4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
b'FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
4XR6A 1CZFA 3VSTA 2VBEA 1K5CA 2PECA 5C1CA 4MR0A 1PLUA 4NK8A 1JRGA 3SUCA 2EWEA 2O0WA 4OJPA 1WMRA 3GQ7A 3GQ9A 4XN3A 3B90A 2QXZA 3GQ8A 4OJ6A 4EW9A 2VJIA 1RMGA 3WWGA 3VMWA 1NHCA 1RU4A 1KCCA 4XLFA 1OOCA 1IDKA 1RWRA 2INUA 1PE9A 1XG2A 1OGOX 3GRHA 1O8KA 1PXZA 2PYHA 1IB4A 4XONA 2O04A 3B8YA 4W8RA 1OFMA 4U4BA 4NK6A 5AMVA 1O8MA 2UVEA 1O8HA 4XM3A 1QCXA 2BSPA 4OJ5A 4U49A 4XKVA 1O88A 4OZZA 3VSVA 1IA5A 2X3HA 2NTBA 4XL9A 2NTQA 4XNFA 1OGMX 1O8DA 4XOPA 1KTWA 4URRA 1BHEA 1VBLA 3LMWA 3EQNA 4XLAA 2X6WA 2QX3A 4Z03A 2NT6A 3B4NA 2X85A 2NZMA 3FY3A 1DBOA 4YZ0A 1JTAA 3VMVA 4XN0A 1OFLA 1O8GA 2X6YA 2NSPA 4YZAA 4YELA 1EE6A 1QJVA 4Z05A 4XMYA 4XOTA 4W8SA 4YZQA 4OJLA 1AIRA 2NTPA 3ZPPA 4XLEA 4I84A 2IQ7A 1GQ8A 5C1EA 2O1DA 1X0CA 4OZYA 1O8JA 2Z8GA 4XQFA 1IDJA 4YEJA 2VBMA 3GQAA 2O17A 4W8QA 2QY1A 4XORA 2VBKA 1DBGA 4C2LA 4XLHA 1KCDA 4W8TA 1H80A 1BN8A 2X6XA 4HWVA 1HG8A 3T9GA 2NT9A 3ZSCA 2UVFA 3UW0A 4YZXA 1O8LA 3JURA 4XKWA 4PMHA 3EQOA 2VJJA 1O8IA 2ODLA 4OJOA 1O8FA 1O8EA 3VSUA 3KRGA 2INVA 4MXNA 4AVZA 2NSTA 2O0VA 2PYGA 4XLCA 4Z06A
chains in the Genus database with same CATH superfamily
3U21A 3ABUA 1X1BA 2RQPA 2KRHA 1FOYA 3A01B 2PLFA 3GZNB 2MABA 3QAHA 1P92A 4CZZA 1IRFA 2P7CB 1UJ8A 4PSXA 4M3GA 2HYJA 1UAAA 3TQNA 3VNVA 3T1BA 3LSMA 1JHHA 5M3MJ 2WYRA 1JA1A 1D0ZA 2KHMA 1VQ5B 2JVGA 5FGMA 1S4MA 3GQ8A 1HW1A 3SFIA 3HPHA 1RMGA 2PMHA 2VFMA 2EIKH 4KDPA 2EFQA 2ZFWA 2DOEA 4L8JA 3ZQ7A 3CCMI 3LJYA 1HXDA 1LJ9A 2ZL5A 2O3FA 4RM2A 1DGWY 1KTVA 1TLHB 2I5UA 5CVIA 4ZC3A 4KITB 3IL2A 5IP9J 3DDYA 4FE4A 3MMPA 1VQNB 2R0QC 1CQTA 1ENHA 3ZQQA 5D5UB 3S8PA 3SLDA 2JK3A 4IF4A 1V5GA 2LVSA 2BY0A 2WB1A 2BM4A 2V5IA 2E60A 4MEYF 1E3OC 2QVOA 4U49A 3GTOJ 4OOXA 1MBKA 1BA5A 1XQBA 1ZUNB 5J8FA 2NAZA 1XN7A 1WFXA 4PZJA 3FBIB 2FBKA 3Q0UA 4IVNA 4LFUA 4PUSA 4G7OF 4KT5C 3OYEA 3E20A 1B59A 3CMYA 1KQ8A 4M1KA 3CCJB 2EJRA 1OGMX 1J09A 2AXTC 4G9YA 3LA2A 2E1MB 3HOXJ 5LHHA 4RLFA 3G71I 3SY2A 3I59A 3A02A 3RQ4A 3S32A 4C3JJ 4IHSA 3WGIA 3WG9A 1BC8C 4M3BA 5F6FA 3MKWB 1YRNA 4WCGA 1DBOA 3GTLJ 2MLGA 2B5OA 4EM2A 1LEBA 2B0RA 1T0FA 5FLXK 3LSPA 2LP0A 5IYPA 1R23A 4A5NA 5KHDA 2M5SA 4ESJA 4BHPA 2FOWA 2VKEA 5B6IA 2WA0A 2V7FA 4ETSA 1O3QA 3I55I 3QOPA 4YZQA 1TWAJ 5F64A 2KIMA 2ETHA 1FP1D 5GADJ 2PJPA 2GJRA 2MC3A 3DTIA 1SC7A 2Y0MA 3K4MA 4XLEA 1D1CA 2ZNZA 2I8DA 2GREA 3HB9A 5TV2A 2WB1N 3N4MA 5D4RA 2O1DA 2R7OA 1YTYA 4W1UA 1IV6A 2Z3YA 1D3YA 4ZCMA 3DFGA 2KZVA 2I10A 1YJNB 2KRCA 2QY1A 3Q9VA 1ZM9A 1WDTA 5LD2C 1SKYB 5K5QA 4P1WA 2CW0F 1LVAA 2CS3A 2AQFA 2FA5A 1RC9A 4BU2A 5GV7A 3CC7B 3M1EA 3FXKA 2PI0A 2M34A 4XKBA 2L2OA 4GXOA 2K7LA 5F4MA 4B48A 4JYKA 2VJJA 3WTZA 2YWEA 1O8FA 2ZBKA 2V7UA 3I71A 3W2FA 3R0JA 3BQYA 2ZZQA 3HZJA 1TT0A 1WH7A 3F8BA 3HIFA 4LC0A 3OS0A 1D8JA 1T98A 3D0SA 4E7SA 2ZTGA 4ROXA 4U88A 5ILSA 4IOAF 1FSHA 3M8JA 1FNDA 2DMTA 2JN6A 3FDYA 4Y3OA 4WZEA 1VQ4I 4Y7CA 4FASD 4RPDA 1TUIA 2NVTJ 5FLXZ 3CW2A 1MDMB 2V7VA 2FQ3A 2M0CA 5DS0A 2QKMB 4X7FA 5IY5H 4A0XA 3VOEA 1MBFA 4EEFG 4BE0A 2IOUG 3G6EI 1HW5A 3I56B 5F08A 2O5RA 4UVCA 2XKOA 3JCUC 4MNUA 2JPCA 3HXLA 3OZUA 4ESFA 4RD1A 4UV8A 1RWRA 4CCOA 4KT6A 1K83J 2JVHA 3ECOA 4ZH4F 2VFNA 3OYAA 1WXRA 5IT9Z 4M0LA 4AC9A 2K27A 4QWQA 2L7KA 1IB4A 2QTLA 1DDNA 1VQOI 4ASUA 2ELHA 1MBJA 1MH3A 3WTYC 4QPQA 2NOJB 1OMIA 2OYNA 2XAGA 4YAFA 2L7ZA 3CQZJ 2HDNB 2VPLA 4Q7JB 1QGAA 1NDHA 2QEXI 1O7FA 3LA3A 4RD4A 3M3YJ 4X0CA 2YWGA 2XZOA 4ON0A 4LK1F 2GLOA 3K4JA 1COWA 2GXGA 1Z0XA 2DTRA 4ENKA 1EFCA 2IP2A 2ZZEA 2K4JA 5DD4A 2JA5J 2LY2A 2QSGX 1XPXA 2G0YA 2OTJB 1VBLA 2PJRA 1J2XA 5LGUA 2XTWA 4ZDLA 5LMZA 2R5YB 1K73D 4EGZA 1GT0C 3AVUA 3P7NA 3I5UA 2QYUA 2Z6BD 2E2IJ 4A3LJ 3PUBA 4NNJA 4ZDPA 1Y1WJ 4ZZLA 4X07A 1VQLB 2C5BA 1OFLA 4MFDA 5J4YA 4QPOA 2X6YA 4YALA 2KT0A 1MH4A 2DT7B 1JE8A 1V55H 1X2MA 2CUEA 5FO5A 1FIPA 2KISA 1U3EM 3RQIA 2YX7A 5BPIA 1YX3A 2CV0A 2MA3A 5DNSA 3SZGA 2EPFA 3J81Z 3ZQCA 3H9NA 2R4GA 2QQBA 2W57A 2HOAA 1S3JA 4TSFA 5CPRB 2YR2A 3JREA 2DN0A 2BPOA 3OS1A 1ZH5A 4DK0A 4E4HA 1Y0NA 4Y15A 5AN9A 1F60A 1QHGA 1TWHJ 4BJTA 2NS8A 2ZB9A 5ED4A 4K1XA 4ANJA 1B23P 3FHNA 1VJSA 3S3MA 1H89C 1I6HJ 2Y69H 3UW0A 4HDVA 3T53B 3REOA 4Z1MA 3AG4H 1L1IA 4TKOB 2ZO4A 4YG2F 4KH3A 3CESA 5JHUA 1WOPA 4PABA 2OTLB 1MNDA 2ZMEC 3HOSA 5FNZA 1Z3YA 1T39A 1IRXA 1DGRM 3R61A 2DCEA 1EFTA 3TW7A 2DIEA 1KC8D 3HRMA 2OZ6A 3K7AJ 5H2FC 4FETA 2XOKA 3HRTA 1QBJA 3GZ6A 5L3CA 1CNFA 1U78A 2V1DA 3BJAA 5DV5A 1T56A 5C1CA 2VFQA 2BY2A 4MR0A 2MLKA 2EA2A 1D1AA 2EFOA 3N97A 5E17F 5E20A 4WZTA 4FWTA 2EFPA 4KKUA 2JN9A 1YRNB 4FK8A 1VQKB 3BH4A 3ABMH 3B90A 1YJ9B 1V0FA 1BJZA 2GQQA 2IJLA 4L0YB 1Q81D 3OYIA 4DJAA 1F43A 2HXIA 4WK8F 3WGGA 2AQEA 1U8BA 3FF5A 1XGSA 4N3GA 2F1MA 3BH7B 2JSPA 5L3GA 3UR3C 1IXCA 2DJNA 1IUYA 2HR3A 4Y13A 3K69A 1WP6A 5A88A 3H9QA 2CBXA 4FISA 3ZMUA 3OYGA 1E3HA 4F92B 1E3ZA 1Q86D 4F55A 4DYQA 1MGTA 3WTSC 2O8KA 3ONQA 3QWLA 1GVHA 5E6TA 2IXSA 5DEQA 1O8MA 1B1BA 1WJFA 5AMVA 1O8HA 2DA7A 3CMAI 3P9IA 3A3GA 2QSHX 4Q5SF 3S1NJ 3KEOA 1VQPI 2ECCA 4M3DA 1Z77A 2J5PA 4NBQA 2JMWA 4L5JA 1OKRA 4E7HA 1RNLA 1Q1HA 2CUFA 3V7RA 2ICWG 4KFCA 4XNFA 2YX4A 3VPRA 1G7RA 5LHIA 3F9KA 2W4SA 3BY6A 2VFOA 1S72B 2PN6A 3DLAA 2R7FA 4PSWA 1OLTA 2DMPA 1YIJB 2QX3A 1SD5A 1T95A 3L7WA 4L5EA 1GR1A 4LBZA 4B3FX 5K1YA 4PCQA 2MH2A 2VIXA 2XIGA 3GYHX 4HF2A 1JA0A 2X85A 2ELJA 1XD7A 5CVRA 3HSEA 4UB8C 1HDDC 1HDPA 2H6CA 3GX4X 1HF2A 4UY8I 2QQAA 4Z4TA 4XD7A 4IKFA 2XUBA 3ZZ0A 2KZGA 1YIOA 2M4KA 4AU7A 2EQRA 4C3HJ 4XMYA 1FRNA 4RD0A 3ML3A 3QP6A 3UKGA 4BNCA 4KIGA 1OPCA 4YFXF 3MFKA 3BCBA 2XGCA 3OYFA 4JX5A 3H5AA 3OYLA 3HEFA 1TP4A 2ELKA 3PUNA 3CC2B 4OMZA 1LKXA 3PSIA 1WPKA 2M2EA 4LG0B 3ZMSA 4B44A 2BSAA 5D6EA 4G8XA 3ZN1A 1WOOA 1E3XA 4XORA 5JLXA 1Z3XA 1UHMA 4HSTA 3ZQHA 3CMEI 5IYDJ 1AWCA 2QLZA 3BCAA 5D8LB 2RNGA 2RNJA 1ZRCA 1LFBA 3TOAA 3T5XA 1PUEE 3JRBA 2F4OB 3AVWA 5J3LA 1U5TC 1X19A 3F8MA 2DETA 2QENA 3ZZTA 1B9NA 3TBIA 4UZUA 1N75A 4RLZA 3AG2H 2VBXA 3QU3A 1UCRA 4BHBA 1T6SA 4KJZA 4P55A 2QZ8A 2YUSA 5HS7A 3CCLI 2AHQA 2YUHA 3AVVA 1SFUA 5F27A 1X1AA 1YQAA 3KP6A 2DU9A 3HPGA 3LAPA 2CGPA 2DBBA 1UHSA 2JSCA 4OAZA 1CNEA 1ETOA 2V9KA 3OJXA 3GFMA 4FX0A 2O7OA 1YJWB 4R1HA 3AAFA 2HEOA 5K7HA 4HF1A 3SUCA 2EWEA 3Q5FA 1JKRC 3JSOA 3HRUA 2L0KA 1NG6A 2JA8J 1DU0A 2IAIA 1N77A 1LE8A 4ASNA 4X7CA 1IDKA 1PVEA 1IAWA 1RUOA 2OBPA 4J0QA 3C2HA 1LLWA 3JU4A 3ZPLA 1GAQA 3GRHA 2K9MA 2FSWA 4JP0A 5FFXA 2OPTA 1E1RA 4RS8A 4NC6A 5E8GA 2GIZA 4XONA 3K0LA 3E6DA 4BJ6C 4W8RA 3QP5A 1QZYA 3CP2A 3CTAA 1JTYA 4Z4UA 1G7CA 3H0DA 4BQOA 1B6AA 3I9V2 1I18A 1O88A 1QRCA 2X0LA 3JW4A 4I7HA 4OZZA 4C43A 3BR0A 4AM3A 1PUFA 4G7ZF 1RPWA 1Y6IA 5IT3A 1HC8A 1KQ5A 5EG0A 1VQ6B 5EEAA 3OZWA 3EQNA 3DCFA 2DK5A 2BY3A 3GIRA 3H94A 2O03A 3BZCA 1D5VA 3BPVA 3CP8A 1AA7A 3SEJA 2JJ2A 3OKXA 1UG2A 1XMAA 2K02A 3AG1H 2M7BA 3ZN0A 1U2RA 1FBUA 4G1VA 4YXWA 1KU2A 3ASNH 2UUZA 1YHQI 1ZLJA 3F8CA 2Y9YA 3WGHA 3JRFA 1XGOA 1GVJA 2RDPA 3FM3A 4Q48A 2F5CA 5FA6A 1LDJA 1GVDA 2CRVA 2R7UA 1SEUA 1BLIA 2XT4A 1G3YA 1V4RA 2VI6A 2MYSA 2Z2SB 3KIOA 2Q6LA 4AIHA 3KLNA 2C77A 1MMAA 2XF6A 3BNWA 1M1KD 5GPCA 4HV6A 1ZREA 1O8JA 2M0MA 2GK6A 2NSTA 4OZYA 2X48A 3QSYA 3KX2A 1N08A 4LITA 2LKPA 3A8JA 2WC2A 3JRAA 3W6VA 1FDRA 2JUGA 3GO5A 3LSTA 4HWVA 4I99C 2ADUA 2HYGD 4E7LA 4O6JA 4AIKA 4QHYA 1VNDA 2ME0A 3V8KA 2EFWA 2UXXA 1SAXA 4RB0A 1O8LA 3GFJA 1NBMA 4X05A 1WKMA 5B5EC 5JVGF 1X3ZB 1KZLA 1DU6A 3OS2A 2H1KA 3S3OA 4XLPF 3L2UA 2H94A 4U0WA 1O8EA 2R3SA 1JJ8C 3OSFA 4NBSA 2W25A 3CF2A 1EXMA 2V79A 3V8LA 3PQJA 2C5HA 3W5HA 3D5RC 1XDUA 1HKSA 3OL3A 2WWYA 4II3A 3L2WA 1BI1A 1EWYA 3OAAA 1KD1D 3FMRA 3TKYA 5IK2A 3WU2C 4BBSJ 1T6YA 3ZMDA 2VASA 2D3NA 4LBWA 3T51B 2VN2A 1ETKA 1TWCJ 4P9FA 4RDKA 2D1HA 5L3DA 2KKOA 2XB5A 2GXBA 4WZLA 2PBIA 1W5CC 3F72A 2FEZA 2E71A 3OWTA 5D5XB 1U0JA 1MNMC 4V02C 3HHHA 3RPUD 3OP1A 4R71A 2BX6A 4A3EJ 2QXZA 2ZTNA 2JPBA 5GPAA 5TRDA 1ERDA 1QZZA 2LSOA 2VJ5A 2WV1A 2WSSA 1P6RA 4KIFA 3L2VA 2WJYA 4II2A 3SXYA 4MGRA 5IP7J 1ZR4A 2KIFA 1HSJA 2R7ZJ 4QFMA 3FWEA 2A5WA 1WGXA 4Q4ZF 2QDXA 5EF6A 3RZDJ 1CLWA 3KEWA 1ZGJA 4KMUX 4CCJA 1BI2A 3TP3A 5CVVA 5LFAA 1ELOA 2IA2A 3BY2A 1E1QA 3OOUA 2LKSA 4YIRX 3PA1A 1S7EA 4KYWA 3W5VA 3JRDA 3F21A 1A04A 1YE9A 3RIRA 3PENA 3EUKL 4G94A 2ZJQF 3QODA 1FOKA 2HZDA 2L9VA 3H92A 5KK1A 2QUFA 2ZXJA 4PC2A 4DNTB 1KTWA 2OA4A 3BR2A 1WTHD 1ULYA 1VQMB 5J4VA 2D3LA 3PM1A 2W7NA 1QQIA 2M9HA 2X6WA 4ZYDA 3CC4B 4Z03A 2JT1A 2YU3A 3CCVI 3PO3J 3OOCA 4YHBA 3W2EA 4GCVA 4OIPF 1XCVA 4A3KJ 2ZXWH 2NZMA 1P7IA 3G2BA 1RRJA 1E79A 2VXDA 4RLQA 2F5VA 3W2WA 3OYCA 4TMZA 1O4XA 4A0ZA 2HLDA 4RB3C 1JUMA 2IRFG 1W5TA 2EWNA 4DZJA 2HTJA 4KIBA 2STTA 5LGTA 2OAZA 1EH7A 1F36A 5C3EJ 1J59A 3EYYA 1R4MB 5EYRA 5FJ8J 3ONUA 4X0GA 2DW4A 3U1KA 1W7PA 2ESHA 3DP7A 1IG7A 4PC1A 1X0CA 3FKJA 4C30A 3K1MA 4V2GA 3JRCA 3R4KA 2C4TA 2XZLA 2Z8GA 1YLOA 1ETXA 1VZ0A 1EFUA 1JHFA 1I50J 3VR6A 3I4MJ 2VNKA 4TMTA 3HOZJ 1FNNA 3RIQA 3QFRA 3G3ZA 2BM6A 4IW3B 2ISYA 1EV7A 4GO1A 3WE2A 4RBOA 5TR9A 3E3VA 1E43A 2KMUA 1H80A 2ECBA 1N0UA 4RGRA 3T8TA 1S29A 4A93J 2COMA 5D6FA 2BM7A 1BIBA 2BGJA 2ZZGA 2X0KA 2PLYA 3RPQA 5FRNA 4JQFA 2H6BA 5CQEA 1TLLA 1PDNC 2DY1A 1VQ8I 1IO2A 4CCMA 1FYKA 4X7EA 1J7KA 2DMQA 3HYIA 2LNBA 2KJCA 4M6VA 3IH2A 3K4CA 1PUFB 5IYNA 3A1YA 3HG9A 2PYGA 2OZUA 5EG0B 2QA4I 3B82A 2HFHA 2G7HA 2JTVA 3GFLA 4JX4A 1U8RA 1ZM4A 3E1YE 3TP0A 4NUBA 1JGGA 2BMWA 3GUDA 1YW7A 4G12A 4AD9A 5J1YA 4FHTA 2O8XA 3T56B 2ZSHB 1YLFA 2EZIA 2VPRA 4AIJA 4YDTA 2DO7A 4ENMA 3KL9A 1QGYA 2O9LA 1F20A 2EFNA 4A12A 4WZKA 1J5YA 1HF0A 3ASPA 3BWGA 1QX4A 3CCUI 1B9MA 5GAEJ 3WNDA 2R7DA 2E19A 2BM1A 2BGIA 4ACBA 2VC0A 2B63J 3PFYA 3RI4A 3DEEA 4DOZA 2OU2A 3KCCA 2JDIA 2BZTA 3J81k 5K5RA 3AVYA 2R7VA 1MMNA 2VQCA 3O2PE 3W2VA 4FT8A 2PQ8A 1P2FA 2XAFA 1IXSB 3DBHB 2F48A 3H5NA 2V7QA 4OJ5A 4EGYA 5DUIA 2DMUA 2P6SA 1FIAA 3WNBA 3F22A 1WORA 1WCMJ 1DDIA 4OU0A 5TY0A 1KA8A 2X3HA 2OBSA 3TDZC 3AG3H 4XL9A 3MKZA 4KN7X 4Y4RA 1JTXA 2MSYA 3HKZA 4XOPA 2RC4A 2P4WA 3CJNA 4ZCIA 1HKTA 2QQ8A 4BKXA 1YYVA 1X58A 1FPQA 4EVIA 2W1OA 3GQBA 2P5KA 3S17J 2CQQA 4MFEA 3LAJA 3BC9A 3RZOJ 3ZUGA 2C2WA 3I54A 1VQ7B 5FKNA 2HGCA 2ZKZA 2PIAA 1SFKA 1P9QC 2IS1A 2GXAA 4CQJA 3OFNA 1SVOA 5DCMA 4YELA 1TT5B 5KCMA 4DZPA 3CO6C 5IYQA 1QJVA 3R6SA 2XAHA 1QO0D 2L9RA 2NOGA 1WOSA 1PYVA 4IO9F 1VQ9I 4Y33A 4B47A 3KEQA 3U2QA 3WNCA 3KP4A 5M3FJ 3FZVA 5KW9A 1TVCA 2E1OA 4XK4A 2X53S 2GOXB 2F5FA 2XDVA 2DOFA 1I6XA 3IH4A 3CJTB 1R1UA 2XGXA 4A6DA 4GYGA 2KDZA 1S0UA 3F0CA 3CPWB 3BR6A 4PJMA 3DBLB 3QQAA 3TO7A 2FMLA 3LQEA 4EM1A 3M8EA 2CC2A 5FD5A 3W2IA 2VBKA 2DFFA 3K9TA 3KP7A 1TYVA 2GQFA 1OJLA 3HKZN 3PSZA 1UD8A 4FXUA 1DPRA 3IV5A 4BACA 1XMXA 3J7AO 2WR8A 5TGTA 4XKWA 4U9UA 4ZGNB 4PMHA 2EINH 4EM0B 2L01A 3IWZA 1QA3A 1EP1B 2PMUA 4PJJA 3DTKA 1E64A 4YC5A 1N05A 3PIOF 4EJWA 2FMYA 2H8RA 5BSXA 3KRGA 1OFEA 2INVA 1JJ6C 2Z16A 1H85A 5GP9A 1KK3A 1J75A 2RQQA 2TRTA 3E7LA 1I8DA 4L0ZB 1W4MA 4NDLA 3EYIA 1G3TA 4GQNA 3MWMA 3LSJA 3G4SI 1ORKA 4NC7A 1F1ZA 4MYTA 4P2NA 2QBYB 3PA2A 3VYSB 4ESBA 4O5VA 1EH6A 3OR1C 3RKYA 3VSTA 2R5ZA 1WWXA 2PECA 2QF7A 3B6AA 4CCNA 2K4BA 1U9NA 1RI7A 2UXNA 1YFHA 3LOCA 2PE3A 2BBYA 3ONYA 1EFRA 2NRAC 4RDLA 3K4LA 1K7AA 4D9JA 2BOLA 3DQVC 4G6QA 4S05A 3P26A 1FC3A 5KSWB 3QU6A 3IKVA 1JUPA 1Q1VA 4XLFA 2CQKA 1TQMA 4BXUA 5D5VB 1UFMA 4A3DJ 3CCSB 1XG2A 3RSNA 5FO1A 4PJ0C 3ERED 2A61A 3ZXSA 2ZBVA 2M8GX 3P27A 4DBRA 1S8NA 3BG3A 4ZYEA 2LYCA 4NQWA 1YITB 4PC7A 4RB1A 3ULQB 3TW6A 3I58A 4XKVA 1XFOA 2ZBUA 3IKTA 1IHMA 1P4MA 3B6CA 1TL8A 5DUKA 4YAWA 2XRLA 1DDGA 3WY9A 2XT2A 1MW7A 1SKQA 5GV8A 1AHDP 3O8GA 1XG1A 1ZGWA 3PSSA 4CO8A 1VHEA 2D9RA 3TO6A 2OBRA 2BVLA 1EP3B 3DWLE 5AIQA 2E1BA 2R7WA 3WODF 3AL0B 3G1OA 1J9ZA 1G6NA 2L02A 2LDUA 3HRSA 1TYWA 3B4NA 1WPCA 4ZDOA 2F5EA 2LZJA 1EH8A 4PDKA 2V4DA 1JTAA 5GAGJ 2DA2A 2KDOA 3CDLA 3CCRI 4HIZA 2NVQJ 1ZARA 4RGSA 5F0FA 3L2RA 2XGJA 2B0LA 4GGGA 2VBZA 3WTWC 1E62A 1BL0A 1MZBA 2H27A 1KQSB 4LGWA 5FKLA 2XPWA 1AIRA 2BW3A 1P4AA 1QH0A 4UUVA 3M7GA 4HA8A 3ASQA 1PJ6A 3MZYA 5CJ9A 5F1RA 4K2EA 4EJOA 1S9HA 1OYWA 3C1DA 2E5ZA 2GZWA 4PFPA 1VQ5I 4HRIA 2VT3A 4KICA 4WF2A 2Z33A 1QFZA 4QTRA 3V76A 3KZYA 2COBA 1YI2B 3BPXA 2H09A 1HA3A 1SVMA 4HDUA 1V54H 3F8FA 1SFEA 1PP7U 2LF8A 3FK6A 4EV0A 1H0MA 3Q3AA 2M30A 5CVJA 1W1WE 3JTGA 4LLNA 2M7AA 3CDHA 1VQNI 4RAZA 5BSYA 1UELB 1MABA 3BG5A 4YCQA 3N6ZA 2FJ1A 2YSRA 3BJOA 4TN1A 3C3WA 2DK8A 1BC7C 2N8GA 3QOEA 5FKKA 2Q6KA 3B78A 4PC6A 4AWXB 4BEHA 4MXNA 4KMFA 3JR9A 3MCAA 1YX2A 3C2GA 3EUAA 4P6YA 1V5FA 1X1DA 5HLTA 1V3FA 4RD3A 4IPAA 4XICA 1S7AA 3V4GA 1OYIA 3CCJI 3NB2A 2VBEA 3AK5A 3KYLA 5K7ZA 4HSRA 3ESWB 2WTEA 3S1MJ 4OPOA 3QYBA 1OR7C 4BDYA 2R7QA 1QGPA 4Y52J 1CQXA 3V7AA 2HQ5A 5DCMB 5TISC 4FX4A 2VBYA 2FUG2 5E3LA 5LEKA 3WWGA 3VWBA 3PJRA 2EIJH 2XNJA 5FROA 1E63A 3CD6B 3HOVJ 4PJLA 4LJZF 4JK1X 4RAFA 4L9JA 4CGZA 2BF4A 4D7MA 4AYBA 2FRHA 1QPMA 3GZ5A 2C4UA 3CB4A 3A1PA 2DAOA 4HBLA 1SANA 4MHGA 3CUQC 3SQVA 4XRFA 1DABA 4HZFA 4NC8A 4BDZA 2Y31A 1WVRA 5JBQA 1LNWA 4GYIA 2OK7A 4QLCU 3W2AA 3DXJF 3I59B 1FNMA 4M3EA 2H1LA 2OQGA 2I1LA 1IN4A 2WV0A 4B3XA 4CH7A 3I1FA 4G1BA 2YWFA 4S0HB 1YJNI 3C7JA 5GTHC 4M72A 3L09A 4L9VA 1MIJA 3ZQLA 1I3QJ 2B9SA 3G1MA 4IEJA 3RKXA 2DA4A 2GJPA 2XAQA 3KYDB 3ZCOA 3HM5A 1SMTA 3OYJA 1A5JA 3CC7I 3OE7A 5EDNA 3JRHA 4IZZA 2DA5A 1MJ9A 3DV8A 3GW2A 2FOKA 4PGGA 5A2QK 1V0EA 4M6YA 2XSJC 5H20A 2E1RA 1HSTA 2XPUA 4GFBA 3PO2J 2ZFUA 2WJVA 2XRNA 3FM5A 3BROA 1S6LA 1WJCA 3G1LA 3LSIA 4XN0A 1XSVA 5E3NA 5F4OA 1OISA 1Y8RB 1DG1G 3ZBTA 4EJTA 3X2QH 4P3IA 4BXFA 4HLXA 2EZLA 3CLOA 1Z7LA 2IA0A 2R5ZB 1UG0A 4HEA2 3O8HA 4AYBN 2JUCA 4XOTA 1XX5A 2MW8A 4BPRA 1KJZA 2XAJA 4P26A 5KVRA 3VYTB 2CW5A 2QQ9A 2W85A 3ZMTA 2E36A 4U7DA 1HW2A 5ICGA 2CV1A 1IJFA 1K28D 1KONA 5E1WA 4MLOA 2CFXA 3H9JA 4LOCA 3IC7A 1B8IA 1U6GA 3I56I 5F0CA 2QN6A 5BNGA 2HQNA 5EEGA 4B09A 2YS9A 1T8IA 1XB4A 1DP3A 1RQPA 3AGQA 5E8IA 3P9KA 1OFCX 3TO9A 4M71A 3LWFA 2L7MP 3J80K 4EQQA 2W6IA 1USTA 4FQGA 5IYBJ 2XB0X 3DKYA 2NVUB 1WU8A 2Z9OA 1ZG1A 1GUUA 5LRRA 1FMVA 1E0EA 2A69F 3D5LA 2VT2A 4LLGF 1K8FA 1JXSA 3EQOA 2K3PA 1O3TA 2OCCH 1HLVA 5F0HA 4PAAA 5L46A 2DDBA 3U6BA 2CFOA 2JA7J 5CYVA 4HX4A 2DJIA 3M07A 1H8HA 5DD8A 1B72A 1QNTA 4D7NA 1WSVA 3VSUA 4A5MA 4M9ZA 4D5CA 2JRTA 2IEKA 4HNVA 2XEXA 2BV3A 1FWZA 3VO1A 4FCYA 5J40A 1K4ZA 1FNBA 5FIUA 2E1MC 4HX8A 3E0JB 2PEXA 2A6TA 5EZGA 2OTJI 2QM3A 1PLUA 2GA2A 4RGXA 3MQ0A 1VLYA 1D0YA 4NK8A 4AVPA 4HNUA 2UWMA 2O0WA 3ERMA 3GQ7A 4OJ6A 3QPSA 3ES9A 1KQ0A 3JQQA 1MBGA 1QZEA 3GMEA 1TW2A 2BXYA 3CCYA 3GWZA 4U0YA 1VQLI 4O3MA 1NHCA 3KLOA 3FBNB 1L3LA 3BG9A 1ZYRF 3I4PA 3RTRA 1YS7A 3OMYA 2DXIA 1UB9A 5HLIA 4DGWB 2D2WA 1MNEA 4YAOA 1O8KA 1PXZA 1PJ5A 4G5GA 1I27A 4JRAC 3OYHA 1UD6A 4Y9UA 4D0PA 1Z6TA 5ICCA 2DYRH 1T38A 1BOAA 2PJRB 5E79C 1JI8A 3VB2A 3HHGA 3ZZUA 1R7JA 2ZNYA 2DFHA 2K9SA 3RY8A 2GPJA 1YX5A 2V7XA 3GEZA 2VJ4A 1EKEA 2R7XA 3NQOA 4ITVA 2K9LA 1KYZA 2EV0A 4L9TA 3K2ZA 2XVCA 1EJ9A 1LDDA 2E7XA 4UB6C 3F8NA 1LEAA 1LDKB 2VBWA 5CVUA 4YFNF 1QVFB 3U1DA 2KJBA 4YIFA 2E2HJ 4YIIA 1JKOC 2V6CA 3ABLH 1OCOH 1MSEC 2OTLI 5J6XA 2HTSA 5B3SH 2OBTA 3FPPA 2FNPA 3QE2A 3I64A 2R6HA 3LSHA 4FN5A 1P4XA 2P0WA 2DFIA 4LMYA 1G3WA 3NAUA 1K4TA 2RGVA 2HWVA 2HMAA 5DM6F 5IOYA 5M5XJ 3GTJJ 3GVKA 2MGQA 3BG7A 1HZEA 4P9SA 2CF4A 4W8SA 2GIVA 1UZCA 1FT9A 1IB0A 3WU0A 1TZLA 1BPLA 3F6OA 1F5TA 3ASRA 3MKLA 5HVQC 3MVPA 1GQ8A 1OCCH 1WSRA 3I53A 1VQKI 1FJLA 2DPDA 2VBVA 1QQ1A 1T6ZA 4E0FA 1YJ9I 2DQLA 2JQ7A 4HW0A 1IDJA 1AOYA 4R8HA 1KMHA 2EA4A 3GQAA 2FBHA 1SD6A 4W8QA 2ZMEA 1AU7A 2HDCA 1SM4A 2VKHA 3CO7C 1QVTA 3OYBA 3T9GA 3H5RA 3AL0C 5EGOA 3S1QJ 2NT9A 6PAXA 4HLYA 3M8FA 1DPUA 2UVFA 2X1EA 3BOQA 2F4NA 2LLKA 2X1CA 3K10A 3MN2A 2IGOA 4I02A 5EZHA 2QGUA 3Q3SA 4RM3A 3K4KA 4E70A 2AS5F 1O8IA 4UNOA 3SQNA 4HQMA 3E5XA 4WXHA 3SJPA 1B4AA 3KZIC 4J00A 1RR7A 3S14J 3SLNA 2J8IA 2LKXA 1OB0A 1QHHD 3ZC3A 1PKVA 2XSDC 3AVXA 1R5ID 4RM0A 1WJDA 3VEPA 3LVBA 3OEHA 3DLLF 3BTLA 4RCZA 2HKOA 5C4XJ 1BMFA 3CDIA 1S72I 1H9TA 3LFUA 4RPBA 3JSPA 1I1GA 4UVBA 1YIJI 2DPUA 4AIDA 5FLMJ 3H3UA 2HDDA 1MMSA 1BX1A 1FRQA 1QPIA 3OJWA 4N9HA 3CCEB 1JRGA 5F04A 3ZP5A 2G7UA 1D1BA 4HPQA 4A3FJ 1HCRA 3ZIAA 2LBFA 4A3BJ 1WMRA 4FTHA 2VJIA 4DBQA 1AKHA 2E1CA 3VMWA 1FTTA 3SEZA 1BI3A 2K40A 1Z21A 3Q6QA 5H6RA 2OD5A 3KEYA 3R6JA 2KP6A 2P81A 2DDAA 4MO7A 3CCQB 1QVUA 3MAJA 4X6AJ 1E3PA 1RQRA 1ZTRA 3K1PA 1I5ZA 4PK4A 5JI6A 3VDXA 2Q2EA 1K78A 2Q1ZB 3CUOA 3FMQA 2QTZA 1MBHA 2VOOA 1I3AA 3FJOA 3ISXA 1OB5A 1XTAA 1A8PA 4HAMA 3B8YA 2ME6A 1MBEA 1B8IB 3E6BA 1WJAA 4A3MJ 4Z4ZA 4E7KA 4WX9A 1V5EA 1QUEA 2DA3A 2AO9A 4B3GA 4OM9A 2V7WA 5HKKA 3GTKJ 3M9AA 2L5QA 4A2UA 2P3MA 2A6HF 1JT6A 1ETQA 2IGMA 2VKVA 1ZQ3P 4I98B 4ZYAA 3ABTA 2HVRA 1MD0A 1VI0A 2CUJA 5FD6A 3C2BA 4BGDA 4EJUA 5E3MA 1Q82D 2A05A 4KNYA 2HS5A 1O8DA 2IPQX 3OR2C 4G6DA 2BVMA 5HDGA 1G8XA 1ZG5A 1RUNA 1IN6A 1J0RA 2FX0A 2XNCA 2R93J 1KQ9A 1B72B 1IW7F 3W3CA 1QG0A 3HSRA 4IQ4A 2D5VA 3QFCA 3FY3A 3EETA 2NNYA 1VHOA 5IYRA 5FO0A 3L2QA 2EH3A 1IN7A 2GBYA 4A3IJ 2NSPA 2QSFX 5CLSA 3CCMB 2LH9A 3VMFA 3I0TA 2DEUA 3H9GA 5B1BH 1ITYA 1VF7A 2DOGA 3B73A 3S15J 4B4DA 1D5YA 4D5FA 1RETA 5BMZA 3HC7A 4IRGA 1H9GA 3S93A 4IHYA 4HX7A 1YJWI 2IQ7A 1IF1A 1A6QA 2O0YA 1BIAA 1T0FC 1ZN2A 4M73A 3WE3A 2CJJA 5HDNA 4M2LA 2MFZA 3HSFA 1U5TA 3GVJA 3R0AA 4NCNA 3ZMZA 1W34A 1BX0A 3OW7A 3M4OJ 4C2LA 3W6JB 4ENNA 2BE5F 1KU9A 1H8AC 1O57A 2NYXA 2X6XA 4H4KC 4V19K 2L4AA 2MBFA 2Y75A 2DOAA 4OWRB 4M4SA 3PNYA 4XLNF 1ZAOA 1XDSA 2O6GE 2LG4A 2XTXA 3K4NA 3AKZA 3G71B 4BS9A 1QA2A 3O3KA 4AC0A 4YFOA 1KGSA 4OJOA 4ZYHA 3C18A 4IXAA 4LBYA 1Y8QB 3Q9SA 3A0HC 1K79A 4AVZA 2O0VA 1FOXA 3OL4A 1POGA 4DYRA 2WAFA 1LE8B 4MTEA 3RJPA 3S2HJ 2L9NA 3GVLA 3H0GJ 1KU7A 4G6IA 2QMUA 1SVLA 4M3FA 1CZFA 3I55B 2Q6IA 3OOPA 5D4SA 4BL0B 4HQEA 2A07F 2M1BA 1VQ6I 2VXZA 2PMDA 4B4CA 2X9DA 3ZQGA 1R00A 3BH6B 4ZV4A 3PETA 1NTCA 1UD5A 4OP7A 4DNRB 4NHJA 1YW8A 2AXLA 2J7KA 3V8JA 1BR2A 1S7OA 1ZK8A 4CZCA 4PJNA 3FKSA 2KPMA 1KK0A 2XF5A 3F6VA 4DQKA 3ROUA 3LYCA 1OYYA 1G4DA 3IHUA 1O3SA 2O61A 1A36A 1XE1A 2X51A 1WI9A 4XRSA 1MMGA 2G9WA 3TEDA 1EA3A 3PSFA 2FX3A 2XNDA 4RA2A 4YEIA 3NWSA 3WTUC 3WTTC 1BOBA 2LFBA 3FXRA 4A3GJ 1MKMA 4Z2YA 3GTGJ 2W84A 4MYUA 1HQCA 1HOMA 2IBDA 1R22A 1IRGA 1JKPC 2EIMH 4I01A 4IHTA 2ZMEB 3P5JA 4MQ9F 5DDGA 2BHZA 3WHCA 4DQLA 4X8IA 4C2UA 4LB5A 1PJ7A 4OMYA 1FYLA 4YRVA 5EGOB 1SD4A 2JA6J 2P5LC 2VE8A 2ID3A 2NS0A 4CCLA 4BQAA 1VQ4B 2E34A 2EBIA 1VFCA 1QFJA 4Y17A 2OQRA 3OYDA 3JQPA 2DFEA 1ZR2A 5LRSA 1O7LA 4TT3A 2BM5A 2FXAA 2ZJRF 3SJZA 3QFTA 2CMPA 1VTNC 4IHWA 5L3FA 1GXQA 4XRSG 3WBJA 1OGIA 1N78A 2R7TA 1F4KA 3V7CA 5J3OA 3G6EB 4RJLA 2KVOA 4A0YA 2IW5A 4RD2A 1Y0YA 1IJEA 2PMZN 4N0BA 4R79A 2D45A 1JUSA 1RESA 1QA6A 1T5EA 1FY7A 2VL8A 2A68F 4PGHA 1EE6A 4CSWA 3Q0WA 2WAQA 4NB5A 1WJBA 2LREA 3FXUA 3K1NA 4BE1A 1FLIA 2KIQA 5K5OA 2R5YA 1VQOB 4EH1A 5FL7A 2GWRA 5HLGA 3B8HA 3SZPA 2VNJA 4LBVA 4EATA 2KQRA 2MG4A 2JA2A 2CH0A 2QEXB 2KFDA 3SZTA 1JB9A 5ILVA 2O17A 2LR8A 4F7ZA 3H3ZA 3T0YA 5J1RA 3AFHA 2CYYA 3BQZA 2JWTA 4IJAA 2Q2EB 4XLHA 5L3EA 1K78B 1DBGA 3SZEA 1KCDA 3FXQA 1P4WA 3E6CC 1ON1A 2DLLA 4S04A 1PP8F 4IQJA 5HZAA 2XASA 2X4HA 3J7YJ 2QZAA 1TQIA 1X1PA 3EQLF 3A8IA 1Y0UA 4BYYA 5TJJA 3DPLC 1UHWA 4HE5A 1ZELA 3FXJA 3IAM2 4G7WA 3QPTA 2C78A 3EPZA 4QV2A 3KP2A 1NH3A 3JRGA 4ABZA 3OIQA 5HNHA 2HPIA 3ABKH 4XKCA 1Y56A 1H88C 4CUGA 1CGPA 3GTMJ 1H42A 2Y0SA 3L00A 4OOSA 2WAQN 2HVSA 1GHCA 2G0EA 4N9IA 3WTVC 4H0EA 2RAEA 5J35A 1D0XA 1XSXA 5KAIC 1IV8A 3ASSA 5IYWA 1GLNA 1Y1VJ 2ZCWA 5CKTA 1VQMI 3DEWA 1UMKA 3RKWA 1TW3A 3CZ6A 3Q0VA 3CC4I 2P6TA 1ZM2A 4C2TA 4X1EA 1R5OA 2BHYA 2V26A 1LB2A 1RU4A 2R9VA 1N07A 1KCCA 2E7WA 3HUGA 4ZYGA 4M53A 1S5LC 1REPC 2QYOA 3OY9A 1BR1A 4I6ZA 1N06A 1TNSA 3EDPA 2XKPA 2YWHA 5DSZA 2VBSA 3ASTA 4QIWN 1NK3P 2WAEA 3SEQA 5GAHJ 3ZRGA 4P6VF 4I0BA 3WU1B 2O04A 2L9SA 2OK8A 4IRIA 4NK6A 1U5TB 2LOOA 3P9CA 5JFRA 4Z4WA 5H59A 3IUOA 2QGGA 1D1NA 4LLLA 4GDFA 3HDDA 2BSPA 3BTCA 5BS6A 4ZCLA 1FMWA 4UXNA 1Z67A 4HYEA 2B7CA 2Y0SN 2BM0A 1WQ2A 2WADA 4LD5A 1IUFA 1KU3A 4EJVA 2BV6A 4YFKF 3OYMA 3ZR8X 2NTQA 4F91B 3S1RJ 1NB9A 2CQNA 2FVGA 2X6OA 4URRA 1ZRFA 2NVXJ 3J7ZI 3LMWA 1ZKGA 3VODA 5IT9K 3RCOA 4N4OB 3Q38A 2Y2ZA 4YAUA 1W7PB 2HOEA 2M87A 2KLOA 2NXNB 3IRQA 2O6WA 3NAWA 4CYDA 1FX0A 2VZLA 2RV8A 2DMNA 3OEEA 3VYRB 2Q0OA 1JJ2B 1O8GA 3S3NA 5D5WB 1BM9A 2ID6A 3D5SC 4D1QA 1LFUP 1J9IA 5HXBA 1B2RA 1QUFA 1DARA 5BPDA 4KKTA 4RAYA 4MEXF 5EMNA 3BT9A 1XSDA 2DQRA 1BN5A 2LY1A 3FXOA 5DYMA 1VF9A 3OPOA 3DU5A 1W0TA 4RDJA 4G6TB 5AONA 4IL6C 2W6JA 4HG2A 4HOBA 2VE9A 3CMAB 4XQFA 4DQ2A 1DP7P 2XC1A 3ASOH 5EEHA 4E6KG 3E5QA 1V5VA 1VQPB 5B66C 3I4NJ 5C44J 3WBKA 2FBIA 3QYEA 4WWCA 1R49A 1G7SA 1L0OC 1KRHA 3DPTA 2VONA 1HG8A 1D2EA 5KNLA 4CYCA 1ON2A 2W24A 5D8KB 3JURA 3LQQA 2F6CA 1D8KA 4E7JA 3V42A 3ZPNA 3DKWA 3J81K 2VQHA 1QVGB 4ZZDA 4LG0A 4BQQA 2WBMA 3GFIA 3F3XA 1Z9CA 3W2GA 2K3FA 4I09A 4WXCA 4A3JJ 3U9GA 2VYQA 2ZZFA 1ONVA 1FZPB 4XLCA 2VLAA 2EFGA 4Z06A 2XZPA 1FBQA 1X1CA 1XMKA 5JLWA 1ACIA 1FSEA 3BDDA 4AUXA 2K86A 1G2HA 2HZTA 1Z1DA 4IHXA 1MRZA 1G7TA 3LNQA 2ESNA 1K5CA 2GAUA 3EUHC 4W97A 5JVTA 2ZXIA 3PUMA 1WJEA 1TYXA 5A89A 1RKTA 1UMQA 4DW6A 1TQPA 2CQXA 4AF7A 1X4OA 2KRFA 3RPUA 3GQ9A 4OJPA 1VQ7I 4L9NA 2CU7A 1GXPA 2FNAA 5FKMA 1SD7A 2V1XA 1OB2A 2JRMA 5L3BA 4CXFA 1R5BA 1IJWC 2XC7A 2XROA 4J19A 2NS7A 4BY7J 2F1LA 3CMEB 2WZPP 3TDUC 4A6EA 3JX8A 5E18F 1XC5A 2VNHA 3H35A 2A6EF 1W9XA 3J7AY 1HVXA 1T33A 4CHUA 3SKBA 3A4CA 3DF8A 4X06A 4FE7A 4Z4SA 3GSIA 2UVEA 3SYTA 4M9XA 5FLVA 3VYUB 2DTZA 3QFSA 1YOVB 5F1JA 2Q8KA 5HS9A 3VSVA 3CCLB 2KIUA 1X2NA 2KL4A 1FNCA 2NTBA 1H8EA 2V6EA 5H6QA 4LK0F 1QGZA 3RDIA 2HPMA 2LMDA 5THXA 4QSHA 3SHFA 3A3BA 1IDYA 3LQ6A 1YW9A 4A3CJ 4TMXA 3BR1A 5DM7F 2CUZA 3LA7A 2TDXA 1VQ8B 3I3LA 3WG7H 2CRGA 3OV8A 5LLQA 5HZBA 2NT6A 4UV9A 3ZQIA 3BJ6A 2R7SA 1YG2A 3Q6RA 2MD0A 3VMVA 3TL4X 1WRJA 3IWFA 1KZHA 2TCTA 2ZITA 4KUMA 2MH9A 1W5SA 5DN6A 4B43A 2RKHA 2W7ZA 4WWVA 3AVTA 3IAS2 2XGEA 3HTUA 1K8AD 1R6RA 3KE2A 4CCKA 3ZPPA 4CA0A 3DPUA 3ZBUA 4EMSA 1E17A 1W7PD 4Z4VA 1G59A 3WQZA 4I2OA 2EB7A 2VFPA 3DU1X 4WXDA 5JLVC 3MZ8A 3HUGB 2VBTA 4YEJA 1NB0A 4BHCA 2IS4A 3BLYA 1M90D 2HOSA 3R60A 4OIOF 2GJKA 1KK2A 5HLHA 3ZGKA 3DEUA 3PNVA 4W8TA 1TC3C 4P25A 3CCSI 3MKYB 2K9NA 3DTEA 1NG7A 4HV5A 3TOBA 3KFWX 3ZSCA 3WXMA 5K7FA 1W36D 4YZXA 5JR3A 4PFOA 4UUTA 1W87A 3ISPA 1W35A 4Q47A 3ZOBA 1EA0A 3OYKA 3T8RA 1LVKA 2F5DA 1QFYA 2ODLA 2IS6A 1YITI 1I7PA 1Z6RA 4N4NB 3BZKA 1YHQB 2XTYA 1ETVA 5BOXA 2F4IA 2R92J 3OW2B 3FMSA 5J1UA 4MTDA 4OOVA 1IC8A 1OQYA 1GJRA 3W2HA 1BJAA 3MCZA 4XRMA 3NARA 4CDGA 2ACJA 3H09A 5FB2A 2P8TA 1LQ1A 2L4MA 1ETYA 1U9OA 3OIPA 3VNUA 2YPRA 3HOUJ 5ERIA 3ELKA 1FX7A 3CPXA 2VODA 1D8TA 3GLXA 3CMMA 4U0VA 3CF5F 1DUXC 4NQWB 4XN3A 3E1SA 3GCMA 4J01A 3TGNA 3K6GA 5DCFA 1ZLKA 1ZGAA 3KP5A 3SFZA 5LHGA 2XV4S 2EZHA 3BCFA 3BQJA 2WPDA 2LK2A 1ZG3A 3N05A 3GTPJ 1PE9A 1CF7A 3H1CA 1OGOX 5A2QZ 1UD2A 3BZ6A 5HODA 2FQ4A 4Y7NJ 3VSKA 1BJKA 1OFMA 1RKWA 3FK7A 2A3SA 3DKXA 2VUMJ 2Y48A 3LSRA 3K4BA 2VNIA 2WY7Q 4BY1J 1QCXA 2L54A 4C0SA 1K4SA 3AGPA 2BXZA 2BN4A 4XSZF 1ODDA 1HA8A 3RKQA 1YI2I 1OCPA 1T08B 3L1PA 3BTJA 1XGMA 2F43A 4L5IA 4N3NA 2HQAA 4P9UA 4CYCB 1BBYA 2E1NA 2ZC2A 2ZJ2A 4BH9A 1E2XA 1U2WA 2JZYA 3L2CA 2GM4A 2CQ7A 2VB6A 3IH3A 1XCBA 4TV7A 3K70D 1SFOJ 9ANTA 1XB2A 3GF2A 2BW3B 3ML6A 4OPSA 1SAUA 4ENJA 4RD6A 4U87A 2DA1A 2IT0A 3E6MA 1K6YA 1R71A 2V7TA 3J80Z 3SDBA 2V31A 4RMNA 1I1SA 1OCZH 4P5OA 4YZAA 1WSUA 1MJBA 3SDGA 1WI3A 1GO2A 4UHTA 5HDKA 4PGOA 4Z05A 4UUSA 2BVNA 4BAYA 1FP2A 2V4JC 3GBGA 3QPLA 2ZL7A 2DI3A 2HXOA 4C9YA 3H3VK 4KISA 4OJLA 4P1VA 4BJ5C 4CICA 3EUHA 3S2WA 4U7BA 4ZTFA 2NVYJ 1X4PA 3VO2A 1EZGA 1TNTA 2OJED 2RVCA 3F23A 1FTZA 4IRHA 4KN4X 2L3DA 3DBRB 1BR4A 1RZ4A 4LIUA 2GK7A 3HBLA 2VBMA 3LSGA 1IXRC 3CD6I 4BEHB 1ETWA 5AIPA 1NJID 3GLLA 5IOZA 5E3OA 3JAMK 5E1XA 3HTSB 3CXCB 1WJ5A 1FOWA 1IN5A 1GV2A 1R58A 3NEUA 4F7DA 2FF4A 3KP3A 3LL7A 2IGKA 2LRDA 1BI0A 5C4JJ 2DYSH 3FXMA 3CCVB 5J8CA 4OIRF 1IZ1A 1TBXA 2HU9A 1HKQA 4XIDA 3FX3A 4JOMA 2Y30A 1OR7A 1IRZA 3WYAA 4TMVA 4DK1A 2B7EA 1RIOH 4G7XA 1Z05A 4ZTJA 1BQEA 1W36C 3RYRA 4ZGQB 4WQMA 2PFBA 3QYFA 1XGNA 2CW8A 4XR6A 1JKQC 1T6XA 1NHAA 2VC1A 3KYCB 2RC5A 1QA1A 2Z5UA 1N25A 4C2MJ 2OV7A 2IA1A 2W00A 5EJCA 3PL8A 3SJMA 1TTTA 2W48A 2Z99A 3FISA 2Y9ZA 2IGNA 4LIVA 3VSLA 4B1RA 3TMOA 3O6BB 1LM1A 3BTIA 2LD5A 3MD2A 4LG3A 1YO5C 4OPVA 2MC4A 3CUQA 1QRYA 1TTYA 4IX7A 3JRIA 3BR5A 5DTDA 2CV2A 5GTIC 5H5JA 2HKXA 3BG6A 1IGNA 1G3SA 1WHUA 3ZQFA 2WZNA 2INUA 4HNTA 1ZM3A 5B1AH 3LO8A 4X7DA 2VQLA 3PUFA 4JBAA 5E1ZB 1KYWA 4B3AA 1SMYF 2P5VA 3UNGC 1JGSA 3MHPA 3JAMZ 3FHZA 3N90A 1QRBA 5JHFA 3QRFF 1BW5A 1MSFC 4MQVA 4A69C 2HDWA 3G05A 3DU6A 3L9FA 5CQGA 3RYPA 4DNCA 1HBXG 4RCYA 3BR3A 4KKSA 1RR8C 4QVJA 2ZJPF 3FKIJ 4UZFA 1R4NB 2M4GA 2RC6A 3P4GA 1R1TA 2HNHA 2EV6A 2EZKA 2GOMA 2M8EA 2K5CA 2VBUA 2XGDA 1FEXA 2QA4B 1UD4A 1IA5A 3HOTA 4H9GA 2UZKA 5DS9A 2ZL6A 1BHEA 4HE6A 3A01A 1R5GA 4P3YA 1WH5A 5ICEA 3H36A 1R5NA 4UAJA 2K9QA 3IP4B 1GAWA 2RN7A 3SYJA 2VQGA 2QE7A 2NNNA 1EF4A 1GV5A 4AF6A 1NRKA 4YZ0A 2CK3A 3V7SA 3JTHA 3CC2I 1UD3A 3E97A 3MEXA 1OFDA 3CCUB 3K70C 1JT0A 4JX6A 4BE2A 2W82A 1K61A 2V9PA 4QVAA 4OOIA 1OHHA 1DQUA 1M1EB 2NTPA 2IVMA 5LEJA 1Q7YD 3JQRA 4RGUA 1Y39A 2YU9J 2HI3A 3BC8A 2XPVA 5ILUA 4UZEA 1K9MD 5KAFC 1TSPA 2V1NA 1T2KA 1K6OA 2HOTA 3FPKA 3E5UA 5IYCJ 2DT6A 2E35A 1BW6A 2LF7A 2QCOA 3PQKA 2CG4A 4BQNA 1MMDA 2LC2A 3IRRA 1CF7B 4OINF 1GDTA 4P96A 1A31A 3FIWA 2Z1DA 3A8KA 2XAUA 4F3QA 3GXOA 2XF7A 2DCUA 4Z4RA 4M74A 5LGNA 1N0VC 3LNNA 3G73A 3LFKA 1TWFJ 2F4MB 2PX9A 5IP6A 4P22A 4E7ZA 2R7RA 3QPHA 3R6KA 3A2KA 4I76A 2DODA 2NPFA 1TYUA 2VOPA 2B7BA 3BP8A 5LBQA 4P12A 1X3WB 4Z4YA 1AIPA 4UVAA 1EP2B 4RDUA 4HF0A 2F3LA 1O3RA 3HJEA 1YS6A 2X8KA 1JNYA 2J8KA 2CSOA 4G7HF 3OZVA 3U2RA 1FYMA 2GA1A 2E5NA 3W6KB 1LUJB 2M3AA 3TH0A 3A35A 3BY1A 2JIZA 1VQ9B 2Q6OA 2H8WA 2OF7A 2A5YB 1R36A 2X1DA 1WZ2A 5IPAA 4RB2C 1N8RD 3OYNA 3D1NI 1ZRDA 4EW9A 1AMOA 2HYFA 5FFZA 4IOCF 4KA4A 2DA6A 3COAC 3HOYJ 4UUSB 2E2JJ 5FRMA 4V2FA 5M5WJ 2WY8Q 3PNTA 2FE3A 1R9TJ 5F4JA 1OOCA 4BBRJ 2QBYA 1FBSA 3LSKA 1W0UA 1Y0RA 2CNDA 3GTQJ 3PVDA 3CLQA 3HOWJ 2HQRA 3HL2A 5A8AA 1SFXA 2PYHA 4OPWA 1Z91A 4OAYA 4I0AA 2LY9A 3B02A 3ECHA 1APLC 1OCTC 4OIQF 2NV4A 4U4BA 3M1CA 5CDFA 2CW7A 2CO5A 2OCEA 2ISZA 2CWEA 4XM3A 2J5OA 4C3IJ 4F93B 3OIOA 4GRIA 3VFZA 1KK1A 5BQTA 2FD5A 1OGJA 1Z7UA 1ZHFA 2IS2A 1W0KA 5HS8A 4QUZA 4XBFA 3A0BC 1X3UA 4IHVA 3A03A 2VKDA 4MIMA 2K85A 3NE5B 1VLOA 1Q9SA 3G4SB 2QWWA 3LQRA 2BY1A 2V9VA 2PMZA 4XLAA 2D74A 1OCRH 3S16J 2AHOA 1LPQA 1C0WA 1W0JA 2LTPA 1MDMA 3BCDA 4DYCA 4DIQA 5M5YJ 5HOOA 1QU3A 2P7VB 3HGYA 1P7JA 1XS9A 2C6YA 3OSGA 5JMCB 3D26A 1STZA 2M5WA 4E7IA 1F9NA 1I39A 3WTXC 1A35A 1IDZA 2STWA 4BUPA 1TWGJ 2M45A 2DERA 3CJQB 3MMYB 1LLZA 3WHBA 1NK2P 5J47A 2DT5A 2JJ1A 1PJRA 4L18B 3KZZA 3HGGA 2L7FP 4B8XA 1R5HA 4I84A 3CCEI 2V1UA 5C1EA 2F2EA 3CUQB 3HAGA 4JMQA 2XHKA 1LFPA 2HCJB 4Y9RA 3MZHA 1USSA 2OUMA 2DYIA 2RREA 3ZMVA 4RAGA 4ACAA 2D1VA 3K2AA 3PIPF 2ZXHA 4M9SA 2BEOA 2ZSIB 2EK5A 3CCQI 4M6XA 4TMWA 2QKLB 4Z6YA 1A6IA 1BN8A 4LB6B 1IN8A 2OC6A 1R1VA 2X3UA 3FXLA 4BXXJ 5HNFA 2EV5A 3NWTA 2FU4A 3CJRB 3KETA 2EILH 3W5UA 3S2DJ 4XSXF 2EIXA 3Q39A 2MD5A 4ZJZA 4F52A 2BYVE 3LMMA 1MJAA 3CRZA 2BGCA 5ICFA 1W2BB 2LBFB 3CCRB 2PG4A 3GVAA 3NRVA 3U6KA 5FKOA 2JJ7A 2HVQA 3PFIA 2UV1A 1AKHB 3KPHA 4PC3A
chains in the Genus database with same CATH topology
3OAAA 1X1CA 3U21A 5IK2A 1X1BA 3T51B 2D3NA 2KRHA 2VASA 2MABA 2E1MC 1K5CA 3E0JB 2A6TA 3EUHC 4PSXA 1PLUA 2ZXIA 1UAAA 1WJEA 1VLYA 1D0YA 4NK8A 4HNUA 3LSMA 3OWTA 2UWMA 1U0JA 1X4OA 2O0WA 1D0ZA 2KHMA 3GQ7A 3GQ9A 2JVGA 3RPUD 2QXZA 3GQ8A 4OJPA 4OJ6A 2ZTNA 3HPHA 1RMGA 1NHCA 1ERDA 3FBNB 2VJ5A 2WSSA 4L8JA 3L2VA 2WJYA 3RTRA 2XC7A 3OMYA 4II2A 2DXIA 2WZPP 4DGWB 3H35A 4RM2A 1DGWY 2A5WA 1MNEA 1W9XA 1O8KA 1PXZA 3DDYA 4ZC3A 4KITB 3J7AY 1HVXA 3OYHA 1UD6A 3A4CA 3KEWA 3ZQQA 2PJRB 3S8PA 4CCJA 2UVEA 1V5GA 1JI8A 3SYTA 2WB1A 5LFAA 2E60A 3VYUB 4U49A 1E1QA 3OOUA 3VSVA 1YX5A 2R7XA 2VJ4A 2KL4A 1YE9A 4ITVA 1WFXA 2NTBA 2K9LA 3EUKL 3FBIB 4PUSA 3QODA 2V6EA 2HZDA 1H8EA 4JMQA 3OYEA 4DNTB 1OGMX 2HPMA 1KTWA 1J09A 1WTHD 1LDKB 2E1MB 3A3BA 2D3LA 2W7NA 2X6WA 2CUZA 3I3LA 4RLFA 3OOCA 4Z03A 2NT6A 3RQ4A 3S32A 2NZMA 3FPPA 2R7SA 1DBOA 3MKWB 3G2BA 2MD0A 1E79A 2VXDA 3LSHA 2F5VA 4RLQA 3TL4X 3W2WA 3OYCA 3VMVA 2P0WA 2HLDA 5KHDA 2M5SA 5DN6A 4B43A 3GVKA 2WA0A 3BG7A 2V7FA 1HZEA 4W8SA 4YZQA 3IAS2 1R6RA 1TZLA 1BPLA 4CCKA 3ZPPA 2GJRA 4CA0A 3DTIA 3K4MA 4XLEA 3DPUA 1D1CA 5HVQC 2I8DA 4X0GA 1GQ8A 2O1DA 1X0CA 4OZYA 2R7OA 3FKJA 4C30A 1G59A 3WQZA 2XZLA 2Z8GA 4E0FA 1VZ0A 3HUGB 3VR6A 2KZVA 4YEJA 1IDJA 2IS4A 1KMHA 3BLYA 3GQAA 4W8QA 2KRCA 2QY1A 2GJKA 5LD2C 1SKYB 3ZGKA 3PNVA 2VKHA 4W8TA 1H80A 1E43A 2KMUA 3OYBA 4P1WA 3MKYB 3DTEA 3H5RA 3AL0C 1NG7A 2CS3A 2NT9A 2AQFA 3T9GA 4BU2A 3ZSCA 2UVFA 2ZZGA 1W36D 4YZXA 2X1EA 4PFOA 4XKBA 2X1CA 2L2OA 3K10A 2IGOA 4JQFA 4B48A 5FRNA 5CQEA 2VJJA 1LVKA 3OYKA 4RM3A 3K4KA 4CCMA 1O8IA 2ODLA 2IS6A 1O8FA 4N4NB 2ZZQA 4J00A 1TT0A 3K4CA 2PYGA 2F4IA 3A1YA 3HG9A 3OS0A 1OB0A 1QHHD 4E7SA 2ZTGA 1PKVA 3M8JA 3FDYA 4Y3OA 1WJDA 4NUBA 3OEHA 4FASD 1BMFA 3LFUA 3OIPA 2QKMB 3T56B 2ZSHB 1JRGA 3CMMA 1D1BA 4HPQA 3ZIAA 4NQWB 4BE0A 2LBFA 4XN3A 1WMRA 3E1SA 4J01A 2VJIA 4DBQA 2O5RA 3VMWA 3K6GA 3SEZA 1Z21A 3HXLA 3KEYA 3BCFA 2KP6A 2WPDA 1RWRA 3N05A 4CCOA 4KT6A 1PE9A 2JVHA 1OGOX 1UD2A 3PFYA 4PK4A 3OYAA 3VDXA 3DEEA 4DOZA 2Q1ZB 2JDIA 2L7KA 1IB4A 3VSKA 4ASUA 3B8YA 1OFMA 4QPQA 1MMNA 2NOJB 2VQCA 3DKXA 3W2VA 1WJAA 2R7VA 3K4BA 2WY7Q 4E7KA 1V5EA 2VPLA 1QCXA 4B3GA 3H5NA 2V7QA 4OJ5A 1HA8A 5HKKA 2XZOA 2L5QA 1COWA 3K4JA 2IGMA 2F43A 2HQAA 2X3HA 4ZYAA 4XL9A 2HVRA 2CUJA 3MKZA 4Y4RA 4BGDA 2ZZEA 2LY2A 3HKZA 1O8DA 4XOPA 3OR2C 2BVMA 1G8XA 1VBLA 2VB6A 2PJRA 3K70D 4ZDLA 2BW3B 1SAUA 2W1OA 3GQBA 3W3CA 4U87A 4IQ4A 2Z6BD 3BC9A 3FY3A 1K6YA 3PUBA 4NNJA 3SDBA 4ZDPA 3L2QA 1SFKA 1P9QC 2IS1A 2V31A 1OFLA 4RMNA 3OFNA 4QPOA 2X6YA 2NSPA 4P5OA 4YZAA 4YELA 5KCMA 2LH9A 1QJVA 4Z05A 3H9GA 2DT7B 1VF7A 2V4JC 2CV0A 3GBGA 1PYVA 1YX3A 4C9YA 4OJLA 4KISA 3HC7A 3SZGA 4Y33A 4B47A 4BJ5C 4U7BA 3S93A 4ZTFA 2R4GA 1X4PA 4TSFA 5CPRB 2GOXB 2XDVA 2X53S 1E0EA 2IQ7A 1T0FC 3OS1A 2MFZA 4DK0A 4E4HA 4PJMA 1BR4A 3GVJA 4LIUA 2GK7A 2VBMA 1QHGA 3LSGA 4BEHB 4BJTA 3OW7A 2VBKA 4C2LA 4ANJA 1WJ5A 2X6XA 3FHNA 4H4KC 2VLAA 1UD8A 1VJSA 4FXUA 3S3MA 2DOAA 4OWRB 4BACA 3PNYA 3UW0A 3T53B 5TGTA 4Z1MA 3LL7A 4XKWA 2IGKA 2LG4A 2LRDA 4TKOB 4PMHA 3K4NA 3AKZA 4BS9A 3CESA 4PJJA 1MNDA 2HU9A 3DTKA 3HOSA 4OJOA 1Z3YA 1IRXA 1DGRM 4JOMA 2DCEA 3KRGA 2DIEA 2INVA 2Z16A 4AVZA 4G7XA 4DK1A 3OL4A 2O0VA 4ZTJA 2WAFA 2RQQA 1W36C 1I8DA 4GQNA 2L9NA 3GVLA 3QYFA 4FETA 2CW8A 4XR6A 2XOKA 4G6IA 4NC7A 1CZFA 3VYSB 2OV7A 2W00A 3OR1C 4II3A 4BL0B 3VSTA 2VXZA 3PL8A 2PECA 5C1CA 4CCNA 4MR0A 1D1AA 2IGNA 4LIVA 3VSLA 3TMOA 4KKUA 1UD5A 4DNRB 1EFRA 3BH4A 3K4LA 1BR2A 3B90A 3MD2A 2BOLA 4LG3A 3DQVC 4PJNA 4D9JA 2MC4A 4CZCA 1V0FA 3FKSA 2KPMA 4IX7A 2XF5A 3OYIA 4DJAA 2CV2A 4XLFA 2AQEA 3BG6A 2F1MA 2JSPA 3UR3C 2INUA 4HNTA 1XG2A 2X51A 2VQLA 1MMGA 3RSNA 1WP6A 1EA3A 3PSFA 3H9QA 3ZXSA 2XNDA 3OYGA 3NWSA 4F92B 1E3ZA 1BOBA 3UNGC 4F55A 4DBRA 3ONQA 2LYCA 5JHFA 2IXSA 5AMVA 1O8MA 2HDWA 1WJFA 3DU6A 5CQGA 3G05A 1O8HA 3A3GA 4KKSA 4XKVA 2M4GA 4C2UA 2HNHA 4YRVA 2GOMA 1IA5A 2K5CA 1UD4A 1MW7A 4CCLA 4E7HA 4XNFA 3OYDA 3HOTA 3F9KA 2W4SA 2BVLA 4TT3A 1BHEA 3DLAA 4PSWA 3DWLE 1OLTA 2CMPA 2QX3A 2E1BA 1T95A 3IP4B 2R7WA 4B3FX 2VIXA 3AL0B 1N78A 3B4NA 2VQGA 2R7TA 2QE7A 2X85A 1WPCA 4ZDOA 2ELJA 2LZJA 1NRKA 2KVOA 2V4DA 1JTAA 4HIZA 2KDOA 4YZ0A 2CK3A 3L2RA 4R79A 2XGJA 4XD7A 4IKFA 1T5EA 2VL8A 1UD3A 1EE6A 3K70C 4CSWA 4BE2A 2M4KA 2W82A 4AU7A 2WAQA 1WJBA 2LREA 4XMYA 4BE1A 1OHHA 1AIRA 1DQUA 2NTPA 2BW3A 3BCBA 3OYFA 5FL7A 3H5AA 3BC8A 3OYLA 4EATA 2KQRA 2V1NA 2JA2A 1S9HA 2CH0A 1LKXA 2DT6A 2E5ZA 3PSIA 4PFPA 4HRIA 4B44A 1E3XA 2O17A 4BQNA 1MMDA 2LC2A 4XORA 3AFHA 2Z1DA 1Z3XA 4XLHA 4HSTA 2Q2EB 1DBGA 1KCDA 2XAUA 4F3QA 3BCAA 2RNGA 2XF7A 4IQJA 3LNNA 2M7AA 1UELB 1X19A 4P22A 4E7ZA 2R7RA 1MABA 3DPLC 3TBIA 4UZUA 1N75A 3A2KA 1ZELA 3IAM2 4G7WA 3QOEA 3EPZA 4KJZA 4BEHA 4MXNA 2NSTA 3OIQA 5HNHA 2HPIA 4XKCA 1Y56A 2X8KA 4CUGA 2Y0SA 3C2GA 3EUAA 2HVSA 1V5FA 1X1DA 2E5NA 5HLTA 2M3AA 1X1AA 3HPGA 1D0XA 3A35A 2VBEA 4OAZA 2JIZA 1GLNA 2V9KA 3KYLA 5CKTA 4HSRA 3CZ6A 3QYBA 2X1DA 1OR7C 4BDYA 2R7QA 3OYNA 3SUCA 2EWEA 4C2TA 4EW9A 1NG6A 2FUG2 3WWGA 2V26A 3VWBA 1N77A 3PJRA 5FRMA 1RU4A 2R9VA 1KCCA 5FROA 2WY8Q 3PNTA 1OOCA 4PJLA 1IDKA 3OY9A 1BR1A 3C2HA 3LSKA 3JU4A 3GRHA 2K9MA 4AYBA 3HL2A 1E1RA 2PYHA 4OAYA 2WAEA 3SEQA 3ZRGA 4XONA 2O04A 4BJ6C 4W8RA 2L9SA 4U4BA 3M1CA 5CDFA 4NK6A 2CW7A 4NC8A 4BDZA 3CP2A 2LOOA 4XM3A 3IUOA 3W2AA 4F93B 4Z06A 4GRIA 2BSPA 1W0KA 4CH7A 1FMWA 4B3XA 4BQOA 3I9V2 3H0DA 2IS2A 1I18A 1O88A 4OZZA 2VKDA 3NE5B 2WADA 3OYMA 2GJPA 3ZCOA 3ZR8X 2NTQA 1Y6IA 4F91B 3OYJA 3OE7A 4IZZA 2PMZA 4URRA 3LMWA 3EQNA 4XLAA 1V0EA 2XSJC 3RCOA 3H94A 4N4OB 2WJVA 1W0JA 2ZFUA 3CP8A 1AA7A 3BCDA 2JJ2A 5HOOA 4DIQA 1QU3A 2KLOA 2M7BA 1WJCA 1FX0A 3LSIA 4XN0A 4YXWA 2UUZA 3OEEA 4E7IA 3VYRB 1O8GA 3S3NA 4BXFA 3D5SC 4BUPA 4D1QA 1Z7LA 1UG0A 4HEA2 3CJQB 3MMYB 4XOTA 2R7UA 4KKTA 1BLIA 3VYTB 2JJ1A 1PJRA 2LY1A 2MYSA 2Z2SB 2CV1A 1K28D 3OPOA 3DU5A 1MMAA 1KONA 2XF6A 4G6TB 4I84A 5C1EA 2W6JA 4HG2A 3HAGA 1O8JA 2M0MA 4MLOA 2GK6A 1LFPA 3H9JA 4XQFA 2OUMA 4E6KG 2RREA 3KX2A 4LITA 1DP3A 2ZXHA 3QYEA 2ZSIB 2JUGA 2QKLB 3DPTA 2W6IA 1BN8A 4HWVA 1HG8A 3DKYA 4E7LA 2OC6A 5KNLA 1FMVA 3D5LA 5HNFA 3NWTA 3CJRB 1O8LA 3JURA 2F6CA 1NBMA 3EQOA 2K3PA 4E7JA 4ZJZA 4F52A 1KZLA 3V42A 3ZPNA 2VQHA 2CFOA 3LMMA 3OS2A 3S3OA 3L2UA 2DJIA 4BQQA 1H8HA 2WBMA 1O8EA 3VSUA 3CF2A 2LBFB 2ZZFA 3D5RC 2HVQA 3OL3A 2UV1A 4XLCA 3L2WA 2XZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR6 A;  1CZF A;  3VST A;  2VBE A;  1K5C A;  2PEC A;  5C1C A;  4MR0 A;  1PLU A;  4NK8 A;  1JRG A;  3SUC A;  2EWE A;  2O0W A;  4OJP A;  1WMR A;  3GQ7 A;  3GQ9 A;  4XN3 A;  3B90 A;  2QXZ A;  3GQ8 A;  4OJ6 A;  4EW9 A;  2VJI A;  1RMG A;  3WWG A;  3VMW A;  1NHC A;  1RU4 A;  1KCC A;  4XLF A;  1OOC A;  1IDK A;  1RWR A;  2INU A;  1PE9 A;  1XG2 A;  1OGO X;  3GRH A;  1O8K A;  1PXZ A;  2PYH A;  1IB4 A;  4XON A;  2O04 A;  3B8Y A;  4W8R A;  1OFM A;  4U4B A;  4NK6 A;  5AMV A;  1O8M A;  2UVE A;  1O8H A;  4XM3 A;  1QCX A;  2BSP A;  4OJ5 A;  4U49 A;  4XKV A;  1O88 A;  4OZZ A;  3VSV A;  1IA5 A;  2X3H A;  2NTB A;  4XL9 A;  2NTQ A;  4XNF A;  1OGM X;  1O8D A;  4XOP A;  1KTW A;  4URR A;  1BHE A;  1VBL A;  3LMW A;  3EQN A;  4XLA A;  2X6W A;  2QX3 A;  4Z03 A;  2NT6 A;  3B4N A;  2X85 A;  2NZM A;  3FY3 A;  1DBO A;  4YZ0 A;  1JTA A;  3VMV A;  4XN0 A;  1OFL A;  1O8G A;  2X6Y A;  2NSP A;  4YZA A;  4YEL A;  1EE6 A;  1QJV A;  4Z05 A;  4XMY A;  4XOT A;  4W8S A;  4YZQ A;  4OJL A;  1AIR A;  2NTP A;  3ZPP A;  4XLE A;  4I84 A;  2IQ7 A;  1GQ8 A;  5C1E A;  2O1D A;  1X0C A;  4OZY A;  1O8J A;  2Z8G A;  4XQF A;  1IDJ A;  4YEJ A;  2VBM A;  3GQA A;  2O17 A;  4W8Q A;  2QY1 A;  4XOR A;  2VBK A;  1DBG A;  4C2L A;  4XLH A;  1KCD A;  4W8T A;  1H80 A;  1BN8 A;  2X6X A;  4HWV A;  1HG8 A;  3T9G A;  2NT9 A;  3ZSC A;  2UVF A;  3UW0 A;  4YZX A;  1O8L A;  3JUR A;  4XKW A;  4PMH A;  3EQO A;  2VJJ A;  1O8I A;  2ODL A;  4OJO A;  1O8F A;  1O8E A;  3VSU A;  3KRG A;  2INV A;  4MXN A;  4AVZ A;  2NST A;  2O0V A;  2PYG A;  4XLC A;  4Z06 A; 
#chains in the Genus database with same CATH topology
 3U21 A;  3ABU A;  1X1B A;  2RQP A;  2KRH A;  1FOY A;  3A01 B;  2PLF A;  3GZN B;  2MAB A;  3QAH A;  1P92 A;  4CZZ A;  1IRF A;  2P7C B;  1UJ8 A;  4PSX A;  4M3G A;  2HYJ A;  1UAA A;  3TQN A;  3VNV A;  3T1B A;  3LSM A;  1JHH A;  5M3M J;  2WYR A;  1JA1 A;  1D0Z A;  2KHM A;  1VQ5 B;  2JVG A;  5FGM A;  1S4M A;  3GQ8 A;  1HW1 A;  3SFI A;  3HPH A;  1RMG A;  2PMH A;  2VFM A;  2EIK H;  4KDP A;  2EFQ A;  2ZFW A;  2DOE A;  4L8J A;  3ZQ7 A;  3CCM I;  3LJY A;  1HXD A;  1LJ9 A;  2ZL5 A;  2O3F A;  4RM2 A;  1DGW Y;  1KTV A;  1TLH B;  2I5U A;  5CVI A;  4ZC3 A;  4KIT B;  3IL2 A;  5IP9 J;  3DDY A;  4FE4 A;  3MMP A;  1VQN B;  2R0Q C;  1CQT A;  1ENH A;  3ZQQ A;  5D5U B;  3S8P A;  3SLD A;  2JK3 A;  4IF4 A;  1V5G A;  2LVS A;  2BY0 A;  2WB1 A;  2BM4 A;  2V5I A;  2E60 A;  4MEY F;  1E3O C;  2QVO A;  4U49 A;  3GTO J;  4OOX A;  1MBK A;  1BA5 A;  1XQB A;  1ZUN B;  5J8F A;  2NAZ A;  1XN7 A;  1WFX A;  4PZJ A;  3FBI B;  2FBK A;  3Q0U A;  4IVN A;  4LFU A;  4PUS A;  4G7O F;  4KT5 C;  3OYE A;  3E20 A;  1B59 A;  3CMY A;  1KQ8 A;  4M1K A;  3CCJ B;  2EJR A;  1OGM X;  1J09 A;  2AXT C;  4G9Y A;  3LA2 A;  2E1M B;  3HOX J;  5LHH A;  4RLF A;  3G71 I;  3SY2 A;  3I59 A;  3A02 A;  3RQ4 A;  3S32 A;  4C3J J;  4IHS A;  3WGI A;  3WG9 A;  1BC8 C;  4M3B A;  5F6F A;  3MKW B;  1YRN A;  4WCG A;  1DBO A;  3GTL J;  2MLG A;  2B5O A;  4EM2 A;  1LEB A;  2B0R A;  1T0F A;  5FLX K;  3LSP A;  2LP0 A;  5IYP A;  1R23 A;  4A5N A;  5KHD A;  2M5S A;  4ESJ A;  4BHP A;  2FOW A;  2VKE A;  5B6I A;  2WA0 A;  2V7F A;  4ETS A;  1O3Q A;  3I55 I;  3QOP A;  4YZQ A;  1TWA J;  5F64 A;  2KIM A;  2ETH A;  1FP1 D;  5GAD J;  2PJP A;  2GJR A;  2MC3 A;  3DTI A;  1SC7 A;  2Y0M A;  3K4M A;  4XLE A;  1D1C A;  2ZNZ A;  2I8D A;  2GRE A;  3HB9 A;  5TV2 A;  2WB1 N;  3N4M A;  5D4R A;  2O1D A;  2R7O A;  1YTY A;  4W1U A;  1IV6 A;  2Z3Y A;  1D3Y A;  4ZCM A;  3DFG A;  2KZV A;  2I10 A;  1YJN B;  2KRC A;  2QY1 A;  3Q9V A;  1ZM9 A;  1WDT A;  5LD2 C;  1SKY B;  5K5Q A;  4P1W A;  2CW0 F;  1LVA A;  2CS3 A;  2AQF A;  2FA5 A;  1RC9 A;  4BU2 A;  5GV7 A;  3CC7 B;  3M1E A;  3FXK A;  2PI0 A;  2M34 A;  4XKB A;  2L2O A;  4GXO A;  2K7L A;  5F4M A;  4B48 A;  4JYK A;  2VJJ A;  3WTZ A;  2YWE A;  1O8F A;  2ZBK A;  2V7U A;  3I71 A;  3W2F A;  3R0J A;  3BQY A;  2ZZQ A;  3HZJ A;  1TT0 A;  1WH7 A;  3F8B A;  3HIF A;  4LC0 A;  3OS0 A;  1D8J A;  1T98 A;  3D0S A;  4E7S A;  2ZTG A;  4ROX A;  4U88 A;  5ILS A;  4IOA F;  1FSH A;  3M8J A;  1FND A;  2DMT A;  2JN6 A;  3FDY A;  4Y3O A;  4WZE A;  1VQ4 I;  4Y7C A;  4FAS D;  4RPD A;  1TUI A;  2NVT J;  5FLX Z;  3CW2 A;  1MDM B;  2V7V A;  2FQ3 A;  2M0C A;  5DS0 A;  2QKM B;  4X7F A;  5IY5 H;  4A0X A;  3VOE A;  1MBF A;  4EEF G;  4BE0 A;  2IOU G;  3G6E I;  1HW5 A;  3I56 B;  5F08 A;  2O5R A;  4UVC A;  2XKO A;  3JCU C;  4MNU A;  2JPC A;  3HXL A;  3OZU A;  4ESF A;  4RD1 A;  4UV8 A;  1RWR A;  4CCO A;  4KT6 A;  1K83 J;  2JVH A;  3ECO A;  4ZH4 F;  2VFN A;  3OYA A;  1WXR A;  5IT9 Z;  4M0L A;  4AC9 A;  2K27 A;  4QWQ A;  2L7K A;  1IB4 A;  2QTL A;  1DDN A;  1VQO I;  4ASU A;  2ELH A;  1MBJ A;  1MH3 A;  3WTY C;  4QPQ A;  2NOJ B;  1OMI A;  2OYN A;  2XAG A;  4YAF A;  2L7Z A;  3CQZ J;  2HDN B;  2VPL A;  4Q7J B;  1QGA A;  1NDH A;  2QEX I;  1O7F A;  3LA3 A;  4RD4 A;  3M3Y J;  4X0C A;  2YWG A;  2XZO A;  4ON0 A;  4LK1 F;  2GLO A;  3K4J A;  1COW A;  2GXG A;  1Z0X A;  2DTR A;  4ENK A;  1EFC A;  2IP2 A;  2ZZE A;  2K4J A;  5DD4 A;  2JA5 J;  2LY2 A;  2QSG X;  1XPX A;  2G0Y A;  2OTJ B;  1VBL A;  2PJR A;  1J2X A;  5LGU A;  2XTW A;  4ZDL A;  5LMZ A;  2R5Y B;  1K73 D;  4EGZ A;  1GT0 C;  3AVU A;  3P7N A;  3I5U A;  2QYU A;  2Z6B D;  2E2I J;  4A3L J;  3PUB A;  4NNJ A;  4ZDP A;  1Y1W J;  4ZZL A;  4X07 A;  1VQL B;  2C5B A;  1OFL A;  4MFD A;  5J4Y A;  4QPO A;  2X6Y A;  4YAL A;  2KT0 A;  1MH4 A;  2DT7 B;  1JE8 A;  1V55 H;  1X2M A;  2CUE A;  5FO5 A;  1FIP A;  2KIS A;  1U3E M;  3RQI A;  2YX7 A;  5BPI A;  1YX3 A;  2CV0 A;  2MA3 A;  5DNS A;  3SZG A;  2EPF A;  3J81 Z;  3ZQC A;  3H9N A;  2R4G A;  2QQB A;  2W57 A;  2HOA A;  1S3J A;  4TSF A;  5CPR B;  2YR2 A;  3JRE A;  2DN0 A;  2BPO A;  3OS1 A;  1ZH5 A;  4DK0 A;  4E4H A;  1Y0N A;  4Y15 A;  5AN9 A;  1F60 A;  1QHG A;  1TWH J;  4BJT A;  2NS8 A;  2ZB9 A;  5ED4 A;  4K1X A;  4ANJ A;  1B23 P;  3FHN A;  1VJS A;  3S3M A;  1H89 C;  1I6H J;  2Y69 H;  3UW0 A;  4HDV A;  3T53 B;  3REO A;  4Z1M A;  3AG4 H;  1L1I A;  4TKO B;  2ZO4 A;  4YG2 F;  4KH3 A;  3CES A;  5JHU A;  1WOP A;  4PAB A;  2OTL B;  1MND A;  2ZME C;  3HOS A;  5FNZ A;  1Z3Y A;  1T39 A;  1IRX A;  1DGR M;  3R61 A;  2DCE A;  1EFT A;  3TW7 A;  2DIE A;  1KC8 D;  3HRM A;  2OZ6 A;  3K7A J;  5H2F C;  4FET A;  2XOK A;  3HRT A;  1QBJ A;  3GZ6 A;  5L3C A;  1CNF A;  1U78 A;  2V1D A;  3BJA A;  5DV5 A;  1T56 A;  5C1C A;  2VFQ A;  2BY2 A;  4MR0 A;  2MLK A;  2EA2 A;  1D1A A;  2EFO A;  3N97 A;  5E17 F;  5E20 A;  4WZT A;  4FWT A;  2EFP A;  4KKU A;  2JN9 A;  1YRN B;  4FK8 A;  1VQK B;  3BH4 A;  3ABM H;  3B90 A;  1YJ9 B;  1V0F A;  1BJZ A;  2GQQ A;  2IJL A;  4L0Y B;  1Q81 D;  3OYI A;  4DJA A;  1F43 A;  2HXI A;  4WK8 F;  3WGG A;  2AQE A;  1U8B A;  3FF5 A;  1XGS A;  4N3G A;  2F1M A;  3BH7 B;  2JSP A;  5L3G A;  3UR3 C;  1IXC A;  2DJN A;  1IUY A;  2HR3 A;  4Y13 A;  3K69 A;  1WP6 A;  5A88 A;  3H9Q A;  2CBX A;  4FIS A;  3ZMU A;  3OYG A;  1E3H A;  4F92 B;  1E3Z A;  1Q86 D;  4F55 A;  4DYQ A;  1MGT A;  3WTS C;  2O8K A;  3ONQ A;  3QWL A;  1GVH A;  5E6T A;  2IXS A;  5DEQ A;  1O8M A;  1B1B A;  1WJF A;  5AMV A;  1O8H A;  2DA7 A;  3CMA I;  3P9I A;  3A3G A;  2QSH X;  4Q5S F;  3S1N J;  3KEO A;  1VQP I;  2ECC A;  4M3D A;  1Z77 A;  2J5P A;  4NBQ A;  2JMW A;  4L5J A;  1OKR A;  4E7H A;  1RNL A;  1Q1H A;  2CUF A;  3V7R A;  2ICW G;  4KFC A;  4XNF A;  2YX4 A;  3VPR A;  1G7R A;  5LHI A;  3F9K A;  2W4S A;  3BY6 A;  2VFO A;  1S72 B;  2PN6 A;  3DLA A;  2R7F A;  4PSW A;  1OLT A;  2DMP A;  1YIJ B;  2QX3 A;  1SD5 A;  1T95 A;  3L7W A;  4L5E A;  1GR1 A;  4LBZ A;  4B3F X;  5K1Y A;  4PCQ A;  2MH2 A;  2VIX A;  2XIG A;  3GYH X;  4HF2 A;  1JA0 A;  2X85 A;  2ELJ A;  1XD7 A;  5CVR A;  3HSE A;  4UB8 C;  1HDD C;  1HDP A;  2H6C A;  3GX4 X;  1HF2 A;  4UY8 I;  2QQA A;  4Z4T A;  4XD7 A;  4IKF A;  2XUB A;  3ZZ0 A;  2KZG A;  1YIO A;  2M4K A;  4AU7 A;  2EQR A;  4C3H J;  4XMY A;  1FRN A;  4RD0 A;  3ML3 A;  3QP6 A;  3UKG A;  4BNC A;  4KIG A;  1OPC A;  4YFX F;  3MFK A;  3BCB A;  2XGC A;  3OYF A;  4JX5 A;  3H5A A;  3OYL A;  3HEF A;  1TP4 A;  2ELK A;  3PUN A;  3CC2 B;  4OMZ A;  1LKX A;  3PSI A;  1WPK A;  2M2E A;  4LG0 B;  3ZMS A;  4B44 A;  2BSA A;  5D6E A;  4G8X A;  3ZN1 A;  1WOO A;  1E3X A;  4XOR A;  5JLX A;  1Z3X A;  1UHM A;  4HST A;  3ZQH A;  3CME I;  5IYD J;  1AWC A;  2QLZ A;  3BCA A;  5D8L B;  2RNG A;  2RNJ A;  1ZRC A;  1LFB A;  3TOA A;  3T5X A;  1PUE E;  3JRB A;  2F4O B;  3AVW A;  5J3L A;  1U5T C;  1X19 A;  3F8M A;  2DET A;  2QEN A;  3ZZT A;  1B9N A;  3TBI A;  4UZU A;  1N75 A;  4RLZ A;  3AG2 H;  2VBX A;  3QU3 A;  1UCR A;  4BHB A;  1T6S A;  4KJZ A;  4P55 A;  2QZ8 A;  2YUS A;  5HS7 A;  3CCL I;  2AHQ A;  2YUH A;  3AVV A;  1SFU A;  5F27 A;  1X1A A;  1YQA A;  3KP6 A;  2DU9 A;  3HPG A;  3LAP A;  2CGP A;  2DBB A;  1UHS A;  2JSC A;  4OAZ A;  1CNE A;  1ETO A;  2V9K A;  3OJX A;  3GFM A;  4FX0 A;  2O7O A;  1YJW B;  4R1H A;  3AAF A;  2HEO A;  5K7H A;  4HF1 A;  3SUC A;  2EWE A;  3Q5F A;  1JKR C;  3JSO A;  3HRU A;  2L0K A;  1NG6 A;  2JA8 J;  1DU0 A;  2IAI A;  1N77 A;  1LE8 A;  4ASN A;  4X7C A;  1IDK A;  1PVE A;  1IAW A;  1RUO A;  2OBP A;  4J0Q A;  3C2H A;  1LLW A;  3JU4 A;  3ZPL A;  1GAQ A;  3GRH A;  2K9M A;  2FSW A;  4JP0 A;  5FFX A;  2OPT A;  1E1R A;  4RS8 A;  4NC6 A;  5E8G A;  2GIZ A;  4XON A;  3K0L A;  3E6D A;  4BJ6 C;  4W8R A;  3QP5 A;  1QZY A;  3CP2 A;  3CTA A;  1JTY A;  4Z4U A;  1G7C A;  3H0D A;  4BQO A;  1B6A A;  3I9V 2;  1I18 A;  1O88 A;  1QRC A;  2X0L A;  3JW4 A;  4I7H A;  4OZZ A;  4C43 A;  3BR0 A;  4AM3 A;  1PUF A;  4G7Z F;  1RPW A;  1Y6I A;  5IT3 A;  1HC8 A;  1KQ5 A;  5EG0 A;  1VQ6 B;  5EEA A;  3OZW A;  3EQN A;  3DCF A;  2DK5 A;  2BY3 A;  3GIR A;  3H94 A;  2O03 A;  3BZC A;  1D5V A;  3BPV A;  3CP8 A;  1AA7 A;  3SEJ A;  2JJ2 A;  3OKX A;  1UG2 A;  1XMA A;  2K02 A;  3AG1 H;  2M7B A;  3ZN0 A;  1U2R A;  1FBU A;  4G1V A;  4YXW A;  1KU2 A;  3ASN H;  2UUZ A;  1YHQ I;  1ZLJ A;  3F8C A;  2Y9Y A;  3WGH A;  3JRF A;  1XGO A;  1GVJ A;  2RDP A;  3FM3 A;  4Q48 A;  2F5C A;  5FA6 A;  1LDJ A;  1GVD A;  2CRV A;  2R7U A;  1SEU A;  1BLI A;  2XT4 A;  1G3Y A;  1V4R A;  2VI6 A;  2MYS A;  2Z2S B;  3KIO A;  2Q6L A;  4AIH A;  3KLN A;  2C77 A;  1MMA A;  2XF6 A;  3BNW A;  1M1K D;  5GPC A;  4HV6 A;  1ZRE A;  1O8J A;  2M0M A;  2GK6 A;  2NST A;  4OZY A;  2X48 A;  3QSY A;  3KX2 A;  1N08 A;  4LIT A;  2LKP A;  3A8J A;  2WC2 A;  3JRA A;  3W6V A;  1FDR A;  2JUG A;  3GO5 A;  3LST A;  4HWV A;  4I99 C;  2ADU A;  2HYG D;  4E7L A;  4O6J A;  4AIK A;  4QHY A;  1VND A;  2ME0 A;  3V8K A;  2EFW A;  2UXX A;  1SAX A;  4RB0 A;  1O8L A;  3GFJ A;  1NBM A;  4X05 A;  1WKM A;  5B5E C;  5JVG F;  1X3Z B;  1KZL A;  1DU6 A;  3OS2 A;  2H1K A;  3S3O A;  4XLP F;  3L2U A;  2H94 A;  4U0W A;  1O8E A;  2R3S A;  1JJ8 C;  3OSF A;  4NBS A;  2W25 A;  3CF2 A;  1EXM A;  2V79 A;  3V8L A;  3PQJ A;  2C5H A;  3W5H A;  3D5R C;  1XDU A;  1HKS A;  3OL3 A;  2WWY A;  4II3 A;  3L2W A;  1BI1 A;  1EWY A;  3OAA A;  1KD1 D;  3FMR A;  3TKY A;  5IK2 A;  3WU2 C;  4BBS J;  1T6Y A;  3ZMD A;  2VAS A;  2D3N A;  4LBW A;  3T51 B;  2VN2 A;  1ETK A;  1TWC J;  4P9F A;  4RDK A;  2D1H A;  5L3D A;  2KKO A;  2XB5 A;  2GXB A;  4WZL A;  2PBI A;  1W5C C;  3F72 A;  2FEZ A;  2E71 A;  3OWT A;  5D5X B;  1U0J A;  1MNM C;  4V02 C;  3HHH A;  3RPU D;  3OP1 A;  4R71 A;  2BX6 A;  4A3E J;  2QXZ A;  2ZTN A;  2JPB A;  5GPA A;  5TRD A;  1ERD A;  1QZZ A;  2LSO A;  2VJ5 A;  2WV1 A;  2WSS A;  1P6R A;  4KIF A;  3L2V A;  2WJY A;  4II2 A;  3SXY A;  4MGR A;  5IP7 J;  1ZR4 A;  2KIF A;  1HSJ A;  2R7Z J;  4QFM A;  3FWE A;  2A5W A;  1WGX A;  4Q4Z F;  2QDX A;  5EF6 A;  3RZD J;  1CLW A;  3KEW A;  1ZGJ A;  4KMU X;  4CCJ A;  1BI2 A;  3TP3 A;  5CVV A;  5LFA A;  1ELO A;  2IA2 A;  3BY2 A;  1E1Q A;  3OOU A;  2LKS A;  4YIR X;  3PA1 A;  1S7E A;  4KYW A;  3W5V A;  3JRD A;  3F21 A;  1A04 A;  1YE9 A;  3RIR A;  3PEN A;  3EUK L;  4G94 A;  2ZJQ F;  3QOD A;  1FOK A;  2HZD A;  2L9V A;  3H92 A;  5KK1 A;  2QUF A;  2ZXJ A;  4PC2 A;  4DNT B;  1KTW A;  2OA4 A;  3BR2 A;  1WTH D;  1ULY A;  1VQM B;  5J4V A;  2D3L A;  3PM1 A;  2W7N A;  1QQI A;  2M9H A;  2X6W A;  4ZYD A;  3CC4 B;  4Z03 A;  2JT1 A;  2YU3 A;  3CCV I;  3PO3 J;  3OOC A;  4YHB A;  3W2E A;  4GCV A;  4OIP F;  1XCV A;  4A3K J;  2ZXW H;  2NZM A;  1P7I A;  3G2B A;  1RRJ A;  1E79 A;  2VXD A;  4RLQ A;  2F5V A;  3W2W A;  3OYC A;  4TMZ A;  1O4X A;  4A0Z A;  2HLD A;  4RB3 C;  1JUM A;  2IRF G;  1W5T A;  2EWN A;  4DZJ A;  2HTJ A;  4KIB A;  2STT A;  5LGT A;  2OAZ A;  1EH7 A;  1F36 A;  5C3E J;  1J59 A;  3EYY A;  1R4M B;  5EYR A;  5FJ8 J;  3ONU A;  4X0G A;  2DW4 A;  3U1K A;  1W7P A;  2ESH A;  3DP7 A;  1IG7 A;  4PC1 A;  1X0C A;  3FKJ A;  4C30 A;  3K1M A;  4V2G A;  3JRC A;  3R4K A;  2C4T A;  2XZL A;  2Z8G A;  1YLO A;  1ETX A;  1VZ0 A;  1EFU A;  1JHF A;  1I50 J;  3VR6 A;  3I4M J;  2VNK A;  4TMT A;  3HOZ J;  1FNN A;  3RIQ A;  3QFR A;  3G3Z A;  2BM6 A;  4IW3 B;  2ISY A;  1EV7 A;  4GO1 A;  3WE2 A;  4RBO A;  5TR9 A;  3E3V A;  1E43 A;  2KMU A;  1H80 A;  2ECB A;  1N0U A;  4RGR A;  3T8T A;  1S29 A;  4A93 J;  2COM A;  5D6F A;  2BM7 A;  1BIB A;  2BGJ A;  2ZZG A;  2X0K A;  2PLY A;  3RPQ A;  5FRN A;  4JQF A;  2H6B A;  5CQE A;  1TLL A;  1PDN C;  2DY1 A;  1VQ8 I;  1IO2 A;  4CCM A;  1FYK A;  4X7E A;  1J7K A;  2DMQ A;  3HYI A;  2LNB A;  2KJC A;  4M6V A;  3IH2 A;  3K4C A;  1PUF B;  5IYN A;  3A1Y A;  3HG9 A;  2PYG A;  2OZU A;  5EG0 B;  2QA4 I;  3B82 A;  2HFH A;  2G7H A;  2JTV A;  3GFL A;  4JX4 A;  1U8R A;  1ZM4 A;  3E1Y E;  3TP0 A;  4NUB A;  1JGG A;  2BMW A;  3GUD A;  1YW7 A;  4G12 A;  4AD9 A;  5J1Y A;  4FHT A;  2O8X A;  3T56 B;  2ZSH B;  1YLF A;  2EZI A;  2VPR A;  4AIJ A;  4YDT A;  2DO7 A;  4ENM A;  3KL9 A;  1QGY A;  2O9L A;  1F20 A;  2EFN A;  4A12 A;  4WZK A;  1J5Y A;  1HF0 A;  3ASP A;  3BWG A;  1QX4 A;  3CCU I;  1B9M A;  5GAE J;  3WND A;  2R7D A;  2E19 A;  2BM1 A;  2BGI A;  4ACB A;  2VC0 A;  2B63 J;  3PFY A;  3RI4 A;  3DEE A;  4DOZ A;  2OU2 A;  3KCC A;  2JDI A;  2BZT A;  3J81 k;  5K5R A;  3AVY A;  2R7V A;  1MMN A;  2VQC A;  3O2P E;  3W2V A;  4FT8 A;  2PQ8 A;  1P2F A;  2XAF A;  1IXS B;  3DBH B;  2F48 A;  3H5N A;  2V7Q A;  4OJ5 A;  4EGY A;  5DUI A;  2DMU A;  2P6S A;  1FIA A;  3WNB A;  3F22 A;  1WOR A;  1WCM J;  1DDI A;  4OU0 A;  5TY0 A;  1KA8 A;  2X3H A;  2OBS A;  3TDZ C;  3AG3 H;  4XL9 A;  3MKZ A;  4KN7 X;  4Y4R A;  1JTX A;  2MSY A;  3HKZ A;  4XOP A;  2RC4 A;  2P4W A;  3CJN A;  4ZCI A;  1HKT A;  2QQ8 A;  4BKX A;  1YYV A;  1X58 A;  1FPQ A;  4EVI A;  2W1O A;  3GQB A;  2P5K A;  3S17 J;  2CQQ A;  4MFE A;  3LAJ A;  3BC9 A;  3RZO J;  3ZUG A;  2C2W A;  3I54 A;  1VQ7 B;  5FKN A;  2HGC A;  2ZKZ A;  2PIA A;  1SFK A;  1P9Q C;  2IS1 A;  2GXA A;  4CQJ A;  3OFN A;  1SVO A;  5DCM A;  4YEL A;  1TT5 B;  5KCM A;  4DZP A;  3CO6 C;  5IYQ A;  1QJV A;  3R6S A;  2XAH A;  1QO0 D;  2L9R A;  2NOG A;  1WOS A;  1PYV A;  4IO9 F;  1VQ9 I;  4Y33 A;  4B47 A;  3KEQ A;  3U2Q A;  3WNC A;  3KP4 A;  5M3F J;  3FZV A;  5KW9 A;  1TVC A;  2E1O A;  4XK4 A;  2X53 S;  2GOX B;  2F5F A;  2XDV A;  2DOF A;  1I6X A;  3IH4 A;  3CJT B;  1R1U A;  2XGX A;  4A6D A;  4GYG A;  2KDZ A;  1S0U A;  3F0C A;  3CPW B;  3BR6 A;  4PJM A;  3DBL B;  3QQA A;  3TO7 A;  2FML A;  3LQE A;  4EM1 A;  3M8E A;  2CC2 A;  5FD5 A;  3W2I A;  2VBK A;  2DFF A;  3K9T A;  3KP7 A;  1TYV A;  2GQF A;  1OJL A;  3HKZ N;  3PSZ A;  1UD8 A;  4FXU A;  1DPR A;  3IV5 A;  4BAC A;  1XMX A;  3J7A O;  2WR8 A;  5TGT A;  4XKW A;  4U9U A;  4ZGN B;  4PMH A;  2EIN H;  4EM0 B;  2L01 A;  3IWZ A;  1QA3 A;  1EP1 B;  2PMU A;  4PJJ A;  3DTK A;  1E64 A;  4YC5 A;  1N05 A;  3PIO F;  4EJW A;  2FMY A;  2H8R A;  5BSX A;  3KRG A;  1OFE A;  2INV A;  1JJ6 C;  2Z16 A;  1H85 A;  5GP9 A;  1KK3 A;  1J75 A;  2RQQ A;  2TRT A;  3E7L A;  1I8D A;  4L0Z B;  1W4M A;  4NDL A;  3EYI A;  1G3T A;  4GQN A;  3MWM A;  3LSJ A;  3G4S I;  1ORK A;  4NC7 A;  1F1Z A;  4MYT A;  4P2N A;  2QBY B;  3PA2 A;  3VYS B;  4ESB A;  4O5V A;  1EH6 A;  3OR1 C;  3RKY A;  3VST A;  2R5Z A;  1WWX A;  2PEC A;  2QF7 A;  3B6A A;  4CCN A;  2K4B A;  1U9N A;  1RI7 A;  2UXN A;  1YFH A;  3LOC A;  2PE3 A;  2BBY A;  3ONY A;  1EFR A;  2NRA C;  4RDL A;  3K4L A;  1K7A A;  4D9J A;  2BOL A;  3DQV C;  4G6Q A;  4S05 A;  3P26 A;  1FC3 A;  5KSW B;  3QU6 A;  3IKV A;  1JUP A;  1Q1V A;  4XLF A;  2CQK A;  1TQM A;  4BXU A;  5D5V B;  1UFM A;  4A3D J;  3CCS B;  1XG2 A;  3RSN A;  5FO1 A;  4PJ0 C;  3ERE D;  2A61 A;  3ZXS A;  2ZBV A;  2M8G X;  3P27 A;  4DBR A;  1S8N A;  3BG3 A;  4ZYE A;  2LYC A;  4NQW A;  1YIT B;  4PC7 A;  4RB1 A;  3ULQ B;  3TW6 A;  3I58 A;  4XKV A;  1XFO A;  2ZBU A;  3IKT A;  1IHM A;  1P4M A;  3B6C A;  1TL8 A;  5DUK A;  4YAW A;  2XRL A;  1DDG A;  3WY9 A;  2XT2 A;  1MW7 A;  1SKQ A;  5GV8 A;  1AHD P;  3O8G A;  1XG1 A;  1ZGW A;  3PSS A;  4CO8 A;  1VHE A;  2D9R A;  3TO6 A;  2OBR A;  2BVL A;  1EP3 B;  3DWL E;  5AIQ A;  2E1B A;  2R7W A;  3WOD F;  3AL0 B;  3G1O A;  1J9Z A;  1G6N A;  2L02 A;  2LDU A;  3HRS A;  1TYW A;  3B4N A;  1WPC A;  4ZDO A;  2F5E A;  2LZJ A;  1EH8 A;  4PDK A;  2V4D A;  1JTA A;  5GAG J;  2DA2 A;  2KDO A;  3CDL A;  3CCR I;  4HIZ A;  2NVQ J;  1ZAR A;  4RGS A;  5F0F A;  3L2R A;  2XGJ A;  2B0L A;  4GGG A;  2VBZ A;  3WTW C;  1E62 A;  1BL0 A;  1MZB A;  2H27 A;  1KQS B;  4LGW A;  5FKL A;  2XPW A;  1AIR A;  2BW3 A;  1P4A A;  1QH0 A;  4UUV A;  3M7G A;  4HA8 A;  3ASQ A;  1PJ6 A;  3MZY A;  5CJ9 A;  5F1R A;  4K2E A;  4EJO A;  1S9H A;  1OYW A;  3C1D A;  2E5Z A;  2GZW A;  4PFP A;  1VQ5 I;  4HRI A;  2VT3 A;  4KIC A;  4WF2 A;  2Z33 A;  1QFZ A;  4QTR A;  3V76 A;  3KZY A;  2COB A;  1YI2 B;  3BPX A;  2H09 A;  1HA3 A;  1SVM A;  4HDU A;  1V54 H;  3F8F A;  1SFE A;  1PP7 U;  2LF8 A;  3FK6 A;  4EV0 A;  1H0M A;  3Q3A A;  2M30 A;  5CVJ A;  1W1W E;  3JTG A;  4LLN A;  2M7A A;  3CDH A;  1VQN I;  4RAZ A;  5BSY A;  1UEL B;  1MAB A;  3BG5 A;  4YCQ A;  3N6Z A;  2FJ1 A;  2YSR A;  3BJO A;  4TN1 A;  3C3W A;  2DK8 A;  1BC7 C;  2N8G A;  3QOE A;  5FKK A;  2Q6K A;  3B78 A;  4PC6 A;  4AWX B;  4BEH A;  4MXN A;  4KMF A;  3JR9 A;  3MCA A;  1YX2 A;  3C2G A;  3EUA A;  4P6Y A;  1V5F A;  1X1D A;  5HLT A;  1V3F A;  4RD3 A;  4IPA A;  4XIC A;  1S7A A;  3V4G A;  1OYI A;  3CCJ I;  3NB2 A;  2VBE A;  3AK5 A;  3KYL A;  5K7Z A;  4HSR A;  3ESW B;  2WTE A;  3S1M J;  4OPO A;  3QYB A;  1OR7 C;  4BDY A;  2R7Q A;  1QGP A;  4Y52 J;  1CQX A;  3V7A A;  2HQ5 A;  5DCM B;  5TIS C;  4FX4 A;  2VBY A;  2FUG 2;  5E3L A;  5LEK A;  3WWG A;  3VWB A;  3PJR A;  2EIJ H;  2XNJ A;  5FRO A;  1E63 A;  3CD6 B;  3HOV J;  4PJL A;  4LJZ F;  4JK1 X;  4RAF A;  4L9J A;  4CGZ A;  2BF4 A;  4D7M A;  4AYB A;  2FRH A;  1QPM A;  3GZ5 A;  2C4U A;  3CB4 A;  3A1P A;  2DAO A;  4HBL A;  1SAN A;  4MHG A;  3CUQ C;  3SQV A;  4XRF A;  1DAB A;  4HZF A;  4NC8 A;  4BDZ A;  2Y31 A;  1WVR A;  5JBQ A;  1LNW A;  4GYI A;  2OK7 A;  4QLC U;  3W2A A;  3DXJ F;  3I59 B;  1FNM A;  4M3E A;  2H1L A;  2OQG A;  2I1L A;  1IN4 A;  2WV0 A;  4B3X A;  4CH7 A;  3I1F A;  4G1B A;  2YWF A;  4S0H B;  1YJN I;  3C7J A;  5GTH C;  4M72 A;  3L09 A;  4L9V A;  1MIJ A;  3ZQL A;  1I3Q J;  2B9S A;  3G1M A;  4IEJ A;  3RKX A;  2DA4 A;  2GJP A;  2XAQ A;  3KYD B;  3ZCO A;  3HM5 A;  1SMT A;  3OYJ A;  1A5J A;  3CC7 I;  3OE7 A;  5EDN A;  3JRH A;  4IZZ A;  2DA5 A;  1MJ9 A;  3DV8 A;  3GW2 A;  2FOK A;  4PGG A;  5A2Q K;  1V0E A;  4M6Y A;  2XSJ C;  5H20 A;  2E1R A;  1HST A;  2XPU A;  4GFB A;  3PO2 J;  2ZFU A;  2WJV A;  2XRN A;  3FM5 A;  3BRO A;  1S6L A;  1WJC A;  3G1L A;  3LSI A;  4XN0 A;  1XSV A;  5E3N A;  5F4O A;  1OIS A;  1Y8R B;  1DG1 G;  3ZBT A;  4EJT A;  3X2Q H;  4P3I A;  4BXF A;  4HLX A;  2EZL A;  3CLO A;  1Z7L A;  2IA0 A;  2R5Z B;  1UG0 A;  4HEA 2;  3O8H A;  4AYB N;  2JUC A;  4XOT A;  1XX5 A;  2MW8 A;  4BPR A;  1KJZ A;  2XAJ A;  4P26 A;  5KVR A;  3VYT B;  2CW5 A;  2QQ9 A;  2W85 A;  3ZMT A;  2E36 A;  4U7D A;  1HW2 A;  5ICG A;  2CV1 A;  1IJF A;  1K28 D;  1KON A;  5E1W A;  4MLO A;  2CFX A;  3H9J A;  4LOC A;  3IC7 A;  1B8I A;  1U6G A;  3I56 I;  5F0C A;  2QN6 A;  5BNG A;  2HQN A;  5EEG A;  4B09 A;  2YS9 A;  1T8I A;  1XB4 A;  1DP3 A;  1RQP A;  3AGQ A;  5E8I A;  3P9K A;  1OFC X;  3TO9 A;  4M71 A;  3LWF A;  2L7M P;  3J80 K;  4EQQ A;  2W6I A;  1UST A;  4FQG A;  5IYB J;  2XB0 X;  3DKY A;  2NVU B;  1WU8 A;  2Z9O A;  1ZG1 A;  1GUU A;  5LRR A;  1FMV A;  1E0E A;  2A69 F;  3D5L A;  2VT2 A;  4LLG F;  1K8F A;  1JXS A;  3EQO A;  2K3P A;  1O3T A;  2OCC H;  1HLV A;  5F0H A;  4PAA A;  5L46 A;  2DDB A;  3U6B A;  2CFO A;  2JA7 J;  5CYV A;  4HX4 A;  2DJI A;  3M07 A;  1H8H A;  5DD8 A;  1B72 A;  1QNT A;  4D7N A;  1WSV A;  3VSU A;  4A5M A;  4M9Z A;  4D5C A;  2JRT A;  2IEK A;  4HNV A;  2XEX A;  2BV3 A;  1FWZ A;  3VO1 A;  4FCY A;  5J40 A;  1K4Z A;  1FNB A;  5FIU A;  2E1M C;  4HX8 A;  3E0J B;  2PEX A;  2A6T A;  5EZG A;  2OTJ I;  2QM3 A;  1PLU A;  2GA2 A;  4RGX A;  3MQ0 A;  1VLY A;  1D0Y A;  4NK8 A;  4AVP A;  4HNU A;  2UWM A;  2O0W A;  3ERM A;  3GQ7 A;  4OJ6 A;  3QPS A;  3ES9 A;  1KQ0 A;  3JQQ A;  1MBG A;  1QZE A;  3GME A;  1TW2 A;  2BXY A;  3CCY A;  3GWZ A;  4U0Y A;  1VQL I;  4O3M A;  1NHC A;  3KLO A;  3FBN B;  1L3L A;  3BG9 A;  1ZYR F;  3I4P A;  3RTR A;  1YS7 A;  3OMY A;  2DXI A;  1UB9 A;  5HLI A;  4DGW B;  2D2W A;  1MNE A;  4YAO A;  1O8K A;  1PXZ A;  1PJ5 A;  4G5G A;  1I27 A;  4JRA C;  3OYH A;  1UD6 A;  4Y9U A;  4D0P A;  1Z6T A;  5ICC A;  2DYR H;  1T38 A;  1BOA A;  2PJR B;  5E79 C;  1JI8 A;  3VB2 A;  3HHG A;  3ZZU A;  1R7J A;  2ZNY A;  2DFH A;  2K9S A;  3RY8 A;  2GPJ A;  1YX5 A;  2V7X A;  3GEZ A;  2VJ4 A;  1EKE A;  2R7X A;  3NQO A;  4ITV A;  2K9L A;  1KYZ A;  2EV0 A;  4L9T A;  3K2Z A;  2XVC A;  1EJ9 A;  1LDD A;  2E7X A;  4UB6 C;  3F8N A;  1LEA A;  1LDK B;  2VBW A;  5CVU A;  4YFN F;  1QVF B;  3U1D A;  2KJB A;  4YIF A;  2E2H J;  4YII A;  1JKO C;  2V6C A;  3ABL H;  1OCO H;  1MSE C;  2OTL I;  5J6X A;  2HTS A;  5B3S H;  2OBT A;  3FPP A;  2FNP A;  3QE2 A;  3I64 A;  2R6H A;  3LSH A;  4FN5 A;  1P4X A;  2P0W A;  2DFI A;  4LMY A;  1G3W A;  3NAU A;  1K4T A;  2RGV A;  2HWV A;  2HMA A;  5DM6 F;  5IOY A;  5M5X J;  3GTJ J;  3GVK A;  2MGQ A;  3BG7 A;  1HZE A;  4P9S A;  2CF4 A;  4W8S A;  2GIV A;  1UZC A;  1FT9 A;  1IB0 A;  3WU0 A;  1TZL A;  1BPL A;  3F6O A;  1F5T A;  3ASR A;  3MKL A;  5HVQ C;  3MVP A;  1GQ8 A;  1OCC H;  1WSR A;  3I53 A;  1VQK I;  1FJL A;  2DPD A;  2VBV A;  1QQ1 A;  1T6Z A;  4E0F A;  1YJ9 I;  2DQL A;  2JQ7 A;  4HW0 A;  1IDJ A;  1AOY A;  4R8H A;  1KMH A;  2EA4 A;  3GQA A;  2FBH A;  1SD6 A;  4W8Q A;  2ZME A;  1AU7 A;  2HDC A;  1SM4 A;  2VKH A;  3CO7 C;  1QVT A;  3OYB A;  3T9G A;  3H5R A;  3AL0 C;  5EGO A;  3S1Q J;  2NT9 A;  6PAX A;  4HLY A;  3M8F A;  1DPU A;  2UVF A;  2X1E A;  3BOQ A;  2F4N A;  2LLK A;  2X1C A;  3K10 A;  3MN2 A;  2IGO A;  4I02 A;  5EZH A;  2QGU A;  3Q3S A;  4RM3 A;  3K4K A;  4E70 A;  2AS5 F;  1O8I A;  4UNO A;  3SQN A;  4HQM A;  3E5X A;  4WXH A;  3SJP A;  1B4A A;  3KZI C;  4J00 A;  1RR7 A;  3S14 J;  3SLN A;  2J8I A;  2LKX A;  1OB0 A;  1QHH D;  3ZC3 A;  1PKV A;  2XSD C;  3AVX A;  1R5I D;  4RM0 A;  1WJD A;  3VEP A;  3LVB A;  3OEH A;  3DLL F;  3BTL A;  4RCZ A;  2HKO A;  5C4X J;  1BMF A;  3CDI A;  1S72 I;  1H9T A;  3LFU A;  4RPB A;  3JSP A;  1I1G A;  4UVB A;  1YIJ I;  2DPU A;  4AID A;  5FLM J;  3H3U A;  2HDD A;  1MMS A;  1BX1 A;  1FRQ A;  1QPI A;  3OJW A;  4N9H A;  3CCE B;  1JRG A;  5F04 A;  3ZP5 A;  2G7U A;  1D1B A;  4HPQ A;  4A3F J;  1HCR A;  3ZIA A;  2LBF A;  4A3B J;  1WMR A;  4FTH A;  2VJI A;  4DBQ A;  1AKH A;  2E1C A;  3VMW A;  1FTT A;  3SEZ A;  1BI3 A;  2K40 A;  1Z21 A;  3Q6Q A;  5H6R A;  2OD5 A;  3KEY A;  3R6J A;  2KP6 A;  2P81 A;  2DDA A;  4MO7 A;  3CCQ B;  1QVU A;  3MAJ A;  4X6A J;  1E3P A;  1RQR A;  1ZTR A;  3K1P A;  1I5Z A;  4PK4 A;  5JI6 A;  3VDX A;  2Q2E A;  1K78 A;  2Q1Z B;  3CUO A;  3FMQ A;  2QTZ A;  1MBH A;  2VOO A;  1I3A A;  3FJO A;  3ISX A;  1OB5 A;  1XTA A;  1A8P A;  4HAM A;  3B8Y A;  2ME6 A;  1MBE A;  1B8I B;  3E6B A;  1WJA A;  4A3M J;  4Z4Z A;  4E7K A;  4WX9 A;  1V5E A;  1QUE A;  2DA3 A;  2AO9 A;  4B3G A;  4OM9 A;  2V7W A;  5HKK A;  3GTK J;  3M9A A;  2L5Q A;  4A2U A;  2P3M A;  2A6H F;  1JT6 A;  1ETQ A;  2IGM A;  2VKV A;  1ZQ3 P;  4I98 B;  4ZYA A;  3ABT A;  2HVR A;  1MD0 A;  1VI0 A;  2CUJ A;  5FD6 A;  3C2B A;  4BGD A;  4EJU A;  5E3M A;  1Q82 D;  2A05 A;  4KNY A;  2HS5 A;  1O8D A;  2IPQ X;  3OR2 C;  4G6D A;  2BVM A;  5HDG A;  1G8X A;  1ZG5 A;  1RUN A;  1IN6 A;  1J0R A;  2FX0 A;  2XNC A;  2R93 J;  1KQ9 A;  1B72 B;  1IW7 F;  3W3C A;  1QG0 A;  3HSR A;  4IQ4 A;  2D5V A;  3QFC A;  3FY3 A;  3EET A;  2NNY A;  1VHO A;  5IYR A;  5FO0 A;  3L2Q A;  2EH3 A;  1IN7 A;  2GBY A;  4A3I J;  2NSP A;  2QSF X;  5CLS A;  3CCM B;  2LH9 A;  3VMF A;  3I0T A;  2DEU A;  3H9G A;  5B1B H;  1ITY A;  1VF7 A;  2DOG A;  3B73 A;  3S15 J;  4B4D A;  1D5Y A;  4D5F A;  1RET A;  5BMZ A;  3HC7 A;  4IRG A;  1H9G A;  3S93 A;  4IHY A;  4HX7 A;  1YJW I;  2IQ7 A;  1IF1 A;  1A6Q A;  2O0Y A;  1BIA A;  1T0F C;  1ZN2 A;  4M73 A;  3WE3 A;  2CJJ A;  5HDN A;  4M2L A;  2MFZ A;  3HSF A;  1U5T A;  3GVJ A;  3R0A A;  4NCN A;  3ZMZ A;  1W34 A;  1BX0 A;  3OW7 A;  3M4O J;  4C2L A;  3W6J B;  4ENN A;  2BE5 F;  1KU9 A;  1H8A C;  1O57 A;  2NYX A;  2X6X A;  4H4K C;  4V19 K;  2L4A A;  2MBF A;  2Y75 A;  2DOA A;  4OWR B;  4M4S A;  3PNY A;  4XLN F;  1ZAO A;  1XDS A;  2O6G E;  2LG4 A;  2XTX A;  3K4N A;  3AKZ A;  3G71 B;  4BS9 A;  1QA2 A;  3O3K A;  4AC0 A;  4YFO A;  1KGS A;  4OJO A;  4ZYH A;  3C18 A;  4IXA A;  4LBY A;  1Y8Q B;  3Q9S A;  3A0H C;  1K79 A;  4AVZ A;  2O0V A;  1FOX A;  3OL4 A;  1POG A;  4DYR A;  2WAF A;  1LE8 B;  4MTE A;  3RJP A;  3S2H J;  2L9N A;  3GVL A;  3H0G J;  1KU7 A;  4G6I A;  2QMU A;  1SVL A;  4M3F A;  1CZF A;  3I55 B;  2Q6I A;  3OOP A;  5D4S A;  4BL0 B;  4HQE A;  2A07 F;  2M1B A;  1VQ6 I;  2VXZ A;  2PMD A;  4B4C A;  2X9D A;  3ZQG A;  1R00 A;  3BH6 B;  4ZV4 A;  3PET A;  1NTC A;  1UD5 A;  4OP7 A;  4DNR B;  4NHJ A;  1YW8 A;  2AXL A;  2J7K A;  3V8J A;  1BR2 A;  1S7O A;  1ZK8 A;  4CZC A;  4PJN A;  3FKS A;  2KPM A;  1KK0 A;  2XF5 A;  3F6V A;  4DQK A;  3ROU A;  3LYC A;  1OYY A;  1G4D A;  3IHU A;  1O3S A;  2O61 A;  1A36 A;  1XE1 A;  2X51 A;  1WI9 A;  4XRS A;  1MMG A;  2G9W A;  3TED A;  1EA3 A;  3PSF A;  2FX3 A;  2XND A;  4RA2 A;  4YEI A;  3NWS A;  3WTU C;  3WTT C;  1BOB A;  2LFB A;  3FXR A;  4A3G J;  1MKM A;  4Z2Y A;  3GTG J;  2W84 A;  4MYU A;  1HQC A;  1HOM A;  2IBD A;  1R22 A;  1IRG A;  1JKP C;  2EIM H;  4I01 A;  4IHT A;  2ZME B;  3P5J A;  4MQ9 F;  5DDG A;  2BHZ A;  3WHC A;  4DQL A;  4X8I A;  4C2U A;  4LB5 A;  1PJ7 A;  4OMY A;  1FYL A;  4YRV A;  5EGO B;  1SD4 A;  2JA6 J;  2P5L C;  2VE8 A;  2ID3 A;  2NS0 A;  4CCL A;  4BQA A;  1VQ4 B;  2E34 A;  2EBI A;  1VFC A;  1QFJ A;  4Y17 A;  2OQR A;  3OYD A;  3JQP A;  2DFE A;  1ZR2 A;  5LRS A;  1O7L A;  4TT3 A;  2BM5 A;  2FXA A;  2ZJR F;  3SJZ A;  3QFT A;  2CMP A;  1VTN C;  4IHW A;  5L3F A;  1GXQ A;  4XRS G;  3WBJ A;  1OGI A;  1N78 A;  2R7T A;  1F4K A;  3V7C A;  5J3O A;  3G6E B;  4RJL A;  2KVO A;  4A0Y A;  2IW5 A;  4RD2 A;  1Y0Y A;  1IJE A;  2PMZ N;  4N0B A;  4R79 A;  2D45 A;  1JUS A;  1RES A;  1QA6 A;  1T5E A;  1FY7 A;  2VL8 A;  2A68 F;  4PGH A;  1EE6 A;  4CSW A;  3Q0W A;  2WAQ A;  4NB5 A;  1WJB A;  2LRE A;  3FXU A;  3K1N A;  4BE1 A;  1FLI A;  2KIQ A;  5K5O A;  2R5Y A;  1VQO B;  4EH1 A;  5FL7 A;  2GWR A;  5HLG A;  3B8H A;  3SZP A;  2VNJ A;  4LBV A;  4EAT A;  2KQR A;  2MG4 A;  2JA2 A;  2CH0 A;  2QEX B;  2KFD A;  3SZT A;  1JB9 A;  5ILV A;  2O17 A;  2LR8 A;  4F7Z A;  3H3Z A;  3T0Y A;  5J1R A;  3AFH A;  2CYY A;  3BQZ A;  2JWT A;  4IJA A;  2Q2E B;  4XLH A;  5L3E A;  1K78 B;  1DBG A;  3SZE A;  1KCD A;  3FXQ A;  1P4W A;  3E6C C;  1ON1 A;  2DLL A;  4S04 A;  1PP8 F;  4IQJ A;  5HZA A;  2XAS A;  2X4H A;  3J7Y J;  2QZA A;  1TQI A;  1X1P A;  3EQL F;  3A8I A;  1Y0U A;  4BYY A;  5TJJ A;  3DPL C;  1UHW A;  4HE5 A;  1ZEL A;  3FXJ A;  3IAM 2;  4G7W A;  3QPT A;  2C78 A;  3EPZ A;  4QV2 A;  3KP2 A;  1NH3 A;  3JRG A;  4ABZ A;  3OIQ A;  5HNH A;  2HPI A;  3ABK H;  4XKC A;  1Y56 A;  1H88 C;  4CUG A;  1CGP A;  3GTM J;  1H42 A;  2Y0S A;  3L00 A;  4OOS A;  2WAQ N;  2HVS A;  1GHC A;  2G0E A;  4N9I A;  3WTV C;  4H0E A;  2RAE A;  5J35 A;  1D0X A;  1XSX A;  5KAI C;  1IV8 A;  3ASS A;  5IYW A;  1GLN A;  1Y1V J;  2ZCW A;  5CKT A;  1VQM I;  3DEW A;  1UMK A;  3RKW A;  1TW3 A;  3CZ6 A;  3Q0V A;  3CC4 I;  2P6T A;  1ZM2 A;  4C2T A;  4X1E A;  1R5O A;  2BHY A;  2V26 A;  1LB2 A;  1RU4 A;  2R9V A;  1N07 A;  1KCC A;  2E7W A;  3HUG A;  4ZYG A;  4M53 A;  1S5L C;  1REP C;  2QYO A;  3OY9 A;  1BR1 A;  4I6Z A;  1N06 A;  1TNS A;  3EDP A;  2XKP A;  2YWH A;  5DSZ A;  2VBS A;  3AST A;  4QIW N;  1NK3 P;  2WAE A;  3SEQ A;  5GAH J;  3ZRG A;  4P6V F;  4I0B A;  3WU1 B;  2O04 A;  2L9S A;  2OK8 A;  4IRI A;  4NK6 A;  1U5T B;  2LOO A;  3P9C A;  5JFR A;  4Z4W A;  5H59 A;  3IUO A;  2QGG A;  1D1N A;  4LLL A;  4GDF A;  3HDD A;  2BSP A;  3BTC A;  5BS6 A;  4ZCL A;  1FMW A;  4UXN A;  1Z67 A;  4HYE A;  2B7C A;  2Y0S N;  2BM0 A;  1WQ2 A;  2WAD A;  4LD5 A;  1IUF A;  1KU3 A;  4EJV A;  2BV6 A;  4YFK F;  3OYM A;  3ZR8 X;  2NTQ A;  4F91 B;  3S1R J;  1NB9 A;  2CQN A;  2FVG A;  2X6O A;  4URR A;  1ZRF A;  2NVX J;  3J7Z I;  3LMW A;  1ZKG A;  3VOD A;  5IT9 K;  3RCO A;  4N4O B;  3Q38 A;  2Y2Z A;  4YAU A;  1W7P B;  2HOE A;  2M87 A;  2KLO A;  2NXN B;  3IRQ A;  2O6W A;  3NAW A;  4CYD A;  1FX0 A;  2VZL A;  2RV8 A;  2DMN A;  3OEE A;  3VYR B;  2Q0O A;  1JJ2 B;  1O8G A;  3S3N A;  5D5W B;  1BM9 A;  2ID6 A;  3D5S C;  4D1Q A;  1LFU P;  1J9I A;  5HXB A;  1B2R A;  1QUF A;  1DAR A;  5BPD A;  4KKT A;  4RAY A;  4MEX F;  5EMN A;  3BT9 A;  1XSD A;  2DQR A;  1BN5 A;  2LY1 A;  3FXO A;  5DYM A;  1VF9 A;  3OPO A;  3DU5 A;  1W0T A;  4RDJ A;  4G6T B;  5AON A;  4IL6 C;  2W6J A;  4HG2 A;  4HOB A;  2VE9 A;  3CMA B;  4XQF A;  4DQ2 A;  1DP7 P;  2XC1 A;  3ASO H;  5EEH A;  4E6K G;  3E5Q A;  1V5V A;  1VQP B;  5B66 C;  3I4N J;  5C44 J;  3WBK A;  2FBI A;  3QYE A;  4WWC A;  1R49 A;  1G7S A;  1L0O C;  1KRH A;  3DPT A;  2VON A;  1HG8 A;  1D2E A;  5KNL A;  4CYC A;  1ON2 A;  2W24 A;  5D8K B;  3JUR A;  3LQQ A;  2F6C A;  1D8K A;  4E7J A;  3V42 A;  3ZPN A;  3DKW A;  3J81 K;  2VQH A;  1QVG B;  4ZZD A;  4LG0 A;  4BQQ A;  2WBM A;  3GFI A;  3F3X A;  1Z9C A;  3W2G A;  2K3F A;  4I09 A;  4WXC A;  4A3J J;  3U9G A;  2VYQ A;  2ZZF A;  1ONV A;  1FZP B;  4XLC A;  2VLA A;  2EFG A;  4Z06 A;  2XZP A;  1FBQ A;  1X1C A;  1XMK A;  5JLW A;  1ACI A;  1FSE A;  3BDD A;  4AUX A;  2K86 A;  1G2H A;  2HZT A;  1Z1D A;  4IHX A;  1MRZ A;  1G7T A;  3LNQ A;  2ESN A;  1K5C A;  2GAU A;  3EUH C;  4W97 A;  5JVT A;  2ZXI A;  3PUM A;  1WJE A;  1TYX A;  5A89 A;  1RKT A;  1UMQ A;  4DW6 A;  1TQP A;  2CQX A;  4AF7 A;  1X4O A;  2KRF A;  3RPU A;  3GQ9 A;  4OJP A;  1VQ7 I;  4L9N A;  2CU7 A;  1GXP A;  2FNA A;  5FKM A;  1SD7 A;  2V1X A;  1OB2 A;  2JRM A;  5L3B A;  4CXF A;  1R5B A;  1IJW C;  2XC7 A;  2XRO A;  4J19 A;  2NS7 A;  4BY7 J;  2F1L A;  3CME B;  2WZP P;  3TDU C;  4A6E A;  3JX8 A;  5E18 F;  1XC5 A;  2VNH A;  3H35 A;  2A6E F;  1W9X A;  3J7A Y;  1HVX A;  1T33 A;  4CHU A;  3SKB A;  3A4C A;  3DF8 A;  4X06 A;  4FE7 A;  4Z4S A;  3GSI A;  2UVE A;  3SYT A;  4M9X A;  5FLV A;  3VYU B;  2DTZ A;  3QFS A;  1YOV B;  5F1J A;  2Q8K A;  5HS9 A;  3VSV A;  3CCL B;  2KIU A;  1X2N A;  2KL4 A;  1FNC A;  2NTB A;  1H8E A;  2V6E A;  5H6Q A;  4LK0 F;  1QGZ A;  3RDI A;  2HPM A;  2LMD A;  5THX A;  4QSH A;  3SHF A;  3A3B A;  1IDY A;  3LQ6 A;  1YW9 A;  4A3C J;  4TMX A;  3BR1 A;  5DM7 F;  2CUZ A;  3LA7 A;  2TDX A;  1VQ8 B;  3I3L A;  3WG7 H;  2CRG A;  3OV8 A;  5LLQ A;  5HZB A;  2NT6 A;  4UV9 A;  3ZQI A;  3BJ6 A;  2R7S A;  1YG2 A;  3Q6R A;  2MD0 A;  3VMV A;  3TL4 X;  1WRJ A;  3IWF A;  1KZH A;  2TCT A;  2ZIT A;  4KUM A;  2MH9 A;  1W5S A;  5DN6 A;  4B43 A;  2RKH A;  2W7Z A;  4WWV A;  3AVT A;  3IAS 2;  2XGE A;  3HTU A;  1K8A D;  1R6R A;  3KE2 A;  4CCK A;  3ZPP A;  4CA0 A;  3DPU A;  3ZBU A;  4EMS A;  1E17 A;  1W7P D;  4Z4V A;  1G59 A;  3WQZ A;  4I2O A;  2EB7 A;  2VFP A;  3DU1 X;  4WXD A;  5JLV C;  3MZ8 A;  3HUG B;  2VBT A;  4YEJ A;  1NB0 A;  4BHC A;  2IS4 A;  3BLY A;  1M90 D;  2HOS A;  3R60 A;  4OIO F;  2GJK A;  1KK2 A;  5HLH A;  3ZGK A;  3DEU A;  3PNV A;  4W8T A;  1TC3 C;  4P25 A;  3CCS I;  3MKY B;  2K9N A;  3DTE A;  1NG7 A;  4HV5 A;  3TOB A;  3KFW X;  3ZSC A;  3WXM A;  5K7F A;  1W36 D;  4YZX A;  5JR3 A;  4PFO A;  4UUT A;  1W87 A;  3ISP A;  1W35 A;  4Q47 A;  3ZOB A;  1EA0 A;  3OYK A;  3T8R A;  1LVK A;  2F5D A;  1QFY A;  2ODL A;  2IS6 A;  1YIT I;  1I7P A;  1Z6R A;  4N4N B;  3BZK A;  1YHQ B;  2XTY A;  1ETV A;  5BOX A;  2F4I A;  2R92 J;  3OW2 B;  3FMS A;  5J1U A;  4MTD A;  4OOV A;  1IC8 A;  1OQY A;  1GJR A;  3W2H A;  1BJA A;  3MCZ A;  4XRM A;  3NAR A;  4CDG A;  2ACJ A;  3H09 A;  5FB2 A;  2P8T A;  1LQ1 A;  2L4M A;  1ETY A;  1U9O A;  3OIP A;  3VNU A;  2YPR A;  3HOU J;  5ERI A;  3ELK A;  1FX7 A;  3CPX A;  2VOD A;  1D8T A;  3GLX A;  3CMM A;  4U0V A;  3CF5 F;  1DUX C;  4NQW B;  4XN3 A;  3E1S A;  3GCM A;  4J01 A;  3TGN A;  3K6G A;  5DCF A;  1ZLK A;  1ZGA A;  3KP5 A;  3SFZ A;  5LHG A;  2XV4 S;  2EZH A;  3BCF A;  3BQJ A;  2WPD A;  2LK2 A;  1ZG3 A;  3N05 A;  3GTP J;  1PE9 A;  1CF7 A;  3H1C A;  1OGO X;  5A2Q Z;  1UD2 A;  3BZ6 A;  5HOD A;  2FQ4 A;  4Y7N J;  3VSK A;  1BJK A;  1OFM A;  1RKW A;  3FK7 A;  2A3S A;  3DKX A;  2VUM J;  2Y48 A;  3LSR A;  3K4B A;  2VNI A;  2WY7 Q;  4BY1 J;  1QCX A;  2L54 A;  4C0S A;  1K4S A;  3AGP A;  2BXZ A;  2BN4 A;  4XSZ F;  1ODD A;  1HA8 A;  3RKQ A;  1YI2 I;  1OCP A;  1T08 B;  3L1P A;  3BTJ A;  1XGM A;  2F43 A;  4L5I A;  4N3N A;  2HQA A;  4P9U A;  4CYC B;  1BBY A;  2E1N A;  2ZC2 A;  2ZJ2 A;  4BH9 A;  1E2X A;  1U2W A;  2JZY A;  3L2C A;  2GM4 A;  2CQ7 A;  2VB6 A;  3IH3 A;  1XCB A;  4TV7 A;  3K70 D;  1SFO J;  9ANT A;  1XB2 A;  3GF2 A;  2BW3 B;  3ML6 A;  4OPS A;  1SAU A;  4ENJ A;  4RD6 A;  4U87 A;  2DA1 A;  2IT0 A;  3E6M A;  1K6Y A;  1R71 A;  2V7T A;  3J80 Z;  3SDB A;  2V31 A;  4RMN A;  1I1S A;  1OCZ H;  4P5O A;  4YZA A;  1WSU A;  1MJB A;  3SDG A;  1WI3 A;  1GO2 A;  4UHT A;  5HDK A;  4PGO A;  4Z05 A;  4UUS A;  2BVN A;  4BAY A;  1FP2 A;  2V4J C;  3GBG A;  3QPL A;  2ZL7 A;  2DI3 A;  2HXO A;  4C9Y A;  3H3V K;  4KIS A;  4OJL A;  4P1V A;  4BJ5 C;  4CIC A;  3EUH A;  3S2W A;  4U7B A;  4ZTF A;  2NVY J;  1X4P A;  3VO2 A;  1EZG A;  1TNT A;  2OJE D;  2RVC A;  3F23 A;  1FTZ A;  4IRH A;  4KN4 X;  2L3D A;  3DBR B;  1BR4 A;  1RZ4 A;  4LIU A;  2GK7 A;  3HBL A;  2VBM A;  3LSG A;  1IXR C;  3CD6 I;  4BEH B;  1ETW A;  5AIP A;  1NJI D;  3GLL A;  5IOZ A;  5E3O A;  3JAM K;  5E1X A;  3HTS B;  3CXC B;  1WJ5 A;  1FOW A;  1IN5 A;  1GV2 A;  1R58 A;  3NEU A;  4F7D A;  2FF4 A;  3KP3 A;  3LL7 A;  2IGK A;  2LRD A;  1BI0 A;  5C4J J;  2DYS H;  3FXM A;  3CCV B;  5J8C A;  4OIR F;  1IZ1 A;  1TBX A;  2HU9 A;  1HKQ A;  4XID A;  3FX3 A;  4JOM A;  2Y30 A;  1OR7 A;  1IRZ A;  3WYA A;  4TMV A;  4DK1 A;  2B7E A;  1RIO H;  4G7X A;  1Z05 A;  4ZTJ A;  1BQE A;  1W36 C;  3RYR A;  4ZGQ B;  4WQM A;  2PFB A;  3QYF A;  1XGN A;  2CW8 A;  4XR6 A;  1JKQ C;  1T6X A;  1NHA A;  2VC1 A;  3KYC B;  2RC5 A;  1QA1 A;  2Z5U A;  1N25 A;  4C2M J;  2OV7 A;  2IA1 A;  2W00 A;  5EJC A;  3PL8 A;  3SJM A;  1TTT A;  2W48 A;  2Z99 A;  3FIS A;  2Y9Z A;  2IGN A;  4LIV A;  3VSL A;  4B1R A;  3TMO A;  3O6B B;  1LM1 A;  3BTI A;  2LD5 A;  3MD2 A;  4LG3 A;  1YO5 C;  4OPV A;  2MC4 A;  3CUQ A;  1QRY A;  1TTY A;  4IX7 A;  3JRI A;  3BR5 A;  5DTD A;  2CV2 A;  5GTI C;  5H5J A;  2HKX A;  3BG6 A;  1IGN A;  1G3S A;  1WHU A;  3ZQF A;  2WZN A;  2INU A;  4HNT A;  1ZM3 A;  5B1A H;  3LO8 A;  4X7D A;  2VQL A;  3PUF A;  4JBA A;  5E1Z B;  1KYW A;  4B3A A;  1SMY F;  2P5V A;  3UNG C;  1JGS A;  3MHP A;  3JAM Z;  3FHZ A;  3N90 A;  1QRB A;  5JHF A;  3QRF F;  1BW5 A;  1MSF C;  4MQV A;  4A69 C;  2HDW A;  3G05 A;  3DU6 A;  3L9F A;  5CQG A;  3RYP A;  4DNC A;  1HBX G;  4RCY A;  3BR3 A;  4KKS A;  1RR8 C;  4QVJ A;  2ZJP F;  3FKI J;  4UZF A;  1R4N B;  2M4G A;  2RC6 A;  3P4G A;  1R1T A;  2HNH A;  2EV6 A;  2EZK A;  2GOM A;  2M8E A;  2K5C A;  2VBU A;  2XGD A;  1FEX A;  2QA4 B;  1UD4 A;  1IA5 A;  3HOT A;  4H9G A;  2UZK A;  5DS9 A;  2ZL6 A;  1BHE A;  4HE6 A;  3A01 A;  1R5G A;  4P3Y A;  1WH5 A;  5ICE A;  3H36 A;  1R5N A;  4UAJ A;  2K9Q A;  3IP4 B;  1GAW A;  2RN7 A;  3SYJ A;  2VQG A;  2QE7 A;  2NNN A;  1EF4 A;  1GV5 A;  4AF6 A;  1NRK A;  4YZ0 A;  2CK3 A;  3V7S A;  3JTH A;  3CC2 I;  1UD3 A;  3E97 A;  3MEX A;  1OFD A;  3CCU B;  3K70 C;  1JT0 A;  4JX6 A;  4BE2 A;  2W82 A;  1K61 A;  2V9P A;  4QVA A;  4OOI A;  1OHH A;  1DQU A;  1M1E B;  2NTP A;  2IVM A;  5LEJ A;  1Q7Y D;  3JQR A;  4RGU A;  1Y39 A;  2YU9 J;  2HI3 A;  3BC8 A;  2XPV A;  5ILU A;  4UZE A;  1K9M D;  5KAF C;  1TSP A;  2V1N A;  1T2K A;  1K6O A;  2HOT A;  3FPK A;  3E5U A;  5IYC J;  2DT6 A;  2E35 A;  1BW6 A;  2LF7 A;  2QCO A;  3PQK A;  2CG4 A;  4BQN A;  1MMD A;  2LC2 A;  3IRR A;  1CF7 B;  4OIN F;  1GDT A;  4P96 A;  1A31 A;  3FIW A;  2Z1D A;  3A8K A;  2XAU A;  4F3Q A;  3GXO A;  2XF7 A;  2DCU A;  4Z4R A;  4M74 A;  5LGN A;  1N0V C;  3LNN A;  3G73 A;  3LFK A;  1TWF J;  2F4M B;  2PX9 A;  5IP6 A;  4P22 A;  4E7Z A;  2R7R A;  3QPH A;  3R6K A;  3A2K A;  4I76 A;  2DOD A;  2NPF A;  1TYU A;  2VOP A;  2B7B A;  3BP8 A;  5LBQ A;  4P12 A;  1X3W B;  4Z4Y A;  1AIP A;  4UVA A;  1EP2 B;  4RDU A;  4HF0 A;  2F3L A;  1O3R A;  3HJE A;  1YS6 A;  2X8K A;  1JNY A;  2J8K A;  2CSO A;  4G7H F;  3OZV A;  3U2R A;  1FYM A;  2GA1 A;  2E5N A;  3W6K B;  1LUJ B;  2M3A A;  3TH0 A;  3A35 A;  3BY1 A;  2JIZ A;  1VQ9 B;  2Q6O A;  2H8W A;  2OF7 A;  2A5Y B;  1R36 A;  2X1D A;  1WZ2 A;  5IPA A;  4RB2 C;  1N8R D;  3OYN A;  3D1N I;  1ZRD A;  4EW9 A;  1AMO A;  2HYF A;  5FFZ A;  4IOC F;  4KA4 A;  2DA6 A;  3COA C;  3HOY J;  4UUS B;  2E2J J;  5FRM A;  4V2F A;  5M5W J;  2WY8 Q;  3PNT A;  2FE3 A;  1R9T J;  5F4J A;  1OOC A;  4BBR J;  2QBY A;  1FBS A;  3LSK A;  1W0U A;  1Y0R A;  2CND A;  3GTQ J;  3PVD A;  3CLQ A;  3HOW J;  2HQR A;  3HL2 A;  5A8A A;  1SFX A;  2PYH A;  4OPW A;  1Z91 A;  4OAY A;  4I0A A;  2LY9 A;  3B02 A;  3ECH A;  1APL C;  1OCT C;  4OIQ F;  2NV4 A;  4U4B A;  3M1C A;  5CDF A;  2CW7 A;  2CO5 A;  2OCE A;  2ISZ A;  2CWE A;  4XM3 A;  2J5O A;  4C3I J;  4F93 B;  3OIO A;  4GRI A;  3VFZ A;  1KK1 A;  5BQT A;  2FD5 A;  1OGJ A;  1Z7U A;  1ZHF A;  2IS2 A;  1W0K A;  5HS8 A;  4QUZ A;  4XBF A;  3A0B C;  1X3U A;  4IHV A;  3A03 A;  2VKD A;  4MIM A;  2K85 A;  3NE5 B;  1VLO A;  1Q9S A;  3G4S B;  2QWW A;  3LQR A;  2BY1 A;  2V9V A;  2PMZ A;  4XLA A;  2D74 A;  1OCR H;  3S16 J;  2AHO A;  1LPQ A;  1C0W A;  1W0J A;  2LTP A;  1MDM A;  3BCD A;  4DYC A;  4DIQ A;  5M5Y J;  5HOO A;  1QU3 A;  2P7V B;  3HGY A;  1P7J A;  1XS9 A;  2C6Y A;  3OSG A;  5JMC B;  3D26 A;  1STZ A;  2M5W A;  4E7I A;  1F9N A;  1I39 A;  3WTX C;  1A35 A;  1IDZ A;  2STW A;  4BUP A;  1TWG J;  2M45 A;  2DER A;  3CJQ B;  3MMY B;  1LLZ A;  3WHB A;  1NK2 P;  5J47 A;  2DT5 A;  2JJ1 A;  1PJR A;  4L18 B;  3KZZ A;  3HGG A;  2L7F P;  4B8X A;  1R5H A;  4I84 A;  3CCE I;  2V1U A;  5C1E A;  2F2E A;  3CUQ B;  3HAG A;  4JMQ A;  2XHK A;  1LFP A;  2HCJ B;  4Y9R A;  3MZH A;  1USS A;  2OUM A;  2DYI A;  2RRE A;  3ZMV A;  4RAG A;  4ACA A;  2D1V A;  3K2A A;  3PIP F;  2ZXH A;  4M9S A;  2BEO A;  2ZSI B;  2EK5 A;  3CCQ I;  4M6X A;  4TMW A;  2QKL B;  4Z6Y A;  1A6I A;  1BN8 A;  4LB6 B;  1IN8 A;  2OC6 A;  1R1V A;  2X3U A;  3FXL A;  4BXX J;  5HNF A;  2EV5 A;  3NWT A;  2FU4 A;  3CJR B;  3KET A;  2EIL H;  3W5U A;  3S2D J;  4XSX F;  2EIX A;  3Q39 A;  2MD5 A;  4ZJZ A;  4F52 A;  2BYV E;  3LMM A;  1MJA A;  3CRZ A;  2BGC A;  5ICF A;  1W2B B;  2LBF B;  3CCR B;  2PG4 A;  3GVA A;  3NRV A;  3U6K A;  5FKO A;  2JJ7 A;  2HVQ A;  3PFI A;  2UV1 A;  1AKH B;  3KPH A;  4PC3 A; 
#chains in the Genus database with same CATH homology
 3OAA A;  1X1C A;  3U21 A;  5IK2 A;  1X1B A;  3T51 B;  2D3N A;  2KRH A;  2VAS A;  2MAB A;  2E1M C;  1K5C A;  3E0J B;  2A6T A;  3EUH C;  4PSX A;  1PLU A;  2ZXI A;  1UAA A;  1WJE A;  1VLY A;  1D0Y A;  4NK8 A;  4HNU A;  3LSM A;  3OWT A;  2UWM A;  1U0J A;  1X4O A;  2O0W A;  1D0Z A;  2KHM A;  3GQ7 A;  3GQ9 A;  2JVG A;  3RPU D;  2QXZ A;  3GQ8 A;  4OJP A;  4OJ6 A;  2ZTN A;  3HPH A;  1RMG A;  1NHC A;  1ERD A;  3FBN B;  2VJ5 A;  2WSS A;  4L8J A;  3L2V A;  2WJY A;  3RTR A;  2XC7 A;  3OMY A;  4II2 A;  2DXI A;  2WZP P;  4DGW B;  3H35 A;  4RM2 A;  1DGW Y;  2A5W A;  1MNE A;  1W9X A;  1O8K A;  1PXZ A;  3DDY A;  4ZC3 A;  4KIT B;  3J7A Y;  1HVX A;  3OYH A;  1UD6 A;  3A4C A;  3KEW A;  3ZQQ A;  2PJR B;  3S8P A;  4CCJ A;  2UVE A;  1V5G A;  1JI8 A;  3SYT A;  2WB1 A;  5LFA A;  2E60 A;  3VYU B;  4U49 A;  1E1Q A;  3OOU A;  3VSV A;  1YX5 A;  2R7X A;  2VJ4 A;  2KL4 A;  1YE9 A;  4ITV A;  1WFX A;  2NTB A;  2K9L A;  3EUK L;  3FBI B;  4PUS A;  3QOD A;  2V6E A;  2HZD A;  1H8E A;  4JMQ A;  3OYE A;  4DNT B;  1OGM X;  2HPM A;  1KTW A;  1J09 A;  1WTH D;  1LDK B;  2E1M B;  3A3B A;  2D3L A;  2W7N A;  2X6W A;  2CUZ A;  3I3L A;  4RLF A;  3OOC A;  4Z03 A;  2NT6 A;  3RQ4 A;  3S32 A;  2NZM A;  3FPP A;  2R7S A;  1DBO A;  3MKW B;  3G2B A;  2MD0 A;  1E79 A;  2VXD A;  3LSH A;  2F5V A;  4RLQ A;  3TL4 X;  3W2W A;  3OYC A;  3VMV A;  2P0W A;  2HLD A;  5KHD A;  2M5S A;  5DN6 A;  4B43 A;  3GVK A;  2WA0 A;  3BG7 A;  2V7F A;  1HZE A;  4W8S A;  4YZQ A;  3IAS 2;  1R6R A;  1TZL A;  1BPL A;  4CCK A;  3ZPP A;  2GJR A;  4CA0 A;  3DTI A;  3K4M A;  4XLE A;  3DPU A;  1D1C A;  5HVQ C;  2I8D A;  4X0G A;  1GQ8 A;  2O1D A;  1X0C A;  4OZY A;  2R7O A;  3FKJ A;  4C30 A;  1G59 A;  3WQZ A;  2XZL A;  2Z8G A;  4E0F A;  1VZ0 A;  3HUG B;  3VR6 A;  2KZV A;  4YEJ A;  1IDJ A;  2IS4 A;  1KMH A;  3BLY A;  3GQA A;  4W8Q A;  2KRC A;  2QY1 A;  2GJK A;  5LD2 C;  1SKY B;  3ZGK A;  3PNV A;  2VKH A;  4W8T A;  1H80 A;  1E43 A;  2KMU A;  3OYB A;  4P1W A;  3MKY B;  3DTE A;  3H5R A;  3AL0 C;  1NG7 A;  2CS3 A;  2NT9 A;  2AQF A;  3T9G A;  4BU2 A;  3ZSC A;  2UVF A;  2ZZG A;  1W36 D;  4YZX A;  2X1E A;  4PFO A;  4XKB A;  2X1C A;  2L2O A;  3K10 A;  2IGO A;  4JQF A;  4B48 A;  5FRN A;  5CQE A;  2VJJ A;  1LVK A;  3OYK A;  4RM3 A;  3K4K A;  4CCM A;  1O8I A;  2ODL A;  2IS6 A;  1O8F A;  4N4N B;  2ZZQ A;  4J00 A;  1TT0 A;  3K4C A;  2PYG A;  2F4I A;  3A1Y A;  3HG9 A;  3OS0 A;  1OB0 A;  1QHH D;  4E7S A;  2ZTG A;  1PKV A;  3M8J A;  3FDY A;  4Y3O A;  1WJD A;  4NUB A;  3OEH A;  4FAS D;  1BMF A;  3LFU A;  3OIP A;  2QKM B;  3T56 B;  2ZSH B;  1JRG A;  3CMM A;  1D1B A;  4HPQ A;  3ZIA A;  4NQW B;  4BE0 A;  2LBF A;  4XN3 A;  1WMR A;  3E1S A;  4J01 A;  2VJI A;  4DBQ A;  2O5R A;  3VMW A;  3K6G A;  3SEZ A;  1Z21 A;  3HXL A;  3KEY A;  3BCF A;  2KP6 A;  2WPD A;  1RWR A;  3N05 A;  4CCO A;  4KT6 A;  1PE9 A;  2JVH A;  1OGO X;  1UD2 A;  3PFY A;  4PK4 A;  3OYA A;  3VDX A;  3DEE A;  4DOZ A;  2Q1Z B;  2JDI A;  2L7K A;  1IB4 A;  3VSK A;  4ASU A;  3B8Y A;  1OFM A;  4QPQ A;  1MMN A;  2NOJ B;  2VQC A;  3DKX A;  3W2V A;  1WJA A;  2R7V A;  3K4B A;  2WY7 Q;  4E7K A;  1V5E A;  2VPL A;  1QCX A;  4B3G A;  3H5N A;  2V7Q A;  4OJ5 A;  1HA8 A;  5HKK A;  2XZO A;  2L5Q A;  1COW A;  3K4J A;  2IGM A;  2F43 A;  2HQA A;  2X3H A;  4ZYA A;  4XL9 A;  2HVR A;  2CUJ A;  3MKZ A;  4Y4R A;  4BGD A;  2ZZE A;  2LY2 A;  3HKZ A;  1O8D A;  4XOP A;  3OR2 C;  2BVM A;  1G8X A;  1VBL A;  2VB6 A;  2PJR A;  3K70 D;  4ZDL A;  2BW3 B;  1SAU A;  2W1O A;  3GQB A;  3W3C A;  4U87 A;  4IQ4 A;  2Z6B D;  3BC9 A;  3FY3 A;  1K6Y A;  3PUB A;  4NNJ A;  3SDB A;  4ZDP A;  3L2Q A;  1SFK A;  1P9Q C;  2IS1 A;  2V31 A;  1OFL A;  4RMN A;  3OFN A;  4QPO A;  2X6Y A;  2NSP A;  4P5O A;  4YZA A;  4YEL A;  5KCM A;  2LH9 A;  1QJV A;  4Z05 A;  3H9G A;  2DT7 B;  1VF7 A;  2V4J C;  2CV0 A;  3GBG A;  1PYV A;  1YX3 A;  4C9Y A;  4OJL A;  4KIS A;  3HC7 A;  3SZG A;  4Y33 A;  4B47 A;  4BJ5 C;  4U7B A;  3S93 A;  4ZTF A;  2R4G A;  1X4P A;  4TSF A;  5CPR B;  2GOX B;  2XDV A;  2X53 S;  1E0E A;  2IQ7 A;  1T0F C;  3OS1 A;  2MFZ A;  4DK0 A;  4E4H A;  4PJM A;  1BR4 A;  3GVJ A;  4LIU A;  2GK7 A;  2VBM A;  1QHG A;  3LSG A;  4BEH B;  4BJT A;  3OW7 A;  2VBK A;  4C2L A;  4ANJ A;  1WJ5 A;  2X6X A;  3FHN A;  4H4K C;  2VLA A;  1UD8 A;  1VJS A;  4FXU A;  3S3M A;  2DOA A;  4OWR B;  4BAC A;  3PNY A;  3UW0 A;  3T53 B;  5TGT A;  4Z1M A;  3LL7 A;  4XKW A;  2IGK A;  2LG4 A;  2LRD A;  4TKO B;  4PMH A;  3K4N A;  3AKZ A;  4BS9 A;  3CES A;  4PJJ A;  1MND A;  2HU9 A;  3DTK A;  3HOS A;  4OJO A;  1Z3Y A;  1IRX A;  1DGR M;  4JOM A;  2DCE A;  3KRG A;  2DIE A;  2INV A;  2Z16 A;  4AVZ A;  4G7X A;  4DK1 A;  3OL4 A;  2O0V A;  4ZTJ A;  2WAF A;  2RQQ A;  1W36 C;  1I8D A;  4GQN A;  2L9N A;  3GVL A;  3QYF A;  4FET A;  2CW8 A;  4XR6 A;  2XOK A;  4G6I A;  4NC7 A;  1CZF A;  3VYS B;  2OV7 A;  2W00 A;  3OR1 C;  4II3 A;  4BL0 B;  3VST A;  2VXZ A;  3PL8 A;  2PEC A;  5C1C A;  4CCN A;  4MR0 A;  1D1A A;  2IGN A;  4LIV A;  3VSL A;  3TMO A;  4KKU A;  1UD5 A;  4DNR B;  1EFR A;  3BH4 A;  3K4L A;  1BR2 A;  3B90 A;  3MD2 A;  2BOL A;  4LG3 A;  3DQV C;  4PJN A;  4D9J A;  2MC4 A;  4CZC A;  1V0F A;  3FKS A;  2KPM A;  4IX7 A;  2XF5 A;  3OYI A;  4DJA A;  2CV2 A;  4XLF A;  2AQE A;  3BG6 A;  2F1M A;  2JSP A;  3UR3 C;  2INU A;  4HNT A;  1XG2 A;  2X51 A;  2VQL A;  1MMG A;  3RSN A;  1WP6 A;  1EA3 A;  3PSF A;  3H9Q A;  3ZXS A;  2XND A;  3OYG A;  3NWS A;  4F92 B;  1E3Z A;  1BOB A;  3UNG C;  4F55 A;  4DBR A;  3ONQ A;  2LYC A;  5JHF A;  2IXS A;  5AMV A;  1O8M A;  2HDW A;  1WJF A;  3DU6 A;  5CQG A;  3G05 A;  1O8H A;  3A3G A;  4KKS A;  4XKV A;  2M4G A;  4C2U A;  2HNH A;  4YRV A;  2GOM A;  1IA5 A;  2K5C A;  1UD4 A;  1MW7 A;  4CCL A;  4E7H A;  4XNF A;  3OYD A;  3HOT A;  3F9K A;  2W4S A;  2BVL A;  4TT3 A;  1BHE A;  3DLA A;  4PSW A;  3DWL E;  1OLT A;  2CMP A;  2QX3 A;  2E1B A;  1T95 A;  3IP4 B;  2R7W A;  4B3F X;  2VIX A;  3AL0 B;  1N78 A;  3B4N A;  2VQG A;  2R7T A;  2QE7 A;  2X85 A;  1WPC A;  4ZDO A;  2ELJ A;  2LZJ A;  1NRK A;  2KVO A;  2V4D A;  1JTA A;  4HIZ A;  2KDO A;  4YZ0 A;  2CK3 A;  3L2R A;  4R79 A;  2XGJ A;  4XD7 A;  4IKF A;  1T5E A;  2VL8 A;  1UD3 A;  1EE6 A;  3K70 C;  4CSW A;  4BE2 A;  2M4K A;  2W82 A;  4AU7 A;  2WAQ A;  1WJB A;  2LRE A;  4XMY A;  4BE1 A;  1OHH A;  1AIR A;  1DQU A;  2NTP A;  2BW3 A;  3BCB A;  3OYF A;  5FL7 A;  3H5A A;  3BC8 A;  3OYL A;  4EAT A;  2KQR A;  2V1N A;  2JA2 A;  1S9H A;  2CH0 A;  1LKX A;  2DT6 A;  2E5Z A;  3PSI A;  4PFP A;  4HRI A;  4B44 A;  1E3X A;  2O17 A;  4BQN A;  1MMD A;  2LC2 A;  4XOR A;  3AFH A;  2Z1D A;  1Z3X A;  4XLH A;  4HST A;  2Q2E B;  1DBG A;  1KCD A;  2XAU A;  4F3Q A;  3BCA A;  2RNG A;  2XF7 A;  4IQJ A;  3LNN A;  2M7A A;  1UEL B;  1X19 A;  4P22 A;  4E7Z A;  2R7R A;  1MAB A;  3DPL C;  3TBI A;  4UZU A;  1N75 A;  3A2K A;  1ZEL A;  3IAM 2;  4G7W A;  3QOE A;  3EPZ A;  4KJZ A;  4BEH A;  4MXN A;  2NST A;  3OIQ A;  5HNH A;  2HPI A;  4XKC A;  1Y56 A;  2X8K A;  4CUG A;  2Y0S A;  3C2G A;  3EUA A;  2HVS A;  1V5F A;  1X1D A;  2E5N A;  5HLT A;  2M3A A;  1X1A A;  3HPG A;  1D0X A;  3A35 A;  2VBE A;  4OAZ A;  2JIZ A;  1GLN A;  2V9K A;  3KYL A;  5CKT A;  4HSR A;  3CZ6 A;  3QYB A;  2X1D A;  1OR7 C;  4BDY A;  2R7Q A;  3OYN A;  3SUC A;  2EWE A;  4C2T A;  4EW9 A;  1NG6 A;  2FUG 2;  3WWG A;  2V26 A;  3VWB A;  1N77 A;  3PJR A;  5FRM A;  1RU4 A;  2R9V A;  1KCC A;  5FRO A;  2WY8 Q;  3PNT A;  1OOC A;  4PJL A;  1IDK A;  3OY9 A;  1BR1 A;  3C2H A;  3LSK A;  3JU4 A;  3GRH A;  2K9M A;  4AYB A;  3HL2 A;  1E1R A;  2PYH A;  4OAY A;  2WAE A;  3SEQ A;  3ZRG A;  4XON A;  2O04 A;  4BJ6 C;  4W8R A;  2L9S A;  4U4B A;  3M1C A;  5CDF A;  4NK6 A;  2CW7 A;  4NC8 A;  4BDZ A;  3CP2 A;  2LOO A;  4XM3 A;  3IUO A;  3W2A A;  4F93 B;  4Z06 A;  4GRI A;  2BSP A;  1W0K A;  4CH7 A;  1FMW A;  4B3X A;  4BQO A;  3I9V 2;  3H0D A;  2IS2 A;  1I18 A;  1O88 A;  4OZZ A;  2VKD A;  3NE5 B;  2WAD A;  3OYM A;  2GJP A;  3ZCO A;  3ZR8 X;  2NTQ A;  1Y6I A;  4F91 B;  3OYJ A;  3OE7 A;  4IZZ A;  2PMZ A;  4URR A;  3LMW A;  3EQN A;  4XLA A;  1V0E A;  2XSJ C;  3RCO A;  3H94 A;  4N4O B;  2WJV A;  1W0J A;  2ZFU A;  3CP8 A;  1AA7 A;  3BCD A;  2JJ2 A;  5HOO A;  4DIQ A;  1QU3 A;  2KLO A;  2M7B A;  1WJC A;  1FX0 A;  3LSI A;  4XN0 A;  4YXW A;  2UUZ A;  3OEE A;  4E7I A;  3VYR B;  1O8G A;  3S3N A;  4BXF A;  3D5S C;  4BUP A;  4D1Q A;  1Z7L A;  1UG0 A;  4HEA 2;  3CJQ B;  3MMY B;  4XOT A;  2R7U A;  4KKT A;  1BLI A;  3VYT B;  2JJ1 A;  1PJR A;  2LY1 A;  2MYS A;  2Z2S B;  2CV1 A;  1K28 D;  3OPO A;  3DU5 A;  1MMA A;  1KON A;  2XF6 A;  4G6T B;  4I84 A;  5C1E A;  2W6J A;  4HG2 A;  3HAG A;  1O8J A;  2M0M A;  4MLO A;  2GK6 A;  1LFP A;  3H9J A;  4XQF A;  2OUM A;  4E6K G;  2RRE A;  3KX2 A;  4LIT A;  1DP3 A;  2ZXH A;  3QYE A;  2ZSI B;  2JUG A;  2QKL B;  3DPT A;  2W6I A;  1BN8 A;  4HWV A;  1HG8 A;  3DKY A;  4E7L A;  2OC6 A;  5KNL A;  1FMV A;  3D5L A;  5HNF A;  3NWT A;  3CJR B;  1O8L A;  3JUR A;  2F6C A;  1NBM A;  3EQO A;  2K3P A;  4E7J A;  4ZJZ A;  4F52 A;  1KZL A;  3V42 A;  3ZPN A;  2VQH A;  2CFO A;  3LMM A;  3OS2 A;  3S3O A;  3L2U A;  2DJI A;  4BQQ A;  1H8H A;  2WBM A;  1O8E A;  3VSU A;  3CF2 A;  2LBF B;  2ZZF A;  3D5R C;  2HVQ A;  3OL3 A;  2UV1 A;  4XLC A;  3L2W A;  2XZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...