2EWEA

Crystal structure of pectate lyase c r218k mutant in complex with pentagalacturonic acid
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNAKLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pectate lyase C
publication title Structure of a Plant Cell Wall Fragment Complexed to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2eweA00
4MR0A 4OJ6A 4XNFA 4W8QA 4XQFA 1IB4A 4XKVA 1HG8A 2PYGA 2ODLA 1O8FA 1KTWA 1O8JA 4EW9A 4XL9A 1X0CA 1JRGA 2VBMA 1XG2A 1RWRA 4OJ5A 2NTBA 5C1EA 4NK8A 1IDKA 2X3HA 2O04A 4XORA 2Z8GA 1OOCA 4Z06A 4YZQA 2NSTA 1IDJA 3GQ9A 3GRHA 1PE9A 4U4BA 4W8RA 4XR6A 4YZAA 2X6XA 1KCDA 1O8KA 1BHEA 1PLUA 4XONA 2BSPA 4YELA 5C1CA 4XLFA 2INUA 2EWEA 2VBEA 1BN8A 1O8GA 3LMWA 4YZXA 1NHCA 1GQ8A 4XKWA 2VBKA 1QCXA 5AMVA 2NT9A 1O8MA 2PECA 4OZZA 4XM3A 1O8LA 1WMRA 2NTPA 4XLHA 2X6WA 1KCCA 4XLAA 3VSVA 3ZPPA 1O8IA 1PXZA 2UVFA 3VMVA 4PMHA 4YEJA 3VSUA 2NTQA 1DBOA 1O8EA 3GQAA 1O8HA 4HWVA 3FY3A 3B4NA 4MXNA 1O88A 3VSTA 4XLCA 2O0WA 2O1DA 1AIRA 1VBLA 2O17A 4XMYA 1O8DA 1RMGA 4NK6A 2VJJA 3GQ7A 4XN3A 3EQOA 1RU4A 3B8YA 3JURA 4AVZA 4I84A 2VJIA 2NSPA 4OJPA 3T9GA 4XN0A 4W8SA 2X6YA 4XOTA 2NZMA 4YZ0A 2X85A 2UVEA 2PYHA 4OJLA 1QJVA 1OFLA 2NT6A 2O0VA 4XOPA 2IQ7A 1DBGA 4OJOA 3GQ8A 3ZSCA 3B90A 4C2LA 3KRGA 4Z05A 1H80A 1EE6A 4W8TA 1IA5A 3EQNA 3UW0A 4Z03A 1CZFA 1OGOX 2QXZA 4OZYA 3VMWA 2QY1A 4URRA 1K5CA 2QX3A 4U49A 4XLEA 1OGMX 3WWGA 1OFMA 1JTAA 2INVA 3SUCA
chains in the Genus database with same CATH superfamily
4MR0A 4OJ6A 1L1IA 4XNFA 4W8QA 4XQFA 1DABA 1IB4A 4XKVA 1HG8A 2PYGA 3AK5A 2ODLA 1O8FA 1KTWA 1O8JA 2BM6A 4EW9A 3BH6B 2BM7A 1OFEA 3NB2A 1X0CA 1JRGA 2VBMA 1XG2A 2XT4A 4XL9A 1RWRA 4OJ5A 2NTBA 5C1EA 4NK8A 3SYJA 1IDKA 2X3HA 4YFOA 1EA0A 2O04A 4XORA 2Z8GA 5DNSA 1OOCA 4Z06A 1TYVA 4YZQA 2NSTA 1IDJA 3N90A 3GQ9A 3GRHA 4YC5A 1PE9A 1OFDA 4U4BA 4W8RA 3PETA 4XR6A 2X6XA 4YZAA 1KCDA 3BH7B 1O8KA 1BHEA 1PLUA 4OPWA 4XONA 2BSPA 4YELA 5C1CA 4XLFA 1QRBA 2INUA 2EWEA 2VBEA 2B0RA 1BN8A 1O8GA 2W7ZA 3LMWA 4YZXA 1NHCA 4JRAC 3N6ZA 1GQ8A 4XKWA 1QCXA 2VBKA 5AMVA 2NT9A 1O8MA 2PECA 4OZZA 4YCQA 1WXRA 2G0YA 4XM3A 1O8LA 3RIQA 1WMRA 3ML3A 3NAWA 2NTPA 2V5IA 2XT2A 1TYWA 4XLHA 2X6WA 1KCCA 4XLAA 3VSVA 3ZPPA 2QZAA 1O8IA 1PXZA 2UVFA 3H09A 4PMHA 3VMVA 1LM1A 2XTXA 4YEJA 3VSUA 4OM9A 2NTQA 1DBOA 1LLWA 1O8EA 3GQAA 1O8HA 3P4GA 4HWVA 1QA1A 1K4ZA 3FY3A 2IOUG 3B4NA 4MXNA 1TYXA 1O88A 2J8KA 4XLCA 3VSTA 3PSZA 5JLVC 2O0WA 2BM4A 2O1DA 3LYCA 1AIRA 1VBLA 2O17A 2XTWA 4XMYA 1O8DA 1QA3A 1RMGA 4NK6A 2VJJA 3GQ7A 1EZGA 4XN3A 3EQOA 5JMCB 1RU4A 1K8FA 1KQ5A 3B8YA 3JURA 4AVZA 2VFOA 4I84A 4YDTA 2VJIA 3LJYA 2NSPA 4OJPA 1QQ1A 3T9GA 4XN0A 1LLZA 2BM5A 1HF2A 2O6WA 2QYUA 2XTYA 2X6YA 4W8SA 2NZMA 4XOTA 4YZ0A 1QA2A 2X85A 2UVEA 1QRCA 2PYHA 4OJLA 1QJVA 2VFQA 1OFLA 3SQVA 2NT6A 2O0VA 3PSSA 4XOPA 2YUHA 2IQ7A 1DBGA 4OJOA 3GQ8A 4V02C 3TH0A 2F3LA 3ZSCA 3B90A 4KH3A 1CLWA 3KRGA 2XC1A 4C2LA 4Z05A 3SY2A 1H80A 1EE6A 1TYUA 4W8TA 1IA5A 1TSPA 2VFMA 3EQNA 3UW0A 4Z03A 2J8IA 1CZFA 1OGOX 2QXZA 4OZYA 3VMWA 2BX6A 2QY1A 3JX8A 3DU1X 4URRA 1K5CA 2QX3A 2VFNA 4U49A 4XLEA 1OGMX 3SZEA 2VFPA 1OFMA 3WWGA 1JTAA 4YEIA 2INVA 3SUCA
chains in the Genus database with same CATH topology
4MR0A 4OJ6A 4XNFA 4W8QA 4XQFA 1IB4A 4XKVA 1HG8A 2PYGA 2ODLA 1O8FA 1KTWA 1O8JA 4EW9A 4XL9A 1X0CA 1JRGA 2VBMA 1XG2A 1RWRA 4OJ5A 2NTBA 5C1EA 4NK8A 1IDKA 2X3HA 2O04A 4XORA 2Z8GA 1OOCA 4Z06A 4YZQA 2NSTA 1IDJA 3GQ9A 3GRHA 1PE9A 4U4BA 4W8RA 4XR6A 4YZAA 2X6XA 1KCDA 1O8KA 1BHEA 1PLUA 4XONA 2BSPA 4YELA 5C1CA 4XLFA 2INUA 2EWEA 2VBEA 1BN8A 1O8GA 3LMWA 4YZXA 1NHCA 1GQ8A 4XKWA 2VBKA 1QCXA 5AMVA 2NT9A 1O8MA 2PECA 4OZZA 4XM3A 1O8LA 1WMRA 2NTPA 4XLHA 2X6WA 1KCCA 4XLAA 3VSVA 3ZPPA 1O8IA 1PXZA 2UVFA 3VMVA 4PMHA 4YEJA 3VSUA 2NTQA 1DBOA 1O8EA 3GQAA 1O8HA 4HWVA 3FY3A 3B4NA 4MXNA 1O88A 3VSTA 4XLCA 2O0WA 2O1DA 1AIRA 1VBLA 2O17A 4XMYA 1O8DA 1RMGA 4NK6A 2VJJA 3GQ7A 4XN3A 3EQOA 1RU4A 3B8YA 3JURA 4AVZA 4I84A 2VJIA 2NSPA 4OJPA 3T9GA 4XN0A 4W8SA 2X6YA 4XOTA 2NZMA 4YZ0A 2X85A 2UVEA 2PYHA 4OJLA 1QJVA 1OFLA 2NT6A 2O0VA 4XOPA 2IQ7A 1DBGA 4OJOA 3GQ8A 3ZSCA 3B90A 4C2LA 3KRGA 4Z05A 1H80A 1EE6A 4W8TA 1IA5A 3EQNA 3UW0A 4Z03A 1CZFA 1OGOX 2QXZA 4OZYA 3VMWA 2QY1A 4URRA 1K5CA 2QX3A 4U49A 4XLEA 1OGMX 3WWGA 1OFMA 1JTAA 2INVA 3SUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR0 A;  4OJ6 A;  4XNF A;  4W8Q A;  4XQF A;  1IB4 A;  4XKV A;  1HG8 A;  2PYG A;  2ODL A;  1O8F A;  1KTW A;  1O8J A;  4EW9 A;  4XL9 A;  1X0C A;  1JRG A;  2VBM A;  1XG2 A;  1RWR A;  4OJ5 A;  2NTB A;  5C1E A;  4NK8 A;  1IDK A;  2X3H A;  2O04 A;  4XOR A;  2Z8G A;  1OOC A;  4Z06 A;  4YZQ A;  2NST A;  1IDJ A;  3GQ9 A;  3GRH A;  1PE9 A;  4U4B A;  4W8R A;  4XR6 A;  4YZA A;  2X6X A;  1KCD A;  1O8K A;  1BHE A;  1PLU A;  4XON A;  2BSP A;  4YEL A;  5C1C A;  4XLF A;  2INU A;  2EWE A;  2VBE A;  1BN8 A;  1O8G A;  3LMW A;  4YZX A;  1NHC A;  1GQ8 A;  4XKW A;  2VBK A;  1QCX A;  5AMV A;  2NT9 A;  1O8M A;  2PEC A;  4OZZ A;  4XM3 A;  1O8L A;  1WMR A;  2NTP A;  4XLH A;  2X6W A;  1KCC A;  4XLA A;  3VSV A;  3ZPP A;  1O8I A;  1PXZ A;  2UVF A;  3VMV A;  4PMH A;  4YEJ A;  3VSU A;  2NTQ A;  1DBO A;  1O8E A;  3GQA A;  1O8H A;  4HWV A;  3FY3 A;  3B4N A;  4MXN A;  1O88 A;  3VST A;  4XLC A;  2O0W A;  2O1D A;  1AIR A;  1VBL A;  2O17 A;  4XMY A;  1O8D A;  1RMG A;  4NK6 A;  2VJJ A;  3GQ7 A;  4XN3 A;  3EQO A;  1RU4 A;  3B8Y A;  3JUR A;  4AVZ A;  4I84 A;  2VJI A;  2NSP A;  4OJP A;  3T9G A;  4XN0 A;  4W8S A;  2X6Y A;  4XOT A;  2NZM A;  4YZ0 A;  2X85 A;  2UVE A;  2PYH A;  4OJL A;  1QJV A;  1OFL A;  2NT6 A;  2O0V A;  4XOP A;  2IQ7 A;  1DBG A;  4OJO A;  3GQ8 A;  3ZSC A;  3B90 A;  4C2L A;  3KRG A;  4Z05 A;  1H80 A;  1EE6 A;  4W8T A;  1IA5 A;  3EQN A;  3UW0 A;  4Z03 A;  1CZF A;  1OGO X;  2QXZ A;  4OZY A;  3VMW A;  2QY1 A;  4URR A;  1K5C A;  2QX3 A;  4U49 A;  4XLE A;  1OGM X;  3WWG A;  1OFM A;  1JTA A;  2INV A;  3SUC A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  4OJ6 A;  1L1I A;  4XNF A;  4W8Q A;  4XQF A;  1DAB A;  1IB4 A;  4XKV A;  1HG8 A;  2PYG A;  3AK5 A;  2ODL A;  1O8F A;  1KTW A;  1O8J A;  2BM6 A;  4EW9 A;  3BH6 B;  2BM7 A;  1OFE A;  3NB2 A;  1X0C A;  1JRG A;  2VBM A;  1XG2 A;  2XT4 A;  4XL9 A;  1RWR A;  4OJ5 A;  2NTB A;  5C1E A;  4NK8 A;  3SYJ A;  1IDK A;  2X3H A;  4YFO A;  1EA0 A;  2O04 A;  4XOR A;  2Z8G A;  5DNS A;  1OOC A;  4Z06 A;  1TYV A;  4YZQ A;  2NST A;  1IDJ A;  3N90 A;  3GQ9 A;  3GRH A;  4YC5 A;  1PE9 A;  1OFD A;  4U4B A;  4W8R A;  3PET A;  4XR6 A;  2X6X A;  4YZA A;  1KCD A;  3BH7 B;  1O8K A;  1BHE A;  1PLU A;  4OPW A;  4XON A;  2BSP A;  4YEL A;  5C1C A;  4XLF A;  1QRB A;  2INU A;  2EWE A;  2VBE A;  2B0R A;  1BN8 A;  1O8G A;  2W7Z A;  3LMW A;  4YZX A;  1NHC A;  4JRA C;  3N6Z A;  1GQ8 A;  4XKW A;  1QCX A;  2VBK A;  5AMV A;  2NT9 A;  1O8M A;  2PEC A;  4OZZ A;  4YCQ A;  1WXR A;  2G0Y A;  4XM3 A;  1O8L A;  3RIQ A;  1WMR A;  3ML3 A;  3NAW A;  2NTP A;  2V5I A;  2XT2 A;  1TYW A;  4XLH A;  2X6W A;  1KCC A;  4XLA A;  3VSV A;  3ZPP A;  2QZA A;  1O8I A;  1PXZ A;  2UVF A;  3H09 A;  4PMH A;  3VMV A;  1LM1 A;  2XTX A;  4YEJ A;  3VSU A;  4OM9 A;  2NTQ A;  1DBO A;  1LLW A;  1O8E A;  3GQA A;  1O8H A;  3P4G A;  4HWV A;  1QA1 A;  1K4Z A;  3FY3 A;  2IOU G;  3B4N A;  4MXN A;  1TYX A;  1O88 A;  2J8K A;  4XLC A;  3VST A;  3PSZ A;  5JLV C;  2O0W A;  2BM4 A;  2O1D A;  3LYC A;  1AIR A;  1VBL A;  2O17 A;  2XTW A;  4XMY A;  1O8D A;  1QA3 A;  1RMG A;  4NK6 A;  2VJJ A;  3GQ7 A;  1EZG A;  4XN3 A;  3EQO A;  5JMC B;  1RU4 A;  1K8F A;  1KQ5 A;  3B8Y A;  3JUR A;  4AVZ A;  2VFO A;  4I84 A;  4YDT A;  2VJI A;  3LJY A;  2NSP A;  4OJP A;  1QQ1 A;  3T9G A;  4XN0 A;  1LLZ A;  2BM5 A;  1HF2 A;  2O6W A;  2QYU A;  2XTY A;  2X6Y A;  4W8S A;  2NZM A;  4XOT A;  4YZ0 A;  1QA2 A;  2X85 A;  2UVE A;  1QRC A;  2PYH A;  4OJL A;  1QJV A;  2VFQ A;  1OFL A;  3SQV A;  2NT6 A;  2O0V A;  3PSS A;  4XOP A;  2YUH A;  2IQ7 A;  1DBG A;  4OJO A;  3GQ8 A;  4V02 C;  3TH0 A;  2F3L A;  3ZSC A;  3B90 A;  4KH3 A;  1CLW A;  3KRG A;  2XC1 A;  4C2L A;  4Z05 A;  3SY2 A;  1H80 A;  1EE6 A;  1TYU A;  4W8T A;  1IA5 A;  1TSP A;  2VFM A;  3EQN A;  3UW0 A;  4Z03 A;  2J8I A;  1CZF A;  1OGO X;  2QXZ A;  4OZY A;  3VMW A;  2BX6 A;  2QY1 A;  3JX8 A;  3DU1 X;  4URR A;  1K5C A;  2QX3 A;  2VFN A;  4U49 A;  4XLE A;  1OGM X;  3SZE A;  2VFP A;  1OFM A;  3WWG A;  1JTA A;  4YEI A;  2INV A;  3SUC A; 
#chains in the Genus database with same CATH homology
 4MR0 A;  4OJ6 A;  4XNF A;  4W8Q A;  4XQF A;  1IB4 A;  4XKV A;  1HG8 A;  2PYG A;  2ODL A;  1O8F A;  1KTW A;  1O8J A;  4EW9 A;  4XL9 A;  1X0C A;  1JRG A;  2VBM A;  1XG2 A;  1RWR A;  4OJ5 A;  2NTB A;  5C1E A;  4NK8 A;  1IDK A;  2X3H A;  2O04 A;  4XOR A;  2Z8G A;  1OOC A;  4Z06 A;  4YZQ A;  2NST A;  1IDJ A;  3GQ9 A;  3GRH A;  1PE9 A;  4U4B A;  4W8R A;  4XR6 A;  4YZA A;  2X6X A;  1KCD A;  1O8K A;  1BHE A;  1PLU A;  4XON A;  2BSP A;  4YEL A;  5C1C A;  4XLF A;  2INU A;  2EWE A;  2VBE A;  1BN8 A;  1O8G A;  3LMW A;  4YZX A;  1NHC A;  1GQ8 A;  4XKW A;  2VBK A;  1QCX A;  5AMV A;  2NT9 A;  1O8M A;  2PEC A;  4OZZ A;  4XM3 A;  1O8L A;  1WMR A;  2NTP A;  4XLH A;  2X6W A;  1KCC A;  4XLA A;  3VSV A;  3ZPP A;  1O8I A;  1PXZ A;  2UVF A;  3VMV A;  4PMH A;  4YEJ A;  3VSU A;  2NTQ A;  1DBO A;  1O8E A;  3GQA A;  1O8H A;  4HWV A;  3FY3 A;  3B4N A;  4MXN A;  1O88 A;  3VST A;  4XLC A;  2O0W A;  2O1D A;  1AIR A;  1VBL A;  2O17 A;  4XMY A;  1O8D A;  1RMG A;  4NK6 A;  2VJJ A;  3GQ7 A;  4XN3 A;  3EQO A;  1RU4 A;  3B8Y A;  3JUR A;  4AVZ A;  4I84 A;  2VJI A;  2NSP A;  4OJP A;  3T9G A;  4XN0 A;  4W8S A;  2X6Y A;  4XOT A;  2NZM A;  4YZ0 A;  2X85 A;  2UVE A;  2PYH A;  4OJL A;  1QJV A;  1OFL A;  2NT6 A;  2O0V A;  4XOP A;  2IQ7 A;  1DBG A;  4OJO A;  3GQ8 A;  3ZSC A;  3B90 A;  4C2L A;  3KRG A;  4Z05 A;  1H80 A;  1EE6 A;  4W8T A;  1IA5 A;  3EQN A;  3UW0 A;  4Z03 A;  1CZF A;  1OGO X;  2QXZ A;  4OZY A;  3VMW A;  2QY1 A;  4URR A;  1K5C A;  2QX3 A;  4U49 A;  4XLE A;  1OGM X;  3WWG A;  1OFM A;  1JTA A;  2INV A;  3SUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...