3B90A

Crystal structure of the catalytic domain of pectate lyase peli from erwinia chrysanthemi
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
b'SECKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSGNCTIENVIWEDICEDAATNNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTIDSIAGVNRNYGDVATISGLKIKNYKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-pectate lyase
publication title The Crystal Structure of Pectate Lyase PelI from Soft Rot Pathogen Erwinia chrysanthemi in Complex with Its Substrate
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3b90A00
4HWVA 4W8TA 2X3HA 2QXZA 2UVFA 2O0VA 3SUCA 1EE6A 1OFMA 2O17A 4XN0A 4XONA 3ZSCA 1O8MA 1O8JA 4OZYA 2VJIA 4AVZA 1OGMX 2NSTA 1QCXA 2INVA 3GQ7A 3VSUA 1RU4A 2VBEA 2NT6A 4YELA 2UVEA 4NK6A 2EWEA 1IB4A 2X6YA 3UW0A 1H80A 1PLUA 1JRGA 4XOTA 1O8EA 2NTQA 3GQAA 1OGOX 3VMVA 1XG2A 3B8YA 4XN3A 2O0WA 1O8KA 1JTAA 4EW9A 1X0CA 3EQNA 4W8SA 4XORA 4XLHA 1KCCA 2PECA 5C1EA 1IA5A 1RMGA 2VJJA 2NSPA 1HG8A 2O04A 4OZZA 1O88A 2INUA 1AIRA 2NZMA 1O8LA 3VMWA 4OJPA 4OJ5A 4YZQA 2NTPA 2PYGA 4XLFA 3VSTA 4I84A 3EQOA 2QY1A 4XKVA 4Z03A 3GQ9A 4Z05A 4YZXA 2ODLA 4U4BA 3FY3A 4XOPA 2BSPA 2VBKA 3B4NA 4C2LA 3KRGA 2VBMA 4PMHA 4XKWA 4MXNA 1VBLA 5C1CA 4XLCA 4OJOA 1O8IA 4OJLA 3LMWA 4NK8A 4XL9A 1O8HA 4YEJA 1OOCA 4XLAA 1QJVA 4XQFA 1DBGA 4YZ0A 1K5CA 1BHEA 3GRHA 4XMYA 4OJ6A 2NTBA 3GQ8A 1DBOA 1PXZA 2NT9A 4XM3A 1WMRA 2PYHA 2Z8GA 1CZFA 1O8DA 1KCDA 3JURA 1KTWA 4U49A 1GQ8A 4W8QA 2O1DA 2X6WA 3T9GA 2IQ7A 4XLEA 1BN8A 1O8FA 1O8GA 1NHCA 4XNFA 1RWRA 3VSVA 4MR0A 1PE9A 4Z06A 3ZPPA 2QX3A 4W8RA 5AMVA 4YZAA 1OFLA 1IDJA 4URRA 2X85A 4XR6A 1IDKA 3WWGA 2X6XA 3B90A
chains in the Genus database with same CATH superfamily
4HWVA 4W8TA 2XT4A 4V02C 2X3HA 2QXZA 2UVFA 3SYJA 2O0VA 3SUCA 1EE6A 1OFMA 2O17A 2BM6A 4XN0A 4XONA 1O8MA 1O8JA 2BX6A 2G0YA 4OZYA 3ZSCA 2VJIA 1QA2A 4AVZA 5DNSA 1TYVA 3SQVA 2V5IA 2VFQA 3DU1X 3NAWA 4YC5A 1OGMX 1HF2A 2NSTA 1QCXA 5JMCB 2INVA 3GQ7A 3VSUA 1QQ1A 1RU4A 1LM1A 1TYXA 2NT6A 2VBEA 2XTYA 2UVEA 4YELA 4NK6A 2EWEA 1QRCA 3N90A 1IB4A 1WXRA 1LLZA 2X6YA 3UW0A 1H80A 1PLUA 2F3LA 4OPWA 1JRGA 4XOTA 1O8EA 2NTQA 3GQAA 3PSZA 1OGOX 2XTWA 4KH3A 3VMVA 1XG2A 3B8YA 2XTXA 4XN3A 2O0WA 1O8KA 1JTAA 2XC1A 4EW9A 1X0CA 3EQNA 5JLVC 3AK5A 4W8SA 3PETA 2VFNA 2YUHA 4XORA 1TYWA 4XLHA 1KCCA 2PECA 1K4ZA 5C1EA 1IA5A 2VFOA 1CLWA 1RMGA 2VJJA 2NSPA 1HG8A 2O04A 2QYUA 4OZZA 2VFMA 1O88A 2INUA 1AIRA 2NZMA 1O8LA 1EZGA 3VMWA 4OJPA 4OJ5A 4YZQA 1OFEA 2BM5A 4YEIA 2NTPA 2PYGA 4XLFA 1TYUA 3BH6B 3VSTA 4I84A 3EQOA 2QY1A 4XKVA 4Z03A 2VFPA 3GQ9A 4JRAC 1QA3A 4Z05A 3NB2A 4YZXA 3RIQA 2ODLA 4U4BA 3LJYA 3SY2A 3FY3A 4XOPA 2BSPA 2VBKA 3B4NA 4C2LA 3KRGA 2VBMA 3LYCA 4PMHA 2XT2A 3N6ZA 4XKWA 4MXNA 3PSSA 1VBLA 2O6WA 5C1CA 4XLCA 4OJOA 1O8IA 1QRBA 4OJLA 3LMWA 4NK8A 4XL9A 1O8HA 2B0RA 4YEJA 1QA1A 1OOCA 2W7ZA 3JX8A 4XLAA 1QJVA 3ML3A 4XQFA 4YFOA 2J8IA 1OFDA 1DBGA 4YZ0A 1K5CA 1L1IA 1BHEA 3GRHA 4XMYA 1K8FA 2BM7A 4OJ6A 2NTBA 2IOUG 3GQ8A 4YDTA 1DBOA 1PXZA 2NT9A 4XM3A 1WMRA 4YCQA 2PYHA 2Z8GA 1CZFA 1O8DA 1KCDA 3JURA 1KTWA 3BH7B 1GQ8A 4U49A 2O1DA 2X6WA 4W8QA 3T9GA 2IQ7A 4XLEA 1BN8A 1O8FA 1O8GA 1NHCA 3H09A 1LLWA 3TH0A 4XNFA 1RWRA 1EA0A 3VSVA 4MR0A 1PE9A 4Z06A 2J8KA 3ZPPA 2QX3A 2QZAA 4W8RA 5AMVA 1KQ5A 4YZAA 3SZEA 1DABA 4OM9A 1OFLA 1IDJA 3P4GA 4URRA 2X85A 4XR6A 1IDKA 3WWGA 1TSPA 2X6XA 3B90A 2BM4A
chains in the Genus database with same CATH topology
4HWVA 4W8TA 2X3HA 2QXZA 2UVFA 2O0VA 3SUCA 1EE6A 1OFMA 2O17A 4XN0A 4XONA 3ZSCA 1O8MA 1O8JA 4OZYA 2VJIA 4AVZA 1OGMX 2NSTA 1QCXA 2INVA 3GQ7A 3VSUA 1RU4A 2VBEA 2NT6A 4YELA 2UVEA 4NK6A 2EWEA 1IB4A 2X6YA 3UW0A 1H80A 1PLUA 1JRGA 4XOTA 1O8EA 2NTQA 3GQAA 1OGOX 3VMVA 1XG2A 3B8YA 4XN3A 2O0WA 1O8KA 1JTAA 4EW9A 1X0CA 3EQNA 4W8SA 4XORA 4XLHA 1KCCA 2PECA 5C1EA 1IA5A 1RMGA 2VJJA 2NSPA 1HG8A 2O04A 4OZZA 1O88A 2INUA 1AIRA 2NZMA 1O8LA 3VMWA 4OJPA 4OJ5A 4YZQA 2NTPA 2PYGA 4XLFA 3VSTA 4I84A 3EQOA 2QY1A 4XKVA 4Z03A 3GQ9A 4Z05A 4YZXA 2ODLA 4U4BA 3FY3A 4XOPA 2BSPA 2VBKA 3B4NA 4C2LA 3KRGA 2VBMA 4PMHA 4XKWA 4MXNA 1VBLA 5C1CA 4XLCA 4OJOA 1O8IA 4OJLA 3LMWA 4NK8A 4XL9A 1O8HA 4YEJA 1OOCA 4XLAA 1QJVA 4XQFA 1DBGA 4YZ0A 1K5CA 1BHEA 3GRHA 4XMYA 4OJ6A 2NTBA 3GQ8A 1DBOA 1PXZA 2NT9A 4XM3A 1WMRA 2PYHA 2Z8GA 1CZFA 1O8DA 1KCDA 3JURA 1KTWA 4U49A 1GQ8A 4W8QA 2O1DA 2X6WA 3T9GA 2IQ7A 4XLEA 1BN8A 1O8FA 1O8GA 1NHCA 4XNFA 1RWRA 3VSVA 4MR0A 1PE9A 4Z06A 3ZPPA 2QX3A 4W8RA 5AMVA 4YZAA 1OFLA 1IDJA 4URRA 2X85A 4XR6A 1IDKA 3WWGA 2X6XA 3B90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWV A;  4W8T A;  2X3H A;  2QXZ A;  2UVF A;  2O0V A;  3SUC A;  1EE6 A;  1OFM A;  2O17 A;  4XN0 A;  4XON A;  3ZSC A;  1O8M A;  1O8J A;  4OZY A;  2VJI A;  4AVZ A;  1OGM X;  2NST A;  1QCX A;  2INV A;  3GQ7 A;  3VSU A;  1RU4 A;  2VBE A;  2NT6 A;  4YEL A;  2UVE A;  4NK6 A;  2EWE A;  1IB4 A;  2X6Y A;  3UW0 A;  1H80 A;  1PLU A;  1JRG A;  4XOT A;  1O8E A;  2NTQ A;  3GQA A;  1OGO X;  3VMV A;  1XG2 A;  3B8Y A;  4XN3 A;  2O0W A;  1O8K A;  1JTA A;  4EW9 A;  1X0C A;  3EQN A;  4W8S A;  4XOR A;  4XLH A;  1KCC A;  2PEC A;  5C1E A;  1IA5 A;  1RMG A;  2VJJ A;  2NSP A;  1HG8 A;  2O04 A;  4OZZ A;  1O88 A;  2INU A;  1AIR A;  2NZM A;  1O8L A;  3VMW A;  4OJP A;  4OJ5 A;  4YZQ A;  2NTP A;  2PYG A;  4XLF A;  3VST A;  4I84 A;  3EQO A;  2QY1 A;  4XKV A;  4Z03 A;  3GQ9 A;  4Z05 A;  4YZX A;  2ODL A;  4U4B A;  3FY3 A;  4XOP A;  2BSP A;  2VBK A;  3B4N A;  4C2L A;  3KRG A;  2VBM A;  4PMH A;  4XKW A;  4MXN A;  1VBL A;  5C1C A;  4XLC A;  4OJO A;  1O8I A;  4OJL A;  3LMW A;  4NK8 A;  4XL9 A;  1O8H A;  4YEJ A;  1OOC A;  4XLA A;  1QJV A;  4XQF A;  1DBG A;  4YZ0 A;  1K5C A;  1BHE A;  3GRH A;  4XMY A;  4OJ6 A;  2NTB A;  3GQ8 A;  1DBO A;  1PXZ A;  2NT9 A;  4XM3 A;  1WMR A;  2PYH A;  2Z8G A;  1CZF A;  1O8D A;  1KCD A;  3JUR A;  1KTW A;  4U49 A;  1GQ8 A;  4W8Q A;  2O1D A;  2X6W A;  3T9G A;  2IQ7 A;  4XLE A;  1BN8 A;  1O8F A;  1O8G A;  1NHC A;  4XNF A;  1RWR A;  3VSV A;  4MR0 A;  1PE9 A;  4Z06 A;  3ZPP A;  2QX3 A;  4W8R A;  5AMV A;  4YZA A;  1OFL A;  1IDJ A;  4URR A;  2X85 A;  4XR6 A;  1IDK A;  3WWG A;  2X6X A;  3B90 A; 
#chains in the Genus database with same CATH topology
 4HWV A;  4W8T A;  2XT4 A;  4V02 C;  2X3H A;  2QXZ A;  2UVF A;  3SYJ A;  2O0V A;  3SUC A;  1EE6 A;  1OFM A;  2O17 A;  2BM6 A;  4XN0 A;  4XON A;  1O8M A;  1O8J A;  2BX6 A;  2G0Y A;  4OZY A;  3ZSC A;  2VJI A;  1QA2 A;  4AVZ A;  5DNS A;  1TYV A;  3SQV A;  2V5I A;  2VFQ A;  3DU1 X;  3NAW A;  4YC5 A;  1OGM X;  1HF2 A;  2NST A;  1QCX A;  5JMC B;  2INV A;  3GQ7 A;  3VSU A;  1QQ1 A;  1RU4 A;  1LM1 A;  1TYX A;  2NT6 A;  2VBE A;  2XTY A;  2UVE A;  4YEL A;  4NK6 A;  2EWE A;  1QRC A;  3N90 A;  1IB4 A;  1WXR A;  1LLZ A;  2X6Y A;  3UW0 A;  1H80 A;  1PLU A;  2F3L A;  4OPW A;  1JRG A;  4XOT A;  1O8E A;  2NTQ A;  3GQA A;  3PSZ A;  1OGO X;  2XTW A;  4KH3 A;  3VMV A;  1XG2 A;  3B8Y A;  2XTX A;  4XN3 A;  2O0W A;  1O8K A;  1JTA A;  2XC1 A;  4EW9 A;  1X0C A;  3EQN A;  5JLV C;  3AK5 A;  4W8S A;  3PET A;  2VFN A;  2YUH A;  4XOR A;  1TYW A;  4XLH A;  1KCC A;  2PEC A;  1K4Z A;  5C1E A;  1IA5 A;  2VFO A;  1CLW A;  1RMG A;  2VJJ A;  2NSP A;  1HG8 A;  2O04 A;  2QYU A;  4OZZ A;  2VFM A;  1O88 A;  2INU A;  1AIR A;  2NZM A;  1O8L A;  1EZG A;  3VMW A;  4OJP A;  4OJ5 A;  4YZQ A;  1OFE A;  2BM5 A;  4YEI A;  2NTP A;  2PYG A;  4XLF A;  1TYU A;  3BH6 B;  3VST A;  4I84 A;  3EQO A;  2QY1 A;  4XKV A;  4Z03 A;  2VFP A;  3GQ9 A;  4JRA C;  1QA3 A;  4Z05 A;  3NB2 A;  4YZX A;  3RIQ A;  2ODL A;  4U4B A;  3LJY A;  3SY2 A;  3FY3 A;  4XOP A;  2BSP A;  2VBK A;  3B4N A;  4C2L A;  3KRG A;  2VBM A;  3LYC A;  4PMH A;  2XT2 A;  3N6Z A;  4XKW A;  4MXN A;  3PSS A;  1VBL A;  2O6W A;  5C1C A;  4XLC A;  4OJO A;  1O8I A;  1QRB A;  4OJL A;  3LMW A;  4NK8 A;  4XL9 A;  1O8H A;  2B0R A;  4YEJ A;  1QA1 A;  1OOC A;  2W7Z A;  3JX8 A;  4XLA A;  1QJV A;  3ML3 A;  4XQF A;  4YFO A;  2J8I A;  1OFD A;  1DBG A;  4YZ0 A;  1K5C A;  1L1I A;  1BHE A;  3GRH A;  4XMY A;  1K8F A;  2BM7 A;  4OJ6 A;  2NTB A;  2IOU G;  3GQ8 A;  4YDT A;  1DBO A;  1PXZ A;  2NT9 A;  4XM3 A;  1WMR A;  4YCQ A;  2PYH A;  2Z8G A;  1CZF A;  1O8D A;  1KCD A;  3JUR A;  1KTW A;  3BH7 B;  1GQ8 A;  4U49 A;  2O1D A;  2X6W A;  4W8Q A;  3T9G A;  2IQ7 A;  4XLE A;  1BN8 A;  1O8F A;  1O8G A;  1NHC A;  3H09 A;  1LLW A;  3TH0 A;  4XNF A;  1RWR A;  1EA0 A;  3VSV A;  4MR0 A;  1PE9 A;  4Z06 A;  2J8K A;  3ZPP A;  2QX3 A;  2QZA A;  4W8R A;  5AMV A;  1KQ5 A;  4YZA A;  3SZE A;  1DAB A;  4OM9 A;  1OFL A;  1IDJ A;  3P4G A;  4URR A;  2X85 A;  4XR6 A;  1IDK A;  3WWG A;  1TSP A;  2X6X A;  3B90 A;  2BM4 A; 
#chains in the Genus database with same CATH homology
 4HWV A;  4W8T A;  2X3H A;  2QXZ A;  2UVF A;  2O0V A;  3SUC A;  1EE6 A;  1OFM A;  2O17 A;  4XN0 A;  4XON A;  3ZSC A;  1O8M A;  1O8J A;  4OZY A;  2VJI A;  4AVZ A;  1OGM X;  2NST A;  1QCX A;  2INV A;  3GQ7 A;  3VSU A;  1RU4 A;  2VBE A;  2NT6 A;  4YEL A;  2UVE A;  4NK6 A;  2EWE A;  1IB4 A;  2X6Y A;  3UW0 A;  1H80 A;  1PLU A;  1JRG A;  4XOT A;  1O8E A;  2NTQ A;  3GQA A;  1OGO X;  3VMV A;  1XG2 A;  3B8Y A;  4XN3 A;  2O0W A;  1O8K A;  1JTA A;  4EW9 A;  1X0C A;  3EQN A;  4W8S A;  4XOR A;  4XLH A;  1KCC A;  2PEC A;  5C1E A;  1IA5 A;  1RMG A;  2VJJ A;  2NSP A;  1HG8 A;  2O04 A;  4OZZ A;  1O88 A;  2INU A;  1AIR A;  2NZM A;  1O8L A;  3VMW A;  4OJP A;  4OJ5 A;  4YZQ A;  2NTP A;  2PYG A;  4XLF A;  3VST A;  4I84 A;  3EQO A;  2QY1 A;  4XKV A;  4Z03 A;  3GQ9 A;  4Z05 A;  4YZX A;  2ODL A;  4U4B A;  3FY3 A;  4XOP A;  2BSP A;  2VBK A;  3B4N A;  4C2L A;  3KRG A;  2VBM A;  4PMH A;  4XKW A;  4MXN A;  1VBL A;  5C1C A;  4XLC A;  4OJO A;  1O8I A;  4OJL A;  3LMW A;  4NK8 A;  4XL9 A;  1O8H A;  4YEJ A;  1OOC A;  4XLA A;  1QJV A;  4XQF A;  1DBG A;  4YZ0 A;  1K5C A;  1BHE A;  3GRH A;  4XMY A;  4OJ6 A;  2NTB A;  3GQ8 A;  1DBO A;  1PXZ A;  2NT9 A;  4XM3 A;  1WMR A;  2PYH A;  2Z8G A;  1CZF A;  1O8D A;  1KCD A;  3JUR A;  1KTW A;  4U49 A;  1GQ8 A;  4W8Q A;  2O1D A;  2X6W A;  3T9G A;  2IQ7 A;  4XLE A;  1BN8 A;  1O8F A;  1O8G A;  1NHC A;  4XNF A;  1RWR A;  3VSV A;  4MR0 A;  1PE9 A;  4Z06 A;  3ZPP A;  2QX3 A;  4W8R A;  5AMV A;  4YZA A;  1OFL A;  1IDJ A;  4URR A;  2X85 A;  4XR6 A;  1IDK A;  3WWG A;  2X6X A;  3B90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...