4XLEA

Tailspike protein double mutant d339n/e372a of e. coli bacteriophage hk620 in complex with hexasaccharide
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
596
structure length
596
Chain Sequence
FRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVALHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 229
structure length 596
sequence length 596
ec nomenclature
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xleA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xleA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xleA02
2NZMA 1O8EA 1O8HA 4XLCA 5C1CA 4XMYA 4Z03A 1JTAA 1IA5A 4OZYA 3GQ7A 4EW9A 3EQOA 1O8MA 1RWRA 5AMVA 4OJ5A 2UVEA 4XORA 3B90A 2EWEA 1QCXA 2PYGA 3JURA 3KRGA 1H80A 2NTPA 2BSPA 3T9GA 4W8TA 4XLEA 2X6YA 2INVA 1PXZA 1NHCA 4OJLA 3VSUA 3GQ8A 4XQFA 4NK6A 3B4NA 3ZSCA 1GQ8A 1OGMX 4W8QA 2O0WA 4U4BA 2NTQA 4XKVA 4XN0A 2PYHA 4NK8A 4Z06A 2QXZA 4W8RA 1RMGA 1KTWA 1KCDA 3FY3A 4Z05A 4U49A 4W8SA 4AVZA 1O88A 2VJJA 1IDJA 1KCCA 1O8KA 1OFLA 2VJIA 1O8LA 1RU4A 3EQNA 3UW0A 1BHEA 2UVFA 3VMVA 4OJPA 4XKWA 1XG2A 2NSTA 1AIRA 1DBOA 1IB4A 4OJ6A 2INUA 4YZQA 4C2LA 4XOTA 3B8YA 2NT6A 4I84A 1OGOX 1CZFA 4XONA 4YELA 2X85A 1O8FA 1IDKA 4XL9A 3VMWA 1VBLA 1OOCA 3VSVA 4YZ0A 2O04A 4XNFA 4OJOA 1EE6A 4XM3A 2X3HA 1WMRA 2Z8GA 2ODLA 4YZAA 4YEJA 3VSTA 4HWVA 1O8IA 4XR6A 3WWGA 2QY1A 2QX3A 2IQ7A 1X0CA 2X6WA 1O8DA 1JRGA 2O17A 4XLFA 4XOPA 4XLAA 2VBKA 4OZZA 4YZXA 2NT9A 4XN3A 1O8JA 4MXNA 1BN8A 1HG8A 3GRHA 3GQ9A 4URRA 2NTBA 3SUCA 2O1DA 2PECA 1O8GA 2NSPA 4PMHA 3GQAA 4MR0A 3LMWA 4XLHA 2VBEA 1DBGA 3ZPPA 2O0VA 1K5CA 1OFMA 1QJVA 2VBMA 1PLUA 2X6XA 1PE9A 5C1EA
chains in the Genus database with same CATH superfamily
1HA8A 1AU7A 2VT3A 3ZMDA 2EILH 3CCJI 3OJWA 2GK6A 1PP7U 1PUFA 2NVQJ 4HV5A 1XGMA 1QUFA 1R5ID 3RPQA 5GAHJ 4AIKA 3JQPA 4C2UA 3CCRB 1A04A 2R5ZA 1MH4A 3DTIA 1A35A 1P9QC 2MA3A 3DDYA 4F93B 2C77A 1TYXA 5LFAA 2V31A 3WNBA 5FO1A 5E3MA 2DQLA 2RQPA 1J9ZA 4UUSB 4JX6A 5JLVC 3SLDA 4CCMA 4XLEA 3OYLA 4IQJA 1TLLA 1TTTA 1VNDA 3RKYA 1RQRA 3BY2A 2YUHA 4I0AA 1S3JA 2DIEA 2LF7A 2X51A 3L2QA 1U2RA 3B82A 4NC8A 1R5GA 3O8GA 4CH7A 1O3TA 2K27A 2OBTA 3JAMZ 2QQBA 3ZMSA 1KU2A 3ABTA 2R6HA 3PNYA 3BT9A 4ZGQB 1RMGA 5FNZA 3FY3A 2OTJI 1OCRH 2MG4A 1KYWA 4W8SA 2E2HJ 3H92A 2VQLA 2R7VA 3CDHA 3P9CA 3LAJA 1I7PA 2GK7A 5LGNA 1OCPA 5D5WB 2L9RA 1HXDA 3M3YJ 1N78A 2PYHA 4FETA 2XGJA 4NNJA 4WZKA 1LEAA 3L7WA 4EM0B 3RQ4A 2CRVA 3AVXA 2DA4A 4I98B 1QGAA 1KU7A 2EINH 2E5NA 2CJJA 3CCVB 3MEXA 1ZREA 2NNYA 2D1HA 4OJ6A 3R4KA 3DLAA 3BR0A 2HXIA 2J7KA 3B8YA 2ETHA 1QA2A 4D1QA 3L00A 3ASPA 1OGOX 3F72A 2CV0A 2I1LA 1ON2A 4O3MA 4LLGF 1N0VC 1QPIA 2VPRA 4G6IA 5FRNA 2VKHA 4IZZA 3KYLA 2G7HA 3CMEB 3S8PA 3ERED 4ENMA 3VNVA 1K9MD 2GA2A 1ONVA 1SKQA 3VR6A 1S4MA 2X6WA 5DUKA 1XTAA 3HYIA 2IGMA 4FASD 4ACBA 1FIPA 1VQ8I 3ZPNA 3PNVA 5DS9A 4DBRA 4B48A 4FWTA 4MTDA 4NB5A 2XV4S 4U0YA 4A3MJ 1ZGWA 3Q9VA 3W5HA 4URRA 1BR4A 2V7FA 4AIDA 5HLGA 2QZ8A 3CCSB 1UMKA 2VKDA 5F04A 1T38A 2CUEA 2E1MC 2A05A 4MEYF 2VN2A 4M9ZA 5F4MA 4BJ6C 2EFPA 3BR1A 3MKYB 2VOPA 4YDTA 2VYQA 1QJVA 4L8JA 2BY1A 2X6XA 3G1MA 2K3FA 4KUMA 5J8CA 1FOWA 3CMAI 1TSPA 3H9GA 2XAFA 4DNCA 2TDXA 2DW4A 2Y69H 4MFDA 2LKPA 4OZYA 5AIQA 4RMNA 3QP5A 2DI3A 4DBQA 4BXFA 2Z1DA 5B66C 5AMVA 4AYBN 4M6YA 3B90A 2K9MA 2C2WA 4BGDA 3ZXSA 1TWGJ 4QSHA 5LEKA 5FLXZ 1SFOJ 3DPUA 3OL3A 1T56A 2W4SA 3ERMA 1YO5C 1R23A 1EF4A 4OPSA 2DOEA 4B3XA 1WP6A 3BQYA 1W2BB 2L7ZA 3TDUC 3GMEA 1FBQA 3FBIB 5K7ZA 2IVMA 3F6OA 4V19K 2HCJB 2E7XA 3A01A 3W6VA 2MH9A 1JXSA 3CJTB 1KU3A 3HAGA 4R8HA 3V7RA 2HKXA 4RLQA 1HKQA 4RLFA 3PO2J 2PFBA 2DMTA 4U0VA 1CF7B 3H94A 1K73D 2WB1A 1Z1DA 2DOGA 1YI2I 4YEIA 3FF5A 2B7CA 3OYFA 2QXZA 2PMZA 4W8RA 2LZJA 3WTXC 5FFZA 3KPHA 2I5UA 3M8JA 3EUHC 4FXUA 2LY9A 5E3OA 1YOVB 3JRCA 2DA3A 3LWFA 3Q39A 1ODDA 3A0HC 1HQCA 2X0LA 4MHGA 1UD2A 3CESA 2FXAA 4MIMA 5TISC 1H42A 5ICEA 4KYWA 2K9SA 3OEHA 1J7KA 3BNWA 2WY8Q 3VYUB 2UVFA 3ZQFA 2VQGA 3IHUA 3OL4A 4AC0A 3OE7A 2A69F 1PJ5A 4OJPA 3LQEA 3QP6A 4X7FA 3AL0C 2V1XA 1KA8A 4A93J 1BW6A 4CCKA 1VJSA 5J1RA 2IJLA 4IHWA 4A6DA 1B6AA 3K0LA 3CD6I 2J8IA 3QYBA 4YFNF 4HZFA 3H5NA 3HPGA 1F20A 1WJFA 3LL7A 2CV2A 2CH0A 1BX1A 2K4BA 4I01A 1BMFA 4EJOA 3CMMA 3SJZA 4E4HA 4GYGA 2FOWA 2Z3YA 1FP1D 1D0YA 1W5SA 4BJ5C 2DY1A 3MAJA 3ZMVA 1PJRA 2GOMA 3SDGA 5CKTA 2VXZA 1SFKA 2QKLB 5B1AH 1NJID 3F22A 3QU6A 2WBMA 4PJ0C 1B72B 4JBAA 4EJVA 2BW3A 5LGUA 3IL2A 1JRGA 1GVHA 2W84A 4K1XA 4ASNA 1XCVA 4IRGA 2W7NA 3OSGA 2RVCA 1T95A 1DQUA 2ID6A 3OYKA 4M3FA 4E7KA 2KRHA 4HNUA 2CW7A 1TWCJ 4D9JA 4BQQA 2ZBUA 1B9MA 2VBUA 3ROUA 1OR7C 2VE8A 3G71I 4A3IJ 2R7XA 4E7LA 3ZIAA 4FISA 4Z4SA 5ERIA 1N77A 5IOZA 2FJ1A 4UVCA 2X6OA 4ZH4F 1SD4A 5FLXK 4BAYA 3OEEA 3CCRI 3BDDA 4GO1A 3RKWA 1TYUA 1YG2A 2KZVA 4D0PA 4A3LJ 3PSIA 4BPRA 4UB8C 2V79A 4BQAA 2R7UA 1YHQI 2XOKA 1VQOB 5JLWA 1MDMB 4XLPF 5EYRA 2Q6KA 2PIAA 4P3IA 1YIOA 2GZWA 4WXDA 1WJCA 4G7XA 5HDGA 1MMAA 3VYRB 1NB0A 3MKZA 4CHUA 4FCYA 5L3EA 2FRHA 4DK1A 1VQKI 3GIRA 1P92A 3OZWA 4DYCA 1CGPA 4OPWA 1DGWY 1YX2A 1KMHA 2BN4A 1FT9A 3BCAA 3K1NA 4CCLA 4BY1J 2X0KA 5EEHA 1HBXG 4PFOA 1G59A 2VBTA 4H4KC 2COMA 1NBMA 3CCUB 4LK0F 1NTCA 1B2RA 3FISA 2V9KA 2HQRA 3FHNA 4L9TA 5LHGA 1AHDP 4M74A 2F43A 3R61A 3U21A 4RPDA 3J81k 5L3FA 1YS6A 5EEGA 1UFMA 4PUSA 2X1DA 5K5RA 3WHCA 1W0UA 5J6XA 1K4SA 1EKEA 3RKQA 2HU9A 3A35A 1MNEA 3ZR8X 4DK0A 3QSYA 1DABA 2WB1N 3BPVA 3IH3A 3FM3A 3ZQLA 4RA2A 2E5ZA 2K02A 1Q1HA 3RZDJ 1X3UA 3GFLA 3HPHA 1Y1WJ 4PCQA 1TT0A 4PC3A 2AS5F 4L0YB 3E1SA 1KJZA 1WSUA 2DEUA 3OS1A 2DODA 2BHZA 5B1BH 4E7HA 3CCVI 2B63J 2W6IA 2BOLA 3MZ8A 1UAAA 1D2EA 3ABKH 1QA1A 3SEQA 1ITYA 4L9NA 2DOAA 2F4OB 1V5VA 1W9XA 2HDNB 4M9SA 1HCRA 5DYMA 3IRRA 1USSA 1W7PB 3ZMTA 2LSOA 5HS9A 4Y17A 2K40A 2O5RA 3I55I 3PA2A 4DQLA 9ANTA 1T0FC 3CPXA 3CMEI 4I84A 4YC5A 4PJNA 2EV5A 2P7CB 1POGA 2EWNA 2VASA 3ISPA 2E1NA 1FIAA 2Q0OA 1IDKA 3AG1H 4OAYA 2VQHA 4HX4A 2X3HA 1I1GA 1G3WA 4HLYA 4KFCA 4M3DA 3SYTA 5JVTA 2CQKA 4QIWN 2AXTC 4WX9A 3B6CA 2FE3A 3CUQB 5D5VB 2R5YB 4BQNA 2BBYA 2ZFUA 1ETWA 4X7CA 2ISYA 2V7TA 1O8DA 1Y6IA 1H9GA 2VE9A 2FUG2 3BWGA 3CCSI 5F0CA 1HSJA 1ZG1A 1QA6A 3OYNA 4JMQA 3TO7A 2LYCA 3W2HA 4EJWA 3LSRA 5TRDA 3C18A 2FF4A 1Y0YA 1ETQA 3DCFA 1BI1A 3FMRA 1W0KA 3IKTA 3TGNA 3HDDA 3HM5A 3G1LA 4DQ2A 1E1RA 1FX0A 2XTXA 3GTGJ 3IUOA 3AGPA 1A8PA 1ZRDA 1X2NA 1XD7A 3K4MA 3VPRA 4EM2A 2X9DA 5IP9J 2DMUA 2LF8A 1B8IB 4MFEA 1PE9A 3I9V2 2CC2A 5GV8A 3FXQA 3AAFA 3S2HJ 4NC6A 3W2GA 3WBKA 5E8GA 3CW2A 2O0YA 2XVCA 2R7WA 1IW7F 2X8KA 2HPMA 5HODA 4OJ5A 4II2A 1FTTA 3D5SC 3K1PA 2O6GE 4ESJA 1R6RA 1I39A 1YW7A 2Z2SB 4GCVA 2B0RA 3P9KA 4ZTJA 2L4MA 4XSZF 1HW2A 2I8DA 3K4BA 1MBGA 2R7RA 1PKVA 4F91B 1IN8A 2DT5A 3K4LA 2M2EA 3Q9SA 2F5FA 4R1HA 5M5WJ 4N3NA 2QLZA 3GQBA 3B4NA 1JB9A 3H3UA 4ESFA 2J5OA 2HNHA 3TW6A 5E8IA 1U78A 1FSHA 1SKYB 3AG3H 1YLOA 2XNJA 4TT3A 3BTCA 2VFMA 2A6HF 3CF2A 3CCJB 1PYVA 4AVZA 4D5FA 3LAPA 1F4KA 2TCTA 3HKZN 3JX8A 1A6IA 2Y0SN 4RCZA 3FPPA 1WFXA 1CQXA 5LHHA 3ZP5A 1CF7A 2YWEA 4D7NA 3GZNB 3ECOA 3AG4H 4OPOA 1KGSA 5HS8A 4G7HF 1P6RA 4EH1A 1H9TA 4MO7A 2IA1A 1D1AA 3KEYA 4G8XA 2GAUA 1VLOA 1W34A 5K7FA 4HA8A 5A2QZ 4UB6C 1T39A 3CO7C 1K78A 3BG3A 1O7FA 3PVDA 2WZPP 4ANJA 1SVLA 4HSTA 3BJ6A 1GVJA 5E3LA 4RCYA 4XONA 3CCQI 3TBIA 3SY2A 5J1UA 2BM6A 2LREA 3TP3A 3IV5A 5TR9A 5BSXA 3BJOA 3CCEI 2CW0F 4HNVA 3HRSA 4Z4UA 1GO2A 3H09A 1WWXA 2MC3A 1LDKB 4LITA 3ZN1A 4LBZA 2DJNA 4A6EA 4CZCA 3RSNA 4I6ZA 2Y75A 3JREA 3FKJA 4PC2A 3LSTA 2DN0A 1AKHB 1HOMA 5JBQA 5KAIC 3ASSA 3BZKA 3S1RJ 1BLIA 5IYPA 4DYRA 5DD4A 3LSIA 1QH0A 4MXNA 1USTA 4N0BA 2EFQA 3HGGA 3TOAA 2PI0A 3DV8A 5FRMA 4Y7CA 3FWEA 2L01A 3QOPA 1R1VA 1O8GA 2HKOA 1R4NB 3S16J 1F43A 1B72A 2P6SA 2PEXA 4NBQA 1GAQA 1LFUP 3ECHA 5ICFA 1P2FA 2BGJA 3LFKA 3AG2H 1MBJA 1LPQA 1WZ2A 1VLYA 1HW1A 4PFPA 3JTGA 1FYMA 2CFOA 3F8NA 4UUTA 1VQOI 3HOSA 1XDSA 3C3WA 3FMQA 3JRIA 2Q6LA 1P4AA 1ZAOA 5JHUA 2YWGA 5AN9A 1O8HA 2R7DA 1WJEA 5J3LA 4HBLA 5C1CA 4TKOB 3A02A 1IA5A 2RAEA 1ETKA 4ESBA 2LP0A 2R0QC 5LEJA 3RPUD 2VFOA 1JT6A 2Y0MA 4HEA2 1RPWA 1QHGA 1VQ8B 3F3XA 1QX4A 5CQEA 1XE1A 2C4TA 3NEUA 1OLTA 4RDUA 1MSFC 5DTDA 4X6AJ 3QU3A 1UJ8A 1H80A 3VWBA 4RGXA 3HGYA 1QFZA 4QPQA 3B8HA 4RB3C 3CCUI 3D5LA 2VBSA 3QE2A 1BI0A 3LMMA 1YIJI 1U5TB 1JJ2B 3BCBA 2ZNZA 3PSSA 1EV7A 4XQFA 3HOUJ 3ZSCA 1GXPA 1IXRC 2Z99A 1UD5A 3W2EA 5GTHC 1Z7LA 4A5NA 2CGPA 4C9YA 5IYCJ 3A8JA 5B6IA 1OFDA 4NK8A 3PUNA 4LG0A 1IC8A 1E64A 4IL6C 4UVAA 1KTWA 3OOCA 1DUXC 2D2WA 3COAC 1ZELA 2PJRB 3PA1A 2H1KA 2IGKA 2GJPA 2KIMA 5A2QK 2F5CA 5THXA 5BSYA 1Q81D 1FEXA 2CU7A 2DTZA 1E63A 1KRHA 2XF5A 4PGOA 2D3NA 4IKFA 2NS8A 2O61A 3CCYA 2C5BA 2Q2EB 4M3BA 3BG6A 3LA7A 1EJ9A 2Y2ZA 2JT1A 2VKEA 4F52A 1ZG5A 1IRZA 4YHBA 3OYGA 5TJJA 4M0LA 2WAQN 1OGJA 3WGGA 1N06A 3HSFA 3G2BA 1QVFB 1JJ6C 3FIWA 1GUUA 5LLQA 2QBYB 2EIJH 3GTKJ 2CQQA 3PENA 1OCOH 2R7SA 3L09A 2AXLA 3H0DA 1I3QJ 1UHMA 4YELA 4BL0B 1BIAA 3HUGB 1SMYF 4P2NA 3U6KA 4IW3B 1BL0A 1OGIA 4P1WA 3LJYA 2E60A 2KP6A 3SQVA 1YI2B 4XK4A 3I4MJ 3K7AJ 1U2WA 1DPRA 1W7PA 4E7ZA 3CMYA 3SZEA 3K2AA 2A07F 4YRVA 2OJED 4OOSA 1SD7A 1MNDA 5E6TA 3ZUGA 4S05A 2KVOA 2ICWG 3I5UA 4KKUA 2MD5A 4MTEA 3ZPLA 3ZQQA 3K70D 3D1NI 3PJRA 1J0RA 1IDZA 1QZZA 1FBUA 2JPCA 2ZJQF 5LGTA 4TMZA 3GLLA 1ZARA 1Y0RA 3I3LA 2E1BA 3BH4A 1TQMA 1MMSA 3GVJA 2NTBA 5EZHA 3GO5A 2JZYA 3JU4A 2R5YA 5K5QA 1RZ4A 4Y9UA 2Q1ZB 3GQAA 2ZCWA 1ZTRA 1D8JA 2VBVA 3LA2A 3V76A 4CYDA 1VZ0A 4S0HB 1WQ2A 3GF2A 3MMYB 5IYRA 2OZUA 1EH8A 2LMDA 2HXOA 4BQOA 2K7LA 3OYCA 2OPTA 1Y0NA 3WXMA 3LA3A 4PJJA 3OZUA 3T8TA 5CVIA 4OINF 4J01A 5GTIC 4X1EA 1WJDA 2IS1A 2M0MA 4QWQA 2ZJPF 2HQAA 2CYYA 2L5QA 5J40A 4EW9A 2M4KA 1S6LA 3AFHA 2GQFA 1E1QA 1RQPA 1B8IA 1XMXA 2DJIA 4H0EA 4CSWA 2H1LA 4IRIA 3JQQA 1S8NA 1I5ZA 3I4PA 2GXBA 3SJPA 1E62A 1LB2A 3ES9A 3R0JA 4PJLA 3OS0A 4CO8A 3AGQA 1VF9A 4D5CA 4E7SA 3BG5A 5DN6A 1AMOA 4GGGA 2GJKA 3VYSB 2GREA 5ICCA 3G71B 4I0BA 3WODF 4PZJA 5D4RA 4LOCA 2BY3A 5DM6F 2ZXIA 3G1OA 1VQ5I 4MQVA 4AYBA 4WQMA 1XGSA 2DO7A 3M1EA 4BUPA 2D74A 4KJZA 3ZQIA 3JCUC 5LBQA 2WY7Q 4PC6A 1IV6A 1X3WB 1Y1VJ 3VDXA 2HZDA 4ZDLA 4EGYA 2BVNA 3ZZTA 4Q5SF 2PLYA 2DK8A 2M30A 1D0ZA 2QCOA 4QTRA 1JKRC 1YHQB 2F4IA 4FE4A 3KX2A 2H8RA 2M9HA 1Z0XA 3T5XA 1R49A 2WSSA 2F3LA 3MD2A 1S5LC 4UXNA 3VEPA 5JMCB 3RDIA 3OYMA 3WTYC 3D26A 1DARA 1S7AA 2KJCA 2XASA 3MCAA 2VNJA 2NPFA 3PETA 2ZTGA 3LSMA 2BF4A 3WNDA 1ZR4A 2BMWA 4EVIA 1GV2A 1VQKB 4P9FA 1Y8QB 2IPQX 5F1JA 1DBOA 2BM1A 2L02A 5FO0A 4RGUA 2X1EA 5LMZA 1D0XA 3QFRA 2DT6A 1OYWA 3LNQA 1R5OA 2JQ7A 5H2FC 2PE3A 1B9NA 2FNAA 4LGWA 3VMWA 1FJLA 1FBSA 2VBYA 3WU2C 1EE6A 5D8KB 3I0TA 1KQ9A 1QZYA 5L3CA 3W2IA 3LFUA 2HWVA 1G4DA 2QE7A 1P7JA 1UD4A 2XRLA 4N4NB 4ETSA 1ORKA 2BPOA 4LB5A 5FL7A 5C4XJ 4XOPA 5DCMB 2LRDA 3PNTA 4HW0A 2FD5A 5CVVA 4BHCA 5HVQC 2VBKA 2WTEA 3SFIA 4HG2A 3QRFF 4OZZA 2DTRA 4L18B 4RGRA 2L9VA 3AL0B 3B78A 4QVJA 4J19A 3FXJA 3FXOA 4HSRA 1AOYA 2A61A 2DA2A 3E6DA 1K8AD 3FXRA 1BX0A 3OOUA 2V1NA 3HRTA 3ONQA 1W5CC 1FX7A 5K5OA 2J5PA 4RJLA 1RUOA 2VKVA 1VHEA 3S3MA 2GA1A 4M6VA 5EGOA 3FJOA 3I55B 1JUPA 1R00A 2P5LC 3V8KA 3ASQA 3P4GA 3OIOA 2XNDA 2Y9ZA 1JGGA 1Z77A 4CYCA 3CF5F 1FOYA 1SAUA 2JA5J 2O9LA 4UUVA 3F9KA 4ZV4A 4YAWA 4FTHA 3X2QH 1Z91A 1R71A 2GOXB 4IXAA 1KYZA 4LIUA 4OU0A 3TW7A 3I56B 3OYJA 2XZOA 4I7HA 4YFXF 4OIPF 3HOZJ 1YJNI 5KAFC 1GHCA 3DFGA 1EP2B 3KP2A 2ZZQA 2JMWA 4Z6YA 4YAFA 2AO9A 4V2FA 3U6BA 1LLWA 2XF6A 2XEXA 4XLNF 1T08B 2HVSA 4KISA 1X3ZB 1QU3A 4KKSA 2EWEA 4DZPA 2PYGA 2N8GA 3IP4B 1P4MA 3WU1B 4Q47A 4P3YA 4IF4A 1ZYRF 3OSFA 3ONUA 1RKTA 1X1BA 4YCQA 2HYGD 5HLHA 4YIFA 2VFPA 1BA5A 3FK6A 2LTPA 1OJLA 5F0FA 5JI6A 1L1IA 3FXLA 1G7TA 2JK3A 3G4SI 5HLTA 1WH7A 2O03A 5LD2C 3Q6RA 1BIBA 4G1BA 3JRBA 2QSFX 4G6TB 5H6RA 3FXUA 1LKXA 5BNGA 3FXKA 2E1RA 4LBYA 5FKMA 1YJWB 5LHIA 3P26A 1G3SA 4XN0A 1XSXA 5FKKA 4PGHA 2BHYA 3W6JB 2NV4A 3A8KA 2JDIA 2PMHA 4YALA 1KQ8A 1WKMA 1HW5A 3DTKA 3K4NA 4NUBA 2ZKZA 3E6MA 1OHHA 2QTLA 2XTWA 1L0OC 3BG7A 1KCCA 3QPLA 2DA5A 1BR2A 4PC1A 1DDGA 3I58A 1X1CA 5DCFA 3JAMK 2NOJB 3HIFA 3N97A 3ONYA 1G6NA 4AVPA 3I59A 1BHEA 3QAHA 1OB5A 1A31A 3RZOJ 2Q6IA 2PJRA 1MMGA 3IH4A 4JYKA 1OYYA 3ZMZA 1T2KA 2ZO4A 3WE3A 3A4CA 3HJEA 4CQJA 2M1BA 4BDZA 2VXDA 5J1YA 5TV2A 4LLLA 4L9JA 4YZQA 1DDNA 1MBKA 1YX3A 1I50J 3HG9A 5DUIA 1LE8B 5CVUA 4UHTA 1AIPA 1D8KA 3VODA 2X85A 3I4NJ 1VF7A 4BE1A 4M72A 2UXXA 3CCLB 2O04A 4XNFA 3SYJA 3VSVA 2E71A 4V2GA 4X7DA 1WMRA 1OPCA 3FX3A 3ZQCA 2R93J 2QA4B 2VONA 5J4YA 3E6CC 4WCGA 2QY1A 3CC4B 1IXCA 2XROA 3Q38A 3HUGA 2XAQA 1XMAA 2CUJA 1FZPB 1TTYA 3WTVC 2H6BA 2CK3A 4A0ZA 3UNGC 2F2EA 2OQGA 5D5XB 2CUZA 4JQFA 2KJBA 2MGQA 2K9LA 1KONA 1RKWA 1KZHA 3BQJA 3LSKA 1V4RA 5IT3A 2DPUA 2EZIA 2P81A 3S32A 3W2FA 2OBSA 4KA4A 2VUMJ 2HYFA 4KH3A 1HZEA 2VBEA 3KYCB 1QNTA 2WJYA 4EGZA 4G94A 5F64A 3ZCOA 2ZL7A 1OMIA 3CCQB 4RD6A 4U7BA 1SD5A 2GJRA 1UG0A 2C5HA 2B0LA 2MD0A 3K70C 1Z9CA 3M1CA 3CCEB 2W7ZA 2ISZA 1O4XA 1O8EA 3GFMA 2RC6A 2RV8A 2IS2A 3REOA 3GQ7A 4AWXB 1WOSA 3VO1A 4MGRA 4FN5A 3GLXA 2W24A 1IXSB 3FXMA 4NQWB 1Z3XA 3PQKA 1BM9A 1LNWA 3PM1A 3JRGA 5GPAA 1H8EA 1ENHA 5BOXA 1QRCA 5EDNA 3KRGA 3KL9A 2VJ5A 2XKOA 1I3AA 1N05A 1W5TA 3MVPA 3I64A 1BPLA 1R9TJ 4KIGA 3KZIC 5D6FA 1COWA 5HXBA 2LKXA 1HF2A 1WVRA 2WZNA 1V5GA 2O6WA 2JJ1A 2HLDA 2EJRA 3IAM2 2HVQA 1TBXA 3WU0A 2R7QA 2HOEA 1BI2A 4M3EA 4IJAA 2H27A 4BEHB 4BXXJ 4Z4RA 2QVOA 3S1QJ 1W0JA 2VOOA 1UG2A 4RAYA 5C44J 3A8IA 2IT0A 5BQTA 4HRIA 3K9TA 1BI3A 1TWAJ 1SM4A 2K9QA 2UWMA 1IDJA 3BR6A 4G12A 3F6VA 4WK8F 3HB9A 3HBLA 2LY2A 1N25A 5FKOA 3QODA 4UV9A 3ASRA 4RD4A 1MABA 1HLVA 1ULYA 2JUCA 2V1DA 2XAUA 4GFBA 1WTHD 1XG2A 2NSTA 3J7AY 3S1NJ 1QQIA 1W1WE 2MW8A 3M07A 2DXIA 3OKXA 1YIJB 1HC8A 1ETXA 2INUA 5ILUA 1S7OA 2Y30A 1FY7A 2QDXA 3HKZA 3Q3AA 4UUSA 2Y0SA 2W00A 1XG1A 1CZFA 5HS7A 2YWHA 3E0JB 1RC9A 2HDDA 4CICA 1TP4A 1G3YA 2ZTNA 3SFZA 4RD0A 1EZGA 3H5RA 4TV7A 4YZ0A 2NVTJ 3DU1X 1QO0D 2HZTA 2KPMA 3W2AA 4LB6B 2Z8GA 1YLFA 4KKTA 3G6EB 1V0EA 4YZAA 3DPLC 4ZYHA 1I6HJ 5HOOA 1JHFA 3OYEA 2JIZA 1QVTA 3OW7A 1BC7C 2DDAA 4HF1A 3ZOBA 1K8FA 3LSJA 1ZM2A 2OD5A 4DNTB 2M34A 2VBZA 3CC7B 3NARA 2IS4A 2XPVA 4C2MJ 3SZTA 5EEAA 1ZM9A 1QGYA 2A6TA 2CS3A 5TY0A 1R1TA 1QVGB 3L2CA 2ZL5A 3DKYA 4PJMA 2IGOA 1WJAA 4OOIA 2D5VA 2QM3A 1T8IA 4U87A 3HOTA 5AIPA 1H89C 3GTOJ 5DCMA 1WI9A 3BR2A 2QEXI 3I56I 3OMYA 2O0VA 4LD5A 2E36A 1FMWA 4H9GA 2QWWA 3S2WA 3SXYA 2ZL6A 1PLUA 2VB6A 1QRBA 4BKXA 1O3QA 1J9IA 3KE2A 1F9NA 2X3UA 3BZ6A 1ERDA 1GR1A 2HGCA 3JRFA 4RD3A 5BS6A 2KFDA 3TP0A 4A3DJ 1FPQA 3CDLA 5F08A 1HSTA 3EQOA 2G9WA 1VQ6B 3SDBA 3GBGA 1NHAA 2QYOA 3H0GJ 2LVSA 2V9VA 4XKCA 2GPJA 1XSDA 3DEUA 4A0XA 3UR3C 2PG4A 1U3EM 1MNMC 1G8XA 4MYUA 1EFRA 2CV1A 1PUEE 1GLNA 3E5QA 3V8LA 1DP3A 1B1BA 2K3PA 1YJWI 3O3KA 3RYRA 3S1MJ 1H8HA 1KTVA 3QPHA 1G7CA 2EZHA 2P6TA 1VQ4B 4RDKA 1ZM4A 4TMVA 2IA0A 2W82A 3A3GA 3BP8A 3EQLF 3JRAA 1V54H 2YU9J 2O7OA 4W8QA 1J5YA 4G5GA 2JN6A 1OR7A 2L9NA 4Z1MA 3GTQJ 1MMDA 2OBPA 2RKHA 2L3DA 1Q86D 2PBIA 4OOXA 1KCDA 4ZDPA 3KLOA 4OIRF 4QFMA 3J80Z 3KEQA 4N4OB 1A36A 2ME6A 2BV6A 3H35A 2GXGA 4RM2A 5ICGA 3ZZ0A 3OYHA 3L2UA 2XB0X 3CP2A 1OISA 2C78A 3WY9A 1OFLA 3C1DA 3ULQB 4ON0A 2BE5F 1LDDA 4ABZA 4A3JJ 1O8LA 2DFEA 4DZJA 4TN1A 2DAOA 4KNYA 3E97A 3CRZA 5HDKA 1WH5A 3HRMA 3QFCA 3CP8A 2PQ8A 5FD5A 3V7AA 2QKMB 2STTA 5B5EC 2O8KA 4RAZA 1FLIA 1EFUA 2OCEA 2UV1A 2KHMA 2GIVA 1YW9A 3P27A 5F0HA 1VQNI 2M7BA 4KIFA 4XIDA 4HQEA 4A3CJ 1DPUA 3CCLI 4XOTA 2OA4A 2W1OA 3CXCB 1OFEA 2GBYA 1DGRM 4M73A 2B9SA 3JQRA 3HSEA 2CW5A 2VBXA 3OV8A 2QA4I 1VQ5B 1V5EA 4C3HJ 5GPCA 2XF7A 1OOCA 4GQNA 3MQ0A 3CC4I 1ZH5A 2VIXA 3SHFA 2YR2A 5IOYA 4ZDOA 2XC7A 1IRGA 2H8WA 4HDUA 1BW5A 1U0JA 2ZBVA 4UVBA 3ZBTA 4NHJA 4ACAA 5K7HA 2AQEA 2ESHA 1LE8A 4OMYA 2QX3A 3BPXA 3V8JA 2WAQA 2WWYA 4ENNA 4C3IJ 1IN6A 3TOBA 2PN6A 4AC9A 2XGXA 2ME0A 2VT2A 3H36A 2QYUA 1N75A 4XLAA 2OCCH 1IUYA 2YWFA 1LDJA 4B3AA 1O8JA 2IA2A 5CYVA 1BN8A 4B4CA 4BJTA 4IHYA 5J47A 4NCNA 4YAOA 4G6DA 3DBRB 3EUAA 4AF7A 3S93A 5L3BA 2F4MB 4RBOA 4IO9F 1R5NA 3GTLJ 2JJ2A 1ZGAA 3PSFA 1JJ8C 1BBYA 1X4PA 1UELB 2HTJA 2EBIA 3C2HA 3TL4X 1R58A 3N6ZA 4LG3A 1JI8A 1F1ZA 3ASTA 1I18A 3RY8A 1X1AA 1IF1A 1DU0A 2XRNA 1IJFA 5E17F 3CJQB 1EFCA 3PUMA 1SFXA 2VBWA 2CG4A 3Q6QA 4YIIA 4IEJA 4XMYA 4B4DA 5HKKA 4AD9A 3U2RA 4OMZA 3QWLA 3SEJA 2P5KA 1W87A 1RWRA 5M5XJ 1TQIA 1PP8F 2X53S 3FHZA 3FPKA 4HDVA 2FMYA 2M3AA 1T6XA 4J00A 2XSDC 4OP7A 3KP6A 1B59A 1XB4A 2QF7A 4IHTA 2Y48A 1NK3P 3JURA 4B1RA 1IAWA 3A2KA 3OW2B 3A03A 2VFNA 3RQIA 4L0ZB 4ENKA 1D1NA 2ESNA 2EK5A 2M8GX 1KD1D 3IWZA 4XRSG 1FTZA 1JTYA 2MSYA 4X07A 4XD7A 1TLHB 1FDRA 3ABUA 2VI6A 3HXLA 3M9AA 1HDPA 3L9FA 4NQWA 5JFRA 1FNNA 2DMPA 1U9OA 5BPDA 4A3KJ 2XAJA 2XPUA 3U9GA 3A3BA 4NK6A 1RR8C 3CUOA 1JUSA 4IOAF 1ELOA 2Q6OA 4G1VA 1J75A 1BN5A 1TL8A 1TUIA 1VQ7B 4E7IA 4U4BA 3K4JA 3NWSA 3HL2A 4R79A 1YFHA 1IN4A 3KEOA 1MIJA 1H85A 2V7XA 3KP5A 1BC8C 1IV8A 2FX0A 2HQ5A 1K7AA 1MMNA 1YJNB 1T6YA 1XPXA 2VC0A 1W4MA 2GIZA 3IKVA 3MFKA 2C4UA 1KQ5A 2E35A 4BDYA 1O8KA 1VHOA 2GLOA 2JSCA 3P9IA 2ZMEC 2CNDA 2I10A 4IRHA 4BEHA 3QFSA 3RYPA 4P96A 1MDMA 3OIQA 4UZFA 5J35A 3W2VA 1PVEA 4BU2A 2B7EA 5CLSA 2LC2A 3BR5A 4BH9A 2KKOA 3ML6A 1Q82D 1AIRA 2XB5A 3KP7A 2AHOA 1BJKA 2FU4A 3G4SB 5FFXA 5M3MJ 4HQMA 2HVRA 1JA1A 4TMWA 2ZZFA 5E18F 1FNCA 3G6EI 2KRFA 2AHQA 5H5JA 2KLOA 3HRUA 2VQCA 1HKSA 1PDNC 2JTVA 2XNCA 4AIHA 1OYIA 3FMSA 3HHHA 4DQKA 1MH3A 1KC8D 2JSPA 4L5EA 1EH7A 1FOXA 3PUFA 1O8IA 3DU5A 1IRXA 3PFIA 5D4SA 2XDVA 4CUGA 3CC7I 4B09A 3RCOA 4UNOA 5FA6A 1AWCA 3S15J 1K6YA 2GXAA 4L9VA 1T5EA 3HC7A 2EIXA 3I1FA 2G7UA 1UHSA 1V5FA 4RS8A 1T98A 2NT9A 3ISXA 1HG8A 1ZUNB 4N9IA 2B7BA 2JPBA 3DP7A 1OKRA 1J2XA 2FX3A 4WWCA 4ZZLA 1TYWA 3CTAA 1S9HA 1O3SA 2NNNA 4BACA 2NS0A 2BYVE 4ZCMA 2HOTA 2HOAA 2EZLA 1OFMA 3LSPA 4ITVA 3BTIA 3WHBA 2OYNA 1HA3A 3DBHB 3T8RA 2XT4A 1GVDA 1WGXA 3B6AA 1JKOC 1EH6A 1ZKGA 2LY1A 1G3TA 5KHDA 2MH2A 3CO6C 1VQ6I 2IGNA 3O8HA 2P3MA 5IYNA 2ZB9A 4XLCA 5L3GA 3GFJA 1NK2P 5IYDJ 1JTAA 2M5SA 1NB9A 4IVNA 3VO2A 1JNYA 2RC5A 4QVAA 4WXCA 2ZBKA 2DFIA 3Q5FA 1XC5A 3HOVJ 1JA0A 3CUQA 1LM1A 4WZTA 4HV6A 1LVAA 1MJAA 2XZPA 1ZHFA 5HZAA 3HSRA 3JSOA 2EPFA 2M4GA 2NTPA 3FZVA 1VQ4I 1CNEA 2Y9YA 2JRMA 3S3NA 3V7CA 3BTLA 2INVA 2PLFA 4U7DA 4LK1F 1J59A 4WZEA 4RLZA 4A5MA 5FLVA 1E2XA 1VQ9B 5AONA 3AVWA 3GQ8A 2VPLA 3KP3A 3DXJF 5A89A 1GQ8A 2KISA 4RB2C 1EWYA 2O0WA 4B43A 3U1DA 4HE6A 1J09A 4U9UA 4Z06A 1E3ZA 2KQRA 1V55H 3BC9A 1PJ6A 3F0CA 2FQ4A 3MKLA 2UXNA 3F23A 5DV5A 2BW3B 1O88A 1W35A 2M5WA 1G7SA 2RNGA 2OV7A 4OAZA 2BXZA 3VNUA 5A88A 3BY6A 4BBSJ 4QUZA 5LRRA 2RNJA 4PK4A 3LSGA 1S72I 2JA7J 2E34A 2VJIA 3BOQA 5DS0A 3ML3A 1QQ1A 2E1MB 3JRHA 2DFFA 3HOYJ 3A1YA 3GWZA 3HOWJ 2LLKA 4KICA 4IOCF 1UD8A 4M2LA 1K4ZA 4Y33A 4A3GJ 1A6QA 2DCEA 3NAUA 2VNIA 3R6JA 3WTSC 2EZKA 1WJ5A 3WG7H 1MBHA 4DOZA 5ILVA 3WTWC 1JGSA 2C6YA 1EXMA 4C2LA 3CLOA 3QYEA 2XHKA 1WOOA 1IJEA 1FYLA 4UZUA 4EEFG 2NVUB 3SEZA 3BR3A 4GDFA 1O8FA 1GV5A 1ZRFA 3BC8A 3SLNA 2ODLA 3H5AA 1JTXA 5FO5A 1WXRA 3OS2A 3BQZA 1O3RA 4ZYDA 5DNSA 3MHPA 2R4GA 3DQVC 4DNRB 4A3FJ 4IQ4A 4RDLA 1T6SA 1YRNB 3WQZA 2CO5A 2FVGA 1T6ZA 3ZN0A 4F7ZA 3BJAA 2BZTA 1Z6TA 4A0YA 4RM0A 2TRTA 1HDDC 2FSWA 1H0MA 1E79A 4MNUA 2DA1A 1OCCH 4ZYAA 4IX7A 4PABA 4ZGNB 1TW3A 4M53A 1HVXA 3GRHA 4BNCA 5E3NA 4UY8I 4I76A 4RM3A 2D3LA 1MKMA 5GAEJ 3E7LA 2PECA 2IAIA 5B3SH 4PMHA 4I2OA 1IB0A 4P55A 3TDZC 3LMWA 1ZG3A 1QUEA 2G0EA 4XLHA 1LJ9A 1FMVA 1S7EA 4A2UA 1R22A 5E79C 1FP2A 1QBJA 4PGGA 1WPCA 2JVHA 3KZYA 2WADA 2RGVA 4LJZF 5D5UB 2OTLB 3U1KA 4Z4TA 3I53A 2KDZA 2CQNA 2BY0A 2DA6A 2LG4A 1R7JA 2Z33A 4IHXA 5C1EA 4IHSA 2NZMA 2XUBA 1CLWA 4ENJA 3CDIA 4I09A 3J7ZI 4Z03A 5IYQA 4M3GA 3EPZA 4Z4VA 1X4OA 4HX7A 5GP9A 3TO6A 2QMUA 2UVEA 1QZEA 3JSPA 2EQRA 1Z3YA 4BXUA 3ABMH 4WF2A 2HDCA 3PO3J 1D5VA 4Z2YA 3QQAA 3TMOA 4M9XA 2J8KA 2IBDA 3CJNA 1KQ0A 3CLQA 3W6KB 1AKHA 2E2JJ 4A3BJ 4Q4ZF 3OAAA 1VQPB 2LKSA 3NE5B 3LNNA 2YSRA 4I99C 2JRTA 1VQ7I 2CSOA 2IW5A 1ZM3A 4MLOA 2QEXB 2R7ZJ 4YFOA 2ECBA 4LFUA 4RB0A 4YG2F 2D1VA 3K10A 3N4MA 2WV1A 5M3FJ 2V6CA 4XRSA 4RB1A 3ZQGA 1DG1G 2NTQA 1SANA 1MJ9A 4NDLA 1K6OA 2KRCA 2E1OA 3WTTC 2PJPA 4L5IA 2WYRA 2M45A 2K4JA 2WC2A 4M6XA 2DYSH 3F8CA 3OFNA 2W48A 1REPC 1FOKA 3PL8A 2ZJ2A 1SFUA 3EYIA 3IWFA 1EFTA 2L54A 1WU8A 4OOVA 2GWRA 1VQLI 5ILSA 5IP7J 4Y13A 2QZAA 4P6YA 3GZ5A 2HDWA 4D7MA 2XSJC 1W36C 1ZLJA 1RR7A 2XPWA 5K1YA 5KSWB 2QQ8A 4XICA 3VMFA 1IB4A 2ELHA 2JA2A 3NWTA 1Y39A 5IYWA 2OF7A 5J8FA 5HDNA 3GTJJ 2BM7A 4W97A 4P25A 1MD0A 3J7AO 5E20A 3LQ6A 1U5TA 1UCRA 3GVKA 4U88A 4XKBA 4FE7A 4XL9A 3F21A 3FKIJ 4UAJA 3T0YA 1FNBA 2XAGA 4PAAA 1WDTA 5M5YJ 4X05A 2EIMH 1FRQA 2JUGA 4GXOA 4P5OA 2HYJA 1ZRCA 2MABA 4KT6A 4LBWA 1TT5B 2QUFA 3T56B 1U8BA 4Y52J 5KW9A 2CUFA 2W85A 5IP6A 1OCZH 2OU2A 3GX4X 4Q7JB 2XGCA 5GV7A 1KQSB 3H9QA 2HPIA 1X19A 2R92J 2BX6A 4XLFA 4AUXA 2GM4A 1OFCX 3ABLH 1IUFA 3MMPA 1E3PA 2F5VA 3W5VA 1FYKA 2R7FA 4Q48A 2HS5A 2B5OA 5KVRA 3E3VA 1FC3A 2WR8A 3GQ9A 2Z6BD 1W0TA 2NXNB 3VSLA 4CGZA 4WZLA 1D5YA 2BM4A 2KIFA 2COBA 4G7OF 2Q2EA 2DYIA 1U6GA 3GTPJ 1IG7A 1ZN2A 1X1DA 4QPOA 3CCMI 1XS9A 3OP1A 1VQNB 1B23P 4MR0A 4RGSA 4JRAC 3PUBA 1ZK8A 4KDPA 3ZPPA 3F8BA 3OR1C 4B47A 2MLGA 2OC6A 2OK7A 1ETYA 3C2GA 2R7OA 1UD6A 2QBYA 1SMTA 4LLNA 4BBRJ 2CFXA 3K6GA 1WCMJ 4RD1A 2F5EA 2NOGA 3OR2C 2K86A 4CZZA 2PMDA 4PC7A 4QV2A 4ZCIA 2VC1A 3PSZA 1D3YA 4L5JA 2V9PA 4R71A 2V7QA 5C3EJ 1OQYA 5LRSA 2R9VA 1GT0C 1W7PD 3NB2A 2XT2A 1A5JA 1R5HA 1BJZA 1JKQC 1XFOA 2BV3A 2EV6A 3Q3SA 2NVXJ 2F1MA 4DW6A 3S17J 1AA7A 2WA0A 1VQ9I 4LMYA 2M8EA 4U0WA 1K78B 2E1CA 1CNFA 2LDUA 1EP1B 3QFTA 3O6BB 1NH3A 2X6YA 5JHFA 1QHHD 2NS7A 1KZLA 3JRDA 3V42A 4A12A 3BTJA 1JE8A 3H1CA 1NHCA 3HHGA 2X48A 3KCCA 2FBKA 4JX4A 1RESA 4M1KA 1QPMA 3VFZA 5E1WA 1OGMX 3B73A 3A0BC 4XKVA 1WJBA 1SAXA 3DBLB 3K4CA 5CQGA 3ASNH 3JR9A 1XDUA 2FA5A 2NRAC 3WTZA 4C2TA 2XZLA 3L2WA 4YIRX 2LFBA 4Z05A 1ON1A 2VL8A 4NBSA 3H3VK 2DYRH 1KK3A 3M4OJ 3WGIA 3E1YE 1TWFJ 3GYHX 2WV0A 4GRIA 4PSXA 1EA0A 4AU7A 2QGUA 5KCMA 1XQBA 3LOCA 3ZBUA 3E6BA 2OZ6A 1ZQ3P 3DU6A 3EUKL 5FB2A 4EJTA 1RU4A 1GXQA 4P9UA 5BPIA 3BH6B 3EQNA 4G6QA 5DM7F 2X4HA 1QFYA 2VNKA 4ROXA 3MZYA 2NVYJ 3R6SA 3OYDA 5KK1A 4DYQA 1S29A 3E20A 1IZ1A 2ZXWH 1P4XA 3NQOA 3WNCA 4DJAA 2DK5A 2KL4A 3BH7B 3EETA 3DKXA 3GFIA 1SVMA 4MYTA 2LBFB 4CXFA 5L3DA 4FQGA 1BOBA 3S14J 2BEOA 3FBNB 5EG0B 4EV0A 5GADJ 1TW2A 4Y7NJ 3SZGA 5CJ9A 2DPDA 2VLAA 1XCBA 4F7DA 4OJOA 3JW4A 4FX0A 5FKLA 3RJPA 2QQAA 1L3LA 4X7EA 1YJ9B 1KU9A 1MRZA 1N08A 1K83J 2ZZEA 3RPUA 3OPOA 1LUJB 1QG0A 3WE2A 1STZA 1KK1A 1JT0A 3KZZA 2ZITA 1WI3A 3AVUA 3AK5A 3C7JA 3DKWA 5CVRA 3VSKA 1FNMA 2BSAA 2F6CA 2E19A 5DEQA 1XX5A 1OB0A 1U8RA 2XIGA 3SUCA 2O1DA 2DT7B 1IRFA 1YX5A 2ECCA 2Q8KA 3PIOF 1K61A 1YRNA 1BQEA 2L7KA 2OTLI 2V4DA 2ADUA 2R7TA 4P22A 5FKNA 2E2IJ 2WAFA 5FJ8J 1SC7A 4E0FA 2XTYA 4KITB 4LG0B 2OAZA 2VODA 1XGOA 2VBMA 1LVKA 2EA4A 1JKPC 5H20A 3Q0VA 3CZ6A 2L7MP 2CQXA 2YS9A 1R1UA 1MBFA 2F1LA 4K2EA 3W2WA 3GCMA 4AM3A 4OIQF 3K4KA 4ASUA 1DDIA 2RC4A 4CCJA 4E7JA 4OPVA 3AVYA 3AVTA 2FBIA 3RTRA 3EUHA 2IEKA 1Z67A 3MKWB 2DFHA 3A1PA 4W1UA 4Z4WA 2P5VA 1VQPI 2JN9A 2QGGA 2KZGA 1Y0UA 1YW8A 3KETA 5FIUA 1JUMA 4Y9RA 1LLZA 2PMZN 4JK1X 3DEEA 4QHYA 1M90D 1MSEC 3GVAA 1GJRA 1QFJA 4ZC3A 3E5XA 1ETOA 5ED4A 3CPWB 2BVLA 1I8DA 3PIPF 1YITB 3R0AA 6PAXA 4BYYA 3PFYA 3TEDA 1ACIA 2JJ7A 2BM0A 1LEBA 3R6KA 1PXZA 4EM1A 3VSUA 1UB9A 2ID3A 3HEFA 2A5WA 4FHTA 2ACJA 3WBJA 1M1KD 1LFBA 2EFNA 2XGEA 4O5VA 5FD6A 1NDHA 2D9RA 3VYTB 3MCZA 4UV8A 3V7SA 2Z5UA 4S04A 3IC7A 3BCFA 2FNPA 2DMQA 3I54A 3ASOH 3BG9A 3GW2A 1IGNA 4IHVA 1K28D 3IRQA 1G2HA 2VJJA 1T33A 4RD2A 1K4TA 4PSWA 3I71A 4HE5A 4II3A 3LO8A 2MFZA 1XGNA 1M1EB 5HLIA 2QTZA 2IOUG 3GUDA 2HQNA 3UW0A 4V02C 2A6EF 1TNTA 4LIVA 1I6XA 2K85A 3ESWB 3TO9A 4XKWA 4HF2A 3E5UA 1I27A 2ZNYA 3Q0UA 3T53B 2L0KA 1YYVA 5FGMA 3CQZJ 2KDOA 3OYBA 1N0UA 1MBEA 1D8TA 1RUNA 2NT6A 2ZXHA 3NRVA 2GQQA 2QN6A 1EA3A 4P1VA 3ZMUA 1QA3A 2H09A 4EATA 2K9NA 3QPTA 5DD8A 5F1RA 1HKTA 5F4OA 1V0FA 1IN7A 2STWA 1VBLA 2VNHA 1TQPA 3F8FA 2L2OA 3HTUA 2MC4A 4XRFA 2DLLA 5TGTA 4EMSA 2RDPA 4FK8A 1P7IA 3U2QA 1RETA 1TZLA 1K79A 3W5UA 3VSTA 3HOXJ 3LYCA 2QSGX 2DA7A 1R5BA 2A5YB 4B3FX 3MN2A 3WWGA 4XSXF 4Y3OA 1Y56A 2P7VB 3WG9A 1P4WA 2ZMEB 3S3OA 2KIUA 1V3FA 4Y15A 1RIOH 5IPAA 2Z9OA 4P6VF 4Z4ZA 3FDYA 2HOSA 2V4JC 1S72B 3MZHA 4YZXA 4XN3A 5CPRB 4BE2A 4XBFA 4HNTA 3CC2B 1FSEA 2ZFWA 3T51B 3GEZA 2A68F 3C2BA 2QENA 4BE0A 1VQMB 1E3XA 3AKZA 2P8TA 3J7YJ 4AF6A 3BY1A 2LD5A 4TMXA 3DLLF 4ZYEA 3P5JA 1DBGA 2ZSIB 2QQ9A 3TH0A 2DOFA 4KT5C 1RNLA 1PUFB 1GDTA 3CB4A 4TSFA 1Q1VA 1JHHA 1O57A 1CQTA 5JVGF 1FWZA 4C30A 2DETA 1SFEA 3SJMA 2OQRA 2R5ZB 4UZEA 2ZSHB 1YE9A 5JR3A 1VFCA 4J0QA 5DDGA 2ZC2A 4OWRB 1ZR2A 1E43A 4RAGA 1IO2A 3LVBA 4YAUA 3KYDB 3QOEA 1WSVA 4JX5A 2F4NA 2YU3A 1Q7YD 2V26A 1H8AC 3H9NA 3KEWA 3BLYA 1S0UA 2V7VA 1U9NA 2EB7A 1O8MA 1BOAA 4N9HA 4XORA 3BZCA 2V7WA 4ZJZA 3GXOA 3BROA 4KIBA 2HEOA 4RPBA 3QYFA 1QCXA 4C3JJ 3TQNA 2DU9A 4HAMA 5JLXA 2RQQA 2VFQA 2RN7A 4HF0A 2EV0A 3J81Z 3V4GA 5HNHA 2X1CA 4HX8A 3PQJA 2IXSA 1DU6A 1GAWA 3DTEA 1I1SA 2WPDA 5KNLA 3ZRGA 1Z05A 3AVVA 3WYAA 1Z7UA 1SEUA 1T0FA 4KN7X 2PX9A 3OY9A 4G9YA 3L1PA 1Y8RB 5L46A 2DERA 1LQ1A 2M87A 4BS9A 2W57A 3ELKA 1YS7A 1HF0A 3CJRB 4Y4RA 2UZKA 3M7GA 3K1MA 3VOEA 2ZXJA 1IJWC 1APLC 4GYIA 4FX4A 4M4SA 4U49A 1WSRA 3QPSA 5EF6A 3ZC3A 5IYBJ 1QGPA 2DQRA 5FROA 1WOPA 4C0SA 3KLNA 2W25A 1OCTC 3OWTA 2OTJB 2LH9A 3CUQC 5HZBA 4CCNA 4OM9A 4B3GA 4PDKA 1IN5A 1TYVA 1N8RD 3VMVA 3ZQ7A 5EGOB 5IT9Z 2HFHA 3J80K 3EYYA 5J4VA 2XKPA 5H6QA 4KMUX 5A8AA 2BXYA 2EH3A 2CW8A 2IP2A 2EA2A 3H3ZA 1W36D 4JOMA 4CYCB 4IPAA 2R3SA 4ZTFA 1Q9SA 1QVUA 1TVCA 2Z16A 3BCDA 1QGZA 2QSHX 3P7NA 2ELKA 2LOOA 1YJ9I 3OOPA 4E6KG 1YTYA 3KFWX 2ZJRF 5F27A 2BGCA 2YUSA 3S2DJ 1MZBA 1E3OC 4YEJA 2LBFA 3RIQA 4HWVA 2OBRA 4X06A 3M8FA 1NG6A 1FNDA 5EG0A 1DP7P 1F5TA 1X0CA 2IQ7A 3DWLE 2L9SA 4X8IA 2O17A 2XC1A 1ZLKA 2W6JA 3ZQHA 1VQLB 3FM5A 1PJ7A 1Z6RA 3RIRA 3RKXA 4NC7A 2EIKH 2LK2A 1RI7A 3GTMJ 1F60A 2WJVA 3OJXA 2NSPA 5EJCA 2DCUA 3DF8A 4YXWA 2HR3A 3O2PE 2P4WA 4ZZDA 5FLMJ 3OZVA 1WRJA 3VB2A 4BHPA 1B4AA 4F92B 2EFWA 3OYIA 4F55A 2L7FP 2FMLA 3DEWA 2MBFA 1KK0A 3DPTA 1KK2A 2EFOA 2OUMA 3ZGKA 5F4JA 3N90A 1XSVA 2HTSA 1VI0A 2XAHA 4WWVA 2F48A 2HI3A 2NAZA 3RI4A 1QRYA 3TKYA 4BY7J 1NRKA 1G7RA 3GSIA 2CMPA 3K69A 3WTUC 3G3ZA 3L2RA 1VTNC 4M71A 1WORA 1IHMA 1BR1A 1SVOA 1TC3C 1E0EA 3J81K 3IAS2 3CMAB 2VJ4A 3I59B 2V5IA 2D45A 3A01B 3T1BA 4JP0A 4CA0A 2K5CA 2KIQA 3WGHA 3G05A 3GVLA 3SQNA 2FOKA 1YITI 1IDYA 2YPRA 4HLXA 5F6FA 3GZ6A 1MJBA 1TNSA 2BSPA 4B8XA 4BHBA 2LNBA 4HYEA 3T9GA 2DDBA 4W8TA 5D8LB 3IH2A 1XMKA 3LSHA 1C0WA 3D5RC 1D1BA 4KN4X 4G7WA 3MWMA 3CCMB 4ZYGA 4OJLA 4E70A 4HIZA 1X58A 3K2ZA 2E7WA 3LQRA 5H59A 4Z4YA 4HPQA 2CF4A 4EJUA 2P0WA 1R36A 1UHWA 2Y31A 5IY5H 1X1PA 1WPKA 4FT8A 4G7ZF 3OYAA 4DGWB 3R60A 3G73A 2L4AA 5DSZA 2DMNA 2CBXA 2F5DA 2XGDA 5EZGA 3EDPA 4DIQA 3Q0WA 5IT9K 2FBHA 3F8MA 4OIOF 2H94A 4RAFA 2WAEA 4P12A 3HTSB 3SKBA 2VZLA 1ZGJA 4I02A 5J3OA 5EMNA 1NG7A 2LR8A 2IRFG 2BM5A 2ELJA 2FQ3A 3JTHA 3FKSA 3LQQA 3SZPA 1WHUA 2JWTA 1UD3A 2MYSA 1E17A 1Z21A 2G0YA 2M0CA 1F36A 1X2MA 5GAGJ 4QLCU 1E3HA 5BMZA 2V7UA 4AIJA 2MLKA 4P9SA 2O8XA 4CCOA 4YFKF 2NYXA 2DBBA 4XRMA 2V1UA 1SD6A 1EP3B 1R4MB 3UKGA 2RREA 2H6CA 2CQ7A 2V6EA 4N3GA 5IK2A 5CDFA 1UMQA 4MQ9F 2FEZA 4X0GA 4XM3A 4F3QA 3CD6B 1TWHJ 1MW7A 4WXHA 4ZCLA 1XN7A 2A3SA 3KIOA 1H88C 3NAWA 2IS6A 4XR6A 3W3CA 2EFGA 3CC2I 1BJAA 2O3FA 1ETVA 3KP4A 2KMUA 2JA8J 1VQMI 1RRJA 1N07A 1MGTA 3ZZUA 2HMAA 2KT0A 5C4JJ 4A3EJ 1D1CA 4LC0A 2UUZA 1OB2A 1O7LA 3H9JA 3N05A 4B44A 2BY2A 2M7AA 2OK8A 2BVMA 4CDGA 3M8EA 2BGIA 4RDJA 5E1XA 2YX7A 5E1ZB 4EQQA 2ZZGA 5D6EA 2ZMEA 3D0SA 3B02A 1UZCA 4O6JA 4P26A 2PMUA 4X0CA 2YX4A 5HNFA 5CVJA 2AQFA 3FK7A 4KMFA 1YQAA 2JVGA 3L2VA 1U5TC 1K5CA 4TMTA 4C43A 4A69C 4HOBA 2JA6J 1LFPA 2CWEA 3OIPA 4MEXF 4LBVA 1XB2A 2CRGA 1FRNA 3HZJA
chains in the Genus database with same CATH topology
1HA8A 3WWGA 1ERDA 1O8HA 2GK6A 1WJEA 2V7QA 5C1CA 1IA5A 4TKOB 2R9VA 3EQOA 4C2UA 3RPUD 3SDBA 3GBGA 4HEA2 2F1MA 3DTIA 1QHGA 1P9QC 1AA7A 3DDYA 4XKCA 5CQEA 4F93B 2WA0A 1OLTA 1H80A 5LFAA 2V31A 3VWBA 3UR3C 1G8XA 4QPQA 1EFRA 2CV1A 3D5LA 4CCMA 1GLNA 3LMMA 4XLEA 3OYLA 2X6YA 4IQJA 1DP3A 2K3PA 5JHFA 1QHHD 1H8HA 1KZLA 3V42A 3BCBA 1NHCA 4XQFA 2DIEA 2W82A 3A3GA 3ZSCA 3L2QA 2X51A 1UD5A 1OGMX 4W8QA 1Z7LA 4NC8A 4C9YA 4CH7A 4XKVA 1WJBA 2PYHA 4C2TA 3K4CA 5CQGA 4NK8A 2L9NA 2XZLA 4Z1MA 3PNYA 3L2WA 1MMDA 1KTWA 1RMGA 3FY3A 4Z05A 1KCDA 3OOCA 4ZDPA 4W8SA 2VL8A 1ZELA 2VQLA 2PJRB 2R7VA 4N4OB 2IGKA 2GJPA 3H35A 4GRIA 4RM2A 4PSXA 4AU7A 3OYHA 5KCMA 3CP2A 3L2UA 2GK7A 1OFLA 2XF5A 3DU6A 3EUKL 1N78A 2D3NA 1O8LA 4IKFA 1RU4A 3EQNA 2Q2EB 4FETA 3BG6A 2XGJA 4NNJA 3OYDA 3CP8A 3RQ4A 4F52A 2QKMB 3OYGA 2UV1A 4DJAA 2KHMA 2E5NA 2KL4A 3G2BA 2M7BA 3DKXA 4OJ6A 2LBFB 3DLAA 4XOTA 2W1OA 3B8YA 1BOBA 2R7SA 3FBNB 1DGRM 4D1QA 3H0DA 1OGOX 2CV0A 4YELA 4BL0B 3HUGB 1V5EA 2XF7A 4G6IA 3SZGA 2VKHA 5FRNA 4IZZA 3KYLA 2VLAA 4GQNA 4P1WA 1OOCA 2E60A 2KP6A 2VIXA 4OJOA 4ZDOA 3S8PA 2XC7A 1U0JA 4E7ZA 4YRVA 2AQEA 1MNDA 2ZZEA 2QX3A 3OPOA 2WAQA 3VR6A 2KVOA 2X6WA 4KKUA 2IGMA 4FASD 1N75A 4XLAA 3VSKA 3ZQQA 3K70D 3ZPNA 2F6CA 3PJRA 3PNVA 1O8JA 4DBRA 4B48A 1BN8A 3I3LA 1OB0A 2E1BA 4BJTA 3BH4A 4URRA 3GVJA 2NTBA 2O1DA 2DT7B 1BR4A 1YX5A 2V7FA 3SUCA 3JU4A 3EUAA 2VKDA 2Q1ZB 3GQAA 3S93A 2L7KA 2V4DA 4P22A 2R7TA 2E1MC 1VZ0A 2JJ2A 3PSFA 2WAFA 4BJ6C 1X4PA 3C2HA 1UELB 3MMYB 3MKYB 3TL4X 4E0FA 4KITB 1QJVA 4L8JA 2VBMA 1LVKA 2X6XA 4LG3A 1JI8A 4BQOA 3OYCA 1I18A 3CZ6A 1X1AA 4PJJA 4J01A 3CJQB 3H9GA 3W2WA 1WJDA 3K4KA 2IS1A 4ASUA 2M0MA 4XMYA 5HKKA 2HQAA 4CCJA 4E7JA 4OZYA 2L5QA 4RMNA 3RTRA 4EW9A 2M4KA 4DBQA 4BXFA 2Z1DA 3AFHA 3MKWB 1E1QA 1RWRA 5AMVA 2X53S 2DJIA 4CSWA 3B90A 2M3AA 2K9MA 4BGDA 3ZXSA 4J00A 3DPUA 3OL3A 3DEEA 3JURA 2W4SA 3A2KA 4B3XA 4PJLA 1WP6A 3OS0A 5DN6A 4E7SA 3FBIB 4ZC3A 2GJKA 2BVLA 3VYSB 1I8DA 4XD7A 3PFYA 3HXLA 1PXZA 3HAGA 3VSUA 2A5WA 4RLQA 3A3BA 4NK6A 4RLFA 2ZXIA 4AYBA 3H94A 3VYTB 2WB1A 4BUPA 4E7IA 4KJZA 4U4BA 3K4JA 3NWSA 2WY7Q 4R79A 3OYFA 3HL2A 2PMZA 3BCFA 3VDXA 2LZJA 2HZDA 4W8RA 4ZDLA 1K28D 1MMNA 3M8JA 3EUHC 4FXUA 1D0ZA 2VJJA 2F4IA 3KX2A 4PSWA 2WSSA 1UD2A 3CESA 3MD2A 4BDYA 4II3A 1O8KA 2MFZA 3OYMA 4BEHA 3OEHA 3UW0A 3OIQA 2WY8Q 4LIVA 3LSMA 3VYUB 3W2VA 2ZTGA 4BU2A 2UVFA 2VQGA 2LC2A 3OL4A 3OE7A 4OJPA 4XKWA 1AIRA 1DBOA 3AL0C 3T53B 4CCKA 1VJSA 2X1EA 1D0XA 2KDOA 3OYBA 2DT6A 2HVRA 2NT6A 2ZXHA 2ZZFA 3QYBA 1EA3A 3H5NA 3HPGA 1WJFA 3LL7A 2CV2A 2CH0A 4EATA 1BMFA 1V0FA 3VMWA 1VBLA 2KLOA 3CMMA 2VQCA 2L2OA 1EE6A 2MC4A 5TGTA 4E4HA 1TZLA 3LFUA 4BJ5C 1D0YA 2JSPA 3VSTA 4B3FX 1O8IA 2QE7A 1PJRA 2GOMA 3DU5A 1IRXA 5CKTA 4CUGA 2VXZA 1SFKA 2QKLB 2XDVA 4N4NB 1Y56A 4Y3OA 3RCOA 1UD4A 2WBMA 3S3OA 5FL7A 1K6YA 1JRGA 2BW3A 1T5EA 4XOPA 3HC7A 2LRDA 3FDYA 2V4JC 3PNTA 5HVQC 2VBKA 1V5FA 4OZZA 4HG2A 2NT9A 4YZXA 4XN3A 5CPRB 2W7NA 4HNTA 4BE2A 3T51B 1HG8A 1T95A 1DQUA 3AL0B 3OYKA 4HSRA 4BE0A 1E3XA 3AKZA 4E7KA 3OOUA 2KRHA 4HNUA 2V1NA 3ONQA 2CW7A 4D9JA 4BQQA 3S3MA 1S9HA 1OR7C 2R7XA 4BACA 1DBGA 4E7LA 2ZSIB 3ZIAA 4TSFA 1N77A 2XNDA 1OFMA 4ITVA 4C30A 1SAUA 3F9KA 2ZSHB 1YE9A 2LY1A 2GOXB 4LIUA 5KHDA 3OEEA 2IGNA 3OYJA 4OWRB 1E43A 2XZOA 2KZVA 3PSIA 4XLCA 3QOEA 1JTAA 2ZZQA 2R7UA 2V26A 2XOKA 3KEWA 2M5SA 3BLYA 1O8MA 2XF6A 2HVSA 4XORA 4KISA 4ZJZA 1QU3A 4KKSA 1WJCA 3QYFA 4G7XA 1QCXA 2EWEA 2PYGA 3IP4B 1MMAA 3VYRB 2XZPA 2RQQA 2M4GA 1X1BA 3MKZA 2NTPA 4DK1A 3S3NA 1DGWY 1KMHA 5HNHA 3BCAA 2X1CA 4CCLA 2INVA 5HLTA 2IXSA 5LD2C 3DTEA 2WPDA 4PFOA 5KNLA 1G59A 3ZRGA 4H4KC 4G6TB 2VPLA 3GQ8A 1NBMA 1LKXA 2F43A 2V9KA 1GQ8A 3FHNA 3OY9A 3U21A 2O0WA 4PUSA 2X1DA 4XN0A 1J09A 4B43A 4BS9A 4Z06A 1E3ZA 2KQRA 2HU9A 3A35A 1MNEA 3CJRB 4Y4RA 3ZR8X 3BC9A 4DK0A 2JDIA 4U49A 2BW3B 3DTKA 3K4NA 4NUBA 1O88A 1OHHA 2E5ZA 2RNGA 3BG7A 2OV7A 5FROA 4OAZA 3HPHA 1KCCA 1TT0A 3OWTA 2LH9A 4PK4A 3LSGA 4CCNA 1BR2A 2VJIA 3E1SA 3OS1A 4B3GA 1X1CA 4E7HA 2NOJB 2E1MB 3A1YA 2W6IA 1BHEA 1UD8A 2BOLA 1UAAA 4Y33A 3VMVA 2DCEA 3SEQA 2DOAA 2PJRA 1MMGA 1W9XA 1WJ5A 3A4CA 4DOZA 4BDZA 1W36D 2CW8A 2VXDA 4JOMA 4ZTFA 3BCDA 2O5RA 4YZQA 4C2LA 2Z16A 1YX3A 1T0FC 3HG9A 3QYEA 4I84A 4PJNA 2LOOA 2VASA 4UZUA 1VF7A 2X85A 3SEZA 1O8FA 1IDKA 3BC8A 4BE1A 4OAYA 3VSVA 4E6KG 2O04A 2VQHA 4XNFA 2X3HA 1WMRA 2ODLA 3H5AA 4YEJA 3SYTA 3OS2A 2LBFA 4HWVA 2R4GA 3DQVC 4DNRB 2QY1A 4IQ4A 1NG6A 4BQNA 3WQZA 2IQ7A 1X0CA 2ZFUA 3DWLE 2CUJA 1O8DA 2L9SA 1Y6IA 2O17A 2CK3A 2FUG2 3UNGC 2W6JA 1E79A 4ZYAA 2CUZA 4JQFA 4IX7A 2K9LA 1KONA 3OYNA 3LSKA 4JMQA 1HVXA 3GRHA 2LYCA 4RM3A 4NC7A 3S32A 2D3LA 2WJVA 2PECA 2NSPA 4YXWA 4PMHA 3LMWA 1W0KA 4XLHA 1HZEA 2VBEA 1FMVA 2WJYA 4F92B 1E1RA 1FX0A 3OYIA 4F55A 3IUOA 3ZCOA 1WPCA 3DPTA 2JVHA 2OUMA 2WADA 3K4MA 3ZGKA 4U7BA 2GJRA 1UG0A 1PE9A 3I9V2 5C1EA 2MD0A 2LG4A 3K70C 3M1CA 2NZMA 1NRKA 2CMPA 1O8EA 3L2RA 4Z03A 1BR1A 2R7WA 2IS2A 3GQ7A 1E0EA 3EPZA 2HPMA 2X8KA 1X4OA 3IAS2 2VJ4A 4II2A 2UVEA 4OJ5A 3D5SC 1Z3YA 4CA0A 2K5CA 4NQWB 1Z3XA 1R6RA 3G05A 3GVLA 2Z2SB 3TMOA 1H8EA 4ZTJA 2QXZA 3OAAA 3KRGA 2BSPA 2VJ5A 2I8DA 3K4BA 2R7RA 1PKVA 3NE5B 3T9GA 4F91B 4W8TA 3LNNA 1BPLA 3LSHA 3D5RC 1D1BA 4G7WA 3K4LA 1COWA 1V5GA 4MLOA 4OJLA 4HIZA 2JJ1A 3GQBA 3B4NA 4HPQA 2HLDA 3IAM2 2HVQA 3K10A 2P0WA 2HNHA 2NTQA 2R7QA 1SKYB 3OYAA 4BEHB 4DGWB 4TT3A 2KRCA 1W0JA 3CF2A 1PYVA 4AVZA 4HRIA 4DIQA 3OFNA 3FPPA 1WFXA 2UWMA 1IDJA 2WAEA 3PL8A 1NG7A 2LY2A 2ELJA 3QODA 3FKSA 1MABA 2HDWA 1W36C 1D1AA 2XSJC 3KEYA 1UD3A 2XAUA 2MYSA 1WTHD 1Z21A 1XG2A 2NSTA 3J7AY 1IB4A 2JA2A 3NWTA 2DXIA 2INUA 4CCOA 2WZPP 3HKZA 2Y0SA 2W00A 4ANJA 1CZFA 4HSTA 3E0JB 4XONA 2ZTNA 3TBIA 2V6EA 2RREA 5CDFA 2LREA 5IK2A 3GVKA 3H5RA 4XKBA 4XL9A 4X0GA 4YZ0A 3W2AA 4XM3A 2KPMA 4F3QA 2Z8GA 4KKTA 4YZAA 1MW7A 1V0EA 3DPLC 5HOOA 2JUGA 4P5OA 2IS6A 2MABA 1LDKB 4KT6A 4LITA 4XR6A 3W3CA 3T56B 4CZCA 3RSNA 3OYEA 3FKJA 2JIZA 3H9QA 2KMUA 3OW7A 2HPIA 1X19A 4XLFA 1BLIA 4DNTB 3LSIA 1D1CA 2F5VA 2IS4A 4MXNA 2UUZA 5FRMA 3H9JA 2A6TA 2CS3A 3N05A 2M7AA 4B44A 2BVMA 3VSLA 2Z6BD 3GQ9A 3DKYA 4PJMA 2IGOA 1WJAA 2ZZGA 1O8GA 1X1DA 4QPOA 4U87A 3HOTA 4MR0A 3PUBA 5HNFA 2AQFA 3ZPPA 3OR1C 2JVGA 4B47A 3L2VA 3OMYA 2O0VA 2OC6A 1K5CA 3C2GA 2R7OA 1UD6A 1FMWA 1LFPA 1PLUA 3OIPA 2VB6A 1VLYA 4PFPA 3K6GA 2CFOA 3OR2C 3HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZM A;  1O8E A;  1O8H A;  4XLC A;  5C1C A;  4XMY A;  4Z03 A;  1JTA A;  1IA5 A;  4OZY A;  3GQ7 A;  4EW9 A;  3EQO A;  1O8M A;  1RWR A;  5AMV A;  4OJ5 A;  2UVE A;  4XOR A;  3B90 A;  2EWE A;  1QCX A;  2PYG A;  3JUR A;  3KRG A;  1H80 A;  2NTP A;  2BSP A;  3T9G A;  4W8T A;  4XLE A;  2X6Y A;  2INV A;  1PXZ A;  1NHC A;  4OJL A;  3VSU A;  3GQ8 A;  4XQF A;  4NK6 A;  3B4N A;  3ZSC A;  1GQ8 A;  1OGM X;  4W8Q A;  2O0W A;  4U4B A;  2NTQ A;  4XKV A;  4XN0 A;  2PYH A;  4NK8 A;  4Z06 A;  2QXZ A;  4W8R A;  1RMG A;  1KTW A;  1KCD A;  3FY3 A;  4Z05 A;  4U49 A;  4W8S A;  4AVZ A;  1O88 A;  2VJJ A;  1IDJ A;  1KCC A;  1O8K A;  1OFL A;  2VJI A;  1O8L A;  1RU4 A;  3EQN A;  3UW0 A;  1BHE A;  2UVF A;  3VMV A;  4OJP A;  4XKW A;  1XG2 A;  2NST A;  1AIR A;  1DBO A;  1IB4 A;  4OJ6 A;  2INU A;  4YZQ A;  4C2L A;  4XOT A;  3B8Y A;  2NT6 A;  4I84 A;  1OGO X;  1CZF A;  4XON A;  4YEL A;  2X85 A;  1O8F A;  1IDK A;  4XL9 A;  3VMW A;  1VBL A;  1OOC A;  3VSV A;  4YZ0 A;  2O04 A;  4XNF A;  4OJO A;  1EE6 A;  4XM3 A;  2X3H A;  1WMR A;  2Z8G A;  2ODL A;  4YZA A;  4YEJ A;  3VST A;  4HWV A;  1O8I A;  4XR6 A;  3WWG A;  2QY1 A;  2QX3 A;  2IQ7 A;  1X0C A;  2X6W A;  1O8D A;  1JRG A;  2O17 A;  4XLF A;  4XOP A;  4XLA A;  2VBK A;  4OZZ A;  4YZX A;  2NT9 A;  4XN3 A;  1O8J A;  4MXN A;  1BN8 A;  1HG8 A;  3GRH A;  3GQ9 A;  4URR A;  2NTB A;  3SUC A;  2O1D A;  2PEC A;  1O8G A;  2NSP A;  4PMH A;  3GQA A;  4MR0 A;  3LMW A;  4XLH A;  2VBE A;  1DBG A;  3ZPP A;  2O0V A;  1K5C A;  1OFM A;  1QJV A;  2VBM A;  1PLU A;  2X6X A;  1PE9 A;  5C1E A; 
#chains in the Genus database with same CATH topology
 1HA8 A;  1AU7 A;  2VT3 A;  3ZMD A;  2EIL H;  3CCJ I;  3OJW A;  2GK6 A;  1PP7 U;  1PUF A;  2NVQ J;  4HV5 A;  1XGM A;  1QUF A;  1R5I D;  3RPQ A;  5GAH J;  4AIK A;  3JQP A;  4C2U A;  3CCR B;  1A04 A;  2R5Z A;  1MH4 A;  3DTI A;  1A35 A;  1P9Q C;  2MA3 A;  3DDY A;  4F93 B;  2C77 A;  1TYX A;  5LFA A;  2V31 A;  3WNB A;  5FO1 A;  5E3M A;  2DQL A;  2RQP A;  1J9Z A;  4UUS B;  4JX6 A;  5JLV C;  3SLD A;  4CCM A;  4XLE A;  3OYL A;  4IQJ A;  1TLL A;  1TTT A;  1VND A;  3RKY A;  1RQR A;  3BY2 A;  2YUH A;  4I0A A;  1S3J A;  2DIE A;  2LF7 A;  2X51 A;  3L2Q A;  1U2R A;  3B82 A;  4NC8 A;  1R5G A;  3O8G A;  4CH7 A;  1O3T A;  2K27 A;  2OBT A;  3JAM Z;  2QQB A;  3ZMS A;  1KU2 A;  3ABT A;  2R6H A;  3PNY A;  3BT9 A;  4ZGQ B;  1RMG A;  5FNZ A;  3FY3 A;  2OTJ I;  1OCR H;  2MG4 A;  1KYW A;  4W8S A;  2E2H J;  3H92 A;  2VQL A;  2R7V A;  3CDH A;  3P9C A;  3LAJ A;  1I7P A;  2GK7 A;  5LGN A;  1OCP A;  5D5W B;  2L9R A;  1HXD A;  3M3Y J;  1N78 A;  2PYH A;  4FET A;  2XGJ A;  4NNJ A;  4WZK A;  1LEA A;  3L7W A;  4EM0 B;  3RQ4 A;  2CRV A;  3AVX A;  2DA4 A;  4I98 B;  1QGA A;  1KU7 A;  2EIN H;  2E5N A;  2CJJ A;  3CCV B;  3MEX A;  1ZRE A;  2NNY A;  2D1H A;  4OJ6 A;  3R4K A;  3DLA A;  3BR0 A;  2HXI A;  2J7K A;  3B8Y A;  2ETH A;  1QA2 A;  4D1Q A;  3L00 A;  3ASP A;  1OGO X;  3F72 A;  2CV0 A;  2I1L A;  1ON2 A;  4O3M A;  4LLG F;  1N0V C;  1QPI A;  2VPR A;  4G6I A;  5FRN A;  2VKH A;  4IZZ A;  3KYL A;  2G7H A;  3CME B;  3S8P A;  3ERE D;  4ENM A;  3VNV A;  1K9M D;  2GA2 A;  1ONV A;  1SKQ A;  3VR6 A;  1S4M A;  2X6W A;  5DUK A;  1XTA A;  3HYI A;  2IGM A;  4FAS D;  4ACB A;  1FIP A;  1VQ8 I;  3ZPN A;  3PNV A;  5DS9 A;  4DBR A;  4B48 A;  4FWT A;  4MTD A;  4NB5 A;  2XV4 S;  4U0Y A;  4A3M J;  1ZGW A;  3Q9V A;  3W5H A;  4URR A;  1BR4 A;  2V7F A;  4AID A;  5HLG A;  2QZ8 A;  3CCS B;  1UMK A;  2VKD A;  5F04 A;  1T38 A;  2CUE A;  2E1M C;  2A05 A;  4MEY F;  2VN2 A;  4M9Z A;  5F4M A;  4BJ6 C;  2EFP A;  3BR1 A;  3MKY B;  2VOP A;  4YDT A;  2VYQ A;  1QJV A;  4L8J A;  2BY1 A;  2X6X A;  3G1M A;  2K3F A;  4KUM A;  5J8C A;  1FOW A;  3CMA I;  1TSP A;  3H9G A;  2XAF A;  4DNC A;  2TDX A;  2DW4 A;  2Y69 H;  4MFD A;  2LKP A;  4OZY A;  5AIQ A;  4RMN A;  3QP5 A;  2DI3 A;  4DBQ A;  4BXF A;  2Z1D A;  5B66 C;  5AMV A;  4AYB N;  4M6Y A;  3B90 A;  2K9M A;  2C2W A;  4BGD A;  3ZXS A;  1TWG J;  4QSH A;  5LEK A;  5FLX Z;  1SFO J;  3DPU A;  3OL3 A;  1T56 A;  2W4S A;  3ERM A;  1YO5 C;  1R23 A;  1EF4 A;  4OPS A;  2DOE A;  4B3X A;  1WP6 A;  3BQY A;  1W2B B;  2L7Z A;  3TDU C;  3GME A;  1FBQ A;  3FBI B;  5K7Z A;  2IVM A;  3F6O A;  4V19 K;  2HCJ B;  2E7X A;  3A01 A;  3W6V A;  2MH9 A;  1JXS A;  3CJT B;  1KU3 A;  3HAG A;  4R8H A;  3V7R A;  2HKX A;  4RLQ A;  1HKQ A;  4RLF A;  3PO2 J;  2PFB A;  2DMT A;  4U0V A;  1CF7 B;  3H94 A;  1K73 D;  2WB1 A;  1Z1D A;  2DOG A;  1YI2 I;  4YEI A;  3FF5 A;  2B7C A;  3OYF A;  2QXZ A;  2PMZ A;  4W8R A;  2LZJ A;  3WTX C;  5FFZ A;  3KPH A;  2I5U A;  3M8J A;  3EUH C;  4FXU A;  2LY9 A;  5E3O A;  1YOV B;  3JRC A;  2DA3 A;  3LWF A;  3Q39 A;  1ODD A;  3A0H C;  1HQC A;  2X0L A;  4MHG A;  1UD2 A;  3CES A;  2FXA A;  4MIM A;  5TIS C;  1H42 A;  5ICE A;  4KYW A;  2K9S A;  3OEH A;  1J7K A;  3BNW A;  2WY8 Q;  3VYU B;  2UVF A;  3ZQF A;  2VQG A;  3IHU A;  3OL4 A;  4AC0 A;  3OE7 A;  2A69 F;  1PJ5 A;  4OJP A;  3LQE A;  3QP6 A;  4X7F A;  3AL0 C;  2V1X A;  1KA8 A;  4A93 J;  1BW6 A;  4CCK A;  1VJS A;  5J1R A;  2IJL A;  4IHW A;  4A6D A;  1B6A A;  3K0L A;  3CD6 I;  2J8I A;  3QYB A;  4YFN F;  4HZF A;  3H5N A;  3HPG A;  1F20 A;  1WJF A;  3LL7 A;  2CV2 A;  2CH0 A;  1BX1 A;  2K4B A;  4I01 A;  1BMF A;  4EJO A;  3CMM A;  3SJZ A;  4E4H A;  4GYG A;  2FOW A;  2Z3Y A;  1FP1 D;  1D0Y A;  1W5S A;  4BJ5 C;  2DY1 A;  3MAJ A;  3ZMV A;  1PJR A;  2GOM A;  3SDG A;  5CKT A;  2VXZ A;  1SFK A;  2QKL B;  5B1A H;  1NJI D;  3F22 A;  3QU6 A;  2WBM A;  4PJ0 C;  1B72 B;  4JBA A;  4EJV A;  2BW3 A;  5LGU A;  3IL2 A;  1JRG A;  1GVH A;  2W84 A;  4K1X A;  4ASN A;  1XCV A;  4IRG A;  2W7N A;  3OSG A;  2RVC A;  1T95 A;  1DQU A;  2ID6 A;  3OYK A;  4M3F A;  4E7K A;  2KRH A;  4HNU A;  2CW7 A;  1TWC J;  4D9J A;  4BQQ A;  2ZBU A;  1B9M A;  2VBU A;  3ROU A;  1OR7 C;  2VE8 A;  3G71 I;  4A3I J;  2R7X A;  4E7L A;  3ZIA A;  4FIS A;  4Z4S A;  5ERI A;  1N77 A;  5IOZ A;  2FJ1 A;  4UVC A;  2X6O A;  4ZH4 F;  1SD4 A;  5FLX K;  4BAY A;  3OEE A;  3CCR I;  3BDD A;  4GO1 A;  3RKW A;  1TYU A;  1YG2 A;  2KZV A;  4D0P A;  4A3L J;  3PSI A;  4BPR A;  4UB8 C;  2V79 A;  4BQA A;  2R7U A;  1YHQ I;  2XOK A;  1VQO B;  5JLW A;  1MDM B;  4XLP F;  5EYR A;  2Q6K A;  2PIA A;  4P3I A;  1YIO A;  2GZW A;  4WXD A;  1WJC A;  4G7X A;  5HDG A;  1MMA A;  3VYR B;  1NB0 A;  3MKZ A;  4CHU A;  4FCY A;  5L3E A;  2FRH A;  4DK1 A;  1VQK I;  3GIR A;  1P92 A;  3OZW A;  4DYC A;  1CGP A;  4OPW A;  1DGW Y;  1YX2 A;  1KMH A;  2BN4 A;  1FT9 A;  3BCA A;  3K1N A;  4CCL A;  4BY1 J;  2X0K A;  5EEH A;  1HBX G;  4PFO A;  1G59 A;  2VBT A;  4H4K C;  2COM A;  1NBM A;  3CCU B;  4LK0 F;  1NTC A;  1B2R A;  3FIS A;  2V9K A;  2HQR A;  3FHN A;  4L9T A;  5LHG A;  1AHD P;  4M74 A;  2F43 A;  3R61 A;  3U21 A;  4RPD A;  3J81 k;  5L3F A;  1YS6 A;  5EEG A;  1UFM A;  4PUS A;  2X1D A;  5K5R A;  3WHC A;  1W0U A;  5J6X A;  1K4S A;  1EKE A;  3RKQ A;  2HU9 A;  3A35 A;  1MNE A;  3ZR8 X;  4DK0 A;  3QSY A;  1DAB A;  2WB1 N;  3BPV A;  3IH3 A;  3FM3 A;  3ZQL A;  4RA2 A;  2E5Z A;  2K02 A;  1Q1H A;  3RZD J;  1X3U A;  3GFL A;  3HPH A;  1Y1W J;  4PCQ A;  1TT0 A;  4PC3 A;  2AS5 F;  4L0Y B;  3E1S A;  1KJZ A;  1WSU A;  2DEU A;  3OS1 A;  2DOD A;  2BHZ A;  5B1B H;  4E7H A;  3CCV I;  2B63 J;  2W6I A;  2BOL A;  3MZ8 A;  1UAA A;  1D2E A;  3ABK H;  1QA1 A;  3SEQ A;  1ITY A;  4L9N A;  2DOA A;  2F4O B;  1V5V A;  1W9X A;  2HDN B;  4M9S A;  1HCR A;  5DYM A;  3IRR A;  1USS A;  1W7P B;  3ZMT A;  2LSO A;  5HS9 A;  4Y17 A;  2K40 A;  2O5R A;  3I55 I;  3PA2 A;  4DQL A;  9ANT A;  1T0F C;  3CPX A;  3CME I;  4I84 A;  4YC5 A;  4PJN A;  2EV5 A;  2P7C B;  1POG A;  2EWN A;  2VAS A;  3ISP A;  2E1N A;  1FIA A;  2Q0O A;  1IDK A;  3AG1 H;  4OAY A;  2VQH A;  4HX4 A;  2X3H A;  1I1G A;  1G3W A;  4HLY A;  4KFC A;  4M3D A;  3SYT A;  5JVT A;  2CQK A;  4QIW N;  2AXT C;  4WX9 A;  3B6C A;  2FE3 A;  3CUQ B;  5D5V B;  2R5Y B;  4BQN A;  2BBY A;  2ZFU A;  1ETW A;  4X7C A;  2ISY A;  2V7T A;  1O8D A;  1Y6I A;  1H9G A;  2VE9 A;  2FUG 2;  3BWG A;  3CCS I;  5F0C A;  1HSJ A;  1ZG1 A;  1QA6 A;  3OYN A;  4JMQ A;  3TO7 A;  2LYC A;  3W2H A;  4EJW A;  3LSR A;  5TRD A;  3C18 A;  2FF4 A;  1Y0Y A;  1ETQ A;  3DCF A;  1BI1 A;  3FMR A;  1W0K A;  3IKT A;  3TGN A;  3HDD A;  3HM5 A;  3G1L A;  4DQ2 A;  1E1R A;  1FX0 A;  2XTX A;  3GTG J;  3IUO A;  3AGP A;  1A8P A;  1ZRD A;  1X2N A;  1XD7 A;  3K4M A;  3VPR A;  4EM2 A;  2X9D A;  5IP9 J;  2DMU A;  2LF8 A;  1B8I B;  4MFE A;  1PE9 A;  3I9V 2;  2CC2 A;  5GV8 A;  3FXQ A;  3AAF A;  3S2H J;  4NC6 A;  3W2G A;  3WBK A;  5E8G A;  3CW2 A;  2O0Y A;  2XVC A;  2R7W A;  1IW7 F;  2X8K A;  2HPM A;  5HOD A;  4OJ5 A;  4II2 A;  1FTT A;  3D5S C;  3K1P A;  2O6G E;  4ESJ A;  1R6R A;  1I39 A;  1YW7 A;  2Z2S B;  4GCV A;  2B0R A;  3P9K A;  4ZTJ A;  2L4M A;  4XSZ F;  1HW2 A;  2I8D A;  3K4B A;  1MBG A;  2R7R A;  1PKV A;  4F91 B;  1IN8 A;  2DT5 A;  3K4L A;  2M2E A;  3Q9S A;  2F5F A;  4R1H A;  5M5W J;  4N3N A;  2QLZ A;  3GQB A;  3B4N A;  1JB9 A;  3H3U A;  4ESF A;  2J5O A;  2HNH A;  3TW6 A;  5E8I A;  1U78 A;  1FSH A;  1SKY B;  3AG3 H;  1YLO A;  2XNJ A;  4TT3 A;  3BTC A;  2VFM A;  2A6H F;  3CF2 A;  3CCJ B;  1PYV A;  4AVZ A;  4D5F A;  3LAP A;  1F4K A;  2TCT A;  3HKZ N;  3JX8 A;  1A6I A;  2Y0S N;  4RCZ A;  3FPP A;  1WFX A;  1CQX A;  5LHH A;  3ZP5 A;  1CF7 A;  2YWE A;  4D7N A;  3GZN B;  3ECO A;  3AG4 H;  4OPO A;  1KGS A;  5HS8 A;  4G7H F;  1P6R A;  4EH1 A;  1H9T A;  4MO7 A;  2IA1 A;  1D1A A;  3KEY A;  4G8X A;  2GAU A;  1VLO A;  1W34 A;  5K7F A;  4HA8 A;  5A2Q Z;  4UB6 C;  1T39 A;  3CO7 C;  1K78 A;  3BG3 A;  1O7F A;  3PVD A;  2WZP P;  4ANJ A;  1SVL A;  4HST A;  3BJ6 A;  1GVJ A;  5E3L A;  4RCY A;  4XON A;  3CCQ I;  3TBI A;  3SY2 A;  5J1U A;  2BM6 A;  2LRE A;  3TP3 A;  3IV5 A;  5TR9 A;  5BSX A;  3BJO A;  3CCE I;  2CW0 F;  4HNV A;  3HRS A;  4Z4U A;  1GO2 A;  3H09 A;  1WWX A;  2MC3 A;  1LDK B;  4LIT A;  3ZN1 A;  4LBZ A;  2DJN A;  4A6E A;  4CZC A;  3RSN A;  4I6Z A;  2Y75 A;  3JRE A;  3FKJ A;  4PC2 A;  3LST A;  2DN0 A;  1AKH B;  1HOM A;  5JBQ A;  5KAI C;  3ASS A;  3BZK A;  3S1R J;  1BLI A;  5IYP A;  4DYR A;  5DD4 A;  3LSI A;  1QH0 A;  4MXN A;  1UST A;  4N0B A;  2EFQ A;  3HGG A;  3TOA A;  2PI0 A;  3DV8 A;  5FRM A;  4Y7C A;  3FWE A;  2L01 A;  3QOP A;  1R1V A;  1O8G A;  2HKO A;  1R4N B;  3S16 J;  1F43 A;  1B72 A;  2P6S A;  2PEX A;  4NBQ A;  1GAQ A;  1LFU P;  3ECH A;  5ICF A;  1P2F A;  2BGJ A;  3LFK A;  3AG2 H;  1MBJ A;  1LPQ A;  1WZ2 A;  1VLY A;  1HW1 A;  4PFP A;  3JTG A;  1FYM A;  2CFO A;  3F8N A;  4UUT A;  1VQO I;  3HOS A;  1XDS A;  3C3W A;  3FMQ A;  3JRI A;  2Q6L A;  1P4A A;  1ZAO A;  5JHU A;  2YWG A;  5AN9 A;  1O8H A;  2R7D A;  1WJE A;  5J3L A;  4HBL A;  5C1C A;  4TKO B;  3A02 A;  1IA5 A;  2RAE A;  1ETK A;  4ESB A;  2LP0 A;  2R0Q C;  5LEJ A;  3RPU D;  2VFO A;  1JT6 A;  2Y0M A;  4HEA 2;  1RPW A;  1QHG A;  1VQ8 B;  3F3X A;  1QX4 A;  5CQE A;  1XE1 A;  2C4T A;  3NEU A;  1OLT A;  4RDU A;  1MSF C;  5DTD A;  4X6A J;  3QU3 A;  1UJ8 A;  1H80 A;  3VWB A;  4RGX A;  3HGY A;  1QFZ A;  4QPQ A;  3B8H A;  4RB3 C;  3CCU I;  3D5L A;  2VBS A;  3QE2 A;  1BI0 A;  3LMM A;  1YIJ I;  1U5T B;  1JJ2 B;  3BCB A;  2ZNZ A;  3PSS A;  1EV7 A;  4XQF A;  3HOU J;  3ZSC A;  1GXP A;  1IXR C;  2Z99 A;  1UD5 A;  3W2E A;  5GTH C;  1Z7L A;  4A5N A;  2CGP A;  4C9Y A;  5IYC J;  3A8J A;  5B6I A;  1OFD A;  4NK8 A;  3PUN A;  4LG0 A;  1IC8 A;  1E64 A;  4IL6 C;  4UVA A;  1KTW A;  3OOC A;  1DUX C;  2D2W A;  3COA C;  1ZEL A;  2PJR B;  3PA1 A;  2H1K A;  2IGK A;  2GJP A;  2KIM A;  5A2Q K;  2F5C A;  5THX A;  5BSY A;  1Q81 D;  1FEX A;  2CU7 A;  2DTZ A;  1E63 A;  1KRH A;  2XF5 A;  4PGO A;  2D3N A;  4IKF A;  2NS8 A;  2O61 A;  3CCY A;  2C5B A;  2Q2E B;  4M3B A;  3BG6 A;  3LA7 A;  1EJ9 A;  2Y2Z A;  2JT1 A;  2VKE A;  4F52 A;  1ZG5 A;  1IRZ A;  4YHB A;  3OYG A;  5TJJ A;  4M0L A;  2WAQ N;  1OGJ A;  3WGG A;  1N06 A;  3HSF A;  3G2B A;  1QVF B;  1JJ6 C;  3FIW A;  1GUU A;  5LLQ A;  2QBY B;  2EIJ H;  3GTK J;  2CQQ A;  3PEN A;  1OCO H;  2R7S A;  3L09 A;  2AXL A;  3H0D A;  1I3Q J;  1UHM A;  4YEL A;  4BL0 B;  1BIA A;  3HUG B;  1SMY F;  4P2N A;  3U6K A;  4IW3 B;  1BL0 A;  1OGI A;  4P1W A;  3LJY A;  2E60 A;  2KP6 A;  3SQV A;  1YI2 B;  4XK4 A;  3I4M J;  3K7A J;  1U2W A;  1DPR A;  1W7P A;  4E7Z A;  3CMY A;  3SZE A;  3K2A A;  2A07 F;  4YRV A;  2OJE D;  4OOS A;  1SD7 A;  1MND A;  5E6T A;  3ZUG A;  4S05 A;  2KVO A;  2ICW G;  3I5U A;  4KKU A;  2MD5 A;  4MTE A;  3ZPL A;  3ZQQ A;  3K70 D;  3D1N I;  3PJR A;  1J0R A;  1IDZ A;  1QZZ A;  1FBU A;  2JPC A;  2ZJQ F;  5LGT A;  4TMZ A;  3GLL A;  1ZAR A;  1Y0R A;  3I3L A;  2E1B A;  3BH4 A;  1TQM A;  1MMS A;  3GVJ A;  2NTB A;  5EZH A;  3GO5 A;  2JZY A;  3JU4 A;  2R5Y A;  5K5Q A;  1RZ4 A;  4Y9U A;  2Q1Z B;  3GQA A;  2ZCW A;  1ZTR A;  1D8J A;  2VBV A;  3LA2 A;  3V76 A;  4CYD A;  1VZ0 A;  4S0H B;  1WQ2 A;  3GF2 A;  3MMY B;  5IYR A;  2OZU A;  1EH8 A;  2LMD A;  2HXO A;  4BQO A;  2K7L A;  3OYC A;  2OPT A;  1Y0N A;  3WXM A;  3LA3 A;  4PJJ A;  3OZU A;  3T8T A;  5CVI A;  4OIN F;  4J01 A;  5GTI C;  4X1E A;  1WJD A;  2IS1 A;  2M0M A;  4QWQ A;  2ZJP F;  2HQA A;  2CYY A;  2L5Q A;  5J40 A;  4EW9 A;  2M4K A;  1S6L A;  3AFH A;  2GQF A;  1E1Q A;  1RQP A;  1B8I A;  1XMX A;  2DJI A;  4H0E A;  4CSW A;  2H1L A;  4IRI A;  3JQQ A;  1S8N A;  1I5Z A;  3I4P A;  2GXB A;  3SJP A;  1E62 A;  1LB2 A;  3ES9 A;  3R0J A;  4PJL A;  3OS0 A;  4CO8 A;  3AGQ A;  1VF9 A;  4D5C A;  4E7S A;  3BG5 A;  5DN6 A;  1AMO A;  4GGG A;  2GJK A;  3VYS B;  2GRE A;  5ICC A;  3G71 B;  4I0B A;  3WOD F;  4PZJ A;  5D4R A;  4LOC A;  2BY3 A;  5DM6 F;  2ZXI A;  3G1O A;  1VQ5 I;  4MQV A;  4AYB A;  4WQM A;  1XGS A;  2DO7 A;  3M1E A;  4BUP A;  2D74 A;  4KJZ A;  3ZQI A;  3JCU C;  5LBQ A;  2WY7 Q;  4PC6 A;  1IV6 A;  1X3W B;  1Y1V J;  3VDX A;  2HZD A;  4ZDL A;  4EGY A;  2BVN A;  3ZZT A;  4Q5S F;  2PLY A;  2DK8 A;  2M30 A;  1D0Z A;  2QCO A;  4QTR A;  1JKR C;  1YHQ B;  2F4I A;  4FE4 A;  3KX2 A;  2H8R A;  2M9H A;  1Z0X A;  3T5X A;  1R49 A;  2WSS A;  2F3L A;  3MD2 A;  1S5L C;  4UXN A;  3VEP A;  5JMC B;  3RDI A;  3OYM A;  3WTY C;  3D26 A;  1DAR A;  1S7A A;  2KJC A;  2XAS A;  3MCA A;  2VNJ A;  2NPF A;  3PET A;  2ZTG A;  3LSM A;  2BF4 A;  3WND A;  1ZR4 A;  2BMW A;  4EVI A;  1GV2 A;  1VQK B;  4P9F A;  1Y8Q B;  2IPQ X;  5F1J A;  1DBO A;  2BM1 A;  2L02 A;  5FO0 A;  4RGU A;  2X1E A;  5LMZ A;  1D0X A;  3QFR A;  2DT6 A;  1OYW A;  3LNQ A;  1R5O A;  2JQ7 A;  5H2F C;  2PE3 A;  1B9N A;  2FNA A;  4LGW A;  3VMW A;  1FJL A;  1FBS A;  2VBY A;  3WU2 C;  1EE6 A;  5D8K B;  3I0T A;  1KQ9 A;  1QZY A;  5L3C A;  3W2I A;  3LFU A;  2HWV A;  1G4D A;  2QE7 A;  1P7J A;  1UD4 A;  2XRL A;  4N4N B;  4ETS A;  1ORK A;  2BPO A;  4LB5 A;  5FL7 A;  5C4X J;  4XOP A;  5DCM B;  2LRD A;  3PNT A;  4HW0 A;  2FD5 A;  5CVV A;  4BHC A;  5HVQ C;  2VBK A;  2WTE A;  3SFI A;  4HG2 A;  3QRF F;  4OZZ A;  2DTR A;  4L18 B;  4RGR A;  2L9V A;  3AL0 B;  3B78 A;  4QVJ A;  4J19 A;  3FXJ A;  3FXO A;  4HSR A;  1AOY A;  2A61 A;  2DA2 A;  3E6D A;  1K8A D;  3FXR A;  1BX0 A;  3OOU A;  2V1N A;  3HRT A;  3ONQ A;  1W5C C;  1FX7 A;  5K5O A;  2J5P A;  4RJL A;  1RUO A;  2VKV A;  1VHE A;  3S3M A;  2GA1 A;  4M6V A;  5EGO A;  3FJO A;  3I55 B;  1JUP A;  1R00 A;  2P5L C;  3V8K A;  3ASQ A;  3P4G A;  3OIO A;  2XND A;  2Y9Z A;  1JGG A;  1Z77 A;  4CYC A;  3CF5 F;  1FOY A;  1SAU A;  2JA5 J;  2O9L A;  4UUV A;  3F9K A;  4ZV4 A;  4YAW A;  4FTH A;  3X2Q H;  1Z91 A;  1R71 A;  2GOX B;  4IXA A;  1KYZ A;  4LIU A;  4OU0 A;  3TW7 A;  3I56 B;  3OYJ A;  2XZO A;  4I7H A;  4YFX F;  4OIP F;  3HOZ J;  1YJN I;  5KAF C;  1GHC A;  3DFG A;  1EP2 B;  3KP2 A;  2ZZQ A;  2JMW A;  4Z6Y A;  4YAF A;  2AO9 A;  4V2F A;  3U6B A;  1LLW A;  2XF6 A;  2XEX A;  4XLN F;  1T08 B;  2HVS A;  4KIS A;  1X3Z B;  1QU3 A;  4KKS A;  2EWE A;  4DZP A;  2PYG A;  2N8G A;  3IP4 B;  1P4M A;  3WU1 B;  4Q47 A;  4P3Y A;  4IF4 A;  1ZYR F;  3OSF A;  3ONU A;  1RKT A;  1X1B A;  4YCQ A;  2HYG D;  5HLH A;  4YIF A;  2VFP A;  1BA5 A;  3FK6 A;  2LTP A;  1OJL A;  5F0F A;  5JI6 A;  1L1I A;  3FXL A;  1G7T A;  2JK3 A;  3G4S I;  5HLT A;  1WH7 A;  2O03 A;  5LD2 C;  3Q6R A;  1BIB A;  4G1B A;  3JRB A;  2QSF X;  4G6T B;  5H6R A;  3FXU A;  1LKX A;  5BNG A;  3FXK A;  2E1R A;  4LBY A;  5FKM A;  1YJW B;  5LHI A;  3P26 A;  1G3S A;  4XN0 A;  1XSX A;  5FKK A;  4PGH A;  2BHY A;  3W6J B;  2NV4 A;  3A8K A;  2JDI A;  2PMH A;  4YAL A;  1KQ8 A;  1WKM A;  1HW5 A;  3DTK A;  3K4N A;  4NUB A;  2ZKZ A;  3E6M A;  1OHH A;  2QTL A;  2XTW A;  1L0O C;  3BG7 A;  1KCC A;  3QPL A;  2DA5 A;  1BR2 A;  4PC1 A;  1DDG A;  3I58 A;  1X1C A;  5DCF A;  3JAM K;  2NOJ B;  3HIF A;  3N97 A;  3ONY A;  1G6N A;  4AVP A;  3I59 A;  1BHE A;  3QAH A;  1OB5 A;  1A31 A;  3RZO J;  2Q6I A;  2PJR A;  1MMG A;  3IH4 A;  4JYK A;  1OYY A;  3ZMZ A;  1T2K A;  2ZO4 A;  3WE3 A;  3A4C A;  3HJE A;  4CQJ A;  2M1B A;  4BDZ A;  2VXD A;  5J1Y A;  5TV2 A;  4LLL A;  4L9J A;  4YZQ A;  1DDN A;  1MBK A;  1YX3 A;  1I50 J;  3HG9 A;  5DUI A;  1LE8 B;  5CVU A;  4UHT A;  1AIP A;  1D8K A;  3VOD A;  2X85 A;  3I4N J;  1VF7 A;  4BE1 A;  4M72 A;  2UXX A;  3CCL B;  2O04 A;  4XNF A;  3SYJ A;  3VSV A;  2E71 A;  4V2G A;  4X7D A;  1WMR A;  1OPC A;  3FX3 A;  3ZQC A;  2R93 J;  2QA4 B;  2VON A;  5J4Y A;  3E6C C;  4WCG A;  2QY1 A;  3CC4 B;  1IXC A;  2XRO A;  3Q38 A;  3HUG A;  2XAQ A;  1XMA A;  2CUJ A;  1FZP B;  1TTY A;  3WTV C;  2H6B A;  2CK3 A;  4A0Z A;  3UNG C;  2F2E A;  2OQG A;  5D5X B;  2CUZ A;  4JQF A;  2KJB A;  2MGQ A;  2K9L A;  1KON A;  1RKW A;  1KZH A;  3BQJ A;  3LSK A;  1V4R A;  5IT3 A;  2DPU A;  2EZI A;  2P81 A;  3S32 A;  3W2F A;  2OBS A;  4KA4 A;  2VUM J;  2HYF A;  4KH3 A;  1HZE A;  2VBE A;  3KYC B;  1QNT A;  2WJY A;  4EGZ A;  4G94 A;  5F64 A;  3ZCO A;  2ZL7 A;  1OMI A;  3CCQ B;  4RD6 A;  4U7B A;  1SD5 A;  2GJR A;  1UG0 A;  2C5H A;  2B0L A;  2MD0 A;  3K70 C;  1Z9C A;  3M1C A;  3CCE B;  2W7Z A;  2ISZ A;  1O4X A;  1O8E A;  3GFM A;  2RC6 A;  2RV8 A;  2IS2 A;  3REO A;  3GQ7 A;  4AWX B;  1WOS A;  3VO1 A;  4MGR A;  4FN5 A;  3GLX A;  2W24 A;  1IXS B;  3FXM A;  4NQW B;  1Z3X A;  3PQK A;  1BM9 A;  1LNW A;  3PM1 A;  3JRG A;  5GPA A;  1H8E A;  1ENH A;  5BOX A;  1QRC A;  5EDN A;  3KRG A;  3KL9 A;  2VJ5 A;  2XKO A;  1I3A A;  1N05 A;  1W5T A;  3MVP A;  3I64 A;  1BPL A;  1R9T J;  4KIG A;  3KZI C;  5D6F A;  1COW A;  5HXB A;  2LKX A;  1HF2 A;  1WVR A;  2WZN A;  1V5G A;  2O6W A;  2JJ1 A;  2HLD A;  2EJR A;  3IAM 2;  2HVQ A;  1TBX A;  3WU0 A;  2R7Q A;  2HOE A;  1BI2 A;  4M3E A;  4IJA A;  2H27 A;  4BEH B;  4BXX J;  4Z4R A;  2QVO A;  3S1Q J;  1W0J A;  2VOO A;  1UG2 A;  4RAY A;  5C44 J;  3A8I A;  2IT0 A;  5BQT A;  4HRI A;  3K9T A;  1BI3 A;  1TWA J;  1SM4 A;  2K9Q A;  2UWM A;  1IDJ A;  3BR6 A;  4G12 A;  3F6V A;  4WK8 F;  3HB9 A;  3HBL A;  2LY2 A;  1N25 A;  5FKO A;  3QOD A;  4UV9 A;  3ASR A;  4RD4 A;  1MAB A;  1HLV A;  1ULY A;  2JUC A;  2V1D A;  2XAU A;  4GFB A;  1WTH D;  1XG2 A;  2NST A;  3J7A Y;  3S1N J;  1QQI A;  1W1W E;  2MW8 A;  3M07 A;  2DXI A;  3OKX A;  1YIJ B;  1HC8 A;  1ETX A;  2INU A;  5ILU A;  1S7O A;  2Y30 A;  1FY7 A;  2QDX A;  3HKZ A;  3Q3A A;  4UUS A;  2Y0S A;  2W00 A;  1XG1 A;  1CZF A;  5HS7 A;  2YWH A;  3E0J B;  1RC9 A;  2HDD A;  4CIC A;  1TP4 A;  1G3Y A;  2ZTN A;  3SFZ A;  4RD0 A;  1EZG A;  3H5R A;  4TV7 A;  4YZ0 A;  2NVT J;  3DU1 X;  1QO0 D;  2HZT A;  2KPM A;  3W2A A;  4LB6 B;  2Z8G A;  1YLF A;  4KKT A;  3G6E B;  1V0E A;  4YZA A;  3DPL C;  4ZYH A;  1I6H J;  5HOO A;  1JHF A;  3OYE A;  2JIZ A;  1QVT A;  3OW7 A;  1BC7 C;  2DDA A;  4HF1 A;  3ZOB A;  1K8F A;  3LSJ A;  1ZM2 A;  2OD5 A;  4DNT B;  2M34 A;  2VBZ A;  3CC7 B;  3NAR A;  2IS4 A;  2XPV A;  4C2M J;  3SZT A;  5EEA A;  1ZM9 A;  1QGY A;  2A6T A;  2CS3 A;  5TY0 A;  1R1T A;  1QVG B;  3L2C A;  2ZL5 A;  3DKY A;  4PJM A;  2IGO A;  1WJA A;  4OOI A;  2D5V A;  2QM3 A;  1T8I A;  4U87 A;  3HOT A;  5AIP A;  1H89 C;  3GTO J;  5DCM A;  1WI9 A;  3BR2 A;  2QEX I;  3I56 I;  3OMY A;  2O0V A;  4LD5 A;  2E36 A;  1FMW A;  4H9G A;  2QWW A;  3S2W A;  3SXY A;  2ZL6 A;  1PLU A;  2VB6 A;  1QRB A;  4BKX A;  1O3Q A;  1J9I A;  3KE2 A;  1F9N A;  2X3U A;  3BZ6 A;  1ERD A;  1GR1 A;  2HGC A;  3JRF A;  4RD3 A;  5BS6 A;  2KFD A;  3TP0 A;  4A3D J;  1FPQ A;  3CDL A;  5F08 A;  1HST A;  3EQO A;  2G9W A;  1VQ6 B;  3SDB A;  3GBG A;  1NHA A;  2QYO A;  3H0G J;  2LVS A;  2V9V A;  4XKC A;  2GPJ A;  1XSD A;  3DEU A;  4A0X A;  3UR3 C;  2PG4 A;  1U3E M;  1MNM C;  1G8X A;  4MYU A;  1EFR A;  2CV1 A;  1PUE E;  1GLN A;  3E5Q A;  3V8L A;  1DP3 A;  1B1B A;  2K3P A;  1YJW I;  3O3K A;  3RYR A;  3S1M J;  1H8H A;  1KTV A;  3QPH A;  1G7C A;  2EZH A;  2P6T A;  1VQ4 B;  4RDK A;  1ZM4 A;  4TMV A;  2IA0 A;  2W82 A;  3A3G A;  3BP8 A;  3EQL F;  3JRA A;  1V54 H;  2YU9 J;  2O7O A;  4W8Q A;  1J5Y A;  4G5G A;  2JN6 A;  1OR7 A;  2L9N A;  4Z1M A;  3GTQ J;  1MMD A;  2OBP A;  2RKH A;  2L3D A;  1Q86 D;  2PBI A;  4OOX A;  1KCD A;  4ZDP A;  3KLO A;  4OIR F;  4QFM A;  3J80 Z;  3KEQ A;  4N4O B;  1A36 A;  2ME6 A;  2BV6 A;  3H35 A;  2GXG A;  4RM2 A;  5ICG A;  3ZZ0 A;  3OYH A;  3L2U A;  2XB0 X;  3CP2 A;  1OIS A;  2C78 A;  3WY9 A;  1OFL A;  3C1D A;  3ULQ B;  4ON0 A;  2BE5 F;  1LDD A;  4ABZ A;  4A3J J;  1O8L A;  2DFE A;  4DZJ A;  4TN1 A;  2DAO A;  4KNY A;  3E97 A;  3CRZ A;  5HDK A;  1WH5 A;  3HRM A;  3QFC A;  3CP8 A;  2PQ8 A;  5FD5 A;  3V7A A;  2QKM B;  2STT A;  5B5E C;  2O8K A;  4RAZ A;  1FLI A;  1EFU A;  2OCE A;  2UV1 A;  2KHM A;  2GIV A;  1YW9 A;  3P27 A;  5F0H A;  1VQN I;  2M7B A;  4KIF A;  4XID A;  4HQE A;  4A3C J;  1DPU A;  3CCL I;  4XOT A;  2OA4 A;  2W1O A;  3CXC B;  1OFE A;  2GBY A;  1DGR M;  4M73 A;  2B9S A;  3JQR A;  3HSE A;  2CW5 A;  2VBX A;  3OV8 A;  2QA4 I;  1VQ5 B;  1V5E A;  4C3H J;  5GPC A;  2XF7 A;  1OOC A;  4GQN A;  3MQ0 A;  3CC4 I;  1ZH5 A;  2VIX A;  3SHF A;  2YR2 A;  5IOY A;  4ZDO A;  2XC7 A;  1IRG A;  2H8W A;  4HDU A;  1BW5 A;  1U0J A;  2ZBV A;  4UVB A;  3ZBT A;  4NHJ A;  4ACA A;  5K7H A;  2AQE A;  2ESH A;  1LE8 A;  4OMY A;  2QX3 A;  3BPX A;  3V8J A;  2WAQ A;  2WWY A;  4ENN A;  4C3I J;  1IN6 A;  3TOB A;  2PN6 A;  4AC9 A;  2XGX A;  2ME0 A;  2VT2 A;  3H36 A;  2QYU A;  1N75 A;  4XLA A;  2OCC H;  1IUY A;  2YWF A;  1LDJ A;  4B3A A;  1O8J A;  2IA2 A;  5CYV A;  1BN8 A;  4B4C A;  4BJT A;  4IHY A;  5J47 A;  4NCN A;  4YAO A;  4G6D A;  3DBR B;  3EUA A;  4AF7 A;  3S93 A;  5L3B A;  2F4M B;  4RBO A;  4IO9 F;  1R5N A;  3GTL J;  2JJ2 A;  1ZGA A;  3PSF A;  1JJ8 C;  1BBY A;  1X4P A;  1UEL B;  2HTJ A;  2EBI A;  3C2H A;  3TL4 X;  1R58 A;  3N6Z A;  4LG3 A;  1JI8 A;  1F1Z A;  3AST A;  1I18 A;  3RY8 A;  1X1A A;  1IF1 A;  1DU0 A;  2XRN A;  1IJF A;  5E17 F;  3CJQ B;  1EFC A;  3PUM A;  1SFX A;  2VBW A;  2CG4 A;  3Q6Q A;  4YII A;  4IEJ A;  4XMY A;  4B4D A;  5HKK A;  4AD9 A;  3U2R A;  4OMZ A;  3QWL A;  3SEJ A;  2P5K A;  1W87 A;  1RWR A;  5M5X J;  1TQI A;  1PP8 F;  2X53 S;  3FHZ A;  3FPK A;  4HDV A;  2FMY A;  2M3A A;  1T6X A;  4J00 A;  2XSD C;  4OP7 A;  3KP6 A;  1B59 A;  1XB4 A;  2QF7 A;  4IHT A;  2Y48 A;  1NK3 P;  3JUR A;  4B1R A;  1IAW A;  3A2K A;  3OW2 B;  3A03 A;  2VFN A;  3RQI A;  4L0Z B;  4ENK A;  1D1N A;  2ESN A;  2EK5 A;  2M8G X;  1KD1 D;  3IWZ A;  4XRS G;  1FTZ A;  1JTY A;  2MSY A;  4X07 A;  4XD7 A;  1TLH B;  1FDR A;  3ABU A;  2VI6 A;  3HXL A;  3M9A A;  1HDP A;  3L9F A;  4NQW A;  5JFR A;  1FNN A;  2DMP A;  1U9O A;  5BPD A;  4A3K J;  2XAJ A;  2XPU A;  3U9G A;  3A3B A;  4NK6 A;  1RR8 C;  3CUO A;  1JUS A;  4IOA F;  1ELO A;  2Q6O A;  4G1V A;  1J75 A;  1BN5 A;  1TL8 A;  1TUI A;  1VQ7 B;  4E7I A;  4U4B A;  3K4J A;  3NWS A;  3HL2 A;  4R79 A;  1YFH A;  1IN4 A;  3KEO A;  1MIJ A;  1H85 A;  2V7X A;  3KP5 A;  1BC8 C;  1IV8 A;  2FX0 A;  2HQ5 A;  1K7A A;  1MMN A;  1YJN B;  1T6Y A;  1XPX A;  2VC0 A;  1W4M A;  2GIZ A;  3IKV A;  3MFK A;  2C4U A;  1KQ5 A;  2E35 A;  4BDY A;  1O8K A;  1VHO A;  2GLO A;  2JSC A;  3P9I A;  2ZME C;  2CND A;  2I10 A;  4IRH A;  4BEH A;  3QFS A;  3RYP A;  4P96 A;  1MDM A;  3OIQ A;  4UZF A;  5J35 A;  3W2V A;  1PVE A;  4BU2 A;  2B7E A;  5CLS A;  2LC2 A;  3BR5 A;  4BH9 A;  2KKO A;  3ML6 A;  1Q82 D;  1AIR A;  2XB5 A;  3KP7 A;  2AHO A;  1BJK A;  2FU4 A;  3G4S B;  5FFX A;  5M3M J;  4HQM A;  2HVR A;  1JA1 A;  4TMW A;  2ZZF A;  5E18 F;  1FNC A;  3G6E I;  2KRF A;  2AHQ A;  5H5J A;  2KLO A;  3HRU A;  2VQC A;  1HKS A;  1PDN C;  2JTV A;  2XNC A;  4AIH A;  1OYI A;  3FMS A;  3HHH A;  4DQK A;  1MH3 A;  1KC8 D;  2JSP A;  4L5E A;  1EH7 A;  1FOX A;  3PUF A;  1O8I A;  3DU5 A;  1IRX A;  3PFI A;  5D4S A;  2XDV A;  4CUG A;  3CC7 I;  4B09 A;  3RCO A;  4UNO A;  5FA6 A;  1AWC A;  3S15 J;  1K6Y A;  2GXA A;  4L9V A;  1T5E A;  3HC7 A;  2EIX A;  3I1F A;  2G7U A;  1UHS A;  1V5F A;  4RS8 A;  1T98 A;  2NT9 A;  3ISX A;  1HG8 A;  1ZUN B;  4N9I A;  2B7B A;  2JPB A;  3DP7 A;  1OKR A;  1J2X A;  2FX3 A;  4WWC A;  4ZZL A;  1TYW A;  3CTA A;  1S9H A;  1O3S A;  2NNN A;  4BAC A;  2NS0 A;  2BYV E;  4ZCM A;  2HOT A;  2HOA A;  2EZL A;  1OFM A;  3LSP A;  4ITV A;  3BTI A;  3WHB A;  2OYN A;  1HA3 A;  3DBH B;  3T8R A;  2XT4 A;  1GVD A;  1WGX A;  3B6A A;  1JKO C;  1EH6 A;  1ZKG A;  2LY1 A;  1G3T A;  5KHD A;  2MH2 A;  3CO6 C;  1VQ6 I;  2IGN A;  3O8H A;  2P3M A;  5IYN A;  2ZB9 A;  4XLC A;  5L3G A;  3GFJ A;  1NK2 P;  5IYD J;  1JTA A;  2M5S A;  1NB9 A;  4IVN A;  3VO2 A;  1JNY A;  2RC5 A;  4QVA A;  4WXC A;  2ZBK A;  2DFI A;  3Q5F A;  1XC5 A;  3HOV J;  1JA0 A;  3CUQ A;  1LM1 A;  4WZT A;  4HV6 A;  1LVA A;  1MJA A;  2XZP A;  1ZHF A;  5HZA A;  3HSR A;  3JSO A;  2EPF A;  2M4G A;  2NTP A;  3FZV A;  1VQ4 I;  1CNE A;  2Y9Y A;  2JRM A;  3S3N A;  3V7C A;  3BTL A;  2INV A;  2PLF A;  4U7D A;  4LK1 F;  1J59 A;  4WZE A;  4RLZ A;  4A5M A;  5FLV A;  1E2X A;  1VQ9 B;  5AON A;  3AVW A;  3GQ8 A;  2VPL A;  3KP3 A;  3DXJ F;  5A89 A;  1GQ8 A;  2KIS A;  4RB2 C;  1EWY A;  2O0W A;  4B43 A;  3U1D A;  4HE6 A;  1J09 A;  4U9U A;  4Z06 A;  1E3Z A;  2KQR A;  1V55 H;  3BC9 A;  1PJ6 A;  3F0C A;  2FQ4 A;  3MKL A;  2UXN A;  3F23 A;  5DV5 A;  2BW3 B;  1O88 A;  1W35 A;  2M5W A;  1G7S A;  2RNG A;  2OV7 A;  4OAZ A;  2BXZ A;  3VNU A;  5A88 A;  3BY6 A;  4BBS J;  4QUZ A;  5LRR A;  2RNJ A;  4PK4 A;  3LSG A;  1S72 I;  2JA7 J;  2E34 A;  2VJI A;  3BOQ A;  5DS0 A;  3ML3 A;  1QQ1 A;  2E1M B;  3JRH A;  2DFF A;  3HOY J;  3A1Y A;  3GWZ A;  3HOW J;  2LLK A;  4KIC A;  4IOC F;  1UD8 A;  4M2L A;  1K4Z A;  4Y33 A;  4A3G J;  1A6Q A;  2DCE A;  3NAU A;  2VNI A;  3R6J A;  3WTS C;  2EZK A;  1WJ5 A;  3WG7 H;  1MBH A;  4DOZ A;  5ILV A;  3WTW C;  1JGS A;  2C6Y A;  1EXM A;  4C2L A;  3CLO A;  3QYE A;  2XHK A;  1WOO A;  1IJE A;  1FYL A;  4UZU A;  4EEF G;  2NVU B;  3SEZ A;  3BR3 A;  4GDF A;  1O8F A;  1GV5 A;  1ZRF A;  3BC8 A;  3SLN A;  2ODL A;  3H5A A;  1JTX A;  5FO5 A;  1WXR A;  3OS2 A;  3BQZ A;  1O3R A;  4ZYD A;  5DNS A;  3MHP A;  2R4G A;  3DQV C;  4DNR B;  4A3F J;  4IQ4 A;  4RDL A;  1T6S A;  1YRN B;  3WQZ A;  2CO5 A;  2FVG A;  1T6Z A;  3ZN0 A;  4F7Z A;  3BJA A;  2BZT A;  1Z6T A;  4A0Y A;  4RM0 A;  2TRT A;  1HDD C;  2FSW A;  1H0M A;  1E79 A;  4MNU A;  2DA1 A;  1OCC H;  4ZYA A;  4IX7 A;  4PAB A;  4ZGN B;  1TW3 A;  4M53 A;  1HVX A;  3GRH A;  4BNC A;  5E3N A;  4UY8 I;  4I76 A;  4RM3 A;  2D3L A;  1MKM A;  5GAE J;  3E7L A;  2PEC A;  2IAI A;  5B3S H;  4PMH A;  4I2O A;  1IB0 A;  4P55 A;  3TDZ C;  3LMW A;  1ZG3 A;  1QUE A;  2G0E A;  4XLH A;  1LJ9 A;  1FMV A;  1S7E A;  4A2U A;  1R22 A;  5E79 C;  1FP2 A;  1QBJ A;  4PGG A;  1WPC A;  2JVH A;  3KZY A;  2WAD A;  2RGV A;  4LJZ F;  5D5U B;  2OTL B;  3U1K A;  4Z4T A;  3I53 A;  2KDZ A;  2CQN A;  2BY0 A;  2DA6 A;  2LG4 A;  1R7J A;  2Z33 A;  4IHX A;  5C1E A;  4IHS A;  2NZM A;  2XUB A;  1CLW A;  4ENJ A;  3CDI A;  4I09 A;  3J7Z I;  4Z03 A;  5IYQ A;  4M3G A;  3EPZ A;  4Z4V A;  1X4O A;  4HX7 A;  5GP9 A;  3TO6 A;  2QMU A;  2UVE A;  1QZE A;  3JSP A;  2EQR A;  1Z3Y A;  4BXU A;  3ABM H;  4WF2 A;  2HDC A;  3PO3 J;  1D5V A;  4Z2Y A;  3QQA A;  3TMO A;  4M9X A;  2J8K A;  2IBD A;  3CJN A;  1KQ0 A;  3CLQ A;  3W6K B;  1AKH A;  2E2J J;  4A3B J;  4Q4Z F;  3OAA A;  1VQP B;  2LKS A;  3NE5 B;  3LNN A;  2YSR A;  4I99 C;  2JRT A;  1VQ7 I;  2CSO A;  2IW5 A;  1ZM3 A;  4MLO A;  2QEX B;  2R7Z J;  4YFO A;  2ECB A;  4LFU A;  4RB0 A;  4YG2 F;  2D1V A;  3K10 A;  3N4M A;  2WV1 A;  5M3F J;  2V6C A;  4XRS A;  4RB1 A;  3ZQG A;  1DG1 G;  2NTQ A;  1SAN A;  1MJ9 A;  4NDL A;  1K6O A;  2KRC A;  2E1O A;  3WTT C;  2PJP A;  4L5I A;  2WYR A;  2M45 A;  2K4J A;  2WC2 A;  4M6X A;  2DYS H;  3F8C A;  3OFN A;  2W48 A;  1REP C;  1FOK A;  3PL8 A;  2ZJ2 A;  1SFU A;  3EYI A;  3IWF A;  1EFT A;  2L54 A;  1WU8 A;  4OOV A;  2GWR A;  1VQL I;  5ILS A;  5IP7 J;  4Y13 A;  2QZA A;  4P6Y A;  3GZ5 A;  2HDW A;  4D7M A;  2XSJ C;  1W36 C;  1ZLJ A;  1RR7 A;  2XPW A;  5K1Y A;  5KSW B;  2QQ8 A;  4XIC A;  3VMF A;  1IB4 A;  2ELH A;  2JA2 A;  3NWT A;  1Y39 A;  5IYW A;  2OF7 A;  5J8F A;  5HDN A;  3GTJ J;  2BM7 A;  4W97 A;  4P25 A;  1MD0 A;  3J7A O;  5E20 A;  3LQ6 A;  1U5T A;  1UCR A;  3GVK A;  4U88 A;  4XKB A;  4FE7 A;  4XL9 A;  3F21 A;  3FKI J;  4UAJ A;  3T0Y A;  1FNB A;  2XAG A;  4PAA A;  1WDT A;  5M5Y J;  4X05 A;  2EIM H;  1FRQ A;  2JUG A;  4GXO A;  4P5O A;  2HYJ A;  1ZRC A;  2MAB A;  4KT6 A;  4LBW A;  1TT5 B;  2QUF A;  3T56 B;  1U8B A;  4Y52 J;  5KW9 A;  2CUF A;  2W85 A;  5IP6 A;  1OCZ H;  2OU2 A;  3GX4 X;  4Q7J B;  2XGC A;  5GV7 A;  1KQS B;  3H9Q A;  2HPI A;  1X19 A;  2R92 J;  2BX6 A;  4XLF A;  4AUX A;  2GM4 A;  1OFC X;  3ABL H;  1IUF A;  3MMP A;  1E3P A;  2F5V A;  3W5V A;  1FYK A;  2R7F A;  4Q48 A;  2HS5 A;  2B5O A;  5KVR A;  3E3V A;  1FC3 A;  2WR8 A;  3GQ9 A;  2Z6B D;  1W0T A;  2NXN B;  3VSL A;  4CGZ A;  4WZL A;  1D5Y A;  2BM4 A;  2KIF A;  2COB A;  4G7O F;  2Q2E A;  2DYI A;  1U6G A;  3GTP J;  1IG7 A;  1ZN2 A;  1X1D A;  4QPO A;  3CCM I;  1XS9 A;  3OP1 A;  1VQN B;  1B23 P;  4MR0 A;  4RGS A;  4JRA C;  3PUB A;  1ZK8 A;  4KDP A;  3ZPP A;  3F8B A;  3OR1 C;  4B47 A;  2MLG A;  2OC6 A;  2OK7 A;  1ETY A;  3C2G A;  2R7O A;  1UD6 A;  2QBY A;  1SMT A;  4LLN A;  4BBR J;  2CFX A;  3K6G A;  1WCM J;  4RD1 A;  2F5E A;  2NOG A;  3OR2 C;  2K86 A;  4CZZ A;  2PMD A;  4PC7 A;  4QV2 A;  4ZCI A;  2VC1 A;  3PSZ A;  1D3Y A;  4L5J A;  2V9P A;  4R71 A;  2V7Q A;  5C3E J;  1OQY A;  5LRS A;  2R9V A;  1GT0 C;  1W7P D;  3NB2 A;  2XT2 A;  1A5J A;  1R5H A;  1BJZ A;  1JKQ C;  1XFO A;  2BV3 A;  2EV6 A;  3Q3S A;  2NVX J;  2F1M A;  4DW6 A;  3S17 J;  1AA7 A;  2WA0 A;  1VQ9 I;  4LMY A;  2M8E A;  4U0W A;  1K78 B;  2E1C A;  1CNF A;  2LDU A;  1EP1 B;  3QFT A;  3O6B B;  1NH3 A;  2X6Y A;  5JHF A;  1QHH D;  2NS7 A;  1KZL A;  3JRD A;  3V42 A;  4A12 A;  3BTJ A;  1JE8 A;  3H1C A;  1NHC A;  3HHG A;  2X48 A;  3KCC A;  2FBK A;  4JX4 A;  1RES A;  4M1K A;  1QPM A;  3VFZ A;  5E1W A;  1OGM X;  3B73 A;  3A0B C;  4XKV A;  1WJB A;  1SAX A;  3DBL B;  3K4C A;  5CQG A;  3ASN H;  3JR9 A;  1XDU A;  2FA5 A;  2NRA C;  3WTZ A;  4C2T A;  2XZL A;  3L2W A;  4YIR X;  2LFB A;  4Z05 A;  1ON1 A;  2VL8 A;  4NBS A;  3H3V K;  2DYR H;  1KK3 A;  3M4O J;  3WGI A;  3E1Y E;  1TWF J;  3GYH X;  2WV0 A;  4GRI A;  4PSX A;  1EA0 A;  4AU7 A;  2QGU A;  5KCM A;  1XQB A;  3LOC A;  3ZBU A;  3E6B A;  2OZ6 A;  1ZQ3 P;  3DU6 A;  3EUK L;  5FB2 A;  4EJT A;  1RU4 A;  1GXQ A;  4P9U A;  5BPI A;  3BH6 B;  3EQN A;  4G6Q A;  5DM7 F;  2X4H A;  1QFY A;  2VNK A;  4ROX A;  3MZY A;  2NVY J;  3R6S A;  3OYD A;  5KK1 A;  4DYQ A;  1S29 A;  3E20 A;  1IZ1 A;  2ZXW H;  1P4X A;  3NQO A;  3WNC A;  4DJA A;  2DK5 A;  2KL4 A;  3BH7 B;  3EET A;  3DKX A;  3GFI A;  1SVM A;  4MYT A;  2LBF B;  4CXF A;  5L3D A;  4FQG A;  1BOB A;  3S14 J;  2BEO A;  3FBN B;  5EG0 B;  4EV0 A;  5GAD J;  1TW2 A;  4Y7N J;  3SZG A;  5CJ9 A;  2DPD A;  2VLA A;  1XCB A;  4F7D A;  4OJO A;  3JW4 A;  4FX0 A;  5FKL A;  3RJP A;  2QQA A;  1L3L A;  4X7E A;  1YJ9 B;  1KU9 A;  1MRZ A;  1N08 A;  1K83 J;  2ZZE A;  3RPU A;  3OPO A;  1LUJ B;  1QG0 A;  3WE2 A;  1STZ A;  1KK1 A;  1JT0 A;  3KZZ A;  2ZIT A;  1WI3 A;  3AVU A;  3AK5 A;  3C7J A;  3DKW A;  5CVR A;  3VSK A;  1FNM A;  2BSA A;  2F6C A;  2E19 A;  5DEQ A;  1XX5 A;  1OB0 A;  1U8R A;  2XIG A;  3SUC A;  2O1D A;  2DT7 B;  1IRF A;  1YX5 A;  2ECC A;  2Q8K A;  3PIO F;  1K61 A;  1YRN A;  1BQE A;  2L7K A;  2OTL I;  2V4D A;  2ADU A;  2R7T A;  4P22 A;  5FKN A;  2E2I J;  2WAF A;  5FJ8 J;  1SC7 A;  4E0F A;  2XTY A;  4KIT B;  4LG0 B;  2OAZ A;  2VOD A;  1XGO A;  2VBM A;  1LVK A;  2EA4 A;  1JKP C;  5H20 A;  3Q0V A;  3CZ6 A;  2L7M P;  2CQX A;  2YS9 A;  1R1U A;  1MBF A;  2F1L A;  4K2E A;  3W2W A;  3GCM A;  4AM3 A;  4OIQ F;  3K4K A;  4ASU A;  1DDI A;  2RC4 A;  4CCJ A;  4E7J A;  4OPV A;  3AVY A;  3AVT A;  2FBI A;  3RTR A;  3EUH A;  2IEK A;  1Z67 A;  3MKW B;  2DFH A;  3A1P A;  4W1U A;  4Z4W A;  2P5V A;  1VQP I;  2JN9 A;  2QGG A;  2KZG A;  1Y0U A;  1YW8 A;  3KET A;  5FIU A;  1JUM A;  4Y9R A;  1LLZ A;  2PMZ N;  4JK1 X;  3DEE A;  4QHY A;  1M90 D;  1MSE C;  3GVA A;  1GJR A;  1QFJ A;  4ZC3 A;  3E5X A;  1ETO A;  5ED4 A;  3CPW B;  2BVL A;  1I8D A;  3PIP F;  1YIT B;  3R0A A;  6PAX A;  4BYY A;  3PFY A;  3TED A;  1ACI A;  2JJ7 A;  2BM0 A;  1LEB A;  3R6K A;  1PXZ A;  4EM1 A;  3VSU A;  1UB9 A;  2ID3 A;  3HEF A;  2A5W A;  4FHT A;  2ACJ A;  3WBJ A;  1M1K D;  1LFB A;  2EFN A;  2XGE A;  4O5V A;  5FD6 A;  1NDH A;  2D9R A;  3VYT B;  3MCZ A;  4UV8 A;  3V7S A;  2Z5U A;  4S04 A;  3IC7 A;  3BCF A;  2FNP A;  2DMQ A;  3I54 A;  3ASO H;  3BG9 A;  3GW2 A;  1IGN A;  4IHV A;  1K28 D;  3IRQ A;  1G2H A;  2VJJ A;  1T33 A;  4RD2 A;  1K4T A;  4PSW A;  3I71 A;  4HE5 A;  4II3 A;  3LO8 A;  2MFZ A;  1XGN A;  1M1E B;  5HLI A;  2QTZ A;  2IOU G;  3GUD A;  2HQN A;  3UW0 A;  4V02 C;  2A6E F;  1TNT A;  4LIV A;  1I6X A;  2K85 A;  3ESW B;  3TO9 A;  4XKW A;  4HF2 A;  3E5U A;  1I27 A;  2ZNY A;  3Q0U A;  3T53 B;  2L0K A;  1YYV A;  5FGM A;  3CQZ J;  2KDO A;  3OYB A;  1N0U A;  1MBE A;  1D8T A;  1RUN A;  2NT6 A;  2ZXH A;  3NRV A;  2GQQ A;  2QN6 A;  1EA3 A;  4P1V A;  3ZMU A;  1QA3 A;  2H09 A;  4EAT A;  2K9N A;  3QPT A;  5DD8 A;  5F1R A;  1HKT A;  5F4O A;  1V0F A;  1IN7 A;  2STW A;  1VBL A;  2VNH A;  1TQP A;  3F8F A;  2L2O A;  3HTU A;  2MC4 A;  4XRF A;  2DLL A;  5TGT A;  4EMS A;  2RDP A;  4FK8 A;  1P7I A;  3U2Q A;  1RET A;  1TZL A;  1K79 A;  3W5U A;  3VST A;  3HOX J;  3LYC A;  2QSG X;  2DA7 A;  1R5B A;  2A5Y B;  4B3F X;  3MN2 A;  3WWG A;  4XSX F;  4Y3O A;  1Y56 A;  2P7V B;  3WG9 A;  1P4W A;  2ZME B;  3S3O A;  2KIU A;  1V3F A;  4Y15 A;  1RIO H;  5IPA A;  2Z9O A;  4P6V F;  4Z4Z A;  3FDY A;  2HOS A;  2V4J C;  1S72 B;  3MZH A;  4YZX A;  4XN3 A;  5CPR B;  4BE2 A;  4XBF A;  4HNT A;  3CC2 B;  1FSE A;  2ZFW A;  3T51 B;  3GEZ A;  2A68 F;  3C2B A;  2QEN A;  4BE0 A;  1VQM B;  1E3X A;  3AKZ A;  2P8T A;  3J7Y J;  4AF6 A;  3BY1 A;  2LD5 A;  4TMX A;  3DLL F;  4ZYE A;  3P5J A;  1DBG A;  2ZSI B;  2QQ9 A;  3TH0 A;  2DOF A;  4KT5 C;  1RNL A;  1PUF B;  1GDT A;  3CB4 A;  4TSF A;  1Q1V A;  1JHH A;  1O57 A;  1CQT A;  5JVG F;  1FWZ A;  4C30 A;  2DET A;  1SFE A;  3SJM A;  2OQR A;  2R5Z B;  4UZE A;  2ZSH B;  1YE9 A;  5JR3 A;  1VFC A;  4J0Q A;  5DDG A;  2ZC2 A;  4OWR B;  1ZR2 A;  1E43 A;  4RAG A;  1IO2 A;  3LVB A;  4YAU A;  3KYD B;  3QOE A;  1WSV A;  4JX5 A;  2F4N A;  2YU3 A;  1Q7Y D;  2V26 A;  1H8A C;  3H9N A;  3KEW A;  3BLY A;  1S0U A;  2V7V A;  1U9N A;  2EB7 A;  1O8M A;  1BOA A;  4N9H A;  4XOR A;  3BZC A;  2V7W A;  4ZJZ A;  3GXO A;  3BRO A;  4KIB A;  2HEO A;  4RPB A;  3QYF A;  1QCX A;  4C3J J;  3TQN A;  2DU9 A;  4HAM A;  5JLX A;  2RQQ A;  2VFQ A;  2RN7 A;  4HF0 A;  2EV0 A;  3J81 Z;  3V4G A;  5HNH A;  2X1C A;  4HX8 A;  3PQJ A;  2IXS A;  1DU6 A;  1GAW A;  3DTE A;  1I1S A;  2WPD A;  5KNL A;  3ZRG A;  1Z05 A;  3AVV A;  3WYA A;  1Z7U A;  1SEU A;  1T0F A;  4KN7 X;  2PX9 A;  3OY9 A;  4G9Y A;  3L1P A;  1Y8R B;  5L46 A;  2DER A;  1LQ1 A;  2M87 A;  4BS9 A;  2W57 A;  3ELK A;  1YS7 A;  1HF0 A;  3CJR B;  4Y4R A;  2UZK A;  3M7G A;  3K1M A;  3VOE A;  2ZXJ A;  1IJW C;  1APL C;  4GYI A;  4FX4 A;  4M4S A;  4U49 A;  1WSR A;  3QPS A;  5EF6 A;  3ZC3 A;  5IYB J;  1QGP A;  2DQR A;  5FRO A;  1WOP A;  4C0S A;  3KLN A;  2W25 A;  1OCT C;  3OWT A;  2OTJ B;  2LH9 A;  3CUQ C;  5HZB A;  4CCN A;  4OM9 A;  4B3G A;  4PDK A;  1IN5 A;  1TYV A;  1N8R D;  3VMV A;  3ZQ7 A;  5EGO B;  5IT9 Z;  2HFH A;  3J80 K;  3EYY A;  5J4V A;  2XKP A;  5H6Q A;  4KMU X;  5A8A A;  2BXY A;  2EH3 A;  2CW8 A;  2IP2 A;  2EA2 A;  3H3Z A;  1W36 D;  4JOM A;  4CYC B;  4IPA A;  2R3S A;  4ZTF A;  1Q9S A;  1QVU A;  1TVC A;  2Z16 A;  3BCD A;  1QGZ A;  2QSH X;  3P7N A;  2ELK A;  2LOO A;  1YJ9 I;  3OOP A;  4E6K G;  1YTY A;  3KFW X;  2ZJR F;  5F27 A;  2BGC A;  2YUS A;  3S2D J;  1MZB A;  1E3O C;  4YEJ A;  2LBF A;  3RIQ A;  4HWV A;  2OBR A;  4X06 A;  3M8F A;  1NG6 A;  1FND A;  5EG0 A;  1DP7 P;  1F5T A;  1X0C A;  2IQ7 A;  3DWL E;  2L9S A;  4X8I A;  2O17 A;  2XC1 A;  1ZLK A;  2W6J A;  3ZQH A;  1VQL B;  3FM5 A;  1PJ7 A;  1Z6R A;  3RIR A;  3RKX A;  4NC7 A;  2EIK H;  2LK2 A;  1RI7 A;  3GTM J;  1F60 A;  2WJV A;  3OJX A;  2NSP A;  5EJC A;  2DCU A;  3DF8 A;  4YXW A;  2HR3 A;  3O2P E;  2P4W A;  4ZZD A;  5FLM J;  3OZV A;  1WRJ A;  3VB2 A;  4BHP A;  1B4A A;  4F92 B;  2EFW A;  3OYI A;  4F55 A;  2L7F P;  2FML A;  3DEW A;  2MBF A;  1KK0 A;  3DPT A;  1KK2 A;  2EFO A;  2OUM A;  3ZGK A;  5F4J A;  3N90 A;  1XSV A;  2HTS A;  1VI0 A;  2XAH A;  4WWV A;  2F48 A;  2HI3 A;  2NAZ A;  3RI4 A;  1QRY A;  3TKY A;  4BY7 J;  1NRK A;  1G7R A;  3GSI A;  2CMP A;  3K69 A;  3WTU C;  3G3Z A;  3L2R A;  1VTN C;  4M71 A;  1WOR A;  1IHM A;  1BR1 A;  1SVO A;  1TC3 C;  1E0E A;  3J81 K;  3IAS 2;  3CMA B;  2VJ4 A;  3I59 B;  2V5I A;  2D45 A;  3A01 B;  3T1B A;  4JP0 A;  4CA0 A;  2K5C A;  2KIQ A;  3WGH A;  3G05 A;  3GVL A;  3SQN A;  2FOK A;  1YIT I;  1IDY A;  2YPR A;  4HLX A;  5F6F A;  3GZ6 A;  1MJB A;  1TNS A;  2BSP A;  4B8X A;  4BHB A;  2LNB A;  4HYE A;  3T9G A;  2DDB A;  4W8T A;  5D8L B;  3IH2 A;  1XMK A;  3LSH A;  1C0W A;  3D5R C;  1D1B A;  4KN4 X;  4G7W A;  3MWM A;  3CCM B;  4ZYG A;  4OJL A;  4E70 A;  4HIZ A;  1X58 A;  3K2Z A;  2E7W A;  3LQR A;  5H59 A;  4Z4Y A;  4HPQ A;  2CF4 A;  4EJU A;  2P0W A;  1R36 A;  1UHW A;  2Y31 A;  5IY5 H;  1X1P A;  1WPK A;  4FT8 A;  4G7Z F;  3OYA A;  4DGW B;  3R60 A;  3G73 A;  2L4A A;  5DSZ A;  2DMN A;  2CBX A;  2F5D A;  2XGD A;  5EZG A;  3EDP A;  4DIQ A;  3Q0W A;  5IT9 K;  2FBH A;  3F8M A;  4OIO F;  2H94 A;  4RAF A;  2WAE A;  4P12 A;  3HTS B;  3SKB A;  2VZL A;  1ZGJ A;  4I02 A;  5J3O A;  5EMN A;  1NG7 A;  2LR8 A;  2IRF G;  2BM5 A;  2ELJ A;  2FQ3 A;  3JTH A;  3FKS A;  3LQQ A;  3SZP A;  1WHU A;  2JWT A;  1UD3 A;  2MYS A;  1E17 A;  1Z21 A;  2G0Y A;  2M0C A;  1F36 A;  1X2M A;  5GAG J;  4QLC U;  1E3H A;  5BMZ A;  2V7U A;  4AIJ A;  2MLK A;  4P9S A;  2O8X A;  4CCO A;  4YFK F;  2NYX A;  2DBB A;  4XRM A;  2V1U A;  1SD6 A;  1EP3 B;  1R4M B;  3UKG A;  2RRE A;  2H6C A;  2CQ7 A;  2V6E A;  4N3G A;  5IK2 A;  5CDF A;  1UMQ A;  4MQ9 F;  2FEZ A;  4X0G A;  4XM3 A;  4F3Q A;  3CD6 B;  1TWH J;  1MW7 A;  4WXH A;  4ZCL A;  1XN7 A;  2A3S A;  3KIO A;  1H88 C;  3NAW A;  2IS6 A;  4XR6 A;  3W3C A;  2EFG A;  3CC2 I;  1BJA A;  2O3F A;  1ETV A;  3KP4 A;  2KMU A;  2JA8 J;  1VQM I;  1RRJ A;  1N07 A;  1MGT A;  3ZZU A;  2HMA A;  2KT0 A;  5C4J J;  4A3E J;  1D1C A;  4LC0 A;  2UUZ A;  1OB2 A;  1O7L A;  3H9J A;  3N05 A;  4B44 A;  2BY2 A;  2M7A A;  2OK8 A;  2BVM A;  4CDG A;  3M8E A;  2BGI A;  4RDJ A;  5E1X A;  2YX7 A;  5E1Z B;  4EQQ A;  2ZZG A;  5D6E A;  2ZME A;  3D0S A;  3B02 A;  1UZC A;  4O6J A;  4P26 A;  2PMU A;  4X0C A;  2YX4 A;  5HNF A;  5CVJ A;  2AQF A;  3FK7 A;  4KMF A;  1YQA A;  2JVG A;  3L2V A;  1U5T C;  1K5C A;  4TMT A;  4C43 A;  4A69 C;  4HOB A;  2JA6 J;  1LFP A;  2CWE A;  3OIP A;  4MEX F;  4LBV A;  1XB2 A;  2CRG A;  1FRN A;  3HZJ A; 
#chains in the Genus database with same CATH homology
 1HA8 A;  3WWG A;  1ERD A;  1O8H A;  2GK6 A;  1WJE A;  2V7Q A;  5C1C A;  1IA5 A;  4TKO B;  2R9V A;  3EQO A;  4C2U A;  3RPU D;  3SDB A;  3GBG A;  4HEA 2;  2F1M A;  3DTI A;  1QHG A;  1P9Q C;  1AA7 A;  3DDY A;  4XKC A;  5CQE A;  4F93 B;  2WA0 A;  1OLT A;  1H80 A;  5LFA A;  2V31 A;  3VWB A;  3UR3 C;  1G8X A;  4QPQ A;  1EFR A;  2CV1 A;  3D5L A;  4CCM A;  1GLN A;  3LMM A;  4XLE A;  3OYL A;  2X6Y A;  4IQJ A;  1DP3 A;  2K3P A;  5JHF A;  1QHH D;  1H8H A;  1KZL A;  3V42 A;  3BCB A;  1NHC A;  4XQF A;  2DIE A;  2W82 A;  3A3G A;  3ZSC A;  3L2Q A;  2X51 A;  1UD5 A;  1OGM X;  4W8Q A;  1Z7L A;  4NC8 A;  4C9Y A;  4CH7 A;  4XKV A;  1WJB A;  2PYH A;  4C2T A;  3K4C A;  5CQG A;  4NK8 A;  2L9N A;  2XZL A;  4Z1M A;  3PNY A;  3L2W A;  1MMD A;  1KTW A;  1RMG A;  3FY3 A;  4Z05 A;  1KCD A;  3OOC A;  4ZDP A;  4W8S A;  2VL8 A;  1ZEL A;  2VQL A;  2PJR B;  2R7V A;  4N4O B;  2IGK A;  2GJP A;  3H35 A;  4GRI A;  4RM2 A;  4PSX A;  4AU7 A;  3OYH A;  5KCM A;  3CP2 A;  3L2U A;  2GK7 A;  1OFL A;  2XF5 A;  3DU6 A;  3EUK L;  1N78 A;  2D3N A;  1O8L A;  4IKF A;  1RU4 A;  3EQN A;  2Q2E B;  4FET A;  3BG6 A;  2XGJ A;  4NNJ A;  3OYD A;  3CP8 A;  3RQ4 A;  4F52 A;  2QKM B;  3OYG A;  2UV1 A;  4DJA A;  2KHM A;  2E5N A;  2KL4 A;  3G2B A;  2M7B A;  3DKX A;  4OJ6 A;  2LBF B;  3DLA A;  4XOT A;  2W1O A;  3B8Y A;  1BOB A;  2R7S A;  3FBN B;  1DGR M;  4D1Q A;  3H0D A;  1OGO X;  2CV0 A;  4YEL A;  4BL0 B;  3HUG B;  1V5E A;  2XF7 A;  4G6I A;  3SZG A;  2VKH A;  5FRN A;  4IZZ A;  3KYL A;  2VLA A;  4GQN A;  4P1W A;  1OOC A;  2E60 A;  2KP6 A;  2VIX A;  4OJO A;  4ZDO A;  3S8P A;  2XC7 A;  1U0J A;  4E7Z A;  4YRV A;  2AQE A;  1MND A;  2ZZE A;  2QX3 A;  3OPO A;  2WAQ A;  3VR6 A;  2KVO A;  2X6W A;  4KKU A;  2IGM A;  4FAS D;  1N75 A;  4XLA A;  3VSK A;  3ZQQ A;  3K70 D;  3ZPN A;  2F6C A;  3PJR A;  3PNV A;  1O8J A;  4DBR A;  4B48 A;  1BN8 A;  3I3L A;  1OB0 A;  2E1B A;  4BJT A;  3BH4 A;  4URR A;  3GVJ A;  2NTB A;  2O1D A;  2DT7 B;  1BR4 A;  1YX5 A;  2V7F A;  3SUC A;  3JU4 A;  3EUA A;  2VKD A;  2Q1Z B;  3GQA A;  3S93 A;  2L7K A;  2V4D A;  4P22 A;  2R7T A;  2E1M C;  1VZ0 A;  2JJ2 A;  3PSF A;  2WAF A;  4BJ6 C;  1X4P A;  3C2H A;  1UEL B;  3MMY B;  3MKY B;  3TL4 X;  4E0F A;  4KIT B;  1QJV A;  4L8J A;  2VBM A;  1LVK A;  2X6X A;  4LG3 A;  1JI8 A;  4BQO A;  3OYC A;  1I18 A;  3CZ6 A;  1X1A A;  4PJJ A;  4J01 A;  3CJQ B;  3H9G A;  3W2W A;  1WJD A;  3K4K A;  2IS1 A;  4ASU A;  2M0M A;  4XMY A;  5HKK A;  2HQA A;  4CCJ A;  4E7J A;  4OZY A;  2L5Q A;  4RMN A;  3RTR A;  4EW9 A;  2M4K A;  4DBQ A;  4BXF A;  2Z1D A;  3AFH A;  3MKW B;  1E1Q A;  1RWR A;  5AMV A;  2X53 S;  2DJI A;  4CSW A;  3B90 A;  2M3A A;  2K9M A;  4BGD A;  3ZXS A;  4J00 A;  3DPU A;  3OL3 A;  3DEE A;  3JUR A;  2W4S A;  3A2K A;  4B3X A;  4PJL A;  1WP6 A;  3OS0 A;  5DN6 A;  4E7S A;  3FBI B;  4ZC3 A;  2GJK A;  2BVL A;  3VYS B;  1I8D A;  4XD7 A;  3PFY A;  3HXL A;  1PXZ A;  3HAG A;  3VSU A;  2A5W A;  4RLQ A;  3A3B A;  4NK6 A;  4RLF A;  2ZXI A;  4AYB A;  3H94 A;  3VYT B;  2WB1 A;  4BUP A;  4E7I A;  4KJZ A;  4U4B A;  3K4J A;  3NWS A;  2WY7 Q;  4R79 A;  3OYF A;  3HL2 A;  2PMZ A;  3BCF A;  3VDX A;  2LZJ A;  2HZD A;  4W8R A;  4ZDL A;  1K28 D;  1MMN A;  3M8J A;  3EUH C;  4FXU A;  1D0Z A;  2VJJ A;  2F4I A;  3KX2 A;  4PSW A;  2WSS A;  1UD2 A;  3CES A;  3MD2 A;  4BDY A;  4II3 A;  1O8K A;  2MFZ A;  3OYM A;  4BEH A;  3OEH A;  3UW0 A;  3OIQ A;  2WY8 Q;  4LIV A;  3LSM A;  3VYU B;  3W2V A;  2ZTG A;  4BU2 A;  2UVF A;  2VQG A;  2LC2 A;  3OL4 A;  3OE7 A;  4OJP A;  4XKW A;  1AIR A;  1DBO A;  3AL0 C;  3T53 B;  4CCK A;  1VJS A;  2X1E A;  1D0X A;  2KDO A;  3OYB A;  2DT6 A;  2HVR A;  2NT6 A;  2ZXH A;  2ZZF A;  3QYB A;  1EA3 A;  3H5N A;  3HPG A;  1WJF A;  3LL7 A;  2CV2 A;  2CH0 A;  4EAT A;  1BMF A;  1V0F A;  3VMW A;  1VBL A;  2KLO A;  3CMM A;  2VQC A;  2L2O A;  1EE6 A;  2MC4 A;  5TGT A;  4E4H A;  1TZL A;  3LFU A;  4BJ5 C;  1D0Y A;  2JSP A;  3VST A;  4B3F X;  1O8I A;  2QE7 A;  1PJR A;  2GOM A;  3DU5 A;  1IRX A;  5CKT A;  4CUG A;  2VXZ A;  1SFK A;  2QKL B;  2XDV A;  4N4N B;  1Y56 A;  4Y3O A;  3RCO A;  1UD4 A;  2WBM A;  3S3O A;  5FL7 A;  1K6Y A;  1JRG A;  2BW3 A;  1T5E A;  4XOP A;  3HC7 A;  2LRD A;  3FDY A;  2V4J C;  3PNT A;  5HVQ C;  2VBK A;  1V5F A;  4OZZ A;  4HG2 A;  2NT9 A;  4YZX A;  4XN3 A;  5CPR B;  2W7N A;  4HNT A;  4BE2 A;  3T51 B;  1HG8 A;  1T95 A;  1DQU A;  3AL0 B;  3OYK A;  4HSR A;  4BE0 A;  1E3X A;  3AKZ A;  4E7K A;  3OOU A;  2KRH A;  4HNU A;  2V1N A;  3ONQ A;  2CW7 A;  4D9J A;  4BQQ A;  3S3M A;  1S9H A;  1OR7 C;  2R7X A;  4BAC A;  1DBG A;  4E7L A;  2ZSI B;  3ZIA A;  4TSF A;  1N77 A;  2XND A;  1OFM A;  4ITV A;  4C30 A;  1SAU A;  3F9K A;  2ZSH B;  1YE9 A;  2LY1 A;  2GOX B;  4LIU A;  5KHD A;  3OEE A;  2IGN A;  3OYJ A;  4OWR B;  1E43 A;  2XZO A;  2KZV A;  3PSI A;  4XLC A;  3QOE A;  1JTA A;  2ZZQ A;  2R7U A;  2V26 A;  2XOK A;  3KEW A;  2M5S A;  3BLY A;  1O8M A;  2XF6 A;  2HVS A;  4XOR A;  4KIS A;  4ZJZ A;  1QU3 A;  4KKS A;  1WJC A;  3QYF A;  4G7X A;  1QCX A;  2EWE A;  2PYG A;  3IP4 B;  1MMA A;  3VYR B;  2XZP A;  2RQQ A;  2M4G A;  1X1B A;  3MKZ A;  2NTP A;  4DK1 A;  3S3N A;  1DGW Y;  1KMH A;  5HNH A;  3BCA A;  2X1C A;  4CCL A;  2INV A;  5HLT A;  2IXS A;  5LD2 C;  3DTE A;  2WPD A;  4PFO A;  5KNL A;  1G59 A;  3ZRG A;  4H4K C;  4G6T B;  2VPL A;  3GQ8 A;  1NBM A;  1LKX A;  2F43 A;  2V9K A;  1GQ8 A;  3FHN A;  3OY9 A;  3U21 A;  2O0W A;  4PUS A;  2X1D A;  4XN0 A;  1J09 A;  4B43 A;  4BS9 A;  4Z06 A;  1E3Z A;  2KQR A;  2HU9 A;  3A35 A;  1MNE A;  3CJR B;  4Y4R A;  3ZR8 X;  3BC9 A;  4DK0 A;  2JDI A;  4U49 A;  2BW3 B;  3DTK A;  3K4N A;  4NUB A;  1O88 A;  1OHH A;  2E5Z A;  2RNG A;  3BG7 A;  2OV7 A;  5FRO A;  4OAZ A;  3HPH A;  1KCC A;  1TT0 A;  3OWT A;  2LH9 A;  4PK4 A;  3LSG A;  4CCN A;  1BR2 A;  2VJI A;  3E1S A;  3OS1 A;  4B3G A;  1X1C A;  4E7H A;  2NOJ B;  2E1M B;  3A1Y A;  2W6I A;  1BHE A;  1UD8 A;  2BOL A;  1UAA A;  4Y33 A;  3VMV A;  2DCE A;  3SEQ A;  2DOA A;  2PJR A;  1MMG A;  1W9X A;  1WJ5 A;  3A4C A;  4DOZ A;  4BDZ A;  1W36 D;  2CW8 A;  2VXD A;  4JOM A;  4ZTF A;  3BCD A;  2O5R A;  4YZQ A;  4C2L A;  2Z16 A;  1YX3 A;  1T0F C;  3HG9 A;  3QYE A;  4I84 A;  4PJN A;  2LOO A;  2VAS A;  4UZU A;  1VF7 A;  2X85 A;  3SEZ A;  1O8F A;  1IDK A;  3BC8 A;  4BE1 A;  4OAY A;  3VSV A;  4E6K G;  2O04 A;  2VQH A;  4XNF A;  2X3H A;  1WMR A;  2ODL A;  3H5A A;  4YEJ A;  3SYT A;  3OS2 A;  2LBF A;  4HWV A;  2R4G A;  3DQV C;  4DNR B;  2QY1 A;  4IQ4 A;  1NG6 A;  4BQN A;  3WQZ A;  2IQ7 A;  1X0C A;  2ZFU A;  3DWL E;  2CUJ A;  1O8D A;  2L9S A;  1Y6I A;  2O17 A;  2CK3 A;  2FUG 2;  3UNG C;  2W6J A;  1E79 A;  4ZYA A;  2CUZ A;  4JQF A;  4IX7 A;  2K9L A;  1KON A;  3OYN A;  3LSK A;  4JMQ A;  1HVX A;  3GRH A;  2LYC A;  4RM3 A;  4NC7 A;  3S32 A;  2D3L A;  2WJV A;  2PEC A;  2NSP A;  4YXW A;  4PMH A;  3LMW A;  1W0K A;  4XLH A;  1HZE A;  2VBE A;  1FMV A;  2WJY A;  4F92 B;  1E1R A;  1FX0 A;  3OYI A;  4F55 A;  3IUO A;  3ZCO A;  1WPC A;  3DPT A;  2JVH A;  2OUM A;  2WAD A;  3K4M A;  3ZGK A;  4U7B A;  2GJR A;  1UG0 A;  1PE9 A;  3I9V 2;  5C1E A;  2MD0 A;  2LG4 A;  3K70 C;  3M1C A;  2NZM A;  1NRK A;  2CMP A;  1O8E A;  3L2R A;  4Z03 A;  1BR1 A;  2R7W A;  2IS2 A;  3GQ7 A;  1E0E A;  3EPZ A;  2HPM A;  2X8K A;  1X4O A;  3IAS 2;  2VJ4 A;  4II2 A;  2UVE A;  4OJ5 A;  3D5S C;  1Z3Y A;  4CA0 A;  2K5C A;  4NQW B;  1Z3X A;  1R6R A;  3G05 A;  3GVL A;  2Z2S B;  3TMO A;  1H8E A;  4ZTJ A;  2QXZ A;  3OAA A;  3KRG A;  2BSP A;  2VJ5 A;  2I8D A;  3K4B A;  2R7R A;  1PKV A;  3NE5 B;  3T9G A;  4F91 B;  4W8T A;  3LNN A;  1BPL A;  3LSH A;  3D5R C;  1D1B A;  4G7W A;  3K4L A;  1COW A;  1V5G A;  4MLO A;  4OJL A;  4HIZ A;  2JJ1 A;  3GQB A;  3B4N A;  4HPQ A;  2HLD A;  3IAM 2;  2HVQ A;  3K10 A;  2P0W A;  2HNH A;  2NTQ A;  2R7Q A;  1SKY B;  3OYA A;  4BEH B;  4DGW B;  4TT3 A;  2KRC A;  1W0J A;  3CF2 A;  1PYV A;  4AVZ A;  4HRI A;  4DIQ A;  3OFN A;  3FPP A;  1WFX A;  2UWM A;  1IDJ A;  2WAE A;  3PL8 A;  1NG7 A;  2LY2 A;  2ELJ A;  3QOD A;  3FKS A;  1MAB A;  2HDW A;  1W36 C;  1D1A A;  2XSJ C;  3KEY A;  1UD3 A;  2XAU A;  2MYS A;  1WTH D;  1Z21 A;  1XG2 A;  2NST A;  3J7A Y;  1IB4 A;  2JA2 A;  3NWT A;  2DXI A;  2INU A;  4CCO A;  2WZP P;  3HKZ A;  2Y0S A;  2W00 A;  4ANJ A;  1CZF A;  4HST A;  3E0J B;  4XON A;  2ZTN A;  3TBI A;  2V6E A;  2RRE A;  5CDF A;  2LRE A;  5IK2 A;  3GVK A;  3H5R A;  4XKB A;  4XL9 A;  4X0G A;  4YZ0 A;  3W2A A;  4XM3 A;  2KPM A;  4F3Q A;  2Z8G A;  4KKT A;  4YZA A;  1MW7 A;  1V0E A;  3DPL C;  5HOO A;  2JUG A;  4P5O A;  2IS6 A;  2MAB A;  1LDK B;  4KT6 A;  4LIT A;  4XR6 A;  3W3C A;  3T56 B;  4CZC A;  3RSN A;  3OYE A;  3FKJ A;  2JIZ A;  3H9Q A;  2KMU A;  3OW7 A;  2HPI A;  1X19 A;  4XLF A;  1BLI A;  4DNT B;  3LSI A;  1D1C A;  2F5V A;  2IS4 A;  4MXN A;  2UUZ A;  5FRM A;  3H9J A;  2A6T A;  2CS3 A;  3N05 A;  2M7A A;  4B44 A;  2BVM A;  3VSL A;  2Z6B D;  3GQ9 A;  3DKY A;  4PJM A;  2IGO A;  1WJA A;  2ZZG A;  1O8G A;  1X1D A;  4QPO A;  4U87 A;  3HOT A;  4MR0 A;  3PUB A;  5HNF A;  2AQF A;  3ZPP A;  3OR1 C;  2JVG A;  4B47 A;  3L2V A;  3OMY A;  2O0V A;  2OC6 A;  1K5C A;  3C2G A;  2R7O A;  1UD6 A;  1FMW A;  1LFP A;  1PLU A;  3OIP A;  2VB6 A;  1VLY A;  4PFP A;  3K6G A;  2CFO A;  3OR2 C;  3HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...