2VBEA

Tailspike protein of bacteriophage sf6
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
510
structure length
510
Chain Sequence
FGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6.
pubmed doi rcsb
source organism Bacteriophage sfvi
molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
total genus 185
structure length 510
sequence length 510
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbeA00
2EWEA 3JURA 1QCXA 2NT6A 1OGMX 4YELA 4XQFA 2VJJA 1O8IA 4OJ5A 2QX3A 1O8KA 4W8QA 1QJVA 1O8HA 2VJIA 1O8JA 1OFLA 3B4NA 1IB4A 4W8RA 1IA5A 4Z03A 1EE6A 1GQ8A 4XLCA 1PLUA 4XL9A 5C1EA 2PYHA 1O8GA 1JRGA 3WWGA 1VBLA 1X0CA 2INVA 4I84A 4XOPA 1KCCA 1O8DA 4Z06A 1PXZA 4YZXA 3VSVA 2O1DA 1DBOA 4XN0A 3VSUA 4MXNA 3VSTA 4YEJA 1IDKA 1RU4A 4XOTA 4OJ6A 2NTPA 4NK6A 1AIRA 2X3HA 2X6YA 4XLHA 1NHCA 2Z8GA 4W8SA 2UVFA 2X85A 4XORA 4XMYA 4XLAA 2INUA 2NSTA 3EQNA 4PMHA 2NTQA 3KRGA 3GQ9A 3LMWA 4XKWA 4U49A 4W8TA 2VBEA 1JTAA 1OOCA 2NTBA 3GRHA 4YZQA 2QXZA 2VBMA 3UW0A 4OZZA 3EQOA 4EW9A 4XLFA 2IQ7A 4HWVA 1CZFA 1H80A 1O8LA 2ODLA 3GQ7A 2BSPA 4Z05A 2NZMA 4YZ0A 3ZSCA 4XN3A 3SUCA 4URRA 3ZPPA 1IDJA 3T9GA 3FY3A 4XKVA 1XG2A 3B8YA 4XM3A 1O8MA 4XR6A 1RMGA 2O0VA 1KTWA 2O0WA 1OFMA 4XNFA 2QY1A 1RWRA 5C1CA 1PE9A 4C2LA 1KCDA 1OGOX 1BHEA 3GQ8A 4U4BA 1HG8A 2VBKA 1BN8A 4YZAA 4NK8A 2O17A 3VMVA 3VMWA 1O88A 1K5CA 4XONA 4MR0A 2O04A 2PYGA 4OZYA 5AMVA 4AVZA 1DBGA 4OJPA 1O8FA 2PECA 1WMRA 2NT9A 2UVEA 3GQAA 1O8EA 4XLEA 4OJLA 2X6WA 2X6XA 2NSPA 4OJOA 3B90A
chains in the Genus database with same CATH superfamily
2EWEA 4JRAC 3JURA 1L1IA 1QCXA 2BX6A 2NT6A 1OGMX 3LJYA 3PETA 1QRCA 4YELA 2XTXA 2VJJA 1O8IA 4XQFA 4OJ5A 2QX3A 5DNSA 2IOUG 1O8KA 4W8QA 5JLVC 1QJVA 1O8HA 2VJIA 1O8JA 3N90A 1OFLA 3B4NA 1IB4A 3NAWA 3PSZA 4W8RA 2YUHA 1IA5A 3BH7B 4Z03A 1TYWA 1EE6A 1GQ8A 3PSSA 1PLUA 4XLCA 4XL9A 5C1EA 2PYHA 1O8GA 1JRGA 3WWGA 2J8IA 3BH6B 1QRBA 1VBLA 1X0CA 3TH0A 2INVA 4I84A 4XOPA 1KCCA 1O8DA 4Z06A 1PXZA 4YZXA 3VSVA 2O1DA 2QZAA 1DBOA 1KQ5A 2VFOA 4XN0A 2F3LA 3SQVA 3SYJA 3VSUA 4MXNA 3RIQA 3VSTA 2XTWA 2XC1A 4YEJA 1IDKA 1RU4A 3P4GA 4XOTA 4OJ6A 4YDTA 1TYVA 4YCQA 2NTPA 4NK6A 1AIRA 2J8KA 4KH3A 2X3HA 2O6WA 2VFNA 2X6YA 4XLHA 1TSPA 1OFDA 2V5IA 1QA1A 1NHCA 1WXRA 1EA0A 2Z8GA 4W8SA 2UVFA 2X85A 4XORA 4XMYA 4XLAA 2INUA 2NSTA 4V02C 3EQNA 4PMHA 2NTQA 5JMCB 3KRGA 3GQ9A 1TYXA 3LMWA 4XKWA 2XT4A 4U49A 4W8TA 2BM4A 2VBEA 3DU1X 1JTAA 2XT2A 1TYUA 1OOCA 2NTBA 3ML3A 3GRHA 4YZQA 2QXZA 2VBMA 2VFQA 3UW0A 4OZZA 3EQOA 3NB2A 4EW9A 1QA2A 1LLZA 4XLFA 2IQ7A 4HWVA 1CZFA 1H80A 1O8LA 2ODLA 1OFEA 1LLWA 3GQ7A 3N6ZA 2VFMA 2BSPA 4Z05A 2NZMA 4YZ0A 3ZSCA 1K4ZA 4XN3A 3SUCA 4URRA 2BM6A 3ZPPA 1IDJA 3T9GA 3FY3A 4XKVA 1XG2A 3H09A 2B0RA 3B8YA 1O8MA 4XM3A 4XR6A 4YEIA 1RMGA 4YC5A 2O0VA 1KTWA 1OFMA 2O0WA 3SZEA 4XNFA 2QY1A 1RWRA 5C1CA 1PE9A 3AK5A 4C2LA 1QA3A 1DABA 1KCDA 1OGOX 1BHEA 3GQ8A 4U4BA 1K8FA 2BM7A 1HG8A 3SY2A 2VBKA 1BN8A 4YZAA 4NK8A 2O17A 3VMVA 3VMWA 1O88A 1K5CA 4OPWA 4XONA 1EZGA 3LYCA 4MR0A 2O04A 2PYGA 4OZYA 4OM9A 5AMVA 1CLWA 1LM1A 2XTYA 4AVZA 1DBGA 2G0YA 4OJPA 1O8FA 2PECA 2W7ZA 1WMRA 1HF2A 2NT9A 2UVEA 1O8EA 2VFPA 3GQAA 3JX8A 4YFOA 4XLEA 4OJLA 2QYUA 2X6WA 2NSPA 2X6XA 2BM5A 4OJOA 1QQ1A 3B90A
chains in the Genus database with same CATH topology
2EWEA 3JURA 1QCXA 2NT6A 1OGMX 4YELA 4XQFA 2VJJA 1O8IA 4OJ5A 2QX3A 1O8KA 4W8QA 1QJVA 1O8HA 2VJIA 1O8JA 1OFLA 3B4NA 1IB4A 4W8RA 1IA5A 4Z03A 1EE6A 1GQ8A 4XLCA 1PLUA 4XL9A 5C1EA 2PYHA 1O8GA 1JRGA 3WWGA 1VBLA 1X0CA 2INVA 4I84A 4XOPA 1KCCA 1O8DA 4Z06A 1PXZA 4YZXA 3VSVA 2O1DA 1DBOA 4XN0A 3VSUA 4MXNA 3VSTA 4YEJA 1IDKA 1RU4A 4XOTA 4OJ6A 2NTPA 4NK6A 1AIRA 2X3HA 2X6YA 4XLHA 1NHCA 2Z8GA 4W8SA 2UVFA 2X85A 4XORA 4XMYA 4XLAA 2INUA 2NSTA 3EQNA 4PMHA 2NTQA 3KRGA 3GQ9A 3LMWA 4XKWA 4U49A 4W8TA 2VBEA 1JTAA 1OOCA 2NTBA 3GRHA 4YZQA 2QXZA 2VBMA 3UW0A 4OZZA 3EQOA 4EW9A 4XLFA 2IQ7A 4HWVA 1CZFA 1H80A 1O8LA 2ODLA 3GQ7A 2BSPA 4Z05A 2NZMA 4YZ0A 3ZSCA 4XN3A 3SUCA 4URRA 3ZPPA 1IDJA 3T9GA 3FY3A 4XKVA 1XG2A 3B8YA 4XM3A 1O8MA 4XR6A 1RMGA 2O0VA 1KTWA 2O0WA 1OFMA 4XNFA 2QY1A 1RWRA 5C1CA 1PE9A 4C2LA 1KCDA 1OGOX 1BHEA 3GQ8A 4U4BA 1HG8A 2VBKA 1BN8A 4YZAA 4NK8A 2O17A 3VMVA 3VMWA 1O88A 1K5CA 4XONA 4MR0A 2O04A 2PYGA 4OZYA 5AMVA 4AVZA 1DBGA 4OJPA 1O8FA 2PECA 1WMRA 2NT9A 2UVEA 3GQAA 1O8EA 4XLEA 4OJLA 2X6WA 2X6XA 2NSPA 4OJOA 3B90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWE A;  3JUR A;  1QCX A;  2NT6 A;  1OGM X;  4YEL A;  4XQF A;  2VJJ A;  1O8I A;  4OJ5 A;  2QX3 A;  1O8K A;  4W8Q A;  1QJV A;  1O8H A;  2VJI A;  1O8J A;  1OFL A;  3B4N A;  1IB4 A;  4W8R A;  1IA5 A;  4Z03 A;  1EE6 A;  1GQ8 A;  4XLC A;  1PLU A;  4XL9 A;  5C1E A;  2PYH A;  1O8G A;  1JRG A;  3WWG A;  1VBL A;  1X0C A;  2INV A;  4I84 A;  4XOP A;  1KCC A;  1O8D A;  4Z06 A;  1PXZ A;  4YZX A;  3VSV A;  2O1D A;  1DBO A;  4XN0 A;  3VSU A;  4MXN A;  3VST A;  4YEJ A;  1IDK A;  1RU4 A;  4XOT A;  4OJ6 A;  2NTP A;  4NK6 A;  1AIR A;  2X3H A;  2X6Y A;  4XLH A;  1NHC A;  2Z8G A;  4W8S A;  2UVF A;  2X85 A;  4XOR A;  4XMY A;  4XLA A;  2INU A;  2NST A;  3EQN A;  4PMH A;  2NTQ A;  3KRG A;  3GQ9 A;  3LMW A;  4XKW A;  4U49 A;  4W8T A;  2VBE A;  1JTA A;  1OOC A;  2NTB A;  3GRH A;  4YZQ A;  2QXZ A;  2VBM A;  3UW0 A;  4OZZ A;  3EQO A;  4EW9 A;  4XLF A;  2IQ7 A;  4HWV A;  1CZF A;  1H80 A;  1O8L A;  2ODL A;  3GQ7 A;  2BSP A;  4Z05 A;  2NZM A;  4YZ0 A;  3ZSC A;  4XN3 A;  3SUC A;  4URR A;  3ZPP A;  1IDJ A;  3T9G A;  3FY3 A;  4XKV A;  1XG2 A;  3B8Y A;  4XM3 A;  1O8M A;  4XR6 A;  1RMG A;  2O0V A;  1KTW A;  2O0W A;  1OFM A;  4XNF A;  2QY1 A;  1RWR A;  5C1C A;  1PE9 A;  4C2L A;  1KCD A;  1OGO X;  1BHE A;  3GQ8 A;  4U4B A;  1HG8 A;  2VBK A;  1BN8 A;  4YZA A;  4NK8 A;  2O17 A;  3VMV A;  3VMW A;  1O88 A;  1K5C A;  4XON A;  4MR0 A;  2O04 A;  2PYG A;  4OZY A;  5AMV A;  4AVZ A;  1DBG A;  4OJP A;  1O8F A;  2PEC A;  1WMR A;  2NT9 A;  2UVE A;  3GQA A;  1O8E A;  4XLE A;  4OJL A;  2X6W A;  2X6X A;  2NSP A;  4OJO A;  3B90 A; 
#chains in the Genus database with same CATH topology
 2EWE A;  4JRA C;  3JUR A;  1L1I A;  1QCX A;  2BX6 A;  2NT6 A;  1OGM X;  3LJY A;  3PET A;  1QRC A;  4YEL A;  2XTX A;  2VJJ A;  1O8I A;  4XQF A;  4OJ5 A;  2QX3 A;  5DNS A;  2IOU G;  1O8K A;  4W8Q A;  5JLV C;  1QJV A;  1O8H A;  2VJI A;  1O8J A;  3N90 A;  1OFL A;  3B4N A;  1IB4 A;  3NAW A;  3PSZ A;  4W8R A;  2YUH A;  1IA5 A;  3BH7 B;  4Z03 A;  1TYW A;  1EE6 A;  1GQ8 A;  3PSS A;  1PLU A;  4XLC A;  4XL9 A;  5C1E A;  2PYH A;  1O8G A;  1JRG A;  3WWG A;  2J8I A;  3BH6 B;  1QRB A;  1VBL A;  1X0C A;  3TH0 A;  2INV A;  4I84 A;  4XOP A;  1KCC A;  1O8D A;  4Z06 A;  1PXZ A;  4YZX A;  3VSV A;  2O1D A;  2QZA A;  1DBO A;  1KQ5 A;  2VFO A;  4XN0 A;  2F3L A;  3SQV A;  3SYJ A;  3VSU A;  4MXN A;  3RIQ A;  3VST A;  2XTW A;  2XC1 A;  4YEJ A;  1IDK A;  1RU4 A;  3P4G A;  4XOT A;  4OJ6 A;  4YDT A;  1TYV A;  4YCQ A;  2NTP A;  4NK6 A;  1AIR A;  2J8K A;  4KH3 A;  2X3H A;  2O6W A;  2VFN A;  2X6Y A;  4XLH A;  1TSP A;  1OFD A;  2V5I A;  1QA1 A;  1NHC A;  1WXR A;  1EA0 A;  2Z8G A;  4W8S A;  2UVF A;  2X85 A;  4XOR A;  4XMY A;  4XLA A;  2INU A;  2NST A;  4V02 C;  3EQN A;  4PMH A;  2NTQ A;  5JMC B;  3KRG A;  3GQ9 A;  1TYX A;  3LMW A;  4XKW A;  2XT4 A;  4U49 A;  4W8T A;  2BM4 A;  2VBE A;  3DU1 X;  1JTA A;  2XT2 A;  1TYU A;  1OOC A;  2NTB A;  3ML3 A;  3GRH A;  4YZQ A;  2QXZ A;  2VBM A;  2VFQ A;  3UW0 A;  4OZZ A;  3EQO A;  3NB2 A;  4EW9 A;  1QA2 A;  1LLZ A;  4XLF A;  2IQ7 A;  4HWV A;  1CZF A;  1H80 A;  1O8L A;  2ODL A;  1OFE A;  1LLW A;  3GQ7 A;  3N6Z A;  2VFM A;  2BSP A;  4Z05 A;  2NZM A;  4YZ0 A;  3ZSC A;  1K4Z A;  4XN3 A;  3SUC A;  4URR A;  2BM6 A;  3ZPP A;  1IDJ A;  3T9G A;  3FY3 A;  4XKV A;  1XG2 A;  3H09 A;  2B0R A;  3B8Y A;  1O8M A;  4XM3 A;  4XR6 A;  4YEI A;  1RMG A;  4YC5 A;  2O0V A;  1KTW A;  1OFM A;  2O0W A;  3SZE A;  4XNF A;  2QY1 A;  1RWR A;  5C1C A;  1PE9 A;  3AK5 A;  4C2L A;  1QA3 A;  1DAB A;  1KCD A;  1OGO X;  1BHE A;  3GQ8 A;  4U4B A;  1K8F A;  2BM7 A;  1HG8 A;  3SY2 A;  2VBK A;  1BN8 A;  4YZA A;  4NK8 A;  2O17 A;  3VMV A;  3VMW A;  1O88 A;  1K5C A;  4OPW A;  4XON A;  1EZG A;  3LYC A;  4MR0 A;  2O04 A;  2PYG A;  4OZY A;  4OM9 A;  5AMV A;  1CLW A;  1LM1 A;  2XTY A;  4AVZ A;  1DBG A;  2G0Y A;  4OJP A;  1O8F A;  2PEC A;  2W7Z A;  1WMR A;  1HF2 A;  2NT9 A;  2UVE A;  1O8E A;  2VFP A;  3GQA A;  3JX8 A;  4YFO A;  4XLE A;  4OJL A;  2QYU A;  2X6W A;  2NSP A;  2X6X A;  2BM5 A;  4OJO A;  1QQ1 A;  3B90 A; 
#chains in the Genus database with same CATH homology
 2EWE A;  3JUR A;  1QCX A;  2NT6 A;  1OGM X;  4YEL A;  4XQF A;  2VJJ A;  1O8I A;  4OJ5 A;  2QX3 A;  1O8K A;  4W8Q A;  1QJV A;  1O8H A;  2VJI A;  1O8J A;  1OFL A;  3B4N A;  1IB4 A;  4W8R A;  1IA5 A;  4Z03 A;  1EE6 A;  1GQ8 A;  4XLC A;  1PLU A;  4XL9 A;  5C1E A;  2PYH A;  1O8G A;  1JRG A;  3WWG A;  1VBL A;  1X0C A;  2INV A;  4I84 A;  4XOP A;  1KCC A;  1O8D A;  4Z06 A;  1PXZ A;  4YZX A;  3VSV A;  2O1D A;  1DBO A;  4XN0 A;  3VSU A;  4MXN A;  3VST A;  4YEJ A;  1IDK A;  1RU4 A;  4XOT A;  4OJ6 A;  2NTP A;  4NK6 A;  1AIR A;  2X3H A;  2X6Y A;  4XLH A;  1NHC A;  2Z8G A;  4W8S A;  2UVF A;  2X85 A;  4XOR A;  4XMY A;  4XLA A;  2INU A;  2NST A;  3EQN A;  4PMH A;  2NTQ A;  3KRG A;  3GQ9 A;  3LMW A;  4XKW A;  4U49 A;  4W8T A;  2VBE A;  1JTA A;  1OOC A;  2NTB A;  3GRH A;  4YZQ A;  2QXZ A;  2VBM A;  3UW0 A;  4OZZ A;  3EQO A;  4EW9 A;  4XLF A;  2IQ7 A;  4HWV A;  1CZF A;  1H80 A;  1O8L A;  2ODL A;  3GQ7 A;  2BSP A;  4Z05 A;  2NZM A;  4YZ0 A;  3ZSC A;  4XN3 A;  3SUC A;  4URR A;  3ZPP A;  1IDJ A;  3T9G A;  3FY3 A;  4XKV A;  1XG2 A;  3B8Y A;  4XM3 A;  1O8M A;  4XR6 A;  1RMG A;  2O0V A;  1KTW A;  2O0W A;  1OFM A;  4XNF A;  2QY1 A;  1RWR A;  5C1C A;  1PE9 A;  4C2L A;  1KCD A;  1OGO X;  1BHE A;  3GQ8 A;  4U4B A;  1HG8 A;  2VBK A;  1BN8 A;  4YZA A;  4NK8 A;  2O17 A;  3VMV A;  3VMW A;  1O88 A;  1K5C A;  4XON A;  4MR0 A;  2O04 A;  2PYG A;  4OZY A;  5AMV A;  4AVZ A;  1DBG A;  4OJP A;  1O8F A;  2PEC A;  1WMR A;  2NT9 A;  2UVE A;  3GQA A;  1O8E A;  4XLE A;  4OJL A;  2X6W A;  2X6X A;  2NSP A;  4OJO A;  3B90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...