3LJYA

Crystal structure of putative adhesin (yp_001304413.1) from parabacteroides distasonis atcc 8503 at 2.41 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
239
structure length
239
Chain Sequence
DHVKGDGKLTSKKISVADYNEIKVDGVIDFNYEQSDDPSTVEVTVDQNLHPYVNIEVKDRVLTIAFKGAKVDHFTKFIVKTNSKWLAAAKVSGNANFMVNSPLTGDETVIKANANSLVQLKETVTVGKLDLNVSGSANMVVNHLEADKIECDIDGSGSITIKKGNAKEGDYSIVSSGDIHAFGLAVPQLSCKVTGNGLAEVHATDNLKANVVGKGNIRYKGPTAVQQRIIGKGTVEEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords putative adhesin
publication title Crystal structure of putative adhesin (YP_001304413.1) from Parabacteroides distasonis ATCC 8503 at 2.41 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 85
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3ljyA00
3JX8A 4OPWA 3PETA 3LJYA 3LYCA
chains in the Genus database with same CATH superfamily
1DABA 3N6ZA 3JURA 4URRA 2NZMA 1OFDA 4XL9A 4YZXA 1KTWA 3KRGA 3SY2A 2X3HA 2QX3A 1OFMA 1TSPA 2XC1A 3B8YA 1CZFA 1PE9A 4V02C 4HWVA 1GQ8A 4XN0A 1RWRA 3WWGA 2V5IA 3SYJA 2VFMA 2VFNA 4OZZA 3ZPPA 3JX8A 2O0VA 4OJ6A 1EA0A 1QRBA 2F3LA 4YZAA 3GQ9A 4YZ0A 4XLEA 2QZAA 2BM5A 2NT9A 5C1EA 1WXRA 2PECA 1IA5A 1X0CA 3NB2A 1K4ZA 4XONA 4YEJA 2VFQA 1O88A 1O8MA 2BX6A 4OJLA 2BM4A 2O17A 4PMHA 3VMWA 4YEIA 2NTQA 2O04A 1TYWA 2UVFA 1LM1A 4OJOA 3BH7B 1O8DA 1O8KA 2QYUA 4OZYA 1CLWA 4OPWA 2XT2A 4U4BA 1OGMX 3LJYA 3PSSA 3T9GA 4XM3A 2XT4A 4MR0A 1WMRA 2VFPA 2X6XA 4MXNA 2NTPA 1KCCA 3UW0A 1KQ5A 2B0RA 1RMGA 2BSPA 4I84A 1AIRA 2PYGA 2NTBA 1QA1A 2NT6A 3FY3A 2X6WA 4W8TA 4YC5A 3EQOA 2VFOA 3NAWA 2VBMA 4OJ5A 1JTAA 1LLWA 3B4NA 5AMVA 1DBGA 2VBKA 1NHCA 1EZGA 3DU1X 1O8GA 1EE6A 4NK8A 2QY1A 4XORA 1O8FA 2O1DA 4YELA 4XNFA 5DNSA 3RIQA 4NK6A 1RU4A 1O8EA 4JRAC 2VJIA 2ODLA 1TYXA 1QQ1A 1TYVA 2INUA 2X85A 1OOCA 1K8FA 2NSTA 2XTWA 3B90A 3GQ7A 3SQVA 1DBOA 5JMCB 1OGOX 1QJVA 2X6YA 2Z8GA 4YFOA 1L1IA 3VSTA 4XR6A 3AK5A 1PXZA 3LYCA 2INVA 3H09A 3LMWA 4XMYA 1O8HA 1H80A 1HF2A 2BM6A 1LLZA 4XLFA 1OFLA 1IDKA 4XKVA 3SUCA 2XTXA 2YUHA 1QA3A 3BH6B 5JLVC 1XG2A 2J8IA 4XOTA 3PSZA 2J8KA 1TYUA 4W8RA 1BN8A 1K5CA 4Z06A 1VBLA 4XKWA 1IB4A 2G0YA 4Z03A 2EWEA 3GQ8A 1JRGA 4OM9A 1KCDA 1QCXA 2O0WA 1QA2A 1QRCA 1O8IA 2IQ7A 2NSPA 3GRHA 3VSVA 2W7ZA 2O6WA 4OJPA 3PETA 4W8QA 4C2LA 2XTYA 3ML3A 4XLHA 2VJJA 2BM7A 3ZSCA 2IOUG 5C1CA 4YZQA 2VBEA 4XLAA 3GQAA 3P4GA 4XLCA 3SZEA 4YDTA 4W8SA 4YCQA 1OFEA 2UVEA 4U49A 3EQNA 2QXZA 3N90A 4XOPA 1HG8A 3VSUA 4AVZA 4Z05A 3TH0A 1BHEA 4XN3A 4XQFA 2PYHA 4EW9A 1O8LA 4KH3A 3VMVA 1O8JA 1PLUA 1IDJA
chains in the Genus database with same CATH topology
2BX6A 1DABA 2BM4A 3N6ZA 4OM9A 4JRAC 1TYWA 1QA2A 1QRCA 4OJOA 3BH7B 1TYXA 1QQ1A 1TYVA 1TSPA 2XC1A 2W7ZA 1K8FA 4V02C 1CLWA 3PETA 4OPWA 4OJPA 3ML3A 5JMCB 3LJYA 2BM7A 2IOUG 3AK5A 2VFPA 2V5IA 3P4GA 2VFMA 2VFNA 3SYJA 3LYCA 3SZEA 2B0RA 1KQ5A 3H09A 3JX8A 4OJ6A 1QA1A 1HF2A 2BM6A 1QRBA 2F3LA 3N90A 2VFOA 4OJ5A 2YUHA 1QA3A 2BM5A 3BH6B 5JLVC 1WXRA 2J8IA 3TH0A 1TYUA 4KH3A 3RIQA 1K4ZA 2VFQA 2G0YA 4OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  4OPW A;  3PET A;  3LJY A;  3LYC A; 
#chains in the Genus database with same CATH topology
 1DAB A;  3N6Z A;  3JUR A;  4URR A;  2NZM A;  1OFD A;  4XL9 A;  4YZX A;  1KTW A;  3KRG A;  3SY2 A;  2X3H A;  2QX3 A;  1OFM A;  1TSP A;  2XC1 A;  3B8Y A;  1CZF A;  1PE9 A;  4V02 C;  4HWV A;  1GQ8 A;  4XN0 A;  1RWR A;  3WWG A;  2V5I A;  3SYJ A;  2VFM A;  2VFN A;  4OZZ A;  3ZPP A;  3JX8 A;  2O0V A;  4OJ6 A;  1EA0 A;  1QRB A;  2F3L A;  4YZA A;  3GQ9 A;  4YZ0 A;  4XLE A;  2QZA A;  2BM5 A;  2NT9 A;  5C1E A;  1WXR A;  2PEC A;  1IA5 A;  1X0C A;  3NB2 A;  1K4Z A;  4XON A;  4YEJ A;  2VFQ A;  1O88 A;  1O8M A;  2BX6 A;  4OJL A;  2BM4 A;  2O17 A;  4PMH A;  3VMW A;  4YEI A;  2NTQ A;  2O04 A;  1TYW A;  2UVF A;  1LM1 A;  4OJO A;  3BH7 B;  1O8D A;  1O8K A;  2QYU A;  4OZY A;  1CLW A;  4OPW A;  2XT2 A;  4U4B A;  1OGM X;  3LJY A;  3PSS A;  3T9G A;  4XM3 A;  2XT4 A;  4MR0 A;  1WMR A;  2VFP A;  2X6X A;  4MXN A;  2NTP A;  1KCC A;  3UW0 A;  1KQ5 A;  2B0R A;  1RMG A;  2BSP A;  4I84 A;  1AIR A;  2PYG A;  2NTB A;  1QA1 A;  2NT6 A;  3FY3 A;  2X6W A;  4W8T A;  4YC5 A;  3EQO A;  2VFO A;  3NAW A;  2VBM A;  4OJ5 A;  1JTA A;  1LLW A;  3B4N A;  5AMV A;  1DBG A;  2VBK A;  1NHC A;  1EZG A;  3DU1 X;  1O8G A;  1EE6 A;  4NK8 A;  2QY1 A;  4XOR A;  1O8F A;  2O1D A;  4YEL A;  4XNF A;  5DNS A;  3RIQ A;  4NK6 A;  1RU4 A;  1O8E A;  4JRA C;  2VJI A;  2ODL A;  1TYX A;  1QQ1 A;  1TYV A;  2INU A;  2X85 A;  1OOC A;  1K8F A;  2NST A;  2XTW A;  3B90 A;  3GQ7 A;  3SQV A;  1DBO A;  5JMC B;  1OGO X;  1QJV A;  2X6Y A;  2Z8G A;  4YFO A;  1L1I A;  3VST A;  4XR6 A;  3AK5 A;  1PXZ A;  3LYC A;  2INV A;  3H09 A;  3LMW A;  4XMY A;  1O8H A;  1H80 A;  1HF2 A;  2BM6 A;  1LLZ A;  4XLF A;  1OFL A;  1IDK A;  4XKV A;  3SUC A;  2XTX A;  2YUH A;  1QA3 A;  3BH6 B;  5JLV C;  1XG2 A;  2J8I A;  4XOT A;  3PSZ A;  2J8K A;  1TYU A;  4W8R A;  1BN8 A;  1K5C A;  4Z06 A;  1VBL A;  4XKW A;  1IB4 A;  2G0Y A;  4Z03 A;  2EWE A;  3GQ8 A;  1JRG A;  4OM9 A;  1KCD A;  1QCX A;  2O0W A;  1QA2 A;  1QRC A;  1O8I A;  2IQ7 A;  2NSP A;  3GRH A;  3VSV A;  2W7Z A;  2O6W A;  4OJP A;  3PET A;  4W8Q A;  4C2L A;  2XTY A;  3ML3 A;  4XLH A;  2VJJ A;  2BM7 A;  3ZSC A;  2IOU G;  5C1C A;  4YZQ A;  2VBE A;  4XLA A;  3GQA A;  3P4G A;  4XLC A;  3SZE A;  4YDT A;  4W8S A;  4YCQ A;  1OFE A;  2UVE A;  4U49 A;  3EQN A;  2QXZ A;  3N90 A;  4XOP A;  1HG8 A;  3VSU A;  4AVZ A;  4Z05 A;  3TH0 A;  1BHE A;  4XN3 A;  4XQF A;  2PYH A;  4EW9 A;  1O8L A;  4KH3 A;  3VMV A;  1O8J A;  1PLU A;  1IDJ A; 
#chains in the Genus database with same CATH homology
 2BX6 A;  1DAB A;  2BM4 A;  3N6Z A;  4OM9 A;  4JRA C;  1TYW A;  1QA2 A;  1QRC A;  4OJO A;  3BH7 B;  1TYX A;  1QQ1 A;  1TYV A;  1TSP A;  2XC1 A;  2W7Z A;  1K8F A;  4V02 C;  1CLW A;  3PET A;  4OPW A;  4OJP A;  3ML3 A;  5JMC B;  3LJY A;  2BM7 A;  2IOU G;  3AK5 A;  2VFP A;  2V5I A;  3P4G A;  2VFM A;  2VFN A;  3SYJ A;  3LYC A;  3SZE A;  2B0R A;  1KQ5 A;  3H09 A;  3JX8 A;  4OJ6 A;  1QA1 A;  1HF2 A;  2BM6 A;  1QRB A;  2F3L A;  3N90 A;  2VFO A;  4OJ5 A;  2YUH A;  1QA3 A;  2BM5 A;  3BH6 B;  5JLV C;  1WXR A;  2J8I A;  3TH0 A;  1TYU A;  4KH3 A;  3RIQ A;  1K4Z A;  2VFQ A;  2G0Y A;  4OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...