5JMCB

Receptor binding domain of botulinum neurotoxin a in complex with rat sv2c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
DKYANFSINFTMENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFENTDFEPYKFIDSEFQNCSFLHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
molecule keywords Botulinum neurotoxin type A
total genus 36
structure length 91
sequence length 91
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jmcB00
2G0YA 2BM6A 3N90A 2BM7A 2BM5A 5JMCB 2W7ZA 4JRAC 2F3LA 2J8IA 5JLVC 2BM4A
chains in the Genus database with same CATH superfamily
3JX8A 4PMHA 2NSTA 2X6WA 4W8TA 5JMCB 4U49A 2ODLA 1O8IA 1HF2A 1O8MA 4XOTA 2BM6A 3SUCA 3ZPPA 4XR6A 1RU4A 1XG2A 4MXNA 4NK6A 2O0WA 4HWVA 4YZQA 3VSUA 4YEIA 2VFOA 4YELA 1OGMX 4XKVA 4I84A 1HG8A 1DBOA 1LLZA 1WMRA 2XTWA 3EQNA 3UW0A 4YFOA 1EZGA 1QA1A 2V5IA 1O8GA 3ZSCA 1X0CA 1LM1A 2XTYA 1K4ZA 2INUA 2QY1A 2W7ZA 2VFNA 3P4GA 2VBEA 2VJJA 4URRA 2NTBA 4OJLA 1O8EA 1EE6A 3B90A 1QQ1A 4NK8A 2IOUG 3LMWA 3LJYA 2BSPA 2NZMA 4AVZA 1JTAA 2UVFA 2XT4A 2VFPA 3ML3A 3PSZA 4YZXA 2XTXA 2EWEA 1O8FA 2UVEA 3GQAA 4OJOA 1K5CA 4YZAA 3GQ9A 1H80A 5AMVA 3BH7B 4XLEA 4XMYA 4EW9A 1AIRA 1WXRA 3PSSA 4OZYA 1EA0A 2Z8GA 2O0VA 3VSVA 2G0YA 3N6ZA 3N90A 3VMVA 1KQ5A 1O8KA 3BH6B 2XC1A 2J8KA 4XN0A 4YC5A 1QA3A 4OJ6A 1O8LA 3GQ7A 2IQ7A 1OFMA 2QX3A 1OFDA 2VJIA 1CZFA 4XLAA 2VBMA 2X6YA 3SQVA 2VBKA 1IB4A 4XM3A 1KCCA 2BM7A 1GQ8A 4YDTA 3GRHA 4Z03A 3PETA 1PXZA 4XLFA 1O8JA 2X6XA 2NT9A 1KCDA 4XOPA 3SYJA 3AK5A 1O8DA 1TSPA 4YZ0A 1K8FA 1BHEA 3B8YA 4OJ5A 4YEJA 4OJPA 4KH3A 4W8QA 2QXZA 2INVA 4W8RA 3NAWA 1QA2A 4XN3A 1QCXA 1VBLA 2O1DA 3B4NA 2YUHA 4C2LA 1TYVA 2PYHA 1IDJA 1OFEA 4JRAC 4XLHA 2XT2A 1QJVA 1RMGA 1JRGA 1PLUA 4XNFA 3LYCA 3VMWA 1DABA 4XKWA 1OFLA 1TYUA 2X85A 3KRGA 4XLCA 1KTWA 3VSTA 4XONA 2O17A 5C1EA 1DBGA 2NTPA 2QYUA 3DU1X 2F3LA 1QRCA 2J8IA 2NT6A 2O04A 2QZAA 2VFQA 4OM9A 4XORA 1OOCA 1CLWA 1TYWA 3TH0A 1L1IA 1RWRA 2VFMA 5C1CA 3SY2A 2BM5A 3SZEA 3WWGA 5DNSA 3H09A 4MR0A 3GQ8A 2NSPA 2PYGA 4V02C 2PECA 2B0RA 1LLWA 4Z06A 1TYXA 1BN8A 3FY3A 4Z05A 1OGOX 1QRBA 3NB2A 5JLVC 4YCQA 3T9GA 2NTQA 4OPWA 4W8SA 1PE9A 4OZZA 4U4BA 1O8HA 1IA5A 1IDKA 1NHCA 1O88A 2X3HA 3JURA 2BM4A 4XL9A 3EQOA 2O6WA 2BX6A 3RIQA 4XQFA
chains in the Genus database with same CATH topology
4OJLA 3JX8A 1QQ1A 2IOUG 2BM7A 5JMCB 3LJYA 2F3LA 1QRCA 2J8IA 3PETA 4OM9A 2VFQA 1CLWA 1HF2A 1TYWA 2BM6A 2VFPA 2VFMA 3ML3A 3TH0A 2BM5A 3RIQA 3SZEA 3SYJA 3AK5A 3H09A 1TSPA 1K8FA 4OJOA 4V02C 2VFOA 2B0RA 4OJ5A 4OJPA 4KH3A 1QA2A 1TYXA 3BH7B 1QRBA 2YUHA 1TYVA 4JRAC 5JLVC 1WXRA 4OPWA 1QA1A 2V5IA 2G0YA 3N6ZA 3N90A 1KQ5A 3BH6B 1K4ZA 2XC1A 3LYCA 1QA3A 2W7ZA 4OJ6A 2VFNA 3P4GA 1DABA 2BM4A 2BX6A 1TYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0Y A;  2BM6 A;  3N90 A;  2BM7 A;  2BM5 A;  5JMC B;  2W7Z A;  4JRA C;  2F3L A;  2J8I A;  5JLV C;  2BM4 A; 
#chains in the Genus database with same CATH topology
 3JX8 A;  4PMH A;  2NST A;  2X6W A;  4W8T A;  5JMC B;  4U49 A;  2ODL A;  1O8I A;  1HF2 A;  1O8M A;  4XOT A;  2BM6 A;  3SUC A;  3ZPP A;  4XR6 A;  1RU4 A;  1XG2 A;  4MXN A;  4NK6 A;  2O0W A;  4HWV A;  4YZQ A;  3VSU A;  4YEI A;  2VFO A;  4YEL A;  1OGM X;  4XKV A;  4I84 A;  1HG8 A;  1DBO A;  1LLZ A;  1WMR A;  2XTW A;  3EQN A;  3UW0 A;  4YFO A;  1EZG A;  1QA1 A;  2V5I A;  1O8G A;  3ZSC A;  1X0C A;  1LM1 A;  2XTY A;  1K4Z A;  2INU A;  2QY1 A;  2W7Z A;  2VFN A;  3P4G A;  2VBE A;  2VJJ A;  4URR A;  2NTB A;  4OJL A;  1O8E A;  1EE6 A;  3B90 A;  1QQ1 A;  4NK8 A;  2IOU G;  3LMW A;  3LJY A;  2BSP A;  2NZM A;  4AVZ A;  1JTA A;  2UVF A;  2XT4 A;  2VFP A;  3ML3 A;  3PSZ A;  4YZX A;  2XTX A;  2EWE A;  1O8F A;  2UVE A;  3GQA A;  4OJO A;  1K5C A;  4YZA A;  3GQ9 A;  1H80 A;  5AMV A;  3BH7 B;  4XLE A;  4XMY A;  4EW9 A;  1AIR A;  1WXR A;  3PSS A;  4OZY A;  1EA0 A;  2Z8G A;  2O0V A;  3VSV A;  2G0Y A;  3N6Z A;  3N90 A;  3VMV A;  1KQ5 A;  1O8K A;  3BH6 B;  2XC1 A;  2J8K A;  4XN0 A;  4YC5 A;  1QA3 A;  4OJ6 A;  1O8L A;  3GQ7 A;  2IQ7 A;  1OFM A;  2QX3 A;  1OFD A;  2VJI A;  1CZF A;  4XLA A;  2VBM A;  2X6Y A;  3SQV A;  2VBK A;  1IB4 A;  4XM3 A;  1KCC A;  2BM7 A;  1GQ8 A;  4YDT A;  3GRH A;  4Z03 A;  3PET A;  1PXZ A;  4XLF A;  1O8J A;  2X6X A;  2NT9 A;  1KCD A;  4XOP A;  3SYJ A;  3AK5 A;  1O8D A;  1TSP A;  4YZ0 A;  1K8F A;  1BHE A;  3B8Y A;  4OJ5 A;  4YEJ A;  4OJP A;  4KH3 A;  4W8Q A;  2QXZ A;  2INV A;  4W8R A;  3NAW A;  1QA2 A;  4XN3 A;  1QCX A;  1VBL A;  2O1D A;  3B4N A;  2YUH A;  4C2L A;  1TYV A;  2PYH A;  1IDJ A;  1OFE A;  4JRA C;  4XLH A;  2XT2 A;  1QJV A;  1RMG A;  1JRG A;  1PLU A;  4XNF A;  3LYC A;  3VMW A;  1DAB A;  4XKW A;  1OFL A;  1TYU A;  2X85 A;  3KRG A;  4XLC A;  1KTW A;  3VST A;  4XON A;  2O17 A;  5C1E A;  1DBG A;  2NTP A;  2QYU A;  3DU1 X;  2F3L A;  1QRC A;  2J8I A;  2NT6 A;  2O04 A;  2QZA A;  2VFQ A;  4OM9 A;  4XOR A;  1OOC A;  1CLW A;  1TYW A;  3TH0 A;  1L1I A;  1RWR A;  2VFM A;  5C1C A;  3SY2 A;  2BM5 A;  3SZE A;  3WWG A;  5DNS A;  3H09 A;  4MR0 A;  3GQ8 A;  2NSP A;  2PYG A;  4V02 C;  2PEC A;  2B0R A;  1LLW A;  4Z06 A;  1TYX A;  1BN8 A;  3FY3 A;  4Z05 A;  1OGO X;  1QRB A;  3NB2 A;  5JLV C;  4YCQ A;  3T9G A;  2NTQ A;  4OPW A;  4W8S A;  1PE9 A;  4OZZ A;  4U4B A;  1O8H A;  1IA5 A;  1IDK A;  1NHC A;  1O88 A;  2X3H A;  3JUR A;  2BM4 A;  4XL9 A;  3EQO A;  2O6W A;  2BX6 A;  3RIQ A;  4XQF A; 
#chains in the Genus database with same CATH homology
 4OJL A;  3JX8 A;  1QQ1 A;  2IOU G;  2BM7 A;  5JMC B;  3LJY A;  2F3L A;  1QRC A;  2J8I A;  3PET A;  4OM9 A;  2VFQ A;  1CLW A;  1HF2 A;  1TYW A;  2BM6 A;  2VFP A;  2VFM A;  3ML3 A;  3TH0 A;  2BM5 A;  3RIQ A;  3SZE A;  3SYJ A;  3AK5 A;  3H09 A;  1TSP A;  1K8F A;  4OJO A;  4V02 C;  2VFO A;  2B0R A;  4OJ5 A;  4OJP A;  4KH3 A;  1QA2 A;  1TYX A;  3BH7 B;  1QRB A;  2YUH A;  1TYV A;  4JRA C;  5JLV C;  1WXR A;  4OPW A;  1QA1 A;  2V5I A;  2G0Y A;  3N6Z A;  3N90 A;  1KQ5 A;  3BH6 B;  1K4Z A;  2XC1 A;  3LYC A;  1QA3 A;  2W7Z A;  4OJ6 A;  2VFN A;  3P4G A;  1DAB A;  2BM4 A;  2BX6 A;  1TYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...