2EWEA

Crystal structure of pectate lyase c r218k mutant in complex with pentagalacturonic acid
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNAKLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Pectate lyase C
publication title Structure of a Plant Cell Wall Fragment Complexed to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2eweA00
2UVEA 2NTBA 2PYGA 2VBMA 2IQ7A 3KRGA 4XNFA 1O8DA 2NZMA 2Z8GA 1O8MA 2NTQA 2X6YA 1BN8A 4XKVA 3GQ9A 4XL9A 2NSPA 4Z05A 4YZ0A 3GRHA 4U4BA 2VJIA 2X6WA 3VSUA 4XOTA 4XLHA 2O04A 3VSTA 2ODLA 3B8YA 1PXZA 1PLUA 3VMVA 1NHCA 1VBLA 1H80A 3T9GA 1DBOA 1XG2A 1OFMA 2NT9A 1CZFA 1O8KA 2NT6A 1O88A 2UVFA 1K5CA 4NK8A 1O8HA 2VBKA 3FY3A 4Z06A 2X3HA 2O1DA 4OJ6A 3B90A 1QJVA 4XLEA 4W8TA 3LMWA 1O8FA 4OZZA 3ZSCA 2EWEA 1JTAA 2X6XA 4NK6A 4XLFA 2PECA 1OGOX 1IDJA 4XLAA 4I84A 3GQ8A 1OGMX 4OJOA 4OZYA 3UW0A 2PYHA 4XR6A 4XN0A 5C1CA 1DBGA 1O8GA 4EW9A 1IB4A 2QX3A 2VBEA 1X0CA 5AMVA 1O8EA 4AVZA 5C1EA 4W8SA 2VJJA 1RWRA 1EE6A 1KTWA 1WMRA 4MR0A 4YZQA 3SUCA 3ZPPA 3VSVA 4XM3A 4PMHA 2NTPA 4XQFA 4YEJA 1GQ8A 3GQAA 4W8RA 1KCDA 4XLCA 4XORA 1OFLA 4XONA 4YELA 2NSTA 4W8QA 1AIRA 1JRGA 2INUA 2QXZA 3EQNA 1O8LA 1RMGA 4MXNA 4OJLA 1IA5A 1QCXA 4HWVA 1OOCA 2QY1A 4YZAA 1O8IA 1KCCA 2O17A 3VMWA 1IDKA 2BSPA 1HG8A 2O0VA 4XKWA 2INVA 4OJPA 2O0WA 3EQOA 4XN3A 4C2LA 4URRA 3GQ7A 3B4NA 2X85A 4YZXA 4XOPA 3WWGA 1PE9A 3JURA 1RU4A 1BHEA 4XMYA 4Z03A 1O8JA 4OJ5A 4U49A
chains in the Genus database with same CATH superfamily
2UVEA 2NTBA 2QZAA 2PYGA 4KH3A 2VBMA 2IQ7A 3SY2A 3KRGA 4XNFA 1O8DA 1QA3A 2NZMA 2VFPA 2YUHA 1QA1A 2G0YA 1O8MA 2Z8GA 2NTQA 2VFQA 2X6YA 1TYUA 3JX8A 3N90A 1BN8A 4XKVA 3GQ9A 1EZGA 4XL9A 2NSPA 4Z05A 1LM1A 4YZ0A 3GRHA 1TSPA 4U4BA 2VJIA 2X6WA 1TYWA 3VSUA 4XOTA 4XLHA 1KQ5A 2O04A 3VSTA 1DABA 2ODLA 3BH7B 3B8YA 1PXZA 2BM6A 2J8IA 4U49A 2XTYA 3SQVA 1PLUA 2XTWA 3VMVA 4YEIA 1NHCA 1VBLA 1H80A 2VFOA 2B0RA 3T9GA 1DBOA 1EA0A 1XG2A 1LLWA 1OFMA 2NT9A 2VFMA 3RIQA 1CZFA 1O8KA 2NT6A 1O88A 2UVFA 4YC5A 1K5CA 4NK8A 1O8HA 2VBKA 3FY3A 4Z06A 2X3HA 1K4ZA 2O1DA 4OJ6A 3B90A 1QJVA 3PETA 4XLEA 4W8TA 3LMWA 4YFOA 1O8FA 4OZZA 3ZSCA 2EWEA 2O6WA 1HF2A 1JTAA 2X6XA 4NK6A 4XLFA 5JLVC 2PECA 1WXRA 1OGOX 4YCQA 1IDJA 1LLZA 4XLAA 4I84A 2V5IA 1OGMX 3GQ8A 3ML3A 4OZYA 2BM7A 2PYHA 1QQ1A 4OJOA 4XR6A 3UW0A 4XN0A 5C1CA 1DBGA 2J8KA 3PSSA 1O8GA 5DNSA 4EW9A 1IB4A 3NB2A 4OPWA 2QX3A 2VBEA 1X0CA 5AMVA 1O8EA 4AVZA 5C1EA 2BM5A 1K8FA 1QRBA 2VJJA 4W8SA 1RWRA 1EE6A 1KTWA 1WMRA 1QRCA 4JRAC 4MR0A 4YZQA 3SUCA 1OFEA 3ZPPA 3VSVA 4XM3A 2BM4A 2F3LA 4PMHA 5JMCB 2XT4A 2QYUA 2NTPA 4XQFA 2XT2A 4YEJA 1GQ8A 3GQAA 4W8RA 1KCDA 2BX6A 3DU1X 4XLCA 3NAWA 4XORA 1OFLA 3TH0A 1QA2A 4V02C 4XONA 4YELA 2NSTA 2W7ZA 3LJYA 1OFDA 4W8QA 4YDTA 1AIRA 1JRGA 2INUA 2QXZA 3EQNA 1O8LA 1RMGA 4MXNA 3SZEA 3N6ZA 4OJLA 1IA5A 1QCXA 1TYXA 4HWVA 1OOCA 2XTXA 2QY1A 4YZAA 1O8IA 1KCCA 2IOUG 2O17A 3VMWA 1IDKA 4Z03A 3SYJA 2BSPA 1CLWA 1HG8A 2O0VA 1TYVA 4OM9A 4XKWA 3BH6B 2INVA 1L1IA 2XC1A 4OJPA 2O0WA 3EQOA 4XN3A 4C2LA 4URRA 3LYCA 3GQ7A 3B4NA 2X85A 4YZXA 3PSZA 4XOPA 3WWGA 1PE9A 3H09A 1RU4A 1BHEA 3JURA 3P4GA 4XMYA 1O8JA 3AK5A 4OJ5A 2VFNA
chains in the Genus database with same CATH topology
2UVEA 2NTBA 2PYGA 2VBMA 2IQ7A 3KRGA 4XNFA 1O8DA 2NZMA 2Z8GA 1O8MA 2NTQA 2X6YA 1BN8A 4XKVA 3GQ9A 4XL9A 2NSPA 4Z05A 4YZ0A 3GRHA 4U4BA 2VJIA 2X6WA 3VSUA 4XOTA 4XLHA 2O04A 3VSTA 2ODLA 3B8YA 1PXZA 1PLUA 3VMVA 1NHCA 1VBLA 1H80A 3T9GA 1DBOA 1XG2A 1OFMA 2NT9A 1CZFA 1O8KA 2NT6A 1O88A 2UVFA 1K5CA 4NK8A 1O8HA 2VBKA 3FY3A 4Z06A 2X3HA 2O1DA 4OJ6A 3B90A 1QJVA 4XLEA 4W8TA 3LMWA 1O8FA 4OZZA 3ZSCA 2EWEA 1JTAA 2X6XA 4NK6A 4XLFA 2PECA 1OGOX 1IDJA 4XLAA 4I84A 3GQ8A 1OGMX 4OJOA 4OZYA 3UW0A 2PYHA 4XR6A 4XN0A 5C1CA 1DBGA 1O8GA 4EW9A 1IB4A 2QX3A 2VBEA 1X0CA 5AMVA 1O8EA 4AVZA 5C1EA 4W8SA 2VJJA 1RWRA 1EE6A 1KTWA 1WMRA 4MR0A 4YZQA 3SUCA 3ZPPA 3VSVA 4XM3A 4PMHA 2NTPA 4XQFA 4YEJA 1GQ8A 3GQAA 4W8RA 1KCDA 4XLCA 4XORA 1OFLA 4XONA 4YELA 2NSTA 4W8QA 1AIRA 1JRGA 2INUA 2QXZA 3EQNA 1O8LA 1RMGA 4MXNA 4OJLA 1IA5A 1QCXA 4HWVA 1OOCA 2QY1A 4YZAA 1O8IA 1KCCA 2O17A 3VMWA 1IDKA 2BSPA 1HG8A 2O0VA 4XKWA 2INVA 4OJPA 2O0WA 3EQOA 4XN3A 4C2LA 4URRA 3GQ7A 3B4NA 2X85A 4YZXA 4XOPA 3WWGA 1PE9A 3JURA 1RU4A 1BHEA 4XMYA 4Z03A 1O8JA 4OJ5A 4U49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVE A;  2NTB A;  2PYG A;  2VBM A;  2IQ7 A;  3KRG A;  4XNF A;  1O8D A;  2NZM A;  2Z8G A;  1O8M A;  2NTQ A;  2X6Y A;  1BN8 A;  4XKV A;  3GQ9 A;  4XL9 A;  2NSP A;  4Z05 A;  4YZ0 A;  3GRH A;  4U4B A;  2VJI A;  2X6W A;  3VSU A;  4XOT A;  4XLH A;  2O04 A;  3VST A;  2ODL A;  3B8Y A;  1PXZ A;  1PLU A;  3VMV A;  1NHC A;  1VBL A;  1H80 A;  3T9G A;  1DBO A;  1XG2 A;  1OFM A;  2NT9 A;  1CZF A;  1O8K A;  2NT6 A;  1O88 A;  2UVF A;  1K5C A;  4NK8 A;  1O8H A;  2VBK A;  3FY3 A;  4Z06 A;  2X3H A;  2O1D A;  4OJ6 A;  3B90 A;  1QJV A;  4XLE A;  4W8T A;  3LMW A;  1O8F A;  4OZZ A;  3ZSC A;  2EWE A;  1JTA A;  2X6X A;  4NK6 A;  4XLF A;  2PEC A;  1OGO X;  1IDJ A;  4XLA A;  4I84 A;  3GQ8 A;  1OGM X;  4OJO A;  4OZY A;  3UW0 A;  2PYH A;  4XR6 A;  4XN0 A;  5C1C A;  1DBG A;  1O8G A;  4EW9 A;  1IB4 A;  2QX3 A;  2VBE A;  1X0C A;  5AMV A;  1O8E A;  4AVZ A;  5C1E A;  4W8S A;  2VJJ A;  1RWR A;  1EE6 A;  1KTW A;  1WMR A;  4MR0 A;  4YZQ A;  3SUC A;  3ZPP A;  3VSV A;  4XM3 A;  4PMH A;  2NTP A;  4XQF A;  4YEJ A;  1GQ8 A;  3GQA A;  4W8R A;  1KCD A;  4XLC A;  4XOR A;  1OFL A;  4XON A;  4YEL A;  2NST A;  4W8Q A;  1AIR A;  1JRG A;  2INU A;  2QXZ A;  3EQN A;  1O8L A;  1RMG A;  4MXN A;  4OJL A;  1IA5 A;  1QCX A;  4HWV A;  1OOC A;  2QY1 A;  4YZA A;  1O8I A;  1KCC A;  2O17 A;  3VMW A;  1IDK A;  2BSP A;  1HG8 A;  2O0V A;  4XKW A;  2INV A;  4OJP A;  2O0W A;  3EQO A;  4XN3 A;  4C2L A;  4URR A;  3GQ7 A;  3B4N A;  2X85 A;  4YZX A;  4XOP A;  3WWG A;  1PE9 A;  3JUR A;  1RU4 A;  1BHE A;  4XMY A;  4Z03 A;  1O8J A;  4OJ5 A;  4U49 A; 
#chains in the Genus database with same CATH topology
 2UVE A;  2NTB A;  2QZA A;  2PYG A;  4KH3 A;  2VBM A;  2IQ7 A;  3SY2 A;  3KRG A;  4XNF A;  1O8D A;  1QA3 A;  2NZM A;  2VFP A;  2YUH A;  1QA1 A;  2G0Y A;  1O8M A;  2Z8G A;  2NTQ A;  2VFQ A;  2X6Y A;  1TYU A;  3JX8 A;  3N90 A;  1BN8 A;  4XKV A;  3GQ9 A;  1EZG A;  4XL9 A;  2NSP A;  4Z05 A;  1LM1 A;  4YZ0 A;  3GRH A;  1TSP A;  4U4B A;  2VJI A;  2X6W A;  1TYW A;  3VSU A;  4XOT A;  4XLH A;  1KQ5 A;  2O04 A;  3VST A;  1DAB A;  2ODL A;  3BH7 B;  3B8Y A;  1PXZ A;  2BM6 A;  2J8I A;  4U49 A;  2XTY A;  3SQV A;  1PLU A;  2XTW A;  3VMV A;  4YEI A;  1NHC A;  1VBL A;  1H80 A;  2VFO A;  2B0R A;  3T9G A;  1DBO A;  1EA0 A;  1XG2 A;  1LLW A;  1OFM A;  2NT9 A;  2VFM A;  3RIQ A;  1CZF A;  1O8K A;  2NT6 A;  1O88 A;  2UVF A;  4YC5 A;  1K5C A;  4NK8 A;  1O8H A;  2VBK A;  3FY3 A;  4Z06 A;  2X3H A;  1K4Z A;  2O1D A;  4OJ6 A;  3B90 A;  1QJV A;  3PET A;  4XLE A;  4W8T A;  3LMW A;  4YFO A;  1O8F A;  4OZZ A;  3ZSC A;  2EWE A;  2O6W A;  1HF2 A;  1JTA A;  2X6X A;  4NK6 A;  4XLF A;  5JLV C;  2PEC A;  1WXR A;  1OGO X;  4YCQ A;  1IDJ A;  1LLZ A;  4XLA A;  4I84 A;  2V5I A;  1OGM X;  3GQ8 A;  3ML3 A;  4OZY A;  2BM7 A;  2PYH A;  1QQ1 A;  4OJO A;  4XR6 A;  3UW0 A;  4XN0 A;  5C1C A;  1DBG A;  2J8K A;  3PSS A;  1O8G A;  5DNS A;  4EW9 A;  1IB4 A;  3NB2 A;  4OPW A;  2QX3 A;  2VBE A;  1X0C A;  5AMV A;  1O8E A;  4AVZ A;  5C1E A;  2BM5 A;  1K8F A;  1QRB A;  2VJJ A;  4W8S A;  1RWR A;  1EE6 A;  1KTW A;  1WMR A;  1QRC A;  4JRA C;  4MR0 A;  4YZQ A;  3SUC A;  1OFE A;  3ZPP A;  3VSV A;  4XM3 A;  2BM4 A;  2F3L A;  4PMH A;  5JMC B;  2XT4 A;  2QYU A;  2NTP A;  4XQF A;  2XT2 A;  4YEJ A;  1GQ8 A;  3GQA A;  4W8R A;  1KCD A;  2BX6 A;  3DU1 X;  4XLC A;  3NAW A;  4XOR A;  1OFL A;  3TH0 A;  1QA2 A;  4V02 C;  4XON A;  4YEL A;  2NST A;  2W7Z A;  3LJY A;  1OFD A;  4W8Q A;  4YDT A;  1AIR A;  1JRG A;  2INU A;  2QXZ A;  3EQN A;  1O8L A;  1RMG A;  4MXN A;  3SZE A;  3N6Z A;  4OJL A;  1IA5 A;  1QCX A;  1TYX A;  4HWV A;  1OOC A;  2XTX A;  2QY1 A;  4YZA A;  1O8I A;  1KCC A;  2IOU G;  2O17 A;  3VMW A;  1IDK A;  4Z03 A;  3SYJ A;  2BSP A;  1CLW A;  1HG8 A;  2O0V A;  1TYV A;  4OM9 A;  4XKW A;  3BH6 B;  2INV A;  1L1I A;  2XC1 A;  4OJP A;  2O0W A;  3EQO A;  4XN3 A;  4C2L A;  4URR A;  3LYC A;  3GQ7 A;  3B4N A;  2X85 A;  4YZX A;  3PSZ A;  4XOP A;  3WWG A;  1PE9 A;  3H09 A;  1RU4 A;  1BHE A;  3JUR A;  3P4G A;  4XMY A;  1O8J A;  3AK5 A;  4OJ5 A;  2VFN A; 
#chains in the Genus database with same CATH homology
 2UVE A;  2NTB A;  2PYG A;  2VBM A;  2IQ7 A;  3KRG A;  4XNF A;  1O8D A;  2NZM A;  2Z8G A;  1O8M A;  2NTQ A;  2X6Y A;  1BN8 A;  4XKV A;  3GQ9 A;  4XL9 A;  2NSP A;  4Z05 A;  4YZ0 A;  3GRH A;  4U4B A;  2VJI A;  2X6W A;  3VSU A;  4XOT A;  4XLH A;  2O04 A;  3VST A;  2ODL A;  3B8Y A;  1PXZ A;  1PLU A;  3VMV A;  1NHC A;  1VBL A;  1H80 A;  3T9G A;  1DBO A;  1XG2 A;  1OFM A;  2NT9 A;  1CZF A;  1O8K A;  2NT6 A;  1O88 A;  2UVF A;  1K5C A;  4NK8 A;  1O8H A;  2VBK A;  3FY3 A;  4Z06 A;  2X3H A;  2O1D A;  4OJ6 A;  3B90 A;  1QJV A;  4XLE A;  4W8T A;  3LMW A;  1O8F A;  4OZZ A;  3ZSC A;  2EWE A;  1JTA A;  2X6X A;  4NK6 A;  4XLF A;  2PEC A;  1OGO X;  1IDJ A;  4XLA A;  4I84 A;  3GQ8 A;  1OGM X;  4OJO A;  4OZY A;  3UW0 A;  2PYH A;  4XR6 A;  4XN0 A;  5C1C A;  1DBG A;  1O8G A;  4EW9 A;  1IB4 A;  2QX3 A;  2VBE A;  1X0C A;  5AMV A;  1O8E A;  4AVZ A;  5C1E A;  4W8S A;  2VJJ A;  1RWR A;  1EE6 A;  1KTW A;  1WMR A;  4MR0 A;  4YZQ A;  3SUC A;  3ZPP A;  3VSV A;  4XM3 A;  4PMH A;  2NTP A;  4XQF A;  4YEJ A;  1GQ8 A;  3GQA A;  4W8R A;  1KCD A;  4XLC A;  4XOR A;  1OFL A;  4XON A;  4YEL A;  2NST A;  4W8Q A;  1AIR A;  1JRG A;  2INU A;  2QXZ A;  3EQN A;  1O8L A;  1RMG A;  4MXN A;  4OJL A;  1IA5 A;  1QCX A;  4HWV A;  1OOC A;  2QY1 A;  4YZA A;  1O8I A;  1KCC A;  2O17 A;  3VMW A;  1IDK A;  2BSP A;  1HG8 A;  2O0V A;  4XKW A;  2INV A;  4OJP A;  2O0W A;  3EQO A;  4XN3 A;  4C2L A;  4URR A;  3GQ7 A;  3B4N A;  2X85 A;  4YZX A;  4XOP A;  3WWG A;  1PE9 A;  3JUR A;  1RU4 A;  1BHE A;  4XMY A;  4Z03 A;  1O8J A;  4OJ5 A;  4U49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...