAY A;  3K70 D;  1OGI A;  3GVA A;  2LR8 A;  3SZE A;  4H0E A;  2IGK A;  1BR4 A;  1WCM J;  3BY2 A;  3OIO A;  2EZK A;  2VJ4 A;  4OJL A;  3VSU A;  1IB0 A;  1R5I D;  1X0C A;  1S7A A;  2NST A;  1CQT A;  3SJM A;  5H5J A;  2CW8 A;  1TYX A;  2IGO A;  1YLF A;  2PBI A;  2DDB A;  3NQO A;  4C2T A;  4X6A J;  3NAW A;  3R61 A;  5DTD A;  3BQZ A;  3C3W A;  4RLZ A;  2XT2 A;  1RR7 A;  2JTV A;  3DBR B;  4IX7 A;  4HNU A;  2B5O A;  2DBB A;  2TRT A;  3ESW B;  4RGX A;  2BGI A;  4YII A;  5FKK A;  4Y33 A;  2V7W A;  2M34 A;  1ZM9 A;  4BE0 A;  3BG7 A;  1QJV A;  4B3X A;  3HSE A;  4HE6 A;  3B6A A;  4P3Y A;  2JA8 J;  4ZYH A;  3BR0 A;  1HCR A;  2W24 A;  1Z3Y A;  4MQ9 F;  4IJA A;  3CD6 B;  3RYR A;  4D7M A;  4KIF A;  4UUS B;  1FIP A;  4Y4R A;  4BQA A;  4MO7 A;  1XMX A;  1TWA J;  2EA2 A;  2LD5 A;  2D74 A;  3GX4 X;  3LAJ A;  3NE5 B;  1HZE A;  3GTG J;  3TED A;  2DA5 A;  4BH9 A;  2E2J J;  4XMY A;  4HOB A;  4DK1 A;  1Q1H A;  2D5V A;  1IV8 A;  3F3X A;  2BPO A;  3ZZU A;  2VFQ A;  4HIZ A;  4IRH A;  2L9S A;  1BBY A;  4PC2 A;  1GAW A;  4FN5 A;  3BG5 A;  4RA2 A;  4XKC A;  2P6T A;  1FOY A;  1MZB A;  2ELJ A;  2LP0 A;  2MAB A;  5FFZ A;  1W34 A;  2GK7 A;  2JK3 A;  1LVA A;  2PN6 A;  4XRS G;  3HRM A;  2ZJP F;  1SVL A;  1X2M A;  2KJC A;  1SC7 A;  5EG0 A;  2W7Z A;  3C1D A;  4U7B A;  4WWC A;  5FLM J;  4P55 A;  1TQP A;  3WHB A;  1VI0 A;  1VQ9 I;  3WGG A;  3L7W A;  2VYQ A;  2ZFU A;  4IL6 C;  2E7W A;  2E34 A;  1T6Z A;  2NVQ J;  4E7S A;  1O3Q A;  3A4C A;  1QNT A;  4EEF G;  3DFG A;  4W8Q A;  3ONQ A;  1SFE A;  3IAM 2;  1BL0 A;  1MH4 A;  4A0Y A;  5D4S A;  4EJW A;  1T33 A;  1IUF A;  1J2X A;  1UD6 A;  2E1B A;  4L18 B;  1MGT A;  3J80 K;  1FSE A;  3DU6 A;  3OYD A;  4HAM A;  3G6E I;  1ZAO A;  2ECB A;  4AYB N;  2LKX A;  1OFD A;  4BS9 A;  1VF9 A;  3W3C A;  3A0B C;  5HLG A;  3K4J A;  1ZN2 A;  2R3S A;  2ZME C;  4CZC A;  1OMI A;  3HSF A;  3DPL C;  2VXD A;  3WBJ A;  3VST A;  2PE3 A;  3TMO A;  4Y13 A;  1I7P A;  2GJK A;  3SYJ A;  2QUF A;  1B9N A;  4F52 A;  3DF8 A;  5ICC A;  1RUN A;  1V0E A;  2Y31 A;  1KRH A;  3GLX A;  1C0W A;  2JRT A;  3GTO J;  4YZQ A;  3UR3 C;  3WGI A;  1PXZ A;  3E20 A;  4BUP A;  1X1C A;  3A8J A;  1TTY A;  1E17 A;  5IYW A;  3GFI A;  1MKM A;  3CP2 A;  5M5X J;  1Z7L A;  4C3H J;  3CCV I;  2XTY A;  5E6T A;  3TGN A;  2KRC A;  2VQH A;  1OYY A;  5IYC J;  2XIG A;  5DUI A;  1NTC A;  3V7R A;  4J01 A;  2CV2 A;  5IYP A;  2YWH A;  3LJY A;  4ZTF A;  2UUZ A;  1ZRC A;  4MGR A;  1GQ8 A;  4V2F A;  1BI2 A;  5ILS A;  1Q9S A;  2KDZ A;  4QUZ A;  1WSU A;  3K70 C;  4IO9 F;  2P81 A;  2BHY A;  4IQ4 A;  1PLU A;  1QZE A;  1Z7U A;  4LD5 A;  4G7H F;  1FND A;  4GGG A;  3V42 A;  4F7D A;  4PDK A;  1E0E A;  2RC5 A;  5IYD J;  1VQK B;  1VQ4 B;  3EYI A;  2XNC A;  1FYL A;  2B63 J;  4DYR A;  4WXH A;  2WZN A;  3PUN A;  1MMA A;  3A01 A;  1ZAR A;  1YIJ B;  2JN9 A;  1E1Q A;  2Q6I A;  3BH6 B;  1YJW B;  2EQR A;  1GT0 C;  2BE5 F;  2YWF A;  2X8K A;  1TWC J;  2XB5 A;  2LF8 A;  3GSI A;  3QSY A;  4FET A;  1R5H A;  1UG0 A;  2DK8 A;  5E1Z B;  1IC8 A;  3SDB A;  1XMK A;  2GLO A;  4AC9 A;  3BJ6 A;  4UUT A;  4HNT A;  3KET A;  5L46 A;  4D5C A;  1MMN A;  2HDW A;  4HDU A;  1D0Z A;  3FHZ A;  3PET A;  2L9N A;  1J7K A;  2Q1Z B;  3OL3 A;  2CRV A;  4OIR F;  2IP2 A;  1P6R A;  2BXY A;  3J7A O;  1YLO A;  1Z21 A;  1FNC A;  3WXM A;  3FKS A;  4EGY A;  3GRH A;  1MIJ A;  3CCE I;  4HDV A;  1TYU A;  4DZJ A;  3T5X A;  3OYC A;  3HTU A;  3HOY J;  1I3Q J;  2NRA C;  1U5T B;  5GAE J;  5D5W B;  1FDR A;  4WXD A;  2F1M A;  2D3N A;  3K4M A;  1NH3 A;  2QYO A;  2DTR A;  2M5S A;  2RN7 A;  4QWQ A;  1KQ8 A;  1H9G A;  1IV6 A;  3JSO A;  4M4S A;  1VQ5 I;  2F5E A;  3BY1 A;  4PAB A;  2EFQ A;  3Q0W A;  1KZH A;  2CWE A;  1WWX A; 
#chains in the Genus database with same CATH homology
 2ODL A;  2CV1 A;  1MAB A;  2VAS A;  3CJQ B;  4Z1M A;  1KCC A;  4LIU A;  4BAC A;  2R9V A;  2V6E A;  2M0M A;  1UD3 A;  4EW9 A;  1ERD A;  3BCF A;  4P5O A;  1OGO X;  1XG2 A;  4XN3 A;  2VXZ A;  3OPO A;  2R7O A;  2R7T A;  2O1D A;  3EQO A;  1MMD A;  2X3H A;  4XQF A;  4DNR B;  3C2H A;  1E79 A;  1VF7 A;  2VBE A;  2LG4 A;  4PK4 A;  1Z3X A;  2M4G A;  2CUJ A;  3VDX A;  4HEA 2;  2RQQ A;  3OYI A;  2R7R A;  3DU5 A;  3L2U A;  1W0J A;  1O8F A;  2KZV A;  2RNG A;  3L2Q A;  4CCM A;  2KL4 A;  3H5N A;  3WWG A;  1VZ0 A;  2MD0 A;  3OR1 C;  4LIT A;  3HOS A;  3L2R A;  4PJN A;  3SEZ A;  3VSK A;  4G6I A;  4E7I A;  4HSR A;  3B8Y A;  1HA8 A;  2INV A;  2OC6 A;  3PUB A;  2LH9 A;  2CK3 A;  2FUG 2;  3LMM A;  4TKO B;  4KKU A;  2LRD A;  4ASU A;  1X4P A;  5LFA A;  1BMF A;  1AIR A;  3ZPP A;  2ZZQ A;  4YRV A;  2ZZG A;  3H5R A;  2NTP A;  4DGW B;  4CSW A;  1O8L A;  2NZM A;  1KON A;  1KCD A;  2KVO A;  3NWS A;  3VR6 A;  3SUC A;  3OW7 A;  1MMG A;  2IQ7 A;  4BU2 A;  3DDY A;  1DGW Y;  2L5Q A;  4C2L A;  1D0X A;  3M1C A;  4CCL A;  1T5E A;  3DTI A;  2ZSI B;  1E3X A;  2VIX A;  4OAY A;  4BEH B;  1QHH D;  4BL0 B;  1VBL A;  2KQR A;  4DJA A;  3FPP A;  1E43 A;  1N78 A;  3IUO A;  4RLQ A;  4Z03 A;  2AQF A;  5TGT A;  2PJR A;  3BCB A;  2WAD A;  1BR2 A;  3C2G A;  2E5Z A;  1PJR A;  3MKZ A;  3GVK A;  1T95 A;  3PSI A;  4C30 A;  2KPM A;  1UAA A;  3G05 A;  3DQV C;  2V7F A;  3K4B A;  1S9H A;  1ZEL A;  1NG7 A;  4NQW B;  4BQN A;  2JIZ A;  2MYS A;  3OEH A;  2X1E A;  2IS6 A;  4F55 A;  4KKS A;  2VB6 A;  2I8D A;  1X1D A;  4YEL A;  2XAU A;  3QYF A;  1KTW A;  4CCK A;  4OJ5 A;  2IS4 A;  4XD7 A;  1WJF A;  4XNF A;  2KP6 A;  2HZD A;  2QXZ A;  1NG6 A;  2WSS A;  4PJJ A;  1LVK A;  1MNE A;  4W8S A;  1PYV A;  3EQN A;  4E7J A;  1O8M A;  1QCX A;  4N4O B;  5KHD A;  5C1C A;  4CCJ A;  2VQC A;  1YX3 A;  4F3Q A;  2XZL A;  2QY1 A;  1IB4 A;  5KCM A;  3PL8 A;  3K6G A;  4NNJ A;  2W6J A;  4BEH A;  5HNF A;  4RMN A;  2V4D A;  4YZX A;  4EAT A;  2K9M A;  2W4S A;  1BHE A;  1IDK A;  1I8D A;  2UWM A;  5LD2 C;  2UVF A;  2WY8 Q;  4W8R A;  3ZXS A;  2LBF B;  3PNV A;  1N75 A;  3RQ4 A;  1W0K A;  3OYB A;  2HQA A;  2PYG A;  2VKD A;  1OFM A;  3PSF A;  4E7H A;  1KZL A;  3K10 A;  3W2A A;  4W8T A;  1WJ5 A;  2X1D A;  3E0J B;  5JHF A;  4XKW A;  2JA2 A;  4HPQ A;  4KT6 A;  4CA0 A;  4ZDO A;  1Y56 A;  4U87 A;  2IS1 A;  1IDJ A;  2LOO A;  2UV1 A;  4Y3O A;  3D5R C;  2QE7 A;  1RMG A;  3ZRG A;  3LNN A;  4CCO A;  1BPL A;  1WP6 A;  3L2W A;  2HVR A;  4B47 A;  3GBG A;  3CES A;  2DJI A;  3ZGK A;  5FRN A;  3AKZ A;  1H8E A;  1O8D A;  1BOB A;  3CZ6 A;  4IZZ A;  2M4K A;  3OYF A;  1JRG A;  3OL4 A;  4LIV A;  2CH0 A;  1OGM X;  3G2B A;  3KX2 A;  3BH4 A;  3DTE A;  3VYS B;  2LY1 A;  4GRI A;  2IGM A;  4XLA A;  3BC8 A;  3VYT B;  4BJT A;  1PE9 A;  4ZJZ A;  3LMW A;  3OEE A;  2WJY A;  2XC7 A;  3EUK L;  2X6X A;  2NTQ A;  3QOE A;  3OYN A;  2V31 A;  3OFN A;  3DPU A;  3FKJ A;  5FRM A;  5CDF A;  2XSJ C;  4NUB A;  3S93 A;  2LYC A;  2ZZE A;  2O0V A;  3HG9 A;  3PNT A;  3GQA A;  4OZZ A;  4OZY A;  1X4O A;  3HPG A;  2XOK A;  2BOL A;  1EA3 A;  1QHG A;  2M7A A;  2JJ1 A;  2VQL A;  3H9J A;  3AL0 C;  2WAQ A;  3EPZ A;  4BDY A;  4XLF A;  2E5N A;  1MW7 A;  3TBI A;  2VBM A;  1IA5 A;  1H80 A;  3UW0 A;  2GOX B;  3A1Y A;  2X51 A;  4CUG A;  2KMU A;  5HNH A;  2R7U A;  1K5C A;  3KYL A;  2INU A;  3NWT A;  2DCE A;  4YXW A;  3GQ9 A;  4C9Y A;  4MR0 A;  4Z06 A;  2BVL A;  3D5L A;  3OYG A;  2OUM A;  3OYM A;  2HPM A;  3ZPN A;  4DBQ A;  2X6Y A;  4XL9 A;  3RSN A;  3TL4 X;  3T9G A;  3FDY A;  3T53 B;  2O0W A;  4B3F X;  2Q2E B;  4U4B A;  4ZTJ A;  3S3N A;  4E7Z A;  3GQ7 A;  4HG2 A;  2CUZ A;  2R7V A;  3A3G A;  4XLC A;  5CQG A;  1K28 D;  2Z6B D;  3OYL A;  1W9X A;  1D1B A;  3LSI A;  4XOR A;  3OYJ A;  1WPC A;  2F43 A;  2GJP A;  5CPR B;  4B44 A;  2XF5 A;  3M8J A;  3T51 B;  3OIQ A;  2GK6 A;  4B3G A;  4X0G A;  3J7A Y;  5FL7 A;  1DGR M;  2WY7 Q;  4KKT A;  1SKY B;  2XND A;  4PUS A;  1N77 A;  4KIS A;  3K4L A;  2X85 A;  2A5W A;  4JOM A;  2R4G A;  4RLF A;  2PEC A;  2Z2S B;  1SAU A;  4XR6 A;  4XKB A;  1AA7 A;  2X1C A;  3LL7 A;  4ANJ A;  3N05 A;  4H4K C;  1VJS A;  2DIE A;  4LG3 A;  3H5A A;  2XZP A;  3VWB A;  2W1O A;  2V7Q A;  1OLT A;  1PKV A;  2PYH A;  3S32 A;  4NK6 A;  3SZG A;  3L2V A;  4BE1 A;  1DBG A;  4ITV A;  2K9L A;  4PSX A;  4XLH A;  3OS2 A;  1G59 A;  4PFO A;  3LSM A;  2QKM B;  2DXI A;  1COW A;  4BGD A;  2BW3 A;  4MLO A;  3DPT A;  2ZTN A;  3B4N A;  1T0F C;  1HG8 A;  2XZO A;  1O8I A;  2NSP A;  2WAE A;  4URR A;  1WMR A;  2BW3 B;  3EUH C;  1GLN A;  4BJ5 C;  4CH7 A;  2K5C A;  3BLY A;  4II2 A;  5KNL A;  3H94 A;  3SYT A;  1BN8 A;  1O8H A;  3HOT A;  2Z16 A;  3DTK A;  3ZCO A;  3BG6 A;  3MD2 A;  4ZDP A;  1D0Y A;  4RM2 A;  1IRX A;  2WAF A;  2QKL B;  3DWL E;  4QPO A;  2L2O A;  2X53 S;  2O04 A;  2WA0 A;  4BDZ A;  2CW7 A;  2GJR A;  3FY3 A;  3S3O A;  2ZTG A;  3OYE A;  3WQZ A;  2F6C A;  2LRE A;  4E4H A;  2R7S A;  2DOA A;  2JVH A;  3VYU B;  3OOC A;  1Y6I A;  2CFO A;  4N4N B;  1FMV A;  2PJR B;  4C2U A;  3GVL A;  2BSP A;  2V1N A;  2V9K A;  3LFU A;  3OS0 A;  2W7N A;  3MKY B;  4ZYA A;  2M3A A;  3PJR A;  4NK8 A;  1BR1 A;  1SFK A;  3OYH A;  4XKV A;  4UZU A;  2HNH A;  4RM3 A;  3JU4 A;  4BJ6 C;  3VMW A;  2E60 A;  3HC7 A;  3B90 A;  2VJJ A;  4AVZ A;  1V5G A;  2JDI A;  4E7L A;  1JTA A;  1V5E A;  1LKX A;  1VLY A;  3A2K A;  3PFY A;  5IK2 A;  4JMQ A;  4YZ0 A;  2WB1 A;  3OE7 A;  1J09 A;  4J00 A;  4IKF A;  3PNY A;  2W00 A;  4NC8 A;  1EFR A;  3GVJ A;  2KHM A;  5CQE A;  3H0D A;  2VBK A;  4F93 B;  2VQG A;  2GOM A;  5FRO A;  1WJC A;  4ZDL A;  4D9J A;  4OWR B;  3OS1 A;  3DEE A;  3GQB A;  4I84 A;  1K6Y A;  1V5F A;  2LC2 A;  3K4N A;  3KRG A;  3K70 D;  3I3L A;  3H35 A;  1WJB A;  3RTR A;  2HVS A;  2VKH A;  2IGK A;  3DLA A;  1BR4 A;  2A6T A;  4OJL A;  2VJ4 A;  1E1R A;  1FMW A;  3VSU A;  1X0C A;  3UNG C;  2NST A;  2CW8 A;  2EWE A;  4B43 A;  2IGO A;  2R7X A;  1OFL A;  2OV7 A;  1O8K A;  2LY2 A;  2V4J C;  4C2T A;  5DN6 A;  2VJI A;  4BXF A;  1UD4 A;  4IX7 A;  2R7W A;  1D1A A;  2WBM A;  4HNU A;  1HVX A;  1OB0 A;  3IP4 B;  2JSP A;  2NT6 A;  1X1A A;  4Y33 A;  2E1M B;  5HKK A;  3CP8 A;  2W82 A;  4BE0 A;  3BG7 A;  1QJV A;  4B3X A;  3BCA A;  4DOZ A;  3RCO A;  3OYA A;  2NOJ B;  2K3P A;  3HL2 A;  1Z3Y A;  2IXS A;  4BQQ A;  3FHN A;  4Y4R A;  4F92 B;  2ZZF A;  1TT0 A;  2JUG A;  3HXL A;  2VPL A;  3NE5 B;  1HZE A;  4JQF A;  1O8J A;  4XMY A;  2IS2 A;  1WJD A;  2O5R A;  4DK1 A;  2HVQ A;  3HAG A;  3MMY B;  1W36 C;  4HIZ A;  4XOP A;  3D5S C;  3E1S A;  2L9S A;  3CF2 A;  3S3M A;  2RRE A;  3HPH A;  2HPI A;  4XKC A;  2XF6 A;  3VYR B;  4IQJ A;  3QYE A;  2ELJ A;  2MAB A;  2GK7 A;  2IGN A;  3OAA A;  2MC4 A;  2VLA A;  3OMY A;  4II3 A;  1EE6 A;  3W2W A;  1LDK B;  1E3Z A;  1WJE A;  4U7B A;  1RWR A;  3BC9 A;  4YEJ A;  1G8X A;  3FBI B;  3OIP A;  4HST A;  4DIQ A;  1UD5 A;  3JUR A;  2ZFU A;  4P1W A;  4HWV A;  3K4C A;  4KIT B;  3KEY A;  4E7S A;  3A4C A;  3DKX A;  4OAZ A;  2UVE A;  3ONQ A;  4W8Q A;  3IAM 2;  1DP3 A;  2ZXI A;  2QX3 A;  3KEW A;  1D1C A;  3FBN B;  4KJZ A;  1UD6 A;  2E1B A;  5CKT A;  2D3L A;  3F9K A;  1P9Q C;  3HKZ A;  3GQ8 A;  3DU6 A;  2VJ5 A;  3OYD A;  2VL8 A;  2E1M C;  2R7Q A;  4BS9 A;  2P0W A;  3W3C A;  3K4J A;  5C1E A;  4CZC A;  1KMH A;  3DPL C;  1OR7 C;  2VXD A;  1WTH D;  1NBM A;  3VST A;  2CV0 A;  3TMO A;  2GJK A;  4F52 A;  4YZA A;  1V0E A;  4L8J A;  5HLT A;  3SEQ A;  2LBF A;  4TT3 A;  2ZXH A;  1O8E A;  2X6W A;  2AQE A;  3AFH A;  3UR3 C;  4E6K G;  3MKW B;  1PXZ A;  4YZQ A;  1OOC A;  4BUP A;  1X1C A;  1X19 A;  2XDV A;  1RU4 A;  4XLE A;  1QU3 A;  1V0F A;  1DBO A;  2HU9 A;  3CP2 A;  3ZIA A;  1Z7L A;  2KRH A;  1CZF A;  1BLI A;  2KRC A;  2VQH A;  1O88 A;  2Z1D A;  1WFX A;  3QYB A;  4J01 A;  2MFZ A;  2CV2 A;  4ZTF A;  2UUZ A;  1NRK A;  4OJO A;  4G7W A;  1YE9 A;  4D1Q A;  1GQ8 A;  1U0J A;  1H8H A;  4PJM A;  3LSH A;  2CS3 A;  4BQO A;  5AMV A;  2KLO A;  4B48 A;  2JJ2 A;  3K70 C;  2CMP A;  3EUA A;  3AL0 B;  4XM3 A;  2ZSH B;  1LFP A;  2HLD A;  4DBR A;  3OWT A;  2DT6 A;  4IQ4 A;  4AU7 A;  2M7B A;  1PLU A;  4HRI A;  2WPD A;  3ZQQ A;  2XGJ A;  3V42 A;  4E7K A;  1UD2 A;  4DK0 A;  1E0E A;  1I18 A;  3I9V 2;  4PFP A;  4OJ6 A;  3OY9 A;  3ZSC A;  4E0F A;  1TZL A;  3QOD A;  3W2V A;  3CMM A;  4CCN A;  4QPQ A;  4TSF A;  2W6I A;  1MMA A;  2WJV A;  3OYK A;  4R79 A;  4PJL A;  1E1Q A;  2NT9 A;  4AYB A;  2Z8G A;  4Z05 A;  1JI8 A;  2X8K A;  3K4K A;  4XN0 A;  2XF7 A;  3VSV A;  4FET A;  3H9Q A;  1UG0 A;  4NC7 A;  3U21 A;  2JVG A;  2O17 A;  3SDB A;  2F5V A;  4HNT A;  3OOU A;  4G6T B;  1MMN A;  1UEL B;  2HDW A;  3VSL A;  4PSW A;  2LZJ A;  1D0Z A;  1DQU A;  3LSG A;  3T56 B;  2L9N A;  1MND A;  4OJP A;  1YX5 A;  1R6R A;  2L7K A;  4G7X A;  2Q1Z B;  3OL3 A;  2WZP P;  1UD8 A;  2F4I A;  4PMH A;  3BCD A;  1X1B A;  1Z21 A;  4DNT B;  2Y0S A;  4BE2 A;  1OHH A;  4FXU A;  3FKS A;  3GRH A;  1W36 D;  2PMZ A;  2V26 A;  1NHC A;  3CJR B;  3VMV A;  1WJA A;  4XOT A;  3IAS 2;  4XON A;  3RPU D;  3OYC A;  5HOO A;  4F91 B;  4ZC3 A;  2F1M A;  3A3B A;  2D3N A;  3K4M A;  4FAS D;  4MXN A;  3LSK A;  2DT7 B;  2M5S A;  3OR2 C;  3HUG B;  4U49 A;  2KDO A;  3DKY A;  3A35 A;  1O8G A;  1FX0 A;  3H9G A;  2BVM A;  4GQN A;  3S8P A;  3ZR8 X;  2NTB A;  4P22 A;  5HVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...