2VBEA

Tailspike protein of bacteriophage sf6
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
510
structure length
510
Chain Sequence
FGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAILSPIKE-PROTEIN
publication title An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6.
pubmed doi rcsb
source organism Bacteriophage sfvi
molecule tags Viral protein
total genus 185
structure length 510
sequence length 510
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbeA00
4XORA 4XNFA 4OZZA 3B90A 1X0CA 4EW9A 3B8YA 1IA5A 4MR0A 3GRHA 1PXZA 3VSUA 4YELA 3T9GA 1OGOX 4XN3A 2VBEA 1VBLA 3WWGA 2NSTA 2UVEA 1JRGA 2NT9A 4OJLA 1O8MA 3VMWA 1XG2A 1OOCA 1OGMX 4URRA 3EQOA 2O1DA 3EQNA 2NTPA 1OFLA 5AMVA 3ZSCA 4PMHA 1O8DA 3JURA 4W8SA 2X85A 4XOPA 1DBOA 1BN8A 1KCCA 3GQAA 1O8FA 4YZ0A 3VSVA 4OJ5A 4C2LA 1WMRA 2PECA 5C1EA 4HWVA 4OJPA 1IDKA 1O8GA 2UVFA 4XMYA 1AIRA 1IB4A 3ZPPA 2QXZA 2O0VA 2X6XA 1PLUA 2O17A 4XLAA 4XL9A 2O0WA 2PYHA 2X6WA 4NK6A 4OZYA 4Z03A 1O88A 2QY1A 4XLEA 2O04A 3GQ9A 4U49A 2QX3A 1KTWA 4Z05A 2X6YA 1K5CA 1EE6A 4YZXA 1O8HA 4XM3A 4XN0A 1JTAA 1QCXA 2VBKA 2NTBA 2NZMA 4OJOA 4MXNA 4XLHA 1CZFA 4U4BA 2VBMA 4XOTA 3GQ7A 1BHEA 3UW0A 4W8TA 1O8LA 1O8KA 4XKVA 4YZAA 3B4NA 1QJVA 1RU4A 5C1CA 2VJJA 4AVZA 1KCDA 2INUA 2NT6A 4YZQA 2NTQA 2ODLA 2EWEA 4W8RA 1RMGA 4NK8A 1RWRA 4XONA 2PYGA 4XKWA 4W8QA 4Z06A 3FY3A 1NHCA 1OFMA 3VSTA 1IDJA 4YEJA 2IQ7A 1O8IA 2INVA 3KRGA 2NSPA 4OJ6A 2BSPA 4XQFA 2VJIA 3VMVA 1O8EA 3GQ8A 4XLFA 4XLCA 1DBGA 1PE9A 1H80A 4I84A 1HG8A 1O8JA 2Z8GA 3LMWA 3SUCA 1GQ8A 2X3HA 4XR6A
chains in the Genus database with same CATH superfamily
3PSSA 4XORA 1TSPA 4OZZA 3ML3A 4XNFA 3B90A 1X0CA 4EW9A 2W7ZA 3B8YA 1IA5A 2F3LA 1LLZA 4MR0A 3GRHA 1PXZA 2BM4A 3PETA 3VSUA 4YELA 2B0RA 3T9GA 1OGOX 2VFNA 4XN3A 2VBEA 1VBLA 3WWGA 2NSTA 2UVEA 1JRGA 2NT9A 4OJLA 1O8MA 2VFOA 1XG2A 1OOCA 1OGMX 4URRA 3VMWA 1QA1A 3N90A 4XQFA 3EQOA 2O1DA 3EQNA 4OPWA 2NTPA 1OFLA 3SQVA 1TYUA 3P4GA 5AMVA 3ZSCA 4PMHA 3TH0A 1O8DA 3JURA 4W8SA 2X85A 2VFPA 1CLWA 4XOPA 1DBOA 1BN8A 1K4ZA 1KCCA 3GQAA 3BH7B 3BH6B 1O8FA 3NAWA 4YZ0A 2J8KA 3VSVA 4OJ5A 4C2LA 1WMRA 5JLVC 2PECA 5C1EA 4OM9A 2VFMA 3SZEA 4HWVA 4OJPA 1IDKA 1O8GA 2UVFA 1LLWA 1TYXA 1QRBA 1LM1A 1TYWA 4XMYA 1AIRA 3LJYA 1IB4A 3JX8A 1TYVA 3SYJA 3ZPPA 2G0YA 2QXZA 2O0VA 2X6XA 4YDTA 1PLUA 2BM7A 2O17A 1QRCA 4XLAA 2XTYA 3SY2A 4XL9A 2IOUG 2O0WA 2PYHA 2X6WA 3H09A 3DU1X 4NK6A 1O88A 4OZYA 4Z03A 2QY1A 4XLEA 2O04A 3GQ9A 4U49A 2QX3A 2BX6A 1KTWA 5JMCB 1K8FA 4Z05A 2X6YA 2XTXA 1EZGA 1K5CA 1QA3A 1EE6A 3N6ZA 4YZXA 1O8HA 4XM3A 4YCQA 4XN0A 1JTAA 1QCXA 4YC5A 1KQ5A 2O6WA 2NTBA 2VBKA 2XT2A 2NZMA 4OJOA 4MXNA 4XLHA 1CZFA 4U4BA 2VBMA 4XOTA 3AK5A 2V5IA 3GQ7A 1BHEA 3LYCA 3UW0A 4W8TA 1O8LA 1O8KA 4XKVA 4YZAA 1L1IA 3B4NA 1QJVA 1RU4A 5C1CA 4KH3A 4V02C 2VJJA 4AVZA 1QQ1A 1KCDA 2INUA 2NT6A 4YZQA 2BM5A 2NTQA 2ODLA 2EWEA 2QZAA 1RMGA 4NK8A 1RWRA 4W8RA 4XONA 2PYGA 1QA2A 4XKWA 4W8QA 4Z06A 3FY3A 1NHCA 1OFMA 3VSTA 1IDJA 1WXRA 4YEJA 2IQ7A 3RIQA 1O8IA 2XC1A 1EA0A 2INVA 2XTWA 4YFOA 2QYUA 3KRGA 2NSPA 2XT4A 1OFDA 4OJ6A 2BSPA 3NB2A 2VJIA 3VMVA 1O8EA 3GQ8A 4XLFA 4XLCA 1DBGA 2BM6A 4XR6A 4YEIA 1OFEA 5DNSA 1PE9A 1H80A 2J8IA 2YUHA 1HG8A 1O8JA 2Z8GA 3LMWA 4I84A 4JRAC 3SUCA 1GQ8A 2X3HA 3PSZA 2VFQA 1DABA 1HF2A
chains in the Genus database with same CATH topology
4XORA 4XNFA 4OZZA 3B90A 1X0CA 4EW9A 3B8YA 1IA5A 4MR0A 3GRHA 1PXZA 3VSUA 4YELA 3T9GA 1OGOX 4XN3A 2VBEA 1VBLA 3WWGA 2NSTA 2UVEA 1JRGA 2NT9A 4OJLA 1O8MA 3VMWA 1XG2A 1OOCA 1OGMX 4URRA 3EQOA 2O1DA 3EQNA 2NTPA 1OFLA 5AMVA 3ZSCA 4PMHA 1O8DA 3JURA 4W8SA 2X85A 4XOPA 1DBOA 1BN8A 1KCCA 3GQAA 1O8FA 4YZ0A 3VSVA 4OJ5A 4C2LA 1WMRA 2PECA 5C1EA 4HWVA 4OJPA 1IDKA 1O8GA 2UVFA 4XMYA 1AIRA 1IB4A 3ZPPA 2QXZA 2O0VA 2X6XA 1PLUA 2O17A 4XLAA 4XL9A 2O0WA 2PYHA 2X6WA 4NK6A 4OZYA 4Z03A 1O88A 2QY1A 4XLEA 2O04A 3GQ9A 4U49A 2QX3A 1KTWA 4Z05A 2X6YA 1K5CA 1EE6A 4YZXA 1O8HA 4XM3A 4XN0A 1JTAA 1QCXA 2VBKA 2NTBA 2NZMA 4OJOA 4MXNA 4XLHA 1CZFA 4U4BA 2VBMA 4XOTA 3GQ7A 1BHEA 3UW0A 4W8TA 1O8LA 1O8KA 4XKVA 4YZAA 3B4NA 1QJVA 1RU4A 5C1CA 2VJJA 4AVZA 1KCDA 2INUA 2NT6A 4YZQA 2NTQA 2ODLA 2EWEA 4W8RA 1RMGA 4NK8A 1RWRA 4XONA 2PYGA 4XKWA 4W8QA 4Z06A 3FY3A 1NHCA 1OFMA 3VSTA 1IDJA 4YEJA 2IQ7A 1O8IA 2INVA 3KRGA 2NSPA 4OJ6A 2BSPA 4XQFA 2VJIA 3VMVA 1O8EA 3GQ8A 4XLFA 4XLCA 1DBGA 1PE9A 1H80A 4I84A 1HG8A 1O8JA 2Z8GA 3LMWA 3SUCA 1GQ8A 2X3HA 4XR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOR A;  4XNF A;  4OZZ A;  3B90 A;  1X0C A;  4EW9 A;  3B8Y A;  1IA5 A;  4MR0 A;  3GRH A;  1PXZ A;  3VSU A;  4YEL A;  3T9G A;  1OGO X;  4XN3 A;  2VBE A;  1VBL A;  3WWG A;  2NST A;  2UVE A;  1JRG A;  2NT9 A;  4OJL A;  1O8M A;  3VMW A;  1XG2 A;  1OOC A;  1OGM X;  4URR A;  3EQO A;  2O1D A;  3EQN A;  2NTP A;  1OFL A;  5AMV A;  3ZSC A;  4PMH A;  1O8D A;  3JUR A;  4W8S A;  2X85 A;  4XOP A;  1DBO A;  1BN8 A;  1KCC A;  3GQA A;  1O8F A;  4YZ0 A;  3VSV A;  4OJ5 A;  4C2L A;  1WMR A;  2PEC A;  5C1E A;  4HWV A;  4OJP A;  1IDK A;  1O8G A;  2UVF A;  4XMY A;  1AIR A;  1IB4 A;  3ZPP A;  2QXZ A;  2O0V A;  2X6X A;  1PLU A;  2O17 A;  4XLA A;  4XL9 A;  2O0W A;  2PYH A;  2X6W A;  4NK6 A;  4OZY A;  4Z03 A;  1O88 A;  2QY1 A;  4XLE A;  2O04 A;  3GQ9 A;  4U49 A;  2QX3 A;  1KTW A;  4Z05 A;  2X6Y A;  1K5C A;  1EE6 A;  4YZX A;  1O8H A;  4XM3 A;  4XN0 A;  1JTA A;  1QCX A;  2VBK A;  2NTB A;  2NZM A;  4OJO A;  4MXN A;  4XLH A;  1CZF A;  4U4B A;  2VBM A;  4XOT A;  3GQ7 A;  1BHE A;  3UW0 A;  4W8T A;  1O8L A;  1O8K A;  4XKV A;  4YZA A;  3B4N A;  1QJV A;  1RU4 A;  5C1C A;  2VJJ A;  4AVZ A;  1KCD A;  2INU A;  2NT6 A;  4YZQ A;  2NTQ A;  2ODL A;  2EWE A;  4W8R A;  1RMG A;  4NK8 A;  1RWR A;  4XON A;  2PYG A;  4XKW A;  4W8Q A;  4Z06 A;  3FY3 A;  1NHC A;  1OFM A;  3VST A;  1IDJ A;  4YEJ A;  2IQ7 A;  1O8I A;  2INV A;  3KRG A;  2NSP A;  4OJ6 A;  2BSP A;  4XQF A;  2VJI A;  3VMV A;  1O8E A;  3GQ8 A;  4XLF A;  4XLC A;  1DBG A;  1PE9 A;  1H80 A;  4I84 A;  1HG8 A;  1O8J A;  2Z8G A;  3LMW A;  3SUC A;  1GQ8 A;  2X3H A;  4XR6 A; 
#chains in the Genus database with same CATH topology
 3PSS A;  4XOR A;  1TSP A;  4OZZ A;  3ML3 A;  4XNF A;  3B90 A;  1X0C A;  4EW9 A;  2W7Z A;  3B8Y A;  1IA5 A;  2F3L A;  1LLZ A;  4MR0 A;  3GRH A;  1PXZ A;  2BM4 A;  3PET A;  3VSU A;  4YEL A;  2B0R A;  3T9G A;  1OGO X;  2VFN A;  4XN3 A;  2VBE A;  1VBL A;  3WWG A;  2NST A;  2UVE A;  1JRG A;  2NT9 A;  4OJL A;  1O8M A;  2VFO A;  1XG2 A;  1OOC A;  1OGM X;  4URR A;  3VMW A;  1QA1 A;  3N90 A;  4XQF A;  3EQO A;  2O1D A;  3EQN A;  4OPW A;  2NTP A;  1OFL A;  3SQV A;  1TYU A;  3P4G A;  5AMV A;  3ZSC A;  4PMH A;  3TH0 A;  1O8D A;  3JUR A;  4W8S A;  2X85 A;  2VFP A;  1CLW A;  4XOP A;  1DBO A;  1BN8 A;  1K4Z A;  1KCC A;  3GQA A;  3BH7 B;  3BH6 B;  1O8F A;  3NAW A;  4YZ0 A;  2J8K A;  3VSV A;  4OJ5 A;  4C2L A;  1WMR A;  5JLV C;  2PEC A;  5C1E A;  4OM9 A;  2VFM A;  3SZE A;  4HWV A;  4OJP A;  1IDK A;  1O8G A;  2UVF A;  1LLW A;  1TYX A;  1QRB A;  1LM1 A;  1TYW A;  4XMY A;  1AIR A;  3LJY A;  1IB4 A;  3JX8 A;  1TYV A;  3SYJ A;  3ZPP A;  2G0Y A;  2QXZ A;  2O0V A;  2X6X A;  4YDT A;  1PLU A;  2BM7 A;  2O17 A;  1QRC A;  4XLA A;  2XTY A;  3SY2 A;  4XL9 A;  2IOU G;  2O0W A;  2PYH A;  2X6W A;  3H09 A;  3DU1 X;  4NK6 A;  1O88 A;  4OZY A;  4Z03 A;  2QY1 A;  4XLE A;  2O04 A;  3GQ9 A;  4U49 A;  2QX3 A;  2BX6 A;  1KTW A;  5JMC B;  1K8F A;  4Z05 A;  2X6Y A;  2XTX A;  1EZG A;  1K5C A;  1QA3 A;  1EE6 A;  3N6Z A;  4YZX A;  1O8H A;  4XM3 A;  4YCQ A;  4XN0 A;  1JTA A;  1QCX A;  4YC5 A;  1KQ5 A;  2O6W A;  2NTB A;  2VBK A;  2XT2 A;  2NZM A;  4OJO A;  4MXN A;  4XLH A;  1CZF A;  4U4B A;  2VBM A;  4XOT A;  3AK5 A;  2V5I A;  3GQ7 A;  1BHE A;  3LYC A;  3UW0 A;  4W8T A;  1O8L A;  1O8K A;  4XKV A;  4YZA A;  1L1I A;  3B4N A;  1QJV A;  1RU4 A;  5C1C A;  4KH3 A;  4V02 C;  2VJJ A;  4AVZ A;  1QQ1 A;  1KCD A;  2INU A;  2NT6 A;  4YZQ A;  2BM5 A;  2NTQ A;  2ODL A;  2EWE A;  2QZA A;  1RMG A;  4NK8 A;  1RWR A;  4W8R A;  4XON A;  2PYG A;  1QA2 A;  4XKW A;  4W8Q A;  4Z06 A;  3FY3 A;  1NHC A;  1OFM A;  3VST A;  1IDJ A;  1WXR A;  4YEJ A;  2IQ7 A;  3RIQ A;  1O8I A;  2XC1 A;  1EA0 A;  2INV A;  2XTW A;  4YFO A;  2QYU A;  3KRG A;  2NSP A;  2XT4 A;  1OFD A;  4OJ6 A;  2BSP A;  3NB2 A;  2VJI A;  3VMV A;  1O8E A;  3GQ8 A;  4XLF A;  4XLC A;  1DBG A;  2BM6 A;  4XR6 A;  4YEI A;  1OFE A;  5DNS A;  1PE9 A;  1H80 A;  2J8I A;  2YUH A;  1HG8 A;  1O8J A;  2Z8G A;  3LMW A;  4I84 A;  4JRA C;  3SUC A;  1GQ8 A;  2X3H A;  3PSZ A;  2VFQ A;  1DAB A;  1HF2 A; 
#chains in the Genus database with same CATH homology
 4XOR A;  4XNF A;  4OZZ A;  3B90 A;  1X0C A;  4EW9 A;  3B8Y A;  1IA5 A;  4MR0 A;  3GRH A;  1PXZ A;  3VSU A;  4YEL A;  3T9G A;  1OGO X;  4XN3 A;  2VBE A;  1VBL A;  3WWG A;  2NST A;  2UVE A;  1JRG A;  2NT9 A;  4OJL A;  1O8M A;  3VMW A;  1XG2 A;  1OOC A;  1OGM X;  4URR A;  3EQO A;  2O1D A;  3EQN A;  2NTP A;  1OFL A;  5AMV A;  3ZSC A;  4PMH A;  1O8D A;  3JUR A;  4W8S A;  2X85 A;  4XOP A;  1DBO A;  1BN8 A;  1KCC A;  3GQA A;  1O8F A;  4YZ0 A;  3VSV A;  4OJ5 A;  4C2L A;  1WMR A;  2PEC A;  5C1E A;  4HWV A;  4OJP A;  1IDK A;  1O8G A;  2UVF A;  4XMY A;  1AIR A;  1IB4 A;  3ZPP A;  2QXZ A;  2O0V A;  2X6X A;  1PLU A;  2O17 A;  4XLA A;  4XL9 A;  2O0W A;  2PYH A;  2X6W A;  4NK6 A;  4OZY A;  4Z03 A;  1O88 A;  2QY1 A;  4XLE A;  2O04 A;  3GQ9 A;  4U49 A;  2QX3 A;  1KTW A;  4Z05 A;  2X6Y A;  1K5C A;  1EE6 A;  4YZX A;  1O8H A;  4XM3 A;  4XN0 A;  1JTA A;  1QCX A;  2VBK A;  2NTB A;  2NZM A;  4OJO A;  4MXN A;  4XLH A;  1CZF A;  4U4B A;  2VBM A;  4XOT A;  3GQ7 A;  1BHE A;  3UW0 A;  4W8T A;  1O8L A;  1O8K A;  4XKV A;  4YZA A;  3B4N A;  1QJV A;  1RU4 A;  5C1C A;  2VJJ A;  4AVZ A;  1KCD A;  2INU A;  2NT6 A;  4YZQ A;  2NTQ A;  2ODL A;  2EWE A;  4W8R A;  1RMG A;  4NK8 A;  1RWR A;  4XON A;  2PYG A;  4XKW A;  4W8Q A;  4Z06 A;  3FY3 A;  1NHC A;  1OFM A;  3VST A;  1IDJ A;  4YEJ A;  2IQ7 A;  1O8I A;  2INV A;  3KRG A;  2NSP A;  4OJ6 A;  2BSP A;  4XQF A;  2VJI A;  3VMV A;  1O8E A;  3GQ8 A;  4XLF A;  4XLC A;  1DBG A;  1PE9 A;  1H80 A;  4I84 A;  1HG8 A;  1O8J A;  2Z8G A;  3LMW A;  3SUC A;  1GQ8 A;  2X3H A;  4XR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...