4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
2UVFA 2ODLA 1DBOA 4OJ6A 3VSVA 1O8JA 1EE6A 4YZAA 4XQFA 1O8MA 4XOTA 1K5CA 4XNFA 2X6XA 4NK6A 1OGMX 4XLAA 2IQ7A 2X6YA 2VBMA 2NTBA 4URRA 4YZXA 4XLEA 3B4NA 2QXZA 3LMWA 2NTPA 2INVA 4YZ0A 4Z06A 4OJLA 5C1EA 1O8FA 2EWEA 3GQ8A 5AMVA 2PYGA 3GQAA 3T9GA 1X0CA 2O04A 4W8SA 4XLCA 1O8KA 4XN3A 4XONA 4Z03A 4XLHA 3ZSCA 2VJJA 1PXZA 1O8EA 3JURA 1RWRA 1PLUA 3EQNA 1IDKA 4OZZA 5C1CA 3VSUA 4XKVA 1OOCA 2QX3A 4MXNA 1HG8A 4XL9A 4YEJA 3EQOA 4AVZA 2VBEA 1IDJA 4NK8A 1XG2A 4HWVA 3VMWA 1KCDA 1IA5A 1OFLA 2VJIA 4XORA 2PECA 1WMRA 2X3HA 2O17A 3SUCA 1O88A 4MR0A 3KRGA 2QY1A 1QCXA 2PYHA 3GRHA 1PE9A 1BHEA 2INUA 4I84A 4W8QA 3UW0A 4W8RA 2VBKA 1H80A 4OZYA 3GQ9A 4PMHA 1NHCA 1O8GA 2Z8GA 4YZQA 2X85A 1GQ8A 4XMYA 2O0WA 4XR6A 3VMVA 3B8YA 1O8LA 2O1DA 1VBLA 4OJ5A 1DBGA 2O0VA 4XLFA 4U4BA 4OJPA 2NTQA 4XKWA 1O8HA 1OFMA 4W8TA 4XM3A 1QJVA 1OGOX 3VSTA 2NT6A 3WWGA 2NT9A 3GQ7A 1JRGA 3B90A 1IB4A 1O8IA 2NSTA 4Z05A 2NSPA 1KCCA 2UVEA 1AIRA 4XN0A 1CZFA 1RMGA 4U49A 4XOPA 3FY3A 1O8DA 2BSPA 4OJOA 1RU4A 4YELA 2X6WA 1JTAA 1BN8A 2NZMA 3ZPPA 1KTWA 4C2LA 4EW9A
chains in the Genus database with same CATH superfamily
1HLVA 4X8IA 4B4CA 3WTYC 2EA2A 4IOAF 4TMVA 1UJ8A 1RQRA 1EE6A 1BI2A 1GUUA 4M1KA 2V9VA 3RKQA 1K5CA 2ETHA 2CGPA 4UV8A 3F23A 1PUFA 4XNFA 2VONA 3KL9A 3GMEA 4MYTA 1OFEA 3MFKA 2LBFB 1OGMX 5LHHA 1G7RA 2LK2A 4N9HA 4CA0A 1Z77A 1Q81D 4TKOB 1MH4A 4XRSA 2P81A 2Y0SA 3TMOA 4AYBN 5D4RA 3BOQA 2GJKA 2L4AA 1CQXA 4PC1A 1VQ7B 3CCVB 3CD6B 2D3NA 1KU9A 3AVYA 1MNMC 5IP6A 4HYEA 1N25A 1E62A 3I54A 4HSTA 4ENJA 3FHNA 2OK7A 4W8SA 5L3DA 3I58A 2DTZA 3DEUA 2EBIA 1LVAA 4L9JA 4ZYHA 1ERDA 1IC8A 4M3DA 2HR3A 2XVCA 4R8HA 3BZ6A 1PLUA 3DU1X 3E6DA 3HOSA 4YCQA 3OR1C 2ZSIB 1JJ8C 4G5GA 4Y17A 3F8NA 1ELOA 1OCTC 2WWYA 1FX0A 2RDPA 2XUBA 4NB5A 3KZZA 3MKLA 5HDKA 3WBKA 1N0UA 1MD0A 1TYVA 3JRHA 2FVGA 2YWHA 1E3HA 1KCDA 3S1MJ 1ON1A 3Q0WA 1HXDA 1W7PA 2DA4A 3S2DJ 2HS5A 2MYSA 1A36A 4DBRA 3BR0A 2LSOA 3HM5A 1WHUA 1R22A 4DOZA 2O8KA 1FNMA 5F64A 2X53S 1JNYA 1KJZA 2XSJC 4M2LA 3FM5A 1DG1G 3I59B 5DM6F 4F3QA 3OYKA 3G71I 2VLAA 5FLXK 1DABA 5HS9A 5JFRA 3O6BB 2OTLB 4LBWA 4C3HJ 3QFTA 2NVUB 2ZFWA 1OISA 3K1MA 4TN1A 1E63A 3Q6QA 2QN6A 2LZJA 3R6KA 3I9V2 3LFUA 5EYRA 3WU0A 3LL7A 2KLOA 4QHYA 4UAJA 1H88C 2VOOA 2JRTA 3WTWC 1T98A 2Z9OA 1BR1A 4MTDA 4U88A 4WK8F 1WKMA 1N8RD 1ORKA 3FK7A 3HOXJ 4AM3A 3V7AA 1YS7A 4CDGA 5GADJ 2HEOA 4Y52J 3QSYA 2DCUA 1MIJA 3SYTA 3QE2A 3I4PA 2OUMA 4JK1X 3JREA 1X1BA 2A6EF 3I71A 4JOMA 1CGPA 2NSPA 4KJZA 4OAYA 3BR6A 3DCFA 4CCOA 2OBRA 4LMYA 3OY9A 2TRTA 4IJAA 1AOYA 1W7PB 3CZ6A 3F8BA 4RGSA 4OU0A 5CVRA 4MIMA 5K7HA 1U2WA 2O0YA 2C4UA 1T8IA 2BYVE 4M6XA 4L8JA 5J3OA 2X1CA 1NHAA 1MSEC 1PJ5A 3OOCA 2NS8A 2GJRA 1Z67A 3FXRA 3EUKL 3ESWB 3H5RA 2NZMA 2CH0A 4XBFA 2HZDA 4LJZF 2Z33A 3N05A 1T33A 2MA3A 2M0MA 4IVNA 5FRMA 4AIHA 2QUFA 2VODA 3QODA 4AIDA 1YITB 3HKZA 4ZH4F 4ZTJA 3FKIJ 1MJAA 2A6HF 5F1JA 1WP6A 4IKFA 3M9AA 1QGAA 2DMTA 3AFHA 1H85A 2ZZQA 1WI3A 2F1MA 2XIGA 5JLWA 5EEGA 3H3UA 2RKHA 3K4JA 3HPHA 2DIEA 3RDIA 1EKEA 1VQ7I 3V7RA 3CCVI 4YDTA 2R7SA 1YQAA 2LTPA 1EZGA 3KP5A 3HOZJ 5JR3A 1RR7A 2VQCA 2E2HJ 3BC9A 4FQGA 5LRSA 4J00A 3ABMH 2UXNA 2VUMJ 1SKQA 2V7WA 5CPRB 4DNTB 4C2UA 2ECCA 3A0HC 4CCKA 2QZAA 4M3FA 2COMA 3RKWA 2V1UA 2XAJA 1SANA 4IPAA 3BG9A 4JX6A 2ZCWA 2CUEA 3TL4X 1ZREA 2R7TA 3JURA 1Z6TA 3S1QJ 3K70D 1ETVA 3DPTA 3FKJA 3H0GJ 1IDKA 2HOEA 2GBYA 3VYTB 5K1YA 2H1LA 1DP7P 2FSWA 2LP0A 5KVRA 1FBSA 5DUIA 2HKXA 4ESBA 3U2QA 1STZA 4WF2A 1QZZA 3H5NA 1LQ1A 4RD4A 3HRMA 3HUGA 2Y75A 2HOSA 2DFHA 2MGQA 1W36C 4AVZA 2PE3A 2VJ4A 2M5SA 2D5VA 3DFGA 3PNYA 2F4OB 3CCMI 1FOXA 3BR5A 4G94A 3BJ6A 2MSYA 2IW5A 3S1RJ 4PJMA 1FT9A 5DV5A 1ZM4A 2K02A 4OPVA 2KRCA 2VQGA 1JHHA 1VQLB 4TMTA 2OTLI 4P5OA 4D9JA 2IPQX 2L3DA 2F4MB 4CXFA 1F4KA 4Z4RA 3OOUA 4UHTA 1OB5A 2HYFA 2JSCA 2HDDA 3GZ5A 2BW3B 3QWLA 3PSZA 3CJQB 3FX3A 2XGDA 3TDUC 1K4ZA 1VLYA 3IV5A 2O0WA 1DQUA 1TC3C 2B9SA 3ASPA 3B8YA 2XTWA 1T56A 2VBTA 3P27A 1RKWA 3C2HA 3N90A 1QA2A 4D7NA 3F3XA 4KUMA 2NTQA 2NVTJ 2H09A 1X4OA 2I8DA 4KT5C 3ASSA 2HU9A 4RM0A 1D2EA 4W8TA 1L1IA 4M72A 1JJ6C 2O6GE 3ASTA 3PA2A 1BC8C 2NT6A 1PVEA 2F2EA 4Z4WA 3IAS2 2L02A 3HUGB 4G12A 4C3JJ 2Y9ZA 1R00A 3JQPA 3OZUA 5D4SA 4PFOA 2ACJA 2JDIA 4ABZA 2DA7A 4UZEA 3WQZA 2X4HA 1EA3A 3IH3A 2Q6OA 1KQ9A 3IC7A 5F27A 1FOYA 1SFEA 2P7VB 4OIPF 1WOOA 2DQLA 1ZRDA 1SAXA 1NRKA 4IX7A 3TP3A 2BM6A 4IOCF 2CNDA 2CQQA 2TDXA 4LBYA 2O7OA 4KKTA 2L5QA 3VYSB 4Y9RA 2DT6A 3RTRA 5EEAA 4B3GA 5KCMA 5F04A 3CCQI 2BY1A 3S15J 1YITI 1XSVA 3ISPA 2JJ1A 3OV8A 2XEXA 2Y30A 3GTQJ 1XDSA 1O8MA 4BY7J 1D8JA 4YXWA 4NDLA 3EYYA 2OBSA 3C7JA 2ZB9A 2WV0A 4Z4ZA 3OSFA 1USTA 2E34A 2NRAC 2RREA 5FLMJ 2KJCA 4E7JA 4I6ZA 4XLEA 5LEJA 5DS0A 3HHGA 4Y4RA 1ZRCA 1FOKA 1V55H 2B7BA 3MD2A 1YE9A 2BXZA 3NAUA 1VQ8B 2EFQA 3GVJA 4B4DA 4YRVA 3I55I 2QEXB 1RKTA 4EJUA 4BY1J 1W34A 3GQAA 1NK3P 4LIVA 5J8FA 3RJPA 1T6SA 3KEWA 3CTAA 1FP1D 2H8WA 4XLCA 2R7UA 5KSWB 2L7MP 5IYNA 4PGOA 3SQNA 4P1WA 2WY7Q 1O8EA 3BDDA 1PP7U 2G0YA 2CYYA 4OZZA 3NQOA 4OOIA 4CSWA 1FX7A 1RETA 1FTZA 1QFYA 2V6EA 4A5NA 2GWRA 2K9SA 1XTAA 2F48A 4MEYF 1TYUA 2K9NA 2DJNA 1AA7A 3ZN1A 2VPLA 3TBIA 3BCDA 1O4XA 4NK8A 3GYHX 2O8XA 2CQNA 1X19A 3FXMA 2OK8A 4XLPF 1JA0A 4ZGQB 3A2KA 4PCQA 4CCMA 3RY8A 4E7IA 3IAM2 1EFCA 1K4SA 1FEXA 1W0JA 2XZOA 2Z3YA 4Y3OA 4A3JJ 1QCXA 5KAFC 3UW0A 5F0HA 1V5EA 2VT3A 3ZBTA 2AO9A 1O7LA 2GOMA 2RAEA 2IGOA 4EGYA 1N06A 4QFMA 1HDDC 2WAFA 1HQCA 3OKXA 3KEOA 3DF8A 3I64A 1VQNB 4GQNA 3ZUGA 4EGZA 2BMWA 3H9GA 2VOPA 2BXYA 1E3OC 2W4SA 4PJNA 5EG0B 4G7HF 2EFWA 3T0YA 1WJDA 1OCZH 2CMPA 4CYCA 3CUQA 3E0JB 3QPTA 4IZZA 3GTKJ 2V7FA 5HODA 3RQIA 1WORA 3MCAA 3F6VA 4UXNA 2ISYA 3WTTC 5LD2C 4IW3B 2V4JC 3CO7C 4HDVA 1V5VA 4HX4A 3GFLA 1U78A 2Z99A 5LHIA 2HQRA 3HJEA 1AWCA 3ASRA 3LVBA 1IB4A 5CVIA 4HBLA 3OYAA 2E2IJ 2JA6J 2DI3A 1QFJA 3OEEA 1ACIA 2I1LA 2QKLB 2HDWA 3LSIA 1T6XA 4Q7JB 2ADUA 2ZZFA 3BNWA 2C5HA 1Z21A 1VNDA 3AAFA 3DKXA 1T5EA 4CQJA 1E3XA 3BG7A 1CLWA 4FWTA 2EZKA 1S8NA 3LMMA 2VFPA 3KIOA 4P25A 3HGYA 1ETYA 1W2BB 4X7CA 3OJWA 2J8IA 1YW7A 2B63J 1BOBA 1QUEA 4HW0A 4MEXF 2XRLA 2F5VA 2RGVA 1EP1B 2J7KA 5H20A 1O3TA 5L3EA 2ISZA 1ZYRF 4P6YA 2LNBA 1KD1D 1J7KA 4DK1A 2GK6A 4H9GA 3ERED 3DWLE 3R0AA 4H0EA 2K4BA 3FXOA 1GAWA 4OM9A 1QPIA 3ZMVA 4G7XA 2EZHA 2MLGA 3GVAA 4NC8A 1LEAA 2E36A 4GYGA 4CYCB 2X6XA 2EK5A 2O3FA 2W7ZA 2CSOA 2ZMEA 2HQ5A 4IQJA 2BHZA 3GX4X 1Z7LA 2DU9A 2QEXI 2ZZGA 2LVSA 2EB7A 1BOAA 1TVCA 3K4KA 2V7VA 1R1UA 2RC4A 2A5YB 3A8IA 5FL7A 2PMZA 5FRNA 1VQ6B 2GA2A 4GRIA 3BT9A 3RZOJ 2BVLA 4RAYA 1BX0A 5JLXA 2KIFA 3TEDA 3ZQHA 1VQMI 2CRVA 4KNYA 2IS2A 3K0LA 4WXDA 1LNWA 4CCJA 4RB0A 2FBHA 2Y48A 3FBNB 2EIMH 3OS2A 1RWRA 1QQ1A 2ZNYA 1A6IA 2R6HA 3QPHA 4JX4A 2M0CA 1KK3A 2LC2A 5H59A 5JVGF 2CW5A 3MMYB 3RKXA 3SDBA 1I7PA 2ZL7A 2CG4A 2EINH 3E5QA 1HSJA 1S5LC 1NJID 3HZJA 3WTVC 1YJWB 1YJNB 3F9KA 4DGWB 3BH6B 1ZARA 3AG2H 3HIFA 3PFIA 4CCNA 4B43A 3IKTA 3J80Z 1NG7A 3KEQA 3JRDA 3OMYA 3C18A 3ZCOA 2D9RA 5E3LA 4C30A 1QG0A 2LG4A 2Y0SN 1X3WB 3HRUA 2MD0A 1SFUA 4RS8A 5EF6A 1LLWA 2KL4A 1Y8QB 3BZCA 3DKWA 2LY1A 1P7JA 5B5EC 4OOXA 1TWFJ 2RC6A 3FM3A 4PFPA 2KRFA 5KAIC 1JUPA 1D0YA 1VQOI 1KYWA 1S72I 4OIOF 4DIQA 2E1MB 4LLNA 3ML6A 1OCOH 1TNSA 4HX7A 4WCGA 1I6HJ 2DMPA 2A6TA 5GAGJ 4PUSA 2ME6A 2O0VA 4I01A 2VQLA 5LBQA 4Z4TA 1TYXA 4U4BA 2ZBVA 4OJPA 4TV7A 1BJAA 1FJLA 1MBFA 1B72A 4HF1A 1BIAA 4L0ZB 2H94A 3WWGA 5HXBA 3B90A 3S1NJ 3VMFA 4W1UA 4UVAA 2BV3A 3GF2A 2YUSA 1GT0C 2J8KA 3S93A 2KIMA 3GQ9A 1W5CC 1VF7A 4M9SA 2X1DA 1E17A 1FDRA 3S32A 3ECOA 3JRAA 3GWZA 1HCRA 2VBWA 1WJ5A 2WYRA 3L7WA 4RGUA 2CFXA 3SZEA 2HYJA 1Q7YD 4WXCA 1SD4A 5HDGA 2X6WA 1R4MB 1VFCA 1P9QC 4RGXA 3ABLH 3L2WA 3A1YA 3SLDA 2W84A 2P5KA 2K4JA 2WC2A 3UR3C 3HGGA 3QAHA 4DW6A 1VQPB 2XB0X 2M3AA 1SVMA 1O8JA 3TP0A 5DUKA 1PKVA 5GV8A 5M5WJ 3BPVA 3FWEA 1YX5A 2IAIA 3QOPA 4R1HA 2HKOA 4DQ2A 2VBUA 2XOKA 1XGSA 1ETQA 4X0GA 1EF4A 2C4TA 3E3VA 4RM2A 1SC7A 2R7XA 5F6FA 3L2QA 1F20A 2X6YA 2MABA 1KK2A 2ELKA 2VBMA 1OFCX 4RM3A 3SQVA 2VE9A 2C78A 1TT5B 3QOEA 2PI0A 4P26A 1FMWA 1H42A 1ITYA 3EUAA 4TMZA 4LBVA 4GDFA 3F22A 4EJOA 2JUCA 2H1KA 1XCVA 4S04A 1X4PA 4MO7A 1BL0A 1SMTA 1WJCA 3LSGA 1SEUA 3CXCB 3OYFA 4ASUA 2FEZA 2YSRA 2VJJA 1R71A 3HC7A 3WE3A 5GPAA 1KU3A 3C2GA 2DDBA 2CV0A 1W35A 5KK1A 2VNIA 3BTLA 1DDIA 4Q4ZF 1BJKA 4N3GA 3VSUA 1E1RA 4M73A 3CUOA 3JSPA 4I7HA 1YJWI 5CKTA 2E7XA 3HOYJ 1JKRC 2ZTNA 3I3LA 4XKBA 4XL9A 4QVAA 1TTTA 4K1XA 3PA1A 3HKZN 2VT2A 2GXBA 1HF2A 2VBEA 5IK2A 5A2QK 4UUSA 2V9KA 5H6QA 4FE7A 2Z6BD 2GJPA 4II2A 3SZGA 1QRYA 2WSSA 4IHTA 3CUQC 4L9NA 2O17A 2HTJA 2IT0A 2DYSH 2WJYA 2DQRA 3LNQA 2BM5A 3HB9A 1OLTA 5LRRA 4JQFA 4LGWA 3HOTA 3KZIC 1KU7A 1JGGA 3F8CA 3LO8A 3CRZA 1VLOA 4ASNA 2X9DA 5D5UB 3F0CA 3ZR8X 4KN4X 4BEHA 5HVQC 3IWZA 5FFXA 1N08A 2L4MA 4I0BA 5GAHJ 1TP4A 1IGNA 3TH0A 1YYVA 4PJJA 3VMVA 4N4NB 2XF6A 1F5TA 3AVUA 2P6SA 5J6XA 1MBEA 1XMAA 2FOWA 3OYHA 4A3CJ 4UUTA 5C4XJ 2FMLA 2XAGA 2CF4A 4ZCLA 2KQRA 4RAGA 3OEHA 4XLFA 1S0UA 3V4GA 5KW9A 5D8KB 1VQ4I 4QVJA 4OAZA 4DQLA 3FJOA 3IH2A 1R58A 3OIPA 3LSPA 2IS4A 2AS5F 2QGGA 3FIWA 2LD5A 4RLZA 4U87A 2VI6A 3G3ZA 1O8IA 1YJ9B 2WA0A 2GQFA 2LF7A 3E6CC 3H5AA 1KCCA 4UUSB 1IDZA 1P6RA 2VNJA 5E3NA 1P4AA 1EFRA 5F4JA 1G7TA 2E2JJ 4B3XA 2VBYA 1IO2A 3L9FA 4IXAA 4MHGA 1S3JA 3KZYA 2MC4A 3S3NA 2B5OA 5TJJA 2F5EA 2OD5A 4YIIA 3AG4H 3PM1A 4HEA2 2ZMEC 4A93J 1BX1A 4OJOA 1RU4A 1WJFA 3U2RA 1Q1VA 2V5IA 3G05A 3AVVA 2PMUA 1JTAA 4BEHB 3PENA 3ZQGA 1RRJA 2ZJPF 5FKNA 1QA6A 3CC7I 1VQPI 3WG7H 1I1GA 5EGOB 4AU7A 2E1MC 2KZGA 2JZYA 3ONQA 3PUBA 5CVJA 4F52A 1MRZA 3A35A 1EH6A 1GXQA 4PC6A 2QZ8A 3L00A 3CC4B 4YZAA 1WXRA 1SFXA 2EILH 1TLHB 2FJ1A 4X7EA 1T0FA 3A01A 1U5TA 1MMDA 3OS0A 1EH8A 4RBOA 1DDNA 2R92J 2R7FA 1WSVA 3B73A 3U1KA 4LFUA 2MW8A 1R49A 3LMWA 4CO8A 4FE4A 4M3EA 1WVRA 4ZZLA 1DPRA 3H9JA 2KISA 3CMAB 1B6AA 3EUHC 2DDAA 2WZNA 2EIJH 5DN6A 3CDIA 4MQ9F 1O8FA 2HDCA 3WNDA 4I98B 4KMFA 1S29A 2CQXA 3CB4A 3HSRA 5K5RA 1O8KA 5LGTA 4XN3A 4XONA 4KYWA 2JA7J 2Y31A 2Q6LA 4MQVA 3VPRA 1D8TA 4G1VA 2YPRA 2L01A 1ON2A 1YIJI 5E20A 1YFHA 1KQ0A 4X07A 1MMNA 1XG1A 4EJTA 3F21A 4HE6A 3IH4A 1VI0A 2FQ4A 5C1CA 4FISA 4KITB 2E5NA 2IGNA 3I4NJ 3CLOA 3ZQIA 4PSWA 1TNTA 1UB9A 1YG2A 1U8RA 2GA1A 1MBJA 3ZGKA 4KMUX 5F1RA 2LDUA 3FHZA 1UAAA 3GBGA 3EQOA 1YHQI 2JIZA 4EMSA 2MD5A 2VFMA 2A68F 1YS6A 1OYWA 4A6DA 4NUBA 1U5TB 3OL4A 5IYQA 1MJBA 1OJLA 1O88A 5LFAA 4BKXA 3G1OA 3E7LA 2VFOA 4BPRA 1KA8A 4RDKA 1IV8A 4W8QA 4G6DA 1CF7A 5E8IA 2XDVA 4X0CA 2K85A 1YTYA 3Q39A 2QA4B 2XAQA 4XICA 2JT1A 2WAEA 3EETA 1R7JA 2Z8GA 3TOBA 4FK8A 1ZG1A 3GLLA 4GO1A 1FBUA 2H6CA 2LREA 2O03A 3PQJA 2XROA 3S14J 4HLXA 1ZGWA 2Y0MA 4LBZA 4U7BA 3CESA 3DEWA 2OZUA 4QUZA 1VQ5B 3DXJF 3BR1A 3QYBA 5FROA 4GYIA 3G4SI 4LLGF 1ZM2A 1I6XA 3E1SA 4RA2A 1K78A 1I1SA 3ES9A 2OTJB 1ZM9A 2IBDA 4DZPA 1HOMA 2QMUA 4I2OA 4CZCA 5D6FA 2HXIA 3S16J 4J0QA 4RD2A 1IDYA 1PUFB 3VSTA 3S8PA 1D5VA 2GREA 4OP7A 1JRGA 1D0ZA 1JI8A 5DCFA 3QPSA 4Z05A 2COBA 2ZXWH 1G4DA 2K86A 4DYQA 4HDUA 1FNBA 3SZTA 2BSAA 1T38A 3QFRA 3A03A 1BLIA 1RZ4A 2DMQA 1FZPB 3NAWA 3ULQB 3K69A 3CPWB 1N75A 2WY8Q 3CMMA 1O8DA 2STWA 3VWBA 3AG3H 3P7NA 1CF7B 3S2HJ 1FYMA 2O6WA 3ZZUA 2Q6IA 1LLZA 1Z7UA 5DEQA 4PC3A 1VHEA 3ZQ7A 1E43A 1ZAOA 3IHUA 2GZWA 4ZCMA 2XB5A 5BMZA 1BN5A 1G7CA 4EW9A 3GEZA 3CC4I 4A2UA 2NVQJ 2R7DA 2ODLA 3MVPA 4PJLA 1GJRA 2QDXA 5M5YJ 4RB1A 5ILVA 4AUXA 2DLLA 2OYNA 3M4OJ 3WU1B 1YX3A 4BNCA 3UNGC 3U6KA 3BTCA 3U9GA 3SJPA 5DNSA 4KT6A 1K78B 1LFUP 3BWGA 3U21A 5LHGA 4CGZA 4QIWN 2ZZEA 5L46A 4X7FA 3FXQA 2QM3A 5IT3A 1QU3A 3ZQCA 2PMHA 4BHPA 1XGOA 4IRHA 3OYNA 3CMAI 3CCEB 1W7PD 2GXAA 3CMEB 4BJ6C 2VJ5A 1K4TA 1WH7A 2C77A 2QYOA 4UUVA 2PIAA 4QV2A 4RD6A 4ON0A 4OWRB 1O3QA 3FMSA 4ITVA 5DD8A 1O3SA 3O8GA 2BX6A 1FYKA 2XAHA 2NYXA 1GVJA 1WJBA 1X1DA 1Y1VJ 2QSFX 3LSTA 4L5JA 3WTSC 3HRTA 5FKLA 3W2WA 2DJIA 1PXZA 2XT4A 4MLOA 4E7KA 4GXOA 3K4MA 3R61A 2CO5A 2BGJA 1V5FA 4OOSA 5ICGA 1TSPA 1TQIA 3M8EA 3JQRA 2A5WA 4P2NA 2RQPA 4Y15A 2F5FA 5HS7A 3L2RA 3ZZ0A 1LDJA 4GCVA 5ERIA 5JMCB 2XAUA 2QCOA 2DFEA 3PL8A 3CD6I 1QHHD 4G7ZF 3QU3A 3DLAA 1JTXA 2VPRA 3GO5A 4LB5A 2Q8KA 1MH3A 4X7DA 3VO1A 1OR7A 3S3MA 4M9ZA 5HKKA 1E3PA 1IRXA 1RNLA 2GPJA 1QQIA 4AIKA 3D26A 2IA1A 2XRNA 2VBSA 4OZYA 4PMHA 5LGNA 3OYBA 2CU7A 4ZJZA 1D5YA 1KYZA 2PMZN 5CVUA 1LKXA 1WGXA 2OA4A 4YZQA 1VF9A 3CDHA 4XR6A 4YC5A 4IL6C 3FXKA 1MZBA 1OB2A 2P5VA 4KA4A 1DBGA 5IP7J 2EFPA 3J7AY 2WB1A 3CCJB 4PSXA 4A3IJ 1R5HA 3LSMA 2R9VA 3NARA 1OGOX 3WTUC 2XGJA 4HV6A 4WZLA 1BJZA 5J1RA 1CNFA 1YW8A 1OFDA 1OYIA 2Q1ZB 2DT5A 1JTYA 2VXDA 1OYYA 3P9IA 1Y0UA 3K4LA 4DYRA 1K61A 1G7SA 4EJVA 2BZTA 4EH1A 3CQZJ 1PJ7A 1AIRA 2E1BA 1T0FC 3BH7B 1SAUA 4RCZA 1U5TC 2KHMA 2ESHA 2DOAA 3G1MA 4G6TB 3AKZA 1Y39A 5IT9Z 4BUPA 2DETA 3RKYA 1DDGA 1LUJB 3LSHA 2ECBA 1T2KA 1D1BA 2E60A 3D5SC 2PMDA 1K9MD 1LFBA 3D1NI 2HMAA 1MMSA 2K40A 1IRFA 2KIUA 4E7LA 3PSSA 3HAGA 1Y0YA 4A12A 5J1YA 2DOGA 3W2GA 1V54H 4HQMA 3ROUA 1SFOJ 2B0RA 3JU4A 4MYUA 2DA5A 3RZDJ 3VYRB 4QSHA 5E3OA 3FKSA 2DPUA 5ED4A 1Q1HA 2Y69H 5FO0A 3SYJA 3D0SA 4F55A 2YX4A 4V2GA 5HLHA 3CPXA 5FA6A 1POGA 5CQEA 1FTTA 1R9TJ 5ICEA 3CCEI 5JHUA 2DAOA 4DNCA 3DBLB 5BSXA 4LC0A 1O57A 1R5OA 1TWCJ 1OCPA 2J5OA 2YWFA 1IXRC 1XGMA 2QVOA 5DDGA 5FO1A 2INVA 1WWXA 3W6KB 1KQ8A 1TWAJ 1QGPA 2X1EA 3PQKA 2EIXA 2F3LA 4AF6A 4KKUA 1U0JA 3OW7A 2HDNB 3U1DA 2X51A 3HEFA 3VDXA 2LYCA 2L9SA 3FZVA 2P7CB 1DPUA 2KVOA 3K1PA 4XLHA 2VFNA 2DOFA 4JBAA 2ZC2A 2M4KA 1ZHFA 2ZBKA 1U9NA 3KLOA 3LWFA 4WWVA 5H5JA 2BPOA 4MXNA 2IJLA 5BOXA 1B8IA 2QKMB 1HW5A 2W82A 3L09A 2MC3A 4O5VA 4DYCA 2ZBUA 3ZPNA 1TUIA 2MBFA 2L0KA 1QX4A 3VEPA 1Z6RA 1N77A 3LAJA 4A0YA 2ZXIA 2JA8J 1UD5A 2LKSA 5HOOA 2BBYA 3WY9A 4KISA 2BY3A 1EFTA 4BBRJ 1K28D 1YIOA 5K7FA 3CO6C 4X06A 3GRHA 4I84A 1B2RA 4AYBA 2INUA 1R5ID 3CP8A 4L0YB 1F9NA 4BXUA 1TQPA 3ZIAA 2ELHA 5JI6A 2ESNA 2WJVA 3VNUA 1WU8A 2BEOA 1V4RA 3BG5A 1HDPA 3H35A 3OOPA 2BGIA 4IO9F 3WTZA 1IRZA 3OYMA 3H9QA 3QFSA 4G6QA 4RDUA 2AHQA 3CCJI 3WHCA 3VFZA 2ZJQF 2J5PA 1Y56A 3ZMZA 3BG6A 1PYVA 3TW7A 1RESA 1BR4A 2JTVA 4EEFG 5THXA 1QJVA 4KICA 1E0EA 2Q6KA 1CQTA 3F8FA 3H3ZA 1VQLI 4P6VF 1ETKA 2JUGA 1LEBA 1KTVA 2V79A 3DU5A 4A0XA 1EJ9A 2LY2A 5F0CA 3GIRA 2JA5J 1FIPA 1KU2A 2A3SA 2UVEA 5IPAA 3NWSA 1SD5A 2KP6A 2QQAA 2KPMA 5FJ8J 4A3BJ 4KN7X 3N97A 5IYDJ 5EZGA 3LQRA 3GZNB 5DYMA 4A3EJ 3FY3A 3OIQA 1LFPA 3H94A 4CUGA 2E1CA 1ZLJA 3G1LA 4HX8A 4XRSG 1J0RA 4RLQA 1DUXC 3K4NA 4CYDA 2HNHA 3CMYA 2BN4A 2CW7A 3RPUD 2EWNA 1W0UA 2YUHA 5IP9J 3ZPPA 4DZJA 1JKQC 2HWVA 5CLSA 2YU9J 1LPQA 3CC2B 2DA1A 2FNAA 4BE0A 3BCFA 4ZCIA 4EM0B 3CW2A 3R6JA 1W4MA 1WDTA 3PNTA 1FC3A 2LMDA 4XQFA 2E1RA 4IHSA 2D2WA 2FUG2 1JUMA 5CYVA 4YFOA 5D8LB 2IVMA 3FMQA 3AVXA 3J80K 3PSFA 4NK6A 4M74A 3K70C 1OMIA 3M1CA 1A31A 3BY6A 3O8HA 4C43A 2V1XA 1VTNC 1GR1A 2XTYA 5JBQA 2EH3A 1A35A 1IAWA 4BXFA 3C2BA 2M8EA 2KFDA 3FDYA 1A04A 3DBHB 1YI2B 3KFWX 1B4AA 3K2ZA 1DP3A 4Y7CA 2IGKA 2F4NA 2M5WA 4Z03A 3ONYA 2YU3A 4A0ZA 1OR7C 3MZYA 3I53A 2IEKA 4IRGA 2DCEA 3W5HA 3HBLA 3KP6A 4HLYA 1Y8RB 4G1BA 2DMNA 5ICCA 1RQPA 4ZDOA 3B6CA 2P8TA 3IWFA 1QFZA 5CDFA 1MW7A 3CUQB 4N0BA 2XSDC 4F91B 3A3BA 4RDJA 3CCLB 2AQFA 2LFBA 4XRFA 4NC6A 2ELJA 4YEJA 1IW7F 1SKYB 3JRGA 1VQ8I 2XGEA 1IUYA 1NG6A 1ZUNB 5D5VB 3BP8A 4CHUA 2JN9A 2NV4A 2P3MA 2KDOA 4GGGA 4BHCA 2VN2A 4HWVA 3FXUA 1XGNA 4XORA 2QQBA 5B66C 1IG7A 5HS8A 3MKZA 1NH3A 4WX9A 1I3AA 3DPLC 4NQWA 3K4BA 1NB9A 3OP1A 4Z4YA 1PE9A 4CZZA 3HHHA 4K2EA 1WPKA 3K1NA 2OPTA 3JTHA 4MTEA 2GQQA 2R7WA 2R93J 1E3ZA 2ZFUA 4Q48A 3SJMA 2JPCA 4UY8I 4L9TA 3NRVA 2M9HA 3RYRA 5J35A 2IA0A 2AXLA 4BGDA 3HTUA 5EJCA 1E1QA 1MDMA 2FQ3A 1X3ZB 2K7LA 4RLFA 1C0WA 2ID3A 2QBYA 2L9VA 5J1UA 2IP2A 1BIBA 2W57A 1FRQA 1XX5A 5KNLA 2W1OA 1LE8A 2WR8A 4TSFA 4YEIA 3EUHA 4RAFA 4OIRF 2QTZA 1OFMA 1S7OA 2NS7A 4OIQF 4QPQA 3OFNA 2OV7A 1MBGA 1QO0D 2G7UA 3Q3SA 3WNBA 3SDGA 2BM4A 3GQ7A 3DTIA 5HNHA 2ZMEB 4WZEA 2NSTA 4BQNA 1EP2B 4RCYA 3S2WA 4CH7A 1JGSA 1VQNI 4IHYA 2EZLA 4RB2C 3V42A 5L3BA 3QFCA 1RMGA 3V7SA 4U49A 1LJ9A 2VKHA 2NNYA 1E79A 1MBHA 2PBIA 3ECHA 1R5NA 1FMVA 1FY7A 4NQWB 4YFKF 2XPVA 1IRGA 1EH7A 4NCNA 5IYBJ 4M6YA 1HKTA 1EA0A 3ML3A 1XCBA 2XV4S 5E1XA 5F4MA 1PUEE 4F7ZA 3CC2I 5ICFA 3RYPA 3W6JB 3SY2A 2EFOA 4ROXA 3R0JA 4BDZA 2QWWA 4KKSA 2BVMA 2PX9A 2BOLA 2K9MA 1R36A 1DBOA 1U8BA 1HKQA 4ESJA 4A3MJ 1X1CA 1SVLA 1MABA 3ABUA 3HXLA 1RPWA 1R1TA 2QBYB 2ZXJA 2X3UA 1P2FA 1HW1A 3UKGA 1W9XA 3OYDA 4X05A 1ZH5A 3AVTA 3PFYA 1LE8B 3NB2A 2P0WA 1ZGJA 2L9RA 2VQHA 4C2TA 4XLAA 2CW0F 3GTLJ 1W5TA 2VC1A 3ONUA 1TW3A 1JUSA 1FNNA 3KP7A 3QP6A 2M2EA 3NWTA 1M1KD 2QXZA 4OOVA 5GP9A 2XC1A 3KP2A 2WAQA 4B48A 1T6ZA 2B7CA 1TTYA 4GFBA 3GVKA 2WADA 3S17J 4HIZA 3MQ0A 3K6GA 1QRCA 3ZQFA 4U0WA 1ODDA 3GQ8A 5AMVA 3W2AA 3T9GA 1OQYA 3MMPA 1D1AA 1XS9A 3W6VA 3VSKA 2VNKA 2NPFA 3PUFA 2HOAA 5LLQA 1JKOC 1FRNA 3AGPA 3Q9VA 2XHKA 3M7GA 1ETWA 4KDPA 5IYRA 1J09A 5H6RA 4KFCA 3OZWA 2KRHA 2CQ7A 3BTJA 3B6AA 2M34A 1W5SA 4LD5A 1X2NA 2P4WA 3CDLA 1QVFB 1VZ0A 3M3YJ 1NB0A 2HYGD 5FD5A 1B72B 3QYEA 1OGJA 2F4IA 3LSRA 1W0TA 1UD2A 2XT2A 2CFOA 3QYFA 5J47A 5FKMA 3OWTA 2P5LC 4N4OB 1DU0A 2L54A 3AL0B 3TO6A 2JJ2A 1TWGJ 1XG2A 1WH5A 3BCAA 1VQ6I 2Y2ZA 1WMRA 1K7AA 1ZGAA 2NAZA 1BHEA 2HTSA 3GFJA 3PNVA 5C44J 3N4MA 2QE7A 2DA2A 4M71A 4NHJA 1NHCA 1ZM3A 3DBRB 3HOWJ 2KJBA 3RSNA 1IJFA 1Z91A 3GVLA 3ZXSA 5IY5H 1Y1WJ 3S3OA 2UUZA 2LOOA 4LITA 2R5ZA 3SLNA 1YJNI 3GUDA 2O1DA 2IS6A 2L7KA 2BHYA 3P9CA 1TW2A 2L7ZA 1JA1A 3OZVA 4C2MJ 3BPXA 1ZK8A 2GIVA 3CCRB 1R23A 3T8TA 1Z3YA 2Z1DA 2EPFA 5B1BH 3BJOA 1MBKA 4BJ5C 2OJED 1HC8A 3GLXA 1COWA 1WCMJ 1A5JA 4DJAA 4TMXA 1Y0RA 3GW2A 1ZR2A 1IN7A 1IXCA 3Q0VA 2RVCA 1GO2A 2EV6A 4HAMA 2A69F 1FWZA 5M3FJ 3HDDA 1XSDA 1I50J 2DOEA 2WPDA 1XFOA 4QTRA 2HPMA 2LY9A 3BZKA 3F72A 4QPOA 2NNNA 4Z1MA 2F6CA 4YELA 1ZR4A 4A3DJ 2FRHA 2DT7B 3P5JA 3BCBA 4Z6YA 3CJNA 2E71A 1T08B 2DYRH 1YW9A 4FX4A 1ULYA 2CV1A 1D3YA 3SEZA 3OYEA 3HPGA 1GHCA 3W5UA 4O6JA 1XE1A 4IHWA 3C3WA 5GTHC 2VL8A 3J7YJ 1QHGA 1HA3A 2GAUA 2YR2A 3BTIA 5TY0A 2V4DA 1FNDA 5A88A 1S7AA 2WB1N 2A05A 2DEUA 1LDKB 5FNZA 2BE5F 5TGTA 3PIPF 4YAOA 1V3FA 1FBQA 1HZEA 5TV2A 1Z05A 2UV1A 1YLOA 5AN9A 3KPHA 4PC2A 2LR8A 1WFXA 5IOYA 3T8RA 3FMRA 2VXZA 3GTPJ 4Z06A 2HGCA 3F6OA 4XLNF 3B02A 4OJLA 4TMWA 5C1EA 5ILSA 4S05A 4UV9A 2RC5A 1KQ5A 1IHMA 2X0KA 4HA8A 2QGUA 2XC7A 3BR2A 4A6EA 1X0CA 4BS9A 1BW5A 1KZHA 1VHOA 2YWGA 2L2OA 5FB2A 2VC0A 2HQNA 4M6VA 2P6TA 3OR2C 3DU6A 3QPLA 4BQOA 3KEYA 2C2WA 1A8PA 1FIAA 2JA2A 3PUMA 4L5IA 1ZG3A 4PK4A 4XKVA 1OOCA 1J5YA 5AIQA 3SZPA 4PZJA 4FETA 1APLC 2F5CA 1RR8C 1N78A 3KE2A 1XB2A 2D74A 3E1YE 3E97A 2WV1A 1AHDP 3LFKA 2FNPA 1BW6A 3H9NA 3VMWA 2DBBA 3LOCA 2EV5A 4MGRA 5FGMA 1JB9A 1H9TA 1A6QA 4Z4SA 2G7HA 4MR0A 1DU6A 2R0QC 4ZYAA 1QVTA 1WJAA 4I02A 1X2MA 4ENNA 1M1EB 2D3LA 1H8HA 1J9IA 3REOA 4BQQA 2OZ6A 3R6SA 2O9LA 3BROA 3DTEA 4ESFA 4FTHA 1BI1A 3HTSB 3HOVJ 2BF4A 1F36A 2PLYA 1QA3A 3ZN0A 4EQQA 3WGGA 2BY0A 1W36D 4P1VA 4V19K 3B82A 1PJRA 3O2PE 3ZMTA 1F1ZA 2CUZA 4N9IA 4I99C 1U6GA 5FD6A 1FYLA 1Y0NA 2MH2A 3ABTA 4NBQA 2YX7A 1IZ1A 3RCOA 3OYIA 4B44A 2HZTA 2JJ7A 2V1NA 2XZPA 3W2IA 4WZKA 5EEHA 5J4YA 4AIJA 3G6EB 3W2VA 4BHBA 2FXAA 3A01B 1FOWA 1YO5C 4PGGA 4LOCA 2V1DA 1NDHA 1I3QJ 1SFKA 1B23P 4RDLA 1JHFA 4M3BA 2F43A 1S6LA 4UB6C 1XB4A 3DTKA 1P4WA 3ZOBA 4UVCA 4RD3A 1BR2A 2D1HA 4C0SA 3AL0C 3CCYA 3LSJA 2JN6A 3G73A 3GFMA 4XN0A 1EFUA 3ASOH 3B8HA 4YFXF 4UNOA 2PJPA 1G3WA 4XOPA 3I59A 4P55A 3IKVA 4YG2F 3KX2A 4ENMA 3V8KA 1OB0A 2I5UA 4RD1A 4U0VA 1PJ6A 1TZLA 4YAUA 3AK5A 5HZBA 2UXXA 1G6NA 2AXTC 2CQKA 1FLIA 2EJRA 2K9LA 3M8FA 3OYJA 4C2LA 2UVFA 5GTIC 2PG4A 2XGXA 5A8AA 1SMYF 1YJ9I 1XMKA 3DKYA 2G9WA 3PO2J 2X48A 4OPOA 1ZKGA 3LA7A 3O3KA 1Z3XA 4I09A 1VQKB 4EATA 2OBPA 4BYYA 3JAMK 1XC5A 2R7QA 1YX2A 1QRBA 1J59A 2IOUG 4JP0A 2DN0A 2NTBA 3SXYA 3VB2A 1WOPA 5ILUA 1AKHA 1Z9CA 5GV7A 1KGSA 2JPBA 1DARA 3TOAA 3EQLF 5HLIA 5B3SH 9ANTA 2EIKH 1MMGA 4ZGNB 1QH0A 4XSZF 4EJWA 2PYGA 3KYCB 1K8AD 4HSRA 2R5YA 3CCMB 4ZTFA 1N05A 3IUOA 5HLTA 2PJRA 4B3FX 3C1DA 4AVPA 1XMXA 3V8JA 1QNTA 1YLFA 2ICWG 3Q6RA 1UHMA 1XN7A 1Q9SA 2VYQA 4ZDLA 4BE2A 1H9GA 2E1OA 2LKPA 2PLFA 4LG0A 2EZIA 2NS0A 2XGCA 1FP2A 4MFDA 5FO5A 2CK3A 1H8EA 3MZ8A 4Z4UA 5BNGA 3PVDA 5GAEJ 3L2VA 4E6KG 5L3GA 2A61A 2R4GA 2W85A 2E5ZA 3TDZC 1USSA 5E6TA 4PGHA 4BXXJ 3E6BA 1IA5A 4ZC3A 1K6OA 5IYWA 2TCTA 5DCMA 4HF2A 2DA6A 5TISC 2ZL5A 4M53A 1U9OA 2DO7A 1ZN2A 5JHFA 2DPDA 3B78A 3W2HA 1ETOA 2BVNA 4D5CA 1TLLA 5IT9K 1QGZA 2HFHA 4H4KC 5IYPA 1AKHB 4D7MA 3PETA 2V9PA 2QQ8A 2MH9A 5F0FA 1WI9A 3K2AA 4E7HA 2BGCA 3I5UA 3R4KA 3OPOA 2OCEA 4OINF 3K9TA 5A89A 2MG4A 3SEQA 4M9XA 5LGUA 2R5YB 3OJXA 2PJRB 2CS3A 3GTGJ 3KETA 1B9MA 3G6EI 4QWQA 1MJ9A 2GXGA 2OQRA 4IHVA 2FX0A 2A07F 3WG9A 3SKBA 4JX5A 2ID6A 1QZEA 3VYUB 3CF5F 3JAMZ 2DK5A 2VKVA 4LG0B 1P7IA 1CNEA 1ENHA 3TO9A 2LH9A 2QA4I 2NT9A 3CCQB 2DTRA 5M5XJ 2QSHX 1KK1A 2PEXA 2K3FA 3H36A 1HW2A 3OL3A 2MLKA 2HLDA 1G3TA 5JLVC 4I0AA 1CZFA 5DCMB 1BBYA 1I5ZA 5AONA 3KP4A 2I10A 1VQ5I 4HV5A 1S9HA 3PSIA 4BAYA 1S4MA 4NBSA 3JCUC 2XASA 5FKKA 2PQ8A 2AHOA 2DXIA 2OTJI 3VNVA 4HE5A 1RC9A 5FLXZ 1EWYA 2BW3A 4XD7A 2X0LA 2M7BA 2KZVA 1IDJA 2V7TA 2NVYJ 1BN8A 2M7AA 3I55B 3Q3AA 3BQYA 3Q0UA 3A8KA 2QYUA 1FPQA 1QZYA 2Y9YA 4HRIA 3K4CA 4YAWA 4AD9A 3H09A 3SJZA 3LNNA 1VQKI 1I27A 3FF5A 4XOTA 4Q5SF 3SEJA 2XPWA 2GIZA 1K8FA 2W00A 4HQEA 2YS9A 3LQ6A 5E8GA 3Q9SA 4E7SA 1UD4A 5GPCA 3K7AJ 1YOVB 4IQ4A 2LKXA 4YZXA 5H2FC 4ZZDA 3B4NA 5K5OA 1WJEA 4YZ0A 1PDNC 3QU6A 2K9QA 3P26A 2KDZA 2VKDA 4P12A 2RQQA 2EWEA 4M0LA 4RPBA 2STTA 3CP2A 2E7WA 4LLLA 3L2UA 4HG2A 1IF1A 4EV0A 3DPUA 2QTLA 3AG1H 2FF4A 3DQVC 1V5GA 1R1VA 3HOUJ 3WYAA 5E17F 3SFIA 1NK2P 1GV2A 2HCJB 2NOJB 5L3FA 4RD0A 2QSGX 2LF8A 2QX3A 3ZP5A 4AC0A 4O3MA 4A3FJ 1RI7A 2Z5UA 3A3GA 3CMEI 3P9KA 1VQ9B 4RGRA 1HG8A 1JE8A 3I1FA 5F4OA 3BLYA 1BC7C 2W6JA 4G8XA 1XPXA 1OFLA 2VJIA 4RMNA 4E0FA 4PABA 1LDDA 3SUCA 1H0MA 1TYWA 5K7ZA 1NTCA 2N8GA 5TRDA 5DSZA 4IF4A 1JT0A 1Q86D 1X1PA 2JRMA 2WAQN 2ZNZA 3T5XA 3DEEA 4YIFA 2MFZA 2DY1A 1Z1DA 4Y33A 2X8KA 2XAFA 3ABKH 2FOKA 5JVTA 4XMYA 3BY2A 1UHSA 1O8LA 1VBLA 1M90D 4OJ5A 2Z2SB 2WZPP 3ASNH 2E1NA 4EM2A 1UMKA 4B09A 4JYKA 2QENA 1FSEA 1O8HA 3KYDB 2DW4A 5FFZA 4R79A 3DLLF 1R5BA 3WBJA 3X2QH 4G9YA 1IUFA 4V2FA 1K83J 5D6EA 2QQ9A 4A3KJ 1IN4A 5J3LA 2VBXA 1ZQ3P 1WTHD 2V31A 1J9ZA 2DA3A 1W0KA 2O5RA 2E19A 2CC2A 1N0VC 1QPMA 3OIOA 5J40A 2DODA 1RUOA 4P9SA 1QA1A 5M3MJ 4LK1F 2AQEA 2WBMA 2HVQA 1E64A 1TWHJ 1YRNA 2V7XA 5AIPA 4YFNF 5J8CA 3IL2A 2VE8A 4ANJA 1RIOH 3V76A 3GTOJ 1V0EA 3WHBA 2C5BA 1KTWA 4FCYA 3KLNA 3IP4B 3BQJA 1MMAA 3RPUA 4G6IA 5EG0A 2V7QA 1S7EA 4L9VA 3NEUA 1UFMA 3TKYA 4OJ6A 2FBKA 3VSVA 3ZMDA 1JJ2B 3W2FA 5EMNA 1B8IB 1VQMB 4LK0F 4IHXA 3ZZTA 4Y7NJ 3TQNA 3M1EA 1XDUA 1HBXG 2JVHA 5HNFA 4U0YA 2W48A 3WGHA 1K73D 3VR6A 5BPDA 1GDTA 1P92A 1KQSB 3OYCA 2FE3A 2CRGA 3M8JA 2NVXJ 1BI0A 1F43A 3WU2C 4YIRX 2ZL6A 2NTPA 1UG2A 2VBVA 1D1NA 3GZ6A 1I39A 3ZC3A 4F92B 4B47A 4C3IJ 2IGMA 5B1AH 5EDNA 4BQAA 3WXMA 4ZDPA 2VKEA 1MSFC 1MKMA 3P4GA 2OBTA 3OYGA 3W2EA 3BJAA 2F1LA 3BY1A 3OE7A 1OGIA 3ELKA 4FX0A 4CICA 1YRNB 1LVKA 2JMWA 3OYLA 2H27A 2CV2A 3OW2B 1JT6A 3JQQA 1D0XA 1JKPC 3SFZA 2XTXA 1U2RA 3WGIA 3JX8A 4B1RA 4OMZA 1VQ9I 2HOTA 4BU2A 4NC7A 4EVIA 1GXPA 4FXUA 3T53B 1VQOB 3JRIA 3VO2A 1S72B 4II3A 2JVGA 1NBMA 4DQKA 2VB6A 4XSXF 1H8AC 2XNCA 2CUFA 2PFBA 4A5MA 1WRJA 1KC8D 4D1QA 2PECA 1DGRM 3CLQA 3T56B 2X3HA 3Q5FA 5TR9A 3RI4A 2FMYA 2W24A 2HQAA 3KRGA 1L0OC 2JK3A 3MZHA 3BR3A 2M87A 2D45A 1O7FA 2JSPA 1XQBA 4FT8A 1I18A 1TQMA 3FXJA 5HLGA 1H80A 2W7NA 2OC6A 3GTJJ 3LAPA 2XKOA 2R7RA 3E6MA 4ZYDA 3H1CA 5D5WB 4OPWA 2R3SA 1BM9A 2X85A 2X6OA 3ZQLA 4Z4VA 1GQ8A 2VASA 3J7ZI 4CCLA 5DTDA 2Q0OA 3L1PA 1N07A 3AVWA 5F08A 1X58A 1F60A 5E79C 2B7EA 1TT0A 4P3IA 6PAXA 3ZRGA 2HPIA 4B8XA 1KK0A 4WZTA 4F7DA 2M45A 4P96A 4E4HA 4A3LJ 4YAFA 1WPCA 2EV0A 1DGWY 1KZLA 4WXHA 3A0BC 3W5VA 2RV8A 3T1BA 2FD5A 2IXSA 4Y9UA 2HXOA 1UG0A 3JRFA 1SVOA 3A8JA 3JSOA 1QUFA 5HZAA 2CJJA 3J7AO 4MNUA 3U6BA 3PUNA 2R7OA 2D1VA 3FK6A 1IN5A 2YWEA 1OHHA 4TT3A 2DFIA 4U9UA 2BSPA 2B0LA 5HDNA 1WQ2A 4D5FA 3G2BA 3AGQA 5DD4A 1I8DA 1WSRA 1ETXA 3HSFA 4RAZA 2E35A 2GLOA 4OMYA 3A02A 3K10A 4MFEA 3FBIB 1UMQA 3LQQA 3GXOA 1U3EM 3WNCA 4QLCU 1QVUA 1B9NA 2QF7A 5CVVA 2H8RA 4FN5A 3HG9A 1ZLKA 2HI3A 2XZLA 3CCUB 4KIFA 4HNVA 3H3VK 3MHPA 2CBXA 5CJ9A 1OKRA 2UZKA 2R7VA 2FBIA 4PDKA 1KONA 5DM7F 5E1ZB 4B3AA 3OS1A 2DMUA 1ZG5A 1X3UA 4BACA 4WQMA 4JRAC 3ASQA 3IRQA 3CCSB 1ONVA 4XRMA 1P4XA 1SD7A 3MKYB 1T39A 2HVRA 3PO3J 4URRA 4DNRB 2V26A 2K5CA 2Z16A 5B6IA 2OU2A 3D5LA 3IRRA 3VOEA 5BQTA 4HOBA 1IJEA 1PP8F 2V7UA 1UZCA 3JW4A 4HZFA 2EQRA 2ZXHA 5IOZA 5LEKA 2BM7A 1UELB 2BY2A 2Q2EA 3CF2A 1MDMB 1H89C 4KH3A 3EPZA 3WTXC 2KKOA 4X1EA 4A3GJ 2NXNB 3H0DA 3EQNA 4D0PA 2OCCH 3JRCA 3GQBA 1IV6A 1ZTRA 4ENKA 3WODF 2RNGA 2ZKZA 2VFQA 4G7OF 5DS9A 4PJ0C 2XNDA 2UWMA 4P3YA 2OF7A 3EDPA 4FHTA 4KIGA 1G3SA 4HPQA 1YI2I 1QGYA 2OQGA 1VQ4B 4J01A 2HVSA 3A4CA 2GOXB 1G2HA 4F93B 4IRIA 3MN2A 3LA2A 4W8RA 5J4VA 2XKPA 3RQ4A 3CJRB 2VBKA 4L18B 1O8GA 3KYLA 3H92A 3HSEA 4AWXB 4P22A 4BDYA 3LYCA 2CW8A 3E5XA 3CCLI 4HF0A 1IN6A 4L5EA 4FASD 4BL0B 4E7ZA 4YALA 2LRDA 2V6CA 1JXSA 3ZMSA 1MNEA 3TW6A 5BPIA 3ZMUA 2JWTA 1WZ2A 1BQEA 2Q2EB 4ETSA 3E5UA 1AU7A 1UD6A 1IN8A 1IJWC 4XKWA 4PC7A 3QQAA 4ZYGA 1HSTA 2RN7A 2R7ZJ 2CWEA 3WE2A 3FPKA 3OAAA 4DK0A 2VIXA 3CC7B 4UZFA 1R6RA 4J19A 4P9FA 3F8MA 3KP3A 1GVHA 1T95A 3GFIA 2W25A 2XF7A 1W1WE 2OAZA 3D5RC 2M1BA 3BG3A 4UZUA 4I76A 2EFGA 3ZBUA 4YHBA 3LJYA 3HL2A 4WWCA 4Q47A 3LSKA 5C4JJ 2M4GA 1REPC 3MCZA 2DFFA 1MGTA 1T6YA 5IYCJ 2ZJRF 2CUJA 4S0HB 3BC8A 4W97A 4U7DA 1G59A 1B1BA 3MKWB 1BMFA 2BV6A 4XKCA 3HRSA 2WTEA 1GLNA 1J75A 3CCUI 1OPCA 5BSYA 1R5GA 3I56B 2XNJA 3W3CA 1UCRA 5E1WA 3GTMJ 1B59A 3FISA 2C6YA 1K79A 3ZPLA 1FSHA 1GAQA 1UD8A 1ZRFA 1AIPA 4XK4A 4UB8C 4BE1A 3V7CA 1YIJB 3CCSI 4RPDA 3ERMA 3NE5B 1LB2A 3J81k 3L2CA 3Q38A 1K6YA 2IQ7A 3MEXA 1E2XA 4HNTA 1J2XA 2ZSHB 3LA3A 3MWMA 1Z0XA 4N3NA 4KIBA 1OCRH 4LB6B 4BH9A 2ZO4A 4XIDA 3J81K 1XSXA 1TL8A 2M30A 1GVDA 1YHQB 1HA8A 2VNHA 3GSIA 3QRFF 2O04A 3CJTB 5EZHA 3RIRA 3VODA 1D8KA 3R60A 3KCCA 4RJLA 4UVBA 2R5ZB 3ZSCA 2ME0A 1IB0A 1BI3A 2NOGA 3MAJA 1FNCA 5CQGA 3COAC 2W6IA 2DYIA 3ZQQA 5EGOA 1VJSA 1L3LA 2JQ7A 1EP3B 1UD3A 2BM1A 1EV7A 1X1AA 2XPUA 1BPLA 3DV8A 2BM0A 1QBJA 1MNDA 4Y13A 2O61A 4BBSJ 1G8XA 3OSGA 5KHDA 5E18F 1O3RA 2QLZA 3DDYA 4DBQA 3G4SB 5LMZA 1IXSB 1UHWA 1RUNA 2LLKA 1WSUA 2GK7A 3BH4A 4A69C 3I4MJ 1V0FA 2QY1A 4P9UA 2PYHA 2FU4A 3PJRA 2IA2A 2PN6A 1R4NB 3DP7A 3V8LA 5C3EJ 3EYIA 4C9YA 4JMQA 3JR9A 1HF0A 5FLVA 4ZYEA 1SD6A 4LG3A 4NNJA 2IRFG 5E3MA 1SM4A 4R71A 3RIQA 3E20A 4IEJA 2ZITA 2ZTGA 4ACBA 4LIUA 2GM4A 2FX3A 3G71B 1Y6IA 2M8GX 3HYIA 1W87A 2VZLA 3ISXA 4M4SA 2H6BA 1ZELA 1XD7A 2K3PA 3PIOF 1KRHA 1G3YA 1AMOA 2EFNA 4G7WA 5L3CA 3FXLA 2G0EA 2F5DA 2XF5A 4Z2YA 4RB3C 3FPPA 2K27A 2LBFA 1QVGB 1HKSA 4XM3A 3LQEA 1P4MA 5BS6A 4ACAA 4E70A 3A1PA 5K5QA 4AC9A 5FIUA 5FKOA 2ZJ2A 2RNJA 4X6AJ 4EM1A 1D1CA 5A2QZ 1WOSA 3QP5A 1EXMA 1HVXA 4M3GA 4BJTA 3J81Z 3VSLA 3RPQA 3N6ZA 2L9NA 4HNUA 4V02C 3JTGA 4AF7A 2EA4A 5D5XB 2DK8A 3M07A 2VBZA 3GCMA 2IS1A 4OPSA 3TO7A 1Q82D 3BQZA 1LM1A 4ZV4A 3I0TA 1GV5A 1OCCH 3CCRI 4PAAA 1BA5A 3T51B 2FA5A 1KMHA 2L7FP 2KIQA 2KT0A 3SHFA 3I56I 2DERA 1TBXA 2KMUA 3JRBA 3TGNA
chains in the Genus database with same CATH topology
3UR3C 4HRIA 3K4CA 4BE0A 3BCFA 2M3AA 1O8JA 1EE6A 3PNTA 4XQFA 3LNNA 4XOTA 2FUG2 1PKVA 1K5CA 1YX5A 4XNFA 3PSFA 4X0GA 2XOKA 2W00A 4NK6A 2LBFB 4RM2A 1OGMX 2R7XA 4E7SA 3L2QA 3K70C 4CA0A 2X6YA 2MABA 3M1CA 4IQ4A 1UD4A 4TKOB 2VBMA 4YZXA 2Y0SA 3B4NA 3TMOA 4RM3A 1WJEA 2GJKA 4YZ0A 3QOEA 4BXFA 1FMWA 3FDYA 3EUAA 2D3NA 2VKDA 2RQQA 2EWEA 3CP2A 1DP3A 4HSTA 1X4PA 2IGKA 3FHNA 3L2UA 4W8SA 1WJCA 4HG2A 3LSGA 4Z03A 3DPUA 3OYFA 1ERDA 4ASUA 1OR7C 2VJJA 3DQVC 3HC7A 2DCEA 1V5GA 3C2GA 1PLUA 3HOSA 2CV0A 3OR1C 2ZSIB 2NOJB 4ZDOA 5CDFA 3VSUA 1MW7A 1E1RA 2QX3A 4F91B 1FX0A 3A3BA 5CKTA 3A3GA 2ZTNA 2AQFA 3I3LA 4XKBA 4XL9A 1HG8A 1SKYB 2ELJA 4YEJA 1NG6A 2VBEA 3BLYA 2W6JA 5IK2A 4HWVA 2KDOA 2V9KA 1KCDA 2Z6BD 1OFLA 2GJPA 2VJIA 4II2A 4RMNA 4XORA 3SZGA 2WSSA 2O17A 4E0FA 2MYSA 3SUCA 4DBRA 2WJYA 4DOZA 3MKZA 1OLTA 3DPLC 3K4BA 4JQFA 1PE9A 2X53S 3HOTA 2XSJC 3DEEA 2R7WA 2MFZA 4F3QA 3ZR8X 4BEHA 5HVQC 2ZFUA 3OYKA 2VLAA 1E3ZA 4Y33A 2X8KA 4PJJA 4BGDA 1E1QA 4XMYA 4N4NB 2XF6A 3VMVA 4RLFA 2LZJA 1O8LA 3I9V2 3LFUA 3OYHA 1VBLA 4OJ5A 2Z2SB 3LL7A 2KLOA 2KQRA 3OEHA 4XLFA 2WZPP 5KNLA 2W1OA 4TSFA 1BR1A 4OAZA 1O8HA 1OFMA 4R79A 3OIPA 4QPQA 2IS4A 3OFNA 2OV7A 4U87A 3GQ7A 3DTIA 3SYTA 4KKSA 2OUMA 1O8IA 5HNHA 1WTHD 1X1BA 1W0KA 2WA0A 4JOMA 2O5RA 2V31A 4BQNA 2NSTA 4KJZA 2NSPA 4OAYA 3H5AA 1KCCA 4CCOA 4CH7A 3OY9A 1EFRA 3V42A 3CZ6A 2AQEA 2WBMA 4B3XA 1RMGA 4U49A 2HVQA 2VKHA 1E79A 3S3NA 2MC4A 4L8JA 1FMVA 4HEA2 2X1CA 4NQWB 4OJOA 1RU4A 1WJFA 3OOCA 4ANJA 2GJRA 3G05A 1JTAA 3EUKL 4BEHB 1V0EA 3H5RA 2NZMA 1KTWA 2CH0A 4BDZA 3IP4B 4AU7A 1MMAA 2E1MC 2BVMA 3ONQA 2HZDA 3PUBA 4F52A 2BOLA 2K9MA 3A35A 4G6IA 2V7QA 1DBOA 4OJ6A 3N05A 3VSVA 5FRMA 1X1CA 2M0MA 4YZAA 1MABA 3HXLA 3QODA 3HKZA 4ZTJA 1W9XA 1WP6A 3OYDA 4IKFA 3PFYA 2JVHA 5HNFA 1MMDA 2P0WA 3AFHA 3OS0A 3VR6A 2VQHA 2ZZQA 2F1MA 4C2TA 4XLAA 3OYCA 3K4JA 3M8JA 3HPHA 2DIEA 3NWTA 2QXZA 3LMWA 2NTPA 2WAQA 4B48A 2R7SA 3GVKA 2WADA 3H9JA 4B47A 4F92B 2IGMA 2VQCA 3BC9A 4HIZA 4ZDPA 3K6GA 3EUHC 4J00A 5DN6A 1O8FA 3T9GA 3GQ8A 4DNTB 5CPRB 3W2AA 5AMVA 3OYGA 4C2UA 1D1AA 4CCKA 3VSKA 1O8KA 3EQOA 4XN3A 4XONA 3OE7A 1LVKA 2R7TA 3OYLA 3TL4X 3JURA 2CV2A 3K70D 1D0XA 1MMNA 3DPTA 3FKJA 1J09A 1IDKA 3VYTB 2KRHA 5C1CA 4BU2A 4KITB 2E5NA 4NC7A 1VZ0A 4FXUA 2IGNA 3T53B 3H5NA 4PSWA 3QYEA 2F4IA 4II3A 2JVGA 3ZGKA 1NBMA 1UAAA 2VB6A 3GBGA 1UD2A 2CFOA 3QYFA 4AVZA 1W36C 2VJ4A 3OWTA 2JIZA 4N4OB 2JJ2A 3AL0B 2M5SA 4D1QA 1IDJA 1XG2A 3BCAA 2PECA 1DGRM 3T56B 4NUBA 1WMRA 3OL4A 3PNYA 2X3HA 1O88A 2HQAA 3KRGA 5LFAA 4PJMA 1BHEA 4W8QA 2JSPA 2KRCA 2VQGA 2XDVA 1I18A 3PNVA 2QE7A 1H80A 2W7NA 2OC6A 4P5OA 4D9JA 3GQ9A 1NHCA 3OOUA 2R7RA 2WAEA 2BW3B 2Z8GA 3CJQB 3RSNA 3GVLA 3ZXSA 2X85A 1VLYA 2LREA 1GQ8A 3S3OA 2UUZA 2LOOA 2VASA 1DQUA 4LITA 2O0WA 4U7BA 3CESA 3B8YA 4CCLA 2IS6A 2O1DA 2L7KA 3QYBA 5FROA 3C2HA 1TT0A 3E1SA 2NTQA 3ZRGA 2HPIA 1X4OA 2I8DA 4CZCA 1Z3YA 2Z1DA 4E4HA 2HU9A 1WPCA 4W8TA 4BJ5C 3VSTA 1DGWY 1KZLA 2NT6A 3S8PA 1COWA 1JRGA 3IAS2 1D0ZA 1JI8A 4DJAA 3HUGB 2IXSA 4Z05A 1UG0A 4PFOA 2JDIA 3WQZA 1EA3A 1BLIA 2R7OA 1N75A 2WY8Q 3CMMA 4IX7A 1NRKA 1OHHA 4TT3A 2WPDA 1O8DA 2BSPA 2HPMA 3VWBA 3G2BA 1I8DA 4QPOA 4Z1MA 2F6CA 4YELA 3K10A 1E43A 4KKTA 2DT7B 2L5QA 3VYSB 3BCBA 3FBIB 2DT6A 3RTRA 2CV1A 3SEZA 4EW9A 3OYEA 3HPGA 4B3GA 5KCMA 3HG9A 2ODLA 4PJLA 2XZLA 2VL8A 2JJ1A 1QHGA 1YX3A 2V4DA 2R7VA 1O8MA 3UNGC 4YXWA 1KONA 1LDKB 4KT6A 3U21A 5TGTA 3OS1A 2ZZEA 4BACA 1HZEA 2UV1A 1QU3A 2RREA 3MKYB 4E7JA 2HVRA 4URRA 1WFXA 4XLEA 2V26A 2K5CA 2Z16A 3OYNA 4DNRB 4Y4RA 4BJ6C 2VJ5A 3D5LA 1YE9A 3MD2A 2VXZA 4Z06A 3GVJA 4OJLA 5C1EA 4YRVA 4OWRB 3GQAA 4LIVA 2XC7A 2ZXHA 4ITVA 1X0CA 4BS9A 3KEWA 2R7UA 4XLCA 1UELB 2L2OA 1WJBA 1X1DA 3CF2A 3W2WA 2DJIA 3OR2C 2WY7Q 3DU6A 4P1WA 3EPZA 4MLOA 4BQOA 1O8EA 3KEYA 4E7KA 3K4MA 2JA2A 1V5FA 3H0DA 3EQNA 4OZZA 2A5WA 3GQBA 4PK4A 4XKVA 4CSWA 1OOCA 2RNGA 3L2RA 2V6EA 4FETA 1N78A 1AA7A 2XAUA 3PL8A 3TBIA 2VPLA 2UWMA 1QHHD 2XNDA 3BCDA 4NK8A 1X19A 3VMWA 4HPQA 3A2KA 3DLAA 4CCMA 4J01A 4E7IA 3IAM2 2HVSA 3A4CA 4MR0A 2GOXB 1W0JA 4ZYAA 3S3MA 4Y3OA 1WJAA 5HKKA 4F93B 2XZOA 1QCXA 2D3LA 1H8HA 1IRXA 3UW0A 1V5EA 4BQQA 4W8RA 3RQ4A 2VBKA 3CJRB 3DTEA 4OZYA 2GOMA 4PMHA 2IGOA 3OYBA 1O8GA 4ZJZA 3KYLA 2WAFA 4P22A 1LKXA 4BDYA 2CW8A 4YZQA 1W36D 4GQNA 1PJRA 4FASD 4XR6A 4BL0B 4E7ZA 2CUZA 2LRDA 3H9GA 1MNEA 2W4SA 4PJNA 3RCOA 1DBGA 3OYIA 1PXZA 1WJDA 2Q2EB 4B44A 2CMPA 2V1NA 3J7AY 1UD6A 2XZPA 3E0JB 2WB1A 4XKWA 4IZZA 2V7FA 4PSXA 3W2VA 3LSMA 2R9VA 5LD2C 3OAAA 2VIXA 2V4JC 4DK0A 2XGJA 1OGOX 1SFKA 1R6RA 2VXDA 2Q1ZB 2F43A 1IB4A 3OYAA 3DTKA 3K4LA 1T95A 1BR2A 2XF7A 3OEEA 3AL0C 4UZUA 3D5RC 2QKLB 1AIRA 2HDWA 2E1BA 1T0FC 3LSIA 1SAUA 2KHMA 4XN0A 3HL2A 2DOAA 3LSKA 4G6TB 2M4GA 2ZZFA 3AKZA 1Z21A 3DKXA 4XOPA 4BUPA 1T5EA 1E3XA 3BG7A 2CUJA 3KX2A 3LMMA 3BC8A 3LSHA 1G59A 1D1BA 1OB0A 2E60A 3D5SC 3MKWB 1TZLA 1BMFA 4XKCA 1GLNA 1BOBA 2K9LA 3OYJA 4C2LA 2F5VA 4E7LA 2UVFA 3HAGA 3W3CA 3JU4A 3DKYA 2GK6A 4DK1A 3VYRB 3DWLE 3FKSA 1UD8A 4BE1A 1Z3XA 4G7XA 4NC8A 4EATA 4F55A 3NE5B 2X6XA 2R7QA 5CQEA 1K6YA 2IQ7A 2NTBA 4HNTA 2ZSHB 4IQJA 1Z7LA 2ZZGA 2INVA 3K4KA 2X1EA 1MMGA 4KKUA 5FL7A 2PMZA 1HA8A 5FRNA 1U0JA 2PYGA 3OW7A 4HSRA 4GRIA 2X51A 3VDXA 4ZTFA 2O04A 2BVLA 2LYCA 2L9SA 3IUOA 5HLTA 2PJRA 4B3FX 2KVOA 4XLHA 3ZSCA 2IS2A 4CCJA 3FBNB 1RWRA 5CQGA 3OS2A 2M4KA 4ZDLA 4BE2A 3ZQQA 2W6IA 1VJSA 2LC2A 1UD3A 2CK3A 1X1AA 1H8EA 3MMYB 3SDBA 4MXNA 1BPLA 2QKMB 2W82A 1MNDA 3L2VA 4E6KG 3ZPNA 1G8XA 2R4GA 2E5ZA 3F9KA 1N77A 4DGWB 5KHDA 4CCNA 4B43A 4DBQA 2ZXIA 3DDYA 1IA5A 1UD5A 4ZC3A 5HOOA 1NG7A 4KISA 2GK7A 3BH4A 3OMYA 5JHFA 3ZCOA 1K28D 1V0FA 4C30A 2QY1A 2PYHA 3GRHA 2LG4A 3PJRA 4I84A 2INUA 4AYBA 2MD0A 3CP8A 4JMQA 4C9YA 4H4KC 3ZIAA 4LG3A 2KL4A 4NNJA 2LY1A 2WJVA 4PFPA 3H35A 4E7HA 2ZTGA 3OPOA 4LIUA 1D0YA 1Y6IA 4DIQA 2E1MB 3OYMA 3H9QA 3SEQA 2A6TA 2PJRB 1ZELA 2K3PA 2CS3A 4PUSA 2O0VA 2VQLA 4G7WA 4U4BA 4OJPA 1Y56A 3BG6A 2XF5A 3FPPA 3VYUB 1PYVA 2LBFA 1BR4A 4XM3A 1QJVA 1E0EA 2LH9A 3WWGA 2NT9A 3B90A 2JUGA 1D1CA 3DU5A 1HVXA 4BJTA 2LY2A 3OL3A 3VSLA 2HLDA 2UVEA 3S93A 2L9NA 4HNUA 3NWSA 1VF7A 2KP6A 1CZFA 2KPMA 2X1DA 2IS1A 3S32A 1S9HA 3PSIA 1WJ5A 3FY3A 3OIQA 1LFPA 3H94A 4CUGA 2DXIA 4RLQA 2BW3A 4XD7A 3K4NA 3T51B 2M7BA 2KZVA 2HNHA 2X6WA 1KMHA 2CW7A 3RPUD 1P9QC 1BN8A 2M7AA 3ZPPA 3L2WA 3A1YA 2KMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVF A;  2ODL A;  1DBO A;  4OJ6 A;  3VSV A;  1O8J A;  1EE6 A;  4YZA A;  4XQF A;  1O8M A;  4XOT A;  1K5C A;  4XNF A;  2X6X A;  4NK6 A;  1OGM X;  4XLA A;  2IQ7 A;  2X6Y A;  2VBM A;  2NTB A;  4URR A;  4YZX A;  4XLE A;  3B4N A;  2QXZ A;  3LMW A;  2NTP A;  2INV A;  4YZ0 A;  4Z06 A;  4OJL A;  5C1E A;  1O8F A;  2EWE A;  3GQ8 A;  5AMV A;  2PYG A;  3GQA A;  3T9G A;  1X0C A;  2O04 A;  4W8S A;  4XLC A;  1O8K A;  4XN3 A;  4XON A;  4Z03 A;  4XLH A;  3ZSC A;  2VJJ A;  1PXZ A;  1O8E A;  3JUR A;  1RWR A;  1PLU A;  3EQN A;  1IDK A;  4OZZ A;  5C1C A;  3VSU A;  4XKV A;  1OOC A;  2QX3 A;  4MXN A;  1HG8 A;  4XL9 A;  4YEJ A;  3EQO A;  4AVZ A;  2VBE A;  1IDJ A;  4NK8 A;  1XG2 A;  4HWV A;  3VMW A;  1KCD A;  1IA5 A;  1OFL A;  2VJI A;  4XOR A;  2PEC A;  1WMR A;  2X3H A;  2O17 A;  3SUC A;  1O88 A;  4MR0 A;  3KRG A;  2QY1 A;  1QCX A;  2PYH A;  3GRH A;  1PE9 A;  1BHE A;  2INU A;  4I84 A;  4W8Q A;  3UW0 A;  4W8R A;  2VBK A;  1H80 A;  4OZY A;  3GQ9 A;  4PMH A;  1NHC A;  1O8G A;  2Z8G A;  4YZQ A;  2X85 A;  1GQ8 A;  4XMY A;  2O0W A;  4XR6 A;  3VMV A;  3B8Y A;  1O8L A;  2O1D A;  1VBL A;  4OJ5 A;  1DBG A;  2O0V A;  4XLF A;  4U4B A;  4OJP A;  2NTQ A;  4XKW A;  1O8H A;  1OFM A;  4W8T A;  4XM3 A;  1QJV A;  1OGO X;  3VST A;  2NT6 A;  3WWG A;  2NT9 A;  3GQ7 A;  1JRG A;  3B90 A;  1IB4 A;  1O8I A;  2NST A;  4Z05 A;  2NSP A;  1KCC A;  2UVE A;  1AIR A;  4XN0 A;  1CZF A;  1RMG A;  4U49 A;  4XOP A;  3FY3 A;  1O8D A;  2BSP A;  4OJO A;  1RU4 A;  4YEL A;  2X6W A;  1JTA A;  1BN8 A;  2NZM A;  3ZPP A;  1KTW A;  4C2L A;  4EW9 A; 
#chains in the Genus database with same CATH topology
 1HLV A;  4X8I A;  4B4C A;  3WTY C;  2EA2 A;  4IOA F;  4TMV A;  1UJ8 A;  1RQR A;  1EE6 A;  1BI2 A;  1GUU A;  4M1K A;  2V9V A;  3RKQ A;  1K5C A;  2ETH A;  2CGP A;  4UV8 A;  3F23 A;  1PUF A;  4XNF A;  2VON A;  3KL9 A;  3GME A;  4MYT A;  1OFE A;  3MFK A;  2LBF B;  1OGM X;  5LHH A;  1G7R A;  2LK2 A;  4N9H A;  4CA0 A;  1Z77 A;  1Q81 D;  4TKO B;  1MH4 A;  4XRS A;  2P81 A;  2Y0S A;  3TMO A;  4AYB N;  5D4R A;  3BOQ A;  2GJK A;  2L4A A;  1CQX A;  4PC1 A;  1VQ7 B;  3CCV B;  3CD6 B;  2D3N A;  1KU9 A;  3AVY A;  1MNM C;  5IP6 A;  4HYE A;  1N25 A;  1E62 A;  3I54 A;  4HST A;  4ENJ A;  3FHN A;  2OK7 A;  4W8S A;  5L3D A;  3I58 A;  2DTZ A;  3DEU A;  2EBI A;  1LVA A;  4L9J A;  4ZYH A;  1ERD A;  1IC8 A;  4M3D A;  2HR3 A;  2XVC A;  4R8H A;  3BZ6 A;  1PLU A;  3DU1 X;  3E6D A;  3HOS A;  4YCQ A;  3OR1 C;  2ZSI B;  1JJ8 C;  4G5G A;  4Y17 A;  3F8N A;  1ELO A;  1OCT C;  2WWY A;  1FX0 A;  2RDP A;  2XUB A;  4NB5 A;  3KZZ A;  3MKL A;  5HDK A;  3WBK A;  1N0U A;  1MD0 A;  1TYV A;  3JRH A;  2FVG A;  2YWH A;  1E3H A;  1KCD A;  3S1M J;  1ON1 A;  3Q0W A;  1HXD A;  1W7P A;  2DA4 A;  3S2D J;  2HS5 A;  2MYS A;  1A36 A;  4DBR A;  3BR0 A;  2LSO A;  3HM5 A;  1WHU A;  1R22 A;  4DOZ A;  2O8K A;  1FNM A;  5F64 A;  2X53 S;  1JNY A;  1KJZ A;  2XSJ C;  4M2L A;  3FM5 A;  1DG1 G;  3I59 B;  5DM6 F;  4F3Q A;  3OYK A;  3G71 I;  2VLA A;  5FLX K;  1DAB A;  5HS9 A;  5JFR A;  3O6B B;  2OTL B;  4LBW A;  4C3H J;  3QFT A;  2NVU B;  2ZFW A;  1OIS A;  3K1M A;  4TN1 A;  1E63 A;  3Q6Q A;  2QN6 A;  2LZJ A;  3R6K A;  3I9V 2;  3LFU A;  5EYR A;  3WU0 A;  3LL7 A;  2KLO A;  4QHY A;  4UAJ A;  1H88 C;  2VOO A;  2JRT A;  3WTW C;  1T98 A;  2Z9O A;  1BR1 A;  4MTD A;  4U88 A;  4WK8 F;  1WKM A;  1N8R D;  1ORK A;  3FK7 A;  3HOX J;  4AM3 A;  3V7A A;  1YS7 A;  4CDG A;  5GAD J;  2HEO A;  4Y52 J;  3QSY A;  2DCU A;  1MIJ A;  3SYT A;  3QE2 A;  3I4P A;  2OUM A;  4JK1 X;  3JRE A;  1X1B A;  2A6E F;  3I71 A;  4JOM A;  1CGP A;  2NSP A;  4KJZ A;  4OAY A;  3BR6 A;  3DCF A;  4CCO A;  2OBR A;  4LMY A;  3OY9 A;  2TRT A;  4IJA A;  1AOY A;  1W7P B;  3CZ6 A;  3F8B A;  4RGS A;  4OU0 A;  5CVR A;  4MIM A;  5K7H A;  1U2W A;  2O0Y A;  2C4U A;  1T8I A;  2BYV E;  4M6X A;  4L8J A;  5J3O A;  2X1C A;  1NHA A;  1MSE C;  1PJ5 A;  3OOC A;  2NS8 A;  2GJR A;  1Z67 A;  3FXR A;  3EUK L;  3ESW B;  3H5R A;  2NZM A;  2CH0 A;  4XBF A;  2HZD A;  4LJZ F;  2Z33 A;  3N05 A;  1T33 A;  2MA3 A;  2M0M A;  4IVN A;  5FRM A;  4AIH A;  2QUF A;  2VOD A;  3QOD A;  4AID A;  1YIT B;  3HKZ A;  4ZH4 F;  4ZTJ A;  3FKI J;  1MJA A;  2A6H F;  5F1J A;  1WP6 A;  4IKF A;  3M9A A;  1QGA A;  2DMT A;  3AFH A;  1H85 A;  2ZZQ A;  1WI3 A;  2F1M A;  2XIG A;  5JLW A;  5EEG A;  3H3U A;  2RKH A;  3K4J A;  3HPH A;  2DIE A;  3RDI A;  1EKE A;  1VQ7 I;  3V7R A;  3CCV I;  4YDT A;  2R7S A;  1YQA A;  2LTP A;  1EZG A;  3KP5 A;  3HOZ J;  5JR3 A;  1RR7 A;  2VQC A;  2E2H J;  3BC9 A;  4FQG A;  5LRS A;  4J00 A;  3ABM H;  2UXN A;  2VUM J;  1SKQ A;  2V7W A;  5CPR B;  4DNT B;  4C2U A;  2ECC A;  3A0H C;  4CCK A;  2QZA A;  4M3F A;  2COM A;  3RKW A;  2V1U A;  2XAJ A;  1SAN A;  4IPA A;  3BG9 A;  4JX6 A;  2ZCW A;  2CUE A;  3TL4 X;  1ZRE A;  2R7T A;  3JUR A;  1Z6T A;  3S1Q J;  3K70 D;  1ETV A;  3DPT A;  3FKJ A;  3H0G J;  1IDK A;  2HOE A;  2GBY A;  3VYT B;  5K1Y A;  2H1L A;  1DP7 P;  2FSW A;  2LP0 A;  5KVR A;  1FBS A;  5DUI A;  2HKX A;  4ESB A;  3U2Q A;  1STZ A;  4WF2 A;  1QZZ A;  3H5N A;  1LQ1 A;  4RD4 A;  3HRM A;  3HUG A;  2Y75 A;  2HOS A;  2DFH A;  2MGQ A;  1W36 C;  4AVZ A;  2PE3 A;  2VJ4 A;  2M5S A;  2D5V A;  3DFG A;  3PNY A;  2F4O B;  3CCM I;  1FOX A;  3BR5 A;  4G94 A;  3BJ6 A;  2MSY A;  2IW5 A;  3S1R J;  4PJM A;  1FT9 A;  5DV5 A;  1ZM4 A;  2K02 A;  4OPV A;  2KRC A;  2VQG A;  1JHH A;  1VQL B;  4TMT A;  2OTL I;  4P5O A;  4D9J A;  2IPQ X;  2L3D A;  2F4M B;  4CXF A;  1F4K A;  4Z4R A;  3OOU A;  4UHT A;  1OB5 A;  2HYF A;  2JSC A;  2HDD A;  3GZ5 A;  2BW3 B;  3QWL A;  3PSZ A;  3CJQ B;  3FX3 A;  2XGD A;  3TDU C;  1K4Z A;  1VLY A;  3IV5 A;  2O0W A;  1DQU A;  1TC3 C;  2B9S A;  3ASP A;  3B8Y A;  2XTW A;  1T56 A;  2VBT A;  3P27 A;  1RKW A;  3C2H A;  3N90 A;  1QA2 A;  4D7N A;  3F3X A;  4KUM A;  2NTQ A;  2NVT J;  2H09 A;  1X4O A;  2I8D A;  4KT5 C;  3ASS A;  2HU9 A;  4RM0 A;  1D2E A;  4W8T A;  1L1I A;  4M72 A;  1JJ6 C;  2O6G E;  3AST A;  3PA2 A;  1BC8 C;  2NT6 A;  1PVE A;  2F2E A;  4Z4W A;  3IAS 2;  2L02 A;  3HUG B;  4G12 A;  4C3J J;  2Y9Z A;  1R00 A;  3JQP A;  3OZU A;  5D4S A;  4PFO A;  2ACJ A;  2JDI A;  4ABZ A;  2DA7 A;  4UZE A;  3WQZ A;  2X4H A;  1EA3 A;  3IH3 A;  2Q6O A;  1KQ9 A;  3IC7 A;  5F27 A;  1FOY A;  1SFE A;  2P7V B;  4OIP F;  1WOO A;  2DQL A;  1ZRD A;  1SAX A;  1NRK A;  4IX7 A;  3TP3 A;  2BM6 A;  4IOC F;  2CND A;  2CQQ A;  2TDX A;  4LBY A;  2O7O A;  4KKT A;  2L5Q A;  3VYS B;  4Y9R A;  2DT6 A;  3RTR A;  5EEA A;  4B3G A;  5KCM A;  5F04 A;  3CCQ I;  2BY1 A;  3S15 J;  1YIT I;  1XSV A;  3ISP A;  2JJ1 A;  3OV8 A;  2XEX A;  2Y30 A;  3GTQ J;  1XDS A;  1O8M A;  4BY7 J;  1D8J A;  4YXW A;  4NDL A;  3EYY A;  2OBS A;  3C7J A;  2ZB9 A;  2WV0 A;  4Z4Z A;  3OSF A;  1UST A;  2E34 A;  2NRA C;  2RRE A;  5FLM J;  2KJC A;  4E7J A;  4I6Z A;  4XLE A;  5LEJ A;  5DS0 A;  3HHG A;  4Y4R A;  1ZRC A;  1FOK A;  1V55 H;  2B7B A;  3MD2 A;  1YE9 A;  2BXZ A;  3NAU A;  1VQ8 B;  2EFQ A;  3GVJ A;  4B4D A;  4YRV A;  3I55 I;  2QEX B;  1RKT A;  4EJU A;  4BY1 J;  1W34 A;  3GQA A;  1NK3 P;  4LIV A;  5J8F A;  3RJP A;  1T6S A;  3KEW A;  3CTA A;  1FP1 D;  2H8W A;  4XLC A;  2R7U A;  5KSW B;  2L7M P;  5IYN A;  4PGO A;  3SQN A;  4P1W A;  2WY7 Q;  1O8E A;  3BDD A;  1PP7 U;  2G0Y A;  2CYY A;  4OZZ A;  3NQO A;  4OOI A;  4CSW A;  1FX7 A;  1RET A;  1FTZ A;  1QFY A;  2V6E A;  4A5N A;  2GWR A;  2K9S A;  1XTA A;  2F48 A;  4MEY F;  1TYU A;  2K9N A;  2DJN A;  1AA7 A;  3ZN1 A;  2VPL A;  3TBI A;  3BCD A;  1O4X A;  4NK8 A;  3GYH X;  2O8X A;  2CQN A;  1X19 A;  3FXM A;  2OK8 A;  4XLP F;  1JA0 A;  4ZGQ B;  3A2K A;  4PCQ A;  4CCM A;  3RY8 A;  4E7I A;  3IAM 2;  1EFC A;  1K4S A;  1FEX A;  1W0J A;  2XZO A;  2Z3Y A;  4Y3O A;  4A3J J;  1QCX A;  5KAF C;  3UW0 A;  5F0H A;  1V5E A;  2VT3 A;  3ZBT A;  2AO9 A;  1O7L A;  2GOM A;  2RAE A;  2IGO A;  4EGY A;  1N06 A;  4QFM A;  1HDD C;  2WAF A;  1HQC A;  3OKX A;  3KEO A;  3DF8 A;  3I64 A;  1VQN B;  4GQN A;  3ZUG A;  4EGZ A;  2BMW A;  3H9G A;  2VOP A;  2BXY A;  1E3O C;  2W4S A;  4PJN A;  5EG0 B;  4G7H F;  2EFW A;  3T0Y A;  1WJD A;  1OCZ H;  2CMP A;  4CYC A;  3CUQ A;  3E0J B;  3QPT A;  4IZZ A;  3GTK J;  2V7F A;  5HOD A;  3RQI A;  1WOR A;  3MCA A;  3F6V A;  4UXN A;  2ISY A;  3WTT C;  5LD2 C;  4IW3 B;  2V4J C;  3CO7 C;  4HDV A;  1V5V A;  4HX4 A;  3GFL A;  1U78 A;  2Z99 A;  5LHI A;  2HQR A;  3HJE A;  1AWC A;  3ASR A;  3LVB A;  1IB4 A;  5CVI A;  4HBL A;  3OYA A;  2E2I J;  2JA6 J;  2DI3 A;  1QFJ A;  3OEE A;  1ACI A;  2I1L A;  2QKL B;  2HDW A;  3LSI A;  1T6X A;  4Q7J B;  2ADU A;  2ZZF A;  3BNW A;  2C5H A;  1Z21 A;  1VND A;  3AAF A;  3DKX A;  1T5E A;  4CQJ A;  1E3X A;  3BG7 A;  1CLW A;  4FWT A;  2EZK A;  1S8N A;  3LMM A;  2VFP A;  3KIO A;  4P25 A;  3HGY A;  1ETY A;  1W2B B;  4X7C A;  3OJW A;  2J8I A;  1YW7 A;  2B63 J;  1BOB A;  1QUE A;  4HW0 A;  4MEX F;  2XRL A;  2F5V A;  2RGV A;  1EP1 B;  2J7K A;  5H20 A;  1O3T A;  5L3E A;  2ISZ A;  1ZYR F;  4P6Y A;  2LNB A;  1KD1 D;  1J7K A;  4DK1 A;  2GK6 A;  4H9G A;  3ERE D;  3DWL E;  3R0A A;  4H0E A;  2K4B A;  3FXO A;  1GAW A;  4OM9 A;  1QPI A;  3ZMV A;  4G7X A;  2EZH A;  2MLG A;  3GVA A;  4NC8 A;  1LEA A;  2E36 A;  4GYG A;  4CYC B;  2X6X A;  2EK5 A;  2O3F A;  2W7Z A;  2CSO A;  2ZME A;  2HQ5 A;  4IQJ A;  2BHZ A;  3GX4 X;  1Z7L A;  2DU9 A;  2QEX I;  2ZZG A;  2LVS A;  2EB7 A;  1BOA A;  1TVC A;  3K4K A;  2V7V A;  1R1U A;  2RC4 A;  2A5Y B;  3A8I A;  5FL7 A;  2PMZ A;  5FRN A;  1VQ6 B;  2GA2 A;  4GRI A;  3BT9 A;  3RZO J;  2BVL A;  4RAY A;  1BX0 A;  5JLX A;  2KIF A;  3TED A;  3ZQH A;  1VQM I;  2CRV A;  4KNY A;  2IS2 A;  3K0L A;  4WXD A;  1LNW A;  4CCJ A;  4RB0 A;  2FBH A;  2Y48 A;  3FBN B;  2EIM H;  3OS2 A;  1RWR A;  1QQ1 A;  2ZNY A;  1A6I A;  2R6H A;  3QPH A;  4JX4 A;  2M0C A;  1KK3 A;  2LC2 A;  5H59 A;  5JVG F;  2CW5 A;  3MMY B;  3RKX A;  3SDB A;  1I7P A;  2ZL7 A;  2CG4 A;  2EIN H;  3E5Q A;  1HSJ A;  1S5L C;  1NJI D;  3HZJ A;  3WTV C;  1YJW B;  1YJN B;  3F9K A;  4DGW B;  3BH6 B;  1ZAR A;  3AG2 H;  3HIF A;  3PFI A;  4CCN A;  4B43 A;  3IKT A;  3J80 Z;  1NG7 A;  3KEQ A;  3JRD A;  3OMY A;  3C18 A;  3ZCO A;  2D9R A;  5E3L A;  4C30 A;  1QG0 A;  2LG4 A;  2Y0S N;  1X3W B;  3HRU A;  2MD0 A;  1SFU A;  4RS8 A;  5EF6 A;  1LLW A;  2KL4 A;  1Y8Q B;  3BZC A;  3DKW A;  2LY1 A;  1P7J A;  5B5E C;  4OOX A;  1TWF J;  2RC6 A;  3FM3 A;  4PFP A;  2KRF A;  5KAI C;  1JUP A;  1D0Y A;  1VQO I;  1KYW A;  1S72 I;  4OIO F;  4DIQ A;  2E1M B;  4LLN A;  3ML6 A;  1OCO H;  1TNS A;  4HX7 A;  4WCG A;  1I6H J;  2DMP A;  2A6T A;  5GAG J;  4PUS A;  2ME6 A;  2O0V A;  4I01 A;  2VQL A;  5LBQ A;  4Z4T A;  1TYX A;  4U4B A;  2ZBV A;  4OJP A;  4TV7 A;  1BJA A;  1FJL A;  1MBF A;  1B72 A;  4HF1 A;  1BIA A;  4L0Z B;  2H94 A;  3WWG A;  5HXB A;  3B90 A;  3S1N J;  3VMF A;  4W1U A;  4UVA A;  2BV3 A;  3GF2 A;  2YUS A;  1GT0 C;  2J8K A;  3S93 A;  2KIM A;  3GQ9 A;  1W5C C;  1VF7 A;  4M9S A;  2X1D A;  1E17 A;  1FDR A;  3S32 A;  3ECO A;  3JRA A;  3GWZ A;  1HCR A;  2VBW A;  1WJ5 A;  2WYR A;  3L7W A;  4RGU A;  2CFX A;  3SZE A;  2HYJ A;  1Q7Y D;  4WXC A;  1SD4 A;  5HDG A;  2X6W A;  1R4M B;  1VFC A;  1P9Q C;  4RGX A;  3ABL H;  3L2W A;  3A1Y A;  3SLD A;  2W84 A;  2P5K A;  2K4J A;  2WC2 A;  3UR3 C;  3HGG A;  3QAH A;  4DW6 A;  1VQP B;  2XB0 X;  2M3A A;  1SVM A;  1O8J A;  3TP0 A;  5DUK A;  1PKV A;  5GV8 A;  5M5W J;  3BPV A;  3FWE A;  1YX5 A;  2IAI A;  3QOP A;  4R1H A;  2HKO A;  4DQ2 A;  2VBU A;  2XOK A;  1XGS A;  1ETQ A;  4X0G A;  1EF4 A;  2C4T A;  3E3V A;  4RM2 A;  1SC7 A;  2R7X A;  5F6F A;  3L2Q A;  1F20 A;  2X6Y A;  2MAB A;  1KK2 A;  2ELK A;  2VBM A;  1OFC X;  4RM3 A;  3SQV A;  2VE9 A;  2C78 A;  1TT5 B;  3QOE A;  2PI0 A;  4P26 A;  1FMW A;  1H42 A;  1ITY A;  3EUA A;  4TMZ A;  4LBV A;  4GDF A;  3F22 A;  4EJO A;  2JUC A;  2H1K A;  1XCV A;  4S04 A;  1X4P A;  4MO7 A;  1BL0 A;  1SMT A;  1WJC A;  3LSG A;  1SEU A;  3CXC B;  3OYF A;  4ASU A;  2FEZ A;  2YSR A;  2VJJ A;  1R71 A;  3HC7 A;  3WE3 A;  5GPA A;  1KU3 A;  3C2G A;  2DDB A;  2CV0 A;  1W35 A;  5KK1 A;  2VNI A;  3BTL A;  1DDI A;  4Q4Z F;  1BJK A;  4N3G A;  3VSU A;  1E1R A;  4M73 A;  3CUO A;  3JSP A;  4I7H A;  1YJW I;  5CKT A;  2E7X A;  3HOY J;  1JKR C;  2ZTN A;  3I3L A;  4XKB A;  4XL9 A;  4QVA A;  1TTT A;  4K1X A;  3PA1 A;  3HKZ N;  2VT2 A;  2GXB A;  1HF2 A;  2VBE A;  5IK2 A;  5A2Q K;  4UUS A;  2V9K A;  5H6Q A;  4FE7 A;  2Z6B D;  2GJP A;  4II2 A;  3SZG A;  1QRY A;  2WSS A;  4IHT A;  3CUQ C;  4L9N A;  2O17 A;  2HTJ A;  2IT0 A;  2DYS H;  2WJY A;  2DQR A;  3LNQ A;  2BM5 A;  3HB9 A;  1OLT A;  5LRR A;  4JQF A;  4LGW A;  3HOT A;  3KZI C;  1KU7 A;  1JGG A;  3F8C A;  3LO8 A;  3CRZ A;  1VLO A;  4ASN A;  2X9D A;  5D5U B;  3F0C A;  3ZR8 X;  4KN4 X;  4BEH A;  5HVQ C;  3IWZ A;  5FFX A;  1N08 A;  2L4M A;  4I0B A;  5GAH J;  1TP4 A;  1IGN A;  3TH0 A;  1YYV A;  4PJJ A;  3VMV A;  4N4N B;  2XF6 A;  1F5T A;  3AVU A;  2P6S A;  5J6X A;  1MBE A;  1XMA A;  2FOW A;  3OYH A;  4A3C J;  4UUT A;  5C4X J;  2FML A;  2XAG A;  2CF4 A;  4ZCL A;  2KQR A;  4RAG A;  3OEH A;  4XLF A;  1S0U A;  3V4G A;  5KW9 A;  5D8K B;  1VQ4 I;  4QVJ A;  4OAZ A;  4DQL A;  3FJO A;  3IH2 A;  1R58 A;  3OIP A;  3LSP A;  2IS4 A;  2AS5 F;  2QGG A;  3FIW A;  2LD5 A;  4RLZ A;  4U87 A;  2VI6 A;  3G3Z A;  1O8I A;  1YJ9 B;  2WA0 A;  2GQF A;  2LF7 A;  3E6C C;  3H5A A;  1KCC A;  4UUS B;  1IDZ A;  1P6R A;  2VNJ A;  5E3N A;  1P4A A;  1EFR A;  5F4J A;  1G7T A;  2E2J J;  4B3X A;  2VBY A;  1IO2 A;  3L9F A;  4IXA A;  4MHG A;  1S3J A;  3KZY A;  2MC4 A;  3S3N A;  2B5O A;  5TJJ A;  2F5E A;  2OD5 A;  4YII A;  3AG4 H;  3PM1 A;  4HEA 2;  2ZME C;  4A93 J;  1BX1 A;  4OJO A;  1RU4 A;  1WJF A;  3U2R A;  1Q1V A;  2V5I A;  3G05 A;  3AVV A;  2PMU A;  1JTA A;  4BEH B;  3PEN A;  3ZQG A;  1RRJ A;  2ZJP F;  5FKN A;  1QA6 A;  3CC7 I;  1VQP I;  3WG7 H;  1I1G A;  5EGO B;  4AU7 A;  2E1M C;  2KZG A;  2JZY A;  3ONQ A;  3PUB A;  5CVJ A;  4F52 A;  1MRZ A;  3A35 A;  1EH6 A;  1GXQ A;  4PC6 A;  2QZ8 A;  3L00 A;  3CC4 B;  4YZA A;  1WXR A;  1SFX A;  2EIL H;  1TLH B;  2FJ1 A;  4X7E A;  1T0F A;  3A01 A;  1U5T A;  1MMD A;  3OS0 A;  1EH8 A;  4RBO A;  1DDN A;  2R92 J;  2R7F A;  1WSV A;  3B73 A;  3U1K A;  4LFU A;  2MW8 A;  1R49 A;  3LMW A;  4CO8 A;  4FE4 A;  4M3E A;  1WVR A;  4ZZL A;  1DPR A;  3H9J A;  2KIS A;  3CMA B;  1B6A A;  3EUH C;  2DDA A;  2WZN A;  2EIJ H;  5DN6 A;  3CDI A;  4MQ9 F;  1O8F A;  2HDC A;  3WND A;  4I98 B;  4KMF A;  1S29 A;  2CQX A;  3CB4 A;  3HSR A;  5K5R A;  1O8K A;  5LGT A;  4XN3 A;  4XON A;  4KYW A;  2JA7 J;  2Y31 A;  2Q6L A;  4MQV A;  3VPR A;  1D8T A;  4G1V A;  2YPR A;  2L01 A;  1ON2 A;  1YIJ I;  5E20 A;  1YFH A;  1KQ0 A;  4X07 A;  1MMN A;  1XG1 A;  4EJT A;  3F21 A;  4HE6 A;  3IH4 A;  1VI0 A;  2FQ4 A;  5C1C A;  4FIS A;  4KIT B;  2E5N A;  2IGN A;  3I4N J;  3CLO A;  3ZQI A;  4PSW A;  1TNT A;  1UB9 A;  1YG2 A;  1U8R A;  2GA1 A;  1MBJ A;  3ZGK A;  4KMU X;  5F1R A;  2LDU A;  3FHZ A;  1UAA A;  3GBG A;  3EQO A;  1YHQ I;  2JIZ A;  4EMS A;  2MD5 A;  2VFM A;  2A68 F;  1YS6 A;  1OYW A;  4A6D A;  4NUB A;  1U5T B;  3OL4 A;  5IYQ A;  1MJB A;  1OJL A;  1O88 A;  5LFA A;  4BKX A;  3G1O A;  3E7L A;  2VFO A;  4BPR A;  1KA8 A;  4RDK A;  1IV8 A;  4W8Q A;  4G6D A;  1CF7 A;  5E8I A;  2XDV A;  4X0C A;  2K85 A;  1YTY A;  3Q39 A;  2QA4 B;  2XAQ A;  4XIC A;  2JT1 A;  2WAE A;  3EET A;  1R7J A;  2Z8G A;  3TOB A;  4FK8 A;  1ZG1 A;  3GLL A;  4GO1 A;  1FBU A;  2H6C A;  2LRE A;  2O03 A;  3PQJ A;  2XRO A;  3S14 J;  4HLX A;  1ZGW A;  2Y0M A;  4LBZ A;  4U7B A;  3CES A;  3DEW A;  2OZU A;  4QUZ A;  1VQ5 B;  3DXJ F;  3BR1 A;  3QYB A;  5FRO A;  4GYI A;  3G4S I;  4LLG F;  1ZM2 A;  1I6X A;  3E1S A;  4RA2 A;  1K78 A;  1I1S A;  3ES9 A;  2OTJ B;  1ZM9 A;  2IBD A;  4DZP A;  1HOM A;  2QMU A;  4I2O A;  4CZC A;  5D6F A;  2HXI A;  3S16 J;  4J0Q A;  4RD2 A;  1IDY A;  1PUF B;  3VST A;  3S8P A;  1D5V A;  2GRE A;  4OP7 A;  1JRG A;  1D0Z A;  1JI8 A;  5DCF A;  3QPS A;  4Z05 A;  2COB A;  2ZXW H;  1G4D A;  2K86 A;  4DYQ A;  4HDU A;  1FNB A;  3SZT A;  2BSA A;  1T38 A;  3QFR A;  3A03 A;  1BLI A;  1RZ4 A;  2DMQ A;  1FZP B;  3NAW A;  3ULQ B;  3K69 A;  3CPW B;  1N75 A;  2WY8 Q;  3CMM A;  1O8D A;  2STW A;  3VWB A;  3AG3 H;  3P7N A;  1CF7 B;  3S2H J;  1FYM A;  2O6W A;  3ZZU A;  2Q6I A;  1LLZ A;  1Z7U A;  5DEQ A;  4PC3 A;  1VHE A;  3ZQ7 A;  1E43 A;  1ZAO A;  3IHU A;  2GZW A;  4ZCM A;  2XB5 A;  5BMZ A;  1BN5 A;  1G7C A;  4EW9 A;  3GEZ A;  3CC4 I;  4A2U A;  2NVQ J;  2R7D A;  2ODL A;  3MVP A;  4PJL A;  1GJR A;  2QDX A;  5M5Y J;  4RB1 A;  5ILV A;  4AUX A;  2DLL A;  2OYN A;  3M4O J;  3WU1 B;  1YX3 A;  4BNC A;  3UNG C;  3U6K A;  3BTC A;  3U9G A;  3SJP A;  5DNS A;  4KT6 A;  1K78 B;  1LFU P;  3BWG A;  3U21 A;  5LHG A;  4CGZ A;  4QIW N;  2ZZE A;  5L46 A;  4X7F A;  3FXQ A;  2QM3 A;  5IT3 A;  1QU3 A;  3ZQC A;  2PMH A;  4BHP A;  1XGO A;  4IRH A;  3OYN A;  3CMA I;  3CCE B;  1W7P D;  2GXA A;  3CME B;  4BJ6 C;  2VJ5 A;  1K4T A;  1WH7 A;  2C77 A;  2QYO A;  4UUV A;  2PIA A;  4QV2 A;  4RD6 A;  4ON0 A;  4OWR B;  1O3Q A;  3FMS A;  4ITV A;  5DD8 A;  1O3S A;  3O8G A;  2BX6 A;  1FYK A;  2XAH A;  2NYX A;  1GVJ A;  1WJB A;  1X1D A;  1Y1V J;  2QSF X;  3LST A;  4L5J A;  3WTS C;  3HRT A;  5FKL A;  3W2W A;  2DJI A;  1PXZ A;  2XT4 A;  4MLO A;  4E7K A;  4GXO A;  3K4M A;  3R61 A;  2CO5 A;  2BGJ A;  1V5F A;  4OOS A;  5ICG A;  1TSP A;  1TQI A;  3M8E A;  3JQR A;  2A5W A;  4P2N A;  2RQP A;  4Y15 A;  2F5F A;  5HS7 A;  3L2R A;  3ZZ0 A;  1LDJ A;  4GCV A;  5ERI A;  5JMC B;  2XAU A;  2QCO A;  2DFE A;  3PL8 A;  3CD6 I;  1QHH D;  4G7Z F;  3QU3 A;  3DLA A;  1JTX A;  2VPR A;  3GO5 A;  4LB5 A;  2Q8K A;  1MH3 A;  4X7D A;  3VO1 A;  1OR7 A;  3S3M A;  4M9Z A;  5HKK A;  1E3P A;  1IRX A;  1RNL A;  2GPJ A;  1QQI A;  4AIK A;  3D26 A;  2IA1 A;  2XRN A;  2VBS A;  4OZY A;  4PMH A;  5LGN A;  3OYB A;  2CU7 A;  4ZJZ A;  1D5Y A;  1KYZ A;  2PMZ N;  5CVU A;  1LKX A;  1WGX A;  2OA4 A;  4YZQ A;  1VF9 A;  3CDH A;  4XR6 A;  4YC5 A;  4IL6 C;  3FXK A;  1MZB A;  1OB2 A;  2P5V A;  4KA4 A;  1DBG A;  5IP7 J;  2EFP A;  3J7A Y;  2WB1 A;  3CCJ B;  4PSX A;  4A3I J;  1R5H A;  3LSM A;  2R9V A;  3NAR A;  1OGO X;  3WTU C;  2XGJ A;  4HV6 A;  4WZL A;  1BJZ A;  5J1R A;  1CNF A;  1YW8 A;  1OFD A;  1OYI A;  2Q1Z B;  2DT5 A;  1JTY A;  2VXD A;  1OYY A;  3P9I A;  1Y0U A;  3K4L A;  4DYR A;  1K61 A;  1G7S A;  4EJV A;  2BZT A;  4EH1 A;  3CQZ J;  1PJ7 A;  1AIR A;  2E1B A;  1T0F C;  3BH7 B;  1SAU A;  4RCZ A;  1U5T C;  2KHM A;  2ESH A;  2DOA A;  3G1M A;  4G6T B;  3AKZ A;  1Y39 A;  5IT9 Z;  4BUP A;  2DET A;  3RKY A;  1DDG A;  1LUJ B;  3LSH A;  2ECB A;  1T2K A;  1D1B A;  2E60 A;  3D5S C;  2PMD A;  1K9M D;  1LFB A;  3D1N I;  2HMA A;  1MMS A;  2K40 A;  1IRF A;  2KIU A;  4E7L A;  3PSS A;  3HAG A;  1Y0Y A;  4A12 A;  5J1Y A;  2DOG A;  3W2G A;  1V54 H;  4HQM A;  3ROU A;  1SFO J;  2B0R A;  3JU4 A;  4MYU A;  2DA5 A;  3RZD J;  3VYR B;  4QSH A;  5E3O A;  3FKS A;  2DPU A;  5ED4 A;  1Q1H A;  2Y69 H;  5FO0 A;  3SYJ A;  3D0S A;  4F55 A;  2YX4 A;  4V2G A;  5HLH A;  3CPX A;  5FA6 A;  1POG A;  5CQE A;  1FTT A;  1R9T J;  5ICE A;  3CCE I;  5JHU A;  2DAO A;  4DNC A;  3DBL B;  5BSX A;  4LC0 A;  1O57 A;  1R5O A;  1TWC J;  1OCP A;  2J5O A;  2YWF A;  1IXR C;  1XGM A;  2QVO A;  5DDG A;  5FO1 A;  2INV A;  1WWX A;  3W6K B;  1KQ8 A;  1TWA J;  1QGP A;  2X1E A;  3PQK A;  2EIX A;  2F3L A;  4AF6 A;  4KKU A;  1U0J A;  3OW7 A;  2HDN B;  3U1D A;  2X51 A;  3HEF A;  3VDX A;  2LYC A;  2L9S A;  3FZV A;  2P7C B;  1DPU A;  2KVO A;  3K1P A;  4XLH A;  2VFN A;  2DOF A;  4JBA A;  2ZC2 A;  2M4K A;  1ZHF A;  2ZBK A;  1U9N A;  3KLO A;  3LWF A;  4WWV A;  5H5J A;  2BPO A;  4MXN A;  2IJL A;  5BOX A;  1B8I A;  2QKM B;  1HW5 A;  2W82 A;  3L09 A;  2MC3 A;  4O5V A;  4DYC A;  2ZBU A;  3ZPN A;  1TUI A;  2MBF A;  2L0K A;  1QX4 A;  3VEP A;  1Z6R A;  1N77 A;  3LAJ A;  4A0Y A;  2ZXI A;  2JA8 J;  1UD5 A;  2LKS A;  5HOO A;  2BBY A;  3WY9 A;  4KIS A;  2BY3 A;  1EFT A;  4BBR J;  1K28 D;  1YIO A;  5K7F A;  3CO6 C;  4X06 A;  3GRH A;  4I84 A;  1B2R A;  4AYB A;  2INU A;  1R5I D;  3CP8 A;  4L0Y B;  1F9N A;  4BXU A;  1TQP A;  3ZIA A;  2ELH A;  5JI6 A;  2ESN A;  2WJV A;  3VNU A;  1WU8 A;  2BEO A;  1V4R A;  3BG5 A;  1HDP A;  3H35 A;  3OOP A;  2BGI A;  4IO9 F;  3WTZ A;  1IRZ A;  3OYM A;  3H9Q A;  3QFS A;  4G6Q A;  4RDU A;  2AHQ A;  3CCJ I;  3WHC A;  3VFZ A;  2ZJQ F;  2J5P A;  1Y56 A;  3ZMZ A;  3BG6 A;  1PYV A;  3TW7 A;  1RES A;  1BR4 A;  2JTV A;  4EEF G;  5THX A;  1QJV A;  4KIC A;  1E0E A;  2Q6K A;  1CQT A;  3F8F A;  3H3Z A;  1VQL I;  4P6V F;  1ETK A;  2JUG A;  1LEB A;  1KTV A;  2V79 A;  3DU5 A;  4A0X A;  1EJ9 A;  2LY2 A;  5F0C A;  3GIR A;  2JA5 J;  1FIP A;  1KU2 A;  2A3S A;  2UVE A;  5IPA A;  3NWS A;  1SD5 A;  2KP6 A;  2QQA A;  2KPM A;  5FJ8 J;  4A3B J;  4KN7 X;  3N97 A;  5IYD J;  5EZG A;  3LQR A;  3GZN B;  5DYM A;  4A3E J;  3FY3 A;  3OIQ A;  1LFP A;  3H94 A;  4CUG A;  2E1C A;  1ZLJ A;  3G1L A;  4HX8 A;  4XRS G;  1J0R A;  4RLQ A;  1DUX C;  3K4N A;  4CYD A;  2HNH A;  3CMY A;  2BN4 A;  2CW7 A;  3RPU D;  2EWN A;  1W0U A;  2YUH A;  5IP9 J;  3ZPP A;  4DZJ A;  1JKQ C;  2HWV A;  5CLS A;  2YU9 J;  1LPQ A;  3CC2 B;  2DA1 A;  2FNA A;  4BE0 A;  3BCF A;  4ZCI A;  4EM0 B;  3CW2 A;  3R6J A;  1W4M A;  1WDT A;  3PNT A;  1FC3 A;  2LMD A;  4XQF A;  2E1R A;  4IHS A;  2D2W A;  2FUG 2;  1JUM A;  5CYV A;  4YFO A;  5D8L B;  2IVM A;  3FMQ A;  3AVX A;  3J80 K;  3PSF A;  4NK6 A;  4M74 A;  3K70 C;  1OMI A;  3M1C A;  1A31 A;  3BY6 A;  3O8H A;  4C43 A;  2V1X A;  1VTN C;  1GR1 A;  2XTY A;  5JBQ A;  2EH3 A;  1A35 A;  1IAW A;  4BXF A;  3C2B A;  2M8E A;  2KFD A;  3FDY A;  1A04 A;  3DBH B;  1YI2 B;  3KFW X;  1B4A A;  3K2Z A;  1DP3 A;  4Y7C A;  2IGK A;  2F4N A;  2M5W A;  4Z03 A;  3ONY A;  2YU3 A;  4A0Z A;  1OR7 C;  3MZY A;  3I53 A;  2IEK A;  4IRG A;  2DCE A;  3W5H A;  3HBL A;  3KP6 A;  4HLY A;  1Y8R B;  4G1B A;  2DMN A;  5ICC A;  1RQP A;  4ZDO A;  3B6C A;  2P8T A;  3IWF A;  1QFZ A;  5CDF A;  1MW7 A;  3CUQ B;  4N0B A;  2XSD C;  4F91 B;  3A3B A;  4RDJ A;  3CCL B;  2AQF A;  2LFB A;  4XRF A;  4NC6 A;  2ELJ A;  4YEJ A;  1IW7 F;  1SKY B;  3JRG A;  1VQ8 I;  2XGE A;  1IUY A;  1NG6 A;  1ZUN B;  5D5V B;  3BP8 A;  4CHU A;  2JN9 A;  2NV4 A;  2P3M A;  2KDO A;  4GGG A;  4BHC A;  2VN2 A;  4HWV A;  3FXU A;  1XGN A;  4XOR A;  2QQB A;  5B66 C;  1IG7 A;  5HS8 A;  3MKZ A;  1NH3 A;  4WX9 A;  1I3A A;  3DPL C;  4NQW A;  3K4B A;  1NB9 A;  3OP1 A;  4Z4Y A;  1PE9 A;  4CZZ A;  3HHH A;  4K2E A;  1WPK A;  3K1N A;  2OPT A;  3JTH A;  4MTE A;  2GQQ A;  2R7W A;  2R93 J;  1E3Z A;  2ZFU A;  4Q48 A;  3SJM A;  2JPC A;  4UY8 I;  4L9T A;  3NRV A;  2M9H A;  3RYR A;  5J35 A;  2IA0 A;  2AXL A;  4BGD A;  3HTU A;  5EJC A;  1E1Q A;  1MDM A;  2FQ3 A;  1X3Z B;  2K7L A;  4RLF A;  1C0W A;  2ID3 A;  2QBY A;  2L9V A;  5J1U A;  2IP2 A;  1BIB A;  2W57 A;  1FRQ A;  1XX5 A;  5KNL A;  2W1O A;  1LE8 A;  2WR8 A;  4TSF A;  4YEI A;  3EUH A;  4RAF A;  4OIR F;  2QTZ A;  1OFM A;  1S7O A;  2NS7 A;  4OIQ F;  4QPQ A;  3OFN A;  2OV7 A;  1MBG A;  1QO0 D;  2G7U A;  3Q3S A;  3WNB A;  3SDG A;  2BM4 A;  3GQ7 A;  3DTI A;  5HNH A;  2ZME B;  4WZE A;  2NST A;  4BQN A;  1EP2 B;  4RCY A;  3S2W A;  4CH7 A;  1JGS A;  1VQN I;  4IHY A;  2EZL A;  4RB2 C;  3V42 A;  5L3B A;  3QFC A;  1RMG A;  3V7S A;  4U49 A;  1LJ9 A;  2VKH A;  2NNY A;  1E79 A;  1MBH A;  2PBI A;  3ECH A;  1R5N A;  1FMV A;  1FY7 A;  4NQW B;  4YFK F;  2XPV A;  1IRG A;  1EH7 A;  4NCN A;  5IYB J;  4M6Y A;  1HKT A;  1EA0 A;  3ML3 A;  1XCB A;  2XV4 S;  5E1X A;  5F4M A;  1PUE E;  4F7Z A;  3CC2 I;  5ICF A;  3RYP A;  3W6J B;  3SY2 A;  2EFO A;  4ROX A;  3R0J A;  4BDZ A;  2QWW A;  4KKS A;  2BVM A;  2PX9 A;  2BOL A;  2K9M A;  1R36 A;  1DBO A;  1U8B A;  1HKQ A;  4ESJ A;  4A3M J;  1X1C A;  1SVL A;  1MAB A;  3ABU A;  3HXL A;  1RPW A;  1R1T A;  2QBY B;  2ZXJ A;  2X3U A;  1P2F A;  1HW1 A;  3UKG A;  1W9X A;  3OYD A;  4X05 A;  1ZH5 A;  3AVT A;  3PFY A;  1LE8 B;  3NB2 A;  2P0W A;  1ZGJ A;  2L9R A;  2VQH A;  4C2T A;  4XLA A;  2CW0 F;  3GTL J;  1W5T A;  2VC1 A;  3ONU A;  1TW3 A;  1JUS A;  1FNN A;  3KP7 A;  3QP6 A;  2M2E A;  3NWT A;  1M1K D;  2QXZ A;  4OOV A;  5GP9 A;  2XC1 A;  3KP2 A;  2WAQ A;  4B48 A;  1T6Z A;  2B7C A;  1TTY A;  4GFB A;  3GVK A;  2WAD A;  3S17 J;  4HIZ A;  3MQ0 A;  3K6G A;  1QRC A;  3ZQF A;  4U0W A;  1ODD A;  3GQ8 A;  5AMV A;  3W2A A;  3T9G A;  1OQY A;  3MMP A;  1D1A A;  1XS9 A;  3W6V A;  3VSK A;  2VNK A;  2NPF A;  3PUF A;  2HOA A;  5LLQ A;  1JKO C;  1FRN A;  3AGP A;  3Q9V A;  2XHK A;  3M7G A;  1ETW A;  4KDP A;  5IYR A;  1J09 A;  5H6R A;  4KFC A;  3OZW A;  2KRH A;  2CQ7 A;  3BTJ A;  3B6A A;  2M34 A;  1W5S A;  4LD5 A;  1X2N A;  2P4W A;  3CDL A;  1QVF B;  1VZ0 A;  3M3Y J;  1NB0 A;  2HYG D;  5FD5 A;  1B72 B;  3QYE A;  1OGJ A;  2F4I A;  3LSR A;  1W0T A;  1UD2 A;  2XT2 A;  2CFO A;  3QYF A;  5J47 A;  5FKM A;  3OWT A;  2P5L C;  4N4O B;  1DU0 A;  2L54 A;  3AL0 B;  3TO6 A;  2JJ2 A;  1TWG J;  1XG2 A;  1WH5 A;  3BCA A;  1VQ6 I;  2Y2Z A;  1WMR A;  1K7A A;  1ZGA A;  2NAZ A;  1BHE A;  2HTS A;  3GFJ A;  3PNV A;  5C44 J;  3N4M A;  2QE7 A;  2DA2 A;  4M71 A;  4NHJ A;  1NHC A;  1ZM3 A;  3DBR B;  3HOW J;  2KJB A;  3RSN A;  1IJF A;  1Z91 A;  3GVL A;  3ZXS A;  5IY5 H;  1Y1W J;  3S3O A;  2UUZ A;  2LOO A;  4LIT A;  2R5Z A;  3SLN A;  1YJN I;  3GUD A;  2O1D A;  2IS6 A;  2L7K A;  2BHY A;  3P9C A;  1TW2 A;  2L7Z A;  1JA1 A;  3OZV A;  4C2M J;  3BPX A;  1ZK8 A;  2GIV A;  3CCR B;  1R23 A;  3T8T A;  1Z3Y A;  2Z1D A;  2EPF A;  5B1B H;  3BJO A;  1MBK A;  4BJ5 C;  2OJE D;  1HC8 A;  3GLX A;  1COW A;  1WCM J;  1A5J A;  4DJA A;  4TMX A;  1Y0R A;  3GW2 A;  1ZR2 A;  1IN7 A;  1IXC A;  3Q0V A;  2RVC A;  1GO2 A;  2EV6 A;  4HAM A;  2A69 F;  1FWZ A;  5M3F J;  3HDD A;  1XSD A;  1I50 J;  2DOE A;  2WPD A;  1XFO A;  4QTR A;  2HPM A;  2LY9 A;  3BZK A;  3F72 A;  4QPO A;  2NNN A;  4Z1M A;  2F6C A;  4YEL A;  1ZR4 A;  4A3D J;  2FRH A;  2DT7 B;  3P5J A;  3BCB A;  4Z6Y A;  3CJN A;  2E71 A;  1T08 B;  2DYR H;  1YW9 A;  4FX4 A;  1ULY A;  2CV1 A;  1D3Y A;  3SEZ A;  3OYE A;  3HPG A;  1GHC A;  3W5U A;  4O6J A;  1XE1 A;  4IHW A;  3C3W A;  5GTH C;  2VL8 A;  3J7Y J;  1QHG A;  1HA3 A;  2GAU A;  2YR2 A;  3BTI A;  5TY0 A;  2V4D A;  1FND A;  5A88 A;  1S7A A;  2WB1 N;  2A05 A;  2DEU A;  1LDK B;  5FNZ A;  2BE5 F;  5TGT A;  3PIP F;  4YAO A;  1V3F A;  1FBQ A;  1HZE A;  5TV2 A;  1Z05 A;  2UV1 A;  1YLO A;  5AN9 A;  3KPH A;  4PC2 A;  2LR8 A;  1WFX A;  5IOY A;  3T8R A;  3FMR A;  2VXZ A;  3GTP J;  4Z06 A;  2HGC A;  3F6O A;  4XLN F;  3B02 A;  4OJL A;  4TMW A;  5C1E A;  5ILS A;  4S05 A;  4UV9 A;  2RC5 A;  1KQ5 A;  1IHM A;  2X0K A;  4HA8 A;  2QGU A;  2XC7 A;  3BR2 A;  4A6E A;  1X0C A;  4BS9 A;  1BW5 A;  1KZH A;  1VHO A;  2YWG A;  2L2O A;  5FB2 A;  2VC0 A;  2HQN A;  4M6V A;  2P6T A;  3OR2 C;  3DU6 A;  3QPL A;  4BQO A;  3KEY A;  2C2W A;  1A8P A;  1FIA A;  2JA2 A;  3PUM A;  4L5I A;  1ZG3 A;  4PK4 A;  4XKV A;  1OOC A;  1J5Y A;  5AIQ A;  3SZP A;  4PZJ A;  4FET A;  1APL C;  2F5C A;  1RR8 C;  1N78 A;  3KE2 A;  1XB2 A;  2D74 A;  3E1Y E;  3E97 A;  2WV1 A;  1AHD P;  3LFK A;  2FNP A;  1BW6 A;  3H9N A;  3VMW A;  2DBB A;  3LOC A;  2EV5 A;  4MGR A;  5FGM A;  1JB9 A;  1H9T A;  1A6Q A;  4Z4S A;  2G7H A;  4MR0 A;  1DU6 A;  2R0Q C;  4ZYA A;  1QVT A;  1WJA A;  4I02 A;  1X2M A;  4ENN A;  1M1E B;  2D3L A;  1H8H A;  1J9I A;  3REO A;  4BQQ A;  2OZ6 A;  3R6S A;  2O9L A;  3BRO A;  3DTE A;  4ESF A;  4FTH A;  1BI1 A;  3HTS B;  3HOV J;  2BF4 A;  1F36 A;  2PLY A;  1QA3 A;  3ZN0 A;  4EQQ A;  3WGG A;  2BY0 A;  1W36 D;  4P1V A;  4V19 K;  3B82 A;  1PJR A;  3O2P E;  3ZMT A;  1F1Z A;  2CUZ A;  4N9I A;  4I99 C;  1U6G A;  5FD6 A;  1FYL A;  1Y0N A;  2MH2 A;  3ABT A;  4NBQ A;  2YX7 A;  1IZ1 A;  3RCO A;  3OYI A;  4B44 A;  2HZT A;  2JJ7 A;  2V1N A;  2XZP A;  3W2I A;  4WZK A;  5EEH A;  5J4Y A;  4AIJ A;  3G6E B;  3W2V A;  4BHB A;  2FXA A;  3A01 B;  1FOW A;  1YO5 C;  4PGG A;  4LOC A;  2V1D A;  1NDH A;  1I3Q J;  1SFK A;  1B23 P;  4RDL A;  1JHF A;  4M3B A;  2F43 A;  1S6L A;  4UB6 C;  1XB4 A;  3DTK A;  1P4W A;  3ZOB A;  4UVC A;  4RD3 A;  1BR2 A;  2D1H A;  4C0S A;  3AL0 C;  3CCY A;  3LSJ A;  2JN6 A;  3G73 A;  3GFM A;  4XN0 A;  1EFU A;  3ASO H;  3B8H A;  4YFX F;  4UNO A;  2PJP A;  1G3W A;  4XOP A;  3I59 A;  4P55 A;  3IKV A;  4YG2 F;  3KX2 A;  4ENM A;  3V8K A;  1OB0 A;  2I5U A;  4RD1 A;  4U0V A;  1PJ6 A;  1TZL A;  4YAU A;  3AK5 A;  5HZB A;  2UXX A;  1G6N A;  2AXT C;  2CQK A;  1FLI A;  2EJR A;  2K9L A;  3M8F A;  3OYJ A;  4C2L A;  2UVF A;  5GTI C;  2PG4 A;  2XGX A;  5A8A A;  1SMY F;  1YJ9 I;  1XMK A;  3DKY A;  2G9W A;  3PO2 J;  2X48 A;  4OPO A;  1ZKG A;  3LA7 A;  3O3K A;  1Z3X A;  4I09 A;  1VQK B;  4EAT A;  2OBP A;  4BYY A;  3JAM K;  1XC5 A;  2R7Q A;  1YX2 A;  1QRB A;  1J59 A;  2IOU G;  4JP0 A;  2DN0 A;  2NTB A;  3SXY A;  3VB2 A;  1WOP A;  5ILU A;  1AKH A;  1Z9C A;  5GV7 A;  1KGS A;  2JPB A;  1DAR A;  3TOA A;  3EQL F;  5HLI A;  5B3S H;  9ANT A;  2EIK H;  1MMG A;  4ZGN B;  1QH0 A;  4XSZ F;  4EJW A;  2PYG A;  3KYC B;  1K8A D;  4HSR A;  2R5Y A;  3CCM B;  4ZTF A;  1N05 A;  3IUO A;  5HLT A;  2PJR A;  4B3F X;  3C1D A;  4AVP A;  1XMX A;  3V8J A;  1QNT A;  1YLF A;  2ICW G;  3Q6R A;  1UHM A;  1XN7 A;  1Q9S A;  2VYQ A;  4ZDL A;  4BE2 A;  1H9G A;  2E1O A;  2LKP A;  2PLF A;  4LG0 A;  2EZI A;  2NS0 A;  2XGC A;  1FP2 A;  4MFD A;  5FO5 A;  2CK3 A;  1H8E A;  3MZ8 A;  4Z4U A;  5BNG A;  3PVD A;  5GAE J;  3L2V A;  4E6K G;  5L3G A;  2A61 A;  2R4G A;  2W85 A;  2E5Z A;  3TDZ C;  1USS A;  5E6T A;  4PGH A;  4BXX J;  3E6B A;  1IA5 A;  4ZC3 A;  1K6O A;  5IYW A;  2TCT A;  5DCM A;  4HF2 A;  2DA6 A;  5TIS C;  2ZL5 A;  4M53 A;  1U9O A;  2DO7 A;  1ZN2 A;  5JHF A;  2DPD A;  3B78 A;  3W2H A;  1ETO A;  2BVN A;  4D5C A;  1TLL A;  5IT9 K;  1QGZ A;  2HFH A;  4H4K C;  5IYP A;  1AKH B;  4D7M A;  3PET A;  2V9P A;  2QQ8 A;  2MH9 A;  5F0F A;  1WI9 A;  3K2A A;  4E7H A;  2BGC A;  3I5U A;  3R4K A;  3OPO A;  2OCE A;  4OIN F;  3K9T A;  5A89 A;  2MG4 A;  3SEQ A;  4M9X A;  5LGU A;  2R5Y B;  3OJX A;  2PJR B;  2CS3 A;  3GTG J;  3KET A;  1B9M A;  3G6E I;  4QWQ A;  1MJ9 A;  2GXG A;  2OQR A;  4IHV A;  2FX0 A;  2A07 F;  3WG9 A;  3SKB A;  4JX5 A;  2ID6 A;  1QZE A;  3VYU B;  3CF5 F;  3JAM Z;  2DK5 A;  2VKV A;  4LG0 B;  1P7I A;  1CNE A;  1ENH A;  3TO9 A;  2LH9 A;  2QA4 I;  2NT9 A;  3CCQ B;  2DTR A;  5M5X J;  2QSH X;  1KK1 A;  2PEX A;  2K3F A;  3H36 A;  1HW2 A;  3OL3 A;  2MLK A;  2HLD A;  1G3T A;  5JLV C;  4I0A A;  1CZF A;  5DCM B;  1BBY A;  1I5Z A;  5AON A;  3KP4 A;  2I10 A;  1VQ5 I;  4HV5 A;  1S9H A;  3PSI A;  4BAY A;  1S4M A;  4NBS A;  3JCU C;  2XAS A;  5FKK A;  2PQ8 A;  2AHO A;  2DXI A;  2OTJ I;  3VNV A;  4HE5 A;  1RC9 A;  5FLX Z;  1EWY A;  2BW3 A;  4XD7 A;  2X0L A;  2M7B A;  2KZV A;  1IDJ A;  2V7T A;  2NVY J;  1BN8 A;  2M7A A;  3I55 B;  3Q3A A;  3BQY A;  3Q0U A;  3A8K A;  2QYU A;  1FPQ A;  1QZY A;  2Y9Y A;  4HRI A;  3K4C A;  4YAW A;  4AD9 A;  3H09 A;  3SJZ A;  3LNN A;  1VQK I;  1I27 A;  3FF5 A;  4XOT A;  4Q5S F;  3SEJ A;  2XPW A;  2GIZ A;  1K8F A;  2W00 A;  4HQE A;  2YS9 A;  3LQ6 A;  5E8G A;  3Q9S A;  4E7S A;  1UD4 A;  5GPC A;  3K7A J;  1YOV B;  4IQ4 A;  2LKX A;  4YZX A;  5H2F C;  4ZZD A;  3B4N A;  5K5O A;  1WJE A;  4YZ0 A;  1PDN C;  3QU6 A;  2K9Q A;  3P26 A;  2KDZ A;  2VKD A;  4P12 A;  2RQQ A;  2EWE A;  4M0L A;  4RPB A;  2STT A;  3CP2 A;  2E7W A;  4LLL A;  3L2U A;  4HG2 A;  1IF1 A;  4EV0 A;  3DPU A;  2QTL A;  3AG1 H;  2FF4 A;  3DQV C;  1V5G A;  1R1V A;  3HOU J;  3WYA A;  5E17 F;  3SFI A;  1NK2 P;  1GV2 A;  2HCJ B;  2NOJ B;  5L3F A;  4RD0 A;  2QSG X;  2LF8 A;  2QX3 A;  3ZP5 A;  4AC0 A;  4O3M A;  4A3F J;  1RI7 A;  2Z5U A;  3A3G A;  3CME I;  3P9K A;  1VQ9 B;  4RGR A;  1HG8 A;  1JE8 A;  3I1F A;  5F4O A;  3BLY A;  1BC7 C;  2W6J A;  4G8X A;  1XPX A;  1OFL A;  2VJI A;  4RMN A;  4E0F A;  4PAB A;  1LDD A;  3SUC A;  1H0M A;  1TYW A;  5K7Z A;  1NTC A;  2N8G A;  5TRD A;  5DSZ A;  4IF4 A;  1JT0 A;  1Q86 D;  1X1P A;  2JRM A;  2WAQ N;  2ZNZ A;  3T5X A;  3DEE A;  4YIF A;  2MFZ A;  2DY1 A;  1Z1D A;  4Y33 A;  2X8K A;  2XAF A;  3ABK H;  2FOK A;  5JVT A;  4XMY A;  3BY2 A;  1UHS A;  1O8L A;  1VBL A;  1M90 D;  4OJ5 A;  2Z2S B;  2WZP P;  3ASN H;  2E1N A;  4EM2 A;  1UMK A;  4B09 A;  4JYK A;  2QEN A;  1FSE A;  1O8H A;  3KYD B;  2DW4 A;  5FFZ A;  4R79 A;  3DLL F;  1R5B A;  3WBJ A;  3X2Q H;  4G9Y A;  1IUF A;  4V2F A;  1K83 J;  5D6E A;  2QQ9 A;  4A3K J;  1IN4 A;  5J3L A;  2VBX A;  1ZQ3 P;  1WTH D;  2V31 A;  1J9Z A;  2DA3 A;  1W0K A;  2O5R A;  2E19 A;  2CC2 A;  1N0V C;  1QPM A;  3OIO A;  5J40 A;  2DOD A;  1RUO A;  4P9S A;  1QA1 A;  5M3M J;  4LK1 F;  2AQE A;  2WBM A;  2HVQ A;  1E64 A;  1TWH J;  1YRN A;  2V7X A;  5AIP A;  4YFN F;  5J8C A;  3IL2 A;  2VE8 A;  4ANJ A;  1RIO H;  3V76 A;  3GTO J;  1V0E A;  3WHB A;  2C5B A;  1KTW A;  4FCY A;  3KLN A;  3IP4 B;  3BQJ A;  1MMA A;  3RPU A;  4G6I A;  5EG0 A;  2V7Q A;  1S7E A;  4L9V A;  3NEU A;  1UFM A;  3TKY A;  4OJ6 A;  2FBK A;  3VSV A;  3ZMD A;  1JJ2 B;  3W2F A;  5EMN A;  1B8I B;  1VQM B;  4LK0 F;  4IHX A;  3ZZT A;  4Y7N J;  3TQN A;  3M1E A;  1XDU A;  1HBX G;  2JVH A;  5HNF A;  4U0Y A;  2W48 A;  3WGH A;  1K73 D;  3VR6 A;  5BPD A;  1GDT A;  1P92 A;  1KQS B;  3OYC A;  2FE3 A;  2CRG A;  3M8J A;  2NVX J;  1BI0 A;  1F43 A;  3WU2 C;  4YIR X;  2ZL6 A;  2NTP A;  1UG2 A;  2VBV A;  1D1N A;  3GZ6 A;  1I39 A;  3ZC3 A;  4F92 B;  4B47 A;  4C3I J;  2IGM A;  5B1A H;  5EDN A;  4BQA A;  3WXM A;  4ZDP A;  2VKE A;  1MSF C;  1MKM A;  3P4G A;  2OBT A;  3OYG A;  3W2E A;  3BJA A;  2F1L A;  3BY1 A;  3OE7 A;  1OGI A;  3ELK A;  4FX0 A;  4CIC A;  1YRN B;  1LVK A;  2JMW A;  3OYL A;  2H27 A;  2CV2 A;  3OW2 B;  1JT6 A;  3JQQ A;  1D0X A;  1JKP C;  3SFZ A;  2XTX A;  1U2R A;  3WGI A;  3JX8 A;  4B1R A;  4OMZ A;  1VQ9 I;  2HOT A;  4BU2 A;  4NC7 A;  4EVI A;  1GXP A;  4FXU A;  3T53 B;  1VQO B;  3JRI A;  3VO2 A;  1S72 B;  4II3 A;  2JVG A;  1NBM A;  4DQK A;  2VB6 A;  4XSX F;  1H8A C;  2XNC A;  2CUF A;  2PFB A;  4A5M A;  1WRJ A;  1KC8 D;  4D1Q A;  2PEC A;  1DGR M;  3CLQ A;  3T56 B;  2X3H A;  3Q5F A;  5TR9 A;  3RI4 A;  2FMY A;  2W24 A;  2HQA A;  3KRG A;  1L0O C;  2JK3 A;  3MZH A;  3BR3 A;  2M87 A;  2D45 A;  1O7F A;  2JSP A;  1XQB A;  4FT8 A;  1I18 A;  1TQM A;  3FXJ A;  5HLG A;  1H80 A;  2W7N A;  2OC6 A;  3GTJ J;  3LAP A;  2XKO A;  2R7R A;  3E6M A;  4ZYD A;  3H1C A;  5D5W B;  4OPW A;  2R3S A;  1BM9 A;  2X85 A;  2X6O A;  3ZQL A;  4Z4V A;  1GQ8 A;  2VAS A;  3J7Z I;  4CCL A;  5DTD A;  2Q0O A;  3L1P A;  1N07 A;  3AVW A;  5F08 A;  1X58 A;  1F60 A;  5E79 C;  2B7E A;  1TT0 A;  4P3I A;  6PAX A;  3ZRG A;  2HPI A;  4B8X A;  1KK0 A;  4WZT A;  4F7D A;  2M45 A;  4P96 A;  4E4H A;  4A3L J;  4YAF A;  1WPC A;  2EV0 A;  1DGW Y;  1KZL A;  4WXH A;  3A0B C;  3W5V A;  2RV8 A;  3T1B A;  2FD5 A;  2IXS A;  4Y9U A;  2HXO A;  1UG0 A;  3JRF A;  1SVO A;  3A8J A;  3JSO A;  1QUF A;  5HZA A;  2CJJ A;  3J7A O;  4MNU A;  3U6B A;  3PUN A;  2R7O A;  2D1V A;  3FK6 A;  1IN5 A;  2YWE A;  1OHH A;  4TT3 A;  2DFI A;  4U9U A;  2BSP A;  2B0L A;  5HDN A;  1WQ2 A;  4D5F A;  3G2B A;  3AGQ A;  5DD4 A;  1I8D A;  1WSR A;  1ETX A;  3HSF A;  4RAZ A;  2E35 A;  2GLO A;  4OMY A;  3A02 A;  3K10 A;  4MFE A;  3FBI B;  1UMQ A;  3LQQ A;  3GXO A;  1U3E M;  3WNC A;  4QLC U;  1QVU A;  1B9N A;  2QF7 A;  5CVV A;  2H8R A;  4FN5 A;  3HG9 A;  1ZLK A;  2HI3 A;  2XZL A;  3CCU B;  4KIF A;  4HNV A;  3H3V K;  3MHP A;  2CBX A;  5CJ9 A;  1OKR A;  2UZK A;  2R7V A;  2FBI A;  4PDK A;  1KON A;  5DM7 F;  5E1Z B;  4B3A A;  3OS1 A;  2DMU A;  1ZG5 A;  1X3U A;  4BAC A;  4WQM A;  4JRA C;  3ASQ A;  3IRQ A;  3CCS B;  1ONV A;  4XRM A;  1P4X A;  1SD7 A;  3MKY B;  1T39 A;  2HVR A;  3PO3 J;  4URR A;  4DNR B;  2V26 A;  2K5C A;  2Z16 A;  5B6I A;  2OU2 A;  3D5L A;  3IRR A;  3VOE A;  5BQT A;  4HOB A;  1IJE A;  1PP8 F;  2V7U A;  1UZC A;  3JW4 A;  4HZF A;  2EQR A;  2ZXH A;  5IOZ A;  5LEK A;  2BM7 A;  1UEL B;  2BY2 A;  2Q2E A;  3CF2 A;  1MDM B;  1H89 C;  4KH3 A;  3EPZ A;  3WTX C;  2KKO A;  4X1E A;  4A3G J;  2NXN B;  3H0D A;  3EQN A;  4D0P A;  2OCC H;  3JRC A;  3GQB A;  1IV6 A;  1ZTR A;  4ENK A;  3WOD F;  2RNG A;  2ZKZ A;  2VFQ A;  4G7O F;  5DS9 A;  4PJ0 C;  2XND A;  2UWM A;  4P3Y A;  2OF7 A;  3EDP A;  4FHT A;  4KIG A;  1G3S A;  4HPQ A;  1YI2 I;  1QGY A;  2OQG A;  1VQ4 B;  4J01 A;  2HVS A;  3A4C A;  2GOX B;  1G2H A;  4F93 B;  4IRI A;  3MN2 A;  3LA2 A;  4W8R A;  5J4V A;  2XKP A;  3RQ4 A;  3CJR B;  2VBK A;  4L18 B;  1O8G A;  3KYL A;  3H92 A;  3HSE A;  4AWX B;  4P22 A;  4BDY A;  3LYC A;  2CW8 A;  3E5X A;  3CCL I;  4HF0 A;  1IN6 A;  4L5E A;  4FAS D;  4BL0 B;  4E7Z A;  4YAL A;  2LRD A;  2V6C A;  1JXS A;  3ZMS A;  1MNE A;  3TW6 A;  5BPI A;  3ZMU A;  2JWT A;  1WZ2 A;  1BQE A;  2Q2E B;  4ETS A;  3E5U A;  1AU7 A;  1UD6 A;  1IN8 A;  1IJW C;  4XKW A;  4PC7 A;  3QQA A;  4ZYG A;  1HST A;  2RN7 A;  2R7Z J;  2CWE A;  3WE2 A;  3FPK A;  3OAA A;  4DK0 A;  2VIX A;  3CC7 B;  4UZF A;  1R6R A;  4J19 A;  4P9F A;  3F8M A;  3KP3 A;  1GVH A;  1T95 A;  3GFI A;  2W25 A;  2XF7 A;  1W1W E;  2OAZ A;  3D5R C;  2M1B A;  3BG3 A;  4UZU A;  4I76 A;  2EFG A;  3ZBU A;  4YHB A;  3LJY A;  3HL2 A;  4WWC A;  4Q47 A;  3LSK A;  5C4J J;  2M4G A;  1REP C;  3MCZ A;  2DFF A;  1MGT A;  1T6Y A;  5IYC J;  2ZJR F;  2CUJ A;  4S0H B;  3BC8 A;  4W97 A;  4U7D A;  1G59 A;  1B1B A;  3MKW B;  1BMF A;  2BV6 A;  4XKC A;  3HRS A;  2WTE A;  1GLN A;  1J75 A;  3CCU I;  1OPC A;  5BSY A;  1R5G A;  3I56 B;  2XNJ A;  3W3C A;  1UCR A;  5E1W A;  3GTM J;  1B59 A;  3FIS A;  2C6Y A;  1K79 A;  3ZPL A;  1FSH A;  1GAQ A;  1UD8 A;  1ZRF A;  1AIP A;  4XK4 A;  4UB8 C;  4BE1 A;  3V7C A;  1YIJ B;  3CCS I;  4RPD A;  3ERM A;  3NE5 B;  1LB2 A;  3J81 k;  3L2C A;  3Q38 A;  1K6Y A;  2IQ7 A;  3MEX A;  1E2X A;  4HNT A;  1J2X A;  2ZSH B;  3LA3 A;  3MWM A;  1Z0X A;  4N3N A;  4KIB A;  1OCR H;  4LB6 B;  4BH9 A;  2ZO4 A;  4XID A;  3J81 K;  1XSX A;  1TL8 A;  2M30 A;  1GVD A;  1YHQ B;  1HA8 A;  2VNH A;  3GSI A;  3QRF F;  2O04 A;  3CJT B;  5EZH A;  3RIR A;  3VOD A;  1D8K A;  3R60 A;  3KCC A;  4RJL A;  4UVB A;  2R5Z B;  3ZSC A;  2ME0 A;  1IB0 A;  1BI3 A;  2NOG A;  3MAJ A;  1FNC A;  5CQG A;  3COA C;  2W6I A;  2DYI A;  3ZQQ A;  5EGO A;  1VJS A;  1L3L A;  2JQ7 A;  1EP3 B;  1UD3 A;  2BM1 A;  1EV7 A;  1X1A A;  2XPU A;  1BPL A;  3DV8 A;  2BM0 A;  1QBJ A;  1MND A;  4Y13 A;  2O61 A;  4BBS J;  1G8X A;  3OSG A;  5KHD A;  5E18 F;  1O3R A;  2QLZ A;  3DDY A;  4DBQ A;  3G4S B;  5LMZ A;  1IXS B;  1UHW A;  1RUN A;  2LLK A;  1WSU A;  2GK7 A;  3BH4 A;  4A69 C;  3I4M J;  1V0F A;  2QY1 A;  4P9U A;  2PYH A;  2FU4 A;  3PJR A;  2IA2 A;  2PN6 A;  1R4N B;  3DP7 A;  3V8L A;  5C3E J;  3EYI A;  4C9Y A;  4JMQ A;  3JR9 A;  1HF0 A;  5FLV A;  4ZYE A;  1SD6 A;  4LG3 A;  4NNJ A;  2IRF G;  5E3M A;  1SM4 A;  4R71 A;  3RIQ A;  3E20 A;  4IEJ A;  2ZIT A;  2ZTG A;  4ACB A;  4LIU A;  2GM4 A;  2FX3 A;  3G71 B;  1Y6I A;  2M8G X;  3HYI A;  1W87 A;  2VZL A;  3ISX A;  4M4S A;  2H6B A;  1ZEL A;  1XD7 A;  2K3P A;  3PIO F;  1KRH A;  1G3Y A;  1AMO A;  2EFN A;  4G7W A;  5L3C A;  3FXL A;  2G0E A;  2F5D A;  2XF5 A;  4Z2Y A;  4RB3 C;  3FPP A;  2K27 A;  2LBF A;  1QVG B;  1HKS A;  4XM3 A;  3LQE A;  1P4M A;  5BS6 A;  4ACA A;  4E70 A;  3A1P A;  5K5Q A;  4AC9 A;  5FIU A;  5FKO A;  2ZJ2 A;  2RNJ A;  4X6A J;  4EM1 A;  1D1C A;  5A2Q Z;  1WOS A;  3QP5 A;  1EXM A;  1HVX A;  4M3G A;  4BJT A;  3J81 Z;  3VSL A;  3RPQ A;  3N6Z A;  2L9N A;  4HNU A;  4V02 C;  3JTG A;  4AF7 A;  2EA4 A;  5D5X B;  2DK8 A;  3M07 A;  2VBZ A;  3GCM A;  2IS1 A;  4OPS A;  3TO7 A;  1Q82 D;  3BQZ A;  1LM1 A;  4ZV4 A;  3I0T A;  1GV5 A;  1OCC H;  3CCR I;  4PAA A;  1BA5 A;  3T51 B;  2FA5 A;  1KMH A;  2L7F P;  2KIQ A;  2KT0 A;  3SHF A;  3I56 I;  2DER A;  1TBX A;  2KMU A;  3JRB A;  3TGN A; 
#chains in the Genus database with same CATH homology
 3UR3 C;  4HRI A;  3K4C A;  4BE0 A;  3BCF A;  2M3A A;  1O8J A;  1EE6 A;  3PNT A;  4XQF A;  3LNN A;  4XOT A;  2FUG 2;  1PKV A;  1K5C A;  1YX5 A;  4XNF A;  3PSF A;  4X0G A;  2XOK A;  2W00 A;  4NK6 A;  2LBF B;  4RM2 A;  1OGM X;  2R7X A;  4E7S A;  3L2Q A;  3K70 C;  4CA0 A;  2X6Y A;  2MAB A;  3M1C A;  4IQ4 A;  1UD4 A;  4TKO B;  2VBM A;  4YZX A;  2Y0S A;  3B4N A;  3TMO A;  4RM3 A;  1WJE A;  2GJK A;  4YZ0 A;  3QOE A;  4BXF A;  1FMW A;  3FDY A;  3EUA A;  2D3N A;  2VKD A;  2RQQ A;  2EWE A;  3CP2 A;  1DP3 A;  4HST A;  1X4P A;  2IGK A;  3FHN A;  3L2U A;  4W8S A;  1WJC A;  4HG2 A;  3LSG A;  4Z03 A;  3DPU A;  3OYF A;  1ERD A;  4ASU A;  1OR7 C;  2VJJ A;  3DQV C;  3HC7 A;  2DCE A;  1V5G A;  3C2G A;  1PLU A;  3HOS A;  2CV0 A;  3OR1 C;  2ZSI B;  2NOJ B;  4ZDO A;  5CDF A;  3VSU A;  1MW7 A;  1E1R A;  2QX3 A;  4F91 B;  1FX0 A;  3A3B A;  5CKT A;  3A3G A;  2ZTN A;  2AQF A;  3I3L A;  4XKB A;  4XL9 A;  1HG8 A;  1SKY B;  2ELJ A;  4YEJ A;  1NG6 A;  2VBE A;  3BLY A;  2W6J A;  5IK2 A;  4HWV A;  2KDO A;  2V9K A;  1KCD A;  2Z6B D;  1OFL A;  2GJP A;  2VJI A;  4II2 A;  4RMN A;  4XOR A;  3SZG A;  2WSS A;  2O17 A;  4E0F A;  2MYS A;  3SUC A;  4DBR A;  2WJY A;  4DOZ A;  3MKZ A;  1OLT A;  3DPL C;  3K4B A;  4JQF A;  1PE9 A;  2X53 S;  3HOT A;  2XSJ C;  3DEE A;  2R7W A;  2MFZ A;  4F3Q A;  3ZR8 X;  4BEH A;  5HVQ C;  2ZFU A;  3OYK A;  2VLA A;  1E3Z A;  4Y33 A;  2X8K A;  4PJJ A;  4BGD A;  1E1Q A;  4XMY A;  4N4N B;  2XF6 A;  3VMV A;  4RLF A;  2LZJ A;  1O8L A;  3I9V 2;  3LFU A;  3OYH A;  1VBL A;  4OJ5 A;  2Z2S B;  3LL7 A;  2KLO A;  2KQR A;  3OEH A;  4XLF A;  2WZP P;  5KNL A;  2W1O A;  4TSF A;  1BR1 A;  4OAZ A;  1O8H A;  1OFM A;  4R79 A;  3OIP A;  4QPQ A;  2IS4 A;  3OFN A;  2OV7 A;  4U87 A;  3GQ7 A;  3DTI A;  3SYT A;  4KKS A;  2OUM A;  1O8I A;  5HNH A;  1WTH D;  1X1B A;  1W0K A;  2WA0 A;  4JOM A;  2O5R A;  2V31 A;  4BQN A;  2NST A;  4KJZ A;  2NSP A;  4OAY A;  3H5A A;  1KCC A;  4CCO A;  4CH7 A;  3OY9 A;  1EFR A;  3V42 A;  3CZ6 A;  2AQE A;  2WBM A;  4B3X A;  1RMG A;  4U49 A;  2HVQ A;  2VKH A;  1E79 A;  3S3N A;  2MC4 A;  4L8J A;  1FMV A;  4HEA 2;  2X1C A;  4NQW B;  4OJO A;  1RU4 A;  1WJF A;  3OOC A;  4ANJ A;  2GJR A;  3G05 A;  1JTA A;  3EUK L;  4BEH B;  1V0E A;  3H5R A;  2NZM A;  1KTW A;  2CH0 A;  4BDZ A;  3IP4 B;  4AU7 A;  1MMA A;  2E1M C;  2BVM A;  3ONQ A;  2HZD A;  3PUB A;  4F52 A;  2BOL A;  2K9M A;  3A35 A;  4G6I A;  2V7Q A;  1DBO A;  4OJ6 A;  3N05 A;  3VSV A;  5FRM A;  1X1C A;  2M0M A;  4YZA A;  1MAB A;  3HXL A;  3QOD A;  3HKZ A;  4ZTJ A;  1W9X A;  1WP6 A;  3OYD A;  4IKF A;  3PFY A;  2JVH A;  5HNF A;  1MMD A;  2P0W A;  3AFH A;  3OS0 A;  3VR6 A;  2VQH A;  2ZZQ A;  2F1M A;  4C2T A;  4XLA A;  3OYC A;  3K4J A;  3M8J A;  3HPH A;  2DIE A;  3NWT A;  2QXZ A;  3LMW A;  2NTP A;  2WAQ A;  4B48 A;  2R7S A;  3GVK A;  2WAD A;  3H9J A;  4B47 A;  4F92 B;  2IGM A;  2VQC A;  3BC9 A;  4HIZ A;  4ZDP A;  3K6G A;  3EUH C;  4J00 A;  5DN6 A;  1O8F A;  3T9G A;  3GQ8 A;  4DNT B;  5CPR B;  3W2A A;  5AMV A;  3OYG A;  4C2U A;  1D1A A;  4CCK A;  3VSK A;  1O8K A;  3EQO A;  4XN3 A;  4XON A;  3OE7 A;  1LVK A;  2R7T A;  3OYL A;  3TL4 X;  3JUR A;  2CV2 A;  3K70 D;  1D0X A;  1MMN A;  3DPT A;  3FKJ A;  1J09 A;  1IDK A;  3VYT B;  2KRH A;  5C1C A;  4BU2 A;  4KIT B;  2E5N A;  4NC7 A;  1VZ0 A;  4FXU A;  2IGN A;  3T53 B;  3H5N A;  4PSW A;  3QYE A;  2F4I A;  4II3 A;  2JVG A;  3ZGK A;  1NBM A;  1UAA A;  2VB6 A;  3GBG A;  1UD2 A;  2CFO A;  3QYF A;  4AVZ A;  1W36 C;  2VJ4 A;  3OWT A;  2JIZ A;  4N4O B;  2JJ2 A;  3AL0 B;  2M5S A;  4D1Q A;  1IDJ A;  1XG2 A;  3BCA A;  2PEC A;  1DGR M;  3T56 B;  4NUB A;  1WMR A;  3OL4 A;  3PNY A;  2X3H A;  1O88 A;  2HQA A;  3KRG A;  5LFA A;  4PJM A;  1BHE A;  4W8Q A;  2JSP A;  2KRC A;  2VQG A;  2XDV A;  1I18 A;  3PNV A;  2QE7 A;  1H80 A;  2W7N A;  2OC6 A;  4P5O A;  4D9J A;  3GQ9 A;  1NHC A;  3OOU A;  2R7R A;  2WAE A;  2BW3 B;  2Z8G A;  3CJQ B;  3RSN A;  3GVL A;  3ZXS A;  2X85 A;  1VLY A;  2LRE A;  1GQ8 A;  3S3O A;  2UUZ A;  2LOO A;  2VAS A;  1DQU A;  4LIT A;  2O0W A;  4U7B A;  3CES A;  3B8Y A;  4CCL A;  2IS6 A;  2O1D A;  2L7K A;  3QYB A;  5FRO A;  3C2H A;  1TT0 A;  3E1S A;  2NTQ A;  3ZRG A;  2HPI A;  1X4O A;  2I8D A;  4CZC A;  1Z3Y A;  2Z1D A;  4E4H A;  2HU9 A;  1WPC A;  4W8T A;  4BJ5 C;  3VST A;  1DGW Y;  1KZL A;  2NT6 A;  3S8P A;  1COW A;  1JRG A;  3IAS 2;  1D0Z A;  1JI8 A;  4DJA A;  3HUG B;  2IXS A;  4Z05 A;  1UG0 A;  4PFO A;  2JDI A;  3WQZ A;  1EA3 A;  1BLI A;  2R7O A;  1N75 A;  2WY8 Q;  3CMM A;  4IX7 A;  1NRK A;  1OHH A;  4TT3 A;  2WPD A;  1O8D A;  2BSP A;  2HPM A;  3VWB A;  3G2B A;  1I8D A;  4QPO A;  4Z1M A;  2F6C A;  4YEL A;  3K10 A;  1E43 A;  4KKT A;  2DT7 B;  2L5Q A;  3VYS B;  3BCB A;  3FBI B;  2DT6 A;  3RTR A;  2CV1 A;  3SEZ A;  4EW9 A;  3OYE A;  3HPG A;  4B3G A;  5KCM A;  3HG9 A;  2ODL A;  4PJL A;  2XZL A;  2VL8 A;  2JJ1 A;  1QHG A;  1YX3 A;  2V4D A;  2R7V A;  1O8M A;  3UNG C;  4YXW A;  1KON A;  1LDK B;  4KT6 A;  3U21 A;  5TGT A;  3OS1 A;  2ZZE A;  4BAC A;  1HZE A;  2UV1 A;  1QU3 A;  2RRE A;  3MKY B;  4E7J A;  2HVR A;  4URR A;  1WFX A;  4XLE A;  2V26 A;  2K5C A;  2Z16 A;  3OYN A;  4DNR B;  4Y4R A;  4BJ6 C;  2VJ5 A;  3D5L A;  1YE9 A;  3MD2 A;  2VXZ A;  4Z06 A;  3GVJ A;  4OJL A;  5C1E A;  4YRV A;  4OWR B;  3GQA A;  4LIV A;  2XC7 A;  2ZXH A;  4ITV A;  1X0C A;  4BS9 A;  3KEW A;  2R7U A;  4XLC A;  1UEL B;  2L2O A;  1WJB A;  1X1D A;  3CF2 A;  3W2W A;  2DJI A;  3OR2 C;  2WY7 Q;  3DU6 A;  4P1W A;  3EPZ A;  4MLO A;  4BQO A;  1O8E A;  3KEY A;  4E7K A;  3K4M A;  2JA2 A;  1V5F A;  3H0D A;  3EQN A;  4OZZ A;  2A5W A;  3GQB A;  4PK4 A;  4XKV A;  4CSW A;  1OOC A;  2RNG A;  3L2R A;  2V6E A;  4FET A;  1N78 A;  1AA7 A;  2XAU A;  3PL8 A;  3TBI A;  2VPL A;  2UWM A;  1QHH D;  2XND A;  3BCD A;  4NK8 A;  1X19 A;  3VMW A;  4HPQ A;  3A2K A;  3DLA A;  4CCM A;  4J01 A;  4E7I A;  3IAM 2;  2HVS A;  3A4C A;  4MR0 A;  2GOX B;  1W0J A;  4ZYA A;  3S3M A;  4Y3O A;  1WJA A;  5HKK A;  4F93 B;  2XZO A;  1QCX A;  2D3L A;  1H8H A;  1IRX A;  3UW0 A;  1V5E A;  4BQQ A;  4W8R A;  3RQ4 A;  2VBK A;  3CJR B;  3DTE A;  4OZY A;  2GOM A;  4PMH A;  2IGO A;  3OYB A;  1O8G A;  4ZJZ A;  3KYL A;  2WAF A;  4P22 A;  1LKX A;  4BDY A;  2CW8 A;  4YZQ A;  1W36 D;  4GQN A;  1PJR A;  4FAS D;  4XR6 A;  4BL0 B;  4E7Z A;  2CUZ A;  2LRD A;  3H9G A;  1MNE A;  2W4S A;  4PJN A;  3RCO A;  1DBG A;  3OYI A;  1PXZ A;  1WJD A;  2Q2E B;  4B44 A;  2CMP A;  2V1N A;  3J7A Y;  1UD6 A;  2XZP A;  3E0J B;  2WB1 A;  4XKW A;  4IZZ A;  2V7F A;  4PSX A;  3W2V A;  3LSM A;  2R9V A;  5LD2 C;  3OAA A;  2VIX A;  2V4J C;  4DK0 A;  2XGJ A;  1OGO X;  1SFK A;  1R6R A;  2VXD A;  2Q1Z B;  2F43 A;  1IB4 A;  3OYA A;  3DTK A;  3K4L A;  1T95 A;  1BR2 A;  2XF7 A;  3OEE A;  3AL0 C;  4UZU A;  3D5R C;  2QKL B;  1AIR A;  2HDW A;  2E1B A;  1T0F C;  3LSI A;  1SAU A;  2KHM A;  4XN0 A;  3HL2 A;  2DOA A;  3LSK A;  4G6T B;  2M4G A;  2ZZF A;  3AKZ A;  1Z21 A;  3DKX A;  4XOP A;  4BUP A;  1T5E A;  1E3X A;  3BG7 A;  2CUJ A;  3KX2 A;  3LMM A;  3BC8 A;  3LSH A;  1G59 A;  1D1B A;  1OB0 A;  2E60 A;  3D5S C;  3MKW B;  1TZL A;  1BMF A;  4XKC A;  1GLN A;  1BOB A;  2K9L A;  3OYJ A;  4C2L A;  2F5V A;  4E7L A;  2UVF A;  3HAG A;  3W3C A;  3JU4 A;  3DKY A;  2GK6 A;  4DK1 A;  3VYR B;  3DWL E;  3FKS A;  1UD8 A;  4BE1 A;  1Z3X A;  4G7X A;  4NC8 A;  4EAT A;  4F55 A;  3NE5 B;  2X6X A;  2R7Q A;  5CQE A;  1K6Y A;  2IQ7 A;  2NTB A;  4HNT A;  2ZSH B;  4IQJ A;  1Z7L A;  2ZZG A;  2INV A;  3K4K A;  2X1E A;  1MMG A;  4KKU A;  5FL7 A;  2PMZ A;  1HA8 A;  5FRN A;  1U0J A;  2PYG A;  3OW7 A;  4HSR A;  4GRI A;  2X51 A;  3VDX A;  4ZTF A;  2O04 A;  2BVL A;  2LYC A;  2L9S A;  3IUO A;  5HLT A;  2PJR A;  4B3F X;  2KVO A;  4XLH A;  3ZSC A;  2IS2 A;  4CCJ A;  3FBN B;  1RWR A;  5CQG A;  3OS2 A;  2M4K A;  4ZDL A;  4BE2 A;  3ZQQ A;  2W6I A;  1VJS A;  2LC2 A;  1UD3 A;  2CK3 A;  1X1A A;  1H8E A;  3MMY B;  3SDB A;  4MXN A;  1BPL A;  2QKM B;  2W82 A;  1MND A;  3L2V A;  4E6K G;  3ZPN A;  1G8X A;  2R4G A;  2E5Z A;  3F9K A;  1N77 A;  4DGW B;  5KHD A;  4CCN A;  4B43 A;  4DBQ A;  2ZXI A;  3DDY A;  1IA5 A;  1UD5 A;  4ZC3 A;  5HOO A;  1NG7 A;  4KIS A;  2GK7 A;  3BH4 A;  3OMY A;  5JHF A;  3ZCO A;  1K28 D;  1V0F A;  4C30 A;  2QY1 A;  2PYH A;  3GRH A;  2LG4 A;  3PJR A;  4I84 A;  2INU A;  4AYB A;  2MD0 A;  3CP8 A;  4JMQ A;  4C9Y A;  4H4K C;  3ZIA A;  4LG3 A;  2KL4 A;  4NNJ A;  2LY1 A;  2WJV A;  4PFP A;  3H35 A;  4E7H A;  2ZTG A;  3OPO A;  4LIU A;  1D0Y A;  1Y6I A;  4DIQ A;  2E1M B;  3OYM A;  3H9Q A;  3SEQ A;  2A6T A;  2PJR B;  1ZEL A;  2K3P A;  2CS3 A;  4PUS A;  2O0V A;  2VQL A;  4G7W A;  4U4B A;  4OJP A;  1Y56 A;  3BG6 A;  2XF5 A;  3FPP A;  3VYU B;  1PYV A;  2LBF A;  1BR4 A;  4XM3 A;  1QJV A;  1E0E A;  2LH9 A;  3WWG A;  2NT9 A;  3B90 A;  2JUG A;  1D1C A;  3DU5 A;  1HVX A;  4BJT A;  2LY2 A;  3OL3 A;  3VSL A;  2HLD A;  2UVE A;  3S93 A;  2L9N A;  4HNU A;  3NWS A;  1VF7 A;  2KP6 A;  1CZF A;  2KPM A;  2X1D A;  2IS1 A;  3S32 A;  1S9H A;  3PSI A;  1WJ5 A;  3FY3 A;  3OIQ A;  1LFP A;  3H94 A;  4CUG A;  2DXI A;  4RLQ A;  2BW3 A;  4XD7 A;  3K4N A;  3T51 B;  2M7B A;  2KZV A;  2HNH A;  2X6W A;  1KMH A;  2CW7 A;  3RPU D;  1P9Q C;  1BN8 A;  2M7A A;  3ZPP A;  3L2W A;  3A1Y A;  2KMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...