2EWEA

Crystal structure of pectate lyase c r218k mutant in complex with pentagalacturonic acid
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNAKLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pectate lyase C
publication title Structure of a Plant Cell Wall Fragment Complexed to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2eweA00
1BN8A 4XR6A 4YEJA 4MR0A 1K5CA 4XLHA 3EQOA 4W8QA 1DBGA 2NSPA 4OJ5A 1KCDA 4NK6A 1QCXA 2INVA 1OFMA 2O0VA 2PYHA 4OZZA 2VJJA 1DBOA 4I84A 4OJPA 2PYGA 2X85A 2NTBA 3VSTA 4U49A 5C1CA 1AIRA 3EQNA 4OJLA 2QY1A 3B8YA 1O8IA 2QX3A 3B90A 3GRHA 4W8RA 1QJVA 2O17A 2NTQA 2BSPA 2VBKA 4NK8A 4Z03A 4URRA 1O8HA 2X3HA 4W8TA 3SUCA 1O8JA 1OOCA 4XONA 3ZPPA 1CZFA 1O8DA 4XKWA 4MXNA 5C1EA 4XKVA 4XN0A 3VSUA 2NZMA 4YZ0A 2X6XA 3WWGA 1OGOX 4AVZA 1KCCA 1JTAA 1O8LA 2X6WA 4OZYA 4XLCA 1RU4A 3FY3A 1IDKA 1PXZA 4XOPA 1HG8A 3KRGA 4YZXA 4YZQA 1O88A 1O8MA 4XMYA 3GQ7A 3GQ9A 2NT9A 4XNFA 1BHEA 4XLFA 1NHCA 4OJ6A 3VSVA 4XL9A 4EW9A 1IA5A 2UVFA 2INUA 3B4NA 4XM3A 4YELA 2PECA 3VMWA 1RWRA 1VBLA 2O0WA 4XORA 1KTWA 1OGMX 2NSTA 1O8KA 3JURA 2IQ7A 4C2LA 1O8EA 1RMGA 1H80A 2UVEA 1EE6A 5AMVA 2ODLA 4U4BA 2NT6A 1XG2A 1O8FA 2QXZA 3GQAA 1JRGA 1GQ8A 1PLUA 4PMHA 4Z06A 2VBMA 4XQFA 1IB4A 3LMWA 4HWVA 4OJOA 3T9GA 1PE9A 2Z8GA 3ZSCA 2VBEA 2VJIA 1IDJA 2O04A 3UW0A 2NTPA 2O1DA 1WMRA 4YZAA 3GQ8A 4XLEA 4XOTA 1X0CA 4Z05A 2X6YA 2EWEA 3VMVA 4XLAA 4XN3A 1O8GA 4W8SA 1OFLA
chains in the Genus database with same CATH superfamily
1BN8A 1TSPA 5DNSA 4XR6A 3PETA 1DABA 4YEJA 1QRCA 2XT2A 4MR0A 2B0RA 4YEIA 1K5CA 4XLHA 3EQOA 4W8QA 3AK5A 3SZEA 1OFEA 1DBGA 1LLWA 2NSPA 4OJ5A 1KCDA 4JRAC 4NK6A 1QCXA 2INVA 1OFMA 2O0VA 2PYHA 2YUHA 3P4GA 4OZZA 2VJJA 1DBOA 4OM9A 4I84A 4OJPA 2PYGA 3SYJA 2X85A 1EZGA 2NTBA 3VSTA 2BM7A 4U49A 5C1CA 1AIRA 3EQNA 2BX6A 2W7ZA 1OFDA 2QY1A 3B8YA 4OJLA 1O8IA 1LM1A 4YDTA 1HF2A 2QX3A 1EA0A 3B90A 3GRHA 2XTXA 4W8RA 2VFOA 1QJVA 2XT4A 3SY2A 2O17A 2NTQA 2BSPA 2F3LA 2VBKA 4NK8A 4Z03A 4URRA 4YC5A 1O8HA 2X3HA 3SQVA 4W8TA 1TYUA 3SUCA 2QYUA 1O8JA 1OOCA 1L1IA 4XONA 3PSZA 1CZFA 3ZPPA 1O8DA 4XKWA 4MXNA 5C1EA 4XKVA 1CLWA 4XN0A 3VSUA 2NZMA 2VFMA 4YZ0A 2X6XA 3WWGA 1OGOX 4AVZA 1KCCA 3JX8A 1JTAA 1WXRA 1O8LA 1TYVA 2X6WA 4OZYA 4XLCA 1RU4A 3FY3A 1IDKA 2XC1A 1PXZA 4XOPA 1HG8A 3KRGA 2V5IA 3PSSA 1TYWA 4YZXA 4YZQA 4V02C 1O88A 4KH3A 1O8MA 3N90A 3ML3A 4YCQA 2VFPA 3GQ7A 4XMYA 4OPWA 3GQ9A 5JLVC 2NT9A 4XNFA 1BHEA 4XLFA 1NHCA 4OJ6A 1LLZA 3VSVA 1K8FA 4XL9A 4EW9A 1IA5A 2UVFA 3N6ZA 2INUA 2G0YA 3B4NA 4XM3A 2PECA 4YELA 3VMWA 1RWRA 1VBLA 2J8IA 2O0WA 1KTWA 1OGMX 4XORA 3RIQA 2NSTA 1O8KA 3JURA 2IQ7A 4C2LA 3TH0A 1QA3A 1O8EA 1RMGA 2IOUG 1H80A 2UVEA 1EE6A 3LYCA 5AMVA 2ODLA 1QRBA 4U4BA 2NT6A 1XG2A 1O8FA 2QXZA 3GQAA 1JRGA 1GQ8A 1K4ZA 1PLUA 2QZAA 4PMHA 4Z06A 2VBMA 4XQFA 1IB4A 3LMWA 2BM6A 2XTYA 2VFNA 2BM4A 3NB2A 4HWVA 4OJOA 3H09A 3NAWA 3T9GA 1QA2A 1PE9A 2Z8GA 3ZSCA 2BM5A 2VBEA 2VJIA 1IDJA 2O04A 3UW0A 2NTPA 4YFOA 2O1DA 2VFQA 2J8KA 1WMRA 4YZAA 3GQ8A 1TYXA 3BH6B 4XLEA 4XOTA 1QQ1A 1X0CA 2XTWA 1QA1A 3DU1X 3BH7B 4Z05A 3LJYA 1KQ5A 2EWEA 2O6WA 2X6YA 3VMVA 4XLAA 4XN3A 5JMCB 1O8GA 4W8SA 1OFLA
chains in the Genus database with same CATH topology
1BN8A 4XR6A 4YEJA 4MR0A 1K5CA 4XLHA 3EQOA 4W8QA 1DBGA 2NSPA 4OJ5A 1KCDA 4NK6A 1QCXA 2INVA 1OFMA 2O0VA 2PYHA 4OZZA 2VJJA 1DBOA 4I84A 4OJPA 2PYGA 2X85A 2NTBA 3VSTA 4U49A 5C1CA 1AIRA 3EQNA 4OJLA 2QY1A 3B8YA 1O8IA 2QX3A 3B90A 3GRHA 4W8RA 1QJVA 2O17A 2NTQA 2BSPA 2VBKA 4NK8A 4Z03A 4URRA 1O8HA 2X3HA 4W8TA 3SUCA 1O8JA 1OOCA 4XONA 3ZPPA 1CZFA 1O8DA 4XKWA 4MXNA 5C1EA 4XKVA 4XN0A 3VSUA 2NZMA 4YZ0A 2X6XA 3WWGA 1OGOX 4AVZA 1KCCA 1JTAA 1O8LA 2X6WA 4OZYA 4XLCA 1RU4A 3FY3A 1IDKA 1PXZA 4XOPA 1HG8A 3KRGA 4YZXA 4YZQA 1O88A 1O8MA 4XMYA 3GQ7A 3GQ9A 2NT9A 4XNFA 1BHEA 4XLFA 1NHCA 4OJ6A 3VSVA 4XL9A 4EW9A 1IA5A 2UVFA 2INUA 3B4NA 4XM3A 4YELA 2PECA 3VMWA 1RWRA 1VBLA 2O0WA 4XORA 1KTWA 1OGMX 2NSTA 1O8KA 3JURA 2IQ7A 4C2LA 1O8EA 1RMGA 1H80A 2UVEA 1EE6A 5AMVA 2ODLA 4U4BA 2NT6A 1XG2A 1O8FA 2QXZA 3GQAA 1JRGA 1GQ8A 1PLUA 4PMHA 4Z06A 2VBMA 4XQFA 1IB4A 3LMWA 4HWVA 4OJOA 3T9GA 1PE9A 2Z8GA 3ZSCA 2VBEA 2VJIA 1IDJA 2O04A 3UW0A 2NTPA 2O1DA 1WMRA 4YZAA 3GQ8A 4XLEA 4XOTA 1X0CA 4Z05A 2X6YA 2EWEA 3VMVA 4XLAA 4XN3A 1O8GA 4W8SA 1OFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  4XR6 A;  4YEJ A;  4MR0 A;  1K5C A;  4XLH A;  3EQO A;  4W8Q A;  1DBG A;  2NSP A;  4OJ5 A;  1KCD A;  4NK6 A;  1QCX A;  2INV A;  1OFM A;  2O0V A;  2PYH A;  4OZZ A;  2VJJ A;  1DBO A;  4I84 A;  4OJP A;  2PYG A;  2X85 A;  2NTB A;  3VST A;  4U49 A;  5C1C A;  1AIR A;  3EQN A;  4OJL A;  2QY1 A;  3B8Y A;  1O8I A;  2QX3 A;  3B90 A;  3GRH A;  4W8R A;  1QJV A;  2O17 A;  2NTQ A;  2BSP A;  2VBK A;  4NK8 A;  4Z03 A;  4URR A;  1O8H A;  2X3H A;  4W8T A;  3SUC A;  1O8J A;  1OOC A;  4XON A;  3ZPP A;  1CZF A;  1O8D A;  4XKW A;  4MXN A;  5C1E A;  4XKV A;  4XN0 A;  3VSU A;  2NZM A;  4YZ0 A;  2X6X A;  3WWG A;  1OGO X;  4AVZ A;  1KCC A;  1JTA A;  1O8L A;  2X6W A;  4OZY A;  4XLC A;  1RU4 A;  3FY3 A;  1IDK A;  1PXZ A;  4XOP A;  1HG8 A;  3KRG A;  4YZX A;  4YZQ A;  1O88 A;  1O8M A;  4XMY A;  3GQ7 A;  3GQ9 A;  2NT9 A;  4XNF A;  1BHE A;  4XLF A;  1NHC A;  4OJ6 A;  3VSV A;  4XL9 A;  4EW9 A;  1IA5 A;  2UVF A;  2INU A;  3B4N A;  4XM3 A;  4YEL A;  2PEC A;  3VMW A;  1RWR A;  1VBL A;  2O0W A;  4XOR A;  1KTW A;  1OGM X;  2NST A;  1O8K A;  3JUR A;  2IQ7 A;  4C2L A;  1O8E A;  1RMG A;  1H80 A;  2UVE A;  1EE6 A;  5AMV A;  2ODL A;  4U4B A;  2NT6 A;  1XG2 A;  1O8F A;  2QXZ A;  3GQA A;  1JRG A;  1GQ8 A;  1PLU A;  4PMH A;  4Z06 A;  2VBM A;  4XQF A;  1IB4 A;  3LMW A;  4HWV A;  4OJO A;  3T9G A;  1PE9 A;  2Z8G A;  3ZSC A;  2VBE A;  2VJI A;  1IDJ A;  2O04 A;  3UW0 A;  2NTP A;  2O1D A;  1WMR A;  4YZA A;  3GQ8 A;  4XLE A;  4XOT A;  1X0C A;  4Z05 A;  2X6Y A;  2EWE A;  3VMV A;  4XLA A;  4XN3 A;  1O8G A;  4W8S A;  1OFL A; 
#chains in the Genus database with same CATH topology
 1BN8 A;  1TSP A;  5DNS A;  4XR6 A;  3PET A;  1DAB A;  4YEJ A;  1QRC A;  2XT2 A;  4MR0 A;  2B0R A;  4YEI A;  1K5C A;  4XLH A;  3EQO A;  4W8Q A;  3AK5 A;  3SZE A;  1OFE A;  1DBG A;  1LLW A;  2NSP A;  4OJ5 A;  1KCD A;  4JRA C;  4NK6 A;  1QCX A;  2INV A;  1OFM A;  2O0V A;  2PYH A;  2YUH A;  3P4G A;  4OZZ A;  2VJJ A;  1DBO A;  4OM9 A;  4I84 A;  4OJP A;  2PYG A;  3SYJ A;  2X85 A;  1EZG A;  2NTB A;  3VST A;  2BM7 A;  4U49 A;  5C1C A;  1AIR A;  3EQN A;  2BX6 A;  2W7Z A;  1OFD A;  2QY1 A;  3B8Y A;  4OJL A;  1O8I A;  1LM1 A;  4YDT A;  1HF2 A;  2QX3 A;  1EA0 A;  3B90 A;  3GRH A;  2XTX A;  4W8R A;  2VFO A;  1QJV A;  2XT4 A;  3SY2 A;  2O17 A;  2NTQ A;  2BSP A;  2F3L A;  2VBK A;  4NK8 A;  4Z03 A;  4URR A;  4YC5 A;  1O8H A;  2X3H A;  3SQV A;  4W8T A;  1TYU A;  3SUC A;  2QYU A;  1O8J A;  1OOC A;  1L1I A;  4XON A;  3PSZ A;  1CZF A;  3ZPP A;  1O8D A;  4XKW A;  4MXN A;  5C1E A;  4XKV A;  1CLW A;  4XN0 A;  3VSU A;  2NZM A;  2VFM A;  4YZ0 A;  2X6X A;  3WWG A;  1OGO X;  4AVZ A;  1KCC A;  3JX8 A;  1JTA A;  1WXR A;  1O8L A;  1TYV A;  2X6W A;  4OZY A;  4XLC A;  1RU4 A;  3FY3 A;  1IDK A;  2XC1 A;  1PXZ A;  4XOP A;  1HG8 A;  3KRG A;  2V5I A;  3PSS A;  1TYW A;  4YZX A;  4YZQ A;  4V02 C;  1O88 A;  4KH3 A;  1O8M A;  3N90 A;  3ML3 A;  4YCQ A;  2VFP A;  3GQ7 A;  4XMY A;  4OPW A;  3GQ9 A;  5JLV C;  2NT9 A;  4XNF A;  1BHE A;  4XLF A;  1NHC A;  4OJ6 A;  1LLZ A;  3VSV A;  1K8F A;  4XL9 A;  4EW9 A;  1IA5 A;  2UVF A;  3N6Z A;  2INU A;  2G0Y A;  3B4N A;  4XM3 A;  2PEC A;  4YEL A;  3VMW A;  1RWR A;  1VBL A;  2J8I A;  2O0W A;  1KTW A;  1OGM X;  4XOR A;  3RIQ A;  2NST A;  1O8K A;  3JUR A;  2IQ7 A;  4C2L A;  3TH0 A;  1QA3 A;  1O8E A;  1RMG A;  2IOU G;  1H80 A;  2UVE A;  1EE6 A;  3LYC A;  5AMV A;  2ODL A;  1QRB A;  4U4B A;  2NT6 A;  1XG2 A;  1O8F A;  2QXZ A;  3GQA A;  1JRG A;  1GQ8 A;  1K4Z A;  1PLU A;  2QZA A;  4PMH A;  4Z06 A;  2VBM A;  4XQF A;  1IB4 A;  3LMW A;  2BM6 A;  2XTY A;  2VFN A;  2BM4 A;  3NB2 A;  4HWV A;  4OJO A;  3H09 A;  3NAW A;  3T9G A;  1QA2 A;  1PE9 A;  2Z8G A;  3ZSC A;  2BM5 A;  2VBE A;  2VJI A;  1IDJ A;  2O04 A;  3UW0 A;  2NTP A;  4YFO A;  2O1D A;  2VFQ A;  2J8K A;  1WMR A;  4YZA A;  3GQ8 A;  1TYX A;  3BH6 B;  4XLE A;  4XOT A;  1QQ1 A;  1X0C A;  2XTW A;  1QA1 A;  3DU1 X;  3BH7 B;  4Z05 A;  3LJY A;  1KQ5 A;  2EWE A;  2O6W A;  2X6Y A;  3VMV A;  4XLA A;  4XN3 A;  5JMC B;  1O8G A;  4W8S A;  1OFL A; 
#chains in the Genus database with same CATH homology
 1BN8 A;  4XR6 A;  4YEJ A;  4MR0 A;  1K5C A;  4XLH A;  3EQO A;  4W8Q A;  1DBG A;  2NSP A;  4OJ5 A;  1KCD A;  4NK6 A;  1QCX A;  2INV A;  1OFM A;  2O0V A;  2PYH A;  4OZZ A;  2VJJ A;  1DBO A;  4I84 A;  4OJP A;  2PYG A;  2X85 A;  2NTB A;  3VST A;  4U49 A;  5C1C A;  1AIR A;  3EQN A;  4OJL A;  2QY1 A;  3B8Y A;  1O8I A;  2QX3 A;  3B90 A;  3GRH A;  4W8R A;  1QJV A;  2O17 A;  2NTQ A;  2BSP A;  2VBK A;  4NK8 A;  4Z03 A;  4URR A;  1O8H A;  2X3H A;  4W8T A;  3SUC A;  1O8J A;  1OOC A;  4XON A;  3ZPP A;  1CZF A;  1O8D A;  4XKW A;  4MXN A;  5C1E A;  4XKV A;  4XN0 A;  3VSU A;  2NZM A;  4YZ0 A;  2X6X A;  3WWG A;  1OGO X;  4AVZ A;  1KCC A;  1JTA A;  1O8L A;  2X6W A;  4OZY A;  4XLC A;  1RU4 A;  3FY3 A;  1IDK A;  1PXZ A;  4XOP A;  1HG8 A;  3KRG A;  4YZX A;  4YZQ A;  1O88 A;  1O8M A;  4XMY A;  3GQ7 A;  3GQ9 A;  2NT9 A;  4XNF A;  1BHE A;  4XLF A;  1NHC A;  4OJ6 A;  3VSV A;  4XL9 A;  4EW9 A;  1IA5 A;  2UVF A;  2INU A;  3B4N A;  4XM3 A;  4YEL A;  2PEC A;  3VMW A;  1RWR A;  1VBL A;  2O0W A;  4XOR A;  1KTW A;  1OGM X;  2NST A;  1O8K A;  3JUR A;  2IQ7 A;  4C2L A;  1O8E A;  1RMG A;  1H80 A;  2UVE A;  1EE6 A;  5AMV A;  2ODL A;  4U4B A;  2NT6 A;  1XG2 A;  1O8F A;  2QXZ A;  3GQA A;  1JRG A;  1GQ8 A;  1PLU A;  4PMH A;  4Z06 A;  2VBM A;  4XQF A;  1IB4 A;  3LMW A;  4HWV A;  4OJO A;  3T9G A;  1PE9 A;  2Z8G A;  3ZSC A;  2VBE A;  2VJI A;  1IDJ A;  2O04 A;  3UW0 A;  2NTP A;  2O1D A;  1WMR A;  4YZA A;  3GQ8 A;  4XLE A;  4XOT A;  1X0C A;  4Z05 A;  2X6Y A;  2EWE A;  3VMV A;  4XLA A;  4XN3 A;  1O8G A;  4W8S A;  1OFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...