4XORA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xorA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xorA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xorA02
1BN8A 2NSTA 3ZSCA 1QCXA 2X6XA 2UVFA 4XONA 2QX3A 3SUCA 1O8HA 1OFMA 4XLCA 3B90A 4XLEA 2NTQA 2NTPA 3WWGA 3B4NA 2VBKA 1IA5A 1RMGA 4XQFA 3VSUA 3ZPPA 3LMWA 4YEJA 1DBGA 4XNFA 2UVEA 2IQ7A 2PYHA 1VBLA 4XN3A 4I84A 5C1CA 1PE9A 4XOPA 1HG8A 1CZFA 2VJIA 4EW9A 1O8LA 2O1DA 4NK6A 4OZZA 1O8KA 4YZ0A 2VJJA 1KTWA 4MR0A 3B8YA 3JURA 4W8RA 1KCCA 3KRGA 4XM3A 1O8IA 1GQ8A 4XR6A 3VSTA 1O88A 4XLFA 4W8SA 3T9GA 4PMHA 4XL9A 4W8QA 1O8GA 1WMRA 2X6YA 4YZQA 1O8MA 4YZXA 3VMWA 1OOCA 2PYGA 1JTAA 2O04A 2VBMA 1AIRA 3EQOA 3GQAA 2QXZA 4OJ5A 3FY3A 1O8JA 4OJPA 1O8DA 2NTBA 1JRGA 2PECA 1QJVA 4OJ6A 1RU4A 4XKWA 2O0VA 2VBEA 4U4BA 4YZAA 4Z03A 1NHCA 4XLAA 1H80A 4XKVA 4C2LA 4XOTA 2INVA 4OZYA 3EQNA 4XMYA 2X3HA 4OJOA 4XN0A 2O17A 2X85A 4URRA 3GQ8A 1IB4A 2NT6A 5AMVA 2INUA 1IDKA 3GQ7A 4AVZA 4XLHA 1XG2A 4OJLA 1O8FA 1K5CA 1OFLA 1RWRA 1X0CA 2QY1A 2O0WA 2X6WA 2ODLA 4Z06A 1EE6A 4XORA 1IDJA 1OGOX 1PXZA 4Z05A 4MXNA 1BHEA 2NT9A 3VSVA 4W8TA 4U49A 5C1EA 1KCDA 1OGMX 2EWEA 4YELA 2Z8GA 1PLUA 4HWVA 3UW0A 4NK8A 1O8EA 2NZMA 1DBOA 3VMVA 3GRHA 2BSPA 3GQ9A 2NSPA
chains in the Genus database with same CATH superfamily
3IWZA 1S7AA 3KIOA 3CO7C 2QKMB 5AIPA 2ZNYA 4PABA 3ZSCA 3WNCA 1WFXA 1VQ7B 3E6BA 3BT9A 1GR1A 3G1MA 1Q7YD 1MDMA 1BPLA 2D5VA 2W7NA 3EETA 1R36A 2I5UA 2NTPA 4G7OF 4BU2A 1GHCA 1B2RA 3GVJA 4IXAA 3CCLI 2HQAA 3M9AA 2H6BA 3A01A 2DI3A 4DNRB 3CUOA 4XNFA 3BQYA 3F3XA 3RPQA 2KKOA 4B3AA 5KHDA 2DPDA 1W2BB 1Q81D 3MKLA 1OCTC 1TYUA 3BR3A 3DKWA 3FX3A 4HF2A 2BM4A 3QPSA 2FSWA 4BE2A 3IC7A 1PE9A 2VJIA 2Q0OA 5J1UA 4S0HB 4B47A 5J8FA 3K9TA 2ID3A 1VQLI 4YZ0A 2P6TA 2FD5A 1UD8A 1FT9A 4C43A 3EUKL 3SDGA 1BQEA 5E1ZB 4YALA 4FTHA 1IF1A 4M9ZA 2YWHA 1YIJB 5GPCA 3DKYA 4M0LA 5E8GA 1D0XA 1SFXA 5BOXA 1EFRA 2ESNA 3QU3A 2HOTA 1KK3A 1TQMA 2ZMEA 1HLVA 5JHUA 4HV5A 2V7WA 2V7FA 2DAOA 2P7VB 4FE4A 2YU3A 4U88A 3MCAA 3HOVJ 3D0SA 3LL7A 1ZM9A 1BIAA 4KDPA 5FO0A 2E1NA 2UZKA 3I55B 1IV6A 1ON2A 2YU9J 1O8JA 1H42A 3A1PA 5HLIA 1KK2A 1JE8A 3P9IA 5DEQA 2FQ3A 4PGOA 2QF7A 1YRNA 2ZB9A 1ZLJA 2DCEA 3HYIA 2B0RA 5HNHA 2IGOA 4A3DJ 3CCVB 2BY2A 2O6GE 3Q6QA 5HKKA 3CUQC 1QH0A 3EQNA 1HKTA 2MFZA 2WWYA 4E7IA 2VNJA 2JTVA 1TC3C 2BZTA 5CDFA 2V9PA 3KZZA 4A5MA 2QQ8A 2JUCA 2GQFA 1PJ5A 2CNDA 1HDPA 2ZO4A 2GIZA 3RYPA 3HOUJ 2R7UA 1BBYA 1V5EA 4Q47A 4XLHA 3OAAA 3VDXA 1VQKI 2TRTA 1ZRFA 1QFYA 3OKXA 2CW5A 2DT5A 2MW8A 4TSFA 3G71B 1F36A 3GO5A 3C7JA 2EZLA 5M3MJ 1R9TJ 1CNEA 1A6QA 4NDLA 2EK5A 1N78A 2FVGA 1FIAA 2XB5A 2DT7B 1W7PA 4BYYA 4EJTA 1ODDA 2L4MA 4DOZA 1E3XA 1WXRA 1PXZA 3K4LA 4P25A 2Y0SN 4RD6A 1TTYA 1R1TA 1O3RA 2H1LA 2LY9A 2HQNA 2XV4S 3K4NA 5CVVA 1IDZA 2BEOA 5FLXK 4H4KC 2AXTC 2DOGA 1X1DA 2HOAA 1ONVA 1FNMA 3CESA 5DM6F 2LY1A 3I3LA 2YWFA 4NK8A 3CP2A 3W5VA 2RNJA 3FISA 1R5OA 2X48A 2XGCA 3CCUI 3CC4B 4RBOA 3FF5A 2WAFA 4Z4UA 2K9SA 3A03A 3LFKA 4QFMA 4AC9A 3SLDA 3DPUA 3WGIA 4C2UA 3O2PE 1ETQA 2QTZA 2HZDA 4P22A 3B90A 4P9UA 3OIOA 5K1YA 2Y2ZA 3Q5FA 2E1OA 2DMQA 1DQUA 3I56I 1SKYB 2V1DA 3BG9A 2R7QA 2M7AA 2MLKA 1WSRA 2E1RA 5GP9A 3BR1A 2HVSA 4JX6A 2IT0A 2XPUA 4GQNA 5CQGA 4UUSB 3HRTA 3F72A 3LQ6A 2IS2A 2ECCA 4EATA 4ZDLA 2P3MA 4G94A 3RQ4A 4RJLA 3U1KA 3OOPA 2K5CA 4OMZA 3WU1B 1ZLKA 1N25A 2FX3A 2RC6A 3TDZC 3BG6A 1A5JA 2VNHA 1LB2A 1VQMI 1IXSB 4M6YA 3T5XA 1EP2B 2K9LA 4XM3A 1Z77A 2ZZEA 5FO1A 3KP5A 4DYQA 2NVXJ 3FBIB 3X2QH 5D8LB 2CG4A 5F0CA 2JK3A 4KITB 2X1DA 1JHHA 4DYCA 3H9QA 3SQNA 3RPUA 3F6OA 4YZQA 1IN5A 3JQRA 3JRDA 4L9JA 5L3DA 2HPMA 1Z05A 2LF7A 1JTAA 1G59A 2QTLA 3KCCA 3K10A 3K2ZA 5B5EC 1UD2A 2O04A 2F3LA 1VQ4B 2CUZA 4KKSA 2ETHA 3GBGA 4PSWA 2KIMA 2GREA 1KQ5A 2JIZA 2WAQA 1N0VC 2R3SA 3EUAA 1QBJA 1UCRA 1A36A 3WQZA 1HCRA 1BI2A 4QLCU 2XOKA 3J81k 4LLLA 1OYWA 1TWHJ 2HGCA 4IL6C 1YJNI 4DQ2A 3PSFA 1T38A 1Y56A 2DK5A 1QX4A 3JRAA 5IYBJ 3PNVA 1OKRA 2ESHA 1XDUA 2FNPA 2VI6A 1XD7A 4A3BJ 2P0WA 1SD6A 3S2DJ 3CCLB 1JJ2B 1IUFA 4NUBA 3ZR8X 4IHWA 4IEJA 1CLWA 2QKLB 2XAQA 4HX8A 1D5YA 1J9ZA 3ZQFA 4U7DA 1HKSA 1BX0A 3GIRA 4P6VF 4RD1A 1IRFA 2L7FP 2O5RA 4D7NA 4MFEA 2OBRA 3EUHC 3TW6A 2HXOA 2Z3YA 5E8IA 5FLMJ 1VQLB 2K4JA 2GXGA 4RD0A 3OYGA 1IXRC 2EILH 3DF8A 1G7RA 4PJ0C 2YUSA 2NNYA 2DA3A 3KEOA 3K4BA 1UAAA 5F0FA 4MHGA 5LLQA 1IJWC 3PO3J 3S17J 3W2EA 2M87A 4QHYA 2EQRA 3I9V2 3CMEI 1FLIA 4RGSA 3SEJA 3W2VA 1FTTA 1FJLA 3QQAA 1IJFA 2DMUA 4YEIA 4YFNF 4JYKA 3K0LA 3GQ9A 1J59A 3M8JA 4TT3A 2BW3B 1BN8A 2BOLA 3TGNA 3CXCB 1QNTA 2Z6BD 3E97A 2C6YA 1MIJA 5JHFA 5DS0A 2V7UA 1N08A 1Y6IA 1ZARA 2JJ7A 2JA6J 4ZH4F 4F92B 5H6QA 4M6XA 1CF7A 1PJ7A 2CUJA 2BXZA 2LLKA 3IP4B 4IVNA 1UFMA 3WE3A 1RMGA 2VBSA 4HBLA 1S6LA 3WTXC 3D1NI 5E6TA 4B09A 2WPDA 2JA2A 1ZQ3P 3U6BA 4JBAA 4EM2A 2OAZA 2GJKA 2E35A 3PNYA 3S1MJ 2MD0A 3OYKA 1JUPA 3LNNA 4CYDA 5FFZA 1DGRM 2HDNB 2XAJA 1K6OA 1VQKB 1S72I 2CQNA 3DU6A 4AVPA 1H0MA 3B8HA 3BZ6A 2JVGA 5FKLA 2O9LA 1W9XA 2C5BA 4OOVA 5L3BA 2KT0A 3RIRA 2HKXA 2VOOA 1LDKB 2V79A 4ZV4A 3H36A 5E1WA 3ZRGA 5J6XA 1G7SA 4J01A 1GJRA 1O8GA 1PJRA 3PSIA 2DDAA 2XZOA 4KT5C 2EFPA 4P9SA 4KICA 1DU0A 1F1ZA 1S3JA 3ZQIA 4RPDA 3OYLA 5AMVA 4GXOA 3FXRA 3JREA 2VFMA 2QENA 2VASA 4OJPA 2VKEA 4H9GA 4BGDA 1WP6A 2JSPA 5DCMA 3LSMA 4G7HF 4ZGQB 3G1OA 1HW1A 1U6GA 2NS0A 3QPHA 3LMMA 2VBEA 4Z03A 2XNJA 5L3CA 1H80A 5DTDA 4PJJA 2TDXA 3MZ8A 1XGOA 5KNLA 4JQFA 4LGWA 4V2FA 1KYWA 3FPKA 3CPXA 1W0UA 2FOWA 2MLGA 2Y0SA 2VKVA 3LAPA 1GVHA 2YUHA 3I56B 3HZJA 3L2CA 3TP0A 2E19A 5D5VB 4HDUA 3GQ7A 3V76A 2DDBA 2IGKA 3B82A 3KP2A 2ZNZA 4M9SA 5GTHC 3VNVA 1QQ1A 2V4JC 2R5YA 2KVOA 2HDWA 5ICEA 4M1KA 2B9SA 3NARA 3NRVA 3GTJJ 5ICFA 2HVRA 4RGRA 3DTIA 1B8IB 1Q1HA 1ZG3A 5IP9J 3DU5A 1KK1A 1GO2A 2R7OA 3ERED 2B7EA 4EMSA 3KETA 1NTCA 2KIQA 2MH9A 1HA8A 1BJAA 3SQVA 3SDBA 3P27A 3QYEA 1WJDA 1LFBA 3Q0WA 4N4OB 5ICCA 1QA6A 2EIXA 5EMNA 5M5YJ 3ISXA 5DD4A 3FXOA 2ZBKA 1E64A 1QVFB 3IH4A 3ES9A 1IRZA 2ELJA 3CJQB 3VOEA 1OGMX 1BJZA 3VEPA 5FFXA 1PLUA 3CC2I 2GXBA 3OW7A 1UJ8A 2GA1A 3L2VA 1A35A 1TZLA 4B4DA 3AG2H 3H3UA 2D2WA 5GAGJ 3PM1A 4KKUA 3WTZA 3F0CA 5KSWB 2YWGA 1VHOA 3I5UA 3DEEA 1VQ5I 5LGTA 3HKZN 5HDKA 2BMWA 4UXNA 3QSYA 2NS7A 4N0BA 3K70C 3HRUA 4YHBA 5IYDJ 3D5LA 4MFDA 1YJNB 4IF4A 3E1SA 5J3OA 3CUQA 2LZJA 2GAUA 4YEJA 1U9NA 2JPBA 1LNWA 2M4KA 2QN6A 3ASTA 4P6YA 1NG7A 3AKZA 1PDNC 3REOA 4ZDPA 2RN7A 2E2JJ 2DMPA 5KW9A 1UELB 2FOKA 3GWZA 2OYNA 1W5SA 3CCYA 4O5VA 4XN3A 2MSYA 4PFOA 1FZPB 5C1CA 4RAFA 3TOBA 1IXCA 3DBRB 1H8AC 3P26A 2HR3A 4JP0A 5H20A 3JTHA 3TP3A 4WZKA 2HS5A 3D5RC 4XRSG 1R5BA 1SKQA 2BE5F 1VF7A 1W1WE 2VPLA 2JVHA 1R5NA 1WJFA 5ILVA 2D3NA 4MLOA 3HTSB 1KTWA 2VBUA 3COAC 2P81A 3AFHA 3EYIA 2YS9A 4AIDA 2ELKA 1GQ8A 4X1EA 4CCJA 4L18B 4X8IA 4W1UA 3H1CA 3WU0A 4MYTA 3JSPA 1TT5B 3OV8A 2L3DA 2E5ZA 4YFKF 4Y9RA 1EF4A 1I3QJ 4HG2A 4CYCB 3F22A 4BE0A 4BHCA 2F5EA 2AO9A 1X3UA 3CMEB 4ZCIA 1KGSA 1LDDA 1WWXA 4IHVA 4XRMA 4P3IA 1V55H 2BHYA 5FKKA 4ZCMA 3FDYA 3CCRI 1F4KA 2O7OA 4XLAA 4AUXA 3BR2A 1X19A 3DPLC 1YYVA 3ZMTA 2RC5A 3ZN0A 1TWFJ 4E0FA 3M8EA 4BE1A 4A0YA 4ESBA 3OYJA 1BJKA 3G3ZA 4HF0A 3J80K 2A6EF 1N05A 1PKVA 4F7DA 3E7LA 5GAEJ 2MBFA 3E6DA 2NAZA 2LKPA 1ETWA 1Z0XA 2CQ7A 2PMHA 2HI3A 4BJTA 2QZ8A 1COWA 1DARA 4NBSA 1Z6TA 5JFRA 5D5XB 4MR0A 2EWNA 5FRNA 1S72B 3B6CA 2P5VA 4BDZA 2EZKA 1Z3YA 4BH9A 1TLHB 5HOOA 2PBIA 4U7BA 2O61A 1IDJA 4PJNA 2O8XA 4FASD 4M6VA 5J3LA 3P5JA 3E5UA 2W85A 1Y1VJ 4A69C 3V8JA 4CHUA 4MNUA 1DDGA 1JA1A 2ECBA 3ASSA 1XGNA 2QSHX 1GV2A 3G1LA 2HPIA 4Z4YA 4ZYEA 4HSRA 2FMLA 3TMOA 1OGJA 1Y0UA 2N8GA 5L3GA 2Q2EA 2WR8A 3F8BA 4ZYAA 3R6SA 4DK1A 2EJRA 2HMAA 1POGA 2Z5UA 2V7QA 2STTA 1FRQA 2XGXA 1QFZA 3DBHB 4YAFA 4ZJZA 2BVMA 3CCSB 3I59A 3F8NA 2ZBVA 3BJOA 1XGMA 4ZDOA 2BVNA 3ONYA 2OK8A 3FHZA 1OFMA 4HPQA 4BJ6C 1B72A 5J4YA 1BX1A 4XLEA 2VFOA 1T0FA 3U6KA 1KK0A 3KL9A 3KPHA 1QZYA 3BY6A 1UG0A 2FU4A 2VXZA 4M74A 2QBYB 2KMUA 3A0BC 2CBXA 2CK3A 3ABUA 3FZVA 1U8RA 4FX0A 3I4NJ 4B43A 3EQLF 2VNIA 3Q9SA 4F91B 1FNCA 4JK1X 4YRVA 1KU9A 1D1AA 2DJIA 4G8XA 5JLXA 2UXNA 3EUHA 4IRIA 4I99C 4KIFA 3VNUA 3CJTB 1X2NA 2DU9A 4EGYA 1EP3B 1G3TA 3IRQA 5E1XA 5FGMA 2O3FA 4GRIA 3CCQI 4KUMA 4PCQA 3R0AA 3DP7A 4G7XA 3GFLA 2WTEA 4NCNA 1O88A 3T9GA 3F21A 1JI8A 1KQSB 1AKHA 2JWTA 4KA4A 2DYSH 1WKMA 1F9NA 3Q0UA 4M53A 4P96A 5FKOA 1WJAA 4U9UA 4RM2A 2Q6IA 4GGGA 2LP0A 5CLSA 4YCQA 3H35A 1K4TA 1ZM4A 2DJNA 2GIVA 4LBYA 4TMXA 2G9WA 3K4MA 3LSRA 2QA4I 3OZWA 5F4OA 1ZRDA 2NTBA 2ZL7A 4OJ5A 3OIQA 2L9NA 1BA5A 2ELHA 4A2UA 4L5JA 2IW5A 4NQWA 3MKYB 1HZEA 3ABKH 3ZOBA 3F6VA 4XKCA 1VQ5B 1QJVA 2YWEA 4PUSA 1RU4A 4YIFA 1TYXA 5IT3A 1VQ9B 2I8DA 3NAUA 3W3CA 1E1QA 1K78B 2DW4A 2PJPA 5EDNA 2K4BA 3BTLA 1WJEA 2X85A 4NBQA 4LBWA 5E3MA 1USSA 4Q7JB 1YOVB 2Y30A 3BR5A 3MQ0A 2EA4A 5J40A 3QRFF 2VUMJ 5C4XJ 3Q6RA 1E3HA 1X1CA 2IP2A 3GFMA 5D6EA 2WB1A 3ZMDA 4ASNA 4CCLA 4EQQA 3QU6A 1YJWI 2C4TA 2IPQX 3BC8A 3F8MA 2AS5F 3WTVC 2XRNA 3H5RA 3FK7A 5JR3A 1OB0A 1O8FA 1OFLA 2BSAA 2BBYA 1P2FA 2J8IA 1T6SA 2ICWG 2BY0A 1JJ6C 1SVMA 2VN2A 4MQ9F 4JRAC 1OGOX 5B1BH 3GTGJ 1E2XA 3BH6B 1O57A 4L9NA 2YSRA 3HKZA 3ZQ7A 1ZG1A 5BS6A 2XC1A 3QYBA 4RDKA 2CUEA 4G6TB 1QA2A 1JKRC 2XTWA 5LHIA 4BUPA 2JUGA 4XIDA 3DLAA 1BR1A 2W57A 1R49A 2PE3A 5CVRA 3QFCA 1EH8A 5TJJA 2OF7A 4L0YB 5EGOA 3U2QA 2EA2A 2B0LA 3FKSA 3TO7A 4BACA 3ZIAA 4CXFA 2LKSA 4OAZA 4OAYA 1U8BA 3ML3A 3OR2C 5LMZA 2R5ZB 1XQBA 3E1YE 1I7PA 1R4NB 4U87A 5D6FA 2DLLA 4HLYA 3J7AY 4A3GJ 1LLZA 3R4KA 1I3AA 1YLFA 3ZC3A 2Y9ZA 3T1BA 1W36C 3V7SA 4D9JA 4A3JJ 2F43A 3OPOA 3RIQA 3FWEA 4ITVA 5FLVA 3DXJF 2B7BA 3PUBA 3Q3SA 2A69F 5CQEA 3M1EA 5E3LA 1AU7A 1DGWY 1MH3A 2PMUA 3BLYA 3T0YA 3A2KA 1IB0A 4HE5A 1OR7A 2CQKA 2OZUA 4G6IA 2KIFA 2OZ6A 5B3SH 2KFDA 3OYFA 3P9KA 1HC8A 1KD1D 4ZC3A 2DN0A 3ZQLA 3WYAA 1SFUA 4G7WA 1BIBA 2CQXA 5K7HA 2VBTA 2CFOA 3V42A 2R7RA 2PMDA 4N9HA 3IUOA 4L5EA 3VSLA 1HG8A 3C3WA 3EYYA 1B59A 1UB9A 2M9HA 4EW9A 3CJNA 1TQPA 4A3IJ 4TN1A 1O8KA 3T8RA 2VJJA 2ZZGA 4FX4A 1L1IA 5H2FC 2XNCA 1R5ID 1VQOI 1W7PD 2COBA 1RIOH 1BOAA 5HS8A 4RA2A 1JTXA 4Q4ZF 4BDYA 2F4OB 2OUMA 2DMNA 1X4OA 3SJMA 4GCVA 4OIRF 2M1BA 4W8SA 2DTRA 2I10A 1FBUA 5KCMA 2G0YA 1RC9A 2UUZA 3PETA 3IKTA 1QVTA 4WWCA 3BG3A 4RCZA 2O8KA 4HV6A 4OINF 1ETOA 3MFKA 4MGRA 4IQ4A 3OJXA 3GQAA 2VPRA 4CA0A 1Q9SA 1WPKA 2QXZA 1UD5A 3FY3A 2R7XA 1P4XA 3RDIA 5IOYA 2PECA 4IO9F 1EH7A 1X1AA 1UMQA 1WCMJ 1I6XA 1TQIA 3RKWA 3ZN1A 2GK6A 4RD2A 1K28D 3FXMA 1MJ9A 2M2EA 4UZUA 2VQHA 2GXAA 4HW0A 1H85A 1XX5A 5ILUA 2L2OA 4BQQA 2KHMA 4DZPA 1MMSA 1Q86D 4URRA 2K40A 4ENMA 4DNTB 3AVXA 4IRGA 5FNZA 3E5XA 2JA8J 4OP7A 2FBIA 5FKNA 1CGPA 2FQ4A 1TUIA 5GAHJ 2K02A 4M3BA 1PYVA 3U9GA 2L7KA 5K5RA 3OYHA 3GUDA 3WHBA 3VYUB 4LBVA 1ON1A 3OP1A 2HYFA 3CLQA 1BN5A 3GTLJ 1X0CA 2JDIA 1T6ZA 4L8JA 2QY1A 1KU3A 3TO6A 2UXXA 2OTLI 4CDGA 3W6VA 1WOSA 4BXFA 3LSGA 1RNLA 2AQEA 2RV8A 2PI0A 4UZFA 2Z2SB 4BQAA 4N9IA 4OIOF 1BC7C 3J7ZI 2DETA 1YQAA 1MABA 2WV1A 1VLOA 2IGMA 2LSOA 3CMAI 2EFGA 4I7HA 4ETSA 2F4NA 3SJZA 3GCMA 3T56B 2EWEA 3O6BB 1VJSA 3K4JA 3ABTA 3RPUD 1DP7P 3AVYA 1PVEA 2R9VA 2JN9A 2A07F 2W6JA 2R7ZJ 1F5TA 1O4XA 2GJRA 1T98A 1PP7U 2RQQA 4AU7A 2FXAA 2L02A 1SANA 1IV8A 2L7ZA 1B23P 2QA4B 2X6XA 1BW5A 4BBRJ 1OYYA 2EZHA 2Y75A 3TW7A 3W2WA 2K3FA 2EFQA 3VPRA 5FROA 4XLCA 3ZCOA 5KVRA 1FOYA 1VNDA 3B4NA 2CU7A 2LBFB 1X3ZB 4MEYF 3HPHA 4K2EA 4XQFA 2VBKA 1FWZA 1N06A 3IAS2 2VJ5A 2AHQA 5BSYA 3GLXA 1PUFB 1E62A 2WSSA 3J7YJ 4IQJA 1HA3A 4EEFG 2DCUA 2V31A 1EKEA 4RDJA 5JVGF 4X06A 2UVEA 3F9KA 2DERA 1TWGJ 3HOSA 1XB2A 3JQQA 3FBNB 4AF6A 2XAUA 3VWBA 3KZYA 3RCOA 2R7TA 1YJWB 2XZPA 4ANJA 3SYTA 2HTJA 3WBJA 2BW3A 3C2GA 5DD8A 3G73A 1AOYA 1CZFA 1FOKA 5EEAA 1O8LA 2KQRA 2Z1DA 4HZFA 1RPWA 1EV7A 3BNWA 3DLLF 2WJVA 3ASRA 4YFXF 3B73A 1UD4A 2XT2A 4W8RA 3WG7H 3QP6A 4RB2C 2NYXA 3IKVA 1FP2A 2QWWA 4BKXA 1GT0C 1XMKA 1E17A 5L46A 1Y8RB 1O8IA 4HYEA 4P2NA 2CMPA 5THXA 1RI7A 3J80Z 1SAUA 3Q9VA 4RAZA 2Q1ZB 4JOMA 4F7ZA 3V7RA 1FY7A 1RR7A 2KIUA 5FD5A 2KPMA 1QGAA 4KH3A 5FB2A 4O6JA 3WE2A 3HAGA 2G0EA 1HXDA 3PQJA 1AIRA 2A5WA 1Q1VA 3E3VA 1MMNA 3OSFA 4M3GA 5K5OA 2GQQA 4E7HA 2L54A 4Z6YA 1QUFA 1JRGA 4PZJA 1MDMB 4B4CA 4PGHA 2EINH 1HF0A 3BCAA 3S3NA 1T39A 4UNOA 4M4SA 4XKVA 3I4PA 2INVA 4V02C 4GYIA 1TT0A 4M72A 3OE7A 3Q3AA 1LE8A 3A01B 1FOXA 1IB4A 2DT6A 4P3YA 4PC7A 3JR9A 1GLNA 1T2KA 4A0ZA 5DCFA 3WNBA 4DW6A 1NBMA 3BC9A 3F23A 4XLNF 3GW2A 1HSTA 4P1WA 1HDDC 3M1CA 3GQBA 1FIPA 2NXNB 3OOCA 2ODLA 2X0KA 2QQBA 3HOTA 2Q6LA 4DQKA 2XTXA 4YFOA 1NDHA 1VQOB 4GYGA 3VSKA 2M3AA 1BHEA 4W8TA 4U49A 2WAEA 2ZMEB 3RZDJ 2K9NA 3BTIA 3IH3A 4LC0A 5HDNA 2HWVA 2V7VA 3IAM2 2ZKZA 1NK3P 3WTWC 2LDUA 3CP8A 5J4VA 2NVQJ 5CVUA 4HWVA 3A8KA 4HOBA 4HAMA 2L9VA 4LLGF 1E63A 3T53B 3VODA 1KONA 1D2EA 1YW7A 4HA8A 2OPTA 3HHGA 3GRHA 2BSPA 3ZMVA 5BPIA 3HOYJ 4ESFA 4BEHA 3MKZA 2WZNA 2Q8KA 4WZTA 3FMSA 4TMZA 4Y7CA 1B8IA 2XSJC 3C18A 2LNBA 3BZKA 2VBVA 3VMFA 1X1BA 2H8WA 3KEYA 2VZLA 3GTKJ 3IL2A 3TL4X 4BHBA 2D9RA 4NC6A 1RETA 4M73A 4DQLA 1V0EA 4R71A 4ZYHA 5F1RA 2WBMA 4Z4SA 1IHMA 1LLWA 4CCKA 1QRBA 2R92J 3V7AA 2CV1A 4E6KG 2PYHA 3HG9A 5IOZA 1WZ2A 1VBLA 1O7FA 2B63J 4C3IJ 1MNEA 1TL8A 2HOSA 1ZKGA 2HYGD 2D45A 1LUJB 1C0WA 3V4GA 2DA7A 1FMWA 3BG5A 5A2QZ 2P5LC 2P7CB 3ECOA 2AQFA 1CQTA 3E20A 3QFRA 1ZYRF 5FL7A 5IP7J 3H3VK 1OB2A 4A6EA 2P4WA 3GZNB 4QPOA 1DUXC 1Y39A 3OZUA 1EP1B 1KCCA 2H1KA 3KRGA 2OTLB 4C3HJ 5BSXA 4D0PA 2E2IJ 2KJCA 1SVLA 4Z1MA 3JW4A 4YZXA 4CZZA 3CMAB 2PG4A 3HUGB 5ILSA 1YX5A 4MTEA 4ESJA 4GDFA 1LEAA 3WG9A 4I2OA 1WGXA 3ZMUA 1KTVA 1XPXA 1UMKA 4X07A 2VBMA 2F1LA 1J5YA 5AN9A 2HKOA 3SZPA 1FNDA 4II2A 2OD5A 5IYCJ 1KZLA 2CUFA 4AD9A 1YHQI 4YAUA 4C2MJ 4ON0A 5JI6A 2A3SA 3CQZJ 2IS4A 1FYMA 3BQZA 2A05A 5CKTA 2OTJI 1GDTA 1TLLA 4G6DA 4C2LA 4XOTA 2KRHA 1TW2A 2DA5A 4F93B 2GZWA 3OIPA 3DV8A 3VYSB 1RRJA 2L4AA 5L3FA 2HVQA 1WOOA 3GQ8A 2PMZN 1VHEA 1FX7A 1W5CC 1SVOA 3DEUA 3GLLA 3KYCB 1IO2A 2QZAA 3ZQCA 4BBSJ 3QODA 2COMA 4Z4VA 1P92A 1ULYA 3LA2A 1USTA 3CDLA 3BDDA 2E60A 2HZTA 2R7VA 3FKJA 4YIIA 3HRMA 2IVMA 3DFGA 1K5CA 2IAIA 2CC2A 1M90D 5IT9Z 4DJAA 4O3MA 3CCUB 3GTMJ 1EZGA 4U0WA 3S8PA 4UB6C 4HQMA 5E79C 3O8HA 2M8EA 2V7TA 1IDYA 1J2XA 2ZL5A 4WF2A 2IJLA 2D3LA 2H09A 1H8HA 2R7WA 1K6YA 4PFPA 2ZITA 4KMUX 1DPRA 2QQ9A 2FBHA 3WGGA 5A8AA 2X1CA 2MGQA 2C78A 4KYWA 5BNGA 2E5NA 1O8EA 2FNAA 1E79A 2XKPA 3N4MA 5IK2A 1XN7A 1D1NA 5E3NA 1I50J 4FK8A 4BHPA 3MD2A 2QX3A 2IA1A 1KQ9A 4J00A 4BY7J 1ZUNB 4HX4A 1O8HA 4OOSA 3CF2A 2V9KA 1IN8A 4A3LJ 1QGZA 1P4AA 3CRZA 1YX2A 2W48A 1QHGA 1T6XA 4M3EA 1WPCA 1VQMB 2OC6A 4Y4RA 2K27A 1S0UA 2V1NA 3RY8A 2IA2A 1WH7A 3JX8A 1IZ1A 3KEWA 2DK8A 2D74A 3R6JA 4XRFA 2BX6A 3GSIA 3JRIA 3CB4A 2LRDA 1OHHA 3VFZA 4L0ZB 1D8JA 3WTTC 1EFUA 4HLXA 3LOCA 1LFPA 3CZ6A 2XUBA 2ZFUA 3RSNA 4LB5A 3ASOH 1BL0A 4DYRA 3LO8A 2VBXA 1QZZA 1BW6A 4OPVA 5HZAA 2XAGA 2X53S 2J8KA 2XHKA 4R1HA 2BM1A 4TMWA 1ETXA 2OU2A 2XVCA 2HDDA 2F5FA 3KYDB 3A8IA 3ASNH 2KRFA 3FIWA 3FJOA 1SD4A 5C4JJ 3VSTA 2LR8A 4LIVA 5FO5A 2LKXA 3TEDA 1LQ1A 4W8QA 1ZGWA 2HEOA 4L9VA 2V9VA 4IHSA 1X2MA 3PFYA 1SC7A 4ZZDA 4KNYA 2GM4A 1GVJA 1YW9A 1FTZA 3MKWB 4RDLA 4LOCA 3S2WA 3H0GJ 4EJUA 1DU6A 3BCFA 4B1RA 2QM3A 1Z67A 1BMFA 2X51A 3BCBA 3CW2A 2LG4A 4G1BA 2LOOA 3O3KA 3P4GA 3CDHA 3W2IA 1OFDA 1ZRCA 3GXOA 4FQGA 4LG0A 4ENJA 4JX4A 1OPCA 3RYRA 3OYBA 3HSRA 3RTRA 1K61A 1CF7B 3LVBA 1WVRA 4FXUA 2O0VA 3HJEA 4C30A 2EPFA 1SFOJ 4ZTJA 3ERMA 2R4GA 3I53A 2JSCA 4CCNA 4NHJA 4KKTA 2LTPA 3JTGA 4XN0A 3CMMA 3ZP5A 2IS6A 3WBKA 3LNQA 2HNHA 1H88C 2KLOA 3OYNA 1R5HA 4GFBA 1M1EB 2QYOA 3HHHA 4Y15A 2ZC2A 1BM9A 3QE2A 1Z21A 1XG2A 5IYQA 2BPOA 4RLQA 2JQ7A 2XTYA 3S93A 1GXPA 2ZSIB 1FNBA 1T5EA 1G3YA 3DQVC 3HM5A 1ZR2A 1O3QA 2BV3A 2ZJRF 1Y8QB 2O0WA 5EEGA 1XMXA 4HNUA 3RJPA 4KIBA 1DG1G 1R4MB 2WADA 3WNDA 1D3YA 4U0VA 2CRGA 5LGUA 2JA5J 4A3CJ 1WORA 3HTUA 3ZZ0A 3QFSA 3OL4A 5JMCB 1IW7F 4RAYA 1WJBA 5LRRA 1KMHA 4EV0A 1N77A 5J1RA 4CO8A 2E1CA 4HEA2 3EDPA 3UW0A 1OISA 3ZQGA 4G7ZF 5B1AH 1X58A 4B48A 3PSSA 4AIHA 1VQPI 4X0GA 4EH1A 1EH6A 1FRNA 1EA0A 2E34A 3LA7A 2DYRH 2X6OA 3H5AA 1YLOA 2PEXA 2K86A 4E7ZA 1R6RA 2HYJA 2KP6A 2OBSA 3OEEA 1MMDA 1ZK8A 3IH2A 1NHAA 1HOMA 4XLPF 2HXIA 4M9XA 2DXIA 1D5VA 1LFUP 1AMOA 3WWGA 2F48A 2OTJB 3HXLA 4I0AA 3KE2A 3KP7A 3RQIA 4WWVA 3CTAA 2DY1A 4R8HA 4N3GA 4YC5A 4P55A 6PAXA 3PUNA 1WH5A 3HIFA 1TNSA 3HGGA 2ZJQF 3ROUA 3L1PA 4C0SA 3PFIA 2R5YB 3GVKA 3MVPA 3R6KA 1NB0A 3BQJA 3S1QJ 4X05A 3G6EI 2QEXI 1T6YA 3OW2B 2PN6A 4FISA 1B1BA 1FOWA 4EGZA 5F6FA 1H9GA 2HDCA 2D1HA 4CUGA 4WQMA 3JCUC 1JGSA 5HLGA 2PLFA 3J81Z 3LSKA 4AIJA 3L09A 1I27A 4AIKA 2LC2A 2ZTNA 2FF4A 3A02A 4HSTA 1M1KD 1JXSA 2RVCA 3H94A 5D8KB 1EWYA 1GAWA 3DPTA 4HIZA 1LVKA 2VIXA 2X6YA 1F20A 1WQ2A 2EB7A 2M0MA 4KIGA 1B9NA 2CYYA 2K9QA 3EPZA 3FK6A 4CCOA 3MMPA 1BI3A 3MWMA 3SKBA 3LSIA 1AWCA 4OU0A 1WI3A 2DA6A 1MBGA 2A68F 4B3GA 2UWMA 2MC3A 1NH3A 2JRTA 5DM7F 3PIOF 3K1NA 4BL0B 3GVAA 3KLNA 1OQYA 4RGUA 2QVOA 1YIJI 3K4KA 2QGGA 3WY9A 4MTDA 1IN4A 2HQ5A 1W5TA 3Q39A 2B5OA 1DPUA 1SD5A 2GOMA 3ONQA 4OZYA 2DQRA 2XF7A 3A0HC 4XMYA 2V6CA 4RD3A 2QSGX 5HDGA 4XSXF 3VO1A 1BC8C 4U0YA 1JJ8C 1IDKA 5KAFC 4ZYGA 4MYUA 2GWRA 3S1RJ 3CC2B 4AWXB 5FJ8J 3DU1X 1J9IA 1I39A 3ULQB 2V1UA 5KAIC 3TH0A 1A04A 2C77A 2NVYJ 1LPQA 2A61A 5JVTA 1RZ4A 3CPWB 1E3PA 2DTZA 3WTSC 4OPSA 3AG3H 2QYUA 5A2QK 4ENNA 4PC1A 4B44A 4MXNA 2CWEA 2JMWA 4Z2YA 2M5SA 3K1MA 1SMYF 1AIPA 4Z4WA 2XAFA 4E7LA 4PAAA 1BOBA 2M45A 4WXDA 1OJLA 2XAHA 1ZH5A 2XF5A 3HB9A 4E7SA 5DN6A 2F4IA 9ANTA 1N8RD 2DMTA 1KZHA 1MSFC 5M3FJ 1TTTA 1QRYA 2MD5A 2O03A 1RKTA 2D1VA 3ZQHA 5K7ZA 1REPC 1XFOA 4I09A 4RM0A 5HXBA 4D5FA 2W24A 3F8FA 5JBQA 4UVBA 4HRIA 5IP6A 1ZG5A 1ZM3A 3KEQA 5ERIA 3C2BA 3ZBTA 2LFBA 1Z1DA 1A6IA 2ZZFA 5D5WB 5CPRB 1B9MA 3DCFA 2RQPA 4BXUA 3ABMH 2K85A 2IBDA 3JAMZ 3S3OA 4DBRA 3ZZTA 3IHUA 1HBXG 3CF5F 3K70D 3VSUA 2FJ1A 3LMWA 1TSPA 1K83J 2E1BA 4BS9A 1XGSA 2MG4A 4IKFA 3K1PA 3PUFA 3CC4I 4TMTA 1ETVA 3M7GA 1MZBA 1VQ6I 3A35A 5A88A 3E6MA 2QMUA 4UZEA 3MEXA 4XKBA 5EJCA 4FN5A 1KQ0A 4UUVA 2ACJA 3AGPA 4S05A 3NWSA 4F55A 4RD4A 5IT9K 1HQCA 2VONA 2EV5A 1TYVA 3JQPA 3OJWA 5EF6A 4MEXF 2LBFA 4C3JJ 3IRRA 3CCRB 3QWLA 5LEKA 4A3MJ 3S1NJ 5J35A 1P7JA 2WY8Q 2NVUB 4Y7NJ 3D5SC 1PUFA 5C44J 3UNGC 1T08B 1MBKA 3I71A 2GLOA 4Y9UA 1GAQA 1APLC 4A0XA 1IJEA 3W5UA 4B8XA 2PYGA 4LIUA 2WAQN 2Q2EB 3OS2A 5GV7A 4X0CA 3FKIJ 1K9MD 1VQPB 1G8XA 3TQNA 4AYBN 1O8DA 4Y17A 3ZQQA 4BQNA 4MIMA 1G3SA 1V4RA 5F27A 1Y1WJ 5IYWA 5BQTA 2PFBA 4XK4A 1FYLA 2STWA 1ITYA 2VE8A 1V0FA 1B72B 3L7WA 2VBYA 1NB9A 1J75A 1LKXA 2DFEA 4EJOA 2NPFA 2GBYA 2LYCA 4QV2A 3BH4A 2L9RA 1BR4A 2EH3A 3BY2A 5DDGA 1G2HA 2X3HA 2M5WA 3LSPA 1MBFA 4MO7A 3H9GA 2Y69H 4OPWA 1VQ4I 2ZXHA 3PSZA 4WK8F 1P6RA 2PX9A 3F8CA 1P4WA 4UUSA 4ZGNB 5JLWA 2XROA 1FC3A 1DDIA 5HVQC 2XEXA 3G6EB 4OM9A 3QPLA 2QEXB 1NRKA 3HC7A 5EZGA 3SFZA 1BLIA 2LH9A 3CD6I 2H27A 5LHGA 3PNTA 1KRHA 3OR1C 3HRSA 3VSVA 3KP3A 2L01A 5IY5H 5TISC 5D4SA 1AKHB 3HSEA 2PJRB 3NAWA 3KZIC 3K4CA 4OMYA 3BG7A 3W6KB 3N6ZA 4DIQA 3H9JA 2DFIA 2M7BA 3R60A 3TBIA 3AG4H 2VC0A 2CQQA 2IEKA 3MHPA 2Q6OA 1Z91A 3U21A 4BNCA 1DBOA 4C9YA 4P5OA 3CDIA 1K4ZA 3CC7I 4PGGA 3AK5A 2M34A 4UAJA 5IYRA 1TP4A 1FBQA 1QCXA 4NQWB 2GPJA 1D0YA 2X4HA 3CCMI 2JA7J 2VLAA 2NVTJ 1T8IA 4BXXJ 1FMVA 4YXWA 4YIRX 2VC1A 2DOAA 3HDDA 3KP6A 2ZBUA 1QRCA 1AA7A 3B6AA 4XSZF 2OCEA 4G6QA 3BR6A 5H59A 5TGTA 1B6AA 3CCQB 1IA5A 2W84A 4QSHA 1STZA 4FE7A 3BJ6A 4X7EA 1ZREA 4X7CA 1ENHA 1DBGA 4NC7A 1YG2A 4KISA 4B3FX 1EXMA 1KYZA 1MBJA 4EM0B 3OFNA 4M71A 2E7WA 2HFHA 3ELKA 2DFFA 2BGIA 5LHHA 1AHDP 4IOAF 3JRFA 3L00A 5KK1A 2M0CA 2R7DA 2YX7A 4DK0A 5A89A 1YS7A 3LFUA 1QO0D 2O1DA 4LB6B 1HVXA 2F5DA 3OSGA 1XG1A 3GFJA 2GJPA 1SFKA 2FUG2 3AVWA 1K79A 1YX3A 2V1XA 1R1VA 4TMVA 4HNTA 2RDPA 1IAWA 1E0EA 2ZJPF 2WJYA 5EG0B 1RQRA 2Y48A 1UHMA 2YPRA 3BROA 3KFWX 1OCPA 1UD3A 5EGOB 1WTHD 2JPCA 1MJBA 2W6IA 5CVIA 1OFCX 1KU2A 5TY0A 3LSJA 1XB4A 2W4SA 2XB0X 1VQ8I 3OS1A 1ERDA 5J47A 4ZYDA 2P5KA 3DTEA 3ZMZA 1QUEA 5F08A 1L0OC 3LQRA 4A6DA 3BPXA 3LWFA 1IUYA 2LY2A 2TCTA 5HS9A 4AC0A 2R7FA 3LAJA 3J7AO 2V5IA 3I0TA 3R61A 3AVTA 1XMAA 2IS1A 1B4AA 3GEZA 1BI0A 1BI1A 4GO1A 3LJYA 5EYRA 4LITA 1YO5C 3AVUA 1XE1A 2OBTA 4XD7A 5ICGA 4Z4TA 2W25A 4X7DA 3OY9A 3H0DA 2RAEA 3BP8A 4UUTA 1E3ZA 1MRZA 2XPWA 2OA4A 4RCYA 2O17A 4RM3A 2INUA 1U5TB 1N75A 2Z16A 3HUGA 3BWGA 2F5VA 1WOPA 2HTSA 3FMRA 1X3WB 4CCMA 1R7JA 4N4NB 3SLNA 1PJ6A 2QCOA 2DIEA 2DQLA 3SZTA 1YI2I 4N3NA 5IYPA 1Q82D 3DBLB 3ASPA 3OMYA 4P26A 1VQ6B 3H3ZA 1O3TA 3MZYA 4ENKA 1MSEC 3HBLA 1OGIA 2ZTGA 2XGEA 2XIGA 4HNVA 2XRLA 3IV5A 3A3GA 2X6WA 1D1BA 5CVJA 2KISA 1DABA 4CICA 3PA2A 3ASQA 4IHYA 5FA6A 3OYCA 3FXQA 1KCDA 2G7UA 1Z3XA 1Y0YA 3J81K 1S9HA 4RMNA 4UB8C 1YITI 1IRGA 1F60A 1U3EM 2CV0A 1W0TA 3I4MJ 3ABLH 1XC5A 3BOQA 1UD6A 1NK2P 3AG1H 3FM5A 4ABZA 3W2GA 1R5GA 1L3LA 1V5VA 1VI0A 1ZAOA 3HOXJ 3LSHA 1D1CA 2DOEA 4H0EA 1SEUA 2BYVE 4V19K 4Z06A 1X4PA 2EBIA 2KRCA 1WRJA 2NOJB 2CRVA 1KA8A 5IYNA 4I02A 1U9OA 3GTPJ 5HLHA 1O3SA 4A93J 2HCJB 1W36D 2QE7A 4UY8I 2CFXA 3C1DA 4JX5A 4RDUA 5F4JA 1G7CA 3KYLA 2ZXIA 1VQNI 5TRDA 5FKMA 5K7FA 3GTOJ 2F4MB 2ZXJA 2W7ZA 2XT4A 1U0JA 5M5WJ 1RQPA 1MJAA 2R7SA 1LM1A 3V8LA 3GZ6A 3A8JA 4KJZA 2HOEA 1K8AD 4D1QA 2DA2A 4E7KA 3CLOA 1K8FA 2G7HA 2UV1A 2XSDC 1YIOA 3P7NA 3S2HJ 4I01A 1IN6A 3BTCA 1FPQA 4EJVA 1ZGAA 5L3EA 4F3QA 1BR2A 3G4SI 2QDXA 3BTJA 2ID6A 1YRNB 3JURA 2ZXWH 3A1YA 3WGHA 1T0FC 2HU9A 4AYBA 5GTIC 3CCJI 4HDVA 3RKQA 1IG7A 2R93J 1QGYA 1MNDA 2KZVA 3HEFA 4IX7A 1I18A 2MA3A 3CD6B 2L9SA 4XR6A 4LJZF 1EA3A 3PO2J 1HW5A 4XL9A 1QPIA 1WMRA 3ZXSA 1F43A 1JKOC 1S5LC 4G5GA 4KMFA 4LK0F 4KN7X 4QVJA 1UG2A 2VT3A 4Y33A 1OOCA 4OOIA 3H5NA 1UZCA 1SM4A 2PIAA 3SEQA 2X3UA 3PQKA 2XASA 3TDUC 1J7KA 4LD5A 4BQOA 5DNSA 3OYEA 1JT0A 4FCYA 5F04A 3CC7B 1VFCA 3VO2A 2FA5A 2DPUA 1W7PB 1MBEA 2AXLA 2XF6A 3MCZA 1TW3A 4ZCLA 4XKWA 3SFIA 1SD7A 4CQJA 3ISPA 3CCMB 4ROXA 1KU7A 1A8PA 2BXYA 4CGZA 1FEXA 1E43A 4II3A 2J5OA 4Q48A 1VF9A 2Q6KA 2K7LA 2A6TA 3LQEA 4Z4RA 2A5YB 2W1OA 4OJOA 3ONUA 1YTYA 3Q0VA 3JAMK 2E7XA 2IXSA 2F1MA 5EZHA 3MZHA 3N90A 5IPAA 3PENA 2VT2A 3FPPA 4A3KJ 2O0YA 2GA2A 4CH7A 1FBSA 1R1UA 1UHWA 1QVGB 1V3FA 4PJMA 5DUKA 2BM7A 1EJ9A 4XICA 1LVAA 2DODA 4Y52J 1RWRA 2FE3A 2VE9A 4D5CA 1W35A 4XORA 3WU2C 4A5NA 4Z05A 2C5HA 3FXKA 3HSFA 3SY2A 3U2RA 3SHFA 4HQEA 4PK4A 4YAWA 1ORKA 2YX4A 4V2GA 1VTNC 3W2HA 1ACIA 3AVVA 1LDJA 1YW8A 5TV2A 4J0QA 2GK7A 2L7MP 3W6JB 2KDOA 5F64A 4B3XA 5E3OA 2VBWA 1D8KA 2WC2A 1Y0RA 4CYCA 3I54A 2XDVA 1V54H 3AL0B 1W34A 3L2RA 1ZTRA 1Z7UA 4P12A 4X7FA 1VQ8B 1XCBA 2QLZA 3T8TA 2NZMA 4NB5A 2NSPA 4QPQA 3Q38A 3AAFA 5GPAA 4BAYA 2X0LA 3DTKA 5E18F 3HGYA 4HX7A 2ISYA 1D0ZA 2OCCH 3I58A 1K7AA 1R71A 1J0RA 1XTAA 2NRAC 3GFIA 2FRHA 4ACBA 2JJ2A 1HSJA 1NG6A 2BHZA 2L5QA 1S7EA 2BM5A 3MMYB 2MC4A 2R0QC 2CW8A 4J19A 1LE8B 2AHOA 2VJ4A 2NOGA 1ZELA 3D26A 2ISZA 1IGNA 1P9QC 3NE5B 3BCDA 2NNNA 5DYMA 3PL8A 2XPVA 2DBBA 1TVCA 1MNMC 4Z4ZA 4A3EJ 2F2EA 1I8DA 3G2BA 3CCSI 4WZEA 4XOPA 1CNFA 5HNFA 3S16J 5HS7A 2JJ1A 1YI2B 2BM0A 1ZGJA 1K4SA 1Z6RA 1MMGA 2ME6A 3DWLE 4G1VA 1QQIA 1MD0A 2E36A 2VQGA 1XSXA 5GADJ 1IN7A 3E0JB 3GMEA 1D8TA 3QP5A 4QUZA 5F1JA 4XRSA 2EZIA 2DOFA 4WZLA 1HF2A 1OR7C 2CH0A 4RLFA 4ASUA 3AGQA 4RB3C 2KJBA 3NWTA 3HOZJ 1OLTA 1RESA 1JKQC 2O6WA 3SXYA 1W0JA 1U5TC 5JLVC 5D5UB 4ZZLA 3JRGA 1O8MA 3KP4A 2JZYA 4PDKA 4A12A 1CQXA 1YITB 2VQLA 3PVDA 4S04A 3PIPF 1MH4A 1WSVA 4DNCA 2XZLA 5LEJA 1OMIA 3EQOA 4FWTA 2Z99A 5K5QA 3CO6C 4BEHB 1QGPA 1YE9A 3QPTA 1JUMA 4F52A 5FRMA 5DSZA 3OYAA 3DKXA 3DDYA 1QHHD 1KC8D 3PJRA 3SZEA 5DV5A 3ZBUA 1GUUA 3ZPNA 2V26A 2E2HJ 2ZCWA 4Q5SF 4OJ6A 3RZOJ 3I1FA 4Y3OA 4L9TA 1NHCA 4BY1J 1XCVA 2MYSA 1ELOA 2WY7Q 2Z9OA 5B66C 1QZEA 2WB1N 4FT8A 2EV0A 1JUSA 1O7LA 4ZTFA 2VNKA 1VQNB 1QA1A 5FD6A 2QBYA 2NT6A 5LGNA 3CMYA 3L2UA 2XNDA 3BR0A 4KFCA 4LBZA 3ZZUA 1YJ9I 3PUMA 2DFHA 1YS6A 3FXLA 4I76A 4PJLA 2WV0A 5LFAA 1HW2A 3V7CA 3A3BA 4CSWA 1G6NA 3ML6A 4QWQA 3L2WA 2QQAA 4OJLA 3SEZA 2VODA 2VFPA 2JN6A 1WI9A 3LQQA 4RB1A 1QA3A 2M8GX 3M4OJ 1QU3A 1VQ9I 4OOXA 2BVLA 3OS0A 4NC8A 3S3MA 4X6AJ 3WODF 3UKGA 2C2WA 3G4SB 1OCZH 3JRHA 1OYIA 4WX9A 2I1LA 1N0UA 3CCJB 3OYMA 1V5FA 4M2LA 5C1EA 3S15J 2ZMEC 3NEUA 3VYRB 3BY1A 3E6CC 1TYWA 3WHCA 1RUNA 5M5XJ 1XSVA 1FSEA 3SYJA 4IHXA 3E5QA 1OCCH 4CZCA 2EIMH 4UVAA 1T56A 1ZN2A 5HODA 3OYDA 3HL2A 2F6CA 3IWFA 4L5IA 3CCEI 1ZR4A 2NSTA 1I5ZA 4IHTA 3QAHA 5EEHA 2UVFA 4XONA 1TBXA 3OZVA 5B6IA 1OCOH 4LK1F 1W4MA 1Y0NA 3JRCA 4OIPF 4PC3A 4RS8A 2E1MB 2B7CA 2BGJA 1X1PA 1S8NA 4LFUA 4D7MA 1WDTA 2VFNA 5LRSA 2H94A 1K78A 2V6EA 3ZPPA 1LEBA 2CW0F 4Y13A 2KL4A 2GOXB 2CV2A 4LMYA 2RNGA 1IRXA 3TO9A 1FP1D 2BY1A 2ZFWA 2ZL6A 5H6RA 2IQ7A 2W82A 1JKPC 3HPGA 4TV7A 1HKQA 3FXJA 3NB2A 1OFEA 4HF1A 2CF4A 3KX2A 1OB5A 2BM6A 3BZCA 4I98B 4QTRA 4NK6A 2BGCA 3ECHA 2J5PA 4XBFA 2KDZA 2C4UA 4OZZA 2VB6A 3W2FA 3RI4A 3VR6A 5DCMB 3P9CA 3BH7B 2CSOA 2QGUA 3JRBA 2JRMA 5FLXZ 1H9TA 2E71A 1YHQB 1JA0A 2RC4A 1W87A 1ZM2A 1MKMA 2J7KA 4DGWB 4M3DA 2IOUG 1S4MA 1S7OA 3OWTA 1GVDA 2MABA 3W5HA 2IA0A 1U2WA 2QSFX 3WTUC 5CYVA 5F0HA 3ZGKA 3I64A 1MW7A 5BMZA 4AM3A 2HQRA 3A4CA 1K73D 4IJAA 2XC7A 1JT6A 2P6SA 1V5GA 2OK7A 1FNNA 2BY3A 2R5ZA 1ETYA 3RKXA 4E70A 1VQ7I 1QPMA 3C2HA 3DEWA 1NJID 4YAOA 3TOAA 1G4DA 3K69A 1W0KA 1ZHFA 2WZPP 3H92A 3VYTB 3BPVA 1MMAA 2QUFA 1H89C 4BPRA 2VKDA 4RAGA 4K1XA 4LG3A 2BF4A 2CS3A 5LD2C 2M30A 3CJRB 1QG0A 1RR8C 3ZUGA 4RPBA 2FMYA 1XDSA 2VOPA 1TWCJ 3RKYA 4EVIA 3T51B 4QVAA 3OEHA 1U78A 1R58A 2PLYA 1RKWA 4A3FJ 3MN2A 2DO7A 1R00A 1KJZA 3AL0C 2XGJA 4UVCA 1JGGA 2PMZA 5F4MA 2K3PA 1FX0A 2IGNA 3OOUA 4IOCF 4ACAA 5GV8A 3QOPA 3H9NA 1SAXA 3LSTA 4FHTA 3U1DA 3S14J 2DYIA 1Z7LA 3GZ5A 1EFCA 2DEUA 1E3OC 1WJCA 2FEZA 4C2TA 4RGXA 3S32A 1N07A 2WA0A 2NT9A 3ESWB 1DP3A 1H8EA 4PC2A 2P8TA 3CUQB 3N97A 2VL8A 2IRFG 2WYRA 2Y31A 5D4RA 1WHUA 2JT1A 2FBKA 4YELA 4LLNA 2X1EA 4EJWA 1XS9A 2OJED 4NNJA 1J09A 3I55I 1FDRA 2EFOA 3K2AA 2RREA 4RLZA 3VMVA 1P7IA 2RKHA 2PQ8A 1FYKA 4YDTA 2LD5A 2Y9YA 1VZ0A 3GYHX 3GTQJ 2ZSHB 4LG0B 4IW3B 5J8CA 2FX0A 4R79A 4WXCA 3SUCA 1T33A 4EM1A 2V4DA 1QFJA 3CCVI 2NTQA 1WU8A 2A6HF 2MH2A 2HLDA 5HZBA 4PSXA 3G05A 2X9DA 1ETKA 2LMDA 2K9MA 1OCRH 1PUEE 2PJRA 1FSHA 4P9FA 2ADUA 1TNTA 4YG2F 1VLYA 2VYQA 4HE6A 2YR2A 5AONA 3W2AA 4I0BA 4TKOB 3G71I 4WXHA 4RB0A 3O8GA 1YJ9B 4I84A 2VBZA 2L0KA 3ZMSA 4FETA 2BN4A 3TKYA 5CJ9A 3FXUA 3L9FA 4E7JA 5BPDA 4UV9A 5DUIA 5FIUA 1EFTA 4BJ5C 4OPOA 2F5CA 1YFHA 2KZGA 5LBQA 2H8RA 3B8YA 1TWAJ 3SZGA 3B02A 1A31A 1P4MA 1SFEA 2VKHA 3LA3A 4E4HA 4XLFA 5C3EJ 3WTYC 4PMHA 5DS9A 4G12A 2CO5A 3GF2A 1R22A 3QYFA 3VMWA 2W00A 1UHSA 5AIQA 2ME0A 2OBPA 3FM3A 4W97A 3GVLA 2XGDA 1JNYA 2M4GA 3M07A 2X8KA 4G9YA 1PP8F 1G7TA 3HOWJ 2Y0MA 1JHFA 2EFWA 3CCEB 3JSOA 2EFNA 3B78A 3R0JA 2NV4A 4U4BA 4YZAA 5E17F 1R23A 2LREA 3ZPLA 3FHNA 3M8FA 4UV8A 5HLTA 3GX4X 4UHTA 1MBHA 5J1YA 2V7XA 5EG0A 2EV6A 1KQ8A 2XKOA 2BV6A 2R6HA 3BJAA 4IRHA 1RUOA 2LVSA 2ZJ2A 4WCGA 4JMQA 1MGTA 2RGVA 5TR9A 3QOEA 1JB9A 4OIQF 1WSUA 3OL3A 1S29A 1I1GA 1G3WA 1WJ5A 1E1RA 1I6HJ 4P1VA 2LF8A 4AVZA 3PA1A 2DA1A 3L2QA 4I6ZA 4IPAA 4KT6A 3H09A 2CJJA 3FMQA 2NS8A 3N05A 3MAJA 2OQRA 4OWRB 3OYIA 2CGPA 4AF7A 3I59B 4M3FA 2OV7A 3VB2A 1GV5A 2H6CA 4KN4X 1U2RA 3M3YJ 1T95A 3V8KA 1I1SA 2E1MC 1Z9CA 3SJPA 1EE6A 2EIJH 4QIWN 1LJ9A 2DA4A 2LK2A 5E20A 2CW7A 2OQGA 1QVUA 3KLOA 2VQCA 3QFTA 1GXQA 3WXMA 4DBQA 1U5TA 1JTYA 3K6GA 4IZZA 3UR3C 1IC8A 4PC6A 1DDNA 2Z8GA 3JU4A 1XSDA 2ZZQA 4DZJA 2VXDA 4MQVA 1SMTA 3K7AJ 2Z33A 2VFQA 3NQOA 5ED4A 5H5JA 2EIKH 3LYCA
chains in the Genus database with same CATH topology
1X4PA 2KRCA 3ZSCA 2QKMB 1WFXA 2NOJB 4ZJZA 2BVMA 3MD2A 2QX3A 4J00A 4ZDOA 1BPLA 1O8HA 1OFMA 4HPQA 4BJ6C 3CF2A 1W36D 2W7NA 4XLEA 2V9KA 2QE7A 2NTPA 3KYLA 2ZXIA 4BU2A 1QHGA 1WPCA 3GVJA 2OC6A 1UG0A 4Y4RA 2V1NA 2HQAA 2VXZA 2KMUA 2CK3A 1U0JA 4DNRB 4XNFA 5KHDA 3KEWA 2R7SA 4B43A 4KJZA 2LRDA 1OHHA 4D1QA 4F91B 4E7KA 3FY3A 1LFPA 2UV1A 3CZ6A 4BE2A 1PE9A 2ZFUA 3RSNA 1D1AA 2DJIA 4YRVA 2VJIA 4B47A 4F3QA 1BR2A 4YZ0A 1UD8A 4MR0A 3JURA 3A1YA 3EUKL 4GRIA 1T0FC 2HU9A 4AYBA 2X53S 3T53B 1MNDA 2KZVA 4IX7A 3DKYA 4G7XA 1I18A 2L9SA 1D0XA 4XR6A 1EFRA 1O88A 1EA3A 3VSTA 3T9GA 4LIVA 1JI8A 4XL9A 4W8QA 1WMRA 2V7FA 3ZXSA 3PFYA 4Y33A 3MKWB 1WJAA 1OOCA 4RM2A 3H5NA 3LL7A 3BCFA 3H35A 3SEQA 1BMFA 2X51A 3BCBA 4BQOA 2LG4A 3K4MA 3OYEA 4OJ5A 1O8JA 2LOOA 2NTBA 3OIQA 2L9NA 3MKYB 1HZEA 2XF6A 4XKCA 3OYBA 3RTRA 1QJVA 4PUSA 1RU4A 4XKWA 4FXUA 2O0VA 4C30A 2DCEA 2I8DA 4ZTJA 2R4GA 3W3CA 5HNHA 1E43A 1E1QA 2IGOA 4II3A 4CCNA 5HKKA 4KKTA 2A6TA 3EQNA 1WJEA 4XN0A 2MFZA 2W1OA 2X85A 3CMMA 4E7IA 2IS6A 2HNHA 4OJOA 2IXSA 2F1MA 5AMVA 2KLOA 3OYNA 4KKSA 1X1CA 5CDFA 2WB1A 4CCLA 3FPPA 2R7UA 3BC8A 4CH7A 3OAAA 1V5EA 4XLHA 1Z21A 1XG2A 3H5RA 3VDXA 1OB0A 1O8FA 4TSFA 4RLQA 4PJMA 3S93A 1OFLA 2ZSIB 1T5EA 3DQVC 1N78A 1RWRA 2DT7B 1E3XA 4DOZA 2O0WA 1OGOX 4XORA 4HNUA 1PXZA 4Z05A 3K4LA 2WADA 3HKZA 4PK4A 3QYBA 4G6TB 3K4NA 3OL4A 4H4KC 1WJBA 4BUPA 2JUGA 1KMHA 3DLAA 1BR1A 1X1DA 1N77A 3CESA 2GK7A 2LY1A 4HEA2 2KDOA 4B3XA 3I3LA 3FKSA 3UW0A 4NK8A 3CP2A 4BACA 3ZIAA 4OAZA 4OAYA 2XDVA 4B48A 3AL0B 3OR2C 3L2RA 2NZMA 4X0GA 4U87A 2NSPA 2WAFA 4QPQA 3J7AY 3H5AA 3DTKA 4E7ZA 1R6RA 3DPUA 2KP6A 3OEEA 1W36C 4C2UA 1D0ZA 1MMDA 2HZDA 4D9JA 2F43A 3OPOA 4ITVA 4P22A 3B90A 2DXIA 2JJ2A 3WWGA 3PUBA 1NG6A 2L5QA 5CQEA 1DGWY 3BLYA 3A2KA 3MMYB 2MC4A 2CW8A 1DQUA 3HXLA 2VJ4A 1ZELA 1SKYB 2R7QA 2M7AA 4G6IA 3OYFA 1P9QC 3NE5B 3BCDA 3PL8A 2HVSA 4ZC3A 1I8DA 3GVKA 4GQNA 5CQGA 3G2BA 4G7WA 2IS2A 2CFOA 3V42A 4EATA 2R7RA 4XOPA 3IUOA 4ZDLA 3RQ4A 3VSLA 5HNFA 1HG8A 2JJ1A 4EW9A 2K5CA 1MMGA 3DWLE 1O8KA 2VJJA 4CUGA 2ZZGA 2VQGA 3E0JB 3BG6A 3LSKA 2K9LA 1OR7C 2CH0A 4RLFA 4XM3A 4BDYA 2LC2A 2ZTNA 2OUMA 4HSTA 4ASUA 3NWTA 3FBIB 1OLTA 1X4OA 4W8SA 3H94A 4KITB 2X1DA 3DPTA 3H9QA 1LVKA 2VIXA 2X6YA 2UUZA 5KCMA 2M0MA 1W0JA 4HIZA 1O8MA 2HPMA 4YZQA 3EPZA 4CCOA 2VQLA 1JTAA 1G59A 3LSIA 3K10A 2O04A 1UD2A 2XZLA 4B3GA 4IQ4A 3EQOA 3GQAA 2CUZA 4CA0A 3GBGA 4BEHB 4PSWA 2UWMA 1UD5A 1YE9A 2QXZA 2R7XA 4F52A 2JIZA 2WAQA 5FRMA 3OYAA 3DKXA 3EUAA 1QHHD 3DDYA 3PJRA 4BL0B 3WQZA 2PECA 3ZPNA 2V26A 4OJ6A 2XOKA 1X1AA 3K4KA 2GK6A 4Y3OA 1NHCA 1K28D 2MYSA 3PSFA 1Y56A 4UZUA 2VQHA 2GOMA 2WY7Q 3ONQA 4OZYA 3PNVA 2L2OA 2XF7A 2KHMA 4XMYA 4BQQA 4ZTFA 4URRA 4DNTB 2NT6A 2P0WA 2XNDA 3L2UA 4NUBA 3ZR8X 1IDKA 2QKLB 4PJLA 5LFAA 1PYVA 2L7KA 3OYHA 3A3BA 3VYUB 4CSWA 3L2WA 2O5RA 4OJLA 3SEZA 3EUHC 1X0CA 1QU3A 2BVLA 3OS0A 2JDIA 4NC8A 3S3MA 4L8JA 2QY1A 3OYGA 4B44A 4BXFA 3LSGA 2AQEA 4MXNA 2Z2SB 2M5SA 3OYMA 1V5FA 4E7LA 5C1EA 3VYRB 1BOBA 1MABA 2IGMA 1UAAA 3K4BA 2XF5A 3T56B 2EWEA 4E7SA 5DN6A 1VJSA 2F4IA 3K4JA 3RPUD 3I9V2 2R9VA 4CZCA 3W2VA 2W6JA 4E0FA 2GJRA 3OYDA 3HL2A 2F6CA 2RQQA 4AU7A 3GQ9A 3M8JA 4TT3A 2BW3B 4HRIA 1BN8A 2BOLA 2NSTA 2Z6BD 5JHFA 2X6XA 2UVFA 4XONA 1Y6IA 3W2WA 4F92B 3ZCOA 2ZZFA 5FROA 4XLCA 2CUJA 5CPRB 2E1MB 3S3OA 3IP4B 3B4NA 2VBKA 2LBFB 4DBRA 1RMGA 3HPHA 4XQFA 3K70D 3VSUA 3ZPPA 2V6EA 3IAS2 3LMWA 2VJ5A 2E1BA 2WPDA 2WSSA 2KL4A 2GOXB 4BS9A 2CV2A 2JA2A 4IQJA 2RNGA 1IRXA 2V31A 2UVEA 4IKFA 3F9KA 2GJKA 2IQ7A 3HOSA 2W82A 3PNYA 3FBNB 3HPGA 2XAUA 3VWBA 2MD0A 3RCOA 3OYKA 2R7TA 2XZPA 3LNNA 4ANJA 3SYTA 3A35A 3KX2A 1DGRM 1CZFA 2BW3A 3C2GA 1O8LA 4NK6A 3DU6A 4OZZA 2KQRA 4XKBA 2Z1DA 2VB6A 2JVGA 3VR6A 3NWSA 2WJVA 4F55A 1UD4A 4W8RA 1W9XA 2LBFA 4DGWB 1LDKB 1O8IA 3OWTA 2MABA 3ZRGA 2CMPA 2WY8Q 1SAUA 3D5SC 2Q1ZB 4JOMA 4J01A 1O8GA 1PJRA 3UNGC 3PSIA 2XZOA 3ZGKA 1MW7A 3A4CA 2KPMA 2PYGA 4LIUA 2XC7A 2Q2EB 3OS2A 3OYLA 3HAGA 1V5GA 1AIRA 2A5WA 1G8XA 1MMNA 3C2HA 2VASA 4OJPA 1O8DA 3ZQQA 4E7HA 4BQNA 1JRGA 4BGDA 1W0KA 1WP6A 2WZPP 4DK1A 2JSPA 3LSMA 3VYTB 1V0FA 1MMAA 4Z03A 3LMMA 2VBEA 2VKDA 1LKXA 3BCAA 4LG3A 3S3NA 2CS3A 1H80A 4XKVA 4PJJA 5LD2C 2INVA 3CJRB 1TT0A 2LYCA 3BH4A 5KNLA 1BR4A 4JQFA 3OE7A 2X3HA 3T51B 2Y0SA 1IB4A 3OEHA 2DT6A 3H9GA 1GLNA 3GQ7A 2IGKA 1NBMA 3AL0C 2XGJA 2ZXHA 3BC9A 2V4JC 2PMZA 2K3PA 2KVOA 2HDWA 1FX0A 2IGNA 3OOUA 4P1WA 2HVRA 3M1CA 5HVQC 3DTIA 3GQBA 3DU5A 1Z7LA 2R7OA 3HC7A 1NRKA 3OOCA 2ODLA 1WJCA 1HA8A 2LH9A 4C2TA 3S32A 1BLIA 3HOTA 2WA0A 3SDBA 3PNTA 3QYEA 1WJDA 4N4OB 3OR1C 3VSKA 2M3AA 1BHEA 2NT9A 3VSVA 4W8TA 1DP3A 2WAEA 4U49A 1H8EA 2PJRB 2VL8A 2ELJA 3K4CA 3BG7A 3CJQB 3IAM2 1OGMX 4DIQA 3H9JA 4YELA 2M7BA 1PLUA 3CP8A 3TBIA 3OW7A 4HWVA 2X1EA 3L2VA 1TZLA 4NNJA 1J09A 3U21A 1KONA 2RREA 1DBOA 4C9YA 3VMVA 4P5OA 3GRHA 4KKUA 2BSPA 3MKZA 4BEHA 1VZ0A 3DEEA 2ZSHB 4NQWB 1QCXA 1D0YA 2XSJC 4R79A 2VLAA 4YXWA 1FMVA 1X1BA 3KEYA 3SUCA 2DOAA 2V4DA 2NTQA 1AA7A 3K70C 3TL4X 2HLDA 4PSXA 3D5LA 3G05A 1IA5A 5TGTA 1V0EA 2K9MA 3E1SA 2PJRA 2LZJA 2WBMA 4YEJA 1VLYA 1DBGA 4NC7A 2M4KA 4CCKA 4KISA 4B3FX 1NG7A 3AKZA 2CV1A 4E6KG 4ZDPA 3W2AA 3OFNA 1UELB 3HG9A 4TKOB 2PYHA 1VBLA 4XN3A 4I84A 1MNEA 4PFOA 5C1CA 4DK0A 4FETA 1FMWA 4E7JA 3LFUA 2O1DA 2AQFA 3D5RC 4BJ5C 1VF7A 5FL7A 2ZZEA 2VPLA 2JVHA 1HVXA 1WJFA 2D3NA 4MLOA 1KTWA 4QPOA 3B8YA 2GJPA 1SFKA 1KCCA 3SZGA 2FUG2 3AFHA 1YX3A 3KRGA 4HNTA 2WJYA 1E0EA 2VKHA 4CCJA 1GQ8A 4E4HA 4XLFA 4PMHA 1UD3A 4Z1MA 1WTHD 4YZXA 2E5ZA 3QYFA 2W6IA 3VMWA 3HUGB 1YX5A 2W4SA 4HG2A 2W00A 4BE0A 3OS1A 1ERDA 3GVLA 3DTEA 2VBMA 2M4GA 4II2A 2X8KA 2LY2A 1KZLA 2IS1A 3FDYA 4U4BA 4YZAA 4LITA 2IS4A 2LREA 4XLAA 5CKTA 1X19A 3FHNA 3DPLC 5HLTA 4XD7A 4C2LA 4XOTA 2KRHA 3OY9A 3H0DA 1E3ZA 4F93B 3VYSB 3OIPA 2O17A 4BE1A 4RM3A 2HVQA 3GQ8A 4JMQA 3OYJA 2INUA 1PKVA 1N75A 2Z16A 3QOEA 3QODA 2F5VA 3OL3A 1WJ5A 1E1RA 4AVZA 4CCMA 3L2QA 4N4NB 2DIEA 2E60A 4KT6A 2R7VA 3FKJA 3N05A 3OMYA 4BJTA 1K5CA 1COWA 4OWRB 3OYIA 4DJAA 2ZTGA 5FRNA 3S8PA 2OV7A 4BDZA 1Z3YA 3A3GA 1T95A 2X6WA 1D1BA 5HOOA 4U7BA 2E1MC 1EE6A 1IDJA 4PJNA 4FASD 2D3LA 1H8HA 3OYCA 1K6YA 2R7WA 2CW7A 4PFPA 1KCDA 1Z3XA 1S9HA 4RMNA 2VQCA 2HPIA 2CV0A 4DBQA 3K6GA 1UD6A 2Z8GA 4IZZA 3UR3C 4HSRA 3JU4A 3TMOA 2X1CA 2ZZQA 2VXDA 2E5NA 1O8EA 1E79A 4ZYAA 3LSHA 1D1CA 4Z06A 5IK2A 2V7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  2NST A;  3ZSC A;  1QCX A;  2X6X A;  2UVF A;  4XON A;  2QX3 A;  3SUC A;  1O8H A;  1OFM A;  4XLC A;  3B90 A;  4XLE A;  2NTQ A;  2NTP A;  3WWG A;  3B4N A;  2VBK A;  1IA5 A;  1RMG A;  4XQF A;  3VSU A;  3ZPP A;  3LMW A;  4YEJ A;  1DBG A;  4XNF A;  2UVE A;  2IQ7 A;  2PYH A;  1VBL A;  4XN3 A;  4I84 A;  5C1C A;  1PE9 A;  4XOP A;  1HG8 A;  1CZF A;  2VJI A;  4EW9 A;  1O8L A;  2O1D A;  4NK6 A;  4OZZ A;  1O8K A;  4YZ0 A;  2VJJ A;  1KTW A;  4MR0 A;  3B8Y A;  3JUR A;  4W8R A;  1KCC A;  3KRG A;  4XM3 A;  1O8I A;  1GQ8 A;  4XR6 A;  3VST A;  1O88 A;  4XLF A;  4W8S A;  3T9G A;  4PMH A;  4XL9 A;  4W8Q A;  1O8G A;  1WMR A;  2X6Y A;  4YZQ A;  1O8M A;  4YZX A;  3VMW A;  1OOC A;  2PYG A;  1JTA A;  2O04 A;  2VBM A;  1AIR A;  3EQO A;  3GQA A;  2QXZ A;  4OJ5 A;  3FY3 A;  1O8J A;  4OJP A;  1O8D A;  2NTB A;  1JRG A;  2PEC A;  1QJV A;  4OJ6 A;  1RU4 A;  4XKW A;  2O0V A;  2VBE A;  4U4B A;  4YZA A;  4Z03 A;  1NHC A;  4XLA A;  1H80 A;  4XKV A;  4C2L A;  4XOT A;  2INV A;  4OZY A;  3EQN A;  4XMY A;  2X3H A;  4OJO A;  4XN0 A;  2O17 A;  2X85 A;  4URR A;  3GQ8 A;  1IB4 A;  2NT6 A;  5AMV A;  2INU A;  1IDK A;  3GQ7 A;  4AVZ A;  4XLH A;  1XG2 A;  4OJL A;  1O8F A;  1K5C A;  1OFL A;  1RWR A;  1X0C A;  2QY1 A;  2O0W A;  2X6W A;  2ODL A;  4Z06 A;  1EE6 A;  4XOR A;  1IDJ A;  1OGO X;  1PXZ A;  4Z05 A;  4MXN A;  1BHE A;  2NT9 A;  3VSV A;  4W8T A;  4U49 A;  5C1E A;  1KCD A;  1OGM X;  2EWE A;  4YEL A;  2Z8G A;  1PLU A;  4HWV A;  3UW0 A;  4NK8 A;  1O8E A;  2NZM A;  1DBO A;  3VMV A;  3GRH A;  2BSP A;  3GQ9 A;  2NSP A; 
#chains in the Genus database with same CATH topology
 3IWZ A;  1S7A A;  3KIO A;  3CO7 C;  2QKM B;  5AIP A;  2ZNY A;  4PAB A;  3ZSC A;  3WNC A;  1WFX A;  1VQ7 B;  3E6B A;  3BT9 A;  1GR1 A;  3G1M A;  1Q7Y D;  1MDM A;  1BPL A;  2D5V A;  2W7N A;  3EET A;  1R36 A;  2I5U A;  2NTP A;  4G7O F;  4BU2 A;  1GHC A;  1B2R A;  3GVJ A;  4IXA A;  3CCL I;  2HQA A;  3M9A A;  2H6B A;  3A01 A;  2DI3 A;  4DNR B;  3CUO A;  4XNF A;  3BQY A;  3F3X A;  3RPQ A;  2KKO A;  4B3A A;  5KHD A;  2DPD A;  1W2B B;  1Q81 D;  3MKL A;  1OCT C;  1TYU A;  3BR3 A;  3DKW A;  3FX3 A;  4HF2 A;  2BM4 A;  3QPS A;  2FSW A;  4BE2 A;  3IC7 A;  1PE9 A;  2VJI A;  2Q0O A;  5J1U A;  4S0H B;  4B47 A;  5J8F A;  3K9T A;  2ID3 A;  1VQL I;  4YZ0 A;  2P6T A;  2FD5 A;  1UD8 A;  1FT9 A;  4C43 A;  3EUK L;  3SDG A;  1BQE A;  5E1Z B;  4YAL A;  4FTH A;  1IF1 A;  4M9Z A;  2YWH A;  1YIJ B;  5GPC A;  3DKY A;  4M0L A;  5E8G A;  1D0X A;  1SFX A;  5BOX A;  1EFR A;  2ESN A;  3QU3 A;  2HOT A;  1KK3 A;  1TQM A;  2ZME A;  1HLV A;  5JHU A;  4HV5 A;  2V7W A;  2V7F A;  2DAO A;  2P7V B;  4FE4 A;  2YU3 A;  4U88 A;  3MCA A;  3HOV J;  3D0S A;  3LL7 A;  1ZM9 A;  1BIA A;  4KDP A;  5FO0 A;  2E1N A;  2UZK A;  3I55 B;  1IV6 A;  1ON2 A;  2YU9 J;  1O8J A;  1H42 A;  3A1P A;  5HLI A;  1KK2 A;  1JE8 A;  3P9I A;  5DEQ A;  2FQ3 A;  4PGO A;  2QF7 A;  1YRN A;  2ZB9 A;  1ZLJ A;  2DCE A;  3HYI A;  2B0R A;  5HNH A;  2IGO A;  4A3D J;  3CCV B;  2BY2 A;  2O6G E;  3Q6Q A;  5HKK A;  3CUQ C;  1QH0 A;  3EQN A;  1HKT A;  2MFZ A;  2WWY A;  4E7I A;  2VNJ A;  2JTV A;  1TC3 C;  2BZT A;  5CDF A;  2V9P A;  3KZZ A;  4A5M A;  2QQ8 A;  2JUC A;  2GQF A;  1PJ5 A;  2CND A;  1HDP A;  2ZO4 A;  2GIZ A;  3RYP A;  3HOU J;  2R7U A;  1BBY A;  1V5E A;  4Q47 A;  4XLH A;  3OAA A;  3VDX A;  1VQK I;  2TRT A;  1ZRF A;  1QFY A;  3OKX A;  2CW5 A;  2DT5 A;  2MW8 A;  4TSF A;  3G71 B;  1F36 A;  3GO5 A;  3C7J A;  2EZL A;  5M3M J;  1R9T J;  1CNE A;  1A6Q A;  4NDL A;  2EK5 A;  1N78 A;  2FVG A;  1FIA A;  2XB5 A;  2DT7 B;  1W7P A;  4BYY A;  4EJT A;  1ODD A;  2L4M A;  4DOZ A;  1E3X A;  1WXR A;  1PXZ A;  3K4L A;  4P25 A;  2Y0S N;  4RD6 A;  1TTY A;  1R1T A;  1O3R A;  2H1L A;  2LY9 A;  2HQN A;  2XV4 S;  3K4N A;  5CVV A;  1IDZ A;  2BEO A;  5FLX K;  4H4K C;  2AXT C;  2DOG A;  1X1D A;  2HOA A;  1ONV A;  1FNM A;  3CES A;  5DM6 F;  2LY1 A;  3I3L A;  2YWF A;  4NK8 A;  3CP2 A;  3W5V A;  2RNJ A;  3FIS A;  1R5O A;  2X48 A;  2XGC A;  3CCU I;  3CC4 B;  4RBO A;  3FF5 A;  2WAF A;  4Z4U A;  2K9S A;  3A03 A;  3LFK A;  4QFM A;  4AC9 A;  3SLD A;  3DPU A;  3WGI A;  4C2U A;  3O2P E;  1ETQ A;  2QTZ A;  2HZD A;  4P22 A;  3B90 A;  4P9U A;  3OIO A;  5K1Y A;  2Y2Z A;  3Q5F A;  2E1O A;  2DMQ A;  1DQU A;  3I56 I;  1SKY B;  2V1D A;  3BG9 A;  2R7Q A;  2M7A A;  2MLK A;  1WSR A;  2E1R A;  5GP9 A;  3BR1 A;  2HVS A;  4JX6 A;  2IT0 A;  2XPU A;  4GQN A;  5CQG A;  4UUS B;  3HRT A;  3F72 A;  3LQ6 A;  2IS2 A;  2ECC A;  4EAT A;  4ZDL A;  2P3M A;  4G94 A;  3RQ4 A;  4RJL A;  3U1K A;  3OOP A;  2K5C A;  4OMZ A;  3WU1 B;  1ZLK A;  1N25 A;  2FX3 A;  2RC6 A;  3TDZ C;  3BG6 A;  1A5J A;  2VNH A;  1LB2 A;  1VQM I;  1IXS B;  4M6Y A;  3T5X A;  1EP2 B;  2K9L A;  4XM3 A;  1Z77 A;  2ZZE A;  5FO1 A;  3KP5 A;  4DYQ A;  2NVX J;  3FBI B;  3X2Q H;  5D8L B;  2CG4 A;  5F0C A;  2JK3 A;  4KIT B;  2X1D A;  1JHH A;  4DYC A;  3H9Q A;  3SQN A;  3RPU A;  3F6O A;  4YZQ A;  1IN5 A;  3JQR A;  3JRD A;  4L9J A;  5L3D A;  2HPM A;  1Z05 A;  2LF7 A;  1JTA A;  1G59 A;  2QTL A;  3KCC A;  3K10 A;  3K2Z A;  5B5E C;  1UD2 A;  2O04 A;  2F3L A;  1VQ4 B;  2CUZ A;  4KKS A;  2ETH A;  3GBG A;  4PSW A;  2KIM A;  2GRE A;  1KQ5 A;  2JIZ A;  2WAQ A;  1N0V C;  2R3S A;  3EUA A;  1QBJ A;  1UCR A;  1A36 A;  3WQZ A;  1HCR A;  1BI2 A;  4QLC U;  2XOK A;  3J81 k;  4LLL A;  1OYW A;  1TWH J;  2HGC A;  4IL6 C;  1YJN I;  4DQ2 A;  3PSF A;  1T38 A;  1Y56 A;  2DK5 A;  1QX4 A;  3JRA A;  5IYB J;  3PNV A;  1OKR A;  2ESH A;  1XDU A;  2FNP A;  2VI6 A;  1XD7 A;  4A3B J;  2P0W A;  1SD6 A;  3S2D J;  3CCL B;  1JJ2 B;  1IUF A;  4NUB A;  3ZR8 X;  4IHW A;  4IEJ A;  1CLW A;  2QKL B;  2XAQ A;  4HX8 A;  1D5Y A;  1J9Z A;  3ZQF A;  4U7D A;  1HKS A;  1BX0 A;  3GIR A;  4P6V F;  4RD1 A;  1IRF A;  2L7F P;  2O5R A;  4D7N A;  4MFE A;  2OBR A;  3EUH C;  3TW6 A;  2HXO A;  2Z3Y A;  5E8I A;  5FLM J;  1VQL B;  2K4J A;  2GXG A;  4RD0 A;  3OYG A;  1IXR C;  2EIL H;  3DF8 A;  1G7R A;  4PJ0 C;  2YUS A;  2NNY A;  2DA3 A;  3KEO A;  3K4B A;  1UAA A;  5F0F A;  4MHG A;  5LLQ A;  1IJW C;  3PO3 J;  3S17 J;  3W2E A;  2M87 A;  4QHY A;  2EQR A;  3I9V 2;  3CME I;  1FLI A;  4RGS A;  3SEJ A;  3W2V A;  1FTT A;  1FJL A;  3QQA A;  1IJF A;  2DMU A;  4YEI A;  4YFN F;  4JYK A;  3K0L A;  3GQ9 A;  1J59 A;  3M8J A;  4TT3 A;  2BW3 B;  1BN8 A;  2BOL A;  3TGN A;  3CXC B;  1QNT A;  2Z6B D;  3E97 A;  2C6Y A;  1MIJ A;  5JHF A;  5DS0 A;  2V7U A;  1N08 A;  1Y6I A;  1ZAR A;  2JJ7 A;  2JA6 J;  4ZH4 F;  4F92 B;  5H6Q A;  4M6X A;  1CF7 A;  1PJ7 A;  2CUJ A;  2BXZ A;  2LLK A;  3IP4 B;  4IVN A;  1UFM A;  3WE3 A;  1RMG A;  2VBS A;  4HBL A;  1S6L A;  3WTX C;  3D1N I;  5E6T A;  4B09 A;  2WPD A;  2JA2 A;  1ZQ3 P;  3U6B A;  4JBA A;  4EM2 A;  2OAZ A;  2GJK A;  2E35 A;  3PNY A;  3S1M J;  2MD0 A;  3OYK A;  1JUP A;  3LNN A;  4CYD A;  5FFZ A;  1DGR M;  2HDN B;  2XAJ A;  1K6O A;  1VQK B;  1S72 I;  2CQN A;  3DU6 A;  4AVP A;  1H0M A;  3B8H A;  3BZ6 A;  2JVG A;  5FKL A;  2O9L A;  1W9X A;  2C5B A;  4OOV A;  5L3B A;  2KT0 A;  3RIR A;  2HKX A;  2VOO A;  1LDK B;  2V79 A;  4ZV4 A;  3H36 A;  5E1W A;  3ZRG A;  5J6X A;  1G7S A;  4J01 A;  1GJR A;  1O8G A;  1PJR A;  3PSI A;  2DDA A;  2XZO A;  4KT5 C;  2EFP A;  4P9S A;  4KIC A;  1DU0 A;  1F1Z A;  1S3J A;  3ZQI A;  4RPD A;  3OYL A;  5AMV A;  4GXO A;  3FXR A;  3JRE A;  2VFM A;  2QEN A;  2VAS A;  4OJP A;  2VKE A;  4H9G A;  4BGD A;  1WP6 A;  2JSP A;  5DCM A;  3LSM A;  4G7H F;  4ZGQ B;  3G1O A;  1HW1 A;  1U6G A;  2NS0 A;  3QPH A;  3LMM A;  2VBE A;  4Z03 A;  2XNJ A;  5L3C A;  1H80 A;  5DTD A;  4PJJ A;  2TDX A;  3MZ8 A;  1XGO A;  5KNL A;  4JQF A;  4LGW A;  4V2F A;  1KYW A;  3FPK A;  3CPX A;  1W0U A;  2FOW A;  2MLG A;  2Y0S A;  2VKV A;  3LAP A;  1GVH A;  2YUH A;  3I56 B;  3HZJ A;  3L2C A;  3TP0 A;  2E19 A;  5D5V B;  4HDU A;  3GQ7 A;  3V76 A;  2DDB A;  2IGK A;  3B82 A;  3KP2 A;  2ZNZ A;  4M9S A;  5GTH C;  3VNV A;  1QQ1 A;  2V4J C;  2R5Y A;  2KVO A;  2HDW A;  5ICE A;  4M1K A;  2B9S A;  3NAR A;  3NRV A;  3GTJ J;  5ICF A;  2HVR A;  4RGR A;  3DTI A;  1B8I B;  1Q1H A;  1ZG3 A;  5IP9 J;  3DU5 A;  1KK1 A;  1GO2 A;  2R7O A;  3ERE D;  2B7E A;  4EMS A;  3KET A;  1NTC A;  2KIQ A;  2MH9 A;  1HA8 A;  1BJA A;  3SQV A;  3SDB A;  3P27 A;  3QYE A;  1WJD A;  1LFB A;  3Q0W A;  4N4O B;  5ICC A;  1QA6 A;  2EIX A;  5EMN A;  5M5Y J;  3ISX A;  5DD4 A;  3FXO A;  2ZBK A;  1E64 A;  1QVF B;  3IH4 A;  3ES9 A;  1IRZ A;  2ELJ A;  3CJQ B;  3VOE A;  1OGM X;  1BJZ A;  3VEP A;  5FFX A;  1PLU A;  3CC2 I;  2GXB A;  3OW7 A;  1UJ8 A;  2GA1 A;  3L2V A;  1A35 A;  1TZL A;  4B4D A;  3AG2 H;  3H3U A;  2D2W A;  5GAG J;  3PM1 A;  4KKU A;  3WTZ A;  3F0C A;  5KSW B;  2YWG A;  1VHO A;  3I5U A;  3DEE A;  1VQ5 I;  5LGT A;  3HKZ N;  5HDK A;  2BMW A;  4UXN A;  3QSY A;  2NS7 A;  4N0B A;  3K70 C;  3HRU A;  4YHB A;  5IYD J;  3D5L A;  4MFD A;  1YJN B;  4IF4 A;  3E1S A;  5J3O A;  3CUQ A;  2LZJ A;  2GAU A;  4YEJ A;  1U9N A;  2JPB A;  1LNW A;  2M4K A;  2QN6 A;  3AST A;  4P6Y A;  1NG7 A;  3AKZ A;  1PDN C;  3REO A;  4ZDP A;  2RN7 A;  2E2J J;  2DMP A;  5KW9 A;  1UEL B;  2FOK A;  3GWZ A;  2OYN A;  1W5S A;  3CCY A;  4O5V A;  4XN3 A;  2MSY A;  4PFO A;  1FZP B;  5C1C A;  4RAF A;  3TOB A;  1IXC A;  3DBR B;  1H8A C;  3P26 A;  2HR3 A;  4JP0 A;  5H20 A;  3JTH A;  3TP3 A;  4WZK A;  2HS5 A;  3D5R C;  4XRS G;  1R5B A;  1SKQ A;  2BE5 F;  1VF7 A;  1W1W E;  2VPL A;  2JVH A;  1R5N A;  1WJF A;  5ILV A;  2D3N A;  4MLO A;  3HTS B;  1KTW A;  2VBU A;  3COA C;  2P81 A;  3AFH A;  3EYI A;  2YS9 A;  4AID A;  2ELK A;  1GQ8 A;  4X1E A;  4CCJ A;  4L18 B;  4X8I A;  4W1U A;  3H1C A;  3WU0 A;  4MYT A;  3JSP A;  1TT5 B;  3OV8 A;  2L3D A;  2E5Z A;  4YFK F;  4Y9R A;  1EF4 A;  1I3Q J;  4HG2 A;  4CYC B;  3F22 A;  4BE0 A;  4BHC A;  2F5E A;  2AO9 A;  1X3U A;  3CME B;  4ZCI A;  1KGS A;  1LDD A;  1WWX A;  4IHV A;  4XRM A;  4P3I A;  1V55 H;  2BHY A;  5FKK A;  4ZCM A;  3FDY A;  3CCR I;  1F4K A;  2O7O A;  4XLA A;  4AUX A;  3BR2 A;  1X19 A;  3DPL C;  1YYV A;  3ZMT A;  2RC5 A;  3ZN0 A;  1TWF J;  4E0F A;  3M8E A;  4BE1 A;  4A0Y A;  4ESB A;  3OYJ A;  1BJK A;  3G3Z A;  4HF0 A;  3J80 K;  2A6E F;  1N05 A;  1PKV A;  4F7D A;  3E7L A;  5GAE J;  2MBF A;  3E6D A;  2NAZ A;  2LKP A;  1ETW A;  1Z0X A;  2CQ7 A;  2PMH A;  2HI3 A;  4BJT A;  2QZ8 A;  1COW A;  1DAR A;  4NBS A;  1Z6T A;  5JFR A;  5D5X B;  4MR0 A;  2EWN A;  5FRN A;  1S72 B;  3B6C A;  2P5V A;  4BDZ A;  2EZK A;  1Z3Y A;  4BH9 A;  1TLH B;  5HOO A;  2PBI A;  4U7B A;  2O61 A;  1IDJ A;  4PJN A;  2O8X A;  4FAS D;  4M6V A;  5J3L A;  3P5J A;  3E5U A;  2W85 A;  1Y1V J;  4A69 C;  3V8J A;  4CHU A;  4MNU A;  1DDG A;  1JA1 A;  2ECB A;  3ASS A;  1XGN A;  2QSH X;  1GV2 A;  3G1L A;  2HPI A;  4Z4Y A;  4ZYE A;  4HSR A;  2FML A;  3TMO A;  1OGJ A;  1Y0U A;  2N8G A;  5L3G A;  2Q2E A;  2WR8 A;  3F8B A;  4ZYA A;  3R6S A;  4DK1 A;  2EJR A;  2HMA A;  1POG A;  2Z5U A;  2V7Q A;  2STT A;  1FRQ A;  2XGX A;  1QFZ A;  3DBH B;  4YAF A;  4ZJZ A;  2BVM A;  3CCS B;  3I59 A;  3F8N A;  2ZBV A;  3BJO A;  1XGM A;  4ZDO A;  2BVN A;  3ONY A;  2OK8 A;  3FHZ A;  1OFM A;  4HPQ A;  4BJ6 C;  1B72 A;  5J4Y A;  1BX1 A;  4XLE A;  2VFO A;  1T0F A;  3U6K A;  1KK0 A;  3KL9 A;  3KPH A;  1QZY A;  3BY6 A;  1UG0 A;  2FU4 A;  2VXZ A;  4M74 A;  2QBY B;  2KMU A;  3A0B C;  2CBX A;  2CK3 A;  3ABU A;  3FZV A;  1U8R A;  4FX0 A;  3I4N J;  4B43 A;  3EQL F;  2VNI A;  3Q9S A;  4F91 B;  1FNC A;  4JK1 X;  4YRV A;  1KU9 A;  1D1A A;  2DJI A;  4G8X A;  5JLX A;  2UXN A;  3EUH A;  4IRI A;  4I99 C;  4KIF A;  3VNU A;  3CJT B;  1X2N A;  2DU9 A;  4EGY A;  1EP3 B;  1G3T A;  3IRQ A;  5E1X A;  5FGM A;  2O3F A;  4GRI A;  3CCQ I;  4KUM A;  4PCQ A;  3R0A A;  3DP7 A;  4G7X A;  3GFL A;  2WTE A;  4NCN A;  1O88 A;  3T9G A;  3F21 A;  1JI8 A;  1KQS B;  1AKH A;  2JWT A;  4KA4 A;  2DYS H;  1WKM A;  1F9N A;  3Q0U A;  4M53 A;  4P96 A;  5FKO A;  1WJA A;  4U9U A;  4RM2 A;  2Q6I A;  4GGG A;  2LP0 A;  5CLS A;  4YCQ A;  3H35 A;  1K4T A;  1ZM4 A;  2DJN A;  2GIV A;  4LBY A;  4TMX A;  2G9W A;  3K4M A;  3LSR A;  2QA4 I;  3OZW A;  5F4O A;  1ZRD A;  2NTB A;  2ZL7 A;  4OJ5 A;  3OIQ A;  2L9N A;  1BA5 A;  2ELH A;  4A2U A;  4L5J A;  2IW5 A;  4NQW A;  3MKY B;  1HZE A;  3ABK H;  3ZOB A;  3F6V A;  4XKC A;  1VQ5 B;  1QJV A;  2YWE A;  4PUS A;  1RU4 A;  4YIF A;  1TYX A;  5IT3 A;  1VQ9 B;  2I8D A;  3NAU A;  3W3C A;  1E1Q A;  1K78 B;  2DW4 A;  2PJP A;  5EDN A;  2K4B A;  3BTL A;  1WJE A;  2X85 A;  4NBQ A;  4LBW A;  5E3M A;  1USS A;  4Q7J B;  1YOV B;  2Y30 A;  3BR5 A;  3MQ0 A;  2EA4 A;  5J40 A;  3QRF F;  2VUM J;  5C4X J;  3Q6R A;  1E3H A;  1X1C A;  2IP2 A;  3GFM A;  5D6E A;  2WB1 A;  3ZMD A;  4ASN A;  4CCL A;  4EQQ A;  3QU6 A;  1YJW I;  2C4T A;  2IPQ X;  3BC8 A;  3F8M A;  2AS5 F;  3WTV C;  2XRN A;  3H5R A;  3FK7 A;  5JR3 A;  1OB0 A;  1O8F A;  1OFL A;  2BSA A;  2BBY A;  1P2F A;  2J8I A;  1T6S A;  2ICW G;  2BY0 A;  1JJ6 C;  1SVM A;  2VN2 A;  4MQ9 F;  4JRA C;  1OGO X;  5B1B H;  3GTG J;  1E2X A;  3BH6 B;  1O57 A;  4L9N A;  2YSR A;  3HKZ A;  3ZQ7 A;  1ZG1 A;  5BS6 A;  2XC1 A;  3QYB A;  4RDK A;  2CUE A;  4G6T B;  1QA2 A;  1JKR C;  2XTW A;  5LHI A;  4BUP A;  2JUG A;  4XID A;  3DLA A;  1BR1 A;  2W57 A;  1R49 A;  2PE3 A;  5CVR A;  3QFC A;  1EH8 A;  5TJJ A;  2OF7 A;  4L0Y B;  5EGO A;  3U2Q A;  2EA2 A;  2B0L A;  3FKS A;  3TO7 A;  4BAC A;  3ZIA A;  4CXF A;  2LKS A;  4OAZ A;  4OAY A;  1U8B A;  3ML3 A;  3OR2 C;  5LMZ A;  2R5Z B;  1XQB A;  3E1Y E;  1I7P A;  1R4N B;  4U87 A;  5D6F A;  2DLL A;  4HLY A;  3J7A Y;  4A3G J;  1LLZ A;  3R4K A;  1I3A A;  1YLF A;  3ZC3 A;  2Y9Z A;  3T1B A;  1W36 C;  3V7S A;  4D9J A;  4A3J J;  2F43 A;  3OPO A;  3RIQ A;  3FWE A;  4ITV A;  5FLV A;  3DXJ F;  2B7B A;  3PUB A;  3Q3S A;  2A69 F;  5CQE A;  3M1E A;  5E3L A;  1AU7 A;  1DGW Y;  1MH3 A;  2PMU A;  3BLY A;  3T0Y A;  3A2K A;  1IB0 A;  4HE5 A;  1OR7 A;  2CQK A;  2OZU A;  4G6I A;  2KIF A;  2OZ6 A;  5B3S H;  2KFD A;  3OYF A;  3P9K A;  1HC8 A;  1KD1 D;  4ZC3 A;  2DN0 A;  3ZQL A;  3WYA A;  1SFU A;  4G7W A;  1BIB A;  2CQX A;  5K7H A;  2VBT A;  2CFO A;  3V42 A;  2R7R A;  2PMD A;  4N9H A;  3IUO A;  4L5E A;  3VSL A;  1HG8 A;  3C3W A;  3EYY A;  1B59 A;  1UB9 A;  2M9H A;  4EW9 A;  3CJN A;  1TQP A;  4A3I J;  4TN1 A;  1O8K A;  3T8R A;  2VJJ A;  2ZZG A;  4FX4 A;  1L1I A;  5H2F C;  2XNC A;  1R5I D;  1VQO I;  1W7P D;  2COB A;  1RIO H;  1BOA A;  5HS8 A;  4RA2 A;  1JTX A;  4Q4Z F;  4BDY A;  2F4O B;  2OUM A;  2DMN A;  1X4O A;  3SJM A;  4GCV A;  4OIR F;  2M1B A;  4W8S A;  2DTR A;  2I10 A;  1FBU A;  5KCM A;  2G0Y A;  1RC9 A;  2UUZ A;  3PET A;  3IKT A;  1QVT A;  4WWC A;  3BG3 A;  4RCZ A;  2O8K A;  4HV6 A;  4OIN F;  1ETO A;  3MFK A;  4MGR A;  4IQ4 A;  3OJX A;  3GQA A;  2VPR A;  4CA0 A;  1Q9S A;  1WPK A;  2QXZ A;  1UD5 A;  3FY3 A;  2R7X A;  1P4X A;  3RDI A;  5IOY A;  2PEC A;  4IO9 F;  1EH7 A;  1X1A A;  1UMQ A;  1WCM J;  1I6X A;  1TQI A;  3RKW A;  3ZN1 A;  2GK6 A;  4RD2 A;  1K28 D;  3FXM A;  1MJ9 A;  2M2E A;  4UZU A;  2VQH A;  2GXA A;  4HW0 A;  1H85 A;  1XX5 A;  5ILU A;  2L2O A;  4BQQ A;  2KHM A;  4DZP A;  1MMS A;  1Q86 D;  4URR A;  2K40 A;  4ENM A;  4DNT B;  3AVX A;  4IRG A;  5FNZ A;  3E5X A;  2JA8 J;  4OP7 A;  2FBI A;  5FKN A;  1CGP A;  2FQ4 A;  1TUI A;  5GAH J;  2K02 A;  4M3B A;  1PYV A;  3U9G A;  2L7K A;  5K5R A;  3OYH A;  3GUD A;  3WHB A;  3VYU B;  4LBV A;  1ON1 A;  3OP1 A;  2HYF A;  3CLQ A;  1BN5 A;  3GTL J;  1X0C A;  2JDI A;  1T6Z A;  4L8J A;  2QY1 A;  1KU3 A;  3TO6 A;  2UXX A;  2OTL I;  4CDG A;  3W6V A;  1WOS A;  4BXF A;  3LSG A;  1RNL A;  2AQE A;  2RV8 A;  2PI0 A;  4UZF A;  2Z2S B;  4BQA A;  4N9I A;  4OIO F;  1BC7 C;  3J7Z I;  2DET A;  1YQA A;  1MAB A;  2WV1 A;  1VLO A;  2IGM A;  2LSO A;  3CMA I;  2EFG A;  4I7H A;  4ETS A;  2F4N A;  3SJZ A;  3GCM A;  3T56 B;  2EWE A;  3O6B B;  1VJS A;  3K4J A;  3ABT A;  3RPU D;  1DP7 P;  3AVY A;  1PVE A;  2R9V A;  2JN9 A;  2A07 F;  2W6J A;  2R7Z J;  1F5T A;  1O4X A;  2GJR A;  1T98 A;  1PP7 U;  2RQQ A;  4AU7 A;  2FXA A;  2L02 A;  1SAN A;  1IV8 A;  2L7Z A;  1B23 P;  2QA4 B;  2X6X A;  1BW5 A;  4BBR J;  1OYY A;  2EZH A;  2Y75 A;  3TW7 A;  3W2W A;  2K3F A;  2EFQ A;  3VPR A;  5FRO A;  4XLC A;  3ZCO A;  5KVR A;  1FOY A;  1VND A;  3B4N A;  2CU7 A;  2LBF B;  1X3Z B;  4MEY F;  3HPH A;  4K2E A;  4XQF A;  2VBK A;  1FWZ A;  1N06 A;  3IAS 2;  2VJ5 A;  2AHQ A;  5BSY A;  3GLX A;  1PUF B;  1E62 A;  2WSS A;  3J7Y J;  4IQJ A;  1HA3 A;  4EEF G;  2DCU A;  2V31 A;  1EKE A;  4RDJ A;  5JVG F;  4X06 A;  2UVE A;  3F9K A;  2DER A;  1TWG J;  3HOS A;  1XB2 A;  3JQQ A;  3FBN B;  4AF6 A;  2XAU A;  3VWB A;  3KZY A;  3RCO A;  2R7T A;  1YJW B;  2XZP A;  4ANJ A;  3SYT A;  2HTJ A;  3WBJ A;  2BW3 A;  3C2G A;  5DD8 A;  3G73 A;  1AOY A;  1CZF A;  1FOK A;  5EEA A;  1O8L A;  2KQR A;  2Z1D A;  4HZF A;  1RPW A;  1EV7 A;  3BNW A;  3DLL F;  2WJV A;  3ASR A;  4YFX F;  3B73 A;  1UD4 A;  2XT2 A;  4W8R A;  3WG7 H;  3QP6 A;  4RB2 C;  2NYX A;  3IKV A;  1FP2 A;  2QWW A;  4BKX A;  1GT0 C;  1XMK A;  1E17 A;  5L46 A;  1Y8R B;  1O8I A;  4HYE A;  4P2N A;  2CMP A;  5THX A;  1RI7 A;  3J80 Z;  1SAU A;  3Q9V A;  4RAZ A;  2Q1Z B;  4JOM A;  4F7Z A;  3V7R A;  1FY7 A;  1RR7 A;  2KIU A;  5FD5 A;  2KPM A;  1QGA A;  4KH3 A;  5FB2 A;  4O6J A;  3WE2 A;  3HAG A;  2G0E A;  1HXD A;  3PQJ A;  1AIR A;  2A5W A;  1Q1V A;  3E3V A;  1MMN A;  3OSF A;  4M3G A;  5K5O A;  2GQQ A;  4E7H A;  2L54 A;  4Z6Y A;  1QUF A;  1JRG A;  4PZJ A;  1MDM B;  4B4C A;  4PGH A;  2EIN H;  1HF0 A;  3BCA A;  3S3N A;  1T39 A;  4UNO A;  4M4S A;  4XKV A;  3I4P A;  2INV A;  4V02 C;  4GYI A;  1TT0 A;  4M72 A;  3OE7 A;  3Q3A A;  1LE8 A;  3A01 B;  1FOX A;  1IB4 A;  2DT6 A;  4P3Y A;  4PC7 A;  3JR9 A;  1GLN A;  1T2K A;  4A0Z A;  5DCF A;  3WNB A;  4DW6 A;  1NBM A;  3BC9 A;  3F23 A;  4XLN F;  3GW2 A;  1HST A;  4P1W A;  1HDD C;  3M1C A;  3GQB A;  1FIP A;  2NXN B;  3OOC A;  2ODL A;  2X0K A;  2QQB A;  3HOT A;  2Q6L A;  4DQK A;  2XTX A;  4YFO A;  1NDH A;  1VQO B;  4GYG A;  3VSK A;  2M3A A;  1BHE A;  4W8T A;  4U49 A;  2WAE A;  2ZME B;  3RZD J;  2K9N A;  3BTI A;  3IH3 A;  4LC0 A;  5HDN A;  2HWV A;  2V7V A;  3IAM 2;  2ZKZ A;  1NK3 P;  3WTW C;  2LDU A;  3CP8 A;  5J4V A;  2NVQ J;  5CVU A;  4HWV A;  3A8K A;  4HOB A;  4HAM A;  2L9V A;  4LLG F;  1E63 A;  3T53 B;  3VOD A;  1KON A;  1D2E A;  1YW7 A;  4HA8 A;  2OPT A;  3HHG A;  3GRH A;  2BSP A;  3ZMV A;  5BPI A;  3HOY J;  4ESF A;  4BEH A;  3MKZ A;  2WZN A;  2Q8K A;  4WZT A;  3FMS A;  4TMZ A;  4Y7C A;  1B8I A;  2XSJ C;  3C18 A;  2LNB A;  3BZK A;  2VBV A;  3VMF A;  1X1B A;  2H8W A;  3KEY A;  2VZL A;  3GTK J;  3IL2 A;  3TL4 X;  4BHB A;  2D9R A;  4NC6 A;  1RET A;  4M73 A;  4DQL A;  1V0E A;  4R71 A;  4ZYH A;  5F1R A;  2WBM A;  4Z4S A;  1IHM A;  1LLW A;  4CCK A;  1QRB A;  2R92 J;  3V7A A;  2CV1 A;  4E6K G;  2PYH A;  3HG9 A;  5IOZ A;  1WZ2 A;  1VBL A;  1O7F A;  2B63 J;  4C3I J;  1MNE A;  1TL8 A;  2HOS A;  1ZKG A;  2HYG D;  2D45 A;  1LUJ B;  1C0W A;  3V4G A;  2DA7 A;  1FMW A;  3BG5 A;  5A2Q Z;  2P5L C;  2P7C B;  3ECO A;  2AQF A;  1CQT A;  3E20 A;  3QFR A;  1ZYR F;  5FL7 A;  5IP7 J;  3H3V K;  1OB2 A;  4A6E A;  2P4W A;  3GZN B;  4QPO A;  1DUX C;  1Y39 A;  3OZU A;  1EP1 B;  1KCC A;  2H1K A;  3KRG A;  2OTL B;  4C3H J;  5BSX A;  4D0P A;  2E2I J;  2KJC A;  1SVL A;  4Z1M A;  3JW4 A;  4YZX A;  4CZZ A;  3CMA B;  2PG4 A;  3HUG B;  5ILS A;  1YX5 A;  4MTE A;  4ESJ A;  4GDF A;  1LEA A;  3WG9 A;  4I2O A;  1WGX A;  3ZMU A;  1KTV A;  1XPX A;  1UMK A;  4X07 A;  2VBM A;  2F1L A;  1J5Y A;  5AN9 A;  2HKO A;  3SZP A;  1FND A;  4II2 A;  2OD5 A;  5IYC J;  1KZL A;  2CUF A;  4AD9 A;  1YHQ I;  4YAU A;  4C2M J;  4ON0 A;  5JI6 A;  2A3S A;  3CQZ J;  2IS4 A;  1FYM A;  3BQZ A;  2A05 A;  5CKT A;  2OTJ I;  1GDT A;  1TLL A;  4G6D A;  4C2L A;  4XOT A;  2KRH A;  1TW2 A;  2DA5 A;  4F93 B;  2GZW A;  3OIP A;  3DV8 A;  3VYS B;  1RRJ A;  2L4A A;  5L3F A;  2HVQ A;  1WOO A;  3GQ8 A;  2PMZ N;  1VHE A;  1FX7 A;  1W5C C;  1SVO A;  3DEU A;  3GLL A;  3KYC B;  1IO2 A;  2QZA A;  3ZQC A;  4BBS J;  3QOD A;  2COM A;  4Z4V A;  1P92 A;  1ULY A;  3LA2 A;  1UST A;  3CDL A;  3BDD A;  2E60 A;  2HZT A;  2R7V A;  3FKJ A;  4YII A;  3HRM A;  2IVM A;  3DFG A;  1K5C A;  2IAI A;  2CC2 A;  1M90 D;  5IT9 Z;  4DJA A;  4O3M A;  3CCU B;  3GTM J;  1EZG A;  4U0W A;  3S8P A;  4UB6 C;  4HQM A;  5E79 C;  3O8H A;  2M8E A;  2V7T A;  1IDY A;  1J2X A;  2ZL5 A;  4WF2 A;  2IJL A;  2D3L A;  2H09 A;  1H8H A;  2R7W A;  1K6Y A;  4PFP A;  2ZIT A;  4KMU X;  1DPR A;  2QQ9 A;  2FBH A;  3WGG A;  5A8A A;  2X1C A;  2MGQ A;  2C78 A;  4KYW A;  5BNG A;  2E5N A;  1O8E A;  2FNA A;  1E79 A;  2XKP A;  3N4M A;  5IK2 A;  1XN7 A;  1D1N A;  5E3N A;  1I50 J;  4FK8 A;  4BHP A;  3MD2 A;  2QX3 A;  2IA1 A;  1KQ9 A;  4J00 A;  4BY7 J;  1ZUN B;  4HX4 A;  1O8H A;  4OOS A;  3CF2 A;  2V9K A;  1IN8 A;  4A3L J;  1QGZ A;  1P4A A;  3CRZ A;  1YX2 A;  2W48 A;  1QHG A;  1T6X A;  4M3E A;  1WPC A;  1VQM B;  2OC6 A;  4Y4R A;  2K27 A;  1S0U A;  2V1N A;  3RY8 A;  2IA2 A;  1WH7 A;  3JX8 A;  1IZ1 A;  3KEW A;  2DK8 A;  2D74 A;  3R6J A;  4XRF A;  2BX6 A;  3GSI A;  3JRI A;  3CB4 A;  2LRD A;  1OHH A;  3VFZ A;  4L0Z B;  1D8J A;  3WTT C;  1EFU A;  4HLX A;  3LOC A;  1LFP A;  3CZ6 A;  2XUB A;  2ZFU A;  3RSN A;  4LB5 A;  3ASO H;  1BL0 A;  4DYR A;  3LO8 A;  2VBX A;  1QZZ A;  1BW6 A;  4OPV A;  5HZA A;  2XAG A;  2X53 S;  2J8K A;  2XHK A;  4R1H A;  2BM1 A;  4TMW A;  1ETX A;  2OU2 A;  2XVC A;  2HDD A;  2F5F A;  3KYD B;  3A8I A;  3ASN H;  2KRF A;  3FIW A;  3FJO A;  1SD4 A;  5C4J J;  3VST A;  2LR8 A;  4LIV A;  5FO5 A;  2LKX A;  3TED A;  1LQ1 A;  4W8Q A;  1ZGW A;  2HEO A;  4L9V A;  2V9V A;  4IHS A;  1X2M A;  3PFY A;  1SC7 A;  4ZZD A;  4KNY A;  2GM4 A;  1GVJ A;  1YW9 A;  1FTZ A;  3MKW B;  4RDL A;  4LOC A;  3S2W A;  3H0G J;  4EJU A;  1DU6 A;  3BCF A;  4B1R A;  2QM3 A;  1Z67 A;  1BMF A;  2X51 A;  3BCB A;  3CW2 A;  2LG4 A;  4G1B A;  2LOO A;  3O3K A;  3P4G A;  3CDH A;  3W2I A;  1OFD A;  1ZRC A;  3GXO A;  4FQG A;  4LG0 A;  4ENJ A;  4JX4 A;  1OPC A;  3RYR A;  3OYB A;  3HSR A;  3RTR A;  1K61 A;  1CF7 B;  3LVB A;  1WVR A;  4FXU A;  2O0V A;  3HJE A;  4C30 A;  2EPF A;  1SFO J;  4ZTJ A;  3ERM A;  2R4G A;  3I53 A;  2JSC A;  4CCN A;  4NHJ A;  4KKT A;  2LTP A;  3JTG A;  4XN0 A;  3CMM A;  3ZP5 A;  2IS6 A;  3WBK A;  3LNQ A;  2HNH A;  1H88 C;  2KLO A;  3OYN A;  1R5H A;  4GFB A;  1M1E B;  2QYO A;  3HHH A;  4Y15 A;  2ZC2 A;  1BM9 A;  3QE2 A;  1Z21 A;  1XG2 A;  5IYQ A;  2BPO A;  4RLQ A;  2JQ7 A;  2XTY A;  3S93 A;  1GXP A;  2ZSI B;  1FNB A;  1T5E A;  1G3Y A;  3DQV C;  3HM5 A;  1ZR2 A;  1O3Q A;  2BV3 A;  2ZJR F;  1Y8Q B;  2O0W A;  5EEG A;  1XMX A;  4HNU A;  3RJP A;  4KIB A;  1DG1 G;  1R4M B;  2WAD A;  3WND A;  1D3Y A;  4U0V A;  2CRG A;  5LGU A;  2JA5 J;  4A3C J;  1WOR A;  3HTU A;  3ZZ0 A;  3QFS A;  3OL4 A;  5JMC B;  1IW7 F;  4RAY A;  1WJB A;  5LRR A;  1KMH A;  4EV0 A;  1N77 A;  5J1R A;  4CO8 A;  2E1C A;  4HEA 2;  3EDP A;  3UW0 A;  1OIS A;  3ZQG A;  4G7Z F;  5B1A H;  1X58 A;  4B48 A;  3PSS A;  4AIH A;  1VQP I;  4X0G A;  4EH1 A;  1EH6 A;  1FRN A;  1EA0 A;  2E34 A;  3LA7 A;  2DYR H;  2X6O A;  3H5A A;  1YLO A;  2PEX A;  2K86 A;  4E7Z A;  1R6R A;  2HYJ A;  2KP6 A;  2OBS A;  3OEE A;  1MMD A;  1ZK8 A;  3IH2 A;  1NHA A;  1HOM A;  4XLP F;  2HXI A;  4M9X A;  2DXI A;  1D5V A;  1LFU P;  1AMO A;  3WWG A;  2F48 A;  2OTJ B;  3HXL A;  4I0A A;  3KE2 A;  3KP7 A;  3RQI A;  4WWV A;  3CTA A;  2DY1 A;  4R8H A;  4N3G A;  4YC5 A;  4P55 A;  6PAX A;  3PUN A;  1WH5 A;  3HIF A;  1TNS A;  3HGG A;  2ZJQ F;  3ROU A;  3L1P A;  4C0S A;  3PFI A;  2R5Y B;  3GVK A;  3MVP A;  3R6K A;  1NB0 A;  3BQJ A;  3S1Q J;  4X05 A;  3G6E I;  2QEX I;  1T6Y A;  3OW2 B;  2PN6 A;  4FIS A;  1B1B A;  1FOW A;  4EGZ A;  5F6F A;  1H9G A;  2HDC A;  2D1H A;  4CUG A;  4WQM A;  3JCU C;  1JGS A;  5HLG A;  2PLF A;  3J81 Z;  3LSK A;  4AIJ A;  3L09 A;  1I27 A;  4AIK A;  2LC2 A;  2ZTN A;  2FF4 A;  3A02 A;  4HST A;  1M1K D;  1JXS A;  2RVC A;  3H94 A;  5D8K B;  1EWY A;  1GAW A;  3DPT A;  4HIZ A;  1LVK A;  2VIX A;  2X6Y A;  1F20 A;  1WQ2 A;  2EB7 A;  2M0M A;  4KIG A;  1B9N A;  2CYY A;  2K9Q A;  3EPZ A;  3FK6 A;  4CCO A;  3MMP A;  1BI3 A;  3MWM A;  3SKB A;  3LSI A;  1AWC A;  4OU0 A;  1WI3 A;  2DA6 A;  1MBG A;  2A68 F;  4B3G A;  2UWM A;  2MC3 A;  1NH3 A;  2JRT A;  5DM7 F;  3PIO F;  3K1N A;  4BL0 B;  3GVA A;  3KLN A;  1OQY A;  4RGU A;  2QVO A;  1YIJ I;  3K4K A;  2QGG A;  3WY9 A;  4MTD A;  1IN4 A;  2HQ5 A;  1W5T A;  3Q39 A;  2B5O A;  1DPU A;  1SD5 A;  2GOM A;  3ONQ A;  4OZY A;  2DQR A;  2XF7 A;  3A0H C;  4XMY A;  2V6C A;  4RD3 A;  2QSG X;  5HDG A;  4XSX F;  3VO1 A;  1BC8 C;  4U0Y A;  1JJ8 C;  1IDK A;  5KAF C;  4ZYG A;  4MYU A;  2GWR A;  3S1R J;  3CC2 B;  4AWX B;  5FJ8 J;  3DU1 X;  1J9I A;  1I39 A;  3ULQ B;  2V1U A;  5KAI C;  3TH0 A;  1A04 A;  2C77 A;  2NVY J;  1LPQ A;  2A61 A;  5JVT A;  1RZ4 A;  3CPW B;  1E3P A;  2DTZ A;  3WTS C;  4OPS A;  3AG3 H;  2QYU A;  5A2Q K;  4ENN A;  4PC1 A;  4B44 A;  4MXN A;  2CWE A;  2JMW A;  4Z2Y A;  2M5S A;  3K1M A;  1SMY F;  1AIP A;  4Z4W A;  2XAF A;  4E7L A;  4PAA A;  1BOB A;  2M45 A;  4WXD A;  1OJL A;  2XAH A;  1ZH5 A;  2XF5 A;  3HB9 A;  4E7S A;  5DN6 A;  2F4I A;  9ANT A;  1N8R D;  2DMT A;  1KZH A;  1MSF C;  5M3F J;  1TTT A;  1QRY A;  2MD5 A;  2O03 A;  1RKT A;  2D1V A;  3ZQH A;  5K7Z A;  1REP C;  1XFO A;  4I09 A;  4RM0 A;  5HXB A;  4D5F A;  2W24 A;  3F8F A;  5JBQ A;  4UVB A;  4HRI A;  5IP6 A;  1ZG5 A;  1ZM3 A;  3KEQ A;  5ERI A;  3C2B A;  3ZBT A;  2LFB A;  1Z1D A;  1A6I A;  2ZZF A;  5D5W B;  5CPR B;  1B9M A;  3DCF A;  2RQP A;  4BXU A;  3ABM H;  2K85 A;  2IBD A;  3JAM Z;  3S3O A;  4DBR A;  3ZZT A;  3IHU A;  1HBX G;  3CF5 F;  3K70 D;  3VSU A;  2FJ1 A;  3LMW A;  1TSP A;  1K83 J;  2E1B A;  4BS9 A;  1XGS A;  2MG4 A;  4IKF A;  3K1P A;  3PUF A;  3CC4 I;  4TMT A;  1ETV A;  3M7G A;  1MZB A;  1VQ6 I;  3A35 A;  5A88 A;  3E6M A;  2QMU A;  4UZE A;  3MEX A;  4XKB A;  5EJC A;  4FN5 A;  1KQ0 A;  4UUV A;  2ACJ A;  3AGP A;  4S05 A;  3NWS A;  4F55 A;  4RD4 A;  5IT9 K;  1HQC A;  2VON A;  2EV5 A;  1TYV A;  3JQP A;  3OJW A;  5EF6 A;  4MEX F;  2LBF A;  4C3J J;  3IRR A;  3CCR B;  3QWL A;  5LEK A;  4A3M J;  3S1N J;  5J35 A;  1P7J A;  2WY8 Q;  2NVU B;  4Y7N J;  3D5S C;  1PUF A;  5C44 J;  3UNG C;  1T08 B;  1MBK A;  3I71 A;  2GLO A;  4Y9U A;  1GAQ A;  1APL C;  4A0X A;  1IJE A;  3W5U A;  4B8X A;  2PYG A;  4LIU A;  2WAQ N;  2Q2E B;  3OS2 A;  5GV7 A;  4X0C A;  3FKI J;  1K9M D;  1VQP B;  1G8X A;  3TQN A;  4AYB N;  1O8D A;  4Y17 A;  3ZQQ A;  4BQN A;  4MIM A;  1G3S A;  1V4R A;  5F27 A;  1Y1W J;  5IYW A;  5BQT A;  2PFB A;  4XK4 A;  1FYL A;  2STW A;  1ITY A;  2VE8 A;  1V0F A;  1B72 B;  3L7W A;  2VBY A;  1NB9 A;  1J75 A;  1LKX A;  2DFE A;  4EJO A;  2NPF A;  2GBY A;  2LYC A;  4QV2 A;  3BH4 A;  2L9R A;  1BR4 A;  2EH3 A;  3BY2 A;  5DDG A;  1G2H A;  2X3H A;  2M5W A;  3LSP A;  1MBF A;  4MO7 A;  3H9G A;  2Y69 H;  4OPW A;  1VQ4 I;  2ZXH A;  3PSZ A;  4WK8 F;  1P6R A;  2PX9 A;  3F8C A;  1P4W A;  4UUS A;  4ZGN B;  5JLW A;  2XRO A;  1FC3 A;  1DDI A;  5HVQ C;  2XEX A;  3G6E B;  4OM9 A;  3QPL A;  2QEX B;  1NRK A;  3HC7 A;  5EZG A;  3SFZ A;  1BLI A;  2LH9 A;  3CD6 I;  2H27 A;  5LHG A;  3PNT A;  1KRH A;  3OR1 C;  3HRS A;  3VSV A;  3KP3 A;  2L01 A;  5IY5 H;  5TIS C;  5D4S A;  1AKH B;  3HSE A;  2PJR B;  3NAW A;  3KZI C;  3K4C A;  4OMY A;  3BG7 A;  3W6K B;  3N6Z A;  4DIQ A;  3H9J A;  2DFI A;  2M7B A;  3R60 A;  3TBI A;  3AG4 H;  2VC0 A;  2CQQ A;  2IEK A;  3MHP A;  2Q6O A;  1Z91 A;  3U21 A;  4BNC A;  1DBO A;  4C9Y A;  4P5O A;  3CDI A;  1K4Z A;  3CC7 I;  4PGG A;  3AK5 A;  2M34 A;  4UAJ A;  5IYR A;  1TP4 A;  1FBQ A;  1QCX A;  4NQW B;  2GPJ A;  1D0Y A;  2X4H A;  3CCM I;  2JA7 J;  2VLA A;  2NVT J;  1T8I A;  4BXX J;  1FMV A;  4YXW A;  4YIR X;  2VC1 A;  2DOA A;  3HDD A;  3KP6 A;  2ZBU A;  1QRC A;  1AA7 A;  3B6A A;  4XSZ F;  2OCE A;  4G6Q A;  3BR6 A;  5H59 A;  5TGT A;  1B6A A;  3CCQ B;  1IA5 A;  2W84 A;  4QSH A;  1STZ A;  4FE7 A;  3BJ6 A;  4X7E A;  1ZRE A;  4X7C A;  1ENH A;  1DBG A;  4NC7 A;  1YG2 A;  4KIS A;  4B3F X;  1EXM A;  1KYZ A;  1MBJ A;  4EM0 B;  3OFN A;  4M71 A;  2E7W A;  2HFH A;  3ELK A;  2DFF A;  2BGI A;  5LHH A;  1AHD P;  4IOA F;  3JRF A;  3L00 A;  5KK1 A;  2M0C A;  2R7D A;  2YX7 A;  4DK0 A;  5A89 A;  1YS7 A;  3LFU A;  1QO0 D;  2O1D A;  4LB6 B;  1HVX A;  2F5D A;  3OSG A;  1XG1 A;  3GFJ A;  2GJP A;  1SFK A;  2FUG 2;  3AVW A;  1K79 A;  1YX3 A;  2V1X A;  1R1V A;  4TMV A;  4HNT A;  2RDP A;  1IAW A;  1E0E A;  2ZJP F;  2WJY A;  5EG0 B;  1RQR A;  2Y48 A;  1UHM A;  2YPR A;  3BRO A;  3KFW X;  1OCP A;  1UD3 A;  5EGO B;  1WTH D;  2JPC A;  1MJB A;  2W6I A;  5CVI A;  1OFC X;  1KU2 A;  5TY0 A;  3LSJ A;  1XB4 A;  2W4S A;  2XB0 X;  1VQ8 I;  3OS1 A;  1ERD A;  5J47 A;  4ZYD A;  2P5K A;  3DTE A;  3ZMZ A;  1QUE A;  5F08 A;  1L0O C;  3LQR A;  4A6D A;  3BPX A;  3LWF A;  1IUY A;  2LY2 A;  2TCT A;  5HS9 A;  4AC0 A;  2R7F A;  3LAJ A;  3J7A O;  2V5I A;  3I0T A;  3R61 A;  3AVT A;  1XMA A;  2IS1 A;  1B4A A;  3GEZ A;  1BI0 A;  1BI1 A;  4GO1 A;  3LJY A;  5EYR A;  4LIT A;  1YO5 C;  3AVU A;  1XE1 A;  2OBT A;  4XD7 A;  5ICG A;  4Z4T A;  2W25 A;  4X7D A;  3OY9 A;  3H0D A;  2RAE A;  3BP8 A;  4UUT A;  1E3Z A;  1MRZ A;  2XPW A;  2OA4 A;  4RCY A;  2O17 A;  4RM3 A;  2INU A;  1U5T B;  1N75 A;  2Z16 A;  3HUG A;  3BWG A;  2F5V A;  1WOP A;  2HTS A;  3FMR A;  1X3W B;  4CCM A;  1R7J A;  4N4N B;  3SLN A;  1PJ6 A;  2QCO A;  2DIE A;  2DQL A;  3SZT A;  1YI2 I;  4N3N A;  5IYP A;  1Q82 D;  3DBL B;  3ASP A;  3OMY A;  4P26 A;  1VQ6 B;  3H3Z A;  1O3T A;  3MZY A;  4ENK A;  1MSE C;  3HBL A;  1OGI A;  2ZTG A;  2XGE A;  2XIG A;  4HNV A;  2XRL A;  3IV5 A;  3A3G A;  2X6W A;  1D1B A;  5CVJ A;  2KIS A;  1DAB A;  4CIC A;  3PA2 A;  3ASQ A;  4IHY A;  5FA6 A;  3OYC A;  3FXQ A;  1KCD A;  2G7U A;  1Z3X A;  1Y0Y A;  3J81 K;  1S9H A;  4RMN A;  4UB8 C;  1YIT I;  1IRG A;  1F60 A;  1U3E M;  2CV0 A;  1W0T A;  3I4M J;  3ABL H;  1XC5 A;  3BOQ A;  1UD6 A;  1NK2 P;  3AG1 H;  3FM5 A;  4ABZ A;  3W2G A;  1R5G A;  1L3L A;  1V5V A;  1VI0 A;  1ZAO A;  3HOX J;  3LSH A;  1D1C A;  2DOE A;  4H0E A;  1SEU A;  2BYV E;  4V19 K;  4Z06 A;  1X4P A;  2EBI A;  2KRC A;  1WRJ A;  2NOJ B;  2CRV A;  1KA8 A;  5IYN A;  4I02 A;  1U9O A;  3GTP J;  5HLH A;  1O3S A;  4A93 J;  2HCJ B;  1W36 D;  2QE7 A;  4UY8 I;  2CFX A;  3C1D A;  4JX5 A;  4RDU A;  5F4J A;  1G7C A;  3KYL A;  2ZXI A;  1VQN I;  5TRD A;  5FKM A;  5K7F A;  3GTO J;  2F4M B;  2ZXJ A;  2W7Z A;  2XT4 A;  1U0J A;  5M5W J;  1RQP A;  1MJA A;  2R7S A;  1LM1 A;  3V8L A;  3GZ6 A;  3A8J A;  4KJZ A;  2HOE A;  1K8A D;  4D1Q A;  2DA2 A;  4E7K A;  3CLO A;  1K8F A;  2G7H A;  2UV1 A;  2XSD C;  1YIO A;  3P7N A;  3S2H J;  4I01 A;  1IN6 A;  3BTC A;  1FPQ A;  4EJV A;  1ZGA A;  5L3E A;  4F3Q A;  1BR2 A;  3G4S I;  2QDX A;  3BTJ A;  2ID6 A;  1YRN B;  3JUR A;  2ZXW H;  3A1Y A;  3WGH A;  1T0F C;  2HU9 A;  4AYB A;  5GTI C;  3CCJ I;  4HDV A;  3RKQ A;  1IG7 A;  2R93 J;  1QGY A;  1MND A;  2KZV A;  3HEF A;  4IX7 A;  1I18 A;  2MA3 A;  3CD6 B;  2L9S A;  4XR6 A;  4LJZ F;  1EA3 A;  3PO2 J;  1HW5 A;  4XL9 A;  1QPI A;  1WMR A;  3ZXS A;  1F43 A;  1JKO C;  1S5L C;  4G5G A;  4KMF A;  4LK0 F;  4KN7 X;  4QVJ A;  1UG2 A;  2VT3 A;  4Y33 A;  1OOC A;  4OOI A;  3H5N A;  1UZC A;  1SM4 A;  2PIA A;  3SEQ A;  2X3U A;  3PQK A;  2XAS A;  3TDU C;  1J7K A;  4LD5 A;  4BQO A;  5DNS A;  3OYE A;  1JT0 A;  4FCY A;  5F04 A;  3CC7 B;  1VFC A;  3VO2 A;  2FA5 A;  2DPU A;  1W7P B;  1MBE A;  2AXL A;  2XF6 A;  3MCZ A;  1TW3 A;  4ZCL A;  4XKW A;  3SFI A;  1SD7 A;  4CQJ A;  3ISP A;  3CCM B;  4ROX A;  1KU7 A;  1A8P A;  2BXY A;  4CGZ A;  1FEX A;  1E43 A;  4II3 A;  2J5O A;  4Q48 A;  1VF9 A;  2Q6K A;  2K7L A;  2A6T A;  3LQE A;  4Z4R A;  2A5Y B;  2W1O A;  4OJO A;  3ONU A;  1YTY A;  3Q0V A;  3JAM K;  2E7X A;  2IXS A;  2F1M A;  5EZH A;  3MZH A;  3N90 A;  5IPA A;  3PEN A;  2VT2 A;  3FPP A;  4A3K J;  2O0Y A;  2GA2 A;  4CH7 A;  1FBS A;  1R1U A;  1UHW A;  1QVG B;  1V3F A;  4PJM A;  5DUK A;  2BM7 A;  1EJ9 A;  4XIC A;  1LVA A;  2DOD A;  4Y52 J;  1RWR A;  2FE3 A;  2VE9 A;  4D5C A;  1W35 A;  4XOR A;  3WU2 C;  4A5N A;  4Z05 A;  2C5H A;  3FXK A;  3HSF A;  3SY2 A;  3U2R A;  3SHF A;  4HQE A;  4PK4 A;  4YAW A;  1ORK A;  2YX4 A;  4V2G A;  1VTN C;  3W2H A;  1ACI A;  3AVV A;  1LDJ A;  1YW8 A;  5TV2 A;  4J0Q A;  2GK7 A;  2L7M P;  3W6J B;  2KDO A;  5F64 A;  4B3X A;  5E3O A;  2VBW A;  1D8K A;  2WC2 A;  1Y0R A;  4CYC A;  3I54 A;  2XDV A;  1V54 H;  3AL0 B;  1W34 A;  3L2R A;  1ZTR A;  1Z7U A;  4P12 A;  4X7F A;  1VQ8 B;  1XCB A;  2QLZ A;  3T8T A;  2NZM A;  4NB5 A;  2NSP A;  4QPQ A;  3Q38 A;  3AAF A;  5GPA A;  4BAY A;  2X0L A;  3DTK A;  5E18 F;  3HGY A;  4HX7 A;  2ISY A;  1D0Z A;  2OCC H;  3I58 A;  1K7A A;  1R71 A;  1J0R A;  1XTA A;  2NRA C;  3GFI A;  2FRH A;  4ACB A;  2JJ2 A;  1HSJ A;  1NG6 A;  2BHZ A;  2L5Q A;  1S7E A;  2BM5 A;  3MMY B;  2MC4 A;  2R0Q C;  2CW8 A;  4J19 A;  1LE8 B;  2AHO A;  2VJ4 A;  2NOG A;  1ZEL A;  3D26 A;  2ISZ A;  1IGN A;  1P9Q C;  3NE5 B;  3BCD A;  2NNN A;  5DYM A;  3PL8 A;  2XPV A;  2DBB A;  1TVC A;  1MNM C;  4Z4Z A;  4A3E J;  2F2E A;  1I8D A;  3G2B A;  3CCS I;  4WZE A;  4XOP A;  1CNF A;  5HNF A;  3S16 J;  5HS7 A;  2JJ1 A;  1YI2 B;  2BM0 A;  1ZGJ A;  1K4S A;  1Z6R A;  1MMG A;  2ME6 A;  3DWL E;  4G1V A;  1QQI A;  1MD0 A;  2E36 A;  2VQG A;  1XSX A;  5GAD J;  1IN7 A;  3E0J B;  3GME A;  1D8T A;  3QP5 A;  4QUZ A;  5F1J A;  4XRS A;  2EZI A;  2DOF A;  4WZL A;  1HF2 A;  1OR7 C;  2CH0 A;  4RLF A;  4ASU A;  3AGQ A;  4RB3 C;  2KJB A;  3NWT A;  3HOZ J;  1OLT A;  1RES A;  1JKQ C;  2O6W A;  3SXY A;  1W0J A;  1U5T C;  5JLV C;  5D5U B;  4ZZL A;  3JRG A;  1O8M A;  3KP4 A;  2JZY A;  4PDK A;  4A12 A;  1CQX A;  1YIT B;  2VQL A;  3PVD A;  4S04 A;  3PIP F;  1MH4 A;  1WSV A;  4DNC A;  2XZL A;  5LEJ A;  1OMI A;  3EQO A;  4FWT A;  2Z99 A;  5K5Q A;  3CO6 C;  4BEH B;  1QGP A;  1YE9 A;  3QPT A;  1JUM A;  4F52 A;  5FRM A;  5DSZ A;  3OYA A;  3DKX A;  3DDY A;  1QHH D;  1KC8 D;  3PJR A;  3SZE A;  5DV5 A;  3ZBU A;  1GUU A;  3ZPN A;  2V26 A;  2E2H J;  2ZCW A;  4Q5S F;  4OJ6 A;  3RZO J;  3I1F A;  4Y3O A;  4L9T A;  1NHC A;  4BY1 J;  1XCV A;  2MYS A;  1ELO A;  2WY7 Q;  2Z9O A;  5B66 C;  1QZE A;  2WB1 N;  4FT8 A;  2EV0 A;  1JUS A;  1O7L A;  4ZTF A;  2VNK A;  1VQN B;  1QA1 A;  5FD6 A;  2QBY A;  2NT6 A;  5LGN A;  3CMY A;  3L2U A;  2XND A;  3BR0 A;  4KFC A;  4LBZ A;  3ZZU A;  1YJ9 I;  3PUM A;  2DFH A;  1YS6 A;  3FXL A;  4I76 A;  4PJL A;  2WV0 A;  5LFA A;  1HW2 A;  3V7C A;  3A3B A;  4CSW A;  1G6N A;  3ML6 A;  4QWQ A;  3L2W A;  2QQA A;  4OJL A;  3SEZ A;  2VOD A;  2VFP A;  2JN6 A;  1WI9 A;  3LQQ A;  4RB1 A;  1QA3 A;  2M8G X;  3M4O J;  1QU3 A;  1VQ9 I;  4OOX A;  2BVL A;  3OS0 A;  4NC8 A;  3S3M A;  4X6A J;  3WOD F;  3UKG A;  2C2W A;  3G4S B;  1OCZ H;  3JRH A;  1OYI A;  4WX9 A;  2I1L A;  1N0U A;  3CCJ B;  3OYM A;  1V5F A;  4M2L A;  5C1E A;  3S15 J;  2ZME C;  3NEU A;  3VYR B;  3BY1 A;  3E6C C;  1TYW A;  3WHC A;  1RUN A;  5M5X J;  1XSV A;  1FSE A;  3SYJ A;  4IHX A;  3E5Q A;  1OCC H;  4CZC A;  2EIM H;  4UVA A;  1T56 A;  1ZN2 A;  5HOD A;  3OYD A;  3HL2 A;  2F6C A;  3IWF A;  4L5I A;  3CCE I;  1ZR4 A;  2NST A;  1I5Z A;  4IHT A;  3QAH A;  5EEH A;  2UVF A;  4XON A;  1TBX A;  3OZV A;  5B6I A;  1OCO H;  4LK1 F;  1W4M A;  1Y0N A;  3JRC A;  4OIP F;  4PC3 A;  4RS8 A;  2E1M B;  2B7C A;  2BGJ A;  1X1P A;  1S8N A;  4LFU A;  4D7M A;  1WDT A;  2VFN A;  5LRS A;  2H94 A;  1K78 A;  2V6E A;  3ZPP A;  1LEB A;  2CW0 F;  4Y13 A;  2KL4 A;  2GOX B;  2CV2 A;  4LMY A;  2RNG A;  1IRX A;  3TO9 A;  1FP1 D;  2BY1 A;  2ZFW A;  2ZL6 A;  5H6R A;  2IQ7 A;  2W82 A;  1JKP C;  3HPG A;  4TV7 A;  1HKQ A;  3FXJ A;  3NB2 A;  1OFE A;  4HF1 A;  2CF4 A;  3KX2 A;  1OB5 A;  2BM6 A;  3BZC A;  4I98 B;  4QTR A;  4NK6 A;  2BGC A;  3ECH A;  2J5P A;  4XBF A;  2KDZ A;  2C4U A;  4OZZ A;  2VB6 A;  3W2F A;  3RI4 A;  3VR6 A;  5DCM B;  3P9C A;  3BH7 B;  2CSO A;  2QGU A;  3JRB A;  2JRM A;  5FLX Z;  1H9T A;  2E71 A;  1YHQ B;  1JA0 A;  2RC4 A;  1W87 A;  1ZM2 A;  1MKM A;  2J7K A;  4DGW B;  4M3D A;  2IOU G;  1S4M A;  1S7O A;  3OWT A;  1GVD A;  2MAB A;  3W5H A;  2IA0 A;  1U2W A;  2QSF X;  3WTU C;  5CYV A;  5F0H A;  3ZGK A;  3I64 A;  1MW7 A;  5BMZ A;  4AM3 A;  2HQR A;  3A4C A;  1K73 D;  4IJA A;  2XC7 A;  1JT6 A;  2P6S A;  1V5G A;  2OK7 A;  1FNN A;  2BY3 A;  2R5Z A;  1ETY A;  3RKX A;  4E70 A;  1VQ7 I;  1QPM A;  3C2H A;  3DEW A;  1NJI D;  4YAO A;  3TOA A;  1G4D A;  3K69 A;  1W0K A;  1ZHF A;  2WZP P;  3H92 A;  3VYT B;  3BPV A;  1MMA A;  2QUF A;  1H89 C;  4BPR A;  2VKD A;  4RAG A;  4K1X A;  4LG3 A;  2BF4 A;  2CS3 A;  5LD2 C;  2M30 A;  3CJR B;  1QG0 A;  1RR8 C;  3ZUG A;  4RPB A;  2FMY A;  1XDS A;  2VOP A;  1TWC J;  3RKY A;  4EVI A;  3T51 B;  4QVA A;  3OEH A;  1U78 A;  1R58 A;  2PLY A;  1RKW A;  4A3F J;  3MN2 A;  2DO7 A;  1R00 A;  1KJZ A;  3AL0 C;  2XGJ A;  4UVC A;  1JGG A;  2PMZ A;  5F4M A;  2K3P A;  1FX0 A;  2IGN A;  3OOU A;  4IOC F;  4ACA A;  5GV8 A;  3QOP A;  3H9N A;  1SAX A;  3LST A;  4FHT A;  3U1D A;  3S14 J;  2DYI A;  1Z7L A;  3GZ5 A;  1EFC A;  2DEU A;  1E3O C;  1WJC A;  2FEZ A;  4C2T A;  4RGX A;  3S32 A;  1N07 A;  2WA0 A;  2NT9 A;  3ESW B;  1DP3 A;  1H8E A;  4PC2 A;  2P8T A;  3CUQ B;  3N97 A;  2VL8 A;  2IRF G;  2WYR A;  2Y31 A;  5D4R A;  1WHU A;  2JT1 A;  2FBK A;  4YEL A;  4LLN A;  2X1E A;  4EJW A;  1XS9 A;  2OJE D;  4NNJ A;  1J09 A;  3I55 I;  1FDR A;  2EFO A;  3K2A A;  2RRE A;  4RLZ A;  3VMV A;  1P7I A;  2RKH A;  2PQ8 A;  1FYK A;  4YDT A;  2LD5 A;  2Y9Y A;  1VZ0 A;  3GYH X;  3GTQ J;  2ZSH B;  4LG0 B;  4IW3 B;  5J8C A;  2FX0 A;  4R79 A;  4WXC A;  3SUC A;  1T33 A;  4EM1 A;  2V4D A;  1QFJ A;  3CCV I;  2NTQ A;  1WU8 A;  2A6H F;  2MH2 A;  2HLD A;  5HZB A;  4PSX A;  3G05 A;  2X9D A;  1ETK A;  2LMD A;  2K9M A;  1OCR H;  1PUE E;  2PJR A;  1FSH A;  4P9F A;  2ADU A;  1TNT A;  4YG2 F;  1VLY A;  2VYQ A;  4HE6 A;  2YR2 A;  5AON A;  3W2A A;  4I0B A;  4TKO B;  3G71 I;  4WXH A;  4RB0 A;  3O8G A;  1YJ9 B;  4I84 A;  2VBZ A;  2L0K A;  3ZMS A;  4FET A;  2BN4 A;  3TKY A;  5CJ9 A;  3FXU A;  3L9F A;  4E7J A;  5BPD A;  4UV9 A;  5DUI A;  5FIU A;  1EFT A;  4BJ5 C;  4OPO A;  2F5C A;  1YFH A;  2KZG A;  5LBQ A;  2H8R A;  3B8Y A;  1TWA J;  3SZG A;  3B02 A;  1A31 A;  1P4M A;  1SFE A;  2VKH A;  3LA3 A;  4E4H A;  4XLF A;  5C3E J;  3WTY C;  4PMH A;  5DS9 A;  4G12 A;  2CO5 A;  3GF2 A;  1R22 A;  3QYF A;  3VMW A;  2W00 A;  1UHS A;  5AIQ A;  2ME0 A;  2OBP A;  3FM3 A;  4W97 A;  3GVL A;  2XGD A;  1JNY A;  2M4G A;  3M07 A;  2X8K A;  4G9Y A;  1PP8 F;  1G7T A;  3HOW J;  2Y0M A;  1JHF A;  2EFW A;  3CCE B;  3JSO A;  2EFN A;  3B78 A;  3R0J A;  2NV4 A;  4U4B A;  4YZA A;  5E17 F;  1R23 A;  2LRE A;  3ZPL A;  3FHN A;  3M8F A;  4UV8 A;  5HLT A;  3GX4 X;  4UHT A;  1MBH A;  5J1Y A;  2V7X A;  5EG0 A;  2EV6 A;  1KQ8 A;  2XKO A;  2BV6 A;  2R6H A;  3BJA A;  4IRH A;  1RUO A;  2LVS A;  2ZJ2 A;  4WCG A;  4JMQ A;  1MGT A;  2RGV A;  5TR9 A;  3QOE A;  1JB9 A;  4OIQ F;  1WSU A;  3OL3 A;  1S29 A;  1I1G A;  1G3W A;  1WJ5 A;  1E1R A;  1I6H J;  4P1V A;  2LF8 A;  4AVZ A;  3PA1 A;  2DA1 A;  3L2Q A;  4I6Z A;  4IPA A;  4KT6 A;  3H09 A;  2CJJ A;  3FMQ A;  2NS8 A;  3N05 A;  3MAJ A;  2OQR A;  4OWR B;  3OYI A;  2CGP A;  4AF7 A;  3I59 B;  4M3F A;  2OV7 A;  3VB2 A;  1GV5 A;  2H6C A;  4KN4 X;  1U2R A;  3M3Y J;  1T95 A;  3V8K A;  1I1S A;  2E1M C;  1Z9C A;  3SJP A;  1EE6 A;  2EIJ H;  4QIW N;  1LJ9 A;  2DA4 A;  2LK2 A;  5E20 A;  2CW7 A;  2OQG A;  1QVU A;  3KLO A;  2VQC A;  3QFT A;  1GXQ A;  3WXM A;  4DBQ A;  1U5T A;  1JTY A;  3K6G A;  4IZZ A;  3UR3 C;  1IC8 A;  4PC6 A;  1DDN A;  2Z8G A;  3JU4 A;  1XSD A;  2ZZQ A;  4DZJ A;  2VXD A;  4MQV A;  1SMT A;  3K7A J;  2Z33 A;  2VFQ A;  3NQO A;  5ED4 A;  5H5J A;  2EIK H;  3LYC A; 
#chains in the Genus database with same CATH homology
 1X4P A;  2KRC A;  3ZSC A;  2QKM B;  1WFX A;  2NOJ B;  4ZJZ A;  2BVM A;  3MD2 A;  2QX3 A;  4J00 A;  4ZDO A;  1BPL A;  1O8H A;  1OFM A;  4HPQ A;  4BJ6 C;  3CF2 A;  1W36 D;  2W7N A;  4XLE A;  2V9K A;  2QE7 A;  2NTP A;  3KYL A;  2ZXI A;  4BU2 A;  1QHG A;  1WPC A;  3GVJ A;  2OC6 A;  1UG0 A;  4Y4R A;  2V1N A;  2HQA A;  2VXZ A;  2KMU A;  2CK3 A;  1U0J A;  4DNR B;  4XNF A;  5KHD A;  3KEW A;  2R7S A;  4B43 A;  4KJZ A;  2LRD A;  1OHH A;  4D1Q A;  4F91 B;  4E7K A;  3FY3 A;  1LFP A;  2UV1 A;  3CZ6 A;  4BE2 A;  1PE9 A;  2ZFU A;  3RSN A;  1D1A A;  2DJI A;  4YRV A;  2VJI A;  4B47 A;  4F3Q A;  1BR2 A;  4YZ0 A;  1UD8 A;  4MR0 A;  3JUR A;  3A1Y A;  3EUK L;  4GRI A;  1T0F C;  2HU9 A;  4AYB A;  2X53 S;  3T53 B;  1MND A;  2KZV A;  4IX7 A;  3DKY A;  4G7X A;  1I18 A;  2L9S A;  1D0X A;  4XR6 A;  1EFR A;  1O88 A;  1EA3 A;  3VST A;  3T9G A;  4LIV A;  1JI8 A;  4XL9 A;  4W8Q A;  1WMR A;  2V7F A;  3ZXS A;  3PFY A;  4Y33 A;  3MKW B;  1WJA A;  1OOC A;  4RM2 A;  3H5N A;  3LL7 A;  3BCF A;  3H35 A;  3SEQ A;  1BMF A;  2X51 A;  3BCB A;  4BQO A;  2LG4 A;  3K4M A;  3OYE A;  4OJ5 A;  1O8J A;  2LOO A;  2NTB A;  3OIQ A;  2L9N A;  3MKY B;  1HZE A;  2XF6 A;  4XKC A;  3OYB A;  3RTR A;  1QJV A;  4PUS A;  1RU4 A;  4XKW A;  4FXU A;  2O0V A;  4C30 A;  2DCE A;  2I8D A;  4ZTJ A;  2R4G A;  3W3C A;  5HNH A;  1E43 A;  1E1Q A;  2IGO A;  4II3 A;  4CCN A;  5HKK A;  4KKT A;  2A6T A;  3EQN A;  1WJE A;  4XN0 A;  2MFZ A;  2W1O A;  2X85 A;  3CMM A;  4E7I A;  2IS6 A;  2HNH A;  4OJO A;  2IXS A;  2F1M A;  5AMV A;  2KLO A;  3OYN A;  4KKS A;  1X1C A;  5CDF A;  2WB1 A;  4CCL A;  3FPP A;  2R7U A;  3BC8 A;  4CH7 A;  3OAA A;  1V5E A;  4XLH A;  1Z21 A;  1XG2 A;  3H5R A;  3VDX A;  1OB0 A;  1O8F A;  4TSF A;  4RLQ A;  4PJM A;  3S93 A;  1OFL A;  2ZSI B;  1T5E A;  3DQV C;  1N78 A;  1RWR A;  2DT7 B;  1E3X A;  4DOZ A;  2O0W A;  1OGO X;  4XOR A;  4HNU A;  1PXZ A;  4Z05 A;  3K4L A;  2WAD A;  3HKZ A;  4PK4 A;  3QYB A;  4G6T B;  3K4N A;  3OL4 A;  4H4K C;  1WJB A;  4BUP A;  2JUG A;  1KMH A;  3DLA A;  1BR1 A;  1X1D A;  1N77 A;  3CES A;  2GK7 A;  2LY1 A;  4HEA 2;  2KDO A;  4B3X A;  3I3L A;  3FKS A;  3UW0 A;  4NK8 A;  3CP2 A;  4BAC A;  3ZIA A;  4OAZ A;  4OAY A;  2XDV A;  4B48 A;  3AL0 B;  3OR2 C;  3L2R A;  2NZM A;  4X0G A;  4U87 A;  2NSP A;  2WAF A;  4QPQ A;  3J7A Y;  3H5A A;  3DTK A;  4E7Z A;  1R6R A;  3DPU A;  2KP6 A;  3OEE A;  1W36 C;  4C2U A;  1D0Z A;  1MMD A;  2HZD A;  4D9J A;  2F43 A;  3OPO A;  4ITV A;  4P22 A;  3B90 A;  2DXI A;  2JJ2 A;  3WWG A;  3PUB A;  1NG6 A;  2L5Q A;  5CQE A;  1DGW Y;  3BLY A;  3A2K A;  3MMY B;  2MC4 A;  2CW8 A;  1DQU A;  3HXL A;  2VJ4 A;  1ZEL A;  1SKY B;  2R7Q A;  2M7A A;  4G6I A;  3OYF A;  1P9Q C;  3NE5 B;  3BCD A;  3PL8 A;  2HVS A;  4ZC3 A;  1I8D A;  3GVK A;  4GQN A;  5CQG A;  3G2B A;  4G7W A;  2IS2 A;  2CFO A;  3V42 A;  4EAT A;  2R7R A;  4XOP A;  3IUO A;  4ZDL A;  3RQ4 A;  3VSL A;  5HNF A;  1HG8 A;  2JJ1 A;  4EW9 A;  2K5C A;  1MMG A;  3DWL E;  1O8K A;  2VJJ A;  4CUG A;  2ZZG A;  2VQG A;  3E0J B;  3BG6 A;  3LSK A;  2K9L A;  1OR7 C;  2CH0 A;  4RLF A;  4XM3 A;  4BDY A;  2LC2 A;  2ZTN A;  2OUM A;  4HST A;  4ASU A;  3NWT A;  3FBI B;  1OLT A;  1X4O A;  4W8S A;  3H94 A;  4KIT B;  2X1D A;  3DPT A;  3H9Q A;  1LVK A;  2VIX A;  2X6Y A;  2UUZ A;  5KCM A;  2M0M A;  1W0J A;  4HIZ A;  1O8M A;  2HPM A;  4YZQ A;  3EPZ A;  4CCO A;  2VQL A;  1JTA A;  1G59 A;  3LSI A;  3K10 A;  2O04 A;  1UD2 A;  2XZL A;  4B3G A;  4IQ4 A;  3EQO A;  3GQA A;  2CUZ A;  4CA0 A;  3GBG A;  4BEH B;  4PSW A;  2UWM A;  1UD5 A;  1YE9 A;  2QXZ A;  2R7X A;  4F52 A;  2JIZ A;  2WAQ A;  5FRM A;  3OYA A;  3DKX A;  3EUA A;  1QHH D;  3DDY A;  3PJR A;  4BL0 B;  3WQZ A;  2PEC A;  3ZPN A;  2V26 A;  4OJ6 A;  2XOK A;  1X1A A;  3K4K A;  2GK6 A;  4Y3O A;  1NHC A;  1K28 D;  2MYS A;  3PSF A;  1Y56 A;  4UZU A;  2VQH A;  2GOM A;  2WY7 Q;  3ONQ A;  4OZY A;  3PNV A;  2L2O A;  2XF7 A;  2KHM A;  4XMY A;  4BQQ A;  4ZTF A;  4URR A;  4DNT B;  2NT6 A;  2P0W A;  2XND A;  3L2U A;  4NUB A;  3ZR8 X;  1IDK A;  2QKL B;  4PJL A;  5LFA A;  1PYV A;  2L7K A;  3OYH A;  3A3B A;  3VYU B;  4CSW A;  3L2W A;  2O5R A;  4OJL A;  3SEZ A;  3EUH C;  1X0C A;  1QU3 A;  2BVL A;  3OS0 A;  2JDI A;  4NC8 A;  3S3M A;  4L8J A;  2QY1 A;  3OYG A;  4B44 A;  4BXF A;  3LSG A;  2AQE A;  4MXN A;  2Z2S B;  2M5S A;  3OYM A;  1V5F A;  4E7L A;  5C1E A;  3VYR B;  1BOB A;  1MAB A;  2IGM A;  1UAA A;  3K4B A;  2XF5 A;  3T56 B;  2EWE A;  4E7S A;  5DN6 A;  1VJS A;  2F4I A;  3K4J A;  3RPU D;  3I9V 2;  2R9V A;  4CZC A;  3W2V A;  2W6J A;  4E0F A;  2GJR A;  3OYD A;  3HL2 A;  2F6C A;  2RQQ A;  4AU7 A;  3GQ9 A;  3M8J A;  4TT3 A;  2BW3 B;  4HRI A;  1BN8 A;  2BOL A;  2NST A;  2Z6B D;  5JHF A;  2X6X A;  2UVF A;  4XON A;  1Y6I A;  3W2W A;  4F92 B;  3ZCO A;  2ZZF A;  5FRO A;  4XLC A;  2CUJ A;  5CPR B;  2E1M B;  3S3O A;  3IP4 B;  3B4N A;  2VBK A;  2LBF B;  4DBR A;  1RMG A;  3HPH A;  4XQF A;  3K70 D;  3VSU A;  3ZPP A;  2V6E A;  3IAS 2;  3LMW A;  2VJ5 A;  2E1B A;  2WPD A;  2WSS A;  2KL4 A;  2GOX B;  4BS9 A;  2CV2 A;  2JA2 A;  4IQJ A;  2RNG A;  1IRX A;  2V31 A;  2UVE A;  4IKF A;  3F9K A;  2GJK A;  2IQ7 A;  3HOS A;  2W82 A;  3PNY A;  3FBN B;  3HPG A;  2XAU A;  3VWB A;  2MD0 A;  3RCO A;  3OYK A;  2R7T A;  2XZP A;  3LNN A;  4ANJ A;  3SYT A;  3A35 A;  3KX2 A;  1DGR M;  1CZF A;  2BW3 A;  3C2G A;  1O8L A;  4NK6 A;  3DU6 A;  4OZZ A;  2KQR A;  4XKB A;  2Z1D A;  2VB6 A;  2JVG A;  3VR6 A;  3NWS A;  2WJV A;  4F55 A;  1UD4 A;  4W8R A;  1W9X A;  2LBF A;  4DGW B;  1LDK B;  1O8I A;  3OWT A;  2MAB A;  3ZRG A;  2CMP A;  2WY8 Q;  1SAU A;  3D5S C;  2Q1Z B;  4JOM A;  4J01 A;  1O8G A;  1PJR A;  3UNG C;  3PSI A;  2XZO A;  3ZGK A;  1MW7 A;  3A4C A;  2KPM A;  2PYG A;  4LIU A;  2XC7 A;  2Q2E B;  3OS2 A;  3OYL A;  3HAG A;  1V5G A;  1AIR A;  2A5W A;  1G8X A;  1MMN A;  3C2H A;  2VAS A;  4OJP A;  1O8D A;  3ZQQ A;  4E7H A;  4BQN A;  1JRG A;  4BGD A;  1W0K A;  1WP6 A;  2WZP P;  4DK1 A;  2JSP A;  3LSM A;  3VYT B;  1V0F A;  1MMA A;  4Z03 A;  3LMM A;  2VBE A;  2VKD A;  1LKX A;  3BCA A;  4LG3 A;  3S3N A;  2CS3 A;  1H80 A;  4XKV A;  4PJJ A;  5LD2 C;  2INV A;  3CJR B;  1TT0 A;  2LYC A;  3BH4 A;  5KNL A;  1BR4 A;  4JQF A;  3OE7 A;  2X3H A;  3T51 B;  2Y0S A;  1IB4 A;  3OEH A;  2DT6 A;  3H9G A;  1GLN A;  3GQ7 A;  2IGK A;  1NBM A;  3AL0 C;  2XGJ A;  2ZXH A;  3BC9 A;  2V4J C;  2PMZ A;  2K3P A;  2KVO A;  2HDW A;  1FX0 A;  2IGN A;  3OOU A;  4P1W A;  2HVR A;  3M1C A;  5HVQ C;  3DTI A;  3GQB A;  3DU5 A;  1Z7L A;  2R7O A;  3HC7 A;  1NRK A;  3OOC A;  2ODL A;  1WJC A;  1HA8 A;  2LH9 A;  4C2T A;  3S32 A;  1BLI A;  3HOT A;  2WA0 A;  3SDB A;  3PNT A;  3QYE A;  1WJD A;  4N4O B;  3OR1 C;  3VSK A;  2M3A A;  1BHE A;  2NT9 A;  3VSV A;  4W8T A;  1DP3 A;  2WAE A;  4U49 A;  1H8E A;  2PJR B;  2VL8 A;  2ELJ A;  3K4C A;  3BG7 A;  3CJQ B;  3IAM 2;  1OGM X;  4DIQ A;  3H9J A;  4YEL A;  2M7B A;  1PLU A;  3CP8 A;  3TBI A;  3OW7 A;  4HWV A;  2X1E A;  3L2V A;  1TZL A;  4NNJ A;  1J09 A;  3U21 A;  1KON A;  2RRE A;  1DBO A;  4C9Y A;  3VMV A;  4P5O A;  3GRH A;  4KKU A;  2BSP A;  3MKZ A;  4BEH A;  1VZ0 A;  3DEE A;  2ZSH B;  4NQW B;  1QCX A;  1D0Y A;  2XSJ C;  4R79 A;  2VLA A;  4YXW A;  1FMV A;  1X1B A;  3KEY A;  3SUC A;  2DOA A;  2V4D A;  2NTQ A;  1AA7 A;  3K70 C;  3TL4 X;  2HLD A;  4PSX A;  3D5L A;  3G05 A;  1IA5 A;  5TGT A;  1V0E A;  2K9M A;  3E1S A;  2PJR A;  2LZJ A;  2WBM A;  4YEJ A;  1VLY A;  1DBG A;  4NC7 A;  2M4K A;  4CCK A;  4KIS A;  4B3F X;  1NG7 A;  3AKZ A;  2CV1 A;  4E6K G;  4ZDP A;  3W2A A;  3OFN A;  1UEL B;  3HG9 A;  4TKO B;  2PYH A;  1VBL A;  4XN3 A;  4I84 A;  1MNE A;  4PFO A;  5C1C A;  4DK0 A;  4FET A;  1FMW A;  4E7J A;  3LFU A;  2O1D A;  2AQF A;  3D5R C;  4BJ5 C;  1VF7 A;  5FL7 A;  2ZZE A;  2VPL A;  2JVH A;  1HVX A;  1WJF A;  2D3N A;  4MLO A;  1KTW A;  4QPO A;  3B8Y A;  2GJP A;  1SFK A;  1KCC A;  3SZG A;  2FUG 2;  3AFH A;  1YX3 A;  3KRG A;  4HNT A;  2WJY A;  1E0E A;  2VKH A;  4CCJ A;  1GQ8 A;  4E4H A;  4XLF A;  4PMH A;  1UD3 A;  4Z1M A;  1WTH D;  4YZX A;  2E5Z A;  3QYF A;  2W6I A;  3VMW A;  3HUG B;  1YX5 A;  2W4S A;  4HG2 A;  2W00 A;  4BE0 A;  3OS1 A;  1ERD A;  3GVL A;  3DTE A;  2VBM A;  2M4G A;  4II2 A;  2X8K A;  2LY2 A;  1KZL A;  2IS1 A;  3FDY A;  4U4B A;  4YZA A;  4LIT A;  2IS4 A;  2LRE A;  4XLA A;  5CKT A;  1X19 A;  3FHN A;  3DPL C;  5HLT A;  4XD7 A;  4C2L A;  4XOT A;  2KRH A;  3OY9 A;  3H0D A;  1E3Z A;  4F93 B;  3VYS B;  3OIP A;  2O17 A;  4BE1 A;  4RM3 A;  2HVQ A;  3GQ8 A;  4JMQ A;  3OYJ A;  2INU A;  1PKV A;  1N75 A;  2Z16 A;  3QOE A;  3QOD A;  2F5V A;  3OL3 A;  1WJ5 A;  1E1R A;  4AVZ A;  4CCM A;  3L2Q A;  4N4N B;  2DIE A;  2E60 A;  4KT6 A;  2R7V A;  3FKJ A;  3N05 A;  3OMY A;  4BJT A;  1K5C A;  1COW A;  4OWR B;  3OYI A;  4DJA A;  2ZTG A;  5FRN A;  3S8P A;  2OV7 A;  4BDZ A;  1Z3Y A;  3A3G A;  1T95 A;  2X6W A;  1D1B A;  5HOO A;  4U7B A;  2E1M C;  1EE6 A;  1IDJ A;  4PJN A;  4FAS D;  2D3L A;  1H8H A;  3OYC A;  1K6Y A;  2R7W A;  2CW7 A;  4PFP A;  1KCD A;  1Z3X A;  1S9H A;  4RMN A;  2VQC A;  2HPI A;  2CV0 A;  4DBQ A;  3K6G A;  1UD6 A;  2Z8G A;  4IZZ A;  3UR3 C;  4HSR A;  3JU4 A;  3TMO A;  2X1C A;  2ZZQ A;  2VXD A;  2E5N A;  1O8E A;  1E79 A;  4ZYA A;  3LSH A;  1D1C A;  4Z06 A;  5IK2 A;  2V7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...