4XORA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xorA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xorA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xorA02
4XKVA 3VSTA 2IQ7A 4W8RA 1EE6A 2ODLA 1IDKA 1GQ8A 5AMVA 3B90A 3EQOA 4XNFA 3KRGA 1O8DA 1O8GA 1PXZA 2EWEA 2X6WA 4XR6A 4XMYA 2QXZA 1K5CA 3ZSCA 2INVA 1DBGA 1OOCA 2INUA 4OJLA 2UVFA 1RU4A 1QCXA 1JTAA 1PE9A 2NT9A 1VBLA 2NTPA 3FY3A 1BHEA 1RWRA 1O88A 3LMWA 3GQ7A 3VMVA 4NK6A 4OJPA 1OGMX 2NSPA 2O17A 4YZXA 1PLUA 2PYHA 2X6XA 4OJOA 2PECA 1RMGA 1KCCA 4YZQA 4XORA 4XM3A 2QX3A 3ZPPA 1O8EA 3GQ8A 4Z03A 1IDJA 3VSUA 4OJ6A 1O8JA 4PMHA 4I84A 4EW9A 1O8KA 2O04A 2UVEA 5C1EA 1BN8A 1O8IA 1O8LA 2VBEA 4YZAA 3UW0A 1KCDA 4YZ0A 4XONA 3B4NA 1IB4A 4MXNA 1JRGA 2PYGA 2X6YA 4YELA 2VJJA 1H80A 3JURA 3EQNA 2O0VA 3WWGA 1CZFA 2X3HA 1IA5A 4OZYA 5C1CA 4XOPA 4U4BA 3VMWA 4C2LA 1O8MA 3SUCA 3GRHA 4URRA 4XLHA 1OFLA 4XLEA 4XL9A 4AVZA 4HWVA 4OJ5A 4XLFA 1DBOA 4W8SA 1AIRA 2O1DA 1O8HA 2BSPA 4W8TA 2NTQA 1XG2A 2O0WA 2X85A 3B8YA 2NT6A 3T9GA 1KTWA 4Z05A 2NZMA 1HG8A 2VJIA 2QY1A 4XOTA 4U49A 4Z06A 1NHCA 4OZZA 3GQ9A 1O8FA 4W8QA 4XN0A 2NSTA 2Z8GA 4XN3A 4XLCA 1QJVA 3VSVA 4XKWA 1X0CA 1OGOX 3GQAA 4XLAA 4MR0A 4NK8A 4YEJA 4XQFA 1OFMA 1WMRA 2NTBA 2VBMA 2VBKA
chains in the Genus database with same CATH superfamily
3OYDA 4HIZA 1FBSA 2QQBA 4BL0B 2DA4A 3PA2A 3G4SI 1U78A 2E7XA 1IDKA 1VQKB 1KQ9A 4M2LA 3CCSI 2RQPA 1VQ8B 1A6IA 3KRGA 3HKZN 2OQRA 5B1BH 5LGNA 1OLTA 4XR6A 2HMAA 2DI3A 3M1CA 3BZCA 3WU2C 1DP7P 5DSZA 2G0YA 1VQ7B 4HF2A 2FBKA 4BJ5C 1GVDA 2DA1A 3JREA 2DXIA 2DQLA 3PSSA 2BM6A 2CUZA 1NG6A 3A01A 1Y0RA 1MSEC 1RPWA 2PJRA 4G7ZF 2WAFA 1VBLA 3G3ZA 3ULQB 3OR1C 1VQ5B 4PJ0C 5IPAA 4A3KJ 3PQJA 1RUOA 1TW3A 3JRGA 3CUQC 4IW3B 2Q0OA 2OTLB 1WJEA 2KFDA 1X1AA 1GAWA 3ZRGA 3E97A 1E3OC 1XTAA 2K4BA 3WTYC 3A02A 3V8JA 1BQEA 1MABA 2DPUA 1M90D 2Z9OA 2I5UA 3GF2A 5LHHA 3FM3A 3CDHA 1W0JA 2K9LA 4PFPA 1NTCA 3W2GA 1JA0A 2KRFA 1O4XA 4OMYA 3MMPA 2FD5A 3OYCA 5C44J 1ZRCA 2WJVA 2V7WA 2Q8KA 4L8JA 5BPDA 1DU6A 3U6BA 1KCDA 1XN7A 1AU7A 2GLOA 4HQMA 1UJ8A 2C5HA 3B4NA 1XC5A 2IGKA 2JUCA 1ETKA 1P4AA 2E1MB 1BIAA 2CO5A 2PX9A 2HOSA 4N9IA 3JURA 3WGHA 1MDMA 3ABKH 3WWGA 1IDZA 1MNDA 1FRQA 4YALA 3I1FA 1U2RA 4CCOA 4M9SA 1SM4A 4IHWA 1WFXA 2QYUA 4XOPA 3ZPNA 5E3NA 1DUXC 1O8MA 4OPOA 3OP1A 4YFXF 2JSCA 4EQQA 3JQRA 4HWVA 2IW5A 1CLWA 3ZZ0A 3BR3A 4CA0A 3CB4A 3CQZJ 3LYCA 5FKNA 1LJ9A 3LQRA 1LKXA 2BV6A 3Q5FA 2XPUA 3W2VA 4J00A 1KU2A 4BQNA 4Z4WA 4TMZA 3CLOA 3BC8A 4QWQA 1IJWC 4HX4A 2FSWA 1QZZA 3V7AA 1IN6A 1FMWA 3D5LA 2ISZA 2E35A 2JPBA 2D1HA 3CJTB 3OS1A 3L2CA 4ROXA 2QGGA 3C3WA 1IB0A 1R5OA 2DK8A 3I4MJ 3BPVA 4WZTA 4RJLA 1ETOA 3I56I 1PKVA 3J81Z 1O8FA 1JUSA 2EIMH 4PUSA 2BN4A 1KC8D 2Q2EA 4HOBA 4UUSB 2JIZA 1R4MB 2CSOA 1D1BA 5BSYA 1ZRFA 2Z8GA 1H9GA 2VNHA 1XGNA 2LP0A 1X0CA 3DWLE 3H35A 5H59A 1MRZA 2NTBA 3OMYA 1AOYA 1MMGA 3K4LA 3SZGA 4PDKA 2DERA 1WHUA 1X1BA 1JXSA 2EK5A 2E71A 4HAMA 5A2QZ 2V7QA 4Y4RA 3V7RA 4AWXB 1PJRA 3AAFA 3ZMVA 2QBYB 3QU6A 5LD2C 3AFHA 1SFXA 3RPUD 5J4VA 3ZR8X 1U9OA 3HHHA 5JI6A 5GPAA 4JMQA 4S0HB 3QU3A 4ANJA 1IJFA 1G8XA 3PUFA 2GQQA 3ZZUA 1B4AA 2W1OA 3OYNA 1H89C 1EA3A 4JX4A 3GXOA 3J80Z 2NS7A 1W0KA 2QY1A 1E3ZA 5M3MJ 2HVQA 1SFUA 4TMWA 2DA5A 4S04A 5A2QK 3QYEA 4FWTA 1RU4A 3CMAI 4RB0A 4ZDLA 3TOBA 2HZTA 3JAMZ 2VC0A 1MH3A 5F0CA 3W2HA 4ACBA 5AIQA 3S1MJ 2L01A 2VPRA 4DQ2A 4P1VA 1LFBA 1FNCA 2P81A 1V5EA 1Y0YA 2WADA 2DFHA 1YX3A 2O17A 4YZXA 1ORKA 2ZFWA 2H94A 4AVPA 1KTVA 2FU4A 2VE8A 3A1YA 3M8JA 3BJOA 3EPZA 1W5CC 2JT1A 2DMUA 2YWEA 3U6KA 1IRZA 1G3WA 5JFRA 1X4OA 2DA3A 1IHMA 1WSRA 2VQLA 2GZWA 3L2VA 1QGZA 4Z03A 2XAQA 1DGRM 2F4MB 2JJ7A 1YIJI 1SMYF 2RGVA 4PMHA 1QHHD 2IGNA 3C2BA 1BC8C 4P3YA 3FXJA 3RTRA 1IRFA 1T08B 3ZIAA 1YJ9I 4XONA 4EGZA 3I59A 2K3FA 2CQKA 2V6EA 3SFIA 4HSRA 1D0YA 1WORA 3HRUA 2F43A 4Q7JB 4G6QA 4J19A 2WTEA 4PJLA 2K9MA 4MYTA 2GA1A 4I2OA 1XD7A 1OCRH 2P8TA 3OZWA 4AM3A 1E63A 1R5BA 1V5FA 2OCCH 1YS6A 4U4BA 2XGEA 4E7ZA 1LFPA 4ITVA 2L7KA 1UD6A 2BM0A 4CCNA 4QIWN 2R7RA 5FKKA 2W00A 4UUTA 4ENMA 1R5GA 1BJKA 1MBKA 4NC6A 3I58A 3WQZA 1D0ZA 5E79C 2VB6A 3WTSC 3OYJA 3SJPA 2F2EA 3MFKA 2ZFUA 4H9GA 2L2OA 4Z4YA 4E7SA 2OBTA 1P7JA 2KLOA 5FD5A 4OIRF 1B23P 4RAYA 5DUIA 3FK7A 5EEHA 3E3VA 4N3GA 1JHFA 1H0MA 1IG7A 1HW2A 2VE9A 2J5OA 3KEQA 1CQXA 2HDWA 3VOEA 2D3LA 2P5VA 3ZGKA 4R79A 1CNFA 1FEXA 1Q82D 3CUOA 4MO7A 5TRDA 4QPQA 1GVHA 4NQWA 5IT9Z 1GUUA 4NC8A 2FMYA 2B9SA 1DG1G 1MJBA 4W8QA 3HRMA 3VO1A 2Y31A 2OC6A 3IWFA 1IJEA 3KX2A 3QP5A 2VJ4A 3HRTA 2ME0A 1P6RA 2Z16A 3E0JB 3A35A 3ZBUA 1MJ9A 3GZNB 3DDYA 2KT0A 3OAAA 4A5MA 3WTTC 2V1XA 3KCCA 1A36A 1QH0A 1OYYA 2KL4A 3CCEB 3TMOA 4CCKA 1H8AC 1HDPA 2VBMA 1UG0A 2KRCA 4GFBA 2O6GE 1T98A 3E5UA 2YS9A 2Y75A 4P26A 5BNGA 3MZ8A 1V5VA 1BM9A 2QVOA 2F5CA 5LHGA 1OMIA 3WTWC 5KHDA 1K7AA 5AMVA 1AKHB 4XKBA 3CCLI 2O61A 3ZCOA 2V5IA 4DYCA 2ELHA 1X4PA 4KN7X 5B6IA 1PXZA 3OOPA 1OCPA 1KK0A 3HHGA 2Q6IA 2BW3A 3GIRA 3S1NJ 2BY1A 4KISA 3KEOA 1U5TB 1WJCA 5AIPA 4FETA 4I0BA 2QWWA 1QA6A 2R7XA 3ZMSA 1FNDA 2QA4B 3OIOA 4OU0A 1ULYA 2L9SA 3H36A 3PNTA 3JSOA 1FNMA 2F3LA 3FY3A 1Y8RB 1QG0A 2Z2SB 4G6TB 2V7VA 4CSWA 1ZM3A 4M1KA 5A8AA 4NK6A 1VQLB 5BMZA 1BI3A 3E1YE 5JHFA 3BQYA 2QCOA 3KYDB 4X0GA 3ZOBA 3MZHA 3SJMA 4MNUA 4DIQA 4DZPA 3CC2B 3N4MA 2Z99A 3HB9A 2CW8A 3LA2A 3SXYA 4BU2A 4E4HA 1YFHA 3B78A 4RD2A 2IAIA 5KAIC 3RDIA 6PAXA 2C4UA 2HQ5A 4IOCF 3HBLA 5L3DA 4HV6A 1WH5A 4IRIA 3RKYA 5K7HA 1MW7A 2YSRA 1I5ZA 3F23A 3GFMA 3BCAA 1KK3A 1S6LA 3M8EA 5GAGJ 2GXBA 4MQVA 3HTUA 5D6FA 1QA2A 3FZVA 1BX0A 4UZFA 5HOOA 3N6ZA 3CESA 1B2RA 1JRGA 3SLNA 2XRLA 2CV1A 1GAQA 1K8FA 2HTSA 2CJJA 2R3SA 3BPXA 5E1ZB 4TMVA 2O0VA 1R23A 2HYFA 5IT9K 2OPTA 2DCUA 1VQLI 2EFGA 3PNVA 4N9HA 4KDPA 2B0LA 4RM3A 4U87A 4BNCA 1WH7A 2DMQA 4M3EA 5HDGA 1VQ9I 3BG9A 1I1GA 3AG1H 5D8LB 1P7IA 2PI0A 2JN9A 2ECCA 5LRRA 1O8HA 4CDGA 2XGJA 2EH3A 1KK2A 2VYQA 2BVNA 1WJDA 2L9RA 3SDBA 3PSZA 2IEKA 4RAGA 2VZLA 1VI0A 1I39A 3TP3A 1H85A 3W2AA 1HVXA 1A6QA 1EKEA 2P6SA 3R6KA 4JK1X 4FX0A 2JPCA 4M3GA 3VB2A 3OIQA 1BA5A 5B66C 1K73D 1XGSA 2E1MC 4PGOA 1H9TA 2K3PA 2YPRA 4G6DA 3CO6C 1E1QA 4FE4A 5DCFA 4EMSA 1G7SA 4M0LA 4FCYA 4PZJA 1JA1A 2Q2EB 2IXSA 4AC0A 3DPTA 4B48A 5D5VB 2L9NA 3C2GA 3OW2B 4M4SA 5ILUA 4M6VA 4H0EA 4A5NA 3J80K 4BXXJ 2QYOA 3CPWB 4GYGA 1D5YA 3GTMJ 2Y0SN 2WY8Q 3T8RA 3JRIA 3P9KA 1FX0A 1QFYA 5DYMA 5L3CA 1ZREA 3OOUA 1LUJB 3CLQA 3S8PA 5D5UB 3WBJA 5FKLA 2BPOA 4NK8A 3OYAA 4C0SA 1Z6TA 3GFLA 1OPCA 3IH2A 2XIGA 2UWMA 3PFIA 2CQNA 4TMXA 3G2BA 2PMDA 2P4WA 2WWYA 2Z33A 3V4GA 1BJZA 3J81k 4Z2YA 3GW2A 4XLNF 5L3EA 4P3IA 4RD4A 1BW6A 1LFUP 3JQQA 3K4CA 3OYHA 3K4BA 4G7HF 2X48A 2W7NA 1BLIA 3LSKA 4UVCA 1FWZA 3OEHA 3CMEI 2VFOA 1UD3A 3G71B 3ONYA 4EJWA 1BR4A 2N8GA 1X1DA 4RAZA 3ROUA 2A5WA 1BR2A 3I4NJ 2HQAA 4EVIA 1WDTA 5E20A 2DAOA 4BJTA 1IO2A 5HXBA 1JTAA 2KP6A 1G4DA 5IYPA 3DU5A 2M0MA 3W6VA 2D45A 3HSEA 1KJZA 1JTYA 1TLLA 1HOMA 1RWRA 5TV2A 3O8HA 4C9YA 4G7WA 1DDIA 4QVJA 2XV4S 2E1NA 4UAJA 5B5EC 1ZK8A 2CMPA 5ED4A 2PECA 1F4KA 1JT0A 3SLDA 2ZZFA 1H88C 5IYRA 2PJPA 2EQRA 3JTHA 4M72A 3P4GA 4RD3A 1SVOA 2VN2A 1EFCA 4XBFA 4U0VA 1IDJA 4OJ6A 4I09A 4ZYAA 4I84A 3K70C 3BWGA 3RZOJ 1UELB 2YWGA 2ZITA 3G4SB 2O04A 5C1EA 2M87A 3JRHA 1SAXA 2XNCA 3S2DJ 2R93J 2EZHA 2R7QA 4Q47A 4Z4UA 3BR1A 1QUEA 5HZBA 1R5NA 2UV1A 2DPDA 4NUBA 2X6YA 1RQRA 1EFUA 3GEZA 5M5XJ 1GT0C 1OJLA 1NK3P 3VPRA 3CUQB 3FXOA 4B1RA 3CCJB 4GO1A 5CYVA 3NAUA 3TDUC 2K86A 4AYBN 1LM1A 1FDRA 2DOEA 2QMUA 4URRA 2DMTA 4XKCA 1ZH5A 3RKQA 5ICEA 1D1CA 1WVRA 3RYRA 1R36A 1E0EA 3ECOA 4QSHA 2WPDA 3V7SA 1RRJA 2DYSH 1VQPI 4NHJA 1APLC 1WKMA 1K6OA 1XG2A 4P1WA 4Z6YA 2DY1A 1R6RA 1XMAA 1YLOA 3H09A 4M71A 1JT6A 3AL0C 4Y52J 2L7MP 1IV6A 1SKYB 1XQBA 4QVAA 4G5GA 5E1XA 4B3XA 3O8GA 2XZPA 3BCFA 4IVNA 2IGMA 4BQOA 4FE7A 1R00A 1N25A 2QKMB 2R5YB 1G7TA 4RM2A 5FKMA 1NHCA 4KKUA 4XIDA 3J7AO 1FT9A 3CP8A 3GLLA 4BH9A 3S16J 2GK7A 4BYYA 2GOXB 2LTPA 3VSLA 3F8MA 3DP7A 4YFKF 5LGTA 4YFOA 3CC2I 3DQVC 4B4DA 2MSYA 5F6FA 4OPVA 1FIPA 4B09A 2ZL6A 1YLFA 2XSJC 2XTYA 4MR0A 1KU7A 4KIFA 4XSXF 5FLXZ 1WMRA 2VKDA 4WXHA 4D5CA 1D3YA 1ZGAA 2IS2A 2R9VA 1YW7A 4WZEA 3F8FA 3OZUA 4MQ9F 1EH6A 1QVUA 2L02A 3PA1A 1FYMA 1O8DA 3QSYA 3BCDA 5D5XB 3SQVA 4JQFA 2X6WA 2ZMEC 2VL8A 3PNYA 1T8IA 1BJAA 3FKSA 4ENJA 2NVYJ 1V5GA 1H42A 3MCAA 2BM4A 4N0BA 1N07A 4AC9A 2GIZA 3ZQ7A 4QV2A 3ASRA 2WAQN 4XLPF 4V2GA 4QPOA 1K6YA 5LBQA 3OYMA 1EF4A 1Z7LA 2QF7A 1IAWA 3K4JA 2DTZA 4KN4X 3B8HA 4RD1A 2K40A 1BHEA 1MMAA 1XCVA 1FNNA 5EG0A 3ZUGA 3IV5A 1MBJA 3FBIB 5HZAA 1B8IB 1OGMX 3KZIC 3ZQFA 3C1DA 4OJOA 2GREA 1MIJA 2O8XA 2VQHA 2K9SA 4L9TA 1U2WA 1N75A 2BVLA 4YC5A 3HAGA 4A3LJ 5DCMB 2KHMA 1LLWA 4ACAA 3VSUA 3L9FA 2EZIA 5KSWB 1VF9A 3SEQA 2LZJA 3WNCA 1O8LA 2KIUA 2DCEA 4LLLA 1UFMA 3KZZA 5TGTA 2LY9A 2HPIA 3K0LA 5J47A 3OIPA 3GMEA 2V9VA 5LHIA 3ASQA 4WXCA 3DTIA 2MW8A 2QE7A 3S93A 1YRNA 2GJRA 4IEJA 2X3HA 3HPGA 5FROA 2VLAA 1S7OA 1U5TA 3CF2A 3CC4B 1MNMC 1FBUA 4NCNA 2ZNZA 5AONA 5D8KB 2XNJA 2STTA 1ZR2A 4XLFA 1WWXA 2R4GA 1D8KA 2MBFA 3MKWB 1WP6A 5J8FA 3H94A 4HW0A 3B8YA 2L7ZA 1XFOA 2OUMA 3C2HA 3DKXA 3A8JA 3FDYA 2WY7Q 1LVKA 2OU2A 1TWFJ 3QPHA 4Z4VA 1UZCA 2MG4A 3TKYA 1EJ9A 2PN6A 3P5JA 1OCTC 1QX4A 2QZ8A 5BQTA 1UCRA 2WAQA 4OINF 2OBPA 4GGGA 5EEGA 3KEYA 2I8DA 1QA1A 4KKTA 5K5RA 4X7EA 3G1OA 2IT0A 2MC4A 3ZQQA 4Z06A 4HDVA 4M6XA 4PC3A 1NB9A 3G73A 2DBBA 1KQ8A 1YIOA 3N97A 1YX5A 1CQTA 1FBQA 3B82A 1P9QC 3M9AA 4GRIA 4QHYA 2V9KA 1N06A 5IYCJ 1VQKI 2Q6OA 4B43A 2E1BA 3T0YA 1W2BB 3CPXA 4L0ZB 3AK5A 2J8KA 4KIBA 3AVXA 4Y9RA 5CVIA 1IGNA 1S5LC 1W5SA 2TRTA 3OJWA 1KA8A 3EQOA 2CYYA 5ERIA 3LSTA 1U0JA 1YTYA 1SVMA 4IRGA 1J7KA 5GTIC 3KLNA 3F21A 3TQNA 1BMFA 3E6DA 2BM7A 3FXLA 2CRVA 5CVJA 1RR8C 2ME6A 2IA2A 1YI2B 4I02A 1WCMJ 4BHCA 4UVBA 2DMPA 5CPRB 2Z1DA 3HXLA 4BBRJ 4HG2A 4PJNA 2EFOA 3GSIA 3VYUB 4IO9F 5F0HA 2NT9A 1YITB 3BR2A 2RDPA 2J7KA 1VQPB 1I18A 4OP7A 1RUNA 2LY1A 3W3CA 3CC7B 1W7PA 4OJPA 1V54H 2HDCA 2H8RA 4CYCB 2EFQA 3KP7A 4PFOA 3CZ6A 3CCQI 3HKZA 2AHQA 5K7FA 1HXDA 3PUNA 4Z4ZA 3LVBA 4CYDA 4Z4SA 2CV2A 3L2RA 1I7PA 4M9XA 3Q3SA 3FPKA 2O9LA 2IRFG 3PSIA 4OIOF 2CQ7A 2ZNYA 4C3IJ 2OQGA 1O8KA 1X3ZB 5DV5A 4U7DA 2CQXA 2EFWA 2NS0A 2B7EA 4XK4A 4QUZA 4DOZA 3MAJA 3WTXC 2HZDA 2K02A 2WB1N 2WC2A 4R1HA 2ELKA 3ELKA 3K4NA 3PUBA 4RDUA 3EQNA 1XDSA 2EZLA 4ZDPA 4Z1MA 4LBZA 1XG1A 5C1CA 4AIHA 4Y17A 2IS1A 1E62A 3SZTA 2QUFA 1UHSA 2JA6J 4IX7A 1IXSB 4XL9A 1TQPA 2E1OA 5FO0A 3H3UA 5CVVA 2W48A 4XSZF 2E5ZA 3BTJA 1WJFA 2O0WA 5CLSA 1G7RA 1COWA 2NT6A 3BTCA 5GV7A 2G7UA 2E2JJ 3W2IA 4LLGF 4M9ZA 5JVTA 5ILSA 1GR1A 2OBRA 3GBGA 1YYVA 1IUFA 3I53A 1VHOA 2D9RA 5HNFA 2MFZA 4IF4A 4EJTA 2DOFA 3AKZA 4BGDA 3CCVI 4KIGA 3M4OJ 2BXZA 4I98B 1ZGWA 1TWAJ 3GTLJ 3HOUJ 1VJSA 3OL4A 2P7VB 4PSXA 4U49A 2ZXJA 1NHAA 1WSUA 1BBYA 2ISYA 2VKHA 1XSDA 2D5VA 3GQ9A 2VOPA 1P2FA 3FIWA 2OTJI 1Q81D 1IRXA 4ZYDA 5BSXA 4IL6C 2A6TA 3IWZA 3BCBA 1DPRA 4LOCA 4BDYA 2B63J 1EV7A 2MLGA 3KE2A 3VSVA 1YJNB 3SZEA 3ASTA 2PMUA 1DARA 2RNGA 3ZQLA 4ESBA 3S14J 4P6YA 4GXOA 1HF2A 2MYSA 1DPUA 2CFXA 4RLQA 2ODLA 1PYVA 3EDPA 5F27A 3B90A 2FOWA 1LE8A 2FEZA 2Q1ZB 3D5RC 4M73A 1B59A 3V7CA 4B44A 4CQJA 4M6YA 1WPCA 5KAFC 1VTNC 5DD4A 4XMYA 1FIAA 2M34A 2KQRA 4HZFA 5D4SA 3W5VA 1TQMA 4EATA 1X3WB 3A1PA 3OJXA 2X51A 3N05A 1SFEA 4CZZA 3LNQA 2LF7A 5BPIA 5F4JA 2OZUA 4IRHA 1PUFB 4FHTA 4X1EA 4RGSA 1G3YA 1O88A 1ZELA 1O3TA 1Q1HA 2ESHA 2EA2A 3FXKA 2LKPA 5IOZA 2DYIA 4JP0A 1G6NA 2AXTC 1YO5C 5JBQA 3WTZA 5DN6A 3BDDA 2PEXA 1IRGA 2UUZA 2BGCA 5M3FJ 1KQ5A 4LLNA 2ZL7A 4JX6A 3WG7H 1PUEE 4I01A 3WU0A 1Z67A 2WB1A 2ZMEB 3ZQCA 2GXAA 4MYUA 2D1VA 4DK1A 4RLFA 1R9TJ 3IAM2 1UB9A 5IYBJ 3GFJA 2ELJA 1BN8A 5CDFA 2VASA 5GPCA 1GV5A 5EZGA 3SEJA 1FRNA 1HDDC 4K1XA 2LC2A 3LOCA 3FK6A 1VQ8I 2BGIA 2V4JC 4IHTA 2L0KA 2K4JA 1O7LA 5E8GA 3V8LA 5HNHA 3JR9A 3JW4A 2E1CA 2LG4A 2PYGA 5FIUA 2ZKZA 3G6EI 1H80A 2WV1A 2FRHA 1MMDA 2LVSA 3QRFF 3SYJA 3T56B 2KDOA 3OE7A 2BY3A 2EIKH 3W2WA 4X8IA 1AKHA 4C2LA 3VMWA 1VNDA 3T5XA 3L2QA 1U8RA 4WXDA 1OFLA 4O6JA 3VNUA 2VBSA 1T95A 2HKXA 1VQ7I 1Q1VA 1AIRA 2L54A 5IYWA 1WJBA 4W8TA 3ZXSA 3R4KA 3LAPA 2B5OA 4G9YA 4ENKA 1XGMA 2KZVA 3HG9A 2NZMA 4OWRB 3SQNA 1DABA 4LIVA 1JKRC 3R60A 1OFEA 1IF1A 3E5XA 1ZM4A 3RQ4A 2ZJRF 2QA4I 4BY7J 4MFEA 4XOTA 1F43A 4LIUA 2CUEA 2W25A 4LMYA 2VNKA 3CCUI 5FLMJ 3DKYA 1R49A 3PENA 3CCMB 4RA2A 2VOOA 4KT6A 5K7ZA 2BY2A 2XOKA 3ZQGA 1D0XA 2XHKA 2MABA 1DQUA 4XN0A 1VQMI 2W6IA 4BEHA 2X53S 1NB0A 1VQ6B 3QYFA 5TJJA 4Y15A 4CCMA 3LA7A 5EYRA 2DTRA 1X1PA 1KZHA 1OGOX 2VI6A 4WZLA 2RKHA 2FBHA 3IKVA 4KT5C 2FJ1A 2C77A 2XF5A 4UXNA 2DW4A 1L3LA 4XKVA 3CCRI 1QRYA 1YS7A 4L5JA 2RC6A 1XPXA 3UR3C 2V1DA 4X7FA 3GCMA 1BOBA 1F36A 3H9JA 3HSFA 4A3JJ 4PABA 5TY0A 1M1KD 2QTLA 1ZYRF 2XTXA 2XGDA 3O6BB 3BROA 4PCQA 4YHBA 5E6TA 2LNBA 3QODA 3BZKA 3RSNA 2D2WA 3SZPA 2Y2ZA 3TOAA 5KCMA 5C4JJ 3LSPA 3CCQB 4C30A 3D1NI 4YAFA 5A89A 3AVYA 3I59B 3I3LA 4BY1J 4N3NA 1ZKGA 2XKPA 2XTWA 1JGSA 1Z3YA 3DTEA 3IH4A 2DIEA 1QCXA 4AIJA 1S3JA 5J1UA 4I6ZA 1X1CA 2F5FA 1R1VA 4ZC3A 3LQQA 4EV0A 3JRAA 2DA2A 3DEWA 3Q6RA 5DS0A 2QZAA 3T8TA 1FOXA 1FYLA 1MKMA 2LD5A 3HEFA 5CQEA 2NSPA 1EP2B 2O7OA 4WK8F 4IQJA 2FX0A 1RNLA 3FHNA 1WU8A 2DFIA 2ZXWH 3PJRA 4KMUX 1BX1A 2WJYA 4KMFA 4H4KC 4HA8A 2A6EF 3I54A 3MCZA 4NC7A 3DBRB 4P9UA 4KITB 2EFNA 3KP2A 3E20A 2GJPA 3K70D 1YJWI 3CCVB 3WE3A 1FZPB 2VXZA 1ZUNB 3HM5A 3QPTA 5IP7J 3OEEA 3LSIA 1G3TA 4D7NA 4AIDA 5KW9A 4P9FA 5LEKA 3VFZA 3BC9A 1J9ZA 1QU3A 3ZQHA 5E1WA 3JRBA 1LNWA 4G8XA 3AGQA 2RN7A 4UB8C 4F7ZA 4EM0B 2H8WA 2HTJA 2QSFX 3CRZA 1GLNA 4A3MJ 1J75A 4RDLA 2ZSHB 5CKTA 1CGPA 2EILH 5JLVC 3P26A 4OZYA 1NH3A 2X3UA 5F04A 4P2NA 2E19A 1Q7YD 5CVUA 3BOQA 4OJ5A 2EINH 3AVUA 3QQAA 5HS9A 2RC4A 3U1KA 1QHGA 3K1NA 3P9CA 1OCCH 5GAHJ 2PLFA 4K2EA 1ZRDA 1JHHA 2DYRH 1X2NA 3LA3A 2A05A 2HPMA 2HNHA 2VFNA 5DNSA 2X0KA 1QBJA 2X6OA 3MKYB 2E2HJ 2M2EA 2EB7A 3LQEA 1BW5A 2H1LA 4RD0A 4YEIA 5EMNA 1SD5A 3M8FA 4U0WA 1YW9A 1FY7A 4L9VA 3H5RA 5J6XA 3FPPA 1TQIA 4A0YA 4LB5A 4NB5A 2BX6A 1S9HA 3PO3J 1S4MA 3WHBA 4F91B 4BE2A 1U9NA 3J7AY 3DPLC 2E7WA 3DU6A 1N8RD 1TT0A 2HCJB 1ENHA 1QVTA 3GLXA 1VHEA 2JJ1A 3ISPA 4PC6A 2Y30A 4QTRA 1TWCJ 4YEJA 2MGQA 1OFMA 2ID6A 3C7JA 3NWTA 3FKIJ 1TLHB 4A2UA 3QPSA 4C2TA 5IP6A 1FOYA 2OA4A 1XS9A 5DTDA 3LSRA 1Z9CA 4X05A 3RKWA 4Y9UA 1SVLA 3GYHX 1SANA 2XUBA 4DGWB 3E1SA 4P5OA 1O8GA 1KGSA 1OR7A 3PSFA 3PIOF 4DNTB 1D8JA 3ASPA 1ETXA 4M3DA 4BJ6C 1XCBA 3ESWB 4KYWA 1DBGA 2PLYA 2I10A 3MN2A 5F0FA 1H8HA 3FBNB 3CCEI 4IZZA 3S2WA 1R4NB 4OMZA 2HYJA 5F1JA 2YWFA 4M3BA 3AVWA 4EM1A 2HR3A 4DBRA 1N0VC 1PE9A 2VBVA 4G7XA 3W5HA 2EV5A 2NNYA 2ZB9A 3B73A 2QQ9A 1H8EA 2XC7A 1NJID 1Y0NA 3ASSA 2FF4A 3WBKA 1JKPC 5J1YA 4G1BA 1DDGA 2J5PA 4WQMA 4LFUA 1N0UA 2AQFA 3Q9VA 3UNGC 5LLQA 4X0CA 1EXMA 3P7NA 4F55A 1O7FA 1USTA 1V3FA 2M8EA 4XORA 1R71A 3H92A 1HZEA 5DCMA 1Z7UA 5THXA 1TWGJ 1V4RA 2IJLA 1ERDA 4UZEA 5IYNA 2LYCA 1RR7A 2CNDA 3GQ8A 3AG4H 1YW8A 4ZTJA 2W85A 4A12A 2GWRA 4C3HJ 5EJCA 1RESA 3L2UA 3GX4X 2PJRB 3VEPA 3CCJI 4FK8A 1HW5A 4B3AA 4HPQA 4LBYA 5DEQA 4YFNF 5EG0B 2P5LC 1T39A 1XB2A 4KH3A 1IB4A 2XAJA 1OGIA 4BQAA 4MXNA 4ZYEA 3OYLA 4A3FJ 3GWZA 2VJJA 4WCGA 1TTYA 1X2MA 4W97A 2XASA 3W5UA 3OOCA 2IA1A 4BAYA 5DM7F 1ZM9A 2F1LA 1IA5A 3NWSA 1OB5A 3SUCA 1XGOA 1F20A 4RDKA 3BQZA 4RPDA 2MD5A 4F92B 3DV8A 1I27A 4HE6A 4OOVA 3I71A 2VBYA 1BL0A 1WI9A 1JB9A 2DU9A 2Y69H 4ZDOA 4LBVA 5HLGA 2VKVA 1J59A 2YX7A 2A07F 1W0TA 2VBXA 3ZPLA 5AN9A 2JA5J 4A3CJ 2CUJA 2M8GX 3CF5F 3HOTA 2TCTA 3Q6QA 3CXCB 2ZCWA 1K4ZA 1YE9A 2BV3A 3L09A 3IAS2 2ACJA 5KNLA 2HS5A 2YU9J 3QFCA 1JJ8C 1O3RA 3JRFA 3OW7A 1YHQB 1J0RA 3IP4B 1OYWA 2XVCA 2JMWA 3ABMH 2QEXI 1N05A 1LEBA 4FXUA 2R7DA 1B9MA 2GXGA 4NNJA 3SYTA 3E6BA 3I55I 5K5QA 9ANTA 3GZ6A 3F0CA 5DS9A 4D9JA 3DEUA 1K78B 1WOSA 2R5YA 4LG0B 4TV7A 4A6DA 1N08A 2GOMA 3TW7A 1NDHA 4XLAA 4RDJA 3EETA 3U1DA 1NG7A 1X19A 5F1RA 1MMSA 1AWCA 1ETYA 3F8NA 2Y0SA 4MEXF 4A3BJ 4MGRA 4XRSA 3RYPA 1VZ0A 2BM5A 2Z6BD 4DYRA 2VC1A 3ASOH 1AIPA 1KRHA 3TP0A 4U7BA 4ENNA 4Y7CA 2COMA 1QZYA 1K5CA 2BZTA 3KLOA 1J9IA 2QEXB 2DFFA 3QPLA 3OSGA 2QDXA 1XSXA 3CJQB 3DEEA 5E3OA 3U9GA 3CC4I 4OOIA 2R7SA 1EZGA 2DA6A 1OCZH 1MDMB 2HVRA 3GTGJ 2MLKA 4A93J 1CF7A 2R7TA 1D2EA 2F5EA 4ZCIA 3HL2A 5TISC 4CHUA 2LDUA 1W0UA 1Q9SA 2VBWA 4D0PA 4P96A 2VNJA 3HGGA 3L7WA 1RQPA 1PLUA 2JA7J 2XNDA 1HQCA 2H09A 5HS8A 4XRMA 1LPQA 3RZDJ 5H5JA 2JDIA 1SEUA 2VFQA 4FASD 3CMEB 4CYCA 2X8KA 4PC1A 2JRMA 1QA3A 3A4CA 5J35A 1WPKA 2JVGA 2H6BA 1YX2A 1VQ4I 4A3IJ 1YIJB 1RETA 2RV8A 2LSOA 1LDJA 1MGTA 3BTLA 2OJED 2V9PA 5C4XJ 3K4KA 2C4TA 2VNIA 4B4CA 2Z5UA 2JWTA 2KIMA 2WZNA 3M1EA 2LBFB 3DLAA 4E0FA 2F5DA 3I5UA 2Q6LA 1W34A 3A01B 1TZLA 3S2HJ 1GDTA 3ZZTA 1FX7A 2M9HA 2AHOA 2M4KA 3RPQA 1QO0D 1MZBA 1Y6IA 3H5AA 3ML6A 2STWA 2NPFA 1QVFB 2W7ZA 4YCQA 4AVZA 3ZMZA 2ZJQF 3VYSB 4W8SA 4BQQA 3KIOA 2O1DA 1ZQ3P 2LK2A 3BG3A 1Q86D 4D5FA 3COAC 3OWTA 1R22A 3CMYA 4ZYGA 3PUMA 1PP8F 1T5EA 4OM9A 1VQOI 2BM1A 1W36D 3CW2A 2WZPP 5D4RA 1G7CA 2E2IJ 1SMTA 5DDGA 4DNCA 2NRAC 3QOEA 3IRQA 2KPMA 3H9GA 4IHSA 3NRVA 3GVJA 3K6GA 2PE3A 4DW6A 4Y3OA 5GTHC 3D5SC 1V0FA 2RVCA 3K1MA 1Z6RA 3K7AJ 3F22A 2L5QA 3DCFA 5GV8A 2DJIA 3DBLB 4R8HA 5CJ9A 5L3GA 3WG9A 3BG7A 4I99C 5M5WJ 1Z21A 3ECHA 1WTHD 4C2MJ 5IY5H 5J3OA 1TTTA 3CC7I 4ZCLA 2HYGD 3TGNA 4C43A 1B1BA 3LAJA 1D5VA 1WOOA 2NSTA 2VIXA 4FX4A 1D8TA 1SD4A 1V0EA 1EP1B 4IHVA 1E64A 4C3JJ 4AYBA 5F4MA 3T53B 2KRHA 4G12A 3CCMI 5H2FC 2HOTA 2OBSA 4B8XA 3GQBA 3P27A 4PGHA 2ZJPF 2ZXHA 4BE0A 2F6CA 2OD5A 5ICCA 3A03A 3CP2A 1W36C 2W6JA 1BI0A 3DKWA 2R7UA 2IQ7A 4W8RA 1ETWA 2YR2A 1QGPA 3J7YJ 3K2AA 1DU0A 2HEOA 4G94A 4LGWA 1YI2I 1BI1A 2FQ4A 2C2WA 3D26A 4BPRA 5FRMA 4B3GA 5L3FA 4PK4A 5FGMA 4HRIA 2XZOA 3DU1X 5BS6A 3S17J 1IN5A 4ABZA 1EH7A 5ICGA 4JYKA 1YITI 3RJPA 4HBLA 1W7PD 1REPC 2DK5A 2GA2A 4E7IA 4RCYA 1VLYA 2CG4A 1SD6A 1QNTA 3BH6B 1Y1WJ 1Y39A 3MD2A 1GHCA 4ZTFA 2P5KA 4TSFA 5LMZA 2LBFA 1IUYA 4LD5A 2OF7A 3OPOA 2NTPA 3ML3A 2QQAA 1IN4A 2DFEA 3MEXA 4P9SA 4Z4RA 2IS6A 4Y13A 2FE3A 3HC7A 1R7JA 2BBYA 3GZ5A 4D7MA 4AF7A 5GAEJ 3Q39A 3JX8A 2GJKA 5FJ8J 3QWLA 1HKQA 4HX7A 1S7EA 2Y48A 4OOXA 4ZZDA 4XRSG 2QX3A 1B8IA 4RD6A 1KONA 2CS3A 3OR2C 4DJAA 3AL0B 3ISXA 2CUFA 4GDFA 2XB5A 3B02A 1ITYA 1D1AA 5A88A 1CNEA 5F4OA 2O6WA 2AS5F 4YG2F 2GQFA 3TL4X 3KEWA 2LFBA 3NAWA 4EW9A 4CICA 1L1IA 4KA4A 3FJOA 2X4HA 5FKOA 1WSVA 5FD6A 2RREA 4ZV4A 2V26A 2ZXIA 3RI4A 2LRDA 3ZMUA 1ZLKA 1WGXA 2A68F 4N4OB 3Q38A 1W1WE 1G3SA 3E6CC 3VO2A 2GBYA 3G1LA 4HLXA 3KZYA 3FX3A 2HQNA 3WHCA 4UUVA 2DLLA 3WE2A 2CF4A 1W87A 2VT2A 1OKRA 1QZEA 3O3KA 2BW3B 3SDGA 4A6EA 4UZUA 2M7BA 3F72A 2L7FP 1K61A 4F52A 2XF7A 3DBHB 2DT6A 3WY9A 1TYXA 3CMMA 4B3FX 2VQCA 1HBXG 1F60A 1FPQA 3B6CA 4RB2C 4UHTA 1LLZA 1KTWA 1KQ0A 1ZAOA 3H9NA 5E3MA 4L0YB 3OS2A 1SKQA 2D3NA 4L9JA 5TR9A 2W57A 5JLWA 4RS8A 2GK6A 3BG6A 3CCYA 2R7VA 3SEZA 2IPQX 3GTQJ 2IGOA 1IXRC 1F9NA 1BN5A 5E8IA 3BTIA 3G05A 2OK7A 1MNEA 1UG2A 2FBIA 3VODA 1FMVA 1ETVA 2LLKA 5FNZA 2IP2A 3CTAA 3MVPA 1TNTA 2XKOA 3GTJJ 4OAYA 2XT2A 4TN1A 3BZ6A 1LEAA 5HLIA 1ZARA 1T2KA 1O3SA 1YG2A 2LKSA 5EZHA 2E5NA 3KP5A 1TYWA 3F8CA 3QFSA 2WA0A 4V2FA 2HDDA 3S15J 1S29A 2NS8A 2VXDA 4A3EJ 1VQ4B 1FNBA 3A0BC 3FXUA 2NAZA 3LSHA 1ZM2A 2CGPA 1RKWA 4HSTA 5GP9A 4ESFA 4L18B 4LC0A 3CMAB 1HLVA 1R5ID 1N78A 4DQKA 5H6RA 1EE6A 2PMZA 2O8KA 2BOLA 3LSGA 1F5TA 5FLVA 1AA7A 4DQLA 1T56A 2DODA 2FOKA 2A61A 1T6ZA 2X0LA 3E6MA 1JGGA 2NV4A 4YXWA 2DN0A 5DUKA 4CCLA 4A69C 3CUQA 2COBA 4KJZA 1QGAA 2IVMA 4DK0A 2G0EA 3MZYA 4Y33A 4WWCA 3DPUA 3S3MA 4JRAC 1JTXA 5CVRA 4MTEA 4ETSA 2QSGX 2CW5A 5L3BA 1OYIA 2PMHA 4UB6C 3JRDA 4OIPF 5E17F 1BPLA 3WYAA 3CCSB 4RGXA 4MIMA 2XGXA 2UVFA 4G7OF 2BF4A 4A0XA 4EEFG 2CQQA 4EGYA 2KISA 2K85A 4ZJZA 4KUMA 2DOAA 1E3HA 4P12A 2BHZA 1U5TC 2ZMEA 4PAAA 3ZBTA 2EV0A 2VT3A 3R0JA 1DDNA 3GO5A 3AG3H 1IN7A 2GM4A 3RIQA 2X6XA 2CRGA 2F4OB 4ZGNB 1K28D 3PFYA 2JUGA 3F6OA 1MBGA 1Z1DA 2E34A 3N90A 2FXAA 2JZYA 4WX9A 1VQ5I 1Y0UA 4HNVA 1T0FA 4ASUA 2A6HF 2HGCA 3GVAA 4BBSJ 1O8JA 4E6KG 1PUFA 4AIKA 1BOAA 4XRFA 3K10A 2YU3A 3GFIA 3GTKJ 3BY2A 3QOPA 2K9NA 4RBOA 3G71I 2H1KA 2PG4A 2PBIA 3VDXA 4HNUA 4E7HA 4UNOA 4YZAA 3UW0A 3WTUC 3W2FA 1KQSB 3TH0A 3KYCB 2DT7B 1HCRA 1VQ6I 3E5QA 1KU9A 1VQOB 2RAEA 4V19K 4OOSA 3LSMA 5JVGF 2ZTGA 2QLZA 2HKOA 4R71A 2XAGA 3B6AA 2I1LA 2G9WA 2H6CA 3U2RA 3T1BA 3FXMA 5J3LA 3ASNH 4M74A 4XLHA 1UD5A 2FVGA 3BH4A 1JJ2B 1DBOA 3MHPA 1VQNI 5JR3A 2XSDC 1JNYA 1WI3A 2V4DA 2MD0A 2QBYA 1TVCA 4X07A 1I50J 1ZGJA 3FISA 2O5RA 2OZ6A 1RIOH 1P4MA 3K4MA 4HDUA 4C2UA 1YOVB 3OYIA 4NBSA 2VODA 5LGUA 1R58A 3HOVJ 3RY8A 3TO9A 2XZLA 1HG8A 3H3ZA 2RQQA 1YQAA 3EUKL 3KP3A 3ERED 5B3SH 2E1RA 3WXMA 3IL2A 1IXCA 4IQ4A 4HE5A 1P4XA 1SC7A 2DMNA 4UUSA 1ZR4A 4WZKA 2B0RA 3O2PE 1RKTA 1AHDP 2Y9YA 2F1MA 2LMDA 1G2HA 4S05A 1TWHJ 1UD2A 3CCRB 2M0CA 4NDLA 3OZVA 2QTZA 3A3BA 2PMZN 4DNRB 5GADJ 1LVAA 1POGA 4YDTA 2C78A 1MH4A 1QPIA 3W2EA 1VQNB 4DZJA 3I55B 2XROA 2W4SA 4XQFA 1MSFC 1W5TA 3I9V2 1QGYA 2IOUG 1K4SA 4GCVA 2X1CA 4OAZA 1STZA 4MEYF 1O57A 1BIBA 3I64A 1XE1A 1Z05A 4U9UA 3CJNA 2MC3A 3HOWJ 1XMXA 3F9KA 1A5JA 2KVOA 4P6VF 5B1AH 1Y1VJ 2JVHA 1R5HA 4XNFA 2ZBVA 1ONVA 2KZGA 4LK1F 4BACA 3OL3A 4X7DA 3VNVA 2CU7A 3KP4A 3T51B 5IYQA 3H0GJ 4IPAA 2QXZA 4X06A 2XAUA 2EA4A 1Y56A 3X2QH 5HVQC 4HF1A 4ZZLA 2CV0A 2XC1A 5EEAA 4II2A 2DDBA 3SFZA 1OGJA 2FX3A 4OJLA 5LRSA 4PC2A 2ECBA 3A8IA 1S8NA 1ZTRA 3NB2A 5E3LA 3TW6A 1FLIA 2QSHX 1BC7C 5EGOB 1QRBA 1F1ZA 3CO7C 2M1BA 4EJUA 3D0SA 2R6HA 2W84A 4CO8A 1FYKA 1OQYA 2VFPA 1KZLA 1A8PA 2M45A 2X1EA 1RMGA 1TW2A 2EV6A 3F3XA 2WAEA 1MBFA 2V7FA 2OTJB 1KU3A 1R1TA 4XM3A 3WTVC 1TL8A 2DQRA 2YUSA 4TT3A 3EQLF 3HRSA 3L00A 2DA7A 4FN5A 2RC5A 3A8KA 1O8EA 1Z0XA 2P0WA 2AXLA 5FRNA 1ELOA 3DXJF 3TO6A 3H9QA 3VSKA 1GXPA 2UVEA 3FMRA 3OYEA 3F6VA 4YZ0A 3HGYA 2ADUA 4HQEA 2QN6A 1E17A 1SAUA 3Q0VA 2XRNA 3GTOJ 2XF6A 1T6YA 1NRKA 3EUHA 2GPJA 1D1NA 1X58A 3SHFA 2CH0A 1SFKA 3HSRA 3UKGA 1WZ2A 3HOZJ 3QFRA 4GQNA 4CZCA 3BQJA 3LJYA 3QP6A 4V02C 3A0HC 5JHUA 4X7CA 3HOXJ 5E18F 4DYQA 2R7WA 3OYBA 2BGJA 3EYIA 3EUAA 1UMQA 3LFUA 1P92A 5ICFA 3OYKA 3FXRA 3A3GA 5FA6A 2XDVA 4FISA 3PETA 1A04A 2MH9A 3KPHA 1C0WA 4F3QA 1LQ1A 1I8DA 1QQIA 3HOSA 1WOPA 2VBUA 2JSPA 1XB4A 3CDIA 2RNJA 3RCOA 4YIFA 2NVTJ 3F8BA 3G6EB 4LG3A 3IH3A 2CFOA 4IXAA 1S72B 3H1CA 3ZP5A 1KK1A 5BOXA 3PIPF 2BXYA 2V79A 3V8KA 5J40A 4PSWA 1HKSA 1IN8A 2IBDA 4NQWB 5EF6A 1HA8A 1MD0A 1I3AA 1RZ4A 1BI2A 1PJ6A 5HLHA 2NNNA 3ES9A 3KFWX 1TYUA 3BP8A 4OZZA 2OK8A 2YX4A 4BE1A 4UY8I 4L5IA 1OCOH 1TC3C 2XT4A 3SY2A 3EYYA 3KYLA 2UZKA 1BR1A 4IKFA 1E1RA 3QE2A 2HQRA 3U21A 1QJVA 2V6CA 2ZZGA 4AUXA 4OIQF 1L0OC 2QQ8A 3L2WA 1HSJA 5H6QA 3JQPA 3FM5A 5IOYA 2NVXJ 4O5VA 2VPLA 2LOOA 2VBKA 2WYRA 4I7HA 4CGZA 2D74A 3OS0A 1HC8A 4O3MA 1K8AD 2ZBKA 1S72I 4BUPA 2ZZQA 1U8BA 3R61A 3CJRB 2F4IA 4U0YA 1R1UA 3ABTA 4YIRX 2R5ZA 3FKJA 2EWEA 2FA5A 4DBQA 4M53A 2FNPA 4TKOB 4KKSA 1VLOA 3VYTB 2AO9A 1JUMA 4CUGA 4MLOA 2NOJB 1E43A 3TDZC 4HX8A 1ZHFA 3CCLB 1A35A 1OOCA 1ZG3A 5DD8A 3MQ0A 2NYXA 3IC7A 2L9VA 3H0DA 3H3VK 1Y8QB 3IKTA 3OV8A 3FF5A 1XSVA 2BYVE 3HIFA 5KK1A 3NEUA 5FFZA 5IP9J 3LNNA 3S3OA 2JK3A 3LMWA 2LY2A 5HODA 4YAWA 2A3SA 2K7LA 3VWBA 3TO7A 2BEOA 1JKQC 3G1MA 1TBXA 1TT5B 1LB2A 3BNWA 1WJAA 4AF6A 1T38A 3QFTA 3TEDA 3PVDA 1KCCA 4JX5A 5K1YA 2QENA 4LK0F 2V1NA 1ON2A 4MHGA 3HDDA 1EP3B 1EA0A 5K5OA 2M5WA 3LSJA 2ICWG 4JBAA 2JJ2A 1QRCA 2HI3A 3JSPA 5L46A 4NBQA 2FUG2 5J1RA 5JMCB 2WBMA 1O8IA 2OYNA 3PO2J 2UXNA 3FHZA 1EFRA 1UHMA 1PP7U 2DOGA 4Q5SF 5FO1A 3BG5A 3GUDA 4L9NA 2O0YA 4BXUA 5EGOA 2ZZEA 4A3GJ 4RLZA 3NARA 3H5NA 4YELA 1EH8A 4G6IA 4P22A 2R0QC 1E3XA 1UD8A 2F4NA 2JTVA 3ZMTA 1JI8A 1K9MD 2J8IA 4CH7A 3JU4A 1CZFA 2P7CB 5LFAA 3S3NA 4B47A 1FP2A 2XB0X 2PQ8A 2VONA 4FT8A 3WGGA 1WRJA 3ZMDA 4Q4ZF 2F48A 2XPVA 3BR5A 1MMNA 2VQGA 3HUGA 4YIIA 1X3UA 3ZN0A 3M7GA 2XAFA 2VFMA 4N4NB 2JN6A 4IJAA 1LE8B 4RMNA 4XD7A 4E7LA 2X85A 3J81K 1J5YA 3HYIA 4II3A 4PGGA 2CW7A 2M5SA 4HF0A 2B7CA 3T9GA 3BY6A 4J0QA 4Z05A 1YHQI 1FTZA 2CW0F 3I56B 3VYRB 3OY9A 2XGCA 1I6HJ 3NE5B 4HYEA 3BJ6A 2P6TA 4F93B 2WR8A 3I4PA 1XMKA 1OFDA 5JLXA 3BLYA 3V76A 1FOKA 2DETA 4LG0A 1JE8A 3ERMA 3P9IA 4BHPA 2EFPA 2HXOA 2EIXA 4EJVA 1S0UA 2HDNB 1DGWY 3LQ6A 4WF2A 2PIAA 4ASNA 1Z3XA 3BR6A 5HS7A 4XLCA 1HKTA 4XKWA 1SD7A 2EWNA 2KIQA 2Q6KA 3PQKA 5KVRA 3GQAA 1QUFA 3I0TA 2K9QA 1OFCX 3WGIA 3WNDA 4UV8A 4UVAA 3HUGB 1E3PA 1QFZA 1FJLA 4BS9A 3TBIA 2MH2A 3MKZA 4W1UA 2VJ5A 4AU7A 5HDKA 1KYZA 3GTPJ 1GQ8A 2G7HA 3MWMA 1JKOC 1W35A 3V42A 1YJ9B 3M3YJ 1J2XA 2EIJH 5FB2A 2YWHA 3BY1A 3OKXA 2V7UA 3EUHC 4IHYA 2BSAA 3IRRA 2V7XA 5D6EA 3PL8A 4RAFA 4WWVA 3BJAA 3LL7A 1HF0A 3FMSA 4LBWA 2PFBA 1XDUA 1GV2A 1PVEA 1WJ5A 3QAHA 2X1DA 2HWVA 4P55A 1GO2A 4KNYA 1TSPA 3IUOA 3W6JB 3W6KB 2R7OA 3M07A 2V7TA 5LEJA 1LDDA 3S1RJ 2BMWA 4UV9A 4YAOA 3GQ7A 3S32A 5IT3A 1GXQA 1FTTA 1ACIA 1K4TA 4ON0A 3LO8A 5HKKA 4I0AA 2E60A 3PM1A 1HW1A 4YRVA 5DM6F 3R6SA 3ONQA 5EDNA 1QFJA 1K83J 3RPUA 2ZJ2A 1JUPA 3L1PA 1FP1D 2C6YA 3OYFA 3JCUC 3ZPPA 1OISA 4AD9A 4FQGA 2L3DA 1I1SA 2M3AA 2HLDA 2TDXA 1GJRA 3AGPA 1TNSA 2KDZA 2ZSIB 3HZJA 2JRTA 2YUHA 1EFTA 1XX5A 2EJRA 1W7PB 1LDKB 4E70A 2HU9A 1NBMA 4Y7NJ 1IW7F 2OTLI 5HLTA 1ETQA 1KYWA 3C18A 2VUMJ 3FMQA 3CDLA 4M3FA 4ZGQB 2M7AA 1SFOJ 1T0FC 1ZG5A 3CCUB 2DEUA 3DTKA 2HFHA 4HEA2 3KP6A 4OPWA 3U2QA 4EM2A 4P25A 2CWEA 3SKBA 4XICA 1EWYA 4D1QA 1KMHA 1QVGB 1TP4A 1FOWA 4ESJA 2OAZA 3ZN1A 2FNAA 3DLLF 5J8CA 3CD6B 4MFDA 3CD6I 2O03A 1K79A 1U3EM 2HVSA 1PJ5A 3DF8A 2DO7A 2CC2A 2BSPA 5C3EJ 1ZLJA 1T6XA 2FQ3A 2H27A 2EZKA 2QKLB 4EJOA 4RB3C 1HSTA 2BE5F 2KIFA 1IV8A 3MKLA 2O3FA 4BKXA 2K5CA 2WSSA 2VJIA 2EPFA 2VBTA 1GVJA 2OCEA 2UXXA 2ZBUA 4RGUA 4RPBA 3FXQA 3E7LA 2ZC2A 3BR0A 1Z91A 2M4GA 3REOA 1I6XA 4E7JA 1E79A 2HXIA 2F5VA 1AMOA 1VQMB 1V55H 2DDAA 2A5YB 2W82A 1ZG1A 2R7FA 3GVLA 1T6SA 2ZL5A 4HLYA 4MTDA 1FSHA 4XN3A 3OYGA 4BDZA 3QYBA 1UMKA 5FLXK 3WODF 2XPWA 3K9TA 2R7ZJ 2EBIA 3J7ZI 3K2ZA 4X6AJ 2LREA 2Z3YA 3SJZA 4E7KA 1QQ1A 3VSTA 4BXFA 1FC3A 2ETHA 4QLCU 1IC8A 4G1VA 1DP3A 2JA8J 4RGRA 3JTGA 3HOYJ 3LMMA 2DJNA 4Z4TA 5H20A 3RQIA 4RCZA 3ZC3A 4CXFA 2VBZA 1YJWB 3RIRA 1G59A 2XEXA 1B72A 1O3QA 1JJ6C 2LR8A 1IDYA 1OHHA 3LFKA 1VF7A 4RB1A 2KKOA 1KD1D 3AVTA 4YAUA 2INVA 3ZSCA 4JOMA 1NK2P 2KMUA 3Q3AA 2INUA 2VKEA 2Y9ZA 2V1UA 1W9XA 4ZCMA 3BH7B 2X9DA 1YRNB 2IS4A 1ZN2A 3Q9SA 1ON1A 4PC7A 2JQ7A 2ZO4A 2W24A 3HTSB 1RI7A 2M30A 4U88A 2LKXA 1OB0A 5CQGA 3VMVA 3MMYB 4IOAF 1HA3A 4TMTA 3ONUA 2E36A 2Y0MA 5ILVA 3K1PA 2PYHA 2AQEA 2K27A 1MBHA 3Q0UA 5D5WB 4YZQA 3Q0WA 1MJAA 2BY0A 2WV0A 3OSFA 4RM0A 2HOAA 3R6JA 1QPMA 1FSEA 1N77A 2P3MA 3HPHA 3A2KA 3LWFA 4PJJA 2NVUB 3AVVA 2LF8A 1UAAA 4CCJA 3S1QJ 5IK2A 1CF7B 5FO5A 2ESNA 3GVKA 2R92J 1OR7C 2QGUA 2NXNB 2VBEA 3RKXA 3DFGA 2XAHA 4EH1A 3KL9A 3JAMK 5IYDJ 4OPSA 1VQ9B 2LH9A 1YJNI 1USSA 2HOEA 2BVMA 2MA3A 1I3QJ 2OV7A 1B72B 4A0ZA 1T33A 1PDNC 5F64A 4HNTA 3KETA 3VR6A 2BHYA 4J01A 1WXRA 3OFNA 2V31A 3GRHA 3ABUA 4LJZF 1UD4A 4XLEA 4ZYHA 3HJEA 4KICA 1ODDA 3R0AA 5J4YA 2CBXA 4LITA 1UHWA 1OB2A 2R5ZB 3BT9A 2NTQA 2L4AA 2NOGA 5FFXA 4FTHA 4Q48A 1PJ7A 1W4MA 3WNBA 1TYVA 1IZ1A 1K78A 1U6GA 1Z77A 4L5EA 4HV5A 4PJMA 2GIVA 3ZQIA 2QM3A 3AG2H 4QFMA 5F08A 2DT5A 1VFCA 5HDNA 4I76A 4KFCA 1S7AA 1MBEA 2KJCA 2ID3A 3ABLH 2NVQJ 3WU1B 2FMLA 4BEHB 4LB6B 2GAUA 2A69F 1RC9A 1TUIA 3VMFA 4IHXA 2ZTNA 4A3DJ 1P4WA 3JRCA 3K69A 2L4MA 2KJBA 5M5YJ 3FWEA 3NQOA 1B9NA 4GYIA 3IHUA 2B7BA 2IA0A 1A31A 2CK3A 4F7DA 4ZH4F 1M1EB 5FL7A 1B6AA 4BHBA 2JA2A 1E2XA 1WQ2A 1J09A 2C5BA
chains in the Genus database with same CATH topology
3OYDA 2IS2A 2R9VA 4HIZA 4BL0B 1IDKA 3F9KA 2KVOA 2JVHA 4XNFA 4DGWB 3E1SA 4P5OA 3KRGA 4BACA 1O8DA 3OL3A 1O8GA 3PSFA 3BCDA 4JQFA 3T51B 4DNTB 2X6WA 3PNYA 1OLTA 2VL8A 4XR6A 3FKSA 2QXZA 2XAUA 3M1CA 4BJ6C 1Y56A 1V5GA 5HVQC 1DBGA 2CV0A 4BJ5C 2DXIA 1H8HA 4II2A 3FBNB 4IZZA 2CUZA 4OJLA 1NG6A 4QPOA 1K6YA 4DBRA 3OYMA 2PJRA 1PE9A 4G7XA 1Z7LA 2WAFA 3K4JA 1VBLA 1H8EA 2XC7A 1BHEA 1MMAA 3OR1C 3FBIB 1WJEA 1OGMX 1KZLA 1X1AA 3ZRGA 4OJOA 2X1EA 2AQFA 3UNGC 2VQHA 1RMGA 2WAEA 1N75A 2BVLA 4F55A 2V7FA 1MABA 4XORA 4XM3A 1HZEA 3HAGA 1ERDA 4TT3A 2KHMA 1O8EA 2LYCA 3GQ8A 1W0JA 4ZTJA 5FRNA 2K9LA 2P0WA 3VSUA 4PFPA 3OYCA 3H9QA 3SEQA 3VSKA 3L2UA 2PJRB 2LZJA 2WJVA 1O8LA 2UVEA 4L8JA 2DCEA 4HPQA 3OYEA 1KCDA 5TGTA 2HPIA 4YZ0A 3OIPA 3B4NA 1SAUA 2IGKA 1IB4A 2XF6A 4MXNA 2E1MB 1NRKA 3DTIA 3OYLA 2VJJA 2QE7A 2CH0A 3S93A 3JURA 1SFKA 4GQNA 2GJRA 3WWGA 4CZCA 1MNDA 3OOCA 2X3HA 1IA5A 3HPGA 4CCOA 3NWSA 5FROA 2VLAA 1WFXA 3CF2A 4XOPA 3ZPNA 2R7WA 1O8MA 3SUCA 3OYBA 3EUAA 3LFUA 4HWVA 4XLFA 4F92B 2R4GA 3OYKA 3A3GA 2XDVA 3MKWB 4CA0A 1WP6A 4F3QA 4ZDOA 1I8DA 3H94A 1LKXA 3HOSA 3B8YA 2OUMA 2JSPA 3W2VA 3C2HA 3DKXA 4J00A 3RCOA 4BQNA 2CUJA 3FDYA 2WY7Q 1LVKA 4LG3A 3BC8A 3HOTA 2CFOA 1YE9A 3D5LA 1FMWA 2WAQA 3IAS2 5KNLA 3KEYA 2I8DA 4NQWB 4PSWA 3OS1A 1HA8A 3OW7A 4KKTA 3IP4B 2MC4A 3ZQQA 4Z06A 4OZZA 4FXUA 1PKVA 4BE1A 1O8FA 3SYTA 4NNJA 4PUSA 1YX5A 2JIZA 1P9QC 1D1BA 3KYLA 1BR1A 4D9JA 4GRIA 4IKFA 1E1RA 2V9KA 3U21A 2Z8GA 1QJVA 2ZZGA 2GOMA 1X0CA 3DWLE 3H35A 4XLAA 4B43A 3L2WA 2E1BA 1NG7A 2NTBA 1X19A 3OMYA 1MMGA 3K4LA 2VPLA 2LOOA 3SZGA 2VBKA 3OS0A 1X1BA 2Y0SA 2V7QA 4Y4RA 1PJRA 4BUPA 2ZZQA 3EQOA 5LD2C 3AFHA 2F4IA 3CJRB 3RPUD 3ZR8X 1VZ0A 2Z6BD 4JMQA 1U0JA 3FKJA 2EWEA 4ANJA 4DBQA 4TKOB 1G8XA 4KKSA 1BMFA 2W1OA 4U7BA 3VYTB 3OYNA 4CUGA 1EA3A 1K5CA 4MLOA 2NOJB 1E43A 1W0KA 3CJQB 3DEEA 1E3ZA 2HVQA 1OOCA 5CPRB 2R7SA 3QYEA 2Z1DA 3HXLA 3H0DA 2HVRA 4HG2A 1RU4A 4PJNA 2R7TA 4ZDLA 3VYUB 2NT9A 3LNNA 3HL2A 3S3OA 1I18A 3LMWA 2LY2A 2LY1A 3W3CA 3VWBA 1V5EA 4OJPA 2WADA 1YX3A 2O17A 4YZXA 1PLUA 1WJAA 2XNDA 3A1YA 3M8JA 2JDIA 3EPZA 1KCCA 4PFOA 4FASD 2V1NA 3CZ6A 3HKZA 2X8KA 2CV2A 1X4OA 4OAZA 3L2RA 2JJ2A 3A4CA 2JVGA 2VQLA 3L2VA 4Z03A 1DGRM 3PSIA 4PMHA 1QHHD 2IGNA 2FUG2 1O8KA 3K4KA 2WBMA 1O8IA 3RTRA 1EFRA 3ZIAA 4XONA 4DOZA 2V6EA 2ZZEA 2HZDA 4HSRA 1D0YA 3H5NA 2F43A 2LBFB 3DLAA 4YELA 4E0FA 3K4NA 4G6IA 4P22A 4PJLA 3PUBA 1E3XA 2K9MA 1UD8A 3EQNA 1JI8A 1TZLA 4CH7A 3JU4A 4ZDPA 4Z1MA 1CZFA 5C1CA 2M4KA 5LFAA 3S3NA 4B47A 1V5FA 2IS1A 3H5AA 1Y6IA 4U4BA 4E7ZA 1LFPA 4ITVA 4IX7A 4XL9A 4AVZA 2L7KA 1UD6A 3VYSB 1MMNA 2VQGA 4W8SA 4BQQA 2O1DA 4CCNA 2R7RA 2W00A 2E5ZA 4N4NB 1WJFA 4RMNA 4XD7A 1D0ZA 3OWTA 2VB6A 2X85A 3OYJA 4E7LA 4II3A 1COWA 2CW7A 2M5SA 2NT6A 1T5EA 3T9GA 4C2TA 1W36D 2WZPP 2ZFUA 2L2OA 4Z05A 4E7SA 3GBGA 3QOEA 2KLOA 2KPMA 3H9GA 3VYRB 3OY9A 3NE5B 3GVJA 5HNFA 2MFZA 4F93B 3K6GA 2QY1A 4Y3OA 3BLYA 3D5SC 3AKZA 4BGDA 1V0FA 2L5QA 2HDWA 1VJSA 2DJIA 3OL4A 2D3LA 3ZGKA 4R79A 4PSXA 4U49A 2VKHA 4QPQA 3BG7A 1WTHD 1Z21A 3GQ9A 4NC8A 1IRXA 1DGWY 4W8QA 2OC6A 2A6TA 3KX2A 2NSTA 2VJ4A 1Z3XA 2VIXA 3BCBA 4BDYA 4XLCA 1V0EA 2Z16A 3E0JB 3A35A 4XKWA 4AYBA 3VSVA 3T53B 2KRHA 3DDYA 3GQAA 3OAAA 3GQBA 2RNGA 2ZXHA 2KL4A 3TMOA 4CCKA 4BE0A 2F6CA 2VBMA 1UG0A 2KRCA 3HUGB 3CP2A 2MYSA 1W36C 2W6JA 2R7UA 4BS9A 3TBIA 2IQ7A 4W8RA 3MKZA 4RLQA 2VJ5A 4AU7A 2O0WA 2ODLA 1PYVA 1GQ8A 5KHDA 5AMVA 3B90A 4XKBA 2Q1ZB 3D5RC 3V42A 3ZCOA 4B44A 5FRMA 4B3GA 1X4PA 4PK4A 4HRIA 1WPCA 2XZOA 1PXZA 4XMYA 3EUHC 2BW3A 4KISA 2KQRA 3PL8A 1WJCA 4EATA 4E7IA 3LL7A 4FETA 2R7XA 1VLYA 2X51A 3N05A 1WJ5A 2X1DA 3MD2A 4ZTFA 2L9SA 3PNTA 4TSFA 2LBFA 3IUOA 3FY3A 2NTPA 3OPOA 2R7OA 2Z2SB 4G6TB 1O88A 1ZELA 4CSWA 3GQ7A 3S32A 4NK6A 2IS6A 3HC7A 5JHFA 5HKKA 5DN6A 2GJKA 2E60A 4X0GA 2UUZA 4DIQA 4YRVA 4BU2A 2CW8A 4E4HA 3ONQA 2QX3A 1KONA 2CS3A 3OR2C 4DJAA 3OYFA 3AL0B 3ZPPA 2WB1A 1D1AA 4DK1A 4RLFA 3WQZA 2M3AA 3IAM2 3TL4X 2HLDA 3KEWA 4EW9A 1MW7A 2ELJA 2ZSIB 1BN8A 5CDFA 2RREA 2VASA 3BCAA 2V26A 1LDKB 2ZXIA 2HU9A 2LC2A 1NBMA 2LRDA 2V4JC 5HOOA 5HLTA 3CESA 5HNHA 4N4OB 1JRGA 2PYGA 2LG4A 2CV1A 2M7AA 1H80A 1T0FC 3DTKA 4HEA2 2O0VA 1MMDA 3T56B 2KDOA 3OE7A 3W2WA 4D1QA 3PNVA 1KMHA 3VMWA 4C2LA 4RM3A 3L2QA 4U87A 1OFLA 2BW3B 4UZUA 2M7BA 1T95A 2HVSA 1AIRA 4F52A 1O8HA 2XF7A 2BSPA 2DT6A 1WJBA 4W8TA 3CMMA 2XGJA 4B3FX 2VQCA 1WJDA 2QKLB 3ZXSA 3SDBA 1KTWA 1HVXA 3W2AA 2KZVA 3HG9A 2NZMA 3OS2A 4OWRB 2D3NA 4LIVA 2K5CA 2WSSA 2VJIA 2GK6A 3OIQA 3BG6A 2R7VA 2E1MC 3SEZA 2IGOA 2K3PA 3RQ4A 3G05A 4XOTA 1E1QA 1MNEA 4LIUA 1FMVA 2M4GA 3DKYA 2Q2EB 2IXSA 4E7JA 3DPTA 4B48A 1E79A 4KT6A 2L9NA 3C2GA 2XOKA 2F5VA 1D0XA 2MABA 1DQUA 4OAYA 2W82A 4XN0A 4BEHA 2W6IA 2X53S 3GVLA 3QYFA 2E5NA 4XN3A 4CCMA 3OYGA 4BDZA 3QYBA 2WA0A 2WY8Q 2VXDA 1FX0A 1OGOX 3OOUA 3S8PA 4NK8A 2LREA 2XF5A 3LSHA 3OYAA 4HSTA 2UWMA 4E7KA 4XKVA 3VSTA 4BXFA 1N78A 1DP3A 1EE6A 2PMZA 3UR3C 2BOLA 3G2BA 3LMMA 3LSGA 1AA7A 1BOBA 3H9JA 4YXWA 1G59A 4CCLA 3K4CA 3OYHA 3K4BA 4KJZA 2W7NA 4DK0A 3QODA 4Y33A 3LSKA 3RSNA 3S3MA 3DPUA 1BLIA 5KCMA 1OHHA 1VF7A 3OEHA 2INVA 4C30A 1UD3A 3ZSCA 1BR4A 4JOMA 1X1DA 2KMUA 1BPLA 2A5WA 1BR2A 3I3LA 2HQAA 2INUA 4BJTA 1W9XA 1Z3YA 3DTEA 2DIEA 2UVFA 1QCXA 1JTAA 2KP6A 2IS4A 3DU5A 2M0MA 1X1CA 4ZC3A 4ZJZA 2DOAA 1RWRA 4C9YA 4G7WA 3VMVA 1OB0A 5CQGA 3MMYB 5CQEA 2NSPA 2CMPA 4IQJA 2PYHA 2X6XA 3FHNA 2PECA 2AQEA 1K28D 4YZQA 2ZZFA 3PFYA 3PJRA 2WJYA 2JUGA 4H4KC 4NC7A 4KITB 1N77A 3HPHA 3A2KA 3K70D 2GJPA 4ASUA 4PJJA 1IDJA 2VXZA 5IK2A 1UAAA 4CCJA 4OJ6A 1O8JA 4E6KG 4I84A 4ZYAA 3OEEA 3K10A 3LSIA 3K70C 1UELB 2O04A 3GVKA 5C1EA 1OR7C 4HNUA 3VDXA 2VBEA 4E7HA 3BC9A 1QU3A 4YZAA 3UW0A 2R7QA 2DT7B 2UV1A 4NUBA 2X6YA 1GLNA 2LH9A 2BVMA 3LSMA 2OV7A 2ZSHB 5CKTA 2ZTGA 4HNTA 4OZYA 3VR6A 4J01A 3OFNA 2V31A 1UD5A 3BH4A 3GRHA 4URRA 4XLHA 1UD4A 4XKCA 4XLEA 4OJ5A 1DBOA 1E0EA 1D1CA 1QHGA 4LITA 2WPDA 2NTQA 1XG2A 2V4DA 4P1WA 2MD0A 1R6RA 2HPMA 2HNHA 2O5RA 3AL0C 3K4MA 4C2UA 3OYIA 1SKYB 3MKYB 4PJMA 1HG8A 2XZLA 4B3XA 2RQQA 2XZPA 3EUKL 3BCFA 2IGMA 4BQOA 4IQ4A 2QKMB 3H5RA 3FPPA 4RM2A 1NHCA 4BEHB 1S9HA 4KKUA 3CP8A 4F91B 4BE2A 2F1MA 2GK7A 2ZTNA 2GOXB 3DPLC 3J7AY 3VSLA 1UD2A 3DQVC 3DU6A 1TT0A 3A3BA 4DNRB 2CK3A 2JJ1A 2XSJC 2W4SA 4MR0A 4YEJA 4XQFA 5FL7A 1OFMA 3I9V2 1WMRA 2JA2A 2VKDA 3NWTA 1J09A 2X1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKV A;  3VST A;  2IQ7 A;  4W8R A;  1EE6 A;  2ODL A;  1IDK A;  1GQ8 A;  5AMV A;  3B90 A;  3EQO A;  4XNF A;  3KRG A;  1O8D A;  1O8G A;  1PXZ A;  2EWE A;  2X6W A;  4XR6 A;  4XMY A;  2QXZ A;  1K5C A;  3ZSC A;  2INV A;  1DBG A;  1OOC A;  2INU A;  4OJL A;  2UVF A;  1RU4 A;  1QCX A;  1JTA A;  1PE9 A;  2NT9 A;  1VBL A;  2NTP A;  3FY3 A;  1BHE A;  1RWR A;  1O88 A;  3LMW A;  3GQ7 A;  3VMV A;  4NK6 A;  4OJP A;  1OGM X;  2NSP A;  2O17 A;  4YZX A;  1PLU A;  2PYH A;  2X6X A;  4OJO A;  2PEC A;  1RMG A;  1KCC A;  4YZQ A;  4XOR A;  4XM3 A;  2QX3 A;  3ZPP A;  1O8E A;  3GQ8 A;  4Z03 A;  1IDJ A;  3VSU A;  4OJ6 A;  1O8J A;  4PMH A;  4I84 A;  4EW9 A;  1O8K A;  2O04 A;  2UVE A;  5C1E A;  1BN8 A;  1O8I A;  1O8L A;  2VBE A;  4YZA A;  3UW0 A;  1KCD A;  4YZ0 A;  4XON A;  3B4N A;  1IB4 A;  4MXN A;  1JRG A;  2PYG A;  2X6Y A;  4YEL A;  2VJJ A;  1H80 A;  3JUR A;  3EQN A;  2O0V A;  3WWG A;  1CZF A;  2X3H A;  1IA5 A;  4OZY A;  5C1C A;  4XOP A;  4U4B A;  3VMW A;  4C2L A;  1O8M A;  3SUC A;  3GRH A;  4URR A;  4XLH A;  1OFL A;  4XLE A;  4XL9 A;  4AVZ A;  4HWV A;  4OJ5 A;  4XLF A;  1DBO A;  4W8S A;  1AIR A;  2O1D A;  1O8H A;  2BSP A;  4W8T A;  2NTQ A;  1XG2 A;  2O0W A;  2X85 A;  3B8Y A;  2NT6 A;  3T9G A;  1KTW A;  4Z05 A;  2NZM A;  1HG8 A;  2VJI A;  2QY1 A;  4XOT A;  4U49 A;  4Z06 A;  1NHC A;  4OZZ A;  3GQ9 A;  1O8F A;  4W8Q A;  4XN0 A;  2NST A;  2Z8G A;  4XN3 A;  4XLC A;  1QJV A;  3VSV A;  4XKW A;  1X0C A;  1OGO X;  3GQA A;  4XLA A;  4MR0 A;  4NK8 A;  4YEJ A;  4XQF A;  1OFM A;  1WMR A;  2NTB A;  2VBM A;  2VBK A; 
#chains in the Genus database with same CATH topology
 3OYD A;  4HIZ A;  1FBS A;  2QQB A;  4BL0 B;  2DA4 A;  3PA2 A;  3G4S I;  1U78 A;  2E7X A;  1IDK A;  1VQK B;  1KQ9 A;  4M2L A;  3CCS I;  2RQP A;  1VQ8 B;  1A6I A;  3KRG A;  3HKZ N;  2OQR A;  5B1B H;  5LGN A;  1OLT A;  4XR6 A;  2HMA A;  2DI3 A;  3M1C A;  3BZC A;  3WU2 C;  1DP7 P;  5DSZ A;  2G0Y A;  1VQ7 B;  4HF2 A;  2FBK A;  4BJ5 C;  1GVD A;  2DA1 A;  3JRE A;  2DXI A;  2DQL A;  3PSS A;  2BM6 A;  2CUZ A;  1NG6 A;  3A01 A;  1Y0R A;  1MSE C;  1RPW A;  2PJR A;  4G7Z F;  2WAF A;  1VBL A;  3G3Z A;  3ULQ B;  3OR1 C;  1VQ5 B;  4PJ0 C;  5IPA A;  4A3K J;  3PQJ A;  1RUO A;  1TW3 A;  3JRG A;  3CUQ C;  4IW3 B;  2Q0O A;  2OTL B;  1WJE A;  2KFD A;  1X1A A;  1GAW A;  3ZRG A;  3E97 A;  1E3O C;  1XTA A;  2K4B A;  3WTY C;  3A02 A;  3V8J A;  1BQE A;  1MAB A;  2DPU A;  1M90 D;  2Z9O A;  2I5U A;  3GF2 A;  5LHH A;  3FM3 A;  3CDH A;  1W0J A;  2K9L A;  4PFP A;  1NTC A;  3W2G A;  1JA0 A;  2KRF A;  1O4X A;  4OMY A;  3MMP A;  2FD5 A;  3OYC A;  5C44 J;  1ZRC A;  2WJV A;  2V7W A;  2Q8K A;  4L8J A;  5BPD A;  1DU6 A;  3U6B A;  1KCD A;  1XN7 A;  1AU7 A;  2GLO A;  4HQM A;  1UJ8 A;  2C5H A;  3B4N A;  1XC5 A;  2IGK A;  2JUC A;  1ETK A;  1P4A A;  2E1M B;  1BIA A;  2CO5 A;  2PX9 A;  2HOS A;  4N9I A;  3JUR A;  3WGH A;  1MDM A;  3ABK H;  3WWG A;  1IDZ A;  1MND A;  1FRQ A;  4YAL A;  3I1F A;  1U2R A;  4CCO A;  4M9S A;  1SM4 A;  4IHW A;  1WFX A;  2QYU A;  4XOP A;  3ZPN A;  5E3N A;  1DUX C;  1O8M A;  4OPO A;  3OP1 A;  4YFX F;  2JSC A;  4EQQ A;  3JQR A;  4HWV A;  2IW5 A;  1CLW A;  3ZZ0 A;  3BR3 A;  4CA0 A;  3CB4 A;  3CQZ J;  3LYC A;  5FKN A;  1LJ9 A;  3LQR A;  1LKX A;  2BV6 A;  3Q5F A;  2XPU A;  3W2V A;  4J00 A;  1KU2 A;  4BQN A;  4Z4W A;  4TMZ A;  3CLO A;  3BC8 A;  4QWQ A;  1IJW C;  4HX4 A;  2FSW A;  1QZZ A;  3V7A A;  1IN6 A;  1FMW A;  3D5L A;  2ISZ A;  2E35 A;  2JPB A;  2D1H A;  3CJT B;  3OS1 A;  3L2C A;  4ROX A;  2QGG A;  3C3W A;  1IB0 A;  1R5O A;  2DK8 A;  3I4M J;  3BPV A;  4WZT A;  4RJL A;  1ETO A;  3I56 I;  1PKV A;  3J81 Z;  1O8F A;  1JUS A;  2EIM H;  4PUS A;  2BN4 A;  1KC8 D;  2Q2E A;  4HOB A;  4UUS B;  2JIZ A;  1R4M B;  2CSO A;  1D1B A;  5BSY A;  1ZRF A;  2Z8G A;  1H9G A;  2VNH A;  1XGN A;  2LP0 A;  1X0C A;  3DWL E;  3H35 A;  5H59 A;  1MRZ A;  2NTB A;  3OMY A;  1AOY A;  1MMG A;  3K4L A;  3SZG A;  4PDK A;  2DER A;  1WHU A;  1X1B A;  1JXS A;  2EK5 A;  2E71 A;  4HAM A;  5A2Q Z;  2V7Q A;  4Y4R A;  3V7R A;  4AWX B;  1PJR A;  3AAF A;  3ZMV A;  2QBY B;  3QU6 A;  5LD2 C;  3AFH A;  1SFX A;  3RPU D;  5J4V A;  3ZR8 X;  1U9O A;  3HHH A;  5JI6 A;  5GPA A;  4JMQ A;  4S0H B;  3QU3 A;  4ANJ A;  1IJF A;  1G8X A;  3PUF A;  2GQQ A;  3ZZU A;  1B4A A;  2W1O A;  3OYN A;  1H89 C;  1EA3 A;  4JX4 A;  3GXO A;  3J80 Z;  2NS7 A;  1W0K A;  2QY1 A;  1E3Z A;  5M3M J;  2HVQ A;  1SFU A;  4TMW A;  2DA5 A;  4S04 A;  5A2Q K;  3QYE A;  4FWT A;  1RU4 A;  3CMA I;  4RB0 A;  4ZDL A;  3TOB A;  2HZT A;  3JAM Z;  2VC0 A;  1MH3 A;  5F0C A;  3W2H A;  4ACB A;  5AIQ A;  3S1M J;  2L01 A;  2VPR A;  4DQ2 A;  4P1V A;  1LFB A;  1FNC A;  2P81 A;  1V5E A;  1Y0Y A;  2WAD A;  2DFH A;  1YX3 A;  2O17 A;  4YZX A;  1ORK A;  2ZFW A;  2H94 A;  4AVP A;  1KTV A;  2FU4 A;  2VE8 A;  3A1Y A;  3M8J A;  3BJO A;  3EPZ A;  1W5C C;  2JT1 A;  2DMU A;  2YWE A;  3U6K A;  1IRZ A;  1G3W A;  5JFR A;  1X4O A;  2DA3 A;  1IHM A;  1WSR A;  2VQL A;  2GZW A;  3L2V A;  1QGZ A;  4Z03 A;  2XAQ A;  1DGR M;  2F4M B;  2JJ7 A;  1YIJ I;  1SMY F;  2RGV A;  4PMH A;  1QHH D;  2IGN A;  3C2B A;  1BC8 C;  4P3Y A;  3FXJ A;  3RTR A;  1IRF A;  1T08 B;  3ZIA A;  1YJ9 I;  4XON A;  4EGZ A;  3I59 A;  2K3F A;  2CQK A;  2V6E A;  3SFI A;  4HSR A;  1D0Y A;  1WOR A;  3HRU A;  2F43 A;  4Q7J B;  4G6Q A;  4J19 A;  2WTE A;  4PJL A;  2K9M A;  4MYT A;  2GA1 A;  4I2O A;  1XD7 A;  1OCR H;  2P8T A;  3OZW A;  4AM3 A;  1E63 A;  1R5B A;  1V5F A;  2OCC H;  1YS6 A;  4U4B A;  2XGE A;  4E7Z A;  1LFP A;  4ITV A;  2L7K A;  1UD6 A;  2BM0 A;  4CCN A;  4QIW N;  2R7R A;  5FKK A;  2W00 A;  4UUT A;  4ENM A;  1R5G A;  1BJK A;  1MBK A;  4NC6 A;  3I58 A;  3WQZ A;  1D0Z A;  5E79 C;  2VB6 A;  3WTS C;  3OYJ A;  3SJP A;  2F2E A;  3MFK A;  2ZFU A;  4H9G A;  2L2O A;  4Z4Y A;  4E7S A;  2OBT A;  1P7J A;  2KLO A;  5FD5 A;  4OIR F;  1B23 P;  4RAY A;  5DUI A;  3FK7 A;  5EEH A;  3E3V A;  4N3G A;  1JHF A;  1H0M A;  1IG7 A;  1HW2 A;  2VE9 A;  2J5O A;  3KEQ A;  1CQX A;  2HDW A;  3VOE A;  2D3L A;  2P5V A;  3ZGK A;  4R79 A;  1CNF A;  1FEX A;  1Q82 D;  3CUO A;  4MO7 A;  5TRD A;  4QPQ A;  1GVH A;  4NQW A;  5IT9 Z;  1GUU A;  4NC8 A;  2FMY A;  2B9S A;  1DG1 G;  1MJB A;  4W8Q A;  3HRM A;  3VO1 A;  2Y31 A;  2OC6 A;  3IWF A;  1IJE A;  3KX2 A;  3QP5 A;  2VJ4 A;  3HRT A;  2ME0 A;  1P6R A;  2Z16 A;  3E0J B;  3A35 A;  3ZBU A;  1MJ9 A;  3GZN B;  3DDY A;  2KT0 A;  3OAA A;  4A5M A;  3WTT C;  2V1X A;  3KCC A;  1A36 A;  1QH0 A;  1OYY A;  2KL4 A;  3CCE B;  3TMO A;  4CCK A;  1H8A C;  1HDP A;  2VBM A;  1UG0 A;  2KRC A;  4GFB A;  2O6G E;  1T98 A;  3E5U A;  2YS9 A;  2Y75 A;  4P26 A;  5BNG A;  3MZ8 A;  1V5V A;  1BM9 A;  2QVO A;  2F5C A;  5LHG A;  1OMI A;  3WTW C;  5KHD A;  1K7A A;  5AMV A;  1AKH B;  4XKB A;  3CCL I;  2O61 A;  3ZCO A;  2V5I A;  4DYC A;  2ELH A;  1X4P A;  4KN7 X;  5B6I A;  1PXZ A;  3OOP A;  1OCP A;  1KK0 A;  3HHG A;  2Q6I A;  2BW3 A;  3GIR A;  3S1N J;  2BY1 A;  4KIS A;  3KEO A;  1U5T B;  1WJC A;  5AIP A;  4FET A;  4I0B A;  2QWW A;  1QA6 A;  2R7X A;  3ZMS A;  1FND A;  2QA4 B;  3OIO A;  4OU0 A;  1ULY A;  2L9S A;  3H36 A;  3PNT A;  3JSO A;  1FNM A;  2F3L A;  3FY3 A;  1Y8R B;  1QG0 A;  2Z2S B;  4G6T B;  2V7V A;  4CSW A;  1ZM3 A;  4M1K A;  5A8A A;  4NK6 A;  1VQL B;  5BMZ A;  1BI3 A;  3E1Y E;  5JHF A;  3BQY A;  2QCO A;  3KYD B;  4X0G A;  3ZOB A;  3MZH A;  3SJM A;  4MNU A;  4DIQ A;  4DZP A;  3CC2 B;  3N4M A;  2Z99 A;  3HB9 A;  2CW8 A;  3LA2 A;  3SXY A;  4BU2 A;  4E4H A;  1YFH A;  3B78 A;  4RD2 A;  2IAI A;  5KAI C;  3RDI A;  6PAX A;  2C4U A;  2HQ5 A;  4IOC F;  3HBL A;  5L3D A;  4HV6 A;  1WH5 A;  4IRI A;  3RKY A;  5K7H A;  1MW7 A;  2YSR A;  1I5Z A;  3F23 A;  3GFM A;  3BCA A;  1KK3 A;  1S6L A;  3M8E A;  5GAG J;  2GXB A;  4MQV A;  3HTU A;  5D6F A;  1QA2 A;  3FZV A;  1BX0 A;  4UZF A;  5HOO A;  3N6Z A;  3CES A;  1B2R A;  1JRG A;  3SLN A;  2XRL A;  2CV1 A;  1GAQ A;  1K8F A;  2HTS A;  2CJJ A;  2R3S A;  3BPX A;  5E1Z B;  4TMV A;  2O0V A;  1R23 A;  2HYF A;  5IT9 K;  2OPT A;  2DCU A;  1VQL I;  2EFG A;  3PNV A;  4N9H A;  4KDP A;  2B0L A;  4RM3 A;  4U87 A;  4BNC A;  1WH7 A;  2DMQ A;  4M3E A;  5HDG A;  1VQ9 I;  3BG9 A;  1I1G A;  3AG1 H;  5D8L B;  1P7I A;  2PI0 A;  2JN9 A;  2ECC A;  5LRR A;  1O8H A;  4CDG A;  2XGJ A;  2EH3 A;  1KK2 A;  2VYQ A;  2BVN A;  1WJD A;  2L9R A;  3SDB A;  3PSZ A;  2IEK A;  4RAG A;  2VZL A;  1VI0 A;  1I39 A;  3TP3 A;  1H85 A;  3W2A A;  1HVX A;  1A6Q A;  1EKE A;  2P6S A;  3R6K A;  4JK1 X;  4FX0 A;  2JPC A;  4M3G A;  3VB2 A;  3OIQ A;  1BA5 A;  5B66 C;  1K73 D;  1XGS A;  2E1M C;  4PGO A;  1H9T A;  2K3P A;  2YPR A;  4G6D A;  3CO6 C;  1E1Q A;  4FE4 A;  5DCF A;  4EMS A;  1G7S A;  4M0L A;  4FCY A;  4PZJ A;  1JA1 A;  2Q2E B;  2IXS A;  4AC0 A;  3DPT A;  4B48 A;  5D5V B;  2L9N A;  3C2G A;  3OW2 B;  4M4S A;  5ILU A;  4M6V A;  4H0E A;  4A5N A;  3J80 K;  4BXX J;  2QYO A;  3CPW B;  4GYG A;  1D5Y A;  3GTM J;  2Y0S N;  2WY8 Q;  3T8R A;  3JRI A;  3P9K A;  1FX0 A;  1QFY A;  5DYM A;  5L3C A;  1ZRE A;  3OOU A;  1LUJ B;  3CLQ A;  3S8P A;  5D5U B;  3WBJ A;  5FKL A;  2BPO A;  4NK8 A;  3OYA A;  4C0S A;  1Z6T A;  3GFL A;  1OPC A;  3IH2 A;  2XIG A;  2UWM A;  3PFI A;  2CQN A;  4TMX A;  3G2B A;  2PMD A;  2P4W A;  2WWY A;  2Z33 A;  3V4G A;  1BJZ A;  3J81 k;  4Z2Y A;  3GW2 A;  4XLN F;  5L3E A;  4P3I A;  4RD4 A;  1BW6 A;  1LFU P;  3JQQ A;  3K4C A;  3OYH A;  3K4B A;  4G7H F;  2X48 A;  2W7N A;  1BLI A;  3LSK A;  4UVC A;  1FWZ A;  3OEH A;  3CME I;  2VFO A;  1UD3 A;  3G71 B;  3ONY A;  4EJW A;  1BR4 A;  2N8G A;  1X1D A;  4RAZ A;  3ROU A;  2A5W A;  1BR2 A;  3I4N J;  2HQA A;  4EVI A;  1WDT A;  5E20 A;  2DAO A;  4BJT A;  1IO2 A;  5HXB A;  1JTA A;  2KP6 A;  1G4D A;  5IYP A;  3DU5 A;  2M0M A;  3W6V A;  2D45 A;  3HSE A;  1KJZ A;  1JTY A;  1TLL A;  1HOM A;  1RWR A;  5TV2 A;  3O8H A;  4C9Y A;  4G7W A;  1DDI A;  4QVJ A;  2XV4 S;  2E1N A;  4UAJ A;  5B5E C;  1ZK8 A;  2CMP A;  5ED4 A;  2PEC A;  1F4K A;  1JT0 A;  3SLD A;  2ZZF A;  1H88 C;  5IYR A;  2PJP A;  2EQR A;  3JTH A;  4M72 A;  3P4G A;  4RD3 A;  1SVO A;  2VN2 A;  1EFC A;  4XBF A;  4U0V A;  1IDJ A;  4OJ6 A;  4I09 A;  4ZYA A;  4I84 A;  3K70 C;  3BWG A;  3RZO J;  1UEL B;  2YWG A;  2ZIT A;  3G4S B;  2O04 A;  5C1E A;  2M87 A;  3JRH A;  1SAX A;  2XNC A;  3S2D J;  2R93 J;  2EZH A;  2R7Q A;  4Q47 A;  4Z4U A;  3BR1 A;  1QUE A;  5HZB A;  1R5N A;  2UV1 A;  2DPD A;  4NUB A;  2X6Y A;  1RQR A;  1EFU A;  3GEZ A;  5M5X J;  1GT0 C;  1OJL A;  1NK3 P;  3VPR A;  3CUQ B;  3FXO A;  4B1R A;  3CCJ B;  4GO1 A;  5CYV A;  3NAU A;  3TDU C;  2K86 A;  4AYB N;  1LM1 A;  1FDR A;  2DOE A;  2QMU A;  4URR A;  2DMT A;  4XKC A;  1ZH5 A;  3RKQ A;  5ICE A;  1D1C A;  1WVR A;  3RYR A;  1R36 A;  1E0E A;  3ECO A;  4QSH A;  2WPD A;  3V7S A;  1RRJ A;  2DYS H;  1VQP I;  4NHJ A;  1APL C;  1WKM A;  1K6O A;  1XG2 A;  4P1W A;  4Z6Y A;  2DY1 A;  1R6R A;  1XMA A;  1YLO A;  3H09 A;  4M71 A;  1JT6 A;  3AL0 C;  4Y52 J;  2L7M P;  1IV6 A;  1SKY B;  1XQB A;  4QVA A;  4G5G A;  5E1X A;  4B3X A;  3O8G A;  2XZP A;  3BCF A;  4IVN A;  2IGM A;  4BQO A;  4FE7 A;  1R00 A;  1N25 A;  2QKM B;  2R5Y B;  1G7T A;  4RM2 A;  5FKM A;  1NHC A;  4KKU A;  4XID A;  3J7A O;  1FT9 A;  3CP8 A;  3GLL A;  4BH9 A;  3S16 J;  2GK7 A;  4BYY A;  2GOX B;  2LTP A;  3VSL A;  3F8M A;  3DP7 A;  4YFK F;  5LGT A;  4YFO A;  3CC2 I;  3DQV C;  4B4D A;  2MSY A;  5F6F A;  4OPV A;  1FIP A;  4B09 A;  2ZL6 A;  1YLF A;  2XSJ C;  2XTY A;  4MR0 A;  1KU7 A;  4KIF A;  4XSX F;  5FLX Z;  1WMR A;  2VKD A;  4WXH A;  4D5C A;  1D3Y A;  1ZGA A;  2IS2 A;  2R9V A;  1YW7 A;  4WZE A;  3F8F A;  3OZU A;  4MQ9 F;  1EH6 A;  1QVU A;  2L02 A;  3PA1 A;  1FYM A;  1O8D A;  3QSY A;  3BCD A;  5D5X B;  3SQV A;  4JQF A;  2X6W A;  2ZME C;  2VL8 A;  3PNY A;  1T8I A;  1BJA A;  3FKS A;  4ENJ A;  2NVY J;  1V5G A;  1H42 A;  3MCA A;  2BM4 A;  4N0B A;  1N07 A;  4AC9 A;  2GIZ A;  3ZQ7 A;  4QV2 A;  3ASR A;  2WAQ N;  4XLP F;  4V2G A;  4QPO A;  1K6Y A;  5LBQ A;  3OYM A;  1EF4 A;  1Z7L A;  2QF7 A;  1IAW A;  3K4J A;  2DTZ A;  4KN4 X;  3B8H A;  4RD1 A;  2K40 A;  1BHE A;  1MMA A;  1XCV A;  1FNN A;  5EG0 A;  3ZUG A;  3IV5 A;  1MBJ A;  3FBI B;  5HZA A;  1B8I B;  1OGM X;  3KZI C;  3ZQF A;  3C1D A;  4OJO A;  2GRE A;  1MIJ A;  2O8X A;  2VQH A;  2K9S A;  4L9T A;  1U2W A;  1N75 A;  2BVL A;  4YC5 A;  3HAG A;  4A3L J;  5DCM B;  2KHM A;  1LLW A;  4ACA A;  3VSU A;  3L9F A;  2EZI A;  5KSW B;  1VF9 A;  3SEQ A;  2LZJ A;  3WNC A;  1O8L A;  2KIU A;  2DCE A;  4LLL A;  1UFM A;  3KZZ A;  5TGT A;  2LY9 A;  2HPI A;  3K0L A;  5J47 A;  3OIP A;  3GME A;  2V9V A;  5LHI A;  3ASQ A;  4WXC A;  3DTI A;  2MW8 A;  2QE7 A;  3S93 A;  1YRN A;  2GJR A;  4IEJ A;  2X3H A;  3HPG A;  5FRO A;  2VLA A;  1S7O A;  1U5T A;  3CF2 A;  3CC4 B;  1MNM C;  1FBU A;  4NCN A;  2ZNZ A;  5AON A;  5D8K B;  2XNJ A;  2STT A;  1ZR2 A;  4XLF A;  1WWX A;  2R4G A;  1D8K A;  2MBF A;  3MKW B;  1WP6 A;  5J8F A;  3H94 A;  4HW0 A;  3B8Y A;  2L7Z A;  1XFO A;  2OUM A;  3C2H A;  3DKX A;  3A8J A;  3FDY A;  2WY7 Q;  1LVK A;  2OU2 A;  1TWF J;  3QPH A;  4Z4V A;  1UZC A;  2MG4 A;  3TKY A;  1EJ9 A;  2PN6 A;  3P5J A;  1OCT C;  1QX4 A;  2QZ8 A;  5BQT A;  1UCR A;  2WAQ A;  4OIN F;  2OBP A;  4GGG A;  5EEG A;  3KEY A;  2I8D A;  1QA1 A;  4KKT A;  5K5R A;  4X7E A;  3G1O A;  2IT0 A;  2MC4 A;  3ZQQ A;  4Z06 A;  4HDV A;  4M6X A;  4PC3 A;  1NB9 A;  3G73 A;  2DBB A;  1KQ8 A;  1YIO A;  3N97 A;  1YX5 A;  1CQT A;  1FBQ A;  3B82 A;  1P9Q C;  3M9A A;  4GRI A;  4QHY A;  2V9K A;  1N06 A;  5IYC J;  1VQK I;  2Q6O A;  4B43 A;  2E1B A;  3T0Y A;  1W2B B;  3CPX A;  4L0Z B;  3AK5 A;  2J8K A;  4KIB A;  3AVX A;  4Y9R A;  5CVI A;  1IGN A;  1S5L C;  1W5S A;  2TRT A;  3OJW A;  1KA8 A;  3EQO A;  2CYY A;  5ERI A;  3LST A;  1U0J A;  1YTY A;  1SVM A;  4IRG A;  1J7K A;  5GTI C;  3KLN A;  3F21 A;  3TQN A;  1BMF A;  3E6D A;  2BM7 A;  3FXL A;  2CRV A;  5CVJ A;  1RR8 C;  2ME6 A;  2IA2 A;  1YI2 B;  4I02 A;  1WCM J;  4BHC A;  4UVB A;  2DMP A;  5CPR B;  2Z1D A;  3HXL A;  4BBR J;  4HG2 A;  4PJN A;  2EFO A;  3GSI A;  3VYU B;  4IO9 F;  5F0H A;  2NT9 A;  1YIT B;  3BR2 A;  2RDP A;  2J7K A;  1VQP B;  1I18 A;  4OP7 A;  1RUN A;  2LY1 A;  3W3C A;  3CC7 B;  1W7P A;  4OJP A;  1V54 H;  2HDC A;  2H8R A;  4CYC B;  2EFQ A;  3KP7 A;  4PFO A;  3CZ6 A;  3CCQ I;  3HKZ A;  2AHQ A;  5K7F A;  1HXD A;  3PUN A;  4Z4Z A;  3LVB A;  4CYD A;  4Z4S A;  2CV2 A;  3L2R A;  1I7P A;  4M9X A;  3Q3S A;  3FPK A;  2O9L A;  2IRF G;  3PSI A;  4OIO F;  2CQ7 A;  2ZNY A;  4C3I J;  2OQG A;  1O8K A;  1X3Z B;  5DV5 A;  4U7D A;  2CQX A;  2EFW A;  2NS0 A;  2B7E A;  4XK4 A;  4QUZ A;  4DOZ A;  3MAJ A;  3WTX C;  2HZD A;  2K02 A;  2WB1 N;  2WC2 A;  4R1H A;  2ELK A;  3ELK A;  3K4N A;  3PUB A;  4RDU A;  3EQN A;  1XDS A;  2EZL A;  4ZDP A;  4Z1M A;  4LBZ A;  1XG1 A;  5C1C A;  4AIH A;  4Y17 A;  2IS1 A;  1E62 A;  3SZT A;  2QUF A;  1UHS A;  2JA6 J;  4IX7 A;  1IXS B;  4XL9 A;  1TQP A;  2E1O A;  5FO0 A;  3H3U A;  5CVV A;  2W48 A;  4XSZ F;  2E5Z A;  3BTJ A;  1WJF A;  2O0W A;  5CLS A;  1G7R A;  1COW A;  2NT6 A;  3BTC A;  5GV7 A;  2G7U A;  2E2J J;  3W2I A;  4LLG F;  4M9Z A;  5JVT A;  5ILS A;  1GR1 A;  2OBR A;  3GBG A;  1YYV A;  1IUF A;  3I53 A;  1VHO A;  2D9R A;  5HNF A;  2MFZ A;  4IF4 A;  4EJT A;  2DOF A;  3AKZ A;  4BGD A;  3CCV I;  4KIG A;  3M4O J;  2BXZ A;  4I98 B;  1ZGW A;  1TWA J;  3GTL J;  3HOU J;  1VJS A;  3OL4 A;  2P7V B;  4PSX A;  4U49 A;  2ZXJ A;  1NHA A;  1WSU A;  1BBY A;  2ISY A;  2VKH A;  1XSD A;  2D5V A;  3GQ9 A;  2VOP A;  1P2F A;  3FIW A;  2OTJ I;  1Q81 D;  1IRX A;  4ZYD A;  5BSX A;  4IL6 C;  2A6T A;  3IWZ A;  3BCB A;  1DPR A;  4LOC A;  4BDY A;  2B63 J;  1EV7 A;  2MLG A;  3KE2 A;  3VSV A;  1YJN B;  3SZE A;  3AST A;  2PMU A;  1DAR A;  2RNG A;  3ZQL A;  4ESB A;  3S14 J;  4P6Y A;  4GXO A;  1HF2 A;  2MYS A;  1DPU A;  2CFX A;  4RLQ A;  2ODL A;  1PYV A;  3EDP A;  5F27 A;  3B90 A;  2FOW A;  1LE8 A;  2FEZ A;  2Q1Z B;  3D5R C;  4M73 A;  1B59 A;  3V7C A;  4B44 A;  4CQJ A;  4M6Y A;  1WPC A;  5KAF C;  1VTN C;  5DD4 A;  4XMY A;  1FIA A;  2M34 A;  2KQR A;  4HZF A;  5D4S A;  3W5V A;  1TQM A;  4EAT A;  1X3W B;  3A1P A;  3OJX A;  2X51 A;  3N05 A;  1SFE A;  4CZZ A;  3LNQ A;  2LF7 A;  5BPI A;  5F4J A;  2OZU A;  4IRH A;  1PUF B;  4FHT A;  4X1E A;  4RGS A;  1G3Y A;  1O88 A;  1ZEL A;  1O3T A;  1Q1H A;  2ESH A;  2EA2 A;  3FXK A;  2LKP A;  5IOZ A;  2DYI A;  4JP0 A;  1G6N A;  2AXT C;  1YO5 C;  5JBQ A;  3WTZ A;  5DN6 A;  3BDD A;  2PEX A;  1IRG A;  2UUZ A;  2BGC A;  5M3F J;  1KQ5 A;  4LLN A;  2ZL7 A;  4JX6 A;  3WG7 H;  1PUE E;  4I01 A;  3WU0 A;  1Z67 A;  2WB1 A;  2ZME B;  3ZQC A;  2GXA A;  4MYU A;  2D1V A;  4DK1 A;  4RLF A;  1R9T J;  3IAM 2;  1UB9 A;  5IYB J;  3GFJ A;  2ELJ A;  1BN8 A;  5CDF A;  2VAS A;  5GPC A;  1GV5 A;  5EZG A;  3SEJ A;  1FRN A;  1HDD C;  4K1X A;  2LC2 A;  3LOC A;  3FK6 A;  1VQ8 I;  2BGI A;  2V4J C;  4IHT A;  2L0K A;  2K4J A;  1O7L A;  5E8G A;  3V8L A;  5HNH A;  3JR9 A;  3JW4 A;  2E1C A;  2LG4 A;  2PYG A;  5FIU A;  2ZKZ A;  3G6E I;  1H80 A;  2WV1 A;  2FRH A;  1MMD A;  2LVS A;  3QRF F;  3SYJ A;  3T56 B;  2KDO A;  3OE7 A;  2BY3 A;  2EIK H;  3W2W A;  4X8I A;  1AKH A;  4C2L A;  3VMW A;  1VND A;  3T5X A;  3L2Q A;  1U8R A;  4WXD A;  1OFL A;  4O6J A;  3VNU A;  2VBS A;  1T95 A;  2HKX A;  1VQ7 I;  1Q1V A;  1AIR A;  2L54 A;  5IYW A;  1WJB A;  4W8T A;  3ZXS A;  3R4K A;  3LAP A;  2B5O A;  4G9Y A;  4ENK A;  1XGM A;  2KZV A;  3HG9 A;  2NZM A;  4OWR B;  3SQN A;  1DAB A;  4LIV A;  1JKR C;  3R60 A;  1OFE A;  1IF1 A;  3E5X A;  1ZM4 A;  3RQ4 A;  2ZJR F;  2QA4 I;  4BY7 J;  4MFE A;  4XOT A;  1F43 A;  4LIU A;  2CUE A;  2W25 A;  4LMY A;  2VNK A;  3CCU I;  5FLM J;  3DKY A;  1R49 A;  3PEN A;  3CCM B;  4RA2 A;  2VOO A;  4KT6 A;  5K7Z A;  2BY2 A;  2XOK A;  3ZQG A;  1D0X A;  2XHK A;  2MAB A;  1DQU A;  4XN0 A;  1VQM I;  2W6I A;  4BEH A;  2X53 S;  1NB0 A;  1VQ6 B;  3QYF A;  5TJJ A;  4Y15 A;  4CCM A;  3LA7 A;  5EYR A;  2DTR A;  1X1P A;  1KZH A;  1OGO X;  2VI6 A;  4WZL A;  2RKH A;  2FBH A;  3IKV A;  4KT5 C;  2FJ1 A;  2C77 A;  2XF5 A;  4UXN A;  2DW4 A;  1L3L A;  4XKV A;  3CCR I;  1QRY A;  1YS7 A;  4L5J A;  2RC6 A;  1XPX A;  3UR3 C;  2V1D A;  4X7F A;  3GCM A;  1BOB A;  1F36 A;  3H9J A;  3HSF A;  4A3J J;  4PAB A;  5TY0 A;  1M1K D;  2QTL A;  1ZYR F;  2XTX A;  2XGD A;  3O6B B;  3BRO A;  4PCQ A;  4YHB A;  5E6T A;  2LNB A;  3QOD A;  3BZK A;  3RSN A;  2D2W A;  3SZP A;  2Y2Z A;  3TOA A;  5KCM A;  5C4J J;  3LSP A;  3CCQ B;  4C30 A;  3D1N I;  4YAF A;  5A89 A;  3AVY A;  3I59 B;  3I3L A;  4BY1 J;  4N3N A;  1ZKG A;  2XKP A;  2XTW A;  1JGS A;  1Z3Y A;  3DTE A;  3IH4 A;  2DIE A;  1QCX A;  4AIJ A;  1S3J A;  5J1U A;  4I6Z A;  1X1C A;  2F5F A;  1R1V A;  4ZC3 A;  3LQQ A;  4EV0 A;  3JRA A;  2DA2 A;  3DEW A;  3Q6R A;  5DS0 A;  2QZA A;  3T8T A;  1FOX A;  1FYL A;  1MKM A;  2LD5 A;  3HEF A;  5CQE A;  2NSP A;  1EP2 B;  2O7O A;  4WK8 F;  4IQJ A;  2FX0 A;  1RNL A;  3FHN A;  1WU8 A;  2DFI A;  2ZXW H;  3PJR A;  4KMU X;  1BX1 A;  2WJY A;  4KMF A;  4H4K C;  4HA8 A;  2A6E F;  3I54 A;  3MCZ A;  4NC7 A;  3DBR B;  4P9U A;  4KIT B;  2EFN A;  3KP2 A;  3E20 A;  2GJP A;  3K70 D;  1YJW I;  3CCV B;  3WE3 A;  1FZP B;  2VXZ A;  1ZUN B;  3HM5 A;  3QPT A;  5IP7 J;  3OEE A;  3LSI A;  1G3T A;  4D7N A;  4AID A;  5KW9 A;  4P9F A;  5LEK A;  3VFZ A;  3BC9 A;  1J9Z A;  1QU3 A;  3ZQH A;  5E1W A;  3JRB A;  1LNW A;  4G8X A;  3AGQ A;  2RN7 A;  4UB8 C;  4F7Z A;  4EM0 B;  2H8W A;  2HTJ A;  2QSF X;  3CRZ A;  1GLN A;  4A3M J;  1J75 A;  4RDL A;  2ZSH B;  5CKT A;  1CGP A;  2EIL H;  5JLV C;  3P26 A;  4OZY A;  1NH3 A;  2X3U A;  5F04 A;  4P2N A;  2E19 A;  1Q7Y D;  5CVU A;  3BOQ A;  4OJ5 A;  2EIN H;  3AVU A;  3QQA A;  5HS9 A;  2RC4 A;  3U1K A;  1QHG A;  3K1N A;  3P9C A;  1OCC H;  5GAH J;  2PLF A;  4K2E A;  1ZRD A;  1JHH A;  2DYR H;  1X2N A;  3LA3 A;  2A05 A;  2HPM A;  2HNH A;  2VFN A;  5DNS A;  2X0K A;  1QBJ A;  2X6O A;  3MKY B;  2E2H J;  2M2E A;  2EB7 A;  3LQE A;  1BW5 A;  2H1L A;  4RD0 A;  4YEI A;  5EMN A;  1SD5 A;  3M8F A;  4U0W A;  1YW9 A;  1FY7 A;  4L9V A;  3H5R A;  5J6X A;  3FPP A;  1TQI A;  4A0Y A;  4LB5 A;  4NB5 A;  2BX6 A;  1S9H A;  3PO3 J;  1S4M A;  3WHB A;  4F91 B;  4BE2 A;  1U9N A;  3J7A Y;  3DPL C;  2E7W A;  3DU6 A;  1N8R D;  1TT0 A;  2HCJ B;  1ENH A;  1QVT A;  3GLX A;  1VHE A;  2JJ1 A;  3ISP A;  4PC6 A;  2Y30 A;  4QTR A;  1TWC J;  4YEJ A;  2MGQ A;  1OFM A;  2ID6 A;  3C7J A;  3NWT A;  3FKI J;  1TLH B;  4A2U A;  3QPS A;  4C2T A;  5IP6 A;  1FOY A;  2OA4 A;  1XS9 A;  5DTD A;  3LSR A;  1Z9C A;  4X05 A;  3RKW A;  4Y9U A;  1SVL A;  3GYH X;  1SAN A;  2XUB A;  4DGW B;  3E1S A;  4P5O A;  1O8G A;  1KGS A;  1OR7 A;  3PSF A;  3PIO F;  4DNT B;  1D8J A;  3ASP A;  1ETX A;  4M3D A;  4BJ6 C;  1XCB A;  3ESW B;  4KYW A;  1DBG A;  2PLY A;  2I10 A;  3MN2 A;  5F0F A;  1H8H A;  3FBN B;  3CCE I;  4IZZ A;  3S2W A;  1R4N B;  4OMZ A;  2HYJ A;  5F1J A;  2YWF A;  4M3B A;  3AVW A;  4EM1 A;  2HR3 A;  4DBR A;  1N0V C;  1PE9 A;  2VBV A;  4G7X A;  3W5H A;  2EV5 A;  2NNY A;  2ZB9 A;  3B73 A;  2QQ9 A;  1H8E A;  2XC7 A;  1NJI D;  1Y0N A;  3ASS A;  2FF4 A;  3WBK A;  1JKP C;  5J1Y A;  4G1B A;  1DDG A;  2J5P A;  4WQM A;  4LFU A;  1N0U A;  2AQF A;  3Q9V A;  3UNG C;  5LLQ A;  4X0C A;  1EXM A;  3P7N A;  4F55 A;  1O7F A;  1UST A;  1V3F A;  2M8E A;  4XOR A;  1R71 A;  3H92 A;  1HZE A;  5DCM A;  1Z7U A;  5THX A;  1TWG J;  1V4R A;  2IJL A;  1ERD A;  4UZE A;  5IYN A;  2LYC A;  1RR7 A;  2CND A;  3GQ8 A;  3AG4 H;  1YW8 A;  4ZTJ A;  2W85 A;  4A12 A;  2GWR A;  4C3H J;  5EJC A;  1RES A;  3L2U A;  3GX4 X;  2PJR B;  3VEP A;  3CCJ I;  4FK8 A;  1HW5 A;  4B3A A;  4HPQ A;  4LBY A;  5DEQ A;  4YFN F;  5EG0 B;  2P5L C;  1T39 A;  1XB2 A;  4KH3 A;  1IB4 A;  2XAJ A;  1OGI A;  4BQA A;  4MXN A;  4ZYE A;  3OYL A;  4A3F J;  3GWZ A;  2VJJ A;  4WCG A;  1TTY A;  1X2M A;  4W97 A;  2XAS A;  3W5U A;  3OOC A;  2IA1 A;  4BAY A;  5DM7 F;  1ZM9 A;  2F1L A;  1IA5 A;  3NWS A;  1OB5 A;  3SUC A;  1XGO A;  1F20 A;  4RDK A;  3BQZ A;  4RPD A;  2MD5 A;  4F92 B;  3DV8 A;  1I27 A;  4HE6 A;  4OOV A;  3I71 A;  2VBY A;  1BL0 A;  1WI9 A;  1JB9 A;  2DU9 A;  2Y69 H;  4ZDO A;  4LBV A;  5HLG A;  2VKV A;  1J59 A;  2YX7 A;  2A07 F;  1W0T A;  2VBX A;  3ZPL A;  5AN9 A;  2JA5 J;  4A3C J;  2CUJ A;  2M8G X;  3CF5 F;  3HOT A;  2TCT A;  3Q6Q A;  3CXC B;  2ZCW A;  1K4Z A;  1YE9 A;  2BV3 A;  3L09 A;  3IAS 2;  2ACJ A;  5KNL A;  2HS5 A;  2YU9 J;  3QFC A;  1JJ8 C;  1O3R A;  3JRF A;  3OW7 A;  1YHQ B;  1J0R A;  3IP4 B;  1OYW A;  2XVC A;  2JMW A;  3ABM H;  2QEX I;  1N05 A;  1LEB A;  4FXU A;  2R7D A;  1B9M A;  2GXG A;  4NNJ A;  3SYT A;  3E6B A;  3I55 I;  5K5Q A;  9ANT A;  3GZ6 A;  3F0C A;  5DS9 A;  4D9J A;  3DEU A;  1K78 B;  1WOS A;  2R5Y A;  4LG0 B;  4TV7 A;  4A6D A;  1N08 A;  2GOM A;  3TW7 A;  1NDH A;  4XLA A;  4RDJ A;  3EET A;  3U1D A;  1NG7 A;  1X19 A;  5F1R A;  1MMS A;  1AWC A;  1ETY A;  3F8N A;  2Y0S A;  4MEX F;  4A3B J;  4MGR A;  4XRS A;  3RYP A;  1VZ0 A;  2BM5 A;  2Z6B D;  4DYR A;  2VC1 A;  3ASO H;  1AIP A;  1KRH A;  3TP0 A;  4U7B A;  4ENN A;  4Y7C A;  2COM A;  1QZY A;  1K5C A;  2BZT A;  3KLO A;  1J9I A;  2QEX B;  2DFF A;  3QPL A;  3OSG A;  2QDX A;  1XSX A;  3CJQ B;  3DEE A;  5E3O A;  3U9G A;  3CC4 I;  4OOI A;  2R7S A;  1EZG A;  2DA6 A;  1OCZ H;  1MDM B;  2HVR A;  3GTG J;  2MLK A;  4A93 J;  1CF7 A;  2R7T A;  1D2E A;  2F5E A;  4ZCI A;  3HL2 A;  5TIS C;  4CHU A;  2LDU A;  1W0U A;  1Q9S A;  2VBW A;  4D0P A;  4P96 A;  2VNJ A;  3HGG A;  3L7W A;  1RQP A;  1PLU A;  2JA7 J;  2XND A;  1HQC A;  2H09 A;  5HS8 A;  4XRM A;  1LPQ A;  3RZD J;  5H5J A;  2JDI A;  1SEU A;  2VFQ A;  4FAS D;  3CME B;  4CYC A;  2X8K A;  4PC1 A;  2JRM A;  1QA3 A;  3A4C A;  5J35 A;  1WPK A;  2JVG A;  2H6B A;  1YX2 A;  1VQ4 I;  4A3I J;  1YIJ B;  1RET A;  2RV8 A;  2LSO A;  1LDJ A;  1MGT A;  3BTL A;  2OJE D;  2V9P A;  5C4X J;  3K4K A;  2C4T A;  2VNI A;  4B4C A;  2Z5U A;  2JWT A;  2KIM A;  2WZN A;  3M1E A;  2LBF B;  3DLA A;  4E0F A;  2F5D A;  3I5U A;  2Q6L A;  1W34 A;  3A01 B;  1TZL A;  3S2H J;  1GDT A;  3ZZT A;  1FX7 A;  2M9H A;  2AHO A;  2M4K A;  3RPQ A;  1QO0 D;  1MZB A;  1Y6I A;  3H5A A;  3ML6 A;  2STW A;  2NPF A;  1QVF B;  2W7Z A;  4YCQ A;  4AVZ A;  3ZMZ A;  2ZJQ F;  3VYS B;  4W8S A;  4BQQ A;  3KIO A;  2O1D A;  1ZQ3 P;  2LK2 A;  3BG3 A;  1Q86 D;  4D5F A;  3COA C;  3OWT A;  1R22 A;  3CMY A;  4ZYG A;  3PUM A;  1PP8 F;  1T5E A;  4OM9 A;  1VQO I;  2BM1 A;  1W36 D;  3CW2 A;  2WZP P;  5D4R A;  1G7C A;  2E2I J;  1SMT A;  5DDG A;  4DNC A;  2NRA C;  3QOE A;  3IRQ A;  2KPM A;  3H9G A;  4IHS A;  3NRV A;  3GVJ A;  3K6G A;  2PE3 A;  4DW6 A;  4Y3O A;  5GTH C;  3D5S C;  1V0F A;  2RVC A;  3K1M A;  1Z6R A;  3K7A J;  3F22 A;  2L5Q A;  3DCF A;  5GV8 A;  2DJI A;  3DBL B;  4R8H A;  5CJ9 A;  5L3G A;  3WG9 A;  3BG7 A;  4I99 C;  5M5W J;  1Z21 A;  3ECH A;  1WTH D;  4C2M J;  5IY5 H;  5J3O A;  1TTT A;  3CC7 I;  4ZCL A;  2HYG D;  3TGN A;  4C43 A;  1B1B A;  3LAJ A;  1D5V A;  1WOO A;  2NST A;  2VIX A;  4FX4 A;  1D8T A;  1SD4 A;  1V0E A;  1EP1 B;  4IHV A;  1E64 A;  4C3J J;  4AYB A;  5F4M A;  3T53 B;  2KRH A;  4G12 A;  3CCM I;  5H2F C;  2HOT A;  2OBS A;  4B8X A;  3GQB A;  3P27 A;  4PGH A;  2ZJP F;  2ZXH A;  4BE0 A;  2F6C A;  2OD5 A;  5ICC A;  3A03 A;  3CP2 A;  1W36 C;  2W6J A;  1BI0 A;  3DKW A;  2R7U A;  2IQ7 A;  4W8R A;  1ETW A;  2YR2 A;  1QGP A;  3J7Y J;  3K2A A;  1DU0 A;  2HEO A;  4G94 A;  4LGW A;  1YI2 I;  1BI1 A;  2FQ4 A;  2C2W A;  3D26 A;  4BPR A;  5FRM A;  4B3G A;  5L3F A;  4PK4 A;  5FGM A;  4HRI A;  2XZO A;  3DU1 X;  5BS6 A;  3S17 J;  1IN5 A;  4ABZ A;  1EH7 A;  5ICG A;  4JYK A;  1YIT I;  3RJP A;  4HBL A;  1W7P D;  1REP C;  2DK5 A;  2GA2 A;  4E7I A;  4RCY A;  1VLY A;  2CG4 A;  1SD6 A;  1QNT A;  3BH6 B;  1Y1W J;  1Y39 A;  3MD2 A;  1GHC A;  4ZTF A;  2P5K A;  4TSF A;  5LMZ A;  2LBF A;  1IUY A;  4LD5 A;  2OF7 A;  3OPO A;  2NTP A;  3ML3 A;  2QQA A;  1IN4 A;  2DFE A;  3MEX A;  4P9S A;  4Z4R A;  2IS6 A;  4Y13 A;  2FE3 A;  3HC7 A;  1R7J A;  2BBY A;  3GZ5 A;  4D7M A;  4AF7 A;  5GAE J;  3Q39 A;  3JX8 A;  2GJK A;  5FJ8 J;  3QWL A;  1HKQ A;  4HX7 A;  1S7E A;  2Y48 A;  4OOX A;  4ZZD A;  4XRS G;  2QX3 A;  1B8I A;  4RD6 A;  1KON A;  2CS3 A;  3OR2 C;  4DJA A;  3AL0 B;  3ISX A;  2CUF A;  4GDF A;  2XB5 A;  3B02 A;  1ITY A;  1D1A A;  5A88 A;  1CNE A;  5F4O A;  2O6W A;  2AS5 F;  4YG2 F;  2GQF A;  3TL4 X;  3KEW A;  2LFB A;  3NAW A;  4EW9 A;  4CIC A;  1L1I A;  4KA4 A;  3FJO A;  2X4H A;  5FKO A;  1WSV A;  5FD6 A;  2RRE A;  4ZV4 A;  2V26 A;  2ZXI A;  3RI4 A;  2LRD A;  3ZMU A;  1ZLK A;  1WGX A;  2A68 F;  4N4O B;  3Q38 A;  1W1W E;  1G3S A;  3E6C C;  3VO2 A;  2GBY A;  3G1L A;  4HLX A;  3KZY A;  3FX3 A;  2HQN A;  3WHC A;  4UUV A;  2DLL A;  3WE2 A;  2CF4 A;  1W87 A;  2VT2 A;  1OKR A;  1QZE A;  3O3K A;  2BW3 B;  3SDG A;  4A6E A;  4UZU A;  2M7B A;  3F72 A;  2L7F P;  1K61 A;  4F52 A;  2XF7 A;  3DBH B;  2DT6 A;  3WY9 A;  1TYX A;  3CMM A;  4B3F X;  2VQC A;  1HBX G;  1F60 A;  1FPQ A;  3B6C A;  4RB2 C;  4UHT A;  1LLZ A;  1KTW A;  1KQ0 A;  1ZAO A;  3H9N A;  5E3M A;  4L0Y B;  3OS2 A;  1SKQ A;  2D3N A;  4L9J A;  5TR9 A;  2W57 A;  5JLW A;  4RS8 A;  2GK6 A;  3BG6 A;  3CCY A;  2R7V A;  3SEZ A;  2IPQ X;  3GTQ J;  2IGO A;  1IXR C;  1F9N A;  1BN5 A;  5E8I A;  3BTI A;  3G05 A;  2OK7 A;  1MNE A;  1UG2 A;  2FBI A;  3VOD A;  1FMV A;  1ETV A;  2LLK A;  5FNZ A;  2IP2 A;  3CTA A;  3MVP A;  1TNT A;  2XKO A;  3GTJ J;  4OAY A;  2XT2 A;  4TN1 A;  3BZ6 A;  1LEA A;  5HLI A;  1ZAR A;  1T2K A;  1O3S A;  1YG2 A;  2LKS A;  5EZH A;  2E5N A;  3KP5 A;  1TYW A;  3F8C A;  3QFS A;  2WA0 A;  4V2F A;  2HDD A;  3S15 J;  1S29 A;  2NS8 A;  2VXD A;  4A3E J;  1VQ4 B;  1FNB A;  3A0B C;  3FXU A;  2NAZ A;  3LSH A;  1ZM2 A;  2CGP A;  1RKW A;  4HST A;  5GP9 A;  4ESF A;  4L18 B;  4LC0 A;  3CMA B;  1HLV A;  1R5I D;  1N78 A;  4DQK A;  5H6R A;  1EE6 A;  2PMZ A;  2O8K A;  2BOL A;  3LSG A;  1F5T A;  5FLV A;  1AA7 A;  4DQL A;  1T56 A;  2DOD A;  2FOK A;  2A61 A;  1T6Z A;  2X0L A;  3E6M A;  1JGG A;  2NV4 A;  4YXW A;  2DN0 A;  5DUK A;  4CCL A;  4A69 C;  3CUQ A;  2COB A;  4KJZ A;  1QGA A;  2IVM A;  4DK0 A;  2G0E A;  3MZY A;  4Y33 A;  4WWC A;  3DPU A;  3S3M A;  4JRA C;  1JTX A;  5CVR A;  4MTE A;  4ETS A;  2QSG X;  2CW5 A;  5L3B A;  1OYI A;  2PMH A;  4UB6 C;  3JRD A;  4OIP F;  5E17 F;  1BPL A;  3WYA A;  3CCS B;  4RGX A;  4MIM A;  2XGX A;  2UVF A;  4G7O F;  2BF4 A;  4A0X A;  4EEF G;  2CQQ A;  4EGY A;  2KIS A;  2K85 A;  4ZJZ A;  4KUM A;  2DOA A;  1E3H A;  4P12 A;  2BHZ A;  1U5T C;  2ZME A;  4PAA A;  3ZBT A;  2EV0 A;  2VT3 A;  3R0J A;  1DDN A;  3GO5 A;  3AG3 H;  1IN7 A;  2GM4 A;  3RIQ A;  2X6X A;  2CRG A;  2F4O B;  4ZGN B;  1K28 D;  3PFY A;  2JUG A;  3F6O A;  1MBG A;  1Z1D A;  2E34 A;  3N90 A;  2FXA A;  2JZY A;  4WX9 A;  1VQ5 I;  1Y0U A;  4HNV A;  1T0F A;  4ASU A;  2A6H F;  2HGC A;  3GVA A;  4BBS J;  1O8J A;  4E6K G;  1PUF A;  4AIK A;  1BOA A;  4XRF A;  3K10 A;  2YU3 A;  3GFI A;  3GTK J;  3BY2 A;  3QOP A;  2K9N A;  4RBO A;  3G71 I;  2H1K A;  2PG4 A;  2PBI A;  3VDX A;  4HNU A;  4E7H A;  4UNO A;  4YZA A;  3UW0 A;  3WTU C;  3W2F A;  1KQS B;  3TH0 A;  3KYC B;  2DT7 B;  1HCR A;  1VQ6 I;  3E5Q A;  1KU9 A;  1VQO B;  2RAE A;  4V19 K;  4OOS A;  3LSM A;  5JVG F;  2ZTG A;  2QLZ A;  2HKO A;  4R71 A;  2XAG A;  3B6A A;  2I1L A;  2G9W A;  2H6C A;  3U2R A;  3T1B A;  3FXM A;  5J3L A;  3ASN H;  4M74 A;  4XLH A;  1UD5 A;  2FVG A;  3BH4 A;  1JJ2 B;  1DBO A;  3MHP A;  1VQN I;  5JR3 A;  2XSD C;  1JNY A;  1WI3 A;  2V4D A;  2MD0 A;  2QBY A;  1TVC A;  4X07 A;  1I50 J;  1ZGJ A;  3FIS A;  2O5R A;  2OZ6 A;  1RIO H;  1P4M A;  3K4M A;  4HDU A;  4C2U A;  1YOV B;  3OYI A;  4NBS A;  2VOD A;  5LGU A;  1R58 A;  3HOV J;  3RY8 A;  3TO9 A;  2XZL A;  1HG8 A;  3H3Z A;  2RQQ A;  1YQA A;  3EUK L;  3KP3 A;  3ERE D;  5B3S H;  2E1R A;  3WXM A;  3IL2 A;  1IXC A;  4IQ4 A;  4HE5 A;  1P4X A;  1SC7 A;  2DMN A;  4UUS A;  1ZR4 A;  4WZK A;  2B0R A;  3O2P E;  1RKT A;  1AHD P;  2Y9Y A;  2F1M A;  2LMD A;  1G2H A;  4S05 A;  1TWH J;  1UD2 A;  3CCR B;  2M0C A;  4NDL A;  3OZV A;  2QTZ A;  3A3B A;  2PMZ N;  4DNR B;  5GAD J;  1LVA A;  1POG A;  4YDT A;  2C78 A;  1MH4 A;  1QPI A;  3W2E A;  1VQN B;  4DZJ A;  3I55 B;  2XRO A;  2W4S A;  4XQF A;  1MSF C;  1W5T A;  3I9V 2;  1QGY A;  2IOU G;  1K4S A;  4GCV A;  2X1C A;  4OAZ A;  1STZ A;  4MEY F;  1O57 A;  1BIB A;  3I64 A;  1XE1 A;  1Z05 A;  4U9U A;  3CJN A;  2MC3 A;  3HOW J;  1XMX A;  3F9K A;  1A5J A;  2KVO A;  4P6V F;  5B1A H;  1Y1V J;  2JVH A;  1R5H A;  4XNF A;  2ZBV A;  1ONV A;  2KZG A;  4LK1 F;  4BAC A;  3OL3 A;  4X7D A;  3VNV A;  2CU7 A;  3KP4 A;  3T51 B;  5IYQ A;  3H0G J;  4IPA A;  2QXZ A;  4X06 A;  2XAU A;  2EA4 A;  1Y56 A;  3X2Q H;  5HVQ C;  4HF1 A;  4ZZL A;  2CV0 A;  2XC1 A;  5EEA A;  4II2 A;  2DDB A;  3SFZ A;  1OGJ A;  2FX3 A;  4OJL A;  5LRS A;  4PC2 A;  2ECB A;  3A8I A;  1S8N A;  1ZTR A;  3NB2 A;  5E3L A;  3TW6 A;  1FLI A;  2QSH X;  1BC7 C;  5EGO B;  1QRB A;  1F1Z A;  3CO7 C;  2M1B A;  4EJU A;  3D0S A;  2R6H A;  2W84 A;  4CO8 A;  1FYK A;  1OQY A;  2VFP A;  1KZL A;  1A8P A;  2M45 A;  2X1E A;  1RMG A;  1TW2 A;  2EV6 A;  3F3X A;  2WAE A;  1MBF A;  2V7F A;  2OTJ B;  1KU3 A;  1R1T A;  4XM3 A;  3WTV C;  1TL8 A;  2DQR A;  2YUS A;  4TT3 A;  3EQL F;  3HRS A;  3L00 A;  2DA7 A;  4FN5 A;  2RC5 A;  3A8K A;  1O8E A;  1Z0X A;  2P0W A;  2AXL A;  5FRN A;  1ELO A;  3DXJ F;  3TO6 A;  3H9Q A;  3VSK A;  1GXP A;  2UVE A;  3FMR A;  3OYE A;  3F6V A;  4YZ0 A;  3HGY A;  2ADU A;  4HQE A;  2QN6 A;  1E17 A;  1SAU A;  3Q0V A;  2XRN A;  3GTO J;  2XF6 A;  1T6Y A;  1NRK A;  3EUH A;  2GPJ A;  1D1N A;  1X58 A;  3SHF A;  2CH0 A;  1SFK A;  3HSR A;  3UKG A;  1WZ2 A;  3HOZ J;  3QFR A;  4GQN A;  4CZC A;  3BQJ A;  3LJY A;  3QP6 A;  4V02 C;  3A0H C;  5JHU A;  4X7C A;  3HOX J;  5E18 F;  4DYQ A;  2R7W A;  3OYB A;  2BGJ A;  3EYI A;  3EUA A;  1UMQ A;  3LFU A;  1P92 A;  5ICF A;  3OYK A;  3FXR A;  3A3G A;  5FA6 A;  2XDV A;  4FIS A;  3PET A;  1A04 A;  2MH9 A;  3KPH A;  1C0W A;  4F3Q A;  1LQ1 A;  1I8D A;  1QQI A;  3HOS A;  1WOP A;  2VBU A;  2JSP A;  1XB4 A;  3CDI A;  2RNJ A;  3RCO A;  4YIF A;  2NVT J;  3F8B A;  3G6E B;  4LG3 A;  3IH3 A;  2CFO A;  4IXA A;  1S72 B;  3H1C A;  3ZP5 A;  1KK1 A;  5BOX A;  3PIP F;  2BXY A;  2V79 A;  3V8K A;  5J40 A;  4PSW A;  1HKS A;  1IN8 A;  2IBD A;  4NQW B;  5EF6 A;  1HA8 A;  1MD0 A;  1I3A A;  1RZ4 A;  1BI2 A;  1PJ6 A;  5HLH A;  2NNN A;  3ES9 A;  3KFW X;  1TYU A;  3BP8 A;  4OZZ A;  2OK8 A;  2YX4 A;  4BE1 A;  4UY8 I;  4L5I A;  1OCO H;  1TC3 C;  2XT4 A;  3SY2 A;  3EYY A;  3KYL A;  2UZK A;  1BR1 A;  4IKF A;  1E1R A;  3QE2 A;  2HQR A;  3U21 A;  1QJV A;  2V6C A;  2ZZG A;  4AUX A;  4OIQ F;  1L0O C;  2QQ8 A;  3L2W A;  1HSJ A;  5H6Q A;  3JQP A;  3FM5 A;  5IOY A;  2NVX J;  4O5V A;  2VPL A;  2LOO A;  2VBK A;  2WYR A;  4I7H A;  4CGZ A;  2D74 A;  3OS0 A;  1HC8 A;  4O3M A;  1K8A D;  2ZBK A;  1S72 I;  4BUP A;  2ZZQ A;  1U8B A;  3R61 A;  3CJR B;  2F4I A;  4U0Y A;  1R1U A;  3ABT A;  4YIR X;  2R5Z A;  3FKJ A;  2EWE A;  2FA5 A;  4DBQ A;  4M53 A;  2FNP A;  4TKO B;  4KKS A;  1VLO A;  3VYT B;  2AO9 A;  1JUM A;  4CUG A;  4MLO A;  2NOJ B;  1E43 A;  3TDZ C;  4HX8 A;  1ZHF A;  3CCL B;  1A35 A;  1OOC A;  1ZG3 A;  5DD8 A;  3MQ0 A;  2NYX A;  3IC7 A;  2L9V A;  3H0D A;  3H3V K;  1Y8Q B;  3IKT A;  3OV8 A;  3FF5 A;  1XSV A;  2BYV E;  3HIF A;  5KK1 A;  3NEU A;  5FFZ A;  5IP9 J;  3LNN A;  3S3O A;  2JK3 A;  3LMW A;  2LY2 A;  5HOD A;  4YAW A;  2A3S A;  2K7L A;  3VWB A;  3TO7 A;  2BEO A;  1JKQ C;  3G1M A;  1TBX A;  1TT5 B;  1LB2 A;  3BNW A;  1WJA A;  4AF6 A;  1T38 A;  3QFT A;  3TED A;  3PVD A;  1KCC A;  4JX5 A;  5K1Y A;  2QEN A;  4LK0 F;  2V1N A;  1ON2 A;  4MHG A;  3HDD A;  1EP3 B;  1EA0 A;  5K5O A;  2M5W A;  3LSJ A;  2ICW G;  4JBA A;  2JJ2 A;  1QRC A;  2HI3 A;  3JSP A;  5L46 A;  4NBQ A;  2FUG 2;  5J1R A;  5JMC B;  2WBM A;  1O8I A;  2OYN A;  3PO2 J;  2UXN A;  3FHZ A;  1EFR A;  1UHM A;  1PP7 U;  2DOG A;  4Q5S F;  5FO1 A;  3BG5 A;  3GUD A;  4L9N A;  2O0Y A;  4BXU A;  5EGO A;  2ZZE A;  4A3G J;  4RLZ A;  3NAR A;  3H5N A;  4YEL A;  1EH8 A;  4G6I A;  4P22 A;  2R0Q C;  1E3X A;  1UD8 A;  2F4N A;  2JTV A;  3ZMT A;  1JI8 A;  1K9M D;  2J8I A;  4CH7 A;  3JU4 A;  1CZF A;  2P7C B;  5LFA A;  3S3N A;  4B47 A;  1FP2 A;  2XB0 X;  2PQ8 A;  2VON A;  4FT8 A;  3WGG A;  1WRJ A;  3ZMD A;  4Q4Z F;  2F48 A;  2XPV A;  3BR5 A;  1MMN A;  2VQG A;  3HUG A;  4YII A;  1X3U A;  3ZN0 A;  3M7G A;  2XAF A;  2VFM A;  4N4N B;  2JN6 A;  4IJA A;  1LE8 B;  4RMN A;  4XD7 A;  4E7L A;  2X85 A;  3J81 K;  1J5Y A;  3HYI A;  4II3 A;  4PGG A;  2CW7 A;  2M5S A;  4HF0 A;  2B7C A;  3T9G A;  3BY6 A;  4J0Q A;  4Z05 A;  1YHQ I;  1FTZ A;  2CW0 F;  3I56 B;  3VYR B;  3OY9 A;  2XGC A;  1I6H J;  3NE5 B;  4HYE A;  3BJ6 A;  2P6T A;  4F93 B;  2WR8 A;  3I4P A;  1XMK A;  1OFD A;  5JLX A;  3BLY A;  3V76 A;  1FOK A;  2DET A;  4LG0 A;  1JE8 A;  3ERM A;  3P9I A;  4BHP A;  2EFP A;  2HXO A;  2EIX A;  4EJV A;  1S0U A;  2HDN B;  1DGW Y;  3LQ6 A;  4WF2 A;  2PIA A;  4ASN A;  1Z3X A;  3BR6 A;  5HS7 A;  4XLC A;  1HKT A;  4XKW A;  1SD7 A;  2EWN A;  2KIQ A;  2Q6K A;  3PQK A;  5KVR A;  3GQA A;  1QUF A;  3I0T A;  2K9Q A;  1OFC X;  3WGI A;  3WND A;  4UV8 A;  4UVA A;  3HUG B;  1E3P A;  1QFZ A;  1FJL A;  4BS9 A;  3TBI A;  2MH2 A;  3MKZ A;  4W1U A;  2VJ5 A;  4AU7 A;  5HDK A;  1KYZ A;  3GTP J;  1GQ8 A;  2G7H A;  3MWM A;  1JKO C;  1W35 A;  3V42 A;  1YJ9 B;  3M3Y J;  1J2X A;  2EIJ H;  5FB2 A;  2YWH A;  3BY1 A;  3OKX A;  2V7U A;  3EUH C;  4IHY A;  2BSA A;  3IRR A;  2V7X A;  5D6E A;  3PL8 A;  4RAF A;  4WWV A;  3BJA A;  3LL7 A;  1HF0 A;  3FMS A;  4LBW A;  2PFB A;  1XDU A;  1GV2 A;  1PVE A;  1WJ5 A;  3QAH A;  2X1D A;  2HWV A;  4P55 A;  1GO2 A;  4KNY A;  1TSP A;  3IUO A;  3W6J B;  3W6K B;  2R7O A;  3M07 A;  2V7T A;  5LEJ A;  1LDD A;  3S1R J;  2BMW A;  4UV9 A;  4YAO A;  3GQ7 A;  3S32 A;  5IT3 A;  1GXQ A;  1FTT A;  1ACI A;  1K4T A;  4ON0 A;  3LO8 A;  5HKK A;  4I0A A;  2E60 A;  3PM1 A;  1HW1 A;  4YRV A;  5DM6 F;  3R6S A;  3ONQ A;  5EDN A;  1QFJ A;  1K83 J;  3RPU A;  2ZJ2 A;  1JUP A;  3L1P A;  1FP1 D;  2C6Y A;  3OYF A;  3JCU C;  3ZPP A;  1OIS A;  4AD9 A;  4FQG A;  2L3D A;  1I1S A;  2M3A A;  2HLD A;  2TDX A;  1GJR A;  3AGP A;  1TNS A;  2KDZ A;  2ZSI B;  3HZJ A;  2JRT A;  2YUH A;  1EFT A;  1XX5 A;  2EJR A;  1W7P B;  1LDK B;  4E70 A;  2HU9 A;  1NBM A;  4Y7N J;  1IW7 F;  2OTL I;  5HLT A;  1ETQ A;  1KYW A;  3C18 A;  2VUM J;  3FMQ A;  3CDL A;  4M3F A;  4ZGQ B;  2M7A A;  1SFO J;  1T0F C;  1ZG5 A;  3CCU B;  2DEU A;  3DTK A;  2HFH A;  4HEA 2;  3KP6 A;  4OPW A;  3U2Q A;  4EM2 A;  4P25 A;  2CWE A;  3SKB A;  4XIC A;  1EWY A;  4D1Q A;  1KMH A;  1QVG B;  1TP4 A;  1FOW A;  4ESJ A;  2OAZ A;  3ZN1 A;  2FNA A;  3DLL F;  5J8C A;  3CD6 B;  4MFD A;  3CD6 I;  2O03 A;  1K79 A;  1U3E M;  2HVS A;  1PJ5 A;  3DF8 A;  2DO7 A;  2CC2 A;  2BSP A;  5C3E J;  1ZLJ A;  1T6X A;  2FQ3 A;  2H27 A;  2EZK A;  2QKL B;  4EJO A;  4RB3 C;  1HST A;  2BE5 F;  2KIF A;  1IV8 A;  3MKL A;  2O3F A;  4BKX A;  2K5C A;  2WSS A;  2VJI A;  2EPF A;  2VBT A;  1GVJ A;  2OCE A;  2UXX A;  2ZBU A;  4RGU A;  4RPB A;  3FXQ A;  3E7L A;  2ZC2 A;  3BR0 A;  1Z91 A;  2M4G A;  3REO A;  1I6X A;  4E7J A;  1E79 A;  2HXI A;  2F5V A;  1AMO A;  1VQM B;  1V55 H;  2DDA A;  2A5Y B;  2W82 A;  1ZG1 A;  2R7F A;  3GVL A;  1T6S A;  2ZL5 A;  4HLY A;  4MTD A;  1FSH A;  4XN3 A;  3OYG A;  4BDZ A;  3QYB A;  1UMK A;  5FLX K;  3WOD F;  2XPW A;  3K9T A;  2R7Z J;  2EBI A;  3J7Z I;  3K2Z A;  4X6A J;  2LRE A;  2Z3Y A;  3SJZ A;  4E7K A;  1QQ1 A;  3VST A;  4BXF A;  1FC3 A;  2ETH A;  4QLC U;  1IC8 A;  4G1V A;  1DP3 A;  2JA8 J;  4RGR A;  3JTG A;  3HOY J;  3LMM A;  2DJN A;  4Z4T A;  5H20 A;  3RQI A;  4RCZ A;  3ZC3 A;  4CXF A;  2VBZ A;  1YJW B;  3RIR A;  1G59 A;  2XEX A;  1B72 A;  1O3Q A;  1JJ6 C;  2LR8 A;  1IDY A;  1OHH A;  3LFK A;  1VF7 A;  4RB1 A;  2KKO A;  1KD1 D;  3AVT A;  4YAU A;  2INV A;  3ZSC A;  4JOM A;  1NK2 P;  2KMU A;  3Q3A A;  2INU A;  2VKE A;  2Y9Z A;  2V1U A;  1W9X A;  4ZCM A;  3BH7 B;  2X9D A;  1YRN B;  2IS4 A;  1ZN2 A;  3Q9S A;  1ON1 A;  4PC7 A;  2JQ7 A;  2ZO4 A;  2W24 A;  3HTS B;  1RI7 A;  2M30 A;  4U88 A;  2LKX A;  1OB0 A;  5CQG A;  3VMV A;  3MMY B;  4IOA F;  1HA3 A;  4TMT A;  3ONU A;  2E36 A;  2Y0M A;  5ILV A;  3K1P A;  2PYH A;  2AQE A;  2K27 A;  1MBH A;  3Q0U A;  5D5W B;  4YZQ A;  3Q0W A;  1MJA A;  2BY0 A;  2WV0 A;  3OSF A;  4RM0 A;  2HOA A;  3R6J A;  1QPM A;  1FSE A;  1N77 A;  2P3M A;  3HPH A;  3A2K A;  3LWF A;  4PJJ A;  2NVU B;  3AVV A;  2LF8 A;  1UAA A;  4CCJ A;  3S1Q J;  5IK2 A;  1CF7 B;  5FO5 A;  2ESN A;  3GVK A;  2R92 J;  1OR7 C;  2QGU A;  2NXN B;  2VBE A;  3RKX A;  3DFG A;  2XAH A;  4EH1 A;  3KL9 A;  3JAM K;  5IYD J;  4OPS A;  1VQ9 B;  2LH9 A;  1YJN I;  1USS A;  2HOE A;  2BVM A;  2MA3 A;  1I3Q J;  2OV7 A;  1B72 B;  4A0Z A;  1T33 A;  1PDN C;  5F64 A;  4HNT A;  3KET A;  3VR6 A;  2BHY A;  4J01 A;  1WXR A;  3OFN A;  2V31 A;  3GRH A;  3ABU A;  4LJZ F;  1UD4 A;  4XLE A;  4ZYH A;  3HJE A;  4KIC A;  1ODD A;  3R0A A;  5J4Y A;  2CBX A;  4LIT A;  1UHW A;  1OB2 A;  2R5Z B;  3BT9 A;  2NTQ A;  2L4A A;  2NOG A;  5FFX A;  4FTH A;  4Q48 A;  1PJ7 A;  1W4M A;  3WNB A;  1TYV A;  1IZ1 A;  1K78 A;  1U6G A;  1Z77 A;  4L5E A;  4HV5 A;  4PJM A;  2GIV A;  3ZQI A;  2QM3 A;  3AG2 H;  4QFM A;  5F08 A;  2DT5 A;  1VFC A;  5HDN A;  4I76 A;  4KFC A;  1S7A A;  1MBE A;  2KJC A;  2ID3 A;  3ABL H;  2NVQ J;  3WU1 B;  2FML A;  4BEH B;  4LB6 B;  2GAU A;  2A69 F;  1RC9 A;  1TUI A;  3VMF A;  4IHX A;  2ZTN A;  4A3D J;  1P4W A;  3JRC A;  3K69 A;  2L4M A;  2KJB A;  5M5Y J;  3FWE A;  3NQO A;  1B9N A;  4GYI A;  3IHU A;  2B7B A;  2IA0 A;  1A31 A;  2CK3 A;  4F7D A;  4ZH4 F;  1M1E B;  5FL7 A;  1B6A A;  4BHB A;  2JA2 A;  1E2X A;  1WQ2 A;  1J09 A;  2C5B A; 
#chains in the Genus database with same CATH homology
 3OYD A;  2IS2 A;  2R9V A;  4HIZ A;  4BL0 B;  1IDK A;  3F9K A;  2KVO A;  2JVH A;  4XNF A;  4DGW B;  3E1S A;  4P5O A;  3KRG A;  4BAC A;  1O8D A;  3OL3 A;  1O8G A;  3PSF A;  3BCD A;  4JQF A;  3T51 B;  4DNT B;  2X6W A;  3PNY A;  1OLT A;  2VL8 A;  4XR6 A;  3FKS A;  2QXZ A;  2XAU A;  3M1C A;  4BJ6 C;  1Y56 A;  1V5G A;  5HVQ C;  1DBG A;  2CV0 A;  4BJ5 C;  2DXI A;  1H8H A;  4II2 A;  3FBN B;  4IZZ A;  2CUZ A;  4OJL A;  1NG6 A;  4QPO A;  1K6Y A;  4DBR A;  3OYM A;  2PJR A;  1PE9 A;  4G7X A;  1Z7L A;  2WAF A;  3K4J A;  1VBL A;  1H8E A;  2XC7 A;  1BHE A;  1MMA A;  3OR1 C;  3FBI B;  1WJE A;  1OGM X;  1KZL A;  1X1A A;  3ZRG A;  4OJO A;  2X1E A;  2AQF A;  3UNG C;  2VQH A;  1RMG A;  2WAE A;  1N75 A;  2BVL A;  4F55 A;  2V7F A;  1MAB A;  4XOR A;  4XM3 A;  1HZE A;  3HAG A;  1ERD A;  4TT3 A;  2KHM A;  1O8E A;  2LYC A;  3GQ8 A;  1W0J A;  4ZTJ A;  5FRN A;  2K9L A;  2P0W A;  3VSU A;  4PFP A;  3OYC A;  3H9Q A;  3SEQ A;  3VSK A;  3L2U A;  2PJR B;  2LZJ A;  2WJV A;  1O8L A;  2UVE A;  4L8J A;  2DCE A;  4HPQ A;  3OYE A;  1KCD A;  5TGT A;  2HPI A;  4YZ0 A;  3OIP A;  3B4N A;  1SAU A;  2IGK A;  1IB4 A;  2XF6 A;  4MXN A;  2E1M B;  1NRK A;  3DTI A;  3OYL A;  2VJJ A;  2QE7 A;  2CH0 A;  3S93 A;  3JUR A;  1SFK A;  4GQN A;  2GJR A;  3WWG A;  4CZC A;  1MND A;  3OOC A;  2X3H A;  1IA5 A;  3HPG A;  4CCO A;  3NWS A;  5FRO A;  2VLA A;  1WFX A;  3CF2 A;  4XOP A;  3ZPN A;  2R7W A;  1O8M A;  3SUC A;  3OYB A;  3EUA A;  3LFU A;  4HWV A;  4XLF A;  4F92 B;  2R4G A;  3OYK A;  3A3G A;  2XDV A;  3MKW B;  4CA0 A;  1WP6 A;  4F3Q A;  4ZDO A;  1I8D A;  3H94 A;  1LKX A;  3HOS A;  3B8Y A;  2OUM A;  2JSP A;  3W2V A;  3C2H A;  3DKX A;  4J00 A;  3RCO A;  4BQN A;  2CUJ A;  3FDY A;  2WY7 Q;  1LVK A;  4LG3 A;  3BC8 A;  3HOT A;  2CFO A;  1YE9 A;  3D5L A;  1FMW A;  2WAQ A;  3IAS 2;  5KNL A;  3KEY A;  2I8D A;  4NQW B;  4PSW A;  3OS1 A;  1HA8 A;  3OW7 A;  4KKT A;  3IP4 B;  2MC4 A;  3ZQQ A;  4Z06 A;  4OZZ A;  4FXU A;  1PKV A;  4BE1 A;  1O8F A;  3SYT A;  4NNJ A;  4PUS A;  1YX5 A;  2JIZ A;  1P9Q C;  1D1B A;  3KYL A;  1BR1 A;  4D9J A;  4GRI A;  4IKF A;  1E1R A;  2V9K A;  3U21 A;  2Z8G A;  1QJV A;  2ZZG A;  2GOM A;  1X0C A;  3DWL E;  3H35 A;  4XLA A;  4B43 A;  3L2W A;  2E1B A;  1NG7 A;  2NTB A;  1X19 A;  3OMY A;  1MMG A;  3K4L A;  2VPL A;  2LOO A;  3SZG A;  2VBK A;  3OS0 A;  1X1B A;  2Y0S A;  2V7Q A;  4Y4R A;  1PJR A;  4BUP A;  2ZZQ A;  3EQO A;  5LD2 C;  3AFH A;  2F4I A;  3CJR B;  3RPU D;  3ZR8 X;  1VZ0 A;  2Z6B D;  4JMQ A;  1U0J A;  3FKJ A;  2EWE A;  4ANJ A;  4DBQ A;  4TKO B;  1G8X A;  4KKS A;  1BMF A;  2W1O A;  4U7B A;  3VYT B;  3OYN A;  4CUG A;  1EA3 A;  1K5C A;  4MLO A;  2NOJ B;  1E43 A;  1W0K A;  3CJQ B;  3DEE A;  1E3Z A;  2HVQ A;  1OOC A;  5CPR B;  2R7S A;  3QYE A;  2Z1D A;  3HXL A;  3H0D A;  2HVR A;  4HG2 A;  1RU4 A;  4PJN A;  2R7T A;  4ZDL A;  3VYU B;  2NT9 A;  3LNN A;  3HL2 A;  3S3O A;  1I18 A;  3LMW A;  2LY2 A;  2LY1 A;  3W3C A;  3VWB A;  1V5E A;  4OJP A;  2WAD A;  1YX3 A;  2O17 A;  4YZX A;  1PLU A;  1WJA A;  2XND A;  3A1Y A;  3M8J A;  2JDI A;  3EPZ A;  1KCC A;  4PFO A;  4FAS D;  2V1N A;  3CZ6 A;  3HKZ A;  2X8K A;  2CV2 A;  1X4O A;  4OAZ A;  3L2R A;  2JJ2 A;  3A4C A;  2JVG A;  2VQL A;  3L2V A;  4Z03 A;  1DGR M;  3PSI A;  4PMH A;  1QHH D;  2IGN A;  2FUG 2;  1O8K A;  3K4K A;  2WBM A;  1O8I A;  3RTR A;  1EFR A;  3ZIA A;  4XON A;  4DOZ A;  2V6E A;  2ZZE A;  2HZD A;  4HSR A;  1D0Y A;  3H5N A;  2F43 A;  2LBF B;  3DLA A;  4YEL A;  4E0F A;  3K4N A;  4G6I A;  4P22 A;  4PJL A;  3PUB A;  1E3X A;  2K9M A;  1UD8 A;  3EQN A;  1JI8 A;  1TZL A;  4CH7 A;  3JU4 A;  4ZDP A;  4Z1M A;  1CZF A;  5C1C A;  2M4K A;  5LFA A;  3S3N A;  4B47 A;  1V5F A;  2IS1 A;  3H5A A;  1Y6I A;  4U4B A;  4E7Z A;  1LFP A;  4ITV A;  4IX7 A;  4XL9 A;  4AVZ A;  2L7K A;  1UD6 A;  3VYS B;  1MMN A;  2VQG A;  4W8S A;  4BQQ A;  2O1D A;  4CCN A;  2R7R A;  2W00 A;  2E5Z A;  4N4N B;  1WJF A;  4RMN A;  4XD7 A;  1D0Z A;  3OWT A;  2VB6 A;  2X85 A;  3OYJ A;  4E7L A;  4II3 A;  1COW A;  2CW7 A;  2M5S A;  2NT6 A;  1T5E A;  3T9G A;  4C2T A;  1W36 D;  2WZP P;  2ZFU A;  2L2O A;  4Z05 A;  4E7S A;  3GBG A;  3QOE A;  2KLO A;  2KPM A;  3H9G A;  3VYR B;  3OY9 A;  3NE5 B;  3GVJ A;  5HNF A;  2MFZ A;  4F93 B;  3K6G A;  2QY1 A;  4Y3O A;  3BLY A;  3D5S C;  3AKZ A;  4BGD A;  1V0F A;  2L5Q A;  2HDW A;  1VJS A;  2DJI A;  3OL4 A;  2D3L A;  3ZGK A;  4R79 A;  4PSX A;  4U49 A;  2VKH A;  4QPQ A;  3BG7 A;  1WTH D;  1Z21 A;  3GQ9 A;  4NC8 A;  1IRX A;  1DGW Y;  4W8Q A;  2OC6 A;  2A6T A;  3KX2 A;  2NST A;  2VJ4 A;  1Z3X A;  2VIX A;  3BCB A;  4BDY A;  4XLC A;  1V0E A;  2Z16 A;  3E0J B;  3A35 A;  4XKW A;  4AYB A;  3VSV A;  3T53 B;  2KRH A;  3DDY A;  3GQA A;  3OAA A;  3GQB A;  2RNG A;  2ZXH A;  2KL4 A;  3TMO A;  4CCK A;  4BE0 A;  2F6C A;  2VBM A;  1UG0 A;  2KRC A;  3HUG B;  3CP2 A;  2MYS A;  1W36 C;  2W6J A;  2R7U A;  4BS9 A;  3TBI A;  2IQ7 A;  4W8R A;  3MKZ A;  4RLQ A;  2VJ5 A;  4AU7 A;  2O0W A;  2ODL A;  1PYV A;  1GQ8 A;  5KHD A;  5AMV A;  3B90 A;  4XKB A;  2Q1Z B;  3D5R C;  3V42 A;  3ZCO A;  4B44 A;  5FRM A;  4B3G A;  1X4P A;  4PK4 A;  4HRI A;  1WPC A;  2XZO A;  1PXZ A;  4XMY A;  3EUH C;  2BW3 A;  4KIS A;  2KQR A;  3PL8 A;  1WJC A;  4EAT A;  4E7I A;  3LL7 A;  4FET A;  2R7X A;  1VLY A;  2X51 A;  3N05 A;  1WJ5 A;  2X1D A;  3MD2 A;  4ZTF A;  2L9S A;  3PNT A;  4TSF A;  2LBF A;  3IUO A;  3FY3 A;  2NTP A;  3OPO A;  2R7O A;  2Z2S B;  4G6T B;  1O88 A;  1ZEL A;  4CSW A;  3GQ7 A;  3S32 A;  4NK6 A;  2IS6 A;  3HC7 A;  5JHF A;  5HKK A;  5DN6 A;  2GJK A;  2E60 A;  4X0G A;  2UUZ A;  4DIQ A;  4YRV A;  4BU2 A;  2CW8 A;  4E4H A;  3ONQ A;  2QX3 A;  1KON A;  2CS3 A;  3OR2 C;  4DJA A;  3OYF A;  3AL0 B;  3ZPP A;  2WB1 A;  1D1A A;  4DK1 A;  4RLF A;  3WQZ A;  2M3A A;  3IAM 2;  3TL4 X;  2HLD A;  3KEW A;  4EW9 A;  1MW7 A;  2ELJ A;  2ZSI B;  1BN8 A;  5CDF A;  2RRE A;  2VAS A;  3BCA A;  2V26 A;  1LDK B;  2ZXI A;  2HU9 A;  2LC2 A;  1NBM A;  2LRD A;  2V4J C;  5HOO A;  5HLT A;  3CES A;  5HNH A;  4N4O B;  1JRG A;  2PYG A;  2LG4 A;  2CV1 A;  2M7A A;  1H80 A;  1T0F C;  3DTK A;  4HEA 2;  2O0V A;  1MMD A;  3T56 B;  2KDO A;  3OE7 A;  3W2W A;  4D1Q A;  3PNV A;  1KMH A;  3VMW A;  4C2L A;  4RM3 A;  3L2Q A;  4U87 A;  1OFL A;  2BW3 B;  4UZU A;  2M7B A;  1T95 A;  2HVS A;  1AIR A;  4F52 A;  1O8H A;  2XF7 A;  2BSP A;  2DT6 A;  1WJB A;  4W8T A;  3CMM A;  2XGJ A;  4B3F X;  2VQC A;  1WJD A;  2QKL B;  3ZXS A;  3SDB A;  1KTW A;  1HVX A;  3W2A A;  2KZV A;  3HG9 A;  2NZM A;  3OS2 A;  4OWR B;  2D3N A;  4LIV A;  2K5C A;  2WSS A;  2VJI A;  2GK6 A;  3OIQ A;  3BG6 A;  2R7V A;  2E1M C;  3SEZ A;  2IGO A;  2K3P A;  3RQ4 A;  3G05 A;  4XOT A;  1E1Q A;  1MNE A;  4LIU A;  1FMV A;  2M4G A;  3DKY A;  2Q2E B;  2IXS A;  4E7J A;  3DPT A;  4B48 A;  1E79 A;  4KT6 A;  2L9N A;  3C2G A;  2XOK A;  2F5V A;  1D0X A;  2MAB A;  1DQU A;  4OAY A;  2W82 A;  4XN0 A;  4BEH A;  2W6I A;  2X53 S;  3GVL A;  3QYF A;  2E5N A;  4XN3 A;  4CCM A;  3OYG A;  4BDZ A;  3QYB A;  2WA0 A;  2WY8 Q;  2VXD A;  1FX0 A;  1OGO X;  3OOU A;  3S8P A;  4NK8 A;  2LRE A;  2XF5 A;  3LSH A;  3OYA A;  4HST A;  2UWM A;  4E7K A;  4XKV A;  3VST A;  4BXF A;  1N78 A;  1DP3 A;  1EE6 A;  2PMZ A;  3UR3 C;  2BOL A;  3G2B A;  3LMM A;  3LSG A;  1AA7 A;  1BOB A;  3H9J A;  4YXW A;  1G59 A;  4CCL A;  3K4C A;  3OYH A;  3K4B A;  4KJZ A;  2W7N A;  4DK0 A;  3QOD A;  4Y33 A;  3LSK A;  3RSN A;  3S3M A;  3DPU A;  1BLI A;  5KCM A;  1OHH A;  1VF7 A;  3OEH A;  2INV A;  4C30 A;  1UD3 A;  3ZSC A;  1BR4 A;  4JOM A;  1X1D A;  2KMU A;  1BPL A;  2A5W A;  1BR2 A;  3I3L A;  2HQA A;  2INU A;  4BJT A;  1W9X A;  1Z3Y A;  3DTE A;  2DIE A;  2UVF A;  1QCX A;  1JTA A;  2KP6 A;  2IS4 A;  3DU5 A;  2M0M A;  1X1C A;  4ZC3 A;  4ZJZ A;  2DOA A;  1RWR A;  4C9Y A;  4G7W A;  3VMV A;  1OB0 A;  5CQG A;  3MMY B;  5CQE A;  2NSP A;  2CMP A;  4IQJ A;  2PYH A;  2X6X A;  3FHN A;  2PEC A;  2AQE A;  1K28 D;  4YZQ A;  2ZZF A;  3PFY A;  3PJR A;  2WJY A;  2JUG A;  4H4K C;  4NC7 A;  4KIT B;  1N77 A;  3HPH A;  3A2K A;  3K70 D;  2GJP A;  4ASU A;  4PJJ A;  1IDJ A;  2VXZ A;  5IK2 A;  1UAA A;  4CCJ A;  4OJ6 A;  1O8J A;  4E6K G;  4I84 A;  4ZYA A;  3OEE A;  3K10 A;  3LSI A;  3K70 C;  1UEL B;  2O04 A;  3GVK A;  5C1E A;  1OR7 C;  4HNU A;  3VDX A;  2VBE A;  4E7H A;  3BC9 A;  1QU3 A;  4YZA A;  3UW0 A;  2R7Q A;  2DT7 B;  2UV1 A;  4NUB A;  2X6Y A;  1GLN A;  2LH9 A;  2BVM A;  3LSM A;  2OV7 A;  2ZSH B;  5CKT A;  2ZTG A;  4HNT A;  4OZY A;  3VR6 A;  4J01 A;  3OFN A;  2V31 A;  1UD5 A;  3BH4 A;  3GRH A;  4URR A;  4XLH A;  1UD4 A;  4XKC A;  4XLE A;  4OJ5 A;  1DBO A;  1E0E A;  1D1C A;  1QHG A;  4LIT A;  2WPD A;  2NTQ A;  1XG2 A;  2V4D A;  4P1W A;  2MD0 A;  1R6R A;  2HPM A;  2HNH A;  2O5R A;  3AL0 C;  3K4M A;  4C2U A;  3OYI A;  1SKY B;  3MKY B;  4PJM A;  1HG8 A;  2XZL A;  4B3X A;  2RQQ A;  2XZP A;  3EUK L;  3BCF A;  2IGM A;  4BQO A;  4IQ4 A;  2QKM B;  3H5R A;  3FPP A;  4RM2 A;  1NHC A;  4BEH B;  1S9H A;  4KKU A;  3CP8 A;  4F91 B;  4BE2 A;  2F1M A;  2GK7 A;  2ZTN A;  2GOX B;  3DPL C;  3J7A Y;  3VSL A;  1UD2 A;  3DQV C;  3DU6 A;  1TT0 A;  3A3B A;  4DNR B;  2CK3 A;  2JJ1 A;  2XSJ C;  2W4S A;  4MR0 A;  4YEJ A;  4XQF A;  5FL7 A;  1OFM A;  3I9V 2;  1WMR A;  2JA2 A;  2VKD A;  3NWT A;  1J09 A;  2X1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...