4YZQA

C. bescii family 3 pectate lyase double mutant k108a/q111n in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFNLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzqA00
1VBLA 2NT9A 1JTAA 4XORA 3VSUA 1H80A 4XLCA 4XR6A 1PXZA 4XOTA 4OJ6A 3B90A 2NTPA 1NHCA 1O8MA 4MR0A 4NK6A 4XKVA 4PMHA 4OJOA 1XG2A 2O0VA 1OGOX 4Z03A 2ODLA 3FY3A 4W8SA 4XONA 4NK8A 2VBKA 4U4BA 2O17A 1JRGA 1OGMX 2VBMA 4HWVA 4XKWA 1O8GA 3VSVA 1PLUA 3GQ8A 1O8IA 4XQFA 2VJIA 2O1DA 1QCXA 2UVEA 3VMVA 4MXNA 4XL9A 1OFMA 1O8FA 4YZAA 4XM3A 4XN0A 4OZYA 4W8QA 2O0WA 4YZQA 4YZXA 3UW0A 4C2LA 1OFLA 1QJVA 3GQ9A 4XLAA 2IQ7A 4Z05A 2INUA 3T9GA 1IB4A 2NT6A 1KCDA 4OZZA 3ZSCA 1IA5A 4URRA 1O8JA 4W8RA 3JURA 4XLEA 2NSTA 2BSPA 3VMWA 3GQ7A 3VSTA 1RU4A 1PE9A 1OOCA 1HG8A 2EWEA 2PYHA 2QX3A 3GRHA 3LMWA 4YEJA 2NTBA 3SUCA 3GQAA 2QY1A 2X3HA 2NSPA 4W8TA 4OJPA 1CZFA 4AVZA 3ZPPA 2VJJA 3EQOA 1KTWA 4XNFA 2Z8GA 5AMVA 1DBGA 3B8YA 1RWRA 5C1EA 4U49A 1DBOA 2X85A 4I84A 4YZ0A 1KCCA 2QXZA 4OJ5A 4XLHA 1BHEA 2NZMA 1RMGA 4EW9A 2X6XA 1O88A 4OJLA 1BN8A 3B4NA 1O8EA 2NTQA 4XN3A 4Z06A 3KRGA 3WWGA 2INVA 4XMYA 2UVFA 1O8LA 2PYGA 4YELA 1AIRA 2O04A 5C1CA 1X0CA 1GQ8A 1WMRA 1IDJA 2X6YA 1O8KA 2PECA 1O8DA 1EE6A 3EQNA 2VBEA 1O8HA 1IDKA 2X6WA 4XOPA 4XLFA 1K5CA
chains in the Genus database with same CATH superfamily
1VBLA 3DU1X 2V5IA 4YEIA 2NT9A 1JTAA 4XORA 3VSUA 4OM9A 1L1IA 1CLWA 1H80A 4XLCA 4XR6A 1PXZA 3N90A 4XOTA 4KH3A 4OJ6A 3B90A 2YUHA 3PSSA 2NTPA 3SZEA 1NHCA 1O8MA 4MR0A 4NK6A 4XKVA 4PMHA 4OJOA 1QA1A 1XG2A 2O0VA 1OGOX 4Z03A 2ODLA 3FY3A 3LJYA 2J8IA 4W8SA 3TH0A 4XONA 4NK8A 1TSPA 2VBKA 1TYXA 3N6ZA 4U4BA 2O17A 2XT4A 1JRGA 4OPWA 3SYJA 1DABA 1OGMX 2VBMA 4HWVA 4XKWA 1O8GA 2QYUA 2BM7A 3VSVA 1PLUA 3GQ8A 2B0RA 2BM5A 1O8IA 3JX8A 3BH7B 4XQFA 2QZAA 2VJIA 2O1DA 1QCXA 1QRCA 2F3LA 2UVEA 3VMVA 4MXNA 1TYUA 2BM4A 4XL9A 1OFMA 1O8FA 1QQ1A 2BX6A 4YDTA 4YZAA 4YCQA 1LLWA 4XM3A 2XTWA 4V02C 4JRAC 4XN0A 4OZYA 4W8QA 2O0WA 4YZQA 4YZXA 3UW0A 4C2LA 1OFLA 1QJVA 3GQ9A 3LYCA 4XLAA 2IQ7A 4Z05A 2INUA 5DNSA 3T9GA 1IB4A 2NT6A 1KCDA 4OZZA 1LM1A 1OFEA 2VFNA 4YFOA 1K8FA 3ZSCA 1IA5A 4URRA 1O8JA 2VFMA 4W8RA 3JURA 3PETA 4XLEA 2NSTA 2BSPA 3PSZA 3VMWA 3P4GA 1TYVA 2VFPA 2W7ZA 1EA0A 2VFQA 3GQ7A 3VSTA 1RU4A 1WXRA 1PE9A 1OOCA 1HG8A 2EWEA 2PYHA 2QX3A 3BH6B 3GRHA 3LMWA 2NTBA 4YEJA 3SQVA 1TYWA 3SUCA 3ML3A 3GQAA 1LLZA 2QY1A 2X3HA 2NSPA 2XTXA 4W8TA 3SY2A 4OJPA 1CZFA 4AVZA 1QA3A 3ZPPA 2VJJA 3EQOA 3H09A 1KTWA 4XNFA 1QA2A 2Z8GA 5AMVA 1DBGA 3AK5A 3B8YA 1RWRA 5C1EA 4U49A 1DBOA 2X85A 1EZGA 4I84A 4YZ0A 2G0YA 2QXZA 1KCCA 4OJ5A 4XLHA 3RIQA 1BHEA 2NZMA 1RMGA 2IOUG 4EW9A 2X6XA 1O88A 4OJLA 5JMCB 1KQ5A 1BN8A 3B4NA 1K5CA 1O8EA 2NTQA 1OFDA 4XN3A 4Z06A 3KRGA 3WWGA 3NAWA 2XTYA 2INVA 4XMYA 2UVFA 1QRBA 1O8LA 2PYGA 4YELA 1AIRA 2O04A 5C1CA 1K4ZA 1X0CA 2O6WA 1GQ8A 1WMRA 1HF2A 1IDJA 2X6YA 1O8KA 2PECA 4YC5A 1O8DA 1EE6A 2BM6A 3EQNA 2VBEA 1O8HA 3NB2A 1IDKA 2X6WA 2XT2A 4XOPA 5JLVC 2J8KA 2VFOA 4XLFA 2XC1A
chains in the Genus database with same CATH topology
1VBLA 2NT9A 1JTAA 4XORA 3VSUA 1H80A 4XLCA 4XR6A 1PXZA 4XOTA 4OJ6A 3B90A 2NTPA 1NHCA 1O8MA 4MR0A 4NK6A 4XKVA 4PMHA 4OJOA 1XG2A 2O0VA 1OGOX 4Z03A 2ODLA 3FY3A 4W8SA 4XONA 4NK8A 2VBKA 4U4BA 2O17A 1JRGA 1OGMX 2VBMA 4HWVA 4XKWA 1O8GA 3VSVA 1PLUA 3GQ8A 1O8IA 4XQFA 2VJIA 2O1DA 1QCXA 2UVEA 3VMVA 4MXNA 4XL9A 1OFMA 1O8FA 4YZAA 4XM3A 4XN0A 4OZYA 4W8QA 2O0WA 4YZQA 4YZXA 3UW0A 4C2LA 1OFLA 1QJVA 3GQ9A 4XLAA 2IQ7A 4Z05A 2INUA 3T9GA 1IB4A 2NT6A 1KCDA 4OZZA 3ZSCA 1IA5A 4URRA 1O8JA 4W8RA 3JURA 4XLEA 2NSTA 2BSPA 3VMWA 3GQ7A 3VSTA 1RU4A 1PE9A 1OOCA 1HG8A 2EWEA 2PYHA 2QX3A 3GRHA 3LMWA 4YEJA 2NTBA 3SUCA 3GQAA 2QY1A 2X3HA 2NSPA 4W8TA 4OJPA 1CZFA 4AVZA 3ZPPA 2VJJA 3EQOA 1KTWA 4XNFA 2Z8GA 5AMVA 1DBGA 3B8YA 1RWRA 5C1EA 4U49A 1DBOA 2X85A 4I84A 4YZ0A 1KCCA 2QXZA 4OJ5A 4XLHA 1BHEA 2NZMA 1RMGA 4EW9A 2X6XA 1O88A 4OJLA 1BN8A 3B4NA 1O8EA 2NTQA 4XN3A 4Z06A 3KRGA 3WWGA 2INVA 4XMYA 2UVFA 1O8LA 2PYGA 4YELA 1AIRA 2O04A 5C1CA 1X0CA 1GQ8A 1WMRA 1IDJA 2X6YA 1O8KA 2PECA 1O8DA 1EE6A 3EQNA 2VBEA 1O8HA 1IDKA 2X6WA 4XOPA 4XLFA 1K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBL A;  2NT9 A;  1JTA A;  4XOR A;  3VSU A;  1H80 A;  4XLC A;  4XR6 A;  1PXZ A;  4XOT A;  4OJ6 A;  3B90 A;  2NTP A;  1NHC A;  1O8M A;  4MR0 A;  4NK6 A;  4XKV A;  4PMH A;  4OJO A;  1XG2 A;  2O0V A;  1OGO X;  4Z03 A;  2ODL A;  3FY3 A;  4W8S A;  4XON A;  4NK8 A;  2VBK A;  4U4B A;  2O17 A;  1JRG A;  1OGM X;  2VBM A;  4HWV A;  4XKW A;  1O8G A;  3VSV A;  1PLU A;  3GQ8 A;  1O8I A;  4XQF A;  2VJI A;  2O1D A;  1QCX A;  2UVE A;  3VMV A;  4MXN A;  4XL9 A;  1OFM A;  1O8F A;  4YZA A;  4XM3 A;  4XN0 A;  4OZY A;  4W8Q A;  2O0W A;  4YZQ A;  4YZX A;  3UW0 A;  4C2L A;  1OFL A;  1QJV A;  3GQ9 A;  4XLA A;  2IQ7 A;  4Z05 A;  2INU A;  3T9G A;  1IB4 A;  2NT6 A;  1KCD A;  4OZZ A;  3ZSC A;  1IA5 A;  4URR A;  1O8J A;  4W8R A;  3JUR A;  4XLE A;  2NST A;  2BSP A;  3VMW A;  3GQ7 A;  3VST A;  1RU4 A;  1PE9 A;  1OOC A;  1HG8 A;  2EWE A;  2PYH A;  2QX3 A;  3GRH A;  3LMW A;  4YEJ A;  2NTB A;  3SUC A;  3GQA A;  2QY1 A;  2X3H A;  2NSP A;  4W8T A;  4OJP A;  1CZF A;  4AVZ A;  3ZPP A;  2VJJ A;  3EQO A;  1KTW A;  4XNF A;  2Z8G A;  5AMV A;  1DBG A;  3B8Y A;  1RWR A;  5C1E A;  4U49 A;  1DBO A;  2X85 A;  4I84 A;  4YZ0 A;  1KCC A;  2QXZ A;  4OJ5 A;  4XLH A;  1BHE A;  2NZM A;  1RMG A;  4EW9 A;  2X6X A;  1O88 A;  4OJL A;  1BN8 A;  3B4N A;  1O8E A;  2NTQ A;  4XN3 A;  4Z06 A;  3KRG A;  3WWG A;  2INV A;  4XMY A;  2UVF A;  1O8L A;  2PYG A;  4YEL A;  1AIR A;  2O04 A;  5C1C A;  1X0C A;  1GQ8 A;  1WMR A;  1IDJ A;  2X6Y A;  1O8K A;  2PEC A;  1O8D A;  1EE6 A;  3EQN A;  2VBE A;  1O8H A;  1IDK A;  2X6W A;  4XOP A;  4XLF A;  1K5C A; 
#chains in the Genus database with same CATH topology
 1VBL A;  3DU1 X;  2V5I A;  4YEI A;  2NT9 A;  1JTA A;  4XOR A;  3VSU A;  4OM9 A;  1L1I A;  1CLW A;  1H80 A;  4XLC A;  4XR6 A;  1PXZ A;  3N90 A;  4XOT A;  4KH3 A;  4OJ6 A;  3B90 A;  2YUH A;  3PSS A;  2NTP A;  3SZE A;  1NHC A;  1O8M A;  4MR0 A;  4NK6 A;  4XKV A;  4PMH A;  4OJO A;  1QA1 A;  1XG2 A;  2O0V A;  1OGO X;  4Z03 A;  2ODL A;  3FY3 A;  3LJY A;  2J8I A;  4W8S A;  3TH0 A;  4XON A;  4NK8 A;  1TSP A;  2VBK A;  1TYX A;  3N6Z A;  4U4B A;  2O17 A;  2XT4 A;  1JRG A;  4OPW A;  3SYJ A;  1DAB A;  1OGM X;  2VBM A;  4HWV A;  4XKW A;  1O8G A;  2QYU A;  2BM7 A;  3VSV A;  1PLU A;  3GQ8 A;  2B0R A;  2BM5 A;  1O8I A;  3JX8 A;  3BH7 B;  4XQF A;  2QZA A;  2VJI A;  2O1D A;  1QCX A;  1QRC A;  2F3L A;  2UVE A;  3VMV A;  4MXN A;  1TYU A;  2BM4 A;  4XL9 A;  1OFM A;  1O8F A;  1QQ1 A;  2BX6 A;  4YDT A;  4YZA A;  4YCQ A;  1LLW A;  4XM3 A;  2XTW A;  4V02 C;  4JRA C;  4XN0 A;  4OZY A;  4W8Q A;  2O0W A;  4YZQ A;  4YZX A;  3UW0 A;  4C2L A;  1OFL A;  1QJV A;  3GQ9 A;  3LYC A;  4XLA A;  2IQ7 A;  4Z05 A;  2INU A;  5DNS A;  3T9G A;  1IB4 A;  2NT6 A;  1KCD A;  4OZZ A;  1LM1 A;  1OFE A;  2VFN A;  4YFO A;  1K8F A;  3ZSC A;  1IA5 A;  4URR A;  1O8J A;  2VFM A;  4W8R A;  3JUR A;  3PET A;  4XLE A;  2NST A;  2BSP A;  3PSZ A;  3VMW A;  3P4G A;  1TYV A;  2VFP A;  2W7Z A;  1EA0 A;  2VFQ A;  3GQ7 A;  3VST A;  1RU4 A;  1WXR A;  1PE9 A;  1OOC A;  1HG8 A;  2EWE A;  2PYH A;  2QX3 A;  3BH6 B;  3GRH A;  3LMW A;  2NTB A;  4YEJ A;  3SQV A;  1TYW A;  3SUC A;  3ML3 A;  3GQA A;  1LLZ A;  2QY1 A;  2X3H A;  2NSP A;  2XTX A;  4W8T A;  3SY2 A;  4OJP A;  1CZF A;  4AVZ A;  1QA3 A;  3ZPP A;  2VJJ A;  3EQO A;  3H09 A;  1KTW A;  4XNF A;  1QA2 A;  2Z8G A;  5AMV A;  1DBG A;  3AK5 A;  3B8Y A;  1RWR A;  5C1E A;  4U49 A;  1DBO A;  2X85 A;  1EZG A;  4I84 A;  4YZ0 A;  2G0Y A;  2QXZ A;  1KCC A;  4OJ5 A;  4XLH A;  3RIQ A;  1BHE A;  2NZM A;  1RMG A;  2IOU G;  4EW9 A;  2X6X A;  1O88 A;  4OJL A;  5JMC B;  1KQ5 A;  1BN8 A;  3B4N A;  1K5C A;  1O8E A;  2NTQ A;  1OFD A;  4XN3 A;  4Z06 A;  3KRG A;  3WWG A;  3NAW A;  2XTY A;  2INV A;  4XMY A;  2UVF A;  1QRB A;  1O8L A;  2PYG A;  4YEL A;  1AIR A;  2O04 A;  5C1C A;  1K4Z A;  1X0C A;  2O6W A;  1GQ8 A;  1WMR A;  1HF2 A;  1IDJ A;  2X6Y A;  1O8K A;  2PEC A;  4YC5 A;  1O8D A;  1EE6 A;  2BM6 A;  3EQN A;  2VBE A;  1O8H A;  3NB2 A;  1IDK A;  2X6W A;  2XT2 A;  4XOP A;  5JLV C;  2J8K A;  2VFO A;  4XLF A;  2XC1 A; 
#chains in the Genus database with same CATH homology
 1VBL A;  2NT9 A;  1JTA A;  4XOR A;  3VSU A;  1H80 A;  4XLC A;  4XR6 A;  1PXZ A;  4XOT A;  4OJ6 A;  3B90 A;  2NTP A;  1NHC A;  1O8M A;  4MR0 A;  4NK6 A;  4XKV A;  4PMH A;  4OJO A;  1XG2 A;  2O0V A;  1OGO X;  4Z03 A;  2ODL A;  3FY3 A;  4W8S A;  4XON A;  4NK8 A;  2VBK A;  4U4B A;  2O17 A;  1JRG A;  1OGM X;  2VBM A;  4HWV A;  4XKW A;  1O8G A;  3VSV A;  1PLU A;  3GQ8 A;  1O8I A;  4XQF A;  2VJI A;  2O1D A;  1QCX A;  2UVE A;  3VMV A;  4MXN A;  4XL9 A;  1OFM A;  1O8F A;  4YZA A;  4XM3 A;  4XN0 A;  4OZY A;  4W8Q A;  2O0W A;  4YZQ A;  4YZX A;  3UW0 A;  4C2L A;  1OFL A;  1QJV A;  3GQ9 A;  4XLA A;  2IQ7 A;  4Z05 A;  2INU A;  3T9G A;  1IB4 A;  2NT6 A;  1KCD A;  4OZZ A;  3ZSC A;  1IA5 A;  4URR A;  1O8J A;  4W8R A;  3JUR A;  4XLE A;  2NST A;  2BSP A;  3VMW A;  3GQ7 A;  3VST A;  1RU4 A;  1PE9 A;  1OOC A;  1HG8 A;  2EWE A;  2PYH A;  2QX3 A;  3GRH A;  3LMW A;  4YEJ A;  2NTB A;  3SUC A;  3GQA A;  2QY1 A;  2X3H A;  2NSP A;  4W8T A;  4OJP A;  1CZF A;  4AVZ A;  3ZPP A;  2VJJ A;  3EQO A;  1KTW A;  4XNF A;  2Z8G A;  5AMV A;  1DBG A;  3B8Y A;  1RWR A;  5C1E A;  4U49 A;  1DBO A;  2X85 A;  4I84 A;  4YZ0 A;  1KCC A;  2QXZ A;  4OJ5 A;  4XLH A;  1BHE A;  2NZM A;  1RMG A;  4EW9 A;  2X6X A;  1O88 A;  4OJL A;  1BN8 A;  3B4N A;  1O8E A;  2NTQ A;  4XN3 A;  4Z06 A;  3KRG A;  3WWG A;  2INV A;  4XMY A;  2UVF A;  1O8L A;  2PYG A;  4YEL A;  1AIR A;  2O04 A;  5C1C A;  1X0C A;  1GQ8 A;  1WMR A;  1IDJ A;  2X6Y A;  1O8K A;  2PEC A;  1O8D A;  1EE6 A;  3EQN A;  2VBE A;  1O8H A;  1IDK A;  2X6W A;  4XOP A;  4XLF A;  1K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...