3B90A

Crystal structure of the catalytic domain of pectate lyase peli from erwinia chrysanthemi
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
226
Chain Sequence
SECKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSGNCTIENVIWEDICEDAATNNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTIDSIAGVNRNYGDVATISGLKIKNYKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-pectate lyase
publication title The Crystal Structure of Pectate Lyase PelI from Soft Rot Pathogen Erwinia chrysanthemi in Complex with Its Substrate
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
total genus 79
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3b90A00
1HG8A 2NTQA 3VSUA 4YZ0A 1X0CA 1AIRA 2NTBA 4U49A 4C2LA 4W8RA 1DBOA 1O8HA 3B4NA 1OGMX 4U4BA 1WMRA 1IA5A 2NT9A 4OJOA 1RWRA 1EE6A 4W8TA 4Z05A 3LMWA 1GQ8A 2NTPA 2Z8GA 1O8DA 2X85A 3KRGA 1O8EA 1RU4A 4XLCA 4XKVA 1OOCA 2NZMA 3ZPPA 4YELA 4XOPA 3EQOA 1H80A 1O8LA 4XOTA 2PYHA 1O88A 3EQNA 4XL9A 2ODLA 3VMVA 4YZQA 1NHCA 3B8YA 4XN3A 4XORA 4OJ5A 5AMVA 1QCXA 4XLEA 2X3HA 2NSPA 1OFLA 3GQ7A 1BHEA 4YZAA 2UVFA 4XN0A 2X6XA 1K5CA 2NT6A 1O8GA 1IDKA 5C1CA 1KCDA 4W8QA 1XG2A 4AVZA 2NSTA 4EW9A 4YZXA 2O17A 3B90A 1VBLA 2O04A 3ZSCA 4W8SA 1RMGA 3GQAA 1O8IA 2VBMA 2PYGA 1O8JA 2INVA 4NK8A 2VJIA 4I84A 4OZZA 4PMHA 3VMWA 1PXZA 1JRGA 3FY3A 4Z03A 2O1DA 2UVEA 3GRHA 1PE9A 1OFMA 4OJPA 1O8MA 3VSVA 4XQFA 1KTWA 4XLAA 3GQ9A 1IDJA 4Z06A 2QXZA 2QX3A 1QJVA 2INUA 4MR0A 4OZYA 1JTAA 4XM3A 1O8KA 2EWEA 2PECA 2VBEA 4XMYA 1IB4A 4HWVA 3T9GA 4URRA 1DBGA 3GQ8A 3VSTA 4XLFA 3WWGA 2BSPA 4XKWA 1CZFA 3JURA 1O8FA 3UW0A 2O0WA 5C1EA 4XR6A 1OGOX 1KCCA 4NK6A 1PLUA 2IQ7A 4XONA 2VJJA 4MXNA 2VBKA 4OJLA 4XLHA 1BN8A 4XNFA 2O0VA 3SUCA 4OJ6A 2QY1A 2X6YA 4YEJA 2X6WA
chains in the Genus database with same CATH superfamily
1HG8A 1QRBA 2NTQA 3VSUA 1X0CA 1LLWA 4YZ0A 1AIRA 2NTBA 4U49A 4C2LA 1KQ5A 4W8RA 1DBOA 1O8HA 4OPWA 3B4NA 5JMCB 1OGMX 4U4BA 1WMRA 3DU1X 2J8KA 1IA5A 2NT9A 2VFQA 4OJOA 1RWRA 1EE6A 4W8TA 4Z05A 3LMWA 1GQ8A 2NTPA 2V5IA 2Z8GA 1O8DA 1QA3A 2X85A 3KRGA 1O8EA 1RU4A 4XLCA 4JRAC 4XKVA 1OOCA 2NZMA 2VFOA 1LLZA 3SY2A 4YELA 3ZPPA 4XOPA 3EQOA 1H80A 1O8LA 2QZAA 2F3LA 4XOTA 2PYHA 1O88A 1WXRA 1TYXA 2BM5A 3PETA 4KH3A 3PSSA 3EQNA 4XL9A 4YEIA 2ODLA 3VMVA 4YZQA 1NHCA 3PSZA 3B8YA 4XN3A 3H09A 4XORA 4OJ5A 5AMVA 1QCXA 3LYCA 4XLEA 2X3HA 2XTXA 2NSPA 3AK5A 1OFLA 2BM4A 2J8IA 2XC1A 1BHEA 3GQ7A 4YZAA 2UVFA 2XTWA 3ML3A 4XN0A 2XT4A 2X6XA 1K5CA 1OFDA 2NT6A 1O8GA 1QA2A 1IDKA 5C1CA 3N90A 1QQ1A 1KCDA 3JX8A 4YC5A 4W8QA 1XG2A 2BX6A 2NSTA 4AVZA 4EW9A 4YZXA 2O17A 3B90A 1VBLA 2O04A 3ZSCA 2BM7A 4W8SA 3TH0A 1RMGA 3GQAA 2XTYA 1O8IA 2VBMA 3NAWA 1K4ZA 2B0RA 2PYGA 4YDTA 2VFMA 1CLWA 4V02C 1O8JA 1LM1A 3SZEA 2INVA 4NK8A 1L1IA 2VJIA 4I84A 4OZZA 4PMHA 3VMWA 2XT2A 1PXZA 1JRGA 2QYUA 3FY3A 4Z03A 2O1DA 1QRCA 2UVEA 2W7ZA 3GRHA 1TYWA 3RIQA 1OFMA 4OJPA 1O8MA 3VSVA 4XQFA 1KTWA 1HF2A 1TSPA 4XLAA 1QA1A 3GQ9A 1IDJA 4Z06A 2QXZA 2QX3A 1K8FA 1QJVA 2INUA 4MR0A 4OZYA 3P4GA 1JTAA 4XM3A 2IOUG 1O8KA 4YFOA 3BH6B 2EWEA 2PECA 2VBEA 2VFNA 4XMYA 1IB4A 3N6ZA 5DNSA 2VFPA 3NB2A 1TYUA 4HWVA 3T9GA 2BM6A 1EA0A 4URRA 1DBGA 3SQVA 3GQ8A 1DABA 3VSTA 4XLFA 4OM9A 3SYJA 2G0YA 3WWGA 2BSPA 4XKWA 1CZFA 3JURA 3LJYA 1O8FA 3UW0A 2O0WA 5C1EA 4XR6A 1OGOX 1KCCA 4NK6A 1PLUA 2O6WA 5JLVC 2IQ7A 4XONA 1EZGA 1TYVA 2VJJA 3BH7B 2QY1A 1OFEA 4MXNA 4YCQA 2VBKA 4OJLA 4XLHA 1BN8A 4XNFA 2O0VA 3SUCA 4OJ6A 1PE9A 2X6YA 2YUHA 4YEJA 2X6WA
chains in the Genus database with same CATH topology
1HG8A 2NTQA 3VSUA 4YZ0A 1X0CA 1AIRA 2NTBA 4U49A 4C2LA 4W8RA 1DBOA 1O8HA 3B4NA 1OGMX 4U4BA 1WMRA 1IA5A 2NT9A 4OJOA 1RWRA 1EE6A 4W8TA 4Z05A 3LMWA 1GQ8A 2NTPA 2Z8GA 1O8DA 2X85A 3KRGA 1O8EA 1RU4A 4XLCA 4XKVA 1OOCA 2NZMA 3ZPPA 4YELA 4XOPA 3EQOA 1H80A 1O8LA 4XOTA 2PYHA 1O88A 3EQNA 4XL9A 2ODLA 3VMVA 4YZQA 1NHCA 3B8YA 4XN3A 4XORA 4OJ5A 5AMVA 1QCXA 4XLEA 2X3HA 2NSPA 1OFLA 3GQ7A 1BHEA 4YZAA 2UVFA 4XN0A 2X6XA 1K5CA 2NT6A 1O8GA 1IDKA 5C1CA 1KCDA 4W8QA 1XG2A 4AVZA 2NSTA 4EW9A 4YZXA 2O17A 3B90A 1VBLA 2O04A 3ZSCA 4W8SA 1RMGA 3GQAA 1O8IA 2VBMA 2PYGA 1O8JA 2INVA 4NK8A 2VJIA 4I84A 4OZZA 4PMHA 3VMWA 1PXZA 1JRGA 3FY3A 4Z03A 2O1DA 2UVEA 3GRHA 1PE9A 1OFMA 4OJPA 1O8MA 3VSVA 4XQFA 1KTWA 4XLAA 3GQ9A 1IDJA 4Z06A 2QXZA 2QX3A 1QJVA 2INUA 4MR0A 4OZYA 1JTAA 4XM3A 1O8KA 2EWEA 2PECA 2VBEA 4XMYA 1IB4A 4HWVA 3T9GA 4URRA 1DBGA 3GQ8A 3VSTA 4XLFA 3WWGA 2BSPA 4XKWA 1CZFA 3JURA 1O8FA 3UW0A 2O0WA 5C1EA 4XR6A 1OGOX 1KCCA 4NK6A 1PLUA 2IQ7A 4XONA 2VJJA 4MXNA 2VBKA 4OJLA 4XLHA 1BN8A 4XNFA 2O0VA 3SUCA 4OJ6A 2QY1A 2X6YA 4YEJA 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HG8 A;  2NTQ A;  3VSU A;  4YZ0 A;  1X0C A;  1AIR A;  2NTB A;  4U49 A;  4C2L A;  4W8R A;  1DBO A;  1O8H A;  3B4N A;  1OGM X;  4U4B A;  1WMR A;  1IA5 A;  2NT9 A;  4OJO A;  1RWR A;  1EE6 A;  4W8T A;  4Z05 A;  3LMW A;  1GQ8 A;  2NTP A;  2Z8G A;  1O8D A;  2X85 A;  3KRG A;  1O8E A;  1RU4 A;  4XLC A;  4XKV A;  1OOC A;  2NZM A;  3ZPP A;  4YEL A;  4XOP A;  3EQO A;  1H80 A;  1O8L A;  4XOT A;  2PYH A;  1O88 A;  3EQN A;  4XL9 A;  2ODL A;  3VMV A;  4YZQ A;  1NHC A;  3B8Y A;  4XN3 A;  4XOR A;  4OJ5 A;  5AMV A;  1QCX A;  4XLE A;  2X3H A;  2NSP A;  1OFL A;  3GQ7 A;  1BHE A;  4YZA A;  2UVF A;  4XN0 A;  2X6X A;  1K5C A;  2NT6 A;  1O8G A;  1IDK A;  5C1C A;  1KCD A;  4W8Q A;  1XG2 A;  4AVZ A;  2NST A;  4EW9 A;  4YZX A;  2O17 A;  3B90 A;  1VBL A;  2O04 A;  3ZSC A;  4W8S A;  1RMG A;  3GQA A;  1O8I A;  2VBM A;  2PYG A;  1O8J A;  2INV A;  4NK8 A;  2VJI A;  4I84 A;  4OZZ A;  4PMH A;  3VMW A;  1PXZ A;  1JRG A;  3FY3 A;  4Z03 A;  2O1D A;  2UVE A;  3GRH A;  1PE9 A;  1OFM A;  4OJP A;  1O8M A;  3VSV A;  4XQF A;  1KTW A;  4XLA A;  3GQ9 A;  1IDJ A;  4Z06 A;  2QXZ A;  2QX3 A;  1QJV A;  2INU A;  4MR0 A;  4OZY A;  1JTA A;  4XM3 A;  1O8K A;  2EWE A;  2PEC A;  2VBE A;  4XMY A;  1IB4 A;  4HWV A;  3T9G A;  4URR A;  1DBG A;  3GQ8 A;  3VST A;  4XLF A;  3WWG A;  2BSP A;  4XKW A;  1CZF A;  3JUR A;  1O8F A;  3UW0 A;  2O0W A;  5C1E A;  4XR6 A;  1OGO X;  1KCC A;  4NK6 A;  1PLU A;  2IQ7 A;  4XON A;  2VJJ A;  4MXN A;  2VBK A;  4OJL A;  4XLH A;  1BN8 A;  4XNF A;  2O0V A;  3SUC A;  4OJ6 A;  2QY1 A;  2X6Y A;  4YEJ A;  2X6W A; 
#chains in the Genus database with same CATH topology
 1HG8 A;  1QRB A;  2NTQ A;  3VSU A;  1X0C A;  1LLW A;  4YZ0 A;  1AIR A;  2NTB A;  4U49 A;  4C2L A;  1KQ5 A;  4W8R A;  1DBO A;  1O8H A;  4OPW A;  3B4N A;  5JMC B;  1OGM X;  4U4B A;  1WMR A;  3DU1 X;  2J8K A;  1IA5 A;  2NT9 A;  2VFQ A;  4OJO A;  1RWR A;  1EE6 A;  4W8T A;  4Z05 A;  3LMW A;  1GQ8 A;  2NTP A;  2V5I A;  2Z8G A;  1O8D A;  1QA3 A;  2X85 A;  3KRG A;  1O8E A;  1RU4 A;  4XLC A;  4JRA C;  4XKV A;  1OOC A;  2NZM A;  2VFO A;  1LLZ A;  3SY2 A;  4YEL A;  3ZPP A;  4XOP A;  3EQO A;  1H80 A;  1O8L A;  2QZA A;  2F3L A;  4XOT A;  2PYH A;  1O88 A;  1WXR A;  1TYX A;  2BM5 A;  3PET A;  4KH3 A;  3PSS A;  3EQN A;  4XL9 A;  4YEI A;  2ODL A;  3VMV A;  4YZQ A;  1NHC A;  3PSZ A;  3B8Y A;  4XN3 A;  3H09 A;  4XOR A;  4OJ5 A;  5AMV A;  1QCX A;  3LYC A;  4XLE A;  2X3H A;  2XTX A;  2NSP A;  3AK5 A;  1OFL A;  2BM4 A;  2J8I A;  2XC1 A;  1BHE A;  3GQ7 A;  4YZA A;  2UVF A;  2XTW A;  3ML3 A;  4XN0 A;  2XT4 A;  2X6X A;  1K5C A;  1OFD A;  2NT6 A;  1O8G A;  1QA2 A;  1IDK A;  5C1C A;  3N90 A;  1QQ1 A;  1KCD A;  3JX8 A;  4YC5 A;  4W8Q A;  1XG2 A;  2BX6 A;  2NST A;  4AVZ A;  4EW9 A;  4YZX A;  2O17 A;  3B90 A;  1VBL A;  2O04 A;  3ZSC A;  2BM7 A;  4W8S A;  3TH0 A;  1RMG A;  3GQA A;  2XTY A;  1O8I A;  2VBM A;  3NAW A;  1K4Z A;  2B0R A;  2PYG A;  4YDT A;  2VFM A;  1CLW A;  4V02 C;  1O8J A;  1LM1 A;  3SZE A;  2INV A;  4NK8 A;  1L1I A;  2VJI A;  4I84 A;  4OZZ A;  4PMH A;  3VMW A;  2XT2 A;  1PXZ A;  1JRG A;  2QYU A;  3FY3 A;  4Z03 A;  2O1D A;  1QRC A;  2UVE A;  2W7Z A;  3GRH A;  1TYW A;  3RIQ A;  1OFM A;  4OJP A;  1O8M A;  3VSV A;  4XQF A;  1KTW A;  1HF2 A;  1TSP A;  4XLA A;  1QA1 A;  3GQ9 A;  1IDJ A;  4Z06 A;  2QXZ A;  2QX3 A;  1K8F A;  1QJV A;  2INU A;  4MR0 A;  4OZY A;  3P4G A;  1JTA A;  4XM3 A;  2IOU G;  1O8K A;  4YFO A;  3BH6 B;  2EWE A;  2PEC A;  2VBE A;  2VFN A;  4XMY A;  1IB4 A;  3N6Z A;  5DNS A;  2VFP A;  3NB2 A;  1TYU A;  4HWV A;  3T9G A;  2BM6 A;  1EA0 A;  4URR A;  1DBG A;  3SQV A;  3GQ8 A;  1DAB A;  3VST A;  4XLF A;  4OM9 A;  3SYJ A;  2G0Y A;  3WWG A;  2BSP A;  4XKW A;  1CZF A;  3JUR A;  3LJY A;  1O8F A;  3UW0 A;  2O0W A;  5C1E A;  4XR6 A;  1OGO X;  1KCC A;  4NK6 A;  1PLU A;  2O6W A;  5JLV C;  2IQ7 A;  4XON A;  1EZG A;  1TYV A;  2VJJ A;  3BH7 B;  2QY1 A;  1OFE A;  4MXN A;  4YCQ A;  2VBK A;  4OJL A;  4XLH A;  1BN8 A;  4XNF A;  2O0V A;  3SUC A;  4OJ6 A;  1PE9 A;  2X6Y A;  2YUH A;  4YEJ A;  2X6W A; 
#chains in the Genus database with same CATH homology
 1HG8 A;  2NTQ A;  3VSU A;  4YZ0 A;  1X0C A;  1AIR A;  2NTB A;  4U49 A;  4C2L A;  4W8R A;  1DBO A;  1O8H A;  3B4N A;  1OGM X;  4U4B A;  1WMR A;  1IA5 A;  2NT9 A;  4OJO A;  1RWR A;  1EE6 A;  4W8T A;  4Z05 A;  3LMW A;  1GQ8 A;  2NTP A;  2Z8G A;  1O8D A;  2X85 A;  3KRG A;  1O8E A;  1RU4 A;  4XLC A;  4XKV A;  1OOC A;  2NZM A;  3ZPP A;  4YEL A;  4XOP A;  3EQO A;  1H80 A;  1O8L A;  4XOT A;  2PYH A;  1O88 A;  3EQN A;  4XL9 A;  2ODL A;  3VMV A;  4YZQ A;  1NHC A;  3B8Y A;  4XN3 A;  4XOR A;  4OJ5 A;  5AMV A;  1QCX A;  4XLE A;  2X3H A;  2NSP A;  1OFL A;  3GQ7 A;  1BHE A;  4YZA A;  2UVF A;  4XN0 A;  2X6X A;  1K5C A;  2NT6 A;  1O8G A;  1IDK A;  5C1C A;  1KCD A;  4W8Q A;  1XG2 A;  4AVZ A;  2NST A;  4EW9 A;  4YZX A;  2O17 A;  3B90 A;  1VBL A;  2O04 A;  3ZSC A;  4W8S A;  1RMG A;  3GQA A;  1O8I A;  2VBM A;  2PYG A;  1O8J A;  2INV A;  4NK8 A;  2VJI A;  4I84 A;  4OZZ A;  4PMH A;  3VMW A;  1PXZ A;  1JRG A;  3FY3 A;  4Z03 A;  2O1D A;  2UVE A;  3GRH A;  1PE9 A;  1OFM A;  4OJP A;  1O8M A;  3VSV A;  4XQF A;  1KTW A;  4XLA A;  3GQ9 A;  1IDJ A;  4Z06 A;  2QXZ A;  2QX3 A;  1QJV A;  2INU A;  4MR0 A;  4OZY A;  1JTA A;  4XM3 A;  1O8K A;  2EWE A;  2PEC A;  2VBE A;  4XMY A;  1IB4 A;  4HWV A;  3T9G A;  4URR A;  1DBG A;  3GQ8 A;  3VST A;  4XLF A;  3WWG A;  2BSP A;  4XKW A;  1CZF A;  3JUR A;  1O8F A;  3UW0 A;  2O0W A;  5C1E A;  4XR6 A;  1OGO X;  1KCC A;  4NK6 A;  1PLU A;  2IQ7 A;  4XON A;  2VJJ A;  4MXN A;  2VBK A;  4OJL A;  4XLH A;  1BN8 A;  4XNF A;  2O0V A;  3SUC A;  4OJ6 A;  2QY1 A;  2X6Y A;  4YEJ A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...