2EWEA

Crystal structure of pectate lyase c r218k mutant in complex with pentagalacturonic acid
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNAKLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Plant Cell Wall Fragment Complexed to Pectate Lyase C
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Lyase
molecule keywords Pectate lyase C
total genus 139
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2eweA00
2VBKA 1CZFA 1EE6A 1OGOX 1O8FA 4OZYA 2O04A 2NTBA 4OJPA 3UW0A 1K5CA 1JTAA 2INVA 4XNFA 1BN8A 1O8HA 2NT9A 4W8QA 4C2LA 1PXZA 2X3HA 2O17A 2VBEA 1O8IA 4OZZA 4Z06A 3WWGA 1BHEA 4NK8A 2NT6A 3GQ7A 3KRGA 1IA5A 2NZMA 4YEJA 1O8GA 1QCXA 4OJOA 2IQ7A 2UVEA 4YELA 1OFMA 3GQ9A 2X6WA 4XLAA 2NSTA 2O1DA 2QXZA 4PMHA 2PYHA 4W8TA 1IDKA 1PE9A 1O8MA 4XN0A 4XMYA 4U49A 4XLEA 4URRA 2VJIA 1XG2A 4MXNA 4OJ5A 5C1CA 1O8KA 3T9GA 1KCCA 3EQOA 3VSUA 2X85A 2O0WA 3EQNA 1RMGA 1DBOA 1QJVA 3JURA 3VSVA 1O8LA 1OFLA 4MR0A 4XLFA 3VSTA 3FY3A 3SUCA 1H80A 4XM3A 2X6XA 3VMWA 4EW9A 2VBMA 4XLCA 5AMVA 3VMVA 1DBGA 2PYGA 2QX3A 1O8DA 3B90A 1VBLA 4XLHA 1IB4A 1PLUA 4XOTA 1WMRA 4XKVA 4YZXA 1AIRA 1NHCA 1O8EA 4XONA 4YZ0A 1O8JA 1RU4A 4OJ6A 1O88A 4XQFA 2BSPA 2NTPA 3GRHA 4YZAA 1X0CA 1RWRA 4YZQA 1GQ8A 2NTQA 1JRGA 4HWVA 2QY1A 3B8YA 4XORA 2PECA 2UVFA 1OGMX 3GQ8A 1KTWA 1HG8A 4XR6A 4Z03A 2ODLA 4W8RA 1KCDA 4U4BA 4XKWA 2O0VA 4NK6A 3ZPPA 5C1EA 2NSPA 2Z8GA 4Z05A 4XOPA 2EWEA 2VJJA 2X6YA 3B4NA 4XN3A 4AVZA 3LMWA 1IDJA 3ZSCA 4I84A 4OJLA 3GQAA 2INUA 4XL9A 1OOCA 4W8SA
chains in the Genus database with same CATH superfamily
2VBKA 1CZFA 1EE6A 1OGOX 1QA2A 1O8FA 4JRAC 4KH3A 4OZYA 4YDTA 2O04A 2NTBA 4OJPA 3UW0A 1K5CA 1TYUA 1LM1A 1JTAA 1TYVA 2INVA 4XNFA 1BN8A 1O8HA 2NT9A 2XT2A 3DU1X 1PXZA 2J8KA 3PSSA 2X3HA 4OM9A 4W8QA 3RIQA 4C2LA 2O17A 3LJYA 2VBEA 1O8IA 4OZZA 2XTXA 4Z06A 3WWGA 1BHEA 4NK8A 2NT6A 1QA1A 1K4ZA 3GQ7A 3KRGA 1IA5A 2NZMA 1KQ5A 4YEJA 1O8GA 1QCXA 2VFOA 4OJOA 2IQ7A 2UVEA 3SZEA 4YELA 3SY2A 1OFMA 1TYWA 3GQ9A 3TH0A 2X6WA 4XLAA 2NSTA 2O1DA 2QXZA 3AK5A 2BX6A 1QRBA 4PMHA 2PYHA 4W8TA 1CLWA 1IDKA 1PE9A 3PETA 1O8MA 4XN0A 3BH6B 1L1IA 4XMYA 1EZGA 3SYJA 1HF2A 4U49A 2VFPA 2W7ZA 4XLEA 1QA3A 4URRA 2BM6A 2VJIA 1XG2A 3JX8A 4MXNA 4OJ5A 5C1CA 1LLWA 1O8KA 3T9GA 1KCCA 3EQOA 3VSUA 1OFDA 3BH7B 3ML3A 3PSZA 1WXRA 2X85A 2O0WA 3EQNA 3N6ZA 1RMGA 2VFMA 1DBOA 1QJVA 1TSPA 3JURA 3VSVA 1OFEA 2J8IA 1O8LA 1OFLA 4MR0A 2F3LA 4XLFA 3VSTA 4OPWA 3FY3A 3SUCA 1H80A 2BM5A 4XM3A 2X6XA 3VMWA 4EW9A 2VBMA 4XLCA 5AMVA 3VMVA 1DBGA 1QQ1A 2PYGA 2QX3A 1O8DA 3B90A 3N90A 1VBLA 3NB2A 4XLHA 4YFOA 2V5IA 1EA0A 2VFNA 1IB4A 1PLUA 4XOTA 1WMRA 4XKVA 4YZXA 1AIRA 1NHCA 1O8EA 4XONA 4YZ0A 1TYXA 1O8JA 1RU4A 4OJ6A 1O88A 2IOUG 2QZAA 2BSPA 4XQFA 2NTPA 3GRHA 4YZAA 1X0CA 1RWRA 4YZQA 1GQ8A 2NTQA 4YCQA 1JRGA 3H09A 5JMCB 3P4GA 4HWVA 1QRCA 2BM4A 2G0YA 2QY1A 2XC1A 3B8YA 2PECA 4XORA 2XTYA 5DNSA 2QYUA 2UVFA 1OGMX 3GQ8A 2B0RA 4YEIA 1KTWA 1HG8A 4XR6A 3NAWA 4Z03A 2ODLA 4W8RA 1KCDA 1LLZA 4U4BA 4XKWA 2O0VA 4NK6A 2VFQA 3ZPPA 5C1EA 5JLVC 2NSPA 2Z8GA 2O6WA 2XTWA 4Z05A 3LYCA 2EWEA 2YUHA 4XOPA 2VJJA 2X6YA 3B4NA 4XN3A 4AVZA 3LMWA 1IDJA 4YC5A 2XT4A 2BM7A 4I84A 4OJLA 3GQAA 3ZSCA 1K8FA 2INUA 4V02C 1DABA 4XL9A 1OOCA 3SQVA 4W8SA
chains in the Genus database with same CATH topology
2VBKA 1CZFA 1EE6A 1OGOX 1O8FA 4OZYA 2O04A 2NTBA 4OJPA 3UW0A 1K5CA 1JTAA 2INVA 4XNFA 1BN8A 1O8HA 2NT9A 4W8QA 4C2LA 1PXZA 2X3HA 2O17A 2VBEA 1O8IA 4OZZA 4Z06A 3WWGA 1BHEA 4NK8A 2NT6A 3GQ7A 3KRGA 1IA5A 2NZMA 4YEJA 1O8GA 1QCXA 4OJOA 2IQ7A 2UVEA 4YELA 1OFMA 3GQ9A 2X6WA 4XLAA 2NSTA 2O1DA 2QXZA 4PMHA 2PYHA 4W8TA 1IDKA 1PE9A 1O8MA 4XN0A 4XMYA 4U49A 4XLEA 4URRA 2VJIA 1XG2A 4MXNA 4OJ5A 5C1CA 1O8KA 3T9GA 1KCCA 3EQOA 3VSUA 2X85A 2O0WA 3EQNA 1RMGA 1DBOA 1QJVA 3JURA 3VSVA 1O8LA 1OFLA 4MR0A 4XLFA 3VSTA 3FY3A 3SUCA 1H80A 4XM3A 2X6XA 3VMWA 4EW9A 2VBMA 4XLCA 5AMVA 3VMVA 1DBGA 2PYGA 2QX3A 1O8DA 3B90A 1VBLA 4XLHA 1IB4A 1PLUA 4XOTA 1WMRA 4XKVA 4YZXA 1AIRA 1NHCA 1O8EA 4XONA 4YZ0A 1O8JA 1RU4A 4OJ6A 1O88A 4XQFA 2BSPA 2NTPA 3GRHA 4YZAA 1X0CA 1RWRA 4YZQA 1GQ8A 2NTQA 1JRGA 4HWVA 2QY1A 3B8YA 4XORA 2PECA 2UVFA 1OGMX 3GQ8A 1KTWA 1HG8A 4XR6A 4Z03A 2ODLA 4W8RA 1KCDA 4U4BA 4XKWA 2O0VA 4NK6A 3ZPPA 5C1EA 2NSPA 2Z8GA 4Z05A 4XOPA 2EWEA 2VJJA 2X6YA 3B4NA 4XN3A 4AVZA 3LMWA 1IDJA 3ZSCA 4I84A 4OJLA 3GQAA 2INUA 4XL9A 1OOCA 4W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBK A;  1CZF A;  1EE6 A;  1OGO X;  1O8F A;  4OZY A;  2O04 A;  2NTB A;  4OJP A;  3UW0 A;  1K5C A;  1JTA A;  2INV A;  4XNF A;  1BN8 A;  1O8H A;  2NT9 A;  4W8Q A;  4C2L A;  1PXZ A;  2X3H A;  2O17 A;  2VBE A;  1O8I A;  4OZZ A;  4Z06 A;  3WWG A;  1BHE A;  4NK8 A;  2NT6 A;  3GQ7 A;  3KRG A;  1IA5 A;  2NZM A;  4YEJ A;  1O8G A;  1QCX A;  4OJO A;  2IQ7 A;  2UVE A;  4YEL A;  1OFM A;  3GQ9 A;  2X6W A;  4XLA A;  2NST A;  2O1D A;  2QXZ A;  4PMH A;  2PYH A;  4W8T A;  1IDK A;  1PE9 A;  1O8M A;  4XN0 A;  4XMY A;  4U49 A;  4XLE A;  4URR A;  2VJI A;  1XG2 A;  4MXN A;  4OJ5 A;  5C1C A;  1O8K A;  3T9G A;  1KCC A;  3EQO A;  3VSU A;  2X85 A;  2O0W A;  3EQN A;  1RMG A;  1DBO A;  1QJV A;  3JUR A;  3VSV A;  1O8L A;  1OFL A;  4MR0 A;  4XLF A;  3VST A;  3FY3 A;  3SUC A;  1H80 A;  4XM3 A;  2X6X A;  3VMW A;  4EW9 A;  2VBM A;  4XLC A;  5AMV A;  3VMV A;  1DBG A;  2PYG A;  2QX3 A;  1O8D A;  3B90 A;  1VBL A;  4XLH A;  1IB4 A;  1PLU A;  4XOT A;  1WMR A;  4XKV A;  4YZX A;  1AIR A;  1NHC A;  1O8E A;  4XON A;  4YZ0 A;  1O8J A;  1RU4 A;  4OJ6 A;  1O88 A;  4XQF A;  2BSP A;  2NTP A;  3GRH A;  4YZA A;  1X0C A;  1RWR A;  4YZQ A;  1GQ8 A;  2NTQ A;  1JRG A;  4HWV A;  2QY1 A;  3B8Y A;  4XOR A;  2PEC A;  2UVF A;  1OGM X;  3GQ8 A;  1KTW A;  1HG8 A;  4XR6 A;  4Z03 A;  2ODL A;  4W8R A;  1KCD A;  4U4B A;  4XKW A;  2O0V A;  4NK6 A;  3ZPP A;  5C1E A;  2NSP A;  2Z8G A;  4Z05 A;  4XOP A;  2EWE A;  2VJJ A;  2X6Y A;  3B4N A;  4XN3 A;  4AVZ A;  3LMW A;  1IDJ A;  3ZSC A;  4I84 A;  4OJL A;  3GQA A;  2INU A;  4XL9 A;  1OOC A;  4W8S A; 
#chains in the Genus database with same CATH topology
 2VBK A;  1CZF A;  1EE6 A;  1OGO X;  1QA2 A;  1O8F A;  4JRA C;  4KH3 A;  4OZY A;  4YDT A;  2O04 A;  2NTB A;  4OJP A;  3UW0 A;  1K5C A;  1TYU A;  1LM1 A;  1JTA A;  1TYV A;  2INV A;  4XNF A;  1BN8 A;  1O8H A;  2NT9 A;  2XT2 A;  3DU1 X;  1PXZ A;  2J8K A;  3PSS A;  2X3H A;  4OM9 A;  4W8Q A;  3RIQ A;  4C2L A;  2O17 A;  3LJY A;  2VBE A;  1O8I A;  4OZZ A;  2XTX A;  4Z06 A;  3WWG A;  1BHE A;  4NK8 A;  2NT6 A;  1QA1 A;  1K4Z A;  3GQ7 A;  3KRG A;  1IA5 A;  2NZM A;  1KQ5 A;  4YEJ A;  1O8G A;  1QCX A;  2VFO A;  4OJO A;  2IQ7 A;  2UVE A;  3SZE A;  4YEL A;  3SY2 A;  1OFM A;  1TYW A;  3GQ9 A;  3TH0 A;  2X6W A;  4XLA A;  2NST A;  2O1D A;  2QXZ A;  3AK5 A;  2BX6 A;  1QRB A;  4PMH A;  2PYH A;  4W8T A;  1CLW A;  1IDK A;  1PE9 A;  3PET A;  1O8M A;  4XN0 A;  3BH6 B;  1L1I A;  4XMY A;  1EZG A;  3SYJ A;  1HF2 A;  4U49 A;  2VFP A;  2W7Z A;  4XLE A;  1QA3 A;  4URR A;  2BM6 A;  2VJI A;  1XG2 A;  3JX8 A;  4MXN A;  4OJ5 A;  5C1C A;  1LLW A;  1O8K A;  3T9G A;  1KCC A;  3EQO A;  3VSU A;  1OFD A;  3BH7 B;  3ML3 A;  3PSZ A;  1WXR A;  2X85 A;  2O0W A;  3EQN A;  3N6Z A;  1RMG A;  2VFM A;  1DBO A;  1QJV A;  1TSP A;  3JUR A;  3VSV A;  1OFE A;  2J8I A;  1O8L A;  1OFL A;  4MR0 A;  2F3L A;  4XLF A;  3VST A;  4OPW A;  3FY3 A;  3SUC A;  1H80 A;  2BM5 A;  4XM3 A;  2X6X A;  3VMW A;  4EW9 A;  2VBM A;  4XLC A;  5AMV A;  3VMV A;  1DBG A;  1QQ1 A;  2PYG A;  2QX3 A;  1O8D A;  3B90 A;  3N90 A;  1VBL A;  3NB2 A;  4XLH A;  4YFO A;  2V5I A;  1EA0 A;  2VFN A;  1IB4 A;  1PLU A;  4XOT A;  1WMR A;  4XKV A;  4YZX A;  1AIR A;  1NHC A;  1O8E A;  4XON A;  4YZ0 A;  1TYX A;  1O8J A;  1RU4 A;  4OJ6 A;  1O88 A;  2IOU G;  2QZA A;  2BSP A;  4XQF A;  2NTP A;  3GRH A;  4YZA A;  1X0C A;  1RWR A;  4YZQ A;  1GQ8 A;  2NTQ A;  4YCQ A;  1JRG A;  3H09 A;  5JMC B;  3P4G A;  4HWV A;  1QRC A;  2BM4 A;  2G0Y A;  2QY1 A;  2XC1 A;  3B8Y A;  2PEC A;  4XOR A;  2XTY A;  5DNS A;  2QYU A;  2UVF A;  1OGM X;  3GQ8 A;  2B0R A;  4YEI A;  1KTW A;  1HG8 A;  4XR6 A;  3NAW A;  4Z03 A;  2ODL A;  4W8R A;  1KCD A;  1LLZ A;  4U4B A;  4XKW A;  2O0V A;  4NK6 A;  2VFQ A;  3ZPP A;  5C1E A;  5JLV C;  2NSP A;  2Z8G A;  2O6W A;  2XTW A;  4Z05 A;  3LYC A;  2EWE A;  2YUH A;  4XOP A;  2VJJ A;  2X6Y A;  3B4N A;  4XN3 A;  4AVZ A;  3LMW A;  1IDJ A;  4YC5 A;  2XT4 A;  2BM7 A;  4I84 A;  4OJL A;  3GQA A;  3ZSC A;  1K8F A;  2INU A;  4V02 C;  1DAB A;  4XL9 A;  1OOC A;  3SQV A;  4W8S A; 
#chains in the Genus database with same CATH homology
 2VBK A;  1CZF A;  1EE6 A;  1OGO X;  1O8F A;  4OZY A;  2O04 A;  2NTB A;  4OJP A;  3UW0 A;  1K5C A;  1JTA A;  2INV A;  4XNF A;  1BN8 A;  1O8H A;  2NT9 A;  4W8Q A;  4C2L A;  1PXZ A;  2X3H A;  2O17 A;  2VBE A;  1O8I A;  4OZZ A;  4Z06 A;  3WWG A;  1BHE A;  4NK8 A;  2NT6 A;  3GQ7 A;  3KRG A;  1IA5 A;  2NZM A;  4YEJ A;  1O8G A;  1QCX A;  4OJO A;  2IQ7 A;  2UVE A;  4YEL A;  1OFM A;  3GQ9 A;  2X6W A;  4XLA A;  2NST A;  2O1D A;  2QXZ A;  4PMH A;  2PYH A;  4W8T A;  1IDK A;  1PE9 A;  1O8M A;  4XN0 A;  4XMY A;  4U49 A;  4XLE A;  4URR A;  2VJI A;  1XG2 A;  4MXN A;  4OJ5 A;  5C1C A;  1O8K A;  3T9G A;  1KCC A;  3EQO A;  3VSU A;  2X85 A;  2O0W A;  3EQN A;  1RMG A;  1DBO A;  1QJV A;  3JUR A;  3VSV A;  1O8L A;  1OFL A;  4MR0 A;  4XLF A;  3VST A;  3FY3 A;  3SUC A;  1H80 A;  4XM3 A;  2X6X A;  3VMW A;  4EW9 A;  2VBM A;  4XLC A;  5AMV A;  3VMV A;  1DBG A;  2PYG A;  2QX3 A;  1O8D A;  3B90 A;  1VBL A;  4XLH A;  1IB4 A;  1PLU A;  4XOT A;  1WMR A;  4XKV A;  4YZX A;  1AIR A;  1NHC A;  1O8E A;  4XON A;  4YZ0 A;  1O8J A;  1RU4 A;  4OJ6 A;  1O88 A;  4XQF A;  2BSP A;  2NTP A;  3GRH A;  4YZA A;  1X0C A;  1RWR A;  4YZQ A;  1GQ8 A;  2NTQ A;  1JRG A;  4HWV A;  2QY1 A;  3B8Y A;  4XOR A;  2PEC A;  2UVF A;  1OGM X;  3GQ8 A;  1KTW A;  1HG8 A;  4XR6 A;  4Z03 A;  2ODL A;  4W8R A;  1KCD A;  4U4B A;  4XKW A;  2O0V A;  4NK6 A;  3ZPP A;  5C1E A;  2NSP A;  2Z8G A;  4Z05 A;  4XOP A;  2EWE A;  2VJJ A;  2X6Y A;  3B4N A;  4XN3 A;  4AVZ A;  3LMW A;  1IDJ A;  3ZSC A;  4I84 A;  4OJL A;  3GQA A;  2INU A;  4XL9 A;  1OOC A;  4W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...