2EWEA

Crystal structure of pectate lyase c r218k mutant in complex with pentagalacturonic acid
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNAKLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pectate lyase C
publication title Structure of a Plant Cell Wall Fragment Complexed to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2eweA00
1KTWA 4I84A 3KRGA 4OZZA 3EQNA 3GQ9A 1RMGA 4XR6A 1IDKA 5AMVA 1JRGA 3VSVA 4C2LA 1QCXA 1DBOA 1O8GA 4XLHA 2INVA 3GQAA 4XN3A 4XORA 2IQ7A 2BSPA 4Z06A 3ZPPA 4W8QA 5C1CA 2UVEA 4W8RA 1BN8A 1PLUA 3GQ7A 3VMVA 1OGOX 4XOPA 3VSTA 4NK8A 3B8YA 2ODLA 2NTPA 1O8JA 4MXNA 4XLAA 2PYHA 4YELA 1O8FA 4XN0A 4XMYA 2O04A 2UVFA 1BHEA 1QJVA 1HG8A 3SUCA 2X6YA 1JTAA 4U4BA 1EE6A 3B90A 1OGMX 4XLCA 5C1EA 4XQFA 3JURA 3VMWA 3VSUA 4YZ0A 1IDJA 2NSTA 1O8EA 1OFLA 4U49A 1KCCA 1IA5A 1O8LA 1XG2A 1DBGA 4YZAA 4XNFA 2NTQA 2INUA 1IB4A 2VJIA 2O1DA 3B4NA 2VBKA 4HWVA 4XL9A 2QX3A 3WWGA 2O0VA 4XM3A 4XLFA 1PXZA 2NT6A 1O8IA 4W8SA 4MR0A 4Z03A 4XLEA 3T9GA 1AIRA 1X0CA 2PYGA 4AVZA 2X85A 4XKVA 3GQ8A 4OJ5A 2NSPA 1K5CA 1O8DA 4XOTA 1OOCA 4OZYA 4OJLA 1H80A 4W8TA 2VJJA 1O8KA 2VBEA 1O8HA 3GRHA 1RWRA 4OJ6A 3UW0A 4YZQA 1NHCA 2EWEA 1O8MA 2O17A 1OFMA 1WMRA 1KCDA 4YEJA 1PE9A 2NZMA 4Z05A 4XKWA 4URRA 1GQ8A 2Z8GA 4NK6A 1RU4A 4YZXA 4OJOA 3EQOA 2O0WA 2NTBA 3LMWA 2QY1A 3ZSCA 2X6XA 4OJPA 2PECA 1VBLA 1CZFA 1O88A 2X3HA 3FY3A 2X6WA 4PMHA 2QXZA 4EW9A 2NT9A 2VBMA 4XONA
chains in the Genus database with same CATH superfamily
2V5IA 2G0YA 1KTWA 5JLVC 4I84A 3KRGA 1CLWA 3N90A 3SQVA 4OZZA 3EQNA 3NB2A 2XTWA 3GQ9A 1RMGA 4XR6A 2VFOA 1IDKA 5AMVA 1JRGA 3VSVA 1LLZA 1QCXA 3PETA 1DBOA 4C2LA 1OFEA 4YCQA 3BH7B 1O8GA 2XT2A 4XLHA 5DNSA 1DABA 2INVA 3GQAA 4YC5A 4YEIA 4XN3A 4XORA 2IQ7A 2BSPA 3N6ZA 4Z06A 3ZPPA 4W8QA 1QRCA 5C1CA 2UVEA 1QRBA 1BN8A 1PLUA 3GQ7A 2BM5A 4W8RA 3VMVA 5JMCB 1EZGA 1OGOX 4XOPA 3VSTA 4NK8A 1LLWA 3B8YA 3DU1X 2ODLA 3LJYA 2NTPA 1O8JA 4MXNA 2QYUA 4XLAA 2PYHA 4YELA 1O8FA 2W7ZA 4XN0A 4XMYA 1QA3A 2O04A 2UVFA 1BHEA 1QJVA 2BM7A 1HG8A 2XTYA 3SUCA 2X6YA 1JTAA 4U4BA 1QQ1A 1EE6A 1TSPA 1OFDA 3B90A 1OGMX 4XLCA 5C1EA 2O6WA 2XT4A 2J8IA 4XQFA 3JURA 3SYJA 3VMWA 3VSUA 4YZ0A 1IDJA 1WXRA 2NSTA 1O8EA 1OFLA 4U49A 3RIQA 1KCCA 1IA5A 1O8LA 3PSZA 1XG2A 1DBGA 4V02C 1KQ5A 2XTXA 2NTQA 4XNFA 2INUA 2BX6A 2BM4A 4YZAA 2J8KA 1IB4A 2VFMA 2VJIA 1QA1A 3ML3A 1EA0A 2O1DA 3B4NA 2IOUG 2VBKA 4HWVA 4XL9A 2QX3A 3WWGA 3SZEA 3AK5A 2O0VA 4XM3A 4YFOA 4XLFA 1PXZA 2BM6A 2NT6A 1O8IA 3P4GA 2B0RA 4W8SA 4MR0A 4Z03A 3TH0A 4XLEA 3T9GA 1QA2A 1AIRA 1X0CA 2PYGA 2VFQA 4AVZA 1TYUA 2X85A 2YUHA 4XKVA 3H09A 2VFPA 3GQ8A 4OJ5A 2NSPA 1K5CA 1O8DA 3NAWA 4XOTA 1OOCA 4OZYA 4OJLA 1H80A 3PSSA 4W8TA 2VJJA 1O8KA 1LM1A 1K4ZA 1O8HA 2VBEA 3GRHA 1RWRA 4OJ6A 3UW0A 4YZQA 1NHCA 2EWEA 2F3LA 1O8MA 2O17A 1OFMA 1WMRA 4KH3A 1KCDA 4OM9A 4YEJA 1PE9A 3BH6B 2NZMA 4Z05A 4XKWA 2VFNA 4URRA 1GQ8A 2Z8GA 4NK6A 1RU4A 4YZXA 4OJOA 3EQOA 2O0WA 4JRAC 4YDTA 2NTBA 3LMWA 2QY1A 3ZSCA 2X6XA 3JX8A 4OPWA 4OJPA 2PECA 2XC1A 1TYWA 1VBLA 1HF2A 3LYCA 3SY2A 1TYXA 1CZFA 1O88A 2X3HA 3FY3A 1K8FA 1L1IA 2X6WA 2QZAA 1TYVA 4PMHA 2QXZA 4EW9A 2NT9A 2VBMA 4XONA
chains in the Genus database with same CATH topology
1KTWA 4I84A 3KRGA 4OZZA 3EQNA 3GQ9A 1RMGA 4XR6A 1IDKA 5AMVA 1JRGA 3VSVA 4C2LA 1QCXA 1DBOA 1O8GA 4XLHA 2INVA 3GQAA 4XN3A 4XORA 2IQ7A 2BSPA 4Z06A 3ZPPA 4W8QA 5C1CA 2UVEA 4W8RA 1BN8A 1PLUA 3GQ7A 3VMVA 1OGOX 4XOPA 3VSTA 4NK8A 3B8YA 2ODLA 2NTPA 1O8JA 4MXNA 4XLAA 2PYHA 4YELA 1O8FA 4XN0A 4XMYA 2O04A 2UVFA 1BHEA 1QJVA 1HG8A 3SUCA 2X6YA 1JTAA 4U4BA 1EE6A 3B90A 1OGMX 4XLCA 5C1EA 4XQFA 3JURA 3VMWA 3VSUA 4YZ0A 1IDJA 2NSTA 1O8EA 1OFLA 4U49A 1KCCA 1IA5A 1O8LA 1XG2A 1DBGA 4YZAA 4XNFA 2NTQA 2INUA 1IB4A 2VJIA 2O1DA 3B4NA 2VBKA 4HWVA 4XL9A 2QX3A 3WWGA 2O0VA 4XM3A 4XLFA 1PXZA 2NT6A 1O8IA 4W8SA 4MR0A 4Z03A 4XLEA 3T9GA 1AIRA 1X0CA 2PYGA 4AVZA 2X85A 4XKVA 3GQ8A 4OJ5A 2NSPA 1K5CA 1O8DA 4XOTA 1OOCA 4OZYA 4OJLA 1H80A 4W8TA 2VJJA 1O8KA 2VBEA 1O8HA 3GRHA 1RWRA 4OJ6A 3UW0A 4YZQA 1NHCA 2EWEA 1O8MA 2O17A 1OFMA 1WMRA 1KCDA 4YEJA 1PE9A 2NZMA 4Z05A 4XKWA 4URRA 1GQ8A 2Z8GA 4NK6A 1RU4A 4YZXA 4OJOA 3EQOA 2O0WA 2NTBA 3LMWA 2QY1A 3ZSCA 2X6XA 4OJPA 2PECA 1VBLA 1CZFA 1O88A 2X3HA 3FY3A 2X6WA 4PMHA 2QXZA 4EW9A 2NT9A 2VBMA 4XONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTW A;  4I84 A;  3KRG A;  4OZZ A;  3EQN A;  3GQ9 A;  1RMG A;  4XR6 A;  1IDK A;  5AMV A;  1JRG A;  3VSV A;  4C2L A;  1QCX A;  1DBO A;  1O8G A;  4XLH A;  2INV A;  3GQA A;  4XN3 A;  4XOR A;  2IQ7 A;  2BSP A;  4Z06 A;  3ZPP A;  4W8Q A;  5C1C A;  2UVE A;  4W8R A;  1BN8 A;  1PLU A;  3GQ7 A;  3VMV A;  1OGO X;  4XOP A;  3VST A;  4NK8 A;  3B8Y A;  2ODL A;  2NTP A;  1O8J A;  4MXN A;  4XLA A;  2PYH A;  4YEL A;  1O8F A;  4XN0 A;  4XMY A;  2O04 A;  2UVF A;  1BHE A;  1QJV A;  1HG8 A;  3SUC A;  2X6Y A;  1JTA A;  4U4B A;  1EE6 A;  3B90 A;  1OGM X;  4XLC A;  5C1E A;  4XQF A;  3JUR A;  3VMW A;  3VSU A;  4YZ0 A;  1IDJ A;  2NST A;  1O8E A;  1OFL A;  4U49 A;  1KCC A;  1IA5 A;  1O8L A;  1XG2 A;  1DBG A;  4YZA A;  4XNF A;  2NTQ A;  2INU A;  1IB4 A;  2VJI A;  2O1D A;  3B4N A;  2VBK A;  4HWV A;  4XL9 A;  2QX3 A;  3WWG A;  2O0V A;  4XM3 A;  4XLF A;  1PXZ A;  2NT6 A;  1O8I A;  4W8S A;  4MR0 A;  4Z03 A;  4XLE A;  3T9G A;  1AIR A;  1X0C A;  2PYG A;  4AVZ A;  2X85 A;  4XKV A;  3GQ8 A;  4OJ5 A;  2NSP A;  1K5C A;  1O8D A;  4XOT A;  1OOC A;  4OZY A;  4OJL A;  1H80 A;  4W8T A;  2VJJ A;  1O8K A;  2VBE A;  1O8H A;  3GRH A;  1RWR A;  4OJ6 A;  3UW0 A;  4YZQ A;  1NHC A;  2EWE A;  1O8M A;  2O17 A;  1OFM A;  1WMR A;  1KCD A;  4YEJ A;  1PE9 A;  2NZM A;  4Z05 A;  4XKW A;  4URR A;  1GQ8 A;  2Z8G A;  4NK6 A;  1RU4 A;  4YZX A;  4OJO A;  3EQO A;  2O0W A;  2NTB A;  3LMW A;  2QY1 A;  3ZSC A;  2X6X A;  4OJP A;  2PEC A;  1VBL A;  1CZF A;  1O88 A;  2X3H A;  3FY3 A;  2X6W A;  4PMH A;  2QXZ A;  4EW9 A;  2NT9 A;  2VBM A;  4XON A; 
#chains in the Genus database with same CATH topology
 2V5I A;  2G0Y A;  1KTW A;  5JLV C;  4I84 A;  3KRG A;  1CLW A;  3N90 A;  3SQV A;  4OZZ A;  3EQN A;  3NB2 A;  2XTW A;  3GQ9 A;  1RMG A;  4XR6 A;  2VFO A;  1IDK A;  5AMV A;  1JRG A;  3VSV A;  1LLZ A;  1QCX A;  3PET A;  1DBO A;  4C2L A;  1OFE A;  4YCQ A;  3BH7 B;  1O8G A;  2XT2 A;  4XLH A;  5DNS A;  1DAB A;  2INV A;  3GQA A;  4YC5 A;  4YEI A;  4XN3 A;  4XOR A;  2IQ7 A;  2BSP A;  3N6Z A;  4Z06 A;  3ZPP A;  4W8Q A;  1QRC A;  5C1C A;  2UVE A;  1QRB A;  1BN8 A;  1PLU A;  3GQ7 A;  2BM5 A;  4W8R A;  3VMV A;  5JMC B;  1EZG A;  1OGO X;  4XOP A;  3VST A;  4NK8 A;  1LLW A;  3B8Y A;  3DU1 X;  2ODL A;  3LJY A;  2NTP A;  1O8J A;  4MXN A;  2QYU A;  4XLA A;  2PYH A;  4YEL A;  1O8F A;  2W7Z A;  4XN0 A;  4XMY A;  1QA3 A;  2O04 A;  2UVF A;  1BHE A;  1QJV A;  2BM7 A;  1HG8 A;  2XTY A;  3SUC A;  2X6Y A;  1JTA A;  4U4B A;  1QQ1 A;  1EE6 A;  1TSP A;  1OFD A;  3B90 A;  1OGM X;  4XLC A;  5C1E A;  2O6W A;  2XT4 A;  2J8I A;  4XQF A;  3JUR A;  3SYJ A;  3VMW A;  3VSU A;  4YZ0 A;  1IDJ A;  1WXR A;  2NST A;  1O8E A;  1OFL A;  4U49 A;  3RIQ A;  1KCC A;  1IA5 A;  1O8L A;  3PSZ A;  1XG2 A;  1DBG A;  4V02 C;  1KQ5 A;  2XTX A;  2NTQ A;  4XNF A;  2INU A;  2BX6 A;  2BM4 A;  4YZA A;  2J8K A;  1IB4 A;  2VFM A;  2VJI A;  1QA1 A;  3ML3 A;  1EA0 A;  2O1D A;  3B4N A;  2IOU G;  2VBK A;  4HWV A;  4XL9 A;  2QX3 A;  3WWG A;  3SZE A;  3AK5 A;  2O0V A;  4XM3 A;  4YFO A;  4XLF A;  1PXZ A;  2BM6 A;  2NT6 A;  1O8I A;  3P4G A;  2B0R A;  4W8S A;  4MR0 A;  4Z03 A;  3TH0 A;  4XLE A;  3T9G A;  1QA2 A;  1AIR A;  1X0C A;  2PYG A;  2VFQ A;  4AVZ A;  1TYU A;  2X85 A;  2YUH A;  4XKV A;  3H09 A;  2VFP A;  3GQ8 A;  4OJ5 A;  2NSP A;  1K5C A;  1O8D A;  3NAW A;  4XOT A;  1OOC A;  4OZY A;  4OJL A;  1H80 A;  3PSS A;  4W8T A;  2VJJ A;  1O8K A;  1LM1 A;  1K4Z A;  1O8H A;  2VBE A;  3GRH A;  1RWR A;  4OJ6 A;  3UW0 A;  4YZQ A;  1NHC A;  2EWE A;  2F3L A;  1O8M A;  2O17 A;  1OFM A;  1WMR A;  4KH3 A;  1KCD A;  4OM9 A;  4YEJ A;  1PE9 A;  3BH6 B;  2NZM A;  4Z05 A;  4XKW A;  2VFN A;  4URR A;  1GQ8 A;  2Z8G A;  4NK6 A;  1RU4 A;  4YZX A;  4OJO A;  3EQO A;  2O0W A;  4JRA C;  4YDT A;  2NTB A;  3LMW A;  2QY1 A;  3ZSC A;  2X6X A;  3JX8 A;  4OPW A;  4OJP A;  2PEC A;  2XC1 A;  1TYW A;  1VBL A;  1HF2 A;  3LYC A;  3SY2 A;  1TYX A;  1CZF A;  1O88 A;  2X3H A;  3FY3 A;  1K8F A;  1L1I A;  2X6W A;  2QZA A;  1TYV A;  4PMH A;  2QXZ A;  4EW9 A;  2NT9 A;  2VBM A;  4XON A; 
#chains in the Genus database with same CATH homology
 1KTW A;  4I84 A;  3KRG A;  4OZZ A;  3EQN A;  3GQ9 A;  1RMG A;  4XR6 A;  1IDK A;  5AMV A;  1JRG A;  3VSV A;  4C2L A;  1QCX A;  1DBO A;  1O8G A;  4XLH A;  2INV A;  3GQA A;  4XN3 A;  4XOR A;  2IQ7 A;  2BSP A;  4Z06 A;  3ZPP A;  4W8Q A;  5C1C A;  2UVE A;  4W8R A;  1BN8 A;  1PLU A;  3GQ7 A;  3VMV A;  1OGO X;  4XOP A;  3VST A;  4NK8 A;  3B8Y A;  2ODL A;  2NTP A;  1O8J A;  4MXN A;  4XLA A;  2PYH A;  4YEL A;  1O8F A;  4XN0 A;  4XMY A;  2O04 A;  2UVF A;  1BHE A;  1QJV A;  1HG8 A;  3SUC A;  2X6Y A;  1JTA A;  4U4B A;  1EE6 A;  3B90 A;  1OGM X;  4XLC A;  5C1E A;  4XQF A;  3JUR A;  3VMW A;  3VSU A;  4YZ0 A;  1IDJ A;  2NST A;  1O8E A;  1OFL A;  4U49 A;  1KCC A;  1IA5 A;  1O8L A;  1XG2 A;  1DBG A;  4YZA A;  4XNF A;  2NTQ A;  2INU A;  1IB4 A;  2VJI A;  2O1D A;  3B4N A;  2VBK A;  4HWV A;  4XL9 A;  2QX3 A;  3WWG A;  2O0V A;  4XM3 A;  4XLF A;  1PXZ A;  2NT6 A;  1O8I A;  4W8S A;  4MR0 A;  4Z03 A;  4XLE A;  3T9G A;  1AIR A;  1X0C A;  2PYG A;  4AVZ A;  2X85 A;  4XKV A;  3GQ8 A;  4OJ5 A;  2NSP A;  1K5C A;  1O8D A;  4XOT A;  1OOC A;  4OZY A;  4OJL A;  1H80 A;  4W8T A;  2VJJ A;  1O8K A;  2VBE A;  1O8H A;  3GRH A;  1RWR A;  4OJ6 A;  3UW0 A;  4YZQ A;  1NHC A;  2EWE A;  1O8M A;  2O17 A;  1OFM A;  1WMR A;  1KCD A;  4YEJ A;  1PE9 A;  2NZM A;  4Z05 A;  4XKW A;  4URR A;  1GQ8 A;  2Z8G A;  4NK6 A;  1RU4 A;  4YZX A;  4OJO A;  3EQO A;  2O0W A;  2NTB A;  3LMW A;  2QY1 A;  3ZSC A;  2X6X A;  4OJP A;  2PEC A;  1VBL A;  1CZF A;  1O88 A;  2X3H A;  3FY3 A;  2X6W A;  4PMH A;  2QXZ A;  4EW9 A;  2NT9 A;  2VBM A;  4XON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...