5JMCB

Receptor binding domain of botulinum neurotoxin a in complex with rat sv2c
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
DKYANFSINFTMENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFENTDFEPYKFIDSEFQNCSFLHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Botulinum neurotoxin type A
publication title N-linked glycosylation of SV2 is required for binding and uptake of botulinum neurotoxin A.
pubmed doi rcsb
source organism Clostridium botulinum
total genus 36
structure length 91
sequence length 91
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.100 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 5jmcB00
5JLVC 2BM7A 5JMCB 3N90A 2J8IA 2BM4A 2G0YA 2BM6A 4JRAC 2W7ZA 2BM5A 2F3LA
chains in the Genus database with same CATH superfamily
2QY1A 2V5IA 2Z8GA 4YDTA 1VBLA 1O8IA 1RMGA 1LLZA 3PSZA 5C1CA 3LJYA 1IDKA 3GQ9A 4XR6A 5C1EA 3UW0A 3ZPPA 1TSPA 1KQ5A 2ODLA 2PYHA 2VFNA 3VMVA 4YZ0A 4XORA 2VBMA 1O8HA 2QYUA 4Z05A 2BM4A 2VBKA 2VJIA 2VJJA 3GQAA 4OJ6A 5JLVC 2IOUG 3NAWA 2O0WA 4Z03A 1O8MA 2UVFA 1HG8A 4YCQA 2O04A 1DABA 1BHEA 4W8TA 1TYXA 4XLCA 1O8DA 1EA0A 2QZAA 2O0VA 2QXZA 2XC1A 1GQ8A 1BN8A 4XM3A 3N90A 1DBOA 1X0CA 2UVEA 2XT2A 3LMWA 3SQVA 1EE6A 1RWRA 4HWVA 4OZYA 3TH0A 2J8KA 1H80A 2O17A 4AVZA 1OOCA 2NTPA 2NT6A 2O1DA 3FY3A 4YEJA 3T9GA 2NTQA 2XT4A 4PMHA 1O88A 2XTYA 4OZZA 2PECA 4OJOA 4XL9A 2W7ZA 3EQOA 1OGOX 4Z06A 1QJVA 4XLAA 1KCDA 4OJPA 4XLEA 3JURA 4NK8A 3NB2A 4EW9A 1HF2A 3SY2A 4I84A 3SZEA 1O8GA 1OFLA 1DBGA 4OJ5A 1QRCA 2VBEA 1WXRA 3LYCA 3VSUA 3WWGA 1KCCA 4XKWA 2NTBA 4U4BA 1EZGA 3B4NA 1QA1A 3JX8A 2X6XA 5JMCB 4KH3A 3VMWA 3GRHA 2PYGA 2VFOA 1WMRA 2BM6A 4NK6A 1OGMX 4XMYA 2BSPA 4OJLA 4YEIA 2XTWA 3BH7B 3PETA 4OM9A 4YFOA 5AMVA 1OFDA 1PXZA 3GQ7A 4C2LA 3PSSA 1CLWA 1NHCA 2QX3A 1QA2A 1IB4A 2VFPA 3VSVA 4XOTA 4W8QA 1K4ZA 2YUHA 2G0YA 4U49A 1LLWA 5DNSA 2B0RA 1OFMA 3N6ZA 1TYWA 2BM5A 3H09A 4YZAA 3ZSCA 3B8YA 1L1IA 2O6WA 3EQNA 4XN3A 1OFEA 4YZXA 2J8IA 4W8SA 4XOPA 4W8RA 1K5CA 4XN0A 2XTXA 1O8EA 4MXNA 4MR0A 2INVA 1CZFA 2BM7A 3SUCA 2X6WA 3AK5A 4XKVA 4OPWA 2IQ7A 3VSTA 1TYUA 2EWEA 1RU4A 1O8LA 1LM1A 2NZMA 2INUA 3RIQA 1TYVA 1QQ1A 2NT9A 4YZQA 4XNFA 3ML3A 1K8FA 2BX6A 1KTWA 2X3HA 1XG2A 3P4GA 1O8KA 1JRGA 3SYJA 2NSTA 2X6YA 3GQ8A 3B90A 1QCXA 3KRGA 4XONA 4XLFA 4JRAC 4URRA 1AIRA 2X85A 2VFMA 2VFQA 2NSPA 3DU1X 1O8FA 1PLUA 4V02C 4YC5A 1PE9A 1O8JA 4YELA 1QRBA 1QA3A 3BH6B 4XLHA 1IDJA 1IA5A 4XQFA 1JTAA 2F3LA
chains in the Genus database with same CATH topology
1QA1A 3JX8A 2V5IA 2XC1A 3AK5A 2BM7A 5JMCB 3N90A 4OPWA 4KH3A 1TYUA 2VFOA 2BM6A 4OJLA 3LJYA 3TH0A 3PETA 3BH7B 4OM9A 3RIQA 1TYVA 1QQ1A 1TSPA 1KQ5A 4OJOA 2VFNA 3ML3A 1K8FA 2BX6A 2W7ZA 1CLWA 3P4GA 3SYJA 1QA2A 2VFPA 4OJPA 1K4ZA 2YUHA 2BM4A 2G0YA 2B0RA 1HF2A 3N6ZA 4JRAC 3SZEA 1TYWA 2VFMA 2BM5A 2VFQA 3H09A 1QRCA 2IOUG 4OJ5A 4OJ6A 4V02C 5JLVC 3LYCA 1WXRA 1QRBA 2J8IA 1QA3A 1DABA 3BH6B 1TYXA 2F3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLV C;  2BM7 A;  5JMC B;  3N90 A;  2J8I A;  2BM4 A;  2G0Y A;  2BM6 A;  4JRA C;  2W7Z A;  2BM5 A;  2F3L A; 
#chains in the Genus database with same CATH topology
 2QY1 A;  2V5I A;  2Z8G A;  4YDT A;  1VBL A;  1O8I A;  1RMG A;  1LLZ A;  3PSZ A;  5C1C A;  3LJY A;  1IDK A;  3GQ9 A;  4XR6 A;  5C1E A;  3UW0 A;  3ZPP A;  1TSP A;  1KQ5 A;  2ODL A;  2PYH A;  2VFN A;  3VMV A;  4YZ0 A;  4XOR A;  2VBM A;  1O8H A;  2QYU A;  4Z05 A;  2BM4 A;  2VBK A;  2VJI A;  2VJJ A;  3GQA A;  4OJ6 A;  5JLV C;  2IOU G;  3NAW A;  2O0W A;  4Z03 A;  1O8M A;  2UVF A;  1HG8 A;  4YCQ A;  2O04 A;  1DAB A;  1BHE A;  4W8T A;  1TYX A;  4XLC A;  1O8D A;  1EA0 A;  2QZA A;  2O0V A;  2QXZ A;  2XC1 A;  1GQ8 A;  1BN8 A;  4XM3 A;  3N90 A;  1DBO A;  1X0C A;  2UVE A;  2XT2 A;  3LMW A;  3SQV A;  1EE6 A;  1RWR A;  4HWV A;  4OZY A;  3TH0 A;  2J8K A;  1H80 A;  2O17 A;  4AVZ A;  1OOC A;  2NTP A;  2NT6 A;  2O1D A;  3FY3 A;  4YEJ A;  3T9G A;  2NTQ A;  2XT4 A;  4PMH A;  1O88 A;  2XTY A;  4OZZ A;  2PEC A;  4OJO A;  4XL9 A;  2W7Z A;  3EQO A;  1OGO X;  4Z06 A;  1QJV A;  4XLA A;  1KCD A;  4OJP A;  4XLE A;  3JUR A;  4NK8 A;  3NB2 A;  4EW9 A;  1HF2 A;  3SY2 A;  4I84 A;  3SZE A;  1O8G A;  1OFL A;  1DBG A;  4OJ5 A;  1QRC A;  2VBE A;  1WXR A;  3LYC A;  3VSU A;  3WWG A;  1KCC A;  4XKW A;  2NTB A;  4U4B A;  1EZG A;  3B4N A;  1QA1 A;  3JX8 A;  2X6X A;  5JMC B;  4KH3 A;  3VMW A;  3GRH A;  2PYG A;  2VFO A;  1WMR A;  2BM6 A;  4NK6 A;  1OGM X;  4XMY A;  2BSP A;  4OJL A;  4YEI A;  2XTW A;  3BH7 B;  3PET A;  4OM9 A;  4YFO A;  5AMV A;  1OFD A;  1PXZ A;  3GQ7 A;  4C2L A;  3PSS A;  1CLW A;  1NHC A;  2QX3 A;  1QA2 A;  1IB4 A;  2VFP A;  3VSV A;  4XOT A;  4W8Q A;  1K4Z A;  2YUH A;  2G0Y A;  4U49 A;  1LLW A;  5DNS A;  2B0R A;  1OFM A;  3N6Z A;  1TYW A;  2BM5 A;  3H09 A;  4YZA A;  3ZSC A;  3B8Y A;  1L1I A;  2O6W A;  3EQN A;  4XN3 A;  1OFE A;  4YZX A;  2J8I A;  4W8S A;  4XOP A;  4W8R A;  1K5C A;  4XN0 A;  2XTX A;  1O8E A;  4MXN A;  4MR0 A;  2INV A;  1CZF A;  2BM7 A;  3SUC A;  2X6W A;  3AK5 A;  4XKV A;  4OPW A;  2IQ7 A;  3VST A;  1TYU A;  2EWE A;  1RU4 A;  1O8L A;  1LM1 A;  2NZM A;  2INU A;  3RIQ A;  1TYV A;  1QQ1 A;  2NT9 A;  4YZQ A;  4XNF A;  3ML3 A;  1K8F A;  2BX6 A;  1KTW A;  2X3H A;  1XG2 A;  3P4G A;  1O8K A;  1JRG A;  3SYJ A;  2NST A;  2X6Y A;  3GQ8 A;  3B90 A;  1QCX A;  3KRG A;  4XON A;  4XLF A;  4JRA C;  4URR A;  1AIR A;  2X85 A;  2VFM A;  2VFQ A;  2NSP A;  3DU1 X;  1O8F A;  1PLU A;  4V02 C;  4YC5 A;  1PE9 A;  1O8J A;  4YEL A;  1QRB A;  1QA3 A;  3BH6 B;  4XLH A;  1IDJ A;  1IA5 A;  4XQF A;  1JTA A;  2F3L A; 
#chains in the Genus database with same CATH homology
 1QA1 A;  3JX8 A;  2V5I A;  2XC1 A;  3AK5 A;  2BM7 A;  5JMC B;  3N90 A;  4OPW A;  4KH3 A;  1TYU A;  2VFO A;  2BM6 A;  4OJL A;  3LJY A;  3TH0 A;  3PET A;  3BH7 B;  4OM9 A;  3RIQ A;  1TYV A;  1QQ1 A;  1TSP A;  1KQ5 A;  4OJO A;  2VFN A;  3ML3 A;  1K8F A;  2BX6 A;  2W7Z A;  1CLW A;  3P4G A;  3SYJ A;  1QA2 A;  2VFP A;  4OJP A;  1K4Z A;  2YUH A;  2BM4 A;  2G0Y A;  2B0R A;  1HF2 A;  3N6Z A;  4JRA C;  3SZE A;  1TYW A;  2VFM A;  2BM5 A;  2VFQ A;  3H09 A;  1QRC A;  2IOU G;  4OJ5 A;  4OJ6 A;  4V02 C;  5JLV C;  3LYC A;  1WXR A;  1QRB A;  2J8I A;  1QA3 A;  1DAB A;  3BH6 B;  1TYX A;  2F3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...