2VBEA

Tailspike protein of bacteriophage sf6
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
510
structure length
510
Chain Sequence
FGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAILSPIKE-PROTEIN
publication title An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6.
pubmed doi rcsb
source organism Bacteriophage sfvi
total genus 185
structure length 510
sequence length 510
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12708 Pectate_lyase_3 Pectate lyase superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 2vbeA00
2X85A 4URRA 2NTPA 4EW9A 4OZZA 1X0CA 3VMWA 3B8YA 1O8HA 4NK8A 2UVFA 3GQAA 1VBLA 2O0VA 3B4NA 4MR0A 1IDKA 1PE9A 1QJVA 3EQOA 4OJPA 2EWEA 3JURA 3FY3A 4OZYA 4XR6A 1CZFA 1XG2A 4XQFA 1O8LA 1JTAA 2QXZA 1O8KA 3LMWA 4OJOA 1O8MA 4MXNA 4U49A 2NTBA 1BHEA 2O04A 2NSTA 2QX3A 1HG8A 4C2LA 2INVA 1RU4A 2VBKA 1RWRA 2NTQA 4XMYA 4Z06A 3EQNA 1OGOX 2BSPA 1KCCA 4YELA 2PECA 2O0WA 1NHCA 4OJLA 4XL9A 4W8SA 1O8EA 4I84A 4XLCA 5AMVA 4XOTA 4YZ0A 2O1DA 4XM3A 1O8GA 2ODLA 2X6YA 4XORA 1OOCA 4YZQA 1IDJA 1WMRA 1JRGA 3T9GA 4AVZA 3WWGA 4XOPA 1AIRA 4U4BA 1GQ8A 3GQ9A 2PYGA 3GRHA 3VSTA 4W8RA 2X3HA 4W8TA 4XKWA 1PXZA 2QY1A 4PMHA 4OJ5A 4XN3A 2VBMA 4OJ6A 4HWVA 4XKVA 4XLEA 1IB4A 1RMGA 4YEJA 4XLFA 4XONA 1OFLA 3ZSCA 5C1EA 4Z05A 3SUCA 1PLUA 1O8FA 1QCXA 2VJJA 4XN0A 1IA5A 2VJIA 1O88A 3KRGA 4XLHA 5C1CA 1K5CA 1BN8A 2X6WA 4Z03A 2X6XA 1DBGA 3GQ7A 4YZAA 3VSUA 4NK6A 3GQ8A 1OGMX 1O8DA 2NZMA 1O8JA 2INUA 2NSPA 1KTWA 2VBEA 2Z8GA 1EE6A 2NT9A 4YZXA 1DBOA 2UVEA 3B90A 3VMVA 1KCDA 4XLAA 2NT6A 4XNFA 2PYHA 2O17A 3ZPPA 1OFMA 1O8IA 3VSVA 4W8QA 2IQ7A 3UW0A 1H80A
chains in the Genus database with same CATH superfamily
1CLWA 1OFEA 1K4ZA 2X85A 1LLWA 2QYUA 4URRA 2NTPA 4EW9A 4OZZA 1X0CA 3VMWA 3B8YA 1O8HA 4NK8A 1KQ5A 4V02C 2UVFA 3GQAA 2V5IA 1VBLA 3UW0A 2O0VA 2VFNA 3B4NA 1TSPA 2XTYA 4MR0A 1IDKA 1PE9A 1QJVA 3EQOA 1LM1A 3N90A 2EWEA 3JURA 4OJPA 3FY3A 4OZYA 1WXRA 4KH3A 4XR6A 1CZFA 3BH6B 1XG2A 1HF2A 1OFDA 2VFQA 4OM9A 4XQFA 1O8LA 1JTAA 2QXZA 3PSSA 1O8KA 3LMWA 4OJOA 1QRCA 1O8MA 4MXNA 1QRBA 4U49A 2NTBA 1BHEA 2O04A 2NSTA 2QX3A 1HG8A 4C2LA 2INVA 1RU4A 2VBKA 1RWRA 2NTQA 4XMYA 4Z06A 3EQNA 1OGOX 2BSPA 2YUHA 1KCCA 2F3LA 2XT4A 3DU1X 4YELA 2PECA 3ML3A 3SZEA 2O0WA 1TYXA 1EA0A 1NHCA 5DNSA 1TYUA 4OJLA 4XL9A 4W8SA 1O8EA 3NB2A 1EZGA 2BM5A 4I84A 4XLCA 4XOTA 5AMVA 1L1IA 4YZ0A 2J8KA 2O1DA 4XM3A 1O8GA 2ODLA 4YEIA 2X6YA 4XORA 1OOCA 4YZQA 1IDJA 1WMRA 1JRGA 1K8FA 2VFMA 3T9GA 4AVZA 3WWGA 3LYCA 4XOPA 1AIRA 2O6WA 4U4BA 1GQ8A 3GQ9A 2PYGA 3GRHA 3VSTA 4W8RA 2X3HA 4W8TA 4XKWA 1PXZA 2QY1A 4PMHA 4OJ5A 3RIQA 4XN3A 2VBMA 4YFOA 4OJ6A 1QQ1A 4HWVA 3SYJA 4XKVA 4XLEA 3JX8A 2B0RA 4YC5A 2VFOA 3PETA 1IB4A 1RMGA 4YEJA 4XLFA 4XONA 2IOUG 1QA3A 2XTWA 3PSZA 1OFLA 3ZSCA 5C1EA 1TYVA 4Z05A 3SUCA 2XTXA 2QZAA 1PLUA 1O8FA 1QCXA 2VJJA 1DABA 4XN0A 1IA5A 2VJIA 1QA1A 1O88A 3KRGA 3NAWA 4OPWA 4XLHA 5C1CA 1K5CA 3SY2A 2G0YA 1BN8A 2X6WA 4Z03A 5JLVC 2J8IA 3H09A 3P4GA 3AK5A 2BM4A 2X6XA 1LLZA 1DBGA 3GQ7A 4YZAA 4YCQA 2W7ZA 5JMCB 3N6ZA 3VSUA 4NK6A 2VFPA 3GQ8A 1OGMX 1O8DA 1TYWA 2BX6A 2NZMA 1O8JA 2INUA 2NSPA 2XC1A 4JRAC 1KTWA 2VBEA 2Z8GA 1EE6A 2NT9A 4YZXA 1DBOA 2UVEA 3B90A 3VMVA 2BM6A 1KCDA 4YDTA 4XLAA 3BH7B 2NT6A 4XNFA 2PYHA 2O17A 3LJYA 3SQVA 3ZPPA 1OFMA 1O8IA 3VSVA 1QA2A 4W8QA 2IQ7A 2XT2A 2BM7A 1H80A 3TH0A
chains in the Genus database with same CATH topology
2X85A 4URRA 2NTPA 4EW9A 4OZZA 1X0CA 3VMWA 3B8YA 1O8HA 4NK8A 2UVFA 3GQAA 1VBLA 2O0VA 3B4NA 4MR0A 1IDKA 1PE9A 1QJVA 3EQOA 4OJPA 2EWEA 3JURA 3FY3A 4OZYA 4XR6A 1CZFA 1XG2A 4XQFA 1O8LA 1JTAA 2QXZA 1O8KA 3LMWA 4OJOA 1O8MA 4MXNA 4U49A 2NTBA 1BHEA 2O04A 2NSTA 2QX3A 1HG8A 4C2LA 2INVA 1RU4A 2VBKA 1RWRA 2NTQA 4XMYA 4Z06A 3EQNA 1OGOX 2BSPA 1KCCA 4YELA 2PECA 2O0WA 1NHCA 4OJLA 4XL9A 4W8SA 1O8EA 4I84A 4XLCA 5AMVA 4XOTA 4YZ0A 2O1DA 4XM3A 1O8GA 2ODLA 2X6YA 4XORA 1OOCA 4YZQA 1IDJA 1WMRA 1JRGA 3T9GA 4AVZA 3WWGA 4XOPA 1AIRA 4U4BA 1GQ8A 3GQ9A 2PYGA 3GRHA 3VSTA 4W8RA 2X3HA 4W8TA 4XKWA 1PXZA 2QY1A 4PMHA 4OJ5A 4XN3A 2VBMA 4OJ6A 4HWVA 4XKVA 4XLEA 1IB4A 1RMGA 4YEJA 4XLFA 4XONA 1OFLA 3ZSCA 5C1EA 4Z05A 3SUCA 1PLUA 1O8FA 1QCXA 2VJJA 4XN0A 1IA5A 2VJIA 1O88A 3KRGA 4XLHA 5C1CA 1K5CA 1BN8A 2X6WA 4Z03A 2X6XA 1DBGA 3GQ7A 4YZAA 3VSUA 4NK6A 3GQ8A 1OGMX 1O8DA 2NZMA 1O8JA 2INUA 2NSPA 1KTWA 2VBEA 2Z8GA 1EE6A 2NT9A 4YZXA 1DBOA 2UVEA 3B90A 3VMVA 1KCDA 4XLAA 2NT6A 4XNFA 2PYHA 2O17A 3ZPPA 1OFMA 1O8IA 3VSVA 4W8QA 2IQ7A 3UW0A 1H80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X85 A;  4URR A;  2NTP A;  4EW9 A;  4OZZ A;  1X0C A;  3VMW A;  3B8Y A;  1O8H A;  4NK8 A;  2UVF A;  3GQA A;  1VBL A;  2O0V A;  3B4N A;  4MR0 A;  1IDK A;  1PE9 A;  1QJV A;  3EQO A;  4OJP A;  2EWE A;  3JUR A;  3FY3 A;  4OZY A;  4XR6 A;  1CZF A;  1XG2 A;  4XQF A;  1O8L A;  1JTA A;  2QXZ A;  1O8K A;  3LMW A;  4OJO A;  1O8M A;  4MXN A;  4U49 A;  2NTB A;  1BHE A;  2O04 A;  2NST A;  2QX3 A;  1HG8 A;  4C2L A;  2INV A;  1RU4 A;  2VBK A;  1RWR A;  2NTQ A;  4XMY A;  4Z06 A;  3EQN A;  1OGO X;  2BSP A;  1KCC A;  4YEL A;  2PEC A;  2O0W A;  1NHC A;  4OJL A;  4XL9 A;  4W8S A;  1O8E A;  4I84 A;  4XLC A;  5AMV A;  4XOT A;  4YZ0 A;  2O1D A;  4XM3 A;  1O8G A;  2ODL A;  2X6Y A;  4XOR A;  1OOC A;  4YZQ A;  1IDJ A;  1WMR A;  1JRG A;  3T9G A;  4AVZ A;  3WWG A;  4XOP A;  1AIR A;  4U4B A;  1GQ8 A;  3GQ9 A;  2PYG A;  3GRH A;  3VST A;  4W8R A;  2X3H A;  4W8T A;  4XKW A;  1PXZ A;  2QY1 A;  4PMH A;  4OJ5 A;  4XN3 A;  2VBM A;  4OJ6 A;  4HWV A;  4XKV A;  4XLE A;  1IB4 A;  1RMG A;  4YEJ A;  4XLF A;  4XON A;  1OFL A;  3ZSC A;  5C1E A;  4Z05 A;  3SUC A;  1PLU A;  1O8F A;  1QCX A;  2VJJ A;  4XN0 A;  1IA5 A;  2VJI A;  1O88 A;  3KRG A;  4XLH A;  5C1C A;  1K5C A;  1BN8 A;  2X6W A;  4Z03 A;  2X6X A;  1DBG A;  3GQ7 A;  4YZA A;  3VSU A;  4NK6 A;  3GQ8 A;  1OGM X;  1O8D A;  2NZM A;  1O8J A;  2INU A;  2NSP A;  1KTW A;  2VBE A;  2Z8G A;  1EE6 A;  2NT9 A;  4YZX A;  1DBO A;  2UVE A;  3B90 A;  3VMV A;  1KCD A;  4XLA A;  2NT6 A;  4XNF A;  2PYH A;  2O17 A;  3ZPP A;  1OFM A;  1O8I A;  3VSV A;  4W8Q A;  2IQ7 A;  3UW0 A;  1H80 A; 
#chains in the Genus database with same CATH topology
 1CLW A;  1OFE A;  1K4Z A;  2X85 A;  1LLW A;  2QYU A;  4URR A;  2NTP A;  4EW9 A;  4OZZ A;  1X0C A;  3VMW A;  3B8Y A;  1O8H A;  4NK8 A;  1KQ5 A;  4V02 C;  2UVF A;  3GQA A;  2V5I A;  1VBL A;  3UW0 A;  2O0V A;  2VFN A;  3B4N A;  1TSP A;  2XTY A;  4MR0 A;  1IDK A;  1PE9 A;  1QJV A;  3EQO A;  1LM1 A;  3N90 A;  2EWE A;  3JUR A;  4OJP A;  3FY3 A;  4OZY A;  1WXR A;  4KH3 A;  4XR6 A;  1CZF A;  3BH6 B;  1XG2 A;  1HF2 A;  1OFD A;  2VFQ A;  4OM9 A;  4XQF A;  1O8L A;  1JTA A;  2QXZ A;  3PSS A;  1O8K A;  3LMW A;  4OJO A;  1QRC A;  1O8M A;  4MXN A;  1QRB A;  4U49 A;  2NTB A;  1BHE A;  2O04 A;  2NST A;  2QX3 A;  1HG8 A;  4C2L A;  2INV A;  1RU4 A;  2VBK A;  1RWR A;  2NTQ A;  4XMY A;  4Z06 A;  3EQN A;  1OGO X;  2BSP A;  2YUH A;  1KCC A;  2F3L A;  2XT4 A;  3DU1 X;  4YEL A;  2PEC A;  3ML3 A;  3SZE A;  2O0W A;  1TYX A;  1EA0 A;  1NHC A;  5DNS A;  1TYU A;  4OJL A;  4XL9 A;  4W8S A;  1O8E A;  3NB2 A;  1EZG A;  2BM5 A;  4I84 A;  4XLC A;  4XOT A;  5AMV A;  1L1I A;  4YZ0 A;  2J8K A;  2O1D A;  4XM3 A;  1O8G A;  2ODL A;  4YEI A;  2X6Y A;  4XOR A;  1OOC A;  4YZQ A;  1IDJ A;  1WMR A;  1JRG A;  1K8F A;  2VFM A;  3T9G A;  4AVZ A;  3WWG A;  3LYC A;  4XOP A;  1AIR A;  2O6W A;  4U4B A;  1GQ8 A;  3GQ9 A;  2PYG A;  3GRH A;  3VST A;  4W8R A;  2X3H A;  4W8T A;  4XKW A;  1PXZ A;  2QY1 A;  4PMH A;  4OJ5 A;  3RIQ A;  4XN3 A;  2VBM A;  4YFO A;  4OJ6 A;  1QQ1 A;  4HWV A;  3SYJ A;  4XKV A;  4XLE A;  3JX8 A;  2B0R A;  4YC5 A;  2VFO A;  3PET A;  1IB4 A;  1RMG A;  4YEJ A;  4XLF A;  4XON A;  2IOU G;  1QA3 A;  2XTW A;  3PSZ A;  1OFL A;  3ZSC A;  5C1E A;  1TYV A;  4Z05 A;  3SUC A;  2XTX A;  2QZA A;  1PLU A;  1O8F A;  1QCX A;  2VJJ A;  1DAB A;  4XN0 A;  1IA5 A;  2VJI A;  1QA1 A;  1O88 A;  3KRG A;  3NAW A;  4OPW A;  4XLH A;  5C1C A;  1K5C A;  3SY2 A;  2G0Y A;  1BN8 A;  2X6W A;  4Z03 A;  5JLV C;  2J8I A;  3H09 A;  3P4G A;  3AK5 A;  2BM4 A;  2X6X A;  1LLZ A;  1DBG A;  3GQ7 A;  4YZA A;  4YCQ A;  2W7Z A;  5JMC B;  3N6Z A;  3VSU A;  4NK6 A;  2VFP A;  3GQ8 A;  1OGM X;  1O8D A;  1TYW A;  2BX6 A;  2NZM A;  1O8J A;  2INU A;  2NSP A;  2XC1 A;  4JRA C;  1KTW A;  2VBE A;  2Z8G A;  1EE6 A;  2NT9 A;  4YZX A;  1DBO A;  2UVE A;  3B90 A;  3VMV A;  2BM6 A;  1KCD A;  4YDT A;  4XLA A;  3BH7 B;  2NT6 A;  4XNF A;  2PYH A;  2O17 A;  3LJY A;  3SQV A;  3ZPP A;  1OFM A;  1O8I A;  3VSV A;  1QA2 A;  4W8Q A;  2IQ7 A;  2XT2 A;  2BM7 A;  1H80 A;  3TH0 A; 
#chains in the Genus database with same CATH homology
 2X85 A;  4URR A;  2NTP A;  4EW9 A;  4OZZ A;  1X0C A;  3VMW A;  3B8Y A;  1O8H A;  4NK8 A;  2UVF A;  3GQA A;  1VBL A;  2O0V A;  3B4N A;  4MR0 A;  1IDK A;  1PE9 A;  1QJV A;  3EQO A;  4OJP A;  2EWE A;  3JUR A;  3FY3 A;  4OZY A;  4XR6 A;  1CZF A;  1XG2 A;  4XQF A;  1O8L A;  1JTA A;  2QXZ A;  1O8K A;  3LMW A;  4OJO A;  1O8M A;  4MXN A;  4U49 A;  2NTB A;  1BHE A;  2O04 A;  2NST A;  2QX3 A;  1HG8 A;  4C2L A;  2INV A;  1RU4 A;  2VBK A;  1RWR A;  2NTQ A;  4XMY A;  4Z06 A;  3EQN A;  1OGO X;  2BSP A;  1KCC A;  4YEL A;  2PEC A;  2O0W A;  1NHC A;  4OJL A;  4XL9 A;  4W8S A;  1O8E A;  4I84 A;  4XLC A;  5AMV A;  4XOT A;  4YZ0 A;  2O1D A;  4XM3 A;  1O8G A;  2ODL A;  2X6Y A;  4XOR A;  1OOC A;  4YZQ A;  1IDJ A;  1WMR A;  1JRG A;  3T9G A;  4AVZ A;  3WWG A;  4XOP A;  1AIR A;  4U4B A;  1GQ8 A;  3GQ9 A;  2PYG A;  3GRH A;  3VST A;  4W8R A;  2X3H A;  4W8T A;  4XKW A;  1PXZ A;  2QY1 A;  4PMH A;  4OJ5 A;  4XN3 A;  2VBM A;  4OJ6 A;  4HWV A;  4XKV A;  4XLE A;  1IB4 A;  1RMG A;  4YEJ A;  4XLF A;  4XON A;  1OFL A;  3ZSC A;  5C1E A;  4Z05 A;  3SUC A;  1PLU A;  1O8F A;  1QCX A;  2VJJ A;  4XN0 A;  1IA5 A;  2VJI A;  1O88 A;  3KRG A;  4XLH A;  5C1C A;  1K5C A;  1BN8 A;  2X6W A;  4Z03 A;  2X6X A;  1DBG A;  3GQ7 A;  4YZA A;  3VSU A;  4NK6 A;  3GQ8 A;  1OGM X;  1O8D A;  2NZM A;  1O8J A;  2INU A;  2NSP A;  1KTW A;  2VBE A;  2Z8G A;  1EE6 A;  2NT9 A;  4YZX A;  1DBO A;  2UVE A;  3B90 A;  3VMV A;  1KCD A;  4XLA A;  2NT6 A;  4XNF A;  2PYH A;  2O17 A;  3ZPP A;  1OFM A;  1O8I A;  3VSV A;  4W8Q A;  2IQ7 A;  3UW0 A;  1H80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...