4XORA

Tailspike protein double mutant d339n/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNANHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4xorA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4xorA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4xorA02
4XLEA 1RU4A 3EQOA 1EE6A 4I84A 4PMHA 4XL9A 1IDKA 4W8SA 4U4BA 4YZ0A 1RWRA 3VSTA 1KCCA 2INUA 2QX3A 4XOPA 4OZYA 1KCDA 5C1EA 3GQAA 2X3HA 1O8LA 3WWGA 2X6YA 3VSUA 1O88A 1O8MA 2PYHA 4W8TA 2VBEA 1KTWA 1OFMA 4MR0A 2X6WA 4XLHA 4YZAA 4YZQA 4XM3A 1BHEA 4OZZA 4EW9A 4XLFA 1NHCA 1BN8A 4XKVA 3GQ7A 4AVZA 4XLCA 1PXZA 2NSTA 3B4NA 2IQ7A 2VJIA 4NK8A 4NK6A 2PYGA 2UVEA 3KRGA 4XQFA 4W8QA 1OGMX 4XOTA 2UVFA 4C2LA 2QXZA 1HG8A 2Z8GA 3GRHA 4HWVA 4OJLA 2NT9A 1OFLA 4MXNA 4XMYA 2BSPA 4XN3A 2VBKA 2VJJA 4Z06A 4XR6A 1O8KA 1K5CA 3UW0A 3JURA 1PLUA 2EWEA 4Z03A 3VMWA 4U49A 2NTPA 1O8GA 5AMVA 1IA5A 4YEJA 1JTAA 2X85A 2O0VA 3FY3A 1CZFA 1QJVA 3ZPPA 1RMGA 2NSPA 2O17A 3LMWA 2ODLA 3VMVA 4YELA 1DBOA 1OOCA 3GQ9A 4OJPA 3VSVA 1OGOX 1IDJA 1O8IA 3B90A 3SUCA 2QY1A 4XKWA 1O8FA 1X0CA 4XLAA 1DBGA 1GQ8A 1AIRA 1VBLA 4XNFA 1WMRA 2O0WA 4URRA 4OJ6A 2INVA 2NTBA 3ZSCA 3T9GA 2NZMA 1O8DA 1XG2A 2PECA 2X6XA 4OJOA 1O8JA 4XORA 1O8HA 1PE9A 2O1DA 3GQ8A 1IB4A 2O04A 4Z05A 4XONA 1H80A 3EQNA 4W8RA 4YZXA 4XN0A 4OJ5A 2NTQA 2NT6A 5C1CA 3B8YA 1JRGA 1O8EA 2VBMA 1QCXA
chains in the Genus database with same CATH superfamily
4XLEA 4PMHA 3L2QA 4U87A 2B7CA 1P4XA 4E7HA 1J75A 4P3YA 3OYFA 4XLNF 1WOOA 2VZLA 1NG7A 3QFSA 2PN6A 1XCVA 2EZKA 3ZQHA 2XGJA 2IEKA 2XZOA 2QGGA 4HE5A 3LO8A 1RWRA 2E2JJ 1UJ8A 2YWHA 4W97A 1BA5A 5EZHA 2VBTA 3S1QJ 4G6QA 3DWLE 2HNHA 1O8LA 3GQAA 5LGTA 3SQNA 1YX5A 3F22A 3M8FA 1FTTA 1TTYA 3QP6A 2DFIA 1IUYA 4I0BA 2HR3A 2MC4A 1ZH5A 3OZVA 3H3VK 4X05A 2M87A 4HLYA 1S8NA 4IHVA 4WXDA 3RI4A 4GFBA 4Y3OA 3ZMZA 4DQKA 1KJZA 4OIQF 1FMWA 3IWFA 4NK6A 3MCAA 4NDLA 1POGA 4BE1A 2M4GA 3RQ4A 4NC8A 3W6VA 4RPDA 1XDUA 2NVQJ 1SC7A 3R6JA 4OIRF 5C4JJ 2IGNA 1WRJA 5DS9A 3FKSA 1R5NA 2R7SA 2BSPA 4D0PA 2BN4A 1BN5A 2G9WA 2JRMA 4A3DJ 2W24A 1G3YA 3RY8A 3K4BA 2HOTA 3JU4A 1MRZA 2GA2A 5EF6A 2M3AA 2EWEA 2YX7A 4OU0A 3CO6C 2QVOA 2RN7A 5E1ZB 1K83J 2VNHA 2VNIA 1JTAA 2R7ZJ 1LEAA 4DNCA 2M8GX 2XKOA 2R92J 2K9QA 1RUOA 4N0BA 3K10A 1UG0A 3GSIA 4M3EA 4CHUA 4HF2A 3Q3SA 3CRZA 5FO1A 3OYHA 1ZELA 1WJAA 2MYSA 2VYQA 2GXGA 5IYQA 5B1BH 3ONUA 5FRMA 4HW0A 4MQ9F 1QQIA 4YIRX 3K1MA 2BM7A 2KLOA 1K61A 1O4XA 5HS7A 4HF1A 3I59B 3H92A 2X3UA 3CP8A 1FSHA 1GV2A 2KRHA 1MBHA 1E3OC 3G6EI 1IJEA 3ABMH 4FASD 2KKOA 4G5GA 3LFKA 2P5LC 5K7HA 3IH4A 3V7SA 1YIJB 2Y48A 2NZMA 3OFNA 3MCZA 4FX0A 3SJPA 4C2TA 4N9HA 4NUBA 2P4WA 2MC3A 1Y8RB 4FE4A 2ACJA 4XORA 3P7NA 1XD7A 4UXNA 1Z91A 1Y1WJ 4HPQA 4I98B 4V2GA 3HOTA 1ZUNB 3BR6A 3V7AA 2X4HA 3WG9A 2CUJA 2IA2A 3AVTA 3QWLA 2DOAA 3H1CA 1WSUA 2E5ZA 2Z16A 5EEAA 1WDTA 3PIPF 2BV3A 1K9MD 2WY7Q 3OR2C 4B09A 5IP9J 1PVEA 1YG2A 3V8KA 1DP3A 1LDJA 1K78A 4OAYA 4U7BA 2NT6A 1ETYA 3PFIA 4L5JA 3BY6A 1L3LA 4ZCIA 3EUAA 2IBDA 5HLIA 2W82A 1TNSA 3S2WA 3MKWB 3HRTA 3L2VA 4KFCA 4XK4A 4BQAA 3I9V2 1WHUA 2STTA 4F52A 3JQQA 1BW6A 1X19A 2R6HA 4W8SA 2R5YB 1YHQB 3SLNA 4HX8A 2C2WA 1D2EA 4M71A 3GFLA 1ZARA 4GGGA 3BZKA 4FX4A 4DNRB 1KCDA 2XV4S 2ZBVA 3MMYB 3R0JA 4EJUA 1HLVA 1G4DA 5K1YA 1BIBA 4Z4ZA 1I50J 1ETXA 4BJ6C 2QYUA 2RC6A 1FLIA 4I0AA 3ZUGA 1R1VA 3CMEI 2EFWA 4YAUA 2Y69H 4TMTA 5E8GA 1K79A 3AL0B 2OV7A 5B1AH 3PENA 1NHCA 1V3FA 3DKXA 5AONA 3WTVC 4RMNA 3D5RC 1AWCA 3HC7A 2QM3A 3HYIA 4C3HJ 1FJLA 1PJ5A 4ZH4F 1Y39A 2P8TA 3PSSA 4CA0A 3A01B 2CYYA 3TP3A 2M5WA 3CJNA 3F21A 4W8QA 4GYGA 2HDDA 2VQLA 1L1IA 3ZMVA 4ZTFA 3DF8A 1Z7LA 1UD2A 2Z8GA 3H9JA 4D5FA 1B1BA 1R22A 1Z67A 3GCMA 1D3YA 3G1OA 1GUUA 4X6AJ 2P3MA 3ASQA 5B6IA 1IG7A 4AWXB 4XN3A 3S3OA 3ZMTA 1GVDA 5DCMA 2OYNA 3BQJA 1O8KA 1RZ4A 2QENA 3UW0A 4Z4VA 3L9FA 3ABLH 4M6YA 2WWYA 4GO1A 4UHTA 3Q5FA 1BI0A 3A8IA 4D7MA 2GK7A 4LIVA 4YEJA 2O0VA 2WV0A 1N06A 3H3ZA 1RMGA 1VQLI 2PJRA 2J8IA 2V4JC 4JOMA 1U6GA 4CCJA 3HTSB 1VHOA 3UKGA 3FPPA 2Y9YA 1OCOH 3HXLA 2VXDA 5M5YJ 3SDGA 1VQKI 3ZC3A 3D5SC 1FX7A 2K4JA 5FFZA 5GTIC 2KJBA 4XKWA 3AKZA 2E1NA 2LMDA 1I7PA 3ZPNA 4E7LA 2BHZA 3KX2A 5J1RA 1KTVA 2Q2EB 5DDGA 1DBGA 4IVNA 4A0ZA 3ZQLA 3OYAA 1XSVA 2A6EF 4Y9UA 4KDPA 3BNWA 3B6AA 5LRRA 3IKTA 4M74A 4TMVA 2ZCWA 1AU7A 4X06A 1UZCA 3LSJA 2M45A 1DUXC 2IT0A 2F4NA 4D1QA 2WR8A 3KL9A 4NBSA 3TH0A 1XG2A 3WTTC 4BHBA 5HDNA 3E6CC 1YJWI 4BXFA 1JB9A 2M5SA 1TW3A 2V79A 3PNTA 4DK1A 2P81A 3IL2A 1IV6A 3CCSB 1VQ8B 1R00A 1QGYA 1A6QA 5LMZA 2QZAA 2KDOA 1KK3A 5J4VA 5FD6A 5GADJ 4OPSA 1NTCA 3TP0A 1QZEA 3LQ6A 2VFQA 2A07F 2D1HA 1IC8A 2L9NA 3G3ZA 2PMUA 4HX7A 1XSDA 4OJ5A 1MSFC 3CMMA 2VOPA 2G0EA 3FXRA 2NS0A 3U9GA 2K3FA 1F4KA 5B66C 4I6ZA 2P7CB 3CPXA 2OA4A 5LRSA 3OL3A 3ROUA 3U2RA 3QYEA 2NVUB 4A6EA 1SFOJ 1V0FA 1JJ8C 3J7ZI 1R71A 1VQNI 5TV2A 2IGMA 3QSYA 3CC7B 1TNTA 5DCFA 1B72A 3PO3J 2JZYA 2VJ4A 3P9IA 3S17J 1EV7A 1VZ0A 4WXHA 5EG0B 1WZ2A 4L0YB 3W2HA 2C5BA 2W00A 1ULYA 3WWGA 2VONA 1A5JA 4PJNA 1QVUA 2K3PA 2V26A 1O88A 2XDVA 3QAHA 3JRAA 1YX2A 1N8RD 3WG7H 2LBFA 3OYDA 1I6HJ 3HPHA 3E5QA 4BHCA 1ITYA 3BY2A 3GLLA 4ZCLA 2E36A 3I64A 1QZZA 3L00A 3DKYA 2IAIA 1ZLKA 1SFKA 3AL0C 2M0MA 3BG3A 3MHPA 3KETA 4P55A 2F5CA 4KICA 5HZBA 4MQVA 1KQ0A 4XLCA 4ZYAA 3HSFA 4Y7NJ 2Z6BD 2VQGA 2VJIA 1OFCX 2CW5A 2B0LA 3UNGC 3DU1X 2XF7A 1T0FA 2HCJB 2BM1A 4RB2C 2Z99A 3DP7A 4BDZA 5K5QA 1YJNB 5J35A 3WGGA 1RQRA 3CCEB 1KA8A 5EYRA 4ZZLA 3GTQJ 3S2DJ 4YAWA 2ZSHB 4UV9A 4F3QA 3C2BA 4OOSA 4YFXF 5GV8A 5ED4A 4G7ZF 1TYUA 4P1VA 2LDUA 2DYSH 1K6YA 5J3OA 3HOWJ 3OKXA 1QX4A 2IGOA 3GVKA 2QN6A 4NCNA 1TWFJ 2Q6KA 3HOUJ 2RREA 4JX4A 4KISA 2YR2A 4A0YA 3Q39A 4HAMA 1KZHA 1FNDA 4XRSG 2L9VA 4DIQA 5KSWB 2L5QA 2QCOA 4R79A 3ML6A 3G1MA 1BW5A 1OISA 4HE6A 3NWSA 1DBOA 2LFBA 3TL4X 3ESWB 2MLGA 1QRYA 3LVBA 3PETA 3EUKL 1QA3A 4LG0B 3HOVJ 1H89C 1D8TA 1IXSB 2XAQA 3QPHA 2B7EA 1PDNC 3PA2A 3I0TA 1KU9A 4KT6A 5CVJA 1MBEA 3F8FA 5FJ8J 1MH3A 3A1PA 1LNWA 3BLYA 2HYFA 3IH2A 1RPWA 4ACBA 3SZTA 2DA1A 2JJ2A 1DDIA 2OK8A 2E71A 3AVXA 4UUTA 1RETA 2ZMEA 2YPRA 5FKOA 2XTYA 1HF0A 4CDGA 2F4OB 2NOJB 3HOYJ 5KW9A 1JKPC 3ZZ0A 1Y8QB 4RD4A 1T6XA 3Q38A 2X0KA 3OIPA 1ON2A 1UB9A 4QWQA 3KEYA 2VB6A 5M5WJ 3ZQGA 1LQ1A 5GV7A 3Q6RA 3MWMA 4X0GA 1J0RA 3O2PE 3LSRA 5M3MJ 1PP8F 2BVLA 1N07A 4LK1F 1XMXA 3DPTA 2B0RA 1X3ZB 4HZFA 1HVXA 2L3DA 3H3UA 1I39A 1CQXA 1B23P 3M07A 2ZTNA 1P6RA 3R6SA 2ZTGA 3ZMUA 3FHNA 1F20A 3NARA 3OYLA 3AG1H 3OP1A 3AVWA 2KDZA 2PMHA 3SXYA 3V7CA 1Z7UA 1SD7A 2DA7A 1SEUA 5A2QK 3BZ6A 3N90A 1KQ9A 5IP6A 3IRQA 3M8EA 1S7OA 3CCLI 3B6CA 2XSJC 4P2NA 1MMAA 2VL8A 1Y1VJ 1W36C 3PO2J 2BPOA 3HAGA 4ZGNB 4YZQA 4IRGA 1S7EA 3CLQA 3RTRA 1UCRA 3VSKA 4CGZA 4LJZF 2NS7A 4I02A 2OUMA 1UD6A 2DMPA 4M72A 4KKUA 1PYVA 2L9RA 3T0YA 5F0HA 4OP7A 2YUHA 3WTXC 2OU2A 1ZM4A 4IPAA 2HQRA 1XCBA 1FNCA 3IKVA 1WKMA 2KRCA 4UB8C 4XOTA 5D5UB 3CCQI 4Z4RA 1FY7A 1J09A 3RJPA 1PUFA 2QXZA 2ZXWH 4PJJA 3G6EB 3IP4B 3TQNA 1ETVA 4F55A 1A04A 1NBMA 1QFYA 3H36A 3W5HA 5C3EJ 2JUGA 1R9TJ 1G7SA 5LHHA 1TTTA 2IGKA 1JT6A 1W2BB 2KIMA 2PMDA 2Q8KA 4N4NB 2R9VA 3K69A 5DUKA 1KYWA 2VBVA 2R0QC 4D5CA 1Z3YA 3CMYA 2OBTA 4RAFA 1MABA 2DBBA 3CPWB 1IA5A 2QQ9A 2X85A 1BJZA 2L0KA 2ELHA 1GVJA 5F04A 2COBA 3CF2A 4E7IA 5E6TA 2GOXB 1ZTRA 2BYVE 1D8JA 3HHHA 4YELA 4JK1X 3OYEA 1IXCA 4MO7A 1EP2B 1IN5A 4BBSJ 1UHSA 3KEOA 4ASNA 2DMUA 1FTZA 1YS7A 4DGWB 3CCJI 2ELJA 2JTVA 2DQLA 5FKNA 1R58A 3BCDA 1H8EA 4G6IA 3JRDA 2F2EA 4B3GA 1X0CA 1JUMA 3VYTB 3HUGB 1MMGA 3ASSA 1YTYA 4U9UA 3SZEA 3PFYA 2NTBA 2F5DA 1VI0A 2CK3A 3WNDA 1KMHA 3CCUI 1KU3A 2HTJA 3ZPLA 2L7FP 1OPCA 2EZLA 2VBSA 2DLLA 2CW8A 2FNAA 3ULQB 3V4GA 2BGCA 4X7EA 1F43A 1O8JA 1VQMI 4J0QA 3CD6B 3ISPA 5DD8A 5FLVA 2CV1A 2HVRA 5KHDA 2QKMB 2YX4A 4TMWA 1Y6IA 5IYWA 5DUIA 1OCPA 3PQKA 5A88A 2OBPA 3HIFA 1ZAOA 3FJOA 4RDLA 2H8RA 4AIHA 4BY1J 4KH3A 4BJTA 1EFTA 3I53A 3HRUA 4Y15A 5GP9A 2OAZA 5HNFA 2UZKA 4G7HF 4Q48A 3JREA 1V4RA 2OQRA 1LEBA 2WTEA 5D5XB 2G7HA 4A3BJ 4V19K 2PFBA 1VQOI 3IRRA 3ZQ7A 2XT4A 1RIOH 1U2WA 2V7WA 2V31A 4CSWA 1XMKA 2HVSA 1RU4A 2EJRA 1O7LA 4Y9RA 3O8HA 1Z21A 3P26A 2LH9A 3BZCA 2W48A 4LLLA 2JA2A 2ZJRF 4BNCA 5FGMA 1MGTA 4A3LJ 4O5VA 2AQFA 4IW3B 3FISA 1BI3A 4FQGA 4A0XA 1HKTA 2CBXA 1E3PA 3GUDA 3ONQA 4Z2YA 5GTHC 2ZKZA 1O8MA 2BX6A 1RC9A 3MQ0A 4QTRA 1ETQA 2P5VA 1S72B 3S3NA 3BG6A 3CJQB 4XICA 1O3RA 3D5LA 3ZMSA 3J7AY 1R23A 2E1BA 3E3VA 3HGYA 4XM3A 4B44A 3OSGA 2DPDA 3L09A 4PFOA 2XAFA 2K5CA 1IJFA 4X07A 2EZIA 3T51B 1VQLB 3MZYA 1VQKB 2VFPA 1PXZA 3GQBA 1W7PD 1QBJA 2PJPA 2DIEA 2OF7A 1JTYA 1OYIA 3PUFA 5CLSA 2UVFA 2HPIA 2X48A 3FMRA 2JRTA 2D3NA 2V7TA 2DA5A 3BR3A 3WE2A 3RPUD 3VO2A 3ZN1A 4YHBA 1BI2A 4KT5C 1BOAA 1G7CA 2VJJA 2X1EA 3VNUA 4XR6A 2CQNA 3X2QH 2V7UA 2RKHA 1YJWB 3VMWA 2OC6A 4CICA 5TGTA 4CZZA 2BEOA 2D1VA 4HG2A 4M3DA 1CZFA 3T56B 2EFQA 4RD3A 1ZM3A 4IHSA 2GIVA 1IGNA 1QGAA 2H6CA 1D0ZA 3M9AA 5DCMB 4BKXA 4DZPA 4RD1A 3DQVC 1K6OA 1IN7A 2L7MP 1DDGA 1IN4A 4HF0A 4C43A 2DMTA 4LB6B 3MD2A 1REPC 1F5TA 2FBIA 2ZJ2A 4KITB 3T1BA 1HC8A 5CVUA 4MFEA 1VQNB 2F43A 5FO0A 2PLFA 4B1RA 3ZP5A 4OJ6A 4CO8A 1ETOA 1QHGA 3S15J 2WPDA 2V5IA 1WP6A 1Q1VA 3TKYA 2QA4I 3H9NA 4B8XA 5FNZA 4HSTA 5JLVC 4H0EA 1EA0A 1R1TA 1MJ9A 1FYMA 1ZK8A 3OYBA 2OQGA 3K1PA 2F5EA 2OCCH 3JSOA 3FM3A 2WZNA 2QEXB 2F4IA 1IDZA 4Z4TA 1LKXA 3CDLA 3TOBA 2NS8A 2V7FA 4YCQA 1IZ1A 4IJAA 3LNQA 1FOKA 1IB4A 2DODA 1M1EB 1N08A 5ILSA 4W8RA 3ZQIA 1BBYA 1W5CC 1AKHA 2FEZA 1E64A 3V42A 2LOOA 2F1LA 3ISXA 4RJLA 1SVOA 4NNJA 3A35A 1G3WA 3NB2A 2QBYA 5FD5A 2Q6OA 4YFKF 1DABA 4N3NA 2V9KA 4IQJA 4V02C 1JUSA 4YRVA 4G12A 2R5ZA 4EEFG 2LG4A 3BTJA 3JRBA 2RNGA 4YG2F 1E3XA 2DT5A 3RPQA 1SKQA 1KD1D 1DDNA 4D9JA 3K4MA 1JNYA 3CLOA 1ON1A 3PQJA 1ZG1A 4XOPA 1IF1A 4XD7A 4DYRA 2FNPA 3OEEA 3K1NA 4IHTA 4RGSA 1TT5B 2JSPA 4J01A 4RDKA 3WNCA 2I8DA 3DCFA 2XB5A 2RV8A 3W3CA 1KQ8A 2VBEA 1W5SA 1FP2A 2O7OA 3PSFA 2V7VA 4P9SA 1WSRA 1BIAA 1VQPB 2QZ8A 3T8RA 5DN6A 2HOEA 1FNNA 3SKBA 1B72B 2OCEA 5E3LA 4KJZA 2BY0A 3ECOA 1GJRA 3AG2H 5FB2A 1FX0A 2F6CA 3QPTA 2WC2A 3LFUA 1P9QC 4B4CA 5FLXK 2NSTA 3KLNA 4AIJA 2CF4A 1HF2A 4MLOA 2WY8Q 2B7BA 1EKEA 2EA2A 4JX5A 5ILVA 3GWZA 2KPMA 1E79A 3ES9A 1W9XA 2GIZA 1D1AA 1RNLA 3HKZN 3OEHA 3CJTB 4C0SA 2Y9ZA 4B3FX 5GAGJ 3WYAA 4QIWN 2RNJA 2XAUA 1D1CA 3EYYA 3NRVA 4M9XA 1T39A 2LY2A 1USSA 2CGPA 1D5YA 2AXTC 1FOXA 1VLYA 4IRIA 4V2FA 1UFMA 3OOPA 2RQQA 2FX0A 3DTEA 1FSEA 2HWVA 1W0KA 1WORA 3WTYC 1YITI 1O3QA 5HLHA 1X1BA 3LMMA 3P5JA 2XSDC 1DQUA 2VKEA 2IOUG 3U21A 2DYRH 3K70C 4BU2A 5IOZA 4EJOA 2IS2A 3VO1A 5ICEA 5HLGA 2O0YA 3MKLA 4RB3C 4IOCF 1EF4A 1GLNA 1R36A 3SHFA 1K73D 2NSPA 3V7RA 1HOMA 4ZCMA 2O17A 2XGDA 1W87A 1OB5A 3KCCA 5GAEJ 2R93J 3VMVA 3LQRA 3SLDA 4S04A 4II3A 3DPUA 3F8CA 4IHWA 5K7ZA 2DPUA 1VQ6I 4PJ0C 1D0XA 3DBHB 2A68F 3GQ9A 2DDBA 1OGOX 4P12A 2QY1A 2FF4A 5F1JA 4J19A 1EP1B 2FQ4A 2CUEA 4M73A 1GQ8A 5D6EA 3PM1A 2OBRA 4A6DA 2FA5A 4Q4ZF 5D5VB 1MDMB 1RR8C 1N05A 4M3BA 1TLLA 1LDDA 2E1OA 3KZYA 3SEZA 3SJZA 2XGEA 2XPVA 1MIJA 3CUQA 5F27A 3RQIA 5EMNA 2K7LA 2CQ7A 4HNTA 3HPGA 3CCLB 1UHMA 1JI8A 1JKRC 3WBKA 3VYUB 1U2RA 2O04A 2AHQA 2HXOA 5F0FA 1N75A 3CQZJ 2LR8A 2Y0SA 3DDYA 5E17F 4P22A 2FX3A 4AD9A 3D26A 1Z77A 3ASNH 1OYYA 2GWRA 4BGDA 3FMQA 3H5RA 3CO7C 1WU8A 3ZGKA 2JDIA 2PLYA 5IYCJ 5FIUA 5HDGA 3FHZA 2PMZN 4RDJA 4M9SA 1PKVA 2OTLI 1OCCH 2P6TA 4TSFA 4XIDA 4EV0A 3CCQB 5FL7A 3VOEA 1B4AA 1TC3C 4ABZA 3KZIC 4E7JA 1G2HA 2PX9A 1NDHA 3WBJA 2ZZFA 4RA2A 3HHGA 4Z6YA 4K2EA 3G2BA 3BR0A 2P7VB 2FD5A 3K4JA 3P27A 1I5ZA 3B02A 2CUZA 2HZDA 2WBMA 4HA8A 1U5TB 1NB0A 3E7LA 3VMFA 4OWRB 5CQEA 3A4CA 2K9SA 3HG9A 3KIOA 5L3DA 3QU3A 4KNYA 1FNBA 1WPCA 4HQMA 2HMAA 1QFZA 1OR7A 2BW3A 2FXAA 2ZFUA 4DZJA 1WH5A 2L7ZA 3CCRI 2B9SA 3IAM2 1NB9A 4BY7J 1UELB 1VQ5I 2PE3A 2E5NA 4OOVA 3GW2A 4MTDA 2JA7J 4YALA 5D6FA 4ZYDA 3AGPA 4UVAA 1FT9A 1SMYF 1KZLA 2ISYA 2LTPA 2M7AA 3CCJB 5HS9A 1G8XA 2VFMA 2Q1ZB 3GO5A 3OYKA 3E5UA 3DXJF 1JGGA 2KZGA 1S0UA 4A3JJ 2E1CA 3BOQA 1J5YA 1FP1D 1K7AA 4XBFA 3HSEA 2LYCA 4LFUA 5EEHA 2YU9J 2I10A 2UWMA 3DEEA 3SZPA 1P4AA 4WZTA 3OE7A 5FFXA 4EGYA 2W7ZA 1T0FC 4ENNA 2WZPP 1Y0NA 2Q0OA 2RGVA 2L4MA 3KP3A 3R6KA 4Z4UA 3AGQA 1VQMB 4OPWA 1KONA 2Z1DA 2NVTJ 2RQPA 4L5IA 1PUFB 1J9ZA 1O8GA 2M30A 3B73A 3RKYA 4PC7A 1XPXA 3ZQQA 2OZUA 1T5EA 4BQNA 2KRFA 1RESA 1TQMA 4FWTA 1YI2B 5H2FC 3RKXA 4ZDOA 2EFNA 2QSFX 2R4GA 4DYCA 4MYTA 1HXDA 1QQ1A 5FROA 1JHHA 1YQAA 3N4MA 4L9VA 3PVDA 3DPLC 3I4MJ 1YRNA 4EJWA 1V5GA 1GO2A 2VXZA 5GPAA 2R7FA 4RB0A 4A3MJ 4E7SA 4YAFA 1G6NA 2LSOA 4XKBA 1I18A 3GTGJ 3K7AJ 1STZA 1J59A 9ANTA 4AC9A 3QOPA 2DYIA 1ZR4A 3Q9VA 3LWFA 2X1CA 1DP7P 4P3IA 1YLOA 4HYEA 3CXCB 3OS0A 3EETA 2CO5A 1PUEE 1BX0A 2HDNB 4IXAA 1WVRA 3C18A 4CCKA 1YX3A 2ICWG 4YFNF 2KMUA 3AK5A 1TWGJ 1AIPA 2W84A 2DOGA 1RUNA 1VQ9I 2CFOA 3ONYA 5DNSA 3MKZA 3BROA 3CDHA 2XGCA 4RLFA 3VSLA 5CYVA 4BXUA 3DBRB 1XQBA 2F3LA 4HV5A 5CKTA 1TSPA 1FIPA 3H0DA 2XNCA 4U0YA 2KZVA 3K2ZA 4QPOA 3I71A 3D1NI 2W57A 5JLXA 4A2UA 4MEXF 5JI6A 4YFOA 2E60A 4F91B 2JN9A 2Y0SN 2DMNA 5E3NA 2QX3A 1D0YA 5BNGA 1Q81D 3H9QA 1MKMA 3FXUA 4MNUA 1U5TC 2NNNA 3K2AA 1FIAA 2B63J 1QA1A 1FOYA 1X1PA 2V1DA 3OYCA 1WJ5A 1X1CA 3TBIA 2M8EA 3AVYA 5JR3A 2EIKH 1NK2P 3QE2A 2K9NA 3WTUC 4P5OA 2DO7A 3KZZA 3R0AA 2Z33A 2HOSA 2DTRA 1FOWA 4N4OB 4XLHA 4HDUA 4PK4A 1E17A 4EW9A 4JBAA 3HTUA 5KVRA 4EATA 3PUMA 3GVAA 1E43A 1BN8A 4RD2A 3M4OJ 2JT1A 1YS6A 2CRGA 1OJLA 3PNVA 2KFDA 1D8KA 5L3EA 1ZGWA 2OBSA 3WU1B 2KP6A 2EZHA 3OJXA 4P96A 4ENKA 3K4CA 4NQWA 1ZQ3P 2GLOA 4OINF 3S1NJ 1QUFA 3I54A 2L4AA 1W4MA 4UNOA 2QMUA 2NT9A 3CDIA 5LD2C 2FU4A 4FHTA 4P9UA 1SD4A 5J6XA 3ASRA 3VNVA 4QVAA 5FRNA 2HKXA 1W5TA 2X53S 1YE9A 4E7KA 2FVGA 1FZPB 2GJRA 1EFCA 1R49A 5AIQA 1BLIA 3UR3C 2V1UA 1V5VA 3CZ6A 3CC2I 3OYIA 3HOZJ 2QTZA 2VJ5A 2CMPA 2MABA 4HV6A 2C77A 1H42A 3U6KA 3KEQA 1S3JA 2EINH 2WJVA 2DU9A 1T33A 2DA2A 3LMWA 1IXRC 1WQ2A 4GRIA 2XAHA 4MHGA 1J9IA 2XAGA 3KE2A 3B78A 1OGJA 3F6VA 4HLXA 1T2KA 4L9NA 3T8TA 1CF7B 5BOXA 3CESA 2ZJQF 2IJLA 1D5VA 1JA1A 3EUHC 4FT8A 3H5AA 4NC6A 4EH1A 1YFHA 1ZM2A 2VFOA 1WOSA 1HW5A 2C6YA 1FRNA 3BY1A 4ZTJA 2CWEA 3G73A 4JQFA 4MIMA 4OMYA 4QVJA 3WU2C 1KK0A 2BY3A 2K9LA 1GR1A 1WMRA 4URRA 4G8XA 4L5EA 2Y2ZA 1R5ID 5LEKA 1OB0A 5M5XJ 3U6BA 3BQZA 3IUOA 2XRLA 2W85A 4LBZA 1LFPA 1UG2A 5LHGA 2JPBA 2V9PA 3LL7A 1MNEA 5F0CA 4BACA 3VWBA 3I55B 1K4ZA 3V76A 2VBWA 5IOYA 2HQ5A 2Z9OA 1EZGA 4FTHA 2H27A 2I1LA 4BS9A 1IRFA 1LVAA 2DA6A 2O1DA 1T8IA 1EH8A 4UUSB 1D1NA 2P6SA 5EEGA 4YZXA 4KIGA 3HM5A 2QDXA 2HQAA 1DPRA 3ZQFA 1BPLA 1TWHJ 2NOGA 1EH6A 4OOIA 5DTDA 4AC0A 3K4NA 4MGRA 1USTA 1TZLA 5C1CA 5KCMA 3Q9SA 1WJDA 3BR5A 1O8EA 3FKIJ 5DV5A 1I1SA 4Z4SA 1Y0RA 5DD4A 2F4MB 4RGRA 3O3KA 4PZJA 3SFIA 1EE6A 2LKXA 1BOBA 5ICGA 1JKOC 4IHYA 1Z0XA 2ELKA 1AKHB 1X2NA 3DEWA 2OTJI 3QRFF 5CVIA 1ELOA 2JWTA 1QGZA 2GA1A 5IPAA 4CCLA 1B8IB 3GIRA 3W2IA 5C1EA 4A12A 4UY8I 1WH7A 1OKRA 2GQQA 2F5VA 2UXXA 3GLXA 3VPRA 5FKKA 1H8HA 3CUOA 2ID3A 1KTWA 5TJJA 4YC5A 4ENMA 1IUFA 3TDZC 2ZXHA 1VQ4I 4Z4WA 5A8AA 3OV8A 1QH0A 1QG0A 5DM7F 1P4MA 2BM6A 3JSPA 1B6AA 2BHYA 3G71I 1TUIA 4NHJA 2KIQA 2M1BA 3FKJA 1G3SA 2DETA 2TRTA 3GQ7A 4M3GA 2GJPA 1VQ6B 4CCOA 3I59A 1LPQA 1QVGB 4HOBA 1G3TA 1S5LC 2O8XA 2J8KA 3S32A 1TYXA 3IHUA 2XB0X 3A03A 2W1OA 3OMYA 5E3OA 1OQYA 4RLQA 4DQ2A 2XOKA 2Z3YA 3GZ5A 2MSYA 2VC0A 5IT3A 1BR2A 3FXJA 1AMOA 2VLAA 1L0OC 4DJAA 2Y75A 2GK6A 4E70A 2OK7A 1LM1A 2FSWA 2LRDA 2V7QA 1WWXA 2V6CA 3VODA 5KAFC 1P92A 3ABKH 2LVSA 5L46A 1PLUA 5IT9K 4C2MJ 3DLLF 3M3YJ 4PDKA 3SZGA 2C5HA 4IHXA 3JQRA 3W2AA 1M90D 2LF7A 2CH0A 3CB4A 2ESNA 4KMUX 2LF8A 3MEXA 3L2RA 1LFBA 3DTKA 1XG1A 4EM0B 5CVRA 3D0SA 2ODLA 2VQCA 3FWEA 2DFHA 1XGSA 1LFUP 1UD4A 3W6JB 2W7NA 2XNDA 1F60A 4O6JA 3VSVA 2OTLB 1WPKA 3BCFA 4PCQA 1MJAA 4ETSA 3LSHA 3GTPJ 2VPLA 2BM0A 1YO5C 3L7WA 2YWEA 1SFUA 2DERA 3O8GA 3TMOA 4ESFA 4TKOB 5CDFA 3PSZA 4PABA 5E8IA 2IVMA 4C3IJ 3GX4X 2GREA 2CV2A 5LEJA 1U8BA 1IAWA 2WJYA 4JMQA 4M9ZA 3KP5A 4P1WA 2EFPA 3WTSC 1A6IA 1F9NA 1RR7A 2CRVA 4LBYA 2L02A 2W25A 1MBGA 2VKDA 2OD5A 3RDIA 1JHFA 3J80K 1D1BA 3JTGA 1ZGJA 2WADA 4WF2A 4X8IA 3CCRB 1IW7F 2DK8A 3S1MJ 1VQ5B 4G6DA 3A01A 1XX5A 1FYLA 1BM9A 1KK1A 3NEUA 2W6JA 3TO7A 2IA0A 4HSRA 2D3LA 3BG7A 3JAMK 2LC2A 1LE8A 2YWGA 4PAAA 1FNMA 4G7WA 2XVCA 2HXIA 4B4DA 1GAWA 2LKPA 2IA1A 4WX9A 1ETKA 3B82A 4A93J 1ZREA 1Q7YD 2W4SA 2K27A 2Z2SB 3ECHA 1SANA 3S1RJ 1KQ5A 4C9YA 4YZ0A 4DBQA 1KC8D 3ZOBA 3PNYA 3ZQCA 2WB1N 1JGSA 2I5UA 2ETHA 3BT9A 4AYBN 1W0UA 3A2KA 1DG1G 4LG3A 4ZYHA 2XEXA 3PUNA 3CMEB 4XRMA 2QE7A 2W6IA 3CW2A 2BGIA 2KJCA 3FM5A 3KEWA 4E0FA 1WJFA 5JFRA 1A8PA 3U1KA 3E1SA 2K40A 1QPMA 1XN7A 2GPJA 3I4PA 1TYWA 1IO2A 3BJAA 3LSTA 3BH4A 3HRSA 3ABTA 3E6BA 3OS2A 4XSZF 3W5VA 3W5UA 3KP4A 3T53B 2DW4A 3AVUA 3K4KA 2LNBA 2LK2A 1MH4A 5J8CA 2IQ7A 2AHOA 1IRZA 1WGXA 2COMA 1AHDP 1K78B 2HEOA 5GAHJ 3ZMDA 1EFRA 2MBFA 2BW3B 4KYWA 2EK5A 2GAUA 4RAZA 3GRHA 1DU0A 5F6FA 1W1WE 3GFIA 1E1RA 4EGZA 4Y52J 3FX3A 2KVOA 3QOEA 5A2QZ 2ZB9A 1Z3XA 3BCAA 5L3GA 2IS4A 3FK7A 4G7OF 5D8KB 3J81K 1W36D 5CJ9A 3HZJA 4HDVA 5IYPA 3HKZA 3SJMA 4A3GJ 1K5CA 3HL2A 5IYRA 2EIMH 1E3HA 1I6XA 2VI6A 4LGWA 5DEQA 1GV5A 4P9FA 2VNKA 3DTIA 4A3EJ 1JJ6C 4WXCA 1YYVA 4BE0A 1QHHD 4DK0A 1BI1A 3KPHA 3FY3A 1NH3A 4DYQA 4LB5A 2STWA 3WXMA 1OFDA 1OFEA 5F08A 2ZL5A 2ME6A 2BY1A 4OPVA 4CCMA 2D2WA 1SVLA 2EWNA 3LSIA 4ZDPA 1T6ZA 2V1XA 4FE7A 2DQRA 1T95A 2JA5J 2XRNA 1IRXA 2DFFA 3ERED 3QPLA 1SFXA 3W6KB 3SUCA 3OIOA 2QTLA 4CUGA 2O61A 5BPIA 2R7UA 5IK2A 4CYCA 1K4SA 1MBJA 1O8FA 3JRIA 5BSXA 3BH6B 2XASA 4XLAA 4IOAF 2C78A 2MH2A 1KK2A 5IYNA 4A5NA 4G1BA 3U2QA 3W2VA 5ILUA 2QGUA 1LDKB 4EM1A 3WGHA 2INVA 2A5YB 2KQRA 3DKWA 5F4OA 2OZ6A 3F0CA 1T98A 3MKYB 4BE2A 2D45A 1HKSA 1TP4A 1YRNB 1O8DA 1OGIA 3MZHA 1Z9CA 2PECA 3NQOA 1TWCJ 3OYMA 1FDRA 4EVIA 4TN1A 4M53A 1RKTA 4UVBA 3LSMA 4JRAC 3R4KA 1O8HA 2FMLA 1E2XA 1X1DA 3CCMI 2Q6IA 2VE9A 4J00A 2Z5UA 1ZRDA 3BJOA 3FXLA 1MNMC 4A3KJ 3SDBA 4X0CA 1VQ8I 4RPBA 2WAQA 1W7PA 1RKWA 2EPFA 3HGGA 1FRQA 3ASOH 1ZYRF 4IF4A 1CNEA 5E79C 2A6HF 2VFNA 1QU3A 3K4LA 1Z6RA 4LLNA 3L2WA 3E5XA 2PJRB 1T56A 3C1DA 1EJ9A 5LHIA 1Z05A 1ZKGA 4A3FJ 3S8PA 5H20A 2L7KA 2HZTA 3QYBA 3RPUA 1V0EA 3Q6QA 3F6OA 3OW2B 3ERMA 2CQQA 1H9GA 2H6BA 2H94A 3A8JA 3JQPA 2VC1A 3DLAA 1N77A 3K9TA 3KLOA 5FA6A 4A3CJ 2QQAA 2HYGD 2RVCA 4B43A 3LNNA 2INUA 4DW6A 2PMZA 3OAAA 3TW7A 4KIBA 1U3EM 4CQJA 1GDTA 2BM5A 3BR2A 4TMXA 4Y4RA 1NJID 5HOOA 5DS0A 3IV5A 1B9NA 3CC2B 1X1AA 1WJEA 2UUZA 1OFMA 2KIUA 3MVPA 1F1ZA 2K9MA 3GTLJ 3LA3A 4QFMA 4LG0A 5BMZA 4R8HA 4EQQA 2E7WA 2JVHA 1TL8A 4II2A 2ZSIB 1B2RA 3NE5B 1COWA 4IZZA 1VNDA 2VBYA 1PJ6A 2EILH 2H8WA 4ZJZA 1H85A 1HKQA 2XNJA 1VHEA 3FMSA 3OSFA 1S7AA 1HA8A 2PYGA 1ZHFA 2UVEA 4YDTA 3GEZA 3COAC 3F8MA 4LBWA 2XHKA 2ZZQA 2CNDA 1H0MA 1MSEC 1ONVA 3TDUC 1Z6TA 1LVKA 2EA4A 1IJWC 5D4SA 4XMYA 5HS8A 2NPFA 1DGRM 5E1XA 2MW8A 4G9YA 2X1DA 3GZNB 1OLTA 1OCZH 1XE1A 2BM4A 5J40A 3J81Z 1UMKA 2VBKA 1UD8A 2B5OA 2IXSA 2E34A 1W35A 3JURA 2A61A 2E2IJ 5IY5H 4RLZA 5K5RA 3FXMA 4NQWB 3QFTA 4X7FA 4GYIA 5E3MA 2V9VA 4RBOA 2O9LA 1EP3B 2E1RA 2ZFWA 5THXA 1DGWY 2GOMA 1IN6A 4AIKA 1ZGAA 1FEXA 2J5OA 4NB5A 1EWYA 2LBFB 4UZFA 4UV8A 4LMYA 3AVVA 1QVTA 1WCMJ 3I5UA 4OJPA 1XC5A 4PGGA 4ENJA 2XAJA 1YOVB 2BF4A 3A0BC 2D74A 3E0JB 1MBKA 4P26A 2IRFG 2X51A 2R7QA 5ERIA 2ZJPF 1YJ9I 2DT6A 5IYBJ 4IO9F 1H8AC 2WAEA 4MYUA 4XNFA 2GZWA 1ZG3A 2LY9A 2PQ8A 3MMPA 4Y7CA 4UB6C 1Z1DA 3V8JA 3S16J 1Q9SA 2R7VA 1BJKA 1HZEA 5HLTA 2VBZA 1AA7A 1V5EA 5HODA 5JLWA 1CGPA 2JQ7A 1K8FA 1OMIA 1YLFA 3PL8A 1SM4A 3OYJA 2EBIA 2AO9A 1X3WB 4C30A 2A5WA 5DSZA 2V6EA 1ERDA 2ESHA 4ACAA 1VQ4B 4BL0B 3OZWA 3ABUA 4XONA 2A6TA 1HCRA 3EQNA 4KUMA 3SFZA 1B59A 1UHWA 3G71B 4MTEA 2E35A 2VODA 4WWCA 2ISZA 1LUJB 4U0VA 3R61A 4CYDA 1O57A 4FK8A 3QFRA 2VBMA 1YW9A 1ZRFA 5KK1A 3PA1A 3I4NJ 1V54H 2LP0A 4KIFA 2XF5A 3RKWA 2QQBA 4A5MA 2BXYA 2A3SA 4GCVA 2EV0A 2WAQN 1HW1A 2AXLA 4KMFA 2RC5A 4X7CA 1IDKA 1XGOA 2XTXA 2L54A 4U4BA 2GBYA 3PJRA 4M3FA 3GVJA 4PJMA 4F92B 4OPOA 4LBVA 2DJIA 1PJRA 2V1NA 4BQOA 3GTKJ 3FBIB 4HNVA 1T6SA 3OIQA 3CJRB 5FKLA 4WQMA 5BSYA 3KFWX 2ME0A 1VLOA 2ZMEB 3PUBA 3E6MA 1VQ7I 3I3LA 4D7NA 2JUCA 2NYXA 2M9HA 4BXXJ 3M7GA 1BHEA 1W0JA 4XRFA 4Y33A 2DA3A 5LGUA 1BL0A 3GVLA 2MD5A 2WA0A 2HU9A 1BC7C 3ZBUA 3SQVA 1VFCA 3HUGA 4PSWA 4NK8A 2QLZA 1AOYA 4XQFA 2HI3A 1JJ2B 3JR9A 3C2GA 4ANJA 4E4HA 4C2LA 2DTZA 4B3AA 3FZVA 3HJEA 2JIZA 2M2EA 5H6RA 3OYNA 2ZNZA 3BG5A 2V7XA 4OMZA 2NVYJ 4L9JA 1RQPA 1MD0A 4PC3A 1X58A 2CJJA 5IYDJ 2LLKA 3LSGA 1U78A 1TLHB 2HTSA 5IP7J 2M34A 4BEHA 2VKHA 3CCYA 2JA8J 4Z4YA 1R5BA 2JMWA 3W2WA 3JRCA 4FN5A 1TBXA 4U49A 3EQLF 4ROXA 3BPXA 5AMVA 2XC7A 2E2HJ 3SEQA 5JBQA 5FLXZ 1E63A 1XMAA 2HGCA 3NAWA 1ZR2A 1WI9A 4I09A 2KIFA 2L2OA 2VBXA 4LK0F 1WTHD 4LLGF 4HX4A 1C0WA 2ECBA 2XC1A 2LZJA 1SMTA 3ZCOA 3OOCA 3H5NA 3M1CA 4QLCU 4Q47A 3VR6A 4ZGQB 3TO9A 4OAZA 4BYYA 3QODA 1ZRCA 4P6YA 5D5WB 2O03A 5F64A 2BV6A 2QSHX 3RSNA 4TV7A 3L2CA 4RM0A 3CCUB 2H09A 5HZAA 1O7FA 3MFKA 1K4TA 1EH7A 1JE8A 4KN4X 4H9GA 3K70D 1P2FA 5DM6F 1OHHA 3HRMA 1UD3A 2JK3A 4AF7A 5K7FA 3GMEA 1ZG5A 3FXKA 3ZBTA 2ADUA 2FOWA 2EIJH 2AQEA 3CTAA 1XGMA 5J47A 3FF5A 5B5EC 2WSSA 4Y13A 3K6GA 2NVXJ 1FBUA 1RI7A 5EGOA 2JN6A 4BBRJ 2VQHA 2YWFA 2ZL7A 1VQOB 4Y17A 3CD6I 5A89A 3K0LA 4G94A 5CVVA 2WAFA 4DBRA 1LLWA 3DU5A 2VPRA 4PJLA 4AVPA 1M1KD 3ZRGA 1CLWA 4TMZA 1IV8A 4L0ZB 2VUMJ 3BWGA 3IH3A 3KP2A 1QPIA 4JP0A 4M2LA 1ETWA 4IRHA 2O6WA 1R5HA 4MFDA 3EQOA 1YIOA 2FMYA 4RAGA 2XKPA 4OIOF 4ESBA 2C4TA 2O6GE 3G1LA 3LJYA 1S29A 2VASA 5M3FJ 1LE8B 1EFUA 2DEUA 3JRGA 1BR4A 1J7KA 1CQTA 2X6YA 5F4MA 4YEIA 5L3BA 2JJ7A 3VSUA 4HBLA 1T08B 2ZO4A 5DYMA 3CC4I 2PYHA 2XZLA 1R4MB 2MFZA 1QZYA 3HB9A 3Q0VA 2ZMEC 3A8KA 4ZYEA 5TR9A 1WSVA 3FXOA 4B3XA 3IWZA 4RGXA 4OZZA 2XTWA 4EJTA 2YSRA 1S72I 3WHBA 2BZTA 2O3FA 1SAXA 1BR1A 5EZGA 3ELKA 2JPCA 1R4NB 4I7HA 2H1LA 3E20A 3KYCB 2KL4A 1W34A 2CUFA 2FUG2 1ORKA 1N78A 2F1MA 2FRHA 4JX6A 5E1WA 2IW5A 5E18F 2JJ1A 4EMSA 3QFCA 2FBKA 4RCYA 3A1YA 2MGQA 1SD5A 3SYTA 4K1XA 5TRDA 2UV1A 3P4GA 2Y0MA 1PP7U 1UAAA 3BTIA 3EYIA 4ZYGA 5AN9A 1CNFA 1ENHA 3OW7A 2HDWA 1JT0A 1QNTA 1TW2A 3EPZA 3GYHX 2XF6A 3WQZA 3CCMB 1MZBA 1ACIA 3M8JA 1V5FA 1QUEA 5CPRB 4IL6C 4L9TA 1U8RA 1QJVA 2HS5A 2A05A 3RZDJ 3LQEA 4WZKA 2RAEA 5D8LB 2JA6J 3AG4H 3S2HJ 1IB0A 1N25A 1V55H 2QF7A 5LBQA 3IAS2 2CS3A 1NK3P 1OOCA 3N05A 4C2UA 2VE8A 2A69F 4ZZDA 4XRSA 3B90A 1HW2A 3LSKA 2ID6A 4U7DA 2DMQA 3CMAI 2QA4B 2FE3A 3REOA 4QPQA 3LAJA 4CZCA 4LD5A 3MN2A 1Q86D 3VEPA 5HXBA 3GFMA 3ZSCA 2QKLB 2VT2A 2WV1A 1NRKA 2BMWA 3GTJJ 3FDYA 4RD0A 4IQ4A 2K86A 4G6TB 2X6XA 4CYCB 3AAFA 2R7TA 3HBLA 3JX8A 1P4WA 3BCBA 3BPVA 2ZBKA 1DU6A 3V8LA 1QRBA 2L01A 3JRFA 2CU7A 4AIDA 3QQAA 2EB7A 2QEXI 3KYLA 1XSXA 2MLKA 3R60A 5F1RA 4HNUA 1B9MA 2XIGA 3RKQA 4OOXA 4RD6A 4UZUA 2QUFA 4IEJA 3N6ZA 1OCRH 4AUXA 5JHFA 3FBNB 2EV5A 4MEYF 2PBIA 2Y31A 3LA7A 1HBXG 3BC9A 4DQLA 1QCXA 3JCUC 1U9OA 2MD0A 1NHAA 4I84A 4RGUA 3VDXA 1X4OA 1G7RA 2FBHA 2JVGA 1W7PB 1BQEA 3BTLA 4BPRA 2YU3A 3VSTA 1GXQA 4RS8A 3TEDA 3GF2A 4P25A 1X4PA 3CCVI 4KN7X 2KHMA 2X3HA 2F48A 2G7UA 5FLMJ 3G4SI 4W8TA 3N97A 3QP5A 1EA3A 1WJCA 3OOUA 1Y0UA 4AU7A 2MH9A 2WB1A 3I56I 2X6WA 4YIIA 4AYBA 1F36A 1QA2A 4XLFA 2QSGX 2L9SA 1WFXA 4WK8F 4BDYA 2QYOA 2AS5F 1VQPI 4AVZA 6PAXA 2HVQA 5HKKA 1WI3A 1JTXA 3BJ6A 4GQNA 3C3WA 4Z1MA 1K8AD 3BDDA 3KYDB 4AF6A 2ZITA 1T38A 1UD5A 4RCZA 3ZZTA 1MDMA 1HA3A 2WYRA 1YJ9B 2FJ1A 3RYPA 1SAUA 3F8BA 1XGNA 3CP2A 1O3TA 3H9GA 1N0UA 2QBYB 1TQPA 4HRIA 4OJLA 2K85A 4G1VA 1OFLA 1YITB 4CH7A 3TGNA 1LJ9A 5JHUA 1I3AA 2R5ZB 1FBQA 3O6BB 1FMVA 3ZXSA 1VJSA 4Q5SF 2DDAA 2HQNA 5J3LA 3OR1C 4Z03A 3I1FA 1KRHA 3GBGA 1Y0YA 1YW8A 2XGXA 1BX1A 2DA4A 2HKOA 1S9HA 3LSPA 2DT7B 4OIPF 2E19A 4JYKA 4UZEA 2J5PA 3IC7A 1E1QA 4WZEA 3GXOA 3HDDA 1APLC 1JKQC 3F8NA 4LIUA 4BH9A 3J7AO 4G7XA 1QRCA 1R1UA 2XPWA 3OJWA 3S14J 3ASPA 1IDJA 4IKFA 5TY0A 3L2UA 4FXUA 2K02A 4PGOA 4QUZA 3MAJA 2QQ8A 2K4BA 2PIAA 1U5TA 4BJ5C 3DBLB 4QV2A 2O0WA 3AFHA 2EQRA 1A36A 3BP8A 1DPUA 3GZ6A 3FK6A 5LLQA 3T9GA 3BC8A 1H88C 4PGHA 3TOAA 5TISC 3PSIA 3WODF 4RAYA 5ICFA 2PI0A 4PC1A 2CW7A 4ZC3A 1ZN2A 1QA6A 1ZLJA 4OM9A 3KP6A 2R7OA 3BQYA 4TT3A 2EFGA 3WNBA 4LOCA 1RRJA 1XB4A 1VQ7B 2DOEA 4I99C 1GXPA 1HDPA 4Z05A 3C2HA 5HVQC 4L18B 2R7XA 3ZZUA 4XN0A 3RYRA 4H4KC 3PIOF 4KA4A 2ZZEA 2R5YA 4Q7JB 4BAYA 2NTQA 3F23A 2N8GA 3RIQA 2DJNA 1BC8C 3FXQA 2DK5A 2EV6A 4RDUA 2BVNA 5AIPA 3Q3AA 1JRGA 1KGSA 4PUSA 1N0VC 3BH7B 4NC7A 2DN0A 1QVFB 2X8KA 5JMCB 2H1KA 1R6RA 5EJCA 2Y30A 4XL9A 1BJAA 4DOZA 2ZXIA 4EJVA 2XROA 2RDPA 5J1UA 2XPUA 2E1MB 4ESJA 1KCCA 3BG9A 4FCYA 3HOXJ 4GXOA 1YIJI 1GAQA 1WXRA 2VBUA 4S05A 4OZYA 2MA3A 4FISA 2ZXJA 1IN8A 3LYCA 3EDPA 3ASTA 2NXNB 3L1PA 3BR1A 1JA0A 3TW6A 5J4YA 2KISA 5D4RA 2VN2A 1MMSA 2CC2A 4I76A 3F3XA 4ASUA 4DNTB 2BXZA 3LOCA 5HDKA 4WWVA 3EUHA 1QGPA 3CUQB 3KP7A 1VF9A 2EIXA 1H9TA 1I27A 4YZAA 2IS1A 3U1DA 2X0LA 4WCGA 2BOLA 2DOFA 3OL4A 3QYFA 4HEA2 1E62A 2M4KA 3T5XA 5LFAA 4IX7A 1S4MA 2CW0F 3OWTA 1SD6A 2CQKA 3W2EA 1OGMX 5HNHA 1MW7A 3HSRA 2DI3A 4C3JJ 1XB2A 1U9NA 1UMQA 3QU6A 3WGIA 3Q0WA 1OB2A 1YHQI 2ZZGA 2ZC2A 3WU0A 4YAOA 1E3ZA 2TCTA 5JVGF 1EXMA 1JXSA 1K28D 2HPMA 1Y56A 2X6OA 3VFZA 1IHMA 2HYJA 2Q6LA 3SYJA 5LGNA 4L8JA 4CCNA 5H5JA 2NTPA 3GFJA 3SY2A 2R7DA 4S0HB 4UAJA 3LAPA 3DU6A 2M7BA 5BQTA 2DY1A 1KQSB 2NAZA 4WZLA 2Q2EA 3ZPPA 1TWAJ 1I8DA 1J2XA 3F9KA 4XLPF 5BPDA 2VOOA 2J7KA 4P6VF 1LLZA 4YXWA 4BEHB 2GQFA 3DEUA 3RCOA 5C44J 2R7RA 1PJ7A 3E6DA 4HQEA 1R5OA 4LC0A 4E7ZA 1XTAA 3P9CA 3H94A 1YI2I 1OCTC 4M4SA 3S93A 2VKVA 5FO5A 1FPQA 2F5FA 2OJED 2RC4A 2HDCA 1FWZA 1OYWA 2ZBUA 1HQCA 1MMNA 4X1EA 4A3IJ 2UXNA 4XKCA 3RIRA 4PC2A 1VBLA 2R3SA 3OZUA 5B3SH 2PEXA 1TT0A 5GPCA 1KYZA 2P5KA 1FC3A 4RM2A 5IT9Z 4HIZA 2YUSA 2P0WA 1JUPA 3NWTA 1I1GA 1KU2A 2EFOA 2ECCA 4U0WA 2BGJA 2HLDA 1TYVA 2MG4A 3LA2A 1GHCA 1VQ9B 3CC4B 4W1UA 4YIFA 3RZOJ 1R5GA 1IDYA 4UVCA 5CQGA 2XZPA 3GQ8A 1MMDA 5JVTA 2IP2A 1H80A 4I01A 1QFJA 4GDFA 1HSJA 3WE3A 4ZV4A 3C7JA 5F4JA 5C4XJ 3I58A 1QO0D 3E97A 5FKMA 5L3FA 5EG0A 2BE5F 2X9DA 4M0LA 1TVCA 1SFEA 3B8YA 2BBYA 4EM2A 2FQ3A 3WHCA 2GXAA 5EGOB 1ODDA 1W0TA 2GM4A 4M6XA 2IS6A 1WJBA 5H6QA 3ZR8X 3W2FA 3F72A 1DARA 2E1MC 1Q1HA 1VTNC 2VNJA 3MZ8A 2NV4A 1P7IA 3FPKA 3QPSA 3DFGA 2DCEA 1BMFA 3HEFA 1U0JA 3LQQA 3J80Z 2D5VA 4AM3A 4LITA 1TQIA 2O8KA 3B8HA 3CCSI 4F7ZA 1Q82D 3W2GA 4MR0A 3OYGA 2CG4A 2LREA 1MJBA 2D9RA 3S3MA 1CF7A 1WOPA 2CFXA 2DFEA 2PG4A 2XUBA 3CUQC 3JTHA 3JAMZ 4RM3A 3WY9A 2QWWA 3VB2A 4XKVA 5J8FA 1LB2A 1O3SA 2LKSA 1HSTA 1NG6A 3B4NA 1HDDC 2O5RA 5BS6A 3WTWC 2ZL6A 4NBQA 2VIXA 3GTOJ 1G59A 3H09A 3KRGA 4QSHA 4RB1A 2V4DA 3CMAB 2DXIA 5L3CA 3ZN0A 1HG8A 4X7DA 4HWVA 3BTCA 2R7WA 3CC7I 4MXNA 1R7JA 1XS9A 2BY2A 3WTZA 3A02A 3H35A 4Z06A 5J1YA 3OY9A 3VYSB 4UUSA 2G0YA 1S6LA 2HFHA 3M1EA 5KAIC 4A69C 1G7TA 1T6YA 4M6VA 2FOKA 4XSXF 1GT0C 3TO6A 4BQQA 2E7XA 2YS9A 4R71A 3H0GJ 4FETA 5KNLA 2C4UA 3HOSA 3J81k 3FIWA 4ZDLA 4PFPA 3VYRB 3DV8A 1VF7A 1XFOA 3OS1A 2NRAC 3CF5F 1OR7C 2CV0A 4I2OA 4KKSA 5H59A 2JSCA 2M0CA 2DCUA 4BUPA 1O8IA 4F93B 1IRGA 5E20A 1GVHA 1ZM9A 2NNYA 2XT2A 4UUVA 1X2MA 1FYKA 1A31A 3ZIAA 1AIRA 1YJNI 4E6KG 1B8IA 4PSXA 4O3MA 2GJKA 1YW7A 2EH3A 3A0HC 1I3QJ 3NAUA 5EDNA 3CCEI 3E1YE 4M1KA 3A3BA 4F7DA 4N9IA 1E0EA 2VT3A 3G05A 1MNDA 1XDSA 2IPQX 2OPTA 3CCVB 3P9KA 5ICCA 4B47A 4KKTA 4N3GA 4OJOA 2CSOA 3G4SB 2CQXA 3GTMJ 4R1HA 4BHPA 3OPOA 1PE9A 1X3UA 3I55I 3I56B 3JRHA 3A3GA 2KT0A 3AG3H 2TDXA 2ZNYA 4U88A 1FBSA 2BVMA 1SVMA 5K5OA 2LD5A 1SKYB 4PC6A 1P7JA 4ITVA 1A35A 4B48A 3SEJA 4QHYA 2HOAA 4ON0A 3Q0UA 3J7YJ 3ML3A 3JW4A 4CXFA 2GXBA 1KU7A 1MBFA 2DAOA 2OTJB 2BSAA 2LY1A
chains in the Genus database with same CATH topology
2V31A 4XLEA 4CSWA 3L2QA 4U87A 2HVSA 1EE6A 1RU4A 3EQOA 1BOBA 4PMHA 4E7HA 3OYFA 1NG7A 1Z21A 2LH9A 2XGJA 2XZOA 1RWRA 2JA2A 2VASA 5C1EA 4CCLA 2AQFA 1BR4A 3DWLE 2HNHA 1O8LA 3GQAA 2X6YA 1H8HA 1YX5A 2F5VA 3ONQA 3VSUA 1O8MA 2PYHA 2XZLA 2MFZA 1KTWA 3S3NA 2ZXHA 3BG6A 3CJQB 3J7AY 2E1BA 3D5LA 2MC4A 4B3XA 4XM3A 4B44A 4OZZA 3T51B 4PFOA 2K5CA 3FKJA 3GQ7A 1BR1A 2GJPA 1PXZA 4CCOA 3GQBA 4Y3OA 3S32A 1FMWA 2KL4A 2F1MA 2FUG2 2DIEA 2W1OA 1N78A 3OMYA 3BC9A 4NK6A 4BE1A 2JJ1A 2M4GA 2HPIA 4RLQA 4NC8A 3RQ4A 2D3NA 2XOKA 2UVFA 1BR2A 3A1YA 3RPUD 3SYTA 4DJAA 2IGNA 2VLAA 2GK6A 3FKSA 2UV1A 2R7SA 2BSPA 2LRDA 2V7QA 1UAAA 2VJJA 2X1EA 3K4BA 4XR6A 3OW7A 3JU4A 2HDWA 2M3AA 1PLUA 2EWEA 3VMWA 2OC6A 3EPZA 5TGTA 2XF6A 3SZGA 3WQZA 3W2AA 4HG2A 3M8JA 1V5FA 2CH0A 1JTAA 5CPRB 1CZFA 3T56B 1QJVA 3L2RA 3K10A 1UG0A 3DTKA 1D0ZA 2ODLA 2VQCA 1ZELA 1WJAA 2MYSA 3DQVC 3IAS2 2CS3A 3OYHA 1OOCA 5FRMA 1UD4A 2W7NA 2XNDA 3N05A 4C2UA 3VSVA 3B90A 2KLOA 3LSKA 3MD2A 4KITB 3BCFA 3CP8A 2F43A 4QPQA 3LSHA 2KRHA 4CZCA 2VPLA 4OJ6A 4FASD 1QHGA 2WPDA 1WP6A 3TMOA 3ZSCA 4TKOB 5CDFA 2QKLB 2NZMA 4HSTA 1NRKA 2CV2A 3OFNA 3FDYA 4C2TA 4IQ4A 3OYBA 2WJYA 4NUBA 4JMQA 4G6TB 2X6XA 2F4IA 4P1WA 2R7TA 1LKXA 4XORA 2V7FA 3BCBA 4HPQA 3HOTA 2VKDA 2CUJA 1D1BA 1IB4A 2DOAA 2E5ZA 3KYLA 2WADA 2Z16A 4W8RA 2WY7Q 3OR2C 4HNUA 3V42A 2LOOA 1DP3A 4OAYA 4UZUA 4U7BA 2NT6A 2W6JA 4HSRA 4NNJA 2D3LA 3BG7A 3A35A 2LC2A 3EUAA 2W82A 5JHFA 3FBNB 4G7WA 3MKWB 2LY1A 3L2VA 4IQJA 1QCXA 2MD0A 4YRVA 4I84A 3I9V2 2LG4A 4F52A 3VDXA 2W4SA 1X4OA 2Z2SB 2JVGA 1X19A 2RNGA 1E3XA 4W8SA 4C9YA 4YZ0A 3VSTA 4DBQA 4D9JA 3K4MA 3PNYA 3A2KA 4DNRB 4XOPA 4LG3A 4XD7A 1X4PA 1KCDA 3MMYB 2QE7A 2KHMA 2W6IA 3OEEA 2X3HA 3KEWA 4J01A 2JSPA 4E0FA 4W8TA 1WJFA 2I8DA 4BJ6C 3W3CA 2VBEA 1EA3A 1WJCA 3OOUA 3E1SA 3PSFA 4AU7A 2WB1A 2X6WA 4AYBA 5DN6A 3BH4A 3AL0B 2OV7A 3OS2A 4XLFA 1NHCA 2L9SA 1WFXA 3DKXA 4KJZA 4BDYA 1FX0A 3T53B 2F6CA 3D5RC 4RMNA 3HC7A 3K4KA 3LFUA 1P9QC 4AVZA 2HVQA 5HKKA 2NSTA 4MLOA 2WY8Q 4GQNA 4Z1MA 2IQ7A 2KPMA 4CA0A 1E79A 1W9XA 1UD5A 4W8QA 1D1AA 1EFRA 2VQLA 1SAUA 2BW3B 3CP2A 3OEHA 4B3FX 3H9GA 4ZTFA 1Z7LA 1D1CA 2XAUA 4HRIA 3H9JA 1UD2A 2Z8GA 2LY2A 3GRHA 4OJLA 1E1RA 1OFLA 4CH7A 2KVOA 3QOEA 2IS4A 1VLYA 1Z3XA 3BCAA 2RQQA 3DTEA 1FMVA 4XN3A 3S3OA 1W36D 1W0KA 3ZXSA 3HKZA 1O8KA 1K5CA 1VJSA 3HL2A 3UW0A 3OR1C 4Z03A 1X1BA 3LMMA 3GBGA 1DQUA 3U21A 3DTIA 3K70C 2GK7A 4BU2A 4LIVA 2IS2A 4YEJA 4BE0A 1QHHD 4DK0A 2O0VA 3FY3A 1S9HA 1GLNA 1RMGA 2DT7B 2NSPA 2O17A 4CCMA 2PJRA 2V4JC 4JOMA 4ZDPA 4CCJA 3LSIA 1E1QA 3FPPA 3VMVA 3HXLA 2VXDA 3DPUA 4II3A 1T95A 4LIUA 3GQ9A 3D5SC 1D0XA 1IRXA 4G7XA 1OGOX 1IDJA 3SUCA 4IKFA 3L2UA 4CUGA 2QY1A 2R7UA 4FXUA 4XKWA 3AKZA 5IK2A 3ZPNA 4E7LA 3KX2A 1O8FA 2Q2EB 4XLAA 1DBGA 1GQ8A 3OYAA 4BJ5C 3W2VA 2O0WA 3AFHA 1LDKB 2INVA 2KQRA 3MKYB 4BE2A 3T9GA 3BC8A 4D1QA 1O8DA 3PSIA 1XG2A 2PECA 3SEZA 2M5SA 4DK1A 3OYMA 4BXFA 2CW7A 4ZC3A 3PNTA 4HNTA 3HPGA 3LSMA 2R7OA 4TT3A 1O8HA 1X1DA 2KDOA 1JI8A 4J00A 3VYUB 2O04A 4Z05A 1N75A 3SDBA 3C2HA 5HVQC 2Y0SA 2L9NA 2WAQA 2R7XA 4XN0A 2ZZEA 4H4KC 3DDYA 3CMMA 4P22A 4OJ5A 2NTQA 4BGDA 3H5RA 2JDIA 3ZGKA 3K4LA 1QU3A 1JRGA 3L2WA 3OL3A 4PUSA 4NC7A 2PJRB 3QYEA 1PKVA 4TSFA 1V0EA 3S8PA 2L7KA 2X8KA 3QYBA 1V0FA 1R6RA 5FL7A 4E7JA 4XL9A 3DLAA 2ZXIA 4DOZA 2IGMA 1N77A 2ZZFA 2E1MB 4B43A 3LNNA 3G2BA 2INUA 1KCCA 2PMZA 2VJ4A 3K4JA 3OAAA 1VZ0A 2CUZA 2HZDA 2WBMA 4OZYA 2W00A 3WWGA 4OWRB 4Y4RA 3A4CA 4PJNA 2K3PA 3HG9A 2V26A 5CQEA 5HOOA 2XDVA 1O88A 1X1AA 1WJEA 2LBFA 2UUZA 3OYDA 1OFMA 3HPHA 2K9MA 1WPCA 4ASUA 4DNTB 2BW3A 2ZFUA 3DKYA 4YZAA 3AL0C 1SFKA 2JVHA 2IS1A 4II2A 2ZSIB 2M0MA 3IAM2 3NE5B 1UELB 1COWA 2BOLA 3OL4A 3QYFA 4HEA2 2E5NA 4IZZA 4ZJZA 4ZYAA 4XLCA 2M4KA 2Z6BD 2VQGA 5LFAA 4IX7A 2VJIA 1KZLA 2M7AA 3UNGC 2XF7A 1HA8A 3OWTA 1G8XA 2PYGA 2UVEA 2Q1ZB 3OYKA 1OGMX 5HNHA 1MW7A 4BDZA 2ZZQA 1LVKA 2LYCA 4XMYA 2ZZGA 1DGRM 2ZSHB 4F3QA 2X1DA 2UWMA 1OLTA 3DEEA 1E3ZA 2VBKA 1UD8A 2IXSA 2HPMA 1Y56A 1K28D 3OE7A 3JURA 1T0FC 1K6YA 2WZPP 2IGOA 4L8JA 4NQWB 4CCNA 3GVKA 1KONA 2Z1DA 2NTPA 1O8GA 2RREA 4KISA 3DU6A 2M7BA 3ZQQA 1T5EA 1DGWY 2GOMA 4BQNA 3ZPPA 4DIQA 1I8DA 2L5QA 3F9KA 4ZDOA 4R79A 2LBFB 2R4GA 4BEHB 4YXWA 1DBOA 3NWSA 3RCOA 3TL4X 5FROA 2R7RA 3DPLC 3EUKL 4E7ZA 4OJPA 3H94A 3S93A 1V5GA 3E0JB 4KT6A 2VXZA 2X51A 2R7QA 2DT6A 1MMNA 3BLYA 4E7SA 2WAEA 4XKCA 1VBLA 4XNFA 4XKBA 1I18A 1TT0A 2JJ2A 2R7VA 4RM2A 1HZEA 4HIZA 5HLTA 2P0WA 3NWTA 1AA7A 1V5EA 2X1CA 2HLDA 3PL8A 2NOJB 3OS0A 3OYJA 4C30A 2A5WA 4CCKA 1YX3A 2V6EA 1ERDA 2KMUA 5CQGA 2XZPA 4BL0B 1MMDA 3OIPA 3GQ8A 4XONA 2A6TA 2CFOA 1H80A 3KEYA 3EQNA 2VB6A 3MKZA 4RLFA 4X0GA 3VSLA 3B8YA 2BVLA 3DPTA 5CKTA 3H0DA 2VBMA 1HVXA 2KZVA 4QPOA 2XF5A 2E60A 4F91B 2ZTNA 2IS6A 1WJBA 3ZR8X 2ZTGA 1IDKA 4U4BA 3FHNA 3OYLA 2E1MC 3PJRA 2QX3A 1D0YA 3GVJA 4PJMA 4F92B 2DJIA 1PJRA 2V1NA 3H9QA 4BQOA 3FBIB 2DCEA 1BMFA 3OIQA 1U0JA 3CJRB 4LITA 3OYCA 1WJ5A 1X1CA 3TBIA 4MR0A 3PUBA 3OYGA 2LREA 4P5OA 2XSJC 3S3MA 1MMAA 2VL8A 1W36C 3HAGA 3I3LA 4N4OB 4XLHA 4YZQA 4PK4A 1BHEA 4RM3A 4EW9A 4EATA 1W0JA 3RTRA 4Y33A 1BN8A 4XKVA 3VSKA 1E43A 3GVLA 2WA0A 2OUMA 1NG6A 3B4NA 2HU9A 1UD6A 3PNVA 2O5RA 4KKUA 1PYVA 2VIXA 4PSWA 1G59A 4NK8A 2KP6A 3KRGA 4XQFA 2KRCA 3C2GA 4ANJA 4XOTA 3K4CA 4E4HA 2DXIA 2V4DA 1J09A 4C2LA 2QXZA 1HG8A 2JIZA 4HWVA 4PJJA 3IP4B 3OYNA 2NT9A 5LD2C 4F55A 2R7WA 1NBMA 4MXNA 5FRNA 3LSGA 2JUGA 2X53S 1YE9A 4E7KA 2IGKA 3H35A 4BEHA 4Z06A 2GJRA 2VKHA 3OY9A 3VYSB 4N4NB 1BLIA 3UR3C 2R9VA 3W2WA 1Z3YA 3CZ6A 4U49A 3OYIA 1MABA 5AMVA 2VJ5A 2CMPA 2MABA 2XC7A 3SEQA 1IA5A 2X85A 4BQQA 2WJVA 3LMWA 4FETA 4GRIA 3CF2A 5KNLA 3HOSA 4E7IA 2GOXB 4ZDLA 4PFPA 2L2OA 3VYRB 1VF7A 1WTHD 4YELA 3OYEA 3OS1A 2LZJA 3ZCOA 3OOCA 3CESA 1OR7C 3H5NA 3M1CA 2CV0A 3EUHC 4KKSA 3H5AA 3VR6A 4OAZA 4BUPA 1O8IA 4DGWB 3QODA 4F93B 2ELJA 3BCDA 4ZTJA 1H8EA 4G6IA 3RSNA 3ZIAA 4JQFA 4B3GA 1X0CA 1AIRA 3VYTB 3HUGB 1MMGA 4E6KG 1WMRA 4PSXA 4URRA 2K9LA 2GJKA 1OB0A 3PFYA 3K70D 2NTBA 1OHHA 1UD3A 3IUOA 3A3BA 2CK3A 1KMHA 1E0EA 3G05A 1MNDA 1LFPA 3VWBA 3LL7A 1MNEA 4BACA 2CW8A 4B47A 4KKTA 1O8JA 4OJOA 2AQEA 2CV1A 2HVRA 4BS9A 5KHDA 2QKMB 3K6GA 2WSSA 3OPOA 1PE9A 2O1DA 1Y6IA 3A3GA 2VQHA 2BVMA 4YZXA 2HQAA 1SKYB 4BJTA 1BPLA 4ITVA 2WAFA 4DBRA 5HNFA 3DU5A 4PJLA 3K4NA 5C1CA 1TZLA 4B48A 3ZRGA 5KCMA 1WJDA 1O8EA 2V9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLE A;  1RU4 A;  3EQO A;  1EE6 A;  4I84 A;  4PMH A;  4XL9 A;  1IDK A;  4W8S A;  4U4B A;  4YZ0 A;  1RWR A;  3VST A;  1KCC A;  2INU A;  2QX3 A;  4XOP A;  4OZY A;  1KCD A;  5C1E A;  3GQA A;  2X3H A;  1O8L A;  3WWG A;  2X6Y A;  3VSU A;  1O88 A;  1O8M A;  2PYH A;  4W8T A;  2VBE A;  1KTW A;  1OFM A;  4MR0 A;  2X6W A;  4XLH A;  4YZA A;  4YZQ A;  4XM3 A;  1BHE A;  4OZZ A;  4EW9 A;  4XLF A;  1NHC A;  1BN8 A;  4XKV A;  3GQ7 A;  4AVZ A;  4XLC A;  1PXZ A;  2NST A;  3B4N A;  2IQ7 A;  2VJI A;  4NK8 A;  4NK6 A;  2PYG A;  2UVE A;  3KRG A;  4XQF A;  4W8Q A;  1OGM X;  4XOT A;  2UVF A;  4C2L A;  2QXZ A;  1HG8 A;  2Z8G A;  3GRH A;  4HWV A;  4OJL A;  2NT9 A;  1OFL A;  4MXN A;  4XMY A;  2BSP A;  4XN3 A;  2VBK A;  2VJJ A;  4Z06 A;  4XR6 A;  1O8K A;  1K5C A;  3UW0 A;  3JUR A;  1PLU A;  2EWE A;  4Z03 A;  3VMW A;  4U49 A;  2NTP A;  1O8G A;  5AMV A;  1IA5 A;  4YEJ A;  1JTA A;  2X85 A;  2O0V A;  3FY3 A;  1CZF A;  1QJV A;  3ZPP A;  1RMG A;  2NSP A;  2O17 A;  3LMW A;  2ODL A;  3VMV A;  4YEL A;  1DBO A;  1OOC A;  3GQ9 A;  4OJP A;  3VSV A;  1OGO X;  1IDJ A;  1O8I A;  3B90 A;  3SUC A;  2QY1 A;  4XKW A;  1O8F A;  1X0C A;  4XLA A;  1DBG A;  1GQ8 A;  1AIR A;  1VBL A;  4XNF A;  1WMR A;  2O0W A;  4URR A;  4OJ6 A;  2INV A;  2NTB A;  3ZSC A;  3T9G A;  2NZM A;  1O8D A;  1XG2 A;  2PEC A;  2X6X A;  4OJO A;  1O8J A;  4XOR A;  1O8H A;  1PE9 A;  2O1D A;  3GQ8 A;  1IB4 A;  2O04 A;  4Z05 A;  4XON A;  1H80 A;  3EQN A;  4W8R A;  4YZX A;  4XN0 A;  4OJ5 A;  2NTQ A;  2NT6 A;  5C1C A;  3B8Y A;  1JRG A;  1O8E A;  2VBM A;  1QCX A; 
#chains in the Genus database with same CATH topology
 4XLE A;  4PMH A;  3L2Q A;  4U87 A;  2B7C A;  1P4X A;  4E7H A;  1J75 A;  4P3Y A;  3OYF A;  4XLN F;  1WOO A;  2VZL A;  1NG7 A;  3QFS A;  2PN6 A;  1XCV A;  2EZK A;  3ZQH A;  2XGJ A;  2IEK A;  2XZO A;  2QGG A;  4HE5 A;  3LO8 A;  1RWR A;  2E2J J;  1UJ8 A;  2YWH A;  4W97 A;  1BA5 A;  5EZH A;  2VBT A;  3S1Q J;  4G6Q A;  3DWL E;  2HNH A;  1O8L A;  3GQA A;  5LGT A;  3SQN A;  1YX5 A;  3F22 A;  3M8F A;  1FTT A;  1TTY A;  3QP6 A;  2DFI A;  1IUY A;  4I0B A;  2HR3 A;  2MC4 A;  1ZH5 A;  3OZV A;  3H3V K;  4X05 A;  2M87 A;  4HLY A;  1S8N A;  4IHV A;  4WXD A;  3RI4 A;  4GFB A;  4Y3O A;  3ZMZ A;  4DQK A;  1KJZ A;  4OIQ F;  1FMW A;  3IWF A;  4NK6 A;  3MCA A;  4NDL A;  1POG A;  4BE1 A;  2M4G A;  3RQ4 A;  4NC8 A;  3W6V A;  4RPD A;  1XDU A;  2NVQ J;  1SC7 A;  3R6J A;  4OIR F;  5C4J J;  2IGN A;  1WRJ A;  5DS9 A;  3FKS A;  1R5N A;  2R7S A;  2BSP A;  4D0P A;  2BN4 A;  1BN5 A;  2G9W A;  2JRM A;  4A3D J;  2W24 A;  1G3Y A;  3RY8 A;  3K4B A;  2HOT A;  3JU4 A;  1MRZ A;  2GA2 A;  5EF6 A;  2M3A A;  2EWE A;  2YX7 A;  4OU0 A;  3CO6 C;  2QVO A;  2RN7 A;  5E1Z B;  1K83 J;  2VNH A;  2VNI A;  1JTA A;  2R7Z J;  1LEA A;  4DNC A;  2M8G X;  2XKO A;  2R92 J;  2K9Q A;  1RUO A;  4N0B A;  3K10 A;  1UG0 A;  3GSI A;  4M3E A;  4CHU A;  4HF2 A;  3Q3S A;  3CRZ A;  5FO1 A;  3OYH A;  1ZEL A;  1WJA A;  2MYS A;  2VYQ A;  2GXG A;  5IYQ A;  5B1B H;  3ONU A;  5FRM A;  4HW0 A;  4MQ9 F;  1QQI A;  4YIR X;  3K1M A;  2BM7 A;  2KLO A;  1K61 A;  1O4X A;  5HS7 A;  4HF1 A;  3I59 B;  3H92 A;  2X3U A;  3CP8 A;  1FSH A;  1GV2 A;  2KRH A;  1MBH A;  1E3O C;  3G6E I;  1IJE A;  3ABM H;  4FAS D;  2KKO A;  4G5G A;  3LFK A;  2P5L C;  5K7H A;  3IH4 A;  3V7S A;  1YIJ B;  2Y48 A;  2NZM A;  3OFN A;  3MCZ A;  4FX0 A;  3SJP A;  4C2T A;  4N9H A;  4NUB A;  2P4W A;  2MC3 A;  1Y8R B;  4FE4 A;  2ACJ A;  4XOR A;  3P7N A;  1XD7 A;  4UXN A;  1Z91 A;  1Y1W J;  4HPQ A;  4I98 B;  4V2G A;  3HOT A;  1ZUN B;  3BR6 A;  3V7A A;  2X4H A;  3WG9 A;  2CUJ A;  2IA2 A;  3AVT A;  3QWL A;  2DOA A;  3H1C A;  1WSU A;  2E5Z A;  2Z16 A;  5EEA A;  1WDT A;  3PIP F;  2BV3 A;  1K9M D;  2WY7 Q;  3OR2 C;  4B09 A;  5IP9 J;  1PVE A;  1YG2 A;  3V8K A;  1DP3 A;  1LDJ A;  1K78 A;  4OAY A;  4U7B A;  2NT6 A;  1ETY A;  3PFI A;  4L5J A;  3BY6 A;  1L3L A;  4ZCI A;  3EUA A;  2IBD A;  5HLI A;  2W82 A;  1TNS A;  3S2W A;  3MKW B;  3HRT A;  3L2V A;  4KFC A;  4XK4 A;  4BQA A;  3I9V 2;  1WHU A;  2STT A;  4F52 A;  3JQQ A;  1BW6 A;  1X19 A;  2R6H A;  4W8S A;  2R5Y B;  1YHQ B;  3SLN A;  4HX8 A;  2C2W A;  1D2E A;  4M71 A;  3GFL A;  1ZAR A;  4GGG A;  3BZK A;  4FX4 A;  4DNR B;  1KCD A;  2XV4 S;  2ZBV A;  3MMY B;  3R0J A;  4EJU A;  1HLV A;  1G4D A;  5K1Y A;  1BIB A;  4Z4Z A;  1I50 J;  1ETX A;  4BJ6 C;  2QYU A;  2RC6 A;  1FLI A;  4I0A A;  3ZUG A;  1R1V A;  3CME I;  2EFW A;  4YAU A;  2Y69 H;  4TMT A;  5E8G A;  1K79 A;  3AL0 B;  2OV7 A;  5B1A H;  3PEN A;  1NHC A;  1V3F A;  3DKX A;  5AON A;  3WTV C;  4RMN A;  3D5R C;  1AWC A;  3HC7 A;  2QM3 A;  3HYI A;  4C3H J;  1FJL A;  1PJ5 A;  4ZH4 F;  1Y39 A;  2P8T A;  3PSS A;  4CA0 A;  3A01 B;  2CYY A;  3TP3 A;  2M5W A;  3CJN A;  3F21 A;  4W8Q A;  4GYG A;  2HDD A;  2VQL A;  1L1I A;  3ZMV A;  4ZTF A;  3DF8 A;  1Z7L A;  1UD2 A;  2Z8G A;  3H9J A;  4D5F A;  1B1B A;  1R22 A;  1Z67 A;  3GCM A;  1D3Y A;  3G1O A;  1GUU A;  4X6A J;  2P3M A;  3ASQ A;  5B6I A;  1IG7 A;  4AWX B;  4XN3 A;  3S3O A;  3ZMT A;  1GVD A;  5DCM A;  2OYN A;  3BQJ A;  1O8K A;  1RZ4 A;  2QEN A;  3UW0 A;  4Z4V A;  3L9F A;  3ABL H;  4M6Y A;  2WWY A;  4GO1 A;  4UHT A;  3Q5F A;  1BI0 A;  3A8I A;  4D7M A;  2GK7 A;  4LIV A;  4YEJ A;  2O0V A;  2WV0 A;  1N06 A;  3H3Z A;  1RMG A;  1VQL I;  2PJR A;  2J8I A;  2V4J C;  4JOM A;  1U6G A;  4CCJ A;  3HTS B;  1VHO A;  3UKG A;  3FPP A;  2Y9Y A;  1OCO H;  3HXL A;  2VXD A;  5M5Y J;  3SDG A;  1VQK I;  3ZC3 A;  3D5S C;  1FX7 A;  2K4J A;  5FFZ A;  5GTI C;  2KJB A;  4XKW A;  3AKZ A;  2E1N A;  2LMD A;  1I7P A;  3ZPN A;  4E7L A;  2BHZ A;  3KX2 A;  5J1R A;  1KTV A;  2Q2E B;  5DDG A;  1DBG A;  4IVN A;  4A0Z A;  3ZQL A;  3OYA A;  1XSV A;  2A6E F;  4Y9U A;  4KDP A;  3BNW A;  3B6A A;  5LRR A;  3IKT A;  4M74 A;  4TMV A;  2ZCW A;  1AU7 A;  4X06 A;  1UZC A;  3LSJ A;  2M45 A;  1DUX C;  2IT0 A;  2F4N A;  4D1Q A;  2WR8 A;  3KL9 A;  4NBS A;  3TH0 A;  1XG2 A;  3WTT C;  4BHB A;  5HDN A;  3E6C C;  1YJW I;  4BXF A;  1JB9 A;  2M5S A;  1TW3 A;  2V79 A;  3PNT A;  4DK1 A;  2P81 A;  3IL2 A;  1IV6 A;  3CCS B;  1VQ8 B;  1R00 A;  1QGY A;  1A6Q A;  5LMZ A;  2QZA A;  2KDO A;  1KK3 A;  5J4V A;  5FD6 A;  5GAD J;  4OPS A;  1NTC A;  3TP0 A;  1QZE A;  3LQ6 A;  2VFQ A;  2A07 F;  2D1H A;  1IC8 A;  2L9N A;  3G3Z A;  2PMU A;  4HX7 A;  1XSD A;  4OJ5 A;  1MSF C;  3CMM A;  2VOP A;  2G0E A;  3FXR A;  2NS0 A;  3U9G A;  2K3F A;  1F4K A;  5B66 C;  4I6Z A;  2P7C B;  3CPX A;  2OA4 A;  5LRS A;  3OL3 A;  3ROU A;  3U2R A;  3QYE A;  2NVU B;  4A6E A;  1SFO J;  1V0F A;  1JJ8 C;  3J7Z I;  1R71 A;  1VQN I;  5TV2 A;  2IGM A;  3QSY A;  3CC7 B;  1TNT A;  5DCF A;  1B72 A;  3PO3 J;  2JZY A;  2VJ4 A;  3P9I A;  3S17 J;  1EV7 A;  1VZ0 A;  4WXH A;  5EG0 B;  1WZ2 A;  4L0Y B;  3W2H A;  2C5B A;  2W00 A;  1ULY A;  3WWG A;  2VON A;  1A5J A;  4PJN A;  1QVU A;  2K3P A;  2V26 A;  1O88 A;  2XDV A;  3QAH A;  3JRA A;  1YX2 A;  1N8R D;  3WG7 H;  2LBF A;  3OYD A;  1I6H J;  3HPH A;  3E5Q A;  4BHC A;  1ITY A;  3BY2 A;  3GLL A;  4ZCL A;  2E36 A;  3I64 A;  1QZZ A;  3L00 A;  3DKY A;  2IAI A;  1ZLK A;  1SFK A;  3AL0 C;  2M0M A;  3BG3 A;  3MHP A;  3KET A;  4P55 A;  2F5C A;  4KIC A;  5HZB A;  4MQV A;  1KQ0 A;  4XLC A;  4ZYA A;  3HSF A;  4Y7N J;  2Z6B D;  2VQG A;  2VJI A;  1OFC X;  2CW5 A;  2B0L A;  3UNG C;  3DU1 X;  2XF7 A;  1T0F A;  2HCJ B;  2BM1 A;  4RB2 C;  2Z99 A;  3DP7 A;  4BDZ A;  5K5Q A;  1YJN B;  5J35 A;  3WGG A;  1RQR A;  3CCE B;  1KA8 A;  5EYR A;  4ZZL A;  3GTQ J;  3S2D J;  4YAW A;  2ZSH B;  4UV9 A;  4F3Q A;  3C2B A;  4OOS A;  4YFX F;  5GV8 A;  5ED4 A;  4G7Z F;  1TYU A;  4P1V A;  2LDU A;  2DYS H;  1K6Y A;  5J3O A;  3HOW J;  3OKX A;  1QX4 A;  2IGO A;  3GVK A;  2QN6 A;  4NCN A;  1TWF J;  2Q6K A;  3HOU J;  2RRE A;  4JX4 A;  4KIS A;  2YR2 A;  4A0Y A;  3Q39 A;  4HAM A;  1KZH A;  1FND A;  4XRS G;  2L9V A;  4DIQ A;  5KSW B;  2L5Q A;  2QCO A;  4R79 A;  3ML6 A;  3G1M A;  1BW5 A;  1OIS A;  4HE6 A;  3NWS A;  1DBO A;  2LFB A;  3TL4 X;  3ESW B;  2MLG A;  1QRY A;  3LVB A;  3PET A;  3EUK L;  1QA3 A;  4LG0 B;  3HOV J;  1H89 C;  1D8T A;  1IXS B;  2XAQ A;  3QPH A;  2B7E A;  1PDN C;  3PA2 A;  3I0T A;  1KU9 A;  4KT6 A;  5CVJ A;  1MBE A;  3F8F A;  5FJ8 J;  1MH3 A;  3A1P A;  1LNW A;  3BLY A;  2HYF A;  3IH2 A;  1RPW A;  4ACB A;  3SZT A;  2DA1 A;  2JJ2 A;  1DDI A;  2OK8 A;  2E71 A;  3AVX A;  4UUT A;  1RET A;  2ZME A;  2YPR A;  5FKO A;  2XTY A;  1HF0 A;  4CDG A;  2F4O B;  2NOJ B;  3HOY J;  5KW9 A;  1JKP C;  3ZZ0 A;  1Y8Q B;  4RD4 A;  1T6X A;  3Q38 A;  2X0K A;  3OIP A;  1ON2 A;  1UB9 A;  4QWQ A;  3KEY A;  2VB6 A;  5M5W J;  3ZQG A;  1LQ1 A;  5GV7 A;  3Q6R A;  3MWM A;  4X0G A;  1J0R A;  3O2P E;  3LSR A;  5M3M J;  1PP8 F;  2BVL A;  1N07 A;  4LK1 F;  1XMX A;  3DPT A;  2B0R A;  1X3Z B;  4HZF A;  1HVX A;  2L3D A;  3H3U A;  1I39 A;  1CQX A;  1B23 P;  3M07 A;  2ZTN A;  1P6R A;  3R6S A;  2ZTG A;  3ZMU A;  3FHN A;  1F20 A;  3NAR A;  3OYL A;  3AG1 H;  3OP1 A;  3AVW A;  2KDZ A;  2PMH A;  3SXY A;  3V7C A;  1Z7U A;  1SD7 A;  2DA7 A;  1SEU A;  5A2Q K;  3BZ6 A;  3N90 A;  1KQ9 A;  5IP6 A;  3IRQ A;  3M8E A;  1S7O A;  3CCL I;  3B6C A;  2XSJ C;  4P2N A;  1MMA A;  2VL8 A;  1Y1V J;  1W36 C;  3PO2 J;  2BPO A;  3HAG A;  4ZGN B;  4YZQ A;  4IRG A;  1S7E A;  3CLQ A;  3RTR A;  1UCR A;  3VSK A;  4CGZ A;  4LJZ F;  2NS7 A;  4I02 A;  2OUM A;  1UD6 A;  2DMP A;  4M72 A;  4KKU A;  1PYV A;  2L9R A;  3T0Y A;  5F0H A;  4OP7 A;  2YUH A;  3WTX C;  2OU2 A;  1ZM4 A;  4IPA A;  2HQR A;  1XCB A;  1FNC A;  3IKV A;  1WKM A;  2KRC A;  4UB8 C;  4XOT A;  5D5U B;  3CCQ I;  4Z4R A;  1FY7 A;  1J09 A;  3RJP A;  1PUF A;  2QXZ A;  2ZXW H;  4PJJ A;  3G6E B;  3IP4 B;  3TQN A;  1ETV A;  4F55 A;  1A04 A;  1NBM A;  1QFY A;  3H36 A;  3W5H A;  5C3E J;  2JUG A;  1R9T J;  1G7S A;  5LHH A;  1TTT A;  2IGK A;  1JT6 A;  1W2B B;  2KIM A;  2PMD A;  2Q8K A;  4N4N B;  2R9V A;  3K69 A;  5DUK A;  1KYW A;  2VBV A;  2R0Q C;  4D5C A;  1Z3Y A;  3CMY A;  2OBT A;  4RAF A;  1MAB A;  2DBB A;  3CPW B;  1IA5 A;  2QQ9 A;  2X85 A;  1BJZ A;  2L0K A;  2ELH A;  1GVJ A;  5F04 A;  2COB A;  3CF2 A;  4E7I A;  5E6T A;  2GOX B;  1ZTR A;  2BYV E;  1D8J A;  3HHH A;  4YEL A;  4JK1 X;  3OYE A;  1IXC A;  4MO7 A;  1EP2 B;  1IN5 A;  4BBS J;  1UHS A;  3KEO A;  4ASN A;  2DMU A;  1FTZ A;  1YS7 A;  4DGW B;  3CCJ I;  2ELJ A;  2JTV A;  2DQL A;  5FKN A;  1R58 A;  3BCD A;  1H8E A;  4G6I A;  3JRD A;  2F2E A;  4B3G A;  1X0C A;  1JUM A;  3VYT B;  3HUG B;  1MMG A;  3ASS A;  1YTY A;  4U9U A;  3SZE A;  3PFY A;  2NTB A;  2F5D A;  1VI0 A;  2CK3 A;  3WND A;  1KMH A;  3CCU I;  1KU3 A;  2HTJ A;  3ZPL A;  2L7F P;  1OPC A;  2EZL A;  2VBS A;  2DLL A;  2CW8 A;  2FNA A;  3ULQ B;  3V4G A;  2BGC A;  4X7E A;  1F43 A;  1O8J A;  1VQM I;  4J0Q A;  3CD6 B;  3ISP A;  5DD8 A;  5FLV A;  2CV1 A;  2HVR A;  5KHD A;  2QKM B;  2YX4 A;  4TMW A;  1Y6I A;  5IYW A;  5DUI A;  1OCP A;  3PQK A;  5A88 A;  2OBP A;  3HIF A;  1ZAO A;  3FJO A;  4RDL A;  2H8R A;  4AIH A;  4BY1 J;  4KH3 A;  4BJT A;  1EFT A;  3I53 A;  3HRU A;  4Y15 A;  5GP9 A;  2OAZ A;  5HNF A;  2UZK A;  4G7H F;  4Q48 A;  3JRE A;  1V4R A;  2OQR A;  1LEB A;  2WTE A;  5D5X B;  2G7H A;  4A3B J;  4V19 K;  2PFB A;  1VQO I;  3IRR A;  3ZQ7 A;  2XT4 A;  1RIO H;  1U2W A;  2V7W A;  2V31 A;  4CSW A;  1XMK A;  2HVS A;  1RU4 A;  2EJR A;  1O7L A;  4Y9R A;  3O8H A;  1Z21 A;  3P26 A;  2LH9 A;  3BZC A;  2W48 A;  4LLL A;  2JA2 A;  2ZJR F;  4BNC A;  5FGM A;  1MGT A;  4A3L J;  4O5V A;  2AQF A;  4IW3 B;  3FIS A;  1BI3 A;  4FQG A;  4A0X A;  1HKT A;  2CBX A;  1E3P A;  3GUD A;  3ONQ A;  4Z2Y A;  5GTH C;  2ZKZ A;  1O8M A;  2BX6 A;  1RC9 A;  3MQ0 A;  4QTR A;  1ETQ A;  2P5V A;  1S72 B;  3S3N A;  3BG6 A;  3CJQ B;  4XIC A;  1O3R A;  3D5L A;  3ZMS A;  3J7A Y;  1R23 A;  2E1B A;  3E3V A;  3HGY A;  4XM3 A;  4B44 A;  3OSG A;  2DPD A;  3L09 A;  4PFO A;  2XAF A;  2K5C A;  1IJF A;  4X07 A;  2EZI A;  3T51 B;  1VQL B;  3MZY A;  1VQK B;  2VFP A;  1PXZ A;  3GQB A;  1W7P D;  1QBJ A;  2PJP A;  2DIE A;  2OF7 A;  1JTY A;  1OYI A;  3PUF A;  5CLS A;  2UVF A;  2HPI A;  2X48 A;  3FMR A;  2JRT A;  2D3N A;  2V7T A;  2DA5 A;  3BR3 A;  3WE2 A;  3RPU D;  3VO2 A;  3ZN1 A;  4YHB A;  1BI2 A;  4KT5 C;  1BOA A;  1G7C A;  2VJJ A;  2X1E A;  3VNU A;  4XR6 A;  2CQN A;  3X2Q H;  2V7U A;  2RKH A;  1YJW B;  3VMW A;  2OC6 A;  4CIC A;  5TGT A;  4CZZ A;  2BEO A;  2D1V A;  4HG2 A;  4M3D A;  1CZF A;  3T56 B;  2EFQ A;  4RD3 A;  1ZM3 A;  4IHS A;  2GIV A;  1IGN A;  1QGA A;  2H6C A;  1D0Z A;  3M9A A;  5DCM B;  4BKX A;  4DZP A;  4RD1 A;  3DQV C;  1K6O A;  1IN7 A;  2L7M P;  1DDG A;  1IN4 A;  4HF0 A;  4C43 A;  2DMT A;  4LB6 B;  3MD2 A;  1REP C;  1F5T A;  2FBI A;  2ZJ2 A;  4KIT B;  3T1B A;  1HC8 A;  5CVU A;  4MFE A;  1VQN B;  2F43 A;  5FO0 A;  2PLF A;  4B1R A;  3ZP5 A;  4OJ6 A;  4CO8 A;  1ETO A;  1QHG A;  3S15 J;  2WPD A;  2V5I A;  1WP6 A;  1Q1V A;  3TKY A;  2QA4 I;  3H9N A;  4B8X A;  5FNZ A;  4HST A;  5JLV C;  4H0E A;  1EA0 A;  1R1T A;  1MJ9 A;  1FYM A;  1ZK8 A;  3OYB A;  2OQG A;  3K1P A;  2F5E A;  2OCC H;  3JSO A;  3FM3 A;  2WZN A;  2QEX B;  2F4I A;  1IDZ A;  4Z4T A;  1LKX A;  3CDL A;  3TOB A;  2NS8 A;  2V7F A;  4YCQ A;  1IZ1 A;  4IJA A;  3LNQ A;  1FOK A;  1IB4 A;  2DOD A;  1M1E B;  1N08 A;  5ILS A;  4W8R A;  3ZQI A;  1BBY A;  1W5C C;  1AKH A;  2FEZ A;  1E64 A;  3V42 A;  2LOO A;  2F1L A;  3ISX A;  4RJL A;  1SVO A;  4NNJ A;  3A35 A;  1G3W A;  3NB2 A;  2QBY A;  5FD5 A;  2Q6O A;  4YFK F;  1DAB A;  4N3N A;  2V9K A;  4IQJ A;  4V02 C;  1JUS A;  4YRV A;  4G12 A;  2R5Z A;  4EEF G;  2LG4 A;  3BTJ A;  3JRB A;  2RNG A;  4YG2 F;  1E3X A;  2DT5 A;  3RPQ A;  1SKQ A;  1KD1 D;  1DDN A;  4D9J A;  3K4M A;  1JNY A;  3CLO A;  1ON1 A;  3PQJ A;  1ZG1 A;  4XOP A;  1IF1 A;  4XD7 A;  4DYR A;  2FNP A;  3OEE A;  3K1N A;  4IHT A;  4RGS A;  1TT5 B;  2JSP A;  4J01 A;  4RDK A;  3WNC A;  2I8D A;  3DCF A;  2XB5 A;  2RV8 A;  3W3C A;  1KQ8 A;  2VBE A;  1W5S A;  1FP2 A;  2O7O A;  3PSF A;  2V7V A;  4P9S A;  1WSR A;  1BIA A;  1VQP B;  2QZ8 A;  3T8R A;  5DN6 A;  2HOE A;  1FNN A;  3SKB A;  1B72 B;  2OCE A;  5E3L A;  4KJZ A;  2BY0 A;  3ECO A;  1GJR A;  3AG2 H;  5FB2 A;  1FX0 A;  2F6C A;  3QPT A;  2WC2 A;  3LFU A;  1P9Q C;  4B4C A;  5FLX K;  2NST A;  3KLN A;  4AIJ A;  2CF4 A;  1HF2 A;  4MLO A;  2WY8 Q;  2B7B A;  1EKE A;  2EA2 A;  4JX5 A;  5ILV A;  3GWZ A;  2KPM A;  1E79 A;  3ES9 A;  1W9X A;  2GIZ A;  1D1A A;  1RNL A;  3HKZ N;  3OEH A;  3CJT B;  4C0S A;  2Y9Z A;  4B3F X;  5GAG J;  3WYA A;  4QIW N;  2RNJ A;  2XAU A;  1D1C A;  3EYY A;  3NRV A;  4M9X A;  1T39 A;  2LY2 A;  1USS A;  2CGP A;  1D5Y A;  2AXT C;  1FOX A;  1VLY A;  4IRI A;  4V2F A;  1UFM A;  3OOP A;  2RQQ A;  2FX0 A;  3DTE A;  1FSE A;  2HWV A;  1W0K A;  1WOR A;  3WTY C;  1YIT I;  1O3Q A;  5HLH A;  1X1B A;  3LMM A;  3P5J A;  2XSD C;  1DQU A;  2VKE A;  2IOU G;  3U21 A;  2DYR H;  3K70 C;  4BU2 A;  5IOZ A;  4EJO A;  2IS2 A;  3VO1 A;  5ICE A;  5HLG A;  2O0Y A;  3MKL A;  4RB3 C;  4IOC F;  1EF4 A;  1GLN A;  1R36 A;  3SHF A;  1K73 D;  2NSP A;  3V7R A;  1HOM A;  4ZCM A;  2O17 A;  2XGD A;  1W87 A;  1OB5 A;  3KCC A;  5GAE J;  2R93 J;  3VMV A;  3LQR A;  3SLD A;  4S04 A;  4II3 A;  3DPU A;  3F8C A;  4IHW A;  5K7Z A;  2DPU A;  1VQ6 I;  4PJ0 C;  1D0X A;  3DBH B;  2A68 F;  3GQ9 A;  2DDB A;  1OGO X;  4P12 A;  2QY1 A;  2FF4 A;  5F1J A;  4J19 A;  1EP1 B;  2FQ4 A;  2CUE A;  4M73 A;  1GQ8 A;  5D6E A;  3PM1 A;  2OBR A;  4A6D A;  2FA5 A;  4Q4Z F;  5D5V B;  1MDM B;  1RR8 C;  1N05 A;  4M3B A;  1TLL A;  1LDD A;  2E1O A;  3KZY A;  3SEZ A;  3SJZ A;  2XGE A;  2XPV A;  1MIJ A;  3CUQ A;  5F27 A;  3RQI A;  5EMN A;  2K7L A;  2CQ7 A;  4HNT A;  3HPG A;  3CCL B;  1UHM A;  1JI8 A;  1JKR C;  3WBK A;  3VYU B;  1U2R A;  2O04 A;  2AHQ A;  2HXO A;  5F0F A;  1N75 A;  3CQZ J;  2LR8 A;  2Y0S A;  3DDY A;  5E17 F;  4P22 A;  2FX3 A;  4AD9 A;  3D26 A;  1Z77 A;  3ASN H;  1OYY A;  2GWR A;  4BGD A;  3FMQ A;  3H5R A;  3CO7 C;  1WU8 A;  3ZGK A;  2JDI A;  2PLY A;  5IYC J;  5FIU A;  5HDG A;  3FHZ A;  2PMZ N;  4RDJ A;  4M9S A;  1PKV A;  2OTL I;  1OCC H;  2P6T A;  4TSF A;  4XID A;  4EV0 A;  3CCQ B;  5FL7 A;  3VOE A;  1B4A A;  1TC3 C;  4ABZ A;  3KZI C;  4E7J A;  1G2H A;  2PX9 A;  1NDH A;  3WBJ A;  2ZZF A;  4RA2 A;  3HHG A;  4Z6Y A;  4K2E A;  3G2B A;  3BR0 A;  2P7V B;  2FD5 A;  3K4J A;  3P27 A;  1I5Z A;  3B02 A;  2CUZ A;  2HZD A;  2WBM A;  4HA8 A;  1U5T B;  1NB0 A;  3E7L A;  3VMF A;  4OWR B;  5CQE A;  3A4C A;  2K9S A;  3HG9 A;  3KIO A;  5L3D A;  3QU3 A;  4KNY A;  1FNB A;  1WPC A;  4HQM A;  2HMA A;  1QFZ A;  1OR7 A;  2BW3 A;  2FXA A;  2ZFU A;  4DZJ A;  1WH5 A;  2L7Z A;  3CCR I;  2B9S A;  3IAM 2;  1NB9 A;  4BY7 J;  1UEL B;  1VQ5 I;  2PE3 A;  2E5N A;  4OOV A;  3GW2 A;  4MTD A;  2JA7 J;  4YAL A;  5D6F A;  4ZYD A;  3AGP A;  4UVA A;  1FT9 A;  1SMY F;  1KZL A;  2ISY A;  2LTP A;  2M7A A;  3CCJ B;  5HS9 A;  1G8X A;  2VFM A;  2Q1Z B;  3GO5 A;  3OYK A;  3E5U A;  3DXJ F;  1JGG A;  2KZG A;  1S0U A;  4A3J J;  2E1C A;  3BOQ A;  1J5Y A;  1FP1 D;  1K7A A;  4XBF A;  3HSE A;  2LYC A;  4LFU A;  5EEH A;  2YU9 J;  2I10 A;  2UWM A;  3DEE A;  3SZP A;  1P4A A;  4WZT A;  3OE7 A;  5FFX A;  4EGY A;  2W7Z A;  1T0F C;  4ENN A;  2WZP P;  1Y0N A;  2Q0O A;  2RGV A;  2L4M A;  3KP3 A;  3R6K A;  4Z4U A;  3AGQ A;  1VQM B;  4OPW A;  1KON A;  2Z1D A;  2NVT J;  2RQP A;  4L5I A;  1PUF B;  1J9Z A;  1O8G A;  2M30 A;  3B73 A;  3RKY A;  4PC7 A;  1XPX A;  3ZQQ A;  2OZU A;  1T5E A;  4BQN A;  2KRF A;  1RES A;  1TQM A;  4FWT A;  1YI2 B;  5H2F C;  3RKX A;  4ZDO A;  2EFN A;  2QSF X;  2R4G A;  4DYC A;  4MYT A;  1HXD A;  1QQ1 A;  5FRO A;  1JHH A;  1YQA A;  3N4M A;  4L9V A;  3PVD A;  3DPL C;  3I4M J;  1YRN A;  4EJW A;  1V5G A;  1GO2 A;  2VXZ A;  5GPA A;  2R7F A;  4RB0 A;  4A3M J;  4E7S A;  4YAF A;  1G6N A;  2LSO A;  4XKB A;  1I18 A;  3GTG J;  3K7A J;  1STZ A;  1J59 A;  9ANT A;  4AC9 A;  3QOP A;  2DYI A;  1ZR4 A;  3Q9V A;  3LWF A;  2X1C A;  1DP7 P;  4P3I A;  1YLO A;  4HYE A;  3CXC B;  3OS0 A;  3EET A;  2CO5 A;  1PUE E;  1BX0 A;  2HDN B;  4IXA A;  1WVR A;  3C18 A;  4CCK A;  1YX3 A;  2ICW G;  4YFN F;  2KMU A;  3AK5 A;  1TWG J;  1AIP A;  2W84 A;  2DOG A;  1RUN A;  1VQ9 I;  2CFO A;  3ONY A;  5DNS A;  3MKZ A;  3BRO A;  3CDH A;  2XGC A;  4RLF A;  3VSL A;  5CYV A;  4BXU A;  3DBR B;  1XQB A;  2F3L A;  4HV5 A;  5CKT A;  1TSP A;  1FIP A;  3H0D A;  2XNC A;  4U0Y A;  2KZV A;  3K2Z A;  4QPO A;  3I71 A;  3D1N I;  2W57 A;  5JLX A;  4A2U A;  4MEX F;  5JI6 A;  4YFO A;  2E60 A;  4F91 B;  2JN9 A;  2Y0S N;  2DMN A;  5E3N A;  2QX3 A;  1D0Y A;  5BNG A;  1Q81 D;  3H9Q A;  1MKM A;  3FXU A;  4MNU A;  1U5T C;  2NNN A;  3K2A A;  1FIA A;  2B63 J;  1QA1 A;  1FOY A;  1X1P A;  2V1D A;  3OYC A;  1WJ5 A;  1X1C A;  3TBI A;  2M8E A;  3AVY A;  5JR3 A;  2EIK H;  1NK2 P;  3QE2 A;  2K9N A;  3WTU C;  4P5O A;  2DO7 A;  3KZZ A;  3R0A A;  2Z33 A;  2HOS A;  2DTR A;  1FOW A;  4N4O B;  4XLH A;  4HDU A;  4PK4 A;  1E17 A;  4EW9 A;  4JBA A;  3HTU A;  5KVR A;  4EAT A;  3PUM A;  3GVA A;  1E43 A;  1BN8 A;  4RD2 A;  3M4O J;  2JT1 A;  1YS6 A;  2CRG A;  1OJL A;  3PNV A;  2KFD A;  1D8K A;  5L3E A;  1ZGW A;  2OBS A;  3WU1 B;  2KP6 A;  2EZH A;  3OJX A;  4P96 A;  4ENK A;  3K4C A;  4NQW A;  1ZQ3 P;  2GLO A;  4OIN F;  3S1N J;  1QUF A;  3I54 A;  2L4A A;  1W4M A;  4UNO A;  2QMU A;  2NT9 A;  3CDI A;  5LD2 C;  2FU4 A;  4FHT A;  4P9U A;  1SD4 A;  5J6X A;  3ASR A;  3VNV A;  4QVA A;  5FRN A;  2HKX A;  1W5T A;  2X53 S;  1YE9 A;  4E7K A;  2FVG A;  1FZP B;  2GJR A;  1EFC A;  1R49 A;  5AIQ A;  1BLI A;  3UR3 C;  2V1U A;  1V5V A;  3CZ6 A;  3CC2 I;  3OYI A;  3HOZ J;  2QTZ A;  2VJ5 A;  2CMP A;  2MAB A;  4HV6 A;  2C77 A;  1H42 A;  3U6K A;  3KEQ A;  1S3J A;  2EIN H;  2WJV A;  2DU9 A;  1T33 A;  2DA2 A;  3LMW A;  1IXR C;  1WQ2 A;  4GRI A;  2XAH A;  4MHG A;  1J9I A;  2XAG A;  3KE2 A;  3B78 A;  1OGJ A;  3F6V A;  4HLX A;  1T2K A;  4L9N A;  3T8T A;  1CF7 B;  5BOX A;  3CES A;  2ZJQ F;  2IJL A;  1D5V A;  1JA1 A;  3EUH C;  4FT8 A;  3H5A A;  4NC6 A;  4EH1 A;  1YFH A;  1ZM2 A;  2VFO A;  1WOS A;  1HW5 A;  2C6Y A;  1FRN A;  3BY1 A;  4ZTJ A;  2CWE A;  3G73 A;  4JQF A;  4MIM A;  4OMY A;  4QVJ A;  3WU2 C;  1KK0 A;  2BY3 A;  2K9L A;  1GR1 A;  1WMR A;  4URR A;  4G8X A;  4L5E A;  2Y2Z A;  1R5I D;  5LEK A;  1OB0 A;  5M5X J;  3U6B A;  3BQZ A;  3IUO A;  2XRL A;  2W85 A;  4LBZ A;  1LFP A;  1UG2 A;  5LHG A;  2JPB A;  2V9P A;  3LL7 A;  1MNE A;  5F0C A;  4BAC A;  3VWB A;  3I55 B;  1K4Z A;  3V76 A;  2VBW A;  5IOY A;  2HQ5 A;  2Z9O A;  1EZG A;  4FTH A;  2H27 A;  2I1L A;  4BS9 A;  1IRF A;  1LVA A;  2DA6 A;  2O1D A;  1T8I A;  1EH8 A;  4UUS B;  1D1N A;  2P6S A;  5EEG A;  4YZX A;  4KIG A;  3HM5 A;  2QDX A;  2HQA A;  1DPR A;  3ZQF A;  1BPL A;  1TWH J;  2NOG A;  1EH6 A;  4OOI A;  5DTD A;  4AC0 A;  3K4N A;  4MGR A;  1UST A;  1TZL A;  5C1C A;  5KCM A;  3Q9S A;  1WJD A;  3BR5 A;  1O8E A;  3FKI J;  5DV5 A;  1I1S A;  4Z4S A;  1Y0R A;  5DD4 A;  2F4M B;  4RGR A;  3O3K A;  4PZJ A;  3SFI A;  1EE6 A;  2LKX A;  1BOB A;  5ICG A;  1JKO C;  4IHY A;  1Z0X A;  2ELK A;  1AKH B;  1X2N A;  3DEW A;  2OTJ I;  3QRF F;  5CVI A;  1ELO A;  2JWT A;  1QGZ A;  2GA1 A;  5IPA A;  4CCL A;  1B8I B;  3GIR A;  3W2I A;  5C1E A;  4A12 A;  4UY8 I;  1WH7 A;  1OKR A;  2GQQ A;  2F5V A;  2UXX A;  3GLX A;  3VPR A;  5FKK A;  1H8H A;  3CUO A;  2ID3 A;  1KTW A;  5TJJ A;  4YC5 A;  4ENM A;  1IUF A;  3TDZ C;  2ZXH A;  1VQ4 I;  4Z4W A;  5A8A A;  3OV8 A;  1QH0 A;  1QG0 A;  5DM7 F;  1P4M A;  2BM6 A;  3JSP A;  1B6A A;  2BHY A;  3G71 I;  1TUI A;  4NHJ A;  2KIQ A;  2M1B A;  3FKJ A;  1G3S A;  2DET A;  2TRT A;  3GQ7 A;  4M3G A;  2GJP A;  1VQ6 B;  4CCO A;  3I59 A;  1LPQ A;  1QVG B;  4HOB A;  1G3T A;  1S5L C;  2O8X A;  2J8K A;  3S32 A;  1TYX A;  3IHU A;  2XB0 X;  3A03 A;  2W1O A;  3OMY A;  5E3O A;  1OQY A;  4RLQ A;  4DQ2 A;  2XOK A;  2Z3Y A;  3GZ5 A;  2MSY A;  2VC0 A;  5IT3 A;  1BR2 A;  3FXJ A;  1AMO A;  2VLA A;  1L0O C;  4DJA A;  2Y75 A;  2GK6 A;  4E70 A;  2OK7 A;  1LM1 A;  2FSW A;  2LRD A;  2V7Q A;  1WWX A;  2V6C A;  3VOD A;  5KAF C;  1P92 A;  3ABK H;  2LVS A;  5L46 A;  1PLU A;  5IT9 K;  4C2M J;  3DLL F;  3M3Y J;  4PDK A;  3SZG A;  2C5H A;  4IHX A;  3JQR A;  3W2A A;  1M90 D;  2LF7 A;  2CH0 A;  3CB4 A;  2ESN A;  4KMU X;  2LF8 A;  3MEX A;  3L2R A;  1LFB A;  3DTK A;  1XG1 A;  4EM0 B;  5CVR A;  3D0S A;  2ODL A;  2VQC A;  3FWE A;  2DFH A;  1XGS A;  1LFU P;  1UD4 A;  3W6J B;  2W7N A;  2XND A;  1F60 A;  4O6J A;  3VSV A;  2OTL B;  1WPK A;  3BCF A;  4PCQ A;  1MJA A;  4ETS A;  3LSH A;  3GTP J;  2VPL A;  2BM0 A;  1YO5 C;  3L7W A;  2YWE A;  1SFU A;  2DER A;  3O8G A;  3TMO A;  4ESF A;  4TKO B;  5CDF A;  3PSZ A;  4PAB A;  5E8I A;  2IVM A;  4C3I J;  3GX4 X;  2GRE A;  2CV2 A;  5LEJ A;  1U8B A;  1IAW A;  2WJY A;  4JMQ A;  4M9Z A;  3KP5 A;  4P1W A;  2EFP A;  3WTS C;  1A6I A;  1F9N A;  1RR7 A;  2CRV A;  4LBY A;  2L02 A;  2W25 A;  1MBG A;  2VKD A;  2OD5 A;  3RDI A;  1JHF A;  3J80 K;  1D1B A;  3JTG A;  1ZGJ A;  2WAD A;  4WF2 A;  4X8I A;  3CCR B;  1IW7 F;  2DK8 A;  3S1M J;  1VQ5 B;  4G6D A;  3A01 A;  1XX5 A;  1FYL A;  1BM9 A;  1KK1 A;  3NEU A;  2W6J A;  3TO7 A;  2IA0 A;  4HSR A;  2D3L A;  3BG7 A;  3JAM K;  2LC2 A;  1LE8 A;  2YWG A;  4PAA A;  1FNM A;  4G7W A;  2XVC A;  2HXI A;  4B4D A;  1GAW A;  2LKP A;  2IA1 A;  4WX9 A;  1ETK A;  3B82 A;  4A93 J;  1ZRE A;  1Q7Y D;  2W4S A;  2K27 A;  2Z2S B;  3ECH A;  1SAN A;  3S1R J;  1KQ5 A;  4C9Y A;  4YZ0 A;  4DBQ A;  1KC8 D;  3ZOB A;  3PNY A;  3ZQC A;  2WB1 N;  1JGS A;  2I5U A;  2ETH A;  3BT9 A;  4AYB N;  1W0U A;  3A2K A;  1DG1 G;  4LG3 A;  4ZYH A;  2XEX A;  3PUN A;  3CME B;  4XRM A;  2QE7 A;  2W6I A;  3CW2 A;  2BGI A;  2KJC A;  3FM5 A;  3KEW A;  4E0F A;  1WJF A;  5JFR A;  1A8P A;  3U1K A;  3E1S A;  2K40 A;  1QPM A;  1XN7 A;  2GPJ A;  3I4P A;  1TYW A;  1IO2 A;  3BJA A;  3LST A;  3BH4 A;  3HRS A;  3ABT A;  3E6B A;  3OS2 A;  4XSZ F;  3W5V A;  3W5U A;  3KP4 A;  3T53 B;  2DW4 A;  3AVU A;  3K4K A;  2LNB A;  2LK2 A;  1MH4 A;  5J8C A;  2IQ7 A;  2AHO A;  1IRZ A;  1WGX A;  2COM A;  1AHD P;  1K78 B;  2HEO A;  5GAH J;  3ZMD A;  1EFR A;  2MBF A;  2BW3 B;  4KYW A;  2EK5 A;  2GAU A;  4RAZ A;  3GRH A;  1DU0 A;  5F6F A;  1W1W E;  3GFI A;  1E1R A;  4EGZ A;  4Y52 J;  3FX3 A;  2KVO A;  3QOE A;  5A2Q Z;  2ZB9 A;  1Z3X A;  3BCA A;  5L3G A;  2IS4 A;  3FK7 A;  4G7O F;  5D8K B;  3J81 K;  1W36 D;  5CJ9 A;  3HZJ A;  4HDV A;  5IYP A;  3HKZ A;  3SJM A;  4A3G J;  1K5C A;  3HL2 A;  5IYR A;  2EIM H;  1E3H A;  1I6X A;  2VI6 A;  4LGW A;  5DEQ A;  1GV5 A;  4P9F A;  2VNK A;  3DTI A;  4A3E J;  1JJ6 C;  4WXC A;  1YYV A;  4BE0 A;  1QHH D;  4DK0 A;  1BI1 A;  3KPH A;  3FY3 A;  1NH3 A;  4DYQ A;  4LB5 A;  2STW A;  3WXM A;  1OFD A;  1OFE A;  5F08 A;  2ZL5 A;  2ME6 A;  2BY1 A;  4OPV A;  4CCM A;  2D2W A;  1SVL A;  2EWN A;  3LSI A;  4ZDP A;  1T6Z A;  2V1X A;  4FE7 A;  2DQR A;  1T95 A;  2JA5 J;  2XRN A;  1IRX A;  2DFF A;  3ERE D;  3QPL A;  1SFX A;  3W6K B;  3SUC A;  3OIO A;  2QTL A;  4CUG A;  2O61 A;  5BPI A;  2R7U A;  5IK2 A;  4CYC A;  1K4S A;  1MBJ A;  1O8F A;  3JRI A;  5BSX A;  3BH6 B;  2XAS A;  4XLA A;  4IOA F;  2C78 A;  2MH2 A;  1KK2 A;  5IYN A;  4A5N A;  4G1B A;  3U2Q A;  3W2V A;  5ILU A;  2QGU A;  1LDK B;  4EM1 A;  3WGH A;  2INV A;  2A5Y B;  2KQR A;  3DKW A;  5F4O A;  2OZ6 A;  3F0C A;  1T98 A;  3MKY B;  4BE2 A;  2D45 A;  1HKS A;  1TP4 A;  1YRN B;  1O8D A;  1OGI A;  3MZH A;  1Z9C A;  2PEC A;  3NQO A;  1TWC J;  3OYM A;  1FDR A;  4EVI A;  4TN1 A;  4M53 A;  1RKT A;  4UVB A;  3LSM A;  4JRA C;  3R4K A;  1O8H A;  2FML A;  1E2X A;  1X1D A;  3CCM I;  2Q6I A;  2VE9 A;  4J00 A;  2Z5U A;  1ZRD A;  3BJO A;  3FXL A;  1MNM C;  4A3K J;  3SDB A;  4X0C A;  1VQ8 I;  4RPB A;  2WAQ A;  1W7P A;  1RKW A;  2EPF A;  3HGG A;  1FRQ A;  3ASO H;  1ZYR F;  4IF4 A;  1CNE A;  5E79 C;  2A6H F;  2VFN A;  1QU3 A;  3K4L A;  1Z6R A;  4LLN A;  3L2W A;  3E5X A;  2PJR B;  1T56 A;  3C1D A;  1EJ9 A;  5LHI A;  1Z05 A;  1ZKG A;  4A3F J;  3S8P A;  5H20 A;  2L7K A;  2HZT A;  3QYB A;  3RPU A;  1V0E A;  3Q6Q A;  3F6O A;  3OW2 B;  3ERM A;  2CQQ A;  1H9G A;  2H6B A;  2H94 A;  3A8J A;  3JQP A;  2VC1 A;  3DLA A;  1N77 A;  3K9T A;  3KLO A;  5FA6 A;  4A3C J;  2QQA A;  2HYG D;  2RVC A;  4B43 A;  3LNN A;  2INU A;  4DW6 A;  2PMZ A;  3OAA A;  3TW7 A;  4KIB A;  1U3E M;  4CQJ A;  1GDT A;  2BM5 A;  3BR2 A;  4TMX A;  4Y4R A;  1NJI D;  5HOO A;  5DS0 A;  3IV5 A;  1B9N A;  3CC2 B;  1X1A A;  1WJE A;  2UUZ A;  1OFM A;  2KIU A;  3MVP A;  1F1Z A;  2K9M A;  3GTL J;  3LA3 A;  4QFM A;  4LG0 A;  5BMZ A;  4R8H A;  4EQQ A;  2E7W A;  2JVH A;  1TL8 A;  4II2 A;  2ZSI B;  1B2R A;  3NE5 B;  1COW A;  4IZZ A;  1VND A;  2VBY A;  1PJ6 A;  2EIL H;  2H8W A;  4ZJZ A;  1H85 A;  1HKQ A;  2XNJ A;  1VHE A;  3FMS A;  3OSF A;  1S7A A;  1HA8 A;  2PYG A;  1ZHF A;  2UVE A;  4YDT A;  3GEZ A;  3COA C;  3F8M A;  4LBW A;  2XHK A;  2ZZQ A;  2CND A;  1H0M A;  1MSE C;  1ONV A;  3TDU C;  1Z6T A;  1LVK A;  2EA4 A;  1IJW C;  5D4S A;  4XMY A;  5HS8 A;  2NPF A;  1DGR M;  5E1X A;  2MW8 A;  4G9Y A;  2X1D A;  3GZN B;  1OLT A;  1OCZ H;  1XE1 A;  2BM4 A;  5J40 A;  3J81 Z;  1UMK A;  2VBK A;  1UD8 A;  2B5O A;  2IXS A;  2E34 A;  1W35 A;  3JUR A;  2A61 A;  2E2I J;  5IY5 H;  4RLZ A;  5K5R A;  3FXM A;  4NQW B;  3QFT A;  4X7F A;  4GYI A;  5E3M A;  2V9V A;  4RBO A;  2O9L A;  1EP3 B;  2E1R A;  2ZFW A;  5THX A;  1DGW Y;  2GOM A;  1IN6 A;  4AIK A;  1ZGA A;  1FEX A;  2J5O A;  4NB5 A;  1EWY A;  2LBF B;  4UZF A;  4UV8 A;  4LMY A;  3AVV A;  1QVT A;  1WCM J;  3I5U A;  4OJP A;  1XC5 A;  4PGG A;  4ENJ A;  2XAJ A;  1YOV B;  2BF4 A;  3A0B C;  2D74 A;  3E0J B;  1MBK A;  4P26 A;  2IRF G;  2X51 A;  2R7Q A;  5ERI A;  2ZJP F;  1YJ9 I;  2DT6 A;  5IYB J;  4IO9 F;  1H8A C;  2WAE A;  4MYU A;  4XNF A;  2GZW A;  1ZG3 A;  2LY9 A;  2PQ8 A;  3MMP A;  4Y7C A;  4UB6 C;  1Z1D A;  3V8J A;  3S16 J;  1Q9S A;  2R7V A;  1BJK A;  1HZE A;  5HLT A;  2VBZ A;  1AA7 A;  1V5E A;  5HOD A;  5JLW A;  1CGP A;  2JQ7 A;  1K8F A;  1OMI A;  1YLF A;  3PL8 A;  1SM4 A;  3OYJ A;  2EBI A;  2AO9 A;  1X3W B;  4C30 A;  2A5W A;  5DSZ A;  2V6E A;  1ERD A;  2ESH A;  4ACA A;  1VQ4 B;  4BL0 B;  3OZW A;  3ABU A;  4XON A;  2A6T A;  1HCR A;  3EQN A;  4KUM A;  3SFZ A;  1B59 A;  1UHW A;  3G71 B;  4MTE A;  2E35 A;  2VOD A;  4WWC A;  2ISZ A;  1LUJ B;  4U0V A;  3R61 A;  4CYD A;  1O57 A;  4FK8 A;  3QFR A;  2VBM A;  1YW9 A;  1ZRF A;  5KK1 A;  3PA1 A;  3I4N J;  1V54 H;  2LP0 A;  4KIF A;  2XF5 A;  3RKW A;  2QQB A;  4A5M A;  2BXY A;  2A3S A;  4GCV A;  2EV0 A;  2WAQ N;  1HW1 A;  2AXL A;  4KMF A;  2RC5 A;  4X7C A;  1IDK A;  1XGO A;  2XTX A;  2L54 A;  4U4B A;  2GBY A;  3PJR A;  4M3F A;  3GVJ A;  4PJM A;  4F92 B;  4OPO A;  4LBV A;  2DJI A;  1PJR A;  2V1N A;  4BQO A;  3GTK J;  3FBI B;  4HNV A;  1T6S A;  3OIQ A;  3CJR B;  5FKL A;  4WQM A;  5BSY A;  3KFW X;  2ME0 A;  1VLO A;  2ZME B;  3PUB A;  3E6M A;  1VQ7 I;  3I3L A;  4D7N A;  2JUC A;  2NYX A;  2M9H A;  4BXX J;  3M7G A;  1BHE A;  1W0J A;  4XRF A;  4Y33 A;  2DA3 A;  5LGU A;  1BL0 A;  3GVL A;  2MD5 A;  2WA0 A;  2HU9 A;  1BC7 C;  3ZBU A;  3SQV A;  1VFC A;  3HUG A;  4PSW A;  4NK8 A;  2QLZ A;  1AOY A;  4XQF A;  2HI3 A;  1JJ2 B;  3JR9 A;  3C2G A;  4ANJ A;  4E4H A;  4C2L A;  2DTZ A;  4B3A A;  3FZV A;  3HJE A;  2JIZ A;  2M2E A;  5H6R A;  3OYN A;  2ZNZ A;  3BG5 A;  2V7X A;  4OMZ A;  2NVY J;  4L9J A;  1RQP A;  1MD0 A;  4PC3 A;  1X58 A;  2CJJ A;  5IYD J;  2LLK A;  3LSG A;  1U78 A;  1TLH B;  2HTS A;  5IP7 J;  2M34 A;  4BEH A;  2VKH A;  3CCY A;  2JA8 J;  4Z4Y A;  1R5B A;  2JMW A;  3W2W A;  3JRC A;  4FN5 A;  1TBX A;  4U49 A;  3EQL F;  4ROX A;  3BPX A;  5AMV A;  2XC7 A;  2E2H J;  3SEQ A;  5JBQ A;  5FLX Z;  1E63 A;  1XMA A;  2HGC A;  3NAW A;  1ZR2 A;  1WI9 A;  4I09 A;  2KIF A;  2L2O A;  2VBX A;  4LK0 F;  1WTH D;  4LLG F;  4HX4 A;  1C0W A;  2ECB A;  2XC1 A;  2LZJ A;  1SMT A;  3ZCO A;  3OOC A;  3H5N A;  3M1C A;  4QLC U;  4Q47 A;  3VR6 A;  4ZGQ B;  3TO9 A;  4OAZ A;  4BYY A;  3QOD A;  1ZRC A;  4P6Y A;  5D5W B;  2O03 A;  5F64 A;  2BV6 A;  2QSH X;  3RSN A;  4TV7 A;  3L2C A;  4RM0 A;  3CCU B;  2H09 A;  5HZA A;  1O7F A;  3MFK A;  1K4T A;  1EH7 A;  1JE8 A;  4KN4 X;  4H9G A;  3K70 D;  1P2F A;  5DM6 F;  1OHH A;  3HRM A;  1UD3 A;  2JK3 A;  4AF7 A;  5K7F A;  3GME A;  1ZG5 A;  3FXK A;  3ZBT A;  2ADU A;  2FOW A;  2EIJ H;  2AQE A;  3CTA A;  1XGM A;  5J47 A;  3FF5 A;  5B5E C;  2WSS A;  4Y13 A;  3K6G A;  2NVX J;  1FBU A;  1RI7 A;  5EGO A;  2JN6 A;  4BBR J;  2VQH A;  2YWF A;  2ZL7 A;  1VQO B;  4Y17 A;  3CD6 I;  5A89 A;  3K0L A;  4G94 A;  5CVV A;  2WAF A;  4DBR A;  1LLW A;  3DU5 A;  2VPR A;  4PJL A;  4AVP A;  1M1K D;  3ZRG A;  1CLW A;  4TMZ A;  1IV8 A;  4L0Z B;  2VUM J;  3BWG A;  3IH3 A;  3KP2 A;  1QPI A;  4JP0 A;  4M2L A;  1ETW A;  4IRH A;  2O6W A;  1R5H A;  4MFD A;  3EQO A;  1YIO A;  2FMY A;  4RAG A;  2XKP A;  4OIO F;  4ESB A;  2C4T A;  2O6G E;  3G1L A;  3LJY A;  1S29 A;  2VAS A;  5M3F J;  1LE8 B;  1EFU A;  2DEU A;  3JRG A;  1BR4 A;  1J7K A;  1CQT A;  2X6Y A;  5F4M A;  4YEI A;  5L3B A;  2JJ7 A;  3VSU A;  4HBL A;  1T08 B;  2ZO4 A;  5DYM A;  3CC4 I;  2PYH A;  2XZL A;  1R4M B;  2MFZ A;  1QZY A;  3HB9 A;  3Q0V A;  2ZME C;  3A8K A;  4ZYE A;  5TR9 A;  1WSV A;  3FXO A;  4B3X A;  3IWZ A;  4RGX A;  4OZZ A;  2XTW A;  4EJT A;  2YSR A;  1S72 I;  3WHB A;  2BZT A;  2O3F A;  1SAX A;  1BR1 A;  5EZG A;  3ELK A;  2JPC A;  1R4N B;  4I7H A;  2H1L A;  3E20 A;  3KYC B;  2KL4 A;  1W34 A;  2CUF A;  2FUG 2;  1ORK A;  1N78 A;  2F1M A;  2FRH A;  4JX6 A;  5E1W A;  2IW5 A;  5E18 F;  2JJ1 A;  4EMS A;  3QFC A;  2FBK A;  4RCY A;  3A1Y A;  2MGQ A;  1SD5 A;  3SYT A;  4K1X A;  5TRD A;  2UV1 A;  3P4G A;  2Y0M A;  1PP7 U;  1UAA A;  3BTI A;  3EYI A;  4ZYG A;  5AN9 A;  1CNF A;  1ENH A;  3OW7 A;  2HDW A;  1JT0 A;  1QNT A;  1TW2 A;  3EPZ A;  3GYH X;  2XF6 A;  3WQZ A;  3CCM B;  1MZB A;  1ACI A;  3M8J A;  1V5F A;  1QUE A;  5CPR B;  4IL6 C;  4L9T A;  1U8R A;  1QJV A;  2HS5 A;  2A05 A;  3RZD J;  3LQE A;  4WZK A;  2RAE A;  5D8L B;  2JA6 J;  3AG4 H;  3S2H J;  1IB0 A;  1N25 A;  1V55 H;  2QF7 A;  5LBQ A;  3IAS 2;  2CS3 A;  1NK3 P;  1OOC A;  3N05 A;  4C2U A;  2VE8 A;  2A69 F;  4ZZD A;  4XRS A;  3B90 A;  1HW2 A;  3LSK A;  2ID6 A;  4U7D A;  2DMQ A;  3CMA I;  2QA4 B;  2FE3 A;  3REO A;  4QPQ A;  3LAJ A;  4CZC A;  4LD5 A;  3MN2 A;  1Q86 D;  3VEP A;  5HXB A;  3GFM A;  3ZSC A;  2QKL B;  2VT2 A;  2WV1 A;  1NRK A;  2BMW A;  3GTJ J;  3FDY A;  4RD0 A;  4IQ4 A;  2K86 A;  4G6T B;  2X6X A;  4CYC B;  3AAF A;  2R7T A;  3HBL A;  3JX8 A;  1P4W A;  3BCB A;  3BPV A;  2ZBK A;  1DU6 A;  3V8L A;  1QRB A;  2L01 A;  3JRF A;  2CU7 A;  4AID A;  3QQA A;  2EB7 A;  2QEX I;  3KYL A;  1XSX A;  2MLK A;  3R60 A;  5F1R A;  4HNU A;  1B9M A;  2XIG A;  3RKQ A;  4OOX A;  4RD6 A;  4UZU A;  2QUF A;  4IEJ A;  3N6Z A;  1OCR H;  4AUX A;  5JHF A;  3FBN B;  2EV5 A;  4MEY F;  2PBI A;  2Y31 A;  3LA7 A;  1HBX G;  3BC9 A;  4DQL A;  1QCX A;  3JCU C;  1U9O A;  2MD0 A;  1NHA A;  4I84 A;  4RGU A;  3VDX A;  1X4O A;  1G7R A;  2FBH A;  2JVG A;  1W7P B;  1BQE A;  3BTL A;  4BPR A;  2YU3 A;  3VST A;  1GXQ A;  4RS8 A;  3TED A;  3GF2 A;  4P25 A;  1X4P A;  3CCV I;  4KN7 X;  2KHM A;  2X3H A;  2F48 A;  2G7U A;  5FLM J;  3G4S I;  4W8T A;  3N97 A;  3QP5 A;  1EA3 A;  1WJC A;  3OOU A;  1Y0U A;  4AU7 A;  2MH9 A;  2WB1 A;  3I56 I;  2X6W A;  4YII A;  4AYB A;  1F36 A;  1QA2 A;  4XLF A;  2QSG X;  2L9S A;  1WFX A;  4WK8 F;  4BDY A;  2QYO A;  2AS5 F;  1VQP I;  4AVZ A;  6PAX A;  2HVQ A;  5HKK A;  1WI3 A;  1JTX A;  3BJ6 A;  4GQN A;  3C3W A;  4Z1M A;  1K8A D;  3BDD A;  3KYD B;  4AF6 A;  2ZIT A;  1T38 A;  1UD5 A;  4RCZ A;  3ZZT A;  1MDM A;  1HA3 A;  2WYR A;  1YJ9 B;  2FJ1 A;  3RYP A;  1SAU A;  3F8B A;  1XGN A;  3CP2 A;  1O3T A;  3H9G A;  1N0U A;  2QBY B;  1TQP A;  4HRI A;  4OJL A;  2K85 A;  4G1V A;  1OFL A;  1YIT B;  4CH7 A;  3TGN A;  1LJ9 A;  5JHU A;  1I3A A;  2R5Z B;  1FBQ A;  3O6B B;  1FMV A;  3ZXS A;  1VJS A;  4Q5S F;  2DDA A;  2HQN A;  5J3L A;  3OR1 C;  4Z03 A;  3I1F A;  1KRH A;  3GBG A;  1Y0Y A;  1YW8 A;  2XGX A;  1BX1 A;  2DA4 A;  2HKO A;  1S9H A;  3LSP A;  2DT7 B;  4OIP F;  2E19 A;  4JYK A;  4UZE A;  2J5P A;  3IC7 A;  1E1Q A;  4WZE A;  3GXO A;  3HDD A;  1APL C;  1JKQ C;  3F8N A;  4LIU A;  4BH9 A;  3J7A O;  4G7X A;  1QRC A;  1R1U A;  2XPW A;  3OJW A;  3S14 J;  3ASP A;  1IDJ A;  4IKF A;  5TY0 A;  3L2U A;  4FXU A;  2K02 A;  4PGO A;  4QUZ A;  3MAJ A;  2QQ8 A;  2K4B A;  2PIA A;  1U5T A;  4BJ5 C;  3DBL B;  4QV2 A;  2O0W A;  3AFH A;  2EQR A;  1A36 A;  3BP8 A;  1DPU A;  3GZ6 A;  3FK6 A;  5LLQ A;  3T9G A;  3BC8 A;  1H88 C;  4PGH A;  3TOA A;  5TIS C;  3PSI A;  3WOD F;  4RAY A;  5ICF A;  2PI0 A;  4PC1 A;  2CW7 A;  4ZC3 A;  1ZN2 A;  1QA6 A;  1ZLJ A;  4OM9 A;  3KP6 A;  2R7O A;  3BQY A;  4TT3 A;  2EFG A;  3WNB A;  4LOC A;  1RRJ A;  1XB4 A;  1VQ7 B;  2DOE A;  4I99 C;  1GXP A;  1HDP A;  4Z05 A;  3C2H A;  5HVQ C;  4L18 B;  2R7X A;  3ZZU A;  4XN0 A;  3RYR A;  4H4K C;  3PIO F;  4KA4 A;  2ZZE A;  2R5Y A;  4Q7J B;  4BAY A;  2NTQ A;  3F23 A;  2N8G A;  3RIQ A;  2DJN A;  1BC8 C;  3FXQ A;  2DK5 A;  2EV6 A;  4RDU A;  2BVN A;  5AIP A;  3Q3A A;  1JRG A;  1KGS A;  4PUS A;  1N0V C;  3BH7 B;  4NC7 A;  2DN0 A;  1QVF B;  2X8K A;  5JMC B;  2H1K A;  1R6R A;  5EJC A;  2Y30 A;  4XL9 A;  1BJA A;  4DOZ A;  2ZXI A;  4EJV A;  2XRO A;  2RDP A;  5J1U A;  2XPU A;  2E1M B;  4ESJ A;  1KCC A;  3BG9 A;  4FCY A;  3HOX J;  4GXO A;  1YIJ I;  1GAQ A;  1WXR A;  2VBU A;  4S05 A;  4OZY A;  2MA3 A;  4FIS A;  2ZXJ A;  1IN8 A;  3LYC A;  3EDP A;  3AST A;  2NXN B;  3L1P A;  3BR1 A;  1JA0 A;  3TW6 A;  5J4Y A;  2KIS A;  5D4R A;  2VN2 A;  1MMS A;  2CC2 A;  4I76 A;  3F3X A;  4ASU A;  4DNT B;  2BXZ A;  3LOC A;  5HDK A;  4WWV A;  3EUH A;  1QGP A;  3CUQ B;  3KP7 A;  1VF9 A;  2EIX A;  1H9T A;  1I27 A;  4YZA A;  2IS1 A;  3U1D A;  2X0L A;  4WCG A;  2BOL A;  2DOF A;  3OL4 A;  3QYF A;  4HEA 2;  1E62 A;  2M4K A;  3T5X A;  5LFA A;  4IX7 A;  1S4M A;  2CW0 F;  3OWT A;  1SD6 A;  2CQK A;  3W2E A;  1OGM X;  5HNH A;  1MW7 A;  3HSR A;  2DI3 A;  4C3J J;  1XB2 A;  1U9N A;  1UMQ A;  3QU6 A;  3WGI A;  3Q0W A;  1OB2 A;  1YHQ I;  2ZZG A;  2ZC2 A;  3WU0 A;  4YAO A;  1E3Z A;  2TCT A;  5JVG F;  1EXM A;  1JXS A;  1K28 D;  2HPM A;  1Y56 A;  2X6O A;  3VFZ A;  1IHM A;  2HYJ A;  2Q6L A;  3SYJ A;  5LGN A;  4L8J A;  4CCN A;  5H5J A;  2NTP A;  3GFJ A;  3SY2 A;  2R7D A;  4S0H B;  4UAJ A;  3LAP A;  3DU6 A;  2M7B A;  5BQT A;  2DY1 A;  1KQS B;  2NAZ A;  4WZL A;  2Q2E A;  3ZPP A;  1TWA J;  1I8D A;  1J2X A;  3F9K A;  4XLP F;  5BPD A;  2VOO A;  2J7K A;  4P6V F;  1LLZ A;  4YXW A;  4BEH B;  2GQF A;  3DEU A;  3RCO A;  5C44 J;  2R7R A;  1PJ7 A;  3E6D A;  4HQE A;  1R5O A;  4LC0 A;  4E7Z A;  1XTA A;  3P9C A;  3H94 A;  1YI2 I;  1OCT C;  4M4S A;  3S93 A;  2VKV A;  5FO5 A;  1FPQ A;  2F5F A;  2OJE D;  2RC4 A;  2HDC A;  1FWZ A;  1OYW A;  2ZBU A;  1HQC A;  1MMN A;  4X1E A;  4A3I J;  2UXN A;  4XKC A;  3RIR A;  4PC2 A;  1VBL A;  2R3S A;  3OZU A;  5B3S H;  2PEX A;  1TT0 A;  5GPC A;  1KYZ A;  2P5K A;  1FC3 A;  4RM2 A;  5IT9 Z;  4HIZ A;  2YUS A;  2P0W A;  1JUP A;  3NWT A;  1I1G A;  1KU2 A;  2EFO A;  2ECC A;  4U0W A;  2BGJ A;  2HLD A;  1TYV A;  2MG4 A;  3LA2 A;  1GHC A;  1VQ9 B;  3CC4 B;  4W1U A;  4YIF A;  3RZO J;  1R5G A;  1IDY A;  4UVC A;  5CQG A;  2XZP A;  3GQ8 A;  1MMD A;  5JVT A;  2IP2 A;  1H80 A;  4I01 A;  1QFJ A;  4GDF A;  1HSJ A;  3WE3 A;  4ZV4 A;  3C7J A;  5F4J A;  5C4X J;  3I58 A;  1QO0 D;  3E97 A;  5FKM A;  5L3F A;  5EG0 A;  2BE5 F;  2X9D A;  4M0L A;  1TVC A;  1SFE A;  3B8Y A;  2BBY A;  4EM2 A;  2FQ3 A;  3WHC A;  2GXA A;  5EGO B;  1ODD A;  1W0T A;  2GM4 A;  4M6X A;  2IS6 A;  1WJB A;  5H6Q A;  3ZR8 X;  3W2F A;  3F72 A;  1DAR A;  2E1M C;  1Q1H A;  1VTN C;  2VNJ A;  3MZ8 A;  2NV4 A;  1P7I A;  3FPK A;  3QPS A;  3DFG A;  2DCE A;  1BMF A;  3HEF A;  1U0J A;  3LQQ A;  3J80 Z;  2D5V A;  4AM3 A;  4LIT A;  1TQI A;  2O8K A;  3B8H A;  3CCS I;  4F7Z A;  1Q82 D;  3W2G A;  4MR0 A;  3OYG A;  2CG4 A;  2LRE A;  1MJB A;  2D9R A;  3S3M A;  1CF7 A;  1WOP A;  2CFX A;  2DFE A;  2PG4 A;  2XUB A;  3CUQ C;  3JTH A;  3JAM Z;  4RM3 A;  3WY9 A;  2QWW A;  3VB2 A;  4XKV A;  5J8F A;  1LB2 A;  1O3S A;  2LKS A;  1HST A;  1NG6 A;  3B4N A;  1HDD C;  2O5R A;  5BS6 A;  3WTW C;  2ZL6 A;  4NBQ A;  2VIX A;  3GTO J;  1G59 A;  3H09 A;  3KRG A;  4QSH A;  4RB1 A;  2V4D A;  3CMA B;  2DXI A;  5L3C A;  3ZN0 A;  1HG8 A;  4X7D A;  4HWV A;  3BTC A;  2R7W A;  3CC7 I;  4MXN A;  1R7J A;  1XS9 A;  2BY2 A;  3WTZ A;  3A02 A;  3H35 A;  4Z06 A;  5J1Y A;  3OY9 A;  3VYS B;  4UUS A;  2G0Y A;  1S6L A;  2HFH A;  3M1E A;  5KAI C;  4A69 C;  1G7T A;  1T6Y A;  4M6V A;  2FOK A;  4XSX F;  1GT0 C;  3TO6 A;  4BQQ A;  2E7X A;  2YS9 A;  4R71 A;  3H0G J;  4FET A;  5KNL A;  2C4U A;  3HOS A;  3J81 k;  3FIW A;  4ZDL A;  4PFP A;  3VYR B;  3DV8 A;  1VF7 A;  1XFO A;  3OS1 A;  2NRA C;  3CF5 F;  1OR7 C;  2CV0 A;  4I2O A;  4KKS A;  5H59 A;  2JSC A;  2M0C A;  2DCU A;  4BUP A;  1O8I A;  4F93 B;  1IRG A;  5E20 A;  1GVH A;  1ZM9 A;  2NNY A;  2XT2 A;  4UUV A;  1X2M A;  1FYK A;  1A31 A;  3ZIA A;  1AIR A;  1YJN I;  4E6K G;  1B8I A;  4PSX A;  4O3M A;  2GJK A;  1YW7 A;  2EH3 A;  3A0H C;  1I3Q J;  3NAU A;  5EDN A;  3CCE I;  3E1Y E;  4M1K A;  3A3B A;  4F7D A;  4N9I A;  1E0E A;  2VT3 A;  3G05 A;  1MND A;  1XDS A;  2IPQ X;  2OPT A;  3CCV B;  3P9K A;  5ICC A;  4B47 A;  4KKT A;  4N3G A;  4OJO A;  2CSO A;  3G4S B;  2CQX A;  3GTM J;  4R1H A;  4BHP A;  3OPO A;  1PE9 A;  1X3U A;  3I55 I;  3I56 B;  3JRH A;  3A3G A;  2KT0 A;  3AG3 H;  2TDX A;  2ZNY A;  4U88 A;  1FBS A;  2BVM A;  1SVM A;  5K5O A;  2LD5 A;  1SKY B;  4PC6 A;  1P7J A;  4ITV A;  1A35 A;  4B48 A;  3SEJ A;  4QHY A;  2HOA A;  4ON0 A;  3Q0U A;  3J7Y J;  3ML3 A;  3JW4 A;  4CXF A;  2GXB A;  1KU7 A;  1MBF A;  2DAO A;  2OTJ B;  2BSA A;  2LY1 A; 
#chains in the Genus database with same CATH homology
 2V31 A;  4XLE A;  4CSW A;  3L2Q A;  4U87 A;  2HVS A;  1EE6 A;  1RU4 A;  3EQO A;  1BOB A;  4PMH A;  4E7H A;  3OYF A;  1NG7 A;  1Z21 A;  2LH9 A;  2XGJ A;  2XZO A;  1RWR A;  2JA2 A;  2VAS A;  5C1E A;  4CCL A;  2AQF A;  1BR4 A;  3DWL E;  2HNH A;  1O8L A;  3GQA A;  2X6Y A;  1H8H A;  1YX5 A;  2F5V A;  3ONQ A;  3VSU A;  1O8M A;  2PYH A;  2XZL A;  2MFZ A;  1KTW A;  3S3N A;  2ZXH A;  3BG6 A;  3CJQ B;  3J7A Y;  2E1B A;  3D5L A;  2MC4 A;  4B3X A;  4XM3 A;  4B44 A;  4OZZ A;  3T51 B;  4PFO A;  2K5C A;  3FKJ A;  3GQ7 A;  1BR1 A;  2GJP A;  1PXZ A;  4CCO A;  3GQB A;  4Y3O A;  3S32 A;  1FMW A;  2KL4 A;  2F1M A;  2FUG 2;  2DIE A;  2W1O A;  1N78 A;  3OMY A;  3BC9 A;  4NK6 A;  4BE1 A;  2JJ1 A;  2M4G A;  2HPI A;  4RLQ A;  4NC8 A;  3RQ4 A;  2D3N A;  2XOK A;  2UVF A;  1BR2 A;  3A1Y A;  3RPU D;  3SYT A;  4DJA A;  2IGN A;  2VLA A;  2GK6 A;  3FKS A;  2UV1 A;  2R7S A;  2BSP A;  2LRD A;  2V7Q A;  1UAA A;  2VJJ A;  2X1E A;  3K4B A;  4XR6 A;  3OW7 A;  3JU4 A;  2HDW A;  2M3A A;  1PLU A;  2EWE A;  3VMW A;  2OC6 A;  3EPZ A;  5TGT A;  2XF6 A;  3SZG A;  3WQZ A;  3W2A A;  4HG2 A;  3M8J A;  1V5F A;  2CH0 A;  1JTA A;  5CPR B;  1CZF A;  3T56 B;  1QJV A;  3L2R A;  3K10 A;  1UG0 A;  3DTK A;  1D0Z A;  2ODL A;  2VQC A;  1ZEL A;  1WJA A;  2MYS A;  3DQV C;  3IAS 2;  2CS3 A;  3OYH A;  1OOC A;  5FRM A;  1UD4 A;  2W7N A;  2XND A;  3N05 A;  4C2U A;  3VSV A;  3B90 A;  2KLO A;  3LSK A;  3MD2 A;  4KIT B;  3BCF A;  3CP8 A;  2F43 A;  4QPQ A;  3LSH A;  2KRH A;  4CZC A;  2VPL A;  4OJ6 A;  4FAS D;  1QHG A;  2WPD A;  1WP6 A;  3TMO A;  3ZSC A;  4TKO B;  5CDF A;  2QKL B;  2NZM A;  4HST A;  1NRK A;  2CV2 A;  3OFN A;  3FDY A;  4C2T A;  4IQ4 A;  3OYB A;  2WJY A;  4NUB A;  4JMQ A;  4G6T B;  2X6X A;  2F4I A;  4P1W A;  2R7T A;  1LKX A;  4XOR A;  2V7F A;  3BCB A;  4HPQ A;  3HOT A;  2VKD A;  2CUJ A;  1D1B A;  1IB4 A;  2DOA A;  2E5Z A;  3KYL A;  2WAD A;  2Z16 A;  4W8R A;  2WY7 Q;  3OR2 C;  4HNU A;  3V42 A;  2LOO A;  1DP3 A;  4OAY A;  4UZU A;  4U7B A;  2NT6 A;  2W6J A;  4HSR A;  4NNJ A;  2D3L A;  3BG7 A;  3A35 A;  2LC2 A;  3EUA A;  2W82 A;  5JHF A;  3FBN B;  4G7W A;  3MKW B;  2LY1 A;  3L2V A;  4IQJ A;  1QCX A;  2MD0 A;  4YRV A;  4I84 A;  3I9V 2;  2LG4 A;  4F52 A;  3VDX A;  2W4S A;  1X4O A;  2Z2S B;  2JVG A;  1X19 A;  2RNG A;  1E3X A;  4W8S A;  4C9Y A;  4YZ0 A;  3VST A;  4DBQ A;  4D9J A;  3K4M A;  3PNY A;  3A2K A;  4DNR B;  4XOP A;  4LG3 A;  4XD7 A;  1X4P A;  1KCD A;  3MMY B;  2QE7 A;  2KHM A;  2W6I A;  3OEE A;  2X3H A;  3KEW A;  4J01 A;  2JSP A;  4E0F A;  4W8T A;  1WJF A;  2I8D A;  4BJ6 C;  3W3C A;  2VBE A;  1EA3 A;  1WJC A;  3OOU A;  3E1S A;  3PSF A;  4AU7 A;  2WB1 A;  2X6W A;  4AYB A;  5DN6 A;  3BH4 A;  3AL0 B;  2OV7 A;  3OS2 A;  4XLF A;  1NHC A;  2L9S A;  1WFX A;  3DKX A;  4KJZ A;  4BDY A;  1FX0 A;  3T53 B;  2F6C A;  3D5R C;  4RMN A;  3HC7 A;  3K4K A;  3LFU A;  1P9Q C;  4AVZ A;  2HVQ A;  5HKK A;  2NST A;  4MLO A;  2WY8 Q;  4GQN A;  4Z1M A;  2IQ7 A;  2KPM A;  4CA0 A;  1E79 A;  1W9X A;  1UD5 A;  4W8Q A;  1D1A A;  1EFR A;  2VQL A;  1SAU A;  2BW3 B;  3CP2 A;  3OEH A;  4B3F X;  3H9G A;  4ZTF A;  1Z7L A;  1D1C A;  2XAU A;  4HRI A;  3H9J A;  1UD2 A;  2Z8G A;  2LY2 A;  3GRH A;  4OJL A;  1E1R A;  1OFL A;  4CH7 A;  2KVO A;  3QOE A;  2IS4 A;  1VLY A;  1Z3X A;  3BCA A;  2RQQ A;  3DTE A;  1FMV A;  4XN3 A;  3S3O A;  1W36 D;  1W0K A;  3ZXS A;  3HKZ A;  1O8K A;  1K5C A;  1VJS A;  3HL2 A;  3UW0 A;  3OR1 C;  4Z03 A;  1X1B A;  3LMM A;  3GBG A;  1DQU A;  3U21 A;  3DTI A;  3K70 C;  2GK7 A;  4BU2 A;  4LIV A;  2IS2 A;  4YEJ A;  4BE0 A;  1QHH D;  4DK0 A;  2O0V A;  3FY3 A;  1S9H A;  1GLN A;  1RMG A;  2DT7 B;  2NSP A;  2O17 A;  4CCM A;  2PJR A;  2V4J C;  4JOM A;  4ZDP A;  4CCJ A;  3LSI A;  1E1Q A;  3FPP A;  3VMV A;  3HXL A;  2VXD A;  3DPU A;  4II3 A;  1T95 A;  4LIU A;  3GQ9 A;  3D5S C;  1D0X A;  1IRX A;  4G7X A;  1OGO X;  1IDJ A;  3SUC A;  4IKF A;  3L2U A;  4CUG A;  2QY1 A;  2R7U A;  4FXU A;  4XKW A;  3AKZ A;  5IK2 A;  3ZPN A;  4E7L A;  3KX2 A;  1O8F A;  2Q2E B;  4XLA A;  1DBG A;  1GQ8 A;  3OYA A;  4BJ5 C;  3W2V A;  2O0W A;  3AFH A;  1LDK B;  2INV A;  2KQR A;  3MKY B;  4BE2 A;  3T9G A;  3BC8 A;  4D1Q A;  1O8D A;  3PSI A;  1XG2 A;  2PEC A;  3SEZ A;  2M5S A;  4DK1 A;  3OYM A;  4BXF A;  2CW7 A;  4ZC3 A;  3PNT A;  4HNT A;  3HPG A;  3LSM A;  2R7O A;  4TT3 A;  1O8H A;  1X1D A;  2KDO A;  1JI8 A;  4J00 A;  3VYU B;  2O04 A;  4Z05 A;  1N75 A;  3SDB A;  3C2H A;  5HVQ C;  2Y0S A;  2L9N A;  2WAQ A;  2R7X A;  4XN0 A;  2ZZE A;  4H4K C;  3DDY A;  3CMM A;  4P22 A;  4OJ5 A;  2NTQ A;  4BGD A;  3H5R A;  2JDI A;  3ZGK A;  3K4L A;  1QU3 A;  1JRG A;  3L2W A;  3OL3 A;  4PUS A;  4NC7 A;  2PJR B;  3QYE A;  1PKV A;  4TSF A;  1V0E A;  3S8P A;  2L7K A;  2X8K A;  3QYB A;  1V0F A;  1R6R A;  5FL7 A;  4E7J A;  4XL9 A;  3DLA A;  2ZXI A;  4DOZ A;  2IGM A;  1N77 A;  2ZZF A;  2E1M B;  4B43 A;  3LNN A;  3G2B A;  2INU A;  1KCC A;  2PMZ A;  2VJ4 A;  3K4J A;  3OAA A;  1VZ0 A;  2CUZ A;  2HZD A;  2WBM A;  4OZY A;  2W00 A;  3WWG A;  4OWR B;  4Y4R A;  3A4C A;  4PJN A;  2K3P A;  3HG9 A;  2V26 A;  5CQE A;  5HOO A;  2XDV A;  1O88 A;  1X1A A;  1WJE A;  2LBF A;  2UUZ A;  3OYD A;  1OFM A;  3HPH A;  2K9M A;  1WPC A;  4ASU A;  4DNT B;  2BW3 A;  2ZFU A;  3DKY A;  4YZA A;  3AL0 C;  1SFK A;  2JVH A;  2IS1 A;  4II2 A;  2ZSI B;  2M0M A;  3IAM 2;  3NE5 B;  1UEL B;  1COW A;  2BOL A;  3OL4 A;  3QYF A;  4HEA 2;  2E5N A;  4IZZ A;  4ZJZ A;  4ZYA A;  4XLC A;  2M4K A;  2Z6B D;  2VQG A;  5LFA A;  4IX7 A;  2VJI A;  1KZL A;  2M7A A;  3UNG C;  2XF7 A;  1HA8 A;  3OWT A;  1G8X A;  2PYG A;  2UVE A;  2Q1Z B;  3OYK A;  1OGM X;  5HNH A;  1MW7 A;  4BDZ A;  2ZZQ A;  1LVK A;  2LYC A;  4XMY A;  2ZZG A;  1DGR M;  2ZSH B;  4F3Q A;  2X1D A;  2UWM A;  1OLT A;  3DEE A;  1E3Z A;  2VBK A;  1UD8 A;  2IXS A;  2HPM A;  1Y56 A;  1K28 D;  3OE7 A;  3JUR A;  1T0F C;  1K6Y A;  2WZP P;  2IGO A;  4L8J A;  4NQW B;  4CCN A;  3GVK A;  1KON A;  2Z1D A;  2NTP A;  1O8G A;  2RRE A;  4KIS A;  3DU6 A;  2M7B A;  3ZQQ A;  1T5E A;  1DGW Y;  2GOM A;  4BQN A;  3ZPP A;  4DIQ A;  1I8D A;  2L5Q A;  3F9K A;  4ZDO A;  4R79 A;  2LBF B;  2R4G A;  4BEH B;  4YXW A;  1DBO A;  3NWS A;  3RCO A;  3TL4 X;  5FRO A;  2R7R A;  3DPL C;  3EUK L;  4E7Z A;  4OJP A;  3H94 A;  3S93 A;  1V5G A;  3E0J B;  4KT6 A;  2VXZ A;  2X51 A;  2R7Q A;  2DT6 A;  1MMN A;  3BLY A;  4E7S A;  2WAE A;  4XKC A;  1VBL A;  4XNF A;  4XKB A;  1I18 A;  1TT0 A;  2JJ2 A;  2R7V A;  4RM2 A;  1HZE A;  4HIZ A;  5HLT A;  2P0W A;  3NWT A;  1AA7 A;  1V5E A;  2X1C A;  2HLD A;  3PL8 A;  2NOJ B;  3OS0 A;  3OYJ A;  4C30 A;  2A5W A;  4CCK A;  1YX3 A;  2V6E A;  1ERD A;  2KMU A;  5CQG A;  2XZP A;  4BL0 B;  1MMD A;  3OIP A;  3GQ8 A;  4XON A;  2A6T A;  2CFO A;  1H80 A;  3KEY A;  3EQN A;  2VB6 A;  3MKZ A;  4RLF A;  4X0G A;  3VSL A;  3B8Y A;  2BVL A;  3DPT A;  5CKT A;  3H0D A;  2VBM A;  1HVX A;  2KZV A;  4QPO A;  2XF5 A;  2E60 A;  4F91 B;  2ZTN A;  2IS6 A;  1WJB A;  3ZR8 X;  2ZTG A;  1IDK A;  4U4B A;  3FHN A;  3OYL A;  2E1M C;  3PJR A;  2QX3 A;  1D0Y A;  3GVJ A;  4PJM A;  4F92 B;  2DJI A;  1PJR A;  2V1N A;  3H9Q A;  4BQO A;  3FBI B;  2DCE A;  1BMF A;  3OIQ A;  1U0J A;  3CJR B;  4LIT A;  3OYC A;  1WJ5 A;  1X1C A;  3TBI A;  4MR0 A;  3PUB A;  3OYG A;  2LRE A;  4P5O A;  2XSJ C;  3S3M A;  1MMA A;  2VL8 A;  1W36 C;  3HAG A;  3I3L A;  4N4O B;  4XLH A;  4YZQ A;  4PK4 A;  1BHE A;  4RM3 A;  4EW9 A;  4EAT A;  1W0J A;  3RTR A;  4Y33 A;  1BN8 A;  4XKV A;  3VSK A;  1E43 A;  3GVL A;  2WA0 A;  2OUM A;  1NG6 A;  3B4N A;  2HU9 A;  1UD6 A;  3PNV A;  2O5R A;  4KKU A;  1PYV A;  2VIX A;  4PSW A;  1G59 A;  4NK8 A;  2KP6 A;  3KRG A;  4XQF A;  2KRC A;  3C2G A;  4ANJ A;  4XOT A;  3K4C A;  4E4H A;  2DXI A;  2V4D A;  1J09 A;  4C2L A;  2QXZ A;  1HG8 A;  2JIZ A;  4HWV A;  4PJJ A;  3IP4 B;  3OYN A;  2NT9 A;  5LD2 C;  4F55 A;  2R7W A;  1NBM A;  4MXN A;  5FRN A;  3LSG A;  2JUG A;  2X53 S;  1YE9 A;  4E7K A;  2IGK A;  3H35 A;  4BEH A;  4Z06 A;  2GJR A;  2VKH A;  3OY9 A;  3VYS B;  4N4N B;  1BLI A;  3UR3 C;  2R9V A;  3W2W A;  1Z3Y A;  3CZ6 A;  4U49 A;  3OYI A;  1MAB A;  5AMV A;  2VJ5 A;  2CMP A;  2MAB A;  2XC7 A;  3SEQ A;  1IA5 A;  2X85 A;  4BQQ A;  2WJV A;  3LMW A;  4FET A;  4GRI A;  3CF2 A;  5KNL A;  3HOS A;  4E7I A;  2GOX B;  4ZDL A;  4PFP A;  2L2O A;  3VYR B;  1VF7 A;  1WTH D;  4YEL A;  3OYE A;  3OS1 A;  2LZJ A;  3ZCO A;  3OOC A;  3CES A;  1OR7 C;  3H5N A;  3M1C A;  2CV0 A;  3EUH C;  4KKS A;  3H5A A;  3VR6 A;  4OAZ A;  4BUP A;  1O8I A;  4DGW B;  3QOD A;  4F93 B;  2ELJ A;  3BCD A;  4ZTJ A;  1H8E A;  4G6I A;  3RSN A;  3ZIA A;  4JQF A;  4B3G A;  1X0C A;  1AIR A;  3VYT B;  3HUG B;  1MMG A;  4E6K G;  1WMR A;  4PSX A;  4URR A;  2K9L A;  2GJK A;  1OB0 A;  3PFY A;  3K70 D;  2NTB A;  1OHH A;  1UD3 A;  3IUO A;  3A3B A;  2CK3 A;  1KMH A;  1E0E A;  3G05 A;  1MND A;  1LFP A;  3VWB A;  3LL7 A;  1MNE A;  4BAC A;  2CW8 A;  4B47 A;  4KKT A;  1O8J A;  4OJO A;  2AQE A;  2CV1 A;  2HVR A;  4BS9 A;  5KHD A;  2QKM B;  3K6G A;  2WSS A;  3OPO A;  1PE9 A;  2O1D A;  1Y6I A;  3A3G A;  2VQH A;  2BVM A;  4YZX A;  2HQA A;  1SKY B;  4BJT A;  1BPL A;  4ITV A;  2WAF A;  4DBR A;  5HNF A;  3DU5 A;  4PJL A;  3K4N A;  5C1C A;  1TZL A;  4B48 A;  3ZRG A;  5KCM A;  1WJD A;  1O8E A;  2V9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...