4YZQA

C. bescii family 3 pectate lyase double mutant k108a/q111n in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFNLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzqA00
4U4BA 1JRGA 4XKWA 1BHEA 2QY1A 3EQOA 2VJIA 4HWVA 3VMWA 3ZSCA 1IA5A 4W8QA 1K5CA 2NTBA 4XMYA 1X0CA 1GQ8A 2X6WA 1H80A 3VMVA 4MXNA 3FY3A 4OJOA 4YZ0A 1PE9A 4W8TA 4OZZA 4NK8A 1AIRA 2ODLA 1O8IA 2O0WA 4OJ6A 1BN8A 1O8HA 2O17A 2UVEA 2EWEA 2QXZA 1RWRA 4PMHA 2NTPA 3GQ9A 4XQFA 2NT6A 4XNFA 3VSVA 3T9GA 4W8SA 1VBLA 1O8GA 2PECA 2NSPA 2UVFA 4YZXA 2PYGA 1RMGA 4XOTA 4YELA 2Z8GA 1HG8A 4URRA 2O0VA 4XOPA 1IDJA 4XLCA 4C2LA 4I84A 4XKVA 2INUA 2X85A 4XORA 1IDKA 2NZMA 4XN3A 3LMWA 1KCDA 4XLAA 4XLFA 4XLEA 2VBMA 1O8MA 4XLHA 4YEJA 1OFMA 4MR0A 1WMRA 2X6XA 5AMVA 1CZFA 1EE6A 1KTWA 3GQ8A 4XN0A 1OGOX 1O8DA 2O1DA 4YZQA 4YZAA 1RU4A 4W8RA 2X6YA 4XONA 4Z03A 4XL9A 2NSTA 1NHCA 3WWGA 2QX3A 3SUCA 1O8LA 4Z06A 3B90A 1O8EA 1O8FA 2PYHA 3JURA 4AVZA 3GQ7A 1DBOA 3B8YA 3B4NA 1XG2A 1QCXA 4Z05A 1OOCA 1IB4A 2NTQA 3KRGA 4OZYA 4OJLA 5C1EA 4XR6A 4NK6A 1O88A 5C1CA 4XM3A 1OFLA 1PLUA 3GQAA 3EQNA 3UW0A 4OJ5A 2VJJA 1O8JA 1PXZA 2X3HA 4EW9A 1OGMX 2VBKA 3VSUA 2BSPA 3ZPPA 2IQ7A 4U49A 2VBEA 3GRHA 3VSTA 1O8KA 4OJPA 1DBGA 1KCCA 2NT9A 2O04A 2INVA 1JTAA 1QJVA
chains in the Genus database with same CATH superfamily
4U4BA 1JRGA 4XKWA 1BHEA 4OPWA 2QY1A 1KQ5A 2VJIA 3EQOA 4V02C 3P4GA 4HWVA 4YFOA 3TH0A 3VMWA 3ZSCA 1QQ1A 1IA5A 4W8QA 4YCQA 1HF2A 1QRBA 1K5CA 2NTBA 4XMYA 3RIQA 2F3LA 1X0CA 3N6ZA 1GQ8A 2X6WA 1H80A 3VMVA 4MXNA 3FY3A 3LJYA 3PSZA 2QYUA 4OJOA 4YZ0A 1PE9A 4W8TA 4OZZA 1WXRA 3NB2A 4NK8A 1AIRA 2ODLA 1TSPA 1O8IA 2O0WA 4OJ6A 1BN8A 1O8HA 2BM7A 3NAWA 1QA3A 1LLWA 2O17A 2UVEA 1TYUA 2XT4A 2EWEA 3PSSA 1RWRA 2QXZA 4PMHA 2NTPA 3SY2A 3GQ9A 4XQFA 2NT6A 4XNFA 3VSVA 1TYXA 3T9GA 1TYWA 1QRCA 2BM5A 4W8SA 1VBLA 2XTYA 1O8GA 3H09A 2PECA 5DNSA 2VFPA 2NSPA 2UVFA 4YZXA 2PYGA 1RMGA 2VFOA 2XTXA 4XOTA 4YELA 3ML3A 4JRAC 2Z8GA 1HG8A 4URRA 2IOUG 2O0VA 1EA0A 4XOPA 1IDJA 4XLCA 4YC5A 4C2LA 1OFDA 4I84A 2INUA 4XKVA 2BM4A 2QZAA 2X85A 5JLVC 1OFEA 4XORA 1CLWA 1IDKA 2NZMA 2J8KA 3JX8A 3LMWA 4XN3A 2VFMA 4YEIA 1KCDA 3BH6B 1QA1A 4XLAA 4XLFA 4XLEA 2VBMA 1O8MA 4XLHA 4YEJA 2BX6A 1OFMA 3BH7B 4MR0A 1TYVA 1WMRA 2X6XA 5AMVA 1CZFA 1EE6A 3AK5A 1KTWA 3GQ8A 1LLZA 4XN0A 1OGOX 1O8DA 2O1DA 2YUHA 4YZAA 4YZQA 1RU4A 4W8RA 1K4ZA 2X6YA 3PETA 2XC1A 4XONA 4Z03A 4XL9A 3SZEA 2NSTA 1NHCA 1DABA 3WWGA 2O6WA 2QX3A 3SUCA 2XT2A 1O8LA 2VFNA 4KH3A 4Z06A 3B90A 1O8EA 3LYCA 1O8FA 2PYHA 3JURA 4AVZA 3GQ7A 1DBOA 1QA2A 3B8YA 4YDTA 3B4NA 2VFQA 1XG2A 2W7ZA 1QCXA 4Z05A 1OOCA 1IB4A 2NTQA 3SYJA 3KRGA 3N90A 4OZYA 4OJLA 1LM1A 1EZGA 3DU1X 5C1EA 4XR6A 4NK6A 5JMCB 1O88A 4OM9A 5C1CA 4XM3A 1OFLA 1PLUA 3GQAA 3EQNA 2G0YA 4OJ5A 3SQVA 3UW0A 2VJJA 1O8JA 1PXZA 2X3HA 2XTWA 1OGMX 2VBKA 3VSUA 4EW9A 2BSPA 2J8IA 2BM6A 3ZPPA 2IQ7A 4U49A 2VBEA 3GRHA 3VSTA 1L1IA 1O8KA 4OJPA 1DBGA 1K8FA 1KCCA 2NT9A 2V5IA 2O04A 2B0RA 2INVA 1JTAA 1QJVA
chains in the Genus database with same CATH topology
4U4BA 1JRGA 4XKWA 1BHEA 2QY1A 3EQOA 2VJIA 4HWVA 3VMWA 3ZSCA 1IA5A 4W8QA 1K5CA 2NTBA 4XMYA 1X0CA 1GQ8A 2X6WA 1H80A 3VMVA 4MXNA 3FY3A 4OJOA 4YZ0A 1PE9A 4W8TA 4OZZA 4NK8A 1AIRA 2ODLA 1O8IA 2O0WA 4OJ6A 1BN8A 1O8HA 2O17A 2UVEA 2EWEA 2QXZA 1RWRA 4PMHA 2NTPA 3GQ9A 4XQFA 2NT6A 4XNFA 3VSVA 3T9GA 4W8SA 1VBLA 1O8GA 2PECA 2NSPA 2UVFA 4YZXA 2PYGA 1RMGA 4XOTA 4YELA 2Z8GA 1HG8A 4URRA 2O0VA 4XOPA 1IDJA 4XLCA 4C2LA 4I84A 4XKVA 2INUA 2X85A 4XORA 1IDKA 2NZMA 4XN3A 3LMWA 1KCDA 4XLAA 4XLFA 4XLEA 2VBMA 1O8MA 4XLHA 4YEJA 1OFMA 4MR0A 1WMRA 2X6XA 5AMVA 1CZFA 1EE6A 1KTWA 3GQ8A 4XN0A 1OGOX 1O8DA 2O1DA 4YZQA 4YZAA 1RU4A 4W8RA 2X6YA 4XONA 4Z03A 4XL9A 2NSTA 1NHCA 3WWGA 2QX3A 3SUCA 1O8LA 4Z06A 3B90A 1O8EA 1O8FA 2PYHA 3JURA 4AVZA 3GQ7A 1DBOA 3B8YA 3B4NA 1XG2A 1QCXA 4Z05A 1OOCA 1IB4A 2NTQA 3KRGA 4OZYA 4OJLA 5C1EA 4XR6A 4NK6A 1O88A 5C1CA 4XM3A 1OFLA 1PLUA 3GQAA 3EQNA 3UW0A 4OJ5A 2VJJA 1O8JA 1PXZA 2X3HA 4EW9A 1OGMX 2VBKA 3VSUA 2BSPA 3ZPPA 2IQ7A 4U49A 2VBEA 3GRHA 3VSTA 1O8KA 4OJPA 1DBGA 1KCCA 2NT9A 2O04A 2INVA 1JTAA 1QJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  1JRG A;  4XKW A;  1BHE A;  2QY1 A;  3EQO A;  2VJI A;  4HWV A;  3VMW A;  3ZSC A;  1IA5 A;  4W8Q A;  1K5C A;  2NTB A;  4XMY A;  1X0C A;  1GQ8 A;  2X6W A;  1H80 A;  3VMV A;  4MXN A;  3FY3 A;  4OJO A;  4YZ0 A;  1PE9 A;  4W8T A;  4OZZ A;  4NK8 A;  1AIR A;  2ODL A;  1O8I A;  2O0W A;  4OJ6 A;  1BN8 A;  1O8H A;  2O17 A;  2UVE A;  2EWE A;  2QXZ A;  1RWR A;  4PMH A;  2NTP A;  3GQ9 A;  4XQF A;  2NT6 A;  4XNF A;  3VSV A;  3T9G A;  4W8S A;  1VBL A;  1O8G A;  2PEC A;  2NSP A;  2UVF A;  4YZX A;  2PYG A;  1RMG A;  4XOT A;  4YEL A;  2Z8G A;  1HG8 A;  4URR A;  2O0V A;  4XOP A;  1IDJ A;  4XLC A;  4C2L A;  4I84 A;  4XKV A;  2INU A;  2X85 A;  4XOR A;  1IDK A;  2NZM A;  4XN3 A;  3LMW A;  1KCD A;  4XLA A;  4XLF A;  4XLE A;  2VBM A;  1O8M A;  4XLH A;  4YEJ A;  1OFM A;  4MR0 A;  1WMR A;  2X6X A;  5AMV A;  1CZF A;  1EE6 A;  1KTW A;  3GQ8 A;  4XN0 A;  1OGO X;  1O8D A;  2O1D A;  4YZQ A;  4YZA A;  1RU4 A;  4W8R A;  2X6Y A;  4XON A;  4Z03 A;  4XL9 A;  2NST A;  1NHC A;  3WWG A;  2QX3 A;  3SUC A;  1O8L A;  4Z06 A;  3B90 A;  1O8E A;  1O8F A;  2PYH A;  3JUR A;  4AVZ A;  3GQ7 A;  1DBO A;  3B8Y A;  3B4N A;  1XG2 A;  1QCX A;  4Z05 A;  1OOC A;  1IB4 A;  2NTQ A;  3KRG A;  4OZY A;  4OJL A;  5C1E A;  4XR6 A;  4NK6 A;  1O88 A;  5C1C A;  4XM3 A;  1OFL A;  1PLU A;  3GQA A;  3EQN A;  3UW0 A;  4OJ5 A;  2VJJ A;  1O8J A;  1PXZ A;  2X3H A;  4EW9 A;  1OGM X;  2VBK A;  3VSU A;  2BSP A;  3ZPP A;  2IQ7 A;  4U49 A;  2VBE A;  3GRH A;  3VST A;  1O8K A;  4OJP A;  1DBG A;  1KCC A;  2NT9 A;  2O04 A;  2INV A;  1JTA A;  1QJV A; 
#chains in the Genus database with same CATH topology
 4U4B A;  1JRG A;  4XKW A;  1BHE A;  4OPW A;  2QY1 A;  1KQ5 A;  2VJI A;  3EQO A;  4V02 C;  3P4G A;  4HWV A;  4YFO A;  3TH0 A;  3VMW A;  3ZSC A;  1QQ1 A;  1IA5 A;  4W8Q A;  4YCQ A;  1HF2 A;  1QRB A;  1K5C A;  2NTB A;  4XMY A;  3RIQ A;  2F3L A;  1X0C A;  3N6Z A;  1GQ8 A;  2X6W A;  1H80 A;  3VMV A;  4MXN A;  3FY3 A;  3LJY A;  3PSZ A;  2QYU A;  4OJO A;  4YZ0 A;  1PE9 A;  4W8T A;  4OZZ A;  1WXR A;  3NB2 A;  4NK8 A;  1AIR A;  2ODL A;  1TSP A;  1O8I A;  2O0W A;  4OJ6 A;  1BN8 A;  1O8H A;  2BM7 A;  3NAW A;  1QA3 A;  1LLW A;  2O17 A;  2UVE A;  1TYU A;  2XT4 A;  2EWE A;  3PSS A;  1RWR A;  2QXZ A;  4PMH A;  2NTP A;  3SY2 A;  3GQ9 A;  4XQF A;  2NT6 A;  4XNF A;  3VSV A;  1TYX A;  3T9G A;  1TYW A;  1QRC A;  2BM5 A;  4W8S A;  1VBL A;  2XTY A;  1O8G A;  3H09 A;  2PEC A;  5DNS A;  2VFP A;  2NSP A;  2UVF A;  4YZX A;  2PYG A;  1RMG A;  2VFO A;  2XTX A;  4XOT A;  4YEL A;  3ML3 A;  4JRA C;  2Z8G A;  1HG8 A;  4URR A;  2IOU G;  2O0V A;  1EA0 A;  4XOP A;  1IDJ A;  4XLC A;  4YC5 A;  4C2L A;  1OFD A;  4I84 A;  2INU A;  4XKV A;  2BM4 A;  2QZA A;  2X85 A;  5JLV C;  1OFE A;  4XOR A;  1CLW A;  1IDK A;  2NZM A;  2J8K A;  3JX8 A;  3LMW A;  4XN3 A;  2VFM A;  4YEI A;  1KCD A;  3BH6 B;  1QA1 A;  4XLA A;  4XLF A;  4XLE A;  2VBM A;  1O8M A;  4XLH A;  4YEJ A;  2BX6 A;  1OFM A;  3BH7 B;  4MR0 A;  1TYV A;  1WMR A;  2X6X A;  5AMV A;  1CZF A;  1EE6 A;  3AK5 A;  1KTW A;  3GQ8 A;  1LLZ A;  4XN0 A;  1OGO X;  1O8D A;  2O1D A;  2YUH A;  4YZA A;  4YZQ A;  1RU4 A;  4W8R A;  1K4Z A;  2X6Y A;  3PET A;  2XC1 A;  4XON A;  4Z03 A;  4XL9 A;  3SZE A;  2NST A;  1NHC A;  1DAB A;  3WWG A;  2O6W A;  2QX3 A;  3SUC A;  2XT2 A;  1O8L A;  2VFN A;  4KH3 A;  4Z06 A;  3B90 A;  1O8E A;  3LYC A;  1O8F A;  2PYH A;  3JUR A;  4AVZ A;  3GQ7 A;  1DBO A;  1QA2 A;  3B8Y A;  4YDT A;  3B4N A;  2VFQ A;  1XG2 A;  2W7Z A;  1QCX A;  4Z05 A;  1OOC A;  1IB4 A;  2NTQ A;  3SYJ A;  3KRG A;  3N90 A;  4OZY A;  4OJL A;  1LM1 A;  1EZG A;  3DU1 X;  5C1E A;  4XR6 A;  4NK6 A;  5JMC B;  1O88 A;  4OM9 A;  5C1C A;  4XM3 A;  1OFL A;  1PLU A;  3GQA A;  3EQN A;  2G0Y A;  4OJ5 A;  3SQV A;  3UW0 A;  2VJJ A;  1O8J A;  1PXZ A;  2X3H A;  2XTW A;  1OGM X;  2VBK A;  3VSU A;  4EW9 A;  2BSP A;  2J8I A;  2BM6 A;  3ZPP A;  2IQ7 A;  4U49 A;  2VBE A;  3GRH A;  3VST A;  1L1I A;  1O8K A;  4OJP A;  1DBG A;  1K8F A;  1KCC A;  2NT9 A;  2V5I A;  2O04 A;  2B0R A;  2INV A;  1JTA A;  1QJV A; 
#chains in the Genus database with same CATH homology
 4U4B A;  1JRG A;  4XKW A;  1BHE A;  2QY1 A;  3EQO A;  2VJI A;  4HWV A;  3VMW A;  3ZSC A;  1IA5 A;  4W8Q A;  1K5C A;  2NTB A;  4XMY A;  1X0C A;  1GQ8 A;  2X6W A;  1H80 A;  3VMV A;  4MXN A;  3FY3 A;  4OJO A;  4YZ0 A;  1PE9 A;  4W8T A;  4OZZ A;  4NK8 A;  1AIR A;  2ODL A;  1O8I A;  2O0W A;  4OJ6 A;  1BN8 A;  1O8H A;  2O17 A;  2UVE A;  2EWE A;  2QXZ A;  1RWR A;  4PMH A;  2NTP A;  3GQ9 A;  4XQF A;  2NT6 A;  4XNF A;  3VSV A;  3T9G A;  4W8S A;  1VBL A;  1O8G A;  2PEC A;  2NSP A;  2UVF A;  4YZX A;  2PYG A;  1RMG A;  4XOT A;  4YEL A;  2Z8G A;  1HG8 A;  4URR A;  2O0V A;  4XOP A;  1IDJ A;  4XLC A;  4C2L A;  4I84 A;  4XKV A;  2INU A;  2X85 A;  4XOR A;  1IDK A;  2NZM A;  4XN3 A;  3LMW A;  1KCD A;  4XLA A;  4XLF A;  4XLE A;  2VBM A;  1O8M A;  4XLH A;  4YEJ A;  1OFM A;  4MR0 A;  1WMR A;  2X6X A;  5AMV A;  1CZF A;  1EE6 A;  1KTW A;  3GQ8 A;  4XN0 A;  1OGO X;  1O8D A;  2O1D A;  4YZQ A;  4YZA A;  1RU4 A;  4W8R A;  2X6Y A;  4XON A;  4Z03 A;  4XL9 A;  2NST A;  1NHC A;  3WWG A;  2QX3 A;  3SUC A;  1O8L A;  4Z06 A;  3B90 A;  1O8E A;  1O8F A;  2PYH A;  3JUR A;  4AVZ A;  3GQ7 A;  1DBO A;  3B8Y A;  3B4N A;  1XG2 A;  1QCX A;  4Z05 A;  1OOC A;  1IB4 A;  2NTQ A;  3KRG A;  4OZY A;  4OJL A;  5C1E A;  4XR6 A;  4NK6 A;  1O88 A;  5C1C A;  4XM3 A;  1OFL A;  1PLU A;  3GQA A;  3EQN A;  3UW0 A;  4OJ5 A;  2VJJ A;  1O8J A;  1PXZ A;  2X3H A;  4EW9 A;  1OGM X;  2VBK A;  3VSU A;  2BSP A;  3ZPP A;  2IQ7 A;  4U49 A;  2VBE A;  3GRH A;  3VST A;  1O8K A;  4OJP A;  1DBG A;  1KCC A;  2NT9 A;  2O04 A;  2INV A;  1JTA A;  1QJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...