4XORA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xorA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xorA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xorA02
4MXNA 2NTPA 1O8JA 4XOPA 2PYHA 3ZPPA 1DBOA 2O04A 2UVFA 1PE9A 4XMYA 2IQ7A 2QXZA 4XKWA 4YEJA 2O1DA 2NZMA 1RWRA 3LMWA 4U4BA 4Z05A 4XM3A 3VMWA 4XLEA 1OOCA 2INUA 1PXZA 2NSTA 2NSPA 4NK6A 2X85A 4YZ0A 2PECA 1IB4A 2NTBA 1KCDA 2BSPA 4XLAA 4OZZA 2NTQA 1PLUA 1KCCA 1OFMA 3KRGA 3WWGA 4XNFA 4U49A 1BN8A 1AIRA 1JRGA 1HG8A 3B90A 4W8RA 1IDKA 1EE6A 4XKVA 4XORA 2Z8GA 5AMVA 1O8KA 1CZFA 1VBLA 3VSUA 4OJ6A 3SUCA 2INVA 3GQ7A 4XL9A 4HWVA 4C2LA 4URRA 4OJOA 1OFLA 3ZSCA 1IA5A 2O0VA 1QJVA 1X0CA 1K5CA 1IDJA 4XONA 3GRHA 2ODLA 4XLFA 1RMGA 3B4NA 4OZYA 2X3HA 2O17A 1DBGA 4W8SA 4OJPA 3GQAA 4NK8A 4W8QA 2NT9A 2UVEA 3GQ8A 1JTAA 1XG2A 1KTWA 4W8TA 4YZXA 2X6WA 5C1EA 3VMVA 4XN0A 3JURA 4XN3A 4OJ5A 2VJJA 2EWEA 2NT6A 1GQ8A 1O8MA 1RU4A 3B8YA 3VSVA 1O8HA 2X6XA 1O8DA 4YZAA 4XLHA 1OGMX 1QCXA 1O8LA 3EQNA 4Z06A 1BHEA 4XLCA 2PYGA 5C1CA 2VBEA 3EQOA 4XOTA 4AVZA 4PMHA 3T9GA 2VBKA 1O8EA 3VSTA 4YELA 2QX3A 1O8FA 3FY3A 4MR0A 2X6YA 1OGOX 2O0WA 2VBMA 3UW0A 1H80A 2QY1A 1WMRA 4EW9A 4XQFA 4XR6A 1NHCA 1O88A 4Z03A 4OJLA 1O8GA 4I84A 1O8IA 3GQ9A 2VJIA 4YZQA
chains in the Genus database with same CATH superfamily
2UXNA 1OJLA 2R7XA 1IN8A 1LVKA 4HNTA 3R60A 1ZR4A 2PYHA 2DA3A 3ZPPA 5IT3A 1STZA 3A02A 3PUNA 2F4MB 3C2BA 4Y9UA 2LBFB 1JUSA 3HHHA 3LMWA 4C9YA 2DA2A 4BE0A 1IF1A 4MTEA 1IRXA 2LY1A 4E6KG 3IP4B 2KT0A 3V42A 4IHWA 2ECCA 2P3MA 1QVFB 3KLNA 5EG0B 1NJID 2GIVA 2PJPA 4KMUX 4PZJA 1FBQA 1J59A 1E79A 2BY3A 2LYCA 3WTXC 3DTEA 3SFZA 1EWYA 2B7BA 1EH6A 3FXRA 3TGNA 3KP4A 3PQJA 2TRTA 3E6CC 4WF2A 1Y39A 4HRIA 3CPXA 4IL6C 2OZUA 5DUIA 1ETXA 2BSPA 1GJRA 1XDUA 5F4OA 1WP6A 2MD0A 1H9TA 2XPUA 4EJOA 1P2FA 1IN4A 3KP3A 1VQLI 4GDFA 3K4NA 4LMYA 3ML6A 3CCUB 2PX9A 2XT4A 2LP0A 4Z1MA 1B6AA 1JKQC 5IP9J 4P12A 2JA5J 1N78A 3LSIA 2UXXA 1ETVA 1ACIA 2ZXHA 1IN5A 4DZPA 5J4VA 3G4SI 3BG7A 3QWLA 1I6XA 1SAXA 2V7WA 2QEXB 4HNUA 1E3HA 3I4PA 1IDJA 3BCAA 2XTYA 1SMTA 4F52A 4HQEA 1SVMA 3E5XA 4HW0A 4BHBA 1W36C 3GVLA 3G73A 1VQ8I 3LSJA 1WU8A 1JA1A 5LFAA 3WQZA 3ZR8X 4YRVA 3U1KA 2DJNA 1HQCA 3LA3A 2OBSA 3J80Z 3DU1X 1XDSA 2X6WA 3S32A 3BG9A 3W6VA 4X0CA 3SKBA 3M3YJ 5C1EA 3JRHA 2EIJH 3W5UA 2BYVE 2CV2A 2JPCA 1FY7A 1NBMA 2EZLA 2Z16A 2A6HF 1ZG3A 3ELKA 3MZ8A 4KT5C 2OQRA 5CQGA 3G3ZA 2I10A 3TBIA 1YIJB 5HOOA 2MSYA 1UMKA 1J5YA 3QE2A 3I64A 4LGWA 1HKTA 2DETA 2DFIA 5D4SA 5CQEA 5K7ZA 1V0EA 3V7SA 3OYNA 1DDGA 3CCVI 2CSOA 1LQ1A 1PJRA 3VSTA 4PSXA 3GF2A 1MBKA 2LFBA 3M1CA 5F08A 1Z9CA 2B7CA 3DCFA 2V9VA 1G8XA 4IXAA 5L3GA 1WMRA 3GMEA 4M6VA 3SQVA 1AMOA 4NHJA 3G6EB 4C3JJ 5LGNA 2OU2A 3CCSB 4Y7NJ 4KKUA 3BH7B 2W48A 5C44J 3H3VK 4A3GJ 2XEXA 2FXAA 3NWTA 4NB5A 2FNPA 4LJZF 4ETSA 2DFEA 4Z06A 4ZDLA 1XD7A 2JUGA 4IHVA 3OR1C 2WZNA 1O8JA 1FPQA 3ZP5A 4XOPA 2RDPA 2UVFA 2VKDA 1SD7A 1UZCA 2HZDA 3K4JA 5ICEA 1MGTA 2HTJA 4OOXA 3FXQA 4RD6A 3RCOA 2M7BA 4RGSA 2FBHA 1N07A 2XAUA 4XM3A 2OTLI 3M1EA 5FKKA 3V7AA 2XZPA 5IYPA 5FO5A 2X51A 4XRMA 3OFNA 4R1HA 3G05A 1FP2A 2OD5A 2ZMEA 4LLNA 1WWXA 1FYKA 3WNCA 1GLNA 1H89C 1EF4A 4KN4X 2STWA 1UHWA 1XGNA 2FSWA 3QODA 2ISYA 1YX5A 4I7HA 5GV8A 4UY8I 4II2A 2PEXA 2Z3YA 3HG9A 2NTBA 3S2WA 2VIXA 1R1TA 1DUXC 2V7XA 2OCEA 3OP1A 1SFEA 4WWVA 3LSGA 3WWGA 4M72A 3E6MA 5LBQA 1KD1D 3WU1B 3ZXSA 3MD2A 4I76A 2RNGA 1TQPA 3RSNA 1N08A 2BE5F 2O5RA 1BOBA 3DPTA 2W25A 4JX4A 5JHUA 4OPVA 2EH3A 2PN6A 3WTVC 3VSLA 3I3LA 1AU7A 3E7LA 4DNTB 5FJ8J 4PGOA 2INVA 4RB3C 4LBZA 1LDDA 2VBTA 3DBLB 4CYCB 2EZIA 2MH2A 1RZ4A 2HNHA 2XKOA 3SYJA 4HF2A 1UELB 5EZHA 3RIQA 4NCNA 2JA6J 4XONA 3Q3AA 2VBWA 2HYGD 1RMGA 1OB5A 1YJWI 1ZLKA 4BXXJ 2PIAA 1T33A 1FMWA 3WHCA 1E64A 1LFPA 4FISA 3ZUGA 1TNTA 1SVLA 3MCZA 2PQ8A 3F8MA 4PSWA 3L9FA 1GUUA 4K1XA 4W8QA 2QN6A 3NARA 1XMKA 4YZXA 2Z2SB 5DUKA 4OAYA 1A6IA 5IYNA 1B4AA 3DEUA 4U87A 1PVEA 4HOBA 5F0HA 3KP7A 3CMAB 4M6YA 1BJZA 4G9YA 3FM3A 3VNUA 1XGSA 1X1BA 3PNVA 3WE2A 1DP3A 4RD0A 3ZIAA 1RU4A 2DTZA 2XRLA 3FBIB 3KX2A 1OGMX 1PJ5A 4Z4WA 2IS6A 3AG2H 1MBGA 1VTNC 1S29A 2DERA 2OV7A 3ABKH 2W4SA 4JP0A 4RM3A 3L2UA 2WAFA 4PMHA 2JRMA 4LD5A 3U2RA 4DYCA 1Y1WJ 4MR0A 1NB9A 2M0CA 1Z91A 1VQMI 2HDNB 3FPPA 3JSOA 1QRBA 1LEAA 1WRJA 3I5UA 3R0JA 3V8JA 4RBOA 1I18A 3ECHA 1G7TA 4AIDA 2XTXA 3JRAA 4Y4RA 3FHZA 5EEAA 4A5MA 2ID6A 2PJRB 1O8GA 4EQQA 4ZCLA 3LO8A 2M45A 1X1AA 2WY8Q 3QP5A 2VT2A 3CQZJ 2OBRA 3N97A 2JSCA 3J7ZI 2EB7A 2C77A 1TVCA 1HF2A 2XIGA 2AQFA 2VBYA 3S93A 2CUEA 2IRFG 2R7SA 1MBFA 4OIRF 2QQBA 4AYBN 5H2FC 2EIKH 2XNDA 2YWFA 2RQPA 3CCQI 3DLAA 1KMHA 4G1BA 4CGZA 1F43A 3P26A 4A0YA 4Q5SF 3F8NA 3ZQHA 2WZPP 4IX7A 2ELJA 2OUMA 1QGPA 1BLIA 2ZL6A 4II3A 1MH4A 5CVJA 5B6IA 3KCCA 4NK6A 3U6KA 3K4KA 3OIOA 3BZKA 4I02A 3PM1A 5F6FA 4B4CA 2CFOA 2BM6A 1KCDA 2HYFA 4OM9A 5TRDA 4L9TA 2LBFA 1XGMA 3LFUA 3ZMUA 1N05A 3OYFA 2Y0SA 4XNFA 4U0WA 4B3XA 3IUOA 1DP7P 1M1KD 4BE1A 1T6YA 1G6NA 5J3OA 5HDGA 1JJ2B 3A01B 3E5QA 4RJLA 1V5VA 3T56B 4L5EA 1P92A 1MMGA 2VC0A 1TQIA 2P8TA 2QKLB 3ECOA 1P9QC 2RVCA 1ZH5A 1TYXA 2E1MB 3WG9A 4P3YA 2LG4A 1HCRA 2Y2ZA 1CNFA 5FLXK 3TP0A 2QLZA 2ZC2A 3OIPA 4A3IJ 2LVSA 2YWGA 2R5YA 3PETA 2O0VA 1OR7A 2NVUB 3D0SA 2M4KA 4X1EA 2DJIA 1TTTA 1MMDA 3VNVA 1YHQB 2IGOA 4XKBA 2V7VA 1V0FA 2DXIA 1ENHA 2A5WA 2FMLA 3DF8A 4W8SA 3PL8A 4M71A 5B1AH 1DARA 3HSRA 4LOCA 1LDKB 5D5VB 1MW7A 3HL2A 1BW5A 2UVEA 1KTWA 1WGXA 1XSXA 3I54A 3JREA 4ZYEA 1JUMA 2EFQA 3QAHA 2GXAA 2CBXA 2ECBA 3AAFA 4A3CJ 3CB4A 2NT6A 2ZBUA 3IKVA 4ZJZA 4FTHA 2QA4B 1Q1VA 4G7HF 3TO9A 3WBKA 4AM3A 1KQ5A 2P6SA 2DFHA 2OBPA 2WB1A 3FMRA 3RPUD 5DM6F 2GPJA 1E3OC 4XRFA 3EQNA 1JKRC 3S1MJ 2V6EA 2L3DA 2PYGA 3F6OA 1Y0YA 4A69C 4S05A 4EJVA 4CO8A 1SANA 1MDMA 2VYQA 1ZM9A 2HYJA 4JX5A 5F64A 5JLVC 3VEPA 2QSGX 3LAJA 3GW2A 4IPAA 4FASD 4PFOA 1KZHA 3A8JA 3HOUJ 1EFRA 2V1UA 2K9QA 2A5YB 2O0WA 2XB5A 4PGHA 1JTYA 4X6AJ 4EW9A 1VNDA 4NC7A 2JT1A 3GFIA 1LE8A 1BA5A 4YAOA 1B23P 2JRTA 1IN6A 3B6CA 5DN6A 5EGOB 3ISXA 1J7KA 3JRBA 3G2BA 3HUGB 1OR7C 1BR4A 4NNJA 4MXNA 1RR7A 5BMZA 4PABA 2NTPA 3GFLA 2O0YA 3I9V2 3L2CA 1K78A 5F4JA 2HWVA 1IDZA 1ZQ3P 3KE2A 4PUSA 4QHYA 2E60A 2VB6A 4B09A 4HSTA 1GT0C 1RWRA 4LG0A 3W6JB 1FP1D 4UXNA 5IT9Z 3G71B 2VQLA 2NVQJ 2CO5A 5HZBA 1TT0A 5DS9A 3K2AA 3V4GA 4HV6A 1S6LA 3H94A 1SMYF 4HF0A 2O6GE 4DQLA 5J35A 1KU7A 4X7DA 4PK4A 5FGMA 2J8IA 3H9GA 1T39A 1EJ9A 3KL9A 3ZBUA 3OL4A 3FDYA 2C78A 1FNNA 2K3FA 1T08B 4RS8A 1VQNI 2D74A 1IZ1A 2ME6A 2G7UA 4YZ0A 2R3SA 3R61A 5L3FA 2DDAA 1HOMA 2Q6KA 1P6RA 2HS5A 1HLVA 4ZV4A 5DYMA 2DA1A 3ROUA 2ZZQA 3OJWA 3A3BA 4ZGQB 3HPGA 5J1YA 4KUMA 4W8RA 3K70D 2L9RA 5K1YA 1HF0A 4KMFA 1Q82D 4RDJA 5AMVA 3KIOA 1PJ6A 2KIFA 1ZRDA 2HQRA 4E70A 3PUFA 5DD8A 1MJAA 3KP6A 2RC5A 2KHMA 1FEXA 4ANJA 3T1BA 1IA5A 3GVJA 2B0LA 3L2RA 3GZNB 2JMWA 3CCRB 1UMQA 3J80K 1FC3A 4XLFA 2QZAA 2L01A 3M8JA 1K9MD 1ZAOA 3ZMDA 2HVSA 1S0UA 5D5XB 4A6EA 3JRCA 2WTEA 2HDDA 1FNDA 1NRKA 1A6QA 4UZUA 4WQMA 4W8TA 1FTTA 1PUFA 4M4SA 4CYCA 3WE3A 4B3FX 1B59A 2EK5A 2QMUA 4CCMA 3CC2B 2HKOA 2TDXA 4G7XA 1X4PA 1AIPA 2HOSA 4G94A 1XX5A 1O8HA 3ABLH 3WGGA 2V5IA 2F2EA 2H8WA 2F48A 1VQPB 3QPHA 3P5JA 3HKZA 3FPKA 1AHDP 4XOTA 2WJVA 2BY1A 1Y6IA 2ZNYA 3QOEA 1MNMC 1E63A 4G1VA 4PC6A 1U9OA 2ISZA 2HDWA 2QX3A 2WV1A 1H0MA 4ESJA 3AL0B 1E1RA 1FRQA 3KYCB 2V4DA 1X4OA 3DV8A 1H80A 1QUEA 3BQZA 3Q0VA 5F1RA 1BM9A 1NTCA 4GO1A 2K40A 3WTYC 4JRAC 2CUFA 2M8GX 2COBA 4HF1A 1JB9A 4RLQA 1PP7U 1NH3A 2XOKA 2RNJA 2HVQA 1B9MA 1O57A 3RKXA 4XBFA 5E3NA 1YITI 1HSJA 4AU7A 3DLLF 4UVBA 4ENMA 3LSRA 4G12A 5D8LB 1MMAA 2BZTA 1BI3A 2CS3A 4YEJA 2ZZFA 2LKPA 4E7KA 1BI0A 4ROXA 2VFNA 4OMZA 3BZCA 3JW4A 1O3QA 3M07A 4OOVA 2VZLA 4M73A 4C2TA 4FX0A 1S72I 1HA8A 2VPRA 2H8RA 1B72B 3TL4X 5HNHA 3KP2A 4D5FA 4LB5A 3KEWA 4KIBA 1O3SA 4MNUA 2INUA 4RM0A 1P4MA 4G8XA 5TV2A 3O6BB 4MYTA 2RKHA 4R79A 5ICFA 4F7DA 2ZMEB 2BOLA 3CDHA 1BW6A 3QU3A 1JI8A 5AIQA 3OYKA 2P5LC 1IJEA 1YS6A 1G7CA 3DPLC 3EUAA 3OOCA 3BCDA 1JRGA 1E62A 4PJMA 3OMYA 3E20A 1QGAA 2NS0A 4RMNA 3D5SC 1IV6A 2W6JA 3F9KA 3DBRB 4UNOA 4M3FA 4IZZA 2X48A 4AIKA 3BDDA 3OYBA 3AFHA 4KISA 1OFLA 1HVXA 2J5OA 2DQRA 1D0XA 2P6TA 1HBXG 3HIFA 4EH1A 4C30A 1ZRCA 1K5CA 2A05A 2OK8A 3UNGC 3FKSA 3HSFA 4JK1X 1RI7A 4D0PA 5ILUA 2E35A 4OZYA 2JZYA 4PGGA 1WPCA 4B43A 2VLAA 1E1QA 1G3TA 2A6TA 3CJNA 3GQAA 4RPBA 5HS7A 4XRSA 4AD9A 4OPOA 4YHBA 2X9DA 1ZM3A 3ONUA 2NVTJ 3QU6A 1YIOA 2ZBKA 1RKTA 3CD6B 3CP2A 3GQ8A 3E5UA 1KK3A 2VL8A 4ASNA 3H3ZA 3S3OA 1D0ZA 4XN0A 4EATA 3OS0A 4RD1A 1OB2A 4P26A 4F55A 4A3LJ 1UCRA 1O8MA 5HODA 1CQXA 4KT6A 5L3EA 3S2HJ 5IYCJ 1K7AA 1YJ9B 2V9KA 3NE5B 4RDLA 3I4NJ 5K5QA 3ZQQA 5C1CA 5GPAA 2EFPA 1R00A 2HU9A 1RQRA 2CV1A 1I8DA 2IA0A 3BROA 4BQOA 2W6IA 1TYUA 1VQ4B 3HOSA 4P25A 3BLYA 4GYIA 2RQQA 3BZ6A 4CA0A 4J19A 3DWLE 1QX4A 1YLOA 1ZM2A 3KZYA 3UW0A 4IJAA 1TC3C 3M8EA 5BPIA 1YJNB 3EUKL 3NEUA 1TW2A 4MGRA 5LGTA 3T8TA 2VFMA 3DDYA 4MQVA 1KU2A 2D3LA 2WY7Q 1F60A 2KMUA 3WU0A 1ETQA 2JSPA 1OGJA 4TMVA 3F72A 3JAMZ 3MVPA 4RAGA 3W2WA 3VYRB 4G6IA 4XLNF 3MAJA 3HTSB 1GVDA 4ASUA 1E17A 3A8KA 1FYMA 3AGQA 3Q9VA 1TBXA 2ZKZA 4EGYA 3PFIA 2E7XA 3AG1H 3H35A 2M1BA 3RI4A 4I0AA 4PDKA 1KYWA 3H0DA 2JDIA 3I55I 4NC6A 3OS2A 2XDVA 5CYVA 4CCNA 1YI2I 4ZYAA 4BPRA 2Q0OA 4XSZF 2E1MC 2YX4A 4M3GA 4KA4A 4IW3B 3JU4A 4G6QA 4AUXA 3K10A 2WYRA 1FDRA 3SJPA 3S16J 2XROA 2BGCA 4I0BA 2V1DA 1XTAA 2K9NA 3GEZA 1AKHA 2L9SA 1NG6A 3FXKA 3WTTC 2JJ7A 3S3MA 1HA3A 3GLXA 4X7CA 1OMIA 4BXFA 4BBSJ 2HLDA 5KSWB 1TLHB 1QGZA 3BG3A 5M5YJ 3IHUA 3OYLA 4UAJA 3H1CA 4LG3A 1R49A 2HPMA 3O2PE 1AOYA 2J7KA 5HS8A 3PIOF 1JGGA 3KRGA 1J2XA 4F7ZA 1QRYA 3BR3A 5KHDA 3CRZA 3TOBA 3JTGA 2DDBA 4UHTA 2R7UA 2XC1A 3AG4H 2L7ZA 3K2ZA 3D1NI 1IDKA 2R93J 1V3FA 1OYYA 3OL3A 1L3LA 3TW6A 4AF6A 3TO7A 1O8KA 3SZPA 4BDZA 2XGXA 4UB6C 1VQOB 1S9HA 2MC4A 5E8IA 2JA2A 1D1CA 4XL9A 2JJ2A 3K9TA 4HWVA 3H5RA 1X1DA 1MNEA 3GZ5A 3OZVA 4HAMA 1X1PA 1H8HA 2M2EA 1T0FA 1X3UA 2L0KA 3ASQA 3LQEA 3DKWA 3IH4A 3BH6B 1YLFA 1MIJA 5F27A 2JQ7A 2R5YB 2VQHA 2YR2A 3MHPA 4P9SA 4WZLA 4ZZLA 1T38A 2XGEA 3I56B 1DBGA 2BX6A 4OJPA 1P7IA 2GA1A 5LMZA 2FD5A 4NK8A 1QO0D 2Q2EB 3TW7A 3AVTA 4LITA 1FX7A 1I39A 3JCUC 5B1BH 3K4LA 1O4XA 3F8CA 3W2GA 1D8JA 1LJ9A 4XN3A 3GXOA 3I53A 5LEKA 2EWEA 2Z5UA 1QA1A 4Y9RA 1BBYA 3W2VA 3BPVA 3ASTA 2KLOA 4X06A 4H0EA 4Q7JB 1U8BA 1Y0NA 2KPMA 3HC7A 3TH0A 1FIAA 4QFMA 2NVYJ 3M8FA 1VQKB 2B63J 2DU9A 4M74A 1QVTA 4MO7A 2E19A 1CLWA 3EQOA 3KEYA 2F4OB 3KFWX 2DPUA 2O61A 1W87A 1ZYRF 3A0BC 2IGMA 3PNYA 4I6ZA 5FLVA 1QBJA 1UD8A 1QA2A 1DGRM 2LDUA 3E97A 3CCUI 3ZN1A 2HTSA 3MMPA 3RPUA 2VBMA 1MDMB 2YU9J 3JQPA 1ZR2A 2BY2A 1E3PA 2HCJB 1IN7A 2OF7A 3P4GA 3J7AY 2B7EA 2R7QA 4Q47A 5IOZA 5CDFA 4Q4ZF 5K5RA 2QEXI 4RGRA 4CH7A 2ME0A 5EEHA 1LE8B 1T0FC 3CMEB 3SEZA 5IT9K 5GPCA 4N0BA 1R71A 4HA8A 4M9XA 3CPWB 1N0UA 1W34A 2PFBA 4HEA2 5FRNA 3VSKA 2QQ8A 5E8GA 2QXZA 4IHTA 1QNTA 1T6SA 2O1DA 2DT6A 1F4KA 2NZMA 3K6GA 1F9NA 1Y0RA 1RR8C 1K78B 4TSFA 2R4GA 3LVBA 5A8AA 3AVXA 3CCJB 2FVGA 2TCTA 3VMWA 3TP3A 1I7PA 2X6OA 5EMNA 1FZPB 2M3AA 4BQQA 3RKQA 5BSXA 1OOCA 3LL7A 5FKLA 4LG0B 4I99C 3OEEA 2NYXA 1WSUA 5IYWA 2W7NA 3FXJA 2GWRA 4ZYDA 3UKGA 2CYYA 2BXZA 5E6TA 3GTOJ 3B78A 2R5ZA 2NXNB 4DJAA 5LEJA 2P7CB 2FOKA 1YIJI 5LD2C 2IP2A 4IO9F 4I2OA 2Q6LA 5F0FA 1SEUA 3A1PA 1H8AC 2QGUA 2RREA 4IHXA 4BAYA 3KZZA 1AIRA 1B72A 3DEEA 1Y8RB 2MA3A 1UD4A 4ZTJA 1WI3A 3FKJA 2F1MA 2OTLB 2XT2A 3LA2A 3MWMA 1FBUA 1N25A 3H0GJ 5D8KB 3A3GA 2GAUA 2O8XA 2X1CA 3G6EI 1LB2A 4YC5A 1IB0A 1RUOA 3ABTA 3CCSI 2V7TA 1HW1A 1RPWA 1Q9SA 4U9UA 4OOIA 2M9HA 2DN0A 2VNKA 4WWCA 1W2BB 2O9LA 1VQ9B 2CW0F 5DTDA 4CDGA 1Q7YD 4X05A 3CCEB 2HQ5A 4NUBA 1UHMA 4A3JJ 3GTJJ 1A36A 2XPVA 2YPRA 5K5OA 3JTHA 2MW8A 5C4JJ 3WTSC 2HDCA 3MCAA 3ZQGA 3GBGA 3KYLA 3WODF 1N75A 2D1VA 5IOYA 1ZK8A 2Z99A 3AL0C 2VNIA 3BOQA 3F6VA 5J47A 3S2DJ 2W1OA 3OIQA 3GX4X 3HYIA 4M0LA 2EZKA 5KVRA 1DABA 5B3SH 5IY5H 1J9ZA 2AXLA 3SFIA 4Y7CA 2NS7A 2BHZA 4FK8A 2QF7A 1WJBA 1PUFB 1D1BA 5E18F 2L54A 1XB2A 2KIMA 5M3MJ 1VQ7I 3QFCA 1D5YA 2DOEA 2O7OA 2GBYA 3MZHA 4LBVA 1K73D 2ELKA 2ZTGA 1BR2A 1Z77A 3P7NA 3FZVA 1XCVA 1JTXA 3OZUA 2VBEA 5JMCB 1WJDA 2OJED 5ILVA 2XUBA 3ESWB 4HQMA 3SYTA 2EILH 3B73A 3BG6A 5E3OA 1O8FA 5ILSA 1X2NA 2E1OA 3HSEA 4LFUA 4BXUA 3IC7A 2IS1A 3K7AJ 4MTDA 2EIMH 1ZN2A 3QQAA 3LNNA 2ZMEC 3I71A 2RN7A 4Z4SA 2A07F 1U9NA 4YIRX 2QE7A 1V54H 3HXLA 1HZEA 1W0JA 5M5XJ 3K70C 2K4JA 4MQ9F 3ES9A 4TN1A 1E2XA 3CC7I 1FWZA 4ZYGA 3VFZA 2CW8A 4K2EA 3W2HA 3HM5A 5M5WJ 4PAAA 3BCBA 2V1XA 3PFYA 4X8IA 2BM5A 4AVPA 2L02A 1DBOA 4L9JA 2LLKA 2HGCA 2IPQX 1WJ5A 3HGYA 2BVLA 4IOAF 2OC6A 2D45A 2L7MP 3H36A 2LRDA 5HLTA 4C0SA 1XPXA 3QYFA 3R4KA 3DTIA 1RNLA 1U78A 4WXDA 3NRVA 5GAGJ 1UG0A 3CMAI 1G4DA 1TWHJ 4Z4UA 3BC9A 4S04A 4QWQA 4HX4A 1B2RA 1EZGA 2XV4S 4Q48A 3PENA 2VE8A 1K6OA 2HPIA 2X1EA 4C2UA 3MKLA 1FRNA 4P55A 2XF6A 1F1ZA 4CCJA 2JA7J 1SKYB 1WSVA 3H3UA 2KFDA 1TNSA 1QHHD 3WNBA 1ZG5A 4PFPA 4D5CA 1EP2B 1KK1A 4XIDA 5DCMA 1YW9A 2EJRA 3RTRA 1E3XA 2ZL5A 4X7FA 1KCCA 2IOUG 4HG2A 3WNDA 2MLKA 1BN8A 2ZNZA 2NOJB 1LKXA 1FIPA 1XGOA 5LRSA 1W0UA 4Z4RA 2G0YA 1MRZA 4C2MJ 4O6JA 4EJWA 2F4NA 3CCMB 3CCQB 2CQQA 3VSUA 2CC2A 5CKTA 2CH0A 2OTJB 2GLOA 4OPWA 4RD4A 3PSIA 5HLGA 2NV4A 1N77A 3WYAA 4ON0A 3GTKJ 3WG7H 1R36A 2JUCA 4D1QA 1LPQA 1Q81D 3BJAA 5J8FA 2IJLA 2DT7B 1T6ZA 4GFBA 1V55H 1IUFA 4U7BA 1XSVA 2EA4A 1R5HA 1I1SA 3JQQA 3Q6RA 2BM4A 1JNYA 3W5HA 4AF7A 3QPLA 1P4WA 1ZGWA 3S14J 5IP7J 5J40A 2O17A 3H92A 4MEXF 4BBRJ 1FSHA 4UZEA 4C43A 4M3DA 4FCYA 1O3RA 1ON1A 4RCYA 1I5ZA 2VOPA 4D7MA 4HIZA 3JRFA 3S3NA 3A4CA 1OQYA 5BNGA 3DXJF 2HR3A 4B48A 4LIUA 4BYYA 3CXCB 3VMVA 1Z21A 2P5VA 2ACJA 2ZL7A 2VN2A 4A12A 2VJJA 5J8CA 3KEQA 1QUFA 1L0OC 4PJJA 1GQ8A 1R1VA 3RZOJ 4WX9A 4W1UA 3SQNA 3OSGA 4QV2A 3WY9A 4AIHA 4QTRA 1NK2P 3K4MA 1F5TA 3W3CA 2VE9A 5J1RA 2HMAA 1YG2A 3HRSA 3JR9A 1IGNA 1LLWA 4QPOA 1WH5A 2E5ZA 2Q2EA 3RYRA 4BNCA 2MG4A 3LSMA 2LSOA 1UD2A 1E3ZA 1MBJA 1USTA 4RB1A 4LBWA 3U9GA 1S8NA 2V79A 1QFZA 1PLUA 2VBKA 2DA6A 3HOZJ 1P4AA 1W5CC 1XMXA 2YS9A 3JAMK 3FJOA 2VFOA 1J9IA 2EFWA 2NPFA 1GAQA 2GQQA 1KTVA 5BS6A 3ASSA 1X1CA 3CC4I 1O88A 2Y75A 2DO7A 1O8EA 2NVXJ 2QENA 2K85A 3VYSB 1RQPA 1O8IA 1Z0XA 3FXMA 1U8RA 3GQ9A 3OS1A 1Z6TA 5J4YA 1YHQI 3BG5A 2OBTA 3M4OJ 2OQGA 3G1LA 1YFHA 5D5UB 2CK3A 2BW3A 2JTVA 3TDUC 2XAFA 1T2KA 4OP7A 2DMUA 1I50J 4U4BA 1IUYA 4JBAA 4AYBA 4O5VA 2CG4A 3JRDA 3OY9A 5D4RA 1FNCA 4RAZA 1FBSA 1TT5B 1WDTA 3FIWA 4A5NA 4BQNA 1QVGB 1YRNA 3DU6A 2QA4I 4FETA 1IXCA 1UHSA 2YWEA 2WJYA 1ULYA 4L0ZB 1YE9A 3DBHB 2WR8A 1IB4A 1AKHB 4J0QA 2FUG2 1L1IA 2V26A 4Z4YA 4PJLA 4E7JA 1O7LA 2AS5F 2W7ZA 4RLFA 2VASA 2XSDC 4DNCA 4F3QA 1ZLJA 5AONA 2PLFA 4A3DJ 3AG3H 3VMFA 2RGVA 1GDTA 1T56A 4BACA 2BM1A 2L2OA 1K8AD 1I3QJ 2LY2A 1ZRFA 4QVJA 2H6CA 2A3SA 2A6EF 2XPWA 4NBSA 1MJ9A 4BY7J 1UFMA 4P9FA 3GFMA 3EUHA 4RGXA 1ZGJA 4ABZA 4KKTA 2CWEA 3IRRA 4BHPA 2V1NA 3E6BA 3MKZA 3E1YE 2E1NA 5HXBA 2W84A 1T8IA 1IW7F 1H9GA 5CVIA 1TW3A 1KONA 4CCKA 3SJMA 3CDLA 3R0AA 5DCFA 4DW6A 4YXWA 5F1JA 2I5UA 5LGUA 1G2HA 2GK6A 4MYUA 3B4NA 3HRUA 1ONVA 2QZ8A 1K6YA 3F23A 2J8KA 1KQ0A 4PJ0C 4EEFG 4B3GA 2XAGA 2GOXB 2NNYA 2KKOA 2FX3A 1HDPA 2QQAA 2MD5A 3G71I 2K27A 2OA4A 5ED4A 2ICWG 1EKEA 3BP8A 3OYGA 1C0WA 2W00A 4QSHA 4EM2A 3MFKA 1D0YA 3ZPLA 4N4NB 2C5BA 4DYQA 2NOGA 1QG0A 1G3WA 4HV5A 2KQRA 3LSTA 4EM1A 5BPDA 1X3ZB 3WTWC 2CQ7A 2XB0X 4A0ZA 4EM0B 2WWYA 3B8YA 2EA2A 2DTRA 2WPDA 2L4AA 4TV7A 1K79A 3VO2A 1QCXA 1KU3A 2ZJRF 3A1YA 3AVYA 1MSEC 1XC5A 2ZXJA 2X3UA 5IPAA 3B02A 3Q6QA 2YU3A 5BOXA 3AGPA 1WOOA 2ZBVA 1R5BA 3BTLA 3ISPA 1WQ2A 1IG7A 2AXTC 3K4CA 1XMAA 3FMQA 4YELA 3SXYA 3ZRGA 3ZOBA 4HNVA 4A3KJ 1ZG1A 1UG2A 1UAAA 1OGOX 2IEKA 1UD3A 3O8GA 1XQBA 1YQAA 4UUSA 3FX3A 2QUFA 3QFRA 2K9MA 3REOA 1T95A 1IJWC 3C1DA 3L00A 4G6TB 4Z03A 2EPFA 2CV0A 4KH3A 1FOXA 2M4GA 2JK3A 2M5SA 4AC9A 2V4JC 3CCRI 1GV5A 4YZQA 1R22A 2BV3A 4IRHA 4ZYHA 5C3EJ 3LAPA 3PO2J 2V7QA 2Z1DA 2XTWA 4XD7A 2CFXA 3HOXJ 5DD4A 4RPDA 2IQ7A 4XKWA 3U2QA 3VODA 1X19A 3IL2A 5KCMA 1GV2A 4ITVA 1EFCA 1F20A 3SLNA 4DK1A 3E0JB 2AHOA 3AK5A 4X7EA 1VF7A 4M3EA 2IBDA 5JR3A 3U6BA 3QFSA 4TMTA 3CC2I 1A04A 1EA0A 3EDPA 2PE3A 4BH9A 5IK2A 3SZEA 4M1KA 2B9SA 5F4MA 2EBIA 1R7JA 1R1UA 4L0YB 2GOMA 6PAXA 3DP7A 4U0VA 5HDKA 2QBYB 4IRGA 2QVOA 2KL4A 1G59A 4BEHA 3J81Z 3C3WA 3FK7A 3GCMA 2R5ZB 1S3JA 3BR5A 2O3FA 1WJEA 3QPSA 2QTLA 2KRHA 4F93B 1W35A 2DAOA 4NQWA 3PUBA 5JLXA 1CQTA 3N05A 1K61A 4A3MJ 3MMYB 4UB8C 4V02C 1KK2A 5E1ZB 3GIRA 2Z8GA 1R4NB 2CW5A 3IKTA 2Y31A 3P27A 2F43A 1IC8A 5FL7A 2OPTA 2XZLA 2IW5A 1UD6A 1OCCH 1ELOA 2VBXA 2WAQN 3CDIA 3HBLA 1JT0A 1D3YA 3G1MA 4AWXB 4OJOA 1ERDA 2LC2A 3ZSCA 3MZYA 4F92B 3BC8A 5FFXA 2BV6A 1GVJA 3KYDB 4QIWN 1QU3A 3F8BA 3D5LA 1WKMA 2LKSA 2EQRA 2BSAA 2DOGA 4UZFA 1MH3A 4TMWA 3E1SA 4ENNA 2VPLA 2LZJA 4WZTA 2ELHA 5E1XA 2BGJA 2FA5A 2YSRA 4EVIA 1BX0A 3ZC3A 1MD0A 4U7DA 3RJPA 4IKFA 3RKWA 4B47A 2Z33A 1QGYA 1O7FA 1DDNA 1BQEA 1JTAA 4BJ6C 3WGIA 2HEOA 2H6BA 1ETKA 2R9VA 4N4OB 1PKVA 3ZGKA 1LFBA 4L8JA 4E7LA 2VKHA 2E2IJ 1XG1A 4GRIA 4KIFA 5JHFA 2KZGA 3D5RC 1D1AA 1S7EA 3VWBA 2A61A 2Y0MA 1MBEA 2CJJA 3E3VA 5EJCA 1TTYA 4RB2C 2K9LA 5E20A 3TKYA 1WFXA 1CGPA 2HXIA 3GLLA 5CVVA 3GTQJ 1U5TB 4LLLA 2KRCA 1OYIA 4PC7A 4YG2F 5A2QZ 1OPCA 2HZTA 3B8HA 2H1KA 4G7OF 2QQ9A 4GYGA 2D2WA 2V9PA 2QYOA 3OZWA 1X58A 2LD5A 2QY1A 5J3LA 2MFZA 2P4WA 3HEFA 4XQFA 2E34A 3DQVC 4XR6A 3LNQA 4HLYA 1H42A 1HW2A 4EJUA 3ZQCA 2AQEA 1FNBA 2XVCA 3BTIA 5C4XJ 2BF4A 4P22A 5EYRA 3GUDA 2ZJQF 3HOYJ 3ZCOA 2L7FP 2DYRH 1USSA 1WSRA 2O04A 3B6AA 2KISA 2E36A 4WZEA 1B9NA 5B66C 1QQ1A 2EWNA 4WK8F 1APLC 3CCLI 3CLQA 2STTA 2E2JJ 1OCOH 3RPQA 3CD6I 4IVNA 4HE5A 4Y13A 4OOSA 1P7JA 4P2NA 4L9NA 2HVRA 4P1WA 4XLPF 1S5LC 2DY1A 2Q8KA 5EDNA 2WAQA 3BY2A 3H9QA 1QRCA 5BQTA 2DMNA 5TY0A 1W4MA 3CUQA 3C18A 2DI3A 2M7AA 3O3KA 2X85A 1Q86D 4D9JA 2E71A 5TGTA 4A6DA 4ESFA 1YJ9I 3FISA 3EQLF 4N9HA 3FHNA 3SZTA 3VOEA 4KFCA 4IHYA 4DK0A 1TYVA 2NAZA 1KRHA 2DYSH 3H9JA 2DQLA 2FQ4A 4LIVA 3Q9SA 1VQ6B 2I8DA 4L5JA 4G7WA 1VQ4I 2H94A 2R7RA 1VQ5I 1KU9A 4OWRB 5DCMB 2EFOA 4A0XA 3VPRA 1KJZA 5KW9A 2YUSA 4AIJA 2IVMA 1SD4A 4XORA 2IA2A 3ZQLA 2VNJA 1YJNI 4OPSA 3NB2A 3BQJA 5L3CA 3GTGJ 4Y15A 5E17F 1E0EA 4YALA 1TSPA 3CF5F 2ZZGA 3F0CA 3V7CA 3A8IA 1IV8A 2EV5A 1HKSA 2K3PA 2K4BA 1BL0A 1S7OA 3BR6A 4YAWA 3OYIA 2YWHA 3Q5FA 2ZJ2A 3Q39A 2M8EA 4LK1F 5CVRA 4XICA 1I3AA 4Z4ZA 1FT9A 2CW7A 3CO6C 1MABA 3GO5A 3BNWA 1OKRA 1ITYA 1YW8A 1IJFA 2XF5A 1IAWA 4LK0F 2CU7A 1D8KA 1SFOJ 1FOKA 1XG2A 4JMQA 4FX4A 2PBIA 3NAUA 3T8RA 3P9IA 4XSXF 4MFEA 4BL0B 1EFTA 1V5FA 1TP4A 4HLXA 4A3BJ 3WU2C 3S1NJ 3HOTA 5EF6A 5IP6A 1BC7C 3VSVA 3KLOA 3JX8A 2LNBA 5A88A 1VHEA 5D6EA 2PMZN 3HRTA 5JI6A 2LK2A 2W85A 4DGWB 4ZGNB 5TJJA 1VJSA 4FE4A 1XS9A 1A5JA 4YAUA 1JJ8C 1BOAA 1LUJB 3C2GA 4JX6A 2XHKA 2O8KA 3WHBA 5DV5A 2XZOA 5D5WB 1N0VC 5D6FA 1N06A 1VQLB 2WC2A 1VQOI 1U2WA 5FKNA 2W82A 1G7RA 2E2HJ 1ZHFA 3HTUA 1BMFA 2GXGA 5HS9A 3GVKA 1BIAA 2K86A 1G7SA 5GAHJ 4EV0A 1LFUP 3RKYA 1R58A 4JQFA 1HXDA 2ADUA 1YOVB 1Z6RA 2AO9A 2JN6A 3OOUA 3G4SB 2QM3A 3SDGA 1J09A 1Z7LA 3T5XA 3OYEA 4F91B 3U1DA 3COAC 5GV7A 5AN9A 4Y3OA 2DOFA 2BEOA 3I56I 3PO3J 4V2FA 3FWEA 5ERIA 1VQ8B 4UV9A 2M34A 4OMYA 4DIQA 3BTCA 1FJLA 2V7FA 4GQNA 3ZQIA 4HDVA 4GGGA 3KZIC 4RDUA 1CF7A 2IS4A 2BW3B 3ASOH 1WJFA 1D5VA 2XC7A 4RB0A 2XAQA 4ENJA 1VF9A 2R7ZJ 2Q6OA 4BU2A 1UB9A 1QHGA 2LF8A 4ZDPA 1MMNA 2GA2A 3VB2A 4O3MA 1GR1A 5THXA 2DYIA 3CF2A 4R71A 2NSTA 4H9GA 1FX0A 1VFCA 1FMVA 5GTHC 5GADJ 2QSFX 1G3SA 1RESA 4JYKA 4CICA 1YRNB 1UD5A 2HQNA 5E3LA 1VQKI 2Q6IA 2VNHA 3B82A 3L7WA 4QLCU 3PSSA 3BY6A 2DK8A 2PG4A 2ZXIA 4J01A 4U88A 3BTJA 2CQXA 1A31A 1K28D 2C4UA 2D9RA 3CCVB 4KYWA 5FRMA 1YO5C 1MJBA 4KKSA 2FNAA 2L9NA 2F5DA 3BJOA 1NK3P 1YTYA 2M5WA 2R6HA 3GQ7A 1W7PA 1TWAJ 1SD6A 4HYEA 2QBYA 2VJ4A 2GM4A 2KIUA 4I09A 4WXHA 3VO1A 2DBBA 3CMEI 1WHUA 5IYBJ 1Y1VJ 1RUNA 3W2IA 4OIOF 2B5OA 5A89A 3HHGA 3AVUA 2CQNA 3TOAA 4PCQA 1R5OA 2ODLA 2PMZA 1GHCA 2XGCA 1XB4A 3L09A 4IHSA 2KIQA 1CNEA 4QUZA 2WADA 1TYWA 3HB9A 3N4MA 2DA4A 1OFEA 4TT3A 2HOTA 3J7AO 1QPMA 2MABA 3A2KA 3CCJI 5FO0A 2XRNA 5DM7F 5FKOA 3F8FA 1ZGAA 3P9KA 2JA8J 2PI0A 5F04A 2HQAA 3BR0A 1QVUA 3S15J 1K83J 3K1NA 1H85A 3NAWA 4QPQA 2FRHA 2VFPA 4A2UA 2CF4A 4BGDA 1Z05A 3LSHA 2FJ1A 1QFYA 4W97A 4YFXF 4A3EJ 3I59A 1LVAA 2F6CA 3ZZUA 3CLOA 1UJ8A 5M3FJ 5LHHA 2Y9ZA 2M87A 5H6QA 4P3IA 3TO6A 3L1PA 2UV1A 1EFUA 2E7WA 4AVZA 2OAZA 1W5TA 3T9GA 3ABUA 1TL8A 3BR1A 2J5PA 3LFKA 2R7FA 3DFGA 1E43A 2VFQA 5FNZA 3FY3A 2P5KA 3Q38A 3CJQB 2RC4A 4ZCMA 4YFNF 2ZFWA 3TMOA 3LOCA 5F0CA 4B8XA 1JT6A 4H4KC 4E7SA 5LHGA 1B8IB 4PC2A 5DSZA 4FE7A 3GZ6A 1K8FA 3M7GA 1VLYA 1VQ9I 2RC6A 3Q3SA 4L9VA 4I84A 3CP8A 3CCEI 4UUSB 1M90D 5CVUA 1U5TA 1VQ7B 1HSTA 5FA6A 1VHOA 1ON2A 2QSHX 1QPIA 4FXUA 2IT0A 2DFFA 5E79C 2CQKA 1YJWB 5FKMA 1FSEA 1MBHA 2LR8A 5H20A 1NDHA 3FMSA 2O6WA 2DOAA 1PJ7A 5E1WA 1FNMA 1WOSA 2BGIA 2VBUA 1KYZA 5CLSA 4Y17A 3OYAA 2ZO4A 2CGPA 2UZKA 3UR3C 4BHCA 2VODA 5IYQA 1ZTRA 3ASRA 2XSJC 2GJPA 3EYYA 3ZZTA 5ICGA 4OAZA 2COMA 3J81K 1JKOC 4N3GA 3W5VA 4YIFA 1KZLA 4ACAA 2D5VA 2GJKA 3BR2A 3FF5A 3S17J 5AIPA 3CW2A 2XGJA 1PYVA 1R5ID 3DKYA 3LQRA 4RAFA 5FROA 4ZC3A 2IA1A 5KK1A 3MN2A 2BVNA 2V31A 4N3NA 1COWA 3A0HC 4CQJA 5DEQA 3CC7B 5L3DA 2VQGA 5FD6A 2Y0SN 2FF4A 2R7DA 1U0JA 2W57A 3ZMVA 3Q0UA 3F21A 4BEHB 1TWGJ 1JUPA 1HG8A 2VBZA 2KRFA 1D8TA 3BCFA 2DMPA 1WVRA 3K0LA 1X2MA 4FHTA 4UVAA 3T0YA 3GSIA 1S7AA 3V8LA 4NQWB 4BKXA 2VI6A 2MH9A 1Y56A 3HAGA 1VQMB 4E7HA 5K7FA 4E0FA 2NNNA 1POGA 5DDGA 1HC8A 1A35A 3BT9A 1K4ZA 4C2LA 1IHMA 4RM2A 1JHFA 4ENKA 1Q1HA 3CTAA 3IWZA 1X0CA 1JE8A 2H1LA 2DODA 1U5TC 3FK6A 1VLOA 3H5NA 3BY1A 4Y33A 4UVCA 1WJAA 1BX1A 5FIUA 1JKPC 1BJAA 2X0LA 1SFUA 1ZELA 2VXDA 3RIRA 1IRFA 5GAEJ 5JVGF 1BC8C 4WCGA 1BI1A 5IYDJ 1R6RA 2VBVA 3WXMA 2ID3A 3FXOA 3BQYA 3LWFA 3S8PA 4UUVA 2LTPA 3X2QH 5JBQA 3IH2A 3F3XA 3V8KA 1LDJA 5L46A 1D1NA 3KETA 3R6KA 5CPRB 4Z2YA 5LRRA 5H5JA 5A2QK 2UWMA 2JIZA 4RCZA 3OSFA 3MEXA 2WB1N 1X3WB 3Q0WA 4HBLA 2BPOA 3QFTA 4KIGA 2IAIA 1Y8QB 2KZVA 1D2EA 5LLQA 3RYPA 3L2WA 3AVVA 4YEIA 5J1UA 5GTIC 1O8LA 1JHHA 4XLCA 2DCEA 2NRAC 1IO2A 2OCCH 3QPTA 4HZFA 1ZUNB 3OYHA 5J6XA 3ZQFA 2DA5A 2OZ6A 1U2RA 2F1LA 3CCMI 4RD3A 3N90A 3F22A 3OJXA 1BI2A 1BPLA 3H5AA 5IYRA 2OTJI 1W36D 3M9AA 2R7TA 2QGGA 1EXMA 5DNSA 2HKXA 1Y0UA 2D3NA 1WOPA 3HOVJ 3OYDA 3LJYA 4B44A 1B1BA 5JLWA 3HDDA 3DPUA 3P9CA 3MKYB 5CJ9A 4MIMA 3IWFA 3PQKA 3I4MJ 4E7IA 5HZAA 2CRVA 3KPHA 4UV8A 1W0TA 4CCOA 1TZLA 1PE9A 3FKIJ 3ZPNA 1Z67A 1WH7A 4C3IJ 1ORKA 2HFHA 4RGUA 5FD5A 1I1GA 2DIEA 5EG0A 2XNCA 3S1QJ 1P4XA 1SD5A 4HE6A 1ZKGA 1OCPA 2AHQA 4V2GA 1OCTC 2JN9A 3WBJA 3C7JA 2K02A 1JA0A 3SLDA 1WJCA 2IXSA 3CCYA 1YS7A 2DEUA 1BIBA 2ZZEA 3CC4B 2FEZA 2WA0A 4BUPA 2Z9OA 2QWWA 2PLYA 2NSPA 3ONQA 3QP6A 2FX0A 1T6XA 2VKEA 2ZTNA 3JRIA 3LQQA 4G6DA 3HZJA 4CCLA 3N6ZA 2VOOA 3OKXA 3CUQB 3FXUA 4ESBA 4E7ZA 5FLMJ 2BBYA 5FFZA 4DNRB 4OZZA 1OLTA 1BN5A 1ETWA 1HKQA 2ESHA 3GVAA 3LMMA 3J7YJ 2GJRA 3OW7A 5H59A 1SFKA 2IGNA 3EETA 2ESNA 2N8GA 4YFKF 3W6KB 4A93J 1XFOA 2Y69H 1Z3XA 4KICA 3BJ6A 4X0GA 3SY2A 3OW2B 1OFCX 4RA2A 1CZFA 1K4SA 4IRIA 2E1BA 2F5VA 4B4DA 1DGWY 1KA8A 4NC8A 3GYHX 3ML3A 3ASNH 1FTZA 1OFMA 5JFRA 1QA6A 1BJKA 3DEWA 3SEJA 1QJVA 3CO7C 3ERED 3QSYA 4ZTFA 4C3HJ 1Z1DA 2E5NA 1RKWA 3OR2C 5EEGA 4AC0A 4EMSA 3CMYA 1RRJA 2XKPA 2R92J 2JJ1A 1WTHD 4M3BA 2EV6A 1W0KA 1MMSA 4L5IA 2LREA 2NS8A 4LLGF 2X3HA 1W7PD 3I0TA 1XE1A 4M53A 1XN7A 1NG7A 1T98A 1QZZA 1ZARA 2HOEA 1R9TJ 2GK7A 3L2QA 2R0QC 4RD2A 1T5EA 4IOCF 1KQSB 4IEJA 3FXLA 1H8EA 3OEHA 2YUHA 3JSPA 2GREA 3DU5A 1FOWA 3K4BA 3TQNA 4DQ2A 5ICCA 3HOWJ 1OYWA 5TR9A 1EA3A 4GXOA 3GTLJ 3SEQA 4OJ5A 2A68F 1GO2A 2R7WA 1R5GA 1R4MB 3EYIA 1DU0A 1WCMJ 3RY8A 1VQNB 1O8DA 3R6JA 4YZAA 1JXSA 4XLHA 2WBMA 3HKZN 3RQ4A 4DBQA 4HDUA 1YX2A 3PVDA 1IXRC 1BHEA 1SM4A 3PNTA 4ZZDA 2GXBA 1JGSA 1M1EB 5HNFA 3CJTB 3WGHA 1R23A 2FE3A 4S0HB 3HPHA 4CHUA 3ZMZA 1H88C 1WZ2A 2CRGA 1F36A 1OCRH 3A03A 5HDNA 4KITB 1U3EM 1S4MA 4LC0A 1FLIA 4MFDA 3JRGA 3VDXA 2JVHA 4NDLA 2DW4A 4NBQA 3FBNB 2WV0A 1GVHA 3H9NA 1A8PA 2VJ5A 2ZJPF 4A3FJ 2BMWA 4P1VA 3GFJA 3PIPF 2ZITA 4ZCIA 3HGGA 4XRSG 3WTUC 2KDOA 3ZBTA 5KAIC 1OHHA 3OPOA 3S1RJ 4EGZA 2BHYA 2P7VB 4UUTA 3PSZA 5HKKA 4CSWA 4HPQA 2GIZA 2X4HA 2E1CA 2CUZA 1RIOH 3PA2A 1LNWA 1U6GA 4B1RA 2V7UA 2X8KA 4Z05A 2DLLA 2HI3A 4XLEA 1B8IA 2VBSA 2L5QA 2FBKA 2XAJA 2K7LA 3QRFF 4P6VF 1V4RA 4OU0A 4RDKA 3EUHC 4GCVA 4N9IA 1CF7B 4KN7X 1LM1A 3KEOA 1PXZA 3T51B 1TQMA 3NQOA 3LSPA 2F5CA 5TISC 4QVAA 4XKCA 1DQUA 2V6CA 3VYTB 2C6YA 2R7VA 2C5HA 2PMDA 4P5OA 1W9XA 4OIQF 4TKOB 2MBFA 2O03A 2R7OA 3U21A 1AWCA 5EZGA 2VC1A 4XLAA 4B3AA 4DZJA 2NTQA 4D7NA 4LB6B 5GP9A 1JJ6C 3PJRA 2OK7A 2G9WA 4DBRA 4FT8A 3R6SA 4U49A 2L4MA 1DU6A 3GQBA 2VONA 1TUIA 2HXOA 3NWSA 2X0KA 2QKMB 3RDIA 1LLZA 3ZQ7A 3G1OA 3RQIA 1FOYA 3W2AA 3SUCA 2QCOA 2FOWA 4P6YA 3IH3A 1TWFJ 3GTMJ 3E6DA 1J75A 2BN4A 3CZ6A 4URRA 1YX3A 3C2HA 3QOPA 3W2EA 5L3BA 4BY1J 2IS2A 1W7PB 4G7ZF 4M6XA 1IDYA 1Z7UA 1XCBA 2QDXA 1YITB 1I27A 2D1HA 1VQPI 1I6HJ 3ULQB 5LHIA 1QH0A 3DKXA 3BPXA 2LY9A 1KC8D 3WTZA 1DDIA 2YX7A 2EV0A 1TWCJ 1SC7A 4BJ5C 2NT9A 2MC3A 1WPKA 3BH4A 5E3MA 2ZFUA 2A69F 4IQ4A 3LQ6A 1RC9A 4CYDA 1S72B 2PMUA 5HVQC 3AKZA 4G5GA 1IXSB 4XK4A 3ZZ0A 3DTKA 3OYMA 4KNYA 3JURA 5KAFC 3IAS2 3FM5A 3OE7A 2C2WA 2XNJA 4TMXA 1NHAA 2X6XA 2W24A 4HX7A 4IF4A 2PMHA 4CZZA 4KDPA 4YDTA 4DYRA 2OYNA 3AVWA 4YIIA 1HDDC 2MLGA 4OINF 2EFGA 1AA7A 4YFOA 1VI0A 4BJTA 2Y9YA 2KP6A 3MQ0A 3VR6A 1LEBA 1GXPA 3I59B 1WXRA 2FBIA 2VUMJ 3QYBA 4HSRA 2LF7A 2X6YA 2CMPA 3LSKA 3VYUB 2GQFA 3V76A 1G3YA 3O8HA 2DMTA 2F5FA 3ZN0A 1PUEE 2PJRA 3D26A 2F3LA 3K1PA 1MKMA 1OB0A 1ZM4A 4WXCA 2BXYA 3SHFA 2ZCWA 2F4IA 1Z3YA 4PJNA 1EH7A 2FU4A 3SJZA 3GWZA 3CMMA 4ZDOA 1OFDA 3IRQA 1W1WE 4RAYA 5H6RA 4IQJA 3SDBA 4RLZA 3T53B 4DQKA 4BE2A 1ODDA 4FQGA 1V5EA 2BVMA 2QTZA 2KJCA 1MNDA 2UUZA 3ABMH 2DMQA 4XMYA 3IAM2 1W5SA 4PC3A 2JVGA 2M30A 4LBYA 4JOMA 1DPUA 2ZB9A 2C4TA 4FN5A 1J0RA 2DPDA 1PP8F 1XSDA 1EP1B 1R5NA 2X1DA 3V7RA 3K69A 1QFJA 2G0EA 2LMDA 4MHGA 1DPRA 2P81A 2VQCA 3HRMA 1KGSA 3L2VA 4ACBA 1HW5A 2L9VA 1FYLA 4E4HA 4BDYA 4I98B 2K9SA 4Z4VA 1DG1G 1SVOA 2KDZA 1O3TA 1OGIA 1TLLA 2G7HA 1ETYA 2LOOA 3OV8A 3H09A 2PECA 4Z6YA 3TEDA 2DA7A 3CJRB 1KQ8A 3A35A 3ERMA 3A01A 3OYJA 2BY0A 3SZGA 3PSFA 2X53S 4U0YA 2VKVA 2FMYA 4Y52J 1OISA 2HOAA 2P0WA 4MLOA 4WZKA 5DS0A 2FQ3A 2WSSA 2LH9A 3CCLB 3B90A 2DCUA 3ZMSA 4I01A 2LKXA 2EINH 2E1RA 2Z6BD 3ONYA 1EE6A 1SKQA 3ZMTA 2ETHA 4XKVA 3CUOA 1QZYA 2DK5A 4MEYF 4DOZA 5FO1A 2XAHA 1VBLA 2L7KA 1QA3A 2WAEA 1WI9A 4HX8A 1RETA 3TDZC 5B5EC 4OJ6A 2K5CA 1EV7A 4YCQA 2KJBA 2Y48A 1SFXA 1NB0A 9ANTA 1KQ9A 4TMZA 1VZ0A 3CESA 2IGKA 1ZREA 1WORA 1QZEA 4YAFA 4BQAA 1PDNC 3GRHA 1N8RD 4CXFA 3OOPA 4CZCA 3I58A 2QYUA 2CUJA 1QQIA 2GZWA 2JWTA 5FLXZ 3RZDJ 4EJTA 4Z4TA 3I55B 1IRGA 3QYEA 1VQ5B 2B0RA 1YI2B 4OIPF 2Q1ZB 4P9UA 1GXQA 2MYSA 1KK0A 1OCZH 4PC1A 3J81k 2CNDA 3PUMA 3OAAA 4V19K 2VT3A 4J00A 4BS9A 1GAWA 3PA1A 3BWGA 1EH8A 2XASA 2M0MA 2Y30A 3K1MA 2KVOA 2XF7A 4M9ZA 5KNLA 3MKWB 1IRZA 3ASPA 1YYVA 2EZHA 4M2LA 2JPBA 2DT5A 2RAEA 2XGDA 2EIXA 2EFNA 2ZSHB 1YW7A 5FB2A 4KJZA 3I1FA 1V5GA 2RV8A 3OWTA 4L18B 3GTPJ 4CUGA 5K7HA 2I1LA 4ZH4F 1K4TA 1VQ6I 1EP3B 2F5EA 3KP5A 3JQRA 4P96A 5JVTA 2ZSIB 2BM0A 2H09A 3IV5A 1REPC 1ETOA 2MGQA 5EGOA 3OYCA 2H27A 5BSYA 1MSFC 3HUGA 4M9SA 3LA7A 5HLIA 5HLHA 2BM7A 1NHCA 4FWTA 2ZXWH 3HJEA 3EPZA 3W2FA 4OJLA 4X07A 3CUQC 3LYCA 4R8HA 1SAUA 2VJIA 1MZBA 2VXZA 1BR1A
chains in the Genus database with same CATH topology
2R7XA 1LVKA 4AU7A 4HNTA 4FXUA 2PYHA 3ZPPA 2CK3A 1MMAA 2CS3A 4YEJA 2ZZFA 2BW3A 2DOAA 4E7KA 2LBFB 3LMWA 4C9YA 4BE0A 4U4BA 3OYAA 4AYBA 3UR3C 4C2TA 1IRXA 2LY1A 3OY9A 4E6KG 3IP4B 3V42A 1HA8A 2XSJC 2GJPA 3TL4X 5HNHA 4OAZA 4BQNA 3KEWA 3DU6A 1KZLA 2INUA 4FETA 2GJKA 2WJYA 1PYVA 3DKYA 2LYCA 5FROA 3DTEA 4R79A 1YE9A 4ZC3A 2BOLA 1E79A 2V31A 1COWA 1IB4A 4HRIA 2FUG2 1JI8A 2VQGA 3OYKA 2V26A 4PJLA 4E7JA 2BSPA 4RLFA 2VASA 1WP6A 4F3QA 2MD0A 3DPLC 1U0JA 3EUAA 3OOCA 3BCDA 4BEHB 1HG8A 4BACA 1JRGA 2L2OA 4PJMA 3OMYA 2LY2A 3D5SC 4RMNA 3BCFA 3K4NA 2W6JA 3F9KA 4Z1MA 4NQWB 3HAGA 1Y56A 4KKTA 4E7HA 1N78A 4E0FA 3LSIA 4IZZA 2V1NA 2ZXHA 3MKZA 4C2LA 3OYBA 3AFHA 4KISA 1OFLA 4RM2A 1HVXA 1D0XA 3BG7A 1KONA 4CCKA 4C30A 1X0CA 1K5CA 4HNUA 1IDJA 3BCAA 3UNGC 4YXWA 3FKSA 3H5NA 4F52A 2GK6A 4Y33A 3B4NA 1WJAA 4OZYA 1W36C 1WPCA 1K6YA 4B43A 3GVLA 2VLAA 1E1QA 4B3GA 2A6TA 2GOXB 3GQAA 2XGJA 1ZELA 2VXDA 5LFAA 3WQZA 3ZR8X 4YRVA 1R6RA 3S8PA 3OYGA 2W00A 3CP2A 3GQ8A 1D0YA 2X6WA 3S32A 4N4NB 5C1EA 2VL8A 3S3OA 1D0ZA 4XN0A 4EATA 3OS0A 2CV2A 2KQRA 5CPRB 4F55A 1NBMA 2Z16A 2UWMA 2JIZA 1O8MA 3B8YA 5CQGA 4KT6A 3TBIA 2KZVA 5HOOA 2WPDA 3L2WA 1QCXA 1O8LA 2V9KA 3A1YA 3NE5B 4XLCA 5CQEA 2DCEA 3ZQQA 3OYNA 1V0EA 5C1CA 2HU9A 3OYHA 2CV1A 1I8DA 1PJRA 4BQOA 2W6IA 1O8EA 3K4CA 4PSXA 3VSTA 4YELA 3M1CA 3ZRGA 3BLYA 3HOSA 2RQQA 4CA0A 1UAAA 3DWLE 1BPLA 3H5AA 1OGOX 3UW0A 1G8XA 1W36D 1UD3A 2R7TA 1WMRA 3EUKL 3DDYA 2D3LA 2WY7Q 2D3NA 2KMUA 2K9MA 1T95A 4KKUA 4G6TB 4Z03A 2JSPA 3OYDA 4B44A 2CV0A 3W2WA 3VYRB 4G6IA 2M4GA 3DPUA 3NWTA 3MKYB 2M5SA 2V4JC 4ASUA 4YZQA 4Z06A 4ZDLA 4E7IA 2V7QA 2JUGA 2Z1DA 3OR1C 1O8JA 3H35A 4XOPA 4XD7A 4CCOA 2UVFA 1TZLA 2VKDA 3H0DA 2HZDA 3K4JA 4XKWA 2JDIA 3ZPNA 1PE9A 2IQ7A 3OS2A 2XDVA 4CCNA 3RCOA 1X19A 2M7BA 4ZYAA 5KCMA 4ITVA 2DIEA 4DK1A 2XAUA 4XM3A 3E0JB 2XZPA 2E1MC 2X51A 3OFNA 1VF7A 3JU4A 3K10A 1WJCA 3G05A 2IXSA 2ZZEA 1GLNA 5IK2A 2WA0A 4BUPA 2L9SA 1NG6A 3QODA 2NSPA 3S3MA 1YX5A 2GOMA 3ONQA 2ZTNA 4II2A 4BXFA 2HLDA 2KL4A 3HG9A 4CCLA 1G59A 2NTBA 2VIXA 4BEHA 3OYLA 4LG3A 4E7ZA 2HPMA 4DNRB 4OZZA 1OLTA 2GJRA 1WJEA 1PLUA 3LSGA 3LMMA 2KRHA 4F93B 5KHDA 3OW7A 3KRGA 1SFKA 2IGNA 3WWGA 3ZXSA 3MD2A 3PUBA 2RNGA 3RSNA 3N05A 2R7UA 2O5RA 1BOBA 3DPTA 3MMYB 1IDKA 1Z3XA 3OL3A 4X0GA 2Z8GA 1O8KA 4BDZA 3VSLA 2F43A 3I3LA 1CZFA 5FL7A 2E1BA 1S9HA 2MC4A 4DNTB 2F5VA 2JA2A 2XZLA 2INVA 1UD6A 1D1CA 4XL9A 1DGWY 4NC8A 2JJ2A 4HWVA 3H5RA 1X1DA 4OJOA 1MNEA 2LC2A 1ERDA 4F92B 3ZSCA 3BC8A 1QU3A 1H8HA 1QJVA 2HNHA 3D5LA 4ZTFA 1UELB 2E5NA 3OR2C 4XONA 2JJ1A 3E1SA 2VPLA 1RMGA 1WTHD 2LZJA 2VQHA 1W0KA 1FMWA 2LREA 2X3HA 1DBGA 1LFPA 4OJPA 4IKFA 1NG7A 4NK8A 2GK7A 4PSWA 4W8QA 3L2QA 4B47A 2Q2EB 1T5EA 1JTAA 4YZXA 2Z2SB 4LITA 4OAYA 4BJ6C 1H8EA 3OEHA 4U87A 2R9VA 4N4OB 3DU5A 3K4LA 3K4BA 3ZGKA 1PKVA 4L8JA 1EA3A 4XN3A 4E7LA 3SEQA 4OJ5A 2EWEA 2VKHA 1X1BA 3PNVA 3W2VA 4GRIA 5JHFA 3D5RC 1DP3A 2KLOA 1D1AA 2R7WA 3VWBA 3ZIAA 1RU4A 1O8DA 4YZAA 2K9LA 3FBIB 2KPMA 1WFXA 3HC7A 4XLHA 3KX2A 2WBMA 3RQ4A 4DBQA 1OGMX 2IS6A 1BHEA 2KRCA 3PNTA 2OV7A 2W4SA 3EQOA 3KEYA 5HNFA 4RM3A 3L2UA 2WAFA 4PMHA 3PNYA 2IGMA 1UD8A 3HPHA 1DGRM 4MR0A 4KITB 2VBMA 2QY1A 3VDXA 2JVHA 3FPPA 2MFZA 3FBNB 4XQFA 1I18A 3DQVC 4XR6A 3J7AY 2R7QA 5CDFA 2VJ5A 4Y4RA 2AQEA 2PJRB 1O8GA 4CH7A 1T0FC 3SEZA 2KDOA 4P22A 2WY8Q 1X1AA 1OHHA 3OPOA 3ZCOA 5HKKA 4HEA2 5FRNA 4CSWA 3S93A 2AQFA 3VSKA 2O04A 4HPQA 2QXZA 2R7SA 2O1DA 2CUZA 2DT6A 2NZMA 3K6GA 2X8KA 2XNDA 4Z05A 4TSFA 2R4GA 4XLEA 3VMWA 3DLAA 2L5QA 1KMHA 1OOCA 2M3AA 4BQQA 4P1WA 2HVRA 3LL7A 3OEEA 2W7NA 3EUHC 2WZPP 4IX7A 2ELJA 2OUMA 2WAQA 3H9QA 1BLIA 1PXZA 4II3A 3T51B 2M7AA 4NK6A 4DJAA 4XKCA 1DQUA 2X85A 3K4KA 3VYTB 2R7VA 4D9JA 2CFOA 4P5OA 1W9XA 5TGTA 5LD2C 4TKOB 1KCDA 2R7OA 3U21A 3FHNA 4XLAA 4DK0A 2NTQA 2LBFA 3PJRA 3LFUA 3OYFA 2Y0SA 2RREA 3H9JA 4XNFA 3IUOA 4LIVA 4B3XA 4DBRA 4U49A 3GQBA 2I8DA 4G7WA 1AIRA 4BE1A 2R7RA 3DEEA 4OWRB 1UD4A 4ZTJA 3FKJA 2F1MA 3NWSA 3T56B 4XORA 2QKMB 3A3GA 1MMGA 2QKLB 1P9QC 2X1CA 3W2AA 1E0EA 3SUCA 2E1MB 2ZZGA 2LG4A 3CZ6A 4URRA 1YX3A 3C2HA 3OIPA 2K3PA 2O0VA 3OYIA 2IS2A 2M4KA 4NUBA 2DJIA 1MMDA 2IGOA 4XKBA 1V0FA 2DXIA 3GBGA 2CW7A 3KYLA 2A5WA 4W8SA 3DKXA 1N75A 3PL8A 1MABA 3AL0C 1LDKB 4BJ5C 2NT9A 1MW7A 3BH4A 3HL2A 2XF5A 2W1OA 2ZFUA 3OIQA 2UVEA 1XG2A 4JMQA 1KTWA 4IQ4A 5HVQC 3AKZA 3DTKA 3OYMA 4BL0B 3JURA 1V5FA 3IAS2 2NT6A 4ZJZA 3OE7A 1WJBA 1D1BA 3HOTA 3VSVA 2X6XA 2WB1A 3RPUD 4DGWB 1VJSA 3EQNA 2ZTGA 1BR2A 2V6EA 2PYGA 1AA7A 2VBEA 1WJDA 4BJTA 2KP6A 3C2GA 3VR6A 3SYTA 3BG6A 2XZOA 3QYBA 4HSRA 4FASD 1O8FA 2X6YA 2CMPA 3LSKA 4PFOA 3VYUB 1EFRA 2O0WA 2W82A 2IS1A 2PJRA 4EW9A 1BMFA 3GVKA 4NC7A 1OB0A 3LNNA 5DN6A 4JQFA 2F4IA 1Z3YA 3OOUA 4PJNA 3HXLA 1HZEA 1W0JA 2QE7A 3CMMA 3G2BA 3K70C 3HUGB 1J09A 4ZDOA 1OR7C 1Z7LA 4IQJA 1BR4A 4NNJA 4F91B 3SDBA 2CW8A 3OYEA 2NTPA 3T53B 4MXNA 4Y3OA 3BCBA 4BE2A 1V5EA 2BVMA 3I9V2 3PFYA 1MNDA 1DBOA 2UUZA 4XMYA 3IAM2 1WJ5A 4PUSA 2JVGA 2E60A 2VB6A 2BVLA 2OC6A 4HSTA 4JOMA 4DIQA 1RWRA 2V7FA 4GQNA 2LRDA 5HLTA 2X1DA 2VQLA 3QYFA 1TT0A 2IS4A 2BW3B 3DTIA 1WJFA 1UG0A 2XC7A 2VQCA 3H94A 3L2VA 3BC9A 4PK4A 4BU2A 4E4HA 3H9GA 1QHGA 4ZDPA 4BDYA 1MMNA 3OL4A 3FDYA 2HPIA 2X1EA 3CF2A 4C2UA 2NSTA 2LOOA 2XF6A 4CCJA 1FX0A 1SKYB 1FMVA 4YZ0A 1QHHD 2PECA 1UD5A 3CJRB 4PFPA 3A35A 3RTRA 2ZXIA 3OYJA 4J01A 3SZGA 3PSFA 1E3XA 2X53S 2ZZQA 1OFMA 1KCCA 4HG2A 2P0WA 4MLOA 3A3BA 1K28D 3HPGA 1BN8A 2WSSA 2LH9A 1LKXA 2NOJB 3K70D 3B90A 4W8RA 5FRMA 2Z6BD 1EE6A 4KKSA 4XKVA 5AMVA 4DOZA 2L9NA 1VBLA 3VSUA 2L7KA 5CKTA 2CH0A 2WAEA 4OJ6A 3PSIA 3GQ7A 1N77A 2K5CA 2VJ4A 4D1QA 2KHMA 4ANJA 1IA5A 3GVJA 1VZ0A 3CESA 2DT7B 2IGKA 3L2RA 4U7BA 3GRHA 2ODLA 4XLFA 2PMZA 4CZCA 3M8JA 2CUJA 2O17A 2WADA 2HVSA 4TT3A 3QYEA 2MABA 3A2KA 2Q1ZB 2MYSA 4HIZA 3S3NA 3A4CA 1NRKA 4W8TA 3OAAA 4UZUA 4J00A 4B48A 4BS9A 4LIUA 3VMVA 4B3FX 1Z21A 2HQAA 2M0MA 2KVOA 2XF7A 2VJJA 5KNLA 4CCMA 3MKWB 4QPQA 4PJJA 4G7XA 1GQ8A 4BGDA 1X4PA 3LSHA 2ZSHB 1O8HA 4KJZA 3K4MA 1V5GA 3W3CA 3OWTA 2F6CA 4CUGA 4QPOA 3HKZA 2E5ZA 2UV1A 3LSMA 4XOTA 3QOEA 1Y6IA 1E3ZA 4AVZA 1UD2A 2WJVA 3T9GA 2ZSIB 2VBKA 2HDWA 1E43A 2QX3A 3FY3A 3AL0B 1E1RA 2V4DA 3CJQB 1X4OA 3OYCA 1H80A 3TMOA 4H4KC 4E7SA 1NHCA 1X1CA 1O88A 3EPZA 1VLYA 4OJLA 4RLQA 4I84A 3CP8A 3VYSB 2XOKA 1O8IA 2HVQA 3GQ9A 1SAUA 3OS1A 2VJIA 2VXZA 1BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXN A;  2NTP A;  1O8J A;  4XOP A;  2PYH A;  3ZPP A;  1DBO A;  2O04 A;  2UVF A;  1PE9 A;  4XMY A;  2IQ7 A;  2QXZ A;  4XKW A;  4YEJ A;  2O1D A;  2NZM A;  1RWR A;  3LMW A;  4U4B A;  4Z05 A;  4XM3 A;  3VMW A;  4XLE A;  1OOC A;  2INU A;  1PXZ A;  2NST A;  2NSP A;  4NK6 A;  2X85 A;  4YZ0 A;  2PEC A;  1IB4 A;  2NTB A;  1KCD A;  2BSP A;  4XLA A;  4OZZ A;  2NTQ A;  1PLU A;  1KCC A;  1OFM A;  3KRG A;  3WWG A;  4XNF A;  4U49 A;  1BN8 A;  1AIR A;  1JRG A;  1HG8 A;  3B90 A;  4W8R A;  1IDK A;  1EE6 A;  4XKV A;  4XOR A;  2Z8G A;  5AMV A;  1O8K A;  1CZF A;  1VBL A;  3VSU A;  4OJ6 A;  3SUC A;  2INV A;  3GQ7 A;  4XL9 A;  4HWV A;  4C2L A;  4URR A;  4OJO A;  1OFL A;  3ZSC A;  1IA5 A;  2O0V A;  1QJV A;  1X0C A;  1K5C A;  1IDJ A;  4XON A;  3GRH A;  2ODL A;  4XLF A;  1RMG A;  3B4N A;  4OZY A;  2X3H A;  2O17 A;  1DBG A;  4W8S A;  4OJP A;  3GQA A;  4NK8 A;  4W8Q A;  2NT9 A;  2UVE A;  3GQ8 A;  1JTA A;  1XG2 A;  1KTW A;  4W8T A;  4YZX A;  2X6W A;  5C1E A;  3VMV A;  4XN0 A;  3JUR A;  4XN3 A;  4OJ5 A;  2VJJ A;  2EWE A;  2NT6 A;  1GQ8 A;  1O8M A;  1RU4 A;  3B8Y A;  3VSV A;  1O8H A;  2X6X A;  1O8D A;  4YZA A;  4XLH A;  1OGM X;  1QCX A;  1O8L A;  3EQN A;  4Z06 A;  1BHE A;  4XLC A;  2PYG A;  5C1C A;  2VBE A;  3EQO A;  4XOT A;  4AVZ A;  4PMH A;  3T9G A;  2VBK A;  1O8E A;  3VST A;  4YEL A;  2QX3 A;  1O8F A;  3FY3 A;  4MR0 A;  2X6Y A;  1OGO X;  2O0W A;  2VBM A;  3UW0 A;  1H80 A;  2QY1 A;  1WMR A;  4EW9 A;  4XQF A;  4XR6 A;  1NHC A;  1O88 A;  4Z03 A;  4OJL A;  1O8G A;  4I84 A;  1O8I A;  3GQ9 A;  2VJI A;  4YZQ A; 
#chains in the Genus database with same CATH topology
 2UXN A;  1OJL A;  2R7X A;  1IN8 A;  1LVK A;  4HNT A;  3R60 A;  1ZR4 A;  2PYH A;  2DA3 A;  3ZPP A;  5IT3 A;  1STZ A;  3A02 A;  3PUN A;  2F4M B;  3C2B A;  4Y9U A;  2LBF B;  1JUS A;  3HHH A;  3LMW A;  4C9Y A;  2DA2 A;  4BE0 A;  1IF1 A;  4MTE A;  1IRX A;  2LY1 A;  4E6K G;  3IP4 B;  2KT0 A;  3V42 A;  4IHW A;  2ECC A;  2P3M A;  1QVF B;  3KLN A;  5EG0 B;  1NJI D;  2GIV A;  2PJP A;  4KMU X;  4PZJ A;  1FBQ A;  1J59 A;  1E79 A;  2BY3 A;  2LYC A;  3WTX C;  3DTE A;  3SFZ A;  1EWY A;  2B7B A;  1EH6 A;  3FXR A;  3TGN A;  3KP4 A;  3PQJ A;  2TRT A;  3E6C C;  4WF2 A;  1Y39 A;  4HRI A;  3CPX A;  4IL6 C;  2OZU A;  5DUI A;  1ETX A;  2BSP A;  1GJR A;  1XDU A;  5F4O A;  1WP6 A;  2MD0 A;  1H9T A;  2XPU A;  4EJO A;  1P2F A;  1IN4 A;  3KP3 A;  1VQL I;  4GDF A;  3K4N A;  4LMY A;  3ML6 A;  3CCU B;  2PX9 A;  2XT4 A;  2LP0 A;  4Z1M A;  1B6A A;  1JKQ C;  5IP9 J;  4P12 A;  2JA5 J;  1N78 A;  3LSI A;  2UXX A;  1ETV A;  1ACI A;  2ZXH A;  1IN5 A;  4DZP A;  5J4V A;  3G4S I;  3BG7 A;  3QWL A;  1I6X A;  1SAX A;  2V7W A;  2QEX B;  4HNU A;  1E3H A;  3I4P A;  1IDJ A;  3BCA A;  2XTY A;  1SMT A;  4F52 A;  4HQE A;  1SVM A;  3E5X A;  4HW0 A;  4BHB A;  1W36 C;  3GVL A;  3G73 A;  1VQ8 I;  3LSJ A;  1WU8 A;  1JA1 A;  5LFA A;  3WQZ A;  3ZR8 X;  4YRV A;  3U1K A;  2DJN A;  1HQC A;  3LA3 A;  2OBS A;  3J80 Z;  3DU1 X;  1XDS A;  2X6W A;  3S32 A;  3BG9 A;  3W6V A;  4X0C A;  3SKB A;  3M3Y J;  5C1E A;  3JRH A;  2EIJ H;  3W5U A;  2BYV E;  2CV2 A;  2JPC A;  1FY7 A;  1NBM A;  2EZL A;  2Z16 A;  2A6H F;  1ZG3 A;  3ELK A;  3MZ8 A;  4KT5 C;  2OQR A;  5CQG A;  3G3Z A;  2I10 A;  3TBI A;  1YIJ B;  5HOO A;  2MSY A;  1UMK A;  1J5Y A;  3QE2 A;  3I64 A;  4LGW A;  1HKT A;  2DET A;  2DFI A;  5D4S A;  5CQE A;  5K7Z A;  1V0E A;  3V7S A;  3OYN A;  1DDG A;  3CCV I;  2CSO A;  1LQ1 A;  1PJR A;  3VST A;  4PSX A;  3GF2 A;  1MBK A;  2LFB A;  3M1C A;  5F08 A;  1Z9C A;  2B7C A;  3DCF A;  2V9V A;  1G8X A;  4IXA A;  5L3G A;  1WMR A;  3GME A;  4M6V A;  3SQV A;  1AMO A;  4NHJ A;  3G6E B;  4C3J J;  5LGN A;  2OU2 A;  3CCS B;  4Y7N J;  4KKU A;  3BH7 B;  2W48 A;  5C44 J;  3H3V K;  4A3G J;  2XEX A;  2FXA A;  3NWT A;  4NB5 A;  2FNP A;  4LJZ F;  4ETS A;  2DFE A;  4Z06 A;  4ZDL A;  1XD7 A;  2JUG A;  4IHV A;  3OR1 C;  2WZN A;  1O8J A;  1FPQ A;  3ZP5 A;  4XOP A;  2RDP A;  2UVF A;  2VKD A;  1SD7 A;  1UZC A;  2HZD A;  3K4J A;  5ICE A;  1MGT A;  2HTJ A;  4OOX A;  3FXQ A;  4RD6 A;  3RCO A;  2M7B A;  4RGS A;  2FBH A;  1N07 A;  2XAU A;  4XM3 A;  2OTL I;  3M1E A;  5FKK A;  3V7A A;  2XZP A;  5IYP A;  5FO5 A;  2X51 A;  4XRM A;  3OFN A;  4R1H A;  3G05 A;  1FP2 A;  2OD5 A;  2ZME A;  4LLN A;  1WWX A;  1FYK A;  3WNC A;  1GLN A;  1H89 C;  1EF4 A;  4KN4 X;  2STW A;  1UHW A;  1XGN A;  2FSW A;  3QOD A;  2ISY A;  1YX5 A;  4I7H A;  5GV8 A;  4UY8 I;  4II2 A;  2PEX A;  2Z3Y A;  3HG9 A;  2NTB A;  3S2W A;  2VIX A;  1R1T A;  1DUX C;  2V7X A;  2OCE A;  3OP1 A;  1SFE A;  4WWV A;  3LSG A;  3WWG A;  4M72 A;  3E6M A;  5LBQ A;  1KD1 D;  3WU1 B;  3ZXS A;  3MD2 A;  4I76 A;  2RNG A;  1TQP A;  3RSN A;  1N08 A;  2BE5 F;  2O5R A;  1BOB A;  3DPT A;  2W25 A;  4JX4 A;  5JHU A;  4OPV A;  2EH3 A;  2PN6 A;  3WTV C;  3VSL A;  3I3L A;  1AU7 A;  3E7L A;  4DNT B;  5FJ8 J;  4PGO A;  2INV A;  4RB3 C;  4LBZ A;  1LDD A;  2VBT A;  3DBL B;  4CYC B;  2EZI A;  2MH2 A;  1RZ4 A;  2HNH A;  2XKO A;  3SYJ A;  4HF2 A;  1UEL B;  5EZH A;  3RIQ A;  4NCN A;  2JA6 J;  4XON A;  3Q3A A;  2VBW A;  2HYG D;  1RMG A;  1OB5 A;  1YJW I;  1ZLK A;  4BXX J;  2PIA A;  1T33 A;  1FMW A;  3WHC A;  1E64 A;  1LFP A;  4FIS A;  3ZUG A;  1TNT A;  1SVL A;  3MCZ A;  2PQ8 A;  3F8M A;  4PSW A;  3L9F A;  1GUU A;  4K1X A;  4W8Q A;  2QN6 A;  3NAR A;  1XMK A;  4YZX A;  2Z2S B;  5DUK A;  4OAY A;  1A6I A;  5IYN A;  1B4A A;  3DEU A;  4U87 A;  1PVE A;  4HOB A;  5F0H A;  3KP7 A;  3CMA B;  4M6Y A;  1BJZ A;  4G9Y A;  3FM3 A;  3VNU A;  1XGS A;  1X1B A;  3PNV A;  3WE2 A;  1DP3 A;  4RD0 A;  3ZIA A;  1RU4 A;  2DTZ A;  2XRL A;  3FBI B;  3KX2 A;  1OGM X;  1PJ5 A;  4Z4W A;  2IS6 A;  3AG2 H;  1MBG A;  1VTN C;  1S29 A;  2DER A;  2OV7 A;  3ABK H;  2W4S A;  4JP0 A;  4RM3 A;  3L2U A;  2WAF A;  4PMH A;  2JRM A;  4LD5 A;  3U2R A;  4DYC A;  1Y1W J;  4MR0 A;  1NB9 A;  2M0C A;  1Z91 A;  1VQM I;  2HDN B;  3FPP A;  3JSO A;  1QRB A;  1LEA A;  1WRJ A;  3I5U A;  3R0J A;  3V8J A;  4RBO A;  1I18 A;  3ECH A;  1G7T A;  4AID A;  2XTX A;  3JRA A;  4Y4R A;  3FHZ A;  5EEA A;  4A5M A;  2ID6 A;  2PJR B;  1O8G A;  4EQQ A;  4ZCL A;  3LO8 A;  2M45 A;  1X1A A;  2WY8 Q;  3QP5 A;  2VT2 A;  3CQZ J;  2OBR A;  3N97 A;  2JSC A;  3J7Z I;  2EB7 A;  2C77 A;  1TVC A;  1HF2 A;  2XIG A;  2AQF A;  2VBY A;  3S93 A;  2CUE A;  2IRF G;  2R7S A;  1MBF A;  4OIR F;  2QQB A;  4AYB N;  5H2F C;  2EIK H;  2XND A;  2YWF A;  2RQP A;  3CCQ I;  3DLA A;  1KMH A;  4G1B A;  4CGZ A;  1F43 A;  3P26 A;  4A0Y A;  4Q5S F;  3F8N A;  3ZQH A;  2WZP P;  4IX7 A;  2ELJ A;  2OUM A;  1QGP A;  1BLI A;  2ZL6 A;  4II3 A;  1MH4 A;  5CVJ A;  5B6I A;  3KCC A;  4NK6 A;  3U6K A;  3K4K A;  3OIO A;  3BZK A;  4I02 A;  3PM1 A;  5F6F A;  4B4C A;  2CFO A;  2BM6 A;  1KCD A;  2HYF A;  4OM9 A;  5TRD A;  4L9T A;  2LBF A;  1XGM A;  3LFU A;  3ZMU A;  1N05 A;  3OYF A;  2Y0S A;  4XNF A;  4U0W A;  4B3X A;  3IUO A;  1DP7 P;  1M1K D;  4BE1 A;  1T6Y A;  1G6N A;  5J3O A;  5HDG A;  1JJ2 B;  3A01 B;  3E5Q A;  4RJL A;  1V5V A;  3T56 B;  4L5E A;  1P92 A;  1MMG A;  2VC0 A;  1TQI A;  2P8T A;  2QKL B;  3ECO A;  1P9Q C;  2RVC A;  1ZH5 A;  1TYX A;  2E1M B;  3WG9 A;  4P3Y A;  2LG4 A;  1HCR A;  2Y2Z A;  1CNF A;  5FLX K;  3TP0 A;  2QLZ A;  2ZC2 A;  3OIP A;  4A3I J;  2LVS A;  2YWG A;  2R5Y A;  3PET A;  2O0V A;  1OR7 A;  2NVU B;  3D0S A;  2M4K A;  4X1E A;  2DJI A;  1TTT A;  1MMD A;  3VNV A;  1YHQ B;  2IGO A;  4XKB A;  2V7V A;  1V0F A;  2DXI A;  1ENH A;  2A5W A;  2FML A;  3DF8 A;  4W8S A;  3PL8 A;  4M71 A;  5B1A H;  1DAR A;  3HSR A;  4LOC A;  1LDK B;  5D5V B;  1MW7 A;  3HL2 A;  1BW5 A;  2UVE A;  1KTW A;  1WGX A;  1XSX A;  3I54 A;  3JRE A;  4ZYE A;  1JUM A;  2EFQ A;  3QAH A;  2GXA A;  2CBX A;  2ECB A;  3AAF A;  4A3C J;  3CB4 A;  2NT6 A;  2ZBU A;  3IKV A;  4ZJZ A;  4FTH A;  2QA4 B;  1Q1V A;  4G7H F;  3TO9 A;  3WBK A;  4AM3 A;  1KQ5 A;  2P6S A;  2DFH A;  2OBP A;  2WB1 A;  3FMR A;  3RPU D;  5DM6 F;  2GPJ A;  1E3O C;  4XRF A;  3EQN A;  1JKR C;  3S1M J;  2V6E A;  2L3D A;  2PYG A;  3F6O A;  1Y0Y A;  4A69 C;  4S05 A;  4EJV A;  4CO8 A;  1SAN A;  1MDM A;  2VYQ A;  1ZM9 A;  2HYJ A;  4JX5 A;  5F64 A;  5JLV C;  3VEP A;  2QSG X;  3LAJ A;  3GW2 A;  4IPA A;  4FAS D;  4PFO A;  1KZH A;  3A8J A;  3HOU J;  1EFR A;  2V1U A;  2K9Q A;  2A5Y B;  2O0W A;  2XB5 A;  4PGH A;  1JTY A;  4X6A J;  4EW9 A;  1VND A;  4NC7 A;  2JT1 A;  3GFI A;  1LE8 A;  1BA5 A;  4YAO A;  1B23 P;  2JRT A;  1IN6 A;  3B6C A;  5DN6 A;  5EGO B;  3ISX A;  1J7K A;  3JRB A;  3G2B A;  3HUG B;  1OR7 C;  1BR4 A;  4NNJ A;  4MXN A;  1RR7 A;  5BMZ A;  4PAB A;  2NTP A;  3GFL A;  2O0Y A;  3I9V 2;  3L2C A;  1K78 A;  5F4J A;  2HWV A;  1IDZ A;  1ZQ3 P;  3KE2 A;  4PUS A;  4QHY A;  2E60 A;  2VB6 A;  4B09 A;  4HST A;  1GT0 C;  1RWR A;  4LG0 A;  3W6J B;  1FP1 D;  4UXN A;  5IT9 Z;  3G71 B;  2VQL A;  2NVQ J;  2CO5 A;  5HZB A;  1TT0 A;  5DS9 A;  3K2A A;  3V4G A;  4HV6 A;  1S6L A;  3H94 A;  1SMY F;  4HF0 A;  2O6G E;  4DQL A;  5J35 A;  1KU7 A;  4X7D A;  4PK4 A;  5FGM A;  2J8I A;  3H9G A;  1T39 A;  1EJ9 A;  3KL9 A;  3ZBU A;  3OL4 A;  3FDY A;  2C78 A;  1FNN A;  2K3F A;  1T08 B;  4RS8 A;  1VQN I;  2D74 A;  1IZ1 A;  2ME6 A;  2G7U A;  4YZ0 A;  2R3S A;  3R61 A;  5L3F A;  2DDA A;  1HOM A;  2Q6K A;  1P6R A;  2HS5 A;  1HLV A;  4ZV4 A;  5DYM A;  2DA1 A;  3ROU A;  2ZZQ A;  3OJW A;  3A3B A;  4ZGQ B;  3HPG A;  5J1Y A;  4KUM A;  4W8R A;  3K70 D;  2L9R A;  5K1Y A;  1HF0 A;  4KMF A;  1Q82 D;  4RDJ A;  5AMV A;  3KIO A;  1PJ6 A;  2KIF A;  1ZRD A;  2HQR A;  4E70 A;  3PUF A;  5DD8 A;  1MJA A;  3KP6 A;  2RC5 A;  2KHM A;  1FEX A;  4ANJ A;  3T1B A;  1IA5 A;  3GVJ A;  2B0L A;  3L2R A;  3GZN B;  2JMW A;  3CCR B;  1UMQ A;  3J80 K;  1FC3 A;  4XLF A;  2QZA A;  2L01 A;  3M8J A;  1K9M D;  1ZAO A;  3ZMD A;  2HVS A;  1S0U A;  5D5X B;  4A6E A;  3JRC A;  2WTE A;  2HDD A;  1FND A;  1NRK A;  1A6Q A;  4UZU A;  4WQM A;  4W8T A;  1FTT A;  1PUF A;  4M4S A;  4CYC A;  3WE3 A;  4B3F X;  1B59 A;  2EK5 A;  2QMU A;  4CCM A;  3CC2 B;  2HKO A;  2TDX A;  4G7X A;  1X4P A;  1AIP A;  2HOS A;  4G94 A;  1XX5 A;  1O8H A;  3ABL H;  3WGG A;  2V5I A;  2F2E A;  2H8W A;  2F48 A;  1VQP B;  3QPH A;  3P5J A;  3HKZ A;  3FPK A;  1AHD P;  4XOT A;  2WJV A;  2BY1 A;  1Y6I A;  2ZNY A;  3QOE A;  1MNM C;  1E63 A;  4G1V A;  4PC6 A;  1U9O A;  2ISZ A;  2HDW A;  2QX3 A;  2WV1 A;  1H0M A;  4ESJ A;  3AL0 B;  1E1R A;  1FRQ A;  3KYC B;  2V4D A;  1X4O A;  3DV8 A;  1H80 A;  1QUE A;  3BQZ A;  3Q0V A;  5F1R A;  1BM9 A;  1NTC A;  4GO1 A;  2K40 A;  3WTY C;  4JRA C;  2CUF A;  2M8G X;  2COB A;  4HF1 A;  1JB9 A;  4RLQ A;  1PP7 U;  1NH3 A;  2XOK A;  2RNJ A;  2HVQ A;  1B9M A;  1O57 A;  3RKX A;  4XBF A;  5E3N A;  1YIT I;  1HSJ A;  4AU7 A;  3DLL F;  4UVB A;  4ENM A;  3LSR A;  4G12 A;  5D8L B;  1MMA A;  2BZT A;  1BI3 A;  2CS3 A;  4YEJ A;  2ZZF A;  2LKP A;  4E7K A;  1BI0 A;  4ROX A;  2VFN A;  4OMZ A;  3BZC A;  3JW4 A;  1O3Q A;  3M07 A;  4OOV A;  2VZL A;  4M73 A;  4C2T A;  4FX0 A;  1S72 I;  1HA8 A;  2VPR A;  2H8R A;  1B72 B;  3TL4 X;  5HNH A;  3KP2 A;  4D5F A;  4LB5 A;  3KEW A;  4KIB A;  1O3S A;  4MNU A;  2INU A;  4RM0 A;  1P4M A;  4G8X A;  5TV2 A;  3O6B B;  4MYT A;  2RKH A;  4R79 A;  5ICF A;  4F7D A;  2ZME B;  2BOL A;  3CDH A;  1BW6 A;  3QU3 A;  1JI8 A;  5AIQ A;  3OYK A;  2P5L C;  1IJE A;  1YS6 A;  1G7C A;  3DPL C;  3EUA A;  3OOC A;  3BCD A;  1JRG A;  1E62 A;  4PJM A;  3OMY A;  3E20 A;  1QGA A;  2NS0 A;  4RMN A;  3D5S C;  1IV6 A;  2W6J A;  3F9K A;  3DBR B;  4UNO A;  4M3F A;  4IZZ A;  2X48 A;  4AIK A;  3BDD A;  3OYB A;  3AFH A;  4KIS A;  1OFL A;  1HVX A;  2J5O A;  2DQR A;  1D0X A;  2P6T A;  1HBX G;  3HIF A;  4EH1 A;  4C30 A;  1ZRC A;  1K5C A;  2A05 A;  2OK8 A;  3UNG C;  3FKS A;  3HSF A;  4JK1 X;  1RI7 A;  4D0P A;  5ILU A;  2E35 A;  4OZY A;  2JZY A;  4PGG A;  1WPC A;  4B43 A;  2VLA A;  1E1Q A;  1G3T A;  2A6T A;  3CJN A;  3GQA A;  4RPB A;  5HS7 A;  4XRS A;  4AD9 A;  4OPO A;  4YHB A;  2X9D A;  1ZM3 A;  3ONU A;  2NVT J;  3QU6 A;  1YIO A;  2ZBK A;  1RKT A;  3CD6 B;  3CP2 A;  3GQ8 A;  3E5U A;  1KK3 A;  2VL8 A;  4ASN A;  3H3Z A;  3S3O A;  1D0Z A;  4XN0 A;  4EAT A;  3OS0 A;  4RD1 A;  1OB2 A;  4P26 A;  4F55 A;  4A3L J;  1UCR A;  1O8M A;  5HOD A;  1CQX A;  4KT6 A;  5L3E A;  3S2H J;  5IYC J;  1K7A A;  1YJ9 B;  2V9K A;  3NE5 B;  4RDL A;  3I4N J;  5K5Q A;  3ZQQ A;  5C1C A;  5GPA A;  2EFP A;  1R00 A;  2HU9 A;  1RQR A;  2CV1 A;  1I8D A;  2IA0 A;  3BRO A;  4BQO A;  2W6I A;  1TYU A;  1VQ4 B;  3HOS A;  4P25 A;  3BLY A;  4GYI A;  2RQQ A;  3BZ6 A;  4CA0 A;  4J19 A;  3DWL E;  1QX4 A;  1YLO A;  1ZM2 A;  3KZY A;  3UW0 A;  4IJA A;  1TC3 C;  3M8E A;  5BPI A;  1YJN B;  3EUK L;  3NEU A;  1TW2 A;  4MGR A;  5LGT A;  3T8T A;  2VFM A;  3DDY A;  4MQV A;  1KU2 A;  2D3L A;  2WY7 Q;  1F60 A;  2KMU A;  3WU0 A;  1ETQ A;  2JSP A;  1OGJ A;  4TMV A;  3F72 A;  3JAM Z;  3MVP A;  4RAG A;  3W2W A;  3VYR B;  4G6I A;  4XLN F;  3MAJ A;  3HTS B;  1GVD A;  4ASU A;  1E17 A;  3A8K A;  1FYM A;  3AGQ A;  3Q9V A;  1TBX A;  2ZKZ A;  4EGY A;  3PFI A;  2E7X A;  3AG1 H;  3H35 A;  2M1B A;  3RI4 A;  4I0A A;  4PDK A;  1KYW A;  3H0D A;  2JDI A;  3I55 I;  4NC6 A;  3OS2 A;  2XDV A;  5CYV A;  4CCN A;  1YI2 I;  4ZYA A;  4BPR A;  2Q0O A;  4XSZ F;  2E1M C;  2YX4 A;  4M3G A;  4KA4 A;  4IW3 B;  3JU4 A;  4G6Q A;  4AUX A;  3K10 A;  2WYR A;  1FDR A;  3SJP A;  3S16 J;  2XRO A;  2BGC A;  4I0B A;  2V1D A;  1XTA A;  2K9N A;  3GEZ A;  1AKH A;  2L9S A;  1NG6 A;  3FXK A;  3WTT C;  2JJ7 A;  3S3M A;  1HA3 A;  3GLX A;  4X7C A;  1OMI A;  4BXF A;  4BBS J;  2HLD A;  5KSW B;  1TLH B;  1QGZ A;  3BG3 A;  5M5Y J;  3IHU A;  3OYL A;  4UAJ A;  3H1C A;  4LG3 A;  1R49 A;  2HPM A;  3O2P E;  1AOY A;  2J7K A;  5HS8 A;  3PIO F;  1JGG A;  3KRG A;  1J2X A;  4F7Z A;  1QRY A;  3BR3 A;  5KHD A;  3CRZ A;  3TOB A;  3JTG A;  2DDB A;  4UHT A;  2R7U A;  2XC1 A;  3AG4 H;  2L7Z A;  3K2Z A;  3D1N I;  1IDK A;  2R93 J;  1V3F A;  1OYY A;  3OL3 A;  1L3L A;  3TW6 A;  4AF6 A;  3TO7 A;  1O8K A;  3SZP A;  4BDZ A;  2XGX A;  4UB6 C;  1VQO B;  1S9H A;  2MC4 A;  5E8I A;  2JA2 A;  1D1C A;  4XL9 A;  2JJ2 A;  3K9T A;  4HWV A;  3H5R A;  1X1D A;  1MNE A;  3GZ5 A;  3OZV A;  4HAM A;  1X1P A;  1H8H A;  2M2E A;  1T0F A;  1X3U A;  2L0K A;  3ASQ A;  3LQE A;  3DKW A;  3IH4 A;  3BH6 B;  1YLF A;  1MIJ A;  5F27 A;  2JQ7 A;  2R5Y B;  2VQH A;  2YR2 A;  3MHP A;  4P9S A;  4WZL A;  4ZZL A;  1T38 A;  2XGE A;  3I56 B;  1DBG A;  2BX6 A;  4OJP A;  1P7I A;  2GA1 A;  5LMZ A;  2FD5 A;  4NK8 A;  1QO0 D;  2Q2E B;  3TW7 A;  3AVT A;  4LIT A;  1FX7 A;  1I39 A;  3JCU C;  5B1B H;  3K4L A;  1O4X A;  3F8C A;  3W2G A;  1D8J A;  1LJ9 A;  4XN3 A;  3GXO A;  3I53 A;  5LEK A;  2EWE A;  2Z5U A;  1QA1 A;  4Y9R A;  1BBY A;  3W2V A;  3BPV A;  3AST A;  2KLO A;  4X06 A;  4H0E A;  4Q7J B;  1U8B A;  1Y0N A;  2KPM A;  3HC7 A;  3TH0 A;  1FIA A;  4QFM A;  2NVY J;  3M8F A;  1VQK B;  2B63 J;  2DU9 A;  4M74 A;  1QVT A;  4MO7 A;  2E19 A;  1CLW A;  3EQO A;  3KEY A;  2F4O B;  3KFW X;  2DPU A;  2O61 A;  1W87 A;  1ZYR F;  3A0B C;  2IGM A;  3PNY A;  4I6Z A;  5FLV A;  1QBJ A;  1UD8 A;  1QA2 A;  1DGR M;  2LDU A;  3E97 A;  3CCU I;  3ZN1 A;  2HTS A;  3MMP A;  3RPU A;  2VBM A;  1MDM B;  2YU9 J;  3JQP A;  1ZR2 A;  2BY2 A;  1E3P A;  2HCJ B;  1IN7 A;  2OF7 A;  3P4G A;  3J7A Y;  2B7E A;  2R7Q A;  4Q47 A;  5IOZ A;  5CDF A;  4Q4Z F;  5K5R A;  2QEX I;  4RGR A;  4CH7 A;  2ME0 A;  5EEH A;  1LE8 B;  1T0F C;  3CME B;  3SEZ A;  5IT9 K;  5GPC A;  4N0B A;  1R71 A;  4HA8 A;  4M9X A;  3CPW B;  1N0U A;  1W34 A;  2PFB A;  4HEA 2;  5FRN A;  3VSK A;  2QQ8 A;  5E8G A;  2QXZ A;  4IHT A;  1QNT A;  1T6S A;  2O1D A;  2DT6 A;  1F4K A;  2NZM A;  3K6G A;  1F9N A;  1Y0R A;  1RR8 C;  1K78 B;  4TSF A;  2R4G A;  3LVB A;  5A8A A;  3AVX A;  3CCJ B;  2FVG A;  2TCT A;  3VMW A;  3TP3 A;  1I7P A;  2X6O A;  5EMN A;  1FZP B;  2M3A A;  4BQQ A;  3RKQ A;  5BSX A;  1OOC A;  3LL7 A;  5FKL A;  4LG0 B;  4I99 C;  3OEE A;  2NYX A;  1WSU A;  5IYW A;  2W7N A;  3FXJ A;  2GWR A;  4ZYD A;  3UKG A;  2CYY A;  2BXZ A;  5E6T A;  3GTO J;  3B78 A;  2R5Z A;  2NXN B;  4DJA A;  5LEJ A;  2P7C B;  2FOK A;  1YIJ I;  5LD2 C;  2IP2 A;  4IO9 F;  4I2O A;  2Q6L A;  5F0F A;  1SEU A;  3A1P A;  1H8A C;  2QGU A;  2RRE A;  4IHX A;  4BAY A;  3KZZ A;  1AIR A;  1B72 A;  3DEE A;  1Y8R B;  2MA3 A;  1UD4 A;  4ZTJ A;  1WI3 A;  3FKJ A;  2F1M A;  2OTL B;  2XT2 A;  3LA2 A;  3MWM A;  1FBU A;  1N25 A;  3H0G J;  5D8K B;  3A3G A;  2GAU A;  2O8X A;  2X1C A;  3G6E I;  1LB2 A;  4YC5 A;  1IB0 A;  1RUO A;  3ABT A;  3CCS I;  2V7T A;  1HW1 A;  1RPW A;  1Q9S A;  4U9U A;  4OOI A;  2M9H A;  2DN0 A;  2VNK A;  4WWC A;  1W2B B;  2O9L A;  1VQ9 B;  2CW0 F;  5DTD A;  4CDG A;  1Q7Y D;  4X05 A;  3CCE B;  2HQ5 A;  4NUB A;  1UHM A;  4A3J J;  3GTJ J;  1A36 A;  2XPV A;  2YPR A;  5K5O A;  3JTH A;  2MW8 A;  5C4J J;  3WTS C;  2HDC A;  3MCA A;  3ZQG A;  3GBG A;  3KYL A;  3WOD F;  1N75 A;  2D1V A;  5IOY A;  1ZK8 A;  2Z99 A;  3AL0 C;  2VNI A;  3BOQ A;  3F6V A;  5J47 A;  3S2D J;  2W1O A;  3OIQ A;  3GX4 X;  3HYI A;  4M0L A;  2EZK A;  5KVR A;  1DAB A;  5B3S H;  5IY5 H;  1J9Z A;  2AXL A;  3SFI A;  4Y7C A;  2NS7 A;  2BHZ A;  4FK8 A;  2QF7 A;  1WJB A;  1PUF B;  1D1B A;  5E18 F;  2L54 A;  1XB2 A;  2KIM A;  5M3M J;  1VQ7 I;  3QFC A;  1D5Y A;  2DOE A;  2O7O A;  2GBY A;  3MZH A;  4LBV A;  1K73 D;  2ELK A;  2ZTG A;  1BR2 A;  1Z77 A;  3P7N A;  3FZV A;  1XCV A;  1JTX A;  3OZU A;  2VBE A;  5JMC B;  1WJD A;  2OJE D;  5ILV A;  2XUB A;  3ESW B;  4HQM A;  3SYT A;  2EIL H;  3B73 A;  3BG6 A;  5E3O A;  1O8F A;  5ILS A;  1X2N A;  2E1O A;  3HSE A;  4LFU A;  4BXU A;  3IC7 A;  2IS1 A;  3K7A J;  4MTD A;  2EIM H;  1ZN2 A;  3QQA A;  3LNN A;  2ZME C;  3I71 A;  2RN7 A;  4Z4S A;  2A07 F;  1U9N A;  4YIR X;  2QE7 A;  1V54 H;  3HXL A;  1HZE A;  1W0J A;  5M5X J;  3K70 C;  2K4J A;  4MQ9 F;  3ES9 A;  4TN1 A;  1E2X A;  3CC7 I;  1FWZ A;  4ZYG A;  3VFZ A;  2CW8 A;  4K2E A;  3W2H A;  3HM5 A;  5M5W J;  4PAA A;  3BCB A;  2V1X A;  3PFY A;  4X8I A;  2BM5 A;  4AVP A;  2L02 A;  1DBO A;  4L9J A;  2LLK A;  2HGC A;  2IPQ X;  1WJ5 A;  3HGY A;  2BVL A;  4IOA F;  2OC6 A;  2D45 A;  2L7M P;  3H36 A;  2LRD A;  5HLT A;  4C0S A;  1XPX A;  3QYF A;  3R4K A;  3DTI A;  1RNL A;  1U78 A;  4WXD A;  3NRV A;  5GAG J;  1UG0 A;  3CMA I;  1G4D A;  1TWH J;  4Z4U A;  3BC9 A;  4S04 A;  4QWQ A;  4HX4 A;  1B2R A;  1EZG A;  2XV4 S;  4Q48 A;  3PEN A;  2VE8 A;  1K6O A;  2HPI A;  2X1E A;  4C2U A;  3MKL A;  1FRN A;  4P55 A;  2XF6 A;  1F1Z A;  4CCJ A;  2JA7 J;  1SKY B;  1WSV A;  3H3U A;  2KFD A;  1TNS A;  1QHH D;  3WNB A;  1ZG5 A;  4PFP A;  4D5C A;  1EP2 B;  1KK1 A;  4XID A;  5DCM A;  1YW9 A;  2EJR A;  3RTR A;  1E3X A;  2ZL5 A;  4X7F A;  1KCC A;  2IOU G;  4HG2 A;  3WND A;  2MLK A;  1BN8 A;  2ZNZ A;  2NOJ B;  1LKX A;  1FIP A;  1XGO A;  5LRS A;  1W0U A;  4Z4R A;  2G0Y A;  1MRZ A;  4C2M J;  4O6J A;  4EJW A;  2F4N A;  3CCM B;  3CCQ B;  2CQQ A;  3VSU A;  2CC2 A;  5CKT A;  2CH0 A;  2OTJ B;  2GLO A;  4OPW A;  4RD4 A;  3PSI A;  5HLG A;  2NV4 A;  1N77 A;  3WYA A;  4ON0 A;  3GTK J;  3WG7 H;  1R36 A;  2JUC A;  4D1Q A;  1LPQ A;  1Q81 D;  3BJA A;  5J8F A;  2IJL A;  2DT7 B;  1T6Z A;  4GFB A;  1V55 H;  1IUF A;  4U7B A;  1XSV A;  2EA4 A;  1R5H A;  1I1S A;  3JQQ A;  3Q6R A;  2BM4 A;  1JNY A;  3W5H A;  4AF7 A;  3QPL A;  1P4W A;  1ZGW A;  3S14 J;  5IP7 J;  5J40 A;  2O17 A;  3H92 A;  4MEX F;  4BBR J;  1FSH A;  4UZE A;  4C43 A;  4M3D A;  4FCY A;  1O3R A;  1ON1 A;  4RCY A;  1I5Z A;  2VOP A;  4D7M A;  4HIZ A;  3JRF A;  3S3N A;  3A4C A;  1OQY A;  5BNG A;  3DXJ F;  2HR3 A;  4B48 A;  4LIU A;  4BYY A;  3CXC B;  3VMV A;  1Z21 A;  2P5V A;  2ACJ A;  2ZL7 A;  2VN2 A;  4A12 A;  2VJJ A;  5J8C A;  3KEQ A;  1QUF A;  1L0O C;  4PJJ A;  1GQ8 A;  1R1V A;  3RZO J;  4WX9 A;  4W1U A;  3SQN A;  3OSG A;  4QV2 A;  3WY9 A;  4AIH A;  4QTR A;  1NK2 P;  3K4M A;  1F5T A;  3W3C A;  2VE9 A;  5J1R A;  2HMA A;  1YG2 A;  3HRS A;  3JR9 A;  1IGN A;  1LLW A;  4QPO A;  1WH5 A;  2E5Z A;  2Q2E A;  3RYR A;  4BNC A;  2MG4 A;  3LSM A;  2LSO A;  1UD2 A;  1E3Z A;  1MBJ A;  1UST A;  4RB1 A;  4LBW A;  3U9G A;  1S8N A;  2V79 A;  1QFZ A;  1PLU A;  2VBK A;  2DA6 A;  3HOZ J;  1P4A A;  1W5C C;  1XMX A;  2YS9 A;  3JAM K;  3FJO A;  2VFO A;  1J9I A;  2EFW A;  2NPF A;  1GAQ A;  2GQQ A;  1KTV A;  5BS6 A;  3ASS A;  1X1C A;  3CC4 I;  1O88 A;  2Y75 A;  2DO7 A;  1O8E A;  2NVX J;  2QEN A;  2K85 A;  3VYS B;  1RQP A;  1O8I A;  1Z0X A;  3FXM A;  1U8R A;  3GQ9 A;  3OS1 A;  1Z6T A;  5J4Y A;  1YHQ I;  3BG5 A;  2OBT A;  3M4O J;  2OQG A;  3G1L A;  1YFH A;  5D5U B;  2CK3 A;  2BW3 A;  2JTV A;  3TDU C;  2XAF A;  1T2K A;  4OP7 A;  2DMU A;  1I50 J;  4U4B A;  1IUY A;  4JBA A;  4AYB A;  4O5V A;  2CG4 A;  3JRD A;  3OY9 A;  5D4R A;  1FNC A;  4RAZ A;  1FBS A;  1TT5 B;  1WDT A;  3FIW A;  4A5N A;  4BQN A;  1QVG B;  1YRN A;  3DU6 A;  2QA4 I;  4FET A;  1IXC A;  1UHS A;  2YWE A;  2WJY A;  1ULY A;  4L0Z B;  1YE9 A;  3DBH B;  2WR8 A;  1IB4 A;  1AKH B;  4J0Q A;  2FUG 2;  1L1I A;  2V26 A;  4Z4Y A;  4PJL A;  4E7J A;  1O7L A;  2AS5 F;  2W7Z A;  4RLF A;  2VAS A;  2XSD C;  4DNC A;  4F3Q A;  1ZLJ A;  5AON A;  2PLF A;  4A3D J;  3AG3 H;  3VMF A;  2RGV A;  1GDT A;  1T56 A;  4BAC A;  2BM1 A;  2L2O A;  1K8A D;  1I3Q J;  2LY2 A;  1ZRF A;  4QVJ A;  2H6C A;  2A3S A;  2A6E F;  2XPW A;  4NBS A;  1MJ9 A;  4BY7 J;  1UFM A;  4P9F A;  3GFM A;  3EUH A;  4RGX A;  1ZGJ A;  4ABZ A;  4KKT A;  2CWE A;  3IRR A;  4BHP A;  2V1N A;  3E6B A;  3MKZ A;  3E1Y E;  2E1N A;  5HXB A;  2W84 A;  1T8I A;  1IW7 F;  1H9G A;  5CVI A;  1TW3 A;  1KON A;  4CCK A;  3SJM A;  3CDL A;  3R0A A;  5DCF A;  4DW6 A;  4YXW A;  5F1J A;  2I5U A;  5LGU A;  1G2H A;  2GK6 A;  4MYU A;  3B4N A;  3HRU A;  1ONV A;  2QZ8 A;  1K6Y A;  3F23 A;  2J8K A;  1KQ0 A;  4PJ0 C;  4EEF G;  4B3G A;  2XAG A;  2GOX B;  2NNY A;  2KKO A;  2FX3 A;  1HDP A;  2QQA A;  2MD5 A;  3G71 I;  2K27 A;  2OA4 A;  5ED4 A;  2ICW G;  1EKE A;  3BP8 A;  3OYG A;  1C0W A;  2W00 A;  4QSH A;  4EM2 A;  3MFK A;  1D0Y A;  3ZPL A;  4N4N B;  2C5B A;  4DYQ A;  2NOG A;  1QG0 A;  1G3W A;  4HV5 A;  2KQR A;  3LST A;  4EM1 A;  5BPD A;  1X3Z B;  3WTW C;  2CQ7 A;  2XB0 X;  4A0Z A;  4EM0 B;  2WWY A;  3B8Y A;  2EA2 A;  2DTR A;  2WPD A;  2L4A A;  4TV7 A;  1K79 A;  3VO2 A;  1QCX A;  1KU3 A;  2ZJR F;  3A1Y A;  3AVY A;  1MSE C;  1XC5 A;  2ZXJ A;  2X3U A;  5IPA A;  3B02 A;  3Q6Q A;  2YU3 A;  5BOX A;  3AGP A;  1WOO A;  2ZBV A;  1R5B A;  3BTL A;  3ISP A;  1WQ2 A;  1IG7 A;  2AXT C;  3K4C A;  1XMA A;  3FMQ A;  4YEL A;  3SXY A;  3ZRG A;  3ZOB A;  4HNV A;  4A3K J;  1ZG1 A;  1UG2 A;  1UAA A;  1OGO X;  2IEK A;  1UD3 A;  3O8G A;  1XQB A;  1YQA A;  4UUS A;  3FX3 A;  2QUF A;  3QFR A;  2K9M A;  3REO A;  1T95 A;  1IJW C;  3C1D A;  3L00 A;  4G6T B;  4Z03 A;  2EPF A;  2CV0 A;  4KH3 A;  1FOX A;  2M4G A;  2JK3 A;  2M5S A;  4AC9 A;  2V4J C;  3CCR I;  1GV5 A;  4YZQ A;  1R22 A;  2BV3 A;  4IRH A;  4ZYH A;  5C3E J;  3LAP A;  3PO2 J;  2V7Q A;  2Z1D A;  2XTW A;  4XD7 A;  2CFX A;  3HOX J;  5DD4 A;  4RPD A;  2IQ7 A;  4XKW A;  3U2Q A;  3VOD A;  1X19 A;  3IL2 A;  5KCM A;  1GV2 A;  4ITV A;  1EFC A;  1F20 A;  3SLN A;  4DK1 A;  3E0J B;  2AHO A;  3AK5 A;  4X7E A;  1VF7 A;  4M3E A;  2IBD A;  5JR3 A;  3U6B A;  3QFS A;  4TMT A;  3CC2 I;  1A04 A;  1EA0 A;  3EDP A;  2PE3 A;  4BH9 A;  5IK2 A;  3SZE A;  4M1K A;  2B9S A;  5F4M A;  2EBI A;  1R7J A;  1R1U A;  4L0Y B;  2GOM A;  6PAX A;  3DP7 A;  4U0V A;  5HDK A;  2QBY B;  4IRG A;  2QVO A;  2KL4 A;  1G59 A;  4BEH A;  3J81 Z;  3C3W A;  3FK7 A;  3GCM A;  2R5Z B;  1S3J A;  3BR5 A;  2O3F A;  1WJE A;  3QPS A;  2QTL A;  2KRH A;  4F93 B;  1W35 A;  2DAO A;  4NQW A;  3PUB A;  5JLX A;  1CQT A;  3N05 A;  1K61 A;  4A3M J;  3MMY B;  4UB8 C;  4V02 C;  1KK2 A;  5E1Z B;  3GIR A;  2Z8G A;  1R4N B;  2CW5 A;  3IKT A;  2Y31 A;  3P27 A;  2F43 A;  1IC8 A;  5FL7 A;  2OPT A;  2XZL A;  2IW5 A;  1UD6 A;  1OCC H;  1ELO A;  2VBX A;  2WAQ N;  3CDI A;  3HBL A;  1JT0 A;  1D3Y A;  3G1M A;  4AWX B;  4OJO A;  1ERD A;  2LC2 A;  3ZSC A;  3MZY A;  4F92 B;  3BC8 A;  5FFX A;  2BV6 A;  1GVJ A;  3KYD B;  4QIW N;  1QU3 A;  3F8B A;  3D5L A;  1WKM A;  2LKS A;  2EQR A;  2BSA A;  2DOG A;  4UZF A;  1MH3 A;  4TMW A;  3E1S A;  4ENN A;  2VPL A;  2LZJ A;  4WZT A;  2ELH A;  5E1X A;  2BGJ A;  2FA5 A;  2YSR A;  4EVI A;  1BX0 A;  3ZC3 A;  1MD0 A;  4U7D A;  3RJP A;  4IKF A;  3RKW A;  4B47 A;  2Z33 A;  1QGY A;  1O7F A;  1DDN A;  1BQE A;  1JTA A;  4BJ6 C;  3WGI A;  2HEO A;  2H6B A;  1ETK A;  2R9V A;  4N4O B;  1PKV A;  3ZGK A;  1LFB A;  4L8J A;  4E7L A;  2VKH A;  2E2I J;  1XG1 A;  4GRI A;  4KIF A;  5JHF A;  2KZG A;  3D5R C;  1D1A A;  1S7E A;  3VWB A;  2A61 A;  2Y0M A;  1MBE A;  2CJJ A;  3E3V A;  5EJC A;  1TTY A;  4RB2 C;  2K9L A;  5E20 A;  3TKY A;  1WFX A;  1CGP A;  2HXI A;  3GLL A;  5CVV A;  3GTQ J;  1U5T B;  4LLL A;  2KRC A;  1OYI A;  4PC7 A;  4YG2 F;  5A2Q Z;  1OPC A;  2HZT A;  3B8H A;  2H1K A;  4G7O F;  2QQ9 A;  4GYG A;  2D2W A;  2V9P A;  2QYO A;  3OZW A;  1X58 A;  2LD5 A;  2QY1 A;  5J3L A;  2MFZ A;  2P4W A;  3HEF A;  4XQF A;  2E34 A;  3DQV C;  4XR6 A;  3LNQ A;  4HLY A;  1H42 A;  1HW2 A;  4EJU A;  3ZQC A;  2AQE A;  1FNB A;  2XVC A;  3BTI A;  5C4X J;  2BF4 A;  4P22 A;  5EYR A;  3GUD A;  2ZJQ F;  3HOY J;  3ZCO A;  2L7F P;  2DYR H;  1USS A;  1WSR A;  2O04 A;  3B6A A;  2KIS A;  2E36 A;  4WZE A;  1B9N A;  5B66 C;  1QQ1 A;  2EWN A;  4WK8 F;  1APL C;  3CCL I;  3CLQ A;  2STT A;  2E2J J;  1OCO H;  3RPQ A;  3CD6 I;  4IVN A;  4HE5 A;  4Y13 A;  4OOS A;  1P7J A;  4P2N A;  4L9N A;  2HVR A;  4P1W A;  4XLP F;  1S5L C;  2DY1 A;  2Q8K A;  5EDN A;  2WAQ A;  3BY2 A;  3H9Q A;  1QRC A;  5BQT A;  2DMN A;  5TY0 A;  1W4M A;  3CUQ A;  3C18 A;  2DI3 A;  2M7A A;  3O3K A;  2X85 A;  1Q86 D;  4D9J A;  2E71 A;  5TGT A;  4A6D A;  4ESF A;  1YJ9 I;  3FIS A;  3EQL F;  4N9H A;  3FHN A;  3SZT A;  3VOE A;  4KFC A;  4IHY A;  4DK0 A;  1TYV A;  2NAZ A;  1KRH A;  2DYS H;  3H9J A;  2DQL A;  2FQ4 A;  4LIV A;  3Q9S A;  1VQ6 B;  2I8D A;  4L5J A;  4G7W A;  1VQ4 I;  2H94 A;  2R7R A;  1VQ5 I;  1KU9 A;  4OWR B;  5DCM B;  2EFO A;  4A0X A;  3VPR A;  1KJZ A;  5KW9 A;  2YUS A;  4AIJ A;  2IVM A;  1SD4 A;  4XOR A;  2IA2 A;  3ZQL A;  2VNJ A;  1YJN I;  4OPS A;  3NB2 A;  3BQJ A;  5L3C A;  3GTG J;  4Y15 A;  5E17 F;  1E0E A;  4YAL A;  1TSP A;  3CF5 F;  2ZZG A;  3F0C A;  3V7C A;  3A8I A;  1IV8 A;  2EV5 A;  1HKS A;  2K3P A;  2K4B A;  1BL0 A;  1S7O A;  3BR6 A;  4YAW A;  3OYI A;  2YWH A;  3Q5F A;  2ZJ2 A;  3Q39 A;  2M8E A;  4LK1 F;  5CVR A;  4XIC A;  1I3A A;  4Z4Z A;  1FT9 A;  2CW7 A;  3CO6 C;  1MAB A;  3GO5 A;  3BNW A;  1OKR A;  1ITY A;  1YW8 A;  1IJF A;  2XF5 A;  1IAW A;  4LK0 F;  2CU7 A;  1D8K A;  1SFO J;  1FOK A;  1XG2 A;  4JMQ A;  4FX4 A;  2PBI A;  3NAU A;  3T8R A;  3P9I A;  4XSX F;  4MFE A;  4BL0 B;  1EFT A;  1V5F A;  1TP4 A;  4HLX A;  4A3B J;  3WU2 C;  3S1N J;  3HOT A;  5EF6 A;  5IP6 A;  1BC7 C;  3VSV A;  3KLO A;  3JX8 A;  2LNB A;  5A88 A;  1VHE A;  5D6E A;  2PMZ N;  3HRT A;  5JI6 A;  2LK2 A;  2W85 A;  4DGW B;  4ZGN B;  5TJJ A;  1VJS A;  4FE4 A;  1XS9 A;  1A5J A;  4YAU A;  1JJ8 C;  1BOA A;  1LUJ B;  3C2G A;  4JX6 A;  2XHK A;  2O8K A;  3WHB A;  5DV5 A;  2XZO A;  5D5W B;  1N0V C;  5D6F A;  1N06 A;  1VQL B;  2WC2 A;  1VQO I;  1U2W A;  5FKN A;  2W82 A;  1G7R A;  2E2H J;  1ZHF A;  3HTU A;  1BMF A;  2GXG A;  5HS9 A;  3GVK A;  1BIA A;  2K86 A;  1G7S A;  5GAH J;  4EV0 A;  1LFU P;  3RKY A;  1R58 A;  4JQF A;  1HXD A;  2ADU A;  1YOV B;  1Z6R A;  2AO9 A;  2JN6 A;  3OOU A;  3G4S B;  2QM3 A;  3SDG A;  1J09 A;  1Z7L A;  3T5X A;  3OYE A;  4F91 B;  3U1D A;  3COA C;  5GV7 A;  5AN9 A;  4Y3O A;  2DOF A;  2BEO A;  3I56 I;  3PO3 J;  4V2F A;  3FWE A;  5ERI A;  1VQ8 B;  4UV9 A;  2M34 A;  4OMY A;  4DIQ A;  3BTC A;  1FJL A;  2V7F A;  4GQN A;  3ZQI A;  4HDV A;  4GGG A;  3KZI C;  4RDU A;  1CF7 A;  2IS4 A;  2BW3 B;  3ASO H;  1WJF A;  1D5V A;  2XC7 A;  4RB0 A;  2XAQ A;  4ENJ A;  1VF9 A;  2R7Z J;  2Q6O A;  4BU2 A;  1UB9 A;  1QHG A;  2LF8 A;  4ZDP A;  1MMN A;  2GA2 A;  3VB2 A;  4O3M A;  1GR1 A;  5THX A;  2DYI A;  3CF2 A;  4R71 A;  2NST A;  4H9G A;  1FX0 A;  1VFC A;  1FMV A;  5GTH C;  5GAD J;  2QSF X;  1G3S A;  1RES A;  4JYK A;  4CIC A;  1YRN B;  1UD5 A;  2HQN A;  5E3L A;  1VQK I;  2Q6I A;  2VNH A;  3B82 A;  3L7W A;  4QLC U;  3PSS A;  3BY6 A;  2DK8 A;  2PG4 A;  2ZXI A;  4J01 A;  4U88 A;  3BTJ A;  2CQX A;  1A31 A;  1K28 D;  2C4U A;  2D9R A;  3CCV B;  4KYW A;  5FRM A;  1YO5 C;  1MJB A;  4KKS A;  2FNA A;  2L9N A;  2F5D A;  3BJO A;  1NK3 P;  1YTY A;  2M5W A;  2R6H A;  3GQ7 A;  1W7P A;  1TWA J;  1SD6 A;  4HYE A;  2QBY A;  2VJ4 A;  2GM4 A;  2KIU A;  4I09 A;  4WXH A;  3VO1 A;  2DBB A;  3CME I;  1WHU A;  5IYB J;  1Y1V J;  1RUN A;  3W2I A;  4OIO F;  2B5O A;  5A89 A;  3HHG A;  3AVU A;  2CQN A;  3TOA A;  4PCQ A;  1R5O A;  2ODL A;  2PMZ A;  1GHC A;  2XGC A;  1XB4 A;  3L09 A;  4IHS A;  2KIQ A;  1CNE A;  4QUZ A;  2WAD A;  1TYW A;  3HB9 A;  3N4M A;  2DA4 A;  1OFE A;  4TT3 A;  2HOT A;  3J7A O;  1QPM A;  2MAB A;  3A2K A;  3CCJ I;  5FO0 A;  2XRN A;  5DM7 F;  5FKO A;  3F8F A;  1ZGA A;  3P9K A;  2JA8 J;  2PI0 A;  5F04 A;  2HQA A;  3BR0 A;  1QVU A;  3S15 J;  1K83 J;  3K1N A;  1H85 A;  3NAW A;  4QPQ A;  2FRH A;  2VFP A;  4A2U A;  2CF4 A;  4BGD A;  1Z05 A;  3LSH A;  2FJ1 A;  1QFY A;  4W97 A;  4YFX F;  4A3E J;  3I59 A;  1LVA A;  2F6C A;  3ZZU A;  3CLO A;  1UJ8 A;  5M3F J;  5LHH A;  2Y9Z A;  2M87 A;  5H6Q A;  4P3I A;  3TO6 A;  3L1P A;  2UV1 A;  1EFU A;  2E7W A;  4AVZ A;  2OAZ A;  1W5T A;  3T9G A;  3ABU A;  1TL8 A;  3BR1 A;  2J5P A;  3LFK A;  2R7F A;  3DFG A;  1E43 A;  2VFQ A;  5FNZ A;  3FY3 A;  2P5K A;  3Q38 A;  3CJQ B;  2RC4 A;  4ZCM A;  4YFN F;  2ZFW A;  3TMO A;  3LOC A;  5F0C A;  4B8X A;  1JT6 A;  4H4K C;  4E7S A;  5LHG A;  1B8I B;  4PC2 A;  5DSZ A;  4FE7 A;  3GZ6 A;  1K8F A;  3M7G A;  1VLY A;  1VQ9 I;  2RC6 A;  3Q3S A;  4L9V A;  4I84 A;  3CP8 A;  3CCE I;  4UUS B;  1M90 D;  5CVU A;  1U5T A;  1VQ7 B;  1HST A;  5FA6 A;  1VHO A;  1ON2 A;  2QSH X;  1QPI A;  4FXU A;  2IT0 A;  2DFF A;  5E79 C;  2CQK A;  1YJW B;  5FKM A;  1FSE A;  1MBH A;  2LR8 A;  5H20 A;  1NDH A;  3FMS A;  2O6W A;  2DOA A;  1PJ7 A;  5E1W A;  1FNM A;  1WOS A;  2BGI A;  2VBU A;  1KYZ A;  5CLS A;  4Y17 A;  3OYA A;  2ZO4 A;  2CGP A;  2UZK A;  3UR3 C;  4BHC A;  2VOD A;  5IYQ A;  1ZTR A;  3ASR A;  2XSJ C;  2GJP A;  3EYY A;  3ZZT A;  5ICG A;  4OAZ A;  2COM A;  3J81 K;  1JKO C;  4N3G A;  3W5V A;  4YIF A;  1KZL A;  4ACA A;  2D5V A;  2GJK A;  3BR2 A;  3FF5 A;  3S17 J;  5AIP A;  3CW2 A;  2XGJ A;  1PYV A;  1R5I D;  3DKY A;  3LQR A;  4RAF A;  5FRO A;  4ZC3 A;  2IA1 A;  5KK1 A;  3MN2 A;  2BVN A;  2V31 A;  4N3N A;  1COW A;  3A0H C;  4CQJ A;  5DEQ A;  3CC7 B;  5L3D A;  2VQG A;  5FD6 A;  2Y0S N;  2FF4 A;  2R7D A;  1U0J A;  2W57 A;  3ZMV A;  3Q0U A;  3F21 A;  4BEH B;  1TWG J;  1JUP A;  1HG8 A;  2VBZ A;  2KRF A;  1D8T A;  3BCF A;  2DMP A;  1WVR A;  3K0L A;  1X2M A;  4FHT A;  4UVA A;  3T0Y A;  3GSI A;  1S7A A;  3V8L A;  4NQW B;  4BKX A;  2VI6 A;  2MH9 A;  1Y56 A;  3HAG A;  1VQM B;  4E7H A;  5K7F A;  4E0F A;  2NNN A;  1POG A;  5DDG A;  1HC8 A;  1A35 A;  3BT9 A;  1K4Z A;  4C2L A;  1IHM A;  4RM2 A;  1JHF A;  4ENK A;  1Q1H A;  3CTA A;  3IWZ A;  1X0C A;  1JE8 A;  2H1L A;  2DOD A;  1U5T C;  3FK6 A;  1VLO A;  3H5N A;  3BY1 A;  4Y33 A;  4UVC A;  1WJA A;  1BX1 A;  5FIU A;  1JKP C;  1BJA A;  2X0L A;  1SFU A;  1ZEL A;  2VXD A;  3RIR A;  1IRF A;  5GAE J;  5JVG F;  1BC8 C;  4WCG A;  1BI1 A;  5IYD J;  1R6R A;  2VBV A;  3WXM A;  2ID3 A;  3FXO A;  3BQY A;  3LWF A;  3S8P A;  4UUV A;  2LTP A;  3X2Q H;  5JBQ A;  3IH2 A;  3F3X A;  3V8K A;  1LDJ A;  5L46 A;  1D1N A;  3KET A;  3R6K A;  5CPR B;  4Z2Y A;  5LRR A;  5H5J A;  5A2Q K;  2UWM A;  2JIZ A;  4RCZ A;  3OSF A;  3MEX A;  2WB1 N;  1X3W B;  3Q0W A;  4HBL A;  2BPO A;  3QFT A;  4KIG A;  2IAI A;  1Y8Q B;  2KZV A;  1D2E A;  5LLQ A;  3RYP A;  3L2W A;  3AVV A;  4YEI A;  5J1U A;  5GTI C;  1O8L A;  1JHH A;  4XLC A;  2DCE A;  2NRA C;  1IO2 A;  2OCC H;  3QPT A;  4HZF A;  1ZUN B;  3OYH A;  5J6X A;  3ZQF A;  2DA5 A;  2OZ6 A;  1U2R A;  2F1L A;  3CCM I;  4RD3 A;  3N90 A;  3F22 A;  3OJX A;  1BI2 A;  1BPL A;  3H5A A;  5IYR A;  2OTJ I;  1W36 D;  3M9A A;  2R7T A;  2QGG A;  1EXM A;  5DNS A;  2HKX A;  1Y0U A;  2D3N A;  1WOP A;  3HOV J;  3OYD A;  3LJY A;  4B44 A;  1B1B A;  5JLW A;  3HDD A;  3DPU A;  3P9C A;  3MKY B;  5CJ9 A;  4MIM A;  3IWF A;  3PQK A;  3I4M J;  4E7I A;  5HZA A;  2CRV A;  3KPH A;  4UV8 A;  1W0T A;  4CCO A;  1TZL A;  1PE9 A;  3FKI J;  3ZPN A;  1Z67 A;  1WH7 A;  4C3I J;  1ORK A;  2HFH A;  4RGU A;  5FD5 A;  1I1G A;  2DIE A;  5EG0 A;  2XNC A;  3S1Q J;  1P4X A;  1SD5 A;  4HE6 A;  1ZKG A;  1OCP A;  2AHQ A;  4V2G A;  1OCT C;  2JN9 A;  3WBJ A;  3C7J A;  2K02 A;  1JA0 A;  3SLD A;  1WJC A;  2IXS A;  3CCY A;  1YS7 A;  2DEU A;  1BIB A;  2ZZE A;  3CC4 B;  2FEZ A;  2WA0 A;  4BUP A;  2Z9O A;  2QWW A;  2PLY A;  2NSP A;  3ONQ A;  3QP6 A;  2FX0 A;  1T6X A;  2VKE A;  2ZTN A;  3JRI A;  3LQQ A;  4G6D A;  3HZJ A;  4CCL A;  3N6Z A;  2VOO A;  3OKX A;  3CUQ B;  3FXU A;  4ESB A;  4E7Z A;  5FLM J;  2BBY A;  5FFZ A;  4DNR B;  4OZZ A;  1OLT A;  1BN5 A;  1ETW A;  1HKQ A;  2ESH A;  3GVA A;  3LMM A;  3J7Y J;  2GJR A;  3OW7 A;  5H59 A;  1SFK A;  2IGN A;  3EET A;  2ESN A;  2N8G A;  4YFK F;  3W6K B;  4A93 J;  1XFO A;  2Y69 H;  1Z3X A;  4KIC A;  3BJ6 A;  4X0G A;  3SY2 A;  3OW2 B;  1OFC X;  4RA2 A;  1CZF A;  1K4S A;  4IRI A;  2E1B A;  2F5V A;  4B4D A;  1DGW Y;  1KA8 A;  4NC8 A;  3GYH X;  3ML3 A;  3ASN H;  1FTZ A;  1OFM A;  5JFR A;  1QA6 A;  1BJK A;  3DEW A;  3SEJ A;  1QJV A;  3CO7 C;  3ERE D;  3QSY A;  4ZTF A;  4C3H J;  1Z1D A;  2E5N A;  1RKW A;  3OR2 C;  5EEG A;  4AC0 A;  4EMS A;  3CMY A;  1RRJ A;  2XKP A;  2R92 J;  2JJ1 A;  1WTH D;  4M3B A;  2EV6 A;  1W0K A;  1MMS A;  4L5I A;  2LRE A;  2NS8 A;  4LLG F;  2X3H A;  1W7P D;  3I0T A;  1XE1 A;  4M53 A;  1XN7 A;  1NG7 A;  1T98 A;  1QZZ A;  1ZAR A;  2HOE A;  1R9T J;  2GK7 A;  3L2Q A;  2R0Q C;  4RD2 A;  1T5E A;  4IOC F;  1KQS B;  4IEJ A;  3FXL A;  1H8E A;  3OEH A;  2YUH A;  3JSP A;  2GRE A;  3DU5 A;  1FOW A;  3K4B A;  3TQN A;  4DQ2 A;  5ICC A;  3HOW J;  1OYW A;  5TR9 A;  1EA3 A;  4GXO A;  3GTL J;  3SEQ A;  4OJ5 A;  2A68 F;  1GO2 A;  2R7W A;  1R5G A;  1R4M B;  3EYI A;  1DU0 A;  1WCM J;  3RY8 A;  1VQN B;  1O8D A;  3R6J A;  4YZA A;  1JXS A;  4XLH A;  2WBM A;  3HKZ N;  3RQ4 A;  4DBQ A;  4HDU A;  1YX2 A;  3PVD A;  1IXR C;  1BHE A;  1SM4 A;  3PNT A;  4ZZD A;  2GXB A;  1JGS A;  1M1E B;  5HNF A;  3CJT B;  3WGH A;  1R23 A;  2FE3 A;  4S0H B;  3HPH A;  4CHU A;  3ZMZ A;  1H88 C;  1WZ2 A;  2CRG A;  1F36 A;  1OCR H;  3A03 A;  5HDN A;  4KIT B;  1U3E M;  1S4M A;  4LC0 A;  1FLI A;  4MFD A;  3JRG A;  3VDX A;  2JVH A;  4NDL A;  2DW4 A;  4NBQ A;  3FBN B;  2WV0 A;  1GVH A;  3H9N A;  1A8P A;  2VJ5 A;  2ZJP F;  4A3F J;  2BMW A;  4P1V A;  3GFJ A;  3PIP F;  2ZIT A;  4ZCI A;  3HGG A;  4XRS G;  3WTU C;  2KDO A;  3ZBT A;  5KAI C;  1OHH A;  3OPO A;  3S1R J;  4EGZ A;  2BHY A;  2P7V B;  4UUT A;  3PSZ A;  5HKK A;  4CSW A;  4HPQ A;  2GIZ A;  2X4H A;  2E1C A;  2CUZ A;  1RIO H;  3PA2 A;  1LNW A;  1U6G A;  4B1R A;  2V7U A;  2X8K A;  4Z05 A;  2DLL A;  2HI3 A;  4XLE A;  1B8I A;  2VBS A;  2L5Q A;  2FBK A;  2XAJ A;  2K7L A;  3QRF F;  4P6V F;  1V4R A;  4OU0 A;  4RDK A;  3EUH C;  4GCV A;  4N9I A;  1CF7 B;  4KN7 X;  1LM1 A;  3KEO A;  1PXZ A;  3T51 B;  1TQM A;  3NQO A;  3LSP A;  2F5C A;  5TIS C;  4QVA A;  4XKC A;  1DQU A;  2V6C A;  3VYT B;  2C6Y A;  2R7V A;  2C5H A;  2PMD A;  4P5O A;  1W9X A;  4OIQ F;  4TKO B;  2MBF A;  2O03 A;  2R7O A;  3U21 A;  1AWC A;  5EZG A;  2VC1 A;  4XLA A;  4B3A A;  4DZJ A;  2NTQ A;  4D7N A;  4LB6 B;  5GP9 A;  1JJ6 C;  3PJR A;  2OK7 A;  2G9W A;  4DBR A;  4FT8 A;  3R6S A;  4U49 A;  2L4M A;  1DU6 A;  3GQB A;  2VON A;  1TUI A;  2HXO A;  3NWS A;  2X0K A;  2QKM B;  3RDI A;  1LLZ A;  3ZQ7 A;  3G1O A;  3RQI A;  1FOY A;  3W2A A;  3SUC A;  2QCO A;  2FOW A;  4P6Y A;  3IH3 A;  1TWF J;  3GTM J;  3E6D A;  1J75 A;  2BN4 A;  3CZ6 A;  4URR A;  1YX3 A;  3C2H A;  3QOP A;  3W2E A;  5L3B A;  4BY1 J;  2IS2 A;  1W7P B;  4G7Z F;  4M6X A;  1IDY A;  1Z7U A;  1XCB A;  2QDX A;  1YIT B;  1I27 A;  2D1H A;  1VQP I;  1I6H J;  3ULQ B;  5LHI A;  1QH0 A;  3DKX A;  3BPX A;  2LY9 A;  1KC8 D;  3WTZ A;  1DDI A;  2YX7 A;  2EV0 A;  1TWC J;  1SC7 A;  4BJ5 C;  2NT9 A;  2MC3 A;  1WPK A;  3BH4 A;  5E3M A;  2ZFU A;  2A69 F;  4IQ4 A;  3LQ6 A;  1RC9 A;  4CYD A;  1S72 B;  2PMU A;  5HVQ C;  3AKZ A;  4G5G A;  1IXS B;  4XK4 A;  3ZZ0 A;  3DTK A;  3OYM A;  4KNY A;  3JUR A;  5KAF C;  3IAS 2;  3FM5 A;  3OE7 A;  2C2W A;  2XNJ A;  4TMX A;  1NHA A;  2X6X A;  2W24 A;  4HX7 A;  4IF4 A;  2PMH A;  4CZZ A;  4KDP A;  4YDT A;  4DYR A;  2OYN A;  3AVW A;  4YII A;  1HDD C;  2MLG A;  4OIN F;  2EFG A;  1AA7 A;  4YFO A;  1VI0 A;  4BJT A;  2Y9Y A;  2KP6 A;  3MQ0 A;  3VR6 A;  1LEB A;  1GXP A;  3I59 B;  1WXR A;  2FBI A;  2VUM J;  3QYB A;  4HSR A;  2LF7 A;  2X6Y A;  2CMP A;  3LSK A;  3VYU B;  2GQF A;  3V76 A;  1G3Y A;  3O8H A;  2DMT A;  2F5F A;  3ZN0 A;  1PUE E;  2PJR A;  3D26 A;  2F3L A;  3K1P A;  1MKM A;  1OB0 A;  1ZM4 A;  4WXC A;  2BXY A;  3SHF A;  2ZCW A;  2F4I A;  1Z3Y A;  4PJN A;  1EH7 A;  2FU4 A;  3SJZ A;  3GWZ A;  3CMM A;  4ZDO A;  1OFD A;  3IRQ A;  1W1W E;  4RAY A;  5H6R A;  4IQJ A;  3SDB A;  4RLZ A;  3T53 B;  4DQK A;  4BE2 A;  1ODD A;  4FQG A;  1V5E A;  2BVM A;  2QTZ A;  2KJC A;  1MND A;  2UUZ A;  3ABM H;  2DMQ A;  4XMY A;  3IAM 2;  1W5S A;  4PC3 A;  2JVG A;  2M30 A;  4LBY A;  4JOM A;  1DPU A;  2ZB9 A;  2C4T A;  4FN5 A;  1J0R A;  2DPD A;  1PP8 F;  1XSD A;  1EP1 B;  1R5N A;  2X1D A;  3V7R A;  3K69 A;  1QFJ A;  2G0E A;  2LMD A;  4MHG A;  1DPR A;  2P81 A;  2VQC A;  3HRM A;  1KGS A;  3L2V A;  4ACB A;  1HW5 A;  2L9V A;  1FYL A;  4E4H A;  4BDY A;  4I98 B;  2K9S A;  4Z4V A;  1DG1 G;  1SVO A;  2KDZ A;  1O3T A;  1OGI A;  1TLL A;  2G7H A;  1ETY A;  2LOO A;  3OV8 A;  3H09 A;  2PEC A;  4Z6Y A;  3TED A;  2DA7 A;  3CJR B;  1KQ8 A;  3A35 A;  3ERM A;  3A01 A;  3OYJ A;  2BY0 A;  3SZG A;  3PSF A;  2X53 S;  4U0Y A;  2VKV A;  2FMY A;  4Y52 J;  1OIS A;  2HOA A;  2P0W A;  4MLO A;  4WZK A;  5DS0 A;  2FQ3 A;  2WSS A;  2LH9 A;  3CCL B;  3B90 A;  2DCU A;  3ZMS A;  4I01 A;  2LKX A;  2EIN H;  2E1R A;  2Z6B D;  3ONY A;  1EE6 A;  1SKQ A;  3ZMT A;  2ETH A;  4XKV A;  3CUO A;  1QZY A;  2DK5 A;  4MEY F;  4DOZ A;  5FO1 A;  2XAH A;  1VBL A;  2L7K A;  1QA3 A;  2WAE A;  1WI9 A;  4HX8 A;  1RET A;  3TDZ C;  5B5E C;  4OJ6 A;  2K5C A;  1EV7 A;  4YCQ A;  2KJB A;  2Y48 A;  1SFX A;  1NB0 A;  9ANT A;  1KQ9 A;  4TMZ A;  1VZ0 A;  3CES A;  2IGK A;  1ZRE A;  1WOR A;  1QZE A;  4YAF A;  4BQA A;  1PDN C;  3GRH A;  1N8R D;  4CXF A;  3OOP A;  4CZC A;  3I58 A;  2QYU A;  2CUJ A;  1QQI A;  2GZW A;  2JWT A;  5FLX Z;  3RZD J;  4EJT A;  4Z4T A;  3I55 B;  1IRG A;  3QYE A;  1VQ5 B;  2B0R A;  1YI2 B;  4OIP F;  2Q1Z B;  4P9U A;  1GXQ A;  2MYS A;  1KK0 A;  1OCZ H;  4PC1 A;  3J81 k;  2CND A;  3PUM A;  3OAA A;  4V19 K;  2VT3 A;  4J00 A;  4BS9 A;  1GAW A;  3PA1 A;  3BWG A;  1EH8 A;  2XAS A;  2M0M A;  2Y30 A;  3K1M A;  2KVO A;  2XF7 A;  4M9Z A;  5KNL A;  3MKW B;  1IRZ A;  3ASP A;  1YYV A;  2EZH A;  4M2L A;  2JPB A;  2DT5 A;  2RAE A;  2XGD A;  2EIX A;  2EFN A;  2ZSH B;  1YW7 A;  5FB2 A;  4KJZ A;  3I1F A;  1V5G A;  2RV8 A;  3OWT A;  4L18 B;  3GTP J;  4CUG A;  5K7H A;  2I1L A;  4ZH4 F;  1K4T A;  1VQ6 I;  1EP3 B;  2F5E A;  3KP5 A;  3JQR A;  4P96 A;  5JVT A;  2ZSI B;  2BM0 A;  2H09 A;  3IV5 A;  1REP C;  1ETO A;  2MGQ A;  5EGO A;  3OYC A;  2H27 A;  5BSY A;  1MSF C;  3HUG A;  4M9S A;  3LA7 A;  5HLI A;  5HLH A;  2BM7 A;  1NHC A;  4FWT A;  2ZXW H;  3HJE A;  3EPZ A;  3W2F A;  4OJL A;  4X07 A;  3CUQ C;  3LYC A;  4R8H A;  1SAU A;  2VJI A;  1MZB A;  2VXZ A;  1BR1 A; 
#chains in the Genus database with same CATH homology
 2R7X A;  1LVK A;  4AU7 A;  4HNT A;  4FXU A;  2PYH A;  3ZPP A;  2CK3 A;  1MMA A;  2CS3 A;  4YEJ A;  2ZZF A;  2BW3 A;  2DOA A;  4E7K A;  2LBF B;  3LMW A;  4C9Y A;  4BE0 A;  4U4B A;  3OYA A;  4AYB A;  3UR3 C;  4C2T A;  1IRX A;  2LY1 A;  3OY9 A;  4E6K G;  3IP4 B;  3V42 A;  1HA8 A;  2XSJ C;  2GJP A;  3TL4 X;  5HNH A;  4OAZ A;  4BQN A;  3KEW A;  3DU6 A;  1KZL A;  2INU A;  4FET A;  2GJK A;  2WJY A;  1PYV A;  3DKY A;  2LYC A;  5FRO A;  3DTE A;  4R79 A;  1YE9 A;  4ZC3 A;  2BOL A;  1E79 A;  2V31 A;  1COW A;  1IB4 A;  4HRI A;  2FUG 2;  1JI8 A;  2VQG A;  3OYK A;  2V26 A;  4PJL A;  4E7J A;  2BSP A;  4RLF A;  2VAS A;  1WP6 A;  4F3Q A;  2MD0 A;  3DPL C;  1U0J A;  3EUA A;  3OOC A;  3BCD A;  4BEH B;  1HG8 A;  4BAC A;  1JRG A;  2L2O A;  4PJM A;  3OMY A;  2LY2 A;  3D5S C;  4RMN A;  3BCF A;  3K4N A;  2W6J A;  3F9K A;  4Z1M A;  4NQW B;  3HAG A;  1Y56 A;  4KKT A;  4E7H A;  1N78 A;  4E0F A;  3LSI A;  4IZZ A;  2V1N A;  2ZXH A;  3MKZ A;  4C2L A;  3OYB A;  3AFH A;  4KIS A;  1OFL A;  4RM2 A;  1HVX A;  1D0X A;  3BG7 A;  1KON A;  4CCK A;  4C30 A;  1X0C A;  1K5C A;  4HNU A;  1IDJ A;  3BCA A;  3UNG C;  4YXW A;  3FKS A;  3H5N A;  4F52 A;  2GK6 A;  4Y33 A;  3B4N A;  1WJA A;  4OZY A;  1W36 C;  1WPC A;  1K6Y A;  4B43 A;  3GVL A;  2VLA A;  1E1Q A;  4B3G A;  2A6T A;  2GOX B;  3GQA A;  2XGJ A;  1ZEL A;  2VXD A;  5LFA A;  3WQZ A;  3ZR8 X;  4YRV A;  1R6R A;  3S8P A;  3OYG A;  2W00 A;  3CP2 A;  3GQ8 A;  1D0Y A;  2X6W A;  3S32 A;  4N4N B;  5C1E A;  2VL8 A;  3S3O A;  1D0Z A;  4XN0 A;  4EAT A;  3OS0 A;  2CV2 A;  2KQR A;  5CPR B;  4F55 A;  1NBM A;  2Z16 A;  2UWM A;  2JIZ A;  1O8M A;  3B8Y A;  5CQG A;  4KT6 A;  3TBI A;  2KZV A;  5HOO A;  2WPD A;  3L2W A;  1QCX A;  1O8L A;  2V9K A;  3A1Y A;  3NE5 B;  4XLC A;  5CQE A;  2DCE A;  3ZQQ A;  3OYN A;  1V0E A;  5C1C A;  2HU9 A;  3OYH A;  2CV1 A;  1I8D A;  1PJR A;  4BQO A;  2W6I A;  1O8E A;  3K4C A;  4PSX A;  3VST A;  4YEL A;  3M1C A;  3ZRG A;  3BLY A;  3HOS A;  2RQQ A;  4CA0 A;  1UAA A;  3DWL E;  1BPL A;  3H5A A;  1OGO X;  3UW0 A;  1G8X A;  1W36 D;  1UD3 A;  2R7T A;  1WMR A;  3EUK L;  3DDY A;  2D3L A;  2WY7 Q;  2D3N A;  2KMU A;  2K9M A;  1T95 A;  4KKU A;  4G6T B;  4Z03 A;  2JSP A;  3OYD A;  4B44 A;  2CV0 A;  3W2W A;  3VYR B;  4G6I A;  2M4G A;  3DPU A;  3NWT A;  3MKY B;  2M5S A;  2V4J C;  4ASU A;  4YZQ A;  4Z06 A;  4ZDL A;  4E7I A;  2V7Q A;  2JUG A;  2Z1D A;  3OR1 C;  1O8J A;  3H35 A;  4XOP A;  4XD7 A;  4CCO A;  2UVF A;  1TZL A;  2VKD A;  3H0D A;  2HZD A;  3K4J A;  4XKW A;  2JDI A;  3ZPN A;  1PE9 A;  2IQ7 A;  3OS2 A;  2XDV A;  4CCN A;  3RCO A;  1X19 A;  2M7B A;  4ZYA A;  5KCM A;  4ITV A;  2DIE A;  4DK1 A;  2XAU A;  4XM3 A;  3E0J B;  2XZP A;  2E1M C;  2X51 A;  3OFN A;  1VF7 A;  3JU4 A;  3K10 A;  1WJC A;  3G05 A;  2IXS A;  2ZZE A;  1GLN A;  5IK2 A;  2WA0 A;  4BUP A;  2L9S A;  1NG6 A;  3QOD A;  2NSP A;  3S3M A;  1YX5 A;  2GOM A;  3ONQ A;  2ZTN A;  4II2 A;  4BXF A;  2HLD A;  2KL4 A;  3HG9 A;  4CCL A;  1G59 A;  2NTB A;  2VIX A;  4BEH A;  3OYL A;  4LG3 A;  4E7Z A;  2HPM A;  4DNR B;  4OZZ A;  1OLT A;  2GJR A;  1WJE A;  1PLU A;  3LSG A;  3LMM A;  2KRH A;  4F93 B;  5KHD A;  3OW7 A;  3KRG A;  1SFK A;  2IGN A;  3WWG A;  3ZXS A;  3MD2 A;  3PUB A;  2RNG A;  3RSN A;  3N05 A;  2R7U A;  2O5R A;  1BOB A;  3DPT A;  3MMY B;  1IDK A;  1Z3X A;  3OL3 A;  4X0G A;  2Z8G A;  1O8K A;  4BDZ A;  3VSL A;  2F43 A;  3I3L A;  1CZF A;  5FL7 A;  2E1B A;  1S9H A;  2MC4 A;  4DNT B;  2F5V A;  2JA2 A;  2XZL A;  2INV A;  1UD6 A;  1D1C A;  4XL9 A;  1DGW Y;  4NC8 A;  2JJ2 A;  4HWV A;  3H5R A;  1X1D A;  4OJO A;  1MNE A;  2LC2 A;  1ERD A;  4F92 B;  3ZSC A;  3BC8 A;  1QU3 A;  1H8H A;  1QJV A;  2HNH A;  3D5L A;  4ZTF A;  1UEL B;  2E5N A;  3OR2 C;  4XON A;  2JJ1 A;  3E1S A;  2VPL A;  1RMG A;  1WTH D;  2LZJ A;  2VQH A;  1W0K A;  1FMW A;  2LRE A;  2X3H A;  1DBG A;  1LFP A;  4OJP A;  4IKF A;  1NG7 A;  4NK8 A;  2GK7 A;  4PSW A;  4W8Q A;  3L2Q A;  4B47 A;  2Q2E B;  1T5E A;  1JTA A;  4YZX A;  2Z2S B;  4LIT A;  4OAY A;  4BJ6 C;  1H8E A;  3OEH A;  4U87 A;  2R9V A;  4N4O B;  3DU5 A;  3K4L A;  3K4B A;  3ZGK A;  1PKV A;  4L8J A;  1EA3 A;  4XN3 A;  4E7L A;  3SEQ A;  4OJ5 A;  2EWE A;  2VKH A;  1X1B A;  3PNV A;  3W2V A;  4GRI A;  5JHF A;  3D5R C;  1DP3 A;  2KLO A;  1D1A A;  2R7W A;  3VWB A;  3ZIA A;  1RU4 A;  1O8D A;  4YZA A;  2K9L A;  3FBI B;  2KPM A;  1WFX A;  3HC7 A;  4XLH A;  3KX2 A;  2WBM A;  3RQ4 A;  4DBQ A;  1OGM X;  2IS6 A;  1BHE A;  2KRC A;  3PNT A;  2OV7 A;  2W4S A;  3EQO A;  3KEY A;  5HNF A;  4RM3 A;  3L2U A;  2WAF A;  4PMH A;  3PNY A;  2IGM A;  1UD8 A;  3HPH A;  1DGR M;  4MR0 A;  4KIT B;  2VBM A;  2QY1 A;  3VDX A;  2JVH A;  3FPP A;  2MFZ A;  3FBN B;  4XQF A;  1I18 A;  3DQV C;  4XR6 A;  3J7A Y;  2R7Q A;  5CDF A;  2VJ5 A;  4Y4R A;  2AQE A;  2PJR B;  1O8G A;  4CH7 A;  1T0F C;  3SEZ A;  2KDO A;  4P22 A;  2WY8 Q;  1X1A A;  1OHH A;  3OPO A;  3ZCO A;  5HKK A;  4HEA 2;  5FRN A;  4CSW A;  3S93 A;  2AQF A;  3VSK A;  2O04 A;  4HPQ A;  2QXZ A;  2R7S A;  2O1D A;  2CUZ A;  2DT6 A;  2NZM A;  3K6G A;  2X8K A;  2XND A;  4Z05 A;  4TSF A;  2R4G A;  4XLE A;  3VMW A;  3DLA A;  2L5Q A;  1KMH A;  1OOC A;  2M3A A;  4BQQ A;  4P1W A;  2HVR A;  3LL7 A;  3OEE A;  2W7N A;  3EUH C;  2WZP P;  4IX7 A;  2ELJ A;  2OUM A;  2WAQ A;  3H9Q A;  1BLI A;  1PXZ A;  4II3 A;  3T51 B;  2M7A A;  4NK6 A;  4DJA A;  4XKC A;  1DQU A;  2X85 A;  3K4K A;  3VYT B;  2R7V A;  4D9J A;  2CFO A;  4P5O A;  1W9X A;  5TGT A;  5LD2 C;  4TKO B;  1KCD A;  2R7O A;  3U21 A;  3FHN A;  4XLA A;  4DK0 A;  2NTQ A;  2LBF A;  3PJR A;  3LFU A;  3OYF A;  2Y0S A;  2RRE A;  3H9J A;  4XNF A;  3IUO A;  4LIV A;  4B3X A;  4DBR A;  4U49 A;  3GQB A;  2I8D A;  4G7W A;  1AIR A;  4BE1 A;  2R7R A;  3DEE A;  4OWR B;  1UD4 A;  4ZTJ A;  3FKJ A;  2F1M A;  3NWS A;  3T56 B;  4XOR A;  2QKM B;  3A3G A;  1MMG A;  2QKL B;  1P9Q C;  2X1C A;  3W2A A;  1E0E A;  3SUC A;  2E1M B;  2ZZG A;  2LG4 A;  3CZ6 A;  4URR A;  1YX3 A;  3C2H A;  3OIP A;  2K3P A;  2O0V A;  3OYI A;  2IS2 A;  2M4K A;  4NUB A;  2DJI A;  1MMD A;  2IGO A;  4XKB A;  1V0F A;  2DXI A;  3GBG A;  2CW7 A;  3KYL A;  2A5W A;  4W8S A;  3DKX A;  1N75 A;  3PL8 A;  1MAB A;  3AL0 C;  1LDK B;  4BJ5 C;  2NT9 A;  1MW7 A;  3BH4 A;  3HL2 A;  2XF5 A;  2W1O A;  2ZFU A;  3OIQ A;  2UVE A;  1XG2 A;  4JMQ A;  1KTW A;  4IQ4 A;  5HVQ C;  3AKZ A;  3DTK A;  3OYM A;  4BL0 B;  3JUR A;  1V5F A;  3IAS 2;  2NT6 A;  4ZJZ A;  3OE7 A;  1WJB A;  1D1B A;  3HOT A;  3VSV A;  2X6X A;  2WB1 A;  3RPU D;  4DGW B;  1VJS A;  3EQN A;  2ZTG A;  1BR2 A;  2V6E A;  2PYG A;  1AA7 A;  2VBE A;  1WJD A;  4BJT A;  2KP6 A;  3C2G A;  3VR6 A;  3SYT A;  3BG6 A;  2XZO A;  3QYB A;  4HSR A;  4FAS D;  1O8F A;  2X6Y A;  2CMP A;  3LSK A;  4PFO A;  3VYU B;  1EFR A;  2O0W A;  2W82 A;  2IS1 A;  2PJR A;  4EW9 A;  1BMF A;  3GVK A;  4NC7 A;  1OB0 A;  3LNN A;  5DN6 A;  4JQF A;  2F4I A;  1Z3Y A;  3OOU A;  4PJN A;  3HXL A;  1HZE A;  1W0J A;  2QE7 A;  3CMM A;  3G2B A;  3K70 C;  3HUG B;  1J09 A;  4ZDO A;  1OR7 C;  1Z7L A;  4IQJ A;  1BR4 A;  4NNJ A;  4F91 B;  3SDB A;  2CW8 A;  3OYE A;  2NTP A;  3T53 B;  4MXN A;  4Y3O A;  3BCB A;  4BE2 A;  1V5E A;  2BVM A;  3I9V 2;  3PFY A;  1MND A;  1DBO A;  2UUZ A;  4XMY A;  3IAM 2;  1WJ5 A;  4PUS A;  2JVG A;  2E60 A;  2VB6 A;  2BVL A;  2OC6 A;  4HST A;  4JOM A;  4DIQ A;  1RWR A;  2V7F A;  4GQN A;  2LRD A;  5HLT A;  2X1D A;  2VQL A;  3QYF A;  1TT0 A;  2IS4 A;  2BW3 B;  3DTI A;  1WJF A;  1UG0 A;  2XC7 A;  2VQC A;  3H94 A;  3L2V A;  3BC9 A;  4PK4 A;  4BU2 A;  4E4H A;  3H9G A;  1QHG A;  4ZDP A;  4BDY A;  1MMN A;  3OL4 A;  3FDY A;  2HPI A;  2X1E A;  3CF2 A;  4C2U A;  2NST A;  2LOO A;  2XF6 A;  4CCJ A;  1FX0 A;  1SKY B;  1FMV A;  4YZ0 A;  1QHH D;  2PEC A;  1UD5 A;  3CJR B;  4PFP A;  3A35 A;  3RTR A;  2ZXI A;  3OYJ A;  4J01 A;  3SZG A;  3PSF A;  1E3X A;  2X53 S;  2ZZQ A;  1OFM A;  1KCC A;  4HG2 A;  2P0W A;  4MLO A;  3A3B A;  1K28 D;  3HPG A;  1BN8 A;  2WSS A;  2LH9 A;  1LKX A;  2NOJ B;  3K70 D;  3B90 A;  4W8R A;  5FRM A;  2Z6B D;  1EE6 A;  4KKS A;  4XKV A;  5AMV A;  4DOZ A;  2L9N A;  1VBL A;  3VSU A;  2L7K A;  5CKT A;  2CH0 A;  2WAE A;  4OJ6 A;  3PSI A;  3GQ7 A;  1N77 A;  2K5C A;  2VJ4 A;  4D1Q A;  2KHM A;  4ANJ A;  1IA5 A;  3GVJ A;  1VZ0 A;  3CES A;  2DT7 B;  2IGK A;  3L2R A;  4U7B A;  3GRH A;  2ODL A;  4XLF A;  2PMZ A;  4CZC A;  3M8J A;  2CUJ A;  2O17 A;  2WAD A;  2HVS A;  4TT3 A;  3QYE A;  2MAB A;  3A2K A;  2Q1Z B;  2MYS A;  4HIZ A;  3S3N A;  3A4C A;  1NRK A;  4W8T A;  3OAA A;  4UZU A;  4J00 A;  4B48 A;  4BS9 A;  4LIU A;  3VMV A;  4B3F X;  1Z21 A;  2HQA A;  2M0M A;  2KVO A;  2XF7 A;  2VJJ A;  5KNL A;  4CCM A;  3MKW B;  4QPQ A;  4PJJ A;  4G7X A;  1GQ8 A;  4BGD A;  1X4P A;  3LSH A;  2ZSH B;  1O8H A;  4KJZ A;  3K4M A;  1V5G A;  3W3C A;  3OWT A;  2F6C A;  4CUG A;  4QPO A;  3HKZ A;  2E5Z A;  2UV1 A;  3LSM A;  4XOT A;  3QOE A;  1Y6I A;  1E3Z A;  4AVZ A;  1UD2 A;  2WJV A;  3T9G A;  2ZSI B;  2VBK A;  2HDW A;  1E43 A;  2QX3 A;  3FY3 A;  3AL0 B;  1E1R A;  2V4D A;  3CJQ B;  1X4O A;  3OYC A;  1H80 A;  3TMO A;  4H4K C;  4E7S A;  1NHC A;  1X1C A;  1O88 A;  3EPZ A;  1VLY A;  4OJL A;  4RLQ A;  4I84 A;  3CP8 A;  3VYS B;  2XOK A;  1O8I A;  2HVQ A;  3GQ9 A;  1SAU A;  3OS1 A;  2VJI A;  2VXZ A;  1BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...