3B90A

Crystal structure of the catalytic domain of pectate lyase peli from erwinia chrysanthemi
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
SECKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSGNCTIENVIWEDICEDAATNNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTIDSIAGVNRNYGDVATISGLKIKNYKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Endo-pectate lyase
publication title The Crystal Structure of Pectate Lyase PelI from Soft Rot Pathogen Erwinia chrysanthemi in Complex with Its Substrate
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3b90A00
4OZYA 4XOPA 4W8QA 2QXZA 4OZZA 4AVZA 2NTQA 4EW9A 4XONA 4Z06A 1RU4A 1JTAA 2IQ7A 2O0WA 3LMWA 3JURA 4NK8A 4YEJA 1O8GA 4YZQA 2O0VA 2UVEA 3VSVA 2NSTA 2BSPA 1VBLA 3GQ8A 3GQ7A 1PXZA 4PMHA 1IB4A 4OJPA 1KCCA 2INUA 4YZXA 4W8RA 2X6XA 4XLAA 4XMYA 1RMGA 2VBMA 1AIRA 1O8DA 2UVFA 1EE6A 1BHEA 2X6WA 1OOCA 1WMRA 4OJ5A 2VBKA 1H80A 2NSPA 3WWGA 4W8SA 1O8EA 2PYHA 2O17A 4MXNA 3GRHA 1O8JA 4XL9A 2QY1A 2X3HA 2NZMA 4OJ6A 1O8FA 4NK6A 4XOTA 2PECA 1DBGA 2NT9A 1OGMX 4W8TA 1BN8A 4I84A 3VMVA 1IDJA 2ODLA 1O8HA 4OJLA 4XLFA 3VSTA 5C1EA 4XLCA 3EQOA 2VBEA 4U49A 1QCXA 1O8KA 1QJVA 3VMWA 4YZ0A 1O8MA 1OGOX 3ZPPA 1XG2A 4XN0A 5C1CA 1IA5A 4Z03A 3GQAA 2O04A 4XR6A 1PE9A 3KRGA 2INVA 4XM3A 2O1DA 4OJOA 1GQ8A 1O88A 4HWVA 3UW0A 3VSUA 1OFLA 1OFMA 1X0CA 2NT6A 4URRA 3B8YA 4Z05A 2PYGA 1O8LA 1RWRA 4XORA 1DBOA 4XN3A 4XNFA 1O8IA 2X85A 3GQ9A 4XQFA 1CZFA 3EQNA 4XKWA 3ZSCA 4MR0A 4XLEA 1PLUA 1NHCA 5AMVA 2QX3A 1HG8A 1JRGA 2NTPA 4YZAA 3FY3A 1K5CA 1KCDA 4YELA 4XKVA 3B4NA 3SUCA 2VJJA 3B90A 2Z8GA 4XLHA 1IDKA 3T9GA 4U4BA 2EWEA 2VJIA 4C2LA 2X6YA 2NTBA 1KTWA
chains in the Genus database with same CATH superfamily
3SYJA 4OZYA 4XOPA 4W8QA 3SZEA 2VFOA 2QXZA 4OZZA 4AVZA 2NTQA 4EW9A 2VFQA 4XONA 2YUHA 4Z06A 1RU4A 3RIQA 1JTAA 2IQ7A 2O0WA 4YC5A 3LMWA 3JURA 3H09A 4NK8A 4YEJA 1O8GA 4YZQA 2O0VA 2UVEA 3VSVA 2NSTA 3NAWA 2BSPA 1VBLA 3GQ8A 3GQ7A 1PXZA 4PMHA 2O6WA 1IB4A 1K8FA 3ML3A 4OJPA 1KCCA 2INUA 4YZXA 2QZAA 4W8RA 2X6XA 4OPWA 3DU1X 4XLAA 4XMYA 1RMGA 2VBMA 1AIRA 1O8DA 2UVFA 1EE6A 4JRAC 1LLZA 1BHEA 2X6WA 1K4ZA 4YDTA 5DNSA 1OOCA 1WMRA 3PSSA 4OJ5A 2VBKA 1H80A 2NSPA 3WWGA 4W8SA 1O8EA 2PYHA 2VFPA 1KQ5A 2F3LA 2O17A 4MXNA 3GRHA 1TYVA 1O8JA 2XTYA 4V02C 4XL9A 2QY1A 2X3HA 2NZMA 2VJIA 4OJ6A 1O8FA 1OFEA 4NK6A 3PETA 4XOTA 2PECA 1DBGA 1CLWA 1OGMX 4W8TA 1BN8A 4I84A 3VMVA 2XC1A 1IDJA 2ODLA 1O8HA 4OM9A 4OJLA 4XLFA 3VSTA 2XTWA 5C1EA 4XLCA 1LM1A 2B0RA 3LJYA 4YEIA 3EQOA 5JMCB 2VBEA 4U49A 1QCXA 1QA3A 1QJVA 3VMWA 1EZGA 1O8MA 1OGOX 3ZPPA 1XG2A 4XN0A 4YZ0A 5C1CA 1IA5A 4Z03A 1QA1A 2BM4A 2J8IA 3AK5A 3GQAA 1HF2A 2O04A 2VFMA 3SQVA 1EA0A 4XR6A 4C2LA 1TYWA 1PE9A 3KRGA 2INVA 4XM3A 3SY2A 4KH3A 4YCQA 3JX8A 1DABA 2O1DA 4OJOA 1GQ8A 2QYUA 1O88A 4HWVA 1QRBA 3UW0A 3VSUA 1OFLA 1OFMA 1X0CA 2NT6A 1QRCA 4URRA 1WXRA 3B8YA 4Z05A 2BM5A 2PYGA 1O8LA 2XT4A 1QQ1A 4YFOA 3P4GA 2VFNA 2XT2A 1RWRA 4XORA 1DBOA 4XN3A 3TH0A 1QA2A 3BH7B 4XNFA 1O8IA 2X85A 3GQ9A 4XQFA 1CZFA 3EQNA 2X6YA 4XKWA 3ZSCA 4MR0A 4XLEA 1PLUA 3PSZA 1NHCA 5AMVA 2QX3A 1HG8A 1JRGA 3N90A 2IOUG 2NTPA 1OFDA 2BM7A 2J8KA 4YZAA 3FY3A 1K5CA 2BM6A 1KCDA 4YELA 2XTXA 1LLWA 2V5IA 4XKVA 3B4NA 3SUCA 2G0YA 2VJJA 1TSPA 1TYXA 1TYUA 3B90A 2Z8GA 3N6ZA 4XLHA 1IDKA 2W7ZA 3T9GA 4U4BA 1L1IA 3LYCA 2BX6A 2EWEA 5JLVC 2NT9A 3NB2A 3BH6B 1O8KA 2NTBA 1KTWA
chains in the Genus database with same CATH topology
4OZYA 4XOPA 4W8QA 2QXZA 4OZZA 4AVZA 2NTQA 4EW9A 4XONA 4Z06A 1RU4A 1JTAA 2IQ7A 2O0WA 3LMWA 3JURA 4NK8A 4YEJA 1O8GA 4YZQA 2O0VA 2UVEA 3VSVA 2NSTA 2BSPA 1VBLA 3GQ8A 3GQ7A 1PXZA 4PMHA 1IB4A 4OJPA 1KCCA 2INUA 4YZXA 4W8RA 2X6XA 4XLAA 4XMYA 1RMGA 2VBMA 1AIRA 1O8DA 2UVFA 1EE6A 1BHEA 2X6WA 1OOCA 1WMRA 4OJ5A 2VBKA 1H80A 2NSPA 3WWGA 4W8SA 1O8EA 2PYHA 2O17A 4MXNA 3GRHA 1O8JA 4XL9A 2QY1A 2X3HA 2NZMA 4OJ6A 1O8FA 4NK6A 4XOTA 2PECA 1DBGA 2NT9A 1OGMX 4W8TA 1BN8A 4I84A 3VMVA 1IDJA 2ODLA 1O8HA 4OJLA 4XLFA 3VSTA 5C1EA 4XLCA 3EQOA 2VBEA 4U49A 1QCXA 1O8KA 1QJVA 3VMWA 4YZ0A 1O8MA 1OGOX 3ZPPA 1XG2A 4XN0A 5C1CA 1IA5A 4Z03A 3GQAA 2O04A 4XR6A 1PE9A 3KRGA 2INVA 4XM3A 2O1DA 4OJOA 1GQ8A 1O88A 4HWVA 3UW0A 3VSUA 1OFLA 1OFMA 1X0CA 2NT6A 4URRA 3B8YA 4Z05A 2PYGA 1O8LA 1RWRA 4XORA 1DBOA 4XN3A 4XNFA 1O8IA 2X85A 3GQ9A 4XQFA 1CZFA 3EQNA 4XKWA 3ZSCA 4MR0A 4XLEA 1PLUA 1NHCA 5AMVA 2QX3A 1HG8A 1JRGA 2NTPA 4YZAA 3FY3A 1K5CA 1KCDA 4YELA 4XKVA 3B4NA 3SUCA 2VJJA 3B90A 2Z8GA 4XLHA 1IDKA 3T9GA 4U4BA 2EWEA 2VJIA 4C2LA 2X6YA 2NTBA 1KTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZY A;  4XOP A;  4W8Q A;  2QXZ A;  4OZZ A;  4AVZ A;  2NTQ A;  4EW9 A;  4XON A;  4Z06 A;  1RU4 A;  1JTA A;  2IQ7 A;  2O0W A;  3LMW A;  3JUR A;  4NK8 A;  4YEJ A;  1O8G A;  4YZQ A;  2O0V A;  2UVE A;  3VSV A;  2NST A;  2BSP A;  1VBL A;  3GQ8 A;  3GQ7 A;  1PXZ A;  4PMH A;  1IB4 A;  4OJP A;  1KCC A;  2INU A;  4YZX A;  4W8R A;  2X6X A;  4XLA A;  4XMY A;  1RMG A;  2VBM A;  1AIR A;  1O8D A;  2UVF A;  1EE6 A;  1BHE A;  2X6W A;  1OOC A;  1WMR A;  4OJ5 A;  2VBK A;  1H80 A;  2NSP A;  3WWG A;  4W8S A;  1O8E A;  2PYH A;  2O17 A;  4MXN A;  3GRH A;  1O8J A;  4XL9 A;  2QY1 A;  2X3H A;  2NZM A;  4OJ6 A;  1O8F A;  4NK6 A;  4XOT A;  2PEC A;  1DBG A;  2NT9 A;  1OGM X;  4W8T A;  1BN8 A;  4I84 A;  3VMV A;  1IDJ A;  2ODL A;  1O8H A;  4OJL A;  4XLF A;  3VST A;  5C1E A;  4XLC A;  3EQO A;  2VBE A;  4U49 A;  1QCX A;  1O8K A;  1QJV A;  3VMW A;  4YZ0 A;  1O8M A;  1OGO X;  3ZPP A;  1XG2 A;  4XN0 A;  5C1C A;  1IA5 A;  4Z03 A;  3GQA A;  2O04 A;  4XR6 A;  1PE9 A;  3KRG A;  2INV A;  4XM3 A;  2O1D A;  4OJO A;  1GQ8 A;  1O88 A;  4HWV A;  3UW0 A;  3VSU A;  1OFL A;  1OFM A;  1X0C A;  2NT6 A;  4URR A;  3B8Y A;  4Z05 A;  2PYG A;  1O8L A;  1RWR A;  4XOR A;  1DBO A;  4XN3 A;  4XNF A;  1O8I A;  2X85 A;  3GQ9 A;  4XQF A;  1CZF A;  3EQN A;  4XKW A;  3ZSC A;  4MR0 A;  4XLE A;  1PLU A;  1NHC A;  5AMV A;  2QX3 A;  1HG8 A;  1JRG A;  2NTP A;  4YZA A;  3FY3 A;  1K5C A;  1KCD A;  4YEL A;  4XKV A;  3B4N A;  3SUC A;  2VJJ A;  3B90 A;  2Z8G A;  4XLH A;  1IDK A;  3T9G A;  4U4B A;  2EWE A;  2VJI A;  4C2L A;  2X6Y A;  2NTB A;  1KTW A; 
#chains in the Genus database with same CATH topology
 3SYJ A;  4OZY A;  4XOP A;  4W8Q A;  3SZE A;  2VFO A;  2QXZ A;  4OZZ A;  4AVZ A;  2NTQ A;  4EW9 A;  2VFQ A;  4XON A;  2YUH A;  4Z06 A;  1RU4 A;  3RIQ A;  1JTA A;  2IQ7 A;  2O0W A;  4YC5 A;  3LMW A;  3JUR A;  3H09 A;  4NK8 A;  4YEJ A;  1O8G A;  4YZQ A;  2O0V A;  2UVE A;  3VSV A;  2NST A;  3NAW A;  2BSP A;  1VBL A;  3GQ8 A;  3GQ7 A;  1PXZ A;  4PMH A;  2O6W A;  1IB4 A;  1K8F A;  3ML3 A;  4OJP A;  1KCC A;  2INU A;  4YZX A;  2QZA A;  4W8R A;  2X6X A;  4OPW A;  3DU1 X;  4XLA A;  4XMY A;  1RMG A;  2VBM A;  1AIR A;  1O8D A;  2UVF A;  1EE6 A;  4JRA C;  1LLZ A;  1BHE A;  2X6W A;  1K4Z A;  4YDT A;  5DNS A;  1OOC A;  1WMR A;  3PSS A;  4OJ5 A;  2VBK A;  1H80 A;  2NSP A;  3WWG A;  4W8S A;  1O8E A;  2PYH A;  2VFP A;  1KQ5 A;  2F3L A;  2O17 A;  4MXN A;  3GRH A;  1TYV A;  1O8J A;  2XTY A;  4V02 C;  4XL9 A;  2QY1 A;  2X3H A;  2NZM A;  2VJI A;  4OJ6 A;  1O8F A;  1OFE A;  4NK6 A;  3PET A;  4XOT A;  2PEC A;  1DBG A;  1CLW A;  1OGM X;  4W8T A;  1BN8 A;  4I84 A;  3VMV A;  2XC1 A;  1IDJ A;  2ODL A;  1O8H A;  4OM9 A;  4OJL A;  4XLF A;  3VST A;  2XTW A;  5C1E A;  4XLC A;  1LM1 A;  2B0R A;  3LJY A;  4YEI A;  3EQO A;  5JMC B;  2VBE A;  4U49 A;  1QCX A;  1QA3 A;  1QJV A;  3VMW A;  1EZG A;  1O8M A;  1OGO X;  3ZPP A;  1XG2 A;  4XN0 A;  4YZ0 A;  5C1C A;  1IA5 A;  4Z03 A;  1QA1 A;  2BM4 A;  2J8I A;  3AK5 A;  3GQA A;  1HF2 A;  2O04 A;  2VFM A;  3SQV A;  1EA0 A;  4XR6 A;  4C2L A;  1TYW A;  1PE9 A;  3KRG A;  2INV A;  4XM3 A;  3SY2 A;  4KH3 A;  4YCQ A;  3JX8 A;  1DAB A;  2O1D A;  4OJO A;  1GQ8 A;  2QYU A;  1O88 A;  4HWV A;  1QRB A;  3UW0 A;  3VSU A;  1OFL A;  1OFM A;  1X0C A;  2NT6 A;  1QRC A;  4URR A;  1WXR A;  3B8Y A;  4Z05 A;  2BM5 A;  2PYG A;  1O8L A;  2XT4 A;  1QQ1 A;  4YFO A;  3P4G A;  2VFN A;  2XT2 A;  1RWR A;  4XOR A;  1DBO A;  4XN3 A;  3TH0 A;  1QA2 A;  3BH7 B;  4XNF A;  1O8I A;  2X85 A;  3GQ9 A;  4XQF A;  1CZF A;  3EQN A;  2X6Y A;  4XKW A;  3ZSC A;  4MR0 A;  4XLE A;  1PLU A;  3PSZ A;  1NHC A;  5AMV A;  2QX3 A;  1HG8 A;  1JRG A;  3N90 A;  2IOU G;  2NTP A;  1OFD A;  2BM7 A;  2J8K A;  4YZA A;  3FY3 A;  1K5C A;  2BM6 A;  1KCD A;  4YEL A;  2XTX A;  1LLW A;  2V5I A;  4XKV A;  3B4N A;  3SUC A;  2G0Y A;  2VJJ A;  1TSP A;  1TYX A;  1TYU A;  3B90 A;  2Z8G A;  3N6Z A;  4XLH A;  1IDK A;  2W7Z A;  3T9G A;  4U4B A;  1L1I A;  3LYC A;  2BX6 A;  2EWE A;  5JLV C;  2NT9 A;  3NB2 A;  3BH6 B;  1O8K A;  2NTB A;  1KTW A; 
#chains in the Genus database with same CATH homology
 4OZY A;  4XOP A;  4W8Q A;  2QXZ A;  4OZZ A;  4AVZ A;  2NTQ A;  4EW9 A;  4XON A;  4Z06 A;  1RU4 A;  1JTA A;  2IQ7 A;  2O0W A;  3LMW A;  3JUR A;  4NK8 A;  4YEJ A;  1O8G A;  4YZQ A;  2O0V A;  2UVE A;  3VSV A;  2NST A;  2BSP A;  1VBL A;  3GQ8 A;  3GQ7 A;  1PXZ A;  4PMH A;  1IB4 A;  4OJP A;  1KCC A;  2INU A;  4YZX A;  4W8R A;  2X6X A;  4XLA A;  4XMY A;  1RMG A;  2VBM A;  1AIR A;  1O8D A;  2UVF A;  1EE6 A;  1BHE A;  2X6W A;  1OOC A;  1WMR A;  4OJ5 A;  2VBK A;  1H80 A;  2NSP A;  3WWG A;  4W8S A;  1O8E A;  2PYH A;  2O17 A;  4MXN A;  3GRH A;  1O8J A;  4XL9 A;  2QY1 A;  2X3H A;  2NZM A;  4OJ6 A;  1O8F A;  4NK6 A;  4XOT A;  2PEC A;  1DBG A;  2NT9 A;  1OGM X;  4W8T A;  1BN8 A;  4I84 A;  3VMV A;  1IDJ A;  2ODL A;  1O8H A;  4OJL A;  4XLF A;  3VST A;  5C1E A;  4XLC A;  3EQO A;  2VBE A;  4U49 A;  1QCX A;  1O8K A;  1QJV A;  3VMW A;  4YZ0 A;  1O8M A;  1OGO X;  3ZPP A;  1XG2 A;  4XN0 A;  5C1C A;  1IA5 A;  4Z03 A;  3GQA A;  2O04 A;  4XR6 A;  1PE9 A;  3KRG A;  2INV A;  4XM3 A;  2O1D A;  4OJO A;  1GQ8 A;  1O88 A;  4HWV A;  3UW0 A;  3VSU A;  1OFL A;  1OFM A;  1X0C A;  2NT6 A;  4URR A;  3B8Y A;  4Z05 A;  2PYG A;  1O8L A;  1RWR A;  4XOR A;  1DBO A;  4XN3 A;  4XNF A;  1O8I A;  2X85 A;  3GQ9 A;  4XQF A;  1CZF A;  3EQN A;  4XKW A;  3ZSC A;  4MR0 A;  4XLE A;  1PLU A;  1NHC A;  5AMV A;  2QX3 A;  1HG8 A;  1JRG A;  2NTP A;  4YZA A;  3FY3 A;  1K5C A;  1KCD A;  4YEL A;  4XKV A;  3B4N A;  3SUC A;  2VJJ A;  3B90 A;  2Z8G A;  4XLH A;  1IDK A;  3T9G A;  4U4B A;  2EWE A;  2VJI A;  4C2L A;  2X6Y A;  2NTB A;  1KTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...