4XORA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xorA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xorA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xorA02
3FY3A 4Z03A 1AIRA 4XONA 5C1CA 1JTAA 4Z05A 2QY1A 3VSTA 1IDJA 2O1DA 1NHCA 1O8HA 1JRGA 1O8KA 1O8EA 2NSPA 4OJPA 1O8IA 4Z06A 3UW0A 2PYHA 2PECA 1O8LA 3GQ8A 1O88A 2VBMA 2X85A 2VBKA 4OJ6A 2UVEA 4OJLA 2ODLA 1O8FA 4XN0A 2NTBA 1QJVA 4XOPA 1IA5A 4XR6A 4XKWA 1O8DA 1OGOX 1DBOA 4W8RA 3B4NA 4XLEA 3SUCA 2X3HA 1O8MA 4MR0A 4OJOA 1O8GA 1VBLA 2X6XA 4YZXA 2X6WA 4YZAA 3VSUA 3ZPPA 2NSTA 1K5CA 4MXNA 2VJIA 4XLAA 1RMGA 4URRA 2NTQA 1HG8A 3B8YA 2NTPA 4HWVA 1IDKA 2BSPA 4I84A 4PMHA 3VMWA 2EWEA 1KCCA 3VMVA 1O8JA 1GQ8A 1X0CA 4YZ0A 4OZZA 4XLFA 3JURA 2X6YA 4XKVA 4XLHA 3GQ7A 2INUA 4C2LA 1DBGA 1WMRA 1BHEA 4XORA 2INVA 4XN3A 2VBEA 3ZSCA 1KTWA 4NK8A 3EQOA 2NZMA 1RU4A 1BN8A 2QXZA 3T9GA 4U4BA 4XL9A 4XOTA 4W8SA 3B90A 2NT9A 4YELA 2UVFA 4U49A 1OFMA 1PE9A 4EW9A 2VJJA 1OGMX 2IQ7A 1QCXA 4W8TA 4OJ5A 2NT6A 4OZYA 1RWRA 2O0VA 4XLCA 1H80A 2O17A 3KRGA 1PXZA 1IB4A 3GQAA 2Z8GA 3WWGA 1OOCA 1XG2A 1PLUA 4YZQA 5C1EA 1KCDA 3VSVA 4NK6A 5AMVA 3GRHA 2O04A 4AVZA 2PYGA 2QX3A 4XQFA 3GQ9A 4YEJA 1EE6A 1OFLA 4XM3A 1CZFA 4XMYA 4W8QA 4XNFA 3LMWA 2O0WA 3EQNA
chains in the Genus database with same CATH superfamily
3I3LA 2VC0A 3PFYA 2EFWA 2OTLB 2DAOA 4E0FA 5IY5H 1UG0A 4QPQA 4ZGQB 2ZJPF 3DCFA 1CF7A 4LBVA 3ZRGA 4B44A 1XSVA 2FEZA 3TP3A 1BQEA 4LBWA 5ICEA 2XPVA 2LSOA 2MBFA 4E7KA 1VQ6B 1FMWA 1D5VA 1JKRC 2E2IJ 5B1AH 5IYQA 3OEEA 2JDIA 5D8KB 2XSJC 3A0BC 4OOVA 2VXDA 1KQ0A 2D2WA 4B3FX 1Y1VJ 4UV8A 2LP0A 3ABMH 4OJ6A 4ENMA 1EP1B 4ZZLA 1T5EA 4FETA 3WY9A 2VKEA 3KYCB 4A6DA 1HF2A 1WH5A 3LQQA 5J8FA 5DUKA 3S2DJ 1QHHD 3GMEA 5DD4A 1DP3A 1EP2B 1ZRFA 2HYGD 3U6BA 2DU9A 1AIPA 2BMWA 1X1PA 2K3PA 1MH4A 5IYBJ 1ZN2A 4J01A 4X7CA 2X3HA 2KZGA 2RAEA 3BTLA 3C2HA 2QSGX 1BN5A 4PK4A 3CDLA 4O6JA 1MNDA 1FDRA 3ZPNA 1QVTA 4CCMA 3OYCA 3OIQA 3FM3A 2R92J 1FY7A 2R7XA 2NSTA 2FQ4A 3C2BA 5D5UB 3AGQA 3GO5A 2OQGA 4RM2A 5CVRA 1BJAA 1ETQA 1TZLA 2CBXA 4HWVA 3IC7A 1VQ6I 1F60A 1KCCA 1O8JA 1V0EA 4IF4A 3RKXA 2XKPA 4DW6A 4ENNA 3K7AJ 1PKVA 3MCAA 3GRHA 3GLLA 3I53A 2OC6A 3JURA 1R22A 3ZQFA 3J81Z 3R6SA 4G7XA 1MDMB 4C2LA 1RRJA 1IUYA 3TQNA 3F8MA 4P1VA 1R71A 3I59A 3P9KA 3OR2C 4C3IJ 1UD5A 4PC6A 4FWTA 3BJAA 3QAHA 5JR3A 2FBKA 3BG9A 5E6TA 2E5ZA 5JHFA 1W34A 3K4LA 5EEAA 3DEUA 4BXFA 2GXAA 1XMAA 3N90A 1JTXA 2ZJQF 3HB9A 3NRVA 4KN7X 5TJJA 3CUQC 2L5QA 5CKTA 1DG1G 1E3OC 1WDTA 2PLFA 2JA6J 2K7LA 3H5RA 5K1YA 1PJ7A 2BM1A 3GVLA 5E79C 4HRIA 4HV5A 2JA8J 3J80K 5ICFA 2V7XA 5LHHA 1QVFB 2M3AA 4ZYHA 1EV7A 1GVJA 2STTA 2O61A 2XKOA 4E7JA 1YX2A 3BCAA 2YUSA 3CMMA 2EILH 2WC2A 2GK6A 2MA3A 2L7ZA 2C2WA 3BCFA 1XD7A 1K8AD 3CCMI 1HKQA 1QUEA 3C7JA 4NK6A 3H0DA 3TW7A 2Y9ZA 3ZN0A 1T6SA 1GV2A 3FXUA 1E0EA 1QPMA 2FA5A 2RC6A 2VYQA 3JRBA 4M4SA 5TR9A 5E17F 1D2EA 3CCSB 3M8EA 4EJUA 1SD7A 1VQPI 4BEHB 3L2VA 4Y7CA 4CSWA 1R5NA 3OL4A 1VQ4B 3HOTA 2M5WA 4JX6A 4ESBA 3CB4A 1REPC 1GDTA 1PYVA 2XAJA 4E7HA 3A1PA 1WJBA 1E1QA 4KMFA 1ZH5A 4D7MA 1B8IA 2ZKZA 2A69F 1ZM3A 2ELKA 2W82A 2F4MB 2KJBA 3AAFA 2V7QA 2ZSIB 1K4TA 4IHTA 3FKJA 3ZMDA 1U3EM 4LLLA 2F1MA 1MW7A 4A5MA 1BR2A 1DGWY 3MKWB 3ABTA 1IXSB 5K7HA 3GVAA 2ZNZA 2O8KA 3WBJA 3H09A 3OOPA 3ZR8X 2N8GA 2XGJA 1DU0A 4LLNA 3GTLJ 4IVNA 1VQ7I 3CLQA 2ZXIA 1MMAA 1C0WA 4GO1A 4CA0A 5KNLA 2ESHA 3GBGA 4BXUA 1OJLA 4KUMA 3VPRA 3ZUGA 2F2EA 3BPVA 3DLLF 3AG2H 5HNFA 3C18A 3PUMA 3B4NA 2R4GA 5J1RA 2JQ7A 4HF1A 2LK2A 2FU4A 4RA2A 2JZYA 3S8PA 4NHJA 4A3CJ 1G7CA 4YAFA 2L4AA 2HOTA 1EFUA 3ZIAA 4AF7A 4YZAA 1XTAA 4A69C 1OGJA 4DJAA 1YW9A 2KMUA 5KW9A 1D3YA 3FXOA 3DKYA 5HVQC 3TMOA 3V7RA 1YO5C 1PUFA 3VSKA 1YTYA 3Q3AA 1YRNB 4ZYEA 4B8XA 3AVWA 3VMWA 3BR6A 4R1HA 1EJ9A 3AGPA 1S3JA 4HSRA 3CCRB 1LPQA 3WTSC 4Z2YA 4BE1A 2VNJA 3C1DA 1TW3A 2R7RA 3M1CA 1ZLJA 1WQ2A 1WMRA 2E1OA 3G4SI 5FRNA 3ISXA 4GFBA 3P9CA 3OYAA 3E6CC 2HI3A 1LFUP 1ULYA 3I4NJ 2EZLA 1MSFC 2LY1A 4HLYA 2EPFA 5F6FA 4RAFA 2E1CA 2Y31A 1FYLA 1SD4A 2A3SA 3E5UA 1UD4A 1S6LA 1UCRA 3KP6A 1HVXA 1H89C 2JJ1A 1YS6A 2KQRA 4DOZA 5IOYA 1T2KA 2ISYA 1R4MB 4IOCF 1FBQA 2AQEA 2OTJB 3ONQA 2HQNA 3BTJA 2BF4A 4HE6A 4P26A 2YSRA 1QFYA 2E7WA 3PNYA 3S16J 3P26A 2VBTA 4OOXA 5FNZA 3ZN1A 3IWFA 2IT0A 3OY9A 1R9TJ 1VHEA 2VASA 5HNHA 4DBRA 4RD4A 3U6KA 2G7HA 2P81A 3R60A 4QPOA 2AS5F 4HE5A 4IW3B 3WNDA 1RWRA 3OYNA 4WZLA 1SEUA 4HEA2 4W97A 2BM5A 1APLC 5IYRA 3CCLB 1LJ9A 4JRAC 1WORA 1IXCA 2FMYA 1BM9A 2M1BA 2X51A 4N9IA 2EFOA 5EZHA 2E2JJ 3N6ZA 4YRVA 5HDNA 2BPOA 2VC1A 4L0YB 2A6EF 1UD6A 2DK8A 3FMRA 5H6RA 4XLNF 5IT9Z 5E3MA 1A5JA 2WYRA 1U9OA 4ZGNB 5EG0B 2QA4I 4L9JA 3WNCA 1KYWA 1O3QA 2EINH 4N9HA 2VE9A 3K2AA 5C1CA 1XMKA 2BGCA 2V1NA 3RDIA 4Z05A 1L3LA 1QUFA 3SHFA 5FROA 3PQKA 3T1BA 3CMEI 1R4NB 3DP7A 4G6IA 2CW7A 3FK7A 2JJ7A 3FMSA 5BS6A 2FOWA 1TL8A 5ICCA 1KU7A 1XQBA 3OKXA 4WQMA 3VR6A 3PUFA 3ZMUA 3ZBTA 4MYTA 1K4SA 4BS9A 4A3IJ 2HZTA 5J47A 4G8XA 1G7TA 3VB2A 5KVRA 3OV8A 5CVJA 1MBFA 5F1RA 2VBSA 2LC2A 3F72A 4E70A 1HKTA 4XSZF 4XKCA 1SD5A 1WPKA 3AVVA 1IUFA 2G0EA 1T39A 4PFOA 5FB2A 3TGNA 1OCTC 3Q5FA 4JK1X 3QRFF 5FLXZ 4Y52J 5B66C 1O3RA 2HQAA 3FXKA 2XTXA 2GA1A 4BHBA 1DQUA 3G1MA 4FE7A 1ZAOA 4CUGA 2EQRA 3OR1C 2GM4A 4A3FJ 1K78B 2F5DA 3K1PA 2XTYA 5TGTA 1KA8A 2X48A 1HDDC 1ZRCA 4A0YA 1O3TA 3RSNA 5FKLA 1P4AA 1TW2A 2G7UA 1T0FA 4PGGA 2KZVA 4ENJA 5D5VB 3EUHC 5J8CA 3GQBA 4RB1A 1K7AA 5JBQA 2ETHA 3DFGA 2X3UA 1XSDA 3LSGA 4RB0A 5FGMA 2XV4S 1JJ6C 4U88A 5L46A 3T8TA 1BLIA 3Q9VA 4RD2A 2B7EA 1POGA 2INUA 2BVLA 2EA2A 1DBGA 3LYCA 2MW8A 4PC1A 3FBIB 4LGWA 2OD5A 5HLTA 3HDDA 1FX0A 3CCQB 1LNWA 3LSKA 2DA6A 2OV7A 1SVLA 2M87A 5E3OA 1YLFA 3HL2A 2H94A 3A01B 4NK8A 3S1QJ 1UG2A 4MYUA 1B2RA 4L0ZB 3E5QA 3GTOJ 2LVSA 1A31A 3J7YJ 4EV0A 4MHGA 3HAGA 4XL9A 3BLYA 1Z9CA 2YWGA 3AVUA 2I5UA 1I6HJ 3GW2A 1KGSA 2XUBA 1DUXC 1UMKA 1ACIA 3MZHA 3ASRA 3B90A 2OU2A 1I27A 4OMZA 4R8HA 4DYCA 2HTSA 1G2HA 2QQ8A 3CC4I 1IN6A 5ICGA 3I9V2 2YWFA 2W84A 4N4NB 1V55H 1TWAJ 3K70D 3I4MJ 3DU1X 3IRQA 2AO9A 3PJRA 4ENKA 2XAHA 1VF7A 2H1KA 1RC9A 1N77A 5GP9A 1OCZH 3CUQA 5F27A 3GTKJ 2EZKA 3DWLE 4Y15A 3WWGA 2K9QA 2KIFA 2DTZA 4RDKA 2O7OA 5BPDA 5C4JJ 4YIFA 5GAEJ 3NB2A 1JUPA 2O04A 2VKHA 1MBHA 2KISA 2C4TA 2V1UA 1H85A 4DIQA 1VQ5I 3PM1A 4FE4A 4YCQA 2L3DA 2Z6BD 2A5WA 1WFXA 1R58A 3RYRA 2X1EA 2OTJI 2QCOA 3EQNA 2H8WA 3M7GA 2XAUA 4GXOA 3H94A 3CCUI 3LNQA 5IPAA 3ZQ7A 4UVBA 1WI9A 1E63A 2E19A 4IHYA 2VFMA 4WK8F 5HLHA 3E6DA 2YWEA 2ZC2A 4ZV4A 3K4MA 2Q2EA 4ZDPA 1I5ZA 4FT8A 3ZBUA 2O1DA 2VKVA 1Z05A 3OYFA 1AWCA 4UZEA 1QA6A 2YX4A 3WE3A 4KN4X 1T0FC 3S1RJ 2NSPA 5IOZA 3Q6QA 3OYKA 2F5VA 2L0KA 2L9RA 1BR4A 2KIQA 1S7OA 4Z4WA 3HOWJ 4PC3A 1ZREA 4MTDA 5E20A 1OMIA 1XSXA 3HIFA 4NC6A 3LJYA 1YITB 5HZAA 1HSJA 1N0UA 4FN5A 3KP7A 3MZ8A 4CICA 2RNJA 2D74A 1YJNB 3KP4A 3B8HA 4WF2A 3H9JA 1X3WB 2IPQX 2F5FA 3SZEA 2Y48A 1XGSA 3ZGKA 2IA2A 1ETXA 3IAM2 4RLFA 4AVPA 4F91B 1GR1A 1FTZA 3BC9A 1XPXA 2QENA 1AU7A 2UWMA 3A0HC 2Y2ZA 3ERMA 2DQRA 4L5JA 2F1LA 4FXUA 3TL4X 2L9SA 2KFDA 1FJLA 5JLVC 1RZ4A 4I0AA 2HPMA 3VO1A 2HFHA 1B9MA 4PJLA 2HLDA 3W5VA 3S15J 1FPQA 2HS5A 4LG3A 4A3BJ 1Q81D 2DJIA 4I01A 1FC3A 1TQIA 5D8LB 4X05A 2LOOA 2B9SA 1MNMC 2R93J 2M8GX 3HKZA 1YITI 2XAQA 4L9TA 4C3JJ 4XRFA 4XORA 4NC7A 3QODA 5EMNA 2K4BA 4PAAA 1DPUA 1MD0A 2QM3A 1CQXA 2EV0A 5FD6A 2NZMA 2VBYA 3DKWA 1IF1A 1UAAA 1KMHA 1MRZA 2DXIA 3ZQQA 3Q0VA 4PSXA 1ZKGA 4V19K 2RV8A 5FFZA 3E0JB 4IXAA 1E64A 5TY0A 5ILVA 3JX8A 1MMGA 2L7MP 3CO6C 1G4DA 4WCGA 4XOTA 1ZGWA 1ZTRA 3H5NA 3BOQA 3BQZA 1VQOI 3H3VK 2O0YA 3MZYA 4CQJA 1I3AA 2M34A 3EYYA 3TW6A 1H0MA 3WTYC 3ASSA 5CJ9A 3W5UA 2H27A 1TT0A 2BY1A 3I59B 1W35A 2CRVA 3V76A 4EGZA 3CCMB 1WSUA 3JRCA 2HNHA 2BV3A 3KE2A 3VYSB 4OZYA 2K9SA 2JRTA 2KL4A 2HYFA 3V7AA 1IB4A 4OIOF 1VF9A 1XMXA 2CU7A 2CW5A 4BXXJ 4AC0A 4A3MJ 3ZXSA 2R7FA 1YS7A 2VT2A 4LG0B 4L9NA 3SKBA 1XG2A 3CCSI 4Z4TA 2VE8A 4BJTA 4LITA 2DERA 2QX3A 2R7UA 5C44J 5AN9A 3HEFA 3TKYA 5BMZA 2DOGA 2LTPA 1B72A 2B63J 1ZG3A 5DM7F 1PP8F 4TKOB 5FL7A 1B6AA 1BJZA 3I55I 3LSPA 3QYFA 5F4MA 1Q86D 4MXNA 4UB6C 1QU3A 2HQRA 1W2BB 1YOVB 2Q6OA 1E3HA 2QY1A 1FLIA 5L3BA 5H6QA 2CUJA 3ASOH 3Q3SA 3I56I 4KIFA 3I0TA 3HRMA 2WY8Q 3OOUA 1R5OA 3CCUB 5LGNA 1G3TA 2IS2A 1QNTA 3F6OA 1QZEA 2Z2SB 2JWTA 2QGUA 2NS8A 5J4YA 1FYKA 1O8IA 4KKSA 4AYBA 4ZYGA 2F48A 1XDUA 1GUUA 1U5TA 3ZMZA 1BL0A 3M8FA 2X4HA 1FP2A 2EBIA 2Y0SN 4L5IA 3JSPA 2NVQJ 1ZR2A 1IA5A 1FZPB 3DBRB 3MCZA 2KDOA 5D5WB 3HRSA 4ZTFA 3QPSA 3CZ6A 4DNTB 1GLNA 3B02A 1P6RA 4A3EJ 4K2EA 3WHBA 1P2FA 1MJ9A 3KYLA 2GZWA 3ZPPA 3CC7I 1AKHA 2XHKA 3K4CA 2XRNA 4OAZA 1HA3A 3KEWA 3OYLA 2BM0A 1ON2A 3H3UA 2HPIA 3BC8A 4YXWA 2NTQA 4PMHA 5FA6A 2DYRH 4YAUA 1TTTA 3L2QA 5DUIA 3BTCA 3M07A 3HJEA 2C5BA 4EM2A 2DA5A 4OIPF 4RPBA 2BE5F 4X6AJ 1CNEA 1TQMA 4LK0F 3JAMK 1DARA 3H9GA 1GO2A 1Z6RA 2OK8A 2XZPA 3R6JA 2NNYA 2IS1A 1EFRA 1YG2A 5BOXA 3KEQA 1N08A 4HX4A 2R0QC 4NCNA 4BE2A 1ZQ3P 1KYZA 3T8RA 3W2AA 3DDYA 4ACBA 3BCDA 1W9XA 3E1YE 2PX9A 2PJRB 3OS0A 1Z6TA 4XN3A 3J81k 4BY7J 1TYVA 1TP4A 5TRDA 2X53S 4ZDOA 4P1WA 3CJTB 4XKBA 1KQSB 5E18F 1RU4A 4BY1J 2BZTA 2DYIA 2MD5A 3F0CA 1UHSA 2QA4B 1V3FA 1E2XA 5C3EJ 4QHYA 1WZ2A 1MGTA 3E7LA 1N06A 1QQIA 5LGTA 4A3JJ 1J59A 2QBYA 1FOXA 1JJ8C 4KKUA 1BR1A 1G6NA 3BG7A 4YELA 4WWCA 4MFDA 1XG1A 2PJRA 4U9UA 3A8JA 3RPUD 1IDYA 3KP2A 3OYHA 3RZDJ 2NRAC 1BA5A 4HZFA 3ECOA 2QQAA 5JHUA 2O6WA 5B1BH 3OPOA 3TEDA 1VTNC 2V7TA 2WA0A 4QLCU 1E17A 2HYJA 2NPFA 1TNSA 3K4NA 1ZG1A 1HQCA 2DMTA 4C3HJ 1YJNI 2GJKA 3D0SA 2M5SA 4BE0A 1J75A 3P4GA 1IN5A 4XQFA 3DF8A 2VQGA 2DK5A 3BR2A 4EJVA 3IL2A 4X07A 3WODF 5CDFA 5D6EA 3HTSB 1S8NA 3KLOA 1WJEA 3GXOA 3WHCA 3CCEI 3GTMJ 2K5CA 5H59A 4UNOA 3WG9A 1G3SA 1SFKA 3HHGA 1WHUA 3BG3A 5FKNA 3I56B 3BR3A 3VO2A 1VLOA 2XT2A 3HRTA 1VJSA 4HIZA 3WTUC 3ZZ0A 2C77A 1IDJA 4A3KJ 1RESA 2P7VB 2X9DA 4IHVA 1BPLA 2R7ZJ 5D6FA 1P4WA 3N97A 1IG7A 2BVMA 4UXNA 2GREA 4F55A 1O8KA 3QP6A 4YIIA 5EGOB 3A03A 5CVUA 4HYEA 4ROXA 1XGMA 1YJ9I 4ZYDA 4M2LA 1O88A 1DPRA 1HLVA 1HKSA 2XDVA 4MIMA 4JMQA 5HKKA 3I58A 2ODLA 1L1IA 2GOMA 5HS9A 1ETKA 2EV6A 2GOXB 3WTZA 2QSFX 2VIXA 4LK1F 1N05A 1NH3A 1I1SA 3BR5A 3H1CA 3KIOA 1S7EA 3OYGA 4MEXF 1KQ8A 5FO5A 4RCZA 3R6KA 5LBQA 3GX4X 4XLEA 3V42A 2FRHA 1I39A 4E7LA 2ZBUA 3PA2A 2YX7A 2FSWA 4XIDA 3NQOA 1NB9A 1OYWA 2J8KA 3W2EA 1NK2P 5GTHC 3RQIA 4HAMA 2CQKA 2DTRA 3HTUA 1YX5A 4G94A 5AONA 2L9NA 1UJ8A 4ETSA 4P6YA 1DDIA 3B8YA 4GCVA 3DU6A 1BW6A 2H1LA 1ZM9A 1IW7F 3SLDA 2JA7J 4I84A 4B09A 2MYSA 4WXDA 4XSXF 2DDBA 2CGPA 3QYBA 1IO2A 3PSSA 2DMUA 2D1HA 2IVMA 1WGXA 3S3MA 3A1YA 2X6YA 4RDUA 1BMFA 3NEUA 1K78A 4YC5A 4G5GA 3HOXJ 1DGRM 4Z1MA 4BUPA 3TOAA 1IB0A 5J3OA 1IN8A 2K9NA 4A3LJ 4PJ0C 2XB0X 2VQHA 3TO6A 2DA3A 4BYYA 1QRCA 3TBIA 1EFTA 1FIAA 4PABA 2E35A 4HNUA 3QP5A 5HODA 1FT9A 2V4JC 1NG7A 1KK2A 3T9GA 3F21A 3WGGA 3H5AA 2GA2A 2JPCA 4EM0B 4CZCA 2YPRA 3D1NI 4P3IA 3BJ6A 1KQ5A 2BX6A 3K4JA 2HZDA 1G3YA 4KNYA 3OSGA 3PA1A 5FFXA 4DNCA 3CPWB 2NT9A 4B4CA 3Q6RA 1YHQB 3H35A 3JRDA 2DT5A 3GEZA 4E7SA 3LQEA 4QUZA 1XCVA 4HF2A 1J5YA 1AKHB 1QCXA 2LFBA 2Q0OA 2E1NA 2E7XA 1U0JA 1AA7A 3VYTB 1N8RD 1X1DA 2HOAA 3VODA 2VPLA 3E6MA 4MNUA 3FPKA 1NBMA 2IEKA 3WU0A 2FD5A 1K61A 1KC8D 1X4OA 2MFZA 2VKDA 1T6XA 1VQKB 2W4SA 2BN4A 3QU6A 5JLWA 2VLAA 1JB9A 1GXPA 3WGIA 1LKXA 2FF4A 3CUOA 3PNVA 2RNGA 3ERED 2K3FA 1NK3P 1EP3B 5L3EA 1YLOA 4PCQA 3OJXA 3RKWA 4CYCA 3HBLA 1XC5A 2PQ8A 3ZMSA 5A2QK 1KRHA 5E3LA 1A36A 2HXIA 2E1MC 5E1WA 1IXRC 1QH0A 2O03A 4KDPA 3MD2A 3IAS2 4ASUA 2ISZA 4GYGA 2JVHA 5D4SA 5CQEA 2RC5A 3G3ZA 2XASA 4X8IA 3ASNH 4OJPA 3K6GA 5DTDA 1OYIA 2W7ZA 1Y0NA 1FNCA 2I10A 1ZELA 2TCTA 2W6IA 1JJ2B 2XAGA 4Z4SA 1G7RA 2RREA 1R49A 4BDYA 1J9IA 3ASTA 3FKSA 1LQ1A 2RKHA 2ZB9A 4LB5A 1QZZA 4XN0A 1ZM4A 2HGCA 3E6BA 3HG9A 2VJ5A 4BHPA 4OU0A 4JX5A 3GIRA 1KQ9A 2X0LA 3FX3A 5GAHJ 2XGDA 4CZZA 5J1YA 4M9ZA 2HMAA 3SEZA 3HOUJ 1O8DA 4W8RA 4BBSJ 2QTZA 1IGNA 2OUMA 5CPRB 4CCNA 2Z9OA 3CC4B 4OJOA 2IGOA 3DPTA 3BQJA 1I50J 2RN7A 3OYJA 5FRMA 1MBEA 4FX0A 3O2PE 1K5CA 2C78A 2VJIA 4Y9RA 1SMYF 1S5LC 3H92A 4KKTA 4BDZA 3AG3H 3E1SA 2W00A 5HLIA 5AIPA 3VNVA 1U2WA 1GQ8A 1T8IA 2V7UA 1VQ8I 3L2UA 2B7BA 1Z67A 1ZGJA 1ZG5A 1EXMA 1X4PA 2V26A 4M0LA 1FP1D 4GDFA 2VOPA 1NG6A 5EF6A 3OIPA 2LG4A 1LFPA 4AYBN 4P55A 1H8EA 1Y0YA 1S72B 1BHEA 3LSMA 3ZOBA 3DPLC 3VEPA 4RGXA 3PO2J 5L3DA 1LM1A 5LD2C 3S2WA 4BKXA 2F6CA 2V5IA 1SD6A 3OIOA 3DTIA 2M8EA 2UUZA 3EPZA 2QMUA 2GQQA 2A61A 2O9LA 3S93A 3Q0UA 1U78A 3S14J 1WOOA 1W0TA 2ZZQA 1MZBA 1JE8A 3IUOA 3EDPA 4C2UA 2AHOA 1LDJA 2IA0A 3CP8A 3GZ5A 5BQTA 1JI8A 1EKEA 3LFKA 4HNTA 1JNYA 2WSSA 4TN1A 3T51B 1ONVA 4Y17A 5EYRA 4S0HB 4UUTA 1WU8A 1HZEA 1Q1VA 4AIDA 4XLCA 2GAUA 1R1TA 2O17A 1QGZA 3BDDA 1OOCA 1D1CA 2QGGA 3S17J 4IRHA 3JU4A 4CO8A 1R00A 4Z4RA 3VSVA 3PUBA 1N75A 2HKOA 2ZMEA 3L9FA 3QYEA 4R79A 2GLOA 2ACJA 4PDKA 1EA0A 4BU2A 1T33A 3RCOA 1IDZA 4ZYAA 4IZZA 4DK1A 1OFEA 1EA3A 2LH9A 1W7PA 3ONUA 3SQNA 1E3ZA 4XNFA 1UD3A 2DT7B 1DDGA 2PJPA 1B59A 4WXHA 4M6VA 3FXQA 3FZVA 3MFKA 3PO3J 3FY3A 2IS6A 1A6IA 4V2GA 5KHDA 3WU1B 2Y0MA 2D3LA 2LY9A 3VYRB 2GQFA 4A93J 2DPDA 2Y75A 1SM4A 1V4RA 3MHPA 2CK3A 3E97A 2PMUA 5DYMA 2M7AA 5FO1A 2L7FP 4CCLA 2NYXA 4AU7A 1ZR4A 3RY8A 1QX4A 4RB2C 1TNTA 4H4KC 5BSYA 3IV5A 2YUHA 3RYPA 2F3LA 4DGWB 3HKZN 2DIEA 3S1MJ 4Q5SF 4G6TB 1W0UA 1A8PA 4A3GJ 1VQPB 2RQPA 2XC1A 4II2A 3GTQJ 2X85A 2B0LA 5DS9A 3ZQCA 2UVEA 3G4SB 3BROA 3CD6I 3OEHA 3VSLA 1GXQA 5BNGA 1TWCJ 2NTBA 4UB8C 3MMPA 5HS8A 2H8RA 2X1CA 1Z91A 5E8GA 1U5TC 5LHIA 4F92B 2VXZA 2ZFWA 4J19A 3BNWA 1QQ1A 4E7ZA 2DFEA 2L01A 2VNHA 4AIJA 2M0CA 1H88C 1IV8A 1OCCH 1OCOH 1QO0D 1IV6A 2JK3A 4YAOA 3DQVC 2PIAA 2A05A 1K4ZA 1JHFA 1H42A 3GZ6A 4IJAA 4YFKF 2A68F 2PE3A 4N3GA 2OZUA 4BQNA 2IOUG 5M5YJ 2YR2A 4DQKA 4LB6B 2HCJB 3S2HJ 4M3FA 2PEXA 3BQYA 2E36A 4ZCMA 3K69A 1EH7A 1Y56A 1G7SA 1NTCA 4LMYA 1P4MA 1O57A 3ZCOA 5CLSA 2VJ4A 3M4OJ 4IX7A 4CDGA 4EATA 3CCRI 2DJNA 1FTTA 1FOWA 4TMZA 2QF7A 3KETA 1IRXA 3LQ6A 4I09A 4KT5C 4HDVA 4RS8A 2CO5A 3TP0A 1UD2A 2XAFA 3HUGA 1ZK8A 3QFSA 2VONA 1TLLA 3X2QH 4N3NA 2VFOA 4CCJA 1X1BA 3LSRA 3ZZTA 3P9IA 3H36A 4U49A 4PC7A 2BXYA 2ZBVA 2W1OA 4XRSG 1OFMA 3WTTC 2IGMA 3F8CA 3LAJA 2BGJA 3CTAA 3VMFA 3RI4A 4MO7A 3EYIA 4HBLA 4Q4ZF 2V31A 4X1EA 2R5YB 3WTXC 3QOEA 1QZYA 1A35A 2Z3YA 1FNMA 2XROA 4OAYA 4G7WA 1CNFA 2FBHA 4RM0A 4UAJA 2NVYJ 1E3PA 3IP4B 1J09A 2KHMA 1PJ5A 1GJRA 4FX4A 2O5RA 4CYCB 2E34A 2HTJA 2VBWA 3W2WA 1H8AC 4YALA 1RETA 3HOSA 1Z3YA 1F1ZA 1X2NA 4M3EA 2YWHA 2JSPA 2E1RA 2LKSA 1TUIA 1IAWA 3OZVA 4RAZA 3MEXA 1MBJA 1XB2A 2NVUB 4QIWN 1JTAA 1QA1A 2K85A 2PMZN 3VSTA 2QLZA 3AG4H 3FBNB 3Q0WA 2QN6A 1OHHA 3D5SC 1UHWA 2P6TA 4FCYA 2BSAA 3ASQA 3G71B 4EVIA 2QUFA 5E1XA 4ZTJA 3SLNA 4JYKA 1KK3A 1MJAA 2HR3A 1KK1A 4XLPF 1DDNA 2STWA 4OOSA 3H3ZA 3ZMVA 4Z06A 3P27A 3LOCA 5HS7A 2DPUA 2QSHX 5FJ8J 4D1QA 4IHWA 4HNVA 1Y6IA 2DO7A 3A3BA 2LR8A 2Q6LA 1XX5A 4DNRB 5JVTA 3OZWA 1I7PA 1KTVA 1HW1A 4G7OF 1J2XA 5KAIC 2BM6A 2XEXA 2HQ5A 3CMAB 1OQYA 3G2BA 4GRIA 2HU9A 1FYMA 1W4MA 3CCVB 1Y8QB 2J5OA 3A4CA 1SFUA 1XN7A 1RIOH 2BBYA 2ZL6A 5M3MJ 5H5JA 1DU6A 4HG2A 2I1LA 4YZXA 1YW7A 1N25A 4W1UA 4B4DA 4WZKA 3W6VA 4BL0B 2GBYA 2BGIA 1V54H 3QPLA 3RKQA 3J7ZI 2NVXJ 1B23P 2ZSHB 1RMGA 3EUAA 2XF6A 4QSHA 3GCMA 4C2TA 4C0SA 4P6VF 1SVOA 3TO9A 2NTPA 2MC4A 3U1KA 3J81K 4DBQA 4KH3A 1ODDA 2ZJ2A 3ABLH 3F9KA 3FF5A 5DNSA 5B6IA 1BI3A 1OLTA 4LBYA 5IT9K 3FM5A 2WADA 2KKOA 4B43A 1PJ6A 1HA8A 4PGOA 3OP1A 2X6OA 5LFAA 2JN6A 4IRGA 3JW4A 4BGDA 4KT6A 2MH9A 1KTWA 2VQLA 3EQOA 3ZMTA 1HC8A 2P4WA 1LUJB 2RGVA 2CSOA 3T5XA 4O3MA 3O3KA 4G6DA 2DFHA 2BW3B 1T6YA 2DFIA 2ZITA 3CCLI 3OYIA 3V7CA 4B3AA 3MN2A 4EH1A 4RPDA 4IRIA 5HDKA 3HC7A 2HOSA 2QTLA 2V4DA 3LL7A 3K0LA 1ZYRF 2R7QA 3HZJA 1OCPA 1U9NA 1FRNA 3CW2A 4L9VA 4EJTA 4BAYA 4WZTA 2LZJA 2GWRA 3W6JB 5IYDJ 3WYAA 3I55B 1PXZA 1K83J 2QQBA 5F64A 3E3VA 1R1UA 1QVUA 1JA1A 4CHUA 3SXYA 1KCDA 4OPWA 5LHGA 3RIQA 2XOKA 1UMQA 4P3YA 1IRFA 2MABA 3JCUC 1K6YA 2ECBA 4ZH4F 2M2EA 3ECHA 4W8QA 1W36C 3HSFA 1Z1DA 3CCJB 4RCYA 2O0WA 2LKPA 1CQTA 3ONYA 2ME6A 2P3MA 3SFIA 4Q7JB 3PETA 4M72A 2V7VA 2LDUA 4DQLA 4NDLA 1RKTA 3BCBA 3QU3A 4HLXA 1WJCA 4NBQA 2DOEA 3SDBA 5HOOA 4OPSA 1BW5A 4Z4ZA 3F3XA 3GSIA 4HOBA 4RD0A 4ZJZA 2FXAA 2UV1A 2Y9YA 3EUHA 3KX2A 1YQAA 1T6ZA 3PQJA 2BY2A 2EIJH 4EM1A 1ON1A 1VZ0A 4P25A 2FNPA 1RQPA 1KD1D 3PIPF 1E1RA 5FKOA 3EQLF 5J35A 4FASD 1LDKB 1K8FA 1XGNA 1FOYA 2P5VA 2KIUA 2P5KA 3A01A 4F7ZA 2IS4A 2UXNA 2FUG2 1UELB 3V4GA 4U7BA 2LREA 4UVAA 2OPTA 2XT4A 1YW8A 2PN6A 1JTYA 5A8AA 3C2GA 2MSYA 3BH6B 3A8IA 1NRKA 1S7AA 1DBOA 3LSJA 4KYWA 5JMCB 4ESJA 1VBLA 5IP9J 4BJ5C 5J6XA 3ELKA 5HLGA 1QFJA 1TVCA 1KU9A 3PL8A 1VQ5B 3IKVA 2M7BA 2WB1A 2CV1A 1VQKI 4IEJA 1K6OA 3OYMA 1GVHA 2K02A 1X1CA 1BIAA 2CQXA 1WJAA 2E2HJ 1OB0A 1YIJI 2MD0A 1HW5A 2OBTA 1GVDA 4I02A 1X19A 4YZ0A 4QFMA 2XZLA 5LEKA 3GFIA 4LLGF 3OW2B 5IYPA 2L02A 3N05A 2M9HA 2VZLA 2J8IA 2NV4A 3IH2A 3LAPA 4ZDLA 3CDIA 2OYNA 3F6VA 2KLOA 1P4XA 4M3GA 3I1FA 4AIHA 5CVIA 3NAWA 3CJQB 3K4BA 4ABZA 3CF2A 1MJBA 2VNKA 1BI0A 1KONA 1IRGA 4YIRX 4M9SA 2P6SA 3HOZJ 2GPJA 1TT5B 1VFCA 2DYSH 2XIGA 1S9HA 4CYDA 3E20A 3VNUA 5EDNA 1WCMJ 4I7HA 3BG5A 2NVTJ 1XFOA 2VB6A 3CRZA 4HX7A 2CF4A 4TV7A 3OOCA 2R7WA 4YFNF 1ZRDA 4KFCA 1W5CC 5DS0A 4ZCLA 2H6CA 4WWVA 1F36A 4DZPA 3OYBA 1WOPA 3NE5B 2XF5A 1HSTA 2V1XA 2ZXJA 4AIKA 4EW9A 4W8TA 5D4RA 4HA8A 3WTVC 4OJ5A 2DMQA 3K2ZA 2NT6A 1RI7A 2EZHA 1MMNA 2XPWA 1QFZA 1F9NA 4YEIA 3HOYJ 2QKLB 1LB2A 3PSZA 2QYUA 3BH4A 5EJCA 3CDHA 3WXMA 2JUGA 4CCKA 3T0YA 1V5FA 3N4MA 2W6JA 3GTPJ 4Z4YA 5F04A 4YEJA 4O5VA 4KISA 3BTIA 3QWLA 2ZTNA 3L1PA 1GAWA 4OOIA 3JQRA 4P9UA 1G8XA 3FXMA 1VQ9I 1QG0A 1QGAA 1TYXA 4DK0A 3OYEA 1WPCA 5M5XJ 4BNCA 4JX4A 1W1WE 2V1DA 2FJ1A 1MABA 2ZBKA 2Z99A 1Z21A 1WWXA 1P7JA 2QZ8A 2UXXA 4NB5A 2XNDA 4C30A 4EMSA 2R5ZA 1D8KA 2ME0A 3O8GA 5GPCA 2UZKA 4ITVA 4OM9A 2CRGA 1RUOA 5E8IA 4PUSA 3VYUB 2CUFA 4YG2F 3DTKA 2OJED 5EG0A 4OIQF 1TC3C 1ELOA 1WP6A 2AQFA 2EV5A 2GJPA 4AD9A 3WTWC 1H9TA 1IJFA 5TV2A 5J4VA 2A07F 1QPIA 1VI0A 2DMPA 2VL8A 2G0YA 2VBKA 1U5TB 3UNGC 5A2QZ 1PUEE 2Z33A 4IHSA 1WTHD 4D7NA 4QTRA 2JT1A 5FIUA 3AG1H 3AFHA 4RAGA 1I6XA 2HVRA 4LD5A 3VWBA 2OZ6A 2H6BA 5LMZA 2XSDC 2HDWA 4A0ZA 5IYCJ 2GXBA 3LVBA 3CLOA 4AWXB 2WBMA 3G1OA 4TMTA 4ZCIA 1ZARA 2DETA 4V2FA 3R61A 4BEHA 1JGGA 5L3FA 2VNIA 2OQRA 2ZXWH 3HM5A 2DOAA 2KP6A 3KLNA 4LFUA 1RNLA 1OR7A 4XLAA 3PVDA 4QVJA 1JGSA 2Z5UA 1XB4A 1G59A 4XRSA 4RMNA 3G6EI 1D8JA 1UZCA 5FKMA 3VMVA 2P5LC 1ZLKA 5IYWA 1FRQA 3PSIA 5J3LA 4TT3A 3HRUA 3H9QA 2F43A 2MGQA 3ZQIA 4V02C 3JRHA 5M3FJ 1MSEC 2AHQA 1FNBA 2WV0A 5K5QA 1YI2B 1FBSA 1T38A 3ZQLA 1JKOC 2OBPA 4PJNA 2Y30A 4F93B 2ZZFA 2DA4A 3HPHA 4B3GA 2DA7A 3QFTA 4L8JA 2BHYA 1WSRA 3MMYB 5K7ZA 1P92A 1AHDP 1TBXA 2ZZGA 2QXZA 2BXZA 3B6AA 2EK5A 4OIRF 3V8LA 1QBJA 1ZUNB 4U4BA 1FSEA 2Z1DA 1TTYA 2BW3A 3CMYA 2ID3A 4ANJA 2ELJA 2F5EA 3MKYB 2DA2A 4LIVA 2FOKA 2HKXA 1P9QC 5DCFA 1R1VA 2QBYB 1LFBA 5JVGF 1FOKA 4PC2A 4N0BA 2XZOA 4U0VA 4ACAA 3HOVJ 2ZL7A 1OGMX 3KP3A 4U87A 4NQWB 5GPAA 4CCOA 2OBRA 1AOYA 3S32A 2VBVA 2JVGA 4Y7NJ 4X7EA 2IGKA 2K9LA 1YJWI 2HVSA 3FXJA 1JT6A 5ERIA 3GVKA 2GIZA 3ES9A 4P2NA 1W5SA 2LMDA 1RR8C 2Q2EB 5AMVA 3E5XA 5HDGA 3TO7A 3ULQB 1J9ZA 3CC7B 1QVGB 1WVRA 1MH3A 1OFLA 1WI3A 3EUKL 1X58A 2EFNA 5FD5A 5DEQA 2ZCWA 2R6HA 4B48A 5DM6F 3LMWA 2JRMA 1OFCX 4HQEA 2ZZEA 1NB0A 2BM4A 3F8BA 1AIRA 4M6XA 2DDAA 1JUSA 2KJCA 2V6CA 3CJNA 1H9GA 3KCCA 1VQLB 3DKXA 1B8IB 1U8BA 3GYHX 4M71A 3HSRA 3I5UA 4M6YA 4D0PA 3U1DA 1FBUA 3BZ6A 3VOEA 1YYVA 4EQQA 2VI6A 4XK4A 4BQAA 1I3QJ 3A02A 4UZUA 1MBKA 5E1ZB 4Y9UA 2FX3A 3F8FA 3PNTA 1VHOA 2NS7A 2QQ9A 1YIJB 4F3QA 5EGOA 1PDNC 1LE8A 3J7AY 2G9WA 1FWZA 4RGSA 4U0WA 3CO7C 4FHTA 3QPHA 2C4UA 4X06A 4X7FA 3GQ8A 1MMDA 1WKMA 5DCMB 3BP8A 4ON0A 5DV5A 3F23A 2IAIA 2TDXA 2JSCA 1JKQC 2D3NA 2VN2A 2IP2A 3M8JA 1JXSA 2P8TA 4XR6A 2KIMA 2P7CB 4M53A 4BJ6C 4DQ2A 1D8TA 4RDLA 3AKZA 1MNEA 4IPAA 3AL0C 2X6XA 1O8GA 4G7ZF 5LRRA 2OAZA 3REOA 3UKGA 1T95A 2OA4A 4HQMA 4IQ4A 2O6GE 2XPUA 2IGNA 2W48A 2TRTA 2CW0F 4XICA 1YJ9B 1VQ7B 1ETWA 3W2GA 4RAYA 4KJZA 1CLWA 1HG8A 4ASNA 3AVYA 3T53B 2BSPA 4G1BA 3KZZA 4CH7A 2OCCH 2LBFB 1E43A 1TLHB 2VQCA 2FE3A 4OZZA 2M0MA 3IH4A 2CG4A 3B6CA 4XLHA 3LSIA 4LOCA 4PJMA 1HF0A 1IJEA 1BX0A 3B78A 3ZQGA 1VQNB 3BWGA 3QFRA 4AUXA 2R7SA 2L54A 1Z7UA 1HW2A 4I99C 1IN4A 1QRBA 2IA1A 2WPDA 2X8KA 1V5GA 4JQFA 5E3NA 1HOMA 1NDHA 1VLYA 1K73D 2IRFG 1FNDA 2XNJA 4MLOA 2NOGA 1USSA 2HEOA 3RPQA 1BC8C 3W2VA 1XE1A 2MC3A 4P12A 3LA2A 3BG6A 3ML6A 3OL3A 3BPXA 3PENA 1Z77A 5FLXK 2V9KA 4M3DA 3D26A 4QWQA 3QE2A 3FJOA 2JIZA 2YU3A 5THXA 1R5GA 2D5VA 3JRGA 1W7PB 1UB9A 2I8DA 4B3XA 3CCQI 1R5BA 1T08B 5D5XB 1LLZA 5B5EC 5F08A 5H20A 1IN7A 3IKTA 3W2FA 1PE9A 1OFDA 5C4XJ 1TWFJ 2DFFA 2WV1A 4HW0A 4A2UA 1Y8RB 2LNBA 2OK7A 1VQ4I 3LA3A 2LYCA 1YIOA 4Y4RA 3GQAA 3BJOA 5DD8A 2R9VA 2RQQA 4M9XA 2LRDA 1Q9SA 2W25A 3GWZA 1SKYB 1WJ5A 3BR1A 2PYGA 2RVCA 1EE6A 5F0CA 4C9YA 3GUDA 3B82A 2M4KA 3ZC3A 3WNBA 4G9YA 5KCMA 3TDZC 2VBXA 3C3WA 5IT3A 3CQZJ 3O8HA 5LEJA 2K86A 1RR7A 2JTVA 3FHZA 1SFOJ 2EIMH 1XGOA 1PP7U 3K9TA 4RLQA 1HBXG 1QGYA 2R7DA 2WZPP 3R4KA 2VOOA 3A2KA 1BOBA 2DY1A 3RKYA 4FK8A 3TH0A 4E6KG 3WE2A 3FDYA 2CV2A 2WB1N 2R5ZB 1SAUA 2K40A 3KPHA 3H0GJ 1FNNA 2HOEA 4I98B 4XBFA 1ETVA 1K28D 5GV8A 1OB2A 3IWZA 3RQ4A 2J7KA 2QKMB 2F4IA 4LJZF 4D5CA 2F5CA 1R7JA 2E1MB 2FMLA 3L7WA 1F20A 2GK7A 3OE7A 1B72B 2F4OB 4D5FA 3M9AA 1WJFA 3UW0A 2PECA 1B9NA 2VPRA 2K4JA 3DBLB 1ETYA 4RGRA 4NQWA 4B1RA 2VBMA 3SZTA 1EWYA 4UHTA 2PG4A 3DV8A 4P9FA 1TWHJ 5GAGJ 3KZIC 4PFPA 4S04A 4TMXA 3CUQB 2A6HF 3EETA 3GZNB 1EZGA 3HYIA 3S1NJ 1MIJA 5F0FA 1K79A 2KRFA 3GLXA 2CFOA 4M3BA 3FIWA 1N78A 1X1AA 2EB7A 2JMWA 5BPIA 1WXRA 3W2HA 3WQZA 3WBKA 3OJWA 5L3GA 1Y0UA 1VQ9B 6PAXA 4NBSA 2JA2A 2KVOA 2KPMA 3VDXA 1ZM2A 1NHAA 4FTHA 2QZAA 4URRA 4E7IA 2ADUA 2CS3A 2WAEA 3RZOJ 2KRHA 2L7KA 1YJWB 3SY2A 3U9GA 5ED4A 4P9SA 1EF4A 2VFQA 1J0RA 1O3SA 2C5HA 1X0CA 3LO8A 4KITB 3ZP5A 5JI6A 4U0YA 2V9VA 3KZYA 1T98A 1R5HA 1WJDA 1BX1A 3O6BB 1FIPA 2IJLA 1MMSA 2PBIA 4JOMA 4RJLA 3RPUA 4BPRA 2HWVA 3SYJA 3B73A 2OF7A 3I54A 4X0CA 3DPUA 1RQRA 1W5TA 2R5YA 2ECCA 1BN8A 1IC8A 3G6EB 2EFQA 2EZIA 2HVQA 3D5RC 3Q39A 2BV6A 3LA7A 3NAUA 1RPWA 2CC2A 3OAAA 1U8RA 1SVMA 3K1NA 4PZJA 4DYQA 1GV5A 3HSEA 3LSHA 5FKKA 2ZXHA 4G7HF 3HGYA 4CGZA 2XVCA 3IHUA 1TSPA 1RKWA 1OCRH 5L3CA 4OINF 1GHCA 3DEWA 4G12A 2IQ7A 2WAQN 4Q48A 1HXDA 1E62A 3SJMA 2CUZA 2L4MA 2V6EA 3CP2A 1H80A 3FK6A 1CF7B 5F4JA 3GFLA 3ZQHA 2CJJA 2LBFA 2ZNYA 1VQOB 3ESWB 3LNNA 3A35A 4H0EA 1EH8A 4UY8I 4YFOA 4A5NA 3NWTA 1FMVA 1CZFA 2BHZA 4JP0A 2XRLA 1QHGA 3JRAA 5JLXA 4OP7A 1D1BA 4A3DJ 4YFXF 4L5EA 3W3CA 5DDGA 5EEGA 3GTGJ 3ZPLA 1BJKA 1LEBA 2VFPA 3MKLA 3CC2B 1TYUA 1HDPA 1BIBA 4FQGA 1GT0C 2WR8A 4MTEA 2JA5J 5J1UA 1ENHA 2ELHA 3V8KA 1COWA 1L0OC 3I4PA 1O8EA 1ETOA 5DSZA 2EJRA 3AVXA 1H8HA 3M1EA 1MBGA 1LE8B 2XB5A 3CXCB 4KMUX 3G05A 1STZA 2VT3A 1D1NA 3SFZA 1LDDA 5F0HA 5DCMA 3JTGA 5FLVA 4AM3A 2CQQA 3CPXA 4AC9A 3QSYA 4D9JA 1OB5A 2QVOA 2KDZA 3LMMA 2WJYA 2Y0SA 2GXGA 4A6EA 4X0GA 1XS9A 2B5OA 3U2QA 2CQNA 3RJPA 5AIQA 4XKWA 2LY2A 3G1LA 3K4KA 3BY1A 2NS0A 4Y3OA 2PLYA 3DXJF 2Y69H 4M73A 2QEXB 3DU5A 3BZCA 4YAWA 5F4OA 3JREA 3FXLA 3SEJA 4Z4UA 5IYNA 4MR0A 2ZL5A 1G3WA 3HGGA 4GGGA 4UV9A 2W24A 3S3NA 1X3ZB 3MVPA 3CD6B 3OFNA 1U2RA 4OPOA 2CH0A 3T56B 2XF7A 1WH7A 3BH7B 3IH3A 3MAJA 4MFEA 4WX9A 1QA2A 4LC0A 4NUBA 2DEUA 2RDPA 2VODA 3L00A 4RM3A 3DEEA 3MQ0A 2F4NA 3FHNA 4UZFA 2MLKA 2ZFUA 1Z3XA 3OW7A 1D0YA 4XKVA 2LKXA 3GQ7A 2B7CA 2KT0A 2JN9A 4IL6C 3FXRA 3W5HA 1IHMA 4Z4VA 1D0ZA 2A5YB 3PFIA 1TQPA 3V7SA 1W0KA 3W2IA 2VBEA 1SMTA 4RD1A 2OBSA 1P7IA 2Q8KA 4F7DA 1YE9A 4IQJA 1V5EA 3BY6A 2VUMJ 4H9GA 2V9PA 3KFWX 4EJWA 1Q1HA 1VQMI 2QDXA 4P22A 2OCEA 4Z6YA 3G73A 3WU2C 2AXTC 3WG7H 4W8SA 3HUGB 1JT0A 1UHMA 1VQLI 3ABKH 3TOBA 1OKRA 3L2RA 2QYOA 2VBZA 4DZJA 1LLWA 2UVFA 2YU9J 1PJRA 1TWGJ 2H09A 3OS2A 1RUNA 3MWMA 3OMYA 3W6KB 4GQNA 1NJID 3K70C 2DLLA 3LWFA 1FEXA 5M5WJ 5CQGA 3SDGA 2M30A 3CCJI 1FSHA 1R36A 2DQLA 4OPVA 5FO0A 2O0VA 3WGHA 3CCEB 1WRJA 4KIGA 1WOSA 4I2OA 1QGPA 2W7NA 5C1EA 2CWEA 3VFZA 3OZUA 1V0FA 3KEOA 3OWTA 1B4AA 4AVZA 4BHCA 4UUSB 2O3FA 3IRRA 3OS1A 4PSWA 2X0KA 4XMYA 2NOJB 4TSFA 2M4GA 3U2RA 4A0XA 3JRFA 4M74A 2IBDA 3KYDB 5TISC 2FX0A 4OWRB 5ILSA 4I76A 4A12A 4XD7A 5KAFC 3DTEA 4Z03A 5GV7A 4XONA 4BQQA 2D1VA 2ID6A 4S05A 3LSTA 1BC7C 4UUSA 1ERDA 2XTWA 4UUVA 1O8HA 2CFXA 2XC7A 1S72I 3QQAA 2OTLI 2LF7A 2RC4A 4JBAA 2P0WA 3UR3C 2BOLA 4YDTA 1PUFB 2J5PA 1OYYA 1Y39A 2WJVA 1Q82D 2EH3A 3BT9A 1R6RA 3FMQA 4KA4A 2CW8A 3K10A 1TYWA 4BACA 1YI2I 3G71I 3NWSA 1D0XA 1QJVA 4XOPA 1SKQA 2DN0A 2GJRA 2DBBA 1YX3A 3M3YJ 1CGPA 4UVCA 4IHXA 2LF8A 3CCYA 3NARA 4TMVA 4BH9A 1OGOX 2BM7A 3SUCA 3RIRA 1DP7P 1GAQA 2XGEA 4ESFA 5LGUA 3Q38A 2ESNA 4RLZA 4Q47A 2X6WA 4BQOA 3VSUA 2EA4A 2O8XA 1VNDA 1IZ1A 4E4HA 5ILUA 3GVJA 3SZPA 3SYTA 2BY3A 2FBIA 2DT6A 5GTIC 1JKPC 2DW4A 1T56A 2W85A 4X7DA 4C43A 5LRSA 1X3UA 3JTHA 1Y0RA 1OPCA 4NNJA 2PMDA 5A88A 2V79A 1IDKA 3CJRB 1S4MA 2D45A 1R5ID 1Z7LA 5KK1A 3CCVI 3ML3A 5CYVA 4K1XA 4XLFA 2VFNA 3AVTA 3GFJA 5IP6A 2DCUA 3Q9SA 2E60A 4HX8A 4KICA 3P5JA 3FWEA 2QE7A 4NC8A 4G1VA 2MG4A 4RD6A 1KK0A 3HXLA 3OSFA 3H9NA 1Q7YD 3COAC 3D5LA 3HHHA 4MQVA 3BR0A 5HXBA 5K5OA 1ORKA 2INVA 3A3GA 1R23A 2CNDA 3SJZA 4HSTA 3ZSCA 5FLMJ 1BI1A 2ZMEC 5K5RA 1F43A 2CMPA 5J40A 2CUEA 1SFXA 4BBRJ 4CXFA 2BY0A 1JA0A 1EFCA 1DABA 2A6TA 2WY7Q 3DBHB 4HPQA 1LEAA 3CF5F 4IO9F 1ITYA 3JAMZ 3A8KA 5IP7J 1WSVA 3SJPA 2BYVE 3ROUA 3AL0B 4I6ZA 4LIUA 4RGUA 4LBZA 1W36D 2HDDA 4J0QA 2COBA 1F4KA 3ABUA 2VJJA 2B0RA 5EEHA 1W87A 4IOAF 2E1BA 3CMAI 4MGRA 3JRIA 3QFCA 2W57A 5IK2A 3JQQA 4IKFA 4L18B 5H2FC 3FPPA 3R0JA 2DODA 1J7KA 4HDUA 4YZQA 4I0BA 3FISA 4AF6A 3QOPA 3JSOA 3JR9A 2Q6IA 1S0UA 1YHQI 1XDSA 1K9MD 2DA1A 3V8JA 3FKIJ 2L9VA 2BEOA 3BZKA 2K9MA 5F1JA 3L2CA 1JHHA 3JQPA 2K27A 2DCEA 2PMHA 2QEXI 3RTRA 3CMEB 1E79A 2YS9A 2ZTGA 1PVEA 4EEFG 1E3XA 2EFPA 4M1KA 2ICWG 1O7FA 1I1GA 2FVGA 1BBYA 1VQNI 1I18A 3J80Z 4LG0A 1W0JA 1XCBA 2ZMEB 1NHCA 1B1BA 2IW5A 1HCRA 3LFUA 5HZBA 4Y13A 2HXOA 3PSFA 1SFEA 1JRGA 2R7OA 2WTEA 4ZC3A 1FX7A 1ZGAA 4Y33A 2VBUA 2D9RA 1D5YA 3PIOF 1MDMA 1N0VC 1USTA 1W7PD 5B3SH 4YHBA 4MEYF 4PJJA 3F22A 1BOAA 3U21A 3S3OA 1U6GA 2DOFA 2R7TA 2CYYA 2JUCA 1KZLA 1O8LA 2PYHA 4HF0A 2JJ2A 5JFRA 1OGIA 5EZGA 2DI3A 4P5OA 4TMWA 4OJLA 1SANA 1O8FA 2LLKA 1D1AA 2EIKH 5LLQA 3L09A 4FISA 3CC2I 2EFGA 2X1DA 5BSXA 2PMZA 4XRMA 4HV6A 9ANTA 2Q6KA 4EGYA 1O8MA 3J7AO 4GYIA 2GIVA 2LD5A 3GTJJ 4MQ9F 1S29A 3P7NA 1V5VA 4R71A 5GADJ 2EIXA 2IXSA 2C6YA 2XGCA 3KP5A 1BI2A 1EH6A 2WWYA 2HDCA 2DMNA 2KRCA 2XGXA 1SAXA 3ASPA 3KL9A 2M45A 4ZZDA 3MKZA 1LVKA 1YRNA 2EWNA 1M1EB 2COMA 1F5TA 1KU2A 1X2MA 4QV2A 2CQ7A 4P96A 2EWEA 1OISA 1AMOA 4G6QA 1N07A 1Y1WJ 1UFMA 2NAZA 1OR7C 1SC7A 2JPBA 4KIBA 2PI0A 3F8NA 5CVVA 4WZEA 3AK5A 1IRZA 1QRYA 3LQRA 4C2MJ 2WZNA 5DN6A 1JUMA 2AXLA 2ZJRF 4J00A 1VQMB 3GFMA 5K7FA 2MH2A 4OMYA 3ZZUA 3R0AA 1MKMA 3TDUC 2CV0A 5A89A 3DLAA 2XNCA 1VQ8B 1UD8A 3KEYA 1QA3A 2E5NA 3HPGA 2Q1ZB 3ISPA 4B47A 4RBOA 5KSWB 2R7VA 4EJOA 1KJZA 1IJWC 2QWWA 1KU3A 3SEQA 3SZGA 3PUNA 1A6QA 4RB3C 1O7LA 1A04A 3GF2A 4WXCA 2WAQA 1YFHA 3I71A 4RDJA 4U7DA 3BY2A 4N4OB 4F52A 1M1KD 2E71A 1M90D 2ZO4A 3KRGA 2Z8GA 4PGHA 2NNNA 3K1MA 1PLUA 1I8DA 2V7FA 2HDNB 2WAFA 1O4XA 4QVAA 4II3A 3GQ9A 1LVAA 3QPTA 1ZHFA 1Z0XA 4XM3A 2Z16A 2V7WA 1KZHA 3CESA 2FNAA 2FQ3A 4RD3A 2L2OA 2MLGA 3OYDA 2R3SA 3I64A 3L2WA 3SQVA 2BVNA 2NXNB 4DYRA 2PFBA
chains in the Genus database with same CATH topology
4E6KG 3I3LA 3FDYA 2CV2A 3PFYA 1QU3A 1SAUA 4E0FA 1JTAA 1UG0A 4QPQA 2QY1A 3VSTA 3FBNB 1OHHA 2CUJA 3D5SC 1K28D 3OOUA 2WY8Q 3ZRGA 4B44A 3RQ4A 2QKMB 2F4IA 2IS2A 3OE7A 2E1MB 4ZTJA 2GK7A 2Z2SB 4E7KA 1FMWA 1O8IA 4Z06A 4KKSA 4AYBA 3UW0A 1WJFA 3OEEA 2JDIA 2XSJC 2PECA 2VXDA 2VBMA 4D1QA 3A3BA 4B3FX 1Y6IA 4OJ6A 4DNRB 4PFPA 1T5EA 4FETA 1IA5A 1QHHD 1DP3A 3G2BA 2CFOA 4GRIA 2KDOA 2HU9A 1N78A 1X1AA 4ZTFA 3A4CA 3CZ6A 2K3PA 2X3HA 4J01A 4DNTB 1GLNA 3WQZA 4HG2A 3C2HA 4YZXA 4PK4A 1MNDA 3KYLA 3ZPNA 4BL0B 4CCMA 3OYCA 2JA2A 3OIQA 2KPMA 3VDXA 2R7XA 2KVOA 2NSTA 3K4CA 3KEWA 2ZSHB 4OAZA 1RMGA 4URRA 4RM2A 4E7IA 3EUAA 3OYLA 2CS3A 2WAEA 2HPIA 2XF6A 2KRHA 3BC8A 1TZLA 2L7KA 4C2TA 4YXWA 2NTQA 2NTPA 2MC4A 4HWVA 4PMHA 3L2QA 1KCCA 4DBQA 1O8JA 1V0EA 1PKVA 3F9KA 1X0CA 4KITB 1OLTA 2OC6A 3H9GA 2XZPA 3JURA 2WADA 4B43A 2IS1A 1EFRA 4G7XA 1HA8A 4C2LA 5LFAA 1WJDA 4BE2A 3W2AA 3DDYA 3OR2C 4JOMA 1UD5A 1W9XA 3BCDA 2PJRB 4BGDA 4KT6A 3OS0A 4XN3A 2E5ZA 3DPUA 1KTWA 2VQLA 5JHFA 2X53S 3EQOA 3K4LA 4BXFA 4P1WA 4ZDOA 4XKBA 1RU4A 1BN8A 3D5RC 2HVQA 3OAAA 2L5QA 5CKTA 2BW3B 3LSHA 2ZXHA 4KKUA 3H5RA 3OYIA 3GVLA 1BR1A 4YELA 3BG7A 4HRIA 3HC7A 2PJRA 2V4DA 3LL7A 3RPUD 3OYHA 2R7QA 2IQ7A 2M3AA 4E7JA 3BCAA 3OPOA 3CMMA 2CUZA 2V6EA 2LZJA 3CP2A 1H80A 1PXZA 2GK6A 2WA0A 3K4NA 3BCFA 2LBFA 2GJKA 1KCDA 2M5SA 4NK6A 3H0DA 4BE0A 3LNNA 4XQFA 2XOKA 3A35A 1E0EA 2MABA 2VQGA 3NWTA 1FMVA 1CZFA 1K6YA 4W8QA 1QHGA 1W36C 5CDFA 4BEHB 3L2VA 2O0WA 4CSWA 1WJEA 2K5CA 3OL4A 1D1BA 3HOTA 1SFKA 3BCBA 3W3CA 1WJCA 1PYVA 3SDBA 5HOOA 4E7HA 1WJBA 1E1QA 1VJSA 4HIZA 1IDJA 1BPLA 2W82A 4ZJZA 2UV1A 3KX2A 2V7QA 2ZSIB 2BVMA 3FKJA 4F55A 1COWA 1O8KA 1VZ0A 1O8EA 2F1MA 1MW7A 1H8HA 1BR2A 1DGWY 3MKWB 1E1RA 4FASD 1LDKB 3G05A 1O88A 2XDVA 3ZR8X 4JMQA 2XGJA 2IS4A 4D9JA 2WJYA 3LMMA 5HKKA 2Y0SA 2ZXIA 2GOMA 2FUG2 1UELB 2ODLA 1MMAA 2GOXB 4U7BA 2LREA 2VIXA 4X0GA 4CA0A 5KNLA 3GBGA 3OYGA 4XKWA 2LY2A 3C2GA 3K4KA 1NRKA 1DBOA 4Y3OA 5HNFA 4XLEA 3V42A 3B4NA 2R4GA 3DU5A 4MR0A 4E7LA 3S8PA 1VBLA 4BJ5C 4YZAA 3ZIAA 3S3NA 4DJAA 2KMUA 3PL8A 2M7BA 2WB1A 3DKYA 3TMOA 5HVQC 2CV1A 3OFNA 1YX5A 3VSKA 2CH0A 2L9NA 3T56B 2XF7A 3OYMA 3ZPPA 3B8YA 1X1CA 3DU6A 4I84A 3VMWA 1WJAA 4NUBA 2MYSA 4HSRA 1OB0A 2MD0A 4BE1A 1X19A 3QYBA 4RM3A 2R7RA 4YZ0A 3DEEA 2XZLA 3FHNA 3M1CA 3S3MA 2ZFUA 1Z3XA 3A1YA 1D0YA 2X6YA 4XKVA 3OW7A 3GQ7A 1BMFA 1WMRA 3N05A 5FRNA 3OYAA 1DGRM 4Z1MA 4BUPA 4ZDLA 2LY1A 1D0ZA 2KLOA 1W0KA 2VQHA 2VBEA 3TBIA 1YE9A 1UD4A 3CJQB 4HNUA 1HVXA 3K4BA 4IQJA 2JJ1A 2KQRA 3CF2A 2V4JC 1NG7A 1V5EA 4DOZA 3T9GA 2AQEA 1KONA 3H5AA 3ONQA 4CZCA 4P22A 3K4JA 1S9HA 2HZDA 4W8SA 3HUGB 2VB6A 3PNYA 2NT9A 3OY9A 3H35A 3OOCA 2UVFA 3L2RA 2R7WA 4E7SA 2VASA 5HNHA 1PJRA 3OS2A 4GQNA 3OMYA 4DBRA 3OYBA 3NE5B 2XF5A 4EW9A 3K70C 1QCXA 4W8TA 4OJ5A 4QPOA 1U0JA 1AA7A 3VYTB 5CQGA 1RWRA 1X1DA 2VPLA 2NT6A 3OYNA 1MMNA 2O0VA 4HEA2 1NBMA 2QKLB 2W7NA 1X4OA 2MFZA 2VKDA 3BH4A 5C1EA 2JUGA 4CCKA 1V0FA 2W4SA 3OWTA 1V5FA 2X51A 4AVZA 2W6JA 2VLAA 3GRHA 4YEJA 4YRVA 1LKXA 4KISA 2ZTNA 3PNVA 2RNGA 3OS1A 4PSWA 1UD6A 4XMYA 2NOJB 4TSFA 1G8XA 2M4GA 4DK0A 3OYEA 1WPCA 4OWRB 4XD7A 2E1MC 1MABA 3DTEA 4Z03A 5C1CA 4XONA 1Z21A 4BQQA 2V1NA 2XNDA 4Z05A 4C30A 3MD2A 3IAS2 5FROA 4ASUA 1ERDA 1O8HA 2XC7A 2CW7A 4G6IA 2JVHA 5CQEA 3VR6A 4ITVA 4OJPA 3K6GA 4PUSA 3VYUB 2P0WA 3UR3C 3DTKA 4BS9A 1WP6A 2AQFA 2GJPA 1ZELA 2BOLA 2W6IA 2WJVA 2LC2A 2RREA 1R6RA 2VL8A 2VBKA 4BDYA 2CW8A 4XKCA 3FKSA 3K10A 3UNGC 4BACA 4PFOA 1WTHD 3NWSA 1D0XA 4XN0A 1QJVA 3HG9A 2VJ5A 4XOPA 2GJRA 1YX3A 2HQAA 3AFHA 2HVRA 3VWBA 1DQUA 3SEZA 1O8DA 1OGOX 4CUGA 4W8RA 3OR1C 3SUCA 2HDWA 2OUMA 5CPRB 4CCNA 4OJOA 2IGOA 2WBMA 3DPTA 2X6WA 5TGTA 4BQOA 3OYJA 5FRMA 4E4HA 3GVJA 3VSUA 4BEHA 3RSNA 3SYTA 2DT6A 2DOAA 2KP6A 2VJIA 4XLAA 1K5CA 4KKTA 4BDZA 1G59A 2KZVA 4NNJA 3E1SA 3EUHC 3GQBA 2W00A 4RMNA 1IDKA 3CJRB 3VMVA 1Z7LA 1GQ8A 3PSIA 3LSGA 4TT3A 3L2UA 3H9QA 2F43A 1BLIA 1X4PA 4XLFA 2V26A 1NG6A 2E60A 3OIPA 2LG4A 1LFPA 2QE7A 2INUA 2BVLA 4NC8A 1H8EA 1DBGA 3HXLA 3LSMA 1BHEA 3FBIB 5HLTA 1FX0A 4PJNA 4F93B 3D5LA 3DPLC 3LSKA 2OV7A 2ZZFA 3HL2A 3HPHA 3A3GA 5LD2C 4B3GA 4L8JA 2INVA 2F6CA 4HSTA 3ZSCA 4NK8A 3MMYB 3DTIA 2UUZA 3EPZA 2CMPA 2QXZA 2ZZGA 3S93A 4U4BA 3HAGA 4XL9A 3BLYA 2A6TA 2Z1DA 2BW3A 2ZZQA 2WY7Q 4HPQA 3IUOA 4ANJA 2ELJA 4C2UA 3MKYB 3CP8A 1JI8A 4LIVA 3B90A 1P9QC 3AL0B 4HNTA 4LIUA 1W36D 2XZOA 2WSSA 3T51B 3I9V2 4N4NB 2VJJA 1OGMX 3K70D 4U87A 4NQWB 4CCOA 3PJRA 1HZEA 2E1BA 1VF7A 3S32A 5IK2A 4XLCA 2JVGA 2O17A 1N77A 2IGKA 2K9LA 2HVSA 3DWLE 4IKFA 3WWGA 3FPPA 1D1CA 1OOCA 3GVKA 3JU4A 4YZQA 3VSVA 2Q2EB 1N75A 3PUBA 5AMVA 2O04A 2VKHA 3QYEA 4R79A 4BU2A 1OFLA 3EUKL 3RCOA 4DK1A 4ZYAA 4DIQA 4IZZA 2Z6BD 1EA3A 2A5WA 1WFXA 2K9MA 2LH9A 4B48A 2X1EA 1E3ZA 4XNFA 1UD3A 3LMWA 2DT7B 3EQNA 2XAUA 2DCEA 3H94A 2ZZEA 3RTRA 1E79A 2ZTGA 3FY3A 1AIRA 2IS6A 5KHDA 1E3XA 2D3LA 3VYRB 3DKXA 1I18A 3K4MA 4ZDPA 1W0JA 2O1DA 1NHCA 3OYFA 2CK3A 3LFUA 2M7AA 3PSFA 1JRGA 1T0FC 2R7OA 4ZC3A 4AU7A 4CCLA 4UZUA 2NSPA 4H4KC 4Y33A 3OYKA 2F5VA 3PNTA 4PJJA 4DGWB 3U21A 3S3OA 2DIEA 4G6TB 4F3QA 2PYHA 2R7TA 1BR4A 3J7AY 1KZLA 1O8LA 3GQ8A 4II2A 2JJ2A 1MMDA 2X85A 4P5OA 2UVEA 4OJLA 3OEHA 3VSLA 1O8FA 2D3NA 1D1AA 2NTBA 3M8JA 2X1DA 3H9JA 4XR6A 2X1CA 2PMZA 4BJ6C 3ZGKA 4F92B 1O8MA 2VXZA 3AKZA 1MNEA 3AL0C 1O8GA 2X6XA 3IAM2 4RLFA 4E7ZA 4F91B 3BC9A 1T95A 4IQ4A 2IGNA 2UWMA 4FXUA 2IXSA 4MXNA 3TL4X 2L9SA 3DQVC 2KRCA 4KJZA 2HPMA 3MKZA 1HG8A 3T53B 1LVKA 4PJLA 2HLDA 2BSPA 4BQNA 2EWEA 4CH7A 4LG3A 2LBFB 1E43A 2DJIA 2VQCA 1OR7C 4OZZA 2M0MA 2LOOA 4XLHA 3LSIA 4PJMA 1Y56A 3HKZA 2R7SA 4XORA 4NC7A 3ZCOA 3QODA 2VJ4A 5DN6A 2WPDA 2X8KA 1V5GA 4JQFA 4J00A 4IX7A 1VLYA 4EATA 2NZMA 4MLOA 1UAAA 1KMHA 2CV0A 2DXIA 3ZQQA 4PSXA 3DLAA 3W2VA 1IRXA 3E0JB 1MMGA 1UD8A 3KEYA 2E5NA 3BG6A 3HPGA 2Q1ZB 3OL3A 4XOTA 4B47A 1UD2A 2V9KA 2R7VA 3H5NA 2JIZA 4CCJA 1X1BA 3SEQA 2I8DA 3SZGA 4B3XA 1TT0A 4U49A 1OFMA 2W1OA 1PE9A 2WAQA 2HNHA 2IGMA 3VYSB 4N4OB 4F52A 4OZYA 2KL4A 3KRGA 1IB4A 2V31A 2LYCA 4Y4RA 3GQAA 3QOEA 2Z8GA 3ZXSA 2R9VA 1XG2A 2RQQA 4OAYA 2LRDA 1I8DA 4G7WA 2V7FA 1PLUA 2WAFA 4BJTA 1SKYB 4II3A 4LITA 1WJ5A 2PYGA 2QX3A 3IP4B 3GQ9A 1J09A 2KHMA 2R7UA 4C9YA 1EE6A 2M4KA 4XM3A 2Z16A 5KCMA 2O5RA 3W2WA 3CESA 3HOSA 4TKOB 1Z3YA 5FL7A 2L2OA 2WZPP 4RLQA 2JSPA 3OYDA 3QYFA 3L2WA 3A2KA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FY3 A;  4Z03 A;  1AIR A;  4XON A;  5C1C A;  1JTA A;  4Z05 A;  2QY1 A;  3VST A;  1IDJ A;  2O1D A;  1NHC A;  1O8H A;  1JRG A;  1O8K A;  1O8E A;  2NSP A;  4OJP A;  1O8I A;  4Z06 A;  3UW0 A;  2PYH A;  2PEC A;  1O8L A;  3GQ8 A;  1O88 A;  2VBM A;  2X85 A;  2VBK A;  4OJ6 A;  2UVE A;  4OJL A;  2ODL A;  1O8F A;  4XN0 A;  2NTB A;  1QJV A;  4XOP A;  1IA5 A;  4XR6 A;  4XKW A;  1O8D A;  1OGO X;  1DBO A;  4W8R A;  3B4N A;  4XLE A;  3SUC A;  2X3H A;  1O8M A;  4MR0 A;  4OJO A;  1O8G A;  1VBL A;  2X6X A;  4YZX A;  2X6W A;  4YZA A;  3VSU A;  3ZPP A;  2NST A;  1K5C A;  4MXN A;  2VJI A;  4XLA A;  1RMG A;  4URR A;  2NTQ A;  1HG8 A;  3B8Y A;  2NTP A;  4HWV A;  1IDK A;  2BSP A;  4I84 A;  4PMH A;  3VMW A;  2EWE A;  1KCC A;  3VMV A;  1O8J A;  1GQ8 A;  1X0C A;  4YZ0 A;  4OZZ A;  4XLF A;  3JUR A;  2X6Y A;  4XKV A;  4XLH A;  3GQ7 A;  2INU A;  4C2L A;  1DBG A;  1WMR A;  1BHE A;  4XOR A;  2INV A;  4XN3 A;  2VBE A;  3ZSC A;  1KTW A;  4NK8 A;  3EQO A;  2NZM A;  1RU4 A;  1BN8 A;  2QXZ A;  3T9G A;  4U4B A;  4XL9 A;  4XOT A;  4W8S A;  3B90 A;  2NT9 A;  4YEL A;  2UVF A;  4U49 A;  1OFM A;  1PE9 A;  4EW9 A;  2VJJ A;  1OGM X;  2IQ7 A;  1QCX A;  4W8T A;  4OJ5 A;  2NT6 A;  4OZY A;  1RWR A;  2O0V A;  4XLC A;  1H80 A;  2O17 A;  3KRG A;  1PXZ A;  1IB4 A;  3GQA A;  2Z8G A;  3WWG A;  1OOC A;  1XG2 A;  1PLU A;  4YZQ A;  5C1E A;  1KCD A;  3VSV A;  4NK6 A;  5AMV A;  3GRH A;  2O04 A;  4AVZ A;  2PYG A;  2QX3 A;  4XQF A;  3GQ9 A;  4YEJ A;  1EE6 A;  1OFL A;  4XM3 A;  1CZF A;  4XMY A;  4W8Q A;  4XNF A;  3LMW A;  2O0W A;  3EQN A; 
#chains in the Genus database with same CATH topology
 3I3L A;  2VC0 A;  3PFY A;  2EFW A;  2OTL B;  2DAO A;  4E0F A;  5IY5 H;  1UG0 A;  4QPQ A;  4ZGQ B;  2ZJP F;  3DCF A;  1CF7 A;  4LBV A;  3ZRG A;  4B44 A;  1XSV A;  2FEZ A;  3TP3 A;  1BQE A;  4LBW A;  5ICE A;  2XPV A;  2LSO A;  2MBF A;  4E7K A;  1VQ6 B;  1FMW A;  1D5V A;  1JKR C;  2E2I J;  5B1A H;  5IYQ A;  3OEE A;  2JDI A;  5D8K B;  2XSJ C;  3A0B C;  4OOV A;  2VXD A;  1KQ0 A;  2D2W A;  4B3F X;  1Y1V J;  4UV8 A;  2LP0 A;  3ABM H;  4OJ6 A;  4ENM A;  1EP1 B;  4ZZL A;  1T5E A;  4FET A;  3WY9 A;  2VKE A;  3KYC B;  4A6D A;  1HF2 A;  1WH5 A;  3LQQ A;  5J8F A;  5DUK A;  3S2D J;  1QHH D;  3GME A;  5DD4 A;  1DP3 A;  1EP2 B;  1ZRF A;  2HYG D;  3U6B A;  2DU9 A;  1AIP A;  2BMW A;  1X1P A;  2K3P A;  1MH4 A;  5IYB J;  1ZN2 A;  4J01 A;  4X7C A;  2X3H A;  2KZG A;  2RAE A;  3BTL A;  3C2H A;  2QSG X;  1BN5 A;  4PK4 A;  3CDL A;  4O6J A;  1MND A;  1FDR A;  3ZPN A;  1QVT A;  4CCM A;  3OYC A;  3OIQ A;  3FM3 A;  2R92 J;  1FY7 A;  2R7X A;  2NST A;  2FQ4 A;  3C2B A;  5D5U B;  3AGQ A;  3GO5 A;  2OQG A;  4RM2 A;  5CVR A;  1BJA A;  1ETQ A;  1TZL A;  2CBX A;  4HWV A;  3IC7 A;  1VQ6 I;  1F60 A;  1KCC A;  1O8J A;  1V0E A;  4IF4 A;  3RKX A;  2XKP A;  4DW6 A;  4ENN A;  3K7A J;  1PKV A;  3MCA A;  3GRH A;  3GLL A;  3I53 A;  2OC6 A;  3JUR A;  1R22 A;  3ZQF A;  3J81 Z;  3R6S A;  4G7X A;  1MDM B;  4C2L A;  1RRJ A;  1IUY A;  3TQN A;  3F8M A;  4P1V A;  1R71 A;  3I59 A;  3P9K A;  3OR2 C;  4C3I J;  1UD5 A;  4PC6 A;  4FWT A;  3BJA A;  3QAH A;  5JR3 A;  2FBK A;  3BG9 A;  5E6T A;  2E5Z A;  5JHF A;  1W34 A;  3K4L A;  5EEA A;  3DEU A;  4BXF A;  2GXA A;  1XMA A;  3N90 A;  1JTX A;  2ZJQ F;  3HB9 A;  3NRV A;  4KN7 X;  5TJJ A;  3CUQ C;  2L5Q A;  5CKT A;  1DG1 G;  1E3O C;  1WDT A;  2PLF A;  2JA6 J;  2K7L A;  3H5R A;  5K1Y A;  1PJ7 A;  2BM1 A;  3GVL A;  5E79 C;  4HRI A;  4HV5 A;  2JA8 J;  3J80 K;  5ICF A;  2V7X A;  5LHH A;  1QVF B;  2M3A A;  4ZYH A;  1EV7 A;  1GVJ A;  2STT A;  2O61 A;  2XKO A;  4E7J A;  1YX2 A;  3BCA A;  2YUS A;  3CMM A;  2EIL H;  2WC2 A;  2GK6 A;  2MA3 A;  2L7Z A;  2C2W A;  3BCF A;  1XD7 A;  1K8A D;  3CCM I;  1HKQ A;  1QUE A;  3C7J A;  4NK6 A;  3H0D A;  3TW7 A;  2Y9Z A;  3ZN0 A;  1T6S A;  1GV2 A;  3FXU A;  1E0E A;  1QPM A;  2FA5 A;  2RC6 A;  2VYQ A;  3JRB A;  4M4S A;  5TR9 A;  5E17 F;  1D2E A;  3CCS B;  3M8E A;  4EJU A;  1SD7 A;  1VQP I;  4BEH B;  3L2V A;  4Y7C A;  4CSW A;  1R5N A;  3OL4 A;  1VQ4 B;  3HOT A;  2M5W A;  4JX6 A;  4ESB A;  3CB4 A;  1REP C;  1GDT A;  1PYV A;  2XAJ A;  4E7H A;  3A1P A;  1WJB A;  1E1Q A;  4KMF A;  1ZH5 A;  4D7M A;  1B8I A;  2ZKZ A;  2A69 F;  1ZM3 A;  2ELK A;  2W82 A;  2F4M B;  2KJB A;  3AAF A;  2V7Q A;  2ZSI B;  1K4T A;  4IHT A;  3FKJ A;  3ZMD A;  1U3E M;  4LLL A;  2F1M A;  1MW7 A;  4A5M A;  1BR2 A;  1DGW Y;  3MKW B;  3ABT A;  1IXS B;  5K7H A;  3GVA A;  2ZNZ A;  2O8K A;  3WBJ A;  3H09 A;  3OOP A;  3ZR8 X;  2N8G A;  2XGJ A;  1DU0 A;  4LLN A;  3GTL J;  4IVN A;  1VQ7 I;  3CLQ A;  2ZXI A;  1MMA A;  1C0W A;  4GO1 A;  4CA0 A;  5KNL A;  2ESH A;  3GBG A;  4BXU A;  1OJL A;  4KUM A;  3VPR A;  3ZUG A;  2F2E A;  3BPV A;  3DLL F;  3AG2 H;  5HNF A;  3C18 A;  3PUM A;  3B4N A;  2R4G A;  5J1R A;  2JQ7 A;  4HF1 A;  2LK2 A;  2FU4 A;  4RA2 A;  2JZY A;  3S8P A;  4NHJ A;  4A3C J;  1G7C A;  4YAF A;  2L4A A;  2HOT A;  1EFU A;  3ZIA A;  4AF7 A;  4YZA A;  1XTA A;  4A69 C;  1OGJ A;  4DJA A;  1YW9 A;  2KMU A;  5KW9 A;  1D3Y A;  3FXO A;  3DKY A;  5HVQ C;  3TMO A;  3V7R A;  1YO5 C;  1PUF A;  3VSK A;  1YTY A;  3Q3A A;  1YRN B;  4ZYE A;  4B8X A;  3AVW A;  3VMW A;  3BR6 A;  4R1H A;  1EJ9 A;  3AGP A;  1S3J A;  4HSR A;  3CCR B;  1LPQ A;  3WTS C;  4Z2Y A;  4BE1 A;  2VNJ A;  3C1D A;  1TW3 A;  2R7R A;  3M1C A;  1ZLJ A;  1WQ2 A;  1WMR A;  2E1O A;  3G4S I;  5FRN A;  3ISX A;  4GFB A;  3P9C A;  3OYA A;  3E6C C;  2HI3 A;  1LFU P;  1ULY A;  3I4N J;  2EZL A;  1MSF C;  2LY1 A;  4HLY A;  2EPF A;  5F6F A;  4RAF A;  2E1C A;  2Y31 A;  1FYL A;  1SD4 A;  2A3S A;  3E5U A;  1UD4 A;  1S6L A;  1UCR A;  3KP6 A;  1HVX A;  1H89 C;  2JJ1 A;  1YS6 A;  2KQR A;  4DOZ A;  5IOY A;  1T2K A;  2ISY A;  1R4M B;  4IOC F;  1FBQ A;  2AQE A;  2OTJ B;  3ONQ A;  2HQN A;  3BTJ A;  2BF4 A;  4HE6 A;  4P26 A;  2YSR A;  1QFY A;  2E7W A;  3PNY A;  3S16 J;  3P26 A;  2VBT A;  4OOX A;  5FNZ A;  3ZN1 A;  3IWF A;  2IT0 A;  3OY9 A;  1R9T J;  1VHE A;  2VAS A;  5HNH A;  4DBR A;  4RD4 A;  3U6K A;  2G7H A;  2P81 A;  3R60 A;  4QPO A;  2AS5 F;  4HE5 A;  4IW3 B;  3WND A;  1RWR A;  3OYN A;  4WZL A;  1SEU A;  4HEA 2;  4W97 A;  2BM5 A;  1APL C;  5IYR A;  3CCL B;  1LJ9 A;  4JRA C;  1WOR A;  1IXC A;  2FMY A;  1BM9 A;  2M1B A;  2X51 A;  4N9I A;  2EFO A;  5EZH A;  2E2J J;  3N6Z A;  4YRV A;  5HDN A;  2BPO A;  2VC1 A;  4L0Y B;  2A6E F;  1UD6 A;  2DK8 A;  3FMR A;  5H6R A;  4XLN F;  5IT9 Z;  5E3M A;  1A5J A;  2WYR A;  1U9O A;  4ZGN B;  5EG0 B;  2QA4 I;  4L9J A;  3WNC A;  1KYW A;  1O3Q A;  2EIN H;  4N9H A;  2VE9 A;  3K2A A;  5C1C A;  1XMK A;  2BGC A;  2V1N A;  3RDI A;  4Z05 A;  1L3L A;  1QUF A;  3SHF A;  5FRO A;  3PQK A;  3T1B A;  3CME I;  1R4N B;  3DP7 A;  4G6I A;  2CW7 A;  3FK7 A;  2JJ7 A;  3FMS A;  5BS6 A;  2FOW A;  1TL8 A;  5ICC A;  1KU7 A;  1XQB A;  3OKX A;  4WQM A;  3VR6 A;  3PUF A;  3ZMU A;  3ZBT A;  4MYT A;  1K4S A;  4BS9 A;  4A3I J;  2HZT A;  5J47 A;  4G8X A;  1G7T A;  3VB2 A;  5KVR A;  3OV8 A;  5CVJ A;  1MBF A;  5F1R A;  2VBS A;  2LC2 A;  3F72 A;  4E70 A;  1HKT A;  4XSZ F;  4XKC A;  1SD5 A;  1WPK A;  3AVV A;  1IUF A;  2G0E A;  1T39 A;  4PFO A;  5FB2 A;  3TGN A;  1OCT C;  3Q5F A;  4JK1 X;  3QRF F;  5FLX Z;  4Y52 J;  5B66 C;  1O3R A;  2HQA A;  3FXK A;  2XTX A;  2GA1 A;  4BHB A;  1DQU A;  3G1M A;  4FE7 A;  1ZAO A;  4CUG A;  2EQR A;  3OR1 C;  2GM4 A;  4A3F J;  1K78 B;  2F5D A;  3K1P A;  2XTY A;  5TGT A;  1KA8 A;  2X48 A;  1HDD C;  1ZRC A;  4A0Y A;  1O3T A;  3RSN A;  5FKL A;  1P4A A;  1TW2 A;  2G7U A;  1T0F A;  4PGG A;  2KZV A;  4ENJ A;  5D5V B;  3EUH C;  5J8C A;  3GQB A;  4RB1 A;  1K7A A;  5JBQ A;  2ETH A;  3DFG A;  2X3U A;  1XSD A;  3LSG A;  4RB0 A;  5FGM A;  2XV4 S;  1JJ6 C;  4U88 A;  5L46 A;  3T8T A;  1BLI A;  3Q9V A;  4RD2 A;  2B7E A;  1POG A;  2INU A;  2BVL A;  2EA2 A;  1DBG A;  3LYC A;  2MW8 A;  4PC1 A;  3FBI B;  4LGW A;  2OD5 A;  5HLT A;  3HDD A;  1FX0 A;  3CCQ B;  1LNW A;  3LSK A;  2DA6 A;  2OV7 A;  1SVL A;  2M87 A;  5E3O A;  1YLF A;  3HL2 A;  2H94 A;  3A01 B;  4NK8 A;  3S1Q J;  1UG2 A;  4MYU A;  1B2R A;  4L0Z B;  3E5Q A;  3GTO J;  2LVS A;  1A31 A;  3J7Y J;  4EV0 A;  4MHG A;  3HAG A;  4XL9 A;  3BLY A;  1Z9C A;  2YWG A;  3AVU A;  2I5U A;  1I6H J;  3GW2 A;  1KGS A;  2XUB A;  1DUX C;  1UMK A;  1ACI A;  3MZH A;  3ASR A;  3B90 A;  2OU2 A;  1I27 A;  4OMZ A;  4R8H A;  4DYC A;  2HTS A;  1G2H A;  2QQ8 A;  3CC4 I;  1IN6 A;  5ICG A;  3I9V 2;  2YWF A;  2W84 A;  4N4N B;  1V55 H;  1TWA J;  3K70 D;  3I4M J;  3DU1 X;  3IRQ A;  2AO9 A;  3PJR A;  4ENK A;  2XAH A;  1VF7 A;  2H1K A;  1RC9 A;  1N77 A;  5GP9 A;  1OCZ H;  3CUQ A;  5F27 A;  3GTK J;  2EZK A;  3DWL E;  4Y15 A;  3WWG A;  2K9Q A;  2KIF A;  2DTZ A;  4RDK A;  2O7O A;  5BPD A;  5C4J J;  4YIF A;  5GAE J;  3NB2 A;  1JUP A;  2O04 A;  2VKH A;  1MBH A;  2KIS A;  2C4T A;  2V1U A;  1H85 A;  4DIQ A;  1VQ5 I;  3PM1 A;  4FE4 A;  4YCQ A;  2L3D A;  2Z6B D;  2A5W A;  1WFX A;  1R58 A;  3RYR A;  2X1E A;  2OTJ I;  2QCO A;  3EQN A;  2H8W A;  3M7G A;  2XAU A;  4GXO A;  3H94 A;  3CCU I;  3LNQ A;  5IPA A;  3ZQ7 A;  4UVB A;  1WI9 A;  1E63 A;  2E19 A;  4IHY A;  2VFM A;  4WK8 F;  5HLH A;  3E6D A;  2YWE A;  2ZC2 A;  4ZV4 A;  3K4M A;  2Q2E A;  4ZDP A;  1I5Z A;  4FT8 A;  3ZBU A;  2O1D A;  2VKV A;  1Z05 A;  3OYF A;  1AWC A;  4UZE A;  1QA6 A;  2YX4 A;  3WE3 A;  4KN4 X;  1T0F C;  3S1R J;  2NSP A;  5IOZ A;  3Q6Q A;  3OYK A;  2F5V A;  2L0K A;  2L9R A;  1BR4 A;  2KIQ A;  1S7O A;  4Z4W A;  3HOW J;  4PC3 A;  1ZRE A;  4MTD A;  5E20 A;  1OMI A;  1XSX A;  3HIF A;  4NC6 A;  3LJY A;  1YIT B;  5HZA A;  1HSJ A;  1N0U A;  4FN5 A;  3KP7 A;  3MZ8 A;  4CIC A;  2RNJ A;  2D74 A;  1YJN B;  3KP4 A;  3B8H A;  4WF2 A;  3H9J A;  1X3W B;  2IPQ X;  2F5F A;  3SZE A;  2Y48 A;  1XGS A;  3ZGK A;  2IA2 A;  1ETX A;  3IAM 2;  4RLF A;  4AVP A;  4F91 B;  1GR1 A;  1FTZ A;  3BC9 A;  1XPX A;  2QEN A;  1AU7 A;  2UWM A;  3A0H C;  2Y2Z A;  3ERM A;  2DQR A;  4L5J A;  2F1L A;  4FXU A;  3TL4 X;  2L9S A;  2KFD A;  1FJL A;  5JLV C;  1RZ4 A;  4I0A A;  2HPM A;  3VO1 A;  2HFH A;  1B9M A;  4PJL A;  2HLD A;  3W5V A;  3S15 J;  1FPQ A;  2HS5 A;  4LG3 A;  4A3B J;  1Q81 D;  2DJI A;  4I01 A;  1FC3 A;  1TQI A;  5D8L B;  4X05 A;  2LOO A;  2B9S A;  1MNM C;  2R93 J;  2M8G X;  3HKZ A;  1YIT I;  2XAQ A;  4L9T A;  4C3J J;  4XRF A;  4XOR A;  4NC7 A;  3QOD A;  5EMN A;  2K4B A;  4PAA A;  1DPU A;  1MD0 A;  2QM3 A;  1CQX A;  2EV0 A;  5FD6 A;  2NZM A;  2VBY A;  3DKW A;  1IF1 A;  1UAA A;  1KMH A;  1MRZ A;  2DXI A;  3ZQQ A;  3Q0V A;  4PSX A;  1ZKG A;  4V19 K;  2RV8 A;  5FFZ A;  3E0J B;  4IXA A;  1E64 A;  5TY0 A;  5ILV A;  3JX8 A;  1MMG A;  2L7M P;  3CO6 C;  1G4D A;  4WCG A;  4XOT A;  1ZGW A;  1ZTR A;  3H5N A;  3BOQ A;  3BQZ A;  1VQO I;  3H3V K;  2O0Y A;  3MZY A;  4CQJ A;  1I3A A;  2M34 A;  3EYY A;  3TW6 A;  1H0M A;  3WTY C;  3ASS A;  5CJ9 A;  3W5U A;  2H27 A;  1TT0 A;  2BY1 A;  3I59 B;  1W35 A;  2CRV A;  3V76 A;  4EGZ A;  3CCM B;  1WSU A;  3JRC A;  2HNH A;  2BV3 A;  3KE2 A;  3VYS B;  4OZY A;  2K9S A;  2JRT A;  2KL4 A;  2HYF A;  3V7A A;  1IB4 A;  4OIO F;  1VF9 A;  1XMX A;  2CU7 A;  2CW5 A;  4BXX J;  4AC0 A;  4A3M J;  3ZXS A;  2R7F A;  1YS7 A;  2VT2 A;  4LG0 B;  4L9N A;  3SKB A;  1XG2 A;  3CCS I;  4Z4T A;  2VE8 A;  4BJT A;  4LIT A;  2DER A;  2QX3 A;  2R7U A;  5C44 J;  5AN9 A;  3HEF A;  3TKY A;  5BMZ A;  2DOG A;  2LTP A;  1B72 A;  2B63 J;  1ZG3 A;  5DM7 F;  1PP8 F;  4TKO B;  5FL7 A;  1B6A A;  1BJZ A;  3I55 I;  3LSP A;  3QYF A;  5F4M A;  1Q86 D;  4MXN A;  4UB6 C;  1QU3 A;  2HQR A;  1W2B B;  1YOV B;  2Q6O A;  1E3H A;  2QY1 A;  1FLI A;  5L3B A;  5H6Q A;  2CUJ A;  3ASO H;  3Q3S A;  3I56 I;  4KIF A;  3I0T A;  3HRM A;  2WY8 Q;  3OOU A;  1R5O A;  3CCU B;  5LGN A;  1G3T A;  2IS2 A;  1QNT A;  3F6O A;  1QZE A;  2Z2S B;  2JWT A;  2QGU A;  2NS8 A;  5J4Y A;  1FYK A;  1O8I A;  4KKS A;  4AYB A;  4ZYG A;  2F48 A;  1XDU A;  1GUU A;  1U5T A;  3ZMZ A;  1BL0 A;  3M8F A;  2X4H A;  1FP2 A;  2EBI A;  2Y0S N;  4L5I A;  3JSP A;  2NVQ J;  1ZR2 A;  1IA5 A;  1FZP B;  3DBR B;  3MCZ A;  2KDO A;  5D5W B;  3HRS A;  4ZTF A;  3QPS A;  3CZ6 A;  4DNT B;  1GLN A;  3B02 A;  1P6R A;  4A3E J;  4K2E A;  3WHB A;  1P2F A;  1MJ9 A;  3KYL A;  2GZW A;  3ZPP A;  3CC7 I;  1AKH A;  2XHK A;  3K4C A;  2XRN A;  4OAZ A;  1HA3 A;  3KEW A;  3OYL A;  2BM0 A;  1ON2 A;  3H3U A;  2HPI A;  3BC8 A;  4YXW A;  2NTQ A;  4PMH A;  5FA6 A;  2DYR H;  4YAU A;  1TTT A;  3L2Q A;  5DUI A;  3BTC A;  3M07 A;  3HJE A;  2C5B A;  4EM2 A;  2DA5 A;  4OIP F;  4RPB A;  2BE5 F;  4X6A J;  1CNE A;  1TQM A;  4LK0 F;  3JAM K;  1DAR A;  3H9G A;  1GO2 A;  1Z6R A;  2OK8 A;  2XZP A;  3R6J A;  2NNY A;  2IS1 A;  1EFR A;  1YG2 A;  5BOX A;  3KEQ A;  1N08 A;  4HX4 A;  2R0Q C;  4NCN A;  4BE2 A;  1ZQ3 P;  1KYZ A;  3T8R A;  3W2A A;  3DDY A;  4ACB A;  3BCD A;  1W9X A;  3E1Y E;  2PX9 A;  2PJR B;  3OS0 A;  1Z6T A;  4XN3 A;  3J81 k;  4BY7 J;  1TYV A;  1TP4 A;  5TRD A;  2X53 S;  4ZDO A;  4P1W A;  3CJT B;  4XKB A;  1KQS B;  5E18 F;  1RU4 A;  4BY1 J;  2BZT A;  2DYI A;  2MD5 A;  3F0C A;  1UHS A;  2QA4 B;  1V3F A;  1E2X A;  5C3E J;  4QHY A;  1WZ2 A;  1MGT A;  3E7L A;  1N06 A;  1QQI A;  5LGT A;  4A3J J;  1J59 A;  2QBY A;  1FOX A;  1JJ8 C;  4KKU A;  1BR1 A;  1G6N A;  3BG7 A;  4YEL A;  4WWC A;  4MFD A;  1XG1 A;  2PJR A;  4U9U A;  3A8J A;  3RPU D;  1IDY A;  3KP2 A;  3OYH A;  3RZD J;  2NRA C;  1BA5 A;  4HZF A;  3ECO A;  2QQA A;  5JHU A;  2O6W A;  5B1B H;  3OPO A;  3TED A;  1VTN C;  2V7T A;  2WA0 A;  4QLC U;  1E17 A;  2HYJ A;  2NPF A;  1TNS A;  3K4N A;  1ZG1 A;  1HQC A;  2DMT A;  4C3H J;  1YJN I;  2GJK A;  3D0S A;  2M5S A;  4BE0 A;  1J75 A;  3P4G A;  1IN5 A;  4XQF A;  3DF8 A;  2VQG A;  2DK5 A;  3BR2 A;  4EJV A;  3IL2 A;  4X07 A;  3WOD F;  5CDF A;  5D6E A;  3HTS B;  1S8N A;  3KLO A;  1WJE A;  3GXO A;  3WHC A;  3CCE I;  3GTM J;  2K5C A;  5H59 A;  4UNO A;  3WG9 A;  1G3S A;  1SFK A;  3HHG A;  1WHU A;  3BG3 A;  5FKN A;  3I56 B;  3BR3 A;  3VO2 A;  1VLO A;  2XT2 A;  3HRT A;  1VJS A;  4HIZ A;  3WTU C;  3ZZ0 A;  2C77 A;  1IDJ A;  4A3K J;  1RES A;  2P7V B;  2X9D A;  4IHV A;  1BPL A;  2R7Z J;  5D6F A;  1P4W A;  3N97 A;  1IG7 A;  2BVM A;  4UXN A;  2GRE A;  4F55 A;  1O8K A;  3QP6 A;  4YII A;  5EGO B;  3A03 A;  5CVU A;  4HYE A;  4ROX A;  1XGM A;  1YJ9 I;  4ZYD A;  4M2L A;  1O88 A;  1DPR A;  1HLV A;  1HKS A;  2XDV A;  4MIM A;  4JMQ A;  5HKK A;  3I58 A;  2ODL A;  1L1I A;  2GOM A;  5HS9 A;  1ETK A;  2EV6 A;  2GOX B;  3WTZ A;  2QSF X;  2VIX A;  4LK1 F;  1N05 A;  1NH3 A;  1I1S A;  3BR5 A;  3H1C A;  3KIO A;  1S7E A;  3OYG A;  4MEX F;  1KQ8 A;  5FO5 A;  4RCZ A;  3R6K A;  5LBQ A;  3GX4 X;  4XLE A;  3V42 A;  2FRH A;  1I39 A;  4E7L A;  2ZBU A;  3PA2 A;  2YX7 A;  2FSW A;  4XID A;  3NQO A;  1NB9 A;  1OYW A;  2J8K A;  3W2E A;  1NK2 P;  5GTH C;  3RQI A;  4HAM A;  2CQK A;  2DTR A;  3HTU A;  1YX5 A;  4G94 A;  5AON A;  2L9N A;  1UJ8 A;  4ETS A;  4P6Y A;  1DDI A;  3B8Y A;  4GCV A;  3DU6 A;  1BW6 A;  2H1L A;  1ZM9 A;  1IW7 F;  3SLD A;  2JA7 J;  4I84 A;  4B09 A;  2MYS A;  4WXD A;  4XSX F;  2DDB A;  2CGP A;  3QYB A;  1IO2 A;  3PSS A;  2DMU A;  2D1H A;  2IVM A;  1WGX A;  3S3M A;  3A1Y A;  2X6Y A;  4RDU A;  1BMF A;  3NEU A;  1K78 A;  4YC5 A;  4G5G A;  3HOX J;  1DGR M;  4Z1M A;  4BUP A;  3TOA A;  1IB0 A;  5J3O A;  1IN8 A;  2K9N A;  4A3L J;  4PJ0 C;  2XB0 X;  2VQH A;  3TO6 A;  2DA3 A;  4BYY A;  1QRC A;  3TBI A;  1EFT A;  1FIA A;  4PAB A;  2E35 A;  4HNU A;  3QP5 A;  5HOD A;  1FT9 A;  2V4J C;  1NG7 A;  1KK2 A;  3T9G A;  3F21 A;  3WGG A;  3H5A A;  2GA2 A;  2JPC A;  4EM0 B;  4CZC A;  2YPR A;  3D1N I;  4P3I A;  3BJ6 A;  1KQ5 A;  2BX6 A;  3K4J A;  2HZD A;  1G3Y A;  4KNY A;  3OSG A;  3PA1 A;  5FFX A;  4DNC A;  3CPW B;  2NT9 A;  4B4C A;  3Q6R A;  1YHQ B;  3H35 A;  3JRD A;  2DT5 A;  3GEZ A;  4E7S A;  3LQE A;  4QUZ A;  1XCV A;  4HF2 A;  1J5Y A;  1AKH B;  1QCX A;  2LFB A;  2Q0O A;  2E1N A;  2E7X A;  1U0J A;  1AA7 A;  3VYT B;  1N8R D;  1X1D A;  2HOA A;  3VOD A;  2VPL A;  3E6M A;  4MNU A;  3FPK A;  1NBM A;  2IEK A;  3WU0 A;  2FD5 A;  1K61 A;  1KC8 D;  1X4O A;  2MFZ A;  2VKD A;  1T6X A;  1VQK B;  2W4S A;  2BN4 A;  3QU6 A;  5JLW A;  2VLA A;  1JB9 A;  1GXP A;  3WGI A;  1LKX A;  2FF4 A;  3CUO A;  3PNV A;  2RNG A;  3ERE D;  2K3F A;  1NK3 P;  1EP3 B;  5L3E A;  1YLO A;  4PCQ A;  3OJX A;  3RKW A;  4CYC A;  3HBL A;  1XC5 A;  2PQ8 A;  3ZMS A;  5A2Q K;  1KRH A;  5E3L A;  1A36 A;  2HXI A;  2E1M C;  5E1W A;  1IXR C;  1QH0 A;  2O03 A;  4KDP A;  3MD2 A;  3IAS 2;  4ASU A;  2ISZ A;  4GYG A;  2JVH A;  5D4S A;  5CQE A;  2RC5 A;  3G3Z A;  2XAS A;  4X8I A;  3ASN H;  4OJP A;  3K6G A;  5DTD A;  1OYI A;  2W7Z A;  1Y0N A;  1FNC A;  2I10 A;  1ZEL A;  2TCT A;  2W6I A;  1JJ2 B;  2XAG A;  4Z4S A;  1G7R A;  2RRE A;  1R49 A;  4BDY A;  1J9I A;  3AST A;  3FKS A;  1LQ1 A;  2RKH A;  2ZB9 A;  4LB5 A;  1QZZ A;  4XN0 A;  1ZM4 A;  2HGC A;  3E6B A;  3HG9 A;  2VJ5 A;  4BHP A;  4OU0 A;  4JX5 A;  3GIR A;  1KQ9 A;  2X0L A;  3FX3 A;  5GAH J;  2XGD A;  4CZZ A;  5J1Y A;  4M9Z A;  2HMA A;  3SEZ A;  3HOU J;  1O8D A;  4W8R A;  4BBS J;  2QTZ A;  1IGN A;  2OUM A;  5CPR B;  4CCN A;  2Z9O A;  3CC4 B;  4OJO A;  2IGO A;  3DPT A;  3BQJ A;  1I50 J;  2RN7 A;  3OYJ A;  5FRM A;  1MBE A;  4FX0 A;  3O2P E;  1K5C A;  2C78 A;  2VJI A;  4Y9R A;  1SMY F;  1S5L C;  3H92 A;  4KKT A;  4BDZ A;  3AG3 H;  3E1S A;  2W00 A;  5HLI A;  5AIP A;  3VNV A;  1U2W A;  1GQ8 A;  1T8I A;  2V7U A;  1VQ8 I;  3L2U A;  2B7B A;  1Z67 A;  1ZGJ A;  1ZG5 A;  1EXM A;  1X4P A;  2V26 A;  4M0L A;  1FP1 D;  4GDF A;  2VOP A;  1NG6 A;  5EF6 A;  3OIP A;  2LG4 A;  1LFP A;  4AYB N;  4P55 A;  1H8E A;  1Y0Y A;  1S72 B;  1BHE A;  3LSM A;  3ZOB A;  3DPL C;  3VEP A;  4RGX A;  3PO2 J;  5L3D A;  1LM1 A;  5LD2 C;  3S2W A;  4BKX A;  2F6C A;  2V5I A;  1SD6 A;  3OIO A;  3DTI A;  2M8E A;  2UUZ A;  3EPZ A;  2QMU A;  2GQQ A;  2A61 A;  2O9L A;  3S93 A;  3Q0U A;  1U78 A;  3S14 J;  1WOO A;  1W0T A;  2ZZQ A;  1MZB A;  1JE8 A;  3IUO A;  3EDP A;  4C2U A;  2AHO A;  1LDJ A;  2IA0 A;  3CP8 A;  3GZ5 A;  5BQT A;  1JI8 A;  1EKE A;  3LFK A;  4HNT A;  1JNY A;  2WSS A;  4TN1 A;  3T51 B;  1ONV A;  4Y17 A;  5EYR A;  4S0H B;  4UUT A;  1WU8 A;  1HZE A;  1Q1V A;  4AID A;  4XLC A;  2GAU A;  1R1T A;  2O17 A;  1QGZ A;  3BDD A;  1OOC A;  1D1C A;  2QGG A;  3S17 J;  4IRH A;  3JU4 A;  4CO8 A;  1R00 A;  4Z4R A;  3VSV A;  3PUB A;  1N75 A;  2HKO A;  2ZME A;  3L9F A;  3QYE A;  4R79 A;  2GLO A;  2ACJ A;  4PDK A;  1EA0 A;  4BU2 A;  1T33 A;  3RCO A;  1IDZ A;  4ZYA A;  4IZZ A;  4DK1 A;  1OFE A;  1EA3 A;  2LH9 A;  1W7P A;  3ONU A;  3SQN A;  1E3Z A;  4XNF A;  1UD3 A;  2DT7 B;  1DDG A;  2PJP A;  1B59 A;  4WXH A;  4M6V A;  3FXQ A;  3FZV A;  3MFK A;  3PO3 J;  3FY3 A;  2IS6 A;  1A6I A;  4V2G A;  5KHD A;  3WU1 B;  2Y0M A;  2D3L A;  2LY9 A;  3VYR B;  2GQF A;  4A93 J;  2DPD A;  2Y75 A;  1SM4 A;  1V4R A;  3MHP A;  2CK3 A;  3E97 A;  2PMU A;  5DYM A;  2M7A A;  5FO1 A;  2L7F P;  4CCL A;  2NYX A;  4AU7 A;  1ZR4 A;  3RY8 A;  1QX4 A;  4RB2 C;  1TNT A;  4H4K C;  5BSY A;  3IV5 A;  2YUH A;  3RYP A;  2F3L A;  4DGW B;  3HKZ N;  2DIE A;  3S1M J;  4Q5S F;  4G6T B;  1W0U A;  1A8P A;  4A3G J;  1VQP B;  2RQP A;  2XC1 A;  4II2 A;  3GTQ J;  2X85 A;  2B0L A;  5DS9 A;  3ZQC A;  2UVE A;  3G4S B;  3BRO A;  3CD6 I;  3OEH A;  3VSL A;  1GXQ A;  5BNG A;  1TWC J;  2NTB A;  4UB8 C;  3MMP A;  5HS8 A;  2H8R A;  2X1C A;  1Z91 A;  5E8G A;  1U5T C;  5LHI A;  4F92 B;  2VXZ A;  2ZFW A;  4J19 A;  3BNW A;  1QQ1 A;  4E7Z A;  2DFE A;  2L01 A;  2VNH A;  4AIJ A;  2M0C A;  1H88 C;  1IV8 A;  1OCC H;  1OCO H;  1QO0 D;  1IV6 A;  2JK3 A;  4YAO A;  3DQV C;  2PIA A;  2A05 A;  1K4Z A;  1JHF A;  1H42 A;  3GZ6 A;  4IJA A;  4YFK F;  2A68 F;  2PE3 A;  4N3G A;  2OZU A;  4BQN A;  2IOU G;  5M5Y J;  2YR2 A;  4DQK A;  4LB6 B;  2HCJ B;  3S2H J;  4M3F A;  2PEX A;  3BQY A;  2E36 A;  4ZCM A;  3K69 A;  1EH7 A;  1Y56 A;  1G7S A;  1NTC A;  4LMY A;  1P4M A;  1O57 A;  3ZCO A;  5CLS A;  2VJ4 A;  3M4O J;  4IX7 A;  4CDG A;  4EAT A;  3CCR I;  2DJN A;  1FTT A;  1FOW A;  4TMZ A;  2QF7 A;  3KET A;  1IRX A;  3LQ6 A;  4I09 A;  4KT5 C;  4HDV A;  4RS8 A;  2CO5 A;  3TP0 A;  1UD2 A;  2XAF A;  3HUG A;  1ZK8 A;  3QFS A;  2VON A;  1TLL A;  3X2Q H;  4N3N A;  2VFO A;  4CCJ A;  1X1B A;  3LSR A;  3ZZT A;  3P9I A;  3H36 A;  4U49 A;  4PC7 A;  2BXY A;  2ZBV A;  2W1O A;  4XRS G;  1OFM A;  3WTT C;  2IGM A;  3F8C A;  3LAJ A;  2BGJ A;  3CTA A;  3VMF A;  3RI4 A;  4MO7 A;  3EYI A;  4HBL A;  4Q4Z F;  2V31 A;  4X1E A;  2R5Y B;  3WTX C;  3QOE A;  1QZY A;  1A35 A;  2Z3Y A;  1FNM A;  2XRO A;  4OAY A;  4G7W A;  1CNF A;  2FBH A;  4RM0 A;  4UAJ A;  2NVY J;  1E3P A;  3IP4 B;  1J09 A;  2KHM A;  1PJ5 A;  1GJR A;  4FX4 A;  2O5R A;  4CYC B;  2E34 A;  2HTJ A;  2VBW A;  3W2W A;  1H8A C;  4YAL A;  1RET A;  3HOS A;  1Z3Y A;  1F1Z A;  1X2N A;  4M3E A;  2YWH A;  2JSP A;  2E1R A;  2LKS A;  1TUI A;  1IAW A;  3OZV A;  4RAZ A;  3MEX A;  1MBJ A;  1XB2 A;  2NVU B;  4QIW N;  1JTA A;  1QA1 A;  2K85 A;  2PMZ N;  3VST A;  2QLZ A;  3AG4 H;  3FBN B;  3Q0W A;  2QN6 A;  1OHH A;  3D5S C;  1UHW A;  2P6T A;  4FCY A;  2BSA A;  3ASQ A;  3G71 B;  4EVI A;  2QUF A;  5E1X A;  4ZTJ A;  3SLN A;  4JYK A;  1KK3 A;  1MJA A;  2HR3 A;  1KK1 A;  4XLP F;  1DDN A;  2STW A;  4OOS A;  3H3Z A;  3ZMV A;  4Z06 A;  3P27 A;  3LOC A;  5HS7 A;  2DPU A;  2QSH X;  5FJ8 J;  4D1Q A;  4IHW A;  4HNV A;  1Y6I A;  2DO7 A;  3A3B A;  2LR8 A;  2Q6L A;  1XX5 A;  4DNR B;  5JVT A;  3OZW A;  1I7P A;  1KTV A;  1HW1 A;  4G7O F;  1J2X A;  5KAI C;  2BM6 A;  2XEX A;  2HQ5 A;  3CMA B;  1OQY A;  3G2B A;  4GRI A;  2HU9 A;  1FYM A;  1W4M A;  3CCV B;  1Y8Q B;  2J5O A;  3A4C A;  1SFU A;  1XN7 A;  1RIO H;  2BBY A;  2ZL6 A;  5M3M J;  5H5J A;  1DU6 A;  4HG2 A;  2I1L A;  4YZX A;  1YW7 A;  1N25 A;  4W1U A;  4B4D A;  4WZK A;  3W6V A;  4BL0 B;  2GBY A;  2BGI A;  1V54 H;  3QPL A;  3RKQ A;  3J7Z I;  2NVX J;  1B23 P;  2ZSH B;  1RMG A;  3EUA A;  2XF6 A;  4QSH A;  3GCM A;  4C2T A;  4C0S A;  4P6V F;  1SVO A;  3TO9 A;  2NTP A;  2MC4 A;  3U1K A;  3J81 K;  4DBQ A;  4KH3 A;  1ODD A;  2ZJ2 A;  3ABL H;  3F9K A;  3FF5 A;  5DNS A;  5B6I A;  1BI3 A;  1OLT A;  4LBY A;  5IT9 K;  3FM5 A;  2WAD A;  2KKO A;  4B43 A;  1PJ6 A;  1HA8 A;  4PGO A;  3OP1 A;  2X6O A;  5LFA A;  2JN6 A;  4IRG A;  3JW4 A;  4BGD A;  4KT6 A;  2MH9 A;  1KTW A;  2VQL A;  3EQO A;  3ZMT A;  1HC8 A;  2P4W A;  1LUJ B;  2RGV A;  2CSO A;  3T5X A;  4O3M A;  3O3K A;  4G6D A;  2DFH A;  2BW3 B;  1T6Y A;  2DFI A;  2ZIT A;  3CCL I;  3OYI A;  3V7C A;  4B3A A;  3MN2 A;  4EH1 A;  4RPD A;  4IRI A;  5HDK A;  3HC7 A;  2HOS A;  2QTL A;  2V4D A;  3LL7 A;  3K0L A;  1ZYR F;  2R7Q A;  3HZJ A;  1OCP A;  1U9N A;  1FRN A;  3CW2 A;  4L9V A;  4EJT A;  4BAY A;  4WZT A;  2LZJ A;  2GWR A;  3W6J B;  5IYD J;  3WYA A;  3I55 B;  1PXZ A;  1K83 J;  2QQB A;  5F64 A;  3E3V A;  1R1U A;  1QVU A;  1JA1 A;  4CHU A;  3SXY A;  1KCD A;  4OPW A;  5LHG A;  3RIQ A;  2XOK A;  1UMQ A;  4P3Y A;  1IRF A;  2MAB A;  3JCU C;  1K6Y A;  2ECB A;  4ZH4 F;  2M2E A;  3ECH A;  4W8Q A;  1W36 C;  3HSF A;  1Z1D A;  3CCJ B;  4RCY A;  2O0W A;  2LKP A;  1CQT A;  3ONY A;  2ME6 A;  2P3M A;  3SFI A;  4Q7J B;  3PET A;  4M72 A;  2V7V A;  2LDU A;  4DQL A;  4NDL A;  1RKT A;  3BCB A;  3QU3 A;  4HLX A;  1WJC A;  4NBQ A;  2DOE A;  3SDB A;  5HOO A;  4OPS A;  1BW5 A;  4Z4Z A;  3F3X A;  3GSI A;  4HOB A;  4RD0 A;  4ZJZ A;  2FXA A;  2UV1 A;  2Y9Y A;  3EUH A;  3KX2 A;  1YQA A;  1T6Z A;  3PQJ A;  2BY2 A;  2EIJ H;  4EM1 A;  1ON1 A;  1VZ0 A;  4P25 A;  2FNP A;  1RQP A;  1KD1 D;  3PIP F;  1E1R A;  5FKO A;  3EQL F;  5J35 A;  4FAS D;  1LDK B;  1K8F A;  1XGN A;  1FOY A;  2P5V A;  2KIU A;  2P5K A;  3A01 A;  4F7Z A;  2IS4 A;  2UXN A;  2FUG 2;  1UEL B;  3V4G A;  4U7B A;  2LRE A;  4UVA A;  2OPT A;  2XT4 A;  1YW8 A;  2PN6 A;  1JTY A;  5A8A A;  3C2G A;  2MSY A;  3BH6 B;  3A8I A;  1NRK A;  1S7A A;  1DBO A;  3LSJ A;  4KYW A;  5JMC B;  4ESJ A;  1VBL A;  5IP9 J;  4BJ5 C;  5J6X A;  3ELK A;  5HLG A;  1QFJ A;  1TVC A;  1KU9 A;  3PL8 A;  1VQ5 B;  3IKV A;  2M7B A;  2WB1 A;  2CV1 A;  1VQK I;  4IEJ A;  1K6O A;  3OYM A;  1GVH A;  2K02 A;  1X1C A;  1BIA A;  2CQX A;  1WJA A;  2E2H J;  1OB0 A;  1YIJ I;  2MD0 A;  1HW5 A;  2OBT A;  1GVD A;  4I02 A;  1X19 A;  4YZ0 A;  4QFM A;  2XZL A;  5LEK A;  3GFI A;  4LLG F;  3OW2 B;  5IYP A;  2L02 A;  3N05 A;  2M9H A;  2VZL A;  2J8I A;  2NV4 A;  3IH2 A;  3LAP A;  4ZDL A;  3CDI A;  2OYN A;  3F6V A;  2KLO A;  1P4X A;  4M3G A;  3I1F A;  4AIH A;  5CVI A;  3NAW A;  3CJQ B;  3K4B A;  4ABZ A;  3CF2 A;  1MJB A;  2VNK A;  1BI0 A;  1KON A;  1IRG A;  4YIR X;  4M9S A;  2P6S A;  3HOZ J;  2GPJ A;  1TT5 B;  1VFC A;  2DYS H;  2XIG A;  1S9H A;  4CYD A;  3E20 A;  3VNU A;  5EDN A;  1WCM J;  4I7H A;  3BG5 A;  2NVT J;  1XFO A;  2VB6 A;  3CRZ A;  4HX7 A;  2CF4 A;  4TV7 A;  3OOC A;  2R7W A;  4YFN F;  1ZRD A;  4KFC A;  1W5C C;  5DS0 A;  4ZCL A;  2H6C A;  4WWV A;  1F36 A;  4DZP A;  3OYB A;  1WOP A;  3NE5 B;  2XF5 A;  1HST A;  2V1X A;  2ZXJ A;  4AIK A;  4EW9 A;  4W8T A;  5D4R A;  4HA8 A;  3WTV C;  4OJ5 A;  2DMQ A;  3K2Z A;  2NT6 A;  1RI7 A;  2EZH A;  1MMN A;  2XPW A;  1QFZ A;  1F9N A;  4YEI A;  3HOY J;  2QKL B;  1LB2 A;  3PSZ A;  2QYU A;  3BH4 A;  5EJC A;  3CDH A;  3WXM A;  2JUG A;  4CCK A;  3T0Y A;  1V5F A;  3N4M A;  2W6J A;  3GTP J;  4Z4Y A;  5F04 A;  4YEJ A;  4O5V A;  4KIS A;  3BTI A;  3QWL A;  2ZTN A;  3L1P A;  1GAW A;  4OOI A;  3JQR A;  4P9U A;  1G8X A;  3FXM A;  1VQ9 I;  1QG0 A;  1QGA A;  1TYX A;  4DK0 A;  3OYE A;  1WPC A;  5M5X J;  4BNC A;  4JX4 A;  1W1W E;  2V1D A;  2FJ1 A;  1MAB A;  2ZBK A;  2Z99 A;  1Z21 A;  1WWX A;  1P7J A;  2QZ8 A;  2UXX A;  4NB5 A;  2XND A;  4C30 A;  4EMS A;  2R5Z A;  1D8K A;  2ME0 A;  3O8G A;  5GPC A;  2UZK A;  4ITV A;  4OM9 A;  2CRG A;  1RUO A;  5E8I A;  4PUS A;  3VYU B;  2CUF A;  4YG2 F;  3DTK A;  2OJE D;  5EG0 A;  4OIQ F;  1TC3 C;  1ELO A;  1WP6 A;  2AQF A;  2EV5 A;  2GJP A;  4AD9 A;  3WTW C;  1H9T A;  1IJF A;  5TV2 A;  5J4V A;  2A07 F;  1QPI A;  1VI0 A;  2DMP A;  2VL8 A;  2G0Y A;  2VBK A;  1U5T B;  3UNG C;  5A2Q Z;  1PUE E;  2Z33 A;  4IHS A;  1WTH D;  4D7N A;  4QTR A;  2JT1 A;  5FIU A;  3AG1 H;  3AFH A;  4RAG A;  1I6X A;  2HVR A;  4LD5 A;  3VWB A;  2OZ6 A;  2H6B A;  5LMZ A;  2XSD C;  2HDW A;  4A0Z A;  5IYC J;  2GXB A;  3LVB A;  3CLO A;  4AWX B;  2WBM A;  3G1O A;  4TMT A;  4ZCI A;  1ZAR A;  2DET A;  4V2F A;  3R61 A;  4BEH A;  1JGG A;  5L3F A;  2VNI A;  2OQR A;  2ZXW H;  3HM5 A;  2DOA A;  2KP6 A;  3KLN A;  4LFU A;  1RNL A;  1OR7 A;  4XLA A;  3PVD A;  4QVJ A;  1JGS A;  2Z5U A;  1XB4 A;  1G59 A;  4XRS A;  4RMN A;  3G6E I;  1D8J A;  1UZC A;  5FKM A;  3VMV A;  2P5L C;  1ZLK A;  5IYW A;  1FRQ A;  3PSI A;  5J3L A;  4TT3 A;  3HRU A;  3H9Q A;  2F43 A;  2MGQ A;  3ZQI A;  4V02 C;  3JRH A;  5M3F J;  1MSE C;  2AHQ A;  1FNB A;  2WV0 A;  5K5Q A;  1YI2 B;  1FBS A;  1T38 A;  3ZQL A;  1JKO C;  2OBP A;  4PJN A;  2Y30 A;  4F93 B;  2ZZF A;  2DA4 A;  3HPH A;  4B3G A;  2DA7 A;  3QFT A;  4L8J A;  2BHY A;  1WSR A;  3MMY B;  5K7Z A;  1P92 A;  1AHD P;  1TBX A;  2ZZG A;  2QXZ A;  2BXZ A;  3B6A A;  2EK5 A;  4OIR F;  3V8L A;  1QBJ A;  1ZUN B;  4U4B A;  1FSE A;  2Z1D A;  1TTY A;  2BW3 A;  3CMY A;  2ID3 A;  4ANJ A;  2ELJ A;  2F5E A;  3MKY B;  2DA2 A;  4LIV A;  2FOK A;  2HKX A;  1P9Q C;  5DCF A;  1R1V A;  2QBY B;  1LFB A;  5JVG F;  1FOK A;  4PC2 A;  4N0B A;  2XZO A;  4U0V A;  4ACA A;  3HOV J;  2ZL7 A;  1OGM X;  3KP3 A;  4U87 A;  4NQW B;  5GPA A;  4CCO A;  2OBR A;  1AOY A;  3S32 A;  2VBV A;  2JVG A;  4Y7N J;  4X7E A;  2IGK A;  2K9L A;  1YJW I;  2HVS A;  3FXJ A;  1JT6 A;  5ERI A;  3GVK A;  2GIZ A;  3ES9 A;  4P2N A;  1W5S A;  2LMD A;  1RR8 C;  2Q2E B;  5AMV A;  3E5X A;  5HDG A;  3TO7 A;  3ULQ B;  1J9Z A;  3CC7 B;  1QVG B;  1WVR A;  1MH3 A;  1OFL A;  1WI3 A;  3EUK L;  1X58 A;  2EFN A;  5FD5 A;  5DEQ A;  2ZCW A;  2R6H A;  4B48 A;  5DM6 F;  3LMW A;  2JRM A;  1OFC X;  4HQE A;  2ZZE A;  1NB0 A;  2BM4 A;  3F8B A;  1AIR A;  4M6X A;  2DDA A;  1JUS A;  2KJC A;  2V6C A;  3CJN A;  1H9G A;  3KCC A;  1VQL B;  3DKX A;  1B8I B;  1U8B A;  3GYH X;  4M71 A;  3HSR A;  3I5U A;  4M6Y A;  4D0P A;  3U1D A;  1FBU A;  3BZ6 A;  3VOE A;  1YYV A;  4EQQ A;  2VI6 A;  4XK4 A;  4BQA A;  1I3Q J;  3A02 A;  4UZU A;  1MBK A;  5E1Z B;  4Y9U A;  2FX3 A;  3F8F A;  3PNT A;  1VHO A;  2NS7 A;  2QQ9 A;  1YIJ B;  4F3Q A;  5EGO A;  1PDN C;  1LE8 A;  3J7A Y;  2G9W A;  1FWZ A;  4RGS A;  4U0W A;  3CO7 C;  4FHT A;  3QPH A;  2C4U A;  4X06 A;  4X7F A;  3GQ8 A;  1MMD A;  1WKM A;  5DCM B;  3BP8 A;  4ON0 A;  5DV5 A;  3F23 A;  2IAI A;  2TDX A;  2JSC A;  1JKQ C;  2D3N A;  2VN2 A;  2IP2 A;  3M8J A;  1JXS A;  2P8T A;  4XR6 A;  2KIM A;  2P7C B;  4M53 A;  4BJ6 C;  4DQ2 A;  1D8T A;  4RDL A;  3AKZ A;  1MNE A;  4IPA A;  3AL0 C;  2X6X A;  1O8G A;  4G7Z F;  5LRR A;  2OAZ A;  3REO A;  3UKG A;  1T95 A;  2OA4 A;  4HQM A;  4IQ4 A;  2O6G E;  2XPU A;  2IGN A;  2W48 A;  2TRT A;  2CW0 F;  4XIC A;  1YJ9 B;  1VQ7 B;  1ETW A;  3W2G A;  4RAY A;  4KJZ A;  1CLW A;  1HG8 A;  4ASN A;  3AVY A;  3T53 B;  2BSP A;  4G1B A;  3KZZ A;  4CH7 A;  2OCC H;  2LBF B;  1E43 A;  1TLH B;  2VQC A;  2FE3 A;  4OZZ A;  2M0M A;  3IH4 A;  2CG4 A;  3B6C A;  4XLH A;  3LSI A;  4LOC A;  4PJM A;  1HF0 A;  1IJE A;  1BX0 A;  3B78 A;  3ZQG A;  1VQN B;  3BWG A;  3QFR A;  4AUX A;  2R7S A;  2L54 A;  1Z7U A;  1HW2 A;  4I99 C;  1IN4 A;  1QRB A;  2IA1 A;  2WPD A;  2X8K A;  1V5G A;  4JQF A;  5E3N A;  1HOM A;  1NDH A;  1VLY A;  1K73 D;  2IRF G;  1FND A;  2XNJ A;  4MLO A;  2NOG A;  1USS A;  2HEO A;  3RPQ A;  1BC8 C;  3W2V A;  1XE1 A;  2MC3 A;  4P12 A;  3LA2 A;  3BG6 A;  3ML6 A;  3OL3 A;  3BPX A;  3PEN A;  1Z77 A;  5FLX K;  2V9K A;  4M3D A;  3D26 A;  4QWQ A;  3QE2 A;  3FJO A;  2JIZ A;  2YU3 A;  5THX A;  1R5G A;  2D5V A;  3JRG A;  1W7P B;  1UB9 A;  2I8D A;  4B3X A;  3CCQ I;  1R5B A;  1T08 B;  5D5X B;  1LLZ A;  5B5E C;  5F08 A;  5H20 A;  1IN7 A;  3IKT A;  3W2F A;  1PE9 A;  1OFD A;  5C4X J;  1TWF J;  2DFF A;  2WV1 A;  4HW0 A;  4A2U A;  1Y8R B;  2LNB A;  2OK7 A;  1VQ4 I;  3LA3 A;  2LYC A;  1YIO A;  4Y4R A;  3GQA A;  3BJO A;  5DD8 A;  2R9V A;  2RQQ A;  4M9X A;  2LRD A;  1Q9S A;  2W25 A;  3GWZ A;  1SKY B;  1WJ5 A;  3BR1 A;  2PYG A;  2RVC A;  1EE6 A;  5F0C A;  4C9Y A;  3GUD A;  3B82 A;  2M4K A;  3ZC3 A;  3WNB A;  4G9Y A;  5KCM A;  3TDZ C;  2VBX A;  3C3W A;  5IT3 A;  3CQZ J;  3O8H A;  5LEJ A;  2K86 A;  1RR7 A;  2JTV A;  3FHZ A;  1SFO J;  2EIM H;  1XGO A;  1PP7 U;  3K9T A;  4RLQ A;  1HBX G;  1QGY A;  2R7D A;  2WZP P;  3R4K A;  2VOO A;  3A2K A;  1BOB A;  2DY1 A;  3RKY A;  4FK8 A;  3TH0 A;  4E6K G;  3WE2 A;  3FDY A;  2CV2 A;  2WB1 N;  2R5Z B;  1SAU A;  2K40 A;  3KPH A;  3H0G J;  1FNN A;  2HOE A;  4I98 B;  4XBF A;  1ETV A;  1K28 D;  5GV8 A;  1OB2 A;  3IWZ A;  3RQ4 A;  2J7K A;  2QKM B;  2F4I A;  4LJZ F;  4D5C A;  2F5C A;  1R7J A;  2E1M B;  2FML A;  3L7W A;  1F20 A;  2GK7 A;  3OE7 A;  1B72 B;  2F4O B;  4D5F A;  3M9A A;  1WJF A;  3UW0 A;  2PEC A;  1B9N A;  2VPR A;  2K4J A;  3DBL B;  1ETY A;  4RGR A;  4NQW A;  4B1R A;  2VBM A;  3SZT A;  1EWY A;  4UHT A;  2PG4 A;  3DV8 A;  4P9F A;  1TWH J;  5GAG J;  3KZI C;  4PFP A;  4S04 A;  4TMX A;  3CUQ B;  2A6H F;  3EET A;  3GZN B;  1EZG A;  3HYI A;  3S1N J;  1MIJ A;  5F0F A;  1K79 A;  2KRF A;  3GLX A;  2CFO A;  4M3B A;  3FIW A;  1N78 A;  1X1A A;  2EB7 A;  2JMW A;  5BPI A;  1WXR A;  3W2H A;  3WQZ A;  3WBK A;  3OJW A;  5L3G A;  1Y0U A;  1VQ9 B;  6PAX A;  4NBS A;  2JA2 A;  2KVO A;  2KPM A;  3VDX A;  1ZM2 A;  1NHA A;  4FTH A;  2QZA A;  4URR A;  4E7I A;  2ADU A;  2CS3 A;  2WAE A;  3RZO J;  2KRH A;  2L7K A;  1YJW B;  3SY2 A;  3U9G A;  5ED4 A;  4P9S A;  1EF4 A;  2VFQ A;  1J0R A;  1O3S A;  2C5H A;  1X0C A;  3LO8 A;  4KIT B;  3ZP5 A;  5JI6 A;  4U0Y A;  2V9V A;  3KZY A;  1T98 A;  1R5H A;  1WJD A;  1BX1 A;  3O6B B;  1FIP A;  2IJL A;  1MMS A;  2PBI A;  4JOM A;  4RJL A;  3RPU A;  4BPR A;  2HWV A;  3SYJ A;  3B73 A;  2OF7 A;  3I54 A;  4X0C A;  3DPU A;  1RQR A;  1W5T A;  2R5Y A;  2ECC A;  1BN8 A;  1IC8 A;  3G6E B;  2EFQ A;  2EZI A;  2HVQ A;  3D5R C;  3Q39 A;  2BV6 A;  3LA7 A;  3NAU A;  1RPW A;  2CC2 A;  3OAA A;  1U8R A;  1SVM A;  3K1N A;  4PZJ A;  4DYQ A;  1GV5 A;  3HSE A;  3LSH A;  5FKK A;  2ZXH A;  4G7H F;  3HGY A;  4CGZ A;  2XVC A;  3IHU A;  1TSP A;  1RKW A;  1OCR H;  5L3C A;  4OIN F;  1GHC A;  3DEW A;  4G12 A;  2IQ7 A;  2WAQ N;  4Q48 A;  1HXD A;  1E62 A;  3SJM A;  2CUZ A;  2L4M A;  2V6E A;  3CP2 A;  1H80 A;  3FK6 A;  1CF7 B;  5F4J A;  3GFL A;  3ZQH A;  2CJJ A;  2LBF A;  2ZNY A;  1VQO B;  3ESW B;  3LNN A;  3A35 A;  4H0E A;  1EH8 A;  4UY8 I;  4YFO A;  4A5N A;  3NWT A;  1FMV A;  1CZF A;  2BHZ A;  4JP0 A;  2XRL A;  1QHG A;  3JRA A;  5JLX A;  4OP7 A;  1D1B A;  4A3D J;  4YFX F;  4L5E A;  3W3C A;  5DDG A;  5EEG A;  3GTG J;  3ZPL A;  1BJK A;  1LEB A;  2VFP A;  3MKL A;  3CC2 B;  1TYU A;  1HDP A;  1BIB A;  4FQG A;  1GT0 C;  2WR8 A;  4MTE A;  2JA5 J;  5J1U A;  1ENH A;  2ELH A;  3V8K A;  1COW A;  1L0O C;  3I4P A;  1O8E A;  1ETO A;  5DSZ A;  2EJR A;  3AVX A;  1H8H A;  3M1E A;  1MBG A;  1LE8 B;  2XB5 A;  3CXC B;  4KMU X;  3G05 A;  1STZ A;  2VT3 A;  1D1N A;  3SFZ A;  1LDD A;  5F0H A;  5DCM A;  3JTG A;  5FLV A;  4AM3 A;  2CQQ A;  3CPX A;  4AC9 A;  3QSY A;  4D9J A;  1OB5 A;  2QVO A;  2KDZ A;  3LMM A;  2WJY A;  2Y0S A;  2GXG A;  4A6E A;  4X0G A;  1XS9 A;  2B5O A;  3U2Q A;  2CQN A;  3RJP A;  5AIQ A;  4XKW A;  2LY2 A;  3G1L A;  3K4K A;  3BY1 A;  2NS0 A;  4Y3O A;  2PLY A;  3DXJ F;  2Y69 H;  4M73 A;  2QEX B;  3DU5 A;  3BZC A;  4YAW A;  5F4O A;  3JRE A;  3FXL A;  3SEJ A;  4Z4U A;  5IYN A;  4MR0 A;  2ZL5 A;  1G3W A;  3HGG A;  4GGG A;  4UV9 A;  2W24 A;  3S3N A;  1X3Z B;  3MVP A;  3CD6 B;  3OFN A;  1U2R A;  4OPO A;  2CH0 A;  3T56 B;  2XF7 A;  1WH7 A;  3BH7 B;  3IH3 A;  3MAJ A;  4MFE A;  4WX9 A;  1QA2 A;  4LC0 A;  4NUB A;  2DEU A;  2RDP A;  2VOD A;  3L00 A;  4RM3 A;  3DEE A;  3MQ0 A;  2F4N A;  3FHN A;  4UZF A;  2MLK A;  2ZFU A;  1Z3X A;  3OW7 A;  1D0Y A;  4XKV A;  2LKX A;  3GQ7 A;  2B7C A;  2KT0 A;  2JN9 A;  4IL6 C;  3FXR A;  3W5H A;  1IHM A;  4Z4V A;  1D0Z A;  2A5Y B;  3PFI A;  1TQP A;  3V7S A;  1W0K A;  3W2I A;  2VBE A;  1SMT A;  4RD1 A;  2OBS A;  1P7I A;  2Q8K A;  4F7D A;  1YE9 A;  4IQJ A;  1V5E A;  3BY6 A;  2VUM J;  4H9G A;  2V9P A;  3KFW X;  4EJW A;  1Q1H A;  1VQM I;  2QDX A;  4P22 A;  2OCE A;  4Z6Y A;  3G73 A;  3WU2 C;  2AXT C;  3WG7 H;  4W8S A;  3HUG B;  1JT0 A;  1UHM A;  1VQL I;  3ABK H;  3TOB A;  1OKR A;  3L2R A;  2QYO A;  2VBZ A;  4DZJ A;  1LLW A;  2UVF A;  2YU9 J;  1PJR A;  1TWG J;  2H09 A;  3OS2 A;  1RUN A;  3MWM A;  3OMY A;  3W6K B;  4GQN A;  1NJI D;  3K70 C;  2DLL A;  3LWF A;  1FEX A;  5M5W J;  5CQG A;  3SDG A;  2M30 A;  3CCJ I;  1FSH A;  1R36 A;  2DQL A;  4OPV A;  5FO0 A;  2O0V A;  3WGH A;  3CCE B;  1WRJ A;  4KIG A;  1WOS A;  4I2O A;  1QGP A;  2W7N A;  5C1E A;  2CWE A;  3VFZ A;  3OZU A;  1V0F A;  3KEO A;  3OWT A;  1B4A A;  4AVZ A;  4BHC A;  4UUS B;  2O3F A;  3IRR A;  3OS1 A;  4PSW A;  2X0K A;  4XMY A;  2NOJ B;  4TSF A;  2M4G A;  3U2R A;  4A0X A;  3JRF A;  4M74 A;  2IBD A;  3KYD B;  5TIS C;  2FX0 A;  4OWR B;  5ILS A;  4I76 A;  4A12 A;  4XD7 A;  5KAF C;  3DTE A;  4Z03 A;  5GV7 A;  4XON A;  4BQQ A;  2D1V A;  2ID6 A;  4S05 A;  3LST A;  1BC7 C;  4UUS A;  1ERD A;  2XTW A;  4UUV A;  1O8H A;  2CFX A;  2XC7 A;  1S72 I;  3QQA A;  2OTL I;  2LF7 A;  2RC4 A;  4JBA A;  2P0W A;  3UR3 C;  2BOL A;  4YDT A;  1PUF B;  2J5P A;  1OYY A;  1Y39 A;  2WJV A;  1Q82 D;  2EH3 A;  3BT9 A;  1R6R A;  3FMQ A;  4KA4 A;  2CW8 A;  3K10 A;  1TYW A;  4BAC A;  1YI2 I;  3G71 I;  3NWS A;  1D0X A;  1QJV A;  4XOP A;  1SKQ A;  2DN0 A;  2GJR A;  2DBB A;  1YX3 A;  3M3Y J;  1CGP A;  4UVC A;  4IHX A;  2LF8 A;  3CCY A;  3NAR A;  4TMV A;  4BH9 A;  1OGO X;  2BM7 A;  3SUC A;  3RIR A;  1DP7 P;  1GAQ A;  2XGE A;  4ESF A;  5LGU A;  3Q38 A;  2ESN A;  4RLZ A;  4Q47 A;  2X6W A;  4BQO A;  3VSU A;  2EA4 A;  2O8X A;  1VND A;  1IZ1 A;  4E4H A;  5ILU A;  3GVJ A;  3SZP A;  3SYT A;  2BY3 A;  2FBI A;  2DT6 A;  5GTI C;  1JKP C;  2DW4 A;  1T56 A;  2W85 A;  4X7D A;  4C43 A;  5LRS A;  1X3U A;  3JTH A;  1Y0R A;  1OPC A;  4NNJ A;  2PMD A;  5A88 A;  2V79 A;  1IDK A;  3CJR B;  1S4M A;  2D45 A;  1R5I D;  1Z7L A;  5KK1 A;  3CCV I;  3ML3 A;  5CYV A;  4K1X A;  4XLF A;  2VFN A;  3AVT A;  3GFJ A;  5IP6 A;  2DCU A;  3Q9S A;  2E60 A;  4HX8 A;  4KIC A;  3P5J A;  3FWE A;  2QE7 A;  4NC8 A;  4G1V A;  2MG4 A;  4RD6 A;  1KK0 A;  3HXL A;  3OSF A;  3H9N A;  1Q7Y D;  3COA C;  3D5L A;  3HHH A;  4MQV A;  3BR0 A;  5HXB A;  5K5O A;  1ORK A;  2INV A;  3A3G A;  1R23 A;  2CND A;  3SJZ A;  4HST A;  3ZSC A;  5FLM J;  1BI1 A;  2ZME C;  5K5R A;  1F43 A;  2CMP A;  5J40 A;  2CUE A;  1SFX A;  4BBR J;  4CXF A;  2BY0 A;  1JA0 A;  1EFC A;  1DAB A;  2A6T A;  2WY7 Q;  3DBH B;  4HPQ A;  1LEA A;  3CF5 F;  4IO9 F;  1ITY A;  3JAM Z;  3A8K A;  5IP7 J;  1WSV A;  3SJP A;  2BYV E;  3ROU A;  3AL0 B;  4I6Z A;  4LIU A;  4RGU A;  4LBZ A;  1W36 D;  2HDD A;  4J0Q A;  2COB A;  1F4K A;  3ABU A;  2VJJ A;  2B0R A;  5EEH A;  1W87 A;  4IOA F;  2E1B A;  3CMA I;  4MGR A;  3JRI A;  3QFC A;  2W57 A;  5IK2 A;  3JQQ A;  4IKF A;  4L18 B;  5H2F C;  3FPP A;  3R0J A;  2DOD A;  1J7K A;  4HDU A;  4YZQ A;  4I0B A;  3FIS A;  4AF6 A;  3QOP A;  3JSO A;  3JR9 A;  2Q6I A;  1S0U A;  1YHQ I;  1XDS A;  1K9M D;  2DA1 A;  3V8J A;  3FKI J;  2L9V A;  2BEO A;  3BZK A;  2K9M A;  5F1J A;  3L2C A;  1JHH A;  3JQP A;  2K27 A;  2DCE A;  2PMH A;  2QEX I;  3RTR A;  3CME B;  1E79 A;  2YS9 A;  2ZTG A;  1PVE A;  4EEF G;  1E3X A;  2EFP A;  4M1K A;  2ICW G;  1O7F A;  1I1G A;  2FVG A;  1BBY A;  1VQN I;  1I18 A;  3J80 Z;  4LG0 A;  1W0J A;  1XCB A;  2ZME B;  1NHC A;  1B1B A;  2IW5 A;  1HCR A;  3LFU A;  5HZB A;  4Y13 A;  2HXO A;  3PSF A;  1SFE A;  1JRG A;  2R7O A;  2WTE A;  4ZC3 A;  1FX7 A;  1ZGA A;  4Y33 A;  2VBU A;  2D9R A;  1D5Y A;  3PIO F;  1MDM A;  1N0V C;  1UST A;  1W7P D;  5B3S H;  4YHB A;  4MEY F;  4PJJ A;  3F22 A;  1BOA A;  3U21 A;  3S3O A;  1U6G A;  2DOF A;  2R7T A;  2CYY A;  2JUC A;  1KZL A;  1O8L A;  2PYH A;  4HF0 A;  2JJ2 A;  5JFR A;  1OGI A;  5EZG A;  2DI3 A;  4P5O A;  4TMW A;  4OJL A;  1SAN A;  1O8F A;  2LLK A;  1D1A A;  2EIK H;  5LLQ A;  3L09 A;  4FIS A;  3CC2 I;  2EFG A;  2X1D A;  5BSX A;  2PMZ A;  4XRM A;  4HV6 A;  9ANT A;  2Q6K A;  4EGY A;  1O8M A;  3J7A O;  4GYI A;  2GIV A;  2LD5 A;  3GTJ J;  4MQ9 F;  1S29 A;  3P7N A;  1V5V A;  4R71 A;  5GAD J;  2EIX A;  2IXS A;  2C6Y A;  2XGC A;  3KP5 A;  1BI2 A;  1EH6 A;  2WWY A;  2HDC A;  2DMN A;  2KRC A;  2XGX A;  1SAX A;  3ASP A;  3KL9 A;  2M45 A;  4ZZD A;  3MKZ A;  1LVK A;  1YRN A;  2EWN A;  1M1E B;  2COM A;  1F5T A;  1KU2 A;  1X2M A;  4QV2 A;  2CQ7 A;  4P96 A;  2EWE A;  1OIS A;  1AMO A;  4G6Q A;  1N07 A;  1Y1W J;  1UFM A;  2NAZ A;  1OR7 C;  1SC7 A;  2JPB A;  4KIB A;  2PI0 A;  3F8N A;  5CVV A;  4WZE A;  3AK5 A;  1IRZ A;  1QRY A;  3LQR A;  4C2M J;  2WZN A;  5DN6 A;  1JUM A;  2AXL A;  2ZJR F;  4J00 A;  1VQM B;  3GFM A;  5K7F A;  2MH2 A;  4OMY A;  3ZZU A;  3R0A A;  1MKM A;  3TDU C;  2CV0 A;  5A89 A;  3DLA A;  2XNC A;  1VQ8 B;  1UD8 A;  3KEY A;  1QA3 A;  2E5N A;  3HPG A;  2Q1Z B;  3ISP A;  4B47 A;  4RBO A;  5KSW B;  2R7V A;  4EJO A;  1KJZ A;  1IJW C;  2QWW A;  1KU3 A;  3SEQ A;  3SZG A;  3PUN A;  1A6Q A;  4RB3 C;  1O7L A;  1A04 A;  3GF2 A;  4WXC A;  2WAQ A;  1YFH A;  3I71 A;  4RDJ A;  4U7D A;  3BY2 A;  4N4O B;  4F52 A;  1M1K D;  2E71 A;  1M90 D;  2ZO4 A;  3KRG A;  2Z8G A;  4PGH A;  2NNN A;  3K1M A;  1PLU A;  1I8D A;  2V7F A;  2HDN B;  2WAF A;  1O4X A;  4QVA A;  4II3 A;  3GQ9 A;  1LVA A;  3QPT A;  1ZHF A;  1Z0X A;  4XM3 A;  2Z16 A;  2V7W A;  1KZH A;  3CES A;  2FNA A;  2FQ3 A;  4RD3 A;  2L2O A;  2MLG A;  3OYD A;  2R3S A;  3I64 A;  3L2W A;  3SQV A;  2BVN A;  2NXN B;  4DYR A;  2PFB A; 
#chains in the Genus database with same CATH homology
 4E6K G;  3I3L A;  3FDY A;  2CV2 A;  3PFY A;  1QU3 A;  1SAU A;  4E0F A;  1JTA A;  1UG0 A;  4QPQ A;  2QY1 A;  3VST A;  3FBN B;  1OHH A;  2CUJ A;  3D5S C;  1K28 D;  3OOU A;  2WY8 Q;  3ZRG A;  4B44 A;  3RQ4 A;  2QKM B;  2F4I A;  2IS2 A;  3OE7 A;  2E1M B;  4ZTJ A;  2GK7 A;  2Z2S B;  4E7K A;  1FMW A;  1O8I A;  4Z06 A;  4KKS A;  4AYB A;  3UW0 A;  1WJF A;  3OEE A;  2JDI A;  2XSJ C;  2PEC A;  2VXD A;  2VBM A;  4D1Q A;  3A3B A;  4B3F X;  1Y6I A;  4OJ6 A;  4DNR B;  4PFP A;  1T5E A;  4FET A;  1IA5 A;  1QHH D;  1DP3 A;  3G2B A;  2CFO A;  4GRI A;  2KDO A;  2HU9 A;  1N78 A;  1X1A A;  4ZTF A;  3A4C A;  3CZ6 A;  2K3P A;  2X3H A;  4J01 A;  4DNT B;  1GLN A;  3WQZ A;  4HG2 A;  3C2H A;  4YZX A;  4PK4 A;  1MND A;  3KYL A;  3ZPN A;  4BL0 B;  4CCM A;  3OYC A;  2JA2 A;  3OIQ A;  2KPM A;  3VDX A;  2R7X A;  2KVO A;  2NST A;  3K4C A;  3KEW A;  2ZSH B;  4OAZ A;  1RMG A;  4URR A;  4RM2 A;  4E7I A;  3EUA A;  3OYL A;  2CS3 A;  2WAE A;  2HPI A;  2XF6 A;  2KRH A;  3BC8 A;  1TZL A;  2L7K A;  4C2T A;  4YXW A;  2NTQ A;  2NTP A;  2MC4 A;  4HWV A;  4PMH A;  3L2Q A;  1KCC A;  4DBQ A;  1O8J A;  1V0E A;  1PKV A;  3F9K A;  1X0C A;  4KIT B;  1OLT A;  2OC6 A;  3H9G A;  2XZP A;  3JUR A;  2WAD A;  4B43 A;  2IS1 A;  1EFR A;  4G7X A;  1HA8 A;  4C2L A;  5LFA A;  1WJD A;  4BE2 A;  3W2A A;  3DDY A;  3OR2 C;  4JOM A;  1UD5 A;  1W9X A;  3BCD A;  2PJR B;  4BGD A;  4KT6 A;  3OS0 A;  4XN3 A;  2E5Z A;  3DPU A;  1KTW A;  2VQL A;  5JHF A;  2X53 S;  3EQO A;  3K4L A;  4BXF A;  4P1W A;  4ZDO A;  4XKB A;  1RU4 A;  1BN8 A;  3D5R C;  2HVQ A;  3OAA A;  2L5Q A;  5CKT A;  2BW3 B;  3LSH A;  2ZXH A;  4KKU A;  3H5R A;  3OYI A;  3GVL A;  1BR1 A;  4YEL A;  3BG7 A;  4HRI A;  3HC7 A;  2PJR A;  2V4D A;  3LL7 A;  3RPU D;  3OYH A;  2R7Q A;  2IQ7 A;  2M3A A;  4E7J A;  3BCA A;  3OPO A;  3CMM A;  2CUZ A;  2V6E A;  2LZJ A;  3CP2 A;  1H80 A;  1PXZ A;  2GK6 A;  2WA0 A;  3K4N A;  3BCF A;  2LBF A;  2GJK A;  1KCD A;  2M5S A;  4NK6 A;  3H0D A;  4BE0 A;  3LNN A;  4XQF A;  2XOK A;  3A35 A;  1E0E A;  2MAB A;  2VQG A;  3NWT A;  1FMV A;  1CZF A;  1K6Y A;  4W8Q A;  1QHG A;  1W36 C;  5CDF A;  4BEH B;  3L2V A;  2O0W A;  4CSW A;  1WJE A;  2K5C A;  3OL4 A;  1D1B A;  3HOT A;  1SFK A;  3BCB A;  3W3C A;  1WJC A;  1PYV A;  3SDB A;  5HOO A;  4E7H A;  1WJB A;  1E1Q A;  1VJS A;  4HIZ A;  1IDJ A;  1BPL A;  2W82 A;  4ZJZ A;  2UV1 A;  3KX2 A;  2V7Q A;  2ZSI B;  2BVM A;  3FKJ A;  4F55 A;  1COW A;  1O8K A;  1VZ0 A;  1O8E A;  2F1M A;  1MW7 A;  1H8H A;  1BR2 A;  1DGW Y;  3MKW B;  1E1R A;  4FAS D;  1LDK B;  3G05 A;  1O88 A;  2XDV A;  3ZR8 X;  4JMQ A;  2XGJ A;  2IS4 A;  4D9J A;  2WJY A;  3LMM A;  5HKK A;  2Y0S A;  2ZXI A;  2GOM A;  2FUG 2;  1UEL B;  2ODL A;  1MMA A;  2GOX B;  4U7B A;  2LRE A;  2VIX A;  4X0G A;  4CA0 A;  5KNL A;  3GBG A;  3OYG A;  4XKW A;  2LY2 A;  3C2G A;  3K4K A;  1NRK A;  1DBO A;  4Y3O A;  5HNF A;  4XLE A;  3V42 A;  3B4N A;  2R4G A;  3DU5 A;  4MR0 A;  4E7L A;  3S8P A;  1VBL A;  4BJ5 C;  4YZA A;  3ZIA A;  3S3N A;  4DJA A;  2KMU A;  3PL8 A;  2M7B A;  2WB1 A;  3DKY A;  3TMO A;  5HVQ C;  2CV1 A;  3OFN A;  1YX5 A;  3VSK A;  2CH0 A;  2L9N A;  3T56 B;  2XF7 A;  3OYM A;  3ZPP A;  3B8Y A;  1X1C A;  3DU6 A;  4I84 A;  3VMW A;  1WJA A;  4NUB A;  2MYS A;  4HSR A;  1OB0 A;  2MD0 A;  4BE1 A;  1X19 A;  3QYB A;  4RM3 A;  2R7R A;  4YZ0 A;  3DEE A;  2XZL A;  3FHN A;  3M1C A;  3S3M A;  2ZFU A;  1Z3X A;  3A1Y A;  1D0Y A;  2X6Y A;  4XKV A;  3OW7 A;  3GQ7 A;  1BMF A;  1WMR A;  3N05 A;  5FRN A;  3OYA A;  1DGR M;  4Z1M A;  4BUP A;  4ZDL A;  2LY1 A;  1D0Z A;  2KLO A;  1W0K A;  2VQH A;  2VBE A;  3TBI A;  1YE9 A;  1UD4 A;  3CJQ B;  4HNU A;  1HVX A;  3K4B A;  4IQJ A;  2JJ1 A;  2KQR A;  3CF2 A;  2V4J C;  1NG7 A;  1V5E A;  4DOZ A;  3T9G A;  2AQE A;  1KON A;  3H5A A;  3ONQ A;  4CZC A;  4P22 A;  3K4J A;  1S9H A;  2HZD A;  4W8S A;  3HUG B;  2VB6 A;  3PNY A;  2NT9 A;  3OY9 A;  3H35 A;  3OOC A;  2UVF A;  3L2R A;  2R7W A;  4E7S A;  2VAS A;  5HNH A;  1PJR A;  3OS2 A;  4GQN A;  3OMY A;  4DBR A;  3OYB A;  3NE5 B;  2XF5 A;  4EW9 A;  3K70 C;  1QCX A;  4W8T A;  4OJ5 A;  4QPO A;  1U0J A;  1AA7 A;  3VYT B;  5CQG A;  1RWR A;  1X1D A;  2VPL A;  2NT6 A;  3OYN A;  1MMN A;  2O0V A;  4HEA 2;  1NBM A;  2QKL B;  2W7N A;  1X4O A;  2MFZ A;  2VKD A;  3BH4 A;  5C1E A;  2JUG A;  4CCK A;  1V0F A;  2W4S A;  3OWT A;  1V5F A;  2X51 A;  4AVZ A;  2W6J A;  2VLA A;  3GRH A;  4YEJ A;  4YRV A;  1LKX A;  4KIS A;  2ZTN A;  3PNV A;  2RNG A;  3OS1 A;  4PSW A;  1UD6 A;  4XMY A;  2NOJ B;  4TSF A;  1G8X A;  2M4G A;  4DK0 A;  3OYE A;  1WPC A;  4OWR B;  4XD7 A;  2E1M C;  1MAB A;  3DTE A;  4Z03 A;  5C1C A;  4XON A;  1Z21 A;  4BQQ A;  2V1N A;  2XND A;  4Z05 A;  4C30 A;  3MD2 A;  3IAS 2;  5FRO A;  4ASU A;  1ERD A;  1O8H A;  2XC7 A;  2CW7 A;  4G6I A;  2JVH A;  5CQE A;  3VR6 A;  4ITV A;  4OJP A;  3K6G A;  4PUS A;  3VYU B;  2P0W A;  3UR3 C;  3DTK A;  4BS9 A;  1WP6 A;  2AQF A;  2GJP A;  1ZEL A;  2BOL A;  2W6I A;  2WJV A;  2LC2 A;  2RRE A;  1R6R A;  2VL8 A;  2VBK A;  4BDY A;  2CW8 A;  4XKC A;  3FKS A;  3K10 A;  3UNG C;  4BAC A;  4PFO A;  1WTH D;  3NWS A;  1D0X A;  4XN0 A;  1QJV A;  3HG9 A;  2VJ5 A;  4XOP A;  2GJR A;  1YX3 A;  2HQA A;  3AFH A;  2HVR A;  3VWB A;  1DQU A;  3SEZ A;  1O8D A;  1OGO X;  4CUG A;  4W8R A;  3OR1 C;  3SUC A;  2HDW A;  2OUM A;  5CPR B;  4CCN A;  4OJO A;  2IGO A;  2WBM A;  3DPT A;  2X6W A;  5TGT A;  4BQO A;  3OYJ A;  5FRM A;  4E4H A;  3GVJ A;  3VSU A;  4BEH A;  3RSN A;  3SYT A;  2DT6 A;  2DOA A;  2KP6 A;  2VJI A;  4XLA A;  1K5C A;  4KKT A;  4BDZ A;  1G59 A;  2KZV A;  4NNJ A;  3E1S A;  3EUH C;  3GQB A;  2W00 A;  4RMN A;  1IDK A;  3CJR B;  3VMV A;  1Z7L A;  1GQ8 A;  3PSI A;  3LSG A;  4TT3 A;  3L2U A;  3H9Q A;  2F43 A;  1BLI A;  1X4P A;  4XLF A;  2V26 A;  1NG6 A;  2E60 A;  3OIP A;  2LG4 A;  1LFP A;  2QE7 A;  2INU A;  2BVL A;  4NC8 A;  1H8E A;  1DBG A;  3HXL A;  3LSM A;  1BHE A;  3FBI B;  5HLT A;  1FX0 A;  4PJN A;  4F93 B;  3D5L A;  3DPL C;  3LSK A;  2OV7 A;  2ZZF A;  3HL2 A;  3HPH A;  3A3G A;  5LD2 C;  4B3G A;  4L8J A;  2INV A;  2F6C A;  4HST A;  3ZSC A;  4NK8 A;  3MMY B;  3DTI A;  2UUZ A;  3EPZ A;  2CMP A;  2QXZ A;  2ZZG A;  3S93 A;  4U4B A;  3HAG A;  4XL9 A;  3BLY A;  2A6T A;  2Z1D A;  2BW3 A;  2ZZQ A;  2WY7 Q;  4HPQ A;  3IUO A;  4ANJ A;  2ELJ A;  4C2U A;  3MKY B;  3CP8 A;  1JI8 A;  4LIV A;  3B90 A;  1P9Q C;  3AL0 B;  4HNT A;  4LIU A;  1W36 D;  2XZO A;  2WSS A;  3T51 B;  3I9V 2;  4N4N B;  2VJJ A;  1OGM X;  3K70 D;  4U87 A;  4NQW B;  4CCO A;  3PJR A;  1HZE A;  2E1B A;  1VF7 A;  3S32 A;  5IK2 A;  4XLC A;  2JVG A;  2O17 A;  1N77 A;  2IGK A;  2K9L A;  2HVS A;  3DWL E;  4IKF A;  3WWG A;  3FPP A;  1D1C A;  1OOC A;  3GVK A;  3JU4 A;  4YZQ A;  3VSV A;  2Q2E B;  1N75 A;  3PUB A;  5AMV A;  2O04 A;  2VKH A;  3QYE A;  4R79 A;  4BU2 A;  1OFL A;  3EUK L;  3RCO A;  4DK1 A;  4ZYA A;  4DIQ A;  4IZZ A;  2Z6B D;  1EA3 A;  2A5W A;  1WFX A;  2K9M A;  2LH9 A;  4B48 A;  2X1E A;  1E3Z A;  4XNF A;  1UD3 A;  3LMW A;  2DT7 B;  3EQN A;  2XAU A;  2DCE A;  3H94 A;  2ZZE A;  3RTR A;  1E79 A;  2ZTG A;  3FY3 A;  1AIR A;  2IS6 A;  5KHD A;  1E3X A;  2D3L A;  3VYR B;  3DKX A;  1I18 A;  3K4M A;  4ZDP A;  1W0J A;  2O1D A;  1NHC A;  3OYF A;  2CK3 A;  3LFU A;  2M7A A;  3PSF A;  1JRG A;  1T0F C;  2R7O A;  4ZC3 A;  4AU7 A;  4CCL A;  4UZU A;  2NSP A;  4H4K C;  4Y33 A;  3OYK A;  2F5V A;  3PNT A;  4PJJ A;  4DGW B;  3U21 A;  3S3O A;  2DIE A;  4G6T B;  4F3Q A;  2PYH A;  2R7T A;  1BR4 A;  3J7A Y;  1KZL A;  1O8L A;  3GQ8 A;  4II2 A;  2JJ2 A;  1MMD A;  2X85 A;  4P5O A;  2UVE A;  4OJL A;  3OEH A;  3VSL A;  1O8F A;  2D3N A;  1D1A A;  2NTB A;  3M8J A;  2X1D A;  3H9J A;  4XR6 A;  2X1C A;  2PMZ A;  4BJ6 C;  3ZGK A;  4F92 B;  1O8M A;  2VXZ A;  3AKZ A;  1MNE A;  3AL0 C;  1O8G A;  2X6X A;  3IAM 2;  4RLF A;  4E7Z A;  4F91 B;  3BC9 A;  1T95 A;  4IQ4 A;  2IGN A;  2UWM A;  4FXU A;  2IXS A;  4MXN A;  3TL4 X;  2L9S A;  3DQV C;  2KRC A;  4KJZ A;  2HPM A;  3MKZ A;  1HG8 A;  3T53 B;  1LVK A;  4PJL A;  2HLD A;  2BSP A;  4BQN A;  2EWE A;  4CH7 A;  4LG3 A;  2LBF B;  1E43 A;  2DJI A;  2VQC A;  1OR7 C;  4OZZ A;  2M0M A;  2LOO A;  4XLH A;  3LSI A;  4PJM A;  1Y56 A;  3HKZ A;  2R7S A;  4XOR A;  4NC7 A;  3ZCO A;  3QOD A;  2VJ4 A;  5DN6 A;  2WPD A;  2X8K A;  1V5G A;  4JQF A;  4J00 A;  4IX7 A;  1VLY A;  4EAT A;  2NZM A;  4MLO A;  1UAA A;  1KMH A;  2CV0 A;  2DXI A;  3ZQQ A;  4PSX A;  3DLA A;  3W2V A;  1IRX A;  3E0J B;  1MMG A;  1UD8 A;  3KEY A;  2E5N A;  3BG6 A;  3HPG A;  2Q1Z B;  3OL3 A;  4XOT A;  4B47 A;  1UD2 A;  2V9K A;  2R7V A;  3H5N A;  2JIZ A;  4CCJ A;  1X1B A;  3SEQ A;  2I8D A;  3SZG A;  4B3X A;  1TT0 A;  4U49 A;  1OFM A;  2W1O A;  1PE9 A;  2WAQ A;  2HNH A;  2IGM A;  3VYS B;  4N4O B;  4F52 A;  4OZY A;  2KL4 A;  3KRG A;  1IB4 A;  2V31 A;  2LYC A;  4Y4R A;  3GQA A;  3QOE A;  2Z8G A;  3ZXS A;  2R9V A;  1XG2 A;  2RQQ A;  4OAY A;  2LRD A;  1I8D A;  4G7W A;  2V7F A;  1PLU A;  2WAF A;  4BJT A;  1SKY B;  4II3 A;  4LIT A;  1WJ5 A;  2PYG A;  2QX3 A;  3IP4 B;  3GQ9 A;  1J09 A;  2KHM A;  2R7U A;  4C9Y A;  1EE6 A;  2M4K A;  4XM3 A;  2Z16 A;  5KCM A;  2O5R A;  3W2W A;  3CES A;  3HOS A;  4TKO B;  1Z3Y A;  5FL7 A;  2L2O A;  2WZP P;  4RLQ A;  2JSP A;  3OYD A;  3QYF A;  3L2W A;  3A2K A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...