4YZQA

C. bescii family 3 pectate lyase double mutant k108a/q111n in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
b'HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFNLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzqA00
1IDKA 4XLAA 2NSTA 4YZ0A 4OJPA 1IB4A 2O1DA 4YZAA 1O8KA 4U49A 2X6YA 4PMHA 1DBGA 1O8MA 1O8HA 1O8IA 4XLFA 2UVEA 2INVA 3KRGA 4Z05A 2O04A 1PXZA 4W8TA 1O8GA 2X6XA 2O0VA 4XLCA 1NHCA 3LMWA 2O0WA 2O17A 4YELA 1PE9A 4OJ6A 4MR0A 2QX3A 2VBKA 2IQ7A 2NT6A 3GQ7A 3VSTA 1KCDA 3FY3A 5AMVA 4XN3A 1RWRA 1QCXA 1QJVA 2VJIA 3JURA 4XLEA 1O8JA 2VBMA 4OJ5A 2QXZA 2UVFA 4W8RA 5C1EA 1KCCA 2EWEA 1IA5A 3B4NA 4NK6A 3VSVA 1PLUA 4YZQA 1OGMX 3B8YA 3B90A 4XM3A 1DBOA 3WWGA 3GQAA 1CZFA 2VJJA 2PECA 4XNFA 4XOTA 3ZSCA 1KTWA 1JRGA 1RU4A 3EQNA 4W8SA 1EE6A 4AVZA 1BHEA 2NTPA 4XMYA 2PYGA 4XR6A 1O8FA 2X85A 1X0CA 1O8EA 1K5CA 2NSPA 2Z8GA 1OGOX 4XONA 4XLHA 1RMGA 3VSUA 1AIRA 2NTBA 1OFMA 4XKVA 4Z06A 1O8DA 3GRHA 1HG8A 4YZXA 4I84A 3T9GA 4C2LA 4URRA 4OZZA 2INUA 1WMRA 4XORA 1IDJA 4XQFA 4XKWA 2NTQA 1OOCA 1O8LA 4OJLA 4U4BA 3EQOA 1H80A 2NZMA 1JTAA 4XL9A 4XN0A 3UW0A 2NT9A 4Z03A 3GQ9A 2ODLA 2QY1A 1O88A 4YEJA 2VBEA 1GQ8A 2X6WA 2X3HA 4NK8A 4OJOA 3GQ8A 4EW9A 4W8QA 3VMWA 1XG2A 1BN8A 2BSPA 1VBLA 4XOPA 4HWVA 2PYHA 3VMVA 3ZPPA 5C1CA 4MXNA 4OZYA 3SUCA 1OFLA
chains in the Genus database with same CATH superfamily
1IDKA 4XLAA 2NSTA 4JRAC 2IOUG 3DU1X 4OJPA 4YZ0A 5JMCB 2J8IA 1IB4A 2O1DA 3H09A 4YZAA 1O8KA 3NAWA 4U49A 2B0RA 1TYWA 2X6YA 4PMHA 1DBGA 1O8MA 1O8HA 4OPWA 1O8IA 1DABA 4XLFA 2BX6A 2UVEA 2J8KA 1HF2A 2INVA 3KRGA 2QYUA 4YC5A 1TSPA 1K8FA 4Z05A 2O04A 3N90A 1PXZA 1LM1A 1TYXA 4W8TA 1O8GA 1QA1A 2X6XA 2O0VA 4XLCA 5DNSA 1NHCA 3LMWA 2O0WA 2O17A 4YELA 1PE9A 4OJ6A 4MR0A 3SYJA 2QX3A 2VFNA 4KH3A 2VBKA 2IQ7A 2NT6A 3GQ7A 3BH6B 3VSTA 1KCDA 2VFPA 3FY3A 5AMVA 4OM9A 4XN3A 1RWRA 1QCXA 1QJVA 1OFEA 2VJIA 3JURA 4XLEA 2W7ZA 3TH0A 3LJYA 1EA0A 1O8JA 2VBMA 4OJ5A 2QXZA 2UVFA 4W8RA 5C1EA 1KCCA 2EWEA 1IA5A 3B4NA 4NK6A 3VSVA 1PLUA 4YZQA 1OGMX 3B8YA 2F3LA 3B90A 1DBOA 4XM3A 3RIQA 1QA3A 3WWGA 3GQAA 1CZFA 3LYCA 2VJJA 4YFOA 1WXRA 1K4ZA 2PECA 4XNFA 4XOTA 3ZSCA 1KTWA 1JRGA 3PETA 3JX8A 1RU4A 3EQNA 4W8SA 1EE6A 4AVZA 1BHEA 2NTPA 4XMYA 2PYGA 4XR6A 1O8FA 2X85A 1X0CA 1O8EA 1K5CA 2NSPA 1CLWA 2Z8GA 3PSSA 1OGOX 2BM4A 4XONA 4XLHA 1RMGA 3SQVA 3VSUA 1AIRA 2NTBA 1OFMA 2V5IA 4XKVA 3SY2A 4Z06A 3AK5A 1O8DA 3GRHA 1HG8A 1EZGA 4YZXA 2YUHA 4I84A 3T9GA 2VFOA 4C2LA 4URRA 4OZZA 2O6WA 2INUA 1WMRA 4XORA 1IDJA 4YDTA 4XQFA 1QA2A 1LLZA 2BM6A 4XKWA 2NTQA 1OOCA 1O8LA 2BM5A 4OJLA 4U4BA 1QRBA 3PSZA 3EQOA 1H80A 2NZMA 2QZAA 2XTXA 3P4GA 1JTAA 1L1IA 4XL9A 3N6ZA 4YEIA 2G0YA 2VFMA 3NB2A 4XN0A 3UW0A 1OFDA 2NT9A 2VFQA 3BH7B 4Z03A 3ML3A 3GQ9A 2ODLA 2QY1A 4V02C 1TYUA 1O88A 4YEJA 2VBEA 1GQ8A 1QQ1A 2X3HA 2X6WA 4NK8A 4OJOA 4YCQA 3GQ8A 4EW9A 1TYVA 1LLWA 2XT4A 4W8QA 3VMWA 2XTYA 1XG2A 1BN8A 2BSPA 1QRCA 2XC1A 1KQ5A 1VBLA 3SZEA 4XOPA 4HWVA 2XT2A 2PYHA 3VMVA 3ZPPA 2XTWA 5C1CA 2BM7A 4MXNA 4OZYA 5JLVC 3SUCA 1OFLA
chains in the Genus database with same CATH topology
1IDKA 4XLAA 2NSTA 4YZ0A 4OJPA 1IB4A 2O1DA 4YZAA 1O8KA 4U49A 2X6YA 4PMHA 1DBGA 1O8MA 1O8HA 1O8IA 4XLFA 2UVEA 2INVA 3KRGA 4Z05A 2O04A 1PXZA 4W8TA 1O8GA 2X6XA 2O0VA 4XLCA 1NHCA 3LMWA 2O0WA 2O17A 4YELA 1PE9A 4OJ6A 4MR0A 2QX3A 2VBKA 2IQ7A 2NT6A 3GQ7A 3VSTA 1KCDA 3FY3A 5AMVA 4XN3A 1RWRA 1QCXA 1QJVA 2VJIA 3JURA 4XLEA 1O8JA 2VBMA 4OJ5A 2QXZA 2UVFA 4W8RA 5C1EA 1KCCA 2EWEA 1IA5A 3B4NA 4NK6A 3VSVA 1PLUA 4YZQA 1OGMX 3B8YA 3B90A 4XM3A 1DBOA 3WWGA 3GQAA 1CZFA 2VJJA 2PECA 4XNFA 4XOTA 3ZSCA 1KTWA 1JRGA 1RU4A 3EQNA 4W8SA 1EE6A 4AVZA 1BHEA 2NTPA 4XMYA 2PYGA 4XR6A 1O8FA 2X85A 1X0CA 1O8EA 1K5CA 2NSPA 2Z8GA 1OGOX 4XONA 4XLHA 1RMGA 3VSUA 1AIRA 2NTBA 1OFMA 4XKVA 4Z06A 1O8DA 3GRHA 1HG8A 4YZXA 4I84A 3T9GA 4C2LA 4URRA 4OZZA 2INUA 1WMRA 4XORA 1IDJA 4XQFA 4XKWA 2NTQA 1OOCA 1O8LA 4OJLA 4U4BA 3EQOA 1H80A 2NZMA 1JTAA 4XL9A 4XN0A 3UW0A 2NT9A 4Z03A 3GQ9A 2ODLA 2QY1A 1O88A 4YEJA 2VBEA 1GQ8A 2X6WA 2X3HA 4NK8A 4OJOA 3GQ8A 4EW9A 4W8QA 3VMWA 1XG2A 1BN8A 2BSPA 1VBLA 4XOPA 4HWVA 2PYHA 3VMVA 3ZPPA 5C1CA 4MXNA 4OZYA 3SUCA 1OFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDK A;  4XLA A;  2NST A;  4YZ0 A;  4OJP A;  1IB4 A;  2O1D A;  4YZA A;  1O8K A;  4U49 A;  2X6Y A;  4PMH A;  1DBG A;  1O8M A;  1O8H A;  1O8I A;  4XLF A;  2UVE A;  2INV A;  3KRG A;  4Z05 A;  2O04 A;  1PXZ A;  4W8T A;  1O8G A;  2X6X A;  2O0V A;  4XLC A;  1NHC A;  3LMW A;  2O0W A;  2O17 A;  4YEL A;  1PE9 A;  4OJ6 A;  4MR0 A;  2QX3 A;  2VBK A;  2IQ7 A;  2NT6 A;  3GQ7 A;  3VST A;  1KCD A;  3FY3 A;  5AMV A;  4XN3 A;  1RWR A;  1QCX A;  1QJV A;  2VJI A;  3JUR A;  4XLE A;  1O8J A;  2VBM A;  4OJ5 A;  2QXZ A;  2UVF A;  4W8R A;  5C1E A;  1KCC A;  2EWE A;  1IA5 A;  3B4N A;  4NK6 A;  3VSV A;  1PLU A;  4YZQ A;  1OGM X;  3B8Y A;  3B90 A;  4XM3 A;  1DBO A;  3WWG A;  3GQA A;  1CZF A;  2VJJ A;  2PEC A;  4XNF A;  4XOT A;  3ZSC A;  1KTW A;  1JRG A;  1RU4 A;  3EQN A;  4W8S A;  1EE6 A;  4AVZ A;  1BHE A;  2NTP A;  4XMY A;  2PYG A;  4XR6 A;  1O8F A;  2X85 A;  1X0C A;  1O8E A;  1K5C A;  2NSP A;  2Z8G A;  1OGO X;  4XON A;  4XLH A;  1RMG A;  3VSU A;  1AIR A;  2NTB A;  1OFM A;  4XKV A;  4Z06 A;  1O8D A;  3GRH A;  1HG8 A;  4YZX A;  4I84 A;  3T9G A;  4C2L A;  4URR A;  4OZZ A;  2INU A;  1WMR A;  4XOR A;  1IDJ A;  4XQF A;  4XKW A;  2NTQ A;  1OOC A;  1O8L A;  4OJL A;  4U4B A;  3EQO A;  1H80 A;  2NZM A;  1JTA A;  4XL9 A;  4XN0 A;  3UW0 A;  2NT9 A;  4Z03 A;  3GQ9 A;  2ODL A;  2QY1 A;  1O88 A;  4YEJ A;  2VBE A;  1GQ8 A;  2X6W A;  2X3H A;  4NK8 A;  4OJO A;  3GQ8 A;  4EW9 A;  4W8Q A;  3VMW A;  1XG2 A;  1BN8 A;  2BSP A;  1VBL A;  4XOP A;  4HWV A;  2PYH A;  3VMV A;  3ZPP A;  5C1C A;  4MXN A;  4OZY A;  3SUC A;  1OFL A; 
#chains in the Genus database with same CATH topology
 1IDK A;  4XLA A;  2NST A;  4JRA C;  2IOU G;  3DU1 X;  4OJP A;  4YZ0 A;  5JMC B;  2J8I A;  1IB4 A;  2O1D A;  3H09 A;  4YZA A;  1O8K A;  3NAW A;  4U49 A;  2B0R A;  1TYW A;  2X6Y A;  4PMH A;  1DBG A;  1O8M A;  1O8H A;  4OPW A;  1O8I A;  1DAB A;  4XLF A;  2BX6 A;  2UVE A;  2J8K A;  1HF2 A;  2INV A;  3KRG A;  2QYU A;  4YC5 A;  1TSP A;  1K8F A;  4Z05 A;  2O04 A;  3N90 A;  1PXZ A;  1LM1 A;  1TYX A;  4W8T A;  1O8G A;  1QA1 A;  2X6X A;  2O0V A;  4XLC A;  5DNS A;  1NHC A;  3LMW A;  2O0W A;  2O17 A;  4YEL A;  1PE9 A;  4OJ6 A;  4MR0 A;  3SYJ A;  2QX3 A;  2VFN A;  4KH3 A;  2VBK A;  2IQ7 A;  2NT6 A;  3GQ7 A;  3BH6 B;  3VST A;  1KCD A;  2VFP A;  3FY3 A;  5AMV A;  4OM9 A;  4XN3 A;  1RWR A;  1QCX A;  1QJV A;  1OFE A;  2VJI A;  3JUR A;  4XLE A;  2W7Z A;  3TH0 A;  3LJY A;  1EA0 A;  1O8J A;  2VBM A;  4OJ5 A;  2QXZ A;  2UVF A;  4W8R A;  5C1E A;  1KCC A;  2EWE A;  1IA5 A;  3B4N A;  4NK6 A;  3VSV A;  1PLU A;  4YZQ A;  1OGM X;  3B8Y A;  2F3L A;  3B90 A;  1DBO A;  4XM3 A;  3RIQ A;  1QA3 A;  3WWG A;  3GQA A;  1CZF A;  3LYC A;  2VJJ A;  4YFO A;  1WXR A;  1K4Z A;  2PEC A;  4XNF A;  4XOT A;  3ZSC A;  1KTW A;  1JRG A;  3PET A;  3JX8 A;  1RU4 A;  3EQN A;  4W8S A;  1EE6 A;  4AVZ A;  1BHE A;  2NTP A;  4XMY A;  2PYG A;  4XR6 A;  1O8F A;  2X85 A;  1X0C A;  1O8E A;  1K5C A;  2NSP A;  1CLW A;  2Z8G A;  3PSS A;  1OGO X;  2BM4 A;  4XON A;  4XLH A;  1RMG A;  3SQV A;  3VSU A;  1AIR A;  2NTB A;  1OFM A;  2V5I A;  4XKV A;  3SY2 A;  4Z06 A;  3AK5 A;  1O8D A;  3GRH A;  1HG8 A;  1EZG A;  4YZX A;  2YUH A;  4I84 A;  3T9G A;  2VFO A;  4C2L A;  4URR A;  4OZZ A;  2O6W A;  2INU A;  1WMR A;  4XOR A;  1IDJ A;  4YDT A;  4XQF A;  1QA2 A;  1LLZ A;  2BM6 A;  4XKW A;  2NTQ A;  1OOC A;  1O8L A;  2BM5 A;  4OJL A;  4U4B A;  1QRB A;  3PSZ A;  3EQO A;  1H80 A;  2NZM A;  2QZA A;  2XTX A;  3P4G A;  1JTA A;  1L1I A;  4XL9 A;  3N6Z A;  4YEI A;  2G0Y A;  2VFM A;  3NB2 A;  4XN0 A;  3UW0 A;  1OFD A;  2NT9 A;  2VFQ A;  3BH7 B;  4Z03 A;  3ML3 A;  3GQ9 A;  2ODL A;  2QY1 A;  4V02 C;  1TYU A;  1O88 A;  4YEJ A;  2VBE A;  1GQ8 A;  1QQ1 A;  2X3H A;  2X6W A;  4NK8 A;  4OJO A;  4YCQ A;  3GQ8 A;  4EW9 A;  1TYV A;  1LLW A;  2XT4 A;  4W8Q A;  3VMW A;  2XTY A;  1XG2 A;  1BN8 A;  2BSP A;  1QRC A;  2XC1 A;  1KQ5 A;  1VBL A;  3SZE A;  4XOP A;  4HWV A;  2XT2 A;  2PYH A;  3VMV A;  3ZPP A;  2XTW A;  5C1C A;  2BM7 A;  4MXN A;  4OZY A;  5JLV C;  3SUC A;  1OFL A; 
#chains in the Genus database with same CATH homology
 1IDK A;  4XLA A;  2NST A;  4YZ0 A;  4OJP A;  1IB4 A;  2O1D A;  4YZA A;  1O8K A;  4U49 A;  2X6Y A;  4PMH A;  1DBG A;  1O8M A;  1O8H A;  1O8I A;  4XLF A;  2UVE A;  2INV A;  3KRG A;  4Z05 A;  2O04 A;  1PXZ A;  4W8T A;  1O8G A;  2X6X A;  2O0V A;  4XLC A;  1NHC A;  3LMW A;  2O0W A;  2O17 A;  4YEL A;  1PE9 A;  4OJ6 A;  4MR0 A;  2QX3 A;  2VBK A;  2IQ7 A;  2NT6 A;  3GQ7 A;  3VST A;  1KCD A;  3FY3 A;  5AMV A;  4XN3 A;  1RWR A;  1QCX A;  1QJV A;  2VJI A;  3JUR A;  4XLE A;  1O8J A;  2VBM A;  4OJ5 A;  2QXZ A;  2UVF A;  4W8R A;  5C1E A;  1KCC A;  2EWE A;  1IA5 A;  3B4N A;  4NK6 A;  3VSV A;  1PLU A;  4YZQ A;  1OGM X;  3B8Y A;  3B90 A;  4XM3 A;  1DBO A;  3WWG A;  3GQA A;  1CZF A;  2VJJ A;  2PEC A;  4XNF A;  4XOT A;  3ZSC A;  1KTW A;  1JRG A;  1RU4 A;  3EQN A;  4W8S A;  1EE6 A;  4AVZ A;  1BHE A;  2NTP A;  4XMY A;  2PYG A;  4XR6 A;  1O8F A;  2X85 A;  1X0C A;  1O8E A;  1K5C A;  2NSP A;  2Z8G A;  1OGO X;  4XON A;  4XLH A;  1RMG A;  3VSU A;  1AIR A;  2NTB A;  1OFM A;  4XKV A;  4Z06 A;  1O8D A;  3GRH A;  1HG8 A;  4YZX A;  4I84 A;  3T9G A;  4C2L A;  4URR A;  4OZZ A;  2INU A;  1WMR A;  4XOR A;  1IDJ A;  4XQF A;  4XKW A;  2NTQ A;  1OOC A;  1O8L A;  4OJL A;  4U4B A;  3EQO A;  1H80 A;  2NZM A;  1JTA A;  4XL9 A;  4XN0 A;  3UW0 A;  2NT9 A;  4Z03 A;  3GQ9 A;  2ODL A;  2QY1 A;  1O88 A;  4YEJ A;  2VBE A;  1GQ8 A;  2X6W A;  2X3H A;  4NK8 A;  4OJO A;  3GQ8 A;  4EW9 A;  4W8Q A;  3VMW A;  1XG2 A;  1BN8 A;  2BSP A;  1VBL A;  4XOP A;  4HWV A;  2PYH A;  3VMV A;  3ZPP A;  5C1C A;  4MXN A;  4OZY A;  3SUC A;  1OFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...