2VBEA

Tailspike protein of bacteriophage sf6
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
510
structure length
510
Chain Sequence
b'FGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE-PROTEIN
publication title An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6.
pubmed doi rcsb
source organism Bacteriophage sfvi
molecule tags Viral protein
total genus 185
structure length 510
sequence length 510
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbeA00
1IDJA 1H80A 4URRA 3SUCA 4YEJA 3VSUA 2INUA 5AMVA 1PE9A 4W8QA 4W8RA 1OOCA 2X6YA 2VBMA 1OFLA 2NT9A 4U49A 3B90A 3VSTA 1VBLA 4XM3A 1QCXA 1O8FA 1IDKA 2NSTA 2PYHA 4MR0A 4XOTA 1OGOX 4OZYA 1IA5A 3GQ9A 4XL9A 1NHCA 2EWEA 4YZXA 1O8LA 1O8DA 2QXZA 1KTWA 4Z06A 3B8YA 3EQOA 2INVA 2VBKA 1PXZA 4XOPA 3FY3A 1IB4A 4NK6A 4Z03A 1K5CA 4XLAA 3GRHA 2Z8GA 4XNFA 4YELA 2UVEA 4OZZA 2BSPA 2X6WA 4XLFA 3ZSCA 2O17A 1QJVA 4EW9A 2NZMA 4W8SA 4AVZA 4XR6A 1O8HA 2X3HA 1O8KA 4OJPA 4I84A 2NTBA 4HWVA 1CZFA 1BHEA 3GQ7A 3VSVA 1BN8A 3T9GA 3GQAA 3WWGA 4XLEA 3ZPPA 1KCCA 1X0CA 3EQNA 3VMWA 1AIRA 4YZQA 2IQ7A 1O8EA 3VMVA 1O8IA 4XKVA 4XQFA 1OFMA 4XLHA 3UW0A 4XMYA 4XONA 1EE6A 1DBGA 2O0WA 3KRGA 1XG2A 2VJJA 2O1DA 5C1CA 2VBEA 3B4NA 4W8TA 4OJ5A 5C1EA 4C2LA 4XN3A 2QY1A 2VJIA 2X85A 1JTAA 4XN0A 2UVFA 1RMGA 3GQ8A 4NK8A 1JRGA 3LMWA 2O04A 2ODLA 1KCDA 3JURA 1PLUA 1HG8A 2O0VA 2PECA 4U4BA 1GQ8A 2NTPA 2NTQA 2QX3A 4PMHA 2NSPA 1RWRA 1DBOA 1RU4A 1O8GA 4XKWA 4XORA 1O8JA 4OJLA 2X6XA 4OJ6A 1OGMX 1O88A 4XLCA 2NT6A 1WMRA 1O8MA 4YZ0A 4OJOA 4YZAA 4MXNA 2PYGA 4Z05A
chains in the Genus database with same CATH superfamily
1IDJA 1H80A 1TYVA 3BH7B 1OFEA 4URRA 3SUCA 2BM7A 4YEJA 3VSUA 2INUA 5AMVA 1PE9A 3ML3A 2QZAA 4W8QA 1QA1A 2XTWA 4W8RA 1OOCA 2X6YA 4Z05A 2VBMA 3LYCA 4KH3A 1LM1A 1OFLA 2YUHA 2NT9A 4U49A 5JMCB 3B90A 2VFMA 3SYJA 3VSTA 1VBLA 4XM3A 1K8FA 1QCXA 5JLVC 2O6WA 1O8FA 4YC5A 1IDKA 2NSTA 2PYHA 4MR0A 4XOTA 1OGOX 4OZYA 1IA5A 3GQ9A 4MXNA 4XL9A 4YEIA 1NHCA 2EWEA 4YZXA 3PSSA 1O8LA 1O8DA 2XC1A 2QXZA 1KTWA 4Z06A 2VFNA 3B8YA 1KQ5A 3EQOA 2INVA 3N6ZA 2VBKA 1PXZA 4XOPA 3FY3A 1IB4A 4NK6A 5DNSA 2VFPA 4Z03A 1DABA 1K5CA 1QA2A 1L1IA 2B0RA 4XLAA 3GRHA 2Z8GA 4XNFA 4YELA 1CLWA 1EZGA 1OFDA 2UVEA 2BSPA 4OZZA 2V5IA 2X6WA 4OM9A 1QQ1A 4XLFA 3ZSCA 2O17A 1QJVA 4EW9A 3AK5A 2NZMA 4W8SA 4AVZA 4XR6A 1O8HA 2X3HA 1O8KA 4OJPA 4I84A 2NTBA 4HWVA 1LLZA 1K4ZA 1CZFA 1BHEA 3GQ7A 3VSVA 1QRBA 3BH6B 1BN8A 3T9GA 3GQAA 3WWGA 3SZEA 4XLEA 1EA0A 3ZPPA 1KCCA 1X0CA 3EQNA 3VMWA 1WXRA 1AIRA 4YZQA 2IQ7A 2W7ZA 3P4GA 1O8EA 4JRAC 4OPWA 4YCQA 3VMVA 1O8IA 3LJYA 4XKVA 3TH0A 1OFMA 1LLWA 3H09A 4XLHA 4XQFA 3UW0A 4XMYA 4XONA 1EE6A 1DBGA 2BM5A 2J8KA 2O0WA 1XG2A 2VJJA 3KRGA 2O1DA 5C1CA 2VBEA 3B4NA 4W8TA 4OJ5A 5C1EA 1QA3A 2XT2A 3PETA 4C2LA 4XN3A 2QY1A 3SQVA 2VJIA 2X85A 2J8IA 1JTAA 4V02C 3N90A 4XN0A 1QRCA 2UVFA 1RMGA 3NB2A 3GQ8A 2BX6A 4NK8A 4YFOA 2G0YA 1TYXA 1JRGA 3LMWA 2O04A 2ODLA 3NAWA 1KCDA 3JURA 1PLUA 2VFQA 1HG8A 2IOUG 2O0VA 4YDTA 2PECA 4U4BA 1GQ8A 3SY2A 2NTPA 2NTQA 2QX3A 4PMHA 2NSPA 1RWRA 1DBOA 1RU4A 1O8GA 1TYUA 4XKWA 3JX8A 2XTYA 4XORA 3RIQA 2F3LA 1O8JA 2QYUA 2BM6A 4OJLA 2X6XA 4OJ6A 1TYWA 1OGMX 1O88A 3PSZA 2NT6A 2XTXA 4XLCA 1WMRA 3DU1X 1O8MA 4YZ0A 4OJOA 2BM4A 2VFOA 1HF2A 4YZAA 1TSPA 2PYGA 2XT4A
chains in the Genus database with same CATH topology
1IDJA 1H80A 4URRA 3SUCA 4YEJA 3VSUA 2INUA 5AMVA 1PE9A 4W8QA 4W8RA 1OOCA 2X6YA 2VBMA 1OFLA 2NT9A 4U49A 3B90A 3VSTA 1VBLA 4XM3A 1QCXA 1O8FA 1IDKA 2NSTA 2PYHA 4MR0A 4XOTA 1OGOX 4OZYA 1IA5A 3GQ9A 4XL9A 1NHCA 2EWEA 4YZXA 1O8LA 1O8DA 2QXZA 1KTWA 4Z06A 3B8YA 3EQOA 2INVA 2VBKA 1PXZA 4XOPA 3FY3A 1IB4A 4NK6A 4Z03A 1K5CA 4XLAA 3GRHA 2Z8GA 4XNFA 4YELA 2UVEA 4OZZA 2BSPA 2X6WA 4XLFA 3ZSCA 2O17A 1QJVA 4EW9A 2NZMA 4W8SA 4AVZA 4XR6A 1O8HA 2X3HA 1O8KA 4OJPA 4I84A 2NTBA 4HWVA 1CZFA 1BHEA 3GQ7A 3VSVA 1BN8A 3T9GA 3GQAA 3WWGA 4XLEA 3ZPPA 1KCCA 1X0CA 3EQNA 3VMWA 1AIRA 4YZQA 2IQ7A 1O8EA 3VMVA 1O8IA 4XKVA 4XQFA 1OFMA 4XLHA 3UW0A 4XMYA 4XONA 1EE6A 1DBGA 2O0WA 3KRGA 1XG2A 2VJJA 2O1DA 5C1CA 2VBEA 3B4NA 4W8TA 4OJ5A 5C1EA 4C2LA 4XN3A 2QY1A 2VJIA 2X85A 1JTAA 4XN0A 2UVFA 1RMGA 3GQ8A 4NK8A 1JRGA 3LMWA 2O04A 2ODLA 1KCDA 3JURA 1PLUA 1HG8A 2O0VA 2PECA 4U4BA 1GQ8A 2NTPA 2NTQA 2QX3A 4PMHA 2NSPA 1RWRA 1DBOA 1RU4A 1O8GA 4XKWA 4XORA 1O8JA 4OJLA 2X6XA 4OJ6A 1OGMX 1O88A 4XLCA 2NT6A 1WMRA 1O8MA 4YZ0A 4OJOA 4YZAA 4MXNA 2PYGA 4Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  1H80 A;  4URR A;  3SUC A;  4YEJ A;  3VSU A;  2INU A;  5AMV A;  1PE9 A;  4W8Q A;  4W8R A;  1OOC A;  2X6Y A;  2VBM A;  1OFL A;  2NT9 A;  4U49 A;  3B90 A;  3VST A;  1VBL A;  4XM3 A;  1QCX A;  1O8F A;  1IDK A;  2NST A;  2PYH A;  4MR0 A;  4XOT A;  1OGO X;  4OZY A;  1IA5 A;  3GQ9 A;  4XL9 A;  1NHC A;  2EWE A;  4YZX A;  1O8L A;  1O8D A;  2QXZ A;  1KTW A;  4Z06 A;  3B8Y A;  3EQO A;  2INV A;  2VBK A;  1PXZ A;  4XOP A;  3FY3 A;  1IB4 A;  4NK6 A;  4Z03 A;  1K5C A;  4XLA A;  3GRH A;  2Z8G A;  4XNF A;  4YEL A;  2UVE A;  4OZZ A;  2BSP A;  2X6W A;  4XLF A;  3ZSC A;  2O17 A;  1QJV A;  4EW9 A;  2NZM A;  4W8S A;  4AVZ A;  4XR6 A;  1O8H A;  2X3H A;  1O8K A;  4OJP A;  4I84 A;  2NTB A;  4HWV A;  1CZF A;  1BHE A;  3GQ7 A;  3VSV A;  1BN8 A;  3T9G A;  3GQA A;  3WWG A;  4XLE A;  3ZPP A;  1KCC A;  1X0C A;  3EQN A;  3VMW A;  1AIR A;  4YZQ A;  2IQ7 A;  1O8E A;  3VMV A;  1O8I A;  4XKV A;  4XQF A;  1OFM A;  4XLH A;  3UW0 A;  4XMY A;  4XON A;  1EE6 A;  1DBG A;  2O0W A;  3KRG A;  1XG2 A;  2VJJ A;  2O1D A;  5C1C A;  2VBE A;  3B4N A;  4W8T A;  4OJ5 A;  5C1E A;  4C2L A;  4XN3 A;  2QY1 A;  2VJI A;  2X85 A;  1JTA A;  4XN0 A;  2UVF A;  1RMG A;  3GQ8 A;  4NK8 A;  1JRG A;  3LMW A;  2O04 A;  2ODL A;  1KCD A;  3JUR A;  1PLU A;  1HG8 A;  2O0V A;  2PEC A;  4U4B A;  1GQ8 A;  2NTP A;  2NTQ A;  2QX3 A;  4PMH A;  2NSP A;  1RWR A;  1DBO A;  1RU4 A;  1O8G A;  4XKW A;  4XOR A;  1O8J A;  4OJL A;  2X6X A;  4OJ6 A;  1OGM X;  1O88 A;  4XLC A;  2NT6 A;  1WMR A;  1O8M A;  4YZ0 A;  4OJO A;  4YZA A;  4MXN A;  2PYG A;  4Z05 A; 
#chains in the Genus database with same CATH topology
 1IDJ A;  1H80 A;  1TYV A;  3BH7 B;  1OFE A;  4URR A;  3SUC A;  2BM7 A;  4YEJ A;  3VSU A;  2INU A;  5AMV A;  1PE9 A;  3ML3 A;  2QZA A;  4W8Q A;  1QA1 A;  2XTW A;  4W8R A;  1OOC A;  2X6Y A;  4Z05 A;  2VBM A;  3LYC A;  4KH3 A;  1LM1 A;  1OFL A;  2YUH A;  2NT9 A;  4U49 A;  5JMC B;  3B90 A;  2VFM A;  3SYJ A;  3VST A;  1VBL A;  4XM3 A;  1K8F A;  1QCX A;  5JLV C;  2O6W A;  1O8F A;  4YC5 A;  1IDK A;  2NST A;  2PYH A;  4MR0 A;  4XOT A;  1OGO X;  4OZY A;  1IA5 A;  3GQ9 A;  4MXN A;  4XL9 A;  4YEI A;  1NHC A;  2EWE A;  4YZX A;  3PSS A;  1O8L A;  1O8D A;  2XC1 A;  2QXZ A;  1KTW A;  4Z06 A;  2VFN A;  3B8Y A;  1KQ5 A;  3EQO A;  2INV A;  3N6Z A;  2VBK A;  1PXZ A;  4XOP A;  3FY3 A;  1IB4 A;  4NK6 A;  5DNS A;  2VFP A;  4Z03 A;  1DAB A;  1K5C A;  1QA2 A;  1L1I A;  2B0R A;  4XLA A;  3GRH A;  2Z8G A;  4XNF A;  4YEL A;  1CLW A;  1EZG A;  1OFD A;  2UVE A;  2BSP A;  4OZZ A;  2V5I A;  2X6W A;  4OM9 A;  1QQ1 A;  4XLF A;  3ZSC A;  2O17 A;  1QJV A;  4EW9 A;  3AK5 A;  2NZM A;  4W8S A;  4AVZ A;  4XR6 A;  1O8H A;  2X3H A;  1O8K A;  4OJP A;  4I84 A;  2NTB A;  4HWV A;  1LLZ A;  1K4Z A;  1CZF A;  1BHE A;  3GQ7 A;  3VSV A;  1QRB A;  3BH6 B;  1BN8 A;  3T9G A;  3GQA A;  3WWG A;  3SZE A;  4XLE A;  1EA0 A;  3ZPP A;  1KCC A;  1X0C A;  3EQN A;  3VMW A;  1WXR A;  1AIR A;  4YZQ A;  2IQ7 A;  2W7Z A;  3P4G A;  1O8E A;  4JRA C;  4OPW A;  4YCQ A;  3VMV A;  1O8I A;  3LJY A;  4XKV A;  3TH0 A;  1OFM A;  1LLW A;  3H09 A;  4XLH A;  4XQF A;  3UW0 A;  4XMY A;  4XON A;  1EE6 A;  1DBG A;  2BM5 A;  2J8K A;  2O0W A;  1XG2 A;  2VJJ A;  3KRG A;  2O1D A;  5C1C A;  2VBE A;  3B4N A;  4W8T A;  4OJ5 A;  5C1E A;  1QA3 A;  2XT2 A;  3PET A;  4C2L A;  4XN3 A;  2QY1 A;  3SQV A;  2VJI A;  2X85 A;  2J8I A;  1JTA A;  4V02 C;  3N90 A;  4XN0 A;  1QRC A;  2UVF A;  1RMG A;  3NB2 A;  3GQ8 A;  2BX6 A;  4NK8 A;  4YFO A;  2G0Y A;  1TYX A;  1JRG A;  3LMW A;  2O04 A;  2ODL A;  3NAW A;  1KCD A;  3JUR A;  1PLU A;  2VFQ A;  1HG8 A;  2IOU G;  2O0V A;  4YDT A;  2PEC A;  4U4B A;  1GQ8 A;  3SY2 A;  2NTP A;  2NTQ A;  2QX3 A;  4PMH A;  2NSP A;  1RWR A;  1DBO A;  1RU4 A;  1O8G A;  1TYU A;  4XKW A;  3JX8 A;  2XTY A;  4XOR A;  3RIQ A;  2F3L A;  1O8J A;  2QYU A;  2BM6 A;  4OJL A;  2X6X A;  4OJ6 A;  1TYW A;  1OGM X;  1O88 A;  3PSZ A;  2NT6 A;  2XTX A;  4XLC A;  1WMR A;  3DU1 X;  1O8M A;  4YZ0 A;  4OJO A;  2BM4 A;  2VFO A;  1HF2 A;  4YZA A;  1TSP A;  2PYG A;  2XT4 A; 
#chains in the Genus database with same CATH homology
 1IDJ A;  1H80 A;  4URR A;  3SUC A;  4YEJ A;  3VSU A;  2INU A;  5AMV A;  1PE9 A;  4W8Q A;  4W8R A;  1OOC A;  2X6Y A;  2VBM A;  1OFL A;  2NT9 A;  4U49 A;  3B90 A;  3VST A;  1VBL A;  4XM3 A;  1QCX A;  1O8F A;  1IDK A;  2NST A;  2PYH A;  4MR0 A;  4XOT A;  1OGO X;  4OZY A;  1IA5 A;  3GQ9 A;  4XL9 A;  1NHC A;  2EWE A;  4YZX A;  1O8L A;  1O8D A;  2QXZ A;  1KTW A;  4Z06 A;  3B8Y A;  3EQO A;  2INV A;  2VBK A;  1PXZ A;  4XOP A;  3FY3 A;  1IB4 A;  4NK6 A;  4Z03 A;  1K5C A;  4XLA A;  3GRH A;  2Z8G A;  4XNF A;  4YEL A;  2UVE A;  4OZZ A;  2BSP A;  2X6W A;  4XLF A;  3ZSC A;  2O17 A;  1QJV A;  4EW9 A;  2NZM A;  4W8S A;  4AVZ A;  4XR6 A;  1O8H A;  2X3H A;  1O8K A;  4OJP A;  4I84 A;  2NTB A;  4HWV A;  1CZF A;  1BHE A;  3GQ7 A;  3VSV A;  1BN8 A;  3T9G A;  3GQA A;  3WWG A;  4XLE A;  3ZPP A;  1KCC A;  1X0C A;  3EQN A;  3VMW A;  1AIR A;  4YZQ A;  2IQ7 A;  1O8E A;  3VMV A;  1O8I A;  4XKV A;  4XQF A;  1OFM A;  4XLH A;  3UW0 A;  4XMY A;  4XON A;  1EE6 A;  1DBG A;  2O0W A;  3KRG A;  1XG2 A;  2VJJ A;  2O1D A;  5C1C A;  2VBE A;  3B4N A;  4W8T A;  4OJ5 A;  5C1E A;  4C2L A;  4XN3 A;  2QY1 A;  2VJI A;  2X85 A;  1JTA A;  4XN0 A;  2UVF A;  1RMG A;  3GQ8 A;  4NK8 A;  1JRG A;  3LMW A;  2O04 A;  2ODL A;  1KCD A;  3JUR A;  1PLU A;  1HG8 A;  2O0V A;  2PEC A;  4U4B A;  1GQ8 A;  2NTP A;  2NTQ A;  2QX3 A;  4PMH A;  2NSP A;  1RWR A;  1DBO A;  1RU4 A;  1O8G A;  4XKW A;  4XOR A;  1O8J A;  4OJL A;  2X6X A;  4OJ6 A;  1OGM X;  1O88 A;  4XLC A;  2NT6 A;  1WMR A;  1O8M A;  4YZ0 A;  4OJO A;  4YZA A;  4MXN A;  2PYG A;  4Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...